3L7UA

Crystal structure of human nm23-h1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase A
publication title Refined Structure of Human NM23-H1 from a Hexagonal Crystal
doi rcsb
source organism Homo sapiens
total genus 47
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3l7uA00
1XQIA 4S0MA 2HVEA 3ETMA 3NGRA 3ZTPA 3DKDA 2DXDA 3ELHA 1EHWA 4UOFA 3JS9A 1LEOA 1NPKA 3Q83A 1VYAA 3FCWA 3Q8VA 1NUEA 3BBFA 3FBCA 2B8QA 4CP5A 1WKJA 2BX6A 3EM1A 4ANEA 1NDPA 2HVDA 4FKXA 5C7PA 3FBFA 1NDCA 3Q86A 3DDIA 5CABA 3BBCA 2BEFA 2DXEA 1NDKA 4ENOA 1JXVA 1NSKL 5CAAA 3EVOA 1KDNA 3MPDA 4WBFA 1U8WA 3PJ9A 1NLKL 3VGUA 4F4AA 3GP9A 3EJMA 4ANDA 1MN7A 3EICA 3GPAA 1WKLA 3VGVA 4ANCA 4EK2A 4UOGA 3Q8YA 5BXIA 1MN9A 2AZ1A 3BBBA 2DXFA 3EMTA 1UCNA 2VU5A 3Q8UA 3WX8A 1HHQA 3VGSA 1ZS6A 2ZUAA 3BH7B 1F3FA 3VVTA 4C6AA 1NSQA 1PKUA 1HIYA 1K44A 3G2XA 3ZTSA 1F6TA 3FKBA 3NGUA 3VGTA 1NHKL 3FBBA 1LWXA 2HURA 4HR2A 3Q89A 1NCLA 2AZ3A 3EVMA 4W98A 4KPCA 3NGTA 5IOLA 4O0NA 3B6BA 3FC9A 3EE3A 3ZTRA 1NB2A 1PAEX 2CWKA 3FCVA 1S59A 3EVWA 3BH6B 1B4SA 2NCKL 4DZ6A 1S57A 1BHNA 2B8PA 4F36A 3ZTOA 1BE4A 1HLWA 1NSPA 3NGSA 3ENAA 2DY9A 3L7UA 3PRVA 1BUXA 3VVUA 1B99A 4FKYA 3R9LA 1WKKA 1S5ZA 1XIQA 3FBEA 4DUTA 3B54A 1NDLA 4UOHA 4DI6A 1W7WA 3ZTQA 2DYAA
chains in the Genus database with same CATH superfamily
1FKOB 4NLPA 5EN1A 2YXLA 3T1HF 2VOOA 2LDIA 3GSDA 4M95A 1S0NA 3GIKA 2F9JA 4Y2CA 1WG4A 2E29A 3Q8VA 3KDNA 4ELUA 4DL3A 3M6WA 3EM1A 3HVTB 1RT6B 1S0VA 1FRKA 2LCWA 3LQVA 1RWWB 1HD0A 2C2NA 2MY7A 4RUHA 1R6VA 1RT2A 2IYGA 2ASLA 4B3RF 2HLTA 1X60A 2JJ4D 2RU3A 1NJYA 2J0QD 3BO3A 1KVKA 5LL6d 2F40A 1U0HA 3DM2A 4DV4F 3NOGA 4KHMA 5A8WB 3RRKA 4F4KA 2BYCA 1VLYA 3CF5Q 2G0IA 1FXLA 1IQZA 4IQMA 2KVQE 1ZAVA 1ITPA 2MXYA 3I5CA 3QGGA 2J5AA 2LECA 1HNVA 1YHQS 2WSEC 1XN9A 3C66A 1IBCB 2F8HA 2R7SA 5C24B 1Q8IA 4H4OB 1RE1B 2RU9A 3GR1A 1N36J 4OI0A 4X62J 2K8GA 2ZC3A 2XYGB 2U2FA 4ZCIA 3DC2A 2ZH1A 3W65A 2QTWA 1N88A 1RI7A 3PCOB 1R8BA 4ES2A 5LMUJ 4L3KA 1BY9A 1FTCA 2JEIA 4M5IA 2K1RA 2P2CB 2J7WA 2VBZA 2LQ8A 2R7RA 3MEGA 3SZ2A 3KK2B 2E9TA 2OPPB 4M5MA 1KHWA 2CG8A 3OR1A 3MM9B 1HBOA 4B3SJ 1CJKB 2B6AA 1TL4A 2W7OA 1SKSA 2LP4A 3W5YA 4USUA 1QLNA 1WJ9A 3NXZA 1G7CB 4FS2A 3CJ8A 2UXDJ 1Z2ZA 1TKTA 2QE5A 2SXLA 2XHCA 2DH8A 4F02A 3K5OA 3GR0A 5HJYA 4JI4J 2QGFB 4DUYF 4DSJA 1N54B 2CG4A 5I3UB 5B0GA 2VF3A 3POTB 3UPFA 1PBAA 1NDKA 5H9EK 4CLTA 4MAKA 5T7LA 4XK8C 4O3PA 3R97A 3OR2B 2UVRA 4I6YA 5KFMA 5KT4A 4UZBA 4CO2A 1H98A 1VGYA 4HDHA 1IN0A 4E2FB 5KG5A 5LSOA 2F63A 1U09A 5G0RA 4KGMA 3M6UA 5CCLA 3PRBA 4DFPA 4DN0A 1S9EA 5DGBA 4EWTA 2MEWA 3D3BJ 2VG6B 5EUHA 4DPXA 3QAUA 3EE3A 2MLZA 2KZZA 1JB0C 3MD1A 5D4LA 2DGSA 1BHNA 2ACMA 2DNGA 1SJ1A 3UO0A 1O8BA 1NMEB 1PBUA 3UN3A 2GNKA 4I64A 3PV8A 3D0IE 1HQUA 3NGRA 1Z1ZA 2EK1A 4W4MA 1HWLA 2C2EA 4O4GA 3ULHA 3MR7A 5DDRC 2CAJA 2B3TB 2XYHB 1OO0B 3CJ2A 3T6JA 2CQBA 3BB5A 1TMMA 2V8PA 3HVRA 2IM3A 3ITHB 1N5SA 3T9NA 3AD8C 4OI3A 1P1LA 3CE8A 3ZZRA 2K3KA 1IKWA 2KFYA 2KYZA 5K8MA 4DV3J 2AZ1A 2OTJS 2HNZA 4FYXB 1S1XB 2Q43A 5HVGA 1FD8A 5J2QB 2UU9J 4F8RA 2GAGC 3T19A 1VQLS 4DV0J 3ZTSA 4LRBA 4OFZA 2FVRA 4JV5F 4CLFA 1TR0A 2ZH7A 3MMCA 4DR7F 4FXDA 4QPXA 2RRAA 2JH3A 4WTOB 2CQDA 2OEMA 2P9CA 3C15B 2KL8A 4ZHRB 1EIYB 3MAQA 1URNA 1UETA 2ZOMA 2EWHA 5D3GB 3AY0A 2DISA 1RWVB 1UA0A 2DYAA 2NZCA 4CLSA 2AF6A 4AT1B 2FGOA 3MURP 3FCWA 5A8KA 3WDOA 1S4EA 2DPJA 5CYQB 3HSGA 4J9PA 4PG7A 2L9DA 2AT1B 2OJ3A 2R4FA 1H2UX 8RUCA 1QAYA 3RW7A 4KH0B 4L3NA 1SV5B 5M2UA 3TP2A 3LW5C 1VQMS 2OPSA 3MR6A 1X9WA 2GJFA 2ALYB 4C8OA 4ECRA 4HHUA 1RAJA 3TI0A 2B43A 1JJCB 3PYDA 2RQMA 2W4PA 4K4SA 5J2NA 1XMOF 2CQ1A 2PIIA 4OX8A 2CNKB 4DV5F 5F41A 1FK9B 1RLDA 2HHXA 2MJNA 1SJ3P 4ZVEA 2R8HA 3WBZA 1QVFR 3T3FA 2HRYA 2RAQA 5IV4A 3J7YU 3CC2S 3EYZA 2BANA 3X1LB 2CPYA 4HH1A 2J9EA 4WP9A 4TN2A 5DJBA 1IJFB 4DPWA 3M8QB 5KFZA 1Y5LB 5GAHI 1KHVA 3MECB 3LWLA 4DSIA 4O44B 2DNKA 3MEKA 1S1TA 2MPUA 4YY3J 1T05A 3QRPA 2BJ7A 3EVOA 2ZITA 4Z37A 3GIIA 3OXGA 3GPAA 2F5GA 5HROB 4CNZA 1CC8A 1RWKB 1RT7B 1GEHA 1UZHA 1H7WA 1WG1A 5B7WA 2UVWA 4OHXA 3PW4A 4ZCKA 1FWLA 4ETXA 2DNYA 2JEFA 4O3RA 1ELOA 3PXGa 2JLFA 2DHAA 4FYVB 2CVIA 1U49A 1UPPA 4I2QA 2HURA 1F5AA 3I0RA 3NNCA 1YRTA 1N34F 4IO9Q 5IQQA 3IS9B 4J9LA 2Q6CA 3E2EA 1WSVA 3NLCA 4W92B 2Z2ZA 2D3O1 1FVQA 3MR2A 1CQNA 3V6JA 5IFMA 1T7PA 4ID5A 2W9AA 3P49B 4LF6F 2MHNA 2UV8G 3MOZA 2I8EA 4ECQA 1HQEA 1M5OC 3MMBB 3HHLD 3THPA 4IR9A 1G3OA 1FESA 1VLOA 4KKOB 4ZKAA 4JI1J 1NJXA 1FEEA 3MPVA 4LRDA 4WBFA 3SIPB 3NBPB 4JI0F 1HWKA 2ACYA 5HO4A 3NWRA 2IM2A 4U7UK 3L9ZA 3P96A 1WI8A 2R7QA 2D9PA 1WF1A 4J37A 2HAIA 1GAOA 5EWEA 4IDKA 2XY5A 1FA0A 3LP1A 4TYAA 2Y8YA 3M2RA 4LQ3A 4LRFA 2VG7A 1X8DA 1Q79A 2WSFC 3KWMA 2QSFA 4U6PA 1T9UA 1TAQA 3D2WA 1UAWA 1K73T 2MKYA 4V19J 2HWTA 5IT0A 1FWKA 4M5DA 4ZVQB 3TX0A 4OI1A 1IM4A 1NBEB 1AXQA 1NDLA 5L9XA 4K4UA 5HVHA 1RABB 3K2YA 2RQCA 2E1CA 4NWBA 1IM6A 2F4VJ 1YLXA 4RW9A 1WF0A 1CS4A 2OTLS 2XLKA 1QAIA 5J2PB 3O44A 1R0CB 3H5SA 3OLBA 1YSJA 4N8OA 2CYYA 1M5KC 2FZKB 2NLWA 3GJQB 2J9CA 2IM0A 2QV6A 3PW5A 2AIRB 3QYYA 3W2VA 3LP2A 1UFWA 1U4BA 1AUSL 4PUOA 5KFRA 4K50A 4DSEA 3IGNA 1WOPA 1RCOB 1U02A 1BWEA 1U6FA 2IVYA 4GRSA 2QL7B 2E1RA 2ZD1A 2GJIA 1K44A 4MIBA 2R8KA 1HMVB 4A8FA 1KLNA 2GMJA 4WJBA 5LMNJ 1NB7A 3NAIA 1OSCA 2G1DA 3CCMS 3JAMY 3DOMA 4JI5F 4OI2A 5KG7A 1V6HA 2FLNA 3KDOA 3LGNA 2BR0A 3DGPA 1VK3A 3KHRA 1XIQA 2VPYB 4NOHA 2CPHA 2E5JA 5KFWA 3AHPA 2Z57B 1S9GB 1PJ6A 4DR5F 1U1OA 2F65A 1ROFA 3DRRB 1IBLF 2EC2A 7FDRA 5L1JA 1F2GA 4M5LA 4K4ZA 2M8HA 1OY9A 5D6GA 3BGFA 5C2GA 1DHMA 1OQ3A 3SMZA 4LBIA 4ZMMA 1JQGA 4N77A 1XWLA 2YQ1A 3CJ5A 3AH6A 4N56A 3FSXA 1IR1A 3O3LA 3D6TB 2M9KA 4P2MA 1TL3A 3CNQP 4LR8A 3HHEA 3HHDA 4XIUA 2HHPA 3Q8PB 4P73A 1W26A 3CGIA 4TY9A 2GS8A 1R7IA 2HNYB 1U2CA 1JNRB 2CPXA 2GVZB 5K8OA 5J1PA 2DPIA 1C0TB 1E6VA 2MKIA 1S6PA 2BOAA 2PN6A 4FYWB 2IRYA 1IKYB 2P6SA 3G6YA 3OUYA 3CD7A 5AE3A 1X4FA 4OZ2A 3OLAA 1S6UA 3HHLC 2P6TA 4YDXA 1CLFA 1OYEA 1YG0A 1ZZNA 2GA7A 2NXCA 3UE2A 4NASA 4HYKA 2CXEA 3BN4A 1FRXA 4ZCMA 1U1RA 1Y11A 2X51A 4YQWA 5L1IA 1CJVA 4URGA 1HWJA 5DG8A 2VH7A 1PSDA 3VAGA 1U6BA 3AT1B 4C2MA 1PKUA 2XI3A 3TUJC 2E44A 2MMYA 2G13A 2C3PA 1S9FA 3G86A 1UVMA 4LFAJ 2AZ3A 4LF1A 4CO1A 1LKZA 4C8YA 1K8AT 3M8YA 5HBMA 3G6VA 2HFNA 3DN9A 5KOXA 2QZ8A 3ZZZA 2OMLA 4K4XA 4Y2AA 4H4MB 2PMHA 2AJ4A 1N52B 3NCQA 1EARA 1N5VA 1CQMA 4MK7A 1RAIB 3ZNUA 5HK4A 5KFNA 4YOEA 5L39A 4FF4A 4CQ1A 2FB0A 2ZVIA 4I4BA 5KG1A 1NXIA 3HSJA 3H0PA 1FXDA 4LR9A 3CDAA 3I9V9 4GO7X 5DDPC 1NDPA 3CJKA 4J9OA 1R6YA 3GV5B 2V8GA 3TUZC 1NSKL 1GMUA 2W9BB 2VBXA 4JI3J 1XNRF 4DX5A 3I55S 4YEAA 2R7OA 1Q8BA 4GKJJ 2A10A 2M70A 5D0RA 3UWTA 1VMBA 3B8HA 1RAAB 1X5TA 1VQNS 2HS4A 1AZSA 2GX8A 1TVRB 4NLDA 4IG0B 5KG0A 1SKRA 2R8JA 2KM8B 2DNPA 3JTOA 3M05A 1AUDA 2I5JB 3EVWA 5HMYA 3KHHA 4U7UD 3FEYB 2K7KA 4ITSA 2HS0A 1SXLA 2GVDA 4F4XA 1IVZA 3RR7A 2DNMA 3BGUA 3IRXB 1XMQJ 3DRXA 3MM7A 3UDEA 2Y9HA 1L3SA 2VFUA 2DXDA 2PEBA 4PWDA 5EWFA 1EHWA 1N32F 1NJZA 2HHSA 1EP4A 4C8KA 2MQMA 4DOZA 2ADCA 2W9CB 1U2FA 2Z2LA 3A8JA 3I0SB 4NA2A 1YJ7A 4UY85 2Z2YB 1UL3A 9RUBA 1N33F 1W2BR 2VQFJ 4DV1F 3MAHA 1QD1A 1MN7A 1XNQJ 2V94A 4QZVB 4RU9A 5IWAJ 3K5PA 3EZOA 1ZTWA 5KG3A 1KONA 2N3OA 4EBDA 1NSQA 2PDAA 1IKVA 3IR5B 1KWMA 5CQGA 4C3KA 4DFJA 2B56A 4LF8F 4C3MA 2CPZA 3OFEA 1VIOA 1REGX 1LXJA 4ED8A 2GIFA 2OEKA 1UW9A 2W7AA 1JJ4A 5F9LA 3C19A 3D1OA 1KSPA 4RBTA 2XMVA 4NMXA 4ZPAA 4B3TF 3BO2A 2EFQA 2CZ9A 5C25B 1P27B 4OHYA 1LOUA 1QTNB 5L46A 4WTYA 3CTRA 3HHNB 5HP1A 2GHVC 3BBFA 3NGDA 2WZ1A 3SV3A 3QWUA 2GMLA 2BE2A 2YX4A 2KT5A 3DI6A 3MMJA 1VRTA 2OFHX 4MK9A 2BDPA 2CWXA 2C1EB 2HQIA 3BR8A 3NNAA 4YUDA 4RW8B 1M5PC 5KFCA 1XEZA 2JDJA 2XBPA 2V67A 3QAEA 3EMTA 3D28A 2KN4A 3KJQB 2L9NA 3D5MA 3EDRB 2FHKA 2QT7A 3S6EA 5DDOC 4DR2F 2KFNA 2YY3A 1I94J 2HAFA 3UW1A 1N36F 3VZIA 4X62F 3JYTA 4ECSA 2W4DA 2KO1A 5HMZA 2RD5C 1N0UA 3PJWA 3BKTA 2OFGX 3NGSA 2I6WA 3R3TA 3PRVA 2R7XA 4LFCJ 2QA4G 1MWQA 2WOMA 3NP5A 2PFFB 4X84A 3PY8A 4OZ0A 5GAHU 5IS2A 3V4MA 2BKPA 2BJEA 3AJ2A 4X4RA 2HFVA 4TLRA 3VWSA 3KLFB 1V5VA 4DQPA 1DBDA 1U1MA 2KXHA 3O1LA 3KHLA 2UUAF 2G2ZA 3FNNA 2BW2A 2YNHA 4IRKA 4OX7A 3C6UA 1YBUA 4PPDA 3IMQJ 4WU2A 4IQXA 4RUBA 4WF9Q 3FRZA 3FSIA 1U1NA 4AXJA 1R31A 4KGVB 1S76D 4B3SF 2CFXA 1NRKA 3D6HB 1QDUB 2EI5A 2M4MA 4URSA 2MQQA 1RISA 2K2PA 1F6TA 2XMTA 3GG0A 4USVA 4URQU 2NXEA 2J7UA 4LMZA 5DZ7A 4K59A 3FDSA 1CJUB 2FJEB 4Q43A 2RRBA 5D78A 4BC9A 4X4NA 1DFDA 5I3QA 1R27B 4NRUA 1F2HA 3LF0A 3KG1A 1NAQA 2HSEB 5IT4A 2W8KA 3DDNA 4JI4F 2O01C 3MM8A 4BWJA 4WK1A 3IGVA 1RTHA 2LQ9A 3M6XA 2QJ3A 2V68A 2YNGA 1VBKA 4QR0A 2Q79A 1RGVA 4FPIA 1P1TA 1NKCA 1JLBA 2HYIB 2QA2A 3CDEA 4X66F 1WACA 1J5EJ 4A46A 1D9FA 4CLYA 3A1YG 3VTIA 2GIRA 3J7AN 2AD9A 1FDNA 3F44A 4U95A 2AX1A 1HL6A 1C1BB 4FS1A 2QA4S 3L09A 2HWIA 3JSMA 4WU3A 6AT1B 1KVIA 2BJ1A 4AYBD 3DDKA 3IO1A 1YGYA 5H9FJ 2H65B 3IG1B 2CQ3A 2F1FA 4IUFA 3KTQA 4X4VA 3M2VA 1G1XA 5ADZA 3FSYA 5ITHA 1PGZA 3IWNC 3MTKA 1RA6A 5B08A 2X7IA 1HHTP 3NGKA 2RT3A 2MSTA 4ZDNA 3P8BB 2Y8WA 4IH7A 1RBAA 3AXKA 1KTVA 3T5JA 1FTRA 5I42B 3OTBA 3WQPA 4IR1A 5RUBA 2LFVA 1LWCA 4LSLA 2QYGA 4DV3F 1L3KA 1HNWF 1Q86T 4WWSA 1WC1A 3M9MB 3W3SA 4DG1B 2RKIA 3TAMB 3AOAA 1NK5A 1KLMB 4IYQA 4PR6A 1N6QB 2L9WA 1W2IA 1RYRA 2JSXA 3PFEA 3C6TB 2ZUAA 2LEPA 4WZMA 3WZ0A 4L73A 2KU7A 4AE5A 3QIPB 1B0PA 4I56A 2YX7A 3LP0B 4KBIA 3QT7A 4I2PB 1IWGA 4KPCA 4RW4A 3KLHB 1REVA 5A8RA 3DLKA 2LEAA 3UCUP 4MFBB 4PXEA 2IPOB 3M1VA 2HVIA 1RTZA 2QA1A 1HBNA 4QIVA 1UTAA 2H5IB 1R89A 3ZZUA 3HHKA 3D6FB 1Q7LB 4EU0A 1JLCA 3BM7A 2ZOGA 3VAMA 1NPPA 3ZTPA 1ZPVA 3BV8A 2A0FB 4FNHA 4B3MF 1KFDA 1TUWA 4KV8A 2B9EA 2KB2A 4LSNA 2OPRA 4YS2A 1KD1T 3V5RA 3K7RA 1YI2S 1R3NA 2NZ4A 2XEXA 1TP7A 2MY8A 2XZTB 3IWLA 4CLUA 5KG4A 4F0HA 4B3OA 4KC5A 1VRUA 1CEZA 3DRSB 1FJCA 4PYAA 3OTOF 2DT9A 1KRPA 4F67A 3M9OB 1IR2A 2OELA 1RT1B 1A6LA 3IP0A 2R3VA 5ETOA 1FKPB 1TAUA 2LMIA 4HH0A 5IOLA 1S1UA 5K8PA 1S4FA 3GG1A 3VAKA 4Y28C 3C14B 3HFZB 2QO3A 5FJ4A 3VR1A 4A4JA 4ZVPB 4DS4A 4F50A 3F41A 3MEDB 1YJVA 4CO3A 2MKSA 3C46A 2O1PA 3WC0A 2DR7A 2QC3A 1M90T 1GXUA 4P75A 4DUYJ 5MLCV 1E6YA 2IHR1 3UDCA 2I0XA 4R8UA 5D0GA 4DF8A 4GC7A 3QSIA 2M0GB 3CJRA 5KFFA 1CG2A 3N6MA 3EUNA 2NYIA 1FVSA 1QAXA 2CJBA 2W1BA 1OPIA 1WSRA 4C8LA 3MOJB 3ILJA 3LALA 2C28A 4PG6A 2RSQA 3W1YC 4C6AA 5EX0A 1FEHA 5LJ3Y 1KN6A 4CDIA 5KFJA 4CYUA 3CO0P 2ZJRQ 1ZTTA 3U7JA 2CQCA 3ILIA 5ETLA 2CDQA 3NRBA 5BYSA 2HBYB 3EZUA 1B70B 4G6VB 4W90B 3CIMA 3HCXA 2LQJA 1XQIA 3I96A 4JI2F 4RLEA 3MCMA 2RQKA 4UW2A 1NK4A 4Q8FA 3MPWA 3MCSA 2CJXB 2XTJP 1MNEA 2IVMA 2PT0A 4MYUA 2OH2A 5HQLA 2C2KB 1TKXB 3E3XA 4V1Ak 1U0HB 1F9HA 4PYDA 2RNEA 4X4OA 3DM2B 2V2ZA 1M0SA 4QYZJ 1SJQA 2IC3A 3D0GE 1EJ7L 1MLAA 2M52A 1HA1A 2XGPA 1HR0F 4UT4A 3MR5A 2DR8A 1HHQA 3KLIA 2W7PA 2RQ4A 3LH2S 5GVQA 5LOQA 4ZJQA 2Y0SD 1SH0A 5DG7A 2Z56B 2H4YB 3EXYA 4DR7J 4OL8A 2W2MP 4X2BA 4ETZA 1FO1A 2XY6A 4P9SA 5K9FA 2HRTA 3RG6A 2C3OA 2V8VA 3CPWR 1T9YA 1UVKA 3W8GA 2BJDA 3DOLA 1D3WA 4BC7A 4KFBA 4M5HA 2HHUA 4LRCA 1HARA 3QGIA 3UFCX 2K1RB 2B7BB 3D67A 1WKJA 3IWXA 4MJKA 2NPFA 2YWKA 2CQPA 1UMJA 1M5VC 4Q0BB 5KFAA 1C0UA 3IXQA 1KQKA 2Y3YA 3TZWA 3H40A 2BQ3A 3G71S 4TXSA 5LSLA 4WFNQ 3OR1B 1HBOB 2B6AB 5EHHA 4ATNA 1RT6A 2V34A 1H2TZ 3CSKA 3DLGA 4PZVA 5E3AA 1S10A 2KYXA 5DLFA 2HQ3A 4LSZB 2VL1A 1TKTB 3A3OB 1PJ7A 5F8HA 3MGJA 2HHWA 1CVJA 4NCGA 3OVBA 5KFHA 3UI3A 4NLOA 4RUCA 3H5XA 1QUPA 5GAGI 3RAMA 2AEMA 3ETMA 4ILRA 2LQ5A 3PACA 5C2CA 1OMSA 2D3ZA 3FMBA 1HWIA 1S77D 1CBKA 4CM2A 4P2FA 5T7LB 1SL0A 4QW8A 5C24A 3BQ0A 4ED6A 3RAXA 2HFZA 1JXVA 3ISZA 1HNXF 2CQIA 1ZM2A 3SDEA 4WKRA 4WFYA 5G0RB 4EGLA 4E8UA 1NK0A 4JB8B 1DTTA 2E5LF 3TOQA 2BQRA 5GAEU 2W2PP 3OJUA 2XMKA 2KJVA 3NKYA 1LNQA 4FXVA 3RB4A 2Z8QA 4A8XA 3PNIA 2LXFA 4G65A 1VQ4S 2ZBPA 4GVBB 1N34J 4B9TA 2H4WB 1VFJA 3CO9A 1X4CA 2J6UA 2B4VA 2C3UA 2ZVSA 1T9VA 1V9OA 2ZKTA 3I4HX 1UFLA 1BLUA 1O0PA 1HQUB 3KK2A 4GC6A 3VVUA 4NI2A 4KT0C 3AA8A 2HFOA 2V2QA 2MZQA 4LF6J 2HQDA 4O4GB 2WVFA 4HACA 3EGZA 3IR6B 4DJBA 3R6LB 2ZM6J 2WTFA 4DFMA 2EEYA 4ZPTR 3OVSA 2E5IA 2MTLA 1B0TA 2RF2A 2Y1IA 2BKNA 3WIVA 3PX6A 1I6JA 1B7YB 1HHSA 1RT4A 4JI0J 2VHGA 1CC7A 2EC0A 1IKWB 3JQKA 3NY0A 3PJ9A 4ECWA 2KZMA 2HNZB 1IKXA 3EICA 3T1YJ 3TAPA 1N0VC 4TU7A 4LFAF 2AV5A 2CKWA 3HP6A 2O66A 1BGXT 5KFKA 4ZP8A 3MMCB 1TV6A 2GQQA 1U6ZA 2DKOB 4NYPA 4Y6IA 3KK1B 2D69A 1NZ8A 2B9YA 4IO1A 4J5OA 2JVRA 1VI7A 1C2PA 4FYDA 2H1YA 2CPIA 4DWIA 5A6WA 4DR6J 2XWXA 2UVUA 1FI4A 4FXWA 2V50A 2JFDA 2D3UA 2BKOA 4ZCLA 4U7CA 4UUXA 1CJTA 1FX2A 4FP9A 5GMDA 3THTA 5CD4A 2EFNA 5BR8F 1HI1A 1YZ7A 2IRUA 2VQEF 4P52A 1XMBA 4CO0A 2MKHA 3TJ8A 4WPAA 2WBMA 4M94A 1X7VA 2VG5A 1ZA1B 1PYOB 2XM3A 1Q16B 1DLOB 5ETSA 4DFKA 3Q2SC 3MCOA 2N4DA 2C22A 4NA3A 2OPSB 4B02A 3JB9k 4QU6A 1ZZFA 2B4UA 4BBYA 4UOGA 3GYXB 4WE1B 2BJ3A 2YQ3A 4DX6A 2R2RA 1TUVA 1N5YA 1RTIA 2V8HA 3KKFA 5J2NB 2BQUA 4R5PB 2L41A 3CXCR 5GMKa 2WCXA 2WVEA 2R7VA 3GYGA 4A48A 3DRYA 2CWKA 2ATCB 1S6QA 1Z4UA 2BANB 3R9LA 1S5ZA 5J2QA 4R25A 4LIWA 3M8SA 1S7HA 4UOHA 4DR5J 3M2UB 2CPDA 1RBOB 3KHGA 1TTHB 5E3RA 4C0HA 5DM6Q 1IBLJ 1DTQA 3D54A 3IBWA 1K9MT 1S1TB 1J5OA 2D7SA 1IQTA 4G1QA 2BMBA 4UF4A 2PFDA 4J9MA 3R8YA 4ES3A 3CEDA 5D77A 3M9NB 3DYAA 2B4OA 2ZBCA 1P8GA 4YMEA 1RXOB 2W8LA 1GTEA 5DETA 5J1NA 3SQGB 4Q2MA 4EK2A 1NK9A 4QQBA 1VBYA 3CMQA 2IA6A 1S12A 1U1PA 2H54B 1U24A 1QE1A 1S49A 3I0RB 3DOKA 2EKYA 4A47A 5F8MA 1MMDA 4NZ0A 3O2IA 4CCHA 4DV6J 1SV5A 6FD1A 4ID5B 5ETKA 2DHSA 3TJAA 4U9RA 1UPMB 1XR7A 4EEYA 4NA1A 5F9NA 2VPZB 1I3OB 2NS1B 4DDFA 4RBVA 3L7PA 5KFUA 1FDAA 3ZZOA 5CZXA 5B09A 2DGUA 1UZDA 4X64J 4B17A 2DH9A 1D9DA 1P9YA 5K20B 5KT7A 3DCAA 2KDOA 1T8EA 2E9RX 5H9EJ 3M6VA 1M1HA 3GMGA 3MEEB 3GZ7A 2ROGA 4UOCA 4F4AA 4IDKB 2R42A 3MPUB 4BHQA 2L3MA 3CJ3A 3DXSX 3M2RB 4K4VA 2DNZA 2WAQD 3W7BA 5GADU 5DQIA 1KC8T 4TVAB 4OZ1A 4YHHF 3A8KA 4BLGA 4HT5A 2ZH9A 4ZP7A 3OL9A 2GGPA 5D8HB 3VHQA 2OUGA 1AYEA 3FC9A 4EO8A 1Y3JA 2YWHA 2GO9A 1FD2A 4DZ6A 2RVJA 2UUBJ 3SSRA 4DUTA 1GK8A 4RW9B 1CS4B 1YJWS 3GWCA 3GSIA 3I56S 2VFRA 4HHJA 2B4PA 1QAJA 4JI6F 1SKUB 3Q22A 2A6MA 4YR2A 4RW6A 4PQAA 3JQJA 3CW2C 3M4XA 2N7YA 3HJVA 3CC4S 3IS9A 1FJGF 4J9QA 4ZLPA 1WC6A 3D1QA 3OXLA 4DR1F 2FYXA 4HTJA 3W2VB 1XNRJ 3LP2B 5ETRA 4C0BA 4PUOB 2CQGA 2A18A 3N6LA 3LOUA 2ZD1B 3ZFVA 1RA7A 1U0SA 3PYFA 3KLEB 5E5NA 5B0BA 2EFGA 4ELTA 3JTPA 3VVTA 2MKKA 3DOMB 4K8RA 1NHKL 2E7VA 4F2RA 4HR2A 1F5CA 5A2QY 5CA5A 3D1HA 2JZ5A 3DGPB 3GIJA 3HVAA 3I82A 3FCVA 3G82A 3H20A 1X5SA 1R43A 2Z0GA 1GNKA 3ADAC 4KGZB 2LA6A 4FF1A 2CZVC 4EBEA 4PEOA 1DQAA 3U1NA 1LW2A 1RCXB 3S01A 2NPIA 1RWNB 1N32J 1JJ2R 2BRKA 3BGRA 1J5EF 2YVSA 4ZVTB 2ZH3A 1TKZA 2X1GA 4CO4A 3ICLA 1HNZJ 3EGVA 2B51A 1N33J 2E1MC 3KNAA 2ROPA 2F4FA 2WK4A 3BPDA 3SCLE 2FVCA 1JKHA 3OV7A 3NS7B 5M2PA 3PEJA 3R27A 4ANCA 1H3DA 2PI5A 1J27A 4Q44A 1GXLA 4IKAA 1DQ9A 3VAJA 1T0TV 4G1IA 3LUYA 1UVJA 1M1KT 5HJXA 5F8JA 1SQGA 4LF8J 1HBUA 1Q8KA 1LK5A 2M7SA 1WTBA 1WEXA 2HG4A 4ZPBA 3A4TA 3BN7A 1JK9B 2QX0A 3BGLA 1S6PB 4KPYA 3M8PA 2X1FA 1N8RT 3OW2R 2KM8C 2IBOA 5DS7A 4B3TJ 5HMXA 3M8WA 3OT9A 2FJBB 4I6AA 1UEKA 2OKQA 4ICLA 4QWDA 4AL5A 2O3DA 2VONA 4H4KC 5L38A 4UOFA 4PAAA 2IFXA 2QMUB 3AAWB 2FVQA 2R7WA 2E1PA 1BXNA 4LBHA 3OSPA 3AXMA 4OYBA 3FGVA 1CJVB 3GILA 1XBWA 3D66A 1QSSA 1XTZA 4ZPCA 1VK8A 2AMCB 2RUGA 1O6XA 1ZAXA 1I51B 4BCAA 4I69A 4DR2J 2AJ1A 2L48A 4CLWA 4DV7F 2JRSA 5HBMB 3OHBA 3TVKA 4JI8J 2GQCA 3V81A 2RJZA 5A0YA 2JFKA 5EDWA 3N9UC 3PYEA 1HPZA 2V0NA 3BH6B 4O3NA 1UEUA 3SBMA 5GAGU 5C5JA 2A6OA 2O67A 1FDBA 2FUG9 4F0MA 3G8TA 1UJ6A 3C16B 2XS5A 3FFIA 3CJKB 4LJMA 3B78A 1TL7A 1F5BA 2UUAJ 5F8GA 2HNYA 3Q2TC 1DAXA 3DDIA 2JOQA 1Y9OA 5J2MA 2E1AA 4DL2A 3MAAA 2GAHC 4EMDA 3AA9A 2VC1A 3D68A 1YBTA 1IKYA 1VDHA 4ALZA 2YH0A 1AZSB 2GMHA 3QFWA 1LW0B 4OI4A 3TAQA 3ZO7A 1L3VA 4DCPB 4LF5F 3T5LA 2WRMA 3WHIA 4LF7F 1LWEA 5LXRA 2N82B 1VQKS 3CUNA 2XCPA 1GT8A 2XI2A 3IBCB 2GVDB 2KXNB 2JC1A 4I6WA 5IC4B 1RHKB 2D3OR 5DG9A 2PI4A 1PILA 2GHPA 3MM7B 2XWYA 3CJ0A 1BUXA 4PWDB 1EP4B 3O8WA 4PQUA 4LUBA 1NNDA 1FF2A 1YRUA 4CO5A 1HBMA 1JLGA 2LXIA 5AJ3F 4X66J 1YX2A 3ISND 5F3ZA 1Y0HA 1GMVA 4H4MA 4RPFA 3NMAA 1EETB 1AROP 3E01A 2JNJA 4DCJB 2KJWA 3TX8A 3EGNA 4Z2XA 3AQPA 4MTPA 1IKVB 1JLEB 1X0FA 4KAIA 1FNMA 3HSZA 3B82A 1IBKF 4BS2A 1IR0A 2R7UA 1I1GA 3L7OA 3MM6A 3AJDA 3NGTA 2XS2A 4TY8A 1WG5A 2ZBQA 4EUVA 1T3NA 3DGVA 3K5NA 1WC3A 1VBXA 5HP1B 3UCGA 4YN3B 5A76A 1S99A 4KHRA 1AW0A 3TEGA 4M63A 4IG0A 2BE2B 3G8SA 1OPZA 4ZPWR 4I68A 1MWZA 3JS9A 1T3OA 1O51A 3J80U 1VRTB 1R0AA 4HLBA 4ANEA 1HNWJ 4ILLA 2AW0A 4AL7A 3I9ZA 4LF2A 1KNZA 2DGVA 2DRBA 2AHOB 4WFAQ 5DDQC 2KI2A 4ZIWA 2HIQA 1VBZA 3HMJG 1XJWB 4P72A 3Q8YA 2Z4PA 3OXFA 2YKNA 4K5RA 3R7NB 4NXMF 2MQPA 1ZS6A 4DL0C 4WK3A 1F0XA 1Z2LA 1SCJB 2J9DE 3SCJE 2PA3A 2OGUA 2W9CA 4C8MA 3JYTB 2ILYA 3RBDA 4CNYA 5BJRA 2X1BA 3V6KA 3W60A 2MZ1A 1NK7A 3J80Y 4Q8EA 1WTFA 3L4BC 1WC5A 3QQCD 2WOMB 2EG1A 3LGHA 4CI0B 4CT9A 4OQJA 1LWFB 5E2QA 2X3DA 2QIFA 3OQ2A 3W2WA 3FJ2A 1M5HA 4Y00A 1VCTA 1VQOS 3PFOA 4B3MJ 1Q82T 4EZ9A 3DKDA 2CQ2A 2YNHB 4IFVA 1S1VA 4RWWA 3C6UB 1LFPA 1SC6A 4TKTA 1RU2A 2G1HA 3UCZP 2XYPB 2EXUA 2BM1A 2KVIA 5HN0A 3H2UB 1H2VZ 1WF2A 1SKWA 4OYAA 3OTOJ 3HJFA 3PEHA 2XLIA 3QRRA 1FT8A 2LYVA 1FKAF 3FEZA 3O6QA 3TJ9A 4IOAQ 4DPUA 4PWWA 4HKQA 4FN5A 2RS2A 1ULRA 4QJVA 3TA1A 4KRWA 3D0HE 4MIWA 3KJVA 3QT5A 5HQMA 5L8RC 2VA3A 2W01A 2HZVA 2N3LA 4KR0B 3MM8B 1RJJA 2XZWA 2ZDOA 4EFAC 3HULA 5DGAA 2R2TA 1RTHB 5HANA 2YNGB 4ZP9A 1MU2B 2WW8A 2YWFA 3R1HA 2ZZMA 5KAKA 1JLBB 1S97A 2ADBA 3P3DA 1U48A 5K14B 2BX6A 3PHTA 2C3YA 1JJHA 5LXYA 4YP3A 3W62A 1K1QA 5LT5A 4QPTA 2E5GA 4Y3CA 3ISNC 1D9AA 4CLKA 4FNIA 3VV2B 4NCBA 3HD1A 3UN5A 4RR5A 3VGVA 1S0MA 2V9WA 2MZSA 2WSCC 1Y5IB 1V3SA 3M2VB 2P9GA 3AFGA 4Y2MA 4NLSA 1TELA 1QJHA 2CQ0A 2AYMA 2YTCA 3RYLA 2ZDPA 3HFVA 2R8GA 1T9TA 1WOOA 2MGZB 2ZM6F 2FPHX 3RR8A 1R8HA 2P5VA 1NHVA 4P6QA 4JI2J 1W7WA 3ET6A 2AGPA 4D3GA 3BKUA 3EGWB 1LWCB 4LSLB 1PCAA 1FRIA 2CQ4A 4RW7A 5KTQA 3PW2A 4FBUA 4DPYA 3W9IA 4ED7A 1N48A 4QWCA 3T1YF 2RKIB 5IV3A 2FVPA 2H48B 4NLQA 1HNIB 2EPIA 3TEHB 3MPDA 4RNMA 1KQSR 3TVYA 4OZNA 5CHCB 3TW0A 4U8YA 2G2YA 1HR0J 2P8IA 2C2ZB 3BBBA 2AYGA 3SV4A 4QOTA 2OMOA 4U8VA 2VA2A 2CJQA 2DIVA 4DR6F 4IH6A 1REVB 4DS5A 5A8RB 3DLKB 4RL1A 7AT1B 1H74A 1VJQA 4QYZK 2PE8A 4QIWD 1HBNB 2XSJB 3U1MA 4HHHA 2XMUA 4USWA 2DR5A 4M8LA 5HL7Q 4LT6A 2V2KA 4IFYB 2KT2A 4DQQA 1JLCB 3KJFB 1ZYQA 4TU9A 3JAMU 2YKMA 2J8SA 4KJIA 1T02A 4YR3A 3MTJA 3LANA 2DGXA 4LFBF 3W66A 3GCWP 3MZIA 4X65F 2V4QA 3TZXA 2K06A 4OZLA 1NDCA 4B3OB 1ZH5A 4CT8A 2VPXB 3JSRA 4AXIA 4QU7A 1VRUB 2MZTA 2ZFHA 7FD1A 3Q8SB 4C11A 2XMWA 2J0WA 2LDYA 3J7YI 1RT5A 4PKDB 5BXIA 5KFGA 3SYZA 3VGSA 2MKJA 1DURA 2BE7D 2UZAA 4RO0A 1CSJA 3I5BA 2VBYA 1IUJA 4QBUA 4CLZA 2DRAA 4HI1A 2CA9A 2QL5B 3TNVA 4B9SA 2RHQB 4LRAA 4F3OA 4DG1A 3TA2A 3PKMA 5MAOA 2ASJA 3OL7A 4UTGA 2FJXA 1U25A 4F36A 5JJBA 2FLOA 1KLMA 3M7VA 3HK2A 2BABA 2G9OA 2B5JA 3ENWA 3DHWC 4DQIA 2IVFB 1RT3A 2YKAA 1S72S 2HKEA 3RU0A 1OYDA 2YWEA 1E6YB 4P74A 1C1CA 2IJNA 4KQZA 3NG8A 4R8UB 3UNYA 2BJ9A 2J6TA 4O3OA 2L08A 2OLWA 3VQSA 2VKRA 3WX4A 2W2OP 1MROA 1NSAA 4OYXA 1HNXJ 2DXEA 1UFKA 3HVWA 4K2JA 3HI9A 3CIZA 1NU4A 1O5JA 1H7XA 2CPJA 4EI2A 2R2SA 4DQRA 1VIXA 1KP6A 2E5LJ 2KG1A 5JVGQ 1WD6A 2MSSA 3M30A 2KRRA 2F3JA 4J9RA 1GX6A 2BRLA 4CZCA 3CWJA 1PYTA 1QM9A 4CH0S 2PC6A 2IYIA 4DV6F 3BGOP 2ZHOA 5KG2A 1SL2A 4U67Q 5CXTA 1P9QC 1YDLA 1UP1A 2XNQA 1YJUA 1OQ6A 5KT5A 3R6GB 4F0KA 1F60B 2MYFA 1B4SA 4NEZA 2P9EA 3CCVS 1HLWA 1S1WA 3W64A 4C7QA 2QN6B 4PWUA 4X64F 3R7SB 4USMA 3CD0A 2Y1RI 2V9KA 4RX6A 1FKPA 2MB0B 3MPYA 1F3VA 2PA8D 2WW4A 3MFIA 1YKWA 1N5TA 2IC3B 2RDJA 1T9WA 4PXCA 3GYNA 2QG9B 4DX8H 4MKBA 4RU2A 5IXUA 3KLIB 1SH3A 4ILMA 5C42B 2RRNA 2OHDA 1EX8A 4I7FA 4IRCA 1KQFB 3HXMA 3L3CA 4ES1A 4A8YA 2AJ2A 3GFYA 2ALZA 2GO8A 1FRMA 2UUBF 2A2CA 2WBRA 1IWAA 4W98A 2IMOA 4Q45A 2BACA 4X4QA 1FFWB 2BXJA 3K5LA 2KFZA 4L74A 4Y65A 5BR8J 1EB0A 2DY9A 3OL8A 4KFBB 4UY8T 2DNRA 3C8YA 2VQEJ 3VALA 4EBCA 1YZ6A 4DR4J 1T03A 1WOSA 1Q4RA 4E0DA 5KFXA 2OP5A 1ZAWA 2HMIB 3K0JA 2WONA 3SI8A 2YWWA 3CC7S 2M88A 4CTAB 1C0UB 2WVDA 2PEHA 4ZLNA 1TFWA 3M8ZA 4KHPF 2XMAA 3D3CJ 3J81U 2AJ0A 2O5DA 2CNLB 2JHEA 1FHTA 1UJ5A 3BPSP 2HHTA 4WXWA 5E41A 3DLGB 3MF5A 4CWBA 3M32A 3S8SA 2IY5B 4QIEA 3KG0A 4X4PA 1Q81T 3QATA 3A3NB 4OIXA 1TKXA 3MXHP 4YB1P 1WELA 3DRPA 1SC1B 4NCGB 1RAGB 1YK9A 1WWHA 2QFIA 4ZVHA 4KB7A 3HZEA 5KFIA 4ERDA 2DHXA 3GFHA 3CDUA 3J81Y 3CCLS 4DN9A 5H1SV 4LF4F 1BQNB 3TZYA 1VC6A 2YNIA 1HNZF 5FD1A 2HQFA 4OX9F 2VOPA 2QEXS 2UUWA 2AYBA 3G6ES 5D15A 3R7BB 2B8QA 1AA1B 2ZWPA 1H73A 3QNWB 2B7CB 1PJ5A 2HNDA 3SDEB 3OD2A 1RTJB 3QWPA 4IG3A 2PMWA 4RKUC 2Y1JA 4OHZA 3NWGA 1DTTB 4DU8A 1X9SA 4NPOA 2DD8S 2FTRA 3LPEA 3R5AA 5SZTA 3W5ZA 1M5SA 4OJ1A 2M2BA 2Q6BA 4ZPVR 2H5EA 2HBZB 2IJFA 3O5TB 1RUSA 3BYRA 2OD6A 2ZNYA 3CCTA 4KH1B 5FDLA 1RWXB 5EX3A 2R8IA 4J9NA 3NCRA 4F4YA 2E9ZA 4Q0BA 2XO6A 1TFYA 3KLGA 3P5BP 3EVMA 1U1QA 4USTA 5B0FA 4E98A 4NI2B 1X0PA 2RIJA 3HKWA 4HACB 3MDFA 4PRFA 4DL5A 3BSAA 3IN5A 3B54A 1R8CA 1FRLA 1BQMA 2RF2B 3CVKA 3GONA 1Y5NB 3P5TL 4QW9A 2FJAB 3CCWA 1RT4B 2BW7A 2HVHA 2HHVA 4ZK7M 3K89A 3HHLA 3AD7C 3R5DA 3BBCA 1IKXB 2DNNA 2BUNA 2ZH8A 1DY3A 1YJNS 3TYTA 3W8PA 2EBEA 1TV6B 1NM2A 3RZAA 2KKHA 4JI8F 4TYBA 2V4JA 1LXNA 2FHMA 3CJTA 4YHHJ 4NYZA 3AJ1A 5CYMA 4AFFA 4K0KJ 2IA0A 4DV2J 2YPZA 4RWXA 3EPIA 2CJ9A 3HF5A 3GE9A 5IM0A 2NXUA 1CJTB 2XCAA 2ZH2A 1FWPA 3I87A 3DU6A 3VQTA 2QLXA 3MFHA 4B9LA 4FF2A 4ZS6A 1URRA 2N7CA 2W2QP 3JSYA 3PG9A 2MDAA 2XB2D 3GU0A 1XR5A 1RAEB 1V3ZA 4ZVRB 1Q0NA 3QT8A 1SUQA 3OSNA 2VG5B 5DRKA 4OV6A 2QL9B 4DZDA 4JI6J 1SC4B 2EVZA 4GVBA 4ECTA 1FJGJ 5DQGA 3D7SB 2X3GA 4C9DA 4C0OC 5J1EA 2HZAA 4DR1J 4RUAA 2M5YA 4NLRA 4OLOA 3G9CA 5KFTA 1NK8A 3ETOA 1JNZB 1N5YB 3HDSA 1RTIB 3V6DA 2HEKA 1UCNA 2IJRA 5FLXU 4HEA9 3HT3A 1RP5A 4QR1A 2W4CA 2LLZA 3IR7B 3RRGA 2VJVA 3BJYA 1RSCA 1S6QB 3H5UA 2J8AA 4O3QA 1T9XA 4B9MA 3UVJB 3ZTRA 2LEBA 1GMWA 1VOMA 3AB4B 3KMSA 2CIMA 2FY1A 1YRXA 3KMQA 4NLUA 1DTQB 3SXLA 4DU7A 2W24A 1KOOA 1J5OB 1UEVA 4PCQA 2XNRA 5DO2A 4G1QB 3TO8A 1SVDA 4S0MA 3KK1A 4OV1A 1RTDB 3K5MA 2G2OA 3ENQA 3DYAB 1VYAA 5FLXY 3EWGA 4EYIB 1KBRA 5CABA 4RNNA 2XO7A 4OYIA 2HHHJ 1RK8A 3RB3A 2UP1A 2XMMA 2ZHBA 1QE1B 3CULA 4ZVFA 1LV5A 2A2DA 4A8QA 2OD4A 4GKKF 3DOKB 3B4MA 4J90A 2IAJA 2UXBF 4JUZA 1SC3B 1HIYA 2IDEA 1HYSA 1Y7PA 1YITS 2YKQA 1DLOA 3CCES 1WHWA 1FFGB 4NLYA 3H59A 1U47A 4DL4A 4DR3F 2DR9A 2IDLA 4WE1A 3DMJA 2PO4A 4QCLA 3UR0A 4AUKA 3ILLA 1K0VA 1BC6A 4R5PA 2DO0A 2HK2A 1U1KA 4ZVOB 1VHIA 2MQOA 2M8DB 4ZITA 3DLEA 4OYZA 3N0VA 1F1BB 5HI7A 3IAS9 3DLJA 3DU5A 1WEYA 5FIIA 1RACB 4P7TA 1AFIA 3VGUA 4F25A 2HGLA 2XLJA 1NJIT 2XGQA 2YH1A 3M2UA 4K4TA 2EFVA 5KFOA 1PYSB 1JLAA 1SPBP 2V5HG 1A0OB 2ZZNA 2ZE2A 1N4LA 3ZC4A 4CIOA 1Y3KA 4JYAF 2GGPB 3D6MB 4DV7J 1S48A 1NJWA 3FEXB 5KFPA 2MHEA 1CPZA 2MLYA 2IMWP 4JV2A 1X31C 3OFFA 3SQGA 2G0JA 4QYRA 3K8WA 4IRDA 1CULA 1MMLA 4FKYA 4RW6B 1RAOA 3PKYA 3ZNJ1 2OPQA 4LBPA 2JLGA 2DGOA 3CCSS 4AQYF 4ZOSA 2EFOA 2DRDA 2XC9A 4ZJOA 4DQSA 3AODA 2ASDA 5HLFA 2U1AA 1FX4A 5E3PA 2EFPA 1JLFA 2LU2A 1X4GA 4QWEA 2YBVA 3QLHA 4B9NA 1GFWB 1S0OA 2HWHA 2KT3A 3KOAA 2FJDB 4HVZA 4LF5J 3RBEA 4A8OA 3MMAA 2CJKA 3IC1A 4LF7J 4R0JA 2C2MB 4NX9A 4LQ9A 3CJ4A 3RGIA 1JWWA 2MQLA 3FBBA 4ED3A 2JEGA 3ENVA 3G82B 3CD6S 3MEEA 2HIYA 1NK6A 3GIRA 2YPYA 2MQNA 4J9VA 1LW2B 2IRXA 4IOCQ 1OSDA 2YNFA 1QUVA 3QBCA 2QYCA 3BGRB 1B99A 2WB1D 2F8EX 1KEKA 4QR2A 4XAKA 2V6AA 1TKZB 3GJRB 3GV8B 1RQ0A 4J7CA 4Y34A 2W2NP 3PYGA 2YWGA 2CUYA 1WDDA 3RAQA 2VB6A 1UA1A 5DM7Q 5DZ6A 5AJ3J 4C48A 1JLQA 2XULA 4WIIA 2QSWA 1JKHB 1HQ2A 4XDDA 1RZMA 2BEFA 3KK3A 3QPIA 1R8PA 1RYSA 2XZDB 2FZCB 3NL0A 2HLUA 2Q3PA 3K58A 1KTQA 2AJFE 1NPRA 2UXCF 5KFBA 1RAFB 1TKDA 1FFSB 3W9JA 1HBUB 2LXUA 3UQSA 5KG6A 1IBKJ 2HPUA 4N7TA 2GHWA 2CJAA 3CCRS 3M8PB 2CZ4A 2LA4A 1C4AA 4JV0A 3QO9A 1BD6A 1WC4A 2ZH5A 5HMWA 5IQ6A 3HX9A 1OS5A 2NCKL 1U45A 2VDIA 4DPOA 4ICLB 3KLEA 2LKZA 3V6HA 2HFSA 1RT2B 3W5XA 1AFJA 4NZ7A 2GFFA 3OFHA 4OYMA 2JVOA 3BO4A 4DXLA 1V5IB 4J9SA 2HHQA 1NHUA 5HAOA 2VODA 2ZOFA 1GMWD 4DEZA 3MCNA 2HVEA 1IBMF 2QLJB 4KO0A 3RTVA 2A1BA 1X4HA 3CCQS 1JX4A 2JX2A 1YIJS 3S7RA 4F2SA 1OJ4A 3A8EA 4WCEQ 2DR6A 4NZ6A 4FZVA 4NCAA 3J7A1 1HNVB 1VQ6S 1OY6A 5KFQA 3M8RA 3MM5A 3QSYB 3EZ5A 2NUUG 4RZRA 4NXMJ 2BVZA 1MN9A 3D4JA 3PR5B 1UWAA 1S7IA 1SB6A 3BH7B 2K7JA 3V81B 5A0YB 1UWBA 3QZ8A 1Y10A 3MUTP 3S1TA 1NCLA 1HPZB 3BSNA 1TL1A 3I5AA 3JTNA 3V4IA 5A6PA 1R0BG 4K4WA 2MKCA 2VUGA 5E33A 2Z30B 3FFIB 4NEYA 2V2VA 1TL7B 2FGCA 3SFGA 1ICEB 2V8DA 3R5JB 5K5MA 5CD4H 3PHEA 4DBQA 4B08A 1VR6A 4LIRA 4USHA 5J2MB 3MEGB 2EW9A 3QFHA 3MAAB 2OAUA 3RJMB 1FKOA 3BDPA 4LF9F 3RB0A 1VQ9S 2DGTA 3HVTA 1KDNA 5JXSA 4CH7A 4NXNF 3LAMA 2W25A 1IXKA 2MJUA 3NMRA 1SIWB 4RJVA 4O3SA 4XDCA 1JXLA 1LWEB 3KUGA 3GTYX 1YQHA 3QRQA 1DARA 4JV1A 1HFEL 4A8WA 3EXCX 5A8WA 4MKVA 2CDRB 4ECVA 4O23A 1PC5A 1VRQC 3OHAA 5G4DA 4UQTA 3AB2B 4PQUB 1PC4A 1T11A 3TUIC 4CM0A 4NLGA 4PG4A 1HBMB 2VDHA 1JLGB 3F0NA 2G0CA 4H4OA 1RADB 3ZTQA 2FDNA 3CJSA 4XTTA 3CCUS 5CH7B 4M5NA 4ED5A 3UDLA 2DK2A 1K47A 2HBQB 3E01B 5ETTA 1APSA 2ZZTA 1S9EB 3UD3P 1YJTA 2DIUA 2DVIA 5ETQA 2DGQA 4ZA1A 3C16A 2LQBA 2IBKA 2GW8A 3PRDA 3DHXA 5BYQA 1UW4A 1Q5VA 3MM6B 5AXKA 1AT1B 3NNHA 3OJSA 1QTMA 2IM1A 5AXLA 2FD2A 4TY8B 5F8LA 1BWVA 3MUMP 2OPPA 5B0AA 2HW3A 4J9UE 1RHMB 1ZOTA 3QJJA 3HSDA 2FC9A 4P71A 5E0OA 2PMZD 1S59A 2HQGA 3MM9A 3R5GA 1CJKA 4XPEA 3N5BA 4Z7CA 1LW0A 1NH7A 3KXDA 4FDFA 3K8VA 1HD1A 1SQFA 4UZCA 1D8ZA 1C4CA 1R0AB 3QGHA 2ZWOA 4ZLLA 1NPKA 3N01A 3TR5A 1RHUB 3LA0A 4Y0FA 5KOWA 2H9ZA 3A13A 2AGOA 2UUCJ 4U96A 2YKNB 5I3UA 3POTA 4ER8A 1D8YA 2RMLA 2GIQA 2RB7A 1PG5B 1FJEB 5D0EA 2KHDA 3OR2A 1Q7YT 2UVVA 1RWUA 3QZ7A 4QIGA 2AEFA 4EZ6A 3G2XA 1ZPWX 1FRJA 4K7QA 5A8KB 3VAIA 2FHJA 1KS2A 1EETA 4DR4F 3I32A 3CD5A 3W2WB 2ZJQQ 3GQCA 2VG6A 2NR0A 3W63A 3NS6A 1JLEA 3PIOQ 4DL6A 4IFVB 5F0WA 4G1PA 1S1VB 4N8NA 4LFBJ 4AD6A 1GXTA 4WZQA 2XQCA 4X65J 2ABYA 3GFXA 4OYPA 2FLPA 3QMQA 4B9VA 4ZIVA 4FKXA 1Y4ZB 1RWMB 4NLVA 2AWZA 3QT6A 4UUWA 3FZBA 4NLTA 4GO5X 3NAHA 3KUHA 2ZBIA 1VJWA 3H4BA 2J0SD 2NSCA 1TU0B 4RNHA 3THVA 3WX8A 3ITHA 4LVOP 2Y1LB 2R9LA 3SFUA 1I5OB 1GH8A 3KJVB 4J91A 1S1XA 2BOPA 3BF4A 4G3IA 3F56A 3W61A 5BYRA 2VV5A 4MYTA 2GCFA 1T05B 1UVIA 5HQ8A 5D4PA 4DCOB 4MH8A 5GAEI 3D9BA 4KTQA 3C15A 1SL1A 4ZHRA 3PO5A 3TUPA 3GFZA 3ELHA 1LEOA 2EKNA 5D3GA 2BA9A 2DNLA 2OO4A 5LMUF 4X4SA 3GJTB 1QSLA 2I2YA 1WHVA 1UVNA 2H5JB 4I2QB 4C3LA 1FJ7A 4ZJLA 1WUUA 1LWFA 5CYQA 3TQ1A 1HW9A 1QVGR 3LTOA 1HI0P 4NLXA 3ZZTA 2J6SA 3H4DA 1RLCL 3H42A 1MSWD 4JI7J 2F8MA 1F9FA 2FVSA 4OJHA 5ETPA 1HQEB 3G87A 2CPEA 4X4TA 2ZHAA 1NB2A 1KOHA 3BREA 2ZC4A 5HSPA 3ET6B 1LK7A 5L1LA 2A3JA 2UXDF 1D09B 2FIUA 2VPWB 2AYEA 4PG8A 4RW7B 1FK9A 3PO4A 2VKZG 2OIHA 2J76E 2GQ2A 4ZLJA 5F8IA 3MHYA 4FVCA 4DUZJ 3CDWA 3UDVA 1FRHA 4CP5A 3G8QA 3QIDA 2BJ8A 4NE9C 2KXFA 2OSQA 3LP1B 1OWXA 3UD5A 2D41A 3J7ZT 2VG7B 4DSKA 3M8QA 4GVLA 3AD9C 1R8AA 2B9WA 3MECA 4DLGA 1VQYA 4O44A 4CH1A 1MU2A 2KH9A 3U1LA 1B3TA 4K0KF 4M5DB 4C8NA 4DV2F 8ATCB 3RUBL 5JMNA 3Q8UA 3CCJS 3H2VE 2E66A 2BBEA 5K14A 5HROA 2WB4A 1RT7A 3IM9A 1X4DA 4ZVGA 5IC6B 1LWXA 1NKEA 2Z58B 4F3MA 1Q95G 5DLGA 1X4EA 3CT9A 2ATLA 3LGMA 2YKMB 3B6BA 1X4BA 4J9KA 4RNOA 2ZH6A 3VAHA 1FXRA 1PAEX 1EZZB 2BV3A 5A2QU 4N41A 2JLEA 2E7XA 1NKBA 5KFEA 3KUEA 2QRRA 2ILZA 2EK6A 2VBWA 5KFVA 1VISA 3AOCA 3FUYA 4KE5A 3OTDA 5KFSA 1TK0A 4O4RA 4WKYA 1K1SA 4KHPJ 2FJVA 2ZEJA 2AGQA 1NH8A 2JC0A 1U26A 3FBFA 2MGZA 3IAM9 4ECUA 4C11B 3E8OA 4M5JA 1GTHA 3T1HJ 3MMBA 3J7Z5 1RT5B 5CAAA 2MZRA 1PIEA 1NEEA 1JMTA 1NLKL 3BSCA 1A9NB 4KKOA 4ZP6A 2B9XA 3T41A 4MK8A 1VHFA 3NBPA 4X4UA 1DJ0A 4ECYA 2F9DA 4OLPA 1FCAA 4B3RJ 5HATA 3IA0A 3DLHA 4PXDA 3BQ2A 4HI2A 2UU9F 1U2RA 1Q78A 5T14A 1KKHA 4DV0F 5CCMA 3J81j 2ZJPQ 1HNIA 3TARA 4DV4J 2B5JB 3L95X 3PW0A 3C3LA 1RT3B 2QLBB 4LF4J 1ACMB 1U8SA 1TQLA 2KTQA 1OY8A 2KHCA 1C1CB 4OX9J 1YTYA 2FHJD 5DQHA 3PM9A 3I4PA 3UNGC 3GIMA 3X3UA 1L3TA 2YQ0A 3G4SS 1N56A 1MROB 2HFUA 3PTWA 4LR7A 2HHHF 2HBRB 2Y0BB 4C98A 1TL3B 2UV8A 2DHHA 2XSJA 5ETVA 4USKA 4IFYA 2VFTA 3BR9A 4ENOA 4YFUA 2HK3A 2UUTA 1D0EA 3M30B 2AJQA 4KY3A 1WORA 2DEIA 3K59A 3U27A 5J2PA 2BZ2A 4ANDA 3FK4A 2AU0A 1L3UA 1WKLA 1FNOA 5IZHA 4MT1A 2LU1A 4B9UA 1FDDA 1E6VB 4USIA 5LSRA 5LJ5Y 3N6NA 2CRLA 2DHGA 2E7WA 1X4AA 4HL9A 3OUYB 1RB0A 4K4YA 4ZVSB 1ZM4A 5IT9U 2VZ9A 3VCDA 4DF4A 4OZJA 3C2PA 2FQQB 1RHJB 4PABA 4R0EA 2KG0A 1HMVA 1S1WB 4YB6A 4K2XA 5E3CA 3G6XA 1YBAA 1LQ9A 1Y00A 2I1RA 4JBCA 5U47A 3NS5A 1BE4A 1UKUA 1WDTA 5SUHA 3L7UA 4ECZA 4YB7A 5GADI 4HTIA 1WKKA 2MQ8A 2CVEA 4IOBA 2DTJA 2OEJA 4ED2A 4NL5A 3GLJA 4ID8A 2H3EB 5F3TA 1G6BA 3NEKA 1S9GA 3HM9A 2PSZA 4F26A 3DRRA 5IT9Y 3E51A 2APOA 4YY3F 4BWMA 2RDDA 3GP9A 1VC0A 5KFYA 6FDRA 2V4RA 1Q5YA 2RILA 4I7FB 1KQGB 1SI9A 3QJLA 3PZPA 4TQSA 1K0TA 1YJ9S 3H2LA 3VZHA 5F0UA 1B64A 2CPFA 3RBZA 3FQKA 3RW6A 2FY8A 3H5YA 3GJSB 4TNOA 4L75A 2RS8A 1VQPS 2DO4A 2VICA 3UN2A 1S57A 1T03B 2DB1A 4P2XA 4OZ3A 3R2DJ 4HDGA 2WONB 3PDNA 4F4WA 3OFGA 4ECXA 3A3PB 4DI6A 2GVZA 1C0TA 2C2OB 3IM8A 1MWYA 3I31A 1N5QA 1NUEA 4DLEA 3MWBA 2C3MA 3HKZD 3R2CJ 4I67A 3N4WA 5D4NA 4ED1A 4JI1F 3FCHA 2XMJA 5B0EA 2Z2MA 3IFEA 2JWNA 3M32B 5EWGA 4WYLA 3Q24A 3HO1A 1LFWA 3SSSA 4I0WA 4DMZA 2C2RA 3DRPB 1F3FA 1TZ0A 4WP8A 2ZNZA 3G96A 1GQEA 2R2UA 1EKRA 3DLBA 1RAHB 5THWA 5EGYA 4WXOA 4OMFG 4MKYA 4JP8A 2YNIB 3OTCA 1Q1KA 1DZ5A 4EYHB 3U02A 3ZTOA 4F7VA 3R5CA 5C42A 4JV5J 2ZH4A 3ENAA 4OI6A 2RUSA 3N79A 5KT3A 1ZETA 1H0HB 3PW7A 2QLFB 2CNOB 1ZA2B 2BM0A 3DLLQ 4Q2LA 4M1KA 1PAUB 2HNDB 3R5BA 1YVFA 4C97A 2VFVA 4IG3B 2I38A 1D1UA 1VC5A 2M3DA 2F4VF 2HVDA 2AKWB 5AE2A 5AXMA 3HFKA 3GV7B 1Q8LA 4QIFA 2CJYB 3HD2A 2D1CA 1TMJA 3MUVP 2RHSB 4KSEB 3T6BA 4KIAA 5E3QA 5D0HA 3SCKE 5FDLB 2HMIA 4GKKJ 2W9BA 4FBTA 2UXBJ 1TL5A 4CTAA 2NUHA 3LWMA 4FVMA 3KLGB 3GB0A 1KFSA 3NGUA 4O0IA 5H9FK 1TVRA 2ZBRA 5LMNF 4O0NA 4DR3J 1M1GA 4I1TA 1F9EB 2G4BA 3DNCA 4WP3A 3DI6B 1BQMB 1VQSA 1NSPA 3MI7X 4TLQA 3V2UC 2DH7A 1XMOJ 3RBXA 3RRHA 2DEJA 2I5JA 3P45B 1MMNA 4DV5J 3RB6A 4RNFA 3SSQA 3HHLB 2DGWA 4H4KA 4MMOA 3FBCA 3IRXA 2YKOA 4CLPA 1H72C 3MR3A 4OJGA 3DFEA 3Q8RB 4Y2KA 1BQNA 2AX0A 2C42A 1NO8A 3I0SA 3EX7B 3Q0AA 1A7GE 2V4JB 1AB8A 3CDBA 4D3HA 3CCZA 1BMQB 4JYAJ 5CYMB 2VU5A 4OHWA 8AT1B 5IM0B 2RDIA 4TQRA 3H7HB 3JSBA 1X9MA 1RTJA 3BSOA 2K3IA 2XG8A 2ZUGA 2JL9A 1MG7A 1VQ8S 2CQHA 3FMWA 3TZZA 2H51B 1RHQB 1SIZA 1WHYA 1SUQB 2FLLA 1ZM9A 1H6KX 1YJRA 1SJ4P 2NREA 1X5OA 2NYHA 4TU8A 3KNGA 3ZZPA 4DHVA 2C2DA 1UJ4A 1RWOB 3US5A 5J1EB 2VFSA 4OYWA 3Q83A 5C25A 3K17A 5JUMA 4AQYJ 1TUGB 1XC9A 4MIAA 4KGKA 1FE0A 1W25A 3TRGA 3V6DB 5K8NA 2COLA 1RU1A 2PD1A 3OBIA 4WIQA 2DNHA 3TQEA 2E5HA 3KG4A 3BYPA 4N47A 4DPTA 4M5KA 4RW8A 1SH2A 3BS9A 1J2VA 3T9ZA 4YB5A 3FKBA 1B0VA 2QFJA 1ZBTA 5ETMA 4L76A 1G4CA 3BQ1A 5LM7E 1HKAA 1XERA 4OJ3A 2AP6A 2XHWA 1RDRA 3PIPQ 3PX0A 1B7FA 4CRJA 2Q1LA 5E7OB 2GC8A 1HW8A 2B8PA 4DSFA 4NYOA 2AQ4A 3LO3A 1RKIA 2FC8A 4EO6A 2ROEA 3Q8QB 3DXBA 5HVFA 1XR6A 2YX1A 4XO0A 4WFXA 3JSMB 2HVZA 5ETNA 1WEZA 4AL6A 5C7PA 2AEJA 3PJXA 4ED0A 1JIHA 3KLFA 2UXCJ 3BEGB 2WHOA 1P6TA 3CB4A 3Q23A 2J7KA 2IAJB 4JI3F 1S79A 3MD3A 5CYJA 1WI6A 4GKJF 1HYSB 1EAYC 3I6PA 4OX6A 3UR3C 4F4ZA 4WYWA 4WFBQ 2EG2A 3ZZYA 3VGTA 2WVCA 1U7LA 3FRYA 4KGXB 3DMJB 2GJ2A 4A8KA 2QMXA 4JOUA 2KRBA 3NCPA 4V19X 1CJUA 2ERRA 3ILOA 1FE4A 3DLEB 4JI5J 2RH3A 2LVWA 1WHXA 3ZZ0A 1IBMJ 5M2RA 3IRWP 1PO6A 4ZVUB 1XMQF 2UUCF 4YDDB 4LREA 2GV1A 1EKSA 3F73A 3OTEA 3OL6A 1GX5A 1Q53A 3SQOP 3UVJA 3T5KA 2CADA 3Q86A 2NXNA 2HGNA 3N28A 4RW4B 3BDEA 2GZOA 1JLAB 1OIAA 1WC0A 2ZE2B 3NOCA 1T94A 2Q66A 2VQFF 3M1VB 1EQ0A 3JXOA 1XNQF 3ONQA 1RTDA 4N76A 4K5SA 3T1AA 5B0CA 2DJWA 2R7TA 3VAFA 1JXEA 2NSBA 5IWAF 2DBBA 4FF3A 1C1BA 1X5PA 2DCLA 1RBLA 4ZN1A 2FZGB 4NMLA 3WC2A 1CULB 4YR0A 4PPZA 4KV8B 2ZKUA 1H38A 4LSNB 1G2EA 2OPRB 3IG1A 4ELVA 4ZPDA 2DITA 4OYOA 4CLLA 2OPQB 2HQCA 3WIUA 3FBEA 3OPKA 3AQOA 2MLXA 4L6V3 1TK8A 2VJUA 2D74B 2V63A 3KJNB 1UVLA 4IH5A 4C4WA 5KFLA 4LF9J 3B4DA 4GMKA 3H98A 4Q5VA 5HLFB 4XPCA 1VQ7S 3IBFB 5I42A 1JLFB 2NQPA 3QLHB 4NXNJ 2XSFA 1HI8A 1S1UB 1WNEA 2DY1A 3MMAB 3EJMA 2FJWA 3KLVA 4A8SA 3BKFA 2N4CA 3SCIE 3VF0B 4N5SA 5KT6A 3GCXP 4L72B 2F7VA 4M5GA 3TAMA 5T41A 1EQMA 9ATCB 1N6QA 4ED4A 2MZJA 4A8MP 3Q89A 3QJPA 2I9SA 3C6TA 3TWZA 4OZ5A 5L9NA 4FPRA 1I94F 3QIPA 1KR4A 2YNFB 3LP0A 4I2PA 5I3PA 1KVJA 5CZVA 1MW7A 3KLHA 1SQEA 3HZGA 1DRZA 3LPYA 4MFBA 1QY7A 2WVBA 1RWPB 4LFCF 4WFZA 1JLQB 2XY7A 3KK3B 5B0DA 1FERA 3CJQA 2VC0A 5AXNA 1T95A 3AOBA 4P2SA 2JEJA 4P7VA 2EBGA 2POKA 2OSRA 2VD3A 2VASA 5F8NA 2HGMA 5KT2A 4CYUB 1SJRA 1TK5A 5AE1A 1U8WA 1FNXH 3QGPA 3HT0A 1VS3A 2HS3A 3PVXA 4JI7F 2J9DA 4USJC 3BZQA 1RHRB 2OI2A 5D4OA 2RE1A 4RBUA 2DNQA 4Y2IA 3DRSA 3QO9B 3P4UB 3HLUA 4NRTA 4F3QA 3CMES 1YWXA 3A12A 3ZXWA 5AT1B 3W9HA 2DCUB 2J0XA 3A8IA 3UD4P 1RKJA 3T5HA 1U1LA 5I4MA 1BQXA 1RT1A 4P10A 1L5UA 2B0GA 3KFWX 1SBRA 3H25A 4BDPA 1SJFA 1V3RA 2X1AA 2XS7A 4DUZF 4DL7A 4F04B 4KO0B 4PG5A 3C14A 2D9OA 5L1KA 2PGCA 3HPOA 2ASYA 2BE9B 3H8YA 4FYYB 3MEDA 3TA0A 1IJEB 2IIHA 2FHOB 2HRUA 3LAKA 3TANA 1NZAA 3PR4A 3MM5B 2QLWA 4UQGA 5JVHQ 3EDQB 3FQLA 4HT7A 4ZN3A 3K57A 3P6YC 3N5FA 2VIHA 3FVYA 1QSYA 2CNNB 4QWAA 1HWUA 4C8ZA 4LVNP 1DQ8A 1UWBB 5GMEA 3SEOA 2DXFA 3KYLA 4H54A 4KYZA 4Q7AA 4DV1J 3H90A 2V69A 3EPGA 1TL1B 3JQMA 2HZCA 3DOLB 1ZM3A 3TVZA 3V4IB 2DNOA 4QWBA 1VQ5S 4Z7YA 2YKPA 4PXBA 1XK8A 3CMAS 4NLWA 3FZ2A 2QMWA 4OHVA 1S6OA 2NXJA 4DX7A 3PX4A 3R1LA 3OVAA 5KFDA 4MKAA 4DSLA
chains in the Genus database with same CATH topology
1XQIA 4S0MA 2HVEA 3ETMA 3NGRA 3ZTPA 3DKDA 2DXDA 3ELHA 1EHWA 4UOFA 3JS9A 1LEOA 1NPKA 3Q83A 1VYAA 3FCWA 3Q8VA 1NUEA 3BBFA 3FBCA 2B8QA 4CP5A 1WKJA 2BX6A 3EM1A 4ANEA 1NDPA 2HVDA 4FKXA 5C7PA 3FBFA 1NDCA 3Q86A 3DDIA 5CABA 3BBCA 2BEFA 2DXEA 1NDKA 4ENOA 1JXVA 1NSKL 5CAAA 3EVOA 1KDNA 3MPDA 4WBFA 1U8WA 3PJ9A 1NLKL 3VGUA 4F4AA 3GP9A 3EJMA 4ANDA 1MN7A 3EICA 3GPAA 1WKLA 3VGVA 4ANCA 4EK2A 4UOGA 3Q8YA 5BXIA 1MN9A 2AZ1A 3BBBA 2DXFA 3EMTA 1UCNA 2VU5A 3Q8UA 3WX8A 1HHQA 3VGSA 1ZS6A 2ZUAA 3BH7B 1F3FA 3VVTA 4C6AA 1NSQA 1PKUA 1HIYA 1K44A 3G2XA 3ZTSA 1F6TA 3FKBA 3NGUA 3VGTA 1NHKL 3FBBA 1LWXA 2HURA 4HR2A 3Q89A 1NCLA 2AZ3A 3EVMA 4W98A 4KPCA 3NGTA 5IOLA 4O0NA 3B6BA 3FC9A 3EE3A 3ZTRA 1NB2A 1PAEX 2CWKA 3FCVA 1S59A 3EVWA 3BH6B 1B4SA 2NCKL 4DZ6A 1S57A 1BHNA 2B8PA 4F36A 3ZTOA 1BE4A 1HLWA 1NSPA 3NGSA 3ENAA 2DY9A 3L7UA 3PRVA 1BUXA 3VVUA 1B99A 4FKYA 3R9LA 1WKKA 1S5ZA 1XIQA 3FBEA 4DUTA 3B54A 1NDLA 4UOHA 4DI6A 1W7WA 3ZTQA 2DYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQI A;  4S0M A;  2HVE A;  3ETM A;  3NGR A;  3ZTP A;  3DKD A;  2DXD A;  3ELH A;  1EHW A;  4UOF A;  3JS9 A;  1LEO A;  1NPK A;  3Q83 A;  1VYA A;  3FCW A;  3Q8V A;  1NUE A;  3BBF A;  3FBC A;  2B8Q A;  4CP5 A;  1WKJ A;  2BX6 A;  3EM1 A;  4ANE A;  1NDP A;  2HVD A;  4FKX A;  5C7P A;  3FBF A;  1NDC A;  3Q86 A;  3DDI A;  5CAB A;  3BBC A;  2BEF A;  2DXE A;  1NDK A;  4ENO A;  1JXV A;  1NSK L;  5CAA A;  3EVO A;  1KDN A;  3MPD A;  4WBF A;  1U8W A;  3PJ9 A;  1NLK L;  3VGU A;  4F4A A;  3GP9 A;  3EJM A;  4AND A;  1MN7 A;  3EIC A;  3GPA A;  1WKL A;  3VGV A;  4ANC A;  4EK2 A;  4UOG A;  3Q8Y A;  5BXI A;  1MN9 A;  2AZ1 A;  3BBB A;  2DXF A;  3EMT A;  1UCN A;  2VU5 A;  3Q8U A;  3WX8 A;  1HHQ A;  3VGS A;  1ZS6 A;  2ZUA A;  3BH7 B;  1F3F A;  3VVT A;  4C6A A;  1NSQ A;  1PKU A;  1HIY A;  1K44 A;  3G2X A;  3ZTS A;  1F6T A;  3FKB A;  3NGU A;  3VGT A;  1NHK L;  3FBB A;  1LWX A;  2HUR A;  4HR2 A;  3Q89 A;  1NCL A;  2AZ3 A;  3EVM A;  4W98 A;  4KPC A;  3NGT A;  5IOL A;  4O0N A;  3B6B A;  3FC9 A;  3EE3 A;  3ZTR A;  1NB2 A;  1PAE X;  2CWK A;  3FCV A;  1S59 A;  3EVW A;  3BH6 B;  1B4S A;  2NCK L;  4DZ6 A;  1S57 A;  1BHN A;  2B8P A;  4F36 A;  3ZTO A;  1BE4 A;  1HLW A;  1NSP A;  3NGS A;  3ENA A;  2DY9 A;  3L7U A;  3PRV A;  1BUX A;  3VVU A;  1B99 A;  4FKY A;  3R9L A;  1WKK A;  1S5Z A;  1XIQ A;  3FBE A;  4DUT A;  3B54 A;  1NDL A;  4UOH A;  4DI6 A;  1W7W A;  3ZTQ A;  2DYA A; 
#chains in the Genus database with same CATH topology
 1FKO B;  4NLP A;  5EN1 A;  2YXL A;  3T1H F;  2VOO A;  2LDI A;  3GSD A;  4M95 A;  1S0N A;  3GIK A;  2F9J A;  4Y2C A;  1WG4 A;  2E29 A;  3Q8V A;  3KDN A;  4ELU A;  4DL3 A;  3M6W A;  3EM1 A;  3HVT B;  1RT6 B;  1S0V A;  1FRK A;  2LCW A;  3LQV A;  1RWW B;  1HD0 A;  2C2N A;  2MY7 A;  4RUH A;  1R6V A;  1RT2 A;  2IYG A;  2ASL A;  4B3R F;  2HLT A;  1X60 A;  2JJ4 D;  2RU3 A;  1NJY A;  2J0Q D;  3BO3 A;  1KVK A;  5LL6 d;  2F40 A;  1U0H A;  3DM2 A;  4DV4 F;  3NOG A;  4KHM A;  5A8W B;  3RRK A;  4F4K A;  2BYC A;  1VLY A;  3CF5 Q;  2G0I A;  1FXL A;  1IQZ A;  4IQM A;  2KVQ E;  1ZAV A;  1ITP A;  2MXY A;  3I5C A;  3QGG A;  2J5A A;  2LEC A;  1HNV A;  1YHQ S;  2WSE C;  1XN9 A;  3C66 A;  1IBC B;  2F8H A;  2R7S A;  5C24 B;  1Q8I A;  4H4O B;  1RE1 B;  2RU9 A;  3GR1 A;  1N36 J;  4OI0 A;  4X62 J;  2K8G A;  2ZC3 A;  2XYG B;  2U2F A;  4ZCI A;  3DC2 A;  2ZH1 A;  3W65 A;  2QTW A;  1N88 A;  1RI7 A;  3PCO B;  1R8B A;  4ES2 A;  5LMU J;  4L3K A;  1BY9 A;  1FTC A;  2JEI A;  4M5I A;  2K1R A;  2P2C B;  2J7W A;  2VBZ A;  2LQ8 A;  2R7R A;  3MEG A;  3SZ2 A;  3KK2 B;  2E9T A;  2OPP B;  4M5M A;  1KHW A;  2CG8 A;  3OR1 A;  3MM9 B;  1HBO A;  4B3S J;  1CJK B;  2B6A A;  1TL4 A;  2W7O A;  1SKS A;  2LP4 A;  3W5Y A;  4USU A;  1QLN A;  1WJ9 A;  3NXZ A;  1G7C B;  4FS2 A;  3CJ8 A;  2UXD J;  1Z2Z A;  1TKT A;  2QE5 A;  2SXL A;  2XHC A;  2DH8 A;  4F02 A;  3K5O A;  3GR0 A;  5HJY A;  4JI4 J;  2QGF B;  4DUY F;  4DSJ A;  1N54 B;  2CG4 A;  5I3U B;  5B0G A;  2VF3 A;  3POT B;  3UPF A;  1PBA A;  1NDK A;  5H9E K;  4CLT A;  4MAK A;  5T7L A;  4XK8 C;  4O3P A;  3R97 A;  3OR2 B;  2UVR A;  4I6Y A;  5KFM A;  5KT4 A;  4UZB A;  4CO2 A;  1H98 A;  1VGY A;  4HDH A;  1IN0 A;  4E2F B;  5KG5 A;  5LSO A;  2F63 A;  1U09 A;  5G0R A;  4KGM A;  3M6U A;  5CCL A;  3PRB A;  4DFP A;  4DN0 A;  1S9E A;  5DGB A;  4EWT A;  2MEW A;  3D3B J;  2VG6 B;  5EUH A;  4DPX A;  3QAU A;  3EE3 A;  2MLZ A;  2KZZ A;  1JB0 C;  3MD1 A;  5D4L A;  2DGS A;  1BHN A;  2ACM A;  2DNG A;  1SJ1 A;  3UO0 A;  1O8B A;  1NME B;  1PBU A;  3UN3 A;  2GNK A;  4I64 A;  3PV8 A;  3D0I E;  1HQU A;  3NGR A;  1Z1Z A;  2EK1 A;  4W4M A;  1HWL A;  2C2E A;  4O4G A;  3ULH A;  3MR7 A;  5DDR C;  2CAJ A;  2B3T B;  2XYH B;  1OO0 B;  3CJ2 A;  3T6J A;  2CQB A;  3BB5 A;  1TMM A;  2V8P A;  3HVR A;  2IM3 A;  3ITH B;  1N5S A;  3T9N A;  3AD8 C;  4OI3 A;  1P1L A;  3CE8 A;  3ZZR A;  2K3K A;  1IKW A;  2KFY A;  2KYZ A;  5K8M A;  4DV3 J;  2AZ1 A;  2OTJ S;  2HNZ A;  4FYX B;  1S1X B;  2Q43 A;  5HVG A;  1FD8 A;  5J2Q B;  2UU9 J;  4F8R A;  2GAG C;  3T19 A;  1VQL S;  4DV0 J;  3ZTS A;  4LRB A;  4OFZ A;  2FVR A;  4JV5 F;  4CLF A;  1TR0 A;  2ZH7 A;  3MMC A;  4DR7 F;  4FXD A;  4QPX A;  2RRA A;  2JH3 A;  4WTO B;  2CQD A;  2OEM A;  2P9C A;  3C15 B;  2KL8 A;  4ZHR B;  1EIY B;  3MAQ A;  1URN A;  1UET A;  2ZOM A;  2EWH A;  5D3G B;  3AY0 A;  2DIS A;  1RWV B;  1UA0 A;  2DYA A;  2NZC A;  4CLS A;  2AF6 A;  4AT1 B;  2FGO A;  3MUR P;  3FCW A;  5A8K A;  3WDO A;  1S4E A;  2DPJ A;  5CYQ B;  3HSG A;  4J9P A;  4PG7 A;  2L9D A;  2AT1 B;  2OJ3 A;  2R4F A;  1H2U X;  8RUC A;  1QAY A;  3RW7 A;  4KH0 B;  4L3N A;  1SV5 B;  5M2U A;  3TP2 A;  3LW5 C;  1VQM S;  2OPS A;  3MR6 A;  1X9W A;  2GJF A;  2ALY B;  4C8O A;  4ECR A;  4HHU A;  1RAJ A;  3TI0 A;  2B43 A;  1JJC B;  3PYD A;  2RQM A;  2W4P A;  4K4S A;  5J2N A;  1XMO F;  2CQ1 A;  2PII A;  4OX8 A;  2CNK B;  4DV5 F;  5F41 A;  1FK9 B;  1RLD A;  2HHX A;  2MJN A;  1SJ3 P;  4ZVE A;  2R8H A;  3WBZ A;  1QVF R;  3T3F A;  2HRY A;  2RAQ A;  5IV4 A;  3J7Y U;  3CC2 S;  3EYZ A;  2BAN A;  3X1L B;  2CPY A;  4HH1 A;  2J9E A;  4WP9 A;  4TN2 A;  5DJB A;  1IJF B;  4DPW A;  3M8Q B;  5KFZ A;  1Y5L B;  5GAH I;  1KHV A;  3MEC B;  3LWL A;  4DSI A;  4O44 B;  2DNK A;  3MEK A;  1S1T A;  2MPU A;  4YY3 J;  1T05 A;  3QRP A;  2BJ7 A;  3EVO A;  2ZIT A;  4Z37 A;  3GII A;  3OXG A;  3GPA A;  2F5G A;  5HRO B;  4CNZ A;  1CC8 A;  1RWK B;  1RT7 B;  1GEH A;  1UZH A;  1H7W A;  1WG1 A;  5B7W A;  2UVW A;  4OHX A;  3PW4 A;  4ZCK A;  1FWL A;  4ETX A;  2DNY A;  2JEF A;  4O3R A;  1ELO A;  3PXG a;  2JLF A;  2DHA A;  4FYV B;  2CVI A;  1U49 A;  1UPP A;  4I2Q A;  2HUR A;  1F5A A;  3I0R A;  3NNC A;  1YRT A;  1N34 F;  4IO9 Q;  5IQQ A;  3IS9 B;  4J9L A;  2Q6C A;  3E2E A;  1WSV A;  3NLC A;  4W92 B;  2Z2Z A;  2D3O 1;  1FVQ A;  3MR2 A;  1CQN A;  3V6J A;  5IFM A;  1T7P A;  4ID5 A;  2W9A A;  3P49 B;  4LF6 F;  2MHN A;  2UV8 G;  3MOZ A;  2I8E A;  4ECQ A;  1HQE A;  1M5O C;  3MMB B;  3HHL D;  3THP A;  4IR9 A;  1G3O A;  1FES A;  1VLO A;  4KKO B;  4ZKA A;  4JI1 J;  1NJX A;  1FEE A;  3MPV A;  4LRD A;  4WBF A;  3SIP B;  3NBP B;  4JI0 F;  1HWK A;  2ACY A;  5HO4 A;  3NWR A;  2IM2 A;  4U7U K;  3L9Z A;  3P96 A;  1WI8 A;  2R7Q A;  2D9P A;  1WF1 A;  4J37 A;  2HAI A;  1GAO A;  5EWE A;  4IDK A;  2XY5 A;  1FA0 A;  3LP1 A;  4TYA A;  2Y8Y A;  3M2R A;  4LQ3 A;  4LRF A;  2VG7 A;  1X8D A;  1Q79 A;  2WSF C;  3KWM A;  2QSF A;  4U6P A;  1T9U A;  1TAQ A;  3D2W A;  1UAW A;  1K73 T;  2MKY A;  4V19 J;  2HWT A;  5IT0 A;  1FWK A;  4M5D A;  4ZVQ B;  3TX0 A;  4OI1 A;  1IM4 A;  1NBE B;  1AXQ A;  1NDL A;  5L9X A;  4K4U A;  5HVH A;  1RAB B;  3K2Y A;  2RQC A;  2E1C A;  4NWB A;  1IM6 A;  2F4V J;  1YLX A;  4RW9 A;  1WF0 A;  1CS4 A;  2OTL S;  2XLK A;  1QAI A;  5J2P B;  3O44 A;  1R0C B;  3H5S A;  3OLB A;  1YSJ A;  4N8O A;  2CYY A;  1M5K C;  2FZK B;  2NLW A;  3GJQ B;  2J9C A;  2IM0 A;  2QV6 A;  3PW5 A;  2AIR B;  3QYY A;  3W2V A;  3LP2 A;  1UFW A;  1U4B A;  1AUS L;  4PUO A;  5KFR A;  4K50 A;  4DSE A;  3IGN A;  1WOP A;  1RCO B;  1U02 A;  1BWE A;  1U6F A;  2IVY A;  4GRS A;  2QL7 B;  2E1R A;  2ZD1 A;  2GJI A;  1K44 A;  4MIB A;  2R8K A;  1HMV B;  4A8F A;  1KLN A;  2GMJ A;  4WJB A;  5LMN J;  1NB7 A;  3NAI A;  1OSC A;  2G1D A;  3CCM S;  3JAM Y;  3DOM A;  4JI5 F;  4OI2 A;  5KG7 A;  1V6H A;  2FLN A;  3KDO A;  3LGN A;  2BR0 A;  3DGP A;  1VK3 A;  3KHR A;  1XIQ A;  2VPY B;  4NOH A;  2CPH A;  2E5J A;  5KFW A;  3AHP A;  2Z57 B;  1S9G B;  1PJ6 A;  4DR5 F;  1U1O A;  2F65 A;  1ROF A;  3DRR B;  1IBL F;  2EC2 A;  7FDR A;  5L1J A;  1F2G A;  4M5L A;  4K4Z A;  2M8H A;  1OY9 A;  5D6G A;  3BGF A;  5C2G A;  1DHM A;  1OQ3 A;  3SMZ A;  4LBI A;  4ZMM A;  1JQG A;  4N77 A;  1XWL A;  2YQ1 A;  3CJ5 A;  3AH6 A;  4N56 A;  3FSX A;  1IR1 A;  3O3L A;  3D6T B;  2M9K A;  4P2M A;  1TL3 A;  3CNQ P;  4LR8 A;  3HHE A;  3HHD A;  4XIU A;  2HHP A;  3Q8P B;  4P73 A;  1W26 A;  3CGI A;  4TY9 A;  2GS8 A;  1R7I A;  2HNY B;  1U2C A;  1JNR B;  2CPX A;  2GVZ B;  5K8O A;  5J1P A;  2DPI A;  1C0T B;  1E6V A;  2MKI A;  1S6P A;  2BOA A;  2PN6 A;  4FYW B;  2IRY A;  1IKY B;  2P6S A;  3G6Y A;  3OUY A;  3CD7 A;  5AE3 A;  1X4F A;  4OZ2 A;  3OLA A;  1S6U A;  3HHL C;  2P6T A;  4YDX A;  1CLF A;  1OYE A;  1YG0 A;  1ZZN A;  2GA7 A;  2NXC A;  3UE2 A;  4NAS A;  4HYK A;  2CXE A;  3BN4 A;  1FRX A;  4ZCM A;  1U1R A;  1Y11 A;  2X51 A;  4YQW A;  5L1I A;  1CJV A;  4URG A;  1HWJ A;  5DG8 A;  2VH7 A;  1PSD A;  3VAG A;  1U6B A;  3AT1 B;  4C2M A;  1PKU A;  2XI3 A;  3TUJ C;  2E44 A;  2MMY A;  2G13 A;  2C3P A;  1S9F A;  3G86 A;  1UVM A;  4LFA J;  2AZ3 A;  4LF1 A;  4CO1 A;  1LKZ A;  4C8Y A;  1K8A T;  3M8Y A;  5HBM A;  3G6V A;  2HFN A;  3DN9 A;  5KOX A;  2QZ8 A;  3ZZZ A;  2OML A;  4K4X A;  4Y2A A;  4H4M B;  2PMH A;  2AJ4 A;  1N52 B;  3NCQ A;  1EAR A;  1N5V A;  1CQM A;  4MK7 A;  1RAI B;  3ZNU A;  5HK4 A;  5KFN A;  4YOE A;  5L39 A;  4FF4 A;  4CQ1 A;  2FB0 A;  2ZVI A;  4I4B A;  5KG1 A;  1NXI A;  3HSJ A;  3H0P A;  1FXD A;  4LR9 A;  3CDA A;  3I9V 9;  4GO7 X;  5DDP C;  1NDP A;  3CJK A;  4J9O A;  1R6Y A;  3GV5 B;  2V8G A;  3TUZ C;  1NSK L;  1GMU A;  2W9B B;  2VBX A;  4JI3 J;  1XNR F;  4DX5 A;  3I55 S;  4YEA A;  2R7O A;  1Q8B A;  4GKJ J;  2A10 A;  2M70 A;  5D0R A;  3UWT A;  1VMB A;  3B8H A;  1RAA B;  1X5T A;  1VQN S;  2HS4 A;  1AZS A;  2GX8 A;  1TVR B;  4NLD A;  4IG0 B;  5KG0 A;  1SKR A;  2R8J A;  2KM8 B;  2DNP A;  3JTO A;  3M05 A;  1AUD A;  2I5J B;  3EVW A;  5HMY A;  3KHH A;  4U7U D;  3FEY B;  2K7K A;  4ITS A;  2HS0 A;  1SXL A;  2GVD A;  4F4X A;  1IVZ A;  3RR7 A;  2DNM A;  3BGU A;  3IRX B;  1XMQ J;  3DRX A;  3MM7 A;  3UDE A;  2Y9H A;  1L3S A;  2VFU A;  2DXD A;  2PEB A;  4PWD A;  5EWF A;  1EHW A;  1N32 F;  1NJZ A;  2HHS A;  1EP4 A;  4C8K A;  2MQM A;  4DOZ A;  2ADC A;  2W9C B;  1U2F A;  2Z2L A;  3A8J A;  3I0S B;  4NA2 A;  1YJ7 A;  4UY8 5;  2Z2Y B;  1UL3 A;  9RUB A;  1N33 F;  1W2B R;  2VQF J;  4DV1 F;  3MAH A;  1QD1 A;  1MN7 A;  1XNQ J;  2V94 A;  4QZV B;  4RU9 A;  5IWA J;  3K5P A;  3EZO A;  1ZTW A;  5KG3 A;  1KON A;  2N3O A;  4EBD A;  1NSQ A;  2PDA A;  1IKV A;  3IR5 B;  1KWM A;  5CQG A;  4C3K A;  4DFJ A;  2B56 A;  4LF8 F;  4C3M A;  2CPZ A;  3OFE A;  1VIO A;  1REG X;  1LXJ A;  4ED8 A;  2GIF A;  2OEK A;  1UW9 A;  2W7A A;  1JJ4 A;  5F9L A;  3C19 A;  3D1O A;  1KSP A;  4RBT A;  2XMV A;  4NMX A;  4ZPA A;  4B3T F;  3BO2 A;  2EFQ A;  2CZ9 A;  5C25 B;  1P27 B;  4OHY A;  1LOU A;  1QTN B;  5L46 A;  4WTY A;  3CTR A;  3HHN B;  5HP1 A;  2GHV C;  3BBF A;  3NGD A;  2WZ1 A;  3SV3 A;  3QWU A;  2GML A;  2BE2 A;  2YX4 A;  2KT5 A;  3DI6 A;  3MMJ A;  1VRT A;  2OFH X;  4MK9 A;  2BDP A;  2CWX A;  2C1E B;  2HQI A;  3BR8 A;  3NNA A;  4YUD A;  4RW8 B;  1M5P C;  5KFC A;  1XEZ A;  2JDJ A;  2XBP A;  2V67 A;  3QAE A;  3EMT A;  3D28 A;  2KN4 A;  3KJQ B;  2L9N A;  3D5M A;  3EDR B;  2FHK A;  2QT7 A;  3S6E A;  5DDO C;  4DR2 F;  2KFN A;  2YY3 A;  1I94 J;  2HAF A;  3UW1 A;  1N36 F;  3VZI A;  4X62 F;  3JYT A;  4ECS A;  2W4D A;  2KO1 A;  5HMZ A;  2RD5 C;  1N0U A;  3PJW A;  3BKT A;  2OFG X;  3NGS A;  2I6W A;  3R3T A;  3PRV A;  2R7X A;  4LFC J;  2QA4 G;  1MWQ A;  2WOM A;  3NP5 A;  2PFF B;  4X84 A;  3PY8 A;  4OZ0 A;  5GAH U;  5IS2 A;  3V4M A;  2BKP A;  2BJE A;  3AJ2 A;  4X4R A;  2HFV A;  4TLR A;  3VWS A;  3KLF B;  1V5V A;  4DQP A;  1DBD A;  1U1M A;  2KXH A;  3O1L A;  3KHL A;  2UUA F;  2G2Z A;  3FNN A;  2BW2 A;  2YNH A;  4IRK A;  4OX7 A;  3C6U A;  1YBU A;  4PPD A;  3IMQ J;  4WU2 A;  4IQX A;  4RUB A;  4WF9 Q;  3FRZ A;  3FSI A;  1U1N A;  4AXJ A;  1R31 A;  4KGV B;  1S76 D;  4B3S F;  2CFX A;  1NRK A;  3D6H B;  1QDU B;  2EI5 A;  2M4M A;  4URS A;  2MQQ A;  1RIS A;  2K2P A;  1F6T A;  2XMT A;  3GG0 A;  4USV A;  4URQ U;  2NXE A;  2J7U A;  4LMZ A;  5DZ7 A;  4K59 A;  3FDS A;  1CJU B;  2FJE B;  4Q43 A;  2RRB A;  5D78 A;  4BC9 A;  4X4N A;  1DFD A;  5I3Q A;  1R27 B;  4NRU A;  1F2H A;  3LF0 A;  3KG1 A;  1NAQ A;  2HSE B;  5IT4 A;  2W8K A;  3DDN A;  4JI4 F;  2O01 C;  3MM8 A;  4BWJ A;  4WK1 A;  3IGV A;  1RTH A;  2LQ9 A;  3M6X A;  2QJ3 A;  2V68 A;  2YNG A;  1VBK A;  4QR0 A;  2Q79 A;  1RGV A;  4FPI A;  1P1T A;  1NKC A;  1JLB A;  2HYI B;  2QA2 A;  3CDE A;  4X66 F;  1WAC A;  1J5E J;  4A46 A;  1D9F A;  4CLY A;  3A1Y G;  3VTI A;  2GIR A;  3J7A N;  2AD9 A;  1FDN A;  3F44 A;  4U95 A;  2AX1 A;  1HL6 A;  1C1B B;  4FS1 A;  2QA4 S;  3L09 A;  2HWI A;  3JSM A;  4WU3 A;  6AT1 B;  1KVI A;  2BJ1 A;  4AYB D;  3DDK A;  3IO1 A;  1YGY A;  5H9F J;  2H65 B;  3IG1 B;  2CQ3 A;  2F1F A;  4IUF A;  3KTQ A;  4X4V A;  3M2V A;  1G1X A;  5ADZ A;  3FSY A;  5ITH A;  1PGZ A;  3IWN C;  3MTK A;  1RA6 A;  5B08 A;  2X7I A;  1HHT P;  3NGK A;  2RT3 A;  2MST A;  4ZDN A;  3P8B B;  2Y8W A;  4IH7 A;  1RBA A;  3AXK A;  1KTV A;  3T5J A;  1FTR A;  5I42 B;  3OTB A;  3WQP A;  4IR1 A;  5RUB A;  2LFV A;  1LWC A;  4LSL A;  2QYG A;  4DV3 F;  1L3K A;  1HNW F;  1Q86 T;  4WWS A;  1WC1 A;  3M9M B;  3W3S A;  4DG1 B;  2RKI A;  3TAM B;  3AOA A;  1NK5 A;  1KLM B;  4IYQ A;  4PR6 A;  1N6Q B;  2L9W A;  1W2I A;  1RYR A;  2JSX A;  3PFE A;  3C6T B;  2ZUA A;  2LEP A;  4WZM A;  3WZ0 A;  4L73 A;  2KU7 A;  4AE5 A;  3QIP B;  1B0P A;  4I56 A;  2YX7 A;  3LP0 B;  4KBI A;  3QT7 A;  4I2P B;  1IWG A;  4KPC A;  4RW4 A;  3KLH B;  1REV A;  5A8R A;  3DLK A;  2LEA A;  3UCU P;  4MFB B;  4PXE A;  2IPO B;  3M1V A;  2HVI A;  1RTZ A;  2QA1 A;  1HBN A;  4QIV A;  1UTA A;  2H5I B;  1R89 A;  3ZZU A;  3HHK A;  3D6F B;  1Q7L B;  4EU0 A;  1JLC A;  3BM7 A;  2ZOG A;  3VAM A;  1NPP A;  3ZTP A;  1ZPV A;  3BV8 A;  2A0F B;  4FNH A;  4B3M F;  1KFD A;  1TUW A;  4KV8 A;  2B9E A;  2KB2 A;  4LSN A;  2OPR A;  4YS2 A;  1KD1 T;  3V5R A;  3K7R A;  1YI2 S;  1R3N A;  2NZ4 A;  2XEX A;  1TP7 A;  2MY8 A;  2XZT B;  3IWL A;  4CLU A;  5KG4 A;  4F0H A;  4B3O A;  4KC5 A;  1VRU A;  1CEZ A;  3DRS B;  1FJC A;  4PYA A;  3OTO F;  2DT9 A;  1KRP A;  4F67 A;  3M9O B;  1IR2 A;  2OEL A;  1RT1 B;  1A6L A;  3IP0 A;  2R3V A;  5ETO A;  1FKP B;  1TAU A;  2LMI A;  4HH0 A;  5IOL A;  1S1U A;  5K8P A;  1S4F A;  3GG1 A;  3VAK A;  4Y28 C;  3C14 B;  3HFZ B;  2QO3 A;  5FJ4 A;  3VR1 A;  4A4J A;  4ZVP B;  4DS4 A;  4F50 A;  3F41 A;  3MED B;  1YJV A;  4CO3 A;  2MKS A;  3C46 A;  2O1P A;  3WC0 A;  2DR7 A;  2QC3 A;  1M90 T;  1GXU A;  4P75 A;  4DUY J;  5MLC V;  1E6Y A;  2IHR 1;  3UDC A;  2I0X A;  4R8U A;  5D0G A;  4DF8 A;  4GC7 A;  3QSI A;  2M0G B;  3CJR A;  5KFF A;  1CG2 A;  3N6M A;  3EUN A;  2NYI A;  1FVS A;  1QAX A;  2CJB A;  2W1B A;  1OPI A;  1WSR A;  4C8L A;  3MOJ B;  3ILJ A;  3LAL A;  2C28 A;  4PG6 A;  2RSQ A;  3W1Y C;  4C6A A;  5EX0 A;  1FEH A;  5LJ3 Y;  1KN6 A;  4CDI A;  5KFJ A;  4CYU A;  3CO0 P;  2ZJR Q;  1ZTT A;  3U7J A;  2CQC A;  3ILI A;  5ETL A;  2CDQ A;  3NRB A;  5BYS A;  2HBY B;  3EZU A;  1B70 B;  4G6V B;  4W90 B;  3CIM A;  3HCX A;  2LQJ A;  1XQI A;  3I96 A;  4JI2 F;  4RLE A;  3MCM A;  2RQK A;  4UW2 A;  1NK4 A;  4Q8F A;  3MPW A;  3MCS A;  2CJX B;  2XTJ P;  1MNE A;  2IVM A;  2PT0 A;  4MYU A;  2OH2 A;  5HQL A;  2C2K B;  1TKX B;  3E3X A;  4V1A k;  1U0H B;  1F9H A;  4PYD A;  2RNE A;  4X4O A;  3DM2 B;  2V2Z A;  1M0S A;  4QYZ J;  1SJQ A;  2IC3 A;  3D0G E;  1EJ7 L;  1MLA A;  2M52 A;  1HA1 A;  2XGP A;  1HR0 F;  4UT4 A;  3MR5 A;  2DR8 A;  1HHQ A;  3KLI A;  2W7P A;  2RQ4 A;  3LH2 S;  5GVQ A;  5LOQ A;  4ZJQ A;  2Y0S D;  1SH0 A;  5DG7 A;  2Z56 B;  2H4Y B;  3EXY A;  4DR7 J;  4OL8 A;  2W2M P;  4X2B A;  4ETZ A;  1FO1 A;  2XY6 A;  4P9S A;  5K9F A;  2HRT A;  3RG6 A;  2C3O A;  2V8V A;  3CPW R;  1T9Y A;  1UVK A;  3W8G A;  2BJD A;  3DOL A;  1D3W A;  4BC7 A;  4KFB A;  4M5H A;  2HHU A;  4LRC A;  1HAR A;  3QGI A;  3UFC X;  2K1R B;  2B7B B;  3D67 A;  1WKJ A;  3IWX A;  4MJK A;  2NPF A;  2YWK A;  2CQP A;  1UMJ A;  1M5V C;  4Q0B B;  5KFA A;  1C0U A;  3IXQ A;  1KQK A;  2Y3Y A;  3TZW A;  3H40 A;  2BQ3 A;  3G71 S;  4TXS A;  5LSL A;  4WFN Q;  3OR1 B;  1HBO B;  2B6A B;  5EHH A;  4ATN A;  1RT6 A;  2V34 A;  1H2T Z;  3CSK A;  3DLG A;  4PZV A;  5E3A A;  1S10 A;  2KYX A;  5DLF A;  2HQ3 A;  4LSZ B;  2VL1 A;  1TKT B;  3A3O B;  1PJ7 A;  5F8H A;  3MGJ A;  2HHW A;  1CVJ A;  4NCG A;  3OVB A;  5KFH A;  3UI3 A;  4NLO A;  4RUC A;  3H5X A;  1QUP A;  5GAG I;  3RAM A;  2AEM A;  3ETM A;  4ILR A;  2LQ5 A;  3PAC A;  5C2C A;  1OMS A;  2D3Z A;  3FMB A;  1HWI A;  1S77 D;  1CBK A;  4CM2 A;  4P2F A;  5T7L B;  1SL0 A;  4QW8 A;  5C24 A;  3BQ0 A;  4ED6 A;  3RAX A;  2HFZ A;  1JXV A;  3ISZ A;  1HNX F;  2CQI A;  1ZM2 A;  3SDE A;  4WKR A;  4WFY A;  5G0R B;  4EGL A;  4E8U A;  1NK0 A;  4JB8 B;  1DTT A;  2E5L F;  3TOQ A;  2BQR A;  5GAE U;  2W2P P;  3OJU A;  2XMK A;  2KJV A;  3NKY A;  1LNQ A;  4FXV A;  3RB4 A;  2Z8Q A;  4A8X A;  3PNI A;  2LXF A;  4G65 A;  1VQ4 S;  2ZBP A;  4GVB B;  1N34 J;  4B9T A;  2H4W B;  1VFJ A;  3CO9 A;  1X4C A;  2J6U A;  2B4V A;  2C3U A;  2ZVS A;  1T9V A;  1V9O A;  2ZKT A;  3I4H X;  1UFL A;  1BLU A;  1O0P A;  1HQU B;  3KK2 A;  4GC6 A;  3VVU A;  4NI2 A;  4KT0 C;  3AA8 A;  2HFO A;  2V2Q A;  2MZQ A;  4LF6 J;  2HQD A;  4O4G B;  2WVF A;  4HAC A;  3EGZ A;  3IR6 B;  4DJB A;  3R6L B;  2ZM6 J;  2WTF A;  4DFM A;  2EEY A;  4ZPT R;  3OVS A;  2E5I A;  2MTL A;  1B0T A;  2RF2 A;  2Y1I A;  2BKN A;  3WIV A;  3PX6 A;  1I6J A;  1B7Y B;  1HHS A;  1RT4 A;  4JI0 J;  2VHG A;  1CC7 A;  2EC0 A;  1IKW B;  3JQK A;  3NY0 A;  3PJ9 A;  4ECW A;  2KZM A;  2HNZ B;  1IKX A;  3EIC A;  3T1Y J;  3TAP A;  1N0V C;  4TU7 A;  4LFA F;  2AV5 A;  2CKW A;  3HP6 A;  2O66 A;  1BGX T;  5KFK A;  4ZP8 A;  3MMC B;  1TV6 A;  2GQQ A;  1U6Z A;  2DKO B;  4NYP A;  4Y6I A;  3KK1 B;  2D69 A;  1NZ8 A;  2B9Y A;  4IO1 A;  4J5O A;  2JVR A;  1VI7 A;  1C2P A;  4FYD A;  2H1Y A;  2CPI A;  4DWI A;  5A6W A;  4DR6 J;  2XWX A;  2UVU A;  1FI4 A;  4FXW A;  2V50 A;  2JFD A;  2D3U A;  2BKO A;  4ZCL A;  4U7C A;  4UUX A;  1CJT A;  1FX2 A;  4FP9 A;  5GMD A;  3THT A;  5CD4 A;  2EFN A;  5BR8 F;  1HI1 A;  1YZ7 A;  2IRU A;  2VQE F;  4P52 A;  1XMB A;  4CO0 A;  2MKH A;  3TJ8 A;  4WPA A;  2WBM A;  4M94 A;  1X7V A;  2VG5 A;  1ZA1 B;  1PYO B;  2XM3 A;  1Q16 B;  1DLO B;  5ETS A;  4DFK A;  3Q2S C;  3MCO A;  2N4D A;  2C22 A;  4NA3 A;  2OPS B;  4B02 A;  3JB9 k;  4QU6 A;  1ZZF A;  2B4U A;  4BBY A;  4UOG A;  3GYX B;  4WE1 B;  2BJ3 A;  2YQ3 A;  4DX6 A;  2R2R A;  1TUV A;  1N5Y A;  1RTI A;  2V8H A;  3KKF A;  5J2N B;  2BQU A;  4R5P B;  2L41 A;  3CXC R;  5GMK a;  2WCX A;  2WVE A;  2R7V A;  3GYG A;  4A48 A;  3DRY A;  2CWK A;  2ATC B;  1S6Q A;  1Z4U A;  2BAN B;  3R9L A;  1S5Z A;  5J2Q A;  4R25 A;  4LIW A;  3M8S A;  1S7H A;  4UOH A;  4DR5 J;  3M2U B;  2CPD A;  1RBO B;  3KHG A;  1TTH B;  5E3R A;  4C0H A;  5DM6 Q;  1IBL J;  1DTQ A;  3D54 A;  3IBW A;  1K9M T;  1S1T B;  1J5O A;  2D7S A;  1IQT A;  4G1Q A;  2BMB A;  4UF4 A;  2PFD A;  4J9M A;  3R8Y A;  4ES3 A;  3CED A;  5D77 A;  3M9N B;  3DYA A;  2B4O A;  2ZBC A;  1P8G A;  4YME A;  1RXO B;  2W8L A;  1GTE A;  5DET A;  5J1N A;  3SQG B;  4Q2M A;  4EK2 A;  1NK9 A;  4QQB A;  1VBY A;  3CMQ A;  2IA6 A;  1S12 A;  1U1P A;  2H54 B;  1U24 A;  1QE1 A;  1S49 A;  3I0R B;  3DOK A;  2EKY A;  4A47 A;  5F8M A;  1MMD A;  4NZ0 A;  3O2I A;  4CCH A;  4DV6 J;  1SV5 A;  6FD1 A;  4ID5 B;  5ETK A;  2DHS A;  3TJA A;  4U9R A;  1UPM B;  1XR7 A;  4EEY A;  4NA1 A;  5F9N A;  2VPZ B;  1I3O B;  2NS1 B;  4DDF A;  4RBV A;  3L7P A;  5KFU A;  1FDA A;  3ZZO A;  5CZX A;  5B09 A;  2DGU A;  1UZD A;  4X64 J;  4B17 A;  2DH9 A;  1D9D A;  1P9Y A;  5K20 B;  5KT7 A;  3DCA A;  2KDO A;  1T8E A;  2E9R X;  5H9E J;  3M6V A;  1M1H A;  3GMG A;  3MEE B;  3GZ7 A;  2ROG A;  4UOC A;  4F4A A;  4IDK B;  2R42 A;  3MPU B;  4BHQ A;  2L3M A;  3CJ3 A;  3DXS X;  3M2R B;  4K4V A;  2DNZ A;  2WAQ D;  3W7B A;  5GAD U;  5DQI A;  1KC8 T;  4TVA B;  4OZ1 A;  4YHH F;  3A8K A;  4BLG A;  4HT5 A;  2ZH9 A;  4ZP7 A;  3OL9 A;  2GGP A;  5D8H B;  3VHQ A;  2OUG A;  1AYE A;  3FC9 A;  4EO8 A;  1Y3J A;  2YWH A;  2GO9 A;  1FD2 A;  4DZ6 A;  2RVJ A;  2UUB J;  3SSR A;  4DUT A;  1GK8 A;  4RW9 B;  1CS4 B;  1YJW S;  3GWC A;  3GSI A;  3I56 S;  2VFR A;  4HHJ A;  2B4P A;  1QAJ A;  4JI6 F;  1SKU B;  3Q22 A;  2A6M A;  4YR2 A;  4RW6 A;  4PQA A;  3JQJ A;  3CW2 C;  3M4X A;  2N7Y A;  3HJV A;  3CC4 S;  3IS9 A;  1FJG F;  4J9Q A;  4ZLP A;  1WC6 A;  3D1Q A;  3OXL A;  4DR1 F;  2FYX A;  4HTJ A;  3W2V B;  1XNR J;  3LP2 B;  5ETR A;  4C0B A;  4PUO B;  2CQG A;  2A18 A;  3N6L A;  3LOU A;  2ZD1 B;  3ZFV A;  1RA7 A;  1U0S A;  3PYF A;  3KLE B;  5E5N A;  5B0B A;  2EFG A;  4ELT A;  3JTP A;  3VVT A;  2MKK A;  3DOM B;  4K8R A;  1NHK L;  2E7V A;  4F2R A;  4HR2 A;  1F5C A;  5A2Q Y;  5CA5 A;  3D1H A;  2JZ5 A;  3DGP B;  3GIJ A;  3HVA A;  3I82 A;  3FCV A;  3G82 A;  3H20 A;  1X5S A;  1R43 A;  2Z0G A;  1GNK A;  3ADA C;  4KGZ B;  2LA6 A;  4FF1 A;  2CZV C;  4EBE A;  4PEO A;  1DQA A;  3U1N A;  1LW2 A;  1RCX B;  3S01 A;  2NPI A;  1RWN B;  1N32 J;  1JJ2 R;  2BRK A;  3BGR A;  1J5E F;  2YVS A;  4ZVT B;  2ZH3 A;  1TKZ A;  2X1G A;  4CO4 A;  3ICL A;  1HNZ J;  3EGV A;  2B51 A;  1N33 J;  2E1M C;  3KNA A;  2ROP A;  2F4F A;  2WK4 A;  3BPD A;  3SCL E;  2FVC A;  1JKH A;  3OV7 A;  3NS7 B;  5M2P A;  3PEJ A;  3R27 A;  4ANC A;  1H3D A;  2PI5 A;  1J27 A;  4Q44 A;  1GXL A;  4IKA A;  1DQ9 A;  3VAJ A;  1T0T V;  4G1I A;  3LUY A;  1UVJ A;  1M1K T;  5HJX A;  5F8J A;  1SQG A;  4LF8 J;  1HBU A;  1Q8K A;  1LK5 A;  2M7S A;  1WTB A;  1WEX A;  2HG4 A;  4ZPB A;  3A4T A;  3BN7 A;  1JK9 B;  2QX0 A;  3BGL A;  1S6P B;  4KPY A;  3M8P A;  2X1F A;  1N8R T;  3OW2 R;  2KM8 C;  2IBO A;  5DS7 A;  4B3T J;  5HMX A;  3M8W A;  3OT9 A;  2FJB B;  4I6A A;  1UEK A;  2OKQ A;  4ICL A;  4QWD A;  4AL5 A;  2O3D A;  2VON A;  4H4K C;  5L38 A;  4UOF A;  4PAA A;  2IFX A;  2QMU B;  3AAW B;  2FVQ A;  2R7W A;  2E1P A;  1BXN A;  4LBH A;  3OSP A;  3AXM A;  4OYB A;  3FGV A;  1CJV B;  3GIL A;  1XBW A;  3D66 A;  1QSS A;  1XTZ A;  4ZPC A;  1VK8 A;  2AMC B;  2RUG A;  1O6X A;  1ZAX A;  1I51 B;  4BCA A;  4I69 A;  4DR2 J;  2AJ1 A;  2L48 A;  4CLW A;  4DV7 F;  2JRS A;  5HBM B;  3OHB A;  3TVK A;  4JI8 J;  2GQC A;  3V81 A;  2RJZ A;  5A0Y A;  2JFK A;  5EDW A;  3N9U C;  3PYE A;  1HPZ A;  2V0N A;  3BH6 B;  4O3N A;  1UEU A;  3SBM A;  5GAG U;  5C5J A;  2A6O A;  2O67 A;  1FDB A;  2FUG 9;  4F0M A;  3G8T A;  1UJ6 A;  3C16 B;  2XS5 A;  3FFI A;  3CJK B;  4LJM A;  3B78 A;  1TL7 A;  1F5B A;  2UUA J;  5F8G A;  2HNY A;  3Q2T C;  1DAX A;  3DDI A;  2JOQ A;  1Y9O A;  5J2M A;  2E1A A;  4DL2 A;  3MAA A;  2GAH C;  4EMD A;  3AA9 A;  2VC1 A;  3D68 A;  1YBT A;  1IKY A;  1VDH A;  4ALZ A;  2YH0 A;  1AZS B;  2GMH A;  3QFW A;  1LW0 B;  4OI4 A;  3TAQ A;  3ZO7 A;  1L3V A;  4DCP B;  4LF5 F;  3T5L A;  2WRM A;  3WHI A;  4LF7 F;  1LWE A;  5LXR A;  2N82 B;  1VQK S;  3CUN A;  2XCP A;  1GT8 A;  2XI2 A;  3IBC B;  2GVD B;  2KXN B;  2JC1 A;  4I6W A;  5IC4 B;  1RHK B;  2D3O R;  5DG9 A;  2PI4 A;  1PIL A;  2GHP A;  3MM7 B;  2XWY A;  3CJ0 A;  1BUX A;  4PWD B;  1EP4 B;  3O8W A;  4PQU A;  4LUB A;  1NND A;  1FF2 A;  1YRU A;  4CO5 A;  1HBM A;  1JLG A;  2LXI A;  5AJ3 F;  4X66 J;  1YX2 A;  3ISN D;  5F3Z A;  1Y0H A;  1GMV A;  4H4M A;  4RPF A;  3NMA A;  1EET B;  1ARO P;  3E01 A;  2JNJ A;  4DCJ B;  2KJW A;  3TX8 A;  3EGN A;  4Z2X A;  3AQP A;  4MTP A;  1IKV B;  1JLE B;  1X0F A;  4KAI A;  1FNM A;  3HSZ A;  3B82 A;  1IBK F;  4BS2 A;  1IR0 A;  2R7U A;  1I1G A;  3L7O A;  3MM6 A;  3AJD A;  3NGT A;  2XS2 A;  4TY8 A;  1WG5 A;  2ZBQ A;  4EUV A;  1T3N A;  3DGV A;  3K5N A;  1WC3 A;  1VBX A;  5HP1 B;  3UCG A;  4YN3 B;  5A76 A;  1S99 A;  4KHR A;  1AW0 A;  3TEG A;  4M63 A;  4IG0 A;  2BE2 B;  3G8S A;  1OPZ A;  4ZPW R;  4I68 A;  1MWZ A;  3JS9 A;  1T3O A;  1O51 A;  3J80 U;  1VRT B;  1R0A A;  4HLB A;  4ANE A;  1HNW J;  4ILL A;  2AW0 A;  4AL7 A;  3I9Z A;  4LF2 A;  1KNZ A;  2DGV A;  2DRB A;  2AHO B;  4WFA Q;  5DDQ C;  2KI2 A;  4ZIW A;  2HIQ A;  1VBZ A;  3HMJ G;  1XJW B;  4P72 A;  3Q8Y A;  2Z4P A;  3OXF A;  2YKN A;  4K5R A;  3R7N B;  4NXM F;  2MQP A;  1ZS6 A;  4DL0 C;  4WK3 A;  1F0X A;  1Z2L A;  1SCJ B;  2J9D E;  3SCJ E;  2PA3 A;  2OGU A;  2W9C A;  4C8M A;  3JYT B;  2ILY A;  3RBD A;  4CNY A;  5BJR A;  2X1B A;  3V6K A;  3W60 A;  2MZ1 A;  1NK7 A;  3J80 Y;  4Q8E A;  1WTF A;  3L4B C;  1WC5 A;  3QQC D;  2WOM B;  2EG1 A;  3LGH A;  4CI0 B;  4CT9 A;  4OQJ A;  1LWF B;  5E2Q A;  2X3D A;  2QIF A;  3OQ2 A;  3W2W A;  3FJ2 A;  1M5H A;  4Y00 A;  1VCT A;  1VQO S;  3PFO A;  4B3M J;  1Q82 T;  4EZ9 A;  3DKD A;  2CQ2 A;  2YNH B;  4IFV A;  1S1V A;  4RWW A;  3C6U B;  1LFP A;  1SC6 A;  4TKT A;  1RU2 A;  2G1H A;  3UCZ P;  2XYP B;  2EXU A;  2BM1 A;  2KVI A;  5HN0 A;  3H2U B;  1H2V Z;  1WF2 A;  1SKW A;  4OYA A;  3OTO J;  3HJF A;  3PEH A;  2XLI A;  3QRR A;  1FT8 A;  2LYV A;  1FKA F;  3FEZ A;  3O6Q A;  3TJ9 A;  4IOA Q;  4DPU A;  4PWW A;  4HKQ A;  4FN5 A;  2RS2 A;  1ULR A;  4QJV A;  3TA1 A;  4KRW A;  3D0H E;  4MIW A;  3KJV A;  3QT5 A;  5HQM A;  5L8R C;  2VA3 A;  2W01 A;  2HZV A;  2N3L A;  4KR0 B;  3MM8 B;  1RJJ A;  2XZW A;  2ZDO A;  4EFA C;  3HUL A;  5DGA A;  2R2T A;  1RTH B;  5HAN A;  2YNG B;  4ZP9 A;  1MU2 B;  2WW8 A;  2YWF A;  3R1H A;  2ZZM A;  5KAK A;  1JLB B;  1S97 A;  2ADB A;  3P3D A;  1U48 A;  5K14 B;  2BX6 A;  3PHT A;  2C3Y A;  1JJH A;  5LXY A;  4YP3 A;  3W62 A;  1K1Q A;  5LT5 A;  4QPT A;  2E5G A;  4Y3C A;  3ISN C;  1D9A A;  4CLK A;  4FNI A;  3VV2 B;  4NCB A;  3HD1 A;  3UN5 A;  4RR5 A;  3VGV A;  1S0M A;  2V9W A;  2MZS A;  2WSC C;  1Y5I B;  1V3S A;  3M2V B;  2P9G A;  3AFG A;  4Y2M A;  4NLS A;  1TEL A;  1QJH A;  2CQ0 A;  2AYM A;  2YTC A;  3RYL A;  2ZDP A;  3HFV A;  2R8G A;  1T9T A;  1WOO A;  2MGZ B;  2ZM6 F;  2FPH X;  3RR8 A;  1R8H A;  2P5V A;  1NHV A;  4P6Q A;  4JI2 J;  1W7W A;  3ET6 A;  2AGP A;  4D3G A;  3BKU A;  3EGW B;  1LWC B;  4LSL B;  1PCA A;  1FRI A;  2CQ4 A;  4RW7 A;  5KTQ A;  3PW2 A;  4FBU A;  4DPY A;  3W9I A;  4ED7 A;  1N48 A;  4QWC A;  3T1Y F;  2RKI B;  5IV3 A;  2FVP A;  2H48 B;  4NLQ A;  1HNI B;  2EPI A;  3TEH B;  3MPD A;  4RNM A;  1KQS R;  3TVY A;  4OZN A;  5CHC B;  3TW0 A;  4U8Y A;  2G2Y A;  1HR0 J;  2P8I A;  2C2Z B;  3BBB A;  2AYG A;  3SV4 A;  4QOT A;  2OMO A;  4U8V A;  2VA2 A;  2CJQ A;  2DIV A;  4DR6 F;  4IH6 A;  1REV B;  4DS5 A;  5A8R B;  3DLK B;  4RL1 A;  7AT1 B;  1H74 A;  1VJQ A;  4QYZ K;  2PE8 A;  4QIW D;  1HBN B;  2XSJ B;  3U1M A;  4HHH A;  2XMU A;  4USW A;  2DR5 A;  4M8L A;  5HL7 Q;  4LT6 A;  2V2K A;  4IFY B;  2KT2 A;  4DQQ A;  1JLC B;  3KJF B;  1ZYQ A;  4TU9 A;  3JAM U;  2YKM A;  2J8S A;  4KJI A;  1T02 A;  4YR3 A;  3MTJ A;  3LAN A;  2DGX A;  4LFB F;  3W66 A;  3GCW P;  3MZI A;  4X65 F;  2V4Q A;  3TZX A;  2K06 A;  4OZL A;  1NDC A;  4B3O B;  1ZH5 A;  4CT8 A;  2VPX B;  3JSR A;  4AXI A;  4QU7 A;  1VRU B;  2MZT A;  2ZFH A;  7FD1 A;  3Q8S B;  4C11 A;  2XMW A;  2J0W A;  2LDY A;  3J7Y I;  1RT5 A;  4PKD B;  5BXI A;  5KFG A;  3SYZ A;  3VGS A;  2MKJ A;  1DUR A;  2BE7 D;  2UZA A;  4RO0 A;  1CSJ A;  3I5B A;  2VBY A;  1IUJ A;  4QBU A;  4CLZ A;  2DRA A;  4HI1 A;  2CA9 A;  2QL5 B;  3TNV A;  4B9S A;  2RHQ B;  4LRA A;  4F3O A;  4DG1 A;  3TA2 A;  3PKM A;  5MAO A;  2ASJ A;  3OL7 A;  4UTG A;  2FJX A;  1U25 A;  4F36 A;  5JJB A;  2FLO A;  1KLM A;  3M7V A;  3HK2 A;  2BAB A;  2G9O A;  2B5J A;  3ENW A;  3DHW C;  4DQI A;  2IVF B;  1RT3 A;  2YKA A;  1S72 S;  2HKE A;  3RU0 A;  1OYD A;  2YWE A;  1E6Y B;  4P74 A;  1C1C A;  2IJN A;  4KQZ A;  3NG8 A;  4R8U B;  3UNY A;  2BJ9 A;  2J6T A;  4O3O A;  2L08 A;  2OLW A;  3VQS A;  2VKR A;  3WX4 A;  2W2O P;  1MRO A;  1NSA A;  4OYX A;  1HNX J;  2DXE A;  1UFK A;  3HVW A;  4K2J A;  3HI9 A;  3CIZ A;  1NU4 A;  1O5J A;  1H7X A;  2CPJ A;  4EI2 A;  2R2S A;  4DQR A;  1VIX A;  1KP6 A;  2E5L J;  2KG1 A;  5JVG Q;  1WD6 A;  2MSS A;  3M30 A;  2KRR A;  2F3J A;  4J9R A;  1GX6 A;  2BRL A;  4CZC A;  3CWJ A;  1PYT A;  1QM9 A;  4CH0 S;  2PC6 A;  2IYI A;  4DV6 F;  3BGO P;  2ZHO A;  5KG2 A;  1SL2 A;  4U67 Q;  5CXT A;  1P9Q C;  1YDL A;  1UP1 A;  2XNQ A;  1YJU A;  1OQ6 A;  5KT5 A;  3R6G B;  4F0K A;  1F60 B;  2MYF A;  1B4S A;  4NEZ A;  2P9E A;  3CCV S;  1HLW A;  1S1W A;  3W64 A;  4C7Q A;  2QN6 B;  4PWU A;  4X64 F;  3R7S B;  4USM A;  3CD0 A;  2Y1R I;  2V9K A;  4RX6 A;  1FKP A;  2MB0 B;  3MPY A;  1F3V A;  2PA8 D;  2WW4 A;  3MFI A;  1YKW A;  1N5T A;  2IC3 B;  2RDJ A;  1T9W A;  4PXC A;  3GYN A;  2QG9 B;  4DX8 H;  4MKB A;  4RU2 A;  5IXU A;  3KLI B;  1SH3 A;  4ILM A;  5C42 B;  2RRN A;  2OHD A;  1EX8 A;  4I7F A;  4IRC A;  1KQF B;  3HXM A;  3L3C A;  4ES1 A;  4A8Y A;  2AJ2 A;  3GFY A;  2ALZ A;  2GO8 A;  1FRM A;  2UUB F;  2A2C A;  2WBR A;  1IWA A;  4W98 A;  2IMO A;  4Q45 A;  2BAC A;  4X4Q A;  1FFW B;  2BXJ A;  3K5L A;  2KFZ A;  4L74 A;  4Y65 A;  5BR8 J;  1EB0 A;  2DY9 A;  3OL8 A;  4KFB B;  4UY8 T;  2DNR A;  3C8Y A;  2VQE J;  3VAL A;  4EBC A;  1YZ6 A;  4DR4 J;  1T03 A;  1WOS A;  1Q4R A;  4E0D A;  5KFX A;  2OP5 A;  1ZAW A;  2HMI B;  3K0J A;  2WON A;  3SI8 A;  2YWW A;  3CC7 S;  2M88 A;  4CTA B;  1C0U B;  2WVD A;  2PEH A;  4ZLN A;  1TFW A;  3M8Z A;  4KHP F;  2XMA A;  3D3C J;  3J81 U;  2AJ0 A;  2O5D A;  2CNL B;  2JHE A;  1FHT A;  1UJ5 A;  3BPS P;  2HHT A;  4WXW A;  5E41 A;  3DLG B;  3MF5 A;  4CWB A;  3M32 A;  3S8S A;  2IY5 B;  4QIE A;  3KG0 A;  4X4P A;  1Q81 T;  3QAT A;  3A3N B;  4OIX A;  1TKX A;  3MXH P;  4YB1 P;  1WEL A;  3DRP A;  1SC1 B;  4NCG B;  1RAG B;  1YK9 A;  1WWH A;  2QFI A;  4ZVH A;  4KB7 A;  3HZE A;  5KFI A;  4ERD A;  2DHX A;  3GFH A;  3CDU A;  3J81 Y;  3CCL S;  4DN9 A;  5H1S V;  4LF4 F;  1BQN B;  3TZY A;  1VC6 A;  2YNI A;  1HNZ F;  5FD1 A;  2HQF A;  4OX9 F;  2VOP A;  2QEX S;  2UUW A;  2AYB A;  3G6E S;  5D15 A;  3R7B B;  2B8Q A;  1AA1 B;  2ZWP A;  1H73 A;  3QNW B;  2B7C B;  1PJ5 A;  2HND A;  3SDE B;  3OD2 A;  1RTJ B;  3QWP A;  4IG3 A;  2PMW A;  4RKU C;  2Y1J A;  4OHZ A;  3NWG A;  1DTT B;  4DU8 A;  1X9S A;  4NPO A;  2DD8 S;  2FTR A;  3LPE A;  3R5A A;  5SZT A;  3W5Z A;  1M5S A;  4OJ1 A;  2M2B A;  2Q6B A;  4ZPV R;  2H5E A;  2HBZ B;  2IJF A;  3O5T B;  1RUS A;  3BYR A;  2OD6 A;  2ZNY A;  3CCT A;  4KH1 B;  5FDL A;  1RWX B;  5EX3 A;  2R8I A;  4J9N A;  3NCR A;  4F4Y A;  2E9Z A;  4Q0B A;  2XO6 A;  1TFY A;  3KLG A;  3P5B P;  3EVM A;  1U1Q A;  4UST A;  5B0F A;  4E98 A;  4NI2 B;  1X0P A;  2RIJ A;  3HKW A;  4HAC B;  3MDF A;  4PRF A;  4DL5 A;  3BSA A;  3IN5 A;  3B54 A;  1R8C A;  1FRL A;  1BQM A;  2RF2 B;  3CVK A;  3GON A;  1Y5N B;  3P5T L;  4QW9 A;  2FJA B;  3CCW A;  1RT4 B;  2BW7 A;  2HVH A;  2HHV A;  4ZK7 M;  3K89 A;  3HHL A;  3AD7 C;  3R5D A;  3BBC A;  1IKX B;  2DNN A;  2BUN A;  2ZH8 A;  1DY3 A;  1YJN S;  3TYT A;  3W8P A;  2EBE A;  1TV6 B;  1NM2 A;  3RZA A;  2KKH A;  4JI8 F;  4TYB A;  2V4J A;  1LXN A;  2FHM A;  3CJT A;  4YHH J;  4NYZ A;  3AJ1 A;  5CYM A;  4AFF A;  4K0K J;  2IA0 A;  4DV2 J;  2YPZ A;  4RWX A;  3EPI A;  2CJ9 A;  3HF5 A;  3GE9 A;  5IM0 A;  2NXU A;  1CJT B;  2XCA A;  2ZH2 A;  1FWP A;  3I87 A;  3DU6 A;  3VQT A;  2QLX A;  3MFH A;  4B9L A;  4FF2 A;  4ZS6 A;  1URR A;  2N7C A;  2W2Q P;  3JSY A;  3PG9 A;  2MDA A;  2XB2 D;  3GU0 A;  1XR5 A;  1RAE B;  1V3Z A;  4ZVR B;  1Q0N A;  3QT8 A;  1SUQ A;  3OSN A;  2VG5 B;  5DRK A;  4OV6 A;  2QL9 B;  4DZD A;  4JI6 J;  1SC4 B;  2EVZ A;  4GVB A;  4ECT A;  1FJG J;  5DQG A;  3D7S B;  2X3G A;  4C9D A;  4C0O C;  5J1E A;  2HZA A;  4DR1 J;  4RUA A;  2M5Y A;  4NLR A;  4OLO A;  3G9C A;  5KFT A;  1NK8 A;  3ETO A;  1JNZ B;  1N5Y B;  3HDS A;  1RTI B;  3V6D A;  2HEK A;  1UCN A;  2IJR A;  5FLX U;  4HEA 9;  3HT3 A;  1RP5 A;  4QR1 A;  2W4C A;  2LLZ A;  3IR7 B;  3RRG A;  2VJV A;  3BJY A;  1RSC A;  1S6Q B;  3H5U A;  2J8A A;  4O3Q A;  1T9X A;  4B9M A;  3UVJ B;  3ZTR A;  2LEB A;  1GMW A;  1VOM A;  3AB4 B;  3KMS A;  2CIM A;  2FY1 A;  1YRX A;  3KMQ A;  4NLU A;  1DTQ B;  3SXL A;  4DU7 A;  2W24 A;  1KOO A;  1J5O B;  1UEV A;  4PCQ A;  2XNR A;  5DO2 A;  4G1Q B;  3TO8 A;  1SVD A;  4S0M A;  3KK1 A;  4OV1 A;  1RTD B;  3K5M A;  2G2O A;  3ENQ A;  3DYA B;  1VYA A;  5FLX Y;  3EWG A;  4EYI B;  1KBR A;  5CAB A;  4RNN A;  2XO7 A;  4OYI A;  2HHH J;  1RK8 A;  3RB3 A;  2UP1 A;  2XMM A;  2ZHB A;  1QE1 B;  3CUL A;  4ZVF A;  1LV5 A;  2A2D A;  4A8Q A;  2OD4 A;  4GKK F;  3DOK B;  3B4M A;  4J90 A;  2IAJ A;  2UXB F;  4JUZ A;  1SC3 B;  1HIY A;  2IDE A;  1HYS A;  1Y7P A;  1YIT S;  2YKQ A;  1DLO A;  3CCE S;  1WHW A;  1FFG B;  4NLY A;  3H59 A;  1U47 A;  4DL4 A;  4DR3 F;  2DR9 A;  2IDL A;  4WE1 A;  3DMJ A;  2PO4 A;  4QCL A;  3UR0 A;  4AUK A;  3ILL A;  1K0V A;  1BC6 A;  4R5P A;  2DO0 A;  2HK2 A;  1U1K A;  4ZVO B;  1VHI A;  2MQO A;  2M8D B;  4ZIT A;  3DLE A;  4OYZ A;  3N0V A;  1F1B B;  5HI7 A;  3IAS 9;  3DLJ A;  3DU5 A;  1WEY A;  5FII A;  1RAC B;  4P7T A;  1AFI A;  3VGU A;  4F25 A;  2HGL A;  2XLJ A;  1NJI T;  2XGQ A;  2YH1 A;  3M2U A;  4K4T A;  2EFV A;  5KFO A;  1PYS B;  1JLA A;  1SPB P;  2V5H G;  1A0O B;  2ZZN A;  2ZE2 A;  1N4L A;  3ZC4 A;  4CIO A;  1Y3K A;  4JYA F;  2GGP B;  3D6M B;  4DV7 J;  1S48 A;  1NJW A;  3FEX B;  5KFP A;  2MHE A;  1CPZ A;  2MLY A;  2IMW P;  4JV2 A;  1X31 C;  3OFF A;  3SQG A;  2G0J A;  4QYR A;  3K8W A;  4IRD A;  1CUL A;  1MML A;  4FKY A;  4RW6 B;  1RAO A;  3PKY A;  3ZNJ 1;  2OPQ A;  4LBP A;  2JLG A;  2DGO A;  3CCS S;  4AQY F;  4ZOS A;  2EFO A;  2DRD A;  2XC9 A;  4ZJO A;  4DQS A;  3AOD A;  2ASD A;  5HLF A;  2U1A A;  1FX4 A;  5E3P A;  2EFP A;  1JLF A;  2LU2 A;  1X4G A;  4QWE A;  2YBV A;  3QLH A;  4B9N A;  1GFW B;  1S0O A;  2HWH A;  2KT3 A;  3KOA A;  2FJD B;  4HVZ A;  4LF5 J;  3RBE A;  4A8O A;  3MMA A;  2CJK A;  3IC1 A;  4LF7 J;  4R0J A;  2C2M B;  4NX9 A;  4LQ9 A;  3CJ4 A;  3RGI A;  1JWW A;  2MQL A;  3FBB A;  4ED3 A;  2JEG A;  3ENV A;  3G82 B;  3CD6 S;  3MEE A;  2HIY A;  1NK6 A;  3GIR A;  2YPY A;  2MQN A;  4J9V A;  1LW2 B;  2IRX A;  4IOC Q;  1OSD A;  2YNF A;  1QUV A;  3QBC A;  2QYC A;  3BGR B;  1B99 A;  2WB1 D;  2F8E X;  1KEK A;  4QR2 A;  4XAK A;  2V6A A;  1TKZ B;  3GJR B;  3GV8 B;  1RQ0 A;  4J7C A;  4Y34 A;  2W2N P;  3PYG A;  2YWG A;  2CUY A;  1WDD A;  3RAQ A;  2VB6 A;  1UA1 A;  5DM7 Q;  5DZ6 A;  5AJ3 J;  4C48 A;  1JLQ A;  2XUL A;  4WII A;  2QSW A;  1JKH B;  1HQ2 A;  4XDD A;  1RZM A;  2BEF A;  3KK3 A;  3QPI A;  1R8P A;  1RYS A;  2XZD B;  2FZC B;  3NL0 A;  2HLU A;  2Q3P A;  3K58 A;  1KTQ A;  2AJF E;  1NPR A;  2UXC F;  5KFB A;  1RAF B;  1TKD A;  1FFS B;  3W9J A;  1HBU B;  2LXU A;  3UQS A;  5KG6 A;  1IBK J;  2HPU A;  4N7T A;  2GHW A;  2CJA A;  3CCR S;  3M8P B;  2CZ4 A;  2LA4 A;  1C4A A;  4JV0 A;  3QO9 A;  1BD6 A;  1WC4 A;  2ZH5 A;  5HMW A;  5IQ6 A;  3HX9 A;  1OS5 A;  2NCK L;  1U45 A;  2VDI A;  4DPO A;  4ICL B;  3KLE A;  2LKZ A;  3V6H A;  2HFS A;  1RT2 B;  3W5X A;  1AFJ A;  4NZ7 A;  2GFF A;  3OFH A;  4OYM A;  2JVO A;  3BO4 A;  4DXL A;  1V5I B;  4J9S A;  2HHQ A;  1NHU A;  5HAO A;  2VOD A;  2ZOF A;  1GMW D;  4DEZ A;  3MCN A;  2HVE A;  1IBM F;  2QLJ B;  4KO0 A;  3RTV A;  2A1B A;  1X4H A;  3CCQ S;  1JX4 A;  2JX2 A;  1YIJ S;  3S7R A;  4F2S A;  1OJ4 A;  3A8E A;  4WCE Q;  2DR6 A;  4NZ6 A;  4FZV A;  4NCA A;  3J7A 1;  1HNV B;  1VQ6 S;  1OY6 A;  5KFQ A;  3M8R A;  3MM5 A;  3QSY B;  3EZ5 A;  2NUU G;  4RZR A;  4NXM J;  2BVZ A;  1MN9 A;  3D4J A;  3PR5 B;  1UWA A;  1S7I A;  1SB6 A;  3BH7 B;  2K7J A;  3V81 B;  5A0Y B;  1UWB A;  3QZ8 A;  1Y10 A;  3MUT P;  3S1T A;  1NCL A;  1HPZ B;  3BSN A;  1TL1 A;  3I5A A;  3JTN A;  3V4I A;  5A6P A;  1R0B G;  4K4W A;  2MKC A;  2VUG A;  5E33 A;  2Z30 B;  3FFI B;  4NEY A;  2V2V A;  1TL7 B;  2FGC A;  3SFG A;  1ICE B;  2V8D A;  3R5J B;  5K5M A;  5CD4 H;  3PHE A;  4DBQ A;  4B08 A;  1VR6 A;  4LIR A;  4USH A;  5J2M B;  3MEG B;  2EW9 A;  3QFH A;  3MAA B;  2OAU A;  3RJM B;  1FKO A;  3BDP A;  4LF9 F;  3RB0 A;  1VQ9 S;  2DGT A;  3HVT A;  1KDN A;  5JXS A;  4CH7 A;  4NXN F;  3LAM A;  2W25 A;  1IXK A;  2MJU A;  3NMR A;  1SIW B;  4RJV A;  4O3S A;  4XDC A;  1JXL A;  1LWE B;  3KUG A;  3GTY X;  1YQH A;  3QRQ A;  1DAR A;  4JV1 A;  1HFE L;  4A8W A;  3EXC X;  5A8W A;  4MKV A;  2CDR B;  4ECV A;  4O23 A;  1PC5 A;  1VRQ C;  3OHA A;  5G4D A;  4UQT A;  3AB2 B;  4PQU B;  1PC4 A;  1T11 A;  3TUI C;  4CM0 A;  4NLG A;  4PG4 A;  1HBM B;  2VDH A;  1JLG B;  3F0N A;  2G0C A;  4H4O A;  1RAD B;  3ZTQ A;  2FDN A;  3CJS A;  4XTT A;  3CCU S;  5CH7 B;  4M5N A;  4ED5 A;  3UDL A;  2DK2 A;  1K47 A;  2HBQ B;  3E01 B;  5ETT A;  1APS A;  2ZZT A;  1S9E B;  3UD3 P;  1YJT A;  2DIU A;  2DVI A;  5ETQ A;  2DGQ A;  4ZA1 A;  3C16 A;  2LQB A;  2IBK A;  2GW8 A;  3PRD A;  3DHX A;  5BYQ A;  1UW4 A;  1Q5V A;  3MM6 B;  5AXK A;  1AT1 B;  3NNH A;  3OJS A;  1QTM A;  2IM1 A;  5AXL A;  2FD2 A;  4TY8 B;  5F8L A;  1BWV A;  3MUM P;  2OPP A;  5B0A A;  2HW3 A;  4J9U E;  1RHM B;  1ZOT A;  3QJJ A;  3HSD A;  2FC9 A;  4P71 A;  5E0O A;  2PMZ D;  1S59 A;  2HQG A;  3MM9 A;  3R5G A;  1CJK A;  4XPE A;  3N5B A;  4Z7C A;  1LW0 A;  1NH7 A;  3KXD A;  4FDF A;  3K8V A;  1HD1 A;  1SQF A;  4UZC A;  1D8Z A;  1C4C A;  1R0A B;  3QGH A;  2ZWO A;  4ZLL A;  1NPK A;  3N01 A;  3TR5 A;  1RHU B;  3LA0 A;  4Y0F A;  5KOW A;  2H9Z A;  3A13 A;  2AGO A;  2UUC J;  4U96 A;  2YKN B;  5I3U A;  3POT A;  4ER8 A;  1D8Y A;  2RML A;  2GIQ A;  2RB7 A;  1PG5 B;  1FJE B;  5D0E A;  2KHD A;  3OR2 A;  1Q7Y T;  2UVV A;  1RWU A;  3QZ7 A;  4QIG A;  2AEF A;  4EZ6 A;  3G2X A;  1ZPW X;  1FRJ A;  4K7Q A;  5A8K B;  3VAI A;  2FHJ A;  1KS2 A;  1EET A;  4DR4 F;  3I32 A;  3CD5 A;  3W2W B;  2ZJQ Q;  3GQC A;  2VG6 A;  2NR0 A;  3W63 A;  3NS6 A;  1JLE A;  3PIO Q;  4DL6 A;  4IFV B;  5F0W A;  4G1P A;  1S1V B;  4N8N A;  4LFB J;  4AD6 A;  1GXT A;  4WZQ A;  2XQC A;  4X65 J;  2ABY A;  3GFX A;  4OYP A;  2FLP A;  3QMQ A;  4B9V A;  4ZIV A;  4FKX A;  1Y4Z B;  1RWM B;  4NLV A;  2AWZ A;  3QT6 A;  4UUW A;  3FZB A;  4NLT A;  4GO5 X;  3NAH A;  3KUH A;  2ZBI A;  1VJW A;  3H4B A;  2J0S D;  2NSC A;  1TU0 B;  4RNH A;  3THV A;  3WX8 A;  3ITH A;  4LVO P;  2Y1L B;  2R9L A;  3SFU A;  1I5O B;  1GH8 A;  3KJV B;  4J91 A;  1S1X A;  2BOP A;  3BF4 A;  4G3I A;  3F56 A;  3W61 A;  5BYR A;  2VV5 A;  4MYT A;  2GCF A;  1T05 B;  1UVI A;  5HQ8 A;  5D4P A;  4DCO B;  4MH8 A;  5GAE I;  3D9B A;  4KTQ A;  3C15 A;  1SL1 A;  4ZHR A;  3PO5 A;  3TUP A;  3GFZ A;  3ELH A;  1LEO A;  2EKN A;  5D3G A;  2BA9 A;  2DNL A;  2OO4 A;  5LMU F;  4X4S A;  3GJT B;  1QSL A;  2I2Y A;  1WHV A;  1UVN A;  2H5J B;  4I2Q B;  4C3L A;  1FJ7 A;  4ZJL A;  1WUU A;  1LWF A;  5CYQ A;  3TQ1 A;  1HW9 A;  1QVG R;  3LTO A;  1HI0 P;  4NLX A;  3ZZT A;  2J6S A;  3H4D A;  1RLC L;  3H42 A;  1MSW D;  4JI7 J;  2F8M A;  1F9F A;  2FVS A;  4OJH A;  5ETP A;  1HQE B;  3G87 A;  2CPE A;  4X4T A;  2ZHA A;  1NB2 A;  1KOH A;  3BRE A;  2ZC4 A;  5HSP A;  3ET6 B;  1LK7 A;  5L1L A;  2A3J A;  2UXD F;  1D09 B;  2FIU A;  2VPW B;  2AYE A;  4PG8 A;  4RW7 B;  1FK9 A;  3PO4 A;  2VKZ G;  2OIH A;  2J76 E;  2GQ2 A;  4ZLJ A;  5F8I A;  3MHY A;  4FVC A;  4DUZ J;  3CDW A;  3UDV A;  1FRH A;  4CP5 A;  3G8Q A;  3QID A;  2BJ8 A;  4NE9 C;  2KXF A;  2OSQ A;  3LP1 B;  1OWX A;  3UD5 A;  2D41 A;  3J7Z T;  2VG7 B;  4DSK A;  3M8Q A;  4GVL A;  3AD9 C;  1R8A A;  2B9W A;  3MEC A;  4DLG A;  1VQY A;  4O44 A;  4CH1 A;  1MU2 A;  2KH9 A;  3U1L A;  1B3T A;  4K0K F;  4M5D B;  4C8N A;  4DV2 F;  8ATC B;  3RUB L;  5JMN A;  3Q8U A;  3CCJ S;  3H2V E;  2E66 A;  2BBE A;  5K14 A;  5HRO A;  2WB4 A;  1RT7 A;  3IM9 A;  1X4D A;  4ZVG A;  5IC6 B;  1LWX A;  1NKE A;  2Z58 B;  4F3M A;  1Q95 G;  5DLG A;  1X4E A;  3CT9 A;  2ATL A;  3LGM A;  2YKM B;  3B6B A;  1X4B A;  4J9K A;  4RNO A;  2ZH6 A;  3VAH A;  1FXR A;  1PAE X;  1EZZ B;  2BV3 A;  5A2Q U;  4N41 A;  2JLE A;  2E7X A;  1NKB A;  5KFE A;  3KUE A;  2QRR A;  2ILZ A;  2EK6 A;  2VBW A;  5KFV A;  1VIS A;  3AOC A;  3FUY A;  4KE5 A;  3OTD A;  5KFS A;  1TK0 A;  4O4R A;  4WKY A;  1K1S A;  4KHP J;  2FJV A;  2ZEJ A;  2AGQ A;  1NH8 A;  2JC0 A;  1U26 A;  3FBF A;  2MGZ A;  3IAM 9;  4ECU A;  4C11 B;  3E8O A;  4M5J A;  1GTH A;  3T1H J;  3MMB A;  3J7Z 5;  1RT5 B;  5CAA A;  2MZR A;  1PIE A;  1NEE A;  1JMT A;  1NLK L;  3BSC A;  1A9N B;  4KKO A;  4ZP6 A;  2B9X A;  3T41 A;  4MK8 A;  1VHF A;  3NBP A;  4X4U A;  1DJ0 A;  4ECY A;  2F9D A;  4OLP A;  1FCA A;  4B3R J;  5HAT A;  3IA0 A;  3DLH A;  4PXD A;  3BQ2 A;  4HI2 A;  2UU9 F;  1U2R A;  1Q78 A;  5T14 A;  1KKH A;  4DV0 F;  5CCM A;  3J81 j;  2ZJP Q;  1HNI A;  3TAR A;  4DV4 J;  2B5J B;  3L95 X;  3PW0 A;  3C3L A;  1RT3 B;  2QLB B;  4LF4 J;  1ACM B;  1U8S A;  1TQL A;  2KTQ A;  1OY8 A;  2KHC A;  1C1C B;  4OX9 J;  1YTY A;  2FHJ D;  5DQH A;  3PM9 A;  3I4P A;  3UNG C;  3GIM A;  3X3U A;  1L3T A;  2YQ0 A;  3G4S S;  1N56 A;  1MRO B;  2HFU A;  3PTW A;  4LR7 A;  2HHH F;  2HBR B;  2Y0B B;  4C98 A;  1TL3 B;  2UV8 A;  2DHH A;  2XSJ A;  5ETV A;  4USK A;  4IFY A;  2VFT A;  3BR9 A;  4ENO A;  4YFU A;  2HK3 A;  2UUT A;  1D0E A;  3M30 B;  2AJQ A;  4KY3 A;  1WOR A;  2DEI A;  3K59 A;  3U27 A;  5J2P A;  2BZ2 A;  4AND A;  3FK4 A;  2AU0 A;  1L3U A;  1WKL A;  1FNO A;  5IZH A;  4MT1 A;  2LU1 A;  4B9U A;  1FDD A;  1E6V B;  4USI A;  5LSR A;  5LJ5 Y;  3N6N A;  2CRL A;  2DHG A;  2E7W A;  1X4A A;  4HL9 A;  3OUY B;  1RB0 A;  4K4Y A;  4ZVS B;  1ZM4 A;  5IT9 U;  2VZ9 A;  3VCD A;  4DF4 A;  4OZJ A;  3C2P A;  2FQQ B;  1RHJ B;  4PAB A;  4R0E A;  2KG0 A;  1HMV A;  1S1W B;  4YB6 A;  4K2X A;  5E3C A;  3G6X A;  1YBA A;  1LQ9 A;  1Y00 A;  2I1R A;  4JBC A;  5U47 A;  3NS5 A;  1BE4 A;  1UKU A;  1WDT A;  5SUH A;  3L7U A;  4ECZ A;  4YB7 A;  5GAD I;  4HTI A;  1WKK A;  2MQ8 A;  2CVE A;  4IOB A;  2DTJ A;  2OEJ A;  4ED2 A;  4NL5 A;  3GLJ A;  4ID8 A;  2H3E B;  5F3T A;  1G6B A;  3NEK A;  1S9G A;  3HM9 A;  2PSZ A;  4F26 A;  3DRR A;  5IT9 Y;  3E51 A;  2APO A;  4YY3 F;  4BWM A;  2RDD A;  3GP9 A;  1VC0 A;  5KFY A;  6FDR A;  2V4R A;  1Q5Y A;  2RIL A;  4I7F B;  1KQG B;  1SI9 A;  3QJL A;  3PZP A;  4TQS A;  1K0T A;  1YJ9 S;  3H2L A;  3VZH A;  5F0U A;  1B64 A;  2CPF A;  3RBZ A;  3FQK A;  3RW6 A;  2FY8 A;  3H5Y A;  3GJS B;  4TNO A;  4L75 A;  2RS8 A;  1VQP S;  2DO4 A;  2VIC A;  3UN2 A;  1S57 A;  1T03 B;  2DB1 A;  4P2X A;  4OZ3 A;  3R2D J;  4HDG A;  2WON B;  3PDN A;  4F4W A;  3OFG A;  4ECX A;  3A3P B;  4DI6 A;  2GVZ A;  1C0T A;  2C2O B;  3IM8 A;  1MWY A;  3I31 A;  1N5Q A;  1NUE A;  4DLE A;  3MWB A;  2C3M A;  3HKZ D;  3R2C J;  4I67 A;  3N4W A;  5D4N A;  4ED1 A;  4JI1 F;  3FCH A;  2XMJ A;  5B0E A;  2Z2M A;  3IFE A;  2JWN A;  3M32 B;  5EWG A;  4WYL A;  3Q24 A;  3HO1 A;  1LFW A;  3SSS A;  4I0W A;  4DMZ A;  2C2R A;  3DRP B;  1F3F A;  1TZ0 A;  4WP8 A;  2ZNZ A;  3G96 A;  1GQE A;  2R2U A;  1EKR A;  3DLB A;  1RAH B;  5THW A;  5EGY A;  4WXO A;  4OMF G;  4MKY A;  4JP8 A;  2YNI B;  3OTC A;  1Q1K A;  1DZ5 A;  4EYH B;  3U02 A;  3ZTO A;  4F7V A;  3R5C A;  5C42 A;  4JV5 J;  2ZH4 A;  3ENA A;  4OI6 A;  2RUS A;  3N79 A;  5KT3 A;  1ZET A;  1H0H B;  3PW7 A;  2QLF B;  2CNO B;  1ZA2 B;  2BM0 A;  3DLL Q;  4Q2L A;  4M1K A;  1PAU B;  2HND B;  3R5B A;  1YVF A;  4C97 A;  2VFV A;  4IG3 B;  2I38 A;  1D1U A;  1VC5 A;  2M3D A;  2F4V F;  2HVD A;  2AKW B;  5AE2 A;  5AXM A;  3HFK A;  3GV7 B;  1Q8L A;  4QIF A;  2CJY B;  3HD2 A;  2D1C A;  1TMJ A;  3MUV P;  2RHS B;  4KSE B;  3T6B A;  4KIA A;  5E3Q A;  5D0H A;  3SCK E;  5FDL B;  2HMI A;  4GKK J;  2W9B A;  4FBT A;  2UXB J;  1TL5 A;  4CTA A;  2NUH A;  3LWM A;  4FVM A;  3KLG B;  3GB0 A;  1KFS A;  3NGU A;  4O0I A;  5H9F K;  1TVR A;  2ZBR A;  5LMN F;  4O0N A;  4DR3 J;  1M1G A;  4I1T A;  1F9E B;  2G4B A;  3DNC A;  4WP3 A;  3DI6 B;  1BQM B;  1VQS A;  1NSP A;  3MI7 X;  4TLQ A;  3V2U C;  2DH7 A;  1XMO J;  3RBX A;  3RRH A;  2DEJ A;  2I5J A;  3P45 B;  1MMN A;  4DV5 J;  3RB6 A;  4RNF A;  3SSQ A;  3HHL B;  2DGW A;  4H4K A;  4MMO A;  3FBC A;  3IRX A;  2YKO A;  4CLP A;  1H72 C;  3MR3 A;  4OJG A;  3DFE A;  3Q8R B;  4Y2K A;  1BQN A;  2AX0 A;  2C42 A;  1NO8 A;  3I0S A;  3EX7 B;  3Q0A A;  1A7G E;  2V4J B;  1AB8 A;  3CDB A;  4D3H A;  3CCZ A;  1BMQ B;  4JYA J;  5CYM B;  2VU5 A;  4OHW A;  8AT1 B;  5IM0 B;  2RDI A;  4TQR A;  3H7H B;  3JSB A;  1X9M A;  1RTJ A;  3BSO A;  2K3I A;  2XG8 A;  2ZUG A;  2JL9 A;  1MG7 A;  1VQ8 S;  2CQH A;  3FMW A;  3TZZ A;  2H51 B;  1RHQ B;  1SIZ A;  1WHY A;  1SUQ B;  2FLL A;  1ZM9 A;  1H6K X;  1YJR A;  1SJ4 P;  2NRE A;  1X5O A;  2NYH A;  4TU8 A;  3KNG A;  3ZZP A;  4DHV A;  2C2D A;  1UJ4 A;  1RWO B;  3US5 A;  5J1E B;  2VFS A;  4OYW A;  3Q83 A;  5C25 A;  3K17 A;  5JUM A;  4AQY J;  1TUG B;  1XC9 A;  4MIA A;  4KGK A;  1FE0 A;  1W25 A;  3TRG A;  3V6D B;  5K8N A;  2COL A;  1RU1 A;  2PD1 A;  3OBI A;  4WIQ A;  2DNH A;  3TQE A;  2E5H A;  3KG4 A;  3BYP A;  4N47 A;  4DPT A;  4M5K A;  4RW8 A;  1SH2 A;  3BS9 A;  1J2V A;  3T9Z A;  4YB5 A;  3FKB A;  1B0V A;  2QFJ A;  1ZBT A;  5ETM A;  4L76 A;  1G4C A;  3BQ1 A;  5LM7 E;  1HKA A;  1XER A;  4OJ3 A;  2AP6 A;  2XHW A;  1RDR A;  3PIP Q;  3PX0 A;  1B7F A;  4CRJ A;  2Q1L A;  5E7O B;  2GC8 A;  1HW8 A;  2B8P A;  4DSF A;  4NYO A;  2AQ4 A;  3LO3 A;  1RKI A;  2FC8 A;  4EO6 A;  2ROE A;  3Q8Q B;  3DXB A;  5HVF A;  1XR6 A;  2YX1 A;  4XO0 A;  4WFX A;  3JSM B;  2HVZ A;  5ETN A;  1WEZ A;  4AL6 A;  5C7P A;  2AEJ A;  3PJX A;  4ED0 A;  1JIH A;  3KLF A;  2UXC J;  3BEG B;  2WHO A;  1P6T A;  3CB4 A;  3Q23 A;  2J7K A;  2IAJ B;  4JI3 F;  1S79 A;  3MD3 A;  5CYJ A;  1WI6 A;  4GKJ F;  1HYS B;  1EAY C;  3I6P A;  4OX6 A;  3UR3 C;  4F4Z A;  4WYW A;  4WFB Q;  2EG2 A;  3ZZY A;  3VGT A;  2WVC A;  1U7L A;  3FRY A;  4KGX B;  3DMJ B;  2GJ2 A;  4A8K A;  2QMX A;  4JOU A;  2KRB A;  3NCP A;  4V19 X;  1CJU A;  2ERR A;  3ILO A;  1FE4 A;  3DLE B;  4JI5 J;  2RH3 A;  2LVW A;  1WHX A;  3ZZ0 A;  1IBM J;  5M2R A;  3IRW P;  1PO6 A;  4ZVU B;  1XMQ F;  2UUC F;  4YDD B;  4LRE A;  2GV1 A;  1EKS A;  3F73 A;  3OTE A;  3OL6 A;  1GX5 A;  1Q53 A;  3SQO P;  3UVJ A;  3T5K A;  2CAD A;  3Q86 A;  2NXN A;  2HGN A;  3N28 A;  4RW4 B;  3BDE A;  2GZO A;  1JLA B;  1OIA A;  1WC0 A;  2ZE2 B;  3NOC A;  1T94 A;  2Q66 A;  2VQF F;  3M1V B;  1EQ0 A;  3JXO A;  1XNQ F;  3ONQ A;  1RTD A;  4N76 A;  4K5S A;  3T1A A;  5B0C A;  2DJW A;  2R7T A;  3VAF A;  1JXE A;  2NSB A;  5IWA F;  2DBB A;  4FF3 A;  1C1B A;  1X5P A;  2DCL A;  1RBL A;  4ZN1 A;  2FZG B;  4NML A;  3WC2 A;  1CUL B;  4YR0 A;  4PPZ A;  4KV8 B;  2ZKU A;  1H38 A;  4LSN B;  1G2E A;  2OPR B;  3IG1 A;  4ELV A;  4ZPD A;  2DIT A;  4OYO A;  4CLL A;  2OPQ B;  2HQC A;  3WIU A;  3FBE A;  3OPK A;  3AQO A;  2MLX A;  4L6V 3;  1TK8 A;  2VJU A;  2D74 B;  2V63 A;  3KJN B;  1UVL A;  4IH5 A;  4C4W A;  5KFL A;  4LF9 J;  3B4D A;  4GMK A;  3H98 A;  4Q5V A;  5HLF B;  4XPC A;  1VQ7 S;  3IBF B;  5I42 A;  1JLF B;  2NQP A;  3QLH B;  4NXN J;  2XSF A;  1HI8 A;  1S1U B;  1WNE A;  2DY1 A;  3MMA B;  3EJM A;  2FJW A;  3KLV A;  4A8S A;  3BKF A;  2N4C A;  3SCI E;  3VF0 B;  4N5S A;  5KT6 A;  3GCX P;  4L72 B;  2F7V A;  4M5G A;  3TAM A;  5T41 A;  1EQM A;  9ATC B;  1N6Q A;  4ED4 A;  2MZJ A;  4A8M P;  3Q89 A;  3QJP A;  2I9S A;  3C6T A;  3TWZ A;  4OZ5 A;  5L9N A;  4FPR A;  1I94 F;  3QIP A;  1KR4 A;  2YNF B;  3LP0 A;  4I2P A;  5I3P A;  1KVJ A;  5CZV A;  1MW7 A;  3KLH A;  1SQE A;  3HZG A;  1DRZ A;  3LPY A;  4MFB A;  1QY7 A;  2WVB A;  1RWP B;  4LFC F;  4WFZ A;  1JLQ B;  2XY7 A;  3KK3 B;  5B0D A;  1FER A;  3CJQ A;  2VC0 A;  5AXN A;  1T95 A;  3AOB A;  4P2S A;  2JEJ A;  4P7V A;  2EBG A;  2POK A;  2OSR A;  2VD3 A;  2VAS A;  5F8N A;  2HGM A;  5KT2 A;  4CYU B;  1SJR A;  1TK5 A;  5AE1 A;  1U8W A;  1FNX H;  3QGP A;  3HT0 A;  1VS3 A;  2HS3 A;  3PVX A;  4JI7 F;  2J9D A;  4USJ C;  3BZQ A;  1RHR B;  2OI2 A;  5D4O A;  2RE1 A;  4RBU A;  2DNQ A;  4Y2I A;  3DRS A;  3QO9 B;  3P4U B;  3HLU A;  4NRT A;  4F3Q A;  3CME S;  1YWX A;  3A12 A;  3ZXW A;  5AT1 B;  3W9H A;  2DCU B;  2J0X A;  3A8I A;  3UD4 P;  1RKJ A;  3T5H A;  1U1L A;  5I4M A;  1BQX A;  1RT1 A;  4P10 A;  1L5U A;  2B0G A;  3KFW X;  1SBR A;  3H25 A;  4BDP A;  1SJF A;  1V3R A;  2X1A A;  2XS7 A;  4DUZ F;  4DL7 A;  4F04 B;  4KO0 B;  4PG5 A;  3C14 A;  2D9O A;  5L1K A;  2PGC A;  3HPO A;  2ASY A;  2BE9 B;  3H8Y A;  4FYY B;  3MED A;  3TA0 A;  1IJE B;  2IIH A;  2FHO B;  2HRU A;  3LAK A;  3TAN A;  1NZA A;  3PR4 A;  3MM5 B;  2QLW A;  4UQG A;  5JVH Q;  3EDQ B;  3FQL A;  4HT7 A;  4ZN3 A;  3K57 A;  3P6Y C;  3N5F A;  2VIH A;  3FVY A;  1QSY A;  2CNN B;  4QWA A;  1HWU A;  4C8Z A;  4LVN P;  1DQ8 A;  1UWB B;  5GME A;  3SEO A;  2DXF A;  3KYL A;  4H54 A;  4KYZ A;  4Q7A A;  4DV1 J;  3H90 A;  2V69 A;  3EPG A;  1TL1 B;  3JQM A;  2HZC A;  3DOL B;  1ZM3 A;  3TVZ A;  3V4I B;  2DNO A;  4QWB A;  1VQ5 S;  4Z7Y A;  2YKP A;  4PXB A;  1XK8 A;  3CMA S;  4NLW A;  3FZ2 A;  2QMW A;  4OHV A;  1S6O A;  2NXJ A;  4DX7 A;  3PX4 A;  3R1L A;  3OVA A;  5KFD A;  4MKA A;  4DSL A; 
#chains in the Genus database with same CATH homology
 1XQI A;  4S0M A;  2HVE A;  3ETM A;  3NGR A;  3ZTP A;  3DKD A;  2DXD A;  3ELH A;  1EHW A;  4UOF A;  3JS9 A;  1LEO A;  1NPK A;  3Q83 A;  1VYA A;  3FCW A;  3Q8V A;  1NUE A;  3BBF A;  3FBC A;  2B8Q A;  4CP5 A;  1WKJ A;  2BX6 A;  3EM1 A;  4ANE A;  1NDP A;  2HVD A;  4FKX A;  5C7P A;  3FBF A;  1NDC A;  3Q86 A;  3DDI A;  5CAB A;  3BBC A;  2BEF A;  2DXE A;  1NDK A;  4ENO A;  1JXV A;  1NSK L;  5CAA A;  3EVO A;  1KDN A;  3MPD A;  4WBF A;  1U8W A;  3PJ9 A;  1NLK L;  3VGU A;  4F4A A;  3GP9 A;  3EJM A;  4AND A;  1MN7 A;  3EIC A;  3GPA A;  1WKL A;  3VGV A;  4ANC A;  4EK2 A;  4UOG A;  3Q8Y A;  5BXI A;  1MN9 A;  2AZ1 A;  3BBB A;  2DXF A;  3EMT A;  1UCN A;  2VU5 A;  3Q8U A;  3WX8 A;  1HHQ A;  3VGS A;  1ZS6 A;  2ZUA A;  3BH7 B;  1F3F A;  3VVT A;  4C6A A;  1NSQ A;  1PKU A;  1HIY A;  1K44 A;  3G2X A;  3ZTS A;  1F6T A;  3FKB A;  3NGU A;  3VGT A;  1NHK L;  3FBB A;  1LWX A;  2HUR A;  4HR2 A;  3Q89 A;  1NCL A;  2AZ3 A;  3EVM A;  4W98 A;  4KPC A;  3NGT A;  5IOL A;  4O0N A;  3B6B A;  3FC9 A;  3EE3 A;  3ZTR A;  1NB2 A;  1PAE X;  2CWK A;  3FCV A;  1S59 A;  3EVW A;  3BH6 B;  1B4S A;  2NCK L;  4DZ6 A;  1S57 A;  1BHN A;  2B8P A;  4F36 A;  3ZTO A;  1BE4 A;  1HLW A;  1NSP A;  3NGS A;  3ENA A;  2DY9 A;  3L7U A;  3PRV A;  1BUX A;  3VVU A;  1B99 A;  4FKY A;  3R9L A;  1WKK A;  1S5Z A;  1XIQ A;  3FBE A;  4DUT A;  3B54 A;  1NDL A;  4UOH A;  4DI6 A;  1W7W A;  3ZTQ A;  2DYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...