3L7UA

Crystal structure of human nm23-h1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Structure of Human NM23-H1 from a Hexagonal Crystal
doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase A
total genus 47
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3l7uA00
3EICA 4FKYA 1NLKL 3FKBA 5CAAA 2AZ3A 1HIYA 1WKKA 4DZ6A 4ANCA 2CWKA 2DXDA 5BXIA 1EHWA 4W98A 3VGSA 3VGVA 3BBBA 3BBFA 3MPDA 3EM1A 3FCWA 3BBCA 3PRVA 3Q86A 4S0MA 1NDKA 1WKJA 1NCLA 3L7UA 1ZS6A 1VYAA 2DYAA 4ANEA 2AZ1A 1NDCA 3Q89A 3ENAA 3Q83A 3BH7B 3FBEA 2BEFA 3ZTSA 1NDLA 1NSPA 2B8PA 3R9LA 3ZTOA 4O0NA 2BX6A 1HLWA 1S5ZA 4C6AA 1WKLA 4UOGA 3EVWA 1BE4A 3G2XA 2DXFA 3EVMA 4CP5A 4F36A 1NPKA 3EVOA 3VVTA 3VVUA 3VGUA 1NDPA 3ELHA 3ZTQA 4ANDA 3NGSA 4UOFA 4HR2A 5C7PA 2HVEA 3WX8A 4WBFA 3B6BA 1S59A 1F3FA 1W7WA 1KDNA 2NCKL 1NSQA 2HURA 2HVDA 2DXEA 1HHQA 3NGTA 3FBCA 4UOHA 1F6TA 3DKDA 3BH6B 1LWXA 1MN9A 3B54A 3GPAA 4FKXA 3ZTRA 3EJMA 1JXVA 1UCNA 1NHKL 1B4SA 3VGTA 4DUTA 4EK2A 3NGUA 1MN7A 1NUEA 4KPCA 3Q8UA 3NGRA 3Q8YA 4ENOA 1B99A 3PJ9A 2ZUAA 1NSKL 3ETMA 1S57A 3FBFA 1BHNA 3EMTA 2B8QA 2VU5A 1LEOA 3FC9A 3ZTPA 1K44A 3GP9A 3FBBA 1XQIA 2DY9A 1PAEX 1BUXA 4F4AA 1U8WA 3DDIA 1XIQA 3FCVA 5CABA 3EE3A 3Q8VA 3JS9A 1NB2A 4DI6A 5IOLA 1PKUA
chains in the Genus database with same CATH superfamily
3E01A 5DDRC 1UA1A 1SKSA 1N34F 2B51A 3FEYB 2XLIA 1IKWA 2LXUA 4DFMA 4YDXA 1CPZA 2OPRB 3IRXB 3M2VB 5F8LA 3HHNB 2CFXA 3AOAA 1FX4A 1Q7LB 5GMDA 2ZHBA 1R8AA 4ZVEA 2XZDB 1M90T 1K73T 2G2ZA 4ICLA 1VISA 2DNNA 5JJBA 2AGQA 2FY1A 2PMWA 3LP2B 2F4VF 1GEHA 4LQ9A 1W2BR 1X4CA 1REGX 4KH1B 1WOPA 2QSWA 3POTB 3UWTA 2V8PA 3J81j 1UVKA 1S0OA 5FLXU 4NLGA 1G2EA 5KT4A 2G1HA 4G1PA 4JP8A 3SCLE 2MEWA 5CZXA 4LRDA 4IYQA 3GCXP 4S0MA 4F4KA 2P9EA 1QTNB 1N33J 3PVXA 3LOUA 2GIQA 1Y7PA 2VUGA 2HIQA 2I38A 3QT6A 1U09A 4H4OA 3WC0A 4ZHRB 1QAIA 1C4CA 1NO8A 3BH7B 1GX5A 1QDUB 3HT3A 2LEAA 2VODA 1LWCB 3GG0A 4FS1A 3ZTOA 5L39A 2R7RA 4IG0A 2E5LF 2FZKB 2MZSA 2JX2A 1MROB 4DCJB 5HROB 4DCPB 5KG7A 5D4PA 1B0PA 2AJ4A 3SDEA 2HAIA 2QMXA 3CJQA 4C8KA 2H3EB 1P9YA 3BKFA 3KLGA 2ZJRQ 3QMQA 4Q2LA 2VC0A 5BR8F 3K17A 4CP5A 1TAQA 4F36A 4ED0A 4KHMA 4OYIA 4PXEA 2ILZA 3QFHA 2BRLA 2B7BB 2PN6A 2EFGA 4Y2MA 3MM5B 5EWFA 2QLBB 2BJ8A 4J91A 1HBOB 2KT2A 1NRKA 3ZTQA 2ZBCA 4ZLPA 5LOQA 4UOFA 2FLOA 4Q44A 3OTDA 2AX0A 2MHEA 4WBFA 1H2TZ 2DBBA 1XR6A 4DX7A 4K50A 3FCHA 1AUSL 1FI4A 1SV5A 3VQTA 5GMKa 4AL7A 2MZ1A 3H5UA 4OZJA 2J6SA 2WVCA 2K1RA 4NLSA 4I2QB 3OW2R 4DL2A 3H42A 2MKJA 2DPIA 2F5GA 2KI2A 4LSLB 1O51A 2GQQA 5GMEA 1RT2A 2AHOB 2QLFB 1AB8A 1Y3KA 4NOHA 3DM2B 5F3TA 4IQMA 2E1PA 3DKDA 3F44A 3TZWA 3MR6A 2QMWA 2GQCA 2JVRA 1FTRA 3WIUA 1JLCB 2IVMA 2YVSA 4P2SA 1U1PA 1UMJA 3EGZA 1RLDA 2BOPA 1IQTA 4Y6IA 3HM9A 3K8VA 1ACMB 1URNA 1BQNA 3KTQA 1EB0A 3K5PA 5KFUA 1EETB 3VR1A 4CIOA 3GV7B 1QSYA 1N5YB 1UWBB 4ECVA 1QSSA 2FQQB 5HROA 4ED7A 2HNYB 3M32A 1HYSA 4PG7A 4DV6J 4LFAJ 2P9CA 1U48A 3DMJB 2ZBQA 3HLUA 4PR6A 3U1LA 4JI7F 2W7PA 4X4VA 1LWFA 2KDOA 3CC2S 1J5OA 2UXCF 1LEOA 3ZTPA 2YH1A 1T05B 1LQ9A 1VFJA 2HGLA 3O2IA 3A8EA 4M1KA 2W8LA 4Q0BA 3DI6B 2QMUB 1UWAA 1FD2A 2W24A 3N01A 4JOUA 3H0PA 2J7KA 2ZBPA 1RAOA 4ZPWR 3R3TA 4Y00A 4CWBA 2W4PA 3PX4A 2AWZA 2F8MA 4QWDA 1SUQA 5CXTA 3Q2TC 1JNRB 3CWJA 1RLCL 2F9JA 1RWXB 2LDYA 2ROEA 3SSSA 5LL6d 4K7QA 4C3LA 4I68A 1HWJA 3GLJA 5CCMA 2DNHA 2D41A 5KG6A 5DDPC 1VQPS 1YITS 1FNOA 3FSIA 3CCJS 4O3SA 2HIYA 4ES1A 5KFQA 2N3OA 2WW8A 3M8WA 1RT3A 3PYFA 3R7BB 4FP9A 2DK2A 4I64A 4P72A 1S9FA 4F2SA 1Q8LA 2VG7A 3T1YF 3IRXA 3MR5A 3C19A 2CZ4A 4CO2A 4UOCA 3HT0A 3R1HA 2VONA 3DU6A 4NXMJ 4OX9J 2IM3A 3AB2B 1Y10A 3DDKA 3QAEA 3QGGA 3DOMA 2PMHA 4W98A 2FPHX 1DQ8A 4ETZA 5FLXY 2R7SA 3GE9A 4J9VA 2ZVIA 1RT5A 2RRAA 2UUCJ 2BJ7A 3E2EA 2RNEA 4OI0A 4RUBA 3ZXWA 4BWMA 1EX8A 1U8SA 1TKXA 4WIQA 4DJBA 4WFBQ 3FZBA 5AJ3F 3PZPA 2DRBA 1PO6A 2E9TA 4P9SA 2HQDA 2HFSA 5KFRA 3OR2A 3KHRA 2AJQA 1H74A 2O3DA 1YTYA 1PG5B 4LF6F 2LA4A 3FBEA 3CO0P 5K5MA 1VDHA 5D0EA 1FHTA 3DLLQ 4NZ0A 3MEDA 4M5GA 5J2NA 4OZ3A 5JUMA 3RAXA 4FF4A 4ZPTR 4DU7A 4KQZA 4KR0B 2QLXA 1LFPA 3NMRA 1TFWA 3MEDB 5C25B 2KT3A 4YY3J 5E3QA 4EEYA 1H38A 2WBRA 1NJWA 1D8ZA 2MQOA 1RA7A 5KG2A 4BS2A 4EO8A 4C11B 2QO3A 1BE4A 3G2XA 4TN2A 4YOEA 1WG5A 1FJGF 2QA1A 4FVMA 1FVQA 1OS5A 3NCQA 5HMWA 2KXNB 2JH3A 2WVBA 4KO0A 1VQ5S 3MDFA 2L9NA 1VK3A 2AYBA 1WC1A 2IAJA 3BF4A 5H9EJ 1RT4A 2XB2D 2EBEA 2GZOA 2WSFC 1QUPA 3W5YA 5AE3A 4ZVSB 3SCIE 4R0EA 3WX8A 1VBZA 2MZTA 3GFHA 4A8SA 1IM6A 1SIWB 3V4IA 1S9EA 1NSQA 4PWWA 2HURA 2MSTA 5IV4A 2VICA 4ECZA 1VI7A 2GJFA 3KXDA 3LUYA 5B0FA 3DOMB 4TQSA 2CQIA 5M2PA 1VRTA 2E29A 3FBCA 1JLQB 3TAQA 1WORA 3TQEA 3J7ZT 3FSXA 5B0BA 2FVRA 4IUFA 2HKEA 4JV5J 3M2RB 2YWHA 3BQ0A 5DDOC 3LP0A 4G6VB 2PI4A 2KTQA 1KTVA 3MZIA 1T02A 5L1LA 4XIUA 4CQ1A 2IC3B 1RISA 1V3SA 3QO9B 1Y5LB 2Z2ZA 1NNDA 1S7IA 2D7SA 2IMOA 4CDIA 2NXCA 3AXKA 3OHBA 1S0NA 3HO1A 1JXLA 2UXBJ 2I6WA 4YMEA 3GYNA 3MM6A 2QT7A 4M95A 3IR6B 3EMTA 3TEGA 1WHVA 3UN5A 2CPHA 1S76D 2SXLA 1FRMA 1WSRA 5FIIA 5BR8J 1BQXA 3LF0A 4L73A 1WJ9A 2OH2A 3SIPB 1SJFA 1JLGA 2GFFA 3S1TA 2V67A 3OXLA 4AQYF 2B9EA 2NXEA 1BUXA 2X51A 3DMJA 1SIZA 2JOQA 5HANA 2ZE2A 1VBYA 1NMEB 2B5JA 2OSRA 2FVPA 4CLUA 3AXMA 6FD1A 5LSLA 3R6GB 2YTCA 3KUHA 1D09B 2P6TA 3OL7A 1UWBA 4DV5F 3BV8A 2CZVC 2YNHA 4M5NA 3VQSA 4WFAQ 4ZPVR 1KVJA 3D4JA 5D0HA 3MI7X 3EICA 4J90A 3H4DA 1PSDA 3GWCA 1NLKL 1A0OB 2APOA 3QPIA 1O0PA 2CADA 3SV4A 3TEHB 1FT8A 3FEXB 3Q2SC 1QE1A 5CQGA 2G0IA 2UUAF 2RMLA 3DXBA 5KG4A 3QSIA 1WC3A 2C2EA 3G82B 4K4YA 2JEGA 2DIUA 2UZAA 3I4HX 2HLTA 3MMAB 4ZCKA 1UVLA 1SH0A 2DXDA 2J9DA 5B0GA 4I67A 2BANB 4X64F 2DGVA 1KKHA 4LFBJ 3G82A 3D1QA 2KL8A 5I42B 3L7OA 4RBVA 3H5YA 2CQ0A 4MIBA 2CPDA 3BBCA 3GZ7A 3IN5A 3B4DA 1NJXA 1RTHB 1VYAA 1BQMA 2DYAA 2RUGA 4PXCA 5CA5A 4UY8T 3T1YJ 2MJUA 3ENVA 1T05A 4DX6A 4IRCA 1J5EJ 3EGNA 2HQGA 2MQLA 3ENAA 4LJMA 4P74A 2UU9J 1S99A 4B3TF 1B0TA 1HNIA 4NLWA 1NPRA 3M8YA 2H1YA 2V63A 4O4GA 2MGZA 1VQMS 4J9QA 1SQFA 4N8NA 3VV2B 4QPXA 1S4EA 2QRRA 5K20B 3BDPA 3CCZA 3NNAA 4I1TA 2V4JB 3M30B 1U6ZA 2V9KA 4WCEQ 3D2WA 4TYAA 5AXLA 2P5VA 3BKUA 5IXUA 3HULA 4JI7J 3BQ2A 1N6QA 4HI1A 2GMLA 1N88A 1VQ6S 2BW2A 3OTOF 2XGQA 3DGVA 1DHMA 1NHUA 3MEEA 4HH1A 4PCQA 5K14A 2JFKA 3T9NA 5JMNA 1YJTA 3CO9A 5IT9U 1KHWA 3DLKA 4OLPA 3VGUA 1FXRA 3UCUP 2RU3A 1JJ4A 4ANDA 2J7WA 1IR0A 1CJKB 4K0KJ 4PAAA 2H54B 2JWNA 3R97A 2E1AA 2YWFA 4Y65A 3H98A 3B6BA 2M7SA 4ID5B 4ZN1A 4LF9F 2LKZA 1FDNA 2AGPA 1VIXA 4AXIA 4E0DA 1R6YA 1K1QA 2QE5A 3HHLA 3OR1A 1DRZA 3RB6A 3JB9k 4UOHA 1TL4A 4LIRA 1OY9A 2LEBA 1F6TA 4D3GA 1UFKA 5CD4H 2XMMA 3HHKA 1YQHA 3V4MA 2HYIB 3OTEA 2HHHF 1L3UA 2VC1A 2G2YA 3K58A 1UCNA 2DGQA 3I9V9 1CJUA 1FO1A 3BDEA 1JXEA 3KUGA 2ZVSA 3IAS9 4ILRA 4UF4A 1MU2B 1S1XB 1VQOS 4HT7A 1C0UB 2YKOA 4LUBA 2OLWA 4K8RA 4ZVUB 3MMBB 2ZM6J 2HWHA 3MM7B 4RNNA 1CULA 1HNVA 1RT1A 3V81B 3J81Y 3SZ2A 3US5A 1HHSA 1XMBA 2K3KA 3FRZA 3EXYA 5LSRA 4MMOA 2W8KA 1HI1A 3W8PA 4B9SA 1JLFB 1RADB 2DGSA 1N5QA 2ZFHA 3GP9A 3ICLA 4MAKA 4B3MJ 1DLOB 1WTFA 1KBRA 2YH0A 4KKOB 2WSCC 3IG1B 4PG8A 3C14A 3PHEA 5KFCA 2BQRA 4LF4J 4ECSA 4RZRA 3PKYA 2MKIA 4PYAA 4FZVA 2POKA 2WVDA 4C48A 1FRXA 5LMNF 4A8KA 3KJVA 3OUYA 4DSEA 4K4SA 3SCJE 2YNGA 1ZAVA 2DH9A 4TY8A 1VC5A 2IVYA 2DNPA 4DI6A 3MAAB 4TU8A 3E51A 3H7HB 4KAIA 1HI8A 2Q6BA 1CS4A 2GA7A 2XSJA 3EDQB 5HJXA 1U1KA 3PO5A 1CJTA 3CJKB 1S1VB 1RI7A 3DLGB 4K5SA 4ECRA 2A18A 4KPYA 1S48A 3QLHB 3SQGB 2CNOB 4HHUA 1N5VA 1FKPB 1NPPA 2AZ3A 3Q22A 2IBKA 1PIEA 1WHYA 3SCKE 2ZZMA 3HP6A 5B09A 3VAGA 1U1MA 2K7JA 4CLTA 1IR2A 3SMZA 2WBMA 4ZCMA 4EFAC 3DRPB 2I0XA 4NYPA 3U02A 3VGVA 3GIKA 4DQRA 1QUVA 3MPDA 2O1PA 3FRYA 1OY6A 2JRSA 3CMQA 3PNIA 4QU7A 4OYMA 1YK9A 2E9ZA 2Y1LB 1N32J 2CQGA 3ZZ0A 4C2MA 3Q86A 2RB7A 3WX4A 3BGLA 1S0VA 1YI2S 2DITA 1WDTA 4Q45A 2CKWA 2RU9A 3TQ1A 4KYZA 4CM2A 3I0RB 5CZVA 2MY7A 2L9WA 1AROP 2D1CA 2W2NP 3GTYX 2W2QP 1R31A 1FDAA 5IT9Y 1HW9A 2VKZG 1NK6A 2ZZTA 5DM6Q 4B3OB 1LNQA 2FGOA 3CJ0A 3ET6A 1S97A 1SKRA 2HHSA 1MW7A 2MLZA 3R8YA 2ADCA 2HEKA 1NSPA 1FX2A 1UEVA 1OY8A 1YDLA 2HRTA 2UV8G 4H4KC 1WEYA 5F0WA 3W9HA 4NRTA 4EI2A 3G96A 1LW0B 3LP1B 2PIIA 2R8IA 1RABB 5MLCV 3EZ5A 4DV0F 4C4WA 3T6BA 5H9FK 3KG4A 4DPOA 5AE2A 3PACA 2Q79A 1AFJA 1YG0A 3ONQA 3OVSA 3K5NA 3PTWA 1RBAA 3UI3A 3B82A 4LF1A 4RW4A 2DR8A 3IRWP 2L08A 3G6YA 2LA6A 3CJ2A 2XYGB 1SQGA 4LT6A 2DNYA 1HBUB 1X4BA 2XMJA 5J2PB 1KOHA 3D5MA 3UE2A 1ZPWX 3QBCA 4QJVA 3KHGA 3RB3A 1VC6A 1IUJA 1VCTA 5GAEI 1S1XA 5L1JA 2LVWA 5C7PA 4N76A 3E3XA 1GXTA 1ZYQA 3DLEB 1TL5A 2F4FA 3AD8C 3R5GA 3M8RA 4JI0F 3QJJA 1F3FA 1K47A 3OL9A 1PILA 2YX1A 2HNZB 3HJVA 5DQIA 2FC8A 3G8QA 2HMIB 3TJ8A 2XSFA 2R8KA 4O3RA 3GMGA 5IWAF 4UW2A 2RSQA 4URQU 2WRMA 5C42B 2AD9A 4AFFA 4TLRA 4B9VA 4FKXA 1TK0A 2VG7B 1Z1ZA 2X3GA 3A13A 4NXNF 3EJMA 1PAUB 4I6WA 4DV0J 2FZGB 5B0AA 1XNRJ 3J7AN 1X5PA 2CQHA 4DUZJ 2R7TA 2DT9A 1Z2LA 1P8GA 1TP7A 2VFRA 4KV8A 4PWDA 3K2YA 4RNMA 3WIVA 1U6FA 3LWMA 5T7LA 2EG2A 4FF3A 3UFCX 5EX0A 1DAXA 1ZAXA 2CQ2A 2HHPA 2LXFA 4OX6A 5E3AA 3RRKA 1XNRF 2MXYA 1G4CA 1XK8A 5A2QY 4EBCA 3LPYA 2PFFB 1F9EB 1RE1B 4B9LA 4OYAA 2KZZA 1G6BA 2ZH7A 2NZ4A 1P9QC 1DURA 2HRYA 2NUUG 3DC2A 1FK9B 4F4XA 3DLJA 1NJIT 3MR3A 2VDIA 4BLGA 1TL3B 2HSEB 4NLVA 3RTVA 2Q3PA 2VPYB 2EC0A 1R8PA 3BN7A 3KYLA 4LF9J 4W92B 2BQUA 2Z0GA 4QYZJ 1WC5A 2QL9B 5KG0A 3N28A 1QAJA 1VRUB 3DOLA 4N5SA 1G1XA 4O3PA 1TKTA 1DTTB 3GJSB 3M6UA 1CJUB 1KVKA 2N3LA 3N0VA 1SVDA 3CJRA 4RX6A 4AL6A 3T5KA 3CXCR 1XMQJ 4PWUA 3NKYA 3W2VB 2K3IA 4C97A 1RT6A 2E7WA 1HIYA 3NY0A 4DV1J 4DV3J 4ED6A 4B9NA 4P2MA 2RH3A 3ENQA 4NLDA 4OZNA 2CWKA 4OV6A 1Q78A 4ZVQB 1U0SA 2IRYA 4QPTA 4NLRA 3TP2A 1OSCA 3I55S 1T94A 2C42A 4KV8B 2QLWA 4IFVB 3ZO7A 3DRSB 2FD2A 3AD9C 1BD6A 1U4BA 2YKMB 4DSJA 5SUHA 3H2LA 1FJEB 3FCWA 1UZDA 1U24A 2PGCA 2B9WA 4PEOA 2FDNA 2IFXA 2KJVA 4P71A 1Q1KA 1M1GA 2FHJA 4BCAA 5I42A 2KFNA 1PBUA 3OL8A 1VC0A 3PR4A 2BE2A 2C2MB 3CJSA 3CJ3A 3H2VE 3SSRA 3ZZUA 1X4DA 3Q89A 4XO0A 4X4PA 1TKZA 1IKYA 3SEOA 2P6SA 5CHCB 1X4AA 4XPCA 1WHXA 1PYSB 4KGZB 2CNNB 4CCHA 3BGOP 3A1YG 4X62J 2B8PA 4D3HA 3W9JA 2W9CB 3MECB 5DG9A 1LWEB 2KYXA 4J9OA 1S1VA 2UUCF 3KLEA 2QC3A 4FF1A 2COLA 4NX9A 1PJ7A 3HHEA 1U1NA 1TK5A 3CMAS 3A8KA 4KY3A 1H7WA 1XNQJ 3MM8A 4UTGA 2Q66A 1IN0A 3BN4A 3UN3A 4A8XA 5GAEU 1Q82T 3UPFA 4PYDA 3QT7A 2QGFB 3OJUA 3KJVB 1C1BB 1I3OB 3EVOA 4IOAQ 1RWMB 1S6UA 3N5BA 3UO0A 1UPMB 2BZ2A 3OXFA 2GVDA 2GMJA 4ZHRA 3QT5A 3UCZP 3EUNA 1HFEL 1GTEA 1TL1B 2EFPA 4M5HA 4NXMF 3TUJC 3UR3C 3H25A 3B8HA 4JI6J 1ROFA 1T9WA 4U96A 3TRGA 5F3ZA 4F50A 2EKNA 2CQPA 2KVIA 2OPRA 2XGPA 1RTJB 3BS9A 1N5TA 4LR9A 4CLPA 3FMBA 1NH7A 1KEKA 1Y3JA 1N5SA 4DN9A 1NXIA 1HHQA 3D9BA 3U27A 1R8HA 5DG7A 2FJXA 2ABYA 4P73A 2VJVA 4YB6A 1Z4UA 3OHAA 1ZETA 4MTPA 2HBRB 2HMIA 2WHOA 4QOTA 1KOOA 3M9NB 1FRHA 2OPPB 3OFHA 4ZCLA 3LGMA 5GADI 1K1SA 1UVMA 2XBPA 1RHJB 3P5BP 2N7CA 2RDDA 2B0GA 3A12A 5DM7Q 1HBMA 2OMOA 1RT5B 4LF8F 3V6HA 4IOBA 3S7RA 3DFEA 4GC6A 1HD0A 1AYEA 4DSLA 1JLEA 3QATA 2WOMA 3M8PB 1CEZA 3DLBA 1U2FA 4X66J 3V6JA 2HGMA 2VOPA 1JJ2R 1H6KX 2BJ3A 4LF8J 1F0XA 4C11A 4QIVA 4OIXA 2WONB 3R7NB 3FC9A 3G4SS 3C6TA 4JV5F 2CJQA 1RQ0A 3KNAA 5DETA 3KKFA 3JSBA 1TUWA 4NXNJ 2DY9A 1RHUB 1X60A 3DDNA 3HVTB 2KJWA 3NNCA 1OQ3A 3C16B 3CJ8A 3M6VA 3GJRB 4HACB 1F5BA 2Q1LA 3O6QA 1IR1A 3IO1A 3QNWB 4F4AA 2QA2A 2F4VJ 2GVZB 4WK1A 3ZZTA 4F3QA 1ZTTA 3MCNA 1TV6B 4KBIA 5B7WA 1FDDA 4P2XA 3TZZA 2EBGA 4M5DB 5G0RA 2X1AA 1IM4A 5FJ4A 5J2NB 3D1HA 3L9ZA 3GIRA 4FKYA 4GVBB 5B0EA 1KHVA 2CQCA 3MFHA 2VG6B 5A6PA 1GNKA 4B08A 1S79A 2DR6A 5KT6A 4EZ9A 2HS3A 4RUHA 2M8DB 3IGVA 5DG8A 3OJSA 4YY3F 1JKHA 1KWMA 1MG7A 3HF5A 3IAM9 2OFGX 4KT0C 1WF1A 3CDWA 1RACB 3MPUB 3CDUA 2VZ9A 3U1MA 2BKNA 1Y5IB 4B17A 4GRSA 3EM1A 4NRUA 4FYYB 1RTHA 3IM8A 4FNIA 1HQUA 4F0KA 5KFXA 4DN0A 3JYTA 4AL5A 4AUKA 2LQ8A 3VZHA 3QGPA 4F0MA 3JTPA 4KJIA 3W1YC 1H2UX 2PC6A 2YXLA 2FTRA 3KK1A 5HVGA 2W9BB 4DBQA 2GQ2A 2XSJB 1SPBP 2MMYA 4DS4A 2XCAA 3OSPA 4J9MA 3NRBA 1HR0F 4HDHA 2W7AA 4JI0J 4JV2A 3SSQA 4GKJF 3VAKA 3ZNUA 1FKOA 5CYQB 4LSNB 4V19X 3FNNA 4ZJQA 5L1IA 4OZ2A 3I5AA 2XMWA 3VAMA 4F67A 5J1PA 3ADAC 3L3CA 5H9EK 4J5OA 4QIGA 2PMZD 2V2VA 4QWAA 2BX6A 1WF0A 2Q43A 4ILMA 3DRSA 4RBUA 2MZRA 1AFIA 4NA3A 2ZKUA 2JLGA 4CLLA 4Q0BB 4E2FB 4MK9A 3R6LB 3MEEB 1ZBTA 2W01A 3M8QB 3PYEA 2XY6A 5FDLA 3LWLA 3MOJB 3CDBA 4OYPA 1DTQA 1ZAWA 3ILOA 1R6VA 2G1DA 2HLUA 2RRNA 3D1OA 3D7SB 3DI6A 3P45B 4LRFA 2CQBA 4O4RA 5KFEA 3UD3P 2V8DA 3EXCX 3MD3A 2A3JA 3DOLB 2BW7A 3BYRA 1N36F 3D6FB 4DUYJ 5DLGA 1S72S 2NPIA 3CE8A 1S59A 2CWXA 1HQ2A 1OQ6A 1RAGB 3N5FA 4IO9Q 1W7WA 4ECYA 2QA4G 2HZCA 2QL5B 4ZP7A 3V2UC 3M9OB 3A8IA 5IQQA 2VOOA 4JI3J 2IRXA 4YB5A 2PA3A 3D6HB 3MF5A 4I2QA 3IBWA 3M4XA 4G3IA 1VJWA 1A7GE 3O8WA 3K5MA 3GB0A 2BMBA 3CSKA 4ZVRB 1MSWD 2FHMA 5J1NA 3J7YI 2UVUA 2XZWA 2VFSA 3M8ZA 2EEYA 3MPWA 2BM0A 4PXBA 4ZP6A 5D78A 1GQEA 4J7CA 5THWA 3V5RA 2JEIA 2DTJA 2BE2B 2F8HA 2RQ4A 4OYXA 5ETLA 3RW7A 1UFWA 5IM0B 4DDFA 2EK6A 3OD2A 2J76E 4ZVTB 2W9BA 4ERDA 2ZDOA 1S9EB 1UEKA 2EKYA 3KHHA 4IO1A 2YKMA 1RKIA 2E1RA 1M5SA 3M2VA 3M9MB 2O66A 4CLZA 4CTAB 4ECWA 1F1BB 2DHGA 1FWKA 2OUGA 4AD6A 4P7VA 1GFWB 3J7Z5 1JKHB 3ITHB 2K2PA 2MGZB 2OP5A 2XHWA 1RP5A 2B5JB 3JQMA 4USIA 1Q5VA 2QFJA 5I4MA 2AT1B 4H4MA 1LK7A 1LWCA 2QTWA 2RDJA 3DDIA 1VQ7S 2PE8A 3D3CJ 1RTDB 3W7BA 1HWIA 1QAXA 1HWUA 3HXMA 1EJ7L 1T9TA 4MKVA 4PZVA 1XBWA 2ZH5A 2E5IA 4FBUA 3H90A 4K4TA 2M4MA 3KUEA 3MECA 4IH7A 2KFYA 3MUTP 1FFSB 4TNOA 1DTQB 1JMTA 3KJNB 5DO2A 3AOCA 1JIHA 3LTOA 1HW8A 1RHMB 3W61A 4DSKA 4DL0C 4DZ6A 1L5UA 3CC7S 3H8YA 3BO2A 2H5IB 3NOGA 1MLAA 3RB4A 3VF0B 5HJYA 1K9MT 2LCWA 2BM1A 4JI8J 1SCJB 1I1GA 2IRUA 3AY0A 1U1RA 2O67A 3HD1A 4JB8B 3EDRB 1QE1B 1NBEB 3BGFA 4WYLA 4WZMA 3NS7B 1NK8A 1IBKF 2AV5A 4LF5J 4FDFA 4NCBA 1T3OA 1BMQB 2Y8WA 4CLSA 1JLQA 5K8PA 4LQ3A 3JSYA 4LF2A 4M63A 4NLPA 4PWDB 2V9WA 4WTOB 3BYPA 2R2UA 1WOOA 4U7UD 2ZDPA 5C5JA 1VQ4S 3NP5A 1T3NA 1M5VC 2GHWA 3HFKA 2C2NA 2YNIB 4GO5X 3T5JA 1ZM2A 1JLGB 1NJYA 4CLFA 4MJKA 5LMNJ 2MZJA 1N0UA 4NYOA 1HQEA 1LFWA 2KO1A 4GVBA 4I2PA 3RJMB 2DCUB 4CZCA 3KK3A 5ETTA 3G6ES 2NQPA 2KXHA 4HT5A 3EGVA 3GONA 5IV3A 4P2FA 4WF9Q 1RAJA 1WKLA 1RK8A 2AEMA 4OZLA 1GT8A 1LK5A 2DRDA 2FUG9 4L3KA 4ZJOA 5SZTA 3P8BB 4RW4B 5C25A 4Z7YA 5E5NA 4EWTA 4PG4A 2B3TB 1JLAB 1GAOA 2CZ9A 3C16A 1U45A 2IMWP 3MXHP 3S8SA 1JWWA 4M5JA 4OZ1A 2ZKTA 2M5YA 1U47A 2HS4A 4KRWA 5B0CA 5F8GA 2OTLS 3R27A 3E8OA 4BHQA 3BSOA 2KFZA 2F40A 3J7YU 4F2RA 1DFDA 3LPEA 5D0GA 2OPQA 2UV8A 1IQZA 4DS5A 1RDRA 3FK4A 4QYZK 5D6GA 5HSPA 4BDPA 2HVDA 4YEAA 1KVIA 3CCWA 2OELA 1RWNB 3D67A 4NZ7A 1PJ6A 2CJKA 4NZ6A 4FNHA 1FFGB 2W4CA 3UDEA 4DZDA 2ZJPQ 1KC8T 2FLLA 3GU0A 5IQ6A 2DJWA 2FHJD 1DLOA 3BSAA 1WTBA 4JI2F 3W66A 3ILIA 1HMVA 2PDAA 3W8GA 4IRDA 1VJQA 2HFNA 3ET6B 4CH1A 3JYTB 1P1LA 2ATLA 3MEKA 4XPEA 3TX8A 2V34A 2I9SA 4OHXA 4EK2A 1V5IB 3I0RA 5ETNA 2OEJA 5HN0A 4K4XA 2NS1B 3G6VA 3Q8YA 1VOMA 5LM7E 4KHPJ 1MU2A 1XR7A 1FE0A 4FVCA 1EP4B 4ATNA 2NSCA 2ZUAA 1GMWA 3PFEA 3OV7A 4NMXA 4FS2A 4DSFA 3DRYA 4OFZA 2DR7A 3DHWC 3GR1A 3OFFA 4RL1A 4LMZA 2I8EA 1SB6A 5IZHA 4X65F 2HK2A 4KHRA 3EX7B 4RUAA 5KOXA 4CT9A 3DNCA 4Y2KA 3OFEA 4I6YA 4A48A 3G87A 3SYZA 1KFSA 4K4ZA 1YRTA 3K7RA 1CS4B 4LRBA 3W5XA 3IM9A 3MD1A 3AT1B 2P9GA 3QWUA 1R0BG 1SH3A 4X4NA 4TU9A 2VQEJ 4LF7F 1T8EA 3TJAA 3U7JA 4A8QA 2YNGB 4TY8B 2R7WA 4K4VA 4IR1A 1XIQA 2DGTA 2C3PA 2FLPA 4LFBF 2RKIB 2VBZA 1FJ7A 5IFMA 2CAJA 4DL4A 3R5AA 5F8MA 3T3FA 3SDEB 5DZ7A 3HPOA 4X4TA 2GVDB 3PR5B 3BEGB 3A3OB 3IG1A 3NCRA 1MMDA 4C8ZA 2F3JA 1H3DA 2XYHB 4WP8A 3M2UA 5JXSA 4X4QA 4RNOA 4WPAA 4GKKF 2PEBA 4L72B 4WIIA 3C15B 3PYGA 2HFUA 1Q81T 2R8HA 1YJ7A 1D1UA 3KWMA 1XNQF 3C14B 1HNVB 3RBZA 3V81A 1J27A 1V9OA 1VGYA 2FY8A 2XMVA 3CVKA 4M5KA 4MT1A 4DFPA 1BQNB 1KONA 2OMLA 3BSCA 1S1TB 2E66A 4QR2A 2M0GB 4CLWA 4Z2XA 4Q43A 1UETA 4CI0B 4ZKAA 3A3PB 1KRPA 1RT3B 3I4PA 3R5JB 2FC9A 2YY3A 3G8TA 4DV4J 1NDKA 4ZCIA 1ZPVA 1P27B 1RT2B 2XEXA 3FVYA 1RA6A 1R3NA 1G7CB 1E6YB 2IM2A 2KKHA 2EWHA 2DEIA 4OHVA 4Q2MA 4USVA 4J9PA 5G4DA 4I4BA 4OI1A 3CULA 3DCAA 2HHWA 4CTAA 3HHLB 2ZWPA 2UP1A 1UVJA 5J1EB 4C7QA 3KJFB 2MKYA 3THPA 4RU9A 2GS8A 3OVBA 4I7FB 2BRKA 4LVOP 3WC2A 1SJ4P 3ZZRA 4FYDA 2WZ1A 4MYTA 1HWLA 2BBEA 3HKZD 4K2XA 4OZ0A 5T41A 4DX8H 3JSMA 4JBCA 2RF2A 4MFBB 3V6DB 2HG4A 4I69A 4KTQA 2FIUA 3NG8A 4K59A 4Y3CA 3TA1A 5KFJA 1NEEA 1LWFB 1J5OB 4H54A 2A2DA 2IJFA 2RD5C 3KLIB 4OYBA 2D69A 4DL7A 3EVMA 2ASLA 2PSZA 2Y8YA 4EGLA 6AT1B 4OMFG 2HQ3A 5HK4A 5LMUJ 1NU4A 1QY7A 2C2ZB 3IR7B 3MUVP 4X66F 5HLFA 1NDPA 5DQGA 1OPZA 5EHHA 1JLAA 2VPZB 5FD1A 4YHHJ 1JLFA 3OBIA 3T5LA 1F2HA 1GMVA 1OYDA 1UJ6A 2YKNA 3MCSA 4FPRA 1S0MA 2DHAA 2UVRA 5M2UA 1KQSR 1Q16B 5HQ8A 1X8DA 3DU5A 3AJDA 3QIPA 3OLBA 1OYEA 2Y0BB 1OMSA 1UAWA 1PCAA 4K4UA 1JJHA 1XJWB 1FCAA 4QR1A 5CYJA 1AA1B 3KLHA 1Q79A 5EX3A 3W9IA 2HFZA 3IWXA 5A8KB 3CT9A 3CPWR 2UXCJ 3RUBL 4JI5J 1QSLA 3TWZA 2HZVA 1Y4ZB 3W3SA 4OI4A 2DHXA 3JTOA 1PGZA 3M8SA 1S9GB 4U7CA 1NH8A 5T7LB 2CPJA 2H65B 1DY3A 2MYFA 3I0SB 3LQVA 2CG4A 1RT7A 4FYXB 2BVZA 1RWUA 1YVFA 2XNQA 5KG3A 3EPIA 2CUYA 4RLEA 2YQ1A 2ASYA 5KFVA 3KMQA 1SI9A 1OSDA 2VFUA 3CNQP 4DV1F 3ETMA 1UEUA 4USKA 5LXRA 4F3OA 1EQMA 2OAUA 2C2KB 4HYKA 1XN9A 4LBIA 4A8OA 3B4MA 4CLKA 2VU5A 1N48A 1S6QB 2CPIA 4M5IA 4WXOA 1VHIA 2B6AA 4PQUB 1MROA 3DLKB 1IBMF 2Q6CA 3H2UB 2OD4A 4P75A 4UUWA 1RU1A 4O44A 4YB1P 4USMA 4Y28C 3Q23A 4JI1J 1S77D 1R0CB 4OX9F 4YR2A 4QWCA 3TARA 1IWAA 2ADBA 2RQMA 1FK9A 2V68A 4XAKA 1JJCB 2Y1IA 1U02A 2Z30B 1REVA 1VBKA 3G86A 4OLOA 4RO0A 3TVZA 3CJKA 1C0TA 2LU2A 4ED8A 4UQTA 4ZA1A 5ETVA 5AXKA 2D9PA 4CO5A 4X65J 2F1FA 1X5OA 2N4CA 3PW5A 2HWIA 2G4BA 2RS2A 5AXNA 2OO4A 4IG3A 3GIIA 4DV7J 1R0AA 4KC5A 3NGDA 2RJZA 4WTYA 5EDWA 3EGWB 3G6XA 4RW7A 3R1LA 3J80U 4NCGB 1W26A 1VK8A 1VHFA 2V69A 7FD1A 2XULA 5CD4A 3BB5A 2RIJA 3CJ4A 4RR5A 1H7XA 2FJEB 1N52B 4J37A 4RW8A 1O6XA 3ZZOA 4DPYA 3JSMB 1YJWS 3CD6S 2BABA 3P5TL 4LSZB 3HSZA 2VQFJ 4MIAA 1GTHA 1Y9OA 4QQBA 1I5OB 2ZJQQ 5IT4A 1A9NB 4LSNA 2AJ2A 2I5JB 4ANEA 1FNXH 4C3KA 2DNQA 4GKKJ 4DV7F 1RBLA 1KQFB 4USJC 4DHVA 2VDHA 3BQ1A 4L76A 5C24A 3BREA 2NYHA 3CCLS 1SXLA 2ROGA 1KTQA 3D68A 2MKCA 3D6MB 2QEXS 2Z4PA 1VMBA 3NAHA 1X0PA 2CJAA 2AJ0A 3GFYA 4NI2A 3BR9A 4DR6J 1D3WA 4TYBA 4ZITA 4O0IA 5KFFA 3M1VB 3KLFB 3CMES 4HVZA 4C6AA 3CC4S 3C15A 4NI2B 4AXJA 1RAHB 1JLBB 3O44A 5H9FJ 2AQ4A 1SL2A 3KJQB 2Z8QA 3I56S 2ZH2A 2QN6B 1NPKA 4DR4J 4NEYA 2HBZB 1RT4B 1EIYB 3PW4A 5E2QA 1QLNA 1WEXA 2XMKA 4DEZA 2IBOA 3AODA 1AZSB 5ETQA 3PEHA 4HR2A 2RKIA 2D3UA 3N6NA 1FF2A 3SI8A 2EI5A 2R4FA 1YGYA 1RHQB 4ECQA 1YZ7A 4ED5A 4M5MA 4A8FA 4HI2A 3TZYA 2CIMA 3MCOA 3MM9A 4JUZA 2ZITA 1LXNA 5B08A 2JNJA 1O5JA 1PYOB 3R7SB 5IS2A 5DRKA 1TK8A 4R5PA 3JSRA 5D3GB 4IKAA 4C0HA 2ZBIA 2NR0A 3DRRA 2CQ4A 3B54A 1H98A 4Y2CA 4L3NA 2IPOB 3THVA 2IYGA 2AGOA 1L3SA 2BDPA 1JXVA 2YNIA 1N54B 3D6TB 3N6MA 1RYRA 1B7FA 3MM7A 3NOCA 3MM8B 4H4KA 1JLEB 4QW9A 3C46A 2RDIA 4I2PB 5A8WB 3DHXA 3JXOA 5KFIA 9RUBA 2N7YA 2CPXA 1C0TB 2ZD1A 3CIMA 3ILLA 5GADU 3DLHA 3SFGA 2CVIA 3HVWA 2VHGA 1VQLS 2UUAJ 2BOAA 4DFKA 2CRLA 2MQPA 5E3PA 3FUYA 4ZVFA 5HBMB 4LF7J 4DU8A 2UVWA 2ZH4A 2E5JA 1GK8A 1RT7B 2Y9HA 2OFHX 2WCXA 3D0HE 1YBTA 2XC9A 2B6AB 2BE7D 1YKWA 2DGWA 1TTHB 3CD0A 4C98A 1PAEX 4X84A 1AUDA 4RW6B 3IGNA 4A46A 2DRAA 4F4WA 3SV3A 2W25A 2HHVA 1U8WA 4LR8A 3RRGA 4U6PA 1IJFB 3EE3A 4DR5F 1OJ4A 4LF4F 1GMWD 3R5BA 3CCVS 2VH7A 3AJ1A 3NS6A 3UDCA 4KHPF 2YKPA 1NK7A 2KRRA 2YX4A 1PKUA 2MKSA 3CIZA 4RW8B 1HWKA 2V0NA 4YUDA 3Q8SB 2MB0B 2XS7A 1WG4A 4ZPBA 1GH8A 2JSXA 3PKMA 2JVOA 2JL9A 3AHPA 4OYOA 3CDAA 3FKBA 4C0BA 1D9FA 1EAYC 4PUOB 3PJWA 4IH6A 4X4SA 2ZE2B 3S6EA 4DG1B 3OTCA 2ZNZA 1HNIB 4IG3B 2DO0A 2YNFA 3ZZYA 1APSA 2JJ4D 2VBYA 1UA0A 2W2MP 2ZNYA 1FWPA 1WWHA 9ATCB 2AJ1A 5J2MB 4M5LA 4CNYA 5MAOA 3V6KA 3RYLA 5BYQA 4UT4A 2OI2A 3MUMP 4QIFA 2HPUA 2B4OA 3MEGB 4F4ZA 3PRBA 3HKWA 5FDLB 3HSJA 3MHYA 2EVZA 4ZLNA 2A10A 1S6OA 2DNLA 3DM2A 2FB0A 4MFBA 4QWEA 2DD8S 3VAFA 4UZCA 1ZOTA 1RCXB 2AZ1A 2V50A 4BWJA 3HJFA 5ETSA 3PXGa 3NMAA 1RKJA 3Q83A 2IA0A 2BJ9A 4MK8A 5I3QA 2DKOB 3DXSX 5EGYA 1VS3A 4LREA 4LR7A 4MK7A 5A76A 4OQJA 2D3O1 1SJ3P 1O8BA 1X5TA 3FQKA 4NWBA 2EG1A 4ZJLA 5GAHU 4O0NA 3NL0A 4UQGA 1RWWB 2LYVA 4R8UA 1SC3B 4NE9C 4FBTA 2GHVC 4DV2F 5KFZA 3GV5B 1F3VA 5LMUF 4P7TA 5E33A 3HVRA 2Z2MA 2PI5A 2KHCA 1S4FA 3EVWA 3H4BA 3CTRA 1OIAA 4IDKB 2XI3A 1T9YA 4O3OA 1ZZNA 2BR0A 3EZUA 1RJJA 1SL0A 2DHHA 5HATA 1TL1A 1RHKB 4CO1A 2DH7A 2CPZA 2R42A 5HAOA 4DQIA 2ZH1A 3ELHA 2VKRA 4NPOA 1HNWJ 1U2RA 4WP3A 4MYUA 4DQPA 2CXEA 2MLXA 4KO0B 5KFDA 1RHRB 1J2VA 1D9AA 1Q4RA 2V5HG 3OVAA 3MWBA 4JV1A 2JHEA 2LU1A 3O5TB 3DLEA 4AQYJ 3D28A 3QSYB 2VASA 2YKNB 4RPFA 2DNGA 3T6JA 2VV5A 5J2MA 1IBKJ 2DGXA 2ROPA 5EUHA 3LANA 5ETKA 5I3UA 1HNXJ 1VQ8S 3VCDA 4U67Q 4KH0B 1KLMB 4C8NA 4DL5A 1LWXA 1WACA 4ID8A 2YQ3A 3TYTA 5A8RB 1Q8KA 2LFVA 4WFZA 2VA3A 2WSEC 1NHKL 2EFNA 4DR3F 1B4SA 2DEJA 4LVNP 3R2DJ 2AKWB 4X4UA 3R2CJ 3F73A 2C3MA 3LO3A 2E5GA 3NGRA 1OO0B 3RZAA 1UL3A 4R8UB 2RF2B 2WW4A 2E5LJ 1FDBA 2BJ1A 3IMQJ 1LW0A 2OIHA 5ETPA 5F8IA 3L95X 2OKQA 4B02A 2ERRA 4OYZA 2WONA 2WVEA 2ZEJA 4ELUA 1AT1B 1BHNA 4F02A 1IKXB 2XYPB 1HQUB 3MGJA 4A4JA 4HDGA 4CYUA 2ZBRA 1BY9A 1ZM3A 5A0YB 3E01B 5A8WA 2NXUA 3K5LA 1Q86T 2KXFA 2VB6A 2BKPA 1Q8BA 4ELTA 5T14A 2HNZA 3UW1A 1JQGA 4DR1J 1KP6A 1I51B 4HEA9 1NK4A 3KNGA 2DNOA 1TKTB 4DLGA 4NLYA 4DLEA 1HI0P 4TU7A 2MHNA 3C3LA 1RUSA 1RTIB 2HNDB 1Q53A 2W2OP 4F8RA 2C2OB 1UJ5A 4IG0B 3TNVA 2XG8A 3F0NA 2YNFB 4F3MA 2B4PA 4GO7X 2V4QA 3SXLA 1HARA 1NM2A 2J0WA 4HLBA 3BZQA 4XDCA 1U1QA 4R5PB 4PUOA 1F60B 5D3GA 3K59A 3QIDA 4ANCA 4MH8A 2J6UA 5CYMA 1I94J 2DVIA 1RYSA 3OTOJ 2ILYA 4ZLJA 3DOKA 1VLOA 2ZC4A 1NZ8A 1QJHA 4A8WA 2R7VA 4LBPA 2YPZA 4NCGA 2YPYA 5D4OA 2G0CA 2PFDA 1DJ0A 3PRVA 4X64J 1LKZA 2UVVA 1I6JA 3KG1A 3FFIA 3MMCB 3L7UA 1ZS6A 2DNZA 2RHQB 1JNZB 2VJUA 1RAEB 1ZM4A 1U1LA 4WKYA 3ISNC 2ASJA 2E7VA 2HFOA 5KOWA 1R43A 3F56A 1V5VA 4ILLA 1PJ5A 1NDLA 2F65A 4DQSA 3HZEA 2MQMA 4LRCA 3GILA 2ZH9A 2LECA 3MPYA 3IBCB 1NAQA 2JZ5A 2MDAA 4ETXA 2IAJB 5DQHA 1NK5A 3HSGA 1UPPA 4HTIA 4HKQA 1DBDA 4ES2A 4PQUA 2AIRB 2CVEA 4ELVA 4CNZA 2L41A 1IKXA 1SQEA 2HWTA 4QZVB 4AT1B 4X62F 3PIPQ 1S1UB 2KM8C 4JI3F 3GYXB 1L3VA 3QFWA 4KB7A 3QLHA 3KMSA 2OPSB 3VVTA 3RBDA 4IRKA 2H51B 1RAIB 3VVUA 2B9XA 3MM9B 4WU2A 2L48A 2RAQA 1RGVA 4WK3A 4DL3A 2GJ2A 4KFBA 2GO8A 1HBUA 2J7UA 1TZ0A 4ITSA 3PRDA 2RT3A 3JQJA 5D4NA 4M8LA 3RR7A 1WOSA 2DY1A 1FFWB 2R7OA 3IWLA 5EWGA 4JI4J 1R0AB 4MKYA 2M8HA 3AQPA 2WVFA 1KLMA 4X4RA 3QWPA 2MQQA 2IJNA 1UP1A 1GX6A 2EXUA 2XNRA 3LA0A 3DOKB 2CNKB 3O3LA 4PKDB 5AJ3J 3L4BC 3QZ7A 1KNZA 2M70A 4N56A 1H73A 1RWVB 1YJRA 2IDLA 1TUGB 1WG1A 1EARA 2Y0SD 1V3ZA 2ZOGA 3CD5A 1CJVA 3JQKA 5LSOA 4NLUA 2R2SA 4Q5VA 4ZOSA 3T5HA 3CCES 3LAKA 5KFBA 3VGTA 4L74A 4DUTA 2KH9A 1S12A 1MN7A 4WFXA 7FDRA 5A0YA 4N7TA 3Q8QB 3FGVA 4OJ1A 3QJLA 1SC1B 1QVFR 4DF8A 1K0TA 5HO4A 2LLZA 3PW7A 1RTIA 2HNDA 3NWRA 3GFZA 2GNKA 3CCMS 2ALZA 3RW6A 1NSKL 1TR0A 2C2RA 1UZHA 2X1GA 2D3ZA 3GJQB 3P6YC 1ZM9A 3HI9A 3RU0A 2HS0A 3KLIA 3WHIA 3TJ9A 3UDLA 4NEZA 2BUNA 3CD7A 2KG1A 3IXQA 3PIOQ 1L3TA 4PG6A 2I5JA 3D0GE 3FBBA 3ITHA 5GAHI 3NEKA 1FJGJ 1BWEA 4N47A 4WFYA 4CH7A 3RAQA 3KK1B 3DGPB 3UVJB 3BR8A 3JAMU 1E6VA 4DOZA 2IYIA 3PDNA 1TMMA 5F8JA 1RT6B 3LW5C 3CCSS 4WYWA 2UUBF 1NKBA 3I31A 4GVLA 4HTJA 5CH7B 1E6VB 2JLFA 2YKAA 5KFGA 1YSJA 4JI5F 5EN1A 4NLXA 2BYCA 4NL5A 1VRQC 4EO6A 1C2PA 4ZLLA 2WTFA 2R9LA 3SBMA 3NXZA 1X4GA 3KK3B 3TW0A 1E6YA 2D74B 1Q7YT 5KT3A 1AW0A 2QIFA 1C1BA 2GX8A 1ZZFA 1X4EA 2PT0A 3MMAA 2P2CB 4V1Ak 5HQMA 2HGNA 2YWKA 3MEGA 5CAAA 4GKJJ 1IXKA 3I87A 3TVKA 3OL6A 3OSNA 1WKKA 4OZ5A 5J2QA 4O3NA 1DTTA 5A8RA 2L9DA 2ZOFA 4TY9A 3CGIA 1WF2A 2HQFA 3T1AA 4F04B 2GAHC 1YX2A 3MR2A 1EHWA 4C3MA 1N8RT 1X4FA 2LXIA 2VG5A 4R0JA 2V4JA 4W90B 5HMYA 2XLKA 4Y2IA 3CCUS 1TL3A 4NLTA 2HHXA 4OHWA 3C2PA 4OL8A 3H59A 2W7OA 3M7VA 3M8QA 2FVQA 3W60A 1Q8IA 1S49A 2K06A 4H4OB 2Y3YA 3DRXA 1FD8A 2DHSA 2NXNA 5GAGU 3MURP 5DLFA 1HNZJ 3QIPB 3RR8A 1C0UA 2QYCA 2QJ3A 1EZZB 1L3KA 3TAMB 2J0XA 2W9AA 5DGAA 1MWQA 4OHZA 3T41A 4IOCQ 1NDCA 1YRUA 3HHDA 4RNHA 1Y0HA 2AJFE 4KSEB 3N6LA 1X31C 4XK8C 1WC0A 1HNZF 4JI1F 1BXNA 4ED4A 4DQQA 1T7PA 2JC1A 3D3BJ 1X9MA 4DUYF 5KFKA 1U7LA 1F9FA 2GIRA 4IFVA 1IKWB 3I6PA 3NCPA 1HLWA 1F2GA 3ILJA 5D0RA 3ZFVA 1K8AT 4OI3A 2IC3A 1VQYA 2HBYB 3QO9A 3W63A 4QIEA 2PA8D 2V6AA 1WHWA 2YWWA 3VAJA 3IS9B 1S10A 2QYGA 4G1QA 3VHQA 2DXFA 1YJ9S 3C6UA 1S1UA 3TO8A 1QAYA 1S1TA 1X4HA 2A1BA 2CQ3A 3DRPA 1XEZA 1SKUB 2CJXB 4FXWA 2MJNA 4F25A 5F9NA 4UZBA 1FKAF 2DNMA 2A6OA 1PBAA 3LH2S 4CO3A 4C9DA 4TVAB 1C4AA 2AYMA 2YWEA 4Y2AA 1YRXA 2LQ9A 2J9EA 1WUUA 4OJ3A 4IFYA 4B3SJ 2FZCB 2J9DE 2U2FA 2VG5B 3A4TA 5KFNA 2B43A 3A3NB 2LQ5A 5EWEA 1TV6A 1Z2ZA 1WI6A 4RNFA 5J2QB 1HBNA 2DR5A 1MN9A 3KK2A 5KTQA 4WXWA 3CJTA 4HACA 2RILA 2DO4A 5B0DA 2XO6A 2DNRA 3PYDA 1U0HA 5IWAJ 3VWSA 2VG6A 2VQEF 3LP2A 1HBNB 5KAKA 1N34J 2ACYA 2HK3A 3CW2C 3NGUA 2OEMA 1M5HA 2BJDA 3RAMA 5LT5A 4OYWA 1BQMB 1F5AA 1FVSA 3LP1A 1Q0NA 4NMLA 3AA9A 5D4LA 4DPXA 3GIMA 3GV8B 4B9TA 5CYMB 4YR3A 2XO7A 4ED2A 2AMCB 1S57A 2C2DA 2HQCA 1M1KT 4G1IA 3FBFA 2ACMA 1JLBA 2GVZA 3HDSA 3TUZC 1W25A 2WOMB 3DGPA 3M8PA 2VL1A 3PEJA 2EPIA 4KFBB 5KFAA 1IKVA 1FNMA 2DGOA 2M9KA 3OR2B 2KVQE 1F9HA 2EFQA 3MPVA 2VQFF 2OPSA 4HHJA 1N4LA 1SC6A 4DV5J 2BACA 1HPZB 2Z58B 3UN2A 3NBPA 4JI8F 3W62A 4DCOB 5F8HA 2XMAA 1RTZA 2MQNA 1T0TV 1CLFA 5C2GA 1FXLA 1DQ9A 1S1WA 2HHQA 1W2IA 1PYTA 1YZ6A 2B7CB 3G8SA 3DLGA 5BYRA 3JS9A 2CQ1A 1DARA 2JDJA 2MLYA 1CSJA 2C22A 1RCOB 2VBWA 1WC6A 2MTLA 5KT2A 2DR9A 1YHQS 4XTTA 2O01C 4DR2J 1LV5A 1HR0J 2ATCB 3QQCD 1HMVB 2E5HA 2WK4A 5E0OA 3OUYB 3I5CA 2RUSA 1IBLF 4DXLA 1ZTWA 1QTMA 4LFAF 3P49B 1AZSA 4TKTA 3ISND 2CPFA 1ULRA 3HFVA 3X1LB 1KN6A 3RG6A 2OGUA 2ALYB 5G0RB 5L9NA 3HK2A 3AH6A 3THTA 4PPDA 3QZ8A 3Q8RB 3VAHA 3TUIC 2QSFA 2OSQA 1S6PA 2OD6A 2HVZA 4J9UE 1D8YA 1MMNA 1IBCB 3WZ0A 2JEFA 1ITPA 4DR7J 2I1RA 2ZOMA 3QT8A 1NCLA 1MNEA 2U1AA 3ETOA 4B9MA 3AJ2A 2AW0A 2Y1JA 1FRLA 2R2TA 3PV8A 2C28A 2AEJA 1U49A 2F9DA 3HHLD 4J9KA 1NSAA 3LP0B 1Y00A 8ATCB 2UXBF 2QG9B 3ZTSA 2YX7A 3PX0A 2XWXA 4O44B 2UXDJ 1TKZB 3MMBA 1WELA 1SL1A 3TA0A 1P1TA 2V8GA 2BQ3A 1R8BA 2M88A 2V4RA 4ZP9A 1HQEB 2VPWB 4Q7AA 2XMUA 2JC0A 1LWEA 2IHR1 5A2QU 4B9UA 1EQ0A 1A6LA 4O23A 1WD6A 4WE1A 4JI2J 2KB2A 2QX0A 3K0JA 5DDQC 2K8GA 2FYXA 2QL7B 4OX8A 3OQ2A 4ECUA 4GC7A 3MAAA 4LSLA 3UD5A 2LP4A 2X7IA 1ZA1B 3RB0A 3AD7C 2HVEA 4HL9A 4CRJA 5K8NA 3W2VA 2R7XA 4EUVA 4P10A 2JEJA 2C3UA 4DL6A 4CLYA 1KDNA 2N82B 1CJKA 1VIOA 4UUXA 5H1SV 3AA8A 2DXEA 2RQCA 4K4WA 1XR5A 3MCMA 4FPIA 4HHHA 1Y11A 3HHLC 2HQIA 4IFYB 1RB0A 3RBXA 2IJRA 1XC9A 2KN4A 2XY5A 3QRPA 3G9CA 2MSSA 3BH6B 1MWZA 1S7HA 4OJGA 1RWKB 4RW9B 5LJ5Y 4TQRA 3KHLA 3GPAA 1U1OA 3VZIA 3TUPA 1KSPA 4DX5A 2ZUGA 1KQKA 4M94A 4H4MB 2J8AA 3TX0A 4ED1A 1GXUA 1VLYA 2HBQB 3HZGA 1SJ1A 2HHTA 1NHVA 2BA9A 2HNYA 3M32B 4K0KF 1C1CA 3TI0A 2CPEA 1H2VZ 2HHUA 1VRUA 3C66A 1B99A 3C8YA 3NLCA 2ZH8A 3PCOB 3PJ9A 2QLJB 5ITHA 4IH5A 2GV1A 4YFUA 1YBAA 1MWYA 4PG5A 3DN9A 4ZK7M 5IC4B 4O3QA 4ZVPB 3RRHA 2H4WB 3PX6A 4IDKA 4E98A 3MM6B 3N4WA 1YLXA 1K44A 1IKYB 4U95A 3HSDA 5KFYA 4YS2A 1RAAB 1XQIA 5D77A 3OLAA 4LRAA 3VALA 1TVRA 4A47A 3M05A 2XLJA 2K1RB 4I7FA 3AQOA 3BM7A 4QWBA 2GC8A 4WWSA 1WC4A 3N79A 3NWGA 4ID5A 3RGIA 4F7VA 2LDIA 4ZIVA 5CCLA 2VPXB 4N41A 1FJCA 4ER8A 3UVJA 5DJBA 5C42A 3Q8VA 4EBDA 4JYAJ 2ZM6F 4U8VA 5M2RA 2UU9F 2VF3A 3GJTB 1VRTB 1HKAA 2G0JA 4RKUC 2YNHB 2YQ0A 3ZZPA 2NZCA 1B70B 1SJQA 1VQSA 4U7UK 3SQOP 1KD1T 2FVSA 5DZ6A 1SUQB 5C2CA 5JVGQ 3V4IB 5BJRA 2JFDA 1UJ4A 3GG1A 1U26A 2EC2A 2G2OA 3CJ5A 3GIJA 3EPGA 4EYHB 3WBZA 2KM8B 3HMJG 4KIAA 1TAUA 4J9SA 5I3UB 3KLHB 3BBBA 3BBFA 2FLNA 3QYYA 5L38A 1U2CA 2VFVA 2CG8A 4I6AA 4DR6F 3FFIB 3UNGC 4DR4F 2IVFB 3TR5A 3W5ZA 2A0FB 1XERA 3VTIA 3QRQA 1CJVB 2NLWA 3FQLA 4ALZA 2IDEA 5LXYA 1TFYA 1N36J 2PD1A 3UQSA 1WKJA 4IQXA 2AF6A 4NCAA 3M6WA 3HVAA 2OTJS 2GW8A 1R89A 1YIJS 1SBRA 4ZPAA 4RWWA 4DV4F 1ELOA 4DG1A 2PEHA 3BSNA 1UFLA 2BEFA 4F4YA 4RJVA 5HMZA 2KG0A 3TANA 5J1EA 4GMKA 4FN5A 4PABA 2N4DA 3D0IE 2DNKA 2W4DA 3R9LA 3M2RA 5KFPA 2JLEA 4FYWB 5KFSA 4IR9A 2ZHAA 3R5CA 3HVTA 2HHHJ 3CCTA 3F41A 2CDRB 4ZMMA 4UOGA 1OWXA 4ZVHA 5JVHQ 4J9RA 2Y1RI 2H4YB 1ZH5A 5E41A 4YDDB 2BV3A 1BGXT 4RW6A 2XS2A 4X2BA 4ZS6A 1EP4A 3W2WB 3OT9A 1LW2B 1P6TA 2YKQA 2AYGA 4QR0A 2R7UA 1G3OA 4CM0A 2VIHA 1IBLJ 3PW0A 5K9FA 4TXSA 3QGIA 3NGSA 2NYIA 2DGUA 1JX4A 4CYUB 2XCPA 3FJ2A 3T1HF 1FEEA 4EYIB 1FERA 2MQ8A 1IWGA 3SQGA 3AB4B 3UNYA 1J5EF 1NZAA 4LIWA 4QIWD 3BKTA 2CPYA 2FJBB 2OPPA 1TELA 2P8IA 2V8VA 4MKBA 3Q0AA 2RS8A 1URRA 4KGVB 1T95A 4LFCF 3M6XA 4USWA 1HL6A 2FGCA 3U1NA 4MIWA 4I0WA 3PHTA 2C3OA 2GHPA 1KS2A 2CJBA 4RW9A 1S6PB 3EWGA 2MPUA 3M2UB 1LOUA 2XM3A 1N56A 3BO3A 1CBKA 4JI6F 1WNEA 2MZQA 2FHKA 1Q5YA 3Q8UA 4K5RA 2WB4A 2J6TA 1CQNA 1VQNS 2J0QD 2FJDB 4K2JA 4YHHF 1XMOF 2D9OA 1TU0B 2V94A 3FDSA 2EW9A 3UD4P 1BWVA 4ZVGA 1RZMA 5F8NA 3CCQS 1M5PC 2CQDA 1RWOB 3KG0A 3OXGA 2LMIA 1X5SA 3BPSP 2OHDA 4E8UA 3M1VA 4RUCA 1VR6A 3KLFA 4A8YA 3C6TB 5GAGI 2C3YA 1TKXB 1CC7A 3IFEA 5KG5A 4QCLA 1TUVA 2CJ9A 3K57A 1Q95G 7AT1B 5E7OB 1KFDA 4OX7A 5L1KA 4WU3A 4YN3B 2EK1A 2F8EX 4F26A 5CABA 1JK9B 4OV1A 2BE9B 3I96A 4XDDA 4ZVOB 3NBPB 5I3PA 1UTAA 1NB2A 3T9ZA 4NYZA 4JI4F 4LF6J 2Z2LA 2YBVA 2NXJA 5IOLA 5RUBA 3OR1B 2FJVA 4Y34A 2GGPB 1XMOJ 1WDDA 5LJ3Y 3HCXA 4CT8A 4B3MF 2OEKA 2AX1A 5ETOA 2VD3A 3P4UB 5ETMA 2J8SA 3BO4A 3C6UB 1SV5B 1MMLA 2WAQD 5E3RA 5C24B 2R2RA 4J9NA 1VQ9S 3MFIA 2XTJP 3Q24A 1TKDA 2ZH3A 1SKWA 3QJPA 3T19A 3IC1A 5BXIA 1X9SA 3H20A 4M5DA 3HD2A 4NA1A 4P6QA 3WQPA 3H40A 2AU0A 1CVJA 5K14B 2RVJA 3NGKA 4JV0A 1D9DA 3I0SA 3PW2A 4RWXA 4AYBD 4Z37A 1IBMJ 2E9RX 1NKCA 4ZIWA 2GMHA 2G13A 3TAPA 1N6QB 1D0EA 1EKSA 3KLGB 1N0VC 2V2KA 2R7QA 3GSDA 5DS7A 2J0SD 4PRFA 1F5CA 5HQLA 5A8KA 2QZ8A 2MKHA 3M30A 3D66A 4Q8FA 4ZPDA 4C0OC 1C1CB 1RAFB 1XMQF 2OJ3A 3KFWX 4LBHA 1IJEB 1REVB 2CDQA 5AT1B 4G65A 2W9CA 1PC5A 2DB1A 2B4UA 3FEZA 2ZH6A 1UW9A 4Q8EA 5E3CA 1B0VA 3KOAA 5L8RC 1CULB 1RT1B 1N5YA 1FWLA 4OHYA 3I82A 1S5ZA 2IA6A 2IIHA 1TL7B 3BGRA 2HRUA 2AYEA 1HBMB 1X0FA 3NS5A 1LW2A 4DWIA 1FRIA 3KDNA 4BC7A 1QVGR 2H5EA 3P3DA 2F7VA 4NA2A 2DIVA 2L3MA 3IS9A 3AAWB 3DYAA 1YJUA 8AT1B 2EFVA 4DFJA 3MTJA 4N8OA 4CO4A 2ZHOA 4YQWA 2DPJA 1U6BA 3V6DA 3AFGA 1S6QA 3MM5A 5ADZA 3LAMA 3CF5Q 1LXJA 3B78A 3D54A 5AE1A 4PQAA 1RTJA 4Y0FA 3PY8A 1FTCA 2IY5B 5HP1B 3GYGA 1S9GA 2IM1A 2NCKL 1R27B 2E1CA 4QBUA 4B3TJ 2B9YA 3SFUA 3TVYA 2ZC3A 3NGTA 2MY8A 4DPTA 5KFMA 2I2YA 1RSCA 3J7A1 2HZAA 2Z57B 4ECTA 3JTNA 2BANA 1H72C 4NASA 3TAMA 3MMJA 4KGMA 2ZZNA 3N9UC 1HHTP 2E44A 2FJAB 3PJXA 4RW7B 5HVHA 2UUBJ 2Z56B 4YR0A 2KZMA 1DQAA 1B64A 4U8YA 3ZTRA 4EBEA 2H5JB 2V2QA 3DRRB 3O1LA 3IP0A 3JAMY 4V19J 5ETRA 2E7XA 2KHDA 1Y5NB 1YBUA 3L09A 3QGHA 4WZQA 2BKOA 2GIFA 2M52A 3W65A 3KLEB 4U9RA 3G71S 4FXVA 2XZTB 2R3VA 5J2PA 3CUNA 2WB1D 1WI8A 1JLCA 2ASDA 1RTDA 2RQKA 2H48B 2B8QA 3J81U 3UDVA 1FRKA 8RUCA 2H9ZA 2C1EB 3MTKA 5F9LA 5KG1A 3EZOA 4ZDNA 3ZZZA 3KDOA 2QV6A 4USHA 1FE4A 3ISZA 1FRJA 3PG9A 5D15A 1NK9A 2V8HA 5HMXA 1DZ5A 4JYAF 3KLVA 4YB7A 4DUZF 4QU6A 1SC4B 1RBOB 1T11A 1T03A 1I94F 1RWPB 1T9VA 1QM9A 3FCVA 3POTA 1UVNA 4WKRA 5HP1A 2QA4S 1FKOB 5CYQA 5KFLA 1TVRB 4DF4A 4B3OA 2HVHA 3IBFB 4WJBA 1HBOA 3PM9A 5GVQA 4ICLB 4ZN3A 5IM0A 4KGKA 3OPKA 4RU2A 2CA9A 5KT5A 1PC4A 4USTA 4WFNQ 4DSIA 2XHCA 1NK0A 1N33F 2DCLA 3ZC4A 3DYAB 4KE5A 4WE1B 1V3RA 4ZP8A 2LQBA 2X3DA 3HFZB 4DV6F 1WEZA 2QFIA 1T9XA 3I32A 5KFTA 2VFTA 3K5OA 2GJIA 3K89A 2ZD1B 1YJNS 1B3TA 5K8MA 4URGA 3VGSA 2LEPA 4QYRA 1KQGB 1QD1A 2VA2A 1JB0C 2J9CA 3BPDA 3TZXA 4PXDA 1T9UA 2K7KA 2HAFA 3PFOA 3ENWA 4DV2J 3I5BA 3TA2A 4USUA 2NUHA 2V2ZA 3AOBA 2GO9A 3CEDA 3FSYA 3H5SA 3MAHA 4EU0A 3P96A 4NLOA 3EYZA 4CO0A 4TLQA 4DR2F 1UVIA 5D8HB 2CJYB 2CYYA 4AE5A 1R7IA 1CJTB 2NSBA 1B7YB 4OI2A 4C8LA 4DV3F 4L6V3 1NKEA 3VAIA 4ECXA 2B56A 3QAUA 1XWLA 3IA0A 3MMCA 2IM0A 4MKAA 2UUWA 3GSIA 3K8WA 1HNWF 2R8GA 4DMZA 4C8MA 3WDOA 3GQCA 3CDEA 1KLNA 1M5KC 2DH8A 1XTZA 3BGUA 4KGXB 5BYSA 5DGBA 1R8CA 2YWGA 3QRRA 1CC8A 6FDRA 5KFOA 1ZA2B 2RRBA 3LALA 5KFHA 4PPZA 2W2PP 5L46A 2G9OA 1RXOB 1YJVA 4KKOA 3UR0A 4LFCJ 4L75A 2KYZA 4RBTA 5HBMA 4J9LA 1IVZA 2BXJA 3OTBA 3S01A 4DPWA 4OI6A 4EMDA 5AXMA 1SJRA 2EFOA 2O5DA 3GCWP 5F41A 3TOQA 3X3UA 2RHSB 3R5DA 1M1HA 3NAIA 2FVCA 4HH0A 2FHOB 5IC6B 4C8OA 1HPZA 1X7VA 1YWXA 4NLQA 4URSA 4Z7CA 2DISA 2UUTA 1TQLA 3HX9A 4A8MP 2R8JA 2NPFA 5A6WA 3J80Y 1HD1A 2GAGC 1IKVB 1S1WB 1GMUA 1H0HB 5K8OA 4DR5J 1BLUA 3GFXA 1FEHA 5KFWA 1EKRA 1VQKS 3PO4A 3MR7A 4CH0S 1NJZA 3MOZA 4P52A 1FKPA 5F0UA 3Q8PB 1ICEB 3MAQA 1VBXA 1TL7A 3BGRB 3UCGA 3ULHA 4UY85 4ES3A 1CG2A 3GR0A 5HVFA 4DR7F 1FESA 2KU7A 4WP9A 2RE1A 5L9XA 5U47A 2VBXA 3IWNC 3BJYA 3CB4A 2F63A 1U0HB 3W64A 3W2WA 1K0VA 4R25A 1WSVA 2OPQB 3L7PA 3NNHA 1T03B 3I9ZA 3KK2B 4EZ6A 2FJWA 1M5OC 1SH2A 1TMJA 2ZWOA 3LGNA 1NUEA 2M3DA 4KPCA 2BJEA 3FMWA 3T1HJ 2J5AA 2UXDF 3OFGA 4ENOA 4F0HA 1NB7A 4B3RJ 4QW8A 1RU2A 2M2BA 4BBYA 2XI2A 2A2CA 2PO4A 4DR3J 1CQMA 2X1BA 4DPUA 1HA1A 2NREA 3CCRS 4X4OA 5IT0A 1UW4A 4ZPCA 4W4MA 1GXLA 2X1FA 1BC6A 4N77A 4ED3A 2LQJA 1FA0A 4FXDA 4DR1F 2KT5A 3FZ2A 2KRBA 2HFVA 1V6HA 2W1BA 1UKUA 1EETA 1OPIA 2E1MC 4I56A 4FF2A 3LGHA 1FXDA 2XS5A 1N32F 2HVIA 3ZNJ1 2XWYA 5HLFB 1AXQA 1KR4A 4B3SF 2XMTA 2Z2YB 1M0SA 1U25A 2B4VA 2XY7A 1X9WA 4LF5F 2CNLB 1HNXF 3IR5B 2A6MA 2AP6A 4FYVB 4O4GB 4YP3A 3A8JA 2XQCA 3H5XA 4OJHA 4G1QB 2HW3A 5HL7Q 5HI7A 4C8YA 2GCFA 5KT7A 4BC9A 2GGPA 4B3RF 3RBEA 2D3OR 1HYSB 2MKKA 2AEFA
chains in the Genus database with same CATH topology
3EICA 4FKYA 1NLKL 3FKBA 5CAAA 2AZ3A 1HIYA 1WKKA 4DZ6A 4ANCA 2CWKA 2DXDA 5BXIA 1EHWA 4W98A 3VGSA 3VGVA 3BBBA 3BBFA 3MPDA 3EM1A 3FCWA 3BBCA 3PRVA 3Q86A 4S0MA 1NDKA 1WKJA 1NCLA 3L7UA 1ZS6A 1VYAA 2DYAA 4ANEA 2AZ1A 1NDCA 3Q89A 3ENAA 3Q83A 3BH7B 3FBEA 2BEFA 3ZTSA 1NDLA 1NSPA 2B8PA 3R9LA 3ZTOA 4O0NA 2BX6A 1HLWA 1S5ZA 4C6AA 1WKLA 4UOGA 3EVWA 1BE4A 3G2XA 2DXFA 3EVMA 4CP5A 4F36A 1NPKA 3EVOA 3VVTA 3VVUA 3VGUA 1NDPA 3ELHA 3ZTQA 4ANDA 3NGSA 4UOFA 4HR2A 5C7PA 2HVEA 3WX8A 4WBFA 3B6BA 1S59A 1F3FA 1W7WA 1KDNA 2NCKL 1NSQA 2HURA 2HVDA 2DXEA 1HHQA 3NGTA 3FBCA 4UOHA 1F6TA 3DKDA 3BH6B 1LWXA 1MN9A 3B54A 3GPAA 4FKXA 3ZTRA 3EJMA 1JXVA 1UCNA 1NHKL 1B4SA 3VGTA 4DUTA 4EK2A 3NGUA 1MN7A 1NUEA 4KPCA 3Q8UA 3NGRA 3Q8YA 4ENOA 1B99A 3PJ9A 2ZUAA 1NSKL 3ETMA 1S57A 3FBFA 1BHNA 3EMTA 2B8QA 2VU5A 1LEOA 3FC9A 3ZTPA 1K44A 3GP9A 3FBBA 1XQIA 2DY9A 1PAEX 1BUXA 4F4AA 1U8WA 3DDIA 1XIQA 3FCVA 5CABA 3EE3A 3Q8VA 3JS9A 1NB2A 4DI6A 5IOLA 1PKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIC A;  4FKY A;  1NLK L;  3FKB A;  5CAA A;  2AZ3 A;  1HIY A;  1WKK A;  4DZ6 A;  4ANC A;  2CWK A;  2DXD A;  5BXI A;  1EHW A;  4W98 A;  3VGS A;  3VGV A;  3BBB A;  3BBF A;  3MPD A;  3EM1 A;  3FCW A;  3BBC A;  3PRV A;  3Q86 A;  4S0M A;  1NDK A;  1WKJ A;  1NCL A;  3L7U A;  1ZS6 A;  1VYA A;  2DYA A;  4ANE A;  2AZ1 A;  1NDC A;  3Q89 A;  3ENA A;  3Q83 A;  3BH7 B;  3FBE A;  2BEF A;  3ZTS A;  1NDL A;  1NSP A;  2B8P A;  3R9L A;  3ZTO A;  4O0N A;  2BX6 A;  1HLW A;  1S5Z A;  4C6A A;  1WKL A;  4UOG A;  3EVW A;  1BE4 A;  3G2X A;  2DXF A;  3EVM A;  4CP5 A;  4F36 A;  1NPK A;  3EVO A;  3VVT A;  3VVU A;  3VGU A;  1NDP A;  3ELH A;  3ZTQ A;  4AND A;  3NGS A;  4UOF A;  4HR2 A;  5C7P A;  2HVE A;  3WX8 A;  4WBF A;  3B6B A;  1S59 A;  1F3F A;  1W7W A;  1KDN A;  2NCK L;  1NSQ A;  2HUR A;  2HVD A;  2DXE A;  1HHQ A;  3NGT A;  3FBC A;  4UOH A;  1F6T A;  3DKD A;  3BH6 B;  1LWX A;  1MN9 A;  3B54 A;  3GPA A;  4FKX A;  3ZTR A;  3EJM A;  1JXV A;  1UCN A;  1NHK L;  1B4S A;  3VGT A;  4DUT A;  4EK2 A;  3NGU A;  1MN7 A;  1NUE A;  4KPC A;  3Q8U A;  3NGR A;  3Q8Y A;  4ENO A;  1B99 A;  3PJ9 A;  2ZUA A;  1NSK L;  3ETM A;  1S57 A;  3FBF A;  1BHN A;  3EMT A;  2B8Q A;  2VU5 A;  1LEO A;  3FC9 A;  3ZTP A;  1K44 A;  3GP9 A;  3FBB A;  1XQI A;  2DY9 A;  1PAE X;  1BUX A;  4F4A A;  1U8W A;  3DDI A;  1XIQ A;  3FCV A;  5CAB A;  3EE3 A;  3Q8V A;  3JS9 A;  1NB2 A;  4DI6 A;  5IOL A;  1PKU A; 
#chains in the Genus database with same CATH topology
 3E01 A;  5DDR C;  1UA1 A;  1SKS A;  1N34 F;  2B51 A;  3FEY B;  2XLI A;  1IKW A;  2LXU A;  4DFM A;  4YDX A;  1CPZ A;  2OPR B;  3IRX B;  3M2V B;  5F8L A;  3HHN B;  2CFX A;  3AOA A;  1FX4 A;  1Q7L B;  5GMD A;  2ZHB A;  1R8A A;  4ZVE A;  2XZD B;  1M90 T;  1K73 T;  2G2Z A;  4ICL A;  1VIS A;  2DNN A;  5JJB A;  2AGQ A;  2FY1 A;  2PMW A;  3LP2 B;  2F4V F;  1GEH A;  4LQ9 A;  1W2B R;  1X4C A;  1REG X;  4KH1 B;  1WOP A;  2QSW A;  3POT B;  3UWT A;  2V8P A;  3J81 j;  1UVK A;  1S0O A;  5FLX U;  4NLG A;  1G2E A;  5KT4 A;  2G1H A;  4G1P A;  4JP8 A;  3SCL E;  2MEW A;  5CZX A;  4LRD A;  4IYQ A;  3GCX P;  4S0M A;  4F4K A;  2P9E A;  1QTN B;  1N33 J;  3PVX A;  3LOU A;  2GIQ A;  1Y7P A;  2VUG A;  2HIQ A;  2I38 A;  3QT6 A;  1U09 A;  4H4O A;  3WC0 A;  4ZHR B;  1QAI A;  1C4C A;  1NO8 A;  3BH7 B;  1GX5 A;  1QDU B;  3HT3 A;  2LEA A;  2VOD A;  1LWC B;  3GG0 A;  4FS1 A;  3ZTO A;  5L39 A;  2R7R A;  4IG0 A;  2E5L F;  2FZK B;  2MZS A;  2JX2 A;  1MRO B;  4DCJ B;  5HRO B;  4DCP B;  5KG7 A;  5D4P A;  1B0P A;  2AJ4 A;  3SDE A;  2HAI A;  2QMX A;  3CJQ A;  4C8K A;  2H3E B;  1P9Y A;  3BKF A;  3KLG A;  2ZJR Q;  3QMQ A;  4Q2L A;  2VC0 A;  5BR8 F;  3K17 A;  4CP5 A;  1TAQ A;  4F36 A;  4ED0 A;  4KHM A;  4OYI A;  4PXE A;  2ILZ A;  3QFH A;  2BRL A;  2B7B B;  2PN6 A;  2EFG A;  4Y2M A;  3MM5 B;  5EWF A;  2QLB B;  2BJ8 A;  4J91 A;  1HBO B;  2KT2 A;  1NRK A;  3ZTQ A;  2ZBC A;  4ZLP A;  5LOQ A;  4UOF A;  2FLO A;  4Q44 A;  3OTD A;  2AX0 A;  2MHE A;  4WBF A;  1H2T Z;  2DBB A;  1XR6 A;  4DX7 A;  4K50 A;  3FCH A;  1AUS L;  1FI4 A;  1SV5 A;  3VQT A;  5GMK a;  4AL7 A;  2MZ1 A;  3H5U A;  4OZJ A;  2J6S A;  2WVC A;  2K1R A;  4NLS A;  4I2Q B;  3OW2 R;  4DL2 A;  3H42 A;  2MKJ A;  2DPI A;  2F5G A;  2KI2 A;  4LSL B;  1O51 A;  2GQQ A;  5GME A;  1RT2 A;  2AHO B;  2QLF B;  1AB8 A;  1Y3K A;  4NOH A;  3DM2 B;  5F3T A;  4IQM A;  2E1P A;  3DKD A;  3F44 A;  3TZW A;  3MR6 A;  2QMW A;  2GQC A;  2JVR A;  1FTR A;  3WIU A;  1JLC B;  2IVM A;  2YVS A;  4P2S A;  1U1P A;  1UMJ A;  3EGZ A;  1RLD A;  2BOP A;  1IQT A;  4Y6I A;  3HM9 A;  3K8V A;  1ACM B;  1URN A;  1BQN A;  3KTQ A;  1EB0 A;  3K5P A;  5KFU A;  1EET B;  3VR1 A;  4CIO A;  3GV7 B;  1QSY A;  1N5Y B;  1UWB B;  4ECV A;  1QSS A;  2FQQ B;  5HRO A;  4ED7 A;  2HNY B;  3M32 A;  1HYS A;  4PG7 A;  4DV6 J;  4LFA J;  2P9C A;  1U48 A;  3DMJ B;  2ZBQ A;  3HLU A;  4PR6 A;  3U1L A;  4JI7 F;  2W7P A;  4X4V A;  1LWF A;  2KDO A;  3CC2 S;  1J5O A;  2UXC F;  1LEO A;  3ZTP A;  2YH1 A;  1T05 B;  1LQ9 A;  1VFJ A;  2HGL A;  3O2I A;  3A8E A;  4M1K A;  2W8L A;  4Q0B A;  3DI6 B;  2QMU B;  1UWA A;  1FD2 A;  2W24 A;  3N01 A;  4JOU A;  3H0P A;  2J7K A;  2ZBP A;  1RAO A;  4ZPW R;  3R3T A;  4Y00 A;  4CWB A;  2W4P A;  3PX4 A;  2AWZ A;  2F8M A;  4QWD A;  1SUQ A;  5CXT A;  3Q2T C;  1JNR B;  3CWJ A;  1RLC L;  2F9J A;  1RWX B;  2LDY A;  2ROE A;  3SSS A;  5LL6 d;  4K7Q A;  4C3L A;  4I68 A;  1HWJ A;  3GLJ A;  5CCM A;  2DNH A;  2D41 A;  5KG6 A;  5DDP C;  1VQP S;  1YIT S;  1FNO A;  3FSI A;  3CCJ S;  4O3S A;  2HIY A;  4ES1 A;  5KFQ A;  2N3O A;  2WW8 A;  3M8W A;  1RT3 A;  3PYF A;  3R7B B;  4FP9 A;  2DK2 A;  4I64 A;  4P72 A;  1S9F A;  4F2S A;  1Q8L A;  2VG7 A;  3T1Y F;  3IRX A;  3MR5 A;  3C19 A;  2CZ4 A;  4CO2 A;  4UOC A;  3HT0 A;  3R1H A;  2VON A;  3DU6 A;  4NXM J;  4OX9 J;  2IM3 A;  3AB2 B;  1Y10 A;  3DDK A;  3QAE A;  3QGG A;  3DOM A;  2PMH A;  4W98 A;  2FPH X;  1DQ8 A;  4ETZ A;  5FLX Y;  2R7S A;  3GE9 A;  4J9V A;  2ZVI A;  1RT5 A;  2RRA A;  2UUC J;  2BJ7 A;  3E2E A;  2RNE A;  4OI0 A;  4RUB A;  3ZXW A;  4BWM A;  1EX8 A;  1U8S A;  1TKX A;  4WIQ A;  4DJB A;  4WFB Q;  3FZB A;  5AJ3 F;  3PZP A;  2DRB A;  1PO6 A;  2E9T A;  4P9S A;  2HQD A;  2HFS A;  5KFR A;  3OR2 A;  3KHR A;  2AJQ A;  1H74 A;  2O3D A;  1YTY A;  1PG5 B;  4LF6 F;  2LA4 A;  3FBE A;  3CO0 P;  5K5M A;  1VDH A;  5D0E A;  1FHT A;  3DLL Q;  4NZ0 A;  3MED A;  4M5G A;  5J2N A;  4OZ3 A;  5JUM A;  3RAX A;  4FF4 A;  4ZPT R;  4DU7 A;  4KQZ A;  4KR0 B;  2QLX A;  1LFP A;  3NMR A;  1TFW A;  3MED B;  5C25 B;  2KT3 A;  4YY3 J;  5E3Q A;  4EEY A;  1H38 A;  2WBR A;  1NJW A;  1D8Z A;  2MQO A;  1RA7 A;  5KG2 A;  4BS2 A;  4EO8 A;  4C11 B;  2QO3 A;  1BE4 A;  3G2X A;  4TN2 A;  4YOE A;  1WG5 A;  1FJG F;  2QA1 A;  4FVM A;  1FVQ A;  1OS5 A;  3NCQ A;  5HMW A;  2KXN B;  2JH3 A;  2WVB A;  4KO0 A;  1VQ5 S;  3MDF A;  2L9N A;  1VK3 A;  2AYB A;  1WC1 A;  2IAJ A;  3BF4 A;  5H9E J;  1RT4 A;  2XB2 D;  2EBE A;  2GZO A;  2WSF C;  1QUP A;  3W5Y A;  5AE3 A;  4ZVS B;  3SCI E;  4R0E A;  3WX8 A;  1VBZ A;  2MZT A;  3GFH A;  4A8S A;  1IM6 A;  1SIW B;  3V4I A;  1S9E A;  1NSQ A;  4PWW A;  2HUR A;  2MST A;  5IV4 A;  2VIC A;  4ECZ A;  1VI7 A;  2GJF A;  3KXD A;  3LUY A;  5B0F A;  3DOM B;  4TQS A;  2CQI A;  5M2P A;  1VRT A;  2E29 A;  3FBC A;  1JLQ B;  3TAQ A;  1WOR A;  3TQE A;  3J7Z T;  3FSX A;  5B0B A;  2FVR A;  4IUF A;  2HKE A;  4JV5 J;  3M2R B;  2YWH A;  3BQ0 A;  5DDO C;  3LP0 A;  4G6V B;  2PI4 A;  2KTQ A;  1KTV A;  3MZI A;  1T02 A;  5L1L A;  4XIU A;  4CQ1 A;  2IC3 B;  1RIS A;  1V3S A;  3QO9 B;  1Y5L B;  2Z2Z A;  1NND A;  1S7I A;  2D7S A;  2IMO A;  4CDI A;  2NXC A;  3AXK A;  3OHB A;  1S0N A;  3HO1 A;  1JXL A;  2UXB J;  2I6W A;  4YME A;  3GYN A;  3MM6 A;  2QT7 A;  4M95 A;  3IR6 B;  3EMT A;  3TEG A;  1WHV A;  3UN5 A;  2CPH A;  1S76 D;  2SXL A;  1FRM A;  1WSR A;  5FII A;  5BR8 J;  1BQX A;  3LF0 A;  4L73 A;  1WJ9 A;  2OH2 A;  3SIP B;  1SJF A;  1JLG A;  2GFF A;  3S1T A;  2V67 A;  3OXL A;  4AQY F;  2B9E A;  2NXE A;  1BUX A;  2X51 A;  3DMJ A;  1SIZ A;  2JOQ A;  5HAN A;  2ZE2 A;  1VBY A;  1NME B;  2B5J A;  2OSR A;  2FVP A;  4CLU A;  3AXM A;  6FD1 A;  5LSL A;  3R6G B;  2YTC A;  3KUH A;  1D09 B;  2P6T A;  3OL7 A;  1UWB A;  4DV5 F;  3BV8 A;  2CZV C;  2YNH A;  4M5N A;  3VQS A;  4WFA Q;  4ZPV R;  1KVJ A;  3D4J A;  5D0H A;  3MI7 X;  3EIC A;  4J90 A;  3H4D A;  1PSD A;  3GWC A;  1NLK L;  1A0O B;  2APO A;  3QPI A;  1O0P A;  2CAD A;  3SV4 A;  3TEH B;  1FT8 A;  3FEX B;  3Q2S C;  1QE1 A;  5CQG A;  2G0I A;  2UUA F;  2RML A;  3DXB A;  5KG4 A;  3QSI A;  1WC3 A;  2C2E A;  3G82 B;  4K4Y A;  2JEG A;  2DIU A;  2UZA A;  3I4H X;  2HLT A;  3MMA B;  4ZCK A;  1UVL A;  1SH0 A;  2DXD A;  2J9D A;  5B0G A;  4I67 A;  2BAN B;  4X64 F;  2DGV A;  1KKH A;  4LFB J;  3G82 A;  3D1Q A;  2KL8 A;  5I42 B;  3L7O A;  4RBV A;  3H5Y A;  2CQ0 A;  4MIB A;  2CPD A;  3BBC A;  3GZ7 A;  3IN5 A;  3B4D A;  1NJX A;  1RTH B;  1VYA A;  1BQM A;  2DYA A;  2RUG A;  4PXC A;  5CA5 A;  4UY8 T;  3T1Y J;  2MJU A;  3ENV A;  1T05 A;  4DX6 A;  4IRC A;  1J5E J;  3EGN A;  2HQG A;  2MQL A;  3ENA A;  4LJM A;  4P74 A;  2UU9 J;  1S99 A;  4B3T F;  1B0T A;  1HNI A;  4NLW A;  1NPR A;  3M8Y A;  2H1Y A;  2V63 A;  4O4G A;  2MGZ A;  1VQM S;  4J9Q A;  1SQF A;  4N8N A;  3VV2 B;  4QPX A;  1S4E A;  2QRR A;  5K20 B;  3BDP A;  3CCZ A;  3NNA A;  4I1T A;  2V4J B;  3M30 B;  1U6Z A;  2V9K A;  4WCE Q;  3D2W A;  4TYA A;  5AXL A;  2P5V A;  3BKU A;  5IXU A;  3HUL A;  4JI7 J;  3BQ2 A;  1N6Q A;  4HI1 A;  2GML A;  1N88 A;  1VQ6 S;  2BW2 A;  3OTO F;  2XGQ A;  3DGV A;  1DHM A;  1NHU A;  3MEE A;  4HH1 A;  4PCQ A;  5K14 A;  2JFK A;  3T9N A;  5JMN A;  1YJT A;  3CO9 A;  5IT9 U;  1KHW A;  3DLK A;  4OLP A;  3VGU A;  1FXR A;  3UCU P;  2RU3 A;  1JJ4 A;  4AND A;  2J7W A;  1IR0 A;  1CJK B;  4K0K J;  4PAA A;  2H54 B;  2JWN A;  3R97 A;  2E1A A;  2YWF A;  4Y65 A;  3H98 A;  3B6B A;  2M7S A;  4ID5 B;  4ZN1 A;  4LF9 F;  2LKZ A;  1FDN A;  2AGP A;  1VIX A;  4AXI A;  4E0D A;  1R6Y A;  1K1Q A;  2QE5 A;  3HHL A;  3OR1 A;  1DRZ A;  3RB6 A;  3JB9 k;  4UOH A;  1TL4 A;  4LIR A;  1OY9 A;  2LEB A;  1F6T A;  4D3G A;  1UFK A;  5CD4 H;  2XMM A;  3HHK A;  1YQH A;  3V4M A;  2HYI B;  3OTE A;  2HHH F;  1L3U A;  2VC1 A;  2G2Y A;  3K58 A;  1UCN A;  2DGQ A;  3I9V 9;  1CJU A;  1FO1 A;  3BDE A;  1JXE A;  3KUG A;  2ZVS A;  3IAS 9;  4ILR A;  4UF4 A;  1MU2 B;  1S1X B;  1VQO S;  4HT7 A;  1C0U B;  2YKO A;  4LUB A;  2OLW A;  4K8R A;  4ZVU B;  3MMB B;  2ZM6 J;  2HWH A;  3MM7 B;  4RNN A;  1CUL A;  1HNV A;  1RT1 A;  3V81 B;  3J81 Y;  3SZ2 A;  3US5 A;  1HHS A;  1XMB A;  2K3K A;  3FRZ A;  3EXY A;  5LSR A;  4MMO A;  2W8K A;  1HI1 A;  3W8P A;  4B9S A;  1JLF B;  1RAD B;  2DGS A;  1N5Q A;  2ZFH A;  3GP9 A;  3ICL A;  4MAK A;  4B3M J;  1DLO B;  1WTF A;  1KBR A;  2YH0 A;  4KKO B;  2WSC C;  3IG1 B;  4PG8 A;  3C14 A;  3PHE A;  5KFC A;  2BQR A;  4LF4 J;  4ECS A;  4RZR A;  3PKY A;  2MKI A;  4PYA A;  4FZV A;  2POK A;  2WVD A;  4C48 A;  1FRX A;  5LMN F;  4A8K A;  3KJV A;  3OUY A;  4DSE A;  4K4S A;  3SCJ E;  2YNG A;  1ZAV A;  2DH9 A;  4TY8 A;  1VC5 A;  2IVY A;  2DNP A;  4DI6 A;  3MAA B;  4TU8 A;  3E51 A;  3H7H B;  4KAI A;  1HI8 A;  2Q6B A;  1CS4 A;  2GA7 A;  2XSJ A;  3EDQ B;  5HJX A;  1U1K A;  3PO5 A;  1CJT A;  3CJK B;  1S1V B;  1RI7 A;  3DLG B;  4K5S A;  4ECR A;  2A18 A;  4KPY A;  1S48 A;  3QLH B;  3SQG B;  2CNO B;  4HHU A;  1N5V A;  1FKP B;  1NPP A;  2AZ3 A;  3Q22 A;  2IBK A;  1PIE A;  1WHY A;  3SCK E;  2ZZM A;  3HP6 A;  5B09 A;  3VAG A;  1U1M A;  2K7J A;  4CLT A;  1IR2 A;  3SMZ A;  2WBM A;  4ZCM A;  4EFA C;  3DRP B;  2I0X A;  4NYP A;  3U02 A;  3VGV A;  3GIK A;  4DQR A;  1QUV A;  3MPD A;  2O1P A;  3FRY A;  1OY6 A;  2JRS A;  3CMQ A;  3PNI A;  4QU7 A;  4OYM A;  1YK9 A;  2E9Z A;  2Y1L B;  1N32 J;  2CQG A;  3ZZ0 A;  4C2M A;  3Q86 A;  2RB7 A;  3WX4 A;  3BGL A;  1S0V A;  1YI2 S;  2DIT A;  1WDT A;  4Q45 A;  2CKW A;  2RU9 A;  3TQ1 A;  4KYZ A;  4CM2 A;  3I0R B;  5CZV A;  2MY7 A;  2L9W A;  1ARO P;  2D1C A;  2W2N P;  3GTY X;  2W2Q P;  1R31 A;  1FDA A;  5IT9 Y;  1HW9 A;  2VKZ G;  1NK6 A;  2ZZT A;  5DM6 Q;  4B3O B;  1LNQ A;  2FGO A;  3CJ0 A;  3ET6 A;  1S97 A;  1SKR A;  2HHS A;  1MW7 A;  2MLZ A;  3R8Y A;  2ADC A;  2HEK A;  1NSP A;  1FX2 A;  1UEV A;  1OY8 A;  1YDL A;  2HRT A;  2UV8 G;  4H4K C;  1WEY A;  5F0W A;  3W9H A;  4NRT A;  4EI2 A;  3G96 A;  1LW0 B;  3LP1 B;  2PII A;  2R8I A;  1RAB B;  5MLC V;  3EZ5 A;  4DV0 F;  4C4W A;  3T6B A;  5H9F K;  3KG4 A;  4DPO A;  5AE2 A;  3PAC A;  2Q79 A;  1AFJ A;  1YG0 A;  3ONQ A;  3OVS A;  3K5N A;  3PTW A;  1RBA A;  3UI3 A;  3B82 A;  4LF1 A;  4RW4 A;  2DR8 A;  3IRW P;  2L08 A;  3G6Y A;  2LA6 A;  3CJ2 A;  2XYG B;  1SQG A;  4LT6 A;  2DNY A;  1HBU B;  1X4B A;  2XMJ A;  5J2P B;  1KOH A;  3D5M A;  3UE2 A;  1ZPW X;  3QBC A;  4QJV A;  3KHG A;  3RB3 A;  1VC6 A;  1IUJ A;  1VCT A;  5GAE I;  1S1X A;  5L1J A;  2LVW A;  5C7P A;  4N76 A;  3E3X A;  1GXT A;  1ZYQ A;  3DLE B;  1TL5 A;  2F4F A;  3AD8 C;  3R5G A;  3M8R A;  4JI0 F;  3QJJ A;  1F3F A;  1K47 A;  3OL9 A;  1PIL A;  2YX1 A;  2HNZ B;  3HJV A;  5DQI A;  2FC8 A;  3G8Q A;  2HMI B;  3TJ8 A;  2XSF A;  2R8K A;  4O3R A;  3GMG A;  5IWA F;  4UW2 A;  2RSQ A;  4URQ U;  2WRM A;  5C42 B;  2AD9 A;  4AFF A;  4TLR A;  4B9V A;  4FKX A;  1TK0 A;  2VG7 B;  1Z1Z A;  2X3G A;  3A13 A;  4NXN F;  3EJM A;  1PAU B;  4I6W A;  4DV0 J;  2FZG B;  5B0A A;  1XNR J;  3J7A N;  1X5P A;  2CQH A;  4DUZ J;  2R7T A;  2DT9 A;  1Z2L A;  1P8G A;  1TP7 A;  2VFR A;  4KV8 A;  4PWD A;  3K2Y A;  4RNM A;  3WIV A;  1U6F A;  3LWM A;  5T7L A;  2EG2 A;  4FF3 A;  3UFC X;  5EX0 A;  1DAX A;  1ZAX A;  2CQ2 A;  2HHP A;  2LXF A;  4OX6 A;  5E3A A;  3RRK A;  1XNR F;  2MXY A;  1G4C A;  1XK8 A;  5A2Q Y;  4EBC A;  3LPY A;  2PFF B;  1F9E B;  1RE1 B;  4B9L A;  4OYA A;  2KZZ A;  1G6B A;  2ZH7 A;  2NZ4 A;  1P9Q C;  1DUR A;  2HRY A;  2NUU G;  3DC2 A;  1FK9 B;  4F4X A;  3DLJ A;  1NJI T;  3MR3 A;  2VDI A;  4BLG A;  1TL3 B;  2HSE B;  4NLV A;  3RTV A;  2Q3P A;  2VPY B;  2EC0 A;  1R8P A;  3BN7 A;  3KYL A;  4LF9 J;  4W92 B;  2BQU A;  2Z0G A;  4QYZ J;  1WC5 A;  2QL9 B;  5KG0 A;  3N28 A;  1QAJ A;  1VRU B;  3DOL A;  4N5S A;  1G1X A;  4O3P A;  1TKT A;  1DTT B;  3GJS B;  3M6U A;  1CJU B;  1KVK A;  2N3L A;  3N0V A;  1SVD A;  3CJR A;  4RX6 A;  4AL6 A;  3T5K A;  3CXC R;  1XMQ J;  4PWU A;  3NKY A;  3W2V B;  2K3I A;  4C97 A;  1RT6 A;  2E7W A;  1HIY A;  3NY0 A;  4DV1 J;  4DV3 J;  4ED6 A;  4B9N A;  4P2M A;  2RH3 A;  3ENQ A;  4NLD A;  4OZN A;  2CWK A;  4OV6 A;  1Q78 A;  4ZVQ B;  1U0S A;  2IRY A;  4QPT A;  4NLR A;  3TP2 A;  1OSC A;  3I55 S;  1T94 A;  2C42 A;  4KV8 B;  2QLW A;  4IFV B;  3ZO7 A;  3DRS B;  2FD2 A;  3AD9 C;  1BD6 A;  1U4B A;  2YKM B;  4DSJ A;  5SUH A;  3H2L A;  1FJE B;  3FCW A;  1UZD A;  1U24 A;  2PGC A;  2B9W A;  4PEO A;  2FDN A;  2IFX A;  2KJV A;  4P71 A;  1Q1K A;  1M1G A;  2FHJ A;  4BCA A;  5I42 A;  2KFN A;  1PBU A;  3OL8 A;  1VC0 A;  3PR4 A;  2BE2 A;  2C2M B;  3CJS A;  3CJ3 A;  3H2V E;  3SSR A;  3ZZU A;  1X4D A;  3Q89 A;  4XO0 A;  4X4P A;  1TKZ A;  1IKY A;  3SEO A;  2P6S A;  5CHC B;  1X4A A;  4XPC A;  1WHX A;  1PYS B;  4KGZ B;  2CNN B;  4CCH A;  3BGO P;  3A1Y G;  4X62 J;  2B8P A;  4D3H A;  3W9J A;  2W9C B;  3MEC B;  5DG9 A;  1LWE B;  2KYX A;  4J9O A;  1S1V A;  2UUC F;  3KLE A;  2QC3 A;  4FF1 A;  2COL A;  4NX9 A;  1PJ7 A;  3HHE A;  1U1N A;  1TK5 A;  3CMA S;  3A8K A;  4KY3 A;  1H7W A;  1XNQ J;  3MM8 A;  4UTG A;  2Q66 A;  1IN0 A;  3BN4 A;  3UN3 A;  4A8X A;  5GAE U;  1Q82 T;  3UPF A;  4PYD A;  3QT7 A;  2QGF B;  3OJU A;  3KJV B;  1C1B B;  1I3O B;  3EVO A;  4IOA Q;  1RWM B;  1S6U A;  3N5B A;  3UO0 A;  1UPM B;  2BZ2 A;  3OXF A;  2GVD A;  2GMJ A;  4ZHR A;  3QT5 A;  3UCZ P;  3EUN A;  1HFE L;  1GTE A;  1TL1 B;  2EFP A;  4M5H A;  4NXM F;  3TUJ C;  3UR3 C;  3H25 A;  3B8H A;  4JI6 J;  1ROF A;  1T9W A;  4U96 A;  3TRG A;  5F3Z A;  4F50 A;  2EKN A;  2CQP A;  2KVI A;  2OPR A;  2XGP A;  1RTJ B;  3BS9 A;  1N5T A;  4LR9 A;  4CLP A;  3FMB A;  1NH7 A;  1KEK A;  1Y3J A;  1N5S A;  4DN9 A;  1NXI A;  1HHQ A;  3D9B A;  3U27 A;  1R8H A;  5DG7 A;  2FJX A;  2ABY A;  4P73 A;  2VJV A;  4YB6 A;  1Z4U A;  3OHA A;  1ZET A;  4MTP A;  2HBR B;  2HMI A;  2WHO A;  4QOT A;  1KOO A;  3M9N B;  1FRH A;  2OPP B;  3OFH A;  4ZCL A;  3LGM A;  5GAD I;  1K1S A;  1UVM A;  2XBP A;  1RHJ B;  3P5B P;  2N7C A;  2RDD A;  2B0G A;  3A12 A;  5DM7 Q;  1HBM A;  2OMO A;  1RT5 B;  4LF8 F;  3V6H A;  4IOB A;  3S7R A;  3DFE A;  4GC6 A;  1HD0 A;  1AYE A;  4DSL A;  1JLE A;  3QAT A;  2WOM A;  3M8P B;  1CEZ A;  3DLB A;  1U2F A;  4X66 J;  3V6J A;  2HGM A;  2VOP A;  1JJ2 R;  1H6K X;  2BJ3 A;  4LF8 J;  1F0X A;  4C11 A;  4QIV A;  4OIX A;  2WON B;  3R7N B;  3FC9 A;  3G4S S;  3C6T A;  4JV5 F;  2CJQ A;  1RQ0 A;  3KNA A;  5DET A;  3KKF A;  3JSB A;  1TUW A;  4NXN J;  2DY9 A;  1RHU B;  1X60 A;  3DDN A;  3HVT B;  2KJW A;  3NNC A;  1OQ3 A;  3C16 B;  3CJ8 A;  3M6V A;  3GJR B;  4HAC B;  1F5B A;  2Q1L A;  3O6Q A;  1IR1 A;  3IO1 A;  3QNW B;  4F4A A;  2QA2 A;  2F4V J;  2GVZ B;  4WK1 A;  3ZZT A;  4F3Q A;  1ZTT A;  3MCN A;  1TV6 B;  4KBI A;  5B7W A;  1FDD A;  4P2X A;  3TZZ A;  2EBG A;  4M5D B;  5G0R A;  2X1A A;  1IM4 A;  5FJ4 A;  5J2N B;  3D1H A;  3L9Z A;  3GIR A;  4FKY A;  4GVB B;  5B0E A;  1KHV A;  2CQC A;  3MFH A;  2VG6 B;  5A6P A;  1GNK A;  4B08 A;  1S79 A;  2DR6 A;  5KT6 A;  4EZ9 A;  2HS3 A;  4RUH A;  2M8D B;  3IGV A;  5DG8 A;  3OJS A;  4YY3 F;  1JKH A;  1KWM A;  1MG7 A;  3HF5 A;  3IAM 9;  2OFG X;  4KT0 C;  1WF1 A;  3CDW A;  1RAC B;  3MPU B;  3CDU A;  2VZ9 A;  3U1M A;  2BKN A;  1Y5I B;  4B17 A;  4GRS A;  3EM1 A;  4NRU A;  4FYY B;  1RTH A;  3IM8 A;  4FNI A;  1HQU A;  4F0K A;  5KFX A;  4DN0 A;  3JYT A;  4AL5 A;  4AUK A;  2LQ8 A;  3VZH A;  3QGP A;  4F0M A;  3JTP A;  4KJI A;  3W1Y C;  1H2U X;  2PC6 A;  2YXL A;  2FTR A;  3KK1 A;  5HVG A;  2W9B B;  4DBQ A;  2GQ2 A;  2XSJ B;  1SPB P;  2MMY A;  4DS4 A;  2XCA A;  3OSP A;  4J9M A;  3NRB A;  1HR0 F;  4HDH A;  2W7A A;  4JI0 J;  4JV2 A;  3SSQ A;  4GKJ F;  3VAK A;  3ZNU A;  1FKO A;  5CYQ B;  4LSN B;  4V19 X;  3FNN A;  4ZJQ A;  5L1I A;  4OZ2 A;  3I5A A;  2XMW A;  3VAM A;  4F67 A;  5J1P A;  3ADA C;  3L3C A;  5H9E K;  4J5O A;  4QIG A;  2PMZ D;  2V2V A;  4QWA A;  2BX6 A;  1WF0 A;  2Q43 A;  4ILM A;  3DRS A;  4RBU A;  2MZR A;  1AFI A;  4NA3 A;  2ZKU A;  2JLG A;  4CLL A;  4Q0B B;  4E2F B;  4MK9 A;  3R6L B;  3MEE B;  1ZBT A;  2W01 A;  3M8Q B;  3PYE A;  2XY6 A;  5FDL A;  3LWL A;  3MOJ B;  3CDB A;  4OYP A;  1DTQ A;  1ZAW A;  3ILO A;  1R6V A;  2G1D A;  2HLU A;  2RRN A;  3D1O A;  3D7S B;  3DI6 A;  3P45 B;  4LRF A;  2CQB A;  4O4R A;  5KFE A;  3UD3 P;  2V8D A;  3EXC X;  3MD3 A;  2A3J A;  3DOL B;  2BW7 A;  3BYR A;  1N36 F;  3D6F B;  4DUY J;  5DLG A;  1S72 S;  2NPI A;  3CE8 A;  1S59 A;  2CWX A;  1HQ2 A;  1OQ6 A;  1RAG B;  3N5F A;  4IO9 Q;  1W7W A;  4ECY A;  2QA4 G;  2HZC A;  2QL5 B;  4ZP7 A;  3V2U C;  3M9O B;  3A8I A;  5IQQ A;  2VOO A;  4JI3 J;  2IRX A;  4YB5 A;  2PA3 A;  3D6H B;  3MF5 A;  4I2Q A;  3IBW A;  3M4X A;  4G3I A;  1VJW A;  1A7G E;  3O8W A;  3K5M A;  3GB0 A;  2BMB A;  3CSK A;  4ZVR B;  1MSW D;  2FHM A;  5J1N A;  3J7Y I;  2UVU A;  2XZW A;  2VFS A;  3M8Z A;  2EEY A;  3MPW A;  2BM0 A;  4PXB A;  4ZP6 A;  5D78 A;  1GQE A;  4J7C A;  5THW A;  3V5R A;  2JEI A;  2DTJ A;  2BE2 B;  2F8H A;  2RQ4 A;  4OYX A;  5ETL A;  3RW7 A;  1UFW A;  5IM0 B;  4DDF A;  2EK6 A;  3OD2 A;  2J76 E;  4ZVT B;  2W9B A;  4ERD A;  2ZDO A;  1S9E B;  1UEK A;  2EKY A;  3KHH A;  4IO1 A;  2YKM A;  1RKI A;  2E1R A;  1M5S A;  3M2V A;  3M9M B;  2O66 A;  4CLZ A;  4CTA B;  4ECW A;  1F1B B;  2DHG A;  1FWK A;  2OUG A;  4AD6 A;  4P7V A;  1GFW B;  3J7Z 5;  1JKH B;  3ITH B;  2K2P A;  2MGZ B;  2OP5 A;  2XHW A;  1RP5 A;  2B5J B;  3JQM A;  4USI A;  1Q5V A;  2QFJ A;  5I4M A;  2AT1 B;  4H4M A;  1LK7 A;  1LWC A;  2QTW A;  2RDJ A;  3DDI A;  1VQ7 S;  2PE8 A;  3D3C J;  1RTD B;  3W7B A;  1HWI A;  1QAX A;  1HWU A;  3HXM A;  1EJ7 L;  1T9T A;  4MKV A;  4PZV A;  1XBW A;  2ZH5 A;  2E5I A;  4FBU A;  3H90 A;  4K4T A;  2M4M A;  3KUE A;  3MEC A;  4IH7 A;  2KFY A;  3MUT P;  1FFS B;  4TNO A;  1DTQ B;  1JMT A;  3KJN B;  5DO2 A;  3AOC A;  1JIH A;  3LTO A;  1HW8 A;  1RHM B;  3W61 A;  4DSK A;  4DL0 C;  4DZ6 A;  1L5U A;  3CC7 S;  3H8Y A;  3BO2 A;  2H5I B;  3NOG A;  1MLA A;  3RB4 A;  3VF0 B;  5HJY A;  1K9M T;  2LCW A;  2BM1 A;  4JI8 J;  1SCJ B;  1I1G A;  2IRU A;  3AY0 A;  1U1R A;  2O67 A;  3HD1 A;  4JB8 B;  3EDR B;  1QE1 B;  1NBE B;  3BGF A;  4WYL A;  4WZM A;  3NS7 B;  1NK8 A;  1IBK F;  2AV5 A;  4LF5 J;  4FDF A;  4NCB A;  1T3O A;  1BMQ B;  2Y8W A;  4CLS A;  1JLQ A;  5K8P A;  4LQ3 A;  3JSY A;  4LF2 A;  4M63 A;  4NLP A;  4PWD B;  2V9W A;  4WTO B;  3BYP A;  2R2U A;  1WOO A;  4U7U D;  2ZDP A;  5C5J A;  1VQ4 S;  3NP5 A;  1T3N A;  1M5V C;  2GHW A;  3HFK A;  2C2N A;  2YNI B;  4GO5 X;  3T5J A;  1ZM2 A;  1JLG B;  1NJY A;  4CLF A;  4MJK A;  5LMN J;  2MZJ A;  1N0U A;  4NYO A;  1HQE A;  1LFW A;  2KO1 A;  4GVB A;  4I2P A;  3RJM B;  2DCU B;  4CZC A;  3KK3 A;  5ETT A;  3G6E S;  2NQP A;  2KXH A;  4HT5 A;  3EGV A;  3GON A;  5IV3 A;  4P2F A;  4WF9 Q;  1RAJ A;  1WKL A;  1RK8 A;  2AEM A;  4OZL A;  1GT8 A;  1LK5 A;  2DRD A;  2FUG 9;  4L3K A;  4ZJO A;  5SZT A;  3P8B B;  4RW4 B;  5C25 A;  4Z7Y A;  5E5N A;  4EWT A;  4PG4 A;  2B3T B;  1JLA B;  1GAO A;  2CZ9 A;  3C16 A;  1U45 A;  2IMW P;  3MXH P;  3S8S A;  1JWW A;  4M5J A;  4OZ1 A;  2ZKT A;  2M5Y A;  1U47 A;  2HS4 A;  4KRW A;  5B0C A;  5F8G A;  2OTL S;  3R27 A;  3E8O A;  4BHQ A;  3BSO A;  2KFZ A;  2F40 A;  3J7Y U;  4F2R A;  1DFD A;  3LPE A;  5D0G A;  2OPQ A;  2UV8 A;  1IQZ A;  4DS5 A;  1RDR A;  3FK4 A;  4QYZ K;  5D6G A;  5HSP A;  4BDP A;  2HVD A;  4YEA A;  1KVI A;  3CCW A;  2OEL A;  1RWN B;  3D67 A;  4NZ7 A;  1PJ6 A;  2CJK A;  4NZ6 A;  4FNH A;  1FFG B;  2W4C A;  3UDE A;  4DZD A;  2ZJP Q;  1KC8 T;  2FLL A;  3GU0 A;  5IQ6 A;  2DJW A;  2FHJ D;  1DLO A;  3BSA A;  1WTB A;  4JI2 F;  3W66 A;  3ILI A;  1HMV A;  2PDA A;  3W8G A;  4IRD A;  1VJQ A;  2HFN A;  3ET6 B;  4CH1 A;  3JYT B;  1P1L A;  2ATL A;  3MEK A;  4XPE A;  3TX8 A;  2V34 A;  2I9S A;  4OHX A;  4EK2 A;  1V5I B;  3I0R A;  5ETN A;  2OEJ A;  5HN0 A;  4K4X A;  2NS1 B;  3G6V A;  3Q8Y A;  1VOM A;  5LM7 E;  4KHP J;  1MU2 A;  1XR7 A;  1FE0 A;  4FVC A;  1EP4 B;  4ATN A;  2NSC A;  2ZUA A;  1GMW A;  3PFE A;  3OV7 A;  4NMX A;  4FS2 A;  4DSF A;  3DRY A;  4OFZ A;  2DR7 A;  3DHW C;  3GR1 A;  3OFF A;  4RL1 A;  4LMZ A;  2I8E A;  1SB6 A;  5IZH A;  4X65 F;  2HK2 A;  4KHR A;  3EX7 B;  4RUA A;  5KOX A;  4CT9 A;  3DNC A;  4Y2K A;  3OFE A;  4I6Y A;  4A48 A;  3G87 A;  3SYZ A;  1KFS A;  4K4Z A;  1YRT A;  3K7R A;  1CS4 B;  4LRB A;  3W5X A;  3IM9 A;  3MD1 A;  3AT1 B;  2P9G A;  3QWU A;  1R0B G;  1SH3 A;  4X4N A;  4TU9 A;  2VQE J;  4LF7 F;  1T8E A;  3TJA A;  3U7J A;  4A8Q A;  2YNG B;  4TY8 B;  2R7W A;  4K4V A;  4IR1 A;  1XIQ A;  2DGT A;  2C3P A;  2FLP A;  4LFB F;  2RKI B;  2VBZ A;  1FJ7 A;  5IFM A;  2CAJ A;  4DL4 A;  3R5A A;  5F8M A;  3T3F A;  3SDE B;  5DZ7 A;  3HPO A;  4X4T A;  2GVD B;  3PR5 B;  3BEG B;  3A3O B;  3IG1 A;  3NCR A;  1MMD A;  4C8Z A;  2F3J A;  1H3D A;  2XYH B;  4WP8 A;  3M2U A;  5JXS A;  4X4Q A;  4RNO A;  4WPA A;  4GKK F;  2PEB A;  4L72 B;  4WII A;  3C15 B;  3PYG A;  2HFU A;  1Q81 T;  2R8H A;  1YJ7 A;  1D1U A;  3KWM A;  1XNQ F;  3C14 B;  1HNV B;  3RBZ A;  3V81 A;  1J27 A;  1V9O A;  1VGY A;  2FY8 A;  2XMV A;  3CVK A;  4M5K A;  4MT1 A;  4DFP A;  1BQN B;  1KON A;  2OML A;  3BSC A;  1S1T B;  2E66 A;  4QR2 A;  2M0G B;  4CLW A;  4Z2X A;  4Q43 A;  1UET A;  4CI0 B;  4ZKA A;  3A3P B;  1KRP A;  1RT3 B;  3I4P A;  3R5J B;  2FC9 A;  2YY3 A;  3G8T A;  4DV4 J;  1NDK A;  4ZCI A;  1ZPV A;  1P27 B;  1RT2 B;  2XEX A;  3FVY A;  1RA6 A;  1R3N A;  1G7C B;  1E6Y B;  2IM2 A;  2KKH A;  2EWH A;  2DEI A;  4OHV A;  4Q2M A;  4USV A;  4J9P A;  5G4D A;  4I4B A;  4OI1 A;  3CUL A;  3DCA A;  2HHW A;  4CTA A;  3HHL B;  2ZWP A;  2UP1 A;  1UVJ A;  5J1E B;  4C7Q A;  3KJF B;  2MKY A;  3THP A;  4RU9 A;  2GS8 A;  3OVB A;  4I7F B;  2BRK A;  4LVO P;  3WC2 A;  1SJ4 P;  3ZZR A;  4FYD A;  2WZ1 A;  4MYT A;  1HWL A;  2BBE A;  3HKZ D;  4K2X A;  4OZ0 A;  5T41 A;  4DX8 H;  3JSM A;  4JBC A;  2RF2 A;  4MFB B;  3V6D B;  2HG4 A;  4I69 A;  4KTQ A;  2FIU A;  3NG8 A;  4K59 A;  4Y3C A;  3TA1 A;  5KFJ A;  1NEE A;  1LWF B;  1J5O B;  4H54 A;  2A2D A;  2IJF A;  2RD5 C;  3KLI B;  4OYB A;  2D69 A;  4DL7 A;  3EVM A;  2ASL A;  2PSZ A;  2Y8Y A;  4EGL A;  6AT1 B;  4OMF G;  2HQ3 A;  5HK4 A;  5LMU J;  1NU4 A;  1QY7 A;  2C2Z B;  3IR7 B;  3MUV P;  4X66 F;  5HLF A;  1NDP A;  5DQG A;  1OPZ A;  5EHH A;  1JLA A;  2VPZ B;  5FD1 A;  4YHH J;  1JLF A;  3OBI A;  3T5L A;  1F2H A;  1GMV A;  1OYD A;  1UJ6 A;  2YKN A;  3MCS A;  4FPR A;  1S0M A;  2DHA A;  2UVR A;  5M2U A;  1KQS R;  1Q16 B;  5HQ8 A;  1X8D A;  3DU5 A;  3AJD A;  3QIP A;  3OLB A;  1OYE A;  2Y0B B;  1OMS A;  1UAW A;  1PCA A;  4K4U A;  1JJH A;  1XJW B;  1FCA A;  4QR1 A;  5CYJ A;  1AA1 B;  3KLH A;  1Q79 A;  5EX3 A;  3W9I A;  2HFZ A;  3IWX A;  5A8K B;  3CT9 A;  3CPW R;  2UXC J;  3RUB L;  4JI5 J;  1QSL A;  3TWZ A;  2HZV A;  1Y4Z B;  3W3S A;  4OI4 A;  2DHX A;  3JTO A;  1PGZ A;  3M8S A;  1S9G B;  4U7C A;  1NH8 A;  5T7L B;  2CPJ A;  2H65 B;  1DY3 A;  2MYF A;  3I0S B;  3LQV A;  2CG4 A;  1RT7 A;  4FYX B;  2BVZ A;  1RWU A;  1YVF A;  2XNQ A;  5KG3 A;  3EPI A;  2CUY A;  4RLE A;  2YQ1 A;  2ASY A;  5KFV A;  3KMQ A;  1SI9 A;  1OSD A;  2VFU A;  3CNQ P;  4DV1 F;  3ETM A;  1UEU A;  4USK A;  5LXR A;  4F3O A;  1EQM A;  2OAU A;  2C2K B;  4HYK A;  1XN9 A;  4LBI A;  4A8O A;  3B4M A;  4CLK A;  2VU5 A;  1N48 A;  1S6Q B;  2CPI A;  4M5I A;  4WXO A;  1VHI A;  2B6A A;  4PQU B;  1MRO A;  3DLK B;  1IBM F;  2Q6C A;  3H2U B;  2OD4 A;  4P75 A;  4UUW A;  1RU1 A;  4O44 A;  4YB1 P;  4USM A;  4Y28 C;  3Q23 A;  4JI1 J;  1S77 D;  1R0C B;  4OX9 F;  4YR2 A;  4QWC A;  3TAR A;  1IWA A;  2ADB A;  2RQM A;  1FK9 A;  2V68 A;  4XAK A;  1JJC B;  2Y1I A;  1U02 A;  2Z30 B;  1REV A;  1VBK A;  3G86 A;  4OLO A;  4RO0 A;  3TVZ A;  3CJK A;  1C0T A;  2LU2 A;  4ED8 A;  4UQT A;  4ZA1 A;  5ETV A;  5AXK A;  2D9P A;  4CO5 A;  4X65 J;  2F1F A;  1X5O A;  2N4C A;  3PW5 A;  2HWI A;  2G4B A;  2RS2 A;  5AXN A;  2OO4 A;  4IG3 A;  3GII A;  4DV7 J;  1R0A A;  4KC5 A;  3NGD A;  2RJZ A;  4WTY A;  5EDW A;  3EGW B;  3G6X A;  4RW7 A;  3R1L A;  3J80 U;  4NCG B;  1W26 A;  1VK8 A;  1VHF A;  2V69 A;  7FD1 A;  2XUL A;  5CD4 A;  3BB5 A;  2RIJ A;  3CJ4 A;  4RR5 A;  1H7X A;  2FJE B;  1N52 B;  4J37 A;  4RW8 A;  1O6X A;  3ZZO A;  4DPY A;  3JSM B;  1YJW S;  3CD6 S;  2BAB A;  3P5T L;  4LSZ B;  3HSZ A;  2VQF J;  4MIA A;  1GTH A;  1Y9O A;  4QQB A;  1I5O B;  2ZJQ Q;  5IT4 A;  1A9N B;  4LSN A;  2AJ2 A;  2I5J B;  4ANE A;  1FNX H;  4C3K A;  2DNQ A;  4GKK J;  4DV7 F;  1RBL A;  1KQF B;  4USJ C;  4DHV A;  2VDH A;  3BQ1 A;  4L76 A;  5C24 A;  3BRE A;  2NYH A;  3CCL S;  1SXL A;  2ROG A;  1KTQ A;  3D68 A;  2MKC A;  3D6M B;  2QEX S;  2Z4P A;  1VMB A;  3NAH A;  1X0P A;  2CJA A;  2AJ0 A;  3GFY A;  4NI2 A;  3BR9 A;  4DR6 J;  1D3W A;  4TYB A;  4ZIT A;  4O0I A;  5KFF A;  3M1V B;  3KLF B;  3CME S;  4HVZ A;  4C6A A;  3CC4 S;  3C15 A;  4NI2 B;  4AXJ A;  1RAH B;  1JLB B;  3O44 A;  5H9F J;  2AQ4 A;  1SL2 A;  3KJQ B;  2Z8Q A;  3I56 S;  2ZH2 A;  2QN6 B;  1NPK A;  4DR4 J;  4NEY A;  2HBZ B;  1RT4 B;  1EIY B;  3PW4 A;  5E2Q A;  1QLN A;  1WEX A;  2XMK A;  4DEZ A;  2IBO A;  3AOD A;  1AZS B;  5ETQ A;  3PEH A;  4HR2 A;  2RKI A;  2D3U A;  3N6N A;  1FF2 A;  3SI8 A;  2EI5 A;  2R4F A;  1YGY A;  1RHQ B;  4ECQ A;  1YZ7 A;  4ED5 A;  4M5M A;  4A8F A;  4HI2 A;  3TZY A;  2CIM A;  3MCO A;  3MM9 A;  4JUZ A;  2ZIT A;  1LXN A;  5B08 A;  2JNJ A;  1O5J A;  1PYO B;  3R7S B;  5IS2 A;  5DRK A;  1TK8 A;  4R5P A;  3JSR A;  5D3G B;  4IKA A;  4C0H A;  2ZBI A;  2NR0 A;  3DRR A;  2CQ4 A;  3B54 A;  1H98 A;  4Y2C A;  4L3N A;  2IPO B;  3THV A;  2IYG A;  2AGO A;  1L3S A;  2BDP A;  1JXV A;  2YNI A;  1N54 B;  3D6T B;  3N6M A;  1RYR A;  1B7F A;  3MM7 A;  3NOC A;  3MM8 B;  4H4K A;  1JLE B;  4QW9 A;  3C46 A;  2RDI A;  4I2P B;  5A8W B;  3DHX A;  3JXO A;  5KFI A;  9RUB A;  2N7Y A;  2CPX A;  1C0T B;  2ZD1 A;  3CIM A;  3ILL A;  5GAD U;  3DLH A;  3SFG A;  2CVI A;  3HVW A;  2VHG A;  1VQL S;  2UUA J;  2BOA A;  4DFK A;  2CRL A;  2MQP A;  5E3P A;  3FUY A;  4ZVF A;  5HBM B;  4LF7 J;  4DU8 A;  2UVW A;  2ZH4 A;  2E5J A;  1GK8 A;  1RT7 B;  2Y9H A;  2OFH X;  2WCX A;  3D0H E;  1YBT A;  2XC9 A;  2B6A B;  2BE7 D;  1YKW A;  2DGW A;  1TTH B;  3CD0 A;  4C98 A;  1PAE X;  4X84 A;  1AUD A;  4RW6 B;  3IGN A;  4A46 A;  2DRA A;  4F4W A;  3SV3 A;  2W25 A;  2HHV A;  1U8W A;  4LR8 A;  3RRG A;  4U6P A;  1IJF B;  3EE3 A;  4DR5 F;  1OJ4 A;  4LF4 F;  1GMW D;  3R5B A;  3CCV S;  2VH7 A;  3AJ1 A;  3NS6 A;  3UDC A;  4KHP F;  2YKP A;  1NK7 A;  2KRR A;  2YX4 A;  1PKU A;  2MKS A;  3CIZ A;  4RW8 B;  1HWK A;  2V0N A;  4YUD A;  3Q8S B;  2MB0 B;  2XS7 A;  1WG4 A;  4ZPB A;  1GH8 A;  2JSX A;  3PKM A;  2JVO A;  2JL9 A;  3AHP A;  4OYO A;  3CDA A;  3FKB A;  4C0B A;  1D9F A;  1EAY C;  4PUO B;  3PJW A;  4IH6 A;  4X4S A;  2ZE2 B;  3S6E A;  4DG1 B;  3OTC A;  2ZNZ A;  1HNI B;  4IG3 B;  2DO0 A;  2YNF A;  3ZZY A;  1APS A;  2JJ4 D;  2VBY A;  1UA0 A;  2W2M P;  2ZNY A;  1FWP A;  1WWH A;  9ATC B;  2AJ1 A;  5J2M B;  4M5L A;  4CNY A;  5MAO A;  3V6K A;  3RYL A;  5BYQ A;  4UT4 A;  2OI2 A;  3MUM P;  4QIF A;  2HPU A;  2B4O A;  3MEG B;  4F4Z A;  3PRB A;  3HKW A;  5FDL B;  3HSJ A;  3MHY A;  2EVZ A;  4ZLN A;  2A10 A;  1S6O A;  2DNL A;  3DM2 A;  2FB0 A;  4MFB A;  4QWE A;  2DD8 S;  3VAF A;  4UZC A;  1ZOT A;  1RCX B;  2AZ1 A;  2V50 A;  4BWJ A;  3HJF A;  5ETS A;  3PXG a;  3NMA A;  1RKJ A;  3Q83 A;  2IA0 A;  2BJ9 A;  4MK8 A;  5I3Q A;  2DKO B;  3DXS X;  5EGY A;  1VS3 A;  4LRE A;  4LR7 A;  4MK7 A;  5A76 A;  4OQJ A;  2D3O 1;  1SJ3 P;  1O8B A;  1X5T A;  3FQK A;  4NWB A;  2EG1 A;  4ZJL A;  5GAH U;  4O0N A;  3NL0 A;  4UQG A;  1RWW B;  2LYV A;  4R8U A;  1SC3 B;  4NE9 C;  4FBT A;  2GHV C;  4DV2 F;  5KFZ A;  3GV5 B;  1F3V A;  5LMU F;  4P7T A;  5E33 A;  3HVR A;  2Z2M A;  2PI5 A;  2KHC A;  1S4F A;  3EVW A;  3H4B A;  3CTR A;  1OIA A;  4IDK B;  2XI3 A;  1T9Y A;  4O3O A;  1ZZN A;  2BR0 A;  3EZU A;  1RJJ A;  1SL0 A;  2DHH A;  5HAT A;  1TL1 A;  1RHK B;  4CO1 A;  2DH7 A;  2CPZ A;  2R42 A;  5HAO A;  4DQI A;  2ZH1 A;  3ELH A;  2VKR A;  4NPO A;  1HNW J;  1U2R A;  4WP3 A;  4MYU A;  4DQP A;  2CXE A;  2MLX A;  4KO0 B;  5KFD A;  1RHR B;  1J2V A;  1D9A A;  1Q4R A;  2V5H G;  3OVA A;  3MWB A;  4JV1 A;  2JHE A;  2LU1 A;  3O5T B;  3DLE A;  4AQY J;  3D28 A;  3QSY B;  2VAS A;  2YKN B;  4RPF A;  2DNG A;  3T6J A;  2VV5 A;  5J2M A;  1IBK J;  2DGX A;  2ROP A;  5EUH A;  3LAN A;  5ETK A;  5I3U A;  1HNX J;  1VQ8 S;  3VCD A;  4U67 Q;  4KH0 B;  1KLM B;  4C8N A;  4DL5 A;  1LWX A;  1WAC A;  4ID8 A;  2YQ3 A;  3TYT A;  5A8R B;  1Q8K A;  2LFV A;  4WFZ A;  2VA3 A;  2WSE C;  1NHK L;  2EFN A;  4DR3 F;  1B4S A;  2DEJ A;  4LVN P;  3R2D J;  2AKW B;  4X4U A;  3R2C J;  3F73 A;  2C3M A;  3LO3 A;  2E5G A;  3NGR A;  1OO0 B;  3RZA A;  1UL3 A;  4R8U B;  2RF2 B;  2WW4 A;  2E5L J;  1FDB A;  2BJ1 A;  3IMQ J;  1LW0 A;  2OIH A;  5ETP A;  5F8I A;  3L95 X;  2OKQ A;  4B02 A;  2ERR A;  4OYZ A;  2WON A;  2WVE A;  2ZEJ A;  4ELU A;  1AT1 B;  1BHN A;  4F02 A;  1IKX B;  2XYP B;  1HQU B;  3MGJ A;  4A4J A;  4HDG A;  4CYU A;  2ZBR A;  1BY9 A;  1ZM3 A;  5A0Y B;  3E01 B;  5A8W A;  2NXU A;  3K5L A;  1Q86 T;  2KXF A;  2VB6 A;  2BKP A;  1Q8B A;  4ELT A;  5T14 A;  2HNZ A;  3UW1 A;  1JQG A;  4DR1 J;  1KP6 A;  1I51 B;  4HEA 9;  1NK4 A;  3KNG A;  2DNO A;  1TKT B;  4DLG A;  4NLY A;  4DLE A;  1HI0 P;  4TU7 A;  2MHN A;  3C3L A;  1RUS A;  1RTI B;  2HND B;  1Q53 A;  2W2O P;  4F8R A;  2C2O B;  1UJ5 A;  4IG0 B;  3TNV A;  2XG8 A;  3F0N A;  2YNF B;  4F3M A;  2B4P A;  4GO7 X;  2V4Q A;  3SXL A;  1HAR A;  1NM2 A;  2J0W A;  4HLB A;  3BZQ A;  4XDC A;  1U1Q A;  4R5P B;  4PUO A;  1F60 B;  5D3G A;  3K59 A;  3QID A;  4ANC A;  4MH8 A;  2J6U A;  5CYM A;  1I94 J;  2DVI A;  1RYS A;  3OTO J;  2ILY A;  4ZLJ A;  3DOK A;  1VLO A;  2ZC4 A;  1NZ8 A;  1QJH A;  4A8W A;  2R7V A;  4LBP A;  2YPZ A;  4NCG A;  2YPY A;  5D4O A;  2G0C A;  2PFD A;  1DJ0 A;  3PRV A;  4X64 J;  1LKZ A;  2UVV A;  1I6J A;  3KG1 A;  3FFI A;  3MMC B;  3L7U A;  1ZS6 A;  2DNZ A;  2RHQ B;  1JNZ B;  2VJU A;  1RAE B;  1ZM4 A;  1U1L A;  4WKY A;  3ISN C;  2ASJ A;  2E7V A;  2HFO A;  5KOW A;  1R43 A;  3F56 A;  1V5V A;  4ILL A;  1PJ5 A;  1NDL A;  2F65 A;  4DQS A;  3HZE A;  2MQM A;  4LRC A;  3GIL A;  2ZH9 A;  2LEC A;  3MPY A;  3IBC B;  1NAQ A;  2JZ5 A;  2MDA A;  4ETX A;  2IAJ B;  5DQH A;  1NK5 A;  3HSG A;  1UPP A;  4HTI A;  4HKQ A;  1DBD A;  4ES2 A;  4PQU A;  2AIR B;  2CVE A;  4ELV A;  4CNZ A;  2L41 A;  1IKX A;  1SQE A;  2HWT A;  4QZV B;  4AT1 B;  4X62 F;  3PIP Q;  1S1U B;  2KM8 C;  4JI3 F;  3GYX B;  1L3V A;  3QFW A;  4KB7 A;  3QLH A;  3KMS A;  2OPS B;  3VVT A;  3RBD A;  4IRK A;  2H51 B;  1RAI B;  3VVU A;  2B9X A;  3MM9 B;  4WU2 A;  2L48 A;  2RAQ A;  1RGV A;  4WK3 A;  4DL3 A;  2GJ2 A;  4KFB A;  2GO8 A;  1HBU A;  2J7U A;  1TZ0 A;  4ITS A;  3PRD A;  2RT3 A;  3JQJ A;  5D4N A;  4M8L A;  3RR7 A;  1WOS A;  2DY1 A;  1FFW B;  2R7O A;  3IWL A;  5EWG A;  4JI4 J;  1R0A B;  4MKY A;  2M8H A;  3AQP A;  2WVF A;  1KLM A;  4X4R A;  3QWP A;  2MQQ A;  2IJN A;  1UP1 A;  1GX6 A;  2EXU A;  2XNR A;  3LA0 A;  3DOK B;  2CNK B;  3O3L A;  4PKD B;  5AJ3 J;  3L4B C;  3QZ7 A;  1KNZ A;  2M70 A;  4N56 A;  1H73 A;  1RWV B;  1YJR A;  2IDL A;  1TUG B;  1WG1 A;  1EAR A;  2Y0S D;  1V3Z A;  2ZOG A;  3CD5 A;  1CJV A;  3JQK A;  5LSO A;  4NLU A;  2R2S A;  4Q5V A;  4ZOS A;  3T5H A;  3CCE S;  3LAK A;  5KFB A;  3VGT A;  4L74 A;  4DUT A;  2KH9 A;  1S12 A;  1MN7 A;  4WFX A;  7FDR A;  5A0Y A;  4N7T A;  3Q8Q B;  3FGV A;  4OJ1 A;  3QJL A;  1SC1 B;  1QVF R;  4DF8 A;  1K0T A;  5HO4 A;  2LLZ A;  3PW7 A;  1RTI A;  2HND A;  3NWR A;  3GFZ A;  2GNK A;  3CCM S;  2ALZ A;  3RW6 A;  1NSK L;  1TR0 A;  2C2R A;  1UZH A;  2X1G A;  2D3Z A;  3GJQ B;  3P6Y C;  1ZM9 A;  3HI9 A;  3RU0 A;  2HS0 A;  3KLI A;  3WHI A;  3TJ9 A;  3UDL A;  4NEZ A;  2BUN A;  3CD7 A;  2KG1 A;  3IXQ A;  3PIO Q;  1L3T A;  4PG6 A;  2I5J A;  3D0G E;  3FBB A;  3ITH A;  5GAH I;  3NEK A;  1FJG J;  1BWE A;  4N47 A;  4WFY A;  4CH7 A;  3RAQ A;  3KK1 B;  3DGP B;  3UVJ B;  3BR8 A;  3JAM U;  1E6V A;  4DOZ A;  2IYI A;  3PDN A;  1TMM A;  5F8J A;  1RT6 B;  3LW5 C;  3CCS S;  4WYW A;  2UUB F;  1NKB A;  3I31 A;  4GVL A;  4HTJ A;  5CH7 B;  1E6V B;  2JLF A;  2YKA A;  5KFG A;  1YSJ A;  4JI5 F;  5EN1 A;  4NLX A;  2BYC A;  4NL5 A;  1VRQ C;  4EO6 A;  1C2P A;  4ZLL A;  2WTF A;  2R9L A;  3SBM A;  3NXZ A;  1X4G A;  3KK3 B;  3TW0 A;  1E6Y A;  2D74 B;  1Q7Y T;  5KT3 A;  1AW0 A;  2QIF A;  1C1B A;  2GX8 A;  1ZZF A;  1X4E A;  2PT0 A;  3MMA A;  2P2C B;  4V1A k;  5HQM A;  2HGN A;  2YWK A;  3MEG A;  5CAA A;  4GKJ J;  1IXK A;  3I87 A;  3TVK A;  3OL6 A;  3OSN A;  1WKK A;  4OZ5 A;  5J2Q A;  4O3N A;  1DTT A;  5A8R A;  2L9D A;  2ZOF A;  4TY9 A;  3CGI A;  1WF2 A;  2HQF A;  3T1A A;  4F04 B;  2GAH C;  1YX2 A;  3MR2 A;  1EHW A;  4C3M A;  1N8R T;  1X4F A;  2LXI A;  2VG5 A;  4R0J A;  2V4J A;  4W90 B;  5HMY A;  2XLK A;  4Y2I A;  3CCU S;  1TL3 A;  4NLT A;  2HHX A;  4OHW A;  3C2P A;  4OL8 A;  3H59 A;  2W7O A;  3M7V A;  3M8Q A;  2FVQ A;  3W60 A;  1Q8I A;  1S49 A;  2K06 A;  4H4O B;  2Y3Y A;  3DRX A;  1FD8 A;  2DHS A;  2NXN A;  5GAG U;  3MUR P;  5DLF A;  1HNZ J;  3QIP B;  3RR8 A;  1C0U A;  2QYC A;  2QJ3 A;  1EZZ B;  1L3K A;  3TAM B;  2J0X A;  2W9A A;  5DGA A;  1MWQ A;  4OHZ A;  3T41 A;  4IOC Q;  1NDC A;  1YRU A;  3HHD A;  4RNH A;  1Y0H A;  2AJF E;  4KSE B;  3N6L A;  1X31 C;  4XK8 C;  1WC0 A;  1HNZ F;  4JI1 F;  1BXN A;  4ED4 A;  4DQQ A;  1T7P A;  2JC1 A;  3D3B J;  1X9M A;  4DUY F;  5KFK A;  1U7L A;  1F9F A;  2GIR A;  4IFV A;  1IKW B;  3I6P A;  3NCP A;  1HLW A;  1F2G A;  3ILJ A;  5D0R A;  3ZFV A;  1K8A T;  4OI3 A;  2IC3 A;  1VQY A;  2HBY B;  3QO9 A;  3W63 A;  4QIE A;  2PA8 D;  2V6A A;  1WHW A;  2YWW A;  3VAJ A;  3IS9 B;  1S10 A;  2QYG A;  4G1Q A;  3VHQ A;  2DXF A;  1YJ9 S;  3C6U A;  1S1U A;  3TO8 A;  1QAY A;  1S1T A;  1X4H A;  2A1B A;  2CQ3 A;  3DRP A;  1XEZ A;  1SKU B;  2CJX B;  4FXW A;  2MJN A;  4F25 A;  5F9N A;  4UZB A;  1FKA F;  2DNM A;  2A6O A;  1PBA A;  3LH2 S;  4CO3 A;  4C9D A;  4TVA B;  1C4A A;  2AYM A;  2YWE A;  4Y2A A;  1YRX A;  2LQ9 A;  2J9E A;  1WUU A;  4OJ3 A;  4IFY A;  4B3S J;  2FZC B;  2J9D E;  2U2F A;  2VG5 B;  3A4T A;  5KFN A;  2B43 A;  3A3N B;  2LQ5 A;  5EWE A;  1TV6 A;  1Z2Z A;  1WI6 A;  4RNF A;  5J2Q B;  1HBN A;  2DR5 A;  1MN9 A;  3KK2 A;  5KTQ A;  4WXW A;  3CJT A;  4HAC A;  2RIL A;  2DO4 A;  5B0D A;  2XO6 A;  2DNR A;  3PYD A;  1U0H A;  5IWA J;  3VWS A;  2VG6 A;  2VQE F;  3LP2 A;  1HBN B;  5KAK A;  1N34 J;  2ACY A;  2HK3 A;  3CW2 C;  3NGU A;  2OEM A;  1M5H A;  2BJD A;  3RAM A;  5LT5 A;  4OYW A;  1BQM B;  1F5A A;  1FVS A;  3LP1 A;  1Q0N A;  4NML A;  3AA9 A;  5D4L A;  4DPX A;  3GIM A;  3GV8 B;  4B9T A;  5CYM B;  4YR3 A;  2XO7 A;  4ED2 A;  2AMC B;  1S57 A;  2C2D A;  2HQC A;  1M1K T;  4G1I A;  3FBF A;  2ACM A;  1JLB A;  2GVZ A;  3HDS A;  3TUZ C;  1W25 A;  2WOM B;  3DGP A;  3M8P A;  2VL1 A;  3PEJ A;  2EPI A;  4KFB B;  5KFA A;  1IKV A;  1FNM A;  2DGO A;  2M9K A;  3OR2 B;  2KVQ E;  1F9H A;  2EFQ A;  3MPV A;  2VQF F;  2OPS A;  4HHJ A;  1N4L A;  1SC6 A;  4DV5 J;  2BAC A;  1HPZ B;  2Z58 B;  3UN2 A;  3NBP A;  4JI8 F;  3W62 A;  4DCO B;  5F8H A;  2XMA A;  1RTZ A;  2MQN A;  1T0T V;  1CLF A;  5C2G A;  1FXL A;  1DQ9 A;  1S1W A;  2HHQ A;  1W2I A;  1PYT A;  1YZ6 A;  2B7C B;  3G8S A;  3DLG A;  5BYR A;  3JS9 A;  2CQ1 A;  1DAR A;  2JDJ A;  2MLY A;  1CSJ A;  2C22 A;  1RCO B;  2VBW A;  1WC6 A;  2MTL A;  5KT2 A;  2DR9 A;  1YHQ S;  4XTT A;  2O01 C;  4DR2 J;  1LV5 A;  1HR0 J;  2ATC B;  3QQC D;  1HMV B;  2E5H A;  2WK4 A;  5E0O A;  3OUY B;  3I5C A;  2RUS A;  1IBL F;  4DXL A;  1ZTW A;  1QTM A;  4LFA F;  3P49 B;  1AZS A;  4TKT A;  3ISN D;  2CPF A;  1ULR A;  3HFV A;  3X1L B;  1KN6 A;  3RG6 A;  2OGU A;  2ALY B;  5G0R B;  5L9N A;  3HK2 A;  3AH6 A;  3THT A;  4PPD A;  3QZ8 A;  3Q8R B;  3VAH A;  3TUI C;  2QSF A;  2OSQ A;  1S6P A;  2OD6 A;  2HVZ A;  4J9U E;  1D8Y A;  1MMN A;  1IBC B;  3WZ0 A;  2JEF A;  1ITP A;  4DR7 J;  2I1R A;  2ZOM A;  3QT8 A;  1NCL A;  1MNE A;  2U1A A;  3ETO A;  4B9M A;  3AJ2 A;  2AW0 A;  2Y1J A;  1FRL A;  2R2T A;  3PV8 A;  2C28 A;  2AEJ A;  1U49 A;  2F9D A;  3HHL D;  4J9K A;  1NSA A;  3LP0 B;  1Y00 A;  8ATC B;  2UXB F;  2QG9 B;  3ZTS A;  2YX7 A;  3PX0 A;  2XWX A;  4O44 B;  2UXD J;  1TKZ B;  3MMB A;  1WEL A;  1SL1 A;  3TA0 A;  1P1T A;  2V8G A;  2BQ3 A;  1R8B A;  2M88 A;  2V4R A;  4ZP9 A;  1HQE B;  2VPW B;  4Q7A A;  2XMU A;  2JC0 A;  1LWE A;  2IHR 1;  5A2Q U;  4B9U A;  1EQ0 A;  1A6L A;  4O23 A;  1WD6 A;  4WE1 A;  4JI2 J;  2KB2 A;  2QX0 A;  3K0J A;  5DDQ C;  2K8G A;  2FYX A;  2QL7 B;  4OX8 A;  3OQ2 A;  4ECU A;  4GC7 A;  3MAA A;  4LSL A;  3UD5 A;  2LP4 A;  2X7I A;  1ZA1 B;  3RB0 A;  3AD7 C;  2HVE A;  4HL9 A;  4CRJ A;  5K8N A;  3W2V A;  2R7X A;  4EUV A;  4P10 A;  2JEJ A;  2C3U A;  4DL6 A;  4CLY A;  1KDN A;  2N82 B;  1CJK A;  1VIO A;  4UUX A;  5H1S V;  3AA8 A;  2DXE A;  2RQC A;  4K4W A;  1XR5 A;  3MCM A;  4FPI A;  4HHH A;  1Y11 A;  3HHL C;  2HQI A;  4IFY B;  1RB0 A;  3RBX A;  2IJR A;  1XC9 A;  2KN4 A;  2XY5 A;  3QRP A;  3G9C A;  2MSS A;  3BH6 B;  1MWZ A;  1S7H A;  4OJG A;  1RWK B;  4RW9 B;  5LJ5 Y;  4TQR A;  3KHL A;  3GPA A;  1U1O A;  3VZI A;  3TUP A;  1KSP A;  4DX5 A;  2ZUG A;  1KQK A;  4M94 A;  4H4M B;  2J8A A;  3TX0 A;  4ED1 A;  1GXU A;  1VLY A;  2HBQ B;  3HZG A;  1SJ1 A;  2HHT A;  1NHV A;  2BA9 A;  2HNY A;  3M32 B;  4K0K F;  1C1C A;  3TI0 A;  2CPE A;  1H2V Z;  2HHU A;  1VRU A;  3C66 A;  1B99 A;  3C8Y A;  3NLC A;  2ZH8 A;  3PCO B;  3PJ9 A;  2QLJ B;  5ITH A;  4IH5 A;  2GV1 A;  4YFU A;  1YBA A;  1MWY A;  4PG5 A;  3DN9 A;  4ZK7 M;  5IC4 B;  4O3Q A;  4ZVP B;  3RRH A;  2H4W B;  3PX6 A;  4IDK A;  4E98 A;  3MM6 B;  3N4W A;  1YLX A;  1K44 A;  1IKY B;  4U95 A;  3HSD A;  5KFY A;  4YS2 A;  1RAA B;  1XQI A;  5D77 A;  3OLA A;  4LRA A;  3VAL A;  1TVR A;  4A47 A;  3M05 A;  2XLJ A;  2K1R B;  4I7F A;  3AQO A;  3BM7 A;  4QWB A;  2GC8 A;  4WWS A;  1WC4 A;  3N79 A;  3NWG A;  4ID5 A;  3RGI A;  4F7V A;  2LDI A;  4ZIV A;  5CCL A;  2VPX B;  4N41 A;  1FJC A;  4ER8 A;  3UVJ A;  5DJB A;  5C42 A;  3Q8V A;  4EBD A;  4JYA J;  2ZM6 F;  4U8V A;  5M2R A;  2UU9 F;  2VF3 A;  3GJT B;  1VRT B;  1HKA A;  2G0J A;  4RKU C;  2YNH B;  2YQ0 A;  3ZZP A;  2NZC A;  1B70 B;  1SJQ A;  1VQS A;  4U7U K;  3SQO P;  1KD1 T;  2FVS A;  5DZ6 A;  1SUQ B;  5C2C A;  5JVG Q;  3V4I B;  5BJR A;  2JFD A;  1UJ4 A;  3GG1 A;  1U26 A;  2EC2 A;  2G2O A;  3CJ5 A;  3GIJ A;  3EPG A;  4EYH B;  3WBZ A;  2KM8 B;  3HMJ G;  4KIA A;  1TAU A;  4J9S A;  5I3U B;  3KLH B;  3BBB A;  3BBF A;  2FLN A;  3QYY A;  5L38 A;  1U2C A;  2VFV A;  2CG8 A;  4I6A A;  4DR6 F;  3FFI B;  3UNG C;  4DR4 F;  2IVF B;  3TR5 A;  3W5Z A;  2A0F B;  1XER A;  3VTI A;  3QRQ A;  1CJV B;  2NLW A;  3FQL A;  4ALZ A;  2IDE A;  5LXY A;  1TFY A;  1N36 J;  2PD1 A;  3UQS A;  1WKJ A;  4IQX A;  2AF6 A;  4NCA A;  3M6W A;  3HVA A;  2OTJ S;  2GW8 A;  1R89 A;  1YIJ S;  1SBR A;  4ZPA A;  4RWW A;  4DV4 F;  1ELO A;  4DG1 A;  2PEH A;  3BSN A;  1UFL A;  2BEF A;  4F4Y A;  4RJV A;  5HMZ A;  2KG0 A;  3TAN A;  5J1E A;  4GMK A;  4FN5 A;  4PAB A;  2N4D A;  3D0I E;  2DNK A;  2W4D A;  3R9L A;  3M2R A;  5KFP A;  2JLE A;  4FYW B;  5KFS A;  4IR9 A;  2ZHA A;  3R5C A;  3HVT A;  2HHH J;  3CCT A;  3F41 A;  2CDR B;  4ZMM A;  4UOG A;  1OWX A;  4ZVH A;  5JVH Q;  4J9R A;  2Y1R I;  2H4Y B;  1ZH5 A;  5E41 A;  4YDD B;  2BV3 A;  1BGX T;  4RW6 A;  2XS2 A;  4X2B A;  4ZS6 A;  1EP4 A;  3W2W B;  3OT9 A;  1LW2 B;  1P6T A;  2YKQ A;  2AYG A;  4QR0 A;  2R7U A;  1G3O A;  4CM0 A;  2VIH A;  1IBL J;  3PW0 A;  5K9F A;  4TXS A;  3QGI A;  3NGS A;  2NYI A;  2DGU A;  1JX4 A;  4CYU B;  2XCP A;  3FJ2 A;  3T1H F;  1FEE A;  4EYI B;  1FER A;  2MQ8 A;  1IWG A;  3SQG A;  3AB4 B;  3UNY A;  1J5E F;  1NZA A;  4LIW A;  4QIW D;  3BKT A;  2CPY A;  2FJB B;  2OPP A;  1TEL A;  2P8I A;  2V8V A;  4MKB A;  3Q0A A;  2RS8 A;  1URR A;  4KGV B;  1T95 A;  4LFC F;  3M6X A;  4USW A;  1HL6 A;  2FGC A;  3U1N A;  4MIW A;  4I0W A;  3PHT A;  2C3O A;  2GHP A;  1KS2 A;  2CJB A;  4RW9 A;  1S6P B;  3EWG A;  2MPU A;  3M2U B;  1LOU A;  2XM3 A;  1N56 A;  3BO3 A;  1CBK A;  4JI6 F;  1WNE A;  2MZQ A;  2FHK A;  1Q5Y A;  3Q8U A;  4K5R A;  2WB4 A;  2J6T A;  1CQN A;  1VQN S;  2J0Q D;  2FJD B;  4K2J A;  4YHH F;  1XMO F;  2D9O A;  1TU0 B;  2V94 A;  3FDS A;  2EW9 A;  3UD4 P;  1BWV A;  4ZVG A;  1RZM A;  5F8N A;  3CCQ S;  1M5P C;  2CQD A;  1RWO B;  3KG0 A;  3OXG A;  2LMI A;  1X5S A;  3BPS P;  2OHD A;  4E8U A;  3M1V A;  4RUC A;  1VR6 A;  3KLF A;  4A8Y A;  3C6T B;  5GAG I;  2C3Y A;  1TKX B;  1CC7 A;  3IFE A;  5KG5 A;  4QCL A;  1TUV A;  2CJ9 A;  3K57 A;  1Q95 G;  7AT1 B;  5E7O B;  1KFD A;  4OX7 A;  5L1K A;  4WU3 A;  4YN3 B;  2EK1 A;  2F8E X;  4F26 A;  5CAB A;  1JK9 B;  4OV1 A;  2BE9 B;  3I96 A;  4XDD A;  4ZVO B;  3NBP B;  5I3P A;  1UTA A;  1NB2 A;  3T9Z A;  4NYZ A;  4JI4 F;  4LF6 J;  2Z2L A;  2YBV A;  2NXJ A;  5IOL A;  5RUB A;  3OR1 B;  2FJV A;  4Y34 A;  2GGP B;  1XMO J;  1WDD A;  5LJ3 Y;  3HCX A;  4CT8 A;  4B3M F;  2OEK A;  2AX1 A;  5ETO A;  2VD3 A;  3P4U B;  5ETM A;  2J8S A;  3BO4 A;  3C6U B;  1SV5 B;  1MML A;  2WAQ D;  5E3R A;  5C24 B;  2R2R A;  4J9N A;  1VQ9 S;  3MFI A;  2XTJ P;  3Q24 A;  1TKD A;  2ZH3 A;  1SKW A;  3QJP A;  3T19 A;  3IC1 A;  5BXI A;  1X9S A;  3H20 A;  4M5D A;  3HD2 A;  4NA1 A;  4P6Q A;  3WQP A;  3H40 A;  2AU0 A;  1CVJ A;  5K14 B;  2RVJ A;  3NGK A;  4JV0 A;  1D9D A;  3I0S A;  3PW2 A;  4RWX A;  4AYB D;  4Z37 A;  1IBM J;  2E9R X;  1NKC A;  4ZIW A;  2GMH A;  2G13 A;  3TAP A;  1N6Q B;  1D0E A;  1EKS A;  3KLG B;  1N0V C;  2V2K A;  2R7Q A;  3GSD A;  5DS7 A;  2J0S D;  4PRF A;  1F5C A;  5HQL A;  5A8K A;  2QZ8 A;  2MKH A;  3M30 A;  3D66 A;  4Q8F A;  4ZPD A;  4C0O C;  1C1C B;  1RAF B;  1XMQ F;  2OJ3 A;  3KFW X;  4LBH A;  1IJE B;  1REV B;  2CDQ A;  5AT1 B;  4G65 A;  2W9C A;  1PC5 A;  2DB1 A;  2B4U A;  3FEZ A;  2ZH6 A;  1UW9 A;  4Q8E A;  5E3C A;  1B0V A;  3KOA A;  5L8R C;  1CUL B;  1RT1 B;  1N5Y A;  1FWL A;  4OHY A;  3I82 A;  1S5Z A;  2IA6 A;  2IIH A;  1TL7 B;  3BGR A;  2HRU A;  2AYE A;  1HBM B;  1X0F A;  3NS5 A;  1LW2 A;  4DWI A;  1FRI A;  3KDN A;  4BC7 A;  1QVG R;  2H5E A;  3P3D A;  2F7V A;  4NA2 A;  2DIV A;  2L3M A;  3IS9 A;  3AAW B;  3DYA A;  1YJU A;  8AT1 B;  2EFV A;  4DFJ A;  3MTJ A;  4N8O A;  4CO4 A;  2ZHO A;  4YQW A;  2DPJ A;  1U6B A;  3V6D A;  3AFG A;  1S6Q A;  3MM5 A;  5ADZ A;  3LAM A;  3CF5 Q;  1LXJ A;  3B78 A;  3D54 A;  5AE1 A;  4PQA A;  1RTJ A;  4Y0F A;  3PY8 A;  1FTC A;  2IY5 B;  5HP1 B;  3GYG A;  1S9G A;  2IM1 A;  2NCK L;  1R27 B;  2E1C A;  4QBU A;  4B3T J;  2B9Y A;  3SFU A;  3TVY A;  2ZC3 A;  3NGT A;  2MY8 A;  4DPT A;  5KFM A;  2I2Y A;  1RSC A;  3J7A 1;  2HZA A;  2Z57 B;  4ECT A;  3JTN A;  2BAN A;  1H72 C;  4NAS A;  3TAM A;  3MMJ A;  4KGM A;  2ZZN A;  3N9U C;  1HHT P;  2E44 A;  2FJA B;  3PJX A;  4RW7 B;  5HVH A;  2UUB J;  2Z56 B;  4YR0 A;  2KZM A;  1DQA A;  1B64 A;  4U8Y A;  3ZTR A;  4EBE A;  2H5J B;  2V2Q A;  3DRR B;  3O1L A;  3IP0 A;  3JAM Y;  4V19 J;  5ETR A;  2E7X A;  2KHD A;  1Y5N B;  1YBU A;  3L09 A;  3QGH A;  4WZQ A;  2BKO A;  2GIF A;  2M52 A;  3W65 A;  3KLE B;  4U9R A;  3G71 S;  4FXV A;  2XZT B;  2R3V A;  5J2P A;  3CUN A;  2WB1 D;  1WI8 A;  1JLC A;  2ASD A;  1RTD A;  2RQK A;  2H48 B;  2B8Q A;  3J81 U;  3UDV A;  1FRK A;  8RUC A;  2H9Z A;  2C1E B;  3MTK A;  5F9L A;  5KG1 A;  3EZO A;  4ZDN A;  3ZZZ A;  3KDO A;  2QV6 A;  4USH A;  1FE4 A;  3ISZ A;  1FRJ A;  3PG9 A;  5D15 A;  1NK9 A;  2V8H A;  5HMX A;  1DZ5 A;  4JYA F;  3KLV A;  4YB7 A;  4DUZ F;  4QU6 A;  1SC4 B;  1RBO B;  1T11 A;  1T03 A;  1I94 F;  1RWP B;  1T9V A;  1QM9 A;  3FCV A;  3POT A;  1UVN A;  4WKR A;  5HP1 A;  2QA4 S;  1FKO B;  5CYQ A;  5KFL A;  1TVR B;  4DF4 A;  4B3O A;  2HVH A;  3IBF B;  4WJB A;  1HBO A;  3PM9 A;  5GVQ A;  4ICL B;  4ZN3 A;  5IM0 A;  4KGK A;  3OPK A;  4RU2 A;  2CA9 A;  5KT5 A;  1PC4 A;  4UST A;  4WFN Q;  4DSI A;  2XHC A;  1NK0 A;  1N33 F;  2DCL A;  3ZC4 A;  3DYA B;  4KE5 A;  4WE1 B;  1V3R A;  4ZP8 A;  2LQB A;  2X3D A;  3HFZ B;  4DV6 F;  1WEZ A;  2QFI A;  1T9X A;  3I32 A;  5KFT A;  2VFT A;  3K5O A;  2GJI A;  3K89 A;  2ZD1 B;  1YJN S;  1B3T A;  5K8M A;  4URG A;  3VGS A;  2LEP A;  4QYR A;  1KQG B;  1QD1 A;  2VA2 A;  1JB0 C;  2J9C A;  3BPD A;  3TZX A;  4PXD A;  1T9U A;  2K7K A;  2HAF A;  3PFO A;  3ENW A;  4DV2 J;  3I5B A;  3TA2 A;  4USU A;  2NUH A;  2V2Z A;  3AOB A;  2GO9 A;  3CED A;  3FSY A;  3H5S A;  3MAH A;  4EU0 A;  3P96 A;  4NLO A;  3EYZ A;  4CO0 A;  4TLQ A;  4DR2 F;  1UVI A;  5D8H B;  2CJY B;  2CYY A;  4AE5 A;  1R7I A;  1CJT B;  2NSB A;  1B7Y B;  4OI2 A;  4C8L A;  4DV3 F;  4L6V 3;  1NKE A;  3VAI A;  4ECX A;  2B56 A;  3QAU A;  1XWL A;  3IA0 A;  3MMC A;  2IM0 A;  4MKA A;  2UUW A;  3GSI A;  3K8W A;  1HNW F;  2R8G A;  4DMZ A;  4C8M A;  3WDO A;  3GQC A;  3CDE A;  1KLN A;  1M5K C;  2DH8 A;  1XTZ A;  3BGU A;  4KGX B;  5BYS A;  5DGB A;  1R8C A;  2YWG A;  3QRR A;  1CC8 A;  6FDR A;  5KFO A;  1ZA2 B;  2RRB A;  3LAL A;  5KFH A;  4PPZ A;  2W2P P;  5L46 A;  2G9O A;  1RXO B;  1YJV A;  4KKO A;  3UR0 A;  4LFC J;  4L75 A;  2KYZ A;  4RBT A;  5HBM A;  4J9L A;  1IVZ A;  2BXJ A;  3OTB A;  3S01 A;  4DPW A;  4OI6 A;  4EMD A;  5AXM A;  1SJR A;  2EFO A;  2O5D A;  3GCW P;  5F41 A;  3TOQ A;  3X3U A;  2RHS B;  3R5D A;  1M1H A;  3NAI A;  2FVC A;  4HH0 A;  2FHO B;  5IC6 B;  4C8O A;  1HPZ A;  1X7V A;  1YWX A;  4NLQ A;  4URS A;  4Z7C A;  2DIS A;  2UUT A;  1TQL A;  3HX9 A;  4A8M P;  2R8J A;  2NPF A;  5A6W A;  3J80 Y;  1HD1 A;  2GAG C;  1IKV B;  1S1W B;  1GMU A;  1H0H B;  5K8O A;  4DR5 J;  1BLU A;  3GFX A;  1FEH A;  5KFW A;  1EKR A;  1VQK S;  3PO4 A;  3MR7 A;  4CH0 S;  1NJZ A;  3MOZ A;  4P52 A;  1FKP A;  5F0U A;  3Q8P B;  1ICE B;  3MAQ A;  1VBX A;  1TL7 A;  3BGR B;  3UCG A;  3ULH A;  4UY8 5;  4ES3 A;  1CG2 A;  3GR0 A;  5HVF A;  4DR7 F;  1FES A;  2KU7 A;  4WP9 A;  2RE1 A;  5L9X A;  5U47 A;  2VBX A;  3IWN C;  3BJY A;  3CB4 A;  2F63 A;  1U0H B;  3W64 A;  3W2W A;  1K0V A;  4R25 A;  1WSV A;  2OPQ B;  3L7P A;  3NNH A;  1T03 B;  3I9Z A;  3KK2 B;  4EZ6 A;  2FJW A;  1M5O C;  1SH2 A;  1TMJ A;  2ZWO A;  3LGN A;  1NUE A;  2M3D A;  4KPC A;  2BJE A;  3FMW A;  3T1H J;  2J5A A;  2UXD F;  3OFG A;  4ENO A;  4F0H A;  1NB7 A;  4B3R J;  4QW8 A;  1RU2 A;  2M2B A;  4BBY A;  2XI2 A;  2A2C A;  2PO4 A;  4DR3 J;  1CQM A;  2X1B A;  4DPU A;  1HA1 A;  2NRE A;  3CCR S;  4X4O A;  5IT0 A;  1UW4 A;  4ZPC A;  4W4M A;  1GXL A;  2X1F A;  1BC6 A;  4N77 A;  4ED3 A;  2LQJ A;  1FA0 A;  4FXD A;  4DR1 F;  2KT5 A;  3FZ2 A;  2KRB A;  2HFV A;  1V6H A;  2W1B A;  1UKU A;  1EET A;  1OPI A;  2E1M C;  4I56 A;  4FF2 A;  3LGH A;  1FXD A;  2XS5 A;  1N32 F;  2HVI A;  3ZNJ 1;  2XWY A;  5HLF B;  1AXQ A;  1KR4 A;  4B3S F;  2XMT A;  2Z2Y B;  1M0S A;  1U25 A;  2B4V A;  2XY7 A;  1X9W A;  4LF5 F;  2CNL B;  1HNX F;  3IR5 B;  2A6M A;  2AP6 A;  4FYV B;  4O4G B;  4YP3 A;  3A8J A;  2XQC A;  3H5X A;  4OJH A;  4G1Q B;  2HW3 A;  5HL7 Q;  5HI7 A;  4C8Y A;  2GCF A;  5KT7 A;  4BC9 A;  2GGP A;  4B3R F;  3RBE A;  2D3O R;  1HYS B;  2MKK A;  2AEF A; 
#chains in the Genus database with same CATH homology
 3EIC A;  4FKY A;  1NLK L;  3FKB A;  5CAA A;  2AZ3 A;  1HIY A;  1WKK A;  4DZ6 A;  4ANC A;  2CWK A;  2DXD A;  5BXI A;  1EHW A;  4W98 A;  3VGS A;  3VGV A;  3BBB A;  3BBF A;  3MPD A;  3EM1 A;  3FCW A;  3BBC A;  3PRV A;  3Q86 A;  4S0M A;  1NDK A;  1WKJ A;  1NCL A;  3L7U A;  1ZS6 A;  1VYA A;  2DYA A;  4ANE A;  2AZ1 A;  1NDC A;  3Q89 A;  3ENA A;  3Q83 A;  3BH7 B;  3FBE A;  2BEF A;  3ZTS A;  1NDL A;  1NSP A;  2B8P A;  3R9L A;  3ZTO A;  4O0N A;  2BX6 A;  1HLW A;  1S5Z A;  4C6A A;  1WKL A;  4UOG A;  3EVW A;  1BE4 A;  3G2X A;  2DXF A;  3EVM A;  4CP5 A;  4F36 A;  1NPK A;  3EVO A;  3VVT A;  3VVU A;  3VGU A;  1NDP A;  3ELH A;  3ZTQ A;  4AND A;  3NGS A;  4UOF A;  4HR2 A;  5C7P A;  2HVE A;  3WX8 A;  4WBF A;  3B6B A;  1S59 A;  1F3F A;  1W7W A;  1KDN A;  2NCK L;  1NSQ A;  2HUR A;  2HVD A;  2DXE A;  1HHQ A;  3NGT A;  3FBC A;  4UOH A;  1F6T A;  3DKD A;  3BH6 B;  1LWX A;  1MN9 A;  3B54 A;  3GPA A;  4FKX A;  3ZTR A;  3EJM A;  1JXV A;  1UCN A;  1NHK L;  1B4S A;  3VGT A;  4DUT A;  4EK2 A;  3NGU A;  1MN7 A;  1NUE A;  4KPC A;  3Q8U A;  3NGR A;  3Q8Y A;  4ENO A;  1B99 A;  3PJ9 A;  2ZUA A;  1NSK L;  3ETM A;  1S57 A;  3FBF A;  1BHN A;  3EMT A;  2B8Q A;  2VU5 A;  1LEO A;  3FC9 A;  3ZTP A;  1K44 A;  3GP9 A;  3FBB A;  1XQI A;  2DY9 A;  1PAE X;  1BUX A;  4F4A A;  1U8W A;  3DDI A;  1XIQ A;  3FCV A;  5CAB A;  3EE3 A;  3Q8V A;  3JS9 A;  1NB2 A;  4DI6 A;  5IOL A;  1PKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...