3L7UA

Crystal structure of human nm23-h1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase A
publication title Refined Structure of Human NM23-H1 from a Hexagonal Crystal
doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3l7uA00
1NPKA 4O0NA 1LWXA 1MN7A 2B8PA 4W98A 1NDLA 4F36A 2NCKL 3BBCA 3ETMA 2HVDA 1NCLA 3FBBA 4UOFA 3ZTPA 3ZTQA 3Q8UA 2DY9A 2BX6A 3FBCA 4C6AA 1K44A 4ANDA 2DXDA 4S0MA 1NSQA 4UOGA 1HHQA 3PJ9A 4DZ6A 2HVEA 2DXFA 3FBFA 4ENOA 3EE3A 2ZUAA 3FBEA 2CWKA 3MPDA 3R9LA 1WKJA 3ENAA 3Q86A 4KPCA 1EHWA 3NGSA 3ELHA 3ZTOA 3NGTA 4DUTA 2AZ1A 1NB2A 3EVMA 3G2XA 4DI6A 5CABA 1XQIA 3JS9A 4UOHA 3NGRA 3BBBA 1WKKA 4EK2A 1ZS6A 1U8WA 1VYAA 1F3FA 1PAEX 1NSKL 1NLKL 4CP5A 3VVTA 5C7PA 3FC9A 1NHKL 3GP9A 2DXEA 1MN9A 1F6TA 3Q8YA 3BBFA 1LEOA 3EICA 3GPAA 3B6BA 2AZ3A 3L7UA 4F4AA 1PKUA 5CAAA 3VGSA 4HR2A 1JXVA 3VGUA 3FKBA 3BH6B 3Q89A 1W7WA 3VVUA 1HIYA 1XIQA 3Q8VA 2HURA 3FCVA 1S5ZA 4FKYA 3EMTA 3EVOA 3VGTA 1BUXA 5BXIA 3DDIA 3NGUA 3VGVA 3EM1A 5IOLA 2BEFA 3EJMA 3PRVA 2B8QA 1UCNA 3DKDA 1NDCA 3BH7B 1S59A 2VU5A 1KDNA 3WX8A 4WBFA 1NSPA 3Q83A 3ZTRA 3ZTSA 4ANCA 4ANEA 3EVWA 1NUEA 2DYAA 1B99A 3FCWA 3B54A 1B4SA 1BHNA 1NDKA 1WKLA 1S57A 1NDPA 4FKXA 1HLWA 1BE4A
chains in the Genus database with same CATH superfamily
1VK3A 5C2CA 3WDOA 1RT5A 1FVQA 3T1YJ 4TU7A 1JLEB 4KE5A 2KG1A 1HBMA 1Y4ZB 2Q1LA 2OKQA 3NCPA 5J1EA 2JHEA 3T9ZA 1RT4A 4C11A 4QU6A 1RTIB 1WG4A 3K5LA 2FB0A 5EDWA 1HNVB 3Q8YA 4HH1A 3D54A 2MKSA 1AUDA 4NA3A 2RAQA 1W7WA 2OTLS 2C2OB 1YWXA 2ZBQA 3NGUA 2FJBB 2YNIB 5LSOA 2ZJRQ 2RSQA 5F8JA 1JWWA 2P9GA 1TL1A 4QIGA 2G9OA 4P10A 3BKUA 1RCXB 3PFEA 3V6HA 2QE5A 1RAHB 4NLRA 1E6VB 3PYFA 4G1QB 3NNAA 1B0VA 1T3NA 5IT9Y 3R27A 2VUGA 5DO2A 5EHHA 1MNEA 2CDRB 1RTDA 1JK9B 2C3UA 1H7WA 1GX5A 1WC4A 2HQIA 4OX8A 4J9OA 2ADBA 5BR8F 1Q4RA 2IMWP 3W9JA 1G7CB 5C25A 1UEVA 1TK5A 3KJFB 2F7VA 1LWCB 5KFQA 1HQUA 2DHSA 4KIAA 1JX4A 1RT2A 2ATLA 2AEMA 5SZTA 2W7AA 2PDAA 2O5DA 1VRUB 3CIZA 5MLCV 4ZJOA 4MH8A 2BRKA 3OPKA 2GAHC 3RBEA 2CQDA 2PD1A 4ZVUB 2XHWA 2RQMA 2U2FA 5HATA 4KT0C 2GVDA 2R8IA 3ADAC 4J9RA 3EX7B 3GV8B 4IQMA 1L3SA 3UD3P 1AZSB 5K8OA 1IJFB 2CQ1A 3MEDA 2V50A 3CCLS 3LP2B 4KSEB 1BLUA 4ZVRB 3QIPA 3PYGA 3GMGA 2M4MA 5E3QA 2EEYA 4J9LA 1WG5A 5HK4A 4UY85 2HWTA 3OD2A 1T0TV 4OHZA 1X5SA 4PYAA 3DRYA 2DY9A 4ANDA 1SPBP 3CCJS 2BJDA 2KXHA 3EGVA 2G0IA 3K89A 3PX6A 4UT4A 2VBYA 2M5YA 1PYOB 4K2XA 1B7FA 1XTZA 2YKMB 1XNRF 3SDEA 1WDTA 5CZXA 2CPEA 4G65A 2EBEA 4USJC 1YLXA 3MEKA 1L3TA 1N33F 5KTQA 3G4SS 2YX1A 3FQKA 4OQJA 4OX9F 3K8VA 4Z7YA 4U9RA 4Z37A 3VGTA 2LVWA 3W8PA 4C2MA 4WKRA 2NUHA 1QY7A 2KZMA 3G6ES 2VB6A 3M8ZA 2AJ2A 1M90T 1HNIA 1Q95G 1NUEA 1RHUB 2KJVA 4WF9Q 1NDKA 2B4VA 4LFAJ 5K9FA 4LF6F 2F4VJ 1SJ1A 5F0UA 1PAUB 3DRXA 3BGFA 2NCKL 4LIWA 1OYEA 4H4MB 1TFYA 1WTBA 1HBOA 2MSTA 5THWA 2ZKTA 3MF5A 2FVPA 6FD1A 1WC1A 3EZUA 5DQHA 5ETOA 4NZ6A 1RT1A 3KXDA 5HVHA 2W25A 2GHWA 2X3GA 3T1YF 3JAMU 1EP4A 1YBUA 1REGX 2Y9HA 1S1UB 5A8KA 2DIVA 3LP0B 3O44A 4A8YA 4FVCA 1M1KT 4NYPA 2F8EX 3K17A 1RWPB 2BQ3A 2PMHA 5I4MA 5KG7A 1KNZA 1OSCA 2W9BA 2C2NA 5ETNA 3P4UB 4TN2A 3PZPA 4RNFA 3MR5A 1ZBTA 3QT8A 3P5TL 5DG8A 3CIMA 5L8RC 4Y00A 1AFIA 3RTVA 1AFJA 3A4TA 2J9DA 2LQ9A 4TQRA 2PFFB 4PQUA 1HBMB 5B0GA 3MCMA 4JI5J 4KY3A 2F8HA 1LK5A 5J1EB 2XYPB 1NDPA 1X4DA 1N32J 4C11B 3LGHA 4Y3CA 3TANA 4EBCA 4FBTA 1KHWA 4DV1J 1NSQA 1ZA2B 1WHWA 4K4YA 1R8AA 3J7YI 4P2FA 4X65J 1WSVA 3NAIA 4WK3A 2J6SA 4UTGA 4IOAQ 4DS4A 1F0XA 1PILA 2MKCA 4NMXA 4X66J 4BDPA 3MMAA 2KYXA 3SYZA 4QIWD 3PW7A 1VQSA 5C7PA 1T9WA 3IBCB 3OFHA 3JB9k 2PT0A 4NCBA 2CQPA 1IR1A 1BQMA 2R2SA 4PR6A 2WOMB 3DLKA 1TL1B 4J9NA 2JFKA 2GJFA 1QAIA 4M5MA 4LVOP 2V34A 5KFJA 4ECUA 4DR7J 2ZD1A 2FQQB 1JJ2R 2B6AA 3GV5B 3HVTA 2ZM6J 1HNWJ 4FF2A 2R8GA 4DFJA 5DLGA 3KWMA 2YX4A 4G1PA 3M8QA 1RTDB 1FFWB 1S57A 1CPZA 4CLTA 1OY8A 1KFDA 1VQLS 3RW6A 1KTQA 1GEHA 4F2SA 1VDHA 3F44A 5C25B 4IYQA 1H38A 3NGDA 1S79A 4TY9A 2HW3A 1LQ9A 4J9VA 2XZWA 4MKBA 3ZZZA 3NNHA 3WIUA 5K8MA 3I96A 2FDNA 2ZVSA 1JLQA 2OD4A 3BSOA 1WELA 3NS7B 4B9MA 2YPYA 4EWTA 1TZ0A 4HHJA 4QR0A 1JLGA 1VFJA 3D3BJ 2GVDB 2QSWA 3NY0A 3LP1A 2WTFA 2D3UA 4NI2B 1R31A 3D5MA 3MEDB 3W2VA 1QTNB 1EQ0A 3M2UA 4M94A 4EO8A 3QIPB 4FF3A 3PCOB 3KLHA 5D15A 1CS4B 1JKHA 3OBIA 2RDJA 4G6VB 1R89A 1UZDA 1QAJA 3AQOA 2KHCA 1N48A 4JI2J 1SH2A 4I64A 2AHOB 3HXMA 3D1QA 2E5GA 3EGZA 3QJPA 1T9UA 4MT1A 1TELA 5L38A 5D0EA 4K0KF 2J0QD 4IG3A 3DI6A 4NOHA 4LFAF 2F4VF 2X1FA 2MLZA 4YP3A 2XY6A 1TTHB 5KFOA 1S77D 2KDOA 4NLVA 2M0GB 1ICEB 1NLKL 3I31A 1NNDA 2KO1A 4E0DA 4TLQA 1I94J 2YKPA 3Q2TC 3VCDA 4I6YA 2AV5A 2ZH8A 4GMKA 2MZ1A 4NLSA 2H54B 1URNA 4LJMA 4XPEA 4A8XA 1OJ4A 4CZCA 4V1Ak 2OSQA 5DS7A 2VPXB 3ISNC 3KUEA 1N6QA 2DGVA 1OS5A 1IR2A 2QZ8A 2MQOA 5JMNA 4IRKA 4BHQA 3CDWA 1LW2A 4CT8A 5KFHA 3PRVA 3QBCA 1CVJA 4A8FA 2MXYA 3C14A 3QT7A 5HANA 5J2MA 2DGOA 4D3GA 4KB7A 4CLFA 3S7RA 2HBYB 1HWJA 4JI0J 3JSMA 2VHGA 2FLNA 1J5OA 3W9HA 3KG0A 2VFSA 1EP4B 1UFLA 4ZKAA 2XMMA 3D0IE 4N41A 2EWHA 4ZS6A 2K1RA 5A8KB 1OO0B 2DHAA 4FNHA 4JI5F 1RT7B 1MWZA 1DHMA 1A0OB 1IKVA 1N32F 3ZTOA 1DTTA 2W9BB 1FE0A 2AP6A 2DGUA 4DV1F 4B3OA 2HG4A 2HHVA 2O67A 3J7AN 1KLMA 4X65F 1J2VA 2BANA 2IBOA 1EX8A 1GH8A 3P96A 4PQUB 4ZA1A 4X66F 3MCNA 3BGRA 1SB6A 3MZIA 3KLVA 3MUTP 2IFXA 2LYVA 3KJNB 2LEPA 4MTPA 2R4FA 4M5DB 3HHLD 1QDUB 1S10A 3QFWA 3CWJA 4NZ0A 2R2TA 1NBEB 4WIQA 3AQPA 2Z0GA 3ZZPA 3MPWA 3TAPA 2RQKA 3Q83A 1ZM2A 1LOUA 3D0HE 1L3VA 4DR7F 1HD1A 5HQLA 1UPPA 2QA1A 4Y2AA 3C6TA 2ZM6F 1HNWF 3MMAB 4ECRA 1EIYB 5B0BA 1Q86T 4HL9A 3GIMA 3F0NA 1BC6A 1UVMA 4ZPBA 1H3DA 2IM0A 3NGRA 1JXLA 2VL1A 4R25A 1EZZB 4J9MA 3MGJA 1LW0A 2EKYA 3HHKA 2KG0A 1AROP 1KSPA 2ZD1B 3HVTB 3L7UA 4WXOA 4UUXA 1JLCA 1B70B 3RAMA 4A8MP 1QVGR 4OJHA 2WVFA 1MLAA 3R3TA 5E33A 5ETMA 3GIIA 5KFTA 1JLBB 3AAWB 2ZNYA 3GWCA 2M7SA 5AXMA 3T5KA 1IKWA 1NK8A 4BWJA 2W4DA 4LRDA 3DLLQ 4OHWA 2ASDA 4QZVB 2VQFJ 4HVZA 4NEZA 3G6VA 1JLQB 5LXYA 1SJ4P 3R5BA 2QFJA 5ETLA 4JI2F 1JLGB 1FA0A 2A6MA 3Q86A 5DQGA 4B3TJ 3I9V9 4CLPA 2ZOMA 3TUZC 2IA0A 5KFDA 1FKOA 3LP1B 1QM9A 4Y2KA 4ED1A 4OL8A 3W2VB 4IRDA 2GW8A 2ZHOA 3M2UB 2FYXA 1X4FA 3VVTA 4DN9A 3IRXA 4TY8A 3BSNA 1V3ZA 2KM8B 2IRYA 5EUHA 3UN5A 2O66A 4YMEA 1SL0A 4RU9A 1NXIA 1NEEA 4B02A 5G0RA 1HIYA 1I94F 3UO0A 1UW4A 2R7XA 2XCPA 2OPSA 3J7ZT 4IG0A 1ITPA 2CUYA 2RQ4A 2HWIA 2PMZD 1ZZFA 1HBUA 1KDNA 2QG9B 3WX8A 2J6TA 2W4CA 2PO4A 1T05A 3N6MA 3PJXA 5KFRA 3L7OA 3HHDA 4URSA 4DX5A 2LDYA 1NJZA 4LR8A 2N7YA 2L9WA 3L7PA 4TLRA 3OVBA 4O3NA 2AJ0A 4F3QA 3KLFA 4JI3F 3UI3A 2E5HA 2K3IA 3MPUB 3UNGC 3EUNA 1S48A 2GO8A 2NSBA 3QAUA 3SI8A 4NE9C 1R7IA 4CTAA 4M5HA 4ECXA 1A9NB 2DH9A 3OW2R 2E5JA 5FIIA 3CCVS 3GFYA 1LW2B 2LDIA 2FLLA 3C14B 3RBXA 1MU2A 3HFKA 5K8PA 5T7LA 5A8WA 2CA9A 1BGXT 5CCMA 4RJVA 3NAHA 1J5OB 3HVWA 4B9LA 5B0EA 3Q23A 1KD1T 4JV5J 2V9WA 1LFPA 4J91A 5F8MA 2B9EA 3D68A 2K1RB 3M2VB 3PW5A 2DR9A 3GCXP 1BQNA 3O2IA 4DR3F 3G87A 1R0BG 1RWMB 1YHQS 1IKVB 4CYUA 4C9DA 2AX0A 4DI6A 1DTTB 2GMJA 3GJTB 1FDAA 2OPRA 2VC1A 1S72S 1MWYA 3NCQA 1P1TA 1H2TZ 2AJ4A 3OR1A 3I87A 3BQ0A 3DHXA 3HULA 2UXCJ 9RUBA 1HW8A 1V5IB 2BANB 5CYQA 2RS2A 1N5SA 3CCWA 1TKZA 2FJAB 4OI3A 4ICLB 1U1NA 3KHGA 1RAEB 3E2EA 2C2DA 2RQCA 3IN5A 1EQMA 3M9NB 3BGRB 1HW9A 5HVGA 3HSGA 3SIPB 2GC8A 2FC8A 1S1TB 4RO0A 4GVBB 2UUAJ 5D4NA 4DEZA 2V68A 1JLFA 3IBWA 4CO4A 1W2IA 9ATCB 2Z58B 2B9WA 8RUCA 4DU7A 2HHHJ 3KK3A 2B5JA 4X4UA 2FJDB 2FVCA 3DM2A 1FDNA 3J81j 4DG1A 1VMBA 3C6TB 1WC3A 2CPYA 1NDCA 4DSLA 1FT8A 4DR5F 3DN9A 1RHQB 2B3TB 1H0HB 5DDOC 1YBTA 2WBMA 4O4RA 1KVIA 5KT5A 4FKXA 2CJKA 1CULA 4F67A 4TYBA 3GCWP 3CF5Q 1LW0B 2OEJA 2YTCA 3EE3A 2XY7A 3RJMB 2HGNA 1BWEA 3SFUA 2VQFF 1JLCB 1UL3A 3OUYB 4DQQA 2C2RA 4EK2A 2ZBCA 3DLHA 2CG8A 4RW7A 1TL4A 2DR8A 3CCES 1TUWA 2F5GA 5B0CA 4RNHA 3JSBA 1S6QA 2A18A 1Q53A 3W1YC 3I0SB 5GADI 5KFUA 3PTWA 3L9ZA 1IBKF 5FDLA 4Y2CA 8ATCB 2ZEJA 3DOMB 2EI5A 5EX3A 2XC9A 2UUWA 1K1QA 3ZZUA 5KT2A 3BEGB 2HBRB 3CJQA 4YHHJ 4P73A 5HL7Q 2E7VA 5JUMA 3T1HF 2C1EB 4C98A 2CQ2A 3UD5A 1VI7A 4HEA9 1FDBA 4GC6A 1FKOB 2QRRA 5AE1A 3NMRA 1Q0NA 2HZAA 4FN5A 2L3MA 1FRKA 3GG0A 3V6KA 4JI7J 3KJVA 3JTOA 3NEKA 4TY8B 4YR2A 4C3KA 2RE1A 4WP8A 4PEOA 2L48A 2VF3A 3VHQA 4C0HA 1ZS6A 5G0RB 1VGYA 3K5MA 1QUPA 4HYKA 2OPSB 3ILOA 4WP3A 4OHYA 2ZBRA 5KG3A 1HBUB 3GFXA 1X4BA 1T05B 1Q8IA 3CCSS 1FEEA 2FJEB 2BVZA 4C8YA 2GHPA 2JX2A 5FJ4A 3IS9B 5ETRA 2G2YA 1FTRA 3V6JA 4RW6A 5HBMA 3VQTA 1Q5YA 2YKAA 5KFNA 3QATA 2UU9F 1NSPA 3H4BA 3CJ3A 3WX4A 3DNCA 8AT1B 3KJQB 5FLXY 2DBBA 2X51A 1RABB 2LEAA 4W98A 4PABA 1OQ3A 3ETMA 4XO0A 3HF5A 4OJGA 2PMWA 4FXDA 2ATCB 4LFCF 1DTQA 2R8JA 2BXJA 1KC8T 1S0NA 2OMOA 4HH0A 4QW9A 1MU2B 3I5BA 1X9SA 6FDRA 5T7LB 3CGIA 3M32A 5A8WB 3DMJB 1F3FA 3OTDA 2BW2A 1C1BA 4DSFA 2YNHA 3M6VA 2UXBF 1GK8A 2HK2A 5ETTA 5DJBA 4DQIA 1FDDA 1TKDA 1WEYA 2HHTA 3OTOF 3H40A 1ZETA 1VQ9S 1JXVA 5J2PA 1BQNB 1NAQA 3FKBA 1HI0P 1ZM4A 2UVUA 4LT6A 2UUAF 2N3LA 4N47A 2OPRB 1JMTA 2BEFA 3AJ1A 1SJQA 3OR1B 2LQ8A 3U1MA 1VQKS 1O51A 3QRRA 3OV7A 1LNQA 1QSYA 7AT1B 1NJWA 4CNZA 1TKZB 4M95A 1GXUA 3D6FB 3RZAA 2OTJS 1NK7A 3FFIA 4A8KA 3GR0A 3PW4A 3DLEA 1X60A 1NK4A 1IM6A 2UVVA 4IOCQ 4ZVQB 3MM8A 4LRAA 2IVMA 3HD2A 4O0IA 1KLNA 3TZXA 1JLFB 3CJ2A 4WFBQ 3AB4B 3BYPA 3K7RA 3SSSA 2CZ9A 1A6LA 3HO1A 3KK3B 1BXNA 2YNFA 4EBDA 2B5JB 1YI2S 3HHNB 2FGCA 3DM2B 4UQTA 3TEHB 4DG1B 2CQ0A 4U8VA 5EWEA 2GIFA 5M2RA 4DXLA 2HNYA 2DR7A 3VAKA 2HRTA 4YY3F 4QIEA 1S12A 1CULB 2HKEA 2WAQD 4HI2A 2BZ2A 2W2MP 1GFWB 1HYSB 1VQ4S 4CO5A 4HDGA 2GO9A 4L3KA 1RBAA 3VAHA 1IN0A 3SBMA 5KFGA 2W1BA 3HCXA 2BDPA 5M2PA 4RW7B 1RTJA 3FBEA 4K7QA 1S6QB 5AE3A 1XMOJ 3J80Y 1XNQJ 4DN0A 2DIUA 2ZH9A 1VJWA 2AQ4A 4J9SA 1UP1A 5FDLB 3OSNA 5B0DA 3UDCA 5HN0A 1RU1A 2DNOA 3IAM9 3QJJA 3HSJA 2BOAA 4IDKA 1N36J 2CPDA 4P71A 1K8AT 1F2HA 1FD2A 3AHPA 4ZVSB 2RDIA 2R7SA 2CQIA 2RRBA 2H5JB 5KT6A 1FRMA 3MM7A 3EZOA 2J0XA 2D3O1 2Y1IA 4K5RA 2J0WA 3KJVB 3EGNA 2HVHA 4QWCA 2DNZA 3QO9A 4CLWA 3G96A 1FO1A 1U2CA 4USVA 3RYLA 2PEHA 4XPCA 2XM3A 4UOFA 3ZTPA 5AXLA 4IH5A 1SL2A 3P8BB 3HX9A 4DZ6A 4LF4J 3CULA 1Y7PA 4BS2A 1CC7A 1HNXJ 3D6TB 2IVFB 2DR5A 2QEXS 2B4PA 1T94A 4DF8A 4RUBA 3B82A 3M8PA 4NLUA 2ZBIA 4K4SA 2Z2MA 2AYMA 1Y0HA 2ACMA 3W5XA 2ASJA 3O3LA 3ZZOA 4ECWA 3D4JA 1FWLA 3MOZA 4CM0A 4ERDA 3TZZA 2XNRA 2VA2A 4RW6B 2Z4PA 2I5JA 2JNJA 2EKNA 4DV4J 4HR2A 1Z2LA 2BRLA 2ZDOA 2MQMA 1RWWB 2E5IA 5BYQA 4XIUA 5D3GB 2XMJA 4FKYA 1C0UA 5ETKA 5KAKA 2YQ3A 3DGPA 5EN1A 1WSRA 2RIJA 1G6BA 2CAJA 2CPXA 1C0TA 2EC0A 2RU9A 4C8KA 2VPWB 3CT9A 4QJVA 5KT4A 3V81A 3MM9A 4IQXA 3MAAA 1YZ7A 3C3LA 2FUG9 3VTIA 1C1BB 2BX6A 2YNHB 3SSRA 1VRQC 2GHVC 3JTNA 4O3PA 1LWFA 5ETQA 2WSEC 4GVLA 4U7UD 3G86A 1EHWA 2BKOA 2XLKA 4AD6A 1GTEA 5J2PB 4F3OA 1U6FA 4KR0B 4GO7X 3MAHA 2MKJA 3RBDA 1VQ7S 4K4XA 3ENWA 2H48B 1KOOA 5L39A 4ED2A 2GVZA 4FS1A 4RPFA 3RRHA 3T5LA 4WCEQ 2LCWA 3MFIA 2V94A 4CO2A 2LQ5A 3GQCA 4JOUA 4C0OC 4NXNJ 4NA1A 4N76A 3G6XA 5HQ8A 3HZEA 4CLLA 3DLEB 1D09B 3BH7B 5IT9U 4N56A 2E7WA 3EVWA 4ETZA 2YX7A 3NS6A 3MM8B 3KUHA 3IM8A 5L9NA 2WRMA 1R8CA 2E44A 1IJEB 5F9LA 1NCLA 1QSLA 4JUZA 1FX2A 4ZHRA 4TKTA 3BPDA 2HNYB 2M3DA 2BOPA 4CLYA 3C6UA 3A8IA 1MSWD 3D28A 4KGZB 3TA1A 3MM6A 2OPQA 3TVKA 1XMOF 1XNQF 1LEOA 3IBFB 4X4OA 2X1AA 4OYPA 3MCSA 3I82A 4IOBA 3TJ8A 1IR0A 3D67A 3R1LA 2GZOA 3BZQA 2COLA 1EJ7L 4I2PA 3EJMA 2DGXA 3PM9A 4B3SJ 2MQPA 2ALYB 2OPPA 2ABYA 2JC0A 1RAIB 3SV4A 3MECB 4OZLA 5HJYA 4CT9A 5D8HB 3OFGA 1TL3B 2VFVA 2DR6A 1WDDA 4I7FB 3K0JA 4IDKB 3GYNA 5DDQC 5HP1B 3LGMA 1IBLJ 4ZCIA 1HFEL 4LF4F 2WONA 2MPUA 1SQFA 1YRXA 4TYAA 1D8YA 4H4KA 4F25A 4OJ3A 3PKMA 3MURP 1S1WA 1UETA 4ZP7A 4USHA 5D4LA 4DR4J 2E1MC 2N82B 1RE1B 1VLYA 2EG1A 3GV7B 3H59A 4DPOA 3L4BC 2KXNB 3N5BA 4IO1A 4C7QA 4F4XA 4I56A 3GR1A 1WHVA 4PG6A 3BGOP 4ID8A 4U95A 1TU0B 3PHTA 2RH3A 1RYSA 4DV4F 3AT1B 1JJ4A 2PC6A 2MEWA 3TP2A 1H72C 1WKLA 4NA2A 3ZZYA 2QA2A 3OTCA 1SBRA 3M8PB 3H0PA 2D74B 2AKWB 2QMWA 1S1VA 2NXUA 2ERRA 2ILZA 1JB0C 1TL5A 2W8LA 2ZH4A 1S76D 4ENOA 3MD1A 4ELTA 5KFEA 3EDQB 3IWLA 1N4LA 2I5JB 3MMJA 4DL0C 2KL8A 4LR9A 1VYAA 2CPIA 5KFYA 3NRBA 1PAEX 3AH6A 1T8EA 5HJXA 1SIZA 1Y10A 1S9GB 1C0UB 5KFBA 2VONA 2BE9B 2C2MB 3DGPB 4Y65A 2LXIA 2KRBA 3VAJA 3E3XA 2WVEA 2CQCA 3O8WA 2DHHA 4NYZA 1W25A 4QYZK 1C0TB 3HFVA 1FKPA 2OHDA 2U1AA 4DX7A 3V81B 3FCVA 2ZH3A 3M30A 3MAAB 2ILYA 3I6PA 2KN4A 4RUHA 1T03B 2ZHBA 1S9FA 3UDEA 1X5OA 4CCHA 2E9TA 4EU0A 3KK1A 2C42A 4NXNF 1LWFB 1U1OA 2GJ2A 3LF0A 2KZZA 1N52B 2OI2A 4RUCA 3CC7S 1VC5A 1TP7A 2RRNA 2YY3A 4BC9A 4C6AA 5CZVA 1UVIA 4N8NA 3GIJA 1YIJS 5D6GA 4KJIA 1HMVA 3TEGA 4B9TA 2W2PP 4E8UA 2CPJA 4NLPA 2HPUA 3LUYA 4O3SA 4C8ZA 1EKSA 2GVZB 4WYLA 3QT6A 3TVYA 3BPSP 2DB1A 3C16A 3PO5A 1RJJA 1L3UA 5E3CA 4EZ9A 4LF8F 4I68A 2QMXA 4HKQA 4G1IA 2I6WA 2P6SA 1SUQB 1UWAA 4BC7A 4EYIB 2AJ1A 3MMCA 1U1MA 3JSYA 4QWBA 1RACB 2Y3YA 3Q89A 7FD1A 3MTJA 4K4ZA 2RUGA 3RR7A 3KMQA 3SFGA 3CD6S 2MHNA 1VQYA 4DMZA 2CADA 4ZVGA 2M2BA 2KB2A 1S59A 3CJTA 3KK2B 4W4MA 1DY3A 4NPOA 1TMJA 3G9CA 5HO4A 2IDEA 1K9MT 4ZHRB 4DLGA 2B0GA 5BYSA 2FIUA 2OFGX 3RW7A 3I55S 2H1YA 4O0NA 4C4WA 1LWXA 1U6ZA 3H25A 2HEKA 3VV2B 4ED4A 3C6UB 3FBBA 2V8VA 3Q0AA 2OP5A 4KC5A 2AGPA 4B9NA 3MM6B 2OPQB 4FDFA 1MW7A 6AT1B 2D41A 2XZDB 1SKRA 4IH6A 2B9XA 4W90B 3KTQA 1L5UA 2AEJA 1MWQA 5HMZA 2FY8A 1ROFA 2K7JA 2XULA 1NZAA 4ECSA 1XN9A 2W7PA 3D6HB 3MEGB 1IBLF 5IQQA 4YN3B 1KQSR 1SC6A 1YRTA 2X3DA 3CDEA 4DX6A 3H42A 1XIQA 1Y5LB 4XDCA 1SH3A 4KHPJ 4Q8FA 1FESA 1AXQA 5E3AA 2HK3A 4KH1B 3TUJC 1YJRA 2E9ZA 1HA1A 1FF2A 3AD7C 3FSIA 3BN7A 1SC1B 3R5CA 3DXBA 4DUYF 1LWEA 2FHOB 4DV5F 2H9ZA 2YH0A 2HIYA 3OL8A 2OELA 2XS5A 2MQ8A 2IM1A 4QBUA 3SCJE 1XMBA 4PWUA 2E1CA 1U48A 2WONB 3PXGa 4I69A 5KG1A 4WE1A 4P72A 1R0CB 4QQBA 2VDHA 1F5CA 3JQMA 3IG1A 4RW9B 1S1WB 4MIWA 3PYEA 2G1DA 3OFFA 4HACA 1YJWS 1FFGB 1NK9A 2C2ZB 2FC9A 4DS5A 1FJ7A 3POTB 4CP5A 3EPIA 2HZCA 1NH8A 2LU2A 1VIXA 2D9PA 1X9WA 1PJ5A 2FVQA 3OXLA 5KG6A 4Y34A 3TX8A 3BDPA 2DH7A 2JSXA 1U45A 4TU9A 4FS2A 4AQYF 3DRSA 3HM9A 1S1VB 4DUZJ 4PKDB 2N3OA 3RB4A 3UD4P 4OI2A 2P6TA 3CCZA 4QW8A 2VPYB 3DCAA 1RDRA 3BGLA 3V6DA 3S6EA 3M7VA 2RF2B 1FKAF 3MPDA 5K5MA 1CLFA 2VPZB 2YQ0A 3T3FA 1PCAA 2DGQA 5L1IA 1RWNB 1KS2A 5GAGU 1FKPB 4DR1J 1UPMB 4O4GA 4Y2IA 1VQOS 2FZKB 3IO1A 2H3EB 3M30B 1CJVA 5H9FK 4BLGA 3KNGA 1X4HA 2HNDB 2KT2A 1RAGB 4ZIVA 5JJBA 3KK1B 3BH6B 1VC6A 3VAIA 4JI4J 1WTFA 2IY5B 4WFAQ 3I0RA 3UCZP 4MIBA 2LA6A 5LJ3Y 4WU3A 4ES3A 3P3DA 1HMVB 3FEZA 4OMFG 3MEEB 4PXDA 4ZVOB 5EWFA 2QN6B 3OVSA 4I2QB 1JJCB 1RHMB 1N33J 4IFVA 3RUBL 1Q16B 1D9DA 2IAJA 3NXZA 5DLFA 3RAQA 5D4OA 3HJFA 1RUSA 2R7RA 4MK8A 2CNLB 4ZN1A 2B9YA 2CYYA 5HMXA 1K44A 2AYEA 4ILRA 1RADB 4UZCA 3MMCB 2FVRA 2JC1A 1FI4A 4DQPA 1REVA 4MIAA 4J9PA 2DEJA 4ED0A 4HHHA 3T41A 3W66A 2Q6BA 1IUJA 3B78A 3N5FA 2DH8A 3PDNA 3GFZA 4Q2MA 3I4HX 2Z30B 2H5EA 4ED5A 3NOGA 1FK9B 4LF6J 4RLEA 4QIFA 3PW2A 3JQJA 1C1CA 5ETSA 1K1SA 5KFLA 1DQ8A 3ILJA 1MROB 3SV3A 3LGNA 3OLBA 2VZ9A 3U02A 4DFKA 4JI8J 2G0CA 5KG4A 2ZE2A 2ZC4A 3S8SA 1RK8A 1CQMA 3GJQB 1VCTA 4NLTA 3TZYA 4KHPF 3CCTA 2C2EA 2NS1B 5L1JA 3M2RA 3EDRB 2MKIA 1HWUA 3TZWA 3G82A 5M2UA 1KBRA 3EWGA 4NYOA 3DHWC 5FD1A 3Q24A 5KG2A 1WHYA 2JZ5A 4Q43A 3JS9A 3I32A 3KLEA 1WKKA 2NYHA 1FXDA 4M63A 1RWKB 1CG2A 2DXEA 3FCHA 2GGPA 4DR2J 2QT7A 3IFEA 1N56A 1OY6A 5KT7A 4K4WA 4KBIA 4X64F 1V5VA 4HTJA 1XC9A 3H2VE 2QA4G 1LWEB 5BJRA 3U7JA 2ZZNA 1TKTA 1Y3KA 2XMKA 1TAQA 4QIVA 1ZA1B 3CCQS 2RU3A 4P52A 4YFUA 5HVFA 3MM5A 4ANEA 3TR5A 1YZ6A 5C42A 4ID5A 1WNEA 3IG1B 3FVYA 4CO1A 5GAEU 3ENQA 1TFWA 1RSCA 4OFZA 3GTYX 1QAYA 4ZLJA 3RR8A 4DUZF 4AUKA 1J27A 2OSRA 2RDDA 3NP5A 3ILLA 1HI8A 4ZPTR 1AYEA 3FK4A 1Z2ZA 4DV3F 2JEFA 3M9MB 3K5PA 3A3NB 2KT5A 1U25A 1VLOA 3BGUA 3QSIA 4KYZA 3CVKA 2EVZA 1TKXB 3DRSB 3UDLA 2Y0SD 2NLWA 1OPZA 4USUA 3R7SB 4DR1F 2AT1B 3LWLA 4RBTA 1YKWA 2NUUG 4J9QA 2HAFA 5J2NB 2M9KA 3QSYB 2H5IB 1KWMA 1P9YA 3V6DB 1H2UX 5HLFA 2UUCJ 3GLJA 1Y5NB 5I42A 3E8OA 4JI4F 2AMCB 1B4SA 3M6XA 4JV0A 1WEZA 4O3QA 1MN7A 4KKOA 2V4QA 4OLOA 2V2QA 4O4GB 3WC0A 2W8KA 3HHEA 1HR0J 5ITHA 3TJ9A 1ZM9A 1SV5A 3PR5B 4RWWA 4ECYA 1SQGA 3UNYA 3N01A 2Q43A 2IIHA 5F8NA 4HTIA 2IHR1 5HQMA 4X4SA 2L9NA 4DHVA 4OJ1A 2JJ4D 2UUTA 3ET6A 3Q8RB 3DU6A 4EEYA 3I0RB 1JIHA 4DWIA 1D0EA 2ZH7A 1IQZA 1PO6A 1L3KA 3BDEA 1V3RA 2I9SA 2I1RA 2JDJA 5D0HA 3H90A 2VODA 4A48A 5KG0A 2YWKA 4K0KJ 3LPYA 1BD6A 4IFVB 2IJFA 2IAJB 2C3OA 2CQHA 3BQ1A 2K3KA 1F2GA 1RCOB 4WZQA 1IM4A 2YH1A 3M1VA 1PBAA 3M6WA 3BV8A 4JI8F 2R7OA 1REVB 3BM7A 4DJBA 2MGZA 4NL5A 2KHDA 1HBNB 1PJ6A 2ZH6A 3R5DA 2GAGC 4WTYA 1VS3A 3FMWA 1DFDA 3NGSA 4DV6F 1CJKA 4DCOB 1V6HA 3CCUS 1C1CB 5IT4A 2JLFA 3HHLC 4CLUA 1DLOA 5IM0A 4KFBA 1TUVA 2ZE2B 2R9LA 1RT5B 2HBQB 2EFVA 2ZOGA 3NCRA 4NRTA 2XS7A 1G3OA 3HKZD 4OLPA 1CSJA 2R2UA 3LWMA 3CO9A 4ZCMA 4DR2F 4GRSA 2WVCA 3M2RB 4HT7A 1O6XA 1RT4B 2BABA 4FYXB 4LBPA 4TQSA 4YDDB 3G82B 3SCKE 3IGVA 2HNZA 2G2ZA 3TO8A 3M6UA 3TA2A 3W9IA 1DQAA 3R8YA 3B8HA 1E6YA 3KLEB 4F3MA 1WEXA 5KFMA 3ZXWA 4BCAA 2VG6A 4A4JA 1JNZB 2VG5A 1SJ3P 3NGTA 5HI7A 2MY7A 2J9CA 2QLFB 4RX6A 4DSKA 3K58A 3A12A 2KYZA 2RS8A 2IM2A 5E5NA 3DC2A 2Y1LB 3VAFA 4J37A 3QMQA 1RB0A 1TKTB 4RNOA 3MDFA 3VALA 3CDUA 2DNHA 4LREA 1JLAA 1PYTA 1UVLA 3EICA 3CD5A 4AL6A 1R27B 5IV4A 3MM5B 3CJKA 4M5LA 5C42B 4LQ9A 4ID5B 3W5ZA 3KG4A 3OL6A 5FLXU 4OI0A 2LQBA 3AXKA 5BXIA 3F41A 3T19A 3PW0A 2RILA 3TI0A 3W2WA 1KN6A 2B8QA 4LSNA 4OZ0A 1FWKA 4F26A 4CI0B 1KKHA 2WW8A 1HQUB 2YKOA 3R6GB 1RT2B 1SKWA 3MFHA 2GS8A 1UVKA 1Y3JA 2UUCF 4OZ1A 4KTQA 1KQKA 3HVAA 2XLIA 1SKUB 2IYGA 1X4CA 1TAUA 5DRKA 4L75A 3ENAA 5A2QY 3ZFVA 5GAHU 1YITS 3HK2A 2AX1A 4WKYA 2E29A 2DT9A 3BKTA 1HWIA 4NEYA 1H2VZ 1ZAVA 3ZZRA 4YOEA 2J6UA 2BJEA 1HR0F 4URGA 3PKYA 3ISZA 1H98A 4EBEA 2KT3A 3BBFA 3UN3A 2V67A 3CCMS 5HLFB 2IVYA 4G3IA 1RAAB 2AYBA 3OL9A 5I42B 3HD1A 1FVSA 4PAAA 4OI4A 2N4CA 3EMTA 4PYDA 3CD0A 3QGGA 4KKOB 2OEMA 3SDEB 1Y00A 3VQSA 4Q0BA 2Q79A 4M5KA 2R7TA 2ADCA 1N5TA 1GMWD 4L76A 2LP4A 1SV5B 3LA0A 4YB7A 2MKHA 2PSZA 4N77A 1BE4A 2XSJA 2PFDA 4WXWA 1N8RT 1HL6A 4BBYA 2KFZA 2XCAA 5F9NA 3ZC4A 1HHQA 3ET6B 5DM6Q 5J1NA 4N8OA 5GMEA 5KFPA 4RBUA 1YTYA 4D3HA 3MWBA 2XZTB 1HNIB 2FVSA 3M4XA 3D1HA 1EAYC 2ROGA 5T41A 2Z2LA 4GC7A 3MUVP 3N6LA 4L3NA 3FDSA 4UW2A 1SI9A 5F8IA 3T6JA 1XR7A 3TWZA 1HBOB 3IWXA 4AXJA 4EFAC 1T3OA 4JI3J 1RT1B 2A1BA 1YX2A 3GB0A 3BREA 1KP6A 2MGZB 1U26A 1S49A 3LOUA 2GQCA 5LMUJ 3UWTA 4I4BA 1B99A 2R8KA 3F73A 3J80U 1CJKB 2F9JA 3WC2A 2BJ1A 1VHIA 2FJWA 3HI9A 1HNVA 4A46A 1DZ5A 5J2QA 4Q2LA 1N88A 4UOCA 1DLOB 4AYBD 5IM0B 4ED8A 3BF4A 2O1PA 4YS2A 1U02A 2BUNA 4KFBB 4ZVTB 1URRA 3NG8A 1AA1B 1NB2A 5E3PA 4X4VA 2C2KB 3WIVA 4B3RF 4DR3J 3FRYA 1SC3B 4RNNA 4ATNA 2BBEA 2XO7A 1T02A 2D3OR 4ZP9A 5HSPA 2XHCA 2XMUA 1GQEA 1E6VA 2HNZB 4G1QA 3KLIA 4NX9A 4NZ7A 1NK5A 1YG0A 2XYHB 1FEHA 1WHXA 3H5XA 3T6BA 1MMLA 3W3SA 3AD9C 2FGOA 1E6YB 1FJCA 2H51B 4IR1A 4L6V3 4P7VA 5E7OB 1W2BR 1B0PA 3KYLA 4CQ1A 4DLEA 1LK7A 2A3JA 2IDLA 2EFQA 2R7WA 5KOXA 3FZ2A 3O6QA 1RTZA 2ZDPA 2MZRA 2VG6B 1U47A 3NWGA 4MK9A 1NB7A 1D9AA 1XBWA 2IYIA 1LWCA 1TUGB 1Y11A 1U1KA 1QE1A 2HIQA 1BQMB 3Q22A 3LTOA 2WBRA 3DLKB 2IC3A 2ZJQQ 2YPZA 2WCXA 2J8AA 4ALZA 1JLAB 1YJNS 2B6AB 2R3VA 3CJKB 4R0EA 2N7CA 2XBPA 4DR5J 2RNEA 4RNMA 1JNRB 3M8QB 2M88A 2RT3A 2BM0A 1HKAA 2CQ4A 4C8MA 4PG4A 4RU2A 3IWNC 3GP9A 3AJDA 1U2FA 2XLJA 2HS3A 3W2WB 4LSNB 2XO6A 1G1XA 3E01A 2WB4A 2XYGB 5B0AA 2E1PA 4USKA 1UA0A 1Q78A 2W2OP 4M5NA 1Q8KA 5IC4B 2P2CB 3EM1A 3UCGA 2EBGA 1CJTA 2RB7A 5IS2A 3OTEA 1SJRA 3FGVA 1YJUA 4X2BA 3RGIA 1NPPA 4NCGA 2DVIA 4Y28C 4IR9A 2HQ3A 2K2PA 4OX7A 3CMQA 3AJ2A 4KGXB 3C8YA 1IBKJ 4NCAA 3CJ8A 3RU0A 3THTA 3KLHB 4YUDA 2YWFA 1JKHB 1B3TA 1KVKA 2DRBA 3QLHA 4M1KA 4QOTA 5KFIA 2UXDF 1U8WA 2CKWA 2E1AA 3T1HJ 1K47A 4UY8T 1NMEB 5KFVA 4J9UE 1Q82T 2N4DA 5AXKA 1FFSB 1P6TA 1GXTA 2ZH1A 1G2EA 1KQFB 4TNOA 1HQEA 3MCOA 4IG3B 3DI6B 3VGUA 2OJ3A 2M8DB 3RB0A 2V0NA 2G13A 4FF4A 2QL7B 3G6YA 2KKHA 4F0MA 3CC4S 2XSJB 4F50A 2BYCA 2EC2A 5DGBA 1IWGA 3FJ2A 2G1HA 3TAQA 1H73A 2A6OA 3O5TB 3CW2C 2GQ2A 4ZK7M 2VOOA 4QWAA 4UUWA 3LP0A 3QWPA 4EI2A 4USMA 1FXRA 4F36A 3IC1A 3EPGA 3CNQP 5LMUF 1UTAA 2KXFA 1N6QB 1KTVA 2ACYA 2D3ZA 3H5UA 4R8UA 3QNWB 5IFMA 1RP5A 4RW8A 1NJYA 1ELOA 2HQDA 5J2MB 2YWEA 2UU9J 3ZZ0A 1RA6A 1I6JA 5I3UA 5LMNJ 2G0JA 3JSMB 1NHKL 3R2DJ 4U6PA 2EG2A 4QCLA 4EGLA 2HFVA 3N0VA 4ZCLA 5AXNA 4Q7AA 5D78A 1PG5B 5CCLA 3FZBA 4OYAA 2FHJD 2GIRA 3HSDA 4P75A 4LFCJ 2CQ3A 1UW9A 4RWXA 4A8WA 2HQCA 4FXVA 3GFHA 5J2QB 4OYMA 5A6PA 2XG8A 2HVIA 1KONA 4B3OB 1T11A 3BYRA 1GMUA 2NXNA 3LPEA 1FXLA 3RRKA 1KLMB 5B7WA 1X8DA 3DFEA 1XR5A 1PJ7A 4YB5A 4LR7A 2QSFA 2UXBJ 5KFAA 3VZIA 3TX0A 4FNIA 3S01A 5GAGI 4B9VA 3NL0A 2V8DA 3OTOJ 4M5IA 3QRQA 4OZJA 1KRPA 2WOMA 2CWKA 4B08A 4ZJQA 4DUTA 4DX8H 2ZC3A 3EVMA 4LRCA 1R43A 1RBOB 1SIWB 2HBZB 2EK6A 4PPDA 1U7LA 4DV7F 3KLIB 3FRZA 2GX8A 1VISA 5DDRC 3I4PA 4ZIWA 1VQMS 1LXNA 1ZAWA 2F4FA 1UFWA 5LT5A 3BSCA 4JYAJ 3D1OA 4USWA 4AE5A 4AFFA 4OV1A 4P9SA 3J81Y 1CC8A 4IO9Q 4DV0J 3B4MA 1ZPWX 5AJ3J 1QE1B 1YJVA 4DPXA 2XI2A 4PG8A 2IC3B 2HRYA 4K59A 3DKDA 2VU5A 2MKKA 4IKAA 2NPFA 3C2PA 1GX6A 4DDFA 1K0TA 2JOQA 2IJNA 1RI7A 1OPIA 1WF0A 4CLSA 1B64A 3K5OA 4NLQA 2LEBA 3FSXA 4QYZJ 2CZ4A 3SQGA 3TUPA 1F9FA 4OI6A 4NI2A 4YY3J 2DEIA 2QJ3A 3E01B 4DQRA 1CS4A 1IKWB 3J7Z5 3DGVA 4ED6A 2EFNA 1U24A 3ULHA 3RBZA 2ASLA 1VQ8S 3U1LA 1B0TA 1RISA 3GYGA 1S6UA 4K4VA 3QPIA 1P27B 2M8HA 1CJTB 2MQQA 4I6AA 4ZN3A 3VAGA 4YQWA 1X31C 3I56S 3W61A 2O3DA 4F8RA 1P9QC 1N5QA 2XMWA 3CD7A 4NCGB 1Q7LB 2NZCA 2JRSA 3DOLA 2X1GA 4IH7A 2LMIA 3BSAA 1R6VA 5MAOA 3L3CA 4X4RA 4YR3A 5GVQA 5SUHA 5L46A 5LL6d 4ANCA 1KOHA 4HLBA 3IRXB 4ZPVR 3SQOP 3PO4A 3R97A 1IXKA 3QLHB 3O1LA 2FJXA 1LXJA 2VJVA 1IKXA 2ZJPQ 2HVEA 2CJAA 2UZAA 4IG0B 2XQCA 2VIHA 2Z8QA 2UVWA 2V69A 1HQEB 5F41A 5HROA 3BS9A 5A8RA 3S1TA 3HDSA 4LRFA 3PNIA 2NQPA 2A10A 2BM1A 2F9DA 1NRKA 1Q7YT 4YEAA 1U09A 2WK4A 3PACA 1UEUA 1PC4A 2ROEA 2DK2A 1FRIA 3KLFB 2UP1A 1GAOA 2YVSA 4LBHA 4AT1B 5GAEI 5LMNF 1TL7A 5DG9A 3H5SA 2FZGB 3AD8C 1QAXA 2QLJB 1RT7A 1B7YB 2QA4S 4U7UK 1MG7A 1SJFA 2DNPA 5KFFA 2HHPA 4IFYA 4CTAB 2UVRA 1FERA 3AB2B 1DRZA 4R8UB 2ALZA 1T9XA 4Y2MA 3PIPQ 3B54A 3R7NB 4RW8B 1WG1A 4XK8C 1X7VA 2Z56B 2X7IA 3N4WA 2NSCA 3FUYA 2DO0A 1HHSA 5I3UB 2FHKA 4ZOSA 2HS0A 3R9LA 2NREA 3MD3A 4M5DA 2OGUA 2UV8A 3OVAA 1S0VA 4UOHA 4DPYA 2PEBA 1D9FA 2D7SA 4QPXA 1D3WA 4CYUB 2YWWA 1FNOA 2V2ZA 4NWBA 2J5AA 4C8LA 1ULRA 3GIRA 3ETOA 2YNGA 1HQ2A 1MMNA 3W63A 2CG4A 2HHUA 2VBWA 2HURA 5CYQB 1OQ6A 1RLCL 3CO0P 1Q1KA 2JWNA 3H20A 3RB6A 1TV6A 3FQLA 1NK6A 1NO8A 3QQCD 1KHVA 4W92B 4XTTA 2XS2A 4JYAF 1QSSA 3MPVA 2JL9A 4DV0F 2CJYB 5AJ3F 3NGKA 2AGQA 3PFOA 2ASYA 3NWRA 4WIIA 3MMBA 4U8YA 1X4AA 3QRPA 2Q6CA 1RAFB 3BQ2A 1VIOA 3G8TA 1UJ5A 5E41A 1JLBA 1H6KX 5C24A 4YB1P 2QV6A 4RR5A 1AB8A 2W4PA 3HMJG 1IWAA 5K14A 4ZDNA 2IM3A 1BWVA 2MLXA 3FSYA 3CSKA 4MK7A 2KM8C 4LF9J 4CDIA 2XMTA 4AXIA 3HKWA 3KG1A 4FXWA 1FX4A 1TMMA 1T9TA 3NS5A 2B4UA 1QD1A 3IGNA 2BKPA 2AIRB 1VK8A 4P74A 5E0OA 3M05A 5IZHA 3V2UC 3SQGB 3PR4A 4FYYB 1QTMA 2HFNA 1U49A 5H9FJ 1FCAA 3Q2SC 3T5HA 3CMES 2NXEA 4LF2A 1NDLA 1PC5A 4NXMJ 4ZCKA 2J7WA 4WYWA 1TR0A 1X0FA 3OR2A 1U0SA 2ZZMA 1C2PA 1XEZA 3LW5C 1IVZA 2V2VA 5H9EK 3NKYA 5RUBA 4RKUC 3OJSA 2EK1A 4PPZA 3DOLB 2KTQA 3UE2A 1FJEB 2XMAA 4HHUA 1T9YA 2BJ7A 4F4WA 2AD9A 2GMLA 3MI7X 1Q8BA 4DPTA 3DRPA 3DXSX 2B56A 4O23A 2L9DA 4LFBJ 1S9EA 4DQSA 5IQ6A 2BV3A 5DM7Q 2XGQA 3H7HB 3DDIA 1XERA 4ED3A 5ADZA 3A8EA 4WZMA 5F0WA 3KDNA 2V8HA 2YKNA 1IKXB 2BW7A 2Z2ZA 1S97A 3A8JA 3P45B 4A8OA 5HMYA 4B17A 3ITHA 2QMUB 1D1UA 1OWXA 1QLNA 3PRBA 4JB8B 2J9EA 5HROB 3QZ8A 4WU2A 5A8RB 2CQBA 3ILIA 3M8RA 1FWPA 1OY9A 2G2OA 3QGPA 1RAJA 3W60A 3CJ5A 2NR0A 3FBFA 3JTPA 2CPFA 3OSPA 5HBMB 3OL7A 3UR0A 4Q8EA 2CVIA 1TL7B 3QT5A 2DGTA 3DLJA 2HQGA 1N0UA 1ZM3A 2AJFE 3M2VA 2V6AA 3FC9A 4FP9A 1M0SA 2P5VA 2IBKA 3KDOA 2EXUA 2IJRA 3TW0A 4V19J 4IFYB 2AZ3A 4P2SA 2BKNA 1PGZA 5F8HA 1DTQB 2EPIA 3AOCA 2OEKA 2VH7A 1R0AA 3SEOA 1IBCB 2MQLA 1NKEA 2Q3PA 1RBLA 2M52A 3TJAA 2JEGA 3PYDA 3M32B 2HFOA 2FY1A 4ICLA 4LVNP 4HDHA 3ZTRA 2LQJA 2RD5C 2W24A 5GAHI 1WF2A 5KFZA 5C2GA 1S1TA 2G4BA 4GVBA 1VQNS 2W9AA 4OYWA 4F0HA 3BBCA 2R7QA 5ETPA 3ZTQA 5B0FA 5CA5A 4ILLA 2YXLA 4H54A 4ZPDA 1XWLA 3TA0A 2ZHAA 5D0RA 1VBZA 1WUUA 1YQHA 2YNGB 4ER8A 1OMSA 3G2XA 1F5BA 2AWZA 4KPYA 2CJ9A 4DBQA 1YBAA 1HNZJ 2LXFA 2QC3A 4JV1A 1MN9A 1TV6B 3MR2A 2DCUB 3FFIB 2FLOA 3HVRA 3K2YA 3B6BA 4FPIA 2DNYA 2XY5A 4CWBA 5IXUA 4CNYA 1QJHA 3CTRA 3GE9A 3LALA 3TOQA 4KGVB 1KR4A 2QLBB 4BWMA 1KEKA 4OHXA 5LOQA 3H2UB 2J7KA 4LF9F 2ROPA 5KFSA 1U2RA 3VWSA 5D4PA 3MMBB 3CJ4A 4LF8J 1UCNA 2WW4A 2YNFB 1T7PA 1NJXA 3OUYA 4F2RA 2HYIB 1I1GA 3Q8QB 4K2JA 2V63A 4WFYA 4C8OA 1ZTWA 4OI1A 4DL2A 2HHSA 3W64A 5C24B 2JEIA 2A2DA 1U8SA 1YVFA 1UKUA 1Q8LA 1C4CA 3TRGA 3I0SA 3RG6A 5K14B 5B09A 4DFMA 2AW0A 3DOMA 2B7CB 3UVJA 2IA6A 4NXMF 1HARA 1XMQJ 2AEFA 3HJVA 2CJXB 2P8IA 4EYHB 1SXLA 2BJ9A 2ZZTA 5D77A 2KH9A 2VD3A 1NSAA 2MMYA 1F6TA 2QIFA 2GFFA 5L1KA 4MFBA 2XGPA 4LSLA 1RTJB 1Z4UA 2D9OA 1RXOB 4F7VA 1ACMB 4H4OA 4RZRA 2B51A 2C3MA 5CQGA 1NPRA 3EYZA 2DISA 1Y5IB 2C3PA 4NLYA 4ECQA 4DCJB 1GNKA 3ZTSA 4LFBF 3OR2B 3OXGA 3PEJA 1XK8A 2HMIA 2QL5B 3D0GE 2DY1A 5DDPC 1TK0A 2AJQA 2B4OA 4ZITA 2OO4A 3LAKA 3OLAA 3W7BA 4PXCA 4LQ3A 4FYVB 4ZLLA 2D1CA 2GCFA 1OYDA 3KUGA 4DF4A 3D9BA 4NMLA 3H4DA 4ES1A 5CHCB 2VG7A 4PZVA 2I0XA 3MM7B 3VR1A 4MAKA 1EETA 3TQ1A 2QLXA 5CABA 3IS9A 3DRPB 1RAOA 3U27A 3I9ZA 4RBVA 1KVJA 5EX0A 1S9EB 2ZBPA 2VFTA 3QO9B 3RRGA 4OIXA 2XSFA 4OZ2A 4DUYJ 2AU0A 4JI0F 4DV5J 1Z1ZA 2VFUA 1GT8A 2I38A 2F65A 1UWBA 3HFZB 4E2FB 2YKNB 3LQVA 4B9UA 1EB0A 2QYCA 3ITHB 3TVZA 3C46A 2NYIA 5KFCA 3THPA 1CJUA 3C66A 3KNAA 1GMVA 1ZTTA 2VC0A 4GKKJ 2MTLA 5CXTA 2R8HA 1N54B 4WFXA 1F3VA 4QU7A 1S7HA 3DU5A 1K0VA 1FHTA 3CJ0A 2LLZA 3DMJA 1U1RA 3W5YA 2GIQA 1APSA 5I3PA 2DTJA 3ISND 2H65B 1D8ZA 3DDKA 4F4ZA 3LANA 3VZHA 3TNVA 4K50A 3JYTA 5EGYA 4KGKA 2BE2A 3HPOA 2DXDA 1HPZA 4YR0A 4WJBA 2CXEA 1N5YA 3CUNA 4AQYJ 3R5JB 2CRLA 1O8BA 2FPHX 1RWOB 3G8SA 4M5JA 4OZNA 3MOJB 1R0AB 2CJQA 3MM9B 1FJGJ 3KFWX 4MKAA 2MJUA 3AOBA 4KRWA 2BJ3A 3R5AA 3T1AA 2EFPA 1WF1A 1UAWA 1YK9A 1HNZF 1DJ0A 4O44A 7FDRA 2CQGA 3CDBA 1S4FA 3OHBA 2GA7A 4ZVEA 2V2KA 4QR2A 2LKZA 4DOZA 1WOPA 4CH0S 5IV3A 5I3QA 3J7A1 2DYAA 1SCJB 4GKJJ 3UFCX 4TU8A 4ZP6A 2ZWOA 2Q66A 1UJ4A 1I5OB 4JI1J 1R8HA 2MZJA 4QWDA 5B08A 3LH2S 4B9SA 2HHXA 4ZVHA 1VQ5S 4OYBA 2DNLA 2NZ4A 4DZDA 4USTA 3UPFA 1WJ9A 3BO2A 1J5EJ 2GV1A 3ELHA 3A1YG 1ZAXA 1V9OA 2AZ1A 2KFYA 1AUSL 1T9VA 2HWHA 1YJ7A 3OT9A 3G8QA 1HYSA 1NHVA 4DSEA 4UZBA 1W26A 1RGVA 1YRUA 3PX4A 2W2NP 2HGMA 1RKJA 4J7CA 1XMQF 3JAMY 2RMLA 1YGYA 3IR7B 2EFGA 2CZVC 2OH2A 1RHKB 2F1FA 1RLDA 4WK1A 3EVOA 4B3TF 2ZUGA 2E7XA 2KVIA 3RB3A 2J76E 5CH7B 3A3OB 1VRTA 2MYFA 3WHIA 4WFNQ 2PI5A 2HRUA 3IXQA 1NKCA 5A2QU 2DJWA 4ECTA 3UVJB 3M9OB 2LECA 5CD4H 2WVBA 5LSLA 1NK0A 4F04B 2CPZA 3MR7A 1S7IA 1FD8A 4KHRA 3THVA 3PJ9A 1A7GE 3HZGA 3ZZTA 4P7TA 3ICLA 4KH0B 1WKJA 3ENVA 1YJTA 4I2PB 3CJSA 4MFBB 2PI4A 4NLXA 4LSLB 1HD0A 1CBKA 4ETXA 5LSRA 1FE4A 2OPPB 5IWAJ 4H4OB 3HSZA 4L72B 3D2WA 5AE2A 4AL7A 1YJ9S 2HMIB 2VA3A 1S0MA 2K7KA 1WOOA 1RWXB 2POKA 2WZ1A 4X4NA 4CM2A 2D69A 4HT5A 2VG7B 4KO0A 4K4UA 2DNNA 4WPAA 3IP0A 1EETB 4NRUA 2JH3A 3QAEA 2DKOB 4GKKF 2CFXA 2LXUA 1WD6A 4X64J 2DPIA 2ZUAA 2GJIA 3BKFA 4MMOA 3CXCR 5F3TA 5KOWA 1UWBB 5D3GA 3CEDA 3TARA 1I51B 5K20B 1WC0A 4JV5F 3GYXB 3BBBA 4O3OA 1UZHA 4DFPA 1O0PA 1CJUB 1RTHA 4CH1A 4B3MJ 5GMDA 4CIOA 1Q5VA 3CMAS 1U1LA 1UJ6A 3AXMA 2R42A 1DBDA 2HLUA 2V5HG 2UXCF 1HWLA 2C3YA 3D7SB 5ETVA 4DV3J 1S5ZA 4X62J 3NLCA 1FJGF 1FNMA 3QWUA 4F0KA 2Z57B 4N7TA 3HT0A 1DARA 1JQGA 3VGVA 2BMBA 3VAMA 1RWVB 3JYTB 1PYSB 2BE2B 3DLBA 2CDQA 1HPZB 2FZCB 3D66A 4CO3A 1N5YB 4DL7A 4UF4A 2E5LJ 1BQXA 2H4WB 2NPIA 1V3SA 4USIA 3DLGA 4FPRA 1M5PC 3EXCX 3I5CA 3FBCA 2HHHF 4GKJF 3VF0B 1X5TA 2LFVA 4JI1F 3N79A 3V4IA 4EO6A 2WB1D 3L95X 3WQPA 3AY0A 4Z7CA 4O44B 2CPHA 5E2QA 1WACA 3AA9A 1HHTP 1J5EF 2HFZA 2M70A 2PGCA 2SXLA 2RVJA 2CWXA 1RKIA 2BJ8A 1Q81T 4C3MA 4QPTA 4K4TA 2YWHA 4YDXA 2RKIA 4OX6A 3UQSA 2F63A 2VKRA 1RT3A 1F60B 2ZFHA 3TAMA 4FYDA 4DL6A 3C16B 1RHRB 4ZVFA 1LFWA 5KFWA 5IT0A 4LIRA 1R8BA 1X4EA 4V19X 2VOPA 3US5A 3EXYA 2OFHX 4MKVA 3MXHP 5IC6B 4WFZA 2HAIA 3IR5B 3F56A 5E3RA 2PA8D 3NNCA 2DCLA 3H2LA 5JVGQ 4WP9A 3BR8A 2Y0BB 3K5NA 4DL5A 4ZPAA 1KFSA 5D0GA 3K8WA 2Y8WA 4YHHF 1FNXH 1X0PA 2MSSA 3UR3C 4R0JA 1U1PA 1NSKL 2R2RA 1H7XA 4X4TA 5HMWA 1R3NA 1N34J 4Q5VA 1VRTB 3MECA 2AF6A 2L08A 2XMVA 2YWGA 1X5PA 5IWAF 3SCLE 5DZ7A 3GJRB 3MUMP 4A8QA 2V4RA 3Q8VA 5F8LA 2DRDA 4JI7F 4YB6A 1VBXA 1TL3A 3ZNJ1 4DV6J 3MR6A 2CJBA 4I7FA 4DCPB 5HP1A 1SQEA 5C5JA 2AYGA 4PQAA 2XTJP 3L09A 3PY8A 3V4MA 4ELUA 2KU7A 2IMOA 3DYAA 2B8PA 2MKYA 4K8RA 2J8SA 4DPWA 3CJRA 3NOCA 2CVEA 4DPUA 2Y1RI 2QO3A 5G4DA 2DGSA 2DNKA 3OFEA 1AT1B 2PN6A 2IRXA 3GU0A 2I8EA 2JFDA 1FRHA 2ZH5A 4CRJA 2O01C 3Q8PB 5DGAA 3BR9A 2XEXA 1IQTA 5DQIA 3GSIA 4P6QA 1NKBA 3V5RA 1UVJA 4DU8A 5CAAA 4N5SA 2HHWA 4CLKA 3G71S 4KO0B 4WE1B 3KMSA 2QGFB 5CYJA 4B3MF 4HACB 3GJSB 4L74A 3I5AA 4Y0FA 4M8LA 4ZP8A 2F3JA 3FNNA 5BYRA 4X62F 4NLDA 2B43A 1PSDA 3PIOQ 3PVXA 2F40A 2HHQA 1S9GA 4C48A 4A8SA 2V9KA 2DNRA 3CCRS 4OZ3A 2BQRA 4EUVA 2FHMA 3DRRA 1RTHB 2DXFA 3PG9A 5KFKA 5DETA 2E5LF 1SL1A 3CC2S 3R7BB 3KLGA 2CIMA 3T9NA 2ZVIA 1T03A 4AL5A 4LSZB 1U0HA 1FRJA 3J7YU 4FF1A 1S6PA 5DZ6A 4NLWA 3IA0A 2L41A 2MZTA 5HAOA 4DV2J 2X1BA 3BO4A 2HQFA 1PKUA 1VBKA 3VGSA 4C0BA 1LKZA 1RT6A 3GONA 2EFOA 4LUBA 3DLGB 4OZ5A 1VC0A 1OSDA 4ECVA 4GO5X 4KQZA 5AT1B 1VJQA 4PXEA 2A0FB 4X4PA 3NMAA 3WZ0A 4I0WA 3GILA 1PIEA 2JVRA 3NBPA 1CJVB 4FYWB 3FCWA 1M5VC 5F8GA 2HLTA 4ECZA 2OAUA 3GG1A 2OIHA 1Q79A 3V4IB 4DR6J 5L9XA 4E98A 1SUQA 1M5SA 4TXSA 3R6LB 2HSEB 2HS4A 4UQGA 4OYZA 1WWHA 4C97A 2DHGA 4S0MA 2ZH2A 2BACA 1GMWA 4IUFA 4LF7J 4K5SA 4P2MA 3CPWR 3OQ2A 2WVDA 2KFNA 1XQIA 4RUAA 4FZVA 3R5GA 2RKIB 1VR6A 3BO3A 3A8KA 1RT3B 2HGLA 2K06A 3TAMB 3RAXA 3KK2A 4IRCA 1M5OC 3J81U 5H1SV 3AODA 2E1RA 4JI6J 2V4JA 4OYXA 2VKZG 3EZ5A 1JJHA 4DSJA 2R7UA 2JLGA 2RHQB 1FRXA 3FEXB 3E51A 4KV8A 3W65A 4M5GA 2XB2D 1SC4B 5L1LA 1F5AA 2DD8S 3FMBA 2VDIA 1N34F 4MKYA 2ZKUA 2IRUA 2DITA 1QUVA 4QYRA 4F4YA 3PEHA 3QFHA 3PHEA 1BHNA 1IKYA 2BA9A 1GTHA 2JVOA 1WORA 1I3OB 2QL9B 3MEGA 1N36F 4ZJLA 4H4KC 4ZLNA 2C22A 3D6MB 2UUBJ 2A2CA 1AW0A 3A13A 3CE8A 4OYIA 2KJWA 1T95A 2DRAA 1G4CA 2LA4A 3KHHA 5CYMA 3BB5A 3T5JA 3OXFA 3HT3A 1S0OA 3FEYB 4X84A 3R1HA 3ZO7A 4F4AA 4HI1A 4EZ6A 5GMKa 3HHLA 2E9RX 5U47A 1HNXF 3DYAB 4RW4A 3H98A 1UEKA 1BUXA 1RA7A 5EWGA 3B4DA 2XWXA 5IOLA 4RW9A 2BE7D 4ITSA 3CB4A 3PV8A 1TK8A 4U7CA 3DOKA 3IM9A 4B3RJ 2GGPB 2P9EA 2VJUA 3POTA 2QYGA 5KG5A 1YDLA 1H74A 2YQ1A 4KGMA 3K57A 2DNMA 4J90A 2HVDA 4ZVPB 3GIKA 2YKQA 5A0YA 1UVNA 2OLWA 3LAMA 3K59A 3U1NA 3QIDA 3UCUP 4NLOA 4PG5A 1P8GA 1UMJA 1GXLA 2FTRA 1SVDA 4I67A 2VQEJ 3UW1A 1NH7A 3CDAA 1K73T 3ZNUA 4ILMA 1YSJA 2RRAA 3M8SA 2WSCC 4PUOA 2LU1A 3LO3A 3VVUA 2JEJA 2CNKB 2RF2A 1ZZNA 5KFXA 2FLPA 5J1PA 3GZ7A 1RHJB 3Q8SB 2K8GA 4DV2F 2DNQA 2PIIA 2DPJA 5LM7E 2VV5A 4J9KA 3DRRB 4WBFA 1UFKA 4DL4A 4I6WA 1S6OA 1DQ9A 4OV6A 2W9CA 3OTBA 4PWDA 3P6YC 1DAXA 3TUIC 2KRRA 2C28A 2DNGA 3KLGB 2QX0A 2DHXA 2CNOB 2HNDA 3C15A 1IBMJ 4Q45A 2GMHA 2RHSB 4CH7A 2KVQE 1U0HB 4R5PA 2VBZA 1S6PB 4DR6F 1F9EB 3UDVA 2MLYA 3QGHA 2QLWA 1Y9OA 2Y1JA 2W01A 3OHAA 3HLUA 3KHLA 4U67Q 1RT6B 2RUSA 2VICA 1WI8A 2WSFC 2DGWA 3MEEA 2HFSA 1DURA 4FBUA 3IAS9 1S99A 3W62A 4LF7F 4ZMMA 4I2QA 2EW9A 5JVHQ 2GNKA 1FRLA 2J7UA 4NASA 2NXCA 3NBPB 4ELVA 3PJWA 5LJ5Y 4DSIA 1N5VA 4JI6F 2MB0B 3SZ2A 1RZMA 2MHEA 4OYOA 3EGWB 1VQPS 4JP8A 2UXDJ 2GQQA 1TVRA 4O3RA 1SKSA 1F9HA 4F02A 2OUGA 2QFIA 2QTWA 5DG7A 1WOSA 1FK9A 1S1XA 4LF5J 4QR1A 4J5OA 3KOAA 1MROA 1SH0A 2FD2A 1FTCA 2HFUA 2MQNA 2UV8G 3ONQA 2V4JB 1X9MA 3PX0A 1OIAA 4ES2A 2JLEA 3M8YA 3M1VB 4B3SF 3SXLA 1S4EA 3N6NA 1PBUA 3JXOA 4KV8B 3SSQA 5CD4A 1JLEA 2UUBF 1EARA 4MYUA 1ZYQA 4Q44A 1LV5A 3JSRA 3IR6B 1NJIT 1EKRA 2FJVA 3QJLA 2W7OA 1U4BA 3BJYA 2CNNB 4X4QA 1RTIA 1IKYB 1M5HA 5H9EJ 2ZOFA 1WC5A 1WC6A 1M1HA 3HP6A 1JXEA 2RJZA 2FHJA 4MJKA 2VBXA 1P1LA 1R8PA 1O5JA 2W2QP 2F8MA 4P2XA 1TQLA 3N9UC 4ZPWR 4ZPCA 4LMZA 2R7VA 2YNIA 4DR4F 4I1TA 5F3ZA 4UOGA 3QYYA 5CYMB 2PE8A 3H5YA 3KHRA 3MPYA 4MYTA 1ZOTA 4CO0A 3H8YA 4XDDA 1N0VC 2XI3A 3HHLB 4FVMA 4RW4B 3AFGA 2IPOB 1MMDA 2MDAA 3DOKB 2V8PA 2VQEF 1RQ0A 2VG5B 1M5KC 2VFRA 1U6BA 2MY8A 3R2CJ 2Z2YB 3TQEA 5A0YB 3N28A 4DV7J 1VRUA 2HZVA 2APOA 3IRWP 1ZPVA 1TKXA 1NU4A 1HI1A 1NPKA 1KQGB 3A3PB 4Z2XA 4URQU 2ZITA 5BR8J 3Q8UA 4XAKA 1QVFR 1X4GA 1U1QA 4KHMA 1VHFA 1AZSA 4KPCA 3QGIA 3C19A 4LRBA 5J2NA 3LP2A 3DDNA 4PWWA 4PUOB 1IBMF 2V8GA 4KAIA 3OJUA 1VQ6S 2XNQA 2HVZA 1RU2A 5A76A 5K8NA 5JXSA 4JV2A 3JQKA 4U96A 1F1BB 1NHUA 2YKMA 2I2YA 2W9CB 4PWDB 2H4YB 1C4AA 1RYRA 2ZNZA 3SCIE 3MHYA 4ED7A 2OD6A 3C15B 5A6WA 2MZSA 4PRFA 4F4KA 1NZ8A 1RWUA 1CEZA 2E66A 2Y8YA 4Y6IA 4R5PB 4EMDA 1WI6A 3W8GA 1M1GA 4NLGA 1HWKA 3MTKA 4C8NA 3MR3A 3PRDA 2XWYA 2VASA 3AOAA 2PA3A 1XNRJ 1XR6A 1UA1A 4TVAB 2ZWPA 4WTOB 4LF1A 3P5BP 3X1LB 4CLZA 4ZLPA 4JBCA 4LF5F 4Q0BB 2BQUA 2B7BB 4OX9J 3X3UA 2MJNA 4H4MA 1CQNA 4PCQA 2WHOA 2J0SD 3P49B 2BR0A 3WBZA 3GPAA 1BMQB 2NXJA 3D3CJ 1HBNA 2J9DE 2P9CA 4PXBA 2KI2A 1ZH5A 1TVRB 2DO4A 4WWSA 3UN2A 5LXRA 4DL3A 4RL1A 1VBYA 1S1UA 5KT3A 4L73A 3GSDA 1XJWB 2OMLA 3TYTA 3M8WA 2YBVA 4PG7A 1S1XB 2MZQA 3AA8A 3QZ7A 1VOMA 1R6YA 4C3LA 1NM2A 4LBIA 5T14A 5GADU 1BY9A 3MAQA 4QWEA 4OHVA 2AGOA 3SMZA 3KKFA 3IMQJ 4A47A 3BN4A 1HLWA
chains in the Genus database with same CATH topology
1NPKA 4O0NA 1LWXA 1MN7A 2B8PA 4W98A 1NDLA 4F36A 2NCKL 3BBCA 3ETMA 2HVDA 1NCLA 3FBBA 4UOFA 3ZTPA 3ZTQA 3Q8UA 2DY9A 2BX6A 3FBCA 4C6AA 1K44A 4ANDA 2DXDA 4S0MA 1NSQA 4UOGA 1HHQA 3PJ9A 4DZ6A 2HVEA 2DXFA 3FBFA 4ENOA 3EE3A 2ZUAA 3FBEA 2CWKA 3MPDA 3R9LA 1WKJA 3ENAA 3Q86A 4KPCA 1EHWA 3NGSA 3ELHA 3ZTOA 3NGTA 4DUTA 2AZ1A 1NB2A 3EVMA 3G2XA 4DI6A 5CABA 1XQIA 3JS9A 4UOHA 3NGRA 3BBBA 1WKKA 4EK2A 1ZS6A 1U8WA 1VYAA 1F3FA 1PAEX 1NSKL 1NLKL 4CP5A 3VVTA 5C7PA 3FC9A 1NHKL 3GP9A 2DXEA 1MN9A 1F6TA 3Q8YA 3BBFA 1LEOA 3EICA 3GPAA 3B6BA 2AZ3A 3L7UA 4F4AA 1PKUA 5CAAA 3VGSA 4HR2A 1JXVA 3VGUA 3FKBA 3BH6B 3Q89A 1W7WA 3VVUA 1HIYA 1XIQA 3Q8VA 2HURA 3FCVA 1S5ZA 4FKYA 3EMTA 3EVOA 3VGTA 1BUXA 5BXIA 3DDIA 3NGUA 3VGVA 3EM1A 5IOLA 2BEFA 3EJMA 3PRVA 2B8QA 1UCNA 3DKDA 1NDCA 3BH7B 1S59A 2VU5A 1KDNA 3WX8A 4WBFA 1NSPA 3Q83A 3ZTRA 3ZTSA 4ANCA 4ANEA 3EVWA 1NUEA 2DYAA 1B99A 3FCWA 3B54A 1B4SA 1BHNA 1NDKA 1WKLA 1S57A 1NDPA 4FKXA 1HLWA 1BE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPK A;  4O0N A;  1LWX A;  1MN7 A;  2B8P A;  4W98 A;  1NDL A;  4F36 A;  2NCK L;  3BBC A;  3ETM A;  2HVD A;  1NCL A;  3FBB A;  4UOF A;  3ZTP A;  3ZTQ A;  3Q8U A;  2DY9 A;  2BX6 A;  3FBC A;  4C6A A;  1K44 A;  4AND A;  2DXD A;  4S0M A;  1NSQ A;  4UOG A;  1HHQ A;  3PJ9 A;  4DZ6 A;  2HVE A;  2DXF A;  3FBF A;  4ENO A;  3EE3 A;  2ZUA A;  3FBE A;  2CWK A;  3MPD A;  3R9L A;  1WKJ A;  3ENA A;  3Q86 A;  4KPC A;  1EHW A;  3NGS A;  3ELH A;  3ZTO A;  3NGT A;  4DUT A;  2AZ1 A;  1NB2 A;  3EVM A;  3G2X A;  4DI6 A;  5CAB A;  1XQI A;  3JS9 A;  4UOH A;  3NGR A;  3BBB A;  1WKK A;  4EK2 A;  1ZS6 A;  1U8W A;  1VYA A;  1F3F A;  1PAE X;  1NSK L;  1NLK L;  4CP5 A;  3VVT A;  5C7P A;  3FC9 A;  1NHK L;  3GP9 A;  2DXE A;  1MN9 A;  1F6T A;  3Q8Y A;  3BBF A;  1LEO A;  3EIC A;  3GPA A;  3B6B A;  2AZ3 A;  3L7U A;  4F4A A;  1PKU A;  5CAA A;  3VGS A;  4HR2 A;  1JXV A;  3VGU A;  3FKB A;  3BH6 B;  3Q89 A;  1W7W A;  3VVU A;  1HIY A;  1XIQ A;  3Q8V A;  2HUR A;  3FCV A;  1S5Z A;  4FKY A;  3EMT A;  3EVO A;  3VGT A;  1BUX A;  5BXI A;  3DDI A;  3NGU A;  3VGV A;  3EM1 A;  5IOL A;  2BEF A;  3EJM A;  3PRV A;  2B8Q A;  1UCN A;  3DKD A;  1NDC A;  3BH7 B;  1S59 A;  2VU5 A;  1KDN A;  3WX8 A;  4WBF A;  1NSP A;  3Q83 A;  3ZTR A;  3ZTS A;  4ANC A;  4ANE A;  3EVW A;  1NUE A;  2DYA A;  1B99 A;  3FCW A;  3B54 A;  1B4S A;  1BHN A;  1NDK A;  1WKL A;  1S57 A;  1NDP A;  4FKX A;  1HLW A;  1BE4 A; 
#chains in the Genus database with same CATH topology
 1VK3 A;  5C2C A;  3WDO A;  1RT5 A;  1FVQ A;  3T1Y J;  4TU7 A;  1JLE B;  4KE5 A;  2KG1 A;  1HBM A;  1Y4Z B;  2Q1L A;  2OKQ A;  3NCP A;  5J1E A;  2JHE A;  3T9Z A;  1RT4 A;  4C11 A;  4QU6 A;  1RTI B;  1WG4 A;  3K5L A;  2FB0 A;  5EDW A;  1HNV B;  3Q8Y A;  4HH1 A;  3D54 A;  2MKS A;  1AUD A;  4NA3 A;  2RAQ A;  1W7W A;  2OTL S;  2C2O B;  1YWX A;  2ZBQ A;  3NGU A;  2FJB B;  2YNI B;  5LSO A;  2ZJR Q;  2RSQ A;  5F8J A;  1JWW A;  2P9G A;  1TL1 A;  4QIG A;  2G9O A;  4P10 A;  3BKU A;  1RCX B;  3PFE A;  3V6H A;  2QE5 A;  1RAH B;  4NLR A;  1E6V B;  3PYF A;  4G1Q B;  3NNA A;  1B0V A;  1T3N A;  5IT9 Y;  3R27 A;  2VUG A;  5DO2 A;  5EHH A;  1MNE A;  2CDR B;  1RTD A;  1JK9 B;  2C3U A;  1H7W A;  1GX5 A;  1WC4 A;  2HQI A;  4OX8 A;  4J9O A;  2ADB A;  5BR8 F;  1Q4R A;  2IMW P;  3W9J A;  1G7C B;  5C25 A;  1UEV A;  1TK5 A;  3KJF B;  2F7V A;  1LWC B;  5KFQ A;  1HQU A;  2DHS A;  4KIA A;  1JX4 A;  1RT2 A;  2ATL A;  2AEM A;  5SZT A;  2W7A A;  2PDA A;  2O5D A;  1VRU B;  3CIZ A;  5MLC V;  4ZJO A;  4MH8 A;  2BRK A;  3OPK A;  2GAH C;  3RBE A;  2CQD A;  2PD1 A;  4ZVU B;  2XHW A;  2RQM A;  2U2F A;  5HAT A;  4KT0 C;  2GVD A;  2R8I A;  3ADA C;  4J9R A;  3EX7 B;  3GV8 B;  4IQM A;  1L3S A;  3UD3 P;  1AZS B;  5K8O A;  1IJF B;  2CQ1 A;  3MED A;  2V50 A;  3CCL S;  3LP2 B;  4KSE B;  1BLU A;  4ZVR B;  3QIP A;  3PYG A;  3GMG A;  2M4M A;  5E3Q A;  2EEY A;  4J9L A;  1WG5 A;  5HK4 A;  4UY8 5;  2HWT A;  3OD2 A;  1T0T V;  4OHZ A;  1X5S A;  4PYA A;  3DRY A;  2DY9 A;  4AND A;  1SPB P;  3CCJ S;  2BJD A;  2KXH A;  3EGV A;  2G0I A;  3K89 A;  3PX6 A;  4UT4 A;  2VBY A;  2M5Y A;  1PYO B;  4K2X A;  1B7F A;  1XTZ A;  2YKM B;  1XNR F;  3SDE A;  1WDT A;  5CZX A;  2CPE A;  4G65 A;  2EBE A;  4USJ C;  1YLX A;  3MEK A;  1L3T A;  1N33 F;  5KTQ A;  3G4S S;  2YX1 A;  3FQK A;  4OQJ A;  4OX9 F;  3K8V A;  4Z7Y A;  4U9R A;  4Z37 A;  3VGT A;  2LVW A;  3W8P A;  4C2M A;  4WKR A;  2NUH A;  1QY7 A;  2KZM A;  3G6E S;  2VB6 A;  3M8Z A;  2AJ2 A;  1M90 T;  1HNI A;  1Q95 G;  1NUE A;  1RHU B;  2KJV A;  4WF9 Q;  1NDK A;  2B4V A;  4LFA J;  5K9F A;  4LF6 F;  2F4V J;  1SJ1 A;  5F0U A;  1PAU B;  3DRX A;  3BGF A;  2NCK L;  4LIW A;  1OYE A;  4H4M B;  1TFY A;  1WTB A;  1HBO A;  2MST A;  5THW A;  2ZKT A;  3MF5 A;  2FVP A;  6FD1 A;  1WC1 A;  3EZU A;  5DQH A;  5ETO A;  4NZ6 A;  1RT1 A;  3KXD A;  5HVH A;  2W25 A;  2GHW A;  2X3G A;  3T1Y F;  3JAM U;  1EP4 A;  1YBU A;  1REG X;  2Y9H A;  1S1U B;  5A8K A;  2DIV A;  3LP0 B;  3O44 A;  4A8Y A;  4FVC A;  1M1K T;  4NYP A;  2F8E X;  3K17 A;  1RWP B;  2BQ3 A;  2PMH A;  5I4M A;  5KG7 A;  1KNZ A;  1OSC A;  2W9B A;  2C2N A;  5ETN A;  3P4U B;  4TN2 A;  3PZP A;  4RNF A;  3MR5 A;  1ZBT A;  3QT8 A;  3P5T L;  5DG8 A;  3CIM A;  5L8R C;  4Y00 A;  1AFI A;  3RTV A;  1AFJ A;  3A4T A;  2J9D A;  2LQ9 A;  4TQR A;  2PFF B;  4PQU A;  1HBM B;  5B0G A;  3MCM A;  4JI5 J;  4KY3 A;  2F8H A;  1LK5 A;  5J1E B;  2XYP B;  1NDP A;  1X4D A;  1N32 J;  4C11 B;  3LGH A;  4Y3C A;  3TAN A;  4EBC A;  4FBT A;  1KHW A;  4DV1 J;  1NSQ A;  1ZA2 B;  1WHW A;  4K4Y A;  1R8A A;  3J7Y I;  4P2F A;  4X65 J;  1WSV A;  3NAI A;  4WK3 A;  2J6S A;  4UTG A;  4IOA Q;  4DS4 A;  1F0X A;  1PIL A;  2MKC A;  4NMX A;  4X66 J;  4BDP A;  3MMA A;  2KYX A;  3SYZ A;  4QIW D;  3PW7 A;  1VQS A;  5C7P A;  1T9W A;  3IBC B;  3OFH A;  3JB9 k;  2PT0 A;  4NCB A;  2CQP A;  1IR1 A;  1BQM A;  2R2S A;  4PR6 A;  2WOM B;  3DLK A;  1TL1 B;  4J9N A;  2JFK A;  2GJF A;  1QAI A;  4M5M A;  4LVO P;  2V34 A;  5KFJ A;  4ECU A;  4DR7 J;  2ZD1 A;  2FQQ B;  1JJ2 R;  2B6A A;  3GV5 B;  3HVT A;  2ZM6 J;  1HNW J;  4FF2 A;  2R8G A;  4DFJ A;  5DLG A;  3KWM A;  2YX4 A;  4G1P A;  3M8Q A;  1RTD B;  1FFW B;  1S57 A;  1CPZ A;  4CLT A;  1OY8 A;  1KFD A;  1VQL S;  3RW6 A;  1KTQ A;  1GEH A;  4F2S A;  1VDH A;  3F44 A;  5C25 B;  4IYQ A;  1H38 A;  3NGD A;  1S79 A;  4TY9 A;  2HW3 A;  1LQ9 A;  4J9V A;  2XZW A;  4MKB A;  3ZZZ A;  3NNH A;  3WIU A;  5K8M A;  3I96 A;  2FDN A;  2ZVS A;  1JLQ A;  2OD4 A;  3BSO A;  1WEL A;  3NS7 B;  4B9M A;  2YPY A;  4EWT A;  1TZ0 A;  4HHJ A;  4QR0 A;  1JLG A;  1VFJ A;  3D3B J;  2GVD B;  2QSW A;  3NY0 A;  3LP1 A;  2WTF A;  2D3U A;  4NI2 B;  1R31 A;  3D5M A;  3MED B;  3W2V A;  1QTN B;  1EQ0 A;  3M2U A;  4M94 A;  4EO8 A;  3QIP B;  4FF3 A;  3PCO B;  3KLH A;  5D15 A;  1CS4 B;  1JKH A;  3OBI A;  2RDJ A;  4G6V B;  1R89 A;  1UZD A;  1QAJ A;  3AQO A;  2KHC A;  1N48 A;  4JI2 J;  1SH2 A;  4I64 A;  2AHO B;  3HXM A;  3D1Q A;  2E5G A;  3EGZ A;  3QJP A;  1T9U A;  4MT1 A;  1TEL A;  5L38 A;  5D0E A;  4K0K F;  2J0Q D;  4IG3 A;  3DI6 A;  4NOH A;  4LFA F;  2F4V F;  2X1F A;  2MLZ A;  4YP3 A;  2XY6 A;  1TTH B;  5KFO A;  1S77 D;  2KDO A;  4NLV A;  2M0G B;  1ICE B;  1NLK L;  3I31 A;  1NND A;  2KO1 A;  4E0D A;  4TLQ A;  1I94 J;  2YKP A;  3Q2T C;  3VCD A;  4I6Y A;  2AV5 A;  2ZH8 A;  4GMK A;  2MZ1 A;  4NLS A;  2H54 B;  1URN A;  4LJM A;  4XPE A;  4A8X A;  1OJ4 A;  4CZC A;  4V1A k;  2OSQ A;  5DS7 A;  2VPX B;  3ISN C;  3KUE A;  1N6Q A;  2DGV A;  1OS5 A;  1IR2 A;  2QZ8 A;  2MQO A;  5JMN A;  4IRK A;  4BHQ A;  3CDW A;  1LW2 A;  4CT8 A;  5KFH A;  3PRV A;  3QBC A;  1CVJ A;  4A8F A;  2MXY A;  3C14 A;  3QT7 A;  5HAN A;  5J2M A;  2DGO A;  4D3G A;  4KB7 A;  4CLF A;  3S7R A;  2HBY B;  1HWJ A;  4JI0 J;  3JSM A;  2VHG A;  2FLN A;  1J5O A;  3W9H A;  3KG0 A;  2VFS A;  1EP4 B;  1UFL A;  4ZKA A;  2XMM A;  3D0I E;  4N41 A;  2EWH A;  4ZS6 A;  2K1R A;  5A8K B;  1OO0 B;  2DHA A;  4FNH A;  4JI5 F;  1RT7 B;  1MWZ A;  1DHM A;  1A0O B;  1IKV A;  1N32 F;  3ZTO A;  1DTT A;  2W9B B;  1FE0 A;  2AP6 A;  2DGU A;  4DV1 F;  4B3O A;  2HG4 A;  2HHV A;  2O67 A;  3J7A N;  1KLM A;  4X65 F;  1J2V A;  2BAN A;  2IBO A;  1EX8 A;  1GH8 A;  3P96 A;  4PQU B;  4ZA1 A;  4X66 F;  3MCN A;  3BGR A;  1SB6 A;  3MZI A;  3KLV A;  3MUT P;  2IFX A;  2LYV A;  3KJN B;  2LEP A;  4MTP A;  2R4F A;  4M5D B;  3HHL D;  1QDU B;  1S10 A;  3QFW A;  3CWJ A;  4NZ0 A;  2R2T A;  1NBE B;  4WIQ A;  3AQP A;  2Z0G A;  3ZZP A;  3MPW A;  3TAP A;  2RQK A;  3Q83 A;  1ZM2 A;  1LOU A;  3D0H E;  1L3V A;  4DR7 F;  1HD1 A;  5HQL A;  1UPP A;  2QA1 A;  4Y2A A;  3C6T A;  2ZM6 F;  1HNW F;  3MMA B;  4ECR A;  1EIY B;  5B0B A;  1Q86 T;  4HL9 A;  3GIM A;  3F0N A;  1BC6 A;  1UVM A;  4ZPB A;  1H3D A;  2IM0 A;  3NGR A;  1JXL A;  2VL1 A;  4R25 A;  1EZZ B;  4J9M A;  3MGJ A;  1LW0 A;  2EKY A;  3HHK A;  2KG0 A;  1ARO P;  1KSP A;  2ZD1 B;  3HVT B;  3L7U A;  4WXO A;  4UUX A;  1JLC A;  1B70 B;  3RAM A;  4A8M P;  1QVG R;  4OJH A;  2WVF A;  1MLA A;  3R3T A;  5E33 A;  5ETM A;  3GII A;  5KFT A;  1JLB B;  3AAW B;  2ZNY A;  3GWC A;  2M7S A;  5AXM A;  3T5K A;  1IKW A;  1NK8 A;  4BWJ A;  2W4D A;  4LRD A;  3DLL Q;  4OHW A;  2ASD A;  4QZV B;  2VQF J;  4HVZ A;  4NEZ A;  3G6V A;  1JLQ B;  5LXY A;  1SJ4 P;  3R5B A;  2QFJ A;  5ETL A;  4JI2 F;  1JLG B;  1FA0 A;  2A6M A;  3Q86 A;  5DQG A;  4B3T J;  3I9V 9;  4CLP A;  2ZOM A;  3TUZ C;  2IA0 A;  5KFD A;  1FKO A;  3LP1 B;  1QM9 A;  4Y2K A;  4ED1 A;  4OL8 A;  3W2V B;  4IRD A;  2GW8 A;  2ZHO A;  3M2U B;  2FYX A;  1X4F A;  3VVT A;  4DN9 A;  3IRX A;  4TY8 A;  3BSN A;  1V3Z A;  2KM8 B;  2IRY A;  5EUH A;  3UN5 A;  2O66 A;  4YME A;  1SL0 A;  4RU9 A;  1NXI A;  1NEE A;  4B02 A;  5G0R A;  1HIY A;  1I94 F;  3UO0 A;  1UW4 A;  2R7X A;  2XCP A;  2OPS A;  3J7Z T;  4IG0 A;  1ITP A;  2CUY A;  2RQ4 A;  2HWI A;  2PMZ D;  1ZZF A;  1HBU A;  1KDN A;  2QG9 B;  3WX8 A;  2J6T A;  2W4C A;  2PO4 A;  1T05 A;  3N6M A;  3PJX A;  5KFR A;  3L7O A;  3HHD A;  4URS A;  4DX5 A;  2LDY A;  1NJZ A;  4LR8 A;  2N7Y A;  2L9W A;  3L7P A;  4TLR A;  3OVB A;  4O3N A;  2AJ0 A;  4F3Q A;  3KLF A;  4JI3 F;  3UI3 A;  2E5H A;  2K3I A;  3MPU B;  3UNG C;  3EUN A;  1S48 A;  2GO8 A;  2NSB A;  3QAU A;  3SI8 A;  4NE9 C;  1R7I A;  4CTA A;  4M5H A;  4ECX A;  1A9N B;  2DH9 A;  3OW2 R;  2E5J A;  5FII A;  3CCV S;  3GFY A;  1LW2 B;  2LDI A;  2FLL A;  3C14 B;  3RBX A;  1MU2 A;  3HFK A;  5K8P A;  5T7L A;  5A8W A;  2CA9 A;  1BGX T;  5CCM A;  4RJV A;  3NAH A;  1J5O B;  3HVW A;  4B9L A;  5B0E A;  3Q23 A;  1KD1 T;  4JV5 J;  2V9W A;  1LFP A;  4J91 A;  5F8M A;  2B9E A;  3D68 A;  2K1R B;  3M2V B;  3PW5 A;  2DR9 A;  3GCX P;  1BQN A;  3O2I A;  4DR3 F;  3G87 A;  1R0B G;  1RWM B;  1YHQ S;  1IKV B;  4CYU A;  4C9D A;  2AX0 A;  4DI6 A;  1DTT B;  2GMJ A;  3GJT B;  1FDA A;  2OPR A;  2VC1 A;  1S72 S;  1MWY A;  3NCQ A;  1P1T A;  1H2T Z;  2AJ4 A;  3OR1 A;  3I87 A;  3BQ0 A;  3DHX A;  3HUL A;  2UXC J;  9RUB A;  1HW8 A;  1V5I B;  2BAN B;  5CYQ A;  2RS2 A;  1N5S A;  3CCW A;  1TKZ A;  2FJA B;  4OI3 A;  4ICL B;  1U1N A;  3KHG A;  1RAE B;  3E2E A;  2C2D A;  2RQC A;  3IN5 A;  1EQM A;  3M9N B;  3BGR B;  1HW9 A;  5HVG A;  3HSG A;  3SIP B;  2GC8 A;  2FC8 A;  1S1T B;  4RO0 A;  4GVB B;  2UUA J;  5D4N A;  4DEZ A;  2V68 A;  1JLF A;  3IBW A;  4CO4 A;  1W2I A;  9ATC B;  2Z58 B;  2B9W A;  8RUC A;  4DU7 A;  2HHH J;  3KK3 A;  2B5J A;  4X4U A;  2FJD B;  2FVC A;  3DM2 A;  1FDN A;  3J81 j;  4DG1 A;  1VMB A;  3C6T B;  1WC3 A;  2CPY A;  1NDC A;  4DSL A;  1FT8 A;  4DR5 F;  3DN9 A;  1RHQ B;  2B3T B;  1H0H B;  5DDO C;  1YBT A;  2WBM A;  4O4R A;  1KVI A;  5KT5 A;  4FKX A;  2CJK A;  1CUL A;  4F67 A;  4TYB A;  3GCW P;  3CF5 Q;  1LW0 B;  2OEJ A;  2YTC A;  3EE3 A;  2XY7 A;  3RJM B;  2HGN A;  1BWE A;  3SFU A;  2VQF F;  1JLC B;  1UL3 A;  3OUY B;  4DQQ A;  2C2R A;  4EK2 A;  2ZBC A;  3DLH A;  2CG8 A;  4RW7 A;  1TL4 A;  2DR8 A;  3CCE S;  1TUW A;  2F5G A;  5B0C A;  4RNH A;  3JSB A;  1S6Q A;  2A18 A;  1Q53 A;  3W1Y C;  3I0S B;  5GAD I;  5KFU A;  3PTW A;  3L9Z A;  1IBK F;  5FDL A;  4Y2C A;  8ATC B;  2ZEJ A;  3DOM B;  2EI5 A;  5EX3 A;  2XC9 A;  2UUW A;  1K1Q A;  3ZZU A;  5KT2 A;  3BEG B;  2HBR B;  3CJQ A;  4YHH J;  4P73 A;  5HL7 Q;  2E7V A;  5JUM A;  3T1H F;  2C1E B;  4C98 A;  2CQ2 A;  3UD5 A;  1VI7 A;  4HEA 9;  1FDB A;  4GC6 A;  1FKO B;  2QRR A;  5AE1 A;  3NMR A;  1Q0N A;  2HZA A;  4FN5 A;  2L3M A;  1FRK A;  3GG0 A;  3V6K A;  4JI7 J;  3KJV A;  3JTO A;  3NEK A;  4TY8 B;  4YR2 A;  4C3K A;  2RE1 A;  4WP8 A;  4PEO A;  2L48 A;  2VF3 A;  3VHQ A;  4C0H A;  1ZS6 A;  5G0R B;  1VGY A;  3K5M A;  1QUP A;  4HYK A;  2OPS B;  3ILO A;  4WP3 A;  4OHY A;  2ZBR A;  5KG3 A;  1HBU B;  3GFX A;  1X4B A;  1T05 B;  1Q8I A;  3CCS S;  1FEE A;  2FJE B;  2BVZ A;  4C8Y A;  2GHP A;  2JX2 A;  5FJ4 A;  3IS9 B;  5ETR A;  2G2Y A;  1FTR A;  3V6J A;  4RW6 A;  5HBM A;  3VQT A;  1Q5Y A;  2YKA A;  5KFN A;  3QAT A;  2UU9 F;  1NSP A;  3H4B A;  3CJ3 A;  3WX4 A;  3DNC A;  8AT1 B;  3KJQ B;  5FLX Y;  2DBB A;  2X51 A;  1RAB B;  2LEA A;  4W98 A;  4PAB A;  1OQ3 A;  3ETM A;  4XO0 A;  3HF5 A;  4OJG A;  2PMW A;  4FXD A;  2ATC B;  4LFC F;  1DTQ A;  2R8J A;  2BXJ A;  1KC8 T;  1S0N A;  2OMO A;  4HH0 A;  4QW9 A;  1MU2 B;  3I5B A;  1X9S A;  6FDR A;  5T7L B;  3CGI A;  3M32 A;  5A8W B;  3DMJ B;  1F3F A;  3OTD A;  2BW2 A;  1C1B A;  4DSF A;  2YNH A;  3M6V A;  2UXB F;  1GK8 A;  2HK2 A;  5ETT A;  5DJB A;  4DQI A;  1FDD A;  1TKD A;  1WEY A;  2HHT A;  3OTO F;  3H40 A;  1ZET A;  1VQ9 S;  1JXV A;  5J2P A;  1BQN B;  1NAQ A;  3FKB A;  1HI0 P;  1ZM4 A;  2UVU A;  4LT6 A;  2UUA F;  2N3L A;  4N47 A;  2OPR B;  1JMT A;  2BEF A;  3AJ1 A;  1SJQ A;  3OR1 B;  2LQ8 A;  3U1M A;  1VQK S;  1O51 A;  3QRR A;  3OV7 A;  1LNQ A;  1QSY A;  7AT1 B;  1NJW A;  4CNZ A;  1TKZ B;  4M95 A;  1GXU A;  3D6F B;  3RZA A;  2OTJ S;  1NK7 A;  3FFI A;  4A8K A;  3GR0 A;  3PW4 A;  3DLE A;  1X60 A;  1NK4 A;  1IM6 A;  2UVV A;  4IOC Q;  4ZVQ B;  3MM8 A;  4LRA A;  2IVM A;  3HD2 A;  4O0I A;  1KLN A;  3TZX A;  1JLF B;  3CJ2 A;  4WFB Q;  3AB4 B;  3BYP A;  3K7R A;  3SSS A;  2CZ9 A;  1A6L A;  3HO1 A;  3KK3 B;  1BXN A;  2YNF A;  4EBD A;  2B5J B;  1YI2 S;  3HHN B;  2FGC A;  3DM2 B;  4UQT A;  3TEH B;  4DG1 B;  2CQ0 A;  4U8V A;  5EWE A;  2GIF A;  5M2R A;  4DXL A;  2HNY A;  2DR7 A;  3VAK A;  2HRT A;  4YY3 F;  4QIE A;  1S12 A;  1CUL B;  2HKE A;  2WAQ D;  4HI2 A;  2BZ2 A;  2W2M P;  1GFW B;  1HYS B;  1VQ4 S;  4CO5 A;  4HDG A;  2GO9 A;  4L3K A;  1RBA A;  3VAH A;  1IN0 A;  3SBM A;  5KFG A;  2W1B A;  3HCX A;  2BDP A;  5M2P A;  4RW7 B;  1RTJ A;  3FBE A;  4K7Q A;  1S6Q B;  5AE3 A;  1XMO J;  3J80 Y;  1XNQ J;  4DN0 A;  2DIU A;  2ZH9 A;  1VJW A;  2AQ4 A;  4J9S A;  1UP1 A;  5FDL B;  3OSN A;  5B0D A;  3UDC A;  5HN0 A;  1RU1 A;  2DNO A;  3IAM 9;  3QJJ A;  3HSJ A;  2BOA A;  4IDK A;  1N36 J;  2CPD A;  4P71 A;  1K8A T;  1F2H A;  1FD2 A;  3AHP A;  4ZVS B;  2RDI A;  2R7S A;  2CQI A;  2RRB A;  2H5J B;  5KT6 A;  1FRM A;  3MM7 A;  3EZO A;  2J0X A;  2D3O 1;  2Y1I A;  4K5R A;  2J0W A;  3KJV B;  3EGN A;  2HVH A;  4QWC A;  2DNZ A;  3QO9 A;  4CLW A;  3G96 A;  1FO1 A;  1U2C A;  4USV A;  3RYL A;  2PEH A;  4XPC A;  2XM3 A;  4UOF A;  3ZTP A;  5AXL A;  4IH5 A;  1SL2 A;  3P8B B;  3HX9 A;  4DZ6 A;  4LF4 J;  3CUL A;  1Y7P A;  4BS2 A;  1CC7 A;  1HNX J;  3D6T B;  2IVF B;  2DR5 A;  2QEX S;  2B4P A;  1T94 A;  4DF8 A;  4RUB A;  3B82 A;  3M8P A;  4NLU A;  2ZBI A;  4K4S A;  2Z2M A;  2AYM A;  1Y0H A;  2ACM A;  3W5X A;  2ASJ A;  3O3L A;  3ZZO A;  4ECW A;  3D4J A;  1FWL A;  3MOZ A;  4CM0 A;  4ERD A;  3TZZ A;  2XNR A;  2VA2 A;  4RW6 B;  2Z4P A;  2I5J A;  2JNJ A;  2EKN A;  4DV4 J;  4HR2 A;  1Z2L A;  2BRL A;  2ZDO A;  2MQM A;  1RWW B;  2E5I A;  5BYQ A;  4XIU A;  5D3G B;  2XMJ A;  4FKY A;  1C0U A;  5ETK A;  5KAK A;  2YQ3 A;  3DGP A;  5EN1 A;  1WSR A;  2RIJ A;  1G6B A;  2CAJ A;  2CPX A;  1C0T A;  2EC0 A;  2RU9 A;  4C8K A;  2VPW B;  3CT9 A;  4QJV A;  5KT4 A;  3V81 A;  3MM9 A;  4IQX A;  3MAA A;  1YZ7 A;  3C3L A;  2FUG 9;  3VTI A;  1C1B B;  2BX6 A;  2YNH B;  3SSR A;  1VRQ C;  2GHV C;  3JTN A;  4O3P A;  1LWF A;  5ETQ A;  2WSE C;  4GVL A;  4U7U D;  3G86 A;  1EHW A;  2BKO A;  2XLK A;  4AD6 A;  1GTE A;  5J2P B;  4F3O A;  1U6F A;  4KR0 B;  4GO7 X;  3MAH A;  2MKJ A;  3RBD A;  1VQ7 S;  4K4X A;  3ENW A;  2H48 B;  1KOO A;  5L39 A;  4ED2 A;  2GVZ A;  4FS1 A;  4RPF A;  3RRH A;  3T5L A;  4WCE Q;  2LCW A;  3MFI A;  2V94 A;  4CO2 A;  2LQ5 A;  3GQC A;  4JOU A;  4C0O C;  4NXN J;  4NA1 A;  4N76 A;  3G6X A;  5HQ8 A;  3HZE A;  4CLL A;  3DLE B;  1D09 B;  3BH7 B;  5IT9 U;  4N56 A;  2E7W A;  3EVW A;  4ETZ A;  2YX7 A;  3NS6 A;  3MM8 B;  3KUH A;  3IM8 A;  5L9N A;  2WRM A;  1R8C A;  2E44 A;  1IJE B;  5F9L A;  1NCL A;  1QSL A;  4JUZ A;  1FX2 A;  4ZHR A;  4TKT A;  3BPD A;  2HNY B;  2M3D A;  2BOP A;  4CLY A;  3C6U A;  3A8I A;  1MSW D;  3D28 A;  4KGZ B;  3TA1 A;  3MM6 A;  2OPQ A;  3TVK A;  1XMO F;  1XNQ F;  1LEO A;  3IBF B;  4X4O A;  2X1A A;  4OYP A;  3MCS A;  3I82 A;  4IOB A;  3TJ8 A;  1IR0 A;  3D67 A;  3R1L A;  2GZO A;  3BZQ A;  2COL A;  1EJ7 L;  4I2P A;  3EJM A;  2DGX A;  3PM9 A;  4B3S J;  2MQP A;  2ALY B;  2OPP A;  2ABY A;  2JC0 A;  1RAI B;  3SV4 A;  3MEC B;  4OZL A;  5HJY A;  4CT9 A;  5D8H B;  3OFG A;  1TL3 B;  2VFV A;  2DR6 A;  1WDD A;  4I7F B;  3K0J A;  4IDK B;  3GYN A;  5DDQ C;  5HP1 B;  3LGM A;  1IBL J;  4ZCI A;  1HFE L;  4LF4 F;  2WON A;  2MPU A;  1SQF A;  1YRX A;  4TYA A;  1D8Y A;  4H4K A;  4F25 A;  4OJ3 A;  3PKM A;  3MUR P;  1S1W A;  1UET A;  4ZP7 A;  4USH A;  5D4L A;  4DR4 J;  2E1M C;  2N82 B;  1RE1 B;  1VLY A;  2EG1 A;  3GV7 B;  3H59 A;  4DPO A;  3L4B C;  2KXN B;  3N5B A;  4IO1 A;  4C7Q A;  4F4X A;  4I56 A;  3GR1 A;  1WHV A;  4PG6 A;  3BGO P;  4ID8 A;  4U95 A;  1TU0 B;  3PHT A;  2RH3 A;  1RYS A;  4DV4 F;  3AT1 B;  1JJ4 A;  2PC6 A;  2MEW A;  3TP2 A;  1H72 C;  1WKL A;  4NA2 A;  3ZZY A;  2QA2 A;  3OTC A;  1SBR A;  3M8P B;  3H0P A;  2D74 B;  2AKW B;  2QMW A;  1S1V A;  2NXU A;  2ERR A;  2ILZ A;  1JB0 C;  1TL5 A;  2W8L A;  2ZH4 A;  1S76 D;  4ENO A;  3MD1 A;  4ELT A;  5KFE A;  3EDQ B;  3IWL A;  1N4L A;  2I5J B;  3MMJ A;  4DL0 C;  2KL8 A;  4LR9 A;  1VYA A;  2CPI A;  5KFY A;  3NRB A;  1PAE X;  3AH6 A;  1T8E A;  5HJX A;  1SIZ A;  1Y10 A;  1S9G B;  1C0U B;  5KFB A;  2VON A;  2BE9 B;  2C2M B;  3DGP B;  4Y65 A;  2LXI A;  2KRB A;  3VAJ A;  3E3X A;  2WVE A;  2CQC A;  3O8W A;  2DHH A;  4NYZ A;  1W25 A;  4QYZ K;  1C0T B;  3HFV A;  1FKP A;  2OHD A;  2U1A A;  4DX7 A;  3V81 B;  3FCV A;  2ZH3 A;  3M30 A;  3MAA B;  2ILY A;  3I6P A;  2KN4 A;  4RUH A;  1T03 B;  2ZHB A;  1S9F A;  3UDE A;  1X5O A;  4CCH A;  2E9T A;  4EU0 A;  3KK1 A;  2C42 A;  4NXN F;  1LWF B;  1U1O A;  2GJ2 A;  3LF0 A;  2KZZ A;  1N52 B;  2OI2 A;  4RUC A;  3CC7 S;  1VC5 A;  1TP7 A;  2RRN A;  2YY3 A;  4BC9 A;  4C6A A;  5CZV A;  1UVI A;  4N8N A;  3GIJ A;  1YIJ S;  5D6G A;  4KJI A;  1HMV A;  3TEG A;  4B9T A;  2W2P P;  4E8U A;  2CPJ A;  4NLP A;  2HPU A;  3LUY A;  4O3S A;  4C8Z A;  1EKS A;  2GVZ B;  4WYL A;  3QT6 A;  3TVY A;  3BPS P;  2DB1 A;  3C16 A;  3PO5 A;  1RJJ A;  1L3U A;  5E3C A;  4EZ9 A;  4LF8 F;  4I68 A;  2QMX A;  4HKQ A;  4G1I A;  2I6W A;  2P6S A;  1SUQ B;  1UWA A;  4BC7 A;  4EYI B;  2AJ1 A;  3MMC A;  1U1M A;  3JSY A;  4QWB A;  1RAC B;  2Y3Y A;  3Q89 A;  7FD1 A;  3MTJ A;  4K4Z A;  2RUG A;  3RR7 A;  3KMQ A;  3SFG A;  3CD6 S;  2MHN A;  1VQY A;  4DMZ A;  2CAD A;  4ZVG A;  2M2B A;  2KB2 A;  1S59 A;  3CJT A;  3KK2 B;  4W4M A;  1DY3 A;  4NPO A;  1TMJ A;  3G9C A;  5HO4 A;  2IDE A;  1K9M T;  4ZHR B;  4DLG A;  2B0G A;  5BYS A;  2FIU A;  2OFG X;  3RW7 A;  3I55 S;  2H1Y A;  4O0N A;  4C4W A;  1LWX A;  1U6Z A;  3H25 A;  2HEK A;  3VV2 B;  4ED4 A;  3C6U B;  3FBB A;  2V8V A;  3Q0A A;  2OP5 A;  4KC5 A;  2AGP A;  4B9N A;  3MM6 B;  2OPQ B;  4FDF A;  1MW7 A;  6AT1 B;  2D41 A;  2XZD B;  1SKR A;  4IH6 A;  2B9X A;  4W90 B;  3KTQ A;  1L5U A;  2AEJ A;  1MWQ A;  5HMZ A;  2FY8 A;  1ROF A;  2K7J A;  2XUL A;  1NZA A;  4ECS A;  1XN9 A;  2W7P A;  3D6H B;  3MEG B;  1IBL F;  5IQQ A;  4YN3 B;  1KQS R;  1SC6 A;  1YRT A;  2X3D A;  3CDE A;  4DX6 A;  3H42 A;  1XIQ A;  1Y5L B;  4XDC A;  1SH3 A;  4KHP J;  4Q8F A;  1FES A;  1AXQ A;  5E3A A;  2HK3 A;  4KH1 B;  3TUJ C;  1YJR A;  2E9Z A;  1HA1 A;  1FF2 A;  3AD7 C;  3FSI A;  3BN7 A;  1SC1 B;  3R5C A;  3DXB A;  4DUY F;  1LWE A;  2FHO B;  4DV5 F;  2H9Z A;  2YH0 A;  2HIY A;  3OL8 A;  2OEL A;  2XS5 A;  2MQ8 A;  2IM1 A;  4QBU A;  3SCJ E;  1XMB A;  4PWU A;  2E1C A;  1U48 A;  2WON B;  3PXG a;  4I69 A;  5KG1 A;  4WE1 A;  4P72 A;  1R0C B;  4QQB A;  2VDH A;  1F5C A;  3JQM A;  3IG1 A;  4RW9 B;  1S1W B;  4MIW A;  3PYE A;  2G1D A;  3OFF A;  4HAC A;  1YJW S;  1FFG B;  1NK9 A;  2C2Z B;  2FC9 A;  4DS5 A;  1FJ7 A;  3POT B;  4CP5 A;  3EPI A;  2HZC A;  1NH8 A;  2LU2 A;  1VIX A;  2D9P A;  1X9W A;  1PJ5 A;  2FVQ A;  3OXL A;  5KG6 A;  4Y34 A;  3TX8 A;  3BDP A;  2DH7 A;  2JSX A;  1U45 A;  4TU9 A;  4FS2 A;  4AQY F;  3DRS A;  3HM9 A;  1S1V B;  4DUZ J;  4PKD B;  2N3O A;  3RB4 A;  3UD4 P;  4OI2 A;  2P6T A;  3CCZ A;  4QW8 A;  2VPY B;  3DCA A;  1RDR A;  3BGL A;  3V6D A;  3S6E A;  3M7V A;  2RF2 B;  1FKA F;  3MPD A;  5K5M A;  1CLF A;  2VPZ B;  2YQ0 A;  3T3F A;  1PCA A;  2DGQ A;  5L1I A;  1RWN B;  1KS2 A;  5GAG U;  1FKP B;  4DR1 J;  1UPM B;  4O4G A;  4Y2I A;  1VQO S;  2FZK B;  3IO1 A;  2H3E B;  3M30 B;  1CJV A;  5H9F K;  4BLG A;  3KNG A;  1X4H A;  2HND B;  2KT2 A;  1RAG B;  4ZIV A;  5JJB A;  3KK1 B;  3BH6 B;  1VC6 A;  3VAI A;  4JI4 J;  1WTF A;  2IY5 B;  4WFA Q;  3I0R A;  3UCZ P;  4MIB A;  2LA6 A;  5LJ3 Y;  4WU3 A;  4ES3 A;  3P3D A;  1HMV B;  3FEZ A;  4OMF G;  3MEE B;  4PXD A;  4ZVO B;  5EWF A;  2QN6 B;  3OVS A;  4I2Q B;  1JJC B;  1RHM B;  1N33 J;  4IFV A;  3RUB L;  1Q16 B;  1D9D A;  2IAJ A;  3NXZ A;  5DLF A;  3RAQ A;  5D4O A;  3HJF A;  1RUS A;  2R7R A;  4MK8 A;  2CNL B;  4ZN1 A;  2B9Y A;  2CYY A;  5HMX A;  1K44 A;  2AYE A;  4ILR A;  1RAD B;  4UZC A;  3MMC B;  2FVR A;  2JC1 A;  1FI4 A;  4DQP A;  1REV A;  4MIA A;  4J9P A;  2DEJ A;  4ED0 A;  4HHH A;  3T41 A;  3W66 A;  2Q6B A;  1IUJ A;  3B78 A;  3N5F A;  2DH8 A;  3PDN A;  3GFZ A;  4Q2M A;  3I4H X;  2Z30 B;  2H5E A;  4ED5 A;  3NOG A;  1FK9 B;  4LF6 J;  4RLE A;  4QIF A;  3PW2 A;  3JQJ A;  1C1C A;  5ETS A;  1K1S A;  5KFL A;  1DQ8 A;  3ILJ A;  1MRO B;  3SV3 A;  3LGN A;  3OLB A;  2VZ9 A;  3U02 A;  4DFK A;  4JI8 J;  2G0C A;  5KG4 A;  2ZE2 A;  2ZC4 A;  3S8S A;  1RK8 A;  1CQM A;  3GJQ B;  1VCT A;  4NLT A;  3TZY A;  4KHP F;  3CCT A;  2C2E A;  2NS1 B;  5L1J A;  3M2R A;  3EDR B;  2MKI A;  1HWU A;  3TZW A;  3G82 A;  5M2U A;  1KBR A;  3EWG A;  4NYO A;  3DHW C;  5FD1 A;  3Q24 A;  5KG2 A;  1WHY A;  2JZ5 A;  4Q43 A;  3JS9 A;  3I32 A;  3KLE A;  1WKK A;  2NYH A;  1FXD A;  4M63 A;  1RWK B;  1CG2 A;  2DXE A;  3FCH A;  2GGP A;  4DR2 J;  2QT7 A;  3IFE A;  1N56 A;  1OY6 A;  5KT7 A;  4K4W A;  4KBI A;  4X64 F;  1V5V A;  4HTJ A;  1XC9 A;  3H2V E;  2QA4 G;  1LWE B;  5BJR A;  3U7J A;  2ZZN A;  1TKT A;  1Y3K A;  2XMK A;  1TAQ A;  4QIV A;  1ZA1 B;  3CCQ S;  2RU3 A;  4P52 A;  4YFU A;  5HVF A;  3MM5 A;  4ANE A;  3TR5 A;  1YZ6 A;  5C42 A;  4ID5 A;  1WNE A;  3IG1 B;  3FVY A;  4CO1 A;  5GAE U;  3ENQ A;  1TFW A;  1RSC A;  4OFZ A;  3GTY X;  1QAY A;  4ZLJ A;  3RR8 A;  4DUZ F;  4AUK A;  1J27 A;  2OSR A;  2RDD A;  3NP5 A;  3ILL A;  1HI8 A;  4ZPT R;  1AYE A;  3FK4 A;  1Z2Z A;  4DV3 F;  2JEF A;  3M9M B;  3K5P A;  3A3N B;  2KT5 A;  1U25 A;  1VLO A;  3BGU A;  3QSI A;  4KYZ A;  3CVK A;  2EVZ A;  1TKX B;  3DRS B;  3UDL A;  2Y0S D;  2NLW A;  1OPZ A;  4USU A;  3R7S B;  4DR1 F;  2AT1 B;  3LWL A;  4RBT A;  1YKW A;  2NUU G;  4J9Q A;  2HAF A;  5J2N B;  2M9K A;  3QSY B;  2H5I B;  1KWM A;  1P9Y A;  3V6D B;  1H2U X;  5HLF A;  2UUC J;  3GLJ A;  1Y5N B;  5I42 A;  3E8O A;  4JI4 F;  2AMC B;  1B4S A;  3M6X A;  4JV0 A;  1WEZ A;  4O3Q A;  1MN7 A;  4KKO A;  2V4Q A;  4OLO A;  2V2Q A;  4O4G B;  3WC0 A;  2W8K A;  3HHE A;  1HR0 J;  5ITH A;  3TJ9 A;  1ZM9 A;  1SV5 A;  3PR5 B;  4RWW A;  4ECY A;  1SQG A;  3UNY A;  3N01 A;  2Q43 A;  2IIH A;  5F8N A;  4HTI A;  2IHR 1;  5HQM A;  4X4S A;  2L9N A;  4DHV A;  4OJ1 A;  2JJ4 D;  2UUT A;  3ET6 A;  3Q8R B;  3DU6 A;  4EEY A;  3I0R B;  1JIH A;  4DWI A;  1D0E A;  2ZH7 A;  1IQZ A;  1PO6 A;  1L3K A;  3BDE A;  1V3R A;  2I9S A;  2I1R A;  2JDJ A;  5D0H A;  3H90 A;  2VOD A;  4A48 A;  5KG0 A;  2YWK A;  4K0K J;  3LPY A;  1BD6 A;  4IFV B;  2IJF A;  2IAJ B;  2C3O A;  2CQH A;  3BQ1 A;  2K3K A;  1F2G A;  1RCO B;  4WZQ A;  1IM4 A;  2YH1 A;  3M1V A;  1PBA A;  3M6W A;  3BV8 A;  4JI8 F;  2R7O A;  1REV B;  3BM7 A;  4DJB A;  2MGZ A;  4NL5 A;  2KHD A;  1HBN B;  1PJ6 A;  2ZH6 A;  3R5D A;  2GAG C;  4WTY A;  1VS3 A;  3FMW A;  1DFD A;  3NGS A;  4DV6 F;  1CJK A;  4DCO B;  1V6H A;  3CCU S;  1C1C B;  5IT4 A;  2JLF A;  3HHL C;  4CLU A;  1DLO A;  5IM0 A;  4KFB A;  1TUV A;  2ZE2 B;  2R9L A;  1RT5 B;  2HBQ B;  2EFV A;  2ZOG A;  3NCR A;  4NRT A;  2XS7 A;  1G3O A;  3HKZ D;  4OLP A;  1CSJ A;  2R2U A;  3LWM A;  3CO9 A;  4ZCM A;  4DR2 F;  4GRS A;  2WVC A;  3M2R B;  4HT7 A;  1O6X A;  1RT4 B;  2BAB A;  4FYX B;  4LBP A;  4TQS A;  4YDD B;  3G82 B;  3SCK E;  3IGV A;  2HNZ A;  2G2Z A;  3TO8 A;  3M6U A;  3TA2 A;  3W9I A;  1DQA A;  3R8Y A;  3B8H A;  1E6Y A;  3KLE B;  4F3M A;  1WEX A;  5KFM A;  3ZXW A;  4BCA A;  2VG6 A;  4A4J A;  1JNZ B;  2VG5 A;  1SJ3 P;  3NGT A;  5HI7 A;  2MY7 A;  2J9C A;  2QLF B;  4RX6 A;  4DSK A;  3K58 A;  3A12 A;  2KYZ A;  2RS8 A;  2IM2 A;  5E5N A;  3DC2 A;  2Y1L B;  3VAF A;  4J37 A;  3QMQ A;  1RB0 A;  1TKT B;  4RNO A;  3MDF A;  3VAL A;  3CDU A;  2DNH A;  4LRE A;  1JLA A;  1PYT A;  1UVL A;  3EIC A;  3CD5 A;  4AL6 A;  1R27 B;  5IV4 A;  3MM5 B;  3CJK A;  4M5L A;  5C42 B;  4LQ9 A;  4ID5 B;  3W5Z A;  3KG4 A;  3OL6 A;  5FLX U;  4OI0 A;  2LQB A;  3AXK A;  5BXI A;  3F41 A;  3T19 A;  3PW0 A;  2RIL A;  3TI0 A;  3W2W A;  1KN6 A;  2B8Q A;  4LSN A;  4OZ0 A;  1FWK A;  4F26 A;  4CI0 B;  1KKH A;  2WW8 A;  1HQU B;  2YKO A;  3R6G B;  1RT2 B;  1SKW A;  3MFH A;  2GS8 A;  1UVK A;  1Y3J A;  2UUC F;  4OZ1 A;  4KTQ A;  1KQK A;  3HVA A;  2XLI A;  1SKU B;  2IYG A;  1X4C A;  1TAU A;  5DRK A;  4L75 A;  3ENA A;  5A2Q Y;  3ZFV A;  5GAH U;  1YIT S;  3HK2 A;  2AX1 A;  4WKY A;  2E29 A;  2DT9 A;  3BKT A;  1HWI A;  4NEY A;  1H2V Z;  1ZAV A;  3ZZR A;  4YOE A;  2J6U A;  2BJE A;  1HR0 F;  4URG A;  3PKY A;  3ISZ A;  1H98 A;  4EBE A;  2KT3 A;  3BBF A;  3UN3 A;  2V67 A;  3CCM S;  5HLF B;  2IVY A;  4G3I A;  1RAA B;  2AYB A;  3OL9 A;  5I42 B;  3HD1 A;  1FVS A;  4PAA A;  4OI4 A;  2N4C A;  3EMT A;  4PYD A;  3CD0 A;  3QGG A;  4KKO B;  2OEM A;  3SDE B;  1Y00 A;  3VQS A;  4Q0B A;  2Q79 A;  4M5K A;  2R7T A;  2ADC A;  1N5T A;  1GMW D;  4L76 A;  2LP4 A;  1SV5 B;  3LA0 A;  4YB7 A;  2MKH A;  2PSZ A;  4N77 A;  1BE4 A;  2XSJ A;  2PFD A;  4WXW A;  1N8R T;  1HL6 A;  4BBY A;  2KFZ A;  2XCA A;  5F9N A;  3ZC4 A;  1HHQ A;  3ET6 B;  5DM6 Q;  5J1N A;  4N8O A;  5GME A;  5KFP A;  4RBU A;  1YTY A;  4D3H A;  3MWB A;  2XZT B;  1HNI B;  2FVS A;  3M4X A;  3D1H A;  1EAY C;  2ROG A;  5T41 A;  2Z2L A;  4GC7 A;  3MUV P;  3N6L A;  4L3N A;  3FDS A;  4UW2 A;  1SI9 A;  5F8I A;  3T6J A;  1XR7 A;  3TWZ A;  1HBO B;  3IWX A;  4AXJ A;  4EFA C;  1T3O A;  4JI3 J;  1RT1 B;  2A1B A;  1YX2 A;  3GB0 A;  3BRE A;  1KP6 A;  2MGZ B;  1U26 A;  1S49 A;  3LOU A;  2GQC A;  5LMU J;  3UWT A;  4I4B A;  1B99 A;  2R8K A;  3F73 A;  3J80 U;  1CJK B;  2F9J A;  3WC2 A;  2BJ1 A;  1VHI A;  2FJW A;  3HI9 A;  1HNV A;  4A46 A;  1DZ5 A;  5J2Q A;  4Q2L A;  1N88 A;  4UOC A;  1DLO B;  4AYB D;  5IM0 B;  4ED8 A;  3BF4 A;  2O1P A;  4YS2 A;  1U02 A;  2BUN A;  4KFB B;  4ZVT B;  1URR A;  3NG8 A;  1AA1 B;  1NB2 A;  5E3P A;  4X4V A;  2C2K B;  3WIV A;  4B3R F;  4DR3 J;  3FRY A;  1SC3 B;  4RNN A;  4ATN A;  2BBE A;  2XO7 A;  1T02 A;  2D3O R;  4ZP9 A;  5HSP A;  2XHC A;  2XMU A;  1GQE A;  1E6V A;  2HNZ B;  4G1Q A;  3KLI A;  4NX9 A;  4NZ7 A;  1NK5 A;  1YG0 A;  2XYH B;  1FEH A;  1WHX A;  3H5X A;  3T6B A;  1MML A;  3W3S A;  3AD9 C;  2FGO A;  1E6Y B;  1FJC A;  2H51 B;  4IR1 A;  4L6V 3;  4P7V A;  5E7O B;  1W2B R;  1B0P A;  3KYL A;  4CQ1 A;  4DLE A;  1LK7 A;  2A3J A;  2IDL A;  2EFQ A;  2R7W A;  5KOX A;  3FZ2 A;  3O6Q A;  1RTZ A;  2ZDP A;  2MZR A;  2VG6 B;  1U47 A;  3NWG A;  4MK9 A;  1NB7 A;  1D9A A;  1XBW A;  2IYI A;  1LWC A;  1TUG B;  1Y11 A;  1U1K A;  1QE1 A;  2HIQ A;  1BQM B;  3Q22 A;  3LTO A;  2WBR A;  3DLK B;  2IC3 A;  2ZJQ Q;  2YPZ A;  2WCX A;  2J8A A;  4ALZ A;  1JLA B;  1YJN S;  2B6A B;  2R3V A;  3CJK B;  4R0E A;  2N7C A;  2XBP A;  4DR5 J;  2RNE A;  4RNM A;  1JNR B;  3M8Q B;  2M88 A;  2RT3 A;  2BM0 A;  1HKA A;  2CQ4 A;  4C8M A;  4PG4 A;  4RU2 A;  3IWN C;  3GP9 A;  3AJD A;  1U2F A;  2XLJ A;  2HS3 A;  3W2W B;  4LSN B;  2XO6 A;  1G1X A;  3E01 A;  2WB4 A;  2XYG B;  5B0A A;  2E1P A;  4USK A;  1UA0 A;  1Q78 A;  2W2O P;  4M5N A;  1Q8K A;  5IC4 B;  2P2C B;  3EM1 A;  3UCG A;  2EBG A;  1CJT A;  2RB7 A;  5IS2 A;  3OTE A;  1SJR A;  3FGV A;  1YJU A;  4X2B A;  3RGI A;  1NPP A;  4NCG A;  2DVI A;  4Y28 C;  4IR9 A;  2HQ3 A;  2K2P A;  4OX7 A;  3CMQ A;  3AJ2 A;  4KGX B;  3C8Y A;  1IBK J;  4NCA A;  3CJ8 A;  3RU0 A;  3THT A;  3KLH B;  4YUD A;  2YWF A;  1JKH B;  1B3T A;  1KVK A;  2DRB A;  3QLH A;  4M1K A;  4QOT A;  5KFI A;  2UXD F;  1U8W A;  2CKW A;  2E1A A;  3T1H J;  1K47 A;  4UY8 T;  1NME B;  5KFV A;  4J9U E;  1Q82 T;  2N4D A;  5AXK A;  1FFS B;  1P6T A;  1GXT A;  2ZH1 A;  1G2E A;  1KQF B;  4TNO A;  1HQE A;  3MCO A;  4IG3 B;  3DI6 B;  3VGU A;  2OJ3 A;  2M8D B;  3RB0 A;  2V0N A;  2G13 A;  4FF4 A;  2QL7 B;  3G6Y A;  2KKH A;  4F0M A;  3CC4 S;  2XSJ B;  4F50 A;  2BYC A;  2EC2 A;  5DGB A;  1IWG A;  3FJ2 A;  2G1H A;  3TAQ A;  1H73 A;  2A6O A;  3O5T B;  3CW2 C;  2GQ2 A;  4ZK7 M;  2VOO A;  4QWA A;  4UUW A;  3LP0 A;  3QWP A;  4EI2 A;  4USM A;  1FXR A;  4F36 A;  3IC1 A;  3EPG A;  3CNQ P;  5LMU F;  1UTA A;  2KXF A;  1N6Q B;  1KTV A;  2ACY A;  2D3Z A;  3H5U A;  4R8U A;  3QNW B;  5IFM A;  1RP5 A;  4RW8 A;  1NJY A;  1ELO A;  2HQD A;  5J2M B;  2YWE A;  2UU9 J;  3ZZ0 A;  1RA6 A;  1I6J A;  5I3U A;  5LMN J;  2G0J A;  3JSM B;  1NHK L;  3R2D J;  4U6P A;  2EG2 A;  4QCL A;  4EGL A;  2HFV A;  3N0V A;  4ZCL A;  5AXN A;  4Q7A A;  5D78 A;  1PG5 B;  5CCL A;  3FZB A;  4OYA A;  2FHJ D;  2GIR A;  3HSD A;  4P75 A;  4LFC J;  2CQ3 A;  1UW9 A;  4RWX A;  4A8W A;  2HQC A;  4FXV A;  3GFH A;  5J2Q B;  4OYM A;  5A6P A;  2XG8 A;  2HVI A;  1KON A;  4B3O B;  1T11 A;  3BYR A;  1GMU A;  2NXN A;  3LPE A;  1FXL A;  3RRK A;  1KLM B;  5B7W A;  1X8D A;  3DFE A;  1XR5 A;  1PJ7 A;  4YB5 A;  4LR7 A;  2QSF A;  2UXB J;  5KFA A;  3VZI A;  3TX0 A;  4FNI A;  3S01 A;  5GAG I;  4B9V A;  3NL0 A;  2V8D A;  3OTO J;  4M5I A;  3QRQ A;  4OZJ A;  1KRP A;  2WOM A;  2CWK A;  4B08 A;  4ZJQ A;  4DUT A;  4DX8 H;  2ZC3 A;  3EVM A;  4LRC A;  1R43 A;  1RBO B;  1SIW B;  2HBZ B;  2EK6 A;  4PPD A;  1U7L A;  4DV7 F;  3KLI B;  3FRZ A;  2GX8 A;  1VIS A;  5DDR C;  3I4P A;  4ZIW A;  1VQM S;  1LXN A;  1ZAW A;  2F4F A;  1UFW A;  5LT5 A;  3BSC A;  4JYA J;  3D1O A;  4USW A;  4AE5 A;  4AFF A;  4OV1 A;  4P9S A;  3J81 Y;  1CC8 A;  4IO9 Q;  4DV0 J;  3B4M A;  1ZPW X;  5AJ3 J;  1QE1 B;  1YJV A;  4DPX A;  2XI2 A;  4PG8 A;  2IC3 B;  2HRY A;  4K59 A;  3DKD A;  2VU5 A;  2MKK A;  4IKA A;  2NPF A;  3C2P A;  1GX6 A;  4DDF A;  1K0T A;  2JOQ A;  2IJN A;  1RI7 A;  1OPI A;  1WF0 A;  4CLS A;  1B64 A;  3K5O A;  4NLQ A;  2LEB A;  3FSX A;  4QYZ J;  2CZ4 A;  3SQG A;  3TUP A;  1F9F A;  4OI6 A;  4NI2 A;  4YY3 J;  2DEI A;  2QJ3 A;  3E01 B;  4DQR A;  1CS4 A;  1IKW B;  3J7Z 5;  3DGV A;  4ED6 A;  2EFN A;  1U24 A;  3ULH A;  3RBZ A;  2ASL A;  1VQ8 S;  3U1L A;  1B0T A;  1RIS A;  3GYG A;  1S6U A;  4K4V A;  3QPI A;  1P27 B;  2M8H A;  1CJT B;  2MQQ A;  4I6A A;  4ZN3 A;  3VAG A;  4YQW A;  1X31 C;  3I56 S;  3W61 A;  2O3D A;  4F8R A;  1P9Q C;  1N5Q A;  2XMW A;  3CD7 A;  4NCG B;  1Q7L B;  2NZC A;  2JRS A;  3DOL A;  2X1G A;  4IH7 A;  2LMI A;  3BSA A;  1R6V A;  5MAO A;  3L3C A;  4X4R A;  4YR3 A;  5GVQ A;  5SUH A;  5L46 A;  5LL6 d;  4ANC A;  1KOH A;  4HLB A;  3IRX B;  4ZPV R;  3SQO P;  3PO4 A;  3R97 A;  1IXK A;  3QLH B;  3O1L A;  2FJX A;  1LXJ A;  2VJV A;  1IKX A;  2ZJP Q;  2HVE A;  2CJA A;  2UZA A;  4IG0 B;  2XQC A;  2VIH A;  2Z8Q A;  2UVW A;  2V69 A;  1HQE B;  5F41 A;  5HRO A;  3BS9 A;  5A8R A;  3S1T A;  3HDS A;  4LRF A;  3PNI A;  2NQP A;  2A10 A;  2BM1 A;  2F9D A;  1NRK A;  1Q7Y T;  4YEA A;  1U09 A;  2WK4 A;  3PAC A;  1UEU A;  1PC4 A;  2ROE A;  2DK2 A;  1FRI A;  3KLF B;  2UP1 A;  1GAO A;  2YVS A;  4LBH A;  4AT1 B;  5GAE I;  5LMN F;  1TL7 A;  5DG9 A;  3H5S A;  2FZG B;  3AD8 C;  1QAX A;  2QLJ B;  1RT7 A;  1B7Y B;  2QA4 S;  4U7U K;  1MG7 A;  1SJF A;  2DNP A;  5KFF A;  2HHP A;  4IFY A;  4CTA B;  2UVR A;  1FER A;  3AB2 B;  1DRZ A;  4R8U B;  2ALZ A;  1T9X A;  4Y2M A;  3PIP Q;  3B54 A;  3R7N B;  4RW8 B;  1WG1 A;  4XK8 C;  1X7V A;  2Z56 B;  2X7I A;  3N4W A;  2NSC A;  3FUY A;  2DO0 A;  1HHS A;  5I3U B;  2FHK A;  4ZOS A;  2HS0 A;  3R9L A;  2NRE A;  3MD3 A;  4M5D A;  2OGU A;  2UV8 A;  3OVA A;  1S0V A;  4UOH A;  4DPY A;  2PEB A;  1D9F A;  2D7S A;  4QPX A;  1D3W A;  4CYU B;  2YWW A;  1FNO A;  2V2Z A;  4NWB A;  2J5A A;  4C8L A;  1ULR A;  3GIR A;  3ETO A;  2YNG A;  1HQ2 A;  1MMN A;  3W63 A;  2CG4 A;  2HHU A;  2VBW A;  2HUR A;  5CYQ B;  1OQ6 A;  1RLC L;  3CO0 P;  1Q1K A;  2JWN A;  3H20 A;  3RB6 A;  1TV6 A;  3FQL A;  1NK6 A;  1NO8 A;  3QQC D;  1KHV A;  4W92 B;  4XTT A;  2XS2 A;  4JYA F;  1QSS A;  3MPV A;  2JL9 A;  4DV0 F;  2CJY B;  5AJ3 F;  3NGK A;  2AGQ A;  3PFO A;  2ASY A;  3NWR A;  4WII A;  3MMB A;  4U8Y A;  1X4A A;  3QRP A;  2Q6C A;  1RAF B;  3BQ2 A;  1VIO A;  3G8T A;  1UJ5 A;  5E41 A;  1JLB A;  1H6K X;  5C24 A;  4YB1 P;  2QV6 A;  4RR5 A;  1AB8 A;  2W4P A;  3HMJ G;  1IWA A;  5K14 A;  4ZDN A;  2IM3 A;  1BWV A;  2MLX A;  3FSY A;  3CSK A;  4MK7 A;  2KM8 C;  4LF9 J;  4CDI A;  2XMT A;  4AXI A;  3HKW A;  3KG1 A;  4FXW A;  1FX4 A;  1TMM A;  1T9T A;  3NS5 A;  2B4U A;  1QD1 A;  3IGN A;  2BKP A;  2AIR B;  1VK8 A;  4P74 A;  5E0O A;  3M05 A;  5IZH A;  3V2U C;  3SQG B;  3PR4 A;  4FYY B;  1QTM A;  2HFN A;  1U49 A;  5H9F J;  1FCA A;  3Q2S C;  3T5H A;  3CME S;  2NXE A;  4LF2 A;  1NDL A;  1PC5 A;  4NXM J;  4ZCK A;  2J7W A;  4WYW A;  1TR0 A;  1X0F A;  3OR2 A;  1U0S A;  2ZZM A;  1C2P A;  1XEZ A;  3LW5 C;  1IVZ A;  2V2V A;  5H9E K;  3NKY A;  5RUB A;  4RKU C;  3OJS A;  2EK1 A;  4PPZ A;  3DOL B;  2KTQ A;  3UE2 A;  1FJE B;  2XMA A;  4HHU A;  1T9Y A;  2BJ7 A;  4F4W A;  2AD9 A;  2GML A;  3MI7 X;  1Q8B A;  4DPT A;  3DRP A;  3DXS X;  2B56 A;  4O23 A;  2L9D A;  4LFB J;  1S9E A;  4DQS A;  5IQ6 A;  2BV3 A;  5DM7 Q;  2XGQ A;  3H7H B;  3DDI A;  1XER A;  4ED3 A;  5ADZ A;  3A8E A;  4WZM A;  5F0W A;  3KDN A;  2V8H A;  2YKN A;  1IKX B;  2BW7 A;  2Z2Z A;  1S97 A;  3A8J A;  3P45 B;  4A8O A;  5HMY A;  4B17 A;  3ITH A;  2QMU B;  1D1U A;  1OWX A;  1QLN A;  3PRB A;  4JB8 B;  2J9E A;  5HRO B;  3QZ8 A;  4WU2 A;  5A8R B;  2CQB A;  3ILI A;  3M8R A;  1FWP A;  1OY9 A;  2G2O A;  3QGP A;  1RAJ A;  3W60 A;  3CJ5 A;  2NR0 A;  3FBF A;  3JTP A;  2CPF A;  3OSP A;  5HBM B;  3OL7 A;  3UR0 A;  4Q8E A;  2CVI A;  1TL7 B;  3QT5 A;  2DGT A;  3DLJ A;  2HQG A;  1N0U A;  1ZM3 A;  2AJF E;  3M2V A;  2V6A A;  3FC9 A;  4FP9 A;  1M0S A;  2P5V A;  2IBK A;  3KDO A;  2EXU A;  2IJR A;  3TW0 A;  4V19 J;  4IFY B;  2AZ3 A;  4P2S A;  2BKN A;  1PGZ A;  5F8H A;  1DTQ B;  2EPI A;  3AOC A;  2OEK A;  2VH7 A;  1R0A A;  3SEO A;  1IBC B;  2MQL A;  1NKE A;  2Q3P A;  1RBL A;  2M52 A;  3TJA A;  2JEG A;  3PYD A;  3M32 B;  2HFO A;  2FY1 A;  4ICL A;  4LVN P;  4HDH A;  3ZTR A;  2LQJ A;  2RD5 C;  2W24 A;  5GAH I;  1WF2 A;  5KFZ A;  5C2G A;  1S1T A;  2G4B A;  4GVB A;  1VQN S;  2W9A A;  4OYW A;  4F0H A;  3BBC A;  2R7Q A;  5ETP A;  3ZTQ A;  5B0F A;  5CA5 A;  4ILL A;  2YXL A;  4H54 A;  4ZPD A;  1XWL A;  3TA0 A;  2ZHA A;  5D0R A;  1VBZ A;  1WUU A;  1YQH A;  2YNG B;  4ER8 A;  1OMS A;  3G2X A;  1F5B A;  2AWZ A;  4KPY A;  2CJ9 A;  4DBQ A;  1YBA A;  1HNZ J;  2LXF A;  2QC3 A;  4JV1 A;  1MN9 A;  1TV6 B;  3MR2 A;  2DCU B;  3FFI B;  2FLO A;  3HVR A;  3K2Y A;  3B6B A;  4FPI A;  2DNY A;  2XY5 A;  4CWB A;  5IXU A;  4CNY A;  1QJH A;  3CTR A;  3GE9 A;  3LAL A;  3TOQ A;  4KGV B;  1KR4 A;  2QLB B;  4BWM A;  1KEK A;  4OHX A;  5LOQ A;  3H2U B;  2J7K A;  4LF9 F;  2ROP A;  5KFS A;  1U2R A;  3VWS A;  5D4P A;  3MMB B;  3CJ4 A;  4LF8 J;  1UCN A;  2WW4 A;  2YNF B;  1T7P A;  1NJX A;  3OUY A;  4F2R A;  2HYI B;  1I1G A;  3Q8Q B;  4K2J A;  2V63 A;  4WFY A;  4C8O A;  1ZTW A;  4OI1 A;  4DL2 A;  2HHS A;  3W64 A;  5C24 B;  2JEI A;  2A2D A;  1U8S A;  1YVF A;  1UKU A;  1Q8L A;  1C4C A;  3TRG A;  3I0S A;  3RG6 A;  5K14 B;  5B09 A;  4DFM A;  2AW0 A;  3DOM A;  2B7C B;  3UVJ A;  2IA6 A;  4NXM F;  1HAR A;  1XMQ J;  2AEF A;  3HJV A;  2CJX B;  2P8I A;  4EYH B;  1SXL A;  2BJ9 A;  2ZZT A;  5D77 A;  2KH9 A;  2VD3 A;  1NSA A;  2MMY A;  1F6T A;  2QIF A;  2GFF A;  5L1K A;  4MFB A;  2XGP A;  4LSL A;  1RTJ B;  1Z4U A;  2D9O A;  1RXO B;  4F7V A;  1ACM B;  4H4O A;  4RZR A;  2B51 A;  2C3M A;  5CQG A;  1NPR A;  3EYZ A;  2DIS A;  1Y5I B;  2C3P A;  4NLY A;  4ECQ A;  4DCJ B;  1GNK A;  3ZTS A;  4LFB F;  3OR2 B;  3OXG A;  3PEJ A;  1XK8 A;  2HMI A;  2QL5 B;  3D0G E;  2DY1 A;  5DDP C;  1TK0 A;  2AJQ A;  2B4O A;  4ZIT A;  2OO4 A;  3LAK A;  3OLA A;  3W7B A;  4PXC A;  4LQ3 A;  4FYV B;  4ZLL A;  2D1C A;  2GCF A;  1OYD A;  3KUG A;  4DF4 A;  3D9B A;  4NML A;  3H4D A;  4ES1 A;  5CHC B;  2VG7 A;  4PZV A;  2I0X A;  3MM7 B;  3VR1 A;  4MAK A;  1EET A;  3TQ1 A;  2QLX A;  5CAB A;  3IS9 A;  3DRP B;  1RAO A;  3U27 A;  3I9Z A;  4RBV A;  1KVJ A;  5EX0 A;  1S9E B;  2ZBP A;  2VFT A;  3QO9 B;  3RRG A;  4OIX A;  2XSF A;  4OZ2 A;  4DUY J;  2AU0 A;  4JI0 F;  4DV5 J;  1Z1Z A;  2VFU A;  1GT8 A;  2I38 A;  2F65 A;  1UWB A;  3HFZ B;  4E2F B;  2YKN B;  3LQV A;  4B9U A;  1EB0 A;  2QYC A;  3ITH B;  3TVZ A;  3C46 A;  2NYI A;  5KFC A;  3THP A;  1CJU A;  3C66 A;  3KNA A;  1GMV A;  1ZTT A;  2VC0 A;  4GKK J;  2MTL A;  5CXT A;  2R8H A;  1N54 B;  4WFX A;  1F3V A;  4QU7 A;  1S7H A;  3DU5 A;  1K0V A;  1FHT A;  3CJ0 A;  2LLZ A;  3DMJ A;  1U1R A;  3W5Y A;  2GIQ A;  1APS A;  5I3P A;  2DTJ A;  3ISN D;  2H65 B;  1D8Z A;  3DDK A;  4F4Z A;  3LAN A;  3VZH A;  3TNV A;  4K50 A;  3JYT A;  5EGY A;  4KGK A;  2BE2 A;  3HPO A;  2DXD A;  1HPZ A;  4YR0 A;  4WJB A;  2CXE A;  1N5Y A;  3CUN A;  4AQY J;  3R5J B;  2CRL A;  1O8B A;  2FPH X;  1RWO B;  3G8S A;  4M5J A;  4OZN A;  3MOJ B;  1R0A B;  2CJQ A;  3MM9 B;  1FJG J;  3KFW X;  4MKA A;  2MJU A;  3AOB A;  4KRW A;  2BJ3 A;  3R5A A;  3T1A A;  2EFP A;  1WF1 A;  1UAW A;  1YK9 A;  1HNZ F;  1DJ0 A;  4O44 A;  7FDR A;  2CQG A;  3CDB A;  1S4F A;  3OHB A;  2GA7 A;  4ZVE A;  2V2K A;  4QR2 A;  2LKZ A;  4DOZ A;  1WOP A;  4CH0 S;  5IV3 A;  5I3Q A;  3J7A 1;  2DYA A;  1SCJ B;  4GKJ J;  3UFC X;  4TU8 A;  4ZP6 A;  2ZWO A;  2Q66 A;  1UJ4 A;  1I5O B;  4JI1 J;  1R8H A;  2MZJ A;  4QWD A;  5B08 A;  3LH2 S;  4B9S A;  2HHX A;  4ZVH A;  1VQ5 S;  4OYB A;  2DNL A;  2NZ4 A;  4DZD A;  4UST A;  3UPF A;  1WJ9 A;  3BO2 A;  1J5E J;  2GV1 A;  3ELH A;  3A1Y G;  1ZAX A;  1V9O A;  2AZ1 A;  2KFY A;  1AUS L;  1T9V A;  2HWH A;  1YJ7 A;  3OT9 A;  3G8Q A;  1HYS A;  1NHV A;  4DSE A;  4UZB A;  1W26 A;  1RGV A;  1YRU A;  3PX4 A;  2W2N P;  2HGM A;  1RKJ A;  4J7C A;  1XMQ F;  3JAM Y;  2RML A;  1YGY A;  3IR7 B;  2EFG A;  2CZV C;  2OH2 A;  1RHK B;  2F1F A;  1RLD A;  4WK1 A;  3EVO A;  4B3T F;  2ZUG A;  2E7X A;  2KVI A;  3RB3 A;  2J76 E;  5CH7 B;  3A3O B;  1VRT A;  2MYF A;  3WHI A;  4WFN Q;  2PI5 A;  2HRU A;  3IXQ A;  1NKC A;  5A2Q U;  2DJW A;  4ECT A;  3UVJ B;  3M9O B;  2LEC A;  5CD4 H;  2WVB A;  5LSL A;  1NK0 A;  4F04 B;  2CPZ A;  3MR7 A;  1S7I A;  1FD8 A;  4KHR A;  3THV A;  3PJ9 A;  1A7G E;  3HZG A;  3ZZT A;  4P7T A;  3ICL A;  4KH0 B;  1WKJ A;  3ENV A;  1YJT A;  4I2P B;  3CJS A;  4MFB B;  2PI4 A;  4NLX A;  4LSL B;  1HD0 A;  1CBK A;  4ETX A;  5LSR A;  1FE4 A;  2OPP B;  5IWA J;  4H4O B;  3HSZ A;  4L72 B;  3D2W A;  5AE2 A;  4AL7 A;  1YJ9 S;  2HMI B;  2VA3 A;  1S0M A;  2K7K A;  1WOO A;  1RWX B;  2POK A;  2WZ1 A;  4X4N A;  4CM2 A;  2D69 A;  4HT5 A;  2VG7 B;  4KO0 A;  4K4U A;  2DNN A;  4WPA A;  3IP0 A;  1EET B;  4NRU A;  2JH3 A;  3QAE A;  2DKO B;  4GKK F;  2CFX A;  2LXU A;  1WD6 A;  4X64 J;  2DPI A;  2ZUA A;  2GJI A;  3BKF A;  4MMO A;  3CXC R;  5F3T A;  5KOW A;  1UWB B;  5D3G A;  3CED A;  3TAR A;  1I51 B;  5K20 B;  1WC0 A;  4JV5 F;  3GYX B;  3BBB A;  4O3O A;  1UZH A;  4DFP A;  1O0P A;  1CJU B;  1RTH A;  4CH1 A;  4B3M J;  5GMD A;  4CIO A;  1Q5V A;  3CMA S;  1U1L A;  1UJ6 A;  3AXM A;  2R42 A;  1DBD A;  2HLU A;  2V5H G;  2UXC F;  1HWL A;  2C3Y A;  3D7S B;  5ETV A;  4DV3 J;  1S5Z A;  4X62 J;  3NLC A;  1FJG F;  1FNM A;  3QWU A;  4F0K A;  2Z57 B;  4N7T A;  3HT0 A;  1DAR A;  1JQG A;  3VGV A;  2BMB A;  3VAM A;  1RWV B;  3JYT B;  1PYS B;  2BE2 B;  3DLB A;  2CDQ A;  1HPZ B;  2FZC B;  3D66 A;  4CO3 A;  1N5Y B;  4DL7 A;  4UF4 A;  2E5L J;  1BQX A;  2H4W B;  2NPI A;  1V3S A;  4USI A;  3DLG A;  4FPR A;  1M5P C;  3EXC X;  3I5C A;  3FBC A;  2HHH F;  4GKJ F;  3VF0 B;  1X5T A;  2LFV A;  4JI1 F;  3N79 A;  3V4I A;  4EO6 A;  2WB1 D;  3L95 X;  3WQP A;  3AY0 A;  4Z7C A;  4O44 B;  2CPH A;  5E2Q A;  1WAC A;  3AA9 A;  1HHT P;  1J5E F;  2HFZ A;  2M70 A;  2PGC A;  2SXL A;  2RVJ A;  2CWX A;  1RKI A;  2BJ8 A;  1Q81 T;  4C3M A;  4QPT A;  4K4T A;  2YWH A;  4YDX A;  2RKI A;  4OX6 A;  3UQS A;  2F63 A;  2VKR A;  1RT3 A;  1F60 B;  2ZFH A;  3TAM A;  4FYD A;  4DL6 A;  3C16 B;  1RHR B;  4ZVF A;  1LFW A;  5KFW A;  5IT0 A;  4LIR A;  1R8B A;  1X4E A;  4V19 X;  2VOP A;  3US5 A;  3EXY A;  2OFH X;  4MKV A;  3MXH P;  5IC6 B;  4WFZ A;  2HAI A;  3IR5 B;  3F56 A;  5E3R A;  2PA8 D;  3NNC A;  2DCL A;  3H2L A;  5JVG Q;  4WP9 A;  3BR8 A;  2Y0B B;  3K5N A;  4DL5 A;  4ZPA A;  1KFS A;  5D0G A;  3K8W A;  2Y8W A;  4YHH F;  1FNX H;  1X0P A;  2MSS A;  3UR3 C;  4R0J A;  1U1P A;  1NSK L;  2R2R A;  1H7X A;  4X4T A;  5HMW A;  1R3N A;  1N34 J;  4Q5V A;  1VRT B;  3MEC A;  2AF6 A;  2L08 A;  2XMV A;  2YWG A;  1X5P A;  5IWA F;  3SCL E;  5DZ7 A;  3GJR B;  3MUM P;  4A8Q A;  2V4R A;  3Q8V A;  5F8L A;  2DRD A;  4JI7 F;  4YB6 A;  1VBX A;  1TL3 A;  3ZNJ 1;  4DV6 J;  3MR6 A;  2CJB A;  4I7F A;  4DCP B;  5HP1 A;  1SQE A;  5C5J A;  2AYG A;  4PQA A;  2XTJ P;  3L09 A;  3PY8 A;  3V4M A;  4ELU A;  2KU7 A;  2IMO A;  3DYA A;  2B8P A;  2MKY A;  4K8R A;  2J8S A;  4DPW A;  3CJR A;  3NOC A;  2CVE A;  4DPU A;  2Y1R I;  2QO3 A;  5G4D A;  2DGS A;  2DNK A;  3OFE A;  1AT1 B;  2PN6 A;  2IRX A;  3GU0 A;  2I8E A;  2JFD A;  1FRH A;  2ZH5 A;  4CRJ A;  2O01 C;  3Q8P B;  5DGA A;  3BR9 A;  2XEX A;  1IQT A;  5DQI A;  3GSI A;  4P6Q A;  1NKB A;  3V5R A;  1UVJ A;  4DU8 A;  5CAA A;  4N5S A;  2HHW A;  4CLK A;  3G71 S;  4KO0 B;  4WE1 B;  3KMS A;  2QGF B;  5CYJ A;  4B3M F;  4HAC B;  3GJS B;  4L74 A;  3I5A A;  4Y0F A;  4M8L A;  4ZP8 A;  2F3J A;  3FNN A;  5BYR A;  4X62 F;  4NLD A;  2B43 A;  1PSD A;  3PIO Q;  3PVX A;  2F40 A;  2HHQ A;  1S9G A;  4C48 A;  4A8S A;  2V9K A;  2DNR A;  3CCR S;  4OZ3 A;  2BQR A;  4EUV A;  2FHM A;  3DRR A;  1RTH B;  2DXF A;  3PG9 A;  5KFK A;  5DET A;  2E5L F;  1SL1 A;  3CC2 S;  3R7B B;  3KLG A;  2CIM A;  3T9N A;  2ZVI A;  1T03 A;  4AL5 A;  4LSZ B;  1U0H A;  1FRJ A;  3J7Y U;  4FF1 A;  1S6P A;  5DZ6 A;  4NLW A;  3IA0 A;  2L41 A;  2MZT A;  5HAO A;  4DV2 J;  2X1B A;  3BO4 A;  2HQF A;  1PKU A;  1VBK A;  3VGS A;  4C0B A;  1LKZ A;  1RT6 A;  3GON A;  2EFO A;  4LUB A;  3DLG B;  4OZ5 A;  1VC0 A;  1OSD A;  4ECV A;  4GO5 X;  4KQZ A;  5AT1 B;  1VJQ A;  4PXE A;  2A0F B;  4X4P A;  3NMA A;  3WZ0 A;  4I0W A;  3GIL A;  1PIE A;  2JVR A;  3NBP A;  1CJV B;  4FYW B;  3FCW A;  1M5V C;  5F8G A;  2HLT A;  4ECZ A;  2OAU A;  3GG1 A;  2OIH A;  1Q79 A;  3V4I B;  4DR6 J;  5L9X A;  4E98 A;  1SUQ A;  1M5S A;  4TXS A;  3R6L B;  2HSE B;  2HS4 A;  4UQG A;  4OYZ A;  1WWH A;  4C97 A;  2DHG A;  4S0M A;  2ZH2 A;  2BAC A;  1GMW A;  4IUF A;  4LF7 J;  4K5S A;  4P2M A;  3CPW R;  3OQ2 A;  2WVD A;  2KFN A;  1XQI A;  4RUA A;  4FZV A;  3R5G A;  2RKI B;  1VR6 A;  3BO3 A;  3A8K A;  1RT3 B;  2HGL A;  2K06 A;  3TAM B;  3RAX A;  3KK2 A;  4IRC A;  1M5O C;  3J81 U;  5H1S V;  3AOD A;  2E1R A;  4JI6 J;  2V4J A;  4OYX A;  2VKZ G;  3EZ5 A;  1JJH A;  4DSJ A;  2R7U A;  2JLG A;  2RHQ B;  1FRX A;  3FEX B;  3E51 A;  4KV8 A;  3W65 A;  4M5G A;  2XB2 D;  1SC4 B;  5L1L A;  1F5A A;  2DD8 S;  3FMB A;  2VDI A;  1N34 F;  4MKY A;  2ZKU A;  2IRU A;  2DIT A;  1QUV A;  4QYR A;  4F4Y A;  3PEH A;  3QFH A;  3PHE A;  1BHN A;  1IKY A;  2BA9 A;  1GTH A;  2JVO A;  1WOR A;  1I3O B;  2QL9 B;  3MEG A;  1N36 F;  4ZJL A;  4H4K C;  4ZLN A;  2C22 A;  3D6M B;  2UUB J;  2A2C A;  1AW0 A;  3A13 A;  3CE8 A;  4OYI A;  2KJW A;  1T95 A;  2DRA A;  1G4C A;  2LA4 A;  3KHH A;  5CYM A;  3BB5 A;  3T5J A;  3OXF A;  3HT3 A;  1S0O A;  3FEY B;  4X84 A;  3R1H A;  3ZO7 A;  4F4A A;  4HI1 A;  4EZ6 A;  5GMK a;  3HHL A;  2E9R X;  5U47 A;  1HNX F;  3DYA B;  4RW4 A;  3H98 A;  1UEK A;  1BUX A;  1RA7 A;  5EWG A;  3B4D A;  2XWX A;  5IOL A;  4RW9 A;  2BE7 D;  4ITS A;  3CB4 A;  3PV8 A;  1TK8 A;  4U7C A;  3DOK A;  3IM9 A;  4B3R J;  2GGP B;  2P9E A;  2VJU A;  3POT A;  2QYG A;  5KG5 A;  1YDL A;  1H74 A;  2YQ1 A;  4KGM A;  3K57 A;  2DNM A;  4J90 A;  2HVD A;  4ZVP B;  3GIK A;  2YKQ A;  5A0Y A;  1UVN A;  2OLW A;  3LAM A;  3K59 A;  3U1N A;  3QID A;  3UCU P;  4NLO A;  4PG5 A;  1P8G A;  1UMJ A;  1GXL A;  2FTR A;  1SVD A;  4I67 A;  2VQE J;  3UW1 A;  1NH7 A;  3CDA A;  1K73 T;  3ZNU A;  4ILM A;  1YSJ A;  2RRA A;  3M8S A;  2WSC C;  4PUO A;  2LU1 A;  3LO3 A;  3VVU A;  2JEJ A;  2CNK B;  2RF2 A;  1ZZN A;  5KFX A;  2FLP A;  5J1P A;  3GZ7 A;  1RHJ B;  3Q8S B;  2K8G A;  4DV2 F;  2DNQ A;  2PII A;  2DPJ A;  5LM7 E;  2VV5 A;  4J9K A;  3DRR B;  4WBF A;  1UFK A;  4DL4 A;  4I6W A;  1S6O A;  1DQ9 A;  4OV6 A;  2W9C A;  3OTB A;  4PWD A;  3P6Y C;  1DAX A;  3TUI C;  2KRR A;  2C28 A;  2DNG A;  3KLG B;  2QX0 A;  2DHX A;  2CNO B;  2HND A;  3C15 A;  1IBM J;  4Q45 A;  2GMH A;  2RHS B;  4CH7 A;  2KVQ E;  1U0H B;  4R5P A;  2VBZ A;  1S6P B;  4DR6 F;  1F9E B;  3UDV A;  2MLY A;  3QGH A;  2QLW A;  1Y9O A;  2Y1J A;  2W01 A;  3OHA A;  3HLU A;  3KHL A;  4U67 Q;  1RT6 B;  2RUS A;  2VIC A;  1WI8 A;  2WSF C;  2DGW A;  3MEE A;  2HFS A;  1DUR A;  4FBU A;  3IAS 9;  1S99 A;  3W62 A;  4LF7 F;  4ZMM A;  4I2Q A;  2EW9 A;  5JVH Q;  2GNK A;  1FRL A;  2J7U A;  4NAS A;  2NXC A;  3NBP B;  4ELV A;  3PJW A;  5LJ5 Y;  4DSI A;  1N5V A;  4JI6 F;  2MB0 B;  3SZ2 A;  1RZM A;  2MHE A;  4OYO A;  3EGW B;  1VQP S;  4JP8 A;  2UXD J;  2GQQ A;  1TVR A;  4O3R A;  1SKS A;  1F9H A;  4F02 A;  2OUG A;  2QFI A;  2QTW A;  5DG7 A;  1WOS A;  1FK9 A;  1S1X A;  4LF5 J;  4QR1 A;  4J5O A;  3KOA A;  1MRO A;  1SH0 A;  2FD2 A;  1FTC A;  2HFU A;  2MQN A;  2UV8 G;  3ONQ A;  2V4J B;  1X9M A;  3PX0 A;  1OIA A;  4ES2 A;  2JLE A;  3M8Y A;  3M1V B;  4B3S F;  3SXL A;  1S4E A;  3N6N A;  1PBU A;  3JXO A;  4KV8 B;  3SSQ A;  5CD4 A;  1JLE A;  2UUB F;  1EAR A;  4MYU A;  1ZYQ A;  4Q44 A;  1LV5 A;  3JSR A;  3IR6 B;  1NJI T;  1EKR A;  2FJV A;  3QJL A;  2W7O A;  1U4B A;  3BJY A;  2CNN B;  4X4Q A;  1RTI A;  1IKY B;  1M5H A;  5H9E J;  2ZOF A;  1WC5 A;  1WC6 A;  1M1H A;  3HP6 A;  1JXE A;  2RJZ A;  2FHJ A;  4MJK A;  2VBX A;  1P1L A;  1R8P A;  1O5J A;  2W2Q P;  2F8M A;  4P2X A;  1TQL A;  3N9U C;  4ZPW R;  4ZPC A;  4LMZ A;  2R7V A;  2YNI A;  4DR4 F;  4I1T A;  5F3Z A;  4UOG A;  3QYY A;  5CYM B;  2PE8 A;  3H5Y A;  3KHR A;  3MPY A;  4MYT A;  1ZOT A;  4CO0 A;  3H8Y A;  4XDD A;  1N0V C;  2XI3 A;  3HHL B;  4FVM A;  4RW4 B;  3AFG A;  2IPO B;  1MMD A;  2MDA A;  3DOK B;  2V8P A;  2VQE F;  1RQ0 A;  2VG5 B;  1M5K C;  2VFR A;  1U6B A;  2MY8 A;  3R2C J;  2Z2Y B;  3TQE A;  5A0Y B;  3N28 A;  4DV7 J;  1VRU A;  2HZV A;  2APO A;  3IRW P;  1ZPV A;  1TKX A;  1NU4 A;  1HI1 A;  1NPK A;  1KQG B;  3A3P B;  4Z2X A;  4URQ U;  2ZIT A;  5BR8 J;  3Q8U A;  4XAK A;  1QVF R;  1X4G A;  1U1Q A;  4KHM A;  1VHF A;  1AZS A;  4KPC A;  3QGI A;  3C19 A;  4LRB A;  5J2N A;  3LP2 A;  3DDN A;  4PWW A;  4PUO B;  1IBM F;  2V8G A;  4KAI A;  3OJU A;  1VQ6 S;  2XNQ A;  2HVZ A;  1RU2 A;  5A76 A;  5K8N A;  5JXS A;  4JV2 A;  3JQK A;  4U96 A;  1F1B B;  1NHU A;  2YKM A;  2I2Y A;  2W9C B;  4PWD B;  2H4Y B;  1C4A A;  1RYR A;  2ZNZ A;  3SCI E;  3MHY A;  4ED7 A;  2OD6 A;  3C15 B;  5A6W A;  2MZS A;  4PRF A;  4F4K A;  1NZ8 A;  1RWU A;  1CEZ A;  2E66 A;  2Y8Y A;  4Y6I A;  4R5P B;  4EMD A;  1WI6 A;  3W8G A;  1M1G A;  4NLG A;  1HWK A;  3MTK A;  4C8N A;  3MR3 A;  3PRD A;  2XWY A;  2VAS A;  3AOA A;  2PA3 A;  1XNR J;  1XR6 A;  1UA1 A;  4TVA B;  2ZWP A;  4WTO B;  4LF1 A;  3P5B P;  3X1L B;  4CLZ A;  4ZLP A;  4JBC A;  4LF5 F;  4Q0B B;  2BQU A;  2B7B B;  4OX9 J;  3X3U A;  2MJN A;  4H4M A;  1CQN A;  4PCQ A;  2WHO A;  2J0S D;  3P49 B;  2BR0 A;  3WBZ A;  3GPA A;  1BMQ B;  2NXJ A;  3D3C J;  1HBN A;  2J9D E;  2P9C A;  4PXB A;  2KI2 A;  1ZH5 A;  1TVR B;  2DO4 A;  4WWS A;  3UN2 A;  5LXR A;  4DL3 A;  4RL1 A;  1VBY A;  1S1U A;  5KT3 A;  4L73 A;  3GSD A;  1XJW B;  2OML A;  3TYT A;  3M8W A;  2YBV A;  4PG7 A;  1S1X B;  2MZQ A;  3AA8 A;  3QZ7 A;  1VOM A;  1R6Y A;  4C3L A;  1NM2 A;  4LBI A;  5T14 A;  5GAD U;  1BY9 A;  3MAQ A;  4QWE A;  4OHV A;  2AGO A;  3SMZ A;  3KKF A;  3IMQ J;  4A47 A;  3BN4 A;  1HLW A; 
#chains in the Genus database with same CATH homology
 1NPK A;  4O0N A;  1LWX A;  1MN7 A;  2B8P A;  4W98 A;  1NDL A;  4F36 A;  2NCK L;  3BBC A;  3ETM A;  2HVD A;  1NCL A;  3FBB A;  4UOF A;  3ZTP A;  3ZTQ A;  3Q8U A;  2DY9 A;  2BX6 A;  3FBC A;  4C6A A;  1K44 A;  4AND A;  2DXD A;  4S0M A;  1NSQ A;  4UOG A;  1HHQ A;  3PJ9 A;  4DZ6 A;  2HVE A;  2DXF A;  3FBF A;  4ENO A;  3EE3 A;  2ZUA A;  3FBE A;  2CWK A;  3MPD A;  3R9L A;  1WKJ A;  3ENA A;  3Q86 A;  4KPC A;  1EHW A;  3NGS A;  3ELH A;  3ZTO A;  3NGT A;  4DUT A;  2AZ1 A;  1NB2 A;  3EVM A;  3G2X A;  4DI6 A;  5CAB A;  1XQI A;  3JS9 A;  4UOH A;  3NGR A;  3BBB A;  1WKK A;  4EK2 A;  1ZS6 A;  1U8W A;  1VYA A;  1F3F A;  1PAE X;  1NSK L;  1NLK L;  4CP5 A;  3VVT A;  5C7P A;  3FC9 A;  1NHK L;  3GP9 A;  2DXE A;  1MN9 A;  1F6T A;  3Q8Y A;  3BBF A;  1LEO A;  3EIC A;  3GPA A;  3B6B A;  2AZ3 A;  3L7U A;  4F4A A;  1PKU A;  5CAA A;  3VGS A;  4HR2 A;  1JXV A;  3VGU A;  3FKB A;  3BH6 B;  3Q89 A;  1W7W A;  3VVU A;  1HIY A;  1XIQ A;  3Q8V A;  2HUR A;  3FCV A;  1S5Z A;  4FKY A;  3EMT A;  3EVO A;  3VGT A;  1BUX A;  5BXI A;  3DDI A;  3NGU A;  3VGV A;  3EM1 A;  5IOL A;  2BEF A;  3EJM A;  3PRV A;  2B8Q A;  1UCN A;  3DKD A;  1NDC A;  3BH7 B;  1S59 A;  2VU5 A;  1KDN A;  3WX8 A;  4WBF A;  1NSP A;  3Q83 A;  3ZTR A;  3ZTS A;  4ANC A;  4ANE A;  3EVW A;  1NUE A;  2DYA A;  1B99 A;  3FCW A;  3B54 A;  1B4S A;  1BHN A;  1NDK A;  1WKL A;  1S57 A;  1NDP A;  4FKX A;  1HLW A;  1BE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...