3L7UA

Crystal structure of human nm23-h1
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined Structure of Human NM23-H1 from a Hexagonal Crystal
doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase A
total genus 47
structure length 152
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2009-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3l7uA00
3EJMA 3BBBA 3ZTPA 1PAEX 2B8PA 2DYAA 1XIQA 1W7WA 3Q89A 2DXEA 1NPKA 3Q8UA 4CP5A 3BH7B 4F36A 3DKDA 3FCVA 1NDLA 1WKLA 4W98A 1JXVA 3ENAA 3PJ9A 2VU5A 3FBFA 5IOLA 3VVTA 1NCLA 1U8WA 3FBEA 1NUEA 3EVWA 1XQIA 1BUXA 3WX8A 3B54A 1WKJA 1S5ZA 3FBBA 4FKYA 4UOFA 5CABA 2NCKL 1NHKL 2DXFA 1HHQA 1PKUA 2HVEA 1NDCA 3Q83A 2ZUAA 2DY9A 1WKKA 2CWKA 3EE3A 3ZTRA 1VYAA 2AZ1A 3NGUA 1KDNA 4UOGA 4ANDA 4ANCA 3VGSA 3Q86A 3ZTOA 3FC9A 1NB2A 3DDIA 1HIYA 4ANEA 5BXIA 3ETMA 3GP9A 4C6AA 2BEFA 1EHWA 3B6BA 2DXDA 4DUTA 3FBCA 3EVOA 1NSKL 3EMTA 3VGVA 3GPAA 4WBFA 1F3FA 3ZTSA 4ENOA 3EICA 3ZTQA 3G2XA 2AZ3A 3FKBA 4HR2A 1NDPA 4KPCA 1NSPA 1F6TA 4EK2A 5CAAA 4F4AA 2B8QA 4DZ6A 3NGSA 1HLWA 2HURA 3VGUA 3JS9A 1BHNA 1B4SA 1NSQA 3VGTA 5C7PA 3FCWA 1B99A 4FKXA 2HVDA 4S0MA 3MPDA 1LEOA 1ZS6A 3EVMA 4DI6A 1BE4A 3BBFA 3L7UA 3NGTA 3Q8VA 4O0NA 3EM1A 3VVUA 1UCNA 1NLKL 2BX6A 3BBCA 3Q8YA 1K44A 3R9LA 1MN7A 1MN9A 3NGRA 4UOHA 1S57A 1S59A 3ELHA 1LWXA 3PRVA 1NDKA 3BH6B
chains in the Genus database with same CATH superfamily
3EJMA 1VRUB 3H0PA 4X4PA 3OTEA 4OI4A 3QWPA 3ILOA 1MWYA 5G0RB 3D2WA 5LXRA 1NB7A 2DH7A 1HR0F 4OHXA 2DTJA 3M6WA 1F1BB 1Q8KA 3E51A 3MZIA 4FNIA 4WFXA 5HVFA 2W8LA 3WHIA 3QLHA 4DLEA 1HKAA 3EPIA 3LGMA 4OJ3A 2JZ5A 4JI1J 2OKQA 5KTQA 4KKOB 2FUG9 3TVYA 2J0QD 2CZ4A 5K14B 4YR3A 1S9GB 2CQIA 1S76D 2JLEA 3QRQA 3DRSB 3SSQA 4ZJLA 2MB0B 4ZVGA 2AD9A 4IR9A 3N9UC 5E5NA 4K5RA 5LL6d 1M5KC 2I5JB 5F41A 1JXLA 3Q23A 1RT4A 1MMDA 1X4HA 2HVZA 1F9HA 4DPYA 3IRXA 2HPUA 5F3ZA 2NPIA 1SC6A 2XZTB 3DGPA 4C0BA 5DDOC 5HQ8A 1NXIA 1KLNA 3CT9A 1KOHA 5F3TA 3EE3A 3OXFA 2FJVA 4WP9A 3J7YI 5EDWA 1YK9A 3LUYA 2DNLA 3EUNA 2CA9A 5F8IA 1U1MA 3WC0A 4B9VA 1UVNA 4ANDA 1HPZA 4OI0A 1LW2A 1S9GA 5I42B 4C9DA 3NAHA 3PR5B 4CT8A 3V81A 1R6YA 3HVTB 3TJAA 4NASA 5JUMA 3SV3A 2AQ4A 2VIHA 2KFNA 4GC7A 4CTAA 4WWSA 4ECWA 3MFIA 3U1MA 4OZLA 1T03A 4UZBA 3W61A 2DNGA 3H2LA 2BEFA 4O0IA 5D15A 3JSMA 1F2GA 1F9FA 4IDKA 1HHSA 2EWHA 4KTQA 4G1QB 2GMLA 4P2FA 4DL6A 5LOQA 1JLAB 2BQRA 2CDQA 4URGA 3TZZA 3J80U 2GVDB 4PXEA 1RWWB 4PABA 3HHLB 3DC2A 1VLYA 1AA1B 3ZTSA 3F73A 2XGQA 1GTEA 4ECVA 3ET6B 3C14A 3FK4A 4GRSA 1N34J 1IVZA 1E6YB 3KMQA 1RT7B 1RAAB 2WVDA 4GC6A 5D0HA 4ER8A 1JLFA 3BDEA 5HLFA 4J9OA 1S1UA 4HLBA 5CA5A 4M5DB 5IZHA 5F8LA 1MMNA 3LW5C 4MT1A 2Y1IA 5DQGA 3CDWA 3OVSA 4D3GA 5I3QA 1X9MA 3HO1A 1HMVB 3CVKA 4DSIA 1URNA 3M6VA 1CPZA 1B99A 3EGNA 4GKJF 4KR0B 1J5OB 1G2EA 4ALZA 4L6V3 1HBMA 2EI5A 5E7OB 4JI3J 3EVMA 3PACA 4P9SA 2W24A 5RUBA 2X1FA 1JQGA 3P49B 2R7SA 1Q53A 4DSLA 3QGIA 2ZEJA 2CYYA 1RAGB 2HRTA 3Q2SC 4DXLA 3OL7A 1RQ0A 1EP4B 3W63A 1MSWD 1LWCB 2XQCA 4Y00A 1TFWA 2PDAA 1Y5NB 5ADZA 1XMQF 3KLGA 5G4DA 2HZCA 2HG4A 1K0TA 1S72S 2DGQA 2R7XA 2NXEA 5DRKA 5K5MA 3M9OB 1JJHA 4QR0A 5KFSA 4X4OA 2CRLA 5C24A 1M5HA 2QFIA 3RR8A 4A8KA 4OFZA 3OLAA 4LSLA 1X4AA 3DRRA 4P2SA 1RHRB 3LA0A 3N5FA 1AXQA 3KK3A 2E1RA 3CDUA 2B9XA 4U6PA 1A0OB 2CKWA 3QO9A 4ZVTB 2J6SA 1HBNA 4PQUB 3LOUA 2V4JB 4C3LA 4M5HA 3CDBA 3ZZTA 4DMZA 2RKIA 4J9NA 4Q0BA 2CPDA 5DG9A 2HZVA 3J7AN 2HHUA 2MQLA 4M5MA 1HNIA 3OTOF 3TUIC 2IVYA 2ZHOA 5CD4A 2D9PA 3PW2A 3MEKA 1SKSA 3T6JA 3I0SA 4OZ1A 3U1LA 1RABB 1T9TA 1Q79A 5F9LA 1VQ5S 4FF1A 3KJQB 5CCLA 1KQGB 1P27B 1NPKA 3SSRA 2VFTA 1TV6A 2G1DA 2C28A 2KKHA 1RTHB 2ZOFA 4MAKA 4I56A 5GAEI 1ZH5A 3MEGA 1UTAA 2QLXA 3GYGA 5DG7A 4ZJOA 1IWAA 2IC3B 4BLGA 2KT2A 3TAMA 3C46A 1HNXF 3LP0A 4X4VA 1Y11A 3HKWA 2Y0SD 1XN9A 1WHYA 4EBCA 2RDIA 4LREA 3HJVA 5D6GA 1DFDA 1U8WA 4WP8A 3MI7X 4PR6A 1HNWJ 2PEHA 1UEVA 2JX2A 3KUEA 3FMWA 3MCOA 4CWBA 1RT5A 2XMJA 4P52A 2B7CB 3T3FA 3H4DA 2R2UA 3N4WA 1L5UA 2OPQB 3GIRA 3AD8C 1U1RA 4LF8J 2E1AA 2RT3A 3N6NA 3L7PA 1YWXA 3Q83A 4CLPA 2IJRA 4NLQA 1RZMA 4NXNJ 2JEGA 1GX5A 3NXZA 5AE1A 3GILA 4DR6J 2IA0A 4L3KA 4IFVA 3D5MA 4B3RF 1O8BA 4X84A 4CO2A 3HLUA 3K59A 3EXCX 2E7XA 5DS7A 3TA0A 4DX6A 1YJNS 1RT2B 4M5KA 2IAJA 1CG2A 3Q86A 5CCMA 4RW8A 4J9MA 2JHEA 4URSA 1I94J 5E3AA 3J81U 1MMLA 2QLBB 4KFBB 4PXCA 3PW5A 4RL1A 1IKXA 3THVA 1ZM2A 2WAQD 1T02A 3DLGA 2FZCB 2NXCA 2VFVA 3IFEA 3RRHA 2EK1A 4DV2F 2XNRA 3I5AA 4J9VA 5A8KB 2XB2D 1YJRA 3CIZA 1U24A 1G1XA 2M9KA 2VPZB 1IQTA 2P8IA 1Y5LB 2KXFA 4IO9Q 3W8PA 4QOTA 1C4CA 3GPAA 3UFCX 4HL9A 4J9UE 3RUBL 3EWGA 3KLIA 4WP3A 5DDRC 1UW4A 2RH3A 3EICA 1UPMB 2DY1A 3SSSA 3VWSA 1KRPA 1T05A 5DLFA 1TFYA 5K14A 3ZC4A 1FE0A 2KTQA 4UT4A 4R8UB 1JLQB 3GTYX 1HBOB 2BM1A 4DPXA 4KHPJ 3R1LA 2QGFB 3HVRA 1JLCA 3W7BA 2ACYA 1S49A 1FESA 4G65A 1N34F 9RUBA 2DR9A 2GAHC 1VR6A 1RLDA 4MYTA 2YX7A 2X7IA 3SQGB 5B09A 2Q66A 1CS4B 2F8MA 8RUCA 4LF6F 2ZJPQ 4C8OA 4MMOA 1AUDA 3ZXWA 1F0XA 1TU0B 1WOOA 2VG6A 3M4XA 1XR6A 1S0OA 3EM1A 3SDEB 2CIMA 3ENWA 3B82A 3O44A 4FVMA 1M5SA 1W25A 2IMOA 2ASLA 5T7LA 2B3TB 1HNIB 1VLOA 1RYSA 1FERA 3H90A 3J7ZT 3CCES 3A3PB 3MMJA 1PCAA 5IWAJ 2VQFJ 2ZH2A 3E01B 3LO3A 3DCAA 2ZH5A 3GR1A 3NGRA 4AUKA 4B9SA 2DEIA 1FT8A 3KNAA 3RJMB 2ADBA 4KO0A 2YWEA 3L3CA 4CO0A 3NY0A 1JLFB 5DJBA 1FJEB 2M8DB 1SIZA 2XTJP 1N5TA 3ILIA 3BKFA 4PG6A 3G9CA 5C24B 1K47A 2V63A 1M1HA 1UFWA 2MLZA 3LP0B 2HQIA 3H98A 1UJ5A 2GW8A 3J81j 1OO0B 4FYVB 3ISZA 1WEXA 5LXYA 5IS2A 4K50A 3H5SA 4R0EA 5B0EA 4LF6J 2BW7A 2UXDF 1FFWB 2GHVC 4O4GA 1W7WA 2V4JA 4ETXA 4LF7J 1UETA 2P6SA 5L1JA 3LAKA 1R43A 1UA1A 2Y9HA 4DBQA 2XCPA 1YRTA 1DQ8A 2KYZA 2N3LA 4DUZJ 3HFVA 2W9AA 4J9SA 1VC0A 4KV8A 2NUUG 3MOJB 2MKHA 3ITHB 1N52B 2IM3A 4C2MA 5IWAF 3N0VA 2WZ1A 2B4VA 2DO0A 4LVNP 2XO7A 2WW4A 1HPZB 5DGBA 2H9ZA 1N33J 4B3TF 2ZE2B 4X65F 1NK8A 2FGOA 2M3DA 2VUGA 2ZBCA 4DOZA 1V3RA 3CDAA 1KONA 1HYSB 3NMRA 4K4SA 4F0KA 5L39A 1Q0NA 3CC2S 2DH9A 1BMQB 1LWEA 2DR6A 3H59A 3ET6A 1RWPB 1NJWA 4TQSA 3O8WA 1GH8A 5KFOA 1UKUA 4RBVA 1IWGA 3T6BA 3NOGA 2LMIA 2CQCA 2RDDA 4A46A 1H38A 3PW4A 2J6UA 1R0BG 2MZQA 2GZOA 4KT0C 4DV0F 2YNFB 1IBMJ 1MNEA 3GJTB 4X4NA 4PKDB 3AJ2A 2P5VA 3IWLA 1TTHB 4H54A 2QIFA 1PC5A 3VGSA 2XMTA 4DUZF 1KD1T 3QT5A 3PJWA 3MECA 2KN4A 4Y2CA 1FD2A 4QQBA 4CZCA 3V6KA 3TQ1A 1S1WB 3M8ZA 3ETMA 4OIXA 4P2XA 3CCUS 4A8SA 2Q6BA 2IC3A 1V5VA 2B43A 3BO4A 4DV7J 5GAGI 2OPSB 2BJEA 1N0UA 1WORA 1H74A 3A3NB 1RGVA 2BMBA 1Q8LA 2AYBA 2X1BA 2WVEA 5ETLA 4G3IA 1I51B 3OL6A 3BQ2A 3CD0A 2MZTA 3H5YA 4AT1B 1TL3A 3OFFA 4DL4A 1XMBA 3P5TL 2W7AA 4DV4J 1M5PC 5J2PA 1ZA2B 2AX0A 1RT4B 2GS8A 2BKPA 1VQ8S 1RTDB 2MTLA 4P7VA 4LFAJ 2FYXA 1IR2A 5KG6A 2OSQA 3MEEB 1RBAA 3OXGA 4MK9A 4ZCMA 3HXMA 3PX4A 1R8HA 3WQPA 3KG1A 4CNYA 4EWTA 5IV4A 2JOQA 4JI2J 1IBMF 1WJ9A 3PRDA 1R8AA 2EC0A 1SCJB 1RAFB 3CCLS 2BBEA 1S9EA 2HVDA 1N33F 1BQNB 2HBYB 3BPDA 3IM8A 3QLHB 1KTQA 4CTAB 1VC6A 2ROPA 1APSA 1BC6A 1S6QB 3I4HX 2RHQB 2OEKA 3L7UA 1CJTA 3NGTA 1F5BA 1Y0HA 3D0HE 2CWXA 1UFLA 1I6JA 5DLGA 1OSDA 1WF1A 4NEZA 3P6YC 2DB1A 1TKTB 3GYNA 2I9SA 4LQ3A 1Y7PA 4P73A 2BANA 1K73T 4ILRA 2VPXB 4DG1B 1SKWA 2GVZA 2LQJA 2QLWA 4WKYA 5F9NA 3IRXB 1L3UA 2KDOA 4JYAJ 2DNHA 1NK7A 3KLHB 1BQNA 1EJ7L 1YG0A 2FHKA 4CDIA 4JV5J 2E5JA 4E0DA 2VBYA 1FJGF 4NXMJ 3QIPB 4OX8A 1KQKA 4JI4F 4WYWA 2F63A 2CJXB 1C4AA 3C6UB 4ILMA 3N5BA 4NYOA 4DR1J 2KG0A 2W7OA 4KKOA 3R8YA 4B9TA 4W92B 4ZPVR 1HNZJ 4NYPA 4FYWB 1C0TA 2LQ9A 2DNQA 3TAPA 4BC7A 3CJ8A 4U7CA 2FHJD 3B4DA 2E29A 1RACB 4LFCJ 4CI0B 3NNHA 1T9XA 1XIQA 1NJZA 2VOOA 2VG6B 2J6TA 2BDPA 4F2RA 3R5AA 5HI7A 3T9ZA 4IO1A 1RAIB 4DSKA 3AH6A 2HS4A 1KFSA 3KHLA 5LMNF 3DKDA 2ZH6A 4RBUA 1FRMA 1UPPA 2AYEA 2EFGA 5CYQB 2E5IA 2CQPA 3PJ9A 1FNMA 3RBDA 1RA7A 2GJIA 4P72A 4KBIA 3EPGA 4WPAA 4XPEA 1PJ5A 2DPJA 1M0SA 2GNKA 4TU8A 2XI3A 1TP7A 2XY6A 3MMAA 1D8YA 3M05A 3WX8A 2OMOA 1UJ6A 4HI1A 1SXLA 2B7BB 2HWHA 3BGLA 3OR2A 3KLIB 4EU0A 3T5JA 1JJ2R 5AXNA 4K0KJ 1RT6B 3G82B 3FQKA 3MOZA 4QPTA 5A8RB 5EGYA 2E5LF 1X31C 3SBMA 1N32J 3JYTB 2YKNB 1VJWA 5CHCB 2HW3A 3JTOA 1U6ZA 2HHQA 2ZBIA 2OPRB 1KDNA 3MAHA 4U8YA 1ZETA 2FY1A 2G2OA 1XMOJ 2BACA 2QO3A 1VIOA 1Q7LB 1QM9A 3ZTOA 4NLXA 2R4FA 3W64A 3CGIA 3QJPA 3TA1A 4F4ZA 4ATNA 2KVIA 1GQEA 1FJ7A 3PRBA 4ED3A 2XY7A 3CCTA 1FWKA 3ITHA 4DL0C 2ZVIA 5GADU 3BSOA 1DZ5A 2IVFB 3BGUA 2FVRA 2UU9J 1JLEA 1T95A 2LCWA 4F4KA 3BKUA 3KK2A 3PY8A 5LSOA 4DQQA 1LXNA 1EIYB 3MPVA 1GX6A 3PM9A 2AWZA 4KRWA 2DHAA 2DGTA 4ICLB 1AT1B 1NKCA 4DX8H 4RWXA 2KHDA 2DNOA 1M5OC 3EDQB 3US5A 2RU3A 2KU7A 1HNVA 4RW6A 1ZOTA 1F6TA 4L76A 2W7PA 4C8YA 4YHHJ 4WIIA 4UW2A 4IRDA 5H9EK 1JNZB 3W5ZA 4WFYA 1HLWA 4OLOA 3MDFA 2XLJA 1YHQS 1FEEA 4C7QA 1T9UA 4LQ9A 4QWDA 1B4SA 4J9PA 1VQ9S 2OD4A 3ILJA 2FVCA 4G6VB 6FD1A 2R8GA 2YNIA 1N6QA 4FKXA 1X4CA 2V0NA 1SH3A 3MEDA 4YUDA 4UQGA 1T9YA 3MPDA 1WF0A 2PE8A 4G1IA 1G6BA 3BM7A 3CCWA 3NBPA 1ZS6A 4RX6A 2R8JA 2RRNA 4HT7A 1Y3KA 1VK8A 4WU3A 4DI6A 3T5LA 1NK6A 4B3OB 1RHJB 2OIHA 4A47A 2NZCA 4FZVA 2DRBA 1LNQA 4O3NA 4PYDA 4DN9A 1LK5A 1YKWA 2VKZG 2LECA 3V4IB 1U1OA 4WZMA 5HAOA 1J2VA 2FTRA 4CYUB 2R2RA 3GJQB 4O3PA 1D8ZA 1Q1KA 3KG0A 1EQMA 3QT8A 2FJAB 4Q0BB 1DQ9A 3QGGA 2B51A 2XG8A 6AT1B 3NS5A 4DU7A 1F60B 2GAGC 1QTMA 2WRMA 2YWHA 3FMBA 1WC3A 3AB2B 1M90T 2I6WA 3DRYA 4O44A 3ISNC 1CULA 3TEGA 2PI5A 1QAJA 2BA9A 4EZ6A 5HSPA 4ERDA 3SYZA 2OAUA 3MM9A 1HBOA 1YX2A 1DLOB 1M1GA 3CEDA 4LF1A 2CNKB 4DR2F 4O3RA 4MYUA 5F8JA 2C42A 1DTTB 1LWCA 1REVB 3WBZA 1L3SA 1IJFB 2OELA 4O23A 3TJ9A 4IQXA 3GLJA 3ONQA 2DNKA 1SUQB 2LKZA 3C19A 4NZ0A 2CPEA 4B08A 1HW9A 2DXEA 4MIWA 1TKDA 4X62J 1SC4B 2K2PA 1HNZF 4USVA 3W3SA 5IT9U 4FP9A 3UWTA 4OYIA 4ZDNA 2RNEA 2CVIA 4ECUA 1T94A 3SFGA 1TZ0A 2RUGA 3CSKA 1RHUB 1RWMB 3CCJS 4IRKA 4LBHA 1RADB 2WONB 1IKXB 1RT3B 1QD1A 2C2OB 2VD3A 3LP1A 5D4NA 5EX0A 4DPOA 2WBMA 3CTRA 4F67A 5M2RA 5KT2A 2KXHA 4XAKA 1JKHA 3O2IA 1P9QC 1RDRA 4QIFA 4TN2A 3EZ5A 3BQ0A 3MF5A 4DS4A 4URQU 1FWPA 1IKVB 2AMCB 2FZGB 1WACA 2ZUGA 4FBTA 1LFWA 4IG3A 4Y3CA 4DPWA 1VMBA 6FDRA 2GGPB 1XR7A 1UZHA 2A1BA 3S6EA 3ZZZA 1PGZA 2MKYA 1JLAA 1EKRA 2ZUAA 2HHPA 2J7UA 2MQMA 4JP8A 1TUGB 3DYAA 4M5GA 4BWMA 5A2QU 3EGWB 4Q44A 2IPOB 4ED0A 3D6MB 2AP6A 1J5EF 4KE5A 5B7WA 5H9EJ 1JKHB 3PV8A 3BEGB 4J9KA 4FVCA 4ECQA 1B7FA 1KN6A 4J37A 2RAQA 3GYXB 2FJEB 2H1YA 2KB2A 3C14B 4MKYA 2CPYA 2G0JA 2IRYA 3CJSA 3D1OA 4ANEA 4CO3A 3EYZA 1H0HB 3R5DA 2YBVA 1N4LA 4A8QA 1U26A 3FNNA 5ETRA 1FJGJ 3AB4B 1JXEA 5D78A 2Y8YA 4TU7A 2W1BA 2PO4A 5KFZA 4DUTA 2IRUA 1RWOB 3TR5A 3GSDA 3LP2B 3K57A 2OMLA 5C42B 4NLPA 3NRBA 4PWDB 5HATA 3IG1A 5IQ6A 1ZM3A 1Q81T 3C2PA 3UDLA 4C98A 2DR5A 3FDSA 4PEOA 1QSYA 1QAIA 4FXDA 2N4CA 3LGNA 1RAOA 3P8BB 2W2PP 1YGYA 5B0FA 2UP1A 1CULB 2W2QP 2ZFHA 1LWFB 1B0VA 4KB7A 5SUHA 1IKWA 2HKEA 2QYCA 5SZTA 2PA3A 1ZTTA 1RKJA 1KKHA 2XBPA 1H6KX 1WOPA 2J7WA 2AHOB 2UUCF 1RT2A 2DVIA 2L9DA 3K5OA 3W9IA 1TUVA 1Q86T 3T1AA 3DGPB 5IFMA 1SBRA 1HI8A 2Z8QA 3M8RA 3C16B 1RKIA 4RO0A 2QA4G 2Z57B 4PUOB 1RYRA 1VS3A 1WC0A 3Q8VA 5G0RA 4ZP7A 2FHMA 3HCXA 3K5PA 3VQSA 2BQ3A 2Z2MA 5HN0A 5BR8J 3AQOA 3K5MA 4JI8J 3DOKA 3G96A 1N5VA 3I9ZA 5GMKa 2LXUA 2LU1A 3KK1B 3NBPB 5FLXU 2KT5A 3TWZA 3HFKA 4P7TA 4QU6A 3G87A 4YR0A 1NK9A 2JEFA 3SXLA 4F4XA 4LIRA 2HNDB 3M1VA 3NCQA 5LM7E 5KAKA 2E1CA 4H4OB 2CJ9A 1KLMA 2J0XA 5KG2A 1YBUA 1OMSA 5KFHA 2DNZA 4HHHA 2D3UA 4EUVA 3W2VB 4PG5A 3D68A 4V1Ak 2C2ZB 3CB4A 4JOUA 3KJNB 3ZZYA 2VQEJ 3Q24A 3ETOA 2UUCJ 4OX9J 3H5UA 3ZZPA 2X3GA 3PIOQ 1FXLA 3QSYB 3OFHA 4UQTA 5B0GA 5DQIA 2HNYB 3TZXA 3KUHA 3GIIA 4ED7A 2MJUA 1SC3B 2C22A 1JX4A 2FJXA 2CQBA 3DLEA 1H73A 3FRYA 1X4BA 2OEJA 3KUGA 5L8RC 3K58A 5J1EB 2IVMA 3W60A 1B70B 2FY8A 4IG3B 3IS9A 1BXNA 4A8YA 3FZ2A 1XMOF 2F4VF 3TO8A 2DHSA 1UP1A 2XULA 4C8NA 3TAQA 3HPOA 3J7A1 2J7KA 5E3PA 2YVSA 2AYGA 3FCVA 1SL1A 1SQEA 1CBKA 4IH5A 4PYAA 3MCSA 4TKTA 3KK3B 4DFPA 1RTIB 1ZAXA 2KT3A 5I3UA 4ZPBA 2Q1LA 3ILLA 4W98A 2POKA 2ASDA 2QC3A 1Q4RA 4IG0A 4RJVA 4LR9A 3V81B 2EBGA 4F7VA 1ZZFA 2ZKTA 3T1HF 4KH1B 4O44B 3I55S 4OZ3A 4C8LA 4Z2XA 3KLGB 2OI2A 3UN3A 4X4UA 1WKJA 2BYCA 2V67A 4QZVB 2XS7A 4UOFA 1FX4A 5D0EA 4DL7A 4A8OA 1HNWF 1AZSB 1ZA1B 4HVZA 1QY7A 3RTVA 3N79A 4JI6J 2B9WA 2RF2A 2XMVA 1REVA 4DU8A 1OJ4A 2ZNZA 3D9BA 2GIQA 3HVAA 4C8ZA 3CJKA 1VYAA 2H3EB 2XZDB 3RRGA 1WELA 2B4UA 3MM9B 1C1BA 2AJ4A 4JB8B 3NGDA 2VICA 3OR1A 4V19X 1SC1B 1NBEB 2CQ4A 1MLAA 1XTZA 4N8OA 1N5SA 1FNXH 1CSJA 2ZWOA 3FC9A 4DUYJ 1PJ7A 2KYXA 3V2UC 5CD4H 2ZH8A 2IMWP 1TL4A 3PX6A 2C2KB 2R8KA 3EGZA 4ZVRB 2C3PA 1OYDA 3HJFA 1RT3A 1VBZA 3OV7A 4I2QA 1PIEA 3DNCA 1IBKF 1O0PA 4PXBA 1OY8A 3M8PB 1YJUA 4WBFA 3QQCD 4RZRA 2IA6A 2P6TA 4I68A 4K4VA 3P45B 3WX4A 3QBCA 4G1QA 2MKIA 3PYFA 2DR7A 2YNHA 2ATLA 4LRBA 3MM8B 3CD6S 1U2FA 3C8YA 3I87A 2YQ0A 4RUBA 4DQSA 4JI5J 3MEDB 3TVKA 2JJ4D 2B8QA 1I1GA 4DCJB 1DARA 1X7VA 2HURA 4NXNF 2AX1A 5KFRA 4CO4A 2YNGA 2O5DA 3DRXA 3JS9A 1BHNA 1KVJA 2OPRA 4OV6A 3IXQA 2VH7A 5K8PA 5M2UA 1RTZA 1B0TA 1G7CB 1V9OA 5HMWA 2ILZA 1WD6A 4FF3A 4A8XA 3I31A 2YKOA 2GV1A 1N36F 3G8TA 4V19J 2HHVA 4ECYA 1NK5A 2F8EX 3BBFA 1WDDA 1IM6A 1HQEB 4RW7B 3TUZC 1SL0A 2LDYA 1NLKL 4B02A 1GAOA 2U1AA 3GFYA 4HDGA 3TW0A 3CUNA 2AGQA 4TQRA 1XC9A 4OYMA 4WKRA 2WCXA 2XWXA 1YBAA 1CJKA 4K7QA 1KR4A 3KK2B 1JJCB 2WB1D 3C15A 3GB0A 4PWDA 1RTIA 5I3UB 4K4YA 1HWKA 1F3VA 2FJDB 1YDLA 2ZH9A 1TK5A 3DN9A 3FZBA 2PA8D 2QA4S 4CLYA 3PR4A 3GV8B 2Q43A 2R7QA 3CJRA 1VQMS 4KPYA 4RW9B 2ROGA 2OLWA 1S1UB 4Y6IA 4CRJA 5HROB 1R8CA 4IRCA 2CVEA 3BYPA 5K8OA 4GO7X 7FD1A 2DIUA 3PVXA 1Q7YT 1FEHA 2ZWPA 3S8SA 5KFNA 2H4WB 4Z7YA 3GIMA 2YNHB 3K5NA 2MZJA 1QUVA 2MEWA 3BBBA 4K59A 3R97A 4HI2A 2P9EA 4ZLJA 2BXJA 3X1LB 2NR0A 2YKPA 4ZVOB 3NS6A 4DJBA 3HHLC 5HMXA 1C2PA 2ZDPA 5JMNA 2GCFA 3DOLB 2UV8G 1YJ9S 4LRAA 1RB0A 1NM2A 3UE2A 5KT5A 3JTNA 4DV4F 5KFDA 2VBWA 3PO4A 1NSAA 3T41A 4AYBD 1D9DA 4KQZA 4FYDA 1GK8A 1WKLA 4Y28C 2ZJQQ 1E6VB 1AUSL 2FZKB 1S1XA 2VU5A 4RR5A 4Y2AA 2ZJRQ 1RK8A 2RE1A 4CLLA 1NK0A 4C8KA 1T9WA 3GU0A 2XHWA 3TJ8A 3ZO7A 2ILYA 1R0AB 1CJKB 2QMWA 1VOMA 3M32B 3OPKA 3AOAA 4FKYA 1S4EA 2JVOA 3VTIA 3CO9A 3UDCA 5FIIA 3GJRB 1Q8IA 1NO8A 3MTJA 3Q8PB 3RU0A 5HVHA 4JI8F 3I56S 1SUQA 3QJLA 3M8WA 1Q8BA 2GJ2A 3IR7B 1S4FA 1IKWB 1H72C 1DTQA 3ULHA 3A8EA 5JJBA 5K8MA 5AJ3F 3MMCB 1ZBTA 2JFKA 4LSZB 3OXLA 5HJXA 5J2MB 4QU7A 1FCAA 2UV8A 3MM6A 4PXDA 5GVQA 3QNWB 4YS2A 3CJKB 4OYBA 3I32A 5HMZA 4BS2A 3CCSS 4JI3F 4Q8FA 1WC4A 3D66A 2J9CA 3C6TB 4QW8A 1TKXB 2GC8A 3HX9A 1BLUA 2D9OA 4Q43A 4NLRA 1VBYA 1HQEA 5KFAA 1KNZA 2PFFB 2VQEF 4X4RA 2RQMA 3FBCA 3E3XA 5GMDA 4EYHB 4ED5A 2QRRA 2BW2A 2EPIA 3NNAA 1NZAA 4HH1A 3CC4S 4O3OA 3KJVB 3I0RB 4JBCA 4O3SA 2DGSA 3OR2B 1BQMB 1EX8A 1RAHB 1X5OA 4ECZA 1CJTB 4F3MA 2VB6A 2QJ3A 3K5LA 3TUPA 4LF5F 3CJ0A 3RG6A 1VBXA 1NPPA 3MECB 5CAAA 1V5IB 2D41A 2DCUB 2MHEA 2FJWA 2R2TA 1WTFA 2MLYA 3UPFA 2OP5A 4CM2A 1N8RT 4PG8A 1KWMA 2AF6A 4YN3B 1V3SA 4MK7A 2B4OA 1TKZA 3SEOA 5KFIA 5KFKA 3D6HB 2R2SA 2EBEA 3OR1B 1L3VA 4LR8A 2CPIA 1C1BB 2WSFC 3GR0A 2ZKUA 4DR5J 3GONA 4JUZA 4RNOA 1RWKB 2YTCA 4FF2A 1XNQJ 3RBZA 4F02A 2EKNA 1T0TV 1HQUA 2WSCC 4QJVA 4TLQA 4ZVFA 3V6HA 2XNQA 3CF5Q 1HWUA 2ASYA 2F40A 4LMZA 3M2UA 1XNRJ 3POTB 8ATCB 3RR7A 4ES1A 2HMIA 3B78A 2QLJB 2EKYA 2WW8A 2A2CA 1R0AA 1FKPA 1OQ6A 2WOMB 2Z2LA 3ZZ0A 3ENVA 4PRFA 1KP6A 2NSBA 4YP3A 3PHEA 1EARA 3AJ1A 3S01A 5MLCV 4USIA 4L3NA 2DITA 2QE5A 3M8SA 3ISND 4R8UA 1S59A 3CCZA 4NMXA 5H9FJ 3C66A 4AE5A 2NYHA 2LVWA 1M5VC 1WI8A 2DIVA 2DISA 2RU9A 1FFSB 1S99A 4MFBA 1TL7B 1R31A 3NEKA 2MXYA 2M8HA 5EX3A 3FRZA 3J7YU 3LF0A 4FN5A 1GT8A 2BE7D 2COLA 4QIVA 4TLRA 4FBUA 4AFFA 2HAIA 4ITSA 2BKNA 1R8PA 2GO8A 1Y00A 3JSRA 5DQHA 3LQVA 4RUAA 4RU9A 2O1PA 2W4CA 3Q8UA 4ED4A 3ADAC 1U0HA 3R7NB 4GKKF 1D9AA 1HD1A 4PAAA 4KFBA 2V9KA 4WK3A 2Z0GA 3PW7A 3DRPB 5LSLA 2VZ9A 2C3UA 4NLGA 4NRTA 5T14A 3ENAA 3OTBA 1VFJA 5EUHA 1VQKS 2DGWA 1FA0A 1TL1B 3MHYA 4H4OA 4KV8B 1NCLA 1NU4A 4BWJA 1RJJA 3TZWA 3QZ7A 2ZZMA 4KO0B 1XQIA 3PKYA 4WK1A 3G71S 2BOPA 4U67Q 3IO1A 4NXMF 1S5ZA 3F44A 2R7RA 1FXDA 1U09A 2FB0A 4OZ5A 4ZPTR 4IOAQ 4DR1F 4DPTA 1Q16B 5AXLA 3BF4A 3QATA 2HGNA 3IC1A 5D0GA 2MZRA 1D0EA 3DLEB 4OYXA 2HRUA 1EETB 1JMTA 3JQMA 3VCDA 2Q3PA 4Q7AA 1JLCB 2UUWA 3NGUA 1OWXA 2DH8A 4LUBA 2A2DA 2AT1B 4MIAA 3L09A 4ZCKA 1HNVB 2UVVA 3GQCA 4ZVPB 4B3SJ 3GE9A 3LP1B 3G6ES 1N5YB 4X64F 4WE1B 4IOCQ 1LKZA 4ELTA 1KVIA 3DI6B 3UW1A 2PEBA 1S9FA 4IKAA 1R6VA 1XR5A 3TOQA 3RAXA 1R8BA 1AYEA 3HHKA 2MKJA 4NI2B 2DNYA 3HSJA 2UVUA 1P1LA 1YBTA 3EVOA 4N76A 5KG1A 3R3TA 1Y3JA 3TYTA 5AE2A 4J9LA 2KM8B 2JLFA 4EGLA 4IR1A 2VQFF 1NAQA 3NGKA 3PTWA 2QTWA 3D0GE 1SL2A 1X0PA 1NPRA 5ETPA 2XLIA 1DTTA 3MCMA 4ECSA 4NLOA 3TP2A 3QJJA 5MAOA 1MU2B 1SJ1A 3BGRA 3VGUA 3KLFB 2OFHX 4DV1J 2JFDA 4CIOA 4RBTA 2N7CA 4ZVSB 4F4YA 1SQFA 2BJ9A 2R7VA 3NS7B 1U02A 3DGVA 3DFEA 2XZWA 3FGVA 4QYZK 2M52A 2OO4A 4OJ1A 1RP5A 3MFHA 4TYBA 4HYKA 3MM5B 2HAFA 2WHOA 1B7YB 3CJTA 2DRAA 2QZ8A 3IM9A 4O4GB 3MR2A 4TY9A 5JVGQ 3D6TB 4C0HA 1SJRA 3KJFB 2KI2A 3R6GB 4KSEB 1ELOA 1XNQF 4UTGA 2K7KA 1OSCA 1IKVA 4K4UA 5B0BA 5IC4B 1FTRA 4EO8A 2VBXA 2M0GB 1PILA 4WYLA 5KFCA 2Z2ZA 4B3TJ 1AFJA 1S6UA 2ZNYA 4I2PB 4DCPB 3IR6B 3O6QA 1TUWA 4OHWA 3QT7A 3M30B 1SKUB 1D09B 4LT6A 1S6PB 1WC1A 1PSDA 1VQNS 3E01A 2UUBF 3ELHA 1QUPA 1RU2A 1QVGR 2LXFA 1KOOA 3QGPA 4YDDB 1CJUB 2HMIB 5DGAA 3H2VE 1DQAA 1VRTA 1HW8A 2DYAA 5FD1A 7AT1B 5E41A 1SJ3P 4F8RA 1XBWA 2MQNA 2RDJA 1PYOB 5KFLA 4JV1A 4NWBA 4OJGA 2GGPA 5KG3A 4ZIVA 3G6YA 3I9V9 3IR5B 1OS5A 3NWGA 3PG9A 4O3QA 4JV0A 5KFQA 1U1QA 3RW6A 4U96A 3U02A 4X66F 2MDAA 2NSCA 1WOSA 2GVZB 2EFOA 3I5CA 2U2FA 4PQUA 2QL7B 4LRCA 3MGJA 3R2DJ 4QYZJ 4XPCA 1JLGB 1TMMA 2EFQA 2EFNA 3T19A 3J7Z5 2BE9B 5E0OA 2A3JA 4Y34A 3ENQA 3RB0A 3GSIA 2CQ0A 2BKOA 2V8GA 4QBUA 5CABA 3H5XA 3UVJB 1NHKL 1IBCB 2IY5B 3H8YA 3IP0A 2XLKA 1F9EB 1FDNA 1LV5A 4RKUC 5LSRA 1NDCA 3LPEA 3W9JA 4UY85 2D1CA 4ID8A 1WKKA 4WIQA 3J80Y 2E9ZA 4USKA 1X5TA 3PIPQ 2HVHA 3U1NA 2WTFA 2Y8WA 3TZYA 1S1VA 4X4SA 3AY0A 1JIHA 1KEKA 2Z30B 3DOMA 5D3GA 3JAMY 1PYTA 2ZBQA 2UZAA 1RAEB 5ETMA 1NJYA 1SQGA 2SXLA 4NLWA 1WG5A 4R5PA 1WHWA 4K2JA 4ZP6A 1R3NA 2BE2B 4NRUA 3O1LA 3TAMB 1WUUA 2ZOGA 4PPZA 3TANA 2BJ3A 4OZJA 3RB4A 1UWAA 1RISA 1VCTA 2HSEB 4DUYF 4Q2LA 3UCZP 4OX7A 1TVRA 4A48A 1N54B 3M8YA 4YFUA 4HKQA 1A9NB 5F8NA 2HFOA 4OI3A 3POTA 5B08A 2UVWA 5KFXA 4RUHA 2VA3A 1RE1B 2V5HG 3K89A 5DZ7A 3MMAB 3S1TA 1OPZA 2NYIA 2H54B 1Q5VA 1NNDA 3CJ4A 3HULA 1CQMA 3OT9A 1NHVA 3ZZOA 2VONA 3MXHP 2GIFA 3F56A 3HFZB 4I1TA 1QTNB 4USJC 3L4BC 3SDEA 3OTCA 1CC8A 5C25B 4EBEA 1GEHA 1X4GA 3NNCA 2RSQA 5FLXY 4QPXA 2MGZA 3IRWP 1U1PA 3AODA 4OJHA 4J9RA 4ZCIA 1ZYQA 3AD7C 3CW2C 1HA1A 4L74A 1TV6B 2YPZA 3DRRB 4HTIA 3W2WB 5L46A 5HL7Q 3OUYA 3T5HA 1SH0A 2Y1JA 1D9FA 1H98A 2MSSA 4EFAC 3Q8SB 1FDDA 3RZAA 1BE4A 2EVZA 2HK2A 2R42A 2V4QA 4DV7F 4WTYA 4AL6A 5J1PA 4OLPA 2L08A 1AROP 1UWBB 4TVAB 4Y2KA 1TL7A 1KFDA 1U45A 4QCLA 3SCIE 1M1KT 1N36J 2F1FA 4ES2A 3BZQA 2LDIA 2Z4PA 4KIAA 1S7HA 3UI3A 2OPPA 4EMDA 1K44A 2C2NA 2EG1A 2MKKA 1FK9A 4F04B 2V50A 2XMUA 2LXIA 4ETZA 2YKAA 3D6FB 4UOHA 3TQEA 1RXOB 1VQYA 4CLWA 8AT1B 3BJYA 4CLUA 2P9GA 2YX1A 3TEHB 1CLFA 1WSRA 3EX7B 2IJFA 3VAHA 2JEIA 5IXUA 1UZDA 3TARA 2DGVA 1FI4A 5AXKA 3DLLQ 4K4ZA 2IYIA 1RT6A 5ETTA 2XS2A 2EG2A 2W9BA 1Z1ZA 3AXMA 4MTPA 1UWBA 1ZTWA 4ZPAA 4DZDA 2OEMA 1EP4A 5HK4A 4X64J 1FKAF 3ZTPA 1S10A 4MKBA 1MWQA 5JXSA 3OSPA 2CQ3A 4B3MJ 1H2VZ 1EETA 1HWJA 3D0IE 3K8VA 4KGMA 1SV5B 4UOCA 4DWIA 4J9QA 4DR7J 2KM8C 2BM0A 1RT1A 3HI9A 2KJWA 3JQJA 3M32A 4KGVB 3GIJA 2VFUA 5C2GA 3BGFA 5DO2A 3GV5B 4K4XA 2V8PA 4X4TA 3BB5A 1UW9A 1OY6A 2OPQA 2WVCA 5H1SV 1AW0A 1CEZA 1QJHA 2J8SA 1N5YA 3DXSX 2BQUA 3H40A 1XMQJ 3QIPA 3BR8A 5LT5A 3MM7A 2OFGX 1X4FA 2R8IA 3FCHA 4DL3A 1CJVB 3NCRA 4KHPF 2MJNA 5T41A 1YZ6A 4QWBA 1YSJA 1FTCA 4K5SA 3KOAA 1GXLA 3QYYA 3OJSA 3VQTA 2HQDA 4EBDA 2VF3A 3R7SB 2CPHA 2G2YA 2Y1RI 4NEYA 4QW9A 2P9CA 4X65J 4P2MA 4OHYA 4OX9F 2BZ2A 4J5OA 1KQFB 2ZH3A 2FLLA 2A0FB 1N56A 2OPSA 3CDEA 3LPYA 1YZ7A 2DY9A 4YHHF 1PC4A 3OTDA 2RQ4A 2X51A 4Y0FA 1J5EJ 2FHJA 1MW7A 3D54A 5AT1B 1VQLS 4FXVA 1WI6A 3UO0A 2HEKA 5IT9Y 1LXJA 2AKWB 3AQPA 4U8VA 2ZE2A 4RUCA 2XMMA 1RBOB 3IBCB 3RB6A 4X2BA 1SB6A 3PDNA 3CPWR 4LRFA 3A13A 4OZ2A 1D1UA 1Y10A 3GG1A 2Z58B 3D1HA 2EC2A 2HRYA 5EWGA 2RQCA 2HIYA 3QSIA 1I3OB 1IM4A 5J2PB 2ROEA 4O4RA 5D8HB 1DY3A 2RF2B 2MY7A 3IBWA 2IFXA 4IH7A 2H48B 4LF2A 2FQQB 3RAMA 5KG7A 4LF5J 2CQ1A 2GJFA 2MHNA 2PSZA 3P4UB 4C0OC 4Z37A 4NA3A 3W62A 1WF2A 1R89A 4ENOA 2QX0A 1ICEB 2XEXA 3ZTQA 3TX0A 2KRRA 2V4RA 4AL5A 2MSTA 3FKBA 4KPCA 1T9VA 3D3CJ 1KSPA 2JH3A 4FF4A 2HBQB 4F4AA 1WC5A 2C3YA 3DHWC 4M5NA 1AFIA 1S1WA 2AJFE 2F5GA 4IYQA 3JSYA 1UFKA 4FDFA 4M5LA 5HBMA 3NOCA 1HI1A 4J90A 2XMAA 3M8QA 5GAGU 2X1AA 3Q8QB 5DM6Q 2KZZA 2HFZA 4RWWA 2CJAA 2RS2A 3N6MA 2BVZA 1MROB 7FDRA 2MGZB 2QSFA 4USHA 1QE1B 3V6DB 1J27A 2HQGA 3F41A 2C3OA 1VRTB 1CVJA 3EZOA 2N3OA 4HHUA 4USUA 1HWIA 5GAHU 3CMES 2D7SA 1E6YA 1CJUA 3CULA 5LJ5Y 1NHUA 1U25A 3ICLA 2WSEC 2IHR1 3IWXA 4MJKA 1FRLA 2E5GA 4R5PB 1BQMA 1TK0A 1T7PA 1RBLA 1S6PA 2HLUA 4N77A 2W2NP 4YY3J 1U2RA 4ZPDA 3MPUB 5IV3A 5GMEA 4I69A 1X8DA 4YEAA 2D3OR 5CH7B 1VQ4S 1V3ZA 3BREA 5I3PA 2D3O1 2ZOMA 2K1RB 4LVOP 4NCGB 4WFAQ 2GFFA 2JWNA 3CCQS 2JL9A 5LMUJ 2PMHA 1X0FA 3PKMA 4F50A 3BYRA 1RI7A 2DD8S 4NLVA 1Q78A 2CADA 3PRVA 3PEHA 1HWLA 2XSJA 4OYAA 5THWA 4QIEA 2UUTA 3A8IA 2B6AB 4ZN1A 2KG1A 1PO6A 3R2CJ 2AGOA 4PZVA 2OPPB 2OUGA 2CUYA 2RJZA 2CNNB 4ILLA 1PYSB 4F0MA 1HYSA 4MKVA 1JB0C 4KY3A 3BO3A 3CCRS 1KBRA 4ZP9A 2Y0BB 4RW4B 2W9BB 2HQFA 3QFHA 5AJ3J 2FGCA 4RNMA 3TNVA 2FC9A 3A8KA 5K20B 4LBPA 2XGPA 1IBLF 2HWTA 2DGUA 3BH7B 1NH7A 3TUJC 3HMJG 3DM2B 4WU2A 3KHHA 4FPRA 3W2WA 3OUYB 4X4QA 1TAQA 1YI2S 1NDLA 3K17A 3HHLD 5FDLB 3IGVA 1IXKA 3RYLA 2IJNA 5IT0A 1S0MA 1U6FA 3DOMB 1FK9B 1C0UA 3MWBA 1FDBA 2F9DA 1FVSA 3EXYA 4H4MA 4RW8B 5B0CA 2HFUA 3HT0A 5F8MA 3G6XA 3HK2A 2RQKA 4OX6A 3FBEA 5HQMA 2QL9B 2BJ7A 1PJ6A 1VQ7S 3OW2R 4ZN3A 1ACMB 4YB1P 3D67A 3GV7B 2JLGA 2JVRA 1PKUA 2G0IA 5A8KA 3SZ2A 1X5SA 4XK8C 2ERRA 2BJ1A 2EK6A 2MQQA 2HNYA 4K2XA 2CWKA 2CG4A 3MMBA 3PYGA 3W1YC 3IMQJ 1RT5B 1LFPA 2RRBA 5M2PA 2RHSB 2UXDJ 2ADCA 2YWGA 4ED1A 4GVLA 3GCWP 2ATCB 4NX9A 2GQ2A 2MKSA 3WIUA 4U7UD 1O51A 1UL3A 1WG4A 2E1MC 3DLKB 5E2QA 4GKJJ 2XYGB 5BXIA 4F0HA 1H2TZ 3MEGB 2NS1B 2DKOB 1OY9A 2BRLA 3S7RA 3GWCA 3OHBA 3VR1A 5D3GB 1FRKA 3B6BA 4KGZB 5D0RA 2PT0A 1UEKA 3OQ2A 1XNRF 3AOBA 3KFWX 3QFWA 3KK1A 3DLBA 4KC5A 2KH9A 1CS4A 1G3OA 2VV5A 2IRXA 3MR7A 2UU9F 2B9YA 2CZ9A 2E7VA 5EHHA 3JSMB 1YRUA 3CD5A 4F26A 1OPIA 1U48A 3DDKA 2W2OP 4RNHA 4DX7A 1WSVA 3DLKA 1BWVA 2XMKA 2AEJA 4EK2A 3RW7A 2OTJS 3PNIA 2W4PA 3KDOA 2YWFA 4I7FA 3CCMS 4ED6A 2C2EA 1TK8A 4RW9A 3BPSP 4H4KA 4LR7A 5CYMA 1FJCA 2CPFA 1S1VB 2X1GA 3NG8A 4FYXB 4N7TA 3LWLA 4ED8A 1C1CB 3D1QA 3P5BP 5IT4A 5ITHA 2DJWA 1EZZB 4DV0J 1U49A 5F8HA 4W4MA 4HTJA 5BJRA 1S0VA 4F4WA 1X4EA 1DJ0A 2MQ8A 2DT9A 2YNGB 3VALA 2FLPA 2V6AA 3IAS9 3TVZA 5J1EA 1S6OA 4DX5A 2PN6A 2R7UA 1XERA 1GMWD 5AXMA 2L9WA 3DLGB 4PG4A 1UVKA 3DRSA 2VPYB 5E3RA 4DV6F 2V8DA 1EKSA 1S12A 2H65B 2M7SA 2PGCA 4KYZA 2YKMB 4LSNA 1RSCA 2V69A 4KAIA 2Z56B 2K3KA 3Q8YA 1WHXA 4USTA 3TX8A 3UCUP 2UXCJ 2XC9A 2YQ1A 1Z2ZA 3CIMA 3UVJA 3CJ5A 2ZD1A 2LQ8A 2OGUA 3R5JB 4LJMA 4QIGA 3G8SA 2HZAA 2Q79A 4DR3F 1O5JA 4OQJA 1YRXA 3W5YA 4ZP8A 4TNOA 4AQYJ 2PMZD 5J2NA 3AHPA 1VQOS 3PFEA 1K9MT 3QAEA 1OYEA 1VDHA 4J91A 4ZVHA 4YMEA 1RHKB 4TU9A 2R7WA 4M94A 1XWLA 2FIUA 1OQ3A 2OD6A 3SIPB 3V6JA 4LF7F 3BN7A 3HSZA 3DOKB 5LMUF 2QMXA 4NCBA 4NYZA 4IFVB 1VRQC 5CZVA 1U4BA 3HT3A 5A6PA 4CH7A 1PBAA 4B3RJ 1HBMB 3LANA 3MPWA 3PHTA 4M5IA 3VAJA 4PUOA 3KXDA 2R7OA 2RKIB 2NXNA 4KH0B 1NRKA 1YJVA 4FPIA 2Q6CA 4J7CA 4DV6J 3HHEA 5J2QA 4A4JA 3M30A 4F36A 2A6OA 3SQGA 4ZMMA 2UVRA 3H25A 2VJUA 1QDUB 4B3SF 3BN4A 2UXCF 1A7GE 3DLJA 5ETQA 2DHGA 4NZ6A 2LQBA 3RBEA 1IBKJ 4XDDA 3HHNB 3FBFA 4E8UA 5KT3A 1LW2B 1UVIA 1XJWB 1WWHA 4NPOA 2YKMA 3I0RA 4LSNB 3VF0B 2VFSA 3PXGa 4OZNA 5KT6A 2CJKA 3UQSA 2FJBB 3NP5A 4IDKB 3MM5A 2G9OA 3UDEA 1PAUB 4BC9A 5ETKA 2ZH4A 2HNZB 1X5PA 2AZ1A 3CJ2A 3UD3P 1U1KA 2B4PA 3PEJA 5HJYA 2F4VJ 4E2FB 4XIUA 4ANCA 1C1CA 4IG0B 5HMYA 5HQLA 1RWUA 1BQXA 3KLEA 1FE4A 1JLGA 3OL9A 1K8AT 3J81Y 1HIYA 2EEYA 4I7FB 5E33A 2ZM6J 1SJ4P 4I6WA 2CNLB 1ZPWX 1ZPVA 2QV6A 5FDLA 2N4DA 2ZH1A 1HNXJ 2JEJA 4I67A 1K0VA 4M1KA 2APOA 1FWLA 4U95A 2WBRA 1VQSA 3JYTA 4LFCF 3CO0P 2E9RX 1VQPS 2QN6B 2YXLA 1RWVB 4WF9Q 4C8MA 2XSFA 2NLWA 2K3IA 5KT7A 2HS0A 4B3OA 2NXUA 2CQGA 3G2XA 3H20A 4HDHA 3L95X 4HR2A 4U9RA 4JI6F 4HHJA 5FJ4A 1IN0A 2YKQA 3T5KA 1UAWA 2ZC4A 5L9NA 4NCAA 1N32F 3MURP 3WZ0A 4M95A 1ROFA 3CMQA 1FHTA 3C16A 4OI6A 4X66J 3DI6A 3MUVP 1GXUA 2RUSA 2F7VA 2ALYB 3N01A 2JC1A 3G4SS 5A76A 2VG7B 5I42A 1KLMB 4GO5X 1R7IA 2HGLA 1UMJA 1RU1A 3PW0A 2X3DA 2B5JB 2GVDA 3QPIA 1LEOA 2OHDA 4L72B 1VISA 3MMBB 2OH2A 1RT1B 1VHIA 2WK4A 4TYAA 4O0NA 3BQ1A 2IDLA 4FNHA 4DV2J 1F5AA 1TKXA 1UCNA 3B8HA 2CPXA 3VVUA 1IBLJ 2V9WA 1C0TB 3V5RA 2ACMA 1IR0A 1BD6A 2YQ3A 1P1TA 3HHLA 3BR9A 3KJVA 3MR5A 2V2VA 4CO5A 2K06A 5KOXA 5D4OA 3M2RA 4USMA 1T3OA 1PBUA 2ZC3A 4DPUA 4ZLPA 1NJXA 1HBNB 4L73A 4C48A 2CPJA 3OVBA 2LP4A 1S57A 5D4LA 1FRIA 3KHRA 1WTBA 3IN5A 2PMWA 3Q22A 2ZDOA 3CWJA 3UDVA 2BOAA 4C3MA 5HBMB 2CQ2A 4MH8A 2IM0A 5A6WA 2I1RA 1WEZA 2DNNA 3NCPA 1FKOA 2KO1A 3O5TB 5KG0A 5DDQC 4DR3J 1NDKA 2ZITA 4M5JA 4QYRA 3T1YJ 2NZ4A 5KFVA 2H5EA 3ZNUA 2HWIA 2GX8A 2G13A 2RS8A 2VPWB 2ZBPA 4M8LA 4DFKA 2FDNA 3R27A 3Q89A 5LMNJ 1SKRA 2ALZA 3NWRA 2GIRA 3DMJB 1UEUA 2BUNA 5L1LA 2B6AA 2B0GA 2KZMA 1KTVA 2PD1A 1REGX 2WB4A 2D69A 3OJUA 2YNIB 4QR2A 1N6QB 4B9UA 1S9EB 4NZ7A 1HARA 3OBIA 1TL5A 2AYMA 5DETA 3R6LB 2KFZA 3GJSB 1GXTA 1RCXB 3UNGC 2V2KA 2J9DA 2IM1A 4I4BA 3LWMA 3QIDA 2W9CB 1RWNB 3MAAB 2L41A 3MM8A 4N47A 5C25A 3VVTA 2GQCA 4RNFA 1O6XA 4KHMA 4K0KF 4WFNQ 3HKZD 2DNRA 1LW0A 3B54A 1IUJA 2VC0A 4LFBF 2HS3A 2V94A 3KYLA 1JK9B 3ZNJ1 1TL3B 1BY9A 3TA2A 4DSJA 1K1SA 4IH6A 4ECRA 2DBBA 5ETSA 1A6LA 4ZLLA 1HHQA 5DG8A 2VHGA 4I2QB 3BS9A 2EW9A 4KHRA 2EFVA 5BYSA 4FYYB 9ATCB 1TVRB 3CCVS 3CE8A 4R25A 4HT5A 4WXWA 1K1QA 2YH1A 2XM3A 1DRZA 3IGNA 4AL7A 2J8AA 3C6UA 4UOGA 3MAAA 2V2QA 1TELA 3C6TA 4NLTA 4MIBA 3UNYA 3I6PA 4H4MB 4DSEA 1FO1A 1JJ4A 2MYFA 3DDNA 3OL8A 4DR5F 3DDIA 5A8WB 3KKFA 3R5GA 1HBUA 4ZVUB 2YNFA 3M7VA 5HO4A 4C6AA 4YB7A 3RBXA 3VAMA 1NK4A 1ZAVA 4AQYF 1PG5B 5KFGA 2QFJA 2HVIA 1RTJA 3HVWA 1U1LA 3DMJA 1UVLA 1IJEB 1AZSA 1YITS 2M2BA 2KHCA 3THTA 2M4MA 1TKTA 2MMYA 1U0HB 3EMTA 3VGVA 4Q45A 5IM0B 3FJ2A 4OHZA 5KFJA 5CZXA 4TY8B 2R9LA 4U7UK 2J5AA 3OVAA 1LWEB 1FXRA 1YJ7A 5KFFA 4LF9F 1UJ4A 2PC6A 3MD3A 4UZCA 2EXUA 3MR3A 3UD4P 3V4IA 4DQIA 3NLCA 2V2ZA 4JV5F 4L75A 3RGIA 4DR7F 1T11A 2E1PA 4DEZA 3EGVA 4DZ6A 3OLBA 3D7SB 2CJYB 3NGSA 2IYGA 3OD2A 5L1IA 3PX0A 4ZA1A 1DTQB 1VGYA 4PWWA 2O3DA 3AXKA 5F0UA 3FEYB 5A0YA 4DN0A 3CXCR 5JVHQ 3RAQA 3DLHA 4A8FA 4S0MA 4FXWA 1RA6A 4CT9A 3MAQA 2YY3A 4C11A 4DV3F 2G4BA 1TAUA 4XTTA 4LBIA 3PFOA 2KFYA 2J9DE 2CJQA 1TMJA 1FKPB 1Z4UA 2WOMA 3DOLA 4RLEA 4WFZA 1N48A 4GKKJ 1V6HA 3VAFA 2W4DA 1JLBA 2HK3A 2N7YA 2DK2A 5KG5A 2BX6A 2YWWA 1VRUA 4CM0A 2VFRA 3M8PA 2PIIA 4NMLA 4F2SA 3LAMA 3PJXA 4ICLA 4WXOA 1HQUB 4ZHRA 4LF9J 2FPHX 1E6VA 2VG7A 2W9CA 5KFWA 2AGPA 1MN7A 4LRDA 3N6LA 2UUAF 2IDEA 4ELUA 3L9ZA 4IQMA 4LFAF 2W2MP 2GO9A 4DR2J 3HSDA 5CXTA 3DU6A 4ZCLA 3U27A 2LQ5A 1TKZB 2C2RA 1VHFA 2RILA 3IAM9 4HACA 1FX2A 1TR0A 1HR0J 1JWWA 2VG5A 3QAUA 3QT6A 2JSXA 4NE9C 5ETVA 3PYDA 1S1TA 5HANA 5T7LB 4K4WA 1RWXB 4ZS6A 1S0NA 4YQWA 2D74B 1ZZNA 3SMZA 5GAEU 2F9JA 3AA8A 1FKOB 3WIVA 2J76E 2Z2YB 4OV1A 3AFGA 4GVBA 2DNPA 3K7RA 3R5BA 1YLXA 2CG8A 2E66A 3FFIA 2KXNB 1GMWA 4FS1A 2F8HA 2C2MB 3WDOA 1VIXA 2R3VA 4CLFA 3DU5A 4ZPWR 4TXSA 4ZIWA 4JI7F 5A2QY 4C4WA 2OJ3A 1ITPA 1UA0A 2JNJA 4PCQA 2YPYA 5CQGA 4DL5A 3GMGA 1ZM9A 2XI2A 2UUAJ 1FFGB 2CXEA 4JYAF 5ETOA 1WNEA 3AOCA 4YDXA 2B56A 2NPFA 4A8WA 4JI1F 1Y4ZB 1SH2A 4ID5B 3SCJE 2RIJA 5BYQA 3X3UA 4XO0A 2FVPA 2UXBF 1B64A 3VV2B 1S48A 1U47A 2MZSA 3FBBA 1BWEA 3O3LA 1QVFR 3PYEA 2NCKL 2XMWA 2MZ1A 4Q8EA 4DR4J 4ZVEA 2DXFA 2MY8A 2H5JB 2HVEA 3HZEA 3BO2A 2I2YA 3GCXP 2ZVSA 4C3KA 3HM9A 2J0WA 4PG7A 1RHQB 4NA2A 3A4TA 3AJDA 4B9LA 3ZTRA 3D28A 5EN1A 1SVDA 1XK8A 3GZ7A 1H7XA 2VDHA 4RW7A 4Q5VA 4ES3A 3SCKE 1H7WA 1URRA 1OIAA 2XY5A 2L3MA 2RB7A 1RAJA 4N8NA 3T9NA 1KHVA 2B5JA 3BSCA 2G1HA 4I64A 3W65A 5C2CA 2H51B 3P3DA 4P75A 2KRBA 1SI9A 4WFBQ 2ZHBA 5J2QB 5CYQA 2E9TA 5GAHI 2J0SD 1SJFA 2WVFA 3M2VA 3QMQA 2HFSA 3B4MA 3LH2S 1Q82T 2DPIA 1NH8A 2AIRB 1FVQA 2LA4A 1H3DA 4P74A 2FLNA 4K8RA 3I4PA 1WG1A 3KG4A 2M70A 4DG1A 4WE1A 3QRPA 5KT4A 1F3FA 1ULRA 2FD2A 3LGHA 4OYOA 4LF8F 3VAKA 4DFJA 2AZ3A 3G86A 2XCAA 4B3MF 1D3WA 1JLBB 5ETNA 1UVMA 3QRRA 5KFBA 1VI7A 2BE2A 2H5IB 5J2NB 2UUBJ 3FEZA 2LA6A 5L38A 2AJ0A 2LFVA 4BHQA 3I96A 2GHPA 2XYHB 2HNZA 4P71A 3JXOA 3VGTA 5C7PA 2W25A 1EQ0A 3CNQP 3HZGA 3KLHA 2PFDA 3BSAA 1Q95G 4ZPCA 3IG1B 5EWEA 1LWFA 4OYZA 3A8JA 1P6TA 3A1YG 4F25A 4QWAA 2BANB 3Q0AA 1AB8A 3CJ3A 3I0SB 3IS9B 2HFVA 2QLFB 4NLUA 4X62F 5U47A 1RTDA 4UF4A 3AA9A 3NAIA 3FQLA 4KJIA 4MFBB 3BGOP 2HHTA 4Y65A 3H2UB 1B0PA 3CJQA 3LP2A 4TY8A 4BCAA 2LEAA 2C1EB 3W66A 2DO4A 2HQ3A 3LTOA 5B0AA 2OTLS 3PO5A 3MD1A 2VDIA 3NMAA 2DGOA 2L48A 3V4MA 2QEXS 1X9SA 4LFBJ 4JI5F 4OMFG 4LIWA 3M6XA 3VAGA 1MU2A 2EFPA 2GMHA 3BGRB 5DDPC 1LWXA 1IQZA 2BV3A 1FDAA 4OI1A 4EEYA 3CC7S 5E3QA 3K8WA 3GG0A 1T8EA 3H4BA 1HHTP 3M2UB 2AJ1A 4NL5A 1PAEX 1CC7A 3PZPA 5HP1A 2ZBRA 1RCOB 4BDPA 3DYAB 2HQCA 5L1KA 2HHSA 2CDRB 2E44A 3PCOB 2HHHJ 1QAYA 3ZZRA 1HD0A 2CZVC 3SQOP 1IKYA 4DLGA 3G6VA 4DF8A 1KHWA 4IFYA 4PWUA 1FRXA 5EWFA 3W2VA 2MKCA 2DR8A 2HYIB 1T3NA 2KVQE 1VQ6S 1VJQA 2C2DA 1DHMA 3A3OB 2V8HA 3W5XA 2O67A 2V68A 5B0DA 3T1HJ 3H7HB 1LW0B 2QT7A 2AEFA 3OFEA 4MK8A 4D3HA 2NQPA 3R7BB 4YY3F 3QWUA 2DGXA 1W2IA 5IOLA 5CYJA 1RTHA 3FSYA 4HH0A 2L9NA 4NLSA 1NUEA 3EVWA 2WONA 1YTYA 2QMUB 1F2HA 3FUYA 5DZ6A 1U0SA 2GQQA 4YOEA 1EAYC 3KDNA 4LF4J 4ZLNA 4IFYB 4QWCA 1I5OB 1HFEL 2HLTA 1IKYB 1YJTA 2HNDA 2FC8A 1DLOA 3HHDA 3M1VB 4M63A 4F3QA 1BGXT 2R8HA 2I8EA 4B9MA 3FSIA 4EYIB 3JTPA 4DV5J 2ZZNA 2HBZB 4JI2F 2NUHA 4N5SA 2HHHF 1FNOA 4CLSA 4K4TA 3AT1B 3QO9B 1C0UB 2IBOA 1MWZA 3D3BJ 3EZUA 1ZAWA 1F5CA 2VODA 3IA0A 2D3ZA 4AXJA 1H2UX 2DEJA 4EO6A 1NB2A 4EI2A 1NMEB 3TRGA 1KQSR 3W8GA 2AW0A 2ZD1B 2MLXA 2BABA 2HFNA 2AEMA 4GMKA 1KS2A 2CJBA 1EHWA 5CYMB 4NA1A 3G82A 1DBDA 4AD6A 2V8VA 2F65A 2WVBA 3UR0A 2ZM6F 3SI8A 1N88A 2ABYA 1QLNA 2FVSA 2V34A 2LLZA 2HBRB 1Y5IB 2AV5A 2MPUA 3FEXB 1FD8A 3HD2A 4CCHA 4OL8A 1QSSA 1WEYA 1NDPA 1NSPA 2G2ZA 3MM6B 3E2EA 3NL0A 2XS5A 5C42A 4IUFA 2BRKA 4DV5F 1VC5A 4QIWD 4N41A 3SCLE 4CNZA 3U7JA 1J5OA 3F0NA 3UN2A 4P6QA 4WJBA 4ZJQA 1N0VC 2VKRA 3FCWA 1YVFA 2VJVA 4I2PA 3AAWB 1WDTA 2DHXA 3CD7A 3UCGA 4HEA9 3SFUA 2N82B 2LYVA 4Y2IA 4ECXA 3Q2TC 3RB3A 3M6UA 2JRSA 1JLEB 1U6BA 4CH0S 1GFWB 3I5BA 4DL2A 2DHHA 3VZHA 2BJ8A 4DR4F 5HP1B 3BBCA 4IOBA 2CQHA 2E5HA 4CH1A 2GA7A 3R9LA 1RUSA 3CMAS 4P10A 4BBYA 1MN9A 1NKEA 2GMJA 2CNOB 3M2VB 2GHWA 2MQOA 4RU2A 4EZ9A 1HQ2A 2CAJA 2DCLA 5IQQA 3BV8A 1U1NA 2QA2A 2FVQA 2W01A 4ZHRB 5KOWA 3DRPA 3KLFA 1TQLA 1U7LA 2RMLA 1JLQA 3HSGA 5IC6B 4WCEQ 3HP6A 2AU0A 1I94F 2HIQA 1G4CA 2RVJA 2ZH7A 2AJ2A 2KL8A 3JSBA 4DHVA 3GFXA 3Q8RB 2DRDA 3OHAA 2BR0A 1T05B 1FF2A 4UUXA 2VOPA 2HHXA 2XYPB 3ZZUA 1YQHA 1N5QA 3KTQA 4ID5A 2M88A 2B8PA 3N28A 4CQ1A 4CYUA 4F3OA 1Y9OA 2VC1A 4OZ0A 1R27B 2A18A 2QL5B 4Q2MA 5K9FA 4C11B 3R1HA 1GNKA 4ZKAA 1VK3A 2I5JA 2VG5B 3E8OA 3LALA 4I0WA 4NI2A 5KFEA 2BJDA 3RRKA 5BR8F 1YJWS 1L3TA 2RD5C 5F0WA 4CP5A 1WHVA 3TI0A 1S7IA 2LU2A 1P8GA 4YB6A 4JI0J 4NLYA 4OI2A 2JC0A 5F8GA 1HBUB 3IWNC 3M2RB 5L9XA 4DSFA 2XSJB 5D77A 3C15B 2O66A 1JXVA 3FFIB 3K2YA 4Z7CA 4DFMA 4W90B 2HGMA 2IAJB 4CLZA 3M9MB 5J2MA 1RT7A 4ZK7M 2ASJA 1LOUA 3DM2A 2QA1A 3HF5A 3JQKA 3MTKA 4AXIA 2W8KA 4NCGA 2XHCA 3BSNA 2YX4A 4C97A 1VBKA 1BUXA 3GFHA 5K8NA 4JI4J 2VL1A 1RLCL 3VAIA 3KWMA 4YR2A 3FSXA 3M9NB 2QSWA 2VBZA 4WZQA 4HACB 2A6MA 2YH0A 1RTJB 3DXBA 2JDJA 4OHVA 1MG7A 4DV1F 2M5YA 4PPDA 2LEBA 4LF4F 4RNNA 2XO6A 3D4JA 3BKTA 1DAXA 1Q5YA 1QAXA 1SPBP 4RPFA 2E7WA 2F3JA 4CO1A 4CLKA 3KMSA 1T03B 3WC2A 3M8QB 4A8MP 4USWA 1TL1A 1CJVA 5A0YB 4OYWA 1LK7A 1LQ9A 1S97A 4MKAA 4ZITA 1RHMB 1QE1A 2QG9B 2Y3YA 3FVYA 5HVGA 1MROA 4JI0F 4PQAA 4RW6B 3KNGA 3DHXA 3P96A 3V6DA 1CQNA 4H4KC 2CPZA 3GP9A 3KHGA 4DQPA 3K0JA 1WC6A 4G1PA 1FRJA 5GADI 1U8SA 2CFXA 4ZVQB 2IBKA 2XWYA 1GTHA 2B9EA 1EB0A 2DXDA 4LSLB 4ZOSA 3MPYA 1IR1A 3OFGA 4NLDA 1NSKL 4NOHA 4XDCA 3G8QA 2YKNA 3MUTP 1S6QA 4ELVA 3A12A 2VASA 4KGKA 2G0CA 3T1YF 2FLOA 1P9YA 2NXJA 2F4FA 3I82A 5D4PA 3THPA 3UR3C 3VHQA 3JAMU 3MUMP 3H42A 2DNMA 3HDSA 3KLVA 4DQRA 1NJIT 5KFMA 4QWEA 4JI7J 3AD9C 4OYPA 2NREA 1NZ8A 3KLEB 2E5LJ 4KGXB 1DURA 5LJ3Y 2K7JA 4FS2A 2H4YB 3SV4A 1KVKA 1XEZA 4ED2A 5A8WA 2P2CB 3ZFVA 5HROA 4I6YA 5KFYA 3QGHA 3UD5A 4DR6F 4DV3J 2AJQA 2FHOB 5BYRA 3OSNA 1FRHA 3L7OA 1NSQA 3JB9k 4E98A 3GIKA 1R0CB 3MMCA 1X9WA 2A10A 2UXBJ 3R5CA 2C3MA 1X4DA 2K1RA 2Y1LB 2HHWA 5H9FK 1S79A 2O01C 2I38A 3GFZA 5A8RA 1JNRB 1SJQA 2QYGA 1HI0P 2K8GA 4WTOB 5IM0A 2J9EA 3VZIA 1W2BR 1NEEA 1X60A 4RW4A 3MR6A 4CLTA 4GVBB 3NKYA 4R0JA 3UN5A 5AE3A 5E3CA 2ZHAA 1YIJS 4UUWA 3W9HA 1GMVA 5C5JA 1L3KA 4QR1A 2VA2A 2CQDA 1QSLA 1S1TB 4N56A 4ECTA 3EDRB 2OSRA 1Z2LA 4DDFA 3BDPA 1W26A 5J1NA 3HD1A 5KFTA 1S1XB 1SIWB 1HMVA 1U2CA 4B17A 4DCOB 2LEPA 2KJVA 4I6AA 5I4MA 5KFPA 1NKBA 4Y2MA 2YWKA 2ZZTA 1B3TA 3C3LA 1S77D 2R7TA 2PI4A 2IIHA 3MEEA 5DM7Q 1ZM4A 4M5DA 4YB5A 5KG4A 5HLFB 1GMUA 1KC8T 1HL6A 3OTOJ 3IBFB 5KFUA 1UVJA 2I0XA 3MCNA 1SV5A 4DF4A 2RRAA 2MQPA 3MM7B 4B9NA 4JV2A 3HVTA 4UY8T 2IM2A 4DS5A 3BH6B 3QZ8A
chains in the Genus database with same CATH topology
3EJMA 3BBBA 3ZTPA 1PAEX 2B8PA 2DYAA 1XIQA 1W7WA 3Q89A 2DXEA 1NPKA 3Q8UA 4CP5A 3BH7B 4F36A 3DKDA 3FCVA 1NDLA 1WKLA 4W98A 1JXVA 3ENAA 3PJ9A 2VU5A 3FBFA 5IOLA 3VVTA 1NCLA 1U8WA 3FBEA 1NUEA 3EVWA 1XQIA 1BUXA 3WX8A 3B54A 1WKJA 1S5ZA 3FBBA 4FKYA 4UOFA 5CABA 2NCKL 1NHKL 2DXFA 1HHQA 1PKUA 2HVEA 1NDCA 3Q83A 2ZUAA 2DY9A 1WKKA 2CWKA 3EE3A 3ZTRA 1VYAA 2AZ1A 3NGUA 1KDNA 4UOGA 4ANDA 4ANCA 3VGSA 3Q86A 3ZTOA 3FC9A 1NB2A 3DDIA 1HIYA 4ANEA 5BXIA 3ETMA 3GP9A 4C6AA 2BEFA 1EHWA 3B6BA 2DXDA 4DUTA 3FBCA 3EVOA 1NSKL 3EMTA 3VGVA 3GPAA 4WBFA 1F3FA 3ZTSA 4ENOA 3EICA 3ZTQA 3G2XA 2AZ3A 3FKBA 4HR2A 1NDPA 4KPCA 1NSPA 1F6TA 4EK2A 5CAAA 4F4AA 2B8QA 4DZ6A 3NGSA 1HLWA 2HURA 3VGUA 3JS9A 1BHNA 1B4SA 1NSQA 3VGTA 5C7PA 3FCWA 1B99A 4FKXA 2HVDA 4S0MA 3MPDA 1LEOA 1ZS6A 3EVMA 4DI6A 1BE4A 3BBFA 3L7UA 3NGTA 3Q8VA 4O0NA 3EM1A 3VVUA 1UCNA 1NLKL 2BX6A 3BBCA 3Q8YA 1K44A 3R9LA 1MN7A 1MN9A 3NGRA 4UOHA 1S57A 1S59A 3ELHA 1LWXA 3PRVA 1NDKA 3BH6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJM A;  3BBB A;  3ZTP A;  1PAE X;  2B8P A;  2DYA A;  1XIQ A;  1W7W A;  3Q89 A;  2DXE A;  1NPK A;  3Q8U A;  4CP5 A;  3BH7 B;  4F36 A;  3DKD A;  3FCV A;  1NDL A;  1WKL A;  4W98 A;  1JXV A;  3ENA A;  3PJ9 A;  2VU5 A;  3FBF A;  5IOL A;  3VVT A;  1NCL A;  1U8W A;  3FBE A;  1NUE A;  3EVW A;  1XQI A;  1BUX A;  3WX8 A;  3B54 A;  1WKJ A;  1S5Z A;  3FBB A;  4FKY A;  4UOF A;  5CAB A;  2NCK L;  1NHK L;  2DXF A;  1HHQ A;  1PKU A;  2HVE A;  1NDC A;  3Q83 A;  2ZUA A;  2DY9 A;  1WKK A;  2CWK A;  3EE3 A;  3ZTR A;  1VYA A;  2AZ1 A;  3NGU A;  1KDN A;  4UOG A;  4AND A;  4ANC A;  3VGS A;  3Q86 A;  3ZTO A;  3FC9 A;  1NB2 A;  3DDI A;  1HIY A;  4ANE A;  5BXI A;  3ETM A;  3GP9 A;  4C6A A;  2BEF A;  1EHW A;  3B6B A;  2DXD A;  4DUT A;  3FBC A;  3EVO A;  1NSK L;  3EMT A;  3VGV A;  3GPA A;  4WBF A;  1F3F A;  3ZTS A;  4ENO A;  3EIC A;  3ZTQ A;  3G2X A;  2AZ3 A;  3FKB A;  4HR2 A;  1NDP A;  4KPC A;  1NSP A;  1F6T A;  4EK2 A;  5CAA A;  4F4A A;  2B8Q A;  4DZ6 A;  3NGS A;  1HLW A;  2HUR A;  3VGU A;  3JS9 A;  1BHN A;  1B4S A;  1NSQ A;  3VGT A;  5C7P A;  3FCW A;  1B99 A;  4FKX A;  2HVD A;  4S0M A;  3MPD A;  1LEO A;  1ZS6 A;  3EVM A;  4DI6 A;  1BE4 A;  3BBF A;  3L7U A;  3NGT A;  3Q8V A;  4O0N A;  3EM1 A;  3VVU A;  1UCN A;  1NLK L;  2BX6 A;  3BBC A;  3Q8Y A;  1K44 A;  3R9L A;  1MN7 A;  1MN9 A;  3NGR A;  4UOH A;  1S57 A;  1S59 A;  3ELH A;  1LWX A;  3PRV A;  1NDK A;  3BH6 B; 
#chains in the Genus database with same CATH topology
 3EJM A;  1VRU B;  3H0P A;  4X4P A;  3OTE A;  4OI4 A;  3QWP A;  3ILO A;  1MWY A;  5G0R B;  3D2W A;  5LXR A;  1NB7 A;  2DH7 A;  1HR0 F;  4OHX A;  2DTJ A;  3M6W A;  1F1B B;  1Q8K A;  3E51 A;  3MZI A;  4FNI A;  4WFX A;  5HVF A;  2W8L A;  3WHI A;  3QLH A;  4DLE A;  1HKA A;  3EPI A;  3LGM A;  4OJ3 A;  2JZ5 A;  4JI1 J;  2OKQ A;  5KTQ A;  4KKO B;  2FUG 9;  3TVY A;  2J0Q D;  2CZ4 A;  5K14 B;  4YR3 A;  1S9G B;  2CQI A;  1S76 D;  2JLE A;  3QRQ A;  3DRS B;  3SSQ A;  4ZJL A;  2MB0 B;  4ZVG A;  2AD9 A;  4IR9 A;  3N9U C;  5E5N A;  4K5R A;  5LL6 d;  1M5K C;  2I5J B;  5F41 A;  1JXL A;  3Q23 A;  1RT4 A;  1MMD A;  1X4H A;  2HVZ A;  1F9H A;  4DPY A;  3IRX A;  2HPU A;  5F3Z A;  2NPI A;  1SC6 A;  2XZT B;  3DGP A;  4C0B A;  5DDO C;  5HQ8 A;  1NXI A;  1KLN A;  3CT9 A;  1KOH A;  5F3T A;  3EE3 A;  3OXF A;  2FJV A;  4WP9 A;  3J7Y I;  5EDW A;  1YK9 A;  3LUY A;  2DNL A;  3EUN A;  2CA9 A;  5F8I A;  1U1M A;  3WC0 A;  4B9V A;  1UVN A;  4AND A;  1HPZ A;  4OI0 A;  1LW2 A;  1S9G A;  5I42 B;  4C9D A;  3NAH A;  3PR5 B;  4CT8 A;  3V81 A;  1R6Y A;  3HVT B;  3TJA A;  4NAS A;  5JUM A;  3SV3 A;  2AQ4 A;  2VIH A;  2KFN A;  4GC7 A;  4CTA A;  4WWS A;  4ECW A;  3MFI A;  3U1M A;  4OZL A;  1T03 A;  4UZB A;  3W61 A;  2DNG A;  3H2L A;  2BEF A;  4O0I A;  5D15 A;  3JSM A;  1F2G A;  1F9F A;  4IDK A;  1HHS A;  2EWH A;  4KTQ A;  4G1Q B;  2GML A;  4P2F A;  4DL6 A;  5LOQ A;  1JLA B;  2BQR A;  2CDQ A;  4URG A;  3TZZ A;  3J80 U;  2GVD B;  4PXE A;  1RWW B;  4PAB A;  3HHL B;  3DC2 A;  1VLY A;  1AA1 B;  3ZTS A;  3F73 A;  2XGQ A;  1GTE A;  4ECV A;  3ET6 B;  3C14 A;  3FK4 A;  4GRS A;  1N34 J;  1IVZ A;  1E6Y B;  3KMQ A;  1RT7 B;  1RAA B;  2WVD A;  4GC6 A;  5D0H A;  4ER8 A;  1JLF A;  3BDE A;  5HLF A;  4J9O A;  1S1U A;  4HLB A;  5CA5 A;  4M5D B;  5IZH A;  5F8L A;  1MMN A;  3LW5 C;  4MT1 A;  2Y1I A;  5DQG A;  3CDW A;  3OVS A;  4D3G A;  5I3Q A;  1X9M A;  3HO1 A;  1HMV B;  3CVK A;  4DSI A;  1URN A;  3M6V A;  1CPZ A;  1B99 A;  3EGN A;  4GKJ F;  4KR0 B;  1J5O B;  1G2E A;  4ALZ A;  4L6V 3;  1HBM A;  2EI5 A;  5E7O B;  4JI3 J;  3EVM A;  3PAC A;  4P9S A;  2W24 A;  5RUB A;  2X1F A;  1JQG A;  3P49 B;  2R7S A;  1Q53 A;  4DSL A;  3QGI A;  2ZEJ A;  2CYY A;  1RAG B;  2HRT A;  3Q2S C;  4DXL A;  3OL7 A;  1RQ0 A;  1EP4 B;  3W63 A;  1MSW D;  1LWC B;  2XQC A;  4Y00 A;  1TFW A;  2PDA A;  1Y5N B;  5ADZ A;  1XMQ F;  3KLG A;  5G4D A;  2HZC A;  2HG4 A;  1K0T A;  1S72 S;  2DGQ A;  2R7X A;  2NXE A;  5DRK A;  5K5M A;  3M9O B;  1JJH A;  4QR0 A;  5KFS A;  4X4O A;  2CRL A;  5C24 A;  1M5H A;  2QFI A;  3RR8 A;  4A8K A;  4OFZ A;  3OLA A;  4LSL A;  1X4A A;  3DRR A;  4P2S A;  1RHR B;  3LA0 A;  3N5F A;  1AXQ A;  3KK3 A;  2E1R A;  3CDU A;  2B9X A;  4U6P A;  1A0O B;  2CKW A;  3QO9 A;  4ZVT B;  2J6S A;  1HBN A;  4PQU B;  3LOU A;  2V4J B;  4C3L A;  4M5H A;  3CDB A;  3ZZT A;  4DMZ A;  2RKI A;  4J9N A;  4Q0B A;  2CPD A;  5DG9 A;  2HZV A;  3J7A N;  2HHU A;  2MQL A;  4M5M A;  1HNI A;  3OTO F;  3TUI C;  2IVY A;  2ZHO A;  5CD4 A;  2D9P A;  3PW2 A;  3MEK A;  1SKS A;  3T6J A;  3I0S A;  4OZ1 A;  3U1L A;  1RAB B;  1T9T A;  1Q79 A;  5F9L A;  1VQ5 S;  4FF1 A;  3KJQ B;  5CCL A;  1KQG B;  1P27 B;  1NPK A;  3SSR A;  2VFT A;  1TV6 A;  2G1D A;  2C28 A;  2KKH A;  1RTH B;  2ZOF A;  4MAK A;  4I56 A;  5GAE I;  1ZH5 A;  3MEG A;  1UTA A;  2QLX A;  3GYG A;  5DG7 A;  4ZJO A;  1IWA A;  2IC3 B;  4BLG A;  2KT2 A;  3TAM A;  3C46 A;  1HNX F;  3LP0 A;  4X4V A;  1Y11 A;  3HKW A;  2Y0S D;  1XN9 A;  1WHY A;  4EBC A;  2RDI A;  4LRE A;  3HJV A;  5D6G A;  1DFD A;  1U8W A;  4WP8 A;  3MI7 X;  4PR6 A;  1HNW J;  2PEH A;  1UEV A;  2JX2 A;  3KUE A;  3FMW A;  3MCO A;  4CWB A;  1RT5 A;  2XMJ A;  4P52 A;  2B7C B;  3T3F A;  3H4D A;  2R2U A;  3N4W A;  1L5U A;  2OPQ B;  3GIR A;  3AD8 C;  1U1R A;  4LF8 J;  2E1A A;  2RT3 A;  3N6N A;  3L7P A;  1YWX A;  3Q83 A;  4CLP A;  2IJR A;  4NLQ A;  1RZM A;  4NXN J;  2JEG A;  1GX5 A;  3NXZ A;  5AE1 A;  3GIL A;  4DR6 J;  2IA0 A;  4L3K A;  4IFV A;  3D5M A;  4B3R F;  1O8B A;  4X84 A;  4CO2 A;  3HLU A;  3K59 A;  3EXC X;  2E7X A;  5DS7 A;  3TA0 A;  4DX6 A;  1YJN S;  1RT2 B;  4M5K A;  2IAJ A;  1CG2 A;  3Q86 A;  5CCM A;  4RW8 A;  4J9M A;  2JHE A;  4URS A;  1I94 J;  5E3A A;  3J81 U;  1MML A;  2QLB B;  4KFB B;  4PXC A;  3PW5 A;  4RL1 A;  1IKX A;  3THV A;  1ZM2 A;  2WAQ D;  1T02 A;  3DLG A;  2FZC B;  2NXC A;  2VFV A;  3IFE A;  3RRH A;  2EK1 A;  4DV2 F;  2XNR A;  3I5A A;  4J9V A;  5A8K B;  2XB2 D;  1YJR A;  3CIZ A;  1U24 A;  1G1X A;  2M9K A;  2VPZ B;  1IQT A;  2P8I A;  1Y5L B;  2KXF A;  4IO9 Q;  3W8P A;  4QOT A;  1C4C A;  3GPA A;  3UFC X;  4HL9 A;  4J9U E;  3RUB L;  3EWG A;  3KLI A;  4WP3 A;  5DDR C;  1UW4 A;  2RH3 A;  3EIC A;  1UPM B;  2DY1 A;  3SSS A;  3VWS A;  1KRP A;  1T05 A;  5DLF A;  1TFY A;  5K14 A;  3ZC4 A;  1FE0 A;  2KTQ A;  4UT4 A;  4R8U B;  1JLQ B;  3GTY X;  1HBO B;  2BM1 A;  4DPX A;  4KHP J;  3R1L A;  2QGF B;  3HVR A;  1JLC A;  3W7B A;  2ACY A;  1S49 A;  1FES A;  4G65 A;  1N34 F;  9RUB A;  2DR9 A;  2GAH C;  1VR6 A;  1RLD A;  4MYT A;  2YX7 A;  2X7I A;  3SQG B;  5B09 A;  2Q66 A;  1CS4 B;  2F8M A;  8RUC A;  4LF6 F;  2ZJP Q;  4C8O A;  4MMO A;  1AUD A;  3ZXW A;  1F0X A;  1TU0 B;  1WOO A;  2VG6 A;  3M4X A;  1XR6 A;  1S0O A;  3EM1 A;  3SDE B;  2CIM A;  3ENW A;  3B82 A;  3O44 A;  4FVM A;  1M5S A;  1W25 A;  2IMO A;  2ASL A;  5T7L A;  2B3T B;  1HNI B;  1VLO A;  1RYS A;  1FER A;  3H90 A;  3J7Z T;  3CCE S;  3A3P B;  3MMJ A;  1PCA A;  5IWA J;  2VQF J;  2ZH2 A;  3E01 B;  3LO3 A;  3DCA A;  2ZH5 A;  3GR1 A;  3NGR A;  4AUK A;  4B9S A;  2DEI A;  1FT8 A;  3KNA A;  3RJM B;  2ADB A;  4KO0 A;  2YWE A;  3L3C A;  4CO0 A;  3NY0 A;  1JLF B;  5DJB A;  1FJE B;  2M8D B;  1SIZ A;  2XTJ P;  1N5T A;  3ILI A;  3BKF A;  4PG6 A;  3G9C A;  5C24 B;  1K47 A;  2V63 A;  1M1H A;  1UFW A;  2MLZ A;  3LP0 B;  2HQI A;  3H98 A;  1UJ5 A;  2GW8 A;  3J81 j;  1OO0 B;  4FYV B;  3ISZ A;  1WEX A;  5LXY A;  5IS2 A;  4K50 A;  3H5S A;  4R0E A;  5B0E A;  4LF6 J;  2BW7 A;  2UXD F;  1FFW B;  2GHV C;  4O4G A;  1W7W A;  2V4J A;  4ETX A;  4LF7 J;  1UET A;  2P6S A;  5L1J A;  3LAK A;  1R43 A;  1UA1 A;  2Y9H A;  4DBQ A;  2XCP A;  1YRT A;  1DQ8 A;  2KYZ A;  2N3L A;  4DUZ J;  3HFV A;  2W9A A;  4J9S A;  1VC0 A;  4KV8 A;  2NUU G;  3MOJ B;  2MKH A;  3ITH B;  1N52 B;  2IM3 A;  4C2M A;  5IWA F;  3N0V A;  2WZ1 A;  2B4V A;  2DO0 A;  4LVN P;  2XO7 A;  2WW4 A;  1HPZ B;  5DGB A;  2H9Z A;  1N33 J;  4B3T F;  2ZE2 B;  4X65 F;  1NK8 A;  2FGO A;  2M3D A;  2VUG A;  2ZBC A;  4DOZ A;  1V3R A;  3CDA A;  1KON A;  1HYS B;  3NMR A;  4K4S A;  4F0K A;  5L39 A;  1Q0N A;  3CC2 S;  2DH9 A;  1BMQ B;  1LWE A;  2DR6 A;  3H59 A;  3ET6 A;  1RWP B;  1NJW A;  4TQS A;  3O8W A;  1GH8 A;  5KFO A;  1UKU A;  4RBV A;  1IWG A;  3T6B A;  3NOG A;  2LMI A;  2CQC A;  2RDD A;  4A46 A;  1H38 A;  3PW4 A;  2J6U A;  1R0B G;  2MZQ A;  2GZO A;  4KT0 C;  4DV0 F;  2YNF B;  1IBM J;  1MNE A;  3GJT B;  4X4N A;  4PKD B;  3AJ2 A;  2P5V A;  3IWL A;  1TTH B;  4H54 A;  2QIF A;  1PC5 A;  3VGS A;  2XMT A;  4DUZ F;  1KD1 T;  3QT5 A;  3PJW A;  3MEC A;  2KN4 A;  4Y2C A;  1FD2 A;  4QQB A;  4CZC A;  3V6K A;  3TQ1 A;  1S1W B;  3M8Z A;  3ETM A;  4OIX A;  4P2X A;  3CCU S;  4A8S A;  2Q6B A;  2IC3 A;  1V5V A;  2B43 A;  3BO4 A;  4DV7 J;  5GAG I;  2OPS B;  2BJE A;  1N0U A;  1WOR A;  1H74 A;  3A3N B;  1RGV A;  2BMB A;  1Q8L A;  2AYB A;  2X1B A;  2WVE A;  5ETL A;  4G3I A;  1I51 B;  3OL6 A;  3BQ2 A;  3CD0 A;  2MZT A;  3H5Y A;  4AT1 B;  1TL3 A;  3OFF A;  4DL4 A;  1XMB A;  3P5T L;  2W7A A;  4DV4 J;  1M5P C;  5J2P A;  1ZA2 B;  2AX0 A;  1RT4 B;  2GS8 A;  2BKP A;  1VQ8 S;  1RTD B;  2MTL A;  4P7V A;  4LFA J;  2FYX A;  1IR2 A;  5KG6 A;  2OSQ A;  3MEE B;  1RBA A;  3OXG A;  4MK9 A;  4ZCM A;  3HXM A;  3PX4 A;  1R8H A;  3WQP A;  3KG1 A;  4CNY A;  4EWT A;  5IV4 A;  2JOQ A;  4JI2 J;  1IBM F;  1WJ9 A;  3PRD A;  1R8A A;  2EC0 A;  1SCJ B;  1RAF B;  3CCL S;  2BBE A;  1S9E A;  2HVD A;  1N33 F;  1BQN B;  2HBY B;  3BPD A;  3IM8 A;  3QLH B;  1KTQ A;  4CTA B;  1VC6 A;  2ROP A;  1APS A;  1BC6 A;  1S6Q B;  3I4H X;  2RHQ B;  2OEK A;  3L7U A;  1CJT A;  3NGT A;  1F5B A;  1Y0H A;  3D0H E;  2CWX A;  1UFL A;  1I6J A;  5DLG A;  1OSD A;  1WF1 A;  4NEZ A;  3P6Y C;  2DB1 A;  1TKT B;  3GYN A;  2I9S A;  4LQ3 A;  1Y7P A;  4P73 A;  2BAN A;  1K73 T;  4ILR A;  2VPX B;  4DG1 B;  1SKW A;  2GVZ A;  2LQJ A;  2QLW A;  4WKY A;  5F9N A;  3IRX B;  1L3U A;  2KDO A;  4JYA J;  2DNH A;  1NK7 A;  3KLH B;  1BQN A;  1EJ7 L;  1YG0 A;  2FHK A;  4CDI A;  4JV5 J;  2E5J A;  4E0D A;  2VBY A;  1FJG F;  4NXM J;  3QIP B;  4OX8 A;  1KQK A;  4JI4 F;  4WYW A;  2F63 A;  2CJX B;  1C4A A;  3C6U B;  4ILM A;  3N5B A;  4NYO A;  4DR1 J;  2KG0 A;  2W7O A;  4KKO A;  3R8Y A;  4B9T A;  4W92 B;  4ZPV R;  1HNZ J;  4NYP A;  4FYW B;  1C0T A;  2LQ9 A;  2DNQ A;  3TAP A;  4BC7 A;  3CJ8 A;  4U7C A;  2FHJ D;  3B4D A;  2E29 A;  1RAC B;  4LFC J;  4CI0 B;  3NNH A;  1T9X A;  1XIQ A;  1NJZ A;  2VOO A;  2VG6 B;  2J6T A;  2BDP A;  4F2R A;  3R5A A;  5HI7 A;  3T9Z A;  4IO1 A;  1RAI B;  4DSK A;  3AH6 A;  2HS4 A;  1KFS A;  3KHL A;  5LMN F;  3DKD A;  2ZH6 A;  4RBU A;  1FRM A;  1UPP A;  2AYE A;  2EFG A;  5CYQ B;  2E5I A;  2CQP A;  3PJ9 A;  1FNM A;  3RBD A;  1RA7 A;  2GJI A;  4P72 A;  4KBI A;  3EPG A;  4WPA A;  4XPE A;  1PJ5 A;  2DPJ A;  1M0S A;  2GNK A;  4TU8 A;  2XI3 A;  1TP7 A;  2XY6 A;  3MMA A;  1D8Y A;  3M05 A;  3WX8 A;  2OMO A;  1UJ6 A;  4HI1 A;  1SXL A;  2B7B B;  2HWH A;  3BGL A;  3OR2 A;  3KLI B;  4EU0 A;  3T5J A;  1JJ2 R;  5AXN A;  4K0K J;  1RT6 B;  3G82 B;  3FQK A;  3MOZ A;  4QPT A;  5A8R B;  5EGY A;  2E5L F;  1X31 C;  3SBM A;  1N32 J;  3JYT B;  2YKN B;  1VJW A;  5CHC B;  2HW3 A;  3JTO A;  1U6Z A;  2HHQ A;  2ZBI A;  2OPR B;  1KDN A;  3MAH A;  4U8Y A;  1ZET A;  2FY1 A;  2G2O A;  1XMO J;  2BAC A;  2QO3 A;  1VIO A;  1Q7L B;  1QM9 A;  3ZTO A;  4NLX A;  2R4F A;  3W64 A;  3CGI A;  3QJP A;  3TA1 A;  4F4Z A;  4ATN A;  2KVI A;  1GQE A;  1FJ7 A;  3PRB A;  4ED3 A;  2XY7 A;  3CCT A;  1FWK A;  3ITH A;  4DL0 C;  2ZVI A;  5GAD U;  3BSO A;  1DZ5 A;  2IVF B;  3BGU A;  2FVR A;  2UU9 J;  1JLE A;  1T95 A;  2LCW A;  4F4K A;  3BKU A;  3KK2 A;  3PY8 A;  5LSO A;  4DQQ A;  1LXN A;  1EIY B;  3MPV A;  1GX6 A;  3PM9 A;  2AWZ A;  4KRW A;  2DHA A;  2DGT A;  4ICL B;  1AT1 B;  1NKC A;  4DX8 H;  4RWX A;  2KHD A;  2DNO A;  1M5O C;  3EDQ B;  3US5 A;  2RU3 A;  2KU7 A;  1HNV A;  4RW6 A;  1ZOT A;  1F6T A;  4L76 A;  2W7P A;  4C8Y A;  4YHH J;  4WII A;  4UW2 A;  4IRD A;  5H9E K;  1JNZ B;  3W5Z A;  4WFY A;  1HLW A;  4OLO A;  3MDF A;  2XLJ A;  1YHQ S;  1FEE A;  4C7Q A;  1T9U A;  4LQ9 A;  4QWD A;  1B4S A;  4J9P A;  1VQ9 S;  2OD4 A;  3ILJ A;  2FVC A;  4G6V B;  6FD1 A;  2R8G A;  2YNI A;  1N6Q A;  4FKX A;  1X4C A;  2V0N A;  1SH3 A;  3MED A;  4YUD A;  4UQG A;  1T9Y A;  3MPD A;  1WF0 A;  2PE8 A;  4G1I A;  1G6B A;  3BM7 A;  3CCW A;  3NBP A;  1ZS6 A;  4RX6 A;  2R8J A;  2RRN A;  4HT7 A;  1Y3K A;  1VK8 A;  4WU3 A;  4DI6 A;  3T5L A;  1NK6 A;  4B3O B;  1RHJ B;  2OIH A;  4A47 A;  2NZC A;  4FZV A;  2DRB A;  1LNQ A;  4O3N A;  4PYD A;  4DN9 A;  1LK5 A;  1YKW A;  2VKZ G;  2LEC A;  3V4I B;  1U1O A;  4WZM A;  5HAO A;  1J2V A;  2FTR A;  4CYU B;  2R2R A;  3GJQ B;  4O3P A;  1D8Z A;  1Q1K A;  3KG0 A;  1EQM A;  3QT8 A;  2FJA B;  4Q0B B;  1DQ9 A;  3QGG A;  2B51 A;  2XG8 A;  6AT1 B;  3NS5 A;  4DU7 A;  1F60 B;  2GAG C;  1QTM A;  2WRM A;  2YWH A;  3FMB A;  1WC3 A;  3AB2 B;  1M90 T;  2I6W A;  3DRY A;  4O44 A;  3ISN C;  1CUL A;  3TEG A;  2PI5 A;  1QAJ A;  2BA9 A;  4EZ6 A;  5HSP A;  4ERD A;  3SYZ A;  2OAU A;  3MM9 A;  1HBO A;  1YX2 A;  1DLO B;  1M1G A;  3CED A;  4LF1 A;  2CNK B;  4DR2 F;  4O3R A;  4MYU A;  5F8J A;  2C42 A;  1DTT B;  1LWC A;  1REV B;  3WBZ A;  1L3S A;  1IJF B;  2OEL A;  4O23 A;  3TJ9 A;  4IQX A;  3GLJ A;  3ONQ A;  2DNK A;  1SUQ B;  2LKZ A;  3C19 A;  4NZ0 A;  2CPE A;  4B08 A;  1HW9 A;  2DXE A;  4MIW A;  1TKD A;  4X62 J;  1SC4 B;  2K2P A;  1HNZ F;  4USV A;  3W3S A;  5IT9 U;  4FP9 A;  3UWT A;  4OYI A;  4ZDN A;  2RNE A;  2CVI A;  4ECU A;  1T94 A;  3SFG A;  1TZ0 A;  2RUG A;  3CSK A;  1RHU B;  1RWM B;  3CCJ S;  4IRK A;  4LBH A;  1RAD B;  2WON B;  1IKX B;  1RT3 B;  1QD1 A;  2C2O B;  2VD3 A;  3LP1 A;  5D4N A;  5EX0 A;  4DPO A;  2WBM A;  3CTR A;  4F67 A;  5M2R A;  5KT2 A;  2KXH A;  4XAK A;  1JKH A;  3O2I A;  1P9Q C;  1RDR A;  4QIF A;  4TN2 A;  3EZ5 A;  3BQ0 A;  3MF5 A;  4DS4 A;  4URQ U;  1FWP A;  1IKV B;  2AMC B;  2FZG B;  1WAC A;  2ZUG A;  4FBT A;  1LFW A;  4IG3 A;  4Y3C A;  4DPW A;  1VMB A;  6FDR A;  2GGP B;  1XR7 A;  1UZH A;  2A1B A;  3S6E A;  3ZZZ A;  1PGZ A;  2MKY A;  1JLA A;  1EKR A;  2ZUA A;  2HHP A;  2J7U A;  2MQM A;  4JP8 A;  1TUG B;  3DYA A;  4M5G A;  4BWM A;  5A2Q U;  3EGW B;  4Q44 A;  2IPO B;  4ED0 A;  3D6M B;  2AP6 A;  1J5E F;  4KE5 A;  5B7W A;  5H9E J;  1JKH B;  3PV8 A;  3BEG B;  4J9K A;  4FVC A;  4ECQ A;  1B7F A;  1KN6 A;  4J37 A;  2RAQ A;  3GYX B;  2FJE B;  2H1Y A;  2KB2 A;  3C14 B;  4MKY A;  2CPY A;  2G0J A;  2IRY A;  3CJS A;  3D1O A;  4ANE A;  4CO3 A;  3EYZ A;  1H0H B;  3R5D A;  2YBV A;  1N4L A;  4A8Q A;  1U26 A;  3FNN A;  5ETR A;  1FJG J;  3AB4 B;  1JXE A;  5D78 A;  2Y8Y A;  4TU7 A;  2W1B A;  2PO4 A;  5KFZ A;  4DUT A;  2IRU A;  1RWO B;  3TR5 A;  3GSD A;  3LP2 B;  3K57 A;  2OML A;  5C42 B;  4NLP A;  3NRB A;  4PWD B;  5HAT A;  3IG1 A;  5IQ6 A;  1ZM3 A;  1Q81 T;  3C2P A;  3UDL A;  4C98 A;  2DR5 A;  3FDS A;  4PEO A;  1QSY A;  1QAI A;  4FXD A;  2N4C A;  3LGN A;  1RAO A;  3P8B B;  2W2P P;  1YGY A;  5B0F A;  2UP1 A;  1CUL B;  2W2Q P;  2ZFH A;  1LWF B;  1B0V A;  4KB7 A;  5SUH A;  1IKW A;  2HKE A;  2QYC A;  5SZT A;  2PA3 A;  1ZTT A;  1RKJ A;  1KKH A;  2XBP A;  1H6K X;  1WOP A;  2J7W A;  2AHO B;  2UUC F;  1RT2 A;  2DVI A;  2L9D A;  3K5O A;  3W9I A;  1TUV A;  1Q86 T;  3T1A A;  3DGP B;  5IFM A;  1SBR A;  1HI8 A;  2Z8Q A;  3M8R A;  3C16 B;  1RKI A;  4RO0 A;  2QA4 G;  2Z57 B;  4PUO B;  1RYR A;  1VS3 A;  1WC0 A;  3Q8V A;  5G0R A;  4ZP7 A;  2FHM A;  3HCX A;  3K5P A;  3VQS A;  2BQ3 A;  2Z2M A;  5HN0 A;  5BR8 J;  3AQO A;  3K5M A;  4JI8 J;  3DOK A;  3G96 A;  1N5V A;  3I9Z A;  5GMK a;  2LXU A;  2LU1 A;  3KK1 B;  3NBP B;  5FLX U;  2KT5 A;  3TWZ A;  3HFK A;  4P7T A;  4QU6 A;  3G87 A;  4YR0 A;  1NK9 A;  2JEF A;  3SXL A;  4F4X A;  4LIR A;  2HND B;  3M1V A;  3NCQ A;  5LM7 E;  5KAK A;  2E1C A;  4H4O B;  2CJ9 A;  1KLM A;  2J0X A;  5KG2 A;  1YBU A;  1OMS A;  5KFH A;  2DNZ A;  4HHH A;  2D3U A;  4EUV A;  3W2V B;  4PG5 A;  3D68 A;  4V1A k;  2C2Z B;  3CB4 A;  4JOU A;  3KJN B;  3ZZY A;  2VQE J;  3Q24 A;  3ETO A;  2UUC J;  4OX9 J;  3H5U A;  3ZZP A;  2X3G A;  3PIO Q;  1FXL A;  3QSY B;  3OFH A;  4UQT A;  5B0G A;  5DQI A;  2HNY B;  3TZX A;  3KUH A;  3GII A;  4ED7 A;  2MJU A;  1SC3 B;  2C22 A;  1JX4 A;  2FJX A;  2CQB A;  3DLE A;  1H73 A;  3FRY A;  1X4B A;  2OEJ A;  3KUG A;  5L8R C;  3K58 A;  5J1E B;  2IVM A;  3W60 A;  1B70 B;  2FY8 A;  4IG3 B;  3IS9 A;  1BXN A;  4A8Y A;  3FZ2 A;  1XMO F;  2F4V F;  3TO8 A;  2DHS A;  1UP1 A;  2XUL A;  4C8N A;  3TAQ A;  3HPO A;  3J7A 1;  2J7K A;  5E3P A;  2YVS A;  2AYG A;  3FCV A;  1SL1 A;  1SQE A;  1CBK A;  4IH5 A;  4PYA A;  3MCS A;  4TKT A;  3KK3 B;  4DFP A;  1RTI B;  1ZAX A;  2KT3 A;  5I3U A;  4ZPB A;  2Q1L A;  3ILL A;  4W98 A;  2POK A;  2ASD A;  2QC3 A;  1Q4R A;  4IG0 A;  4RJV A;  4LR9 A;  3V81 B;  2EBG A;  4F7V A;  1ZZF A;  2ZKT A;  3T1H F;  4KH1 B;  4O44 B;  3I55 S;  4OZ3 A;  4C8L A;  4Z2X A;  3KLG B;  2OI2 A;  3UN3 A;  4X4U A;  1WKJ A;  2BYC A;  2V67 A;  4QZV B;  2XS7 A;  4UOF A;  1FX4 A;  5D0E A;  4DL7 A;  4A8O A;  1HNW F;  1AZS B;  1ZA1 B;  4HVZ A;  1QY7 A;  3RTV A;  3N79 A;  4JI6 J;  2B9W A;  2RF2 A;  2XMV A;  1REV A;  4DU8 A;  1OJ4 A;  2ZNZ A;  3D9B A;  2GIQ A;  3HVA A;  4C8Z A;  3CJK A;  1VYA A;  2H3E B;  2XZD B;  3RRG A;  1WEL A;  2B4U A;  3MM9 B;  1C1B A;  2AJ4 A;  4JB8 B;  3NGD A;  2VIC A;  3OR1 A;  4V19 X;  1SC1 B;  1NBE B;  2CQ4 A;  1MLA A;  1XTZ A;  4N8O A;  1N5S A;  1FNX H;  1CSJ A;  2ZWO A;  3FC9 A;  4DUY J;  1PJ7 A;  2KYX A;  3V2U C;  5CD4 H;  2ZH8 A;  2IMW P;  1TL4 A;  3PX6 A;  2C2K B;  2R8K A;  3EGZ A;  4ZVR B;  2C3P A;  1OYD A;  3HJF A;  1RT3 A;  1VBZ A;  3OV7 A;  4I2Q A;  1PIE A;  3DNC A;  1IBK F;  1O0P A;  4PXB A;  1OY8 A;  3M8P B;  1YJU A;  4WBF A;  3QQC D;  4RZR A;  2IA6 A;  2P6T A;  4I68 A;  4K4V A;  3P45 B;  3WX4 A;  3QBC A;  4G1Q A;  2MKI A;  3PYF A;  2DR7 A;  2YNH A;  2ATL A;  4LRB A;  3MM8 B;  3CD6 S;  1U2F A;  3C8Y A;  3I87 A;  2YQ0 A;  4RUB A;  4DQS A;  4JI5 J;  3MED B;  3TVK A;  2JJ4 D;  2B8Q A;  1I1G A;  4DCJ B;  1DAR A;  1X7V A;  2HUR A;  4NXN F;  2AX1 A;  5KFR A;  4CO4 A;  2YNG A;  2O5D A;  3DRX A;  3JS9 A;  1BHN A;  1KVJ A;  2OPR A;  4OV6 A;  3IXQ A;  2VH7 A;  5K8P A;  5M2U A;  1RTZ A;  1B0T A;  1G7C B;  1V9O A;  5HMW A;  2ILZ A;  1WD6 A;  4FF3 A;  4A8X A;  3I31 A;  2YKO A;  2GV1 A;  1N36 F;  3G8T A;  4V19 J;  2HHV A;  4ECY A;  1NK5 A;  2F8E X;  3BBF A;  1WDD A;  1IM6 A;  1HQE B;  4RW7 B;  3TUZ C;  1SL0 A;  2LDY A;  1NLK L;  4B02 A;  1GAO A;  2U1A A;  3GFY A;  4HDG A;  3TW0 A;  3CUN A;  2AGQ A;  4TQR A;  1XC9 A;  4OYM A;  4WKR A;  2WCX A;  2XWX A;  1YBA A;  1CJK A;  4K7Q A;  1KR4 A;  3KK2 B;  1JJC B;  2WB1 D;  3C15 A;  3GB0 A;  4PWD A;  1RTI A;  5I3U B;  4K4Y A;  1HWK A;  1F3V A;  2FJD B;  1YDL A;  2ZH9 A;  1TK5 A;  3DN9 A;  3FZB A;  2PA8 D;  2QA4 S;  4CLY A;  3PR4 A;  3GV8 B;  2Q43 A;  2R7Q A;  3CJR A;  1VQM S;  4KPY A;  4RW9 B;  2ROG A;  2OLW A;  1S1U B;  4Y6I A;  4CRJ A;  5HRO B;  1R8C A;  4IRC A;  2CVE A;  3BYP A;  5K8O A;  4GO7 X;  7FD1 A;  2DIU A;  3PVX A;  1Q7Y T;  1FEH A;  2ZWP A;  3S8S A;  5KFN A;  2H4W B;  4Z7Y A;  3GIM A;  2YNH B;  3K5N A;  2MZJ A;  1QUV A;  2MEW A;  3BBB A;  4K59 A;  3R97 A;  4HI2 A;  2P9E A;  4ZLJ A;  2BXJ A;  3X1L B;  2NR0 A;  2YKP A;  4ZVO B;  3NS6 A;  4DJB A;  3HHL C;  5HMX A;  1C2P A;  2ZDP A;  5JMN A;  2GCF A;  3DOL B;  2UV8 G;  1YJ9 S;  4LRA A;  1RB0 A;  1NM2 A;  3UE2 A;  5KT5 A;  3JTN A;  4DV4 F;  5KFD A;  2VBW A;  3PO4 A;  1NSA A;  3T41 A;  4AYB D;  1D9D A;  4KQZ A;  4FYD A;  1GK8 A;  1WKL A;  4Y28 C;  2ZJQ Q;  1E6V B;  1AUS L;  2FZK B;  1S1X A;  2VU5 A;  4RR5 A;  4Y2A A;  2ZJR Q;  1RK8 A;  2RE1 A;  4CLL A;  1NK0 A;  4C8K A;  1T9W A;  3GU0 A;  2XHW A;  3TJ8 A;  3ZO7 A;  2ILY A;  1R0A B;  1CJK B;  2QMW A;  1VOM A;  3M32 B;  3OPK A;  3AOA A;  4FKY A;  1S4E A;  2JVO A;  3VTI A;  3CO9 A;  3UDC A;  5FII A;  3GJR B;  1Q8I A;  1NO8 A;  3MTJ A;  3Q8P B;  3RU0 A;  5HVH A;  4JI8 F;  3I56 S;  1SUQ A;  3QJL A;  3M8W A;  1Q8B A;  2GJ2 A;  3IR7 B;  1S4F A;  1IKW B;  1H72 C;  1DTQ A;  3ULH A;  3A8E A;  5JJB A;  5K8M A;  5AJ3 F;  3MMC B;  1ZBT A;  2JFK A;  4LSZ B;  3OXL A;  5HJX A;  5J2M B;  4QU7 A;  1FCA A;  2UV8 A;  3MM6 A;  4PXD A;  5GVQ A;  3QNW B;  4YS2 A;  3CJK B;  4OYB A;  3I32 A;  5HMZ A;  4BS2 A;  3CCS S;  4JI3 F;  4Q8F A;  1WC4 A;  3D66 A;  2J9C A;  3C6T B;  4QW8 A;  1TKX B;  2GC8 A;  3HX9 A;  1BLU A;  2D9O A;  4Q43 A;  4NLR A;  1VBY A;  1HQE A;  5KFA A;  1KNZ A;  2PFF B;  2VQE F;  4X4R A;  2RQM A;  3FBC A;  3E3X A;  5GMD A;  4EYH B;  4ED5 A;  2QRR A;  2BW2 A;  2EPI A;  3NNA A;  1NZA A;  4HH1 A;  3CC4 S;  4O3O A;  3KJV B;  3I0R B;  4JBC A;  4O3S A;  2DGS A;  3OR2 B;  1BQM B;  1EX8 A;  1RAH B;  1X5O A;  4ECZ A;  1CJT B;  4F3M A;  2VB6 A;  2QJ3 A;  3K5L A;  3TUP A;  4LF5 F;  3CJ0 A;  3RG6 A;  1VBX A;  1NPP A;  3MEC B;  5CAA A;  1V5I B;  2D41 A;  2DCU B;  2MHE A;  2FJW A;  2R2T A;  1WTF A;  2MLY A;  3UPF A;  2OP5 A;  4CM2 A;  1N8R T;  4PG8 A;  1KWM A;  2AF6 A;  4YN3 B;  1V3S A;  4MK7 A;  2B4O A;  1TKZ A;  3SEO A;  5KFI A;  5KFK A;  3D6H B;  2R2S A;  2EBE A;  3OR1 B;  1L3V A;  4LR8 A;  2CPI A;  1C1B B;  2WSF C;  3GR0 A;  2ZKU A;  4DR5 J;  3GON A;  4JUZ A;  4RNO A;  1RWK B;  2YTC A;  4FF2 A;  1XNQ J;  3RBZ A;  4F02 A;  2EKN A;  1T0T V;  1HQU A;  2WSC C;  4QJV A;  4TLQ A;  4ZVF A;  3V6H A;  2XNQ A;  3CF5 Q;  1HWU A;  2ASY A;  2F40 A;  4LMZ A;  3M2U A;  1XNR J;  3POT B;  8ATC B;  3RR7 A;  4ES1 A;  2HMI A;  3B78 A;  2QLJ B;  2EKY A;  2WW8 A;  2A2C A;  1R0A A;  1FKP A;  1OQ6 A;  2WOM B;  2Z2L A;  3ZZ0 A;  3ENV A;  4PRF A;  1KP6 A;  2NSB A;  4YP3 A;  3PHE A;  1EAR A;  3AJ1 A;  3S01 A;  5MLC V;  4USI A;  4L3N A;  2DIT A;  2QE5 A;  3M8S A;  3ISN D;  4R8U A;  1S59 A;  3CCZ A;  4NMX A;  5H9F J;  3C66 A;  4AE5 A;  2NYH A;  2LVW A;  1M5V C;  1WI8 A;  2DIV A;  2DIS A;  2RU9 A;  1FFS B;  1S99 A;  4MFB A;  1TL7 B;  1R31 A;  3NEK A;  2MXY A;  2M8H A;  5EX3 A;  3FRZ A;  3J7Y U;  3LF0 A;  4FN5 A;  1GT8 A;  2BE7 D;  2COL A;  4QIV A;  4TLR A;  4FBU A;  4AFF A;  2HAI A;  4ITS A;  2BKN A;  1R8P A;  2GO8 A;  1Y00 A;  3JSR A;  5DQH A;  3LQV A;  4RUA A;  4RU9 A;  2O1P A;  2W4C A;  3Q8U A;  4ED4 A;  3ADA C;  1U0H A;  3R7N B;  4GKK F;  1D9A A;  1HD1 A;  4PAA A;  4KFB A;  2V9K A;  4WK3 A;  2Z0G A;  3PW7 A;  3DRP B;  5LSL A;  2VZ9 A;  2C3U A;  4NLG A;  4NRT A;  5T14 A;  3ENA A;  3OTB A;  1VFJ A;  5EUH A;  1VQK S;  2DGW A;  1FA0 A;  1TL1 B;  3MHY A;  4H4O A;  4KV8 B;  1NCL A;  1NU4 A;  4BWJ A;  1RJJ A;  3TZW A;  3QZ7 A;  2ZZM A;  4KO0 B;  1XQI A;  3PKY A;  4WK1 A;  3G71 S;  2BOP A;  4U67 Q;  3IO1 A;  4NXM F;  1S5Z A;  3F44 A;  2R7R A;  1FXD A;  1U09 A;  2FB0 A;  4OZ5 A;  4ZPT R;  4IOA Q;  4DR1 F;  4DPT A;  1Q16 B;  5AXL A;  3BF4 A;  3QAT A;  2HGN A;  3IC1 A;  5D0G A;  2MZR A;  1D0E A;  3DLE B;  4OYX A;  2HRU A;  1EET B;  1JMT A;  3JQM A;  3VCD A;  2Q3P A;  4Q7A A;  1JLC B;  2UUW A;  3NGU A;  1OWX A;  2DH8 A;  4LUB A;  2A2D A;  2AT1 B;  4MIA A;  3L09 A;  4ZCK A;  1HNV B;  2UVV A;  3GQC A;  4ZVP B;  4B3S J;  3GE9 A;  3LP1 B;  3G6E S;  1N5Y B;  4X64 F;  4WE1 B;  4IOC Q;  1LKZ A;  4ELT A;  1KVI A;  3DI6 B;  3UW1 A;  2PEB A;  1S9F A;  4IKA A;  1R6V A;  1XR5 A;  3TOQ A;  3RAX A;  1R8B A;  1AYE A;  3HHK A;  2MKJ A;  4NI2 B;  2DNY A;  3HSJ A;  2UVU A;  1P1L A;  1YBT A;  3EVO A;  4N76 A;  5KG1 A;  3R3T A;  1Y3J A;  3TYT A;  5AE2 A;  4J9L A;  2KM8 B;  2JLF A;  4EGL A;  4IR1 A;  2VQF F;  1NAQ A;  3NGK A;  3PTW A;  2QTW A;  3D0G E;  1SL2 A;  1X0P A;  1NPR A;  5ETP A;  2XLI A;  1DTT A;  3MCM A;  4ECS A;  4NLO A;  3TP2 A;  3QJJ A;  5MAO A;  1MU2 B;  1SJ1 A;  3BGR A;  3VGU A;  3KLF B;  2OFH X;  4DV1 J;  2JFD A;  4CIO A;  4RBT A;  2N7C A;  4ZVS B;  4F4Y A;  1SQF A;  2BJ9 A;  2R7V A;  3NS7 B;  1U02 A;  3DGV A;  3DFE A;  2XZW A;  3FGV A;  4QYZ K;  2M52 A;  2OO4 A;  4OJ1 A;  1RP5 A;  3MFH A;  4TYB A;  4HYK A;  3MM5 B;  2HAF A;  2WHO A;  1B7Y B;  3CJT A;  2DRA A;  2QZ8 A;  3IM9 A;  4O4G B;  3MR2 A;  4TY9 A;  5JVG Q;  3D6T B;  4C0H A;  1SJR A;  3KJF B;  2KI2 A;  3R6G B;  4KSE B;  1ELO A;  1XNQ F;  4UTG A;  2K7K A;  1OSC A;  1IKV A;  4K4U A;  5B0B A;  5IC4 B;  1FTR A;  4EO8 A;  2VBX A;  2M0G B;  1PIL A;  4WYL A;  5KFC A;  2Z2Z A;  4B3T J;  1AFJ A;  1S6U A;  2ZNY A;  4I2P B;  4DCP B;  3IR6 B;  3O6Q A;  1TUW A;  4OHW A;  3QT7 A;  3M30 B;  1SKU B;  1D09 B;  4LT6 A;  1S6P B;  1WC1 A;  1PSD A;  1VQN S;  3E01 A;  2UUB F;  3ELH A;  1QUP A;  1RU2 A;  1QVG R;  2LXF A;  1KOO A;  3QGP A;  4YDD B;  1CJU B;  2HMI B;  5DGA A;  3H2V E;  1DQA A;  1VRT A;  1HW8 A;  2DYA A;  5FD1 A;  7AT1 B;  5E41 A;  1SJ3 P;  4F8R A;  1XBW A;  2MQN A;  2RDJ A;  1PYO B;  5KFL A;  4JV1 A;  4NWB A;  4OJG A;  2GGP A;  5KG3 A;  4ZIV A;  3G6Y A;  3I9V 9;  3IR5 B;  1OS5 A;  3NWG A;  3PG9 A;  4O3Q A;  4JV0 A;  5KFQ A;  1U1Q A;  3RW6 A;  4U96 A;  3U02 A;  4X66 F;  2MDA A;  2NSC A;  1WOS A;  2GVZ B;  2EFO A;  3I5C A;  2U2F A;  4PQU A;  2QL7 B;  4LRC A;  3MGJ A;  3R2D J;  4QYZ J;  4XPC A;  1JLG B;  1TMM A;  2EFQ A;  2EFN A;  3T19 A;  3J7Z 5;  2BE9 B;  5E0O A;  2A3J A;  4Y34 A;  3ENQ A;  3RB0 A;  3GSI A;  2CQ0 A;  2BKO A;  2V8G A;  4QBU A;  5CAB A;  3H5X A;  3UVJ B;  1NHK L;  1IBC B;  2IY5 B;  3H8Y A;  3IP0 A;  2XLK A;  1F9E B;  1FDN A;  1LV5 A;  4RKU C;  5LSR A;  1NDC A;  3LPE A;  3W9J A;  4UY8 5;  2D1C A;  4ID8 A;  1WKK A;  4WIQ A;  3J80 Y;  2E9Z A;  4USK A;  1X5T A;  3PIP Q;  2HVH A;  3U1N A;  2WTF A;  2Y8W A;  3TZY A;  1S1V A;  4X4S A;  3AY0 A;  1JIH A;  1KEK A;  2Z30 B;  3DOM A;  5D3G A;  3JAM Y;  1PYT A;  2ZBQ A;  2UZA A;  1RAE B;  5ETM A;  1NJY A;  1SQG A;  2SXL A;  4NLW A;  1WG5 A;  4R5P A;  1WHW A;  4K2J A;  4ZP6 A;  1R3N A;  2BE2 B;  4NRU A;  3O1L A;  3TAM B;  1WUU A;  2ZOG A;  4PPZ A;  3TAN A;  2BJ3 A;  4OZJ A;  3RB4 A;  1UWA A;  1RIS A;  1VCT A;  2HSE B;  4DUY F;  4Q2L A;  3UCZ P;  4OX7 A;  1TVR A;  4A48 A;  1N54 B;  3M8Y A;  4YFU A;  4HKQ A;  1A9N B;  5F8N A;  2HFO A;  4OI3 A;  3POT A;  5B08 A;  2UVW A;  5KFX A;  4RUH A;  2VA3 A;  1RE1 B;  2V5H G;  3K89 A;  5DZ7 A;  3MMA B;  3S1T A;  1OPZ A;  2NYI A;  2H54 B;  1Q5V A;  1NND A;  3CJ4 A;  3HUL A;  1CQM A;  3OT9 A;  1NHV A;  3ZZO A;  2VON A;  3MXH P;  2GIF A;  3F56 A;  3HFZ B;  4I1T A;  1QTN B;  4USJ C;  3L4B C;  3SDE A;  3OTC A;  1CC8 A;  5C25 B;  4EBE A;  1GEH A;  1X4G A;  3NNC A;  2RSQ A;  5FLX Y;  4QPX A;  2MGZ A;  3IRW P;  1U1P A;  3AOD A;  4OJH A;  4J9R A;  4ZCI A;  1ZYQ A;  3AD7 C;  3CW2 C;  1HA1 A;  4L74 A;  1TV6 B;  2YPZ A;  3DRR B;  4HTI A;  3W2W B;  5L46 A;  5HL7 Q;  3OUY A;  3T5H A;  1SH0 A;  2Y1J A;  1D9F A;  1H98 A;  2MSS A;  4EFA C;  3Q8S B;  1FDD A;  3RZA A;  1BE4 A;  2EVZ A;  2HK2 A;  2R42 A;  2V4Q A;  4DV7 F;  4WTY A;  4AL6 A;  5J1P A;  4OLP A;  2L08 A;  1ARO P;  1UWB B;  4TVA B;  4Y2K A;  1TL7 A;  1KFD A;  1U45 A;  4QCL A;  3SCI E;  1M1K T;  1N36 J;  2F1F A;  4ES2 A;  3BZQ A;  2LDI A;  2Z4P A;  4KIA A;  1S7H A;  3UI3 A;  2OPP A;  4EMD A;  1K44 A;  2C2N A;  2EG1 A;  2MKK A;  1FK9 A;  4F04 B;  2V50 A;  2XMU A;  2LXI A;  4ETZ A;  2YKA A;  3D6F B;  4UOH A;  3TQE A;  1RXO B;  1VQY A;  4CLW A;  8AT1 B;  3BJY A;  4CLU A;  2P9G A;  2YX1 A;  3TEH B;  1CLF A;  1WSR A;  3EX7 B;  2IJF A;  3VAH A;  2JEI A;  5IXU A;  1UZD A;  3TAR A;  2DGV A;  1FI4 A;  5AXK A;  3DLL Q;  4K4Z A;  2IYI A;  1RT6 A;  5ETT A;  2XS2 A;  2EG2 A;  2W9B A;  1Z1Z A;  3AXM A;  4MTP A;  1UWB A;  1ZTW A;  4ZPA A;  4DZD A;  2OEM A;  1EP4 A;  5HK4 A;  4X64 J;  1FKA F;  3ZTP A;  1S10 A;  4MKB A;  1MWQ A;  5JXS A;  3OSP A;  2CQ3 A;  4B3M J;  1H2V Z;  1EET A;  1HWJ A;  3D0I E;  3K8V A;  4KGM A;  1SV5 B;  4UOC A;  4DWI A;  4J9Q A;  4DR7 J;  2KM8 C;  2BM0 A;  1RT1 A;  3HI9 A;  2KJW A;  3JQJ A;  3M32 A;  4KGV B;  3GIJ A;  2VFU A;  5C2G A;  3BGF A;  5DO2 A;  3GV5 B;  4K4X A;  2V8P A;  4X4T A;  3BB5 A;  1UW9 A;  1OY6 A;  2OPQ A;  2WVC A;  5H1S V;  1AW0 A;  1CEZ A;  1QJH A;  2J8S A;  1N5Y A;  3DXS X;  2BQU A;  3H40 A;  1XMQ J;  3QIP A;  3BR8 A;  5LT5 A;  3MM7 A;  2OFG X;  1X4F A;  2R8I A;  3FCH A;  4DL3 A;  1CJV B;  3NCR A;  4KHP F;  2MJN A;  5T41 A;  1YZ6 A;  4QWB A;  1YSJ A;  1FTC A;  4K5S A;  3KOA A;  1GXL A;  3QYY A;  3OJS A;  3VQT A;  2HQD A;  4EBD A;  2VF3 A;  3R7S B;  2CPH A;  2G2Y A;  2Y1R I;  4NEY A;  4QW9 A;  2P9C A;  4X65 J;  4P2M A;  4OHY A;  4OX9 F;  2BZ2 A;  4J5O A;  1KQF B;  2ZH3 A;  2FLL A;  2A0F B;  1N56 A;  2OPS A;  3CDE A;  3LPY A;  1YZ7 A;  2DY9 A;  4YHH F;  1PC4 A;  3OTD A;  2RQ4 A;  2X51 A;  4Y0F A;  1J5E J;  2FHJ A;  1MW7 A;  3D54 A;  5AT1 B;  1VQL S;  4FXV A;  1WI6 A;  3UO0 A;  2HEK A;  5IT9 Y;  1LXJ A;  2AKW B;  3AQP A;  4U8V A;  2ZE2 A;  4RUC A;  2XMM A;  1RBO B;  3IBC B;  3RB6 A;  4X2B A;  1SB6 A;  3PDN A;  3CPW R;  4LRF A;  3A13 A;  4OZ2 A;  1D1U A;  1Y10 A;  3GG1 A;  2Z58 B;  3D1H A;  2EC2 A;  2HRY A;  5EWG A;  2RQC A;  2HIY A;  3QSI A;  1I3O B;  1IM4 A;  5J2P B;  2ROE A;  4O4R A;  5D8H B;  1DY3 A;  2RF2 B;  2MY7 A;  3IBW A;  2IFX A;  4IH7 A;  2H48 B;  4LF2 A;  2FQQ B;  3RAM A;  5KG7 A;  4LF5 J;  2CQ1 A;  2GJF A;  2MHN A;  2PSZ A;  3P4U B;  4C0O C;  4Z37 A;  4NA3 A;  3W62 A;  1WF2 A;  1R89 A;  4ENO A;  2QX0 A;  1ICE B;  2XEX A;  3ZTQ A;  3TX0 A;  2KRR A;  2V4R A;  4AL5 A;  2MST A;  3FKB A;  4KPC A;  1T9V A;  3D3C J;  1KSP A;  2JH3 A;  4FF4 A;  2HBQ B;  4F4A A;  1WC5 A;  2C3Y A;  3DHW C;  4M5N A;  1AFI A;  1S1W A;  2AJF E;  2F5G A;  4IYQ A;  3JSY A;  1UFK A;  4FDF A;  4M5L A;  5HBM A;  3NOC A;  1HI1 A;  4J90 A;  2XMA A;  3M8Q A;  5GAG U;  2X1A A;  3Q8Q B;  5DM6 Q;  2KZZ A;  2HFZ A;  4RWW A;  2CJA A;  2RS2 A;  3N6M A;  2BVZ A;  1MRO B;  7FDR A;  2MGZ B;  2QSF A;  4USH A;  1QE1 B;  3V6D B;  1J27 A;  2HQG A;  3F41 A;  2C3O A;  1VRT B;  1CVJ A;  3EZO A;  2N3O A;  4HHU A;  4USU A;  1HWI A;  5GAH U;  3CME S;  2D7S A;  1E6Y A;  1CJU A;  3CUL A;  5LJ5 Y;  1NHU A;  1U25 A;  3ICL A;  2WSE C;  2IHR 1;  3IWX A;  4MJK A;  1FRL A;  2E5G A;  4R5P B;  1BQM A;  1TK0 A;  1T7P A;  1RBL A;  1S6P A;  2HLU A;  4N77 A;  2W2N P;  4YY3 J;  1U2R A;  4ZPD A;  3MPU B;  5IV3 A;  5GME A;  4I69 A;  1X8D A;  4YEA A;  2D3O R;  5CH7 B;  1VQ4 S;  1V3Z A;  3BRE A;  5I3P A;  2D3O 1;  2ZOM A;  2K1R B;  4LVO P;  4NCG B;  4WFA Q;  2GFF A;  2JWN A;  3CCQ S;  2JL9 A;  5LMU J;  2PMH A;  1X0F A;  3PKM A;  4F50 A;  3BYR A;  1RI7 A;  2DD8 S;  4NLV A;  1Q78 A;  2CAD A;  3PRV A;  3PEH A;  1HWL A;  2XSJ A;  4OYA A;  5THW A;  4QIE A;  2UUT A;  3A8I A;  2B6A B;  4ZN1 A;  2KG1 A;  1PO6 A;  3R2C J;  2AGO A;  4PZV A;  2OPP B;  2OUG A;  2CUY A;  2RJZ A;  2CNN B;  4ILL A;  1PYS B;  4F0M A;  1HYS A;  4MKV A;  1JB0 C;  4KY3 A;  3BO3 A;  3CCR S;  1KBR A;  4ZP9 A;  2Y0B B;  4RW4 B;  2W9B B;  2HQF A;  3QFH A;  5AJ3 J;  2FGC A;  4RNM A;  3TNV A;  2FC9 A;  3A8K A;  5K20 B;  4LBP A;  2XGP A;  1IBL F;  2HWT A;  2DGU A;  3BH7 B;  1NH7 A;  3TUJ C;  3HMJ G;  3DM2 B;  4WU2 A;  3KHH A;  4FPR A;  3W2W A;  3OUY B;  4X4Q A;  1TAQ A;  1YI2 S;  1NDL A;  3K17 A;  3HHL D;  5FDL B;  3IGV A;  1IXK A;  3RYL A;  2IJN A;  5IT0 A;  1S0M A;  1U6F A;  3DOM B;  1FK9 B;  1C0U A;  3MWB A;  1FDB A;  2F9D A;  1FVS A;  3EXY A;  4H4M A;  4RW8 B;  5B0C A;  2HFU A;  3HT0 A;  5F8M A;  3G6X A;  3HK2 A;  2RQK A;  4OX6 A;  3FBE A;  5HQM A;  2QL9 B;  2BJ7 A;  1PJ6 A;  1VQ7 S;  3OW2 R;  4ZN3 A;  1ACM B;  4YB1 P;  3D67 A;  3GV7 B;  2JLG A;  2JVR A;  1PKU A;  2G0I A;  5A8K A;  3SZ2 A;  1X5S A;  4XK8 C;  2ERR A;  2BJ1 A;  2EK6 A;  2MQQ A;  2HNY A;  4K2X A;  2CWK A;  2CG4 A;  3MMB A;  3PYG A;  3W1Y C;  3IMQ J;  1RT5 B;  1LFP A;  2RRB A;  5M2P A;  2RHS B;  2UXD J;  2ADC A;  2YWG A;  4ED1 A;  4GVL A;  3GCW P;  2ATC B;  4NX9 A;  2GQ2 A;  2MKS A;  3WIU A;  4U7U D;  1O51 A;  1UL3 A;  1WG4 A;  2E1M C;  3DLK B;  5E2Q A;  4GKJ J;  2XYG B;  5BXI A;  4F0H A;  1H2T Z;  3MEG B;  2NS1 B;  2DKO B;  1OY9 A;  2BRL A;  3S7R A;  3GWC A;  3OHB A;  3VR1 A;  5D3G B;  1FRK A;  3B6B A;  4KGZ B;  5D0R A;  2PT0 A;  1UEK A;  3OQ2 A;  1XNR F;  3AOB A;  3KFW X;  3QFW A;  3KK1 A;  3DLB A;  4KC5 A;  2KH9 A;  1CS4 A;  1G3O A;  2VV5 A;  2IRX A;  3MR7 A;  2UU9 F;  2B9Y A;  2CZ9 A;  2E7V A;  5EHH A;  3JSM B;  1YRU A;  3CD5 A;  4F26 A;  1OPI A;  1U48 A;  3DDK A;  2W2O P;  4RNH A;  4DX7 A;  1WSV A;  3DLK A;  1BWV A;  2XMK A;  2AEJ A;  4EK2 A;  3RW7 A;  2OTJ S;  3PNI A;  2W4P A;  3KDO A;  2YWF A;  4I7F A;  3CCM S;  4ED6 A;  2C2E A;  1TK8 A;  4RW9 A;  3BPS P;  4H4K A;  4LR7 A;  5CYM A;  1FJC A;  2CPF A;  1S1V B;  2X1G A;  3NG8 A;  4FYX B;  4N7T A;  3LWL A;  4ED8 A;  1C1C B;  3D1Q A;  3P5B P;  5IT4 A;  5ITH A;  2DJW A;  1EZZ B;  4DV0 J;  1U49 A;  5F8H A;  4W4M A;  4HTJ A;  5BJR A;  1S0V A;  4F4W A;  1X4E A;  1DJ0 A;  2MQ8 A;  2DT9 A;  2YNG B;  3VAL A;  2FLP A;  2V6A A;  3IAS 9;  3TVZ A;  5J1E A;  1S6O A;  4DX5 A;  2PN6 A;  2R7U A;  1XER A;  1GMW D;  5AXM A;  2L9W A;  3DLG B;  4PG4 A;  1UVK A;  3DRS A;  2VPY B;  5E3R A;  4DV6 F;  2V8D A;  1EKS A;  1S12 A;  2H65 B;  2M7S A;  2PGC A;  4KYZ A;  2YKM B;  4LSN A;  1RSC A;  2V69 A;  4KAI A;  2Z56 B;  2K3K A;  3Q8Y A;  1WHX A;  4UST A;  3TX8 A;  3UCU P;  2UXC J;  2XC9 A;  2YQ1 A;  1Z2Z A;  3CIM A;  3UVJ A;  3CJ5 A;  2ZD1 A;  2LQ8 A;  2OGU A;  3R5J B;  4LJM A;  4QIG A;  3G8S A;  2HZA A;  2Q79 A;  4DR3 F;  1O5J A;  4OQJ A;  1YRX A;  3W5Y A;  4ZP8 A;  4TNO A;  4AQY J;  2PMZ D;  5J2N A;  3AHP A;  1VQO S;  3PFE A;  1K9M T;  3QAE A;  1OYE A;  1VDH A;  4J91 A;  4ZVH A;  4YME A;  1RHK B;  4TU9 A;  2R7W A;  4M94 A;  1XWL A;  2FIU A;  1OQ3 A;  2OD6 A;  3SIP B;  3V6J A;  4LF7 F;  3BN7 A;  3HSZ A;  3DOK B;  5LMU F;  2QMX A;  4NCB A;  4NYZ A;  4IFV B;  1VRQ C;  5CZV A;  1U4B A;  3HT3 A;  5A6P A;  4CH7 A;  1PBA A;  4B3R J;  1HBM B;  3LAN A;  3MPW A;  3PHT A;  4M5I A;  3VAJ A;  4PUO A;  3KXD A;  2R7O A;  2RKI B;  2NXN A;  4KH0 B;  1NRK A;  1YJV A;  4FPI A;  2Q6C A;  4J7C A;  4DV6 J;  3HHE A;  5J2Q A;  4A4J A;  3M30 A;  4F36 A;  2A6O A;  3SQG A;  4ZMM A;  2UVR A;  3H25 A;  2VJU A;  1QDU B;  4B3S F;  3BN4 A;  2UXC F;  1A7G E;  3DLJ A;  5ETQ A;  2DHG A;  4NZ6 A;  2LQB A;  3RBE A;  1IBK J;  4XDD A;  3HHN B;  3FBF A;  4E8U A;  5KT3 A;  1LW2 B;  1UVI A;  1XJW B;  1WWH A;  4NPO A;  2YKM A;  3I0R A;  4LSN B;  3VF0 B;  2VFS A;  3PXG a;  4OZN A;  5KT6 A;  2CJK A;  3UQS A;  2FJB B;  3NP5 A;  4IDK B;  3MM5 A;  2G9O A;  3UDE A;  1PAU B;  4BC9 A;  5ETK A;  2ZH4 A;  2HNZ B;  1X5P A;  2AZ1 A;  3CJ2 A;  3UD3 P;  1U1K A;  2B4P A;  3PEJ A;  5HJY A;  2F4V J;  4E2F B;  4XIU A;  4ANC A;  1C1C A;  4IG0 B;  5HMY A;  5HQL A;  1RWU A;  1BQX A;  3KLE A;  1FE4 A;  1JLG A;  3OL9 A;  1K8A T;  3J81 Y;  1HIY A;  2EEY A;  4I7F B;  5E33 A;  2ZM6 J;  1SJ4 P;  4I6W A;  2CNL B;  1ZPW X;  1ZPV A;  2QV6 A;  5FDL A;  2N4D A;  2ZH1 A;  1HNX J;  2JEJ A;  4I67 A;  1K0V A;  4M1K A;  2APO A;  1FWL A;  4U95 A;  2WBR A;  1VQS A;  3JYT A;  4LFC F;  3CO0 P;  2E9R X;  1VQP S;  2QN6 B;  2YXL A;  1RWV B;  4WF9 Q;  4C8M A;  2XSF A;  2NLW A;  2K3I A;  5KT7 A;  2HS0 A;  4B3O A;  2NXU A;  2CQG A;  3G2X A;  3H20 A;  4HDH A;  3L95 X;  4HR2 A;  4U9R A;  4JI6 F;  4HHJ A;  5FJ4 A;  1IN0 A;  2YKQ A;  3T5K A;  1UAW A;  2ZC4 A;  5L9N A;  4NCA A;  1N32 F;  3MUR P;  3WZ0 A;  4M95 A;  1ROF A;  3CMQ A;  1FHT A;  3C16 A;  4OI6 A;  4X66 J;  3DI6 A;  3MUV P;  1GXU A;  2RUS A;  2F7V A;  2ALY B;  3N01 A;  2JC1 A;  3G4S S;  5A76 A;  2VG7 B;  5I42 A;  1KLM B;  4GO5 X;  1R7I A;  2HGL A;  1UMJ A;  1RU1 A;  3PW0 A;  2X3D A;  2B5J B;  2GVD A;  3QPI A;  1LEO A;  2OHD A;  4L72 B;  1VIS A;  3MMB B;  2OH2 A;  1RT1 B;  1VHI A;  2WK4 A;  4TYA A;  4O0N A;  3BQ1 A;  2IDL A;  4FNH A;  4DV2 J;  1F5A A;  1TKX A;  1UCN A;  3B8H A;  2CPX A;  3VVU A;  1IBL J;  2V9W A;  1C0T B;  3V5R A;  2ACM A;  1IR0 A;  1BD6 A;  2YQ3 A;  1P1T A;  3HHL A;  3BR9 A;  3KJV A;  3MR5 A;  2V2V A;  4CO5 A;  2K06 A;  5KOX A;  5D4O A;  3M2R A;  4USM A;  1T3O A;  1PBU A;  2ZC3 A;  4DPU A;  4ZLP A;  1NJX A;  1HBN B;  4L73 A;  4C48 A;  2CPJ A;  3OVB A;  2LP4 A;  1S57 A;  5D4L A;  1FRI A;  3KHR A;  1WTB A;  3IN5 A;  2PMW A;  3Q22 A;  2ZDO A;  3CWJ A;  3UDV A;  2BOA A;  4C3M A;  5HBM B;  2CQ2 A;  4MH8 A;  2IM0 A;  5A6W A;  2I1R A;  1WEZ A;  2DNN A;  3NCP A;  1FKO A;  2KO1 A;  3O5T B;  5KG0 A;  5DDQ C;  4DR3 J;  1NDK A;  2ZIT A;  4M5J A;  4QYR A;  3T1Y J;  2NZ4 A;  5KFV A;  2H5E A;  3ZNU A;  2HWI A;  2GX8 A;  2G13 A;  2RS8 A;  2VPW B;  2ZBP A;  4M8L A;  4DFK A;  2FDN A;  3R27 A;  3Q89 A;  5LMN J;  1SKR A;  2ALZ A;  3NWR A;  2GIR A;  3DMJ B;  1UEU A;  2BUN A;  5L1L A;  2B6A A;  2B0G A;  2KZM A;  1KTV A;  2PD1 A;  1REG X;  2WB4 A;  2D69 A;  3OJU A;  2YNI B;  4QR2 A;  1N6Q B;  4B9U A;  1S9E B;  4NZ7 A;  1HAR A;  3OBI A;  1TL5 A;  2AYM A;  5DET A;  3R6L B;  2KFZ A;  3GJS B;  1GXT A;  1RCX B;  3UNG C;  2V2K A;  2J9D A;  2IM1 A;  4I4B A;  3LWM A;  3QID A;  2W9C B;  1RWN B;  3MAA B;  2L41 A;  3MM8 A;  4N47 A;  5C25 A;  3VVT A;  2GQC A;  4RNF A;  1O6X A;  4KHM A;  4K0K F;  4WFN Q;  3HKZ D;  2DNR A;  1LW0 A;  3B54 A;  1IUJ A;  2VC0 A;  4LFB F;  2HS3 A;  2V94 A;  3KYL A;  1JK9 B;  3ZNJ 1;  1TL3 B;  1BY9 A;  3TA2 A;  4DSJ A;  1K1S A;  4IH6 A;  4ECR A;  2DBB A;  5ETS A;  1A6L A;  4ZLL A;  1HHQ A;  5DG8 A;  2VHG A;  4I2Q B;  3BS9 A;  2EW9 A;  4KHR A;  2EFV A;  5BYS A;  4FYY B;  9ATC B;  1TVR B;  3CCV S;  3CE8 A;  4R25 A;  4HT5 A;  4WXW A;  1K1Q A;  2YH1 A;  2XM3 A;  1DRZ A;  3IGN A;  4AL7 A;  2J8A A;  3C6U A;  4UOG A;  3MAA A;  2V2Q A;  1TEL A;  3C6T A;  4NLT A;  4MIB A;  3UNY A;  3I6P A;  4H4M B;  4DSE A;  1FO1 A;  1JJ4 A;  2MYF A;  3DDN A;  3OL8 A;  4DR5 F;  3DDI A;  5A8W B;  3KKF A;  3R5G A;  1HBU A;  4ZVU B;  2YNF A;  3M7V A;  5HO4 A;  4C6A A;  4YB7 A;  3RBX A;  3VAM A;  1NK4 A;  1ZAV A;  4AQY F;  1PG5 B;  5KFG A;  2QFJ A;  2HVI A;  1RTJ A;  3HVW A;  1U1L A;  3DMJ A;  1UVL A;  1IJE B;  1AZS A;  1YIT S;  2M2B A;  2KHC A;  3THT A;  2M4M A;  1TKT A;  2MMY A;  1U0H B;  3EMT A;  3VGV A;  4Q45 A;  5IM0 B;  3FJ2 A;  4OHZ A;  5KFJ A;  5CZX A;  4TY8 B;  2R9L A;  4U7U K;  2J5A A;  3OVA A;  1LWE B;  1FXR A;  1YJ7 A;  5KFF A;  4LF9 F;  1UJ4 A;  2PC6 A;  3MD3 A;  4UZC A;  2EXU A;  3MR3 A;  3UD4 P;  3V4I A;  4DQI A;  3NLC A;  2V2Z A;  4JV5 F;  4L75 A;  3RGI A;  4DR7 F;  1T11 A;  2E1P A;  4DEZ A;  3EGV A;  4DZ6 A;  3OLB A;  3D7S B;  2CJY B;  3NGS A;  2IYG A;  3OD2 A;  5L1I A;  3PX0 A;  4ZA1 A;  1DTQ B;  1VGY A;  4PWW A;  2O3D A;  3AXK A;  5F0U A;  3FEY B;  5A0Y A;  4DN0 A;  3CXC R;  5JVH Q;  3RAQ A;  3DLH A;  4A8F A;  4S0M A;  4FXW A;  1RA6 A;  4CT9 A;  3MAQ A;  2YY3 A;  4C11 A;  4DV3 F;  2G4B A;  1TAU A;  4XTT A;  4LBI A;  3PFO A;  2KFY A;  2J9D E;  2CJQ A;  1TMJ A;  1FKP B;  1Z4U A;  2WOM A;  3DOL A;  4RLE A;  4WFZ A;  1N48 A;  4GKK J;  1V6H A;  3VAF A;  2W4D A;  1JLB A;  2HK3 A;  2N7Y A;  2DK2 A;  5KG5 A;  2BX6 A;  2YWW A;  1VRU A;  4CM0 A;  2VFR A;  3M8P A;  2PII A;  4NML A;  4F2S A;  3LAM A;  3PJX A;  4ICL A;  4WXO A;  1HQU B;  4ZHR A;  4LF9 J;  2FPH X;  1E6V A;  2VG7 A;  2W9C A;  5KFW A;  2AGP A;  1MN7 A;  4LRD A;  3N6L A;  2UUA F;  2IDE A;  4ELU A;  3L9Z A;  4IQM A;  4LFA F;  2W2M P;  2GO9 A;  4DR2 J;  3HSD A;  5CXT A;  3DU6 A;  4ZCL A;  3U27 A;  2LQ5 A;  1TKZ B;  2C2R A;  1VHF A;  2RIL A;  3IAM 9;  4HAC A;  1FX2 A;  1TR0 A;  1HR0 J;  1JWW A;  2VG5 A;  3QAU A;  3QT6 A;  2JSX A;  4NE9 C;  5ETV A;  3PYD A;  1S1T A;  5HAN A;  5T7L B;  4K4W A;  1RWX B;  4ZS6 A;  1S0N A;  4YQW A;  2D74 B;  1ZZN A;  3SMZ A;  5GAE U;  2F9J A;  3AA8 A;  1FKO B;  3WIV A;  2J76 E;  2Z2Y B;  4OV1 A;  3AFG A;  4GVB A;  2DNP A;  3K7R A;  3R5B A;  1YLX A;  2CG8 A;  2E66 A;  3FFI A;  2KXN B;  1GMW A;  4FS1 A;  2F8H A;  2C2M B;  3WDO A;  1VIX A;  2R3V A;  4CLF A;  3DU5 A;  4ZPW R;  4TXS A;  4ZIW A;  4JI7 F;  5A2Q Y;  4C4W A;  2OJ3 A;  1ITP A;  1UA0 A;  2JNJ A;  4PCQ A;  2YPY A;  5CQG A;  4DL5 A;  3GMG A;  1ZM9 A;  2XI2 A;  2UUA J;  1FFG B;  2CXE A;  4JYA F;  5ETO A;  1WNE A;  3AOC A;  4YDX A;  2B56 A;  2NPF A;  4A8W A;  4JI1 F;  1Y4Z B;  1SH2 A;  4ID5 B;  3SCJ E;  2RIJ A;  5BYQ A;  3X3U A;  4XO0 A;  2FVP A;  2UXB F;  1B64 A;  3VV2 B;  1S48 A;  1U47 A;  2MZS A;  3FBB A;  1BWE A;  3O3L A;  1QVF R;  3PYE A;  2NCK L;  2XMW A;  2MZ1 A;  4Q8E A;  4DR4 J;  4ZVE A;  2DXF A;  2MY8 A;  2H5J B;  2HVE A;  3HZE A;  3BO2 A;  2I2Y A;  3GCX P;  2ZVS A;  4C3K A;  3HM9 A;  2J0W A;  4PG7 A;  1RHQ B;  4NA2 A;  3A4T A;  3AJD A;  4B9L A;  3ZTR A;  3D28 A;  5EN1 A;  1SVD A;  1XK8 A;  3GZ7 A;  1H7X A;  2VDH A;  4RW7 A;  4Q5V A;  4ES3 A;  3SCK E;  1H7W A;  1URR A;  1OIA A;  2XY5 A;  2L3M A;  2RB7 A;  1RAJ A;  4N8N A;  3T9N A;  1KHV A;  2B5J A;  3BSC A;  2G1H A;  4I64 A;  3W65 A;  5C2C A;  2H51 B;  3P3D A;  4P75 A;  2KRB A;  1SI9 A;  4WFB Q;  2ZHB A;  5J2Q B;  5CYQ A;  2E9T A;  5GAH I;  2J0S D;  1SJF A;  2WVF A;  3M2V A;  3QMQ A;  2HFS A;  3B4M A;  3LH2 S;  1Q82 T;  2DPI A;  1NH8 A;  2AIR B;  1FVQ A;  2LA4 A;  1H3D A;  4P74 A;  2FLN A;  4K8R A;  3I4P A;  1WG1 A;  3KG4 A;  2M70 A;  4DG1 A;  4WE1 A;  3QRP A;  5KT4 A;  1F3F A;  1ULR A;  2FD2 A;  3LGH A;  4OYO A;  4LF8 F;  3VAK A;  4DFJ A;  2AZ3 A;  3G86 A;  2XCA A;  4B3M F;  1D3W A;  1JLB B;  5ETN A;  1UVM A;  3QRR A;  5KFB A;  1VI7 A;  2BE2 A;  2H5I B;  5J2N B;  2UUB J;  3FEZ A;  2LA6 A;  5L38 A;  2AJ0 A;  2LFV A;  4BHQ A;  3I96 A;  2GHP A;  2XYH B;  2HNZ A;  4P71 A;  3JXO A;  3VGT A;  5C7P A;  2W25 A;  1EQ0 A;  3CNQ P;  3HZG A;  3KLH A;  2PFD A;  3BSA A;  1Q95 G;  4ZPC A;  3IG1 B;  5EWE A;  1LWF A;  4OYZ A;  3A8J A;  1P6T A;  3A1Y G;  4F25 A;  4QWA A;  2BAN B;  3Q0A A;  1AB8 A;  3CJ3 A;  3I0S B;  3IS9 B;  2HFV A;  2QLF B;  4NLU A;  4X62 F;  5U47 A;  1RTD A;  4UF4 A;  3AA9 A;  3NAI A;  3FQL A;  4KJI A;  4MFB B;  3BGO P;  2HHT A;  4Y65 A;  3H2U B;  1B0P A;  3CJQ A;  3LP2 A;  4TY8 A;  4BCA A;  2LEA A;  2C1E B;  3W66 A;  2DO4 A;  2HQ3 A;  3LTO A;  5B0A A;  2OTL S;  3PO5 A;  3MD1 A;  2VDI A;  3NMA A;  2DGO A;  2L48 A;  3V4M A;  2QEX S;  1X9S A;  4LFB J;  4JI5 F;  4OMF G;  4LIW A;  3M6X A;  3VAG A;  1MU2 A;  2EFP A;  2GMH A;  3BGR B;  5DDP C;  1LWX A;  1IQZ A;  2BV3 A;  1FDA A;  4OI1 A;  4EEY A;  3CC7 S;  5E3Q A;  3K8W A;  3GG0 A;  1T8E A;  3H4B A;  1HHT P;  3M2U B;  2AJ1 A;  4NL5 A;  1PAE X;  1CC7 A;  3PZP A;  5HP1 A;  2ZBR A;  1RCO B;  4BDP A;  3DYA B;  2HQC A;  5L1K A;  2HHS A;  2CDR B;  2E44 A;  3PCO B;  2HHH J;  1QAY A;  3ZZR A;  1HD0 A;  2CZV C;  3SQO P;  1IKY A;  4DLG A;  3G6V A;  4DF8 A;  1KHW A;  4IFY A;  4PWU A;  1FRX A;  5EWF A;  3W2V A;  2MKC A;  2DR8 A;  2HYI B;  1T3N A;  2KVQ E;  1VQ6 S;  1VJQ A;  2C2D A;  1DHM A;  3A3O B;  2V8H A;  3W5X A;  2O67 A;  2V68 A;  5B0D A;  3T1H J;  3H7H B;  1LW0 B;  2QT7 A;  2AEF A;  3OFE A;  4MK8 A;  4D3H A;  2NQP A;  3R7B B;  4YY3 F;  3QWU A;  2DGX A;  1W2I A;  5IOL A;  5CYJ A;  1RTH A;  3FSY A;  4HH0 A;  2L9N A;  4NLS A;  1NUE A;  3EVW A;  2WON A;  1YTY A;  2QMU B;  1F2H A;  3FUY A;  5DZ6 A;  1U0S A;  2GQQ A;  4YOE A;  1EAY C;  3KDN A;  4LF4 J;  4ZLN A;  4IFY B;  4QWC A;  1I5O B;  1HFE L;  2HLT A;  1IKY B;  1YJT A;  2HND A;  2FC8 A;  1DLO A;  3HHD A;  3M1V B;  4M63 A;  4F3Q A;  1BGX T;  2R8H A;  2I8E A;  4B9M A;  3FSI A;  4EYI B;  3JTP A;  4DV5 J;  2ZZN A;  2HBZ B;  4JI2 F;  2NUH A;  4N5S A;  2HHH F;  1FNO A;  4CLS A;  4K4T A;  3AT1 B;  3QO9 B;  1C0U B;  2IBO A;  1MWZ A;  3D3B J;  3EZU A;  1ZAW A;  1F5C A;  2VOD A;  3IA0 A;  2D3Z A;  4AXJ A;  1H2U X;  2DEJ A;  4EO6 A;  1NB2 A;  4EI2 A;  1NME B;  3TRG A;  1KQS R;  3W8G A;  2AW0 A;  2ZD1 B;  2MLX A;  2BAB A;  2HFN A;  2AEM A;  4GMK A;  1KS2 A;  2CJB A;  1EHW A;  5CYM B;  4NA1 A;  3G82 A;  1DBD A;  4AD6 A;  2V8V A;  2F65 A;  2WVB A;  3UR0 A;  2ZM6 F;  3SI8 A;  1N88 A;  2ABY A;  1QLN A;  2FVS A;  2V34 A;  2LLZ A;  2HBR B;  1Y5I B;  2AV5 A;  2MPU A;  3FEX B;  1FD8 A;  3HD2 A;  4CCH A;  4OL8 A;  1QSS A;  1WEY A;  1NDP A;  1NSP A;  2G2Z A;  3MM6 B;  3E2E A;  3NL0 A;  2XS5 A;  5C42 A;  4IUF A;  2BRK A;  4DV5 F;  1VC5 A;  4QIW D;  4N41 A;  3SCL E;  4CNZ A;  3U7J A;  1J5O A;  3F0N A;  3UN2 A;  4P6Q A;  4WJB A;  4ZJQ A;  1N0V C;  2VKR A;  3FCW A;  1YVF A;  2VJV A;  4I2P A;  3AAW B;  1WDT A;  2DHX A;  3CD7 A;  3UCG A;  4HEA 9;  3SFU A;  2N82 B;  2LYV A;  4Y2I A;  4ECX A;  3Q2T C;  3RB3 A;  3M6U A;  2JRS A;  1JLE B;  1U6B A;  4CH0 S;  1GFW B;  3I5B A;  4DL2 A;  2DHH A;  3VZH A;  2BJ8 A;  4DR4 F;  5HP1 B;  3BBC A;  4IOB A;  2CQH A;  2E5H A;  4CH1 A;  2GA7 A;  3R9L A;  1RUS A;  3CMA S;  4P10 A;  4BBY A;  1MN9 A;  1NKE A;  2GMJ A;  2CNO B;  3M2V B;  2GHW A;  2MQO A;  4RU2 A;  4EZ9 A;  1HQ2 A;  2CAJ A;  2DCL A;  5IQQ A;  3BV8 A;  1U1N A;  2QA2 A;  2FVQ A;  2W01 A;  4ZHR B;  5KOW A;  3DRP A;  3KLF A;  1TQL A;  1U7L A;  2RML A;  1JLQ A;  3HSG A;  5IC6 B;  4WCE Q;  3HP6 A;  2AU0 A;  1I94 F;  2HIQ A;  1G4C A;  2RVJ A;  2ZH7 A;  2AJ2 A;  2KL8 A;  3JSB A;  4DHV A;  3GFX A;  3Q8R B;  2DRD A;  3OHA A;  2BR0 A;  1T05 B;  1FF2 A;  4UUX A;  2VOP A;  2HHX A;  2XYP B;  3ZZU A;  1YQH A;  1N5Q A;  3KTQ A;  4ID5 A;  2M88 A;  2B8P A;  3N28 A;  4CQ1 A;  4CYU A;  4F3O A;  1Y9O A;  2VC1 A;  4OZ0 A;  1R27 B;  2A18 A;  2QL5 B;  4Q2M A;  5K9F A;  4C11 B;  3R1H A;  1GNK A;  4ZKA A;  1VK3 A;  2I5J A;  2VG5 B;  3E8O A;  3LAL A;  4I0W A;  4NI2 A;  5KFE A;  2BJD A;  3RRK A;  5BR8 F;  1YJW S;  1L3T A;  2RD5 C;  5F0W A;  4CP5 A;  1WHV A;  3TI0 A;  1S7I A;  2LU2 A;  1P8G A;  4YB6 A;  4JI0 J;  4NLY A;  4OI2 A;  2JC0 A;  5F8G A;  1HBU B;  3IWN C;  3M2R B;  5L9X A;  4DSF A;  2XSJ B;  5D77 A;  3C15 B;  2O66 A;  1JXV A;  3FFI B;  3K2Y A;  4Z7C A;  4DFM A;  4W90 B;  2HGM A;  2IAJ B;  4CLZ A;  3M9M B;  5J2M A;  1RT7 A;  4ZK7 M;  2ASJ A;  1LOU A;  3DM2 A;  2QA1 A;  3HF5 A;  3JQK A;  3MTK A;  4AXI A;  2W8K A;  4NCG A;  2XHC A;  3BSN A;  2YX4 A;  4C97 A;  1VBK A;  1BUX A;  3GFH A;  5K8N A;  4JI4 J;  2VL1 A;  1RLC L;  3VAI A;  3KWM A;  4YR2 A;  3FSX A;  3M9N B;  2QSW A;  2VBZ A;  4WZQ A;  4HAC B;  2A6M A;  2YH0 A;  1RTJ B;  3DXB A;  2JDJ A;  4OHV A;  1MG7 A;  4DV1 F;  2M5Y A;  4PPD A;  2LEB A;  4LF4 F;  4RNN A;  2XO6 A;  3D4J A;  3BKT A;  1DAX A;  1Q5Y A;  1QAX A;  1SPB P;  4RPF A;  2E7W A;  2F3J A;  4CO1 A;  4CLK A;  3KMS A;  1T03 B;  3WC2 A;  3M8Q B;  4A8M P;  4USW A;  1TL1 A;  1CJV A;  5A0Y B;  4OYW A;  1LK7 A;  1LQ9 A;  1S97 A;  4MKA A;  4ZIT A;  1RHM B;  1QE1 A;  2QG9 B;  2Y3Y A;  3FVY A;  5HVG A;  1MRO A;  4JI0 F;  4PQA A;  4RW6 B;  3KNG A;  3DHX A;  3P96 A;  3V6D A;  1CQN A;  4H4K C;  2CPZ A;  3GP9 A;  3KHG A;  4DQP A;  3K0J A;  1WC6 A;  4G1P A;  1FRJ A;  5GAD I;  1U8S A;  2CFX A;  4ZVQ B;  2IBK A;  2XWY A;  1GTH A;  2B9E A;  1EB0 A;  2DXD A;  4LSL B;  4ZOS A;  3MPY A;  1IR1 A;  3OFG A;  4NLD A;  1NSK L;  4NOH A;  4XDC A;  3G8Q A;  2YKN A;  3MUT P;  1S6Q A;  4ELV A;  3A12 A;  2VAS A;  4KGK A;  2G0C A;  3T1Y F;  2FLO A;  1P9Y A;  2NXJ A;  2F4F A;  3I82 A;  5D4P A;  3THP A;  3UR3 C;  3VHQ A;  3JAM U;  3MUM P;  3H42 A;  2DNM A;  3HDS A;  3KLV A;  4DQR A;  1NJI T;  5KFM A;  4QWE A;  4JI7 J;  3AD9 C;  4OYP A;  2NRE A;  1NZ8 A;  3KLE B;  2E5L J;  4KGX B;  1DUR A;  5LJ3 Y;  2K7J A;  4FS2 A;  2H4Y B;  3SV4 A;  1KVK A;  1XEZ A;  4ED2 A;  5A8W A;  2P2C B;  3ZFV A;  5HRO A;  4I6Y A;  5KFY A;  3QGH A;  3UD5 A;  4DR6 F;  4DV3 J;  2AJQ A;  2FHO B;  5BYR A;  3OSN A;  1FRH A;  3L7O A;  1NSQ A;  3JB9 k;  4E98 A;  3GIK A;  1R0C B;  3MMC A;  1X9W A;  2A10 A;  2UXB J;  3R5C A;  2C3M A;  1X4D A;  2K1R A;  2Y1L B;  2HHW A;  5H9F K;  1S79 A;  2O01 C;  2I38 A;  3GFZ A;  5A8R A;  1JNR B;  1SJQ A;  2QYG A;  1HI0 P;  2K8G A;  4WTO B;  5IM0 A;  2J9E A;  3VZI A;  1W2B R;  1NEE A;  1X60 A;  4RW4 A;  3MR6 A;  4CLT A;  4GVB B;  3NKY A;  4R0J A;  3UN5 A;  5AE3 A;  5E3C A;  2ZHA A;  1YIJ S;  4UUW A;  3W9H A;  1GMV A;  5C5J A;  1L3K A;  4QR1 A;  2VA2 A;  2CQD A;  1QSL A;  1S1T B;  4N56 A;  4ECT A;  3EDR B;  2OSR A;  1Z2L A;  4DDF A;  3BDP A;  1W26 A;  5J1N A;  3HD1 A;  5KFT A;  1S1X B;  1SIW B;  1HMV A;  1U2C A;  4B17 A;  4DCO B;  2LEP A;  2KJV A;  4I6A A;  5I4M A;  5KFP A;  1NKB A;  4Y2M A;  2YWK A;  2ZZT A;  1B3T A;  3C3L A;  1S77 D;  2R7T A;  2PI4 A;  2IIH A;  3MEE A;  5DM7 Q;  1ZM4 A;  4M5D A;  4YB5 A;  5KG4 A;  5HLF B;  1GMU A;  1KC8 T;  1HL6 A;  3OTO J;  3IBF B;  5KFU A;  1UVJ A;  2I0X A;  3MCN A;  1SV5 A;  4DF4 A;  2RRA A;  2MQP A;  3MM7 B;  4B9N A;  4JV2 A;  3HVT A;  4UY8 T;  2IM2 A;  4DS5 A;  3BH6 B;  3QZ8 A; 
#chains in the Genus database with same CATH homology
 3EJM A;  3BBB A;  3ZTP A;  1PAE X;  2B8P A;  2DYA A;  1XIQ A;  1W7W A;  3Q89 A;  2DXE A;  1NPK A;  3Q8U A;  4CP5 A;  3BH7 B;  4F36 A;  3DKD A;  3FCV A;  1NDL A;  1WKL A;  4W98 A;  1JXV A;  3ENA A;  3PJ9 A;  2VU5 A;  3FBF A;  5IOL A;  3VVT A;  1NCL A;  1U8W A;  3FBE A;  1NUE A;  3EVW A;  1XQI A;  1BUX A;  3WX8 A;  3B54 A;  1WKJ A;  1S5Z A;  3FBB A;  4FKY A;  4UOF A;  5CAB A;  2NCK L;  1NHK L;  2DXF A;  1HHQ A;  1PKU A;  2HVE A;  1NDC A;  3Q83 A;  2ZUA A;  2DY9 A;  1WKK A;  2CWK A;  3EE3 A;  3ZTR A;  1VYA A;  2AZ1 A;  3NGU A;  1KDN A;  4UOG A;  4AND A;  4ANC A;  3VGS A;  3Q86 A;  3ZTO A;  3FC9 A;  1NB2 A;  3DDI A;  1HIY A;  4ANE A;  5BXI A;  3ETM A;  3GP9 A;  4C6A A;  2BEF A;  1EHW A;  3B6B A;  2DXD A;  4DUT A;  3FBC A;  3EVO A;  1NSK L;  3EMT A;  3VGV A;  3GPA A;  4WBF A;  1F3F A;  3ZTS A;  4ENO A;  3EIC A;  3ZTQ A;  3G2X A;  2AZ3 A;  3FKB A;  4HR2 A;  1NDP A;  4KPC A;  1NSP A;  1F6T A;  4EK2 A;  5CAA A;  4F4A A;  2B8Q A;  4DZ6 A;  3NGS A;  1HLW A;  2HUR A;  3VGU A;  3JS9 A;  1BHN A;  1B4S A;  1NSQ A;  3VGT A;  5C7P A;  3FCW A;  1B99 A;  4FKX A;  2HVD A;  4S0M A;  3MPD A;  1LEO A;  1ZS6 A;  3EVM A;  4DI6 A;  1BE4 A;  3BBF A;  3L7U A;  3NGT A;  3Q8V A;  4O0N A;  3EM1 A;  3VVU A;  1UCN A;  1NLK L;  2BX6 A;  3BBC A;  3Q8Y A;  1K44 A;  3R9L A;  1MN7 A;  1MN9 A;  3NGR A;  4UOH A;  1S57 A;  1S59 A;  3ELH A;  1LWX A;  3PRV A;  1NDK A;  3BH6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...