3KUHA

Crystal structure of e. coli hppk(h115a) in complex with ampcpp and hp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPAYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Roles of residues E77 and H115 in E. coli HPPK
rcsb
source organism Escherichia coli
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3kuhA00
3ILJA 3KUGA 2F63A 1TMMA 3HCXA 4M5MA 1DY3A 1F9HA 1HQ2A 3HSJA 1IM6A 3HSDA 5ETKA 1Q0NA 2QX0A 3IP0A 1EQMA 3UDVA 3HSGA 2F65A 1CBKA 1RAOA 4M5GA 5ETRA 4M5IA 5ETTA 3QBCA 5ETSA 5ETVA 4PZVA 1G4CA 4M5LA 1TMJA 1RB0A 3HSZA 1RU2A 5ETNA 5ETMA 1RTZA 3HD1A 4F7VA 3ILOA 4M5JA 5ETQA 4CYUB 1HKAA 3HT0A 3UDEA 3HD2A 2BMBA 4M5HA 4M5KA 4CYUA 4M5NA 4CWBA 4CRJA 2CG8A 1KBRA 3KUHA 1EX8A 3ILLA 5ETPA 5ETLA 3ILIA 3KUEA 1RU1A 1EQ0A 3MCMA 4AD6A 3MCOA 3UD5A 5ETOA 3MCNA
chains in the Genus database with same CATH superfamily
4C11B 1KDNA 2ZZNA 1BWVA 2XGQA 3FEXB 2M88A 4DF8A 4KKOB 5HAOA 3TA0A 1M5OC 4WZMA 4CLSA 2BV3A 2ROPA 3PX4A 2V4JA 1YBUA 3IC1A 2HLUA 4WFAQ 3DM2A 1D09B 5HMZA 4B3SJ 4DV1F 3DOLA 2L9DA 1UVKA 2DGOA 5IC4B 4R5PB 2BMBA 1GQEA 4LF5F 1Q86T 4LF9F 5LXRA 4LF6J 3LAKA 1IKXA 2LEAA 2QL7B 4RUAA 4C8ZA 2JVOA 2DEJA 1RE1B 2W24A 2FPHX 4OYBA 2VC1A 4X64F 4EGLA 2CQBA 1K44A 4DV0J 3HHLD 2LQ8A 4RW7B 1KLMA 2OPRA 3OR1B 1B99A 4HYKA 1GEHA 1ACMB 1FEEA 4OJGA 4ZK7M 4RUCA 1R43A 4LVOP 3D0HE 2R2RA 5DZ7A 1PCAA 4LSZB 2CA9A 1B4SA 5HBMB 1UVMA 2W7PA 3IP0A 2Y9HA 3GJSB 4L76A 2HWHA 1RTZA 1P1LA 4F4KA 2Z0GA 4J91A 3MM5B 2Y1IA 1YBTA 1NMEB 2E1PA 1VOMA 3I5AA 4P52A 4OI1A 1T02A 1NKCA 4LFAJ 3OFGA 1OSDA 3OD2A 1NPKA 3QO9A 4DX5A 3SZ2A 4CTAB 1K1SA 4DV4J 4PXBA 3DI6A 3SCLE 9ATCB 3VGUA 4DL4A 4XAKA 4OHWA 2NSCA 2ZD1B 1T03B 1ZA1B 4B9VA 3A8EA 2Z30B 4NA2A 1FE0A 4DSFA 1LWFB 4U95A 2R4FA 2LU1A 1C1CB 3GG0A 3A3NB 4OI3A 3NKYA 3HSJA 2FJBB 3K59A 2KFZA 2HYIB 2WB4A 3G2XA 3BKUA 1EIYB 3CF5Q 2FD2A 2XM3A 4DR2J 4CNZA 1JJ2R 3HPOA 1VRUA 3A8JA 3VGVA 5G4DA 3PO5A 5U47A 1KSPA 4EU0A 1TL1B 2WVFA 1DY3A 1NO8A 2ZUAA 2FYXA 3U27A 2W9BA 5K8OA 4QYZJ 5IT0A 3H4DA 3CCLS 5F8GA 4PZVA 3DOKB 2EPIA 3I87A 3PTWA 2ZVIA 1UA0A 1F1BB 2AEMA 2IDEA 2Q43A 3H5XA 5DGBA 2N82B 4Y34A 2OUGA 2V2VA 1X4CA 5CYMB 2G1DA 3SQGA 2HFNA 2GJIA 2JLFA 1UMJA 2EBEA 5LSLA 3EE3A 5ETPA 2QJ3A 4ICLA 4ZP8A 5F3TA 1IUJA 1RSCA 2CVEA 4URQU 1F2HA 2G2ZA 4LT6A 4IFVA 2BW7A 4TN2A 3UNGC 2DJWA 3DU5A 2QRRA 4MYUA 4ZVTB 2O3DA 3UPFA 5D3GB 4LF8J 1X9WA 2HGLA 4ED4A 3DDKA 3PHTA 1RAEB 4Y2MA 3MMCB 2HHQA 1BXNA 4FXVA 4RBVA 3FBCA 3FMWA 5A76A 2FVPA 3PJ9A 3R5JB 3IGVA 2E5LJ 2LU2A 1GT8A 2GX8A 2X3GA 5J2PB 4K7QA 3Q22A 5HN0A 3MUVP 5G0RA 3ENWA 4RX6A 1SJQA 3WC2A 3DYAB 4RW6B 4YY3F 1NJYA 4JI0J 4WJBA 2PGCA 1RAGB 1X4GA 4DV5J 3VZHA 3MM7A 2JEIA 4B3RF 2XSFA 2NXUA 3ET6B 4ES3A 1M5SA 3VF0B 4Q8FA 1FJ7A 5J2QA 1UW9A 3CDAA 4U6PA 1FKPA 3NCQA 4EBEA 4KGXB 3MPUB 1CJUA 1EETA 1LW2B 5EUHA 1XR7A 1Z2LA 1IWGA 2D1CA 5D6GA 2XSJA 3I6PA 2MYFA 3NMAA 2MKYA 3LP0B 4GKKF 1TAUA 1UEKA 5KFWA 3MEEA 4F26A 2J8AA 5K20B 2AX0A 2NUHA 3EXCX 1ZM9A 2FVSA 4DV3F 1VQ7S 3CDBA 2R42A 3IG1B 2B56A 4LSLB 2KM8C 5DO2A 3LANA 2GQ2A 5KFOA 4CO3A 4CLWA 2C2KB 2CUYA 4K2JA 3JTPA 3GB0A 3QWUA 4DCJB 2NS1B 3NMRA 2X1AA 2K06A 4Y6IA 4DU8A 4ZIWA 2DNZA 1SC1B 1HW9A 3CJ2A 1EKRA 2AGQA 5CCLA 3DMJA 3P5TL 3MD1A 2DNHA 1KONA 3JXOA 1SH2A 3F44A 3CJ5A 2JJ4D 2HS4A 2XC9A 3C19A 2CQPA 4KR0B 2FLPA 3W8PA 1S1VA 1K0TA 4G1QB 4LBIA 4BWMA 4ZPDA 1RAFB 1KVKA 1GXUA 5KFPA 1T8EA 2R9LA 2VOPA 3NGRA 1XNRF 1VQYA 1NCLA 2VONA 3ETMA 4R0EA 2ZDOA 2U1AA 1BQXA 2ILZA 3MCSA 1NU4A 3RJMB 4EYIB 2RILA 2OPPB 3BS9A 2V9KA 2RE1A 2KT3A 2F9DA 4KY3A 3DHXA 1LQ9A 1TL7B 2MQ8A 3H8YA 4XPCA 3ICLA 5GVQA 3PZPA 3QJLA 2N3LA 2VBYA 4X4PA 1SC4B 4YR3A 3OW2R 1N5YA 1KS2A 3TJ9A 5E7OB 1O6XA 1SIZA 2IDLA 3BR8A 4DR3F 1S9FA 1WDTA 1G2EA 5A8KB 1YGYA 2YWGA 2QLWA 2H48B 1IBCB 2UV8G 3T3FA 4FVCA 2W9AA 1L3UA 2WONB 1SQGA 2HQGA 1QVGR 4HDGA 3QGHA 3ZC4A 4DV2F 2RS8A 3TZYA 2BYCA 2ZHBA 1U2FA 1O51A 3J81Y 2ZZTA 1R0CB 1R89A 1KVJA 1QAIA 1PO6A 2WK4A 1AZSB 2XYPB 2ZE2B 3C14B 5K14A 1RKJA 3M8ZA 4FYWB 2KVIA 1B3TA 1J5OA 1RXOB 1YDLA 2I1RA 4ZVGA 4EBDA 1YZ7A 3V6KA 2RKIA 1VQLS 3I56S 2UUBJ 2IJNA 5HMWA 3NRBA 1FXDA 1CLFA 5K8MA 3TAMA 5EX3A 3R5GA 2CZVC 3PM9A 4ZVOB 2V69A 2M70A 4MTPA 4OLPA 1SH3A 5LL6d 3OLAA 3WZ0A 3GIJA 4Y3CA 2HHSA 3JQMA 4DR1J 2DNRA 2F65A 4Z7CA 3MM9B 3NAHA 3EPGA 2P9GA 4N77A 3VZIA 3EVOA 4KV8B 4TU7A 3KUEA 5KFMA 3KHLA 2F8MA 5GAHI 4ECVA 5GAGI 2VBWA 2NREA 4MJKA 4WXOA 2BE2A 1NHKL 3TP2A 1F3VA 3HULA 4YEAA 1Y10A 1U6FA 1GXLA 5L9XA 3VWSA 4XPEA 1LWCA 3CCRS 3MURP 3V4IA 1A9NB 1JLFB 1IJEB 3F73A 3NL0A 1XMBA 2FLLA 1GTHA 2V2ZA 1RA7A 2VPWB 5H1SV 4B3TF 4EO8A 3CC7S 1VQ9S 3T5HA 3RW7A 4CO4A 3EXYA 2J6UA 3ZZPA 1Q4RA 2FJVA 3FKBA 3HSZA 2MKIA 1ULRA 2Z4PA 4MIAA 5DG8A 3KDNA 2HQDA 1CC7A 4ZCMA 2JX2A 3SYZA 4X62F 1FD8A 3M9NB 2HNZB 2J6SA 1URRA 4K0KF 1ZM3A 1YRTA 5AE2A 2GFFA 5J2QB 3B8HA 1F60B 4XDCA 4C48A 3Q23A 3C15A 3S1TA 4C0BA 1JWWA 1EETB 3LP2B 2JWNA 4I6AA 4X4RA 1A0OB 1WOOA 4F0HA 2NLWA 2ZH9A 3C6UB 1RYSA 1N0VC 2LKZA 3HHLB 3FFIB 2KU7A 1Y0HA 1V5IB 4KH1B 1HBOA 3HK2A 3Q8UA 4JI3J 3AAWB 1C1BA 2HHTA 2PMHA 3Q8QB 4KO0B 2DNKA 4WTOB 2AKWB 2XQCA 3C2PA 2CQIA 2UXDJ 4DR4J 2G0IA 5GAHU 4KGVB 4L74A 3BR9A 3M8PA 2MZQA 5GAGU 1NHVA 1X4DA 4CYUA 4AYBD 4CRJA 3OTBA 3GV8B 4M1KA 4JV2A 1RJJA 2NYIA 1JLBA 4J37A 5C24B 2MKCA 2CAJA 2DR8A 2MZSA 2VG5A 3IXQA 3DRPA 3CUNA 4WFXA 4F7VA 4ALZA 2MGZB 2FHJD 2V4QA 1RTHA 1VRTB 3NS5A 3O5TB 3T1AA 4QW8A 4Y28C 5DQIA 5KFRA 2GMLA 3SCKE 3GPAA 2FJDB 4JI4F 2FZCB 5HMYA 2EW9A 4ZN3A 4KIAA 1GMVA 1TTHB 2ZEJA 5HMXA 2LXFA 2VFRA 1CPZA 3GMGA 4FP9A 2CJYB 1QAJA 1TUVA 2ABYA 3UDLA 4F50A 2UUAJ 1FI4A 2K1RA 3CTRA 3W8GA 4QWBA 1C0TB 1PYTA 2C28A 5D78A 5LT5A 4G65A 4ETXA 1HQ2A 2LQ9A 3CJSA 4HDHA 3HD1A 2YNHA 1OJ4A 3J7AN 2FGOA 4AD6A 2BQUA 2ZJPQ 1N36F 3CIZA 4URGA 4KB7A 3IS9B 2OPQB 1FD2A 2ATCB 1I6JA 1SC6A 4MKVA 4X2BA 3GONA 2C2RA 2OJ3A 4JI1F 4N41A 3BPSP 4PXDA 4KGZB 4PAAA 1RT7B 3TO8A 2CPDA 4ILLA 4DCOB 1VJWA 3W2VA 2KT2A 2V8HA 2DIUA 3NGUA 3PV8A 5EGYA 4U7UK 2DD8S 1IBKJ 3AD9C 1XTZA 2QTWA 2VUGA 4NEYA 3D5MA 3W62A 4CLKA 2UXCF 3N0VA 5L38A 4ED3A 3W64A 4EMDA 4BBYA 1KR4A 3NP5A 5HATA 1VQOS 1YITS 4I68A 5EHHA 3CJKA 4FZVA 4OX9J 5HO4A 4IO1A 5HROB 4MFBA 4WWSA 4HL9A 4P2MA 3B6BA 2XNRA 2C2NA 1Y5LB 5DLGA 4PQUA 1RWWB 1U25A 3TZXA 1R0AB 4DF4A 4FS1A 4RUBA 2IVMA 1BQNB 5JUMA 1IN0A 5B08A 3DRSB 3PEJA 3AB2B 5F41A 2QMXA 1KHVA 4I7FA 4FBTA 2YKPA 4LF1A 3QRPA 2DPJA 3D3BJ 3CIMA 2QO3A 4KGKA 1N32F 1MU2A 1VJQA 2EKNA 4OMFG 3VR1A 3NLCA 2MQPA 1SJ4P 1JLQB 4DR7J 3BN4A 1TL3B 2HNYB 1IBMF 1GMWD 1N8RT 4I64A 4AL5A 2V63A 2XMJA 3MECA 2HFVA 5DJBA 2ZM6J 3KJNB 2CWXA 3GJTB 2HVEA 4M95A 3L09A 3S01A 5A0YB 3V81A 1VLOA 2QLXA 3D66A 4B3OA 2F4FA 2ATLA 3MPDA 1CJKA 1AROP 4DG1B 1PJ5A 1IXKA 5KT2A 1N4LA 2A2CA 2XULA 3C66A 2F4VF 2RUGA 1UJ4A 1N34J 2P8IA 4F4XA 5HLFB 1NPRA 1EZZB 1UFKA 2RHQB 2JL9A 2CQGA 1HHSA 5HVFA 4RW8B 2I6WA 3CJ4A 4USTA 1SV5A 2W2OP 2C3MA 2K7JA 2JC0A 2Y1JA 2IM3A 2BM1A 4GRSA 4Q0BA 5ETRA 3J7Z5 2YX7A 1HFEL 3HHNB 1RP5A 2WAQD 1EP4A 2IBOA 3LWMA 4PG4A 4ERDA 5IS2A 1VQ4S 4GO5X 2XMAA 2VU5A 1S1XA 4NYOA 4JI2F 5CQGA 2VQFF 4QIGA 4ILRA 3TZWA 4J9RA 4YHHF 2CIMA 2OD4A 4I2QA 2J9EA 1JLEB 3A8KA 2HGMA 4YOEA 3DRPB 2BABA 3KMQA 3DGPB 3K8VA 2W01A 1RT4B 4X65J 3THVA 2HBYB 4FBUA 1SCJB 2BEFA 2XZWA 1N48A 1T94A 3JSMA 4LF7J 2JC1A 1TKXB 3CJTA 5C5JA 2PA3A 4OV6A 2KT5A 4I69A 4RW9A 5KFJA 5DS7A 4PXEA 1DTTB 2E1AA 2JLEA 2PEHA 2R3VA 1GMUA 1XN9A 4CLFA 4CWBA 2FB0A 4V1Ak 4CH1A 1GH8A 3EGNA 1KHWA 4M5JA 1HPZA 4DWIA 3UCZP 1J5EJ 2MQNA 4AL6A 4W98A 4TYBA 4R8UA 4ED7A 4DQSA 3IAM9 1HWJA 2AJ4A 3L7PA 3Q86A 1QAXA 2LDIA 3M2UA 5T14A 3BEGB 2GQCA 2AJQA 1JLAA 3NCPA 4PG6A 1YQHA 2HZVA 5KFBA 1KNZA 2HHHJ 3DDNA 2OPSB 2FHMA 4DPXA 4A8FA 4ANEA 4DPTA 1WSRA 1KWMA 4OI4A 5GMDA 4Y2KA 1PILA 4JI6J 2AYEA 4N76A 3LPYA 3ZTSA 1XIQA 4JV5J 1TUGB 2OMOA 3OXLA 4NCGA 1F5CA 2DVIA 3H25A 3MEGA 2HS3A 4YP3A 1V5VA 2V67A 2XY6A 1SBRA 2JVRA 1WWHA 1IKVA 2HZCA 2OAUA 3FSIA 2AGPA 1SKRA 1QLNA 2RU9A 3BSNA 4CH7A 2HHUA 2XHCA 3HVRA 3ZTRA 2OLWA 3QT7A 4U9RA 1XNQF 4OHXA 3CJKB 4O3NA 3D4JA 3M1VA 3D1QA 2PI5A 2MLZA 2UV8A 1B0VA 2HW3A 1TFWA 2DHHA 3EX7B 4TQSA 1VCTA 3BV8A 2RJZA 3OVBA 3ELHA 3K5PA 1EB0A 4NLDA 3UQSA 4QOTA 2DY1A 1YKWA 3Q2SC 4ZOSA 2E5IA 4DX7A 1HBUB 4J9OA 2J0XA 2VIHA 3WC0A 3U02A 5E3PA 3BBFA 2HFOA 4E8UA 3EGVA 2UZAA 3IWNC 2GGPB 2FC8A 2RHSB 2ACMA 3NCRA 1JXLA 5GAEU 1L5UA 2CZ9A 2HS0A 1NH8A 3W65A 2WVBA 4WFZA 4GO7X 4G1IA 1IKWB 4PYAA 4DX8H 2AF6A 4ECUA 1Q8IA 4YB5A 4QPXA 3FBFA 4OZLA 1NK8A 1X9MA 3M30A 2I8EA 1KOOA 4LSNB 2E29A 5B7WA 3OFEA 3JSYA 5D4NA 5MLCV 2MQQA 2XY5A 2YQ3A 4AE5A 1QSSA 3HZEA 3R6GB 1BQMB 3HT0A 4DFJA 4ZVQB 3EDQB 2FY1A 4WK1A 2BACA 1HQUA 3GU0A 2RQKA 3PO4A 1OY9A 1ITPA 3CCJS 1FWKA 5D77A 3QT6A 3I9ZA 3KXDA 3TZZA 5J1EA 4IG0B 3ENAA 2OD6A 5B0FA 1OQ6A 5KFLA 4KHMA 3P8BB 2DNGA 4P7VA 1S7IA 1HI8A 5T7LA 4NOHA 3WIVA 4XDDA 4WYLA 3K8WA 2O5DA 3U1LA 1Z4UA 4QWDA 3AB4B 2BOAA 5KG6A 1VC5A 4WXWA 3GYXB 4HHUA 5KFKA 3UW1A 2JEFA 2LXUA 2HFUA 4K4UA 1HI1A 1UEUA 3VCDA 1NSQA 1F9FA 1PC5A 1RWNB 3M2RB 3VAIA 3A12A 1GK8A 2KHDA 4PEOA 2EWHA 2BM0A 2V34A 3HF5A 2LDYA 4USHA 2OELA 4LF4J 2MEWA 2E5HA 1O0PA 3M8QA 3AA8A 1RGVA 1OMSA 4EO6A 2H9ZA 1HBNA 5KFUA 2BVZA 4C6AA 3ZZZA 3GFYA 2W9CA 3TW0A 2W4DA 1FX4A 5DM6Q 1ZZFA 4NEZA 5EN1A 3GP9A 2OFGX 4F0MA 3GSIA 5KT7A 2ADCA 1S97A 1IBLF 4RLEA 4X4NA 3BH7B 1W7WA 3OJSA 3POTB 4LF6F 3W5YA 3IM9A 2B0GA 5L8RC 4HI2A 3MMBA 3DRXA 4HEA9 4R8UB 2M3DA 3PFEA 3SFGA 1PIEA 4B3MF 2OFHX 2CQ1A 4DV7J 3KDOA 3LAMA 3S8SA 1RAIB 3HZGA 3CD6S 3NNCA 1J2VA 3NGSA 5I3QA 5C25B 3OL9A 5FLXU 2K8GA 1SPBP 1UPMB 1LEOA 2DGWA 3BQ1A 4HI1A 2RSQA 4P73A 5IOLA 3ULHA 4DSJA 3IRXB 4YN3B 2GMHA 4Z37A 6FD1A 1S0VA 2HBZB 3CCWA 1FXRA 3W7BA 3RAXA 3ZTOA 1S79A 5FDLA 2IRYA 2H51B 2AJ2A 2M2BA 4DR5J 3D0GE 2M4MA 4DCPB 5HP1A 5DDRC 2Z58B 1DARA 3MEGB 4LRAA 1WC4A 3W1YC 4B9MA 3LP1A 3V2UC 1IKVB 4DV4F 3R2DJ 3TVYA 2KB2A 2NXNA 4IQMA 4K8RA 1R6YA 1YIJS 3NWRA 4DN0A 3LGMA 2FJXA 6FDRA 3UD5A 2GS8A 3TI0A 1FFGB 2G0JA 1N5TA 3LGNA 2RF2A 4P2FA 2CNKB 2BJEA 5J2NB 3MUMP 1YJ9S 1XEZA 4DR2F 2OEMA 1Z2ZA 3LO3A 1K0VA 4QBUA 1X5PA 1F9HA 1HNXJ 4LFBJ 4DL2A 1FDDA 2HAIA 1H73A 2FUG9 1ZTTA 2FHKA 2QMWA 4RW4A 4QIVA 2HSEB 2LQJA 3EICA 4NX9A 2J6TA 1SUQA 4CZCA 4MIBA 5EX0A 3P5BP 2DKOB 3MHYA 4USJC 1EQ0A 2VG7B 2E7XA 2ZDPA 4M5MA 1CJVA 3ZNJ1 2EG1A 4CO1A 4MT1A 4QCLA 2F5GA 3MF5A 5L1LA 1MROA 4V19J 1DHMA 2BZ2A 3CCMS 3DLKB 1HNWF 2NCKL 2WOMA 2YNGB 3CO0P 4JI8J 1HQEB 2CDRB 1W2BR 2YH1A 3K89A 4JI5J 5ETVA 3W60A 2ZH7A 4LFCF 1JX4A 1ZOTA 1RADB 1R8PA 4ZPWR 3BZQA 3HSGA 3BKFA 3OL7A 4J5OA 2KO1A 2HHXA 2XS2A 2QL5B 1RCXB 4ZPTR 2LYVA 1V3RA 4RNMA 3FCWA 1JLGB 2MLYA 3KK2A 4NRUA 1H74A 5DG9A 1VIOA 4YS2A 3KLFA 4DI6A 1Y5NB 4CLTA 1CBKA 5CCMA 1ZH5A 1S0MA 4M63A 1C0UA 2MHEA 3KG0A 1UJ5A 3V6DA 4DSEA 2MTLA 2WVDA 1NH7A 4DU7A 1RTIB 2YKMA 5A2QY 2Y8YA 1L3KA 2AHOB 4B9NA 4C0HA 4ECYA 3IR5B 4PABA 2UXBJ 1B0PA 1TKTB 3BGRB 3BO3A 3NG8A 4HHJA 3P3DA 3O6QA 2DR5A 4QU6A 2P6SA 3SDEA 3M9MB 1S6OA 2RNEA 2MB0B 2XYGB 4NA1A 5LJ5Y 2XMKA 1RAOA 1O5JA 2V50A 3KG4A 4ZMMA 3J7ZT 1WI6A 3G71S 3L9ZA 5KFHA 1Q78A 4NE9C 3OQ2A 2DT9A 1S5ZA 3E8OA 3OTOF 4NMXA 2NR0A 2WRMA 4QR0A 1WELA 1SL2A 1T05B 3CMQA 2F3JA 1IKYA 4UTGA 2CPZA 4WP8A 2A1BA 3G82B 1N5QA 2VFVA 4NZ6A 3EVMA 4L72B 1HMVB 2QLJB 4NI2B 3UN2A 2ZH6A 2YX1A 4M5DA 1TVRB 2JFKA 3CWJA 2H5IB 3ZZYA 1S9GB 3SEOA 3I0SA 2G9OA 1KVIA 5A8RA 4O44B 3PNIA 5KAKA 3T5JA 1BUXA 3B82A 4ZVSB 5FJ4A 5BXIA 1B0TA 1GAOA 1RT5A 1X4BA 4UOCA 2R8GA 2X7IA 3MWBA 4J9UE 1NJIT 1BY9A 1FA0A 2BJ7A 4ECZA 3MEDB 4LIRA 5KTQA 2AX1A 3DLGB 3UD3P 4P74A 4K4ZA 1AW0A 2UP1A 4TLRA 3Q8VA 2BE9B 4DV1J 2ZKTA 1IJFB 3UDVA 4RZRA 4LF5J 4LF9J 2FTRA 1LV5A 5KG4A 2W2PP 3BKTA 4LBHA 3QZ7A 1HR0F 1VQSA 5L1KA 4QU7A 3MTKA 3QLHB 5AE1A 4OLOA 3EGWB 1TV6B 4F4WA 1R8CA 1TU0B 4X64J 3MR2A 2HIYA 4QJVA 1S72S 1QE1A 1U7LA 5M2UA 3R1LA 2Q3PA 1NK9A 2PSZA 2CJQA 3KLEA 1WUUA 2D74B 5KG2A 4RNFA 4KFBA 3GYGA 3BH6B 4A46A 3VAKA 1JXEA 4HLBA 1BD6A 1SVDA 1RAJA 2G2YA 4D3HA 1S12A 5CHCB 1RA6A 3OFHA 1G1XA 4M5KA 3GIMA 1JJ4A 3KWMA 2AJ1A 4PKDB 1I5OB 1UPPA 2B9XA 1X5TA 3BJYA 1SL0A 2C42A 5IV4A 2L48A 2YKAA 4RW4B 4C4WA 2GAGC 5THWA 3T1YJ 3PACA 2NSBA 5CYQB 3VAFA 3D28A 2DGXA 2IIHA 4KQZA 1WORA 1WG5A 3EVWA 1HHQA 1GX6A 3R27A 1P6TA 3NS7B 4P72A 5B0BA 1HKAA 1TKDA 5CYJA 5HVHA 2G1HA 3KTQA 4C11A 4W92B 1RDRA 3PR5B 1YLXA 4KKOA 2FZGB 1NDPA 4P9SA 4JI7F 5L9NA 1TK5A 3FK4A 2DRDA 3DCAA 3W5XA 3GCWP 3J80U 1Q82T 3CB4A 2EFPA 4KH0B 3PRBA 1K9MT 1S6QB 3GJQB 2EFGA 4Q45A 1S0NA 3F41A 3GIIA 3PYFA 3SMZA 2DO4A 4ES2A 4PWWA 1Y7PA 1IR1A 2O66A 3JQJA 1YG0A 3CJ3A 5D0GA 4IUFA 4WP3A 1C4CA 3V6JA 3JAMU 2KXNB 1RWUA 4RW7A 3P6YC 8AT1B 2HRUA 3OR1A 1F2GA 1FX2A 2XGPA 1RI7A 2CRLA 3C16B 4C0OC 3QYYA 4WP9A 1R8AA 2XMTA 2Q1LA 1BWEA 2GVZB 1NDLA 3MCNA 5HQLA 3ZZ0A 1S10A 2H65B 1B7YB 2DYAA 1QD1A 5F8NA 5HBMA 3MAAB 2QYCA 3HFVA 1RACB 2DH9A 4FYYB 4QR2A 3SDEB 3OBIA 3MM5A 2VJVA 4F0KA 4OYZA 2Q6BA 1OPZA 3R8YA 2GJ2A 2WZ1A 1H7XA 3BB5A 1MMLA 3G86A 2QIFA 4CTAA 3PR4A 1G7CB 1KQGB 1SJ1A 2KXFA 2LECA 4B3RJ 4W4MA 3QSYB 1RZMA 5F3ZA 1WF2A 2G0CA 1H38A 2L9WA 2ZD1A 1T03A 5E0OA 2B8QA 4LQ9A 4WE1B 4ZPAA 1U1MA 3TEGA 1I3OB 3HFZB 1T9YA 2UXDF 1F0XA 4DQPA 5KT5A 5BR8F 3QFWA 1LWFA 2AYGA 3M8WA 1C1CA 1JK9B 3FNNA 5I42A 5SUHA 4DQIA 4A8MP 4GKKJ 3IRWP 1NSPA 1A7GE 2YTCA 4OZJA 3ZZOA 2R7SA 2RVJA 2QN6B 5I4MA 1REVB 4OIXA 2R8KA 4U67Q 1REGX 4L75A 4YMEA 4OYMA 2DGQA 3OR2B 2ZH4A 1TL1A 2BQRA 1RLDA 1WHWA 5GADI 5M2PA 4DS5A 4AT1B 2HKEA 4CO5A 1VC0A 2B7BB 1VHFA 3DOKA 2U2FA 5KFVA 1RT5B 4P7TA 4HH0A 2F63A 4V19X 2KH9A 2CPJA 1H98A 4IH6A 2LEPA 4I0WA 4RPFA 1RHKB 1DQAA 5CYMA 4DMZA 4OYAA 2BR0A 3DHWC 1JNRB 2E9RX 4C3KA 1RBAA 3CO9A 5GMKa 5ETKA 2M52A 2FY8A 5BYQA 2YXLA 3W2WB 1H0HB 2QA4S 1DJ0A 2GO9A 1YBAA 4O3SA 3UVJB 2ADBA 2DO0A 1OO0B 3BYRA 1WSVA 4DN9A 1T9UA 5D3GA 4GKJF 2B5JB 2CWKA 3A4TA 4O3PA 3HDSA 1XNRJ 1LFPA 3FRYA 3L7OA 2IM2A 3MMCA 4I2PB 5I3UB 3ILIA 2A3JA 3KYLA 1WG1A 5DQHA 5KFFA 2CNLB 2N3OA 2BJ1A 1GX5A 4QPTA 3NBPB 5IXUA 3CMAS 1KN6A 4ZN1A 3BSAA 5B0AA 3IM8A 4F3QA 5KFQA 3DYAA 1APSA 5JXSA 1VIXA 2VHGA 3PRVA 3ET6A 5DZ6A 2EC0A 2EK6A 4ECSA 4ZPVR 2X1BA 2VFTA 2B4PA 9RUBA 1NPPA 2J8SA 5AXNA 3CGIA 5K9FA 5MAOA 2OKQA 2DPIA 3MFIA 1N88A 1UJ6A 1S4EA 4F02A 2N4CA 1LW2A 4KHPF 4I67A 4DV2J 4Q43A 5GADU 2KTQA 4DL5A 1D8YA 3LP0A 3QQCD 3RB0A 1Q16B 4CT8A 3PDNA 4HR2A 2QA2A 3RB3A 4X4UA 2VFSA 4LBPA 1KTQA 1FFWB 1H2UX 2MQLA 1RBOB 4PRFA 4C8YA 1YRUA 3QT8A 2CFXA 1HBMB 3W61A 3IG1A 1MWQA 2XY7A 4IR9A 3SSRA 1MG7A 1TFYA 3LH2S 4LSLA 1FJGF 1RYRA 1IQTA 2I2YA 4NLQA 3F0NA 2C2DA 3OFFA 2CVIA 3FGVA 1UWBB 1W25A 1KC8T 4IKAA 4J9KA 4IYQA 3JSBA 1M5KC 2LP4A 4JP8A 3RZAA 2R7UA 4N7TA 3FSYA 1R8HA 1VHIA 1T3OA 3KLIB 5KFTA 3DLEB 4DUZF 3AH6A 5IT9Y 2LXIA 2WW8A 5F8IA 3I4HX 4EI2A 2OO4A 3DRRB 4YR0A 2IAJB 4ZA1A 3PRDA 1H72C 5J2MB 5H9EK 5LSOA 4YQWA 2RAQA 1H6KX 3OTDA 4G1QA 4U8VA 1N33F 1AA1B 1DZ5A 3CULA 2MKSA 4JYAF 1PJ6A 2RDDA 1S1TB 5IQ6A 2MXYA 3K17A 2OPPA 4Q2MA 2EI5A 4DZDA 3FEYB 3B4DA 1JLCB 2J9DA 1VGYA 1TKZB 1X4HA 2QLBB 2C2MB 4B3TJ 2VKZG 2Z2LA 1TL7A 4PWDB 3FMBA 4TKTA 1X5SA 3CCSS 2VZ9A 1CS4B 2FDNA 2UU9F 2M0GB 3IFEA 4HT5A 1FESA 2VPYB 4OZNA 2J0WA 1L3TA 5A8KA 1U1LA 1NB2A 3GIKA 4XIUA 2WONA 4X62J 1U24A 2P9EA 2RDIA 4NZ0A 4K0KJ 3P96A 4JOUA 1YJRA 2PA8D 2GCFA 4FS2A 4NXNF 2JRSA 3T1HF 3KJVB 1Q0NA 4KJIA 2AV5A 3G9CA 1AZSA 2ZE2A 3C14A 3VAGA 3N6MA 3MGJA 4WCEQ 4C98A 3H0PA 2VB6A 1J27A 5I42B 2W1BA 5D0EA 5L1IA 2ZH2A 4CI0B 1VRQC 1VQ8S 5I3PA 2MSSA 2XI3A 4KGMA 1WD6A 3QRRA 3M2VB 2RT3A 3OHBA 4DXLA 3HVTB 2YNFA 3CJ0A 4CDIA 4WFBQ 4PUOB 5DGAA 1F5BA 4LF7F 3MM8B 2IYGA 3D3CJ 4B9SA 4AXJA 2OH2A 1N5SA 5JVHQ 4FNHA 1FRLA 2NXCA 1AXQA 2J9CA 1CEZA 3MM9A 4X4VA 1B64A 1AB8A 3A8IA 4LF2A 4Y2CA 4P6QA 1U1RA 4KPYA 3MDFA 4KV8A 5L46A 2O1PA 1QTNB 2J76E 3MZIA 4C8MA 5A8WB 3CCZA 2C2OB 3H40A 4RWWA 1DQ9A 4K4XA 2F40A 4OV1A 3KK3B 2IBKA 2CQHA 2VQEJ 3ZZTA 1YVFA 3OVAA 1XC9A 2DCUB 1FO1A 1JLFA 4JI4J 1YZ6A 3D0IE 2ZWPA 1H7WA 4J9QA 3RRHA 3MD3A 2RIJA 3HKWA 2H4YB 3R5DA 2H1YA 4X66F 3R7SB 4ES1A 1PG5B 3K5MA 4DHVA 3EZ5A 4RU2A 1WTBA 2F9JA 1Q7LB 1NK0A 1SB6A 2Z56B 3GFXA 3HHKA 2GNKA 3QAUA 2X1GA 1X31C 3MXHP 4ITSA 2HNZA 3A13A 4U8YA 5IWAJ 1OYDA 2HAFA 2BW2A 4O23A 4FF3A 3H42A 3PY8A 5SZTA 1N36J 4RR5A 2DNMA 3ZTQA 1TAQA 2ZWOA 3LP2A 3WBZA 3RB4A 2NYHA 4RJVA 3QNWB 1QM9A 4NLSA 2H3EB 4JBCA 4FXDA 1WC3A 2CG8A 3C6UA 6AT1B 1FRIA 3HHLA 3AODA 3HCXA 3FFIA 4IDKB 2FLNA 3B54A 1TK8A 1H3DA 4NMLA 2P9CA 2C2EA 3DGVA 4J90A 3U1NA 3V6HA 1U6BA 3SIPB 2YVSA 1WI8A 3FCVA 1SQEA 4ED1A 2KYXA 4ED0A 3P4UB 4QIFA 2MZ1A 4KO0A 2GHWA 1RCOB 1Q1KA 1P9YA 3O8WA 3M8YA 2CJXB 3QFHA 3W66A 2UXCJ 3I82A 3KFWX 2BRKA 1VFJA 5IT9U 4ECQA 1YJNS 1V9OA 2AT1B 2V0NA 4HACA 5C24A 2EBGA 4H4OB 1YWXA 4OX6A 2MKHA 4P71A 4LUBA 2A10A 1BC6A 3TUIC 1U0SA 3ZZUA 5LXYA 4U96A 2MGZA 4EWTA 2DGTA 2Z2ZA 3MPWA 2V94A 2QX0A 3PW7A 1VRTA 5A6WA 2PDAA 4WK3A 1HNZF 4OHZA 3TJ8A 2YPZA 1C4AA 5LMUF 2UVVA 2AYMA 2XEXA 4OHVA 4KBIA 2D3OR 5CABA 5EWEA 3PYEA 4K59A 1N32J 3BDPA 3ITHA 1C2PA 4DLEA 5DDQC 5JMNA 1U0HB 1WKKA 4Q2LA 2BANA 4IQXA 5F9NA 2B8PA 3H2VE 3CJRA 1IBMJ 5KT6A 1C0TA 4O4GB 3OUYB 1NZ8A 2OIHA 4DR6F 3UCGA 4N56A 2KYZA 2AEFA 2ZKUA 1NB7A 3KMSA 2PD1A 1S6PB 4HT7A 3MPVA 2VPZB 1RT1B 1FK9B 1I51B 3FZBA 1T7PA 3M6UA 3X3UA 1RAAB 7FDRA 1R7IA 3WX4A 5A6PA 4K4TA 1FKOB 3THPA 2DR7A 3VV2B 4XTTA 1IVZA 2XBPA 5KG3A 3IS9A 2OPQA 1RHUB 2VG6B 2F4VJ 1N54B 2J0SD 4IRDA 1RTJB 4M8LA 2Q66A 1L3VA 4Q44A 2KG1A 5CD4H 1F3FA 1VI7A 1RT7A 1V3ZA 3NGDA 3G8TA 3G6VA 4FF1A 2QLFB 1ICEB 1T3NA 2WBMA 3T9NA 3O44A 4B17A 2IHR1 5D8HB 4HTIA 2B9EA 4YDDB 2YNFB 3WDOA 1NEEA 2X1FA 1X4EA 4ED5A 1WEYA 3DOMB 1HNVB 5HJYA 4KAIA 4C2MA 2I5JB 4F8RA 2IA0A 1QVFR 1U1QA 1FNMA 5H9EJ 3FUYA 1S4FA 1RU2A 1VQMS 1VS3A 1E6VB 2BKPA 3FJ2A 3QJJA 2IVYA 1QTMA 5HROA 1AUSL 4JI2J 2KKHA 2VQFJ 1NJXA 2XLJA 1Y9OA 4YHHJ 2QSWA 2AW0A 2ZBRA 2LQ5A 1R0AA 4UY85 1ZPWX 1BQNA 4K50A 2IC3B 1UCNA 4JB8B 4Q7AA 3DRSA 2RB7A 3C6TB 4CLLA 3OXGA 3I5CA 2RRBA 1DRZA 1S57A 2FIUA 2ZOGA 2V6AA 3R6LB 3SBMA 3KOAA 4ZHRB 2R8HA 1S9EB 2BJ9A 3PX0A 1QSLA 1F9EB 3D6HB 2VFUA 4WFNQ 1EJ7L 3IBCB 3SSQA 3K0JA 1NAQA 2ZNYA 1NSKL 5KT4A 2R7WA 1JLQA 1U48A 1TL3A 2HNYA 1X7VA 4CLYA 5ETNA 2WVCA 2HVIA 2BDPA 2CQ3A 2OSRA 1LK5A 4NCAA 2I0XA 1FDBA 4H4KC 5AXLA 3CXCR 5CD4A 4DJBA 4N5SA 3UDCA 2CNNB 3OXFA 2J7WA 4MMOA 4DEZA 5CZXA 2DEIA 2BUNA 5A0YA 3MUTP 2BE7D 2B43A 5LMNF 5HJXA 1S49A 2DRAA 3FBEA 2HHPA 4OZ0A 1CC8A 1VBZA 3C8YA 4NZ7A 2YWHA 4DG1A 3A3PB 3CCTA 4QWCA 2SXLA 1XMOF 1U1OA 4GVLA 3S7RA 1VYAA 3NNAA 3E01B 4USUA 2XG8A 1RTDB 4GVBB 2YNIB 3O1LA 2CYYA 2KL8A 5HLFA 4CO0A 4OJ3A 2AYBA 4CO2A 2ASLA 4RW8A 4B9UA 4TVAB 1MSWD 1RT6B 4L6V3 4EZ6A 1NK5A 2NXJA 2FVCA 3TVZA 1TELA 3BSOA 1OQ3A 4J9PA 2MMYA 4YDXA 1ZBTA 4UZBA 1XMQJ 3TAPA 2DNYA 3U1MA 1HNIB 1Y3KA 2MPUA 4C3MA 2R8JA 2MJUA 2MZJA 3RGIA 2H5EA 5F0UA 1WTFA 1ROFA 2Q6CA 2MJNA 1WACA 2HPUA 1S77D 2D9PA 2IMOA 4F4ZA 2LLZA 4HACB 3PKMA 4UT4A 1JLEA 1XNQJ 5DDOC 5D0HA 5HANA 3GQCA 1DTQA 3DGPA 2DBBA 1RT4A 1JIHA 1P9QC 4DUYF 2HBRB 1SL1A 3WHIA 2HQFA 2XLKA 5KOXA 3N28A 1TKXA 5D4OA 4QYRA 2DXFA 4J7CA 2O01C 5C42B 2YKOA 3KLGB 4RKUC 1DTTA 4JI8F 4PWUA 4UUWA 3H90A 5K8NA 4TY8B 1NXIA 1N56A 2EC2A 3NAIA 3QAEA 2NZCA 3EZUA 2PI4A 3ITHB 2JNJA 3D9BA 4OJ1A 1SJRA 2POKA 4LR8A 2BANB 1WG4A 4P2XA 4NLWA 4JV1A 2PC6A 4ECXA 2VH7A 5D4PA 3SFUA 2JEGA 2OSQA 3OTCA 1NDKA 2QA4G 4WKYA 4PQAA 2OEKA 3MEKA 5E3QA 4USIA 2AIRB 1RHMB 2IRXA 1RT3B 4OYWA 3G6YA 4NRTA 2C22A 3K7RA 3J81U 1XJWB 1RWPB 1EARA 2DTJA 3PKYA 3TX8A 1FVSA 1FRJA 4KSEB 5KFDA 3LALA 2W4CA 2Y3YA 2HVHA 3HD2A 3DLBA 4CLZA 2OPSA 4M5NA 1EKSA 2VC0A 3GWCA 4A8OA 2AJFE 1SKUB 3QIDA 2NPFA 4GC6A 2BKNA 4NXMJ 4ED2A 4NL5A 2KRBA 2FJAB 2YKNB 1KQSR 1HYSB 2BBEA 2ZOFA 4IFYA 4UF4A 3M9OB 4AQYF 1ZTWA 1KP6A 4IOBA 3ZZRA 1LK7A 1WC6A 4X84A 4LVNP 4ZCIA 1RU1A 2YPYA 4E0DA 1W2IA 3T5LA 1QY7A 2RQMA 3UO0A 5RUBA 2CXEA 2GHVC 3M32B 5B0EA 1M1KT 2V8DA 2ILYA 2ZC4A 3MMAA 1YSJA 4F25A 3Q8PB 4F4YA 5IM0A 2Y8WA 4OQJA 3CW2C 2OMLA 3H59A 2DH7A 3IMQJ 5KG5A 1NLKL 3QT5A 4DS4A 1YJ7A 3TJAA 3H4BA 4A8WA 1NNDA 2MZTA 4N8OA 4UW2A 1U4BA 3VQSA 1KOHA 3KKFA 5DQGA 5DG7A 3NOCA 3DLHA 1YJWS 4MKAA 1GNKA 1HBUA 1MN9A 3EWGA 4DX6A 2DHAA 1S99A 1FRKA 3VVTA 4UOHA 4P10A 3PIPQ 1S59A 3LW5C 5AXMA 2QL9B 4A8KA 3DFEA 4NLOA 1VQ6S 3O2IA 2GGPA 4S0MA 4XO0A 4IRCA 4ID5B 4RBTA 5GMEA 4ZVHA 1IBLJ 3K57A 3HJFA 5IZHA 3R2CJ 3T19A 1IKWA 2HQCA 2IRUA 2DHSA 3CDWA 3AFGA 4B3MJ 4BS2A 3CCES 2HMIB 2PT0A 1YX2A 1YK9A 5IV3A 3VALA 4QW9A 5KFZA 5AT1B 3GV7B 1LW0B 4LSNA 3H2UB 2W2MP 4PXCA 4IOAQ 3QGPA 2RQCA 2D3UA 2YX4A 3QIPB 2KG0A 4B02A 2Z2MA 1BQMA 2C1EB 2FHJA 3CC4S 2G4BA 2E7WA 1X0PA 4YR2A 3W9JA 5EWGA 1ZAWA 2AMCB 4ZIVA 3DXSX 1U49A 4UZCA 4IR1A 2WVEA 2E5JA 4CCHA 3I0RB 1KD1T 2PO4A 4IG0A 3BBCA 3N5BA 2JFDA 1PBAA 4Q5VA 1RHJB 5E3CA 1TL5A 2P6TA 4M5LA 5KFSA 3NXZA 3JS9A 2ASYA 4ZLLA 3MPYA 3T1YF 2DCLA 1U47A 3SQOP 3R5AA 3B78A 3FBBA 2QSFA 3H98A 2CJKA 1RWOB 3M2RA 3OHAA 1OSCA 4OYXA 3PHEA 4USKA 1DTQB 1WC1A 2J0QD 4L3KA 1FCAA 3UDEA 4BCAA 2ACYA 4QWAA 5DLFA 1JQGA 2V5HG 4ED6A 1F6TA 2W4PA 1BMQB 2GA7A 4ZVFA 2HK3A 3JYTB 2V9WA 1O8BA 2XMVA 1XQIA 1OWXA 4AFFA 4CLUA 2WSEC 1MMNA 4IOCQ 2BX6A 3FC9A 3K2YA 1P8GA 3HI9A 3RB6A 5E3RA 3OVSA 2XLIA 2R7VA 3POTA 1RWMB 4OI0A 3IWLA 4C8NA 4LIWA 1CULB 4O0IA 1OPIA 3H7HB 2GIRA 4ZP6A 4UUXA 3RYLA 2DXDA 3M6VA 2OTLS 3TRGA 1X9SA 5C25A 1FDNA 1HNWJ 3I5BA 2XZDB 4DL0C 2ASJA 1XK8A 4DV6F 2KJWA 4LFCJ 5GAEI 5KG7A 3W3SA 3VAHA 5KFXA 1VLYA 3IRXA 2UUCF 2FVRA 1RLCL 2ASDA 4ZLPA 2CJBA 2O67A 4RL1A 2VODA 1RABB 3G8QA 2VD3A 1Y4ZB 2BOPA 4DDFA 2IY5B 4ZP9A 1XWLA 4MK7A 3K5NA 2M5YA 5IT4A 2EXUA 1CJTB 4OX7A 4J9LA 1UFLA 1WEXA 3PFOA 3GE9A 3MM6B 3ILJA 4IFYB 1GMWA 4BC9A 3C46A 4X4TA 3HHDA 4J9MA 1WJ9A 4LJMA 2GIFA 3ZNUA 3FRZA 3CJQA 1N0UA 5KFYA 1V6HA 4ECRA 1Y5IB 1SXLA 1JNZB 1CQNA 1QJHA 4HH1A 2MZRA 4J9SA 2CQDA 3DLJA 1K1QA 3MMAB 3IBWA 1VDHA 1S1WB 5IM0B 5J2NA 1HWLA 5BYRA 2K3KA 2RDJA 3MMJA 2QFIA 3M8SA 1RAHB 4IG3B 4NLPA 2BJDA 1GTEA 3OTOJ 2GVDA 5LSRA 1MLAA 2BXJA 1BGXT 4XK8C 2E1CA 2LCWA 1IM6A 1ZZNA 4Y65A 2HZAA 2E44A 4YFUA 3R3TA 4NA3A 2ZVSA 3I31A 2V4JB 2G2OA 4UY8T 2VG7A 3DM2B 3LTOA 2MQMA 5DETA 2KRRA 1OY8A 3TAQA 3T9ZA 3DOLB 1SC3B 3T5KA 2W7AA 2F8EX 5F8HA 2B6AA 3MCMA 1IKXB 3DLKA 4OI2A 4DPOA 2YNGA 3MR3A 1HQEA 3GG1A 1I94F 1S1UA 3SXLA 2JH3A 1M5PC 5HK4A 1FERA 2IPOB 1KLMB 4DSIA 2OPRB 2D41A 3US5A 2LQBA 5D15A 2ZJQQ 2CPEA 4CQ1A 3G6XA 3LA0A 3KK1A 3D1OA 2HEKA 4PG8A 5ADZA 1SQFA 1JLGA 1HARA 1P27B 1FKAF 2DB1A 4OL8A 1VQKS 3H5SA 1OYEA 1SJ3P 1JB0C 2NXEA 2J7KA 1HR0J 2RUSA 4E2FB 4DL6A 2F1FA 1RTIA 2ZH1A 4F4AA 1ZETA 1PGZA 1R8BA 3G4SS 3QO9B 5KFEA 1TKTA 3BGRA 4FNIA 3AT1B 3DI6B 1OY6A 1T9TA 1N6QA 1VK8A 1Y3JA 3SCIE 2DNNA 3LWLA 2DK2A 3NEKA 3KUHA 1X4AA 4UQTA 2VASA 1TL4A 2WB1D 2HFZA 2VL1A 2WCXA 3PVXA 1OIAA 2OI2A 1VRUB 1T05A 3S6EA 2CJAA 2WSFC 4DPWA 1RHRB 5F9LA 3M05A 1R3NA 2XCPA 1NK4A 2W9BB 3QPIA 3TA2A 3G82A 4QIWD 1WKJA 2UVRA 2Z2YB 1HMVA 4NI2A 4B3SF 2HQIA 2LA6A 4PPZA 4J9VA 1TVRA 1S9GA 1MNEA 4M5GA 3SQGB 2BKOA 2XHWA 3JTNA 4O44A 3TQEA 4WF9Q 2JEJA 2FZKB 5JVGQ 4ICLB 3GFHA 3OV7A 2B9YA 3O3LA 3FEZA 3GFZA 2MY8A 3W9HA 1D9DA 5KFNA 4DV0F 3RR7A 3LF0A 4IFVB 4JI7J 2DNPA 3MEDA 3DLGA 5ITHA 2ZH8A 1FTCA 4WU2A 2P2CB 3EMTA 2V8PA 3THTA 2IM0A 2KI2A 1T11A 2PFFB 1DURA 3RU0A 1D9AA 4UQGA 3RAMA 1EAYC 1WOSA 4N8NA 1RWXB 1DBDA 4LRDA 5FIIA 2W2QP 3V5RA 2IVFB 3QLHA 5G0RB 3G6ES 1TV6A 3Q2TC 1P1TA 2Y0SD 1NJWA 5ETQA 2ZUGA 4LFAF 4FF4A 4TU9A 1X4FA 1PSDA 2AJ0A 4I1TA 2GC8A 2R7QA 2CPXA 3GILA 1KRPA 2NUUG 3P45B 3MM7B 4FXWA 4NLYA 4M5IA 3BBBA 3TEHB 3CMES 4BDPA 3OJUA 5C7PA 2IFXA 4ECTA 3ISND 4UOFA 1BLUA 1FKPB 1X8DA 1ZAXA 2BQ3A 4DL3A 3FDSA 1S0OA 3OL8A 1CJUB 2DGVA 4F3OA 5CA5A 2XSJB 1U8WA 1FDAA 3MI7X 2EFQA 3MEEB 3RTVA 2CPIA 1XR5A 3HVAA 2AZ3A 3JSRA 3PYGA 4ETZA 2CDQA 2MLXA 2GVDB 4NASA 1AYEA 5E5NA 1MWZA 3N01A 3G87A 2MY7A 5CYQA 2D7SA 2R2SA 2VPXB 3QATA 3EDRB 4TNOA 5HVGA 5BR8J 4RUHA 1S7HA 2XO6A 2HRYA 5JJBA 3OTEA 3N79A 2PMWA 3PW0A 2F8HA 2PN6A 4AXIA 1TMJA 4A8YA 4LMZA 3MR5A 3GSDA 1UFWA 3DMJB 2B6AB 4OYIA 1WC5A 3TQ1A 1TP7A 1AUDA 3QJPA 3KNAA 4IO9Q 4QR1A 3KUGA 1U26A 1BE4A 4N47A 2VQEF 1S1UB 2C3PA 2YWKA 4QQBA 1G4CA 4LF8F 3SV4A 1S1VB 3IN5A 3KNGA 1S6QA 4H4KA 4ZP7A 2HIQA 2CPFA 1S76D 1ZM4A 4DPYA 4ZVUB 3QRQA 2PEBA 3ZFVA 1D8ZA 2E5LF 2AEJA 3KK1B 1WHXA 3RUBL 2IMWP 1FFSB 3IR6B 1RK8A 2D3ZA 2V4RA 1G3OA 4ZJQA 1XERA 3WIUA 4K4SA 3BSCA 4JI0F 2R2UA 3I32A 4DV5F 1WEZA 4EUVA 1N5YB 1YJTA 1RWKB 3C16A 2GJFA 4TYAA 4GKJJ 5IWAF 4F67A 2LA4A 3SI8A 1UW4A 3UE2A 2GVZA 4ZDNA 3ENQA 1T0TV 1YJUA 2UVWA 4DPUA 3LOUA 3TR5A 3NY0A 2JDJA 4O4RA 2B4VA 3MAAA 1TZ0A 2DITA 3KLHA 3CD0A 3QWPA 4OZ3A 1N6QB 5B0DA 4YB7A 2ERRA 3SCJE 3PX6A 2GW8A 5K14B 4F36A 1VQ5S 5IFMA 4NWBA 3EYZA 1J5OB 2D3O1 3VQTA 2RKIB 3N6LA 1M5VC 2R7OA 2DNQA 1FTRA 4Q8EA 3TAMB 5CH7B 5DM7Q 4WE1A 2ZBQA 1LOUA 4OZ2A 3HJVA 1KFSA 1S48A 2DGSA 3CDEA 4WPAA 3CNQP 5L1JA 2R7TA 3F56A 3I9V9 4KHPJ 4DZ6A 4I6WA 3TANA 1WF1A 3AJDA 2ZH3A 4KTQA 4F3MA 4NLTA 2ZHAA 2ZFHA 1REVA 4FF2A 3UWTA 2HWTA 5D0RA 1PC4A 3OR2A 5AJ3J 2CZ4A 1WKLA 4EK2A 4Y0FA 4I56A 1FWLA 3L4BC 2ZZMA 3CT9A 4Y00A 4O0NA 1EHWA 1FJGJ 3PG9A 4ZVPB 1YRXA 2BE2B 2VDHA 3U7JA 2AZ1A 3B4MA 4ZVRB 2HWIA 1S6UA 2OP5A 4A8SA 1LWCB 2EK1A 3FQKA 5B0GA 2FJEB 3V4IB 1JJCB 4LRFA 2HQ3A 1KKHA 5FD1A 4EFAC 4DUZJ 2HNDA 4BHQA 3W2WA 5H9FK 3AOAA 3P49B 1WDDA 3UVJA 3G8SA 1LXJA 4ANCA 1BHNA 4ZPCA 2DH8A 5CXTA 1PBUA 3RBZA 4IRKA 4NLRA 2FC9A 1FVQA 2B5JA 2Q79A 2XI2A 2W8LA 1N33J 5HQ8A 4NLVA 4G3IA 4LR7A 3D6MB 4JYAJ 4I2PA 5I3UA 1ZA2B 4OYOA 2H4WB 1R31A 4WYWA 2GAHC 3UD4P 1TUWA 3NBPA 2VDIA 1T95A 2H54B 3DRYA 3PYDA 4BC7A 3C15B 2WHOA 2OTJS 2WTFA 3QSIA 2UU9J 2UUBF 3MFHA 5D4LA 2ALYB 2RQ4A 2MKKA 3ENVA 2GV1A 5CZVA 1UAWA 4PG7A 2HHWA 1HBOB 5LOQA 3MR7A 1R27B 4WBFA 1SJFA 3GV5B 1UKUA 2K7KA 1U09A 1C1BB 4K4VA 4NXNJ 4C97A 2R7XA 1IR0A 3AY0A 3T1HJ 3RRGA 4FKYA 2R2TA 3CCVS 1Q7YT 3FSXA 2RS2A 3VVUA 3M8PB 2HURA 2XCAA 1Q5YA 4DR1F 3D6TB 4CYUB 4CM2A 1LNQA 1JLBB 2L3MA 1CQMA 3E2EA 3Q8SB 4P75A 2PFDA 1HBMA 2IM1A 2VG5B 2YBVA 4CNYA 2DXEA 3CD5A 3R7BB 4OHYA 4NPOA 4PR6A 2NZ4A 2CPHA 3ILLA 4F2RA 4DQQA 1UWBA 1RTHB 1ZYQA 2WBRA 3ETOA 4ZLNA 2CJ9A 2C3UA 4EZ9A 2IJFA 2E9TA 3PEHA 3KLIA 4ZS6A 4ELUA 1U8SA 3DLEA 4CH0S 1FRHA 1UETA 4GC7A 2MDAA 1Q95G 4DFPA 2XZTB 2LEBA 3DRRA 4URSA 4ZVEA 1IWAA 2IAJA 2K1RB 5J2MA 4DL7A 4C7QA 3AXMA 3DKDA 5A2QU 4TY9A 2D69A 3R97A 3UFCX 1LWEA 3JQKA 3RG6A 3D1HA 1S1TA 2YNHB 4TU8A 1AFJA 2VBZA 1KQKA 4MKYA 3D2WA 1QSYA 2L9NA 4RU9A 4DFKA 1UZHA 1JLCA 4DSLA 1WF0A 1Z1ZA 1TKZA 4C3LA 2EFNA 3TVKA 4RNHA 3H2LA 4ZCKA 4X66J 4A4JA 3AXKA 1U2RA 3D67A 2N7CA 3KLHB 4PWDA 2QE5A 1FWPA 3IR7B 3L95X 3EGZA 1KEKA 5FLXY 1CS4A 3VAMA 2E1MC 1LWXA 2DR6A 4NLGA 4A8QA 4WTYA 5F8JA 4YY3J 5KFCA 2HVDA 3TARA 3DLLQ 1I1GA 1XMQF 3VAJA 3IO1A 3W2VB 3PJXA 4JI3F 2WW4A 2VV5A 3KJVA 3AD8C 1SKSA 2XB2D 5J1PA 5C2CA 2VICA 4DR4F 2OEJA 4A8XA 4ZITA 2LFVA 1UA1A 4ZPBA 4TLQA 2CG4A 1VK3A 3CEDA 2HLTA 5KFAA 4NCBA 3AJ1A 3TUPA 2VA2A 1WOPA 3M2VA 3Q8YA 4MFBB 1KQFB 3N6NA 3HVTA 1YTYA 3W9IA 2B4OA 2MHNA 3BDEA 4DV3J 4PUOA 1PYOB 1VBYA 4PQUB 3Q8RB 3VHQA 3MM8A 2YQ0A 1Q53A 4ED8A 2YWEA 3MAQA 3MOZA 4DBQA 2HRTA 1U45A 1FF2A 5KG0A 3H5UA 2CNOB 1UL3A 4I7FB 2B3TB 2ROEA 3N4WA 4E98A 2ZOMA 3QBCA 3WQPA 2EFOA 1MU2B 1UVLA 4B9TA 1FNOA 2UUAF 3BGLA 4I6YA 5ETOA 3BYPA 1T9VA 1T9WA 3GIRA 3N5FA 4KT0C 2HNDB 3CPWR 2BRLA 4H4MA 5A8WA 2NQPA 3NWGA 1L3SA 4NLUA 3MECB 3TOQA 3KK3A 2VF3A 1U1PA 1HNZJ 2J9DE 3M4XA 5LMUJ 3M8RA 4C9DA 1D9FA 2AU0A 3KHHA 2B7CB 1UVNA 1RB0A 5ETMA 3V81B 4U7CA 1HL6A 4B3OB 3QMQA 3BGOP 1H2VZ 2A6OA 1CJKB 3GTYX 2XS7A 2EVZA 2V2QA 1M1GA 1PAEX 5HSPA 3OPKA 1W26A 2X51A 2AGOA 1RHQB 2DHXA 2CQ0A 2E7VA 4FPIA 4DR6J 4FYDA 1U1KA 3QGIA 4NXMF 2HFSA 3GR1A 2VKRA 1MW7A 1SV5B 4FPRA 4J9NA 5F0WA 4DR3J 4QWEA 3ZXWA 2XTJP 2ZBCA 1PAUB 1IBKF 1HW8A 1FJEB 4Q0BB 2HGNA 4ER8A 1WHVA 3GYNA 1IR2A 3DC2A 4Y2AA 1PYSB 1EP4B 3D6FB 1YI2S 2M8HA 1XR6A 1U2CA 2QA1A 1FJCA 2ZJRQ 3ISZA 4K5RA 4YUDA 4IDKA 3UN5A 1S1XB 4OX9F 1VR6A 1TQLA 4NLXA 3CC2S 1CVJA 1Q8BA 4Y2IA 1Q8KA 3JB9k 1UTAA 1Q8LA 1SI9A 4ATNA 5HQMA 4RNOA 1NM2A 2B9WA 4OZ1A 4I2QB 3A1YG 4C8OA 4OZ5A 1HI0P 3Q89A 3AOBA 1UVJA 3SSSA 5H9FJ 1VBKA 1FEHA 3JSMB 2JZ5A 3J7A1 4RW9B 3TWZA 2DRBA 4DOZA 1RISA 1TR0A 2KDOA 2R8IA 1NDCA 2EFVA 4H4OA 1NZAA 4DR7F 2E66A 1Q5VA 1R0BG 2EEYA 3TA1A 1VISA 5AE3A 2B51A 2ZM6F 3EZOA 1RT2A 2C3YA 3DN9A 3CDUA 1HPZB 1RBLA 3MOJB 3UNYA 2M8DB 3HKZD 3PCOB 2ZBIA 1KBRA 1FNXH 2AQ4A 3ONQA 3OLBA 1LWEB 2CQ2A 1JKHA 3NNHA 5K5MA 3M2UB 4DFMA 1U0HA 1WHYA 4RBUA 1JLAB 2AP6A 1U6ZA 3UCUP 2QEXS 3KHRA 3D54A 4P2SA 4O4GA 3OUYA 5IC6B 1N34F 1YJVA 4RWXA 1FT8A 2GO8A 5BYSA 1Q79A 3PJWA 1FE4A 4USVA 2XWXA 2KN4A 3IGNA 3BQ2A 1JMTA 2HVZA 3KJFB 1S6PA 2XWYA 1M1HA 4DSKA 1RT1A 1HA1A 1FK9A 2W7OA 4CLPA 5LMNJ 4A48A 4HVZA 2PE8A 4NCGB 1FKOA 2DIVA 4K4WA 2G13A 4KPCA 1XMOJ 2YKQA 3OSPA 2XMMA 2Z8QA 2VG6A 4C8KA 4YB1P 1X60A 1RTJA 2I38A 2RD5C 4EEYA 4LR9A 1N52B 5CAAA 1AT1B 2FGCA 4Z2XA 4B9LA 4USWA 3SV3A 2A0FB 3AQOA 4UOGA 2GIQA 1ZS6A 2KZMA 2E5GA 4D3GA 3T6BA 3H20A 3FCHA 3M1VB 2A6MA 3GZ7A 2ROGA 2UUWA 2FJWA 4X65F 2Y1LB 4CT9A 3K5OA 3EM1A 3HHLC 4WKRA 3DOMA 1HNVA 4YB6A 5BJRA 2K2PA 2I5JA 2OHDA 4O3RA 3HP6A 4MK9A 1K8AT 1E6VA 4IH5A 1JJHA 4MYTA 3ADAC 3EJMA 1YHQS 4HKQA 4LRCA 3TYTA 5C2GA 4NYPA 2FLOA 3BQ0A 4Z7YA 3N9UC 4MIWA 3AD7C 2IC3A 1CSJA 1J5EF 1AFIA 3C6TA 1VQPS 4H4MB 4DUYJ 1LKZA 3GR0A 2VJUA 1WC0A 1QUPA 2DISA 1VQNS 4ZHRA 3CE8A 2GMJA 1CG2A 1S9EA 5ETLA 2IJRA 2RRNA 1F5AA 7AT1B 3E3XA 3L7UA 3Q24A 2CADA 3TUZC 7FD1A 2OGUA 4CIOA 1SH0A 3ILOA 3Q0AA 3M6WA 4ENOA 3EPIA 2E9ZA 1E6YA 1DLOA 4L3NA 5F8LA 3M30B 2HHHF 5AXKA 4NYZA 4MK8A 4U7UD 2VA3A 2YY3A 5K8PA 3AOCA 3UI3A 1KTVA 2EG2A 3J7YI 3J80Y 4GMKA 1B70B 4MAKA 3NGTA 5HL7Q 4KYZA 2EKYA 4K2XA 2RMLA 1LXNA 3Q83A 4JI6F 5L39A 3HX9A 1HQUB 4QIEA 2YH0A 4ELTA 4JV0A 3WX8A 4JV5F 4PYDA 3I55S 1NUEA 2E1RA 3ZTPA 2D9OA 5J1EB 3E01A 1RTDA 4GVBA 2YNIA 2RRAA 2DR9A 2RH3A 1NKEA 5T7LB 1GXTA 1ZAVA 1UP1A 3JAMY 2HK2A 2L41A 1FRMA 5DRKA 2DNLA 4PCQA 2QYGA 1RT6A 2C2ZB 1EX8A 2XO7A 4QZVB 4JI1J 4O3OA 2KHCA 3M6XA 3BN7A 4PG5A 1IM4A 2PIIA 1X5OA 4OYPA 1HNIA 1HWKA 5KFGA 4AQYJ 2KM8B 4ECWA 3D68A 4B08A 3CCUS 4PPDA 4OJHA 4R25A 3T6JA 2MSTA 3M8QB 3LQVA 4X4QA 4LQ3A 1HBNB 2M9KA 1D3WA 3RR8A 2W9CB 1M5HA 5T41A 4FYVB 3EUNA 2GHPA 2DHGA 2ZC3A 1K73T 2KJVA 1FXLA 1H2TZ 2A18A 1NBEB 2XMWA 1RT2B 2AD9A 3J81j 2DY9A 4ELVA 3VGTA 3MMBB 5C42A 3KLGA 3J7YU 3HLUA 3NGKA 1UZDA 2FHOB 4DQRA 1B7FA 4TY8A 2LVWA 1HIYA 1JKHB 3LPEA 2UVUA 8ATCB 4ZCLA 4G6VB 3DU6A 4LREA 2W25A 5IQQA 3RW6A 1TMMA 1IQZA 4ZLJA 4ZJOA 2QT7A 1K47A 1ELOA 3VTIA 4M5HA 2BJ3A 5FDLB 1RT3A 3DDIA 3E51A 3MAHA 3L3CA 3CJ8A 5HP1B 5KOWA 5ETTA 4WU3A 5E33A 2BA9A 2QV6A 2QGFB 1M0SA 3IA0A 1HD1A 3R5CA 3LP1B 2BJ8A 2XMUA 1D1UA 3GLJA 3MR6A 2Y0BB 1Y11A 5F8MA 4G1PA 2YKNA 3BF4A 4L73A 4MKBA 2QG9B 1HYSA 3CD7A 3DXBA 3AJ2A 2RF2B 2NPIA 3RAQA 2ZBPA 4KC5A 4LF4F 4KHRA 4F04B 3HO1A 4BWJA 5EDWA 1NJZA 3PW4A 2ALZA 3LUYA 2QFJA 2V2KA 1URNA 1QUVA 4ZKAA 2QMUB 3M32A 2GZOA 2J7UA 2PMZD 1T9XA 3KHGA 3K5LA 1HWUA 5B09A 2ZHOA 3K58A 3C3LA 1SUQB 2V8VA 3BO2A 3HSDA 5HI7A 2CKWA 3RBDA 1VC6A 1EQMA 5KFIA 1NK6A 2K3IA 4JUZA 5LJ3Y 1UVIA 2KXHA 3AQPA 3HMJG 2YWWA 2CPYA 1PKUA 2YQ1A 1CJVB 2LMIA 1KFDA 2N4DA 3KJQB 1DQ8A 1MROB 4DV7F 4TXSA 2A2DA 1ZPVA 2Y1RI 2CQCA 2WOMB 4WIIA 4IH7A 2FVQA 2W8KA 4K5SA 3FVYA 2UUTA 4ZJLA 3AA9A 1E6YB 1DLOB 4OX8A 8RUCA 5E3AA 1Y00A 2I9SA 4ID5A 4R5PA 4BLGA 4X4SA 1NKBA 3CVKA 4KRWA 2VOOA 3OL6A 2YWFA 1RQ0A 4QYZK 2Z57B 1JXVA 5ETSA 1QDUB 2JHEA 4DR5F 4FKXA 3ZO7A 3R5BA 3BPDA 1UEVA 2KVQE 1HWIA 3KK2B 2HMIA 4TQRA 4FVMA 1A6LA 1D0EA 1HLWA 2MKJA 3UN3A 3MCOA 1MWYA 4CP5A 3KLFB 4KE5A 4RNNA 1LW0A 2APOA 4C8LA 1C0UB 2MQOA 1OS5A 3V6DB 2V8GA 4DV6J 3AHPA 3QIPA 1QAYA 2YKMB 2VBXA 4A47A 2UUCJ 4DLGA 4AUKA 3I4PA 2ZH5A 2HG4A 4O3QA 2N7YA 2F7VA 3TNVA 1NK7A 2RU3A 3BO4A 2IYIA 3I0RA 5KG1A 3IBFB 1SIWB 4RO0A 4R0JA 2QC3A 1HNXF 1TK0A 3OSNA 4LFBF 3I96A 4ANDA 4F2SA 3BREA 2V68A 2XNQA 3PW5A 3KG1A 2JLGA 3BM7A 4W90B 2P5VA 1WNEA 1MN7A 5J1NA 3RBXA 1RWVB 4EBCA 3V4MA 1IKYB 2KFNA 3W63A 3W5ZA 4OFZA 3BGUA 3R7NB 3T41A 3IAS9 2R7RA 3R1HA 1KLNA 4FYXB 4ILMA 4M5DB 5EWFA 3FQLA 3G96A 4K4YA 5E2QA 3I0SB 3RRKA 2W2NP 3NOGA 3MTJA 5A8RB 2C3OA 3BGFA 2COLA 2CQ4A 3JYTA 1HD0A 3DNCA 4JI5F 2QZ8A 3ISNC 3HM9A 5B0CA 1NHUA 1FHTA 3NS6A 4WIQA 1SKWA 2ZITA 2FQQB 3PW2A 1CULA 2AWZA 2WSCC 4AL7A 4LRBA 2XS5A 3HVWA 4WZQA 4DUTA 1N5VA 1XBWA 2HBQB 1MMDA 5DDPC 3HHEA 4ID8A 4MH8A 2JOQA 4X4OA 3A3OB 2J5AA 1I94J 1X0FA 3QZ8A 4M94A 3PIOQ 1R6VA 4WFYA 3UR0A 2B4UA 2M7SA 1M90T 3CCQS 1RUSA 1DFDA 1ZM2A 1FRXA 1QE1B 2UXBF 4FN5A 3R9LA 4USMA 2DNOA 2XYHB 3KLEB 2H5JB 1U1NA 5M2RA 3QGGA 1HHTP 4KFBB 1VBXA 5J2PA 5LM7E 1RKIA 4EYHB 2JSXA 1NSAA 3HT3A 4H54A 1CJTA 3UR3C 3IWXA 3GJRB 4HTJA 1Q81T 4I4BA 4RW6A 3MM6A 5E41A 3OT9A 1U02A 3FZ2A 5KT3A 3GCXP 3JTOA 3CSKA 3TX0A 4HHHA 3KLVA 1GFWB 3H5YA 3HXMA 2IA6A 4OI6A 3TUJC 2GQQA 3PXGa 1G6BA 1NRKA 3VGSA 1V3SA 1UWAA 3D7SB 3LGHA 3HFKA 1S1WA 1VMBA 3M7VA 4CM0A 2KZZA 2ZNZA 1PJ7A 4IG3A 2L08A 2KFYA 4FDFA 3RBEA 1LFWA 1DAXA 5AJ3F 2HHVA 2DGUA 2X3DA 3X1LB
chains in the Genus database with same CATH topology
3ILJA 3KUGA 2F63A 1TMMA 3HCXA 4M5MA 1DY3A 1F9HA 1HQ2A 3HSJA 1IM6A 3HSDA 5ETKA 1Q0NA 2QX0A 3IP0A 1EQMA 3UDVA 3HSGA 2F65A 1CBKA 1RAOA 4M5GA 5ETRA 4M5IA 5ETTA 3QBCA 5ETSA 5ETVA 4PZVA 1G4CA 4M5LA 1TMJA 1RB0A 3HSZA 1RU2A 5ETNA 5ETMA 1RTZA 3HD1A 4F7VA 3ILOA 4M5JA 5ETQA 4CYUB 1HKAA 3HT0A 3UDEA 3HD2A 2BMBA 4M5HA 4M5KA 4CYUA 4M5NA 4CWBA 4CRJA 2CG8A 1KBRA 3KUHA 1EX8A 3ILLA 5ETPA 5ETLA 3ILIA 3KUEA 1RU1A 1EQ0A 3MCMA 4AD6A 3MCOA 3UD5A 5ETOA 3MCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ILJ A;  3KUG A;  2F63 A;  1TMM A;  3HCX A;  4M5M A;  1DY3 A;  1F9H A;  1HQ2 A;  3HSJ A;  1IM6 A;  3HSD A;  5ETK A;  1Q0N A;  2QX0 A;  3IP0 A;  1EQM A;  3UDV A;  3HSG A;  2F65 A;  1CBK A;  1RAO A;  4M5G A;  5ETR A;  4M5I A;  5ETT A;  3QBC A;  5ETS A;  5ETV A;  4PZV A;  1G4C A;  4M5L A;  1TMJ A;  1RB0 A;  3HSZ A;  1RU2 A;  5ETN A;  5ETM A;  1RTZ A;  3HD1 A;  4F7V A;  3ILO A;  4M5J A;  5ETQ A;  4CYU B;  1HKA A;  3HT0 A;  3UDE A;  3HD2 A;  2BMB A;  4M5H A;  4M5K A;  4CYU A;  4M5N A;  4CWB A;  4CRJ A;  2CG8 A;  1KBR A;  3KUH A;  1EX8 A;  3ILL A;  5ETP A;  5ETL A;  3ILI A;  3KUE A;  1RU1 A;  1EQ0 A;  3MCM A;  4AD6 A;  3MCO A;  3UD5 A;  5ETO A;  3MCN A; 
#chains in the Genus database with same CATH topology
 4C11 B;  1KDN A;  2ZZN A;  1BWV A;  2XGQ A;  3FEX B;  2M88 A;  4DF8 A;  4KKO B;  5HAO A;  3TA0 A;  1M5O C;  4WZM A;  4CLS A;  2BV3 A;  2ROP A;  3PX4 A;  2V4J A;  1YBU A;  3IC1 A;  2HLU A;  4WFA Q;  3DM2 A;  1D09 B;  5HMZ A;  4B3S J;  4DV1 F;  3DOL A;  2L9D A;  1UVK A;  2DGO A;  5IC4 B;  4R5P B;  2BMB A;  1GQE A;  4LF5 F;  1Q86 T;  4LF9 F;  5LXR A;  4LF6 J;  3LAK A;  1IKX A;  2LEA A;  2QL7 B;  4RUA A;  4C8Z A;  2JVO A;  2DEJ A;  1RE1 B;  2W24 A;  2FPH X;  4OYB A;  2VC1 A;  4X64 F;  4EGL A;  2CQB A;  1K44 A;  4DV0 J;  3HHL D;  2LQ8 A;  4RW7 B;  1KLM A;  2OPR A;  3OR1 B;  1B99 A;  4HYK A;  1GEH A;  1ACM B;  1FEE A;  4OJG A;  4ZK7 M;  4RUC A;  1R43 A;  4LVO P;  3D0H E;  2R2R A;  5DZ7 A;  1PCA A;  4LSZ B;  2CA9 A;  1B4S A;  5HBM B;  1UVM A;  2W7P A;  3IP0 A;  2Y9H A;  3GJS B;  4L76 A;  2HWH A;  1RTZ A;  1P1L A;  4F4K A;  2Z0G A;  4J91 A;  3MM5 B;  2Y1I A;  1YBT A;  1NME B;  2E1P A;  1VOM A;  3I5A A;  4P52 A;  4OI1 A;  1T02 A;  1NKC A;  4LFA J;  3OFG A;  1OSD A;  3OD2 A;  1NPK A;  3QO9 A;  4DX5 A;  3SZ2 A;  4CTA B;  1K1S A;  4DV4 J;  4PXB A;  3DI6 A;  3SCL E;  9ATC B;  3VGU A;  4DL4 A;  4XAK A;  4OHW A;  2NSC A;  2ZD1 B;  1T03 B;  1ZA1 B;  4B9V A;  3A8E A;  2Z30 B;  4NA2 A;  1FE0 A;  4DSF A;  1LWF B;  4U95 A;  2R4F A;  2LU1 A;  1C1C B;  3GG0 A;  3A3N B;  4OI3 A;  3NKY A;  3HSJ A;  2FJB B;  3K59 A;  2KFZ A;  2HYI B;  2WB4 A;  3G2X A;  3BKU A;  1EIY B;  3CF5 Q;  2FD2 A;  2XM3 A;  4DR2 J;  4CNZ A;  1JJ2 R;  3HPO A;  1VRU A;  3A8J A;  3VGV A;  5G4D A;  3PO5 A;  5U47 A;  1KSP A;  4EU0 A;  1TL1 B;  2WVF A;  1DY3 A;  1NO8 A;  2ZUA A;  2FYX A;  3U27 A;  2W9B A;  5K8O A;  4QYZ J;  5IT0 A;  3H4D A;  3CCL S;  5F8G A;  4PZV A;  3DOK B;  2EPI A;  3I87 A;  3PTW A;  2ZVI A;  1UA0 A;  1F1B B;  2AEM A;  2IDE A;  2Q43 A;  3H5X A;  5DGB A;  2N82 B;  4Y34 A;  2OUG A;  2V2V A;  1X4C A;  5CYM B;  2G1D A;  3SQG A;  2HFN A;  2GJI A;  2JLF A;  1UMJ A;  2EBE A;  5LSL A;  3EE3 A;  5ETP A;  2QJ3 A;  4ICL A;  4ZP8 A;  5F3T A;  1IUJ A;  1RSC A;  2CVE A;  4URQ U;  1F2H A;  2G2Z A;  4LT6 A;  4IFV A;  2BW7 A;  4TN2 A;  3UNG C;  2DJW A;  3DU5 A;  2QRR A;  4MYU A;  4ZVT B;  2O3D A;  3UPF A;  5D3G B;  4LF8 J;  1X9W A;  2HGL A;  4ED4 A;  3DDK A;  3PHT A;  1RAE B;  4Y2M A;  3MMC B;  2HHQ A;  1BXN A;  4FXV A;  4RBV A;  3FBC A;  3FMW A;  5A76 A;  2FVP A;  3PJ9 A;  3R5J B;  3IGV A;  2E5L J;  2LU2 A;  1GT8 A;  2GX8 A;  2X3G A;  5J2P B;  4K7Q A;  3Q22 A;  5HN0 A;  3MUV P;  5G0R A;  3ENW A;  4RX6 A;  1SJQ A;  3WC2 A;  3DYA B;  4RW6 B;  4YY3 F;  1NJY A;  4JI0 J;  4WJB A;  2PGC A;  1RAG B;  1X4G A;  4DV5 J;  3VZH A;  3MM7 A;  2JEI A;  4B3R F;  2XSF A;  2NXU A;  3ET6 B;  4ES3 A;  1M5S A;  3VF0 B;  4Q8F A;  1FJ7 A;  5J2Q A;  1UW9 A;  3CDA A;  4U6P A;  1FKP A;  3NCQ A;  4EBE A;  4KGX B;  3MPU B;  1CJU A;  1EET A;  1LW2 B;  5EUH A;  1XR7 A;  1Z2L A;  1IWG A;  2D1C A;  5D6G A;  2XSJ A;  3I6P A;  2MYF A;  3NMA A;  2MKY A;  3LP0 B;  4GKK F;  1TAU A;  1UEK A;  5KFW A;  3MEE A;  4F26 A;  2J8A A;  5K20 B;  2AX0 A;  2NUH A;  3EXC X;  1ZM9 A;  2FVS A;  4DV3 F;  1VQ7 S;  3CDB A;  2R42 A;  3IG1 B;  2B56 A;  4LSL B;  2KM8 C;  5DO2 A;  3LAN A;  2GQ2 A;  5KFO A;  4CO3 A;  4CLW A;  2C2K B;  2CUY A;  4K2J A;  3JTP A;  3GB0 A;  3QWU A;  4DCJ B;  2NS1 B;  3NMR A;  2X1A A;  2K06 A;  4Y6I A;  4DU8 A;  4ZIW A;  2DNZ A;  1SC1 B;  1HW9 A;  3CJ2 A;  1EKR A;  2AGQ A;  5CCL A;  3DMJ A;  3P5T L;  3MD1 A;  2DNH A;  1KON A;  3JXO A;  1SH2 A;  3F44 A;  3CJ5 A;  2JJ4 D;  2HS4 A;  2XC9 A;  3C19 A;  2CQP A;  4KR0 B;  2FLP A;  3W8P A;  1S1V A;  1K0T A;  4G1Q B;  4LBI A;  4BWM A;  4ZPD A;  1RAF B;  1KVK A;  1GXU A;  5KFP A;  1T8E A;  2R9L A;  2VOP A;  3NGR A;  1XNR F;  1VQY A;  1NCL A;  2VON A;  3ETM A;  4R0E A;  2ZDO A;  2U1A A;  1BQX A;  2ILZ A;  3MCS A;  1NU4 A;  3RJM B;  4EYI B;  2RIL A;  2OPP B;  3BS9 A;  2V9K A;  2RE1 A;  2KT3 A;  2F9D A;  4KY3 A;  3DHX A;  1LQ9 A;  1TL7 B;  2MQ8 A;  3H8Y A;  4XPC A;  3ICL A;  5GVQ A;  3PZP A;  3QJL A;  2N3L A;  2VBY A;  4X4P A;  1SC4 B;  4YR3 A;  3OW2 R;  1N5Y A;  1KS2 A;  3TJ9 A;  5E7O B;  1O6X A;  1SIZ A;  2IDL A;  3BR8 A;  4DR3 F;  1S9F A;  1WDT A;  1G2E A;  5A8K B;  1YGY A;  2YWG A;  2QLW A;  2H48 B;  1IBC B;  2UV8 G;  3T3F A;  4FVC A;  2W9A A;  1L3U A;  2WON B;  1SQG A;  2HQG A;  1QVG R;  4HDG A;  3QGH A;  3ZC4 A;  4DV2 F;  2RS8 A;  3TZY A;  2BYC A;  2ZHB A;  1U2F A;  1O51 A;  3J81 Y;  2ZZT A;  1R0C B;  1R89 A;  1KVJ A;  1QAI A;  1PO6 A;  2WK4 A;  1AZS B;  2XYP B;  2ZE2 B;  3C14 B;  5K14 A;  1RKJ A;  3M8Z A;  4FYW B;  2KVI A;  1B3T A;  1J5O A;  1RXO B;  1YDL A;  2I1R A;  4ZVG A;  4EBD A;  1YZ7 A;  3V6K A;  2RKI A;  1VQL S;  3I56 S;  2UUB J;  2IJN A;  5HMW A;  3NRB A;  1FXD A;  1CLF A;  5K8M A;  3TAM A;  5EX3 A;  3R5G A;  2CZV C;  3PM9 A;  4ZVO B;  2V69 A;  2M70 A;  4MTP A;  4OLP A;  1SH3 A;  5LL6 d;  3OLA A;  3WZ0 A;  3GIJ A;  4Y3C A;  2HHS A;  3JQM A;  4DR1 J;  2DNR A;  2F65 A;  4Z7C A;  3MM9 B;  3NAH A;  3EPG A;  2P9G A;  4N77 A;  3VZI A;  3EVO A;  4KV8 B;  4TU7 A;  3KUE A;  5KFM A;  3KHL A;  2F8M A;  5GAH I;  4ECV A;  5GAG I;  2VBW A;  2NRE A;  4MJK A;  4WXO A;  2BE2 A;  1NHK L;  3TP2 A;  1F3V A;  3HUL A;  4YEA A;  1Y10 A;  1U6F A;  1GXL A;  5L9X A;  3VWS A;  4XPE A;  1LWC A;  3CCR S;  3MUR P;  3V4I A;  1A9N B;  1JLF B;  1IJE B;  3F73 A;  3NL0 A;  1XMB A;  2FLL A;  1GTH A;  2V2Z A;  1RA7 A;  2VPW B;  5H1S V;  4B3T F;  4EO8 A;  3CC7 S;  1VQ9 S;  3T5H A;  3RW7 A;  4CO4 A;  3EXY A;  2J6U A;  3ZZP A;  1Q4R A;  2FJV A;  3FKB A;  3HSZ A;  2MKI A;  1ULR A;  2Z4P A;  4MIA A;  5DG8 A;  3KDN A;  2HQD A;  1CC7 A;  4ZCM A;  2JX2 A;  3SYZ A;  4X62 F;  1FD8 A;  3M9N B;  2HNZ B;  2J6S A;  1URR A;  4K0K F;  1ZM3 A;  1YRT A;  5AE2 A;  2GFF A;  5J2Q B;  3B8H A;  1F60 B;  4XDC A;  4C48 A;  3Q23 A;  3C15 A;  3S1T A;  4C0B A;  1JWW A;  1EET B;  3LP2 B;  2JWN A;  4I6A A;  4X4R A;  1A0O B;  1WOO A;  4F0H A;  2NLW A;  2ZH9 A;  3C6U B;  1RYS A;  1N0V C;  2LKZ A;  3HHL B;  3FFI B;  2KU7 A;  1Y0H A;  1V5I B;  4KH1 B;  1HBO A;  3HK2 A;  3Q8U A;  4JI3 J;  3AAW B;  1C1B A;  2HHT A;  2PMH A;  3Q8Q B;  4KO0 B;  2DNK A;  4WTO B;  2AKW B;  2XQC A;  3C2P A;  2CQI A;  2UXD J;  4DR4 J;  2G0I A;  5GAH U;  4KGV B;  4L74 A;  3BR9 A;  3M8P A;  2MZQ A;  5GAG U;  1NHV A;  1X4D A;  4CYU A;  4AYB D;  4CRJ A;  3OTB A;  3GV8 B;  4M1K A;  4JV2 A;  1RJJ A;  2NYI A;  1JLB A;  4J37 A;  5C24 B;  2MKC A;  2CAJ A;  2DR8 A;  2MZS A;  2VG5 A;  3IXQ A;  3DRP A;  3CUN A;  4WFX A;  4F7V A;  4ALZ A;  2MGZ B;  2FHJ D;  2V4Q A;  1RTH A;  1VRT B;  3NS5 A;  3O5T B;  3T1A A;  4QW8 A;  4Y28 C;  5DQI A;  5KFR A;  2GML A;  3SCK E;  3GPA A;  2FJD B;  4JI4 F;  2FZC B;  5HMY A;  2EW9 A;  4ZN3 A;  4KIA A;  1GMV A;  1TTH B;  2ZEJ A;  5HMX A;  2LXF A;  2VFR A;  1CPZ A;  3GMG A;  4FP9 A;  2CJY B;  1QAJ A;  1TUV A;  2ABY A;  3UDL A;  4F50 A;  2UUA J;  1FI4 A;  2K1R A;  3CTR A;  3W8G A;  4QWB A;  1C0T B;  1PYT A;  2C28 A;  5D78 A;  5LT5 A;  4G65 A;  4ETX A;  1HQ2 A;  2LQ9 A;  3CJS A;  4HDH A;  3HD1 A;  2YNH A;  1OJ4 A;  3J7A N;  2FGO A;  4AD6 A;  2BQU A;  2ZJP Q;  1N36 F;  3CIZ A;  4URG A;  4KB7 A;  3IS9 B;  2OPQ B;  1FD2 A;  2ATC B;  1I6J A;  1SC6 A;  4MKV A;  4X2B A;  3GON A;  2C2R A;  2OJ3 A;  4JI1 F;  4N41 A;  3BPS P;  4PXD A;  4KGZ B;  4PAA A;  1RT7 B;  3TO8 A;  2CPD A;  4ILL A;  4DCO B;  1VJW A;  3W2V A;  2KT2 A;  2V8H A;  2DIU A;  3NGU A;  3PV8 A;  5EGY A;  4U7U K;  2DD8 S;  1IBK J;  3AD9 C;  1XTZ A;  2QTW A;  2VUG A;  4NEY A;  3D5M A;  3W62 A;  4CLK A;  2UXC F;  3N0V A;  5L38 A;  4ED3 A;  3W64 A;  4EMD A;  4BBY A;  1KR4 A;  3NP5 A;  5HAT A;  1VQO S;  1YIT S;  4I68 A;  5EHH A;  3CJK A;  4FZV A;  4OX9 J;  5HO4 A;  4IO1 A;  5HRO B;  4MFB A;  4WWS A;  4HL9 A;  4P2M A;  3B6B A;  2XNR A;  2C2N A;  1Y5L B;  5DLG A;  4PQU A;  1RWW B;  1U25 A;  3TZX A;  1R0A B;  4DF4 A;  4FS1 A;  4RUB A;  2IVM A;  1BQN B;  5JUM A;  1IN0 A;  5B08 A;  3DRS B;  3PEJ A;  3AB2 B;  5F41 A;  2QMX A;  1KHV A;  4I7F A;  4FBT A;  2YKP A;  4LF1 A;  3QRP A;  2DPJ A;  3D3B J;  3CIM A;  2QO3 A;  4KGK A;  1N32 F;  1MU2 A;  1VJQ A;  2EKN A;  4OMF G;  3VR1 A;  3NLC A;  2MQP A;  1SJ4 P;  1JLQ B;  4DR7 J;  3BN4 A;  1TL3 B;  2HNY B;  1IBM F;  1GMW D;  1N8R T;  4I64 A;  4AL5 A;  2V63 A;  2XMJ A;  3MEC A;  2HFV A;  5DJB A;  2ZM6 J;  3KJN B;  2CWX A;  3GJT B;  2HVE A;  4M95 A;  3L09 A;  3S01 A;  5A0Y B;  3V81 A;  1VLO A;  2QLX A;  3D66 A;  4B3O A;  2F4F A;  2ATL A;  3MPD A;  1CJK A;  1ARO P;  4DG1 B;  1PJ5 A;  1IXK A;  5KT2 A;  1N4L A;  2A2C A;  2XUL A;  3C66 A;  2F4V F;  2RUG A;  1UJ4 A;  1N34 J;  2P8I A;  4F4X A;  5HLF B;  1NPR A;  1EZZ B;  1UFK A;  2RHQ B;  2JL9 A;  2CQG A;  1HHS A;  5HVF A;  4RW8 B;  2I6W A;  3CJ4 A;  4UST A;  1SV5 A;  2W2O P;  2C3M A;  2K7J A;  2JC0 A;  2Y1J A;  2IM3 A;  2BM1 A;  4GRS A;  4Q0B A;  5ETR A;  3J7Z 5;  2YX7 A;  1HFE L;  3HHN B;  1RP5 A;  2WAQ D;  1EP4 A;  2IBO A;  3LWM A;  4PG4 A;  4ERD A;  5IS2 A;  1VQ4 S;  4GO5 X;  2XMA A;  2VU5 A;  1S1X A;  4NYO A;  4JI2 F;  5CQG A;  2VQF F;  4QIG A;  4ILR A;  3TZW A;  4J9R A;  4YHH F;  2CIM A;  2OD4 A;  4I2Q A;  2J9E A;  1JLE B;  3A8K A;  2HGM A;  4YOE A;  3DRP B;  2BAB A;  3KMQ A;  3DGP B;  3K8V A;  2W01 A;  1RT4 B;  4X65 J;  3THV A;  2HBY B;  4FBU A;  1SCJ B;  2BEF A;  2XZW A;  1N48 A;  1T94 A;  3JSM A;  4LF7 J;  2JC1 A;  1TKX B;  3CJT A;  5C5J A;  2PA3 A;  4OV6 A;  2KT5 A;  4I69 A;  4RW9 A;  5KFJ A;  5DS7 A;  4PXE A;  1DTT B;  2E1A A;  2JLE A;  2PEH A;  2R3V A;  1GMU A;  1XN9 A;  4CLF A;  4CWB A;  2FB0 A;  4V1A k;  4CH1 A;  1GH8 A;  3EGN A;  1KHW A;  4M5J A;  1HPZ A;  4DWI A;  3UCZ P;  1J5E J;  2MQN A;  4AL6 A;  4W98 A;  4TYB A;  4R8U A;  4ED7 A;  4DQS A;  3IAM 9;  1HWJ A;  2AJ4 A;  3L7P A;  3Q86 A;  1QAX A;  2LDI A;  3M2U A;  5T14 A;  3BEG B;  2GQC A;  2AJQ A;  1JLA A;  3NCP A;  4PG6 A;  1YQH A;  2HZV A;  5KFB A;  1KNZ A;  2HHH J;  3DDN A;  2OPS B;  2FHM A;  4DPX A;  4A8F A;  4ANE A;  4DPT A;  1WSR A;  1KWM A;  4OI4 A;  5GMD A;  4Y2K A;  1PIL A;  4JI6 J;  2AYE A;  4N76 A;  3LPY A;  3ZTS A;  1XIQ A;  4JV5 J;  1TUG B;  2OMO A;  3OXL A;  4NCG A;  1F5C A;  2DVI A;  3H25 A;  3MEG A;  2HS3 A;  4YP3 A;  1V5V A;  2V67 A;  2XY6 A;  1SBR A;  2JVR A;  1WWH A;  1IKV A;  2HZC A;  2OAU A;  3FSI A;  2AGP A;  1SKR A;  1QLN A;  2RU9 A;  3BSN A;  4CH7 A;  2HHU A;  2XHC A;  3HVR A;  3ZTR A;  2OLW A;  3QT7 A;  4U9R A;  1XNQ F;  4OHX A;  3CJK B;  4O3N A;  3D4J A;  3M1V A;  3D1Q A;  2PI5 A;  2MLZ A;  2UV8 A;  1B0V A;  2HW3 A;  1TFW A;  2DHH A;  3EX7 B;  4TQS A;  1VCT A;  3BV8 A;  2RJZ A;  3OVB A;  3ELH A;  3K5P A;  1EB0 A;  4NLD A;  3UQS A;  4QOT A;  2DY1 A;  1YKW A;  3Q2S C;  4ZOS A;  2E5I A;  4DX7 A;  1HBU B;  4J9O A;  2J0X A;  2VIH A;  3WC0 A;  3U02 A;  5E3P A;  3BBF A;  2HFO A;  4E8U A;  3EGV A;  2UZA A;  3IWN C;  2GGP B;  2FC8 A;  2RHS B;  2ACM A;  3NCR A;  1JXL A;  5GAE U;  1L5U A;  2CZ9 A;  2HS0 A;  1NH8 A;  3W65 A;  2WVB A;  4WFZ A;  4GO7 X;  4G1I A;  1IKW B;  4PYA A;  4DX8 H;  2AF6 A;  4ECU A;  1Q8I A;  4YB5 A;  4QPX A;  3FBF A;  4OZL A;  1NK8 A;  1X9M A;  3M30 A;  2I8E A;  1KOO A;  4LSN B;  2E29 A;  5B7W A;  3OFE A;  3JSY A;  5D4N A;  5MLC V;  2MQQ A;  2XY5 A;  2YQ3 A;  4AE5 A;  1QSS A;  3HZE A;  3R6G B;  1BQM B;  3HT0 A;  4DFJ A;  4ZVQ B;  3EDQ B;  2FY1 A;  4WK1 A;  2BAC A;  1HQU A;  3GU0 A;  2RQK A;  3PO4 A;  1OY9 A;  1ITP A;  3CCJ S;  1FWK A;  5D77 A;  3QT6 A;  3I9Z A;  3KXD A;  3TZZ A;  5J1E A;  4IG0 B;  3ENA A;  2OD6 A;  5B0F A;  1OQ6 A;  5KFL A;  4KHM A;  3P8B B;  2DNG A;  4P7V A;  1S7I A;  1HI8 A;  5T7L A;  4NOH A;  3WIV A;  4XDD A;  4WYL A;  3K8W A;  2O5D A;  3U1L A;  1Z4U A;  4QWD A;  3AB4 B;  2BOA A;  5KG6 A;  1VC5 A;  4WXW A;  3GYX B;  4HHU A;  5KFK A;  3UW1 A;  2JEF A;  2LXU A;  2HFU A;  4K4U A;  1HI1 A;  1UEU A;  3VCD A;  1NSQ A;  1F9F A;  1PC5 A;  1RWN B;  3M2R B;  3VAI A;  3A12 A;  1GK8 A;  2KHD A;  4PEO A;  2EWH A;  2BM0 A;  2V34 A;  3HF5 A;  2LDY A;  4USH A;  2OEL A;  4LF4 J;  2MEW A;  2E5H A;  1O0P A;  3M8Q A;  3AA8 A;  1RGV A;  1OMS A;  4EO6 A;  2H9Z A;  1HBN A;  5KFU A;  2BVZ A;  4C6A A;  3ZZZ A;  3GFY A;  2W9C A;  3TW0 A;  2W4D A;  1FX4 A;  5DM6 Q;  1ZZF A;  4NEZ A;  5EN1 A;  3GP9 A;  2OFG X;  4F0M A;  3GSI A;  5KT7 A;  2ADC A;  1S97 A;  1IBL F;  4RLE A;  4X4N A;  3BH7 B;  1W7W A;  3OJS A;  3POT B;  4LF6 F;  3W5Y A;  3IM9 A;  2B0G A;  5L8R C;  4HI2 A;  3MMB A;  3DRX A;  4HEA 9;  4R8U B;  2M3D A;  3PFE A;  3SFG A;  1PIE A;  4B3M F;  2OFH X;  2CQ1 A;  4DV7 J;  3KDO A;  3LAM A;  3S8S A;  1RAI B;  3HZG A;  3CD6 S;  3NNC A;  1J2V A;  3NGS A;  5I3Q A;  5C25 B;  3OL9 A;  5FLX U;  2K8G A;  1SPB P;  1UPM B;  1LEO A;  2DGW A;  3BQ1 A;  4HI1 A;  2RSQ A;  4P73 A;  5IOL A;  3ULH A;  4DSJ A;  3IRX B;  4YN3 B;  2GMH A;  4Z37 A;  6FD1 A;  1S0V A;  2HBZ B;  3CCW A;  1FXR A;  3W7B A;  3RAX A;  3ZTO A;  1S79 A;  5FDL A;  2IRY A;  2H51 B;  2AJ2 A;  2M2B A;  4DR5 J;  3D0G E;  2M4M A;  4DCP B;  5HP1 A;  5DDR C;  2Z58 B;  1DAR A;  3MEG B;  4LRA A;  1WC4 A;  3W1Y C;  4B9M A;  3LP1 A;  3V2U C;  1IKV B;  4DV4 F;  3R2D J;  3TVY A;  2KB2 A;  2NXN A;  4IQM A;  4K8R A;  1R6Y A;  1YIJ S;  3NWR A;  4DN0 A;  3LGM A;  2FJX A;  6FDR A;  3UD5 A;  2GS8 A;  3TI0 A;  1FFG B;  2G0J A;  1N5T A;  3LGN A;  2RF2 A;  4P2F A;  2CNK B;  2BJE A;  5J2N B;  3MUM P;  1YJ9 S;  1XEZ A;  4DR2 F;  2OEM A;  1Z2Z A;  3LO3 A;  1K0V A;  4QBU A;  1X5P A;  1F9H A;  1HNX J;  4LFB J;  4DL2 A;  1FDD A;  2HAI A;  1H73 A;  2FUG 9;  1ZTT A;  2FHK A;  2QMW A;  4RW4 A;  4QIV A;  2HSE B;  2LQJ A;  3EIC A;  4NX9 A;  2J6T A;  1SUQ A;  4CZC A;  4MIB A;  5EX0 A;  3P5B P;  2DKO B;  3MHY A;  4USJ C;  1EQ0 A;  2VG7 B;  2E7X A;  2ZDP A;  4M5M A;  1CJV A;  3ZNJ 1;  2EG1 A;  4CO1 A;  4MT1 A;  4QCL A;  2F5G A;  3MF5 A;  5L1L A;  1MRO A;  4V19 J;  1DHM A;  2BZ2 A;  3CCM S;  3DLK B;  1HNW F;  2NCK L;  2WOM A;  2YNG B;  3CO0 P;  4JI8 J;  1HQE B;  2CDR B;  1W2B R;  2YH1 A;  3K89 A;  4JI5 J;  5ETV A;  3W60 A;  2ZH7 A;  4LFC F;  1JX4 A;  1ZOT A;  1RAD B;  1R8P A;  4ZPW R;  3BZQ A;  3HSG A;  3BKF A;  3OL7 A;  4J5O A;  2KO1 A;  2HHX A;  2XS2 A;  2QL5 B;  1RCX B;  4ZPT R;  2LYV A;  1V3R A;  4RNM A;  3FCW A;  1JLG B;  2MLY A;  3KK2 A;  4NRU A;  1H74 A;  5DG9 A;  1VIO A;  4YS2 A;  3KLF A;  4DI6 A;  1Y5N B;  4CLT A;  1CBK A;  5CCM A;  1ZH5 A;  1S0M A;  4M63 A;  1C0U A;  2MHE A;  3KG0 A;  1UJ5 A;  3V6D A;  4DSE A;  2MTL A;  2WVD A;  1NH7 A;  4DU7 A;  1RTI B;  2YKM A;  5A2Q Y;  2Y8Y A;  1L3K A;  2AHO B;  4B9N A;  4C0H A;  4ECY A;  3IR5 B;  4PAB A;  2UXB J;  1B0P A;  1TKT B;  3BGR B;  3BO3 A;  3NG8 A;  4HHJ A;  3P3D A;  3O6Q A;  2DR5 A;  4QU6 A;  2P6S A;  3SDE A;  3M9M B;  1S6O A;  2RNE A;  2MB0 B;  2XYG B;  4NA1 A;  5LJ5 Y;  2XMK A;  1RAO A;  1O5J A;  2V50 A;  3KG4 A;  4ZMM A;  3J7Z T;  1WI6 A;  3G71 S;  3L9Z A;  5KFH A;  1Q78 A;  4NE9 C;  3OQ2 A;  2DT9 A;  1S5Z A;  3E8O A;  3OTO F;  4NMX A;  2NR0 A;  2WRM A;  4QR0 A;  1WEL A;  1SL2 A;  1T05 B;  3CMQ A;  2F3J A;  1IKY A;  4UTG A;  2CPZ A;  4WP8 A;  2A1B A;  3G82 B;  1N5Q A;  2VFV A;  4NZ6 A;  3EVM A;  4L72 B;  1HMV B;  2QLJ B;  4NI2 B;  3UN2 A;  2ZH6 A;  2YX1 A;  4M5D A;  1TVR B;  2JFK A;  3CWJ A;  2H5I B;  3ZZY A;  1S9G B;  3SEO A;  3I0S A;  2G9O A;  1KVI A;  5A8R A;  4O44 B;  3PNI A;  5KAK A;  3T5J A;  1BUX A;  3B82 A;  4ZVS B;  5FJ4 A;  5BXI A;  1B0T A;  1GAO A;  1RT5 A;  1X4B A;  4UOC A;  2R8G A;  2X7I A;  3MWB A;  4J9U E;  1NJI T;  1BY9 A;  1FA0 A;  2BJ7 A;  4ECZ A;  3MED B;  4LIR A;  5KTQ A;  2AX1 A;  3DLG B;  3UD3 P;  4P74 A;  4K4Z A;  1AW0 A;  2UP1 A;  4TLR A;  3Q8V A;  2BE9 B;  4DV1 J;  2ZKT A;  1IJF B;  3UDV A;  4RZR A;  4LF5 J;  4LF9 J;  2FTR A;  1LV5 A;  5KG4 A;  2W2P P;  3BKT A;  4LBH A;  3QZ7 A;  1HR0 F;  1VQS A;  5L1K A;  4QU7 A;  3MTK A;  3QLH B;  5AE1 A;  4OLO A;  3EGW B;  1TV6 B;  4F4W A;  1R8C A;  1TU0 B;  4X64 J;  3MR2 A;  2HIY A;  4QJV A;  1S72 S;  1QE1 A;  1U7L A;  5M2U A;  3R1L A;  2Q3P A;  1NK9 A;  2PSZ A;  2CJQ A;  3KLE A;  1WUU A;  2D74 B;  5KG2 A;  4RNF A;  4KFB A;  3GYG A;  3BH6 B;  4A46 A;  3VAK A;  1JXE A;  4HLB A;  1BD6 A;  1SVD A;  1RAJ A;  2G2Y A;  4D3H A;  1S12 A;  5CHC B;  1RA6 A;  3OFH A;  1G1X A;  4M5K A;  3GIM A;  1JJ4 A;  3KWM A;  2AJ1 A;  4PKD B;  1I5O B;  1UPP A;  2B9X A;  1X5T A;  3BJY A;  1SL0 A;  2C42 A;  5IV4 A;  2L48 A;  2YKA A;  4RW4 B;  4C4W A;  2GAG C;  5THW A;  3T1Y J;  3PAC A;  2NSB A;  5CYQ B;  3VAF A;  3D28 A;  2DGX A;  2IIH A;  4KQZ A;  1WOR A;  1WG5 A;  3EVW A;  1HHQ A;  1GX6 A;  3R27 A;  1P6T A;  3NS7 B;  4P72 A;  5B0B A;  1HKA A;  1TKD A;  5CYJ A;  5HVH A;  2G1H A;  3KTQ A;  4C11 A;  4W92 B;  1RDR A;  3PR5 B;  1YLX A;  4KKO A;  2FZG B;  1NDP A;  4P9S A;  4JI7 F;  5L9N A;  1TK5 A;  3FK4 A;  2DRD A;  3DCA A;  3W5X A;  3GCW P;  3J80 U;  1Q82 T;  3CB4 A;  2EFP A;  4KH0 B;  3PRB A;  1K9M T;  1S6Q B;  3GJQ B;  2EFG A;  4Q45 A;  1S0N A;  3F41 A;  3GII A;  3PYF A;  3SMZ A;  2DO4 A;  4ES2 A;  4PWW A;  1Y7P A;  1IR1 A;  2O66 A;  3JQJ A;  1YG0 A;  3CJ3 A;  5D0G A;  4IUF A;  4WP3 A;  1C4C A;  3V6J A;  3JAM U;  2KXN B;  1RWU A;  4RW7 A;  3P6Y C;  8AT1 B;  2HRU A;  3OR1 A;  1F2G A;  1FX2 A;  2XGP A;  1RI7 A;  2CRL A;  3C16 B;  4C0O C;  3QYY A;  4WP9 A;  1R8A A;  2XMT A;  2Q1L A;  1BWE A;  2GVZ B;  1NDL A;  3MCN A;  5HQL A;  3ZZ0 A;  1S10 A;  2H65 B;  1B7Y B;  2DYA A;  1QD1 A;  5F8N A;  5HBM A;  3MAA B;  2QYC A;  3HFV A;  1RAC B;  2DH9 A;  4FYY B;  4QR2 A;  3SDE B;  3OBI A;  3MM5 A;  2VJV A;  4F0K A;  4OYZ A;  2Q6B A;  1OPZ A;  3R8Y A;  2GJ2 A;  2WZ1 A;  1H7X A;  3BB5 A;  1MML A;  3G86 A;  2QIF A;  4CTA A;  3PR4 A;  1G7C B;  1KQG B;  1SJ1 A;  2KXF A;  2LEC A;  4B3R J;  4W4M A;  3QSY B;  1RZM A;  5F3Z A;  1WF2 A;  2G0C A;  1H38 A;  2L9W A;  2ZD1 A;  1T03 A;  5E0O A;  2B8Q A;  4LQ9 A;  4WE1 B;  4ZPA A;  1U1M A;  3TEG A;  1I3O B;  3HFZ B;  1T9Y A;  2UXD F;  1F0X A;  4DQP A;  5KT5 A;  5BR8 F;  3QFW A;  1LWF A;  2AYG A;  3M8W A;  1C1C A;  1JK9 B;  3FNN A;  5I42 A;  5SUH A;  4DQI A;  4A8M P;  4GKK J;  3IRW P;  1NSP A;  1A7G E;  2YTC A;  4OZJ A;  3ZZO A;  2R7S A;  2RVJ A;  2QN6 B;  5I4M A;  1REV B;  4OIX A;  2R8K A;  4U67 Q;  1REG X;  4L75 A;  4YME A;  4OYM A;  2DGQ A;  3OR2 B;  2ZH4 A;  1TL1 A;  2BQR A;  1RLD A;  1WHW A;  5GAD I;  5M2P A;  4DS5 A;  4AT1 B;  2HKE A;  4CO5 A;  1VC0 A;  2B7B B;  1VHF A;  3DOK A;  2U2F A;  5KFV A;  1RT5 B;  4P7T A;  4HH0 A;  2F63 A;  4V19 X;  2KH9 A;  2CPJ A;  1H98 A;  4IH6 A;  2LEP A;  4I0W A;  4RPF A;  1RHK B;  1DQA A;  5CYM A;  4DMZ A;  4OYA A;  2BR0 A;  3DHW C;  1JNR B;  2E9R X;  4C3K A;  1RBA A;  3CO9 A;  5GMK a;  5ETK A;  2M52 A;  2FY8 A;  5BYQ A;  2YXL A;  3W2W B;  1H0H B;  2QA4 S;  1DJ0 A;  2GO9 A;  1YBA A;  4O3S A;  3UVJ B;  2ADB A;  2DO0 A;  1OO0 B;  3BYR A;  1WSV A;  4DN9 A;  1T9U A;  5D3G A;  4GKJ F;  2B5J B;  2CWK A;  3A4T A;  4O3P A;  3HDS A;  1XNR J;  1LFP A;  3FRY A;  3L7O A;  2IM2 A;  3MMC A;  4I2P B;  5I3U B;  3ILI A;  2A3J A;  3KYL A;  1WG1 A;  5DQH A;  5KFF A;  2CNL B;  2N3O A;  2BJ1 A;  1GX5 A;  4QPT A;  3NBP B;  5IXU A;  3CMA S;  1KN6 A;  4ZN1 A;  3BSA A;  5B0A A;  3IM8 A;  4F3Q A;  5KFQ A;  3DYA A;  1APS A;  5JXS A;  1VIX A;  2VHG A;  3PRV A;  3ET6 A;  5DZ6 A;  2EC0 A;  2EK6 A;  4ECS A;  4ZPV R;  2X1B A;  2VFT A;  2B4P A;  9RUB A;  1NPP A;  2J8S A;  5AXN A;  3CGI A;  5K9F A;  5MAO A;  2OKQ A;  2DPI A;  3MFI A;  1N88 A;  1UJ6 A;  1S4E A;  4F02 A;  2N4C A;  1LW2 A;  4KHP F;  4I67 A;  4DV2 J;  4Q43 A;  5GAD U;  2KTQ A;  4DL5 A;  1D8Y A;  3LP0 A;  3QQC D;  3RB0 A;  1Q16 B;  4CT8 A;  3PDN A;  4HR2 A;  2QA2 A;  3RB3 A;  4X4U A;  2VFS A;  4LBP A;  1KTQ A;  1FFW B;  1H2U X;  2MQL A;  1RBO B;  4PRF A;  4C8Y A;  1YRU A;  3QT8 A;  2CFX A;  1HBM B;  3W61 A;  3IG1 A;  1MWQ A;  2XY7 A;  4IR9 A;  3SSR A;  1MG7 A;  1TFY A;  3LH2 S;  4LSL A;  1FJG F;  1RYR A;  1IQT A;  2I2Y A;  4NLQ A;  3F0N A;  2C2D A;  3OFF A;  2CVI A;  3FGV A;  1UWB B;  1W25 A;  1KC8 T;  4IKA A;  4J9K A;  4IYQ A;  3JSB A;  1M5K C;  2LP4 A;  4JP8 A;  3RZA A;  2R7U A;  4N7T A;  3FSY A;  1R8H A;  1VHI A;  1T3O A;  3KLI B;  5KFT A;  3DLE B;  4DUZ F;  3AH6 A;  5IT9 Y;  2LXI A;  2WW8 A;  5F8I A;  3I4H X;  4EI2 A;  2OO4 A;  3DRR B;  4YR0 A;  2IAJ B;  4ZA1 A;  3PRD A;  1H72 C;  5J2M B;  5H9E K;  5LSO A;  4YQW A;  2RAQ A;  1H6K X;  3OTD A;  4G1Q A;  4U8V A;  1N33 F;  1AA1 B;  1DZ5 A;  3CUL A;  2MKS A;  4JYA F;  1PJ6 A;  2RDD A;  1S1T B;  5IQ6 A;  2MXY A;  3K17 A;  2OPP A;  4Q2M A;  2EI5 A;  4DZD A;  3FEY B;  3B4D A;  1JLC B;  2J9D A;  1VGY A;  1TKZ B;  1X4H A;  2QLB B;  2C2M B;  4B3T J;  2VKZ G;  2Z2L A;  1TL7 A;  4PWD B;  3FMB A;  4TKT A;  1X5S A;  3CCS S;  2VZ9 A;  1CS4 B;  2FDN A;  2UU9 F;  2M0G B;  3IFE A;  4HT5 A;  1FES A;  2VPY B;  4OZN A;  2J0W A;  1L3T A;  5A8K A;  1U1L A;  1NB2 A;  3GIK A;  4XIU A;  2WON A;  4X62 J;  1U24 A;  2P9E A;  2RDI A;  4NZ0 A;  4K0K J;  3P96 A;  4JOU A;  1YJR A;  2PA8 D;  2GCF A;  4FS2 A;  4NXN F;  2JRS A;  3T1H F;  3KJV B;  1Q0N A;  4KJI A;  2AV5 A;  3G9C A;  1AZS A;  2ZE2 A;  3C14 A;  3VAG A;  3N6M A;  3MGJ A;  4WCE Q;  4C98 A;  3H0P A;  2VB6 A;  1J27 A;  5I42 B;  2W1B A;  5D0E A;  5L1I A;  2ZH2 A;  4CI0 B;  1VRQ C;  1VQ8 S;  5I3P A;  2MSS A;  2XI3 A;  4KGM A;  1WD6 A;  3QRR A;  3M2V B;  2RT3 A;  3OHB A;  4DXL A;  3HVT B;  2YNF A;  3CJ0 A;  4CDI A;  4WFB Q;  4PUO B;  5DGA A;  1F5B A;  4LF7 F;  3MM8 B;  2IYG A;  3D3C J;  4B9S A;  4AXJ A;  2OH2 A;  1N5S A;  5JVH Q;  4FNH A;  1FRL A;  2NXC A;  1AXQ A;  2J9C A;  1CEZ A;  3MM9 A;  4X4V A;  1B64 A;  1AB8 A;  3A8I A;  4LF2 A;  4Y2C A;  4P6Q A;  1U1R A;  4KPY A;  3MDF A;  4KV8 A;  5L46 A;  2O1P A;  1QTN B;  2J76 E;  3MZI A;  4C8M A;  5A8W B;  3CCZ A;  2C2O B;  3H40 A;  4RWW A;  1DQ9 A;  4K4X A;  2F40 A;  4OV1 A;  3KK3 B;  2IBK A;  2CQH A;  2VQE J;  3ZZT A;  1YVF A;  3OVA A;  1XC9 A;  2DCU B;  1FO1 A;  1JLF A;  4JI4 J;  1YZ6 A;  3D0I E;  2ZWP A;  1H7W A;  4J9Q A;  3RRH A;  3MD3 A;  2RIJ A;  3HKW A;  2H4Y B;  3R5D A;  2H1Y A;  4X66 F;  3R7S B;  4ES1 A;  1PG5 B;  3K5M A;  4DHV A;  3EZ5 A;  4RU2 A;  1WTB A;  2F9J A;  1Q7L B;  1NK0 A;  1SB6 A;  2Z56 B;  3GFX A;  3HHK A;  2GNK A;  3QAU A;  2X1G A;  1X31 C;  3MXH P;  4ITS A;  2HNZ A;  3A13 A;  4U8Y A;  5IWA J;  1OYD A;  2HAF A;  2BW2 A;  4O23 A;  4FF3 A;  3H42 A;  3PY8 A;  5SZT A;  1N36 J;  4RR5 A;  2DNM A;  3ZTQ A;  1TAQ A;  2ZWO A;  3LP2 A;  3WBZ A;  3RB4 A;  2NYH A;  4RJV A;  3QNW B;  1QM9 A;  4NLS A;  2H3E B;  4JBC A;  4FXD A;  1WC3 A;  2CG8 A;  3C6U A;  6AT1 B;  1FRI A;  3HHL A;  3AOD A;  3HCX A;  3FFI A;  4IDK B;  2FLN A;  3B54 A;  1TK8 A;  1H3D A;  4NML A;  2P9C A;  2C2E A;  3DGV A;  4J90 A;  3U1N A;  3V6H A;  1U6B A;  3SIP B;  2YVS A;  1WI8 A;  3FCV A;  1SQE A;  4ED1 A;  2KYX A;  4ED0 A;  3P4U B;  4QIF A;  2MZ1 A;  4KO0 A;  2GHW A;  1RCO B;  1Q1K A;  1P9Y A;  3O8W A;  3M8Y A;  2CJX B;  3QFH A;  3W66 A;  2UXC J;  3I82 A;  3KFW X;  2BRK A;  1VFJ A;  5IT9 U;  4ECQ A;  1YJN S;  1V9O A;  2AT1 B;  2V0N A;  4HAC A;  5C24 A;  2EBG A;  4H4O B;  1YWX A;  4OX6 A;  2MKH A;  4P71 A;  4LUB A;  2A10 A;  1BC6 A;  3TUI C;  1U0S A;  3ZZU A;  5LXY A;  4U96 A;  2MGZ A;  4EWT A;  2DGT A;  2Z2Z A;  3MPW A;  2V94 A;  2QX0 A;  3PW7 A;  1VRT A;  5A6W A;  2PDA A;  4WK3 A;  1HNZ F;  4OHZ A;  3TJ8 A;  2YPZ A;  1C4A A;  5LMU F;  2UVV A;  2AYM A;  2XEX A;  4OHV A;  4KBI A;  2D3O R;  5CAB A;  5EWE A;  3PYE A;  4K59 A;  1N32 J;  3BDP A;  3ITH A;  1C2P A;  4DLE A;  5DDQ C;  5JMN A;  1U0H B;  1WKK A;  4Q2L A;  2BAN A;  4IQX A;  5F9N A;  2B8P A;  3H2V E;  3CJR A;  1IBM J;  5KT6 A;  1C0T A;  4O4G B;  3OUY B;  1NZ8 A;  2OIH A;  4DR6 F;  3UCG A;  4N56 A;  2KYZ A;  2AEF A;  2ZKU A;  1NB7 A;  3KMS A;  2PD1 A;  1S6P B;  4HT7 A;  3MPV A;  2VPZ B;  1RT1 B;  1FK9 B;  1I51 B;  3FZB A;  1T7P A;  3M6U A;  3X3U A;  1RAA B;  7FDR A;  1R7I A;  3WX4 A;  5A6P A;  4K4T A;  1FKO B;  3THP A;  2DR7 A;  3VV2 B;  4XTT A;  1IVZ A;  2XBP A;  5KG3 A;  3IS9 A;  2OPQ A;  1RHU B;  2VG6 B;  2F4V J;  1N54 B;  2J0S D;  4IRD A;  1RTJ B;  4M8L A;  2Q66 A;  1L3V A;  4Q44 A;  2KG1 A;  5CD4 H;  1F3F A;  1VI7 A;  1RT7 A;  1V3Z A;  3NGD A;  3G8T A;  3G6V A;  4FF1 A;  2QLF B;  1ICE B;  1T3N A;  2WBM A;  3T9N A;  3O44 A;  4B17 A;  2IHR 1;  5D8H B;  4HTI A;  2B9E A;  4YDD B;  2YNF B;  3WDO A;  1NEE A;  2X1F A;  1X4E A;  4ED5 A;  1WEY A;  3DOM B;  1HNV B;  5HJY A;  4KAI A;  4C2M A;  2I5J B;  4F8R A;  2IA0 A;  1QVF R;  1U1Q A;  1FNM A;  5H9E J;  3FUY A;  1S4F A;  1RU2 A;  1VQM S;  1VS3 A;  1E6V B;  2BKP A;  3FJ2 A;  3QJJ A;  2IVY A;  1QTM A;  5HRO A;  1AUS L;  4JI2 J;  2KKH A;  2VQF J;  1NJX A;  2XLJ A;  1Y9O A;  4YHH J;  2QSW A;  2AW0 A;  2ZBR A;  2LQ5 A;  1R0A A;  4UY8 5;  1ZPW X;  1BQN A;  4K50 A;  2IC3 B;  1UCN A;  4JB8 B;  4Q7A A;  3DRS A;  2RB7 A;  3C6T B;  4CLL A;  3OXG A;  3I5C A;  2RRB A;  1DRZ A;  1S57 A;  2FIU A;  2ZOG A;  2V6A A;  3R6L B;  3SBM A;  3KOA A;  4ZHR B;  2R8H A;  1S9E B;  2BJ9 A;  3PX0 A;  1QSL A;  1F9E B;  3D6H B;  2VFU A;  4WFN Q;  1EJ7 L;  3IBC B;  3SSQ A;  3K0J A;  1NAQ A;  2ZNY A;  1NSK L;  5KT4 A;  2R7W A;  1JLQ A;  1U48 A;  1TL3 A;  2HNY A;  1X7V A;  4CLY A;  5ETN A;  2WVC A;  2HVI A;  2BDP A;  2CQ3 A;  2OSR A;  1LK5 A;  4NCA A;  2I0X A;  1FDB A;  4H4K C;  5AXL A;  3CXC R;  5CD4 A;  4DJB A;  4N5S A;  3UDC A;  2CNN B;  3OXF A;  2J7W A;  4MMO A;  4DEZ A;  5CZX A;  2DEI A;  2BUN A;  5A0Y A;  3MUT P;  2BE7 D;  2B43 A;  5LMN F;  5HJX A;  1S49 A;  2DRA A;  3FBE A;  2HHP A;  4OZ0 A;  1CC8 A;  1VBZ A;  3C8Y A;  4NZ7 A;  2YWH A;  4DG1 A;  3A3P B;  3CCT A;  4QWC A;  2SXL A;  1XMO F;  1U1O A;  4GVL A;  3S7R A;  1VYA A;  3NNA A;  3E01 B;  4USU A;  2XG8 A;  1RTD B;  4GVB B;  2YNI B;  3O1L A;  2CYY A;  2KL8 A;  5HLF A;  4CO0 A;  4OJ3 A;  2AYB A;  4CO2 A;  2ASL A;  4RW8 A;  4B9U A;  4TVA B;  1MSW D;  1RT6 B;  4L6V 3;  4EZ6 A;  1NK5 A;  2NXJ A;  2FVC A;  3TVZ A;  1TEL A;  3BSO A;  1OQ3 A;  4J9P A;  2MMY A;  4YDX A;  1ZBT A;  4UZB A;  1XMQ J;  3TAP A;  2DNY A;  3U1M A;  1HNI B;  1Y3K A;  2MPU A;  4C3M A;  2R8J A;  2MJU A;  2MZJ A;  3RGI A;  2H5E A;  5F0U A;  1WTF A;  1ROF A;  2Q6C A;  2MJN A;  1WAC A;  2HPU A;  1S77 D;  2D9P A;  2IMO A;  4F4Z A;  2LLZ A;  4HAC B;  3PKM A;  4UT4 A;  1JLE A;  1XNQ J;  5DDO C;  5D0H A;  5HAN A;  3GQC A;  1DTQ A;  3DGP A;  2DBB A;  1RT4 A;  1JIH A;  1P9Q C;  4DUY F;  2HBR B;  1SL1 A;  3WHI A;  2HQF A;  2XLK A;  5KOX A;  3N28 A;  1TKX A;  5D4O A;  4QYR A;  2DXF A;  4J7C A;  2O01 C;  5C42 B;  2YKO A;  3KLG B;  4RKU C;  1DTT A;  4JI8 F;  4PWU A;  4UUW A;  3H90 A;  5K8N A;  4TY8 B;  1NXI A;  1N56 A;  2EC2 A;  3NAI A;  3QAE A;  2NZC A;  3EZU A;  2PI4 A;  3ITH B;  2JNJ A;  3D9B A;  4OJ1 A;  1SJR A;  2POK A;  4LR8 A;  2BAN B;  1WG4 A;  4P2X A;  4NLW A;  4JV1 A;  2PC6 A;  4ECX A;  2VH7 A;  5D4P A;  3SFU A;  2JEG A;  2OSQ A;  3OTC A;  1NDK A;  2QA4 G;  4WKY A;  4PQA A;  2OEK A;  3MEK A;  5E3Q A;  4USI A;  2AIR B;  1RHM B;  2IRX A;  1RT3 B;  4OYW A;  3G6Y A;  4NRT A;  2C22 A;  3K7R A;  3J81 U;  1XJW B;  1RWP B;  1EAR A;  2DTJ A;  3PKY A;  3TX8 A;  1FVS A;  1FRJ A;  4KSE B;  5KFD A;  3LAL A;  2W4C A;  2Y3Y A;  2HVH A;  3HD2 A;  3DLB A;  4CLZ A;  2OPS A;  4M5N A;  1EKS A;  2VC0 A;  3GWC A;  4A8O A;  2AJF E;  1SKU B;  3QID A;  2NPF A;  4GC6 A;  2BKN A;  4NXM J;  4ED2 A;  4NL5 A;  2KRB A;  2FJA B;  2YKN B;  1KQS R;  1HYS B;  2BBE A;  2ZOF A;  4IFY A;  4UF4 A;  3M9O B;  4AQY F;  1ZTW A;  1KP6 A;  4IOB A;  3ZZR A;  1LK7 A;  1WC6 A;  4X84 A;  4LVN P;  4ZCI A;  1RU1 A;  2YPY A;  4E0D A;  1W2I A;  3T5L A;  1QY7 A;  2RQM A;  3UO0 A;  5RUB A;  2CXE A;  2GHV C;  3M32 B;  5B0E A;  1M1K T;  2V8D A;  2ILY A;  2ZC4 A;  3MMA A;  1YSJ A;  4F25 A;  3Q8P B;  4F4Y A;  5IM0 A;  2Y8W A;  4OQJ A;  3CW2 C;  2OML A;  3H59 A;  2DH7 A;  3IMQ J;  5KG5 A;  1NLK L;  3QT5 A;  4DS4 A;  1YJ7 A;  3TJA A;  3H4B A;  4A8W A;  1NND A;  2MZT A;  4N8O A;  4UW2 A;  1U4B A;  3VQS A;  1KOH A;  3KKF A;  5DQG A;  5DG7 A;  3NOC A;  3DLH A;  1YJW S;  4MKA A;  1GNK A;  1HBU A;  1MN9 A;  3EWG A;  4DX6 A;  2DHA A;  1S99 A;  1FRK A;  3VVT A;  4UOH A;  4P10 A;  3PIP Q;  1S59 A;  3LW5 C;  5AXM A;  2QL9 B;  4A8K A;  3DFE A;  4NLO A;  1VQ6 S;  3O2I A;  2GGP A;  4S0M A;  4XO0 A;  4IRC A;  4ID5 B;  4RBT A;  5GME A;  4ZVH A;  1IBL J;  3K57 A;  3HJF A;  5IZH A;  3R2C J;  3T19 A;  1IKW A;  2HQC A;  2IRU A;  2DHS A;  3CDW A;  3AFG A;  4B3M J;  4BS2 A;  3CCE S;  2HMI B;  2PT0 A;  1YX2 A;  1YK9 A;  5IV3 A;  3VAL A;  4QW9 A;  5KFZ A;  5AT1 B;  3GV7 B;  1LW0 B;  4LSN A;  3H2U B;  2W2M P;  4PXC A;  4IOA Q;  3QGP A;  2RQC A;  2D3U A;  2YX4 A;  3QIP B;  2KG0 A;  4B02 A;  2Z2M A;  1BQM A;  2C1E B;  2FHJ A;  3CC4 S;  2G4B A;  2E7W A;  1X0P A;  4YR2 A;  3W9J A;  5EWG A;  1ZAW A;  2AMC B;  4ZIV A;  3DXS X;  1U49 A;  4UZC A;  4IR1 A;  2WVE A;  2E5J A;  4CCH A;  3I0R B;  1KD1 T;  2PO4 A;  4IG0 A;  3BBC A;  3N5B A;  2JFD A;  1PBA A;  4Q5V A;  1RHJ B;  5E3C A;  1TL5 A;  2P6T A;  4M5L A;  5KFS A;  3NXZ A;  3JS9 A;  2ASY A;  4ZLL A;  3MPY A;  3T1Y F;  2DCL A;  1U47 A;  3SQO P;  3R5A A;  3B78 A;  3FBB A;  2QSF A;  3H98 A;  2CJK A;  1RWO B;  3M2R A;  3OHA A;  1OSC A;  4OYX A;  3PHE A;  4USK A;  1DTQ B;  1WC1 A;  2J0Q D;  4L3K A;  1FCA A;  3UDE A;  4BCA A;  2ACY A;  4QWA A;  5DLF A;  1JQG A;  2V5H G;  4ED6 A;  1F6T A;  2W4P A;  1BMQ B;  2GA7 A;  4ZVF A;  2HK3 A;  3JYT B;  2V9W A;  1O8B A;  2XMV A;  1XQI A;  1OWX A;  4AFF A;  4CLU A;  2WSE C;  1MMN A;  4IOC Q;  2BX6 A;  3FC9 A;  3K2Y A;  1P8G A;  3HI9 A;  3RB6 A;  5E3R A;  3OVS A;  2XLI A;  2R7V A;  3POT A;  1RWM B;  4OI0 A;  3IWL A;  4C8N A;  4LIW A;  1CUL B;  4O0I A;  1OPI A;  3H7H B;  2GIR A;  4ZP6 A;  4UUX A;  3RYL A;  2DXD A;  3M6V A;  2OTL S;  3TRG A;  1X9S A;  5C25 A;  1FDN A;  1HNW J;  3I5B A;  2XZD B;  4DL0 C;  2ASJ A;  1XK8 A;  4DV6 F;  2KJW A;  4LFC J;  5GAE I;  5KG7 A;  3W3S A;  3VAH A;  5KFX A;  1VLY A;  3IRX A;  2UUC F;  2FVR A;  1RLC L;  2ASD A;  4ZLP A;  2CJB A;  2O67 A;  4RL1 A;  2VOD A;  1RAB B;  3G8Q A;  2VD3 A;  1Y4Z B;  2BOP A;  4DDF A;  2IY5 B;  4ZP9 A;  1XWL A;  4MK7 A;  3K5N A;  2M5Y A;  5IT4 A;  2EXU A;  1CJT B;  4OX7 A;  4J9L A;  1UFL A;  1WEX A;  3PFO A;  3GE9 A;  3MM6 B;  3ILJ A;  4IFY B;  1GMW A;  4BC9 A;  3C46 A;  4X4T A;  3HHD A;  4J9M A;  1WJ9 A;  4LJM A;  2GIF A;  3ZNU A;  3FRZ A;  3CJQ A;  1N0U A;  5KFY A;  1V6H A;  4ECR A;  1Y5I B;  1SXL A;  1JNZ B;  1CQN A;  1QJH A;  4HH1 A;  2MZR A;  4J9S A;  2CQD A;  3DLJ A;  1K1Q A;  3MMA B;  3IBW A;  1VDH A;  1S1W B;  5IM0 B;  5J2N A;  1HWL A;  5BYR A;  2K3K A;  2RDJ A;  3MMJ A;  2QFI A;  3M8S A;  1RAH B;  4IG3 B;  4NLP A;  2BJD A;  1GTE A;  3OTO J;  2GVD A;  5LSR A;  1MLA A;  2BXJ A;  1BGX T;  4XK8 C;  2E1C A;  2LCW A;  1IM6 A;  1ZZN A;  4Y65 A;  2HZA A;  2E44 A;  4YFU A;  3R3T A;  4NA3 A;  2ZVS A;  3I31 A;  2V4J B;  2G2O A;  4UY8 T;  2VG7 A;  3DM2 B;  3LTO A;  2MQM A;  5DET A;  2KRR A;  1OY8 A;  3TAQ A;  3T9Z A;  3DOL B;  1SC3 B;  3T5K A;  2W7A A;  2F8E X;  5F8H A;  2B6A A;  3MCM A;  1IKX B;  3DLK A;  4OI2 A;  4DPO A;  2YNG A;  3MR3 A;  1HQE A;  3GG1 A;  1I94 F;  1S1U A;  3SXL A;  2JH3 A;  1M5P C;  5HK4 A;  1FER A;  2IPO B;  1KLM B;  4DSI A;  2OPR B;  2D41 A;  3US5 A;  2LQB A;  5D15 A;  2ZJQ Q;  2CPE A;  4CQ1 A;  3G6X A;  3LA0 A;  3KK1 A;  3D1O A;  2HEK A;  4PG8 A;  5ADZ A;  1SQF A;  1JLG A;  1HAR A;  1P27 B;  1FKA F;  2DB1 A;  4OL8 A;  1VQK S;  3H5S A;  1OYE A;  1SJ3 P;  1JB0 C;  2NXE A;  2J7K A;  1HR0 J;  2RUS A;  4E2F B;  4DL6 A;  2F1F A;  1RTI A;  2ZH1 A;  4F4A A;  1ZET A;  1PGZ A;  1R8B A;  3G4S S;  3QO9 B;  5KFE A;  1TKT A;  3BGR A;  4FNI A;  3AT1 B;  3DI6 B;  1OY6 A;  1T9T A;  1N6Q A;  1VK8 A;  1Y3J A;  3SCI E;  2DNN A;  3LWL A;  2DK2 A;  3NEK A;  3KUH A;  1X4A A;  4UQT A;  2VAS A;  1TL4 A;  2WB1 D;  2HFZ A;  2VL1 A;  2WCX A;  3PVX A;  1OIA A;  2OI2 A;  1VRU B;  1T05 A;  3S6E A;  2CJA A;  2WSF C;  4DPW A;  1RHR B;  5F9L A;  3M05 A;  1R3N A;  2XCP A;  1NK4 A;  2W9B B;  3QPI A;  3TA2 A;  3G82 A;  4QIW D;  1WKJ A;  2UVR A;  2Z2Y B;  1HMV A;  4NI2 A;  4B3S F;  2HQI A;  2LA6 A;  4PPZ A;  4J9V A;  1TVR A;  1S9G A;  1MNE A;  4M5G A;  3SQG B;  2BKO A;  2XHW A;  3JTN A;  4O44 A;  3TQE A;  4WF9 Q;  2JEJ A;  2FZK B;  5JVG Q;  4ICL B;  3GFH A;  3OV7 A;  2B9Y A;  3O3L A;  3FEZ A;  3GFZ A;  2MY8 A;  3W9H A;  1D9D A;  5KFN A;  4DV0 F;  3RR7 A;  3LF0 A;  4IFV B;  4JI7 J;  2DNP A;  3MED A;  3DLG A;  5ITH A;  2ZH8 A;  1FTC A;  4WU2 A;  2P2C B;  3EMT A;  2V8P A;  3THT A;  2IM0 A;  2KI2 A;  1T11 A;  2PFF B;  1DUR A;  3RU0 A;  1D9A A;  4UQG A;  3RAM A;  1EAY C;  1WOS A;  4N8N A;  1RWX B;  1DBD A;  4LRD A;  5FII A;  2W2Q P;  3V5R A;  2IVF B;  3QLH A;  5G0R B;  3G6E S;  1TV6 A;  3Q2T C;  1P1T A;  2Y0S D;  1NJW A;  5ETQ A;  2ZUG A;  4LFA F;  4FF4 A;  4TU9 A;  1X4F A;  1PSD A;  2AJ0 A;  4I1T A;  2GC8 A;  2R7Q A;  2CPX A;  3GIL A;  1KRP A;  2NUU G;  3P45 B;  3MM7 B;  4FXW A;  4NLY A;  4M5I A;  3BBB A;  3TEH B;  3CME S;  4BDP A;  3OJU A;  5C7P A;  2IFX A;  4ECT A;  3ISN D;  4UOF A;  1BLU A;  1FKP B;  1X8D A;  1ZAX A;  2BQ3 A;  4DL3 A;  3FDS A;  1S0O A;  3OL8 A;  1CJU B;  2DGV A;  4F3O A;  5CA5 A;  2XSJ B;  1U8W A;  1FDA A;  3MI7 X;  2EFQ A;  3MEE B;  3RTV A;  2CPI A;  1XR5 A;  3HVA A;  2AZ3 A;  3JSR A;  3PYG A;  4ETZ A;  2CDQ A;  2MLX A;  2GVD B;  4NAS A;  1AYE A;  5E5N A;  1MWZ A;  3N01 A;  3G87 A;  2MY7 A;  5CYQ A;  2D7S A;  2R2S A;  2VPX B;  3QAT A;  3EDR B;  4TNO A;  5HVG A;  5BR8 J;  4RUH A;  1S7H A;  2XO6 A;  2HRY A;  5JJB A;  3OTE A;  3N79 A;  2PMW A;  3PW0 A;  2F8H A;  2PN6 A;  4AXI A;  1TMJ A;  4A8Y A;  4LMZ A;  3MR5 A;  3GSD A;  1UFW A;  3DMJ B;  2B6A B;  4OYI A;  1WC5 A;  3TQ1 A;  1TP7 A;  1AUD A;  3QJP A;  3KNA A;  4IO9 Q;  4QR1 A;  3KUG A;  1U26 A;  1BE4 A;  4N47 A;  2VQE F;  1S1U B;  2C3P A;  2YWK A;  4QQB A;  1G4C A;  4LF8 F;  3SV4 A;  1S1V B;  3IN5 A;  3KNG A;  1S6Q A;  4H4K A;  4ZP7 A;  2HIQ A;  2CPF A;  1S76 D;  1ZM4 A;  4DPY A;  4ZVU B;  3QRQ A;  2PEB A;  3ZFV A;  1D8Z A;  2E5L F;  2AEJ A;  3KK1 B;  1WHX A;  3RUB L;  2IMW P;  1FFS B;  3IR6 B;  1RK8 A;  2D3Z A;  2V4R A;  1G3O A;  4ZJQ A;  1XER A;  3WIU A;  4K4S A;  3BSC A;  4JI0 F;  2R2U A;  3I32 A;  4DV5 F;  1WEZ A;  4EUV A;  1N5Y B;  1YJT A;  1RWK B;  3C16 A;  2GJF A;  4TYA A;  4GKJ J;  5IWA F;  4F67 A;  2LA4 A;  3SI8 A;  1UW4 A;  3UE2 A;  2GVZ A;  4ZDN A;  3ENQ A;  1T0T V;  1YJU A;  2UVW A;  4DPU A;  3LOU A;  3TR5 A;  3NY0 A;  2JDJ A;  4O4R A;  2B4V A;  3MAA A;  1TZ0 A;  2DIT A;  3KLH A;  3CD0 A;  3QWP A;  4OZ3 A;  1N6Q B;  5B0D A;  4YB7 A;  2ERR A;  3SCJ E;  3PX6 A;  2GW8 A;  5K14 B;  4F36 A;  1VQ5 S;  5IFM A;  4NWB A;  3EYZ A;  1J5O B;  2D3O 1;  3VQT A;  2RKI B;  3N6L A;  1M5V C;  2R7O A;  2DNQ A;  1FTR A;  4Q8E A;  3TAM B;  5CH7 B;  5DM7 Q;  4WE1 A;  2ZBQ A;  1LOU A;  4OZ2 A;  3HJV A;  1KFS A;  1S48 A;  2DGS A;  3CDE A;  4WPA A;  3CNQ P;  5L1J A;  2R7T A;  3F56 A;  3I9V 9;  4KHP J;  4DZ6 A;  4I6W A;  3TAN A;  1WF1 A;  3AJD A;  2ZH3 A;  4KTQ A;  4F3M A;  4NLT A;  2ZHA A;  2ZFH A;  1REV A;  4FF2 A;  3UWT A;  2HWT A;  5D0R A;  1PC4 A;  3OR2 A;  5AJ3 J;  2CZ4 A;  1WKL A;  4EK2 A;  4Y0F A;  4I56 A;  1FWL A;  3L4B C;  2ZZM A;  3CT9 A;  4Y00 A;  4O0N A;  1EHW A;  1FJG J;  3PG9 A;  4ZVP B;  1YRX A;  2BE2 B;  2VDH A;  3U7J A;  2AZ1 A;  3B4M A;  4ZVR B;  2HWI A;  1S6U A;  2OP5 A;  4A8S A;  1LWC B;  2EK1 A;  3FQK A;  5B0G A;  2FJE B;  3V4I B;  1JJC B;  4LRF A;  2HQ3 A;  1KKH A;  5FD1 A;  4EFA C;  4DUZ J;  2HND A;  4BHQ A;  3W2W A;  5H9F K;  3AOA A;  3P49 B;  1WDD A;  3UVJ A;  3G8S A;  1LXJ A;  4ANC A;  1BHN A;  4ZPC A;  2DH8 A;  5CXT A;  1PBU A;  3RBZ A;  4IRK A;  4NLR A;  2FC9 A;  1FVQ A;  2B5J A;  2Q79 A;  2XI2 A;  2W8L A;  1N33 J;  5HQ8 A;  4NLV A;  4G3I A;  4LR7 A;  3D6M B;  4JYA J;  4I2P A;  5I3U A;  1ZA2 B;  4OYO A;  2H4W B;  1R31 A;  4WYW A;  2GAH C;  3UD4 P;  1TUW A;  3NBP A;  2VDI A;  1T95 A;  2H54 B;  3DRY A;  3PYD A;  4BC7 A;  3C15 B;  2WHO A;  2OTJ S;  2WTF A;  3QSI A;  2UU9 J;  2UUB F;  3MFH A;  5D4L A;  2ALY B;  2RQ4 A;  2MKK A;  3ENV A;  2GV1 A;  5CZV A;  1UAW A;  4PG7 A;  2HHW A;  1HBO B;  5LOQ A;  3MR7 A;  1R27 B;  4WBF A;  1SJF A;  3GV5 B;  1UKU A;  2K7K A;  1U09 A;  1C1B B;  4K4V A;  4NXN J;  4C97 A;  2R7X A;  1IR0 A;  3AY0 A;  3T1H J;  3RRG A;  4FKY A;  2R2T A;  3CCV S;  1Q7Y T;  3FSX A;  2RS2 A;  3VVU A;  3M8P B;  2HUR A;  2XCA A;  1Q5Y A;  4DR1 F;  3D6T B;  4CYU B;  4CM2 A;  1LNQ A;  1JLB B;  2L3M A;  1CQM A;  3E2E A;  3Q8S B;  4P75 A;  2PFD A;  1HBM A;  2IM1 A;  2VG5 B;  2YBV A;  4CNY A;  2DXE A;  3CD5 A;  3R7B B;  4OHY A;  4NPO A;  4PR6 A;  2NZ4 A;  2CPH A;  3ILL A;  4F2R A;  4DQQ A;  1UWB A;  1RTH B;  1ZYQ A;  2WBR A;  3ETO A;  4ZLN A;  2CJ9 A;  2C3U A;  4EZ9 A;  2IJF A;  2E9T A;  3PEH A;  3KLI A;  4ZS6 A;  4ELU A;  1U8S A;  3DLE A;  4CH0 S;  1FRH A;  1UET A;  4GC7 A;  2MDA A;  1Q95 G;  4DFP A;  2XZT B;  2LEB A;  3DRR A;  4URS A;  4ZVE A;  1IWA A;  2IAJ A;  2K1R B;  5J2M A;  4DL7 A;  4C7Q A;  3AXM A;  3DKD A;  5A2Q U;  4TY9 A;  2D69 A;  3R97 A;  3UFC X;  1LWE A;  3JQK A;  3RG6 A;  3D1H A;  1S1T A;  2YNH B;  4TU8 A;  1AFJ A;  2VBZ A;  1KQK A;  4MKY A;  3D2W A;  1QSY A;  2L9N A;  4RU9 A;  4DFK A;  1UZH A;  1JLC A;  4DSL A;  1WF0 A;  1Z1Z A;  1TKZ A;  4C3L A;  2EFN A;  3TVK A;  4RNH A;  3H2L A;  4ZCK A;  4X66 J;  4A4J A;  3AXK A;  1U2R A;  3D67 A;  2N7C A;  3KLH B;  4PWD A;  2QE5 A;  1FWP A;  3IR7 B;  3L95 X;  3EGZ A;  1KEK A;  5FLX Y;  1CS4 A;  3VAM A;  2E1M C;  1LWX A;  2DR6 A;  4NLG A;  4A8Q A;  4WTY A;  5F8J A;  4YY3 J;  5KFC A;  2HVD A;  3TAR A;  3DLL Q;  1I1G A;  1XMQ F;  3VAJ A;  3IO1 A;  3W2V B;  3PJX A;  4JI3 F;  2WW4 A;  2VV5 A;  3KJV A;  3AD8 C;  1SKS A;  2XB2 D;  5J1P A;  5C2C A;  2VIC A;  4DR4 F;  2OEJ A;  4A8X A;  4ZIT A;  2LFV A;  1UA1 A;  4ZPB A;  4TLQ A;  2CG4 A;  1VK3 A;  3CED A;  2HLT A;  5KFA A;  4NCB A;  3AJ1 A;  3TUP A;  2VA2 A;  1WOP A;  3M2V A;  3Q8Y A;  4MFB B;  1KQF B;  3N6N A;  3HVT A;  1YTY A;  3W9I A;  2B4O A;  2MHN A;  3BDE A;  4DV3 J;  4PUO A;  1PYO B;  1VBY A;  4PQU B;  3Q8R B;  3VHQ A;  3MM8 A;  2YQ0 A;  1Q53 A;  4ED8 A;  2YWE A;  3MAQ A;  3MOZ A;  4DBQ A;  2HRT A;  1U45 A;  1FF2 A;  5KG0 A;  3H5U A;  2CNO B;  1UL3 A;  4I7F B;  2B3T B;  2ROE A;  3N4W A;  4E98 A;  2ZOM A;  3QBC A;  3WQP A;  2EFO A;  1MU2 B;  1UVL A;  4B9T A;  1FNO A;  2UUA F;  3BGL A;  4I6Y A;  5ETO A;  3BYP A;  1T9V A;  1T9W A;  3GIR A;  3N5F A;  4KT0 C;  2HND B;  3CPW R;  2BRL A;  4H4M A;  5A8W A;  2NQP A;  3NWG A;  1L3S A;  4NLU A;  3MEC B;  3TOQ A;  3KK3 A;  2VF3 A;  1U1P A;  1HNZ J;  2J9D E;  3M4X A;  5LMU J;  3M8R A;  4C9D A;  1D9F A;  2AU0 A;  3KHH A;  2B7C B;  1UVN A;  1RB0 A;  5ETM A;  3V81 B;  4U7C A;  1HL6 A;  4B3O B;  3QMQ A;  3BGO P;  1H2V Z;  2A6O A;  1CJK B;  3GTY X;  2XS7 A;  2EVZ A;  2V2Q A;  1M1G A;  1PAE X;  5HSP A;  3OPK A;  1W26 A;  2X51 A;  2AGO A;  1RHQ B;  2DHX A;  2CQ0 A;  2E7V A;  4FPI A;  4DR6 J;  4FYD A;  1U1K A;  3QGI A;  4NXM F;  2HFS A;  3GR1 A;  2VKR A;  1MW7 A;  1SV5 B;  4FPR A;  4J9N A;  5F0W A;  4DR3 J;  4QWE A;  3ZXW A;  2XTJ P;  2ZBC A;  1PAU B;  1IBK F;  1HW8 A;  1FJE B;  4Q0B B;  2HGN A;  4ER8 A;  1WHV A;  3GYN A;  1IR2 A;  3DC2 A;  4Y2A A;  1PYS B;  1EP4 B;  3D6F B;  1YI2 S;  2M8H A;  1XR6 A;  1U2C A;  2QA1 A;  1FJC A;  2ZJR Q;  3ISZ A;  4K5R A;  4YUD A;  4IDK A;  3UN5 A;  1S1X B;  4OX9 F;  1VR6 A;  1TQL A;  4NLX A;  3CC2 S;  1CVJ A;  1Q8B A;  4Y2I A;  1Q8K A;  3JB9 k;  1UTA A;  1Q8L A;  1SI9 A;  4ATN A;  5HQM A;  4RNO A;  1NM2 A;  2B9W A;  4OZ1 A;  4I2Q B;  3A1Y G;  4C8O A;  4OZ5 A;  1HI0 P;  3Q89 A;  3AOB A;  1UVJ A;  3SSS A;  5H9F J;  1VBK A;  1FEH A;  3JSM B;  2JZ5 A;  3J7A 1;  4RW9 B;  3TWZ A;  2DRB A;  4DOZ A;  1RIS A;  1TR0 A;  2KDO A;  2R8I A;  1NDC A;  2EFV A;  4H4O A;  1NZA A;  4DR7 F;  2E66 A;  1Q5V A;  1R0B G;  2EEY A;  3TA1 A;  1VIS A;  5AE3 A;  2B51 A;  2ZM6 F;  3EZO A;  1RT2 A;  2C3Y A;  3DN9 A;  3CDU A;  1HPZ B;  1RBL A;  3MOJ B;  3UNY A;  2M8D B;  3HKZ D;  3PCO B;  2ZBI A;  1KBR A;  1FNX H;  2AQ4 A;  3ONQ A;  3OLB A;  1LWE B;  2CQ2 A;  1JKH A;  3NNH A;  5K5M A;  3M2U B;  4DFM A;  1U0H A;  1WHY A;  4RBU A;  1JLA B;  2AP6 A;  1U6Z A;  3UCU P;  2QEX S;  3KHR A;  3D54 A;  4P2S A;  4O4G A;  3OUY A;  5IC6 B;  1N34 F;  1YJV A;  4RWX A;  1FT8 A;  2GO8 A;  5BYS A;  1Q79 A;  3PJW A;  1FE4 A;  4USV A;  2XWX A;  2KN4 A;  3IGN A;  3BQ2 A;  1JMT A;  2HVZ A;  3KJF B;  1S6P A;  2XWY A;  1M1H A;  4DSK A;  1RT1 A;  1HA1 A;  1FK9 A;  2W7O A;  4CLP A;  5LMN J;  4A48 A;  4HVZ A;  2PE8 A;  4NCG B;  1FKO A;  2DIV A;  4K4W A;  2G13 A;  4KPC A;  1XMO J;  2YKQ A;  3OSP A;  2XMM A;  2Z8Q A;  2VG6 A;  4C8K A;  4YB1 P;  1X60 A;  1RTJ A;  2I38 A;  2RD5 C;  4EEY A;  4LR9 A;  1N52 B;  5CAA A;  1AT1 B;  2FGC A;  4Z2X A;  4B9L A;  4USW A;  3SV3 A;  2A0F B;  3AQO A;  4UOG A;  2GIQ A;  1ZS6 A;  2KZM A;  2E5G A;  4D3G A;  3T6B A;  3H20 A;  3FCH A;  3M1V B;  2A6M A;  3GZ7 A;  2ROG A;  2UUW A;  2FJW A;  4X65 F;  2Y1L B;  4CT9 A;  3K5O A;  3EM1 A;  3HHL C;  4WKR A;  3DOM A;  1HNV A;  4YB6 A;  5BJR A;  2K2P A;  2I5J A;  2OHD A;  4O3R A;  3HP6 A;  4MK9 A;  1K8A T;  1E6V A;  4IH5 A;  1JJH A;  4MYT A;  3ADA C;  3EJM A;  1YHQ S;  4HKQ A;  4LRC A;  3TYT A;  5C2G A;  4NYP A;  2FLO A;  3BQ0 A;  4Z7Y A;  3N9U C;  4MIW A;  3AD7 C;  2IC3 A;  1CSJ A;  1J5E F;  1AFI A;  3C6T A;  1VQP S;  4H4M B;  4DUY J;  1LKZ A;  3GR0 A;  2VJU A;  1WC0 A;  1QUP A;  2DIS A;  1VQN S;  4ZHR A;  3CE8 A;  2GMJ A;  1CG2 A;  1S9E A;  5ETL A;  2IJR A;  2RRN A;  1F5A A;  7AT1 B;  3E3X A;  3L7U A;  3Q24 A;  2CAD A;  3TUZ C;  7FD1 A;  2OGU A;  4CIO A;  1SH0 A;  3ILO A;  3Q0A A;  3M6W A;  4ENO A;  3EPI A;  2E9Z A;  1E6Y A;  1DLO A;  4L3N A;  5F8L A;  3M30 B;  2HHH F;  5AXK A;  4NYZ A;  4MK8 A;  4U7U D;  2VA3 A;  2YY3 A;  5K8P A;  3AOC A;  3UI3 A;  1KTV A;  2EG2 A;  3J7Y I;  3J80 Y;  4GMK A;  1B70 B;  4MAK A;  3NGT A;  5HL7 Q;  4KYZ A;  2EKY A;  4K2X A;  2RML A;  1LXN A;  3Q83 A;  4JI6 F;  5L39 A;  3HX9 A;  1HQU B;  4QIE A;  2YH0 A;  4ELT A;  4JV0 A;  3WX8 A;  4JV5 F;  4PYD A;  3I55 S;  1NUE A;  2E1R A;  3ZTP A;  2D9O A;  5J1E B;  3E01 A;  1RTD A;  4GVB A;  2YNI A;  2RRA A;  2DR9 A;  2RH3 A;  1NKE A;  5T7L B;  1GXT A;  1ZAV A;  1UP1 A;  3JAM Y;  2HK2 A;  2L41 A;  1FRM A;  5DRK A;  2DNL A;  4PCQ A;  2QYG A;  1RT6 A;  2C2Z B;  1EX8 A;  2XO7 A;  4QZV B;  4JI1 J;  4O3O A;  2KHC A;  3M6X A;  3BN7 A;  4PG5 A;  1IM4 A;  2PII A;  1X5O A;  4OYP A;  1HNI A;  1HWK A;  5KFG A;  4AQY J;  2KM8 B;  4ECW A;  3D68 A;  4B08 A;  3CCU S;  4PPD A;  4OJH A;  4R25 A;  3T6J A;  2MST A;  3M8Q B;  3LQV A;  4X4Q A;  4LQ3 A;  1HBN B;  2M9K A;  1D3W A;  3RR8 A;  2W9C B;  1M5H A;  5T41 A;  4FYV B;  3EUN A;  2GHP A;  2DHG A;  2ZC3 A;  1K73 T;  2KJV A;  1FXL A;  1H2T Z;  2A18 A;  1NBE B;  2XMW A;  1RT2 B;  2AD9 A;  3J81 j;  2DY9 A;  4ELV A;  3VGT A;  3MMB B;  5C42 A;  3KLG A;  3J7Y U;  3HLU A;  3NGK A;  1UZD A;  2FHO B;  4DQR A;  1B7F A;  4TY8 A;  2LVW A;  1HIY A;  1JKH B;  3LPE A;  2UVU A;  8ATC B;  4ZCL A;  4G6V B;  3DU6 A;  4LRE A;  2W25 A;  5IQQ A;  3RW6 A;  1TMM A;  1IQZ A;  4ZLJ A;  4ZJO A;  2QT7 A;  1K47 A;  1ELO A;  3VTI A;  4M5H A;  2BJ3 A;  5FDL B;  1RT3 A;  3DDI A;  3E51 A;  3MAH A;  3L3C A;  3CJ8 A;  5HP1 B;  5KOW A;  5ETT A;  4WU3 A;  5E33 A;  2BA9 A;  2QV6 A;  2QGF B;  1M0S A;  3IA0 A;  1HD1 A;  3R5C A;  3LP1 B;  2BJ8 A;  2XMU A;  1D1U A;  3GLJ A;  3MR6 A;  2Y0B B;  1Y11 A;  5F8M A;  4G1P A;  2YKN A;  3BF4 A;  4L73 A;  4MKB A;  2QG9 B;  1HYS A;  3CD7 A;  3DXB A;  3AJ2 A;  2RF2 B;  2NPI A;  3RAQ A;  2ZBP A;  4KC5 A;  4LF4 F;  4KHR A;  4F04 B;  3HO1 A;  4BWJ A;  5EDW A;  1NJZ A;  3PW4 A;  2ALZ A;  3LUY A;  2QFJ A;  2V2K A;  1URN A;  1QUV A;  4ZKA A;  2QMU B;  3M32 A;  2GZO A;  2J7U A;  2PMZ D;  1T9X A;  3KHG A;  3K5L A;  1HWU A;  5B09 A;  2ZHO A;  3K58 A;  3C3L A;  1SUQ B;  2V8V A;  3BO2 A;  3HSD A;  5HI7 A;  2CKW A;  3RBD A;  1VC6 A;  1EQM A;  5KFI A;  1NK6 A;  2K3I A;  4JUZ A;  5LJ3 Y;  1UVI A;  2KXH A;  3AQP A;  3HMJ G;  2YWW A;  2CPY A;  1PKU A;  2YQ1 A;  1CJV B;  2LMI A;  1KFD A;  2N4D A;  3KJQ B;  1DQ8 A;  1MRO B;  4DV7 F;  4TXS A;  2A2D A;  1ZPV A;  2Y1R I;  2CQC A;  2WOM B;  4WII A;  4IH7 A;  2FVQ A;  2W8K A;  4K5S A;  3FVY A;  2UUT A;  4ZJL A;  3AA9 A;  1E6Y B;  1DLO B;  4OX8 A;  8RUC A;  5E3A A;  1Y00 A;  2I9S A;  4ID5 A;  4R5P A;  4BLG A;  4X4S A;  1NKB A;  3CVK A;  4KRW A;  2VOO A;  3OL6 A;  2YWF A;  1RQ0 A;  4QYZ K;  2Z57 B;  1JXV A;  5ETS A;  1QDU B;  2JHE A;  4DR5 F;  4FKX A;  3ZO7 A;  3R5B A;  3BPD A;  1UEV A;  2KVQ E;  1HWI A;  3KK2 B;  2HMI A;  4TQR A;  4FVM A;  1A6L A;  1D0E A;  1HLW A;  2MKJ A;  3UN3 A;  3MCO A;  1MWY A;  4CP5 A;  3KLF B;  4KE5 A;  4RNN A;  1LW0 A;  2APO A;  4C8L A;  1C0U B;  2MQO A;  1OS5 A;  3V6D B;  2V8G A;  4DV6 J;  3AHP A;  3QIP A;  1QAY A;  2YKM B;  2VBX A;  4A47 A;  2UUC J;  4DLG A;  4AUK A;  3I4P A;  2ZH5 A;  2HG4 A;  4O3Q A;  2N7Y A;  2F7V A;  3TNV A;  1NK7 A;  2RU3 A;  3BO4 A;  2IYI A;  3I0R A;  5KG1 A;  3IBF B;  1SIW B;  4RO0 A;  4R0J A;  2QC3 A;  1HNX F;  1TK0 A;  3OSN A;  4LFB F;  3I96 A;  4AND A;  4F2S A;  3BRE A;  2V68 A;  2XNQ A;  3PW5 A;  3KG1 A;  2JLG A;  3BM7 A;  4W90 B;  2P5V A;  1WNE A;  1MN7 A;  5J1N A;  3RBX A;  1RWV B;  4EBC A;  3V4M A;  1IKY B;  2KFN A;  3W63 A;  3W5Z A;  4OFZ A;  3BGU A;  3R7N B;  3T41 A;  3IAS 9;  2R7R A;  3R1H A;  1KLN A;  4FYX B;  4ILM A;  4M5D B;  5EWF A;  3FQL A;  3G96 A;  4K4Y A;  5E2Q A;  3I0S B;  3RRK A;  2W2N P;  3NOG A;  3MTJ A;  5A8R B;  2C3O A;  3BGF A;  2COL A;  2CQ4 A;  3JYT A;  1HD0 A;  3DNC A;  4JI5 F;  2QZ8 A;  3ISN C;  3HM9 A;  5B0C A;  1NHU A;  1FHT A;  3NS6 A;  4WIQ A;  1SKW A;  2ZIT A;  2FQQ B;  3PW2 A;  1CUL A;  2AWZ A;  2WSC C;  4AL7 A;  4LRB A;  2XS5 A;  3HVW A;  4WZQ A;  4DUT A;  1N5V A;  1XBW A;  2HBQ B;  1MMD A;  5DDP C;  3HHE A;  4ID8 A;  4MH8 A;  2JOQ A;  4X4O A;  3A3O B;  2J5A A;  1I94 J;  1X0F A;  3QZ8 A;  4M94 A;  3PIO Q;  1R6V A;  4WFY A;  3UR0 A;  2B4U A;  2M7S A;  1M90 T;  3CCQ S;  1RUS A;  1DFD A;  1ZM2 A;  1FRX A;  1QE1 B;  2UXB F;  4FN5 A;  3R9L A;  4USM A;  2DNO A;  2XYH B;  3KLE B;  2H5J B;  1U1N A;  5M2R A;  3QGG A;  1HHT P;  4KFB B;  1VBX A;  5J2P A;  5LM7 E;  1RKI A;  4EYH B;  2JSX A;  1NSA A;  3HT3 A;  4H54 A;  1CJT A;  3UR3 C;  3IWX A;  3GJR B;  4HTJ A;  1Q81 T;  4I4B A;  4RW6 A;  3MM6 A;  5E41 A;  3OT9 A;  1U02 A;  3FZ2 A;  5KT3 A;  3GCX P;  3JTO A;  3CSK A;  3TX0 A;  4HHH A;  3KLV A;  1GFW B;  3H5Y A;  3HXM A;  2IA6 A;  4OI6 A;  3TUJ C;  2GQQ A;  3PXG a;  1G6B A;  1NRK A;  3VGS A;  1V3S A;  1UWA A;  3D7S B;  3LGH A;  3HFK A;  1S1W A;  1VMB A;  3M7V A;  4CM0 A;  2KZZ A;  2ZNZ A;  1PJ7 A;  4IG3 A;  2L08 A;  2KFY A;  4FDF A;  3RBE A;  1LFW A;  1DAX A;  5AJ3 F;  2HHV A;  2DGU A;  2X3D A;  3X1L B; 
#chains in the Genus database with same CATH homology
 3ILJ A;  3KUG A;  2F63 A;  1TMM A;  3HCX A;  4M5M A;  1DY3 A;  1F9H A;  1HQ2 A;  3HSJ A;  1IM6 A;  3HSD A;  5ETK A;  1Q0N A;  2QX0 A;  3IP0 A;  1EQM A;  3UDV A;  3HSG A;  2F65 A;  1CBK A;  1RAO A;  4M5G A;  5ETR A;  4M5I A;  5ETT A;  3QBC A;  5ETS A;  5ETV A;  4PZV A;  1G4C A;  4M5L A;  1TMJ A;  1RB0 A;  3HSZ A;  1RU2 A;  5ETN A;  5ETM A;  1RTZ A;  3HD1 A;  4F7V A;  3ILO A;  4M5J A;  5ETQ A;  4CYU B;  1HKA A;  3HT0 A;  3UDE A;  3HD2 A;  2BMB A;  4M5H A;  4M5K A;  4CYU A;  4M5N A;  4CWB A;  4CRJ A;  2CG8 A;  1KBR A;  3KUH A;  1EX8 A;  3ILL A;  5ETP A;  5ETL A;  3ILI A;  3KUE A;  1RU1 A;  1EQ0 A;  3MCM A;  4AD6 A;  3MCO A;  3UD5 A;  5ETO A;  3MCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...