3KUHA

Crystal structure of e. coli hppk(h115a) in complex with ampcpp and hp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPAYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Roles of residues E77 and H115 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3kuhA00
4M5GA 4M5MA 1EQMA 4CYUB 1EQ0A 3ILOA 1KBRA 1CBKA 1RAOA 3MCMA 3ILLA 1HKAA 5ETSA 2QX0A 3HSDA 1IM6A 3KUHA 5ETVA 3UDVA 5ETKA 1TMMA 4M5IA 2CG8A 1G4CA 3HSJA 5ETMA 3QBCA 3HSZA 2BMBA 5ETTA 5ETLA 1EX8A 5ETNA 4CRJA 3IP0A 3HD1A 4PZVA 1RU2A 1RTZA 3MCNA 4M5NA 3KUGA 5ETQA 4F7VA 2F63A 1DY3A 3ILIA 3MCOA 3UDEA 3UD5A 4AD6A 3HT0A 4M5HA 1F9HA 3HD2A 1RB0A 3HCXA 1Q0NA 2F65A 3ILJA 4M5JA 4CWBA 1RU1A 4M5LA 4M5KA 5ETOA 5ETPA 5ETRA 3HSGA 1TMJA 1HQ2A 4CYUA 3KUEA
chains in the Genus database with same CATH superfamily
3PJXA 2P9CA 3HF5A 4ZJQA 3N6MA 2WB1D 4C0BA 2FHJD 4F25A 4CT8A 4NLDA 2YNIB 4HDHA 5CYQB 1IKWA 1TR0A 1DHMA 3M6VA 4X4RA 3C66A 4PABA 1U6BA 3A8KA 4PWUA 1WC5A 4HT5A 1HQUB 3FMBA 4ANDA 3GTYX 3HO1A 1MROA 1SC1B 1FA0A 3UI3A 2GIFA 2VJVA 2W8KA 4RW4B 2I9SA 3KFWX 3LPYA 1RT2A 4NZ6A 1B0PA 5L39A 3BH6B 3HHLB 4JI7J 1LWCA 2RNEA 3DGVA 5SUHA 1RTDA 3KNAA 3OW2R 1A6LA 4ZVTB 1B64A 2CWKA 3ZXWA 1UKUA 1RQ0A 3F73A 2E7WA 2KXNB 4LFBJ 2UVWA 2KT5A 4USWA 3X1LB 2R4FA 3CNQP 1UWBB 1OQ3A 1WHWA 3I82A 4OYPA 2HVZA 5HAOA 4J91A 3M32A 2O3DA 3CD0A 5IM0B 1F6TA 1K44A 3L7PA 1RUSA 1NB2A 4OI6A 3GYXB 2HHHJ 5F9NA 2JJ4D 2W4DA 4B02A 3DU6A 2R7WA 1X7VA 3IO1A 1WOSA 2DH7A 2A18A 3SSSA 3W5ZA 1HWJA 2OEKA 4LVNP 1R8BA 2KKHA 3C14A 2IM1A 2EI5A 5C42A 4DOZA 1NJIT 3M9OB 1SPBP 3DLGB 1ZM4A 1RWNB 2E1AA 3QT7A 1UETA 3PW7A 1CULB 2MJUA 1WSVA 1XN9A 4NI2B 4KIAA 2E29A 3R5CA 1JXLA 3CJ3A 2UUBF 5JJBA 1HBOA 5KFPA 2OTJS 2QA2A 1WWHA 4NA3A 2HZVA 1OO0B 4TLQA 3PYFA 3POTB 5KT4A 1WKKA 4TKTA 2CWXA 2RQMA 1CJTA 2ATCB 3QIPA 8RUCA 2FD2A 1KVIA 2ERRA 4OV1A 4JI6J 1WG4A 2ASJA 3LP2B 2OI2A 4N41A 1DLOA 5K20B 2RDIA 3R8YA 2QRRA 3DDNA 3VQTA 1VRTB 4KV8A 1RISA 2HG4A 5CZVA 4I6AA 1WSRA 2X51A 1HBUB 1APSA 2JEIA 1HA1A 2F1FA 2UV8A 3G9CA 5J2NB 2BQRA 3B54A 1FRHA 4DS4A 4QIGA 3IGVA 1SQEA 3BQ0A 2ILYA 4F8RA 3LWLA 2B9EA 2C22A 4ID5B 2HGNA 1J27A 2RF2B 3ZNJ1 4PPZA 1U24A 5EGYA 2YNHB 4CLFA 5HN0A 4P2XA 4DR3F 2X1AA 2UUAF 4IFYA 1PC5A 4MTPA 2BJ1A 4RW8B 1N36J 2E5LF 1OSDA 4X4TA 4A47A 3GV5B 5J2MA 2MQPA 4ZP9A 2V8PA 3D1OA 3MUMP 3TJ8A 4JYAF 2V63A 4USKA 5T14A 2CJQA 2RD5C 3UCZP 3TUIC 3KMSA 1S10A 1SB6A 2HQFA 1TL5A 3MR2A 3B78A 3RB3A 4RW6B 3SCJE 2YVSA 3J7A1 4NMLA 3I9ZA 5A76A 2LQ5A 2E5GA 1Y3JA 2A6MA 4JI3F 1RTHA 3V6JA 1S1XB 3DOMB 1WTBA 5F8HA 3MD1A 3PHTA 5G4DA 1I51B 3P96A 4HACB 4ES1A 5L9NA 2XYHB 5KFXA 2MHEA 2AU0A 4ALZA 4L73A 5I3QA 2R7UA 2F8EX 2AYBA 2AZ1A 3OUYA 2XMKA 3P5TL 3BYRA 2A3JA 1GT8A 4ZVGA 2EFNA 1S49A 2W2QP 3I32A 1BWVA 2DGXA 3PVXA 2PDAA 2HHPA 4NXNF 1RAHB 4G1QA 5KFUA 3D28A 4USTA 3EZUA 1Q1KA 1C0UA 3T3FA 2N82B 4WIQA 2AEFA 5I3PA 4F3OA 1IBKF 4U7CA 1NK9A 5KFYA 3NLCA 5HBMB 3TZXA 1IUJA 3HX9A 4F0HA 1EJ7L 4ZCLA 4OI1A 2J7UA 2IJNA 5K8MA 1QE1B 1MWZA 3PEHA 1PILA 5D6GA 3TI0A 2Z2MA 1X4FA 3CCWA 1NEEA 4RW7B 1BE4A 2ILZA 3LOUA 4DPOA 5J1EB 2L9DA 1N5YB 9ATCB 4RW9B 4CLSA 2UUBJ 1F5CA 4ETZA 3RB6A 4JI5J 4DPTA 5A0YB 2ZOFA 4ENOA 1KLMB 2NR0A 3QATA 1JKHB 2UUTA 3W2WB 2F4VF 4NLPA 4HH1A 5B7WA 3PKYA 2J6TA 1F3FA 4YY3F 1F60B 5GAHU 3AA8A 1UFWA 1Y0HA 1RWXB 4B3MF 2KVIA 1UMJA 4DG1A 3R6GB 1GEHA 4QZVB 4RBTA 2VPWB 2HVEA 4LF4J 5AXLA 4GC7A 4O23A 2Q6CA 1T05B 3ENVA 2D41A 4B3SF 4HHHA 3G8TA 1XC9A 5DGAA 3PX6A 5HLFA 1GNKA 4I6YA 3HT0A 2J6UA 4O4GB 3J7YI 5IXUA 4DR3J 2PMZD 4F2RA 1FE4A 2UUAJ 3V4IA 4UT4A 4ICLB 1U2RA 2E5LJ 1TL4A 2BW2A 3S01A 4OZ3A 1SKUB 1SI9A 2VG5A 3W8GA 2CJKA 4USUA 3KJQB 1E6YA 2MKSA 1HL6A 2J5AA 4ED8A 1E6VA 7FDRA 3PHEA 3EUNA 3AJ2A 1TUGB 1ZS6A 5LMUF 1IKWB 3T1AA 2C2EA 2MZTA 1ZYQA 4KQZA 4TQRA 3C2PA 4DFPA 1QVGR 1MROB 4LIWA 2Y0SD 1VHIA 1S1UA 6FDRA 4DUYF 1YBAA 2OUGA 4DEZA 2HZCA 1PJ6A 5EDWA 1RT2B 1K47A 1CJKB 4TXSA 4ED0A 1LWCB 2V9WA 1X4HA 2IPOB 1QTMA 1RTDB 2DEJA 3J80Y 3CDWA 4O3SA 2JH3A 3UD5A 2CYYA 3ZFVA 4M5LA 3T6BA 2UP1A 3W1YC 3EDRB 2I8EA 4OX7A 1F9EB 5MLCV 4CM2A 2QMXA 3M32B 3LW5C 2DNGA 1LEOA 4EGLA 1W2BR 5F8JA 2FDNA 3W7BA 3A4TA 1U4BA 5B0BA 2W1BA 1XMQF 4DV3J 3C14B 2CQ1A 1BMQB 4LFCF 3FCVA 2QIFA 5C42B 3W65A 3F44A 4KR0B 2CQIA 4OZ2A 2WSFC 5GAEU 3JB9k 4O3RA 3KG4A 4ZPCA 4DFJA 4J9UE 3DMJA 2DH9A 3QGGA 2YX1A 4QIFA 1N5TA 2YWGA 1HBOB 2GX8A 3EX7B 2NXJA 2KRBA 1FX4A 2B3TB 1YJWS 4QU7A 4ZP8A 3IC1A 2W2OP 1Q8IA 2VDIA 2F4VJ 1CJTB 1KOHA 1Y5NB 3QIPB 4YY3J 2RVJA 1U6FA 3QWUA 1GAOA 1ZA2B 1DLOB 4C9DA 4B3MJ 2YPYA 2DK2A 1QAIA 1Y11A 4KV8B 2YTCA 3MECA 2HMIA 3BGLA 4PG8A 4E2FB 4ZN3A 3MM8A 5D4LA 3K58A 2DYAA 1FERA 3SQGA 3BO2A 3LP1A 3QJPA 2A1BA 1LWFA 3D0IE 1PAEX 1JJHA 2HLTA 5CABA 4PG7A 3A13A 3ILJA 2YQ3A 4MJKA 1VOMA 5D8HB 1N8RT 1M1HA 1NKEA 3PEJA 4EBDA 2DGSA 2WVCA 3CDUA 3NMAA 2CRLA 1IR1A 5A8RA 3WX8A 1RWPB 1H0HB 3QAUA 4IFYB 3G71S 3H5YA 2XI3A 2JLGA 2WRMA 1FK9A 2Q3PA 3GILA 1RTIA 2Y1JA 2H5IB 1FRLA 1NKCA 2XZDB 3A3PB 5J2MB 2OJ3A 3JQKA 4KH1B 1VQ5S 3N01A 1CLFA 2IVFB 3F56A 1FD2A 4X4PA 2MXYA 1BD6A 2W2NP 2W9CA 4XTTA 3AFGA 3B82A 3CCUS 2HQ3A 1H2UX 3CDBA 4FYDA 3DLBA 2XBPA 2AJFE 2L9WA 2V2QA 2V67A 2CAJA 1W25A 4A8QA 1RTHB 3RU0A 2VFUA 3PY8A 1B70B 4X66F 2R7TA 2OMOA 1TELA 1QTNB 2ALZA 1KD1T 3W9JA 5GADI 3H5XA 3C8YA 4ZLPA 5H9EK 1HLWA 5M2UA 1EB0A 5A2QU 3TZWA 2O01C 4MMOA 2ZH6A 1IBMJ 3ZTSA 4DCOB 2CJYB 2R7OA 3MURP 1K8AT 2N4DA 4G1QB 2ABYA 3N6LA 1C0UB 1GXUA 2XLIA 5T7LA 3MOZA 1B4SA 3E8OA 1J5EJ 4CRJA 3KLHB 2OEJA 1BWEA 4DV7F 2GS8A 4MK8A 4QWAA 5EHHA 4Y28C 4O44B 1HWIA 3JAMU 2I6WA 5KFAA 3CO9A 2QLJB 4YDDB 3WDOA 1FKOA 4J9NA 5F41A 3D54A 3M1VA 2LA6A 1LFWA 4KPYA 5GMDA 2XZWA 2DR9A 4C6AA 1BUXA 2R2UA 3VGUA 5H1SV 4O3OA 3HI9A 3EXCX 3SQOP 3G6VA 2V5HG 2MQ8A 3BGRA 3DOLA 1M5SA 1O0PA 3M8ZA 3KHRA 2Y1IA 3HSDA 4ILLA 1R8PA 5B0FA 1PAUB 4YN3B 1WEXA 3KNGA 3OFFA 3OQ2A 2HAFA 4Q0BA 3THPA 1WI8A 4DG1B 1P9QC 4WXWA 4F4ZA 3HD2A 1CS4A 4WBFA 4K4UA 2QV6A 3GLJA 3MUVP 1VMBA 4GRSA 1AB8A 1Q82T 1TK5A 5C7PA 4DUTA 3I9V9 5KG4A 3MM9A 5HLFB 2BDPA 2IDLA 1RU1A 4MKVA 2R42A 3ZTOA 4ZK7M 4OYXA 3BS9A 1W2IA 3JTOA 3HKWA 4CT9A 3V4IB 2LQ9A 1Y5IB 3KJVA 1ZZFA 5L8RC 2LQJA 3CCZA 3H42A 5DS7A 1JLCA 2JHEA 3GJSB 2AJ2A 2IMWP 2VG5B 3MTKA 4Q2MA 3CXCR 2K1RA 1E6YB 2FJBB 4X2BA 4UUXA 1E6VB 4KGMA 3TR5A 4QBUA 2EVZA 2IJRA 4JV5F 2DRBA 3R5GA 2Y8YA 3DKDA 2H65B 4P7VA 1OYEA 2KT3A 1VBZA 2I0XA 4RX6A 3PFOA 2HHQA 2GQQA 1SC6A 2AEMA 5EWFA 4FXDA 2DNHA 3KDOA 1S1UB 1Q5VA 2W7OA 2E1RA 3V6HA 1M5KC 1KONA 1RJJA 1S9EA 5ETNA 5KAKA 2EXUA 4OZLA 3THVA 1XEZA 2QX0A 3QSYB 2JEFA 1BC6A 3K5OA 2Y0BB 4OI0A 5L1LA 2V4QA 1SH0A 2LXUA 2J7WA 2EKNA 4DV1F 3MMBA 2XSJA 4CLZA 3CJTA 5IWAF 1RT7A 1WF0A 3C6UA 4FBTA 4OJ3A 3MFIA 1NDLA 3FRYA 2EC2A 2XMWA 3KUHA 4B9UA 3PACA 4ZVUB 4DV7J 2ZBPA 4GMKA 2LMIA 3ENWA 1V3ZA 2CDRB 2ZFHA 4IG3A 3HVAA 4UZCA 4OLPA 1I3OB 1YZ6A 3TA0A 1RA6A 3IR6B 4R5PA 2BX6A 4HYKA 2E5JA 3I5CA 1UA0A 3DMJB 4C2MA 5F3TA 2KFZA 3NS7B 3NXZA 2FB0A 5T41A 2HIYA 4IQMA 3MR6A 1SL0A 4WKYA 4DFKA 5FIIA 3MPDA 3FQKA 4I2QA 1CSJA 5BYQA 4HI2A 3SXLA 5FLXY 4DLEA 1KOOA 3VF0B 3FFIA 1QY7A 1S6OA 2HNDA 1AUSL 3M8QA 3M2RA 3MECB 4X64F 5B08A 1K0TA 2HMIB 3CCQS 3MM8B 2YKAA 2EC0A 4JV1A 3BZQA 5THWA 5ETKA 3SQGB 4ZOSA 3LP1B 3PR4A 1VQPS 2GVDA 2NXUA 1LWFB 2RHSB 4OFZA 4F7VA 4JI1J 1DZ5A 4YR0A 3MXHP 2AEJA 1IKVA 2L41A 2K06A 4KH0B 3Q8PB 4IOCQ 2XNRA 2JWNA 3RAQA 1OY9A 1RKJA 1FTCA 3GCWP 2VQFF 5A8RB 1PJ7A 2JEJA 1V3RA 3HCXA 2AP6A 2IJFA 2KB2A 3CTRA 1FK9B 2G9OA 1F2GA 1RTIB 1NCLA 2XY5A 4PCQA 1AFJA 1YBUA 2KI2A 2MSSA 3Q89A 2WVFA 3GIIA 2EBEA 2W9CB 2Z56B 1TMJA 2EG2A 5KFJA 1NM2A 4WU3A 5J1PA 3I0SB 3AOCA 2FLOA 3HK2A 3N9UC 5K14A 1SC4B 2GHWA 2UV8G 1N48A 1PIEA 4DXLA 2BKNA 4OQJA 3DLJA 2BJ3A 4A8WA 1K9MT 2XCPA 1X0FA 3UW1A 1S0VA 2H1YA 2DY1A 3DRPA 2XMJA 1B0VA 1Q7YT 5KFCA 3NAIA 1JK9B 2CNKB 2VPXB 2WW4A 2DGWA 1VHFA 1Z2ZA 4G6VB 3UFCX 5K5MA 2MQOA 2CJ9A 2XLJA 4RPFA 1TTHB 4W4MA 5E3AA 2VJUA 2FJEB 3TVKA 3IRXA 1M5PC 4TVAB 4ZP6A 1JB0C 4DV1J 3TVYA 5D4PA 3CJQA 4C98A 1F3VA 1TV6A 3J81Y 4DR1F 3EPIA 5I3UA 5C2GA 1CEZA 1L3TA 5J2PA 1O8BA 2NZCA 3V6KA 1FRKA 2MMYA 3KLIA 3US5A 4B9VA 3ISND 2F3JA 1D9AA 3EXYA 2DVIA 3BR9A 2GAGC 4WF9Q 1TP7A 2VG6A 5T7LB 3ULHA 1VISA 2PFDA 2Z57B 2IBKA 2GHVC 4AUKA 3PV8A 5BR8F 1AW0A 2VC1A 3D6MB 4Z2XA 1QSLA 3FGVA 4U96A 3K2YA 4F26A 5B09A 1U02A 1LNQA 1HBNA 1FKOB 1G7CB 4C4WA 2HYIB 3M1VB 1RB0A 3CJ4A 1U47A 4C8YA 2UXBF 1X9SA 3KYLA 2LQBA 4KTQA 1MU2A 5MAOA 3TUJC 5C25A 4HR2A 4M94A 5GAHI 1V9OA 1WF1A 2BANA 1Q81T 3BGRB 3B8HA 3DOLB 1HMVA 2ZEJA 4LFAF 1RE1B 1IBLF 3ITHA 1ZTTA 1JLBA 1N32F 4Q0BB 4O3QA 1WC0A 4X64J 1N34F 1CS4B 2H5EA 4X4OA 4YR2A 1MWYA 2YNFA 1TKZA 2PI4A 1X4EA 1XJWB 4Z7CA 2NSCA 1WG5A 5AE3A 4KGVB 4PXCA 1P8GA 3MM9B 1S4EA 3UR3C 4LF1A 2DO0A 5CZXA 4FYXB 2YWKA 2VQFJ 1Q5YA 4NLVA 4X4UA 1RAFB 2ZITA 4CM0A 3AXKA 3KJVB 1HNIA 3Q23A 2HS3A 4LREA 1RA7A 1DTTA 4WKRA 2CPDA 3RG6A 4AL6A 4M95A 3M9MB 4NEYA 1WORA 2ZC4A 4RUHA 2K1RB 3K8VA 4I7FA 1OIAA 2CQGA 4JV2A 4CH1A 2DPIA 2PD1A 3CD5A 4LJMA 3TNVA 3SFUA 3KLVA 2QLFB 3NNAA 4L72B 2LXIA 2YX4A 1DTQA 2DIVA 2LVWA 3CEDA 4EK2A 1D09B 5E3QA 1WHYA 4B9MA 5JUMA 3W60A 2CJAA 1S9EB 2MLYA 2MDAA 4QWBA 5K8OA 3IGNA 1IKXA 3M7VA 2IAJA 3IBWA 2DR8A 4CNYA 1PGZA 5H9EJ 4ZJOA 4C7QA 3KK1A 2L08A 3FQLA 5DLFA 2RRBA 4WFYA 4RU2A 4MFBA 1EKRA 1T9XA 2PGCA 4HDGA 3JTNA 1BXNA 2F8HA 1JLFA 2FZCB 3C3LA 3CCJS 1HYSA 4DR1J 3TP2A 3KOAA 3MMBB 2XSJB 2DCUB 1RT7B 4C8LA 3MEGA 4K50A 2QL7B 2N3OA 1SJ1A 3C6UB 2KG0A 2O5DA 2RDJA 4A46A 4P7TA 3EWGA 3MD3A 1HBMA 1IJEB 1N0UA 2C2DA 1NJYA 1YJ7A 1YI2S 2XULA 4ZHRA 2VKRA 4PWWA 2V69A 5E3RA 3CMES 3K8WA 4F2SA 3AOBA 2ROGA 5IZHA 2ATLA 2R9LA 4CYUA 1RACB 3WX4A 5GAEI 4IG3B 2G13A 4WTYA 2EFQA 3BV8A 2PT0A 4R5PB 2XMTA 5CCLA 4LIRA 4UUWA 5CH7B 3UPFA 2UXBJ 1ZETA 4DN9A 4U6PA 4K4VA 1MMDA 3I0RA 2B7CB 2BE7D 4DPYA 1EX8A 2G2ZA 2B9YA 2VH7A 2HIQA 4I2QB 3AODA 5KFGA 4C3MA 2NCKL 3BM7A 3N28A 1IBLJ 2D7SA 1S1WA 1YRXA 2NPIA 3DRSA 4LF9F 1RYSA 2DNRA 3FFIB 3P6YC 3M8SA 3SIPB 2HNDB 3ZTPA 3CB4A 3HT3A 5LXRA 4LMZA 3M8QB 2AMCB 1RHJB 3ZZUA 1RAOA 2GZOA 4OV6A 2CXEA 4XAKA 2GVDB 1JLGA 4IKAA 2XM3A 3ZZYA 2ZJPQ 1RAAB 4M5JA 2RJZA 4O4RA 1R3NA 3MM6A 3TO8A 1IKVB 4M8LA 3JSYA 2ZH5A 3OTOF 2VD3A 1LK7A 3C19A 5HK4A 1NRKA 2MKYA 3SMZA 2EW9A 3NY0A 4AL7A 1U1MA 1UVIA 3DNCA 3LP0A 1GMVA 1L3SA 2HFNA 4N5SA 4O0IA 5F8MA 3EGZA 2KHDA 1F5AA 3Q22A 4LSLA 2VHGA 3MR7A 2A6OA 2CPIA 1HNZF 5DM6Q 2GJIA 4LBIA 2WVDA 2OPSA 3BREA 1AYEA 3BN4A 4YQWA 5KFQA 3KUGA 5K14B 3QJJA 1ZM2A 4X4SA 4IFVA 3RTVA 2KO1A 2MLXA 2XS7A 4I69A 4Z7YA 1XQIA 3BSAA 2ZC3A 2FHMA 2VASA 3VVUA 5K8PA 3DRPB 3O1LA 4NYOA 1OQ6A 3T19A 1MN9A 4YB7A 2B9WA 2MJNA 4YB5A 5KFOA 2RUSA 2F63A 1ZZNA 3IRXB 3BGUA 2RUGA 2EFOA 3I5AA 4CH0S 2VKZG 2BV3A 1Y5LB 4X62J 2D69A 4F0KA 4TYBA 3LAMA 2G0IA 3I31A 2VA2A 1TV6B 4NPOA 3QSIA 1S6QA 4ECSA 5J2PB 4KRWA 1KKHA 4PQAA 3HP6A 3DDIA 1EHWA 2B4VA 3GV8B 4J9KA 4QW8A 3HHEA 2WOMA 1VR6A 1IWAA 3BKTA 2VG6B 3KK2A 2ZKUA 2OSRA 3ENQA 2WVBA 4C8NA 2BQUA 1BY9A 1YITS 3ZZRA 2C2MB 3EE3A 1FRXA 3NS5A 1G1XA 1ICEB 4UW2A 1N33F 2VG7A 3BPDA 1HBNB 2HHXA 3SV3A 5I4MA 2P2CB 3NCQA 4ECQA 3D4JA 3AB4B 4KKOA 2J7KA 2IC3A 4AXIA 3MHYA 4RNOA 5D4NA 1SJFA 1MU2B 1RAIB 2YWHA 4YUDA 5C25B 3R3TA 4X4VA 4B3TJ 1FJ7A 2GGPA 2CPZA 2BANB 2VB6A 5KG6A 1HMVB 3DDKA 1VLOA 1EARA 3ITHB 3G6ES 3Q8RB 4USJC 4WTOB 4M5IA 2QYGA 1JLBB 2PEBA 1JIHA 1REGX 1N54B 4RKUC 3GJRB 3GG1A 4U67Q 3GV7B 4E8UA 5EWEA 1RHRB 1K1SA 4M5MA 2YNFB 3FEXB 4IYQA 4NLQA 3NP5A 1TKZB 1LW2A 3UDCA 2HKEA 3N4WA 4YOEA 1QSYA 3BGOP 2JRSA 2HFOA 2P5VA 3HDSA 2OMLA 4ELUA 2MPUA 1AXQA 3NRBA 2J9EA 2BE2A 1RAGB 3EM1A 3OTOJ 1NSKL 2R8JA 4DL7A 2BM0A 3DLEA 1U8SA 3H2VE 2VBXA 5E0OA 3LF0A 2AW0A 2HHUA 2MQLA 5U47A 1U1RA 1NKBA 2HSEB 4HL9A 5DZ7A 1RBAA 2AJ4A 1YJUA 2Z0GA 5KFTA 1DTTB 1U1PA 2FJXA 4F4WA 4PZVA 4MKAA 4G3IA 1R8HA 3T5LA 4I7FB 2YQ1A 2I2YA 1B7YB 3D68A 2M70A 1HNZJ 3L4BC 3M2UA 1HARA 1MSWD 2MQQA 1FKPA 1DTQB 2OPPA 4WYWA 4DPWA 1KLNA 2FZGB 4MIBA 5A6PA 1YG0A 1VJQA 4WE1A 3AHPA 3MDFA 3I55S 3HSJA 4V19J 5L46A 1IKXB 1FFGB 2IAJB 1MG7A 3BBBA 3T5HA 4H4KC 2XY6A 3TAQA 3KK1B 1RLDA 4F4XA 4QR2A 3N5FA 1FNXH 4NI2A 1Q8LA 2J76E 4MFBB 1S97A 3GP9A 4PXEA 3R27A 1JLFB 1UJ6A 3VHQA 4PXBA 5IT9U 1CC7A 4M1KA 3QT5A 3AB2B 3JSMA 1HYSB 4YHHF 1HW8A 2CG8A 2HQIA 4EEYA 1NK7A 1R0BG 3FDSA 1FX2A 4GO5X 5D15A 4ES2A 4FBUA 1YVFA 4NA1A 1WD6A 1HBMB 2BJDA 4Y00A 4DL6A 1ZAWA 4MK7A 4OYMA 2XTJP 5DGBA 2W25A 3KMQA 1HHQA 3A8EA 4ZHRB 5CCMA 1R0CB 3BQ2A 1OY8A 1UTAA 3UCUP 2F4FA 4CYUB 4ED2A 3EGWB 2V34A 1RT4A 4DL4A 1N33J 2W9AA 1WUUA 4XO0A 1TL1A 3CVKA 2C2ZB 1XK8A 3AH6A 2GA7A 2MY7A 2R7RA 4AE5A 5ETPA 1KP6A 3DRYA 4JOUA 4BS2A 2GJ2A 2CZ4A 2H48B 3MEEA 4J9RA 3I0RB 2AYMA 3FCWA 3WZ0A 3VAGA 3DC2A 2WW8A 2J0QD 3R5JB 2LKZA 2YKMA 3NKYA 4ES3A 1EQMA 4OLOA 1FEEA 2EKYA 2HLUA 1S1WB 3DRSB 4UOGA 3VAHA 4LF7J 2V2KA 4TU9A 4ZCIA 1REVA 1FF2A 5ETQA 4MK9A 5KT5A 3VAFA 1UJ4A 5IQQA 1Q95G 2BEFA 4B9TA 4K0KJ 4LUBA 4F67A 1X4CA 5AE2A 4I64A 1HQEA 4I68A 4QR0A 4WIIA 2C3PA 2VFTA 2CPJA 1WDTA 1RWOB 4GO7X 1JLGB 1FVSA 1VBXA 1KHVA 4CH7A 3FNNA 3MM6B 1S0MA 5A8WA 4MYUA 1NO8A 2ASDA 5JXSA 4OX9F 1L3VA 1S77D 3Q8UA 2DR5A 4JI7F 3LGMA 2J9DA 3GYGA 5AXMA 2DXDA 5IQ6A 2LEPA 3RW7A 3TUZC 4A8YA 3LP0B 3N0VA 3NBPA 3F41A 3D7SB 3KK3A 4MH8A 2DD8S 4OJGA 1N0VC 4YDXA 4OJHA 4F3MA 1NAQA 4WFNQ 4LFBF 4LSLB 3HSGA 4NCBA 2M3DA 1S4FA 1RYRA 3J80U 2B6AA 1EZZB 5KG1A 3EYZA 1WKJA 3ETOA 4LBHA 4URQU 3H2LA 1WG1A 3W3SA 1H73A 2D9PA 1OPIA 2E5HA 1PKUA 2HHHF 3MMCA 4NRTA 4G1IA 4FVMA 4IFVB 4EYHB 1T02A 2A2CA 5F8GA 2JC1A 4OHVA 5HP1A 1VQ4S 2E44A 1VQ6S 4OX8A 3VWSA 2BRKA 4P9SA 3ADAC 1QE1A 2G0JA 1SCJB 3UCGA 5LT5A 1UAWA 3PX0A 2OHDA 3GIKA 4RL1A 2HFVA 1NHUA 2RE1A 5CD4A 5ETTA 2CQ4A 3OTBA 2QA1A 3MAQA 3W9HA 1SKSA 2EBGA 1X60A 5D0HA 2GMHA 1KEKA 4YHHJ 1MWQA 2FC8A 2JZ5A 1XNQF 3G8SA 3DLLQ 1QAYA 1S6QB 4J9PA 3JYTB 3CIMA 2FHJA 3WC2A 4BBYA 2VPZB 1S57A 1VQMS 2IBOA 1RHMB 3PX4A 4JI6F 1FKAF 2WOMB 1GQEA 2PIIA 2YNGA 2R2TA 3E51A 1KN6A 4B9NA 4KAIA 2U2FA 3D2WA 3D3CJ 4EBCA 3PXGa 2FHKA 2ZH1A 2GW8A 3CCLS 2DHAA 1GMUA 5DQHA 3LQVA 4TY8A 2ZBCA 2VG7B 3FBFA 3O8WA 4U95A 1WKLA 3CIZA 1HNXJ 4B3RF 4KT0C 1S99A 3KWMA 3KHGA 3Q8VA 4KKOB 4DQIA 2DNYA 2IC3B 4ZDNA 1R43A 2F9DA 2HWTA 2DGQA 3HZGA 2W8LA 2LEAA 2GGPB 1N36F 3QGIA 1YZ7A 3OR2A 1F1BB 2KYXA 3B6BA 4KY3A 2DB1A 1WC4A 1CQNA 3OJUA 1V3SA 4NMXA 4CQ1A 3GE9A 1EQ0A 4LQ9A 3W66A 3FRZA 1LW2B 4LF6F 2DGUA 3OJSA 1YX2A 2VV5A 4USHA 1FJGJ 2ACMA 1T7PA 1WNEA 2PSZA 4JBCA 2HFSA 2BE2B 1WTFA 4OX9J 2CVIA 4P2SA 1I1GA 2MLZA 1CJKA 5HQLA 3DLEB 4LRFA 3JXOA 4QYRA 2RMLA 4K8RA 3PR5B 4NLOA 2AGPA 5KG2A 2H3EB 4ECZA 4ZVRB 2KYZA 3I5BA 4FYVB 4ZPDA 2G2OA 3LWMA 5J2QA 5KT6A 1R8AA 1H98A 3CJ5A 1V5VA 2VL1A 5KFFA 3NNHA 2R8KA 5A2QY 4JI4F 3MAHA 4CLKA 5JVGQ 3E2EA 2EK6A 4IH6A 5L1KA 3M2UB 2D3O1 2XI2A 3GZ7A 3EVOA 3OSPA 3PG9A 1FKPB 1W7WA 2OPPB 2FY1A 2JSXA 3M8YA 4K4TA 1FHTA 5HVHA 1NLKL 1T3OA 3R5BA 2UUWA 5DDRC 4WE1B 2D3ZA 5BYSA 4FF1A 4DV4J 2NUUG 2G1DA 2DTJA 4K7QA 1U1KA 4BC9A 4UY8T 4WZQA 1ZBTA 4R0JA 1TVRA 3HVRA 1LW0A 1UVLA 2B8PA 3CO0P 2RDDA 1WI6A 3JSMB 1U1LA 4JI5F 1VRQC 1XNQJ 4NX9A 1FI4A 4PXDA 4I2PA 4AD6A 3QRQA 1U25A 4ZP7A 3W2VA 3GFHA 1K1QA 1Y9OA 4PR6A 1YJRA 4F4AA 5KT3A 1SXLA 3Q86A 3OSNA 1RI7A 3S1TA 2APOA 4QPXA 2RILA 1IQZA 3PW4A 2OIHA 1NK8A 2HRTA 2VPYB 4LF4F 2KXHA 2VFVA 3TANA 1NSQA 2DXEA 1EETA 3SZ2A 4EU0A 1HPZA 1W26A 1RT4B 2YPZA 1TL1B 3LA0A 1I5OB 9RUBA 3BF4A 2J9CA 4B3RJ 2F65A 5B0EA 5EUHA 3OV7A 5C5JA 2BKPA 3MEEB 4RLEA 2ZE2A 2PEHA 4U8VA 4FF2A 2L48A 3FVYA 3OL6A 3IRWP 1KC8T 4QWCA 2YKMB 5L9XA 1DRZA 2WB4A 2V50A 3D0HE 4DR4J 1IR0A 3W63A 4FNIA 1X9MA 4W90B 4CP5A 3PO4A 1H7XA 2CKWA 1UVJA 2ZUGA 2XO7A 2DHXA 4LT6A 1NH7A 1REVB 2V8HA 1F9HA 2HQGA 2QSWA 3LGHA 3ZZPA 1JJ4A 1GMWD 3OVSA 1U49A 2JLEA 3SCKE 3K17A 1PBAA 4LF6J 1HQEB 3BO3A 3SYZA 5ETMA 1XWLA 2WSEC 3NCPA 2MZ1A 1AA1B 1K0VA 4ECXA 2V68A 3CCTA 2RIJA 3HFKA 4TNOA 2ZZMA 5A8WB 3D1HA 3MR5A 4EO6A 3AD8C 4S0MA 5KG5A 3R7NB 2ZH3A 1S76D 1WACA 2ZBRA 1Y7PA 3NBPB 3KK3B 3OFHA 5CHCB 1UZHA 4JI4J 1U26A 2VDHA 2VODA 4H4KA 1TK0A 1AT1B 2B6AB 5E3PA 1X5OA 2AGOA 2ZUAA 4DPUA 5DLGA 3HPOA 2MY8A 4CO1A 3VGSA 4IR1A 3G86A 3MMCB 2AYGA 1RKIA 3HHKA 5IV3A 1JXEA 3OLAA 2E1CA 1IKYA 4CLPA 3W9IA 4DV3F 3JS9A 1T9YA 1VS3A 2JFDA 4P2FA 3KLHA 1M90T 5HP1B 3I96A 5KG0A 3KTQA 2OGUA 2QC3A 4NRUA 4O44A 1VLYA 4QIVA 4L3KA 2C3YA 3IAS9 1XERA 4CZCA 1U2CA 2CNLB 3NGRA 2V2VA 1WEYA 2Y1LB 2OO4A 3HFVA 4AQYF 3HFZB 1ZA1B 5KFEA 2KZZA 1RWUA 3BDPA 2LFVA 4DR6F 3FZBA 3I4HX 4LR8A 2D3UA 4HT7A 3IWNC 3ILLA 4CTAA 2RHQB 4JB8B 2YKNA 1UEVA 2H54B 2YNGB 1JMTA 1WELA 2IVYA 4KGKA 4OZ5A 3VGVA 2DO4A 3QJLA 1U1OA 3MAAB 1HHSA 4PQUA 4TY8B 1SJQA 3T1YJ 4NLWA 1F2HA 4J9OA 3FSYA 5ITHA 3KHHA 2LQ8A 1RWWB 1TQLA 4WFXA 2ALYB 4P52A 4RNMA 1SC3B 3ZZZA 1SV5A 1QVFR 4P10A 3A3NB 4JUZA 4CO2A 2BJ7A 4ZPAA 2MKCA 3OR2B 2NYIA 3VTIA 3UDLA 5DG9A 2Y9HA 3H5UA 2M88A 1FVQA 2DITA 2B9XA 4O3PA 5CXTA 4LF8F 2BM1A 2LEBA 4QCLA 1X5PA 1URNA 2Y8WA 2CPHA 2HFZA 1FDDA 2LP4A 1UW9A 3M2VA 3ZZOA 5F0WA 2ZH9A 4C8MA 2IHR1 1XBWA 4DBQA 3GMGA 5DZ6A 4KYZA 1A0OB 1RWKB 2H4YB 3QBCA 3EGVA 1R89A 4JP8A 3PM9A 5GMEA 3X3UA 2AYEA 5LMNF 1YKWA 3PCOB 1NHVA 3DLHA 3ISNC 4ELVA 2XWYA 2GQCA 1T95A 1RT1A 5HMYA 5AJ3F 4FDFA 3VZHA 3J81j 5J2QB 1QD1A 1YJ9S 2R8HA 5DRKA 3W5XA 4NLYA 4IH5A 4UOHA 4X4QA 3S8SA 2P8IA 2AX0A 1IBMF 3BBCA 4GKJJ 3TQ1A 1LWXA 1T9WA 2OELA 3TRGA 2BACA 3PJWA 1Q53A 1FXLA 1VI7A 1GH8A 2FJVA 4NXMF 5EN1A 4ED6A 4Q44A 4A8MP 1KFSA 1TKTB 1KVKA 3SSQA 1URRA 4IQXA 4OZ1A 2JEGA 2N4CA 2FIUA 4L76A 1J5EF 1FT8A 4TU8A 2IVMA 3FJ2A 3KJFB 4C8OA 3RRGA 1U09A 1WC3A 2HNYB 2C28A 1VQ8S 2FVPA 1HWLA 2FLPA 2OAUA 3FSXA 4AQYJ 4AXJA 1TVRB 1N5QA 2W4CA 1LW0B 3SEOA 1S1TA 3WHIA 1VC5A 2HFUA 1VQSA 1PSDA 3M6WA 4FXWA 4DR6J 1OPZA 2ZH4A 3Q2SC 4I2PB 2MZSA 3B4MA 4KGXB 2UXDJ 3W2VB 1JLQA 4USVA 1X8DA 2WONA 4K4YA 4W92B 5L1JA 3SCIE 3SCLE 2F7VA 4G1PA 4I1TA 4NLSA 2LU1A 2QA4G 2VC0A 1B0TA 1X5SA 5E2QA 3UD4P 1HNVA 2IM3A 3CC4S 1RP5A 2K7JA 1KTVA 1EETB 4CDIA 1IXKA 3CCRS 1HPZB 4Y2IA 4DR7F 2VU5A 3U27A 1ZM3A 5D0EA 3DXBA 1DY3A 4IG0A 2EEYA 2M52A 1EP4A 4KO0A 4N8OA 4E0DA 3H98A 1NU4A 2VBZA 4WFAQ 5G0RA 3SV4A 1FWKA 2GJFA 1Y4ZB 4PYDA 2ZE2B 1UWAA 4FPRA 2RB7A 1DAXA 2KU7A 4FYWB 3H20A 2ASLA 2ZD1A 2B4PA 3D67A 1SL2A 2GC8A 4H54A 2KXFA 4TY9A 3EGNA 3BH7B 4DL5A 1XMBA 3QT6A 4NLUA 1YDLA 4Q43A 1Z2LA 3HHDA 3MEKA 2HS0A 3UVJA 3I0SA 3D5MA 3ZC4A 2D3OR 1ZOTA 4LF8J 4NEZA 1TK8A 2M7SA 2WVEA 4XPCA 2A10A 4HKQA 1S0NA 1ROFA 3CJ0A 5GAGU 5ETOA 1FD8A 4LF5F 1OSCA 2FQQB 3THTA 4URGA 2KL8A 1TL7A 5K9FA 3VCDA 4ZLJA 1FWPA 2CVEA 5LMNJ 4TN2A 1YLXA 3H40A 2QLWA 2RAQA 1BQMA 3GCXP 3LTOA 2J0WA 3HZEA 3WIUA 1C4AA 2QFJA 5AJ3J 4FKXA 1WOPA 5L38A 2AGQA 1NBEB 1FNOA 4DL0C 7FD1A 2B8QA 1FRMA 3PRDA 2CQPA 4P72A 3O6QA 2Z2YB 1TMMA 3CF5Q 3R7BB 4ED1A 2V2ZA 3O3LA 4NXMJ 2R8GA 2X1BA 3L95X 4A8OA 3ZZ0A 1IKYB 1WOOA 1KQKA 2DR6A 1S6PA 2OP5A 4ZN1A 3MPUB 4Z37A 4ZIVA 4A8FA 1S12A 2K7KA 5B0DA 2B4OA 3OTEA 4DUZJ 2KRRA 4URSA 4NA2A 2GAHC 2PI5A 5HQ8A 3MMJA 2BXJA 2E66A 2YQ0A 4QPTA 2HHTA 3AD7C 4USMA 5EX3A 1JNRB 2E7VA 5DETA 4I67A 5BYRA 4K2XA 2CPFA 1S1VB 1J5OA 3L7UA 4RO0A 4YB6A 4CI0B 3R1HA 4ZKAA 2GMJA 5CA5A 4CTAB 2A2DA 2YKNB 4OIXA 1O6XA 3E3XA 3IS9A 1X4AA 2EG1A 5A6WA 3ET6A 4RUBA 1R0AA 1HI8A 2K8GA 1HWKA 1RT3A 3GIJA 1X0PA 4DR2F 2HGLA 4DR7J 5HJYA 5BXIA 4PQUB 1JNZB 2QG9B 1OS5A 4JI1F 4GVBA 4HEA9 4Q5VA 1CC8A 3KG1A 3PRBA 1XR6A 1Q4RA 3QT8A 4L6V3 2FGCA 3VV2B 3ILOA 2FPHX 2RKIA 3Q8YA 3I4PA 2YY3A 2CQHA 3Q8QB 2HK2A 2X1FA 5HMWA 1TAUA 3E01A 1GX6A 1SV5B 2D74B 4F4KA 2EK1A 2UUCF 2IYIA 3QGPA 2PC6A 3EZOA 2BBEA 4L75A 4DV0J 1YJVA 4DDFA 2HRYA 2P9GA 4WK1A 3GB0A 2B0GA 3Q24A 3CCES 3DM2A 2FJAB 1S6UA 2MKIA 4B9SA 3MM5B 4HH0A 1FDAA 1GXTA 4X84A 1X9WA 3OHAA 3C15A 2LYVA 4UZBA 4DL3A 2QN6B 1N52B 2OPQA 3G96A 4LF5J 3RR8A 2G2YA 3M2VB 4J5OA 2CQCA 4DSEA 4OZ0A 3MF5A 4YFUA 1HNWF 4X4NA 2QJ3A 3CWJA 2D9OA 4M5NA 1H7WA 2XZTB 1YQHA 3QNWB 2IYGA 5ETRA 4OI2A 2CPEA 2CIMA 1JXVA 1KDNA 3R2CJ 4ED3A 1RT1B 2MQNA 4CLWA 4NZ0A 2L9NA 3MR3A 3FCHA 3IG1A 2OEMA 3WQPA 4MKBA 2GNKA 4ED4A 1FFWB 2MTLA 1VDHA 3A8JA 1HKAA 4NE9C 3PIPQ 1NK0A 2ZH8A 1NSAA 2XMAA 4YR3A 4DX7A 5IC4B 4NCGA 2BKOA 2IA0A 4LRCA 3RBZA 2KFNA 3LGNA 3RR7A 2UU9F 3RW6A 3I87A 2B43A 2VZ9A 1UW4A 5KFVA 2DJWA 3BPSP 4FS2A 3IXQA 5C24A 2M9KA 5D78A 3MZIA 3ZO7A 3TZZA 3L09A 3KG0A 4CLTA 2E1MC 3R5DA 4FYYB 5LSRA 1D1UA 1Q8BA 2KH9A 3RAMA 3N79A 3HULA 1S1TB 2ZBIA 4XDDA 1U8WA 2U1AA 2JOQA 3T9NA 1JJ2R 4K4ZA 3QZ8A 3OHBA 2F40A 3CW2C 1Q8KA 1NDCA 1C1BA 1RGVA 1TUWA 2ZWOA 2KVQE 1C0TA 1IJFB 1JLQB 3M8WA 2WONB 2M8DB 1FDBA 2BUNA 3QGHA 5KFHA 1MMNA 3IN5A 1WF2A 3H4DA 5HATA 3TVZA 1HNVB 4RNFA 2PMHA 5DJBA 3TZYA 4DR2J 1N5SA 1SUQA 3J7AN 4K59A 4MKYA 4FN5A 3P49B 1XR7A 2GO8A 3GSIA 4IG0B 1VQ7S 1EP4B 4KO0B 5EWGA 3R97A 4DSLA 5G0RB 2ZNZA 3OTDA 4PAAA 4ECUA 2ZDPA 4EO8A 2UUCJ 1HI0P 2GVZA 1AZSA 3BGFA 4RR5A 3G4SS 3EICA 2FHOB 2ZD1B 4ZVHA 4DS5A 2GFFA 4W98A 1EKSA 4QWDA 4B17A 3CCMS 3K5PA 5AT1B 1YJTA 3BO4A 3MCMA 3QWPA 1RLCL 3UVJB 2C3OA 5ETVA 1H38A 4NL5A 1R6VA 5HSPA 4LSNA 4RZRA 5LSOA 4UQGA 4IRKA 4LR9A 3J7Z5 4K4XA 1PYSB 2G4BA 1GX5A 2HAIA 3MMAA 1CJUA 1VQKS 5F9LA 3JQMA 3PFEA 3CC7S 4IOAQ 2OFHX 1HNWJ 1TL7B 2AJQA 1Y10A 3P4UB 4C0OC 2ZOMA 1BQXA 1KRPA 1BQMB 3VVTA 3EJMA 4XK8C 1TUVA 4DCPB 1SKRA 5KFMA 3HXMA 3VR1A 4RNNA 2OPRA 1XR5A 4QYZJ 1X4GA 1JLEB 5EX0A 5IT9Y 4ZPTR 2PA3A 3HMJG 2NUHA 3KLGA 1SIZA 1N6QA 2BR0A 2ZJQQ 2CQ0A 1Q86T 2KJVA 3C46A 2FVQA 4EBEA 1TU0B 1DQAA 4ERDA 2UU9J 2NXCA 2EFGA 1SJRA 4Q2LA 4LQ3A 1UVKA 2VIHA 1M1GA 3CJKA 1VC6A 1NNDA 3S6EA 3ILIA 5DQGA 1S6PB 1HW9A 1H6KX 3TA1A 2ZH7A 2B4UA 3R6LB 1CPZA 2AIRB 4Y0FA 5LM7E 4IOBA 5B0CA 5ETSA 4R0EA 2KTQA 2OFGX 3GFYA 1YHQS 4OHWA 3V81A 5L1IA 3MPYA 1H3DA 2BE9B 1FDNA 3QMQA 2AKWB 3SFGA 4DF8A 2W9BA 1DBDA 3BSCA 2HW3A 1T11A 3EVWA 1F9FA 4WFBQ 3H25A 4PUOA 5IS2A 3ZZTA 3CULA 4C8ZA 1QUVA 2VUGA 3M8PA 5H9FJ 4LSZB 4QJVA 1J5OB 4ATNA 2HNZA 3IS9B 4QIWD 4U7UD 3ET6B 3MM7A 2XB2D 3ZTRA 1R0AB 4N7TA 2Q79A 3QLHA 3JQJA 4ZPBA 2FVCA 3VAMA 1RT3B 2V9KA 3MEDA 1P6TA 2FGOA 3IFEA 1X4BA 3AY0A 4JYAJ 4WFZA 3TOQA 4GVBB 4FNHA 3RBDA 3A8IA 5KT2A 1S9FA 3R9LA 3MPWA 1D8YA 1N4LA 1H74A 3BJYA 2RKIB 4OZNA 5SZTA 4WYLA 2JL9A 3E01B 2HHWA 2VFSA 1GFWB 1FRJA 4JI3J 1IM6A 2E1PA 3CUNA 4DV6F 4PKDB 2FVRA 4ZCKA 2IIHA 3T41A 2F9JA 3KLEA 2XC9A 4V19X 3FBBA 4ZA1A 2NSBA 3DM2B 3H59A 2QO3A 4DSFA 4CO3A 3NNCA 1NPRA 2FJWA 3CD6S 2JFKA 3UNGC 2VF3A 3K0JA 3TAPA 1SBRA 1N88A 3RB4A 1S48A 3C15B 5KFWA 1TFWA 3HVTA 4OYWA 2OPQB 1UEKA 4FPIA 3CDEA 2HQDA 2CJXB 5I42A 3RBEA 3CJ8A 2W7AA 1B3TA 3D6FB 5E3CA 1FFSB 4WPAA 1ELOA 1ZTWA 1FEHA 1T0TV 4NXNJ 3OVBA 1M5HA 2WCXA 3DYAA 4Y34A 4AT1B 3DI6A 4M5GA 5KG3A 1IBKJ 2FTRA 2WSCC 2BJ8A 3P3DA 2AWZA 3B4DA 5ETLA 2GIRA 2V8DA 2XGQA 3W8PA 4BC7A 3U02A 2B56A 3IG1B 4ZVSB 2XYGB 4X62F 5DG7A 2UVRA 5D3GA 2R7QA 4J9QA 2VICA 2FUG9 4JI0F 2ROPA 1HFEL 4NCGB 4ZVOB 4OI3A 4ID8A 2KM8C 1I6JA 2ZBQA 1EIYB 3GSDA 1M5OC 2HQCA 2HZAA 1RXOB 4USIA 2BYCA 2XMUA 3CJ2A 2J8SA 2WTFA 3KLFA 5C24B 2CA9A 2JNJA 1ULRA 2HURA 2KHCA 3TEHB 2CPYA 4IO1A 4NLGA 4IDKA 3QFHA 3T1HF 4A8KA 1X5TA 2V94A 1JJCB 2DGOA 1YRUA 1YRTA 5HJXA 1M5VC 3Q2TC 2F8MA 1CJVA 5GMKa 1JLAA 2IRYA 5HI7A 4Y2MA 1I94F 2IMOA 3TUPA 3TAMA 1MW7A 1AUDA 1NDKA 2YBVA 4ECYA 5JVHQ 1O51A 3LO3A 4KHPF 1VRUA 3ENAA 3ONQA 1A9NB 3SI8A 4KC5A 4B3SJ 2LDIA 3T5KA 2XEXA 4Y2AA 3W64A 2XYPB 1QAXA 6FD1A 3IWLA 4B3TF 2JLFA 2CPXA 2DXFA 5DDOC 1C1BB 4DR5F 3DGPA 3NWRA 1UVMA 1C0TB 2BOPA 4DN0A 2PO4A 3J7ZT 1IM4A 2RU9A 5DDQC 1NH8A 4DWIA 1WEZA 2ZVIA 4Y2CA 2RQKA 3SDEA 3NCRA 1VIOA 4YEAA 1SVDA 5DQIA 2CFXA 5B0AA 3EZ5A 3OTCA 2ZZNA 2MSTA 3L7OA 1PG5B 1NK6A 4R25A 1SIWB 4EI2A 1NK5A 4G65A 1RHKB 3TARA 2JDJA 3OXGA 2XQCA 1SJ3P 1SUQB 3C16A 4RJVA 4TYAA 3BN7A 3BQ1A 3TEGA 1ZM9A 4OI4A 5LMUJ 2AJ1A 2V8GA 3GJQB 2M2BA 1FTRA 1MLAA 3K59A 4ED5A 3OR1A 4QIEA 2D1CA 2DNLA 1HD0A 3GR0A 1FCAA 2IDEA 2VFRA 4O0NA 3QRRA 2DIUA 2CNOB 2XS5A 2GVZB 4DUYJ 1AZSB 1FESA 3RRHA 1SH3A 3FBCA 2WAQD 4ETXA 2NREA 4DV6J 2MKJA 2BMBA 4YB1P 1JX4A 1U7LA 3RRKA 3OVAA 5DDPC 1T3NA 2W4PA 4L74A 3V2UC 2YWEA 3A1YG 4DV2F 2P6SA 2BZ2A 4KHMA 2ZZTA 1RAJA 3BYPA 2X3GA 5GAGI 5D4OA 1WHVA 2XO6A 5D0RA 4LRBA 4FXVA 2NLWA 4LSNB 2CJBA 3QIDA 5E7OB 1N56A 3K5LA 5D77A 3MMAB 1CJUB 3OUYB 3NMRA 4Y6IA 5JMNA 1WJ9A 2ZKTA 2UVVA 2H51B 2IA6A 2LLZA 2RH3A 2NQPA 2JVRA 1LV5A 1BGXT 4ECRA 5F8NA 2CNNB 1QLNA 2HBZB 1UVNA 1R6YA 1XMQJ 4CLLA 1Q79A 3QYYA 1J2VA 2V6AA 4MIAA 2FC9A 3GWCA 3IM8A 5CQGA 2LDYA 4LFCJ 2OPRB 1F5BA 2QLXA 3IAM9 4C0HA 3AJDA 3KLGB 2ACYA 4A8XA 3QZ7A 1N6QB 1LK5A 4NOHA 5F8IA 3JYTA 4JI0J 3NS6A 2BA9A 3UN5A 2XGPA 4DSKA 2V8VA 2DNNA 2QT7A 4N76A 2OLWA 3CJKB 4JI8F 4DX6A 4C48A 4Q7AA 1XIQA 4M5KA 3CJRA 3K57A 3T1HJ 2NXEA 1LOUA 2DNQA 1FXRA 4EZ9A 3Q0AA 1YK9A 3CJSA 4J9SA 2DKOB 3IM9A 1I94J 1T9VA 2CG4A 2VBWA 2LECA 3V81B 2X1GA 2Z58B 1MMLA 5KFKA 2G1HA 2YKOA 4KHPJ 2OKQA 2CQDA 2Z2LA 3O44A 2W9BB 3QAEA 1G2EA 1VFJA 2LU2A 1KQGB 3M8RA 4PUOB 4ANEA 2UVUA 4DR5J 4OZJA 1U6ZA 3M8PB 4ZPWR 3MCSA 5B0GA 2L3MA 8ATCB 1PJ5A 4LF7F 2KN4A 4ZITA 3NG8A 1P1LA 2HNZB 3P45B 1UEUA 4XIUA 3KHLA 4K0KF 3MM7B 5KFNA 3QLHB 4GKKF 2FLNA 3H2UB 3U7JA 3G82A 2EWHA 3MEDB 2FJDB 2QMUB 1UP1A 1TKDA 3OXFA 4DQPA 3UDEA 1ZAVA 3CD7A 4DU7A 1TL3A 2RU3A 3FKBA 2V0NA 3K89A 3BKFA 1NJWA 4QW9A 1L5UA 4C3KA 5KT7A 1VBYA 2V4RA 2QGFB 2XHCA 2X3DA 4KB7A 2G0CA 4K5RA 4N47A 4DFMA 1HR0F 2GQ2A 2XNQA 4DHVA 1IQTA 4PPDA 3OBIA 3GQCA 5DO2A 4X66J 4OX6A 2OD6A 3T6JA 3KLEB 4DV2J 2QA4S 3PKMA 2HVHA 2DNKA 3MTJA 3PJ9A 2O1PA 1FJCA 2CQ3A 2ASYA 1MN7A 1VGYA 2HRUA 1KR4A 3EPGA 3HVTB 4P75A 1C2PA 1GK8A 1RT5A 2ZHBA 4NLTA 4K4WA 1TKXA 1JWWA 2I1RA 5KFIA 4P6QA 5I42B 3FC9A 6AT1B 2PMWA 1QUPA 3RYLA 2QZ8A 3Q8SB 4DMZA 4M5HA 2CDQA 2NPFA 3DYAB 1S7HA 2HS4A 3QFWA 3DI6B 4UF4A 2CADA 4J9LA 3GFXA 1DQ8A 4EZ6A 3PDNA 2FZKB 2PE8A 4ZLLA 2XHWA 2NS1B 3R7SB 2MGZA 1KWMA 1NSPA 4TU7A 5D3GB 5BJRA 4TLRA 2POKA 1GTEA 4J90A 1T9TA 4U8YA 2H4WB 1D3WA 4ER8A 2F5GA 2WBRA 1RT6A 4OJ1A 4Y3CA 2RRAA 1MNEA 1IN0A 1LQ9A 2C42A 3R5AA 4N77A 2R2RA 1S9GA 3UE2A 3BDEA 2HBQB 4YS2A 2ZNYA 2IM0A 1YIJS 4EUVA 4KFBA 1G6BA 2MQMA 4FS1A 4JI8J 1LFPA 3KLFB 3U1MA 4OYBA 4IDKB 2DCLA 1RZMA 4KGZB 1NPKA 2I38A 1KFDA 3EDQB 3FBEA 4LRDA 2UXCF 2K3KA 1CJVB 3NGUA 1JLAB 3H4BA 5KTQA 3PO5A 3TAMB 4F0MA 4U7UK 1HNXF 4CO4A 3BKUA 2C2OB 1HWUA 3R2DJ 3PW2A 1CQMA 1T8EA 3IR7B 1M1KT 4J9MA 1VRUB 2HVDA 3AXMA 3HJFA 1ZAXA 3FEYB 4C11A 4NLXA 5IT0A 4Q8EA 3GJTB 4LBPA 4DL2A 3GG0A 4CLYA 3DGPB 1FWLA 3G8QA 3ISZA 2YX7A 3SDEB 4F50A 3DXSX 4OYOA 5HMZA 1O5JA 2B5JA 2RQCA 1VQYA 3OL8A 4GKKJ 5FD1A 1PC4A 2QTWA 3DLKA 4OYAA 1UPPA 1FJGF 1N5VA 3C16B 4X65F 1NDPA 1VIXA 1RBOB 1KQSR 4Y65A 3AQPA 4JV5J 4UQTA 3TX8A 1T9UA 2I5JA 4WJBA 3CSKA 3GFZA 3HHLC 1VQLS 2MHNA 3OR1B 2PN6A 3AT1B 3V6DA 4DI6A 3T5JA 3GIMA 4CNZA 3IA0A 4K2JA 3FMWA 1HR0J 1SKWA 2GO9A 2YH0A 3UWTA 2R2SA 4ZVFA 1PCAA 2ZJRQ 1T03A 5GVQA 3DHWC 2YXLA 3GIRA 2BJEA 5RUBA 1IVZA 1CG2A 1X31C 1QJHA 4Y2KA 1BHNA 3JSBA 4NYZA 2DEIA 5F0UA 7AT1B 3RBXA 3HHNB 3GR1A 2J0XA 5IWAJ 2XMMA 4O3NA 3C6TA 1XMOF 1L3UA 5KOXA 2K3IA 3MWBA 4DV4F 3K5MA 1S72S 4RBUA 3CMQA 5F3ZA 2R7XA 2DGTA 2BABA 2OSQA 3D3BJ 3NL0A 4R8UA 1P1TA 1AFIA 2Z8QA 3F0NA 3WC0A 4WXOA 2M8HA 3OT9A 1ZH5A 1Y3KA 3QQCD 2AJ0A 2B51A 5HMXA 4BLGA 3PW0A 3H0PA 2FYXA 3H5SA 5HQMA 4IO9Q 1HD1A 1IR2A 4RUAA 3D9BA 4I0WA 2C1EB 2VBYA 2E7XA 3V5RA 1UFKA 1U0SA 5KOWA 4H4OA 2LCWA 1H2TZ 2YWWA 3M30A 4NASA 1TAQA 2ZWPA 4FP9A 2C3MA 2PFFB 3CPWR 1R31A 3JSRA 1RWMB 3S7RA 4HHUA 3MAAA 3CC2S 3I6PA 4PG6A 2UXCJ 3W62A 3D6HB 3A12A 2H9ZA 2C2NA 2QSFA 2KG1A 1SH2A 3VGTA 4I6WA 1NZ8A 3LUYA 4DCJB 4NZ7A 3EVMA 3NGSA 1RABB 3LH2S 1S59A 1RTZA 5IFMA 3MCOA 2DISA 2LXFA 3IR5B 5KFLA 1TFYA 1YJNS 1CVJA 4OYIA 2MZRA 5CYMA 3UNYA 4DR4F 2UZAA 3ZTQA 4RWXA 3T9ZA 4MT1A 5E41A 3HJVA 2Z30B 4NWBA 1WHXA 2FY8A 1VC0A 3N5BA 1C4CA 4DSIA 4CCHA 2FLLA 1DARA 3RGIA 1B99A 3TJ9A 1JLCB 3G82B 1QM9A 4X65J 5KFZA 3TJAA 4FKYA 2V4JA 2SXLA 1TL3B 4LF2A 4B3OA 2W24A 4DSJA 4A48A 2IY5B 2E9RX 4C97A 2GV1A 1KNZA 5M2PA 3L9ZA 2ADCA 3JTPA 3O2IA 2ZM6F 2P9EA 3CMAS 3AA9A 1NHKL 3M05A 4M5DA 1QAJA 1TZ0A 4DQRA 3BSNA 4IRCA 1K73T 2WBMA 3NEKA 1UCNA 1KS2A 5HL7Q 3G2XA 3UR0A 1R7IA 2GIQA 3RJMB 4ZCMA 5HVFA 3QO9A 4WCEQ 1U45A 4NCAA 4ELTA 3BEGB 1KTQA 4YP3A 3QPIA 1WC1A 2FVSA 3DHXA 3L3CA 2B7BB 1NJZA 4TQSA 4E98A 2J6SA 2BVZA 1RCOB 1LXJA 4OHZA 4HVZA 5FJ4A 4ZIWA 1VQ9S 1TKTA 4IRDA 3TX0A 1RT5B 4ILMA 4LR7A 4QR1A 5FDLA 1TKXB 3OFEA 2BJ9A 4OL8A 1T94A 4D3HA 1XMOJ 2A0FB 4ILRA 3IBFB 4BWMA 2KT2A 1RK8A 5KFRA 2NZ4A 3OXLA 3LALA 1B7FA 4DU8A 2Q1LA 2HNYA 2MYFA 2ZHOA 3JAMY 1D9DA 2ZOGA 2BOAA 5AXNA 4EYIB 1YBTA 2MB0B 2O66A 5LXYA 3HD1A 5BR8J 2ZH2A 3HKZD 3CCVS 2Y3YA 2MGZB 4JI2F 1RADB 3M6UA 2N7YA 3VAKA 3I56S 3AJ1A 1PYTA 2XMVA 2C3UA 3FK4A 1RT6B 2HBRB 4RWWA 4FZVA 4WZMA 4JV0A 3IBCB 5HO4A 3ICLA 5HROA 1S9GB 2C2RA 3V4MA 1BQNA 3FUYA 1GMWA 1HIYA 5HANA 2AHOB 1KHWA 4KFBB 4QWEA 3GONA 3NAHA 1IBCB 4PG4A 2QL5B 3GPAA 4LFAJ 2CQBA 1EAYC 1U0HA 4J37A 2VQEF 1KBRA 3H90A 3OLBA 4J7CA 1UPMB 1N32J 5KFSA 4FF4A 2XG8A 3T1YF 3BSOA 1VCTA 3M4XA 1N34J 1U1NA 3M2RB 3OD2A 2M4MA 2VOPA 1RDRA 5AE1A 3HVWA 4C11B 2MKKA 1ACMB 1LWEA 1Z1ZA 2Q6BA 2J0SD 2DNOA 2MEWA 1NJXA 1U2FA 2BW7A 5IOLA 1VJWA 4RBVA 3PYEA 5A8KA 2GCFA 1S5ZA 3U1NA 4OYZA 4U9RA 2WZ1A 1DQ9A 3FSIA 4ECVA 3NGTA 1H2VZ 1BLUA 2B5JB 2GMLA 2P6TA 2HK3A 3EMTA 4J9VA 1YSJA 2MZJA 3D0GE 2DBBA 3DLKB 3W5YA 2OTLS 2HHVA 4HI1A 4AYBD 2I5JB 1RSCA 5DG8A 2ZM6J 4QQBA 3HSZA 2IRUA 3CDAA 3V6DB 4AFFA 4BHQA 4ZPVR 2YWFA 2KFYA 1LXNA 3UN3A 3DRRA 1NMEB 2RS8A 2W2MP 3Q83A 2DPJA 1UA1A 1YGYA 4PWDA 1VBKA 1KSPA 3MGJA 3OL7A 5IV4A 5KG7A 1GXLA 3IP0A 1T03B 3K7RA 2DT9A 5E5NA 4WK3A 4WWSA 3UO0A 1S79A 5M2RA 4GKJF 3O5TB 4DF4A 4DV5F 1G3OA 3P5BP 1RHQB 4PEOA 1RTJA 4DJBA 2QMWA 2R3VA 3KKFA 2R8IA 2OD4A 4ZVQB 2RQ4A 1RHUB 1CBKA 4RNHA 2BQ3A 4HHJA 1XNRF 3G6XA 3C6TB 5I3UB 4WP9A 2R7SA 2GHPA 3IWXA 4C8KA 3GYNA 2HHSA 4R8UB 1S7IA 3KLIB 4ITSA 4N56A 5LSLA 2KM8B 1FJEB 4EFAC 4PRFA 2BRLA 3TWZA 4Q8FA 2M0GB 3K5NA 4DQSA 4P2MA 4BWJA 4F4YA 4F04B 4JI2J 3UQSA 5J1NA 2NYHA 1DFDA 8AT1B 3DOKA 2ROEA 3MPVA 2VA3A 3A3OB 4IR9A 3CT9A 3NWGA 1C1CA 2HVIA 1OJ4A 3PYGA 1SJ4P 2UXDF 1S1VA 2W7PA 4H4MA 2AF6A 3LAKA 4K5SA 1WC6A 2DNPA 1UL3A 2J8AA 2JC0A 2KDOA 1V5IB 2DNMA 4K4SA 3J7YU 5K8NA 3MI7X 4H4OB 3NGDA 3M30B 1NPPA 4ANCA 4F3QA 2VQEJ 5FLXU 3PNIA 3DCAA 2Q66A 4LF9J 2HEKA 2DHSA 3M6XA 4ED7A 4MAKA 2AT1B 2YNIA 4GVLA 5CYQA 5DM7Q 5KFDA 2XCAA 1Y00A 3BBFA 3SBMA 3VAIA 3M9NB 1X4DA 1KVJA 1WDDA 2KJWA 5IC6B 1D0EA 2DH8A 4Q45A 4CO5A 1HQUA 5ADZA 4ZVEA 4FVCA 1KQFB 4CWBA 4RW4A 2AX1A 5CYMB 2M5YA 2QYCA 2XY7A 3D1QA 4HTJA 3PRVA 4QU6A 2AD9A 3HHLA 4KE5A 1FO1A 2CZ9A 2JVOA 3NGKA 1L3KA 1UZDA 2EFVA 3VQSA 3MM5A 1HNIB 4KPCA 5CD4H 5F8LA 2RT3A 2YKPA 4PG5A 2RSQA 3D6TB 4CIOA 1DURA 2OH2A 2VOOA 1Q7LB 2V4JB 4B3OB 1UWBA 2E9TA 1LKZA 1F0XA 4LRAA 2Z4PA 5IM0A 3DU5A 4NLRA 2QLBB 2ZHAA 3ELHA 1JQGA 4A8SA 4M5DB 4WU2A 3BR8A 2RRNA 2IRXA 1UFLA 3OL9A 2VONA 3UN2A 2DY9A 1AROP 2XWXA 3D66A 3NOCA 2DRAA 3AQOA 3QO9B 4C3LA 4P73A 1IWGA 3MFHA 2ADBA 3DLGA 4QYZK 4UTGA 4DV5J 3HHLD 5D0GA 4ZVPB 2HGMA 1CULA 1RCXB 3DN9A 4M63A 1D9FA 2RS2A 4PYAA 1GTHA 4UOCA 1U48A 2W2PP 4WP8A 4OHXA 2COLA 4KBIA 2ZVSA 5FDLB 2DHGA 3P8BB 2YKQA 3FEZA 3J81U 1XNRJ 3DRXA 3WBZA 4N8NA 1G4CA 2DGVA 3POTA 2WK4A 1NUEA 3MEGB 4GC6A 1A7GE 4CLUA 1XTZA 3AD9C 4HLBA 2XLKA 3SSRA 3G6YA 3RZAA 3LP2A 2NXNA 3BB5A 3HM9A 5CAAA 4DUZF 5KFBA 1VRTA 4F02A 2PA8D 3KXDA 1NK4A 3FZ2A 4DX5A 2DRDA 1HBUA 5LL6d 3HLUA 1VQOS 4OMFG 3NOGA 5IT4A 1D8ZA 4ZS6A 2R7VA 2MKHA 5J2NA 4BCAA 2MZQA 1OYDA 2IM2A 2E9ZA 3OPKA 4XDCA 2IFXA 4ID5A 3TYTA 4DX8H 1FNMA 5AXKA 1NZAA 5HROB 3PW5A 2RF2A 4KHRA 4ZJLA 1VK8A 2H5JB 5H9FK 2YNHA 3VALA 1Z4UA 1BQNB 3VAJA 4DZ6A 4KSEB 1RU2A 2Y1RI 4RW8A 2XSFA 4B08A 2EFPA 4UY85 4BDPA 1SQGA 1VK3A 3RUBL 2K2PA 1U0HB 1YWXA 1FRIA 3KJNB 1QSSA 4F36A 2HWHA 5CYJA 4OHYA 3PZPA 3CE8A 1VQNS 4RU9A 2W01A 1ZPVA 1M0SA 4RW6A 3CCSS 1RAEB 5LJ3Y 4EMDA 2CQ2A 3WIVA 3CGIA 1HHTP 1LWEB 2DNZA 4YMEA 2DHHA 4AL5A 1OWXA 2E5IA 4ZLNA 4DV0F 1S1XA 3VZIA 5C2CA 3DOMA 1H72C 4ECTA 3PIOQ 1U1QA 3UD3P 5A8KB 3ZNUA 4NYPA 4QOTA 1NXIA 3QRPA 4D3GA 4L3NA 4DPXA 4HACA 2C2KB 1NB7A 1FXDA 3AOAA 4ZMMA 5GADU 1P27B 1PYOB 2HWIA 1OY6A 4LVOP 2ZDOA 3U1LA 2X7IA 1HQ2A 5LOQA 2YH1A 2J9DE 4DZDA 3OFGA 4P71A 2KZMA 2OPSB 1RBLA 4P74A 4RUCA 2QL9B 2AV5A 1VYAA 2N7CA 4ECWA 1R27B 3PTWA 3DRRB 2QEXS 1V6HA 2AQ4A 4PWDB 1ITPA 2AZ3A 2CUYA 2QFIA 4UOFA 3PYDA 4CO0A 3R1LA 5HBMA 2QE5A 1ZPWX 2O67A 1JLEA 2Q43A 1DJ0A 1SQFA 2LA4A 1UJ5A 1HI1A 1S0OA 4I4BA 4RW7A 3MOJB 1RTJB 2Z2ZA 5J1EA 4XPEA 1N5YA 2N3LA 4RW9A 1Q0NA 3KUEA 3KDNA 2HPUA 3DFEA 4MYTA 3LPEA 5A0YA 3N6NA 1KLMA 1YTYA 1QDUB 3AAWB 4EWTA 3LANA 4DQQA 1JKHA 3MUTP 3W2WA 2JX2A 4V1Ak 4IH7A 5HVGA 1Q16B 2XS2A 3H8YA 3UDVA 1PO6A 5E33A 3H7HB 4A4JA 3KK2B 3TW0A 1PBUA 2EPIA 1T05A 4WP3A 3G87A 4DLGA 2DR7A 2HBYB 1Q78A 2WHOA 1RWVB 1P9YA 3DOKB 4FF3A 3MCNA 3IMQJ 3RAXA 2CZVC 4KJIA 1SL1A 4O4GA 1R8CA 1C1CB 3GU0A 3TA2A 3RB0A 5LJ5Y 4H4MB 4HTIA 4I56A 1FE0A 1OMSA 4MIWA 3W61A 4ICLA 4B9LA 3TQEA 3ETMA 4IUFA
chains in the Genus database with same CATH topology
4M5GA 4M5MA 1EQMA 4CYUB 1EQ0A 3ILOA 1KBRA 1CBKA 1RAOA 3MCMA 3ILLA 1HKAA 5ETSA 2QX0A 3HSDA 1IM6A 3KUHA 5ETVA 3UDVA 5ETKA 1TMMA 4M5IA 2CG8A 1G4CA 3HSJA 5ETMA 3QBCA 3HSZA 2BMBA 5ETTA 5ETLA 1EX8A 5ETNA 4CRJA 3IP0A 3HD1A 4PZVA 1RU2A 1RTZA 3MCNA 4M5NA 3KUGA 5ETQA 4F7VA 2F63A 1DY3A 3ILIA 3MCOA 3UDEA 3UD5A 4AD6A 3HT0A 4M5HA 1F9HA 3HD2A 1RB0A 3HCXA 1Q0NA 2F65A 3ILJA 4M5JA 4CWBA 1RU1A 4M5LA 4M5KA 5ETOA 5ETPA 5ETRA 3HSGA 1TMJA 1HQ2A 4CYUA 3KUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5G A;  4M5M A;  1EQM A;  4CYU B;  1EQ0 A;  3ILO A;  1KBR A;  1CBK A;  1RAO A;  3MCM A;  3ILL A;  1HKA A;  5ETS A;  2QX0 A;  3HSD A;  1IM6 A;  3KUH A;  5ETV A;  3UDV A;  5ETK A;  1TMM A;  4M5I A;  2CG8 A;  1G4C A;  3HSJ A;  5ETM A;  3QBC A;  3HSZ A;  2BMB A;  5ETT A;  5ETL A;  1EX8 A;  5ETN A;  4CRJ A;  3IP0 A;  3HD1 A;  4PZV A;  1RU2 A;  1RTZ A;  3MCN A;  4M5N A;  3KUG A;  5ETQ A;  4F7V A;  2F63 A;  1DY3 A;  3ILI A;  3MCO A;  3UDE A;  3UD5 A;  4AD6 A;  3HT0 A;  4M5H A;  1F9H A;  3HD2 A;  1RB0 A;  3HCX A;  1Q0N A;  2F65 A;  3ILJ A;  4M5J A;  4CWB A;  1RU1 A;  4M5L A;  4M5K A;  5ETO A;  5ETP A;  5ETR A;  3HSG A;  1TMJ A;  1HQ2 A;  4CYU A;  3KUE A; 
#chains in the Genus database with same CATH topology
 3PJX A;  2P9C A;  3HF5 A;  4ZJQ A;  3N6M A;  2WB1 D;  4C0B A;  2FHJ D;  4F25 A;  4CT8 A;  4NLD A;  2YNI B;  4HDH A;  5CYQ B;  1IKW A;  1TR0 A;  1DHM A;  3M6V A;  4X4R A;  3C66 A;  4PAB A;  1U6B A;  3A8K A;  4PWU A;  1WC5 A;  4HT5 A;  1HQU B;  3FMB A;  4AND A;  3GTY X;  3HO1 A;  1MRO A;  1SC1 B;  1FA0 A;  3UI3 A;  2GIF A;  2VJV A;  2W8K A;  4RW4 B;  2I9S A;  3KFW X;  3LPY A;  1RT2 A;  4NZ6 A;  1B0P A;  5L39 A;  3BH6 B;  3HHL B;  4JI7 J;  1LWC A;  2RNE A;  3DGV A;  5SUH A;  1RTD A;  3KNA A;  3OW2 R;  1A6L A;  4ZVT B;  1B64 A;  2CWK A;  3ZXW A;  1UKU A;  1RQ0 A;  3F73 A;  2E7W A;  2KXN B;  4LFB J;  2UVW A;  2KT5 A;  4USW A;  3X1L B;  2R4F A;  3CNQ P;  1UWB B;  1OQ3 A;  1WHW A;  3I82 A;  4OYP A;  2HVZ A;  5HAO A;  4J91 A;  3M32 A;  2O3D A;  3CD0 A;  5IM0 B;  1F6T A;  1K44 A;  3L7P A;  1RUS A;  1NB2 A;  4OI6 A;  3GYX B;  2HHH J;  5F9N A;  2JJ4 D;  2W4D A;  4B02 A;  3DU6 A;  2R7W A;  1X7V A;  3IO1 A;  1WOS A;  2DH7 A;  2A18 A;  3SSS A;  3W5Z A;  1HWJ A;  2OEK A;  4LVN P;  1R8B A;  2KKH A;  3C14 A;  2IM1 A;  2EI5 A;  5C42 A;  4DOZ A;  1NJI T;  3M9O B;  1SPB P;  3DLG B;  1ZM4 A;  1RWN B;  2E1A A;  3QT7 A;  1UET A;  3PW7 A;  1CUL B;  2MJU A;  1WSV A;  1XN9 A;  4NI2 B;  4KIA A;  2E29 A;  3R5C A;  1JXL A;  3CJ3 A;  2UUB F;  5JJB A;  1HBO A;  5KFP A;  2OTJ S;  2QA2 A;  1WWH A;  4NA3 A;  2HZV A;  1OO0 B;  4TLQ A;  3PYF A;  3POT B;  5KT4 A;  1WKK A;  4TKT A;  2CWX A;  2RQM A;  1CJT A;  2ATC B;  3QIP A;  8RUC A;  2FD2 A;  1KVI A;  2ERR A;  4OV1 A;  4JI6 J;  1WG4 A;  2ASJ A;  3LP2 B;  2OI2 A;  4N41 A;  1DLO A;  5K20 B;  2RDI A;  3R8Y A;  2QRR A;  3DDN A;  3VQT A;  1VRT B;  4KV8 A;  1RIS A;  2HG4 A;  5CZV A;  4I6A A;  1WSR A;  2X51 A;  1HBU B;  1APS A;  2JEI A;  1HA1 A;  2F1F A;  2UV8 A;  3G9C A;  5J2N B;  2BQR A;  3B54 A;  1FRH A;  4DS4 A;  4QIG A;  3IGV A;  1SQE A;  3BQ0 A;  2ILY A;  4F8R A;  3LWL A;  2B9E A;  2C22 A;  4ID5 B;  2HGN A;  1J27 A;  2RF2 B;  3ZNJ 1;  4PPZ A;  1U24 A;  5EGY A;  2YNH B;  4CLF A;  5HN0 A;  4P2X A;  4DR3 F;  2X1A A;  2UUA F;  4IFY A;  1PC5 A;  4MTP A;  2BJ1 A;  4RW8 B;  1N36 J;  2E5L F;  1OSD A;  4X4T A;  4A47 A;  3GV5 B;  5J2M A;  2MQP A;  4ZP9 A;  2V8P A;  3D1O A;  3MUM P;  3TJ8 A;  4JYA F;  2V63 A;  4USK A;  5T14 A;  2CJQ A;  2RD5 C;  3UCZ P;  3TUI C;  3KMS A;  1S10 A;  1SB6 A;  2HQF A;  1TL5 A;  3MR2 A;  3B78 A;  3RB3 A;  4RW6 B;  3SCJ E;  2YVS A;  3J7A 1;  4NML A;  3I9Z A;  5A76 A;  2LQ5 A;  2E5G A;  1Y3J A;  2A6M A;  4JI3 F;  1RTH A;  3V6J A;  1S1X B;  3DOM B;  1WTB A;  5F8H A;  3MD1 A;  3PHT A;  5G4D A;  1I51 B;  3P96 A;  4HAC B;  4ES1 A;  5L9N A;  2XYH B;  5KFX A;  2MHE A;  2AU0 A;  4ALZ A;  4L73 A;  5I3Q A;  2R7U A;  2F8E X;  2AYB A;  2AZ1 A;  3OUY A;  2XMK A;  3P5T L;  3BYR A;  2A3J A;  1GT8 A;  4ZVG A;  2EFN A;  1S49 A;  2W2Q P;  3I32 A;  1BWV A;  2DGX A;  3PVX A;  2PDA A;  2HHP A;  4NXN F;  1RAH B;  4G1Q A;  5KFU A;  3D28 A;  4UST A;  3EZU A;  1Q1K A;  1C0U A;  3T3F A;  2N82 B;  4WIQ A;  2AEF A;  5I3P A;  4F3O A;  1IBK F;  4U7C A;  1NK9 A;  5KFY A;  3NLC A;  5HBM B;  3TZX A;  1IUJ A;  3HX9 A;  4F0H A;  1EJ7 L;  4ZCL A;  4OI1 A;  2J7U A;  2IJN A;  5K8M A;  1QE1 B;  1MWZ A;  3PEH A;  1PIL A;  5D6G A;  3TI0 A;  2Z2M A;  1X4F A;  3CCW A;  1NEE A;  4RW7 B;  1BE4 A;  2ILZ A;  3LOU A;  4DPO A;  5J1E B;  2L9D A;  1N5Y B;  9ATC B;  4RW9 B;  4CLS A;  2UUB J;  1F5C A;  4ETZ A;  3RB6 A;  4JI5 J;  4DPT A;  5A0Y B;  2ZOF A;  4ENO A;  1KLM B;  2NR0 A;  3QAT A;  1JKH B;  2UUT A;  3W2W B;  2F4V F;  4NLP A;  4HH1 A;  5B7W A;  3PKY A;  2J6T A;  1F3F A;  4YY3 F;  1F60 B;  5GAH U;  3AA8 A;  1UFW A;  1Y0H A;  1RWX B;  4B3M F;  2KVI A;  1UMJ A;  4DG1 A;  3R6G B;  1GEH A;  4QZV B;  4RBT A;  2VPW B;  2HVE A;  4LF4 J;  5AXL A;  4GC7 A;  4O23 A;  2Q6C A;  1T05 B;  3ENV A;  2D41 A;  4B3S F;  4HHH A;  3G8T A;  1XC9 A;  5DGA A;  3PX6 A;  5HLF A;  1GNK A;  4I6Y A;  3HT0 A;  2J6U A;  4O4G B;  3J7Y I;  5IXU A;  4DR3 J;  2PMZ D;  4F2R A;  1FE4 A;  2UUA J;  3V4I A;  4UT4 A;  4ICL B;  1U2R A;  2E5L J;  1TL4 A;  2BW2 A;  3S01 A;  4OZ3 A;  1SKU B;  1SI9 A;  2VG5 A;  3W8G A;  2CJK A;  4USU A;  3KJQ B;  1E6Y A;  2MKS A;  1HL6 A;  2J5A A;  4ED8 A;  1E6V A;  7FDR A;  3PHE A;  3EUN A;  3AJ2 A;  1TUG B;  1ZS6 A;  5LMU F;  1IKW B;  3T1A A;  2C2E A;  2MZT A;  1ZYQ A;  4KQZ A;  4TQR A;  3C2P A;  4DFP A;  1QVG R;  1MRO B;  4LIW A;  2Y0S D;  1VHI A;  1S1U A;  6FDR A;  4DUY F;  1YBA A;  2OUG A;  4DEZ A;  2HZC A;  1PJ6 A;  5EDW A;  1RT2 B;  1K47 A;  1CJK B;  4TXS A;  4ED0 A;  1LWC B;  2V9W A;  1X4H A;  2IPO B;  1QTM A;  1RTD B;  2DEJ A;  3J80 Y;  3CDW A;  4O3S A;  2JH3 A;  3UD5 A;  2CYY A;  3ZFV A;  4M5L A;  3T6B A;  2UP1 A;  3W1Y C;  3EDR B;  2I8E A;  4OX7 A;  1F9E B;  5MLC V;  4CM2 A;  2QMX A;  3M32 B;  3LW5 C;  2DNG A;  1LEO A;  4EGL A;  1W2B R;  5F8J A;  2FDN A;  3W7B A;  3A4T A;  1U4B A;  5B0B A;  2W1B A;  1XMQ F;  4DV3 J;  3C14 B;  2CQ1 A;  1BMQ B;  4LFC F;  3FCV A;  2QIF A;  5C42 B;  3W65 A;  3F44 A;  4KR0 B;  2CQI A;  4OZ2 A;  2WSF C;  5GAE U;  3JB9 k;  4O3R A;  3KG4 A;  4ZPC A;  4DFJ A;  4J9U E;  3DMJ A;  2DH9 A;  3QGG A;  2YX1 A;  4QIF A;  1N5T A;  2YWG A;  1HBO B;  2GX8 A;  3EX7 B;  2NXJ A;  2KRB A;  1FX4 A;  2B3T B;  1YJW S;  4QU7 A;  4ZP8 A;  3IC1 A;  2W2O P;  1Q8I A;  2VDI A;  2F4V J;  1CJT B;  1KOH A;  1Y5N B;  3QIP B;  4YY3 J;  2RVJ A;  1U6F A;  3QWU A;  1GAO A;  1ZA2 B;  1DLO B;  4C9D A;  4B3M J;  2YPY A;  2DK2 A;  1QAI A;  1Y11 A;  4KV8 B;  2YTC A;  3MEC A;  2HMI A;  3BGL A;  4PG8 A;  4E2F B;  4ZN3 A;  3MM8 A;  5D4L A;  3K58 A;  2DYA A;  1FER A;  3SQG A;  3BO2 A;  3LP1 A;  3QJP A;  2A1B A;  1LWF A;  3D0I E;  1PAE X;  1JJH A;  2HLT A;  5CAB A;  4PG7 A;  3A13 A;  3ILJ A;  2YQ3 A;  4MJK A;  1VOM A;  5D8H B;  1N8R T;  1M1H A;  1NKE A;  3PEJ A;  4EBD A;  2DGS A;  2WVC A;  3CDU A;  3NMA A;  2CRL A;  1IR1 A;  5A8R A;  3WX8 A;  1RWP B;  1H0H B;  3QAU A;  4IFY B;  3G71 S;  3H5Y A;  2XI3 A;  2JLG A;  2WRM A;  1FK9 A;  2Q3P A;  3GIL A;  1RTI A;  2Y1J A;  2H5I B;  1FRL A;  1NKC A;  2XZD B;  3A3P B;  5J2M B;  2OJ3 A;  3JQK A;  4KH1 B;  1VQ5 S;  3N01 A;  1CLF A;  2IVF B;  3F56 A;  1FD2 A;  4X4P A;  2MXY A;  1BD6 A;  2W2N P;  2W9C A;  4XTT A;  3AFG A;  3B82 A;  3CCU S;  2HQ3 A;  1H2U X;  3CDB A;  4FYD A;  3DLB A;  2XBP A;  2AJF E;  2L9W A;  2V2Q A;  2V67 A;  2CAJ A;  1W25 A;  4A8Q A;  1RTH B;  3RU0 A;  2VFU A;  3PY8 A;  1B70 B;  4X66 F;  2R7T A;  2OMO A;  1TEL A;  1QTN B;  2ALZ A;  1KD1 T;  3W9J A;  5GAD I;  3H5X A;  3C8Y A;  4ZLP A;  5H9E K;  1HLW A;  5M2U A;  1EB0 A;  5A2Q U;  3TZW A;  2O01 C;  4MMO A;  2ZH6 A;  1IBM J;  3ZTS A;  4DCO B;  2CJY B;  2R7O A;  3MUR P;  1K8A T;  2N4D A;  4G1Q B;  2ABY A;  3N6L A;  1C0U B;  1GXU A;  2XLI A;  5T7L A;  3MOZ A;  1B4S A;  3E8O A;  1J5E J;  4CRJ A;  3KLH B;  2OEJ A;  1BWE A;  4DV7 F;  2GS8 A;  4MK8 A;  4QWA A;  5EHH A;  4Y28 C;  4O44 B;  1HWI A;  3JAM U;  2I6W A;  5KFA A;  3CO9 A;  2QLJ B;  4YDD B;  3WDO A;  1FKO A;  4J9N A;  5F41 A;  3D54 A;  3M1V A;  2LA6 A;  1LFW A;  4KPY A;  5GMD A;  2XZW A;  2DR9 A;  4C6A A;  1BUX A;  2R2U A;  3VGU A;  5H1S V;  4O3O A;  3HI9 A;  3EXC X;  3SQO P;  3G6V A;  2V5H G;  2MQ8 A;  3BGR A;  3DOL A;  1M5S A;  1O0P A;  3M8Z A;  3KHR A;  2Y1I A;  3HSD A;  4ILL A;  1R8P A;  5B0F A;  1PAU B;  4YN3 B;  1WEX A;  3KNG A;  3OFF A;  3OQ2 A;  2HAF A;  4Q0B A;  3THP A;  1WI8 A;  4DG1 B;  1P9Q C;  4WXW A;  4F4Z A;  3HD2 A;  1CS4 A;  4WBF A;  4K4U A;  2QV6 A;  3GLJ A;  3MUV P;  1VMB A;  4GRS A;  1AB8 A;  1Q82 T;  1TK5 A;  5C7P A;  4DUT A;  3I9V 9;  5KG4 A;  3MM9 A;  5HLF B;  2BDP A;  2IDL A;  1RU1 A;  4MKV A;  2R42 A;  3ZTO A;  4ZK7 M;  4OYX A;  3BS9 A;  1W2I A;  3JTO A;  3HKW A;  4CT9 A;  3V4I B;  2LQ9 A;  1Y5I B;  3KJV A;  1ZZF A;  5L8R C;  2LQJ A;  3CCZ A;  3H42 A;  5DS7 A;  1JLC A;  2JHE A;  3GJS B;  2AJ2 A;  2IMW P;  2VG5 B;  3MTK A;  4Q2M A;  3CXC R;  2K1R A;  1E6Y B;  2FJB B;  4X2B A;  4UUX A;  1E6V B;  4KGM A;  3TR5 A;  4QBU A;  2EVZ A;  2IJR A;  4JV5 F;  2DRB A;  3R5G A;  2Y8Y A;  3DKD A;  2H65 B;  4P7V A;  1OYE A;  2KT3 A;  1VBZ A;  2I0X A;  4RX6 A;  3PFO A;  2HHQ A;  2GQQ A;  1SC6 A;  2AEM A;  5EWF A;  4FXD A;  2DNH A;  3KDO A;  1S1U B;  1Q5V A;  2W7O A;  2E1R A;  3V6H A;  1M5K C;  1KON A;  1RJJ A;  1S9E A;  5ETN A;  5KAK A;  2EXU A;  4OZL A;  3THV A;  1XEZ A;  2QX0 A;  3QSY B;  2JEF A;  1BC6 A;  3K5O A;  2Y0B B;  4OI0 A;  5L1L A;  2V4Q A;  1SH0 A;  2LXU A;  2J7W A;  2EKN A;  4DV1 F;  3MMB A;  2XSJ A;  4CLZ A;  3CJT A;  5IWA F;  1RT7 A;  1WF0 A;  3C6U A;  4FBT A;  4OJ3 A;  3MFI A;  1NDL A;  3FRY A;  2EC2 A;  2XMW A;  3KUH A;  4B9U A;  3PAC A;  4ZVU B;  4DV7 J;  2ZBP A;  4GMK A;  2LMI A;  3ENW A;  1V3Z A;  2CDR B;  2ZFH A;  4IG3 A;  3HVA A;  4UZC A;  4OLP A;  1I3O B;  1YZ6 A;  3TA0 A;  1RA6 A;  3IR6 B;  4R5P A;  2BX6 A;  4HYK A;  2E5J A;  3I5C A;  1UA0 A;  3DMJ B;  4C2M A;  5F3T A;  2KFZ A;  3NS7 B;  3NXZ A;  2FB0 A;  5T41 A;  2HIY A;  4IQM A;  3MR6 A;  1SL0 A;  4WKY A;  4DFK A;  5FII A;  3MPD A;  3FQK A;  4I2Q A;  1CSJ A;  5BYQ A;  4HI2 A;  3SXL A;  5FLX Y;  4DLE A;  1KOO A;  3VF0 B;  3FFI A;  1QY7 A;  1S6O A;  2HND A;  1AUS L;  3M8Q A;  3M2R A;  3MEC B;  4X64 F;  5B08 A;  1K0T A;  2HMI B;  3CCQ S;  3MM8 B;  2YKA A;  2EC0 A;  4JV1 A;  3BZQ A;  5THW A;  5ETK A;  3SQG B;  4ZOS A;  3LP1 B;  3PR4 A;  1VQP S;  2GVD A;  2NXU A;  1LWF B;  2RHS B;  4OFZ A;  4F7V A;  4JI1 J;  1DZ5 A;  4YR0 A;  3MXH P;  2AEJ A;  1IKV A;  2L41 A;  2K06 A;  4KH0 B;  3Q8P B;  4IOC Q;  2XNR A;  2JWN A;  3RAQ A;  1OY9 A;  1RKJ A;  1FTC A;  3GCW P;  2VQF F;  5A8R B;  1PJ7 A;  2JEJ A;  1V3R A;  3HCX A;  2AP6 A;  2IJF A;  2KB2 A;  3CTR A;  1FK9 B;  2G9O A;  1F2G A;  1RTI B;  1NCL A;  2XY5 A;  4PCQ A;  1AFJ A;  1YBU A;  2KI2 A;  2MSS A;  3Q89 A;  2WVF A;  3GII A;  2EBE A;  2W9C B;  2Z56 B;  1TMJ A;  2EG2 A;  5KFJ A;  1NM2 A;  4WU3 A;  5J1P A;  3I0S B;  3AOC A;  2FLO A;  3HK2 A;  3N9U C;  5K14 A;  1SC4 B;  2GHW A;  2UV8 G;  1N48 A;  1PIE A;  4DXL A;  2BKN A;  4OQJ A;  3DLJ A;  2BJ3 A;  4A8W A;  1K9M T;  2XCP A;  1X0F A;  3UW1 A;  1S0V A;  2H1Y A;  2DY1 A;  3DRP A;  2XMJ A;  1B0V A;  1Q7Y T;  5KFC A;  3NAI A;  1JK9 B;  2CNK B;  2VPX B;  2WW4 A;  2DGW A;  1VHF A;  1Z2Z A;  4G6V B;  3UFC X;  5K5M A;  2MQO A;  2CJ9 A;  2XLJ A;  4RPF A;  1TTH B;  4W4M A;  5E3A A;  2VJU A;  2FJE B;  3TVK A;  3IRX A;  1M5P C;  4TVA B;  4ZP6 A;  1JB0 C;  4DV1 J;  3TVY A;  5D4P A;  3CJQ A;  4C98 A;  1F3V A;  1TV6 A;  3J81 Y;  4DR1 F;  3EPI A;  5I3U A;  5C2G A;  1CEZ A;  1L3T A;  5J2P A;  1O8B A;  2NZC A;  3V6K A;  1FRK A;  2MMY A;  3KLI A;  3US5 A;  4B9V A;  3ISN D;  2F3J A;  1D9A A;  3EXY A;  2DVI A;  3BR9 A;  2GAG C;  4WF9 Q;  1TP7 A;  2VG6 A;  5T7L B;  3ULH A;  1VIS A;  2PFD A;  2Z57 B;  2IBK A;  2GHV C;  4AUK A;  3PV8 A;  5BR8 F;  1AW0 A;  2VC1 A;  3D6M B;  4Z2X A;  1QSL A;  3FGV A;  4U96 A;  3K2Y A;  4F26 A;  5B09 A;  1U02 A;  1LNQ A;  1HBN A;  1FKO B;  1G7C B;  4C4W A;  2HYI B;  3M1V B;  1RB0 A;  3CJ4 A;  1U47 A;  4C8Y A;  2UXB F;  1X9S A;  3KYL A;  2LQB A;  4KTQ A;  1MU2 A;  5MAO A;  3TUJ C;  5C25 A;  4HR2 A;  4M94 A;  5GAH I;  1V9O A;  1WF1 A;  2BAN A;  1Q81 T;  3BGR B;  3B8H A;  3DOL B;  1HMV A;  2ZEJ A;  4LFA F;  1RE1 B;  1IBL F;  3ITH A;  1ZTT A;  1JLB A;  1N32 F;  4Q0B B;  4O3Q A;  1WC0 A;  4X64 J;  1N34 F;  1CS4 B;  2H5E A;  4X4O A;  4YR2 A;  1MWY A;  2YNF A;  1TKZ A;  2PI4 A;  1X4E A;  1XJW B;  4Z7C A;  2NSC A;  1WG5 A;  5AE3 A;  4KGV B;  4PXC A;  1P8G A;  3MM9 B;  1S4E A;  3UR3 C;  4LF1 A;  2DO0 A;  5CZX A;  4FYX B;  2YWK A;  2VQF J;  1Q5Y A;  4NLV A;  4X4U A;  1RAF B;  2ZIT A;  4CM0 A;  3AXK A;  3KJV B;  1HNI A;  3Q23 A;  2HS3 A;  4LRE A;  1RA7 A;  1DTT A;  4WKR A;  2CPD A;  3RG6 A;  4AL6 A;  4M95 A;  3M9M B;  4NEY A;  1WOR A;  2ZC4 A;  4RUH A;  2K1R B;  3K8V A;  4I7F A;  1OIA A;  2CQG A;  4JV2 A;  4CH1 A;  2DPI A;  2PD1 A;  3CD5 A;  4LJM A;  3TNV A;  3SFU A;  3KLV A;  2QLF B;  3NNA A;  4L72 B;  2LXI A;  2YX4 A;  1DTQ A;  2DIV A;  2LVW A;  3CED A;  4EK2 A;  1D09 B;  5E3Q A;  1WHY A;  4B9M A;  5JUM A;  3W60 A;  2CJA A;  1S9E B;  2MLY A;  2MDA A;  4QWB A;  5K8O A;  3IGN A;  1IKX A;  3M7V A;  2IAJ A;  3IBW A;  2DR8 A;  4CNY A;  1PGZ A;  5H9E J;  4ZJO A;  4C7Q A;  3KK1 A;  2L08 A;  3FQL A;  5DLF A;  2RRB A;  4WFY A;  4RU2 A;  4MFB A;  1EKR A;  1T9X A;  2PGC A;  4HDG A;  3JTN A;  1BXN A;  2F8H A;  1JLF A;  2FZC B;  3C3L A;  3CCJ S;  1HYS A;  4DR1 J;  3TP2 A;  3KOA A;  3MMB B;  2XSJ B;  2DCU B;  1RT7 B;  4C8L A;  3MEG A;  4K50 A;  2QL7 B;  2N3O A;  1SJ1 A;  3C6U B;  2KG0 A;  2O5D A;  2RDJ A;  4A46 A;  4P7T A;  3EWG A;  3MD3 A;  1HBM A;  1IJE B;  1N0U A;  2C2D A;  1NJY A;  1YJ7 A;  1YI2 S;  2XUL A;  4ZHR A;  2VKR A;  4PWW A;  2V69 A;  5E3R A;  3CME S;  3K8W A;  4F2S A;  3AOB A;  2ROG A;  5IZH A;  2ATL A;  2R9L A;  4CYU A;  1RAC B;  3WX4 A;  5GAE I;  4IG3 B;  2G13 A;  4WTY A;  2EFQ A;  3BV8 A;  2PT0 A;  4R5P B;  2XMT A;  5CCL A;  4LIR A;  4UUW A;  5CH7 B;  3UPF A;  2UXB J;  1ZET A;  4DN9 A;  4U6P A;  4K4V A;  1MMD A;  3I0R A;  2B7C B;  2BE7 D;  4DPY A;  1EX8 A;  2G2Z A;  2B9Y A;  2VH7 A;  2HIQ A;  4I2Q B;  3AOD A;  5KFG A;  4C3M A;  2NCK L;  3BM7 A;  3N28 A;  1IBL J;  2D7S A;  1S1W A;  1YRX A;  2NPI A;  3DRS A;  4LF9 F;  1RYS A;  2DNR A;  3FFI B;  3P6Y C;  3M8S A;  3SIP B;  2HND B;  3ZTP A;  3CB4 A;  3HT3 A;  5LXR A;  4LMZ A;  3M8Q B;  2AMC B;  1RHJ B;  3ZZU A;  1RAO A;  2GZO A;  4OV6 A;  2CXE A;  4XAK A;  2GVD B;  1JLG A;  4IKA A;  2XM3 A;  3ZZY A;  2ZJP Q;  1RAA B;  4M5J A;  2RJZ A;  4O4R A;  1R3N A;  3MM6 A;  3TO8 A;  1IKV B;  4M8L A;  3JSY A;  2ZH5 A;  3OTO F;  2VD3 A;  1LK7 A;  3C19 A;  5HK4 A;  1NRK A;  2MKY A;  3SMZ A;  2EW9 A;  3NY0 A;  4AL7 A;  1U1M A;  1UVI A;  3DNC A;  3LP0 A;  1GMV A;  1L3S A;  2HFN A;  4N5S A;  4O0I A;  5F8M A;  3EGZ A;  2KHD A;  1F5A A;  3Q22 A;  4LSL A;  2VHG A;  3MR7 A;  2A6O A;  2CPI A;  1HNZ F;  5DM6 Q;  2GJI A;  4LBI A;  2WVD A;  2OPS A;  3BRE A;  1AYE A;  3BN4 A;  4YQW A;  5KFQ A;  3KUG A;  5K14 B;  3QJJ A;  1ZM2 A;  4X4S A;  4IFV A;  3RTV A;  2KO1 A;  2MLX A;  2XS7 A;  4I69 A;  4Z7Y A;  1XQI A;  3BSA A;  2ZC3 A;  2FHM A;  2VAS A;  3VVU A;  5K8P A;  3DRP B;  3O1L A;  4NYO A;  1OQ6 A;  3T19 A;  1MN9 A;  4YB7 A;  2B9W A;  2MJN A;  4YB5 A;  5KFO A;  2RUS A;  2F63 A;  1ZZN A;  3IRX B;  3BGU A;  2RUG A;  2EFO A;  3I5A A;  4CH0 S;  2VKZ G;  2BV3 A;  1Y5L B;  4X62 J;  2D69 A;  4F0K A;  4TYB A;  3LAM A;  2G0I A;  3I31 A;  2VA2 A;  1TV6 B;  4NPO A;  3QSI A;  1S6Q A;  4ECS A;  5J2P B;  4KRW A;  1KKH A;  4PQA A;  3HP6 A;  3DDI A;  1EHW A;  2B4V A;  3GV8 B;  4J9K A;  4QW8 A;  3HHE A;  2WOM A;  1VR6 A;  1IWA A;  3BKT A;  2VG6 B;  3KK2 A;  2ZKU A;  2OSR A;  3ENQ A;  2WVB A;  4C8N A;  2BQU A;  1BY9 A;  1YIT S;  3ZZR A;  2C2M B;  3EE3 A;  1FRX A;  3NS5 A;  1G1X A;  1ICE B;  4UW2 A;  1N33 F;  2VG7 A;  3BPD A;  1HBN B;  2HHX A;  3SV3 A;  5I4M A;  2P2C B;  3NCQ A;  4ECQ A;  3D4J A;  3AB4 B;  4KKO A;  2J7K A;  2IC3 A;  4AXI A;  3MHY A;  4RNO A;  5D4N A;  1SJF A;  1MU2 B;  1RAI B;  2YWH A;  4YUD A;  5C25 B;  3R3T A;  4X4V A;  4B3T J;  1FJ7 A;  2GGP A;  2CPZ A;  2BAN B;  2VB6 A;  5KG6 A;  1HMV B;  3DDK A;  1VLO A;  1EAR A;  3ITH B;  3G6E S;  3Q8R B;  4USJ C;  4WTO B;  4M5I A;  2QYG A;  1JLB B;  2PEB A;  1JIH A;  1REG X;  1N54 B;  4RKU C;  3GJR B;  3GG1 A;  4U67 Q;  3GV7 B;  4E8U A;  5EWE A;  1RHR B;  1K1S A;  4M5M A;  2YNF B;  3FEX B;  4IYQ A;  4NLQ A;  3NP5 A;  1TKZ B;  1LW2 A;  3UDC A;  2HKE A;  3N4W A;  4YOE A;  1QSY A;  3BGO P;  2JRS A;  2HFO A;  2P5V A;  3HDS A;  2OML A;  4ELU A;  2MPU A;  1AXQ A;  3NRB A;  2J9E A;  2BE2 A;  1RAG B;  3EM1 A;  3OTO J;  1NSK L;  2R8J A;  4DL7 A;  2BM0 A;  3DLE A;  1U8S A;  3H2V E;  2VBX A;  5E0O A;  3LF0 A;  2AW0 A;  2HHU A;  2MQL A;  5U47 A;  1U1R A;  1NKB A;  2HSE B;  4HL9 A;  5DZ7 A;  1RBA A;  2AJ4 A;  1YJU A;  2Z0G A;  5KFT A;  1DTT B;  1U1P A;  2FJX A;  4F4W A;  4PZV A;  4MKA A;  4G3I A;  1R8H A;  3T5L A;  4I7F B;  2YQ1 A;  2I2Y A;  1B7Y B;  3D68 A;  2M70 A;  1HNZ J;  3L4B C;  3M2U A;  1HAR A;  1MSW D;  2MQQ A;  1FKP A;  1DTQ B;  2OPP A;  4WYW A;  4DPW A;  1KLN A;  2FZG B;  4MIB A;  5A6P A;  1YG0 A;  1VJQ A;  4WE1 A;  3AHP A;  3MDF A;  3I55 S;  3HSJ A;  4V19 J;  5L46 A;  1IKX B;  1FFG B;  2IAJ B;  1MG7 A;  3BBB A;  3T5H A;  4H4K C;  2XY6 A;  3TAQ A;  3KK1 B;  1RLD A;  4F4X A;  4QR2 A;  3N5F A;  1FNX H;  4NI2 A;  1Q8L A;  2J76 E;  4MFB B;  1S97 A;  3GP9 A;  4PXE A;  3R27 A;  1JLF B;  1UJ6 A;  3VHQ A;  4PXB A;  5IT9 U;  1CC7 A;  4M1K A;  3QT5 A;  3AB2 B;  3JSM A;  1HYS B;  4YHH F;  1HW8 A;  2CG8 A;  2HQI A;  4EEY A;  1NK7 A;  1R0B G;  3FDS A;  1FX2 A;  4GO5 X;  5D15 A;  4ES2 A;  4FBU A;  1YVF A;  4NA1 A;  1WD6 A;  1HBM B;  2BJD A;  4Y00 A;  4DL6 A;  1ZAW A;  4MK7 A;  4OYM A;  2XTJ P;  5DGB A;  2W25 A;  3KMQ A;  1HHQ A;  3A8E A;  4ZHR B;  5CCM A;  1R0C B;  3BQ2 A;  1OY8 A;  1UTA A;  3UCU P;  2F4F A;  4CYU B;  4ED2 A;  3EGW B;  2V34 A;  1RT4 A;  4DL4 A;  1N33 J;  2W9A A;  1WUU A;  4XO0 A;  1TL1 A;  3CVK A;  2C2Z B;  1XK8 A;  3AH6 A;  2GA7 A;  2MY7 A;  2R7R A;  4AE5 A;  5ETP A;  1KP6 A;  3DRY A;  4JOU A;  4BS2 A;  2GJ2 A;  2CZ4 A;  2H48 B;  3MEE A;  4J9R A;  3I0R B;  2AYM A;  3FCW A;  3WZ0 A;  3VAG A;  3DC2 A;  2WW8 A;  2J0Q D;  3R5J B;  2LKZ A;  2YKM A;  3NKY A;  4ES3 A;  1EQM A;  4OLO A;  1FEE A;  2EKY A;  2HLU A;  1S1W B;  3DRS B;  4UOG A;  3VAH A;  4LF7 J;  2V2K A;  4TU9 A;  4ZCI A;  1REV A;  1FF2 A;  5ETQ A;  4MK9 A;  5KT5 A;  3VAF A;  1UJ4 A;  5IQQ A;  1Q95 G;  2BEF A;  4B9T A;  4K0K J;  4LUB A;  4F67 A;  1X4C A;  5AE2 A;  4I64 A;  1HQE A;  4I68 A;  4QR0 A;  4WII A;  2C3P A;  2VFT A;  2CPJ A;  1WDT A;  1RWO B;  4GO7 X;  1JLG B;  1FVS A;  1VBX A;  1KHV A;  4CH7 A;  3FNN A;  3MM6 B;  1S0M A;  5A8W A;  4MYU A;  1NO8 A;  2ASD A;  5JXS A;  4OX9 F;  1L3V A;  1S77 D;  3Q8U A;  2DR5 A;  4JI7 F;  3LGM A;  2J9D A;  3GYG A;  5AXM A;  2DXD A;  5IQ6 A;  2LEP A;  3RW7 A;  3TUZ C;  4A8Y A;  3LP0 B;  3N0V A;  3NBP A;  3F41 A;  3D7S B;  3KK3 A;  4MH8 A;  2DD8 S;  4OJG A;  1N0V C;  4YDX A;  4OJH A;  4F3M A;  1NAQ A;  4WFN Q;  4LFB F;  4LSL B;  3HSG A;  4NCB A;  2M3D A;  1S4F A;  1RYR A;  3J80 U;  2B6A A;  1EZZ B;  5KG1 A;  3EYZ A;  1WKJ A;  3ETO A;  4LBH A;  4URQ U;  3H2L A;  1WG1 A;  3W3S A;  1H73 A;  2D9P A;  1OPI A;  2E5H A;  1PKU A;  2HHH F;  3MMC A;  4NRT A;  4G1I A;  4FVM A;  4IFV B;  4EYH B;  1T02 A;  2A2C A;  5F8G A;  2JC1 A;  4OHV A;  5HP1 A;  1VQ4 S;  2E44 A;  1VQ6 S;  4OX8 A;  3VWS A;  2BRK A;  4P9S A;  3ADA C;  1QE1 A;  2G0J A;  1SCJ B;  3UCG A;  5LT5 A;  1UAW A;  3PX0 A;  2OHD A;  3GIK A;  4RL1 A;  2HFV A;  1NHU A;  2RE1 A;  5CD4 A;  5ETT A;  2CQ4 A;  3OTB A;  2QA1 A;  3MAQ A;  3W9H A;  1SKS A;  2EBG A;  1X60 A;  5D0H A;  2GMH A;  1KEK A;  4YHH J;  1MWQ A;  2FC8 A;  2JZ5 A;  1XNQ F;  3G8S A;  3DLL Q;  1QAY A;  1S6Q B;  4J9P A;  3JYT B;  3CIM A;  2FHJ A;  3WC2 A;  4BBY A;  2VPZ B;  1S57 A;  1VQM S;  2IBO A;  1RHM B;  3PX4 A;  4JI6 F;  1FKA F;  2WOM B;  1GQE A;  2PII A;  2YNG A;  2R2T A;  3E51 A;  1KN6 A;  4B9N A;  4KAI A;  2U2F A;  3D2W A;  3D3C J;  4EBC A;  3PXG a;  2FHK A;  2ZH1 A;  2GW8 A;  3CCL S;  2DHA A;  1GMU A;  5DQH A;  3LQV A;  4TY8 A;  2ZBC A;  2VG7 B;  3FBF A;  3O8W A;  4U95 A;  1WKL A;  3CIZ A;  1HNX J;  4B3R F;  4KT0 C;  1S99 A;  3KWM A;  3KHG A;  3Q8V A;  4KKO B;  4DQI A;  2DNY A;  2IC3 B;  4ZDN A;  1R43 A;  2F9D A;  2HWT A;  2DGQ A;  3HZG A;  2W8L A;  2LEA A;  2GGP B;  1N36 F;  3QGI A;  1YZ7 A;  3OR2 A;  1F1B B;  2KYX A;  3B6B A;  4KY3 A;  2DB1 A;  1WC4 A;  1CQN A;  3OJU A;  1V3S A;  4NMX A;  4CQ1 A;  3GE9 A;  1EQ0 A;  4LQ9 A;  3W66 A;  3FRZ A;  1LW2 B;  4LF6 F;  2DGU A;  3OJS A;  1YX2 A;  2VV5 A;  4USH A;  1FJG J;  2ACM A;  1T7P A;  1WNE A;  2PSZ A;  4JBC A;  2HFS A;  2BE2 B;  1WTF A;  4OX9 J;  2CVI A;  4P2S A;  1I1G A;  2MLZ A;  1CJK A;  5HQL A;  3DLE B;  4LRF A;  3JXO A;  4QYR A;  2RML A;  4K8R A;  3PR5 B;  4NLO A;  2AGP A;  5KG2 A;  2H3E B;  4ECZ A;  4ZVR B;  2KYZ A;  3I5B A;  4FYV B;  4ZPD A;  2G2O A;  3LWM A;  5J2Q A;  5KT6 A;  1R8A A;  1H98 A;  3CJ5 A;  1V5V A;  2VL1 A;  5KFF A;  3NNH A;  2R8K A;  5A2Q Y;  4JI4 F;  3MAH A;  4CLK A;  5JVG Q;  3E2E A;  2EK6 A;  4IH6 A;  5L1K A;  3M2U B;  2D3O 1;  2XI2 A;  3GZ7 A;  3EVO A;  3OSP A;  3PG9 A;  1FKP B;  1W7W A;  2OPP B;  2FY1 A;  2JSX A;  3M8Y A;  4K4T A;  1FHT A;  5HVH A;  1NLK L;  1T3O A;  3R5B A;  2UUW A;  5DDR C;  4WE1 B;  2D3Z A;  5BYS A;  4FF1 A;  4DV4 J;  2NUU G;  2G1D A;  2DTJ A;  4K7Q A;  1U1K A;  4BC9 A;  4UY8 T;  4WZQ A;  1ZBT A;  4R0J A;  1TVR A;  3HVR A;  1LW0 A;  1UVL A;  2B8P A;  3CO0 P;  2RDD A;  1WI6 A;  3JSM B;  1U1L A;  4JI5 F;  1VRQ C;  1XNQ J;  4NX9 A;  1FI4 A;  4PXD A;  4I2P A;  4AD6 A;  3QRQ A;  1U25 A;  4ZP7 A;  3W2V A;  3GFH A;  1K1Q A;  1Y9O A;  4PR6 A;  1YJR A;  4F4A A;  5KT3 A;  1SXL A;  3Q86 A;  3OSN A;  1RI7 A;  3S1T A;  2APO A;  4QPX A;  2RIL A;  1IQZ A;  3PW4 A;  2OIH A;  1NK8 A;  2HRT A;  2VPY B;  4LF4 F;  2KXH A;  2VFV A;  3TAN A;  1NSQ A;  2DXE A;  1EET A;  3SZ2 A;  4EU0 A;  1HPZ A;  1W26 A;  1RT4 B;  2YPZ A;  1TL1 B;  3LA0 A;  1I5O B;  9RUB A;  3BF4 A;  2J9C A;  4B3R J;  2F65 A;  5B0E A;  5EUH A;  3OV7 A;  5C5J A;  2BKP A;  3MEE B;  4RLE A;  2ZE2 A;  2PEH A;  4U8V A;  4FF2 A;  2L48 A;  3FVY A;  3OL6 A;  3IRW P;  1KC8 T;  4QWC A;  2YKM B;  5L9X A;  1DRZ A;  2WB4 A;  2V50 A;  3D0H E;  4DR4 J;  1IR0 A;  3W63 A;  4FNI A;  1X9M A;  4W90 B;  4CP5 A;  3PO4 A;  1H7X A;  2CKW A;  1UVJ A;  2ZUG A;  2XO7 A;  2DHX A;  4LT6 A;  1NH7 A;  1REV B;  2V8H A;  1F9H A;  2HQG A;  2QSW A;  3LGH A;  3ZZP A;  1JJ4 A;  1GMW D;  3OVS A;  1U49 A;  2JLE A;  3SCK E;  3K17 A;  1PBA A;  4LF6 J;  1HQE B;  3BO3 A;  3SYZ A;  5ETM A;  1XWL A;  2WSE C;  3NCP A;  2MZ1 A;  1AA1 B;  1K0V A;  4ECX A;  2V68 A;  3CCT A;  2RIJ A;  3HFK A;  4TNO A;  2ZZM A;  5A8W B;  3D1H A;  3MR5 A;  4EO6 A;  3AD8 C;  4S0M A;  5KG5 A;  3R7N B;  2ZH3 A;  1S76 D;  1WAC A;  2ZBR A;  1Y7P A;  3NBP B;  3KK3 B;  3OFH A;  5CHC B;  1UZH A;  4JI4 J;  1U26 A;  2VDH A;  2VOD A;  4H4K A;  1TK0 A;  1AT1 B;  2B6A B;  5E3P A;  1X5O A;  2AGO A;  2ZUA A;  4DPU A;  5DLG A;  3HPO A;  2MY8 A;  4CO1 A;  3VGS A;  4IR1 A;  3G86 A;  3MMC B;  2AYG A;  1RKI A;  3HHK A;  5IV3 A;  1JXE A;  3OLA A;  2E1C A;  1IKY A;  4CLP A;  3W9I A;  4DV3 F;  3JS9 A;  1T9Y A;  1VS3 A;  2JFD A;  4P2F A;  3KLH A;  1M90 T;  5HP1 B;  3I96 A;  5KG0 A;  3KTQ A;  2OGU A;  2QC3 A;  4NRU A;  4O44 A;  1VLY A;  4QIV A;  4L3K A;  2C3Y A;  3IAS 9;  1XER A;  4CZC A;  1U2C A;  2CNL B;  3NGR A;  2V2V A;  1WEY A;  2Y1L B;  2OO4 A;  3HFV A;  4AQY F;  3HFZ B;  1ZA1 B;  5KFE A;  2KZZ A;  1RWU A;  3BDP A;  2LFV A;  4DR6 F;  3FZB A;  3I4H X;  4LR8 A;  2D3U A;  4HT7 A;  3IWN C;  3ILL A;  4CTA A;  2RHQ B;  4JB8 B;  2YKN A;  1UEV A;  2H54 B;  2YNG B;  1JMT A;  1WEL A;  2IVY A;  4KGK A;  4OZ5 A;  3VGV A;  2DO4 A;  3QJL A;  1U1O A;  3MAA B;  1HHS A;  4PQU A;  4TY8 B;  1SJQ A;  3T1Y J;  4NLW A;  1F2H A;  4J9O A;  3FSY A;  5ITH A;  3KHH A;  2LQ8 A;  1RWW B;  1TQL A;  4WFX A;  2ALY B;  4P52 A;  4RNM A;  1SC3 B;  3ZZZ A;  1SV5 A;  1QVF R;  4P10 A;  3A3N B;  4JUZ A;  4CO2 A;  2BJ7 A;  4ZPA A;  2MKC A;  3OR2 B;  2NYI A;  3VTI A;  3UDL A;  5DG9 A;  2Y9H A;  3H5U A;  2M88 A;  1FVQ A;  2DIT A;  2B9X A;  4O3P A;  5CXT A;  4LF8 F;  2BM1 A;  2LEB A;  4QCL A;  1X5P A;  1URN A;  2Y8W A;  2CPH A;  2HFZ A;  1FDD A;  2LP4 A;  1UW9 A;  3M2V A;  3ZZO A;  5F0W A;  2ZH9 A;  4C8M A;  2IHR 1;  1XBW A;  4DBQ A;  3GMG A;  5DZ6 A;  4KYZ A;  1A0O B;  1RWK B;  2H4Y B;  3QBC A;  3EGV A;  1R89 A;  4JP8 A;  3PM9 A;  5GME A;  3X3U A;  2AYE A;  5LMN F;  1YKW A;  3PCO B;  1NHV A;  3DLH A;  3ISN C;  4ELV A;  2XWY A;  2GQC A;  1T95 A;  1RT1 A;  5HMY A;  5AJ3 F;  4FDF A;  3VZH A;  3J81 j;  5J2Q B;  1QD1 A;  1YJ9 S;  2R8H A;  5DRK A;  3W5X A;  4NLY A;  4IH5 A;  4UOH A;  4X4Q A;  3S8S A;  2P8I A;  2AX0 A;  1IBM F;  3BBC A;  4GKJ J;  3TQ1 A;  1LWX A;  1T9W A;  2OEL A;  3TRG A;  2BAC A;  3PJW A;  1Q53 A;  1FXL A;  1VI7 A;  1GH8 A;  2FJV A;  4NXM F;  5EN1 A;  4ED6 A;  4Q44 A;  4A8M P;  1KFS A;  1TKT B;  1KVK A;  3SSQ A;  1URR A;  4IQX A;  4OZ1 A;  2JEG A;  2N4C A;  2FIU A;  4L76 A;  1J5E F;  1FT8 A;  4TU8 A;  2IVM A;  3FJ2 A;  3KJF B;  4C8O A;  3RRG A;  1U09 A;  1WC3 A;  2HNY B;  2C28 A;  1VQ8 S;  2FVP A;  1HWL A;  2FLP A;  2OAU A;  3FSX A;  4AQY J;  4AXJ A;  1TVR B;  1N5Q A;  2W4C A;  1LW0 B;  3SEO A;  1S1T A;  3WHI A;  1VC5 A;  2HFU A;  1VQS A;  1PSD A;  3M6W A;  4FXW A;  4DR6 J;  1OPZ A;  2ZH4 A;  3Q2S C;  4I2P B;  2MZS A;  3B4M A;  4KGX B;  2UXD J;  3W2V B;  1JLQ A;  4USV A;  1X8D A;  2WON A;  4K4Y A;  4W92 B;  5L1J A;  3SCI E;  3SCL E;  2F7V A;  4G1P A;  4I1T A;  4NLS A;  2LU1 A;  2QA4 G;  2VC0 A;  1B0T A;  1X5S A;  5E2Q A;  3UD4 P;  1HNV A;  2IM3 A;  3CC4 S;  1RP5 A;  2K7J A;  1KTV A;  1EET B;  4CDI A;  1IXK A;  3CCR S;  1HPZ B;  4Y2I A;  4DR7 F;  2VU5 A;  3U27 A;  1ZM3 A;  5D0E A;  3DXB A;  1DY3 A;  4IG0 A;  2EEY A;  2M52 A;  1EP4 A;  4KO0 A;  4N8O A;  4E0D A;  3H98 A;  1NU4 A;  2VBZ A;  4WFA Q;  5G0R A;  3SV4 A;  1FWK A;  2GJF A;  1Y4Z B;  4PYD A;  2ZE2 B;  1UWA A;  4FPR A;  2RB7 A;  1DAX A;  2KU7 A;  4FYW B;  3H20 A;  2ASL A;  2ZD1 A;  2B4P A;  3D67 A;  1SL2 A;  2GC8 A;  4H54 A;  2KXF A;  4TY9 A;  3EGN A;  3BH7 B;  4DL5 A;  1XMB A;  3QT6 A;  4NLU A;  1YDL A;  4Q43 A;  1Z2L A;  3HHD A;  3MEK A;  2HS0 A;  3UVJ A;  3I0S A;  3D5M A;  3ZC4 A;  2D3O R;  1ZOT A;  4LF8 J;  4NEZ A;  1TK8 A;  2M7S A;  2WVE A;  4XPC A;  2A10 A;  4HKQ A;  1S0N A;  1ROF A;  3CJ0 A;  5GAG U;  5ETO A;  1FD8 A;  4LF5 F;  1OSC A;  2FQQ B;  3THT A;  4URG A;  2KL8 A;  1TL7 A;  5K9F A;  3VCD A;  4ZLJ A;  1FWP A;  2CVE A;  5LMN J;  4TN2 A;  1YLX A;  3H40 A;  2QLW A;  2RAQ A;  1BQM A;  3GCX P;  3LTO A;  2J0W A;  3HZE A;  3WIU A;  1C4A A;  2QFJ A;  5AJ3 J;  4FKX A;  1WOP A;  5L38 A;  2AGQ A;  1NBE B;  1FNO A;  4DL0 C;  7FD1 A;  2B8Q A;  1FRM A;  3PRD A;  2CQP A;  4P72 A;  3O6Q A;  2Z2Y B;  1TMM A;  3CF5 Q;  3R7B B;  4ED1 A;  2V2Z A;  3O3L A;  4NXM J;  2R8G A;  2X1B A;  3L95 X;  4A8O A;  3ZZ0 A;  1IKY B;  1WOO A;  1KQK A;  2DR6 A;  1S6P A;  2OP5 A;  4ZN1 A;  3MPU B;  4Z37 A;  4ZIV A;  4A8F A;  1S12 A;  2K7K A;  5B0D A;  2B4O A;  3OTE A;  4DUZ J;  2KRR A;  4URS A;  4NA2 A;  2GAH C;  2PI5 A;  5HQ8 A;  3MMJ A;  2BXJ A;  2E66 A;  2YQ0 A;  4QPT A;  2HHT A;  3AD7 C;  4USM A;  5EX3 A;  1JNR B;  2E7V A;  5DET A;  4I67 A;  5BYR A;  4K2X A;  2CPF A;  1S1V B;  1J5O A;  3L7U A;  4RO0 A;  4YB6 A;  4CI0 B;  3R1H A;  4ZKA A;  2GMJ A;  5CA5 A;  4CTA B;  2A2D A;  2YKN B;  4OIX A;  1O6X A;  3E3X A;  3IS9 A;  1X4A A;  2EG1 A;  5A6W A;  3ET6 A;  4RUB A;  1R0A A;  1HI8 A;  2K8G A;  1HWK A;  1RT3 A;  3GIJ A;  1X0P A;  4DR2 F;  2HGL A;  4DR7 J;  5HJY A;  5BXI A;  4PQU B;  1JNZ B;  2QG9 B;  1OS5 A;  4JI1 F;  4GVB A;  4HEA 9;  4Q5V A;  1CC8 A;  3KG1 A;  3PRB A;  1XR6 A;  1Q4R A;  3QT8 A;  4L6V 3;  2FGC A;  3VV2 B;  3ILO A;  2FPH X;  2RKI A;  3Q8Y A;  3I4P A;  2YY3 A;  2CQH A;  3Q8Q B;  2HK2 A;  2X1F A;  5HMW A;  1TAU A;  3E01 A;  1GX6 A;  1SV5 B;  2D74 B;  4F4K A;  2EK1 A;  2UUC F;  2IYI A;  3QGP A;  2PC6 A;  3EZO A;  2BBE A;  4L75 A;  4DV0 J;  1YJV A;  4DDF A;  2HRY A;  2P9G A;  4WK1 A;  3GB0 A;  2B0G A;  3Q24 A;  3CCE S;  3DM2 A;  2FJA B;  1S6U A;  2MKI A;  4B9S A;  3MM5 B;  4HH0 A;  1FDA A;  1GXT A;  4X84 A;  1X9W A;  3OHA A;  3C15 A;  2LYV A;  4UZB A;  4DL3 A;  2QN6 B;  1N52 B;  2OPQ A;  3G96 A;  4LF5 J;  3RR8 A;  2G2Y A;  3M2V B;  4J5O A;  2CQC A;  4DSE A;  4OZ0 A;  3MF5 A;  4YFU A;  1HNW F;  4X4N A;  2QJ3 A;  3CWJ A;  2D9O A;  4M5N A;  1H7W A;  2XZT B;  1YQH A;  3QNW B;  2IYG A;  5ETR A;  4OI2 A;  2CPE A;  2CIM A;  1JXV A;  1KDN A;  3R2C J;  4ED3 A;  1RT1 B;  2MQN A;  4CLW A;  4NZ0 A;  2L9N A;  3MR3 A;  3FCH A;  3IG1 A;  2OEM A;  3WQP A;  4MKB A;  2GNK A;  4ED4 A;  1FFW B;  2MTL A;  1VDH A;  3A8J A;  1HKA A;  4NE9 C;  3PIP Q;  1NK0 A;  2ZH8 A;  1NSA A;  2XMA A;  4YR3 A;  4DX7 A;  5IC4 B;  4NCG A;  2BKO A;  2IA0 A;  4LRC A;  3RBZ A;  2KFN A;  3LGN A;  3RR7 A;  2UU9 F;  3RW6 A;  3I87 A;  2B43 A;  2VZ9 A;  1UW4 A;  5KFV A;  2DJW A;  3BPS P;  4FS2 A;  3IXQ A;  5C24 A;  2M9K A;  5D78 A;  3MZI A;  3ZO7 A;  3TZZ A;  3L09 A;  3KG0 A;  4CLT A;  2E1M C;  3R5D A;  4FYY B;  5LSR A;  1D1U A;  1Q8B A;  2KH9 A;  3RAM A;  3N79 A;  3HUL A;  1S1T B;  2ZBI A;  4XDD A;  1U8W A;  2U1A A;  2JOQ A;  3T9N A;  1JJ2 R;  4K4Z A;  3QZ8 A;  3OHB A;  2F40 A;  3CW2 C;  1Q8K A;  1NDC A;  1C1B A;  1RGV A;  1TUW A;  2ZWO A;  2KVQ E;  1C0T A;  1IJF B;  1JLQ B;  3M8W A;  2WON B;  2M8D B;  1FDB A;  2BUN A;  3QGH A;  5KFH A;  1MMN A;  3IN5 A;  1WF2 A;  3H4D A;  5HAT A;  3TVZ A;  1HNV B;  4RNF A;  2PMH A;  5DJB A;  3TZY A;  4DR2 J;  1N5S A;  1SUQ A;  3J7A N;  4K59 A;  4MKY A;  4FN5 A;  3P49 B;  1XR7 A;  2GO8 A;  3GSI A;  4IG0 B;  1VQ7 S;  1EP4 B;  4KO0 B;  5EWG A;  3R97 A;  4DSL A;  5G0R B;  2ZNZ A;  3OTD A;  4PAA A;  4ECU A;  2ZDP A;  4EO8 A;  2UUC J;  1HI0 P;  2GVZ A;  1AZS A;  3BGF A;  4RR5 A;  3G4S S;  3EIC A;  2FHO B;  2ZD1 B;  4ZVH A;  4DS5 A;  2GFF A;  4W98 A;  1EKS A;  4QWD A;  4B17 A;  3CCM S;  3K5P A;  5AT1 B;  1YJT A;  3BO4 A;  3MCM A;  3QWP A;  1RLC L;  3UVJ B;  2C3O A;  5ETV A;  1H38 A;  4NL5 A;  1R6V A;  5HSP A;  4LSN A;  4RZR A;  5LSO A;  4UQG A;  4IRK A;  4LR9 A;  3J7Z 5;  4K4X A;  1PYS B;  2G4B A;  1GX5 A;  2HAI A;  3MMA A;  1CJU A;  1VQK S;  5F9L A;  3JQM A;  3PFE A;  3CC7 S;  4IOA Q;  2OFH X;  1HNW J;  1TL7 B;  2AJQ A;  1Y10 A;  3P4U B;  4C0O C;  2ZOM A;  1BQX A;  1KRP A;  1BQM B;  3VVT A;  3EJM A;  4XK8 C;  1TUV A;  4DCP B;  1SKR A;  5KFM A;  3HXM A;  3VR1 A;  4RNN A;  2OPR A;  1XR5 A;  4QYZ J;  1X4G A;  1JLE B;  5EX0 A;  5IT9 Y;  4ZPT R;  2PA3 A;  3HMJ G;  2NUH A;  3KLG A;  1SIZ A;  1N6Q A;  2BR0 A;  2ZJQ Q;  2CQ0 A;  1Q86 T;  2KJV A;  3C46 A;  2FVQ A;  4EBE A;  1TU0 B;  1DQA A;  4ERD A;  2UU9 J;  2NXC A;  2EFG A;  1SJR A;  4Q2L A;  4LQ3 A;  1UVK A;  2VIH A;  1M1G A;  3CJK A;  1VC6 A;  1NND A;  3S6E A;  3ILI A;  5DQG A;  1S6P B;  1HW9 A;  1H6K X;  3TA1 A;  2ZH7 A;  2B4U A;  3R6L B;  1CPZ A;  2AIR B;  4Y0F A;  5LM7 E;  4IOB A;  5B0C A;  5ETS A;  4R0E A;  2KTQ A;  2OFG X;  3GFY A;  1YHQ S;  4OHW A;  3V81 A;  5L1I A;  3MPY A;  1H3D A;  2BE9 B;  1FDN A;  3QMQ A;  2AKW B;  3SFG A;  4DF8 A;  2W9B A;  1DBD A;  3BSC A;  2HW3 A;  1T11 A;  3EVW A;  1F9F A;  4WFB Q;  3H25 A;  4PUO A;  5IS2 A;  3ZZT A;  3CUL A;  4C8Z A;  1QUV A;  2VUG A;  3M8P A;  5H9F J;  4LSZ B;  4QJV A;  1J5O B;  4ATN A;  2HNZ A;  3IS9 B;  4QIW D;  4U7U D;  3ET6 B;  3MM7 A;  2XB2 D;  3ZTR A;  1R0A B;  4N7T A;  2Q79 A;  3QLH A;  3JQJ A;  4ZPB A;  2FVC A;  3VAM A;  1RT3 B;  2V9K A;  3MED A;  1P6T A;  2FGO A;  3IFE A;  1X4B A;  3AY0 A;  4JYA J;  4WFZ A;  3TOQ A;  4GVB B;  4FNH A;  3RBD A;  3A8I A;  5KT2 A;  1S9F A;  3R9L A;  3MPW A;  1D8Y A;  1N4L A;  1H74 A;  3BJY A;  2RKI B;  4OZN A;  5SZT A;  4WYL A;  2JL9 A;  3E01 B;  2HHW A;  2VFS A;  1GFW B;  1FRJ A;  4JI3 J;  1IM6 A;  2E1P A;  3CUN A;  4DV6 F;  4PKD B;  2FVR A;  4ZCK A;  2IIH A;  3T41 A;  2F9J A;  3KLE A;  2XC9 A;  4V19 X;  3FBB A;  4ZA1 A;  2NSB A;  3DM2 B;  3H59 A;  2QO3 A;  4DSF A;  4CO3 A;  3NNC A;  1NPR A;  2FJW A;  3CD6 S;  2JFK A;  3UNG C;  2VF3 A;  3K0J A;  3TAP A;  1SBR A;  1N88 A;  3RB4 A;  1S48 A;  3C15 B;  5KFW A;  1TFW A;  3HVT A;  4OYW A;  2OPQ B;  1UEK A;  4FPI A;  3CDE A;  2HQD A;  2CJX B;  5I42 A;  3RBE A;  3CJ8 A;  2W7A A;  1B3T A;  3D6F B;  5E3C A;  1FFS B;  4WPA A;  1ELO A;  1ZTW A;  1FEH A;  1T0T V;  4NXN J;  3OVB A;  1M5H A;  2WCX A;  3DYA A;  4Y34 A;  4AT1 B;  3DI6 A;  4M5G A;  5KG3 A;  1IBK J;  2FTR A;  2WSC C;  2BJ8 A;  3P3D A;  2AWZ A;  3B4D A;  5ETL A;  2GIR A;  2V8D A;  2XGQ A;  3W8P A;  4BC7 A;  3U02 A;  2B56 A;  3IG1 B;  4ZVS B;  2XYG B;  4X62 F;  5DG7 A;  2UVR A;  5D3G A;  2R7Q A;  4J9Q A;  2VIC A;  2FUG 9;  4JI0 F;  2ROP A;  1HFE L;  4NCG B;  4ZVO B;  4OI3 A;  4ID8 A;  2KM8 C;  1I6J A;  2ZBQ A;  1EIY B;  3GSD A;  1M5O C;  2HQC A;  2HZA A;  1RXO B;  4USI A;  2BYC A;  2XMU A;  3CJ2 A;  2J8S A;  2WTF A;  3KLF A;  5C24 B;  2CA9 A;  2JNJ A;  1ULR A;  2HUR A;  2KHC A;  3TEH B;  2CPY A;  4IO1 A;  4NLG A;  4IDK A;  3QFH A;  3T1H F;  4A8K A;  1X5T A;  2V94 A;  1JJC B;  2DGO A;  1YRU A;  1YRT A;  5HJX A;  1M5V C;  3Q2T C;  2F8M A;  1CJV A;  5GMK a;  1JLA A;  2IRY A;  5HI7 A;  4Y2M A;  1I94 F;  2IMO A;  3TUP A;  3TAM A;  1MW7 A;  1AUD A;  1NDK A;  2YBV A;  4ECY A;  5JVH Q;  1O51 A;  3LO3 A;  4KHP F;  1VRU A;  3ENA A;  3ONQ A;  1A9N B;  3SI8 A;  4KC5 A;  4B3S J;  2LDI A;  3T5K A;  2XEX A;  4Y2A A;  3W64 A;  2XYP B;  1QAX A;  6FD1 A;  3IWL A;  4B3T F;  2JLF A;  2CPX A;  2DXF A;  5DDO C;  1C1B B;  4DR5 F;  3DGP A;  3NWR A;  1UVM A;  1C0T B;  2BOP A;  4DN0 A;  2PO4 A;  3J7Z T;  1IM4 A;  2RU9 A;  5DDQ C;  1NH8 A;  4DWI A;  1WEZ A;  2ZVI A;  4Y2C A;  2RQK A;  3SDE A;  3NCR A;  1VIO A;  4YEA A;  1SVD A;  5DQI A;  2CFX A;  5B0A A;  3EZ5 A;  3OTC A;  2ZZN A;  2MST A;  3L7O A;  1PG5 B;  1NK6 A;  4R25 A;  1SIW B;  4EI2 A;  1NK5 A;  4G65 A;  1RHK B;  3TAR A;  2JDJ A;  3OXG A;  2XQC A;  1SJ3 P;  1SUQ B;  3C16 A;  4RJV A;  4TYA A;  3BN7 A;  3BQ1 A;  3TEG A;  1ZM9 A;  4OI4 A;  5LMU J;  2AJ1 A;  2V8G A;  3GJQ B;  2M2B A;  1FTR A;  1MLA A;  3K59 A;  4ED5 A;  3OR1 A;  4QIE A;  2D1C A;  2DNL A;  1HD0 A;  3GR0 A;  1FCA A;  2IDE A;  2VFR A;  4O0N A;  3QRR A;  2DIU A;  2CNO B;  2XS5 A;  2GVZ B;  4DUY J;  1AZS B;  1FES A;  3RRH A;  1SH3 A;  3FBC A;  2WAQ D;  4ETX A;  2NRE A;  4DV6 J;  2MKJ A;  2BMB A;  4YB1 P;  1JX4 A;  1U7L A;  3RRK A;  3OVA A;  5DDP C;  1T3N A;  2W4P A;  4L74 A;  3V2U C;  2YWE A;  3A1Y G;  4DV2 F;  2P6S A;  2BZ2 A;  4KHM A;  2ZZT A;  1RAJ A;  3BYP A;  2X3G A;  5GAG I;  5D4O A;  1WHV A;  2XO6 A;  5D0R A;  4LRB A;  4FXV A;  2NLW A;  4LSN B;  2CJB A;  3QID A;  5E7O B;  1N56 A;  3K5L A;  5D77 A;  3MMA B;  1CJU B;  3OUY B;  3NMR A;  4Y6I A;  5JMN A;  1WJ9 A;  2ZKT A;  2UVV A;  2H51 B;  2IA6 A;  2LLZ A;  2RH3 A;  2NQP A;  2JVR A;  1LV5 A;  1BGX T;  4ECR A;  5F8N A;  2CNN B;  1QLN A;  2HBZ B;  1UVN A;  1R6Y A;  1XMQ J;  4CLL A;  1Q79 A;  3QYY A;  1J2V A;  2V6A A;  4MIA A;  2FC9 A;  3GWC A;  3IM8 A;  5CQG A;  2LDY A;  4LFC J;  2OPR B;  1F5B A;  2QLX A;  3IAM 9;  4C0H A;  3AJD A;  3KLG B;  2ACY A;  4A8X A;  3QZ7 A;  1N6Q B;  1LK5 A;  4NOH A;  5F8I A;  3JYT A;  4JI0 J;  3NS6 A;  2BA9 A;  3UN5 A;  2XGP A;  4DSK A;  2V8V A;  2DNN A;  2QT7 A;  4N76 A;  2OLW A;  3CJK B;  4JI8 F;  4DX6 A;  4C48 A;  4Q7A A;  1XIQ A;  4M5K A;  3CJR A;  3K57 A;  3T1H J;  2NXE A;  1LOU A;  2DNQ A;  1FXR A;  4EZ9 A;  3Q0A A;  1YK9 A;  3CJS A;  4J9S A;  2DKO B;  3IM9 A;  1I94 J;  1T9V A;  2CG4 A;  2VBW A;  2LEC A;  3V81 B;  2X1G A;  2Z58 B;  1MML A;  5KFK A;  2G1H A;  2YKO A;  4KHP J;  2OKQ A;  2CQD A;  2Z2L A;  3O44 A;  2W9B B;  3QAE A;  1G2E A;  1VFJ A;  2LU2 A;  1KQG B;  3M8R A;  4PUO B;  4ANE A;  2UVU A;  4DR5 J;  4OZJ A;  1U6Z A;  3M8P B;  4ZPW R;  3MCS A;  5B0G A;  2L3M A;  8ATC B;  1PJ5 A;  4LF7 F;  2KN4 A;  4ZIT A;  3NG8 A;  1P1L A;  2HNZ B;  3P45 B;  1UEU A;  4XIU A;  3KHL A;  4K0K F;  3MM7 B;  5KFN A;  3QLH B;  4GKK F;  2FLN A;  3H2U B;  3U7J A;  3G82 A;  2EWH A;  3MED B;  2FJD B;  2QMU B;  1UP1 A;  1TKD A;  3OXF A;  4DQP A;  3UDE A;  1ZAV A;  3CD7 A;  4DU7 A;  1TL3 A;  2RU3 A;  3FKB A;  2V0N A;  3K89 A;  3BKF A;  1NJW A;  4QW9 A;  1L5U A;  4C3K A;  5KT7 A;  1VBY A;  2V4R A;  2QGF B;  2XHC A;  2X3D A;  4KB7 A;  2G0C A;  4K5R A;  4N47 A;  4DFM A;  1HR0 F;  2GQ2 A;  2XNQ A;  4DHV A;  1IQT A;  4PPD A;  3OBI A;  3GQC A;  5DO2 A;  4X66 J;  4OX6 A;  2OD6 A;  3T6J A;  3KLE B;  4DV2 J;  2QA4 S;  3PKM A;  2HVH A;  2DNK A;  3MTJ A;  3PJ9 A;  2O1P A;  1FJC A;  2CQ3 A;  2ASY A;  1MN7 A;  1VGY A;  2HRU A;  1KR4 A;  3EPG A;  3HVT B;  4P75 A;  1C2P A;  1GK8 A;  1RT5 A;  2ZHB A;  4NLT A;  4K4W A;  1TKX A;  1JWW A;  2I1R A;  5KFI A;  4P6Q A;  5I42 B;  3FC9 A;  6AT1 B;  2PMW A;  1QUP A;  3RYL A;  2QZ8 A;  3Q8S B;  4DMZ A;  4M5H A;  2CDQ A;  2NPF A;  3DYA B;  1S7H A;  2HS4 A;  3QFW A;  3DI6 B;  4UF4 A;  2CAD A;  4J9L A;  3GFX A;  1DQ8 A;  4EZ6 A;  3PDN A;  2FZK B;  2PE8 A;  4ZLL A;  2XHW A;  2NS1 B;  3R7S B;  2MGZ A;  1KWM A;  1NSP A;  4TU7 A;  5D3G B;  5BJR A;  4TLR A;  2POK A;  1GTE A;  4J90 A;  1T9T A;  4U8Y A;  2H4W B;  1D3W A;  4ER8 A;  2F5G A;  2WBR A;  1RT6 A;  4OJ1 A;  4Y3C A;  2RRA A;  1MNE A;  1IN0 A;  1LQ9 A;  2C42 A;  3R5A A;  4N77 A;  2R2R A;  1S9G A;  3UE2 A;  3BDE A;  2HBQ B;  4YS2 A;  2ZNY A;  2IM0 A;  1YIJ S;  4EUV A;  4KFB A;  1G6B A;  2MQM A;  4FS1 A;  4JI8 J;  1LFP A;  3KLF B;  3U1M A;  4OYB A;  4IDK B;  2DCL A;  1RZM A;  4KGZ B;  1NPK A;  2I38 A;  1KFD A;  3EDQ B;  3FBE A;  4LRD A;  2UXC F;  2K3K A;  1CJV B;  3NGU A;  1JLA B;  3H4B A;  5KTQ A;  3PO5 A;  3TAM B;  4F0M A;  4U7U K;  1HNX F;  4CO4 A;  3BKU A;  2C2O B;  1HWU A;  3R2D J;  3PW2 A;  1CQM A;  1T8E A;  3IR7 B;  1M1K T;  4J9M A;  1VRU B;  2HVD A;  3AXM A;  3HJF A;  1ZAX A;  3FEY B;  4C11 A;  4NLX A;  5IT0 A;  4Q8E A;  3GJT B;  4LBP A;  4DL2 A;  3GG0 A;  4CLY A;  3DGP B;  1FWL A;  3G8Q A;  3ISZ A;  2YX7 A;  3SDE B;  4F50 A;  3DXS X;  4OYO A;  5HMZ A;  1O5J A;  2B5J A;  2RQC A;  1VQY A;  3OL8 A;  4GKK J;  5FD1 A;  1PC4 A;  2QTW A;  3DLK A;  4OYA A;  1UPP A;  1FJG F;  1N5V A;  3C16 B;  4X65 F;  1NDP A;  1VIX A;  1RBO B;  1KQS R;  4Y65 A;  3AQP A;  4JV5 J;  4UQT A;  3TX8 A;  1T9U A;  2I5J A;  4WJB A;  3CSK A;  3GFZ A;  3HHL C;  1VQL S;  2MHN A;  3OR1 B;  2PN6 A;  3AT1 B;  3V6D A;  4DI6 A;  3T5J A;  3GIM A;  4CNZ A;  3IA0 A;  4K2J A;  3FMW A;  1HR0 J;  1SKW A;  2GO9 A;  2YH0 A;  3UWT A;  2R2S A;  4ZVF A;  1PCA A;  2ZJR Q;  1T03 A;  5GVQ A;  3DHW C;  2YXL A;  3GIR A;  2BJE A;  5RUB A;  1IVZ A;  1CG2 A;  1X31 C;  1QJH A;  4Y2K A;  1BHN A;  3JSB A;  4NYZ A;  2DEI A;  5F0U A;  7AT1 B;  3RBX A;  3HHN B;  3GR1 A;  2J0X A;  5IWA J;  2XMM A;  4O3N A;  3C6T A;  1XMO F;  1L3U A;  5KOX A;  2K3I A;  3MWB A;  4DV4 F;  3K5M A;  1S72 S;  4RBU A;  3CMQ A;  5F3Z A;  2R7X A;  2DGT A;  2BAB A;  2OSQ A;  3D3B J;  3NL0 A;  4R8U A;  1P1T A;  1AFI A;  2Z8Q A;  3F0N A;  3WC0 A;  4WXO A;  2M8H A;  3OT9 A;  1ZH5 A;  1Y3K A;  3QQC D;  2AJ0 A;  2B51 A;  5HMX A;  4BLG A;  3PW0 A;  3H0P A;  2FYX A;  3H5S A;  5HQM A;  4IO9 Q;  1HD1 A;  1IR2 A;  4RUA A;  3D9B A;  4I0W A;  2C1E B;  2VBY A;  2E7X A;  3V5R A;  1UFK A;  1U0S A;  5KOW A;  4H4O A;  2LCW A;  1H2T Z;  2YWW A;  3M30 A;  4NAS A;  1TAQ A;  2ZWP A;  4FP9 A;  2C3M A;  2PFF B;  3CPW R;  1R31 A;  3JSR A;  1RWM B;  3S7R A;  4HHU A;  3MAA A;  3CC2 S;  3I6P A;  4PG6 A;  2UXC J;  3W62 A;  3D6H B;  3A12 A;  2H9Z A;  2C2N A;  2QSF A;  2KG1 A;  1SH2 A;  3VGT A;  4I6W A;  1NZ8 A;  3LUY A;  4DCJ B;  4NZ7 A;  3EVM A;  3NGS A;  1RAB B;  3LH2 S;  1S59 A;  1RTZ A;  5IFM A;  3MCO A;  2DIS A;  2LXF A;  3IR5 B;  5KFL A;  1TFY A;  1YJN S;  1CVJ A;  4OYI A;  2MZR A;  5CYM A;  3UNY A;  4DR4 F;  2UZA A;  3ZTQ A;  4RWX A;  3T9Z A;  4MT1 A;  5E41 A;  3HJV A;  2Z30 B;  4NWB A;  1WHX A;  2FY8 A;  1VC0 A;  3N5B A;  1C4C A;  4DSI A;  4CCH A;  2FLL A;  1DAR A;  3RGI A;  1B99 A;  3TJ9 A;  1JLC B;  3G82 B;  1QM9 A;  4X65 J;  5KFZ A;  3TJA A;  4FKY A;  2V4J A;  2SXL A;  1TL3 B;  4LF2 A;  4B3O A;  2W24 A;  4DSJ A;  4A48 A;  2IY5 B;  2E9R X;  4C97 A;  2GV1 A;  1KNZ A;  5M2P A;  3L9Z A;  2ADC A;  3JTP A;  3O2I A;  2ZM6 F;  2P9E A;  3CMA S;  3AA9 A;  1NHK L;  3M05 A;  4M5D A;  1QAJ A;  1TZ0 A;  4DQR A;  3BSN A;  4IRC A;  1K73 T;  2WBM A;  3NEK A;  1UCN A;  1KS2 A;  5HL7 Q;  3G2X A;  3UR0 A;  1R7I A;  2GIQ A;  3RJM B;  4ZCM A;  5HVF A;  3QO9 A;  4WCE Q;  1U45 A;  4NCA A;  4ELT A;  3BEG B;  1KTQ A;  4YP3 A;  3QPI A;  1WC1 A;  2FVS A;  3DHX A;  3L3C A;  2B7B B;  1NJZ A;  4TQS A;  4E98 A;  2J6S A;  2BVZ A;  1RCO B;  1LXJ A;  4OHZ A;  4HVZ A;  5FJ4 A;  4ZIW A;  1VQ9 S;  1TKT A;  4IRD A;  3TX0 A;  1RT5 B;  4ILM A;  4LR7 A;  4QR1 A;  5FDL A;  1TKX B;  3OFE A;  2BJ9 A;  4OL8 A;  1T94 A;  4D3H A;  1XMO J;  2A0F B;  4ILR A;  3IBF B;  4BWM A;  2KT2 A;  1RK8 A;  5KFR A;  2NZ4 A;  3OXL A;  3LAL A;  1B7F A;  4DU8 A;  2Q1L A;  2HNY A;  2MYF A;  2ZHO A;  3JAM Y;  1D9D A;  2ZOG A;  2BOA A;  5AXN A;  4EYI B;  1YBT A;  2MB0 B;  2O66 A;  5LXY A;  3HD1 A;  5BR8 J;  2ZH2 A;  3HKZ D;  3CCV S;  2Y3Y A;  2MGZ B;  4JI2 F;  1RAD B;  3M6U A;  2N7Y A;  3VAK A;  3I56 S;  3AJ1 A;  1PYT A;  2XMV A;  2C3U A;  3FK4 A;  1RT6 B;  2HBR B;  4RWW A;  4FZV A;  4WZM A;  4JV0 A;  3IBC B;  5HO4 A;  3ICL A;  5HRO A;  1S9G B;  2C2R A;  3V4M A;  1BQN A;  3FUY A;  1GMW A;  1HIY A;  5HAN A;  2AHO B;  1KHW A;  4KFB B;  4QWE A;  3GON A;  3NAH A;  1IBC B;  4PG4 A;  2QL5 B;  3GPA A;  4LFA J;  2CQB A;  1EAY C;  1U0H A;  4J37 A;  2VQE F;  1KBR A;  3H90 A;  3OLB A;  4J7C A;  1UPM B;  1N32 J;  5KFS A;  4FF4 A;  2XG8 A;  3T1Y F;  3BSO A;  1VCT A;  3M4X A;  1N34 J;  1U1N A;  3M2R B;  3OD2 A;  2M4M A;  2VOP A;  1RDR A;  5AE1 A;  3HVW A;  4C11 B;  2MKK A;  1ACM B;  1LWE A;  1Z1Z A;  2Q6B A;  2J0S D;  2DNO A;  2MEW A;  1NJX A;  1U2F A;  2BW7 A;  5IOL A;  1VJW A;  4RBV A;  3PYE A;  5A8K A;  2GCF A;  1S5Z A;  3U1N A;  4OYZ A;  4U9R A;  2WZ1 A;  1DQ9 A;  3FSI A;  4ECV A;  3NGT A;  1H2V Z;  1BLU A;  2B5J B;  2GML A;  2P6T A;  2HK3 A;  3EMT A;  4J9V A;  1YSJ A;  2MZJ A;  3D0G E;  2DBB A;  3DLK B;  3W5Y A;  2OTL S;  2HHV A;  4HI1 A;  4AYB D;  2I5J B;  1RSC A;  5DG8 A;  2ZM6 J;  4QQB A;  3HSZ A;  2IRU A;  3CDA A;  3V6D B;  4AFF A;  4BHQ A;  4ZPV R;  2YWF A;  2KFY A;  1LXN A;  3UN3 A;  3DRR A;  1NME B;  2RS8 A;  2W2M P;  3Q83 A;  2DPJ A;  1UA1 A;  1YGY A;  4PWD A;  1VBK A;  1KSP A;  3MGJ A;  3OL7 A;  5IV4 A;  5KG7 A;  1GXL A;  3IP0 A;  1T03 B;  3K7R A;  2DT9 A;  5E5N A;  4WK3 A;  4WWS A;  3UO0 A;  1S79 A;  5M2R A;  4GKJ F;  3O5T B;  4DF4 A;  4DV5 F;  1G3O A;  3P5B P;  1RHQ B;  4PEO A;  1RTJ A;  4DJB A;  2QMW A;  2R3V A;  3KKF A;  2R8I A;  2OD4 A;  4ZVQ B;  2RQ4 A;  1RHU B;  1CBK A;  4RNH A;  2BQ3 A;  4HHJ A;  1XNR F;  3G6X A;  3C6T B;  5I3U B;  4WP9 A;  2R7S A;  2GHP A;  3IWX A;  4C8K A;  3GYN A;  2HHS A;  4R8U B;  1S7I A;  3KLI B;  4ITS A;  4N56 A;  5LSL A;  2KM8 B;  1FJE B;  4EFA C;  4PRF A;  2BRL A;  3TWZ A;  4Q8F A;  2M0G B;  3K5N A;  4DQS A;  4P2M A;  4BWJ A;  4F4Y A;  4F04 B;  4JI2 J;  3UQS A;  5J1N A;  2NYH A;  1DFD A;  8AT1 B;  3DOK A;  2ROE A;  3MPV A;  2VA3 A;  3A3O B;  4IR9 A;  3CT9 A;  3NWG A;  1C1C A;  2HVI A;  1OJ4 A;  3PYG A;  1SJ4 P;  2UXD F;  1S1V A;  2W7P A;  4H4M A;  2AF6 A;  3LAK A;  4K5S A;  1WC6 A;  2DNP A;  1UL3 A;  2J8A A;  2JC0 A;  2KDO A;  1V5I B;  2DNM A;  4K4S A;  3J7Y U;  5K8N A;  3MI7 X;  4H4O B;  3NGD A;  3M30 B;  1NPP A;  4ANC A;  4F3Q A;  2VQE J;  5FLX U;  3PNI A;  3DCA A;  2Q66 A;  4LF9 J;  2HEK A;  2DHS A;  3M6X A;  4ED7 A;  4MAK A;  2AT1 B;  2YNI A;  4GVL A;  5CYQ A;  5DM7 Q;  5KFD A;  2XCA A;  1Y00 A;  3BBF A;  3SBM A;  3VAI A;  3M9N B;  1X4D A;  1KVJ A;  1WDD A;  2KJW A;  5IC6 B;  1D0E A;  2DH8 A;  4Q45 A;  4CO5 A;  1HQU A;  5ADZ A;  4ZVE A;  4FVC A;  1KQF B;  4CWB A;  4RW4 A;  2AX1 A;  5CYM B;  2M5Y A;  2QYC A;  2XY7 A;  3D1Q A;  4HTJ A;  3PRV A;  4QU6 A;  2AD9 A;  3HHL A;  4KE5 A;  1FO1 A;  2CZ9 A;  2JVO A;  3NGK A;  1L3K A;  1UZD A;  2EFV A;  3VQS A;  3MM5 A;  1HNI B;  4KPC A;  5CD4 H;  5F8L A;  2RT3 A;  2YKP A;  4PG5 A;  2RSQ A;  3D6T B;  4CIO A;  1DUR A;  2OH2 A;  2VOO A;  1Q7L B;  2V4J B;  4B3O B;  1UWB A;  2E9T A;  1LKZ A;  1F0X A;  4LRA A;  2Z4P A;  5IM0 A;  3DU5 A;  4NLR A;  2QLB B;  2ZHA A;  3ELH A;  1JQG A;  4A8S A;  4M5D B;  4WU2 A;  3BR8 A;  2RRN A;  2IRX A;  1UFL A;  3OL9 A;  2VON A;  3UN2 A;  2DY9 A;  1ARO P;  2XWX A;  3D66 A;  3NOC A;  2DRA A;  3AQO A;  3QO9 B;  4C3L A;  4P73 A;  1IWG A;  3MFH A;  2ADB A;  3DLG A;  4QYZ K;  4UTG A;  4DV5 J;  3HHL D;  5D0G A;  4ZVP B;  2HGM A;  1CUL A;  1RCX B;  3DN9 A;  4M63 A;  1D9F A;  2RS2 A;  4PYA A;  1GTH A;  4UOC A;  1U48 A;  2W2P P;  4WP8 A;  4OHX A;  2COL A;  4KBI A;  2ZVS A;  5FDL B;  2DHG A;  3P8B B;  2YKQ A;  3FEZ A;  3J81 U;  1XNR J;  3DRX A;  3WBZ A;  4N8N A;  1G4C A;  2DGV A;  3POT A;  2WK4 A;  1NUE A;  3MEG B;  4GC6 A;  1A7G E;  4CLU A;  1XTZ A;  3AD9 C;  4HLB A;  2XLK A;  3SSR A;  3G6Y A;  3RZA A;  3LP2 A;  2NXN A;  3BB5 A;  3HM9 A;  5CAA A;  4DUZ F;  5KFB A;  1VRT A;  4F02 A;  2PA8 D;  3KXD A;  1NK4 A;  3FZ2 A;  4DX5 A;  2DRD A;  1HBU A;  5LL6 d;  3HLU A;  1VQO S;  4OMF G;  3NOG A;  5IT4 A;  1D8Z A;  4ZS6 A;  2R7V A;  2MKH A;  5J2N A;  4BCA A;  2MZQ A;  1OYD A;  2IM2 A;  2E9Z A;  3OPK A;  4XDC A;  2IFX A;  4ID5 A;  3TYT A;  4DX8 H;  1FNM A;  5AXK A;  1NZA A;  5HRO B;  3PW5 A;  2RF2 A;  4KHR A;  4ZJL A;  1VK8 A;  2H5J B;  5H9F K;  2YNH A;  3VAL A;  1Z4U A;  1BQN B;  3VAJ A;  4DZ6 A;  4KSE B;  1RU2 A;  2Y1R I;  4RW8 A;  2XSF A;  4B08 A;  2EFP A;  4UY8 5;  4BDP A;  1SQG A;  1VK3 A;  3RUB L;  2K2P A;  1U0H B;  1YWX A;  1FRI A;  3KJN B;  1QSS A;  4F36 A;  2HWH A;  5CYJ A;  4OHY A;  3PZP A;  3CE8 A;  1VQN S;  4RU9 A;  2W01 A;  1ZPV A;  1M0S A;  4RW6 A;  3CCS S;  1RAE B;  5LJ3 Y;  4EMD A;  2CQ2 A;  3WIV A;  3CGI A;  1HHT P;  1LWE B;  2DNZ A;  4YME A;  2DHH A;  4AL5 A;  1OWX A;  2E5I A;  4ZLN A;  4DV0 F;  1S1X A;  3VZI A;  5C2C A;  3DOM A;  1H72 C;  4ECT A;  3PIO Q;  1U1Q A;  3UD3 P;  5A8K B;  3ZNU A;  4NYP A;  4QOT A;  1NXI A;  3QRP A;  4D3G A;  4L3N A;  4DPX A;  4HAC A;  2C2K B;  1NB7 A;  1FXD A;  3AOA A;  4ZMM A;  5GAD U;  1P27 B;  1PYO B;  2HWI A;  1OY6 A;  4LVO P;  2ZDO A;  3U1L A;  2X7I A;  1HQ2 A;  5LOQ A;  2YH1 A;  2J9D E;  4DZD A;  3OFG A;  4P71 A;  2KZM A;  2OPS B;  1RBL A;  4P74 A;  4RUC A;  2QL9 B;  2AV5 A;  1VYA A;  2N7C A;  4ECW A;  1R27 B;  3PTW A;  3DRR B;  2QEX S;  1V6H A;  2AQ4 A;  4PWD B;  1ITP A;  2AZ3 A;  2CUY A;  2QFI A;  4UOF A;  3PYD A;  4CO0 A;  3R1L A;  5HBM A;  2QE5 A;  1ZPW X;  2O67 A;  1JLE A;  2Q43 A;  1DJ0 A;  1SQF A;  2LA4 A;  1UJ5 A;  1HI1 A;  1S0O A;  4I4B A;  4RW7 A;  3MOJ B;  1RTJ B;  2Z2Z A;  5J1E A;  4XPE A;  1N5Y A;  2N3L A;  4RW9 A;  1Q0N A;  3KUE A;  3KDN A;  2HPU A;  3DFE A;  4MYT A;  3LPE A;  5A0Y A;  3N6N A;  1KLM A;  1YTY A;  1QDU B;  3AAW B;  4EWT A;  3LAN A;  4DQQ A;  1JKH A;  3MUT P;  3W2W A;  2JX2 A;  4V1A k;  4IH7 A;  5HVG A;  1Q16 B;  2XS2 A;  3H8Y A;  3UDV A;  1PO6 A;  5E33 A;  3H7H B;  4A4J A;  3KK2 B;  3TW0 A;  1PBU A;  2EPI A;  1T05 A;  4WP3 A;  3G87 A;  4DLG A;  2DR7 A;  2HBY B;  1Q78 A;  2WHO A;  1RWV B;  1P9Y A;  3DOK B;  4FF3 A;  3MCN A;  3IMQ J;  3RAX A;  2CZV C;  4KJI A;  1SL1 A;  4O4G A;  1R8C A;  1C1C B;  3GU0 A;  3TA2 A;  3RB0 A;  5LJ5 Y;  4H4M B;  4HTI A;  4I56 A;  1FE0 A;  1OMS A;  4MIW A;  3W61 A;  4ICL A;  4B9L A;  3TQE A;  3ETM A;  4IUF A; 
#chains in the Genus database with same CATH homology
 4M5G A;  4M5M A;  1EQM A;  4CYU B;  1EQ0 A;  3ILO A;  1KBR A;  1CBK A;  1RAO A;  3MCM A;  3ILL A;  1HKA A;  5ETS A;  2QX0 A;  3HSD A;  1IM6 A;  3KUH A;  5ETV A;  3UDV A;  5ETK A;  1TMM A;  4M5I A;  2CG8 A;  1G4C A;  3HSJ A;  5ETM A;  3QBC A;  3HSZ A;  2BMB A;  5ETT A;  5ETL A;  1EX8 A;  5ETN A;  4CRJ A;  3IP0 A;  3HD1 A;  4PZV A;  1RU2 A;  1RTZ A;  3MCN A;  4M5N A;  3KUG A;  5ETQ A;  4F7V A;  2F63 A;  1DY3 A;  3ILI A;  3MCO A;  3UDE A;  3UD5 A;  4AD6 A;  3HT0 A;  4M5H A;  1F9H A;  3HD2 A;  1RB0 A;  3HCX A;  1Q0N A;  2F65 A;  3ILJ A;  4M5J A;  4CWB A;  1RU1 A;  4M5L A;  4M5K A;  5ETO A;  5ETP A;  5ETR A;  3HSG A;  1TMJ A;  1HQ2 A;  4CYU A;  3KUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...