3KUHA

Crystal structure of e. coli hppk(h115a) in complex with ampcpp and hp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPAYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of residues E77 and H115 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3kuhA00
1EX8A 3ILJA 1IM6A 4CYUB 2QX0A 1F9HA 3HSGA 5ETPA 3HSZA 3QBCA 4M5JA 3HD1A 1CBKA 4AD6A 3ILOA 1TMMA 2F63A 4M5LA 3UDVA 2CG8A 2F65A 1Q0NA 4M5GA 3UDEA 5ETNA 1TMJA 5ETOA 4M5HA 1RB0A 4F7VA 3HT0A 3KUGA 1KBRA 4M5KA 4M5MA 1EQ0A 1HKAA 5ETTA 1RU2A 1RU1A 4M5IA 4M5NA 4CYUA 3MCOA 5ETQA 3ILIA 4PZVA 5ETMA 5ETSA 5ETKA 3UD5A 3KUEA 4CRJA 3MCNA 3KUHA 1DY3A 5ETRA 2BMBA 4CWBA 3HCXA 3HSDA 3HSJA 3MCMA 1RTZA 5ETLA 3IP0A 3ILLA 1RAOA 1HQ2A 1G4CA 1EQMA 5ETVA 3HD2A
chains in the Genus database with same CATH superfamily
3AODA 1RLCL 4JI3F 2UXCJ 2V5HG 1S9GB 3RU0A 2B4PA 3SXLA 3ZZUA 2CPIA 2OIHA 2Q66A 1NB7A 4UY85 3UPFA 4KE5A 3SCJE 1Y5IB 2DTJA 2ZVIA 4OHZA 3L7OA 4ANCA 3PJ9A 1TELA 1TMJA 3EXYA 2OFHX 4G1QA 1D3WA 3IBFB 1YJNS 2ROPA 1X4EA 5E3CA 1EARA 3SQGB 2HLUA 4M5DB 3EXCX 4Y2MA 4OHWA 3R5JB 1YGYA 3LP0B 2PE8A 2AYGA 2VPXB 5EHHA 2B9YA 3TZYA 3Q24A 4C4WA 2LFVA 3AY0A 3M8YA 4OI6A 2CNOB 3KDOA 1C0UA 5J1NA 4DCJB 3CCQS 1VQKS 4D3GA 2LU2A 5T7LA 3ZTRA 3ISZA 2K1RB 1U6FA 2Z58B 2MMYA 2C1EB 2H5EA 5KFAA 2ZH2A 1WC1A 4MMOA 2OMOA 2BJ8A 5HL7Q 2O5DA 4QIFA 1NCLA 3IRWP 3K5MA 1TL7A 1URRA 3QGPA 3O2IA 1JK9B 4J37A 3MURP 5GVQA 4I6AA 2ZBIA 4F2RA 2B43A 3G9CA 4AD6A 4ILLA 4NWBA 1VS3A 5K8NA 2IHR1 4CLUA 1CG2A 4LUBA 5A8WA 4U7UK 2BKNA 5ETOA 2BJEA 5T14A 4JI4J 1B0VA 1EHWA 2H3EB 2Z2MA 2GIQA 2HZCA 4NI2A 1RLDA 3JTNA 1YRXA 3CNQP 4WFNQ 3H59A 3BSNA 5HROA 2C3MA 1DJ0A 4RW7B 3ZTPA 1T05B 3QNWB 2X51A 2R7QA 3E3XA 4HLBA 4M8LA 2JEJA 1FWLA 1C0TA 3PXGa 4X84A 2O67A 4Z7CA 5F9LA 1U1NA 2BR0A 3MM8A 4RWWA 3C2PA 2GIFA 1PYTA 1T7PA 1RT2B 4PR6A 2V4RA 1F9HA 1JIHA 2HBZB 3DOMB 2ZZTA 1JJ4A 4WTOB 5F41A 3VF0B 3UDVA 3V5RA 1FDAA 2ZOGA 2EFVA 4B08A 4WTYA 4M5HA 4WF9Q 1UP1A 3NCRA 4I6WA 4K4TA 1DHMA 1N5QA 4IQMA 3QPIA 4JBCA 4CLFA 4OI1A 1HQEA 1PC5A 4LQ3A 1DLOA 4KHRA 2VQFJ 4YN3B 4X62F 1GXUA 1X0PA 3OHBA 1CEZA 4ZOSA 2XI3A 3HJVA 4B9VA 1MN9A 3HXMA 1N36F 3OTBA 1TL5A 3M4XA 1R89A 3PJXA 3TOQA 1T03B 4DR5F 1NKBA 1Q8LA 4FZVA 1JJ2R 2CYYA 1XWLA 3QO9B 4JYAJ 2VJUA 5J2MB 1VJQA 1TK0A 2Z0GA 4O23A 1J5EJ 2D9OA 1T9YA 4UOHA 1RGVA 1F9FA 1WC3A 2DHHA 2KT2A 4ATNA 5KG0A 1S72S 1JLQB 3NS5A 3FZ2A 5L8RC 2FLLA 1KOOA 3PO4A 1C0UB 4JV2A 1P8GA 4LMZA 1Q78A 2LQ5A 4LF2A 5D0GA 5CZXA 4JI2F 2HGNA 1RT4A 3QAEA 1V6HA 2J8AA 1MMNA 4I7FA 3ZO7A 3KHLA 3BQ0A 4YFUA 1FRMA 2CWXA 3LP0A 4X4VA 3DOLA 2XNRA 4AL5A 2HURA 3IR5B 1UKUA 4P73A 3KMQA 1SJQA 3LWLA 1JJCB 4AYBD 4YB6A 2J0SD 2V63A 1IKYA 2H51B 4CLLA 4NI2B 2KRRA 2OUGA 3CDAA 5IM0B 1RT7B 1NH8A 1A6LA 1RTIB 1EETB 1J2VA 2APOA 3LALA 4OI4A 4YR2A 3K57A 1V3RA 7AT1B 4CO2A 1SUQB 2CQ4A 4LF5J 3KK3A 2AZ1A 3UWTA 4KBIA 1VRTB 3EGNA 3ZNJ1 1PKUA 2UXBJ 2P2CB 4X4PA 3OUYA 4ZJOA 1TMMA 3JAMU 3UD3P 4D3HA 1S1TA 1SL1A 2HHHJ 2J0QD 3LOUA 4IG3A 2VG7B 4TNOA 1KWMA 4HVZA 3UN2A 4WKYA 2DR5A 4RUAA 4OJGA 2QLFB 5G0RA 4ECYA 2V8DA 3HHLB 1RU1A 1WC5A 3CMES 2VFUA 4KV8A 3A3PB 1CULB 1SC1B 1KQSR 4CRJA 3GONA 3MGJA 5EWGA 5ETRA 1LW0B 2D1CA 2GNKA 2RNEA 3O8WA 2UUBF 2VONA 4NRTA 1W7WA 3G82B 5DG7A 4IRDA 2DNNA 2E7VA 3NAHA 2GC8A 2KYXA 1TVRA 4L6V3 4ZVPB 4ECUA 2XS5A 4WZMA 2VQEF 2ACYA 4TQRA 2F3JA 3G96A 3KLVA 3RBDA 1RYRA 4ZLPA 1GX6A 3IS9A 3AFGA 1N33F 1TK5A 4JP8A 3BDPA 4I2QB 1KC8T 5KFMA 1CLFA 2V34A 2CADA 5J2QA 4LFBJ 4I0WA 4XDCA 5AXLA 5LSOA 1KEKA 1KD1T 3NBPA 1IR1A 3CJRA 4I2PB 4F4XA 3FQLA 1B70B 3TARA 2HNYB 1O0PA 1ULRA 4DR1F 4NEYA 4ECWA 2DPJA 5L46A 1VRTA 3CF5Q 1I51B 4J9NA 3EX7B 2BYCA 3ILIA 4ZLJA 1IR2A 1DBDA 2RHSB 4JUZA 1RBLA 2AJFE 1QD1A 3ZTOA 3ZTQA 4TQSA 2Z2ZA 3OLBA 1B7YB 5KOWA 2H5IB 3D1OA 4FXWA 2V8GA 4LBHA 4F36A 3TNVA 4PPZA 5DLGA 3C6TA 1TQLA 3WBZA 1U49A 3OLAA 1FJGJ 1UJ6A 2ABYA 2CPJA 1HYSA 2FUG9 4KFBB 4FBTA 2E1MC 3GCXP 1JNZB 2GZOA 3MTKA 3H40A 4XIUA 4WFBQ 1YDLA 1RXOB 3DRRB 4ES2A 2ZBCA 3GV7B 3T41A 2AJQA 1U1PA 5GAHU 1S76D 3MAQA 1S6OA 1VOMA 2EBGA 5HBMB 2CJYB 4MKBA 4DU8A 2V2KA 1Q16B 2NSBA 5HAOA 5ETSA 2MQOA 3V81A 2QLJB 1C1CA 4M1KA 4BS2A 2RF2A 3A8KA 3BSAA 4USWA 4OYOA 4USTA 2HBQB 2MZTA 2MPUA 1JLCA 1TVRB 2NCKL 4HI2A 1HBNA 3CCZA 4NEZA 3VGUA 3OSNA 2HZVA 2JEGA 2DHSA 2V67A 4HHUA 1FJ7A 2UU9F 1DQ9A 4A8FA 2B9XA 2VFVA 2YNFB 3R7BB 3MI7X 5A8KB 5CCMA 1RI7A 2KRBA 3B6BA 3OR2A 3SDEA 3G6VA 1FDDA 3I9ZA 5HLFB 2Y3YA 2XZDB 3HHLA 2N7CA 2FLPA 3UN3A 2DNKA 3AT1B 3I9V9 3R2CJ 4ES1A 2VG7A 4W4MA 1ZPWX 2FQQB 3SV4A 5HI7A 5KFYA 2M7SA 5F8JA 1TFWA 4QYZK 4HHHA 4DS5A 2C42A 4J9VA 3KLHB 2GQQA 3IO1A 4IFYB 5CH7B 2B5JB 1L3SA 2ZH9A 4OYZA 4ES3A 1HWJA 3OFFA 2MSSA 5BXIA 2ZH5A 3CCTA 3DRXA 3H8YA 3LQVA 3VAGA 4HTIA 5ETLA 2IA6A 4KAIA 3GZ7A 3MPUB 2EG2A 3ILLA 1GFWB 2GMJA 3OJSA 4ER8A 3D0HE 3W61A 2XGQA 1WF0A 1KFDA 1FK9B 3FCVA 4CO5A 1WI8A 1L3KA 2HVZA 5DDRC 1S4FA 4FYVB 1HNZJ 1PSDA 1XC9A 2MY7A 4CT9A 3POTA 3QLHB 2PFDA 3DKDA 3V2UC 2A6MA 3AOAA 3Q83A 4YR3A 4HL9A 1U6BA 1XIQA 4K4VA 4U95A 1FXDA 4ZVTB 2DR6A 3CJQA 2HVHA 3HVTA 3OFEA 2FJXA 2R2SA 3T5LA 1TL7B 5JUMA 4B3TF 1IKWA 5JJBA 1IKWB 3OW2R 2KN4A 3FFIB 4UOCA 2BV3A 4LF9F 1GQEA 3KNGA 5KFCA 3M6VA 3FBFA 1U0SA 4Y3CA 1X4GA 4OZLA 4LF5F 1N52B 2V0NA 1PBAA 3ENVA 2GFFA 1WEYA 3MM7A 4C8OA 2Z2YB 4YOEA 5BR8J 1S77D 3H2VE 3MUMP 3HHLC 3E2EA 2GX8A 3M9MB 3OR2B 5B0GA 3SDEB 5AE3A 3RB3A 5HLFA 2BE7D 2ZBPA 4L72B 4Y6IA 5DDQC 1TKXA 2FZGB 1TKTB 4YR0A 2A10A 3C15A 3BGRB 2JOQA 2B51A 1ACMB 1RAEB 2PIIA 1FK9A 4QZVB 3R1HA 4GVBB 5KFSA 3GIJA 1NJZA 2I1RA 3MR3A 3TEHB 1QSSA 1OQ3A 4K59A 4XAKA 5I4MA 3M6WA 1C1CB 4BC9A 4KHPF 2JHEA 4V19X 2WHOA 1MU2A 2NXCA 2HQDA 3N4WA 5HBMA 5KFUA 1GMWA 2EWHA 1GT8A 1OSDA 1U2FA 1ZPVA 4TVAB 1IWGA 5ETQA 3PW4A 3DU5A 2FD2A 2P8IA 4O44A 2PGCA 5KT2A 4O3SA 5LMNF 1FFWB 2EBEA 4J9UE 1HWKA 5KFHA 2FY1A 3N79A 2BW7A 4JI7F 3I5AA 1HLWA 5DQIA 3ILJA 1G1XA 4MT1A 3PYEA 2HSEB 4QR2A 1XJWB 3MZIA 1QY7A 3WC0A 5IT9Y 3CCES 4B3OB 2E66A 2R7VA 3IR6B 4OFZA 5ETPA 1Y9OA 1IXKA 1UW4A 4Y2IA 3QWPA 2PFFB 2QMXA 5HN0A 5BJRA 2FLOA 1FKPB 5CYMB 5DQHA 4OX7A 3VWSA 4G3IA 5B0FA 3H25A 4JV0A 1TL4A 4H54A 1S57A 3SSQA 2WTFA 3T1HJ 1U8WA 1VGYA 3ENWA 1TK8A 3MUTP 4X2BA 2HIYA 1BHNA 4LIWA 5CYQB 5A6WA 4RU9A 1RU2A 1LK7A 2CZVC 2ZD1A 3AB2B 4FYYB 2MGZB 3MEDB 4RWXA 4TYAA 3LP1B 4B3RJ 2DCUB 2RD5C 1RHKB 1ZAXA 3NBPB 2DNYA 3NS7B 2JNJA 1LWEB 2BX6A 4DPUA 4J9QA 3RTVA 2PT0A 1J5OA 2HYIB 5T7LB 3D6FB 3VQTA 4RW9B 1HR0J 2XMWA 2WBRA 3HD2A 2YKMA 2LQJA 1U24A 3PIOQ 4C8LA 1ICEB 4ZPWR 1WC0A 4I64A 4U6PA 1XN9A 2J0WA 2OMLA 1RQ0A 2LA4A 3GP9A 3MOZA 3I55S 1JNRB 1VQYA 4NLSA 2FHJA 5L1JA 3LPYA 2DGQA 2LQ8A 4JI8F 3WHIA 1M90T 3JQMA 2G1HA 4ED5A 3QGIA 4WKRA 3DRYA 3UDEA 1N48A 1D9FA 3G8QA 3W5YA 1OSCA 3E8OA 4NE9C 5HO4A 4LRDA 4ZP7A 3DFEA 3M6UA 2P9EA 4KV8B 5HMXA 2VOPA 5C24B 2OEJA 2A0FB 2YH1A 1I94J 1UTAA 5DDOC 4ED1A 1KVJA 3HLUA 2VD3A 1JQGA 2J0XA 1BQXA 4EGLA 3TEGA 3KLEB 4C8NA 3RBEA 3MAAB 4N41A 3CIMA 3CCJS 4DV5J 1U8SA 3ICLA 5GADI 1HMVB 4DPWA 2DIVA 4AQYJ 3LP2B 3OUYB 3BBBA 2HVEA 4K7QA 4USMA 1EQMA 2EW9A 2RVJA 3CJKA 4NXNF 2UUTA 1SC3B 2CNNB 4EU0A 5L1IA 4ZA1A 1LK5A 3BSOA 4OIXA 1WSVA 3T3FA 4HTJA 1HHSA 3M32B 1N54B 2DO0A 2H4WB 3ULHA 5D4LA 4Z2XA 4LSLB 4QWEA 2F7VA 2X1GA 1NPPA 2UV8G 1G3OA 4HDHA 4MYUA 3M1VA 1FDNA 2OD4A 3OSPA 2WW4A 4OYIA 2OEMA 3B82A 1XQIA 3P3DA 2QLBB 1SKWA 2KFNA 2RB7A 4OX6A 4PZVA 2W1BA 3GJRB 1U1KA 4NMLA 2YKQA 1E6VA 2KO1A 3RB6A 2D9PA 3PY8A 2YWKA 4YMEA 1RWWB 1HNZF 5K14B 1JKHB 1WKLA 2X3DA 2VQEJ 2A2CA 2EC2A 2DNRA 3EWGA 2RRAA 1KN6A 4KPYA 3I0RA 2ZD1B 3B54A 4Q2MA 3FKBA 4TY9A 2R8KA 3HVRA 4UW2A 3TAMA 1FDBA 2V8HA 2VFTA 1VC0A 4NLXA 1CPZA 2IJNA 3E01B 1H0HB 2E7WA 1HNWF 4LVNP 4AQYF 1RACB 3RB0A 2XZWA 1SC4B 2XI2A 4FKXA 3M9NB 2CZ4A 1FKAF 4RU2A 5GMKa 1FRXA 3H5YA 1YTYA 4Q7AA 3HSDA 3LA0A 1LQ9A 5F3ZA 3CD5A 2FJVA 1S79A 2IAJA 3N9UC 4KSEB 4O4GB 4PKDB 5F8LA 3UO0A 3M2RB 2KFYA 3MWBA 5KFDA 1VHFA 2CQIA 4RUCA 5J2MA 2VA2A 1LWFB 5I42A 4ANDA 1G2EA 2F5GA 4EWTA 4PWDB 4USKA 2AWZA 3D7SB 2CPHA 3MPYA 4HI1A 1NSKL 5HMYA 4X4UA 2OGUA 3TJ8A 2AT1B 3CJ3A 4PXCA 1Y10A 2V50A 3IWLA 4BWMA 1R8BA 2YNGA 2J9CA 3FVYA 1RWOB 4WYWA 4WCEQ 3QT8A 5T41A 1X4DA 1BY9A 2KVIA 2FJDB 4CIOA 1VJWA 1AZSA 2I6WA 2XMKA 3TAMB 2LA6A 3M8RA 1Q8IA 1Z2ZA 2B9EA 1XNQJ 2JEIA 1F60B 4UY8T 3AOCA 5HVGA 1N5YB 1WHVA 5SZTA 2UU9J 4DV0J 3NRBA 4EO8A 2VUGA 2WCXA 3PRVA 2MZSA 3RZAA 2XSJA 4J9OA 1B0PA 3DLKB 4L75A 3T6JA 1S1UA 4DOZA 2D3UA 2L08A 3ZXWA 4EBCA 4PUOA 2XS2A 4X4NA 2DNZA 1X9SA 2R7XA 4LR7A 1R6YA 2FGCA 5L9XA 4CO0A 2P9CA 3LWMA 4DR3J 1R6VA 4OZ5A 2ZVSA 2JSXA 2UUCJ 1TUGB 3PR4A 1UWAA 1YRTA 1VBYA 2MKCA 3POTB 3JB9k 2HHTA 2E5IA 2CPYA 1ELOA 2MDAA 3KXDA 1FCAA 4K4YA 2FVPA 1H2TZ 1VQ5S 2QGFB 3HM9A 1HR0F 3KUEA 2BMBA 1F9EB 3DN9A 3E01A 2BZ2A 4PXDA 2QFIA 3KNAA 4OZ3A 1XR5A 1GK8A 2XMTA 3I96A 4NZ7A 3TX0A 4C2MA 2JLFA 3M30A 2MJNA 4Q45A 4AXJA 1ZETA 5KG1A 3CXCR 1IN0A 1HW9A 3IBWA 2QFJA 5DM6Q 1PGZA 4NL5A 4E98A 3I0RB 4N8OA 3TI0A 1NHUA 2OPPB 4FPIA 4PYAA 4F0MA 1QE1A 4R5PA 4J9MA 3FC9A 1PYOB 4DDFA 2W4CA 1N33J 3MAAA 1NZAA 4KHPJ 4QIVA 2AMCB 1DURA 3UR0A 2MYFA 4GKKF 2B6AA 2SXLA 2W01A 1KHVA 3EMTA 1O5JA 2V2QA 4OYXA 5E3AA 1V3ZA 1W2BR 2UZAA 2PA3A 4RKUC 4WFZA 4ECZA 1TAUA 4LF9J 2ZFHA 2DNPA 1RT1B 2CJQA 4ELUA 2MZ1A 4DV3F 5BR8F 1NK9A 4DFPA 4WIIA 1AB8A 4QIGA 1NO8A 3FRZA 3GB0A 1LW2B 4OI2A 4PXBA 4FNIA 4IOCQ 1N36J 1TV6A 2HIQA 1R8PA 5D78A 4EFAC 5B7WA 1H74A 4DQIA 2CPZA 2DJWA 2HNDB 1FEHA 5IT4A 3MUVP 1IKVB 1VR6A 1HW8A 2R7SA 3DYAA 3DLEA 1P9QC 1FWKA 2CQ3A 3SSRA 1FXLA 2DPIA 5KG5A 4DBQA 3FGVA 2LQBA 3K2YA 2DR9A 4B9LA 1JLEA 3W9IA 1FA0A 2B9WA 4LBPA 3DDKA 3N6MA 1YLXA 5CYQA 4MTPA 2QA4S 1UVKA 4JI2J 5KFZA 2NS1B 3K58A 3JSMA 3DHWC 2ZHAA 1VC6A 1PJ6A 3ISND 5KFKA 4MH8A 4B9UA 2IMOA 5CYMA 2OPQA 3L7UA 3DRPA 3QAUA 1RTZA 2VFSA 4TLRA 5LXRA 3UD4P 4GMKA 4U7CA 4DV7F 2ZKTA 2XG8A 3ENQA 1SV5B 4I56A 4P2MA 5F0WA 3ZC4A 5KG7A 4A8WA 3MR7A 4NCAA 2BJ3A 4ZPCA 4ZN1A 3GCWP 2DH7A 4PWUA 2GV1A 4Y00A 3CGIA 4E0DA 3MEGA 1Q7YT 5HQMA 3ZZ0A 4QPXA 2ZE2A 3TR5A 5FDLB 2Y1LB 5J1EA 1MWQA 1X0FA 4DR7J 1U1OA 4RW9A 4ZN3A 3DYAB 1WG5A 1FNXH 2QA2A 1VFJA 5A6PA 2UXDF 1J5OB 4P74A 1WC4A 3DM2B 4KH1B 1NDPA 1YJVA 1U1RA 1TV6B 3M8PB 1KDNA 4ZVHA 4RW4A 1ZM4A 4NLOA 2FHMA 3FEZA 5B09A 4DFMA 1L3VA 1F5CA 3P8BB 1T94A 1LFPA 2YNHB 5K8MA 1MROA 3BKTA 3G82A 5LSRA 3Q2SC 2G2YA 2PMHA 4LJMA 2HRYA 1S97A 4Z7YA 2KI2A 2ZOMA 1LNQA 2LLZA 1C4AA 4FF4A 1X8DA 2FYXA 4O3NA 1Q4RA 3NL0A 2RU3A 5G0RB 2B6AB 3OJUA 2HZAA 1UVLA 1FO1A 1SIWB 2ZE2B 3PJWA 2IBOA 2E5JA 4LF1A 1N32F 4ILRA 3LUYA 1NK5A 5DETA 4DCOB 3BKUA 3DI6B 1KBRA 1UWBB 3FUYA 1MWZA 2G9OA 3GR1A 5B0DA 1M5HA 2CQCA 1F1BB 1NK4A 2DGTA 4EI2A 1TL1A 1MW7A 5AXMA 1RTIA 1U48A 3BR8A 3MHYA 4NLWA 3VCDA 1C1BA 2DO4A 5H1SV 1WORA 2C22A 4UZBA 3HO1A 3JSMB 2W9CA 1XK8A 1NHKL 3M8WA 3BO2A 4LIRA 5KT5A 4UZCA 3X3UA 3VAIA 2IM3A 4MKVA 3OTOJ 4I68A 1TKXB 2VASA 3GJSB 4NYPA 2E7XA 3OTEA 4KKOA 2DNMA 3I31A 4NASA 4LSZB 2MQQA 3DLEB 5KG3A 4ZLNA 5KFOA 3SIPB 3DLGB 1VC5A 4IRCA 1KQKA 2AEJA 2JRSA 3H42A 5L39A 4KQZA 3BQ1A 2DR8A 2QA4G 4ZCIA 2ZNYA 3W8PA 2ZH8A 2HFSA 1WOSA 2GAHC 3BN4A 1SH0A 3PM9A 4QR1A 5ETMA 4FXDA 2WRMA 3SQOP 1R43A 3AD9C 4ECTA 4DQPA 3VAMA 4UF4A 2BKPA 1VRUB 4DV5F 2PEHA 1YVFA 2R7OA 1YJ9S 2G1DA 2LECA 4ID8A 4WE1B 3R3TA 4YHHF 4PPDA 3KMSA 1A9NB 3ZFVA 2LDIA 1NJYA 3BR9A 3KG1A 4B9TA 1GTEA 1A7GE 2R7RA 3BKFA 3THTA 2DXFA 1MNEA 5A8KA 3UCZP 1L3TA 4XK8C 1O8BA 2HHHF 1HQEB 1VLYA 4P7TA 4EBDA 3DU6A 3PCOB 2IVYA 3ET6A 2DR7A 2L9NA 4PAAA 3R7NB 1X9WA 3BYPA 3C8YA 3BGFA 4QIEA 3MM9A 2XZTB 2X1AA 4RBVA 3OXFA 2BRLA 4OZJA 3IA0A 1RHRB 2W9BA 3C16B 1GMWD 2EK6A 4H4MA 4IFYA 3R27A 4USUA 1Z2LA 4O3OA 5K8OA 3HT3A 1TUWA 1N5VA 2HHPA 4P72A 3TP2A 1L3UA 1RK8A 4YP3A 4ECXA 3QATA 4KFBA 4PG7A 1NK8A 3SEOA 2O01C 3HI9A 1R0CB 3P5BP 4DR2J 4NCGA 3UE2A 3J7A1 1X5PA 4B3SF 3M8SA 1JLBB 1QVGR 1IBKJ 2KVQE 4ECRA 3AH6A 4Q0BA 3CDEA 3VHQA 2B3TB 2LEAA 3CSKA 1YJ7A 3X1LB 1CSJA 1KRPA 3EICA 3EVMA 3EYZA 1BWVA 4A4JA 3KK2A 1EAYC 4HDGA 1HBNB 1S1XB 2V8PA 1XMQJ 1FEEA 1R7IA 4P71A 3O5TB 4CTAB 4E8UA 1VIXA 1BQNA 3NCQA 1HKAA 1YBTA 1I1GA 4BDPA 4RNHA 4OV1A 2E9ZA 1OIAA 1WF1A 2ZH3A 5IV4A 1P6TA 1ZA1B 3FK4A 4FPRA 2IJRA 1JKHA 1RA6A 2WVDA 9ATCB 3L3CA 3PX0A 4B9MA 1FX4A 1TKZA 6AT1B 1SQFA 5EN1A 5KG2A 2GQCA 5DZ6A 1ZM9A 1TKDA 1IJEB 3NLCA 4PABA 2M4MA 2DNHA 3CJTA 2ZDOA 3HSGA 4G1IA 2GHVC 3EE3A 4RO0A 2XY5A 2J6UA 1B4SA 3NGUA 4DL0C 1UFLA 2N4CA 3PVXA 1KLMB 2PI5A 5ITHA 1OPZA 2CNKB 5G4DA 3K0JA 5CZVA 2V94A 1IR0A 1CULA 3NGTA 2NXNA 5D4OA 5KFWA 1KR4A 3Q8RB 1PO6A 1B3TA 2RHQB 4DV2J 4MKYA 4DSJA 1RAGB 2Z2LA 3IFEA 2B7BB 2GVZB 4RR5A 1DY3A 1WELA 4QU6A 2D3ZA 4IO9Q 4MIAA 4IO1A 3H4DA 4WXOA 1NM2A 3MMAA 4GRSA 2EXUA 1U47A 3D28A 1EX8A 1TZ0A 5J2QB 4LFCJ 3HHNB 2MQLA 2NPFA 3QJJA 2NYIA 4UQGA 2D3O1 1VQLS 4CLKA 1TAQA 3CT9A 4WXWA 1EKRA 1R31A 1VYAA 2D74B 4WK3A 5IQQA 4DPTA 3EZ5A 3EPGA 1SCJB 3QIPA 2AEFA 3FNNA 3M2VB 4ICLB 4FXVA 3CD0A 3DOLB 2WAQD 4ZPDA 1OS5A 4J9PA 2MZRA 2PMZD 1YK9A 3W65A 2BE9B 2RKIA 4Y2CA 2CQGA 2HMIB 5GAEI 3F73A 3OVSA 1HPZB 1VBXA 4KJIA 1EZZB 4OI0A 1S5ZA 5KFXA 2UVVA 1SJ4P 2M8DB 3PO5A 2XNQA 1ZAVA 1HI1A 2EVZA 1S7HA 3LANA 1S1TB 3QT5A 2J7KA 4KC5A 5DRKA 3J7ZT 3VR1A 2RKIB 1N4LA 3KHGA 4WP8A 1UZDA 1N5TA 2MGZA 1RHQB 2WONA 3D0GE 3HSZA 4S0MA 2WVBA 3AOBA 1GX5A 1SH3A 3BREA 4CH7A 3TVYA 2U1AA 3W64A 4X64J 1NJIT 1NLKL 2NLWA 8AT1B 5D77A 1YRUA 5ETNA 1HNVA 1SL2A 4F8RA 5JVGQ 4WPAA 1HWIA 1K8AT 5HQ8A 2F8MA 3BJYA 2VC0A 5IM0A 2PO4A 3IGVA 2UVUA 2XB2D 1EQ0A 4L3KA 4JI1J 2XY6A 2RUGA 3CPWR 2E5HA 3GE9A 3M6XA 4NLTA 4I67A 2OLWA 2XC9A 3VQSA 2R2RA 4AT1B 4Y28C 2R42A 5I3QA 4ALZA 2NZ4A 1W25A 3G87A 1WHXA 1RAOA 3GR0A 4J9RA 4DV7J 5CHCB 4DR6F 2DK2A 3UI3A 4OX8A 3BH6B 1RP5A 1Y5NB 2MLZA 3A13A 3JS9A 2KG0A 3EZUA 4N7TA 3AB4B 4DUZF 2UUAF 4Q5VA 1BGXT 2V4JA 3QQCD 7FDRA 3GIMA 1T9TA 2Y0BB 3QO9A 2LXFA 1HNXF 1RTJA 3JSBA 3MM9B 1KTVA 2QLWA 3KFWX 3D9BA 3NMRA 4CLPA 1WUUA 2HGMA 3AA8A 4LFAJ 1NU4A 2GCFA 1FVQA 2HQIA 2DH8A 1S48A 2JH3A 3FCHA 4M5IA 1D09B 2EFQA 4HT5A 4YDDB 4RL1A 1S1WA 1MN7A 2QV6A 1S6QA 1HIYA 2YKMB 3A8EA 1FD8A 1FRIA 1N0VC 2QSWA 3QFHA 4G6VB 4CI0B 3EJMA 4EUVA 1EIYB 1B7FA 3U1LA 4X66J 4CT8A 3ZZYA 5HMZA 2PA8D 3K89A 2R7UA 3KJFB 4X4TA 2U2FA 2C2RA 3CC7S 1FFSB 1YQHA 5ETVA 1TU0B 2XO6A 2O66A 6FDRA 4JI3J 4LQ9A 2Y8YA 3RUBL 3CDWA 2DGOA 2DXEA 1VQ8S 3CDBA 2HAIA 5I3PA 3UVJA 3D66A 5AXNA 2BOPA 2P9GA 3KK2B 3GMGA 1FESA 2AQ4A 2KFZA 2RE1A 2RQ4A 3VTIA 2HBYB 3DLGA 3A8IA 3UR3C 5DS7A 2YNIB 4DEZA 4GC6A 4B3MF 1JXVA 1RWKB 2B8PA 2UXDJ 4WU3A 3RR8A 1FI4A 1RYSA 5DZ7A 3D6HB 5HROB 4P10A 2KM8B 3M9OB 1YG0A 2CQBA 4OYBA 1O6XA 4KHMA 4YUDA 1Q5YA 1SKRA 2A2DA 3QRRA 1H2UX 1V5IB 2W9CB 4GKJF 2F8HA 1OYEA 5EGYA 3HP6A 5E33A 1CJTA 1VBKA 3NWRA 3N6NA 4MIWA 1UAWA 2EI5A 3KJVB 4DUZJ 1MMLA 4TLQA 2H65B 3MFHA 1H3DA 3BV8A 4AE5A 4AUKA 2HVDA 4X65F 4DFJA 4IRKA 5M2UA 3C16A 1IM6A 4CO4A 2V8VA 4P2XA 1C2PA 5IS2A 3LH2S 3LPEA 1MU2B 5EX0A 2BQRA 1VK8A 1QVFR 1QM9A 2FZKB 4F02A 2FVRA 3QYYA 4Y2AA 1NHVA 5HSPA 4A8MP 3CDUA 3QZ8A 2HFUA 3TJ9A 3ET6B 1NK6A 4FVMA 3OPKA 2W7AA 3KUGA 3N01A 3T1AA 1TKTA 4IG0B 4OQJA 3JSRA 5A0YB 2O1PA 2ASYA 4OJHA 2KHDA 5L38A 2ZITA 1IBMF 3EVOA 3VALA 3FSIA 4XDDA 3SCLE 2JEFA 4LFCF 3M8QA 4BLGA 2W2NP 1LKZA 2IM2A 4P7VA 3SI8A 1U1MA 4AXIA 1Q5VA 3CWJA 2QA1A 3GV8B 3CJ4A 4P2FA 2F4VF 3HHLD 4DQSA 4OLPA 4L76A 4RW6A 1GH8A 3G4SS 4J90A 3V81B 1NK7A 1R8AA 4IDKA 3TANA 5IOLA 2IM1A 3G71S 1KSPA 2V69A 3DM2A 3TA0A 5E0OA 1RHJB 3HK2A 2V6AA 1NKCA 4PQUB 3HZEA 5BYRA 2C3OA 5CA5A 3D2WA 1XNRJ 4RJVA 3TVKA 2YX7A 3KJVA 2HS4A 2DIUA 1GMVA 5A2QU 3L7PA 5HMWA 1U26A 2WK4A 4L3NA 3P5TL 4K2XA 3G6ES 3SSSA 3T9NA 4CYUA 2BXJA 4AL7A 2AJ0A 2ZUAA 2Q79A 5ADZA 1HWLA 2QRRA 3D0IE 3EGWB 8ATCB 5LJ3Y 3DHXA 4X4QA 2CNLB 1HHQA 5LMNJ 3TA1A 1ZTTA 3C6UA 1UL3A 3MR2A 3AJ1A 2AJ2A 2ZH4A 3GSIA 1UEKA 1PBUA 2CAJA 2EK1A 4NRUA 5H9EJ 2OKQA 4URSA 5E41A 4X62J 5D8HB 2G2OA 2N3OA 4K50A 4CLSA 4QW8A 3FBEA 5KFPA 3US5A 1U2RA 3BPDA 2FIUA 2IC3B 3EDQB 3QJLA 3ISNC 4B9NA 5AJ3F 3DMJA 4U8VA 2AGPA 4M5JA 3CJ0A 2Y1RI 2X7IA 3MMBB 3W66A 2J6TA 3C46A 4ETZA 1GAOA 2YPYA 1EKSA 5F9NA 1S4EA 1HL6A 3LF0A 4DV1J 1QAYA 2GGPA 3KWMA 4AL6A 2VPZB 3CO9A 3N6LA 4NLVA 4TXSA 1X4AA 1RT3A 2CZ9A 2ZJPQ 4ECQA 3CJ5A 3H5SA 1ZOTA 3IS9B 2DNGA 5D4PA 3W60A 1SIZA 1AUSL 1HWUA 2A18A 3NS6A 4DZ6A 1D1UA 3TQEA 5EWEA 1MLAA 2HQ3A 2QSFA 2DISA 3A8JA 3G86A 4QQBA 3W2WA 4URGA 4X4SA 3U02A 5KTQA 3PW5A 1WEZA 3UN5A 2YH0A 3GILA 2DY9A 4EEYA 1LW0A 3N0VA 3OTDA 2YBVA 3C14A 4IKAA 2E1CA 4LR9A 3M2UB 2MQNA 2N3LA 2R9LA 5D0RA 3V6KA 4MK8A 1MWYA 1FKOB 2B0GA 4JI4F 1S99A 1WOPA 2YKPA 2UP1A 2MQ8A 3FZBA 3VZHA 4ZDNA 2IFXA 2J8SA 4ZPAA 2RDDA 3KG0A 1FNMA 4DSIA 1U09A 3VAKA 4DUYF 1VHIA 1LXNA 1WHWA 3B8HA 3NGRA 1Q86T 3D3BJ 2WVFA 4N8NA 1VQ9S 3CULA 2YKAA 2QJ3A 5F8NA 5F3TA 2OTLS 3D67A 1WWHA 3ENAA 3PTWA 1BMQB 5C2CA 1X9MA 1NEEA 2FDNA 2VBXA 2DEJA 4ZPBA 2XYGB 3SFUA 4BHQA 4QW9A 2K3KA 2R8HA 1IKYB 4NXNJ 1DTTA 2RJZA 1FVSA 5DGBA 4CCHA 2DD8S 4EYHB 4CLYA 4PRFA 1N88A 2Y0SD 5HVHA 2R2UA 1WDTA 2ZHOA 2CJBA 3TUIC 2QEXS 2HNYA 4DX7A 3HD1A 4U67Q 1JLGB 1LEOA 1MMDA 2JFKA 4FBUA 1I94F 4ZHRB 1FJEB 2OHDA 2ZJQQ 2E5LJ 2GVZA 2JZ5A 2M88A 1VI7A 3TW0A 2FHOB 1NNDA 2CQHA 4LR8A 2VBYA 5BYSA 3T9ZA 4F50A 1RSCA 3BDEA 2OI2A 2OPRB 2WSFC 3ADAC 2XMAA 2ILYA 1Q82T 2KXHA 3A1YG 5DM7Q 3PEJA 3V4IA 1BWEA 1HARA 1HBUA 2VL1A 3HFZB 1YWXA 1S9EB 2WOMB 2DNQA 2CJXB 4N56A 3S1TA 3BZQA 3IM8A 5HK4A 4BC7A 4ZLLA 2XLIA 2MHEA 5IFMA 4A47A 3RAXA 4FF3A 4W98A 1W26A 2Z30B 4ZPVR 1R0AB 2ZH7A 2D3OR 2IY5B 3FMWA 5C42B 3NMAA 4F25A 1FERA 1DLOB 1Z4UA 1BLUA 1W2IA 4RBUA 3V4MA 1YIJS 1JLFA 4NA1A 2I8EA 2HAFA 4LVOP 1HNXJ 3GFYA 3ZZTA 2M0GB 1BXNA 3W5XA 1P1TA 1I5OB 4Y2KA 3R1LA 1QAIA 2W8KA 3Q0AA 2NREA 1TP7A 3PX6A 4A48A 4HH1A 2ADCA 4M5KA 1HD1A 2VF3A 2AP6A 2EFOA 2W4DA 3AA9A 4KGXB 4C3LA 5GAEU 5IV3A 4XPCA 3G2XA 4B3RF 2B4UA 4CH1A 1CJUA 4KGZB 3MAHA 2BANB 2UV8A 4ID5B 1UETA 2IAJB 4USIA 1ROFA 5DG8A 4C7QA 1S1VA 1ZZNA 2UVWA 2BQUA 3SBMA 3KLFA 1ITPA 3DGPA 5LM7E 2R4FA 1HQ2A 1DARA 2VG5A 3LW5C 3MCMA 2OJ3A 1KLMA 4JI7J 2GO8A 3JQJA 2KHCA 4OHYA 3OTCA 1DAXA 3EDRB 2AU0A 1Q1KA 1HNIB 1NSPA 2DHXA 4BCAA 2Z8QA 5J2NA 1XNRF 1FRJA 3CE8A 2YXLA 2VG5B 3GG0A 4J9LA 1RT4B 3R5DA 4DX8H 1ZTWA 2YKNB 2E5LF 4JI8J 1CJKA 2MXYA 1S1VB 3KK1A 2CG8A 1RBAA 3I4PA 1ZA2B 1RTHA 4XO0A 1EP4B 1XERA 4PG5A 1GMUA 3BN7A 1B64A 4JOUA 4X4OA 4IH7A 3PFEA 1RAIB 5C25B 3BM7A 1FE0A 3ITHB 3O6QA 3H2LA 2HHXA 3BS9A 4YY3J 2AX0A 2BACA 4XTTA 2K06A 3TO8A 5C7PA 4UT4A 2V4QA 1R27B 4J9SA 3V6DB 1WOOA 3LO3A 4NMXA 3CCMS 5C5JA 2VDIA 3ITHA 4RW8B 1WC6A 4QU7A 5FJ4A 3WQPA 4OHXA 4ZP6A 3KLGA 1XTZA 3FDSA 1D9AA 3DOKA 1AA1B 4UUXA 4FYDA 4NA2A 4JV5F 3W9HA 2EEYA 2YKNA 2QX0A 3PR5B 1WTFA 2MKYA 4NZ6A 1N56A 1IVZA 3SYZA 2C3YA 3G6XA 2MLXA 3RAMA 5GMEA 2YY3A 4NCGB 1WJ9A 1LV5A 3HZGA 2XHCA 3DGPB 2DB1A 1RISA 1Q79A 2CDRB 4YDXA 4ZP8A 4JB8B 4LT6A 5F8IA 3KLFB 3T1HF 3FEYB 3M32A 2RIJA 1RT6B 4FS1A 4J5OA 3JTOA 1S0VA 3KTQA 1B0TA 1Y4ZB 3MM6B 3QGHA 2W9BB 4WFYA 5AT1B 4RNNA 2AIRB 2LXIA 2PMWA 3K5OA 5E7OB 1PJ5A 1FF2A 4A8QA 4KKOB 1H38A 1BQMA 3PYFA 1NBEB 2VDHA 4O3QA 2ALZA 1NK0A 2LDYA 4WJBA 2GHWA 4C11A 2YWFA 3K8WA 5KT4A 3BH7B 4USJC 3GFXA 2OTJS 2CG4A 2RMLA 3OT9A 1U4BA 2LEBA 1QLNA 2DT9A 4CH0S 1C1BB 2DEIA 1TUVA 3O44A 5C24A 2KXNB 4DQQA 1AUDA 2DGXA 4NXMF 2ZH6A 1OYDA 5A8WB 3OVBA 5E3PA 4M5GA 4YY3F 2L48A 4GKKJ 2O3DA 5HP1A 4BWJA 3GLJA 2K7JA 1UMJA 2PEBA 3VAJA 2ERRA 1GXLA 4QYRA 2C2ZB 4DS4A 4GKJJ 5IC4B 4MFBA 5CABA 4F26A 4NLDA 3BPSP 2LP4A 1H72C 2QLXA 2VQFF 1AT1B 4HR2A 3C3LA 2CQ0A 3H0PA 1NKEA 4MKAA 1HPZA 2IIHA 4ZVFA 3S01A 3NGDA 4DV4J 2HHVA 1JLAB 1S6UA 3M2UA 3UCUP 1GXTA 3PYGA 2GMHA 2CPXA 1NXIA 2G2ZA 3M1VB 2GJ2A 1M5SA 3FBCA 5FIIA 4ZCKA 1NSAA 5HP1B 2AKWB 4ETXA 5L1LA 1UA1A 4G1QB 4YEAA 4LSLA 3HKWA 4YB1P 3T6BA 1IBKF 2JX2A 2HRUA 5LMUJ 1RWXB 2BKOA 1OO0B 2MEWA 2YKOA 3A4TA 4C3KA 3DLLQ 1P9YA 2GQ2A 1VIOA 2Q43A 1SXLA 1YX2A 1P27B 3FRYA 4H4KC 2HPUA 2IM0A 3MDFA 1SBRA 1DQAA 4RUHA 1KVIA 4DN9A 4IUFA 2AEMA 5B0CA 1IQTA 1Y00A 2IDEA 3H98A 3RGIA 3VVUA 3KLEA 1UJ5A 1YBUA 4NOHA 4O0NA 1NZ8A 1TL3A 3AQPA 2B4VA 2I5JB 3I32A 3TYTA 3W63A 3QZ7A 4DL2A 2OPSB 2FC9A 1WKJA 2HFOA 2ZKUA 3HHEA 3NOGA 4NX9A 5CQGA 5KFIA 2ZDPA 5AJ3J 2R2TA 1D8YA 4OMFG 3C14B 2OPQB 2VHGA 1T0TV 5DO2A 1RUSA 1CVJA 3ONQA 4B3TJ 3J7YI 1KP6A 2FTRA 3IMQJ 4KGMA 4UOFA 1KQFB 4DFKA 1M1HA 2JC1A 2I0XA 4DF4A 4IQXA 3OVAA 3QRPA 2K7KA 3IAM9 3BGRA 2IA0A 4BBYA 1SKSA 4I69A 2QO3A 1K0VA 3MF5A 3F56A 1SB6A 2HWIA 2KYZA 3FMBA 5A2QY 4RPFA 2PN6A 4ED2A 4P75A 3CJSA 2L3MA 3IP0A 1XR7A 5A8RA 5FDLA 1QUPA 1LW2A 4LFBF 2HQFA 4RW6B 4A8XA 3DMJB 2E1RA 4F04B 2FY8A 1RAFB 3K17A 2HQCA 2IRYA 2CQDA 5C25A 4LF7J 3HVTB 5KFFA 3P6YC 3DLHA 1HQUA 3CIZA 3HFVA 2NZCA 4Q2LA 1LOUA 3CCSS 1IBLF 2AYBA 4OJ1A 4DR4J 1N32J 4GO5X 1PC4A 4MAKA 5J2PB 2JDJA 2PC6A 2VKRA 4M63A 1NUEA 4ZVUB 3W1YC 1AXQA 3MEEA 2KT3A 1AROP 2G0IA 4R0JA 4TN2A 3NKYA 4DJBA 5LT5A 3QJPA 4C8YA 4B3OA 4M5NA 3MECB 4F3OA 5KFEA 1FFGB 2AGOA 2BQ3A 2I2YA 1OMSA 2IBKA 2DITA 3EVWA 3R5CA 5E3RA 4RZRA 2VU5A 2BJ1A 1YBAA 1EB0A 5KG4A 3CJ2A 1HBOA 4P6QA 5DDPC 4FS2A 2DKOB 3IG1B 4PQUA 2L9WA 1U7LA 5D3GA 2M9KA 2GVDB 5K5MA 2Y1IA 3I4HX 2P6TA 1X4CA 2QTWA 2M3DA 4IH5A 4DG1B 1BUXA 4IDKB 4DZDA 1OY8A 1RT6A 1V3SA 3GV5B 1SL0A 4QPTA 4CO3A 2ADBA 4N47A 4B3SJ 4URQU 3KDNA 1C4CA 1YKWA 3TAQA 1NPRA 5J1PA 2XMUA 1RA7A 4CLTA 1JMTA 1R3NA 2MY8A 1VK3A 2F8EX 5AXKA 2J6SA 3CD7A 1UVNA 4USHA 4IOAQ 3TAPA 3A3OB 1KHWA 2GW8A 4KGVB 2V9KA 2W2MP 3MCSA 3WIVA 2IJFA 3GJQB 5CYJA 1FJCA 2DYAA 3M7VA 1VLOA 5DG9A 3CMQA 3H90A 2L41A 1RWNB 1S6PB 2JVOA 2M5YA 4HT7A 4JV1A 1Q8BA 3AXKA 3QT6A 5THWA 1N8RT 1URNA 2WBMA 3KOAA 2D41A 3PKMA 2E1AA 3CO0P 4DR2F 4DL4A 4IR1A 2DRDA 1QE1B 3BBCA 4R5PB 2CKWA 1JJHA 2OPRA 2WSCC 2XCPA 3HDSA 1RHUB 5CXTA 1ZS6A 1VQPS 1SI9A 1UPMB 2NXJA 3ZNUA 1F2GA 3LAMA 4M5LA 5D3GB 3CC4S 2HK3A 2BDPA 2DRBA 1RTHB 2DBBA 1HBOB 1RJJA 1JLGA 3GYNA 2K8GA 3BSCA 1HA1A 2HNZB 1CJKB 3KK1B 2IPOB 1ZAWA 1X4HA 5CAAA 2FJEB 5GAGI 2Q3PA 1YI2S 1FWPA 3QT7A 1S0OA 4OX9J 2YPZA 5ETKA 1LWCB 4KIAA 1HBMB 3DXSX 2JFDA 2XWXA 5C2GA 4ED4A 2FGOA 3BO3A 3FSYA 4GO7X 2EKYA 3THPA 1RTDA 4WZQA 1S59A 1J5EF 2XHWA 2ATCB 2GO9A 4CZCA 1FHTA 2KZZA 4IFVB 1DRZA 3KHRA 4DV3J 3SZ2A 4DXLA 3MTJA 5LSLA 3TZZA 1CJUB 1QTMA 3L95X 1X5OA 2M70A 3CEDA 2MJUA 2RSQA 5CCLA 1S1UB 3ETMA 3I5BA 2RQMA 1IUJA 2XMJA 3F44A 3JXOA 4I2PA 4EZ9A 4J7CA 4DI6A 1PAEX 3KLIA 4OX9F 4LF6J 1RT5A 1ZM2A 1K44A 2JC0A 1FKOA 3O1LA 1AZSB 3TRGA 4H4KA 2OH2A 1FRLA 4C8KA 1KS2A 2VA3A 4DL3A 4B02A 4W92B 5C42A 4C8ZA 1Q8KA 2VB6A 5L1KA 4DF8A 1FD2A 2WSEC 2ZBRA 1YJWS 2OP5A 4G65A 2GJFA 3R6LB 2HHSA 2MKSA 3NXZA 1PCAA 4ENOA 4ZIWA 1RCOB 4DR5J 2RF2B 2M8HA 2KDOA 2W4PA 4DV0F 2ZUGA 3HULA 1JXLA 4JV5J 1N6QB 1TR0A 2RUSA 3R9LA 3Q8VA 4X64F 2B4OA 4DL7A 2AV5A 1LFWA 2VG6B 2VV5A 2RRNA 4MYTA 2CQPA 3Q89A 3PACA 1E6VB 2BRKA 3AJ2A 3N5FA 4OV6A 1N34F 2XULA 3DCAA 3DRSA 4IG3B 4ZHRA 3NP5A 1RAJA 3MMBA 3P45B 3D1HA 1PG5B 2YQ3A 3K59A 2C28A 1JX4A 4ZVOB 1KVKA 2GS8A 2ILZA 4LBIA 4CLWA 1GEHA 1VQSA 4O0IA 3Q8PB 2XQCA 4B9SA 4JI0J 4LF8J 3PG9A 3KK3B 1SQGA 1DTQB 2XWYA 3A3NB 3CVKA 3L9ZA 4DLEA 3ZZPA 3KYLA 2FVSA 4CM0A 2FHKA 4FKYA 4ZVQB 3RRHA 2G13A 4OYMA 2FJWA 2HHQA 3SMZA 3QGGA 4CYUB 5KFGA 5H9EK 2WONB 2MSTA 2RAQA 2HW3A 5I3UB 2B8QA 1BQMB 4ZVSB 4F67A 3S7RA 2CVIA 1KTQA 4PG4A 2AD9A 4KRWA 2Z4PA 2J9EA 2EFPA 2V68A 2ZWOA 1T3OA 3R5AA 2M52A 4A8OA 3BO4A 2QE5A 3MM6A 4I2QA 2DGSA 4O3RA 1KNZA 3R2DJ 3OQ2A 1VQNS 4AFFA 4X66F 2VG6A 3E51A 4F4ZA 3WC2A 1Y11A 1UEVA 4FF1A 4E2FB 3OR1A 4C8MA 3MM5B 1BD6A 4ZCMA 3TUZC 3HCXA 3AD8C 2QC3A 3G8TA 3P4UB 5GMDA 3J80U 3T5HA 5A76A 3OFHA 3R5BA 5FLXY 3QBCA 1S7IA 3GTYX 4OZ2A 1WACA 2YWHA 3J80Y 3HPOA 3IN5A 1PIEA 4DSEA 2QT7A 1UVJA 1DFDA 1KLNA 1T8EA 5DJBA 1NJWA 3DOKB 4UOGA 3Q23A 2HQGA 2Q1LA 3LTOA 1UFKA 3QFWA 2X1FA 5KFJA 2L9DA 3MR5A 2E5GA 2BM1A 2QZ8A 3IRXB 4QWDA 1EJ7L 2QIFA 1BC6A 1H2VZ 2VH7A 5LMUF 1RB0A 2OPPA 1UFWA 5LOQA 5F0UA 2W9AA 4KO0B 4Q44A 2Z57B 1VDHA 4M5MA 2ROGA 4GVLA 4DR1J 1T3NA 5B0AA 5DLFA 2OSQA 5M2RA 1RT2A 1WHYA 4ZP9A 3ZZOA 2IC3A 1S1XA 2YWEA 3PHEA 5D0HA 5K9FA 3UQSA 3SV3A 2C2DA 1V5VA 3MM8B 1AW0A 2IYIA 1GNKA 1WNEA 3HHKA 1YJUA 2MB0B 1REVA 4Q0BB 1AFIA 3GYGA 1T05A 3NGSA 4ITSA 2OAUA 4DR7F 1HNIA 5J2NB 1HFEL 3NG8A 4PWWA 2CPFA 3MPDA 2JWNA 3CCUS 1F5BA 4QBUA 1CC8A 3M05A 4WFXA 1DQ8A 2QG9B 4ID5A 1JLQA 5D0EA 4C48A 4O44B 1SQEA 1YJRA 3JQKA 2EPIA 3W62A 3Q8YA 1CQMA 2QMUB 2QN6B 3GG1A 3HT0A 4RW8A 3MFIA 1FXRA 4IYQA 2FVCA 1QAJA 1WI6A 3V6DA 2LXUA 2XSJB 2KKHA 3FSXA 3PRDA 3MMJA 1FNOA 1T03A 1WTBA 3Q22A 3J7YU 4DX6A 5KFRA 1X31C 3IRXA 5IXUA 4YS2A 2XLKA 1H7WA 3VZIA 3VVTA 3HFKA 1JLFB 3C19A 5D15A 3J81Y 3CJ8A 4EMDA 1S6QB 1FE4A 1FKPA 2AYMA 3L4BC 4ED8A 3PW7A 3WZ0A 2FZCB 5IT9U 2UUCF 2HFNA 4HKQA 4OI3A 5CD4A 3P49B 1R8HA 5A0YA 1S49A 1K1QA 2XMMA 2H4YB 1D0EA 2BW2A 3JAMY 2CVEA 5IZHA 3G6YA 1P1LA 1N34J 4ELTA 2K3IA 4NLGA 2HGLA 2DHGA 5FLXU 4ZVEA 1V9OA 1U1QA 1REVB 2CFXA 2W2QP 1Y3KA 1X5TA 2LMIA 4UQTA 4CDIA 2IMWP 4LF6F 1RAHB 2BJDA 2FC8A 2V4JB 3M8ZA 4JYAF 3W9JA 3JYTA 3M2RA 4PCQA 1MSWD 4DG1A 1NJXA 2KB2A 4K5SA 3T5JA 4NLQA 2GVDA 4ZVRB 4HYKA 4JI6J 3DXBA 1YHQS 3RRGA 2MKIA 3D54A 2R8GA 1QAXA 3PFOA 1QJHA 3TZXA 4K2JA 1IJFB 3IBCB 2MZJA 1NH7A 2IVFB 3F41A 3OTOF 1SH2A 2XGPA 2WW8A 2DNLA 3IXQA 3MEEB 4A46A 1RKIA 2UVRA 2CPDA 2YNIA 3UNGC 1Q7LB 3D6TB 2AW0A 4WE1A 1WF2A 1HQUB 1OPIA 2ZM6J 3UVJB 4FNHA 3K5NA 2EFNA 2HHUA 1RTDB 5HVFA 1XNQF 3VGSA 2E9RX 4DV6F 2IVMA 5F8MA 1FX2A 4F0KA 3GFHA 5A8RB 1VQ7S 3N28A 4M94A 4CP5A 2QL7B 2QYGA 2WVCA 3TZWA 4FP9A 1F3VA 1NRKA 4DV4F 5B08A 2F4VJ 3BGUA 3GIKA 3QLHA 1B99A 3GPAA 1S1WB 3RB4A 2E9TA 2LKZA 4FVCA 1Y7PA 2DRAA 4JI5J 4ICLA 3J7AN 3PW0A 4LRCA 1SKUB 1F3FA 4P2SA 5MLCV 1U0HB 2CQ1A 2XYPB 4FF2A 3S8SA 4V19J 1LWXA 3K5PA 1RDRA 3NCPA 4I4BA 1FTRA 4LSNB 3H5XA 3RW6A 5LL6d 1H73A 1DTQA 4ED3A 2XYHB 2V2VA 1S9GA 2F40A 5GAGU 2AJ1A 4A8SA 2B5JA 4G1PA 3L09A 5LXYA 2ASDA 1RT5B 3CJKB 2G4BA 3MMAB 2XM3A 3LAKA 5D4NA 3I56S 2MKJA 1HMVA 3CD6S 1N5SA 2IDLA 2Q6BA 3UCGA 2OO4A 3A12A 3ETOA 3TA2A 1OJ4A 1RABB 2HRTA 2FVQA 3U1NA 2HFZA 3W8GA 1T9WA 4IR9A 3C6TB 1Q95G 2Y8WA 1R8CA 1RCXB 4R8UA 5KFBA 4IFVA 2WB1D 1CBKA 2F63A 2C3PA 4LSNA 2KG1A 4RNMA 1KFSA 1HNWJ 3UDCA 1NDKA 1U0HA 2YNHA 1HBMA 1VQOS 2D69A 4LFAF 3HKZD 1FRKA 4C6AA 4PG6A 3CMAS 1QUVA 3S6EA 4NCBA 2HNZA 3M8PA 4FYWB 1UW9A 2KJVA 1JLAA 3DDNA 4LREA 2XMVA 5BYQA 3VGVA 4YB7A 2XCAA 2RT3A 1TKZB 1IKVA 1RWMB 2F9JA 1S0NA 2AF6A 3KLIB 3GIRA 1I6JA 3DRRA 2DHAA 1RADB 4ZIVA 3D68A 3KJQB 3NOCA 3LP1A 3GQCA 3TVZA 2VJVA 1K9MT 2XLJA 3QSYB 1OWXA 2OSRA 4J91A 5KFNA 2W7OA 1BQNB 4CQ1A 2GHPA 9RUBA 4F4WA 2HEKA 4NLYA 4KGKA 2XTJP 2V2ZA 3LGHA 1K0TA 4OYPA 5HJYA 4R25A 2W8LA 2MKHA 3W7BA 1HD0A 1IQZA 1M5VC 1HI8A 4LF4J 2BE2A 5H9FK 1GTHA 2DCLA 2H54B 4TYBA 3SFGA 5EUHA 4R8UB 1D8ZA 2KJWA 2ZOFA 3D1QA 3NNAA 4IOBA 1RWVB 1XR6A 1JLBA 3C6UB 3EPIA 4IG0A 3U7JA 3NNCA 2NPIA 4B17A 4ERDA 3MD1A 4DHVA 1YSJA 2OELA 3DNCA 4O3PA 2BEFA 3CCVS 2NUHA 1JLEB 3MXHP 2B7CB 2GMLA 1G6BA 2KL8A 4PQAA 4ECSA 4K4SA 3AJDA 1LXJA 2IYGA 4CLZA 4X65J 3OV7A 2FJAB 4FDFA 1SJFA 1VQ6S 3Q86A 3MMCB 4WWSA 1MG7A 3PZPA 5H9FJ 1VBZA 2C2OB 1QSLA 4DCPB 4DR3F 4LF4F 3QWUA 3HVAA 2EG1A 2VKZG 4XPEA 3Q8QB 3JYTB 3CCLS 4QCLA 1RT7A 1SPBP 4K4XA 1CJTB 3VGTA 1IKXA 1Q0NA 3R6GB 3EGVA 2GJIA 2C2KB 3GYXB 3SCIE 4N5SA 3H7HB 3H2UB 2CPEA 3FBBA 4DUYJ 3M8QB 3KG4A 4DQRA 2FLNA 1S6PA 4K4ZA 2RRBA 2QL5B 2RDIA 3HJFA 2YX4A 4ED6A 2R8IA 2BVZA 1G7CB 1BE4A 3MCNA 1ZYQA 2OD6A 4CWBA 3HVWA 2PDAA 3TWZA 3MM7B 3ZZRA 4EZ6A 3KLGB 3GSDA 2ZZMA 4K0KJ 2F65A 1IBCB 2BUNA 3T1YF 5D6GA 3GIIA 3DLKA 5KAKA 4OZ0A 2VIHA 1WG1A 4ZPTR 4JI5F 3PNIA 1YZ6A 2WVEA 4ZK7M 2PI4A 4CTAA 3R7SB 4CNYA 4N77A 1FTCA 1SUQA 2HFVA 4I1TA 1RKJA 2VC1A 5AE1A 1D9DA 2H48B 2ZH1A 4QWBA 1EETA 4CNZA 3J81U 1REGX 1X7VA 2A3JA 2ZJRQ 4DL6A 1UPPA 4KB7A 4MJKA 4Y65A 5B0BA 4DL5A 3MCOA 2A1BA 3W5ZA 4KY3A 5HANA 3MECA 5GADU 1Y3JA 1UCNA 3FCWA 1XEZA 3VAHA 4DV6J 4DSKA 4I7FB 1RTJB 1RWUA 3VAFA 4DLGA 1RHMB 2ZZNA 2KZMA 2RH3A 5FD1A 4ED7A 2LQ9A 4R0EA 4USVA 3HX9A 2ZWPA 4DPOA 3PV8A 2BANA 2BM0A 4CM2A 2ROEA 4DR6J 4RUBA 3J7Z5 2JL9A 2RILA 4H4MB 4MK9A 4ZJLA 3KLHA 3I87A 2HG4A 3FEXB 5JMNA 2UUWA 3HF5A 4DN0A 1APSA 5KT7A 2NXUA 3AXMA 4KO0A 5KFTA 4RNFA 4QIWD 1KONA 5HJXA 5MAOA 3CW2C 5F8GA 5EWFA 2HVIA 2GIRA 2I9SA 2XSFA 3EUNA 4DSFA 1VQ4S 2VFRA 1N5YA 1RAAB 5EX3A 4MIBA 4YQWA 4O4RA 1U25A 2CQ2A 3I6PA 3H20A 1FT8A 3OFGA 1XMBA 3H5UA 1M5OC 2VBWA 2VODA 4YB5A 3J81j 4U96A 1SVDA 1Y0HA 4B3MJ 2DGUA 4QR0A 4WBFA 1N0UA 3R97A 3I0SA 3CC2S 3IGNA 2PSZA 1Z1ZA 4NA3A 2RS2A 2VICA 4JI0F 2A6OA 2W7PA 1JLCB 2J9DE 3IWXA 4LRBA 3WX8A 3RR7A 2PD1A 4OHVA 1IWAA 4NLUA 2WOMA 3ELHA 4RW4B 1M5PC 1K47A 3MM5A 3OR1B 4EYIB 3CTRA 2ZHBA 3IC1A 2F1FA 1PYSB 2YVSA 3DOMA 2OPSA 5E5NA 1T02A 4OLOA 4C9DA 3NNHA 2MQMA 1TL3B 4DMZA 4QOTA 1Y5LB 1M0SA 2BJ7A 1RE1B 1CQNA 4Q8EA 5KFVA 2DNOA 3JTPA 1I3OB 2MKKA 4F7VA 2NSCA 2N4DA 3AHPA 4DV1F 4RW7A 3RW7A 2Q6CA 3U1MA 3UDLA 5I3UA 1Q53A 2WB4A 4QWCA 2NQPA 3SQGA 1SV5A 3NWGA 4NYZA 2VPWB 2ZNZA 2HKEA 4WFAQ 3DRPB 3QMQA 3RJMB 1U2CA 2MTLA 1X4BA 1OQ6A 3UFCX 1HNVB 2EFGA 1WD6A 1RWPB 3D6MB 2UUAJ 2IRUA 5JVHQ 3FQKA 2XY7A 4PYDA 3GJTB 3EM1A 4ZJQA 3HMJG 2JLGA 1QTNB 5DGAA 4DPYA 3TUPA 5KFLA 1S12A 4EO6A 1NAQA 2HWHA 2RDJA 3NGKA 4DUTA 4EK2A 1H98A 2Z56B 2C2MB 5HQLA 4TU8A 1FJGF 1KQGB 3QRQA 6FD1A 3DRSB 2K1RA 3Q8UA 4C3MA 1S10A 5HATA 5KFQA 2HNDA 3GWCA 2BBEA 2I38A 2MLYA 3BGOP 3OHAA 2ZM6F 4QYZJ 4ZS6A 1X5SA 3VV2B 4Z37A 1N6QA 2V9WA 1AFJA 4M5DA 4A8YA 1RBOB 2EKNA 2BABA 3F0NA 2VZ9A 3M2VA 3BQ2A 2AJ4A 4HEA9 4MK7A 2LEPA 3PX4A 3T1YJ 2P5VA 2AX1A 3G8SA 3K7RA 2ZC3A 3H4BA 3NY0A 1S9FA 4V1Ak 2CDQA 1Q81T 1UZHA 1PILA 3BGLA 3I5CA 1IBLJ 3MOJB 4OL8A 3R8YA 4NZ0A 4C11B 2MHNA 2W2OP 5SUHA 4H4OA 2M2BA 4F4YA 4F0HA 2J7UA 1J27A 3V6HA 1OY6A 4ELVA 5K8PA 3TJAA 1VQMS 4N76A 2C2EA 3FJ2A 2H9ZA 5IT0A 3IR7B 4EBEA 2KXFA 1F2HA 1FRHA 1RZMA 3TX8A 3OL6A 1SJ1A 4F2SA 2LYVA 3RAQA 2VBZA 2RU9A 4DWIA 4WYLA 3Q2TC 1T9XA 4K4UA 4C0BA 4PG8A 2DY1A 5AE2A 2VOOA 2J7WA 1ZBTA 1KKHA 4KT0C 3OL7A 1WKKA 5IC6B 1LWCA 1IM4A 1UEUA 2HWTA 3OXGA 2AZ3A 3D3CJ 4U7UD 3C66A 4RNOA 2E1PA 3GU0A 1U6ZA 1QSYA 2X1BA 2CA9A 1CC7A 2KT5A 5E3QA 3WX4A 2VPYB 3GFZA 3U27A 2GA7A 4UUWA 3CCWA 1CJVB 5KG6A 2HK2A 2BA9A 4PUOB 3K8VA 2ALYB 1LWEA 4I6YA 3W2VB 3QIDA 5KT6A 5ETTA 4WP3A 2ZC4A 2W25A 3MEDA 3OBIA 2W2PP 4ILMA 4X4RA 4LRAA 4FYXB 2J9DA 2E29A 4LF8F 3OL8A 4GVBA 2HS3A 3R5GA 3KHHA 1EP4A 3BYRA 3MPVA 2DXDA 2ASLA 3P96A 5F8HA 3I0SB 5U47A 7FD1A 1RT1A 5K20B 4K8RA 2HHWA 2KTQA 2POKA 5GAHI 1M1GA 3T19A 2IRXA 4C97A 1R0BG 3IM9A 5CD4H 3B4MA 4LF7F 2LVWA 2G0CA 2P6SA 2ACMA 2DH9A 4L73A 3CB4A 3ILOA 4FN5A 3I82A 1K73T 1CS4A 1NDCA 2XO7A 3O3LA 4OJ3A 1YITS 4PWDA 1TFYA 1HBUB 1OY9A 1LWFA 3D5MA 3FFIA 4KH0B 4IH6A 4NLRA 2CRLA 2X3GA 3DLJA 5I42B 3MR6A 1XMQF 4U9RA 2Y1JA 3AQOA 4OZ1A 2BOAA 2OEKA 3UD5A 4QWAA 2YQ1A 4RBTA 4A8KA 3MMCA 3DLBA 3M30B 1C0TB 2H5JB 1DZ5A 1SJ3P 2E44A 1YZ7A 4OZNA 1ZM3A 1VRQC 3PDNA 2HBRB 2D7SA 4UTGA 3RBZA 4HACB 1M5KC 2ATLA 2YTCA 3RYLA 4L74A 4PEOA 3UNYA 4OYWA 3ZTSA 4M95A 3BBFA 2N82B 1SJRA 4K4WA 3JSYA 2Y9HA 2N7YA 1KOHA 3C15B 1DTTB 3WIUA 4DR4F 1K1SA 3AD7C 2UXBF 1UJ4A 4NXMJ 1T9UA 1HI0P 2DGVA 3KJNB 1WG4A 1R0AA 4DV2F 5J2PA 2R7TA 2BE2B 1JB0C 4Y0FA 2JLEA 2CIMA 2CWKA 5EDWA 2CJKA 3NAIA 4P9SA 2NYHA 1VRUA 4KYZA 1S9EA 2GAGC 2B56A 2XEXA 3PRBA 2DGWA 4J9KA 3V4IB 2WZ1A 1T9VA 3THVA 3RBXA 3TQ1A 5K14A 2C2NA 2HLTA 3KUHA 5E2QA 2UUBJ 1WDDA 2AYEA 5L9NA 1O51A 3W3SA 1CS4B 2ASJA 3HSJA 1L5UA 1VISA 4HHJA 2J5AA 4C0HA 1XMOJ 2YX1A 5M2PA 1G4CA 1TTHB 1X60A 4DSLA 1H7XA 4C98A 4KPCA 4CO1A 4OYAA 4TKTA 5IWAF 4ED0A 3DDIA 4NPOA 2RQCA 3PKYA 2YNGB 3DGVA 3V6JA 5IQ6A 1PJ7A 1SC6A 4U8YA 3RG6A 2OFGX 4HH0A 4LRFA 1IKXB 3W2WB 4ZMMA 2R3VA 2R7WA 1H6KX 2FPHX 3UW1A 2DVIA 2AHOB 4HACA 4Y34A 4ECVA 3LGMA 1XBWA 1S0MA 4P52A 1RT3B 4ANEA 2QYCA 1TL1B 3PYDA 3DC2A 5DQGA 3OD2A 1NDLA 2W24A 8RUCA 2GGPB 3IWNC 1U02A 1UVIA 2RS8A 2YQ0A 3IG1A 3BF4A 4O4GA 1UWBA 1NSQA 3DI6A 1PAUB 3LP2A 1A0OB 4ZKAA 4DPXA 5J1EB 5IWAJ 4F3MA 2MZQA 3IAS9 1QDUB 3LGNA 3QSIA 2HS0A 5JXSA 1YJTA 5KOXA 1ZH5A 3MEGB 2MQPA 4Q43A 4YHHJ 1NMEB 1AYEA 1VMBA 1F0XA 1T11A 1E6YB 2NUUG 4DX5A 1X4FA 5LJ5Y 3K5LA 3MPWA 1F6TA 3CUNA 3PW2A 4KTQA 2FB0A 1WSRA 2CJAA 3AAWB 3MD3A 4RX6A 4ZVGA 3Q8SB 2NR0A 2YNFA 2CXEA 2RQKA 2CJ9A 4RLEA 3RRKA 3T5KA 2EC0A 2UXCF 3OL9A 3EGZA 4JI1F 2F9DA 2LCWA 4F3QA 1MROB 4GC7A 2COLA 4TY8B 3PEHA 4WIQA 3CCRS 2YWWA 2FHJD 1M1KT 4W90B 1UVMA 4K5RA 4Q8FA 2C3UA 4ZCLA 2AGQA 2J76E 3PHTA 5KT3A 4F4KA 4WK1A 4H4OB 4TU7A 4ZITA 3W2VA 1U1LA 1JWWA 3BB5A 1T95A 1IBMJ 1UA0A 1CJVA 3WDOA 1F5AA 2K2PA 2F4FA 1NB2A 2QMWA 3MEKA 2BJ9A 2JJ4D 1U45A 4MFBB 3NEKA 3ZZZA 2G0JA 2YWGA 4PXEA 3OXLA 4JI6F 4F4AA 1XMOF 2JVRA 1NPKA 2KH9A 2HMIA 1HYSB 3N5BA 2CUYA 4TU9A 4WU2A 3TUJC 4KR0B 4TY8A 3HHDA 2FJBB 1WEXA 2QL9B 2LU1A 2KU7A 2XBPA 3PIPQ 3QIPB 4NLPA 4C0OC 4QJVA 3EZOA 3KKFA 4NYOA 2ZEJA 5RUBA 1E6YA 1VCTA 2R8JA 3B78A 1ZZFA 2I5JA 5B0EA 3D4JA 3SCKE 1HHTP 2H1YA 2XS7A 3B4DA 4DU7A 4K0KF 2NXEA 2KM8C 1JXEA 4WP9A 3BEGB 2ZBQA
chains in the Genus database with same CATH topology
1EX8A 3ILJA 1IM6A 4CYUB 2QX0A 1F9HA 3HSGA 5ETPA 3HSZA 3QBCA 4M5JA 3HD1A 1CBKA 4AD6A 3ILOA 1TMMA 2F63A 4M5LA 3UDVA 2CG8A 2F65A 1Q0NA 4M5GA 3UDEA 5ETNA 1TMJA 5ETOA 4M5HA 1RB0A 4F7VA 3HT0A 3KUGA 1KBRA 4M5KA 4M5MA 1EQ0A 1HKAA 5ETTA 1RU2A 1RU1A 4M5IA 4M5NA 4CYUA 3MCOA 5ETQA 3ILIA 4PZVA 5ETMA 5ETSA 5ETKA 3UD5A 3KUEA 4CRJA 3MCNA 3KUHA 1DY3A 5ETRA 2BMBA 4CWBA 3HCXA 3HSDA 3HSJA 3MCMA 1RTZA 5ETLA 3IP0A 3ILLA 1RAOA 1HQ2A 1G4CA 1EQMA 5ETVA 3HD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EX8 A;  3ILJ A;  1IM6 A;  4CYU B;  2QX0 A;  1F9H A;  3HSG A;  5ETP A;  3HSZ A;  3QBC A;  4M5J A;  3HD1 A;  1CBK A;  4AD6 A;  3ILO A;  1TMM A;  2F63 A;  4M5L A;  3UDV A;  2CG8 A;  2F65 A;  1Q0N A;  4M5G A;  3UDE A;  5ETN A;  1TMJ A;  5ETO A;  4M5H A;  1RB0 A;  4F7V A;  3HT0 A;  3KUG A;  1KBR A;  4M5K A;  4M5M A;  1EQ0 A;  1HKA A;  5ETT A;  1RU2 A;  1RU1 A;  4M5I A;  4M5N A;  4CYU A;  3MCO A;  5ETQ A;  3ILI A;  4PZV A;  5ETM A;  5ETS A;  5ETK A;  3UD5 A;  3KUE A;  4CRJ A;  3MCN A;  3KUH A;  1DY3 A;  5ETR A;  2BMB A;  4CWB A;  3HCX A;  3HSD A;  3HSJ A;  3MCM A;  1RTZ A;  5ETL A;  3IP0 A;  3ILL A;  1RAO A;  1HQ2 A;  1G4C A;  1EQM A;  5ETV A;  3HD2 A; 
#chains in the Genus database with same CATH topology
 3AOD A;  1RLC L;  4JI3 F;  2UXC J;  2V5H G;  1S9G B;  3RU0 A;  2B4P A;  3SXL A;  3ZZU A;  2CPI A;  2OIH A;  2Q66 A;  1NB7 A;  4UY8 5;  3UPF A;  4KE5 A;  3SCJ E;  1Y5I B;  2DTJ A;  2ZVI A;  4OHZ A;  3L7O A;  4ANC A;  3PJ9 A;  1TEL A;  1TMJ A;  3EXY A;  2OFH X;  4G1Q A;  1D3W A;  3IBF B;  1YJN S;  2ROP A;  1X4E A;  5E3C A;  1EAR A;  3SQG B;  2HLU A;  4M5D B;  3EXC X;  4Y2M A;  4OHW A;  3R5J B;  1YGY A;  3LP0 B;  2PE8 A;  2AYG A;  2VPX B;  5EHH A;  2B9Y A;  3TZY A;  3Q24 A;  4C4W A;  2LFV A;  3AY0 A;  3M8Y A;  4OI6 A;  2CNO B;  3KDO A;  1C0U A;  5J1N A;  4DCJ B;  3CCQ S;  1VQK S;  4D3G A;  2LU2 A;  5T7L A;  3ZTR A;  3ISZ A;  2K1R B;  1U6F A;  2Z58 B;  2MMY A;  2C1E B;  2H5E A;  5KFA A;  2ZH2 A;  1WC1 A;  4MMO A;  2OMO A;  2BJ8 A;  5HL7 Q;  2O5D A;  4QIF A;  1NCL A;  3IRW P;  3K5M A;  1TL7 A;  1URR A;  3QGP A;  3O2I A;  1JK9 B;  4J37 A;  3MUR P;  5GVQ A;  4I6A A;  2ZBI A;  4F2R A;  2B43 A;  3G9C A;  4AD6 A;  4ILL A;  4NWB A;  1VS3 A;  5K8N A;  2IHR 1;  4CLU A;  1CG2 A;  4LUB A;  5A8W A;  4U7U K;  2BKN A;  5ETO A;  2BJE A;  5T14 A;  4JI4 J;  1B0V A;  1EHW A;  2H3E B;  2Z2M A;  2GIQ A;  2HZC A;  4NI2 A;  1RLD A;  3JTN A;  1YRX A;  3CNQ P;  4WFN Q;  3H59 A;  3BSN A;  5HRO A;  2C3M A;  1DJ0 A;  4RW7 B;  3ZTP A;  1T05 B;  3QNW B;  2X51 A;  2R7Q A;  3E3X A;  4HLB A;  4M8L A;  2JEJ A;  1FWL A;  1C0T A;  3PXG a;  4X84 A;  2O67 A;  4Z7C A;  5F9L A;  1U1N A;  2BR0 A;  3MM8 A;  4RWW A;  3C2P A;  2GIF A;  1PYT A;  1T7P A;  1RT2 B;  4PR6 A;  2V4R A;  1F9H A;  1JIH A;  2HBZ B;  3DOM B;  2ZZT A;  1JJ4 A;  4WTO B;  5F41 A;  3VF0 B;  3UDV A;  3V5R A;  1FDA A;  2ZOG A;  2EFV A;  4B08 A;  4WTY A;  4M5H A;  4WF9 Q;  1UP1 A;  3NCR A;  4I6W A;  4K4T A;  1DHM A;  1N5Q A;  4IQM A;  3QPI A;  4JBC A;  4CLF A;  4OI1 A;  1HQE A;  1PC5 A;  4LQ3 A;  1DLO A;  4KHR A;  2VQF J;  4YN3 B;  4X62 F;  1GXU A;  1X0P A;  3OHB A;  1CEZ A;  4ZOS A;  2XI3 A;  3HJV A;  4B9V A;  1MN9 A;  3HXM A;  1N36 F;  3OTB A;  1TL5 A;  3M4X A;  1R89 A;  3PJX A;  3TOQ A;  1T03 B;  4DR5 F;  1NKB A;  1Q8L A;  4FZV A;  1JJ2 R;  2CYY A;  1XWL A;  3QO9 B;  4JYA J;  2VJU A;  5J2M B;  1VJQ A;  1TK0 A;  2Z0G A;  4O23 A;  1J5E J;  2D9O A;  1T9Y A;  4UOH A;  1RGV A;  1F9F A;  1WC3 A;  2DHH A;  2KT2 A;  4ATN A;  5KG0 A;  1S72 S;  1JLQ B;  3NS5 A;  3FZ2 A;  5L8R C;  2FLL A;  1KOO A;  3PO4 A;  1C0U B;  4JV2 A;  1P8G A;  4LMZ A;  1Q78 A;  2LQ5 A;  4LF2 A;  5D0G A;  5CZX A;  4JI2 F;  2HGN A;  1RT4 A;  3QAE A;  1V6H A;  2J8A A;  1MMN A;  4I7F A;  3ZO7 A;  3KHL A;  3BQ0 A;  4YFU A;  1FRM A;  2CWX A;  3LP0 A;  4X4V A;  3DOL A;  2XNR A;  4AL5 A;  2HUR A;  3IR5 B;  1UKU A;  4P73 A;  3KMQ A;  1SJQ A;  3LWL A;  1JJC B;  4AYB D;  4YB6 A;  2J0S D;  2V63 A;  1IKY A;  2H51 B;  4CLL A;  4NI2 B;  2KRR A;  2OUG A;  3CDA A;  5IM0 B;  1RT7 B;  1NH8 A;  1A6L A;  1RTI B;  1EET B;  1J2V A;  2APO A;  3LAL A;  4OI4 A;  4YR2 A;  3K57 A;  1V3R A;  7AT1 B;  4CO2 A;  1SUQ B;  2CQ4 A;  4LF5 J;  3KK3 A;  2AZ1 A;  3UWT A;  4KBI A;  1VRT B;  3EGN A;  3ZNJ 1;  1PKU A;  2UXB J;  2P2C B;  4X4P A;  3OUY A;  4ZJO A;  1TMM A;  3JAM U;  3UD3 P;  4D3H A;  1S1T A;  1SL1 A;  2HHH J;  2J0Q D;  3LOU A;  4IG3 A;  2VG7 B;  4TNO A;  1KWM A;  4HVZ A;  3UN2 A;  4WKY A;  2DR5 A;  4RUA A;  4OJG A;  2QLF B;  5G0R A;  4ECY A;  2V8D A;  3HHL B;  1RU1 A;  1WC5 A;  3CME S;  2VFU A;  4KV8 A;  3A3P B;  1CUL B;  1SC1 B;  1KQS R;  4CRJ A;  3GON A;  3MGJ A;  5EWG A;  5ETR A;  1LW0 B;  2D1C A;  2GNK A;  2RNE A;  3O8W A;  2UUB F;  2VON A;  4NRT A;  1W7W A;  3G82 B;  5DG7 A;  4IRD A;  2DNN A;  2E7V A;  3NAH A;  2GC8 A;  2KYX A;  1TVR A;  4L6V 3;  4ZVP B;  4ECU A;  2XS5 A;  4WZM A;  2VQE F;  2ACY A;  4TQR A;  2F3J A;  3G96 A;  3KLV A;  3RBD A;  1RYR A;  4ZLP A;  1GX6 A;  3IS9 A;  3AFG A;  1N33 F;  1TK5 A;  4JP8 A;  3BDP A;  4I2Q B;  1KC8 T;  5KFM A;  1CLF A;  2V34 A;  2CAD A;  5J2Q A;  4LFB J;  4I0W A;  4XDC A;  5AXL A;  5LSO A;  1KEK A;  1KD1 T;  3NBP A;  1IR1 A;  3CJR A;  4I2P B;  4F4X A;  3FQL A;  1B70 B;  3TAR A;  2HNY B;  1O0P A;  1ULR A;  4DR1 F;  4NEY A;  4ECW A;  2DPJ A;  5L46 A;  1VRT A;  3CF5 Q;  1I51 B;  4J9N A;  3EX7 B;  2BYC A;  3ILI A;  4ZLJ A;  1IR2 A;  1DBD A;  2RHS B;  4JUZ A;  1RBL A;  2AJF E;  1QD1 A;  3ZTO A;  3ZTQ A;  4TQS A;  2Z2Z A;  3OLB A;  1B7Y B;  5KOW A;  2H5I B;  3D1O A;  4FXW A;  2V8G A;  4LBH A;  4F36 A;  3TNV A;  4PPZ A;  5DLG A;  3C6T A;  1TQL A;  3WBZ A;  1U49 A;  3OLA A;  1FJG J;  1UJ6 A;  2ABY A;  2CPJ A;  1HYS A;  2FUG 9;  4KFB B;  4FBT A;  2E1M C;  3GCX P;  1JNZ B;  2GZO A;  3MTK A;  3H40 A;  4XIU A;  4WFB Q;  1YDL A;  1RXO B;  3DRR B;  4ES2 A;  2ZBC A;  3GV7 B;  3T41 A;  2AJQ A;  1U1P A;  5GAH U;  1S76 D;  3MAQ A;  1S6O A;  1VOM A;  2EBG A;  5HBM B;  2CJY B;  4MKB A;  4DU8 A;  2V2K A;  1Q16 B;  2NSB A;  5HAO A;  5ETS A;  2MQO A;  3V81 A;  2QLJ B;  1C1C A;  4M1K A;  4BS2 A;  2RF2 A;  3A8K A;  3BSA A;  4USW A;  4OYO A;  4UST A;  2HBQ B;  2MZT A;  2MPU A;  1JLC A;  1TVR B;  2NCK L;  4HI2 A;  1HBN A;  3CCZ A;  4NEZ A;  3VGU A;  3OSN A;  2HZV A;  2JEG A;  2DHS A;  2V67 A;  4HHU A;  1FJ7 A;  2UU9 F;  1DQ9 A;  4A8F A;  2B9X A;  2VFV A;  2YNF B;  3R7B B;  3MI7 X;  5A8K B;  5CCM A;  1RI7 A;  2KRB A;  3B6B A;  3OR2 A;  3SDE A;  3G6V A;  1FDD A;  3I9Z A;  5HLF B;  2Y3Y A;  2XZD B;  3HHL A;  2N7C A;  2FLP A;  3UN3 A;  2DNK A;  3AT1 B;  3I9V 9;  3R2C J;  4ES1 A;  2VG7 A;  4W4M A;  1ZPW X;  2FQQ B;  3SV4 A;  5HI7 A;  5KFY A;  2M7S A;  5F8J A;  1TFW A;  4QYZ K;  4HHH A;  4DS5 A;  2C42 A;  4J9V A;  3KLH B;  2GQQ A;  3IO1 A;  4IFY B;  5CH7 B;  2B5J B;  1L3S A;  2ZH9 A;  4OYZ A;  4ES3 A;  1HWJ A;  3OFF A;  2MSS A;  5BXI A;  2ZH5 A;  3CCT A;  3DRX A;  3H8Y A;  3LQV A;  3VAG A;  4HTI A;  5ETL A;  2IA6 A;  4KAI A;  3GZ7 A;  3MPU B;  2EG2 A;  3ILL A;  1GFW B;  2GMJ A;  3OJS A;  4ER8 A;  3D0H E;  3W61 A;  2XGQ A;  1WF0 A;  1KFD A;  1FK9 B;  3FCV A;  4CO5 A;  1WI8 A;  1L3K A;  2HVZ A;  5DDR C;  1S4F A;  4FYV B;  1HNZ J;  1PSD A;  1XC9 A;  2MY7 A;  4CT9 A;  3POT A;  3QLH B;  2PFD A;  3DKD A;  3V2U C;  2A6M A;  3AOA A;  3Q83 A;  4YR3 A;  4HL9 A;  1U6B A;  1XIQ A;  4K4V A;  4U95 A;  1FXD A;  4ZVT B;  2DR6 A;  3CJQ A;  2HVH A;  3HVT A;  3OFE A;  2FJX A;  2R2S A;  3T5L A;  1TL7 B;  5JUM A;  4B3T F;  1IKW A;  5JJB A;  1IKW B;  3OW2 R;  2KN4 A;  3FFI B;  4UOC A;  2BV3 A;  4LF9 F;  1GQE A;  3KNG A;  5KFC A;  3M6V A;  3FBF A;  1U0S A;  4Y3C A;  1X4G A;  4OZL A;  4LF5 F;  1N52 B;  2V0N A;  1PBA A;  3ENV A;  2GFF A;  1WEY A;  3MM7 A;  4C8O A;  2Z2Y B;  4YOE A;  5BR8 J;  1S77 D;  3H2V E;  3MUM P;  3HHL C;  3E2E A;  2GX8 A;  3M9M B;  3OR2 B;  5B0G A;  3SDE B;  5AE3 A;  3RB3 A;  5HLF A;  2BE7 D;  2ZBP A;  4L72 B;  4Y6I A;  5DDQ C;  1TKX A;  2FZG B;  1TKT B;  4YR0 A;  2A10 A;  3C15 A;  3BGR B;  2JOQ A;  2B51 A;  1ACM B;  1RAE B;  2PII A;  1FK9 A;  4QZV B;  3R1H A;  4GVB B;  5KFS A;  3GIJ A;  1NJZ A;  2I1R A;  3MR3 A;  3TEH B;  1QSS A;  1OQ3 A;  4K59 A;  4XAK A;  5I4M A;  3M6W A;  1C1C B;  4BC9 A;  4KHP F;  2JHE A;  4V19 X;  2WHO A;  1MU2 A;  2NXC A;  2HQD A;  3N4W A;  5HBM A;  5KFU A;  1GMW A;  2EWH A;  1GT8 A;  1OSD A;  1U2F A;  1ZPV A;  4TVA B;  1IWG A;  5ETQ A;  3PW4 A;  3DU5 A;  2FD2 A;  2P8I A;  4O44 A;  2PGC A;  5KT2 A;  4O3S A;  5LMN F;  1FFW B;  2EBE A;  4J9U E;  1HWK A;  5KFH A;  2FY1 A;  3N79 A;  2BW7 A;  4JI7 F;  3I5A A;  1HLW A;  5DQI A;  3ILJ A;  1G1X A;  4MT1 A;  3PYE A;  2HSE B;  4QR2 A;  1XJW B;  3MZI A;  1QY7 A;  3WC0 A;  5IT9 Y;  3CCE S;  4B3O B;  2E66 A;  2R7V A;  3IR6 B;  4OFZ A;  5ETP A;  1Y9O A;  1IXK A;  1UW4 A;  4Y2I A;  3QWP A;  2PFF B;  2QMX A;  5HN0 A;  5BJR A;  2FLO A;  1FKP B;  5CYM B;  5DQH A;  4OX7 A;  3VWS A;  4G3I A;  5B0F A;  3H25 A;  4JV0 A;  1TL4 A;  4H54 A;  1S57 A;  3SSQ A;  2WTF A;  3T1H J;  1U8W A;  1VGY A;  3ENW A;  1TK8 A;  3MUT P;  4X2B A;  2HIY A;  1BHN A;  4LIW A;  5CYQ B;  5A6W A;  4RU9 A;  1RU2 A;  1LK7 A;  2CZV C;  2ZD1 A;  3AB2 B;  4FYY B;  2MGZ B;  3MED B;  4RWX A;  4TYA A;  3LP1 B;  4B3R J;  2DCU B;  2RD5 C;  1RHK B;  1ZAX A;  3NBP B;  2DNY A;  3NS7 B;  2JNJ A;  1LWE B;  2BX6 A;  4DPU A;  4J9Q A;  3RTV A;  2PT0 A;  1J5O A;  2HYI B;  5T7L B;  3D6F B;  3VQT A;  4RW9 B;  1HR0 J;  2XMW A;  2WBR A;  3HD2 A;  2YKM A;  2LQJ A;  1U24 A;  3PIO Q;  4C8L A;  1ICE B;  4ZPW R;  1WC0 A;  4I64 A;  4U6P A;  1XN9 A;  2J0W A;  2OML A;  1RQ0 A;  2LA4 A;  3GP9 A;  3MOZ A;  3I55 S;  1JNR B;  1VQY A;  4NLS A;  2FHJ A;  5L1J A;  3LPY A;  2DGQ A;  2LQ8 A;  4JI8 F;  3WHI A;  1M90 T;  3JQM A;  2G1H A;  4ED5 A;  3QGI A;  4WKR A;  3DRY A;  3UDE A;  1N48 A;  1D9F A;  3G8Q A;  3W5Y A;  1OSC A;  3E8O A;  4NE9 C;  5HO4 A;  4LRD A;  4ZP7 A;  3DFE A;  3M6U A;  2P9E A;  4KV8 B;  5HMX A;  2VOP A;  5C24 B;  2OEJ A;  2A0F B;  2YH1 A;  1I94 J;  1UTA A;  5DDO C;  4ED1 A;  1KVJ A;  3HLU A;  2VD3 A;  1JQG A;  2J0X A;  1BQX A;  4EGL A;  3TEG A;  3KLE B;  4C8N A;  3RBE A;  3MAA B;  4N41 A;  3CIM A;  3CCJ S;  4DV5 J;  1U8S A;  3ICL A;  5GAD I;  1HMV B;  4DPW A;  2DIV A;  4AQY J;  3LP2 B;  3OUY B;  3BBB A;  2HVE A;  4K7Q A;  4USM A;  1EQM A;  2EW9 A;  2RVJ A;  3CJK A;  4NXN F;  2UUT A;  1SC3 B;  2CNN B;  4EU0 A;  5L1I A;  4ZA1 A;  1LK5 A;  3BSO A;  4OIX A;  1WSV A;  3T3F A;  4HTJ A;  1HHS A;  3M32 B;  1N54 B;  2DO0 A;  2H4W B;  3ULH A;  5D4L A;  4Z2X A;  4LSL B;  4QWE A;  2F7V A;  2X1G A;  1NPP A;  2UV8 G;  1G3O A;  4HDH A;  4MYU A;  3M1V A;  1FDN A;  2OD4 A;  3OSP A;  2WW4 A;  4OYI A;  2OEM A;  3B82 A;  1XQI A;  3P3D A;  2QLB B;  1SKW A;  2KFN A;  2RB7 A;  4OX6 A;  4PZV A;  2W1B A;  3GJR B;  1U1K A;  4NML A;  2YKQ A;  1E6V A;  2KO1 A;  3RB6 A;  2D9P A;  3PY8 A;  2YWK A;  4YME A;  1RWW B;  1HNZ F;  5K14 B;  1JKH B;  1WKL A;  2X3D A;  2VQE J;  2A2C A;  2EC2 A;  2DNR A;  3EWG A;  2RRA A;  1KN6 A;  4KPY A;  3I0R A;  2ZD1 B;  3B54 A;  4Q2M A;  3FKB A;  4TY9 A;  2R8K A;  3HVR A;  4UW2 A;  3TAM A;  1FDB A;  2V8H A;  2VFT A;  1VC0 A;  4NLX A;  1CPZ A;  2IJN A;  3E01 B;  1H0H B;  2E7W A;  1HNW F;  4LVN P;  4AQY F;  1RAC B;  3RB0 A;  2XZW A;  1SC4 B;  2XI2 A;  4FKX A;  3M9N B;  2CZ4 A;  1FKA F;  4RU2 A;  5GMK a;  1FRX A;  3H5Y A;  1YTY A;  4Q7A A;  3HSD A;  3LA0 A;  1LQ9 A;  5F3Z A;  3CD5 A;  2FJV A;  1S79 A;  2IAJ A;  3N9U C;  4KSE B;  4O4G B;  4PKD B;  5F8L A;  3UO0 A;  3M2R B;  2KFY A;  3MWB A;  5KFD A;  1VHF A;  2CQI A;  4RUC A;  5J2M A;  2VA2 A;  1LWF B;  5I42 A;  4AND A;  1G2E A;  2F5G A;  4EWT A;  4PWD B;  4USK A;  2AWZ A;  3D7S B;  2CPH A;  3MPY A;  4HI1 A;  1NSK L;  5HMY A;  4X4U A;  2OGU A;  3TJ8 A;  2AT1 B;  3CJ3 A;  4PXC A;  1Y10 A;  2V50 A;  3IWL A;  4BWM A;  1R8B A;  2YNG A;  2J9C A;  3FVY A;  1RWO B;  4WYW A;  4WCE Q;  3QT8 A;  5T41 A;  1X4D A;  1BY9 A;  2KVI A;  2FJD B;  4CIO A;  1VJW A;  1AZS A;  2I6W A;  2XMK A;  3TAM B;  2LA6 A;  3M8R A;  1Q8I A;  1Z2Z A;  2B9E A;  1XNQ J;  2JEI A;  1F60 B;  4UY8 T;  3AOC A;  5HVG A;  1N5Y B;  1WHV A;  5SZT A;  2UU9 J;  4DV0 J;  3NRB A;  4EO8 A;  2VUG A;  2WCX A;  3PRV A;  2MZS A;  3RZA A;  2XSJ A;  4J9O A;  1B0P A;  3DLK B;  4L75 A;  3T6J A;  1S1U A;  4DOZ A;  2D3U A;  2L08 A;  3ZXW A;  4EBC A;  4PUO A;  2XS2 A;  4X4N A;  2DNZ A;  1X9S A;  2R7X A;  4LR7 A;  1R6Y A;  2FGC A;  5L9X A;  4CO0 A;  2P9C A;  3LWM A;  4DR3 J;  1R6V A;  4OZ5 A;  2ZVS A;  2JSX A;  2UUC J;  1TUG B;  3PR4 A;  1UWA A;  1YRT A;  1VBY A;  2MKC A;  3POT B;  3JB9 k;  2HHT A;  2E5I A;  2CPY A;  1ELO A;  2MDA A;  3KXD A;  1FCA A;  4K4Y A;  2FVP A;  1H2T Z;  1VQ5 S;  2QGF B;  3HM9 A;  1HR0 F;  3KUE A;  2BMB A;  1F9E B;  3DN9 A;  3E01 A;  2BZ2 A;  4PXD A;  2QFI A;  3KNA A;  4OZ3 A;  1XR5 A;  1GK8 A;  2XMT A;  3I96 A;  4NZ7 A;  3TX0 A;  4C2M A;  2JLF A;  3M30 A;  2MJN A;  4Q45 A;  4AXJ A;  1ZET A;  5KG1 A;  3CXC R;  1IN0 A;  1HW9 A;  3IBW A;  2QFJ A;  5DM6 Q;  1PGZ A;  4NL5 A;  4E98 A;  3I0R B;  4N8O A;  3TI0 A;  1NHU A;  2OPP B;  4FPI A;  4PYA A;  4F0M A;  1QE1 A;  4R5P A;  4J9M A;  3FC9 A;  1PYO B;  4DDF A;  2W4C A;  1N33 J;  3MAA A;  1NZA A;  4KHP J;  4QIV A;  2AMC B;  1DUR A;  3UR0 A;  2MYF A;  4GKK F;  2B6A A;  2SXL A;  2W01 A;  1KHV A;  3EMT A;  1O5J A;  2V2Q A;  4OYX A;  5E3A A;  1V3Z A;  1W2B R;  2UZA A;  2PA3 A;  4RKU C;  4WFZ A;  4ECZ A;  1TAU A;  4LF9 J;  2ZFH A;  2DNP A;  1RT1 B;  2CJQ A;  4ELU A;  2MZ1 A;  4DV3 F;  5BR8 F;  1NK9 A;  4DFP A;  4WII A;  1AB8 A;  4QIG A;  1NO8 A;  3FRZ A;  3GB0 A;  1LW2 B;  4OI2 A;  4PXB A;  4FNI A;  4IOC Q;  1N36 J;  1TV6 A;  2HIQ A;  1R8P A;  5D78 A;  4EFA C;  5B7W A;  1H74 A;  4DQI A;  2CPZ A;  2DJW A;  2HND B;  1FEH A;  5IT4 A;  3MUV P;  1IKV B;  1VR6 A;  1HW8 A;  2R7S A;  3DYA A;  3DLE A;  1P9Q C;  1FWK A;  2CQ3 A;  3SSR A;  1FXL A;  2DPI A;  5KG5 A;  4DBQ A;  3FGV A;  2LQB A;  3K2Y A;  2DR9 A;  4B9L A;  1JLE A;  3W9I A;  1FA0 A;  2B9W A;  4LBP A;  3DDK A;  3N6M A;  1YLX A;  5CYQ A;  4MTP A;  2QA4 S;  1UVK A;  4JI2 J;  5KFZ A;  2NS1 B;  3K58 A;  3JSM A;  3DHW C;  2ZHA A;  1VC6 A;  1PJ6 A;  3ISN D;  5KFK A;  4MH8 A;  4B9U A;  2IMO A;  5CYM A;  2OPQ A;  3L7U A;  3DRP A;  3QAU A;  1RTZ A;  2VFS A;  4TLR A;  5LXR A;  3UD4 P;  4GMK A;  4U7C A;  4DV7 F;  2ZKT A;  2XG8 A;  3ENQ A;  1SV5 B;  4I56 A;  4P2M A;  5F0W A;  3ZC4 A;  5KG7 A;  4A8W A;  3MR7 A;  4NCA A;  2BJ3 A;  4ZPC A;  4ZN1 A;  3GCW P;  2DH7 A;  4PWU A;  2GV1 A;  4Y00 A;  3CGI A;  4E0D A;  3MEG A;  1Q7Y T;  5HQM A;  3ZZ0 A;  4QPX A;  2ZE2 A;  3TR5 A;  5FDL B;  2Y1L B;  5J1E A;  1MWQ A;  1X0F A;  4DR7 J;  1U1O A;  4RW9 A;  4ZN3 A;  3DYA B;  1WG5 A;  1FNX H;  2QA2 A;  1VFJ A;  5A6P A;  2UXD F;  1J5O B;  4P74 A;  1WC4 A;  3DM2 B;  4KH1 B;  1NDP A;  1YJV A;  1U1R A;  1TV6 B;  3M8P B;  1KDN A;  4ZVH A;  4RW4 A;  1ZM4 A;  4NLO A;  2FHM A;  3FEZ A;  5B09 A;  4DFM A;  1L3V A;  1F5C A;  3P8B B;  1T94 A;  1LFP A;  2YNH B;  5K8M A;  1MRO A;  3BKT A;  3G82 A;  5LSR A;  3Q2S C;  2G2Y A;  2PMH A;  4LJM A;  2HRY A;  1S97 A;  4Z7Y A;  2KI2 A;  2ZOM A;  1LNQ A;  2LLZ A;  1C4A A;  4FF4 A;  1X8D A;  2FYX A;  4O3N A;  1Q4R A;  3NL0 A;  2RU3 A;  5G0R B;  2B6A B;  3OJU A;  2HZA A;  1UVL A;  1FO1 A;  1SIW B;  2ZE2 B;  3PJW A;  2IBO A;  2E5J A;  4LF1 A;  1N32 F;  4ILR A;  3LUY A;  1NK5 A;  5DET A;  4DCO B;  3BKU A;  3DI6 B;  1KBR A;  1UWB B;  3FUY A;  1MWZ A;  2G9O A;  3GR1 A;  5B0D A;  1M5H A;  2CQC A;  1F1B B;  1NK4 A;  2DGT A;  4EI2 A;  1TL1 A;  1MW7 A;  5AXM A;  1RTI A;  1U48 A;  3BR8 A;  3MHY A;  4NLW A;  3VCD A;  1C1B A;  2DO4 A;  5H1S V;  1WOR A;  2C22 A;  4UZB A;  3HO1 A;  3JSM B;  2W9C A;  1XK8 A;  1NHK L;  3M8W A;  3BO2 A;  4LIR A;  5KT5 A;  4UZC A;  3X3U A;  3VAI A;  2IM3 A;  4MKV A;  3OTO J;  4I68 A;  1TKX B;  2VAS A;  3GJS B;  4NYP A;  2E7X A;  3OTE A;  4KKO A;  2DNM A;  3I31 A;  4NAS A;  4LSZ B;  2MQQ A;  3DLE B;  5KG3 A;  4ZLN A;  5KFO A;  3SIP B;  3DLG B;  1VC5 A;  4IRC A;  1KQK A;  2AEJ A;  2JRS A;  3H42 A;  5L39 A;  4KQZ A;  3BQ1 A;  2DR8 A;  2QA4 G;  4ZCI A;  2ZNY A;  3W8P A;  2ZH8 A;  2HFS A;  1WOS A;  2GAH C;  3BN4 A;  1SH0 A;  3PM9 A;  4QR1 A;  5ETM A;  4FXD A;  2WRM A;  3SQO P;  1R43 A;  3AD9 C;  4ECT A;  4DQP A;  3VAM A;  4UF4 A;  2BKP A;  1VRU B;  4DV5 F;  2PEH A;  1YVF A;  2R7O A;  1YJ9 S;  2G1D A;  2LEC A;  4ID8 A;  4WE1 B;  3R3T A;  4YHH F;  4PPD A;  3KMS A;  1A9N B;  3ZFV A;  2LDI A;  1NJY A;  3BR9 A;  3KG1 A;  4B9T A;  1GTE A;  1A7G E;  2R7R A;  3BKF A;  3THT A;  2DXF A;  1MNE A;  5A8K A;  3UCZ P;  1L3T A;  4XK8 C;  1O8B A;  2HHH F;  1HQE B;  1VLY A;  4P7T A;  4EBD A;  3DU6 A;  3PCO B;  2IVY A;  3ET6 A;  2DR7 A;  2L9N A;  4PAA A;  3R7N B;  1X9W A;  3BYP A;  3C8Y A;  3BGF A;  4QIE A;  3MM9 A;  2XZT B;  2X1A A;  4RBV A;  3OXF A;  2BRL A;  4OZJ A;  3IA0 A;  1RHR B;  2W9B A;  3C16 B;  1GMW D;  2EK6 A;  4H4M A;  4IFY A;  3R27 A;  4USU A;  1Z2L A;  4O3O A;  5K8O A;  3HT3 A;  1TUW A;  1N5V A;  2HHP A;  4P72 A;  3TP2 A;  1L3U A;  1RK8 A;  4YP3 A;  4ECX A;  3QAT A;  4KFB A;  4PG7 A;  1NK8 A;  3SEO A;  2O01 C;  3HI9 A;  1R0C B;  3P5B P;  4DR2 J;  4NCG A;  3UE2 A;  3J7A 1;  1X5P A;  4B3S F;  3M8S A;  1JLB B;  1QVG R;  1IBK J;  2KVQ E;  4ECR A;  3AH6 A;  4Q0B A;  3CDE A;  3VHQ A;  2B3T B;  2LEA A;  3CSK A;  1YJ7 A;  3X1L B;  1CSJ A;  1KRP A;  3EIC A;  3EVM A;  3EYZ A;  1BWV A;  4A4J A;  3KK2 A;  1EAY C;  4HDG A;  1HBN B;  1S1X B;  2V8P A;  1XMQ J;  1FEE A;  1R7I A;  4P71 A;  3O5T B;  4CTA B;  4E8U A;  1VIX A;  1BQN A;  3NCQ A;  1HKA A;  1YBT A;  1I1G A;  4BDP A;  4RNH A;  4OV1 A;  2E9Z A;  1OIA A;  1WF1 A;  2ZH3 A;  5IV4 A;  1P6T A;  1ZA1 B;  3FK4 A;  4FPR A;  2IJR A;  1JKH A;  1RA6 A;  2WVD A;  9ATC B;  3L3C A;  3PX0 A;  4B9M A;  1FX4 A;  1TKZ A;  6AT1 B;  1SQF A;  5EN1 A;  5KG2 A;  2GQC A;  5DZ6 A;  1ZM9 A;  1TKD A;  1IJE B;  3NLC A;  4PAB A;  2M4M A;  2DNH A;  3CJT A;  2ZDO A;  3HSG A;  4G1I A;  2GHV C;  3EE3 A;  4RO0 A;  2XY5 A;  2J6U A;  1B4S A;  3NGU A;  4DL0 C;  1UFL A;  2N4C A;  3PVX A;  1KLM B;  2PI5 A;  5ITH A;  1OPZ A;  2CNK B;  5G4D A;  3K0J A;  5CZV A;  2V94 A;  1IR0 A;  1CUL A;  3NGT A;  2NXN A;  5D4O A;  5KFW A;  1KR4 A;  3Q8R B;  1PO6 A;  1B3T A;  2RHQ B;  4DV2 J;  4MKY A;  4DSJ A;  1RAG B;  2Z2L A;  3IFE A;  2B7B B;  2GVZ B;  4RR5 A;  1DY3 A;  1WEL A;  4QU6 A;  2D3Z A;  4IO9 Q;  4MIA A;  4IO1 A;  3H4D A;  4WXO A;  1NM2 A;  3MMA A;  4GRS A;  2EXU A;  1U47 A;  3D28 A;  1EX8 A;  1TZ0 A;  5J2Q B;  4LFC J;  3HHN B;  2MQL A;  2NPF A;  3QJJ A;  2NYI A;  4UQG A;  2D3O 1;  1VQL S;  4CLK A;  1TAQ A;  3CT9 A;  4WXW A;  1EKR A;  1R31 A;  1VYA A;  2D74 B;  4WK3 A;  5IQQ A;  4DPT A;  3EZ5 A;  3EPG A;  1SCJ B;  3QIP A;  2AEF A;  3FNN A;  3M2V B;  4ICL B;  4FXV A;  3CD0 A;  3DOL B;  2WAQ D;  4ZPD A;  1OS5 A;  4J9P A;  2MZR A;  2PMZ D;  1YK9 A;  3W65 A;  2BE9 B;  2RKI A;  4Y2C A;  2CQG A;  2HMI B;  5GAE I;  3F73 A;  3OVS A;  1HPZ B;  1VBX A;  4KJI A;  1EZZ B;  4OI0 A;  1S5Z A;  5KFX A;  2UVV A;  1SJ4 P;  2M8D B;  3PO5 A;  2XNQ A;  1ZAV A;  1HI1 A;  2EVZ A;  1S7H A;  3LAN A;  1S1T B;  3QT5 A;  2J7K A;  4KC5 A;  5DRK A;  3J7Z T;  3VR1 A;  2RKI B;  1N4L A;  3KHG A;  4WP8 A;  1UZD A;  1N5T A;  2MGZ A;  1RHQ B;  2WON A;  3D0G E;  3HSZ A;  4S0M A;  2WVB A;  3AOB A;  1GX5 A;  1SH3 A;  3BRE A;  4CH7 A;  3TVY A;  2U1A A;  3W64 A;  4X64 J;  1NJI T;  1NLK L;  2NLW A;  8AT1 B;  5D77 A;  1YRU A;  5ETN A;  1HNV A;  1SL2 A;  4F8R A;  5JVG Q;  4WPA A;  1HWI A;  1K8A T;  5HQ8 A;  2F8M A;  3BJY A;  2VC0 A;  5IM0 A;  2PO4 A;  3IGV A;  2UVU A;  2XB2 D;  1EQ0 A;  4L3K A;  4JI1 J;  2XY6 A;  2RUG A;  3CPW R;  2E5H A;  3GE9 A;  3M6X A;  4NLT A;  4I67 A;  2OLW A;  2XC9 A;  3VQS A;  2R2R A;  4AT1 B;  4Y28 C;  2R42 A;  5I3Q A;  4ALZ A;  2NZ4 A;  1W25 A;  3G87 A;  1WHX A;  1RAO A;  3GR0 A;  4J9R A;  4DV7 J;  5CHC B;  4DR6 F;  2DK2 A;  3UI3 A;  4OX8 A;  3BH6 B;  1RP5 A;  1Y5N B;  2MLZ A;  3A13 A;  3JS9 A;  2KG0 A;  3EZU A;  4N7T A;  3AB4 B;  4DUZ F;  2UUA F;  4Q5V A;  1BGX T;  2V4J A;  3QQC D;  7FDR A;  3GIM A;  1T9T A;  2Y0B B;  3QO9 A;  2LXF A;  1HNX F;  1RTJ A;  3JSB A;  3MM9 B;  1KTV A;  2QLW A;  3KFW X;  3D9B A;  3NMR A;  4CLP A;  1WUU A;  2HGM A;  3AA8 A;  4LFA J;  1NU4 A;  2GCF A;  1FVQ A;  2HQI A;  2DH8 A;  1S48 A;  2JH3 A;  3FCH A;  4M5I A;  1D09 B;  2EFQ A;  4HT5 A;  4YDD B;  4RL1 A;  1S1W A;  1MN7 A;  2QV6 A;  1S6Q A;  1HIY A;  2YKM B;  3A8E A;  1FD8 A;  1FRI A;  1N0V C;  2QSW A;  3QFH A;  4G6V B;  4CI0 B;  3EJM A;  4EUV A;  1EIY B;  1B7F A;  3U1L A;  4X66 J;  4CT8 A;  3ZZY A;  5HMZ A;  2PA8 D;  3K89 A;  2R7U A;  3KJF B;  4X4T A;  2U2F A;  2C2R A;  3CC7 S;  1FFS B;  1YQH A;  5ETV A;  1TU0 B;  2XO6 A;  2O66 A;  6FDR A;  4JI3 J;  4LQ9 A;  2Y8Y A;  3RUB L;  3CDW A;  2DGO A;  2DXE A;  1VQ8 S;  3CDB A;  2HAI A;  5I3P A;  3UVJ A;  3D66 A;  5AXN A;  2BOP A;  2P9G A;  3KK2 B;  3GMG A;  1FES A;  2AQ4 A;  2KFZ A;  2RE1 A;  2RQ4 A;  3VTI A;  2HBY B;  3DLG A;  3A8I A;  3UR3 C;  5DS7 A;  2YNI B;  4DEZ A;  4GC6 A;  4B3M F;  1JXV A;  1RWK B;  2B8P A;  2UXD J;  4WU3 A;  3RR8 A;  1FI4 A;  1RYS A;  5DZ7 A;  3D6H B;  5HRO B;  4P10 A;  2KM8 B;  3M9O B;  1YG0 A;  2CQB A;  4OYB A;  1O6X A;  4KHM A;  4YUD A;  1Q5Y A;  1SKR A;  2A2D A;  3QRR A;  1H2U X;  1V5I B;  2W9C B;  4GKJ F;  2F8H A;  1OYE A;  5EGY A;  3HP6 A;  5E33 A;  1CJT A;  1VBK A;  3NWR A;  3N6N A;  4MIW A;  1UAW A;  2EI5 A;  3KJV B;  4DUZ J;  1MML A;  4TLQ A;  2H65 B;  3MFH A;  1H3D A;  3BV8 A;  4AE5 A;  4AUK A;  2HVD A;  4X65 F;  4DFJ A;  4IRK A;  5M2U A;  3C16 A;  1IM6 A;  4CO4 A;  2V8V A;  4P2X A;  1C2P A;  5IS2 A;  3LH2 S;  3LPE A;  1MU2 B;  5EX0 A;  2BQR A;  1VK8 A;  1QVF R;  1QM9 A;  2FZK B;  4F02 A;  2FVR A;  3QYY A;  4Y2A A;  1NHV A;  5HSP A;  4A8M P;  3CDU A;  3QZ8 A;  2HFU A;  3TJ9 A;  3ET6 B;  1NK6 A;  4FVM A;  3OPK A;  2W7A A;  3KUG A;  3N01 A;  3T1A A;  1TKT A;  4IG0 B;  4OQJ A;  3JSR A;  5A0Y B;  2O1P A;  2ASY A;  4OJH A;  2KHD A;  5L38 A;  2ZIT A;  1IBM F;  3EVO A;  3VAL A;  3FSI A;  4XDD A;  3SCL E;  2JEF A;  4LFC F;  3M8Q A;  4BLG A;  2W2N P;  1LKZ A;  2IM2 A;  4P7V A;  3SI8 A;  1U1M A;  4AXI A;  1Q5V A;  3CWJ A;  2QA1 A;  3GV8 B;  3CJ4 A;  4P2F A;  2F4V F;  3HHL D;  4DQS A;  4OLP A;  4L76 A;  4RW6 A;  1GH8 A;  3G4S S;  4J90 A;  3V81 B;  1NK7 A;  1R8A A;  4IDK A;  3TAN A;  5IOL A;  2IM1 A;  3G71 S;  1KSP A;  2V69 A;  3DM2 A;  3TA0 A;  5E0O A;  1RHJ B;  3HK2 A;  2V6A A;  1NKC A;  4PQU B;  3HZE A;  5BYR A;  2C3O A;  5CA5 A;  3D2W A;  1XNR J;  4RJV A;  3TVK A;  2YX7 A;  3KJV A;  2HS4 A;  2DIU A;  1GMV A;  5A2Q U;  3L7P A;  5HMW A;  1U26 A;  2WK4 A;  4L3N A;  3P5T L;  4K2X A;  3G6E S;  3SSS A;  3T9N A;  4CYU A;  2BXJ A;  4AL7 A;  2AJ0 A;  2ZUA A;  2Q79 A;  5ADZ A;  1HWL A;  2QRR A;  3D0I E;  3EGW B;  8ATC B;  5LJ3 Y;  3DHX A;  4X4Q A;  2CNL B;  1HHQ A;  5LMN J;  3TA1 A;  1ZTT A;  3C6U A;  1UL3 A;  3MR2 A;  3AJ1 A;  2AJ2 A;  2ZH4 A;  3GSI A;  1UEK A;  1PBU A;  2CAJ A;  2EK1 A;  4NRU A;  5H9E J;  2OKQ A;  4URS A;  5E41 A;  4X62 J;  5D8H B;  2G2O A;  2N3O A;  4K50 A;  4CLS A;  4QW8 A;  3FBE A;  5KFP A;  3US5 A;  1U2R A;  3BPD A;  2FIU A;  2IC3 B;  3EDQ B;  3QJL A;  3ISN C;  4B9N A;  5AJ3 F;  3DMJ A;  4U8V A;  2AGP A;  4M5J A;  3CJ0 A;  2Y1R I;  2X7I A;  3MMB B;  3W66 A;  2J6T A;  3C46 A;  4ETZ A;  1GAO A;  2YPY A;  1EKS A;  5F9N A;  1S4E A;  1HL6 A;  3LF0 A;  4DV1 J;  1QAY A;  2GGP A;  3KWM A;  4AL6 A;  2VPZ B;  3CO9 A;  3N6L A;  4NLV A;  4TXS A;  1X4A A;  1RT3 A;  2CZ9 A;  2ZJP Q;  4ECQ A;  3CJ5 A;  3H5S A;  1ZOT A;  3IS9 B;  2DNG A;  5D4P A;  3W60 A;  1SIZ A;  1AUS L;  1HWU A;  2A18 A;  3NS6 A;  4DZ6 A;  1D1U A;  3TQE A;  5EWE A;  1MLA A;  2HQ3 A;  2QSF A;  2DIS A;  3A8J A;  3G86 A;  4QQB A;  3W2W A;  4URG A;  4X4S A;  3U02 A;  5KTQ A;  3PW5 A;  1WEZ A;  3UN5 A;  2YH0 A;  3GIL A;  2DY9 A;  4EEY A;  1LW0 A;  3N0V A;  3OTD A;  2YBV A;  3C14 A;  4IKA A;  2E1C A;  4LR9 A;  3M2U B;  2MQN A;  2N3L A;  2R9L A;  5D0R A;  3V6K A;  4MK8 A;  1MWY A;  1FKO B;  2B0G A;  4JI4 F;  1S99 A;  1WOP A;  2YKP A;  2UP1 A;  2MQ8 A;  3FZB A;  3VZH A;  4ZDN A;  2IFX A;  2J8S A;  4ZPA A;  2RDD A;  3KG0 A;  1FNM A;  4DSI A;  1U09 A;  3VAK A;  4DUY F;  1VHI A;  1LXN A;  1WHW A;  3B8H A;  3NGR A;  1Q86 T;  3D3B J;  2WVF A;  4N8N A;  1VQ9 S;  3CUL A;  2YKA A;  2QJ3 A;  5F8N A;  5F3T A;  2OTL S;  3D67 A;  1WWH A;  3ENA A;  3PTW A;  1BMQ B;  5C2C A;  1X9M A;  1NEE A;  2FDN A;  2VBX A;  2DEJ A;  4ZPB A;  2XYG B;  3SFU A;  4BHQ A;  4QW9 A;  2K3K A;  2R8H A;  1IKY B;  4NXN J;  1DTT A;  2RJZ A;  1FVS A;  5DGB A;  4CCH A;  2DD8 S;  4EYH B;  4CLY A;  4PRF A;  1N88 A;  2Y0S D;  5HVH A;  2R2U A;  1WDT A;  2ZHO A;  2CJB A;  3TUI C;  2QEX S;  2HNY A;  4DX7 A;  3HD1 A;  4U67 Q;  1JLG B;  1LEO A;  1MMD A;  2JFK A;  4FBU A;  1I94 F;  4ZHR B;  1FJE B;  2OHD A;  2ZJQ Q;  2E5L J;  2GVZ A;  2JZ5 A;  2M88 A;  1VI7 A;  3TW0 A;  2FHO B;  1NND A;  2CQH A;  4LR8 A;  2VBY A;  5BYS A;  3T9Z A;  4F50 A;  1RSC A;  3BDE A;  2OI2 A;  2OPR B;  2WSF C;  3ADA C;  2XMA A;  2ILY A;  1Q82 T;  2KXH A;  3A1Y G;  5DM7 Q;  3PEJ A;  3V4I A;  1BWE A;  1HAR A;  1HBU A;  2VL1 A;  3HFZ B;  1YWX A;  1S9E B;  2WOM B;  2DNQ A;  2CJX B;  4N56 A;  3S1T A;  3BZQ A;  3IM8 A;  5HK4 A;  4BC7 A;  4ZLL A;  2XLI A;  2MHE A;  5IFM A;  4A47 A;  3RAX A;  4FF3 A;  4W98 A;  1W26 A;  2Z30 B;  4ZPV R;  1R0A B;  2ZH7 A;  2D3O R;  2IY5 B;  3FMW A;  5C42 B;  3NMA A;  4F25 A;  1FER A;  1DLO B;  1Z4U A;  1BLU A;  1W2I A;  4RBU A;  3V4M A;  1YIJ S;  1JLF A;  4NA1 A;  2I8E A;  2HAF A;  4LVO P;  1HNX J;  3GFY A;  3ZZT A;  2M0G B;  1BXN A;  3W5X A;  1P1T A;  1I5O B;  4Y2K A;  3R1L A;  1QAI A;  2W8K A;  3Q0A A;  2NRE A;  1TP7 A;  3PX6 A;  4A48 A;  4HH1 A;  2ADC A;  4M5K A;  1HD1 A;  2VF3 A;  2AP6 A;  2EFO A;  2W4D A;  3AA9 A;  4KGX B;  4C3L A;  5GAE U;  5IV3 A;  4XPC A;  3G2X A;  4B3R F;  2B4U A;  4CH1 A;  1CJU A;  4KGZ B;  3MAH A;  2BAN B;  2UV8 A;  4ID5 B;  1UET A;  2IAJ B;  4USI A;  1ROF A;  5DG8 A;  4C7Q A;  1S1V A;  1ZZN A;  2UVW A;  2BQU A;  3SBM A;  3KLF A;  1ITP A;  3DGP A;  5LM7 E;  2R4F A;  1HQ2 A;  1DAR A;  2VG5 A;  3LW5 C;  3MCM A;  2OJ3 A;  1KLM A;  4JI7 J;  2GO8 A;  3JQJ A;  2KHC A;  4OHY A;  3OTC A;  1DAX A;  3EDR B;  2AU0 A;  1Q1K A;  1HNI B;  1NSP A;  2DHX A;  4BCA A;  2Z8Q A;  5J2N A;  1XNR F;  1FRJ A;  3CE8 A;  2YXL A;  2VG5 B;  3GG0 A;  4J9L A;  1RT4 B;  3R5D A;  4DX8 H;  1ZTW A;  2YKN B;  2E5L F;  4JI8 J;  1CJK A;  2MXY A;  1S1V B;  3KK1 A;  2CG8 A;  1RBA A;  3I4P A;  1ZA2 B;  1RTH A;  4XO0 A;  1EP4 B;  1XER A;  4PG5 A;  1GMU A;  3BN7 A;  1B64 A;  4JOU A;  4X4O A;  4IH7 A;  3PFE A;  1RAI B;  5C25 B;  3BM7 A;  1FE0 A;  3ITH B;  3O6Q A;  3H2L A;  2HHX A;  3BS9 A;  4YY3 J;  2AX0 A;  2BAC A;  4XTT A;  2K06 A;  3TO8 A;  5C7P A;  4UT4 A;  2V4Q A;  1R27 B;  4J9S A;  3V6D B;  1WOO A;  3LO3 A;  4NMX A;  3CCM S;  5C5J A;  2VDI A;  3ITH A;  4RW8 B;  1WC6 A;  4QU7 A;  5FJ4 A;  3WQP A;  4OHX A;  4ZP6 A;  3KLG A;  1XTZ A;  3FDS A;  1D9A A;  3DOK A;  1AA1 B;  4UUX A;  4FYD A;  4NA2 A;  4JV5 F;  3W9H A;  2EEY A;  2YKN A;  2QX0 A;  3PR5 B;  1WTF A;  2MKY A;  4NZ6 A;  1N56 A;  1IVZ A;  3SYZ A;  2C3Y A;  3G6X A;  2MLX A;  3RAM A;  5GME A;  2YY3 A;  4NCG B;  1WJ9 A;  1LV5 A;  3HZG A;  2XHC A;  3DGP B;  2DB1 A;  1RIS A;  1Q79 A;  2CDR B;  4YDX A;  4ZP8 A;  4JB8 B;  4LT6 A;  5F8I A;  3KLF B;  3T1H F;  3FEY B;  3M32 A;  2RIJ A;  1RT6 B;  4FS1 A;  4J5O A;  3JTO A;  1S0V A;  3KTQ A;  1B0T A;  1Y4Z B;  3MM6 B;  3QGH A;  2W9B B;  4WFY A;  5AT1 B;  4RNN A;  2AIR B;  2LXI A;  2PMW A;  3K5O A;  5E7O B;  1PJ5 A;  1FF2 A;  4A8Q A;  4KKO B;  1H38 A;  1BQM A;  3PYF A;  1NBE B;  2VDH A;  4O3Q A;  2ALZ A;  1NK0 A;  2LDY A;  4WJB A;  2GHW A;  4C11 A;  2YWF A;  3K8W A;  5KT4 A;  3BH7 B;  4USJ C;  3GFX A;  2OTJ S;  2CG4 A;  2RML A;  3OT9 A;  1U4B A;  2LEB A;  1QLN A;  2DT9 A;  4CH0 S;  1C1B B;  2DEI A;  1TUV A;  3O44 A;  5C24 A;  2KXN B;  4DQQ A;  1AUD A;  2DGX A;  4NXM F;  2ZH6 A;  1OYD A;  5A8W B;  3OVB A;  5E3P A;  4M5G A;  4YY3 F;  2L48 A;  4GKK J;  2O3D A;  5HP1 A;  4BWJ A;  3GLJ A;  2K7J A;  1UMJ A;  2PEB A;  3VAJ A;  2ERR A;  1GXL A;  4QYR A;  2C2Z B;  4DS4 A;  4GKJ J;  5IC4 B;  4MFB A;  5CAB A;  4F26 A;  4NLD A;  3BPS P;  2LP4 A;  1H72 C;  2QLX A;  2VQF F;  1AT1 B;  4HR2 A;  3C3L A;  2CQ0 A;  3H0P A;  1NKE A;  4MKA A;  1HPZ A;  2IIH A;  4ZVF A;  3S01 A;  3NGD A;  4DV4 J;  2HHV A;  1JLA B;  1S6U A;  3M2U A;  3UCU P;  1GXT A;  3PYG A;  2GMH A;  2CPX A;  1NXI A;  2G2Z A;  3M1V B;  2GJ2 A;  1M5S A;  3FBC A;  5FII A;  4ZCK A;  1NSA A;  5HP1 B;  2AKW B;  4ETX A;  5L1L A;  1UA1 A;  4G1Q B;  4YEA A;  4LSL A;  3HKW A;  4YB1 P;  3T6B A;  1IBK F;  2JX2 A;  2HRU A;  5LMU J;  1RWX B;  2BKO A;  1OO0 B;  2MEW A;  2YKO A;  3A4T A;  4C3K A;  3DLL Q;  1P9Y A;  2GQ2 A;  1VIO A;  2Q43 A;  1SXL A;  1YX2 A;  1P27 B;  3FRY A;  4H4K C;  2HPU A;  2IM0 A;  3MDF A;  1SBR A;  1DQA A;  4RUH A;  1KVI A;  4DN9 A;  4IUF A;  2AEM A;  5B0C A;  1IQT A;  1Y00 A;  2IDE A;  3H98 A;  3RGI A;  3VVU A;  3KLE A;  1UJ5 A;  1YBU A;  4NOH A;  4O0N A;  1NZ8 A;  1TL3 A;  3AQP A;  2B4V A;  2I5J B;  3I32 A;  3TYT A;  3W63 A;  3QZ7 A;  4DL2 A;  2OPS B;  2FC9 A;  1WKJ A;  2HFO A;  2ZKU A;  3HHE A;  3NOG A;  4NX9 A;  5CQG A;  5KFI A;  2ZDP A;  5AJ3 J;  2R2T A;  1D8Y A;  4OMF G;  3C14 B;  2OPQ B;  2VHG A;  1T0T V;  5DO2 A;  1RUS A;  1CVJ A;  3ONQ A;  4B3T J;  3J7Y I;  1KP6 A;  2FTR A;  3IMQ J;  4KGM A;  4UOF A;  1KQF B;  4DFK A;  1M1H A;  2JC1 A;  2I0X A;  4DF4 A;  4IQX A;  3OVA A;  3QRP A;  2K7K A;  3IAM 9;  3BGR A;  2IA0 A;  4BBY A;  1SKS A;  4I69 A;  2QO3 A;  1K0V A;  3MF5 A;  3F56 A;  1SB6 A;  2HWI A;  2KYZ A;  3FMB A;  5A2Q Y;  4RPF A;  2PN6 A;  4ED2 A;  4P75 A;  3CJS A;  2L3M A;  3IP0 A;  1XR7 A;  5A8R A;  5FDL A;  1QUP A;  1LW2 A;  4LFB F;  2HQF A;  4RW6 B;  4A8X A;  3DMJ B;  2E1R A;  4F04 B;  2FY8 A;  1RAF B;  3K17 A;  2HQC A;  2IRY A;  2CQD A;  5C25 A;  4LF7 J;  3HVT B;  5KFF A;  3P6Y C;  3DLH A;  1HQU A;  3CIZ A;  3HFV A;  2NZC A;  4Q2L A;  1LOU A;  3CCS S;  1IBL F;  2AYB A;  4OJ1 A;  4DR4 J;  1N32 J;  4GO5 X;  1PC4 A;  4MAK A;  5J2P B;  2JDJ A;  2PC6 A;  2VKR A;  4M63 A;  1NUE A;  4ZVU B;  3W1Y C;  1AXQ A;  3MEE A;  2KT3 A;  1ARO P;  2G0I A;  4R0J A;  4TN2 A;  3NKY A;  4DJB A;  5LT5 A;  3QJP A;  4C8Y A;  4B3O A;  4M5N A;  3MEC B;  4F3O A;  5KFE A;  1FFG B;  2AGO A;  2BQ3 A;  2I2Y A;  1OMS A;  2IBK A;  2DIT A;  3EVW A;  3R5C A;  5E3R A;  4RZR A;  2VU5 A;  2BJ1 A;  1YBA A;  1EB0 A;  5KG4 A;  3CJ2 A;  1HBO A;  4P6Q A;  5DDP C;  4FS2 A;  2DKO B;  3IG1 B;  4PQU A;  2L9W A;  1U7L A;  5D3G A;  2M9K A;  2GVD B;  5K5M A;  2Y1I A;  3I4H X;  2P6T A;  1X4C A;  2QTW A;  2M3D A;  4IH5 A;  4DG1 B;  1BUX A;  4IDK B;  4DZD A;  1OY8 A;  1RT6 A;  1V3S A;  3GV5 B;  1SL0 A;  4QPT A;  4CO3 A;  2ADB A;  4N47 A;  4B3S J;  4URQ U;  3KDN A;  1C4C A;  1YKW A;  3TAQ A;  1NPR A;  5J1P A;  2XMU A;  1RA7 A;  4CLT A;  1JMT A;  1R3N A;  2MY8 A;  1VK3 A;  2F8E X;  5AXK A;  2J6S A;  3CD7 A;  1UVN A;  4USH A;  4IOA Q;  3TAP A;  3A3O B;  1KHW A;  2GW8 A;  4KGV B;  2V9K A;  2W2M P;  3MCS A;  3WIV A;  2IJF A;  3GJQ B;  5CYJ A;  1FJC A;  2DYA A;  3M7V A;  1VLO A;  5DG9 A;  3CMQ A;  3H90 A;  2L41 A;  1RWN B;  1S6P B;  2JVO A;  2M5Y A;  4HT7 A;  4JV1 A;  1Q8B A;  3AXK A;  3QT6 A;  5THW A;  1N8R T;  1URN A;  2WBM A;  3KOA A;  2D41 A;  3PKM A;  2E1A A;  3CO0 P;  4DR2 F;  4DL4 A;  4IR1 A;  2DRD A;  1QE1 B;  3BBC A;  4R5P B;  2CKW A;  1JJH A;  2OPR A;  2WSC C;  2XCP A;  3HDS A;  1RHU B;  5CXT A;  1ZS6 A;  1VQP S;  1SI9 A;  1UPM B;  2NXJ A;  3ZNU A;  1F2G A;  3LAM A;  4M5L A;  5D3G B;  3CC4 S;  2HK3 A;  2BDP A;  2DRB A;  1RTH B;  2DBB A;  1HBO B;  1RJJ A;  1JLG A;  3GYN A;  2K8G A;  3BSC A;  1HA1 A;  2HNZ B;  1CJK B;  3KK1 B;  2IPO B;  1ZAW A;  1X4H A;  5CAA A;  2FJE B;  5GAG I;  2Q3P A;  1YI2 S;  1FWP A;  3QT7 A;  1S0O A;  4OX9 J;  2YPZ A;  5ETK A;  1LWC B;  4KIA A;  1HBM B;  3DXS X;  2JFD A;  2XWX A;  5C2G A;  4ED4 A;  2FGO A;  3BO3 A;  3FSY A;  4GO7 X;  2EKY A;  3THP A;  1RTD A;  4WZQ A;  1S59 A;  1J5E F;  2XHW A;  2ATC B;  2GO9 A;  4CZC A;  1FHT A;  2KZZ A;  4IFV B;  1DRZ A;  3KHR A;  4DV3 J;  3SZ2 A;  4DXL A;  3MTJ A;  5LSL A;  3TZZ A;  1CJU B;  1QTM A;  3L95 X;  1X5O A;  2M70 A;  3CED A;  2MJU A;  2RSQ A;  5CCL A;  1S1U B;  3ETM A;  3I5B A;  2RQM A;  1IUJ A;  2XMJ A;  3F44 A;  3JXO A;  4I2P A;  4EZ9 A;  4J7C A;  4DI6 A;  1PAE X;  3KLI A;  4OX9 F;  4LF6 J;  1RT5 A;  1ZM2 A;  1K44 A;  2JC0 A;  1FKO A;  3O1L A;  1AZS B;  3TRG A;  4H4K A;  2OH2 A;  1FRL A;  4C8K A;  1KS2 A;  2VA3 A;  4DL3 A;  4B02 A;  4W92 B;  5C42 A;  4C8Z A;  1Q8K A;  2VB6 A;  5L1K A;  4DF8 A;  1FD2 A;  2WSE C;  2ZBR A;  1YJW S;  2OP5 A;  4G65 A;  2GJF A;  3R6L B;  2HHS A;  2MKS A;  3NXZ A;  1PCA A;  4ENO A;  4ZIW A;  1RCO B;  4DR5 J;  2RF2 B;  2M8H A;  2KDO A;  2W4P A;  4DV0 F;  2ZUG A;  3HUL A;  1JXL A;  4JV5 J;  1N6Q B;  1TR0 A;  2RUS A;  3R9L A;  3Q8V A;  4X64 F;  2B4O A;  4DL7 A;  2AV5 A;  1LFW A;  2VG6 B;  2VV5 A;  2RRN A;  4MYT A;  2CQP A;  3Q89 A;  3PAC A;  1E6V B;  2BRK A;  3AJ2 A;  3N5F A;  4OV6 A;  1N34 F;  2XUL A;  3DCA A;  3DRS A;  4IG3 B;  4ZHR A;  3NP5 A;  1RAJ A;  3MMB A;  3P45 B;  3D1H A;  1PG5 B;  2YQ3 A;  3K59 A;  2C28 A;  1JX4 A;  4ZVO B;  1KVK A;  2GS8 A;  2ILZ A;  4LBI A;  4CLW A;  1GEH A;  1VQS A;  4O0I A;  3Q8P B;  2XQC A;  4B9S A;  4JI0 J;  4LF8 J;  3PG9 A;  3KK3 B;  1SQG A;  1DTQ B;  2XWY A;  3A3N B;  3CVK A;  3L9Z A;  4DLE A;  3ZZP A;  3KYL A;  2FVS A;  4CM0 A;  2FHK A;  4FKY A;  4ZVQ B;  3RRH A;  2G13 A;  4OYM A;  2FJW A;  2HHQ A;  3SMZ A;  3QGG A;  4CYU B;  5KFG A;  5H9E K;  2WON B;  2MST A;  2RAQ A;  2HW3 A;  5I3U B;  2B8Q A;  1BQM B;  4ZVS B;  4F67 A;  3S7R A;  2CVI A;  1KTQ A;  4PG4 A;  2AD9 A;  4KRW A;  2Z4P A;  2J9E A;  2EFP A;  2V68 A;  2ZWO A;  1T3O A;  3R5A A;  2M52 A;  4A8O A;  3BO4 A;  2QE5 A;  3MM6 A;  4I2Q A;  2DGS A;  4O3R A;  1KNZ A;  3R2D J;  3OQ2 A;  1VQN S;  4AFF A;  4X66 F;  2VG6 A;  3E51 A;  4F4Z A;  3WC2 A;  1Y11 A;  1UEV A;  4FF1 A;  4E2F B;  3OR1 A;  4C8M A;  3MM5 B;  1BD6 A;  4ZCM A;  3TUZ C;  3HCX A;  3AD8 C;  2QC3 A;  3G8T A;  3P4U B;  5GMD A;  3J80 U;  3T5H A;  5A76 A;  3OFH A;  3R5B A;  5FLX Y;  3QBC A;  1S7I A;  3GTY X;  4OZ2 A;  1WAC A;  2YWH A;  3J80 Y;  3HPO A;  3IN5 A;  1PIE A;  4DSE A;  2QT7 A;  1UVJ A;  1DFD A;  1KLN A;  1T8E A;  5DJB A;  1NJW A;  3DOK B;  4UOG A;  3Q23 A;  2HQG A;  2Q1L A;  3LTO A;  1UFK A;  3QFW A;  2X1F A;  5KFJ A;  2L9D A;  3MR5 A;  2E5G A;  2BM1 A;  2QZ8 A;  3IRX B;  4QWD A;  1EJ7 L;  2QIF A;  1BC6 A;  1H2V Z;  2VH7 A;  5LMU F;  1RB0 A;  2OPP A;  1UFW A;  5LOQ A;  5F0U A;  2W9A A;  4KO0 B;  4Q44 A;  2Z57 B;  1VDH A;  4M5M A;  2ROG A;  4GVL A;  4DR1 J;  1T3N A;  5B0A A;  5DLF A;  2OSQ A;  5M2R A;  1RT2 A;  1WHY A;  4ZP9 A;  3ZZO A;  2IC3 A;  1S1X A;  2YWE A;  3PHE A;  5D0H A;  5K9F A;  3UQS A;  3SV3 A;  2C2D A;  1V5V A;  3MM8 B;  1AW0 A;  2IYI A;  1GNK A;  1WNE A;  3HHK A;  1YJU A;  2MB0 B;  1REV A;  4Q0B B;  1AFI A;  3GYG A;  1T05 A;  3NGS A;  4ITS A;  2OAU A;  4DR7 F;  1HNI A;  5J2N B;  1HFE L;  3NG8 A;  4PWW A;  2CPF A;  3MPD A;  2JWN A;  3CCU S;  1F5B A;  4QBU A;  1CC8 A;  3M05 A;  4WFX A;  1DQ8 A;  2QG9 B;  4ID5 A;  1JLQ A;  5D0E A;  4C48 A;  4O44 B;  1SQE A;  1YJR A;  3JQK A;  2EPI A;  3W62 A;  3Q8Y A;  1CQM A;  2QMU B;  2QN6 B;  3GG1 A;  3HT0 A;  4RW8 A;  3MFI A;  1FXR A;  4IYQ A;  2FVC A;  1QAJ A;  1WI6 A;  3V6D A;  2LXU A;  2XSJ B;  2KKH A;  3FSX A;  3PRD A;  3MMJ A;  1FNO A;  1T03 A;  1WTB A;  3Q22 A;  3J7Y U;  4DX6 A;  5KFR A;  1X31 C;  3IRX A;  5IXU A;  4YS2 A;  2XLK A;  1H7W A;  3VZI A;  3VVT A;  3HFK A;  1JLF B;  3C19 A;  5D15 A;  3J81 Y;  3CJ8 A;  4EMD A;  1S6Q B;  1FE4 A;  1FKP A;  2AYM A;  3L4B C;  4ED8 A;  3PW7 A;  3WZ0 A;  2FZC B;  5IT9 U;  2UUC F;  2HFN A;  4HKQ A;  4OI3 A;  5CD4 A;  3P49 B;  1R8H A;  5A0Y A;  1S49 A;  1K1Q A;  2XMM A;  2H4Y B;  1D0E A;  2BW2 A;  3JAM Y;  2CVE A;  5IZH A;  3G6Y A;  1P1L A;  1N34 J;  4ELT A;  2K3I A;  4NLG A;  2HGL A;  2DHG A;  5FLX U;  4ZVE A;  1V9O A;  1U1Q A;  1REV B;  2CFX A;  2W2Q P;  1Y3K A;  1X5T A;  2LMI A;  4UQT A;  4CDI A;  2IMW P;  4LF6 F;  1RAH B;  2BJD A;  2FC8 A;  2V4J B;  3M8Z A;  4JYA F;  3W9J A;  3JYT A;  3M2R A;  4PCQ A;  1MSW D;  4DG1 A;  1NJX A;  2KB2 A;  4K5S A;  3T5J A;  4NLQ A;  2GVD A;  4ZVR B;  4HYK A;  4JI6 J;  3DXB A;  1YHQ S;  3RRG A;  2MKI A;  3D54 A;  2R8G A;  1QAX A;  3PFO A;  1QJH A;  3TZX A;  4K2J A;  1IJF B;  3IBC B;  2MZJ A;  1NH7 A;  2IVF B;  3F41 A;  3OTO F;  1SH2 A;  2XGP A;  2WW8 A;  2DNL A;  3IXQ A;  3MEE B;  4A46 A;  1RKI A;  2UVR A;  2CPD A;  2YNI A;  3UNG C;  1Q7L B;  3D6T B;  2AW0 A;  4WE1 A;  1WF2 A;  1HQU B;  1OPI A;  2ZM6 J;  3UVJ B;  4FNH A;  3K5N A;  2EFN A;  2HHU A;  1RTD B;  5HVF A;  1XNQ F;  3VGS A;  2E9R X;  4DV6 F;  2IVM A;  5F8M A;  1FX2 A;  4F0K A;  3GFH A;  5A8R B;  1VQ7 S;  3N28 A;  4M94 A;  4CP5 A;  2QL7 B;  2QYG A;  2WVC A;  3TZW A;  4FP9 A;  1F3V A;  1NRK A;  4DV4 F;  5B08 A;  2F4V J;  3BGU A;  3GIK A;  3QLH A;  1B99 A;  3GPA A;  1S1W B;  3RB4 A;  2E9T A;  2LKZ A;  4FVC A;  1Y7P A;  2DRA A;  4JI5 J;  4ICL A;  3J7A N;  3PW0 A;  4LRC A;  1SKU B;  1F3F A;  4P2S A;  5MLC V;  1U0H B;  2CQ1 A;  2XYP B;  4FF2 A;  3S8S A;  4V19 J;  1LWX A;  3K5P A;  1RDR A;  3NCP A;  4I4B A;  1FTR A;  4LSN B;  3H5X A;  3RW6 A;  5LL6 d;  1H73 A;  1DTQ A;  4ED3 A;  2XYH B;  2V2V A;  1S9G A;  2F40 A;  5GAG U;  2AJ1 A;  4A8S A;  2B5J A;  4G1P A;  3L09 A;  5LXY A;  2ASD A;  1RT5 B;  3CJK B;  2G4B A;  3MMA B;  2XM3 A;  3LAK A;  5D4N A;  3I56 S;  2MKJ A;  1HMV A;  3CD6 S;  1N5S A;  2IDL A;  2Q6B A;  3UCG A;  2OO4 A;  3A12 A;  3ETO A;  3TA2 A;  1OJ4 A;  1RAB B;  2HRT A;  2FVQ A;  3U1N A;  2HFZ A;  3W8G A;  1T9W A;  4IR9 A;  3C6T B;  1Q95 G;  2Y8W A;  1R8C A;  1RCX B;  4R8U A;  5KFB A;  4IFV A;  2WB1 D;  1CBK A;  2F63 A;  2C3P A;  4LSN A;  2KG1 A;  4RNM A;  1KFS A;  1HNW J;  3UDC A;  1NDK A;  1U0H A;  2YNH A;  1HBM A;  1VQO S;  2D69 A;  4LFA F;  3HKZ D;  1FRK A;  4C6A A;  4PG6 A;  3CMA S;  1QUV A;  3S6E A;  4NCB A;  2HNZ A;  3M8P A;  4FYW B;  1UW9 A;  2KJV A;  1JLA A;  3DDN A;  4LRE A;  2XMV A;  5BYQ A;  3VGV A;  4YB7 A;  2XCA A;  2RT3 A;  1TKZ B;  1IKV A;  1RWM B;  2F9J A;  1S0N A;  2AF6 A;  3KLI B;  3GIR A;  1I6J A;  3DRR A;  2DHA A;  1RAD B;  4ZIV A;  3D68 A;  3KJQ B;  3NOC A;  3LP1 A;  3GQC A;  3TVZ A;  2VJV A;  1K9M T;  2XLJ A;  3QSY B;  1OWX A;  2OSR A;  4J91 A;  5KFN A;  2W7O A;  1BQN B;  4CQ1 A;  2GHP A;  9RUB A;  4F4W A;  2HEK A;  4NLY A;  4KGK A;  2XTJ P;  2V2Z A;  3LGH A;  1K0T A;  4OYP A;  5HJY A;  4R25 A;  2W8L A;  2MKH A;  3W7B A;  1HD0 A;  1IQZ A;  1M5V C;  1HI8 A;  4LF4 J;  2BE2 A;  5H9F K;  1GTH A;  2DCL A;  2H54 B;  4TYB A;  3SFG A;  5EUH A;  4R8U B;  1D8Z A;  2KJW A;  2ZOF A;  3D1Q A;  3NNA A;  4IOB A;  1RWV B;  1XR6 A;  1JLB A;  3C6U B;  3EPI A;  4IG0 A;  3U7J A;  3NNC A;  2NPI A;  4B17 A;  4ERD A;  3MD1 A;  4DHV A;  1YSJ A;  2OEL A;  3DNC A;  4O3P A;  2BEF A;  3CCV S;  2NUH A;  1JLE B;  3MXH P;  2B7C B;  2GML A;  1G6B A;  2KL8 A;  4PQA A;  4ECS A;  4K4S A;  3AJD A;  1LXJ A;  2IYG A;  4CLZ A;  4X65 J;  3OV7 A;  2FJA B;  4FDF A;  1SJF A;  1VQ6 S;  3Q86 A;  3MMC B;  4WWS A;  1MG7 A;  3PZP A;  5H9F J;  1VBZ A;  2C2O B;  1QSL A;  4DCP B;  4DR3 F;  4LF4 F;  3QWU A;  3HVA A;  2EG1 A;  2VKZ G;  4XPE A;  3Q8Q B;  3JYT B;  3CCL S;  4QCL A;  1RT7 A;  1SPB P;  4K4X A;  1CJT B;  3VGT A;  1IKX A;  1Q0N A;  3R6G B;  3EGV A;  2GJI A;  2C2K B;  3GYX B;  3SCI E;  4N5S A;  3H7H B;  3H2U B;  2CPE A;  3FBB A;  4DUY J;  3M8Q B;  3KG4 A;  4DQR A;  2FLN A;  1S6P A;  4K4Z A;  2RRB A;  2QL5 B;  2RDI A;  3HJF A;  2YX4 A;  4ED6 A;  2R8I A;  2BVZ A;  1G7C B;  1BE4 A;  3MCN A;  1ZYQ A;  2OD6 A;  4CWB A;  3HVW A;  2PDA A;  3TWZ A;  3MM7 B;  3ZZR A;  4EZ6 A;  3KLG B;  3GSD A;  2ZZM A;  4K0K J;  2F65 A;  1IBC B;  2BUN A;  3T1Y F;  5D6G A;  3GII A;  3DLK A;  5KAK A;  4OZ0 A;  2VIH A;  1WG1 A;  4ZPT R;  4JI5 F;  3PNI A;  1YZ6 A;  2WVE A;  4ZK7 M;  2PI4 A;  4CTA A;  3R7S B;  4CNY A;  4N77 A;  1FTC A;  1SUQ A;  2HFV A;  4I1T A;  1RKJ A;  2VC1 A;  5AE1 A;  1D9D A;  2H48 B;  2ZH1 A;  4QWB A;  1EET A;  4CNZ A;  3J81 U;  1REG X;  1X7V A;  2A3J A;  2ZJR Q;  4DL6 A;  1UPP A;  4KB7 A;  4MJK A;  4Y65 A;  5B0B A;  4DL5 A;  3MCO A;  2A1B A;  3W5Z A;  4KY3 A;  5HAN A;  3MEC A;  5GAD U;  1Y3J A;  1UCN A;  3FCW A;  1XEZ A;  3VAH A;  4DV6 J;  4DSK A;  4I7F B;  1RTJ B;  1RWU A;  3VAF A;  4DLG A;  1RHM B;  2ZZN A;  2KZM A;  2RH3 A;  5FD1 A;  4ED7 A;  2LQ9 A;  4R0E A;  4USV A;  3HX9 A;  2ZWP A;  4DPO A;  3PV8 A;  2BAN A;  2BM0 A;  4CM2 A;  2ROE A;  4DR6 J;  4RUB A;  3J7Z 5;  2JL9 A;  2RIL A;  4H4M B;  4MK9 A;  4ZJL A;  3KLH A;  3I87 A;  2HG4 A;  3FEX B;  5JMN A;  2UUW A;  3HF5 A;  4DN0 A;  1APS A;  5KT7 A;  2NXU A;  3AXM A;  4KO0 A;  5KFT A;  4RNF A;  4QIW D;  1KON A;  5HJX A;  5MAO A;  3CW2 C;  5F8G A;  5EWF A;  2HVI A;  2GIR A;  2I9S A;  2XSF A;  3EUN A;  4DSF A;  1VQ4 S;  2VFR A;  1N5Y A;  1RAA B;  5EX3 A;  4MIB A;  4YQW A;  4O4R A;  1U25 A;  2CQ2 A;  3I6P A;  3H20 A;  1FT8 A;  3OFG A;  1XMB A;  3H5U A;  1M5O C;  2VBW A;  2VOD A;  4YB5 A;  3J81 j;  4U96 A;  1SVD A;  1Y0H A;  4B3M J;  2DGU A;  4QR0 A;  4WBF A;  1N0U A;  3R97 A;  3I0S A;  3CC2 S;  3IGN A;  2PSZ A;  1Z1Z A;  4NA3 A;  2RS2 A;  2VIC A;  4JI0 F;  2A6O A;  2W7P A;  1JLC B;  2J9D E;  3IWX A;  4LRB A;  3WX8 A;  3RR7 A;  2PD1 A;  4OHV A;  1IWA A;  4NLU A;  2WOM A;  3ELH A;  4RW4 B;  1M5P C;  1K47 A;  3MM5 A;  3OR1 B;  4EYI B;  3CTR A;  2ZHB A;  3IC1 A;  2F1F A;  1PYS B;  2YVS A;  3DOM A;  2OPS A;  5E5N A;  1T02 A;  4OLO A;  4C9D A;  3NNH A;  2MQM A;  1TL3 B;  4DMZ A;  4QOT A;  1Y5L B;  1M0S A;  2BJ7 A;  1RE1 B;  1CQN A;  4Q8E A;  5KFV A;  2DNO A;  3JTP A;  1I3O B;  2MKK A;  4F7V A;  2NSC A;  2N4D A;  3AHP A;  4DV1 F;  4RW7 A;  3RW7 A;  2Q6C A;  3U1M A;  3UDL A;  5I3U A;  1Q53 A;  2WB4 A;  4QWC A;  2NQP A;  3SQG A;  1SV5 A;  3NWG A;  4NYZ A;  2VPW B;  2ZNZ A;  2HKE A;  4WFA Q;  3DRP B;  3QMQ A;  3RJM B;  1U2C A;  2MTL A;  1X4B A;  1OQ6 A;  3UFC X;  1HNV B;  2EFG A;  1WD6 A;  1RWP B;  3D6M B;  2UUA J;  2IRU A;  5JVH Q;  3FQK A;  2XY7 A;  4PYD A;  3GJT B;  3EM1 A;  4ZJQ A;  3HMJ G;  2JLG A;  1QTN B;  5DGA A;  4DPY A;  3TUP A;  5KFL A;  1S12 A;  4EO6 A;  1NAQ A;  2HWH A;  2RDJ A;  3NGK A;  4DUT A;  4EK2 A;  1H98 A;  2Z56 B;  2C2M B;  5HQL A;  4TU8 A;  1FJG F;  1KQG B;  3QRQ A;  6FD1 A;  3DRS B;  2K1R A;  3Q8U A;  4C3M A;  1S10 A;  5HAT A;  5KFQ A;  2HND A;  3GWC A;  2BBE A;  2I38 A;  2MLY A;  3BGO P;  3OHA A;  2ZM6 F;  4QYZ J;  4ZS6 A;  1X5S A;  3VV2 B;  4Z37 A;  1N6Q A;  2V9W A;  1AFJ A;  4M5D A;  4A8Y A;  1RBO B;  2EKN A;  2BAB A;  3F0N A;  2VZ9 A;  3M2V A;  3BQ2 A;  2AJ4 A;  4HEA 9;  4MK7 A;  2LEP A;  3PX4 A;  3T1Y J;  2P5V A;  2AX1 A;  3G8S A;  3K7R A;  2ZC3 A;  3H4B A;  3NY0 A;  1S9F A;  4V1A k;  2CDQ A;  1Q81 T;  1UZH A;  1PIL A;  3BGL A;  3I5C A;  1IBL J;  3MOJ B;  4OL8 A;  3R8Y A;  4NZ0 A;  4C11 B;  2MHN A;  2W2O P;  5SUH A;  4H4O A;  2M2B A;  4F4Y A;  4F0H A;  2J7U A;  1J27 A;  3V6H A;  1OY6 A;  4ELV A;  5K8P A;  3TJA A;  1VQM S;  4N76 A;  2C2E A;  3FJ2 A;  2H9Z A;  5IT0 A;  3IR7 B;  4EBE A;  2KXF A;  1F2H A;  1FRH A;  1RZM A;  3TX8 A;  3OL6 A;  1SJ1 A;  4F2S A;  2LYV A;  3RAQ A;  2VBZ A;  2RU9 A;  4DWI A;  4WYL A;  3Q2T C;  1T9X A;  4K4U A;  4C0B A;  4PG8 A;  2DY1 A;  5AE2 A;  2VOO A;  2J7W A;  1ZBT A;  1KKH A;  4KT0 C;  3OL7 A;  1WKK A;  5IC6 B;  1LWC A;  1IM4 A;  1UEU A;  2HWT A;  3OXG A;  2AZ3 A;  3D3C J;  4U7U D;  3C66 A;  4RNO A;  2E1P A;  3GU0 A;  1U6Z A;  1QSY A;  2X1B A;  2CA9 A;  1CC7 A;  2KT5 A;  5E3Q A;  3WX4 A;  2VPY B;  3GFZ A;  3U27 A;  2GA7 A;  4UUW A;  3CCW A;  1CJV B;  5KG6 A;  2HK2 A;  2BA9 A;  4PUO B;  3K8V A;  2ALY B;  1LWE A;  4I6Y A;  3W2V B;  3QID A;  5KT6 A;  5ETT A;  4WP3 A;  2ZC4 A;  2W25 A;  3MED A;  3OBI A;  2W2P P;  4ILM A;  4X4R A;  4LRA A;  4FYX B;  2J9D A;  2E29 A;  4LF8 F;  3OL8 A;  4GVB A;  2HS3 A;  3R5G A;  3KHH A;  1EP4 A;  3BYR A;  3MPV A;  2DXD A;  2ASL A;  3P96 A;  5F8H A;  3I0S B;  5U47 A;  7FD1 A;  1RT1 A;  5K20 B;  4K8R A;  2HHW A;  2KTQ A;  2POK A;  5GAH I;  1M1G A;  3T19 A;  2IRX A;  4C97 A;  1R0B G;  3IM9 A;  5CD4 H;  3B4M A;  4LF7 F;  2LVW A;  2G0C A;  2P6S A;  2ACM A;  2DH9 A;  4L73 A;  3CB4 A;  3ILO A;  4FN5 A;  3I82 A;  1K73 T;  1CS4 A;  1NDC A;  2XO7 A;  3O3L A;  4OJ3 A;  1YIT S;  4PWD A;  1TFY A;  1HBU B;  1OY9 A;  1LWF A;  3D5M A;  3FFI A;  4KH0 B;  4IH6 A;  4NLR A;  2CRL A;  2X3G A;  3DLJ A;  5I42 B;  3MR6 A;  1XMQ F;  4U9R A;  2Y1J A;  3AQO A;  4OZ1 A;  2BOA A;  2OEK A;  3UD5 A;  4QWA A;  2YQ1 A;  4RBT A;  4A8K A;  3MMC A;  3DLB A;  3M30 B;  1C0T B;  2H5J B;  1DZ5 A;  1SJ3 P;  2E44 A;  1YZ7 A;  4OZN A;  1ZM3 A;  1VRQ C;  3PDN A;  2HBR B;  2D7S A;  4UTG A;  3RBZ A;  4HAC B;  1M5K C;  2ATL A;  2YTC A;  3RYL A;  4L74 A;  4PEO A;  3UNY A;  4OYW A;  3ZTS A;  4M95 A;  3BBF A;  2N82 B;  1SJR A;  4K4W A;  3JSY A;  2Y9H A;  2N7Y A;  1KOH A;  3C15 B;  1DTT B;  3WIU A;  4DR4 F;  1K1S A;  3AD7 C;  2UXB F;  1UJ4 A;  4NXM J;  1T9U A;  1HI0 P;  2DGV A;  3KJN B;  1WG4 A;  1R0A A;  4DV2 F;  5J2P A;  2R7T A;  2BE2 B;  1JB0 C;  4Y0F A;  2JLE A;  2CIM A;  2CWK A;  5EDW A;  2CJK A;  3NAI A;  4P9S A;  2NYH A;  1VRU A;  4KYZ A;  1S9E A;  2GAG C;  2B56 A;  2XEX A;  3PRB A;  2DGW A;  4J9K A;  3V4I B;  2WZ1 A;  1T9V A;  3THV A;  3RBX A;  3TQ1 A;  5K14 A;  2C2N A;  2HLT A;  3KUH A;  5E2Q A;  2UUB J;  1WDD A;  2AYE A;  5L9N A;  1O51 A;  3W3S A;  1CS4 B;  2ASJ A;  3HSJ A;  1L5U A;  1VIS A;  4HHJ A;  2J5A A;  4C0H A;  1XMO J;  2YX1 A;  5M2P A;  1G4C A;  1TTH B;  1X60 A;  4DSL A;  1H7X A;  4C98 A;  4KPC A;  4CO1 A;  4OYA A;  4TKT A;  5IWA F;  4ED0 A;  3DDI A;  4NPO A;  2RQC A;  3PKY A;  2YNG B;  3DGV A;  3V6J A;  5IQ6 A;  1PJ7 A;  1SC6 A;  4U8Y A;  3RG6 A;  2OFG X;  4HH0 A;  4LRF A;  1IKX B;  3W2W B;  4ZMM A;  2R3V A;  2R7W A;  1H6K X;  2FPH X;  3UW1 A;  2DVI A;  2AHO B;  4HAC A;  4Y34 A;  4ECV A;  3LGM A;  1XBW A;  1S0M A;  4P52 A;  1RT3 B;  4ANE A;  2QYC A;  1TL1 B;  3PYD A;  3DC2 A;  5DQG A;  3OD2 A;  1NDL A;  2W24 A;  8RUC A;  2GGP B;  3IWN C;  1U02 A;  1UVI A;  2RS8 A;  2YQ0 A;  3IG1 A;  3BF4 A;  4O4G A;  1UWB A;  1NSQ A;  3DI6 A;  1PAU B;  3LP2 A;  1A0O B;  4ZKA A;  4DPX A;  5J1E B;  5IWA J;  4F3M A;  2MZQ A;  3IAS 9;  1QDU B;  3LGN A;  3QSI A;  2HS0 A;  5JXS A;  1YJT A;  5KOX A;  1ZH5 A;  3MEG B;  2MQP A;  4Q43 A;  4YHH J;  1NME B;  1AYE A;  1VMB A;  1F0X A;  1T11 A;  1E6Y B;  2NUU G;  4DX5 A;  1X4F A;  5LJ5 Y;  3K5L A;  3MPW A;  1F6T A;  3CUN A;  3PW2 A;  4KTQ A;  2FB0 A;  1WSR A;  2CJA A;  3AAW B;  3MD3 A;  4RX6 A;  4ZVG A;  3Q8S B;  2NR0 A;  2YNF A;  2CXE A;  2RQK A;  2CJ9 A;  4RLE A;  3RRK A;  3T5K A;  2EC0 A;  2UXC F;  3OL9 A;  3EGZ A;  4JI1 F;  2F9D A;  2LCW A;  4F3Q A;  1MRO B;  4GC7 A;  2COL A;  4TY8 B;  3PEH A;  4WIQ A;  3CCR S;  2YWW A;  2FHJ D;  1M1K T;  4W90 B;  1UVM A;  4K5R A;  4Q8F A;  2C3U A;  4ZCL A;  2AGQ A;  2J76 E;  3PHT A;  5KT3 A;  4F4K A;  4WK1 A;  4H4O B;  4TU7 A;  4ZIT A;  3W2V A;  1U1L A;  1JWW A;  3BB5 A;  1T95 A;  1IBM J;  1UA0 A;  1CJV A;  3WDO A;  1F5A A;  2K2P A;  2F4F A;  1NB2 A;  2QMW A;  3MEK A;  2BJ9 A;  2JJ4 D;  1U45 A;  4MFB B;  3NEK A;  3ZZZ A;  2G0J A;  2YWG A;  4PXE A;  3OXL A;  4JI6 F;  4F4A A;  1XMO F;  2JVR A;  1NPK A;  2KH9 A;  2HMI A;  1HYS B;  3N5B A;  2CUY A;  4TU9 A;  4WU2 A;  3TUJ C;  4KR0 B;  4TY8 A;  3HHD A;  2FJB B;  1WEX A;  2QL9 B;  2LU1 A;  2KU7 A;  2XBP A;  3PIP Q;  3QIP B;  4NLP A;  4C0O C;  4QJV A;  3EZO A;  3KKF A;  4NYO A;  2ZEJ A;  5RUB A;  1E6Y A;  1VCT A;  2R8J A;  3B78 A;  1ZZF A;  2I5J A;  5B0E A;  3D4J A;  3SCK E;  1HHT P;  2H1Y A;  2XS7 A;  3B4D A;  4DU7 A;  4K0K F;  2NXE A;  2KM8 C;  1JXE A;  4WP9 A;  3BEG B;  2ZBQ A; 
#chains in the Genus database with same CATH homology
 1EX8 A;  3ILJ A;  1IM6 A;  4CYU B;  2QX0 A;  1F9H A;  3HSG A;  5ETP A;  3HSZ A;  3QBC A;  4M5J A;  3HD1 A;  1CBK A;  4AD6 A;  3ILO A;  1TMM A;  2F63 A;  4M5L A;  3UDV A;  2CG8 A;  2F65 A;  1Q0N A;  4M5G A;  3UDE A;  5ETN A;  1TMJ A;  5ETO A;  4M5H A;  1RB0 A;  4F7V A;  3HT0 A;  3KUG A;  1KBR A;  4M5K A;  4M5M A;  1EQ0 A;  1HKA A;  5ETT A;  1RU2 A;  1RU1 A;  4M5I A;  4M5N A;  4CYU A;  3MCO A;  5ETQ A;  3ILI A;  4PZV A;  5ETM A;  5ETS A;  5ETK A;  3UD5 A;  3KUE A;  4CRJ A;  3MCN A;  3KUH A;  1DY3 A;  5ETR A;  2BMB A;  4CWB A;  3HCX A;  3HSD A;  3HSJ A;  3MCM A;  1RTZ A;  5ETL A;  3IP0 A;  3ILL A;  1RAO A;  1HQ2 A;  1G4C A;  1EQM A;  5ETV A;  3HD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...