1X4GA

Solution structure of rrm domain in nucleolysin tiar
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
109
Chain Sequence
GSSGSSGNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Nucleolysin TIAR
publication title Solution structure of RRM domain in Nucleolysin TIAR
rcsb
source organism Homo sapiens
total genus 11
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4gA00
2DNGA 5H1SV 2EVZA 2MKCA 2QFJA 3UCUP 1BY9A 1N8RT 3IWNC 2MGZB 3PIPQ 2JX2A 1HA1A 5IFMA 2AYEA 5BJRA 1U6FA 1H6KX 3H2UB 3BO4A 2DNZA 1W2BR 2M70A 2KI2A 2CPXA 4WIIA 2CQ1A 2M8DB 1VQ4S 2DO0A 2LECA 2ZJPQ 2OTJS 3SDEA 2RU3A 1N88A 2MQLA 4PKDB 5GAGU 1X4AA 1KC8T 1N52B 1VQPS 3MUTP 4UQTA 2RRBA 3CCVS 3R27A 5HL7Q 1QM9A 1JJ2R 1UP1A 2Q79A 1YTYA 2XB2D 4LIRA 2JVRA 3U1MA 4CQ1A 1URNA 5D78A 2KT5A 2QEXS 4WFBQ 4TU9A 2KVIA 2LXUA 4J5OA 1VQMS 1DBDA 2OTLS 3DXBA 2LMIA 2ZJRQ 4TLQA 1WHYA 3US5A 1YHQS 2HVZA 3L3CA 2CQ4A 2DGTA 1FNXH 1K8AT 3UCGA 3VF0B 3CCQS 5DM7Q 2I38A 5FJ4A 4ERDA 3BS9A 3S6EA 2FPHX 3V4MA 1YJ9S 3G9CA 2L9WA 3MD3A 5LSOA 2MB0B 4W92B 2KG0A 3TP2A 5DM6Q 3VALA 1SJQA 3OW2R 5CA5A 2DH7A 2MXYA 1FJCA 2LKZA 3CC7S 1WELA 1FO1A 2E5IA 1WF1A 1PO6A 3RW7A 2KXHA 4OZ1A 3CCMS 3UE2A 2DIUA 5DDQC 2DGSA 1SXLA 5DDOC 1VC6A 1L3KA 2DIVA 2OIHA 1VQOS 2KM8C 1VQNS 3BEGB 1FHTA 2CQDA 3G4SS 1VQ7S 2J8AA 5JVGQ 4ED5A 1VQ9S 1WEYA 1WWHA 2D9PA 2F9JA 1WF2A 2D3OR 4LMZA 2MKSA 1U1QA 1FXLA 3NNCA 1SJ4P 1VC0A 1DZ5A 1U1NA 1M1KT 2DGVA 3CMAS 1U1KA 2MZTA 3HI9A 2DNOA 1WF0A 1P27B 2MKHA 2RQ4A 3SMZA 3VAJA 1SJFA 1KOHA 3NNAA 2RS2A 1AUDA 1YJNS 1JJHA 2LEBA 3MURP 1WI6A 2J0SD 3CTRA 2YWKA 2CPDA 2HGLA 2ADBA 4F26A 1WEXA 2RVJA 2LA4A 2DHXA 3RW6A 2DITA 2XNRA 3EGZA 2X1FA 2MZRA 3CXCR 2RT3A 2FC9A 2U1AA 1ZZNA 2HYIB 1UAWA 2RRAA 1A7GE 2CPJA 4YOEA 2CQHA 4FXWA 2VOPA 4A8XA 3I56S 2EK6A 3G6ES 1NU4A 1X4GA 2DNKA 2XNQA 1VQ5S 3LPYA 1Q86T 5ITHA 1IQTA 1JJ4A 4IOAQ 3CCRS 2N3LA 2DHSA 5LXYA 1FT8A 2VOOA 5IM0B 2L08A 3D2WA 3EX7B 3UCZP 2CPEA 1KD1T 2MHNA 1N54B 1M90T 3J7YU 1Q82T 4F25A 2MZJA 3LQVA 3R1LA 3IRWP 1XN9A 5GMKa 2CQIA 2XS2A 4U67Q 4YUDA 2MQOA 1VBXA 2DH9A 2KN4A 3CMES 3B4MA 2DNRA 1VC5A 2MQQA 3EGNA 2CQBA 1YJWS 2U2FA 1X4FA 1WG4A 2BOPA 2V94A 2KHCA 4EGLA 2RNEA 3ULHA 2MQPA 3JB9k 3TYTA 4QU7A 1X4EA 4CH0S 2VONA 1YIJS 5LJ5Y 1X4CA 4WFNQ 2M9KA 5LXRA 2MQMA 1VBZA 1RK8A 4WCEQ 1WTBA 5HO4A 3MOJB 5GADU 3CCLS 3I55S 2G0CA 3K0JA 2GO9A 4C0OC 5CXTA 1P1TA 2AYBA 2UP1A 5EN1A 2D9OA 2E5JA 3CC4S 2DB1A 3S01A 2M4MA 1D8ZA 4IOCQ 1S72S 3CULA 2CQCA 2M7SA 3VAGA 2F3JA 2XSFA 2KXNB 2N7CA 1D9AA 3P6YC 4C4WA 2X1BA 1RKJA 1X4BA 2MZQA 4C7QA 1H2VZ 3G8TA 2KU7A 4PRFA 2OSRA 3G8SA 3R1HA 4TU8A 1WHWA 3ZZZA 2CQ2A 1CVJA 2NLWA 2YH1A 2MSTA 1U1LA 3Q2SC 1HL6A 2SXLA 2YH0A 1U1OA 2CPYA 2MPUA 3VAMA 3NNHA 1X4HA 2X1AA 3CCES 3P3DA 2XS5A 2BZ2A 3P5TL 2J76E 3H2VE 3MUVP 3FEXB 2K3KA 2RUGA 2X1GA 1NJIT 2CPZA 2KRRA 2M88A 3B4DA 3S7RA 1OPIA 4Y0FA 3NS5A 2JRSA 3THPA 2E5HA 2MGZA 3MUMP 1QVGR 2DGUA 2LA6A 2RS8A 2KM8B 1M5OC 4UY8T 2DHGA 4YB1P 1M5PC 5LJ3Y 3VAKA 3NMRA 3HHNB 2L41A 1Q7YT 3UD4P 1WHXA 3DLLQ 2LYVA 3FEYB 2MKKA 2G1DA 2DK2A 2G4BA 1X5TA 1U1PA 1X5OA 2FY1A 3THTA 2DISA 2LCWA 2KYXA 1A9NB 1VQKS 2QA4S 2MZSA 2WBRA 2CQPA 1NO8A 2MY7A 5MLCV 1FJ7A 2AYGA 2N3OA 1HD0A 4Y00A 2RQCA 4BS2A 3Q2TC 2GHPA 2F9DA 1M5KC 2CJKA 1ZZFA 3TO8A 2E5GA 3MD1A 2DNNA 4WKRA 2DNPA 1OO0B 2JVOA 2DGWA 3CUNA 5DETA 4LJMA 4QQBA 2XS7A 3J7ZT 1G2EA 3MI7X 1DHMA 3SXLA 4IO9Q 1R8HA 4OZ0A 3PIOQ 1WEZA 1WG5A 2DNQA 3U1LA 2EK1A 3BO3A 1VQ6S 2MSSA 2J0QD 5GVQA 1KOOA 3UD3P 1U1RA 1WI8A 3SDEB 1YITS 1X0FA 2PEHA 2AYMA 3CC2S 2DNHA 2YKAA 4WF9Q 1Q81T 2DGQA 1VQLS 4F02A 4FXVA 2E44A 2DHAA 2KFYA 3CD6S 2PE8A 3VAIA 1U1MA 1ZH5A 2CQGA 1U2FA 3ZZYA 4Z2XA 1DRZA 1O0PA 3NS6A 4WFAQ 1PGZA 2ADCA 2HZCA 5IQQA 2CQ0A 2CPIA 2MY8A 2M52A 3VAFA 2DO4A 3N9UC 5JVHQ 2CPHA 2CPFA 4RU2A 1M5VC 1S79A 1K73T 2NZ4A 4CIOA 2OJ3A 2DH8A 5LSLA 2KG1A 4V19X 2M0GB 3G96A 2KRBA 4PR6A 2MKIA 3CF5Q 1YI2S 5DDPC 3CCSS 1X5PA 2DNLA 3MXHP 1KQSR 2FC8A 2M8HA 5D77A 2JWNA 1QVFR 1R8PA 2B0GA 2MJNA 4W90B 3MDFA 2ERRA 1K9MT 4IUFA 4TU7A 2YTCA 1FJEB 1UW4A 2DGOA 2VODA 1OWXA 1X4DA 2MJUA 2MKJA 4ZKAA 2O3DA 2K8GA 5GAEU 2ZJQQ 2HGMA 4QPTA 2DGXA 1H2TZ 2M2BA 2LEAA 1B7FA 1UFWA 1H2UX 1SJRA 1JMTA 4QU6A 3S8SA 2HGNA 2MQNA 1WG1A 2I2YA 2CQ3A 1HD1A 1WHVA 2KH9A 2MZ1A 3VAHA 1VBYA 3P49B 2OSQA 1SJ3P 2DNMA 2DNYA 4M5DB 4CH1A 3UWTA 5DDRC 2AD9A 2FHOB 2N82B 2MMYA 3G71S 1YWXA 1U6BA 1X5SA 5CYJA 2LXIA 5GAHU 3CCJS 4P6QA 2KXFA 1VQ8S 3CCUS 1F9FA 1OIAA 5IM0A 3CPWR 3BO2A 2A3JA 2MYFA 2LQ5A
chains in the Genus database with same CATH superfamily
1J5EJ 1LWCB 2EVZA 1HQUA 4OYWA 2OGUA 3FSXA 4LSNB 3UVJB 2K7JA 1REGX 2LDIA 2M8DB 2EC0A 4KTQA 4HHUA 1Z1ZA 1QJHA 4DX7A 3KYLA 3CD7A 2JEIA 1X4AA 3EVOA 2EFPA 5IT9U 1AROP 1VQMS 3MAAA 2QLWA 1WHYA 3MPVA 3LGHA 3DLBA 1LWFB 1PJ6A 3IR6B 1WSRA 3HD1A 1AZSA 3RU0A 3NMAA 4FVCA 1DTTA 5L1KA 3G9CA 1RB0A 4DSJA 4GC6A 1UPPA 4I4BA 1RHJB 3GZ7A 4ILMA 2KXHA 3OBIA 1NZAA 2FLNA 3CW2C 3HSGA 1OSCA 3B6BA 2HHUA 1L3KA 2R7XA 2Q66A 3CCTA 4NYPA 2HNZA 3LP2A 2FVPA 4KH0B 2MKSA 1VC0A 3P96A 3OV7A 4WYLA 3CMAS 3QGIA 1QTMA 4CLSA 2V69A 4K0KF 1LWCA 3P5BP 2P6TA 1AB8A 1UVJA 3UVJA 4F36A 2A1BA 4FYXB 4ELTA 5B09A 1DARA 3OXLA 1MMNA 4ECYA 3DRRB 4FXDA 2B6AB 4DPYA 4X4NA 5F8GA 3HK2A 5K14B 2GAGC 1RISA 1M90T 4DZDA 3SSSA 4OLOA 4ITSA 2BQ3A 5ETNA 1RLCL 2EXUA 3OSNA 4QPXA 1LWFA 3GU0A 4ETZA 2Y8WA 5J2MB 1G6BA 3JB9k 1SKUB 5HVHA 3IGNA 5KFEA 4WFNQ 1HWKA 4WCEQ 1MG7A 4OYOA 4X62J 3B8HA 3MPYA 3W65A 5AJ3J 4JI2F 5CXTA 2BKNA 1ROFA 3I96A 3I4PA 1B3TA 3J81Y 5HMYA 2M4MA 3UO0A 1KVKA 2IDLA 4DR1F 2VG7A 2H5IB 1R0BG 2BEFA 3HULA 3AJDA 3V6HA 1ZM9A 2HBYB 2R7QA 4I67A 1S5ZA 3FMBA 3UPFA 3G87A 3P3DA 3TW0A 1RACB 4ECRA 3HFKA 5KFMA 2WOMB 1OPIA 4RNHA 3VGTA 1QVGR 2R3VA 5ETSA 3MWBA 5CZVA 3HMJG 5HATA 2B6AA 3B78A 2J0XA 5CYMB 3M8WA 2V4JB 3Q8VA 5K14A 5A8WA 5C25A 4WZMA 1VQKS 2QLBB 2XGPA 1T11A 4IYQA 2W7PA 3BGOP 5FDLB 3LWMA 2E5GA 5M2PA 4WKRA 1LXNA 2BA9A 4A48A 1UWAA 5J2MA 4BHQA 4Y2AA 5DETA 1GMVA 3R5JB 3NGDA 1EETB 1S6OA 4CLFA 1QD1A 4UUXA 1DJ0A 3QFWA 2LU1A 2PEHA 4JI3J 2YWWA 5HAOA 5KFJA 2ZD1B 2AJQA 3TUZC 2KFNA 4CLUA 2HFOA 5CYQA 1HQEB 2KJVA 5ETVA 2CVEA 1IBMF 3GCWP 2FIUA 3LOUA 3HPOA 1S79A 2OJ3A 4DFKA 2OPRA 4URQU 3C2PA 4GRSA 2O3DA 2HGMA 4EMDA 1B7FA 5LMUF 1NJWA 3R5CA 2K7KA 2CQ3A 3NBPB 1WHVA 5CYMA 1SJ3P 2V4JA 5KFCA 2VKRA 3NY0A 4JV5F 4P6QA 1I94J 3MAQA 5IM0A 3CPWR 3ENWA 1QAJA 2DNGA 2B7CB 2YKOA 5C5JA 1UVNA 2QFJA 2WVCA 2B9WA 2VASA 5A8KB 2VQFF 4LBIA 3TJ9A 1NXIA 1UJ5A 3BO4A 1PG5B 2M70A 2YWGA 2E1AA 4KHMA 4JYAJ 3IG1B 3NXZA 4C3KA 1KFSA 1LK7A 2ZD1A 1C4CA 4RW6B 5KFHA 3TANA 1QM9A 3OHBA 3SQGB 3KHRA 2PMWA 1HQEA 3F41A 4DS5A 4WFXA 3PW5A 1IJEB 2HVEA 4ZP9A 2O66A 1ELOA 1FRKA 4AL7A 4U7CA 3LGNA 3I4HX 4F4ZA 4AYBD 4LF9F 1Z2ZA 1KLMB 3VALA 2OKQA 5E3PA 1BD6A 2GMJA 3UE2A 3NBPA 1WUUA 1CEZA 3GPAA 1Q5VA 4V19J 2D3OR 2W9AA 5ETLA 2H4YB 4DV1J 1S6QB 1UVIA 2CDQA 4Y2IA 2ILZA 2DR8A 1SIWB 4RJVA 3SMZA 3BQ2A 2B9EA 1HLWA 1NDLA 2UXCF 5E2QA 5KT5A 2I8EA 3FRYA 5A8KA 1FE0A 4AUKA 1ZBTA 4ZJOA 1X8DA 1R0AB 3ICLA 3KNAA 3GB0A 1OQ6A 3RRGA 4CNZA 3PW0A 2BANB 3FBCA 3IG1A 4ID5B 2BMBA 1RCXB 3SV4A 1JJ4A 4JV0A 4KGMA 2CPEA 2MHNA 3F0NA 3W7BA 1UZHA 3OVSA 3LQVA 4F04B 5E5NA 4EFAC 5KFIA 2RH3A 3M8SA 2KN4A 2Z2YB 3AOBA 4D3HA 3OSPA 3HVTB 1NKCA 2IJNA 3CT9A 4J9OA 1KLMA 2IRYA 4ZCKA 2R8IA 5LXRA 4UOFA 5HO4A 5EX0A 4USWA 3LH2S 4LF5J 2J9EA 2CJQA 4C0OC 4TQSA 2B7BB 4Y34A 3MPUB 4NLQA 3M05A 4C8LA 3VTIA 4ATNA 2YKPA 3GYXB 2M7SA 4ZVOB 1S6QA 4X4OA 2OSRA 3RAMA 3CDAA 1V5IB 2X3DA 2ZOMA 1E6VB 1FRXA 1FD2A 4ANCA 3OL6A 3DN9A 3EGVA 1UETA 3FGVA 3N4WA 3CJKA 3NCQA 3NS5A 3ZZRA 1XIQA 1NK6A 2NUHA 4ZDNA 2V6AA 5DZ6A 3ZZOA 4QWEA 3VAKA 4KGKA 2BANA 4ID5A 3ZC4A 4FBTA 4ZPBA 1TK0A 3QAUA 2CXEA 3QJJA 2FJXA 3THTA 1IKWA 3AXKA 4RNMA 2UUBJ 2V5HG 2ILYA 2AYGA 2RQCA 4KSEB 3Q2TC 2W4PA 2OMOA 2BX6A 1GQEA 4J9PA 1PYSB 4MKYA 3HVTA 2ATLA 2E29A 5E3CA 2QO3A 1ICEB 1YRUA 1NDKA 1KN6A 2J0QD 3BKTA 1HHSA 1WI8A 2RRNA 4DR5J 3TQEA 2HLUA 5D4OA 3CD6S 3M8ZA 3VAIA 1U1MA 4CM0A 1M1GA 5D4PA 1GTHA 3D67A 4WFAQ 3KLVA 1NDPA 1RBLA 4A8YA 2YNHB 3ELHA 2CPHA 3AODA 4RU2A 2AEFA 4CIOA 2DH8A 2EC2A 4JI1F 1YI2S 2FZGB 4DDFA 5DDPC 5C24B 1KQSR 4JI6J 1W25A 3BBBA 2RSQA 1QVFR 4C8KA 1N56A 4X62F 1Q8KA 4MH8A 2FGOA 3V6KA 3FDSA 1U09A 2GFFA 2H48B 2K8GA 5AJ3F 7FD1A 4MAKA 2HHHJ 1Q16B 3D9BA 2IBOA 2PA3A 3L7OA 3AY0A 1RDRA 2BJ7A 2B56A 1PSDA 2E7VA 2BJ8A 3TZYA 2AD9A 1NJXA 3JQKA 1P9QC 3PNIA 4B3RF 3LAKA 4KJIA 1MMDA 2D1CA 1S0OA 3GIRA 3HHLB 2HWHA 4ZP8A 3TVYA 1JLCB 3E8OA 3UCUP 1HNIB 1N5QA 4XO0A 3D3CJ 5IFMA 2ZWOA 1RTDB 4DX5A 3HZEA 1VQ4S 3W5XA 1HI0P 3DOKB 3C3LA 1C1BB 1C4AA 3BSCA 1VCTA 4KHRA 4L76A 2J5AA 1DLOB 1R0CB 3FSIA 2GVZB 1RT4B 1TL3B 3HKZD 3JYTB 3BKFA 1DBDA 2KZMA 2LMIA 2W7OA 2DGTA 1T9TA 1FE4A 4K4XA 2AQ4A 1Q1KA 2DPIA 3S6EA 4I2QA 1F2HA 5DM6Q 3IR7B 4JI3F 1N33J 5KFDA 3W9HA 5DDQC 3BYPA 4U7UD 2L3MA 3ISND 1JKHA 3ENQA 1FKOB 3GWCA 3RR7A 2R8HA 2NSBA 1U1QA 2ZC4A 4LT6A 1U1NA 2C3UA 5BYQA 3O3LA 3NWRA 1G4CA 3HHLA 4CM2A 1I3OB 1KOHA 4OV6A 5KOXA 3I82A 2WSEC 1JLCA 5H9FK 1NK8A 3C19A 1DQ8A 3EPIA 1TMJA 2PGCA 4G1IA 2Y1JA 2VKZG 4ECZA 1RTDA 5H9EK 3LP1B 1S4FA 3PTWA 3MM8B 4Y65A 4NLTA 5KG6A 3DRXA 3I56S 4DV0J 4P7TA 1K1SA 3DOKA 4KHPF 1IQTA 4UF4A 5CCLA 4Q45A 2J9DA 4CLKA 2XGQA 4NI2B 1L3VA 2VA2A 3W64A 1DLOA 1I94F 3GIIA 2GVZA 2W2QP 3EM1A 4R5PB 1RT4A 5DRKA 3DXSX 1TL3A 3JYTA 5GMKa 7AT1B 1ZTWA 1N48A 3FK4A 3RG6A 1VC5A 4K4YA 4B17A 1UFLA 2HHVA 2ZC3A 2M9KA 2MQMA 5E41A 2E7WA 2XWXA 4JYAF 4CO0A 2WTFA 2QYCA 2RKIB 5I3QA 3SQOP 1VR6A 4HT5A 4OYPA 2D41A 1FKOA 4DV2J 4QWCA 4HKQA 3DCAA 1H2VZ 4AFFA 2QSWA 3Q2SC 4KFBB 2CPYA 3O6QA 1X4HA 1MW7A 1F0XA 2BZ2A 3CSKA 4F0KA 1JQGA 1KLNA 4LF8J 2XYGB 1NHKL 4Y0FA 2HVDA 2WCXA 4FF4A 2AGOA 4TLRA 5GAHI 3LP1A 2BOAA 3OUYB 5IQ6A 1T8EA 2W8KA 4DL7A 3SEOA 1ZA2B 3NMRA 2QLFB 3K5MA 4MKAA 1Q8IA 4NI2A 1REVA 1C0UA 2MZSA 5L46A 4R5PA 2MY7A 4ZPAA 2AX0A 4BLGA 2B5JA 3AB2B 3KLIB 3RB3A 5EWFA 3JQMA 3EXCX 2QZ8A 4ZPVR 4ZVTB 2LU2A 1YRXA 3PW7A 4TYBA 2DXFA 2HNDB 2QL5B 3U1LA 5KG2A 4O3SA 4NRUA 2XLIA 5GVQA 3WX4A 3UD3P 3H4BA 4LSLA 3ILLA 3IWLA 3IM8A 2GIFA 3TARA 2YKAA 3SV3A 2RKIA 2GHWA 3A12A 1HYSB 2QMWA 3M2VB 1J2VA 4OHXA 4USHA 3QRQA 1UA1A 1S1TB 1U7LA 4ANEA 2ZOGA 3VAFA 3SSRA 3KLFB 1SC3B 2IDEA 4WP8A 4O3OA 4DCOB 3CJQA 4HH0A 4V19X 1K0TA 4KV8A 2F5GA 4DG1B 3GIJA 2UZAA 4K4UA 2A6MA 1TKXB 1S7IA 2J6UA 3M7VA 1K44A 2ZNZA 3D28A 4WK1A 1W2IA 3PXGa 4LF5F 3OUYA 2AU0A 1H2UX 2AT1B 4QU6A 5A8RB 4ED1A 3M4XA 2JFKA 2HWTA 3Q83A 2DNYA 2V2QA 4N41A 3QFHA 4LRBA 2ZH8A 1FRJA 4ALZA 4NZ7A 2IYGA 1R43A 1FK9A 1FFWB 2MKCA 2V4RA 4H4KA 4A47A 3GILA 3Q0AA 3J7YI 2RE1A 4WE1B 2HNDA 2CPXA 2DO0A 2LECA 3N5BA 3TVZA 2V9KA 1QSYA 3C6TB 4ZVHA 2UUWA 1HYSA 4X2BA 2UUBF 2IPOB 1GEHA 5HL7Q 3HJVA 4X65J 2HVIA 2C2KB 1UJ4A 1S1TA 3OXFA 4MTPA 4RUAA 4YMEA 3KLFA 4K5RA 4GVBA 3V5RA 5FJ4A 2CWXA 1GNKA 4KBIA 4NXNJ 2HURA 3HM9A 2KVQE 3MECB 4IQXA 2OFHX 3PV8A 2AV5A 5EWEA 2QIFA 2J6TA 1PO6A 3DRYA 2G9OA 3CCMS 4P2MA 4CT9A 2DIUA 4QWAA 3FVYA 1AFIA 2H1YA 4ECUA 3V6DB 1FHTA 3H5UA 2J8AA 3M2RB 4BWMA 4ECWA 1YX2A 2F9JA 3RR8A 1IVZA 2CJBA 6FD1A 2JEFA 3NNCA 3KLGB 1CQMA 1M5HA 2JH3A 2JHEA 5THWA 4RNOA 3K5OA 2HHWA 4WFZA 4JI6F 3LTOA 4E98A 2RS2A 4C48A 1YBAA 4ZVEA 2ZZTA 3KG1A 5BR8J 1Q7LB 2WONB 2HGLA 2CNOB 1WEXA 2HHHF 3NCRA 2BJ9A 4F0HA 1BQXA 3EZ5A 1ZPVA 4FXWA 4Z37A 3HHLD 3C6TA 2JLGA 2LQJA 2HVHA 1S49A 2Z57B 1N34J 2HW3A 3I0SB 3R1LA 1TAUA 1S9GB 1KDNA 3Q8RB 9RUBA 4ZCLA 4PUOA 4DQSA 1FDDA 4QU7A 1LWXA 4UOGA 5LJ5Y 1X4CA 5HSPA 2GV1A 1RCOB 2ZZNA 5F3ZA 4OZLA 3MECA 3H5XA 4WTOB 1BGXT 1Y5IB 1VIOA 3TUPA 3LA0A 2BUNA 3L7UA 4UT4A 3T1HJ 1MWQA 4YP3A 4Q7AA 3H40A 4IOCQ 3V6DA 2Q3PA 2CQCA 2NXNA 4USTA 4S0MA 3M2RA 3C14B 3P6YC 2ZOFA 1V3SA 3LUYA 5I3UB 1RKJA 3KLGA 4DUYJ 4F4WA 2AGQA 1CVJA 5GMDA 1VK3A 3SCLE 4DEZA 3D66A 5KFTA 4Y28C 4B9TA 2OEKA 3P5TL 3H2VE 1YQHA 2QYGA 1Q95G 4ZVRB 2M88A 2WONA 3S7RA 5A0YB 1N33F 2ZH1A 3DHXA 3PZPA 1JXVA 1VRTB 4U9RA 2KFZA 1M5PC 4ICLA 2C2NA 2ZBCA 3ENAA 3BZQA 5HLFA 5SUHA 4ZLLA 2G4BA 1WD6A 2J6SA 4JI0J 1IKVB 1NDCA 2BJEA 1FD8A 4NLGA 1S9GA 3TJAA 4PG6A 1OYDA 2K06A 5RUBA 4DSKA 2Z8QA 3JTNA 1HKAA 5EHHA 1EZZB 4ZHRB 1NJYA 2IJRA 1J27A 1KQKA 1ZM4A 3DOLB 1CULB 4RX6A 4DV0F 4RW7B 1TQLA 1KOOA 3IBWA 1YITS 3Q8PB 5SZTA 5A6PA 2DGQA 1SL1A 3EVWA 4LSZB 2ADCA 1B99A 2MY8A 5IC4B 2M52A 3CNQP 3F73A 5I3UA 2CPFA 2FLPA 4OZ5A 5LSLA 3TAQA 3CF5Q 4EBDA 1X5PA 3NL0A 1YJUA 2ZNYA 4W4MA 3FZ2A 3W2VB 3MDFA 3MMCA 2VODA 1RYRA 3T19A 3W60A 5HQLA 1WG1A 3P49B 3A8KA 2FDNA 3H4DA 2FYXA 4J7CA 3ZTPA 3ONQA 4LR7A 4DV2F 2N82B 2QA2A 1N6QB 1IKVA 1KVIA 2KXFA 4Q8FA 4NCBA 1IWAA 4GC7A 3D5MA 4TY8A 2HQ3A 3J80Y 1N8RT 2YNIB 3KG0A 4LFAJ 4KH1B 4LF8F 4F4AA 3RB0A 4ZIVA 4ZHRA 4XAKA 3RB4A 3KJQB 1YJTA 3M8YA 3KK2A 3DOLA 1CULA 1FEEA 4RW7A 4RKUC 4L3KA 1G7CB 3E01B 1WNEA 3HSDA 3A3PB 3Q89A 4PYDA 3BN4A 2JVRA 1WC4A 2KVIA 2LXUA 4O3QA 3KHLA 2ASJA 5D0GA 1LEOA 1X9SA 1YJVA 4QJVA 4XTTA 2FPHX 2XMUA 3GMGA 1EKSA 3MD3A 3MR5A 2GAHC 4B9MA 3DRSB 4N5SA 1I5OB 2ATCB 1WELA 2E5IA 2FHKA 3C8YA 3VWSA 2KT2A 3C46A 2IRUA 1T0TV 2VC1A 4NLYA 2HSEB 3HVRA 1SV5A 3CJ3A 2UV8G 2OIHA 3TA0A 2X3GA 2LFVA 4CTAB 2ZHBA 1SKSA 1WEYA 4LMZA 4ED8A 1SJ4P 4G1QB 5CAAA 4F67A 1NUEA 1FRLA 5B0AA 4DV6F 3HI9A 1FESA 4CYUB 1WF0A 4H4OB 2YX4A 2MKHA 3BYRA 5KOWA 3LP0B 2YNIA 3IWXA 4NCAA 3FQKA 2FJDB 3RAXA 4F26A 2LA4A 3KMSA 2IVMA 4OX7A 1YK9A 1UAWA 2RRAA 1A7GE 2NXUA 2DTJA 4C8ZA 2VQEJ 3HT3A 1SIZA 2ACMA 2IVFB 1YKWA 4NCGA 1TMMA 1T05B 3BPDA 5DLFA 3PJWA 3V81A 1RT6B 1VBXA 2CG8A 1UEKA 1TFWA 3B4MA 3N01A 3FMWA 4YR2A 2VONA 2ASLA 1YIJS 3TAMB 2QFIA 2ZE2B 1VRUA 4C9DA 1WORA 4N8OA 2VPYB 3EPGA 2YVSA 1RTHA 1GX6A 2UP1A 1YJRA 4FS2A 1EJ7L 3FKBA 4NL5A 4X65F 2DR5A 3ET6A 1S9FA 3IXQA 4NLWA 4DMZA 2BKOA 2ROEA 4A8KA 2MZQA 4M5DA 4KB7A 2IMWP 4D3GA 4FNIA 4ED2A 4CYUA 4NXNF 4DFJA 2IMOA 3KHGA 3DU5A 1BE4A 2X1AA 3WC0A 4MFBB 2RUGA 4C0HA 1A0OB 3GV8B 3Q8QB 2B4VA 5L39A 4CCHA 3WHIA 3CDWA 3D54A 1PJ7A 2F1FA 3HHNB 1JLBB 2RIJA 1Y0HA 3G82B 4IRCA 4HT7A 3DLGB 2KYXA 2QGFB 2C2DA 3KJFB 1WC1A 2YWEA 1RTZA 4B3SF 2Y1RI 1SCJB 2IHR1 1YDLA 4ZP7A 3T1YJ 5BR8F 3PHTA 1OO0B 3QBCA 2W9BB 2E7XA 1IM6A 4DV7J 2W2PP 3TAMA 1DHMA 2ZE2A 2R8GA 3ILOA 2J7WA 4M94A 3N6MA 1RHKB 3MEDB 3FC9A 2C28A 1RGVA 3JTOA 4PWDA 2K3IA 1NHUA 1WOSA 2Q6BA 2L9DA 3QLHB 3ITHB 4F02A 2HHQA 4EZ6A 5HN0A 4I2PB 1JLAA 3J7A1 3DM2B 2BABA 2HZCA 1X0PA 4KRWA 1DTQB 2FGCA 2IM0A 5B7WA 2F4VF 1IKXB 2CNKB 4DL3A 4OYXA 5IXUA 1HWJA 5D77A 4MFBA 5ETMA 4F3OA 5KG3A 4BCAA 3KFWX 4KGVB 2BR0A 1EB0A 1SJRA 3T1HF 3IS9B 2I2YA 3MEEB 2J9CA 2MZ1A 4KKOB 4DV4F 1S1UA 1JLBA 3A8IA 4X4QA 2W25A 3G82A 4ZITA 3BPSP 3MMBB 4NX9A 3VGSA 3PO5A 1S0VA 1IKYB 4B3OB 3BGUA 4HH1A 4NOHA 2Y0SD 1KQGB 2G13A 3QWPA 4BWJA 3AD8C 3GR0A 3M6VA 2J0WA 2NSCA 1LQ9A 3CDUA 1TFYA 3BGLA 3MEDA 1EIYB 3DLKA 2OTJS 4GVLA 1N52B 2HFNA 2KO1A 3AD7C 5ETKA 4DL0C 4JI0F 3QLHA 5F8IA 4I2PA 2UUAJ 2YX1A 3N28A 1URNA 1L3UA 2HBRB 2ZM6J 3P8BB 4DV3J 4YS2A 2OTLS 4TLQA 5E3QA 1CJTB 4DR6J 2E1CA 3CCQS 5DM7Q 4CLYA 2LEPA 2PIIA 3DC2A 1IKXA 5FIIA 2ZH5A 2UXBJ 2L9WA 1CJUB 2HBZB 1S97A 2FVRA 2RF2B 4C11A 4HHJA 2DGSA 3MEEA 2F7VA 2E9ZA 4M1KA 2UVUA 3CIMA 4P71A 4I7FB 1T9XA 2XMMA 3MM7B 5E7OB 1R27B 5IWAJ 2YY3A 1IKYA 2RQ4A 1XK8A 1S1VB 3GV7B 1JJHA 3L95X 1WI6A 2PI4A 1XR5A 3PYEA 3RRHA 4IH7A 1ZOTA 2ZH4A 2DJWA 2XNRA 3EGZA 2FHJA 2W7AA 4B3MJ 4IOBA 2ZVSA 1X4GA 3K8VA 1U6ZA 3CCRS 5LXYA 2YKMA 3UCZP 4DF8A 4HVZA 2VFUA 4M5LA 1JXEA 1UCNA 2QMUB 2MQOA 1P9YA 1TVRB 2DH9A 1CJTA 4ZN3A 4LFAF 4A8MP 1F60B 2CQBA 4DL4A 4CO4A 2QC3A 1JNRB 5L1JA 3M9NB 2B51A 1Q4RA 1WTBA 3MOJB 2OUGA 3CMQA 2LVWA 2R8JA 3KJNB 1XERA 4OJ3A 1NCLA 2GJIA 2VH7A 4IFVB 2DB1A 1RA7A 1VLYA 2W01A 1S72S 5K9FA 3VAGA 1P8GA 2AWZA 3I6PA 1XMBA 3G8TA 3MM7A 4FBUA 2XMAA 4P52A 1U1OA 2MPUA 1QE1B 3NNHA 4F3MA 2ZUGA 4JBCA 1XEZA 1S1VA 2K3KA 4PXCA 2CPZA 3WIVA 1TL5A 4RNNA 1MU2B 1B64A 2OPPA 3B54A 3M8RA 2AW0A 4K4VA 5HVFA 3TRGA 1HI8A 2VBWA 2JC0A 2LA6A 1JWWA 1F9EB 1RAOA 2VG6B 3PJXA 1UEUA 3OTDA 2EBEA 3BSOA 3QSYB 4N7TA 1PAEX 1HFEL 3NAHA 2VPZB 3GSIA 4NLUA 2VHGA 1FWKA 2ALZA 3KG4A 3WDOA 2DNPA 1HQ2A 4Y6IA 4NLOA 4C6AA 3D0HE 2XZTB 3GJTB 3PFEA 1WEZA 1WG5A 2A10A 3MM6A 2EK1A 3ADAC 3BREA 3MR3A 2VQEF 1PC5A 2IFXA 2LXFA 3KLHA 1WOPA 4DX6A 1VQLS 4YB7A 4ZPTR 1HBMB 4J9QA 2YNFA 5A6WA 4F0MA 2CQGA 1LW2A 3NP5A 3MR6A 2CQ0A 3OTOF 4QOTA 1RHMB 3BGFA 3FFIB 1M5VC 2FB0A 3E51A 4CO3A 2KG1A 3JSYA 4PR6A 1QE1A 1TKZA 8RUCA 3QSIA 5F9LA 5KFLA 3GV5B 1TV6B 3GFZA 2CUYA 2V67A 3DRPB 1MU2A 4TU7A 4ZKAA 5J1EA 1T3NA 1H7WA 4DR3J 4IRKA 2EPIA 3H20A 1U45A 4M63A 2VG6A 1W26A 3VAHA 2FZKB 1HIYA 3VHQA 2HQIA 4CH1A 2E1PA 2Z2MA 1YWXA 4RNFA 4DQPA 3K5NA 3MEKA 2XC9A 3BO2A 2O5DA 2G0JA 2DRDA 4L72B 1T9UA 3IMQJ 1RT5A 1BY9A 3KUGA 3PIPQ 2K1RB 1YBUA 1LWEA 1MROA 4RUBA 1U6FA 3GIKA 1D9DA 1NPRA 5KFUA 4QR2A 4ED3A 4LF2A 5DQHA 2MQLA 3GP9A 5GAGU 4UQTA 2W2MP 3N6LA 3K7RA 1HBMA 1UEVA 3CJ5A 2VV5A 2KL8A 1RTIA 3C6UB 4WFBQ 4TU9A 2EFNA 5GADI 3QO9A 4U7UK 2HVZA 4V1Ak 3NGTA 3EMTA 4RPFA 4WZQA 1RE1B 4OI1A 4ES2A 3OFHA 3HZGA 5G0RA 1VBKA 4DV7F 2CDRB 5DG9A 1TV6A 3DRPA 3TX0A 4MIWA 1FO1A 1KHVA 2MHEA 4WU3A 3IN5A 4FKXA 4OZ1A 1SXLA 1SL0A 3SBMA 2LQ9A 2CQDA 4NA2A 3LALA 4GMKA 2B43A 5ETPA 2RMLA 5IV3A 1H74A 3U7JA 1FI4A 1RAAB 2J7KA 1E6YB 3W61A 1X9MA 1V3RA 1SVDA 3TJ8A 4LF4J 4QWBA 2HQDA 3WIUA 4L75A 1AUDA 2K1RA 3QIDA 2DITA 2MZRA 2OD6A 5HP1A 3R6LB 2HYIB 3AOAA 4EYIB 4DLEA 5C42A 3CEDA 4I68A 4RW9B 1XMQJ 1RLDA 3KKFA 1TELA 3R6GB 1T02A 2FQQB 3GONA 3TZWA 1EHWA 1RQ0A 4URSA 3BJYA 1S4EA 3C6UA 3T5KA 2IY5B 4YUDA 3RBXA 2FJAB 1S7HA 2FHJD 2VFVA 3CMES 4QIFA 3FBFA 1YJWS 5K20B 2DT9A 4EWTA 4I56A 4NZ6A 1AUSL 2GHVC 5B08A 4LBPA 4RWWA 2JDJA 1CLFA 3QT6A 4URGA 2APOA 4B9VA 2GJFA 2FTRA 5DQIA 3SIPB 2JJ4D 2GO9A 4Q2MA 3A4TA 2AYBA 2B9XA 5EN1A 2FVQA 1LFWA 3GFHA 2UUAF 4F4KA 1MSWD 2C2MB 2CZ9A 3G6XA 2ZM6F 4DV3F 3NGRA 3W9JA 2EW9A 3CGIA 1E6YA 2IBKA 4DR6F 2R7TA 3R1HA 2DXDA 4X84A 2NLWA 2YH1A 1HL6A 3VCDA 4JUZA 3Q8SB 4A4JA 2UXBF 3POTA 1U26A 1NSAA 2X1GA 2DEIA 2KRRA 2XO6A 3B4DA 4DR7J 2JRSA 3QT5A 5ETRA 4ZOSA 3K8WA 4WP3A 2DHGA 4FYYB 5I4MA 4DCJB 1SB6A 2UUCJ 3PR4A 2C2RA 5KT6A 2G1DA 3IAM9 1X5TA 4LQ3A 5IWAF 1R6YA 2Z0GA 4K4TA 5DG7A 2KHDA 2GHPA 2AF6A 3JSMB 1RHQB 1OY8A 3TO8A 2IC3B 5KFWA 3WQPA 4XDCA 1FXRA 3JSRA 3CUNA 4M5GA 4QQBA 1K0VA 1NK4A 4OYBA 1PC4A 2EBGA 1UVLA 3C16B 4B3MF 3FEZA 1HNXJ 3GYNA 3KNGA 5KG7A 4O3RA 1YG0A 2ALYB 3HVAA 4LFCJ 3ZZYA 2V2ZA 4X4RA 1PGZA 2D69A 1MNEA 2IAJB 1VQSA 2AEMA 1JLGA 2R7VA 3PFOA 2M0GB 3G96A 4USJC 1TUVA 4R25A 2JNJA 4C0BA 4PWUA 2B0GA 4ZIWA 1JLEB 4DI6A 4NA3A 2BRLA 4X4SA 4FZVA 2VD3A 2DGOA 1KBRA 1X4DA 3IM9A 1XNQJ 4OX8A 4C2MA 3O2IA 2O01C 2J9DE 3Q24A 2HHSA 3W3SA 2VG7B 1ZAXA 2M5YA 5DDRC 4UOCA 1VI7A 5CYJA 4TXSA 1FDNA 3CCJS 2WW8A 1APSA 5KTQA 2C3MA 3JSMA 2AIRB 2IC3A 2ZZMA 3M1VB 4NEYA 4GKKJ 1QSSA 4AXIA 3KMQA 3RJMB 3C16A 5I42B 4LUBA 3PACA 5A8WB 5KT3A 5EGYA 5C25B 2KYZA 4DN0A 2GJ2A 3AQOA 2P8IA 3NOGA 1RWNB 4WFYA 3ZNUA 2RRBA 1O5JA 4P2XA 3O5TB 2JEJA 2VJVA 4A8WA 3BBCA 5DGBA 4X64J 4DUZF 4CQ1A 5D78A 2KT5A 2QEXS 4J37A 3UN2A 2DY1A 4EU0A 2W24A 1GMUA 3DXBA 1Y9OA 2IAJA 1RU1A 3J7Z5 2CQ4A 1FNXH 1K8AT 4HR2A 2I38A 4H54A 1KEKA 2AJ0A 3M8QA 3HT0A 2J7UA 3V4MA 3VVTA 5F0WA 1JLEA 2KG0A 2WVFA 2YQ3A 3OW2R 1NK7A 4CLTA 3CJ8A 3HVWA 4U8YA 3UDCA 2XYPB 1XQIA 3HD2A 5L8RC 4ZJQA 3KDNA 1NSKL 2DPJA 1GMWA 5CYQB 3AT1B 3FCHA 1NM2A 1WKJA 3GFYA 5D0EA 2VFRA 2WVDA 1RKIA 3NGSA 3R5DA 2OPRB 3PJ9A 4EBEA 4FVMA 1BUXA 1T9WA 1C0TB 3NNAA 1X31C 1ZAWA 3RAQA 5F0UA 4JV1A 2YWKA 3M1VA 2OP5A 2QLXA 2RT3A 4YY3J 1L3TA 5I42A 4WBFA 2VBXA 5CCMA 3BDEA 4NMXA 2ZFHA 4XPEA 3BH6B 2C42A 4KGXB 5IM0B 3FZBA 4DX8H 3CD0A 3UD5A 1SH0A 1Q82T 4ED4A 1FVSA 2XS2A 5KFXA 1WTFA 1WSVA 2WVBA 2IVYA 3U1NA 1Y10A 1AFJA 4NPOA 4J9NA 3LO3A 5F8JA 1HBUB 2ACYA 3UNGC 3HCXA 1RAJA 3SCIE 1U25A 2VPXB 4O4GB 4R8UA 1CC8A 3GTYX 4CDIA 5CD4A 4DSLA 2FZCB 2UV8A 3I87A 3ISZA 3MF5A 2KXNB 3D3BJ 2KT3A 1FTCA 5IT9Y 4PRFA 3ZZZA 5C2GA 1C0TA 3DOMA 2IIHA 5B0BA 2XZDB 3MUVP 2OLWA 2HS0A 3THPA 2MGZA 1H72C 4EEYA 3UR0A 2BE2B 1F5AA 3O44A 2L41A 4B9LA 2JLEA 1HPZB 5DGAA 1ZA1B 4HHHA 3L4BC 3V4IB 2QSFA 4DWIA 1WDTA 3D0GE 5CZXA 4YB5A 4LF4F 2RU9A 2PI5A 3QPIA 2HFVA 3CWJA 3RGIA 3TOQA 4QCLA 5CH7B 1WC6A 2B3TB 1FKAF 1U8SA 1U0HA 5J2NB 1W7WA 2CFXA 1HBUA 5T7LB 1DQ9A 1AYEA 1X0FA 1XMQF 3PHEA 1Q53A 1S6UA 3OFFA 4O4GA 3W2WA 4PQAA 4RZRA 5K5MA 4LF7J 1FX2A 1UWBA 1RT3B 2E5LJ 3DGPA 1O6XA 2G0IA 3QNWB 1RAEB 2R7RA 5AE3A 2FC8A 1R8PA 2MJNA 5KG0A 1U47A 1HHQA 5AT1B 3PRBA 4LVNP 5AXNA 2MKJA 4ZVSB 2OMLA 2CJYB 2MQNA 2BE2A 3QYYA 3GE9A 4ECTA 2OSQA 1U4BA 3OR2B 2ZH2A 2FHOB 3IA0A 1X5SA 1HPZA 3V4IA 2C2EA 2VU5A 2EKNA 5KG1A 1NMEB 5H1SV 2FHMA 2P6SA 3CJKB 2FUG9 1VOMA 4C97A 2HZAA 2DR7A 1HA1A 4X4PA 4A8QA 2FJBB 2YNGB 1LFPA 5J2NA 4ID8A 4I6AA 4WPAA 5T7LA 4OJHA 2UUCF 1IKWB 4P75A 3LPEA 1J5EF 1RT3A 1QSLA 1U24A 3BDPA 2OELA 1D8YA 5HROA 2QA4G 3HJFA 3M6WA 1IBLJ 5KT4A 3I9V9 2MB0B 1HNXF 4UZBA 2MXYA 1FJCA 2LKZA 4K4SA 3NKYA 2XMKA 2GQCA 4CNYA 1UFKA 3OD2A 4ES3A 4CWBA 4LFCF 2F8MA 1T03A 1VQNS 3OR2A 4EO8A 4ED5A 3CO9A 3W9IA 1ACMB 1S1WA 1T94A 5KFZA 2E1RA 3RRKA 1NHVA 5IT4A 1F3VA 2DRAA 2GIRA 1BWVA 3P4UB 3DYAB 2HFZA 2BXJA 1GMWD 1YJNS 4FP9A 2YNGA 3HHKA 4HI2A 3RW6A 1XNQF 4OZ3A 5KFVA 1SI9A 2G2OA 5KFSA 2IYIA 3CJTA 5DZ7A 2AGPA 5F8LA 2CQHA 2ASYA 2VOPA 1FWLA 2I1RA 4NLPA 4KC5A 3KXDA 3LPYA 4DSFA 1IBKJ 5ITHA 3TAPA 1QLNA 2I5JA 4LF1A 4OYAA 1UZDA 1UL3A 4G1PA 4IH5A 4OI2A 4M8LA 3JAMY 2LP4A 1G3OA 3LF0A 5K8NA 3H25A 4IFYB 4HL9A 1ZYQA 2CJAA 2EFVA 5DS7A 2BOPA 1Y3KA 3ULHA 3TEHB 4GKKF 5ETTA 1HBOA 1RK8A 3UDEA 2O1PA 4ZCIA 3NG8A 3QT7A 5DQGA 2LLZA 1KS2A 3D6TB 5KAKA 3S01A 4E0DA 4CLPA 2MTLA 1NKBA 4G65A 4XK8C 2BW2A 2X1BA 1XBWA 2WB4A 2KU7A 5GAEI 1OY9A 2XI2A 4I2QB 3JXOA 4NXMJ 3BSNA 3DYAA 3C15B 3EZUA 5BXIA 2B8PA 2YWHA 3PY8A 1UJ6A 3OTBA 4ZLPA 1JKHB 1FTRA 3A8EA 3WX8A 4ZS6A 3A3NB 5A2QY 1VHIA 2DR6A 5ETQA 3LGMA 5HBMB 4AE5A 4JP8A 1O51A 3W5YA 5L1IA 3R8YA 3R7NB 2QA1A 2WW4A 4PG8A 3OLAA 3GIMA 3DLEA 4Y00A 4Y2KA 2HKEA 2QN6B 1IM4A 4IFYA 4WXWA 2RUSA 2OPSA 3WZ0A 4DJBA 1G2EA 3MI7X 4YY3F 3HXMA 3PR5B 4M5KA 3OHAA 1D1UA 3SDEB 2HQCA 3PEHA 3R7SB 4AL6A 4B3TJ 3CD5A 2DHAA 3OR1B 1IR0A 2JSXA 1U2FA 4TNOA 5E3RA 4LIWA 2ROPA 1HNVB 2D3UA 2NYHA 3DLJA 1GX5A 2ZWPA 4I64A 2KRBA 5ADZA 3R2DJ 2XULA 3C15A 5MAOA 3MPWA 4DFPA 4QIGA 3ETMA 1QAXA 2ASDA 3R97A 4YFUA 2VDIA 2HMIA 3CO0P 1IBCB 4QPTA 2DGXA 2BE7D 3ZTRA 5D8HB 4PPZA 3CJ2A 2E9TA 3QGHA 5HBMA 2GQ2A 2DNMA 3DGVA 5D3GB 1URRA 4TY9A 2MMYA 3G71S 3I5AA 1DFDA 1SL2A 5GAHU 4I6WA 4PABA 2NXCA 4N76A 3K59A 1RYSA 2GVDA 1EARA 3R9LA 2LQ8A 3IWNC 3HSJA 4L73A 4F50A 2CRLA 4UY85 2HG4A 1LK5A 4UUWA 3GJQB 2R7SA 4DF4A 4DUTA 3AHPA 2N7YA 2O67A 3DI6B 4WIIA 2WAQD 1OQ3A 2EI5A 2HFSA 1CBKA 2IJFA 4RL1A 1REVB 3SDEA 4U95A 3J81U 1C0UB 1N88A 4ED7A 4ED0A 1RADB 2B5JB 3OR1A 3IO1A 1RP5A 2EG1A 2V8VA 1OJ4A 1UVKA 3AH6A 4YDXA 4AXJA 1WC3A 4MK9A 1HNVA 1H3DA 4R0JA 3BN7A 1D09B 1S1XB 2UXDJ 2H5EA 3VVUA 4QZVB 1RHRB 3MMAB 1GXUA 5J1NA 5HI7A 1YJ9S 4LSLB 1OY6A 1WKLA 4DR4J 4W92B 4J91A 1ITPA 2AMCB 3UR3C 3CC7S 4UTGA 1LOUA 3ZZ0A 2W9CB 1PBAA 2UVWA 3RW7A 1H7XA 1TZ0A 1XR6A 4LF7F 3BEGB 5D3GA 1WWHA 1NJZA 4KV8B 3NCPA 4NYOA 8ATCB 2XG8A 2ZDPA 2OPQA 1PYOB 2MZTA 2ZBQA 2BJ1A 1SJFA 1FKPA 3BH7B 3AJ1A 1NSPA 4OX6A 5J2QA 2DBBA 3IRXB 2CPDA 2K2PA 4RO0A 2MEWA 1PAUB 4LF6J 4Q43A 2DHXA 1DURA 3AA8A 2BKPA 1ZTTA 3DI6A 3AQPA 5B0EA 1IJFB 3W8GA 1Y5NB 4DQIA 4X4TA 4DV1F 2Y8YA 4YR0A 2XLJA 2AJ1A 2FD2A 1KR4A 1PYTA 1FT8A 1HW8A 1KD1T 3J7YU 1FK9B 4P9SA 2H5JB 4U67Q 4ZPWR 2YX7A 1BWEA 2VJUA 1S1XA 4PZVA 2XI3A 2KHCA 4EGLA 3MMAA 3EYZA 1WC0A 1S9EA 3ZTOA 4LRCA 2W9CA 1Y4ZB 1X9WA 1N36J 2V8GA 4X66J 4ILRA 2E5JA 4L74A 1HR0J 3CJSA 4GVBB 2F3JA 4IG3B 3CJ0A 1VQYA 4F3QA 4MKBA 3PO4A 1IBLF 4PXBA 3TX8A 2P9CA 1QUPA 3IRXA 1NJIT 2PN6A 1HARA 5GMEA 1V9OA 4LSNA 5DLGA 2AHOB 4Q0BB 1HWLA 3TNVA 2PO4A 3DDNA 1AXQA 1Y00A 4XIUA 2GIQA 1U1PA 3I9ZA 1KNZA 1OMSA 3RBZA 2DISA 4TQRA 2WBRA 1QDUB 3CB4A 1IXKA 2W4DA 3K58A 2W1BA 4LRFA 2JVOA 4LREA 1EKRA 3ZTQA 2XS7A 3FCWA 5KT7A 3T9NA 4OYMA 3O8WA 4JI1J 5B0GA 3ILJA 2ABYA 4I0WA 1FJGJ 3I0RB 2GQQA 3CJRA 1IBKF 1RAFB 4DZ6A 1QUVA 2DNHA 4NASA 3QQCD 1KRPA 4OIXA 4A8SA 4FPRA 2E44A 1YZ7A 2UU9J 1OS5A 4Z2XA 5J1PA 4FYDA 4IG3A 4PUOB 4PXEA 3R7BB 1HWIA 5K8PA 2E66A 1K73T 4CO5A 2VZ9A 5LT5A 4M5IA 2Z2LA 4B3RJ 3ZNJ1 4JB8B 4DR5F 4HDGA 3BSAA 2EFQA 2ERRA 3HX9A 4MIAA 2YTCA 1UW4A 2PA8D 4LR8A 4LFBJ 2ZUAA 1H2TZ 1UFWA 4Q0BA 1VHFA 2KH9A 3K5PA 1T9VA 3MEGB 3KUHA 3UDVA 3DRRA 2VDHA 4J90A 2LXIA 4ECQA 1VQ8S 2XYHB 1JIHA 2ZDOA 3SSQA 3TI0A 2XSJB 2LQ5A 4RBVA 4NXMF 2QT7A 3DU6A 3A8JA 3LAMA 4O0IA 2V9WA 4DHVA 3RB6A 4ICLB 5HLFB 2A2DA 1QAYA 5M2UA 3I0RA 4NLVA 1FDBA 2ZITA 4LQ9A 1F2GA 1J5OB 4WP9A 1JJ2R 2Q79A 1R31A 2YWFA 2ZJRQ 3EJMA 3PYFA 3US5A 4CZCA 5J2PB 4DV5J 1R7IA 1FF2A 4PPDA 3ZFVA 4KR0B 1VJWA 4FF2A 5L38A 4MYUA 2WOMA 1NK9A 4B3TF 3VQTA 1VC6A 2POKA 4I69A 3MEGA 1VQ9S 4M5HA 2E9RX 4KHPJ 4YDDB 4OV1A 1N5VA 4QIWD 1VFJA 2ROGA 2IA6A 4K5SA 3JAMU 2XSJA 3MMCB 4B02A 1KWMA 4WTYA 1KSPA 4F2RA 2J0SD 3H98A 5FDLA 2W4CA 3TWZA 2RVJA 4NA1A 4ZPCA 2QMXA 3M32B 4YOEA 4ECXA 1SKWA 1NK5A 2DNKA 2C3YA 1EETA 2QTWA 2CYYA 5LL6d 4RWXA 5DO2A 2VOOA 2YKNB 5KFGA 4TY8B 1J5OA 4F8RA 2ZH9A 2IRXA 4A46A 2COLA 3IRWP 3LWLA 2XMVA 3FCVA 2HS4A 4KQZA 4ZA1A 5HJXA 3H2LA 4OYZA 3S1TA 2HAIA 2X51A 1H98A 3EGNA 2NZCA 2HHTA 3MR2A 1S77D 4ILLA 3KK2B 5J2PA 4CH0S 1Z4UA 3H42A 1KONA 1N32J 3EUNA 2WZ1A 3K0JA 1N4LA 5HMZA 2JL9A 4DN9A 5A2QU 4F4XA 1D8ZA 1R8AA 2VFSA 2L48A 3D6HB 1C2PA 3OTEA 1RU2A 3UW1A 2UXDF 4TU8A 1N0VC 3IGVA 2SXLA 2YH0A 3OVAA 3KUEA 1IR2A 3GJRB 3ETOA 4LRDA 2J76E 2I6WA 4DR4F 1UA0A 2HS3A 1WOOA 1BC6A 2QJ3A 4EK2A 3GLJA 1SV5B 3MUMP 3FQLA 3OL8A 5JMNA 3M32A 3R5GA 3PRDA 4YB1P 3QWUA 1NH7A 4PG5A 4DPUA 2X7IA 2R42A 2XY6A 4HI1A 4K59A 2YKNA 3PYDA 3D7SB 4C3LA 5MLCV 2WB1D 4QR1A 2QL9B 3HSZA 4RW6A 3VGUA 2F9DA 4I1TA 3SQGA 2B4UA 2MLZA 1FERA 3BV8A 4MMOA 3T9ZA 1H0HB 4LF6F 4LJMA 4DL5A 2BQUA 1RWWB 4IO9Q 1R8HA 2DNQA 2W2NP 4XPCA 1U1RA 3BM7A 4NCGB 3KJVB 1UKUA 4E2FB 9ATCB 3FSYA 1Q81T 3L7PA 3PX6A 3V81B 3NS6A 1C1CB 1S76D 3UFCX 3EDQB 3WBZA 2CVIA 2D3ZA 1XMOJ 3QAEA 5HANA 3W62A 1HNZJ 1VRUB 2MKIA 4ZMMA 4ES1A 2DNLA 1RUSA 3AD9C 5KT2A 4PG4A 1RTHB 4N77A 5K8OA 4ANDA 5HK4A 4XDDA 4AD6A 1WKKA 3UDLA 2ZVIA 1JNZB 3MHYA 1M1HA 3PX0A 1N36F 4X66F 1JMTA 1R0AA 2DXEA 2Z2ZA 4DS4A 4JI8J 4DL2A 3ET6B 1HR0F 2KZZA 3K57A 2HQFA 4M5DB 4HYKA 3CCUS 1MLAA 4J9UE 2A3JA 4USVA 1GXTA 5HMXA 3SFUA 2VG5B 2R2RA 1NK0A 2JX2A 2VIHA 1XJWB 3TUIC 3QRRA 2VPWB 4B08A 1LNQA 3NRBA 4F4YA 5KG5A 2V8DA 2HWIA 2JC1A 2CQ1A 3VZIA 2ZJPQ 3M8PB 3EZOA 2RU3A 3KJVA 1BQNB 2F8EX 4K4WA 2QL7B 3PEJA 1XR7A 3CCVS 2WSFC 2P9EA 1UP1A 1C1CA 3U1MA 3PW4A 3KWMA 4F2SA 2C3PA 1D9FA 4J5OA 2HRUA 4GKJJ 1FFGB 2I0XA 2R2SA 4J9RA 4TKTA 3V2UC 4QYRA 1IUJA 5CHCB 3SYZA 4P10A 4EBCA 3IBFB 1N0UA 4J9KA 2QE5A 3AAWB 4PWDB 4Y2MA 1I1GA 1T3OA 3T5JA 1E6VA 3OL7A 1FJGF 1SJ1A 3I32A 1JLAB 5L1LA 2HIQA 3T3FA 3HDSA 2CZ4A 4OZNA 2UU9F 2Q43A 4RUHA 3NGUA 4HLBA 2FJWA 3OPKA 3T6BA 3IBCB 4FF1A 5JVGQ 2D9PA 4NZ0A 4C8NA 1O8BA 1YJ7A 2AX1A 2AZ3A 4N47A 2XWYA 2N4DA 1RXOB 2VG5A 2VL1A 1UVMA 3PW2A 3QRPA 5AXMA 3CTRA 2FJEB 3GCXP 1KQFB 4LFBF 1S1UB 3NOCA 4LR9A 3M8PA 1FRIA 2EK6A 1RT2B 3VZHA 2XNQA 1BQNA 1FRHA 4O0NA 1N5TA 4ER8A 3R5BA 4FN5A 3K17A 1HNWJ 1NBEB 2XMWA 3RZAA 3W8PA 1RWUA 1NEEA 4HDHA 3SI8A 4C8YA 4OHVA 5HVGA 2V68A 2XEXA 3Q86A 1ZS6A 2P5VA 2YNHA 3T5HA 4C3MA 4QYZJ 3Q22A 3DLKB 1RWOB 5HJYA 5C24A 1YRTA 1N34F 4TN2A 1KVJA 2RDJA 2GCFA 4M5NA 2L9NA 3HP6A 1NNDA 1TL7B 4FNHA 1TUWA 3G86A 4C4WA 4GO5X 4ENOA 3VV2B 2RDIA 4DL6A 1M0SA 2F65A 1FX4A 2ZEJA 2CZVC 4DV5F 3JTPA 3VAMA 5AXKA 1S12A 3FJ2A 1LW0B 4DCPB 5F8NA 2PMHA 1NRKA 1HNIA 4C11B 3ZTSA 1LXJA 2OD4A 4KPYA 2DGUA 4IKAA 1M5OC 2WBMA 4OFZA 1RT2A 1WHXA 4DUYF 3DLLQ 2R7WA 1FNMA 4OJGA 1GAOA 2CQPA 1C1BA 3V6JA 2XO7A 3VR1A 3CIZA 2B9YA 5M2RA 1M5KC 1VJQA 5KFNA 1ZZFA 3MM9B 5KFBA 4KAIA 2XM3A 1X7VA 3J7ZT 2NUUG 2OFGX 3PIOQ 5LM7E 2DKOB 4A8OA 2YKMB 1SQFA 3OQ2A 4LVOP 3R2CJ 1TK5A 4WF9Q 2IA0A 3MCOA 3QJPA 5KFFA 5D4NA 4RR5A 1U48A 3FRZA 3DLHA 1O0PA 3T1AA 3HFVA 2QX0A 2AJFE 1TL7A 4AQYJ 3TR5A 1NPKA 1CPZA 1PCAA 5F41A 2DO4A 3SCJE 2V2KA 2CA9A 5EX3A 3TA1A 2FY8A 4NYZA 1RA6A 4DQRA 4IDKB 2JWNA 1LW0A 1B0VA 2F8HA 1N32F 4W90B 1RWKB 4LBHA 1CJVB 2M2BA 2FVCA 2B8QA 2RILA 1D0EA 4BDPA 3TZXA 3BQ0A 3MM8A 2VICA 2AJ4A 1WJ9A 3UWTA 3BKUA 1TL1B 1Y7PA 1RI7A 4GO7X 2DYAA 2I9SA 1Q0NA 2VUGA 4P7VA 2OPPB 1F1BB 5D15A 3MM9A 3PYGA 3KHHA 3QZ8A 2XTJP 3EVMA 4K2JA 4OLPA 5BJRA 1H6KX 3H2UB 2DNZA 1U49A 4NLRA 4USMA 1S57A 3AXMA 1HI1A 1PBUA 1RT7B 5D0HA 4BC9A 1S6PB 2R2TA 3R3TA 4PKDB 1KC8T 5IOLA 3ZO7A 2B4OA 4OX9J 2HEKA 2D7SA 1Q79A 4OI3A 2Q1LA 3W66A 2HAFA 3UCGA 1VMBA 2IM1A 3MM6B 2A6OA 4IDKA 2UVRA 4KO0B 2HHXA 3H0PA 1K1QA 4KFBA 4DV6J 1ULRA 2DH7A 3KLHB 1R6VA 1WF1A 2P2CB 1CJVA 2YNFB 1VK8A 4CLWA 1LW2B 2NXEA 2KM8C 2BRKA 3I5CA 2BACA 3GR1A 2DVIA 1YLXA 1FRMA 1TL1A 2PFDA 3W5ZA 5IT0A 1XMOF 1TKZB 3MTKA 1M1KT 2N4CA 1JX4A 1U1KA 1HNZF 2DNOA 3VAJA 3CE8A 4DBQA 1TKTB 3DHWC 3RUBL 5EWGA 1PKUA 4QW8A 5J1EB 2LEBA 1RJJA 3KLIA 1CQNA 2ADBA 1ZPWX 2NREA 4OHYA 2X1FA 3NEKA 4PAAA 4HTIA 4DU8A 3N0VA 3MGJA 4JI8F 3OJSA 1RT7A 4RBUA 3GG1A 1PIEA 1ZM2A 1S6PA 3G6ES 1Q86T 2EKYA 2QV6A 3KDOA 3EX7B 3IP0A 3L09A 1YBTA 5BYSA 1RT5B 1S59A 2CQIA 4OL8A 4YN3B 5K8MA 3M2VA 2XMJA 1LWEB 1MROB 3OT9A 1TR0A 1EAYC 2U2FA 2PD1A 3FNNA 2BJ3A 3TYTA 2AZ1A 2BYCA 4KO0A 5E33A 4Q5VA 2PC6A 4PG7A 4DG1A 5GADU 4FKYA 2IM2A 3N6NA 3C66A 3CCLS 5E3AA 2BDPA 2G0CA 1PILA 4MIBA 2XY5A 4C8OA 1Z2LA 1TKXA 1P1TA 5CABA 2AEJA 1RTIB 3KOAA 3H7HB 2R4FA 3EICA 1JJCB 3UQSA 3QO9B 3SCKE 4ZCMA 5HQ8A 1HHTP 5A8RA 2HRTA 4GKJF 3HF5A 5G0RB 1AA1B 4C7QA 4IG0B 3TVKA 3J80U 2MSTA 5G4DA 4J9SA 2HZVA 1TKTA 2DR9A 4JI5J 4NRTA 4B3SJ 2NS1B 2RQMA 3OVBA 1KKHA 2H9ZA 2R2UA 1RWVB 3MFHA 4WE1A 3UD4P 3D68A 2LYVA 2H51B 1X5OA 2Z58B 2GZOA 2ZH3A 3JSBA 1TU0B 2GGPB 1NO8A 3IR5B 1U8WA 1FA0A 1FJ7A 3A13A 4PWWA 1HD0A 3D1QA 3IAS9 3ZZTA 1QTNB 3H59A 2CJKA 3MD1A 3QGPA 5HP1B 5JXSA 2DGWA 3MOZA 5C42B 4DPWA 2NQPA 2DCLA 2F40A 5I3PA 3SXLA 4YHHJ 2BJDA 1DY3A 4L3NA 3BO3A 2F4VJ 4U6PA 4CH7A 2YKQA 1GTEA 1UMJA 1VLOA 1G1XA 3BB5A 3AFGA 1HNWF 4FXVA 2KFYA 4JI7J 3KLEB 3T1YF 1QAIA 2ZHOA 5JVHQ 4DV4J 4IG0A 1ZETA 3FBBA 3QIPB 1F9HA 4DPOA 3H8YA 3OJUA 4MYTA 2DCUB 1TP7A 2BM1A 1KTVA 3MXHP 2M8HA 1MWZA 1B0PA 1K9MT 1FCAA 4IUFA 1SUQB 4MK8A 4FPIA 4CLLA 5F3TA 2Y1IA 2HBQB 1VIXA 2KDOA 2OO4A 2H54B 2CNNB 1HD1A 3MCNA 2GS8A 1IWGA 1U6BA 3GSDA 5LMNJ 3HO1A 2GGPA 4ZPDA 1BLUA 2BVZA 1F9FA 3POTB 1I51B 2A2CA 4PYAA 2MYFA 3MCSA 2HK2A 3I0SA 1BXNA 3PVXA 1NZ8A 3UI3A 4CI0B 2AYEA 1S48A 5IC6B 3GG0A 4JV2A 1KHWA 2KB2A 3W63A 1GK8A 4HACB 3DMJB 2CWKA 4CO2A 2GA7A 2H3EB 3OTCA 2BV3A 1Y11A 2R9LA 3T41A 3E3XA 3R27A 3DFEA 4NLDA 3KLEA 3I31A 1RWXB 1RABB 4WIQA 3PRVA 4JOUA 3W1YC 2V4QA 3CCWA 2C3OA 2AKWB 1SQGA 1YHQS 4ECVA 3RBEA 3QIPA 2Y0BB 3NS7B 3C14A 3VF0B 1UPMB 3D0IE 3RTVA 3QJLA 3M6XA 3X1LB 2RHSB 3TP2A 3QGGA 2Y3YA 4J9VA 1SUQA 2BBEA 5JJBA 2D3O1 1SC1B 4U8VA 2VF3A 1KTQA 3MM5B 2VBYA 2C22A 5A0YA 4BBYA 1VRTA 1JLGB 4K8RA 3G4SS 4AQYF 2JZ5A 4OQJA 3MFIA 5DJBA 3NWGA 3D1OA 2CJ9A 2GC8A 4EO6A 2YXLA 4I6YA 1FWPA 8AT1B 3GQCA 3MURP 3KK1B 4WYWA 2EEYA 3CXCR 5D0RA 5FLXY 4KE5A 2CAJA 4OYIA 4HACA 1TTHB 3DMJA 1FNOA 2ZH6A 3EXYA 1VQ5S 1OYEA 2CNLB 1ZAVA 4W98A 4IOAQ 2N3LA 2L08A 3M9MB 1CC7A 2OEJA 4F25A 3AB4B 2ZBIA 3DDIA 1JLFB 1XNRJ 2UVVA 1DAXA 4K2XA 7FDRA 1RZMA 2GX8A 2DNRA 3DDKA 2UUTA 1X4FA 1WG4A 2V94A 2RNEA 4IQMA 3BQ1A 1VBZA 3ISNC 1FVQA 4P2SA 4QR0A 3I55S 3W2VA 2C1EB 2YPYA 3MM5A 2D9OA 4OX9F 2GNKA 1OSDA 1TAQA 1SC4B 3GFXA 1Q5YA 1D9AA 4Y2CA 3FUYA 1X4BA 2HLTA 3M8QB 3TZZA 2CQ2A 1MWYA 1R3NA 1U1LA 3UN5A 3LANA 1N6QA 1F5CA 3OFEA 1YSJA 4L6V3 3CCES 1HW9A 3KK3B 1FXDA 4G6VB 2OHDA 3KK1A 4DR2J 3MTJA 2BW7A 5BYRA 2E5HA 6AT1B 5F9NA 5HMWA 2VA3A 4O44B 4UY8T 4FYVB 5LJ3Y 1RAGB 1EQ0A 2KKHA 4ELUA 2WK4A 4WK3A 3K89A 3FEYB 1T7PA 3BR9A 2FJVA 1SPBP 3J81j 4KY3A 5F8MA 1LKZA 1NAQA 1RAIB 1JLFA 3E01A 2N3OA 2Z30B 2MLYA 1RHUB 3D4JA 1V6HA 2HFUA 3F56A 3BR8A 2B4PA 1V3ZA 1RTJB 4OI0A 3ZZPA 2Z4PA 2G2YA 2DRBA 3OTOJ 4K7QA 4WWSA 4OZ0A 4FF3A 5KFAA 5KFYA 2YBVA 1RWPB 1T95A 2CKWA 1XC9A 2CJXB 3B82A 4Q8EA 2AYMA 3DRSA 4IR9A 4DLGA 1F6TA 4Q2LA 5T14A 4YR3A 2W8LA 3Q23A 1Q78A 3PDNA 1DRZA 5IQQA 1UW9A 2W2OP 2GO8A 4CTAA 4WKYA 1YVFA 4ZVUB 3MCMA 2AJ2A 5EUHA 4G1QA 1RT1B 2FVSA 3KK3A 4OHWA 3PCOB 2CADA 4H4OA 1FDAA 3LP0A 5AXLA 1OWXA 2MJUA 5KFRA 4JI4J 4R8UB 4IR1A 3QZ7A 1GH8A 3O1LA 2E1MC 1NPPA 4O44A 4DFMA 4U96A 1QY7A 3D6FB 4P2FA 4RUCA 2Y9HA 1JK9B 3HHDA 1UTAA 2Z56B 1Y3JA 4DPXA 5T41A 2V2VA 4OHZA 2NPFA 3DOMB 3JQJA 3G2XA 1VDHA 3DNCA 3A3OB 1T05A 1RTJA 4JI5F 4B9SA 3M2UB 2MGZB 1RT6A 3J7AN 1A6LA 4DR3F 3VQSA 3X3UA 4WU2A 2R8KA 1W2BR 2KI2A 2HK3A 2YQ1A 3NAIA 2JOQA 3MUTP 1BQMB 1H73A 3NLCA 4TVAB 2GMHA 2YQ0A 3HLUA 2XQCA 1TL4A 5HQMA 1JLQB 4DQQA 2WSCC 2M3DA 2QLJB 3L3CA 1RBAA 2GMLA 2VC0A 1U0HB 4USUA 1CS4B 4UZCA 1RT1A 2G2ZA 1GFWB 1T9YA 1B7YB 3QATA 4YHHF 4PQUB 3RBDA 4QIVA 4G3IA 5CA5A 4F7VA 3CJ4A 3ZXWA 3W2WB 2DHHA 1HBNB 1I6JA 4ZN1A 4C8MA 1FEHA 3U02A 4NWBA 1UWBB 4JI7F 4DSIA 3G6YA 1B70B 2NYIA 3MPDA 3DGPB 1CSJA 2QG9B 4IRDA 1HWUA 2DIVA 4AT1B 4USKA 3KTQA 1BMQB 1VQ7S 2P9GA 4DU7A 1WF2A 1FXLA 1WC5A 2V8HA 3DLGA 3EDRB 2HPUA 1P27B 3PKMA 3M2UA 4WJBA 2WRMA 5IV4A 1V5VA 4CT8A 4KT0C 5KFQA 4O23A 2W9BA 2CPJA 1NU4A 3PX4A 1BQMA 2J8SA 4LRAA 4K4ZA 3D2WA 5LMNF 4B9UA 3MZIA 1FFSB 4M95A 4YQWA 1SC6A 1S10A 1N5YB 1NKEA 1XN9A 3ITHA 1JLQA 2FLOA 3DM2A 2ZBRA 1DTQA 1CS4A 2MQPA 1Q8BA 1X4EA 3M30B 4PQUA 3EE3A 3L9ZA 3D6MB 2V0NA 2V50A 4J9MA 1WACA 1B0TA 1HBNA 3BBFA 1U02A 2H65B 2IM3A 3ILIA 2ZH7A 1RBOB 5IS2A 2CG4A 4ZJLA 3F44A 3CC4S 2PSZA 1U0SA 4MK7A 3SZ2A 5HROB 3MMJA 3IS9A 2XHWA 1VRQC 2N7CA 1RSCA 4KKOA 2RB7A 2MKYA 1U2CA 4OJ1A 3T5LA 4QYZK 3G8SA 1WDDA 4PXDA 1EX8A 2LDYA 4OI4A 1IQZA 4OI6A 5B0CA 3MMBA 4OZ2A 5LOQA 2XS5A 4DSEA 4K50A 2D74B 3FEXB 3HHLC 4B3OA 4ZLNA 1KFDA 1S99A 1S0NA 4P73A 4CRJA 1T03B 3IC1A 2RS8A 4P74A 3OFGA 2BQRA 1SKRA 5D4LA 1EQMA 1S1WB 1D3WA 2OEMA 4N56A 1JXLA 2FY1A 3N5FA 4USIA 1A9NB 5B0DA 2XHCA 3ZZUA 1N5YA 1AT1B 4DR7F 3HKWA 2OI2A 3K2YA 3CVKA 3QMQA 3M30A 4CP5A 4KPCA 1R89A 5EDWA 5CQGA 1B4SA 1VQ6S 2MSSA 3BGRB 4B9NA 4FS1A 2I5JB 2WHOA 3N79A 5U47A 1HMVB 2A0FB 1CJUA 4ETXA 1EP4B 4FDFA 2RF2A 3H90A 1IR1A 2ZHAA 1XNRF 1M5SA 2CPIA 5L9XA 4ZLJA 3DKDA 3N9UC 2R7UA 5FD1A 2NZ4A 1HBOB 4I7FA 3BF4A 3CCSS 4K0KJ 5C2CA 2ZKTA 2HIYA 2RDDA 4DXLA 1NLKL 2RD5C 4HEA9 4MT1A 4YB6A 5GAEU 4FYWB 3Q8YA 2HQGA 1IN0A 3S8SA 3H5SA 1YGYA 4RBTA 4TYAA 1VBYA 2Y1LB 4N8NA 4H4MB 2HRYA 3CCZA 2FLLA 3NGKA 1OIAA 4UOHA 1OPZA 1RWMB 2V63A 3M9OB 4DUZJ 5KG4A 4O3PA 4P72A 5F8HA 4DR2F 1TVRA 2C2ZB 3VGVA 4WXOA 3EWGA 4QBUA 3PKYA 1VYAA 2XMTA 3BGRA 5L9NA 2XZWA 1HMVA 1ZM3A 3FBEA 1X60A 4OZJA 1VQPS 1EP4A 4JI2J 3K5LA 3HHEA 3DLEB 1L5UA 3D1HA 2C2OB 4RU9A 4Z7YA 1YTYA 2XB2D 4LIRA 2ZBPA 1CJKB 2F63A 4NEZA 4DR1J 4IFVA 2OPSB 4QW9A 5D6GA 5A76A 1F3FA 4ERDA 4CO1A 4ELVA 2MQ8A 2V8PA 3BS9A 1MN7A 5LSOA 4NE9C 1SJQA 3OXGA 3AOCA 5H9FJ 2DD8S 4Z7CA 1NB7A 2WVEA 2PFFB 2NXJA 3AJ2A 2OH2A 4X64F 5FLXU 5H9EJ 1GT8A 4ED6A 5DDOC 2RHQB 1SQEA 2CIMA 1VQOS 1VGYA 3THVA 2EG2A 2VFTA 4H4MA 4KYZA 1AW0A 4RW4B 1NH8A 1DZ5A 2DGVA 4BC7A 1GXLA 1R8CA 5AE2A 5DG8A 5B0FA 1RAHB 2JLFA 1SBRA 2HMIB 2DY9A 2HNYB 2PDAA 1VISA 1LV5A 2MLXA 2AP6A 4H4KC 4JI4F 3GYGA 1JB0C 2FC9A 2U1AA 3TEGA 1ZZNA 1Q8LA 1BHNA 1MN9A 4HTJA 4PEOA 4A8XA 1MMLA 5C7PA 1H38A 1SH2A 2RAQA 4C98A 1U2RA 2KJWA 4OMFG 2DHSA 1N5SA 2QRRA 1CG2A 1N54B 2GVDB 5KFKA 2MZJA 4AL5A 1CJKA 4DPTA 1XWLA 2XCAA 1R8BA 1IBMJ 3H5YA 3M6UA 2V34A 2MQQA 2JEGA 1DQAA 3R5AA 5ETOA 2JFDA 3FFIA 2BE9B 1XTZA 3HFZB 3P45B 2BM0A 4O4RA 1Y5LB 4IH6A 4O3NA 4E8UA 5LMUJ 2ZKUA 3QT8A 1P1LA 5KFOA 3SFGA 2F4FA 5IZHA 2XY7A 4ZP6A 3CULA 4R0EA 1TUGB 2XSFA 3T6JA 2DEJA 4RW4A 3OLBA 4JV5J 4ZVGA 2HHPA 3UNYA 1WHWA 1NSQA 1KP6A 2VB6A 4MJKA 2RQKA 3IFEA 3PG9A 5E0OA 3JS9A 4EZ9A 2KTQA 2HNYA 3CDEA 2VQFJ 4M5MA 4RW8B 4Y3CA 3MAHA 1SH3A 4KIAA 2KM8B 4EUVA 1TKDA 1Q7YT 2OPQB 3Q8UA 2MKKA 2DK2A 4A8FA 1VS3A 5LSRA 2LCWA 2XCPA 4NLSA 2QA4S 2VBZA 2MDAA 3MR7A 1FKPB 4IO1A 4ZK7M 2A18A 4NLXA 4QWDA 4ECSA 4BS2A 2PMZD 5J2QB 5CD4H 4ZVFA 2RJZA 1HQUB 5KFPA 3PM9A 4ZVPB 3G6VA 2DNNA 4M5JA 5GAGI 3TA2A 4EI2A 2NR0A 4NMLA 4MKVA 4QIEA 4LF9J 1F5BA 3G8QA 4ZVQB 2H4WB 4RLEA 4YEAA 3U27A 2EWHA 2YPZA 3ENVA 4UQGA 1NB2A 4PCQA 3CC2S 3LW5C 2LQBA 1L3SA 2G1HA 4X4UA 2PE8A 1ZH5A 3E2EA 3MAAB 6FDRA 2PT0A 3CDBA 4X4VA 3I5BA 3OL9A 3A1YG 1AZSB 3WC2A 1S9EB 4DOZA 1DTTB 2UXCJ 3TQ1A 3TUJC 4UW2A 3GJSB 2EFGA 4RW8A 1FJEB 1P6TA 1YZ6A 1TK8A 2OAUA 2ZJQQ 3EGWB 2Q6CA 4CLZA 2LEAA 2GW8A 2NPIA 3UN3A 4KGZB 1S0MA 2HGNA 3AA9A 2NCKL 2E5LF 5JUMA 2XBPA 4J9LA 4EYHB 2EFOA 5AE1A 4Q44A 2HNZB 4RW9A 3LP2B 2PEBA 2R7OA 1PJ5A 3RYLA 2XLKA 1K47A
chains in the Genus database with same CATH topology
2VUGA 2HQ3A 1LWCB 5H1SV 4P7VA 2FHMA 2EVZA 2OPPB 2P6SA 3J80Y 3CJKB 1HQUA 2FUG9 1N8RT 3MM9A 2YNIB 1VOMA 3KG0A 4C97A 3FSXA 4LF8F 2DR7A 3RB0A 1HA1A 3KHHA 3QZ8A 4X4PA 4A8QA 4LSNB 4OLPA 2FJBB 2YNGB 5BJRA 4ZHRA 1H6KX 3H2UB 4XAKA 1LFPA 2K7JA 2DNZA 1U49A 4NLRA 3RB4A 1YJTA 2LDIA 5J2NA 2M8DB 1HI1A 2EC0A 3KK2A 4KTQA 3DOLA 4ID8A 1Z1ZA 1QJHA 1RT7B 4I6AA 5T7LA 1FEEA 4RW7A 4RKUC 4BC9A 1S6PB 3KYLA 2R2TA 4OJHA 2UUCF 3R3TA 3CD7A 1IKWB 4PKDB 2JEIA 1KC8T 1X4AA 1G7CB 3E01B 1WNEA 2B4OA 2EFPA 1J5EF 2D7SA 2JVRA 3BN4A 1AROP 1VQMS 2KVIA 2LXUA 4O3QA 3KHLA 1RT3A 1QSLA 2QLWA 1Q79A 1WHYA 1U24A 3MPVA 3BDPA 4OI3A 1D8YA 2ASJA 2Q1LA 5HROA 3DLBA 1LWFB 3UCGA 2QA4G 1X9SA 1VMBA 3HJFA 3IR6B 1YJVA 2IM1A 3M6WA 3MM6B 4QJVA 3RU0A 5KT4A 3NMAA 4FVCA 1DTTA 2FPHX 2XMUA 3GMGA 3I9V9 4IDKA 4KO0B 5L1KA 2UVRA 3G9CA 1K1QA 3MD3A 3MR5A 2HHXA 4KFBA 2MB0B 4DSJA 1ULRA 4B9MA 3DRSB 1HNXF 2DH7A 2MXYA 4N5SA 3KLHB 4GC6A 1FJCA 2LKZA 1WELA 2E5IA 2FHKA 1WF1A 2YNFB 1VK8A 3C8YA 3NKYA 4K4SA 3VWSA 4I4BA 2XMKA 2KT2A 3C46A 1LW2B 2GQCA 3GZ7A 4CNYA 2KXHA 4ILMA 2IRUA 1NZAA 3OBIA 2VC1A 4NLYA 2FLNA 4ES3A 1OSCA 3HVRA 1SV5A 4LFCF 1L3KA 2F8MA 2HHUA 3CJ3A 2UV8G 1T03A 2OIHA 1VQNS 3TA0A 2KM8C 2BRKA 3OR2A 2R7XA 2X3GA 3I5CA 2BACA 3GR1A 4CTAB 4EO8A 2DVIA 2Q66A 2ZHBA 1SKSA 1FRMA 3CCTA 4NYPA 2HNZA 3CO9A 4ED5A 1TL1A 3LP2A 1WEYA 5IT0A 2FVPA 4LMZA 1XMOF 4ED8A 2MKSA 1SJ4P 1VC0A 4G1QB 3P96A 3OV7A 1TKZB 3MTKA 4WYLA 4F67A 2N4CA 3CMAS 1M1KT 1S1WA 1JX4A 1T94A 1FRLA 5KFZA 1U1KA 5B0AA 2E1RA 3QGIA 4DV6F 3HI9A 1FESA 1HNZF 2DNOA 1QTMA 1WF0A 4H4OB 3RRKA 2YX4A 2MKHA 1NHVA 3VAJA 4K0KF 3CE8A 5IT4A 2DRAA 1LWCA 2GIRA 5KOWA 3DYAB 4DBQA 2HFZA 3LP0B 1TKTB 3DHWC 2BXJA 2YNIA 3IWXA 5EWGA 4NCAA 5J1EB 3FQKA 4QW8A 1YJNS 2P6TA 2FJDB 2LEBA 1RJJA 4FP9A 3KLIA 3RAXA 1CQNA 2YNGA 3HHKA 4HI2A 2ADBA 4F26A 1UVJA 2LA4A 3KMSA 3RW6A 1ZPWX 2A1BA 2NREA 1XNQF 5KFVA 1SI9A 4OHYA 2X1FA 2IVMA 5KFSA 4ELTA 5B09A 4OX7A 4HTIA 1DARA 3N0VA 1UAWA 3MGJA 2IYIA 3OXLA 2RRAA 1A7GE 1MMNA 4JI8F 3OJSA 4ECYA 1RT7A 3DRRB 5F8LA 2CQHA 2AGPA 2ASYA 4RBUA 3GG1A 2VOPA 2NXUA 1ZM2A 2B6AB 1S6PA 2DTJA 2I1RA 3G6ES 4FXDA 4C8ZA 4NLPA 4X4NA 3HT3A 4KC5A 5F8GA 3HK2A 3LPYA 4DSFA 1Q86T 1SIZA 5ITHA 3TAPA 2EKYA 1QLNA 5K14B 2QV6A 1RISA 2IVFB 2I5JA 3EX7B 1UL3A 3L09A 4G1PA 4NCGA 1M90T 1T05B 3SSSA 4IH5A 5BYSA 4OI2A 5DLFA 4M8LA 1RT5B 4OLOA 3PJWA 3JAMY 4ITSA 2CQIA 2BQ3A 4OL8A 1G3OA 3V81A 5K8MA 1RT6B 1VBXA 3M2VA 3LF0A 3OSNA 5K8NA 2XMJA 3H25A 1LWEB 1TFWA 1MROB 4IFYB 3B4MA 4HL9A 3N01A 3FMWA 4QPXA 4YR2A 1LWFA 1TR0A 1ZYQA 2U2FA 2CJAA 2EFVA 2PD1A 4ETZA 5DS7A 5J2MB 1G6BA 1Y3KA 2BOPA 3FNNA 3ULHA 3JB9k 3TYTA 2VONA 2ASLA 4GKKF 3IGNA 1YIJS 3TAMB 5KFEA 4WFNQ 2BYCA 4KO0A 1HBOA 1HWKA 5E33A 1RK8A 2ZE2B 1VRUA 4WCEQ 4Q5VA 4C9DA 2PC6A 2O1PA 3B8HA 4PG7A 4DG1A 5GADU 2IM2A 3N6NA 3C66A 4ZCIA 3CCLS 5E3AA 4N8OA 2BDPA 2VPYB 3EPGA 2G0CA 1PILA 4MIBA 2YVSA 2XY5A 1Z2LA 3NG8A 4C8OA 1RTHA 3MPYA 1TKXA 1GX6A 4JI2F 1P1TA 5CXTA 2UP1A 5DQGA 1YJRA 1ROFA 1RTIB 2LLZA 3I96A 3I4PA 3KOAA 1KS2A 3J81Y 2R4FA 4FS2A 5HMYA 5KAKA 3UQSA 3S01A 2M4MA 4E0DA 3QO9B 4NL5A 4X65F 3SCKE 4ZCMA 5HQ8A 2DR5A 1NKBA 1HHTP 5A8RA 4DR1F 2VG7A 1S9FA 4GKJF 3IXQA 4NLWA 4XK8C 3HF5A 2BW2A 5G0RB 4DMZA 2X1BA 2ROEA 4A8KA 2MZQA 4C7QA 4IG0B 1XBWA 2WB4A 2KU7A 3V6HA 5GAEI 4M5DA 1ZM9A 4KB7A 2R7QA 2XI2A 3TVKA 2IMWP 4I2QB 4I67A 2MSTA 4D3GA 4FNIA 4ED2A 3FMBA 4NXNF 4DFJA 3UPFA 2IMOA 5G4DA 3KHGA 3DU5A 4J9SA 2X1AA 3BSNA 3DYAA 3P3DA 3EZUA 1TKTA 2DR9A 3TW0A 3WC0A 4NRTA 4MFBB 2RUGA 4C0HA 4ECRA 2YWHA 3HFKA 5KFMA 2WOMB 1OPIA 4RNHA 3PY8A 1UJ6A 2NS1B 3GV8B 3Q8QB 2RQMA 3OTBA 4ZLPA 1QVGR 3OVBA 2B4VA 5L39A 2H9ZA 4CCHA 1JKHB 2R2UA 1FTRA 3A8EA 3CDWA 3MWBA 5CZVA 3HMJG 3D54A 4ZS6A 5A2QY 2B6AA 3MFHA 4WE1A 3B78A 2F1FA 3HHNB 2J0XA 5CYMB 3LGMA 5HBMB 4AE5A 1JLBB 3UD4P 2V4JB 2LYVA 1Y0HA 2RIJA 1O51A 5L1IA 4IRCA 5K14A 1X5OA 5A8WA 5C25A 4HT7A 3DLGB 2KYXA 4WZMA 2ZH3A 3JSBA 2QA1A 1VQKS 2GGPB 2C2DA 1NO8A 3IR5B 4PG8A 3OLAA 1FA0A 1FJ7A 2XGPA 2YWEA 1HD0A 3GIMA 3DLEA 4Y00A 3D1QA 3IAS9 3ZZTA 4IYQA 2W7PA 3H59A 2CJKA 4B3SF 4Y2KA 2Y1RI 5FDLB 3LWMA 2IHR1 1IM4A 4IFYA 4WXWA 2E5GA 3MD1A 4ZP7A 5M2PA 4WKRA 1LXNA 5BR8F 3QGPA 2BA9A 5HP1B 4A48A 1OO0B 5J2MA 5JXSA 2DGWA 2OPSA 4Y2AA 3WZ0A 4BHQA 4DJBA 2W9BB 3MOZA 5DETA 2E7XA 5C42B 2NQPA 1G2EA 2DCLA 2F40A 3TAMA 5I3PA 3MI7X 1DHMA 3SXLA 4YY3F 2BJDA 2ZE2A 2R8GA 3NGDA 2J7WA 4M94A 3N6MA 1EETB 4L3NA 3HXMA 3MEDB 3PR5B 1S6OA 3BO3A 4UUXA 1DJ0A 2LU1A 3OHAA 4U6PA 1D1UA 4CH7A 3SDEB 2C28A 1RGVA 2PEHA 3JTOA 2YKQA 4PWDA 1GTEA 5KFJA 1UMJA 2ZD1B 3PEHA 2K3IA 4AL6A 2AJQA 1G1XA 3BB5A 1NHUA 3TUZC 2Q6BA 2L9DA 3QLHB 3ITHB 4FXVA 1HNWF 4F02A 3CD5A 2HHQA 2DHAA 3OR1B 2KFYA 2KFNA 1IR0A 2JSXA 4EZ6A 5HN0A 4I2PB 1JLAA 3KLEB 3J7A1 1U2FA 3DM2B 2HFOA 4TNOA 3T1YF 2BABA 1QAIA 5CYQA