1X4GA

Solution structure of rrm domain in nucleolysin tiar
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
109
Chain Sequence
GSSGSSGNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolysin TIAR
publication title Solution structure of RRM domain in Nucleolysin TIAR
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4gA00
1NO8A 2DNPA 2M2BA 2MGZA 3CPWR 4CH1A 2MQNA 1VBZA 5DDPC 4TLQA 3PIPQ 1X4CA 1WI6A 5GVQA 3S01A 3MUVP 2ERRA 1YITS 2Q79A 1QVGR 1Q82T 1NJIT 3VAJA 1U6BA 2DGSA 3JB9k 2DH7A 1H2UX 1WEYA 3UCZP 1CVJA 4QU6A 4V19X 4TU9A 1VQMS 1VQ6S 2J8AA 5IFMA 2KXNB 2L41A 1O0PA 2DHAA 2CPDA 2X1FA 2RS2A 2NZ4A 2KYXA 2MYFA 2M9KA 3PIOQ 3CUNA 1WHYA 4J5OA 2E5IA 2AYGA 4LMZA 2MGZB 4WFAQ 2DH9A 1OIAA 1X5SA 2O3DA 3MXHP 2DNMA 4OZ1A 2MXYA 1WEXA 2DIUA 1Q81T 1DBDA 1UFWA 3J7YU 1M1KT 2DHSA 1YJ9S 5EN1A 4ZKAA 1M5PC 4TU7A 2DNKA 3U1MA 3G96A 2LXIA 1XN9A 2ZJQQ 3NS5A 4OZ0A 2DGUA 3I56S 2U2FA 5IM0A 2CQ3A 3R27A 1VQPS 1K73T 5GAGU 1WHVA 1OPIA 3BO4A 2DGVA 2DITA 2MQQA 3VAIA 1U1OA 1JJ2R 2XB2D 1FNXH 3UE2A 4WF9Q 3RW7A 1U6FA 2GHPA 1M5VC 1KQSR 2MB0B 1X4AA 3BO3A 1U1NA 3S8SA 5IQQA 2M0GB 3LPYA 4PKDB 2XS2A 5GAHU 3BO2A 1VC6A 4W90B 1YHQS 2E44A 1U1MA 3THPA 1ZZNA 5H1SV 2PEHA 1HD0A 3MD3A 3EX7B 2FPHX 2CQGA 4CQ1A 3MOJB 4YOEA 3MUMP 2DO0A 2BOPA 1B7FA 2MSSA 2KFYA 3Q2SC 3I55S 4IO9Q 2F9DA 2G0CA 4WIIA 1Q86T 3B4MA 1QVFR 4F02A 2CQ1A 2CQHA 1WG4A 1FHTA 1WELA 3R1HA 3CMAS 2RNEA 1WF0A 5IM0B 1YJNS 5MLCV 3VAFA 3ZZYA 1H2VZ 1M5KC 2RT3A 2F9JA 2MPUA 1NU4A 2L9WA 3G71S 2MZTA 3K0JA 2FHOB 2DHXA 3IRWP 2FC9A 2U1AA 2RU3A 5LXYA 1FJCA 2CPFA 2M88A 2D9PA 3DLLQ 3TO8A 2KH9A 3VAMA 1D8ZA 2LMIA 1YI2S 1QM9A 2QEXS 1A7GE 2VONA 1FJ7A 1D9AA 2XNRA 3FEYB 2AYMA 4WFNQ 3H2VE 3CULA 2CPEA 1W2BR 2M52A 2YH1A 3MDFA 4UQTA 3G6ES 1G2EA 4CIOA 2E5GA 2JVRA 4WFBQ 1URNA 2X1BA 4F25A 3MI7X 4RU2A 5DETA 2CQCA 3TP2A 4LJMA 3OW2R 2K3KA 5DDOC 3FEXB 2LQ5A 1K8AT 2MJNA 2MQOA 1KD1T 3BEGB 2MQLA 3S7RA 1VQ7S 1X4FA 2RVJA 1VQNS 3IWNC 1OWXA 3CXCR 2ZJRQ 1PO6A 2KM8C 2KG1A 2VOPA 2MMYA 1N88A 1H6KX 1YJWS 5JVHQ 3S6EA 5HL7Q 1HD1A 3US5A 2EVZA 1SJ4P 2N82B 2AYBA 1RKJA 2LEAA 1BY9A 2BZ2A 2DB1A 2JRSA 1WEZA 2OSQA 4CH0S 2ZJPQ 2MZQA 2I38A 1K9MT 2KU7A 4BS2A 1H2TZ 2HGMA 3G9CA 5HO4A 2HVZA 1VC0A 3G8SA 3NMRA 2G1DA 2HGNA 3CCUS 2UP1A 1WHXA 1WI8A 2EK6A 4QU7A 2D9OA 2MZ1A 5LJ5Y 2M8DB 3CCVS 1WF1A 2JWNA 2PE8A 3UWTA 4A8XA 5LSLA 2VOOA 2KHCA 5LSOA 4FXVA 2CQPA 2MZJA 2AYEA 2HGLA 4PR6A 2V94A 1JMTA 2DGWA 2MKJA 2HZCA 3EGNA 4WCEQ 1VQKS 2F3JA 2WBRA 2LXUA 4Z2XA 1SJQA 4YB1P 1U1LA 1P1TA 2YH0A 2KM8B 3R1LA 3G4SS 2DIVA 2YTCA 1VQ8S 2RUGA 1A9NB 2DNZA 1FO1A 2KT5A 3MD1A 2G4BA 5DDRC 2CQ0A 1WWHA 2RS8A 2MHNA 1ZH5A 4ERDA 1N52B 2NLWA 3NNAA 5DDQC 2KRBA 3V4MA 5LJ3Y 5D78A 2DGQA 2MY7A 1RK8A 1FXLA 1X5PA 2MSTA 4F26A 3CD6S 2KI2A 2XNQA 3BS9A 2RQ4A 2DHGA 3HI9A 2CQDA 2DNHA 2RRAA 1DZ5A 1VQ4S 2MKCA 2EK1A 3SMZA 3CMES 1Q7YT 5GADU 1U1KA 3CCSS 2XSFA 1P27B 2QFJA 3P6YC 1IQTA 2N7CA 3CCRS 1M5OC 1SJ3P 3EGZA 3CC2S 1AUDA 2CQ2A 2LA6A 2CPIA 2E5JA 3NNHA 4LIRA 2J76E 3CTRA 4QPTA 1R8PA 2LKZA 3N9UC 5CA5A 2MKIA 2D3OR 1X4HA 3NNCA 2LCWA 1X4EA 2DNGA 2HYIB 4PRFA 1WTBA 1R8HA 2DNLA 5CXTA 5ITHA 2DNOA 3H2UB 1S79A 5GAEU 1PGZA 1S72S 2DNRA 1FJEB 1X4DA 2LEBA 4Y0FA 3CCJS 1JJ4A 2M70A 3VAKA 2CPHA 3SDEA 4UY8T 3P49B 3CCES 1DHMA 4C4WA 1YIJS 2GO9A 3Q2TC 1VQ5S 3L3CA 2MKKA 3DXBA 2OTLS 5LXRA 5FJ4A 4YUDA 2B0GA 2CPZA 2ADCA 2M4MA 5DM6Q 1U2FA 2RQCA 2XS7A 1ZZFA 1SJRA 4IUFA 1WHWA 2J0SD 1X0FA 3UCGA 5D77A 2MQPA 1VQOS 2YWKA 1L3KA 1YWXA 2XS5A 3CC7S 1WF2A 4Y00A 4C0OC 1SXLA 1VBXA 3THTA 1UP1A 3CCQS 2ADBA 4WKRA 3VALA 1X5OA 5BJRA 3SDEB 5GMKa 4U67Q 3MURP 2I2YA 2KG0A 3D2WA 2A3JA 1SJFA 2CJKA 5DM7Q 2N3OA 1KOOA 2DNYA 3ULHA 2RRBA 3UD4P 3G8TA 3MUTP 2X1AA 3U1LA 4C7QA 1WG1A 2M7SA 2N3LA 3SXLA 2OJ3A 3P3DA 2DGTA 2FY1A 1X4BA 1HL6A 2DNNA 2OTJS 2M8HA 4M5DB 2CQIA 1YTYA 1U1RA 2DO4A 1F9FA 2YKAA 2DISA 2CQBA 3VAHA 1UW4A 1WG5A 1OO0B 1KC8T 2CPJA 4IOAQ 2L08A 3VAGA 2DNQA 2DK2A 2LYVA 1N54B 1VQ9S 2MZSA 3UCUP 2E5HA 2OSRA 2FC8A 1VQLS 2CPYA 5CYJA 1KOHA 2K8GA 2MKSA 3VF0B 2LA4A 3J7ZT 4QQBA 2QA4S 3TYTA 2JX2A 2MQMA 3CCMS 1JJHA 3NS6A 3ZZZA 3P5TL 1M90T 1U1PA 2X1GA 4TU8A 2J0QD 2MY8A 2DGXA 1X4GA 4FXWA 1VC5A 4ED5A 2CQ4A 2LECA 3CCLS 4EGLA 4W92B 2DH8A 3B4DA 2VODA 1X5TA 3HHNB 3CF5Q 4IOCQ 2JVOA 2DGOA 1U1QA 2MZRA 2KVIA 2OIHA 3UD3P 2SXLA 1VBYA 3LQVA 1FT8A 2KXHA 2KN4A 1UAWA 1HA1A 3RW6A 2CPXA 2MJUA 4P6QA 5JVGQ 3CC4S 2MKHA 2AD9A 2KXFA 1N8RT 2KRRA 1DRZA
chains in the Genus database with same CATH superfamily
3CJ3A 4I7FA 4C0HA 3T1YF 4WYWA 4TYAA 3MUVP 3OFGA 2HKEA 4MK7A 5G0RB 4LR8A 2PC6A 3EXCX 4H4MA 1N4LA 1RKIA 1M5HA 1KNZA 1XJWB 2IMOA 4JV2A 1RT6A 1O0PA 3E3XA 2CPDA 4N7TA 5IWAJ 2M9KA 2EBEA 2WK4A 3EGVA 4X4QA 1Q1KA 2EFQA 2G0IA 3GZ7A 3LGNA 1KKHA 2Y3YA 3O5TB 2V4JA 1LWEA 2D3UA 5DQHA 4TU7A 2EI5A 1FTRA 3H5XA 2BJ8A 3QJPA 1NHUA 2YQ3A 1X60A 4G1PA 5A8RB 1S48A 2NXEA 3M9NB 1K0VA 1FKPA 1JJ2R 1U8WA 3OTCA 5KFYA 4ZVHA 3PV8A 3HFZB 7FDRA 3BO3A 3OUYA 1UCNA 1S1TA 1TKZB 1VC6A 1YHQS 4CT8A 5M2PA 1IKVB 4CQ1A 3C6UB 3MUMP 2WZ1A 4UOGA 4WIIA 1WG4A 2HBQB 2RD5C 3I96A 5MLCV 3LP1A 4CO2A 1H7WA 2RQMA 1VLYA 4PYDA 1CJTB 4J9SA 4EZ6A 3NAHA 4RWWA 3QWPA 4Y6IA 2P5VA 4P71A 1ZAXA 1F3FA 2LP4A 2M52A 4DV7F 4CTAB 4KTQA 3OW2R 3HHLD 4DQSA 1Q8IA 1NK9A 2W8LA 3M2UA 2V8VA 4I69A 4RUAA 1N88A 1WC5A 3SCLE 2UUTA 4IRCA 2JHEA 4CH0S 1Q8LA 2ZBQA 3MMCB 4BDPA 2HVZA 2XMWA 2G1DA 3PJWA 3NAIA 4FF4A 2H4WB 2XMMA 5LSLA 1U25A 3AH6A 2AYEA 3R8YA 4O3RA 2IMWP 4UT4A 1U48A 2W25A 2IBKA 2HRUA 1S9EA 4F3QA 2UU9J 5F8GA 3DN9A 2ZH5A 4ZJLA 2Q3PA 4ICLA 4HTIA 3TUIC 3ENVA 1R0AB 4C8LA 4G1IA 3ZNJ1 5IQ6A 1TP7A 1SH2A 1T9VA 2XNQA 3I0RB 3G86A 2MKCA 1BQNA 2E1CA 2XMVA 2VG6A 5IT9U 4A4JA 4MKAA 1YQHA 1M5OC 3DLJA 2RDDA 1SJ3P 1TKDA 2LA6A 2UVWA 2XGQA 4ILRA 2WB1D 1CJKA 2RF2A 5HQLA 2BJ3A 5JJBA 1S99A 1X4EA 4ZVEA 1UA0A 1ZYQA 2YNGB 3M4XA 2DNOA 3TARA 5CH7B 2HBZB 3AY0A 2AW0A 2CPHA 4EEYA 3B54A 4EFAC 3V81A 1YIJS 1E6VA 1FK9A 2GMLA 4ECWA 4R0EA 4D3GA 2RQCA 2Z2ZA 2VBXA 2VC0A 4WE1B 1GQEA 1PJ7A 4P7TA 2XS5A 3TEHB 5A2QY 2IJRA 1AUSL 1TUWA 4CP5A 1IVZA 4WKRA 4M5MA 1D9FA 1ULRA 5D4OA 3PR5B 1NJWA 1RT5B 2RDIA 3Q8UA 3FSIA 4A8QA 4X4RA 1T9UA 1FA0A 4DQIA 1CJVA 2Q43A 4LFAJ 2HK2A 2DNNA 2KB2A 3L4BC 2G2YA 2JFKA 4ED1A 1WG5A 2L08A 4CO1A 5IOLA 2DPIA 1RTHB 1ZM3A 1MN7A 3PYEA 4NLOA 4OV6A 4KY3A 1TK5A 2RAQA 2F4VJ 5FDLA 4H54A 1B99A 3NRBA 3CE8A 1HNIA 4DCOB 2EEYA 3RRHA 3BN7A 2W4PA 4F67A 4FXWA 4Y34A 4PUOA 2FGCA 5BR8J 1S97A 2QLWA 2V5HG 1RWKB 4RNFA 3R5JB 3K5MA 3AB2B 4YQWA 1EARA 1UEVA 6FDRA 4B9LA 5KAKA 2WHOA 1GT8A 4RPFA 2Y1JA 1ZM9A 4EMDA 5U47A 2M2BA 4ELVA 2EW9A 3I31A 5FLXY 2L9NA 1Y10A 1CS4B 2ZUAA 2FHJD 1A6LA 2G9OA 3QSIA 2R7VA 2QL7B 2R2SA 5KFKA 3QGGA 2F65A 5A0YA 3I4PA 2VZ9A 3ISNC 1OIAA 1N5VA 1X8DA 3IWLA 5HLFA 1LWXA 5F0WA 1HPZA 3ZTPA 2DHSA 4U6PA 1UMJA 1YJ9S 2WOMB 4E2FB 5E5NA 4AXJA 2H65B 3H59A 4LRCA 1RBLA 3T1HF 1QE1A 2GIRA 5IM0A 3GJSB 2ATLA 4CLTA 1U2RA 1HBMA 1QAYA 4LRAA 3HMJG 2LQ8A 2WSCC 4X4VA 1JKHB 3RW7A 1M5VC 4N8NA 1SQFA 2OD4A 4KV8B 4WU2A 3BF4A 4DUZF 3SZ2A 1EHWA 3ILOA 2BW7A 5K8OA 4YOEA 2DO0A 2PA8D 2FLPA 2DYAA 4F04B 3D6TB 2BW2A 5HQMA 4IO9Q 2F9DA 3B4MA 4P52A 4RX6A 1WF0A 1MN9A 4JV5J 3EDRB 3I32A 2XYHB 4UUXA 3BN4A 1TL7A 1T05B 4C8MA 1MROA 1EQ0A 4JV1A 3IRWP 2CDQA 3DXSX 3TA2A 3SQOP 4DL3A 3KLIB 2R3VA 3LA0A 3ONQA 2CG8A 2VONA 4OJGA 4WFNQ 4PQUB 1NK0A 4WK1A 2VJUA 1S57A 2DXFA 2K2PA 2CQCA 2RILA 3TP2A 2W4CA 4B9UA 2HBRB 4Y3CA 2H5IB 4RLEA 2YNFB 2GNKA 2LEPA 1RT2B 4K4WA 3QAUA 1XNRF 1YJ7A 2EFPA 3H4BA 4QR1A 2XULA 2N82B 2LEAA 1SC6A 2JRSA 4AQYF 4CLZA 4TN2A 4Q0BB 2KU7A 4BS2A 2WB4A 3MM5B 2ZE2A 3MM7B 2J9DA 4OMFG 3BR9A 3QAEA 2BBEA 1WHXA 1FWPA 3G82A 2D9OA 5KT7A 2MZ1A 4OI6A 4OYMA 1S4EA 3FKBA 1ZM2A 3M30B 3PJ9A 2MKJA 3LP0B 2JDJA 2BACA 2N7YA 1JJCB 1XBWA 4Z2XA 1SJQA 4QWCA 2RH3A 2PMHA 2YTCA 4B17A 1A9NB 2OP5A 2KT5A 3MD1A 4I2QA 2DT9A 5HATA 5DQIA 2JZ5A 3ZXWA 4B3OB 2AGQA 3W8GA 1RK8A 1X5PA 4F26A 3CD6S 3ITHB 1S0MA 3EPIA 4MIBA 1IBMF 5A8KB 4J9KA 2G2ZA 4X84A 1SIZA 4KQZA 1RB0A 4ZCMA 3HHLB 3MEDA 3ETMA 2W9CA 4R25A 1FDAA 4F4AA 4MMOA 1HBUA 4XK8C 1EETB 3MFHA 3VWSA 5CA5A 4TY8A 4HI2A 3JQMA 2YPZA 3DLHA 2DHHA 3V4IB 1C0UB 4JI6F 1RWVB 3IA0A 4RBVA 1X4DA 4F8RA 3UQSA 4IG3A 5D4PA 3N28A 4UY8T 2IFXA 3L7OA 1RAEB 4EYHB 2F40A 5GMDA 1N6QB 3H5YA 3QLHA 2VDHA 2Z2YB 2HWHA 3NGUA 1UZDA 2CNNB 2CRLA 4URSA 4NWBA 3G6VA 1KQFB 4DR5J 4GVBA 2XO6A 3T3FA 2Z30B 1DY3A 1XK8A 5HROB 4NEZA 4OQJA 2E9ZA 1J5EF 3OL6A 4LBIA 3HVTA 4RNOA 1F9FA 1UW4A 5KFCA 1L5UA 4X65F 3UCUP 2KHDA 2OSRA 2C3YA 5LMUJ 4MYUA 2XC9A 4BCAA 2CUYA 4HI1A 5L38A 1V3ZA 2E1MC 4DL7A 3M9MB 3MAAA 1D3WA 1QUVA 2VDIA 2X1GA 1NJYA 2HNZB 1WOOA 1SC3B 4GVLA 4FYVB 1SL1A 6AT1B 4U7UK 1S0VA 4ZPCA 3ISND 1NK7A 2ZNZA 1UWBB 3RW6A 3MTKA 2D41A 3T9ZA 1N8RT 3PR4A 4K7QA 3KUHA 1SUQA 3DGPA 1WI6A 1XC9A 5EHHA 1Q82T 1YRXA 4DV4F 2ZBRA 4DFMA 3OVBA 1H38A 3JTOA 1HQUA 3VQTA 4RWXA 1RDRA 1HWUA 2KYXA 2E29A 4CT9A 5A2QU 4CLFA 3M32B 2MGZB 2HS0A 1YDLA 4F4WA 3SQGA 1L3TA 3QO9B 3IBFB 1CC7A 2Q6BA 2YQ1A 5HP1A 1L3UA 1QAXA 1G3OA 1KFSA 3C46A 4DV0F 1RAFB 1YSJA 1WHVA 1OPIA 3M6VA 4DR3J 1FNXH 3UE2A 2W9BB 1RWNB 1N48A 5ETQA 3U02A 1WKLA 3P8BB 4NPOA 4PG6A 3BO2A 2HRTA 5M2UA 1RACB 4ECRA 4GKJJ 5DS7A 2BXJA 4KRWA 3RGIA 5C2CA 4YB6A 2G0CA 4AT1B 4P73A 5IC6B 1HNZJ 1VRUB 4QIFA 4ZPAA 1TKXB 1S6UA 1K47A 3POTA 3R7BB 3OLAA 2RU3A 1K0TA 4MFBA 5KFTA 2CJAA 3DLLQ 1FRHA 3MM9A 4RW4B 3D0IE 2EFGA 4KGXB 2BJDA 1D8ZA 4J9QA 1VIOA 3H2VE 4NCBA 5HBMA 2ZBPA 1RU2A 3KLHA 1EZZB 3W9JA 2QLFB 4UQGA 2BE9B 5FLXU 2PN6A 2J6SA 3R5DA 4KAIA 4DFPA 3OL9A 1R0BG 4NASA 2EVZA 3PYFA 3CDAA 1WEZA 2IVFB 3KG1A 4M95A 1UVMA 2HSEB 4NX9A 2NCKL 3SSSA 1T7PA 3QZ8A 1S1VA 4RW7A 5KFEA 4LF9F 1VGYA 4PXDA 1KP6A 3KK3A 1JXEA 4LF7F 4RNNA 2DIVA 4RNMA 1TVRA 4B3RF 3M8PA 2MHNA 4NRTA 3CJKA 4ZCIA 1NDCA 1HQ2A 4ERDA 3R5CA 2E5LJ 2DXEA 3OR2B 2G2OA 4H4OB 4MK9A 3MEKA 1MU2A 3HI9A 3RAXA 3CMES 3CCSS 4AFFA 1P27B 5L1LA 3KJQB 5L1KA 4M5NA 5EDWA 2X3GA 3W5ZA 3CTRA 5D8HB 2Z2LA 4IQMA 3N9UC 3D66A 2V34A 4ETZA 3SYZA 3GV7B 1R8HA 2VL1A 2EFNA 3AJDA 5ITHA 1PYTA 3JS9A 2OPPB 2XHWA 3WX8A 1Q8BA 4N47A 3DOKA 1GMVA 2CZ9A 2XYGB 4XDCA 2W7OA 2MQ8A 3OD2A 3BGUA 1P9QC 3PNIA 3HLUA 4LIWA 3R97A 3Q24A 2V8PA 4R0JA 4NYPA 1L3KA 3ZTSA 2D3ZA 2A10A 2DY9A 3R6GB 4C0OC 3CW2C 4USUA 4F7VA 3MEGB 4WBFA 5GMKa 9ATCB 2XQCA 2FB0A 5C25A 4S0MA 3U1LA 3QRQA 3PFEA 5B08A 1ZOTA 4YR3A 4M5LA 4PAAA 4U95A 4ZCKA 1J5OB 1FDNA 1CQNA 4HHJA 4ITSA 3OBIA 2XI3A 1UVKA 3JQKA 5IWAF 4ILMA 1VQ9S 2JFDA 3D1HA 4USMA 1R7IA 3NGRA 3N5FA 2AJ0A 1HR0J 1KHWA 1S49A 4TU8A 1RHRB 2VH7A 2XMTA 3KTQA 3NBPB 1UVIA 4DL0C 4TQSA 4JI5F 5KG0A 3K57A 1RABB 3UW1A 4USVA 2R9LA 3OFHA 4ZPBA 4PPZA 3LQVA 3QIPB 2KXHA 1HA1A 1VOMA 4EO6A 4R8UA 2HK3A 3N5BA 4WXWA 1GMWD 4FKYA 1RA6A 3CPWR 1OSDA 1URRA 3U27A 3QRRA 2NSBA 3CEDA 4NYOA 3LO3A 1PG5B 2Q79A 1N5YA 1JQGA 5T14A 4ANEA 1CVJA 3C8YA 1LXJA 1Z2LA 2KXNB 2BOAA 1NKEA 2VU5A 1S77D 4P10A 2AT1B 2M3DA 1C1CB 1FFGB 4I6AA 2QRRA 4O4RA 1AZSA 4NLQA 4DCPB 1N5TA 2X51A 2W2PP 3J7YU 3MCOA 2RDJA 2R7WA 3SBMA 1DTTA 2ZNYA 1RT7B 3BM7A 1K73T 4O44B 4DSFA 1SC4B 1CC8A 4LR9A 2DGVA 3BJYA 2VFSA 3KMQA 2EWHA 1RGVA 4AL5A 4YEAA 5GAHU 4GRSA 3MD3A 3V6JA 1RBOB 2BOPA 3DMJB 4ZPDA 4OJ3A 4DG1B 1O6XA 1NXIA 5IT4A 3KJVB 3PKMA 1M5KC 1H2VZ 2MPUA 1F6TA 1NU4A 4Y2KA 5F8NA 2P9EA 2EKNA 2B5JA 3JSMB 1R31A 1FNMA 5L9XA 1R0CB 3DM2B 3OXLA 5KOWA 2XI2A 4LF5J 3LP2B 4RU2A 1IBKJ 1MWYA 2GMJA 4P74A 3WDOA 3EPGA 3QNWB 3MGJA 3IWNC 2K1RA 3RBEA 1PO6A 1WC4A 1YJWS 2ZBCA 4ZVUB 3WBZA 5HL7Q 1TKTB 3MPVA 4G6VB 1Y5LB 4X66F 3OHBA 2HEKA 4C2MA 3CCUS 3DOMA 4DX8H 5IV3A 1IKXA 2YKMA 1DTQB 2YX7A 3OFFA 5CYMA 4H4MB 4ENOA 1VQKS 5L1IA 1M1GA 2BABA 5T7LB 1UJ6A 3MECB 5K14A 2Q66A 2WVFA 4KBIA 4B9TA 2CJQA 1FERA 1JK9B 3HFKA 5B09A 2AJ4A 2E1PA 3C6TB 3IGNA 1MMLA 2KRBA 4ZVRB 3KOAA 2V4JB 2C28A 2HS3A 3KDNA 3LWMA 4DLEA 4MK8A 3M8ZA 2DHGA 5KFIA 2ZH2A 2IPOB 1H72C 2W2NP 3NKYA 3NLCA 1TAUA 4N41A 4LFAF 1XR6A 4ZP6A 4CH7A 4LF6J 3OUYB 2KFZA 1S1TB 2OMLA 4B3SF 5DRKA 1KBRA 4USHA 3TW0A 3LPEA 2HFVA 5CXTA 1PBAA 3DRXA 3GTYX 4B3MJ 1NHKL 1FESA 1N5QA 2KFNA 3TZXA 1R43A 1YJTA 1RAGB 5AJ3J 3IR6B 1Z2ZA 2DRBA 4C4WA 4C98A 2IA6A 4OIXA 5BR8F 4OZLA 1QSYA 2B0GA 5CQGA 1YG0A 5MAOA 3EDQB 5HMYA 1WF2A 4ANDA 5IS2A 4IDKA 1N33J 2ADBA 4RW6A 4XAKA 4KHPF 4U67Q 3I5AA 2KG0A 1NUEA 5GAHI 1GTEA 2RRNA 4OI3A 1JLFA 5H9EJ 4CLWA 1YTYA 1IKWB 4JI1J 2KO1A 2DISA 3EM1A 4C11B 1KSPA 1PJ5A 4DR6F 2EPIA 5K9FA 3PW4A 4I64A 2QIFA 2ZD1A 1VDHA 4OLOA 2CPYA 5BXIA 4U96A 3AD7C 2FZGB 3DU6A 4I56A 3QT5A 2MQMA 3K89A 1QUPA 2C2RA 3HPOA 1M90T 4USWA 4B3TJ 1E6YB 2EG2A 3A8EA 4OZ5A 1G7CB 3CCLS 2O5DA 2WSFC 4IG0A 2DH8A 3MEEB 1N0UA 3HHNB 2IJFA 2R2TA 4W98A 4IOCQ 3EVMA 2DGOA 1KTQA 1UTAA 2WW8A 3W2WA 4EUVA 4ECZA 1RAOA 2R2UA 2VG6B 1VHFA 4P6QA 2VF3A 2KRRA 3A3OB 1DQ9A 1UFKA 1XERA 3CD0A 3M1VA 1LFPA 3D4JA 4GO7X 1TL3A 1HNVA 5KOXA 3HX9A 3DHXA 3DOLA 4CNZA 2FHMA 3CJ4A 5KFWA 4V19X 3DRRA 2DHAA 2ILYA 1B0PA 5LOQA 4V19J 2E5IA 4X4PA 4M5IA 4XTTA 1WEXA 5H9EK 3H5SA 2J6TA 3KKFA 2QYGA 1BLUA 5C24B 2ACYA 1O5JA 3R27A 3KNAA 4CYUA 3FBFA 4WFYA 4CRJA 4FYDA 1IBLJ 4LSLB 1U09A 2AZ1A 4MIWA 5J2PA 4CO5A 4ZK7M 4QR2A 4AUKA 3X1LB 3KDOA 5ETTA 3CVKA 2FPHX 3MOJB 3AXKA 1D9DA 1XWLA 3QFWA 3R7SB 1JNRB 2VKRA 3ENWA 2OD6A 3BSOA 5BYRA 5K8NA 4PWDA 4KKOB 4OV1A 2L9WA 3CJ2A 1S9FA 2DHXA 4I0WA 5LXYA 1D09B 2OPQA 5FDLB 3KK1B 2GHVC 2QMUB 4DR7J 4ED2A 2R4FA 4K4XA 1N5SA 3K58A 4KJIA 2KH9A 1NPRA 2JEFA 2XNRA 4ZDNA 4UQTA 2E5GA 2GA7A 2PT0A 2ZWOA 2F8MA 2VJVA 3EWGA 2XMAA 5DDOC 3W1YC 2DVIA 1X4FA 1TL1B 1P9YA 2Z56B 1Y0HA 2KM8C 4L3KA 2VFVA 3KLVA 1H6KX 3TQEA 1RWMB 3QFHA 5LSRA 2HQDA 1R3NA 4LBHA 4DF4A 1VRQC 5HO4A 4LSNA 3Q8PB 2XSJB 2GX8A 2JJ4D 3JTPA 4ALZA 2M8DB 4NA2A 4LFBF 1U4BA 5LSOA 4FYXB 2MZJA 2HGLA 4Y28C 1B3TA 5DJBA 3EGNA 3MM8A 2XMUA 4ZS6A 1TK8A 3DRSA 4ED8A 1XIQA 3C19A 3B8HA 1HWKA 3PYGA 4FBTA 2RS8A 1FWKA 4XPCA 2HLUA 3I5CA 1N52B 2IRUA 5I42B 4URQU 3FCHA 2YX4A 1ZPWX 3GYXB 4DR5F 4Q5VA 3WHIA 3OHAA 1IR0A 3MMAA 5RUBA 2A18A 2IM0A 3BYPA 2N7CA 2YXLA 4Q2LA 1TL5A 1L3SA 2ZEJA 1JXVA 3R9LA 2GVDB 2H51B 1RT4B 2I5JB 4L6V3 3G8QA 2HVDA 4NA3A 4IH5A 2CFXA 1F2GA 1S5ZA 2YY3A 1EP4A 2VA2A 3CCES 3AD8C 3RR7A 4A8WA 1N32F 4LF2A 1NEEA 3UR0A 1KLNA 4DQRA 5LXRA 5KG7A 4NXMJ 2XS7A 3DYAA 4HHUA 3NOGA 4Q8FA 2YWKA 2GGPB 3P45B 4ECXA 2Z57B 1ROFA 4DV3J 4DZ6A 3SDEB 4DV2F 4F2SA 3VVUA 2HNYA 3G8TA 1S1XB 3KLGB 3ZZTA 4UZCA 1CJUA 2C2ZB 3PHTA 5E7OB 4DWIA 3CO9A 3LH2S 4WZQA 2W7PA 4EBCA 4LVOP 4PG8A 4HHHA 2C2MB 2ZC4A 1N54B 3PACA 2DXDA 3ICLA 1AXQA 3NWGA 2A6OA 1RT3A 1QTNB 2HHTA 5HJXA 4ID5A 3TA0A 1Q4RA 4I2QB 3MHYA 2HFUA 2G0JA 2D69A 2UXCF 3CIZA 3M7VA 1FRXA 3BKTA 1NSPA 3PEHA 3CD7A 1F3VA 2W2OP 2C3UA 1F60B 2ZUGA 4F4XA 1RWPB 5E3PA 1UAWA 1NHVA 2MJUA 1H3DA 2FLNA 2W9CB 2D3O1 1X4CA 2CXEA 3LGHA 1HNZF 4K0KF 4FPRA 1YGYA 2O67A 3C16A 5GVQA 2BVZA 1FTCA 2ZOMA 3B6BA 2ZHOA 1S9GB 3ZTOA 3FBCA 5J2MA 1NRKA 4RJVA 2PMWA 5DG9A 3O2IA 3WIUA 2L41A 4J37A 2BRLA 2X1FA 4AXIA 4ZVQB 2NZ4A 3CUNA 5E33A 5B0AA 2GC8A 3CDBA 4UY85 1Q81T 3GG0A 1MMDA 1GX6A 5C42B 3D6FB 2VA3A 3CCTA 2V50A 3CMQA 3GFYA 2BEFA 2C2KB 1XNQF 5HMZA 2DGUA 3OR1A 3MCSA 2JNJA 3PDNA 4O0IA 3BO4A 2DITA 2B8PA 1RCXB 2RJZA 3V6DB 4L73A 1KRPA 3S8SA 1VRTB 2B9EA 1SCJB 2QTWA 1XMQF 3TZZA 1ZZNA 4DMZA 3QBCA 3EX7B 4I6YA 4PXEA 4OYXA 2IA0A 2FLOA 2QYCA 1TELA 1QVFR 2WCXA 2RNEA 3TX0A 3I5BA 4CDIA 2V2QA 3VVTA 5GMEA 3RB0A 5LL6d 2V8DA 1Z4UA 4MKBA 2E5LF 3U1NA 1A7GE 1TU0B 2JEIA 3CJRA 3HT0A 2AX1A 4UOCA 2LQ5A 2MJNA 4QIWD 4Q43A 3A8IA 3D3CJ 4F3OA 1BE4A 2NS1B 2VOPA 1S0NA 4DPTA 3MMBB 2H9ZA 1KLMA 1NH7A 1BY9A 3FZ2A 3NCQA 2BMBA 3G8SA 2EK6A 1SUQB 3CCVS 1HBNB 3JYTA 3OV7A 2V94A 4DBQA 2YH0A 4B08A 4DX7A 2NREA 3OXFA 4NMLA 2ZH1A 4DV1J 3KHGA 2WVCA 1LEOA 1TUGB 5LJ3Y 3DLEA 5HP1B 3BS9A 2RRAA 1AA1B 4CLSA 4NZ0A 2XSFA 2XEXA 4B9MA 3D28A 4HVZA 2VQEF 5F41A 2CPIA 3DRPA 3CJTA 1U26A 2RKIB 3E01B 4CO3A 5E3QA 2QLBB 2BM0A 3DLBA 3OPKA 4AL7A 2BANA 1MLAA 2V63A 2D3OR 2AF6A 2JEGA 1T9XA 5KTQA 4NXNF 3PRDA 4KHRA 3D67A 3PX6A 5F0UA 2YNHB 3TAMA 5D0EA 4NZ6A 1HR0F 1KDNA 2W01A 4OYWA 2I6WA 3I0SB 3HSGA 4IRKA 3DXBA 3MM9B 2WVEA 4FPIA 3HJFA 2I9SA 3Q8RB 4ZVGA 1FX4A 1H74A 2OPRA 3EJMA 2MQPA 5HBMB 1W7WA 2ACMA 4EYIB 1VQOS 2LDIA 3KLHB 3AT1B 3M8SA 1WUUA 2G13A 4Q7AA 1V9OA 3KMSA 1S1WB 3UD5A 2A3JA 2R42A 1QJHA 3TJ8A 1TV6A 3TVZA 1GH8A 4C8NA 5DG7A 4G1QB 2V2ZA 4C7QA 3P3DA 3GFZA 1X4BA 2LLZA 4ZCLA 4FVCA 1HBOA 1JLAB 2HFZA 3ET6B 1SL2A 3W8PA 3HXMA 3G2XA 2CQBA 3L95X 4I2PA 1MWQA 1NAQA 1S1VB 1FKOA 3N01A 4XIUA 4L3NA 2P6SA 3KK3B 3FRYA 3ILJA 4HACA 4QPXA 1S76D 3QGHA 4JI7F 3M9OB 3SSQA 3HD1A 4DUYJ 2MY8A 3OXGA 1X4GA 4ZHRB 5G0RA 4FS1A 3AA9A 4K4SA 1PCAA 3BV8A 2UV8G 4FNIA 1TMJA 1ITPA 2AU0A 1XQIA 3MCMA 5JVGQ 3GB0A 1RWWB 2JEJA 2OH2A 1NO8A 2DNPA 1OSCA 4CH1A 2P9CA 3SEOA 4JI4J 1ZA1B 3UNYA 3C66A 2DH7A 3H0PA 1GX5A 3TNVA 5A8RA 4CZCA 4ED7A 4MKYA 4KC5A 5D3GB 1WHYA 3C2PA 4OX8A 1TL4A 4LMZA 2ZVIA 4ZJOA 2VFUA 1TKZA 2MXYA 3GIKA 1IKVA 3KLEB 5EWEA 3BGOP 3C6UA 2LQ9A 1UVNA 1T03B 5DQGA 3T5KA 1LW2A 2LXIA 2IBOA 1UVJA 2IAJB 5KT6A 1HNWF 3W64A 4Z37A 3DI6A 1U1NA 3UVJA 5A6WA 1CJTA 4DJBA 4YHHF 1VCTA 2XS2A 4WPAA 2VBYA 5H1SV 1HD0A 2AX0A 5HJYA 1S6PB 3KJNB 2KZMA 2K3IA 3QJLA 1PYSB 3J7AN 1CSJA 2JOQA 4TNOA 5E0OA 1G4CA 5I4MA 3FK4A 5THWA 3M2RB 4RR5A 1R6YA 3A8KA 2RT3A 3W2VB 2MZTA 2FVSA 3HHEA 3HVRA 4RW9B 2XGPA 2Y1IA 4ECVA 3OTOJ 1FRKA 3MMCA 4G3IA 3FEYB 2AYMA 2CPEA 4ZLLA 2P6TA 2QGFB 2VBZA 4DL2A 4HT7A 3EMTA 1VQNS 1F2HA 4OI1A 3CXCR 2VPWB 4NLVA 5IC4B 1HNXJ 3G87A 1JXLA 3CSKA 9RUBA 3W5YA 4FS2A 4LQ3A 5DZ7A 3NMRA 1IR1A 1R0AA 5LJ5Y 4PEOA 4P9SA 1Y7PA 3H25A 3NGKA 1Y5NB 1UEUA 4IFVB 4A8OA 3JAMY 2EXUA 2VG7B 2LXUA 4DSIA 3G6YA 1SKUB 1VI7A 2GFFA 1U1LA 2KM8B 1BGXT 3BGRB 4QR0A 2QA1A 2J0XA 1APSA 1VK8A 2JLFA 1JLEA 1N34F 5HK4A 1NSKL 1CLFA 3BREA 1UPPA 1RJJA 1N33F 3BH6B 3MR6A 1NK8A 4WYLA 2YNIB 2UV8A 3D0HE 1SIWB 4YN3B 2WONB 4ECSA 1PYOB 3T1YJ 4F0KA 1CULA 4ZA1A 2HAFA 2CWXA 4RW8B 1KEKA 1YKWA 1X0PA 4ZP9A 2F8HA 4QOTA 2B4PA 3PYDA 4YB5A 2CAJA 2GVZB 3R7NB 2A2CA 4WE1A 2V69A 2HIQA 1G1XA 1NMEB 2QA2A 3TANA 2YWFA 4FF1A 2GV1A 1JJ4A 2W4DA 3LW5C 1RT5A 3BDPA 2B5JB 3UDCA 3PW2A 3GYNA 3HHKA 3CJQA 3MFIA 3KG0A 1JLCB 4LRDA 3KHRA 3GIRA 1IWAA 1X0FA 3I9ZA 4GKKJ 3CC7S 5DLGA 1RTHA 4O23A 4Q44A 1YBUA 3K5NA 2C2DA 2IC3B 5KFXA 2QA4G 4DSJA 1S7IA 4U9RA 2B6AA 3F0NA 2M7SA 3MM6B 3O44A 1OMSA 1HW9A 5KG3A 4WP8A 3GWCA 3QSYB 4OYAA 4MJKA 2K7KA 1WTFA 2V4QA 4X2BA 4RL1A 5CYMB 3VTIA 2OLWA 5DG8A 4DV7J 2LA4A 3FMBA 2NYIA 2F5GA 2XWXA 1GEHA 3NS6A 4M5HA 2BE2B 2QL5B 3TRGA 2IDLA 4WJBA 2V9WA 3M8WA 4C3KA 4DL5A 1SQGA 4OI2A 5CAAA 4P75A 3TAQA 2NUUG 2VODA 1ZPVA 4C9DA 1VBYA 1HQEB 4F4YA 5JUMA 2QZ8A 3CC4S 3I4HX 2YKQA 2BM1A 2OMOA 2NXUA 1X31C 2WOMA 2FD2A 4J90A 3BSAA 2OI2A 4TU9A 4JI8F 1HHSA 4DR7F 5D4LA 2MYFA 2ROEA 4URGA 1PAUB 2ROPA 2Z58B 4P2SA 4BWMA 4KV8A 2O3DA 3MPUB 2DNMA 1REVB 3PKYA 1DBDA 4F0HA 3BBFA 1M1KT 2AZ3A 1WD6A 5EN1A 1NH8A 2YKNB 1TZ0A 3U1MA 5A8WB 2ZJQQ 3NS5A 1XR5A 2YX1A 1FE0A 1FRMA 3GU0A 4U8VA 4Y2MA 2ZZNA 1WSRA 4IDKB 3W65A 3VAIA 4X4TA 5D15A 4USIA 2HHPA 1VLOA 3C15B 4YY3J 3KLIA 3BGLA 1EIYB 2WBMA 3GIJA 5EWFA 4ZLPA 4PQUA 2KFYA 2DD8S 2HWIA 1HI8A 2XM3A 3ZZ0A 3E51A 3I55S 2HVIA 4F02A 2CQ1A 2CQHA 3IP0A 3R1HA 2HMIB 1YJNS 1IM6A 2Y8WA 4FYYB 2H1YA 2YNFA 1NPPA 1RT2A 2R7QA 3PFOA 4OHWA 2GQ2A 2FC9A 4K5SA 4ZVFA 3RJMB 2D9PA 4DF8A 1LV5A 1NDKA 1AYEA 4PXBA 4N76A 4Q0BA 3MM5A 4P72A 3MM7A 4LFCJ 2R7RA 2XLKA 1URNA 2X1BA 4F25A 4KE5A 3M30A 2HFSA 2C2EA 3LP0A 4ED3A 1DQAA 2B9YA 2HHQA 4NZ7A 2B3TB 1OWXA 2MMYA 3EYZA 3S6EA 2HIYA 2IVMA 3D54A 5D6GA 2UXBF 2BZ2A 1LWFB 3H90A 3KHLA 4A8MP 3UR3C 2GQQA 4JOUA 2ZM6F 1NJZA 4KO0B 4B3OA 1KHVA 3K5OA 2O1PA 4A8XA 1C4AA 1NCLA 3FFIB 5E3AA 1VHIA 3ITHA 3K7RA 1HKAA 4WCEQ 5A8KA 2WBRA 1F5BA 4DR2J 4RBTA 1P1TA 2J6UA 3R1LA 4ZPVR 4DFKA 3D68A 3HHLA 1ZS6A 3WQPA 4NXMF 1S6QB 1VK3A 1UVLA 1ZH5A 4NCGB 2K7JA 1UETA 4OI0A 3VV2B 2XY5A 4OZNA 5E3RA 2MSTA 3M6UA 4H4KA 3V4IA 3SMZA 2XLJA 3JSBA 1C0UA 3DKDA 3EICA 2KKHA 1FD2A 1IQTA 3RTVA 5I3QA 1DQ8A 2CQ2A 1SQEA 1Q5YA 4QPTA 2LKZA 3DC2A 2FVQA 2GQCA 1X4HA 2LCWA 4OYIA 1FVQA 2BKNA 5AT1B 3FUYA 4L72B 1PGZA 1DLOB 1S72S 3EVWA 3VGTA 1UW9A 2LU2A 4ES2A 2FJEB 3VCDA 2M70A 2Y9HA 3VAKA 1OYDA 4ECYA 1H98A 2OO4A 3GFXA 2GCFA 4ZVPB 5HROA 4JBCA 2OTLS 4DX6A 1QAIA 2M4MA 5DM6Q 2BQ3A 2B43A 4IUFA 3ETOA 1VQYA 2GJIA 2HVEA 2UVRA 2PFFB 4DUZJ 1UP1A 5DM7Q 5KT3A 3EE3A 2RRBA 3JAMU 1UKUA 4PCQA 1RHJB 3DDKA 4I68A 4PABA 5EWGA 1SL0A 2OTJS 2NYHA 1U1RA 4NA1A 1FWLA 4LSNB 1XMBA 1UWAA 2E9RX 2UVUA 2VUGA 1FXRA 4DN9A 2KJWA 3MM8B 3BQ1A 4A8YA 3NCRA 5CYJA 4DR1F 3J7ZT 3BSNA 1UWBA 1FRIA 3TYTA 2ATCB 4K4YA 1U45A 4EZ9A 2CKWA 1SJ1A 2DGXA 1RTIB 2CQ4A 5AXKA 5C2GA 2FIUA 4X62J 4ECTA 1NLKL 1X5TA 3A4TA 2ZH8A 4U8YA 3UD3P 3M8QA 4CLKA 2MKHA 2AD9A 3M32A 1EAYC 2MGZA 3RR8A 2MQNA 2I8EA 3PIPQ 4WFZA 3QO9A 2C3OA 3FC9A 2AGPA 1YBAA 4O4GB 3CDWA 4I6WA 3T5JA 5KG1A 2RS2A 3KK2B 3W3SA 3GONA 4JV0A 3NOCA 4DUTA 4OZJA 3AJ1A 3N6NA 2F63A 1IBMJ 4QBUA 3IMQJ 2DIUA 4LQ9A 5AE3A 1O8BA 3IG1B 3Q22A 1RISA 3P5BP 3RAMA 1CEZA 1JLGA 4K4UA 2U2FA 2C3MA 1VRUA 2LFVA 1TKXA 1AROP 1U1OA 1FXDA 2FHJA 1KS2A 1YX2A 1C2PA 2FVRA 4JI6J 1ELOA 2HNYB 3BPDA 2AP6A 5CABA 4LVNP 4DV5F 4ELUA 2RE1A 3GLJA 2EC2A 1IXKA 3CMAS 5CD4H 2AIRB 3I9V9 3DRYA 3F44A 5ETKA 2OPSB 1CQMA 4DV1F 1LQ9A 3CGIA 1U02A 3PEJA 1NK5A 4KSEB 4RZRA 1FE4A 5FIIA 5KFHA 3IM8A 1GFWB 1H7XA 4J9OA 1WDDA 1CPZA 4ECUA 3WC2A 2K3KA 3FEXB 1J5EJ 2MQOA 3GP9A 2MQLA 3S7RA 2ASDA 3GSIA 3US5A 3J80Y 1SJ4P 2XG8A 2Y0SD 2MZQA 3OTEA 4X65J 4KPCA 3AQOA 5G4DA 2DR6A 5LT5A 2FJDB 2UP1A 3Q86A 1QLNA 2QL9B 5CCLA 3BGFA 3OR2A 2CYYA 1C4CA 1WSVA 4H4OA 3ZC4A 2HHVA 3VGSA 3WIVA 2DGWA 3C14A 2F3JA 5F8IA 3H42A 3SV3A 2ASYA 1NNDA 3T6BA 4HR2A 4AE5A 3NNAA 2H5EA 2DJWA 5D78A 2DGQA 2R2RA 1GXTA 1TFYA 1RHKB 1F1BB 1DZ5A 2EK1A 2OPPA 1Z1ZA 1Q7YT 4JYAF 2QFJA 3P6YC 4P2FA 1FEEA 3CC2S 2C1EB 3NNHA 3D3BJ 5J1EB 3A12A 1R8BA 2QJ3A 2BKPA 1BWVA 4IFYB 2ZH9A 1S1UB 3H4DA 4LF8F 2Z8QA 2L9DA 4J9UE 3SSRA 4PRFA 3LAKA 5L46A 3IGVA 1WORA 3OSNA 1FJEB 1RXOB 5SUHA 4QIGA 3MEGA 3P49B 3CB4A 3N6LA 4DUYF 3I87A 2B7CB 4DV0J 3GPAA 4NLUA 4C48A 1QSSA 3A1YG 5D77A 1RT1B 1J5OA 4NL5A 3CCWA 4QIEA 3HD2A 1GAOA 2NXCA 3VALA 4RKUC 4ID8A 3D2WA 1K1SA 2VFTA 1PC4A 4J9RA 1PILA 1QSLA 4EBEA 3IAM9 1SKRA 1KLMB 3SXLA 2RIJA 2FY1A 1Q78A 4M5DB 2CQIA 1CG2A 5JMNA 3NBPA 5F9NA 4IOAQ 2YWWA 1T11A 5EGYA 2PO4A 3B78A 3RRKA 4A8KA 3QIPA 3W9HA 3IM9A 2FDNA 3Q8VA 4PWUA 2JX2A 4OYBA 1SV5A 1U1PA 3JQJA 1F9EB 4ES3A 1LWCB 4NI2B 4TXSA 4HDHA 1A0OB 3HHDA 3DGVA 2W8KA 2G1HA 3RAQA 2OEKA 4CO4A 1FJGJ 2V0NA 3Q23A 1C1CA 3VR1A 3M2VA 2H5JB 5DDPC 2RHSB 4C97A 3TZWA 2KYZA 4DR4J 4USJC 1LFWA 3PO5A 4B3RJ 1QVGR 4DPUA 3JB9k 3ZZPA 3R5BA 1JLBB 1RT7A 1XMOJ 2HHHJ 4O44A 2QC3A 5GAGI 2FY8A 1FD8A 3IS9B 3OTOF 3PIOQ 5HANA 4J5OA 3TAMB 3GG1A 1IN0A 3HCXA 5KFPA 3R2DJ 1UFLA 1XEZA 3FJ2A 1I5OB 4M1KA 1VJWA 4DV6J 2NXJA 1U49A 3DMJA 4DG1A 4OFZA 1HNXF 1BUXA 1K44A 1TK0A 2UUBF 1X7VA 2XB2D 3JSMA 1FDBA 3KHHA 3MAHA 5LMNF 4MT1A 4P2XA 3LPYA 1TV6B 1GK8A 4ETXA 3KFWX 3TVYA 1Q7LB 3UN2A 2MKYA 4LUBA 3LP2A 5BYSA 1SH3A 4WKYA 3GILA 5AXMA 5JXSA 1FKOB 1JLQB 3N4WA 5D0RA 1NZ8A 4K4VA 3DDNA 2KJVA 2J9EA 5KFQA 1FJCA 3FCVA 4N56A 3TO8A 4HACB 2Y1LB 3OQ2A 1YI2S 2ZDPA 3PVXA 4OLPA 1YBTA 1REGX 2CG4A 5HQ8A 2HNDB 1MNEA 5KFLA 1V5VA 1LW0B 2I0XA 1DTQA 4LREA 1I94F 1HMVB 2AV5A 3IRXB 5T7LA 3MECA 2XHCA 4PZVA 1GXUA 2GAGC 1IKYB 4DXLA 1VYAA 3FNNA 1KVKA 4DL6A 1QAJA 3RZAA 4WP3A 1TAQA 4BHQA 1BD6A 3G9CA 3C6TA 2B7BB 2JWNA 2A6MA 3IN5A 4PR6A 1I3OB 4A46A 4B9VA 2VPZB 2J8SA 1WC3A 4YB1P 3EZUA 2HWTA 5D0GA 2HZAA 4JI5J 4HH1A 2C42A 3IR5B 3MR5A 4GKKF 1BXNA 2UUAJ 4CLPA 1GNKA 4GO5X 2FJBB 2WVDA 3OL7A 6FD1A 1LW2B 2X7IA 4DX5A 5K8MA 1DJ0A 4CM0A 2XLIA 3AODA 1RTJB 4HLBA 1Q53A 2J76E 3DI6B 4J9MA 3QMQA 3UVJB 4DOZA 1OPZA 2Z4PA 4YR0A 1PJ6A 2GO8A 4OHZA 1SKWA 4K5RA 3EVOA 3UDVA 3PY8A 3NY0A 1RTDB 3H2UB 1S79A 5GAEU 3KJFB 5IV4A 4C8KA 5B0CA 3CO0P 1U2CA 4YB7A 5KG4A 1OQ3A 4IQXA 5HMWA 1WACA 3L3CA 2YKOA 2H54B 4Y2CA 1X9WA 3DLGB 4YUDA 3J80U 4LRBA 3JXOA 2PI5A 3WX4A 2J0SD 1V3SA 3Q8SB 3UCGA 1IKWA 1UJ4A 1PBUA 3HDSA 4C11A 3KYLA 4AD6A 2JLGA 1SXLA 1P6TA 4ANCA 3HJVA 8AT1B 3VQSA 1RU1A 2I2YA 3LALA 1WJ9A 4KGZB 1RZMA 3UD4P 2XZWA 3GSDA 1C0TB 3MPWA 2N3LA 2OJ3A 1T9YA 2XYPB 4WP9A 1ZETA 3NMAA 1Y9OA 1E6YA 1YZ6A 1M5SA 2YKAA 2C2NA 3MEEA 3VAGA 4OX7A 5AE2A 4UF4A 1I1GA 2FC8A 2HRYA 5B0BA 2DY1A 3I6PA 3TUPA 3OJUA 1KOHA 2K8GA 5CZXA 4TKTA 2ZOFA 1JLEB 3K8WA 1VC5A 2UVVA 2L3MA 4ZN3A 3HT3A 2UU9F 4RO0A 2R7UA 4X66J 3GJRB 2ROGA 3K5PA 2JVOA 3M8YA 3K2YA 4OJ1A 4KR0B 4YY3F 4OYZA 1M1HA 2GIFA 1RHMB 1ZTWA 1U0HB 1CULB 3HSDA 1IUJA 4R5PA 5KG6A 3D1QA 1RYSA 1HHTP 1YITS 1JX4A 1JNZB 4DS4A 5J2NA 5C24A 2CDRB 2JC0A 4OZ2A 4GC7A 1Q79A 2F8EX 2FZKB 2HQFA 4LSLA 3T1AA 4KFBB 2KDOA 1B4SA 4LFCF 4IH7A 4WTYA 4QW8A 3BZQA 1PIEA 1W2IA 2DH9A 3MR7A 4OZ1A 4I7FB 4EWTA 1IJEB 3QT8A 2PGCA 1GMWA 5HSPA 4BWJA 4P2MA 4ZN1A 2XY7A 1RA7A 3L9ZA 4OZ0A 4IR9A 2DBBA 1VQPS 4LSZB 1SPBP 1RT6B 2CZVC 4B3SJ 2CVEA 3RYLA 4KKOA 4IO1A 2GHPA 3KK1A 2QX0A 2M0GB 2AJ2A 1JWWA 4PKDB 3TQ1A 2HAIA 3THPA 2B6AB 3CJ5A 1Y5IB 1W25A 3AAWB 1LWEB 1F9HA 1B7FA 5HVHA 1KWMA 5GAEI 4DR2F 1Q86T 1OYEA 4CCHA 5KFBA 3AB4B 1YRUA 1NZAA 3VAFA 3A3NB 2E7WA 1FKPB 2BUNA 4GMKA 1TL1A 2LVWA 3W7BA 2U1AA 1KONA 4X4SA 2IRXA 2QEXS 3NL0A 2GW8A 3ZTQA 4RUHA 4KHPJ 2XSJA 4JI2J 3MDFA 2F4VF 1U7LA 2Y1RI 2JVRA 4O3OA 3MI7X 4Q8EA 3LP1B 1K8AT 2BX6A 4G65A 1KD1T 1PC5A 1P8GA 2RVJA 2ZJRQ 4K2XA 1B64A 2KG1A 2HFNA 1HD1A 4DR6J 1RWXB 3BBCA 1RKJA 3KUGA 3W62A 3KNGA 4FVMA 5CZVA 1K9MT 1H2TZ 2BDPA 3DCAA 3IBCB 2HGNA 1NJXA 2W9AA 2CVIA 1WOSA 5I42A 3QJJA 2CNLB 2RB7A 2AGOA 4RNHA 1HLWA 1V6HA 2FGOA 4DFJA 1D1UA 3N0VA 2O01C 3M2UB 2YQ0A 2RSQA 1RBAA 3GCWP 4HL9A 2G4BA 1VMBA 2WVBA 1F0XA 2ZBIA 3GE9A 5DZ6A 2C2OB 2GVDA 2N4DA 4E0DA 1RT4A 4JP8A 1IBCB 3L7UA 3T6JA 3D6HB 4X4OA 4NOHA 5ETMA 1HI0P 1FXLA 2D1CA 4NLRA 2GJFA 2I5JA 4QWEA 2DNHA 1U1KA 4NLGA 4Z7CA 3MR2A 1U6ZA 3IC1A 1S9EB 4FYWB 2ZITA 2HHWA 2PI4A 3UN3A 3HP6A 1EB0A 2Z2MA 4HYKA 2GJ2A 1D0EA 3QRPA 1HWIA 2HQ3A 4ICLB 4PG7A 5LM7E 2DRAA 5F8HA 4XO0A 4NLTA 2HYIB 1RP5A 2GGPA 2ZFHA 4ZITA 1BQNB 3H2LA 2P9GA 1T3NA 3BQ0A 5F3ZA 4E8UA 3AOCA 2ALYB 3SDEA 1DHMA 4BC7A 2FQQB 2WAQD 1C1BA 1RTZA 1U24A 4F4KA 3K8VA 1S1XA 3KLGA 3HZGA 4JV5F 4X62F 1CJKB 2RF2B 2CPZA 2HFOA 1U2FA 2UUWA 1WHWA 4ZVTB 3SI8A 3JSRA 2CJXB 3AOBA 3IR7B 4JI3J 2GAHC 4FF3A 4IH6A 1R27B 1X5OA 3A13A 2DCUB 1HHQA 1Q5VA 5D0HA 2N3OA 3V81B 1RLCL 3R2CJ 4DPOA 2IY5B 1E6VB 1FK9B 4YFUA 2HLTA 1AFJA 2QMWA 2ASJA 2IVYA 3BKFA 3ISZA 3CT9A 4ZVSB 4NLPA 2V6AA 3ELHA 1T3OA 4DDFA 2VICA 1RHUB 2XTJP 1EQMA 2NPFA 2L48A 4IYQA 3VGUA 3MF5A 4TQRA 1JB0C 3OSPA 4OHVA 1CJVB 4EO8A 4OZ3A 3QQCD 3M8RA 2FYXA 1N36J 1B7YB 2J0QD 2HW3A 3W60A 2QSFA 3KXDA 5KFRA 1S9GA 3IBWA 3OT9A 3CF5Q 1ZA2B 1U1QA 5KFAA 1JIHA 2AHOB 2MLZA 1MSWD 4J9PA 4O3PA 2MDAA 4LFBJ 4YP3A 2CPXA 4ZMMA 3BQ2A 5ADZA 4QW9A 3VZHA 1S4FA 1HNIB 2A2DA 3DU5A 4Q45A 5CHCB 3D9BA 3TJ9A 4USKA 2CJBA 5IXUA 4PUOB 5C42A 1QY7A 4JUZA 3AXMA 4BLGA 4DS5A 5FD1A 5J1NA 1HWJA 3NWRA 2AYGA 3V6DA 1X5SA 1VRTA 4K50A 1IR2A 1HW8A 3PW7A 2XO7A 2AJQA 4ZKAA 4A8SA 3TEGA 3G96A 3B82A 4LF1A 1PKUA 3BH7B 2HQIA 2V4RA 5KFMA 4WF9Q 5A0YB 2MB0B 1FDDA 4CNYA 2VV5A 4YDXA 1ZBTA 4BC9A 5BYQA 5HLFB 1NB7A 3SCKE 2UUCJ 2E44A 1DARA 1HPZB 4M94A 2CQGA 2LXFA 2XMJA 3GYGA 3UI3A 2PIIA 2ZDOA 1N32J 4QJVA 1QE1B 5IM0B 1ZTTA 1WNEA 3T41A 1HBMB 4U7UD 2F9JA 4C6AA 2VG5A 3FSYA 3MMBA 3HO1A 2E66A 3J7Z5 2BV3A 1IQZA 1D9AA 3IFEA 3P96A 3UPFA 4DCJB 4DV2J 1Y3JA 5LMUF 2JC1A 3G6ES 4CIOA 1HFEL 2RHQB 3T19A 4WFBQ 1VFJA 2Q6CA 1HBNA 3HM9A 5J2QA 4JI0J 2B4VA 5AXLA 1TL7B 1MROB 1RADB 2AEFA 3M8QB 3SIPB 2OSQA 4DQPA 3GV8B 1VC0A 2DEJA 3IAS9 2VOOA 2WW4A 3MTJA 3HVAA 1RAAB 2UXCJ 2V68A 1S59A 3TOQA 4KYZA 1X9MA 5DLFA 2ZE2B 2RKIA 3E01A 3FEZA 5CYQA 2FZCB 2ZH3A 3G82B 4CLLA 3NS7B 2PDAA 4FDFA 4F36A 5KFSA 5KT2A 4OX9J 2BQRA 1JLGB 4K2JA 1BMQB 2OFGX 4K0KJ 1HYSA 2YNHA 2HG4A 1T02A 3T9NA 3I0SA 4K4ZA 2IM1A 2J5AA 1FI4A 3LF0A 4LF4J 2R8IA 4DR3F 4Z7YA 4HTJA 4TY9A 3GCXP 5T41A 4GKJF 3BBBA 3CCJS 3MEDB 3O3LA 1S1WA 3PRVA 3RB4A 1XNQJ 1RWOB 1SKSA 4LR7A 2GO9A 1HBUB 4G1QA 4WXOA 2E7VA 4PYAA 4TY8B 1ZZFA 1JLAA 3ET6A 4X4NA 1KN6A 3HVWA 1F5CA 1FJGF 1XMQJ 2Z0GA 1LKZA 2WTFA 3TA1A 4IG3B 1V3RA 2HZVA 3M05A 1SJFA 2DNYA 4J9NA 4DR4F 5I3UA 4X64J 4HH0A 3FBBA 2EFOA 5KT4A 3QLHB 2VQFJ 3IO1A 2ZVSA 1RSCA 2XCPA 2DTJA 2LQJA 2KTQA 2I1RA 1YRTA 1XMOF 4ZHRA 2HHHF 3K17A 5F8JA 1KC8T 5EUHA 5L8RC 3BKUA 5IT0A 1SB6A 3C14B 4GVBB 4NLYA 4PQAA 4OYOA 3DFEA 8ATCB 3M6XA 4DV6F 2HBYB 1TQLA 1FVSA 3ZZZA 3HVTB 4F2RA 2DR9A 2LECA 5DO2A 4NYZA 3GFHA 4W92B 5AXNA 2HHSA 1WC0A 4ZLJA 2ALZA 5F9LA 1OY6A 4J9VA 2KN4A 5D3GA 3H98A 2GIQA 2MLYA 4GC6A 2CZ4A 3MAAB 4UZBA 2KT2A 1EKSA 3KLEA 1Y11A 3BPSP 5F8LA 4FXDA 1T03A 1DFDA 4K4TA 3E2EA 4RUBA 1KVJA 4A47A 1VQ6S 3G6XA 2J8AA 3EZOA 4CLYA 2IAJA 1R8CA 1KQGB 4ZIVA 3PRBA 3LAMA 3KLFA 4XPEA 3MXHP 4ZLNA 3DGPB 3R5AA 1AT1B 4FP9A 5DGAA 5ETVA 2Y8YA 2VQEJ 1S6PA 1LK5A 1VIXA 2KVQE 3I56S 1NKCA 1L3VA 3M2RA 1HQUB 1RAJA 1RUSA 5KFJA 2MQQA 3W2VA 3R6LB 4NXNJ 2PEBA 4YR2A 3Q89A 4DU8A 4RW9A 3SQGB 3R3TA 4EBDA 3OLBA 3TR5A 3DLKA 4NLDA 4I1TA 2IIHA 1T94A 3Q2SC 3W66A 1LXNA 4M8LA 2OELA 3HULA 3ZZYA 3O1LA 3F56A 3PW0A 1T95A 1RWUA 2UUAF 2CPFA 3MZIA 3WZ0A 2CIMA 4ATNA 1YLXA 2PFDA 1QM9A 4N77A 4A8FA 3UDEA 1SV5B 1W2BR 4LBPA 3QZ7A 5H9FJ 2PMZD 2EG1A 1BQMA 3QWUA 2CADA 4IFVA 2B9WA 4DN0A 2VG7A 3POTB 3K59A 2JLEA 2ZC3A 3P4UB 3C3LA 4QIVA 3BGRA 4WTOB 4MFBB 4USTA 4QWDA 2Y0BB 2B56A 4IKAA 4Y2AA 2HURA 3ILIA 1U0SA 3M2VB 2R8JA 3RU0A 4V1Ak 2DR7A 2J7KA 1FNOA 4FXVA 2YNIA 2ILZA 2UXDJ 2B8QA 4KIAA 1JMTA 4ZVOB 4JI7J 2ZOGA 2IM2A 2WONA 2XZTB 4W4MA 2DNZA 5KFOA 4RW8A 2CQ0A 2QMXA 4DPXA 1N0VC 4UOHA 1B70B 2NSCA 2RQKA 2XY6A 3TUJC 3OJSA 2NLWA 1H0HB 5DDQC 3OVSA 2GVZA 5F3TA 2IYGA 4RW7B 2KI2A 2ZH6A 4UOFA 2YPYA 1VQ4S 2YBVA 3GJTB 1KVIA 4WZMA 1TVRB 1SC1B 1UEKA 1EX8A 3M8PB 3T5HA 1CBKA 3CJKB 3LTOA 1R8PA 2R7XA 3D1OA 2DR8A 4IR1A 1JLCA 4L75A 3NNCA 2E7XA 1WTBA 1T0TV 2W24A 1MU2B 5H9FK 2DCLA 3GMGA 2V67A 2AJFE 3CDEA 3KG4A 4KGMA 2LEBA 4QWBA 3CCZA 2PD1A 1TR0A 1X9SA 2EKYA 2X3DA 2ZKUA 2IC3A 1Q16B 3V2UC 3VGVA 3ZTRA 1VQ5S 3LGMA 1FX2A 4NCAA 3L7PA 3MM6A 5FJ4A 2ADCA 2CJYB 1HNWJ 5KG2A 1T9WA 2V8GA 4CI0B 4YHHJ 2V2VA 1KTVA 3DOKB 1OY9A 3QPIA 5A6PA 2AJ1A 4O3NA 4NE9C 4CLUA 3FZBA 2H48B 4A48A 5B0EA 5CCMA 4YMEA 4LF5F 3ULHA 3J81Y 1IBKF 1FEHA 1VJQA 1WG1A 3HFVA 2BE2A 2AEMA 2VASA 3RBZA 3MMJA 3FBEA 5ETRA 5I3PA 2N4CA 1FF2A 4ZIWA 2HPUA 2ASLA 2E5HA 4BBYA 1ZAWA 2W2MP 1HQEA 8RUCA 5C25B 4UW2A 4QQBA 4QCLA 5HN0A 1PAEX 4OI4A 2W1BA 3N6MA 3UNGC 1KFDA 2VPYB 1RYRA 5A76A 4CTAA 1MWZA 3CNQP 3R5GA 1GXLA 2XZDB 3NGDA 2MZRA 2SXLA 1FT8A 5ETOA 1Y4ZB 1OQ6A 2QT7A 5AE1A 2KXFA 4D3HA 3HF5A 5B7WA 1VBZA 1REVA 2ZZMA 3JSYA 2HHUA 3J7YI 2FJAB 1SVDA 4PG4A 3CJSA 2YKNA 3A3PB 1NJIT 3VAJA 5A8WA 1IM4A 3NCPA 1H2UX 1N34J 4LF6F 1VQMS 1OY8A 3PTWA 4F0MA 4J91A 1MMNA 4KH0B 4KPYA 4R8UB 1XTZA 1GTHA 3AQPA 4CO0A 4JI2F 3C15A 4B3MF 3CJ8A 1S7HA 4O3SA 1F5AA 1T9TA 2R8KA 1N5YB 2K06A 3I0RA 5AJ3F 4ZP8A 2DEIA 2DNKA 2P8IA 4PG5A 4K59A 1RAHB 2HMIA 2BQUA 4X4UA 2EBGA 4Y65A 4TYBA 4QZVB 3T5LA 3BB5A 4I67A 1SH0A 4HEA9 1AZSB 2IM3A 5KG5A 2XMKA 4PPDA 3ZNUA 1U1MA 3KUEA 1UJ5A 3QYYA 1VR6A 2MSSA 2YNGA 2YWGA 1WDTA 1DTTB 1NBEB 2V2KA 1K1QA 1HI1A 3ADAC 3AA8A 3S1TA 2FHOB 3PO4A 3UDLA 4JI1F 2PA3A 1I51B 1LWFA 4WIQA 2YWHA 5DGBA 2NPIA 4KO0A 2YH1A 4NEYA 3FVYA 3FFIA 3GIMA 2LDYA 4LJMA 3L09A 2FLLA 3IXQA 1VQ7S 4B3TF 4ZOSA 1TTHB 5HAOA 5JVHQ 4DLGA 1S6QA 3FDSA 4NCGA 3OTDA 2OHDA 4R5PB 4DSLA 5K5MA 2LU1A 1WI8A 2YKPA 2PE8A 3UWTA 3WC0A 2ZHBA 3RUBL 5J2NB 3LOUA 1YVFA 4WFXA 2APOA 2K1RB 1QDUB 4UUWA 5C5JA 4DU7A 3TWZA 5DDRC 1WWHA 4DPWA 1LK7A 4ZP7A 1WC1A 4JI3F 3DOMB 3NG8A 1IKXB 2MY7A 2YKMB 3V6KA 1UL3A 3PCOB 2F7VA 4NMXA 1DLOA 3UFCX 5GADU 4ECQA 1RQ0A 5K14B 3CCRS 2BE7D 2QN6B 2E5JA 3HSJA 2QO3A 3MPDA 4JI8J 1RI7A 2AEJA 1IBLF 2J9DE 1CS4A 5E41A 4N8OA 3DNCA 1NM2A 3EUNA 2DNRA 4Y2IA 2CNKB 2VFRA 2F4FA 4Y0FA 3X3UA 3GV5B 3V6HA 4M5GA 1N36F 4OHXA 2BRKA 4IOBA 1Q95G 2W7AA 2QG9B 2GMHA 3SV4A 2OFHX 3SCJE 3H20A 3RG6A 2DKOB 4TLRA 2E1AA 3N79A 5KFDA 3CCQS 4QYZJ 1BC6A 1J27A 1JKHA 3UO0A 1KOOA 4MAKA 3TAPA 2O66A 4EK2A 2X1AA 3EXYA 3LUYA 4HKQA 2COLA 4PWWA 2HQCA 2KT3A 3U7JA 3F73A 2DO4A 1RTIA 1VBKA 2R7TA 2DR5A 1OO0B 4M5KA 1H73A 1FCAA 4MTPA 3HZEA 1T05A 2MZSA 4RW6B 3UN5A 3RBDA 5HVFA 2IYIA 4C8ZA 2CJ9A 4DQQA 4K8RA 3F41A 3CCMS 4Q2MA 1JLFB 3P5TL 3ZO7A 4C8OA 2UXBJ 2ZD1B 1DAXA 4O4GA 2ZKTA 2ZM6J 1NKBA 1VISA 2UUCF 2QE5A 3KK2A 2D74B 2NR0A 4ES1A 5ETPA 4KGKA 1DRZA 1AFIA 1EKRA 2R7SA 3RBXA 3PX4A 4F4ZA 4QWAA 3QGPA 3IG1A 2B4UA 2BJ7A 4IG0B 3ZZUA 2DGSA 2H3EB 3BR8A 3UCZP 3RB3A 5KFGA 3W2WB 4QYZK 5K20B 2FUG9 4U7CA 2AKWB 4FF2A 1RE1B 4E98A 4B02A 5L9NA 1Y3KA 4WFAQ 2KZZA 3M1VB 4I4BA 2NUHA 1TL3B 1HNVB 3RRGA 1C1BB 1PSDA 4O0NA 4AYBD 1S12A 1UFWA 4FNHA 3DOLB 4LRFA 4JI0F 3J81U 2OKQA 1M5PC 4NRUA 4F3MA 4J7CA 2FJWA 5GADI 4N5SA 2BR0A 5KT5A 4RU9A 2CQ3A 3DRRB 3MCNA 3D0GE 4WK3A 1HWLA 2BJ9A 5KFZA 5E2QA 1FKAF 2OPSA 4DZDA 5L1JA 1QTMA 5B0FA 1Y00A 1KQSR 1X4AA 3VHQA 5IQQA 3TVKA 2BKOA 1EETA 1S10A 3MOZA 1TUVA 3AD9C 2PEHA 3J81j 4KGVB 4DV3F 2NQPA 2NZCA 1FHTA 1WELA 1DURA 2OEMA 4CYUB 2R7OA 3TZYA 2J9CA 1BWEA 4ED4A 1XR7A 3G71S 3K0JA 1NK6A 2VBWA 3ILLA 2ABYA 1ZAVA 5J2PB 3IWXA 4RUCA 3W63A 5HVGA 1N6QA 1HIYA 1UPMB 4OX9F 3VAMA 2LMIA 2C3PA 5KFNA 3CULA 2JL9A 7AT1B 4HT5A 3SCIE 1NSQA 5M2RA 3LWLA 4DEZA 4AL6A 3AFGA 4DSKA 1FFWB 4C3LA 4PWDB 4F50A 1QD1A 1BHNA 3T1HJ 1WOPA 2CNOB 2OPQB 2J0WA 3DDIA 3TX8A 2XCAA 4XDDA 4LF4F 2DB1A 1T8EA 2ZJPQ 1J2VA 2I38A 4OHYA 2ZH4A 2HGMA 5K8PA 3ZZRA 5E3CA 5HI7A 4EI2A 3AOAA 4DI6A 4DR1J 1NDPA 1WF1A 1VS3A 3H7HB 2VD3A 4KB7A 1AW0A 2KHCA 2ZH7A 4O3QA 4EU0A 1YZ7A 2HZCA 3G4SS 3K5LA 3AJ2A 5EX3A 1VQ8S 2RUGA 4DPYA 2BJ1A 5HMXA 5ETSA 1R8AA 2QV6A 4OJHA 5J1EA 1FFSB 2V9KA 2HNZA 5B0GA 3V4MA 2B4OA 4IFYA 1S1UA 5L39A 3O8WA 4KH1B 2JSXA 4X64F 3DRSB 2Q1LA 2VQFF 1G6BA 3EGZA 2XBPA 4LIRA 1SI9A 3W9IA 1XNRJ 2R8GA 2MKIA 1BQXA 1LOUA 2F1FA 4AQYJ 2H4YB 4J9LA 1YJUA 1RT1A 4MIAA 3GQCA 3MMAB 2IDEA 2B51A 4M5JA 3E8OA 3PZPA 4OX6A 1IWGA 2P2CB 2VG5B 2R8HA 2MKKA 2JH3A 4ED6A 3PG9A 1EJ7L 1SJRA 3LANA 4M5DA 4ZPWR 2RMLA 1I6JA 2KL8A 3J7A1 1YWXA 3Q8YA 3THTA 1ICEB 5J2QB 1EP4B 4DV5J 2OAUA 3KWMA 3OFEA 5BJRA 2W9BA 3MURP 4C3MA 2DRDA 3MUTP 3ZFVA 2VB6A 3AHPA 1Q0NA 2DGTA 3TJAA 1B0VA 3DYAB 2M8HA 2QFIA 1U47A 1OJ4A 1LWCA 1ACMB 4NI2A 2E1RA 2CPJA 3TI0A 2DNQA 3GJQB 2LYVA 4FN5A 4NLWA 5C7PA 1N56A 3FQKA 4L76A 1NDLA 2E9TA 3FCWA 4RW4A 4NLXA 1CJUB 1YK9A 2OGUA 4C8YA 3BDEA 4MH8A 5CYQB 4ED5A 2MTLA 4OL8A 4MKVA 3MAQA 1JLBA 2OIHA 2DPJA 3QT6A 3V5RA 1RT3B 2PSZA 3IS9A 1HYSB 4ID5B 3OVAA 1Q8KA 5D4NA 2RU9A 4TLQA 2A1BA 1TMMA 5IZHA 3S01A 2ERRA 3Q0AA 5KFVA 5KFUA 2B9XA 4P7VA 1U6BA 1WEYA 4QU6A 1R6VA 3GR1A 1U8SA 2GS8A 5IFMA 2YVSA 4B9SA 2M5YA 2FVPA 1YJVA 3MWBA 2OUGA 4JYAJ 3C16B 3DHWC 4ER8A 4LT6A 3PJXA 5J2MB 4FKXA 2NXNA 1XN9A 2A0FB 5GAGU 4LF8J 1JLQA 3JTNA 5J1PA 2D7SA 2CA9A 3HK2A 1U6FA 3H40A 3CDUA 5EX0A 5I3UB 4W90B 5KFFA 2UXDF 1NPKA 2POKA 1NSAA 2FTRA 4HDGA 3THVA 2MEWA 3FQLA 1IJFB 5IT9Y 2HNDA 1NB2A 1LW0A 2QLJB 3NGTA 2HQGA 4CM2A 4DSEA 3OR1B 3CD5A 1HMVA 4L74A 3QGIA 3GR0A 3IRXA 4CWBA 4ELTA 4DV4J 3OTBA 1IKYA 3PXGa 2BJEA 1WKJA 2M88A 2VHGA 5ETNA 2AMCB 2W2QP 1S6OA 3BYRA 1FJ7A 1V5IB 3FRZA 4WU3A 3PW5A 1G2EA 1RCOB 1O51A 2AWZA 3GIIA 4KHMA 5DETA 3RB6A 3ENQA 1GMUA 4MYTA 2CWKA 3M6WA 3BEGB 4KT0C 2ZWPA 2HHXA 4YDDB 1RLDA 3H5UA 5F8MA 1KR4A 2AYBA 2FHKA 2IJNA 4C0BA 3SFUA 1UZHA 2GZOA 3HSZA 4QU7A 2QSWA 2OEJA 1AB8A 4FBUA 2CQPA 2HVHA 3Q83A 3EZ5A 3Q8QB 2ZHAA 3EGWB 4JI4F 1RTJA 3HHLC 3FMWA 1HARA 2VPXB 3FGVA 2YWEA 3PX0A 1NK4A 1LNQA 3PM9A 3W5XA 3KLFB 4WWSA 3QT7A 2EFVA 1P1LA 4NLSA 3JYTB 3H8YA 2BYCA 2RQ4A 2CQDA 1RTDA 4H4KC 3O6QA 2WRMA 3I82A 1R89A 3FSXA 3W61A 1TFWA 7FD1A 3TUZC 1AUDA 3CIMA 1RHQB 3MR3A 2QLXA 3DLGA 3DLKB 1B0TA 3DLEB 4JB8B 3D7SB 2DNGA 4OYPA 1WC6A 1UA1A 1FRLA 2DNLA 1MW7A 2VIHA 2MLXA 2RUSA 1D8YA 2VC1A 2VKZG 4UTGA 4ILLA 3PHEA 4LF9J 3DRPB 1ZM4A 3Q2TC 4LF7J 2BA9A 1C0TA 2FJVA 4PXCA 2IHR1 2UUBJ 2BANB 4ZPTR 5LMNJ 3QIDA 3VZIA 3OL8A 1RAIB 4Y00A 4TVAB 1S0OA 1VBXA 3HKZD 1BQMB 2GHWA 1YJRA 3CWJA 3NP5A 2V8HA 1VQSA 2CJKA 1OS5A 2AQ4A 3ENAA 3A8JA 1M0SA 2EC0A 2C22A 1HL6A 2OPRB 3BSCA 4DL4A 4RBUA 4YS2A 3VAHA 3KJVA 2DK2A 2HS4A 5ETLA 5SZTA 4M63A 4FZVA 1VQLS 2MHEA 4ED0A 2MKSA 2XWYA 3VF0B 1U0HA 1FRJA 4DHVA 5CD4A 1SBRA 2QA4S 1W26A 1I94J 2LQBA 1JJHA 3D6MB 2J7WA 3NEKA 3DM2A 4ZJQA 3HKWA 4QYRA 1HBOB 1MG7A 1WKKA 2WSEC 2IRYA 3MPYA 3NXZA 4I2PB 2FJXA 4IRDA 4EGLA 3B4DA 3D5MA 2KVIA 3SFGA 3QATA 1KQKA 5B0DA 1TKTA 2UZAA 4B9NA 4KFBA 3CJ0A 3ZZOA 2FVCA 3NGSA 2J7UA 2ZZTA 1FO1A
chains in the Genus database with same CATH topology
1XERA 3CD0A 2MGZA 2CZ4A 3RR8A 3M1VA 1LFPA 4GO7X 2MQNA 2I8EA 1TL3A 3CJ3A 2KT2A 1HNVA 5KOXA 3PIPQ 4I7FA 3HX9A 4WFZA 4C0HA 3T1YF 3DHXA 3QO9A 2C3OA 4WYWA 4TYAA 3KLEA 3MUVP 3OFGA 4MK7A 3DOLA 5G0RB 5F8LA 2AGPA 4CNZA 4FXDA 2FHMA 3CJ4A 5KFWA 1YBAA 1T03A 2PC6A 3EXCX 4H4MA 1DFDA 1N4LA 1RKIA 1M5HA 4K4TA 1KNZA 3E2EA 4O4GB 3CDWA 2IMOA 4V19X 1KVJA 4A47A 1VQ6S 3DRRA 3G6XA 2J8AA 4JV2A 1RT6A 1O0PA 2DHAA 3E3XA 2ILYA 2CPDA 4I6WA 3T5JA 2IAJA 5KG1A 2RS2A 1B0PA 3KK2B 1R8CA 2M9KA 4V19J 3W3SA 2E5IA 2EBEA 4X4PA 1KQGB 4JV0A 2WK4A 3PRBA 3LAMA 3AJ1A 3N6NA 4OZJA 4X4QA 3KLFA 4QBUA 1Q1KA 2EFQA 4XPEA 3MXHP 3GZ7A 3LGNA 4LQ9A 1WEXA 2DIUA 3O5TB 3H5SA 2V4JA 5AE3A 3R5AA 2J6TA 3KKFA 1O8BA 4FP9A 5DGAA 1LWEA 2D3UA 3IG1B 3Q22A 1RISA 1S6PA 1LK5A 1BLUA 3RAMA 5DQHA 4TU7A 5C24B 2EI5A 1FTRA 1CEZA 3H5XA 1VIXA 1JLGA 3QJPA 4K4UA 2ACYA 3I56S 1O5JA 1NHUA 2U2FA 3R27A 2C3MA 1NKCA 1L3VA 3KNAA 1VRUA 3M2RA 4WFYA 4FYDA 2YQ3A 1HQUB 4G1PA 5A8RB 1S48A 1TKXA 3M9NB 1AROP 1RAJA 5KFJA 4LSLB 1K0VA 2MQQA 3W2VA 1FKPA 1U1OA 3OTCA 1JJ2R 1FXDA 5KFYA 2FHJA 1U09A 4MIWA 1KS2A 4YR2A 4ZVHA 5J2PA 4CO5A 4ZK7M 3PV8A 4RW9A 7FDRA 1C2PA 3BO3A 3OUYA 2FVRA 3SQGB 3R3TA 4EBDA 1ELOA 4QR2A 3OLBA 3TR5A 1S1TA 2HNYB 1TKZB 4AUKA 1VC6A 3X1LB 1YHQS 4CT8A 5M2PA 1IKVB 3CVKA 3DLKA 2AP6A 2FPHX 4CQ1A 4LVNP 4DV5F 3C6UB 4ELUA 3MOJB 3MUMP 4NLDA 4I1TA 1T94A 1D9DA 2RE1A 3Q2SC 4WIIA 1XWLA 1WG4A 1IXKA 3CMAS 5CD4H 1JNRB 1LXNA 2RD5C 2VKRA 3I96A 4M8LA 5MLCV 3ENWA 3I9V9 3LP1A 3DRYA 2OD6A 4CO2A 3F44A 5BYRA 3ZZYA 5K8NA 3BSOA 4PWDA 4KKOB 4OV1A 2L9WA 3CJ2A 3O1LA 2OPSB 3F56A 1S9FA 1CQMA 2DHXA 1LQ9A 1H7WA 3CGIA 4I0WA 4DV1F 3PW0A 1T95A 1RWUA 2RQMA 3PEJA 5LXYA 2OPQA 1VLYA 5FDLB 3KK1B 2GHVC 2UUAF 2CPFA 4J9SA 1NK5A 4ED2A 4EZ6A 2R4FA 4K4XA 4KSEB 3MZIA 1N5SA 3WZ0A 3NAHA 4RWWA 3K58A 4RZRA 4KJIA 2CIMA 3QWPA 2KH9A 4ATNA 4Y6IA 1FE4A 5FIIA 2P5VA 5KFHA 1QM9A 2JEFA 2XNRA 4N77A 4A8FA 1ZAXA 1H7XA 1SV5B 4ZDNA 1W2BR 2M52A 4UQTA 4J9OA 2E5GA 4DV7F 2GA7A 2PT0A 1CPZA 4CTAB 3QZ7A 4ECUA 2F8MA 2GIQA 5H9FJ 3WC2A 2PMZD 2EG1A 4KTQA 3OW2R 2K3KA 1BQMA 3FEXB 3HHLD 5DDOC 3QWUA 4IFVA 2B9WA 4DN0A 2MQOA 4DQSA 2DVIA 1Q8IA 2VG7A 3POTB 2MQLA 1NK9A 3S7RA 2W8LA 1X4FA 3K59A 1TL1B 2JLEA 2ZC3A 2ASDA 1Y0HA 2KM8C 2VFVA 3M2UA 2V8VA 4I69A 4RUAA 3KLVA 3C3LA 1N88A 4QIVA 1H6KX 3BGRA 4MFBB 3SCLE 3US5A 3J80Y 1SJ4P 2UUTA 4QWDA 4IRCA 2JHEA 2Y0SD 2XG8A 2B56A 4CH0S 4IKAA 2MZQA 5LSRA 3OTEA 1Q8LA 4Y2AA 1R3NA 3MMCB 3AQOA 4DF4A 5G4DA 4BDPA 3M2VB 5LT5A 5HO4A 2HVZA 2FJDB 2XMWA 2G1DA 4LSNA 3Q8PB 2UP1A 2XSJB 3RU0A 2R8JA 3PJWA 2GX8A 2JJ4D 1QLNA 3JTPA 4ALZA 2DR7A 2M8DB 3NAIA 4NA2A 2J7KA 4FF4A 4LFBF 1U4BA 5CCLA 3BGFA 1FNOA 2XMMA 2CYYA 1C4CA 3OR2A 4H4OA 5LSLA 1U25A 5LSOA 4FXVA 3ZC4A 2YNIA 2MZJA 3AH6A 2AYEA 2HHVA 2HGLA 2ILZA 4Y28C 4KIAA 4O3RA 1JMTA 2DGWA 5DJBA 2ZOGA 2IM2A 3EGNA 2IMWP 2F3JA 3MM8A 2WONA 2XMUA 5F8IA 1U48A 4ZS6A 2W25A 1TK8A 3DRSA 2IBKA 4ED8A 2HRUA 1S9EA 4F3QA 2DNZA 5F8GA 5KFOA 4RW8A 3B8HA 3DN9A 1HWKA 2ZH5A 2Q3PA 3SV3A 2CQ0A 4FBTA 2RS8A 2ASYA 1NNDA 2QMXA 3T6BA 1N0VC 4XPCA 2HLUA 2RQKA 2NSCA 4ICLA 4HTIA 4AE5A 2XY6A 3TUJC 3I5CA 3OJSA 3TUIC 1N52B 2IRUA 2NLWA 3NNAA 1H0HB 3ENVA 5DDQC 1R0AB 2H5EA 2DJWA 4C8LA 5D78A 5I42B 2DGQA 4URQU 2R2RA 3FCHA 4G1IA 2YX4A 1ZPWX 3GYXB 3OVSA 1GXTA 4DR5F 5F3TA 2IYGA 4RW7B 1TP7A 5IQ6A 4Q5VA 2KI2A 1SH2A 1TFYA 2XNQA 2ZH6A 3I0RB 1DZ5A 1VQ4S 3OHAA 1IR0A 2MKCA 2EK1A 2OPPA 3G86A 3MMAA 1BQNA 2A18A 1Z1ZA 1Q7YT 2E1CA 2XMVA 2IM0A 2VG6A 4JYAF 2QFJA 4A4JA 3P6YC 1KVIA 4MKAA 4WZMA 2N7CA 1YQHA 1M5OC 3DLJA 1TVRB 1SJ3P 1TKDA 4Q2LA 1FEEA 1TL5A 3CC2S 3M8PB 2LA6A 2UVWA 3NNHA 1L3SA 3T5HA 3CJKB 1R8PA 5J1EB 2XGQA 1R8BA 2R7XA 4ILRA 3D1OA 2WB1D 2DR8A 1RT4B 2RF2A 4IFYB 1JLCA 4IR1A 2ZH9A 1S1UB 3H4DA 4LF8F 2Z8QA 3NNCA 5JJBA 2L9DA 1S99A 1X4EA 2E7XA 4ZVEA 1UA0A 2I5JB 4L6V3 3SSRA 4PRFA 1WTBA 3LAKA 1ZYQA 2W24A 1MU2B 3IGVA 3G8QA 2YNGB 3M4XA 2DCLA 2DNOA 3TARA 5CH7B 3GMGA 4NA3A 3OSNA 4IH5A 2CFXA 1F2GA 2AJFE 1FJEB 3CDEA 3KG4A 4KGMA 2LEBA 4QWBA 3CCZA 2YY3A 3AY0A 5SUHA 2PD1A 4QIGA 1EP4A 3MEGA 1TR0A 2AW0A 1X9SA 2EKYA 2CPHA 2VA2A 3P49B 4EEYA 2ZKUA 3CCES 3CB4A 3N6LA 4DUYF 3RR7A 2IC3A 3I87A 2B7CB 4EFAC 1Q16B 4A8WA 3V81A 1N32F 3V2UC 1YIJS 1E6VA 1FK9A 2GMLA 4ECWA 1VQ5S 1NEEA 3LGMA 3UR0A 1KLNA 4NCAA 4R0EA 4DQRA 5LXRA 4D3GA 5KG7A 3L7PA 3MM6A 5FJ4A 2ADCA 2RQCA 4NLUA 2XS7A 3DYAA 2VBXA 5KG2A 1QSSA 4Q8FA 3A1YG 2VC0A 4WE1B 1RT1B 5D77A 1GQEA 2YWKA 2GGPB 1J5OA 2V8GA 4NL5A 4CI0B 4P7TA 3CCWA 2XS5A 5A2QY 4QIEA 4ECXA 1KTVA 3DOKB 1ROFA 3QPIA 5A6PA 4WKRA 1GAOA 1D9FA 3VALA 1ULRA 2AJ1A 4RKUC 4O3NA 3SDEB 5D4OA 3PR5B 4ID8A 1RT5B 2RDIA 4DV2F 1NJWA 4F2SA 3FZBA 3D2WA 4A48A 5B0EA 5CCMA 3FSIA 4X4RA 4YMEA 4A8QA 1K1SA 2VFTA 3ULHA 2HNYA 4LF5F 3G8TA 1PC4A 4J9RA 1PILA 1QSLA 3J81Y 4EBEA 1IBKF 1FEHA 1S1XB