1X4GA

Solution structure of rrm domain in nucleolysin tiar
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
109
Chain Sequence
GSSGSSGNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of RRM domain in Nucleolysin TIAR
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Nucleolysin TIAR
total genus 11
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4gA00
2OSRA 2CQBA 2CPEA 2JVRA 3MUTP 2LXIA 1M5KC 4BS2A 2CQDA 3TYTA 1X4GA 2RUGA 4IUFA 4QU7A 2AYMA 3G4SS 5IM0B 3ULHA 2DHAA 4F25A 1U1NA 1R8HA 3SMZA 4WIIA 2M88A 2M8DB 2DH7A 3SXLA 1SJ4P 2ADBA 3K0JA 2KVIA 1BY9A 2LEBA 4YUDA 2DNLA 2E5HA 2MY7A 3CCJS 3DXBA 3NS6A 5LXRA 4PR6A 2XS5A 2YWKA 4PRFA 3LQVA 2DH9A 1X5OA 1G2EA 3CMES 2MB0B 2XNRA 2OSQA 1U1PA 1WELA 3UD3P 1FJ7A 2CQPA 2DIVA 1N8RT 1S79A 1H6KX 1VQ5S 4F02A 4C4WA 2M0GB 2HZCA 1N54B 3MUMP 2DGXA 2F3JA 2LA4A 1VQNS 2KG1A 1OO0B 1DBDA 4YOEA 2MKIA 2CPXA 3JB9k 1KOOA 1P27B 3VALA 2FY1A 2HYIB 2PE8A 3UCGA 4QU6A 5GMKa 2MGZB 2AYGA 2MZSA 1NO8A 2I38A 1RKJA 2CQHA 3UCUP 1WF0A 2DHGA 2I2YA 1WG4A 2QFJA 2MSTA 2CQGA 4F26A 2CPYA 4C0OC 1QVFR 1S72S 2RRBA 2DB1A 3VAKA 1VQ6S 1HA1A 3L3CA 5HL7Q 1U1LA 4ERDA 2DNRA 2DGQA 1ZZFA 1UP1A 2CQ4A 3SDEB 1VQ4S 4ED5A 1WF2A 3NNAA 2KYXA 2YKAA 2X1BA 2MJUA 4Y00A 4CQ1A 3P49B 3FEYB 2HVZA 4TU7A 1Q7YT 4Y0FA 2MJNA 3CMAS 2KU7A 1U1KA 2JX2A 3NS5A 2YH1A 4FXWA 4TU9A 1YJ9S 5JVGQ 3CTRA 2CQCA 2KXHA 3CF5Q 3CCES 2JWNA 4QQBA 2RRAA 2KT5A 3I56S 4OZ1A 3N9UC 2XS2A 2J76E 1U2FA 3OW2R 1OWXA 2LKZA 5MLCV 1YWXA 5LSLA 4Z2XA 2RS2A 1K8AT 3U1MA 3G6ES 2KN4A 3VAGA 2AYEA 2FC9A 1FO1A 4ZKAA 2OTJS 2FHOB 2VOPA 5LXYA 4IOCQ 1A9NB 3PIPQ 2DNYA 1FNXH 3G96A 3CPWR 1X4DA 3R1LA 3CCUS 2XB2D 2M2BA 2J0SD 1X5SA 1FXLA 1X4BA 2GO9A 3S01A 2MZQA 3J7YU 2M8HA 1K9MT 5GADU 3VAHA 2LEAA 1H2UX 2M7SA 1KQSR 2F9JA 2D9PA 2RT3A 1JJ4A 3BO2A 2LMIA 3BO3A 1U1QA 3UD4P 1M1KT 1HD1A 5DDPC 4RU2A 2X1FA 3CC4S 1XN9A 1KOHA 2L08A 3CULA 2MZTA 3CUNA 3P5TL 2A3JA 2MGZA 2KM8C 1VQ7S 1K73T 5D78A 3S7RA 3HI9A 3U1LA 2M52A 1YIJS 3MOJB 1WF1A 2BZ2A 1L3KA 5H1SV 3VF0B 2DO4A 2N3LA 3EX7B 4P6QA 1VQKS 5CXTA 2RQ4A 2MKSA 1JMTA 2DNKA 2DGUA 4C7QA 2KG0A 2OIHA 3B4DA 1WHYA 2WBRA 1VQMS 4A8XA 2CPJA 4M5DB 2CQIA 2N7CA 1U1MA 2KI2A 1VBYA 2DGWA 1KC8T 2MZ1A 2ERRA 1U1OA 3CCVS 2MQNA 2RS8A 4WCEQ 5IM0A 4W90B 3RW6A 2E5IA 2G0CA 2KM8B 1X4FA 2MPUA 1URNA 2U2FA 2RQCA 1KD1T 2U1AA 2N3OA 3ZZZA 2CPIA 1W2BR 2SXLA 2MKJA 2YH0A 4WFBQ 2MZJA 2KH9A 3THTA 2E44A 2D9OA 1NU4A 5D77A 1D8ZA 1NJIT 5DDOC 1YHQS 3BEGB 3G8SA 2KFYA 2CQ3A 2MKKA 2PEHA 2QEXS 1PGZA 1P1TA 1SJ3P 3CCRS 1H2TZ 1DRZA 3CD6S 3D2WA 1FT8A 2HGNA 2YTCA 3SDEA 3I55S 3EGZA 2CPDA 1ZH5A 2CQ0A 1FJCA 5HO4A 1AUDA 2DGSA 1N52B 3H2UB 1SXLA 2MYFA 2B0GA 2CPZA 1QM9A 2OJ3A 1JJ2R 5CYJA 5GAHU 1FJEB 3US5A 5JVHQ 2NLWA 1WTBA 2VOOA 2F9DA 3TO8A 1WHWA 2DK2A 4FXVA 5GAEU 1VC5A 2EVZA 1M90T 1WEXA 1U6BA 4IOAQ 3BO4A 1X0FA 1H2VZ 2DISA 2LQ5A 5DM6Q 3S8SA 2KHCA 2V94A 5BJRA 2D3OR 4CIOA 2LA6A 1YJWS 1X4CA 2HGMA 1WI8A 2JVOA 3Q2SC 1M5VC 3FEXB 3Q2TC 3THPA 1DHMA 4WKRA 2VONA 2KRBA 3VAMA 2KRRA 5GVQA 2LYVA 2QA4S 3HHNB 2DNHA 2ZJQQ 1SJFA 2DH8A 2DHSA 2NZ4A 2L41A 1U6FA 4LMZA 3CCLS 1VQ8S 3NNHA 2MQOA 4CH0S 5CA5A 2L9WA 2MXYA 1WHVA 3BS9A 3G9CA 4WFAQ 2DNGA 1X4HA 2O3DA 4EGLA 3NMRA 5DM7Q 2CPHA 2RU3A 3LPYA 2K8GA 4OZ0A 2XNQA 1YTYA 3CCSS 4U67Q 1DZ5A 3PIOQ 1WEZA 3H2VE 2RVJA 2ZJRQ 1JJHA 2J0QD 5DETA 2DGVA 2J8AA 1X5TA 3CXCR 1B7FA 2KXFA 2MHNA 1N88A 2CQ2A 2MKCA 1WWHA 2Q79A 3NNCA 3R1HA 2DO0A 5FJ4A 2MMYA 3CC7S 3VAFA 1VBXA 5ITHA 2EK6A 3MUVP 1CVJA 3EGNA 2DNQA 3IRWP 1VQ9S 4WF9Q 1IQTA 2GHPA 5GAGU 3B4MA 2G4BA 4QPTA 2X1AA 2OTLS 3VAIA 2MSSA 4YB1P 4LJMA 1UAWA 1O0PA 2LCWA 5LJ3Y 1Q82T 1PO6A 3IWNC 3MXHP 5DDQC 1VQOS 2XSFA 4UQTA 2CPFA 4TLQA 2DITA 2DHXA 2LECA 5EN1A 1WHXA 1Q81T 1VQPS 2XS7A 2MQLA 5LSOA 2MQQA 1U1RA 2FC8A 2FPHX 2M70A 1SJQA 3VAJA 1X5PA 2CJKA 2UP1A 3ZZYA 1SJRA 1OIAA 3G71S 4LIRA 2VODA 3V4MA 2HGLA 3R27A 1R8PA 3MD3A 5DDRC 2CQ1A 2DNMA 3MI7X 2M4MA 5LJ5Y 1M5OC 1VQLS 1UFWA 2X1GA 2RNEA 2MZRA 2N82B 1M5PC 3G8TA 2AYBA 3UCZP 1A7GE 2DGOA 1YJNS 1HD0A 3MD1A 4UY8T 4IO9Q 3P3DA 2KXNB 3CC2S 2DIUA 3TP2A 2K3KA 1RK8A 2DGTA 4J5OA 4WFNQ 2MKHA 1HL6A 3CCMS 4CH1A 1UW4A 2DNOA 2LXUA 3P6YC 1OPIA 5IQQA 1WI6A 3UWTA 2JRSA 1ZZNA 1QVGR 2E5JA 2E5GA 1X4EA 1YI2S 1Q86T 3MDFA 2MY8A 3MURP 2ZJPQ 4PKDB 3RW7A 3CCQS 1VC0A 5IFMA 4W92B 1FHTA 2AD9A 2DNPA 4TU8A 1VBZA 1YITS 2BOPA 2G1DA 2DNZA 2MQPA 4V19X 3J7ZT 2EK1A 2DNNA 3DLLQ 1WG1A 3UE2A 1F9FA 2MQMA 2ADCA 2M9KA 1X4AA 1WG5A 1VC6A 1D9AA 1WEYA 3S6EA
chains in the Genus database with same CATH superfamily
1ACMB 4CTAB 2JFKA 5CZVA 3OTOJ 3QSIA 1SC4B 2Z30B 3W2WA 4O44A 3W1YC 4P10A 4I2QA 1TFWA 4DFJA 1PJ7A 2V34A 4ED3A 2W7PA 1NCLA 4RNHA 5ETVA 4WZMA 1SC6A 2FZCB 4LBHA 1R8HA 2XWXA 1UVKA 2WZ1A 4K7QA 3AXMA 2XEXA 3U1NA 4CLUA 2W9CA 3R3TA 2V8VA 3R2CJ 3K0JA 4OV6A 4OYBA 1VI7A 2PA3A 4RW7A 2HZVA 2C2DA 3I6PA 1BY9A 1FKPA 2LEBA 2DNLA 3ZZRA 1GT8A 4YQWA 4XPCA 4PXDA 3KYLA 4RNNA 5HP1A 4B3TJ 4M5IA 3ILOA 4DR3F 2JLGA 2YWWA 4AQYJ 2Y1IA 2ZEJA 1TKZB 1REGX 4WBFA 4K4WA 1RTDA 4NEZA 4ZP8A 3OFHA 4C2MA 3CCJS 3NL0A 1RLCL 4MK8A 4PR6A 5C24B 2XS5A 2YWKA 2P8IA 2YWEA 2DH9A 2ZNZA 3T5KA 1X5OA 1S10A 3SV4A 2DD8S 2ATLA 4ED4A 5HVHA 2MB0B 1NJWA 2VPYB 3W3SA 1S6OA 2DBBA 4LFCF 3DOLA 4JI4F 2Z58B 2RU9A 2IYIA 4RR5A 2IVYA 4ANDA 2CFXA 3RRGA 4QIVA 4ZP7A 4B9SA 4DV4J 1NPKA 4C4WA 1H73A 1DTQB 2QMUB 3I32A 3MECB 2NXEA 3MUMP 3IWXA 5A6WA 2F3JA 2LA4A 4NLRA 2JEFA 4IDKA 3V81B 3GCWP 1DBDA 2DEIA 4IFYB 3UW1A 2YKQA 3A8KA 2HFVA 1FRLA 2CPXA 3MEKA 1MW7A 1T95A 1RBOB 3SQGA 5HSPA 1WKLA 3N0VA 1RAHB 1SB6A 5E3AA 5L39A 4OJ3A 1GXTA 3OR2A 1DQAA 3H8YA 4PQUA 5HMWA 2MHEA 4KPCA 4Q2LA 1REVB 1NO8A 4TLRA 3J81j 2J8SA 2F5GA 2C3YA 5KFXA 3M1VB 4KC5A 1N5TA 2OPPA 1KQGB 2BA9A 3DDIA 4URQU 3SEOA 3ZFVA 3V6DA 1MSWD 1RKJA 3OD2A 3M6WA 2GIRA 2RH3A 3RAQA 1EB0A 5KOWA 3BSAA 3GU0A 1NXIA 4H4KC 3PR4A 4LFAF 2RUSA 4CO2A 1LWXA 2FTRA 4L6V3 2YKPA 2ZBQA 2DPIA 3RB0A 1RHMB 1RT6A 1XR5A 4FBUA 1QY7A 3C46A 1KWMA 2AIRB 2HNYB 3OSPA 2HVHA 2HIQA 2AJFE 3LAMA 1BLUA 2DB1A 3MCMA 1YK9A 1HARA 3OHBA 4ERDA 3QRPA 4A8KA 2DNRA 2DGQA 1ZZFA 1CJTB 2W4PA 3D54A 1FRMA 4ZVQB 3SDEB 1IBKF 1VQ4S 2BQUA 4DR6F 2OPRB 1IKWA 2I1RA 5HBMA 4RX6A 4DR6J 2VU5A 5GAGI 2OKQA 2XZWA 2RILA 3UDEA 2GIFA 3V5RA 1OS5A 3W64A 2XLKA 3S1TA 1DTTB 1VISA 3PFEA 4TU7A 1Q7YT 3CMAS 2LLZA 1OYEA 4M5MA 3M6XA 1RHQB 2V4JB 1YJ7A 3NS5A 5J1PA 5EX3A 5KFEA 4NLXA 1HNWJ 4GO7X 4EO8A 4TU9A 1HI1A 1SUQA 1GMWA 3OFGA 4JI8F 4Y65A 2YXLA 3A3OB 2GV1A 2XMVA 3CF5Q 3QT7A 3BGRA 1T8EA 2QTWA 1OQ6A 2PGCA 5GMEA 4U96A 4ZS6A 3T1HF 1SJ1A 2XS2A 4LREA 2XTJP 2A6MA 2J76E 1Y5IB 1U2FA 2AEMA 2AX1A 4HACB 4WWSA 1ZM3A 4X64J 2A6OA 4HDHA 1K47A 2B51A 4F4ZA 3HFZB 4OYAA 3D6TB 5KFAA 1YWXA 4HHHA 2Z2ZA 4E8UA 5GADI 2ZM6F 3U1MA 4JI5F 1QAIA 3VAGA 1S1WA 1EX8A 2HG4A 4FPRA 1C0UB 1LQ9A 2V50A 3GCXP 4DG1A 2B56A 1VK8A 4ZKAA 4JI4J 5E3QA 2FHOB 4ECZA 1HNIA 1YJRA 3MR2A 3NGDA 3T1HJ 2JZ5A 1JLGA 4HKQA 3JXOA 2CNKB 4CO4A 3PDNA 1WC3A 1T05A 1HNVB 4X64F 1Q78A 5ETLA 1TL5A 3M05A 3G96A 2ZHBA 3CPWR 1IBLF 5H9EJ 2RB7A 1XNRF 2E1CA 2XB2D 1AROP 3N28A 1R0AB 1B70B 1CS4B 4QR2A 4ZPWR 1X5SA 2CYYA 2GO9A 1NH7A 5F8HA 4P73A 1U4BA 1FXLA 2XG8A 1DFDA 3S01A 1XEZA 2MZQA 3UFCX 3PW7A 1K9MT 5D4NA 3VAHA 4ZOSA 3AD8C 1TTHB 3QO9B 2EFQA 3G6YA 3NCRA 4JV2A 1KRPA 1X9WA 4ES1A 3BH7B 1KQSR 4K4SA 1ROFA 3QATA 1YG0A 2DCUB 2UUAF 1JJ4A 3BR9A 4IG0A 1N5VA 4OHVA 3P8BB 1LK5A 2A2CA 3HHDA 4DR2F 2BQRA 4LF7J 1U1QA 4KHPF 3IR5B 2OLWA 1FD2A 3EM1A 3H20A 5JMNA 3TI0A 2P6SA 3CIZA 1RACB 4RU2A 1LWFB 4DPUA 3Q8SB 4GKJJ 2FJWA 1KOHA 1IR2A 1XJWB 5CHCB 2MZTA 3J7AN 5GMDA 3CUNA 1VQYA 2NZCA 4XK8C 2C22A 3V6KA 3M4XA 4DU8A 3QT5A 2G9OA 2A3JA 3FRZA 2YX7A 1VQ7S 2JH3A 2WVCA 3PTWA 5D78A 1UFLA 2HFZA 2NPIA 5DLFA 2OMOA 1S1XB 1U25A 5EWGA 3DLGA 2XMMA 2VFUA 3KLHB 2UXBF 3I0RB 1L3KA 4OIXA 3OXLA 2BR0A 3TA2A 3EX7B 5IT9Y 5KFTA 5FDLB 1VQKS 3BGRB 4XDDA 1N48A 5CXTA 2B9EA 5CQGA 5KFUA 3T41A 1M1HA 2QA4G 4B3SF 4USWA 3Q8UA 5AXLA 3GFHA 3B4DA 4WK1A 1NDCA 1UZDA 3CE8A 1NHKL 2VL1A 3A8JA 3M32A 3MAAA 2CQIA 2C3MA 2RF2A 2GAGC 4JI0F 5B08A 2XY6A 5KFDA 2DGWA 2NSCA 3PYFA 4E98A 2MZ1A 3EVWA 2ERRA 1NB2A 1VQSA 2QYCA 3T3FA 2RS8A 1ZBTA 1IKXA 1JLCA 2XYPB 3OL9A 2ILYA 3IAM9 5IQ6A 4GKKF 3NOCA 4N47A 3MFHA 2OFGX 4JI0J 3FZ2A 3LAKA 2AW0A 4KGZB 2Y1RI 4KR0B 4RBVA 2G0CA 4DUYJ 5B0DA 1B3TA 2UXBJ 5I3UB 1SL0A 1JQGA 1KFDA 3GILA 4OJ1A 3K7RA 3TX8A 4CP5A 4OX6A 2Q6BA 4ETXA 3HK2A 2ABYA 3HF5A 4Y2MA 1FKPB 1EKRA 4NLWA 4PYAA 2U1AA 4FKXA 1LWCB 3ZZZA 1TVRA 3PY8A 1W2BR 3PEHA 4DQIA 2SXLA 2YH0A 3KK2B 3ZXWA 3J80Y 1VIXA 3BKTA 4IOBA 2B8PA 1VRTA 1F9HA 1LNQA 2IJRA 2ZKTA 3B6BA 3ELHA 3P4UB 4K0KJ 4DV2F 5F8NA 3AH6A 5JJBA 2GO8A 5DQIA 1CLFA 2VDIA 4NXNJ 5D77A 4R5PB 5A0YB 1D8ZA 2BQ3A 3QBCA 1NJIT 1ZS6A 4NMXA 5BYRA 5KG6A 2WSCC 2QSFA 3IXQA 4C3MA 2HWIA 2EG2A 1YHQS 1U48A 2WSEC 2E5LF 3G8SA 1LFPA 2QEXS 2CZ9A 2FJBB 4Y2CA 5HLFB 1AFJA 4I6AA 2HVEA 1HPZA 3M30B 3UQSA 2BW2A 2H4WB 2W1BA 3D67A 2C2NA 2HQCA 1XNQJ 1RT2B 4GRSA 4CLWA 2DHHA 1XMQF 4LF5F 3DLKB 3MM9A 4CT9A 2AJ4A 3SDEA 3QIDA 4CWBA 1FEEA 3MMJA 3UPFA 1GX5A 2CQ0A 1NK4A 2D69A 5HO4A 1GQEA 1RWNB 2MYFA 2VBWA 2WVEA 1TL3B 2B0GA 4LT6A 4B9VA 4P2FA 4K50A 3E01B 1GTHA 1HLWA 1FJEB 5GAHU 5DRKA 3PR5B 1L3VA 3DKDA 1R89A 4JI6F 2B4OA 3BKFA 4RO0A 2BYCA 1SL1A 4JI6J 4K4UA 2F9DA 4RL1A 5GAEU 1RT3A 2EI5A 1RABB 1DARA 3H5UA 1FVQA 4FXVA 2EVZA 4U8YA 5B0EA 4X66J 3ZO7A 1M90T 3Q23A 2VDHA 1Q53A 1IKXB 1QD1A 3KG4A 4O0NA 3DHXA 3TEHB 5A8KA 3BO4A 2CDRB 4DV6J 2GQQA 3PW2A 4QWAA 2RE1A 4NRUA 2D3OR 5J2NB 1ZETA 3W8GA 4CIOA 3E51A 2JC0A 2BE9B 4F4AA 3CJSA 5GAEI 1X4CA 1E6VB 1CJVB 2WB4A 1UFKA 2ZVIA 3GMGA 4QPXA 2HHQA 2JVOA 1M5VC 4ZDNA 3OLAA 1FERA 1RAJA 1PAUB 4K2XA 3DFEA 4NCBA 2XBPA 3SSSA 2FHMA 2CVIA 3MEEA 4WKRA 4V19J 2VONA 2KRBA 4DPWA 3VAMA 4RUCA 3D1QA 1H7WA 4P2SA 3UD5A 1A0OB 2CIMA 2P9CA 3I0RA 4OYMA 5D8HB 2CUYA 3B54A 1WNEA 1FHTA 4NCAA 1YJVA 4OI6A 1VS3A 2DH8A 3BN4A 2CNNB 4WK3A 1SKSA 1C1BB 1SKWA 1CC8A 4KIAA 3B82A 1U6FA 1W25A 1RWMB 1GFWB 2UUWA 2V8GA 4H4OB 3JYTB 5KFRA 1VQ8S 5F8MA 1IBCB 4Q0BB 1N36J 4NZ7A 1VK3A 2HFNA 2L9WA 4J9VA 2VKRA 4M63A 2DVIA 5BYQA 4USMA 4KB7A 3MMAA 2UXDJ 2F7VA 1NM2A 3FQKA 4ETZA 2O3DA 4EZ9A 4DX5A 2R4FA 2CPHA 2R7WA 1NSQA 1KLMA 3ITHA 4OZ0A 5DM7Q 4DQRA 4FDFA 4R8UA 1BMQB 5BYSA 4XO0A 4B3OA 2H54B 3GTYX 4X62F 4OLOA 3HT3A 1MMDA 3QT6A 1JIHA 4YB5A 4RW9A 4D3GA 3PIOQ 4EBDA 2ZD1B 1GX6A 2ZJRQ 4KPYA 1JJHA 1HBNB 4B3RJ 2W2OP 3PNIA 1RZMA 2O67A 2Z8QA 1X5TA 3WBZA 4JUZA 3PVXA 1B7FA 1LV5A 1D09B 2YNGB 3OVBA 2AHOB 3JYTA 4C8OA 1BHNA 2VG5B 2VQFF 2CQ2A 2AP6A 2ZH9A 1WWHA 5J2PA 1HNIB 1MWYA 5DG7A 4QYZJ 2DO0A 3CW2C 3RJMB 3C19A 1VRTB 5ETMA 3IP0A 4DPYA 1V6HA 3M8YA 4M5KA 1YLXA 4NCGB 3WIVA 3IRWP 4ZVHA 2FVQA 1IKYA 3FVYA 4WPAA 1U0HA 4TQSA 3B4MA 5C2CA 1CVJA 3LH2S 3BBFA 1RAEB 2MSSA 3EXYA 4JV5J 3TX0A 3R5DA 5AT1B 4HEA9 1NPRA 3ET6B 3N6MA 2BX6A 5CAAA 2YQ0A 2UUAJ 1T9XA 2APOA 4KHMA 3FBFA 2A1BA 2W2NP 4LJMA 5D6GA 1CQMA 2VUGA 3TJ9A 3MM8A 3TW0A 2JDJA 3DLKA 3PG9A 1QSLA 4MKYA 4RNFA 4YHHF 3JSMB 1VQOS 2EEYA 4UQTA 4P74A 1UVNA 1XWLA 1WC4A 4OX9J 2FZGB 2DITA 3RUBL 2HQDA 5LT5A 2LECA 3KJQB 1KQKA 5EN1A 4YY3J 1S6PB 3KKFA 4JI3F 4JI3J 2XHWA 2F4FA 5M2RA 1IVZA 3ICLA 3GG0A 1UA0A 4KJIA 2MQQA 4TYAA 3ETOA 3HSGA 2O66A 1U1RA 1HBUA 1RB0A 3FBEA 1SJQA 3FFIB 1X5PA 2CXEA 3BYRA 4IR9A 1IM6A 3W2VB 5K14A 3G71S 1Q79A 5LMNF 4DFKA 3EUNA 3GWCA 4IDKB 4X4VA 1R8PA 3MD3A 4MKAA 5F3TA 1F3FA 1JK9B 2KZZA 3MI7X 2QL5B 1M5OC 2AKWB 4A8WA 5C7PA 5L9NA 2E1AA 3GLJA 2X1GA 2RNEA 2G13A 2IM0A 1S5ZA 2OPQB 4KFBB 4UQGA 4A8MP 2NREA 2MZRA 2C2MB 2NXUA 4ALZA 3KJVB 2VFSA 2N82B 2J9EA 2YX4A 4I68A 3W9HA 2EC2A 3G8TA 3UCZP 2W2PP 4LBIA 1A7GE 3L4BC 2GVZA 1YBAA 3A8EA 5LSRA 2W25A 5DS7A 1H74A 3EICA 2POKA 4I69A 2WTFA 1XMQJ 2IJFA 4KTQA 4QW9A 3PJ9A 1TL7B 3C3LA 2DRAA 1JLQA 3I9V9 3KK3B 2F65A 1JLCB 3R97A 1S9EB 2KXNB 1S99A 2BJ9A 2DIUA 3CCZA 1KQFB 4JOUA 1WOPA 3NWRA 1PIEA 1UPPA 3DRPB 1FFSB 4YP3A 2UP1A 3KLFB 4WFNQ 2J9DA 2VQEF 1TKTA 1HL6A 2B43A 1OYDA 4DMZA 5AE1A 4UT4A 1WI6A 4I7FA 5MAOA 4DQPA 4V1Ak 3LTOA 1R8CA 4LR7A 1QVGR 1E6YA 1EQ0A 1IWGA 3U7JA 2AZ3A 4AD6A 4ZVOB 4QW8A 3SBMA 5IT4A 4DSIA 4W92B 2LDYA 3A3PB 3AB4B 3DC2A 1BWVA 4F3MA 4ZCMA 3AB2B 5EWFA 2E7VA 4KHRA 4DV3J 5M2PA 2G1DA 4R0EA 2DR7A 4RBTA 2QLFB 3DLLQ 1WG1A 2YNHA 4N7TA 3H4DA 1V3SA 3EXCX 2FVRA 3IC1A 3DDKA 2F1FA 2FJVA 1WG5A 2HQ3A 1WEYA 4L76A 4TYBA 4DV5J 1R6VA 2Y8YA 4FYYB 4Y28C 3ISNC 2XMKA 3MUTP 2JVRA 2LXIA 4F04B 1QDUB 3PHEA 4BS2A 1U0SA 3GQCA 1X4GA 3HHLC 4DJBA 4A8QA 1RT2A 4IUFA 2AYMA 3WIUA 4DV4F 2LU2A 4LSLA 5IM0B 4C9DA 2DHAA 2HNDA 4M1KA 4F25A 1C0TA 1XMBA 1CULB 1EETB 3RTVA 2R7UA 4HVZA 3SMZA 1NDKA 2QLJB 2M88A 4DXLA 4DLEA 4OQJA 3SXLA 3R5CA 2M8DB 4N8NA 3UN2A 1AZSB 1ICEB 2COLA 2ADBA 4X4UA 3JTPA 4M5DA 4FNIA 1FJGF 5KG7A 1JLEA 5K5MA 2YKOA 4G1PA 2IHR1 4RPFA 4ZJOA 4OI3A 1B7YB 1Y5LB 5A76A 2GMLA 3EGWB 4LR8A 5KFKA 1EP4B 3SYZA 1UJ5A 4NLOA 3TA1A 3FMBA 4FYWB 4DR1J 4OI2A 3TUJC 3KUEA 4CLPA 2HBQB 1NSPA 4HHJA 5F3ZA 3HLUA 4I2QB 1H7XA 3NS6A 4USTA 4EFAC 5LXRA 5KG5A 4NWBA 3LQVA 3W2WB 2OD4A 4DOZA 3ISZA 3MPUB 3RBZA 4PRFA 1J5OB 4I0WA 3OTCA 3GR0A 2KVQE 1FWLA 1SCJB 2W9BA 5IV4A 2VPZB 2XYHB 4L75A 2G2YA 5A8WA 2VB6A 3SZ2A 1WELA 3UD3P 2PA8D 1FJ7A 4IH7A 2CQPA 4O4GB 4QR1A 2QJ3A 2DIVA 4B3RF 5AE3A 1N8RT 1ULRA 3R7SB 1KKHA 2ASYA 1F9EB 2FJDB 2IRYA 3JTNA 4IG3A 3W62A 1T05B 1N54B 2AQ4A 2PFFB 2PC6A 4WTYA 5L1LA 3H5SA 3B78A 3GP9A 1JKHB 2B9XA 1KOOA 2PSZA 1P27B 1VMBA 1NLKL 3GSIA 2XZTB 2HYIB 2PE8A 3M1VA 3MGJA 3N4WA 5E33A 2V2VA 3I96A 5GMKa 1UVJA 3HFKA 2MZSA 4BCAA 4B3MJ 4Q0BA 4RZRA 4C3KA 2Z2YB 1J5OA 3L7UA 1ZTTA 2R7XA 2GFFA 3DRSA 3ZZUA 3IA0A 3BF4A 1QTNB 5A8RA 5FIIA 2Z2LA 3H5XA 2R7TA 2QLWA 3W5YA 5DG8A 2CQHA 2GMHA 2D3ZA 1VIOA 5FD1A 3SCKE 1WF0A 2DHGA 1ZAWA 3HVTB 3MHYA 4RW8B 4EUVA 3DOMA 4GVBA 4H4KA 4MH8A 5EHHA 3MECA 5ETOA 1VYAA 3H98A 1RCOB 3CVKA 3QWPA 2CPYA 4ECXA 2JEGA 2CDQA 5EUHA 3R7BB 3RBDA 1ZM4A 5KG1A 1MG7A 1WORA 2QLXA 3D7SB 4FP9A 3VAKA 1SH2A 3MCNA 4DL5A 2BXJA 1NK6A 5HL7Q 4UUWA 3G6VA 2PIIA 1U1LA 1T11A 1OJ4A 1UP1A 2ZKUA 4ED5A 3VR1A 2BJ3A 2C3OA 3MPYA 1WF2A 4ZVRB 4CO3A 3DGPA 3AHPA 3DLEB 1RA6A 2HAIA 2MJUA 3ENAA 5EX0A 3OBIA 4CQ1A 3FEYB 3P49B 4NI2A 3PW0A 1XR7A 1IJEB 3KLIB 1YBUA 2HVZA 3HD1A 4KO0A 2ZZNA 2DEJA 4JYAJ 2V8DA 3CGIA 2BRLA 1U2CA 1YBTA 4PWUA 5KFBA 4U8VA 4J90A 1Q8KA 2DXEA 3PJXA 4DL4A 1YJ9S 2CKWA 5JVGQ 3PHTA 3ZZ0A 1AW0A 1X0PA 5H9FK 2W9BB 1J27A 2L9NA 1CSJA 1RHUB 1D0EA 1BUXA 1U8SA 2EFOA 3N79A 3H4BA 1DTTA 1NUEA 2KT5A 5I3UA 2VH7A 4HHUA 4LSLB 2RDDA 3TZXA 3I56S 4DV1J 5KG3A 4C6AA 1N6QB 4HTIA 2WW8A 4Q5VA 4DSKA 3IWNC 4O3SA 2DR9A 1EP4A 1HKAA 4IH5A 2QSWA 7AT1B 4DR2J 2I5JB 3UI3A 2A2DA 3JSYA 5KAKA 5IWAF 3HJFA 3LGHA 4A8SA 5MLCV 2GQCA 3PRBA 2RS2A 4LRDA 3R6GB 2CJYB 2QMXA 4Z2XA 4QWDA 4ZVSB 1V3ZA 3G6ES 2E9ZA 4OHWA 3BSCA 5LL6d 1NNDA 3I4PA 1RU2A 3WDOA 3DRPA 3PYGA 4TNOA 2AYEA 2FC9A 2ZWPA 4DDFA 3LO3A 2V8PA 1KHWA 2G2OA 1RT6B 3ADAC 3I5AA 4L3KA 1GEHA 2G0IA 1HBMA 4PZVA 3ENQA 1WTFA 5T14A 4U7CA 1T03B 1XNRJ 5K8MA 5KTQA 1FE0A 4ITSA 1AXQA 3CJ4A 4DSEA 1S72S 1WACA 1A9NB 1RKIA 3PIPQ 1N0VC 3BM7A 3QFHA 3HP6A 3CCUS 2HHXA 1MU2B 1TVRB 2E7WA 1WDDA 4OHZA 2W8KA 4CYUB 1VJWA 3M8PB 1OY9A 4TKTA 5H9EK 4WZQA 4DL7A 3GPAA 2YNHB 3DDNA 3T5JA 1S49A 3BDPA 3J7YU 3KJVA 2FLPA 5B09A 5GADU 3POTB 4LVOP 5ETPA 3LGMA 1QAJA 4F36A 2M7SA 2V4QA 2HFOA 2Y0SD 1UKUA 4OJGA 2QA2A 1LWEA 2RT3A 4ID8A 2LMIA 5KT3A 3UDLA 5HAOA 5J2QA 3PFOA 3WC2A 3MEDB 2HIYA 4IFVB 3DRRA 1FTRA 3V6JA 1NHVA 4CLLA 2PEBA 3FKBA 4FPIA 4RW7B 2R42A 2VIHA 2C3PA 1FVSA 1FFGB 2MGZA 2KM8C 3T1AA 2K06A 3IMQJ 4FBTA 2I5JA 1NJYA 4IKAA 1PYOB 3PW5A 4CH7A 4FYDA 4ZA1A 3MOJB 1V3RA 1WF1A 1HNWF 4JV1A 4C11B 4ZCIA 1B0VA 2BZ2A 5DG9A 4YB6A 2VBZA 4G1IA 1SVDA 3TAQA 3D3BJ 3HMJG 2N3LA 3IN5A 4FF2A 4P6QA 4PG8A 1A6LA 2RQ4A 3M8WA 1RTDB 1JMTA 3B8HA 2DNKA 3AOAA 3I5BA 4R25A 2OIHA 5KFNA 1TV6A 3D66A 4ZPBA 4B9TA 3FZBA 4A8XA 3TQ1A 1HR0J 2CPJA 2GA7A 3BKUA 4K59A 2N7CA 4PQAA 4USIA 3VQTA 1RBLA 2B8QA 2OFHX 3AA9A 3ZNJ1 1NDPA 2B7BB 4DCJB 1C1BA 1FX2A 1F2HA 1N5QA 4LF1A 2QN6B 4EMDA 5E41A 1NKCA 4NZ0A 2NUHA 1UTAA 4F3OA 1BE4A 1UL3A 4DFMA 2UVVA 3DGPB 2FUG9 2Y3YA 1RAIB 1K1SA 2E5IA 4P7VA 3H90A 3KLHA 2DJWA 3NY0A 2XGQA 4KBIA 1JXVA 5C42B 1S0OA 1X4FA 3UNYA 3DYAB 2VQEJ 2IBOA 2RD5C 4NRTA 3K59A 3GV8B 3HDSA 4G6VB 3AJ1A 3KG1A 5G0RB 2N3OA 4W98A 4LFAJ 1JLEB 1HBOB 5KFCA 1NJXA 2GHVC 4LRAA 5DQGA 1RHKB 2AGQA 3OVSA 2RKIA 3QGGA 4YN3B 2ZNYA 3MR6A 2IA6A 1K0VA 2ZD1A 4ZPVR 4NLTA 2OEKA 2R2TA 1LFWA 2K1RA 4QZVB 4RUBA 5IZHA 2ASDA 3DLJA 3M2VB 2CA9A 3HZGA 1P9QC 2ZH6A 2HHVA 3DXSX 2DRBA 1N5YB 4OFZA 4M5GA 1NU4A 1D1UA 2UUBJ 2B5JB 4N41A 2H51B 5HVGA 3L95X 3OTEA 2HKEA 5DDOC 3PKMA 3OTDA 1QSSA 1S57A 3IRXA 3BEGB 4QWCA 2MKKA 3DN9A 1H72C 1PJ6A 2HK3A 4URSA 3X3UA 1P1TA 5K20B 1FJGJ 4C8YA 2MLYA 2HNYA 4LSNB 1RWXB 1DQ9A 1H2TZ 2P9EA 1SIWB 2DY9A 2XO6A 3GYXB 1S1UA 3CT9A 2ZC3A 3CMQA 3HHLA 3OFFA 3AXKA 2LEPA 1UEKA 4C11A 3D2WA 3V4IB 3PXGa 5D4PA 2EPIA 4ILLA 4NASA 2C28A 3EGZA 1MWQA 4DZDA 2CPDA 2EXUA 3W9JA 2X7IA 1AUDA 1N52B 3H2UB 3SCJE 3ZTPA 1DURA 2YNGA 2Z2MA 2VD3A 4B08A 2E9RX 3O5TB 1JJ2R 5CYJA 1LK7A 3US5A 1U02A 5FLXY 1Y3JA 1FTCA 2VOOA 1F6TA 1Y3KA 3TO8A 2DK2A 4O3RA 2DY1A 5CZXA 5C42A 2RRNA 1I3OB 4P71A 1R0BG 2OELA 1M1KT 3VV2B 1WEXA 1LKZA 2BVZA 4DQSA 1AA1B 3D3CJ 1NSAA 1X0FA 1QUPA 3RAMA 2DISA 5A8RB 1S59A 1LW0A 4DZ6A 1HHTP 2JJ4D 2M3DA 2V94A 2XGPA 2MKIA 2XQCA 3J81Y 5CD4H 3M8SA 2VG6B 1YJWS 4MJKA 1E6YB 1RT3B 4W4MA 5D0RA 4X4SA 1MROB 4O0IA 3Q2SC 2R8KA 5IS2A 1YRUA 4Q2MA 3RR7A 1V9OA 2V4JA 3K8VA 2YNFB 4ZPCA 1EAYC 5E5NA 1S9FA 3MTJA 2GAHC 4UTGA 3UVJB 4NLUA 1HWJA 3RBXA 2KRRA 2H9ZA 2BW7A 3QAEA 2QA4S 4J9LA 3TA0A 3AAWB 1T02A 3E8OA 3DCAA 1S9EA 1W2IA 3RR8A 2DNHA 4K8RA 4OYOA 2NQPA 3MM7A 4J9NA 1S77D 2GJFA 2V0NA 1SJFA 3GJTB 5HANA 2DHSA 3MCSA 1R6YA 3AD9C 3RYLA 2NZ4A 2DR6A 3OJSA 1XBWA 4WE1A 3SIPB 4MK7A 3W60A 4X65F 4X4QA 3CCLS 3MEEB 2V6AA 2FYXA 4EYHB 1U6ZA 2ROEA 9RUBA 1B64A 2LQ9A 1UPMB 5CA5A 4PXBA 3K17A 2QRRA 4X4RA 1C4CA 1SC3B 4LIWA 1X4HA 1FDBA 5KFQA 1ZPWX 4PXCA 1JLBB 1AT1B 2AMCB 1MMNA 4WKYA 4ZHRB 3DLHA 4IFYA 4UW2A 2DXDA 3DOKB 2BEFA 3PRDA 2RU3A 4J9RA 3QRRA 3MM6A 3ZZTA 2HQFA 1NJZA 1NKEA 2HHHJ 3HSZA 3CCSS 4U67Q 2HHHF 2CZ4A 1N6QA 1TFYA 3A3NB 2MLZA 2RVJA 2GIQA 2CRLA 1UMJA 1KSPA 3AOCA 3DOLB 2Z56B 4CZCA 1VFJA 3M2UB 3D0HE 3E2EA 3F56A 4MFBB 1VJQA 5DETA 2DGVA 4WYWA 3RGIA 4MYTA 4DR7J 2OD6A 3NCQA 4TVAB 3TEGA 3DMJA 1N88A 1KFSA 4NCGA 2MKCA 3O6QA 2R9LA 1HHSA 2CJAA 3MAHA 1RTIA 2CWXA 3PEJA 3R5GA 5J1NA 4KE5A 1RAAB 4NI2B 4NPOA 4OX9F 1XR6A 2MMYA 5F8IA 3CC7S 1IR0A 2AF6A 3VAFA 2HMIA 1JXEA 4M5LA 2IIHA 4DV6F 4OI1A 3K5NA 1IQTA 3EGNA 2N7YA 4WP9A 2CWKA 2GHPA 4LF6F 3CJ0A 1Z2ZA 3DNCA 3GIRA 4QPTA 1REVA 4WU3A 4FNHA 2QE5A 3ZTQA 2X1AA 4IYQA 3VAIA 4Q8FA 1N56A 2H5IB 1PC4A 1U26A 3D6HB 4NLVA 5ETSA 5HJXA 1BQNB 2B4VA 2ZUGA 4WXWA 5F0WA 1Q4RA 1SBRA 2IC3B 2ROPA 5FLXU 3KNAA 1MMLA 3GYGA 4PWDB 1UAWA 1H0HB 1YX2A 5LJ3Y 2EFVA 1LWEB 4U95A 3MR3A 3BQ2A 1PO6A 2W01A 1WC0A 4ED1A 1H38A 4PUOA 1BC6A 2XSFA 1CQNA 2FJAB 2R8HA 4ZITA 4CI0B 3KNGA 2UU9F 1AUSL 1OY8A 4IQMA 4LF4J 2JNJA 4C98A 2XS7A 4C8ZA 4O3OA 1XK8A 4PEOA 2VKZG 4C0HA 3EPGA 3Q0AA 2KT2A 2XY5A 2AJQA 1FDNA 4Y3CA 4X4NA 3CD7A 1RP5A 3G82B 2FPHX 3QRQA 4OX8A 4FXDA 3CJKA 2OUGA 5AXKA 2VG6A 3CDAA 1N4LA 2CJKA 5JUMA 2GZOA 1HQEB 1G4CA 4LIRA 1N5SA 1RDRA 4Y6IA 2R7OA 3V4MA 3VGUA 2E5LJ 1FXRA 2BOAA 2ATCB 1JLBA 2DNMA 5DGAA 4B3OB 3MEGB 1I6JA 2A10A 3CJ8A 2GVDA 4ZVUB 2HNZB 2LXFA 2LDIA 2PMWA 1HBUB 1M0SA 1IWAA 4C8NA 4IG3B 4KKOA 1TZ0A 1RAOA 5IWAJ 2MQ8A 2BJ8A 1QAYA 4X62J 2OMLA 3AT1B 2VG7B 2UZAA 3V6HA 2H5EA 1M5PC 4BLGA 2AYBA 4DV2J 4DV5F 4QYZK 4OYZA 2FLNA 2XI3A 1T9VA 1U8WA 1RU1A 3LGNA 4MT1A 2FD2A 4KGXB 2AU0A 3HVTA 4KV8B 4NXMF 2OO4A 2QV6A 4MKVA 3KHGA 4DBQA 7FD1A 1HD0A 1SKUB 1F5AA 2VBXA 4DR7F 1VRQC 2BE7D 5K14B 4F4KA 1F2GA 4DV3F 3R2DJ 2AWZA 3GG1A 3CC2S 1S6QB 2J9DE 3HHLB 1I1GA 2OPSA 3SFGA 4QIWD 3TP2A 2I9SA 1RK8A 2DGTA 3VVTA 2ZWOA 4NYOA 2BKNA 4CTAA 2YKMA 3T5HA 3P6YC 2DNOA 2IFXA 2V69A 1O5JA 3NBPA 1VRUB 3QAUA 5IQQA 1P6TA 1H3DA 4DUYF 2E5JA 3CJ2A 1X4EA 3W61A 1TL3A 3M6UA 1T9TA 2R8JA 3GJRB 2Q1LA 2MY8A 2J7UA 1NPPA 3CCQS 4KGVB 3TZYA 2W2MP 4DF4A 3EZ5A 2JEJA 2ZOFA 5F41A 3KWMA 2ZH5A 1M1GA 2AEFA 3NGSA 4TU8A 3OL7A 4DPTA 2Q3PA 3OPKA 2MQPA 2IVFB 3H59A 4IRDA 4X84A 2ACMA 2EWHA 4RUAA 4USHA 3MM5B 3J7ZT 2ZZTA 4ICLA 2HRUA 4V19X 3HM9A 4X66F 1F9FA 1UVMA 3L09A 1SUQB 4DU7A 2M9KA 3K5LA 5LOQA 2ADCA 3IRXB 5DGBA 1D9AA 1RT7A 3A8IA 3E01A 2OSRA 1YVFA 3LP0A 2R8IA 1FK9A 4DS4A 2CPEA 4DL6A 2CVEA 1EJ7L 3HFVA 4LF4F 1M5KC 4FF4A 1Y10A 1SH3A 3TYTA 1CJUA 1RE1B 4I6WA 4OYXA 2X51A 1S1UB 2OI2A 3D68A 3GFYA 3GJSB 4FN5A 3N6NA 3NS7B 4FYXB 1U1NA 4OI0A 2BE2B 3QIPB 3JSRA 1B4SA 2LQ8A 4FVMA 5LM7E 1YRTA 2W2QP 2IC3A 4OZ2A 1FE4A 1RAFB 1X8DA 3PCOB 4AXIA 3QSYB 3T5LA 1U2RA 4B3MF 4FF3A 1S76D 5G0RA 3H5YA 5A6PA 4F0KA 8ATCB 4DL3A 2KVIA 3PX6A 3LP1A 1TUWA 4YUDA 1LW2B 2E5HA 2IMWP 3RB4A 5E3PA 3OSNA 2MY7A 3D1HA 4M5NA 2H3EB 3WX4A 2R3VA 3KDNA 3KLIA 3VGVA 3NGUA 8AT1B 2Z0GA 3AQOA 1WKJA 3GJQB 4ED8A 3DXBA 1NK5A 2WW4A 5F8LA 1KS2A 1JLAA 5E3RA 9ATCB 2MTLA 1NK9A 4LRBA 2V63A 3BB5A 3H0PA 3CMES 1G2EA 2XNRA 3D5MA 2OSQA 4UOHA 2IAJA 1P8GA 2KHDA 4Y34A 3FC9A 3GIJA 3K5MA 2RF2B 1U1PA 4CYUA 5J2MB 3J81U 1IBLJ 4F2SA 4O3QA 1RT5A 3C14A 1JNZB 1HNXJ 1S79A 1DQ8A 1H6KX 1ZAXA 2XC9A 2HRYA 3I5CA 3FDSA 3QGHA 4A8YA 4F02A 1XERA 5CYQB 3G87A 2VPXB 2N4CA 3ZZPA 1S0NA 3EZUA 5KT6A 4CCHA 3T9ZA 2KG1A 1OO0B 2R7RA 2HFSA 1RT4A 4NEYA 1IM4A 2RHQB 4M5JA 4TN2A 2GMJA 4Q44A 3M9NB 3WC0A 4DUZF 2FY1A 5IT9U 4JYAF 4BDPA 4QU6A 3CJTA 3RB3A 2UUBF 4WFYA 2V2QA 4ZJLA 1B0TA 1HW9A 3BSNA 1AB8A 5J2QB 5EWEA 4G1QA 1AYEA 3NXZA 3TANA 5FDLA 4ZVFA 2XMJA 3GV7B 1YZ7A 1HWKA 2E7XA 2IDEA 5HQLA 1F0XA 5D4LA 4XIUA 1UJ4A 2JFDA 3DOKA 4RBUA 4A48A 2I2YA 1ZA2B 1WG4A 3FSXA 3LOUA 2R8GA 4RWXA 2QFJA 5CCMA 1HHQA 2FHJA 3R5AA 1SPBP 4LBPA 4ZPAA 4F26A 2F8EX 4HH1A 4C0OC 5D0GA 4C3LA 2HVDA 2OEMA 2YNFA 1QVFR 4MFBA 2O5DA 3NBPB 2RRBA 1UZHA 1YSJA 1IBKJ 1U0HB 1HMVB 3HHKA 3LF0A 1NZ8A 2C42A 4OV1A 2L3MA 2KFYA 3W8PA 3NCPA 4ECSA 5KFWA 2XZDB 5I42A 4J9KA 1N33F 4J7CA 1SKRA 1P9YA 1RXOB 1TMJA 3NGTA 3K2YA 3NKYA 3OT9A 4KO0B 4USUA 4F4WA 2CJQA 3KLEA 2C2EA 2D41A 4FS1A 2VHGA 2KYXA 2YKAA 4BC7A 3IGVA 4KHPJ 2X1BA 2UXDF 4Y00A 2JOQA 3MM8B 3OXGA 1VC6A 1JX4A 1RYSA 3DI6A 4N76A 4L3NA 1AFIA 3DRSB 2OH2A 1MWZA 4GKJF 4Y0FA 2MJNA 4KGMA 5HLFA 1GAOA 4U7UK 1G6BA 4WP8A 4GKKJ 1TELA 2FGCA 2JX2A 5SUHA 4USJC 2YH1A 1HWLA 1MNEA 4NLQA 4ED7A 3CTRA 2KXHA 3EYZA 1N34F 3T6BA 4FS2A 2KTQA 4ZLJA 2HPUA 3CCES 1SQGA 1TAUA 4ZLNA 2JWNA 2G2ZA 3TAPA 4WYLA 1Y11A 2RRAA 1ZYQA 2QT7A 1U47A 1UVIA 1R31A 2EC0A 3RG6A 3N5BA 4KYZA 1RGVA 1KHVA 1YJTA 3N9UC 2OHDA 4GMKA 4P75A 5M2UA 1L3SA 4HI1A 4IRCA 3FMWA 4JI1F 4X65J 2WAQD 4O3NA 3OW2R 1OWXA 2FIUA 3HSDA 2ZITA 1RWUA 2ASLA 2LKZA 2RKIB 4K4VA 1S0VA 4AL7A 3K89A 1K44A 2XO7A 4DLGA 3VHQA 5LSLA 1HYSB 2JEIA 3MMAB 2HFUA 3LP1B 2W9CB 3WQPA 2UV8G 4KFBA 5AE2A 5E7OB 2UXCF 4EEYA 1FRHA 3R7NB 3BDEA 5DZ7A 4ZK7M 2B9YA 2YKMB 4RU9A 2ZM6J 1YJUA 3KJFB 1GTEA 2KFNA 4F4XA 2QO3A 4C97A 2HBZB 4HACA 1L3UA 2ZDPA 2BRKA 3IWLA 5KT2A 3G6XA 1S48A 3K5PA 2QX0A 2VZ9A 1OQ3A 4WU2A 4I64A 2VOPA 4HH0A 2BANB 5LXYA 4IOCQ 1ZPVA 2R7QA 2DNYA 3FQLA 3R1LA 1X4DA 3QO9A 4LSNA 3QGPA 2KL8A 4DX6A 5KT7A 4DSJA 3CNQP 2M2BA 3TJ8A 3BR8A 2J0SD 2WB1D 4TXSA 4ANCA 1S1VB 1CC7A 4YR3A 3IBCB 2JHEA 4YY3F 4ED6A 4MIWA 4KKOB 1TK8A 4LF2A 4F4YA 2GGPA 2JLEA 1F60B 1LWFA 4NX9A 5CABA 4MKBA 2YBVA 4P9SA 1VDHA 2LEAA 4XAKA 4ATNA 3KK1A 5K9FA 1GMVA 4IFVA 1N5YA 3CB4A 1FXDA 4AL5A 1ZA1B 3G2XA 3KK3A 5KFOA 3BO2A 2B3TB 3ZZOA 3W9IA 1YDLA 1S1XA 3BO3A 5E0OA 3KLEB 2WOMB 3BV8A 1PCAA 4G1QB 1Q16B 2V9KA 1EARA 3HJVA 4NOHA 5KFZA 5DDPC 2FGOA 1WUUA 4HT7A 2Y1JA 1RT1B 1XN9A 2L08A 2V9WA 3POTA 3EE3A 4BWMA 2HMIB 5B0BA 3CO9A 2B6AA 3G82A 1MROA 3SSQA 1D9FA 4F50A 1HR0F 2WONB 4EK2A 4F0HA 3I0SB 4EI2A 3BSOA 5T7LB 3GYNA 1PBAA 2EBEA 1MU2A 3F0NA 1VLOA 1TK0A 3OXFA 1VOMA 4C0BA 2HBYB 4RLEA 2HLTA 4B9MA 4A8FA 5H1SV 1FWPA 5A2QY 2DO4A 3MPDA 4L74A 2YY3A 3KK1B 3LP2A 4YS2A 1KBRA 2WK4A 3Q8RB 3E3XA 2KG0A 2VJVA 3R5JB 1FNMA 1WHYA 4JBCA 5LMUJ 1VQMS 5F9NA 5D3GA 4NLGA 3W66A 4JI5J 4NLPA 3DRRB 3KG0A 1RTZA 4M5DB 3KXDA 7FDRA 2EFNA 4OZNA 1U1MA 3OJUA 2IJNA 2C3UA 3C15B 4GO5X 4GC7A 4ELUA 2DT9A 1CBKA 1EKSA 3A1YG 2MQNA 4DCPB 3CCVS 1R8AA 1YRXA 4CNZA 4WCEQ 5L1JA 4NLYA 4A4JA 5IM0A 2VFVA 3SCIE 4ZIVA 4W90B 1F5CA 2H5JB 2IM3A 2KJWA 1CULA 1EETA 1KN6A 3RZAA 2OPRA 3NRBA 4MIBA 5HBMB 3D4JA 2ZH8A 3EZOA 1RSCA 4JI8J 2U2FA 2DKOB 2FDNA 4B9UA 3VZIA 3CDWA 2Y0BB 3ET6A 5KFYA 2RQCA 4ZPDA 1KD1T 4B3SJ 3M2UA 3H25A 4KSEB 2HS3A 3OL8A 4HR2A 2K7KA 2CPIA 4NA3A 1UA1A 3MEDA 4ILRA 1O51A 2YWFA 3AQPA 3MM9B 3QWUA 2IVMA 3TAMA 4CLZA 1I5OB 1K1QA 1X60A 4WFBQ 3TARA 1IBMJ 4NXMJ 2XI2A 4C8KA 2MEWA 3ZC4A 2KH9A 4DV7J 1FRIA 2E44A 4K4YA 4LQ3A 3C15A 5ETRA 3DRXA 1Z2LA 3QGIA 1T0TV 4P52A 4EU0A 4AQYF 4DS5A 1HBOA 1Z1ZA 1M5HA 5A2QU 3MPWA 4M94A 1S6UA 4B3TF 2V2ZA 2ZHOA 1SQFA 5J1EA 5J2MA 1NRKA 1TKXA 1VHIA 1Y9OA 2HZAA 4N77A 3DYAA 1FDAA 3GONA 4QIFA 4BWJA 4DEZA 1C2PA 4ELTA 3F73A 3CSKA 3CCRS 1QJHA 2DR8A 2VFRA 1KTQA 1DRZA 3P96A 3MAQA 5I4MA 1QUVA 3NWGA 3CD6S 3VGSA 1TL7A 3OUYA 4CM2A 2HGNA 3CCWA 2L48A 4DI6A 4R0JA 3I55S 3LWLA 2HW3A 3LANA 1KP6A 5SZTA 3AD7C 3FRYA 5DJBA 3TAMB 4DN9A 3SV3A 1JXLA 1D8YA 1ZH5A 2DGSA 1FJCA 4OI4A 2W7AA 4LRCA 2YKNB 2HHWA 3OHAA 2CPZA 2WVDA 4WIQA 4B17A 1QM9A 3CWJA 3TVYA 4F0MA 1EIYB 2OJ3A 4Q8EA 3IR7B 1NH8A 1WTBA 4OLPA 4OHXA 1Y00A 2RDJA 1WHWA 3KUGA 4OZLA 4ECWA 1D9DA 1RT1A 1VC5A 1GXLA 3P5BP 3EGVA 2ZC4A 3UD4P 2CG8A 4JV0A 3ILIA 1U6BA 1I51B 4Q45A 1H2VZ 1XMOF 2LQ5A 2UVRA 2LU1A 3S8SA 1RISA 2KHCA 4C8MA 3Q8PB 4DUTA 3CEDA 3L9ZA 4ER8A 2NUUG 2NPFA 5BR8J 5ADZA 4DF8A 4TQRA 2QA1A 2RAQA 2ZE2B 3LW5C 1S9GA 3CJRA 3NOGA 3VQSA 4ENOA 2C2OB 4UOGA 3FEXB 1T9YA 4JI1J 2VA3A 1GH8A 4Y2KA 1NK0A 1UVLA 3LP2B 4K0KF 1GXUA 3ONQA 2GC8A 1DHMA 3ETMA 1R0AA 3FUYA 2Y1LB 4ID5A 4QWBA 4L72B 3IO1A 2HNZA 2K7JA 4CRJA 3HHNB 2HLUA 4BC9A 3MMBB 5K8NA 4JI7J 2XSJA 1JLFA 3Q8QB 4AXJA 2GS8A 4PPZA 5D4OA 2EKNA 1X31C 2L41A 2AEJA 2KJVA 4WFXA 2CJ9A 2CNLB 2D3UA 3LP0B 3NNHA 4JV5F 4FKYA 1RWWB 2F8HA 3VCDA 4LF9J 2F4VF 2LP4A 1WHVA 2FVPA 2DNGA 4MTPA 4CO0A 5KFFA 2XLIA 2QZ8A 3GSDA 4H4OA 2V68A 1S6QA 2BACA 4WJBA 1G1XA 3NMRA 1T3OA 2BBEA 5KFLA 2K8GA 4N56A 1JKHA 3BQ1A 2WSFC 3HULA 4TY8A 1N33J 4XTTA 4IO1A 5D0EA 2Q43A 1ELOA 3F41A 1DZ5A 1UCNA 2VICA 4B9LA 4QIGA 5J2PB 3RB6A 2FQQB 2NSBA 4RKUC 5DO2A 1IUJA 3TR5A 5KG2A 2HWTA 2CJXB 3BJYA 5A8WB 1HNZJ 3PYEA 1VR6A 4YFUA 3CXCR 3BH6B 3T6JA 1V5VA 2VFTA 1PILA 2N4DA 3MOZA 2MHNA 1R43A 1I94F 2HQGA 1YKWA 4C48A 3GV5B 4P7TA 1R3NA 2KDOA 2Q79A 2XULA 4GVLA 4RW9B 2ZBCA 3AJ2A 5HVFA 2P9GA 4R5PA 5FJ4A 2DR5A 5F8GA 2KT3A 2NCKL 4PG7A 2Q6CA 1VBXA 2P6TA 4I2PA 3MUVP 2CAJA 5THWA 2UU9J 1BQNA 3OLBA 2HS0A 2FJEB 5GAGU 1QSYA 4IQXA 5KFSA 2NXNA 5L46A 1T7PA 4OZ3A 1Q7LB 2EBGA 2XMUA 3W5ZA 3HCXA 3HKWA 3PX0A 4PABA 2UUCF 1TV6B 4ED0A 3BYPA 4LF7F 1U09A 1HWIA 2PDAA 1J5EF 1WSRA 3Q89A 3NG8A 1O0PA 1Q82T 3MXHP 3GIMA 1S0MA 2AJ1A 5DDQC 3T1YF 4CDIA 4DR4J 3X1LB 1RTIB 2CPFA 2NXCA 3IM9A 3UDCA 2DHXA 3CDBA 3M9OB 4EZ6A 3MMBA 2MKYA 4NA2A 1WHXA 4YHHJ 2HEKA 2JL9A 1VLYA 3MTKA 5B0GA 4ZJQA 3BN7A 4HDGA 1PJ5A 4O4GA 4TY9A 3VWSA 5LSOA 3JAMU 3K58A 3Q24A 2R7SA 3D6FB 3J7A1 3LWMA 2ZH7A 1T3NA 2NR0A 3QJLA 2ILZA 2M70A 4K5RA 2GVDB 3GR1A 3VAJA 1EHWA 1SJRA 1OIAA 2HGLA 2QLBB 3H2LA 3FCVA 4O23A 3R27A 4HLBA 2J7WA 2VV5A 2BMBA 2ZBPA 3QNWB 2VC0A 2UUCJ 1RT4B 2CQ1A 3I82A 2FVCA 2E1MC 5HK4A 3NMAA 2QYGA 5A8KB 4ID5B 2C2KB 4PWDA 2M4MA 1F1BB 4DV1F 3SSRA 1VQLS 3DMJB 3W2VA 2BKOA 1BQMB 2WBMA 1FRXA 3EMTA 4ECVA 1RLDA 4N8OA 1S9GB 3AFGA 4J91A 1N32J 4DFPA 6AT1B 1SV5B 3M2RB 3O3LA 2RQKA 5IT0A 1YZ6A 3FSIA 4S0MA 3D6MB 3TRGA 3BPDA 1Q95G 4MAKA 2DGOA 2E66A 1FESA 4A47A 4NZ6A 3MEGA 1L3TA 1YJNS 4F3QA 1JLFB 5HQMA 1NDLA 4USKA 4UY8T 3MD1A 4IH6A 4IO9Q 2WVBA 5C24A 3RRHA 5AXMA 4ZLPA 1QTMA 4EO6A 3P3DA 2J9CA 2GVZB 2LQJA 3EVOA 3CJKB 2BABA 4MMOA 4BHQA 3TZZA 1IJFB 2R2RA 3QJPA 3BZQA 1RTHA 4CLSA 4J5OA 1RWKB 4BBYA 1PSDA 2W7OA 1WKKA 2AT1B 2B4PA 3I87A 1UW4A 3M8QB 2LXUA 2QL7B 2Z4PA 4RW4A 3CCMS 3BREA 3UWTA 1X7VA 1S97A 4ZP9A 2QL9B 3FK4A 2E5GA 1S4EA 3HD2A 3SQOP 1YI2S 1Q86T 4NA1A 3MDFA 2ZZMA 1BQMA 3GE9A 3MURP 2HK2A 2ZJPQ 3RW7A 2ZBIA 4ZN3A 1TQLA 4HYKA 3Q8VA 1RHJB 2RIJA 3CJ3A 4HI2A 5I3QA 5E2QA 4DV7F 2AD9A 2DNPA 3FBCA 1VBZA 3SQGB 4NYPA 2DRDA 2PO4A 3KLVA 1YITS 4JI2J 2FHJD 2BV3A 2DNZA 4LUBA 3QPIA 4OMFG 1RQ0A 1TAQA 4LVNP 4A46A 2EK1A 2DNNA 2J7KA 2PFDA 4QR0A 1IQZA 4Y2AA 3MF5A 5IC6B 4ECYA 2LQBA 5AJ3J 2K2PA 3NP5A 3ZNUA 5C25B 1RWOB 1UETA 5J1EB 1UW9A 4F8RA 4JI7F 3DRYA 2Y9HA 5B7WA 4K4ZA 4EBEA 2O1PA 4QJVA 2CQBA 5T41A 2C1EB 2HRTA 4KAIA 3C6TA 4J9MA 2CQDA 2ZOMA 2RUGA 4ICLB 4QU7A 3I4HX 3CC4S 2XM3A 4IG0B 3G4SS 5ETTA 3ULHA 1YQHA 3MWBA 2H1YA 3G8QA 4WIIA 4X4TA 4OL8A 2DH7A 1J5EJ 2Y8WA 1SJ4P 2ZUAA 3TOQA 2H4YB 2J6TA 4UY85 3MAAB 3QYYA 4FZVA 3LPEA 5IOLA 4CNYA 3TVZA 4QBUA 5LMUF 1IKYB 2BUNA 3OTBA 4NLDA 1NSKL 1UEVA 4KGKA 1MN7A 3ZTSA 1VHFA 4DX7A 2VA2A 4UZBA 1T9WA 1UJ6A 4F2RA 5CD4A 1EQMA 4RWWA 1JWWA 2DTJA 4QWEA 3PW4A 3JQJA 1B0PA 3D1OA 5E3CA 3AY0A 4O3PA 2AJ0A 2UVWA 2IA0A 3BGLA 4LFBF 3HPOA 2V67A 1CG2A 2ACYA 2JC1A 1HIYA 2IRUA 5CCLA 2GGPB 4LFBJ 1ZTWA 2HBRB 3MR7A 3HXMA 2ZDOA 3QT8A 2P5VA 4AFFA 5LMNJ 4DWIA 3UDVA 1PYTA 4UZCA 1HNZF 1K0TA 2AJ2A 2PMHA 4RW6A 5CYMB 1VQ5S 4OZJA 1S1TB 1HI0P 3ENVA 5KFVA 4AT1B 2M0GB 1FFWB 1JLAB 2HZCA 4RW8A 2DGXA 1VQNS 2YWHA 4UF4A 3C2PA 3GIKA 4ZIWA 5L1IA 4YOEA 3P45B 3IGNA 3JB9k 2QG9B 4R8UB 2XSJB 2KFZA 3N5FA 1F5BA 3VALA 3QZ8A 1Y4ZB 1WD6A 3R6LB 1YGYA 4OJHA 2FZKB 4DL0C 3JQMA 3UCGA 4ECQA 5B0FA 2MGZB 3FBBA 2AYGA 1Q5YA 3CCTA 5C25A 2UV8A 2I38A 1IKVA 3D0IE 3R5BA 3O8WA 4X2BA 2EW9A 1P1LA 1IBMF 3BBBA 3H40A 3PX4A 1LOUA 1S7IA 3GZ7A 3H7HB 4J37A 2RQMA 3IG1B 2UUTA 3IS9B 2R7VA 1VCTA 2VPWB 3M2VA 3UCUP 1XQIA 1RBAA 3MZIA 1IXKA 2PD1A 5EDWA 3UN5A 2HHPA 1S1TA 2CADA 3KJNB 1RYRA 3I0SA 1G3OA 2MSTA 4U9RA 5CYQA 2CQGA 4MIAA 2AGOA 2BDPA 3VZHA 3GFZA 4I4BA 1NBEB 2QMWA 2ALYB 3OV7A 3CJ5A 3EVMA 3EDRB 2XMWA 3TQEA 2MDAA 1RADB 3GIIA 1HA1A 1WOOA 2HSEB 3NAHA 4NYZA 2IMOA 3TJAA 4DPXA 3L3CA 3KHLA 1I94J 3BQ0A 1KVJA 1HNVA 1QE1A 5BR8F 3CDEA 3TUPA 4ZCKA 2CQ4A 2ZVSA 3DM2B 2QGFB 4DX8H 2DCLA 3NNAA 2LFVA 4PG4A 4WTOB 4J9PA 1Q1KA 3LUYA 4DSFA 3PZPA 2KZMA 1PBUA 3RRKA 2FLLA 1HQEA 1RAGB 1TKZA 1CJTA 3A4TA 5HN0A 1TUGB 1APSA 2WHOA 1T94A 3C16B 3CJQA 4M8LA 4DUZJ 3FGVA 1TU0B 2KU7A 1VGYA 5CH7B 1U1KA 4K4TA 4FXWA 5L1KA 1RWVB 4YDDB 3QZ7A 3PV8A 1IR1A 1W26A 2CQCA 1FA0A 4Z37A 2CJBA 4H54A 4CLTA 2PI4A 3TUIC 4H4MA 4OYWA 2L9DA 4ECTA 4QQBA 2KO1A 4OZ1A 5KOXA 1FD8A 2IM2A 4PUOB 4EWTA 3IFEA 4PG6A 1TP7A 1Q5VA 4ZP6A 1KVKA 4KV8A 2BM1A 2GJ2A 1KR4A 3GFXA 4OZ5A 4I67A 1DLOA 2R2UA 3IBFB 1HI8A 4AUKA 4DCOB 2IM1A 1L5UA 3DHWC 1R27B 2F8MA 1NKBA 1BD6A 3EWGA 4I6YA 3HVAA 1IN0A 1HBNA 1TKTB 2RHSB 3UR0A 1K8AT 2KN4A 1WDTA 5ETKA 2HQIA 5KT5A 1RTHB 1SQEA 2EFPA 4FF1A 2ZHAA 1FO1A 3C16A 2VBYA 1HQUA 4NXNF 2OTJS 2J0XA 3HT0A 1RHRB 3MM7B 2X3DA 1S4FA 2PN6A 4ZCLA 5KG0A 4PXEA 1NEEA 1R7IA 3KDOA 1D3WA 2OPPB 3NEKA 5KFPA 1GK8A 1DTQA 1URRA 2KYZA 5I42B 2HAFA 4H4MB 4YR0A 2GJIA 3PKYA 3V6DB 1FNXH 4DR4F 1ZM9A 5IXUA 2WCXA 3BGOP 5GAHI 1M5SA 3TWZA 2J5AA 4PPDA 3JAMY 1RWPB 1X4BA 3JSBA 3KLFA 2J0WA 2ZBRA 4RJVA 5DZ6A 5L8RC 3RAXA 2M8HA 3DI6B 2J6UA 5ETQA 4ELVA 3WHIA 1RTJA 2IDLA 3HKZD 1H2UX 4KH0B 4YDXA 2FJXA 3MM6B 5C5JA 1O6XA 2I0XA 2F9JA 1FNOA 2D9PA 5F0UA 4FYVB 3T19A 3TNVA 1Y0HA 2ASJA 2YPZA 1FKAF 1HBMB 3MR5A 1CJUB 3V81A 2KB2A 3DM2A 2YQ3A 3GB0A 3NAIA 5HQ8A 3M9MB 1HD1A 3HX9A 1HNXF 4DHVA 2X1FA 1ZOTA 2VQFJ 3CULA 1HFEL 3HSJA 3M8QA 5DLGA 1OPZA 3HVRA 1TK5A 3P5TL 1XNQF 5H9FJ 2HURA 3OR2B 4RNMA 2NYIA 1PC5A 1S1VA 3C66A 1K73T 3N6LA 3S7RA 1N34J 4ECRA 3HI9A 5IC4B 2ZFHA 3IBWA 3U1LA 2M52A 4K4XA 1YIJS 4WXOA 3AOBA 3JSMA 2YNIB 1BGXT 2KKHA 2OEJA 3L7OA 3M7VA 3AODA 3PRVA 4YB7A 2W8LA 3VF0B 3CDUA 4QOTA 1TUVA 2YVSA 2BJEA 2LVWA 3R8YA 2MKSA 5HATA 4URGA 2HS4A 2WONA 1U7LA 2IY5B 1O8BA 2DGUA 4C7QA 3M2RA 5T7LA 1LWCA 2WBRA 4PCQA 2OPQA 1RT7B 1Y7PA 2IAJB 2WVFA 2P2CB 1VBYA 2KI2A 2DPJA 2WOMA 4ED2A 2HVIA 1KC8T 2XCPA 1N36F 3TZWA 5HI7A 5BXIA 1U1OA 1NK8A 1ZAVA 3Q83A 1ITPA 4HL9A 1DJ0A 5F9LA 4I2PB 4JP8A 5D0HA 3IR6B 3RW6A 4F7VA 3KFWX 3QLHA 2XLJA 1HWUA 1FRJA 1QAXA 3I31A 2CG4A 3K8WA 2E9TA 1F3VA 1SIZA 3J80U 6FD1A 1R0CB 2K3IA 2G0JA 2W24A 3BGFA 2KM8B 2MPUA 5G4DA 1URNA 2EG1A 2HHUA 4OYIA 1LEOA 2XMTA 3UNGC 1FEHA 2XY7A 3FJ2A 2EKYA 5HMXA 4G65A 3UN3A 1DLOB 2D7SA 1FWKA 2NYHA 3PO5A 4E0DA 2FVSA 1FDDA 4X4PA 4JB8B 1NMEB 3Q22A 2MKJA 4CLFA 2MZJA 1C4AA 5K8PA 3J7YI 5KG4A 1TKDA 1SC1B 4KQZA 4CM0A 3M8ZA 4IRKA 4MK9A 3THTA 1C1CB 2NXJA 5HJYA 2D3O1 1C0UA 2D9OA 4DG1B 3W65A 3DU6A 4G3IA 1CPZA 3RU0A 4QYRA 3OFEA 4CO5A 4J9OA 3EPIA 1N32F 2DXFA 3M6VA 3VVUA 4J9QA 2G1HA 3FCWA 4F67A 2Q66A 5IV3A 1VBKA 2VG7A 3CD5A 2B6AB 2CQ3A 4ANEA 1RCXB 2PEHA 2YWGA 4LQ9A 4NLSA 3SFUA 5C2GA 1PGZA 2B5JA 4DR1F 2OP5A 3PYDA 3KLGB 1CEZA 2BM0A 4D3HA 1SJ3P 5ETNA 3LA0A 1LXJA 4K5SA 1NAQA 2W9AA 1CJKB 4DSLA 1LW0B 1OSDA 3VGTA 5HMZA 2HWHA 1FT8A 1S7HA 2CNOB 2H65B 3Q8YA 2YTCA 3T9NA 3N01A 4AL6A 4UUXA 1SH0A 1HPZB 2YNIA 5KFGA 5KFMA 3KHHA 4LF5J 2D1CA 3CIMA 2W4CA 3MMCB 2I6WA 3A13A 1SXLA 1FF2A 2VASA 4EBCA 2V5HG 3HHLD 1RA7A 1WOSA 6FDRA 4OHYA 4I7FB 5D3GB 2JLFA 2GQ2A 4LRFA 2NLWA 5JVHQ 3D0GE 5AJ3F 2XHCA 1R8BA 2GCFA 1CJVA 4I56A 3PO4A 2BJ7A 3VTIA 2E1RA 4O4RA 3SI8A 1KDNA 3SCLE 3ZTRA 3OVAA 2PT0A 4DR3J 1FCAA 1KLNA 2PMZD 4IOAQ 3H42A 4P2MA 5D15A 4DN0A 3HHEA 4NMLA 1X9SA 2Z57B 5KT4A 2ZH1A 2ZH2A 5DM6Q 5KFJA 1WC6A 2I8EA 4A8OA 3IAS9 5BJRA 1BWEA 4DR5J 1B99A 2F40A 3UVJA 2LA6A 2HGMA 2XCAA 1RI7A 4PYDA 4AE5A 5B0AA 1OMSA 3THVA 1WI8A 4GC6A 1HMVA 1S12A 2YPYA 1SV5A 2YKNA 3Q2TC 2GNKA 4CO1A 4ZMMA 4CLKA 5J2NA 3THPA 1PYSB 3OTOF 1HYSA 3C6UB 1NZAA 4QIEA 5GVQA 5AXNA 2LYVA 4LSZB 4N5SA 3RBEA 2AX0A 1WC5A 4AYBD 1FX4A 2HNDB 1Q8BA 2A0FB 2ZJQQ 1IKWB 1KONA 4ZHRA 4ZPTR 4DQQA 2V8HA 4K2JA 2BKPA 2E1PA 3ILLA 3JQKA 3IM8A 3PM9A 4LMZA 2E29A 1H98A 2MQOA 4CH0S 2B9WA 3WZ0A 1RT5B 3C14B 3O2IA 4PQUB 2ALZA 4RW4B 1LW2A 2IPOB 4WP3A 1JB0C 3BS9A 3M8PA 2MXYA 4WFAQ 1TKXB 3G9CA 1KVIA 1J2VA 1MLAA 3F44A 2C2RA 3KUHA 4WE1B 3JTOA 3U27A 1S6PA 2RMLA 2BJ1A 1WC1A 1GMUA 2IYGA 3AA8A 1JJCB 1TL1A 1V5IB 5L9XA 3PJWA 4EGLA 3LPYA 1TMMA 2RSQA 4KRWA 2AGPA 2XNQA 2RJZA 3QLHB 4DV0J 2HHSA 1YTYA 3ISND 1RJJA 1RTJB 3M30A 1NB7A 8RUCA 5F8JA 2OAUA 1CJKA 2UVUA 3OQ2A 1FKOA 1PAEX 1WEZA 3H2VE 3Q86A 3MPVA 2QC3A 3MCOA 1Q0NA 2H48B 4KY3A 4YR2A 4YMEA 1HQ2A 4NL5A 3CD0A 1FK9B 2J0QD 1WJ9A 2J8AA 4ZVTB 4XPEA 4HT5A 2J6SA 1W7WA 5A0YA 2KXFA 4PWWA 2CZVC 4ZVPB 2FB0A 1DAXA 3HZEA 4KT0C 4RUHA 5HROA 3NNCA 1U49A 2BE2A 3QIPA 1JLQB 4DV0F 2VF3A 3R1HA 3W7BA 1HQUB 4J9UE 3KK2A 3T1YJ 4LFCJ 3DLEA 3W63A 3MFIA 4DL2A 2O01C 3G86A 4M95A 3K57A 4Y2IA 5ITHA 3A12A 1Q8LA 1FI4A 2VG5A 1KEKA 2EK6A 3J7Z5 1TL1B 1VQ9S 2DNQA 5EGYA 1HW8A 3QMQA 3TVKA 2IBKA 4WF9Q 3WX8A 2G4BA 3D28A 3NGKA 4X4OA 2ZOGA 1VQPS 1FRKA 1WSVA 2OTLS 1Z4UA 2BJDA 2XYGB 5K8OA 1T9UA 4Z7CA 4J9SA 3QFWA 3LALA 3TUZC 3QJJA 4ILMA 1FKOB 4YB1P 2B7CB 3MMCA 4B02A 1XIQA 3FCHA 4Q43A 1OSCA 3DOMB 4GVBB 4UOFA 3UR3C 4E2FB 1GMWD 3HVWA 3KTQA 4LF8J 2LCWA 3FEZA 3OL6A 3ZTOA 1LXNA 3BPSP 1KTVA 1XTZA 3QQCD 1ZM2A 4MYUA 4DPOA 4RNOA 3KMSA 2EFGA 3EDQB 1G7CB 4TLQA 3AJDA 1EZZB 4HTJA 2R2SA 3M8RA 1Q81T 1IKVB 2A18A 2FLOA 4OX7A 3KLGA 4PAAA 1S1WB 4Z7YA 2MQLA 2XMAA 4LF8F 4M5HA 1XC9A 2ZH3A 3DU5A 2UXCJ 1UWAA 2M5YA 4DR5F 1TL4A 2FC8A 1U45A 1KNZA 3L7PA 2DYAA 3O1LA 5U47A 2X3GA 4PG5A 4ZVGA 1DY3A 3DGVA 3R9LA 3ZZYA 3JS9A 2FY8A 4LR9A 2QIFA 2V4RA 4Q7AA 3BBCA 2VODA 1T03A 2K1RB 2YX1A 3DLGB 5DDRC 4P72A 4TY8B 4CT8A 3V2UC 2OGUA 3KHRA 3C6UA 3FFIA 5LJ5Y 3D9BA 4O44B 5KFIA 4ES2A 4RW6B 4C8LA 4EYIB 4LF6J 2GX8A 2GHWA 1UFWA 1VRUA 1UEUA 3OR1B 5HP1B 2GW8A 2PI5A 4WFZA 2D74B 1Q8IA 1SL2A 1BXNA 1PG5B 4QCLA 1CS4A 1SI9A 3FSYA 3I9ZA 3K5OA 3DLBA 1N0UA 2C2ZB 3FNNA 2VC1A 5KFHA 3M32B 2AV5A 3ENWA 4P2XA 4IR1A 4U7UD 5HMYA 1UWBB 2OPSB 3O44A 2ZH4A 1JNRB 3IG1A 3CO0P 3IS9A 2BANA 4USVA 5JXSA 4ES3A 4FVCA 2JSXA 3W5XA 3V4IA 4LF9F 2F4VJ 4KH1B 4JI2F 4OYPA 3KOAA 1RUSA 2K3KA 2RDIA 4YEAA 1NHUA 5CYMA 2MKHA 1BQXA 2XWYA 4ZN1A 2HHTA 1GNKA 4CH1A 3U02A 3NLCA 5I3PA 1OPIA 1OY6A 2B4UA 2JRSA 2F63A 4CLYA 1PKUA 1ZZNA 1MN9A 4UOCA 1E6VA 3BGUA 5DQHA 1VQ6S 3OR1A 3EJMA 3MM5A 3ILJA 4L73A 1JLGB 4PKDB 1NK7A 1AZSA 1C0TB 1VC0A 5IFMA 2QFIA 2V2KA 2YQ1A 3NGRA 4NE9C 5L38A 2ROGA 3HO1A 4ZLLA 1XMOJ 4I1TA 1C1CA 3UO0A 1KLMB 2W4DA 3ITHB 2FHKA 4ZVEA 3OUYB 2BOPA 3PACA 4B9NA 3KMQA 2MLXA 2WRMA 1UWBA 3UE2A 1QLNA 5HROB 1QE1B 5B0CA 5RUBA 2MQMA 2VJUA 1U24A 3C6TB 4XDCA 4ECUA 4U6PA 1X9MA 1Y5NB 1X4AA 1TR0A 2NS1B 2AZ1A 3S6EA 2IRXA 2ZE2A 3C8YA
chains in the Genus database with same CATH topology
4CTAB 2JFKA 5CZVA 3W2WA 4O44A 4I2QA 1TFWA 4DFJA 4ED3A 2W7PA 4RNHA 4WZMA 1SC6A 1R8HA 2XWXA 1UVKA 2XEXA 3U1NA 2W9CA 3R3TA 2V8VA 3K0JA 1VI7A 2PA3A 4RW7A 2C2DA 3I6PA 1BY9A 1FKPA 2LEBA 2DNLA 3ZZRA 1GT8A 4YQWA 4XPCA 4PXDA 3KYLA 4RNNA 5HP1A 4DR3F 2JLGA 2Y1IA 1TKZB 4K4WA 1RTDA 4ZP8A 3OFHA 4C2MA 3CCJS 3NL0A 4MK8A 4PR6A 5C24B 2XS5A 2YWKA 2YWEA 2DH9A 2ZNZA 3T5KA 1X5OA 1S10A 3SV4A 2DD8S 2ATLA 2MB0B 1NJWA 2VPYB 3W3SA 1S6OA 2DBBA 4LFCF 3DOLA 4JI4F 2RU9A 2IYIA 3RRGA 2IVYA 2CFXA 4QIVA 4ZP7A 4B9SA 4C4WA 3I32A 1DTQB 3MECB 3MUMP 3IWXA 5A6WA 2F3JA 2LA4A 4NLRA 2JEFA 4IDKA 3V81B 1DBDA 4IFYB 3UW1A 2YKQA 3MEKA 3SQGA 1FRLA 2CPXA 2MKIA 1MW7A 1T95A 3N0VA 1SB6A 5E3AA 5L39A 4OJ3A 1GXTA 3OR2A 1DQAA 3H8YA 4PQUA 5HMWA 2MHEA 4Q2LA 1REVB 1NO8A 4TLRA 2C3YA 5KFXA 3M1VB 4KC5A 1N5TA 2OPPA 1KQGB 2BA9A 4URQU 3SEOA 1MSWD 3ZFVA 3V6DA 1RKJA 3M6WA 2GIRA 2RH3A 3RAQA 5KOWA 3BSAA 4LFAF 4H4KC 3PR4A 4CO2A 4L6V3 2FTRA 2YKPA 2DPIA 3RB0A 4FBUA 1RT6A 1XR5A 1QY7A 3C46A 2HNYB 3OSPA 2HVHA 2HIQA 2AJFE 3LAMA 1BLUA 2DB1A 3OHBA 1HARA 4ERDA 4A8KA 2DNRA 2DGQA 1ZZFA 2W4PA 3D54A 1IBKF 1FRMA 3SDEB 1VQ4S 2BQUA 4DR6F 2OPRB 1IKWA 2I1RA 5HBMA 4RX6A 5GAGI 2OKQA 2XZWA 2RILA 3V5RA 1OS5A 2XLKA 3S1TA 1DTTB 4TU7A 3PFEA 1Q7YT 3CMAS 2LLZA 5J1PA 5KFEA 3M6XA 3KLGA 2V4JB 3NS5A 5EX3A 4NLXA 4GO7X 4EO8A 4TU9A 1HI1A 1SUQA 3OFGA 4JI8F 4Y65A 2GV1A 2XMVA 3CF5Q 3BGRA 1T8EA 1OQ6A 2PGCA 4ZS6A 3T1HF 1SJ1A 2XS2A 2J76E 1Y5IB 1U2FA 2AX1A 1ZM3A 4HDHA 4F4ZA 2B51A 5KFAA 4E8UA 5GADI 1YWXA 2ZM6F 4JI5F 3U1MA 1QAIA 3VAGA 1S1WA 2HG4A 4FPRA 1C0UB 1LQ9A 4DG1A 2B56A 1VK8A 4ZKAA 5E3QA 2FHOB 4ECZA 1HNIA 1YJRA 3MR2A 3NGDA 2JZ5A 1JLGA 4HKQA 4CO4A 3PDNA 1T05A 1HNVB 4X64F 1Q78A 3G96A 1TL5A 3M05A 2ZHBA 3CPWR 1IBLF 2XB2D 5H9EJ 2RB7A 1XNRF 2E1CA 1AROP 3N28A 1R0AB 4QR2A 4F2SA 4ZPWR 1X5SA 2CYYA 2GO9A 1NH7A 5F8HA 1U4BA 1FXLA 2XG8A 1DFDA 3S01A 1XEZA 2MZQA 3UFCX 3PW7A 1K9MT 5D4NA 3VAHA 4ZOSA 3QO9B 3G6YA 2EFQA 3NCRA 4JV2A 1KRPA 1X9WA 4ES1A 1KQSR 4K4SA 1ROFA 1YG0A 2DCUB 2UUAF 1JJ4A 3BR9A 4IG0A 1N5VA 4OHVA 4KHPF 1LK5A 2A2CA 3HHDA 4DR2F 2BQRA 1U1QA 3IR5B 2OLWA 1FD2A 3H20A 3TI0A 2P6SA 3CIZA 4RU2A 1LWFB 3Q8SB 2FJWA 1KOHA 5CHCB 2MZTA 3CUNA 2C22A 1VQYA 4XK8C 3V6KA 3M4XA 2G9OA 2A3JA 3FRZA 2YX7A 1VQ7S 2JH3A 5D78A 1UFLA 2HFZA 2NPIA 5DLFA 2OMOA 1S1XB 1U25A 5EWGA 3DLGA 2XMMA 2VFUA 3KLHB 2UXBF 3I0RB 1L3KA 4OIXA 3OXLA 3TA2A 3EX7B 5IT9Y 5KFTA 5FDLB 1VQKS 3BGRB 4XDDA 1N48A 5CXTA 5CQGA 5KFUA 2QA4G 4B3SF 5AXLA 3GFHA 3B4DA 4WK1A 3M32A 3CE8A 2VL1A 2CQIA 2C3MA 2RF2A 4JI0F 5B08A 2XY6A 5KFDA 2DGWA 2NSCA 4E98A 2MZ1A 2ERRA 1VQSA 2QYCA 3T3FA 2RS8A 1ZBTA 1IKXA 1JLCA 3OL9A 2ILYA 3IAM9 5IQ6A 4GKKF 4N47A 3MFHA 2OFGX 3FZ2A 3LAKA 2AW0A 4KR0B 2Y1RI 4RBVA 2G0CA 5B0DA 5I3UB 1SL0A 1KFDA 3GILA 4OJ1A 3K7RA 3TX8A 4ETXA 4OX6A 2Q6BA 3HK2A 2ABYA 3HF5A 4Y2MA 1FKPB 4NLWA 2U1AA 1LWCB 3ZZZA 1TVRA 3PY8A 1W2BR 3PEHA 4DQIA 2SXLA 2YH0A 3KK2B 3J80Y 1VIXA 4IOBA 1VRTA 2ZKTA 4DV2F 5F8NA 3AH6A 5JJBA 2GO8A 5DQIA 1CLFA 4ILMA 5D77A 4R5PB 5A0YB 1D8ZA 2BQ3A 1NJIT 5KG6A 5BYRA 2WSCC 2QSFA 3IXQA 4C3MA 2HWIA 2EG2A 1YHQS 1U48A 2WSEC 2E5LF 3G8SA 1LFPA 2QEXS 5HLFB 2FJBB 4Y2CA 1AFJA 4I6AA 1HPZA 3M30B 3UQSA 2BW2A 1RT2B 4LF5F 1XMQF 3DLKB 3MM9A 4CT9A 2AJ4A 3SDEA 3QIDA 1FEEA 3MMJA 3UPFA 1GX5A 2CQ0A 1NK4A 5HO4A 1GQEA 2MYFA 2VBWA 4LT6A 1TL3B 2B0GA 4B9VA 4K50A 3E01B 1GTHA 1FJEB 5GAHU 5DRKA 3PR5B 1L3VA 1R89A 4JI6F 2B4OA 1SL1A 4K4UA 2BYCA 2F9DA 5GAEU 1RT3A 2EI5A 4FXVA 1DARA 3H5UA 1FVQA 2EVZA 5B0EA 1M90T 3Q23A 1Q53A 1IKXB 3KG4A 5A8KA 3DHXA 3BO4A 2GQQA 3PW2A 4QWAA 2RE1A 4NRUA 2D3OR 5J2NB 1ZETA 4CIOA 3E51A 2JC0A 5GAEI 1X4CA 1E6VB 2WB4A 4QPXA 2HHQA 3GMGA 2JVOA 1M5VC 4ZDNA 3OLAA 1FERA 1RAJA 4K2XA 3DFEA 2XBPA 3SSSA 2FHMA 2CVIA 3MEEA 4WKRA 4V19J 2VONA 2KRBA 3VAMA 4RUCA 3D1QA 1H7WA 4P2SA 2CIMA 2P9CA 3I0RA 5D8HB 1WNEA 4NCAA 1YJVA 4OI6A 1VS3A 2DH8A 3BN4A 4WK3A 1SKSA 1C1BB 1SKWA 1CC8A 4KIAA 3B82A 1U6FA 1W25A 2UUWA 4H4OB 3JYTB 2V8GA 4Q0BB 5KFRA 1VQ8S 5F8MA 4NZ7A 1VK3A 2HFNA 2L9WA 2VKRA 4M63A 2DVIA 5BYQA 4KB7A 3MMAA 2F7VA 3FQKA 4ETZA 2O3DA 4EZ9A 2R4FA 2CPHA 2R7WA 5DM7Q 1KLMA 3ITHA 4OZ0A 4DQRA 4R8UA 5BYSA 4XO0A 4B3OA 4X62F 4OLOA 3HT3A 1MMDA 1JIHA 4YB5A 4RW9A 4D3GA 3PIOQ 4EBDA 2ZD1B 1GX6A 2ZJRQ 4KPYA 1JJHA 1HBNB 3PNIA 2O67A 2Z8QA 1X5TA 3WBZA 4JUZA 3PVXA 1B7FA 1LV5A 2YNGB 3OVBA 3JYTA 4C8OA 2VG5B 2VQFF 2CQ2A 2AP6A 2ZH9A 1WWHA 5J2PA 1HNIB 1MWYA 5DG7A 4QYZJ 2DO0A 1VRTB 1V6HA 4NCGB 3IRWP 4ZVHA 2FVQA 1IKYA 3FVYA 4TQSA 3B4MA 3LH2S 2MSSA 3EXYA 3R5DA 4HEA9 3N6MA 2APOA 4KHMA 4LJMA 2A1BA 5D6GA 1CQMA 2VUGA 3TW0A 3MM8A 2JDJA 3DLKA 1QSLA 4MKYA 4RNFA 4YHHF 3JSMB 1VQOS 4UQTA 1UVNA 1XWLA 2DITA 5LT5A 2LECA 1KQKA 5EN1A 1S6PB 3KKFA 4JI3F 2XHWA 5M2RA 3ICLA 3GG0A 1UA0A 4KJIA 2MQQA 4TYAA 3ETOA 2O66A 1U1RA 1HBUA 1SJQA 3FFI