2CRLA

The apo form of hma domain of copper chaperone for superoxide dismutase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GSSGSSGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The apo form of HMA domain of copper chaperone for superoxide dismutase
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Copper chaperone for superoxide dismutase
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2crlA01
1YJVA 3T9NA 3BN7A 2VH7A 1IUJA 1X8DA 1FEEA 2QLWA 3MZIA 1U7LA 1GXTA 3HHLD 2W4CA 3K7RA 4ZA1A 1AFIA 2BJDA 4OJ1A 3TRGA 2BYCA 2XMTA 2XMVA 4A47A 1Y0HA 4HH0A 1YJUA 2HFOA 1OPZA 4HL9A 4DPOA 5T7LA 3WDOA 4NPOA 5B0CA 3GZ7A 1FD8A 2FB0A 3VTIA 2GGPA 2W4PA 1URRA 2IYIA 5B09A 2ACYA 1CPZA 4Q2MA 2G9OA 4QOTA 1Q8LA 3LO3A 4FNHA 3TNVA 2ROEA 1TL4A 3MCSA 3BM7A 4DN9A 2N4CA 2OMOA 2ASYA 3BGUA 2RMLA 5B0EA 4A4JA 1YJRA 2RILA 4FNIA 3TOQA 5T7LB 1RJJA 1Y3KA 2XMJA 2XMMA 2GO8A 2OFHX 2FHMA 2HIQA 4A46A 2JDJA 1KQKA 4U9RA 1APSA 3KG0A 1N5QA 5KAKA 2HQIA 5A6WA 2W4DA 2K2PA 1FVQA 2PGCA 1VQYA 3BR8A 4NL5A 1SI9A 1FE0A 2CRLA 1LQ9A 2XMKA 5B08A 1TR0A 2IYGA 5A6PA 1W2IA 1K0VA 1GXUA 5B0AA 2OD6A 1N5VA 2LQ9A 3BB5A 2HLTA 3HHLA 1Y9OA 3LGMA 1JWWA 1MWYA 1OQ3A 4Y2MA 5F0UA 2VV5A 2AJ0A 1SB6A 2KT3A 2K7JA 1Y3JA 1FESA 2OP5A 3LGNA 2KYZA 1X7VA 1CC8A 2QIFA 1ULRA 3HF5A 4HI1A 3FMBA 1KVJA 2BUNA 4ZOSA 3I9ZA 3HX9A 2GA7A 4HH1A 3IWXA 2FTRA 4HI2A 1FVSA 2IFXA 4OIXA 1AFJA 2EW9A 2LQBA 2AP6A 1QUPA 1V3ZA 4DL0C 5B0GA 1P8GA 2ZDOA 3DXSX 4Y2KA 3QGPA 3BDEA 1VQSA 2Q3PA 2K7KA 2L3MA 4OJHA 2OKQA 1TZ0A 4YEAA 2GV1A 3CJKA 3QMQA 1WD6A 2BBEA 3DCAA 2QLXA 1Q53A 1YJTA 2ROPA 1XBWA 2K1RA 1S6UA 2RU9A 2N7YA 2OAUA 5B0FA 1CC7A 4A48A 1Q4RA 1R6YA 1Q8BA 3E8OA 4YDXA 1FE4A 2HLUA 2PD1A 3HHLB 1OSDA 5IXUA 1P6TA 3KKFA 2FIUA 2GFFA 1SQEA 2GCFA 2RSQA 3FRYA 3KG1A 1JK9B 1AW0A 2XMUA 1MWZA 1N5SA 3HHLC 3BF4A 2QYCA 2OD4A 3HDSA 3IWLA 1N5TA 2K1RB 2LXFA 1YG0A 2OFGX 3F44A 4OJGA 4EFAC 2GGPB 2XMWA 2HFNA 2ROGA 4OJ3A 2LDIA 3FGVA 3UDCA 3CJKB 4Y2IA 1KVIA 2KKHA 1TUVA 5F0WA 4F67A 2ZDPA 5B0BA 2N4DA 3HFKA 4Q2LA 5B0DA 1OQ6A 2AJ1A 1TL5A 2AW0A 1S6OA 2BJEA 3KNGA 1X0PA 1YRXA 2KT2A 5K9FA
chains in the Genus database with same CATH superfamily
3A13A 1I6JA 3MAQA 3R1LA 2WTFA 3CCTA 2FD2A 3M30B 4IG0B 4GVLA 3FMWA 2HHVA 4ECSA 3PRVA 1JLCB 2RF2B 3G71S 1R43A 1OPZA 2RAQA 2VU5A 4PXCA 5SUHA 5T7LA 3EX7B 3H2LA 4NI2B 2W01A 5E5NA 5DS7A 5L38A 5DM6Q 4ZN1A 1RT3B 2W4PA 4DV6J 1EB0A 2DO0A 4IDKB 2QSWA 2FVQA 1N54B 3UQSA 2R7VA 2ZH1A 5A0YA 2XS7A 3A12A 4MH8A 2JC0A 3QIPA 4YB7A 4ZVUB 2HK2A 3T5LA 1SJ3P 3ILOA 1WC6A 4QQBA 3CCES 1M5PC 5ETTA 2VOOA 1BXNA 4LRAA 4ED6A 3P8BB 4R8UA 2ZEJA 5C25B 3RRGA 4CCHA 4A4JA 2WB1D 4HR2A 3SBMA 1XR5A 1WDDA 1RT4B 2HNDA 1Y3KA 2J0QD 2XHCA 4A46A 1RTZA 4EU0A 1YKWA 3DNCA 5L39A 4OZNA 5KOWA 1RTDB 3KLVA 2KFNA 3CCWA 2AYEA 4B9VA 4NLGA 4ID8A 2GS8A 2W4DA 2K2PA 3MD1A 4PXEA 2L08A 5HLFB 3I82A 1U0SA 2CJXB 3DOKB 2HK3A 2UUBF 2HHQA 2BM1A 3CC2S 2VPZB 3D6TB 2RKIB 1B7YB 1CS4A 1E6YB 4Y2CA 2UV8A 4X62F 2CG8A 2YKMA 4G3IA 2RD5C 3FVYA 2VOPA 1RU2A 3P6YC 4KAIA 2NREA 5GAHI 3QAEA 2C3UA 4IRDA 1XEZA 2IMOA 3DOMA 3T5HA 2VPXB 5GMKa 2O3DA 4P2MA 1J5OA 2IMWP 1X7VA 1CC8A 3NAIA 2AX1A 4CLTA 4TQSA 3C16B 3K5OA 4FXVA 3UN3A 1UJ4A 5KFAA 3IWXA 3UNGC 2VB6A 3QWUA 4DFJA 4OIXA 4G1QA 2RVJA 1CJUA 4HACA 4Y0FA 2QRRA 2CYYA 1Q8IA 4MAKA 4NLWA 3MMCB 4JI5J 3HK2A 2ZDOA 1KTVA 3DXSX 4PG6A 2L3MA 3KLFA 3K5MA 4DLGA 3EDQB 1DARA 1WWHA 1QM9A 4WK3A 4M5JA 2LA6A 1YJ7A 1IR0A 2DT9A 4KH0B 3DDIA 5D4OA 2M88A 1BQNB 4ZLNA 1UL3A 1HBMB 1XR6A 3KJVB 5DGAA 3M7VA 2DGOA 2KL8A 5LL6d 2OAUA 5B0FA 4NCBA 3ZO7A 1B70B 2MHNA 3F41A 1VQMS 2YKPA 3VHQA 2J9EA 2PD1A 1HI8A 2W7PA 1VRUA 1UTAA 4MFBB 5KFUA 1NLKL 1P6TA 1S1XA 4TY8B 4TY8A 1NH7A 2YKOA 2BQUA 1QSYA 1HNVB 3SCLE 2GCFA 2D9OA 3Q8QB 2AYMA 3BPSP 3FZBA 4ZN3A 5A8RB 4CZCA 4W90B 2VUGA 4QR0A 2NUHA 2IPOB 2Z2MA 4CNZA 4IOAQ 3MM5B 4AQYF 2CDQA 1ZOTA 4L3KA 3AAWB 4DR4F 3L95X 2P9EA 3OJSA 1RA7A 2ROGA 4QPXA 2CQ2A 5CH7B 1KLMA 5J2QB 4KFBB 4QU6A 4ZVFA 2LKZA 3M05A 3CCUS 4CT9A 3RB6A 2C2EA 2A2DA 4M5NA 3NGSA 3QPIA 3POTA 1WKKA 2X1BA 2AHOB 5CABA 2FJAB 1YRXA 4IH7A 2OPRB 2AZ1A 2FHJA 3IBCB 4USKA 3G2XA 4B3MF 1RCOB 1XMOF 4B3RF 4L76A 2DGSA 4DOZA 4LBPA 4JI5F 1PYOB 4R5PB 4DZ6A 2JL9A 3RUBL 4WTOB 3VAGA 1HI0P 2JX2A 2DEIA 3FC9A 5DRKA 1UVJA 4HL9A 1RT4A 2HNDB 5KG7A 4IUFA 3RR7A 1WOOA 1JKHB 4ZPWR 3Q0AA 3W2WA 5HVHA 5BXIA 4NXMJ 2PI5A 4MKAA 3IBWA 3TJ9A 2ROEA 2QC3A 2E7XA 4K4ZA 3BSOA 3R6GB 1UETA 2GJ2A 4HT5A 3D7SB 3OFFA 4DQPA 3QATA 2YQ0A 2R7RA 1PBUA 4J9OA 2OPSB 2C2DA 3K89A 4F0MA 2D3O1 3N9UC 2MKCA 3PJ9A 1N5YA 2ILZA 3QO9A 2CWXA 3BYRA 3PYGA 2HIQA 4ETZA 1NK4A 1ZA1B 3ZZYA 2GAGC 2X1FA 5FDLB 4ED5A 3VCDA 2B5JB 1TKTB 3BZQA 5A2QU 5L1KA 2L9DA 2BDPA 4RW8A 1VBXA 2BANB 3TWZA 3VAIA 3NGUA 4MK9A 1CJVA 3HSDA 5LJ3Y 1SKSA 4PG4A 1RYSA 2J6UA 1VBKA 2B6AA 1TUWA 2EG2A 2BM0A 4ES1A 3P49B 1NH8A 4W98A 3Q8UA 3M9MB 2NXCA 3C6UB 3LGNA 2C3YA 4C97A 3T5KA 2NXUA 1QAIA 3R7SB 4F50A 3O8WA 4FYVB 2NQPA 1SUQB 1PG5B 2PEBA 3I96A 4ITSA 4D3HA 2QMWA 3O44A 4JI3F 4LSNB 3QFHA 3UD3P 1BGXT 1FWLA 3LALA 4HI2A 3R8YA 1Q86T 1PILA 1RT7B 1WKLA 4ES3A 2EFNA 1VMBA 3WQPA 4L74A 2JEJA 4NXMF 4Y2KA 4IFVB 4AXJA 3IR5B 4JUZA 4DMZA 2K7KA 2OEMA 5J2MB 4X4QA 3LWMA 3NCQA 1I51B 1JXEA 2KI2A 4USVA 3JSMA 3HXMA 4YFUA 3CDBA 4CO5A 2Z56B 2BVZA 3DXBA 3GB0A 3I56S 4XO0A 4DQIA 3NY0A 4DUYF 2C42A 4OYAA 3W60A 4JI2F 5ETKA 4UZCA 3V5RA 2W9CA 2VQEF 5EX3A 1FDBA 2XNRA 3SCIE 2MKJA 2NXNA 2PMZD 5F9LA 2AJFE 4KPYA 2MQPA 3WX8A 1S7HA 4URGA 3BQ2A 2QV6A 4DLEA 1MSWD 4UUWA 4Q44A 3MEEB 2V2QA 2HYIB 1JLFB 1JK9B 3L7PA 2XMUA 2MQLA 2E5IA 5MLCV 2OD4A 3N5BA 4WFYA 4ZVSB 1TL1A 4DL2A 1RT2A 3CO0P 2OFGX 2QA4G 4J9MA 2VODA 2GHWA 5CD4H 1Q1KA 4H4OB 2ZOMA 1YBAA 2VBXA 5K14B 3UN2A 1KFDA 2XCPA 1KVIA 3R5GA 1TFWA 3J81U 2AV5A 3MPWA 4F67A 3I0SA 3F73A 2C28A 1T9WA 1EAYC 3GONA 2J9DA 1VK3A 3FBEA 5AE1A 3KNGA 3JYTB 1X0PA 2KM8B 4KHPJ 2HVZA 3HHKA 4Y3CA 2M2BA 4CT8A 3ZZ0A 5FLXU 1I94J 3OSNA 4KO0A 3DU5A 4NA1A 3BBCA 4A8QA 1S9FA 3NWGA 4MKYA 2BJDA 4FPIA 2EBEA 4OFZA 4X4VA 4J37A 4RLEA 2W7AA 4ELUA 1YJUA 2B4UA 3W62A 4DPOA 3V4IB 1HA1A 1S57A 2CQPA 4WIQA 4F2SA 1AT1B 5KG3A 4ANEA 2NR0A 3QGIA 5F8MA 1UA1A 4HLBA 2HBYB 4N5SA 4C0HA 1YZ7A 3CW2C 1DQ9A 5CZVA 5KFDA 2ZWPA 1HMVB 4RW8B 3OHAA 2KRRA 2XLIA 1VBYA 2YNIA 2R7TA 4I2QB 2FZCB 2N4CA 4AXIA 2W1BA 1I5OB 2HSEB 2RMLA 1UFWA 4LIRA 2AGPA 1UWAA 4I4BA 1RB0A 2HHPA 3EICA 4U8YA 4ECYA 3JAMU 2XMMA 5IM0A 2FHMA 1O8BA 1PCAA 1R8AA 2GVDB 4ID5B 2OTLS 1BWVA 1T3NA 4BWJA 3SV4A 4ZDNA 1FTCA 4DR1J 5A8KB 3ISND 4DPTA 3HVTA 2GIFA 2V63A 3R27A 3LP2B 4M5LA 4OX8A 5IOLA 3I6PA 3BH6B 1RAHB 2M0GB 4PG5A 4OHZA 1KS2A 4YP3A 3W3SA 1KFSA 5JMNA 2CPIA 4F8RA 3CD7A 3IRWP 4Y2AA 1VQOS 2BE9B 1EETB 4Z7YA 5DO2A 2IM3A 2XLJA 2JEGA 3IO1A 1DRZA 2V2KA 4I68A 4F7VA 4OLPA 3BQ0A 2GAHC 4IRKA 5D0HA 4DCJB 1FESA 1N32F 2JEIA 2ZHBA 1R7IA 2WVFA 4AYBD 1RBAA 1J2VA 2YKQA 4ZP9A 1FDNA 2ZJQQ 4PYAA 5CYQA 4DR5J 3IAM9 4KHMA 1RWWB 2CPEA 2QX0A 4KR0B 4QJVA 1S9EB 1RACB 4LMZA 2R8IA 1U1LA 4LBIA 3ZC4A 5GAGU 1LXNA 2KJVA 1QDUB 4WPAA 2V4QA 2W24A 4LQ9A 3W66A 2A6OA 1KN6A 3ZZRA 5B0GA 3D66A 3OLAA 3LP0B 3QT8A 3BQ1A 2FZKB 2OEJA 2W2OP 2R7OA 1HKAA 3DRPA 4LT6A 2OKQA 1YGYA 1BD6A 4TYBA 3NWRA 4YEAA 3UR3C 2V2VA 3H4BA 4M5HA 2M52A 3KDOA 1O6XA 4ETXA 1MMDA 2VPYB 3S1TA 2UVVA 1VC5A 4ZIWA 3Q24A 1VK8A 2RRBA 2RU9A 3K57A 1Y11A 2R7WA 4IR9A 4ELVA 4LSLB 2KB2A 1RAFB 3SFUA 1KHWA 3T1HF 4EMDA 1BHNA 4CTAB 1S0VA 4OYOA 3FRZA 1N5YB 1Z4UA 2F5GA 2ZH2A 1IJEB 1N34F 1VQKS 1KTQA 2FGCA 2GFFA 3M6VA 1MN7A 4K8RA 2LXIA 8RUCA 4CIOA 1OIAA 4H4MA 5KT6A 2BQRA 1FXDA 5KG2A 3S7RA 3NMRA 2V8DA 3K59A 3CEDA 3DLEA 3DLEB 3W5ZA 1D1UA 4LF5J 3A3OB 1MROA 1X5OA 2F8MA 4FF2A 4C8ZA 2YNGA 3H2UB 3BR9A 3OTBA 1RHQB 4WFAQ 2MJNA 3HMJG 1N52B 4A8MP 1SKUB 2V94A 3MAAA 3C8YA 2EFOA 4GO7X 4IH6A 1RT5A 5BJRA 1VQ4S 1HI1A 2NYHA 4CO4A 3GG1A 1V5VA 3O6QA 4NLSA 4DR5F 3RRHA 3W2VB 5H9FJ 1AB8A 2QE5A 2VH7A 4OHWA 2M3DA 1X31C 2CPJA 3M32A 1HBMA 1S12A 1S1XB 2V0NA 2YPZA 1GXTA 2U1AA 2V34A 3PKYA 1HNZF 4LF9F 2BE2B 1JLEB 5HP1A 2VQEJ 2DH9A 1MNEA 1UFKA 2XO6A 2QA1A 2HNZB 1S1TA 3HULA 3Q89A 1D9DA 1FT8A 3OL9A 2GGPA 3OVSA 3V6HA 1HBUB 3P45B 4ZVEA 1LFWA 4ATNA 4GO5X 3M8RA 1HYSB 2VKRA 2DY9A 2OPPA 3DFEA 4QR2A 4EWTA 4P74A 4JP8A 2FLNA 3QLHA 3BGLA 1FD2A 1YJ9S 2B3TB 1U1KA 4JI6J 1Q95G 4WZMA 3GJTB 5CA5A 5DLGA 3LA0A 3JQMA 2VFRA 3SQGB 1YHQS 1CLFA 1BMQB 5EHHA 3DMJB 5HAOA 3TW0A 1G6BA 4CLSA 4DWIA 4DV5F 2C1EB 1C4AA 1BQNA 1FVQA 2UZAA 4JI0F 5KFMA 4OZ3A 1RAAB 3TVZA 4FDFA 7AT1B 1NM2A 4O3OA 5HVGA 2FDNA 3PNIA 4RUCA 3EZ5A 2YWGA 4DR7J 2B9YA 2JFDA 1RA6A 1HPZA 4ECXA 1FJCA 1ELOA 3JSYA 3PFOA 2B7BB 2EVZA 4BBYA 1CJKA 2LQ9A 2HLTA 2EK1A 1U4BA 2UUCF 5I3QA 1OQ3A 1WF1A 3HP6A 2ALZA 1DTQA 3CC4S 2O66A 4M95A 3OTDA 4Q45A 5L8RC 1Y10A 3LP2A 4YB1P 1QTMA 1FHTA 3UW1A 1B4SA 5ETSA 2F4VF 4LFAJ 1ZAXA 4H4KC 5F9NA 2UXBF 5HMZA 4AL6A 3PY8A 1SJ1A 3AOAA 4X64J 2F9JA 2FHKA 3N4WA 2IJFA 4ZOSA 2ZNZA 2AU0A 1T3OA 2H48B 2EC0A 2A10A 3VZIA 3EVOA 3PW4A 3V2UC 2GMJA 3MMCA 2Y8YA 4YB6A 1RT3A 3H8YA 4ZVGA 2DYAA 2ZC4A 1HD0A 3P5BP 4AD6A 1YZ6A 2CNOB 4CDIA 1NJZA 4NXNF 1O0PA 1OPIA 2R7QA 2Z2LA 3SV3A 1Q5YA 4C4WA 1T9VA 3ZTRA 5F8IA 5LXYA 2XCAA 1AUDA 2AEMA 1KVKA 1UEUA 4X4UA 1TKXA 3HJFA 3GP9A 1QE1B 3G6ES 2FHJD 2O01C 1XTZA 3ET6B 1GTHA 2XC9A 1HBNA 2B56A 1FE4A 2UU9F 1S77D 1M5HA 1G3OA 3AHPA 3HFZB 3AQPA 1S4FA 5JVGQ 2EG1A 1GMUA 1R31A 5CYMA 3W1YC 4X66F 2R2RA 3RU0A 2BKNA 5KT5A 2E1AA 1S0OA 3LW5C 3MR3A 4K5RA 3OTEA 1N36J 4ZP7A 5KOXA 1RHUB 2FGOA 5J1EA 1RZMA 3GR0A 1KOOA 3SDEB 5J1EB 3GIMA 3RAQA 2GW8A 2GHVC 3VGUA 5C42A 2QA4S 5F41A 1L5UA 1F5BA 2GVZA 3AB2B 3IMQJ 3KUGA 4QWBA 2CPFA 4CO2A 4QPTA 1OWXA 1FKAF 2UUCJ 2LDIA 2IAJB 3R5DA 4IFYA 3HVAA 4NI2A 3W61A 4UOGA 4E0DA 4YDDB 4DUZJ 3R2CJ 5L46A 2WW4A 4LF1A 4NZ0A 2M7SA 2F4VJ 2D69A 3DN9A 5KFCA 1SV5A 1N88A 2VG5A 3BBFA 3GFXA 4P2SA 5F3TA 3CC7S 2FPHX 2HNYB 2BJ7A 2AW0A 2IJNA 2XULA 2HFZA 1AUSL 2DH8A 4LRBA 3V6KA 2HMIB 2HMIA 3QIDA 2U2FA 4L72B 4F36A 4GKJF 1RHRB 4PG7A 4F02A 3J81j 3G82A 4DPUA 2QT7A 2IJRA 1PC5A 2E1RA 3HHLD 2VL1A 2ZH4A 4LVNP 3GFZA 2CJ9A 2V8GA 3I87A 4OZ5A 4DV3J 3MD3A 3Q8YA 2KJWA 5FLXY 1NB2A 5A8WB 4V1Ak 3NL0A 4UUXA 1OJ4A 4NPOA 5KFZA 2CJBA 2GNKA 3H59A 2A3JA 1H2TZ 4OHVA 3NG8A 3KK3A 3PJWA 4C0BA 1JIHA 4N77A 2Z2YB 4K4UA 4UZBA 1C1BA 4HDHA 2ZE2A 3V4MA 5D3GA 3UR0A 4OX6A 1FRHA 1GEHA 1NUEA 3NBPB 1Y4ZB 3OR2B 4HTJA 3VGSA 3MR5A 5B0EA 3PW0A 5E0OA 4OYPA 3IGVA 1TL3A 4K5SA 3AOBA 4KGVB 3OL6A 2XMJA 3VALA 3QWPA 4NOHA 5AXKA 3FCHA 1S6PA 3MEGA 4K7QA 5KAKA 2RQMA 1S79A 2B9EA 2XSJB 4N56A 4O3RA 4DCOB 2GX8A 2XNQA 1W26A 2C3OA 2WONA 3IA0A 3KJQB 5D4NA 5E3CA 1S6QB 1LW0A 5FIIA 4PWDB 1FE0A 2CRLA 1UAWA 2R4FA 3DGVA 4M5KA 2IYGA 1BQXA 5JXSA 5BR8F 1WEXA 3K17A 4CLKA 4TU9A 4LBHA 3PIPQ 3KYLA 2E7VA 3EGWB 2FQQB 3KUHA 1N5VA 4E8UA 2MPUA 2Y1RI 3CCLS 1HD1A 4FVMA 1RXOB 1MWYA 3M8PA 1DJ0A 3MXHP 3HZGA 4ER8A 2VV5A 3DDKA 4WU3A 3VWSA 2GMHA 1OYEA 2MJUA 3BGRB 4KC5A 4B17A 3D0IE 1T7PA 3KHLA 3S8SA 1G7CB 5F8LA 3UDVA 4B9LA 5IT9Y 1S1UB 2W7OA 1ZAWA 1ULRA 3MEDB 2YX7A 1JJCB 1TKXB 2OI2A 2HVDA 3MMAB 5D77A 1OY8A 4JV5F 1WORA 4FVCA 4UF4A 1A7GE 2K3KA 2Z0GA 3GQCA 1FXLA 4RU9A 2BE2A 4DV6F 2BV3A 2WSEC 3MM6B 3MM6A 2B9XA 3E3XA 2MKYA 3FSYA 1VQ7S 2Y0BB 4CTAA 4NYOA 4RW9B 3KLHA 2OJ3A 4LQ3A 2ZWOA 2AGQA 5DDOC 3U1NA 5ETMA 5G0RB 5AXMA 4XPCA 4TU7A 4ZVPB 3QMQA 2AD9A 1UEVA 2HPUA 1YLXA 1VRQC 3GYGA 3U7JA 2ZUGA 3UO0A 3ZZUA 5I3UA 1WNEA 2ROPA 3W63A 4ZCKA 2MGZB 4PXBA 3OVAA 2BRKA 4A48A 1LWEA 1IR2A 3ONQA 3H5XA 2B4VA 4USMA 3NAHA 2MZJA 2G2ZA 3J81Y 1M0SA 4NEZA 4Y65A 2VASA 1JLQA 3B82A 3C19A 4ZPDA 1GAOA 2ZVIA 2ZH7A 1NK7A 3M8ZA 1LWFB 5BR8J 2O5DA 1S9EA 2CPHA 2DGXA 3MWBA 1YRUA 2VJVA 4ED1A 3TP2A 1ZTTA 1U47A 2QYCA 2CQCA 2F65A 4J9SA 2XB2D 3AT1B 1EQ0A 4K50A 1RWOB 1VQLS 4X4OA 2XM3A 2EPIA 4WE1B 2IDLA 2GIRA 1RTDA 5FD1A 2J0SD 3NLCA 5IM0B 3H2VE 2QA2A 5IV4A 1WC5A 4UY8T 4RWWA 2HHUA 2YVSA 3R7NB 2BMBA 4ECUA 3F0NA 4OI6A 4ZVOB 4DSJA 2LXUA 3LPYA 1UEKA 3LQVA 1C0TA 3W9JA 3KHGA 4JV5J 1KQFB 3WIVA 1YJVA 2DGQA 2PDAA 3KMSA 1NK9A 1Q82T 3CD6S 4WKRA 2OPPB 4WP8A 3TZXA 2VICA 2XWYA 4I6YA 4EUVA 5IT4A 4IO1A 5KFBA 4KQZA 3RB4A 2RU3A 1AFIA 2HWHA 5CZXA 8ATCB 3AA8A 3IAS9 2O67A 3JB9k 2DR7A 1FD8A 2YKAA 3MDFA 4K2JA 4M5DA 4R8UB 3MM7B 5IQQA 4TYAA 2OMLA 3LOUA 4L6V3 3T1YF 4FF4A 1P27B 4KBIA 4K4VA 4QBUA 3V6DB 3PXGa 2V67A 1NZ8A 2MZRA 2RT3A 2WW8A 5KFJA 1RBOB 2OMOA 2MQMA 1GMVA 2K3IA 3UDLA 2E29A 3Q22A 2DR9A 4ZMMA 1VQ8S 4OL8A 4E2FB 2WSCC 1R3NA 2HFSA 2RILA 3M8QA 2C2ZB 1CEZA 2BKPA 5DM7Q 4K4SA 2CXEA 2HRTA 3L09A 1UVNA 2VG6B 4UOHA 3W5YA 5D6GA 3BGFA 4CLLA 4J9QA 2HZAA 3BSCA 4AQYJ 1PGZA 4UY85 2BRLA 4IG0A 4C8LA 4ED4A 4A8XA 1VQYA 5C24B 4PUOA 4R0EA 3EE3A 3OTOJ 3DOMB 3LP1B 4NCGB 3DRPB 1J5EJ 1RGVA 1LXJA 4I7FA 5IS2A 3BS9A 3HI9A 2YKMB 2EI5A 1MN9A 1F9EB 4IDKA 2MQNA 2LU2A 4DV1J 2X3DA 2NPFA 4M94A 3IC1A 1W7WA 2DNPA 2D9PA 1F9FA 1NB7A 2G0CA 4B3MJ 2UXDF 2W9CB 3LF0A 3BO4A 3UD4P 2QTWA 4WYWA 3ITHA 1RTIA 3NRBA 2J8AA 5C25A 3T41A 4FS1A 3FMBA 3N79A 3GE9A 2A2CA 3TUPA 1KVJA 3NGTA 4Z2XA 3EPIA 1S1VB 3MR7A 3CUNA 3DYAB 2IDEA 4QIFA 5E33A 4ZVQB 3GIKA 5KFEA 1F0XA 2A1BA 3GYNA 2DNHA 5E3RA 3MEEA 3M8PB 4USJC 4YMEA 3J7Z5 4W92B 2I5JB 1KWMA 5LT5A 1FXRA 3SCKE 4J9PA 1IKXB 3BH7B 3ZZZA 3MM9B 4KIAA 3CWJA 3BDEA 1UJ6A 3DM2B 5KFLA 1FNOA 1WG4A 4DQSA 1KKHA 3ISZA 3NOGA 3CNQP 2DR5A 2UVUA 1LK5A 3A8KA 1D9FA 5C5JA 1SC4B 4J91A 1TV6A 1F2GA 3FFIB 3DCAA 1P9YA 3QRQA 2WK4A 4HHUA 3I32A 4PWUA 1VYAA 1YJTA 2KO1A 1XBWA 2IM2A 3R7BB 2K06A 3A1YG 2R9LA 1H2UX 4Y6IA 4DCPB 1FJ7A 4P7TA 1GFWB 3JSBA 1KQSR 2DGVA 1N32J 2Z8QA 4XDCA 2ZUAA 3OJUA 3SDEA 2YWFA 3U1MA 4M5MA 3OTOF 4P52A 4UW2A 4DG1B 1QAYA 2RUSA 3PW7A 1X0FA 1HW9A 3RBXA 3EZUA 4ICLB 3LH2S 3ISNC 2Z58B 3E51A 4OZ0A 2KVIA 4DV1F 3SSRA 4CLZA 1UVIA 3GILA 4DU8A 1FJEB 1HBNB 4Y2IA 2E66A 2ADBA 3O3LA 5C7PA 3J80Y 2GIQA 4H4KA 2FC8A 2IY5B 4ENOA 5H9EK 4F04B 2UUWA 2Q43A 3BPDA 2IIHA 4JI3J 1BQMB 1HIYA 3VVUA 3BKUA 3AODA 4LJMA 2ZKTA 4YUDA 4IYQA 3Q83A 4UOCA 1CPZA 1DBDA 2V6AA 4CO1A 1KQGB 4TN2A 2EXUA 1DTTB 3HHEA 1QE1A 2EKNA 1LEOA 2E1CA 1RAJA 2W4CA 4DU7A 4B9MA 4FYWB 1T9YA 4OJ1A 3OFGA 4WFXA 3US5A 1Y0HA 4HYKA 1K1QA 2E1MC 2XWXA 1VIXA 3M8QB 3WDOA 1U2FA 1SUQA 1CJTA 3VTIA 5JUMA 4RNNA 3UCGA 2GVZB 2AQ4A 3B4MA 2F8EX 3PHEA 1K0TA 1NRKA 2YWHA 1NJYA 5KG5A 3QLHB 4DG1A 2KHCA 3FEXB 5ETPA 4KH1B 1V3RA 4RBUA 3DYAA 5D15A 1NPPA 5AE2A 4OHYA 3EWGA 5KFSA 1R0AA 4A8WA 1ZBTA 2CZVC 2E9RX 4JV2A 2I5JA 4G1PA 2LYVA 4XDDA 3TUJC 2IRUA 3H4DA 4O3PA 4YR0A 2ACMA 1UKUA 2C3PA 3CDAA 3ZZTA 4DZDA 2RHQB 3H90A 3KG4A 4C8KA 1WKJA 1JJ4A 1XN9A 4PAAA 1IXKA 2B5JA 2LA4A 5A6WA 2ZH5A 2P9GA 4J9KA 1RT6A 2PGCA 5K8NA 3QJPA 1G1XA 2CQ0A 1OS5A 4ILLA 1SI9A 1X4CA 5IC6B 3KJFB 2FUG9 1VC0A 2DCLA 1AYEA 1WF0A 3B4DA 3CJ8A 3FZ2A 1C0UB 1X5TA 1EIYB 4J90A 1RADB 4DL3A 1CJKB 3QRPA 5CYMB 1YDLA 3KK2B 3KTQA 2YWKA 2I38A 3HPOA 5HBMB 4DL6A 5L9XA 2HS0A 1WC1A 1IBLJ 2FVPA 5F0UA 2HHTA 5E3PA 4KHPF 1SC3B 4USUA 4Q43A 4F4AA 1GMWA 1YRTA 2WRMA 1REVB 4LRFA 2IC3A 5C24A 1I94F 1IJFB 4AFFA 4PUOB 2KYZA 3R1HA 3HF5A 2RRAA 2G13A 1NHUA 4HI1A 3J7YI 2M70A 4DL5A 2ERRA 1FNMA 3VQTA 1QAJA 2B8PA 4KPCA 4X84A 3TZYA 2FTRA 4LF4J 3P4UB 1CULA 4JB8B 4J9VA 1QSSA 1M1HA 2EW9A 3A3NB 1U0HB 1EKRA 2LQBA 2JFKA 3DGPB 5C2GA 1R8HA 4FP9A 2BXJA 4C48A 1WOPA 3ADAC 2V9KA 1VQSA 2Q3PA 4NMXA 1S48A 1VCTA 2X3GA 3AJ2A 4OJHA 3KK1B 1FRLA 2J7KA 2UXCJ 2Q1LA 1U1OA 1RKJA 1FNXH 3FBFA 1RSCA 2CZ9A 1BWEA 3G87A 4UQTA 3OL7A 3AFGA 3S6EA 3I0RA 3I0RB 5K8OA 4KGXB 3SIPB 1Q0NA 4C3LA 4ZPCA 3PDNA 4EBEA 1SPBP 4LREA 1T9UA 2J7WA 3FEYB 3OQ2A 3WIUA 5U47A 2JLEA 2YNFA 2DXDA 3GFHA 3E8OA 3GFYA 3VQSA 1WC3A 5D78A 2E5HA 2AGOA 1VJQA 1FRXA 2Q6CA 1JLQB 3BEGB 1R8CA 2H1YA 2DJWA 5IXUA 3PRDA 2C2NA 1NHVA 2JWNA 3M8YA 3PTWA 4DR6J 2KTQA 4A8YA 3EM1A 1B3TA 2LQ5A 2POKA 4F2RA 2YKNA 5J2PA 3DOKA 2ZBCA 1IVZA 4ZLPA 3QZ8A 1U02A 1XIQA 4WE1A 4JV1A 1FF2A 3HLUA 3GJSB 4IQXA 2HFNA 2XZWA 3OXGA 5HJXA 3HHNB 4RUHA 3CMES 4KGMA 3SSQA 4NX9A 2JOQA 4K4TA 4I2PA 1QLNA 4QIWD 2CQBA 1WSRA 1SCJB 1NK6A 2B4PA 2OPQA 1WTBA 4NCAA 1XNRJ 3K8VA 5AXLA 1U1QA 2FJXA 3DLLQ 4LF4F 9ATCB 4O3QA 2CJKA 3RBDA 1GT8A 5CYQB 1FEEA 3DLKA 3OSPA 1SXLA 1NSQA 2CQ1A 3D5MA 4ZP8A 3V4IA 2XMVA 3CJ4A 5I4MA 1RHKB 1NSAA 1REGX 1KP6A 2H54B 2MHEA 5B0CA 3J7ZT 3NS5A 1WEZA 6FD1A 2F7VA 2ASLA 5M2UA 3CTRA 1PC4A 1WHYA 2IYIA 3MMBA 1VFJA 2DK2A 3PX6A 2F3JA 3GSDA 3AD8C 4Q2MA 2HS4A 2H51B 1DQ8A 2YKNB 2J0XA 3AOCA 4N7TA 5EDWA 2LLZA 3T1HJ 3UCUP 1HLWA 3FDSA 4CI0B 4M1KA 3VR1A 3AD9C 2C2RA 2EFVA 1PKUA 3M8WA 3SZ2A 4DR6F 1W2BR 1C4CA 2RRNA 4LRDA 4ID5A 2FHOB 4CO3A 2DR8A 2CVEA 2VG7A 3HFVA 2GQ2A 4AUKA 4C2MA 1WI8A 5KT4A 2B51A 4U9RA 3J7YU 3GV8B 3KG0A 3SXLA 1N6QA 5A8KA 2PFDA 3TZZA 2CFXA 2F63A 2A0FB 4KGZB 1R0BG 4X65F 4LF5F 1S10A 1VIOA 1WELA 3MM5A 1A0OB 1B0PA 3R97A 3OXLA 4ALZA 1HNXF 5B08A 1RWXB 2C2KB 2CA9A 5EX0A 1M1KT 3KLHB 1W2IA 1TKZA 1WC0A 3EMTA 3TQEA 4ED2A 3EVWA 4F0KA 1VQPS 1HR0J 1IBMJ 4QYZK 2B0GA 2W2QP 1SIWB 1VJWA 3BB5A 3HHLA 3RRKA 1T94A 2MMYA 5KFQA 2DPJA 2R8GA 2KZZA 1RAEB 1XNRF 1VR6A 4G1QB 4EBDA 1M1GA 1SB6A 2AZ3A 2RDDA 3JTOA 5AE3A 1Z1ZA 3HT0A 4OI2A 3I55S 1D0EA 3NNCA 3OL8A 5JVHQ 2XYPB 1RISA 1FCAA 3CJ5A 3GLJA 3MEDA 4EK2A 1JB0C 2X1AA 1HNZJ 4WIIA 1WHWA 3C3LA 2GA7A 1NCLA 4U8VA 2LMIA 4RW4B 4QYZJ 1MG7A 1JLFA 5KFNA 3HT3A 3VAMA 2H4WB 1S9GA 1X4GA 1JLBB 1HWLA 2AP6A 3IFEA 3FKBA 4Y28C 2MQOA 2JC1A 1YJNS 2AKWB 5HSPA 1T03A 4X2BA 2W8KA 2KRBA 1S0NA 3UD5A 2RKIA 2V4RA 3JXOA 1LFPA 1C1BB 2GJIA 2GZOA 4FN5A 4LSNA 4P6QA 4KYZA 2IAJA 4IOCQ 1IKWA 4L73A 1YI2S 2CADA 2ZBRA 3U02A 3H5YA 1KBRA 3I0SB 1Q53A 1SL2A 2Y9HA 4C0OC 3RAXA 1NSPA 1CVJA 4PG8A 5ETQA 2Z30B 2GQCA 1MU2B 1X4HA 2CPDA 3K0JA 4X4NA 2XEXA 1NXIA 1R6YA 1FJGJ 1FO1A 1P1LA 2VJUA 5H9FK 3MUTP 4DV5J 1HARA 3D4JA 2ZNYA 2D7SA 4IQMA 3DRSB 4X65J 2NLWA 2MYFA 1QY7A 4JI0J 3ELHA 3FCVA 5HK4A 4KKOB 1HNXJ 3ZZOA 2CJQA 1S7IA 1LWCA 4DR7F 3K8WA 1HQEB 4HDGA 4NA2A 2CDRB 5BYRA 3HDSA 4NWBA 1HR0F 2P9CA 1IBMF 2KFYA 1LOUA 2HHHF 2E9TA 4PQUA 2X51A 3TR5A 5GMDA 2DXEA 4EEYA 3C6UA 3DMJA 5J1PA 5AJ3J 5SZTA 1K47A 2IM0A 1TVRB 1VRTB 4DI6A 2HBZB 1SH0A 2OSRA 4BCAA 1T95A 1FKOB 2N3OA 1VLYA 1LW2A 1FWPA 1TL1B 1UP1A 3UN5A 1ICEB 4YQWA 1WHXA 4X64F 1RT7A 2MKKA 4DR3F 4DSFA 2RS2A 1R27B 3LP1A 2GO9A 1GMWD 1X4DA 5RUBA 4ZPBA 1H7WA 1FI4A 3D6MB 3M2UB 1ZTWA 1HBUA 4J5OA 4F4ZA 3NNHA 4KTQA 1SJRA 1XQIA 2D74B 4HVZA 4PWWA 2BYCA 2HNZA 4A47A 5KFOA 2X7IA 3GIIA 2ZBPA 2NUUG 2HFOA 1XJWB 1F5CA 2RNEA 1NU4A 1M5VC 4NXNJ 4C8MA 2E9ZA 4QIGA 2XBPA 2MSTA 2VHGA 1RTIB 2CPXA 3FNNA 2DHXA 2BEFA 2EEYA 3WC2A 2DISA 3AB4B 4F26A 1LWCB 4PZVA 1VQ9S 4RNHA 1FJGF 5F8NA 4DUTA 3RR8A 2PFFB 5IZHA 4OYWA 3KDNA 2HKEA 1TKTA 1YSJA 1WHVA 1QJHA 2ASYA 4OX9F 4X66J 4CWBA 1JLBA 2XG8A 3IG1B 3ITHB 4C6AA 2IM1A 4EBCA 2FJWA 1VHIA 4GMKA 2GO8A 2ZOGA 3DOLA 1J5EF 3BREA 1C1CB 2JDJA 2XY6A 1YITS 1UA0A 4N41A 1XNQF 3SI8A 2HHHJ 2QL5B 2B6AB 2CPYA 3EGVA 1N33J 3O5TB 4TQRA 3RW7A 3Q23A 1RT2B 1R89A 4K59A 4ECQA 2Y1LB 2LEBA 5AJ3F 5D3GB 4B9UA 3LAMA 2AWZA 2DH7A 5GVQA 4CQ1A 4B3OA 1WTFA 2MLYA 2WVEA 2XMAA 4IFVA 5J2MA 2V50A 2YWEA 1SH2A 2R2UA 2DGWA 4PXDA 1VHFA 1VOMA 1M5KC 2BACA 4Y2MA 1JMTA 3TUIC 1D3WA 1ZM3A 2MLXA 2OLWA 4CYUB 4Z7CA 4N47A 2W9BB 1XC9A 1KRPA 2G4BA 4GKJJ 4YR2A 2VA3A 4CLFA 1D8YA 4C9DA 4K4YA 2IHR1 2R8HA 2DNGA 3CJ2A 3JQJA 3EJMA 4DV3F 1S0MA 4DDFA 2J6SA 4WWSA 3HCXA 4DN0A 1H98A 2ZITA 3OT9A 3HVRA 4WFZA 4RW7B 1HWKA 4W4MA 3IR6B 1HQUB 3SFGA 3Q8PB 4QCLA 1YBTA 2ZD1B 3BKTA 5HATA 3CF5Q 3ETMA 1UFLA 2AT1B 2YNHA 3UI3A 1DY3A 1JXVA 2V4JB 4WYLA 1VDHA 3LPEA 2YNGB 3M4XA 2DNMA 2L9WA 3CDWA 3NS6A 3CJKA 3LWLA 4ECTA 3A8JA 2BBEA 2F9DA 4B9TA 1NEEA 1S1WA 2BABA 1SKRA 2ZZMA 1IWGA 1HW8A 4DEZA 2RHSB 1RBLA 2VFUA 3CCRS 2E5JA 5D0RA 2LVWA 3BGRA 1N8RT 2QGFB 1XNQJ 1X5SA 4LF8F 5B7WA 1RE1B 4U67Q 1U26A 3KK2A 3D3BJ 3KKFA 4XAKA 1N33F 4ZLLA 1X4FA 3X1LB 3EGNA 5KFKA 1SQEA 2XHWA 3QAUA 4I2PB 1ACMB 2BZ2A 1AW0A 2F1FA 4OHXA 1U6ZA 4ILMA 4JI8J 1JWWA 3HHLC 4OX9J 5GADU 2WONB 1IR1A 2OPQB 3IWLA 1N5TA 2WOMB 4MFBA 2XZDB 1M5SA 3CCVS 2HZVA 2IVMA 2GGPB 1U1NA 4JYAJ 4WZQA 1UJ5A 3FGVA 3UDCA 2CKWA 3L7UA 4ZJLA 3BDPA 1XK8A 2ZVSA 3C66A 3G96A 4LF6F 1IQTA 3M6WA 2XQCA 5T14A 2XO7A 1B64A 4WXOA 3TJAA 2DHAA 2YQ1A 1PYSB 5KFXA 1TK0A 1FRKA 1WF2A 3VV2B 4FBTA 3HFKA 3VAHA 1VI7A 3B54A 3DHWC 4Q2LA 1OQ6A 3PYDA 1V3SA 2KZMA 4RNMA 2VDIA 2NXJA 1NDCA 3T9NA 3OUYB 1H0HB 3LP0A 2G0JA 4WFNQ 1E6VB 3MMAA 3D67A 5F8GA 2WSFC 3M6UA 3MZIA 1NMEB 3KK3B 1U6FA 2VC0A 2FVSA 4OYMA 3K7RA 3MAAB 5KT2A 1GK8A 3QBCA 2XGQA 5LMUJ 1GQEA 5A8WA 3L9ZA 2M9KA 3DKDA 3CCQS 3V81B 3R6LB 2YPYA 2DGUA 3PYFA 4KE5A 1S97A 1IBCB 1ZPVA 2C2OB 5B09A 2H4YB 5IV3A 3M32B 3OFEA 1NO8A 5KFYA 2VIHA 4WBFA 4NYPA 4OX7A 5LXRA 1CULB 4OYXA 5A8RA 2H9ZA 2P6SA 3PHTA 1RKIA 4IKAA 4DN9A 3CVKA 2GHPA 1F3VA 1AZSA 2E5GA 3A3PB 3HVTB 4PCQA 3DHXA 4DJBA 3SYZA 4P73A 4AE5A 4PR6A 3MURP 4ZLJA 3IP0A 4NYZA 2B9WA 3NGDA 2DIVA 1Y00A 5F8HA 1KLMB 2W9BA 2MKIA 1N5QA 1MROB 2MGZA 1L3VA 1P9QC 5I3PA 1K9MT 5KFGA 3CB4A 3SQOP 4QWEA 2HFUA 1LQ9A 5A6PA 3D6HB 1BC6A 3CDEA 4TKTA 3KLFB 1RABB 5J1NA 2W25A 3PJXA 4NE9C 4YR3A 1GXUA 2NPIA 4ILRA 4LF6J 3PACA 3C6TA 3PZPA 3BO2A 1D9AA 5K5MA 2BOPA 4RR5A 1BE4A 1HQUA 3JAMY 4X4RA 1A9NB 1R6VA 1GXLA 1WI6A 2KT5A 3D2WA 3CXCR 2R2SA 4NRTA 5CCMA 4OMFG 3SEOA 3LAKA 3ET6A 1RWUA 4LFBJ 3KUEA 3CGIA 3T6JA 2RDIA 3ZFVA 1L3UA 4B3TJ 5LM7E 2CQDA 3M1VA 2RQ4A 4O3NA 4OI4A 3I4PA 1S1WB 2IBOA 1UPMB 2OUGA 5KG4A 2GVDA 3FBCA 4DV2F 1TAUA 3CCSS 4NLPA 2Z4PA 2DGTA 2LDYA 2W2MP 3D1HA 5A0YB 3QZ7A 1B0TA 4Z37A 3GV5B 2W8LA 4A8KA 1ZYQA 4JI7F 4LFCJ 2HZCA 3CCJS 4QZVB 5GADI 2XSFA 4P10A 1YK9A 2IA0A 3T1YJ 1NK0A 3QJJA 3R5JB 4CLPA 3LTOA 3MCOA 1R0CB 2R7SA 3UNYA 1PJ6A 1NDLA 3MF5A 4QU7A 2BW2A 3KLIB 4GVBA 2F40A 3MM8B 3OHBA 3FEZA 5L1JA 2HEKA 4CH1A 2ZH3A 3MR2A 3MPUB 2NS1B 1HWIA 4FYXB 2HBQB 1U1PA 2KN4A 3HHLB 1JXLA 2QG9B 3KXDA 1RHJB 2DNQA 4XK8C 4WP3A 1NJWA 2FIUA 2DNLA 4BS2A 2DR6A 1TUGB 1HL6A 3H20A 3ZNUA 1CS4B 2P5VA 1HQEA 3FRYA 4RX6A 1HMVA 2ATCB 3AH6A 2B7CB 4FS2A 4JI4F 3DC2A 1N5SA 3W65A 4KJIA 2RQKA 4B08A 1IKYA 1NDKA 1HFEL 2DNYA 4RBVA 5HLFA 2LXFA 4K2XA 4OI0A 3KNAA 4OV6A 1NNDA 4RBTA 4YB5A 3QT5A 2QLBB 1TVRA 4ZVHA 1L3SA 3LUYA 3NNAA 1Y7PA 3MR6A 4C11B 1N4LA 2UXDJ 1T11A 4JI1F 3LGHA 5HQ8A 4KRWA 2CNKB 1YQHA 1HWJA 1RAGB 3C15B 3MECA 4A8FA 4TLQA 5C42B 3NBPA 2HQ3A 1U25A 3JS9A 1YBUA 3CJ3A 1IBKF 5HMYA 2KT2A 3EXCX 4WTYA 1FRMA 5K9FA 4YY3F 4DS4A 2ATLA 2YQ3A 4ED7A 1FA0A 4LFCF 4M5DB 2Q79A 1PAEX 4GVBB 1JJ2R 2QLJB 2YX4A 3FUYA 2OO4A 3CT9A 3QNWB 2ZH9A 5HROA 3OFHA 1RP5A 1VRTA 5E7OB 4ZVRB 1NAQA 2HHSA 4YHHF 1WG1A 4U7CA 3TQ1A 2HRYA 1AROP 4NASA 2MY8A 4ZITA 4FBUA 2FB0A 4RWXA 2P2CB 3I9V9 3IS9B 5LSRA 5GAHU 2M8DB 2IBKA 3BYPA 4ZCIA 1S59A 2D3UA 2CIMA 3AJ1A 4BWMA 4EGLA 2H5JB 3BN4A 3V6DA 4O44A 3PR4A 7FDRA 5DG7A 3ZXWA 1RWKB 4LRCA 2FZGB 5HJYA 3BM7A 1SL1A 1H3DA 1IKXA 1WOSA 2LU1A 3UFCX 2DRAA 1LW2B 3HD1A 3CPWR 1IKVB 4X4PA 2DIUA 1HPZB 4FNIA 4JI4J 2PSZA 4RJVA 4O0IA 2APOA 2OFHX 2PA3A 2VG7B 2QMXA 1N0UA 2R2TA 4IFYB 5ETOA 3DLHA 3UVJB 4Q0BA 3KJNB 3DRRB 4MYTA 1ZETA 1JX4A 1RCXB 5L9NA 1EP4A 2V8PA 2BA9A 4NL5A 2V2ZA 4G65A 1MMNA 4FZVA 3H25A 1TR0A 1UVMA 3EXYA 1EZZB 1HNVA 2XGPA 4JI1J 5DDPC 5D8HB 1N48A 2YY3A 2NZ4A 3I5AA 2B4OA 3E01B 3CD5A 2DRDA 3DRSA 4DX5A 1RUSA 1BUXA 2KXFA 2O1PA 3X3UA 4DFPA 5KT3A 1ZZNA 3ENVA 1IBKJ 4CRJA 4DSIA 3G6YA 3PKMA 3JTNA 3MEKA 4YY3J 4J9LA 2FVRA 1MU2A 4DSLA 2OP5A 5A76A 2M4MA 4O23A 3IGNA 1C2PA 4ZPTR 3SQGA 3NXZA 5DDRC 1CQNA 3K5LA 4NLQA 5ADZA 3PVXA 1U6BA 3M9NB 3H5SA 1E6VA 3I9ZA 4F25A 5DG8A 5DLFA 4GC6A 2HHWA 2PA8D 2QL9B 4NEYA 1FEHA 3MUMP 3KHRA 3GCWP 2DNNA 4P2XA 2A6MA 2LP4A 2ZD1A 5IC4B 5IQ6A 1S4EA 3MM9A 3LANA 5HMWA 4R5PA 2ZH8A 2HRUA 1NK8A 4DL0C 3R3TA 1FERA 4WCEQ 3MMBB 3S01A 3W7BA 3MCMA 2VZ9A 5LMNF 3QGGA 4KY3A 3TAMB 3Q8RB 4LSLA 2NCKL 1GX6A 2I0XA 3UDEA 1RTHA 2MZ1A 1X9MA 3T5JA 3P96A 2UP1A 4K0KF 2R42A 2V8VA 3NEKA 5J2NB 5J2NA 3HZEA 2DKOB 1H2VZ 3MPVA 1FWKA 2FJEB 5H9EJ 4ED3A 1S1TB 2PIIA 1CC7A 1QVGR 2DNKA 3B6BA 4H4MB 3VF0B 3OW2R 4LR7A 1U1MA 4YDXA 1FRJA 2FJVA 2OIHA 3P5TL 2Y3YA 4EYHB 1OSDA 3IBFB 1P1TA 1SC1B 2JH3A 2ABYA 2AJ2A 4PEOA 3UCZP 3RB0A 2DO4A 1UWBB 3MCNA 3D0GE 3VVTA 5EN1A 4HTIA 2J6TA 5CYJA 2JEFA 4CLWA 1MWZA 1S6QA 4J9NA 2JLGA 2MEWA 1K1SA 1U1RA 2DHGA 4IO9Q 2AJQA 4URQU 1U09A 5CCLA 2X1GA 3MEGB 1IBLF 3OV7A 3R9LA 5ETVA 3ENWA 3PM9A 2V4JA 4QW8A 1OY9A 4TU8A 1HNWF 2KM8C 1GNKA 1LWFA 3BBBA 4O4GB 3A4TA 2CQIA 4HKQA 1T0TV 4UT4A 1UCNA 2VBZA 2H5EA 2YXLA 4I2QA 3IN5A 4C8OA 4K4WA 2ILYA 5D4LA 3OUYA 1Z2LA 4L3NA 1DAXA 2NXEA 5I42B 2J9DE 2QFJA 5I42A 4LUBA 1WSVA 4ZHRA 2G1HA 2BJ3A 2QLWA 3MTJA 4PPDA 1RT5B 3D6FB 2CWKA 3VAKA 2XS2A 1NKBA 5LMNJ 1TK8A 2QSFA 3F56A 2XY5A 3W9HA 2RQCA 2UXCF 3RW6A 3IR7B 4DPXA 3FQKA 2JZ5A 2JNJA 3GZ7A 3RAMA 4Q5VA 3L7OA 1ZM9A 2ACYA 3WHIA 4BC7A 5JJBA 5ITHA 5I3UB 1RDRA 3OLBA 3QT6A 2HW3A 1TKDA 2JVRA 3LO3A 3VZHA 1KEKA 4CLUA 1VGYA 1S72S 1TL4A 4I1TA 1M5OC 3H0PA 2Y8WA 1H73A 1VS3A 4R25A 4OI1A 4B3SF 2E7WA 4WXWA 4F0HA 5BYSA 4EO6A 2DITA 3J7A1 1O51A 2YH0A 3PCOB 3POTB 2DY1A 2VF3A 4LIWA 4MTPA 4RO0A 4DV7F 3R2DJ 4ELTA 4ZCMA 2CVIA 2FLLA 3DOLB 5LSOA 4ERDA 2HVIA 5HVFA 3TEGA 3OTCA 3EPGA 4ECZA 3M6XA 4PKDB 4KB7A 1DLOB 4BDPA 1UW9A 2ZHOA 4AL5A 2GMLA 1B99A 3TA0A 2MB0B 3PW2A 1G4CA 1IKYB 1AA1B 1T02A 4N8NA 5GAGI 5GAEI 1T8EA 1HNWJ 5F8JA 2R7XA 2MZQA 1QD1A 3HKZD 4RW9A 1SQFA 5IWAJ 2D3OR 4HHHA 1E6YA 3PW5A 2FY1A 2WVCA 2I6WA 5E41A 1YWXA 4RUAA 4NLOA 1BLUA 3D1OA 4GKKF 3H7HB 4HHJA 4FXDA 3FBBA 4UQGA 3FSXA 2KYXA 1RT1A 3G6XA 1HBOA 1NSKL 3M2UA 2KFZA 2BUNA 1UW4A 1SJQA 4HH1A 4OLOA 2B43A 2IFXA 2CUYA 3RZAA 2V8HA 1ZAVA 1P8GA 3H42A 1KC8T 3KMQA 1SL0A 5DDQC 1L3TA 2DD8S 1RWVB 1S1VA 2R8KA 2QFIA 4B3SJ 1M90T 4LSZB 2DB1A 1R8PA 3EZOA 3MM8A 4NLRA 3AXKA 3THPA 3DI6A 4BC9A 3KWMA 4P75A 1HNIA 3TZWA 5DQHA 2CAJA 2I9SA 2RJZA 4GC7A 2JSXA 2HBRB 4DS5A 1JNRB 4CO0A 4MIWA 2ZJRQ 2L41A 4F4XA 1Q8BA 5HL7Q 2V5HG 1IKVA 1J27A 5KG0A 3TX0A 1RTJB 3DLBA 4Q7AA 4C8YA 1FX2A 4MKBA 3HO1A 2YNIB 4ES2A 2NYIA 1H38A 2DNRA 1WJ9A 1V9OA 1JJHA 5KT7A 1H7XA 3DRYA 5D0GA 5IWAF 3ETOA 1T05B 4M5GA 1SV5B 1RT1B 1WUUA 2VG5B 3F44A 3IM8A 3QSIA 2N82B 2XMWA 4O3SA 2BKOA 2DBBA 1R8BA 5KFTA 3CD0A 4WFBQ 4GKKJ 5HQLA 1UMJA 5HROB 1FKPB 2ZDPA 1RU1A 2HVHA 3EVMA 1WDTA 4X62J 2H65B 3BKFA 3QGHA 4JOUA 5B0DA 2HGNA 5KFIA 1R0AB 5K8PA 3NGKA 4I7FB 1S6OA 1F3FA 2BJEA 3D68A 3FSIA 3M9OB 2MQ8A 1Q78A 3GWCA 4F4KA 3BN7A 2DVIA 2XLKA 3B78A 1IUJA 3BJYA 4ZA1A 4UOFA 4S0MA 3KLGA 3J7AN 1TV6B 3PO4A 2XMTA 1TTHB 1OY6A 3DLGB 2AF6A 2AMCB 3C14A 3C14B 3MTKA 4YS2A 4KV8B 4USHA 2JVOA 2JHEA 3M8SA 3MGJA 3W9IA 3FFIA 4FKXA 4DQQA 3TNVA 5ETLA 2OHDA 4OYIA 3MUVP 3R5CA 2KH9A 1K44A 4C3MA 5EWGA 1MLAA 2VDHA 2WVBA 4AL7A 2DNZA 4WU2A 3B8HA 2ZHAA 2HIYA 3MECB 1LNQA 1U45A 2E1PA 1NJXA 3PFEA 1SJFA 3FQLA 3CMAS 4NCGA 3M2VA 3C2PA 3T3FA 3QRRA 4C11A 3W8GA 2MXYA 3PIOQ 3THTA 4CNYA 3AY0A 3QO9B 2D1CA 2DHHA 4I64A 1KQKA 4ED8A 2CPZA 2KHDA 4RU2A 1DQAA 2PE8A 1OMSA 1QAXA 2P8IA 3HSGA 2OPSA 3KLIA 4F4YA 4ICLA 1PAUB 3BR8A 4BHQA 4LF8J 2FC9A 2XMKA 5HQMA 4QIVA 4BLGA 3JSMB 4ECRA 4GRSA 2DEJA 4K4XA 2N3LA 2DHSA 3AQOA 3C6TB 4M8LA 5IT0A 2J5AA 4QWCA 1CJVB 4DR4J 3GJQB 4DR3J 3T19A 1SH3A 4O4GA 5LSLA 3CJ0A 2L9NA 5CQGA 3TI0A 5DQIA 4JBCA 2J76E 3AD7C 4RW4A 4ZCLA 3ILJA 2QN6B 3BGOP 1Y3JA 3CJSA 5IFMA 4MKVA 5DQGA 2VFSA 2LEAA 1PJ5A 3M1VB 1JKHA 2YWWA 3CJTA 4KSEB 4V19X 2NZCA 4I6AA 4MMOA 1CBKA 2ZFHA 5KFWA 1UZHA 2FJBB 3HX9A 4U95A 2BQ3A 3WX4A 4P2FA 4ZJQA 1TL7B 4WJBA 3UPFA 3RJMB 3QFWA 1XMOJ 4B3RJ 2GC8A 1T03B 3VAFA 2WZ1A 1FK9A 4CH0S 1TK5A 1RHMB 1SIZA 3GCXP 1HQ2A 1UZDA 4NLXA 4OQJA 3MI7X 3NCPA 3O2IA 1LWEB 2UV8G 1RWNB 4R0JA 4CP5A 4UTGA 1N0VC 4IRCA 1HYSA 1S5ZA 2V68A 2QLFB 2QLXA 2EFPA 1F60B 5THWA 5FDLA 1JLAB 1RLCL 2K1RA 1J5OB 3VGVA 1F1BB 2FYXA 4QW9A 4DF8A 2EKYA 2N7YA 2PO4A 3I4HX 4PQAA 4USIA 4ZP6A 2BJ9A 1KLNA 4USWA 4I69A 1Q4RA 1QUVA 4A8OA 5E2QA 3KK1A 3W5XA 2HURA 5HANA 3CCMS 1I1GA 4P7VA 1Q81T 1NDPA 2G2OA 3KOAA 2V69A 3VAJA 2HG4A 2JJ4D 4YN3B 4XPEA 2ZJPQ 4HACB 2FJDB 3G6VA 1I3OB 1Q79A 3GPAA 4NA3A 3PG9A 4N76A 2CQ3A 2HS3A 3KLEB 2E5LF 5DETA 1UPPA 2QEXS 1D8ZA 3N6NA 1SJ4P 5AXNA 2XS5A 4QWDA 3NKYA 1VQ5S 4B02A 1REVA 2VFVA 3CJKB 1VQNS 3MPYA 2KKHA 2W2PP 3M2VB 4Y00A 1LWXA 3KJVA 4DV4F 4FYDA 4WK1A 1OYDA 4M5IA 4O4RA 4HEA9 2FLPA 4RUBA 4IG3B 5KFRA 4TY9A 3FCWA 3IXQA 4ZK7M 4FF1A 5LOQA 4FXWA 2YX1A 3WZ0A 2D41A 3FJ2A 1ZA2B 3OBIA 2ADCA 3MAHA 2VFTA 2NSCA 3C16A 2AJ4A 1FX4A 4Q8FA 3TJ8A 3MM7A 3DGPA 3UVJA 4Q0BB 8AT1B 4C8NA 1Q16B 3J80U 2Q6BA 2QO3A 4HH0A 3JQKA 1S76D 3I31A 3M2RB 1X9SA 2L48A 2DCUB 1URRA 3GYXB 1ZH5A 1EETA 1NHKL 3BO3A 2EBGA 3DLKB 3GJRB 4YOEA 4QOTA 1C0UA 1U0HA 4EI2A 2UUTA 4J9UE 3Q8SB 3A8EA 2LECA 1PJ7A 4I56A 2GQQA 5EWEA 4IR1A 1HHQA 5HBMA 2HNYA 3CCZA 4LR8A 2YH1A 1VBZA 1BQMA 3GIRA 1ROFA 1RT6B 1YIJS 2XZTB 3BGUA 2BX6A 4DUYJ 1S1UA 4JI2J 1U24A 1YJRA 3ZTOA 4EZ9A 3TOQA 1RJJA 2ZM6J 1F2HA 4IH5A 4JI8F 1RQ0A 2E5LJ 2RH3A 3U27A 3PRBA 3TVKA 1N56A 1LV5A 1EQMA 4X4SA 1RAOA 1EHWA 5IT9U 4JYAF 2EFQA 4LR9A 3NOCA 3ZNJ1 4CYUA 2R8JA 5KG6A 4EO8A 3ENQA 3TAMA 2H3EB 2PMHA 4DV4J 5KTQA 2N7CA 3TO8A 2HFVA 3E01A 1A6LA 1TU0B 3HHDA 1OSCA 1Y9OA 2PT0A 4DPYA 3EDRB 4NZ7A 2IA6A 2BR0A 3PEHA 2RUGA 2KT3A 1RWMB 2PC6A 1LW0B 3OD2A 3JTPA 3MFIA 1TL3B 1IN0A 2AIRB 4JV0A 3N5FA 2M5YA 2ZBIA 1SQGA 4LF2A 4DXLA 2V9WA 4ZS6A 1S6PB 5LMUF 2HGMA 1X4EA 2MLZA 5GMEA 3CMQA 3IRXB 4MT1A 1NK5A 1QVFR 1FVSA 1FDAA 3G4SS 3RTVA 4DQRA 2CJAA 3KLGB 1FRIA 1LK7A 4P71A 4P72A 3PO5A 1AXQA 1QUPA 2BOAA 3R5BA 4DL4A 2UUAF 2AYGA 3H98A 3IS9A 6FDRA 3QGPA 4KV8A 2XI3A 3U1LA 3OR1A 3PX0A 2CG4A 1WACA 3E2EA 1KR4A 1Z2ZA 4XIUA 4B3OB 3OPKA 5K14A 1KD1T 1PO6A 5DZ6A 1HBOB 1WD6A 1EJ7L 1HNIB 1Y5LB 4DSKA 1F9HA 3K5PA 1ZPWX 3M30A 3HVWA 5HN0A 3RB3A 1S6UA 4DX7A 3RGIA 5M2PA 1U48A 4WP9A 2ZM6F 4E98A 1U2RA 4D3GA 3JSRA 1XMQF 1JLCA 4MJKA 2Y1IA 1UVLA 1DFDA 1KSPA 2Y0SD 3GIJA 4RW6A 4RW6B 3ZTPA 3G8SA 1VLOA 3G8QA 1Q7LB 1XERA 4KO0B 1TKZB 3PV8A 3ICLA 4DV0F 1FKPA 1NJIT 1GTEA 4FKYA 4RZRA 1ITPA 3W64A 3R5AA 1EARA 1QTNB 2MSSA 3HD2A 3BF4A 4B9NA 1LKZA 4NZ6A 1CQMA 5E3QA 4F3MA 4ANDA 4DR1F 4EFAC 1XWLA 2DRBA 4NLDA 4OJ3A 2QZ8A 2RE1A 5D0EA 2EFGA 2HGLA 2C3MA 1VQ6S 5DG9A 2RF2A 5ETRA 4LFBF 5B0BA 3KFWX 2IRYA 1YJWS 4B3TF 1Q8KA 3I5BA 4ZIVA 1CSJA 4OZ1A 1PIEA 1TL5A 5ETNA 2EC2A 2PEHA 1KOHA 1SVDA 2DNOA 3CDUA 2I8EA 3OR1B 3IM9A 3QT7A 4NLVA 4DV2J 3DM2A 1X4AA 3QIPB 4G1IA 1JLGA 2YBVA 1X8DA 3D54A 4ZKAA 4DL7A 4EZ6A 1RTJA 4JI7J 3H5UA 2UUAJ 4RNFA 1S9GB 1DLOA 1RAIB 2PMWA 1DURA 3Q86A 4URSA 4C3KA 1IKWB 3TRGA 4C98A 3V81A 3HM9A 4CM0A 2ZOFA 3UE2A 4PPZA 1JLEA 3G8TA 5EUHA 3N01A 5HP1B 3K2YA 2CQHA 3CJRA 4KGKA 4RL1A 3MFHA 1RI7A 5KFHA 2RB7A 1U8SA 3I5CA 1FFSB 3G86A 1X5PA 2ZZNA 2G9OA 4FNHA 1Q5VA 2G0IA 6AT1B 2QJ3A 1XMQJ 1DZ5A 3FK4A 2ZZTA 1GX5A 2PI4A 3BSAA 3TAQA 4LVOP 3N0VA 1H74A 1TMJA 1VC6A 3Q2SC 1V6HA 5T41A 4DX8H 4DV0J 3EUNA 4O0NA 1U49A 2MKSA 2DPIA 2K8GA 5J2QA 3WBZA 1HHSA 5L1LA 1S99A 1TFYA 3HSZA 3T1AA 2HQIA 2Z57B 4EYIB 3DI6B 3NS7B 2EWHA 3K5NA 1N34J 3QJLA 1F6TA 5KFVA 4PQUB 7FD1A 3BSNA 2VONA 2HQCA 2KXHA 3WC0A 2PN6A 2CJYB 2OPRA 1FTRA 1KDNA 2BANA 3ILLA 3W2VA 1C0TB 2G2YA 2KG1A 4KKOA 3UWTA 1BY9A 1RLDA 2OD6A 3BV8A 1YVFA 2AYBA 3LGMA 3MPDA 2BW7A 1RK8A 4OYZA 2KXNB 1X9WA 4J7CA 4F3OA 1IQZA 2AJ0A 4I67A 1IM4A 2ALYB 2HAIA 3D28A 2K7JA 3VGTA 1KNZA 2Q66A 2CQGA 1PYTA 1H6KX 2VD3A 2ZBQA 5KG1A 2QIFA 3W2WB 4OZJA 3N6MA 3KHHA 1QSLA 2VA2A 4B9SA 3TX8A 2XY7A 2VG6A 1U2CA 1NKCA 1Y5IB 1T9XA 3HKWA 4TVAB 1V5IB 3Q8VA 4DX6A 1GH8A 1DTQB 2FLOA 4YHHJ 3GV7B 1AFJA 3CSKA 3TA1A 2OGUA 2HVEA 1NPKA 3A8IA 3P3DA 4RPFA 3GR1A 5GAEU 3PX4A 1VISA 1RYRA 4LF9J 1VRUB 2UVRA 2GJFA 2HWTA 2HQGA 3DLJA 3M2RA 3MOJB 5G4DA 1JNZB 2WAQD 3OVBA 2VBWA 2WCXA 4KFBA 1TZ0A 1EX8A 3NP5A 5HMXA 4IOBA 5K8MA 3H40A 2D3ZA 4ANCA 4P9SA 5E3AA 1KONA 3EGZA 5L1IA 4WKYA 3SCJE 3D3CJ 3GG0A 3GMGA 2MQQA 1RWPB 4JI6F 4A8SA 4DFMA 1ZS6A 1FK9B 1XR7A 5CHCB 3CE8A 2UVWA 1NPRA 2WBRA 2LQJA 2WVDA 4RKUC 5CAAA 4DF4A 4WF9Q 1D09B 4ZHRB 3OXFA 2MKHA 1F5AA 2BE7D 3KLEA 4U6PA 3HJVA 2MTLA 3QQCD 5DJBA 4LF7J 2YNFB 1ZM2A 1ZZFA 4KT0C 2E44A 1EP4B 1TQLA 1L3KA 2HQFA 1JLAA 2K1RB 3ENAA 3RYLA 2BJ1A 2HQDA 3AJDA 4OJGA 5KFPA 2ZH6A 3NGRA 2ASJA 4USTA 3D0HE 4DPWA 2SXLA 2QYGA 1KHVA 2AEJA 5G0RA 2Y1JA 1N6QB 5J2PB 3CULA 4MK7A 3GSIA 2IVYA 3AA9A 3HSJA 1TUVA 4NRUA 4Y34A 5F0WA 3ZZPA 3TARA 5FJ4A 1T9TA 1TAQA 1MMLA 4CM2A 1CG2A 3OR2A 2C22A 3T9ZA 1B7FA 4NLUA 3GTYX 4KHRA 1AZSB 1NBEB 5D4PA 3RBEA 2JRSA 1K0VA 4G6VB 4HT7A 4F4WA 3TVYA 4J9RA 1SC6A 2KDOA 1Y5NB 5M2RA 2RDJA 2J7UA 1TMMA 1XMBA 3TANA 1URNA 1FFGB 1U7LA 2XSJA 3EYZA 4LFAF 2IVFB 5EGYA 2DTJA 2UXBJ 1CJUB 1MW7A 3IWNC 1IM6A 4U96A 2XYHB 3TEHB 3DLGA 2RIJA 3O1LA 1U8WA 1YX2A 3MHYA 3PYEA 4TNOA 5EWFA 2IRXA 2WB4A 2YNHB 2J0WA 3N28A 5DZ7A 2LEPA 3IG1A 3SMZA 2VC1A 4M63A 4DHVA 4ECWA 4ED0A 4K0KJ 1DTTA 1PSDA 3CIMA 1UVKA 4OV1A 1WG5A 4DR2J 1RTHB 4OYBA 1Q8LA 4RW7A 4ECVA 5KFFA 1MWQA 1X4BA 1TL7A 5DGBA 4ZJOA 1OO0B 4ZVTB 3MCSA 2OELA 4NMLA 1HHTP 3NMAA 2VBYA 4C7QA 3PR5B 4V19J 1SBRA 2OSQA 3C15A 3DRRA 4IG3A 2VQFF 3V6JA 1CJTB 1O5JA 5CXTA 3QYYA 1WEYA 5T7LB 3T6BA 5CD4A 1SKWA 4LF7F 5A2QY 2YTCA 4QR1A 2AX0A 2COLA 1APSA 2F4FA 2UU9J 2CQ4A 3NCRA 4TLRA 3K58A 1B0VA 2I1RA 2XYGB 5LJ5Y 2KG0A 1T05A 3W8PA 2WOMA 2ASDA 1N36F 3AXMA 2B8QA 5BYQA 2AEFA 2EK6A 2QL7B 4FF3A 1NZAA 3TUZC 2R3VA 1X60A 1UWBA 2NSBA 1WC4A 4FYYB 4H54A 5B0AA 4X4TA 2G1DA 4Q8EA 2W9AA 2LCWA 3MMJA 1JQGA 4O44B 4DBQA 4DUZF 4QWAA 2MY7A 4PYDA 2R7UA 4CLYA 3N6LA 3L3CA 2P6TA 1PBAA 4N8OA 4ZPVR 4TXSA 2I2YA 1JLGB 1Q7YT 1C1CA 2XTJP 3D9BA 5HI7A 4MIAA 1FFWB 3G9CA 1DHMA 3ZTQA 2ZE2B 2VPWB 3PEJA 2F8HA 2FY8A 2KVQE 3DRXA 3SSSA 2ZC3A 1HWUA 3TA2A 4AT1B 2OH2A 1V3ZA 1EKSA 2CNNB 1ZM4A 1TP7A 2DXFA 2LFVA 3MOZA 4NLTA 9RUBA 4DR2F 2WBMA 1K8AT 2BJ8A 4ZPAA 2OEKA 4MYUA 3THVA 5H1SV 2GV1A 3CO9A 4MIBA 1W25A 1K73T 1FDDA 4U7UK 5K20B 4DV7J 1TELA 2WHOA 2KU7A 4I6WA 5C2CA 2VQFJ 1NKEA 4CH7A 3TAPA 4NLYA 2FVCA 2IC3B 3D1QA 3ZTSA 3GU0A 1G2EA 2VKZG 4H4OA 4I0WA 2OTJS 2J9CA 3ILIA 2HLUA 2MDAA 2XI2A 3RBZA 5AT1B 4OZLA 3G82B 3ULHA 4L75A 2RSQA 2CNLB 3CIZA 3CJQA 3KG1A 4PRFA 3IRXA 2MZSA 2HWIA 3C46A 3JYTA 4PABA 1H72C 2W2NP 4PWDA 3DU6A 2HHXA 2CZ4A 2A18A 1FKOA 2C2MB 1YG0A 2M8HA 2J8SA 3RG6A 2Z2ZA 4DSEA 4OI3A 3L4BC 5HO4A 4F3QA 2H5IB 3TYTA 4QYRA 2UUBJ 4U7UD 2HAFA 2MZTA 4XTTA 4RNOA 2JLFA 3QSYB 1IWAA 4MK8A 3Q2TC 2LQ8A 2N4DA 2QMUB 2RS8A 1YTYA 2ZKUA 4FPRA 5MAOA 2AJ1A 4DFKA 1S49A 4QIEA 5F3ZA 4OZ2A 3DDNA
chains in the Genus database with same CATH topology
1I6JA 3MAQA 3R1LA 2WTFA 3CCTA 2FD2A 3M30B 4IG0B 3FMWA 2HHVA 1JLCB 2RF2B 1R43A 1OPZA 5SUHA 4PXCA 5T7LA 3EX7B 3H2LA 5E5NA 5L38A 1Q86T 5DS7A 5DM6Q 3RR7A 1RT3B 2W4PA 2DO0A 4IDKB 2QSWA 2FVQA 1N54B 3UQSA 2R7VA 2ZH1A 5A0YA 2XS7A 4MH8A 2JC0A 3QIPA 4YB7A 3T5LA 1SJ3P 3CCES 4QQBA 1M5PC 2VOOA 4ED6A 4R8UA 5C25B 3RRGA 4CCHA 4A4JA 2WB1D 1XR5A 1RT4B 2HNDA 1Y3KA 2J0QD 4A46A 4EU0A 5L39A 3DNCA 1RTDB 4FF3A 4OZNA 5KOWA 3KLVA 2KFNA 3CCWA 2AYEA 4B9VA 4NLGA 4ID8A 4F02A 2W4DA 2K2PA 3MD1A 4PXEA 2L08A 5HLFB 3I82A 3DOKB 2UUBF 2HHQA 2BM1A 3CC2S 2VPZB 2RKIB 1E6YB 4Y2CA 2UV8A 4X62F 2YKMA 2RD5C 3FVYA 2VOPA 3P6YC 4KAIA 2NREA 5GAHI 3QAEA 2C3UA 4IRDA 1XEZA 2IMOA 3DOMA 3T5HA 2VPXB 5GMKa 2O3DA 1J5OA 2IMWP 1X7VA 1CC8A 3NAIA 2AX1A 4TQSA 3K5OA 4FXVA 1UJ4A 5KFAA 3IWXA 3UNGC 2VB6A 3QWUA 4DFJA 4OIXA 4G1QA 2RVJA 4Y0FA 2QRRA 2CYYA 1Q8IA 4MAKA 4NLWA 3MMCB 3HK2A 2ZDOA 1KTVA 3DXSX 4PG6A 2L3MA 3KLFA 3K5MA 4DLGA 1DARA 1WWHA 1QM9A 4WK3A 2LA6A 1IR0A 2DT9A 5D4OA 2M88A 1BQNB 1UL3A 1HBMB 1XR6A 3KJVB 5DGAA 4NCBA 2DGOA 5LL6d 2OAUA 5B0FA 3F41A 2MHNA 1VQMS 2YKPA 2J9EA 2PD1A 1HI8A 2W7PA 1VRUA 4MFBB 5KFUA 1S1XA 1P6TA 4TY8B 4TY8A 2BQUA 1NH7A 2YKOA 1QSYA 1HNVB 3SCLE 2GCFA 2D9OA 3Q8QB 2AYMA 3FZBA 5A8RB 4CZCA 4W90B 2VUGA 4QR0A 2NUHA 2Z2MA 4CNZA 4IOAQ 3MM5B 4AQYF 2CDQA 1ZOTA 3AAWB 4DR4F 3L95X 2P9EA 3OJSA 1RA7A 2ROGA 4QPXA 2CQ2A 5CH7B 1KLMA 5J2QB 4KFBB 4QU6A 4ZVFA 2LKZA 3M05A 3CCUS 4CT9A 3RB6A 2C2EA 2A2DA 3QPIA 3POTA 2X1BA 2FJAB 1YRXA 4IH7A 2OPRB 2FHJA 4B3MF 1XMOF 4B3RF 2DGSA 4DOZA 4JI5F 4R5PB 2JL9A 3VAGA 1HI0P 2JX2A 5DRKA 1UVJA 4HL9A 1RT4A 2HNDB 5KG7A 4IUFA 1JKHB 4ZPWR 3Q0AA 3W2WA 2PI5A 4MKAA 3IBWA 2ROEA 2E7XA 4K4ZA 3BSOA 1UETA 2GJ2A 4HT5A 3OFFA 4DQPA 2R7RA 4J9OA 2OPSB 2C2DA 3N9UC 2MKCA 1N5YA 2ILZA 3QO9A 2HIQA 4ETZA 1NK4A 3ZZYA 2X1FA 5FDLB 4ED5A 3VCDA 2B5JB 1TKTB 3BZQA 5L1KA 2L9DA 2BDPA 4RW8A 1VBXA 2BANB 3VAIA 4MK9A 1RYSA 5LJ3Y 1SKSA 4PG4A 2J6UA 2B6AA 2EG2A 2BM0A 4ES1A 3P49B 1NH8A 3M9MB 3C6UB 3LGNA 2C3YA 4C97A 3T5KA 2NXUA 1QAIA 4F50A 3O8WA 2NQPA 1SUQB 3I96A 4ITSA 4D3HA 4JI3F 2QMWA 3O44A 4LSNB 3UD3P 1BGXT 3LALA 4HI2A 1PILA 1RT7B 4ES3A 2EFNA 1VMBA 2JEJA 4NXMF 4Y2KA 4IFVB 4AXJA 3IR5B 4JUZA 4DMZA 2K7KA 5J2MB 4X4QA 3LWMA 3NCQA 3JSMA 1JXEA 2KI2A 3HXMA 4YFUA 3CDBA 4CO5A 2BVZA 3DXBA 3GB0A 3I56S 4XO0A 4DQIA 4DUYF 2C42A 4JI2F 3V5RA 2W9CA 5EX3A 1FDBA 2XNRA 3SCIE 2MKJA 2PMZD 5F9LA 2AJFE 4KPYA 2MQPA 1S7HA 4URGA 3BQ2A 2QV6A 4DLEA 1MSWD 4UUWA 4Q44A 3MEEB 2HYIB 1JLFB 1JK9B 3L7PA 2XMUA 2MQLA 2E5IA 5MLCV 2OD4A 3N5BA 4WFYA 4DL2A 1TL1A 1RT2A 2OFGX 2QA4G 4J9MA 2VODA 2GHWA 5CD4H 1Q1KA 4H4OB 2ZOMA 1YBAA 2VBXA 5K14B 2XCPA 1KFDA 1KVIA 1TFWA 2AV5A 3MPWA 4F67A 3I0SA 3F73A 2C28A 2J9DA 1VK3A 5AE1A 3KNGA 3JYTB 1X0PA 2KM8B 2HVZA 3HHKA 4Y3CA 2M2BA 4CT8A 3ZZ0A 3OSNA 4KO0A 3DU5A 4NA1A 1S9FA 4A8QA 3NWGA 4MKYA 2BJDA 2EBEA 4OFZA 4X4VA 4J37A 4RLEA 2W7AA 4ELUA 1YJUA 2B4UA 4DPOA 3V4IB 4F2SA 1HA1A 2CQPA 5KG3A 2NR0A 3QGIA 5F8MA 1UA1A 4HLBA 4N5SA 4C0HA 1DQ9A 5CZVA 5KFDA 1HMVB 4RW8B 3OHAA 2KRRA 2XLIA 1VBYA 2YNIA 2R7TA 4I2QB 2N4CA 4AXIA 2RMLA 1UFWA 4LIRA 2AGPA 4I4BA 2HHPA 4ECYA 2XMMA 5IM0A 2FHMA 1O8BA 1R8AA 4ID5B 2OTLS 1T3NA 4BWJA 3SV4A 4ZDNA 1FTCA 5A8KB 3ISND 3HVTA 3R27A 3LP2B 4OX8A 3I6PA 2M0GB 4PG5A 4OHZA 1KS2A 4YP3A 3W3SA 1KFSA 2CPIA 4F8RA 3CD7A 3IRWP 4Y2AA 1VQOS 1EETB 5DO2A 2IM3A 2XLJA 2JEGA 3IO1A 1DRZA 2V2KA 4I68A 4OLPA 3BQ0A 4IRKA 1FESA 1N32F 2JEIA 2ZHBA 1R7IA 4AYBD 4ZP9A 1J2VA 2YKQA 2ZJQQ 1FDNA 5CYQA 3IAM9 4KHMA 2CPEA 4KR0B 4QJVA 1S9EB 4LMZA 2R8IA 1U1LA 3ZC4A 5GAGU 1LXNA 2KJVA 2V4QA 2W24A 4LQ9A 1KN6A 3ZZRA 5B0GA 3OLAA 3LP0B 3BQ1A 4LT6A 2R7OA 3DRPA 2VQEF 4TYBA 5HL7Q 2OKQA 1YGYA 1BD6A 4YEAA 3H4BA 3CCMS 3UR3C 2M52A 4ETXA 1MMDA 2VPYB 3S1TA 2UVVA 1VC5A 3Q24A 1VK8A 2RRBA 2RU9A 3K57A 2R7WA 4IR9A 4ELVA 4LSLB 2KB2A 3T1HF 3SFUA 1KHWA 4CTAB 1S0VA 1N5YB 3FRZA 1Z4UA 2ZH2A 1N34F 1IJEB 1VQKS 1KTQA 2FGCA 2GFFA 3M6VA 2LXIA 4CIOA 1OIAA 4H4MA 5KT6A 2BQRA 1FXDA 5KG2A 3S7RA 3NMRA 2V8DA 3K59A 3CEDA 3DLEA 3DLEB 1D1UA 1MROA 1X5OA 2F8MA 4FF2A 4C8ZA 2YNGA 3H2UB 3BR9A 3OTBA 4WFAQ 2MJNA 3HMJG 1N52B 4A8MP 1VQ4S 2V94A 4GO7X 3C8YA 2EFOA 4IH6A 3DLBA 1RT5A 5BJRA 4BS2A 1HI1A 4CO4A 3GG1A 3O6QA 4NLSA 4DR5F 3RRHA 3W2VB 5H9FJ 2QE5A 2VH7A 4OHWA 2M3DA 2CPJA 3M32A 1HBMA 3PKYA 1S1XB 2V0NA 4LF9F 1GXTA 2U1AA 1HNZF 2BE2B 1JLEB 5HP1A 2DH9A 1MNEA 2QA1A 2HNZB 1S1TA 1D9DA 1FT8A 3OL9A 2GGPA 3OVSA 3V6HA 1HBUB 4ZVEA 1LFWA 4ATNA 4GO5X 3M8RA 1HYSB 2VKRA 3DFEA 2OPPA 4QR2A 4EWTA 2FLNA 3QLHA 3BGLA 1FD2A 1YJ9S 2B3TB 1U1KA 4WZMA 5CA5A 5DLGA 3SQGB 2VFRA 1YHQS 1CLFA 5EHHA 3DMJB 3TW0A 1G6BA 4DWIA 4DV5F 1C4AA 1BQNA 1FVQA 2UZAA 4JI0F 5KFMA 3TVZA 3HO1A 4RUCA 4O3OA 2FDNA 3PNIA 3EZ5A 2YWGA 2B9YA 1RA6A 1HPZA 2JFDA 4ECXA 1FJCA 1ELOA 3JSYA 3PFOA 2B7BB 2EVZA 4BBYA 2LQ9A 2HLTA 2EK1A 1U4BA 2UUCF 5I3QA 1OQ3A 1WF1A 3HP6A 2ALZA 1DTQA 3CC4S 2O66A 3OTDA 4Q45A 5L8RC 3LP2A 4YB1P 1QTMA 1FHTA 3UW1A 2F4VF 1ZAXA 4H4KC 5F9NA 2UXBF 5HMZA 4AL6A 3PY8A 1SJ1A 2F9JA 2FHKA 3N4WA 2IJFA 4ZOSA 2ZNZA 2AU0A 1T3OA 2EC0A 2A10A 3VZIA 3PW4A 3V2UC 2GMJA 3MMCA 4YB6A 1RT3A 3H8YA 4ZVGA 2ZC4A 1HD0A 1NJZA 4NXNF 1O0PA 1OPIA 2R7QA 2Z2LA 3SV3A 4C4WA 5F8IA 5LXYA 2XCAA 1AUDA 1UEUA 1TKXA 3HJFA 1QE1B 3G6ES 2FHJD 2O01C 1XTZA 1GTHA 2XC9A 1HBNA 2B56A 1FE4A 2UU9F 1S77D 1M5HA 1G3OA 3AHPA 3AQPA 1S4FA 5JVGQ 2EG1A 1R31A 5CYMA 4X66F 2R2RA 1S0OA 3RU0A 5KT5A 1QSSA 2E1AA 3LW5C 3MR3A 4K5RA 3OTEA 4ZP7A 5KOXA 2FGOA 5J1EA 5J1EB 3GR0A 4DQQA 1KOOA 3SDEB 3GIMA 3RAQA 2GW8A 2GHVC 5C42A 2QA4S 5F41A 1L5UA 1F5BA 3AB2B 4CO2A 4QWBA 4A8FA 2CPFA 1FKAF 4QPTA 1OWXA 2LDIA 2IAJB 3R5DA 4IFYA 3HVAA 4E0DA 4YDDB 4NZ0A 2M7SA 3DN9A 5KFCA 2VG5A 1N88A 1SV5A 3GFXA 4P2SA 5F3TA 3CC7S 2FPHX 2HNYB 2AW0A 2IJNA 2XULA 2HFZA 2DH8A 3V6KA 2HMIA 2HMIB 3QIDA 2U2FA 4L72B 4GKJF 4PG7A 2QT7A 2ZH4A 1PC5A 2E1RA 3HHLD 2VL1A 4LVNP 3GFZA 2CJ9A 2V8GA 3I87A 4OZ5A 3MD3A 2KJWA 5FLXY 5A8WB 3NL0A 4UUXA 4NPOA 5KFZA 2CJBA 2GNKA 3H59A 2A3JA 1H2TZ 4OHVA 3NG8A 3KK3A 3PJWA 4C0BA 1JIHA 4N77A 4K4UA 1C1BA 4HDHA 2ZE2A 3V4MA 5D3GA 3UR0A 4OX6A 1FRHA 3NBPB 3OR2B 4HTJA 1Y4ZB 3MR5A 5B0EA 3PW0A 5E0OA 3IGVA 1TL3A 4K5SA 3OL6A 2XMJA 3VALA 3QWPA 4NOHA 5AXKA 3FCHA 1S6PA 3MEGA 5KAKA 2RQMA 1S79A 2XSJB 4O3RA 4N56A 2GX8A 2XNQA 2C3OA 2WONA 5D4NA 3IA0A 4PWDB 1S6QB 1LW0A 5FIIA 1FE0A 2CRLA 1UAWA 2R4FA 5BR8F 4G3IA 2IYGA 1BQXA 5JXSA 3PIPQ 1WEXA 4UY8T 3KYLA 4TU9A 3EGWB 1N5VA 4E8UA 2MPUA 2Y1RI 3CCLS 1HD1A 4FVMA 1MWYA 3M8PA 1DJ0A 3MXHP 3HZGA 2VV5A 3DDKA 4WU3A 3VWSA 2GMHA 2MJUA 4KC5A 3BGRB 4B17A 3D0IE 1T7PA 3KHLA 3S8SA 1G7CB 5F8LA 4B9LA 5IT9Y 1S1UB 2W7OA 1ZAWA 1ULRA 3MEDB 2YX7A 1TKXB 3MMAB 5D77A 4JV5F 4FVCA 1A7GE 2K3KA 2Z0GA 3GQCA 1FXLA 4RU9A 2BE2A 4DV6F 2BV3A 2WSEC 3MM6B 3MM6A 2B9XA 3E3XA 3FSYA 1VQ7S 4CTAA 4NYOA 4RW9B 3KLHA 2OJ3A 4LQ3A 2AGQA 5DDOC 3U1NA 5AXMA 5G0RB 4XPCA 4TU7A 2AD9A 3QMQA 1UEVA 2HPUA 3U7JA 5I3UA 2ZUGA 3ZZUA 1WNEA 2ROPA 4ZCKA 2MGZB 4PXBA 3OVAA 2BRKA 4A48A 1LWEA 3ONQA 3H5XA 2B4VA 3NAHA 2MZJA 3J81Y 1M0SA 4Y65A 2VASA 1JLQA 3B82A 4ZPDA 2ZH7A 1GAOA 1NK7A 1LWFB 4ED1A 2O5DA 1S9EA 2CPHA 2DGXA 3MWBA 1YRUA 1ZTTA 1U47A 3TP2A 2QYCA 2CQCA 4J9SA 2XB2D 4K50A 1VQLS 4X4OA 2EPIA 4WE1B 2GIRA