2CRLA

The apo form of hma domain of copper chaperone for superoxide dismutase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'GSSGSSGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper chaperone for superoxide dismutase
molecule tags Chaperone
source organism Homo sapiens
publication title The apo form of HMA domain of copper chaperone for superoxide dismutase
rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2crlA01
1SI9A 3WDOA 1Q8LA 4NPOA 2XMVA 4A4JA 5KAKA 3BB5A 1JWWA 1SQEA 2IYIA 2KYZA 2QIFA 2HLTA 4A46A 1GXTA 2LXFA 4HL9A 1KQKA 2ROGA 1TUVA 3UDCA 1CC8A 1MWYA 3KNGA 2XMWA 5B0BA 1K0VA 2FB0A 2PD1A 3CJKA 1X8DA 2XMTA 2BYCA 2GA7A 2N7YA 2AJ0A 2HIQA 2Q3PA 2K1RA 5A6WA 1OQ6A 2ROEA 1Y3KA 1CPZA 1Q4RA 2LDIA 1P6TA 5F0UA 3FMBA 4YDXA 2FTRA 4QOTA 1X0PA 2OD4A 2FHMA 2G9OA 4U9RA 2W4DA 4Q2LA 2GCFA 4DPOA 5F0WA 2K7KA 2OFGX 1TZ0A 3IWXA 2GV1A 3KG0A 2IYGA 2LQBA 2KKHA 2RMLA 1KVIA 2FIUA 2PGCA 1FEEA 3K7RA 2N4DA 3BM7A 3MZIA 2ROPA 2GO8A 3DXSX 2KT2A 1Q53A 1XBWA 1RJJA 2ASYA 1N5SA 2HFNA 3F44A 1Y9OA 5B09A 1WD6A 4OJGA 1FE4A 2OAUA 2GGPB 3DCAA 2K1RB 1VQYA 4FNIA 4OJ3A 3VTIA 2BJDA 2BBEA 1JK9B 3I9ZA 1GXUA 3IWLA 2GGPA 2ZDPA 2RSQA 1MWZA 4HH1A 1AFIA 1R6YA 1TL4A 1YJTA 3MCSA 1FESA 5B0FA 1S6UA 5IXUA 3KG1A 4OIXA 3TOQA 4DL0C 5K9FA 3HFKA 1TR0A 2ACYA 4HI2A 3LO3A 2XMKA 3HHLB 2HFOA 2K7JA 4OJ1A 1N5QA 1Y3JA 2AJ1A 4YEAA 1OQ3A 3HDSA 4NL5A 1TL5A 2KT3A 3KKFA 4DN9A 4OJHA 1QUPA 1S6OA 2OFHX 3LGMA 1FVQA 3BR8A 1YG0A 4HH0A 5B08A 2GFFA 1IUJA 5T7LA 2AW0A 3FRYA 1FD8A 2OD6A 2K2PA 4Y2IA 1AFJA 1Q8BA 3E8OA 4HI1A 3QMQA 1OSDA 2LQ9A 1ULRA 3T9NA 5A6PA 1URRA 5T7LB 2HQIA 4Y2KA 2N4CA 4A47A 5B0CA 1FE0A 1FVSA 2W4CA 4Y2MA 3TRGA 1OPZA 1W2IA 2BUNA 2CRLA 2BJEA 2RU9A 2XMJA 2HLUA 5B0DA 2ZDOA 2XMUA 4ZOSA 2IFXA 2L3MA 4FNHA 1X7VA 2OP5A 3HF5A 1U7LA 1N5TA 5B0EA 3HHLD 2VH7A 3BDEA 3HX9A 3LGNA 1YJVA 1VQSA 3BGUA 3TNVA 1YRXA 1Y0HA 1APSA 1LQ9A 2VV5A 3FGVA 3GZ7A 2JDJA 3HHLC 3CJKB 1KVJA 5B0GA 1V3ZA 2QLXA 1YJUA 2QYCA 4F67A 2XMMA 3BF4A 2AP6A 4ZA1A 2OMOA 4EFAC 4Q2MA 1AW0A 2W4PA 1P8GA 1SB6A 1N5VA 1CC7A 2EW9A 4A48A 2QLWA 1YJRA 5B0AA 3BN7A 3HHLA 3QGPA 2RILA 2OKQA
chains in the Genus database with same CATH superfamily
1NSKL 1U8WA 3KXDA 5GMKa 4F04B 2JLEA 5BYSA 4X62F 1K73T 4FF4A 4RPFA 3TUIC 1GMVA 2EWHA 4NLTA 4QW9A 3H40A 1VQOS 2CPDA 3HO1A 4QIFA 4C3LA 2XWYA 1D0EA 5ETNA 1W2BR 3UDCA 4QU7A 4LSNA 3D54A 3JTNA 1RT4B 3QAUA 5K5MA 5B0BA 1SKWA 1K0VA 2CQCA 2B56A 4M5GA 1LK7A 4NMLA 2BYCA 3CCWA 2Q3PA 4QR2A 4O4GA 2JFKA 1WHXA 3OXLA 4Z7YA 5A6WA 1HHTP 3GSIA 2G0CA 2XI3A 2ZE2A 1WUUA 2V4JA 3I32A 3R6LB 2DTJA 3TVZA 4C3MA 3CCJS 2LDIA 5FLXU 1KSPA 2M5YA 2G4BA 2FTRA 4ZVTB 3ZZTA 5DG9A 4KPYA 3MXHP 1MN9A 2RHSB 4QIWD 1IKVB 2AX0A 4H54A 3F73A 5JVHQ 1CJVB 2RIJA 3A4TA 4N47A 3VVTA 3WHIA 3TEGA 1WEZA 3OFGA 3QQCD 2VDHA 4OLOA 4ED0A 1S10A 2R7VA 5LOQA 2F63A 3UCGA 5E3QA 1RAIB 1KHVA 3ILJA 4IYQA 4B9LA 1ZYQA 2J9DA 1FF2A 2D9OA 3HT0A 4PG8A 2HYIB 3UD5A 5KOXA 2YKNA 1KS2A 1JKHA 4O23A 4DPYA 1VQYA 2M3DA 2NXCA 2Q6BA 1Q7LB 2C1EB 5F3TA 4F2SA 4OJ3A 2CQGA 1T9UA 1QTMA 4DR2F 4E0DA 2FJBB 2KFNA 3K57A 1SKUB 3GPAA 4OL8A 4DX7A 1UJ4A 4IFYB 2IA0A 2DY1A 4X4VA 4OIXA 3IFEA 1RT3B 1WC0A 1HKAA 4A8WA 1T94A 5LSLA 4M1KA 3IRWP 3VAFA 4QPTA 1RGVA 2LU2A 1JLEA 3N9UC 3JSYA 1X60A 2EPIA 4HHUA 4KSEB 5KG0A 4AYBD 3J7YU 2DPIA 4P75A 3TJAA 3UN3A 4CI0B 3R2CJ 3QAEA 3U1MA 2M9KA 1OPIA 3BQ0A 4EO8A 2R2UA 4JV1A 1SIZA 3T5LA 3HVTA 4ICLA 4QZVB 3RB0A 1ZM4A 2C28A 1IBCB 3NOGA 3MMCB 3MR7A 1RT5A 1TAQA 2C3UA 4O3QA 3G71S 2AW0A 4K4WA 4OFZA 4X66F 4X4RA 3KWMA 4NRTA 2E1AA 1KP6A 2F8MA 3KLFB 2WB4A 5DQGA 3BH7B 1TK8A 1VLOA 3KLIA 2MTLA 2RAQA 4OYZA 2AZ3A 5IQQA 1F9FA 2Y0SD 1RAEB 3G82A 3ZZOA 4A8OA 3QYYA 1U2RA 1TVRB 4DCOB 3CC7S 2VDIA 1SIWB 3US5A 1LWFB 4DZDA 2GQQA 3C6UB 3D28A 4M5DA 3FVYA 4C48A 4U8VA 5H9EK 2E5GA 2UUWA 2ZBPA 3G6YA 5I4MA 1RTIA 2BRKA 4KHRA 4P2MA 2JEGA 2AEMA 3V2UC 2F40A 3OV7A 3C66A 3K58A 2NXJA 3KHRA 3LWLA 2MLZA 3DM2A 2QMXA 3IAS9 3MMAB 2CNOB 2AQ4A 1KTVA 2W7AA 2MQOA 5DGBA 1M0SA 2HBQB 3PTWA 2O67A 4KRWA 3A3PB 1NK8A 2QYCA 4MKYA 4DSKA 1XMOF 1O0PA 5GAGI 5H9FK 3M30B 4IFYA 2I38A 5CD4A 1JNZB 4ID8A 1UTAA 2B6AA 3F0NA 3PHTA 3JTPA 1ZH5A 4ATNA 1VR6A 1NJIT 2CDQA 3C19A 3FSIA 1HNZJ 1QLNA 4GKJF 5IT0A 2A6OA 2IMWP 2MQLA 1Y4ZB 4ZPWR 2MHEA 1UPMB 1VQPS 4PUOB 1KN6A 4A8QA 3BEGB 5KFEA 2V68A 5DM6Q 3KK3B 3PW5A 4LF9F 2B7BB 2I5JB 2ROGA 5DDRC 1TUVA 3V6JA 4OX9J 3KNGA 3T9ZA 3M8QA 2OLWA 5DDPC 3I9V9 1C2PA 1IKXB 1NB2A 3OVAA 2J8SA 3AXKA 3P6YC 4Y3CA 3PW0A 1IQZA 2F9JA 2ROEA 3FEXB 4LR8A 4USTA 1J2VA 4M5HA 4C8KA 1BC6A 3E3XA 3G6ES 1NO8A 2ZM6J 3PRDA 1EZZB 4DV1F 2L9DA 1Q16B 3ENVA 1RTHA 1X0PA 1NDPA 2OD4A 1UWBB 2CQDA 3HD1A 1S79A 2IVMA 3ONQA 5AE1A 4LF5J 1U2CA 1V5IB 2OELA 2PN6A 3NOCA 3HSDA 1T05A 3VGTA 1T9XA 1SUQA 3V81A 1AB8A 5F8MA 2YNHB 1UEKA 3CPWR 1Q8KA 2EKNA 2L41A 3HPOA 1UMJA 2LQJA 3M2VA 3P3DA 4JI6J 4IO1A 2F9DA 2HVEA 2Y3YA 2GO8A 2MLYA 3HI9A 4X64J 3BKUA 4TYAA 3F44A 4DQIA 3NBPA 1SC3B 4NLXA 3TA2A 1VRQC 2J9DE 3P8BB 3CC4S 3R5DA 2V2QA 4DR1F 4FYDA 3OTEA 1X4CA 3IR6B 2MEWA 2HHSA 1IKYB 2A1BA 2DHXA 2IM3A 3JS9A 2KTQA 2HVHA 1JK9B 1FRMA 2GHPA 1KD1T 2X1FA 4P6QA 2DXDA 5J1NA 3OXFA 3A8IA 4DL0C 5L8RC 4G1QA 3ZZZA 2AIRB 4WIIA 2AJQA 3K5NA 4X84A 2J7UA 2EC0A 1REVA 1HQ2A 1PC4A 3NY0A 5ETLA 2DHSA 2K7JA 4L6V3 3OQ2A 1RWMB 2AJ1A 4LIRA 4OJ1A 3LP1A 4ZLPA 3H4BA 4MIBA 4ECXA 3OSPA 5D0GA 1Q5VA 4NL5A 2XB2D 2EBEA 3SCKE 3ZTRA 5KFIA 5L46A 4AL5A 2CPIA 4OJHA 4IOAQ 4YOEA 1FCAA 4UUXA 4DR5J 1TL1B 1WHVA 2XULA 4ECYA 3EXCX 2HBYB 3I87A 4GVBB 4WF9Q 2DNOA 3ZZRA 3FRYA 3IMQJ 5K8OA 3ZTPA 1U1NA 2ADCA 2IRXA 3KLGA 2W2MP 4M5KA 4WKRA 2CVIA 3FC9A 3R97A 1OSDA 5B7WA 1VC6A 3SIPB 4I2QB 1ULRA 1T03A 4ELTA 2HW3A 2VKRA 5J2NB 4NCGB 2HQIA 1NJZA 4JV5F 3DNCA 4DV6F 1SQFA 4Y65A 1FO1A 2QO3A 1RHQB 5HATA 4KHPF 1GTHA 2FVQA 2C3PA 2F8HA 4CNZA 4DL3A 2A2DA 3AODA 1B99A 3LP2B 2OEKA 1H0HB 3KDOA 4DFKA 2HNDB 1H7WA 3DRSB 4W90B 4JI4J 1YGYA 4HVZA 3VAGA 3KLFA 4LSLA 5K14B 1P9QC 2XS7A 1NDLA 5HVFA 1QAIA 4V1Ak 2L3MA 1VMBA 3IXQA 3NS7B 4MKBA 1HWUA 2GX8A 1VRUA 2H5EA 1HBOA 2BE2B 2MLXA 2D69A 2V67A 1X4FA 2DGQA 3BDEA 3NG8A 4ZPAA 5IC4B 2VZ9A 4DPWA 2XQCA 1PSDA 5HLFB 2NZ4A 2PA8D 4W98A 3FQLA 2W2PP 3FBCA 3EGZA 3DHWC 4LFCJ 1CS4A 3BO3A 2K06A 3CD5A 4TKTA 4ECRA 4EFAC 2AP6A 4DX5A 1RT2B 1HYSA 4WCEQ 4QR0A 4NA3A 4ILMA 1IR2A 1VYAA 4A8FA 2ZH3A 2YH1A 3SZ2A 4JI6F 1FXDA 3BN7A 3HHLA 5E5NA 1S97A 1ZPVA 3C14B 2OKQA 1F2GA 1H2TZ 2E5HA 4LSZB 4WFYA 2XMAA 2KG1A 2ASDA 2F4VF 1JWWA 2IYIA 4YR0A 3GYXB 3M9OB 3M30A 2MQMA 5G0RA 3RAQA 1SVDA 1TKTB 1HA1A 4U7CA 4ALZA 1N56A 5D0EA 1X8DA 3CCLS 4FYYB 1CS4B 1WC3A 4JV0A 3VR1A 1HR0F 1VQ5S 3IC1A 2DPJA 1FJGF 1OQ6A 1HQUA 2QLBB 4ZCMA 4PAAA 3GWCA 6AT1B 2HNYA 1FK9A 2YWFA 3FMBA 1RISA 4USMA 2QLFB 4BLGA 2Z30B 3KUGA 4ES3A 4FF1A 4JYAJ 4Q2LA 3MPDA 4WTOB 3IGVA 1VHIA 3M8RA 3IWXA 3DU5A 2GV1A 3NNAA 5K8MA 3GCXP 1K47A 4BBYA 3FEZA 4DOZA 1JLQA 4LF4F 1S0MA 4NZ0A 3UW1A 1RLCL 1FEEA 2EFOA 4TY8A 4C11A 4F3QA 3TQEA 2DITA 3O8WA 1L3TA 2A18A 5IS2A 1S0VA 2AV5A 3GFXA 1KVKA 2LYVA 2YX7A 3CE8A 3HVTB 3ENWA 4DBQA 1N33J 4TXSA 5B09A 4OHWA 2W2NP 3EPIA 3ET6A 4LF2A 2MJUA 3NAHA 5I3QA 2ZE2B 4JV5J 2DRBA 1WI8A 1HMVA 2DY9A 1BUXA 2ZZMA 2XY6A 1DHMA 4RUBA 4ANDA 5HMZA 1ROFA 4LT6A 3BGRA 2JC0A 4FS2A 3OPKA 3ZTOA 1BHNA 3MM8A 4DL6A 1KBRA 1N6QB 3OTCA 2CNLB 1K1SA 2RQMA 3ZZPA 2W7PA 1VK3A 5ETVA 3CMAS 3G8QA 4TVAB 2ACYA 3DDIA 3DRPA 4QYZK 3THVA 1VIXA 2VG5A 1X4EA 1YWXA 2HG4A 3ISNC 1JJ4A 5K20B 2RE1A 5AJ3F 2HS3A 2O5DA 2J0WA 4J9VA 4DV7F 3WC0A 2PSZA 1KEKA 1QE1B 2FJEB 3H8YA 5GMEA 1VGYA 2D74B 2LDYA 1MU2A 3H2VE 3UQSA 1A9NB 3UNGC 3ISND 4DR3F 2MB0B 5GAHU 5DLGA 2SXLA 4Y2IA 2V50A 1WORA 1Q8BA 2FJDB 3E8OA 3PYFA 1OWXA 4PG6A 3X1LB 4J90A 1U49A 2RS8A 4B9UA 3T9NA 2CPEA 1TP7A 1Y00A 3TJ8A 2XLKA 4IG0B 5LXYA 4DSFA 2UV8G 1FE0A 2DKOB 5C24B 1FVSA 3OL9A 4LSLB 1VDHA 4DPTA 2YQ0A 4DV0J 2BQRA 4H4OA 2CRLA 1S1UB 4CM0A 4OYAA 2CZ4A 2W8LA 2UVRA 5KT4A 2CWXA 4H4OB 3SSSA 2V8DA 1SL0A 2KFYA 1HHSA 2GMLA 2UUBF 4RUAA 3G8SA 1VK8A 3TP2A 2HQGA 2D3O1 1N5TA 1DARA 3MCNA 2PMZD 4AD6A 2DVIA 2ZFHA 4QR1A 4ECVA 1SL2A 4Z7CA 2DNKA 2L08A 1HFEL 1NHKL 2J9EA 4RR5A 1O8BA 4RZRA 2E9ZA 1WG1A 2MGZA 2HGNA 1RT1A 1R89A 3FGVA 1WC1A 4TY8B 3BR9A 4B3TF 1MW7A 1UCNA 4UZCA 4KT0C 4JI0J 1RTZA 1S4EA 4GO7X 2ILYA 3KG4A 5IV3A 1VCTA 3JSMA 1H2UX 2X3DA 3D2WA 3MI7X 1AW0A 2VG7A 1LFWA 2AJFE 4TU8A 5F9LA 4DV5F 1FJCA 1X5OA 3I96A 4I7FA 5HQLA 2J5AA 4PXBA 2RVJA 2ZWOA 4OZNA 2RILA 3BSCA 4LR7A 2HHXA 4PKDB 1HQUB 5LMNF 5CYJA 4F4AA 1R8CA 4A4JA 3BKTA 3W62A 4ID5B 2IAJA 4CYUB 5KT2A 1UFKA 2AGOA 2GVDA 3UDVA 5D15A 2EG2A 2FVCA 3CTRA 2XGPA 4JOUA 1BXNA 2ERRA 3HSJA 3I55S 1JB0C 4OLPA 3EYZA 2XMWA 1N5YB 4MK8A 1MLAA 3D0HE 4ZJQA 1XNRF 4DR4F 2B8QA 2DNLA 2M0GB 4P7TA 1FKOA 2ZD1B 1HNIB 1RQ0A 2LMIA 2XYPB 3GFYA 4USIA 4CP5A 3OVSA 2BJ7A 4NASA 1RA6A 3QO9B 3PRVA 4CZCA 4G6VB 5I3UB 4C0HA 3KLHA 2QA4S 4B3TJ 1M5OC 5LXRA 1RK8A 2DGOA 2NLWA 3EDRB 4IDKB 3IRXB 2GQCA 5J2PA 1EARA 4OYPA 2VFSA 1MN7A 5HL7Q 1O6XA 1S1UA 3KYLA 4DV2J 3RW6A 3ICLA 4ZCLA 3PZPA 4R5PB 3KLVA 2FIUA 1MMDA 2QFIA 2MZTA 2NPIA 2PFDA 3CB4A 4DR3J 2MYFA 1NK6A 2K3IA 5J1EA 3G8TA 3GTYX 1FX4A 1HBOB 2BE2A 2M4MA 2I6WA 2ATCB 3T19A 3GFZA 3DCAA 3M6XA 4NLOA 1PAUB 2WVCA 1LWCA 2YY3A 2ZNYA 1RWWB 4KV8A 4I6WA 4X4OA 2BRLA 3WX4A 5ETQA 2N3LA 2UZAA 1L3KA 2KU7A 1SH2A 1IJFB 1RT7A 2FZGB 1R6YA 3WIUA 3IBCB 4DQSA 4KGZB 5J2PB 1R8AA 1S6UA 3OHAA 4PUOA 3DOKB 5C5JA 1T3NA 4WJBA 3QZ8A 5K9FA 2XZWA 2KI2A 2E66A 4RW6A 3TAMB 4DL5A 2IRUA 1VQNS 1HPZA 1RTDA 3MR6A 1QVFR 3TUJC 3ENQA 1ELOA 2FY1A 4DR6F 2VFRA 4ER8A 1HPZB 3IG1B 1NJWA 2HZVA 2WW8A 1C0TB 3S6EA 3W63A 3EX7B 2HRTA 3MOZA 4DCJB 3P45B 2CQ2A 4XAKA 2HS0A 3D0IE 3J80Y 3O1LA 4KC5A 2COLA 3EZ5A 5K8NA 5HMXA 1YTYA 2L9NA 4CQ1A 3AJDA 3HKWA 5T7LA 4ITSA 2VHGA 2K2PA 1G6BA 4CLFA 4MJKA 1S48A 3QMQA 4KQZA 1Z4UA 1RKJA 2CZVC 3S8SA 4ED2A 1JKHB 3FUYA 2VFVA 5C25A 2C3OA 1FT8A 4HDHA 1S1WB 2MJNA 4ETZA 3HVAA 1JXLA 4PG5A 5CHCB 5CD4H 1H38A 1K44A 4CLZA 2XYHB 2XSJA 3TA0A 4PWWA 1OPZA 4L3NA 3EXYA 1XC9A 2E1RA 2ZDOA 5H1SV 4LRAA 1FTCA 3UNYA 1NPKA 3LOUA 4KGVB 2HS4A 4DU7A 1SXLA 3MTJA 4NI2A 5CH7B 5LMNJ 3RUBL 1KQSR 2UXBF 1NU4A 2OP5A 3FJ2A 3IRXA 1EETB 3GJRB 4C8ZA 4LREA 4CCHA 2KH9A 4H4MB 4KH0B 2V6AA 5L1JA 1WDDA 1YRXA 2AHOB 4HLBA 1G4CA 4DUZF 2JLFA 4B9TA 1B0TA 4DPUA 2F4VJ 2BKNA 4FVCA 1Y10A 3LH2S 1IXKA 4DL7A 1Q5YA 4IQMA 1FI4A 3AT1B 5C42A 3MD3A 1YX2A 5D4OA 6FD1A 2FLLA 1U1PA 4LQ3A 4RBVA 5A8RB 1XERA 2FHKA 2M70A 3VZIA 1B3TA 4OZLA 1C0TA 1OY6A 1H6KX 4K8RA 5HJXA 2HHHF 1T9WA 1GQEA 5DQIA 2BX6A 2WSEC 2V34A 2YPZA 4LQ9A 2IBOA 2MKYA 1HWIA 2DYAA 4EUVA 1OIAA 3R8YA 3DLKB 1FRHA 3D6FB 3I82A 3N0VA 1REGX 4E98A 3BB5A 2XY5A 1IBLF 4JBCA 1SQEA 5FIIA 1SC4B 3UE2A 1GXTA 1VBYA 4USHA 3DOLB 4PG7A 1ZETA 1I94J 2FB0A 4UOFA 5ETSA 4Q43A 4JI7J 3K8VA 4RJVA 3D6TB 3CJ0A 4JI3J 1RCXB 4M5MA 4USKA 1YRTA 4ECQA 1U0HA 5A8KB 2JJ4D 1CJUA 5F0UA 3J80U 4DS5A 5IT9Y 3IO1A 4F2RA 1RWOB 3NBPB 1QSYA 1TMMA 1YITS 2WOMB 1IKWA 3I5BA 4AXJA 3A3NB 3KG0A 1JX4A 1FNXH 2XG8A 4OMFG 4ZK7M 3C8YA 2WB1D 1DZ5A 3OFHA 1ZTWA 3CF5Q 2UXDJ 1WHYA 1NSQA 4Z37A 3MZIA 3KJFB 1BLUA 2WVBA 3BSAA 1F3VA 1AXQA 3RW7A 1UW9A 3L09A 3L9ZA 3DM2B 1G2EA 1X4BA 4USWA 1WD6A 1AROP 3SFUA 3VVUA 2ZJRQ 1NK7A 3BYRA 3N5BA 3OFFA 1S1TB 1GX5A 1AYEA 1PBAA 2WBMA 3N01A 4WK3A 4QW8A 4A8XA 5KFZA 4DEZA 1GXUA 1WI6A 4ED6A 2Y1JA 1DTQA 4H4KA 3K5PA 3TX0A 5IXUA 1WKKA 5KFCA 3PYGA 3R5BA 4FYWB 3KHLA 1HNVA 3LP1B 2ZVIA 3DN9A 1TR0A 4WP8A 4X4TA 3GJTB 1ZTTA 2VQFF 3DC2A 4C97A 1NJYA 4LVNP 3CMES 1M1HA 4DS4A 2RHQB 4IKAA 4RNHA 3TW0A 3T5HA 5KFBA 3T1YF 2E5LF 3OTOJ 2D1CA 2V94A 4EBEA 2Z2ZA 3PEJA 4DR7J 5BYRA 5LJ3Y 2IMOA 3AOAA 3AQOA 3LGMA 1LW0B 1QE1A 4G1PA 3C2PA 3MPYA 2DGWA 4ICLB 1YVFA 4JI4F 5HQ8A 2AJ2A 2DD8S 2GAGC 4I69A 2HPUA 4I67A 1RBOB 1UEVA 2ZHOA 4IOBA 5J1PA 4J9KA 4O3NA 4ZPTR 2BV3A 4ECWA 1S49A 4CM2A 4DSLA 4JI0F 3MAAB 3N79A 4J9PA 1J5OB 3PIPQ 5C2GA 4FZVA 1VJQA 2EI5A 2B9EA 2I1RA 1WDTA 3M4XA 1TAUA 4DR2J 1ZAWA 2XMJA 3BZQA 4X4PA 1HARA 2MKJA 2MZQA 3JQJA 4K0KF 1QDUB 2VQFJ 1RACB 3AHPA 3DFEA 4ZPDA 5F8IA 4J9NA 2JSXA 2MHNA 1N88A 3CDBA 2YNGA 1B70B 2WRMA 1S72S 2UP1A 2BEFA 2R4FA 3D1HA 3QFHA 2XTJP 2VA2A 1F0XA 1TKDA 2R2RA 4CO5A 1J27A 3NAIA 4RLEA 1YJVA 4ILRA 2IJRA 3TNVA 4CH0S 5L1IA 1PYTA 1TELA 2BDPA 3AOCA 4AE5A 3GG1A 2VUGA 3GE9A 5FDLB 2H3EB 2AYGA 1NK4A 4LRCA 2GMHA 3Q22A 5BYQA 4ZN1A 4DWIA 1HW9A 2B5JB 3OJUA 1UWAA 4PXEA 2C2OB 4KBIA 3KLEA 3MFIA 2WSFC 2ZH8A 4NCGA 1I5OB 3EJMA 3R27A 3SQOP 4TQRA 2DH9A 1B7FA 2RT3A 3CSKA 2B7CB 4J9OA 2AYMA 1F5BA 1Q1KA 3A8JA 1KRPA 2DNGA 3BBCA 1S0NA 3V5RA 1T02A 4RWWA 2R8GA 2YWEA 2YNIA 4FXWA 5E3RA 4X65J 1C1CA 1WEYA 4Q0BA 4U67Q 2DO4A 1M1GA 3IAM9 1TL1A 3PJ9A 2UXDF 2LXIA 3C6TA 4URSA 2VPYB 2N7YA 1QJHA 2OO4A 1RYRA 2V69A 1U1QA 2ALZA 1PILA 4PR6A 3VAMA 4YMEA 2XLIA 1CPZA 5EWFA 1XNQJ 4YDXA 2XSFA 1LW0A 4OYMA 3B8HA 3M32A 3N5FA 1C4AA 1S9GB 1UJ6A 2QRRA 2LA6A 5D0HA 3T6JA 2AZ1A 5D6GA 3AA8A 3D3CJ 1MMNA 2Y1LB 5BR8J 4F36A 1N34F 2JNJA 4LFAF 4OX7A 1LNQA 1TZ0A 4LFCF 3IP0A 4WFAQ 2E1CA 1RUSA 3Q8VA 1TL3B 4LF8J 4M94A 3OHBA 3W66A 3JB9k 4F25A 2HMIB 2VBZA 4OX6A 1OY8A 4DFJA 1NK0A 1RJJA 5KFSA 4GRSA 2QZ8A 1LEOA 4USJC 4RNOA 1FRJA 2MKIA 3PX6A 3QT6A 3HZGA 2WTFA 4CWBA 1YLXA 4C8LA 3DLEA 5I42B 1KR4A 2YWKA 2L9WA 2IM1A 3KNAA 1YBTA 1R43A 3I9ZA 3MCOA 5T41A 2Z0GA 4CTAA 3EVMA 4UOHA 3UR0A 1AFIA 2HRUA 1U6FA 4RKUC 1SV5B 4LF7F 3IA0A 5KT5A 2FLNA 4N56A 3M2RA 4DR5F 4CO0A 2YKMB 1OJ4A 2UUAF 1M5KC 3LO3A 3HHLB 4WIQA 2HFOA 3P4UB 3PO4A 4ZVQB 1N5QA 2OJ3A 2Y1RI 4YP3A 2V8VA 3LP0B 4TYBA 2GZOA 3NLCA 3MGJA 4JP8A 4RW4B 2UXBJ 1S6OA 2D41A 3I56S 1P1LA 1T9YA 4HH0A 3E01A 2G2OA 4QIVA 3UVJA 2JEIA 4KPCA 2HFUA 2DEIA 4Q8FA 3RYLA 1YZ7A 3LGHA 2ZHAA 3PHEA 2DRDA 5KFGA 1CULB 2B4VA 2CQ4A 3QBCA 3SI8A 2ATLA 1H98A 1T9VA 2Z58B 4FXDA 1E6YA 3VWSA 1FJEB 3KOAA 1GK8A 1RP5A 2GJIA 1R7IA 3MOJB 2XBPA 3HXMA 1IJEB 5KFKA 1Q7YT 4BCAA 2FDNA 1WC6A 4B08A 4X64F 4RW8A 3MEGA 1S9FA 3KHGA 2YNHA 2EFQA 2J7WA 3CIZA 2BE9B 3PFOA 4F0HA 5H9EJ 3DMJA 2RRBA 3OR1B 5IZHA 5HN0A 2JVOA 1FRKA 4FNHA 4XTTA 1JLBA 2HQCA 2OPPB 5GMDA 3TWZA 3ZXWA 1HQEB 1WC5A 1JLCA 5F3ZA 1WTBA 2V2KA 3O2IA 4OZ0A 4ZVEA 3LGNA 1JJ2R 1Y0HA 2EBGA 1LQ9A 5GAHI 4B3SF 4IFVA 3FBEA 2ZBCA 2LCWA 4DV3F 4TN2A 4J37A 1G1XA 1UJ5A 3BO2A 1YRUA 4JI3F 3THPA 2DO0A 2HK3A 1V9OA 2HFSA 1CJKB 2W25A 3VQTA 1N8RT 1LWEB 1S4FA 1HW8A 4JI5J 2FHOB 2ZBRA 1I94F 1XNRJ 4L3KA 1N5VA 3LALA 4MYTA 5EDWA 4DXLA 2VJVA 5CCLA 1XR6A 5I3PA 5J2QA 4K2XA 2VOOA 2XHCA 1YJRA 4IOCQ 4ZP9A 1H74A 1VBKA 3AJ2A 3HP6A 3CUNA 3Q86A 3WDOA 3IM9A 3LTOA 4ZVUB 2BACA 2N3OA 5JUMA 3UCUP 4A46A 3BGLA 2EG1A 4RW7B 2LEAA 4EO6A 3MURP 5HROA 2WVEA 3W64A 4HHHA 2J0SD 2KVIA 4DV0F 4B9SA 1VC5A 4DSJA 1UVJA 3SXLA 1SBRA 5HVGA 2MDAA 3DOMB 3D67A 3A8KA 3D66A 2VKZG 1OY9A 5KT7A 4AL6A 2JEJA 2VFTA 4G1IA 4F4YA 2R42A 3PM9A 4WFXA 1UL3A 3RTVA 4U8YA 1RLDA 1PCAA 1X0FA 1HBNA 2MKCA 5CYQB 2FHMA 3H2UB 2XC9A 4DLEA 3NL0A 3NKYA 2AU0A 2OFGX 2LA4A 1KFDA 2YKOA 4JI2F 4ENOA 3D4JA 3J7AN 2W24A 5DZ7A 3UN5A 1EKSA 1SH3A 3ISZA 4XDDA 3R5GA 3JYTB 2QGFB 3CIMA 3VZHA 4Y0FA 3KDNA 1LWFA 3R5JB 5KTQA 4DV5J 1EETA 1XBWA 4I6YA 1F5CA 2HQDA 1QTNB 2B5JA 2VASA 3DI6A 3ZO7A 4F0KA 4FS1A 3P96A 5E33A 1RAHB 5D3GA 4DR7F 2KRBA 1UW4A 3IS9A 3PDNA 4QCLA 4LBHA 5FLXY 5K14A 7FDRA 4AQYJ 1Q86T 4DUYF 1ZM9A 3LQVA 4R5PA 4I2PA 2MQNA 2U1AA 4HTJA 1KOOA 3W2VA 3KK2A 3VAIA 4PABA 2P8IA 4LBIA 4USVA 3IR7B 2CYYA 4HYKA 5J1EB 1UAWA 2OPSA 1S6QB 5KFPA 5E3AA 2B4UA 4TNOA 4NMXA 5BJRA 4CIOA 2DGUA 4QPXA 1YZ6A 3I0RA 2XMKA 4OI2A 1CJTA 5IWAF 1EQMA 2PC6A 1YK9A 2NUUG 3D1OA 2V8PA 4BHQA 2P9CA 4RNNA 2KL8A 4KKOA 3GG0A 1KLNA 2P5VA 1HD0A 5DDOC 3W3SA 2H4YB 3OFEA 5HP1A 4Q0BB 4U7UK 4C0BA 1HNWF 2DHGA 5KFRA 4WPAA 5HJYA 4ZPCA 3MM9A 1BWVA 4BDPA 3O44A 4IO9Q 1HNIA 3EMTA 3S7RA 2KFZA 4R0EA 3S01A 4EI2A 4LBPA 3GIJA 5GADI 4AQYF 2JWNA 1SJ1A 4Y2KA 2GIQA 4YN3B 2UUBJ 3ITHA 1RU2A 3P5BP 1HHQA 1H73A 2UU9F 2VC1A 4M5LA 5CZXA 5IOLA 3K17A 1CJTB 4OYIA 4ANCA 5D77A 4Y2AA 5KFYA 4NYZA 2R7RA 4ZOSA 3POTB 4B02A 5JMNA 2YVSA 5GAEU 2PEHA 3MUMP 3CULA 1YJ7A 1SC6A 1X7VA 2B9XA 3U1NA 4N7TA 1HBMB 4BC9A 1GMWA 2ZC4A 2QA4G 2R2SA 2YTCA 1UETA 3R7SB 3W8GA 5FDLA 3UFCX 3GV5B 3OT9A 2VG6B 5LJ5Y 2OEMA 3Q8YA 2DXFA 4RNFA 3BYPA 4NLQA 3ZC4A 3WC2A 2ZVSA 2MGZB 4F50A 1IN0A 2XNRA 2GQ2A 4KH1B 3MTKA 4KHMA 2AF6A 3JTOA 1J5OA 2KDOA 4F02A 1DTTB 5C24A 1HWLA 3QIDA 4PYAA 1HQEA 2XLJA 2H1YA 3H5YA 4FBUA 4CLKA 4UZBA 5IM0B 4E2FB 3DKDA 1R0BG 1T03B 2KHCA 2OUGA 5B0AA 4NEZA 1AUDA 3QRPA 2BA9A 4IRDA 2I0XA 4X62J 4DUTA 4XPEA 2NPFA 1FXLA 2HFVA 1EKRA 4ZCKA 2M2BA 3PW7A 3HVWA 5AXLA 3TZWA 1P1TA 4B3RF 4K4XA 1RHKB 1QVGR 2G1DA 2BANB 3MCMA 4PWUA 2IAJB 2XHWA 4CYUA 1N52B 1VLYA 4ZP7A 4FBTA 4N76A 1PBUA 2FPHX 1U0HB 2KJWA 2RF2A 3JQMA 4MAKA 5A8KA 2CXEA 4DUYJ 1EP4A 2HIQA 3NGRA 3PJWA 4CH1A 2CJBA 4DCPB 2CJ9A 4ZITA 5FD1A 3NNCA 4Y34A 3M1VA 2C42A 1P6TA 3DRPB 3I4PA 4PCQA 3RG6A 1T0TV 2OSQA 3UVJB 3WZ0A 5MAOA 3PR5B 2B6AB 3AD7C 4ED5A 1Q82T 2GVZA 2QX0A 2GCFA 4R8UA 4BWMA 3ILIA 3QGHA 3M7VA 5F8GA 1FDNA 3LPEA 3MAHA 4Z2XA 4J9MA 2DR7A 1NZAA 1FWLA 3CMQA 1BQMB 2CZ9A 5KFAA 2QE5A 4PQUA 3DRRA 4OZ1A 1MROA 1IKVA 3BREA 3GONA 4HTIA 4UTGA 2G0JA 1KDNA 5LSOA 3GB0A 1F5AA 1DTQB 5E41A 1JXEA 3QSYB 3CJ2A 1N5SA 2VPWB 3L4BC 3MMAA 4QIGA 3V4MA 4CT9A 5DQHA 1IR0A 3MFHA 2DGSA 2FLOA 2IDLA 4OHXA 4QJVA 1TV6A 3I6PA 3G9CA 1RTIB 3D6MB 3MUVP 1YKWA 1TV6B 1JLQB 1LWXA 1TUGB 1XR7A 4R0JA 1WEXA 5HK4A 4UQGA 3RR8A 2DGVA 3C6UA 4TY9A 2CPHA 4Y2CA 3CCUS 3K8WA 3TAPA 1VC0A 3CXCR 2OTJS 1V5VA 1UFLA 3QLHA 3TOQA 4ED4A 1FXRA 1SJRA 1UVNA 2FUG9 1O5JA 3HFKA 3QGIA 3KK2B 1WNEA 3W1YC 4ZVSB 2EVZA 4DX8H 1D9DA 4RW8B 2R8JA 4L72B 2OPQB 3EUNA 4LF9J 2BKPA 1OQ3A 2DGXA 2WOMA 4DSEA 1DBDA 3MHYA 1RT6B 3KKFA 3LA0A 3RB6A 4OI4A 4ETXA 4ZMMA 1Y5LB 3BSNA 1BE4A 1BQXA 1Q95G 1VFJA 1CJUB 3I31A 3N6NA 3U7JA 5AE2A 1FVQA 2E7VA 5CABA 2CJKA 1PKUA 4DV6J 2MZJA 3FBFA 4TLQA 2VA3A 3AQPA 1F3FA 2CDRB 2YBVA 3AA9A 3GU0A 1NBEB 1FFWB 2B8PA 4YHHJ 2CPFA 3J7ZT 4ZVFA 3PY8A 3EGNA 2BMBA 1HD1A 3Q8UA 4FP9A 4LF5F 4JYAF 3OR2A 3GSDA 4EMDA 1RHRB 1PC5A 3B54A 5CYQA 5A8RA 2XS2A 1WF0A 4GO5X 2O3DA 3SCLE 2HNZB 4TU7A 3W61A 1BMQB 2KM8B 2C2KB 2HLUA 5KFXA 2J7KA 5HO4A 2QFJA 1EX8A 1JLAB 1ZM3A 2BKOA 2XZTB 5EWEA 2ASLA 4ECZA 2IM0A 4RW9A 1WSVA 1DTTA 1RB0A 5J2MA 5HLFA 3BS9A 4C8OA 3IWNC 1N33F 3AD8C 1N36F 1K1QA 2LVWA 4RUHA 4NI2B 1KLMA 4EEYA 1RT7B 2VJUA 1U2FA 4MIAA 4MYUA 4C11B 4F4ZA 5F8NA 5I42A 2AMCB 1D8ZA 1YBAA 4MK9A 2DNZA 3K89A 5CZVA 3M8PB 4C7QA 4DMZA 3OL6A 4TU9A 2CFXA 5J2QB 3FFIB 4UF4A 1SB6A 2DNRA 5H9FJ 4QBUA 1TL3A 1NUEA 3CJSA 2R7XA 1LWEA 3G87A 2QLWA 2C2NA 2DK2A 3H90A 3OD2A 4OZ3A 5D78A 3W7BA 1Z2LA 4ES1A 3RRGA 2IJNA 5KFNA 3X3UA 2IRYA 1KOHA 1SI9A 2KVQE 1VBXA 2QA2A 2XMVA 2HRYA 4KO0B 3ULHA 4WWSA 3SCJE 4PXDA 4ZPVR 1TKTA 4DQQA 4OX9F 3L7UA 3M32B 3ZFVA 3TANA 1XJWB 1IBKF 4IDKA 2RB7A 1CC8A 1MWYA 2VC0A 4O3PA 3KJQB 5I3UA 1PAEX 1EQ0A 3MM9B 1KC8T 4WBFA 1MROB 2KB2A 2DNNA 2KN4A 1N32J 3C6TB 4GVLA 3DOMA 5KG1A 1NCLA 1S7HA 3CCTA 3TAMA 1PGZA 5KFWA 3V6DA 1NB7A 3C3LA 5F8JA 3B78A 1RWUA 1R6VA 4WXWA 2YNIB 3HCXA 4FPIA 4M63A 5CYMB 1ZA2B 3VCDA 4U6PA 2W9AA 2R7TA 2G9OA 5EN1A 1WKLA 2DCLA 2A2CA 2YPYA 2WSCC 1MMLA 2JRSA 1OO0B 3ENAA 3EZUA 1H7XA 1OYEA 2BZ2A 2RMLA 3L7OA 4KV8B 3KFWX 4F4KA 4K5RA 4W4MA 3C46A 3BPDA 3B4DA 4F3MA 5MLCV 1NAQA 2ILZA 1HL6A 3BM7A 3PCOB 4MMOA 5C2CA 1NK9A 1IWGA 2HHHJ 4X4SA 2EEYA 2C2RA 1VRUB 3Q2SC 1TKZA 3MEDA 2UUAJ 3M6VA 1FFGB 3LANA 2Q43A 1FE4A 1X4DA 4DN0A 4ELUA 3J81U 3TUPA 2YWGA 4PWDB 3MMJA 1NDCA 2YKQA 2GMJA 5D3GB 2ZOMA 4ILLA 1KWMA 3T3FA 2YX1A 4L73A 4C8YA 1YJTA 1M5VC 3QT8A 1GEHA 1IBLJ 3C16B 3M2UB 3MECB 2CPZA 1NSPA 2VU5A 4M5JA 4I0WA 4ANEA 4P2XA 5L9NA 3EPGA 2ZJQQ 1WACA 2ZOGA 4ZHRB 1CG2A 3SFGA 2VBXA 2VOPA 1N36J 3IR5B 1F9EB 3NGKA 2IPOB 2KT3A 2YQ3A 1VRTA 2NSCA 2NUHA 2RUGA 1R31A 3CC2S 2W9CB 2ZWPA 3Q0AA 2F4FA 1UKUA 2GFFA 3BPSP 1VQ4S 1IUJA 2UUCF 5KFQA 1E6YB 1S77D 2BQUA 1GTEA 5A0YA 2MMYA 1UA1A 1REVB 2QL5B 3FKBA 4YFUA 2BJ1A 2BVZA 4OI3A 2DHHA 1N0VC 5EGYA 2B9WA 1N5YA 3RB4A 1HI0P 3M8QB 3DOLA 3LW5C 4I6AA 3V4IB 3TO8A 2J6SA 3JSMB 5B0CA 2RH3A 1PJ5A 4WU3A 4G3IA 2UXCJ 4UW2A 3O5TB 4WP9A 2V5HG 4RBTA 2MZSA 3IN5A 2E1MC 4PPDA 1URNA 3SDEB 2RJZA 2QTWA 3MM6A 3FZ2A 4HACB 8ATCB 1LFPA 4K4YA 5DG7A 2W9CA 2B3TB 3HSZA 2WVDA 1X5SA 5DZ6A 2WONB 4CO2A 5KFDA 4K4VA 1C1CB 1B7YB 1U1KA 2OTLS 1ZAXA 3LP0A 1TUWA 4CO4A 3TARA 5ETKA 1N48A 1L3VA 3HHKA 4ZCIA 1SKSA 1HMVB 1JXVA 3C15A 1EHWA 4GMKA 4J91A 3CJKB 1V3ZA 3SMZA 4WYWA 4U95A 3KMSA 2V4QA 3O3LA 1C1BA 1VQ6S 2NQPA 1FD2A 2H54B 4BWJA 4J9SA 1Z1ZA 2BABA 5KFLA 1JLBB 2OPPA 3MPUB 1V3RA 2HWHA 4FVMA 4ZKAA 3OTOF 1ZBTA 2OSRA 2RRNA 4DF4A 1L5UA 3VHQA 2DIVA 2CQ1A 2AJ4A 4MH8A 4DR6J 2MSTA 2OHDA 4NRUA 1WWHA 4P2SA 5KT3A 1RYSA 4M95A 4I2PB 3GILA 1NLKL 2XNQA 3FQKA 1RBLA 2EFPA 1U02A 2NXNA 3ZZUA 1C4CA 1HBUA 2G2YA 1T95A 2CJQA 1WOOA 2CPJA 2CQ3A 2POKA 4JI8F 4ZLNA 3H5UA 1N4LA 2HMIA 4YB6A 1WELA 3QT5A 1NRKA 3QPIA 4DF8A 2DBBA 3CCQS 1FNOA 4DSIA 2AJ0A 1QD1A 4OYOA 1SKRA 1VI7A 2QSWA 1WG4A 1XN9A 2RF2B 1GX6A 4NZ6A 4EU0A 4Y00A 3Q8PB 1JLEB 1WKJA 3MMCA 2D7SA 2VPXB 3DLLQ 1LW2B 1GFWB 4J5OA 4XIUA 1AZSB 2YNFA 4NOHA 4DPOA 4KE5A 2AD9A 1U09A 3MD1A 3IM8A 2KKHA 4LR9A 4ECTA 4O0IA 2YH0A 2HAIA 4IRCA 4YS2A 4C9DA 1AA1B 1TFWA 4G65A 1DFDA 2KZMA 3ZNJ1 1SJ4P 4CT8A 3OUYB 3PKMA 3CO0P 3T6BA 1FDAA 1HYSB 1TQLA 1CBKA 2HGLA 3RB3A 2A3JA 1S59A 2RQKA 4DU8A 2F5GA 2K1RB 3HLUA 2DEJA 1PIEA 2M8HA 3MWBA 1A6LA 3VTIA 1C0UA 1NH8A 4ZJOA 1P9YA 1N32F 2CUYA 2J8AA 1HBMA 4OQJA 2GIRA 1TL4A 2PA3A 3MCSA 5B0FA 1S1XA 3FFIA 3ADAC 3JSBA 4NZ7A 5DO2A 2FC9A 3LUYA 1S12A 3GJSB 4J9LA 3PJXA 1V3SA 4DX6A 1CSJA 4B3OB 1IVZA 2J9CA 3GR0A 1SH0A 4LJMA 3OBIA 4QOTA 4RX6A 2RDIA 4U7UD 2DNHA 4DPXA 1U45A 2J6UA 1XWLA 1J5EF 2BQ3A 2I9SA 3CCRS 2RKIA 2J76E 4O4GB 3VF0B 1NHUA 1RT5B 2E7WA 4URGA 2GC8A 2JVRA 4F4WA 2WW4A 3U1LA 1T8EA 3UO0A 5J2MB 3N28A 4YB5A 2JZ5A 1KNZA 3JYTA 2QLJB 2V9WA 3SV3A 1RA7A 1Q79A 4PXCA 4I2QA 1JLGA 2AKWB 3M6WA 4URQU 1KKHA 2CKWA 3TJ9A 4LF8F 3A8EA 1R0AB 4X66J 4KGKA 3HM9A 3AB4B 4GKKJ 3PKYA 2D3OR 4KHPJ 2ZH1A 2DNQA 3PRBA 1RT4A 2BJ8A 3EDQB 4LRDA 1D3WA 2N4CA 2Z4PA 3M8YA 2WONA 2MQQA 4QWAA 2CPXA 3NGDA 4LFBJ 1W7WA 1WHWA 4P72A 4P9SA 4DQRA 3BBFA 5DGAA 4ID5A 2FVPA 3CJRA 2RU9A 2VBYA 3W60A 2OIHA 3F56A 2BOAA 2LEPA 2HAFA 2OPSB 2MZ1A 2VPZB 2UV8A 4O44B 4K59A 4ZN3A 4DZ6A 1YHQS 5JJBA 1E6VB 3TA1A 3E01B 2E1PA 1FX2A 3QNWB 4P52A 4DV7J 3BGUA 3KJNB 3JQKA 4EK2A 1APSA 1FDBA 2HBRB 3NS6A 2B51A 3HHLC 5HQMA 4UY85 4O4RA 1U1MA 3HK2A 1IR1A 4WE1B 5SZTA 2JHEA 4EWTA 2OMOA 3TZYA 4GKKF 2DH8A 2N82B 3SQGB 4C4WA 3A3OB 2HHTA 1MWQA 3TZXA 3OW2R 1EB0A 3DLGA 9ATCB 4EYHB 5E3PA 4ZHRA 3N6LA 1Q8LA 3MDFA 3QFWA 4HT5A 4NPOA 3TI0A 1QSSA 5AXKA 4GKJJ 3G2XA 5ETRA 4LSNB 2KYZA 2QIFA 3H42A 3M2UA 1BD6A 3OLBA 5DLFA 4LF6J 2C2EA 5M2PA 4ECSA 1KQGB 4HHJA 5KFJA 5J2NA 1BQNB 2YKAA 2HBZB 2E29A 4NLSA 1IQTA 3MPWA 2PD1A 2P6SA 3KLGB 4P74A 3H2LA 3ETOA 3GFHA 2VICA 3M9NB 4K4ZA 3JXOA 2HWIA 2DRAA 2KM8C 3H4DA 1IKXA 3FBBA 3BJYA 3R1HA 2BR0A 1KQFB 3BDPA 1YQHA 4NLRA 2GVDB 2ZM6F 3V4IA 3CDEA 2I5JA 1DLOA 5LL6d 3ITHB 3K5OA 4C0OC 2R7WA 4NE9C 3W65A 3M1VB 4CLPA 5CYMA 1BWEA 1FJ7A 4B3MF 4AUKA 3D7SB 2IYGA 3W9JA 1FWKA 1W25A 3SEOA 4K4UA 2L48A 4OV1A 2FGOA 1X9WA 4YQWA 2MPUA 2YWWA 4ZJLA 2AYEA 4E8UA 2QG9B 2KXNB 2KJVA 3RGIA 5BXIA 1XR5A 2ASYA 2DJWA 2IM2A 1M5HA 2MQ8A 1SJFA 2WZ1A 3TZZA 3RJMB 4ZVOB 1D9FA 2M52A 4K7QA 3GP9A 4FKYA 2GGPA 3CJ8A 3M2RB 1JLCB 3PXGa 3MM7B 1FKPB 5F9NA 5L1KA 4FF3A 3U27A 1R8BA 4Q44A 4JUZA 2G0IA 4CTAB 1RABB 4NLPA 5KG4A 2MY8A 4YR3A 3QJJA 2M88A 4OI6A 3KHHA 4WFBQ 3DLEB 4KGMA 1YBUA 2DNMA 4USUA 4YB7A 4XDCA 4DG1B 2JH3A 4B9MA 1ITPA 3CJQA 1TL5A 3J7Z5 4DN9A 3BH6B 2V8GA 5DJBA 3DI6B 2OFHX 3KK3A 1VQLS 1S1XB 4XO0A 5B08A 3FMWA 2P9EA 5C7PA 1R3NA 2EC2A 2GHWA 3KLIB 1KTQA 3FZBA 2QJ3A 1F1BB 2HSEB 3G6XA 4A8MP 2WK4A 3H25A 3K5LA 5T7LB 2XSJB 4JI2J 3Q8QB 2HNZA 2O1PA 3KTQA 3AJ1A 3UI3A 1S76D 3NCPA 4L75A 4RW4A 2ZZTA 4ZDNA 2DXEA 1H2VZ 2DHAA 3H59A 1DJ0A 1Q78A 4QQBA 3ZTSA 4D3GA 5ADZA 3KLHB 2FZKB 2IVFB 2U2FA 2XMUA 4W92B 1SPBP 4RW6B 5A2QY 2YNFB 5EUHA 4NXNJ 2K8GA 3H5XA 2X1BA 4Y6IA 2R7OA 2YKPA 3VALA 4CH7A 4WXOA 4JI8J 1VQSA 3G86A 3AXMA 2CAJA 3IG1A 3M8ZA 3M8SA 2XS5A 3OVBA 1GNKA 3NP5A 4LMZA 1RTDB 3MR5A 4H4MA 3H7HB 1G3OA 1N0UA 3BGFA 4I7FB 2YKNB 1LXJA 4AXIA 4NXMF 2LFVA 3QLHB 3QWPA 1MNEA 2CPYA 5AT1B 2MSSA 3M8PA 2BXJA 2E7XA 3RZAA 1FRXA 3W2WA 1CJKA 4A48A 4F0MA 1U48A 2E9TA 2ZZNA 3FNNA 1YIJS 2PIIA 1M5SA 3W2WB 3T41A 4LF4J 2Y8YA 2C2DA 5U47A 1Q8IA 3LP2A 4ZIWA 3U02A 5DS7A 1KONA 2RDDA 3PNIA 1NNDA 3HD2A 2HURA 4OZ2A 1T11A 3QSIA 3OSNA 3KUHA 2ZBIA 4DQPA 2IY5B 5GVQA 4B9NA 2DR6A 2GA7A 2LQ5A 2Z2YB 1QAJA 4KTQA 2K1RA 4NCBA 1XTZA 1RE1B 1Y3KA 4CLYA 1KLMB 3TX8A 3EICA 1EIYB 4GC7A 3BO4A 4R8UB 1VQ7S 1F60B 3TUZC 3CDAA 1T7PA 2VBWA 4XK8C 5KG5A 2W4DA 3WIVA 2P9GA 1RADB 4J9UE 1XQIA 1WTFA 1B4SA 2WHOA 5CCMA 2Z2LA 3G4SS 1QUVA 1UFWA 3B6BA 4P10A 4B3SJ 1NM2A 2CQ0A 1VJWA 2HKEA 4RUCA 4QU6A 3RAMA 5HAOA 2J6TA 3D68A 3L7PA 2KT2A 1Q53A 2HHQA 1K8AT 3UN2A 3PFEA 4JI5F 2UUTA 2W2QP 4N8NA 2N7CA 2R8KA 2BJ3A 1S57A 2BW7A 2KXFA 1X5TA 2DNYA 3CJTA 1X9MA 1OMSA 3J81Y 3W9HA 2BBEA 2H4WB 3RBZA 2RRAA 5A2QU 3SYZA 2DGTA 3LF0A 1HNVB 1NPPA 4U96A 2HQ3A 2JL9A 4YR2A 4HH1A 4F3OA 1R8PA 2VG7B 4C2MA 1FESA 2UUCJ 3KG1A 4GC6A 2JC1A 2O66A 3B82A 4N8OA 4QYZJ 2R7UA 1A7GE 1PJ7A 1EAYC 3NRBA 4I56A 1H72C 3GCWP 3CEDA 1QM9A 1S9EB 1FDDA 3HULA 4J9QA 3H98A 4PPZA 2DR8A 3HJFA 4X4NA 3T1YJ 2V4RA 1P27B 4X65F 3OLAA 3HDSA 3IGNA 3GIMA 2VG6A 2X7IA 2A6MA 3B4MA 1FERA 3MAAA 3CJ5A 4NLYA 2MY7A 1FKPA 1UVKA 3KUEA 5DETA 1DQ9A 3UCZP 1FTRA 2UVWA 1C1BB 2QEXS 1FHTA 2KYXA 1JIHA 2OD6A 1ZZFA 1FKOB 2PEBA 2ZD1A 3D1QA 3NXZA 3SCIE 5KG6A 1AFJA 1CEZA 2QSFA 2PMHA 4HI1A 4GVBA 2EK6A 4RO0A 4NXMJ 1T9TA 4P71A 1YJ9S 2JX2A 4YDDB 4WYLA 1FJGJ 2FHJA 2GW8A 1VBZA 2BE7D 3P5TL 3M8WA 1XNQF 2F7VA 1S1VB 3PYDA 4RWXA 3NNHA 1S1WA 4NX9A 1NK5A 1NEEA 2CWKA 1X9SA 4K0KJ 2ZH2A 4MT1A 1U8SA 4YY3F 2FJXA 1RWXB 3NCRA 4K4SA 3MMBB 2XI2A 4ZVHA 2CVEA 4CLSA 1TU0B 1SJQA 3Q89A 5AXMA 2QL7B 2MXYA 2RNEA 1HLWA 1U26A 2PMWA 3LPYA 2V63A 2PE8A 2G1HA 3MM8B 4JB8B 2H9ZA 5G0RB 1BGXT 4OHVA 2W9BA 8RUCA 2RU3A 1OS5A 2NYHA 4PEOA 3TEHB 3DDKA 1KVJA 1X4AA 3MF5A 3UPFA 2FHJD 2NSBA 2QLXA 4KIAA 3ZZYA 2RDJA 4LF7J 1X5PA 3EZOA 3M05A 3MUTP 4Q2MA 4JV2A 5IC6B 2Q79A 4OV6A 1NZ8A 1FWPA 3SV4A 4A8SA 3DOKA 1RAOA 1N6QA 3M2VB 5M2UA 2GJ2A 1RT2A 2QYGA 2OI2A 2Y0BB 1RDRA 4O3SA 1UZHA 3MAQA 3F41A 1EJ7L 4K5SA 3J81j 1IWAA 3R7BB 3SQGA 3V6KA 5IM0A 4F7VA 3UD4P 5KAKA 1U1RA 1KFSA 4HT7A 3A12A 5HMYA 1RTJA 4P2FA 1S6QA 3R9LA 5DDQC 2W2OP 1WC4A 2DNPA 2HGMA 2LXFA 5EX0A 4J7CA 1KQKA 2BOPA 2UXCF 3IBFB 3L95X 1FEHA 3DLHA 3POTA 2P2CB 2CQPA 3MM5A 4D3HA 4CDIA 2UU9J 2GS8A 3VGVA 3H5SA 1ICEB 2R3VA 2VQEJ 1Q4RA 5GADU 3HFZB 4JI7F 2HNDA 1MU2B 4FF2A 2LEBA 1RAFB 2C3MA 8AT1B 3PW2A 3D0GE 3DRXA 3BKFA 4O44A 4OX8A 2ADBA 2HNYB 2EFGA 1I6JA 1PJ6A 1HBNB 2F65A 5F0WA 2WCXA 1HNXF 3DXBA 2B43A 3AFGA 1U6ZA 3MPVA 2CIMA 4ED1A 2H65B 1WJ9A 2ABYA 3HKZD 2CNKB 3K59A 3KJVA 2ROPA 2VODA 1U24A 2YXLA 3VGUA 2MZRA 1YDLA 2ZUGA 4HEA9 1Y9OA 1S99A 1HIYA 2OPRB 3HHEA 2LKZA 4KFBB 1Y5NB 2HQFA 4OJGA 4PZVA 3CGIA 3VQSA 3KJVB 2OAUA 3W8PA 1WF1A 2MKHA 3H0PA 2IVYA 2MKSA 4JI1J 2HWTA 4UQTA 2BJDA 3I0SB 5DG8A 2KHDA 3DLJA 4DL2A 3DLBA 3OTBA 2IA6A 2NREA 4QYRA 3HSGA 3CD6S 1V6HA 3Q24A 1M5PC 3PW4A 2PT0A 1HBUB 2FJAB 3W2VB 4RW7A 1NSAA 2QN6B 2R7QA 3AY0A 2XEXA 3CCZA 3LAKA 3ILLA 3UDLA 4N41A 2OMLA 3R3TA 3MR2A 4HI2A 2G2ZA 2XGQA 1LWCB 2IHR1 4OZ5A 1L3SA 2W01A 3DYAB 3IBWA 3MM5B 1JLFA 4YY3J 2V8HA 4C8NA 4CNYA 4B3OA 1L3UA 3CT9A 4DDFA 2ZKTA 5JVGQ 1M1KT 1Z2ZA 4H4KC 4UT4A 2KG0A 3R2DJ 3A13A 3PR4A 1VQKS 2YNGB 1T3OA 2RD5C 2AGPA 3EVOA 3EGWB 1D09B 1VRTB 2F3JA 4ED7A 1I51B 4OYBA 1NJXA 2AX1A 5AJ3J 2B0GA 2V9KA 3PACA 2C3YA 3CJ3A 1RAJA 2LLZA 3CD7A 4QIEA 3FRZA 1RWVB 2CG8A 4YUDA 2CJAA 1GT8A 2GNKA 3VGSA 7AT1B 3CCMS 1S5ZA 2ZKUA 3OTDA 3JSRA 3K5MA 5IFMA 5T14A 1R0CB 4ZPBA 4NLDA 3C16A 3MECA 2ZITA 2MKKA 1TMJA 4V19X 3MR3A 1RTHB 3HZEA 4IG0A 4PQAA 4IG3A 2KZZA 4EZ9A 3OR1A 1D8YA 2BUNA 2DR9A 4WZMA 2BJEA 4ED8A 1UP1A 1PG5B 5B0DA 1BQMA 1JMTA 4KB7A 1CULA 2B4OA 3HVRA 4IRKA 1HWKA 1R8HA 4QWEA 4UY8T 1LKZA 1LW2A 4PWDA 3QATA 1GXLA 3QT7A 1RWKB 3HJVA 4IR9A 2AT1B 5HANA 2NYIA 2Q1LA 3HX9A 5DRKA 1XIQA 4ECUA 2IBKA 3K0JA 1NPRA 1PYSB 4K50A 1TTHB 1J5EJ 4N77A 4CLUA 3VV2B 4IH5A 4MKVA 2FYXA 3KK1A 2JDJA 3BGOP 3FSYA 1IKYA 2XZDB 5KFFA 1EP4B 4ZVPB 1YJUA 2VG5B 4QWCA 3OJSA 4L76A 2C2MB 4C98A 1RAGB 1RWNB 4B17A 1D1UA 3Q8RB 2EW9A 3QJPA 4OI0A 3A1YG 3CDUA 5IWAJ 3FCWA 5A76A 4IR1A 2P6TA 4RU9A 3G96A 1VHFA 3IWLA 1YJNS 4EZ6A 3LWMA 5ETTA 2H5JB 1X4GA 2CA9A 1HNXJ 3ET6B 3DGPA 2ZH7A 3UR3C 4HL9A 1FFSB 4RBUA 4NLWA 1TK0A 2H5IB 2FLPA 3DGPB 4K2JA 4NLGA 2FJVA 2V4JB 2NCKL 3PVXA 3DMJB 5ETPA 3C15B 1O51A 4P7VA 3CJKA 2XMTA 4Y28C 1IM4A 1ACMB 2HEKA 1JLFB 2VD3A 2Z2MA 1RCOB 1RHMB 4NEYA 2HK2A 5EX3A 2R8IA 1U4BA 4DV4J 4JI1F 5L38A 1U47A 4M5DB 1IKWB 1HI8A 5AXNA 1FRIA 2RS2A 4KGXB 3SBMA 2R2TA 2R8HA 2OH2A 1R27B 4DR4J 2IJFA 2Z57B 3MEDB 2R9LA 2AGQA 2EFNA 3MM6B 4HACA 3BBBA 3M6UA 2WAQD 1W26A 2R7SA 4QWBA 2K7KA 4WE1A 1FK9B 1OYDA 4HKQA 3NWRA 1XEZA 2ZH6A 2CJXB 2LQBA 3E51A 3MEGB 3V6HA 2PI5A 1N34J 2PGCA 3T1AA 5E0OA 4IH6A 1WSRA 4M5NA 3NMRA 2J0XA 1E6VA 2ZOFA 4I1TA 5K8PA 3T1HJ 1WF2A 4WFZA 2YX4A 1MG7A 3MEEB 2ASJA 3JAMU 3CNQP 2E9RX 1PYOB 3AD9C 3TQ1A 2DH7A 2ACMA 1RT1B 4KYZA 5RUBA 4BS2A 3Q23A 5KT6A 2WVFA 4IG3B 1RSCA 2ZDPA 3NGUA 2JOQA 3SSRA 1MWZA 4LF6F 3TAQA 1YI2S 1VOMA 5LMUJ 1AZSA 4OHZA 4ZLJA 5L1LA 3KLEB 3RRHA 5HP1B 4IQXA 1DURA 4DR1J 4FN5A 3J7A1 3W5ZA 4EBDA 2ALYB 4NYPA 1ZAVA 1HNZF 5F8HA 3CCES 4WU2A 2YQ1A 2VF3A 2D3UA 4O0NA 2YKMA 3PO5A 1RI7A 5L9XA 2HVIA 2AEFA 1CQMA 2H48B 3I5CA 4MTPA 3W5XA 4CLTA 1U1LA 1XMOJ 1JNRB 4DI6A 4XPCA 4B3MJ 5D8HB 2GO9A 2GHVC 2HZAA 4F8RA 4KY3A 1C0UB 1RBAA 4J9RA 2A0FB 1ZA1B 4LIWA 5A6PA 3L3CA 1RWPB 3FK4A 1Q0NA 1S9GA 2PDAA 2VONA 3GIKA 3PEHA 5C25B 1UVLA 2OEJA 5L39A 3KMQA 2PFFB 2QC3A 2FGCA 2W4CA 3FDSA 4FYVB 4MK7A 1JLAA 3TRGA 2C22A 1VQ8S 2CQHA 2KO1A 1B0VA 3HT3A 3EE3A 3FSXA 3OL8A 1WOPA 1QSLA 4WTYA 1RAAB 2IFXA 2DCUB 2YWHA 2Z56B 5JXSA 2BW2A 3ELHA 5KFUA 4IH7A 3GIIA 3CCVS 4A8YA 1S0OA 2W9BB 2J0QD 3HF5A 3OUYA 1U7LA 4DHVA 1GMUA 2ZNZA 3BGRB 3HHLD 5E3CA 4PG4A 5B0EA 5HSPA 2JLGA 4K4TA 4DLGA 2EXUA 2Y9HA 1BY9A 5ITHA 1GH8A 2OGUA 4Q7AA 5F8LA 2C2ZB 4NA1A 4EGLA 3QZ7A 2NZCA 3EWGA 5GAGU 2HIYA 5F41A 2IIHA 5A8WB 3N4WA 2XMMA 1DRZA 2D3ZA 4ZA1A 4DV3J 4Q8EA 3MEEA 2Y8WA 1P8GA 4KKOB 2O01C 2V0NA 2FQQB 3JAMY 4DUZJ 3HHNB 5KG3A 5HMWA 4FPRA 4NLVA 1MSWD 2GIFA 3TVKA 2XO6A 3EM1A 1X4HA 3UWTA 3I0RB 2HVZA 2BJ9A 2QMWA 4M5IA 1IBMJ 1RKIA 4HDGA 1RZMA 4MFBA 2X3GA 1FA0A 5KFVA 2HLTA 1I1GA 3GYNA 1JQGA 1R0AA 2QMUB 3G82B 4ZVGA 4WKYA 1RTJB 3WQPA 1KHWA 4DFPA 3DHXA 5THWA 4ZP6A 2QA1A 4KR0B 3VAKA 3RRKA 2QV6A 1HWJA 3IS9B 2JFDA 1N54B 3R1LA 1S1TA 5LMUF 4ELVA 4DG1A 3DDNA 1S9EA 4I64A 3SSQA 4BC7A 1F2HA 5E2QA 3MM7A 2DR5A 7FD1A 4U9RA 1TK5A 1D9AA 1VQMS 2F1FA 4ZS6A 1PO6A 2QT7A 3C14A 3GLJA 1FNMA 2LU1A 2HHUA 2MQPA 3S1TA 3Q8SB 1X31C 3NS5A 4PRFA 4ERDA 3QIPA 3K7RA 1UEUA 3ZTQA 4CLWA 1LOUA 3OR2B 3R7NB 1DQ8A 1A0OB 3DXSX 4ZP8A 4S0MA 2XM3A 3N6MA 2HFZA 2VIHA 1B64A 4CLLA 1Q81T 5ETOA 3I4HX 1U0SA 3Q83A 3SDEA 1UVMA 2VL1A 3T5JA 3BN4A 4NYOA 1SQGA 2GJFA 3LAMA 3KK1B 9RUBA 4EBCA 3UD3P 5A0YB 3NMAA 1F6TA 2VFUA 4G1QB 4UOGA 2RSQA 6FDRA 1QY7A 3DRYA 1DLOB 4FXVA 4OYWA 3ETMA 1QAXA 2FVRA 3E2EA 2A10A 2OPQA 2K3KA 5KG7A 5D4PA 1RXOB 3AB2B 4ES2A 3QIPB 2ZBQA 2EK1A 3DLKA 5HI7A 1NHVA 1Y3JA 3R6GB 4YEAA 5CQGA 1VS3A 1K9MT 1IBKJ 2APOA 2CQIA 3RU0A 1HNWJ 3QRQA 2DT9A 4OYXA 1UVIA 2IC3A 1QUPA 1UZDA 2ZH9A 1SV5A 2UVVA 3FCHA 3BR8A 1YG0A 2E44A 3W5YA 1LV5A 1YSJA 2WBRA 3I5AA 4I4BA 1FD8A 4EYIB 3AAWB 2HVDA 5HBMB 4ED3A 4KO0A 3ZZ0A 4TQSA 2FD2A 5D4LA 4FKXA 3ZNUA 3V81B 1CVJA 2LQ9A 1WG5A 1URRA 3GMGA 4LUBA 2EKYA 3GV7B 1Y5IB 3GR1A 4A8KA 3O6QA 4X4QA 3H20A 5D4NA 1DQAA 3M9MB 1TVRA 1ZPWX 4MFBB 4UUWA 4Y2MA 1SJ3P 3DU6A 2GAHC 2NR0A 4LVOP 3DYAA 4FDFA 3WBZA 1AUSL 3RR7A 3CVKA 1I3OB 1JJCB 2DB1A 1HR0J 2IDEA 4PYDA 2GVZB 3AH6A 1UA0A 3RAXA 3G6VA 3TVYA 2CJYB 5KFOA 1TKZB 4O3OA 1XMQF 2UVUA 4F4XA 2D9PA 2F8EX 2VH7A 2XWXA 4NA2A 1RU1A 1TL7A 2Q6CA 4FYXB 5HVHA 2NS1B 3BQ1A 3V6DB 2X51A 5IV4A 3HHDA 4RW9B 2AEJA 5A8WA 4DL4A 3GIRA 2JEFA 4LF1A 5LSRA 3I0SA 3OXGA 2DIUA 2X1AA 2LECA 3QWUA 1U1OA 3DGVA 1TFYA 1F9HA 5AE3A 1UPPA 2LQ8A 4QWDA 1XMBA 3D5MA 4KJIA 4L74A 1ZM2A 2OPRA 2W4PA 4KFBA 5CAAA 1S6PB 1RT3A 1B0PA 1XK8A 4ZIVA 2X1GA 5C42B 4P73A 1NKEA 1VISA 5IQ6A 2VQEF 1U25A 1GMWD 2DISA 2W1BA 1U6BA 1T05B 3D3BJ 5M2RA 1JLGB 2KXHA 2LXUA 3VAHA 1DY3A 1NMEB 4LRFA 2CNNB 1LXNA 1G7CB 2E5LJ 1RHUB 2EFVA 2FY8A 3CDWA 3WX8A 4B3RJ 3BSOA 3NEKA 3R5CA 1XMQJ 1VQ9S 2B9YA 5HROB 4MIWA 2RKIB 5ETMA 3PG9A 5EHHA 2XY7A 1Y11A 2H51B 3DRSA 4V19J 3P49B 3CWJA 4LRBA 2KT5A 4C6AA 2XCAA 3T1HF 5EWGA 4ZLLA 2HZCA 2PI4A 3RBEA 2RUSA 3PIOQ 4F26A 3FEYB 2CADA 3D6HB 2E5JA 2G13A 3CO9A 3PYEA 2NXUA 3THTA 4NXNF 3W9IA 3D9BA 1DAXA 4M8LA 3HMJG 1NKCA 5LM7E 4B9VA 1NH7A 4WP3A 1NKBA 1H3DA 1KVIA 1NDKA 1SL1A 5KG2A 4AFFA 2N4DA 2CQBA 4Q45A 4LFBF 4NLUA 5LT5A 4RL1A 2XO7A 1YJWS 2HFNA 1SCJB 2ZJPQ 5KFTA 1WOSA 4DV2F 2ZH4A 1Y7PA 1RHJB 2GGPB 1NXIA 2BM1A 4FNIA 3PX4A 4CO3A 2ZEJA 4I68A 3K2YA 4WK1A 3UDEA 4DV1J 3R5AA 2FVSA 4IUFA 3QRRA 4DFMA 1SC1B 1S6PA 1TL7B 2I2YA 3Q2TC 2QL9B 3NCQA 1AT1B 2V2ZA 2Z8QA 4Q5VA 3BQ2A 3PV8A 1LK5A 1ZZNA 3RBXA 4ZVRB 5GAEI 2RQCA 1HI1A 4UOCA 2RQ4A 2I8EA 1ZOTA 2XYGB 5DM7Q 3QGGA 4AT1B 5KOWA 1S7IA 2LP4A 2W7OA 2M8DB 4X4UA 2ZUAA 5KFHA 4OHYA 3NGTA 5D0RA 2NXEA 2HHWA 1RT6A 1TKXB 2FZCB 4YHHF 5FJ4A 3PX0A 4N5SA 4X2BA 1CLFA 3CJ4A 3AOBA 2PO4A 4TLRA 4C3KA 5CA5A 4IFVB 1GAOA 2VB6A 1SUQB 5IT9U 2B4PA 2M7SA 2FC8A 1BQNA 5E7OB 1CQNA 4A47A 4O3RA 1UWBA 2IC3B 3TYTA 3GQCA 5CXTA 2XCPA 4NCAA 3EVWA 3EGVA 3VAJA 4OI1A 1W2IA 3GJQB 4KAIA 2AYBA 3CW2C 3MEKA 2Q66A 5HBMA 4HR2A 4AL7A 4PQUB 3GV8B 3DLGB 2E5IA 1JJHA 2KRRA 1IBMF 1M90T 2Y1IA 1TKXA 3T5KA 4LFAJ 5BR8F 1K0TA 2ZC3A 3NGSA 3CCSS 3QO9A 4MKAA 2FJWA 4CO1A 5KFMA 4WZQA 1FRLA 2VV5A 3DRRB 1VIOA 2W8KA 3QJLA 3GZ7A 4C8MA 5IT4A 1OSCA 5B0GA 3FCVA 1ZS6A 3RBDA 3OL7A 2HHVA 1IM6A 3BV8A 4DJBA 4RNMA 4F67A 2BM0A 3BF4A 4NWBA 4R25A 3TR5A 1S1VA 3HFVA 4WFNQ 2BANA 2HHPA 4RU2A 4YB1P 2ZHBA 1CC7A 2AWZA 4CRJA 1FKAF 3GYGA 5G4DA 5SUHA 3CD0A 2V2VA 2ZH5A 3J7YI 3MMBA 2CG4A 4OZJA 3NWGA 4DV4F 3QGPA 1QAYA 1CJVA 3ILOA
chains in the Genus database with same CATH topology
1K73T 5GMKa 2JLEA 5BYSA 4X62F 4FF4A 3HO1A 3TUIC 2EWHA 4NLTA 3H40A 4QW9A 1VQOS 2CPDA 4QIFA 4C3LA 2XWYA 1D0EA 4QU7A 1W2BR 3UDCA 4LSNA 3D54A 3JTNA 1RT4B 3QAUA 5K5MA 5B0BA 1SKWA 1K0VA 2CQCA 2B56A 4QR2A 1LK7A 4NMLA 2BYCA 3CCWA 2Q3PA 2HVIA 4O4GA 2JFKA 1WHXA 3OXLA 5A6WA 1HHTP 2G0CA 2XI3A 2ZE2A 2V4JA 4C3MA 3I32A 2DTJA 3TVZA 3CCJS 2LDIA 1KSPA 2M5YA 2G4BA 2FTRA 3ZZTA 5DG9A 4KPYA 3MXHP 4QIWD 1IKVB 2AX0A 4H54A 3F73A 5JVHQ 4N47A 2RIJA 4ED0A 1WEZA 3OFGA 4OLOA 1S10A 2R7VA 3UCGA 5E3QA 4IYQA 1KHVA 4B9LA 1ZYQA 2J9DA 1FF2A 2D9OA 4PG8A 2HYIB 5KOXA 2YKNA 1KS2A 1JKHA 4O23A 1VQYA 2M3DA 2Q6BA 4F2SA 1Q7LB 5F3TA 4OJ3A 2CQGA 1QTMA 4DR2F 4E0DA 2FJBB 2KFNA 3K57A 4OL8A 1UJ4A 4IFYB 2IA0A 4X4VA 4OIXA 3IFEA 1RT3B 4A8WA 1T94A 5LSLA 4M1KA 3IRWP 3VAFA 4QPTA 1RGVA 2LU2A 1JLEA 3N9UC 3JSYA 5KG0A 2EPIA 4KSEB 3J7YU 2LECA 4AYBD 2DPIA 4CI0B 3QAEA 3U1MA 2M9KA 1OPIA 3BQ0A 4EO8A 2R2UA 4JV1A 1SIZA 3T5LA 3HVTA 4ICLA 4QZVB 3RB0A 1ZM4A 2C28A 3MMCB 1RT5A 1TAQA 2C3UA 4O3QA 3G71S 2AW0A 4K4WA 4OFZA 4X66F 4X4RA 3KWMA 4NRTA 2E1AA 2F8MA 3KLFB 2WB4A 5DQGA 1TK8A 3KLIA 5IQQA 4A8OA 1F9FA 2Y0SD 3ZZOA 4LFBF 3QYYA 1U2RA 1TVRB 3CC7S 1SIWB 3US5A 1LWFB 2GQQA 3C6UB 3D28A 4M5DA 3FVYA 2E5GA 2UUWA 3G6YA 5I4MA 1RTIA 2BRKA 4KHRA 2JEGA 3V2UC 2F40A 3OV7A 3C66A 3K58A 3KHRA 3LWLA 3DM2A 2QMXA 3IAS9 3MMAB 2AQ4A 1KTVA 2W7AA 2MQOA 5DGBA 1M0SA 2O67A 4KRWA 1NK8A 2QYCA 4MKYA 4DSKA 1XMOF 1O0PA 5GAGI 3M30B 4IFYA 2I38A 1JNZB 4ID8A 2B6AA 3JTPA 1ZH5A 4ATNA 1NJIT 2CDQA 3FSIA 1QLNA 4GKJF 5IT0A 2IMWP 2MQLA 1Y4ZB 4ZPWR 2MHEA 1VQPS 1KN6A 4PUOB 4A8QA 3BEGB 5KFEA 5DM6Q 3KK3B 3PW5A 4LF9F 2B7BB 2I5JB 2ROGA 5DDRC 1TUVA 3V6JA 3KNGA 3T9ZA 3M8QA 2OLWA 5DDPC 3I9V9 1C2PA 1IKXB 3OVAA 3P6YC 4Y3CA 3PW0A 1IQZA 2F9JA 2ROEA 3FEXB 1J2VA 4C8KA 3E3XA 3G6ES 1NO8A 3PRDA 4DV1F 2L9DA 1Q16B 3ENVA 1RTHA 1X0PA 2OD4A 3ONQA 1UWBB 2CQDA 4QOTA 1S79A 2IVMA 5AE1A 2PN6A 1T05A 3V81A 1SUQA 5F8MA 2YNHB 3CPWR 2L41A 3HPOA 1UMJA 2LQJA 3M2VA 3P3DA 4IO1A 2F9DA 2GO8A 3HI9A 4TYAA 3F44A 4DQIA 3NBPA 4NLXA 3TA2A 2J9DE 3CC4S 3R5DA 4DR1F 4FYDA 3OTEA 1X4CA 3IR6B 2HHSA 1IKYB 2A1BA 2DHXA 2IM3A 2KTQA 2HVHA 1JK9B 1FRMA 2GHPA 1KD1T 2X1FA 4P6QA 5J1NA 3OXFA 4DL0C 5L8RC 4G1QA 3ZZZA 4WIIA 2AJQA 3K5NA 4X84A 2J7UA 2EC0A 1REVA 1PC4A 1U6BA 1NJWA 2DHSA 2K7JA 4L6V3 3OQ2A 2AJ1A 4LIRA 4OJ1A 4ZLPA 3LP1A 3H4BA 4ECXA 4MIBA 3OSPA 2XB2D 4AL5A 4NL5A 2EBEA 3SCKE 5KFIA 4YOEA 2CPIA 4OJHA 4IOAQ 1FCAA 4UUXA 1TL1B 1WHVA 2XULA 4ECYA 3EXCX 3I87A 4WF9Q 2DNOA 3ZZRA 3FRYA 5K8OA 1U1NA 2ADCA 2IRXA 3KLGA 4WKRA 2CVIA 5B7WA 1VC6A 1OSDA 4ELTA 2HW3A 4I2QB 1ULRA 1T03A 2VKRA 5J2NB 4NCGB 2HQIA 1NJZA 4JV5F 3DNCA 4DV6F 4Y65A 1FO1A 2QO3A 4KHPF 1GTHA 2FVQA 2C3PA 2F8HA 4CNZA 4DL3A 2A2DA 3LP2B 1H0HB 4DFKA 2HNDB 1H7WA 3DRSB 4W90B 1YGYA 4HVZA 3VAGA 3KLFA 4LSLA 5K14B 1P9QC 2XS7A 1QAIA 2L3MA 1VMBA 3IXQA 4MKBA 1HWUA 2GX8A 1VRUA 2H5EA 1HBOA 2BE2B 4ZCMA 3BDEA 4ZPAA 1X4FA 2DGQA 3NG8A 1R0AB 2NZ4A 2VZ9A 5HLFB 1PSDA 2PA8D 3FQLA 3EGZA 3DHWC 3BO3A 3CD5A 4TKTA 4ECRA 4EFAC 2AP6A 1RT2B 1HYSA 4WCEQ 4QR0A 4NA3A 4ILMA 4A8FA 2ZH3A 2YH1A 3SZ2A 4JI6F 1FXDA 3BN7A 3HHLA 5E5NA 1S97A 1ZPVA 2OKQA 1F2GA 1H2TZ 2E5HA 4WFYA 2F4VF 2KG1A 2ASDA 1JWWA 2IYIA 4YR0A 3GYXB 3M9OB 3M30A 2MQMA 5G0RA 3RAQA 1TKTB 1HA1A 4U7CA 4ALZA 1N56A 1X8DA 3CCLS 4JV0A 1VQ5S 3VR1A 1HR0F 3IC1A 2DPJA 1FJGF 1OQ6A 1HQUA 3GWCA 2HNYA 1FK9A 2YWFA 3FMBA 1RISA 4FF1A 4ES3A 4Q2LA 3IGVA 3M8RA 3IWXA 3DU5A 2GV1A 3NNAA 5K8MA 4LF4F 4BBYA 3FEZA 4DOZA 1JLQA 1S0MA 4NZ0A 3UW1A 4TY8A 1FEEA 2EFOA 4C11A 4F3QA 1S0VA 2DITA 3O8WA 1L3TA 2A18A 5IS2A 2AV5A 3GFXA 2LYVA 2YX7A 3CE8A 3HVTB 3ENWA 4DBQA 4TXSA 5B09A 4OHWA 3EPIA 2MJUA 3NAHA 5I3QA 2ZE2B 2DRBA 1WI8A 1HMVA 2ZZMA 2XY6A 1DHMA 5HMZA 1ROFA 4LT6A 3BGRA 2JC0A 4FS2A 3OPKA 4DL6A 3MM8A 1N6QB 3OTCA 1K1SA 2RQMA 3ZZPA 2W7PA 1VK3A 3CMAS 3G8QA 2ACYA 3DRPA 3THVA 1VIXA 2VG5A 1X4EA 1YWXA 2HG4A 3ISNC 1JJ4A 2RE1A 5AJ3F 2HS3A 2O5DA 2J0WA 3WC0A 2PSZA 1KEKA 1QE1B 2FJEB 3H8YA 1VGYA 2D74B 2LDYA 1MU2A 3H2VE 3UQSA 1A9NB 3UNGC 3ISND 4DR3F 2MB0B 5GAHU 5DLGA 2SXLA 4Y2IA 1Q8BA 2FJDB 3E8OA 4PG6A 1OWXA 3X1LB 1U49A 2RS8A 4B9UA 3T9NA 2CPEA 1TP7A 1Y00A 2XLKA 4IG0B 5LXYA 4DSFA 2UV8G 1FE0A 3OL9A 5C24B 1FVSA 4LSLB 2BQRA 4H4OA 2CRLA 1S1UB 2W8LA 2CZ4A 2UVRA 5KT4A 1SL0A 4H4OB 3SSSA 2V8DA 2KFYA 1HHSA 2GMLA 2UUBF 4RUAA 3G8SA 1VK8A 3TP2A 1N5TA 1DARA 2PMZD 2DVIA 2ZFHA 4QR1A 4ECVA 1SL2A 2DNKA 2L08A 1HFEL 2J9EA 4RZRA 1O8BA 2E9ZA 1WG1A 2MGZA 2HGNA 1RT1A 1R89A 3FGVA 4TY8B 4B3TF 3BR9A 1MW7A 4KT0C 4GO7X 2ILYA 3KG4A 3D2WA 3JSMA 1AW0A 1H2UX 3MI7X 2VG7A 1LFWA 2AJFE 4TU8A 5F9LA 4DV5F 1FJCA 1X5OA 3I96A 4I7FA 2J5AA 4PXBA 2RVJA 4OZNA 2RILA 3BSCA 2HHXA 4PKDB 1HQUB 5LMNF 5CYJA 1R8CA 4A4JA 4ID5B 2IAJA 5KT2A 2AGOA 2EG2A 2FVCA 3CTRA 2XGPA 4JOUA 2ERRA 1N5YB 3I55S 1JB0C 4OLPA 3EYZA 2XMWA 4DR4F 4MK8A 3D0HE 1XNRF 2DNLA 2M0GB 4P7TA 1FKOA 2ZD1B 1HNIB 1RQ0A 2LMIA 3GFYA 4USIA 3OVSA 1RA6A 3QO9B 3KLHA 4CZCA 4G6VB 5I3UB 4C0HA 2QA4S 1M5OC 5LXRA 1RK8A 2DGOA 2NLWA 4IDKB 3IRXB 2GQCA 5J2PA 2VFSA 5HL7Q 1S1UA 3KYLA 3RW6A 3ICLA 4ZCLA 3PZPA 4R5PB 3KLVA 2FIUA 1MMDA 2MZTA 2NPIA 3CB4A 1NK6A 2MYFA 2K3IA 5J1EA 3G8TA 1HBOB 2BE2A 2M4MA 3T19A 3GFZA 3DCAA 3M6XA 4NLOA 2ZNYA 1LWCA 2YY3A 4X4OA 4KV8A 4I6WA 2BRLA 3WX4A 2N3LA 2UZAA 1L3KA 2KU7A 1SH2A 1IJFB 1RT7A 3DLLQ 1R6YA 4DQSA 5J2PB 1R8AA 1S6UA 3OHAA 4PUOA 3DOKB 5C5JA 1T3NA 4WJBA 3QZ8A 5K9FA 2XZWA 2KI2A 2E66A 4RW6A 3TAMB 4DL5A 2IRUA 1VQNS 1HPZA 1RTDA 3MR6A 1QVFR 3TUJC 3ENQA 1ELOA 2FY1A 4DR6F 2VFRA 1HPZB 3IG1B 2WW8A 1C0TB 3S6EA 3EX7B 3MOZA 4XAKA 2CQ2A 2HS0A 3D0IE 3J80Y 3O1LA 4KC5A 2COLA 3EZ5A 5K8NA 5HMXA 1YTYA 2L9NA 4CQ1A 5T7LA 3HKWA 4ITSA 2K2PA 1G6BA 4MJKA 1S48A 3QMQA 4KQZA 1Z4UA 1RKJA 2CZVC 3S8SA 4ED2A 1JKHB 5C25A 2VFVA 2C3OA 1FT8A 4HDHA 1S1WB 2MJNA 4ETZA 3HVAA 1JXLA 4PG5A 5CHCB 5CD4H 1H38A 2XSJA 3TA0A 1OPZA 4L3NA 3EXYA 1XC9A 2E1RA 2ZDOA 5H1SV 1FTCA 3LOUA 2HS4A 1SXLA 3MTJA 5CH7B 1KQSR 2UXBF 1NU4A 2OP5A 3FJ2A 3IRXA 1EETB 4C8ZA 4CCHA 2KH9A 4H4MB 5L1JA 4HLBA 1YRXA 4DUZF 2JLFA 4B9TA 1B0TA 4FVCA 3LH2S 1IXKA 4DL7A 4IQMA 6FD1A 5C42A 3MD3A 5D4OA 2FLLA 1U1PA 4LQ3A 4RBVA 5A8RB 1XERA 2FHKA 2M70A 3VZIA 4OZLA 1C0TA 1H6KX 2HHHF 1GQEA 5DQIA 4LQ9A 2WSEC 2IBOA 1HWIA 4EUVA 1OIAA 3DLKB 1FRHA 3I82A 4E98A 3N0VA 3BB5A 2XY5A 1IBLF 4JBCA 1SQEA 5FIIA 3UE2A 1GXTA 1VBYA 4USHA 3DOLB 4PG7A 1ZETA 2FB0A 4Q43A 3K8VA 3CJ0A 4ECQA 1YRTA 5A8KB 2JJ4D 5F0UA 4DS5A 5IT9Y 3IO1A 4F2RA 3NBPB 1QSYA 1YITS 2WOMB 1IKWA 3I5BA 4AXJA 3KG0A 1JX4A 1FNXH 2XG8A 4OMFG 4ZK7M 3C8YA 2WB1D 1DZ5A 3OFHA 1ZTWA 3CF5Q 1WHYA 4Z37A 3MZIA 1BLUA 3BSAA 1AXQA 3RW7A 3L09A 3DM2B 1G2EA 1X4BA 1WD6A 1AROP 3SFUA 2ZJRQ 1NK7A 3N5BA 3OFFA 1S1TB 1GX5A 4QW8A 2WBMA 3N01A 4WK3A 4A8XA 5KFZA 4DEZA 1GXUA 1WI6A 4ED6A 2Y1JA 1DTQA 4H4KA 3K5PA 5IXUA 5KFCA 3R5BA 3KHLA 1HNVA 3LP1B 3DN9A 1TR0A 4X4TA 1ZTTA 2VQFF 3DC2A 4C97A 1NJYA 4LVNP 3CMES 4DS4A 4IKAA 4RNHA 3TW0A 3T5HA 2E5LF 5KFBA 3T1YF 2D1CA 2V94A 4EBEA 3PEJA 5BYRA 5LJ3Y 2IMOA 3AQOA 3LGMA 1LW0B 1QE1A 4G1PA 3C2PA 3MPYA 2DGWA 4ICLB 1YVFA 4JI4F 5HQ8A 2DD8S 4I69A 2HPUA 4I67A 1UEVA 5J1PA 2ZHOA 4IOBA 4J9KA 4O3NA 4ZPTR 2BV3A 4ECWA 1S49A 4DSLA 4JI0F 3N79A 4J9PA 1J5OB 3PIPQ 4FZVA 2EI5A