2CRLA

The apo form of hma domain of copper chaperone for superoxide dismutase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GSSGSSGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Copper chaperone for superoxide dismutase
publication title The apo form of HMA domain of copper chaperone for superoxide dismutase
rcsb
source organism Homo sapiens
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2crlA01
1YJTA 5T7LB 4A48A 1URRA 1X7VA 1TR0A 3HF5A 4NL5A 5B0AA 4ZOSA 5F0WA 5B09A 2W4CA 1K0VA 2GGPB 3CJKA 2HIQA 5B0BA 3TOQA 3DXSX 4DPOA 1CPZA 2VV5A 3BGUA 1X0PA 1CC8A 1OQ3A 4DN9A 3KNGA 3MZIA 1N5QA 2OMOA 2HLTA 2AP6A 2HFOA 2RSQA 2XMWA 1OSDA 3BDEA 3BR8A 1SB6A 3FGVA 3LGMA 3MCSA 4HI2A 1WD6A 3BB5A 4Y2MA 1JWWA 1YJVA 2QIFA 2JDJA 2RILA 2KT2A 5T7LA 2OD4A 4ZA1A 1KVIA 2GA7A 2GCFA 5A6WA 2QYCA 4A46A 3UDCA 4A4JA 1V3ZA 1Q53A 4A47A 1AFIA 2GGPA 2Q3PA 1FESA 2N4CA 1P6TA 1RJJA 1ULRA 1XBWA 1VQYA 3BF4A 3IWXA 1N5VA 2CRLA 2PGCA 2HFNA 4F67A 3HHLC 1YG0A 2OFHX 2XMMA 1TZ0A 2ROPA 5B0FA 5A6PA 2ZDPA 1X8DA 2OAUA 4OJ1A 3FRYA 1Y3JA 2ZDOA 4OJGA 3GZ7A 1U7LA 3VTIA 4OJHA 2XMUA 1SQEA 3IWLA 1FEEA 3T9NA 1FE0A 1CC7A 4HI1A 2RMLA 2BJEA 2G9OA 1Q4RA 3BN7A 2VH7A 2K7JA 4OIXA 1N5SA 4Q2LA 2LQBA 2HLUA 2N7YA 2K2PA 2XMTA 1QUPA 2BYCA 3LO3A 3E8OA 1JK9B 2ASYA 3BM7A 4DL0C 4HH1A 2FB0A 2K7KA 1Y0HA 1YJUA 3KKFA 4U9RA 5B0EA 3QGPA 1FD8A 4FNIA 5IXUA 5K9FA 2AJ0A 2GV1A 2IYGA 3HHLB 4HH0A 1FVQA 5B0GA 2OP5A 3HFKA 3K7RA 3KG0A 1MWZA 1Y9OA 1GXTA 1FVSA 1MWYA 2XMJA 2FIUA 2IYIA 2HQIA 1S6UA 3F44A 2LDIA 4Y2KA 1Q8BA 2ROEA 2PD1A 3LGNA 3KG1A 4Y2IA 1YJRA 2LQ9A 2W4DA 3HHLD 2BJDA 4YEAA 1W2IA 1IUJA 5KAKA 2OFGX 2QLXA 3HHLA 4FNHA 5F0UA 1S6OA 2FHMA 2XMKA 2GO8A 5B0DA 3QMQA 1Y3KA 2K1RB 2BBEA 4HL9A 1KVJA 2EW9A 1TL5A 3HX9A 3TRGA 1SI9A 2W4PA 4YDXA 3HDSA 4NPOA 4EFAC 2GFFA 2KT3A 1LQ9A 2KYZA 2FTRA 1GXUA 2ACYA 2QLWA 1R6YA 2BUNA 1OQ6A 2KKHA 1VQSA 2ROGA 3TNVA 4OJ3A 5B0CA 1Q8LA 2N4DA 1TUVA 1AFJA 2XMVA 3CJKB 2IFXA 2L3MA 3I9ZA 1P8GA 3FMBA 2AW0A 2K1RA 1APSA 2OD6A 3DCAA 2LXFA 1AW0A 1TL4A 1YRXA 1OPZA 1N5TA 5B08A 2AJ1A 4Q2MA 2OKQA 2RU9A 4QOTA 3WDOA 1FE4A 1KQKA
chains in the Genus database with same CATH superfamily
1HBOB 2DR5A 4O4RA 2AZ3A 1X4CA 2ZE2A 2ZH7A 1BUXA 1FXDA 4FF3A 1O51A 1N6QA 1NK8A 4AQYF 4DR3J 4E98A 3AT1B 4B9SA 1QY7A 3HKWA 2IBKA 3PJ9A 1IM6A 1RBOB 3KLEB 1KBRA 4DFPA 2G2OA 2V8HA 4C0OC 2JLEA 2W1BA 2YPYA 2COLA 4I1TA 5DG9A 1VHIA 3HXMA 2ZVSA 3LP1B 4BS2A 2K7KA 1CJKB 3EX7B 1LK7A 4NYPA 1GMUA 4R0JA 3ETOA 3G87A 1TKXA 3ZTSA 1M1KT 2UUCF 3GJRB 3TUPA 1TP7A 5KG6A 2FHMA 2LU1A 4I2QA 3D68A 2V8GA 2BE7D 2HAFA 4YMEA 1T9TA 5HMYA 2F40A 4LMZA 1C1CB 3V6DA 2ILYA 4WTOB 1WACA 4URQU 4QOTA 2QA1A 4PG5A 4ZJOA 3R7SB 2CQBA 2JOQA 3G86A 1J5OA 1OWXA 2UP1A 4EZ6A 4ZK7M 2V94A 2UUAJ 2DBBA 3O44A 1NHVA 2UZAA 3NGKA 1B7FA 4HI2A 3H20A 1YJVA 3OD2A 3CCZA 1YVFA 2N4CA 3U02A 1S59A 2RDIA 4KFBA 2BMBA 2JEJA 3QAEA 4HEA9 1FX2A 1PAUB 3MMCB 2HRTA 3ISND 4FF4A 4Y00A 1RT5A 4UT4A 4DQRA 5E3RA 2OEJA 1FK9A 2KXFA 1SH3A 3CJSA 3HCXA 2BE2B 4B9VA 3UE2A 4F26A 4G3IA 2ZKUA 4CDIA 1FDBA 3FCVA 2V5HG 1RTJA 5AXKA 3RBDA 1JQGA 4N7TA 4M5KA 1D1UA 3HLUA 2LVWA 2YKNA 3T5JA 1FRHA 2ZC4A 2A1BA 4C0BA 3B54A 1LWXA 2B6AB 2FC8A 2W4CA 3F56A 5B0BA 1U45A 4E0DA 3TNVA 3MCNA 1XNQJ 2XSJB 1S72S 1JLBA 4DPUA 5CQGA 1Q95G 2NUHA 2HFNA 3CF5Q 3SFGA 2OAUA 3KMQA 5HJYA 1WG1A 3TA1A 1CJUA 3IS9A 3KLHB 4FYVB 2HG4A 1HMVA 3TAMB 4U9RA 3KKFA 2F3JA 1CSJA 2AJ0A 3B78A 3HFZB 2O67A 4DR6F 4CLPA 3R6GB 5AXNA 4Y2KA 1LKZA 3CC2S 2ROEA 2UU9F 1J2VA 3J81U 3UDLA 2OIHA 3GG0A 3M2RA 1YRUA 4M5NA 3VAGA 1RWWB 2ZH9A 2XGQA 3SI8A 2Z2LA 2K1RB 2HHVA 4NOHA 2DITA 4LSNA 1JLCA 2BKPA 3CIMA 4ZPVR 3KHLA 4PQUA 3TZZA 4ANCA 1RAAB 2OSQA 1OQ6A 3Q24A 1XMBA 2CQ3A 3PYGA 1V3RA 5KG0A 1OPZA 3TR5A 4K7QA 2ZZMA 4J5OA 1MU2A 2BW2A 4CO2A 3GR0A 2XYGB 2IM2A 2CQIA 3KJNB 2B0GA 1YZ6A 4NLSA 2D1CA 3MECA 2B8PA 4GRSA 4UOFA 4MKYA 2KJWA 2PIIA 7FDRA 2BV3A 4DR5F 4N47A 3T1YJ 3KWMA 5A6PA 2W8LA 3SV4A 3QGGA 4DN0A 2G0IA 3P96A 4JI3F 1X4DA 4DMZA 1WDDA 5CCLA 3DXBA 5HO4A 3B82A 2RUGA 1EKRA 3HFKA 3T1HF 3BH6B 4RL1A 2FIUA 6FDRA 4JI1J 1UKUA 3HT3A 2UXBF 3RAMA 2ZH3A 2CPDA 2QMWA 1HW9A 4Y2AA 4X65J 4NE9C 2MPUA 3VVTA 1UEKA 1JLGB 4OYMA 5GADI 2HZVA 5IFMA 3BQ2A 3SV3A 2B4OA 4IRDA 4GMKA 2YPZA 2GHPA 1VQ9S 3DYAB 4ZOSA 1SL2A 1K9MT 1KNZA 2B43A 3CJKA 2LLZA 4LQ3A 4WXWA 4BWMA 1KOOA 2J6UA 4ZPDA 3BDEA 1MWQA 3IWNC 2JLFA 4KT0C 2HNDA 2VG5A 1S7IA 1XMQF 2ASJA 2MKHA 2YNIB 1RT3B 3FBEA 2YNFB 2XZDB 2Y8WA 3MXHP 1T3NA 2P8IA 4C8YA 1PYSB 2EWHA 4U8YA 3HHLB 4DR4F 2MZ1A 2EFQA 4K4WA 1U25A 2HVDA 3RR8A 1YSJA 2GVDB 1U2CA 3AJ1A 4YEAA 5SUHA 4C8MA 3EYZA 2E9ZA 4FNHA 1D9FA 2ZNYA 2BJ3A 2X7IA 1UTAA 1SJFA 3UVJA 1VQOS 4DCPB 4Y34A 1ZA2B 4WKRA 3C46A 2WVCA 3JQMA 3Q89A 2AIRB 4LQ9A 3JQJA 1HBUA 5KG3A 3IRXA 4Q2MA 5G0RB 3SQGA 4C7QA 1WF2A 3PKMA 1TK0A 2GJ2A 5K20B 4DCJB 3AY0A 4DN9A 3J7YU 3QRQA 4F3MA 2XQCA 1RWOB 3VQTA 3IBWA 3BEGB 1C2PA 3I56S 1IVZA 1VQNS 3FC9A 4USVA 1EJ7L 1JJHA 2JEGA 4DU8A 3IGNA 1NPKA 1FDNA 4DL2A 3KHRA 1JLEA 1R8HA 2EG1A 1XIQA 4PUOB 1DTTA 3KHHA 2LU2A 3CNQP 2AHOB 4TY8B 4KJIA 3CDEA 2BKOA 1S76D 2KB2A 4ZP7A 1VGYA 2NR0A 2FZKB 4N5SA 2CQHA 4NZ6A 3SEOA 1WC6A 1F5CA 2WVEA 2J8SA 4RUCA 3MMBB 5H9EK 4ZHRA 1WSVA 5CYMA 3MGJA 2AW0A 1APSA 3THTA 1TL4A 2QYGA 4F0HA 2DIVA 2ZZTA 4WTYA 1QE1A 5T7LB 3NRBA 1JNRB 4KPYA 1CJVA 2D3UA 4UOHA 2QL5B 4TU7A 2HRUA 3B8HA 2LEPA 2DKOB 3ZZYA 1KVIA 2CIMA 3MEDB 2LQ8A 1K1QA 3HVTA 1VQ6S 3PEHA 5E2QA 2RKIA 1JLAA 2H9ZA 3EXYA 1SUQB 2C3UA 3OUYB 3J7Z5 3AJDA 2VPXB 3A8KA 5EWEA 1MWYA 3QIPB 2ZHOA 2V50A 5K8PA 2HQGA 3M8YA 2W9CA 2R4FA 2ZHBA 3TP2A 1ZAXA 1PC4A 3ZTRA 2EC2A 2A0FB 1LWFA 3SFUA 3V81B 2KVIA 2AJ1A 4IOCQ 3LW5C 4IDKA 2FGCA 3OXFA 3DDIA 3PRDA 3JYTB 3F0NA 3CC7S 2B7CB 5B0AA 4Q43A 2OGUA 2UVUA 5IV3A 3CJ0A 1SVDA 1HNXJ 2GCFA 2HFUA 3WX4A 4DV0J 4MKVA 3OXGA 2XMUA 1R0AA 1MN7A 2K7JA 2JX2A 2UXDF 4CIOA 2ASYA 1IR2A 5KT6A 1U26A 1YIJS 3TUJC 2DNPA 3BKUA 1TFWA 2QA4S 4X4UA 2GZOA 1DHMA 4RUBA 3I0SA 3LQVA 1WKJA 2JVOA 4NA1A 3P5BP 3PACA 3AAWB 5IT9Y 3VGSA 4ZVSB 1XR6A 1KDNA 2DGWA 2G0JA 2VJVA 2HVIA 4IRCA 2VFTA 4ELTA 3H40A 3R5AA 1SJ1A 2CPYA 1NH8A 1U24A 3P3DA 2R7XA 1UWAA 3ETMA 4K2XA 2F8HA 4Y28C 2EPIA 3A3NB 4AQYJ 1U09A 1VQ4S 4QYRA 4AXIA 3EPIA 1WEZA 3GP9A 4H4OB 3LWLA 3FEXB 3PNIA 3LGMA 4RBUA 3E51A 4L75A 5E3AA 3SXLA 2RILA 4JI2F 2J9CA 2LXIA 3EGWB 2FDNA 3ELHA 4KC5A 3THPA 2PGCA 3SQOP 3S7RA 3N79A 4ZIVA 3P45B 3IP0A 5D0HA 5C42A 2N7CA 1RWMB 2WHOA 4ICLB 1P9YA 1NLKL 4O0IA 2M70A 2OP5A 2KG0A 2UUCJ 4B3SF 2HGMA 2XNRA 3AA8A 1GAOA 5LOQA 2IA6A 1VQPS 3ONQA 2R8JA 4DXLA 3N01A 2MJNA 4ED0A 1FWLA 1LQ9A 2FTRA 1IBCB 4U7CA 4EZ9A 2YXLA 2XI3A 4LF9F 4W90B 2KM8C 1QVFR 1FI4A 5D3GA 5BYRA 1QTNB 1WDTA 4F02A 3UDEA 2FC9A 4ZVHA 3TZXA 3H90A 1RHUB 3W63A 2E1MC 1KHWA 4MK7A 1UVMA 1IKYB 4F3OA 4ECRA 2E5GA 1FWKA 2BE9B 2FPHX 4NA2A 4OZ3A 5G4DA 4WF9Q 2CJKA 2EFPA 4ID8A 3I4PA 3C19A 5KFRA 4HH0A 5FIIA 5DM6Q 3PIPQ 4DX8H 2AZ1A 3W2WA 4PXEA 2AWZA 3QO9B 1X9SA 3CDAA 2XM3A 5HANA 3OR2B 1C0TB 4ED4A 1SJRA 1HNVB 3JB9k 4QWBA 4OZ1A 3VZIA 1VBXA 4FVCA 3SCKE 2IVYA 2HHHF 4C97A 1FCAA 1FKPB 2LEAA 1IBLF 4DPYA 3C15B 3DM2A 3GSDA 3MUVP 1S77D 2WB4A 4I2PB 2C28A 2HFZA 3LA0A 4CYUB 1S1UA 3R97A 5F0WA 3G4SS 5BYQA 1X4HA 1UEUA 5J2QA 3RG6A 1WI8A 3HO1A 2D69A 3RTVA 2GVZA 2W9BA 2BVZA 4NEZA 4OLOA 2EXUA 2J7UA 2W2MP 5J2PB 4CO5A 4J7CA 4L76A 1N54B 2JL9A 2WTFA 2LQBA 4I64A 1OSCA 1Q78A 2EKNA 2FB0A 2MKIA 1Y7PA 4FKYA 4ED7A 4ED1A 1SKRA 3BO4A 4DR6J 5F3TA 1QAYA 1D3WA 1RT1B 2UU9J 2QTWA 2VG7B 4ZCIA 1KHVA 3NMAA 2ASDA 2OEKA 2M4MA 4XDCA 2HHQA 5CYQA 2IFXA 1SJQA 4I68A 1H0HB 4WU3A 3FFIA 2Z0GA 4DU7A 4MAKA 1FE4A 4PYAA 2ZUAA 3D6HB 2PN6A 4MT1A 3VV2B 3AB2B 5JJBA 2MY8A 2F63A 4LFBF 4PWDB 3FCHA 4JB8B 2YKAA 5ETRA 1EHWA 3WC2A 3MCOA 1S9EB 4U96A 5E3QA 4L74A 4OJ1A 4JI3J 4UZBA 1Z1ZA 2PDAA 2BJEA 3M8QA 2VFVA 2MHEA 2CKWA 4NLUA 4YN3B 3NGUA 3HD2A 4TU9A 2RIJA 5K8MA 2MGZB 5HQMA 2NSBA 2XC9A 5GAEU 4Z7CA 3GJSB 5ETSA 1YQHA 1W2BR 2OSRA 2AGQA 2ZZNA 2UXBJ 3UDVA 3K5MA 1RAFB 3HT0A 1N0VC 3VALA 2DCUB 2HS3A 1RBAA 2QLBB 2A2CA 2X3DA 2BUNA 2XWXA 3TAPA 2P9GA 3OL6A 4MIBA 1BXNA 1N8RT 2LXFA 4BHQA 3MAQA 2HWIA 3H5YA 4TYBA 1NSAA 1LWEA 2I1RA 3KNGA 5CA5A 1HBNB 5J1EA 3M30A 1D0EA 1LWCA 2Q43A 3LALA 3HPOA 4AUKA 1XMQJ 4G65A 4B9MA 4J9PA 1R3NA 3PO4A 4OHVA 4FXWA 2BJ8A 3DNCA 4ECYA 3DRPB 3JTPA 1SH2A 1VHFA 3LO3A 3TEHB 1X9MA 1NCLA 1RK8A 1ELOA 2YX7A 2HEKA 1WEYA 4DR4J 2OPPA 4ZPBA 4NCGA 1UW4A 3MPDA 2V67A 2LCWA 4RWWA 3ILJA 1U6BA 3Q8RB 1TMMA 1FF2A 1HHQA 4A8YA 2XZWA 3CD6S 3NP5A 3CMAS 4ETXA 3IG1B 4K2JA 2DNYA 1NDKA 4XPCA 5D0EA 3CCTA 3NBPA 3GCXP 4LF7F 3BS9A 2X1BA 4CQ1A 2GIRA 1T05A 1RT7A 1S6PA 1NJWA 4CO3A 3VAFA 4TU8A 2XZTB 2V4JB 3BGFA 4NLVA 2DHAA 2RU3A 3JSMA 1S9FA 2XNQA 2XO7A 5HBMB 1N36F 5CD4H 3H25A 3M2VB 1GT8A 2DIUA 3ZNUA 1IKVA 4USTA 2NSCA 3N6MA 2VOOA 3ZZ0A 2PMWA 3LP2A 4DG1A 3K5OA 4ECZA 1DY3A 4TXSA 4OYOA 1QDUB 3TWZA 3PFEA 1M5SA 1RTHB 4PYDA 1LW0B 2UV8G 2LQ5A 1YHQS 4QWCA 2ZVIA 3K7RA 3QT5A 4YB5A 2H4WB 2LDIA 4Q0BA 4DL3A 2V68A 1UVKA 4CNYA 1T03B 4A8SA 3R5JB 4GKKF 3SCIE 1VS3A 5KFXA 1REGX 2CJBA 4WCEQ 1TKTB 2ROGA 1TV6B 3W5YA 4OZLA 2WB1D 1EARA 1U1QA 3K8WA 3U1NA 2IMOA 4CM2A 2HHXA 2OPQA 2CQ1A 1TR0A 5IOLA 4FYYB 4ANDA 3TOQA 3OL8A 4I6AA 4ZKAA 4IFYB 3DMJA 3OPKA 2KFNA 3UD5A 4I56A 4OI3A 2E9TA 2VC0A 1Q53A 2Y0SD 4PXBA 1IQZA 1FNXH 1VQYA 3FBCA 3NLCA 1DBDA 4MFBA 5GVQA 5DG8A 3MFIA 3CW2C 5A2QY 3ENAA 2XS5A 3R2CJ 1AB8A 2RE1A 1VBKA 5HVGA 1NJZA 4CWBA 1F2GA 2XI2A 1VQ7S 3LP0A 4OZJA 5KFYA 3OHAA 3OTEA 4O44B 2VA2A 3W2VA 3MUTP 2VDHA 4PZVA 5J2MA 1GMVA 5E33A 4NLWA 3CULA 3ZNJ1 1OY6A 2DNHA 2MMYA 4NLRA 2V4QA 1VRTB 1B4SA 1PJ6A 4M5IA 5A8WB 5LXYA 1U49A 1F3FA 3UCZP 4LRBA 1DURA 2DK2A 4HDHA 1ZTWA 1FNOA 4C48A 3MPYA 3QWPA 3GTYX 4OX7A 1SKWA 2HVEA 2GO9A 3EWGA 1BWEA 1F6TA 3QZ8A 2MB0B 5AXLA 1ICEB 5CAAA 2QV6A 3TQ1A 2FY8A 4ED5A 4OLPA 5IM0B 5GAEI 2L9WA 1F9HA 1ULRA 1RLCL 4UUXA 2H48B 5HROA 1TZ0A 4LBIA 3UN3A 3FVYA 2MJUA 2UXDJ 3O8WA 2RHSB 2NXCA 2RH3A 2GJFA 3M8PB 3D66A 2BM0A 4X2BA 3IAM9 4Y65A 5LMUF 1BQNA 4QIVA 2EK1A 2YWKA 2F1FA 4DR2J 5L9XA 2QRRA 3AH6A 2VU5A 3AB4B 2IDLA 4JP8A 2NQPA 5KG1A 1S6OA 4RW4B 1ZA1B 1A7GE 1TL5A 3A3OB 4X62F 2A10A 2QL7B 4DSIA 2KHCA 1B99A 3OL7A 4DV2J 3TZYA 4WZQA 1P8GA 1RWXB 5HL7Q 4K4UA 1QJHA 3DRXA 1SIZA 2D9PA 2QLJB 1IBKF 2M8HA 2VPWB 4ZVUB 5E41A 1C4CA 1OQ3A 4NLPA 2EBEA 4JI2J 1WD6A 3OFEA 3BYPA 3TW0A 4FYXB 3R2DJ 1TFYA 2CNLB 4WU2A 1HA1A 5HLFA 1N33F 4ILMA 1S49A 3FCWA 5C25A 2HBYB 1EETA 4OX9F 2D3O1 4B9UA 2V9KA 1P27B 5C2GA 2HNYB 2GV1A 2RNEA 4J9RA 4MYTA 4B3SJ 3C14B 2V69A 5DDRC 3K5NA 4R8UA 2J0QD 3E2EA 2AYGA 3M1VA 3UD4P 1K47A 5KAKA 3DOKB 4V19X 4ITSA 2Y0BB 2BBEA 1KVJA 3QT8A 3BKTA 2R7RA 3MEEA 1PKUA 1HPZA 5KFCA 1CJTB 1KKHA 1PGZA 3KUHA 4CLSA 2HSEB 4WYWA 5DLGA 3QRRA 1SIWB 4MK9A 3FMBA 4AL6A 2RDJA 1IR1A 4ECVA 1KLMA 1RAGB 5FDLB 2OLWA 3K89A 2MZTA 2DEIA 2BX6A 3IA0A 1CVJA 1M5KC 2XBPA 5B09A 2GGPB 4B3RF 1VI7A 2WSCC 3D6TB 2HLTA 1VIOA 1R8BA 4URGA 1HBOA 1PIEA 3RBZA 3JAMY 1J27A 3GIMA 1VFJA 1OMSA 1YG0A 4QW9A 4K4YA 2X1GA 3POTB 4L3KA 2ERRA 4OIXA 1XQIA 1CBKA 5KFDA 4P2XA 3KLEA 2N82B 2RD5C 2IYGA 1U8SA 2AMCB 2CJYB 3A13A 3LP1A 3FUYA 2B3TB 2VKRA 3HSDA 5JVGQ 3VVUA 2R2UA 2V2KA 3V5RA 3T41A 5HMZA 3GCWP 2HHHJ 2XHCA 1IBLJ 2F4FA 4LF2A 5IS2A 3QSYB 3KFWX 2WONB 2KL8A 1NK6A 2AJ2A 3IM9A 3S6EA 3W65A 1HHSA 4AFFA 1FDDA 2EBGA 4JUZA 3OW2R 2YNGB 5M2UA 2E5HA 1C1CA 4MJKA 1FJ7A 3P49B 4DBQA 1FO1A 2PT0A 1NB7A 3R27A 1KQFB 3BPDA 1SQFA 3LAMA 1VQ5S 3SMZA 4LFCF 2JFDA 4DL6A 2HHWA 2VG6B 2VH7A 4OYBA 1N56A 2JNJA 1E6YB 1SQGA 2J9DA 2DRAA 3BGRA 1YWXA 4PXDA 3EVOA 3CXCR 1T02A 2HQIA 1Q8BA 1IXKA 1UL3A 3PX4A 4A8MP 3G9CA 3MFHA 5K8OA 5C7PA 5BR8F 2C3PA 4IYQA 1EQMA 2CQPA 2VA3A 1XTZA 2BE2A 3L7OA 2C22A 2ALYB 1PJ5A 2L41A 3S1TA 1SH0A 2HAIA 3HULA 2WW8A 4DPTA 2FJXA 4LF6F 1XMOF 4LFBJ 2EKYA 4MIWA 2AP6A 2YQ3A 1AT1B 3W64A 4CLUA 2FVSA 1O0PA 1R0CB 1TTHB 3F41A 1FRXA 3ZXWA 2B6AA 2B56A 4YOEA 5H9FJ 3TVKA 3PX0A 5ETOA 4J9KA 1PBUA 4CZCA 2XSJA 3QYYA 3CCVS 1W26A 2E5LF 4LIRA 5GAGI 3IFEA 1WTFA 3MPUB 2HQDA 2ZHAA 4J90A 1VQ8S 4NXNF 4NLTA 1G2EA 3KLHA 2R7WA 4DQIA 1PC5A 4ILRA 5IWAF 3W3SA 4U7UD 4ZJQA 1WNEA 3HHNB 2FHOB 2NXNA 1I51B 1HR0F 1HNWF 3TZWA 2DO0A 5GMKa 1RKJA 4KHPF 1MSWD 2K1RA 4JI7J 2D74B 2CPIA 2ZBQA 3W9IA 3CTRA 2LDYA 1J5EF 4LVOP 4FBUA 1YBAA 3RRHA 3IM8A 2HNZB 1GX5A 4UOCA 2HFOA 5F8GA 4HHUA 3NGDA 2BQ3A 1V3ZA 3MMJA 2J0XA 2GQ2A 4LBHA 3LPYA 2EK6A 1U8WA 1VISA 4LUBA 5EDWA 1LW2B 4HHJA 1QSLA 2HVHA 2N7YA 2HQCA 3ZO7A 1OO0B 4DSJA 5K8NA 4HHHA 1JKHB 4DOZA 3NXZA 1Z4UA 2R2TA 2GQCA 4J9LA 4RNNA 3DN9A 4AL5A 5D8HB 2VPYB 3I5AA 2HWHA 2MZQA 3NNCA 3MEGB 3M6UA 5DLFA 1NO8A 2KYXA 2QFJA 1NKBA 2XB2D 3QRPA 3L9ZA 3EDRB 2HMIB 4DWIA 4X4NA 4KE5A 4O23A 2QO3A 1VOMA 1X0FA 4XIUA 3Q86A 3FRZA 4OL8A 1F5BA 2MZRA 4USKA 5BJRA 2B8QA 1UVNA 3O3LA 3R5DA 4H4MA 1RT2B 1N36J 2DRDA 4UY85 2R42A 1Q8KA 3CJTA 4LFAF 3DYAA 3EMTA 2GS8A 1VBYA 1Q0NA 3SSQA 2C2DA 1FRIA 2GHWA 4HI1A 1DLOB 3KLFB 1UVLA 2HBQB 3OL9A 4KGXB 1WJ9A 4KFBB 3UNYA 4DX5A 5KFJA 2YNIA 1P1LA 4DFJA 3OVBA 1GXTA 3JTOA 1X5OA 4ANEA 3CB4A 2W2OP 3VAJA 3GV7B 2XY5A 1T9WA 3QT6A 3MM9A 1SV5B 1K73T 3CCJS 5F8LA 3ULHA 1L3UA 3HHLA 3TUZC 1OYDA 3J7ZT 4EFAC 2KT3A 3TQEA 1EZZB 2HHUA 2CAJA 4FZVA 4C0HA 1GTHA 1Y4ZB 2GNKA 3M32B 1X4GA 3MOZA 5KFVA 4DV1F 1EIYB 4K0KF 3DLKB 2HBZB 1UMJA 2PA8D 4JI4F 4C8ZA 5G0RA 2QEXS 5KFQA 2W7PA 1KONA 1NZ8A 2YVSA 3EZ5A 1NK9A 1WOPA 2A6OA 3AOBA 3GZ7A 4IR9A 4IFVA 4DR7J 3KLGB 1FT8A 2C2MB 2QSWA 4K4XA 3GLJA 2HLUA 4K8RA 2YH1A 4DL0C 5K9FA 1HMVB 4N8NA 4FKXA 3HI9A 3MAAB 2PD1A 4PUOA 2DNOA 2H1YA 2HYIB 4KH1B 4LF1A 4TY8A 5I3QA 4LR9A 4MKAA 2YNHB 1OS5A 2JZ5A 1S1WA 1VK3A 2E1AA 4KGZB 3DGPB 2C3OA 3LGHA 1IKWB 4PQUB 2WVBA 2QSFA 2DNQA 2IMWP 1XR7A 5B08A 2XLKA 1HFEL 4RUAA 2DXFA 2Q6BA 4F3QA 3MMBA 1S6QB 4URSA 2RRNA 2DRBA 3WBZA 1JNZB 2IIHA 3NL0A 3EZOA 1DAXA 3BR8A 2XYPB 5T7LA 2OTLS 5KG4A 2V6AA 5FJ4A 3HHEA 3PXGa 2VONA 4WFZA 1WHVA 1VC5A 1GTEA 2XCAA 2AV5A 3Q0AA 2VOPA 1F9EB 3OTOF 4NWBA 3K59A 1A9NB 5FLXU 5F41A 3DRYA 3MEDA 4ZLJA 1ZAVA 5LMUJ 3KJQB 3HVAA 2ZH8A 2Z2YB 2AEFA 2VL1A 4ER8A 2O01C 3PZPA 5KFTA 4WZMA 3TAQA 2CDQA 2V0NA 1RWPB 3EGNA 2BM1A 2MLYA 1SUQA 2W2PP 3OUYA 8RUCA 4J9QA 2YKOA 3RBEA 1U0HB 5K14B 3GFYA 4X62J 5B0DA 3PHEA 2EVZA 1HQEB 3K58A 3QIPA 2ZWOA 1RTDB 4J37A 1O5JA 3I5CA 4G1QB 2GX8A 1RT6B 1VQLS 2N4DA 4CLZA 5IV4A 1IBKJ 4IOBA 3Q2TC 1U4BA 2DNNA 1Z2ZA 3K0JA 2ZH2A 4QBUA 3V81A 3ITHB 1JWWA 4F4WA 1KOHA 3JYTA 4A4JA 4RW8B 1N33J 1U6ZA 3OBIA 1R27B 3I4HX 3VZHA 3H5UA 1SQEA 2CQ4A 4DUTA 4OX9J 3MM7B 2MDAA 1N32F 4CLKA 5KFEA 2J9EA 4EEYA 2BJDA 1Q1KA 4DUZF 5D0GA 2O1PA 3QPIA 2DXEA 3GIKA 2XY7A 3M9MB 4ZIWA 3UVJB 1JXLA 1VQSA 1K0TA 1C1BB 1S1XB 1FKAF 1LEOA 4P72A 3WDOA 4PQAA 1Q81T 3ENQA 3UQSA 4JV0A 3T1AA 1HBUB 4B3RJ 1RGVA 1GH8A 4K4SA 2F7VA 3J7A1 3NGTA 4HDGA 2OMOA 2RSQA 1DFDA 1BGXT 3UDCA 1WHWA 2UVWA 3OVSA 4ZITA 2VODA 4H4OA 3I32A 1U7LA 2N3LA 3W62A 3C8YA 4AE5A 3QSIA 4GO5X 5A0YB 4DJBA 4P73A 4A8XA 1JLFB 4KIAA 1BHNA 2RVJA 4ICLA 3D1OA 1FJGJ 2DGQA 3LPEA 2F8MA 2JJ4D 3GV5B 1L3VA 1NHKL 4HACB 1H74A 1O6XA 1F3VA 5KFSA 2HQFA 1KTVA 1NU4A 3MR6A 1Q8LA 2C2ZB 4OFZA 3BO3A 1OYEA 3D28A 2RB7A 2XTJP 3W5ZA 4V19J 1NJXA 1KN6A 4FN5A 2R2RA 4OI1A 4FVMA 2DHGA 3BO2A 2Y8YA 3BSCA 1X0PA 2GIQA 2QE5A 2DGTA 1CJVB 3I96A 1AXQA 2QIFA 2HVZA 3HJFA 2KTQA 2DNZA 1NHUA 2OFHX 4LFCJ 4K4ZA 3JSBA 5FD1A 3D4JA 3UO0A 1KQGB 4IQXA 4TNOA 1IKYA 3GR1A 3BR9A 2BOPA 4WE1B 4M5HA 1ROFA 2KDOA 4CTAB 1OY9A 3CDBA 1D8ZA 2RRBA 2RUSA 1G1XA 1H2TZ 4RW6B 1WG5A 2VF3A 1HIYA 5BR8J 4KHMA 3D6FB 2KXNB 1HD1A 3W66A 3QO9A 1BQMA 3QWUA 4M5JA 2QMXA 3R3TA 4UW2A 3OR2A 4C11B 1C0TA 1NKEA 5GADU 4DX7A 1HNVA 1UCNA 3EVMA 2I6WA 3W5XA 3EXCX 4QYZJ 2W8KA 1Q16B 1R8PA 2E5JA 1D9DA 1TL1A 4RZRA 1PO6A 4U8VA 1FKPA 4MMOA 3C15A 5EUHA 1XMOJ 2QLFB 5DZ7A 4EBEA 1NZAA 4DV5F 1MNEA 2DR8A 5CCMA 1REVA 4I2PA 5BYSA 3GJQB 3CCMS 1NK5A 3BB5A 2IDEA 4CYUA 3MTJA 3T5HA 2V2QA 2DHHA 1S10A 5AJ3F 2LXUA 4HLBA 2C42A 3DLHA 4O3SA 3D0GE 3FRYA 2CNOB 2M0GB 2GC8A 2CZVC 4DCOB 3GSIA 1E6VB 2EFOA 2EFGA 5J2PA 1TL3B 4NXNJ 2QC3A 3NGRA 5IWAJ 1WHYA 4O0NA 4IG0B 1HWIA 5KG2A 1BE4A 2IRXA 2W4DA 1CULB 2ZBRA 1IBMF 3I0SB 2UUBF 4DS4A 2MKSA 1HR0J 1HNWJ 1RT1A 4OHZA 2CJQA 1PAEX 3DOMB 4OYPA 2HS0A 4KAIA 4KHPJ 2VG7A 1UA1A 3IR5B 4I6YA 3KG4A 4KPCA 4TKTA 3C6UB 4Q5VA 1IWAA 1QD1A 1F0XA 1K0VA 2HIQA 3G8SA 3CD0A 3Q8PB 3RYLA 2QA2A 2WW4A 4EWTA 2L9DA 4QJVA 3WX8A 2Q3PA 1HYSB 2FHJD 2ZUGA 1JX4A 2J7WA 4USUA 2ZJQQ 5KFUA 4GKJF 4PWDA 2AKWB 3J80Y 3PW5A 3PJWA 4YR3A 1QUPA 1S9EA 1ZETA 4X64F 3GU0A 5F8MA 2H5EA 2FLOA 1NDCA 3VHQA 2MGZA 1RB0A 1L3TA 4ZP6A 2WBRA 2BANB 3W8GA 4MYUA 4RR5A 4K5RA 4QR2A 1VC6A 1Y3KA 1M5VC 3ICLA 5MLCV 2B4VA 4NXMF 1WWHA 4PKDB 4ZLPA 4A8WA 2F5GA 1MMLA 2VASA 4RU2A 4ZN1A 3CE8A 3QQCD 3CCQS 2AJ4A 3DXSX 4DSKA 3A4TA 4LFAJ 1FFWB 4B17A 3EVWA 2RQMA 2XGPA 3MURP 4DSEA 2QYCA 2C2KB 3U1LA 2CG8A 1QAIA 2CRLA 1HBNA 4ED3A 1AUSL 4UF4A 3T19A 2CPXA 3CDWA 1U02A 3GFZA 3CO9A 3KLIB 3DRPA 1FVQA 5IQ6A 1FHTA 1Y9OA 2AD9A 4A8QA 4C8OA 1AROP 3DRRB 1WOSA 1NH7A 1UWBB 1MROB 3RB3A 4JYAF 1EP4B 2E1RA 3QMQA 3RAXA 1H2UX 3FSIA 4QU7A 4YDXA 3FDSA 3NNAA 2CPJA 5I42B 1F9FA 2JHEA 2XEXA 1KQKA 4DV1J 2R7TA 4A48A 2KG1A 4OYZA 3PR4A 3ILLA 4JI4J 4EO6A 1OSDA 2UV8A 1W7WA 2QGFB 2GA7A 2E29A 3OR1B 2V4JA 3R9LA 2JFKA 5HBMA 4OHYA 3QJPA 1FEEA 1CC7A 3H5SA 3BN7A 1N5SA 1TU0B 3M2VA 4OQJA 3CJ8A 2DR7A 1YX2A 5KFPA 4XAKA 1BC6A 1LFWA 2JH3A 3EJMA 4YFUA 2VQEJ 4YUDA 4B3MF 3TJ8A 4PWWA 2E5IA 1PSDA 2XG8A 1RWVB 3PTWA 1F5AA 2F9DA 1RTHA 1LW0A 5LM7E 1BWVA 4O4GB 4ENOA 4KKOB 4OV6A 4LF5F 2KZZA 2DNGA 1H7WA 2ILZA 1GXUA 4CLWA 4QPXA 2KKHA 1T03A 2MKKA 5JUMA 4LBPA 4P75A 2DGVA 4K5SA 4P6QA 1TL7B 3DOLB 3AD7C 4QWEA 3FZ2A 3G8QA 1RAHB 1TV6A 3M05A 3BN4A 1KWMA 2DB1A 4GC7A 4ECTA 2R3VA 1IM4A 1SJ3P 1NNDA 3AXKA 3TRGA 2XMWA 3VGTA 2RHQB 4ELVA 2KT2A 5DGBA 3HM9A 3GYXB 1X8DA 4IFYA 3OTOJ 2P6SA 2B4UA 3MUMP 1XC9A 2G9OA 3C6TB 1JLQB 5DQHA 3K5PA 2OEMA 4NRTA 2CQGA 3MDFA 1M5PC 1HI0P 3GV8B 4ERDA 4WFBQ 3NS6A 3PW4A 3IC1A 2V8VA 3L7PA 5DDPC 2DHXA 4O44A 1RA6A 2V63A 5LXRA 2MZJA 1UETA 3QBCA 2NYIA 1QTMA 3IMQJ 4ES2A 5HK4A 2VQFJ 5LSRA 4KO0B 1VRTA 2YQ0A 1NXIA 5A8WA 4OV1A 4Z7YA 3UN5A 1Q8IA 1RABB 3BQ1A 2FVCA 3RW7A 3MZIA 4NLGA 4DV7F 4P74A 2OD4A 4WIQA 1OPIA 4DZ6A 4NLQA 3R7BB 2IPOB 2WOMA 4QPTA 5J2NB 1UAWA 2KH9A 1VIXA 1NK0A 5M2RA 3IWLA 2CNNB 2B51A 2OTJS 1N32J 3OV7A 3PHTA 4DSLA 1LNQA 5CH7B 4TQSA 2Y1LB 2RRAA 1WOOA 2AEMA 4DF4A 2OJ3A 3T1YF 4E2FB 4ZPTR 2CZ4A 1BLUA 3M8PA 4DUZJ 3DLEB 3DI6B 2W7AA 1RZMA 2A3JA 3OLAA 1L3SA 3MTKA 5KFLA 3A8EA 3FEZA 2BABA 3F73A 4A8OA 1RYRA 1YJ7A 1HWJA 4J9VA 2CQCA 4RW4A 4JI1F 2HKEA 4YS2A 3CCRS 2A2DA 5F3ZA 1RT7B 1UZHA 1VR6A 2CJ9A 3T3FA 2EI5A 1SC1B 4GVBB 1R8AA 2CYYA 4ZJLA 1LOUA 4NA3A 4X4PA 2LA6A 2MLZA 3MF5A 2B7BB 1R43A 1N5VA 2AU0A 1UPMB 2HFVA 3QT7A 2FLLA 4ELUA 1IKVB 4DG1B 2DGOA 3ET6B 1RAOA 2FD2A 1WKLA 4RU9A 2V8DA 3PDNA 2XSFA 4DZDA 3OFGA 4OI0A 2HNYA 5KT2A 1N34F 3GPAA 2PEBA 3C14A 3KDOA 5KFGA 1G3OA 3DLGA 1VC0A 1RHRB 1FXLA 3DOKA 3OFHA 5J1NA 3CSKA 2CJXB 2CPZA 4NCAA 1U1NA 4ES1A 2ZD1B 3IGVA 3KUGA 5EHHA 1CJTA 3PKYA 2YX1A 5HVFA 3QLHB 3G71S 1SL1A 4QR0A 1AUDA 1VCTA 2GGPA 5CD4A 4BWJA 1Y3JA 4BCAA 4DUYF 2IM3A 1WKKA 2RQCA 3ZZZA 4MFBB 4USWA 2ZBIA 1JK9B 5EGYA 3AQOA 2AX0A 1XK8A 3POTA 1YKWA 4ZPAA 3KG0A 1FVSA 3ILOA 5K5MA 1YJNS 3HHLD 5ETKA 1UFLA 4DL7A 2DJWA 2QLXA 3N5BA 2XMKA 3J81Y 1VJQA 1RUSA 4G6VB 4DEZA 1TK5A 1U0SA 1N5YB 1FTRA 4N8OA 2CZ9A 5AT1B 3VAKA 3CWJA 2X1AA 4HR2A 3SDEB 3T5KA 4DFMA 4QQBA 2IBOA 3CO0P 5IZHA 2CQ0A 2Q6CA 1H6KX 4HTIA 9ATCB 4B3OB 4YR2A 1XN9A 4RW9A 3CJ2A 2PE8A 4EYHB 1S0OA 5AE1A 4C3KA 4WK1A 5AJ3J 2LECA 2CJAA 3HKZD 2YNGA 3IWXA 4RUHA 3T9NA 2HZAA 5KFHA 2C3YA 5DETA 1NJYA 3QJJA 2XMTA 4ED8A 2J5AA 1T3OA 5B0EA 2Z4PA 1PYOB 2ZOMA 3K17A 1RLDA 2KVQE 1B64A 2VG6A 2MQQA 4DR1F 1IBMJ 2UUBJ 1NSQA 3QFHA 4KGKA 2KRBA 1E6YA 1FERA 1OY8A 4ZCLA 2L08A 3R7NB 4HKQA 3BH7B 4Q45A 2GFFA 1XWLA 1S1VB 2QLWA 3AHPA 1RTIB 2DNRA 1DTQB 2H65B 5ETNA 1PJ7A 2E7VA 2ASLA 4NL5A 3JQKA 2YKMB 3Q8QB 1RQ0A 2CDRB 1KEKA 5A8KA 5KFOA 2M5YA 1B70B 2C2EA 1VLOA 2K3KA 2Y9HA 2MQ8A 3OTDA 5E5NA 3VGVA 4J9SA 3J7AN 3KJVB 2ZEJA 2JEIA 3V4IB 1RWNB 4GKJJ 3PYEA 3MOJB 3IBCB 3D67A 2LA4A 4MK8A 4ED2A 3PO5A 3ZZRA 4X64J 4KR0B 4RO0A 1YLXA 4JI0F 1FD8A 4UY8T 3Q22A 5EX3A 2HFSA 2Y1IA 2UUWA 4C98A 2E7WA 3U1MA 1BMQB 5KFMA 3UR3C 4QIWD 3D54A 4M63A 5KT4A 1UP1A 3H59A 4NXMJ 3BSAA 4MIAA 4ETZA 1Q5VA 3MM6B 4CRJA 3VAHA 1NEEA 3LUYA 1WF0A 1FXRA 3KK1B 1BD6A 3ZTOA 2DY1A 5C5JA 1R8CA 2RQ4A 4NMXA 2GQQA 1B0TA 2EC0A 1B7YB 3NG8A 1I3OB 2D3OR 2OH2A 4RKUC 5DO2A 5LJ3Y 4E8UA 1VDHA 2X1FA 3CJQA 2FLNA 1K44A 1FESA 1MMNA 3O2IA 1JXVA 2F8EX 4ATNA 3BF4A 2VJUA 3GILA 4F67A 4ZVGA 2HNZA 3HHLC 1P1TA 2E44A 1ACMB 4PG4A 3QGHA 8AT1B 2EG2A 3NGSA 3G6ES 1U2FA 3UFCX 1V3SA 1SL0A 4K4TA 1S9GB 2DYAA 3L95X 2FJDB 3LOUA 1LW2A 2DEJA 1HNIB 3LWMA 2AQ4A 3PV8A 3F44A 2HPUA 3C16B 2DGSA 4JYAJ 2XMAA 4FF2A 1SKUB 2WSEC 3RU0A 2IC3B 1JKHA 4I7FB 1S1TB 2MYFA 3UN2A 2JEFA 4YHHF 5ETQA 2BKNA 1HW8A 3MEGA 3RJMB 1MLAA 4DR5J 4LT6A 3DCAA 5D78A 1N5TA 5HI7A 2RU9A 4J91A 3KNAA 5KFNA 3FBFA 3TEGA 2HMIA 1G7CB 4X66F 3BQ0A 1W25A 1GXLA 3BREA 3C3LA 1H7XA 1X4EA 3N4WA 1T9XA 5L1IA 3CVKA 2AYMA 1KS2A 3T1HJ 1VK8A 1X4AA 4DLEA 4X4SA 1RT2A 2GAHC 5DDQC 1WC0A 2ADCA 2MY7A 4JV5F 4OI4A 1UVJA 1T95A 5E0OA 2V2VA 2VUGA 3CUNA 2YH0A 2J9DE 4TVAB 4Y0FA 3NKYA 4ED6A 4B3MJ 1DLOA 5F9NA 2GMHA 3KLFA 5F8NA 3BGRB 4ID5A 2NXUA 1VLYA 1EX8A 4ZVTB 4LF5J 3KTQA 3GYGA 3IR7B 1X5TA 3PIOQ 4PAAA 4ZVEA 4ZCMA 5SZTA 3KK3B 1CG2A 1SV5A 2X51A 4HVZA 3SCJE 2CXEA 1TUWA 4NRUA 3TVZA 5KT3A 2W01A 4RBTA 4J9MA 1TKDA 3BBBA 3D1QA 1Q86T 2CPFA 1SBRA 3M32A 1A0OB 3DGVA 1SC6A 4F8RA 3DLKA 2HWTA 2I5JB 4USJC 4USMA 4S0MA 3UPFA 4EU0A 3M2UB 2MXYA 2VKZG 3NWRA 3M8ZA 3KLGA 1X31C 4F7VA 5IT9U 3KXDA 3S8SA 4CO4A 1S4EA 2HBRB 3I31A 2PO4A 4NLYA 4WFAQ 3KMSA 3BGOP 2OUGA 3I55S 4OMFG 3MAAA 3KDNA 1B3TA 5EWFA 4WPAA 4BLGA 1RADB 2R8HA 3TARA 2YNHA 5KOXA 2ALZA 5CYJA 4K50A 2J76E 1RWUA 4PEOA 4JI8F 4M5DB 3DGPA 5LSLA 4O3RA 3Q2SC 4D3HA 1IKWA 5I3PA 1MMDA 2YTCA 2IM0A 4DV7J 4ZVPB 3VQSA 4NMLA 4PG8A 4DQQA 2ZJRQ 3MCSA 2FUG9 2G0CA 4XO0A 3PFOA 1AFIA 3CEDA 1S6QA 1VJWA 2KM8B 2MSTA 4U67Q 2CUYA 2D7SA 1HNZF 3E3XA 3ILIA 3PW7A 1UVIA 2R7QA 4OYIA 2ZH4A 2XO6A 3G82B 2XCPA 2ZM6F 3UWTA 4AXJA 4XPEA 2XS7A 1PBAA 3WIVA 4ZVFA 2M2BA 2LKZA 2DCLA 3U7JA 3RZAA 4C3LA 2AYEA 4V1Ak 3MR3A 3MMAB 1VRQC 2FJAB 3G6VA 1T9YA 3GQCA 4EMDA 4FS2A 5ETPA 4UOGA 1ZPVA 1RAIB 1C4AA 3CJ5A 5EWGA 2Z2MA 4C8LA 5H9EJ 1U0HA 5K14A 4P10A 3W9JA 4YP3A 4H54A 3H2UB 1HQEA 1FKOB 1RTDA 3PRBA 4I4BA 2VBXA 4G1QA 5IC4B 1RT6A 2QJ3A 1I6JA 4IOAQ 1AA1B 4FYDA 2VPZB 3CMES 3H4DA 3I6PA 4H4MB 4JI5F 4U7UK 4CO0A 5IQQA 2CQDA 5I3UB 5HP1B 2FHKA 4LJMA 2ROPA 4HTJA 1TVRB 3ITHA 4LSLB 1MW7A 1NBEB 4USIA 3ISNC 4IR1A 1F2HA 2P5VA 2Z8QA 2DD8S 4RW8A 3US5A 5J1PA 7AT1B 3PY8A 3KHGA 4GC6A 3LANA 1QM9A 4O3PA 3M8WA 3MI7X 3A8IA 3A8JA 1WC1A 3MM7A 2A18A 4RNFA 3FBBA 2RS8A 1N34J 2NPFA 4PABA 2XY6A 3MM9B 4F4AA 4L3NA 4R5PB 1SXLA 2OHDA 1D9AA 5LSOA 2I9SA 3OXLA 1AZSB 1KRPA 2R7UA 5ITHA 1UZDA 1IR0A 1URNA 2KN4A 3RB0A 1C1BA 1S1XA 4DPOA 4RW7B 2FHJA 3TX8A 3W7BA 5IT0A 3I0RB 5GMEA 4EYIB 1EKSA 1BY9A 5IT4A 4DV4F 3BBCA 3ZTPA 5D4PA 3E01B 3L09A 3S01A 4DUYJ 2DGUA 1H2VZ 3GE9A 3H5XA 4X4RA 2RMLA 3BYRA 4RJVA 3CCLS 1RE1B 2OPSA 4X4QA 1VRUB 4DPWA 2BYCA 7FD1A 4IFVB 4OZ2A 4OZ0A 5GAGU 2MKCA 3B6BA 3VCDA 4KV8B 3H8YA 2R8GA 4JBCA 3OSNA 1U1PA 1U1MA 4CT8A 3BGLA 4F2SA 5A0YA 1FD2A 4Y6IA 1JLFA 2IAJB 3A3PB 5CABA 3B4MA 4CLTA 1ZBTA 4HL9A 4P2FA 2G1DA 2PFFB 4Z2XA 2ACYA 4IG3B 3MCMA 4Z37A 1S1WB 1GMWA 1GX6A 3G2XA 4LSZB 4HACA 2K3IA 2B5JB 1YITS 1NRKA 4J9NA 2FZCB 3RRGA 3FK4A 2MHNA 4TN2A 3A12A 3P4UB 2VD3A 1HQUB 1RT4B 4KYZA 3MM8B 4Y2MA 1ZOTA 2GMLA 4A46A 3H0PA 4DDFA 2FLPA 4USHA 4M1KA 1LXNA 3AODA 2ABYA 3EGZA 3BBFA 4LRDA 2CFXA 8ATCB 2OPRB 5C24B 3DDNA 3C66A 1SCJB 2H5IB 1S5ZA 4M8LA 3MD1A 3JXOA 1ZZNA 5ADZA 4DR1J 2FGOA 1U47A 2PMHA 5L8RC 2H4YB 3KG1A 4YR0A 4WE1A 4QR1A 2IHR1 1W2IA 4CTAA 4B9LA 4LF9J 1T0TV 1YJ9S 4RW6A 4X4VA 1UW9A 1SI9A 3VAIA 1RHQB 4DX6A 2XS2A 2MKJA 2Y3YA 4L72B 2UVVA 1X5PA 1PYTA 4UUWA 3GG1A 3SZ2A 1F1BB 5A8RB 2RAQA 1Y00A 4YY3F 1ZM3A 4B9TA 5ETVA 5CXTA 4C11A 1JB0C 1CPZA 1MN9A 1Y5NB 3QFWA 3KK2B 3BJYA 1RP5A 2HRYA 1V9OA 2IJRA 3MM5B 2YWEA 2RF2B 4X84A 3TJ9A 4LRCA 4EI2A 3MAHA 3R1HA 1T94A 5GMDA 1CJKA 3N9UC 4JI0J 4C8KA 4HH1A 1ZM4A 2V4RA 5D77A 4QIFA 5D15A 3VAMA 2SXLA 2PA3A 1HI1A 5AE2A 3W61A 1E6VA 1UPPA 4LF8F 2LP4A 4QIGA 3WHIA 2QA4G 1IKXB 1TL3A 4PXCA 1Y5IB 2DNKA 2BJ1A 1D09B 1YDLA 3MPWA 2EW9A 1HBMB 4IG0A 3DRSB 5KT5A 1X4FA 1CULA 4DV3F 1N48A 1XERA 2AGOA 4FXDA 4DR2F 4F04B 1AW0A 2VC1A 2DO4A 1U2RA 3DOMA 3W60A 3KJFB 1YBUA 1H98A 1SPBP 4P71A 2JRSA 4O3QA 4DI6A 3C6UA 1DARA 3TA2A 4M94A 4DV2F 5KT7A 3FSXA 2WSFC 1KC8T 2YKQA 1HI8A 1JJ4A 4DLGA 3NCRA 3TVYA 2AYBA 2ZOGA 3MMCA 1HYSA 2DT9A 4H4KC 4A8KA 4OI6A 4ZS6A 1I5OB 4FS1A 2QG9B 4M5LA 4LVNP 1K8AT 2QL9B 2NREA 4NI2B 5HMWA 1IWGA 1T9VA 2ZOFA 3DLJA 3VR1A 2Y1RI 2BQUA 5LT5A 1TKZB 1WC5A 1D8YA 4PG7A 3V6KA 3Q23A 2B9WA 3MEKA 4FDFA 2HQ3A 4YHHJ 2GHVC 1H3DA 2BANA 3HMJG 4K59A 5B0CA 3NAIA 3RRKA 2WZ1A 4CM0A 4X66J 2WCXA 1YJTA 3O1LA 4N41A 3HF5A 1NDLA 3CMQA 3J7YI 3K5LA 4DSFA 4WKYA 2FVRA 1CS4B 3Q8UA 1B0PA 2C2RA 4DF8A 4PRFA 5A2QU 4LR7A 4P2SA 3PRVA 4JV5J 3TAMA 2B4PA 4EK2A 1Q4RA 3PW0A 3BZQA 3CT9A 3K8VA 4O3NA 4BC7A 3V4MA 3CPWR 4YB1P 1NM2A 2FJEB 1RDRA 1CLFA 1R0BG 3NMRA 1C0UB 2FYXA 4F4KA 3IO1A 1I94F 5IC6B 1VMBA 3KLIA 1UFWA 3DRRA 3ZZPA 2ZE2B 1UWBA 4GVLA 1MROA 1Y11A 1N6QB 1EP4A 4WFXA 1BQMB 3L3CA 4RWXA 4WBFA 1S7HA 3IAS9 5RUBA 1URRA 1TL1B 1NK4A 2YWWA 4ES3A 3PEJA 5I42A 2CNKB 1OJ4A 1HQ2A 2YWGA 2VV5A 1G6BA 1TMJA 3CD5A 1RSCA 5DDOC 3UW1A 4QW8A 3W1YC 1S4FA 2JDJA 1KSPA 1REVB 3FJ2A 3M4XA 4ZLLA 2PI5A 4KTQA 4OJGA 3NS5A 1TKXB 1U48A 3QAUA 1WG4A 3OR1A 3TYTA 4YB7A 3AA9A 3PR5B 4KQZA 5D4NA 5KFBA 1RACB 3N6NA 5AXMA 2GIFA 4LF7J 3M6VA 4DL5A 2IJFA 3M9OB 2XMJA 2IYIA 4I2QB 1V5IB 2BA9A 2OI2A 2G4BA 4AD6A 2KU7A 3H2VE 2FJBB 3V6DB 1JLGA 5KFIA 5T41A 2BDPA 2RQKA 2PFDA 1N0UA 3Q8SB 1J5OB 3ZTQA 3EM1A 2QX0A 4O4GA 3PJXA 5L38A 2UXCF 4KKOA 4KSEB 2BJ9A 2DTJA 4JI8J 2NPIA 2NCKL 3N5FA 3GIJA 4YB6A 2VFUA 3D9BA 3ADAC 1TL7A 3DOLA 6AT1B 4WP9A 1M5HA 1LK5A 1B0VA 3FGVA 5KG5A 4NLXA 3QJLA 4QWAA 2E9RX 1NSPA 3L7UA 3QNWB 1NJIT 4CH1A 4OZNA 3KYLA 1S0MA 1RT3A 3CJRA 1WTBA 1HNZJ 5H9FK 2YNFA 2BW7A 2ZNZA 3R5GA 4XK8C 1RT5B 4GKKJ 5KFZA 4B08A 1HKAA 2ZM6J 1FK9B 4EBDA 4M5MA 3OHBA 4KGVB 2GVDA 4C3MA 3AOCA 5KG7A 1RTJB 3HSJA 5B7WA 4ECWA 4I69A 3C6TA 1JLQA 2G2ZA 3T6JA 3HP6A 3AD8C 2VBYA 2YKNB 2ZKTA 3D3BJ 4ZVOB 3P6YC 4PCQA 4ILLA 1R6YA 2O5DA 4UQTA 3D1HA 2IVFB 1KTQA 4X4OA 2EFVA 2J0SD 1R7IA 2M9KA 3GFXA 1KLNA 4B3TF 3L4BC 3BSNA 3CGIA 3WC0A 1JLBB 5DGAA 3W8PA 2V2ZA 4F4YA 4KO0A 2CADA 3RUBL 4NASA 3JAMU 1I1GA 4JI5J 1AYEA 1CJUB 1NAQA 3IS9B 1WELA 2JSXA 2O66A 4F2RA 4OX6A 1FFGB 4JI7F 1BQXA 4Q7AA 4PG6A 3LAKA 2WRMA 4RX6A 2F4VF 3EUNA 1JMTA 4BDPA 2J6TA 2BZ2A 2QN6B 2C1EB 3M2RB 5J2NA 3GYNA 3G96A 4LSNB 1JLCB 3GMGA 2APOA 2LQ9A 2MQMA 1DQ9A 3I9V9 5DQIA 3PYFA 2YWFA 1X60A 3AOAA 4WIIA 1NK7A 5E7OB 2P6TA 2W24A 2KYZA 4MTPA 3P8BB 1MU2B 2BRKA 3DLEA 3DI6A 4OJ3A 1H72C 1RISA 2NYHA 4ZPWR 3MECB 2DVIA 4KH0B 1U1KA 3PM9A 3ENVA 3BKFA 2Q1LA 1NUEA 2DISA 4FBTA 2I0XA 4XTTA 4Q8EA 1VQKS 1QSSA 2VHGA 2JVRA 2HZCA 1NKCA 4DV4J 2DY9A 3G6YA 1N52B 3M7VA 1UA0A 2C2OB 5HSPA 1U6FA 4GVBA 1TAQA 2PI4A 2FVQA 1FRMA 3VTIA 2R7OA 5HVHA 2M88A 2K06A 2RS2A 2MQLA 5ETTA 1U1RA 3BM7A 4RBVA 2KI2A 4UZCA 1KFSA 1NB2A 3DC2A 2DHSA 2E1PA 4JOUA 1WI6A 1XEZA 2DPIA 1EAYC 3ET6A 4LF4F 2JC0A 2GO8A 5H1SV 4KGMA 2DR6A 2I2YA 4DQSA 3NCPA 3RGIA 1IJEB 3TJAA 1M0SA 3RAQA 4DHVA 4EGLA 3M9NB 4XDDA 2HK2A 3CJKB 4PPZA 2J8AA 2B9YA 4ZMMA 4DQPA 1RCXB 2HNDB 2R7SA 2VG5B 3TANA 4CCHA 2HURA 4C4WA 2R2SA 2Z30B 2FQQB 2P9CA 2ZD1A 5KOWA 2HGLA 2EEYA 4WP8A 3PCOB 3QLHA 5D4OA 1FX4A 2KHDA 2Z2ZA 2B9EA 1QAJA 2F65A 1ZZFA 4IKAA 1R6VA 3LTOA 1ZM2A 4G1PA 1X9WA 3AQPA 1S99A 5IXUA 3H4BA 5ETLA 4CLFA 1FJCA 5HAOA 1YGYA 2B9XA 3NNHA 2OO4A 3G8TA 4LREA 4DR7F 4DL4A 3MWBA 4NEYA 2AEJA 4KB7A 3DU6A 3IRXB 2W4PA 3SQGB 2G1HA 4F0KA 4GO7X 3DLLQ 4HYKA 4J9UE 2OD6A 3MR2A 2I8EA 4YY3J 1S97A 2ZH5A 4X4TA 1N5YA 4FXVA 3BV8A 3EICA 4B9NA 4NLDA 3SDEA 5KFFA 3OJSA 2XHWA 3TI0A 1RAJA 2M52A 1UJ5A 3HK2A 2GAGC 1JLEB 5HMXA 2XLJA 2Y1JA 1K1SA 4K4VA 4B3OA 1VQMS 3B4DA 5THWA 1ZTTA 4A47A 1DRZA 1DTTB 2KT5A 5F8JA 3QIDA 1TK8A 2BACA 2WOMB 5GAHU 3NOCA 6FD1A 2H51B 1RHKB 2BR0A 1SKSA 3PX6A 1XNRF 1RHJB 1WC4A 2HHPA 2NUUG 3MR5A 1F60B 3HVRA 4LF8J 3RW6A 2CVIA 2KRRA 3IBFB 4OHWA 2GJIA 2KO1A 4ZHRB 5CYMB 4TY9A 4C8NA 2HS4A 2MSSA 4NPOA 4DV3J 5I4MA 1WC3A 1QE1B 2IVMA 1PCAA 1HWKA 3FQLA 5HQ8A 2YQ1A 4MKBA 2MQNA 5CHCB 3NEKA 3T6BA 1S1VA 3GFHA 4TLQA 3LF0A 3K2YA 1NPPA 5F9LA 3OTBA 1RTIA 3HVTB 2YY3A 5HQLA 2W9AA 1DTQA 3ZZUA 2RKIB 3IXQA 1JLAB 3HHDA 3D5MA 2C2NA 5EN1A 2YKMA 1KR4A 5LMNF 1GNKA 2DNLA 1LXJA 2ACMA 2UVRA 2K2PA 1DQAA 3R6LB 4RLEA 3KJVA 2FVPA 2QT7A 3V4IA 2MLXA 4Q44A 2MEWA 2W9CB 3QZ7A 2JLGA 2U2FA 3AXMA 3HD1A 2HGNA 2OELA 3KUEA 5DG7A 4WJBA 1IJFB 3H42A 1IUJA 3UNGC 4N77A 1CEZA 3IR6B 3CCSS 1LWFB 4LF6J 2DXDA 3EE3A 2NZ4A 4IDKB 1TQLA 4NYOA 1ZYQA 3D6MB 3HVWA 2XMVA 2L3MA 3DLGB 2VFSA 4FPRA 3VF0B 2AX1A 1UJ6A 4U95A 3DLBA 3PW2A 3OJUA 1YI2S 4I6WA 4L73A 3MM6A 3KK1A 2E5LJ 1TUGB 1CC8A 3N6LA 2AJFE 2R7VA 1RAEB 1R0AB 4ZA1A 4LRAA 5CZVA 3D2WA 3V6HA 2E66A 2ZDPA 4ECUA 1FE0A 2LMIA 2ZC3A 4W92B 1Q7LB 1M1HA 4YQWA 1NPRA 2CG4A 2VDIA 2ADBA 3QGPA 4F4XA 1M90T 3G6XA 2JWNA 5B0GA 4KHRA 4EBCA 5JVHQ 1S79A 4WWSA 2IY5B 1I94J 3LGNA 1FDAA 1DZ5A 4JI6F 1S9GA 3EDQB 1RWKB 5DJBA 1J5EJ 4TQRA 2H3EB 5F0UA 1S57A 3JS9A 2NLWA 1HNIA 5D6GA 3R5CA 1Q5YA 4ZVRB 3C16A 1S12A 2V9WA 2IC3A 1FJGF 2MKYA 4I7FA 1XJWB 2VIHA 2V8PA 4FPIA 4AT1B 4JV2A 1S1TA 4WFYA 3D0IE 3T9ZA 2UUTA 3GIRA 3U27A 1MG7A 1Z2LA 3BGUA 2QFIA 1N5QA 4DPXA 4RW9B 5C42B 5A6WA 1PG5B 2ZITA 3SSSA 5D4LA 2ZBCA 5KFAA 4CLYA 1DJ0A 3UR0A 1QLNA 2YWHA 4NYZA 4FNIA 5FLXY 2IRYA 4WXOA 4R0EA 5A76A 1FWPA 4DFKA 3BDPA 4F25A 4JV1A 3GJTB 4NLOA 1ZPWX 3HX9A 2RJZA 2NZCA 4WFNQ 1QUVA 4DV6F 2PC6A 1GMWD 1S0NA 2RDDA 3TX0A 2R8IA 2YX4A 2UXCJ 1ZH5A 5D3GB 1SC4B 3I9ZA 2HW3A 5L9NA 4QYZK 2CQ2A 1FJEB 3KK3A 3UCUP 3DDKA 5DM7Q 3CJ4A 4IO9Q 3IRWP 3C2PA 5D0RA 4O3OA 5GAHI 4DR3F 4M5GA 3I5BA 1VYAA 3OT9A 5A8KB 2BQRA 4ECQA 1Y10A 3TUIC 2W2NP 3J81j 3BSOA 3M6WA 4RNHA 2M3DA 3OVAA 3CCES 4Q2LA 3FQKA 3W2WB 2I5JA 4QZVB 2DGXA 3EZUA 4ZPCA 4IUFA 3X3UA 4TYAA 4KY3A 1NMEB 2VZ9A 4H4KA 3M2UA 1ZAWA 2O3DA 5DZ6A 2WVFA 2XLIA 3DM2B 5E3CA 3IG1A 3H2LA 4K0KJ 4C9DA 2H5JB 2DH7A 2R8KA 3T5LA 3HSGA 1S1UB 2L9NA 3NCQA 1AFJA 3X1LB 1FNMA 5J2QB 3ZFVA 4B3TJ 3MHYA 4NX9A 2OFGX 4ZDNA 2GVZB 3CDUA 4F36A 4QCLA 2W9BB 1X7VA 2Z56B 3SIPB 2AF6A 1YBTA 5F8IA 5LJ5Y 1YZ7A 4W98A 2UUAF 2HHTA 4M5DA 1KQSR 2XWYA 1O8BA 2M7SA 5B0FA 2F4VJ 3ZZOA 1L5UA 3DKDA 2M8DB 1H38A 2MTLA 4QWDA 2KZMA 3NY0A 4W4MA 2AGPA 2A6MA 5U47A 1MWZA 1VBZA 2QZ8A 2ZFHA 3G82A 3NS7B 1JJCB 1M1GA 5CYQB 4LRFA 5F8HA 1UEVA 2ZBPA 1R89A 5M2PA 1EB0A 1X5SA 4RPFA 5DS7A 1FTCA 1TKTA 2HIYA 3FFIB 3W9HA 2E7XA 4YDDB 3V6JA 4ECXA 1Q7YT 1GK8A 2WK4A 2YKPA 1JJ2R 2BXJA 3MMAA 1HARA 1YRXA 2VBWA 4OX8A 4ZN3A 1JXEA 3D7SB 4OI2A 4UQGA 1V6HA 1RHMB 1RTZA 2J0WA 1CQMA 3RB6A 3CC4S 1T8EA 1FKOA 1SB6A 1LV5A 2NXEA 2FJWA 2ATCB 4C2MA 3M8QB 1WF1A 1XNQF 1FFSB 3HZEA 1XR5A 1EQ0A 1RJJA 5CZXA 3BPSP 3MD3A 4ZLNA 3GONA 2FZGB 3O5TB 4RNOA 3GIIA 2CWXA 5I3UA 1RU1A 5HP1A 5ETMA 1NSKL 3EPGA 1YJWS 2DH8A 4P7TA 2LYVA 1TVRA 4LSLA 3K57A 4C6AA 2I38A 4ECSA 4FYWB 2Z58B 3I87A 4LF4J 2WAQD 5HATA 2LQJA 1RA7A 4ID5B 4MH8A 2LEBA 4IRKA 1FEHA 3PYDA 3IN5A 2KJVA 3CIZA 1CQNA 1GEHA 3AD9C 1QSYA 1FA0A 2LFVA 3PVXA 5AE3A 1TUVA 1LWEB 1WHXA 1U1OA 4A8FA 4PPDA 1HLWA 5J1EB 3M30B 4R5PA 1LWCB 2BJ7A 3Q8VA 1N88A 3MR7A 2PSZA 1T7PA 3GB0A 1AZSA 5IM0A 4PWUA 4D3GA 1NDPA 1FRKA 4BC9A 4OHXA 5EX0A 3QGIA 4RW7A 4FP9A 3WIUA 1LFPA 4F0MA 2OPPB 2ZDOA 3I0RA 3R8YA 4NCGB 3FZBA 1HWLA 1FRLA 2L48A 4LR8A 2AJQA 4KRWA 3E01A 5BXIA 4EO8A 3OFFA 1T11A 4CH7A 5KFKA 4KBIA 5LL6d 1TELA 4Y2CA 3UCGA 3DFEA 1VRUA 4Q8FA 1PILA 2WVDA 2OMLA 3NBPB 3OQ2A 4IH5A 4KV8A 3EGVA 1KP6A 1T05B 3OSPA 1S6PB 3D3CJ 2KXHA 4X65F 3WQPA 1RCOB 3SBMA 3KOAA 1IQTA 2DH9A 2IAJA 2VQEF 1A6LA 9RUBA 3JSMB 2E1CA 3Q83A 5L1KA 3FNNA 2GW8A 1IN0A 4IG3A 4CLLA 5JMNA 4HT7A 2CA9A 4TLRA 2B5JA 5L1LA 2P9EA 3THVA 1R31A 3LP2B 1KVKA 4CH0S 1HQUA 1RT4A 3TA0A 2MQOA 2VBZA 4IQMA 3J80U 2BOAA 2CWKA 3OLBA 3MM8A 4QIEA 4AYBD 2BEFA 2VB6A 4R25A 3VWSA 3RR7A 3ZZTA 4Q0BB 3E8OA 4IH6A 1XNRJ 1YJUA 4OZ5A 3NOGA 3TO8A 3M8RA 1GFWB 2YBVA 1Q79A 2OPRA 3HHKA 4U6PA 1S6UA 5C24A 2BRLA 4NZ7A 1YJRA 4Y2IA 2CVEA 4F4ZA 3DU5A 3SYZA 3LH2S 2IJNA 1X4BA 2RT3A 4OYXA 2D3ZA 2Q66A 2V34A 4OYAA 2HHSA 2ATLA 1OIAA 4WK3A 2OPQB 1ZS6A 2R9LA 4CO1A 5FDLA 3P5TL 4NZ0A 2GMJA 3N28A 5E3PA 3R1LA 1QAXA 3DMJB 4ZVQB 2OKQA 3VGUA 3AFGA 3UD3P 1U1LA 4UTGA 3FSYA 5A8RA 1RKIA 2W7OA 2EFNA 2VQFF 4P52A 4DS5A 4RNMA 5LMNJ 2AT1B 4WYLA 4ZP8A 2JC1A 3KK2A 3O6QA 2ZH6A 4CI0B 2H54B 4IO1A 3LP0B 2Q79A 3SSRA 3MM5A 2FY1A 3M6XA 1HWUA 3W2VB 5KTQA 4BBYA 2RF2A 5J2MB 2U1AA 3HJVA 1KFDA 3KLVA 1G4CA 2KFYA 1ZM9A 3JSYA 4EUVA 4L6V3 1Q82T 5L46A 4ALZA 2NXJA 1UFKA 1YK9A 4P2MA 3M8SA 4HT5A 3WZ0A 4J9OA 1N4LA 3ZC4A 4DV5J 3H7HB 2DPJA 2WONA 3FKBA 2XULA 1RI7A 2POKA 3MPVA 3SCLE 1RXOB 3OTCA 1IKXA 2PEHA 2J7KA 1HBMA 2KFZA 3DRSA 4AL7A 4P9SA 4CT9A 3I82A 2F9JA 1WEXA 2D9OA 5HROB 2W25A 1HL6A 1M5OC 4LIWA 2NS1B 2IRUA 2W2QP 1YTYA 3PG9A 1ITPA 3QATA 1XBWA 2MZSA 3V2UC 2G13A 5DQGA 1Y5LB 1BQNB 3DHWC 2X3GA 4PR6A 3NWGA 4N76A 2K8GA 1GQEA 3H98A 1HHTP 4I67A 4B02A 1H73A 5HN0A 2OPSB 4NCBA 4CNZA 1RU2A 3RBXA 3CCUS 3ISZA 1HD0A 4JI6J 2N3OA 3UI3A 3FEYB 2QMUB 2MQPA 4IH7A 4WP3A 3JTNA 4QU6A 2VICA 3HFVA 1S48A 3HDSA 4NI2A 1YRTA 2IM1A 1UJ4A 5HJXA 2J6SA 4P7VA 2D41A 3Q8YA 3AJ2A 3FMWA 4N56A 2HK3A 2IA0A 2Z57B 1TKZA 3GWCA 3RB4A 3CD7A 1WUUA 3CCWA 1TAUA 2XYHB 5L39A 2VFRA 5HLFB 2P2CB 5C25B 3A1YG 3JSRA 1HNXF 1EETB 4Y3CA 1P6TA 2CPEA 3N0VA 3ENWA 1P9QC 3R5BA 2XMMA 4DV0F 4OYWA 4OJHA 2ZWPA 1CS4A 2CPHA 1RYSA 4R8UB 3HZGA 1WSRA 1Y0HA 3D0HE 1FRJA 3M1VB 1L3KA 1JIHA 5DRKA 2DNMA 5MAOA 2ZH1A 4F50A 1KD1T 4M95A 3MEEB 2ZJPQ 3NAHA 1WORA 5KFWA 2WBMA 5JXSA 4FF1A 4CP5A 2DR9A 4ZCKA 1HPZB 1T9UA 2G2YA 4ZP9A 2FJVA 4DV6J 3HSZA 1KLMB 1V5VA 1RBLA 1C0UA 3CJ3A 1QVGR 4G1IA 3DHXA 1S0VA 2PMZD 1SJ4P 5T14A 5C2CA 1DQ8A 4I0WA 2C3MA 5L1JA 1SC3B
chains in the Genus database with same CATH topology
1HBOB 3DRXA 2DR5A 1SIZA 3N5FA 4OV1A 2D9PA 3GIJA 4O4RA 1Q8IA 1X4CA 4YB6A 2ZE2A 2ZH7A 1IBKF 4FF3A 1FXDA 3BQ1A 1O51A 2M8HA 2VPWB 1N6QA 2VFUA 5E41A 1NK8A 2FVCA 3RW7A 1C4CA 3DOLA 4AQYF 1OQ3A 3MZIA 1M5HA 1LK5A 4E98A 4NLPA 4NLGA 1B0VA 3FGVA 4DV7F 2EBEA 5KG5A 4NLXA 3QJLA 1WD6A 4QWAA 2E9RX 4B9SA 3OFEA 1QY7A 3HKWA 2OD4A 1OPIA 3TW0A 2IBKA 1NJIT 4CH1A 4OZNA 3KLEB 4NLQA 1TFYA 3KYLA 1S0MA 1RT3A 4DFPA 1WTBA 2YNFA 2WOMA 4QPTA 1HA1A 2V8HA 4WU2A 5J2NB 4C0OC 5HLFA 1UAWA 2ZNZA 2KH9A 1VIXA 1NK0A 1N33F 4XK8C 4ILMA 2JLEA 5M2RA 3IWLA 1S49A 2COLA 4I1TA 5DG9A 2B51A 1RT5B 5C25A 3HXMA 2ZVSA 3LP1B 2OTJS 5KFZA 4B08A 3OV7A 1EETA 4OX9F 1FK9B 4B9UA 4DSLA 2V9KA 4BS2A 1P27B 2K7KA 5CH7B 3EX7B 4EBDA 1LK7A 4NYPA 4TQSA 2HNYB 3OHBA 4R0JA 2GV1A 2RRAA 2RNEA 3ETOA 4J9RA 4C3MA 4MYTA 1TKXA 5KG7A 4DF4A 2OJ3A 3T1YF 5DDRC 1RTJB 3K5NA 1M1KT 4R8UA 2J0QD 5B7WA 4ZPTR 4ECWA 2UUCF 3E2EA 2CZ4A 4I69A 3C6TA 1BLUA 1JLQA 3M8PA 2AYGA 3M1VA 1TP7A 3DLEB 3DI6B 2W7AA 3UD4P 5KAKA 3T6JA 3DOKB 4V19X 5KG6A 3HP6A 2FHMA 2A3JA 4ITSA 2VBYA 3OLAA 2YKNB 2ZKTA 2BBEA 1KVJA 1L3SA 2LU1A 3MTKA 5KFLA 2R7RA 3A8EA 3FEZA 3MEEA 4PCQA 3P6YC 2BABA 4I2QA 4ILLA 2V8GA 3F73A 4A8OA 1R6YA 4YMEA 1HPZA 5KFCA 1RYRA 5HMYA 1PGZA 2F40A 1HWJA 2O5DA 4UQTA 2CQCA 3D1HA 4WYWA 5DLGA 1SIWB 4RW4A 4MK9A 2IVFB 1KTQA 4X4OA 3FMBA 4LMZA 2EFVA 4AL6A 2J0SD 4JI1F 1C1CB 3V6DA 2ILYA 2RDJA 1WACA 4URQU 4ECVA 4QOTA 2QA1A 1R7IA 1KLMA 4PG5A 2M9KA 3GFXA 5FDLB 1KLNA 4B3TF 2OLWA 3CCRS 2A2DA 5F3ZA 3BSNA 1RT7B 3CGIA 3WC0A 2MZTA 2CQBA 3IA0A 1CVJA 2JOQA 1JLBB 2XBPA 5DGAA 1M5KC 2CJ9A 5B09A 3T3FA 3G86A 2GGPB 2EI5A 1J5OA 1OWXA 2UP1A 4EZ6A 4ZK7M 4B3RF 4F4YA 2V94A 4KO0A 2DBBA 1VI7A 1R8AA 2CYYA 3O44A 1NHVA 1LOUA 2WSCC 2HLTA 4NA3A 1VIOA 2UZAA 3NGKA 1I1GA 1B7FA 4HI2A 1R8BA 4URGA 1HBOA 3H20A 1YJVA 1NAQA 3IS9B 1WELA 4X4PA 2LA6A 2JSXA 3MF5A 2O66A 3JAMY 4F2RA 4OX6A 3CCZA 4JI7F 2B7BB 1YVFA 2N4CA 3GIMA 3U02A 1BQXA 4Q7AA 1VFJA 1R43A 1N5VA 2AU0A 1YG0A 4PG6A 4QW9A 4K4YA 2X1GA 3LAKA 2WRMA 4RX6A 2F4VF 3EUNA 3POTB 2FLLA 4ELUA 1IKVB 2ERRA 2RDIA 4OIXA 4KFBA 5KFDA 3QAEA 2JEJA 3KLEA 1JMTA 4HEA9 2N82B 4BDPA 4DG1B 2J6TA 2BZ2A 2DGOA 2RD5C 3MMCB 3M2RB 3ISND 5J2NA 2IYGA 3GYNA 1U8SA 4FF4A 4Y00A 3G96A 1RT5A 2FD2A 3LP1A 4DQRA 4LSNB 1JLCB 4RU9A 5E3RA 3GMGA 2V8DA 3PDNA 1FK9A 2B3TB 1SH3A 2APOA 2KXFA 2VKRA 2XSFA 5JVGQ 2LQ9A 2R2UA 2V2KA 3V5RA 3OFGA 2BE2B 4OI0A 2MQMA 1DQ9A 5HMZA 2HNYA 5KT2A 3I9V9 5DQIA 4B9VA 1N34F 3UE2A 4F26A 2YWFA 4WIIA 1NK7A 4G3IA 5E7OB 2ZKUA 2P6TA 1FDBA 2V5HG 1RTJA 5KFGA 1G3OA 2W24A 2KYZA 5AXKA 4MTPA 3DLGA 5IS2A 1MU2B 2BRKA 3DLEA 3DI6A 3KFWX 3RBDA 2WONB 4OJ3A 1VC0A 1RISA 1FXLA 3DOKA 1NK6A 3OFHA 1D1UA 5J1NA 3CSKA 3HLUA 2LVWA 2YKNA 3T5JA 2CPZA 4ZPWR 3MECB 4NCAA 1U1NA 1FRHA 2ZC4A 4ES1A 2DVIA 3S6EA 2ZD1B 3IGVA 2A1BA 4C0BA 1HHSA 4AFFA 1U1KA 3PM9A 5EHHA 3ENVA 1FDDA 2B6AB 2FC8A 2EBGA 4JUZA 2W4CA 3PKYA 3OW2R 2YX1A 3F56A 5B0BA 2Q1LA 2YNGB 3QLHB 1U45A 2DISA 4FBTA 5M2UA 2I0XA 3G71S 2E5HA 1C1CA 4MJKA 1FJ7A 1SL1A 4E0DA 4QR0A 4Q8EA 1VQKS 1QSSA 3TNVA 2JVRA 2HZCA 1NKCA 1AUDA 3P49B 3G6YA 2XSJB 4DBQA 1S72S 1JLBA 1N52B 1FO1A 2PT0A 1NB7A 2GGPA 5CQGA 3R27A 1KQFB 1UA0A 1U6FA 2NUHA 2HFNA 4BWJA 3LAMA 3CF5Q 3SFGA 2OAUA 1TAQA 1Y3JA 2FVQA 4BCAA 2PI4A 4DUYF 1FRMA 2IM3A 1WG1A 3TA1A 3VTIA 2R7OA 1VQ5S 3KMQA 3SMZA 4LFCF 2RQCA 2JFDA 2M88A 4DL6A 2RS2A 2MQLA 2HHWA 3IS9A 2VG6B 3ZZZA 2VH7A 3KLHB 4MFBB 2HG4A 1HMVA 1U1RA 3TAMB 2ZBIA 1JK9B 5EGYA 3BM7A 1N56A 4U9RA 3KKFA 2F3JA 1E6YB 3AQOA 1CSJA 2J9DA 2AJ0A 2DRAA 2AX0A 4RBVA 3B78A 1XK8A 1YWXA 3BGRA 2KI2A 3POTA 2O67A 4PXDA 4ZPAA 3KG0A 1KFSA 4DR6F 3CXCR 1T02A 1FVSA 3DC2A 2DHSA 2HQIA 5AXNA 4Y2KA 1LKZA 5K5MA 3CC2S 1Q8BA 2ROEA 4JOUA 1WI6A 1XEZA 1YJNS 1IXKA 3HHLD 2DPIA 2UU9F 1UL3A 1J2VA 1UFLA 3PX4A 3UDLA 4A8MP 3GG0A 2OIHA 3G9CA 3M2RA 3MFHA 1YRUA 4DL7A 2DJWA 3VAGA 5K8OA 4LF4F 2QLXA 2ZH9A 2XGQA 2JC0A 3N5BA 3SI8A 2XMKA 2Z2LA 2GO8A 2K1RB 5H1SV 4KGMA 5BR8F 3J81Y 2HHVA 4G6VB 4NOHA 2I2YA 2DITA 4DQSA 2C3PA 3NCPA 4IYQA 4LSNA 1JLCA 2CQPA 2VA3A 3CIMA 4ZPVR 4DEZA 3KHLA 4PQUA 1XTZA 1IJEB 1M0SA 1TK5A 1N5YB 3RAQA 2OSQA 1FTRA 1OQ6A 2BE2A 4DHVA 4EGLA 3M9NB 4N8OA 4XDDA 3Q24A 1XMBA 3VAKA 2CQ3A 3CWJA 2X1AA 3CJKB 4PPZA 2J8AA 2B9YA 3SDEB 3T5KA 4DFMA 3L7OA 1V3RA 2C22A 5KG0A 4QQBA 2IBOA 4ZMMA 1OPZA 3TR5A 4DQPA 2ZZMA 4J5OA 5IZHA 2CQ0A 2Q6CA 1H6KX 2HNDB 4HTIA 3S1TA 2L41A 1SH0A 1MU2A 2HAIA 2R7SA 2VG5B 2BW2A 3TANA 4CCHA 4B3OB 2WW8A 2FJXA 4YR2A 4CO2A 3GR0A 1XN9A 4LF6F 2IM2A 4RW9A 2CQIA 3CJ2A 1XMOF 2PE8A 2B0GA 2EKYA 4C4WA 4MIWA 4EYHB 2R2SA 4NLSA 2D1CA 2P9CA 3MECA 1S0OA 2AP6A 2YQ3A 5AE1A 4C3KA 2FVSA 4MKYA 1O0PA 2KJWA 2ZD1A 2PIIA 4WK1A 5KOWA 7FDRA 3F41A 1FRXA 2HGLA 2BV3A 4DR5F 4N47A 2LECA 2CJAA 2B6AA 2B56A 4YOEA 3HKZD 2YNGA 3IWXA 3QLHA 5D4OA 5H9FJ 2KHDA 3KWMA 5A6PA 2W8LA 3SV4A 3TVKA 1QAJA 3QGGA 4DN0A 1ZZFA 4RUHA 4IKAA 3PX0A 3T9NA 4J9KA 5KFHA 2C3YA 3P96A 4CZCA 2XSJA 3QYYA 3CCVS 4JI3F 5DETA 1NJYA 1X4DA 3QJJA 2E5LF 2XMTA 4DMZA 5CCLA 4LIRA 3DXBA 5GAGI 1ZM2A 3IFEA 1WTFA 1T3OA 2J5AA 5B0EA 5HO4A 4G1PA 4ED8A 3B82A 2Z4PA 1X9WA 3AQPA 1S99A 5IXUA 3H4BA 2ZOMA 2ZHAA 2RUGA 1FJCA 1VQ8S 3HFKA 4NXNF 3T1HF 2VG6A 1B64A 4NLTA 2MQQA 1G2EA 3KLHA 2FIUA 1YGYA 2B9XA 4DR1F 2R7WA 6FDRA 3NNHA 4DQIA 1PC5A 4ILRA 5IWAF 1UKUA 3HT3A 3W3SA 2OO4A 4KGKA 2UXBF 1WNEA 3HHNB 2KRBA 3RAMA 1E6YA 3G8TA 1FERA 4DR7F 4DL4A 2FHOB 2ZH3A 4ZCLA 2L08A 3MWBA 2CPDA 2QMWA 4HKQA 1HW9A 4KB7A 4Y2AA 1HR0F 4Q45A 2MPUA 3DU6A 3IRXB 2W4PA 2GFFA 1XWLA 3SQGB 1HNWF 1S1VB 2DO0A 2QLWA 4GO7X 3DLLQ 1JLGB 4HYKA 5GADI 3AHPA 5GMKa 1RTIB 1RKJA 5IFMA 4KHPF 1MSWD 2K1RA 3BQ2A 2D74B 2DNRA 2OD6A 2I8EA 3MR2A 3SV3A 2B4OA 4IRDA 1DTQB 4GMKA 2CPIA 2GHPA 1S97A 3CTRA 2LDYA 2ZH5A 2ASLA 4X4TA 1J5EF 1VQ9S 1N5YA 4LVOP 4FBUA 4NL5A 4FXVA 1YBAA 3DYAB 4ZOSA 1SL2A 1K9MT 3RRHA 1KNZA 2B43A 4NLDA 4B9NA 2YKMB 3CJKA 3Q8QB 3SDEA 5KFFA 1RQ0A 3OJSA 2LLZA 2HNZB 4WXWA 1KEKA 1GX5A 4BWMA 4LQ3A 4UOCA 2XHWA 5A8KA 5KFOA 3TI0A 1KOOA 2J6UA 2HFOA 4ZPDA 3BDEA 1RAJA 2M52A 1UJ5A 5F8GA 3IWNC 2M5YA 2JLFA 3HK2A 4KT0C 1JLEB 2C2EA 5HMXA 2HNDA 2XLJA 2Y1JA 3NGDA 1K1SA 2VG5A 4K4VA 4B3OA 1VQMS 2BQ3A 3B4DA 2K3KA 5THWA 1V3ZA 1ZTTA 4A47A 1DRZA 3MMJA 2J0XA 3OTDA 5E5NA 4J9SA 2GQ2A 3KJVB 1XMQF 1DTTB 2KT5A 3LPYA 5F8JA 2EK6A 2ASJA 2JEIA 3V4IB 3QIDA 2MKHA 4LUBA 2YNIB 3MOJB 5EDWA 1RT3B 2LA4A 4MK8A 4ED2A 1LW2B 1TK8A 2BACA 2YNFB 2WOMB 4HHJA 5GAHU 1QSLA 3PO5A 3ZZRA 3MXHP 2HVHA 6FD1A 2N7YA 1T3NA 4KR0B 1OO0B 2BR0A 4C8YA 4JI0F 1SKSA 1FD8A 4DSJA 4UY8T 5K8NA 3PX6A 2EWHA 3Q22A 1XNRF 5EX3A 3HHLB 4DR4F 1JKHB 2MZ1A 4DOZA 2EFQA 4K4WA 1U25A 2HHPA 2NUUG 3MR5A 2Y1IA 1F60B 1Z4UA 2R2TA 2GQCA 3RR8A 4J9LA 4RNNA 1YSJA 3DN9A 3HVRA 3RW6A 4AL5A 2UUWA 3AJ1A 4C98A 2CVIA 2VPYB 5D8HB 4YEAA 2E7WA 2KRRA 3I5AA 5SUHA 4C8MA 2HWHA 2MZQA 3NNCA 3MEGB 3M6UA 3EYZA 4OHWA 3U1MA 5KFMA 2GJIA 4FNHA 3UR3C 5DLFA 4QIWD 1NO8A 2KO1A 2KYXA 2ZNYA 4ZHRB 5CYMB 4TY9A 3D54A 4C8NA 4M63A 2HS4A 1SJFA 5KT4A 2MSSA 2QFJA 1VQOS 1NKBA 1UP1A 4NPOA 2XB2D 3H59A 4Y34A 5I4MA 1QE1B 3BSAA 2IVMA 2HMIB 4WKRA 3C46A 1HWKA 3FQLA 5HQ8A 4MIAA 4ETZA 4DWIA 3MM6B 4X4NA 4MKBA 3VAHA 1NEEA 4KE5A 4O23A 2QO3A 1VOMA 3LUYA 1WF0A 2MQNA 4LQ9A 1X0FA 1FXRA 3KK1B 1BD6A