2CRLA

The apo form of hma domain of copper chaperone for superoxide dismutase
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GSSGSSGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper chaperone for superoxide dismutase
publication title The apo form of HMA domain of copper chaperone for superoxide dismutase
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2crlA01
3BN7A 1VQSA 3LGMA 2N4CA 4HI2A 4NL5A 4FNHA 3FGVA 4DN9A 5T7LB 1CC8A 5B0DA 3BGUA 2LDIA 3HF5A 4OJ3A 2QIFA 2K1RA 3BF4A 2OMOA 1IUJA 2ASYA 2OAUA 2K7JA 4YEAA 1URRA 1N5TA 3FRYA 1LQ9A 1FD8A 2HIQA 2GGPA 1V3ZA 3FMBA 4HH0A 1TL4A 2K7KA 2ZDPA 2W4DA 1X8DA 2OD6A 3F44A 1YJUA 2L3MA 1YRXA 2GFFA 3E8OA 2HLUA 2QYCA 3KG0A 3KKFA 3BDEA 4OIXA 1YJRA 1KQKA 2KT2A 1FEEA 1TUVA 3HHLB 3LGNA 1VQYA 5A6WA 1SQEA 2GA7A 4OJ1A 1FE0A 1FVSA 2VV5A 1U7LA 3GZ7A 4A46A 5B09A 5F0UA 1XBWA 1ULRA 2ROEA 1FVQA 3HHLD 2XMVA 4A4JA 2OKQA 4Q2LA 2K1RB 1MWZA 2BBEA 2N7YA 2ROGA 3HDSA 3T9NA 1TR0A 1FE4A 2K2PA 4OJGA 3I9ZA 4DPOA 1RJJA 1APSA 3KNGA 2XMMA 4OJHA 1GXTA 1S6OA 2IYIA 2OP5A 2AJ0A 2BJDA 2W4PA 2XMTA 3WDOA 2GGPB 1CPZA 1N5QA 3CJKB 2LXFA 3DCAA 2N4DA 3KG1A 2BYCA 4HL9A 3VTIA 1YG0A 3HX9A 1AW0A 5B0EA 2XMWA 2OFHX 2KKHA 1SI9A 1AFJA 1KVJA 2RMLA 4Y2KA 2RILA 3QGPA 2XMJA 2KT3A 4EFAC 5KAKA 2HLTA 5T7LA 1WD6A 2ACYA 4A47A 3MCSA 2IYGA 2RSQA 5B0GA 1GXUA 2GV1A 1YJTA 1Y3KA 4F67A 1P6TA 1TL5A 4YDXA 4ZA1A 2KYZA 2FIUA 4Y2IA 1SB6A 2FB0A 4FNIA 2CRLA 1S6UA 1Y3JA 1N5SA 2ROPA 3HFKA 1OQ3A 2GO8A 4HH1A 2Q3PA 2XMKA 1JK9B 1TZ0A 4DL0C 2HQIA 2VH7A 4U9RA 5F0WA 1QUPA 2EW9A 5B0BA 1X0PA 2IFXA 1OSDA 2HFNA 2AW0A 3BM7A 3K7RA 1K0VA 3DXSX 3BR8A 3HHLA 3MZIA 2RU9A 1CC7A 4NPOA 1X7VA 2JDJA 1OQ6A 3IWLA 2FTRA 4HI1A 5A6PA 5B08A 2BJEA 1Q8BA 1Q53A 1JWWA 1KVIA 2W4CA 5B0FA 1Q4RA 3IWXA 3UDCA 2G9OA 3HHLC 3TOQA 1N5VA 2HFOA 1W2IA 5K9FA 1R6YA 2FHMA 2AJ1A 1FESA 5B0CA 3TNVA 2BUNA 1MWYA 4ZOSA 4QOTA 1Y0HA 2XMUA 3LO3A 3CJKA 2AP6A 1AFIA 2LQ9A 1YJVA 2LQBA 2GCFA 1Y9OA 2PD1A 1P8GA 2QLWA 4Y2MA 5IXUA 2QLXA 4Q2MA 3QMQA 2OD4A 3BB5A 2PGCA 2OFGX 2ZDOA 1OPZA 1Q8LA 4A48A 3TRGA 5B0AA
chains in the Genus database with same CATH superfamily
1UP1A 3OXFA 4IG3A 4J9OA 3MCOA 3MPDA 3UW1A 2UXBF 2QT7A 5HVFA 2EG2A 3ILIA 4UUXA 4IR1A 2HGMA 2F3JA 1QLNA 5CYMA 2CG8A 2DGXA 2I6WA 1WOSA 2NPIA 3EVWA 2KRBA 4YB1P 5KFIA 2Z30B 2EK1A 1ZM3A 2YNFA 2VIHA 1FE4A 4NASA 1AB8A 3WBZA 5J2PA 4YP3A 4DF4A 2ZH4A 4CWBA 4DPTA 1YVFA 1XWLA 3GG0A 1J2VA 1WD6A 4MIWA 4QYZK 5BXIA 2ADCA 4KY3A 3HVTB 2ZBRA 3FEZA 2COLA 2XMKA 1NH7A 1J5OA 3CCTA 3DXSX 2W4CA 3GFYA 3GJRB 1WF2A 4DR6J 1RHUB 3V4IB 2AJ1A 2V5HG 4TKTA 3OQ2A 4LQ3A 4UOCA 4ZHRA 3FCVA 1S6PA 3ITHA 5C25A 3KWMA 4X4TA 4RPFA 3MAAA 2C3MA 3IAM9 2UUAF 1DJ0A 4IFYA 4CNYA 2VKRA 2NLWA 1TL7A 4DFMA 2CG4A 5KFJA 2OEMA 2JFDA 2K7JA 5D4OA 4URSA 1RT7B 3BGRA 4N76A 2NZ4A 1RABB 4LRCA 1U47A 3R8YA 1SJQA 2NPFA 1NSPA 4KIAA 3KYLA 2VG7A 4RNFA 5LMUF 2KM8C 1B4SA 3P49B 2J76E 3POTB 4GKKJ 4XPCA 4JI4J 3HVWA 3PACA 1QUVA 2GZOA 2IA0A 4DPWA 4ZLNA 1WHXA 1SC4B 1KQFB 4NXMF 4WZMA 3VQSA 2ZH7A 4F25A 1R8HA 4PCQA 5L9NA 1LWFB 2B0GA 4DCJB 1CJTB 3W62A 2DGVA 1C4AA 1RADB 3M8SA 2G1HA 4DL4A 1RTJB 3MTKA 2PA3A 1OJ4A 4NLVA 5D78A 2DIVA 1P9QC 3HHKA 3TVKA 2H5EA 4ES2A 4M63A 2D1CA 3TW0A 2HBZB 2ERRA 4ED1A 2YKMB 2CNLB 4X64J 2ZJQQ 1KR4A 1B7FA 4LUBA 2P5VA 1KQKA 4F4ZA 3D7SB 2KO1A 2VPZB 5KFVA 2SXLA 1RACB 3CJKB 4S0MA 5IWAJ 5I3UB 5ETSA 1M1HA 5CABA 4LBPA 3BREA 1NMEB 4ZP8A 2F65A 2LEAA 2CADA 1VQ9S 2DNOA 1ITPA 2FJEB 4Z37A 1GH8A 1RT7A 3KUGA 1Q81T 3SBMA 1X9MA 1RLDA 3I9V9 4F36A 5D15A 3IMQJ 2MZ1A 1FXDA 3BR9A 1D09B 3QWUA 1YZ7A 2FVCA 1SUQB 2BRKA 3QZ7A 4RW6B 2XTJP 4I64A 2MQOA 2DNZA 4DDFA 1MN7A 3MURP 4A8MP 1T02A 1DQ9A 4MT1A 3LPYA 4RUAA 3M9NB 2ZZMA 2MYFA 1XN9A 1UPPA 3NNCA 1N6QB 2ZH1A 1C0TB 1LWFA 8RUCA 1CJTA 2A6MA 2W4DA 3OHAA 1YJUA 1BE4A 1WEYA 2KFYA 2VOPA 1E6YA 3NOCA 1UEUA 1RTJA 3MD1A 1TUVA 5I3QA 2G0CA 2Z4PA 4GVLA 2FJDB 4DPOA 1RWMB 2XCAA 3G6XA 4F02A 3PTWA 1RU2A 1YJ9S 1AW0A 1BQNB 4DWIA 4KQZA 4Y6IA 4ED4A 1RT6B 3T6JA 2OTLS 4PWDB 5J2MB 4DSLA 2YKMA 2U1AA 9RUBA 4WKYA 2GAGC 4ECZA 3PX6A 1GX6A 4EEYA 4K50A 3KK3B 5G0RB 3T1HF 1MMLA 4HI1A 3FC9A 2B5JB 1S12A 4HVZA 5HQLA 1OSCA 3CJKA 5I3UA 3K2YA 1EAYC 1Q5VA 2AV5A 2HHPA 2E1RA 1VQKS 1U6BA 5GAHU 4PUOA 4DR1F 1CEZA 3HF5A 4CO4A 4JI0F 4A8OA 2BOPA 4H4KC 3V2UC 3OFFA 4TU7A 4WYLA 1TTHB 4I2PA 3PRDA 3SSQA 1VLYA 4OZ1A 4K4TA 4AL5A 2R7SA 1OO0B 2EFQA 2Z58B 5JVGQ 3P6YC 4HTJA 1SUQA 2YQ1A 4RW6A 3NBPB 3GYGA 1RI7A 2XLJA 4MFBA 2DNPA 3VVTA 3KHLA 4ECXA 2ZEJA 4L3KA 3ZZPA 2XG8A 2QA4G 2H51B 1REGX 2DRDA 4NCAA 5F3TA 3UPFA 3AA8A 2KYZA 1C0TA 4F3MA 3NL0A 2CPXA 2QTWA 4HHHA 1TP7A 2EC0A 1KTQA 5A6PA 3T9ZA 2G13A 4JI5F 1VBYA 1NKBA 3N6NA 3KLHA 2RIJA 2JEGA 2DH9A 2BUNA 3M2RB 1NK7A 4E8UA 5L9XA 3KDNA 4KAIA 2FJBB 1BQNA 4RBVA 1PAEX 2XGQA 4X4UA 2GVDB 3CB4A 1RT6A 4LF9F 4PWDA 5J2MA 3AQOA 1SJRA 3W2WB 4C0HA 2BE9B 2ATCB 2DH7A 3OHBA 1V3ZA 3H2VE 1PBUA 3D1HA 3KK3A 3QJLA 3CJSA 4LRBA 4CLLA 5A8WB 4LF8F 5LM7E 4ZVOB 1T8EA 4DJBA 2CJAA 3D6TB 4IO1A 2F9DA 5KOXA 3GPAA 1S4FA 3Q83A 4RW4B 3H5YA 1NK8A 1OPIA 1JLBB 5H9FK 2Z56B 4Q44A 2RU9A 5B08A 1RWXB 2ZH9A 2CQDA 4NLPA 2HYIB 4DR6F 4WTYA 3NBPA 3TANA 3BH7B 4I68A 4Q7AA 2JLGA 2GNKA 3LO3A 4DFPA 3H42A 2FZCB 2R2UA 1NJYA 1FHTA 5GAGU 1S97A 3CIMA 3ZTQA 2DR9A 3OFGA 4IOAQ 5GADU 4DN9A 1NUEA 2IC3A 2MY8A 4MTPA 1DZ5A 4DV7J 3KHHA 2ZDPA 2WOMB 3I56S 1D9FA 2DGOA 3M2RA 2L9NA 3UVJB 5IQQA 2KB2A 4OJGA 3J7YI 4K2JA 2UXCJ 2W4PA 4IH5A 4GKKF 3A1YG 2WVBA 4P2XA 4DV0J 4K4SA 5J2QB 2ZZTA 2MDAA 2NUUG 1N56A 4O3SA 1Q16B 2LQJA 2B7CB 5KFAA 3W2WA 3EPIA 1IQTA 1U0HB 5L1JA 3D28A 2FIUA 2J6SA 1B99A 3MM8B 3W8PA 1LEOA 3RAQA 2XYGB 4HR2A 3Q2SC 2QFIA 1K0VA 5A8WA 5K8OA 2JDJA 2B3TB 5C24B 4PQUB 4QU7A 2B56A 4FBTA 3TUPA 3MOJB 4IG0B 4OMFG 4NRTA 1SQGA 3LP0B 4IDKB 4FYYB 1PJ7A 4RW4A 3PO4A 5FIIA 2KVQE 4YHHF 3TJAA 4ELTA 1JLBA 4OHWA 1CJUB 2CQPA 1HNXJ 3M6VA 2XWYA 3L3CA 2Q6CA 4DV6J 3OTBA 5D0GA 3D3CJ 4DQQA 4C8LA 4ZPVR 3K5PA 2NS1B 5KFEA 4B9UA 5DQGA 4HL9A 2PE8A 1Y00A 3HVAA 3UDLA 3CSKA 4C8MA 5E3CA 2OPPB 1LNQA 2RDJA 5FLXU 3JTNA 2MKKA 4KO0B 2D9OA 3EUNA 2WOMA 4CYUB 5DDRC 4IQXA 2M70A 1RWUA 2V9WA 2ZOGA 2FD2A 1F9HA 4P72A 1KSPA 3ZZ0A 1LOUA 4EBDA 4DS5A 5CQGA 1S6QA 4FF4A 1UJ5A 3UVJA 4FVMA 3B4MA 3UCGA 3ZTPA 1YRUA 1U6FA 3MMAB 1UETA 2DCLA 1Q0NA 5J2QA 2XEXA 4RBUA 5K20B 3H2UB 3GJTB 1YSJA 5C7PA 1U0HA 5HMWA 3MM8A 2B7BB 3MEDB 2B4UA 1HWIA 3H8YA 5D3GB 5ETMA 3CJ5A 3I0SB 2QFJA 4A8SA 3NP5A 4OZ5A 4QIFA 4PQUA 2XMVA 2ZVSA 3BGFA 1B0VA 3GIIA 4IG0A 4X62J 4WE1B 3ADAC 1HWJA 3EE3A 3PW5A 4IDKA 5HJXA 1VBXA 2Z57B 4URQU 3VCDA 4DV2J 4ZVFA 4TYBA 5ETPA 1CJUA 1TKDA 4I2QB 3HM9A 3CCES 2Z8QA 1NNDA 2A0FB 3DDNA 3MZIA 2JVRA 2H65B 2ZWOA 1FJCA 2M52A 4OLPA 5A0YB 5MLCV 4I6YA 4F3OA 2W01A 2ZH5A 3CD6S 2HURA 1T9YA 1NAQA 1FERA 4RUBA 2XZDB 2MQ8A 3OSPA 1HHTP 3Q0AA 4CRJA 5J1NA 1YGYA 5K14A 2OPPA 4KBIA 5FLXY 2FZKB 4CYUA 3IS9B 4CLYA 3UWTA 2EXUA 2V67A 1UKUA 2XSJA 3JXOA 4MK8A 3AB2B 3D54A 2ROEA 2C3OA 2KZMA 2IAJA 1W2BR 3N0VA 4DPUA 3MMAA 4WCEQ 5C42A 2WZ1A 3LWMA 2BX6A 1AFJA 1ZAXA 3OUYB 3MCSA 2H9ZA 1TL5A 3MEDA 4DL6A 4OYBA 5D3GA 3C6UA 3I0SA 4USMA 2UVWA 2XS7A 3W9HA 3KHRA 1SV5B 3W63A 1VISA 2BJEA 1YDLA 3TUIC 4E98A 3KJFB 4ZOSA 1PJ6A 1QTNB 4WE1A 4JOUA 2GHWA 1MROB 1N48A 2EBEA 1QJHA 3VGTA 3MUVP 1RKIA 4PG4A 1OY8A 4KGZB 1RP5A 1U2CA 2C2RA 4P2MA 3M8RA 1B3TA 1U1PA 3JQKA 1SJ3P 1YJ7A 2C2ZB 1JJ4A 2F40A 3Q8UA 1FRLA 2OD6A 1UVKA 2G0JA 2C42A 3C15A 2BKPA 2C2EA 1K0TA 5K8NA 5A2QY 2LP4A 5A0YA 1MLAA 3CMES 3RUBL 4C98A 1QM9A 2BJ7A 2MMYA 3S1TA 3V4MA 3F41A 5CCMA 6AT1B 1T9TA 2PC6A 5IV3A 9ATCB 1I6JA 1RWVB 1NDKA 1F6TA 2DNQA 3IS9A 4TN2A 1H2TZ 4KPCA 3WIVA 2WSCC 4LFAJ 1FEHA 3HT3A 3QO9B 5E33A 2CQHA 3IWXA 5CYJA 3EZUA 1R6YA 3FZ2A 2JOQA 3ZZOA 4DU7A 4KGMA 3ILOA 3RW6A 3W65A 1Q7LB 3CMAS 1TV6B 1YIJS 3OUYA 1WKKA 5A8KA 1HYSA 2MLYA 3UDEA 3PDNA 4OV1A 2JLEA 4N47A 3PYFA 4F4XA 3ZZRA 2A18A 1TL3B 4WFYA 4EBCA 3BKFA 2HNYB 4DV7F 1SV5A 3KOAA 1CLFA 1S1XB 2KT2A 4EBEA 1L5UA 3TX8A 3FEXB 1MROA 3ZXWA 1WC3A 2AJ0A 3THVA 2UXCF 4AUKA 2ZD1A 2RMLA 3H98A 1ZOTA 4DV0F 4B08A 3NCPA 2VG5B 4DR5F 3PEJA 2OPQB 4ZP6A 5GAHI 3MAHA 4M94A 4O3QA 2HK2A 4J9MA 4XAKA 4OHVA 4DL0C 2VH7A 3Q8PB 3GB0A 4I0WA 2JNJA 3IBCB 2VU5A 2LA4A 4NMLA 1N5VA 1D3WA 4I69A 1VOMA 2HVIA 2VFUA 4KB7A 1RBAA 4FS1A 2YX1A 3O44A 2B9EA 1RTDB 1WELA 1O6XA 3BGUA 1JX4A 2VFTA 2M7SA 4F4WA 1SJFA 1FX2A 5HAOA 2DNHA 1FFSB 2AX0A 4FF1A 1S7IA 1HNXF 1NK0A 2KG1A 3PJ9A 1RHRB 2ZNYA 4LFBJ 1VFJA 4DV6F 5DGBA 1XIQA 3QBCA 2Q1LA 4C7QA 4Q0BB 4CLFA 1LWCB 2CPHA 5L46A 3SCIE 4DXLA 3NGDA 1SI9A 1TV6A 1IKVB 1YI2S 4KHRA 5KG7A 1FKPB 2JEIA 4RUHA 2D7SA 4JV1A 2WBMA 4NOHA 2HNYA 1IKWA 4Q43A 1S1XA 4LSNB 2HQ3A 2MSSA 3PY8A 1VRTB 3DN9A 2DB1A 3DLHA 2VG6A 5KT5A 4WFBQ 2MKIA 2C2OB 1KTVA 3FEYB 2KT5A 4F26A 3MGJA 3N5BA 2BDPA 3DDIA 2VPXB 3GV8B 4USVA 5BYQA 3KHGA 3CWJA 2DXFA 2JSXA 2OPQA 4NWBA 1O8BA 4QWBA 2KXHA 3D0IE 1U26A 1TMJA 3BV8A 2GFFA 5KFWA 3EVMA 2IY5B 3HZEA 3FBBA 3VV2B 3I32A 1NJXA 4X4OA 1X9SA 1RLCL 4C3KA 4EZ9A 1SBRA 4X62F 3M2VB 1UZHA 4P10A 3CJ8A 1KS2A 5GAEU 1Q79A 1RTDA 5KTQA 4KR0B 3Q8SB 2D3ZA 2XLIA 4R5PB 4RX6A 4FNIA 1V3RA 5CYQB 3L7UA 4DV2F 5GAGI 5GADI 3MOZA 3M8WA 4H4MB 2JJ4D 1XJWB 1KVIA 1R8BA 1QAXA 3WC0A 4DV4J 1W25A 4Q0BA 3EVOA 4ZLJA 1Y5NB 1LWCA 5LMNF 3VAFA 1FCAA 3MR6A 1IKVA 4JV2A 4NEZA 1FKPA 2D3O1 2AJFE 2BVZA 1GMUA 3T6BA 5KT2A 3KNAA 1N4LA 2KN4A 3VGUA 4QIGA 4TY8B 2RQ4A 3U7JA 4LSNA 4NZ7A 3K8WA 4KYZA 4DL7A 1QTMA 2B8QA 2OP5A 3MM9A 3VVUA 1VQ7S 2VDIA 2KKHA 3BBFA 4NE9C 2RILA 3HKWA 5HQMA 1WF1A 5JJBA 5MAOA 4M5DB 2A2CA 1VRQC 1N5SA 2CQ1A 3ENWA 1X5OA 2DPJA 4B9MA 4KRWA 2DHGA 4NPOA 3FCWA 2WVCA 3HSJA 4LRFA 4OX9J 3VR1A 5F9LA 5DZ6A 1HNVB 2QV6A 3PYEA 2AD9A 2CJBA 2KI2A 2V2QA 1UTAA 3ILLA 2QLXA 3AY0A 3M2VA 1JJHA 4UQTA 2F8HA 3GFXA 2AKWB 5K5MA 2ZC3A 3OFHA 4R5PA 4JV5J 2FJAB 5CYQA 1TVRB 2EC2A 3C16B 3HJFA 1SCJB 2PDAA 2YNIB 1X8DA 4H4MA 2FVSA 2QMXA 3ZZTA 3D2WA 4M95A 2ZWPA 3RBXA 2U2FA 1FVSA 4DR2F 3CCWA 4RL1A 1VQ5S 3KG4A 5LSLA 5ETNA 6FD1A 4LREA 4USJC 3IA0A 3BKTA 3EGVA 1X4EA 2I5JB 5DDPC 4AYBD 2FLLA 4CO1A 4ZVUB 2CPDA 1EP4B 4B3OA 4TY8A 5AXNA 3N6LA 5U47A 2BZ2A 1XQIA 1F9FA 2DR8A 3G8SA 2L9DA 3BM7A 4HACB 4LSLA 3C14B 4LFAF 2AMCB 4QU6A 4ED2A 2YWFA 2LXIA 2MQQA 3DRPB 4M5GA 1JJ2R 4Y2MA 4J9KA 2B6AB 4YMEA 1DARA 3OTEA 3LOUA 2FGOA 3FBCA 3W61A 3MD3A 2DXEA 4JUZA 5EDWA 1TQLA 2CZVC 4PYAA 1QDUB 3QIDA 3R7BB 4M5DA 4RO0A 4B9TA 2LQ5A 3QAUA 2E9RX 4U8VA 3HI9A 2HNZB 2JX2A 1C0UB 1IWAA 4O3NA 2I9SA 1S0VA 3RBZA 2M88A 2PT0A 4JI6J 1FE0A 4KSEB 1HNVA 1FKAF 2LEBA 3RAMA 3PHTA 1FF2A 4N7TA 4X4QA 5BYSA 1MU2A 3CDWA 2MQLA 2NSBA 3VTIA 2QMUB 3LP2B 1WI6A 1HW9A 2H5IB 2OFHX 3J81j 3L4BC 1CQMA 2B4OA 4I67A 2KT3A 2R8JA 2NXJA 3O5TB 4ATNA 2QLBB 2EG1A 1YTYA 1VQOS 3F73A 1LXNA 1TVRA 1K1SA 3C16A 5RUBA 5EGYA 3QT5A 1WEZA 1RT1B 1NEEA 4RU9A 1KVKA 4ED7A 4AXJA 1T3OA 2BV3A 3S7RA 1Q4RA 4LVOP 1FESA 2JH3A 3BSAA 2XNQA 4FYDA 2JWNA 3LANA 4B3TJ 2WHOA 3K5OA 2VBYA 4YOEA 2OJ3A 3ELHA 1D9AA 2KL8A 1EP4A 8AT1B 2NYIA 3VGVA 1REVA 2HPUA 4ZLPA 1RTIA 3P96A 2BJ3A 3N4WA 3C14A 1ZZNA 5D4PA 2VICA 4LR8A 5A6WA 2Y1LB 1FK9B 5THWA 1QD1A 2XNRA 3QAEA 3DRPA 4LFBF 2HRTA 4ERDA 2B6AA 3A13A 2MKYA 5LJ5Y 3DLBA 1HI8A 4C3MA 1RWKB 2RUGA 1XNRJ 1T9VA 2V2VA 1SH2A 1J5EJ 2HNZA 4K7QA 2UUBJ 1C0UA 5F8JA 2IFXA 3DDKA 1S79A 2CWXA 4LFCJ 1KLMB 2E5IA 2XQCA 5LOQA 4RWWA 2QGFB 4DBQA 1JNZB 3MFHA 1QE1B 4BWMA 4OYWA 1R0AA 4ECRA 2IM2A 5BR8J 3DRRB 4CT8A 4X4NA 3IAS9 5C5JA 3BPSP 4QYZJ 1T9XA 4X4PA 3KLGB 3THTA 1RT1A 4ZPBA 4DZ6A 3FKBA 4FXDA 4G65A 3R2CJ 1P9YA 2IMOA 2E5GA 4WK3A 3JTPA 4CO2A 2B9XA 5HP1B 2RDDA 5KFTA 2V8DA 2CIMA 3K58A 2QLJB 1RHKB 2VFSA 4ZVGA 2UUWA 3KNGA 4TNOA 2DR7A 2V8PA 2E7VA 4RKUC 4LF2A 1YZ6A 3HO1A 1HARA 2ZKTA 3GE9A 1HHSA 3FVYA 4HDHA 1A9NB 2XO7A 1NPRA 2HLTA 1HHQA 4OI4A 1MWQA 4EGLA 2AT1B 2I0XA 4B3SJ 2MLZA 2QL5B 3ZNJ1 4EI2A 2HHXA 5CD4A 4UOGA 4FXWA 2W9CB 1VQNS 3M8QB 4K4WA 3MPWA 1HR0J 1KONA 3TZWA 3M2UB 2WB1D 2HZVA 4QIWD 4TLRA 4OX8A 3OD2A 3KMQA 1VQSA 3LGMA 1WKLA 2E44A 3TA2A 4WP8A 1LQ9A 1LFPA 5KFMA 2FHKA 4AQYJ 2HQGA 1VC0A 2H48B 3RJMB 1UVNA 3NNAA 1SC3B 2QA2A 1KLMA 3BH6B 2B43A 4EWTA 5ETVA 2GMHA 3HSDA 3R6GB 3HDSA 2C2DA 2HVEA 1RJJA 2P6SA 2ZJPQ 2PI5A 3UD3P 3QYYA 1H74A 3R6LB 1H2VZ 2AGQA 1R0BG 3DRRA 3IGNA 2PEHA 4QR1A 3D3BJ 3OPKA 5CA5A 1SPBP 2CDQA 1U02A 2QSWA 3KLGA 1YLXA 2ZUAA 3GIMA 3QPIA 4X4RA 4ANEA 4WTOB 4ZVEA 2HS0A 2CPYA 1OSDA 1NK6A 4PQAA 2WONB 3MEEB 4C8NA 1H0HB 4OX9F 3ZTSA 1XTZA 4LF5J 1G2EA 4QWAA 2FJWA 1U8WA 4P73A 2WTFA 3K89A 3TQ1A 3E3XA 3DRYA 2WVDA 1RBLA 2J0WA 2M2BA 2LFVA 4M5KA 4CO5A 4ZVQB 2LLZA 5B0DA 1NXIA 3R27A 2HMIB 3PVXA 4M5HA 4JV5F 1HQUA 1NZ8A 1S9EB 2CQCA 3ETOA 5AE1A 1DBDA 2LKZA 2MQMA 1RWWB 2W9CA 3M8QA 5IFMA 2E1AA 4RZRA 3M2UA 5A8RB 3IRXB 3NNHA 3OR2A 1APSA 3N9UC 1WJ9A 2RRBA 3DXBA 2ZH6A 2YBVA 1N5QA 3P8BB 4R8UB 3ZZYA 4DEZA 5GMEA 5KFUA 4CLKA 1BUXA 2XC9A 3NOGA 2QN6B 3GV5B 2IYGA 4TQSA 3IN5A 4J9NA 4RNNA 2FB0A 2MKHA 4G1PA 4QW9A 3KK2B 4DQSA 1Q8IA 1XR7A 4RW9B 4DG1B 3RRHA 4WFAQ 4ZS6A 3GJQB 2WVEA 4A8XA 1FI4A 1ZM9A 3BR8A 2NR0A 2R7RA 3CNQP 3PIOQ 1XNQF 2AEFA 2HHVA 3V81A 1VIXA 4RWXA 3M30A 2Q66A 4BDPA 3ZZUA 5IZHA 3TEGA 2R7XA 2O67A 2HHHJ 3GFHA 2GGPA 1BLUA 5ITHA 2WONA 3MEEA 4ANDA 3M9MB 5KFOA 3A3OB 4JI6F 1FRHA 4NX9A 2DH8A 1D0EA 3NG8A 2DTJA 2HHSA 4O3OA 2HAFA 4I1TA 4NLXA 1RAEB 2M8DB 4FYWB 5FDLA 5LJ3Y 4V19J 3K5NA 4EU0A 5B0GA 4K4XA 2HMIA 4PR6A 4FBUA 3ENVA 3J80Y 1S9EA 2Q3PA 4NYZA 2HQIA 1ROFA 3EJMA 4Y0FA 1HI1A 5DO2A 5KG4A 3IFEA 1RHQB 5A8RA 3D66A 4P52A 2MQNA 3IRXA 2HQDA 1PJ5A 4ZCMA 3HCXA 4R8UA 3TVZA 2F9JA 3RB0A 5KFHA 3E01B 2XSFA 3J81U 4B3TF 3Q23A 1VK3A 5FJ4A 3KK2A 4DG1A 3IGVA 2RJZA 3I31A 4PWWA 3N5FA 3LPEA 1C2PA 2F4FA 3HXMA 3CJ3A 3QFHA 1ULRA 1VBZA 1DFDA 2HNDB 1S6OA 4K0KJ 1NB7A 3UE2A 4OYXA 3OXGA 1G3OA 1M5SA 5KOWA 1RDRA 2I38A 5DQHA 2E5HA 2GJ2A 2A3JA 1WG4A 1FDNA 1TUGB 3HHEA 4LF1A 2MB0B 1R31A 1XNRF 2D69A 2DNMA 1HWKA 2CNKB 3K7RA 4ECVA 3HKZD 3BDPA 4LFCF 3I5BA 3ZO7A 2D3UA 4GRSA 3RYLA 3M32A 5KFFA 1NPKA 1RA6A 2LQ8A 3FZBA 2Q43A 4WXOA 4OYPA 5LMUJ 4MKBA 5BR8F 2ZC4A 2DHAA 2V34A 2VODA 3PFEA 4TLQA 1VJWA 3MMBB 1IUJA 4YEAA 1E6VB 4NXMJ 2ALYB 5H9FJ 5DDQC 4BBYA 1FWLA 3S6EA 1SL1A 4QPTA 4O3PA 3H4DA 3H90A 5E0OA 1NSAA 2CQGA 1CBKA 1SH0A 2QE5A 3E01A 2WCXA 2RB7A 5LXRA 1NM2A 1AT1B 4ILMA 2BW7A 2G2ZA 1FRJA 2NXCA 4B3SF 3DHWC 4DX8H 3FRZA 5KG2A 1CVJA 3Q8VA 2BEFA 2HRYA 2PN6A 1U1OA 4USHA 1HR0F 2HNDA 4C8OA 3B78A 2RAQA 3EDQB 2JC1A 4DSEA 4U67Q 2NXEA 3W5XA 1K47A 4ALZA 4F7VA 2AYGA 4DSKA 2DR6A 2K3KA 1VI7A 3AB4B 3JB9k 2VB6A 1SQFA 5D0EA 1T94A 3NGUA 4AQYF 3AODA 4C0BA 3BJYA 3HT0A 3S8SA 3PEHA 2FGCA 1FRIA 2R42A 5KG3A 4C3LA 1JLFB 1G7CB 2VFRA 1VIOA 1OY9A 4RW8B 3V5RA 3SQGA 2CQ4A 4ER8A 4RW7B 1IM4A 4B9VA 1UJ6A 3WIUA 1TAUA 1RCOB 2AYEA 5DS7A 4DFKA 2CWKA 4J9QA 2GVZB 4U7CA 5HI7A 1DAXA 3MMBA 1JXVA 4ZP7A 3GG1A 3UNYA 1SB6A 1E6VA 1CS4B 3OL9A 5E7OB 3LA0A 2O5DA 4DL3A 3LUYA 1CSJA 1X7VA 2XYPB 2IJFA 4KH0B 2C22A 2V4JB 1GFWB 3A3NB 1N54B 4EYIB 4LF5F 2LMIA 5E41A 4LJMA 4QR0A 3EXCX 1ZZFA 1SKSA 2K06A 1S0MA 5E3QA 2DY1A 1EX8A 2V6AA 3QT8A 3G9CA 1JLCB 2BANB 1L3TA 3PR4A 3PJWA 3M8PB 3SSSA 2UU9F 1GK8A 1LXJA 1LW0B 4G1QB 2BXJA 3KG0A 3TZXA 1HNIB 4IG3B 3CJTA 5C2GA 1NLKL 2HQFA 5M2UA 2K2PA 2H4WB 1VQPS 2WRMA 1IJEB 2XMWA 1U48A 4LQ9A 3QGPA 3KLFA 3H4BA 4PRFA 2XI2A 3NS5A 5HROA 2YNFB 2Y3YA 2VHGA 3TR5A 3R97A 2EW9A 1HNWF 4G6VB 1OQ6A 3D4JA 3UR3C 3GWCA 2F8EX 5T41A 2E1MC 1JLFA 2BJ8A 5E3AA 1LW2A 4FN5A 3VHQA 4RW8A 2J9CA 1KHWA 3J7A1 4RW7A 5IV4A 2EFOA 2AQ4A 2GX8A 2I2YA 3EZ5A 5L1LA 2YNHA 1HIYA 2HBRB 2GQQA 3CF5Q 1F60B 2GVZA 3RGIA 2LDIA 1Q8KA 4YY3J 3CDAA 1Y4ZB 1CS4A 3BQ2A 2HHHF 5DLGA 2HIQA 3ITHB 1UVJA 5CHCB 4C8YA 2FLPA 2VBWA 2P9GA 2L41A 4ZVRB 2KG0A 1UFKA 1FXRA 1N0UA 1U2FA 4GC7A 4IFVB 4PWUA 1EQ0A 1H98A 2X3DA 4JI5J 2Y9HA 5DRKA 4O3RA 2PO4A 4ZMMA 2GC8A 2AU0A 1S9FA 4OI0A 4YDXA 2E9ZA 2VASA 4ILLA 1JLCA 3MHYA 3GIRA 2BANA 1NZAA 3M8PA 1TZ0A 2DHHA 3OL6A 4LF9J 1LW0A 4G1QA 1R6VA 4ZN3A 4IRCA 1HNIA 6FDRA 3PYGA 2OELA 4XTTA 4HYKA 2HHWA 1X4GA 3T41A 1UW4A 4NEYA 4OZLA 5DETA 4KV8B 1NK4A 1JLAB 4X84A 1V5IB 4ECUA 2XS5A 2IBKA 4LF8J 3KJVB 1I51B 3GCWP 4OYIA 2APOA 5KT6A 3TI0A 3DLEA 1X4DA 2K1RA 2XO6A 2VJUA 2QEXS 2K8GA 1RWOB 1U24A 3QLHB 3W5ZA 2J9EA 1LFWA 4KGVB 1B0TA 4IOCQ 5IOLA 2HKEA 2LCWA 1SJ4P 4C97A 3T9NA 4RU2A 3R2DJ 2C28A 1S76D 3H7HB 4GC6A 4U95A 4K0KF 4X4VA 4CLTA 4MIBA 5LSRA 2ZH8A 4WF9Q 4FP9A 2DRAA 4ZA1A 3NMAA 1XEZA 2IVFB 3GJSB 4WWSA 2NQPA 4P6QA 4OFZA 2RQMA 2DJWA 1AUDA 4X66J 4A8WA 2RRNA 4IO9Q 1P27B 2G9OA 3QRQA 1RAAB 4IFVA 1YJNS 2ILYA 3Q86A 1RQ0A 1TK8A 1U25A 3G86A 4KHMA 2UVVA 2CZ4A 1F3FA 2XM3A 1YBUA 3MPUB 1FNOA 1TK0A 3NS7B 3ET6A 4LRAA 1ZAWA 3PW0A 2GJFA 2QJ3A 1VQYA 3VZIA 4OJ1A 1S9GB 4DZDA 4KV8A 1JLAA 3O8WA 1WC5A 2ZE2B 3DM2B 1BWEA 2GJIA 1T03B 3KJVA 1S59A 1E6YB 4K59A 4KH1B 4CIOA 1Q86T 2KVIA 1UW9A 2E9TA 3BO4A 2IM3A 2PMHA 2YWKA 2XY5A 4OZNA 3SZ2A 2XHCA 2VQEF 1C1CB 1JLGB 1YK9A 3QLHA 4MK9A 4NZ0A 3BO3A 2BM1A 3QNWB 4ZVSB 2RKIA 4ZCLA 4LMZA 2WK4A 2R7UA 4YHHJ 2HRUA 2HFOA 1XMQJ 1OYDA 3JAMU 3PFOA 4OZ3A 1VBKA 3TNVA 2M4MA 1MWYA 2UVRA 3VAKA 1YITS 3BSNA 4CI0B 5KFSA 1PO6A 4PPDA 3UD5A 4WZQA 3ZZZA 2XLKA 2Y8WA 1PCAA 1L3KA 4J5OA 4USTA 3DRXA 4Y2CA 2DGTA 1KFSA 2KFNA 4TXSA 3R5GA 2HWTA 3H40A 4PUOB 4OV6A 2FJXA 4TU8A 1BHNA 2VFVA 1ZA1B 2QA1A 5LL6d 3WDOA 5IT9U 4PXEA 4I2PB 1KHVA 3TJ9A 1RB0A 3M8YA 2XB2D 3MI7X 2WW8A 1NSQA 1KNZA 1WC6A 2VDHA 5HJYA 2MJUA 2MKJA 4MFBB 1KFDA 5DQIA 3ISZA 5EWFA 2DO4A 1S9GA 3AJ2A 1HFEL 3CC4S 3RR8A 4ETZA 2W7OA 3M1VB 4QR2A 1U4BA 4XDDA 2ZE2A 4H4OB 3DM2A 5ETKA 2AEJA 1T03A 2CNNB 4Z7CA 2DVIA 3ZTRA 2AJ4A 1OIAA 2HG4A 2B9YA 4O4GB 1IBKJ 1G6BA 4USIA 3KLHB 1RE1B 4XO0A 1C1CA 1JLGA 4ECYA 2IDEA 1YRXA 4LF6J 2YKAA 1W26A 3NGTA 1K1QA 1ZTWA 3BO2A 3CUNA 2CPEA 4DN0A 1RGVA 4WFXA 3NS6A 3LGHA 4ILRA 2DIUA 1KDNA 2XZWA 4IRKA 3LALA 3DCAA 3HX9A 1UFWA 4OLOA 1TMMA 2EFGA 2CYYA 3NEKA 1XK8A 2HVZA 2J0XA 3K8VA 3H59A 3V6JA 3SXLA 3RR7A 4U7UD 4PZVA 1VHIA 2HFNA 2GIRA 1XC9A 4WIIA 1UEKA 4DFJA 1IBLJ 2ZJRQ 4I6WA 4C48A 1WG5A 1Y5IB 4I7FA 1ZTTA 3LWLA 4J9UE 4OHYA 1GMWA 3FFIB 1WKJA 1FJ7A 3D6MB 4J91A 3OJUA 5HANA 1KEKA 4P74A 4ITSA 2WW4A 4ECWA 3AOAA 3DGPB 3AD7C 3CMQA 4YY3F 1WC4A 2CQ2A 2RH3A 1D8ZA 1RAIB 2GA7A 3M1VA 2IRUA 2YWHA 3BQ0A 5DZ7A 2DHXA 2IC3B 4H4OA 1O0PA 1PYTA 2NSCA 5CZVA 1HW8A 2YPZA 3RBEA 2XMJA 4O4GA 1GTHA 2RNEA 3K0JA 2V2ZA 1Y3JA 4LVNP 5BYRA 4ZKAA 1VR6A 4QBUA 3K17A 3M4XA 4DR7J 1CC7A 1RAOA 2PI4A 4ETXA 1K44A 1PG5B 3NAHA 3OT9A 3W7BA 1M5PC 4NYOA 1DTTB 5DG7A 2J8AA 1SKRA 5L8RC 2DGQA 4LF7J 1T9UA 1N33J 2AZ3A 4W4MA 4QZVB 1U1RA 1NDCA 3UN3A 2VQFF 4NLQA 3X1LB 2QRRA 2P2CB 4OIXA 4JV0A 2KYXA 4K8RA 5K8PA 4NXNF 1FKOB 1HPZB 2GHPA 4ZPWR 3L09A 2D9PA 1UWAA 5KT7A 3KUHA 3FFIA 2LU2A 1FDAA 4JYAF 3HHNB 1DTQA 2Y1IA 3SFUA 2CPJA 5ADZA 1ZAVA 1ZPWX 3P45B 3DGPA 2VC1A 3PW7A 3NKYA 4KKOB 3UR0A 2NYHA 3MWBA 2FTRA 3HD2A 4X66F 4J9LA 5HO4A 1JKHA 4IRDA 4JI2J 4FF2A 2UP1A 1UEVA 1SL2A 2XULA 1T0TV 1S1TB 3NY0A 1FNMA 1S6QB 3T1YF 4HDGA 2H1YA 3BBCA 2W9AA 1Q82T 4AT1B 1SKWA 1EKSA 4DR5J 3RRGA 2KTQA 4M5JA 5I42B 2EWHA 5B09A 1DTTA 2XS2A 4L75A 3D5MA 2HFUA 4PAAA 2BKOA 1TK5A 1BQXA 1L3UA 5H9EJ 2W2MP 4HHUA 1H6KX 4JI1J 1D8YA 4A47A 3HSGA 2EBGA 1VQ4S 3Q8YA 3CCRS 2ROPA 4ECQA 1KN6A 3KLVA 1RHJB 2I8EA 1FKOA 2GHVC 3NCQA 2DNNA 2VBXA 1HPZA 4C9DA 5E3PA 5KG6A 1XMQF 1CG2A 1S99A 1BD6A 4Q2MA 3BBBA 3DOMB 4RJVA 2AYMA 4YB6A 2RS2A 2ILZA 4ECSA 3SV3A 3FGVA 3B8HA 2RQKA 4KKOA 1URRA 2JFKA 3T5JA 3DLJA 1IVZA 2ADBA 2QZ8A 2G2OA 5D4LA 4NLRA 2E1PA 4ZITA 2R7VA 3G2XA 3NWRA 5K14B 4A46A 2BE7D 4C11A 4DMZA 2IHR1 4ZVPB 1OS5A 3KG1A 1S1TA 4EUVA 2IMWP 2EKNA 3DRSB 4AL7A 5E5NA 4DX5A 4CZCA 2XSJB 4A8QA 4WYWA 1TUWA 2IAJB 4YR2A 3RW7A 3OXLA 4Z2XA 5C42B 1X5SA 3W9IA 4DU8A 1FFWB 2EK6A 2CJXB 2HFVA 2ZHBA 2AGPA 4IH6A 1M1KT 1LK5A 4ZCIA 1WUUA 5I42A 4ECTA 5K9FA 4I4BA 3VAGA 1FJEB 2ZITA 2IVMA 3L9ZA 2DGUA 3C6UB 1AXQA 3MM6B 2MEWA 5JMNA 3MR3A 2UUTA 4O44B 1IR0A 2EFPA 1IBKF 3OW2R 1TELA 5F3ZA 1WACA 1U0SA 4ZPTR 2E7WA 2Y1RI 5EUHA 2MY7A 3CD0A 4LF6F 3BSCA 2D74B 2MKSA 3V6DB 2XMMA 3L7PA 2PIIA 1HMVB 3C6TB 3DOMA 1HBMB 4LRDA 2BRLA 4USWA 3D0GE 1N8RT 3C15B 5IM0B 1KVJA 2NUHA 5KAKA 1M5HA 2EKYA 4J9SA 5L1IA 5LMNJ 1V5VA 4DPYA 2YH1A 2FDNA 1B7YB 2MLXA 1H7WA 4L76A 2XGPA 4B3MJ 4B02A 1HI0P 2BR0A 2EPIA 1CJVA 4RNHA 1VQ8S 3MR2A 3AXKA 1BMQB 1IBLF 4FPRA 1YBTA 2V4QA 2PGCA 3DRSA 4ID8A 3J7YU 4C8KA 2J8SA 3AQPA 1U45A 1EJ7L 4DLEA 1YQHA 2CQ0A 4ZJOA 3SEOA 1SJ1A 2F4VJ 2K7KA 1HBNB 3FQKA 1GMVA 3F44A 4Z7YA 3BPDA 3TZZA 4JI3J 1GXLA 3QWPA 5A8KB 4OZJA 3GZ7A 1HYSB 4CH7A 2Z2LA 2L9WA 3PYDA 3GILA 4DR4J 1WDTA 3FK4A 2KDOA 1F1BB 2WSEC 3MM6A 4MMOA 3UCUP 4UY8T 4O44A 2CDRB 4HEA9 1T3NA 3UDVA 5GMKa 2R9LA 2BQRA 4K4ZA 1JK9B 2YX7A 4EK2A 2Y0BB 4YFUA 1Y5LB 1QVGR 2ZD1B 3TAPA 3IWLA 3OLAA 4DR7F 2BJ9A 1FJGJ 5CCLA 4AFFA 1KQSR 1UFLA 1NH8A 3FBFA 1WI8A 1X60A 3MM7B 3P5BP 3DU5A 3PW2A 1M1GA 2N3OA 3V6DA 1WC0A 1HMVA 3C6TA 2XMUA 2QMWA 3BYRA 1HBMA 3KLIB 4EO6A 5IM0A 4DR2J 4WKRA 3Q8QB 1RAFB 1GT8A 2P8IA 2MKCA 4LF7F 1N33F 5F8MA 4F2SA 5M2PA 3C8YA 3SCLE 3MUMP 4UY85 3R5BA 5DG9A 2QX0A 3FJ2A 2YQ3A 4ICLB 2YX4A 4DUYJ 4F4AA 1WSVA 3HPOA 3B6BA 2OSQA 4X65J 3A8KA 4CP5A 2J0QD 5HVHA 2UUCJ 2WB4A 4IQMA 1GMWD 3O3LA 1ZYQA 3IO1A 3EGNA 1UPMB 2FYXA 1HBNA 2Q6BA 1S1UB 4UQGA 1URNA 5DM6Q 1S57A 2G2YA 3P5TL 1PGZA 4GO5X 4C8ZA 3I5AA 4YR0A 2VA2A 4QOTA 4JI2F 4NCBA 1IKWB 4IUFA 1VQLS 5HBMA 4NL5A 2HVHA 1OYEA 2VG6B 4QWDA 2FVRA 2DK2A 2VBZA 1NCLA 4EMDA 1TL4A 4LBIA 3IP0A 4QIVA 1NK5A 5F8LA 2HZAA 5E2QA 3MM7A 1H3DA 2QYGA 1U7LA 4DOZA 3JYTB 2N7YA 3D6FB 1NKEA 2C3YA 3WX8A 3D1OA 3J7ZT 3KLIA 4FKXA 3R1LA 2VKZG 5B0EA 4YUDA 4DQRA 2DISA 1IR1A 2RSQA 2GV1A 2BE2B 4JI1F 4U8YA 4CTAB 2M9KA 1ZPVA 4JB8B 5HMZA 4FZVA 4F2RA 3NRBA 1Q53A 4V19X 3CTRA 4ICLA 4P71A 3DKDA 2GIFA 2LQBA 1SVDA 4ZVTB 1FRKA 4NA2A 3PJXA 3MPVA 2RE1A 3M05A 3J7Z5 4DQIA 1WHYA 2YTCA 3CD7A 1S1UA 3AOBA 3Q8RB 2J7KA 2VL1A 2X51A 1NHVA 1FEEA 1KOOA 1KQGB 1XBWA 3R5CA 3HVTA 2DNLA 3I55S 5KG1A 4OZ2A 3E2EA 4CT9A 4Y65A 2EFVA 3JQJA 3V4IA 3BGOP 4HT5A 3ONQA 2IRXA 3OTDA 1IWGA 3PRVA 3Q22A 4RLEA 1NJWA 3HJVA 2FHOB 3MM9B 3D6HB 3IM8A 3ZC4A 2V8HA 3R9LA 4ES1A 2AX1A 3MXHP 2MZTA 4NLDA 1HL6A 1B0PA 4IYQA 5FD1A 3JYTA 4UZBA 1VQ6S 4YDDB 2E7XA 1RAHB 3L7OA 1P8GA 3G8QA 1XMOJ 1V3SA 2R2RA 4FNHA 2BE2A 3U27A 2KJWA 4CTAA 3POTA 1TKTB 3GYNA 1JLEB 3GONA 4RNMA 2MTLA 3KKFA 1A6LA 1RUSA 1UCNA 4YB7A 3GSDA 2BOAA 2YKQA 1UVMA 4YR3A 2DD8S 4WU3A 4K4UA 5DGAA 1PAUB 4FKYA 1SIZA 4Q8EA 5C2CA 1EQMA 3TA0A 2IJRA 3DOLB 2AF6A 2OEJA 3LF0A 3AJ1A 4TU9A 4NYPA 2CRLA 2R7QA 3IRWP 1YBAA 3VZHA 1WHWA 5E3RA 3WQPA 3D0HE 3QT6A 1S72S 4K5SA 1JWWA 1NHUA 3DFEA 3CPWR 4B3MF 2IIHA 5HSPA 1HNZJ 4C2MA 4B3OB 4F04B 2YKNB 4TQRA 5AJ3J 4B9NA 3UQSA 4LSLB 1PIEA 2YVSA 1F5AA 1I3OB 2CUYA 3SI8A 2CJYB 4KGKA 3I0RB 3UD4P 1SL0A 3FDSA 4PXBA 5D6GA 1ZH5A 2V2KA 1BQMB 2F4VF 2HIYA 2DCUB 3SIPB 2LVWA 2L48A 2XI3A 3HHLB 2MHEA 3QRPA 4L72B 2G4BA 4UW2A 2VV5A 7FD1A 4JI3F 4X2BA 1VQMS 4WBFA 4D3HA 3FSYA 3GQCA 3OV7A 4QWEA 3OTOJ 3TYTA 4DR4F 4XPEA 3HZGA 3R7NB 1JIHA 3ZFVA 5CZXA 2KH9A 2ZNZA 1Q78A 5KT3A 2V69A 1TKTA 2UZAA 2R7TA 3NGRA 1JLEA 1MU2B 2GO8A 2ZBQA 2XBPA 3CC2S 2YPYA 5B0BA 3MUTP 4GO7X 4ANCA 3C66A 3H0PA 2YWEA 4CLWA 3Q2TC 1SC6A 1FJGF 3CCSS 1N6QA 1DY3A 1HA1A 3EMTA 3ENQA 2AZ1A 2V50A 2RHSB 5IT4A 1S5ZA 4NLGA 4I6AA 3QZ8A 3DOLA 3DMJB 5KG5A 4USUA 1N32J 3EGWB 4U6PA 2F7VA 2DYAA 3MECB 1UAWA 4E2FB 2ACMA 4JI8J 2OO4A 3UI3A 1KLNA 1MSWD 2ZBIA 2X1BA 4EO8A 2P9CA 1ZM4A 4B9SA 1MWZA 1Q7YT 4QW8A 1REVB 2YKNA 4L74A 4N77A 2XWXA 1RTIB 4DI6A 5JVHQ 4DUYF 3TQEA 1NKCA 1XNQJ 1FDBA 4A8YA 1VC5A 5G0RA 3F0NA 4D3GA 2B5JA 3QGIA 1CJKB 4X65F 3I0RA 2UUCF 4KJIA 4NCGB 3EM1A 3IBWA 1SKUB 4F4YA 1MW7A 1BQMA 3IM9A 2M0GB 4ID5B 3HHLA 1RISA 1JMTA 3EX7B 3T5HA 1HLWA 4MIAA 4WK1A 1X4AA 5HQ8A 1PBAA 1MN9A 5B0CA 2FZGB 3GLJA 2XY6A 3CD5A 2FC9A 1AFIA 1PYOB 2GCFA 1X0FA 3H2LA 5ETRA 3ZNUA 1X5TA 3BYPA 2HBYB 3RRKA 5H1SV 2BQ3A 2CPFA 3AD8C 3PR5B 4DR3J 3P4UB 1FRMA 4A8FA 4DUTA 4DV5J 1R0AB 1NHKL 2HLUA 4R0EA 3CDBA 1J27A 3H5XA 3RB6A 3PCOB 5F0UA 3F56A 3CCUS 2ZBPA 3S01A 2IYIA 3N28A 3AJDA 4NRUA 2UXDJ 3GIJA 1ACMB 1AUSL 3DMJA 5GMDA 2OMLA 3GCXP 1FTRA 5KFQA 2GO9A 5KFZA 1RXOB 5DM7Q 1H72C 3MECA 2B4VA 1KRPA 3KMSA 2OH2A 3H5UA 4JI4F 2LXUA 2GVDA 3MM5B 5JXSA 4BWJA 2DY9A 2DNRA 2MZRA 4WIQA 3NGSA 5CH7B 1W7WA 2RT3A 2MSTA 3NXZA 3IXQA 1CJKA 1NDLA 3KFWX 2HGLA 1DQ8A 3C2PA 3US5A 1I94J 2PEBA 3RU0A 4NCGA 2B8PA 2OAUA 2RDIA 4ID5A 3OVSA 1N52B 5HK4A 1SQEA 4U96A 2BW2A 3G87A 1X4FA 4DSJA 3TVYA 1RAGB 4FYVB 1D1UA 2LYVA 1RT2B 4CM0A 4X64F 3HFZB 5AXLA 3B4DA 5F41A 2JL9A 5CD4H 4M8LA 2ASJA 3DC2A 1JLQB 3ULHA 2C1EB 2QLFB 4XIUA 4ED3A 3IG1B 2DHSA 2DEJA 5IWAF 3SYZA 2OIHA 3MPYA 4UTGA 1BY9A 3VF0B 2FHMA 3V6KA 4PG6A 2KRRA 5T14A 2PD1A 2IJNA 3CULA 4DX7A 5LT5A 1U49A 1VC6A 4HTIA 4ED5A 1XMOF 5T7LB 1BC6A 5AE3A 1X5PA 3EYZA 5HATA 3FMBA 4QIEA 2L3MA 1SC1B 3SDEB 3U1LA 2C3PA 2KU7A 3MM5A 3W1YC 1B70B 2DKOB 2LEPA 1RAJA 1FVQA 2BBEA 1GXTA 1HQUB 2XMTA 3CDEA 1S0OA 3TARA 2HWIA 1EHWA 2E1CA 4WU2A 4ZJQA 2H3EB 5C24A 4I56A 3G6ES 1WF0A 2DNKA 1NDPA 3LQVA 3OR2B 2F8MA 2OEKA 3NGKA 2X1GA 2DR5A 3E51A 1X0PA 3LP0A 3JSBA 2YWWA 2IPOB 4RNOA 4WPAA 1GAOA 3AAWB 3CGIA 3IC1A 1HNZF 1PC5A 2F5GA 1RT2A 2YKOA 5AJ3F 1F2HA 3MF5A 4OI2A 1OPZA 2N4CA 2LA6A 4OI3A 5A2QU 2X1FA 3V81B 4NLUA 1JLQA 2OMOA 4HKQA 4QPXA 4F50A 1N34J 3M30B 1D9DA 3ZTOA 1G1XA 3IG1A 2IVYA 4LIWA 3L95X 1FWPA 3LGNA 3CJ0A 3NMRA 3J7AN 2VC0A 3GFZA 4KO0A 3DOKB 4AE5A 3QFWA 4F4KA 2GGPB 2E66A 2DRBA 4Y34A 5F8GA 1HWUA 4TYAA 3OTOF 3CT9A 1F0XA 4KFBB 5T7LA 5EX3A 5EWEA 4AD6A 2ZH2A 1M90T 3SDEA 3VAJA 4E0DA 3LAKA 1FNXH 4QJVA 3ETMA 3TX0A 3UN5A 5FDLB 1Q5YA 1T95A 3UDCA 2IA6A 1U1QA 4L73A 2C2MB 1NU4A 2UU9J 2QLWA 3Q89A 2VZ9A 1C1BB 2KFZA 3CEDA 4CCHA 4NA3A 1PILA 2C3UA 4BC7A 1F3VA 3KXDA 1IM6A 3ICLA 2XYHB 1N32F 2B51A 5IQ6A 2JHEA 3CCZA 4JI8F 1CQNA 4KC5A 2HZCA 2BJ1A 3BQ1A 1Q95G 2LU1A 2AJ2A 1HNWJ 3MCMA 1RYSA 4I2QA 4N41A 1TFYA 2VPYB 4JP8A 1YX2A 2X3GA 2RVJA 5EWGA 1KD1T 4F0MA 1WSRA 1M5OC 1WORA 4DV3J 3QJJA 1RWPB 3BEGB 3IR5B 1NSKL 3QJPA 1R89A 5KFDA 2E5LJ 1IBMJ 2MXYA 1VCTA 1QY7A 3M8ZA 5D0RA 2FC8A 2MPUA 2QG9B 1IR2A 1S48A 2PSZA 2V0NA 4CDIA 2QC3A 3DLKB 3DOKA 5GAEI 4DUZJ 2PA8D 4YB5A 5DDOC 1HBOB 2E29A 3MR5A 3NAIA 3IR7B 2YKPA 1UL3A 4U7UK 3HK2A 1QAYA 4KFBA 4MKAA 5EX0A 3DYAB 4LIRA 1FX4A 4R0JA 1I1GA 4OJ3A 1Z1ZA 3TP2A 1MNEA 3M32B 4DR3F 3DLGB 4K4VA 1WC1A 4NMXA 2HGNA 2IBOA 1ZBTA 2QYCA 4DV5F 1YKWA 1HD0A 2HK3A 3I9ZA 3DGVA 3C46A 3NWGA 1C1BA 4OX6A 2LXFA 1M5VC 2MZSA 2R7OA 3SCJE 3PO5A 2UXDF 1O5JA 4Y28C 1U6ZA 4ENOA 1EB0A 4BS2A 5IC4B 5KFCA 3ILJA 1RZMA 5I4MA 3TUZC 2XMAA 1V6HA 2GMJA 2YH0A 3K59A 1WNEA 3AFGA 2MZJA 3M6UA 2MGZB 3CDUA 1Y7PA 1A0OB 2D3OR 1U09A 1WOPA 3I82A 1H2UX 3LP1B 4QYRA 1WWHA 2VOOA 3M9OB 1TKZB 4ZCKA 3N79A 2Z2MA 2CPIA 1I94F 4YS2A 2CVIA 3CO0P 1N5YB 1N5TA 3G6YA 1ZS6A 3OTCA 2O66A 5G4DA 3X3UA 4DX6A 3UO0A 3DNCA 2GQ2A 3GV7B 1MMDA 2W24A 5KT4A 3M6XA 3DLKA 2I1RA 3HHLD 1RT3B 3BN4A 3QIPB 4Q2LA 3EXYA 1HBOA 3TZYA 3BS9A 2UVUA 3QO9A 8ATCB 3CCJS 2ZM6J 3DYAA 3QT7A 1GTEA 4EFAC 3MMJA 3KUEA 5AT1B 2P6TA 4F3QA 1U1MA 3DLGA 3MMCB 4GVBB 4NZ6A 4PG5A 2KHDA 4OYOA 4OL8A 3SQGB 1QUPA 2W2OP 2YNGB 4DSFA 5GVQA 1Z2LA 3RZAA 1RT5B 3WX4A 2AYBA 4R25A 3OL7A 3JQMA 2C2NA 3TAMB 5CXTA 2DXDA 5B7WA 2LQ9A 4DHVA 1IKXB 1TL3A 1FO1A 2CZ9A 3BSOA 2BACA 3G8TA 1VGYA 1WG1A 1VLOA 3W9JA 3PKYA 1CC8A 3VWSA 2BABA 1RK8A 3SQOP 3TEHB 2RQCA 2FLOA 1S1WB 3J81Y 3D9BA 4TVAB 2MGZA 3CCMS 3WC2A 1X31C 1NB2A 1NRKA 4Q8FA 3FBEA 2HWHA 1F5BA 4HT7A 2Y0SD 1EZZB 4CLUA 2VQEJ 2VG5A 1Y11A 2R4FA 4A4JA 5KFBA 2FJVA 1IKYB 4OYMA 2XHWA 1HD1A 3LP1A 4OJHA 2DT9A 5F8NA 3R1HA 3MR7A 1TKZA 4LT6A 1TAQA 3CIZA 3OFEA 4OZ0A 3KJNB 5F9NA 2R3VA 2XZTB 5LXYA 5KG0A 1N5YA 2CAJA 1OMSA 3GU0A 2HEKA 1S6UA 2ABYA 4J90A 2A1BA 4J7CA 2ASLA 4KGXB 2A2DA 4IR9A 2H4YB 3CXCR 3JS9A 2GW8A 3RBDA 1FFGB 2OI2A 3OBIA 3KLFB 4QWCA 1V9OA 5KFKA 1R27B 3QIPA 1RT3A 1M0SA 5HROB 3M6WA 5F8IA 2HBQB 4UF4A 2M8HA 1N88A 2HS4A 2AP6A 2OPRB 2YY3A 1BWVA 3VQTA 2FHJA 1BXNA 2WVFA 4HI2A 4MK7A 2JLFA 3MMCA 4GVBA 1LW2B 4P7TA 1MG7A 4P2FA 4XDCA 4CLSA 1NO8A 2YNGA 1N34F 4P7VA 1RT5A 3SFGA 1FRXA 2YNHB 5HN0A 5HMYA 2VD3A 1RA7A 4MJKA 3TAMA 4ZVHA 1P1LA 4F0HA 4C0OC 3FUYA 4UZCA 1IKXA 4OI6A 1X4BA 3OR1B 5KFYA 1U1NA 4CH0S 1RTHB 1VRTA 1YJTA 2N82B 2DITA 1NJZA 2V63A 1S10A 1FXLA 1S1WA 3AD9C 3AA9A 2BKNA 1Z4UA 4O0NA 4P75A 5ETQA 4GKJJ 2KJVA 3HHLC 4WP3A 1IKYA 2AWZA 2GS8A 4NLOA 1Y0HA 5K8MA 5IXUA 4LSZB 4WJBA 4N8OA 2R8HA 3UN2A 1S77D 1R8CA 3BKUA 3CW2C 5D8HB 1WEXA 4B17A 4USKA 1UJ4A 4HHJA 3A8EA 2F63A 3P3DA 2DO0A 3DLEB 2A6OA 2K1RB 2ZHAA 2OPRA 2BJDA 3CE8A 3KJQB 4ZN1A 1EETB 2PMWA 3O2IA 1MMNA 4F8RA 1KBRA 2L08A 4DV3F 4ZK7M 5J2NB 2NREA 3ISND 5IS2A 1VDHA 2AW0A 1RBOB 2FVPA 2V9KA 2E5LF 1LK7A 1IBMF 4LF4J 5B0FA 2HAIA 3RB3A 4XK8C 1UA0A 3PKMA 2NCKL 4MYTA 1Y9OA 4PABA 2OSRA 2OUGA 3OR1A 4DUZF 1VHFA 3FSIA 1ELOA 1EARA 1RTHA 2V8VA 1YWXA 2QIFA 3PV8A 3N01A 1H38A 1JB0C 3W66A 1WHVA 4NI2B 1K8AT 5H9EK 4LR9A 3R5JB 3CJ4A 2HFSA 1PKUA 2AJQA 1IQZA 4N56A 4JI7J 3KDOA 1QSLA 1N36J 5D4NA 1CPZA 3ET6B 5EHHA 3A8IA 3QGHA 3SCKE 3CCLS 1X9WA 2KHCA 3MDFA 3QATA 2ACYA 3KK1B 2LDYA 3EDRB 2H5JB 3DLLQ 3W60A 2UV8A 2RS8A 1P1TA 3GTYX 4ZPAA 2AEMA 2VQFJ 3K5MA 3GIKA 2FQQB 4F0KA 4KHPJ 2R8GA 1UZDA 1R8PA 3LTOA 1S49A 2YNIA 2RUSA 2OGUA 2FUG9 4NXNJ 3JSYA 1EETA 4A8KA 2ZUGA 2RKIB 3HHDA 1U1LA 3W64A 5J2NA 2ASYA 5KFLA 3PXGa 4HH0A 4JYAJ 4ZIWA 1TKXB 4Y3CA 2IM1A 2HS3A 2I5JA 2PFFB 2BQUA 1C4CA 4ZJLA 4FYXB 2G0IA 1WOOA 4HACA 2QA4S 1T9WA 1NPPA 3A8JA 4ZLLA 1YRTA 3T5LA 3BZQA 3UNGC 2ZM6F 2RRAA 1Y3KA 5I3PA 1TU0B 1UMJA 4Y2IA 5F8HA 1BGXT 4C6AA 4NI2A 2DGWA 3QSIA 3CVKA 5F0WA 1KWMA 3CCQS 3CJQA 4WFZA 4EYHB 2PMZD 1FWKA 2EI5A 1Q8BA 5KFGA 3T1YJ 2KM8B 1GEHA 3LAMA 4PEOA 5DG8A 2Y1JA 1S7HA 3G82B 1QAJA 3CCVS 3BB5A 5AE2A 1FT8A 1F9EB 1O51A 1HQ2A 2EEYA 4P9SA 4QQBA 1ZA2B 4FVCA 5L1KA 2YWGA 4KE5A 3KK1A 3GMGA 2OTJS 3ISNC 3FRYA 1FD8A 3FMWA 2C2KB 2O01C 2N7CA 2IRYA 3LP2A 1NK9A 3U02A 1NJIT 1AROP 1HQEB 1YJRA 4BLGA 5DJBA 3EWGA 2V94A 4DS4A 3WZ0A 1N0VC 3OL8A 3CO9A 1UA1A 2ZFHA 3KTQA 3K5LA 3K57A 2AHOB 2NXNA 4OYAA 1XMBA 2W2NP 5KFNA 2HQCA 3BGLA 3LH2S 3SMZA 5HMXA 3FNNA 3O6QA 2JRSA 3U1MA 1TKXA 1KKHA 3JTOA 1OWXA 3MAQA 4M5IA 4OHXA 1EKRA 3PW4A 4K2XA 3GR0A 1YJVA 2ALZA 3QMQA 4IKAA 4DCPB 2OFGX 4DLGA 1Q8LA 1SIWB 1HWLA 1FK9A 5M2RA 4NLTA 3THPA 4LR7A 4ZP9A 4PXCA 3CC7S 1L3VA 4ED8A 1UVLA 4I7FB 2E5JA 2DPIA 4DV4F 3QRRA 1NBEB 3E8OA 4BHQA 4DV1J 1T05B 2QSFA 4ELVA 3HMJG 5KFRA 3ENAA 3G82A 2WAQD 2W8KA 2CJ9A 2XCPA 3TUJC 3MTJA 4ZIVA 3FQLA 3TAQA 3U1NA 4O0IA 2W9BB 4CH1A 1QE1A 3HSZA 4DSIA 3T19A 3C19A 1OQ3A 3PX0A 1R0CB 4J37A 3VAMA 2RF2B 1HQEA 4ELUA 2O1PA 4C4WA 2X7IA 2W2PP 1H7XA 3G96A 4GKJF 4NLSA 2CQIA 2UV8G 4M1KA 1WTBA 1DRZA 1H73A 2ZVIA 3AH6A 1IBCB 2ZH3A 2FY8A 1IN0A 3V6HA 3CJRA 2JEFA 5HP1A 3MCNA 4HLBA 3JAMY 3WHIA 4BCAA 4J9RA 3QSYB 2F1FA 4RUCA 3H25A 2JVOA 1QSYA 5HVGA 1TL1B 2P9EA 1F2GA 1YHQS 3A12A 3PIPQ 2Y8YA 2AGOA 3RTVA 2K3IA 3N6MA 2ASDA 4M5LA 3JSMB 3NCRA 3J80U 5J1EB 1Y10A 3SSRA 3W5YA 4X4SA 1X4HA 2ZOMA 4FF3A 2YQ0A 5L39A 3VGSA 3GSIA 1P6TA 1JXLA 2FHJD 2OLWA 3VALA 1RKJA 5IT9Y 3MEGB 2J9DE 3DI6B 4BC9A 1T05A 1HKAA 3RB4A 2NZCA 3LW5C 2HHQA 4O23A 3Q24A 1DTQB 2Z2YB 3R5DA 3PRBA 4NLWA 1U1KA 4LF4F 2R8IA 2ZKUA 2GMLA 4EZ6A 3MEKA 4CO0A 3AHPA 4NLYA 4ZPCA 2QL7B 1JJCB 2V4RA 3TRGA 2HVDA 3HFVA 2W9BA 3GR1A 4CLZA 3MFIA 4KPYA 1JKHB 4DCOB 3BF4A 3PHEA 1M5KC 1XR5A 3IBFB 4PXDA 4DQPA 2RF2A 4GMKA 1VMBA 4K4YA 1LWEB 3FSXA 3T3FA 4YQWA 1RT4B 3VAIA 3QGGA 2QL9B 1XR6A 2DNYA 1U8SA 4JI7F 5IT0A 4OX7A 3AT1B 1N36F 1YG0A 1DLOB 3IR6B 2G1DA 2Z0GA 4Y2KA 2FY1A 3AOCA 1HBUB 4ZDNA 1QSSA 3W8GA 5SUHA 2RU3A 2CNOB 3HFKA 1X4CA 2RD5C 1TL1A 3T1AA 2DGSA 2W7PA 1LWXA 4V1Ak 4L6V3 1YJWS 1B64A 1FDDA 4TY9A 4B3RJ 1K73T 5BJRA 1ICEB 4UOFA 2HW3A 3JSMA 2FLNA 3H5SA 5ETOA 4KHPF 2IDLA 1L3SA 5J1EA 3PZPA 1DHMA 4URGA 1GNKA 2RHQB 5J1PA 2UXBJ 4J9VA 2MZQA 5B0AA 2HHUA 1VRUB 4H4KA 2GQCA 2WBRA 3MEGA 2POKA 2ZOFA 2JC0A 3DI6A 2J6UA 1VJQA 4YN3B 1RSCA 2M5YA 3GYXB 1R8AA 3D68A 2J0SD 1Q1KA 4Q5VA 2VUGA 4PG8A 2OKQA 3B82A 3IWNC 4H54A 2GAHC 5A76A 3NLCA 4RW9A 3AXMA 3EICA 2N4DA 2BYCA 3I6PA 3T5KA 2A10A 5HLFB 2J9DA 4UT4A 1S1VB 5LSOA 1IJFB 4FDFA 4C11B 1U2RA 2B9WA 1RTZA 1SH3A 4U9RA 2J7UA 1LWEA 4OI1A 1RT4A 2CKWA 3CJ2A 4PG7A 3O1LA 4MKVA 2OHDA 3OVAA 4KTQA 3HULA 1DLOA 4J9PA 2UUAJ 1J5EF 2UUBF 1HBUA 2HFZA 2YXLA 1ZM2A 2FPHX 1AA1B 3I96A 1RU1A 2W8LA 1FD2A 3R3TA 4FS2A 1VYAA 3VAHA 3SV4A 2DBBA 7AT1B 3G4SS 4OHZA 2WSFC 5AXKA 2M3DA 3PNIA 4LBHA 5SZTA 1KP6A 1R43A 1RHMB 3EPGA 4DF8A 3UCZP 1JXEA 5D77A 1VRUA 2J7WA 3HD1A 1IXKA 4F67A 3EGZA 2AIRB 2CFXA 3OVBA 4HH1A 3H20A 2BA9A 1UWBB 3RAXA 3TOQA 4ED0A 1W2IA 1T7PA 3OLBA 4K5RA 2EVZA 1TFWA 5HLFA 2VA3A 3TWZA 1GX5A 3B54A 1S1VA 4AL6A 2O3DA 4NA1A 4MAKA 4ED6A 4RR5A 2QO3A 1CJVB 2EFNA 2LECA 2W2QP 2R2SA 3A4TA 3DHXA 4P2SA 1QVFR 1AZSB 4CLPA 4O4RA 1G4CA 1LKZA 1RWNB 5IC6B 4DV1F 1VK8A 2JZ5A 1VS3A 2ROGA 2PFDA 3RG6A 2R2TA 4M5NA 3KLEB 3G71S 2ZBCA 3TJ8A 4CM2A 3QQCD 2R8KA 5ETLA 4JBCA 4UUWA 4WP9A 3HLUA 2FVQA 3M7VA 4DPXA 2OPSB 2J6TA 3PX4A 1T11A 5JUMA 1PC4A 2NXUA 1DQAA 4Q45A 3JSRA 3W3SA 2CQBA 1FTCA 1CULB 5DLFA 1K9MT 1ZETA 2MHNA 1PYSB 3BN7A 1Z2ZA 3EZOA 3D1QA 1EIYB 3I4PA 2CJKA 2HSEB 4QCLA 5L38A 5HL7Q 1JQGA 5EN1A 4G1IA 3HP6A 2JEJA 1R3NA 4ES3A 3A3PB 4L3NA 2CPZA 5D0HA 2XY7A 1F5CA 2DNGA 2Z2ZA 4IOBA 1UWBA 4RBTA 5AXMA 3TO8A 3FCHA 4Y00A 4N5SA 1WTFA 4ZPDA 7FDRA 1PSDA 2CXEA 2CQ3A 3R5AA 1XERA 3W2VB 4CNZA 2X1AA 1KC8T 3PM9A 3TA1A 4W92B 2Q79A 4UOHA 2VJVA 1SXLA 1A7GE 1GXUA 1LV5A 1UVIA 4FPIA 2V68A 4PKDB 3OSNA 4W90B 4CQ1A 3T1HJ 3I4HX 2W25A 1AZSA 2VPWB 5CYMB 3GP9A 4DL2A 2KXNB 2KXFA 3I5CA 3OJSA 3KLEA 5J2PB 2OD4A 4FXVA 4PYDA 4DR1J 1RYRA 2HHTA 2ZZNA 2V8GA 1DURA 4JI0J 1RCXB 1S4EA 2MQPA 1OY6A 4WXWA 2OPSA 1GQEA 2BMBA 2MJNA 2D41A 2GIQA 2VF3A 2KZZA 1J5OB 2R7WA 1WDDA 3BDEA 2BM0A 5ETTA 5KFXA 2VONA 5HBMB 4CO3A 1I5OB 2CA9A 2H54B 2IM0A 2ZHOA 3R7SB 1QAIA 1TR0A 5CAAA 1CULA 4ZHRB 1AYEA 5KFPA 1S6PB 5C25B 3I87A 3MAAB 2V4JA 4IFYB 2W7AA 4B9LA 2W1BA 4KT0C 4AXIA 3D67A 1TL7B 2DEIA 2CJQA 3BGRB 4MH8A 4MYUA 3HVRA 2CVEA 2B4PA 4MKYA 2ATLA 4M5MA 1JNRB 2N3LA 2VG7B 3C3LA 3PG9A 3G6VA 4PPZA 2J5AA 4B3RF 4N8NA 4OYZA 4DL5A 1R7IA 4WFNQ 4OQJA 3UFCX 1KOHA 4G3IA 3DU6A 1S0NA 3W2VA 4Y2AA 1FA0A 4W98A 4IH7A 2ZDOA 4A48A
chains in the Genus database with same CATH topology
3DYAB 2CZVC 1UP1A 4LIRA 3OXFA 4IG3A 4J9OA 1U1RA 4R0JA 3QIDA 3UW1A 2UXBF 2QT7A 4M5DA 2EG2A 1I1GA 4OJ3A 2VQFF 1Z1ZA 4B9TA 3TP2A 1MNEA 4UUXA 2LQ5A 3M32B 4DR3F 3QAUA 4NLQA 3X1LB 4IR1A 2E9RX 2HGMA 2F3JA 3DLGB 3HI9A 4K4VA 2HNZB 1QLNA 2JX2A 2QRRA 5CYMA 2HGNA 1C0UB 2IBOA 1ZBTA 4O3NA 2QYCA 2DGXA 2I9SA 4DV5F 1S0VA 2NPIA 4OIXA 2M88A 2PT0A 4JV0A 2KRBA 2KYXA 4YB1P 5K8PA 4NXNF 1FE0A 1FKOB 5KFIA 4KSEB 2EK1A 1HNVA 1ZM3A 2YNFA 1HD0A 2LEBA 1FKAF 3RAMA 1HPZB 2GHPA 1FF2A 1FE4A 4X4QA 3I9ZA 3WBZA 5J2PA 3C46A 5BYSA 1MU2A 4YP3A 3NWGA 4DF4A 4ZPWR 1C1BA 3CDWA 2MQLA 2NSBA 4OX6A 2LXFA 3L09A 2D9PA 2ZH4A 3VTIA 5KT7A 1M5VC 3FFIA 2LU2A 1YVFA 1FDAA 3LP2B 2MZSA 1WI6A 1HW9A 2OFHX 2R7OA 1CQMA 3SCJE 2B4OA 4I67A 3PO5A 2UXDF 4JYAF 1XWLA 1O5JA 2KT3A 3GG0A 4Y28C 1U6ZA 1DTQA 3HHNB 2Y1IA 1J2VA 1WD6A 4MIWA 3SFUA 2R8JA 2ADCA 2CPJA 3O5TB 4ATNA 5ADZA 2EG1A 4BS2A 1YTYA 1ZAVA 1ZPWX 1VQOS 3HVTB 5KFCA 1LXNA 1TVRA 2VC1A 3DGPA 1K1SA 3F73A 3FEZA 3PW7A 5I4MA 3TUZC 3NKYA 4KKOB 5EGYA 1V6HA 2COLA 2XMKA 1NH7A 1WEZA 1RT1B 2GMJA 1J5OA 1NEEA 3CCTA 2YH0A 3K59A 1WNEA 4RU9A 3DXSX 3UR0A 4ED7A 4AXJA 3MWBA 2MZJA 2FTRA 3M6UA 2MGZB 4X66F 3CDUA 2W4CA 1T3OA 2BV3A 3GFYA 3S7RA 4J9LA 1WF2A 1Q4RA 1Y7PA 5HO4A 4LVOP 2D3OR 3V4IB 1JKHA 1U09A 2AJ1A 2V5HG 1FESA 4IRDA 2JH3A 3I82A 1H2UX 4FF2A 3BSAA 4TKTA 3OQ2A 4LQ3A 4UOCA 4ZHRA 2XNQA 3LP1B 4QYRA 1S6PA 3ITHA 4FYDA 5C25A 2UP1A 2JWNA 1UEVA 1SL2A 3LANA 3KWMA 2XULA 1WWHA 2WHOA 2VOOA 4X4TA 3M9OB 1S1TB 1TKZB 3K5OA 2C3MA 3IAM9 2UUAF 2VBYA 1DJ0A 4IFYA 4YOEA 4ZCKA 2OJ3A 3N79A 4CNYA 1D9AA 2VKRA 2NLWA 2Z2MA 1EP4A 1FNMA 1S6QB 2CPIA 4DFMA 2CG4A 5KFJA 3T1YF 1I94F 2JFDA 2CVIA 2NYIA 2K7JA 1REVA 5D4OA 2HPUA 4HDGA 1N5TA 4URSA 1N5YB 1RT7B 3BGRA 3G6YA 4ZLPA 4N76A 2NZ4A 1RTIA 3P96A 2W9AA 3OTCA 1Q82T 2O66A 5G4DA 1U47A 1SKWA 3N4WA 1SJQA 3X3UA 3DNCA 2GQ2A 1ZZNA 2NPFA 5D4PA 3GV7B 4KIAA 5A6WA 1MMDA 2W24A 3KYLA 1FK9B 5THWA 5KT4A 3RRGA 2VG7A 4RNFA 2KTQA 5I42B 3M6XA 5LMUF 2EWHA 2XNRA 3DLKA 1DTTA 2I1RA 3QAEA 5B09A 2XS2A 3HHLD 1RT3B 3BN4A 3DRPA 3QIPB 2KM8C 2J76E 4Q2LA 3P49B 4LFBF 3POTB 3EXYA 4XPCA 3D5MA 1HBOA 4ERDA 2B6AA 3HVWA 3PACA 1TK5A 1QUVA 5LJ5Y 2IA0A 1BQXA 1L3UA 3BS9A 2UVUA 3QO9A 3DLBA 5H9EJ 1HI8A 3CCJS 1H6KX 1WHXA 3DYAA 1GTEA 4C3MA 4EFAC 1KQFB 4NXMF 3MMJA 1D8YA 4A47A 4WZMA 2P6TA 3VQSA 2EBGA 4F3QA 2ZH7A 2RUGA 1VQ4S 1U1MA 4F25A 1R8HA 4PCQA 3CCRS 3DLGA 1SH2A 2ROPA 3MMCB 4NZ6A 4PG5A 2HNZA 2KHDA 4ECQA 4OL8A 1KN6A 5L9NA 1LWFB 3KLVA 2B0GA 3SQGB 1C0UA 1QUPA 5F8JA 2IFXA 2YNGB 3DDKA 2DGVA 1C4AA 4DSFA 5GVQA 3M8SA 2I8EA 1Z2LA 1S79A 3RZAA 1RT5B 3WX4A 4DL4A 1RTJB 2AYBA 1FKOA 1KLMB 4R25A 3OL7A 3MTKA 2GHVC 2PA3A 3NCQA 2E5IA 2DNNA 2VBXA 4RWWA 1HPZA 4C9DA 5E3PA 3TAMB 4DBQA 5CXTA 1JNZB 5KG6A 3MFHA 1QE1B 4BWMA 1XMQF 1CG2A 1S99A 5B7WA 4NLVA 2LQ9A 4DHVA 1R0AA 1IKXB 1TL3A 4ECRA 1FO1A 5D78A 1BD6A 4Q2MA 2IM2A 2DIVA 1P9QC 3HHKA 2AYMA 3BSOA 3TVKA 4YB6A 2H5EA 2BACA 3G8TA 2RS2A 1VGYA 3DRRB 1WG1A 2ILZA 4ECSA 4CT8A 3SV3A 4ES2A 4M63A 2D1CA 3FGVA 3B8HA 3PKYA 3TW0A 4X4NA 1CC8A 3IAS9 2RQKA 2ERRA 5C5JA 4ED1A 3VWSA 4QYZJ 2YKMB 2BABA 1RK8A 4X4PA 4KKOA 3KLGB 1URRA 3THTA 2RQCA 2ZJQQ 2JFKA 2FLOA 1RT1A 4ZPBA 3T5JA 3DLJA 2ADBA 2QZ8A 1S1WB 4FXDA 3J81Y 1KR4A 1B7FA 2MGZA 2IMOA 4LUBA 2E5GA 5D4LA 4NLRA 2P5VA 3CCMS 1KQKA 4WK3A 1NRKA 3JTPA 4Q8FA 4CO2A 4F4ZA 2B9XA 2HWHA 5HP1B 2R7VA 2KO1A 1F5BA 5KFTA 2V8DA 4HT7A 2Y0SD 5K14B 2VPZB 2CIMA 4A46A 2VG5A 3K58A 2R4FA 5KFVA 4A4JA 5KFBA 2SXLA 4C11A 2FJVA 1IKYB 2VFSA 4ZVGA 4DMZA 2IHR1 2XHWA 1HD1A 3LP1A 2UUWA 3KNGA 4OJHA 4TNOA 2DT9A 2DR7A 5F8NA 3R1HA 3CJKB 1OS5A 3KG1A 5I3UB 4RKUC 1S1TA 1TKZA 1HARA 4LT6A 3HO1A 1TAQA 4EUVA 3CIZA 3OFEA 2IMWP 3BREA 3DRSB 2ZKTA 4AL7A 5E5NA 4ZP8A 3GE9A 5EDWA 1HHSA 3FVYA 4HDHA 1A9NB 4OZ0A 4CZCA 5F9NA 2XO7A 2HLTA 2XSJB 4OI4A 2LEAA 4EGLA 5LXYA 2I0XA 4A8QA 4WYWA 1VQ9S 2DNOA 5KG0A 2FJEB 2IAJB 1N5YA 4Z37A 1GH8A 4YR2A 1RT7A 3RW7A 1S6UA 2ABYA 2A1BA 2HHXA 3OXLA 2ASLA 1Q81T 2A2DA 4Z2XA 5C42B 1X5SA 1X9MA 4IR9A 3I9V9 3CXCR 2GW8A 3RBDA 2EK6A 2ZHBA 2AGPA 4IH6A 1M1KT 4FXWA 1LK5A 2W9CB 1VQNS 3M8QB 3OBIA 4K4WA 4ZCIA 3KLFB 2MZ1A 5I42A 1FXDA 4QWCA 3BR9A 1V9OA 4ECTA 3MPWA 5KFKA 1R27B 3QIPA 1RT3A 1M0SA 1KONA 5K9FA 5HROB 4I4BA 3M6WA 3QWUA 3M2UB 5F8IA 3VAGA 1FJEB 2FVCA 2WB1D 2IVMA 2ZITA 1SUQB 2BRKA 2M8HA 3QZ7A 1N88A 2HS4A 2AP6A 4RW6B 2OPRB 2YY3A 2DGUA 3C6UB 1AXQA 4QIWD 4TLRA 4I64A 4OX8A 2MQOA 2DNZA 2FHJA 3MM6B 3VQTA 4DDFA 3MURP 3MR3A 4A8MP 1T02A 3KMQA 1DQ9A 2UUTA 1VQSA 3LGMA 4HI2A 4O44B 3LPYA 4MK7A 4RUAA 3M9NB 2ZZMA 2E44A 2JLFA 2MYFA 1XN9A 3TA2A 1IR0A 2EFPA 3NNCA 1N6QB 3MMCA 2ZH1A 1IBKF 1LW2B 1C0TB 4P7TA 1LQ9A 1LFPA 1LWFA 5KFMA 2FHKA 3OW2R 4XDCA 1NO8A 5F3ZA 1WACA 2W4DA 2YNGA 3OHAA 1YJUA 1WEYA 4ZPTR 2E7WA 1N34F 2Y1RI 4P7VA 5EUHA 2KFYA 1E6YA 1VC0A 1UVNA 1RT5A 3NNAA 2VOPA 1UEUA 3SFGA 1FRXA 1RTJA 2YNHB 2QA2A 2MY7A 1TUVA 3CD0A 1KLMA 3MD1A 5HN0A 4LF6F 5HMYA 2VD3A 1RA7A 4MJKA 2B43A 5I3QA 2G0CA 3TAMA 3BSCA 4EWTA 2Z4PA 4ZVHA 2D74B 2GMHA 2MKSA 1P1LA 3HDSA 2C2DA 2FJDB 4DPOA 3G6XA 4C0OC 2XCAA 1RJJA 3V6DB 2P6SA 2XMMA 2ZJPQ 1IKXA 3L7PA 2PIIA 1HMVB 3UD3P 4OI6A 3C6TB 4F02A 1X4BA 3DOMA 3QYYA 1HBMB 2BRLA 1YJ9S 3D0GE 1N8RT 1AW0A 3OR1B 1H2VZ 5KFYA 2AGQA 5IM0B 1BQNB 1KVJA 3DRRA 3IGNA 2PEHA 2NUHA 5KAKA 4DWIA 4KQZA 1M5HA 2EKYA 4QR1A 4Y6IA 4J9SA 1U1NA 3OPKA 1RT6B 4CH0S 1RTHB 1VRTA 3T6JA 2OTLS 4PWDB 5J2MB 4DSLA 1YJTA 5L1IA 5CA5A 2YKMA 2N82B 2CDQA 2U1AA 2QSWA 2DITA 3KLGA 1NJZA 4WKYA 3GIMA 3QPIA 4X4RA 2YH1A 1S10A 2FDNA 1FXLA 4ECZA 3PX6A 1S1WA 1H7WA 1GX6A 4ZVEA 2HS0A 3AA9A 4EEYA 2CPYA 1OSDA 4K50A 3KK3B 1Z4UA 5G0RB 3T1HF 2XGPA 1NK6A 4PQAA 1MMLA 2WONB 3MEEB 4HI1A 1VQPS 4B02A 2B5JB 1HI0P 2KJVA 2BR0A 3HHLC 4C8NA 2EPIA 1H0HB 4RNHA 4OX9F 1IKYA 1XTZA 4HVZA 2AWZA 3MR2A 4NLOA 1VQ8S 1G2EA 4QWAA 1IBLF 4FPRA 1Y0HA 2FJWA 1OSCA 5K8MA 3CJKA 2V4QA 5I3UA 5IXUA 3K2YA 4WJBA 2WTFA 3TQ1A 4N8OA 3E3XA 2AV5A 2PGCA 3DRSA 3DRYA 2HHPA 2E1RA 2R8HA 1VQKS 1U6BA 4ID8A 5GAHU 3J7YU 4PUOA 4C8KA 1S77D 2J0WA 2M2BA 4DR1F 3AQPA 1R8CA 4CO5A 1U45A 1CEZA 2LLZA 5B0DA 3HF5A 4CO4A 3R27A 1WEXA 2HMIB 4DLEA 5D8HB 1YQHA 4JI0F 4A8OA 4B17A 3PVXA 2BOPA 4H4KC 2CQ0A 4JV5F 3V2UC 1HQUA 3SEOA 1SJ1A 3OFFA 4TU7A 4WYLA 1S9EB 2CQCA 2K7KA 1HBNB 3ETOA 3FQKA 4I2PA 3PRDA 3SSQA 1UJ4A 3F44A 4HHJA 5AE1A 1DBDA 2LKZA 2MQMA 1VLYA 4OZ1A 2W9CA 4K4TA 3A8EA 3M8QA 1GXLA 4AL5A 5IFMA 2R7SA 3QWPA 1OO0B 2EFQA 3P3DA 2E1AA 5A8KB 4RZRA 2DO0A 4OZJA 3GZ7A 3DLEB 3M2UA 5JVGQ 1HYSB 3P6YC 5A8RB 4CH7A 3IRXB 1SUQA 2K1RB 4HTJA 3NNHA 3OR2A 2Z2LA 2ZHAA 1APSA 2L9WA 3N9UC 4RW6A 3NBPB 3GILA 2OPRA 2RRBA 1RI7A 3DXBA 2BJDA 2KDOA 3CE8A 2ZH6A 1N5QA 4R8UB 3ZZYA 2XLJA 4DEZA 5KFUA 4MFBA 2DNPA 2WSEC 3KHLA 4ECXA 3MM6A 4MMOA 3UCUP 4UY8T 1EETB 2XC9A 3ZZPA 2XG8A 2QA4G 4O44A 3O2IA 4NCAA 5F3TA 3GV5B 1MMNA 4HEA9 4F8RA 2IYGA 2L08A 4TQSA 1T3NA 3IN5A 3UPFA 4DV3F 4J9NA 4ZK7M 5J2NB 3AA8A 4RNNA 5GMKa 2NREA 2KYZA 1C0TA 4F3MA 2FB0A 2MKHA 4G1PA 4QW9A 3KK2B 3ISND 2R9LA 4DQSA 2BQRA 3NL0A 1Q8IA 5IS2A 1XR7A 4RW9B 2CPXA 4DG1B 1JK9B 2YX7A 3RRHA 4K4ZA 4YFUA 4WFAQ 1TP7A 4ZS6A 2EC0A 4A8XA 2AW0A 1Y5LB 1QVGR 2ZD1B 1ZM9A 1KTQA 3BR8A 2NR0A 2R7RA 3TAPA 5A6PA 3IWLA 3T9ZA 2FVPA 2G13A 2V9KA 3PIOQ 3OLAA