3EVWA

Crystal structure of the mimivirus ndk r107g mutant complexed with dtdp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
b'AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 42
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3evwA00
1ZS6A 2BEFA 1NSKL 3NGRA 2DYAA 1HIYA 1W7WA 2AZ3A 4F4AA 3ENAA 4DI6A 2AZ1A 1S59A 3Q86A 4EK2A 1NLKL 4S0MA 3EVMA 1NB2A 1NPKA 4UOFA 3EMTA 5CABA 1LEOA 1JXVA 3ZTQA 3Q83A 1VYAA 3FBEA 4C6AA 1S5ZA 3Q8YA 3FCVA 1MN9A 3FBBA 3ZTSA 3EM1A 4ENOA 2DXEA 4DUTA 1WKLA 3FBCA 3Q89A 1BUXA 2DXDA 3VGSA 3R9LA 1NDLA 3Q8UA 1KDNA 1UCNA 3FC9A 1WKJA 3ZTPA 3VGVA 4FKXA 2VU5A 1NDKA 4ANEA 2NCKL 3BH6B 3BBFA 1PKUA 3FKBA 5CAAA 3VVTA 3VVUA 1EHWA 3BBBA 4HR2A 2DY9A 1F6TA 2ZUAA 1B99A 4ANCA 3VGTA 1LWXA 5C7PA 1NUEA 2CWKA 4CP5A 1NSPA 3NGTA 1HHQA 1U8WA 3MPDA 4UOGA 1BHNA 3DDIA 3Q8VA 1NDPA 1WKKA 4O0NA 3EICA 3JS9A 3EVOA 1NHKL 1XQIA 2DXFA 3FBFA 3ZTRA 3EE3A 3PJ9A 3FCWA 1NSQA 3B54A 1F3FA 5BXIA 4ANDA 1MN7A 1PAEX 4KPCA 4W98A 3DKDA 1NCLA 4UOHA 1BE4A 3B6BA 4WBFA 1HLWA 1B4SA 3L7UA 2HVEA 3GP9A 2HVDA 3VGUA 4DZ6A 3ZTOA 2B8PA 5IOLA 4F36A 3ELHA 2HURA 3G2XA 1S57A 2BX6A 3NGSA 2B8QA 3EVWA 3WX8A 1XIQA 3ETMA 3BH7B 4FKYA 3GPAA 1K44A 1NDCA 3EJMA 3NGUA 3PRVA 3BBCA
chains in the Genus database with same CATH superfamily
2M88A 3TI0A 1U1OA 4PUOB 1OWXA 2LEAA 1W7WA 1WUUA 2F9JA 1RQ0A 2CPJA 1PYSB 5F41A 3C66A 2MXYA 4L76A 2YY3A 1DTTA 2RNEA 2IYGA 2HZAA 4ZPBA 4B3OA 2KDOA 4NWBA 1JLEA 3EM1A 1HNXF 1BUXA 3BKUA 1IBKF 4U8YA 1FI4A 4LR9A 4ZIWA 3GE9A 4YY3F 3QLHA 4ETXA 1JJHA 3VVUA 4QWDA 1R43A 4X4UA 3HULA 4NOHA 5DGAA 3DDIA 4CI0B 1Q4RA 5HQ8A 3B54A 2F65A 4KO0B 1NK0A 3QGPA 4HDGA 2WSCC 4ZKAA 1IJFB 2HVDA 3OSPA 2GQQA 3I87A 2AEFA 1T7PA 1R0AB 4U7UD 3FEXB 2Y1JA 4K4YA 3BSOA 2FPHX 3OR2A 2UP1A 2BJEA 1Q95G 5IQQA 1VQNS 3PW2A 5L38A 4K0KF 3H4DA 5G0RA 1HQEA 2QV6A 1WSVA 1S1XB 2VBYA 4J37A 3EPGA 4X4QA 1X4DA 2DR9A 2IRXA 4NXNF 2OFHX 2G0CA 2QA2A 3M8WA 1AA1B 3ZZPA 2EC2A 4LF6J 1C1BA 4LBHA 1FRXA 3NXZA 3FCVA 4OLPA 3OHBA 4PR6A 4WU2A 1Y3JA 3ENVA 3A13A 3JSMB 3CO9A 3LP1B 2ZBPA 1FXRA 4CO3A 2IC3A 4WK3A 4QJVA 2WSFC 2YWFA 5KOWA 4RW4A 1N88A 2ADCA 3TA2A 1AB8A 3G86A 1FVQA 1F5BA 2PFDA 4ZHRA 4KPCA 2XS2A 1FJ7A 1VS3A 4O3QA 3KTQA 1U0HA 2RUGA 1FHTA 4DQIA 2B4VA 4QPXA 4DR5F 1YHQS 2FYXA 3DGPB 2DR6A 3K57A 2LU1A 1ZAVA 2IVFB 3T1AA 1M1KT 5HMZA 4NZ6A 4WJBA 4JV5F 1KQKA 2MGZA 2HAIA 2CNOB 2CQHA 5J2PA 1QVFR 5T41A 3C8YA 2AJ1A 1N52B 2V9KA 2RH3A 1RAEB 4FF3A 4Y3CA 1TL3A 4C6AA 1DAXA 2OHDA 2HFZA 3M8PB 4BCAA 4E0DA 4WYLA 4KIAA 2J6TA 3GJRB 3CJ3A 4J9QA 1NSAA 1LWXA 3J80Y 2NR0A 3B8HA 1ZM4A 2QJ3A 2XSJA 3SFUA 4I69A 4C8MA 4TNOA 3CJQA 3QYYA 1M5SA 2VZ9A 4RU9A 3KMSA 2ZITA 1NJZA 2VBZA 3GSIA 3TUPA 2H51B 1S1VA 1D1UA 2RJZA 1FKPB 3DOLA 4ZDNA 5F0UA 2FLOA 4DCPB 2OPQB 3MM5B 1PYOB 5KFOA 2JDJA 3HVTA 4NA1A 1JX4A 2UV8A 4LF9F 2XY7A 1WELA 4WFNQ 5GAGU 2JHEA 2AYEA 5L1LA 4OYBA 1U0SA 1N32J 3HSGA 3D66A 1H3DA 2O1PA 4ALZA 4MK7A 2HBYB 3OLBA 5HP1A 3GWCA 1S1WB 3ZXWA 4ZK7M 1PKUA 4M63A 4P52A 2QMWA 1XERA 2EPIA 4PWDB 5E41A 4ECVA 2HHVA 1QD1A 1N6QB 5HI7A 1BHNA 2R7UA 1PJ5A 2LQ9A 4RR5A 3GG1A 4CM2A 2KO1A 1QLNA 1X4GA 1I6JA 1SL2A 3VAKA 1WI6A 4FNHA 2YVSA 4ZPAA 4NCGB 3R6LB 2R8HA 2XULA 1KBRA 3AJ1A 3HSZA 3MMBB 3IRXB 2AYMA 4LBPA 2DGXA 5HK4A 4RBVA 3PRDA 4DV4F 4F36A 3SCKE 3PY8A 2EFVA 2HURA 5KG6A 1PYTA 2MKSA 2XWYA 5LJ5Y 3ULHA 1LQ9A 4ID8A 2HKEA 2MDAA 3OTOF 3SIPB 2GCFA 3K58A 2CXEA 1S59A 4YHHJ 1REVB 2F4VF 3KYLA 3C6TA 3CMES 4EGLA 4ZCLA 1FNMA 1HWJA 3CCJS 4DN0A 4AL5A 4DOZA 4F4XA 1Y00A 3DU5A 3P3DA 3H7HB 1TAQA 4FP9A 4Z7CA 4HH0A 3HKWA 3E8OA 1VBZA 1X4EA 3DOKA 2MQMA 4JV1A 1SQGA 4F8RA 1ZZNA 2UXDJ 3GFZA 3H40A 4NX9A 2XGQA 1WJ9A 2GVDA 2LYVA 2XY5A 6AT1B 3B6BA 3QO9A 4B02A 1T02A 5T7LA 1EQ0A 3K5LA 2FZKB 4FKYA 4LFAF 1U1RA 3NGUA 2WOMA 2QIFA 2ZH5A 1QE1A 3PDNA 1VQYA 3NS5A 5KG1A 5DLFA 1O8BA 3V4IA 4GVBA 2Z2LA 2IAJA 4ZVEA 2I5JA 1URRA 2GIFA 1UETA 2A2CA 3R7NB 1MG7A 3B4MA 1NPRA 1GXLA 2J8SA 2QYGA 4DX5A 1EB0A 4CZCA 1TKTA 2AW0A 1MWYA 4TU7A 4B3SF 4DV0J 3KNAA 4RLEA 1VDHA 1MMNA 4DR7J 4NLQA 3C19A 1WG5A 3G9CA 1KP6A 1CQNA 3LQVA 4G1PA 2YTCA 4OZ3A 4WZMA 3BBBA 4AL6A 2F1FA 1SH0A 3ZZYA 4A8FA 2I0XA 3RW7A 3CGIA 3OJUA 5EDWA 4K4VA 1G1XA 3J81U 2BR0A 3BGOP 1U1LA 1TUVA 4IRKA 1YDLA 3IG1A 2W4PA 2HNYA 1YJUA 5J1PA 3MUTP 3CD5A 2R2RA 3PZPA 2W01A 2DGWA 2E1PA 3NMRA 1DTQA 3FFIA 2A6MA 3P5TL 4LUBA 4K8RA 3BGFA 1W26A 2ALYB 2VV5A 3HVRA 3D1OA 2RHSB 2V2VA 3ISZA 1QSYA 1LEOA 4CYUB 1SUQB 2FC8A 3ITHA 3M30A 1F60B 4TQSA 2H65B 2DHAA 3FBCA 3MR3A 4GKKF 3M1VA 1NDKA 3SQGB 3MEDB 3LGHA 2PFFB 5HVGA 1S97A 2AYBA 3BO2A 4MYTA 4QIWD 4PZVA 1NSPA 2IM0A 3CSKA 3W2WB 1EJ7L 4GO5X 1FWPA 3CTRA 3HZEA 2X1FA 2VJVA 3QT8A 5F8LA 4FYXB 2UXBJ 1RADB 1WHVA 2OELA 1GXUA 2PA3A 3PR5B 4A47A 2K3IA 1DARA 1VJQA 1EP4A 3SZ2A 2QMUB 5D3GA 1XNRF 4DV2F 3NS7B 1H73A 4KHRA 5IV3A 2XHCA 3CCSS 2CJ9A 3KHGA 4ED1A 3KOAA 1IBLJ 4DG1A 1IKWA 4N7TA 4I7FA 3TEHB 2JFDA 5J2MB 5EWEA 3NGRA 4IFVB 2GX8A 2DH7A 2M8DB 4F02A 3KJNB 3CCZA 2EK1A 4NYOA 2YX4A 2AX0A 3N6LA 1VC6A 5HMYA 3AHPA 1TVRB 1JKHB 1VQSA 2RDIA 2OSQA 1HBMB 4DHVA 3MD1A 2E9TA 4KKOB 3JQMA 3Q22A 4DV3J 2XMJA 1IKYB 4USJC 2HFVA 1S9EA 1OIAA 1S49A 2DNMA 2NCKL 1WNEA 3L4BC 4WFXA 3FZBA 5J1EB 3DLEB 1NJWA 3NGTA 1LXNA 2MKKA 2AJFE 1WC4A 1R7IA 4MK9A 1APSA 4N76A 5ETVA 3Q0AA 3WC2A 4DEZA 3MCNA 1U7LA 3W63A 2B5JB 4PQUB 1Y5IB 1KOOA 4F7VA 3I0SA 4NLUA 2YKMA 3SEOA 1X0PA 1EQMA 1HQUA 1LK5A 1KN6A 3LWLA 3QFWA 2R3VA 4OL8A 3SCLE 3RB4A 3DLGB 4DR3F 1J2VA 1VJWA 2XO6A 4KV8A 4NZ7A 3ISNC 3OR1A 2HLTA 3ZTQA 4IKAA 1HNXJ 4HH1A 2CJYB 3UVJA 1IBKJ 5F8NA 1A9NB 2VPZB 2MKJA 2UVWA 3M2VB 2VFVA 4YY3J 1C1CA 4LBIA 2HQCA 3HHLC 9RUBA 4WFZA 4JI4F 1FVSA 3UI3A 1U02A 1ZM9A 4UQGA 4QR2A 3RJMB 2DO0A 2HRTA 4Y2CA 5GAHI 2HBRB 5M2RA 3FCWA 3M8QA 3MAAB 2AGPA 1B7FA 5JJBA 4LR7A 3F41A 4DL6A 1Q8BA 2QT7A 3EDRB 4LT6A 2UVRA 3GIMA 4K0KJ 2B4OA 2FLLA 3WX8A 3VAIA 3KLIB 1V9OA 4UY8T 5HBMA 4ECTA 3LGNA 3QZ7A 1HIYA 4NXNJ 1YIJS 3MEGB 1SQEA 5D0RA 4TYBA 4QWEA 1F9HA 3IBWA 5HROA 3C16A 2KZMA 1U1PA 3ZTSA 3UN2A 4CLPA 3TZYA 4QYZJ 4ECQA 4C3MA 4WE1B 4M5IA 1RWOB 1SVDA 4F0MA 3BQ2A 2PN6A 1UJ6A 2CQGA 2W8LA 3DM2B 2ZH7A 5KFLA 1RTIB 2KG1A 1CC8A 2AX1A 2EG1A 2DHHA 1PIEA 2VASA 4W98A 3QT7A 1RT5A 4N47A 4ZP9A 5DDPC 4DPYA 1SV5A 3CCTA 4U6PA 1RU2A 3H2UB 1OYEA 5IZHA 4JV5J 2P9GA 5LT5A 1OJ4A 3FQLA 2UVVA 2EFQA 2BBEA 1Z2LA 5IC4B 1P1LA 3LOUA 5GAEU 2W9CA 1U24A 4ICLA 3HKZD 4PG4A 4KTQA 2HVHA 2HW3A 3G71S 3EWGA 4EK2A 4E98A 5FLXY 4I4BA 4LF5J 2BW7A 4R25A 2Q6CA 2BOPA 3LP0B 5A8KA 3P96A 2R7QA 2GC8A 2NSCA 1WACA 2V6AA 1ZM2A 1RXOB 4UOCA 3BO4A 1KDNA 4IH5A 3KJQB 4FKXA 2VU5A 2IHR1 2HMIB 5JVHQ 3ZZRA 3I5BA 1RWKB 3LP1A 2XMWA 4CP5A 2FQQB 2FVPA 2E9ZA 1Q86T 2UUWA 3SDEB 4EYHB 4RL1A 5B0GA 4MKYA 4WKRA 1JLFA 3T5HA 2EI5A 3POTA 2GQCA 2M70A 4JI8F 2H3EB 2BA9A 2HAFA 5KT3A 3EVWA 1VRTB 2ALZA 2RU3A 1KFSA 2ZZNA 4LF9J 2BEFA 2ZE2A 2EEYA 1RISA 2GVZB 1UVJA 4LIRA 4ZVQB 3O44A 1VIOA 3CIZA 3GYXB 1JXVA 2LA6A 4I56A 3DLHA 1DURA 2E5LJ 3QGIA 4NASA 4RW7A 2KZZA 4AFFA 2EWHA 4M1KA 1BLUA 1PILA 2QSWA 3Q8UA 1HBUA 1D9FA 1X5PA 4OYPA 1V5VA 2BE9B 5HLFA 2DH8A 3MPUB 2O66A 3NAHA 1WDDA 3MMCA 2ZUAA 2VG7B 1JJ2R 5D78A 4ZPWR 1T05A 3I0RA 1T3NA 1GX5A 1T03B 4WXOA 3MTKA 1MN7A 2W4DA 2R2UA 4CCHA 3FCHA 4FBUA 2ZDOA 4DV4J 2BM0A 3MM9B 3QIPA 4ECXA 5I3PA 3VGUA 2OAUA 1X4FA 2KYZA 2EKYA 5GAHU 5E5NA 4ELUA 3AJDA 3CJKA 2C22A 2HQFA 3EZOA 2KTQA 3IXQA 1RYSA 3THPA 4NYPA 3HD2A 5A2QU 2F4VJ 2YNFA 1K1QA 2JWNA 1WHYA 4IRCA 4KC5A 4YB1P 2UUBJ 2FC9A 2BJ9A 1B70B 4USHA 1MN9A 5LMUF 2PMWA 1VFJA 2DXDA 3MPVA 1YJNS 2HHUA 1XN9A 1S1WA 2J5AA 2QFJA 3PYGA 2OEKA 5AJ3F 1N54B 3K89A 3BN4A 2DNKA 2IM2A 1VQOS 4L73A 4Q8EA 2XZDB 1C0UB 1IN0A 1VBYA 4QYZK 4V19X 1IKVB 1PC5A 4U96A 4ECYA 2BQUA 1YJ7A 5CCLA 2CVEA 1S6UA 4DZ6A 4O3OA 4LFAJ 3DGVA 2VONA 4QWCA 3O8WA 2XTJP 4PG6A 3A8EA 3FQKA 2MKCA 2ZZMA 1FRJA 3DU6A 1UJ4A 3V6DB 2OJ3A 1XJWB 3WIVA 2R7XA 3E3XA 1G6BA 2RSQA 1REVA 4B3SJ 3IM9A 3IFEA 3CC4S 2E9RX 2R8IA 1X7VA 5J2QA 4K50A 2IRUA 3AXMA 5IS2A 1HHSA 3J7ZT 3P49B 5KAKA 1AZSA 3BH6B 5CZXA 3JAMY 3VQTA 5K8PA 3HHLA 4TYAA 1PJ7A 1Y0HA 2JEIA 4PWWA 1FTRA 1UVMA 2D69A 1AYEA 2BE2A 2CQIA 2F5GA 3I6PA 4F4YA 2OPSA 4KHPF 3I31A 3NCRA 4H4MA 2M5YA 3C46A 4K4UA 2J9DE 1JLGA 2RUSA 4C98A 1N5YB 2DVIA 4O4GB 2XO7A 2PEHA 4DPWA 3PV8A 1FFSB 4UY85 3I5CA 4O0IA 2AU0A 2DBBA 3IC1A 2HBQB 2ZOMA 3MFHA 3Q2TC 1YTYA 4ER8A 1KKHA 4KGXB 2J6UA 2N3OA 3IRWP 3KLHA 1YK9A 3VR1A 3DXBA 4RWWA 4NLPA 1U45A 7AT1B 2CPIA 1K8AT 3THTA 3PX0A 5LXYA 5EHHA 1XR5A 2BANB 3CEDA 3OVSA 1JXLA 4ANCA 3HP6A 1MLAA 2Z8QA 1IKXB 1S9GA 2D3UA 2ZJRQ 1JLAA 2ZEJA 2Z58B 4HTJA 2ACMA 3R27A 2B6AB 1WHXA 4HLBA 1Q82T 4RUBA 1ICEB 2BUNA 4DV2J 2RKIA 3ZTOA 4RBTA 4L3NA 2DRDA 4QPTA 1S6PB 3PEHA 1Y4ZB 4MFBB 4J9OA 2I38A 1R0CB 3R1LA 3BJYA 3DRPB 3PRBA 1R0BG 1ZTTA 2DRAA 2FJDB 3RB6A 4ED0A 2L9WA 4H54A 4OHWA 3PYEA 3TNVA 1U49A 4PXDA 1FRLA 3PFOA 1HD1A 4EO8A 1RGVA 5JXSA 4HACA 1VYAA 1X4AA 3N5BA 3CDEA 2VJUA 3OUYB 3X1LB 3ET6A 3D6HB 5F9NA 1M5VC 4L3KA 2GGPA 3TJAA 3WX4A 5F3TA 2NZCA 5L1IA 4ZN3A 5KG5A 1RT6A 4PXBA 1R8PA 2VICA 4B3TF 4QOTA 5FDLB 1X8DA 3UW1A 4FF4A 2QLBB 4X4SA 4CRJA 4Q43A 4LR8A 1UPMB 4DJBA 4K4WA 4ZVGA 1U09A 1GK8A 2NSBA 1JMTA 5KFQA 4NA3A 4Q7AA 4I2QA 2C3YA 3N5FA 2C3PA 2QMXA 3DDNA 1XMOF 1JQGA 3K7RA 1PSDA 2CPYA 2C2KB 1R6YA 4J9PA 2CIMA 3ADAC 1YX2A 2HHSA 1YZ7A 4DR3J 5KFXA 4USWA 2E7XA 4PG8A 3UO0A 3B82A 3GB0A 4OIXA 5ADZA 1SL1A 1FEHA 4UOFA 1MU2B 3G82B 2Y1IA 2D3ZA 1FRIA 3HVAA 1C0TA 1Q16B 1FD2A 2RRNA 1CJTB 1KHWA 1JKHA 1HWKA 5HVHA 3SSQA 2P6SA 2BJ7A 1EKSA 4JI4J 3UDLA 2CQBA 2W2NP 2CDRB 1Q5VA 1S0MA 1U8WA 1M5PC 2LDIA 2J9DA 3FRYA 1NHKL 2MY7A 1DQAA 2QLJB 1F3FA 2U1AA 2V94A 4JI1F 5ETQA 2B5JA 1VBKA 3KK3B 2CQ3A 2PGCA 3HSJA 1NBEB 4QIEA 5B0AA 1ZH5A 2GO8A 1WC3A 2JSXA 2MZTA 3HDSA 1NO8A 4ID5A 3BYRA 4X4PA 2FTRA 3T9ZA 1D09B 1NK8A 3FEZA 1X60A 3K5PA 2CJXB 1QSLA 3D0IE 3RRHA 4A48A 2WVDA 2V63A 2LDYA 1F9EB 5MLCV 5KG0A 2UXCF 1RBAA 3CB4A 3MM7B 1RLDA 4R0JA 4MKVA 2MPUA 3CDBA 3G6XA 2KRBA 4B3RF 2RS2A 2HHHF 1UFWA 2V34A 2WW4A 2NLWA 4LF4F 1CJKA 1HWUA 3N0VA 4WU3A 5ETOA 2GZOA 3QAUA 1NPPA 3GSDA 2O5DA 2BQRA 1N5SA 5DQHA 1U8SA 1N36J 3GJTB 5ETLA 1LW0A 2YKNB 4HI2A 2RF2A 4LF2A 4RW6B 4DFMA 5L39A 4OQJA 2F3JA 4NLSA 3H4BA 4X84A 1WORA 4Y2IA 2ERRA 5DZ7A 3PW0A 1TKZB 3HFVA 3PACA 5SZTA 4C8KA 1CLFA 4ZLPA 5IV4A 2H4YB 4DL0C 2NS1B 2YNIB 3PKYA 3TW0A 5I3UB 2VFTA 2HK3A 2YNHA 3CC2S 4KAIA 3UNGC 2BRLA 2SXLA 1RCXB 3KLGB 1HARA 1RAIB 1GMWA 4J5OA 3ZZTA 1KNZA 3ZTPA 2CADA 3J7Z5 4CTAB 3D9BA 1F6TA 1P9QC 2JLGA 3TX0A 2WCXA 1U47A 2KT3A 1HI8A 4GO7X 4JI2F 2CZ4A 1LWFA 3IWLA 3SMZA 2Z30B 4JI8J 4IG3B 3GG0A 4JI3F 2VHGA 4C8ZA 2I9SA 4BHQA 3BKTA 1FNXH 1IBMJ 2UUCJ 2DR5A 2J7KA 2KFYA 1JJ4A 4QQBA 3NWGA 1QVGR 2DNOA 1N8RT 1WTFA 1FKAF 3Q2SC 2W24A 3CWJA 4I68A 2J76E 4JI7F 3TAMB 1J5EF 3W8GA 2QTWA 4MT1A 3TOQA 3M8YA 3LP2B 4ECSA 3DFEA 1UWAA 1S6QB 3UPFA 2EW9A 3NBPB 4LRCA 1UTAA 2HSEB 2QL9B 1QJHA 5BR8J 3UD5A 4DL2A 5KTQA 3FKBA 5CD4H 2RAQA 1RT2B 2XLIA 3R5JB 3C14B 3HM9A 4IR9A 3KK1B 8AT1B 1AFIA 1RT7B 1JLCB 1NU4A 3S8SA 2FHOB 3H90A 3TUZC 4U67Q 5KT4A 2B3TB 4MMOA 3QQCD 3JYTA 3WC0A 3RR8A 5KFCA 3NKYA 1KLNA 3A12A 2QN6B 2WB1D 4ZN1A 3HT3A 4KRWA 2R7TA 4C0HA 3CJ2A 5C24A 2E5HA 2RS8A 1REGX 3H0PA 1H2UX 1NK9A 2GVZA 3T1HF 3OV7A 4DSEA 1SIZA 2VPXB 4LF7F 4DUYF 1L3VA 3J7AN 4B9VA 1OY8A 5LMUJ 4YR3A 5KFKA 1SH2A 3KNGA 2MLXA 3GIJA 3W2VA 2ZKUA 2PIIA 1WKLA 2N4DA 1TV6B 3MR6A 4USUA 5L1KA 4F4WA 3FEYB 5AJ3J 1KHVA 1B99A 1MROA 4CH0S 5HMXA 1WF0A 1NKEA 4CLSA 1KLMB 3NY0A 3QJJA 4X66F 5GMEA 5D77A 2V67A 4HL9A 1O5JA 3MM6B 1RBOB 2P9EA 3BGUA 3GIRA 3GCXP 1HR0F 3A3PB 1NRKA 3FJ2A 2LEBA 4ZPCA 3TJ9A 2IVMA 2RDJA 3DN9A 3QRPA 2QEXS 1S57A 2BXJA 4KSEB 4DR6F 2LVWA 1IQZA 2YQ3A 3RB3A 4IQMA 3D2WA 1Q7LB 2VKRA 2DIUA 3I55S 2N3LA 1XNQJ 2HHXA 2VFSA 1RT4B 4M5HA 1T9WA 1DLOB 1E6VB 3M6XA 5HANA 3MMAB 2VD3A 1S1UA 5IC6B 4YN3B 4DDFA 1QAXA 2POKA 4ZVPB 3H5YA 3IMQJ 1CVJA 4MKBA 1P6TA 2F8HA 2P5VA 3T6JA 4FS1A 2ZJQQ 1BY9A 2I2YA 5THWA 4P2SA 3HO1A 3HHDA 2ZD1A 2H5EA 4DUZF 4NLWA 5LSRA 3PCOB 3FUYA 3M7VA 5J2NA 4KHPJ 1H72C 2DNQA 3BB5A 2DXFA 1VHIA 1ULRA 2G2ZA 3BGRA 4DFPA 3M6UA 1YJWS 4KH1B 1TU0B 3DYAB 1B4SA 2EFPA 2CRLA 3M2UA 2K2PA 3JSBA 2ZH6A 2HGLA 1UEUA 2C2EA 2AJQA 1GX6A 3BSCA 2BDPA 3W9IA 2CPHA 4JI6F 1PCAA 3QT6A 2EFNA 1UWBA 2LECA 3DI6B 1RAGB 1N32F 2WB4A 1VQPS 4DI6A 2UZAA 2K7JA 1AFJA 4UTGA 2R8KA 1IR1A 5GMKa 3D7SB 3LH2S 4P6QA 1Y3KA 4IG0B 1RHRB 1HPZB 4PG7A 1QY7A 4Y00A 5KG4A 1H38A 3DRRB 3N01A 5D4PA 2DRBA 1FERA 5HJYA 2LFVA 5CQGA 3MECB 4OHYA 2BJDA 1RAFB 4P9SA 1F0XA 4HR2A 2FLNA 2VUGA 3M2RA 1FK9B 2R9LA 1ZA1B 1TL7A 3H20A 2CJBA 2PE8A 3SCJE 3GV7B 2J0WA 3JS9A 2JNJA 2OPRB 1RAJA 4ZCMA 3O5TB 4C9DA 1WEYA 3HD1A 1JB0C 3BSNA 4OZ1A 4WIQA 2IVYA 2OH2A 3C6UA 5A76A 4O4GA 3CDUA 1IQTA 1BC6A 2V8DA 3OFEA 1NHVA 2ZH4A 1RT1B 3KDOA 4CO0A 2WHOA 4RW8B 4F25A 1VHFA 2ZDPA 1YBUA 2HHWA 1F1BB 2X3GA 2YKPA 4XPEA 3GIKA 1UPPA 2BKOA 1VR6A 1LWEB 2HIQA 3EGNA 2W9BB 4MKAA 1KTQA 2P9CA 3HMJG 4CM0A 2QA4G 4B3TJ 1TK8A 2QZ8A 3PIOQ 1EHWA 1FDDA 3QMQA 1Y10A 5L46A 4ECUA 1RKIA 4C0BA 2VG5B 1P8GA 2X1AA 3MEKA 3D3CJ 3BKFA 1K1SA 5F8MA 4I2PB 1RTDA 3MI7X 1TR0A 1VK8A 2W7OA 3KMQA 3NGKA 2PT0A 1DFDA 2CKWA 3N6MA 2XQCA 1W25A 3K59A 3KLFB 5HVFA 3CE8A 4BWMA 3DRPA 1AT1B 2MZJA 1JLBB 1YSJA 3DLJA 3IS9B 1S77D 4NLDA 2MY8A 4ED7A 3L09A 2UVUA 1MSWD 4DR7F 4EZ6A 1S1TA 2ZVSA 4JV2A 1SKWA 1R8CA 1Q5YA 3BR8A 2R7OA 2XMAA 1EETB 5T14A 4C8LA 1BQMA 1S79A 1Y5NB 2HPUA 3I82A 5FD1A 4NCAA 4CT9A 2AD9A 2CWKA 4NL5A 1JJCB 4JI1J 3VF0B 3BQ1A 4CIOA 2QE5A 3SXLA 2CDQA 3BN7A 1VCTA 2QO3A 1UP1A 3D4JA 4LFBF 1WI8A 3GP9A 1I94J 1SCJB 5F8HA 4J91A 1OY9A 4G1QA 2BV3A 4UUWA 3GPAA 4JI5F 3UN5A 4MTPA 4CLTA 4YMEA 3R6GB 2ZH2A 1UVLA 5I42B 1E6YA 4K5SA 4B9SA 2E29A 1MU2A 2K3KA 2CA9A 4BS2A 2HRYA 4P75A 2XYHB 5CYQA 4FF1A 1CJTA 1C2PA 4HT5A 4I67A 2CVIA 4B3RJ 1UW4A 3Q89A 4F0KA 3C15A 1GTEA 2HNDB 3Q8SB 4AL7A 3RU0A 2CYYA 3E01B 3OBIA 2HEKA 1YVFA 4IOCQ 1B3TA 3ENQA 2VH7A 4O3PA 2DCLA 2H4WB 2MQNA 2UXBF 1VRUA 3H5SA 3QWPA 1NH7A 3US5A 3J81Y 4UUXA 4C48A 4ZITA 4P7TA 4HHUA 5A8RA 3BPSP 2WSEC 4NLGA 4WBFA 2DISA 3LGMA 1IBLF 4X2BA 3QNWB 4F26A 2R2TA 4MYUA 2B4UA 4H4OB 2ATCB 2ZWPA 1XIQA 1RT3A 2ASLA 3S1TA 5IM0B 2GMHA 1N5VA 4TY8B 4WF9Q 3LTOA 3ONQA 2UUTA 3CCRS 3ENAA 2HNZB 3PJXA 4JUZA 4IDKB 4R8UB 3PIPQ 1U48A 4OFZA 4WTYA 1HYSB 2V0NA 3MM7A 1RB0A 4PYAA 4CLZA 3DLBA 5E7OB 2HLUA 2GJ2A 1RWXB 1H7XA 1HBOA 4MIBA 2YKOA 4C3KA 3R2DJ 4HI1A 3M8RA 1S76D 3GIIA 5I4MA 1KVKA 4P2MA 3T5KA 2QX0A 3W5ZA 4JI2J 5K14B 3MR2A 3VAGA 2IIHA 3EYZA 4LSNA 2WVBA 2HZCA 1SPBP 4RNMA 4Q2LA 1EAYC 5C2CA 2WTFA 4JI3J 4LJMA 1HA1A 1LW2B 4X64J 1TKXA 5L9NA 2YWKA 4V1Ak 3DOMB 4F3QA 2HWTA 2VPWB 2LQ5A 3T3FA 3OFGA 1SIWB 3OFHA 4JI7J 1J5EJ 3KLEB 4GC7A 3KJVB 1PJ6A 3I9V9 4OZ5A 1RTHA 3JQJA 1JK9B 1BQNB 2B9EA 1VISA 2Z0GA 4ZJQA 4ED3A 4IO9Q 1UAWA 3QGGA 2K1RB 3CMQA 3V81A 2RIJA 4ERDA 3EGVA 4XIUA 2YX1A 4JBCA 4DBQA 1CJUB 3ZZUA 3IR5B 3IO1A 4NYZA 4OHVA 2DY9A 1K73T 2HIYA 1CEZA 4WP8A 2A18A 1RAAB 2JEFA 4FNIA 1CULB 5EUHA 3FZ2A 2FHMA 1S9FA 4HYKA 2XMUA 3LALA 4KH0B 2X1GA 1J5OA 3GZ7A 2J9CA 2A10A 1RJJA 2YQ0A 5KFAA 4G3IA 3QZ8A 4C8NA 1FO1A 2XI3A 3MTJA 3U7JA 3E51A 4M5DB 3KHHA 3IR6B 3NRBA 1Y9OA 4K2JA 3Q8RB 4F4ZA 3T1HJ 5M2UA 2RRAA 1OPZA 4LF7J 4DUYJ 4YB7A 2XYGB 2V2KA 3QAEA 1JWWA 4ES3A 2ZNZA 2VQFJ 4CWBA 3DMJB 1TUWA 1ZTWA 4C3LA 4ELTA 4LQ9A 8ATCB 4KFBB 4DL4A 3GFYA 1UVKA 1WC5A 2HVIA 3NCPA 1TL4A 5EN1A 3IBFB 2AYGA 2B0GA 4K7QA 2C2DA 2L3MA 4ZVTB 2KXFA 3H98A 3FSXA 2MQQA 1DTTB 2HQGA 5DZ6A 1RAOA 1RTJB 2AGOA 2XLKA 3H2LA 1U6BA 3AD8C 3AJ2A 5B08A 2DGUA 1BMQB 4B3OB 3FK4A 1RT7A 2DPJA 4X66J 3SSSA 2HHPA 5IT9U 2B43A 3QLHB 1N56A 2WVCA 3JQKA 1HR0J 4K4SA 4DN9A 4DPXA 2ROGA 2MZQA 2WVEA 2I1RA 4DR6J 4C11A 1H6KX 3R97A 2ZM6J 4ED6A 3BQ0A 1G7CB 3EXCX 4LF5F 1EARA 4OI1A 4J9VA 1NK7A 1ZETA 5DG7A 2YNGA 1RKJA 1T8EA 2FVCA 3T5JA 2GQ2A 3GCWP 3OR2B 4BBYA 2M52A 2P6TA 3NEKA 3M6VA 4QU7A 1HQEB 3AA9A 2WK4A 1VQ9S 1N5TA 3MUVP 5L1JA 4UF4A 4BDPA 5HSPA 1IBCB 4DUZJ 4DS4A 3IR7B 1C1BB 4NI2A 1XK8A 3EDQB 2G2OA 2D41A 2Q79A 2JVOA 3CCES 3UCZP 4OX9J 2HZVA 2OD4A 3AOCA 4FYYB 1D8ZA 1SKUB 2IC3B 1RHQB 2CJQA 4P10A 2B8QA 1S4FA 2EG2A 4JI6J 2WVFA 1OYDA 4ZHRB 1FXLA 3RGIA 2E1MC 1I51B 2V2QA 1FRKA 5AE3A 1U0HB 2E5LF 2OSRA 2CZVC 3LPYA 1GNKA 3K8WA 5KFHA 4U95A 1ZYQA 4O44A 2GV1A 2MGZB 3R5DA 1ZA2B 4LRAA 5J2PB 4R5PB 2Z4PA 4FVCA 1NDLA 4Y2AA 1S6OA 1UA1A 1IM4A 3CC7S 1GT8A 2Q66A 3D1QA 3VAHA 5KFEA 3HFZB 3BYPA 2W2OP 1TL3B 1OSDA 1FXDA 1AUSL 4LRDA 1UFLA 1X4CA 1TL1B 1ZZFA 1Q53A 2AGQA 3O3LA 1CG2A 3NAIA 2IA6A 3AFGA 1LWCA 3I5AA 4FYDA 3T5LA 4RNFA 2CQ0A 4AXIA 2XSJB 2B8PA 2XZWA 3NWRA 5ETMA 1X4HA 2HFOA 1F3VA 3DLKA 4NE9C 5LJ3Y 4DQQA 5KG7A 4PPDA 4MJKA 1T9TA 2UUBF 3DDKA 3W7BA 2MZ1A 1B0VA 4IRDA 1YRUA 1PGZA 1S1VB 2ZBQA 4TQRA 1RP5A 5B0DA 3DOLB 2V4JA 3CW2C 2RHQB 4IG0A 1I1GA 1FF2A 1XWLA 1ZBTA 3HVTB 3T41A 3VGSA 2U2FA 4ZJOA 4PXEA 2DHSA 2KXHA 2AQ4A 3MECA 2J7UA 4M5KA 4IFYA 3VWSA 4PWUA 1Q0NA 1C4CA 2BE7D 3VHQA 4USVA 1NUEA 1WC6A 4IH6A 2UU9F 3GV8B 3BREA 3UCUP 5HP1B 2FD2A 2LU2A 3W61A 2ZJPQ 4K5RA 3TAQA 2MLYA 4R0EA 3R1HA 3AODA 4J90A 3H42A 4Q0BA 2DHXA 1R8HA 3QSYB 2FVSA 2EC0A 1HNIB 4DV7J 3AH6A 3P8BB 3KFWX 5H1SV 1YJ9S 3CD6S 4DSFA 5A2QY 3TRGA 4DQSA 3VTIA 1HD0A 4F2SA 3OW2R 3DC2A 2RQMA 1S0OA 2Y0SD 3MR7A 1UFKA 4XPCA 4RW8A 4CO2A 3G8SA 4XO0A 1NLKL 3DRSA 4FXWA 1H2TZ 2ZZTA 4WKYA 4OJHA 2HHTA 1FT8A 2CG8A 1S12A 4JV0A 2F8MA 5BYRA 2VG6A 3H8YA 1VQ5S 1G2EA 4ZLLA 2BW2A 3VAFA 4URSA 4ANEA 3KK2A 4WZQA 2OMOA 4WFYA 2H9ZA 4ILLA 2FUG9 3C6TB 2CG4A 2VG5A 1RWNB 1DY3A 2JC1A 3IAS9 1URNA 1K0VA 1CJVA 4N5SA 2IMOA 4LFBJ 3NOCA 1R6VA 3PYDA 2J8AA 4HKQA 2IFXA 4K4TA 3DOKB 2VQEF 4KHMA 4JI5J 2ROPA 2IDEA 2DGQA 2C2RA 4WFBQ 3MMJA 1B7YB 2GIQA 3PNIA 4CO4A 2GHWA 3QO9B 3GILA 1SC3B 1RBLA 1V5IB 3IBCB 4A8OA 2GNKA 5T7LB 1MNEA 3W8PA 3IWXA 4OI0A 3R3TA 3CCQS 1H0HB 2F40A 3KG0A 3ILJA 3G6ES 2WOMB 4OZNA 1QE1B 3R5CA 3Q8YA 2OMLA 4DF4A 4GVBB 1X0FA 2IAJB 2PC6A 3FGVA 2EFOA 2ZH9A 2C3MA 5GAEI 1QUVA 2FY1A 3DRYA 4XDDA 4NEZA 3QIDA 1TKTB 3IP0A 4Q2MA 2JFKA 1U26A 1WOOA 5MAOA 2PSZA 2FLPA 1JXEA 3CO0P 2FZCB 4QWAA 3N9UC 4WTOB 5LMNJ 1IJEB 4O4RA 2Z2YB 1NK6A 2WBRA 1KQGB 2QA4S 3L7UA 4F04B 4DR1F 4BC7A 5JVGQ 1S7HA 2HHQA 2OTLS 3BSAA 2LEPA 4DL3A 4DSKA 3MXHP 3MAQA 4M5MA 3E2EA 1KVIA 4ED4A 2WONA 2KXNB 1FEEA 1NNDA 5DG8A 2CPXA 3JTNA 3IG1B 4PEOA 2HNYB 4X65F 2B51A 5I42A 1SB6A 3FNNA 4LREA 2KM8B 2IDLA 1YI2S 4WCEQ 2BYCA 1DTQB 3FFIB 1N0VC 2R7WA 4OYMA 2C1EB 1UA0A 1FX2A 1HBNA 3K0JA 2EKNA 4USKA 2ZBRA 3OXFA 5KG2A 1MMDA 5KFVA 3OJSA 1ZM3A 2MHNA 4DV6J 3ITHB 2QSFA 3OL8A 4TKTA 4QZVB 1BWVA 5CZVA 3IWNC 3MPDA 5DG9A 1Q78A 3M1VB 5BXIA 1RWVB 3AD7C 5D4NA 5BYSA 4DV5F 1S4EA 2FHJD 2R7RA 1HLWA 2QA1A 2FY8A 3A3NB 2YPZA 5G4DA 1H98A 1GFWB 2GAGC 3QT5A 1RHJB 3MGJA 3RZAA 3F44A 3H5XA 3W1YC 1NXIA 4TY8A 2V2ZA 4LSLB 3AOAA 2ZOFA 3LUYA 3EUNA 2OPPA 1T3OA 1FD8A 3CCUS 5D15A 5D3GB 1A7GE 3HF5A 4NMLA 2XEXA 5CABA 5I3QA 1SJFA 1YRXA 4DG1B 4I7FB 4CLFA 3OL7A 4YB5A 3OD2A 1NZ8A 1T9UA 3RAQA 4D3HA 1RDRA 1NHUA 4Q5VA 4GMKA 3PG9A 1TMJA 4TLQA 2HS0A 1T0TV 3ZTRA 1S9EB 4RW9A 3LWMA 1F2GA 2VOOA 4KE5A 3JTPA 2CZ9A 4Q45A 4PUOA 5HATA 2R2SA 1PBAA 1NJIT 4N8NA 5HQMA 2R8GA 2RD5C 4GVLA 6FD1A 1RHUB 3KUGA 2AJ0A 1HNWF 3SQOP 3A1YG 1U2FA 4PAAA 1AUDA 2FGOA 2AZ3A 2XWXA 2YKMB 2CQ2A 4EMDA 2RB7A 1HQUB 2HGMA 2Q1LA 2PO4A 1HW9A 2EXUA 5D0EA 3ZFVA 2LXFA 1AXQA 4Z37A 5AXLA 3MWBA 4KV8B 1X31C 1WKJA 3OR1B 2QYCA 4KO0A 4ZLJA 4OZ0A 3VVTA 3UVJB 2VFRA 1N36F 2V8PA 1PBUA 1C1CB 1R0AA 4X4TA 1F5CA 3PEJA 3KKFA 1RWUA 4DR4F 2AMCB 1JNZB 1S1XA 3MCOA 2AEMA 2Z2ZA 1RE1B 3BV8A 3OPKA 4KGMA 2W7PA 1H74A 2MQPA 4X4VA 2F7VA 3TAPA 1U6ZA 1H7WA 2NUHA 4CO1A 1TQLA 4ES1A 1XMQF 3U1LA 2RRBA 1D8YA 1WF1A 3TVKA 2ZWOA 2XS5A 1ZAXA 1KWMA 2YXLA 4S0MA 4EFAC 3MD3A 3BZQA 2EBGA 5IQ6A 3JSMA 4XAKA 1LKZA 4WIIA 5HBMB 1UL3A 2FGCA 2YH1A 2DITA 2BQ3A 4LFCF 2APOA 2HG4A 5HROB 1RTJA 3CJSA 2Q43A 4HVZA 2R7SA 3C16B 3TVYA 1IM6A 3VGTA 4FDFA 3PX6A 4ITSA 3Q8VA 4P7VA 1XQIA 3DGPA 4OYZA 4KJIA 1IBMF 2UUCF 2KH9A 2C2NA 1QAIA 3W9HA 3KUHA 2N7YA 2EFGA 1Q8KA 4CDIA 3D5MA 5HO4A 3G2XA 1R3NA 3ETMA 1U1MA 4X62F 3BS9A 1HI0P 1RT5B 2KM8C 4YOEA 3NL0A 5KT5A 4FBTA 1SV5B 1M5HA 1M0SA 1SJQA 2LXUA 1S0NA 3MM8B 3M8PA 1HKAA 2J0XA 4P72A 4FPRA 1T9VA 5BR8F 3ICLA 2AT1B 2ILYA 4EUVA 1CS4B 3FBEA 1UZDA 2W9CB 4ICLB 1HI1A 2W8KA 2X1BA 1VIXA 3CDWA 2V50A 3R8YA 4DPOA 5IWAF 1U25A 3UDVA 2C28A 1G3OA 5A8KB 3K5NA 2VBWA 1HHQA 3P45B 5BJRA 2V8GA 3QATA 1VQ6S 2JZ5A 4F2RA 3TZZA 2IRYA 3R7SB 3W3SA 1FKPA 3GFXA 1ZAWA 1MMLA 2ZHAA 2XMVA 2OPQA 3MM5A 2KT5A 1FJEB 3J7YI 1ZPWX 4DFJA 3SSRA 2DNNA 5RUBA 5F0WA 1JLFB 4OYWA 3POTB 1RSCA 4CLLA 3X3UA 4TU9A 1LOUA 2JC0A 1R89A 3NGDA 4J9NA 3PKMA 1TP7A 2HQIA 4NPOA 3W9JA 2FJWA 1WG1A 4PWDA 3AB2B 1JLQB 3L7PA 5KFGA 2ZE2B 4CH7A 4QW9A 1Z1ZA 1N6QA 4R5PA 1SXLA 3OLAA 1ROFA 1Q1KA 3TR5A 2FDNA 1C4AA 1TZ0A 1YGYA 3D0HE 4IR1A 4NCGA 1W2BR 4E8UA 2Y1LB 4RW7B 1OS5A 4B3MF 2UU9J 3MMBA 3IRXA 4TVAB 1TL1A 1HBUB 1UKUA 5LM7E 5HLFB 3ILLA 3MMCB 5LSOA 3W66A 4W92B 1V3SA 4LF8J 2W2MP 2FVRA 2DGOA 1KQSR 3S01A 3CF5Q 2P2CB 2E44A 4CH1A 4USIA 2PA8D 1T05B 3I0RB 1XNQF 1RYRA 5KT7A 2Q3PA 1NKBA 2OD6A 1NMEB 4G6VB 2RU9A 5EX0A 2ZHOA 4DU8A 2ZVIA 4RKUC 4QYRA 3QIPB 4EBDA 5AE2A 4DXLA 2CPZA 2OFGX 5K8OA 3K2YA 4G1IA 5AXKA 3R2CJ 4P74A 2G1HA 1WOPA 3CJKB 1OY6A 2E7WA 3AA8A 5E33A 4M94A 3D0GE 3UQSA 5F8IA 4M5LA 3I4PA 4ILMA 5HJXA 3PM9A 4L72B 3HFKA 5D4LA 2G1DA 4NLVA 2YNFB 3ZZZA 2HFSA 1K0TA 4QR1A 1PO6A 3FMWA 3THVA 3GYGA 5DO2A 2MSTA 5CYMB 4HHHA 2UUAF 2B7BB 3GU0A 2HVZA 1UEVA 5KFRA 1L5UA 5F3ZA 2VQEJ 1LXJA 4B9NA 1WF2A 2L08A 5KFFA 1HNIA 2ZBIA 1KVJA 1QAYA 3ILIA 2ZH1A 2XMKA 3G6YA 2QGFB 5KFMA 2BM1A 3BR9A 4KGKA 2PI5A 2FJXA 1TL5A 3CCVS 3EMTA 2IA0A 2FJVA 1FRMA 5BYQA 2DGSA 3GV5B 1RUSA 3KXDA 1F5AA 2W2PP 3CD0A 2HRUA 2DT9A 2MQLA 4Y6IA 1TFWA 1RWPB 1KRPA 1RI7A 3SV3A 2NREA 3AB4B 2YWHA 2B56A 1KR4A 1N0UA 4DU7A 5J2QB 1J27A 3PHTA 5KFUA 3HXMA 2O01C 5HL7Q 2E7VA 4LRBA 1AZSB 1Z2ZA 3HHLB 4NLTA 4DR1J 2D9PA 1FE4A 5H9EJ 3D6TB 3V6JA 4ED2A 1DBDA 1QSSA 2VC1A 4OI4A 2BE2B 3BDEA 4CYUA 2OPSB 1SUQA 3P6YC 2G2YA 4X65J 3K5MA 4H4MB 2CPDA 5EGYA 1T11A 4C7QA 2KHCA 3KWMA 1JLGB 2KVQE 3O6QA 3J7YU 4I6WA 4JYAJ 1UMJA 2QRRA 1WOSA 2OLWA 3SQGA 3MEDA 3M9OB 2ZNYA 2N7CA 3W2WA 4OI2A 4YR0A 1F2HA 1YJVA 1KS2A 3VQSA 4OJ3A 4F67A 1FTCA 2IM1A 3L95X 3KLHB 4ES2A 4PYDA 2FHKA 4ZP7A 3T6BA 1LFPA 1PG5B 2ASDA 4ZLNA 4DV5J 3PJ9A 1NSQA 2XS7A 4M95A 2YQ1A 4TXSA 2F63A 5J2MA 1S9GB 4IFVA 3HHEA 4YR2A 4IOBA 1JLAB 2XLJA 4U9RA 3W62A 1VC0A 3PRVA 4IQXA 2VBXA 3BBCA 1TVRA 1HBMA 2RKIB 4FXVA 4KKOA 5IFMA 4GRSA 2YH0A 1OPIA 1IKYA 1NPKA 5K9FA 2QLXA 3PTWA 4O3RA 3EXYA 4DLEA 3ZZOA 1RACB 5J1EA 3DLEA 1N33F 4N8OA 2AP6A 2A2DA 3GJSB 3JB9k 4FYWB 4OMFG 3KDNA 2VL1A 4M5JA 4HACB 4EU0A 4ED5A 3QBCA 4AUKA 2ZHBA 4PQUA 1QDUB 3ET6B 4K4ZA 3A3OB 4YEAA 1I94F 2GGPB 2PEBA 2DEIA 3OL9A 3M05A 1RT6B 3OSNA 3LANA 1RHMB 3LPEA 4UOHA 2O67A 3WZ0A 5JUMA 4A8SA 3OTBA 3DLGA 4J9RA 2XM3A 4NRUA 2OGUA 4C2MA 3IN5A 4N41A 1HNWJ 5B0CA 2CPEA 5EWFA 5A6WA 4Y2MA 4I2QB 4LSLA 3PFEA 1GQEA 5U47A 1EIYB 5CHCB 1X5TA 3PJWA 4C8OA 1FDNA 3M2VA 4UW2A 4L74A 1FRHA 5LOQA 4U7CA 2VC0A 3BF4A 3TZWA 5HQLA 2RT3A 3FMBA 4USMA 3H25A 3PVXA 5E2QA 1S0VA 1U6FA 3BM7A 2DNGA 4OYAA 2WZ1A 1MWQA 1C0TB 3HJFA 1S10A 2MJNA 3BBFA 3MAAA 4JI0J 2MEWA 1NK5A 1SC4B 2KFZA 1N5QA 4RU2A 3LAMA 4LIWA 3UFCX 1P9YA 2BZ2A 3KLIA 4DR4J 4PCQA 2J9EA 4IOAQ 3I32A 5KG3A 4BC9A 3MEGA 2E1CA 2QL5B 2LMIA 1D3WA 1XMQJ 2E5JA 3FSIA 3CT9A 1BGXT 2LQBA 2RILA 5H9EK 5A8WB 5K20B 3TA1A 4ID5B 5AE1A 4WE1A 3FSYA 3ZC4A 5B0BA 4LFCJ 3KG4A 2DR8A 3DM2A 3WBZA 2HYIB 4WXWA 2H48B 1RTIA 3TARA 3FC9A 3L7OA 2G0JA 3MZIA 5LXRA 2BJ1A 4DQPA 4FF2A 2Y1RI 4WWSA 2ACYA 2M7SA 1SJ3P 3AD9C 2V5HG 4X64F 4ZVSB 2A6OA 4KT0C 3B78A 3R5BA 3G8TA 1T9YA 1CJKB 2WRMA 4PQAA 1FKOB 2NXJA 2V68A 3LW5C 4NEYA 2YPYA 1XC9A 1TUGB 3T19A 4X62J 4FXDA 2AF6A 1LV5A 1NKCA 1VGYA 3LP0A 3M9NB 1LW0B 3UWTA 2DYAA 2RF2B 3NNAA 4NMXA 4CQ1A 3RRKA 3UR3C 2HMIA 4Z7YA 3CIMA 2A0FB 3FRZA 2JH3A 5E3PA 3GTYX 2B7CB 4XTTA 3A4TA 3G8QA 5C42B 3SDEA 4G65A 5IWAJ 4KBIA 3AY0A 2D3OR 2F9DA 5CAAA 4DSIA 3AQPA 2YNHB 2X7IA 4CO5A 1HNZF 3V6HA 3J80U 1A6LA 2D1CA 3O2IA 2ZH8A 2FJBB 1VRTA 1SKRA 2ZC4A 4O3NA 1RA7A 4ECWA 4NA2A 2A3JA 4FN5A 1N34F 3A8IA 4OHXA 2B4PA 3NG8A 2RQ4A 1S99A 4J9SA 4WP9A 4X4OA 1VQLS 1LWFB 4DV1F 2VQFF 4DX6A 2HBZB 2GS8A 4DR5J 3QJPA 3D28A 4OZJA 3MM8A 3TANA 4H4KC 1HW8A 1KFDA 3TEGA 3H5UA 1NH8A 1CS4A 3T9NA 4DS5A 3MCMA 2VG7A 5KFSA 2DK2A 2NUUG 2QFIA 2MSSA 4DX7A 4M5GA 2MYFA 4KYZA 1U1KA 4IH7A 2F8EX 3PX4A 4QWBA 2AEJA 2HGNA 2Z56B 2NZ4A 5B0FA 4B3MJ 1VQ4S 1T03A 5ETRA 5DM7Q 2L9NA 2X3DA 4JOUA 3MM9A 4K59A 4ZMMA 3VAMA 1QTMA 3H2VE 1NDPA 3V2UC 2BVZA 1T9XA 3JTOA 1B0PA 2ZM6F 5D6GA 3L9ZA 4ATNA 3OFFA 4A46A 1YBAA 5ETNA 1HMVB 2ABYA 5CCMA 4OX8A 4WYWA 3PHEA 1M1GA 2D7SA 1HFEL 2KFNA 3RAMA 3EGZA 3JYTB 5D8HB 2C3UA 4L6V3 1WWHA 5JMNA 2KJWA 3Q86A 3K5OA 1FCAA 2GIRA 1LNQA 5IT4A 1WG4A 2ZH3A 3PW5A 3I9ZA 5C24B 1KONA 2V69A 2MZRA 1JLQA 1FDBA 4Y2KA 4DUTA 4EI2A 4CLUA 4AYBD 3L3CA 1C0UA 2VOPA 4C8YA 2XSFA 2ASJA 4L75A 9ATCB 2CQCA 2OEJA 5A0YB 1IKVA 3T1YF 4OX9F 2VDIA 2AV5A 2RVJA 2CQ1A 3K8VA 3W2VB 2UUAJ 5IT9Y 4C4WA 3Q23A 4OYXA 1VLOA 3W60A 3RW6A 2A1BA 2PMHA 4W4MA 2GMJA 3CXCR 5CD4A 1FWLA 3SFGA 4OZLA 3D6FB 1MROB 4I0WA 2DNZA 2KT2A 3CJ0A 4NLXA 3ELHA 2KKHA 3V6DA 2B9WA 3AXKA 1UW9A 3G87A 2IJNA 2MMYA 4F3MA 3CCWA 3RTVA 2XCAA 3TQ1A 3TZXA 1VRQC 1L3UA 2NYIA 1O0PA 5EX3A 3G96A 2XHWA 1FFWB 1NAQA 2IM3A 3OTOJ 2J6SA 5KFPA 4PRFA 2X51A 3CUNA 3HLUA 4N56A 3J81j 3R9LA 2M0GB 2Z2MA 1MWZA 1UCNA 1S1UB 3GONA 3UD3P 1V3RA 4HDHA 4NRTA 2XMMA 3DCAA 5C7PA 1DHMA 5CYMA 2OUGA 4UOGA 4OLOA 2V4RA 2R4FA 5ETTA 3TWZA 2O3DA 2IBOA 3J7A1 1L3SA 1N5YA 4RNOA 1SKSA 1PAEX 1ZPVA 3W5YA 4DQRA 1ELOA 2H54B 2ZD1B 1L3TA 2CJKA 4Z2XA 1NCLA 3BO3A 4TY9A 4OHZA 2JEJA 1TK0A 1GAOA 3G6VA 3GR1A 3EZ5A 2HS3A 2W1BA 5J2NB 4F0HA 2J0SD 2PD1A 3BPDA 4MH8A 3BGRB 4RUCA 2FIUA 3N79A 4CNYA 1IXKA 5CXTA 4P71A 1NSKL 4HHJA 3CJTA 2XG8A 3M2UB 1SJRA 4ZCIA 2DR7A 2B9XA 3DHWC 3ZNUA 2BANA 1IWAA 4KPYA 2GFFA 2ROEA 4X4NA 1XBWA 1UWBB 1IKXA 4ENOA 2W2QP 4F3OA 4LVNP 1GH8A 1V6HA 3SV4A 5DRKA 2VA2A 4ZVFA 3M9MB 3Q24A 4ZOSA 3CPWR 2B6AA 2D3O1 1OMSA 1XR6A 2BKNA 3IA0A 3EPIA 1X4BA 3PXGa 4JP8A 1S6PA 4MFBA 3ETOA 4DV7F 1VK3A 3KLVA 4Y0FA 4Q8FA 5F8JA 2I8EA 3N6NA 4OV6A 3M2RB 1TL7B 5F9LA 4CNZA 2FJAB 4OX7A 5KOXA 4RWXA 5IOLA 4EBEA 5E3QA 4RPFA 2C3OA 3M8SA 2G13A 2OO4A 4DLGA 1LK7A 4FVMA 2DGTA 3F0NA 3NNCA 2KYXA 5ETKA 5KFTA 4UZBA 1K47A 3OUYA 2H1YA 2W7AA 1VQMS 2YX7A 4ECZA 3C6UB 4M5NA 4ZJLA 5D0HA 5E0OA 4USTA 2QC3A 2AHOB 1N33J 2WAQD 4HT7A 4ZPVR 5FDLA 3NS6A 3FBBA 2DXEA 2R8JA 3LF0A 5DDRC 2WW8A 3D6MB 1T95A 2J7WA 4ZVUB 4XK8C 4LMZA 1W2IA 2OEMA 4B9MA 1WC1A 4GKKJ 2FZGB 1O51A 3EICA 5IT0A 4TU8A 1TKDA 1YBTA 4C0OC 2XCPA 3GLJA 3MPYA 1R27B 1BE4A 5GVQA 4AD6A 1I3OB 2E5IA 1AW0A 1N48A 3W64A 3G82A 3SCIE 4AQYF 2I6WA 4DSJA 1K44A 1RTDB 2ILZA 4B9LA 2MKIA 4B9TA 4B08A 1X5SA 3M32B 1XNRJ 4PABA 1XMBA 5AXMA 1NB2A 1DQ9A 2AWZA 4XDCA 2Y8YA 3HX9A 3KG1A 1MW7A 3Q8PB 4H4KA 3QSIA 5KFJA 2YWEA 2XNRA 1KOHA 1B0TA 4RO0A 5E3AA 1VMBA 5DQGA 4IYQA 4RUAA 3UN3A 1S1TB 2CQPA 3A8JA 5L9XA 4OZ2A 3KK3A 2JEGA 5LMNF 3HZGA 3ZZ0A 2HS4A 1FNOA 5LSLA 4P73A 1OQ3A 4O3SA 1T94A 2CNLB 4RBUA 3WQPA 1WKKA 1Z4UA 3FDSA 3I4HX 1M90T 1BQMB 2MHEA 1I5OB 1Y11A 5ITHA 4ZVOB 3PW7A 2Y9HA 1EKRA 2LQ8A 3M4XA 3UDCA 3KHLA 2HFNA 3D1HA 5C5JA 4RX6A 2LLZA 4YDDB 1UZHA 1RAHB 5E3RA 2DCUB 2ZOGA 5H9FJ 3OTEA 1CPZA 2MKHA 2H5JB 3GQCA 4URQU 1QAJA 2CPFA 4OJ1A 1NB7A 1Q7YT 4YS2A 2MZSA 4QBUA 4G1QB 1WDTA 2DIVA 1XR7A 3P5BP 2G4BA 2CAJA 5C25B 2CQ4A 1A0OB 3MOZA 4DV6F 1E6YB 3K17A 6FDRA 2XGPA 2QL7B 4LVOP 3VALA 1HNVB 2GAHC 3ILOA 5KT2A 3RR7A 1RCOB 3N28A 4RZRA 5CYQB 3DRXA 3UCGA 3HHKA 3HK2A 2YKNA 3WHIA 4MIWA 3QRRA 2PDAA 3C15B 4RW6A 3AT1B 2RE1A 1N4LA 4DFKA 3FBFA 5D4OA 2W4CA 5K8NA 3HVWA 3OVBA 4NCBA 2QLFB 5M2PA 1X9SA 4EO6A 1TKZA 5CYJA 2VKZG 2W9AA 3SI8A 5LL6d 1VRUB 5FJ4A 1FA0A 3D3BJ 2ZFHA 1D9AA 5SUHA 2DY1A 2BJ3A 2VB6A 3CCLS 1IR0A 1BWEA 2KHDA 4Y34A 2E1AA 4RJVA 5HN0A 4JB8B 1SC1B 2YNIA 5A8RB 4ILRA 5I3UA 2Z57B 1U1NA 4ZCKA 3TUJC 1RZMA 2XNQA 4DR2F 3RB0A 5A8WA 3QRQA 4GC6A 3KLGA 1HL6A 3EVMA 3MR5A 2MQ8A 1RT3B 4U7UK 3U27A 4CTAA 2BACA 5FLXU 1WSRA 3HHNB 3KHRA 2GO9A 4DL5A 4DCOB 1YQHA 1NEEA 1YKWA 4QIFA 1L3KA 3TX8A 4I6YA 3MEEB 3GMGA 3N4WA 4YDXA 1HHTP 5DDQC 2KVIA 1S48A 2MJUA 1Y7PA 1RK8A 1TTHB 3DHXA 1HNZJ 5KFYA 4IG3A 3TO8A 3HPOA 2VIHA 4J9KA 4OJGA 2GHVC 1FE0A 5E3CA 4DSLA 1IUJA 2IY5B 1BD6A 2DNYA 4J9LA 2OIHA 1HBOB 4OI3A 1N34J 4EZ9A 1TMMA 2M2BA 1X9WA 2Y3YA 4PG5A 1VQKS 2K06A 2Y8WA 2B9YA 3DLLQ 1FKOA 2NXNA 4LF1A 2CFXA 4WPAA 3TAMA 2DEJA 4DV1J 4LSNB 4ZVRB 2KB2A 2BOAA 1U4BA 1ITPA 3LP2A 3FVYA 1S6QA 2V9WA 1QTNB 5B0EA 3NBPA 4F4AA 2QG9B 1TKXB 2ZUGA 2OI2A 4A8YA 1GMUA 2XB2D 2LCWA 2HWIA 2P8IA 1RT2A 4LQ3A 2YWGA 3C14A 1S5ZA 3Q8QB 3KK1A 1SBRA 4NLYA 1CSJA 3F73A 1JLEB 3MPWA 3PO5A 5KFIA 1JLCA 5DS7A 2PI4A 4ZA1A 3M6WA 4BLGA 2ATLA 3QWUA 2ASYA 1RTHB 5C42A 3TJ8A 5KFDA 1F9FA 1SI9A 1GXTA 1FFGB 1EX8A 2XZTB 3WDOA 3MCSA 3V81B 4F50A 1LFWA 5KT6A 4GKJF 2JL9A 1FJGF 4O23A 3SYZA 2GA7A 5DETA 2FHJA 4NXMF 1UVNA 4V19J 4QIVA 4YQWA 2XC9A 2DB1A 3DXSX 3ZO7A 3BDPA 1S7IA 4OI6A 5G0RB 1J5OB 2VA3A 4EBCA 5A6PA 4ELVA 5B7WA 1TV6A 2JX2A 4MK8A 4KY3A 2UV8G 2DJWA 2E66A 2KN4A 1UVIA 2IJFA 2XYPB 5H9FK 2LQJA 7FD1A 3KJFB 3ISND 3MAHA 3V6KA 4FZVA 3CVKA 1KLMA 4IUFA 4AE5A 3T1YJ 2ADBA 3MOJB 1R31A 4P2FA 2D74B 5EWGA 3MM6A 1RWWB 4I6AA 3NOGA 2JJ4D 3HHLD 1KQFB 3NCQA 3R7BB 4A8WA 4RW4B 4O0NA 2CJAA 2ZC3A 3RBZA 4RNNA 1Q8LA 4WK1A 3I56S 2C2MB 1O6XA 3RBXA 2DH9A 4AXJA 1U1QA 2CNKB 2HK2A 4FPIA 3VAJA 1RT4A 1HMVA 1DLOA 1E6VA 1WEZA 3MMAA 4K2XA 1NDCA 1X9MA 2V8HA 1P27B 4CLWA 4CLYA 1KTVA 5CA5A 3M8ZA 5HAOA 3C3LA 2NXCA 4HTIA 4D3GA 3NP5A 4C11B 2GHPA 2YKAA 3G4SS 4DPTA 4UQTA 1WEXA 3JSYA 3EX7B 1RTZA 4YP3A 1SJ4P 4LF6F 2ZBCA 5DGBA 2GJFA 3GYNA 2DNHA 2YNGB 2XBPA 2C2ZB 5A0YA 3CD7A 1YJTA 3S6EA 4B17A 2M4MA 4M8LA 3DYAA 3JAMU 5AXNA 1CC7A 2XMTA 3LO3A 2NPFA 2VODA 5AT1B 2J0QD 3R5GA 3RUBL 4KB7A 4NI2B 4PKDB 3UDEA 2WBMA 3DI6A 3ENWA 3CULA 2JLFA 4ZVHA 3CDAA 5GADI 1GMVA 4J9UE 4TLRA 3NGSA 4KGZB 2AIRB 1VI7A 3VZIA 2JRSA 4B9UA 2EBEA 2VDHA 1SH3A 3EJMA 4NLOA 2LA4A 1M5KC 4QU6A 4KGVB 1HPZA 1ZS6A 1IR2A 4IO1A 3V4MA 2JVRA 4UZCA 3DRRA 1QM9A 1YITS 5L8RC 2G9OA 3C2PA 1YWXA 2CWXA 2L9DA 4N77A 3MF5A 2AJ4A 2MTLA 2PMZD 3A8KA 2DTJA 4FYVB 1IWGA 1Q81T 2KL8A 1FK9A 1FWKA 2K7KA 4QR0A 3RYLA 4URGA 4YFUA 1WD6A 3RBEA 3MFIA 4DMZA 1G4CA 2OPRA 2NQPA 4O44B 2AKWB 4P2XA 1BXNA 2IBKA 2FJEB 3TUIC 4A8MP 3BGLA 4LF8F 3PYFA 2E5GA 1RU1A 2IPOB 3I96A 2MB0B 5DM6Q 4UT4A 3QJLA 2DPIA 4PXCA 2CNNB 4Y65A 1RA6A 3GR0A 1IVZA 4ZP8A 3OXLA 4OYOA 4TN2A 2HVEA 1RT1A 4DCJB 1K9MT 4ZS6A 3OTDA 4DZDA 3AQOA 2VPYB 3BH7B 3AAWB 1VLYA 1YZ6A 5ETPA 5D0GA 4RUHA 1LWCB 1SJ1A 4DPUA 4J7CA 1LWEA 5DDOC 3ZNJ1 2W9BA 1ACMB 3U02A 1TFYA 3DLKB 3OVAA 2MQOA 2F4FA 3SBMA 3QGHA 4ZP6A 2NXUA 2RMLA 3H59A 3P4UB 1U2RA 3OQ2A 3CJ8A 2DNLA 1U2CA 3CCMS 2NYHA 4I2PA 3NMAA 2V4JB 4ECRA 4I64A 3UR0A 2BABA 2AJ2A 2OP5A 2YBVA 5K5MA 4Q44A 2KG0A 1X5OA 3RRGA 1HWLA 2XY6A 1WC0A 1R8AA 2VFUA 5HMWA 2M9KA 2H5IB 4ZPDA 3KLFA 2GVDB 4WFAQ 4IFYB 1WHWA 1DRZA 3JXOA 2HFUA 1JLBA 4AQYJ 3IS9A 1B64A 3NLCA 1VBXA 2W25A 3PW4A 4FS2A 3PR4A 1PC4A 3V4IB 3VV2B 2M3DA 3RAXA 4Q0BB 2YKQA 1HWIA 1EETA 1YG0A 2I5JB 2ZKTA 2AZ1A 4OX6A 2FVQA 3CNQP 3TA0A 3VZHA 3S7RA 4OYIA 3Q83A 2RDDA 4YHHF 1RABB 3LAKA 5DLGA 2OKQA 1M5OC 4J9MA 2CQDA 4K4XA 5IXUA 3UD4P 3DRSB 4DF8A 4A8QA 3CJ4A 1SL0A 1WTBA 1PAUB 3IGVA 2XI2A 2QLWA 1DQ8A 1NZAA 2EVZA 2YWWA 2COLA 2VG6B 3CMAS 2N82B 3IAM9 3EZUA 1Q79A 2HWHA 1R8BA 3EE3A 2DGVA 1D9DA 3HSDA 4ZIVA 2V4QA 3KK2B 2EK6A 1OQ6A 2UXDF 3DKDA 3O1LA 1AROP 3TVZA 3VCDA 1KEKA 2HQDA 1TAUA 5ETSA 4C97A 2BX6A 1CJVB 1TELA 3KUEA 4YUDA 7FDRA 4RNHA 1VOMA 4JYAF 2M8HA 2LP4A 2BRKA 1VC5A 1XEZA 2N4CA 3M32A 3OTCA 1XMOJ 4DWIA 1KC8T 3F56A 2MKYA 2HNDA 1JNRB 5K8MA 4A4JA 3E01A 3MDFA 2KRRA 1YLXA 5GADU 1EZZB 3M30B 3R5AA 3BEGB 1RWMB 1DZ5A 5J1NA 1P1TA 3D68A 1VQ7S 4W90B 4I1TA 1Y5LB 8RUCA 4DV0F 2C42A 4EEYA 2K8GA 1M1HA 4CT8A 1GMWD 4KR0B 1UEKA 3LA0A 2JOQA 2DHGA 3HI9A 1RLCL 2HQ3A 4ETZA 3QPIA 2NXEA 1QUPA 4X4RA 3JSRA 3EVOA 5FIIA 4H4OA 4EYIB 4HEA9 5IM0A 1CQMA 2IMWP 3MHYA 3D67A 1UJ5A 1EP4B 2FB0A 2HNZA 2KU7A 2D9OA 2BKPA 2GW8A 2LKZA 4IDKA 2R42A 4R8UA 3HJVA 1IKWB 4DR2J 4WP3A 4ED8A 1HYSA 2CUYA 1OSCA 4ZPTR 4NLRA 4A8XA 1BQXA 5C25A 1SC6A 3AOBA 3V5RA 2WONB 3HCXA 1CBKA 3MURP 3WIUA 1JIHA 2IJRA 1D0EA 3U1NA 3OL6A 2VF3A 3HT0A 5K14A 5GMDA 4LRFA 4F4KA 2Q6BA 4QCLA 1HNVA 5B09A 4U8VA 1TK5A 2IYIA 4BWJA 2DNRA 2UXCJ 4MAKA 1HBNB 2Y0BB 2R7VA 1KSPA 1LW2A 2C2OB 3B4DA 1Q8IA 1GTHA 4Y28C 2HHHJ 3GJQB 2KI2A 3DOMA 3W65A 4LF4J 4ANDA 4DX8H 1FX4A 2DKOB 1FESA 3GFHA 1OO0B 3UNYA 3KLEA 3KJVA 3I0SB 1XTZA 1NJYA 4EWTA 5CH7B 3RBDA 1V3ZA 4E2FB 1FJCA 1BQNA 2V8VA 2GJIA 3D54A 4A8KA 1NJXA 1HQ2A 4LSZB 4QW8A 2K1RA 5C2GA 4CLKA 4DL7A 2GMLA 1CJUA 4AT1B 2DNPA 3TYTA 1YJRA 3QFHA 4KQZA 2NPIA 3OXGA 3OHAA 5F8GA 4OV1A 4JI0F 2JLEA 2OPPB 4NZ0A 1CULA 4QIGA 4MIAA 3IM8A 4YB6A 1KD1T 2OTJS 2LXIA 3MEEA 3VGVA 3EGWB 4DV3F 2L48A 1DJ0A 3MUMP 2RQKA 1GEHA 4PPZA 2KJVA 3CJ5A 4GKJJ 3UE2A 5KFWA 3IGNA 1FJGJ 1ZOTA 3DNCA 1RHKB 2G0IA 5KFZA 2MLZA 3W5XA 4NXMJ 3M8QB 1VQ8S 3RG6A 3PO4A 4M5DA 1YRTA 1H2VZ 3U1MA 3OT9A 5KFBA 2BMBA 5DQIA 1FDAA 5KFNA 2E1RA 3TP2A 1NK4A 2L41A 5GAGI 5DJBA 2DO4A 3DMJA 2RQCA 1S72S 2BJ8A 4RW9B 1SQFA 3CJRA 2DD8S 4KFBA 1NM2A 3TQEA 3NNHA
chains in the Genus database with same CATH topology
1ZS6A 2BEFA 1NSKL 3NGRA 2DYAA 1HIYA 1W7WA 2AZ3A 4F4AA 3ENAA 4DI6A 2AZ1A 1S59A 3Q86A 4EK2A 1NLKL 4S0MA 3EVMA 1NB2A 1NPKA 4UOFA 3EMTA 5CABA 1LEOA 1JXVA 3ZTQA 3Q83A 1VYAA 3FBEA 4C6AA 1S5ZA 3Q8YA 3FCVA 1MN9A 3FBBA 3ZTSA 3EM1A 4ENOA 2DXEA 4DUTA 1WKLA 3FBCA 3Q89A 1BUXA 2DXDA 3VGSA 3R9LA 1NDLA 3Q8UA 1KDNA 1UCNA 3FC9A 1WKJA 3ZTPA 3VGVA 4FKXA 2VU5A 1NDKA 4ANEA 2NCKL 3BH6B 3BBFA 1PKUA 3FKBA 5CAAA 3VVTA 3VVUA 1EHWA 3BBBA 4HR2A 2DY9A 1F6TA 2ZUAA 1B99A 4ANCA 3VGTA 1LWXA 5C7PA 1NUEA 2CWKA 4CP5A 1NSPA 3NGTA 1HHQA 1U8WA 3MPDA 4UOGA 1BHNA 3DDIA 3Q8VA 1NDPA 1WKKA 4O0NA 3EICA 3JS9A 3EVOA 1NHKL 1XQIA 2DXFA 3FBFA 3ZTRA 3EE3A 3PJ9A 3FCWA 1NSQA 3B54A 1F3FA 5BXIA 4ANDA 1MN7A 1PAEX 4KPCA 4W98A 3DKDA 1NCLA 4UOHA 1BE4A 3B6BA 4WBFA 1HLWA 1B4SA 3L7UA 2HVEA 3GP9A 2HVDA 3VGUA 4DZ6A 3ZTOA 2B8PA 5IOLA 4F36A 3ELHA 2HURA 3G2XA 1S57A 2BX6A 3NGSA 2B8QA 3EVWA 3WX8A 1XIQA 3ETMA 3BH7B 4FKYA 3GPAA 1K44A 1NDCA 3EJMA 3NGUA 3PRVA 3BBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS6 A;  2BEF A;  1NSK L;  3NGR A;  2DYA A;  1HIY A;  1W7W A;  2AZ3 A;  4F4A A;  3ENA A;  4DI6 A;  2AZ1 A;  1S59 A;  3Q86 A;  4EK2 A;  1NLK L;  4S0M A;  3EVM A;  1NB2 A;  1NPK A;  4UOF A;  3EMT A;  5CAB A;  1LEO A;  1JXV A;  3ZTQ A;  3Q83 A;  1VYA A;  3FBE A;  4C6A A;  1S5Z A;  3Q8Y A;  3FCV A;  1MN9 A;  3FBB A;  3ZTS A;  3EM1 A;  4ENO A;  2DXE A;  4DUT A;  1WKL A;  3FBC A;  3Q89 A;  1BUX A;  2DXD A;  3VGS A;  3R9L A;  1NDL A;  3Q8U A;  1KDN A;  1UCN A;  3FC9 A;  1WKJ A;  3ZTP A;  3VGV A;  4FKX A;  2VU5 A;  1NDK A;  4ANE A;  2NCK L;  3BH6 B;  3BBF A;  1PKU A;  3FKB A;  5CAA A;  3VVT A;  3VVU A;  1EHW A;  3BBB A;  4HR2 A;  2DY9 A;  1F6T A;  2ZUA A;  1B99 A;  4ANC A;  3VGT A;  1LWX A;  5C7P A;  1NUE A;  2CWK A;  4CP5 A;  1NSP A;  3NGT A;  1HHQ A;  1U8W A;  3MPD A;  4UOG A;  1BHN A;  3DDI A;  3Q8V A;  1NDP A;  1WKK A;  4O0N A;  3EIC A;  3JS9 A;  3EVO A;  1NHK L;  1XQI A;  2DXF A;  3FBF A;  3ZTR A;  3EE3 A;  3PJ9 A;  3FCW A;  1NSQ A;  3B54 A;  1F3F A;  5BXI A;  4AND A;  1MN7 A;  1PAE X;  4KPC A;  4W98 A;  3DKD A;  1NCL A;  4UOH A;  1BE4 A;  3B6B A;  4WBF A;  1HLW A;  1B4S A;  3L7U A;  2HVE A;  3GP9 A;  2HVD A;  3VGU A;  4DZ6 A;  3ZTO A;  2B8P A;  5IOL A;  4F36 A;  3ELH A;  2HUR A;  3G2X A;  1S57 A;  2BX6 A;  3NGS A;  2B8Q A;  3EVW A;  3WX8 A;  1XIQ A;  3ETM A;  3BH7 B;  4FKY A;  3GPA A;  1K44 A;  1NDC A;  3EJM A;  3NGU A;  3PRV A;  3BBC A; 
#chains in the Genus database with same CATH topology
 2M88 A;  3TI0 A;  1U1O A;  4PUO B;  1OWX A;  2LEA A;  1W7W A;  1WUU A;  2F9J A;  1RQ0 A;  2CPJ A;  1PYS B;  5F41 A;  3C66 A;  2MXY A;  4L76 A;  2YY3 A;  1DTT A;  2RNE A;  2IYG A;  2HZA A;  4ZPB A;  4B3O A;  2KDO A;  4NWB A;  1JLE A;  3EM1 A;  1HNX F;  1BUX A;  3BKU A;  1IBK F;  4U8Y A;  1FI4 A;  4LR9 A;  4ZIW A;  3GE9 A;  4YY3 F;  3QLH A;  4ETX A;  1JJH A;  3VVU A;  4QWD A;  1R43 A;  4X4U A;  3HUL A;  4NOH A;  5DGA A;  3DDI A;  4CI0 B;  1Q4R A;  5HQ8 A;  3B54 A;  2F65 A;  4KO0 B;  1NK0 A;  3QGP A;  4HDG A;  2WSC C;  4ZKA A;  1IJF B;  2HVD A;  3OSP A;  2GQQ A;  3I87 A;  2AEF A;  1T7P A;  1R0A B;  4U7U D;  3FEX B;  2Y1J A;  4K4Y A;  3BSO A;  2FPH X;  3OR2 A;  2UP1 A;  2BJE A;  1Q95 G;  5IQQ A;  1VQN S;  3PW2 A;  5L38 A;  4K0K F;  3H4D A;  5G0R A;  1HQE A;  2QV6 A;  1WSV A;  1S1X B;  2VBY A;  4J37 A;  3EPG A;  4X4Q A;  1X4D A;  2DR9 A;  2IRX A;  4NXN F;  2OFH X;  2G0C A;  2QA2 A;  3M8W A;  1AA1 B;  3ZZP A;  2EC2 A;  4LF6 J;  1C1B A;  4LBH A;  1FRX A;  3NXZ A;  3FCV A;  4OLP A;  3OHB A;  4PR6 A;  4WU2 A;  1Y3J A;  3ENV A;  3A13 A;  3JSM B;  3CO9 A;  3LP1 B;  2ZBP A;  1FXR A;  4CO3 A;  2IC3 A;  4WK3 A;  4QJV A;  2WSF C;  2YWF A;  5KOW A;  4RW4 A;  1N88 A;  2ADC A;  3TA2 A;  1AB8 A;  3G86 A;  1FVQ A;  1F5B A;  2PFD A;  4ZHR A;  4KPC A;  2XS2 A;  1FJ7 A;  1VS3 A;  4O3Q A;  3KTQ A;  1U0H A;  2RUG A;  1FHT A;  4DQI A;  2B4V A;  4QPX A;  4DR5 F;  1YHQ S;  2FYX A;  3DGP B;  2DR6 A;  3K57 A;  2LU1 A;  1ZAV A;  2IVF B;  3T1A A;  1M1K T;  5HMZ A;  4NZ6 A;  4WJB A;  4JV5 F;  1KQK A;  2MGZ A;  2HAI A;  2CNO B;  2CQH A;  5J2P A;  1QVF R;  5T41 A;  3C8Y A;  2AJ1 A;  1N52 B;  2V9K A;  2RH3 A;  1RAE B;  4FF3 A;  4Y3C A;  1TL3 A;  4C6A A;  1DAX A;  2OHD A;  2HFZ A;  3M8P B;  4BCA A;  4E0D A;  4WYL A;  4KIA A;  2J6T A;  3GJR B;  3CJ3 A;  4J9Q A;  1NSA A;  1LWX A;  3J80 Y;  2NR0 A;  3B8H A;  1ZM4 A;  2QJ3 A;  2XSJ A;  3SFU A;  4I69 A;  4C8M A;  4TNO A;  3CJQ A;  3QYY A;  1M5S A;  2VZ9 A;  4RU9 A;  3KMS A;  2ZIT A;  1NJZ A;  2VBZ A;  3GSI A;  3TUP A;  2H51 B;  1S1V A;  1D1U A;  2RJZ A;  1FKP B;  3DOL A;  4ZDN A;  5F0U A;  2FLO A;  4DCP B;  2OPQ B;  3MM5 B;  1PYO B;  5KFO A;  2JDJ A;  3HVT A;  4NA1 A;  1JX4 A;  2UV8 A;  4LF9 F;  2XY7 A;  1WEL A;  4WFN Q;  5GAG U;  2JHE A;  2AYE A;  5L1L A;  4OYB A;  1U0S A;  1N32 J;  3HSG A;  3D66 A;  1H3D A;  2O1P A;  4ALZ A;  4MK7 A;  2HBY B;  3OLB A;  5HP1 A;  3GWC A;  1S1W B;  3ZXW A;  4ZK7 M;  1PKU A;  4M63 A;  4P52 A;  2QMW A;  1XER A;  2EPI A;  4PWD B;  5E41 A;  4ECV A;  2HHV A;  1QD1 A;  1N6Q B;  5HI7 A;  1BHN A;  2R7U A;  1PJ5 A;  2LQ9 A;  4RR5 A;  3GG1 A;  4CM2 A;  2KO1 A;  1QLN A;  1X4G A;  1I6J A;  1SL2 A;  3VAK A;  1WI6 A;  4FNH A;  2YVS A;  4ZPA A;  4NCG B;  3R6L B;  2R8H A;  2XUL A;  1KBR A;  3AJ1 A;  3HSZ A;  3MMB B;  3IRX B;  2AYM A;  4LBP A;  2DGX A;  5HK4 A;  4RBV A;  3PRD A;  4DV4 F;  4F36 A;  3SCK E;  3PY8 A;  2EFV A;  2HUR A;  5KG6 A;  1PYT A;  2MKS A;  2XWY A;  5LJ5 Y;  3ULH A;  1LQ9 A;  4ID8 A;  2HKE A;  2MDA A;  3OTO F;  3SIP B;  2GCF A;  3K58 A;  2CXE A;  1S59 A;  4YHH J;  1REV B;  2F4V F;  3KYL A;  3C6T A;  3CME S;  4EGL A;  4ZCL A;  1FNM A;  1HWJ A;  3CCJ S;  4DN0 A;  4AL5 A;  4DOZ A;  4F4X A;  1Y00 A;  3DU5 A;  3P3D A;  3H7H B;  1TAQ A;  4FP9 A;  4Z7C A;  4HH0 A;  3HKW A;  3E8O A;  1VBZ A;  1X4E A;  3DOK A;  2MQM A;  4JV1 A;  1SQG A;  4F8R A;  1ZZN A;  2UXD J;  3GFZ A;  3H40 A;  4NX9 A;  2XGQ A;  1WJ9 A;  2GVD A;  2LYV A;  2XY5 A;  6AT1 B;  3B6B A;  3QO9 A;  4B02 A;  1T02 A;  5T7L A;  1EQ0 A;  3K5L A;  2FZK B;  4FKY A;  4LFA F;  1U1R A;  3NGU A;  2WOM A;  2QIF A;  2ZH5 A;  1QE1 A;  3PDN A;  1VQY A;  3NS5 A;  5KG1 A;  5DLF A;  1O8B A;  3V4I A;  4GVB A;  2Z2L A;  2IAJ A;  4ZVE A;  2I5J A;  1URR A;  2GIF A;  1UET A;  2A2C A;  3R7N B;  1MG7 A;  3B4M A;  1NPR A;  1GXL A;  2J8S A;  2QYG A;  4DX5 A;  1EB0 A;  4CZC A;  1TKT A;  2AW0 A;  1MWY A;  4TU7 A;  4B3S F;  4DV0 J;  3KNA A;  4RLE A;  1VDH A;  1MMN A;  4DR7 J;  4NLQ A;  3C19 A;  1WG5 A;  3G9C A;  1KP6 A;  1CQN A;  3LQV A;  4G1P A;  2YTC A;  4OZ3 A;  4WZM A;  3BBB A;  4AL6 A;  2F1F A;  1SH0 A;  3ZZY A;  4A8F A;  2I0X A;  3RW7 A;  3CGI A;  3OJU A;  5EDW A;  4K4V A;  1G1X A;  3J81 U;  2BR0 A;  3BGO P;  1U1L A;  1TUV A;  4IRK A;  1YDL A;  3IG1 A;  2W4P A;  2HNY A;  1YJU A;  5J1P A;  3MUT P;  3CD5 A;  2R2R A;  3PZP A;  2W01 A;  2DGW A;  2E1P A;  3NMR A;  1DTQ A;  3FFI A;  2A6M A;  3P5T L;  4LUB A;  4K8R A;  3BGF A;  1W26 A;  2ALY B;  2VV5 A;  3HVR A;  3D1O A;  2RHS B;  2V2V A;  3ISZ A;  1QSY A;  1LEO A;  4CYU B;  1SUQ B;  2FC8 A;  3ITH A;  3M30 A;  1F60 B;  4TQS A;  2H65 B;  2DHA A;  3FBC A;  3MR3 A;  4GKK F;  3M1V A;  1NDK A;  3SQG B;  3MED B;  3LGH A;  2PFF B;  5HVG A;  1S97 A;  2AYB A;  3BO2 A;  4MYT A;  4QIW D;  4PZV A;  1NSP A;  2IM0 A;  3CSK A;  3W2W B;  1EJ7 L;  4GO5 X;  1FWP A;  3CTR A;  3HZE A;  2X1F A;  2VJV A;  3QT8 A;  5F8L A;  4FYX B;  2UXB J;  1RAD B;  1WHV A;  2OEL A;  1GXU A;  2PA3 A;  3PR5 B;  4A47 A;  2K3I A;  1DAR A;  1VJQ A;  1EP4 A;  3SZ2 A;  2QMU B;  5D3G A;  1XNR F;  4DV2 F;  3NS7 B;  1H73 A;  4KHR A;  5IV3 A;  2XHC A;  3CCS S;  2CJ9 A;  3KHG A;  4ED1 A;  3KOA A;  1IBL J;  4DG1 A;  1IKW A;  4N7T A;  4I7F A;  3TEH B;  2JFD A;  5J2M B;  5EWE A;  3NGR A;  4IFV B;  2GX8 A;  2DH7 A;  2M8D B;  4F02 A;  3KJN B;  3CCZ A;  2EK1 A;  4NYO A;  2YX4 A;  2AX0 A;  3N6L A;  1VC6 A;  5HMY A;  3AHP A;  1TVR B;  1JKH B;  1VQS A;  2RDI A;  2OSQ A;  1HBM B;  4DHV A;  3MD1 A;  2E9T A;  4KKO B;  3JQM A;  3Q22 A;  4DV3 J;  2XMJ A;  1IKY B;  4USJ C;  2HFV A;  1S9E A;  1OIA A;  1S49 A;  2DNM A;  2NCK L;  1WNE A;  3L4B C;  4WFX A;  3FZB A;  5J1E B;  3DLE B;  1NJW A;  3NGT A;  1LXN A;  2MKK A;  2AJF E;  1WC4 A;  1R7I A;  4MK9 A;  1APS A;  4N76 A;  5ETV A;  3Q0A A;  3WC2 A;  4DEZ A;  3MCN A;  1U7L A;  3W63 A;  2B5J B;  4PQU B;  1Y5I B;  1KOO A;  4F7V A;  3I0S A;  4NLU A;  2YKM A;  3SEO A;  1X0P A;  1EQM A;  1HQU A;  1LK5 A;  1KN6 A;  3LWL A;  3QFW A;  2R3V A;  4OL8 A;  3SCL E;  3RB4 A;  3DLG B;  4DR3 F;  1J2V A;  1VJW A;  2XO6 A;  4KV8 A;  4NZ7 A;  3ISN C;  3OR1 A;  2HLT A;  3ZTQ A;  4IKA A;  1HNX J;  4HH1 A;  2CJY B;  3UVJ A;  1IBK J;  5F8N A;  1A9N B;  2VPZ B;  2MKJ A;  2UVW A;  3M2V B;  2VFV A;  4YY3 J;  1C1C A;  4LBI A;  2HQC A;  3HHL C;  9RUB A;  4WFZ A;  4JI4 F;  1FVS A;  3UI3 A;  1U02 A;  1ZM9 A;  4UQG A;  4QR2 A;  3RJM B;  2DO0 A;  2HRT A;  4Y2C A;  5GAH I;  2HBR B;  5M2R A;  3FCW A;  3M8Q A;  3MAA B;  2AGP A;  1B7F A;  5JJB A;  4LR7 A;  3F41 A;  4DL6 A;  1Q8B A;  2QT7 A;  3EDR B;  4LT6 A;  2UVR A;  3GIM A;  4K0K J;  2B4O A;  2FLL A;  3WX8 A;  3VAI A;  3KLI B;  1V9O A;  4UY8 T;  5HBM A;  4ECT A;  3LGN A;  3QZ7 A;  1HIY A;  4NXN J;  1YIJ S;  3MEG B;  1SQE A;  5D0R A;  4TYB A;  4QWE A;  1F9H A;  3IBW A;  5HRO A;  3C16 A;  2KZM A;  1U1P A;  3ZTS A;  3UN2 A;  4CLP A;  3TZY A;  4QYZ J;  4ECQ A;  4C3M A;  4WE1 B;  4M5I A;  1RWO B;  1SVD A;  4F0M A;  3BQ2 A;  2PN6 A;  1UJ6 A;  2CQG A;  2W8L A;  3DM2 B;  2ZH7 A;  5KFL A;  1RTI B;  2KG1 A;  1CC8 A;  2AX1 A;  2EG1 A;  2DHH A;  1PIE A;  2VAS A;  4W98 A;  3QT7 A;  1RT5 A;  4N47 A;  4ZP9 A;  5DDP C;  4DPY A;  1SV5 A;  3CCT A;  4U6P A;  1RU2 A;  3H2U B;  1OYE A;  5IZH A;  4JV5 J;  2P9G A;  5LT5 A;  1OJ4 A;  3FQL A;  2UVV A;  2EFQ A;  2BBE A;  1Z2L A;  5IC4 B;  1P1L A;  3LOU A;  5GAE U;  2W9C A;  1U24 A;  4ICL A;  3HKZ D;  4PG4 A;  4KTQ A;  2HVH A;  2HW3 A;  3G71 S;  3EWG A;  4EK2 A;  4E98 A;  5FLX Y;  4I4B A;  4LF5 J;  2BW7 A;  4R25 A;  2Q6C A;  2BOP A;  3LP0 B;  5A8K A;  3P96 A;  2R7Q A;  2GC8 A;  2NSC A;  1WAC A;  2V6A A;  1ZM2 A;  1RXO B;  4UOC A;  3BO4 A;  1KDN A;  4IH5 A;  3KJQ B;  4FKX A;  2VU5 A;  2IHR 1;  2HMI B;  5JVH Q;  3ZZR A;  3I5B A;  1RWK B;  3LP1 A;  2XMW A;  4CP5 A;  2FQQ B;  2FVP A;  2E9Z A;  1Q86 T;  2UUW A;  3SDE B;  4EYH B;  4RL1 A;  5B0G A;  4MKY A;  4WKR A;  1JLF A;  3T5H A;  2EI5 A;  3POT A;  2GQC A;  2M70 A;  4JI8 F;  2H3E B;  2BA9 A;  2HAF A;  5KT3 A;  3EVW A;  1VRT B;  2ALZ A;  2RU3 A;  1KFS A;  2ZZN A;  4LF9 J;  2BEF A;  2ZE2 A;  2EEY A;  1RIS A;  2GVZ B;  1UVJ A;  4LIR A;  4ZVQ B;  3O44 A;  1VIO A;  3CIZ A;  3GYX B;  1JXV A;  2LA6 A;  4I56 A;  3DLH A;  1DUR A;  2E5L J;  3QGI A;  4NAS A;  4RW7 A;  2KZZ A;  4AFF A;  2EWH A;  4M1K A;  1BLU A;  1PIL A;  2QSW A;  3Q8U A;  1HBU A;  1D9F A;  1X5P A;  4OYP A;  1V5V A;  2BE9 B;  5HLF A;  2DH8 A;  3MPU B;  2O66 A;  3NAH A;  1WDD A;  3MMC A;  2ZUA A;  2VG7 B;  1JJ2 R;  5D78 A;  4ZPW R;  1T05 A;  3I0R A;  1T3N A;  1GX5 A;  1T03 B;  4WXO A;  3MTK A;  1MN7 A;  2W4D A;  2R2U A;  4CCH A;  3FCH A;  4FBU A;  2ZDO A;  4DV4 J;  2BM0 A;  3MM9 B;  3QIP A;  4ECX A;  5I3P A;  3VGU A;  2OAU A;  1X4F A;  2KYZ A;  2EKY A;  5GAH U;  5E5N A;  4ELU A;  3AJD A;  3CJK A;  2C22 A;  2HQF A;  3EZO A;  2KTQ A;  3IXQ A;  1RYS A;  3THP A;  4NYP A;  3HD2 A;  5A2Q U;  2F4V J;  2YNF A;  1K1Q A;  2JWN A;  1WHY A;  4IRC A;  4KC5 A;  4YB1 P;  2UUB J;  2FC9 A;  2BJ9 A;  1B70 B;  4USH A;  1MN9 A;  5LMU F;  2PMW A;  1VFJ A;  2DXD A;  3MPV A;  1YJN S;  2HHU A;  1XN9 A;  1S1W A;  2J5A A;  2QFJ A;  3PYG A;  2OEK A;  5AJ3 F;  1N54 B;  3K89 A;  3BN4 A;  2DNK A;  2IM2 A;  1VQO S;  4L73 A;  4Q8E A;  2XZD B;  1C0U B;  1IN0 A;  1VBY A;  4QYZ K;  4V19 X;  1IKV B;  1PC5 A;  4U96 A;  4ECY A;  2BQU A;  1YJ7 A;  5CCL A;  2CVE A;  1S6U A;  4DZ6 A;  4O3O A;  4LFA J;  3DGV A;  2VON A;  4QWC A;  3O8W A;  2XTJ P;  4PG6 A;  3A8E A;  3FQK A;  2MKC A;  2ZZM A;  1FRJ A;  3DU6 A;  1UJ4 A;  3V6D B;  2OJ3 A;  1XJW B;  3WIV A;  2R7X A;  3E3X A;  1G6B A;  2RSQ A;  1REV A;  4B3S J;  3IM9 A;  3IFE A;  3CC4 S;  2E9R X;  2R8I A;  1X7V A;  5J2Q A;  4K50 A;  2IRU A;  3AXM A;  5IS2 A;  1HHS A;  3J7Z T;  3P49 B;  5KAK A;  1AZS A;  3BH6 B;  5CZX A;  3JAM Y;  3VQT A;  5K8P A;  3HHL A;  4TYA A;  1PJ7 A;  1Y0H A;  2JEI A;  4PWW A;  1FTR A;  1UVM A;  2D69 A;  1AYE A;  2BE2 A;  2CQI A;  2F5G A;  3I6P A;  4F4Y A;  2OPS A;  4KHP F;  3I31 A;  3NCR A;  4H4M A;  2M5Y A;  3C46 A;  4K4U A;  2J9D E;  1JLG A;  2RUS A;  4C98 A;  1N5Y B;  2DVI A;  4O4G B;  2XO7 A;  2PEH A;  4DPW A;  3PV8 A;  1FFS B;  4UY8 5;  3I5C A;  4O0I A;  2AU0 A;  2DBB A;  3IC1 A;  2HBQ B;  2ZOM A;  3MFH A;  3Q2T C;  1YTY A;  4ER8 A;  1KKH A;  4KGX B;  2J6U A;  2N3O A;  3IRW P;  3KLH A;  1YK9 A;  3VR1 A;  3DXB A;  4RWW A;  4NLP A;  1U45 A;  7AT1 B;  2CPI A;  1K8A T;  3THT A;  3PX0 A;  5LXY A;  5EHH A;  1XR5 A;  2BAN B;  3CED A;  3OVS A;  1JXL A;  4ANC A;  3HP6 A;  1MLA A;  2Z8Q A;  1IKX B;  1S9G A;  2D3U A;  2ZJR Q;  1JLA A;  2ZEJ A;  2Z58 B;  4HTJ A;  2ACM A;  3R27 A;  2B6A B;  1WHX A;  4HLB A;  1Q82 T;  4RUB A;  1ICE B;  2BUN A;  4DV2 J;  2RKI A;  3ZTO A;  4RBT A;  4L3N A;  2DRD A;  4QPT A;  1S6P B;  3PEH A;  1Y4Z B;  4MFB B;  4J9O A;  2I38 A;  1R0C B;  3R1L A;  3BJY A;  3DRP B;  3PRB A;  1R0B G;  1ZTT A;  2DRA A;  2FJD B;  3RB6 A;  4ED0 A;  2L9W A;  4H54 A;  4OHW A;  3PYE A;  3TNV A;  1U49 A;  4PXD A;  1FRL A;  3PFO A;  1HD1 A;  4EO8 A;  1RGV A;  5JXS A;  4HAC A;  1VYA A;  1X4A A;  3N5B A;  3CDE A;  2VJU A;  3OUY B;  3X1L B;  3ET6 A;  3D6H B;  5F9N A;  1M5V C;  4L3K A;  2GGP A;  3TJA A;  3WX4 A;  5F3T A;  2NZC A;  5L1I A;  4ZN3 A;  5KG5 A;  1RT6 A;  4PXB A;  1R8P A;  2VIC A;  4B3T F;  4QOT A;  5FDL B;  1X8D A;  3UW1 A;  4FF4 A;  2QLB B;  4X4S A;  4CRJ A;  4Q43 A;  4LR8 A;  1UPM B;  4DJB A;  4K4W A;  4ZVG A;  1U09 A;  1GK8 A;  2NSB A;  1JMT A;  5KFQ A;  4NA3 A;  4Q7A A;  4I2Q A;  2C3Y A;  3N5F A;  2C3P A;  2QMX A;  3DDN A;  1XMO F;  1JQG A;  3K7R A;  1PSD A;  2CPY A;  2C2K B;  1R6Y A;  4J9P A;  2CIM A;  3ADA C;  1YX2 A;  2HHS A;  1YZ7 A;  4DR3 J;  5KFX A;  4USW A;  2E7X A;  4PG8 A;  3UO0 A;  3B82 A;  3GB0 A;  4OIX A;  5ADZ A;  1SL1 A;  1FEH A;  4UOF A;  1MU2 B;  3G82 B;  2Y1I A;  2D3Z A;  1FRI A;  3HVA A;  1C0T A;  1Q16 B;  1FD2 A;  2RRN A;  1CJT B;  1KHW A;  1JKH A;  1HWK A;  5HVH A;  3SSQ A;  2P6S A;  2BJ7 A;  1EKS A;  4JI4 J;  3UDL A;  2CQB A;  2W2N P;  2CDR B;  1Q5V A;  1S0M A;  1U8W A;  1M5P C;  2LDI A;  2J9D A;  3FRY A;  1NHK L;  2MY7 A;  1DQA A;  2QLJ B;  1F3F A;  2U1A A;  2V94 A;  4JI1 F;  5ETQ A;  2B5J A;  1VBK A;  3KK3 B;  2CQ3 A;  2PGC A;  3HSJ A;  1NBE B;  4QIE A;  5B0A A;  1ZH5 A;  2GO8 A;  1WC3 A;  2JSX A;  2MZT A;  3HDS A;  1NO8 A;  4ID5 A;  3BYR A;  4X4P A;  2FTR A;  3T9Z A;  1D09 B;  1NK8 A;  3FEZ A;  1X60 A;  3K5P A;  2CJX B;  1QSL A;  3D0I E;  3RRH A;  4A48 A;  2WVD A;  2V63 A;  2LDY A;  1F9E B;  5MLC V;  5KG0 A;  2UXC F;  1RBA A;  3CB4 A;  3MM7 B;  1RLD A;  4R0J A;  4MKV A;  2MPU A;  3CDB A;  3G6X A;  2KRB A;  4B3R F;  2RS2 A;  2HHH F;  1UFW A;  2V34 A;  2WW4 A;  2NLW A;  4LF4 F;  1CJK A;  1HWU A;  3N0V A;  4WU3 A;  5ETO A;  2GZO A;  3QAU A;  1NPP A;  3GSD A;  2O5D A;  2BQR A;  1N5S A;  5DQH A;  1U8S A;  1N36 J;  3GJT B;  5ETL A;  1LW0 A;  2YKN B;  4HI2 A;  2RF2 A;  4LF2 A;  4RW6 B;  4DFM A;  5L39 A;  4OQJ A;  2F3J A;  4NLS A;  3H4B A;  4X84 A;  1WOR A;  4Y2I A;  2ERR A;  5DZ7 A;  3PW0 A;  1TKZ B;  3HFV A;  3PAC A;  5SZT A;  4C8K A;  1CLF A;  4ZLP A;  5IV4 A;  2H4Y B;  4DL0 C;  2NS1 B;  2YNI B;  3PKY A;  3TW0 A;  5I3U B;  2VFT A;  2HK3 A;  2YNH A;  3CC2 S;  4KAI A;  3UNG C;  2BRL A;  2SXL A;  1RCX B;  3KLG B;  1HAR A;  1RAI B;  1GMW A;  4J5O A;  3ZZT A;  1KNZ A;  3ZTP A;  2CAD A;  3J7Z 5;  4CTA B;  3D9B A;  1F6T A;  1P9Q C;  2JLG A;  3TX0 A;  2WCX A;  1U47 A;  2KT3 A;  1HI8 A;  4GO7 X;  4JI2 F;  2CZ4 A;  1LWF A;  3IWL A;  3SMZ A;  2Z30 B;  4JI8 J;  4IG3 B;  3GG0 A;  4JI3 F;  2VHG A;  4C8Z A;  2I9S A;  4BHQ A;  3BKT A;  1FNX H;  1IBM J;  2UUC J;  2DR5 A;  2J7K A;  2KFY A;  1JJ4 A;  4QQB A;  3NWG A;  1QVG R;  2DNO A;  1N8R T;  1WTF A;  1FKA F;  3Q2S C;  2W24 A;  3CWJ A;  4I68 A;  2J76 E;  4JI7 F;  3TAM B;  1J5E F;  3W8G A;  2QTW A;  4MT1 A;  3TOQ A;  3M8Y A;  3LP2 B;  4ECS A;  3DFE A;  1UWA A;  1S6Q B;  3UPF A;  2EW9 A;  3NBP B;  4LRC A;  1UTA A;  2HSE B;  2QL9 B;  1QJH A;  5BR8 J;  3UD5 A;  4DL2 A;  5KTQ A;  3FKB A;  5CD4 H;  2RAQ A;  1RT2 B;  2XLI A;  3R5J B;  3C14 B;  3HM9 A;  4IR9 A;  3KK1 B;  8AT1 B;  1AFI A;  1RT7 B;  1JLC B;  1NU4 A;  3S8S A;  2FHO B;  3H90 A;  3TUZ C;  4U67 Q;  5KT4 A;  2B3T B;  4MMO A;  3QQC D;  3JYT A;  3WC0 A;  3RR8 A;  5KFC A;  3NKY A;  1KLN A;  3A12 A;  2QN6 B;  2WB1 D;  4ZN1 A;  3HT3 A;  4KRW A;  2R7T A;  4C0H A;  3CJ2 A;  5C24 A;  2E5H A;  2RS8 A;  1REG X;  3H0P A;  1H2U X;  1NK9 A;  2GVZ A;  3T1H F;  3OV7 A;  4DSE A;  1SIZ A;  2VPX B;  4LF7 F;  4DUY F;  1L3V A;  3J7A N;  4B9V A;  1OY8 A;  5LMU J;  4YR3 A;  5KFK A;  1SH2 A;  3KNG A;  2MLX A;  3GIJ A;  3W2V A;  2ZKU A;  2PII A;  1WKL A;  2N4D A;  1TV6 B;  3MR6 A;  4USU A;  5L1K A;  4F4W A;  3FEY B;  5AJ3 J;  1KHV A;  1B99 A;  1MRO A;  4CH0 S;  5HMX A;  1WF0 A;  1NKE A;  4CLS A;  1KLM B;  3NY0 A;  3QJJ A;  4X66 F;  5GME A;  5D77 A;  2V67 A;  4HL9 A;  1O5J A;  3MM6 B;  1RBO B;  2P9E A;  3BGU A;  3GIR A;  3GCX P;  1HR0 F;  3A3P B;  1NRK A;  3FJ2 A;  2LEB A;  4ZPC A;  3TJ9 A;  2IVM A;  2RDJ A;  3DN9 A;  3QRP A;  2QEX S;  1S57 A;  2BXJ A;  4KSE B;  4DR6 F;  2LVW A;  1IQZ A;  2YQ3 A;  3RB3 A;  4IQM A;  3D2W A;  1Q7L B;  2VKR A;  2DIU A;  3I55 S;  2N3L A;  1XNQ J;  2HHX A;  2VFS A;  1RT4 B;  4M5H A;  1T9W A;  1DLO B;  1E6V B;  3M6X A;  5HAN A;  3MMA B;  2VD3 A;  1S1U A;  5IC6 B;  4YN3 B;  4DDF A;  1QAX A;  2POK A;  4ZVP B;  3H5Y A;  3IMQ J;  1CVJ A;  4MKB A;  1P6T A;  2F8H A;  2P5V A;  3T6J A;  4FS1 A;  2ZJQ Q;  1BY9 A;  2I2Y A;  5THW A;  4P2S A;  3HO1 A;  3HHD A;  2ZD1 A;  2H5E A;  4DUZ F;  4NLW A;  5LSR A;  3PCO B;  3FUY A;  3M7V A;  5J2N A;  4KHP J;  1H72 C;  2DNQ A;  3BB5 A;  2DXF A;  1VHI A;  1ULR A;  2G2Z A;  3BGR A;  4DFP A;  3M6U A;  1YJW S;  4KH1 B;  1TU0 B;  3DYA B;  1B4S A;  2EFP A;  2CRL A;  3M2U A;  2K2P A;  3JSB A;  2ZH6 A;  2HGL A;  1UEU A;  2C2E A;  2AJQ A;  1GX6 A;  3BSC A;  2BDP A;  3W9I A;  2CPH A;  4JI6 F;  1PCA A;  3QT6 A;  2EFN A;  1UWB A;  2LEC A;  3DI6 B;  1RAG B;  1N32 F;  2WB4 A;  1VQP S;  4DI6 A;  2UZA A;  2K7J A;  1AFJ A;  4UTG A;  2R8K A;  1IR1 A;  5GMK a;  3D7S B;  3LH2 S;  4P6Q A;  1Y3K A;  4IG0 B;  1RHR B;  1HPZ B;  4PG7 A;  1QY7 A;  4Y00 A;  5KG4 A;  1H38 A;  3DRR B;  3N01 A;  5D4P A;  2DRB A;  1FER A;  5HJY A;  2LFV A;  5CQG A;  3MEC B;  4OHY A;  2BJD A;  1RAF B;  4P9S A;  1F0X A;  4HR2 A;  2FLN A;  2VUG A;  3M2R A;  1FK9 B;  2R9L A;  1ZA1 B;  1TL7 A;  3H20 A;  2CJB A;  2PE8 A;  3SCJ E;  3GV7 B;  2J0W A;  3JS9 A;  2JNJ A;  2OPR B;  1RAJ A;  4ZCM A;  3O5T B;  4C9D A;  1WEY A;  3HD1 A;  1JB0 C;  3BSN A;  4OZ1 A;  4WIQ A;  2IVY A;  2OH2 A;  3C6U A;  5A76 A;  4O4G A;  3CDU A;  1IQT A;  1BC6 A;  2V8D A;  3OFE A;  1NHV A;  2ZH4 A;  1RT1 B;  3KDO A;  4CO0 A;  2WHO A;  4RW8 B;  4F25 A;  1VHF A;  2ZDP A;  1YBU A;  2HHW A;  1F1B B;  2X3G A;  2YKP A;  4XPE A;  3GIK A;  1UPP A;  2BKO A;  1VR6 A;  1LWE B;  2HIQ A;  3EGN A;  2W9B B;  4MKA A;  1KTQ A;  2P9C A;  3HMJ G;  4CM0 A;  2QA4 G;  4B3T J;  1TK8 A;  2QZ8 A;  3PIO Q;  1EHW A;  1FDD A;  3QMQ A;  1Y10 A;  5L46 A;  4ECU A;  1RKI A;  4C0B A;  2VG5 B;  1P8G A;  2X1A A;  3MEK A;  3D3C J;  3BKF A;  1K1S A;  5F8M A;  4I2P B;  1RTD A;  3MI7 X;  1TR0 A;  1VK8 A;  2W7O A;  3KMQ A;  3NGK A;  2PT0 A;  1DFD A;  2CKW A;  3N6M A;  2XQC A;  1W25 A;  3K59 A;  3KLF B;  5HVF A;  3CE8 A;  4BWM A;  3DRP A;  1AT1 B;  2MZJ A;  1JLB B;  1YSJ A;  3DLJ A;  3IS9 B;  1S77 D;  4NLD A;  2MY8 A;  4ED7 A;  3L09 A;  2UVU A;  1MSW D;  4DR7 F;  4EZ6 A;  1S1T A;  2ZVS A;  4JV2 A;  1SKW A;  1R8C A;  1Q5Y A;  3BR8 A;  2R7O A;  2XMA A;  1EET B;  5T14 A;  4C8L A;  1BQM A;  1S79 A;  1Y5N B;  2HPU A;  3I82 A;  5FD1 A;  4NCA A;  4CT9 A;  2AD9 A;  2CWK A;  4NL5 A;  1JJC B;  4JI1 J;  3VF0 B;  3BQ1 A;  4CIO A;  2QE5 A;  3SXL A;  2CDQ A;  3BN7 A;  1VCT A;  2QO3 A;  1UP1 A;  3D4J A;  4LFB F;  1WI8 A;  3GP9 A;  1I94 J;  1SCJ B;  5F8H A;  4J91 A;  1OY9 A;  4G1Q A;  2BV3 A;  4UUW A;  3GPA A;  4JI5 F;  3UN5 A;  4MTP A;  4CLT A;  4YME A;  3R6G B;  2ZH2 A;  1UVL A;  5I42 B;  1E6Y A;  4K5S A;  4B9S A;  2E29 A;  1MU2 A;  2K3K A;  2CA9 A;  4BS2 A;  2HRY A;  4P75 A;  2XYH B;  5CYQ A;  4FF1 A;  1CJT A;  1C2P A;  4HT5 A;  4I67 A;  2CVI A;  4B3R J;  1UW4 A;  3Q89 A;  4F0K A;  3C15 A;  1GTE A;  2HND B;  3Q8S B;  4AL7 A;  3RU0 A;  2CYY A;  3E01 B;  3OBI A;  2HEK A;  1YVF A;  4IOC Q;  1B3T A;  3ENQ A;  2VH7 A;  4O3P A;  2DCL A;  2H4W B;  2MQN A;  2UXB F;  1VRU A;  3H5S A;  3QWP A;  1NH7 A;  3US5 A;  3J81 Y;  4UUX A;  4C48 A;  4ZIT A;  4P7T A;  4HHU A;  5A8R A;  3BPS P;  2WSE C;  4NLG A;  4WBF A;  2DIS A;  3LGM A;  1IBL F;  4X2B A;  3QNW B;  4F26 A;  2R2T A;  4MYU A;  2B4U A;  4H4O B;  2ATC B;  2ZWP A;  1XIQ A;  1RT3 A;  2ASL A;  3S1T A;  5IM0 B;  2GMH A;  1N5V A;  4TY8 B;  4WF9 Q;  3LTO A;  3ONQ A;  2UUT A;  3CCR S;  3ENA A;  2HNZ B;  3PJX A;  4JUZ A;  4IDK B;  4R8U B;  3PIP Q;  1U48 A;  4OFZ A;  4WTY A;  1HYS B;  2V0N A;  3MM7 A;  1RB0 A;  4PYA A;  4CLZ A;  3DLB A;  5E7O B;  2HLU A;  2GJ2 A;  1RWX B;  1H7X A;  1HBO A;  4MIB A;  2YKO A;  4C3K A;  3R2D J;  4HI1 A;  3M8R A;  1S76 D;  3GII A;  5I4M A;  1KVK A;  4P2M A;  3T5K A;  2QX0 A;  3W5Z A;  4JI2 J;  5K14 B;  3MR2 A;  3VAG A;  2IIH A;  3EYZ A;  4LSN A;  2WVB A;  2HZC A;  1SPB P;  4RNM A;  4Q2L A;  1EAY C;  5C2C A;  2WTF A;  4JI3 J;  4LJM A;  1HA1 A;  1LW2 B;  4X64 J;  1TKX A;  5L9N A;  2YWK A;  4V1A k;  3DOM B;  4F3Q A;  2HWT A;  2VPW B;  2LQ5 A;  3T3F A;  3OFG A;  1SIW B;  3OFH A;  4JI7 J;  1J5E J;  3KLE B;  4GC7 A;  3KJV B;  1PJ6 A;  3I9V 9;  4OZ5 A;  1RTH A;  3JQJ A;  1JK9 B;  1BQN B;  2B9E A;  1VIS A;  2Z0G A;  4ZJQ A;  4ED3 A;  4IO9 Q;  1UAW A;  3QGG A;  2K1R B;  3CMQ A;  3V81 A;  2RIJ A;  4ERD A;  3EGV A;  4XIU A;  2YX1 A;  4JBC A;  4DBQ A;  1CJU B;  3ZZU A;  3IR5 B;  3IO1 A;  4NYZ A;  4OHV A;  2DY9 A;  1K73 T;  2HIY A;  1CEZ A;  4WP8 A;  2A18 A;  1RAA B;  2JEF A;  4FNI A;  1CUL B;  5EUH A;  3FZ2 A;  2FHM A;  1S9F A;  4HYK A;  2XMU A;  3LAL A;  4KH0 B;  2X1G A;  1J5O A;  3GZ7 A;  2J9C A;  2A10 A;  1RJJ A;  2YQ0 A;  5KFA A;  4G3I A;  3QZ8 A;  4C8N A;  1FO1 A;  2XI3 A;  3MTJ A;  3U7J A;  3E51 A;  4M5D B;  3KHH A;  3IR6 B;  3NRB A;  1Y9O A;  4K2J A;  3Q8R B;  4F4Z A;  3T1H J;  5M2U A;  2RRA A;  1OPZ A;  4LF7 J;  4DUY J;  4YB7 A;  2XYG B;  2V2K A;  3QAE A;  1JWW A;  4ES3 A;  2ZNZ A;  2VQF J;  4CWB A;  3DMJ B;  1TUW A;  1ZTW A;  4C3L A;  4ELT A;  4LQ9 A;  8ATC B;  4KFB B;  4DL4 A;  3GFY A;  1UVK A;  1WC5 A;  2HVI A;  3NCP A;  1TL4 A;  5EN1 A;  3IBF B;  2AYG A;  2B0G A;  4K7Q A;  2C2D A;  2L3M A;  4ZVT B;  2KXF A;  3H98 A;  3FSX A;  2MQQ A;  1DTT B;  2HQG A;  5DZ6 A;  1RAO A;  1RTJ B;  2AGO A;  2XLK A;  3H2L A;  1U6B A;  3AD8 C;  3AJ2 A;  5B08 A;  2DGU A;  1BMQ B;  4B3O B;  3FK4 A;  1RT7 A;  2DPJ A;  4X66 J;  3SSS A;  2HHP A;  5IT9 U;  2B43 A;  3QLH B;  1N56 A;  2WVC A;  3JQK A;  1HR0 J;  4K4S A;  4DN9 A;  4DPX A;  2ROG A;  2MZQ A;  2WVE A;  2I1R A;  4DR6 J;  4C11 A;  1H6K X;  3R97 A;  2ZM6 J;  4ED6 A;  3BQ0 A;  1G7C B;  3EXC X;  4LF5 F;  1EAR A;  4OI1 A;  4J9V A;  1NK7 A;  1ZET A;  5DG7 A;  2YNG A;  1RKJ A;  1T8E A;  2FVC A;  3T5J A;  2GQ2 A;  3GCW P;  3OR2 B;  4BBY A;  2M52 A;  2P6T A;  3NEK A;  3M6V A;  4QU7 A;  1HQE B;  3AA9 A;  2WK4 A;  1VQ9 S;  1N5T A;  3MUV P;  5L1J A;  4UF4 A;  4BDP A;  5HSP A;  1IBC B;  4DUZ J;  4DS4 A;  3IR7 B;  1C1B B;  4NI2 A;  1XK8 A;  3EDQ B;  2G2O A;  2D41 A;  2Q79 A;  2JVO A;  3CCE S;  3UCZ P;  4OX9 J;  2HZV A;  2OD4 A;  3AOC A;  4FYY B;  1D8Z A;  1SKU B;  2IC3 B;  1RHQ B;  2CJQ A;  4P10 A;  2B8Q A;  1S4F A;  2EG2 A;  4JI6 J;  2WVF A;  1OYD A;  4ZHR B;  1FXL A;  3RGI A;  2E1M C;  1I51 B;  2V2Q A;  1FRK A;  5AE3 A;  1U0H B;  2E5L F;  2OSR A;  2CZV C;  3LPY A;  1GNK A;  3K8W A;  5KFH A;  4U95 A;  1ZYQ A;  4O44 A;  2GV1 A;  2MGZ B;  3R5D A;  1ZA2 B;  4LRA A;  5J2P B;  4R5P B;  2Z4P A;  4FVC A;  1NDL A;  4Y2A A;  1S6O A;  1UA1 A;  1IM4 A;  3CC7 S;  1GT8 A;  2Q66 A;  3D1Q A;  3VAH A;  5KFE A;  3HFZ B;  3BYP A;  2W2O P;  1TL3 B;  1OSD A;  1FXD A;  1AUS L;  4LRD A;  1UFL A;  1X4C A;  1TL1 B;  1ZZF A;  1Q53 A;  2AGQ A;  3O3L A;  1CG2 A;  3NAI A;  2IA6 A;  3AFG A;  1LWC A;  3I5A A;  4FYD A;  3T5L A;  4RNF A;  2CQ0 A;  4AXI A;  2XSJ B;  2B8P A;  2XZW A;  3NWR A;  5ETM A;  1X4H A;  2HFO A;  1F3V A;  3DLK A;  4NE9 C;  5LJ3 Y;  4DQQ A;  5KG7 A;  4PPD A;  4MJK A;  1T9T A;  2UUB F;  3DDK A;  3W7B A;  2MZ1 A;  1B0V A;  4IRD A;  1YRU A;  1PGZ A;  1S1V B;  2ZBQ A;  4TQR A;  1RP5 A;  5B0D A;  3DOL B;  2V4J A;  3CW2 C;  2RHQ B;  4IG0 A;  1I1G A;  1FF2 A;  1XWL A;  1ZBT A;  3HVT B;  3T41 A;  3VGS A;  2U2F A;  4ZJO A;  4PXE A;  2DHS A;  2KXH A;  2AQ4 A;  3MEC A;  2J7U A;  4M5K A;  4IFY A;  3VWS A;  4PWU A;  1Q0N A;  1C4C A;  2BE7 D;  3VHQ A;  4USV A;  1NUE A;  1WC6 A;  4IH6 A;  2UU9 F;  3GV8 B;  3BRE A;  3UCU P;  5HP1 B;  2FD2 A;  2LU2 A;  3W61 A;  2ZJP Q;  4K5R A;  3TAQ A;  2MLY A;  4R0E A;  3R1H A;  3AOD A;  4J90 A;  3H42 A;  4Q0B A;  2DHX A;  1R8H A;  3QSY B;  2FVS A;  2EC0 A;  1HNI B;  4DV7 J;  3AH6 A;  3P8B B;  3KFW X;  5H1S V;  1YJ9 S;  3CD6 S;  4DSF A;  5A2Q Y;  3TRG A;  4DQS A;  3VTI A;  1HD0 A;  4F2S A;  3OW2 R;  3DC2 A;  2RQM A;  1S0O A;  2Y0S D;  3MR7 A;  1UFK A;  4XPC A;  4RW8 A;  4CO2 A;  3G8S A;  4XO0 A;  1NLK L;  3DRS A;  4FXW A;  1H2T Z;  2ZZT A;  4WKY A;  4OJH A;  2HHT A;  1FT8 A;  2CG8 A;  1S12 A;  4JV0 A;  2F8M A;  5BYR A;  2VG6 A;  3H8Y A;  1VQ5 S;  1G2E A;  4ZLL A;  2BW2 A;  3VAF A;  4URS A;  4ANE A;  3KK2 A;  4WZQ A;  2OMO A;  4WFY A;  2H9Z A;  4ILL A;  2FUG 9;  3C6T B;  2CG4 A;  2VG5 A;  1RWN B;  1DY3 A;  2JC1 A;  3IAS 9;  1URN A;  1K0V A;  1CJV A;  4N5S A;  2IMO A;  4LFB J;  3NOC A;  1R6V A;  3PYD A;  2J8A A;  4HKQ A;  2IFX A;  4K4T A;  3DOK B;  2VQE F;  4KHM A;  4JI5 J;  2ROP A;  2IDE A;  2DGQ A;  2C2R A;  4WFB Q;  3MMJ A;  1B7Y B;  2GIQ A;  3PNI A;  4CO4 A;  2GHW A;  3QO9 B;  3GIL A;  1SC3 B;  1RBL A;  1V5I B;  3IBC B;  4A8O A;  2GNK A;  5T7L B;  1MNE A;  3W8P A;  3IWX A;  4OI0 A;  3R3T A;  3CCQ S;  1H0H B;  2F40 A;  3KG0 A;  3ILJ A;  3G6E S;  2WOM B;  4OZN A;  1QE1 B;  3R5C A;  3Q8Y A;  2OML A;  4DF4 A;  4GVB B;  1X0F A;  2IAJ B;  2PC6 A;  3FGV A;  2EFO A;  2ZH9 A;  2C3M A;  5GAE I;  1QUV A;  2FY1 A;  3DRY A;  4XDD A;  4NEZ A;  3QID A;  1TKT B;  3IP0 A;  4Q2M A;  2JFK A;  1U26 A;  1WOO A;  5MAO A;  2PSZ A;  2FLP A;  1JXE A;  3CO0 P;  2FZC B;  4QWA A;  3N9U C;  4WTO B;  5LMN J;  1IJE B;  4O4R A;  2Z2Y B;  1NK6 A;  2WBR A;  1KQG B;  2QA4 S;  3L7U A;  4F04 B;  4DR1 F;  4BC7 A;  5JVG Q;  1S7H A;  2HHQ A;  2OTL S;  3BSA A;  2LEP A;  4DL3 A;  4DSK A;  3MXH P;  3MAQ A;  4M5M A;  3E2E A;  1KVI A;  4ED4 A;  2WON A;  2KXN B;  1FEE A;  1NND A;  5DG8 A;  2CPX A;  3JTN A;  3IG1 B;  4PEO A;  2HNY B;  4X65 F;  2B51 A;  5I42 A;  1SB6 A;  3FNN A;  4LRE A;  2KM8 B;  2IDL A;  1YI2 S;  4WCE Q;  2BYC A;  1DTQ B;  3FFI B;  1N0V C;  2R7W A;  4OYM A;  2C1E B;  1UA0 A;  1FX2 A;  1HBN A;  3K0J A;  2EKN A;  4USK A;  2ZBR A;  3OXF A;  5KG2 A;  1MMD A;  5KFV A;  3OJS A;  1ZM3 A;  2MHN A;  4DV6 J;  3ITH B;  2QSF A;  3OL8 A;  4TKT A;  4QZV B;  1BWV A;  5CZV A;  3IWN C;  3MPD A;  5DG9 A;  1Q78 A;  3M1V B;  5BXI A;  1RWV B;  3AD7 C;  5D4N A;  5BYS A;  4DV5 F;  1S4E A;  2FHJ D;  2R7R A;  1HLW A;  2QA1 A;  2FY8 A;  3A3N B;  2YPZ A;  5G4D A;  1H98 A;  1GFW B;  2GAG C;  3QT5 A;  1RHJ B;  3MGJ A;  3RZA A;  3F44 A;  3H5X A;  3W1Y C;  1NXI A;  4TY8 A;  2V2Z A;  4LSL B;  3AOA A;  2ZOF A;  3LUY A;  3EUN A;  2OPP A;  1T3O A;  1FD8 A;  3CCU S;  5D15 A;  5D3G B;  1A7G E;  3HF5 A;  4NML A;  2XEX A;  5CAB A;  5I3Q A;  1SJF A;  1YRX A;  4DG1 B;  4I7F B;  4CLF A;  3OL7 A;  4YB5 A;  3OD2 A;  1NZ8 A;  1T9U A;  3RAQ A;  4D3H A;  1RDR A;  1NHU A;  4Q5V A;  4GMK A;  3PG9 A;  1TMJ A;  4TLQ A;  2HS0 A;  1T0T V;  3ZTR A;  1S9E B;  4RW9 A;  3LWM A;  1F2G A;  2VOO A;  4KE5 A;  3JTP A;  2CZ9 A;  4Q45 A;  4PUO A;  5HAT A;  2R2S A;  1PBA A;  1NJI T;  4N8N A;  5HQM A;  2R8G A;  2RD5 C;  4GVL A;  6FD1 A;  1RHU B;  3KUG A;  2AJ0 A;  1HNW F;  3SQO P;  3A1Y G;  1U2F A;  4PAA A;  1AUD A;  2FGO A;  2AZ3 A;  2XWX A;  2YKM B;  2CQ2 A;  4EMD A;  2RB7 A;  1HQU B;  2HGM A;  2Q1L A;  2PO4 A;  1HW9 A;  2EXU A;  5D0E A;  3ZFV A;  2LXF A;  1AXQ A;  4Z37 A;  5AXL A;  3MWB A;  4KV8 B;  1X31 C;  1WKJ A;  3OR1 B;  2QYC A;  4KO0 A;  4ZLJ A;  4OZ0 A;  3VVT A;  3UVJ B;  2VFR A;  1N36 F;  2V8P A;  1PBU A;  1C1C B;  1R0A A;  4X4T A;  1F5C A;  3PEJ A;  3KKF A;  1RWU A;  4DR4 F;  2AMC B;  1JNZ B;  1S1X A;  3MCO A;  2AEM A;  2Z2Z A;  1RE1 B;  3BV8 A;  3OPK A;  4KGM A;  2W7P A;  1H74 A;  2MQP A;  4X4V A;  2F7V A;  3TAP A;  1U6Z A;  1H7W A;  2NUH A;  4CO1 A;  1TQL A;  4ES1 A;  1XMQ F;  3U1L A;  2RRB A;  1D8Y A;  1WF1 A;  3TVK A;  2ZWO A;  2XS5 A;  1ZAX A;  1KWM A;  2YXL A;  4S0M A;  4EFA C;  3MD3 A;  3BZQ A;  2EBG A;  5IQ6 A;  3JSM A;  4XAK A;  1LKZ A;  4WII A;  5HBM B;  1UL3 A;  2FGC A;  2YH1 A;  2DIT A;  2BQ3 A;  4LFC F;  2APO A;  2HG4 A;  5HRO B;  1RTJ A;  3CJS A;  2Q43 A;  4HVZ A;  2R7S A;  3C16 B;  3TVY A;  1IM6 A;  3VGT A;  4FDF A;  3PX6 A;  4ITS A;  3Q8V A;  4P7V A;  1XQI A;  3DGP A;  4OYZ A;  4KJI A;  1IBM F;  2UUC F;  2KH9 A;  2C2N A;  1QAI A;  3W9H A;  3KUH A;  2N7Y A;  2EFG A;  1Q8K A;  4CDI A;  3D5M A;  5HO4 A;  3G2X A;  1R3N A;  3ETM A;  1U1M A;  4X62 F;  3BS9 A;  1HI0 P;  1RT5 B;  2KM8 C;  4YOE A;  3NL0 A;  5KT5 A;  4FBT A;  1SV5 B;  1M5H A;  1M0S A;  1SJQ A;  2LXU A;  1S0N A;  3MM8 B;  3M8P A;  1HKA A;  2J0X A;  4P72 A;  4FPR A;  1T9V A;  5BR8 F;  3ICL A;  2AT1 B;  2ILY A;  4EUV A;  1CS4 B;  3FBE A;  1UZD A;  2W9C B;  4ICL B;  1HI1 A;  2W8K A;  2X1B A;  1VIX A;  3CDW A;  2V50 A;  3R8Y A;  4DPO A;  5IWA F;  1U25 A;  3UDV A;  2C28 A;  1G3O A;  5A8K B;  3K5N A;  2VBW A;  1HHQ A;  3P45 B;  5BJR A;  2V8G A;  3QAT A;  1VQ6 S;  2JZ5 A;  4F2R A;  3TZZ A;  2IRY A;  3R7S B;  3W3S A;  1FKP A;  3GFX A;  1ZAW A;  1MML A;  2ZHA A;  2XMV A;  2OPQ A;  3MM5 A;  2KT5 A;  1FJE B;  3J7Y I;  1ZPW X;  4DFJ A;  3SSR A;  2DNN A;  5RUB A;  5F0W A;  1JLF B;  4OYW A;  3POT B;  1RSC A;  4CLL A;  3X3U A;  4TU9 A;  1LOU A;  2JC0 A;  1R89 A;  3NGD A;  4J9N A;  3PKM A;  1TP7 A;  2HQI A;  4NPO A;  3W9J A;  2FJW A;  1WG1 A;  4PWD A;  3AB2 B;  1JLQ B;  3L7P A;  5KFG A;  2ZE2 B;  4CH7 A;  4QW9 A;  1Z1Z A;  1N6Q A;  4R5P A;  1SXL A;  3OLA A;  1ROF A;  1Q1K A;  3TR5 A;  2FDN A;  1C4A A;  1TZ0 A;  1YGY A;  3D0H E;  4IR1 A;  4NCG A;  1W2B R;  4E8U A;  2Y1L B;  4RW7 B;  1OS5 A;  4B3M F;  2UU9 J;  3MMB A;  3IRX A;  4TVA B;  1TL1 A;  1HBU B;  1UKU A;  5LM7 E;  5HLF B;  3ILL A;  3MMC B;  5LSO A;  3W66 A;  4W92 B;  1V3S A;  4LF8 J;  2W2M P;  2FVR A;  2DGO A;  1KQS R;  3S01 A;  3CF5 Q;  2P2C B;  2E44 A;  4CH1 A;  4USI A;  2PA8 D;  1T05 B;  3I0R B;  1XNQ F;  1RYR A;  5KT7 A;  2Q3P A;  1NKB A;  2OD6 A;  1NME B;  4G6V B;  2RU9 A;  5EX0 A;  2ZHO A;  4DU8 A;  2ZVI A;  4RKU C;  4QYR A;  3QIP B;  4EBD A;  5AE2 A;  4DXL A;  2CPZ A;  2OFG X;  5K8O A;  3K2Y A;  4G1I A;  5AXK A;  3R2C J;  4P74 A;  2G1H A;  1WOP A;  3CJK B;  1OY6 A;  2E7W A;  3AA8 A;  5E33 A;  4M94 A;  3D0G E;  3UQS A;  5F8I A;  4M5L A;  3I4P A;  4ILM A;  5HJX A;  3PM9 A;  4L72 B;  3HFK A;  5D4L A;  2G1D A;  4NLV A;  2YNF B;  3ZZZ A;  2HFS A;  1K0T A;  4QR1 A;  1PO6 A;  3FMW A;  3THV A;  3GYG A;  5DO2 A;  2MST A;  5CYM B;  4HHH A;  2UUA F;  2B7B B;  3GU0 A;  2HVZ A;  1UEV A;  5KFR A;  1L5U A;  5F3Z A;  2VQE J;  1LXJ A;  4B9N A;  1WF2 A;  2L08 A;  5KFF A;  1HNI A;  2ZBI A;  1KVJ A;  1QAY A;  3ILI A;  2ZH1 A;  2XMK A;  3G6Y A;  2QGF B;  5KFM A;  2BM1 A;  3BR9 A;  4KGK A;  2PI5 A;  2FJX A;  1TL5 A;  3CCV S;  3EMT A;  2IA0 A;  2FJV A;  1FRM A;  5BYQ A;  2DGS A;  3GV5 B;  1RUS A;  3KXD A;  1F5A A;  2W2P P;  3CD0 A;  2HRU A;  2DT9 A;  2MQL A;  4Y6I A;  1TFW A;  1RWP B;  1KRP A;  1RI7 A;  3SV3 A;  2NRE A;  3AB4 B;  2YWH A;  2B56 A;  1KR4 A;  1N0U A;  4DU7 A;  5J2Q B;  1J27 A;  3PHT A;  5KFU A;  3HXM A;  2O01 C;  5HL7 Q;  2E7V A;  4LRB A;  1AZS B;  1Z2Z A;  3HHL B;  4NLT A;  4DR1 J;  2D9P A;  1FE4 A;  5H9E J;  3D6T B;  3V6J A;  4ED2 A;  1DBD A;  1QSS A;  2VC1 A;  4OI4 A;  2BE2 B;  3BDE A;  4CYU A;  2OPS B;  1SUQ A;  3P6Y C;  2G2Y A;  4X65 J;  3K5M A;  4H4M B;  2CPD A;  5EGY A;  1T11 A;  4C7Q A;  2KHC A;  3KWM A;  1JLG B;  2KVQ E;  3O6Q A;  3J7Y U;  4I6W A;  4JYA J;  1UMJ A;  2QRR A;  1WOS A;  2OLW A;  3SQG A;  3MED A;  3M9O B;  2ZNY A;  2N7C A;  3W2W A;  4OI2 A;  4YR0 A;  1F2H A;  1YJV A;  1KS2 A;  3VQS A;  4OJ3 A;  4F67 A;  1FTC A;  2IM1 A;  3L95 X;  3KLH B;  4ES2 A;  4PYD A;  2FHK A;  4ZP7 A;  3T6B A;  1LFP A;  1PG5 B;  2ASD A;  4ZLN A;  4DV5 J;  3PJ9 A;  1NSQ A;  2XS7 A;  4M95 A;  2YQ1 A;  4TXS A;  2F63 A;  5J2M A;  1S9G B;  4IFV A;  3HHE A;  4YR2 A;  4IOB A;  1JLA B;  2XLJ A;  4U9R A;  3W62 A;  1VC0 A;  3PRV A;  4IQX A;  2VBX A;  3BBC A;  1TVR A;  1HBM A;  2RKI B;  4FXV A;  4KKO A;  5IFM A;  4GRS A;  2YH0 A;  1OPI A;  1IKY A;  1NPK A;  5K9F A;  2QLX A;  3PTW A;  4O3R A;  3EXY A;  4DLE A;  3ZZO A;  1RAC B;  5J1E A;  3DLE A;  1N33 F;  4N8O A;  2AP6 A;  2A2D A;  3GJS B;  3JB9 k;  4FYW B;  4OMF G;  3KDN A;  2VL1 A;  4M5J A;  4HAC B;  4EU0 A;  4ED5 A;  3QBC A;  4AUK A;  2ZHB A;  4PQU A;  1QDU B;  3ET6 B;  4K4Z A;  3A3O B;  4YEA A;  1I94 F;  2GGP B;  2PEB A;  2DEI A;  3OL9 A;  3M05 A;  1RT6 B;  3OSN A;  3LAN A;  1RHM B;  3LPE A;  4UOH A;  2O67 A;  3WZ0 A;  5JUM A;  4A8S A;  3OTB A;  3DLG A;  4J9R A;  2XM3 A;  4NRU A;  2OGU A;  4C2M A;  3IN5 A;  4N41 A;  1HNW J;  5B0C A;  2CPE A;  5EWF A;  5A6W A;  4Y2M A;  4I2Q B;  4LSL A;  3PFE A;  1GQE A;  5U47 A;  1EIY B;  5CHC B;  1X5T A;  3PJW A;  4C8O A;  1FDN A;  3M2V A;  4UW2 A;  4L74 A;  1FRH A;  5LOQ A;  4U7C A;  2VC0 A;  3BF4 A;  3TZW A;  5HQL A;  2RT3 A;  3FMB A;  4USM A;  3H25 A;  3PVX A;  5E2Q A;  1S0V A;  1U6F A;  3BM7 A;  2DNG A;  4OYA A;  2WZ1 A;  1MWQ A;  1C0T B;  3HJF A;  1S10 A;  2MJN A;  3BBF A;  3MAA A;  4JI0 J;  2MEW A;  1NK5 A;  1SC4 B;  2KFZ A;  1N5Q A;  4RU2 A;  3LAM A;  4LIW A;  3UFC X;  1P9Y A;  2BZ2 A;  3KLI A;  4DR4 J;  4PCQ A;  2J9E A;  4IOA Q;  3I32 A;  5KG3 A;  4BC9 A;  3MEG A;  2E1C A;  2QL5 B;  2LMI A;  1D3W A;  1XMQ J;  2E5J A;  3FSI A;  3CT9 A;  1BGX T;  2LQB A;  2RIL A;  5H9E K;  5A8W B;  5K20 B;  3TA1 A;  4ID5 B;  5AE1 A;  4WE1 A;  3FSY A;  3ZC4 A;  5B0B A;  4LFC J;  3KG4 A;  2DR8 A;  3DM2 A;  3WBZ A;  2HYI B;  4WXW A;  2H48 B;  1RTI A;  3TAR A;  3FC9 A;  3L7O A;  2G0J A;  3MZI A;  5LXR A;  2BJ1 A;  4DQP A;  4FF2 A;  2Y1R I;  4WWS A;  2ACY A;  2M7S A;  1SJ3 P;  3AD9 C;  2V5H G;  4X64 F;  4ZVS B;  2A6O A;  4KT0 C;  3B78 A;  3R5B A;  3G8T A;  1T9Y A;  1CJK B;  2WRM A;  4PQA A;  1FKO B;  2NXJ A;  2V68 A;  3LW5 C;  4NEY A;  2YPY A;  1XC9 A;  1TUG B;  3T19 A;  4X62 J;  4FXD A;  2AF6 A;  1LV5 A;  1NKC A;  1VGY A;  3LP0 A;  3M9N B;  1LW0 B;  3UWT A;  2DYA A;  2RF2 B;  3NNA A;  4NMX A;  4CQ1 A;  3RRK A;  3UR3 C;  2HMI A;  4Z7Y A;  3CIM A;  2A0F B;  3FRZ A;  2JH3 A;  5E3P A;  3GTY X;  2B7C B;  4XTT A;  3A4T A;  3G8Q A;  5C42 B;  3SDE A;  4G65 A;  5IWA J;  4KBI A;  3AY0 A;  2D3O R;  2F9D A;  5CAA A;  4DSI A;  3AQP A;  2YNH B;  2X7I A;  4CO5 A;  1HNZ F;  3V6H A;  3J80 U;  1A6L A;  2D1C A;  3O2I A;  2ZH8 A;  2FJB B;  1VRT A;  1SKR A;  2ZC4 A;  4O3N A;  1RA7 A;  4ECW A;  4NA2 A;  2A3J A;  4FN5 A;  1N34 F;  3A8I A;  4OHX A;  2B4P A;  3NG8 A;  2RQ4 A;  1S99 A;  4J9S A;  4WP9 A;  4X4O A;  1VQL S;  1LWF B;  4DV1 F;  2VQF F;  4DX6 A;  2HBZ B;  2GS8 A;  4DR5 J;  3QJP A;  3D28 A;  4OZJ A;  3MM8 A;  3TAN A;  4H4K C;  1HW8 A;  1KFD A;  3TEG A;  3H5U A;  1NH8 A;  1CS4 A;  3T9N A;  4DS5 A;  3MCM A;  2VG7 A;  5KFS A;  2DK2 A;  2NUU G;  2QFI A;  2MSS A;  4DX7 A;  4M5G A;  2MYF A;  4KYZ A;  1U1K A;  4IH7 A;  2F8E X;  3PX4 A;  4QWB A;  2AEJ A;  2HGN A;  2Z56 B;  2NZ4 A;  5B0F A;  4B3M J;  1VQ4 S;  1T03 A;  5ETR A;  5DM7 Q;  2L9N A;  2X3D A;  4JOU A;  3MM9 A;  4K59 A;  4ZMM A;  3VAM A;  1QTM A;  3H2V E;  1NDP A;  3V2U C;  2BVZ A;  1T9X A;  3JTO A;  1B0P A;  2ZM6 F;  5D6G A;  3L9Z A;  4ATN A;  3OFF A;  4A46 A;  1YBA A;  5ETN A;  1HMV B;  2ABY A;  5CCM A;  4OX8 A;  4WYW A;  3PHE A;  1M1G A;  2D7S A;  1HFE L;  2KFN A;  3RAM A;  3EGZ A;  3JYT B;  5D8H B;  2C3U A;  4L6V 3;  1WWH A;  5JMN A;  2KJW A;  3Q86 A;  3K5O A;  1FCA A;  2GIR A;  1LNQ A;  5IT4 A;  1WG4 A;  2ZH3 A;  3PW5 A;  3I9Z A;  5C24 B;  1KON A;  2V69 A;  2MZR A;  1JLQ A;  1FDB A;  4Y2K A;  4DUT A;  4EI2 A;  4CLU A;  4AYB D;  3L3C A;  1C0U A;  2VOP A;  4C8Y A;  2XSF A;  2ASJ A;  4L75 A;  9ATC B;  2CQC A;  2OEJ A;  5A0Y B;  1IKV A;  3T1Y F;  4OX9 F;  2VDI A;  2AV5 A;  2RVJ A;  2CQ1 A;  3K8V A;  3W2V B;  2UUA J;  5IT9 Y;  4C4W A;  3Q23 A;  4OYX A;  1VLO A;  3W60 A;  3RW6 A;  2A1B A;  2PMH A;  4W4M A;  2GMJ A;  3CXC R;  5CD4 A;  1FWL A;  3SFG A;  4OZL A;  3D6F B;  1MRO B;  4I0W A;  2DNZ A;  2KT2 A;  3CJ0 A;  4NLX A;  3ELH A;  2KKH A;  3V6D A;  2B9W A;  3AXK A;  1UW9 A;  3G87 A;  2IJN A;  2MMY A;  4F3M A;  3CCW A;  3RTV A;  2XCA A;  3TQ1 A;  3TZX A;  1VRQ C;  1L3U A;  2NYI A;  1O0P A;  5EX3 A;  3G96 A;  2XHW A;  1FFW B;  1NAQ A;  2IM3 A;  3OTO J;  2J6S A;  5KFP A;  4PRF A;  2X51 A;  3CUN A;  3HLU A;  4N56 A;  3J81 j;  3R9L A;  2M0G B;  2Z2M A;  1MWZ A;  1UCN A;  1S1U B;  3GON A;  3UD3 P;  1V3R A;  4HDH A;  4NRT A;  2XMM A;  3DCA A;  5C7P A;  1DHM A;  5CYM A;  2OUG A;  4UOG A;  4OLO A;  2V4R A;  2R4F A;  5ETT A;  3TWZ A;  2O3D A;  2IBO A;  3J7A 1;  1L3S A;  1N5Y A;  4RNO A;  1SKS A;  1PAE X;  1ZPV A;  3W5Y A;  4DQR A;  1ELO A;  2H54 B;  2ZD1 B;  1L3T A;  2CJK A;  4Z2X A;  1NCL A;  3BO3 A;  4TY9 A;  4OHZ A;  2JEJ A;  1TK0 A;  1GAO A;  3G6V A;  3GR1 A;  3EZ5 A;  2HS3 A;  2W1B A;  5J2N B;  4F0H A;  2J0S D;  2PD1 A;  3BPD A;  4MH8 A;  3BGR B;  4RUC A;  2FIU A;  3N79 A;  4CNY A;  1IXK A;  5CXT A;  4P71 A;  1NSK L;  4HHJ A;  3CJT A;  2XG8 A;  3M2U B;  1SJR A;  4ZCI A;  2DR7 A;  2B9X A;  3DHW C;  3ZNU A;  2BAN A;  1IWA A;  4KPY A;  2GFF A;  2ROE A;  4X4N A;  1XBW A;  1UWB B;  1IKX A;  4ENO A;  2W2Q P;  4F3O A;  4LVN P;  1GH8 A;  1V6H A;  3SV4 A;  5DRK A;  2VA2 A;  4ZVF A;  3M9M B;  3Q24 A;  4ZOS A;  3CPW R;  2B6A A;  2D3O 1;  1OMS A;  1XR6 A;  2BKN A;  3IA0 A;  3EPI A;  1X4B A;  3PXG a;  4JP8 A;  1S6P A;  4MFB A;  3ETO A;  4DV7 F;  1VK3 A;  3KLV A;  4Y0F A;  4Q8F A;  5F8J A;  2I8E A;  3N6N A;  4OV6 A;  3M2R B;  1TL7 B;  5F9L A;  4CNZ A;  2FJA B;  4OX7 A;  5KOX A;  4RWX A;  5IOL A;  4EBE A;  5E3Q A;  4RPF A;  2C3O A;  3M8S A;  2G13 A;  2OO4 A;  4DLG A;  1LK7 A;  4FVM A;  2DGT A;  3F0N A;  3NNC A;  2KYX A;  5ETK A;  5KFT A;  4UZB A;  1K47 A;  3OUY A;  2H1Y A;  2W7A A;  1VQM S;  2YX7 A;  4ECZ A;  3C6U B;  4M5N A;  4ZJL A;  5D0H A;  5E0O A;  4UST A;  2QC3 A;  2AHO B;  1N33 J;  2WAQ D;  4HT7 A;  4ZPV R;  5FDL A;  3NS6 A;  3FBB A;  2DXE A;  2R8J A;  3LF0 A;  5DDR C;  2WW8 A;  3D6M B;  1T95 A;  2J7W A;  4ZVU B;  4XK8 C;  4LMZ A;  1W2I A;  2OEM A;  4B9M A;  1WC1 A;  4GKK J;  2FZG B;  1O51 A;  3EIC A;  5IT0 A;  4TU8 A;  1TKD A;  1YBT A;  4C0O C;  2XCP A;  3GLJ A;  3MPY A;  1R27 B;  1BE4 A;  5GVQ A;  4AD6 A;  1I3O B;  2E5I A;  1AW0 A;  1N48 A;  3W64 A;  3G82 A;  3SCI E;  4AQY F;  2I6W A;  4DSJ A;  1K44 A;  1RTD B;  2ILZ A;  4B9L A;  2MKI A;  4B9T A;  4B08 A;  1X5S A;  3M32 B;  1XNR J;  4PAB A;  1XMB A;  5AXM A;  1NB2 A;  1DQ9 A;  2AWZ A;  4XDC A;  2Y8Y A;  3HX9 A;  3KG1 A;  1MW7 A;  3Q8P B;  4H4K A;  3QSI A;  5KFJ A;  2YWE A;  2XNR A;  1KOH A;  1B0T A;  4RO0 A;  5E3A A;  1VMB A;  5DQG A;  4IYQ A;  4RUA A;  3UN3 A;  1S1T B;  2CQP A;  3A8J A;  5L9X A;  4OZ2 A;  3KK3 A;  2JEG A;  5LMN F;  3HZG A;  3ZZ0 A;  2HS4 A;  1FNO A;  5LSL A;  4P73 A;  1OQ3 A;  4O3S A;  1T94 A;  2CNL B;  4RBU A;  3WQP A;  1WKK A;  1Z4U A;  3FDS A;  3I4H X;  1M90 T;  1BQM B;  2MHE A;  1I5O B;  1Y11 A;  5ITH A;  4ZVO B;  3PW7 A;  2Y9H A;  1EKR A;  2LQ8 A;  3M4X A;  3UDC A;  3KHL A;  2HFN A;  3D1H A;  5C5J A;  4RX6 A;  2LLZ A;  4YDD B;  1UZH A;  1RAH B;  5E3R A;  2DCU B;  2ZOG A;  5H9F J;  3OTE A;  1CPZ A;  2MKH A;  2H5J B;  3GQC A;  4URQ U;  1QAJ A;  2CPF A;  4OJ1 A;  1NB7 A;  1Q7Y T;  4YS2 A;  2MZS A;  4QBU A;  4G1Q B;  1WDT A;  2DIV A;  1XR7 A;  3P5B P;  2G4B A;  2CAJ A;  5C25 B;  2CQ4 A;  1A0O B;  3MOZ A;  4DV6 F;  1E6Y B;  3K17 A;  6FDR A;  2XGP A;  2QL7 B;  4LVO P;  3VAL A;  1HNV B;  2GAH C;  3ILO A;  5KT2 A;  3RR7 A;  1RCO B;  3N28 A;  4RZR A;  5CYQ B;  3DRX A;  3UCG A;  3HHK A;  3HK2 A;  2YKN A;  3WHI A;  4MIW A;  3QRR A;  2PDA A;  3C15 B;  4RW6 A;  3AT1 B;  2RE1 A;  1N4L A;  4DFK A;  3FBF A;  5D4O A;  2W4C A;  5K8N A;  3HVW A;  3OVB A;  4NCB A;  2QLF B;  5M2P A;  1X9S A;  4EO6 A;  1TKZ A;  5CYJ A;  2VKZ G;  2W9A A;  3SI8 A;  5LL6 d;  1VRU B;  5FJ4 A;  1FA0 A;  3D3B J;  2ZFH A;  1D9A A;  5SUH A;  2DY1 A;  2BJ3 A;  2VB6 A;  3CCL S;  1IR0 A;  1BWE A;  2KHD A;  4Y34 A;  2E1A A;  4RJV A;  5HN0 A;  4JB8 B;  1SC1 B;  2YNI A;  5A8R B;  4ILR A;  5I3U A;  2Z57 B;  1U1N A;  4ZCK A;  3TUJ C;  1RZM A;  2XNQ A;  4DR2 F;  3RB0 A;  5A8W A;  3QRQ A;  4GC6 A;  3KLG A;  1HL6 A;  3EVM A;  3MR5 A;  2MQ8 A;  1RT3 B;  4U7U K;  3U27 A;  4CTA A;  2BAC A;  5FLX U;  1WSR A;  3HHN B;  3KHR A;  2GO9 A;  4DL5 A;  4DCO B;  1YQH A;  1NEE A;  1YKW A;  4QIF A;  1L3K A;  3TX8 A;  4I6Y A;  3MEE B;  3GMG A;  3N4W A;  4YDX A;  1HHT P;  5DDQ C;  2KVI A;  1S48 A;  2MJU A;  1Y7P A;  1RK8 A;  1TTH B;  3DHX A;  1HNZ J;  5KFY A;  4IG3 A;  3TO8 A;  3HPO A;  2VIH A;  4J9K A;  4OJG A;  2GHV C;  1FE0 A;  5E3C A;  4DSL A;  1IUJ A;  2IY5 B;  1BD6 A;  2DNY A;  4J9L A;  2OIH A;  1HBO B;  4OI3 A;  1N34 J;  4EZ9 A;  1TMM A;  2M2B A;  1X9W A;  2Y3Y A;  4PG5 A;  1VQK S;  2K06 A;  2Y8W A;  2B9Y A;  3DLL Q;  1FKO A;  2NXN A;  4LF1 A;  2CFX A;  4WPA A;  3TAM A;  2DEJ A;  4DV1 J;  4LSN B;  4ZVR B;  2KB2 A;  2BOA A;  1U4B A;  1ITP A;  3LP2 A;  3FVY A;  1S6Q A;  2V9W A;  1QTN B;  5B0E A;  3NBP A;  4F4A A;  2QG9 B;  1TKX B;  2ZUG A;  2OI2 A;  4A8Y A;  1GMU A;  2XB2 D;  2LCW A;  2HWI A;  2P8I A;  1RT2 A;  4LQ3 A;  2YWG A;  3C14 A;  1S5Z A;  3Q8Q B;  3KK1 A;  1SBR A;  4NLY A;  1CSJ A;  3F73 A;  1JLE B;  3MPW A;  3PO5 A;  5KFI A;  1JLC A;  5DS7 A;  2PI4 A;  4ZA1 A;  3M6W A;  4BLG A;  2ATL A;  3QWU A;  2ASY A;  1RTH B;  5C42 A;  3TJ8 A;  5KFD A;  1F9F A;  1SI9 A;  1GXT A;  1FFG B;  1EX8 A;  2XZT B;  3WDO A;  3MCS A;  3V81 B;  4F50 A;  1LFW A;  5KT6 A;  4GKJ F;  2JL9 A;  1FJG F;  4O23 A;  3SYZ A;  2GA7 A;  5DET A;  2FHJ A;  4NXM F;  1UVN A;  4V19 J;  4QIV A;  4YQW A;  2XC9 A;  2DB1 A;  3DXS X;  3ZO7 A;  3BDP A;  1S7I A;  4OI6 A;  5G0R B;  1J5O B;  2VA3 A;  4EBC A;  5A6P A;  4ELV A;  5B7W A;  1TV6 A;  2JX2 A;  4MK8 A;  4KY3 A;  2UV8 G;  2DJW A;  2E66 A;  2KN4 A;  1UVI A;  2IJF A;  2XYP B;  5H9F K;  2LQJ A;  7FD1 A;  3KJF B;  3ISN D;  3MAH A;  3V6K A;  4FZV A;  3CVK A;  1KLM A;  4IUF A;  4AE5 A;  3T1Y J;  2ADB A;  3MOJ B;  1R31 A;  4P2F A;  2D74 B;  5EWG A;  3MM6 A;  1RWW B;  4I6A A;  3NOG A;  2JJ4 D;  3HHL D;  1KQF B;  3NCQ A;  3R7B B;  4A8W A;  4RW4 B;  4O0N A;  2CJA A;  2ZC3 A;  3RBZ A;  4RNN A;  1Q8L A;  4WK1 A;  3I56 S;  2C2M B;  1O6X A;  3RBX A;  2DH9 A;  4AXJ A;  1U1Q A;  2CNK B;  2HK2 A;  4FPI A;  3VAJ A;  1RT4 A;  1HMV A;  1DLO A;  1E6V A;  1WEZ A;  3MMA A;  4K2X A;  1NDC A;  1X9M A;  2V8H A;  1P27 B;  4CLW A;  4CLY A;  1KTV A;  5CA5 A;  3M8Z A;  5HAO A;  3C3L A;  2NXC A;  4HTI A;  4D3G A;  3NP5 A;  4C11 B;  2GHP A;  2YKA A;  3G4S S;  4DPT A;  4UQT A;  1WEX A;  3JSY A;  3EX7 B;  1RTZ A;  4YP3 A;  1SJ4 P;  4LF6 F;  2ZBC A;  5DGB A;  2GJF A;  3GYN A;  2DNH A;  2YNG B;  2XBP A;  2C2Z B;  5A0Y A;  3CD7 A;  1YJT A;  3S6E A;  4B17 A;  2M4M A;  4M8L A;  3DYA A;  3JAM U;  5AXN A;  1CC7 A;  2XMT A;  3LO3 A;  2NPF A;  2VOD A;  5AT1 B;  2J0Q D;  3R5G A;  3RUB L;  4KB7 A;  4NI2 B;  4PKD B;  3UDE A;  2WBM A;  3DI6 A;  3ENW A;  3CUL A;  2JLF A;  4ZVH A;  3CDA A;  5GAD I;  1GMV A;  4J9U E;  4TLR A;  3NGS A;  4KGZ B;  2AIR B;  1VI7 A;  3VZI A;  2JRS A;  4B9U A;  2EBE A;  2VDH A;  1SH3 A;  3EJM A;  4NLO A;  2LA4 A;  1M5K C;  4QU6 A;  4KGV B;  1HPZ A;  1ZS6 A;  1IR2 A;  4IO1 A;  3V4M A;  2JVR A;  4UZC A;  3DRR A;  1QM9 A;  1YIT S;  5L8R C;  2G9O A;  3C2P A;  1YWX A;  2CWX A;  2L9D A;  4N77 A;  3MF5 A;  2AJ4 A;  2MTL A;  2PMZ D;  3A8K A;  2DTJ A;  4FYV B;  1IWG A;  1Q81 T;  2KL8 A;  1FK9 A;  1FWK A;  2K7K A;  4QR0 A;  3RYL A;  4URG A;  4YFU A;  1WD6 A;  3RBE A;  3MFI A;  4DMZ A;  1G4C A;  2OPR A;  2NQP A;  4O44 B;  2AKW B;  4P2X A;  1BXN A;  2IBK A;  2FJE B;  3TUI C;  4A8M P;  3BGL A;  4LF8 F;  3PYF A;  2E5G A;  1RU1 A;  2IPO B;  3I96 A;  2MB0 B;  5DM6 Q;  4UT4 A;  3QJL A;  2DPI A;  4PXC A;  2CNN B;  4Y65 A;  1RA6 A;  3GR0 A;  1IVZ A;  4ZP8 A;  3OXL A;  4OYO A;  4TN2 A;  2HVE A;  1RT1 A;  4DCJ B;  1K9M T;  4ZS6 A;  3OTD A;  4DZD A;  3AQO A;  2VPY B;  3BH7 B;  3AAW B;  1VLY A;  1YZ6 A;  5ETP A;  5D0G A;  4RUH A;  1LWC B;  1SJ1 A;  4DPU A;  4J7C A;  1LWE A;  5DDO C;  3ZNJ 1;  2W9B A;  1ACM B;  3U02 A;  1TFY A;  3DLK B;  3OVA A;  2MQO A;  2F4F A;  3SBM A;  3QGH A;  4ZP6 A;  2NXU A;  2RML A;  3H59 A;  3P4U B;  1U2R A;  3OQ2 A;  3CJ8 A;  2DNL A;  1U2C A;  3CCM S;  2NYH A;  4I2P A;  3NMA A;  2V4J B;  4ECR A;  4I64 A;  3UR0 A;  2BAB A;  2AJ2 A;  2OP5 A;  2YBV A;  5K5M A;  4Q44 A;  2KG0 A;  1X5O A;  3RRG A;  1HWL A;  2XY6 A;  1WC0 A;  1R8A A;  2VFU A;  5HMW A;  2M9K A;  2H5I B;  4ZPD A;  3KLF A;  2GVD B;  4WFA Q;  4IFY B;  1WHW A;  1DRZ A;  3JXO A;  2HFU A;  1JLB A;  4AQY J;  3IS9 A;  1B64 A;  3NLC A;  1VBX A;  2W25 A;  3PW4 A;  4FS2 A;  3PR4 A;  1PC4 A;  3V4I B;  3VV2 B;  2M3D A;  3RAX A;  4Q0B B;  2YKQ A;  1HWI A;  1EET A;  1YG0 A;  2I5J B;  2ZKT A;  2AZ1 A;  4OX6 A;  2FVQ A;  3CNQ P;  3TA0 A;  3VZH A;  3S7R A;  4OYI A;  3Q83 A;  2RDD A;  4YHH F;  1RAB B;  3LAK A;  5DLG A;  2OKQ A;  1M5O C;  4J9M A;  2CQD A;  4K4X A;  5IXU A;  3UD4 P;  3DRS B;  4DF8 A;  4A8Q A;  3CJ4 A;  1SL0 A;  1WTB A;  1PAU B;  3IGV A;  2XI2 A;  2QLW A;  1DQ8 A;  1NZA A;  2EVZ A;  2YWW A;  2COL A;  2VG6 B;  3CMA S;  2N82 B;  3IAM 9;  3EZU A;  1Q79 A;  2HWH A;  1R8B A;  3EE3 A;  2DGV A;  1D9D A;  3HSD A;  4ZIV A;  2V4Q A;  3KK2 B;  2EK6 A;  1OQ6 A;  2UXD F;  3DKD A;  3O1L A;  1ARO P;  3TVZ A;  3VCD A;  1KEK A;  2HQD A;  1TAU A;  5ETS A;  4C97 A;  2BX6 A;  1CJV B;  1TEL A;  3KUE A;  4YUD A;  7FDR A;  4RNH A;  1VOM A;  4JYA F;  2M8H A;  2LP4 A;  2BRK A;  1VC5 A;  1XEZ A;  2N4C A;  3M32 A;  3OTC A;  1XMO J;  4DWI A;  1KC8 T;  3F56 A;  2MKY A;  2HND A;  1JNR B;  5K8M A;  4A4J A;  3E01 A;  3MDF A;  2KRR A;  1YLX A;  5GAD U;  1EZZ B;  3M30 B;  3R5A A;  3BEG B;  1RWM B;  1DZ5 A;  5J1N A;  1P1T A;  3D68 A;  1VQ7 S;  4W90 B;  4I1T A;  1Y5L B;  8RUC A;  4DV0 F;  2C42 A;  4EEY A;  2K8G A;  1M1H A;  4CT8 A;  1GMW D;  4KR0 B;  1UEK A;  3LA0 A;  2JOQ A;  2DHG A;  3HI9 A;  1RLC L;  2HQ3 A;  4ETZ A;  3QPI A;  2NXE A;  1QUP A;  4X4R A;  3JSR A;  3EVO A;  5FII A;  4H4O A;  4EYI B;  4HEA 9;  5IM0 A;  1CQM A;  2IMW P;  3MHY A;  3D67 A;  1UJ5 A;  1EP4 B;  2FB0 A;  2HNZ A;  2KU7 A;  2D9O A;  2BKP A;  2GW8 A;  2LKZ A;  4IDK A;  2R42 A;  4R8U A;  3HJV A;  1IKW B;  4DR2 J;  4WP3 A;  4ED8 A;  1HYS A;  2CUY A;  1OSC A;  4ZPT R;  4NLR A;  4A8X A;  1BQX A;  5C25 A;  1SC6 A;  3AOB A;  3V5R A;  2WON B;  3HCX A;  1CBK A;  3MUR P;  3WIU A;  1JIH A;  2IJR A;  1D0E A;  3U1N A;  3OL6 A;  2VF3 A;  3HT0 A;  5K14 A;  5GMD A;  4LRF A;  4F4K A;  2Q6B A;  4QCL A;  1HNV A;  5B09 A;  4U8V A;  1TK5 A;  2IYI A;  4BWJ A;  2DNR A;  2UXC J;  4MAK A;  1HBN B;  2Y0B B;  2R7V A;  1KSP A;  1LW2 A;  2C2O B;  3B4D A;  1Q8I A;  1GTH A;  4Y28 C;  2HHH J;  3GJQ B;  2KI2 A;  3DOM A;  3W65 A;  4LF4 J;  4AND A;  4DX8 H;  1FX4 A;  2DKO B;  1FES A;  3GFH A;  1OO0 B;  3UNY A;  3KLE A;  3KJV A;  3I0S B;  1XTZ A;  1NJY A;  4EWT A;  5CH7 B;  3RBD A;  1V3Z A;  4E2F B;  1FJC A;  1BQN A;  2V8V A;  2GJI A;  3D54 A;  4A8K A;  1NJX A;  1HQ2 A;  4LSZ B;  4QW8 A;  2K1R A;  5C2G A;  4CLK A;  4DL7 A;  2GML A;  1CJU A;  4AT1 B;  2DNP A;  3TYT A;  1YJR A;  3QFH A;  4KQZ A;  2NPI A;  3OXG A;  3OHA A;  5F8G A;  4OV1 A;  4JI0 F;  2JLE A;  2OPP B;  4NZ0 A;  1CUL A;  4QIG A;  4MIA A;  3IM8 A;  4YB6 A;  1KD1 T;  2OTJ S;  2LXI A;  3MEE A;  3VGV A;  3EGW B;  4DV3 F;  2L48 A;  1DJ0 A;  3MUM P;  2RQK A;  1GEH A;  4PPZ A;  2KJV A;  3CJ5 A;  4GKJ J;  3UE2 A;  5KFW A;  3IGN A;  1FJG J;  1ZOT A;  3DNC A;  1RHK B;  2G0I A;  5KFZ A;  2MLZ A;  3W5X A;  4NXM J;  3M8Q B;  1VQ8 S;  3RG6 A;  3PO4 A;  4M5D A;  1YRT A;  1H2V Z;  3U1M A;  3OT9 A;  5KFB A;  2BMB A;  5DQI A;  1FDA A;  5KFN A;  2E1R A;  3TP2 A;  1NK4 A;  2L41 A;  5GAG I;  5DJB A;  2DO4 A;  3DMJ A;  2RQC A;  1S72 S;  2BJ8 A;  4RW9 B;  1SQF A;  3CJR A;  2DD8 S;  4KFB A;  1NM2 A;  3TQE A;  3NNH A; 
#chains in the Genus database with same CATH homology
 1ZS6 A;  2BEF A;  1NSK L;  3NGR A;  2DYA A;  1HIY A;  1W7W A;  2AZ3 A;  4F4A A;  3ENA A;  4DI6 A;  2AZ1 A;  1S59 A;  3Q86 A;  4EK2 A;  1NLK L;  4S0M A;  3EVM A;  1NB2 A;  1NPK A;  4UOF A;  3EMT A;  5CAB A;  1LEO A;  1JXV A;  3ZTQ A;  3Q83 A;  1VYA A;  3FBE A;  4C6A A;  1S5Z A;  3Q8Y A;  3FCV A;  1MN9 A;  3FBB A;  3ZTS A;  3EM1 A;  4ENO A;  2DXE A;  4DUT A;  1WKL A;  3FBC A;  3Q89 A;  1BUX A;  2DXD A;  3VGS A;  3R9L A;  1NDL A;  3Q8U A;  1KDN A;  1UCN A;  3FC9 A;  1WKJ A;  3ZTP A;  3VGV A;  4FKX A;  2VU5 A;  1NDK A;  4ANE A;  2NCK L;  3BH6 B;  3BBF A;  1PKU A;  3FKB A;  5CAA A;  3VVT A;  3VVU A;  1EHW A;  3BBB A;  4HR2 A;  2DY9 A;  1F6T A;  2ZUA A;  1B99 A;  4ANC A;  3VGT A;  1LWX A;  5C7P A;  1NUE A;  2CWK A;  4CP5 A;  1NSP A;  3NGT A;  1HHQ A;  1U8W A;  3MPD A;  4UOG A;  1BHN A;  3DDI A;  3Q8V A;  1NDP A;  1WKK A;  4O0N A;  3EIC A;  3JS9 A;  3EVO A;  1NHK L;  1XQI A;  2DXF A;  3FBF A;  3ZTR A;  3EE3 A;  3PJ9 A;  3FCW A;  1NSQ A;  3B54 A;  1F3F A;  5BXI A;  4AND A;  1MN7 A;  1PAE X;  4KPC A;  4W98 A;  3DKD A;  1NCL A;  4UOH A;  1BE4 A;  3B6B A;  4WBF A;  1HLW A;  1B4S A;  3L7U A;  2HVE A;  3GP9 A;  2HVD A;  3VGU A;  4DZ6 A;  3ZTO A;  2B8P A;  5IOL A;  4F36 A;  3ELH A;  2HUR A;  3G2X A;  1S57 A;  2BX6 A;  3NGS A;  2B8Q A;  3EVW A;  3WX8 A;  1XIQ A;  3ETM A;  3BH7 B;  4FKY A;  3GPA A;  1K44 A;  1NDC A;  3EJM A;  3NGU A;  3PRV A;  3BBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...