3EVWA

Crystal structure of the mimivirus ndk r107g mutant complexed with dtdp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 42
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3evwA00
4C6AA 2DXFA 3FC9A 3FCWA 1KDNA 2BEFA 3PRVA 4DZ6A 3EVWA 3VGTA 1NSKL 1W7WA 4UOHA 1BHNA 2BX6A 3NGSA 3FBCA 3DKDA 3EVMA 1EHWA 3MPDA 4S0MA 1NDCA 2AZ1A 1PKUA 1F3FA 3NGRA 1NLKL 2DY9A 1U8WA 3ZTPA 4WBFA 2NCKL 3DDIA 4UOGA 1BE4A 1NPKA 4F36A 3EE3A 3G2XA 1WKKA 3FKBA 5C7PA 3ENAA 3VGVA 1JXVA 1LEOA 2CWKA 3B54A 3VVUA 4DI6A 2B8PA 3ELHA 3GP9A 1WKJA 3ETMA 1NDPA 1XQIA 3FBEA 3EMTA 4FKYA 1XIQA 1NB2A 2VU5A 3PJ9A 1B99A 3ZTSA 1K44A 3BBFA 1LWXA 3FBBA 3ZTRA 1VYAA 4ANEA 2AZ3A 3VGSA 4W98A 2ZUAA 1PAEX 1HHQA 1WKLA 3Q83A 3FCVA 3Q86A 3NGUA 1F6TA 5CABA 1MN7A 1S57A 4O0NA 3FBFA 1S59A 3GPAA 2DXDA 3B6BA 3WX8A 1ZS6A 2HVDA 3EVOA 5CAAA 2HURA 1S5ZA 3JS9A 4EK2A 2DXEA 4UOFA 3VGUA 1UCNA 3Q8VA 3Q8YA 1NCLA 3BBBA 2DYAA 3EICA 3BBCA 1NSPA 3BH7B 1NSQA 4HR2A 3VVTA 5BXIA 3Q8UA 3R9LA 3L7UA 3EM1A 4ANCA 1HLWA 4ANDA 2HVEA 4DUTA 3EJMA 3BH6B 3ZTOA 5IOLA 4F4AA 1BUXA 1MN9A 2B8QA 3NGTA 4CP5A 3ZTQA 4FKXA 1HIYA 1NDLA 1NDKA 4KPCA 1NHKL 3Q89A 1NUEA 1B4SA 4ENOA
chains in the Genus database with same CATH superfamily
1RLDA 4CTAB 3FC9A 4DZ6A 1PC4A 1RT2B 2VFVA 1S4FA 3AOAA 4WP9A 3ENQA 3GJRB 1FTCA 3E3XA 1XNQJ 2JDJA 2VKZG 1P6TA 2QA2A 3UDLA 3CO9A 1ELOA 2QO3A 2D3OR 1HQ2A 2XHWA 2Z56B 4MMOA 5KFCA 5L1LA 3CCWA 3MMCB 1X4CA 3GIIA 3C14B 5DLGA 3NG8A 3U7JA 3W1YC 1EP4B 3G8TA 3HSJA 2RT3A 2HRTA 1YDLA 5M2RA 2B4VA 4R0EA 3I5AA 5HMXA 3L9ZA 3UR0A 2W24A 1UPMB 2HYIB 3LGMA 1WHYA 3KG4A 2DGTA 2G0IA 2E5IA 4TLRA 5CCMA 4CI0B 3MCMA 2DNGA 4M5KA 3BB5A 5F41A 2MQQA 2CRLA 4USWA 3EDRB 3HVWA 1U45A 3WBZA 2FVCA 3MAHA 3H2LA 5IQQA 4JI8F 2DGVA 1P9YA 1TR0A 3HFKA 5KFNA 1WEXA 3R6LB 2HFUA 2HMIB 2AW0A 3DRPA 2KG1A 2NCKL 4DS5A 4F36A 3BGRA 3PO4A 1JXVA 1DQ9A 1SC6A 1VR6A 3M30B 5KG1A 2MKJA 3RG6A 3NMAA 3SXLA 3VGSA 1JKHA 4LRCA 3MEEA 2F4VJ 2OGUA 2E7WA 2KO1A 1HR0J 1RKJA 2R2UA 3AD8C 4JI7F 4MIAA 1U6BA 1TKZB 2R7XA 3IM9A 2IAJB 1NPRA 5L9NA 4O3PA 3CCUS 3DOLB 1NRKA 3LA0A 4IFVB 3MM5A 2M4MA 1BD6A 3FMBA 4CDIA 3I56S 3M1VA 4ZPAA 2NXUA 4QYZK 2I38A 2BVZA 3FRZA 2LQ9A 4I2PA 4O23A 2ZVIA 4QPTA 3HVTA 3GR1A 5JUMA 2IRUA 4MFBA 4RNMA 3CJ4A 2VUGA 3TZYA 3MAAA 4NX9A 3TI0A 4RWWA 2BUNA 2FIUA 2BX6A 3Q8QB 4EU0A 2W8LA 1NO8A 4IG0B 2HQ3A 1K0VA 4NYPA 3DOMB 4CT9A 4OZ0A 5IV4A 5KAKA 3PO5A 1M5HA 3IRXA 2J76E 4A8WA 4HL9A 1RT7A 2VOOA 4TU7A 2ACYA 2FHJA 3OL9A 4C3KA 3LP1B 2Y1RI 3PRDA 4IKAA 5CYJA 1RQ0A 4EZ6A 2HVDA 3DU6A 3GFZA 5HSPA 4OYBA 2MJNA 2ADBA 1KQFB 4EMDA 2AV5A 3R3TA 1CJUB 5KT3A 4Z7CA 1S7IA 1FKOA 2EG1A 4XO0A 3MOZA 2PSZA 4JP8A 1TL3A 1GH8A 1YJVA 1EIYB 1FKPB 2HQCA 5DDPC 2BR0A 1MN9A 2V4RA 3UCUP 3SI8A 4CO1A 2J6UA 1BLUA 1ROFA 5C42A 4JOUA 2DGWA 2IJFA 1VGYA 4ECTA 1T03B 4HTJA 5IQ6A 4ED2A 1HNVA 2DY1A 3MEKA 2N3OA 2D9PA 2YBVA 5I3PA 5HAOA 1YLXA 2PIIA 1WF1A 3O1LA 4DX7A 1XMQJ 4RR5A 1B7YB 5ETOA 2Q66A 2RQ4A 2HGNA 3A4TA 4C0HA 4OZ2A 1HBMB 1OO0B 4B3MF 3KFWX 4RW9A 2PN6A 4X64J 4DR4J 2ZOMA 4LSLA 1VHIA 3WIVA 3L4BC 2GMJA 1HPZB 2FC9A 3VGUA 4KFBB 5KFUA 4ED6A 1T8EA 2MKHA 5C2CA 1UEUA 4B08A 2EXUA 1X4DA 2ZH8A 3V6HA 2E7VA 3Q8UA 4N8NA 3HHLB 3KHGA 1NEEA 3IGVA 2DKOB 4YEAA 2O3DA 5B7WA 3V81A 1DTTB 3DDKA 1YHQS 2LEPA 2DTJA 2E1RA 2PMZD 1T3OA 3TJ8A 4F4KA 2IM0A 3GV5B 2OELA 3R1HA 2F8MA 2XYGB 2CJ9A 2H54B 1QY7A 5FDLA 1S4EA 4R25A 3T1HJ 2QFIA 4ZPDA 2XLKA 2HHWA 2GHVC 1DTQB 1RAGB 1Y4ZB 4B9NA 3OFHA 1WKLA 2V9WA 2DT9A 2H4YB 3GFHA 3N5BA 4GVBB 1QE1B 4ZMMA 1XJWB 4Z7YA 4DR2J 1UCNA 5KFIA 5J2MA 3EZ5A 3MM8A 2Z30B 2RB7A 4DPTA 3TZZA 4Q0BB 3BZQA 4DR5J 5E7OB 2GVDA 3H98A 2ZH5A 4C8ZA 5CA5A 2C2KB 2VC1A 3W8PA 2ZH9A 4NEZA 1FFWB 2DCLA 3PHTA 1Q8KA 3DHXA 1HYSA 5ETLA 1FK9A 4PKDB 3QIPA 4N56A 3L7OA 1UFWA 2VG6A 2DR6A 5MAOA 3DLEB 4IYQA 3RRHA 2IJRA 1MLAA 3CMQA 4C7QA 1T3NA 1U47A 3ILOA 4P73A 3BKFA 4ZITA 2VA2A 2JVOA 1VQ5S 2B8PA 4OHWA 4QZVB 1RWUA 1XQIA 2CWXA 3JSRA 1CULB 4V19X 1CJTA 4C8OA 2HVZA 2IYIA 1GT8A 4NLDA 3W66A 2HBYB 2ZBPA 1OIAA 4TXSA 1S0VA 1IR0A 4CO0A 2Z58B 3TAMB 4DV3F 3R5GA 4ZPTR 4KHPF 3HVAA 1D3WA 3NOGA 4MKAA 4EO8A 2VC0A 3MM9A 3P5TL 1S49A 2D41A 4FNHA 1HHSA 3LUYA 2KM8B 3EGWB 1IR2A 3BM7A 1RTJA 2N4DA 5A8WA 2ZH7A 1NDLA 2VPXB 1PYSB 4DQSA 4C6AA 5D77A 2IA6A 4YB1P 2HIQA 3HM9A 5KFBA 1RWWB 3ISZA 3LPYA 1GXTA 2PD1A 4NXNF 4UOCA 2QA4S 2IYGA 2YKNA 1UFKA 2BQ3A 2B9WA 5K8MA 1RK8A 1PIEA 4U9RA 2R8HA 2X3GA 1FVQA 3RRGA 5B08A 4DCJB 2D9OA 2WRMA 4QIWD 4WF9Q 4C8NA 1OWXA 3CD6S 4KIAA 2KT2A 3UR3C 2LP4A 5GADI 3G87A 4NE9C 5GAEI 1KQKA 2MLXA 4OYOA 2C2RA 2V9KA 4CTAA 1WOOA 2V4JB 5ETMA 1RT2A 1CSJA 2HZVA 2CJBA 4LF7J 4B3RF 2KFYA 1NXIA 3QO9B 2VG5B 2NZCA 5D4LA 3VAGA 2CPYA 1U2RA 2ZZNA 1AW0A 1D9AA 3MEDB 1VBZA 3M9NB 1RHQB 2Z0GA 2BW7A 1F2HA 4ZP6A 5H9EJ 2YVSA 2A18A 2OLWA 2P2CB 4TN2A 4PAAA 1SKRA 3MMCA 1KRPA 4LF6J 5KFKA 3UCGA 3C14A 3G96A 4WPAA 2VFRA 4X65J 2YX1A 3SZ2A 4KQZA 5CCLA 4K4WA 4KKOB 2W4PA 3N6MA 3NCPA 1LK7A 2ZZTA 4FBUA 2O01C 1YQHA 1XN9A 4LFCF 3SSRA 3TUJC 2LQ5A 1S6OA 3BDPA 2R7OA 1VI7A 1WHXA 1Q78A 2J5AA 4ZVHA 4XDCA 2XS5A 1R8BA 1SJRA 2AQ4A 1GTHA 2GQ2A 1TP7A 3IM8A 3DDNA 2FHJD 3ZXWA 4M5NA 1PO6A 3NCQA 4ICLB 2DEJA 3IWLA 2PEBA 2AGQA 2HMIA 2EBGA 4DUYJ 4YP3A 3M30A 4F0MA 7AT1B 2EFGA 4XTTA 4ED7A 4UUWA 4NLVA 2MZJA 2RUSA 3F41A 3V6KA 3QRRA 4J9OA 1KVKA 1AFIA 3I31A 3VGTA 1FCAA 4LFBF 2IAJA 3I9V9 3RW7A 3DOLA 4ITSA 2G0CA 3W2VA 4KB7A 2AEMA 2BJEA 1UVMA 2V6AA 1EAYC 1FJ7A 3A3NB 4ECYA 1NDPA 1NHVA 9RUBA 4EYIB 1H2TZ 4MKVA 1D1UA 3IG1B 1WSVA 2CPXA 2LU1A 4MKYA 4ECQA 3CJRA 1VBYA 3AXKA 4B3SJ 1Q79A 3MURP 1YITS 3CJ8A 5IWAF 4DV4F 5KG7A 1WOSA 4JB8B 1TKXA 2C22A 1Q95G 4QBUA 5DM6Q 4IG0A 2EWHA 3P45B 2DGXA 4ZPBA 4LF5F 2BKOA 4OX8A 2BQRA 1X5OA 3D1OA 2BJ3A 1GEHA 2X51A 1SV5B 5KFTA 1APSA 1U8SA 1HNXF 1UW9A 4NPOA 5AE2A 5HBMB 4IFYB 4KTQA 3NP5A 4ECVA 1LNQA 4URQU 4YHHF 2PFFB 1FESA 2HSEB 4GRSA 3R5DA 2MSSA 1TKTA 3H59A 1ZAWA 1FRHA 1RYSA 4FKYA 4ZVRB 5CD4A 5HVHA 4O3SA 3BGOP 5F3TA 3H42A 2PT0A 1T9YA 2O5DA 1FKPA 1X4GA 2AF6A 1NJYA 4DR7F 2K06A 4C8LA 1TMMA 2VOPA 1TV6B 1HNWF 1LWFB 4O3RA 3RBEA 3AFGA 1BGXT 1T03A 2ILZA 3CCES 3FRYA 4RUHA 3HXMA 2KL8A 2NS1B 2QC3A 1YJNS 3BJYA 5B0CA 3CNQP 3EX7B 2JSXA 2MKIA 3O44A 2V2ZA 2VBXA 1FRLA 1D8ZA 2U1AA 3M8PB 3MXHP 3M8YA 1OQ3A 2N3LA 2CAJA 1JLEB 3FEYB 4WE1A 2BA9A 2DY9A 2EFQA 2LMIA 1HPZA 4KFBA 1WKKA 2EI5A 5A8KB 4OFZA 2XO7A 5HATA 3A8EA 4USVA 3SCJE 3HHLA 4Y2KA 3HPOA 2UXDF 1VK8A 1DTTA 4A8QA 1RDRA 5SUHA 1S6PB 3NGUA 2K8GA 2OD6A 3GPAA 3M2RB 1U6ZA 1IQTA 3DM2B 1W2BR 3RAXA 1XK8A 2NXEA 3OTCA 2XMTA 1GX6A 3OTBA 3AXMA 3RAQA 3A3OB 3T5LA 2UUAF 4NZ6A 2XMMA 4G1IA 2X1BA 4XIUA 1S0OA 1N8RT 2W4DA 2OSQA 3JQMA 3AT1B 3DLJA 3DFEA 3FSIA 1BUXA 1VFJA 5EX3A 2FJEB 2QIFA 2V8DA 1DTQA 4NLTA 3MCOA 3RYLA 1E6VB 5BR8F 4Y34A 3FBCA 4GVBA 1QE1A 3FZBA 2I5JB 3Q8SB 2DIVA 1PJ6A 5F0WA 3B4MA 1KBRA 2L9NA 1Q86T 1W2IA 3MR2A 2OJ3A 4DOZA 1H6KX 1HMVB 5LMUJ 1CPZA 3E01A 3OLBA 1U02A 2R9LA 1TK5A 4DZDA 2HHHJ 5A0YA 1QM9A 1UPPA 3BGLA 3AB4B 1HD1A 4EUVA 3RB4A 5KFWA 1UZHA 3DLEA 2HHUA 1JLGB 1N0VC 4KR0B 3RBDA 5GAHU 4CH7A 2AEJA 3GLJA 2COLA 2I2YA 2JOQA 1C0UB 3G6XA 5IT4A 3EJMA 3Q0AA 3QRPA 1OYDA 1HBNA 4A8OA 3M6XA 3BO4A 1CULA 1K47A 1ICEB 1D09B 4ZJOA 4ENOA 1X9SA 2R7WA 2EC0A 2BEFA 1VQMS 1EKSA 2CJKA 2I1RA 3HHLC 1EQ0A 5H9FJ 3QRQA 4ER8A 2UVWA 1YTYA 4C8KA 4AXIA 3I55S 3TAMA 2BRLA 4U7CA 3NLCA 1TL7A 3OD2A 4IH7A 1UVNA 1DBDA 1S1VB 1K44A 4DL3A 3B4DA 4N41A 4DMZA 1KC8T 4X66J 2DRAA 3BO3A 5K8PA 1FVSA 2IA0A 2W4CA 1Q81T 3JYTA 3PG9A 1SL1A 1S0MA 2KT5A 4ZP8A 3R7SB 1L5UA 4YS2A 4HHUA 1CJVA 4LQ9A 2FUG9 4CO2A 1NAQA 2CQ3A 3OQ2A 2E5HA 2EKYA 2DD8S 3PNIA 4K8RA 3NWRA 4OJ3A 1KOHA 1RSCA 2GHPA 1R8HA 3EGZA 4FKXA 3NAHA 4MAKA 4NZ0A 1NDKA 3G86A 3UW1A 2WB4A 2G2OA 4FDFA 1VQ7S 3ZZYA 4IO9Q 1C1CB 3NRBA 1NDCA 1RWNB 2POKA 1QDUB 2WONB 5ETKA 3EE3A 3BN4A 3JAMU 2V4JA 4FF4A 1L3VA 1EARA 4L3KA 1XIQA 2HGLA 1ZM9A 3QO9A 2VG5A 1VYAA 3CD7A 1DJ0A 3KUEA 1PGZA 1HNZJ 3MEDA 3CJKB 3AOBA 5KFPA 4ZVSB 3JSMB 4USTA 1JLFB 3JS9A 2NYHA 2M52A 2FC8A 3KLIB 1N88A 1KSPA 1U09A 2DYAA 1REGX 2AGPA 5DQHA 5FLXY 4OI1A 4CO3A 4RUAA 3MR7A 3BSAA 1GFWB 4Q44A 2GJ2A 4KKOA 1LXJA 1S6QA 1VIOA 4ZP7A 3GMGA 3KUHA 1IR1A 1HIYA 1VLOA 3TQ1A 2HPUA 2B43A 1RWOB 3M6VA 1VC0A 1M1GA 3PY8A 2CDQA 5HQMA 2AZ1A 2J0SD 1JNRB 4LF4F 1ITPA 2CADA 1QSLA 4ICLA 2VQEF 2IIHA 5KT4A 1T0TV 2HVHA 4M94A 4DV2J 3NWGA 2W8KA 3OL8A 1NJWA 4F3OA 1UZDA 2XMKA 2OMOA 1N48A 3IR5B 3Q8RB 3Q86A 3DRRB 2Z2ZA 3N6LA 4F2SA 4O3NA 1XBWA 1XEZA 3FFIB 1U4BA 3QAUA 5K8NA 4QR0A 5GMEA 3H5SA 3IAS9 3SBMA 3SCLE 1X8DA 2IM3A 1RT5A 1U1KA 2FHMA 4DF8A 3C15B 4OYIA 3ITHB 1KFDA 4PUOA 2GV1A 2D74B 3DI6B 4Y28C 1LOUA 5F8GA 4J9NA 2JLFA 2XMAA 4DLGA 1WUUA 1FXRA 2JX2A 3PRVA 3W61A 2OPRB 1X0PA 2ACMA 3HD1A 1WG4A 3LF0A 3NKYA 4JI1F 2Q79A 5A2QY 4BDPA 2R7SA 3K8VA 2CWKA 3LTOA 3LH2S 3GV7B 1UETA 2R3VA 1RT3B 3H4BA 1B99A 4V1Ak 4ANEA 1URRA 2VL1A 2ASLA 2V4QA 4RU2A 3GJQB 2M3DA 3CB4A 2VFTA 2G1DA 3HHLD 4TY8B 4X62F 1AB8A 1A6LA 4OYPA 1SV5A 2W9BA 4W4MA 2QG9B 2C2EA 5HBMA 5D15A 4DV7F 3ETOA 1IBLJ 2MKKA 5L1JA 2HFSA 2EEYA 3PDNA 4UQGA 2FVSA 2OSRA 4DFKA 2NR0A 1NSAA 3P8BB 1FJGJ 1GXLA 1DLOB 2QA1A 4OJHA 4JV0A 2EW9A 2E5GA 5DGAA 3PVXA 2KFNA 2RRAA 2VV5A 1T9UA 3TA2A 4K0KF 2VDIA 1CEZA 5DG8A 2QLXA 4KC5A 4L3NA 5KG6A 3CPWR 2H3EB 3M8QB 1TV6A 5F3ZA 1K8AT 2FDNA 3PM9A 2C1EB 2BYCA 8RUCA 1R8CA 4B3OB 2JH3A 4K2XA 1PCAA 4O44B 1OPZA 2MTLA 4NEYA 3T9NA 4OYZA 3MMBB 5ETRA 3ZTSA 2R7RA 2DHAA 2MGZB 4NCAA 4NCGB 3FBBA 2DHXA 3L09A 1LWEB 5RUBA 4U96A 1KQGB 4ECWA 3KXDA 5CAAA 1LV5A 4L73A 1VQKS 3M8PA 2B56A 4FVCA 5A8RB 4DL5A 2FYXA 4Y2AA 1JLEA 1S1WB 4FXDA 1PSDA 1UVLA 3BV8A 5L38A 4LF8F 2G9OA 2W9CB 4JV5F 2BE2A 3ZTQA 1ZBTA 2B9XA 1TVRB 4NLOA 1M5OC 1S6PA 5ETNA 4C11A 2ASJA 3ZZPA 5DZ6A 1PBAA 1UJ4A 1HWKA 2RKIA 3IRWP 1MMNA 1Y11A 3BYPA 5ETVA 3SYZA 4ZCLA 5K20B 2FLLA 1WSRA 5B0EA 4ILLA 2NSCA 2CNLB 3TZWA 3W7BA 3PX0A 3CDWA 5IM0B 4ED4A 2B4OA 2OFGX 5LSOA 4H4OB 2J9CA 2Z2LA 4PQUB 4ETZA 3NNHA 1S59A 4LF1A 2F4FA 3GSIA 1S9EB 4HTIA 1UEKA 1E6VA 3OT9A 4CM0A 3BH7B 1FDDA 4KE5A 3I0SA 1NK7A 3K0JA 4FYVB 2E5LJ 3CCZA 1OMSA 1LW2B 2KTQA 1TFWA 3S8SA 2YWFA 2HBQB 1B0TA 3KLHB 5J2NB 3IN5A 2I8EA 4CO4A 3R7NB 3C8YA 4DR3F 2MLZA 3KG0A 2XGQA 3QFHA 2YY3A 1KP6A 2OEKA 3ILIA 1JLGA 4LBHA 1ZA2B 4LFAF 4DR1F 6FD1A 2KZMA 2E44A 4WZQA 3V2UC 2EVZA 5I3QA 3ADAC 1RAFB 2VU5A 4UQTA 2CQ1A 1C0UA 3DRYA 1IKVB 4LJMA 3TWZA 3DOKA 5B0BA 4PWUA 2I0XA 3T6BA 2GNKA 3BKTA 4CO5A 1HW8A 3SQGB 4BLGA 2HURA 5F8JA 3TVKA 1JJHA 3MR3A 4QU6A 5HQ8A 4WYLA 3D9BA 3J7Z5 1U1QA 4ANCA 1N36F 4F0HA 1HBOB 4URSA 4OYXA 5F8IA 3M2UB 3K2YA 3PX6A 1NBEB 2BRKA 2G13A 3MAQA 1RHKB 1IBMF 1WJ9A 4IR1A 1RI7A 3JQJA 2QN6B 4LF9F 4LSZB 2BM1A 5AE1A 3G4SS 3DKDA 4JI8J 2F8EX 3OTEA 1F3FA 3CC2S 3THTA 4OL8A 1ZZNA 2L08A 2ZH6A 2HIYA 3ZZRA 1F0XA 3NXZA 3CT9A 2Y1JA 2RD5C 1SQEA 2HZAA 3IS9B 4LR7A 1VS3A 4CLWA 2KDOA 3CJ5A 4G1PA 2RILA 1SVDA 4JI7J 2W1BA 1IVZA 3IMQJ 4K50A 2UUCJ 3RJMB 1VQ8S 4I1TA 3ILLA 4ZA1A 1GK8A 4FF3A 1DAXA 5T7LB 2GVZA 1WELA 5KFMA 2P8IA 3WQPA 2WONA 2B5JA 5K14B 1N5TA 3SV3A 1HLWA 2KB2A 3PR5B 3C66A 3BH6B 3W3SA 4LSNB 2JFDA 1CLFA 3PW4A 3BEGB 1N56A 3CCLS 2JJ4D 1DY3A 3NS6A 2Y3YA 2QMWA 4M5HA 1WEYA 2CVIA 1B4SA 1JMTA 4YB5A 2CPHA 3CJTA 1UMJA 4NA1A 5HVFA 1JLFA 4M5GA 4MH8A 5BJRA 2HAFA 4DV6F 5EHHA 5M2PA 3IO1A 2FJVA 1PC5A 2Q6CA 2LDIA 2CDRB 4WFYA 3WX8A 3HSZA 1KHWA 3UD5A 1FNMA 3QT5A 5G0RB 4I67A 3UDEA 2M2BA 2QLWA 5KFDA 1RCOB 3L7UA 2R4FA 3HHKA 3PYDA 1RLCL 2J8AA 2LA6A 1FFSB 3QGGA 2F9DA 1VQYA 4FF2A 1S48A 3HHDA 3GSDA 3TUPA 2NXNA 4R8UB 2G4BA 3MHYA 4ZVFA 1MG7A 4JI6F 1MMLA 4FNIA 3M7VA 1N5VA 3DRRA 3EVWA 1NZ8A 2CJYB 2CG8A 2CZ4A 3T3FA 4B9TA 3CCJS 1HQUB 2ZBCA 2MQPA 4A4JA 1JIHA 3FFIA 4X66F 1BE4A 5GMKa 2W7PA 4X4TA 4M5LA 2WW8A 3MWBA 2HZCA 5KOXA 4PYDA 3C15A 2DHSA 3DRSB 3ITHA 5DG7A 2HQIA 3MTJA 3KJVB 2F3JA 2XY7A 2LDYA 1AUDA 3DI6A 2MY7A 3R97A 1RB0A 3WIUA 1QD1A 3GJTB 2GW8A 4QIGA 1RAJA 3V4IA 4WP8A 4TU9A 1HI0P 1FDAA 2JWNA 2WTFA 2C2DA 4M5DB 3OSPA 2GS8A 1A7GE 1U26A 4NA3A 2OPRA 4RZRA 3GFYA 3CGIA 2MQNA 3FZ2A 1OPIA 3EDQB 2V2VA 2QA4G 4OZ3A 3GCWP 1TFYA 2NPIA 5IC6B 3CE8A 2PGCA 4A8YA 1TK0A 3RB0A 2DRDA 4PWDB 5CYQB 2ASYA 2J9EA 3CUNA 2Y0BB 3A13A 1N54B 3E51A 2OPPB 4WFZA 3K5NA 4PWWA 4MYUA 4PXDA 4LT6A 4TY8A 5IT9Y 3SQOP 5EGYA 4ZK7M 1M5SA 2FTRA 4RW8B 2UVUA 2DHGA 4WU3A 2JLGA 2M0GB 5D0GA 3B54A 2RQMA 3KK1B 4ZP9A 3VQSA 2UU9F 1CQMA 2HBRB 4ZIWA 5HROB 2D7SA 3OXLA 2W01A 2HHPA 4IRKA 3PRBA 1XR7A 4GVLA 1SJFA 4F8RA 2WCXA 4CH1A 2RMLA 4J37A 1TUVA 4O0IA 3PR4A 2XO6A 4IH5A 4NLQA 1JWWA 2BJ8A 3WZ0A 2KXFA 2WVDA 3M8QA 4EBEA 1TK8A 4B3OA 3CCMS 3CC7S 1J5OA 4DG1B 3QPIA 3MUVP 3MMBA 3MUMP 1UFLA 1Q7YT 3US5A 1Y10A 3JQKA 1LWEA 2IM2A 2APOA 5KT7A 3NGSA 4TNOA 4QR1A 3PFEA 3KK2B 5KFVA 1FTRA 4RBUA 3VAFA 5A8RA 3D67A 5E3CA 1V3SA 1T05B 4ZVOB 3GP9A 4ECRA 4KH0B 2XS2A 4DU8A 5KFJA 4J9RA 4KHMA 1HWIA 2A0FB 4M8LA 4XK8C 5DLFA 4YY3J 2W9CA 4ZPVR 2ZJQQ 4KGVB 4PG4A 3G8SA 1ZM3A 4QCLA 2PC6A 3UDCA 4NLRA 1TVRA 5E5NA 2Z2MA 3J80U 4DV3J 4KHPJ 5KFFA 2HHSA 4DJBA 5AXLA 3PIPQ 1FDBA 1UVIA 2VPZB 4MIBA 2AJ2A 4UUXA 3EYZA 2DPJA 5HP1B 4DPUA 2K1RA 1R31A 2W7AA 4C3LA 5CD4H 2M8DB 3R5JB 2W2OP 1KONA 4PQUA 2HGMA 2XHCA 4TLQA 2YPZA 4FS2A 4NXNJ 1U0HB 3MI7X 4ELVA 3ZZ0A 5D3GB 2DHHA 4QWCA 2NQPA 2I6WA 2XYHB 3VCDA 1S9EA 2MZSA 3TAQA 2MQLA 3O2IA 3GR0A 1WKJA 2E1AA 1XWLA 3LAKA 3W63A 2AJFE 2XULA 3VTIA 1LW2A 2BM0A 3G6YA 4BS2A 2DNNA 1FRJA 8ATCB 3FJ2A 4K4ZA 2V2KA 3EPIA 5DRKA 3KLHA 5CZXA 1YX2A 1ZS6A 5GAHI 2HWTA 1S9GB 1FJGF 5I3UA 3NMRA 1VQOS 3DGPA 3MM7A 1V9OA 4R5PA 4NRTA 4B3RJ 1GNKA 3QWPA 2RJZA 4ZHRB 1AFJA 1HW9A 3FSYA 4F4ZA 4A8SA 3DMJB 3HSDA 3P49B 1WDDA 3CF5Q 1FD8A 1GAOA 4H54A 2J9DA 5KFZA 1IKVA 2QFJA 2QT7A 1FWKA 3K7RA 2C28A 2ADCA 5HQLA 3ZO7A 2ATLA 1SJ4P 4IQMA 3MTKA 3ZTPA 2ZVSA 2XMVA 3MM6B 1RHMB 4K4TA 3CXCR 3MCSA 4NLGA 4B3TF 2C3UA 2P9CA 2WBRA 4LFCJ 4RW7A 1ZOTA 4DU7A 3JTOA 3M2UA 1BQNB 2J0QD 4B9LA 2N7CA 4EK2A 1HBUB 1O51A 3UN3A 2AD9A 2MB0B 3PEJA 1NZAA 2KRBA 4PXCA 4OHYA 3GQCA 1GMUA 2F9JA 1ZPVA 2V8VA 2XC9A 2UVRA 3ZTOA 4NMLA 3VAHA 3S7RA 4W90B 1Y9OA 3IS9A 2CQHA 2MZ1A 3IBWA 1RCXB 4Y2MA 4G1QB 1Q7LB 4DSLA 4P6QA 5E3PA 3FEXB 3DLGB 1KNZA 4LFBJ 2HWIA 2GAGC 2G1HA 1IUJA 2RRNA 2IRXA 4ZLNA 1I94F 2RU9A 2OIHA 3KLVA 4P10A 4F4XA 5T7LA 4ZVTB 3K5LA 3SFUA 2LQ8A 4NYZA 1NB2A 2CXEA 3LANA 3L3CA 3RUBL 1GMWA 4I68A 2ZBIA 2XEXA 3W8GA 4EEYA 5KFGA 4U6PA 1MU2A 2ZUAA 5GMDA 1RHJB 4BHQA 5IS2A 5GAGU 2R42A 3HKZD 4ECUA 2XBPA 3OHBA 3QLHB 1AT1B 1X4EA 5IWAJ 4DV4J 4YB7A 2ALZA 3ZZZA 2CQCA 2PE8A 1H0HB 3LALA 3DXSX 2CNKB 1RAOA 3SSQA 1N32J 4ILMA 3N01A 2FD2A 4YMEA 1K1SA 1WC1A 2NXCA 1SKWA 2GFFA 1M1HA 4LF5J 2W2PP 2AIRB 2L9DA 2CQ0A 3POTB 5KG4A 1B0PA 3JB9k 3EGNA 3CW2C 5HN0A 3PCOB 5F8MA 4ZLLA 4ED0A 2WW4A 3MD1A 3AOCA 3QT8A 2XMJA 3VZIA 2CZ9A 4TYBA 3IFEA 4ILRA 2KRRA 1HNXJ 1YJUA 2GX8A 2OP5A 3BR8A 2LQBA 4C4WA 1U8WA 2CFXA 5EWEA 4YHHJ 1ZAXA 5EDWA 3GYGA 4FXVA 5G0RA 1O6XA 3QT6A 3BR9A 2F65A 1FE0A 3N4WA 3QZ8A 2V50A 3I0RA 1M90T 2VF3A 2C42A 4WU2A 2B7BB 1R3NA 2XG8A 4YR3A 5LMNF 4GKKF 2N4CA 4MK9A 4Z2XA 2D3ZA 3WHIA 4DR7J 2HQGA 1XMOF 1IWGA 3J81j 1ZZFA 2HFOA 2MPUA 1HNWJ 1D9FA 3P5BP 2D1CA 4HHJA 2BKPA 4ZVQB 3I4PA 1HQUA 2NYIA 4ZCKA 5KFXA 2HVEA 2RS8A 2VBWA 2CQ2A 4HHHA 2J7WA 4IO1A 3DRSA 3OL7A 2WHOA 2V34A 3KJVA 4RL1A 2XS7A 4DV5F 1UL3A 4MK8A 3DHWC 1YJRA 1PJ7A 2CUYA 2X1FA 1AZSB 5HLFB 1YKWA 3AJ2A 4ETXA 5IV3A 4CLTA 3FMWA 2IPOB 2DR9A 2YH0A 4JI2F 4YDDB 4WKRA 4M5DA 4GO7X 2JNJA 2VJUA 2RDIA 5A6PA 1Z2ZA 1YBUA 5L8RC 2P9GA 3AD7C 2E1MC 2R7TA 1JXEA 3HI9A 1MMDA 2UUCF 4ATNA 2K7JA 3I82A 3GIMA 3HZEA 1WC0A 2HKEA 2V0NA 2UXDJ 1RBOB 4AYBD 2MXYA 4DL0C 1N6QB 6AT1B 1FDNA 3Q83A 1G7CB 5CABA 1HI8A 2DO0A 1NKCA 4UY85 2RVJA 5CYQA 2CQDA 3OHAA 2OPPA 2B3TB 4K4UA 4HT5A 2IC3B 2YNFB 5FJ4A 2UUAJ 2P6TA 4A8XA 2ZOFA 2AHOB 2KKHA 2RQKA 2RSQA 3DC2A 4ZPCA 4WIIA 2K7KA 4TY9A 4KY3A 1YJTA 4AE5A 2NZ4A 2P6SA 3KK1A 4Z37A 2KT3A 3OVSA 3M2VB 2ZJRQ 1TL1B 1X4BA 5HROA 4I69A 1UJ5A 2FB0A 2ZH4A 4QU7A 5BR8J 2ZUGA 1RT1B 1FNOA 4ZLJA 3EGVA 3I5CA 4YQWA 4WIQA 3DN9A 5J2QB 4F02A 4HLBA 2WVBA 5C7PA 4EFAC 3GU0A 2YKQA 4RUCA 3QYYA 3NS7B 2QYCA 4FPIA 1NMEB 1OYEA 1C0TB 2WB1D 4ZVEA 2VD3A 3UI3A 2DNPA 5F8NA 2ZKUA 2H4WB 2UXCF 4X4QA 4RJVA 4CLPA 1HNIB 5AT1B 1T11A 2LXIA 4NRUA 2RF2A 4GC7A 4X4RA 4HKQA 2ZDOA 3PKYA 3DRXA 3MPVA 3C3LA 2MYFA 5C2GA 2LECA 4LMZA 3FK4A 3D4JA 4I7FA 3PYGA 2GA7A 3BPSP 1T9TA 4OX7A 4X4NA 1NK0A 2DISA 3EZOA 1ZA1B 2CQIA 1G6BA 1NLKL 3KLGB 4X4SA 5KT6A 5KFRA 1FRKA 3M8RA 5HMZA 4CLYA 3NAIA 4OV6A 1PYOB 3W5XA 1TUGB 3ELHA 2XCAA 1KTQA 3M8WA 4WFBQ 3ZTRA 2BOAA 2AJ0A 5HP1A 1YJ9S 1AROP 4PG5A 2XB2D 4QPXA 2A2DA 3PJWA 1UP1A 1HQEB 2R8JA 1DHMA 4IOCQ 1WOPA 1LFWA 4F26A 2LEAA 5HANA 4OQJA 4XDDA 3GCXP 2H1YA 5A6WA 1U0HA 3K5OA 2IFXA 5HMWA 2FZKB 1YZ7A 4HACB 1SJQA 3J7ZT 4ANDA 3SFGA 3KHRA 5D0EA 4ZJQA 3LQVA 1N52B 3Q8PB 1U1NA 1VQ6S 5J1PA 3LW5C 5AJ3F 2B8QA 2Y1LB 2FVPA 3SEOA 1I6JA 5DJBA 4FN5A 2HK2A 4KPYA 3OTOF 4QWAA 2OD4A 5EWGA 4O4GB 1S9GA 4LR9A 2NUHA 2IBKA 4F4YA 2J9DE 3OR2A 5THWA 2XSJB 1FWPA 1CG2A 3MDFA 4ZHRA 1Q8IA 3NNAA 2X1GA 1UKUA 1VRUB 1W25A 2AGOA 2HNDB 1Q0NA 2XTJP 2WOMB 1GMWD 3BQ2A 1TAUA 4OYAA 2P9EA 3OVBA 4A47A 4OLOA 4ZN3A 3FVYA 3OBIA 3ISND 2AJ4A 3W9IA 1WF0A 3X1LB 2NSBA 3ZNUA 4J9KA 3MM6A 4RW4B 4DV1F 3R8YA 2DR7A 1TL4A 1S76D 1IBKF 2VG7B 4ZS6A 3QJJA 4ELTA 4WWSA 4I6WA 2YNHB 3KLFB 1BQNA 4KGXB 1MROB 2HHQA 1NH8A 3TR5A 4YY3F 3VZHA 3D3BJ 4LF4J 2GQCA 1S10A 2XYPB 1BC6A 2CG4A 1Y3KA 2BW2A 4AL7A 4DI6A 5DETA 2VQEJ 4WFNQ 5EN1A 3HULA 5KFEA 3C16A 3GG0A 1FXDA 4C0OC 3GYXB 3IAM9 3M1VB 2W2QP 1FRMA 2GIRA 3UO0A 3R5CA 2BQUA 2AJ1A 2E7XA 4UT4A 4JI3J 3J81U 3B6BA 3HHNB 4I6YA 3K89A 4ZJLA 2KZZA 3HVTB 3J7YU 4M95A 2LLZA 1ZTTA 2V94A 5KTQA 4P2MA 3SCKE 4IUFA 3DLGA 3KJFB 3A12A 4KBIA 3NS5A 2CQ4A 3TEGA 2B4PA 4EZ9A 4DS4A 3D1QA 1RWKB 1TU0B 4WFAQ 2VJVA 2FVRA 4DPXA 2CNNB 1NK9A 3MMAB 3UVJB 3AA8A 5HO4A 3LPEA 1IKXA 2ZJPQ 1R0BG 4OYWA 3CCTA 2CJXB 1SBRA 1X60A 2LXFA 2ATCB 3QLHA 4B9SA 1WI8A 3IA0A 4KH1B 4JI1J 5B09A 1SJ3P 5DM7Q 3KK3B 1NJZA 3R2CJ 5F8LA 4QW9A 3OFFA 1Q82T 1J2VA 1SI9A 3EWGA 1FXLA 1U1MA 4A46A 2X1AA 3QMQA 4ID8A 1N5QA 4LQ3A 1X9WA 1WWHA 3POTA 2MKYA 3TW0A 4J9MA 2DNZA 2JEIA 1TL3B 4X62J 5KFSA 1S72S 3U1NA 4LR8A 3TO8A 2RH3A 1MNEA 1YSJA 1AXQA 1WD6A 4H4MB 3E8OA 1O0PA 3Q24A 5C42B 3C6UB 2HEKA 4DV7J 4C97A 2H5IB 1HNVB 2LCWA 1ZETA 4KYZA 4KSEB 1EP4A 2BMBA 4IDKB 4DV0F 5A76A 4PG6A 4ED8A 3QSYB 1EJ7L 2HNZB 2RQCA 3TAPA 1FT8A 2K2PA 4RBTA 5D0RA 4K0KJ 4X4VA 2RS2A 3QAEA 4NLYA 4RW9B 2MY8A 4GMKA 4EBDA 2ZZMA 5JMNA 2GGPB 2J0WA 2E5JA 3TQEA 3DU5A 4FXWA 3BGUA 4KV8B 2QX0A 3GONA 2GC8A 2VICA 1ZTWA 4Q8FA 2IRYA 5CXTA 2UXBF 3V81B 4PXEA 1Y5IB 3D6FB 3HVRA 5HLFA 2JVRA 3BBCA 3RZAA 2EFVA 3OUYB 1QVGR 3VHQA 3T19A 2P5VA 3M32B 2KXHA 3MCNA 4HT7A 5HL7Q 1VQ4S 3U1MA 2FJAB 2ZC3A 2YPYA 3UN2A 3W62A 4LF8J 1UA0A 2MZQA 1TKZA 2O66A 2WZ1A 2RIJA 2Y0SD 4TKTA 4JV5J 1BQMB 4P2FA 5DDQC 4IFVA 2MEWA 2SXLA 4IRDA 1N6QA 2AU0A 1NSKL 3N5FA 5H9FK 3T5JA 4TQRA 1UWAA 3R5AA 1URNA 1XR6A 3IGNA 1RADB 1CVJA 4A48A 3CD0A 4LRDA 1VRTB 2IC3A 2YNFA 5IZHA 2L41A 3AAWB 2AP6A 1UA1A 3CJ3A 1YRUA 3MM8B 3KG1A 3TP2A 4OJGA 2GVDB 1N32F 1WC3A 2CVEA 3NCRA 3H0PA 3M2VA 5MLCV 3RAMA 3DOMA 4I2QB 1TMJA 3PX4A 1HYSB 1TL1A 2L9WA 3HKWA 2GCFA 1S1TB 1Y5LB 4LRBA 3QIPB 4L75A 4CLUA 1RT1A 1T95A 1N33F 3LP1A 1VQ9S 3D28A 3CC4S 1RWXB 1S99A 4I4BA 2HWHA 3UWTA 2C2ZB 1CJUA 3BSCA 2PMWA 1WTBA 1R8PA 4Q43A 5DG9A 4WTYA 4DR3J 2XY6A 1KDNA 3H2UB 5JXSA 3HD2A 2PI4A 5I4MA 1HNIA 2ZC4A 2XM3A 3CO0P 2QL7B 1S97A 1V5VA 4LFAJ 4DR1J 2BACA 3MPUB 1DQ8A 1T9XA 3TOQA 1HA1A 4USUA 3AD9C 3BN7A 3LWLA 1RAEB 1RTIB 1Q8BA 1X5TA 3DLHA 2VFSA 3MM9B 4P2SA 2JEFA 3RR8A 1F6TA 3CULA 4URGA 1MWYA 3UNYA 1TELA 2GJFA 4BWJA 1FFGB 1YI2S 1NCLA 5KFLA 4ES3A 2KVIA 4L74A 2XSFA 3KLGA 1Q4RA 1S12A 5KG0A 3R9LA 3RB6A 1N36J 2YWGA 1HBMA 3NOCA 4CM2A 2GJIA 4YN3B 2JRSA 1BWEA 4RNNA 3VV2B 3DLKB 4LREA 3LP2B 1JJ4A 3NNCA 2J6TA 3NGTA 2F5GA 4ES1A 2HAIA 1IBMJ 3CD5A 5M2UA 2JEGA 3JAMY 1P8GA 4QW8A 4LF9J 3GIJA 2QE5A 2VQFF 2J7UA 2RRBA 1HQEA 2UZAA 1V6HA 4PZVA 3HCXA 2B7CB 4JI5F 2XLJA 1XTZA 4USMA 2KJWA 1YRTA 3QGHA 4F04B 3GB0A 4HACA 3BSOA 1IKWB 3DCAA 1F5BA 7FD1A 3MD3A 2LYVA 2FJWA 3FBFA 4AQYF 4JI4F 2AJQA 2XNRA 3ZZTA 3UFCX 4OIXA 4OI2A 1VQLS 4CLFA 1FEEA 3QZ7A 3UNGC 3R27A 1KLNA 4Q5VA 3BPDA 1IM4A 2WK4A 2KG0A 2CJQA 1IWAA 2WSEC 4O4GA 3EM1A 2R2TA 2DNHA 4ZKAA 2ZHOA 2OI2A 1JLBB 5KFYA 4DX8H 3A1YG 2QYGA 4CNYA 2BOPA 3BF4A 2XSJA 4CP5A 4QIEA 3QSIA 5DDRC 4Q0BA 2GAHC 1RKIA 3TJAA 3F44A 1VRUA 4JYAF 1LKZA 2HNDA 3LAMA 2PI5A 4DUZF 1NM2A 3M8ZA 3CCQS 1KWMA 3SMZA 2AX1A 1N34F 2WOMA 3PIOQ 2DNMA 2ZBQA 2IY5B 4DV6J 3SCIE 2HVIA 4WK1A 3MEGB 5HJXA 1RU1A 4WJBA 3CDEA 4NOHA 3UPFA 4C98A 1LWXA 3TA0A 4RW4A 5K8OA 2HLTA 1HWJA 1NHUA 4UTGA 4OHZA 3KJNB 2VG7A 4EYHB 3HFVA 1F5CA 2YNHA 3KLFA 1IJFB 4LBPA 1YWXA 4I0WA 4DPWA 1RJJA 1MROA 1QAYA 5AXKA 2HHTA 3RU0A 1KTVA 5B0FA 5B0GA 1SUQB 2HNYB 2MLYA 3K17A 2ZHBA 3QT7A 2GO8A 3HT0A 3A3PB 2XMWA 3ENVA 3IBFB 4MK7A 1OY6A 3W2VB 2MQOA 2Q3PA 4PR6A 2WVEA 4P2XA 4U95A 5E3QA 1FF2A 4C9DA 2Z8QA 2YX4A 4JI6J 4OI0A 1RBAA 5ITHA 3HF5A 2BJ1A 3RBXA 3G8QA 2W9AA 1Z4UA 2YNGB 2CPJA 4DQQA 3DGVA 1ACMB 4ZDNA 2UUBF 3FBEA 3THVA 1TKXB 3TRGA 3Q22A 1LXNA 3M4XA 2IVFB 3SIPB 4MYTA 2OMLA 3CMAS 4NZ7A 5E2QA 5GAGI 2KFZA 1DQAA 1G2EA 4A8KA 5F0UA 5FIIA 1S57A 4WXOA 3OPKA 3MMAA 3UVJA 4K4VA 3Q2SC 3S1TA 5HI7A 1E6YB 1XNRF 2E66A 1QLNA 3WX4A 2FLOA 2QMUB 4QR2A 3ZFVA 3KK3A 4DUTA 1WORA 3NGDA 5E3RA 5KFAA 1SH2A 1TKTB 4GKJF 3G71S 2MDAA 2A6OA 4KPCA 4JI0F 4OLPA 4NI2B 4BBYA 4W92B 3T5KA 2YTCA 1GX5A 1C1BB 5KT2A 1JLAB 4J9PA 4DSIA 1QTMA 2DNKA 4J9VA 2FHKA 3DDIA 1L3KA 4L6V3 1T02A 2BABA 1RGVA 4H4MA 1AYEA 4WFXA 3WC0A 3C6UA 2JC1A 4TU8A 2PDAA 2UU9J 4AL5A 2OUGA 3I6PA 3QNWB 3M05A 2J8SA 3BBFA 4RKUC 3PW2A 4DDFA 2C2OB 3LGHA 5C25B 1UJ6A 2VDHA 2EFNA 1M0SA 3U1LA 4I6AA 1S1XB 4Y2IA 4DHVA 4IDKA 3CJQA 4BC7A 1WC5A 5LXYA 1JNZB 4J9SA 4QWEA 2HNZA 4NWBA 2DNYA 1TL5A 2DNRA 4UY8T 6FDRA 2CKWA 4KGMA 2E9TA 1BXNA 4DPYA 1RYRA 4IG3B 2A2CA 4WE1B 4Y0FA 1HD0A 3ILJA 2GGPA 2KM8C 4TQSA 4F50A 4NLSA 4KV8A 2AYMA 4DSKA 1KVJA 1EHWA 5L9XA 3CCRS 4G3IA 4EBCA 3OFEA 5ETPA 5LSLA 2IMOA 3HSGA 2DK2A 3N9UC 4JI3F 3OUYA 1KS2A 3KDOA 1VISA 4J90A 3M32A 4USHA 1EETB 1HFEL 3OVAA 2AZ3A 2J7KA 1YBTA 1WDTA 1F2GA 2F40A 2C3OA 3MECB 1CQNA 1BQMA 5E33A 1NJXA 4CCHA 4FF1A 4PXBA 3MPYA 3PHEA 1JK9B 1UW4A 1PG5B 2XMUA 2UUTA 5LT5A 2YKMB 3IG1A 1U1LA 3JTPA 1OJ4A 4FZVA 1VRTA 3AJ1A 1SIWB 2DIUA 4U7UK 3BKUA 1B3TA 2WSCC 2YXLA 2ILYA 2OEJA 1J5EF 1F60B 1FX4A 4NXMF 3E01B 2RU3A 1QJHA 2KH9A 1R43A 1VC6A 3IWXA 4JBCA 3AQPA 4I2QA 1B70B 1S1TA 5A0YB 3Q2TC 4IRCA 2WAQD 1TTHB 4PEOA 3HHEA 5LL6d 3K5MA 4O4RA 3GTYX 2OHDA 3LO3A 3CIMA 1QAIA 1Q53A 3PACA 1M1KT 5E3AA 4IFYA 2DJWA 3TUIC 1H7WA 2D3O1 3P4UB 4B02A 1HBNB 3IWNC 2G2YA 2CNOB 2DXEA 4N77A 1VQPS 3GJSB 1IKYB 5CH7B 4F2RA 3TANA 3Q23A 3FSXA 1KKHA 4I56A 3W5YA 4QYZJ 4QWBA 4FP9A 3V5RA 4EGLA 5IT0A 1LWFA 4OHVA 1UTAA 1RTIA 3D2WA 1Z1ZA 3D3CJ 3T1YJ 2C3MA 1VBXA 5DO2A 1TL7B 3FCWA 4GC6A 1FI4A 2H51B 2VKRA 5D4PA 3OTDA 2OFHX 4Q7AA 3TX0A 2VPWB 5JJBA 1F3VA 3JYTB 2ERRA 2YWEA 1CJKB 4DCPB 3QGPA 3BQ1A 4B3TJ 2YH1A 3MFHA 1CJVB 3HMJG 1SKSA 4CWBA 3TYTA 4E0DA 2MJUA 3DLKA 2VASA 3LP2A 1QAXA 5T14A 9ATCB 3VWSA 5J1EB 3QQCD 4ZPWR 1YGYA 5A8KA 3PTWA 2WBMA 1A9NB 1JLCB 4FBTA 4N7TA 1OY8A 2ZM6F 4PG8A 3D5MA 3M2RA 1CS4B 2OEMA 3DM2A 1VHFA 3D6HB 1IKWA 4FPRA 4LVNP 2E1PA 1NHKL 3Q89A 4F3MA 1IQZA 3BYRA 2DR5A 3M8SA 1S77D 4XAKA 3EVMA 2XZWA 5D0HA 2XY5A 1JJCB 4NMXA 1YZ6A 1I94J 3G9CA 2ZOGA 4AT1B 3OR1B 2DCUB 4CLLA 3EMTA 2M8HA 4YDXA 5FD1A 3GFXA 1JLBA 2I5JA 3ULHA 1SQFA 2FLPA 1K73T 4EO6A 4B17A 2H5EA 1S6QB 2RHSB 3AJDA 3CTRA 2PMHA 1FERA 2ZH3A 1HMVA 1H74A 3FQKA 1DARA 4FYYB 1NSPA 5T41A 1SXLA 3UD4P 1NKBA 2DPIA 5J2PB 5HK4A 1VQNS 1YVFA 3I5BA 3HP6A 1N0UA 2CJAA 4OX9F 2AYBA 3MEGA 3S6EA 5KOWA 2CQGA 5IOLA 2DGOA 1H7XA 1ZAVA 3FUYA 3HFZB 2HQDA 4OZLA 2E9RX 3EUNA 2GIFA 4HEA9 3H5XA 1Y5NB 1RTZA 2C3YA 2V5HG 2W2MP 1JJ2R 1XC9A 2H9ZA 3TNVA 1WG1A 2OPQB 3QIDA 2V2QA 3LP0B 5KT5A 3CIZA 3N6NA 2CPZA 1P9QC 2FJBB 3VALA 1G3OA 1SH0A 4DCOB 2YWHA 2DNOA 3QJPA 1SUQA 2HNYA 4OJ1A 1RT5B 4ZIVA 3KLEB 1YK9A 4ES2A 5LMNJ 4GKKJ 3J7YI 4PUOB 2DO4A 3C19A 1OSDA 1XMOJ 3AA9A 1TQLA 4WTOB 5AXMA 1SC1B 4OYMA 1R6VA 2R8KA 2HBZB 4ZOSA 1S1VA 2ZHAA 2YNGA 2U2FA 1I1GA 3OW2R 2VH7A 5C24B 1VJQA 4DFMA 1Q5YA 4DV5J 3TJ9A 2R7UA 2PA8D 3GE9A 1G1XA 4JI2J 1D0EA 1RP5A 1XNQF 1E6YA 4J9UE 3FDSA 3H40A 4KO0B 4YOEA 2FVQA 4H4KA 2W9BB 3O8WA 3SSSA 1F9FA 1C1CA 5ETQA 3MMJA 2UVVA 3CWJA 3FCHA 1RU2A 4RW6B 1MN7A 2HS3A 2F63A 1JLQB 4RNFA 2LEBA 1QAJA 2UP1A 4DWIA 2A10A 3H4DA 1Q16B 4NI2A 2RUGA 1VLYA 2CZVC 2DITA 1C1BA 1JLAA 2ROPA 4KGZB 4DXLA 5IC4B 2W2NP 3KMSA 4N5SA 4LF2A 1H2VZ 5LM7E 3CJKA 3PJXA 1F9EB 4WYWA 4DQRA 3JSMA 1RACB 3JTNA 1NK6A 4YR2A 1C4AA 3KLIA 5F8HA 4DLEA 2YNIB 3R2DJ 5C25A 1S1XA 4EI2A 3MR6A 3KDNA 3ZZUA 3BDEA 2BZ2A 1U7LA 3W2WB 2EFPA 3BREA 2MMYA 2GMLA 1U1OA 3P3DA 3CDAA 3NGKA 3C2PA 4QQBA 1S79A 1RTDB 4DFPA 3R6GB 1QUPA 2JL9A 1MW7A 1H73A 4QYRA 4IG3A 3RTVA 4C48A 4HI2A 3B82A 3J80Y 5AE3A 2F4VF 2N7YA 3KWMA 5KG5A 2D3UA 2UXCJ 1HR0F 2PO4A 1U49A 1B7FA 4IQXA 1UEVA 2BDPA 1IN0A 3DNCA 4K59A 4MIWA 1R6YA 2BE2B 3I4HX 3Q8VA 2RHQB 1Q1KA 4FVMA 2JC0A 3AHPA 4L76A 2EBEA 4C11B 3ZNJ1 4U67Q 2ROEA 1LFPA 2RKIB 2PFDA 3IP0A 1EETA 2JZ5A 1NH7A 4PG7A 3QATA 2FZGB 5L39A 4P72A 4OV1A 3OXGA 4RNOA 3EXYA 4H4KC 3SDEB 3MECA 4FYDA 4AXJA 2CPIA 4F0KA 2LKZA 3NGRA 4F67A 1WHVA 2WSFC 3KJQB 2M88A 4WCEQ 3MF5A 1S0NA 4DQPA 5K9FA 3TEHB 2JEJA 1XR5A 2VHGA 2YKMA 3D68A 2R2RA 3I0SB 1VC5A 3M9OB 2FZCB 1PAEX 1HWUA 1DRZA 2YQ1A 2CPDA 4CZCA 2B51A 2QLBB 1YBAA 4USJC 4FYWB 2R7QA 5IXUA 1TKDA 4LIRA 3TZXA 1RT3A 4UW2A 2OAUA 3TUZC 3T5HA 2NXJA 5DGBA 1OY9A 1K1QA 2R8IA 4ZCIA 3UD3P 1IXKA 4Y6IA 4OX6A 5AXNA 3L95X 5AJ3J 4DSEA 3H90A 3JSYA 1S1UB 3BO2A 3HX9A 4AUKA 1SH3A 4N8OA 8AT1B 1VOMA 2AX0A 3BQ0A 4K2JA 5CZVA 3K5PA 2ASDA 3DOKB 2XZDB 3ONQA 3SV4A 3C6TB 3OTOJ 5ETSA 2GMHA 1FJEB 4UOGA 3OJUA 1IKYA 3FKBA 4CRJA 1N5YB 3MZIA 1DLOA 4N47A 5C5JA 3H5UA 5CYMB 1KFSA 1RHRB 1XMQF 1P1TA 1Z2LA 2BANB 1X31C 2DXDA 4K7QA 4J91A 4X64F 4DR4F 2CQPA 1SQGA 4O44A 1BMQB 3HO1A 3AODA 3I96A 3VR1A 2F1FA 3EICA 2QSFA 1RWVB 1SKUB 2JLEA 3KKFA 2MGZA 2EK1A 2FGCA 1QSSA 4NCGA 2XGPA 4DX5A 3D66A 4RWXA 2HHVA 4LBIA 2BJDA 2AKWB 1RWMB 4XPEA 3AQOA 3EXCX 2CQBA 2DRBA 2M5YA 2LFVA 1CJKA 3BS9A 2QTWA 4DV1J 3KNAA 3ENWA 5H1SV 3A8IA 1IBKJ 2JFKA 2UV8A 1TAQA 2QZ8A 1S1WA 3RGIA 3HJVA 1GQEA 2XQCA 1JXLA 5J1EA 3R1LA 5D6GA 2RNEA 1X0FA 1V3ZA 4F3QA 4CH0S 2ZBRA 3T1HF 3AH6A 3VGVA 4KAIA 3PKMA 1JLCA 4QIVA 4QIFA 3N0VA 1VK3A 2V8PA 2EG2A 1PILA 4HH0A 2GVZB 3PZPA 2BE7D 5L1KA 1Q5VA 3ZC4A 1CS4A 3GG1A 2B5JB 1OS5A 2VB6A 1O5JA 3EVOA 4DR2F 7FDRA 3PW7A 3GYNA 4DR5F 4TYAA 3M6WA 5IM0A 4H4OA 3TVZA 4A8MP 4ED5A 4ED1A 2C2MB 4USIA 1IM6A 2XCPA 2ZH1A 3OR1A 2IJNA 2DVIA 2KU7A 4OZ5A 3V4MA 2L48A 2XWYA 1EX8A 4IH6A 1RA7A 1RABB 2HW3A 1HARA 4S0MA 4Q2LA 4CYUB 1DURA 4X2BA 2FGOA 2OPSB 2QV6A 3G6ES 2IDLA 4A8FA 2H48B 3G82B 5J2NA 3V6JA 1UVKA 1X5SA 1K9MT 4OZJA 5J2PA 5D4OA 1EKRA 3F56A 4M1KA 3QWUA 2YWKA 2NREA 4O0NA 2DB1A 1U1PA 4ECXA 3IR6B 3OSNA 5DQGA 2QMXA 3NL0A 2LU2A 4J9QA 1B0VA 1WG5A 4WP3A 2W25A 4IOBA 2VBZA 1FD2A 3PEHA 1EZZB 4C0BA 3T1YF 2OPQA 2ZE2B 1FHTA 2V68A 4G6VB 3LP0A 4LIWA 3SQGA 3L7PA 3T1AA 2ZWOA 1NK4A 3HZGA 4DV0J 2RDDA 2E9ZA 3RR7A 4DR6J 2BE9B 3NY0A 5DS7A 4G65A 3MGJA 4N76A 2M7SA 3WDOA 4CLZA 3KLEA 4TVAB 3QGIA 2NPFA 2EPIA 2Y8YA 1T9WA 1WEZA 4RO0A 1U25A 1BY9A 2BKNA 4F25A 4O3QA 1HBOA 4D3GA 2HRUA 1A0OB 4JUZA 1MSWD 1F9HA 4OI4A 3V4IB 1LQ9A 3HLUA 4RNHA 3R7BB 4OZNA 3LOUA 4ID5B 2O1PA 4DL2A 4NASA 1Y00A 5I42B 2DNQA 4W98A 2QL5B 3VAJA 1SCJB 2WVFA 5C24A 4CLSA 2BJ9A 2UXBJ 1YRXA 2CA9A 2EC2A 4LRFA 4RX6A 1PAUB 3BBBA 2YKAA 4ALZA 2VODA 2Y8WA 3IBCB 3V6DB 1KVIA 5KG2A 4HR2A 1VDHA 3WC2A 3I9ZA 4LF7F 2KHDA 2KI2A 1HKAA 4KO0A 4JV1A 3AB2B 3CVKA 3UE2A 2O67A 4IR9A 3CJ0A 2OH2A 4BCAA 2E1CA 1MWQA 2AYEA 1S9FA 2J6SA 4LF6F 4RW6A 2YKPA 5KFOA 5K14A 1JLQA 3RRKA 3AY0A 5EWFA 3M9MB 1AUSL 4X65F 4LSNA 2RAQA 1NJIT 3J7A1 1GTEA 2QLFB 1C4CA 2XZTB 1UAWA 3ETMA 2DGUA 4M5IA 1MWZA 4D3HA 2QSWA 3CDBA 4DBQA 2XWXA 4PCQA 3VAMA 2W7OA 2ZITA 1RT4B 3UCZP 5D4NA 1QVFR 2YNIA 2Q43A 1HL6A 1J5OB 2AMCB 5HJYA 4RPFA 5U47A 3FNNA 2FQQB 3UDVA 3W2WA 3D0IE 2RDJA 2CYYA 1N33J 1RTDA 3D54A 4DUYF 2NUUG 2MKCA 2BJ7A 2VBYA 2IVMA 2MHEA 4NLUA 4B9MA 3MR5A 4M63A 3ZZOA 4CLKA 3TA1A 5FLXU 3B8HA 2X3DA 3S01A 1RT6B 4DF4A 1U0SA 2GIQA 1R7IA 3OJSA 1RAIB 3MPDA 2R7VA 1PYTA 1RHUB 3D0HE 5E0OA 1Y3JA 1OSCA 1VBKA 2M9KA 2V69A 2Y1IA 2IBOA 4KGKA 3PFOA 4R8UA 3T6JA 3T9ZA 2CPFA 2OO4A 1YIJS 3H8YA 4Q2MA 2ZKTA 1LWCB 2HK3A 4B3SF 1LW0B 1RAAB 3VQTA 2ZFHA 2K1RB 4RUBA 2M70A 1R0AB 2BXJA 3SDEA 2HG4A 5LJ3Y 1RUSA 4ZLPA 1R0CB 2QEXS 1TZ0A 2IHR1 1FX2A 3F0NA 1U1RA 2ALYB 2X7IA 5KG3A 4NLPA 3H25A 5LSRA 2ZWPA 3DXBA 1SC4B 2DGSA 1SC3B 2G0JA 1JX4A 1F5AA 1WC6A 3UQSA 2KN4A 2VQFJ 3ISNC 1RA6A 3P6YC 3GILA 1PJ5A 4JI5J 2MZTA 1W26A 4PRFA 3LWMA 2XI3A 4HH1A 1UVJA 1REVB 3G2XA 2KHCA 4DSJA 4ZN1A 4PWDA 4XPCA 2CIMA 4P75A 5I3UB 2YX7A 2LA4A 1VRQC 1NK8A 3DGPB 3MM7B 1KLMB 5A2QU 4M5MA 4R5PB 4USKA 3OL6A 2ABYA 1D8YA 4ZVGA 3CCVS 3DLBA 1FEHA 1S1UA 2B6AB 4AQYJ 4RW8A 4JI4J 3EZUA 4ZVUB 2OTLS 4HVZA 2QRRA 4J9LA 1Q8LA 2VZ9A 3U27A 1X4FA 3D1HA 3QBCA 1V3RA 4HI1A 1RBLA 1VCTA 4RBVA 3C6TA 1U2FA 4MT1A 1WHWA 4WZMA 2GZOA 2XI2A 2HFZA 3RBZA 1N5YA 1Y0HA 2MHNA 1IJEB 5CYMA 1HHTP 2QJ3A 1ZM2A 4K5SA 3X3UA 2K3KA 2L3MA 2CPEA 2MQMA 2A3JA 2ZD1B 4OZ1A 4ED3A 4U8VA 2BANA 3DYAB 4JYAJ 3NBPB 3BGFA 4DUZJ 4UOHA 3I87A 1FA0A 4RW7B 5CQGA 1N34J 4BC9A 5DQIA 1R89A 4RU9A 5D78A 4DG1A 3J81Y 3CJ2A 4UF4A 5B0AA 3W5ZA 1EB0A 1ULRA 2FHOB 3GIKA 2FLNA 4LVOP 1F1BB 3KTQA 3KHLA 4B9VA 1Y7PA 1X5PA 4Y2CA 3PXGa 3KK2A 3TARA 3NEKA 3KOAA 1PBUA 4HDHA 2DEIA 1S5ZA 1NK5A 1T05A 3D0GE 1NB7A 2FPHX 4EWTA 5H9EK 3H5YA 1I51B 1SL2A 5DZ7A 3PYEA 2QL9B 2FY8A 1RTHB 5CHCB 4FYXB 4I64A 1UWBB 2N82B 1RXOB 4F4AA 4C8YA 3N79A 1ZYQA 1U24A 2MQ8A 2C3PA 4PQAA 4Y00A 2FY1A 4PPZA 3CMES 3ET6B 2EK6A 2KYZA 2LXUA 3QFWA 4B9UA 4UZBA 5BYQA 1FRIA 3PW5A 5F9NA 1MU2B 4WK3A 4OHXA 4WXWA 2HQFA 2AYGA 2UUBJ 1CC8A 3EPGA 5LMUF 5ADZA 1T7PA 4Y3CA 4WKYA 2B4UA 2YKOA 2DBBA 5D3GA 2VPYB 2HHHF 1ZM4A 1KQSR 2VFUA 4K4SA 2V67A 5GADU 5JVHQ 5KFHA 2HFVA 1XNRJ 4YB6A 5GAEU 5LOQA 4CYUA 1NSQA 1X9MA 1WI6A 2GO9A 3O6QA 4NYOA 2OPSA 2OKQA 3D7SB 1WC4A 1P1LA 2ZDPA 3G82A 3VAIA 2VA3A 4GKJJ 4JI0J 3P96A 4O3OA 2AWZA 1H38A 3I0RB 1X7VA 5D8HB 2DH9A 3W9HA 2LQJA 1G4CA 2UV8G 4DL4A 4P9SA 4YUDA 1CC7A 2DR8A 1KD1T 2FJDB 1K0TA 3DMJA 4M5JA 1L3SA 3ENAA 4ELUA 2RE1A 4NCBA 4HYKA 2ZE2A 3MUTP 3J7AN 4YR0A 2GQQA 1H72C 4DX6A 4CQ1A 1WTFA 2H5JB 2YQ3A 4X4OA 1U6FA 2B9YA 4DQIA 2DH8A 4DL6A 4PABA 3K58A 3DLLQ 1DZ5A 3W60A 4UOFA 3KMQA 1R8AA 3DRPB 1YJWS 2K3IA 3BGRB 4CT8A 4PYAA 3OV7A 1SL0A 2YWWA 4B3MJ 5LXRA 3D6TB 4Q8EA 4KRWA 2LVWA 3CJSA 5HMYA 2FJXA 1T9VA 5HVGA 1JKHB 3MEEB 5L1IA 3PYFA 4CIOA 4P7TA 1HBUA 4NLXA 1FWLA 4ID5A 4Q45A 4U7UD 5I42A 2Y9HA 2A1BA 4MTPA 1ZH5A 2ZEJA 4X4PA 3MM5B 1X4AA 4I2PB 3RW6A 3ICLA 1YJ7A 1LEOA 2QGFB 3VVUA 3O3LA 3V6DA 3A8JA 3PW0A 2ZH2A 1H2UX 4G1QA 4AFFA 1VJWA 4MFBB 1QUVA 1M5VC 1M5PC 3GV8B 3MAAB 1WNEA 1HNZF 2BV3A 3FCVA 1KHVA 3OLAA 2DGQA 3PV8A 1RISA 5K5MA 2Z4PA 2MKSA 2BBEA 1HI1A 3Q8YA 4YFUA 5LJ5Y 4QWDA 4QOTA 3C46A 5F9LA 3IRXB 5JVGQ 1RT7B 1AA1B 4J7CA 1JB0C 2G2ZA 4DEZA 4RLEA 3G6VA 1FE4A 3F73A 1I3OB 1J5EJ 3W64A 4NXMJ 3W65A 3R5BA 4LUBA 4KHRA 4R0JA 1SJ1A 1W7WA 1RT4A 1PKUA 5GVQA 1DFDA 1FKOB 3CEDA 2Q1LA 4WBFA 5E41A 4PPDA 3THPA 4ECSA 1H3DA 1T94A 2RF2B 4AD6A 3H7HB 3GIRA 4MKBA 3HDSA 5ETTA 3CCSS 1WF2A 4OI3A 1M5KC 4DV2F 3E2EA 3PJ9A 4FS1A 3FGVA 3HJFA 1HHQA 4OI6A 2Z2YB 4I7FB 1L3TA 3KHHA 1RT6A 1U2CA 4P74A 3H2VE 4F7VA 1QTNB 1KN6A 4DL7A 4DR6F 1LK5A 3A8KA 2ZNYA 4F4WA 4V19J 2R8GA 5G4DA 3K59A 1SPBP 4DPOA 1X4HA 1V5IB 2ROGA 2KJVA 2F7VA 1J27A 3U02A 3TVYA 4LSLB 1RAHB 5DDOC 1NUEA 3H20A 3M6UA 4K5RA 1I5OB 1NU4A 1LWCA 2XNQA 3VAKA 1N5SA 1LW0A 2VIHA 1KEKA 1NKEA 3QJLA 1RZMA 2AEFA 2XLIA 1R0AA 4X4UA 3O5TB 1FKAF 3JSBA 3MFIA 3MOJB 3KYLA 2HHXA 1AZSA 1VQSA 3KNGA 1S7HA 3CSKA 1GXUA 1N4LA 2KVQE 3UN5A 5BYSA 1S6UA 1NPPA 4QJVA 4UZCA 4Y65A 5FDLB 4NLWA 2E29A 3D6MB 1YG0A 2IVYA 3OFGA 1B64A 4BWMA 3VVTA 5BXIA 2ZM6J 3HT3A 1IBLF 3GZ7A 4CNZA 1REVA 1ZPWX 2EFOA 4JV2A 4KT0C 1KR4A 2HRYA 2H65B 4C2MA 4KJIA 1FRXA 2R2SA 1KLMA 3OR2B 1RE1B 5J2MB 1O8BA 1FJCA 1KOOA 4HDGA 3KUGA 2V8GA 2B6AA 2QLJB 1U48A 2VONA 2B0GA 3RB3A 3IR7B 3K8WA 2J0XA 2PA3A 1SIZA 2WVCA 5B0DA 2UUWA 1FK9B 2HFNA 2KYXA 4DSFA 4ZVPB 4ECZA 3LGNA 5IT9U 1H98A 2B9EA 2VG6B 2MSTA 4X84A 3IXQA 4P52A 3GWCA 1EQMA 1BWVA 4NA2A 1NNDA 5J2QA 2V8HA 3B78A 3OXFA 4K4XA 2ZD1A 4IOAQ 3DYAA 3CDUA 3NBPA 1IBCB 1C0TA 1C2PA 3I32A 2D69A 1SB6A 2HLUA 1CJTB 4OMFG 2Q6BA 4OX9J 2YQ0A 2IMWP 2DNLA 3W9JA 1VMBA 5L46A 2AT1B 2MZRA 2PEHA 3VF0B 1XERA 5EX0A 4LRAA 3BSNA 4L72B 1R27B 2Z57B 2OTJS 3C16B 2DXFA 1BHNA 3FEZA 3FQLA 4GO5X 2IM1A 1OQ6A 1NPKA 2NLWA 4C3MA 1WACA 2ZNZA 2HS0A 2HS4A 1D9DA 4E8UA 2I9SA 1JQGA 2F8HA 5EUHA 2IDEA 1RTHA 1P27B 1RTJB 5A8WB 1UWBA 1RWPB 4K4YA 4MJKA 5J1NA 2C2NA 5SZTA 2DH7A 4E98A 1L3UA 2EKNA 4AL6A 4DFJA 4DN0A 2YKNB 1TUWA 3ET6A 2A6MA 2KXNB 2V63A 4U8YA 4E2FB 1GMVA 2JHEA 1CBKA 1FO1A 3MPWA 1IKXB 4P7VA 3K57A 4ZCMA 2E5LF 3HK2A 1BQXA 1QSYA 3T41A 5BYRA 3JXOA 4C8MA 4DN9A 5KFQA 1FNXH 1HWLA 1XMBA 1VIXA 3N28A 3IC1A 4ERDA 5IFMA 4NL5A 4P71A 2GHWA 3TX8A 4J5OA
chains in the Genus database with same CATH topology
4C6AA 2DXFA 3FC9A 3FCWA 1KDNA 2BEFA 3PRVA 4DZ6A 3EVWA 3VGTA 1NSKL 1W7WA 4UOHA 1BHNA 2BX6A 3NGSA 3FBCA 3DKDA 3EVMA 1EHWA 3MPDA 4S0MA 1NDCA 2AZ1A 1PKUA 1F3FA 3NGRA 1NLKL 2DY9A 1U8WA 3ZTPA 4WBFA 2NCKL 3DDIA 4UOGA 1BE4A 1NPKA 4F36A 3EE3A 3G2XA 1WKKA 3FKBA 5C7PA 3ENAA 3VGVA 1JXVA 1LEOA 2CWKA 3B54A 3VVUA 4DI6A 2B8PA 3ELHA 3GP9A 1WKJA 3ETMA 1NDPA 1XQIA 3FBEA 3EMTA 4FKYA 1XIQA 1NB2A 2VU5A 3PJ9A 1B99A 3ZTSA 1K44A 3BBFA 1LWXA 3FBBA 3ZTRA 1VYAA 4ANEA 2AZ3A 3VGSA 4W98A 2ZUAA 1PAEX 1HHQA 1WKLA 3Q83A 3FCVA 3Q86A 3NGUA 1F6TA 5CABA 1MN7A 1S57A 4O0NA 3FBFA 1S59A 3GPAA 2DXDA 3B6BA 3WX8A 1ZS6A 2HVDA 3EVOA 5CAAA 2HURA 1S5ZA 3JS9A 4EK2A 2DXEA 4UOFA 3VGUA 1UCNA 3Q8VA 3Q8YA 1NCLA 3BBBA 2DYAA 3EICA 3BBCA 1NSPA 3BH7B 1NSQA 4HR2A 3VVTA 5BXIA 3Q8UA 3R9LA 3L7UA 3EM1A 4ANCA 1HLWA 4ANDA 2HVEA 4DUTA 3EJMA 3BH6B 3ZTOA 5IOLA 4F4AA 1BUXA 1MN9A 2B8QA 3NGTA 4CP5A 3ZTQA 4FKXA 1HIYA 1NDLA 1NDKA 4KPCA 1NHKL 3Q89A 1NUEA 1B4SA 4ENOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C6A A;  2DXF A;  3FC9 A;  3FCW A;  1KDN A;  2BEF A;  3PRV A;  4DZ6 A;  3EVW A;  3VGT A;  1NSK L;  1W7W A;  4UOH A;  1BHN A;  2BX6 A;  3NGS A;  3FBC A;  3DKD A;  3EVM A;  1EHW A;  3MPD A;  4S0M A;  1NDC A;  2AZ1 A;  1PKU A;  1F3F A;  3NGR A;  1NLK L;  2DY9 A;  1U8W A;  3ZTP A;  4WBF A;  2NCK L;  3DDI A;  4UOG A;  1BE4 A;  1NPK A;  4F36 A;  3EE3 A;  3G2X A;  1WKK A;  3FKB A;  5C7P A;  3ENA A;  3VGV A;  1JXV A;  1LEO A;  2CWK A;  3B54 A;  3VVU A;  4DI6 A;  2B8P A;  3ELH A;  3GP9 A;  1WKJ A;  3ETM A;  1NDP A;  1XQI A;  3FBE A;  3EMT A;  4FKY A;  1XIQ A;  1NB2 A;  2VU5 A;  3PJ9 A;  1B99 A;  3ZTS A;  1K44 A;  3BBF A;  1LWX A;  3FBB A;  3ZTR A;  1VYA A;  4ANE A;  2AZ3 A;  3VGS A;  4W98 A;  2ZUA A;  1PAE X;  1HHQ A;  1WKL A;  3Q83 A;  3FCV A;  3Q86 A;  3NGU A;  1F6T A;  5CAB A;  1MN7 A;  1S57 A;  4O0N A;  3FBF A;  1S59 A;  3GPA A;  2DXD A;  3B6B A;  3WX8 A;  1ZS6 A;  2HVD A;  3EVO A;  5CAA A;  2HUR A;  1S5Z A;  3JS9 A;  4EK2 A;  2DXE A;  4UOF A;  3VGU A;  1UCN A;  3Q8V A;  3Q8Y A;  1NCL A;  3BBB A;  2DYA A;  3EIC A;  3BBC A;  1NSP A;  3BH7 B;  1NSQ A;  4HR2 A;  3VVT A;  5BXI A;  3Q8U A;  3R9L A;  3L7U A;  3EM1 A;  4ANC A;  1HLW A;  4AND A;  2HVE A;  4DUT A;  3EJM A;  3BH6 B;  3ZTO A;  5IOL A;  4F4A A;  1BUX A;  1MN9 A;  2B8Q A;  3NGT A;  4CP5 A;  3ZTQ A;  4FKX A;  1HIY A;  1NDL A;  1NDK A;  4KPC A;  1NHK L;  3Q89 A;  1NUE A;  1B4S A;  4ENO A; 
#chains in the Genus database with same CATH topology
 1RLD A;  4CTA B;  3FC9 A;  4DZ6 A;  1PC4 A;  1RT2 B;  2VFV A;  1S4F A;  3AOA A;  4WP9 A;  3ENQ A;  3GJR B;  1FTC A;  3E3X A;  1XNQ J;  2JDJ A;  2VKZ G;  1P6T A;  2QA2 A;  3UDL A;  3CO9 A;  1ELO A;  2QO3 A;  2D3O R;  1HQ2 A;  2XHW A;  2Z56 B;  4MMO A;  5KFC A;  5L1L A;  3CCW A;  3MMC B;  1X4C A;  3GII A;  3C14 B;  5DLG A;  3NG8 A;  3U7J A;  3W1Y C;  1EP4 B;  3G8T A;  3HSJ A;  2RT3 A;  2HRT A;  1YDL A;  5M2R A;  2B4V A;  4R0E A;  3I5A A;  5HMX A;  3L9Z A;  3UR0 A;  2W24 A;  1UPM B;  2HYI B;  3LGM A;  1WHY A;  3KG4 A;  2DGT A;  2G0I A;  2E5I A;  4TLR A;  5CCM A;  4CI0 B;  3MCM A;  2DNG A;  4M5K A;  3BB5 A;  5F41 A;  2MQQ A;  2CRL A;  4USW A;  3EDR B;  3HVW A;  1U45 A;  3WBZ A;  2FVC A;  3MAH A;  3H2L A;  5IQQ A;  4JI8 F;  2DGV A;  1P9Y A;  1TR0 A;  3HFK A;  5KFN A;  1WEX A;  3R6L B;  2HFU A;  2HMI B;  2AW0 A;  3DRP A;  2KG1 A;  2NCK L;  4DS5 A;  4F36 A;  3BGR A;  3PO4 A;  1JXV A;  1DQ9 A;  1SC6 A;  1VR6 A;  3M30 B;  5KG1 A;  2MKJ A;  3RG6 A;  3NMA A;  3SXL A;  3VGS A;  1JKH A;  4LRC A;  3MEE A;  2F4V J;  2OGU A;  2E7W A;  2KO1 A;  1HR0 J;  1RKJ A;  2R2U A;  3AD8 C;  4JI7 F;  4MIA A;  1U6B A;  1TKZ B;  2R7X A;  3IM9 A;  2IAJ B;  1NPR A;  5L9N A;  4O3P A;  3CCU S;  3DOL B;  1NRK A;  3LA0 A;  4IFV B;  3MM5 A;  2M4M A;  1BD6 A;  3FMB A;  4CDI A;  3I56 S;  3M1V A;  4ZPA A;  2NXU A;  4QYZ K;  2I38 A;  2BVZ A;  3FRZ A;  2LQ9 A;  4I2P A;  4O23 A;  2ZVI A;  4QPT A;  3HVT A;  3GR1 A;  5JUM A;  2IRU A;  4MFB A;  4RNM A;  3CJ4 A;  2VUG A;  3TZY A;  3MAA A;  4NX9 A;  3TI0 A;  4RWW A;  2BUN A;  2FIU A;  2BX6 A;  3Q8Q B;  4EU0 A;  2W8L A;  1NO8 A;  4IG0 B;  2HQ3 A;  1K0V A;  4NYP A;  3DOM B;  4CT9 A;  4OZ0 A;  5IV4 A;  5KAK A;  3PO5 A;  1M5H A;  3IRX A;  2J76 E;  4A8W A;  4HL9 A;  1RT7 A;  2VOO A;  4TU7 A;  2ACY A;  2FHJ A;  3OL9 A;  4C3K A;  3LP1 B;  2Y1R I;  3PRD A;  4IKA A;  5CYJ A;  1RQ0 A;  4EZ6 A;  2HVD A;  3DU6 A;  3GFZ A;  5HSP A;  4OYB A;  2MJN A;  2ADB A;  1KQF B;  4EMD A;  2AV5 A;  3R3T A;  1CJU B;  5KT3 A;  4Z7C A;  1S7I A;  1FKO A;  2EG1 A;  4XO0 A;  3MOZ A;  2PSZ A;  4JP8 A;  1TL3 A;  1GH8 A;  1YJV A;  1EIY B;  1FKP B;  2HQC A;  5DDP C;  2BR0 A;  1MN9 A;  2V4R A;  3UCU P;  3SI8 A;  4CO1 A;  2J6U A;  1BLU A;  1ROF A;  5C42 A;  4JOU A;  2DGW A;  2IJF A;  1VGY A;  4ECT A;  1T03 B;  4HTJ A;  5IQ6 A;  4ED2 A;  1HNV A;  2DY1 A;  3MEK A;  2N3O A;  2D9P A;  2YBV A;  5I3P A;  5HAO A;  1YLX A;  2PII A;  1WF1 A;  3O1L A;  4DX7 A;  1XMQ J;  4RR5 A;  1B7Y B;  5ETO A;  2Q66 A;  2RQ4 A;  2HGN A;  3A4T A;  4C0H A;  4OZ2 A;  1HBM B;  1OO0 B;  4B3M F;  3KFW X;  4RW9 A;  2PN6 A;  4X64 J;  4DR4 J;  2ZOM A;  4LSL A;  1VHI A;  3WIV A;  3L4B C;  2GMJ A;  1HPZ B;  2FC9 A;  3VGU A;  4KFB B;  5KFU A;  4ED6 A;  1T8E A;  2MKH A;  5C2C A;  1UEU A;  4B08 A;  2EXU A;  1X4D A;  2ZH8 A;  3V6H A;  2E7V A;  3Q8U A;  4N8N A;  3HHL B;  3KHG A;  1NEE A;  3IGV A;  2DKO B;  4YEA A;  2O3D A;  5B7W A;  3V81 A;  1DTT B;  3DDK A;  1YHQ S;  2LEP A;  2DTJ A;  2E1R A;  2PMZ D;  1T3O A;  3TJ8 A;  4F4K A;  2IM0 A;  3GV5 B;  2OEL A;  3R1H A;  2F8M A;  2XYG B;  2CJ9 A;  2H54 B;  1QY7 A;  5FDL A;  1S4E A;  4R25 A;  3T1H J;  2QFI A;  4ZPD A;  2XLK A;  2HHW A;  2GHV C;  1DTQ B;  1RAG B;  1Y4Z B;  4B9N A;  3OFH A;  1WKL A;  2V9W A;  2DT9 A;  2H4Y B;  3GFH A;  3N5B A;  4GVB B;  1QE1 B;  4ZMM A;  1XJW B;  4Z7Y A;  4DR2 J;  1UCN A;  5KFI A;  5J2M A;  3EZ5 A;  3MM8 A;  2Z30 B;  2RB7 A;  4DPT A;  3TZZ A;  4Q0B B;  3BZQ A;  4DR5 J;  5E7O B;  2GVD A;  3H98 A;  2ZH5 A;  4C8Z A;  5CA5 A;  2C2K B;  2VC1 A;  3W8P A;  2ZH9 A;  4NEZ A;  1FFW B;  2DCL A;  3PHT A;  1Q8K A;  3DHX A;  1HYS A;  5ETL A;  1FK9 A;  4PKD B;  3QIP A;  4N56 A;  3L7O A;  1UFW A;  2VG6 A;  2DR6 A;  5MAO A;  3DLE B;  4IYQ A;  3RRH A;  2IJR A;  1MLA A;  3CMQ A;  4C7Q A;  1T3N A;  1U47 A;  3ILO A;  4P73 A;  3BKF A;  4ZIT A;  2VA2 A;  2JVO A;  1VQ5 S;  2B8P A;  4OHW A;  4QZV B;  1RWU A;  1XQI A;  2CWX A;  3JSR A;  1CUL B;  4V19 X;  1CJT A;  4C8O A;  2HVZ A;  2IYI A;  1GT8 A;  4NLD A;  3W66 A;  2HBY B;  2ZBP A;  1OIA A;  4TXS A;  1S0V A;  1IR0 A;  4CO0 A;  2Z58 B;  3TAM B;  4DV3 F;  3R5G A;  4ZPT R;  4KHP F;  3HVA A;  1D3W A;  3NOG A;  4MKA A;  4EO8 A;  2VC0 A;  3MM9 A;  3P5T L;  1S49 A;  2D41 A;  4FNH A;  1HHS A;  3LUY A;  2KM8 B;  3EGW B;  1IR2 A;  3BM7 A;  1RTJ A;  2N4D A;  5A8W A;  2ZH7 A;  1NDL A;  2VPX B;  1PYS B;  4DQS A;  4C6A A;  5D77 A;  2IA6 A;  4YB1 P;  2HIQ A;  3HM9 A;  5KFB A;  1RWW B;  3ISZ A;  3LPY A;  1GXT A;  2PD1 A;  4NXN F;  4UOC A;  2QA4 S;  2IYG A;  2YKN A;  1UFK A;  2BQ3 A;  2B9W A;  5K8M A;  1RK8 A;  1PIE A;  4U9R A;  2R8H A;  2X3G A;  1FVQ A;  3RRG A;  5B08 A;  4DCJ B;  2D9O A;  2WRM A;  4QIW D;  4WF9 Q;  4C8N A;  1OWX A;  3CD6 S;  4KIA A;  2KT2 A;  3UR3 C;  2LP4 A;  5GAD I;  3G87 A;  4NE9 C;  5GAE I;  1KQK A;  2MLX A;  4OYO A;  2C2R A;  2V9K A;  4CTA A;  1WOO A;  2V4J B;  5ETM A;  1RT2 A;  1CSJ A;  2HZV A;  2CJB A;  4LF7 J;  4B3R F;  2KFY A;  1NXI A;  3QO9 B;  2VG5 B;  2NZC A;  5D4L A;  3VAG A;  2CPY A;  1U2R A;  2ZZN A;  1AW0 A;  1D9A A;  3MED B;  1VBZ A;  3M9N B;  1RHQ B;  2Z0G A;  2BW7 A;  1F2H A;  4ZP6 A;  5H9E J;  2YVS A;  2A18 A;  2OLW A;  2P2C B;  4TN2 A;  4PAA A;  1SKR A;  3MMC A;  1KRP A;  4LF6 J;  5KFK A;  3UCG A;  3C14 A;  3G96 A;  4WPA A;  2VFR A;  4X65 J;  2YX1 A;  3SZ2 A;  4KQZ A;  5CCL A;  4K4W A;  4KKO B;  2W4P A;  3N6M A;  3NCP A;  1LK7 A;  2ZZT A;  4FBU A;  2O01 C;  1YQH A;  1XN9 A;  4LFC F;  3SSR A;  3TUJ C;  2LQ5 A;  1S6O A;  3BDP A;  2R7O A;  1VI7 A;  1WHX A;  1Q78 A;  2J5A A;  4ZVH A;  4XDC A;  2XS5 A;  1R8B A;  1SJR A;  2AQ4 A;  1GTH A;  2GQ2 A;  1TP7 A;  3IM8 A;  3DDN A;  2FHJ D;  3ZXW A;  4M5N A;  1PO6 A;  3NCQ A;  4ICL B;  2DEJ A;  3IWL A;  2PEB A;  2AGQ A;  2HMI A;  2EBG A;  4DUY J;  4YP3 A;  3M30 A;  4F0M A;  7AT1 B;  2EFG A;  4XTT A;  4ED7 A;  4UUW A;  4NLV A;  2MZJ A;  2RUS A;  3F41 A;  3V6K A;  3QRR A;  4J9O A;  1KVK A;  1AFI A;  3I31 A;  3VGT A;  1FCA A;  4LFB F;  2IAJ A;  3I9V 9;  3RW7 A;  3DOL A;  4ITS A;  2G0C A;  3W2V A;  4KB7 A;  2AEM A;  2BJE A;  1UVM A;  2V6A A;  1EAY C;  1FJ7 A;  3A3N B;  4ECY A;  1NDP A;  1NHV A;  9RUB A;  4EYI B;  1H2T Z;  4MKV A;  1D1U A;  3IG1 B;  1WSV A;  2CPX A;  2LU1 A;  4MKY A;  4ECQ A;  3CJR A;  1VBY A;  3AXK A;  4B3S J;  1Q79 A;  3MUR P;  1YIT S;  3CJ8 A;  5IWA F;  4DV4 F;  5KG7 A;  1WOS A;  4JB8 B;  1TKX A;  2C22 A;  1Q95 G;  4QBU A;  5DM6 Q;  4IG0 A;  2EWH A;  3P45 B;  2DGX A;  4ZPB A;  4LF5 F;  2BKO A;  4OX8 A;  2BQR A;  1X5O A;  3D1O A;  2BJ3 A;  1GEH A;  2X51 A;  1SV5 B;  5KFT A;  1APS A;  1U8S A;  1HNX F;  1UW9 A;  4NPO A;  5AE2 A;  5HBM B;  4IFY B;  4KTQ A;  3NP5 A;  4ECV A;  1LNQ A;  4URQ U;  4YHH F;  2PFF B;  1FES A;  2HSE B;  4GRS A;  3R5D A;  2MSS A;  1TKT A;  3H59 A;  1ZAW A;  1FRH A;  1RYS A;  4FKY A;  4ZVR B;  5CD4 A;  5HVH A;  4O3S A;  3BGO P;  5F3T A;  3H42 A;  2PT0 A;  1T9Y A;  2O5D A;  1FKP A;  1X4G A;  2AF6 A;  1NJY A;  4DR7 F;  2K06 A;  4C8L A;  1TMM A;  2VOP A;  1TV6 B;  1HNW F;  1LWF B;  4O3R A;  3RBE A;  3AFG A;  1BGX T;  1T03 A;  2ILZ A;  3CCE S;  3FRY A;  4RUH A;  3HXM A;  2KL8 A;  2NS1 B;  2QC3 A;  1YJN S;  3BJY A;  5B0C A;  3CNQ P;  3EX7 B;  2JSX A;  2MKI A;  3O44 A;  2V2Z A;  2VBX A;  1FRL A;  1D8Z A;  2U1A A;  3M8P B;  3MXH P;  3M8Y A;  1OQ3 A;  2N3L A;  2CAJ A;  1JLE B;  3FEY B;  4WE1 A;  2BA9 A;  2DY9 A;  2EFQ A;  2LMI A;  1HPZ A;  4KFB A;  1WKK A;  2EI5 A;  5A8K B;  4OFZ A;  2XO7 A;  5HAT A;  3A8E A;  4USV A;  3SCJ E;  3HHL A;  4Y2K A;  3HPO A;  2UXD F;  1VK8 A;  1DTT A;  4A8Q A;  1RDR A;  5SUH A;  1S6P B;  3NGU A;  2K8G A;  2OD6 A;  3GPA A;  3M2R B;  1U6Z A;  1IQT A;  3DM2 B;  1W2B R;  3RAX A;  1XK8 A;  2NXE A;  3OTC A;  2XMT A;  1GX6 A;  3OTB A;  3AXM A;  3RAQ A;  3A3O B;  3T5L A;  2UUA F;  4NZ6 A;  2XMM A;  4G1I A;  2X1B A;  4XIU A;  1S0O A;  1N8R T;  2W4D A;  2OSQ A;  3JQM A;  3AT1 B;  3DLJ A;  3DFE A;  3FSI A;  1BUX A;  1VFJ A;  5EX3 A;  2FJE B;  2QIF A;  2V8D A;  1DTQ A;  4NLT A;  3MCO A;  3RYL A;  1E6V B;  5BR8 F;  4Y34 A;  3FBC A;  4GVB A;  1QE1 A;  3FZB A;  2I5J B;  3Q8S B;  2DIV A;  1PJ6 A;  5F0W A;  3B4M A;  1KBR A;  2L9N A;  1Q86 T;  1W2I A;  3MR2 A;  2OJ3 A;  4DOZ A;  1H6K X;  1HMV B;  5LMU J;  1CPZ A;  3E01 A;  3OLB A;  1U02 A;  2R9L A;  1TK5 A;  4DZD A;  2HHH J;  5A0Y A;  1QM9 A;  1UPP A;  3BGL A;  3AB4 B;  1HD1 A;  4EUV A;  3RB4 A;  5KFW A;  1UZH A;  3DLE A;  2HHU A;  1JLG B;  1N0V C;  4KR0 B;  3RBD A;  5GAH U;  4CH7 A;  2AEJ A;  3GLJ A;  2COL A;  2I2Y A;  2JOQ A;  1C0U B;  3G6X A;  5IT4 A;  3EJM A;  3Q0A A;  3QRP A;  1OYD A;  1HBN A;  4A8O A;  3M6X A;  3BO4 A;  1CUL A;  1K47 A;  1ICE B;  1D09 B;  4ZJO A;  4ENO A;  1X9S A;  2R7W A;  2EC0 A;  2BEF A;  1VQM S;  1EKS A;  2CJK A;  2I1R A;  3HHL C;  1EQ0 A;  5H9F J;  3QRQ A;  4ER8 A;  2UVW A;  1YTY A;  4C8K A;  4AXI A;  3I55 S;  3TAM A;  2BRL A;  4U7C A;  3NLC A;  1TL7 A;  3OD2 A;  4IH7 A;  1UVN A;  1DBD A;  1S1V B;  1K44 A;  4DL3 A;  3B4D A;  4N41 A;  4DMZ A;  1KC8 T;  4X66 J;  2DRA A;  3BO3 A;  5K8P A;  1FVS A;  2IA0 A;  2W4C A;  1Q81 T;  3JYT A;  3PG9 A;  1SL1 A;  1S0M A;  2KT5 A;  4ZP8 A;  3R7S B;  1L5U A;  4YS2 A;  4HHU A;  1CJV A;  4LQ9 A;  2FUG 9;  4CO2 A;  1NAQ A;  2CQ3 A;  3OQ2 A;  2E5H A;  2EKY A;  2DD8 S;  3PNI A;  4K8R A;  3NWR A;  4OJ3 A;  1KOH A;  1RSC A;  2GHP A;  1R8H A;  3EGZ A;  4FKX A;  3NAH A;  4MAK A;  4NZ0 A;  1NDK A;  3G86 A;  3UW1 A;  2WB4 A;  2G2O A;  4FDF A;  1VQ7 S;  3ZZY A;  4IO9 Q;  1C1C B;  3NRB A;  1NDC A;  1RWN B;  2POK A;  1QDU B;  2WON B;  5ETK A;  3EE3 A;  3BN4 A;  3JAM U;  2V4J A;  4FF4 A;  1L3V A;  1EAR A;  4L3K A;  1XIQ A;  2HGL A;  1ZM9 A;  3QO9 A;  2VG5 A;  1VYA A;  3CD7 A;  1DJ0 A;  3KUE A;  1PGZ A;  1HNZ J;  3MED A;  3CJK B;  3AOB A;  5KFP A;  4ZVS B;  3JSM B;  4UST A;  1JLF B;  3JS9 A;  2NYH A;  2M52 A;  2FC8 A;  3KLI B;  1N88 A;  1KSP A;  1U09 A;  2DYA A;  1REG X;  2AGP A;  5DQH A;  5FLX Y;  4OI1 A;  4CO3 A;  4RUA A;  3MR7 A;  3BSA A;  1GFW B;  4Q44 A;  2GJ2 A;  4KKO A;  1LXJ A;  1S6Q A;  1VIO A;  4ZP7 A;  3GMG A;  3KUH A;  1IR1 A;  1HIY A;  1VLO A;  3TQ1 A;  2HPU A;  2B43 A;  1RWO B;  3M6V A;  1VC0 A;  1M1G A;  3PY8 A;  2CDQ A;  5HQM A;  2AZ1 A;  2J0S D;  1JNR B;  4LF4 F;  1ITP A;  2CAD A;  1QSL A;  4ICL A;  2VQE F;  2IIH A;  5KT4 A;  1T0T V;  2HVH A;  4M94 A;  4DV2 J;  3NWG A;  2W8K A;  3OL8 A;  1NJW A;  4F3O A;  1UZD A;  2XMK A;  2OMO A;  1N48 A;  3IR5 B;  3Q8R B;  3Q86 A;  3DRR B;  2Z2Z A;  3N6L A;  4F2S A;  4O3N A;  1XBW A;  1XEZ A;  3FFI B;  1U4B A;  3QAU A;  5K8N A;  4QR0 A;  5GME A;  3H5S A;  3IAS 9;  3SBM A;  3SCL E;  1X8D A;  2IM3 A;  1RT5 A;  1U1K A;  2FHM A;  4DF8 A;  3C15 B;  4OYI A;  3ITH B;  1KFD A;  4PUO A;  2GV1 A;  2D74 B;  3DI6 B;  4Y28 C;  1LOU A;  5F8G A;  4J9N A;  2JLF A;  2XMA A;  4DLG A;  1WUU A;  1FXR A;  2JX2 A;  3PRV A;  3W61 A;  2OPR B;  1X0P A;  2ACM A;  3HD1 A;  1WG4 A;  3LF0 A;  3NKY A;  4JI1 F;  2Q79 A;  5A2Q Y;  4BDP A;  2R7S A;  3K8V A;  2CWK A;  3LTO A;  3LH2 S;  3GV7 B;  1UET A;  2R3V A;  1RT3 B;  3H4B A;  1B99 A;  4V1A k;  4ANE A;  1URR A;  2VL1 A;  2ASL A;  2V4Q A;  4RU2 A;  3GJQ B;  2M3D A;  3CB4 A;  2VFT A;  2G1D A;  3HHL D;  4TY8 B;  4X62 F;  1AB8 A;  1A6L A;  4OYP A;  1SV5 A;  2W9B A;  4W4M A;  2QG9 B;  2C2E A;  5HBM A;  5D15 A;  4DV7 F;  3ETO A;  1IBL J;  2MKK A;  5L1J A;  2HFS A;  2EEY A;  3PDN A;  4UQG A;  2FVS A;  2OSR A;  4DFK A;  2NR0 A;  1NSA A;  3P8B B;  1FJG J;  1GXL A;  1DLO B;  2QA1 A;  4OJH A;  4JV0 A;  2EW9 A;  2E5G A;  5DGA A;  3PVX A;  2KFN A;  2RRA A;  2VV5 A;  1T9U A;  3TA2 A;  4K0K F;  2VDI A;  1CEZ A;  5DG8 A;  2QLX A;  4KC5 A;  4L3N A;  5KG6 A;  3CPW R;  2H3E B;  3M8Q B;  1TV6 A;  5F3Z A;  1K8A T;  2FDN A;  3PM9 A;  2C1E B;  2BYC A;  8RUC A;  1R8C A;  4B3O B;  2JH3 A;  4K2X A;  1PCA A;  4O44 B;  1OPZ A;  2MTL A;  4NEY A;  3T9N A;  4OYZ A;  3MMB B;  5ETR A;  3ZTS A;  2R7R A;  2DHA A;  2MGZ B;  4NCA A;  4NCG B;  3FBB A;  2DHX A;  3L09 A;  1LWE B;  5RUB A;  4U96 A;  1KQG B;  4ECW A;  3KXD A;  5CAA A;  1LV5 A;  4L73 A;  1VQK S;  3M8P A;  2B56 A;  4FVC A;  5A8R B;  4DL5 A;  2FYX A;  4Y2A A;  1JLE A;  1S1W B;  4FXD A;  1PSD A;  1UVL A;  3BV8 A;  5L38 A;  4LF8 F;  2G9O A;  2W9C B;  4JV5 F;  2BE2 A;  3ZTQ A;  1ZBT A;  2B9X A;  1TVR B;  4NLO A;  1M5O C;  1S6P A;  5ETN A;  4C11 A;  2ASJ A;  3ZZP A;  5DZ6 A;  1PBA A;  1UJ4 A;  1HWK A;  2RKI A;  3IRW P;  1MMN A;  1Y11 A;  3BYP A;  5ETV A;  3SYZ A;  4ZCL A;  5K20 B;  2FLL A;  1WSR A;  5B0E A;  4ILL A;  2NSC A;  2CNL B;  3TZW A;  3W7B A;  3PX0 A;  3CDW A;  5IM0 B;  4ED4 A;  2B4O A;  2OFG X;  5LSO A;  4H4O B;  2J9C A;  2Z2L A;  4PQU B;  4ETZ A;  3NNH A;  1S59 A;  4LF1 A;  2F4F A;  3GSI A;  1S9E B;  4HTI A;  1UEK A;  1E6V A;  3OT9 A;  4CM0 A;  3BH7 B;  1FDD A;  4KE5 A;  3I0S A;  1NK7 A;  3K0J A;  4FYV B;  2E5L J;  3CCZ A;  1OMS A;  1LW2 B;  2KTQ A;  1TFW A;  3S8S A;  2YWF A;  2HBQ B;  1B0T A;  3KLH B;  5J2N B;  3IN5 A;  2I8E A;  4CO4 A;  3R7N B;  3C8Y A;  4DR3 F;  2MLZ A;  3KG0 A;  2XGQ A;  3QFH A;  2YY3 A;  1KP6 A;  2OEK A;  3ILI A;  1JLG A;  4LBH A;  1ZA2 B;  4LFA F;  4DR1 F;  6FD1 A;  2KZM A;  2E44 A;  4WZQ A;  3V2U C;  2EVZ A;  5I3Q A;  3ADA C;  1RAF B;  2VU5 A;  4UQT A;  2CQ1 A;  1C0U A;  3DRY A;  1IKV B;  4LJM A;  3TWZ A;  3DOK A;  5B0B A;  4PWU A;  2I0X A;  3T6B A;  2GNK A;  3BKT A;  4CO5 A;  1HW8 A;  3SQG B;  4BLG A;  2HUR A;  5F8J A;  3TVK A;  1JJH A;  3MR3 A;  4QU6 A;  5HQ8 A;  4WYL A;  3D9B A;  3J7Z 5;  1U1Q A;  4ANC A;  1N36 F;  4F0H A;  1HBO B;  4URS A;  4OYX A;  5F8I A;  3M2U B;  3K2Y A;  3PX6 A;  1NBE B;  2BRK A;  2G13 A;  3MAQ A;  1RHK B;  1IBM F;  1WJ9 A;  4IR1 A;  1RI7 A;  3JQJ A;  2QN6 B;  4LF9 F;  4LSZ B;  2BM1 A;  5AE1 A;  3G4S S;  3DKD A;  4JI8 J;  2F8E X;  3OTE A;  1F3F A;  3CC2 S;  3THT A;  4OL8 A;  1ZZN A;  2L08 A;  2ZH6 A;  2HIY A;  3ZZR A;  1F0X A;  3NXZ A;  3CT9 A;  2Y1J A;  2RD5 C;  1SQE A;  2HZA A;  3IS9 B;  4LR7 A;  1VS3 A;  4CLW A;  2KDO A;  3CJ5 A;  4G1P A;  2RIL A;  1SVD A;  4JI7 J;  2W1B A;  1IVZ A;  3IMQ J;  4K50 A;  2UUC J;  3RJM B;  1VQ8 S;  4I1T A;  3ILL A;  4ZA1 A;  1GK8 A;  4FF3 A;  1DAX A;  5T7L B;  2GVZ A;  1WEL A;  5KFM A;  2P8I A;  3WQP A;  2WON A;  2B5J A;  5K14 B;  1N5T A;  3SV3 A;  1HLW A;  2KB2 A;  3PR5 B;  3C66 A;  3BH6 B;  3W3S A;  4LSN B;  2JFD A;  1CLF A;  3PW4 A;  3BEG B;  1N56 A;  3CCL S;  2JJ4 D;  1DY3 A;  3NS6 A;  2Y3Y A;  2QMW A;  4M5H A;  1WEY A;  2CVI A;  1B4S A;  1JMT A;  4YB5 A;  2CPH A;  3CJT A;  1UMJ A;  4NA1 A;  5HVF A;  1JLF A;  4M5G A;  4MH8 A;  5BJR A;  2HAF A;  4DV6 F;  5EHH A;  5M2P A;  3IO1 A;  2FJV A;  1PC5 A;  2Q6C A;  2LDI A;  2CDR B;  4WFY A;  3WX8 A;  3HSZ A;  1KHW A;  3UD5 A;  1FNM A;  3QT5 A;  5G0R B;  4I67 A;  3UDE A;  2M2B A;  2QLW A;  5KFD A;  1RCO B;  3L7U A;  2R4F A;  3HHK A;  3PYD A;  1RLC L;  2J8A A;  2LA6 A;  1FFS B;  3QGG A;  2F9D A;  1VQY A;  4FF2 A;  1S48 A;  3HHD A;  3GSD A;  3TUP A;  2NXN A;  4R8U B;  2G4B A;  3MHY A;  4ZVF A;  1MG7 A;  4JI6 F;  1MML A;  4FNI A;  3M7V A;  1N5V A;  3DRR A;  3EVW A;  1NZ8 A;  2CJY B;  2CG8 A;  2CZ4 A;  3T3F A;  4B9T A;  3CCJ S;  1HQU B;  2ZBC A;  2MQP A;  4A4J A;  1JIH A;  3FFI A;  4X66 F;  1BE4 A;  5GMK a;  2W7P A;  4X4T A;  4M5L A;  2WW8 A;  3MWB A;  2HZC A;  5KOX A;  4PYD A;  3C15 A;  2DHS A;  3DRS B;  3ITH A;  5DG7 A;  2HQI A;  3MTJ A;  3KJV B;  2F3J A;  2XY7 A;  2LDY A;  1AUD A;  3DI6 A;  2MY7 A;  3R97 A;  1RB0 A;  3WIU A;  1QD1 A;  3GJT B;  2GW8 A;  4QIG A;  1RAJ A;  3V4I A;  4WP8 A;  4TU9 A;  1HI0 P;  1FDA A;  2JWN A;  2WTF A;  2C2D A;  4M5D B;  3OSP A;  2GS8 A;  1A7G E;  1U26 A;  4NA3 A;  2OPR A;  4RZR A;  3GFY A;  3CGI A;  2MQN A;  3FZ2 A;  1OPI A;  3EDQ B;  2V2V A;  2QA4 G;  4OZ3 A;  3GCW P;  1TFY A;  2NPI A;  5IC6 B;  3CE8 A;  2PGC A;  4A8Y A;  1TK0 A;  3RB0 A;  2DRD A;  4PWD B;  5CYQ B;  2ASY A;  2J9E A;  3CUN A;  2Y0B B;  3A13 A;  1N54 B;  3E51 A;  2OPP B;  4WFZ A;  3K5N A;  4PWW A;  4MYU A;  4PXD A;  4LT6 A;  4TY8 A;  5IT9 Y;  3SQO P;  5EGY A;  4ZK7 M;  1M5S A;  2FTR A;  4RW8 B;  2UVU A;  2DHG A;  4WU3 A;  2JLG A;  2M0G B;  5D0G A;  3B54 A;  2RQM A;  3KK1 B;  4ZP9 A;  3VQS A;  2UU9 F;  1CQM A;  2HBR B;  4ZIW A;  5HRO B;  2D7S A;  3OXL A;  2W01 A;  2HHP A;  4IRK A;  3PRB A;  1XR7 A;  4GVL A;  1SJF A;  4F8R A;  2WCX A;  4CH1 A;  2RML A;  4J37 A;  1TUV A;  4O0I A;  3PR4 A;  2XO6 A;  4IH5 A;  4NLQ A;  1JWW A;  2BJ8 A;  3WZ0 A;  2KXF A;  2WVD A;  3M8Q A;  4EBE A;  1TK8 A;  4B3O A;  3CCM S;  3CC7 S;  1J5O A;  4DG1 B;  3QPI A;  3MUV P;  3MMB A;  3MUM P;  1UFL A;  1Q7Y T;  3US5 A;  1Y10 A;  3JQK A;  1LWE A;  2IM2 A;  2APO A;  5KT7 A;  3NGS A;  4TNO A;  4QR1 A;  3PFE A;  3KK2 B;  5KFV A;  1FTR A;  4RBU A;  3VAF A;  5A8R A;  3D67 A;  5E3C A;  1V3S A;  1T05 B;  4ZVO B;  3GP9 A;  4ECR A;  4KH0 B;  2XS2 A;  4DU8 A;  5KFJ A;  4J9R A;  4KHM A;  1HWI A;  2A0F B;  4M8L A;  4XK8 C;  5DLF A;  4YY3 J;  2W9C A;  4ZPV R;  2ZJQ Q;  4KGV B;  4PG4 A;  3G8S A;  1ZM3 A;  4QCL A;  2PC6 A;  3UDC A;  4NLR A;  1TVR A;  5E5N A;  2Z2M A;  3J80 U;  4DV3 J;  4KHP J;  5KFF A;  2HHS A;  4DJB A;  5AXL A;  3PIP Q;  1FDB A;  1UVI A;  2VPZ B;  4MIB A;  2AJ2 A;  4UUX A;  3EYZ A;  2DPJ A;  5HP1 B;  4DPU A;  2K1R A;  1R31 A;  2W7A A;  4C3L A;  5CD4 H;  2M8D B;  3R5J B;  2W2O P;  1KON A;  4PQU A;  2HGM A;  2XHC A;  4TLQ A;  2YPZ A;  4FS2 A;  4NXN J;  1U0H B;  3MI7 X;  4ELV A;  3ZZ0 A;  5D3G B;  2DHH A;  4QWC A;  2NQP A;  2I6W A;  2XYH B;  3VCD A;  1S9E A;  2MZS A;  3TAQ A;  2MQL A;  3O2I A;  3GR0 A;  1WKJ A;  2E1A A;  1XWL A;  3LAK A;  3W63 A;  2AJF E;  2XUL A;  3VTI A;  1LW2 A;  2BM0 A;  3G6Y A;  4BS2 A;  2DNN A;  1FRJ A;  8ATC B;  3FJ2 A;  4K4Z A;  2V2K A;  3EPI A;  5DRK A;  3KLH A;  5CZX A;  1YX2 A;  1ZS6 A;  5GAH I;  2HWT A;  1S9G B;  1FJG F;  5I3U A;  3NMR A;  1VQO S;  3DGP A;  3MM7 A;  1V9O A;  4R5P A;  4NRT A;  4B3R J;  1GNK A;  3QWP A;  2RJZ A;  4ZHR B;  1AFJ A;  1HW9 A;  3FSY A;  4F4Z A;  4A8S A;  3DMJ B;  3HSD A;  3P49 B;  1WDD A;  3CF5 Q;  1FD8 A;  1GAO A;  4H54 A;  2J9D A;  5KFZ A;  1IKV A;  2QFJ A;  2QT7 A;  1FWK A;  3K7R A;  2C28 A;  2ADC A;  5HQL A;  3ZO7 A;  2ATL A;  1SJ4 P;  4IQM A;  3MTK A;  3ZTP A;  2ZVS A;  2XMV A;  3MM6 B;  1RHM B;  4K4T A;  3CXC R;  3MCS A;  4NLG A;  4B3T F;  2C3U A;  2P9C A;  2WBR A;  4LFC J;  4RW7 A;  1ZOT A;  4DU7 A;  3JTO A;  3M2U A;  1BQN B;  2J0Q D;  4B9L A;  2N7C A;  4EK2 A;  1HBU B;  1O51 A;  3UN3 A;  2AD9 A;  2MB0 B;  3PEJ A;  1NZA A;  2KRB A;  4PXC A;  4OHY A;  3GQC A;  1GMU A;  2F9J A;  1ZPV A;  2V8V A;  2XC9 A;  2UVR A;  3ZTO A;  4NML A;  3VAH A;  3S7R A;  4W90 B;  1Y9O A;  3IS9 A;  2CQH A;  2MZ1 A;  3IBW A;  1RCX B;  4Y2M A;  4G1Q B;  1Q7L B;  4DSL A;  4P6Q A;  5E3P A;  3FEX B;  3DLG B;  1KNZ A;  4LFB J;  2HWI A;  2GAG C;  2G1H A;  1IUJ A;  2RRN A;  2IRX A;  4ZLN A;  1I94 F;  2RU9 A;  2OIH A;  3KLV A;  4P10 A;  4F4X A;  5T7L A;  4ZVT B;  3K5L A;  3SFU A;  2LQ8 A;  4NYZ A;  1NB2 A;  2CXE A;  3LAN A;  3L3C A;  3RUB L;  1GMW A;  4I68 A;  2ZBI A;  2XEX A;  3W8G A;  4EEY A;  5KFG A;  4U6P A;  1MU2 A;  2ZUA A;  5GMD A;  1RHJ B;  4BHQ A;  5IS2 A;  5GAG U;  2R42 A;  3HKZ D;  4ECU A;  2XBP A;  3OHB A;  3QLH B;  1AT1 B;  1X4E A;  5IWA J;  4DV4 J;  4YB7 A;  2ALZ A;  3ZZZ A;  2CQC A;  2PE8 A;  1H0H B;  3LAL A;  3DXS X;  2CNK B;  1RAO A;  3SSQ A;  1N32 J;  4ILM A;  3N01 A;  2FD2 A;  4YME A;  1K1S A;  1WC1 A;  2NXC A;  1SKW A;  2GFF A;  1M1H A;  4LF5 J;  2W2P P;  2AIR B;  2L9D A;  2CQ0 A;  3POT B;  5KG4 A;  1B0P A;  3JB9 k;  3EGN A;  3CW2 C;  5HN0 A;  3PCO B;  5F8M A;  4ZLL A;  4ED0 A;  2WW4 A;  3MD1 A;  3AOC A;  3QT8 A;  2XMJ A;  3VZI A;  2CZ9 A;  4TYB A;  3IFE A;  4ILR A;  2KRR A;  1HNX J;  1YJU A;  2GX8 A;  2OP5 A;  3BR8 A;  2LQB A;  4C4W A;  1U8W A;  2CFX A;  5EWE A;  4YHH J;  1ZAX A;  5EDW A;  3GYG A;  4FXV A;  5G0R A;  1O6X A;  3QT6 A;  3BR9 A;  2F65 A;  1FE0 A;  3N4W A;  3QZ8 A;  2V50 A;  3I0R A;  1M90 T;  2VF3 A;  2C42 A;  4WU2 A;  2B7B B;  1R3N A;  2XG8 A;  4YR3 A;  5LMN F;  4GKK F;  2N4C A;  4MK9 A;  4Z2X A;  2D3Z A;  3WHI A;  4DR7 J;  2HQG A;  1XMO F;  1IWG A;  3J81 j;  1ZZF A;  2HFO A;  2MPU A;  1HNW J;  1D9F A;  3P5B P;  2D1C A;  4HHJ A;  2BKP A;  4ZVQ B;  3I4P A;  1HQU A;  2NYI A;  4ZCK A;  5KFX A;  2HVE A;  2RS8 A;  2VBW A;  2CQ2 A;  4HHH A;  2J7W A;  4IO1 A;  3DRS A;  3OL7 A;  2WHO A;  2V34 A;  3KJV A;  4RL1 A;  2XS7 A;  4DV5 F;  1UL3 A;  4MK8 A;  3DHW C;  1YJR A;  1PJ7 A;  2CUY A;  2X1F A;  1AZS B;  5HLF B;  1YKW A;  3AJ2 A;  4ETX A;  5IV3 A;  4CLT A;  3FMW A;  2IPO B;  2DR9 A;  2YH0 A;  4JI2 F;  4YDD B;  4WKR A;  4M5D A;  4GO7 X;  2JNJ A;  2VJU A;  2RDI A;  5A6P A;  1Z2Z A;  1YBU A;  5L8R C;  2P9G A;  3AD7 C;  2E1M C;  2R7T A;  1JXE A;  3HI9 A;  1MMD A;  2UUC F;  4ATN A;  2K7J A;  3I82 A;  3GIM A;  3HZE A;  1WC0 A;  2HKE A;  2V0N A;  2UXD J;  1RBO B;  4AYB D;  2MXY A;  4DL0 C;  1N6Q B;  6AT1 B;  1FDN A;  3Q83 A;  1G7C B;  5CAB A;  1HI8 A;  2DO0 A;  1NKC A;  4UY8 5;  2RVJ A;  5CYQ A;  2CQD A;  3OHA A;  2OPP A;  2B3T B;  4K4U A;  4HT5 A;  2IC3 B;  2YNF B;  5FJ4 A;  2UUA J;  2P6T A;  4A8X A;  2ZOF A;  2AHO B;  2KKH A;  2RQK A;  2RSQ A;  3DC2 A;  4ZPC A;  4WII A;  2K7K A;  4TY9 A;  4KY3 A;  1YJT A;  4AE5 A;  2NZ4 A;  2P6S A;  3KK1 A;  4Z37 A;  2KT3 A;  3OVS A;  3M2V B;  2ZJR Q;  1TL1 B;  1X4B A;  5HRO A;  4I69 A;  1UJ5 A;  2FB0 A;  2ZH4 A;  4QU7 A;  5BR8 J;  2ZUG A;  1RT1 B;  1FNO A;  4ZLJ A;  3EGV A;  3I5C A;  4YQW A;  4WIQ A;  3DN9 A;  5J2Q B;  4F02 A;  4HLB A;  2WVB A;  5C7P A;  4EFA C;  3GU0 A;  2YKQ A;  4RUC A;  3QYY A;  3NS7 B;  2QYC A;  4FPI A;  1NME B;  1OYE A;  1C0T B;  2WB1 D;  4ZVE A;  2VD3 A;  3UI3 A;  2DNP A;  5F8N A;  2ZKU A;  2H4W B;  2UXC F;  4X4Q A;  4RJV A;  4CLP A;  1HNI B;  5AT1 B;  1T11 A;  2LXI A;  4NRU A;  2RF2 A;  4GC7 A;  4X4R A;  4HKQ A;  2ZDO A;  3PKY A;  3DRX A;  3MPV A;  3C3L A;  2MYF A;  5C2G A;  2LEC A;  4LMZ A;  3FK4 A;  3D4J A;  4I7F A;  3PYG A;  2GA7 A;  3BPS P;  1T9T A;  4OX7 A;  4X4N A;  1NK0 A;  2DIS A;  3EZO A;  1ZA1 B;  2CQI A;  1G6B A;  1NLK L;  3KLG B;  4X4S A;  5KT6 A;  5KFR A;  1FRK A;  3M8R A;  5HMZ A;  4CLY A;  3NAI A;  4OV6 A;  1PYO B;  3W5X A;  1TUG B;  3ELH A;  2XCA A;  1KTQ A;  3M8W A;  4WFB Q;  3ZTR A;  2BOA A;  2AJ0 A;  5HP1 A;  1YJ9 S;  1ARO P;  4PG5 A;  2XB2 D;  4QPX A;  2A2D A;  3PJW A;  1UP1 A;  1HQE B;  2R8J A;  1DHM A;  4IOC Q;  1WOP A;  1LFW A;  4F26 A;  2LEA A;  5HAN A;  4OQJ A;  4XDD A;  3GCX P;  2H1Y A;  5A6W A;  1U0H A;  3K5O A;  2IFX A;  5HMW A;  2FZK B;  1YZ7 A;  4HAC B;  1SJQ A;  3J7Z T;  4AND A;  3SFG A;  3KHR A;  5D0E A;  4ZJQ A;  3LQV A;  1N52 B;  3Q8P B;  1U1N A;  1VQ6 S;  5J1P A;  3LW5 C;  5AJ3 F;  2B8Q A;  2Y1L B;  2FVP A;  3SEO A;  1I6J A;  5DJB A;  4FN5 A;  2HK2 A;  4KPY A;  3OTO F;  4QWA A;  2OD4 A;  5EWG A;  4O4G B;  1S9G A;  4LR9 A;  2NUH A;  2IBK A;  4F4Y A;  2J9D E;  3OR2 A;  5THW A;  2XSJ B;  1FWP A;  1CG2 A;  3MDF A;  4ZHR A;  1Q8I A;  3NNA A;  2X1G A;  1UKU A;  1VRU B;  1W25 A;  2AGO A;  2HND B;  1Q0N A;  2XTJ P;  2WOM B;  1GMW D;  3BQ2 A;  1TAU A;  4OYA A;  2P9E A;  3OVB A;  4A47 A;  4OLO A;  4ZN3 A;  3FVY A;  3OBI A;  3ISN D;  2AJ4 A;  3W9I A;  1WF0 A;  3X1L B;  2NSB A;  3ZNU A;  4J9K A;  3MM6 A;  4RW4 B;  4DV1 F;  3R8Y A;  2DR7 A;  1TL4 A;  1S76 D;  1IBK F;  2VG7 B;  4ZS6 A;  3QJJ A;  4ELT A;  4WWS A;  4I6W A;  2YNH B;  3KLF B;  1BQN A;  4KGX B;  1MRO B;  2HHQ A;  1NH8 A;  3TR5 A;  4YY3 F;  3VZH A;  3D3B J;  4LF4 J;  2GQC A;  1S10 A;  2XYP B;  1BC6 A;  2CG4 A;  1Y3K A;  2BW2 A;  4AL7 A;  4DI6 A;  5DET A;  2VQE J;  4WFN Q;  5EN1 A;  3HUL A;  5KFE A;  3C16 A;  3GG0 A;  1FXD A;  4C0O C;  3GYX B;  3IAM 9;  3M1V B;  2W2Q P;  1FRM A;  2GIR A;  3UO0 A;  3R5C A;  2BQU A;  2AJ1 A;  2E7X A;  4UT4 A;  4JI3 J;  3J81 U;  3B6B A;  3HHN B;  4I6Y A;  3K89 A;  4ZJL A;  2KZZ A;  3HVT B;  3J7Y U;  4M95 A;  2LLZ A;  1ZTT A;  2V94 A;  5KTQ A;  4P2M A;  3SCK E;  4IUF A;  3DLG A;  3KJF B;  3A12 A;  4KBI A;  3NS5 A;  2CQ4 A;  3TEG A;  2B4P A;  4EZ9 A;  4DS4 A;  3D1Q A;  1RWK B;  1TU0 B;  4WFA Q;  2VJV A;  2FVR A;  4DPX A;  2CNN B;  1NK9 A;  3MMA B;  3UVJ B;  3AA8 A;  5HO4 A;  3LPE A;  1IKX A;  2ZJP Q;  1R0B G;  4OYW A;  3CCT A;  2CJX B;  1SBR A;  1X60 A;  2LXF A;  2ATC B;  3QLH A;  4B9S A;  1WI8 A;  3IA0 A;  4KH1 B;  4JI1 J;  5B09 A;  1SJ3 P;  5DM7 Q;  3KK3 B;  1NJZ A;  3R2C J;  5F8L A;  4QW9 A;  3OFF A;  1Q82 T;  1J2V A;  1SI9 A;  3EWG A;  1FXL A;  1U1M A;  4A46 A;  2X1A A;  3QMQ A;  4ID8 A;  1N5Q A;  4LQ3 A;  1X9W A;  1WWH A;  3POT A;  2MKY A;  3TW0 A;  4J9M A;  2DNZ A;  2JEI A;  1TL3 B;  4X62 J;  5KFS A;  1S72 S;  3U1N A;  4LR8 A;  3TO8 A;  2RH3 A;  1MNE A;  1YSJ A;  1AXQ A;  1WD6 A;  4H4M B;  3E8O A;  1O0P A;  3Q24 A;  5C42 B;  3C6U B;  2HEK A;  4DV7 J;  4C97 A;  2H5I B;  1HNV B;  2LCW A;  1ZET A;  4KYZ A;  4KSE B;  1EP4 A;  2BMB A;  4IDK B;  4DV0 F;  5A76 A;  4PG6 A;  4ED8 A;  3QSY B;  1EJ7 L;  2HNZ B;  2RQC A;  3TAP A;  1FT8 A;  2K2P A;  4RBT A;  5D0R A;  4K0K J;  4X4V A;  2RS2 A;  3QAE A;  4NLY A;  4RW9 B;  2MY8 A;  4GMK A;  4EBD A;  2ZZM A;  5JMN A;  2GGP B;  2J0W A;  2E5J A;  3TQE A;  3DU5 A;  4FXW A;  3BGU A;  4KV8 B;  2QX0 A;  3GON A;  2GC8 A;  2VIC A;  1ZTW A;  4Q8F A;  2IRY A;  5CXT A;  2UXB F;  3V81 B;  4PXE A;  1Y5I B;  3D6F B;  3HVR A;  5HLF A;  2JVR A;  3BBC A;  3RZA A;  2EFV A;  3OUY B;  1QVG R;  3VHQ A;  3T19 A;  2P5V A;  3M32 B;  2KXH A;  3MCN A;  4HT7 A;  5HL7 Q;  1VQ4 S;  3U1M A;  2FJA B;  2ZC3 A;  2YPY A;  3UN2 A;  3W62 A;  4LF8 J;  1UA0 A;  2MZQ A;  1TKZ A;  2O66 A;  2WZ1 A;  2RIJ A;  2Y0S D;  4TKT A;  4JV5 J;  1BQM B;  4P2F A;  5DDQ C;  4IFV A;  2MEW A;  2SXL A;  4IRD A;  1N6Q A;  2AU0 A;  1NSK L;  3N5F A;  5H9F K;  3T5J A;  4TQR A;  1UWA A;  3R5A A;  1URN A;  1XR6 A;  3IGN A;  1RAD B;  1CVJ A;  4A48 A;  3CD0 A;  4LRD A;  1VRT B;  2IC3 A;  2YNF A;  5IZH A;  2L41 A;  3AAW B;  2AP6 A;  1UA1 A;  3CJ3 A;  1YRU A;  3MM8 B;  3KG1 A;  3TP2 A;  4OJG A;  2GVD B;  1N32 F;  1WC3 A;  2CVE A;  3NCR A;  3H0P A;  3M2V A;  5MLC V;  3RAM A;  3DOM A;  4I2Q B;  1TMJ A;  3PX4 A;  1HYS B;  1TL1 A;  2L9W A;  3HKW A;  2GCF A;  1S1T B;  1Y5L B;  4LRB A;  3QIP B;  4L75 A;  4CLU A;  1RT1 A;  1T95 A;  1N33 F;  3LP1 A;  1VQ9 S;  3D28 A;  3CC4 S;  1RWX B;  1S99 A;  4I4B A;  2HWH A;  3UWT A;  2C2Z B;  1CJU A;  3BSC A;  2PMW A;  1WTB A;  1R8P A;  4Q43 A;  5DG9 A;  4WTY A;  4DR3 J;  2XY6 A;  1KDN A;  3H2U B;  5JXS A;  3HD2 A;  2PI4 A;  5I4M A;  1HNI A;  2ZC4 A;  2XM3 A;  3CO0 P;  2QL7 B;  1S97 A;  1V5V A;  4LFA J;  4DR1 J;  2BAC A;  3MPU B;  1DQ8 A;  1T9X A;  3TOQ A;  1HA1 A;  4USU A;  3AD9 C;  3BN7 A;  3LWL A;  1RAE B;  1RTI B;  1Q8B A;  1X5T A;  3DLH A;  2VFS A;  3MM9 B;  4P2S A;  2JEF A;  3RR8 A;  1F6T A;  3CUL A;  4URG A;  1MWY A;  3UNY A;  1TEL A;  2GJF A;  4BWJ A;  1FFG B;  1YI2 S;  1NCL A;  5KFL A;  4ES3 A;  2KVI A;  4L74 A;  2XSF A;  3KLG A;  1Q4R A;  1S12 A;  5KG0 A;  3R9L A;  3RB6 A;  1N36 J;  2YWG A;  1HBM A;  3NOC A;  4CM2 A;  2GJI A;  4YN3 B;  2JRS A;  1BWE A;  4RNN A;  3VV2 B;  3DLK B;  4LRE A;  3LP2 B;  1JJ4 A;  3NNC A;  2J6T A;  3NGT A;  2F5G A;  4ES1 A;  2HAI A;  1IBM J;  3CD5 A;  5M2U A;  2JEG A;  3JAM Y;  1P8G A;  4QW8 A;  4LF9 J;  3GIJ A;  2QE5 A;  2VQF F;  2J7U A;  2RRB A;  1HQE A;  2UZA A;  1V6H A;  4PZV A;  3HCX A;  2B7C B;  4JI5 F;  2XLJ A;  1XTZ A;  4USM A;  2KJW A;  1YRT A;  3QGH A;  4F04 B;  3GB0 A;  4HAC A;  3BSO A;  1IKW B;  3DCA A;  1F5B A;  7FD1 A;  3MD3 A;  2LYV A;  2FJW A;  3FBF A;  4AQY F;  4JI4 F;  2AJQ A;  2XNR A;  3ZZT A;  3UFC X;  4OIX A;  4OI2 A;  1VQL S;  4CLF A;  1FEE A;  3QZ7 A;  3UNG C;  3R27 A;  1KLN A;  4Q5V A;  3BPD A;  1IM4 A;  2WK4 A;  2KG0 A;  2CJQ A;  1IWA A;  2WSE C;  4O4G A;  3EM1 A;  2R2T A;  2DNH A;  4ZKA A;  2ZHO A;  2OI2 A;  1JLB B;  5KFY A;  4DX8 H;  3A1Y G;  2QYG A;  4CNY A;  2BOP A;  3BF4 A;  2XSJ A;  4CP5 A;  4QIE A;  3QSI A;  5DDR C;  4Q0B A;  2GAH C;  1RKI A;  3TJA A;  3F44 A;  1VRU A;  4JYA F;  1LKZ A;  2HND A;  3LAM A;  2PI5 A;  4DUZ F;  1NM2 A;  3M8Z A;  3CCQ S;  1KWM A;  3SMZ A;  2AX1 A;  1N34 F;  2WOM A;  3PIO Q;  2DNM A;  2ZBQ A;  2IY5 B;  4DV6 J;  3SCI E;  2HVI A;  4WK1 A;  3MEG B;  5HJX A;  1RU1 A;  4WJB A;  3CDE A;  4NOH A;  3UPF A;  4C98 A;  1LWX A;  3TA0 A;  4RW4 A;  5K8O A;  2HLT A;  1HWJ A;  1NHU A;  4UTG A;  4OHZ A;  3KJN B;  2VG7 A;  4EYH B;  3HFV A;  1F5C A;  2YNH A;  3KLF A;  1IJF B;  4LBP A;  1YWX A;  4I0W A;  4DPW A;  1RJJ A;  1MRO A;  1QAY A;  5AXK A;  2HHT A;  3RU0 A;  1KTV A;  5B0F A;  5B0G A;  1SUQ B;  2HNY B;  2MLY A;  3K17 A;  2ZHB A;  3QT7 A;  2GO8 A;  3HT0 A;  3A3P B;  2XMW A;  3ENV A;  3IBF B;  4MK7 A;  1OY6 A;  3W2V B;  2MQO A;  2Q3P A;  4PR6 A;  2WVE A;  4P2X A;  4U95 A;  5E3Q A;  1FF2 A;  4C9D A;  2Z8Q A;  2YX4 A;  4JI6 J;  4OI0 A;  1RBA A;  5ITH A;  3HF5 A;  2BJ1 A;  3RBX A;  3G8Q A;  2W9A A;  1Z4U A;  2YNG B;  2CPJ A;  4DQQ A;  3DGV A;  1ACM B;  4ZDN A;  2UUB F;  3FBE A;  3THV A;  1TKX B;  3TRG A;  3Q22 A;  1LXN A;  3M4X A;  2IVF B;  3SIP B;  4MYT A;  2OML A;  3CMA S;  4NZ7 A;  5E2Q A;  5GAG I;  2KFZ A;  1DQA A;  1G2E A;  4A8K A;  5F0U A;  5FII A;  1S57 A;  4WXO A;  3OPK A;  3MMA A;  3UVJ A;  4K4V A;  3Q2S C;  3S1T A;  5HI7 A;  1E6Y B;  1XNR F;  2E66 A;  1QLN A;  3WX4 A;  2FLO A;  2QMU B;  4QR2 A;  3ZFV A;  3KK3 A;  4DUT A;  1WOR A;  3NGD A;  5E3R A;  5KFA A;  1SH2 A;  1TKT B;  4GKJ F;  3G71 S;  2MDA A;  2A6O A;  4KPC A;  4JI0 F;  4OLP A;  4NI2 B;  4BBY A;  4W92 B;  3T5K A;  2YTC A;  1GX5 A;  1C1B B;  5KT2 A;  1JLA B;  4J9P A;  4DSI A;  1QTM A;  2DNK A;  4J9V A;  2FHK A;  3DDI A;  1L3K A;  4L6V 3;  1T02 A;  2BAB A;  1RGV A;  4H4M A;  1AYE A;  4WFX A;  3WC0 A;  3C6U A;  2JC1 A;  4TU8 A;  2PDA A;  2UU9 J;  4AL5 A;  2OUG A;  3I6P A;  3QNW B;  3M05 A;  2J8S A;  3BBF A;  4RKU C;  3PW2 A;  4DDF A;  2C2O B;  3LGH A;  5C25 B;  1UJ6 A;  2VDH A;  2EFN A;  1M0S A;  3U1L A;  4I6A A;  1S1X B;  4Y2I A;  4DHV A;  4IDK A;  3CJQ A;  4BC7 A;  1WC5 A;  5LXY A;  1JNZ B;  4J9S A;  4QWE A;  2HNZ A;  4NWB A;  2DNY A;  1TL5 A;  2DNR A;  4UY8 T;  6FDR A;  2CKW A;  4KGM A;  2E9T A;  1BXN A;  4DPY A;  1RYR A;  4IG3 B;  2A2C A;  4WE1 B;  4Y0F A;  1HD0 A;  3ILJ A;  2GGP A;  2KM8 C;  4TQS A;  4F50 A;  4NLS A;  4KV8 A;  2AYM A;  4DSK A;  1KVJ A;  1EHW A;  5L9X A;  3CCR S;  4G3I A;  4EBC A;  3OFE A;  5ETP A;  5LSL A;  2IMO A;  3HSG A;  2DK2 A;  3N9U C;  4JI3 F;  3OUY A;  1KS2 A;  3KDO A;  1VIS A;  4J90 A;  3M32 A;  4USH A;  1EET B;  1HFE L;  3OVA A;  2AZ3 A;  2J7K A;  1YBT A;  1WDT A;  1F2G A;  2F40 A;  2C3O A;  3MEC B;  1CQN A;  1BQM A;  5E33 A;  1NJX A;  4CCH A;  4FF1 A;  4PXB A;  3MPY A;  3PHE A;  1JK9 B;  1UW4 A;  1PG5 B;  2XMU A;  2UUT A;  5LT5 A;  2YKM B;  3IG1 A;  1U1L A;  3JTP A;  1OJ4 A;  4FZV A;  1VRT A;  3AJ1 A;  1SIW B;  2DIU A;  4U7U K;  3BKU A;  1B3T A;  2WSC C;  2YXL A;  2ILY A;  2OEJ A;  1J5E F;  1F60 B;  1FX4 A;  4NXM F;  3E01 B;  2RU3 A;  1QJH A;  2KH9 A;  1R43 A;  1VC6 A;  3IWX A;  4JBC A;  3AQP A;  4I2Q A;  1B70 B;  1S1T A;  5A0Y B;  3Q2T C;  4IRC A;  2WAQ D;  1TTH B;  4PEO A;  3HHE A;  5LL6 d;  3K5M A;  4O4R A;  3GTY X;  2OHD A;  3LO3 A;  3CIM A;  1QAI A;  1Q53 A;  3PAC A;  1M1K T;  5E3A A;  4IFY A;  2DJW A;  3TUI C;  1H7W A;  2D3O 1;  3P4U B;  4B02 A;  1HBN B;  3IWN C;  2G2Y A;  2CNO B;  2DXE A;  4N77 A;  1VQP S;  3GJS B;  1IKY B;  5CH7 B;  4F2R A;  3TAN A;  3Q23 A;  3FSX A;  1KKH A;  4I56 A;  3W5Y A;  4QYZ J;  4QWB A;  4FP9 A;  3V5R A;  4EGL A;  5IT0 A;  1LWF A;  4OHV A;  1UTA A;  1RTI A;  3D2W A;  1Z1Z A;  3D3C J;  3T1Y J;  2C3M A;  1VBX A;  5DO2 A;  1TL7 B;  3FCW A;  4GC6 A;  1FI4 A;  2H51 B;  2VKR A;  5D4P A;  3OTD A;  2OFH X;  4Q7A A;  3TX0 A;  2VPW B;  5JJB A;  1F3V A;  3JYT B;  2ERR A;  2YWE A;  1CJK B;  4DCP B;  3QGP A;  3BQ1 A;  4B3T J;  2YH1 A;  3MFH A;  1CJV B;  3HMJ G;  1SKS A;  4CWB A;  3TYT A;  4E0D A;  2MJU A;  3DLK A;  2VAS A;  3LP2 A;  1QAX A;  5T14 A;  9ATC B;  3VWS A;  5J1E B;  3QQC D;  4ZPW R;  1YGY A;  5A8K A;  3PTW A;  2WBM A;  1A9N B;  1JLC B;  4FBT A;  4N7T A;  1OY8 A;  2ZM6 F;  4PG8 A;  3D5M A;  3M2R A;  1CS4 B;  2OEM A;  3DM2 A;  1VHF A;  3D6H B;  1IKW A;  4FPR A;  4LVN P;  2E1P A;  1NHK L;  3Q89 A;  4F3M A;  1IQZ A;  3BYR A;  2DR5 A;  3M8S A;  1S77 D;  4XAK A;  3EVM A;  2XZW A;  5D0H A;  2XY5 A;  1JJC B;  4NMX A;  1YZ6 A;  1I94 J;  3G9C A;  2ZOG A;  4AT1 B;  3OR1 B;  2DCU B;  4CLL A;  3EMT A;  2M8H A;  4YDX A;  5FD1 A;  3GFX A;  1JLB A;  2I5J A;  3ULH A;  1SQF A;  2FLP A;  1K73 T;  4EO6 A;  4B17 A;  2H5E A;  1S6Q B;  2RHS B;  3AJD A;  3CTR A;  2PMH A;  1FER A;  2ZH3 A;  1HMV A;  1H74 A;  3FQK A;  1DAR A;  4FYY B;  1NSP A;  5T41 A;  1SXL A;  3UD4 P;  1NKB A;  2DPI A;  5J2P B;  5HK4 A;  1VQN S;  1YVF A;  3I5B A;  3HP6 A;  1N0U A;  2CJA A;  4OX9 F;  2AYB A;  3MEG A;  3S6E A;  5KOW A;  2CQG A;  5IOL A;  2DGO A;  1H7X A;  1ZAV A;  3FUY A;  3HFZ B;  2HQD A;  4OZL A;  2E9R X;  3EUN A;  2GIF A;  4HEA 9;  3H5X A;  1Y5N B;  1RTZ A;  2C3Y A;  2V5H G;  2W2M P;  1JJ2 R;  1XC9 A;  2H9Z A;  3TNV A;  1WG1 A;  2OPQ B;  3QID A;  2V2Q A;  3LP0 B;  5KT5 A;  3CIZ A;  3N6N A;  2CPZ A;  1P9Q C;  2FJB B;  3VAL A;  1G3O A;  1SH0 A;  4DCO B;  2YWH A;  2DNO A;  3QJP A;  1SUQ A;  2HNY A;  4OJ1 A;  1RT5 B;  4ZIV A;  3KLE B;  1YK9 A;  4ES2 A;  5LMN J;  4GKK J;  3J7Y I;  4PUO B;  2DO4 A;  3C19 A;  1OSD A;  1XMO J;  3AA9 A;  1TQL A;  4WTO B;  5AXM A;  1SC1 B;  4OYM A;  1R6V A;  2R8K A;  2HBZ B;  4ZOS A;  1S1V A;  2ZHA A;  2YNG A;  2U2F A;  1I1G A;  3OW2 R;  2VH7 A;  5C24 B;  1VJQ A;  4DFM A;  1Q5Y A;  4DV5 J;  3TJ9 A;  2R7U A;  2PA8 D;  3GE9 A;  1G1X A;  4JI2 J;  1D0E A;  1RP5 A;  1XNQ F;  1E6Y A;  4J9U E;  3FDS A;  3H40 A;  4KO0 B;  4YOE A;  2FVQ A;  4H4K A;  2W9B B;  3O8W A;  3SSS A;  1F9F A;  1C1C A;  5ETQ A;  3MMJ A;  2UVV A;  3CWJ A;  3FCH A;  1RU2 A;  4RW6 B;  1MN7 A;  2HS3 A;  2F63 A;  1JLQ B;  4RNF A;  2LEB A;  1QAJ A;  2UP1 A;  4DWI A;  2A10 A;  3H4D A;  1Q16 B;  4NI2 A;  2RUG A;  1VLY A;  2CZV C;  2DIT A;  1C1B A;  1JLA A;  2ROP A;  4KGZ B;  4DXL A;  5IC4 B;  2W2N P;  3KMS A;  4N5S A;  4LF2 A;  1H2V Z;  5LM7 E;  3CJK A;  3PJX A;  1F9E B;  4WYW A;  4DQR A;  3JSM A;  1RAC B;  3JTN A;  1NK6 A;  4YR2 A;  1C4A A;  3KLI A;  5F8H A;  4DLE A;  2YNI B;  3R2D J;  5C25 A;  1S1X A;  4EI2 A;  3MR6 A;  3KDN A;  3ZZU A;  3BDE A;  2BZ2 A;  1U7L A;  3W2W B;  2EFP A;  3BRE A;  2MMY A;  2GML A;  1U1O A;  3P3D A;  3CDA A;  3NGK A;  3C2P A;  4QQB A;  1S79 A;  1RTD B;  4DFP A;  3R6G B;  1QUP A;  2JL9 A;  1MW7 A;  1H73 A;  4QYR A;  4IG3 A;  3RTV A;  4C48 A;  4HI2 A;  3B82 A;  3J80 Y;  5AE3 A;  2F4V F;  2N7Y A;  3KWM A;  5KG5 A;  2D3U A;  2UXC J;  1HR0 F;  2PO4 A;  1U49 A;  1B7F A;  4IQX A;  1UEV A;  2BDP A;  1IN0 A;  3DNC A;  4K59 A;  4MIW A;  1R6Y A;  2BE2 B;  3I4H X;  3Q8V A;  2RHQ B;  1Q1K A;  4FVM A;  2JC0 A;  3AHP A;  4L76 A;  2EBE A;  4C11 B;  3ZNJ 1;  4U67 Q;  2ROE A;  1LFP A;  2RKI B;  2PFD A;  3IP0 A;  1EET A;  2JZ5 A;  1NH7 A;  4PG7 A;  3QAT A;  2FZG B;  5L39 A;  4P72 A;  4OV1 A;  3OXG A;  4RNO A;  3EXY A;  4H4K C;  3SDE B;  3MEC A;  4FYD A;  4AXJ A;  2CPI A;  4F0K A;  2LKZ A;  3NGR A;  4F67 A;  1WHV A;  2WSF C;  3KJQ B;  2M88 A;  4WCE Q;  3MF5 A;  1S0N A;  4DQP A;  5K9F A;  3TEH B;  2JEJ A;  1XR5 A;  2VHG A;  2YKM A;  3D68 A;  2R2R A;  3I0S B;  1VC5 A;  3M9O B;  2FZC B;  1PAE X;  1HWU A;  1DRZ A;  2YQ1 A;  2CPD A;  4CZC A;  2B51 A;  2QLB B;  1YBA A;  4USJ C;  4FYW B;  2R7Q A;  5IXU A;  1TKD A;  4LIR A;  3TZX A;  1RT3 A;  4UW2 A;  2OAU A;  3TUZ C;  3T5H A;  2NXJ A;  5DGB A;  1OY9 A;  1K1Q A;  2R8I A;  4ZCI A;  3UD3 P;  1IXK A;  4Y6I A;  4OX6 A;  5AXN A;  3L95 X;  5AJ3 J;  4DSE A;  3H90 A;  3JSY A;  1S1U B;  3BO2 A;  3HX9 A;  4AUK A;  1SH3 A;  4N8O A;  8AT1 B;  1VOM A;  2AX0 A;  3BQ0 A;  4K2J A;  5CZV A;  3K5P A;  2ASD A;  3DOK B;  2XZD B;  3ONQ A;  3SV4 A;  3C6T B;  3OTO J;  5ETS A;  2GMH A;  1FJE B;  4UOG A;  3OJU A;  1IKY A;  3FKB A;  4CRJ A;  1N5Y B;  3MZI A;  1DLO A;  4N47 A;  5C5J A;  3H5U A;  5CYM B;  1KFS A;  1RHR B;  1XMQ F;  1P1T A;  1Z2L A;  2BAN B;  1X31 C;  2DXD A;  4K7Q A;  4J91 A;  4X64 F;  4DR4 F;  2CQP A;  1SQG A;  4O44 A;  1BMQ B;  3HO1 A;  3AOD A;  3I96 A;  3VR1 A;  2F1F A;  3EIC A;  2QSF A;  1RWV B;  1SKU B;  2JLE A;  3KKF A;  2MGZ A;  2EK1 A;  2FGC A;  1QSS A;  4NCG A;  2XGP A;  4DX5 A;  3D66 A;  4RWX A;  2HHV A;  4LBI A;  2BJD A;  2AKW B;  1RWM B;  4XPE A;  3AQO A;  3EXC X;  2CQB A;  2DRB A;  2M5Y A;  2LFV A;  1CJK A;  3BS9 A;  2QTW A;  4DV1 J;  3KNA A;  3ENW A;  5H1S V;  3A8I A;  1IBK J;  2JFK A;  2UV8 A;  1TAQ A;  2QZ8 A;  1S1W A;  3RGI A;  3HJV A;  1GQE A;  2XQC A;  1JXL A;  5J1E A;  3R1L A;  5D6G A;  2RNE A;  1X0F A;  1V3Z A;  4F3Q A;  4CH0 S;  2ZBR A;  3T1H F;  3AH6 A;  3VGV A;  4KAI A;  3PKM A;  1JLC A;  4QIV A;  4QIF A;  3N0V A;  1VK3 A;  2V8P A;  2EG2 A;  1PIL A;  4HH0 A;  2GVZ B;  3PZP A;  2BE7 D;  5L1K A;  1Q5V A;  3ZC4 A;  1CS4 A;  3GG1 A;  2B5J B;  1OS5 A;  2VB6 A;  1O5J A;  3EVO A;  4DR2 F;  7FDR A;  3PW7 A;  3GYN A;  4DR5 F;  4TYA A;  3M6W A;  5IM0 A;  4H4O A;  3TVZ A;  4A8M P;  4ED5 A;  4ED1 A;  2C2M B;  4USI A;  1IM6 A;  2XCP A;  2ZH1 A;  3OR1 A;  2IJN A;  2DVI A;  2KU7 A;  4OZ5 A;  3V4M A;  2L48 A;  2XWY A;  1EX8 A;  4IH6 A;  1RA7 A;  1RAB B;  2HW3 A;  1HAR A;  4S0M A;  4Q2L A;  4CYU B;  1DUR A;  4X2B A;  2FGO A;  2OPS B;  2QV6 A;  3G6E S;  2IDL A;  4A8F A;  2H48 B;  3G82 B;  5J2N A;  3V6J A;  1UVK A;  1X5S A;  1K9M T;  4OZJ A;  5J2P A;  5D4O A;  1EKR A;  3F56 A;  4M1K A;  3QWU A;  2YWK A;  2NRE A;  4O0N A;  2DB1 A;  1U1P A;  4ECX A;  3IR6 B;  3OSN A;  5DQG A;  2QMX A;  3NL0 A;  2LU2 A;  4J9Q A;  1B0V A;  1WG5 A;  4WP3 A;  2W25 A;  4IOB A;  2VBZ A;  1FD2 A;  3PEH A;  1EZZ B;  4C0B A;  3T1Y F;  2OPQ A;  2ZE2 B;  1FHT A;  2V68 A;  4G6V B;  3LP0 A;  4LIW A;  3SQG A;  3L7P A;  3T1A A;  2ZWO A;  1NK4 A;  3HZG A;  4DV0 J;  2RDD A;  2E9Z A;  3RR7 A;  4DR6 J;  2BE9 B;  3NY0 A;  5DS7 A;  4G65 A;  3MGJ A;  4N76 A;  2M7S A;  3WDO A;  4CLZ A;  3KLE A;  4TVA B;  3QGI A;  2NPF A;  2EPI A;  2Y8Y A;  1T9W A;  1WEZ A;  4RO0 A;  1U25 A;  1BY9 A;  2BKN A;  4F25 A;  4O3Q A;  1HBO A;  4D3G A;  2HRU A;  1A0O B;  4JUZ A;  1MSW D;  1F9H A;  4OI4 A;  3V4I B;  1LQ9 A;  3HLU A;  4RNH A;  3R7B B;  4OZN A;  3LOU A;  4ID5 B;  2O1P A;  4DL2 A;  4NAS A;  1Y00 A;  5I42 B;  2DNQ A;  4W98 A;  2QL5 B;  3VAJ A;  1SCJ B;  2WVF A;  5C24 A;  4CLS A;  2BJ9 A;  2UXB J;  1YRX A;  2CA9 A;  2EC2 A;  4LRF A;  4RX6 A;  1PAU B;  3BBB A;  2YKA A;  4ALZ A;  2VOD A;  2Y8W A;  3IBC B;  3V6D B;  1KVI A;  5KG2 A;  4HR2 A;  1VDH A;  3WC2 A;  3I9Z A;  4LF7 F;  2KHD A;  2KI2 A;  1HKA A;  4KO0 A;  4JV1 A;  3AB2 B;  3CVK A;  3UE2 A;  2O67 A;  4IR9 A;  3CJ0 A;  2OH2 A;  4BCA A;  2E1C A;  1MWQ A;  2AYE A;  1S9F A;  2J6S A;  4LF6 F;  4RW6 A;  2YKP A;  5KFO A;  5K14 A;  1JLQ A;  3RRK A;  3AY0 A;  5EWF A;  3M9M B;  1AUS L;  4X65 F;  4LSN A;  2RAQ A;  1NJI T;  3J7A 1;  1GTE A;  2QLF B;  1C4C A;  2XZT B;  1UAW A;  3ETM A;  2DGU A;  4M5I A;  1MWZ A;  4D3H A;  2QSW A;  3CDB A;  4DBQ A;  2XWX A;  4PCQ A;  3VAM A;  2W7O A;  2ZIT A;  1RT4 B;  3UCZ P;  5D4N A;  1QVF R;  2YNI A;  2Q43 A;  1HL6 A;  1J5O B;  2AMC B;  5HJY A;  4RPF A;  5U47 A;  3FNN A;  2FQQ B;  3UDV A;  3W2W A;  3D0I E;  2RDJ A;  2CYY A;  1N33 J;  1RTD A;  3D54 A;  4DUY F;  2NUU G;  2MKC A;  2BJ7 A;  2VBY A;  2IVM A;  2MHE A;  4NLU A;  4B9M A;  3MR5 A;  4M63 A;  3ZZO A;  4CLK A;  3TA1 A;  5FLX U;  3B8H A;  2X3D A;  3S01 A;  1RT6 B;  4DF4 A;  1U0S A;  2GIQ A;  1R7I A;  3OJS A;  1RAI B;  3MPD A;  2R7V A;  1PYT A;  1RHU B;  3D0H E;  5E0O A;  1Y3J A;  1OSC A;  1VBK A;  2M9K A;  2V69 A;  2Y1I A;  2IBO A;  4KGK A;  3PFO A;  4R8U A;  3T6J A;  3T9Z A;  2CPF A;  2OO4 A;  1YIJ S;  3H8Y A;  4Q2M A;  2ZKT A;  1LWC B;  2HK3 A;  4B3S F;  1LW0 B;  1RAA B;  3VQT A;  2ZFH A;  2K1R B;  4RUB A;  2M70 A;  1R0A B;  2BXJ A;  3SDE A;  2HG4 A;  5LJ3 Y;  1RUS A;  4ZLP A;  1R0C B;  2QEX S;  1TZ0 A;  2IHR 1;  1FX2 A;  3F0N A;  1U1R A;  2ALY B;  2X7I A;  5KG3 A;  4NLP A;  3H25 A;  5LSR A;  2ZWP A;  3DXB A;  1SC4 B;  2DGS A;  1SC3 B;  2G0J A;  1JX4 A;  1F5A A;  1WC6 A;  3UQS A;  2KN4 A;  2VQF J;  3ISN C;  1RA6 A;  3P6Y C;  3GIL A;  1PJ5 A;  4JI5 J;  2MZT A;  1W26 A;  4PRF A;  3LWM A;  2XI3 A;  4HH1 A;  1UVJ A;  1REV B;  3G2X A;  2KHC A;  4DSJ A;  4ZN1 A;  4PWD A;  4XPC A;  2CIM A;  4P75 A;  5I3U B;  2YX7 A;  2LA4 A;  1VRQ C;  1NK8 A;  3DGP B;  3MM7 B;  1KLM B;  5A2Q U;  4M5M A;  4R5P B;  4USK A;  3OL6 A;  2ABY A;  1D8Y A;  4ZVG A;  3CCV S;  3DLB A;  1FEH A;  1S1U A;  2B6A B;  4AQY J;  4RW8 A;  4JI4 J;  3EZU A;  4ZVU B;  2OTL S;  4HVZ A;  2QRR A;  4J9L A;  1Q8L A;  2VZ9 A;  3U27 A;  1X4F A;  3D1H A;  3QBC A;  1V3R A;  4HI1 A;  1RBL A;  1VCT A;  4RBV A;  3C6T A;  1U2F A;  4MT1 A;  1WHW A;  4WZM A;  2GZO A;  2XI2 A;  2HFZ A;  3RBZ A;  1N5Y A;  1Y0H A;  2MHN A;  1IJE B;  5CYM A;  1HHT P;  2QJ3 A;  1ZM2 A;  4K5S A;  3X3U A;  2K3K A;  2L3M A;  2CPE A;  2MQM A;  2A3J A;  2ZD1 B;  4OZ1 A;  4ED3 A;  4U8V A;  2BAN A;  3DYA B;  4JYA J;  3NBP B;  3BGF A;  4DUZ J;  4UOH A;  3I87 A;  1FA0 A;  4RW7 B;  5CQG A;  1N34 J;  4BC9 A;  5DQI A;  1R89 A;  4RU9 A;  5D78 A;  4DG1 A;  3J81 Y;  3CJ2 A;  4UF4 A;  5B0A A;  3W5Z A;  1EB0 A;  1ULR A;  2FHO B;  3GIK A;  2FLN A;  4LVO P;  1F1B B;  3KTQ A;  3KHL A;  4B9V A;  1Y7P A;  1X5P A;  4Y2C A;  3PXG a;  3KK2 A;  3TAR A;  3NEK A;  3KOA A;  1PBU A;  4HDH A;  2DEI A;  1S5Z A;  1NK5 A;  1T05 A;  3D0G E;  1NB7 A;  2FPH X;  4EWT A;  5H9E K;  3H5Y A;  1I51 B;  1SL2 A;  5DZ7 A;  3PYE A;  2QL9 B;  2FY8 A;  1RTH B;  5CHC B;  4FYX B;  4I64 A;  1UWB B;  2N82 B;  1RXO B;  4F4A A;  4C8Y A;  3N79 A;  1ZYQ A;  1U24 A;  2MQ8 A;  2C3P A;  4PQA A;  4Y00 A;  2FY1 A;  4PPZ A;  3CME S;  3ET6 B;  2EK6 A;  2KYZ A;  2LXU A;  3QFW A;  4B9U A;  4UZB A;  5BYQ A;  1FRI A;  3PW5 A;  5F9N A;  1MU2 B;  4WK3 A;  4OHX A;  4WXW A;  2HQF A;  2AYG A;  2UUB J;  1CC8 A;  3EPG A;  5LMU F;  5ADZ A;  1T7P A;  4Y3C A;  4WKY A;  2B4U A;  2YKO A;  2DBB A;  5D3G A;  2VPY B;  2HHH F;  1ZM4 A;  1KQS R;  2VFU A;  4K4S A;  2V67 A;  5GAD U;  5JVH Q;  5KFH A;  2HFV A;  1XNR J;  4YB6 A;  5GAE U;  5LOQ A;  4CYU A;  1NSQ A;  1X9M A;  1WI6 A;  2GO9 A;  3O6Q A;  4NYO A;  2OPS A;  2OKQ A;  3D7S B;  1WC4 A;  1P1L A;  2ZDP A;  3G82 A;  3VAI A;  2VA3 A;  4GKJ J;  4JI0 J;  3P96 A;  4O3O A;  2AWZ A;  1H38 A;  3I0R B;  1X7V A;  5D8H B;  2DH9 A;  3W9H A;  2LQJ A;  1G4C A;  2UV8 G;  4DL4 A;  4P9S A;  4YUD A;  1CC7 A;  2DR8 A;  1KD1 T;  2FJD B;  1K0T A;  3DMJ A;  4M5J A;  1L3S A;  3ENA A;  4ELU A;  2RE1 A;  4NCB A;  4HYK A;  2ZE2 A;  3MUT P;  3J7A N;  4YR0 A;  2GQQ A;  1H72 C;  4DX6 A;  4CQ1 A;  1WTF A;  2H5J B;  2YQ3 A;  4X4O A;  1U6F A;  2B9Y A;  4DQI A;  2DH8 A;  4DL6 A;  4PAB A;  3K58 A;  3DLL Q;  1DZ5 A;  3W60 A;  4UOF A;  3KMQ A;  1R8A A;  3DRP B;  1YJW S;  2K3I A;  3BGR B;  4CT8 A;  4PYA A;  3OV7 A;  1SL0 A;  2YWW A;  4B3M J;  5LXR A;  3D6T B;  4Q8E A;  4KRW A;  2LVW A;  3CJS A;  5HMY A;  2FJX A;  1T9V A;  5HVG A;  1JKH B;  3MEE B;  5L1I A;  3PYF A;  4CIO A;  4P7T A;  1HBU A;  4NLX A;  1FWL A;  4ID5 A;  4Q45 A;  4U7U D;  5I42 A;  2Y9H A;  2A1B A;  4MTP A;  1ZH5 A;  2ZEJ A;  4X4P A;  3MM5 B;  1X4A A;  4I2P B;  3RW6 A;  3ICL A;  1YJ7 A;  1LEO A;  2QGF B;  3VVU A;  3O3L A;  3V6D A;  3A8J A;  3PW0 A;  2ZH2 A;  1H2U X;  4G1Q A;  4AFF A;  1VJW A;  4MFB B;  1QUV A;  1M5V C;  1M5P C;  3GV8 B;  3MAA B;  1WNE A;  1HNZ F;  2BV3 A;  3FCV A;  1KHV A;  3OLA A;  2DGQ A;  3PV8 A;  1RIS A;  5K5M A;  2Z4P A;  2MKS A;  2BBE A;  1HI1 A;  3Q8Y A;  4YFU A;  5LJ5 Y;  4QWD A;  4QOT A;  3C46 A;  5F9L A;  3IRX B;  5JVG Q;  1RT7 B;  1AA1 B;  4J7C A;  1JB0 C;  2G2Z A;  4DEZ A;  4RLE A;  3G6V A;  1FE4 A;  3F73 A;  1I3O B;  1J5E J;  3W64 A;  4NXM J;  3W65 A;  3R5B A;  4LUB A;  4KHR A;  4R0J A;  1SJ1 A;  1W7W A;  1RT4 A;  1PKU A;  5GVQ A;  1DFD A;  1FKO B;  3CED A;  2Q1L A;  4WBF A;  5E41 A;  4PPD A;  3THP A;  4ECS A;  1H3D A;  1T94 A;  2RF2 B;  4AD6 A;  3H7H B;  3GIR A;  4MKB A;  3HDS A;  5ETT A;  3CCS S;  1WF2 A;  4OI3 A;  1M5K C;  4DV2 F;  3E2E A;  3PJ9 A;  4FS1 A;  3FGV A;  3HJF A;  1HHQ A;  4OI6 A;  2Z2Y B;  4I7F B;  1L3T A;  3KHH A;  1RT6 A;  1U2C A;  4P74 A;  3H2V E;  4F7V A;  1QTN B;  1KN6 A;  4DL7 A;  4DR6 F;  1LK5 A;  3A8K A;  2ZNY A;  4F4W A;  4V19 J;  2R8G A;  5G4D A;  3K59 A;  1SPB P;  4DPO A;  1X4H A;  1V5I B;  2ROG A;  2KJV A;  2F7V A;  1J27 A;  3U02 A;  3TVY A;  4LSL B;  1RAH B;  5DDO C;  1NUE A;  3H20 A;  3M6U A;  4K5R A;  1I5O B;  1NU4 A;  1LWC A;  2XNQ A;  3VAK A;  1N5S A;  1LW0 A;  2VIH A;  1KEK A;  1NKE A;  3QJL A;  1RZM A;  2AEF A;  2XLI A;  1R0A A;  4X4U A;  3O5T B;  1FKA F;  3JSB A;  3MFI A;  3MOJ B;  3KYL A;  2HHX A;  1AZS A;  1VQS A;  3KNG A;  1S7H A;  3CSK A;  1GXU A;  1N4L A;  2KVQ E;  3UN5 A;  5BYS A;  1S6U A;  1NPP A;  4QJV A;  4UZC A;  4Y65 A;  5FDL B;  4NLW A;  2E29 A;  3D6M B;  1YG0 A;  2IVY A;  3OFG A;  1B64 A;  4BWM A;  3VVT A;  5BXI A;  2ZM6 J;  3HT3 A;  1IBL F;  3GZ7 A;  4CNZ A;  1REV A;  1ZPW X;  2EFO A;  4JV2 A;  4KT0 C;  1KR4 A;  2HRY A;  2H65 B;  4C2M A;  4KJI A;  1FRX A;  2R2S A;  1KLM A;  3OR2 B;  1RE1 B;  5J2M B;  1O8B A;  1FJC A;  1KOO A;  4HDG A;  3KUG A;  2V8G A;  2B6A A;  2QLJ B;  1U48 A;  2VON A;  2B0G A;  3RB3 A;  3IR7 B;  3K8W A;  2J0X A;  2PA3 A;  1SIZ A;  2WVC A;  5B0D A;  2UUW A;  1FK9 B;  2HFN A;  2KYX A;  4DSF A;  4ZVP B;  4ECZ A;  3LGN A;  5IT9 U;  1H98 A;  2B9E A;  2VG6 B;  2MST A;  4X84 A;  3IXQ A;  4P52 A;  3GWC A;  1EQM A;  1BWV A;  4NA2 A;  1NND A;  5J2Q A;  2V8H A;  3B78 A;  3OXF A;  4K4X A;  2ZD1 A;  4IOA Q;  3DYA A;  3CDU A;  3NBP A;  1IBC B;  1C0T A;  1C2P A;  3I32 A;  2D69 A;  1SB6 A;  2HLU A;  1CJT B;  4OMF G;  2Q6B A;  4OX9 J;  2YQ0 A;  2IMW P;  2DNL A;  3W9J A;  1VMB A;  5L46 A;  2AT1 B;  2MZR A;  2PEH A;  3VF0 B;  1XER A;  5EX0 A;  4LRA A;  3BSN A;  4L72 B;  1R27 B;  2Z57 B;  2OTJ S;  3C16 B;  2DXF A;  1BHN A;  3FEZ A;  3FQL A;  4GO5 X;  2IM1 A;  1OQ6 A;  1NPK A;  2NLW A;  4C3M A;  1WAC A;  2ZNZ A;  2HS0 A;  2HS4 A;  1D9D A;  4E8U A;  2I9S A;  1JQG A;  2F8H A;  5EUH A;  2IDE A;  1RTH A;  1P27 B;  1RTJ B;  5A8W B;  1UWB A;  1RWP B;  4K4Y A;  4MJK A;  5J1N A;  2C2N A;  5SZT A;  2DH7 A;  4E98 A;  1L3U A;  2EKN A;  4AL6 A;  4DFJ A;  4DN0 A;  2YKN B;  1TUW A;  3ET6 A;  2A6M A;  2KXN B;  2V63 A;  4U8Y A;  4E2F B;  1GMV A;  2JHE A;  1CBK A;  1FO1 A;  3MPW A;  1IKX B;  4P7V A;  3K57 A;  4ZCM A;  2E5L F;  3HK2 A;  1BQX A;  1QSY A;  3T41 A;  5BYR A;  3JXO A;  4C8M A;  4DN9 A;  5KFQ A;  1FNX H;  1HWL A;  1XMB A;  1VIX A;  3N28 A;  3IC1 A;  4ERD A;  5IFM A;  4NL5 A;  4P71 A;  2GHW A;  3TX8 A;  4J5O A; 
#chains in the Genus database with same CATH homology
 4C6A A;  2DXF A;  3FC9 A;  3FCW A;  1KDN A;  2BEF A;  3PRV A;  4DZ6 A;  3EVW A;  3VGT A;  1NSK L;  1W7W A;  4UOH A;  1BHN A;  2BX6 A;  3NGS A;  3FBC A;  3DKD A;  3EVM A;  1EHW A;  3MPD A;  4S0M A;  1NDC A;  2AZ1 A;  1PKU A;  1F3F A;  3NGR A;  1NLK L;  2DY9 A;  1U8W A;  3ZTP A;  4WBF A;  2NCK L;  3DDI A;  4UOG A;  1BE4 A;  1NPK A;  4F36 A;  3EE3 A;  3G2X A;  1WKK A;  3FKB A;  5C7P A;  3ENA A;  3VGV A;  1JXV A;  1LEO A;  2CWK A;  3B54 A;  3VVU A;  4DI6 A;  2B8P A;  3ELH A;  3GP9 A;  1WKJ A;  3ETM A;  1NDP A;  1XQI A;  3FBE A;  3EMT A;  4FKY A;  1XIQ A;  1NB2 A;  2VU5 A;  3PJ9 A;  1B99 A;  3ZTS A;  1K44 A;  3BBF A;  1LWX A;  3FBB A;  3ZTR A;  1VYA A;  4ANE A;  2AZ3 A;  3VGS A;  4W98 A;  2ZUA A;  1PAE X;  1HHQ A;  1WKL A;  3Q83 A;  3FCV A;  3Q86 A;  3NGU A;  1F6T A;  5CAB A;  1MN7 A;  1S57 A;  4O0N A;  3FBF A;  1S59 A;  3GPA A;  2DXD A;  3B6B A;  3WX8 A;  1ZS6 A;  2HVD A;  3EVO A;  5CAA A;  2HUR A;  1S5Z A;  3JS9 A;  4EK2 A;  2DXE A;  4UOF A;  3VGU A;  1UCN A;  3Q8V A;  3Q8Y A;  1NCL A;  3BBB A;  2DYA A;  3EIC A;  3BBC A;  1NSP A;  3BH7 B;  1NSQ A;  4HR2 A;  3VVT A;  5BXI A;  3Q8U A;  3R9L A;  3L7U A;  3EM1 A;  4ANC A;  1HLW A;  4AND A;  2HVE A;  4DUT A;  3EJM A;  3BH6 B;  3ZTO A;  5IOL A;  4F4A A;  1BUX A;  1MN9 A;  2B8Q A;  3NGT A;  4CP5 A;  3ZTQ A;  4FKX A;  1HIY A;  1NDL A;  1NDK A;  4KPC A;  1NHK L;  3Q89 A;  1NUE A;  1B4S A;  4ENO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...