3EVWA

Crystal structure of the mimivirus ndk r107g mutant complexed with dtdp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
b'AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
molecule tags Transferase
source organism Acanthamoeba polyphaga mimivirus
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
total genus 42
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3evwA00
4FKXA 3B54A 1PAEX 2HVEA 2CWKA 2DYAA 3FBEA 3VVUA 3Q8YA 1MN7A 3VGTA 3ETMA 1BE4A 4UOFA 3BBCA 3EVMA 2HVDA 1NSPA 3FBCA 3NGTA 3VGSA 3PRVA 1NDPA 1PKUA 1K44A 3B6BA 1F6TA 3ZTSA 3EJMA 1HLWA 3GP9A 4F36A 3GPAA 2AZ1A 3EE3A 3DKDA 1NDKA 1BHNA 1HHQA 3EICA 4ENOA 4UOHA 4O0NA 3L7UA 2BX6A 4ANDA 1NPKA 1VYAA 1NB2A 1W7WA 4KPCA 3WX8A 3NGUA 2VU5A 3MPDA 1WKKA 4ANEA 1NDLA 3Q83A 3EM1A 1NLKL 3Q8VA 2NCKL 3EVOA 3NGRA 1F3FA 3FBFA 1ZS6A 3ELHA 2DXFA 3FC9A 5BXIA 1NSKL 5IOLA 4EK2A 3ZTOA 1B99A 3EMTA 3VVTA 2HURA 4F4AA 2BEFA 1BUXA 1NDCA 4HR2A 4C6AA 1S57A 3ZTQA 1UCNA 4WBFA 1WKJA 2B8QA 3VGVA 5C7PA 4S0MA 3FKBA 2DXEA 3FCWA 3G2XA 5CAAA 1HIYA 3Q89A 4ANCA 4DUTA 4UOGA 1XIQA 1S59A 3BBBA 4FKYA 4DI6A 3ENAA 1NUEA 1JXVA 3FBBA 3FCVA 5CABA 1NCLA 3BBFA 2ZUAA 3JS9A 1KDNA 4W98A 1EHWA 3VGUA 1NSQA 3Q86A 2B8PA 1MN9A 3EVWA 1WKLA 3BH6B 1XQIA 3ZTPA 3DDIA 3PJ9A 1S5ZA 1U8WA 3NGSA 4CP5A 2AZ3A 1NHKL 3Q8UA 2DXDA 3BH7B 1B4SA 3ZTRA 1LEOA 4DZ6A 3R9LA 2DY9A 1LWXA
chains in the Genus database with same CATH superfamily
3B54A 4K7QA 2BKOA 3J81U 2VG6B 1KS2A 2H65B 2KI2A 3M6VA 3MMBB 1VQ8S 2XY6A 2OGUA 1KWMA 1N33F 5C2CA 2DR9A 3KUHA 4OZ2A 5J1PA 2PIIA 3M2VB 2EW9A 3FBCA 4TY9A 4F26A 3OD2A 1IVZA 1S6PA 4K2XA 2HK3A 4I6YA 5HVFA 1EKSA 4USJC 3T6JA 4ZPWR 4F0MA 2W9CB 4JI5F 3QFWA 4DV5J 1FI4A 1OWXA 2DNHA 5E3CA 2Y3YA 4QR2A 1U1OA 1Q8IA 2K7JA 2XMWA 3DRPB 4CO2A 4A8KA 3X3UA 4ID5B 4RNMA 2XNQA 5KFUA 2KT3A 3VAIA 1RTIA 1FDAA 3BN4A 1U6BA 4ZIVA 2QLXA 1UFWA 4IUFA 2CPHA 1RTJA 2FHJD 3CMES 1KEKA 3H0PA 4KO0A 2ZJPQ 1X4GA 4OZ5A 4ZLNA 2CJYB 4OL8A 4YS2A 3P45B 3I4HX 1OIAA 3BF4A 2YKNB 2NSBA 1MW7A 2PGCA 2YNIA 2LU2A 3KXDA 4RNOA 1RT2A 1FTCA 2HFOA 2QV6A 5SUHA 3P8BB 1HNZJ 2MKSA 1QTMA 3KLIB 3THVA 1VR6A 4WCEQ 3GFXA 1WOPA 1YSJA 1ZS6A 5GAGU 3TVYA 1Y5IB 1FF2A 1WEXA 4NLDA 4PXBA 5CXTA 2E9TA 1YRUA 5DLGA 1QD1A 3OTEA 2HVZA 3EMTA 1CSJA 4R8UA 1NJIT 3HF5A 3VR1A 4ED5A 2V8GA 1SC1B 4NLOA 3S7RA 3VVTA 2D3OR 3OQ2A 5FIIA 3T19A 2EFQA 1UTAA 1ZPWX 2DGQA 1WKJA 2EC0A 2UZAA 4M5DA 4OHVA 4I2QB 4CT8A 5U47A 1MMLA 2LQ5A 1XNRJ 5H9EK 2RU3A 3HPOA 2RHQB 4L75A 4WZQA 3A4TA 3MAAA 1T0TV 4ICLB 3D6MB 3M05A 2HNZA 5C42B 3K58A 5CAAA 3HK2A 3NOGA 2Y1LB 4YFUA 3QRRA 1R43A 4DV4F 5HJXA 4X4QA 3H98A 3UO0A 3DLGA 4F7VA 2DNGA 1XR5A 2DEIA 2ZFHA 3K2YA 3J7A1 2UVWA 3JB9k 2CQBA 4LF6J 2IYIA 3BBBA 1LK5A 3CO0P 4FKYA 2IRUA 1KP6A 1VDHA 4NCAA 1YWXA 4HVZA 4FXVA 7FDRA 3D9BA 3VAGA 2W25A 1JLFA 1RHMB 1JQGA 3BGOP 1RAJA 4WZMA 5I4MA 3KHHA 3EZOA 2OSQA 5T7LB 8AT1B 2HMIA 2XB2D 2P6TA 1TL3B 4JI6F 4DX8H 3TZXA 4OX6A 3OVAA 2XMJA 4C0OC 1SKRA 2PC6A 3QGGA 2DR5A 2QL9B 5ADZA 1S4EA 4ZHRB 1S1VA 1VI7A 4M5GA 4NOHA 3TAPA 3NY0A 2EKNA 4CH0S 4C3MA 4ZKAA 4ECQA 1M5KC 2PFFB 2MSTA 1LEOA 4NCGB 4ES3A 3H4DA 3N01A 4B08A 2DNYA 5JMNA 1Y00A 1MWZA 3H20A 2CNOB 4TY8B 2UUBF 1CJVB 4LF8J 2OMOA 3ZZYA 4DR4F 1VIOA 4MKVA 4NLPA 4NE9C 4U8YA 3UR3C 1Y5NB 4KGXB 1AT1B 1T8EA 1R7IA 2M8HA 3HLUA 3I5BA 4XPCA 4X4RA 4F4WA 4HDHA 1U0HB 1IM6A 3I56S 2J8AA 3A8IA 2A3JA 3D1QA 3H2LA 4MFBB 2K8GA 3SBMA 2X1FA 2OSRA 4LR8A 1X4AA 4H4OB 2IDLA 1YLXA 1HWIA 2QL7B 1VBKA 5HAOA 2N4DA 3DRYA 4O3OA 4ECYA 2J9EA 3C3LA 3PW2A 4UQTA 3KJVB 3O8WA 2DH9A 2ZH6A 2ZH7A 4OZNA 4NZ6A 2HBQB 5E3RA 2XWXA 5E3QA 2VICA 2J8SA 3DHXA 3DLHA 3IXQA 2Y1IA 2XMKA 1R8AA 2I1RA 3EE3A 1D9AA 3JQKA 1NKBA 5GAEI 3DOLB 1PILA 4NLRA 4WTYA 2ZEJA 4P10A 4USTA 4ITSA 3B82A 3GFYA 4KRWA 4KSEB 2IMOA 3VAJA 2H5EA 4P72A 4DV2J 3RAQA 2WVEA 2W4CA 2ABYA 3CJ5A 1P8GA 1K0TA 4KBIA 4B9SA 1Q82T 5KT2A 2FYXA 5B0BA 2B43A 4X4SA 3NMAA 3I5AA 4UY8T 1J5EF 2RRNA 4DG1B 4KR0B 2OPSA 3F41A 4L73A 2GMHA 4DSKA 2ZBIA 1JLEB 3LAMA 3FC9A 1S1WA 2HAFA 2XLJA 1AYEA 2Y0SD 3R1LA 4GVLA 3OVSA 3UQSA 2PFDA 3EGNA 5LMUJ 2FUG9 3TQ1A 3RG6A 2I38A 1WWHA 4F4AA 4DFMA 4WFBQ 4IFYA 4L74A 1S1XA 4XDDA 2HWIA 4IQXA 3F56A 3SCLE 2MDAA 2AF6A 2E7VA 3C14B 3CD7A 2VQEF 3G6XA 4JI1J 2JZ5A 2OP5A 4CO0A 1E6YB 3FEYB 5IZHA 4U8VA 3W63A 3AB4B 3N6NA 5HMYA 1AUSL 1AB8A 2ROPA 3AOCA 3C66A 3HFZB 2VQEJ 3EGVA 2VC0A 1WHWA 2D3O1 1HIYA 2D69A 1OQ6A 4XK8C 1JNRB 4ED6A 2ZE2B 4FBTA 1JK9B 1BWEA 4TQRA 1RTZA 5D4PA 2OKQA 2Q43A 2EFGA 4K8RA 2ALZA 4JV5F 1RCXB 1ZZNA 5A8KB 4ECSA 3QPIA 1BWVA 2C2KB 2C22A 3KDNA 1VS3A 4W92B 4NYPA 4C2MA 1C0TB 1HFEL 1CJVA 1I1GA 1N52B 4IG0A 2F4FA 5EX3A 1Q7LB 3CD5A 3T5KA 4A48A 3S6EA 1JJ4A 4E8UA 2V8VA 4P6QA 2V50A 1Q53A 3WX4A 5LJ3Y 1CC8A 1E6VA 2HZAA 4G1QB 3A3NB 2RQMA 2L41A 2ILYA 4I2PA 4RUAA 3BSAA 4QWAA 5HROA 5KFTA 3PR4A 4BHQA 2Z4PA 2HGLA 2DNOA 5F8IA 2MQOA 2E7XA 2OJ3A 3SMZA 2D9OA 3TUPA 3MR3A 5KTQA 4DV1F 2B9XA 3RBDA 3U27A 1TKDA 3K7RA 4HL9A 2WOMB 2DNNA 3R3TA 1TL7B 4I2QA 1O51A 1RWUA 4X4PA 1Y3JA 1OO0B 4OX8A 1M1GA 2CZVC 2PMHA 1LWXA 4KH1B 3HM9A 3W3SA 4NX9A 3BPDA 1BQMA 2DY1A 3VGTA 3ETMA 1UKUA 1YDLA 2AIRB 2J9DA 4OHZA 2VBWA 3GQCA 1VC6A 2FLNA 1QSSA 3NL0A 3DN9A 3MM6B 4LQ9A 1URRA 3AY0A 3SEOA 5A8KA 1N33J 3NGTA 2XLKA 2HIQA 3KK1B 1M1HA 3W5XA 2HQFA 1RHJB 4DS5A 1B0TA 3FEZA 1HNVB 4IH7A 5AE3A 1X4HA 4NA3A 2ATLA 2KB2A 5KFJA 4OX9J 2XZTB 1BQNB 4YY3F 2NR0A 5L1JA 2VZ9A 2YH0A 4N8NA 3O6QA 3E3XA 1U45A 3E51A 2E5IA 4C97A 1FHTA 2YVSA 2J0WA 2GVDA 1EQMA 2DGWA 3BKFA 3UD5A 3L7OA 4ZVOB 5KFHA 3MR2A 4CWBA 5G0RA 3EICA 3QSIA 3OL8A 3PW5A 4GKJF 4CO4A 1FRIA 4N41A 4OI0A 2FPHX 3ONQA 2KXHA 4ANDA 5AE1A 1RLCL 3CJSA 2QG9B 3K57A 2ZDOA 2CQ3A 5KFRA 1TQLA 1HQUA 2ZWOA 3H59A 3I0RA 2BJ3A 3O44A 4KIAA 3RRGA 1RWOB 4KV8A 2VKRA 2PSZA 3EXYA 3QATA 3SI8A 1XMOJ 3HKZD 2NPFA 3KYLA 4BWJA 2AEMA 4KAIA 1R8CA 1HI1A 4QWEA 2DGXA 4RW8B 4QWDA 5CQGA 2R7UA 3GYGA 1S7HA 4B3RF 2NCKL 2CG8A 1IM4A 3W60A 4W90B 2BYCA 1DHMA 1S7IA 4O3QA 3ZC4A 2R8GA 5IC6B 1VRQC 2IAJA 4OHYA 1REGX 3ELHA 1CS4B 3W66A 4DV7F 1W2IA 5LMNF 3I4PA 1RTIB 1SPBP 2E44A 4ED2A 2KXFA 4URGA 3V6DB 1PAUB 1PG5B 3M1VB 3AJ2A 1JIHA 4QIWD 2HBYB 3CXCR 1KQSR 5J2NA 1RTJB 3MDFA 3MMAA 3SCJE 3V4MA 2ASDA 1M5PC 3DLBA 2FJWA 1FXLA 2UV8G 3PYDA 5DQHA 5KFWA 2R7SA 3G87A 1UA1A 5C7PA 3RZAA 3RAXA 2UV8A 4U7CA 3KLHA 2J7UA 1RAFB 2O67A 1FJ7A 4ECWA 1RHRB 2KZMA 3OXFA 4HHHA 3KLFB 3KK2B 1KC8T 2ZH2A 2IYGA 1I94F 4FF1A 3GE9A 1VMBA 1LW2B 2AJFE 2NREA 1N5VA 3V81B 1S97A 1X9WA 4LF9F 1RUSA 3MEDB 2DNQA 2X51A 3G71S 4EU0A 4KKOB 3G8SA 4DV0F 3HFKA 2R2UA 2IVYA 4K5SA 4R0JA 4PXCA 4R25A 3EDQB 1HYSA 1IQZA 2IJFA 1HBNB 1SVDA 2HFUA 3JQMA 1H98A 4WIQA 3VF0B 5M2UA 2VFSA 3CB4A 3NS5A 1R89A 1HNWJ 2KFZA 4ED8A 3KLGA 5IQQA 2DHAA 3GIMA 1TMJA 3BKUA 1TUVA 3MUMP 2WHOA 2MHEA 1JXEA 3ISZA 4OZLA 2E5LJ 5J1EA 1VBXA 3DRRB 1K1SA 2ZOGA 2AT1B 3CJ2A 2JFKA 5F0UA 3MAHA 3BYRA 2IM1A 5HMWA 1FRKA 3P49B 2ADBA 1F60B 4OYBA 3SFUA 3V81A 1H7XA 2RRBA 1RWNB 4P74A 3PZPA 4GO7X 2IVFB 3T9ZA 5J1EB 1F9HA 1SJRA 5KFNA 4XO0A 4A8MP 4ECTA 2XEXA 4H54A 5HJYA 5DGBA 4QYRA 1VQLS 4URQU 1UMJA 2R2TA 4X65J 4ED0A 2HVEA 4ES1A 1KVJA 2GO9A 2DITA 3BV8A 4ZJOA 3KLGB 2J9DE 1JJ2R 2XZWA 2Q6CA 4Y6IA 1FKOA 2V69A 5CYQB 2R2SA 3OXGA 4B9UA 3QO9B 1JLGB 3FEXB 4KHMA 4QW8A 3UNGC 3BQ1A 4DFKA 4B9NA 1CLFA 4DS4A 4DR2J 3M8ZA 1XR6A 3CF5Q 5E3PA 3T6BA 3LANA 1S6OA 3A8JA 3V4IB 4X66J 3BR8A 2HIYA 1IR0A 1DQAA 1CS4A 1JLAB 1HLWA 1QUPA 1VK3A 4U95A 4EBDA 4ELUA 1SJQA 3GPAA 2AZ1A 2DHSA 1R31A 3V5RA 3CC2S 1QVGR 1RAAB 3DKDA 2DPIA 1RT1A 2C2ZB 4ETXA 2H51B 5J2PB 1NK6A 4ENOA 4CLUA 3PFOA 4QYZJ 2KN4A 2V4QA 3P5TL 5FDLB 4WPAA 1RTDB 2RU9A 4Y34A 4ELTA 2VH7A 1D0EA 3MPUB 2M3DA 3K5NA 5A6WA 3H5YA 4WFZA 1DAXA 4WK1A 1J2VA 2W4DA 2Z2LA 3JTNA 4KY3A 4Y00A 3TYTA 2XMAA 2XC9A 3KLVA 3WC2A 1H74A 4OV1A 1SH0A 2BZ2A 1HQUB 3IC1A 4P2SA 3GV5B 1P1TA 1VFJA 2G2ZA 3Q2SC 1TFWA 2FTRA 5HQMA 3BO2A 1HNIA 1RYRA 1XNQF 2OAUA 2MKJA 2V8PA 5HN0A 1GT8A 1X5OA 5DLFA 4ZS6A 1IKWB 1X5PA 3NOCA 3RUBL 1UVKA 2C2NA 4WE1B 3GJQB 4CQ1A 5DETA 4NEYA 3G6VA 3ZTOA 2BOAA 4DFPA 2C2OB 1AROP 4OFZA 1TZ0A 2RD5C 1DURA 1YBAA 1NDCA 4V1Ak 4Q2MA 1TL4A 5M2PA 2DR7A 4XIUA 3W2VA 4NRTA 2I5JB 3BQ2A 2HGMA 3BSCA 3KJFB 5G4DA 3QYYA 4U67Q 1J5OB 1B7FA 2N3LA 1FRXA 5IV4A 4J9SA 1DLOB 1FD8A 4TXSA 1T05B 4A8OA 1ZAVA 3ULHA 1SJ1A 3AD9C 3DU6A 4LVOP 2NLWA 1K8AT 2PEHA 2UU9F 4UZBA 3G2XA 5HBMA 4FYDA 3TJ9A 4RW6A 4K59A 2F9DA 3X1LB 3Q8SB 2OUGA 4C11B 3KHLA 2DNMA 4DQSA 2QA4G 4FF4A 2K1RA 3HCXA 2JL9A 1VQ4S 2VA2A 4CRJA 4I7FA 1RKJA 1AZSA 1KQKA 3QLHA 2XGQA 5HATA 1WSVA 3MPWA 5KFOA 2ZZMA 1PC5A 3K59A 1WC0A 4DBQA 3HFVA 4M5MA 5CABA 1IUJA 1TL7A 4BCAA 4D3HA 4C8ZA 4O3RA 3OSNA 3N5FA 3OJSA 1RGVA 4HDGA 4TU7A 3TAMA 2FLLA 2XYHB 2ROEA 3EUNA 2XCAA 4DR1J 4Y28C 2AEJA 1VRTA 1WC3A 1S9GA 4CLPA 2JEIA 3SQOP 4JP8A 4QZVB 4TVAB 2ZVSA 1GXUA 4O4GA 2W8LA 5C24A 3MD1A 2GW8A 4HEA9 2QX0A 4ZA1A 4AL5A 2CPXA 3AD8C 3GV8B 1NB7A 4DPWA 3SFGA 4DN0A 3OBIA 2QL5B 2VJVA 1N5YB 2IHR1 2J76E 2U2FA 3GFZA 3HXMA 1AFJA 1KN6A 3QLHB 2M88A 4WU2A 3PYGA 4DR6J 4PYDA 2K1RB 3GLJA 1F0XA 4J9QA 1C0TA 3VAMA 4RU9A 1OPIA 4K4ZA 3W7BA 4Y65A 1R8BA 2JLFA 2UXCJ 4LF1A 3HHLB 3W5YA 5B08A 4M95A 2KO1A 3Q8YA 3SIPB 2WVBA 3QT7A 2LXIA 4B3SJ 4I1TA 3PY8A 4J90A 1NRKA 5DS7A 3EVMA 1CJKA 3G9CA 4JI7F 4IO1A 1YTYA 1PGZA 4RW7B 3GU0A 3JQJA 4O3SA 1PKUA 1FKPB 3DYAA 4J37A 3KK3B 2QFJA 4H4MA 3JSMA 3ICLA 1PJ7A 5D0RA 1IKWA 1C2PA 2GFFA 3J7AN 2CDRB 1JLEA 3J7ZT 2ASYA 4OI4A 3ZNUA 7FD1A 2W2PP 2YKAA 2QIFA 3EPGA 5F8MA 3TARA 3FQLA 5KG2A 2ADCA 3RB6A 4ILMA 1D9FA 2WW4A 3AJ1A 3L7UA 2YWKA 4KQZA 4GKKJ 2BE2A 1NPKA 4P71A 3G8QA 4RNHA 6FDRA 5KG7A 3G6ES 4DV6J 1AFIA 1HWUA 2ZITA 1KNZA 2AYEA 4PYAA 3WX8A 2K2PA 3UDCA 4DV7J 1SKSA 3QRQA 2XCPA 4AYBD 3R6LB 1UFKA 2FJEB 2JH3A 5HQ8A 3J81Y 1RXOB 1HBMA 1ZAXA 4PR6A 4CTAA 3K5OA 5CCLA 5DQGA 1VQ9S 2DRAA 5D4NA 2YXLA 4H4KC 1KTQA 2I9SA 4PCQA 2HW3A 1Q95G 1RISA 1YZ6A 2MZ1A 3FQKA 1JLBB 8RUCA 4PABA 4BC9A 1U2RA 2LEAA 1F9EB 1RA6A 2Z57B 4F25A 2W24A 5D8HB 2JLEA 3D68A 3LO3A 5HK4A 3PRBA 4QJVA 2UUCJ 1P1LA 4RU2A 2RMLA 1KKHA 2CJAA 3UE2A 3W5ZA 2M9KA 1JLQA 1ZM2A 4ECUA 1SUQB 1JLAA 1HA1A 4WBFA 3RAMA 5A2QY 2P9EA 5AJ3J 3OR2A 3H25A 4DQIA 2HHQA 4H4MB 1ICEB 2ZH1A 3L4BC 3CWJA 3MMJA 2FC9A 2WONB 4JV1A 5EN1A 1FK9B 1UW9A 4CYUA 3QIPB 3GIIA 1Y10A 2ZBPA 4DSEA 1HW9A 4MK9A 1EQ0A 1HPZA 4YMEA 4DX7A 3GFHA 1NO8A 4DR2F 3H5SA 4ILRA 1TELA 1RU1A 1T7PA 3DI6A 2R8HA 1IN0A 4I64A 4KHPF 1NU4A 2PDAA 1U25A 1U8SA 4AQYF 3CCES 4G1PA 1ZH5A 2W2MP 2PI4A 3SV4A 1WC5A 2JEGA 1TAQA 2LEBA 4ZVHA 3DLLQ 3JSBA 3MM7B 1RI7A 1SCJB 2W8KA 4CT9A 3OLBA 4YQWA 4PEOA 2I6WA 3BDPA 1O0PA 3BYPA 3DDIA 4TY8A 5KFXA 4ATNA 4A47A 2M4MA 2HBZB 3AAWB 3GONA 3KLFA 2LECA 1SQGA 1KD1T 2BW7A 2DXDA 3IG1B 2IM0A 3LGMA 5B0FA 4DHVA 3AXKA 4HH1A 5J2MA 2ASJA 4EBCA 4Y2AA 2E5LF 2OIHA 4ETZA 2HHXA 4WKRA 1FT8A 1LW2A 2EK1A 1RT5B 2F5GA 3CE8A 2MB0B 3H42A 2WVFA 1QM9A 4DL6A 4OYOA 2JOQA 4IRCA 3F0NA 3OR2B 1O6XA 1TKTA 2D3ZA 5AXLA 4E98A 5KFDA 4JI6J 4ZPBA 5C25B 1LKZA 5C42A 5IQ6A 1PAEX 3KLHB 3PX0A 5A6PA 1ZTWA 5M2RA 1DBDA 4B9MA 4DX5A 3AA9A 4OLPA 3UI3A 2HSEB 1XMQF 1X7VA 4WTOB 4USWA 2KG0A 3M30A 2QYCA 1FX4A 1F1BB 2OD6A 1NXIA 4O44A 2CYYA 3RB0A 4M5DB 3NBPA 4R0EA 3PW0A 4RPFA 4DR5F 4PPDA 2AU0A 5LSLA 2W7PA 5F8LA 4EBEA 3TOQA 5E0OA 1AW0A 4OZ0A 1PYOB 4ICLA 3ZFVA 2E1MC 4UT4A 1GMVA 5DG9A 5CD4H 1IBKF 1IBLF 2QRRA 4G65A 1ZA2B 2YQ3A 3PG9A 2MQ8A 2YPYA 1HBMB 1ZM4A 2IA0A 2NXEA 3T1AA 3M8RA 3SQGB 2BKPA 2G0IA 3OL9A 1T9UA 1R0AA 3RB3A 1FNXH 4DPUA 3FZ2A 3EYZA 2EWHA 4FDFA 4F0HA 1FJCA 2ZZTA 4LVNP 3LUYA 5LXYA 2BACA 2RH3A 1BHNA 3OTBA 1S1TB 2QTWA 3M6XA 1WC6A 4CLTA 2VV5A 3OL7A 2OO4A 2M2BA 1UZHA 1G3OA 2H5JB 3AHPA 3DLEA 2I5JA 2ATCB 4HACB 5BYRA 3TX0A 5I42B 2IJRA 4LR7A 2CQHA 3BEGB 2F7VA 1W7WA 2GV1A 5KFCA 2YH1A 2FQQB 4DR4J 4KO0B 2YNGA 1WORA 4QBUA 3LGHA 1R0CB 2HWHA 3A1YG 5HMZA 1RHKB 4A8WA 2OPRB 4PXEA 3MURP 4JOUA 1DTTB 2Z2YB 2UVRA 1UL3A 3HSJA 1S77D 1CEZA 3LPYA 1N5QA 2UXBF 2CQDA 2E1PA 5ETOA 3TUZC 2W9CA 1RB0A 3R27A 1M5OC 3NBPB 5A8WA 4PG6A 4OZJA 2RSQA 5J2PA 1Y4ZB 2DRDA 3UDEA 2XY7A 2V67A 1RAOA 3B4MA 5KG6A 3IM8A 3THPA 3I55S 4O3PA 4NYOA 2HURA 3BGRB 2VOOA 2MKYA 1RABB 1FNMA 5C5JA 1UCNA 1R27B 3JXOA 2R7WA 3DNCA 4ED7A 3RBXA 5ETRA 1QAIA 2OTLS 3E01A 5J2QA 5KG5A 4QR0A 2FVQA 4PXDA 2GCFA 4DCJB 2QA2A 3GJTB 1GQEA 1IKXA 2GJFA 3FCWA 2XS5A 4USUA 2GHPA 3MM6A 1EJ7L 1G7CB 4DSFA 3SXLA 1NK0A 3CTRA 2VL1A 3PO5A 4GKKF 3C15B 2DEJA 1SC6A 1H7WA 1TL1B 1XIQA 2G2OA 2NPIA 3MCNA 4J5OA 3W64A 1E6VB 2BJ7A 4E2FB 4ZLPA 2ASLA 4ED3A 4RUHA 1CJUB 4YB1P 4Q5VA 3VAFA 1YJTA 2YQ0A 4TYAA 3OUYB 1YITS 3WHIA 3RR7A 1XNRF 2JFDA 4C48A 1H6KX 2RJZA 1T9VA 1KDNA 1GK8A 1ZPVA 2CXEA 3QIDA 2UVVA 4NWBA 3DRXA 1XC9A 1T3OA 2BJ8A 3IWLA 3M2RA 3OLAA 3T1YJ 1MN9A 1IBKJ 1IBLJ 1HNXJ 4UZCA 1FERA 4U96A 4BS2A 2E9RX 3BH6B 4X2BA 3JSYA 3OVBA 1DFDA 4EMDA 2IA6A 3CJKB 4AL6A 1HI0P 4HYKA 1YJNS 5CD4A 2Z8QA 4A8SA 1WI6A 2LYVA 3R5BA 4G1QA 4YB7A 3K0JA 5B0DA 3ET6B 1GAOA 3QT8A 5KFSA 3Q8UA 1W26A 2FJVA 4WXOA 3OL6A 2RKIB 1HBUB 2MTLA 2RQCA 2E29A 3UD3P 2KM8B 3OXLA 1RTHA 3FFIA 2BR0A 2Q66A 1E6YA 2VBYA 3OFGA 3TA0A 4RWWA 4IG3A 1S9FA 3KHRA 1YJ7A 2BE9B 2IBOA 3G86A 3QWPA 2F1FA 4A46A 1MROB 4UQGA 2VIHA 2F8EX 4CYUB 2DGOA 2P9CA 1K9MT 2DYAA 2W4PA 5GMEA 1UPMB 4B02A 2KVQE 2ZH8A 2VPYB 2K3KA 3DXSX 2J7KA 3M8PB 3D6FB 2ZD1A 3C14A 3C2PA 4JI8F 3Q8PB 1JXLA 2HWTA 4F4ZA 3DRSA 3M6UA 2Q79A 3C6TB 4M8LA 4L6V3 2CQPA 2F65A 1YX2A 1LFWA 3RW6A 4UW2A 1K44A 4L76A 1WHXA 1TTHB 3WBZA 3QRPA 4RL1A 5ETPA 1SC4B 2EEYA 5F8NA 3CW2C 4J9RA 1JLBA 3ILJA 2QGFB 4I69A 3CDUA 2ZBRA 4DXLA 2LQBA 4TKTA 5E33A 4B9VA 3TANA 2YWGA 2BJDA 1HHSA 3CMAS 1X0FA 1NBEB 2PMZD 2AP6A 3AA8A 2ZVIA 2HS3A 1QE1B 2EI5A 3QWUA 5KFYA 1VISA 3A3PB 1K0VA 4WK3A 4OJ1A 2IBKA 2AX0A 2D3UA 1MU2A 3VQSA 4K4VA 3U1MA 1GX5A 3MOZA 3J80Y 2JWNA 3ILIA 3D3BJ 5A8WB 5GAEU 3BO3A 4JI1F 2PI5A 1HQ2A 4GO5X 1L3TA 3PTWA 3V4IA 3K17A 3KOAA 1S9EB 4NMLA 2YX7A 2BOPA 5IC4B 4F02A 5EDWA 1HQEA 1BC6A 3W8PA 2HQ3A 5DZ6A 3CD6S 4I56A 1CJKB 1RWMB 2EPIA 4OI3A 2VD3A 5DJBA 2PT0A 5LSRA 1KBRA 1YJVA 2COLA 4DR6F 2X1GA 3M8PA 5ETVA 1RT6B 5FLXU 1J27A 2DNLA 1XJWB 1W2BR 1WI8A 3HVAA 4RW4A 1VJWA 3CC4S 4LT6A 4NLQA 1KLMA 5GAGI 4ZJLA 3DLEB 3NGKA 4A8XA 3PVXA 1ZTTA 1IBMF 3NNAA 2B9EA 2B8QA 3G82A 4X4OA 2M0GB 2R7XA 4F4XA 1T9TA 2DGTA 2OTJS 2FLOA 1WHYA 3D0IE 4K4TA 2M7SA 1Q1KA 3KNGA 1H73A 1X5SA 4F3OA 4G6VB 1T9YA 2H9ZA 2OD4A 1CVJA 1VC0A 3ET6A 2CQ0A 4TU8A 3Q0AA 2IC3B 2XQCA 1FRHA 2GQQA 4AQYJ 1FKPA 3DYAB 4YR3A 2ZM6F 3D5MA 1T9XA 3CCTA 2DKOB 1HBUA 3K8VA 3LW5C 5KG0A 2V9WA 2WW8A 1X8DA 4MYUA 2F8HA 1HL6A 1N0UA 3FCVA 3HZEA 1P9QC 3CEDA 4IQMA 5D77A 1M5SA 2ZUAA 3JS9A 2ZBQA 5KFZA 1EHWA 2CNKB 3I87A 2OEJA 3D1OA 5I3QA 2KG1A 4Q43A 2HHUA 4ZDNA 4QIVA 4LF8F 3OR1B 4ZVRB 3SSRA 2R4FA 3IRWP 1RCOB 1LQ9A 4KTQA 3MEEA 4M5NA 4YEAA 3MR7A 5HROB 3D0HE 4XPEA 1LXNA 2GGPB 1S48A 4W4MA 2Q6BA 3TR5A 3NLCA 1WF2A 3HX9A 4LF7J 2AZ3A 1BQXA 1HD1A 3OR1A 5KT6A 2BJ1A 4NXNF 2LKZA 1T95A 4DZ6A 2I8EA 1YIJS 1WD6A 2BM1A 4RBTA 1TL1A 1DTQA 1F9FA 2YWEA 3UN3A 1G1XA 3BB5A 3DMJA 1GMUA 1UVMA 2HQCA 2Y8YA 2FHKA 3NNHA 2B56A 1TKXB 2CJ9A 2DJWA 2FY8A 3R5AA 5D0GA 2AYMA 5KFAA 2ZUGA 2K06A 3OTOF 1IKXB 3CDWA 4FP9A 3V6DA 4IRDA 3KJQB 1YVFA 2VDIA 2WBMA 4PWWA 1N56A 3CJ0A 3IR7B 2IC3A 2MLYA 2KM8C 3VCDA 3KLEB 5KT4A 1TK8A 3AODA 5THWA 2FVCA 2MY8A 3DFEA 1N36F 1Q7YT 2KL8A 3ZZTA 1NDPA 2HK2A 5ETQA 3B6BA 4ALZA 1VIXA 2Z2MA 1HNWF 2VFVA 1JWWA 1UFLA 3MECA 1QAYA 3QAUA 2ILZA 1Y9OA 4KE5A 1L5UA 4LF9J 1KOHA 2AJ1A 2V4JA 1RT2B 4O3NA 4EEYA 5CA5A 2Q3PA 3C16A 2ACYA 5G0RB 4DR7F 1KLMB 4ZP9A 3J7Z5 2OPSB 2DTJA 5D6GA 2CG4A 1NK8A 1NB2A 2FY1A 1FEHA 1ACMB 2ZOFA 3NGUA 2GMJA 2ZJQQ 3H5UA 4ZN3A 4OYMA 2IRYA 5BYSA 2ERRA 1RT7A 2KHCA 1I5OB 5KG3A 2UXCF 3BSNA 3Q8VA 2LVWA 2CVEA 2JEJA 1UA0A 1FJGF 4QCLA 2OFGX 2C3YA 4DFJA 2VUGA 4K4SA 2HHTA 2FVSA 2L48A 2UVUA 1Q8LA 2EBGA 1JLGA 4ECVA 1KFSA 3ENQA 2E9ZA 3D4JA 3QZ7A 1S1UB 4KC5A 4NXMF 3HHLC 2HHSA 4ERDA 2YKOA 2N3OA 3GIJA 2MEWA 2MZRA 4C8MA 1UJ4A 1OMSA 4RR5A 2J0SD 4OMFG 3EGZA 3PFEA 5A76A 2X1AA 5F3ZA 3GV7B 4ZPDA 3OTOJ 3DOMB 3QGIA 3GYXB 1FKOB 3EGWB 4P73A 1SQEA 5KFQA 2PEBA 3HD2A 4F67A 2Z58B 3HVWA 1H2VZ 3QT6A 1B0VA 2WSCC 2GJ2A 2QEXS 3CULA 5DDQC 4ZCKA 5DZ7A 2WB4A 3TA1A 3IWNC 1NPRA 2VC1A 1BY9A 4N77A 4AUKA 4Q45A 1L3SA 2HBRB 2CQCA 3JTOA 4EWTA 3IWXA 2LXUA 1HHTP 3A8EA 2F9JA 2RILA 4FNHA 4GMKA 1RT5A 3WDOA 1VLOA 1RTHB 1KQFB 4ANCA 3CCRS 1YG0A 1TKZB 2A0FB 4Q7AA 2DRBA 3MTJA 2BDPA 4IR9A 2QLBB 2HS4A 2H5IB 3PXGa 1I94J 4OIXA 1GTHA 3BBFA 1VCTA 2VQFF 4MKBA 4MK8A 4OQJA 2D7SA 3NG8A 1NSQA 3DDNA 4YY3J 4B9TA 3FSYA 5D3GA 4NCGA 5DDRC 2DNKA 4IKAA 1S0NA 1YJWS 3I9V9 3ITHB 4URSA 2IVMA 3QT5A 1RAIB 1OJ4A 1WC1A 4ZHRA 4IG3B 2XM3A 3AH6A 4LFAJ 3G8TA 1IBCB 1UETA 3IBCB 2WTFA 1WG4A 1FRJA 1RAHB 3BH7B 8ATCB 1VBZA 4LIRA 3Q22A 2CFXA 2FJXA 1UJ5A 2VODA 2VDHA 2YNHA 2WSFC 4KFBB 2FVPA 1YBUA 2EXUA 2G2YA 4MIWA 3EWGA 3QMQA 4R5PA 4UF4A 3TA2A 3CDBA 4ZP6A 2KJVA 1UAWA 4KPYA 1HARA 2YKPA 4NCBA 1U0SA 2C3PA 2DK2A 1FA0A 2CWKA 4HT7A 1CG2A 3R7SB 3MHYA 2A6OA 4QU6A 4DPOA 1IJEB 1CULB 2K7KA 3AQPA 3MUVP 2BQ3A 4NXMJ 3O1LA 3KK2A 1SL1A 5ETNA 3UN5A 4OYPA 4P9SA 2VJUA 3BBCA 3SCIE 2E1RA 4DL7A 2IM2A 2VFRA 4WFYA 1S72S 2HNZB 1CJUA 4F2RA 1YRXA 1VQNS 2MJUA 5F9LA 4UTGA 2BKNA 3UNYA 3LQVA 3MAAB 3M7VA 2DO0A 2PO4A 3SDEB 2XO6A 4HI1A 2CPYA 4OYAA 5CYMA 2EVZA 1S99A 1RT7B 3TZYA 4C11A 3B8HA 2Y1JA 3CJRA 1WELA 3NCRA 4NLXA 5LM7E 9RUBA 2VBZA 3UN2A 5CYJA 5IT4A 2IM3A 1WF0A 3N9UC 4LJMA 2BRLA 2QSFA 4A8FA 3R5JB 4HH0A 1U1QA 3PCOB 1UEVA 1HWLA 2W1BA 3H7HB 4AXJA 2P2CB 2XYPB 2FVRA 2JX2A 4Z7CA 1PCAA 1Y7PA 3KWMA 1K73T 3UW1A 3M32B 1J5OA 2M52A 4OX9F 4B3MJ 2BX6A 2AEFA 2WB1D 3F44A 1NNDA 2OEKA 3I0RB 2LP4A 4L3NA 3QFHA 4FYWB 3POTB 5HANA 5CZVA 4HKQA 2MQNA 4WU3A 3C16B 1HW8A 3CCMS 4J9NA 1U47A 4NMXA 1JLCA 1RT3A 3NGDA 1CC7A 1VK8A 3DM2A 4I68A 2PE8A 5KFLA 3VWSA 4CZCA 4C8OA 2E1AA 2GS8A 1K47A 3NGRA 3BO4A 2O66A 5KOWA 2WVCA 4LSNA 2BV3A 5F9NA 3A8KA 5KFMA 2IDEA 2P8IA 4DF4A 2KH9A 5BXIA 4UUWA 2MQMA 1HNVA 5IFMA 3OFHA 1JJHA 2R3VA 3AOAA 3KK1A 4BDPA 4C6AA 2BANB 4B3RJ 4LRFA 3W1YC 1R0AB 2YNFB 4DN9A 1Q8KA 4CO5A 5DRKA 1TVRA 4DCOB 5LJ5Y 3M9NB 2MGZA 3FK4A 2VOPA 2FIUA 2PN6A 3M30B 4RBUA 2MHNA 3PEJA 2ZJRQ 3JAMU 1QSYA 1UW4A 3KHGA 2V2QA 3M2VA 5EWEA 1CBKA 3TVKA 3M2UA 3MEGB 4F4YA 3QJLA 2DO4A 4C0HA 2HNDB 5KFKA 2OPQA 4LRCA 1BQNA 2KRRA 1L3KA 3PM9A 5AE2A 2WRMA 2HZCA 3FNNA 3HHLD 3N28A 3H90A 5CZXA 1DJ0A 1LWEB 3GWCA 2UXDJ 2UUTA 3H4BA 1UZDA 4O23A 3V2UC 3R5GA 3K5PA 3HP6A 4C8NA 3RGIA 1TKXA 4IR1A 1ROFA 4YDDB 1HNXF 4ZLJA 2CDQA 4WF9Q 5KT5A 1VC5A 1Q78A 1Q86T 1VQ7S 4ED4A 1VQ5S 1JMTA 2C2RA 4NA2A 2FB0A 1AUDA 4LFBJ 3IG1A 3O3LA 2XHCA 3PIPQ 3MPVA 1S4FA 1EARA 3MM7A 4ZK7M 1QTNB 2DGUA 4KHPJ 2KT5A 2BQUA 2VKZG 1WHVA 4HT5A 5E5NA 3UVJA 1GXTA 4K5RA 2FZKB 4C4WA 1RWWB 2OPQB 4ZPCA 2B6AA 2EBEA 5IWAF 2VHGA 1RAEB 5ETSA 3C19A 1LV5A 2A2CA 1KONA 3ZTRA 4Y2MA 1D8YA 2CJKA 2OEMA 4RUCA 4PWUA 1U48A 2P6SA 1UVIA 3M4XA 1TL5A 5GADU 2G9OA 3LALA 5IM0B 2QFIA 1HPZB 3IMQJ 3OHAA 3NP5A 2FD2A 2AV5A 4DSJA 3GR0A 1RBOB 2QJ3A 4LSZB 3SSQA 3KTQA 2L08A 4BBYA 1RQ0A 3FBEA 1O8BA 1NK7A 1XBWA 4QYZK 1MN7A 1RDRA 4J9MA 4YR2A 1TUWA 1BLUA 3M9MB 4EUVA 4QU7A 4IRKA 4X4TA 4DF8A 3PX6A 2VA3A 2V4RA 4CLFA 4FBUA 3IS9B 4OYXA 1QAJA 2IRXA 4N47A 1C4AA 3VGSA 1IWGA 3ENWA 3PJWA 4JI4F 4Q0BB 1RP5A 3TP2A 2ZE2A 4GC7A 2NXUA 3ZTSA 2YKMA 4DUZF 2BXJA 2MY7A 4PG4A 4P75A 2OH2A 2F4VF 3FSXA 1N48A 1CJTA 2A2DA 2ZHOA 3IR5B 1GMWD 1TR0A 2DHXA 4IFYB 4WIIA 2N4CA 5H9FJ 1S6QB 2MZQA 3TVZA 3M8SA 3UCGA 4O4RA 4Y2KA 1S9EA 1S1UA 1D09B 2GQ2A 4DX6A 2F40A 1NAQA 1U6ZA 2H48B 2PA3A 3PYEA 2DR6A 3UDLA 1SB6A 1ZA1B 3HD1A 4C3KA 1I51B 3UPFA 3G96A 2AWZA 3P96A 1VBYA 3DOLA 5LMUF 2WSEC 2QC3A 1NEEA 1P27B 4F3QA 3M8QB 4ZJQA 4DZDA 2UUAJ 1LW0B 1KOOA 2G13A 3GG1A 1NH7A 4QQBA 2Y9HA 3MF5A 4LRBA 2GC8A 4WXWA 2DIVA 5KFGA 4DLEA 2YY3A 3D66A 4N7TA 3D2WA 4ANEA 3TUIC 2QSWA 1KSPA 2DHGA 3GR1A 2DCLA 4I6AA 4QIFA 2R8IA 1ZBTA 2C2DA 2NXCA 1U1KA 4LFBF 4QOTA 3EM1A 2LQ9A 2YX4A 3L7PA 3UCUP 5LL6d 4CLLA 2VQFJ 4H4OA 4V19J 1F5AA 3QQCD 2HPUA 2MJNA 4DQPA 2V8HA 1O5JA 4RBVA 2XI3A 4DV1J 4X4VA 4NLWA 1FTRA 1VJQA 3NCQA 4YHHF 4NLUA 1Z2LA 2A18A 5KFIA 1XMQJ 2MZTA 1J5EJ 2V94A 3HKWA 3MECB 3W9JA 3JYTA 4MK7A 1Q8BA 2C3MA 4GRSA 4NLGA 2RQ4A 2B51A 4OYWA 4UOCA 1C0UA 3OJUA 1P9YA 5KT3A 3LTOA 3J81j 3CT9A 3D1HA 2QO3A 4X84A 4WFAQ 1QVFR 3DRSB 2YWFA 2ALYB 5FJ4A 3EX7B 2D9PA 3THTA 3JSMB 1N34F 3KJVA 3UWTA 3I6PA 4OI1A 4F0KA 4PAAA 3RTVA 1T03A 2B4UA 4OZ1A 4Y3CA 2GIFA 5T41A 4NI2B 2C42A 3ITHA 4CLSA 3V6KA 3T1HF 5DM6Q 1ITPA 2RAQA 1IR2A 3ENAA 4EFAC 1DQ8A 4LF6F 2CWXA 1C4CA 4OV6A 2H4YB 2EFNA 3ZO7A 3VAKA 2KU7A 1NK9A 4DV4J 4W98A 2Y0BB 3CDEA 1GFWB 2HFSA 1RE1B 3OPKA 4P2FA 2HKEA 1N4LA 1OY9A 5HI7A 4ED1A 1GEHA 1TL3A 2RKIA 4WP8A 4YOEA 4DL0C 2HMIB 3JAMY 3DMJB 1Y11A 4BWMA 4TQSA 1GH8A 2NZ4A 6FD1A 1QSLA 1KR4A 1RK8A 3I0SA 1PC4A 3HSDA 3MR6A 2UP1A 1NHKL 1PBUA 2CRLA 3CDAA 2L9WA 3RRHA 5HP1A 4USKA 5T7LA 3L3CA 2C2EA 4IDKA 3TEHB 2HVIA 1FNOA 5DG7A 3IA0A 3R7BB 3UVJB 4JYAJ 4YP3A 2EFPA 1NMEB 4FZVA 5GAHU 2J6SA 3WC0A 3M2UB 2ZWPA 1KHWA 2CAJA 3ZZRA 5L1KA 4OLOA 3MMCB 4C8YA 3MPYA 3W8GA 1XR7A 3IGNA 2PA8D 1B64A 1D8ZA 1HNZF 1FE4A 4WFNQ 1YGYA 1H2TZ 3N5BA 1DLOA 5F8HA 2UUCF 2YWWA 1RZMA 1FKAF 4XTTA 1U26A 4PRFA 4CLYA 5B0EA 3HVTB 9ATCB 5GMKa 4M5HA 3SZ2A 1M90T 4OI2A 3NWGA 2VPZB 4Y2CA 3VV2B 1KVIA 1S79A 2HNYB 1P6TA 4DWIA 3DU5A 1JLCB 1RT3B 3MCOA 5FLXY 3CPWR 2MKKA 3K89A 4ER8A 3MCSA 4RW6B 3MM9A 3MTKA 4KV8B 2W01A 4MKAA 5K20B 3FDSA 2HFVA 1X4BA 2JRSA 2ROGA 4Y2IA 3BGRA 2RQKA 3US5A 4RW4B 5LT5A 2HYIB 3GSDA 4LRDA 1L3VA 3WQPA 3DOKB 4P52A 1VLYA 2E5HA 2FHOB 4Z7YA 4ZLLA 1KTVA 1TK0A 1UEKA 4PZVA 2WAQD 4TYBA 5IWAJ 1FDNA 1S1TA 2N7CA 4HLBA 4ZITA 2XBPA 4RKUC 2KXNB 2CJQA 4HHUA 1RTDA 1MWQA 3PRDA 2PMWA 4K4UA 5LOQA 2YBVA 1NHUA 4PG8A 5EWFA 2OPRA 2MKIA 2CPZA 1MLAA 3PHTA 5CYMB 2VFTA 2BE7D 4JUZA 4IOBA 1TMMA 3GSIA 1PSDA 4DG1A 2H4WB 2VB6A 3KLIA 4XDCA 1G6BA 4ES2A 3CCUS 4IO9Q 1U1LA 1B3TA 4DPTA 2HZVA 1YJUA 4TNOA 3UR0A 2FZGB 3S8SA 3TWZA 4J9PA 4DUYF 3BN7A 2YKNA 2XS2A 1Q4RA 2WZ1A 1FFSB 1NSKL 2RNEA 5IOLA 2N7YA 5BR8F 3IGVA 1FDDA 3NS6A 4ECRA 3LP2A 3T5LA 2XSJA 1KQGB 2ZM6J 3S1TA 3ZTQA 4DEZA 2Q1LA 5AXMA 3DLKB 3TZZA 1Z1ZA 4O44B 5F8GA 1TU0B 3OSPA 1YI2S 2JDJA 3NWRA 1W25A 1CULA 2HRTA 1X0PA 4ZPVR 4DV3J 1UWBA 2OLWA 3FKBA 2V9KA 4MJKA 5ETMA 5KG4A 5EWGA 2XO7A 1FO1A 4PWDB 3C6TA 3D6TB 5HP1B 1S0OA 1UWAA 2EK6A 4J7CA 4G3IA 1FEEA 3KG1A 2C28A 1HR0F 2DGSA 3Q89A 3MMBA 4ID8A 4Q44A 4TN2A 3GZ7A 1SIZA 2HHHJ 4KFBA 1TV6B 3DGPA 4B3OA 2BBEA 3PIOQ 3TNVA 1YK9A 2DIUA 4IH5A 5K5MA 3U1NA 1WEZA 1F5BA 1ZAWA 4RUBA 4DI6A 5B09A 2ZZNA 3EZ5A 5HSPA 5F8JA 1XTZA 3QO9A 3FBBA 4MTPA 2V34A 2VFUA 4CLZA 4KH0B 3BGLA 1H3DA 4JI5J 2YNHB 5HVGA 1GTEA 4PQUB 1GXLA 5L9NA 2QMUB 4U9RA 1D3WA 1V3ZA 4LSLA 1X4CA 3BZQA 2YPZA 5E7OB 5J2MB 3EVWA 3M9OB 4LMZA 3PJXA 3HDSA 1ZOTA 3CSKA 2B5JA 2LA4A 1HKAA 2ZBCA 4WWSA 1EAYC 1XQIA 3BPSP 5HO4A 3HJVA 3D3CJ 1RACB 1S5ZA 4ZCIA 4CCHA 3CJKA 2D1CA 4USMA 4CP5A 4B3MF 3IN5A 4EYIB 4DR7J 5HVHA 3CNQP 2FGOA 3TJAA 3U7JA 1B4SA 5DG8A 1VRUA 5MAOA 4P7TA 2E7WA 4DJBA 1SJ3P 4EYHB 5KFVA 1C0UB 3TEGA 3ZZUA 4Q8EA 4U6PA 2KZZA 2GHVC 1OYEA 2P9GA 4FS1A 1YKWA 3OFFA 1KLNA 1UVJA 2Y1RI 4DUZJ 5B0GA 3QIPA 5JVGQ 4WJBA 2IFXA 3RB4A 2IIHA 4LBHA 2AJQA 1EETB 3IO1A 1LXJA 2X3DA 3VVUA 1EX8A 2BJ9A 3RBEA 3QBCA 5B7WA 2IMWP 1S1WB 1YZ7A 2G0CA 4UOFA 4KHRA 3V6JA 4WKYA 1SUQA 1R0BG 2G4BA 4IFVB 1WG1A 4PPZA 4YN3B 4N56A 4K4WA 3OV7A 2NYIA 1HQEB 3BREA 1QAXA 1RJJA 2GVZB 3ILLA 3R6GB 1RWVB 2LCWA 3PDNA 2AKWB 4OJHA 1IR1A 1DARA 3EJMA 3HHNB 2OPPB 4JI2J 2DT9A 2HRUA 1M5HA 4RLEA 2W9AA 5ITHA 3PACA 3FSIA 4TLRA 3Q8QB 4I0WA 5F41A 1FVQA 1D9DA 4NASA 1PYTA 1U24A 1WOOA 3MI7X 4WP9A 1X4FA 4DV5F 5L8RC 4BLGA 4CTAB 4IOAQ 5F0WA 4NXNJ 3EXCX 2V6AA 3DLKA 4UOHA 4AE5A 3J7YU 3OT9A 2YNFA 1N8RT 2QLWA 1MMNA 2HAIA 1NJXA 4GVBA 3MZIA 4DL2A 1M1KT 1DRZA 2FC8A 3L9ZA 1NKEA 2QN6B 4ZOSA 3CCQS 1WKKA 1XERA 5EUHA 2MQQA 1Q0NA 1TAUA 5IS2A 2J0XA 1R8PA 3CIMA 4JV0A 4JI3F 4JV2A 2MLXA 1NDLA 4QW9A 4QIGA 1NLKL 1VQKS 5D4LA 1X31C 4QWBA 1N5TA 4L72B 2Z56B 1XMBA 4J9LA 5KFBA 5A8RA 3HT3A 3MEKA 2YNIB 2JLGA 2XI2A 2AJ0A 2V4JB 3MGJA 2VG7A 3KK3A 1B99A 2O3DA 4M1KA 3IBWA 2M8DB 3IS9A 4WFXA 1BXNA 1S57A 5KFFA 5EHHA 2KVIA 5T14A 3NAIA 2C3OA 3T3FA 1OS5A 4DQQA 2EFVA 3VGVA 1S6UA 4LF4J 3GTYX 5KAKA 2DISA 4PQAA 2LQJA 3IRXB 1XNQJ 4J9KA 4MIBA 4RW7A 1OY8A 1YHQS 4JI2F 1L3UA 2AYGA 2RDIA 4M5LA 4DL4A 2MQLA 1QDUB 1Y5LB 2ZH5A 2Z0GA 1MNEA 3KUGA 1V3RA 2R8KA 1VQOS 4FNIA 4C8LA 3W2WA 4XAKA 4C3LA 2R8JA 3LF0A 1S6PB 1IKYB 2VG5A 4B17A 3J7YI 3V6HA 2LU1A 3MCMA 3QSYB 1OYDA 2B4PA 5RUBA 2E1CA 2MQPA 1JXVA 4QWCA 2CQGA 2QA4S 3UCZP 3EPIA 3NMRA 4K0KF 4O4GB 3MMCA 3T41A 2GZOA 1YQHA 4LF5F 2DH7A 3KKFA 3QGHA 1U02A 2FLPA 3KG0A 4MAKA 4UY85 1LFPA 1DTQB 3CD0A 2GGPA 2NUUG 3M8WA 7AT1B 3S01A 3MR5A 1OSCA 3I5CA 4I2PB 3MEEB 2HEKA 1FESA 1YRTA 3AOBA 5C24B 1EIYB 4LREA 3GMGA 3R8YA 1RWXB 2L9DA 5B0CA 4ECXA 3CJ3A 3L95X 4P2XA 4DPXA 2J7WA 2J6TA 2RE1A 1SQFA 2RF2B 2EG1A 2QE5A 1VHFA 3KUEA 1HWJA 4KYZA 2YQ1A 1OQ3A 3ZZZA 4QPXA 5E41A 1T03B 3SCKE 3E01B 1EP4A 1SBRA 4DU7A 5J2QB 1FD2A 4LF5J 2MZJA 2APOA 2DCUB 2NXNA 1HWKA 3FGVA 4OJ3A 2KT2A 4YR0A 2RHSB 2NQPA 1FWLA 4B3TF 3W2VB 2HQDA 2HG4A 4N76A 2ZHBA 3ZZOA 1SKUB 1AZSB 4X65F 1MMDA 3P5BP 1U1RA 2I2YA 1N36J 2VASA 1C1CB 3LP0B 3R97A 4C7QA 2KTQA 1MG7A 3JYTB 5L9XA 3RR8A 2CNLB 5HBMB 4MYTA 2F3JA 3H8YA 4DR5J 4JI8J 4ZCLA 1C1BB 2PD1A 1FFGB 2WONA 3PW7A 3CCWA 3MM5B 1T9WA 4J9VA 5AXNA 3HI9A 3KMSA 1N34J 2XS7A 1F6TA 2YX1A 2BVZA 1UVLA 3T5HA 3TI0A 3L09A 4EI2A 4ZVUB 2NXJA 4JI0J 2LQ8A 4X4NA 1RADB 1KHVA 2V0NA 4HTIA 4LF4F 1SH2A 4FPIA 3F73A 2DNRA 2VG7B 3NCPA 3DM2B 1NDKA 4KGMA 4DMZA 1WTBA 5I42A 1BMQB 1FRLA 2W7AA 3IAS9 1EKRA 2J6UA 3FMWA 4AXIA 2C2MB 1JKHA 4M5IA 3HMJG 3PV8A 1ULRA 4LFAF 2Y8WA 4K50A 4OHWA 4IYQA 3VHQA 4ID5A 3U02A 5BR8J 2A1BA 1DQ9A 5FDLA 3DRPA 4WYWA 4Q2LA 2FJBB 6AT1B 2RS2A 1XEZA 3ILOA 4NA1A 3MFHA 1PIEA 2B4OA 2XTJP 4EGLA 1RT1B 1S49A 2GNKA 2VPWB 3D28A 2ZH3A 1ZZFA 5SZTA 2DGVA 2I0XA 4DR3F 2AQ4A 3N79A 1V9OA 1S6QA 2AMCB 4NPOA 2G0JA 1IQTA 2MKCA 2BE2B 4OYZA 5C2GA 1F3FA 2HGNA 2OPPA 2XMVA 2IY5B 4PG5A 4X4UA 2ZD1B 3MM8A 4LQ3A 3NRBA 3TAQA 4RX6A 5D15A 4ZVFA 2AGOA 1U4BA 4DSLA 3M8QA 4HR2A 1HBOB 5K8PA 1MSWD 4NLYA 3PW4A 3AFGA 3N6MA 1IKVA 3AXMA 3BDEA 3G4SS 1N54B 4OHXA 1WNEA 5EX0A 5LMNJ 1WUUA 2OI2A 2WVDA 3I31A 4MIAA 5JUMA 5BJRA 2AYBA 1H72C 1R6YA 5AXKA 3RRKA 3ISNC 2X3GA 1WOSA 1IBMJ 3TRGA 4RWXA 3JSRA 2V68A 2F4VJ 1RT4A 1U0HA 1PYSB 3BM7A 5I3PA 2RT3A 4Q0BA 4U7UD 2HRYA 1XMOF 1AA1B 1Q79A 4F3MA 4YDXA 1DZ5A 3GIKA 1PJ6A 2V5HG 5B0AA 3B78A 4WP3A 2IPOB 1EP4B 1C1CA 1N5SA 2EG2A 3LP0A 4QR1A 3FFIB 3CJQA 1FWKA 3ZZPA 3R5DA 3TUJC 4TLQA 2N82B 2LFVA 4KGVB 4UUXA 1HMVB 5A0YA 4YHHJ 4DV0J 3E8OA 5JVHQ 1UP1A 4JYAF 1S1VB 4A8YA 4O0IA 3ZTPA 3H2UB 4E0DA 3KJNB 1HYSB 5H9EJ 1RT4B 2XSFA 3DXBA 3B4DA 4FS2A 5HLFA 1KRPA 2CJXB 3LPEA 2GA7A 4K0KJ 2B6AB 1LWEA 2W2OP 3KG4A 3DGPB 3TAMB 3MUTP 1ZM3A 4DPYA 5EGYA 4LFCF 4B3OB 3VZHA 2R7TA 3WIUA 5GVQA 1IJFB 2EFOA 2K3IA 3DOMA 4M5KA 4MT1A 3UFCX 2HNDA 4L3KA 2FZCB 2ZKTA 3LA0A 2E5GA 3ZXWA 3SYZA 4Z37A 4DL3A 3UD4P 1JLQB 4ELVA 3FCHA 5E2QA 1VOMA 5D0HA 2A10A 1X9SA 1N0VC 4PWDA 2ZDPA 2W9BA 1TP7A 2LMIA 3LP2B 1TV6A 3N0VA 1JLFB 3BR9A 1NKCA 1X5TA 5JJBA 2LDIA 3PEHA 5MLCV 1ZETA 3H5XA 1TVRB 2RUSA 2CPJA 3D0GE 2IAJB 3OUYA 3GCWP 3TZWA 3T1HJ 2R7QA 5AT1B 1YJ9S 1IKYA 2VG5B 3M1VA 5DGAA 1LWFB 1WACA 2BRKA 3PKMA 2DH8A 2O5DA 1V6HA 4ZVQB 4R8UB 2AW0A 3DLGB 3FJ2A 3C15A 1KVKA 4NLTA 1QLNA 2AD9A 5K9FA 1GNKA 1SV5B 1XN9A 4JI4J 3QJJA 4DV3F 3OHBA 1NPPA 3FUYA 1SL0A 2SXLA 2KHDA 2XMTA 1F3VA 2YKQA 4DV2F 4MH8A 2WK4A 3IP0A 1RLDA 2H1YA 1FXRA 1FXDA 4RO0A 4RW9A 4USIA 1NJYA 4LSNB 1U1PA 3PHEA 1A7GE 5HLFB 4B9LA 1XWLA 4GKJJ 2ZH9A 1EB0A 3VTIA 1VYAA 2OHDA 2HHVA 1F2GA 4OZ3A 3GYNA 2GVDB 4KPCA 1SIWB 1SXLA 3LAKA 4V19X 3HJFA 4JV5J 4AD6A 1DTTA 2JHEA 3PR5B 1FX2A 3KMQA 1SC3B 3HHKA 3H2VE 2OELA 3CO9A 3T1YF 4QPTA 3LP1B 4USVA 1U2CA 2B7BB 3EDRB 4ZVGA 4X64J 3Q83A 3BQ0A 3MM5A 1N32J 1KFDA 4DR1F 4K2JA 1RHUB 3LWLA 1U2FA 3D6HB 3MM9B 4FXDA 3HVTA 1LNQA 1U6FA 4PKDB 3KLEA 3PX4A 4Q8FA 3CC7S 2DXFA 2QMWA 3M6WA 4A4JA 2NYHA 3AT1B 3ZZ0A 1X9MA 1UVNA 2YNGB 2UUAF 1SH3A 1WF1A 2HNYA 3FRYA 4LBPA 2XY5A 1ELOA 1PJ5A 4FVCA 1G2EA 2VF3A 4DCPB 3DHWC 2M70A 3O5TB 2DNZA 2EKYA 2QA1A 4F4KA 3MOJB 1S0VA 1VGYA 4J91A 1S76D 2HHWA 3R2CJ 3PKYA 4CO1A 5JXSA 1B70B 4S0MA 3LOUA 4J9OA 3RYLA 2R42A 1RBAA 3QNWB 4KB7A 4ZPTR 4FF2A 1VQ6S 3KNAA 1T02A 5CCMA 5AJ3F 4IFVA 3CCVS 4CLWA 1TKTB 4F50A 2MKHA 3A3OB 3MAQA 5CYQA 4CH1A 2G1HA 4JBCA 4UOGA 2O1PA 5FD1A 2CVIA 3Q8RB 1I6JA 4EZ9A 2JC1A 3GB0A 4FF3A 1FE0A 1RWPB 2A6MA 2AX1A 2F8MA 2KJWA 1HMVA 4LUBA 5A0YB 3N6LA 1WC4A 2GHWA 2WCXA 3KDOA 4HI2A 5D4OA 3I0SB 5CH7B 2UXBJ 4FYXB 2B4VA 1AXQA 1JNZB 1MWYA 3A13A 4G1IA 4AFFA 5I3UB 2XMUA 1EETA 1LOUA 2AJ4A 2GIRA 2VG6A 4NZ0A 3ETOA 3TX8A 4IDKB 2XGPA 2W9BB 1VRUB 3ENVA 4NRUA 1T3NA 5IT9Y 4C98A 1Q5VA 2GIQA 2V2KA 3DC2A 3DI6B 4ZVPB 3E2EA 3DGVA 3DRRA 5D0EA 5J1NA 2XG8A 2JJ4D 4CM2A 4R5PB 4IG0B 3PJ9A 4EZ6A 3DLJA 3HZGA 1R3NA 1T11A 4DV6F 1FDBA 5A2QU 1VQYA 3NGSA 4CIOA 5DM7Q 4DSIA 2D41A 2CQ1A 2KYXA 2CQ4A 4I4BA 4YB6A 5K14A 3P6YC 5ETKA 5E3AA 3HHDA 3TO8A 1G4CA 3GIRA 1K1QA 2B0GA 1GX6A 1HD0A 1Z2ZA 2JNJA 4F8RA 3OW2R 3FMBA 1ZYQA 3VQTA 5DO2A 1NJZA 2JEFA 2KYZA 5HL7Q 4Z2XA 4NZ7A 1NM2A 3R9LA 1I3OB 2CIMA 3BGUA 3VALA 1S1XB 4FKXA 3MEDA 1X4DA 4LSLB 4X64F 2ZH4A 1N32F 3Q2TC 1UPPA 4PQUA 3M8YA 4F2SA 5I3UA 1HBNA 1IWAA 3CJTA 4WE1A 4OYIA 2GJIA 3D54A 1RA7A 3W65A 4JI7J 4KGKA 4GC6A 2B3TB 4OX7A 4ZIWA 3NAHA 4FYYB 1WDTA 3UDVA 1UWBB 1VQPS 1H38A 3PRVA 3RBZA 4ZVEA 1CQNA 4D3GA 2OMLA 3CUNA 3Q23A 5GMDA 2E5JA 2XZDB 3DDKA 3LGNA 4FPRA 1R6VA 4P7VA 4ZN1A 5K8OA 1A6LA 1RSCA 1U09A 4FN5A 4I67A 2C3UA 5DDPC 2HFZA 4F36A 4LR9A 1FK9A 5L1LA 1VHIA 4MKYA 1Q5YA 2XSJB 4JI0F 2RB7A 2BQRA 4H4KA 4A8QA 1NK4A 1BGXT 1QE1A 2QZ8A 2BM0A 1HHQA 5L46A 2GAHC 2X1BA 5KT7A 1U7LA 1YJRA 3CCZA 4RNFA 4O0NA 3I82A 1IKVB 1RKIA 4HHJA 1MU2B 2QT7A 1HBOA 4CM0A 2CNNB 2CQIA 1LW0A 3WIVA 4CI0B 3C46A 4C9DA 4AL7A 2G1DA 2CPIA 4RW8A 3W61A 4DQRA 2HQIA 2LEPA 3K5LA 4PUOB 3NKYA 2NZCA 4I6WA 4LIWA 1FJGJ 5ETTA 4CNYA 3CCSS 4F04B 2WBRA 1ZM9A 3BJYA 4IOCQ 3D67A 3ZNJ1 5HMXA 1LWCB 2OFHX 3EVOA 1REVB 5ETLA 1SKWA 2MYFA 2QLFB 3OTCA 2LA6A 3I32A 4CO3A 4ZCMA 1JX4A 2J0QD 1N6QA 2AGPA 4LFCJ 1SJ4P 1OY6A 3DOKA 2VONA 1NSAA 3T9NA 4ZMMA 3CMQA 2RDDA 3AB2B 3TJ8A 1C1BA 2BEFA 1BUXA 2CUYA 3ISND 4QIEA 4ZP8A 3HVRA 4DR3J 4ECZA 2DVIA 3AD7C 2MPUA 5H9FK 1RWKB 4RW9B 4MFBA 1WSRA 1PO6A 3PO4A 4NLSA 4RNNA 2CZ4A 2MZSA 3WZ0A 2HS0A 4N5SA 2UUBJ 3QAEA 1U1NA 3BSOA 1NZ8A 2DXEA 2RS8A 2QMXA 3HHLA 5K14B 2MLZA 1FVSA 4C8KA 5GADI 2BUNA 3HHEA 3SQGA 3CJ4A 3IM9A 2W7OA 2GQCA 1Y0HA 2Z2ZA 2ZNYA 4M63A 2QLJB 1SI9A 4DUTA 1NH8A 4ILLA 3C8YA 3IBFB 2B5JB 2HLTA 3O2IA 3NNCA 3N4WA 2M5YA 2XHWA 3D7SB 1FJEB 1TFYA 3SV3A 1U1MA 2BA9A 2MSSA 4ZVTB 1NUEA 4FVMA 1GMWA 5KOXA 1Z4UA 2WOMA 2O01C 3CCLS 1RYSA 1H0HB 4M94A 1D1UA 3VGUA 3CGIA 2VPXB 2ZNZA 3BGFA 3CIZA 4ZP7A 5L38A 4K4YA 1QJHA 2B8PA 2DBBA 2D74B 2RF2A 2F63A 2H54B 3BKTA 3NXZA 3OFEA 3W62A 1S9GB 3LWMA 1CPZA 3KFWX 3M2RB 2RUGA 4I7FB 4LBIA 4P2MA 3LH2S 3C6UB 3MFIA 2XMMA 2DD8S 1CQMA 1U8WA 5D78A 4EO6A 5L39A 1R8HA 3HT0A 1Y3KA 2JVOA 3HSGA 3RU0A 2CA9A 2GAGC 3GILA 1N5YA 1VRTB 1RBLA 2BABA 3ADAC 4U7UK 3J80U 4LF7F 4KJIA 1M5VC 3H40A 4B3TJ 1APSA 2L3MA 3G6YA 1WEYA 3C6UA 4FXWA 4USHA 1V5IB 2JC0A 1V3SA 4ZPAA 2DY9A 3MEGA 3NS7B 5DQIA 2Z30B 5J2NB 2BANA 3PNIA 3SSSA 4NL5A 5IT9U 2W2QP 4WYLA 3W2WB 4X66F 3U1LA 2QYGA 2CZ9A 2GO8A 3GJRB 1NJWA 3I9ZA 2MGZB 5L1IA 4FYVB 3P4UB 4DOZA 1BE4A 3G82B 4DDFA 5K8NA 2UXDF 4X62J 1Q81T 4DLGA 4AT1B 1WDDA 2B9YA 2HVDA 1NSPA 4B3SF 4ZVSB 4NI2A 2RRAA 5DDOC 3VAHA 2AGQA 2ZOMA 1FRMA 3IRXA 3P3DA 2AJ2A 5HQLA 3QGPA 1WG5A 1RU2A 2L9NA 1T05A 3LP1A 3A12A 3GCXP 1URNA 1TK5A 1T94A 3R7NB 5A8RB 5IT0A 3GP9A 2R9LA 3GG0A 1A0OB 1REVA 3BS9A 3CVKA 3W9HA 4CNZA 3POTA 2XULA 1LWCA 2BJEA 1X60A 1VQSA 4MMOA 4RJVA 5LSOA 2KFYA 1XK8A 2NUHA 1WTFA 5IXUA 2ZHAA 3VZIA 4YB5A 2V8DA 4HACA 4TU9A 2R2RA 4NLVA 1N6QB 4PUOA 2NS1B 2CJBA 2IJNA 3M32A 1F2HA 1EZZB 3EZUA 5LXRA 1OSDA 1NZAA 1FCAA 2ZKUA 3NEKA 2RIJA 1B7YB 1F5CA 1QUVA 4KGZB 2KFNA 1RT6A 3T5JA 2RDJA 3MM8B 1NHVA 2P5VA 2E66A 2FJDB 2VU5A 3MPDA 4OJGA 1JB0C 1IXKA 1M0SA 3TW0A 2XLIA 2XNRA 2NSCA 1HNIB 2J5AA 1Q16B 3K5MA 2U1AA 2R7VA 1NK5A 2CQ2A 4M5JA 3RW7A 1OPZA 1UEUA 3FVYA 1U49A 1JJCB 1SV5A 3FBFA 4NYZA 5K8MA 1S10A 2DNPA 4KT0C 4CH7A 2HHPA 4N8OA 4X62F 1X4EA 2BMBA 2GVZA 2XYGB 4EK2A 3SDEA 4CDIA 2V2ZA 4DUYJ 1BQMB 1LK7A 1QY7A 2FGCA 1SJFA 4HTJA 3AJDA 1LWFA 2BW2A 2LXFA 4LRAA 1DY3A 2B7CB 2X7IA 2ZC4A 4GVBB 1N88A 1JKHB 2FJAB 1UJ6A 4LF2A 3MXHP 1CJTB 2ZC3A 4J9UE 4JI3J 3R2DJ 3W9IA 2MXYA 1FFWB 1RHQB 5H1SV 2UU9J 1WJ9A 2R7OA 1H2UX 3FRZA 2LDYA 1FWPA 3TQEA 2J9CA 3OTDA 3IFEA 2H3EB 3MD3A 2CKWA 2KKHA 4NEZA 5C25A 1MROA 2JVRA 2HVHA 1VQMS 2YKMB 2FHMA 2POKA 4JB8B 3RJMB 1S59A 3PYFA 5KFPA 4RZRA 5IV3A 2V63A 2EC2A 3FZBA 2B9WA 4EO8A 3IR6B 4K4XA 2MMYA 3CJ8A 3HO1A 3QJPA 2CPFA 2C1EB 2RVJA 2HHHF 4DL5A 2DPJA 3Q24A 3DCAA 1B0PA 1NCLA 2GX8A 2CPEA 2FHJA 2HQGA 4OI6A 4Y0FA 5GAHI 1YBTA 2XWYA 4C0BA 1TUGB 1HR0J 3Q86A 2JSXA 3AQOA 2YWHA 5F3TA 4KKOA 2DHHA 1SL2A 2KRBA 3CCJS 3R1HA 1WKLA 5D3GB 2UUWA 1TKZA 5IM0A 2KDOA 3HULA 3IAM9 4PG7A 1RAGB 4YUDA 1V5VA 2DR8A 2HLUA 1BD6A 5CHCB 4DU8A 1S12A 3MWBA 2VBXA 2AHOB 2V2VA 1PBAA 4IH6A 2R7RA 1S0MA 1HI8A 3HSZA 2ACMA 2GMLA 2HFNA 3I96A 3QZ8A 3R5CA 1A9NB 5KFEA 3GJSB 4CLKA 2CADA 2FDNA 2DB1A 2W2NP 3JTPA 2LLZA 5BYQA 5KG1A 3K8WA 4BC7A 2YTCA 3MMAB 2CPDA
chains in the Genus database with same CATH topology
4FKXA 3B54A 1PAEX 2HVEA 2CWKA 2DYAA 3FBEA 3VVUA 3Q8YA 1MN7A 3VGTA 3ETMA 1BE4A 4UOFA 3BBCA 3EVMA 2HVDA 1NSPA 3FBCA 3NGTA 3VGSA 3PRVA 1NDPA 1PKUA 1K44A 3B6BA 1F6TA 3ZTSA 3EJMA 1HLWA 3GP9A 4F36A 3GPAA 2AZ1A 3EE3A 3DKDA 1NDKA 1BHNA 1HHQA 3EICA 4ENOA 4UOHA 4O0NA 3L7UA 2BX6A 4ANDA 1NPKA 1VYAA 1NB2A 1W7WA 4KPCA 3WX8A 3NGUA 2VU5A 3MPDA 1WKKA 4ANEA 1NDLA 3Q83A 3EM1A 1NLKL 3Q8VA 2NCKL 3EVOA 3NGRA 1F3FA 3FBFA 1ZS6A 3ELHA 2DXFA 3FC9A 5BXIA 1NSKL 5IOLA 4EK2A 3ZTOA 1B99A 3EMTA 3VVTA 2HURA 4F4AA 2BEFA 1BUXA 1NDCA 4HR2A 4C6AA 1S57A 3ZTQA 1UCNA 4WBFA 1WKJA 2B8QA 3VGVA 5C7PA 4S0MA 3FKBA 2DXEA 3FCWA 3G2XA 5CAAA 1HIYA 3Q89A 4ANCA 4DUTA 4UOGA 1XIQA 1S59A 3BBBA 4FKYA 4DI6A 3ENAA 1NUEA 1JXVA 3FBBA 3FCVA 5CABA 1NCLA 3BBFA 2ZUAA 3JS9A 1KDNA 4W98A 1EHWA 3VGUA 1NSQA 3Q86A 2B8PA 1MN9A 3EVWA 1WKLA 3BH6B 1XQIA 3ZTPA 3DDIA 3PJ9A 1S5ZA 1U8WA 3NGSA 4CP5A 2AZ3A 1NHKL 3Q8UA 2DXDA 3BH7B 1B4SA 3ZTRA 1LEOA 4DZ6A 3R9LA 2DY9A 1LWXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FKX A;  3B54 A;  1PAE X;  2HVE A;  2CWK A;  2DYA A;  3FBE A;  3VVU A;  3Q8Y A;  1MN7 A;  3VGT A;  3ETM A;  1BE4 A;  4UOF A;  3BBC A;  3EVM A;  2HVD A;  1NSP A;  3FBC A;  3NGT A;  3VGS A;  3PRV A;  1NDP A;  1PKU A;  1K44 A;  3B6B A;  1F6T A;  3ZTS A;  3EJM A;  1HLW A;  3GP9 A;  4F36 A;  3GPA A;  2AZ1 A;  3EE3 A;  3DKD A;  1NDK A;  1BHN A;  1HHQ A;  3EIC A;  4ENO A;  4UOH A;  4O0N A;  3L7U A;  2BX6 A;  4AND A;  1NPK A;  1VYA A;  1NB2 A;  1W7W A;  4KPC A;  3WX8 A;  3NGU A;  2VU5 A;  3MPD A;  1WKK A;  4ANE A;  1NDL A;  3Q83 A;  3EM1 A;  1NLK L;  3Q8V A;  2NCK L;  3EVO A;  3NGR A;  1F3F A;  3FBF A;  1ZS6 A;  3ELH A;  2DXF A;  3FC9 A;  5BXI A;  1NSK L;  5IOL A;  4EK2 A;  3ZTO A;  1B99 A;  3EMT A;  3VVT A;  2HUR A;  4F4A A;  2BEF A;  1BUX A;  1NDC A;  4HR2 A;  4C6A A;  1S57 A;  3ZTQ A;  1UCN A;  4WBF A;  1WKJ A;  2B8Q A;  3VGV A;  5C7P A;  4S0M A;  3FKB A;  2DXE A;  3FCW A;  3G2X A;  5CAA A;  1HIY A;  3Q89 A;  4ANC A;  4DUT A;  4UOG A;  1XIQ A;  1S59 A;  3BBB A;  4FKY A;  4DI6 A;  3ENA A;  1NUE A;  1JXV A;  3FBB A;  3FCV A;  5CAB A;  1NCL A;  3BBF A;  2ZUA A;  3JS9 A;  1KDN A;  4W98 A;  1EHW A;  3VGU A;  1NSQ A;  3Q86 A;  2B8P A;  1MN9 A;  3EVW A;  1WKL A;  3BH6 B;  1XQI A;  3ZTP A;  3DDI A;  3PJ9 A;  1S5Z A;  1U8W A;  3NGS A;  4CP5 A;  2AZ3 A;  1NHK L;  3Q8U A;  2DXD A;  3BH7 B;  1B4S A;  3ZTR A;  1LEO A;  4DZ6 A;  3R9L A;  2DY9 A;  1LWX A; 
#chains in the Genus database with same CATH topology
 3B54 A;  4K7Q A;  2BKO A;  3J81 U;  2VG6 B;  1KS2 A;  2H65 B;  2KI2 A;  3M6V A;  3MMB B;  1VQ8 S;  2XY6 A;  2OGU A;  1KWM A;  1N33 F;  5C2C A;  2DR9 A;  3KUH A;  4OZ2 A;  5J1P A;  2PII A;  3M2V B;  2EW9 A;  3FBC A;  4TY9 A;  4F26 A;  3OD2 A;  1IVZ A;  1S6P A;  4K2X A;  2HK3 A;  4I6Y A;  5HVF A;  1EKS A;  4USJ C;  3T6J A;  4ZPW R;  4F0M A;  2W9C B;  4JI5 F;  3QFW A;  4DV5 J;  1FI4 A;  1OWX A;  2DNH A;  5E3C A;  2Y3Y A;  4QR2 A;  1U1O A;  1Q8I A;  2K7J A;  2XMW A;  3DRP B;  4CO2 A;  4A8K A;  3X3U A;  4ID5 B;  4RNM A;  2XNQ A;  5KFU A;  2KT3 A;  3VAI A;  1RTI A;  1FDA A;  3BN4 A;  1U6B A;  4ZIV A;  2QLX A;  1UFW A;  4IUF A;  2CPH A;  1RTJ A;  2FHJ D;  3CME S;  1KEK A;  3H0P A;  4KO0 A;  2ZJP Q;  1X4G A;  4OZ5 A;  4ZLN A;  2CJY B;  4OL8 A;  4YS2 A;  3P45 B;  3I4H X;  1OIA A;  3BF4 A;  2YKN B;  2NSB A;  1MW7 A;  2PGC A;  2YNI A;  2LU2 A;  3KXD A;  4RNO A;  1RT2 A;  1FTC A;  2HFO A;  2QV6 A;  5SUH A;  3P8B B;  1HNZ J;  2MKS A;  1QTM A;  3KLI B;  3THV A;  1VR6 A;  4WCE Q;  3GFX A;  1WOP A;  1YSJ A;  1ZS6 A;  5GAG U;  3TVY A;  1Y5I B;  1FF2 A;  1WEX A;  4NLD A;  4PXB A;  5CXT A;  2E9T A;  1YRU A;  5DLG A;  1QD1 A;  3OTE A;  2HVZ A;  3EMT A;  1CSJ A;  4R8U A;  1NJI T;  3HF5 A;  3VR1 A;  4ED5 A;  2V8G A;  1SC1 B;  4NLO A;  3S7R A;  3VVT A;  2D3O R;  3OQ2 A;  5FII A;  3T19 A;  2EFQ A;  1UTA A;  1ZPW X;  2DGQ A;  1WKJ A;  2EC0 A;  2UZA A;  4M5D A;  4OHV A;  4I2Q B;  4CT8 A;  5U47 A;  1MML A;  2LQ5 A;  1XNR J;  5H9E K;  2RU3 A;  3HPO A;  2RHQ B;  4L75 A;  4WZQ A;  3A4T A;  3MAA A;  1T0T V;  4ICL B;  3D6M B;  3M05 A;  2HNZ A;  5C42 B;  3K58 A;  5CAA A;  3HK2 A;  3NOG A;  2Y1L B;  4YFU A;  3QRR A;  1R43 A;  4DV4 F;  5HJX A;  4X4Q A;  3H98 A;  3UO0 A;  3DLG A;  4F7V A;  2DNG A;  1XR5 A;  2DEI A;  2ZFH A;  3K2Y A;  3J7A 1;  2UVW A;  3JB9 k;  2CQB A;  4LF6 J;  2IYI A;  3BBB A;  1LK5 A;  3CO0 P;  4FKY A;  2IRU A;  1KP6 A;  1VDH A;  4NCA A;  1YWX A;  4HVZ A;  4FXV A;  7FDR A;  3D9B A;  3VAG A;  2W25 A;  1JLF A;  1RHM B;  1JQG A;  3BGO P;  1RAJ A;  4WZM A;  5I4M A;  3KHH A;  3EZO A;  2OSQ A;  5T7L B;  8AT1 B;  2HMI A;  2XB2 D;  2P6T A;  1TL3 B;  4JI6 F;  4DX8 H;  3TZX A;  4OX6 A;  3OVA A;  2XMJ A;  4C0O C;  1SKR A;  2PC6 A;  3QGG A;  2DR5 A;  2QL9 B;  5ADZ A;  1S4E A;  4ZHR B;  1S1V A;  1VI7 A;  4M5G A;  4NOH A;  3TAP A;  3NY0 A;  2EKN A;  4CH0 S;  4C3M A;  4ZKA A;  4ECQ A;  1M5K C;  2PFF B;  2MST A;  1LEO A;  4NCG B;  4ES3 A;  3H4D A;  3N01 A;  4B08 A;  2DNY A;  5JMN A;  1Y00 A;  1MWZ A;  3H20 A;  2CNO B;  4TY8 B;  2UUB F;  1CJV B;  4LF8 J;  2OMO A;  3ZZY A;  4DR4 F;  1VIO A;  4MKV A;  4NLP A;  4NE9 C;  4U8Y A;  3UR3 C;  1Y5N B;  4KGX B;  1AT1 B;  1T8E A;  1R7I A;  2M8H A;  3HLU A;  3I5B A;  4XPC A;  4X4R A;  4F4W A;  4HDH A;  1U0H B;  1IM6 A;  3I56 S;  2J8A A;  3A8I A;  2A3J A;  3D1Q A;  3H2L A;  4MFB B;  2K8G A;  3SBM A;  2X1F A;  2OSR A;  4LR8 A;  1X4A A;  4H4O B;  2IDL A;  1YLX A;  1HWI A;  2QL7 B;  1VBK A;  5HAO A;  2N4D A;  3DRY A;  4O3O A;  4ECY A;  2J9E A;  3C3L A;  3PW2 A;  4UQT A;  3KJV B;  3O8W A;  2DH9 A;  2ZH6 A;  2ZH7 A;  4OZN A;  4NZ6 A;  2HBQ B;  5E3R A;  2XWX A;  5E3Q A;  2VIC A;  2J8S A;  3DHX A;  3DLH A;  3IXQ A;  2Y1I A;  2XMK A;  1R8A A;  2I1R A;  3EE3 A;  1D9A A;  3JQK A;  1NKB A;  5GAE I;  3DOL B;  1PIL A;  4NLR A;  4WTY A;  2ZEJ A;  4P10 A;  4UST A;  4ITS A;  3B82 A;  3GFY A;  4KRW A;  4KSE B;  2IMO A;  3VAJ A;  2H5E A;  4P72 A;  4DV2 J;  3RAQ A;  2WVE A;  2W4C A;  2ABY A;  3CJ5 A;  1P8G A;  1K0T A;  4KBI A;  4B9S A;  1Q82 T;  5KT2 A;  2FYX A;  5B0B A;  2B43 A;  4X4S A;  3NMA A;  3I5A A;  4UY8 T;  1J5E F;  2RRN A;  4DG1 B;  4KR0 B;  2OPS A;  3F41 A;  4L73 A;  2GMH A;  4DSK A;  2ZBI A;  1JLE B;  3LAM A;  3FC9 A;  1S1W A;  2HAF A;  2XLJ A;  1AYE A;  2Y0S D;  3R1L A;  4GVL A;  3OVS A;  3UQS A;  2PFD A;  3EGN A;  5LMU J;  2FUG 9;  3TQ1 A;  3RG6 A;  2I38 A;  1WWH A;  4F4A A;  4DFM A;  4WFB Q;  4IFY A;  4L74 A;  1S1X A;  4XDD A;  2HWI A;  4IQX A;  3F56 A;  3SCL E;  2MDA A;  2AF6 A;  2E7V A;  3C14 B;  3CD7 A;  2VQE F;  3G6X A;  4JI1 J;  2JZ5 A;  2OP5 A;  4CO0 A;  1E6Y B;  3FEY B;  5IZH A;  4U8V A;  3W63 A;  3AB4 B;  3N6N A;  5HMY A;  1AUS L;  1AB8 A;  2ROP A;  3AOC A;  3C66 A;  3HFZ B;  2VQE J;  3EGV A;  2VC0 A;  1WHW A;  2D3O 1;  1HIY A;  2D69 A;  1OQ6 A;  4XK8 C;  1JNR B;  4ED6 A;  2ZE2 B;  4FBT A;  1JK9 B;  1BWE A;  4TQR A;  1RTZ A;  5D4P A;  2OKQ A;  2Q43 A;  2EFG A;  4K8R A;  2ALZ A;  4JV5 F;  1RCX B;  1ZZN A;  5A8K B;  4ECS A;  3QPI A;  1BWV A;  2C2K B;  2C22 A;  3KDN A;  1VS3 A;  4W92 B;  4NYP A;  4C2M A;  1C0T B;  1HFE L;  1CJV A;  1I1G A;  1N52 B;  4IG0 A;  2F4F A;  5EX3 A;  1Q7L B;  3CD5 A;  3T5K A;  4A48 A;  3S6E A;  1JJ4 A;  4E8U A;  2V8V A;  4P6Q A;  2V50 A;  1Q53 A;  3WX4 A;  5LJ3 Y;  1CC8 A;  1E6V A;  2HZA A;  4G1Q B;  3A3N B;  2RQM A;  2L41 A;  2ILY A;  4I2P A;  4RUA A;  3BSA A;  4QWA A;  5HRO A;  5KFT A;  3PR4 A;  4BHQ A;  2Z4P A;  2HGL A;  2DNO A;  5F8I A;  2MQO A;  2E7X A;  2OJ3 A;  3SMZ A;  2D9O A;  3TUP A;  3MR3 A;  5KTQ A;  4DV1 F;  2B9X A;  3RBD A;  3U27 A;  1TKD A;  3K7R A;  4HL9 A;  2WOM B;  2DNN A;  3R3T A;  1TL7 B;  4I2Q A;  1O51 A;  1RWU A;  4X4P A;  1Y3J A;  1OO0 B;  4OX8 A;  1M1G A;  2CZV C;  2PMH A;  1LWX A;  4KH1 B;  3HM9 A;  3W3S A;  4NX9 A;  3BPD A;  1BQM A;  2DY1 A;  3VGT A;  3ETM A;  1UKU A;  1YDL A;  2AIR B;  2J9D A;  4OHZ A;  2VBW A;  3GQC A;  1VC6 A;  2FLN A;  1QSS A;  3NL0 A;  3DN9 A;  3MM6 B;  4LQ9 A;  1URR A;  3AY0 A;  3SEO A;  5A8K A;  1N33 J;  3NGT A;  2XLK A;  2HIQ A;  3KK1 B;  1M1H A;  3W5X A;  2HQF A;  1RHJ B;  4DS5 A;  1B0T A;  3FEZ A;  1HNV B;  4IH7 A;  5AE3 A;  1X4H A;  4NA3 A;  2ATL A;  2KB2 A;  5KFJ A;  4OX9 J;  2XZT B;  1BQN B;  4YY3 F;  2NR0 A;  5L1J A;  2VZ9 A;  2YH0 A;  4N8N A;  3O6Q A;  3E3X A;  1U45 A;  3E51 A;  2E5I A;  4C97 A;  1FHT A;  2YVS A;  2J0W A;  2GVD A;  1EQM A;  2DGW A;  3BKF A;  3UD5 A;  3L7O A;  4ZVO B;  5KFH A;  3MR2 A;  4CWB A;  5G0R A;  3EIC A;  3QSI A;  3OL8 A;  3PW5 A;  4GKJ F;  4CO4 A;  1FRI A;  4N41 A;  4OI0 A;  2FPH X;  3ONQ A;  2KXH A;  4AND A;  5AE1 A;  1RLC L;  3CJS A;  2QG9 B;  3K57 A;  2ZDO A;  2CQ3 A;  5KFR A;  1TQL A;  1HQU A;  2ZWO A;  3H59 A;  3I0R A;  2BJ3 A;  3O44 A;  4KIA A;  3RRG A;  1RWO B;  4KV8 A;  2VKR A;  2PSZ A;  3EXY A;  3QAT A;  3SI8 A;  1XMO J;  3HKZ D;  2NPF A;  3KYL A;  4BWJ A;  2AEM A;  4KAI A;  1R8C A;  1HI1 A;  4QWE A;  2DGX A;  4RW8 B;  4QWD A;  5CQG A;  2R7U A;  3GYG A;  1S7H A;  4B3R F;  2NCK L;  2CG8 A;  1IM4 A;  3W60 A;  4W90 B;  2BYC A;  1DHM A;  1S7I A;  4O3Q A;  3ZC4 A;  2R8G A;  5IC6 B;  1VRQ C;  2IAJ A;  4OHY A;  1REG X;  3ELH A;  1CS4 B;  3W66 A;  4DV7 F;  1W2I A;  5LMN F;  3I4P A;  1RTI B;  1SPB P;  2E44 A;  4ED2 A;  2KXF A;  4URG A;  3V6D B;  1PAU B;  1PG5 B;  3M1V B;  3AJ2 A;  1JIH A;  4QIW D;  2HBY B;  3CXC R;  1KQS R;  5J2N A;  1RTJ B;  3MDF A;  3MMA A;  3SCJ E;  3V4M A;  2ASD A;  1M5P C;  3DLB A;  2FJW A;  1FXL A;  2UV8 G;  3PYD A;  5DQH A;  5KFW A;  2R7S A;  3G87 A;  1UA1 A;  5C7P A;  3RZA A;  3RAX A;  2UV8 A;  4U7C A;  3KLH A;  2J7U A;  1RAF B;  2O67 A;  1FJ7 A;  4ECW A;  1RHR B;  2KZM A;  3OXF A;  4HHH A;  3KLF B;  3KK2 B;  1KC8 T;  2ZH2 A;  2IYG A;  1I94 F;  4FF1 A;  3GE9 A;  1VMB A;  1LW2 B;  2AJF E;  2NRE A;  1N5V A;  3V81 B;  1S97 A;  1X9W A;  4LF9 F;  1RUS A;  3MED B;  2DNQ A;  2X51 A;  3G71 S;  4EU0 A;  4KKO B;  3G8S A;  4DV0 F;  3HFK A;  2R2U A;  2IVY A;  4K5S A;  4R0J A;  4PXC A;  4R25 A;  3EDQ B;  1HYS A;  1IQZ A;  2IJF A;  1HBN B;  1SVD A;  2HFU A;  3JQM A;  1H98 A;  4WIQ A;  3VF0 B;  5M2U A;  2VFS A;  3CB4 A;  3NS5 A;  1R89 A;  1HNW J;  2KFZ A;  4ED8 A;  3KLG A;  5IQQ A;  2DHA A;  3GIM A;  1TMJ A;  3BKU A;  1TUV A;  3MUM P;  2WHO A;  2MHE A;  1JXE A;  3ISZ A;  4OZL A;  2E5L J;  5J1E A;  1VBX A;  3DRR B;  1K1S A;  2ZOG A;  2AT1 B;  3CJ2 A;  2JFK A;  5F0U A;  3MAH A;  3BYR A;  2IM1 A;  5HMW A;  1FRK A;  3P49 B;  2ADB A;  1F60 B;  4OYB A;  3SFU A;  3V81 A;  1H7X A;  2RRB A;  1RWN B;  4P74 A;  3PZP A;  4GO7 X;  2IVF B;  3T9Z A;  5J1E B;  1F9H A;  1SJR A;  5KFN A;  4XO0 A;  4A8M P;  4ECT A;  2XEX A;  4H54 A;  5HJY A;  5DGB A;  4QYR A;  1VQL S;  4URQ U;  1UMJ A;  2R2T A;  4X65 J;  4ED0 A;  2HVE A;  4ES1 A;  1KVJ A;  2GO9 A;  2DIT A;  3BV8 A;  4ZJO A;  3KLG B;  2J9D E;  1JJ2 R;  2XZW A;  2Q6C A;  4Y6I A;  1FKO A;  2V69 A;  5CYQ B;  2R2S A;  3OXG A;  4B9U A;  3QO9 B;  1JLG B;  3FEX B;  4KHM A;  4QW8 A;  3UNG C;  3BQ1 A;  4DFK A;  4B9N A;  1CLF A;  4DS4 A;  4DR2 J;  3M8Z A;  1XR6 A;  3CF5 Q;  5E3P A;  3T6B A;  3LAN A;  1S6O A;  3A8J A;  3V4I B;  4X66 J;  3BR8 A;  2HIY A;  1IR0 A;  1DQA A;  1CS4 A;  1JLA B;  1HLW A;  1QUP A;  1VK3 A;  4U95 A;  4EBD A;  4ELU A;  1SJQ A;  3GPA A;  2AZ1 A;  2DHS A;  1R31 A;  3V5R A;  3CC2 S;  1QVG R;  1RAA B;  3DKD A;  2DPI A;  1RT1 A;  2C2Z B;  4ETX A;  2H51 B;  5J2P B;  1NK6 A;  4ENO A;  4CLU A;  3PFO A;  4QYZ J;  2KN4 A;  2V4Q A;  3P5T L;  5FDL B;  4WPA A;  1RTD B;  2RU9 A;  4Y34 A;  4ELT A;  2VH7 A;  1D0E A;  3MPU B;  2M3D A;  3K5N A;  5A6W A;  3H5Y A;  4WFZ A;  1DAX A;  4WK1 A;  1J2V A;  2W4D A;  2Z2L A;  3JTN A;  4KY3 A;  4Y00 A;  3TYT A;  2XMA A;  2XC9 A;  3KLV A;  3WC2 A;  1H74 A;  4OV1 A;  1SH0 A;  2BZ2 A;  1HQU B;  3IC1 A;  4P2S A;  3GV5 B;  1P1T A;  1VFJ A;  2G2Z A;  3Q2S C;  1TFW A;  2FTR A;  5HQM A;  3BO2 A;  1HNI A;  1RYR A;  1XNQ F;  2OAU A;  2MKJ A;  2V8P A;  5HN0 A;  1GT8 A;  1X5O A;  5DLF A;  4ZS6 A;  1IKW B;  1X5P A;  3NOC A;  3RUB L;  1UVK A;  2C2N A;  4WE1 B;  3GJQ B;  4CQ1 A;  5DET A;  4NEY A;  3G6V A;  3ZTO A;  2BOA A;  4DFP A;  2C2O B;  1ARO P;  4OFZ A;  1TZ0 A;  2RD5 C;  1DUR A;  1YBA A;  1NDC A;  4V1A k;  4Q2M A;  1TL4 A;  5M2P A;  2DR7 A;  4XIU A;  3W2V A;  4NRT A;  2I5J B;  3BQ2 A;  2HGM A;  3BSC A;  3KJF B;  5G4D A;  3QYY A;  4U67 Q;  1J5O B;  1B7F A;  2N3L A;  1FRX A;  5IV4 A;  4J9S A;  1DLO B;  1FD8 A;  4TXS A;  1T05 B;  4A8O A;  1ZAV A;  3ULH A;  1SJ1 A;  3AD9 C;  3DU6 A;  4LVO P;  2NLW A;  1K8A T;  2PEH A;  2UU9 F;  4UZB A;  3G2X A;  5HBM A;  4FYD A;  3TJ9 A;  4RW6 A;  4K59 A;  2F9D A;  3X1L B;  3Q8S B;  2OUG A;  4C11 B;  3KHL A;  2DNM A;  4DQS A;  2QA4 G;  4FF4 A;  2K1R A;  3HCX A;  2JL9 A;  1VQ4 S;  2VA2 A;  4CRJ A;  4I7F A;  1RKJ A;  1AZS A;  1KQK A;  3QLH A;  2XGQ A;  5HAT A;  1WSV A;  3MPW A;  5KFO A;  2ZZM A;  1PC5 A;  3K59 A;  1WC0 A;  4DBQ A;  3HFV A;  4M5M A;  5CAB A;  1IUJ A;  1TL7 A;  4BCA A;  4D3H A;  4C8Z A;  4O3R A;  3OSN A;  3N5F A;  3OJS A;  1RGV A;  4HDG A;  4TU7 A;  3TAM A;  2FLL A;  2XYH B;  2ROE A;  3EUN A;  2XCA A;  4DR1 J;  4Y28 C;  2AEJ A;  1VRT A;  1WC3 A;  1S9G A;  4CLP A;  2JEI A;  3SQO P;  4JP8 A;  4QZV B;  4TVA B;  2ZVS A;  1GXU A;  4O4G A;  2W8L A;  5C24 A;  3MD1 A;  2GW8 A;  4HEA 9;  2QX0 A;  4ZA1 A;  4AL5 A;  2CPX A;  3AD8 C;  3GV8 B;  1NB7 A;  4DPW A;  3SFG A;  4DN0 A;  3OBI A;  2QL5 B;  2VJV A;  1N5Y B;  2IHR 1;  2J76 E;  2U2F A;  3GFZ A;  3HXM A;  1AFJ A;  1KN6 A;  3QLH B;  2M88 A;  4WU2 A;  3PYG A;  4DR6 J;  4PYD A;  2K1R B;  3GLJ A;  1F0X A;  4J9Q A;  1C0T A;  3VAM A;  4RU9 A;  1OPI A;  4K4Z A;  3W7B A;  4Y65 A;  1R8B A;  2JLF A;  2UXC J;  4LF1 A;  3HHL B;  3W5Y A;  5B08 A;  4M95 A;  2KO1 A;  3Q8Y A;  3SIP B;  2WVB A;  3QT7 A;  2LXI A;  4B3S J;  4I1T A;  3PY8 A;  4J90 A;  1NRK A;  5DS7 A;  3EVM A;  1CJK A;  3G9C A;  4JI7 F;  4IO1 A;  1YTY A;  1PGZ A;  4RW7 B;  3GU0 A;  3JQJ A;  4O3S A;  1PKU A;  1FKP B;  3DYA A;  4J37 A;  3KK3 B;  2QFJ A;  4H4M A;  3JSM A;  3ICL A;  1PJ7 A;  5D0R A;  1IKW A;  1C2P A;  2GFF A;  3J7A N;  2CDR B;  1JLE A;  3J7Z T;  2ASY A;  4OI4 A;  3ZNU A;  7FD1 A;  2W2P P;  2YKA A;  2QIF A;  3EPG A;  5F8M A;  3TAR A;  3FQL A;  5KG2 A;  2ADC A;  3RB6 A;  4ILM A;  1D9F A;  2WW4 A;  3AJ1 A;  3L7U A;  2YWK A;  4KQZ A;  4GKK J;  2BE2 A;  1NPK A;  4P71 A;  3G8Q A;  4RNH A;  6FDR A;  5KG7 A;  3G6E S;  4DV6 J;  1AFI A;  1HWU A;  2ZIT A;  1KNZ A;  2AYE A;  4PYA A;  3WX8 A;  2K2P A;  3UDC A;  4DV7 J;  1SKS A;  3QRQ A;  2XCP A;  4AYB D;  3R6L B;  1UFK A;  2FJE B;  2JH3 A;  5HQ8 A;  3J81 Y;  1RXO B;  1HBM A;  1ZAX A;  4PR6 A;  4CTA A;  3K5O A;  5CCL A;  5DQG A;  1VQ9 S;  2DRA A;  5D4N A;  2YXL A;  4H4K C;  1KTQ A;  2I9S A;  4PCQ A;  2HW3 A;  1Q95 G;  1RIS A;  1YZ6 A;  2MZ1 A;  3FQK A;  1JLB B;  8RUC A;  4PAB A;  4BC9 A;  1U2R A;  2LEA A;  1F9E B;  1RA6 A;  2Z57 B;  4F25 A;  2W24 A;  5D8H B;  2JLE A;  3D68 A;  3LO3 A;  5HK4 A;  3PRB A;  4QJV A;  2UUC J;  1P1L A;  4RU2 A;  2RML A;  1KKH A;  2CJA A;  3UE2 A;  3W5Z A;  2M9K A;  1JLQ A;  1ZM2 A;  4ECU A;  1SUQ B;  1JLA A;  1HA1 A;  4WBF A;  3RAM A;  5A2Q Y;  2P9E A;  5AJ3 J;  3OR2 A;  3H25 A;  4DQI A;  2HHQ A;  4H4M B;  1ICE B;  2ZH1 A;  3L4B C;  3CWJ A;  3MMJ A;  2FC9 A;  2WON B;  4JV1 A;  5EN1 A;  1FK9 B;  1UW9 A;  4CYU A;  3QIP B;  3GII A;  1Y10 A;  2ZBP A;  4DSE A;  1HW9 A;  4MK9 A;  1EQ0 A;  1HPZ A;  4YME A;  4DX7 A;  3GFH A;  1NO8 A;  4DR2 F;  3H5S A;  4ILR A;  1TEL A;  1RU1 A;  1T7P A;  3DI6 A;  2R8H A;  1IN0 A;  4I64 A;  4KHP F;  1NU4 A;  2PDA A;  1U25 A;  1U8S A;  4AQY F;  3CCE S;  4G1P A;  1ZH5 A;  2W2M P;  2PI4 A;  3SV4 A;  1WC5 A;  2JEG A;  1TAQ A;  2LEB A;  4ZVH A;  3DLL Q;  3JSB A;  3MM7 B;  1RI7 A;  1SCJ B;  2W8K A;  4CT9 A;  3OLB A;  4YQW A;  4PEO A;  2I6W A;  3BDP A;  1O0P A;  3BYP A;  3DDI A;  4TY8 A;  5KFX A;  4ATN A;  4A47 A;  2M4M A;  2HBZ B;  3AAW B;  3GON A;  3KLF A;  2LEC A;  1SQG A;  1KD1 T;  2BW7 A;  2DXD A;  3IG1 B;  2IM0 A;  3LGM A;  5B0F A;  4DHV A;  3AXK A;  4HH1 A;  5J2M A;  2ASJ A;  4EBC A;  4Y2A A;  2E5L F;  2OIH A;  4ETZ A;  2HHX A;  4WKR A;  1FT8 A;  1LW2 A;  2EK1 A;  1RT5 B;  2F5G A;  3CE8 A;  2MB0 B;  3H42 A;  2WVF A;  1QM9 A;  4DL6 A;  4OYO A;  2JOQ A;  4IRC A;  3F0N A;  3OR2 B;  1O6X A;  1TKT A;  2D3Z A;  5AXL A;  4E98 A;  5KFD A;  4JI6 J;  4ZPB A;  5C25 B;  1LKZ A;  5C42 A;  5IQ6 A;  1PAE X;  3KLH B;  3PX0 A;  5A6P A;  1ZTW A;  5M2R A;  1DBD A;  4B9M A;  4DX5 A;  3AA9 A;  4OLP A;  3UI3 A;  2HSE B;  1XMQ F;  1X7V A;  4WTO B;  4USW A;  2KG0 A;  3M30 A;  2QYC A;  1FX4 A;  1F1B B;  2OD6 A;  1NXI A;  4O44 A;  2CYY A;  3RB0 A;  4M5D B;  3NBP A;  4R0E A;  3PW0 A;  4RPF A;  4DR5 F;  4PPD A;  2AU0 A;  5LSL A;  2W7P A;  5F8L A;  4EBE A;  3TOQ A;  5E0O A;  1AW0 A;  4OZ0 A;  1PYO B;  4ICL A;  3ZFV A;  2E1M C;  4UT4 A;  1GMV A;  5DG9 A;  5CD4 H;  1IBK F;  1IBL F;  2QRR A;  4G65 A;  1ZA2 B;  2YQ3 A;  3PG9 A;  2MQ8 A;  2YPY A;  1HBM B;  1ZM4 A;  2IA0 A;  2NXE A;  3T1A A;  3M8R A;  3SQG B;  2BKP A;  2G0I A;  3OL9 A;  1T9U A;  1R0A A;  3RB3 A;  1FNX H;  4DPU A;  3FZ2 A;  3EYZ A;  2EWH A;  4FDF A;  4F0H A;  1FJC A;  2ZZT A;  4LVN P;  3LUY A;  5LXY A;  2BAC A;  2RH3 A;  1BHN A;  3OTB A;  1S1T B;  2QTW A;  3M6X A;  1WC6 A;  4CLT A;  2VV5 A;  3OL7 A;  2OO4 A;  2M2B A;  1UZH A;  1G3O A;  2H5J B;  3AHP A;  3DLE A;  2I5J A;  2ATC B;  4HAC B;  5BYR A;  3TX0 A;  5I42 B;  2IJR A;  4LR7 A;  2CQH A;  3BEG B;  2F7V A;  1W7W A;  2GV1 A;  5KFC A;  2YH1 A;  2FQQ B;  4DR4 J;  4KO0 B;  2YNG A;  1WOR A;  4QBU A;  3LGH A;  1R0C B;  2HWH A;  3A1Y G;  5HMZ A;  1RHK B;  4A8W A;  2OPR B;  4PXE A;  3MUR P;  4JOU A;  1DTT B;  2Z2Y B;  2UVR A;  1UL3 A;  3HSJ A;  1S77 D;  1CEZ A;  3LPY A;  1N5Q A;  2UXB F;  2CQD A;  2E1P A;  5ETO A;  3TUZ C;  2W9C A;  1RB0 A;  3R27 A;  1M5O C;  3NBP B;  5A8W A;  4PG6 A;  4OZJ A;  2RSQ A;  5J2P A;  1Y4Z B;  2DRD A;  3UDE A;  2XY7 A;  2V67 A;  1RAO A;  3B4M A;  5KG6 A;  3IM8 A;  3THP A;  3I55 S;  4O3P A;  4NYO A;  2HUR A;  3BGR B;  2VOO A;  2MKY A;  1RAB B;  1FNM A;  5C5J A;  1UCN A;  1R27 B;  3JXO A;  2R7W A;  3DNC A;  4ED7 A;  3RBX A;  5ETR A;  1QAI A;  2OTL S;  3E01 A;  5J2Q A;  5KG5 A;  4QR0 A;  2FVQ A;  4PXD A;  2GCF A;  4DCJ B;  2QA2 A;  3GJT B;  1GQE A;  1IKX A;  2GJF A;  3FCW A;  2XS5 A;  4USU A;  2GHP A;  3MM6 A;  1EJ7 L;  1G7C B;  4DSF A;  3SXL A;  1NK0 A;  3CTR A;  2VL1 A;  3PO5 A;  4GKK F;  3C15 B;  2DEJ A;  1SC6 A;  1H7W A;  1TL1 B;  1XIQ A;  2G2O A;  2NPI A;  3MCN A;  4J5O A;  3W64 A;  1E6V B;  2BJ7 A;  4E2F B;  4ZLP A;  2ASL A;  4ED3 A;  4RUH A;  1CJU B;  4YB1 P;  4Q5V A;  3VAF A;  1YJT A;  2YQ0 A;  4TYA A;  3OUY B;  1YIT S;  3WHI A;  3RR7 A;  1XNR F;  2JFD A;  4C48 A;  1H6K X;  2RJZ A;  1T9V A;  1KDN A;  1GK8 A;  1ZPV A;  2CXE A;  3QID A;  2UVV A;  4NWB A;  3DRX A;  1XC9 A;  1T3O A;  2BJ8 A;  3IWL A;  3M2R A;  3OLA A;  3T1Y J;  1MN9 A;  1IBK J;  1IBL J;  1HNX J;  4UZC A;  1FER A;  4U96 A;  4BS2 A;  2E9R X;  3BH6 B;  4X2B A;  3JSY A;  3OVB A;  1DFD A;  4EMD A;  2IA6 A;  3CJK B;  4AL6 A;  1HI0 P;  4HYK A;  1YJN S;  5CD4 A;  2Z8Q A;  4A8S A;  1WI6 A;  2LYV A;  3R5B A;  4G1Q A;  4YB7 A;  3K0J A;  5B0D A;  3ET6 B;  1GAO A;  3QT8 A;  5KFS A;  3Q8U A;  1W26 A;  2FJV A;  4WXO A;  3OL6 A;  2RKI B;  1HBU B;  2MTL A;  2RQC A;  2E29 A;  3UD3 P;  2KM8 B;  3OXL A;  1RTH A;  3FFI A;  2BR0 A;  2Q66 A;  1E6Y A;  2VBY A;  3OFG A;  3TA0 A;  4RWW A;  4IG3 A;  1S9F A;  3KHR A;  1YJ7 A;  2BE9 B;  2IBO A;  3G86 A;  3QWP A;  2F1F A;  4A46 A;  1MRO B;  4UQG A;  2VIH A;  2F8E X;  4CYU B;  2DGO A;  2P9C A;  1K9M T;  2DYA A;  2W4P A;  5GME A;  1UPM B;  4B02 A;  2KVQ E;  2ZH8 A;  2VPY B;  2K3K A;  3DXS X;  2J7K A;  3M8P B;  3D6F B;  2ZD1 A;  3C14 A;  3C2P A;  4JI8 F;  3Q8P B;  1JXL A;  2HWT A;  4F4Z A;  3DRS A;  3M6U A;  2Q79 A;  3C6T B;  4M8L A;  4L6V 3;  2CQP A;  2F65 A;  1YX2 A;  1LFW A;  3RW6 A;  4UW2 A;  1K44 A;  4L76 A;  1WHX A;  1TTH B;  3WBZ A;  3QRP A;  4RL1 A;  5ETP A;  1SC4 B;  2EEY A;  5F8N A;  3CW2 C;  4J9R A;  1JLB A;  3ILJ A;  2QGF B;  4I69 A;  3CDU A;  2ZBR A;  4DXL A;  2LQB A;  4TKT A;  5E33 A;  4B9V A;  3TAN A;  2YWG A;  2BJD A;  1HHS A;  3CMA S;  1X0F A;  1NBE B;  2PMZ D;  2AP6 A;  3AA8 A;  2ZVI A;  2HS3 A;  1QE1 B;  2EI5 A;  3QWU A;  5KFY A;  1VIS A;  3A3P B;  1K0V A;  4WK3 A;  4OJ1 A;  2IBK A;  2AX0 A;  2D3U A;  1MU2 A;  3VQS A;  4K4V A;  3U1M A;  1GX5 A;  3MOZ A;  3J80 Y;  2JWN A;  3ILI A;  3D3B J;  5A8W B;  5GAE U;  3BO3 A;  4JI1 F;  2PI5 A;  1HQ2 A;  4GO5 X;  1L3T A;  3PTW A;  3V4I A;  3K17 A;  3KOA A;  1S9E B;  4NML A;  2YX7 A;  2BOP A;  5IC4 B;  4F02 A;  5EDW A;  1HQE A;  1BC6 A;  3W8P A;  2HQ3 A;  5DZ6 A;  3CD6 S;  4I56 A;  1CJK B;  1RWM B;  2EPI A;  4OI3 A;  2VD3 A;  5DJB A;  2PT0 A;  5LSR A;  1KBR A;  1YJV A;  2COL A;  4DR6 F;  2X1G A;  3M8P A;  5ETV A;  1RT6 B;  5FLX U;  1J27 A;  2DNL A;  1XJW B;  1W2B R;  1WI8 A;  3HVA A;  4RW4 A;  1VJW A;  3CC4 S;  4LT6 A;  4NLQ A;  1KLM A;  5GAG I;  4ZJL A;  3DLE B;  3NGK A;  4A8X A;  3PVX A;  1ZTT A;  1IBM F;  3NNA A;  2B9E A;  2B8Q A;  3G82 A;  4X4O A;  2M0G B;  2R7X A;  4F4X A;  1T9T A;  2DGT A;  2OTJ S;  2FLO A;  1WHY A;  3D0I E;  4K4T A;  2M7S A;  1Q1K A;  3KNG A;  1H73 A;  1X5S A;  4F3O A;  4G6V B;  1T9Y A;  2H9Z A;  2OD4 A;  1CVJ A;  1VC0 A;  3ET6 A;  2CQ0 A;  4TU8 A;  3Q0A A;  2IC3 B;  2XQC A;  1FRH A;  2GQQ A;  4AQY J;  1FKP A;  3DYA B;  4YR3 A;  2ZM6 F;  3D5M A;  1T9X A;  3CCT A;  2DKO B;  1HBU A;  3K8V A;  3LW5 C;  5KG0 A;  2V9W A;  2WW8 A;  1X8D A;  4MYU A;  2F8H A;  1HL6 A;  1N0U A;  3FCV A;  3HZE A;  1P9Q C;  3CED A;  4IQM A;  5D77 A;  1M5S A;  2ZUA A;  3JS9 A;  2ZBQ A;  5KFZ A;  1EHW A;  2CNK B;  3I87 A;  2OEJ A;  3D1O A;  5I3Q A;  2KG1 A;  4Q43 A;  2HHU A;  4ZDN A;  4QIV A;  4LF8 F;  3OR1 B;  4ZVR B;  3SSR A;  2R4F A;  3IRW P;  1RCO B;  1LQ9 A;  4KTQ A;  3MEE A;  4M5N A;  4YEA A;  3MR7 A;  5HRO B;  3D0H E;  4XPE A;  1LXN A;  2GGP B;  1S48 A;  4W4M A;  2Q6B A;  3TR5 A;  3NLC A;  1WF2 A;  3HX9 A;  4LF7 J;  2AZ3 A;  1BQX A;  1HD1 A;  3OR1 A;  5KT6 A;  2BJ1 A;  4NXN F;  2LKZ A;  1T95 A;  4DZ6 A;  2I8E A;  1YIJ S;  1WD6 A;  2BM1 A;  4RBT A;  1TL1 A;  1DTQ A;  1F9F A;  2YWE A;  3UN3 A;  1G1X A;  3BB5 A;  3DMJ A;  1GMU A;  1UVM A;  2HQC A;  2Y8Y A;  2FHK A;  3NNH A;  2B56 A;  1TKX B;  2CJ9 A;  2DJW A;  2FY8 A;  3R5A A;  5D0G A;  2AYM A;  5KFA A;  2ZUG A;  2K06 A;  3OTO F;  1IKX B;  3CDW A;  4FP9 A;  3V6D A;  4IRD A;  3KJQ B;  1YVF A;  2VDI A;  2WBM A;  4PWW A;  1N56 A;  3CJ0 A;  3IR7 B;  2IC3 A;  2MLY A;  2KM8 C;  3VCD A;  3KLE B;  5KT4 A;  1TK8 A;  3AOD A;  5THW A;  2FVC A;  2MY8 A;  3DFE A;  1N36 F;  1Q7Y T;  2KL8 A;  3ZZT A;  1NDP A;  2HK2 A;  5ETQ A;  3B6B A;  4ALZ A;  1VIX A;  2Z2M A;  1HNW F;  2VFV A;  1JWW A;  1UFL A;  3MEC A;  1QAY A;  3QAU A;  2ILZ A;  1Y9O A;  4KE5 A;  1L5U A;  4LF9 J;  1KOH A;  2AJ1 A;  2V4J A;  1RT2 B;  4O3N A;  4EEY A;  5CA5 A;  2Q3P A;  3C16 A;  2ACY A;  5G0R B;  4DR7 F;  1KLM B;  4ZP9 A;  3J7Z 5;  2OPS B;  2DTJ A;  5D6G A;  2CG4 A;  1NK8 A;  1NB2 A;  2FY1 A;  1FEH A;  1ACM B;  2ZOF A;  3NGU A;  2GMJ A;  2ZJQ Q;  3H5U A;  4ZN3 A;  4OYM A;  2IRY A;  5BYS A;  2ERR A;  1RT7 A;  2KHC A;  1I5O B;  5KG3 A;  2UXC F;  3BSN A;  3Q8V A;  2LVW A;  2CVE A;  2JEJ A;  1UA0 A;  1FJG F;  4QCL A;  2OFG X;  2C3Y A;  4DFJ A;  2VUG A;  4K4S A;  2HHT A;  2FVS A;  2L48 A;  2UVU A;  1Q8L A;  2EBG A;  1JLG A;  4ECV A;  1KFS A;  3ENQ A;  2E9Z A;  3D4J A;  3QZ7 A;  1S1U B;  4KC5 A;  4NXM F;  3HHL C;  2HHS A;  4ERD A;  2YKO A;  2N3O A;  3GIJ A;  2MEW A;  2MZR A;  4C8M A;  1UJ4 A;  1OMS A;  4RR5 A;  2J0S D;  4OMF G;  3EGZ A;  3PFE A;  5A76 A;  2X1A A;  5F3Z A;  3GV7 B;  4ZPD A;  3OTO J;  3DOM B;  3QGI A;  3GYX B;  1FKO B;  3EGW B;  4P73 A;  1SQE A;  5KFQ A;  2PEB A;  3HD2 A;  4F67 A;  2Z58 B;  3HVW A;  1H2V Z;  3QT6 A;  1B0V A;  2WSC C;  2GJ2 A;  2QEX S;  3CUL A;  5DDQ C;  4ZCK A;  5DZ7 A;  2WB4 A;  3TA1 A;  3IWN C;  1NPR A;  2VC1 A;  1BY9 A;  4N77 A;  4AUK A;  4Q45 A;  1L3S A;  2HBR B;  2CQC A;  3JTO A;  4EWT A;  3IWX A;  2LXU A;  1HHT P;  3A8E A;  2F9J A;  2RIL A;  4FNH A;  4GMK A;  1RT5 A;  3WDO A;  1VLO A;  1RTH B;  1KQF B;  4ANC A;  3CCR S;  1YG0 A;  1TKZ B;  2A0F B;  4Q7A A;  2DRB A;  3MTJ A;  2BDP A;  4IR9 A;  2QLB B;  2HS4 A;  2H5I B;  3PXG a;  1I94 J;  4OIX A;  1GTH A;  3BBF A;  1VCT A;  2VQF F;  4MKB A;  4MK8 A;  4OQJ A;  2D7S A;  3NG8 A;  1NSQ A;  3DDN A;  4YY3 J;  4B9T A;  3FSY A;  5D3G A;  4NCG A;  5DDR C;  2DNK A;  4IKA A;  1S0N A;  1YJW S;  3I9V 9;  3ITH B;  4URS A;  2IVM A;  3QT5 A;  1RAI B;  1OJ4 A;  1WC1 A;  4ZHR A;  4IG3 B;  2XM3 A;  3AH6 A;  4LFA J;  3G8T A;  1IBC B;  1UET A;  3IBC B;  2WTF A;  1WG4 A;  1FRJ A;  1RAH B;  3BH7 B;  8ATC B;  1VBZ A;  4LIR A;  3Q22 A;  2CFX A;  2FJX A;  1UJ5 A;  2VOD A;  2VDH A;  2YNH A;  2WSF C;  4KFB B;  2FVP A;  1YBU A;  2EXU A;  2G2Y A;  4MIW A;  3EWG A;  3QMQ A;  4R5P A;  4UF4 A;  3TA2 A;  3CDB A;  4ZP6 A;  2KJV A;  1UAW A;  4KPY A;  1HAR A;  2YKP A;  4NCB A;  1U0S A;  2C3P A;  2DK2 A;  1FA0 A;  2CWK A;  4HT7 A;  1CG2 A;  3R7S B;  3MHY A;  2A6O A;  4QU6 A;  4DPO A;  1IJE B;  1CUL B;  2K7K A;  3AQP A;  3MUV P;  2BQ3 A;  4NXM J;  3O1L A;  3KK2 A;  1SL1 A;  5ETN A;  3UN5 A;  4OYP A;  4P9S A;  2VJU A;  3BBC A;  3SCI E;  2E1R A;  4DL7 A;  2IM2 A;  2VFR A;  4WFY A;  1S72 S;  2HNZ B;  1CJU A;  4F2R A;  1YRX A;  1VQN S;  2MJU A;  5F9L A;  4UTG A;  2BKN A;  3UNY A;  3LQV A;  3MAA B;  3M7V A;  2DO0 A;  2PO4 A;  3SDE B;  2XO6 A;  4HI1 A;  2CPY A;  4OYA A;  5CYM A;  2EVZ A;  1S99 A;  1RT7 B;  3TZY A;  4C11 A;  3B8H A;  2Y1J A;  3CJR A;  1WEL A;  3NCR A;  4NLX A;  5LM7 E;  9RUB A;  2VBZ A;  3UN2 A;  5CYJ A;  5IT4 A;  2IM3 A;  1WF0 A;  3N9U C;  4LJM A;  2BRL A;  2QSF A;  4A8F A;  3R5J B;  4HH0 A;  1U1Q A;  3PCO B;  1UEV A;  1HWL A;  2W1B A;  3H7H B;  4AXJ A;  2P2C B;  2XYP B;  2FVR A;  2JX2 A;  4Z7C A;  1PCA A;  1Y7P A;  3KWM A;  1K73 T;  3UW1 A;  3M32 B;  1J5O A;  2M52 A;  4OX9 F;  4B3M J;  2BX6 A;  2AEF A;  2WB1 D;  3F44 A;  1NND A;  2OEK A;  3I0R B;  2LP4 A;  4L3N A;  3QFH A;  4FYW B;  3POT B;  5HAN A;  5CZV A;  4HKQ A;  2MQN A;  4WU3 A;  3C16 B;  1HW8 A;  3CCM S;  4J9N A;  1U47 A;  4NMX A;  1JLC A;  1RT3 A;  3NGD A;  1CC7 A;  1VK8 A;  3DM2 A;  4I68 A;  2PE8 A;  5KFL A;  3VWS A;  4CZC A;  4C8O A;  2E1A A;  2GS8 A;  1K47 A;  3NGR A;  3BO4 A;  2O66 A;  5KOW A;  2WVC A;  4LSN A;  2BV3 A;  5F9N A;  3A8K A;  5KFM A;  2IDE A;  2P8I A;  4DF4 A;  2KH9 A;  5BXI A;  4UUW A;  2MQM A;  1HNV A;  5IFM A;  3OFH A;  1JJH A;  2R3V A;  3AOA A;  3KK1 A;  4BDP A;  4C6A A;  2BAN B;  4B3R J;  4LRF A;  3W1Y C;  1R0A B;  2YNF B;  4DN9 A;  1Q8K A;  4CO5 A;  5DRK A;  1TVR A;  4DCO B;  5LJ5 Y;  3M9N B;  2MGZ A;  3FK4 A;  2VOP A;  2FIU A;  2PN6 A;  3M30 B;  4RBU A;  2MHN A;  3PEJ A;  2ZJR Q;  3JAM U;  1QSY A;  1UW4 A;  3KHG A;  2V2Q A;  3M2V A;  5EWE A;  1CBK A;  3TVK A;  3M2U A;  3MEG B;  4F4Y A;  3QJL A;  2DO4 A;  4C0H A;  2HND B;  5KFK A;  2OPQ A;  4LRC A;  1BQN A;  2KRR A;  1L3K A;  3PM9 A;  5AE2 A;  2WRM A;  2HZC A;  3FNN A;  3HHL D;  3N28 A;  3H90 A;  5CZX A;  1DJ0 A;  1LWE B;  3GWC A;  2UXD J;  2UUT A;  3H4B A;  1UZD A;  4O23 A;  3V2U C;  3R5G A;  3K5P A;  3HP6 A;  4C8N A;  3RGI A;  1TKX A;  4IR1 A;  1ROF A;  4YDD B;  1HNX F;  4ZLJ A;  2CDQ A;  4WF9 Q;  5KT5 A;  1VC5 A;  1Q78 A;  1Q86 T;  1VQ7 S;  4ED4 A;  1VQ5 S;  1JMT A;  2C2R A;  4NA2 A;  2FB0 A;  1AUD A;  4LFB J;  3IG1 A;  3O3L A;  2XHC A;  3PIP Q;  3MPV A;  1S4F A;  1EAR A;  3MM7 A;  4ZK7 M;  1QTN B;  2DGU A;  4KHP J;  2KT5 A;  2BQU A;  2VKZ G;  1WHV A;  4HT5 A;  5E5N A;  3UVJ A;  1GXT A;  4K5R A;  2FZK B;  4C4W A;  1RWW B;  2OPQ B;  4ZPC A;  2B6A A;  2EBE A;  5IWA F;  2VHG A;  1RAE B;  5ETS A;  3C19 A;  1LV5 A;  2A2C A;  1KON A;  3ZTR A;  4Y2M A;  1D8Y A;  2CJK A;  2OEM A;  4RUC A;  4PWU A;  1U48 A;  2P6S A;  1UVI A;  3M4X A;  1TL5 A;  5GAD U;  2G9O A;  3LAL A;  5IM0 B;  2QFI A;  1HPZ B;  3IMQ J;  3OHA A;  3NP5 A;  2FD2 A;  2AV5 A;  4DSJ A;  3GR0 A;  1RBO B;  2QJ3 A;  4LSZ B;  3SSQ A;  3KTQ A;  2L08 A;  4BBY A;  1RQ0 A;  3FBE A;  1O8B A;  1NK7 A;  1XBW A;  4QYZ K;  1MN7 A;  1RDR A;  4J9M A;  4YR2 A;  1TUW A;  1BLU A;  3M9M B;  4EUV A;  4QU7 A;  4IRK A;  4X4T A;  4DF8 A;  3PX6 A;  2VA3 A;  2V4R A;  4CLF A;  4FBU A;  3IS9 B;  4OYX A;  1QAJ A;  2IRX A;  4N47 A;  1C4A A;  3VGS A;  1IWG A;  3ENW A;  3PJW A;  4JI4 F;  4Q0B B;  1RP5 A;  3TP2 A;  2ZE2 A;  4GC7 A;  2NXU A;  3ZTS A;  2YKM A;  4DUZ F;  2BXJ A;  2MY7 A;  4PG4 A;  4P75 A;  2OH2 A;  2F4V F;  3FSX A;  1N48 A;  1CJT A;  2A2D A;  2ZHO A;  3IR5 B;  1GMW D;  1TR0 A;  2DHX A;  4IFY B;  4WII A;  2N4C A;  5H9F J;  1S6Q B;  2MZQ A;  3TVZ A;  3M8S A;  3UCG A;  4O4R A;  4Y2K A;  1S9E A;  1S1U A;  1D09 B;  2GQ2 A;  4DX6 A;  2F40 A;  1NAQ A;  1U6Z A;  2H48 B;  2PA3 A;  3PYE A;  2DR6 A;  3UDL A;  1SB6 A;  1ZA1 B;  3HD1 A;  4C3K A;  1I51 B;  3UPF A;  3G96 A;  2AWZ A;  3P96 A;  1VBY A;  3DOL A;  5LMU F;  2WSE C;  2QC3 A;  1NEE A;  1P27 B;  4F3Q A;  3M8Q B;  4ZJQ A;  4DZD A;  2UUA J;  1LW0 B;  1KOO A;  2G13 A;  3GG1 A;  1NH7 A;  4QQB A;  2Y9H A;  3MF5 A;  4LRB A;  2GC8 A;  4WXW A;  2DIV A;  5KFG A;  4DLE A;  2YY3 A;  3D66 A;  4N7T A;  3D2W A;  4ANE A;  3TUI C;  2QSW A;  1KSP A;  2DHG A;  3GR1 A;  2DCL A;  4I6A A;  4QIF A;  2R8I A;  1ZBT A;  2C2D A;  2NXC A;  1U1K A;  4LFB F;  4QOT A;  3EM1 A;  2LQ9 A;  2YX4 A;  3L7P A;  3UCU P;  5LL6 d;  4CLL A;  2VQF J;  4H4O A;  4V19 J;  1F5A A;  3QQC D;  2HPU A;  2MJN A;  4DQP A;  2V8H A;  1O5J A;  4RBV A;  2XI3 A;  4DV1 J;  4X4V A;  4NLW A;  1FTR A;  1VJQ A;  3NCQ A;  4YHH F;  4NLU A;  1Z2L A;  2A18 A;  5KFI A;  1XMQ J;  2MZT A;  1J5E J;  2V94 A;  3HKW A;  3MEC B;  3W9J A;  3JYT A;  4MK7 A;  1Q8B A;  2C3M A;  4GRS A;  4NLG A;  2RQ4 A;  2B51 A;  4OYW A;  4UOC A;  1C0U A;  3OJU A;  1P9Y A;  5KT3 A;  3LTO A;  3J81 j;  3CT9 A;  3D1H A;  2QO3 A;  4X84 A;  4WFA Q;  1QVF R;  3DRS B;  2YWF A;  2ALY B;  5FJ4 A;  3EX7 B;  2D9P A;  3THT A;  3JSM B;  1N34 F;  3KJV A;  3UWT A;  3I6P A;  4OI1 A;  4F0K A;  4PAA A;  3RTV A;  1T03 A;  2B4U A;  4OZ1 A;  4Y3C A;  2GIF A;  5T41 A;  4NI2 B;  2C42 A;  3ITH A;  4CLS A;  3V6K A;  3T1H F;  5DM6 Q;  1ITP A;  2RAQ A;  1IR2 A;  3ENA A;  4EFA C;  1DQ8 A;  4LF6 F;  2CWX A;  1C4C A;  4OV6 A;  2H4Y B;  2EFN A;  3ZO7 A;  3VAK A;  2KU7 A;  1NK9 A;  4DV4 J;  4W98 A;  2Y0B B;  3CDE A;  1GFW B;  2HFS A;  1RE1 B;  3OPK A;  4P2F A;  2HKE A;  1N4L A;  1OY9 A;  5HI7 A;  4ED1 A;  1GEH A;  1TL3 A;  2RKI A;  4WP8 A;  4YOE A;  4DL0 C;  2HMI B;  3JAM Y;  3DMJ B;  1Y11 A;  4BWM A;  4TQS A;  1GH8 A;  2NZ4 A;  6FD1 A;  1QSL A;  1KR4 A;  1RK8 A;  3I0S A;  1PC4 A;  3HSD A;  3MR6 A;  2UP1 A;  1NHK L;  1PBU A;  2CRL A;  3CDA A;  2L9W A;  3RRH A;  5HP1 A;  4USK A;  5T7L A;  3L3C A;  2C2E A;  4IDK A;  3TEH B;  2HVI A;  1FNO A;  5DG7 A;  3IA0 A;  3R7B B;  3UVJ B;  4JYA J;  4YP3 A;  2EFP A;  1NME B;  4FZV A;  5GAH U;  2J6S A;  3WC0 A;  3M2U B;  2ZWP A;  1KHW A;  2CAJ A;  3ZZR A;  5L1K A;  4OLO A;  3MMC B;  4C8Y A;  3MPY A;  3W8G A;  1XR7 A;  3IGN A;  2PA8 D;  1B64 A;  1D8Z A;  1HNZ F;  1FE4 A;  4WFN Q;  1YGY A;  1H2T Z;  3N5B A;  1DLO A;  5F8H A;  2UUC F;  2YWW A;  1RZM A;  1FKA F;  4XTT A;  1U26 A;  4PRF A;  4CLY A;  5B0E A;  3HVT B;  9ATC B;  5GMK a;  4M5H A;  3SZ2 A;  1M90 T;  4OI2 A;  3NWG A;  2VPZ B;  4Y2C A;  3VV2 B;  1KVI A;  1S79 A;  2HNY B;  1P6T A;  4DWI A;  3DU5 A;  1JLC B;  1RT3 B;  3MCO A;  5FLX Y;  3CPW R;  2MKK A;  3K89 A;  4ER8 A;  3MCS A;  4RW6 B;  3MM9 A;  3MTK A;  4KV8 B;  2W01 A;  4MKA A;  5K20 B;  3FDS A;  2HFV A;  1X4B A;  2JRS A;  2ROG A;  4Y2I A;  3BGR A;  2RQK A;  3US5 A;  4RW4 B;  5LT5 A;  2HYI B;  3GSD A;  4LRD A;  1L3V A;  3WQP A;  3DOK B;  4P52 A;  1VLY A;  2E5H A;  2FHO B;  4Z7Y A;  4ZLL A;  1KTV A;  1TK0 A;  1UEK A;  4PZV A;  2WAQ D;  4TYB A;  5IWA J;  1FDN A;  1S1T A;  2N7C A;  4HLB A;  4ZIT A;  2XBP A;  4RKU C;  2KXN B;  2CJQ A;  4HHU A;  1RTD A;  1MWQ A;  3PRD A;  2PMW A;  4K4U A;  5LOQ A;  2YBV A;  1NHU A;  4PG8 A;  5EWF A;  2OPR A;  2MKI A;  2CPZ A;  1MLA A;  3PHT A;  5CYM B;  2VFT A;  2BE7 D;  4JUZ A;  4IOB A;  1TMM A;  3GSI A;  1PSD A;  4DG1 A;  2H4W B;  2VB6 A;  3KLI A;  4XDC A;  1G6B A;  4ES2 A;  3CCU S;  4IO9 Q;  1U1L A;  1B3T A;  4DPT A;  2HZV A;  1YJU A;  4TNO A;  3UR0 A;  2FZG B;  3S8S A;  3TWZ A;  4J9P A;  4DUY F;  3BN7 A;  2YKN A;  2XS2 A;  1Q4R A;  2WZ1 A;  1FFS B;  1NSK L;  2RNE A;  5IOL A;  2N7Y A;  5BR8 F;  3IGV A;  1FDD A;  3NS6 A;  4ECR A;  3LP2 A;  3T5L A;  2XSJ A;  1KQG B;  2ZM6 J;  3S1T A;  3ZTQ A;  4DEZ A;  2Q1L A;  5AXM A;  3DLK B;  3TZZ A;  1Z1Z A;  4O44 B;  5F8G A;  1TU0 B;  3OSP A;  1YI2 S;  2JDJ A;  3NWR A;  1W25 A;  1CUL A;  2HRT A;  1X0P A;  4ZPV R;  4DV3 J;  1UWB A;  2OLW A;  3FKB A;  2V9K A;  4MJK A;  5ETM A;  5KG4 A;  5EWG A;  2XO7 A;  1FO1 A;  4PWD B;  3C6T A;  3D6T B;  5HP1 B;  1S0O A;  1UWA A;  2EK6 A;  4J7C A;  4G3I A;  1FEE A;  3KG1 A;  2C28 A;  1HR0 F;  2DGS A;  3Q89 A;  3MMB A;  4ID8 A;  4Q44 A;  4TN2 A;  3GZ7 A;  1SIZ A;  2HHH J;  4KFB A;  1TV6 B;  3DGP A;  4B3O A;  2BBE A;  3PIO Q;  3TNV A;  1YK9 A;  2DIU A;  4IH5 A;  5K5M A;  3U1N A;  1WEZ A;  1F5B A;  1ZAW A;  4RUB A;  4DI6 A;  5B09 A;  2ZZN A;  3EZ5 A;  5HSP A;  5F8J A;  1XTZ A;  3QO9 A;  3FBB A;  4MTP A;  2V34 A;  2VFU A;  4CLZ A;  4KH0 B;  3BGL A;  1H3D A;  4JI5 J;  2YNH B;  5HVG A;  1GTE A;  4PQU B;  1GXL A;  5L9N A;  2QMU B;  4U9R A;  1D3W A;  1V3Z A;  4LSL A;  1X4C A;  3BZQ A;  2YPZ A;  5E7O B;  5J2M B;  3EVW A;  3M9O B;  4LMZ A;  3PJX A;  3HDS A;  1ZOT A;  3CSK A;  2B5J A;  2LA4 A;  1HKA A;  2ZBC A;  4WWS A;  1EAY C;  1XQI A;  3BPS P;  5HO4 A;  3HJV A;  3D3C J;  1RAC B;  1S5Z A;  4ZCI A;  4CCH A;  3CJK A;  2D1C A;  4USM A;  4CP5 A;  4B3M F;  3IN5 A;  4EYI B;  4DR7 J;  5HVH A;  3CNQ P;  2FGO A;  3TJA A;  3U7J A;  1B4S A;  5DG8 A;  1VRU A;  5MAO A;  4P7T A;  2E7W A;  4DJB A;  1SJ3 P;  4EYH B;  5KFV A;  1C0U B;  3TEG A;  3ZZU A;  4Q8E A;  4U6P A;  2KZZ A;  2GHV C;  1OYE A;  2P9G A;  4FS1 A;  1YKW A;  3OFF A;  1KLN A;  1UVJ A;  2Y1R I;  4DUZ J;  5B0G A;  3QIP A;  5JVG Q;  4WJB A;  2IFX A;  3RB4 A;  2IIH A;  4LBH A;  2AJQ A;  1EET B;  3IO1 A;  1LXJ A;  2X3D A;  3VVU A;  1EX8 A;  2BJ9 A;  3RBE A;  3QBC A;  5B7W A;  2IMW P;  1S1W B;  1YZ7 A;  2G0C A;  4UOF A;  4KHR A;  3V6J A;  4WKY A;  1SUQ A;  1R0B G;  2G4B A;  4IFV B;  1WG1 A;  4PPZ A;  4YN3 B;  4N56 A;  4K4W A;  3OV7 A;  2NYI A;  1HQE B;  3BRE A;  1QAX A;  1RJJ A;  2GVZ B;  3ILL A;  3R6G B;  1RWV B;  2LCW A;  3PDN A;  2AKW B;  4OJH A;  1IR1 A;  1DAR A;  3EJM A;  3HHN B;  2OPP B;  4JI2 J;  2DT9 A;  2HRU A;  1M5H A;  4RLE A;  2W9A A;  5ITH A;  3PAC A;  3FSI A;  4TLR A;  3Q8Q B;  4I0W A;  5F41 A;  1FVQ A;  1D9D A;  4NAS A;  1PYT A;  1U24 A;  1WOO A;  3MI7 X;  4WP9 A;  1X4F A;  4DV5 F;  5L8R C;  4BLG A;  4CTA B;  4IOA Q;  5F0W A;  4NXN J;  3EXC X;  2V6A A;  3DLK A;  4UOH A;  4AE5 A;  3J7Y U;  3OT9 A;  2YNF A;  1N8R T;  2QLW A;  1MMN A;  2HAI A;  1NJX A;  4GVB A;  3MZI A;  4DL2 A;  1M1K T;  1DRZ A;  2FC8 A;  3L9Z A;  1NKE A;  2QN6 B;  4ZOS A;  3CCQ S;  1WKK A;  1XER A;  5EUH A;  2MQQ A;  1Q0N A;  1TAU A;  5IS2 A;  2J0X A;  1R8P A;  3CIM A;  4JV0 A;  4JI3 F;  4JV2 A;  2MLX A;  1NDL A;  4QW9 A;  4QIG A;  1NLK L;  1VQK S;  5D4L A;  1X31 C;  4QWB A;  1N5T A;  4L72 B;  2Z56 B;  1XMB A;  4J9L A;  5KFB A;  5A8R A;  3HT3 A;  3MEK A;  2YNI B;  2JLG A;  2XI2 A;  2AJ0 A;  2V4J B;  3MGJ A;  2VG7 A;  3KK3 A;  1B99 A;  2O3D A;  4M1K A;  3IBW A;  2M8D B;  3IS9 A;  4WFX A;  1BXN A;  1S57 A;  5KFF A;  5EHH A;  2KVI A;  5T14 A;  3NAI A;  2C3O A;  3T3F A;  1OS5 A;  4DQQ A;  2EFV A;  3VGV A;  1S6U A;  4LF4 J;  3GTY X;  5KAK A;  2DIS A;  4PQA A;  2LQJ A;  3IRX B;  1XNQ J;  4J9K A;  4MIB A;  4RW7 A;  1OY8 A;  1YHQ S;  4JI2 F;  1L3U A;  2AYG A;  2RDI A;  4M5L A;  4DL4 A;  2MQL A;  1QDU B;  1Y5L B;  2ZH5 A;  2Z0G A;  1MNE A;  3KUG A;  1V3R A;  2R8K A;  1VQO S;  4FNI A;  4C8L A;  3W2W A;  4XAK A;  4C3L A;  2R8J A;  3LF0 A;  1S6P B;  1IKY B;  2VG5 A;  4B17 A;  3J7Y I;  3V6H A;  2LU1 A;  3MCM A;  3QSY B;  1OYD A;  2B4P A;  5RUB A;  2E1C A;  2MQP A;  1JXV A;  4QWC A;  2CQG A;  2QA4 S;  3UCZ P;  3EPI A;  3NMR A;  4K0K F;  4O4G B;  3MMC A;  3T41 A;  2GZO A;  1YQH A;  4LF5 F;  2DH7 A;  3KKF A;  3QGH A;  1U02 A;  2FLP A;  3KG0 A;  4MAK A;  4UY8 5;  1LFP A;  1DTQ B;  3CD0 A;  2GGP A;  2NUU G;  3M8W A;  7AT1 B;  3S01 A;  3MR5 A;  1OSC A;  3I5C A;  4I2P B;  3MEE B;  2HEK A;  1FES A;  1YRT A;  3AOB A;  5C24 B;  1EIY B;  4LRE A;  3GMG A;  3R8Y A;  1RWX B;  2L9D A;  5B0C A;  4ECX A;  3CJ3 A;  3L95 X;  4P2X A;  4DPX A;  2J7W A;  2J6T A;  2RE1 A;  1SQF A;  2RF2 B;  2EG1 A;  2QE5 A;  1VHF A;  3KUE A;  1HWJ A;  4KYZ A;  2YQ1 A;  1OQ3 A;  3ZZZ A;  4QPX A;  5E41 A;  1T03 B;  3SCK E;  3E01 B;  1EP4 A;  1SBR A;  4DU7 A;  5J2Q B;  1FD2 A;  4LF5 J;  2MZJ A;  2APO A;  2DCU B;  2NXN A;  1HWK A;  3FGV A;  4OJ3 A;  2KT2 A;  4YR0 A;  2RHS B;  2NQP A;  1FWL A;  4B3T F;  3W2V B;  2HQD A;  2HG4 A;  4N76 A;  2ZHB A;  3ZZO A;  1SKU B;  1AZS B;  4X65 F;  1MMD A;  3P5B P;  1U1R A;  2I2Y A;  1N36 J;  2VAS A;  1C1C B;  3LP0 B;  3R97 A;  4C7Q A;  2KTQ A;  1MG7 A;  3JYT B;  5L9X A;  3RR8 A;  2CNL B;  5HBM B;  4MYT A;  2F3J A;  3H8Y A;  4DR5 J;  4JI8 J;  4ZCL A;  1C1B B;  2PD1 A;  1FFG B;  2WON A;  3PW7 A;  3CCW A;  3MM5 B;  1T9W A;  4J9V A;  5AXN A;  3HI9 A;  3KMS A;  1N34 J;  2XS7 A;  1F6T A;  2YX1 A;  2BVZ A;  1UVL A;  3T5H A;  3TI0 A;  3L09 A;  4EI2 A;  4ZVU B;  2NXJ A;  4JI0 J;  2LQ8 A;  4X4N A;  1RAD B;  1KHV A;  2V0N A;  4HTI A;  4LF4 F;  1SH2 A;  4FPI A;  3F73 A;  2DNR A;  2VG7 B;  3NCP A;  3DM2 B;  1NDK A;  4KGM A;  4DMZ A;  1WTB A;  5I42 A;  1BMQ B;  1FRL A;  2W7A A;  3IAS 9;  1EKR A;  2J6U A;  3FMW A;  4AXI A;  2C2M B;  1JKH A;  4M5I A;  3HMJ G;  3PV8 A;  1ULR A;  4LFA F;  2Y8W A;  4K50 A;  4OHW A;  4IYQ A;  3VHQ A;  4ID5 A;  3U02 A;  5BR8 J;  2A1B A;  1DQ9 A;  5FDL A;  3DRP A;  4WYW A;  4Q2L A;  2FJB B;  6AT1 B;  2RS2 A;  1XEZ A;  3ILO A;  4NA1 A;  3MFH A;  1PIE A;  2B4O A;  2XTJ P;  4EGL A;  1RT1 B;  1S49 A;  2GNK A;  2VPW B;  3D28 A;  2ZH3 A;  1ZZF A;  5SZT A;  2DGV A;  2I0X A;  4DR3 F;  2AQ4 A;  3N79 A;  1V9O A;  1S6Q A;  2AMC B;  4NPO A;  2G0J A;  1IQT A;  2MKC A;  2BE2 B;  4OYZ A;  5C2G A;  1F3F A;  2HGN A;  2OPP A;  2XMV A;  2IY5 B;  4PG5 A;  4X4U A;  2ZD1 B;  3MM8 A;  4LQ3 A;  3NRB A;  3TAQ A;  4RX6 A;  5D15 A;  4ZVF A;  2AGO A;  1U4B A;  4DSL A;  3M8Q A;  4HR2 A;  1HBO B;  5K8P A;  1MSW D;  4NLY A;  3PW4 A;  3AFG A;  3N6M A;  1IKV A;  3AXM A;  3BDE A;  3G4S S;  1N54 B;  4OHX A;  1WNE A;  5EX0 A;  5LMN J;  1WUU A;  2OI2 A;  2WVD A;  3I31 A;  4MIA A;  5JUM A;  5BJR A;  2AYB A;  1H72 C;  1R6Y A;  5AXK A;  3RRK A;  3ISN C;  2X3G A;  1WOS A;  1IBM J;  3TRG A;  4RWX A;  3JSR A;  2V68 A;  2F4V J;  1RT4 A;  1U0H A;  1PYS B;  3BM7 A;  5I3P A;  2RT3 A;  4Q0B A;  4U7U D;  2HRY A;  1XMO F;  1AA1 B;  1Q79 A;  4F3M A;  4YDX A;  1DZ5 A;  3GIK A;  1PJ6 A;  2V5H G;  5B0A A;  3B78 A;  4WP3 A;  2IPO B;  1EP4 B;  1C1C A;  1N5S A;  2EG2 A;  3LP0 A;  4QR1 A;  3FFI B;  3CJQ A;  1FWK A;  3ZZP A;  3R5D A;  3TUJ C;  4TLQ A;  2N82 B;  2LFV A;  4KGV B;  4UUX A;  1HMV B;  5A0Y A;  4YHH J;  4DV0 J;  3E8O A;  5JVH Q;  1UP1 A;  4JYA F;  1S1V B;  4A8Y A;  4O0I A;  3ZTP A;  3H2U B;  4E0D A;  3KJN B;  1HYS B;  5H9E J;  1RT4 B;  2XSF A;  3DXB A;  3B4D A;  4FS2 A;  5HLF A;  1KRP A;  2CJX B;  3LPE A;  2GA7 A;  4K0K J;  2B6A B;  1LWE A;  2W2O P;  3KG4 A;  3DGP B;  3TAM B;  3MUT P;  1ZM3 A;  4DPY A;  5EGY A;  4LFC F;  4B3O B;  3VZH A;  2R7T A;  3WIU A;  5GVQ A;  1IJF B;  2EFO A;  2K3I A;  3DOM A;  4M5K A;  4MT1 A;  3UFC X;  2HND A;  4L3K A;  2FZC B;  2ZKT A;  3LA0 A;  2E5G A;  3ZXW A;  3SYZ A;  4Z37 A;  4DL3 A;  3UD4 P;  1JLQ B;  4ELV A;  3FCH A;  5E2Q A;  1VOM A;  5D0H A;  2A10 A;  1X9S A;  1N0V C;  4PWD A;  2ZDP A;  2W9B A;  1TP7 A;  2LMI A;  3LP2 B;  1TV6 A;  3N0V A;  1JLF B;  3BR9 A;  1NKC A;  1X5T A;  5JJB A;  2LDI A;  3PEH A;  5MLC V;  1ZET A;  3H5X A;  1TVR B;  2RUS A;  2CPJ A;  3D0G E;  2IAJ B;  3OUY A;  3GCW P;  3TZW A;  3T1H J;  2R7Q A;  5AT1 B;  1YJ9 S;  1IKY A;  2VG5 B;  3M1V A;  5DGA A;  1LWF B;  1WAC A;  2BRK A;  3PKM A;  2DH8 A;  2O5D A;  1V6H A;  4ZVQ B;  4R8U B;  2AW0 A;  3DLG B;  3FJ2 A;  3C15 A;  1KVK A;  4NLT A;  1QLN A;  2AD9 A;  5K9F A;  1GNK A;  1SV5 B;  1XN9 A;  4JI4 J;  3QJJ A;  4DV3 F;  3OHB A;  1NPP A;  3FUY A;  1SL0 A;  2SXL A;  2KHD A;  2XMT A;  1F3V A;  2YKQ A;  4DV2 F;  4MH8 A;  2WK4 A;  3IP0 A;  1RLD A;  2H1Y A;  1FXR A;  1FXD A;  4RO0 A;  4RW9 A;  4USI A;  1NJY A;  4LSN B;  1U1P A;  3PHE A;  1A7G E;  5HLF B;  4B9L A;  1XWL A;  4GKJ J;  2ZH9 A;  1EB0 A;  3VTI A;  1VYA A;  2OHD A;  2HHV A;  1F2G A;  4OZ3 A;  3GYN A;  2GVD B;  4KPC A;  1SIW B;  1SXL A;  3LAK A;  4V19 X;  3HJF A;  4JV5 J;  4AD6 A;  1DTT A;  2JHE A;  3PR5 B;  1FX2 A;  3KMQ A;  1SC3 B;  3HHK A;  3H2V E;  2OEL A;  3CO9 A;  3T1Y F;  4QPT A;  3LP1 B;  4USV A;  1U2C A;  2B7B B;  3EDR B;  4ZVG A;  4X64 J;  3Q83 A;  3BQ0 A;  3MM5 A;  1N32 J;  1KFD A;  4DR1 F;  4K2J A;  1RHU B;  3LWL A;  1U2F A;  3D6H B;  3MM9 B;  4FXD A;  3HVT A;  1LNQ A;  1U6F A;  4PKD B;  3KLE A;  3PX4 A;  4Q8F A;  3CC7 S;  2DXF A;  2QMW A;  3M6W A;  4A4J A;  2NYH A;  3AT1 B;  3ZZ0 A;  1X9M A;  1UVN A;  2YNG B;  2UUA F;  1SH3 A;  1WF1 A;  2HNY A;  3FRY A;  4LBP A;  2XY5 A;  1ELO A;  1PJ5 A;  4FVC A;  1G2E A;  2VF3 A;  4DCP B;  3DHW C;  2M70 A;  3O5T B;  2DNZ A;  2EKY A;  2QA1 A;  4F4K A;  3MOJ B;  1S0V A;  1VGY A;  4J91 A;  1S76 D;  2HHW A;  3R2C J;  3PKY A;  4CO1 A;  5JXS A;  1B70 B;  4S0M A;  3LOU A;  4J9O A;  3RYL A;  2R42 A;  1RBA A;  3QNW B;  4KB7 A;  4ZPT R;  4FF2 A;  1VQ6 S;  3KNA A;  1T02 A;  5CCM A;  5AJ3 F;  4IFV A;  3CCV S;  4CLW A;  1TKT B;  4F50 A;  2MKH A;  3A3O B;  3MAQ A;  5CYQ A;  4CH1 A;  2G1H A;  4JBC A;  4UOG A;  2O1P A;  5FD1 A;  2CVI A;  3Q8R B;  1I6J A;  4EZ9 A;  2JC1 A;  3GB0 A;  4FF3 A;  1FE0 A;  1RWP B;  2A6M A;  2AX1 A;  2F8M A;  2KJW A;  1HMV A;  4LUB A;  5A0Y B;  3N6L A;  1WC4 A;  2GHW A;  2WCX A;  3KDO A;  4HI2 A;  5D4O A;  3I0S B;  5CH7 B;  2UXB J;  4FYX B;  2B4V A;  1AXQ A;  1JNZ B;  1MWY A;  3A13 A;  4G1I A;  4AFF A;  5I3U B;  2XMU A;  1EET A;  1LOU A;  2AJ4 A;  2GIR A;  2VG6 A;  4NZ0 A;  3ETO A;  3TX8 A;  4IDK B;  2XGP A;  2W9B B;  1VRU B;  3ENV A;  4NRU A;  1T3N A;  5IT9 Y;  4C98 A;  1Q5V A;  2GIQ A;  2V2K A;  3DC2 A;  3DI6 B;  4ZVP B;  3E2E A;  3DGV A;  3DRR A;  5D0E A;  5J1N A;  2XG8 A;  2JJ4 D;  4CM2 A;  4R5P B;  4IG0 B;  3PJ9 A;  4EZ6 A;  3DLJ A;  3HZG A;  1R3N A;  1T11 A;  4DV6 F;  1FDB A;  5A2Q U;  1VQY A;  3NGS A;  4CIO A;  5DM7 Q;  4DSI A;  2D41 A;  2CQ1 A;  2KYX A;  2CQ4 A;  4I4B A;  4YB6 A;  5K14 A;  3P6Y C;  5ETK A;  5E3A A;  3HHD A;  3TO8 A;  1G4C A;  3GIR A;  1K1Q A;  2B0G A;  1GX6 A;  1HD0 A;  1Z2Z A;  2JNJ A;  4F8R A;  3OW2 R;  3FMB A;  1ZYQ A;  3VQT A;  5DO2 A;  1NJZ A;  2JEF A;  2KYZ A;  5HL7 Q;  4Z2X A;  4NZ7 A;  1NM2 A;  3R9L A;  1I3O B;  2CIM A;  3BGU A;  3VAL A;  1S1X B;  4FKX A;  3MED A;  1X4D A;  4LSL B;  4X64 F;  2ZH4 A;  1N32 F;  3Q2T C;  1UPP A;  4PQU A;  3M8Y A;  4F2S A;  5I3U A;  1HBN A;  1IWA A;  3CJT A;  4WE1 A;  4OYI A;  2GJI A;  3D54 A;  1RA7 A;  3W65 A;  4JI7 J;  4KGK A;  4GC6 A;  2B3T B;  4OX7 A;  4ZIW A;  3NAH A;  4FYY B;  1WDT A;  3UDV A;  1UWB B;  1VQP S;  1H38 A;  3PRV A;  3RBZ A;  4ZVE A;  1CQN A;  4D3G A;  2OML A;  3CUN A;  3Q23 A;  5GMD A;  2E5J A;  2XZD B;  3DDK A;  3LGN A;  4FPR A;  1R6V A;  4P7V A;  4ZN1 A;  5K8O A;  1A6L A;  1RSC A;  1U09 A;  4FN5 A;  4I67 A;  2C3U A;  5DDP C;  2HFZ A;  4F36 A;  4LR9 A;  1FK9 A;  5L1L A;  1VHI A;  4MKY A;  1Q5Y A;  2XSJ B;  4JI0 F;  2RB7 A;  2BQR A;  4H4K A;  4A8Q A;  1NK4 A;  1BGX T;  1QE1 A;  2QZ8 A;  2BM0 A;  1HHQ A;  5L46 A;  2GAH C;  2X1B A;  5KT7 A;  1U7L A;  1YJR A;  3CCZ A;  4RNF A;  4O0N A;  3I82 A;  1IKV B;  1RKI A;  4HHJ A;  1MU2 B;  2QT7 A;  1HBO A;  4CM0 A;  2CNN B;  2CQI A;  1LW0 A;  3WIV A;  4CI0 B;  3C46 A;  4C9D A;  4AL7 A;  2G1D A;  2CPI A;  4RW8 A;  3W61 A;  4DQR A;  2HQI A;  2LEP A;  3K5L A;  4PUO B;  3NKY A;  2NZC A;  4I6W A;  4LIW A;  1FJG J;  5ETT A;  4CNY A;  3CCS S;  4F04 B;  2WBR A;  1ZM9 A;  3BJY A;  4IOC Q;  3D67 A;  3ZNJ 1;  5HMX A;  1LWC B;  2OFH X;  3EVO A;  1REV B;  5ETL A;  1SKW A;  2MYF A;  2QLF B;  3OTC A;  2LA6 A;  3I32 A;  4CO3 A;  4ZCM A;  1JX4 A;  2J0Q D;  1N6Q A;  2AGP A;  4LFC J;  1SJ4 P;  1OY6 A;  3DOK A;  2VON A;  1NSA A;  3T9N A;  4ZMM A;  3CMQ A;  2RDD A;  3AB2 B;  3TJ8 A;  1C1B A;  2BEF A;  1BUX A;  2CUY A;  3ISN D;  4QIE A;  4ZP8 A;  3HVR A;  4DR3 J;  4ECZ A;  2DVI A;  3AD7 C;  2MPU A;  5H9F K;  1RWK B;  4RW9 B;  4MFB A;  1WSR A;  1PO6 A;  3PO4 A;  4NLS A;  4RNN A;  2CZ4 A;  2MZS A;  3WZ0 A;  2HS0 A;  4N5S A;  2UUB J;  3QAE A;  1U1N A;  3BSO A;  1NZ8 A;  2DXE A;  2RS8 A;  2QMX A;  3HHL A;  5K14 B;  2MLZ A;  1FVS A;  4C8K A;  5GAD I;  2BUN A;  3HHE A;  3SQG A;  3CJ4 A;  3IM9 A;  2W7O A;  2GQC A;  1Y0H A;  2Z2Z A;  2ZNY A;  4M63 A;  2QLJ B;  1SI9 A;  4DUT A;  1NH8 A;  4ILL A;  3C8Y A;  3IBF B;  2B5J B;  2HLT A;  3O2I A;  3NNC A;  3N4W A;  2M5Y A;  2XHW A;  3D7S B;  1FJE B;  1TFY A;  3SV3 A;  1U1M A;  2BA9 A;  2MSS A;  4ZVT B;  1NUE A;  4FVM A;  1GMW A;  5KOX A;  1Z4U A;  2WOM A;  2O01 C;  3CCL S;  1RYS A;  1H0H B;  4M94 A;  1D1U A;  3VGU A;  3CGI A;  2VPX B;  2ZNZ A;  3BGF A;  3CIZ A;  4ZP7 A;  5L38 A;  4K4Y A;  1QJH A;  2B8P A;  2DBB A;  2D74 B;  2RF2 A;  2F63 A;  2H54 B;  3BKT A;  3NXZ A;  3OFE A;  3W62 A;  1S9G B;  3LWM A;  1CPZ A;  3KFW X;  3M2R B;  2RUG A;  4I7F B;  4LBI A;  4P2M A;  3LH2 S;  3C6U B;  3MFI A;  2XMM A;  2DD8 S;  1CQM A;  1U8W A;  5D78 A;  4EO6 A;  5L39 A;  1R8H A;  3HT0 A;  1Y3K A;  2JVO A;  3HSG A;  3RU0 A;  2CA9 A;  2GAG C;  3GIL A;  1N5Y A;  1VRT B;  1RBL A;  2BAB A;  3ADA C;  4U7U K;  3J80 U;  4LF7 F;  4KJI A;  1M5V C;  3H40 A;  4B3T J;  1APS A;  2L3M A;  3G6Y A;  1WEY A;  3C6U A;  4FXW A;  4USH A;  1V5I B;  2JC0 A;  1V3S A;  4ZPA A;  2DY9 A;  3MEG A;  3NS7 B;  5DQI A;  2Z30 B;  5J2N B;  2BAN A;  3PNI A;  3SSS A;  4NL5 A;  5IT9 U;  2W2Q P;  4WYL A;  3W2W B;  4X66 F;  3U1L A;  2QYG A;  2CZ9 A;  2GO8 A;  3GJR B;  1NJW A;  3I9Z A;  2MGZ B;  5L1I A;  4FYV B;  3P4U B;  4DOZ A;  1BE4 A;  3G82 B;  4DDF A;  5K8N A;  2UXD F;  4X62 J;  1Q81 T;  4DLG A;  4AT1 B;  1WDD A;  2B9Y A;  2HVD A;  1NSP A;  4B3S F;  4ZVS B;  4NI2 A;  2RRA A;  5DDO C;  3VAH A;  2AGQ A;  2ZOM A;  1FRM A;  3IRX A;  3P3D A;  2AJ2 A;  5HQL A;  3QGP A;  1WG5 A;  1RU2 A;  2L9N A;  1T05 A;  3LP1 A;  3A12 A;  3GCX P;  1URN A;  1TK5 A;  1T94 A;  3R7N B;  5A8R B;  5IT0 A;  3GP9 A;  2R9L A;  3GG0 A;  1A0O B;  1REV A;  3BS9 A;  3CVK A;  3W9H A;  4CNZ A;  3POT A;  2XUL A;  1LWC A;  2BJE A;  1X60 A;  1VQS A;  4MMO A;  4RJV A;  5LSO A;  2KFY A;  1XK8 A;  2NUH A;  1WTF A;  5IXU A;  2ZHA A;  3VZI A;  4YB5 A;  2V8D A;  4HAC A;  4TU9 A;  2R2R A;  4NLV A;  1N6Q B;  4PUO A;  2NS1 B;  2CJB A;  2IJN A;  3M32 A;  1F2H A;  1EZZ B;  3EZU A;  5LXR A;  1OSD A;  1NZA A;  1FCA A;  2ZKU A;  3NEK A;  2RIJ A;  1B7Y B;  1F5C A;  1QUV A;  4KGZ B;  2KFN A;  1RT6 A;  3T5J A;  2RDJ A;  3MM8 B;  1NHV A;  2P5V A;  2E66 A;  2FJD B;  2VU5 A;  3MPD A;  4OJG A;  1JB0 C;  1IXK A;  1M0S A;  3TW0 A;  2XLI A;  2XNR A;  2NSC A;  1HNI B;  2J5A A;  1Q16 B;  3K5M A;  2U1A A;  2R7V A;  1NK5 A;  2CQ2 A;  4M5J A;  3RW7 A;  1OPZ A;  1UEU A;  3FVY A;  1U49 A;  1JJC B;  1SV5 A;  3FBF A;  4NYZ A;  5K8M A;  1S10 A;  2DNP A;  4KT0 C;  4CH7 A;  2HHP A;  4N8O A;  4X62 F;  1X4E A;  2BMB A;  2GVZ A;  2XYG B;  4EK2 A;  3SDE A;  4CDI A;  2V2Z A;  4DUY J;  1BQM B;  1LK7 A;  1QY7 A;  2FGC A;  1SJF A;  4HTJ A;  3AJD A;  1LWF A;  2BW2 A;  2LXF A;  4LRA A;  1DY3 A;  2B7C B;  2X7I A;  2ZC4 A;  4GVB B;  1N88 A;  1JKH B;  2FJA B;  1UJ6 A;  4LF2 A;  3MXH P;  1CJT B;  2ZC3 A;  4J9U E;  4JI3 J;  3R2D J;  3W9I A;  2MXY A;  1FFW B;  1RHQ B;  5H1S V;  2UU9 J;  1WJ9 A;  2R7O A;  1H2U X;  3FRZ A;  2LDY A;  1FWP A;  3TQE A;  2J9C A;  3OTD A;  3IFE A;  2H3E B;  3MD3 A;  2CKW A;  2KKH A;  4NEZ A;  5C25 A;  1MRO A;  2JVR A;  2HVH A;  1VQM S;  2YKM B;  2FHM A;  2POK A;  4JB8 B;  3RJM B;  1S59 A;  3PYF A;  5KFP A;  4RZR A;  5IV3 A;  2V63 A;  2EC2 A;  3FZB A;  2B9W A;  4EO8 A;  3IR6 B;  4K4X A;  2MMY A;  3CJ8 A;  3HO1 A;  3QJP A;  2CPF A;  2C1E B;  2RVJ A;  2HHH F;  4DL5 A;  2DPJ A;  3Q24 A;  3DCA A;  1B0P A;  1NCL A;  2GX8 A;  2CPE A;  2FHJ A;  2HQG A;  4OI6 A;  4Y0F A;  5GAH I;  1YBT A;  2XWY A;  4C0B A;  1TUG B;  1HR0 J;  3Q86 A;  2JSX A;  3AQO A;  2YWH A;  5F3T A;  4KKO A;  2DHH A;  1SL2 A;  2KRB A;  3CCJ S;  3R1H A;  1WKL A;  5D3G B;  2UUW A;  1TKZ A;  5IM0 A;  2KDO A;  3HUL A;  3IAM 9;  4PG7 A;  1RAG B;  4YUD A;  1V5V A;  2DR8 A;  2HLU A;  1BD6 A;  5CHC B;  4DU8 A;  1S12 A;  3MWB A;  2VBX A;  2AHO B;  2V2V A;  1PBA A;  4IH6 A;  2R7R A;  1S0M A;  1HI8 A;  3HSZ A;  2ACM A;  2GML A;  2HFN A;  3I96 A;  3QZ8 A;  3R5C A;  1A9N B;  5KFE A;  3GJS B;  4CLK A;  2CAD A;  2FDN A;  2DB1 A;  2W2N P;  3JTP A;  2LLZ A;  5BYQ A;  5KG1 A;  3K8W A;  4BC7 A;  2YTC A;  3MMA B;  2CPD A; 
#chains in the Genus database with same CATH homology
 4FKX A;  3B54 A;  1PAE X;  2HVE A;  2CWK A;  2DYA A;  3FBE A;  3VVU A;  3Q8Y A;  1MN7 A;  3VGT A;  3ETM A;  1BE4 A;  4UOF A;  3BBC A;  3EVM A;  2HVD A;  1NSP A;  3FBC A;  3NGT A;  3VGS A;  3PRV A;  1NDP A;  1PKU A;  1K44 A;  3B6B A;  1F6T A;  3ZTS A;  3EJM A;  1HLW A;  3GP9 A;  4F36 A;  3GPA A;  2AZ1 A;  3EE3 A;  3DKD A;  1NDK A;  1BHN A;  1HHQ A;  3EIC A;  4ENO A;  4UOH A;  4O0N A;  3L7U A;  2BX6 A;  4AND A;  1NPK A;  1VYA A;  1NB2 A;  1W7W A;  4KPC A;  3WX8 A;  3NGU A;  2VU5 A;  3MPD A;  1WKK A;  4ANE A;  1NDL A;  3Q83 A;  3EM1 A;  1NLK L;  3Q8V A;  2NCK L;  3EVO A;  3NGR A;  1F3F A;  3FBF A;  1ZS6 A;  3ELH A;  2DXF A;  3FC9 A;  5BXI A;  1NSK L;  5IOL A;  4EK2 A;  3ZTO A;  1B99 A;  3EMT A;  3VVT A;  2HUR A;  4F4A A;  2BEF A;  1BUX A;  1NDC A;  4HR2 A;  4C6A A;  1S57 A;  3ZTQ A;  1UCN A;  4WBF A;  1WKJ A;  2B8Q A;  3VGV A;  5C7P A;  4S0M A;  3FKB A;  2DXE A;  3FCW A;  3G2X A;  5CAA A;  1HIY A;  3Q89 A;  4ANC A;  4DUT A;  4UOG A;  1XIQ A;  1S59 A;  3BBB A;  4FKY A;  4DI6 A;  3ENA A;  1NUE A;  1JXV A;  3FBB A;  3FCV A;  5CAB A;  1NCL A;  3BBF A;  2ZUA A;  3JS9 A;  1KDN A;  4W98 A;  1EHW A;  3VGU A;  1NSQ A;  3Q86 A;  2B8P A;  1MN9 A;  3EVW A;  1WKL A;  3BH6 B;  1XQI A;  3ZTP A;  3DDI A;  3PJ9 A;  1S5Z A;  1U8W A;  3NGS A;  4CP5 A;  2AZ3 A;  1NHK L;  3Q8U A;  2DXD A;  3BH7 B;  1B4S A;  3ZTR A;  1LEO A;  4DZ6 A;  3R9L A;  2DY9 A;  1LWX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...