3MURP

Crystal structure of the c92u mutant c-di-gmp riboswith bound to c-di-gmp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical determinants of ligand binding by the c-di-GMP riboswitch .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3murP00
2CPFA 2CPXA 1OIAA 2E5JA 3G8TA 3TP2A 1VQ5S 1S79A 3CMES 1YHQS 1X4AA 5H1SV 1WF1A 3DLLQ 2DNRA 4W92B 2M0GB 3CCSS 1G2EA 3CC2S 1KOHA 1SXLA 2E44A 2U1AA 1SJ4P 4TU8A 1UP1A 1WWHA 2ADCA 2MHNA 3MI7X 2DISA 2RS2A 2UP1A 2MSTA 4LIRA 2X1FA 2MY7A 2DNHA 1M5OC 3UWTA 4C7QA 2KFYA 3VAGA 5DM7Q 3S7RA 1WHYA 3G6ES 2VODA 2XSFA 1QVGR 4BS2A 3SDEB 2OJ3A 1L3KA 2L9WA 1OWXA 2OTLS 1U1RA 2VOPA 3ZZYA 2GHPA 2RT3A 2DGXA 2B0GA 1YI2S 1SJFA 5CYJA 4TU7A 3MXHP 2CQIA 3IWNC 2J76E 2N7CA 1JJHA 1YJNS 1VC0A 2DGQA 2AD9A 2KM8C 5LSOA 5DETA 1K9MT 4WIIA 1M5KC 1X4EA 1M90T 1U6FA 2KRBA 1RKJA 2M2BA 1R8HA 3U1LA 2JVRA 2KRRA 5IM0B 1WG5A 2CQCA 2MXYA 3VAIA 3CD6S 3SMZA 4CH0S 1WHWA 5JVHQ 1ZZFA 3G96A 2MJNA 2RUGA 2N3OA 4TLQA 2DB1A 3CMAS 1WEYA 3EGZA 5ITHA 5GADU 2LEBA 2LXUA 4WCEQ 1F9FA 5HO4A 3B4MA 1VBZA 2RNEA 3I55S 2MYFA 3G9CA 4ED5A 1A9NB 1ZZNA 2M7SA 3RW7A 3MD3A 1X5TA 2AYBA 3K0JA 3CCVS 2XNRA 3S01A 1UFWA 2VONA 2DGVA 2MKIA 2D9PA 2XS5A 5FJ4A 2DGWA 3Q2SC 4Y00A 2KI2A 2J8AA 5JVGQ 1UAWA 1U2FA 4EGLA 3FEYB 2CQ2A 1WF0A 3N9UC 3CC4S 4A8XA 2LMIA 5GMKa 1S72S 3BS9A 1FHTA 1N54B 3VALA 2HYIB 2MZQA 4WF9Q 3J7ZT 1HD1A 2CPZA 2DHAA 3CTRA 2E5HA 4F26A 1Q81T 2VOOA 5LSLA 3NMRA 1N52B 1WELA 2DO4A 4Z2XA 4F02A 3S8SA 2XS7A 1DBDA 3G8SA 2DGOA 2V94A 2J0QD 4QQBA 2DITA 4CIOA 2CQ1A 4QU7A 4YUDA 4V19X 3UD3P 2LKZA 4PR6A 2NLWA 2MKJA 3CCUS 1X4DA 1P27B 3US5A 3G4SS 2ADBA 2EVZA 3NS6A 2CJKA 3ZZZA 1JMTA 3TYTA 5LJ3Y 1U1OA 4WFBQ 2MQOA 1W2BR 1WHXA 2MSSA 3CULA 2CQGA 2HGLA 3CXCR 2DK2A 4PRFA 4U67Q 1DRZA 2MMYA 3FEXB 3MUVP 3B4DA 1NU4A 4F25A 2YTCA 3CCRS 1WF2A 2FC9A 2DH7A 2DNGA 2O3DA 3VAFA 3R1HA 2MGZA 5CA5A 1VQ8S 2QA4S 2KG0A 1VBXA 1FXLA 1VQ4S 2DH9A 1K8AT 2DNOA 4IOAQ 1U1MA 4Y0FA 4YOEA 5D78A 3H2VE 3HI9A 3V4MA 2MB0B 3TO8A 1VQOS 2KHCA 2OSQA 1JJ2R 2LA6A 1U1LA 3BO4A 2MPUA 4IO9Q 2MZRA 2DNKA 2DGSA 1A7GE 2HGMA 2KH9A 5CXTA 4TU9A 2DNMA 1OPIA 2CPEA 4J5OA 3P3DA 3VF0B 2N3LA 5LJ5Y 3MURP 1B7FA 2DIVA 2KYXA 1U1PA 5DDRC 2KM8B 2JX2A 3SXLA 1KD1T 3OW2R 1VQKS 3P49B 2KXFA 2KT5A 3IRWP 3UCGA 5EN1A 3CCMS 1JJ4A 3PIPQ 1H2UX 2MKHA 3CCES 2EK6A 4WFAQ 3SDEA 2MQQA 2E5IA 3HHNB 4FXWA 2DNYA 2MJUA 1WEZA 2KU7A 2Q79A 2DGTA 2M70A 1QVFR 3Q2TC 1HA1A 2XB2D 4ERDA 2DHSA 4W90B 2F9DA 2QFJA 2NZ4A 1ZH5A 5GAEU 1Q7YT 1X4GA 3PIOQ 1M5PC 1IQTA 1H2TZ 1YWXA 1UW4A 1X0FA 4IUFA 2E5GA 5LXRA 2HVZA 1VC5A 1WEXA 4QPTA 4WFNQ 2G4BA 2LECA 2RQ4A 2XNQA 5IM0A 2DO0A 2MZJA 1AUDA 1FT8A 5MLCV 3THPA 2ZJRQ 3VAHA 2CPIA 2RS8A 2GO9A 1U1KA 1CVJA 3MUTP 2X1AA 3U1MA 1VC6A 4YB1P 2M8DB 1NJIT 3UD4P 3VAKA 1WG4A 3UCUP 2A3JA 1WG1A 1URNA 2X1GA 1X4HA 1VQMS 2L41A 2HZCA 2KXHA 2FY1A 3CUNA 5IQQA 1VQLS 2M8HA 2LYVA 1OO0B 4P6QA 1P1TA 5DDPC 2KN4A 3L3CA 3UCZP 1O0PA 3ULHA 3JB9k 3DXBA 2DH8A 1VBYA 4UQTA 3NS5A 1U6BA 3LPYA 3BEGB 2D9OA 2PE8A 2KXNB 4OZ0A 2OIHA 1YTYA 1PO6A 1YJ9S 2YKAA 4FXVA 1XN9A 2ZJPQ 2JVOA 2F9JA 1YITS 2YH1A 3R1LA 4C0OC 5HL7Q 2AYGA 1D8ZA 3H2UB 3MDFA 3G71S 1U1NA 5GAGU 2MZSA 2K8GA 1X4CA 2WBRA 2FC8A 2U2FA 1R8PA 3D2WA 1VQ7S 3CCLS 2DIUA 2XS2A 2KVIA 1FJ7A 1X4BA 2FPHX 3R27A 3P5TL 1FJCA 2RU3A 1FNXH 1FJEB 1M1KT 2CQ3A 3VAJA 2DNQA 1RK8A 2M9KA 2ZJQQ 2LA4A 2RQCA 1X5PA 1KOOA 2BOPA 5DM6Q 2JRSA 1WI6A 1WTBA 2M88A 2HGNA 3MOJB 2N82B 2LEAA 3J7YU 2BZ2A 4CQ1A 1WI8A 1X5OA 1SJQA 1HL6A 4RU2A 2LXIA 3NNAA 2I38A 2CQ0A 1SJ3P 1QM9A 2RRAA 3RW6A 5BJRA 4C4WA 4PKDB 4LMZA 3UE2A 1SJRA 2CPDA 2MQNA 1K73T 1H2VZ 2MKKA 1X5SA 2MQPA 5LXYA 5GVQA 1PGZA 5DDOC 3THTA 2DNLA 2CQDA 1WHVA 1DHMA 3S6EA 2MY8A 2DGUA 4UY8T 2CPJA 2F3JA 2I2YA 5IFMA 3BO3A 4OZ1A 2CPYA 1VQNS 3BO2A 2CQPA 1VQ6S 3NNHA 3NNCA 2DNPA 2ERRA 4M5DB 1VQPS 2CQHA 2SXLA 2JWNA 2OTJS 1NO8A 2DNNA 1YJWS 3P6YC 2MKCA 1D9AA 3CCJS 2G1DA 2X1BA 2LQ5A 2QEXS 2CPHA 2CQ4A 2CQBA 1DZ5A 2J0SD 3CCQS 1Q82T 2MZTA 3LQVA 5D77A 1HD0A 1X4FA 3MD1A 1KC8T 2MZ1A 2YH0A 4IOCQ 2AYEA 4LJMA 2DHXA 3EX7B 1KQSR 1BY9A 2M52A 2PEHA 2RRBA 1H6KX 1FO1A 3I56S 2D3OR 4ZKAA 1Q86T 1M5VC 2MKSA 2AYMA 2OSRA 2L08A 1N8RT 3VAMA 4WKRA 3EGNA 2KG1A 1N88A 1VQ9S 2MQLA 1YIJS 2DHGA 2M4MA 2MQMA 2MGZB 3CF5Q 1U1QA 2EK1A 3CC7S 2RVJA 5DDQC 2YWKA 5GAHU 4CH1A 3CPWR 2FHOB 4QU6A 2G0CA 2DNZA 3MUMP 2K3KA 2LCWA
chains in the Genus database with same CATH superfamily
2VF3A 4ILMA 3HJVA 1YHQS 2CJQA 4DN0A 3QATA 3NWGA 3MI7X 4K4TA 2KKHA 3QZ7A 2R8KA 2E7XA 3PX6A 3MGJA 4G6VB 2WHOA 4YR3A 3MMBA 1SIWB 2CVIA 2QL5B 2OJ3A 3MEDA 2KFNA 2QYCA 3M6VA 3Q8YA 2BUNA 2E1MC 4TU7A 2UXCJ 2IC3B 5HJYA 3SQGA 1NB7A 2IBKA 1Z1ZA 2IDLA 4Q0BB 1QAYA 5JVHQ 1QLNA 4NMXA 4WP8A 2EFQA 3ZTOA 3V81B 5AXMA 3L9ZA 1S1TA 4X65J 1VBZA 3G9CA 2MYFA 4LF5J 1A9NB 4QZVB 2B8PA 3C19A 2BJDA 4AYBD 1QTNB 2D9PA 1Q0NA 2XS5A 3Q83A 4ED7A 4B9LA 4B3MJ 1O5JA 2C3MA 4IQXA 2OPQA 1LW0A 3KNGA 2IVFB 2D3UA 4F0MA 4LF8J 1N54B 1SL1A 4IG3A 3FRYA 3TRGA 4C3MA 4P2FA 2Z56B 2VOOA 3RB4A 1N32F 4W4MA 2XI3A 1WC5A 1FXRA 2IY5B 3OTOF 1RAOA 1S1WB 4DL3A 5KOWA 4M5GA 4PR6A 2MHEA 3GFHA 4A8FA 2MQOA 3PRDA 3P8BB 1E6VA 3JYTA 2A2DA 3LO3A 2D69A 2UXBJ 1QSYA 1WF2A 6FDRA 2DH7A 5KFNA 3RUBL 3W5ZA 3KLEB 1RBAA 4WU2A 1Z4UA 5FD1A 1FXLA 4JI5J 4DV0F 2R7OA 1CULA 1RTIA 3X3UA 3A3NB 1DURA 3HT3A 3OQ2A 2R7VA 3ZZTA 3PW4A 1NK8A 3IXQA 4J9RA 2CPEA 5KT3A 3MURP 2VJVA 1TAUA 5EX3A 4IRCA 4OYBA 2WAQD 2GVDB 2LQ8A 3CCMS 1KVKA 1C1CA 2MKHA 4DQIA 4LF6J 3HHNB 2Y0BB 4ELTA 2YNGA 1N4LA 1RAEB 1YX2A 2F9DA 4D3HA 2QZ8A 2NSBA 1VC5A 2HW3A 1SPBP 3I0RB 1WKLA 2ZM6J 2QA4G 2B6AA 4QW8A 4KGMA 2RS8A 4JI7F 2M8DB 1B64A 2XEXA 4FVCA 4LSLB 2RMLA 4URSA 1ZAWA 2XWXA 4RO0A 3RAMA 1WC0A 5D8HB 1X8DA 1VHFA 1TMMA 1R31A 3BB5A 3T6BA 4UOHA 1RWMB 3CJ5A 4B3TF 3K59A 3AA8A 3IMQJ 4J91A 2IDEA 3RGIA 4I6YA 2DT9A 2CVEA 4ANEA 5JUMA 3KG4A 3UQSA 5JMNA 5K8PA 2ZD1B 5D4NA 1NK9A 4YFUA 1NH7A 1OPZA 2DNQA 1IR1A 2M9KA 3LP2B 2AEJA 5HSPA 5HVHA 2FQQB 3U02A 5A2QY 4MIBA 2ALYB 3CO0P 2QA1A 2B8QA 2G0JA 4NEZA 4C0BA 1CJKB 3MCOA 2I38A 1LXJA 3OR2B 1KEKA 3DU6A 4R5PA 1RT4A 3AJ2A 5KFVA 1KLNA 3IBFB 5L8RC 3L7UA 3LALA 2GIRA 1NPRA 1H38A 2OKQA 1VQNS 2GS8A 3HULA 4UOGA 3N6NA 4DV2J 2BE9B 3LQVA 1CLFA 3GP9A 2V67A 1FTCA 1RA6A 4IOCQ 2AYEA 3CB4A 2ZKTA 3DLEA 3KG0A 2HFSA 4UW2A 1LK7A 1Z2ZA 2HZVA 1HNXJ 3DM2A 1JLAA 4URQU 3PX0A 2FVQA 3M6WA 2Y0SD 4L3KA 3FUYA 1WF1A 1LWXA 3QPIA 4USTA 1YLXA 2C2RA 3GLJA 3DI6B 1DQ9A 2KFYA 4RW4A 3S7RA 1MN7A 1UFKA 3LPEA 2VPZB 1JLQB 3MPUB 1SJ1A 3H98A 2B9WA 5KG1A 2HQ3A 3BM7A 1AA1B 2GAGC 2P6TA 1GTHA 1C0TB 3MAAA 1G1XA 3D1OA 1Y7PA 1NNDA 2M2BA 3HD2A 3UNYA 2KRRA 3BGFA 3SCLE 3B6BA 1Y5NB 1IBLJ 4LBIA 1U0HA 4JI8J 1VHIA 3EGZA 2HFNA 5HO4A 2XZWA 2F5GA 3DOKB 1A6LA 3MWBA 3H7HB 3F73A 2ACYA 1PILA 2DXFA 3PG9A 3C3LA 3PYEA 2W9CA 4OJGA 3BQ2A 3C6TA 3NCPA 3M1VB 3RBDA 4OZNA 2HHHJ 4CYUB 3EVWA 2RHSB 3E01B 2BR0A 4CCHA 1PCAA 4U6PA 3DRPB 3DRYA 2L9NA 4USKA 1YBAA 4F26A 1YG0A 3D6TB 3K5NA 2A18A 1YRUA 4IR1A 1YKWA 4RW9A 2YKMB 3PRBA 2NLWA 3H59A 5HP1A 2WSCC 2ADBA 1N0UA 2CJKA 5LJ3Y 4LSZB 4OL8A 4C3KA 2MSSA 2ZHBA 5DGAA 3M8QA 2APOA 1Y0HA 1BHNA 2NPIA 2G2OA 2AJQA 2QA4S 4FBTA 3BR8A 2BE7D 2AEFA 3H2VE 3MMJA 3V4MA 2OSQA 4OV1A 1KNZA 4DR7J 2HFZA 1Q1KA 4ZK7M 3B8HA 3BZQA 3MR2A 3KK2B 4CRJA 3DXSX 4C48A 4J5OA 1LWFA 2DIVA 4LR9A 4MK8A 4B9NA 2KT5A 1DY3A 1F5BA 1JJ4A 1H2UX 3CCES 1V5VA 3R5DA 5LMNF 4RWXA 5A8KA 2AEMA 4X65F 2EFVA 1OYEA 4QPTA 2HBZB 4C11B 1R43A 3FNNA 3CJTA 4I0WA 3KHRA 1AUDA 4A8OA 3M6UA 3POTA 3R97A 4CNZA 2YNFA 2VFSA 1S4FA 4DFKA 1TL3A 3UCUP 4DV1F 3FMWA 2X1GA 3CJRA 2FHMA 3CUNA 1U2CA 5DDPC 4I2PA 3UVJA 1F0XA 2MLYA 3ENWA 2E9ZA 4HHUA 5K5MA 2GGPA 2YKNB 1WKKA 2VJUA 1S76D 4F3MA 1CS4B 1NDKA 2AYGA 4OHZA 2E5LJ 4LRBA 4OX7A 4ZP8A 4A46A 1IR2A 2Q66A 1FKOA 3GE9A 4WXOA 2UXBF 5KFYA 2CZVC 4ETXA 1YZ6A 2W7AA 3D5MA 5KG3A 5B0CA 5D0RA 4UY85 4DV5J 1GFWB 4PABA 4X4PA 5ETQA 4LR8A 5FLXU 2BZ2A 4QW9A 1SJQA 3VZHA 9RUBA 3PO5A 1RHJB 3BYRA 3UE2A 1K73T 2MKKA 1NLKL 1UWBA 2ZVIA 3CJ4A 5DDOC 5ETNA 4NCBA 2IIHA 2DGUA 3PACA 2WONB 3C14B 2IC3A 3HFKA 4OZLA 3C6UB 1VFJA 4AUKA 2PFDA 1VQPS 2JWNA 2XMTA 2OTJS 2B9XA 3P6YC 4LF6F 4IR9A 4QIWD 2IAJB 1R6VA 5AJ3J 4Q0BA 3A12A 4DV7F 2EBGA 4Z7YA 2QL7B 3RR7A 2XMKA 4K4ZA 4O3NA 4USWA 2R7RA 4KTQA 4C3LA 3GV5B 2AYMA 4G1QA 2ZM6F 3RRGA 3GV8B 4ID8A 1P6TA 1B3TA 2V4RA 2DY1A 2FJEB 3I9V9 2ROPA 4I68A 2HNDA 1AFIA 2VPYB 5DQHA 3GJRB 2R7WA 4PQUB 1S1XB 3TP2A 4EEYA 4HKQA 2V5HG 1VISA 3W2VB 2QYGA 2VQFF 4FZVA 4BC9A 5C24B 1S1WA 4F4AA 2V68A 3AQPA 1B99A 1VCTA 3WX4A 5DM7Q 1WHYA 3GONA 4QWCA 4FDFA 4QJVA 4USVA 2DGXA 1S6PA 1YI2S 2YPYA 1C4AA 3IG1A 3MXHP 3F0NA 2WVBA 4BHQA 4Y2KA 1M5KC 3KLEA 2RIJA 3KJFB 1ZM4A 4DG1A 2J7UA 1WHWA 2Y3YA 1D1UA 2PI4A 1TVRA 4NLDA 1ZZFA 4BWJA 2HURA 1H3DA 1XMQJ 4MK7A 3RW7A 4H4MB 4PCQA 4DLEA 1UFWA 3FC9A 3EICA 1UVMA 1BQMA 3A8IA 3CCZA 1HIYA 3AOAA 3OVBA 2ZVSA 1T9TA 4NMLA 1HQ2A 2LMIA 2HMIA 3J7ZT 2QG9B 1I1GA 3CDBA 3NMRA 1CPZA 4ZVQB 2XS7A 1DBDA 2RQMA 1IM4A 5T14A 1AW0A 5BYQA 3W8GA 1CSJA 1S1VB 4DN9A 4CIOA 1XNRJ 3JSYA 3OT9A 4M8LA 1RACB 2XY5A 5J2PB 2RD5C 3A1YG 4KV8A 1U0SA 2GIFA 2ILYA 4WFBQ 2GZOA 1HNXF 1N5YB 4WWSA 5KG4A 2ZH1A 2X3GA 2YTCA 3N28A 4CT9A 4V1Ak 1C0UA 2C2ZB 1VQ8S 1Z2LA 2KG0A 1MU2B 3ENQA 2KFZA 3G6XA 1NK6A 1XTZA 1U1MA 2OH2A 3OSNA 5JXSA 2L48A 5F8JA 1V3SA 4IO9Q 1VOMA 1PJ6A 3C15A 4ZMMA 4X4OA 4DSKA 4OJHA 2J0XA 2CKWA 3TX0A 2YQ1A 3EGWB 1VQSA 4RW8A 4TY9A 1FRLA 1XWLA 3PO4A 3QT7A 4NLQA 2EK6A 3D54A 4NZ0A 2DGTA 2XB2D 4TYAA 1CJKA 1K47A 4A8KA 4K4WA 2VFTA 1UW4A 1KFDA 5H9FK 1WDTA 4WFNQ 3MZIA 3ZZUA 1OYDA 5KG7A 2M5YA 2XNQA 1FT8A 1E6YB 1RQ0A 4ECUA 1T3OA 1H7WA 1UVKA 1OY9A 4ZVUB 4CO3A 1FWKA 2A3JA 1URNA 4RLEA 4NYZA 3ILJA 4DZDA 1HNZJ 5A0YB 1VS3A 3FDSA 2UV8A 2JFDA 1XERA 4IO1A 4FVMA 2C2MB 1RCXB 3R5CA 3LUYA 3M7VA 4PXEA 3M2UA 4HHJA 1V3ZA 3MDFA 4DUYF 1IKYA 3P5BP 1SKRA 2OHDA 5BR8J 2FC8A 4XAKA 3EUNA 3MAQA 1VQ7S 3CCLS 1BE4A 4LF1A 4K4XA 3LTOA 3R27A 3OD2A 3HK2A 1M1KT 1JLFA 1H72C 2WCXA 4RBVA 4RUCA 4DUTA 4C2MA 1SIZA 4TY8B 3SSSA 1MWYA 1RHKB 4A8WA 4W98A 5EWEA 4UZBA 1EETB 2KT2A 2PC6A 2UUWA 1Y5LB 3KHHA 1RTJA 1JLQA 2HVIA 4ATNA 2BBEA 4ALZA 3KJVA 1QAIA 5B08A 5IWAJ 4I4BA 1C0TA 1FRJA 4LF9J 2EWHA 2Z2MA 3R5BA 3LWMA 2PIIA 3Q8SB 4USHA 3EWGA 1NHVA 3QLHA 4MT1A 3CCQS 4LBHA 3W65A 3D3CJ 2IVYA 1ZBTA 3NGTA 3LP1A 2OD4A 4NLSA 5L1LA 3KOAA 3DOKA 3GZ7A 2RUSA 1U24A 4WKRA 3QAUA 2MQLA 3AD8C 2DHGA 1HLWA 3M1VA 2ZWOA 1T7PA 4CYUA 2G0CA 2ZFHA 4DQSA 1NJYA 9ATCB 5DG8A 3B54A 1JLGB 3G8QA 3EJMA 1S79A 1X4AA 3MF5A 5J2QB 1SXLA 2JLGA 3TUZC 3PM9A 1UP1A 2BJ7A 5HMXA 3L95X 3DHWC 4L76A 3HX9A 3I0SB 2UP1A 2YKMA 3J80Y 3ZC4A 4G65A 5AXNA 4B08A 3G6ES 2VASA 5IT9U 4UZCA 4ER8A 4JI3J 1FWLA 3HHLB 2VQEF 1H0HB 3A8JA 4HLBA 1TUGB 3IAS9 3VZIA 3DOMB 2HHUA 1Y5IB 5B0GA 2NXJA 5LSOA 2KM8C 4RW7A 4DV5F 2W4DA 3TAPA 1KFSA 3SMZA 2B5JB 3CDAA 2ZE2A 3CT9A 2LQJA 2ZDOA 4ZVFA 1WNEA 3I9ZA 2F8EX 2J5AA 1TKTA 3AQOA 1NMEB 3U1NA 3K8WA 1KRPA 1Q95G 2JJ4D 2ALZA 3TEHB 2YNHB 1RU1A 2J8AA 4LFBJ 2XM3A 4ITSA 2BE2B 1WF0A 3FZBA 5AJ3F 4WF9Q 1RAAB 2DHAA 2VA2A 2P5VA 4TN2A 2RB7A 1TP7A 1HNIA 1FX4A 1S0VA 2MKYA 2V94A 2EXUA 3IFEA 2DITA 2FGOA 4Q44A 4J9OA 4C11A 2CZ4A 4OI3A 1JMTA 1PC4A 2WVEA 3AY0A 1ZOTA 3MM9B 4U67Q 3HVRA 1SC1B 3OFHA 3MUVP 1TELA 1HNWF 4ZP7A 2D74B 2QGFB 2FZGB 1YGYA 2V8DA 2AZ3A 2XTJP 3BN7A 5CABA 5L46A 1KHWA 4I69A 2B9EA 3W9IA 4GKJF 2YKNA 1GEHA 1FRHA 4OIXA 5EWGA 3EDRB 4ZN3A 1GH8A 1CS4A 2AGPA 4F4YA 2HGMA 3T9ZA 3PXGa 3GMGA 5J1NA 3PW7A 5J1PA 1K0TA 3CMQA 2AJ1A 4LSNB 2V8VA 1S9EB 3F41A 3NRBA 4U8YA 3G6VA 1Y4ZB 4DMZA 4OI4A 1M1GA 2MJUA 4JI6J 3EE3A 5ADZA 3PW5A 3KK3B 1S9FA 2CZ9A 2F65A 1YWXA 1X0FA 2JFKA 1YQHA 2HVZA 4NLYA 2LLZA 3DN9A 2DXEA 4NCGB 5A8WA 1VGYA 2ZJRQ 4NZ7A 2C3PA 1FWPA 2XMVA 3MUTP 1SL0A 2WONA 4Y2MA 3C14A 3T1AA 2VFUA 4OI2A 2IAJA 4GRSA 1OO0B 3HF5A 3QAEA 4ETZA 1T94A 5HROB 3UCZP 1D3WA 2VDHA 2UZAA 1XNRF 1J2VA 3MEGB 2B7BB 3GYXB 2NUUG 1S6UA 3HPOA 3GIIA 3G71S 2K8GA 5D15A 1UA0A 5GMDA 2HWHA 2V63A 5KT7A 3ICLA 2RU3A 2CQ3A 4PQUA 3NS7B 3UN3A 2HQIA 4DDFA 3HP6A 2FLPA 4DPYA 1XMOJ 4FF4A 1EQ0A 4OYXA 2Q1LA 2LP4A 5H9FJ 2LXIA 5IXUA 1VBKA 4ZJOA 1FK9B 3CO9A 3TNVA 4GO5X 2MQPA 4N8NA 4WPAA 1PGZA 3C16A 2EW9A 4DR2J 4LFCJ 3S6EA 2ZH9A 3T3FA 4F4KA 4O3SA 1P9YA 1AUSL 2OPPB 1N6QB 4JP8A 4P73A 5KFQA 1S6QB 5LT5A 3FZ2A 2EC0A 5D4LA 2CPHA 3MD1A 4KC5A 5HMZA 2QLWA 2PA3A 3CSKA 3RB6A 2R2TA 5M2UA 2KG1A 4NYPA 1KTQA 1RU2A 1S1UB 4JI2J 4MJKA 4Q8EA 2RKIB 4OZJA 1BQXA 1Q16B 3BGUA 2CPXA 2FHJA 2B9YA 1KTVA 1VQ5S 1T9UA 4W92B 1ZTWA 2HAIA 4LF7J 3TAMB 5ETRA 1YSJA 1KOHA 3CC2S 2E44A 4ZIVA 4D3GA 2GX8A 2Z2LA 1UL3A 3VGTA 4YDDB 3E2EA 3FQKA 1DTQA 2BEFA 5J2PA 1XJWB 2I8EA 2I5JB 4KGXB 4YS2A 2XYHB 2RT3A 1FKPB 2HS4A 3EXCX 4ZVSB 3CW2C 3D1QA 4J9NA 3CDWA 2ZNZA 1FD8A 2GCFA 3VQTA 4DUZJ 2QLJB 1VIXA 2NCKL 2JVRA 2XLKA 3VAIA 2N4CA 2XSJB 3OTDA 4KJIA 1HBOA 4UT4A 1DQAA 1F9FA 2XZDB 3B4MA 2DPIA 2ZC3A 1JLEA 2HK3A 3S01A 3R9LA 2R7TA 5IWAF 5F9LA 4I6AA 4LF9F 2J9DA 3FJ2A 4R8UB 2XBPA 1XMBA 4B9VA 5G0RB 1J27A 2QSFA 3D1HA 3NCRA 2OPRA 4QR2A 3N4WA 4CWBA 4NCAA 4Z2XA 4F02A 3S8SA 3K8VA 2YKQA 1FJGJ 1RLDA 4X62F 5E2QA 1X4DA 1P27B 1IKWB 3V6DA 2VKZG 4RZRA 2XQCA 3UNGC 4TNOA 2I9SA 4FN5A 4PRFA 5F8NA 2V9WA 5E3CA 2J0WA 2M3DA 2MMYA 2UXDJ 3ZTPA 1LK5A 2R8JA 3CCRS 5A0YA 1ZA2B 2EEYA 3ZZPA 2OPSB 3L09A 4DPUA 1JWWA 1R0AB 4QCLA 3D28A 3HI9A 2R7UA 4BBYA 2G13A 2KHCA 3SFGA 3PYFA 3BKUA 1I6JA 3TANA 1V6HA 4JI3F 2ZBQA 4KY3A 4K4UA 4ELUA 1M1HA 4DR5F 5DS7A 3P3DA 3MM7B 2ZNYA 4UOFA 5LJ5Y 3QBCA 1T95A 4DS4A 2JX2A 2XGQA 3ELHA 4PXCA 4WFYA 3J81Y 1UW9A 4GO7X 3TVZA 3BYPA 4PXBA 4TY8A 4JI0J 2KU7A 3QRPA 3IRXB 3FQLA 2R42A 1ZH5A 1UEVA 1M5PC 5F8LA 2FB0A 3NGRA 2ZH5A 2RU9A 1RABB 3QQCD 3MPWA 4EI2A 3F56A 2CFXA 2GO9A 4LFBF 2RH3A 2X1AA 2QLFB 3DRSB 5LMUF 1S0NA 2UVVA 3W9HA 4BLGA 1WG4A 2ASYA 4QIGA 3LANA 4OFZA 1X31C 1VQMS 3SV4A 1HQEB 2FD2A 1U6BA 1NBEB 3CJQA 1NK0A 5KFIA 5G4DA 2ZJPQ 2ASLA 2W01A 4I6WA 5HL7Q 2DCLA 3GR1A 4MFBB 2IVMA 3ET6B 2BVZA 3M8YA 3V6KA 3OL8A 1TQLA 3FFIB 1SCJB 2VG6A 2W2NP 1NHUA 5DM6Q 5D3GB 3V4IB 2N82B 1G4CA 3J7YU 1SL2A 3VQSA 1IKXB 2P6SA 3HKWA 3I87A 3M9OB 2QMWA 3H5SA 1FVSA 3ZO7A 2R3VA 1I3OB 5ETTA 3GJTB 3PFOA 2QX0A 1X5SA 4OHWA 3M2RB 1FKAF 2CQDA 4WKYA 2CPJA 3PRVA 3DOMA 1WACA 2DNPA 5KFHA 1VRTB 2ZC4A 2V9KA 1Q78A 2D1CA 3SIPB 4U7UK 1NO8A 2NSCA 3DRXA 3BKTA 3K5OA 4USIA 4IDKA 4KPCA 2RDJA 4MK9A 3GV7B 3BSCA 5D0EA 5HJXA 4B9MA 2FHJD 3FBEA 4LJMA 2DHXA 2DEJA 1RGVA 1FNMA 3EZOA 4RL1A 4USMA 2D3OR 3CJSA 5K14B 2BRLA 5KFRA 3W3SA 1QUPA 3NLCA 3CF5Q 2IJFA 4P2SA 2YWKA 1HHQA 2YNHA 2BE2A 4YR2A 4O0NA 3KDNA 1OIAA 1EX8A 2FLOA 5T7LB 2YXLA 2VBYA 3NEKA 2MEWA 3M4XA 1X9MA 2AJFE 3MMCB 1LNQA 4A8MP 5MAOA 1HYSA 4ECZA 4FXDA 5SZTA 6FD1A 3ZTQA 2IJRA 5D0HA 3ZZRA 3L7PA 2YKPA 4EBEA 2GFFA 2YY3A 2HZAA 3BV8A 1LWEB 4KH0B 1T9VA 4OYAA 2OP5A 3MTJA 3RRKA 3CD5A 1M90T 1XMOF 4Q5VA 2CDRB 1JKHA 1IKVA 1WORA 1HHTP 3CD6S 2VU5A 1N36J 4KPYA 4FS2A 5B0DA 4DQQA 3LW5C 2NUHA 1O51A 2EFOA 2R2RA 4WTYA 3I55S 1C1BB 1Y10A 5GMEA 4DR2F 1Q8BA 2DGVA 1Y3JA 3OVSA 3OXFA 3VGSA 4XPCA 3TJ8A 1NKEA 4FF1A 1WDDA 4JV0A 4E8UA 2P2CB 3QIPB 3CTRA 3D0HE 3TZWA 5JJBA 4RNMA 1XNQJ 5IS2A 2J0QD 2FVCA 5KFDA 2HHXA 1SUQB 5HMYA 4JI1F 3DCAA 4ED4A 1GAOA 3DOLB 1HWLA 4NCGA 4JI2F 3FSIA 4PWDA 4GKKJ 1FVQA 2R7SA 2IMWP 2ZEJA 1NJWA 3LP0A 4KT0C 3FEXB 4J9MA 3Q8VA 1GMWA 4LF7F 2HVDA 3RYLA 3N01A 1S57A 2V0NA 3K5LA 1VQ4S 2E66A 4U95A 1GMVA 4FYYB 4ZP9A 4U96A 1QTMA 4FKYA 3TO8A 4NRTA 3MEGA 1JLBB 1A7GE 3BQ0A 3PW0A 2O01C 3FK4A 2DNMA 1OS5A 2B4UA 2YVSA 1YJUA 3GG1A 1U1PA 3PR4A 1SV5A 3MM5B 1BGXT 3DLHA 2HLUA 3AJDA 2MQQA 2E5IA 4MKBA 5KFZA 3JAMY 4ERDA 1BUXA 4WYWA 1RWUA 1FFWB 1WD6A 1FK9A 3T5HA 3FCVA 2LECA 1FNOA 2HNYB 1NJXA 1ROFA 1YRXA 5MLCV 2YBVA 4UUWA 3GIKA 2DEIA 3CVKA 3T5JA 4RWWA 1RT3B 2IM0A 1NDPA 4K50A 3V6HA 3N6MA 4KHMA 2OPPA 3R6GB 3D3BJ 5KFCA 2HHVA 5B0AA 1RAJA 1GQEA 2QC3A 5L9XA 2ZHOA 4DFMA 1FJGF 1HFEL 4YDXA 1IBMJ 2D7SA 1VJWA 2R9LA 1XIQA 2YPZA 3MECB 2KXNB 2OIHA 5HN0A 4FXVA 1XN9A 1FRIA 1UMJA 3S1TA 3BQ1A 1KP6A 1S1UA 1QAJA 3M30A 2W2MP 3IM8A 2WVFA 2DIUA 2RKIA 3X1LB 3PVXA 4N8OA 3SSQA 1MNEA 1UJ4A 4ES3A 1S9GA 2BOPA 1UZHA 2Z30B 4NLOA 4A8QA 4XDDA 4FYDA 5B7WA 1Q79A 1QAXA 4F0KA 2CIMA 1TAQA 2WRMA 3H5XA 3CDEA 2WVDA 2B51A 2R8HA 3M8RA 1S48A 1RTDA 2QN6B 4KFBA 4WYLA 2ZOMA 3SFUA 2NYIA 1NK4A 4KHRA 3NNHA 1GNKA 2XGPA 3QT5A 4L74A 4IH5A 2XLIA 4JI0F 2G1DA 2VPXB 3FGVA 3G6YA 2E1RA 3B82A 1KC8T 2YH0A 4CDIA 2YWHA 2HHQA 2LQ9A 4IOBA 3HFZB 4K5RA 3I56S 2HHWA 2FJBB 4ZLPA 3UR0A 5KFSA 1EP4B 2XULA 3MUMP 4R8UA 1FEEA 5G0RA 3A4TA 2E5JA 2B4VA 1AT1B 4KGZB 2AMCB 3T1HJ 1U8SA 3DLLQ 1TL7A 1G2EA 1H7XA 3GIMA 3RBZA 1JIHA 4IG0A 4ZJLA 4AL5A 2K1RA 3IBCB 2RS2A 4B9TA 2HVHA 2MSTA 3MPVA 5KOXA 1NUEA 4IH7A 5EX0A 1D9FA 2OUGA 2RF2A 1T3NA 1RHRB 4CLSA 1SJFA 4M5HA 1W2IA 3CIZA 4HT7A 4RBUA 2RILA 4QR1A 3A8KA 2GQQA 3HSZA 1Y00A 3MPDA 2GNKA 2KTQA 3QO9B 1X4EA 1U6FA 2OPSA 4CLLA 1HW9A 3O3LA 1NPKA 2RUGA 1U47A 1FEHA 4RNHA 3KUHA 1YZ7A 3J7Z5 1BMQB 5A8RB 3C46A 3DRRA 4JV1A 2RNEA 2F4VF 3IR5B 1ZZNA 3IN5A 5AT1B 4K4YA 4OI1A 3MM7A 4O4GB 1RWVB 2O5DA 2PA8D 4A48A 2FLLA 1MWZA 1EB0A 2UUCF 1FE4A 1NEEA 4Y6IA 3FEYB 2H9ZA 1RWPB 2NXUA 1NSAA 3D7SB 2AP6A 3BJYA 1FHTA 2LFVA 3OVAA 4HL9A 1N52B 2W2OP 5L1IA 2F8MA 2ZZMA 5D6GA 3THVA 4OLOA 4DSIA 1DTTB 1HBMA 1HKAA 5IZHA 2COLA 1FDAA 3PEHA 1PBUA 1Q8IA 4IFVB 1EAYC 4AL6A 4DR1J 3DRSA 1EZZB 1LWCB 3D6HB 2OO4A 2UUTA 3OHAA 4ZCMA 1J5EJ 5CA5A 3OTEA 3EYZA 3LA0A 2QT7A 3M8ZA 4Y0FA 4AL7A 2A1BA 2NZCA 3NAHA 3JSMB 4KIAA 1JJ2R 3DMJB 3V2UC 1LW2B 1TK8A 4F36A 5CYQA 1N33J 3VF0B 4JYAF 4AQYJ 1IWGA 3KNAA 5EN1A 5AXLA 1ZPWX 2Z2ZA 3D68A 1N36F 3DYAB 1JLCB 1HA1A 4UF4A 1PBAA 3MEEB 3TWZA 4RNNA 5EHHA 4W90B 2QFJA 2NZ4A 4K7QA 1IKXA 3HMJG 5CD4A 3PX4A 3FRZA 3LH2S 3M32B 5LXRA 5FDLB 3RBXA 5F9NA 1MG7A 2G4BA 2BMBA 2MZJA 3AT1B 1FTRA 2JEGA 3QWPA 1N5QA 2IBOA 3BF4A 1WKJA 2UUBF 2UU9J 4RW6A 4DX8H 3IAM9 5J2NB 1SH0A 3GG0A 2HZCA 2L41A 1HPZB 3DGVA 1HBUB 1QD1A 2ZITA 5I3UA 2E9RX 1B4SA 4I7FA 5K8OA 1XNQF 3ULHA 3NS5A 4B9SA 3KLFB 3BEGB 2D3O1 2HRYA 4K8RA 1NKCA 3T1YJ 2YH1A 3LGHA 5K14A 1AXQA 1RLCL 2CWKA 4WK3A 2RSQA 2XS2A 1FJ7A 1TKDA 1HNVA 2F40A 2FPHX 4DSFA 2V2VA 4DX6A 2WOMB 1J5OB 1W26A 5T7LA 3CJ3A 4X4TA 5GAGI 2ASDA 2HGNA 3DHXA 2A0FB 1T11A 3NNAA 5EDWA 2RRAA 4X4UA 4LMZA 2WK4A 3M8PB 2HFVA 2IJNA 1X0PA 4QIEA 1QE1B 1LWEA 4FPIA 1VJQA 2D3ZA 4P10A 4M5DB 3RB0A 4PPDA 1G3OA 1BC6A 4LF4J 3SCIE 5KFJA 5EWFA 3NGUA 3R3TA 2AKWB 2NPFA 2UUAJ 1VK3A 2PEHA 3K58A 3TZZA 4CH7A 4X4RA 4E0DA 2OSRA 1KQGB 4P9SA 4F8RA 2EK1A 2V2KA 5KFUA 3ADAC 4EMDA 7FDRA 5GAHU 3JTNA 2FHOB 4PWWA 4LFAJ 1GX6A 3LOUA 4AXIA 2IMOA 5CAAA 2JHEA 2IM1A 1FI4A 2E1CA 1RWXB 2IRYA 1B0PA 2LDYA 3JS9A 4DR6F 2XMAA 1N5TA 4DPXA 3SV3A 1TKZA 4CLUA 4YQWA 1U45A 1SKSA 2PSZA 3TVYA 3JXOA 2VODA 4C8ZA 1RT7B 3MM8B 4A47A 3M2VB 5KTQA 3W9JA 3SDEB 1SH3A 2BW7A 3CD7A 4DV4J 2B7CB 1URRA 2B0GA 1NJZA 1REVA 3IWNC 2XHCA 2DVIA 2DGQA 1CC8A 1SVDA 4J9PA 2WW4A 2AD9A 2RHQB 4GMKA 1XR5A 2BYCA 4PUOB 3IS9A 5KFMA 4L3NA 2JNJA 4RNOA 4RPFA 4QWAA 2BA9A 4P74A 2CADA 3RU0A 3BSAA 2LEBA 3HT0A 2CJ9A 2J9DE 1ACMB 1JLBA 4Y65A 3CCVS 3NKYA 2XNRA 1UPMB 2BW2A 1RXOB 1MW7A 2H51B 2CYYA 2H4WB 3O44A 4N47A 2N7YA 3OR1A 5KT6A 3OXGA 3DLGA 1OQ6A 4TLRA 1RT2B 2CA9A 5I4MA 3VALA 1SBRA 5LSLA 1HWKA 2UV8G 1Q5YA 3M05A 4J90A 4ECXA 4C8LA 4OX9F 1FDDA 4J9VA 2VBXA 4ZHRA 4TYBA 1IBKJ 2AW0A 3RRHA 2HNYA 3QFHA 4CO5A 2VIHA 3KJNB 4R25A 2LVWA 2Y8WA 3GU0A 2KDOA 5C25A 3B4DA 3UN2A 4NYOA 1FD2A 4F3QA 4YY3J 2R8IA 3HVTB 2AIRB 4ZLLA 2MGZA 4EYHB 3LGMA 1OY6A 1ZM9A 2BJ3A 2G2YA 1F9HA 1DFDA 3AJ1A 2LXFA 4NXMJ 1R6YA 1UJ5A 2EFGA 1VQOS 3CJ2A 3HJFA 4TVAB 1TL4A 2CXEA 3HVWA 1Q53A 4IQMA 1FESA 1PJ7A 2Y9HA 5HQLA 4NLXA 4A8SA 3SXLA 5DZ7A 1WSVA 4DZ6A 1UVJA 3BBBA 2R2SA 1RADB 5HBMB 4YHHF 3G86A 3UR3C 4QPXA 2GVZB 1H74A 4NA2A 4KKOB 3VTIA 2EKNA 5B09A 3Q2TC 3J7YI 1DLOA 1FRMA 5GAEU 1FDBA 5F8IA 2HHPA 4H4OA 5A6PA 5L38A 2E1AA 4DOZA 5IM0A 2W8KA 4Q45A 5H9EK 1PYTA 3KUEA 1CVJA 3EXYA 4FF3A 1RT6B 2ZBIA 1BWVA 1K1QA 2XC9A 1VLOA 2CRLA 3ZXWA 2W7OA 2ZH6A 2NREA 1NM2A 1RTZA 2VH7A 3MMBB 3L3CA 1ZPVA 1RB0A 2GJFA 3MEDB 2QRRA 2F63A 4CO0A 1MMNA 1HMVA 3GJSB 4DPOA 1T02A 1PO6A 1YJ7A 2JVOA 1BQNA 1YITS 2HSEB 4EZ9A 1WC1A 1U1NA 4ZDNA 3GYGA 4LRCA 3TX8A 2DYAA 3GILA 1S1TB 4XK8C 1TKXA 3QGGA 1JXLA 1KSPA 1TK0A 2HS3A 5HLFA 2H5IB 4WTOB 1WI8A 2VL1A 1YVFA 2F7VA 1D9DA 4PEOA 2VC1A 1AZSA 1R89A 3HSJA 4ED6A 2MQNA 1H2VZ 3C8YA 2IA6A 3HSDA 4DR4J 1LW0B 2HRUA 4IG3B 3ETMA 1N33F 2VA3A 3EZ5A 1WHVA 4AQYF 1T0TV 3TI0A 3HLUA 3ILLA 1VQ6S 4URGA 3DLJA 2BJ8A 2XY7A 4F2SA 2C42A 2AWZA 1WC3A 2AV5A 3Q8UA 3PCOB 3Q23A 2CQ4A 5KFKA 5D77A 3VVTA 4J9KA 1E6VB 3JYTB 4O44B 3Q86A 2M52A 4OYPA 4N77A 4CLPA 3KHLA 1FO1A 4ZKAA 5CZXA 2WSEC 3VAMA 3EGNA 4Y34A 1YDLA 4B3SF 2QIFA 4ZPVR 2CJBA 2QJ3A 2UU9F 4QU6A 1KDNA 4YEAA 3FMBA 4B17A 2Z4PA 4N7TA 5H1SV 1GXLA 1RYRA 5FLXY 3UDCA 4FPRA 1CJTB 2HHTA 3FEZA 2I6WA 2VB6A 2MHNA 1NZAA 4YR0A 1S6OA 2DISA 4KYZA 4BCAA 4ZVRB 1D8YA 1RBOB 2FJDB 4CLWA 1HQUA 3OFGA 3B78A 1DTTA 4ZPAA 3N0VA 1QVGR 1C1CB 2XYPB 4ZA1A 1APSA 2L9WA 1U1RA 2E9TA 4YB5A 2DXDA 2ZDPA 3H2LA 5CYJA 5E3AA 2J76E 3BSOA 1VC0A 1UA1A 2OEMA 4NLVA 1P8GA 1N48A 3D67A 1CJVB 1RKIA 1PIEA 4CH0S 1TV6A 2UXCF 4CTAA 2MJNA 5CYMB 4DS5A 2N3OA 3NGKA 1VR6A 4DV3J 2K3IA 2IPOB 3JSMA 4WCEQ 1U25A 5KT4A 4ED5A 1LW2A 1TFYA 4KGKA 3K0JA 1Y11A 3EVMA 3OFEA 5FJ4A 3MMAA 3IGNA 1N32J 5JVGQ 4LF5F 1YBTA 4LF4F 1OSDA 2HBQB 3HHDA 3OTOJ 4NE9C 4B9UA 4P7TA 2VPWB 3DYAA 2LDIA 4F2RA 3MEEA 5KG5A 2UUAF 4B3MF 5KFAA 2XMUA 4G1PA 3M32A 3IO1A 1XC9A 4LF8F 2QL9B 3M6XA 4FF2A 2H5EA 3BDEA 1WHXA 2CQGA 5CCLA 1F6TA 1XEZA 4F25A 3PY8A 3R6LB 1HPZA 2EBEA 3NGSA 4RUAA 4CT8A 3CD0A 3W60A 1RT4B 1HWJA 5HQ8A 3P45B 1K8AT 4HT5A 5HAOA 3PJWA 3KLFA 4DL4A 4WFXA 4CM0A 1R3NA 3QSIA 3BO4A 1R27B 3I5BA 2AJ4A 4JI5F 2R2UA 3W5XA 3KK1B 1RBLA 4WZQA 2BJ1A 1FERA 3N6LA 4X4VA 4ECTA 2IYGA 2C2NA 5DDRC 2KM8B 3O8WA 2WOMA 1J5OA 4NLWA 4Z7CA 4WFAQ 4J9UE 5IV4A 4FXWA 2Q79A 3I4PA 5DG9A 4DCOB 1Q7YT 1SI9A 2DD8S 4JI7J 2E5GA 4AD6A 4QR0A 1JLAB 1B0VA 3R5GA 4F04B 5IOLA 3H4BA 1RTHB 1UWAA 4CLZA 1QE1A 3V81A 3MR6A 2ATCB 3TZXA 2Y1RI 3IWLA 1RT5B 3OSPA 4RW4B 1RT1B 1UETA 1RJJA 2FY1A 1TL5A 1NK5A 4B3TJ 1JK9B 1U49A 3ETOA 3LPYA 5ETVA 4OZ0A 3TA1A 3TZYA 4M95A 3MAAB 2BQ3A 4KB7A 2DJWA 4NLPA 3HFVA 1R8PA 3T9NA 1U48A 2XG8A 1FJCA 4HYKA 2OEKA 3EZUA 1PYOB 2ZH7A 3KLVA 3PV8A 2ZJQQ 1G6BA 4C8YA 2ZBPA 2W9CB 4MYTA 3C6TB 4C8KA 5DGBA 1PSDA 3IBWA 2CG4A 1NB2A 2KJVA 4NEYA 3Q24A 1G7CB 5KFPA 3MM8A 3M2VA 5H9EJ 2CJYB 3WIVA 2IM2A 4HVZA 1C4CA 3AB2B 5I3QA 2Z58B 2ROGA 2ERRA 1FDNA 3AB4B 2KZZA 4WU3A 1YJWS 2W9AA 2MKCA 1F5AA 1D9AA 2RAQA 1S49A 1MSWD 1PJ5A 5AE1A 4DSEA 4C8NA 1UFLA 1LXNA 4MAKA 2RRBA 2GVDA 2QMUB 1JNZB 1MLAA 4DV2F 4WJBA 2L08A 2YX7A 1N88A 3IA0A 2MQMA 4FBUA 3PYDA 1XK8A 5IC4B 4CH1A 3KFWX 4L73A 4M5LA 1JJCB 5C2CA 4ED1A 2CPFA 2KJWA 3I0RA 1F2GA 2O66A 3ISZA 2HIYA 3WC0A 2HIQA 4QWEA 2V8GA 4NXNJ 2FVPA 2X1FA 2GMJA 2PGCA 1Y9OA 4DBQA 1PG5B 1FFGB 1NSQA 4I64A 4LSLA 3TUJC 1ZTTA 4ZOSA 4MIWA 1IWAA 1L3KA 2VFRA 3AXMA 4V19J 2P9EA 2Y1LB 1H98A 2E29A 2Y1IA 3SBMA 2ZKUA 2N7CA 5A8KB 1JJHA 3HVTA 4JI4J 3TAQA 4HH1A 5KG2A 2YNFB 5GADU 2ZD1A 2LXUA 3D66A 3AD9C 1TL3B 3KLGB 4DR4F 3LP2A 3K2YA 1LV5A 5THWA 2HQCA 3SEOA 1FF2A 3HHKA 1IBLF 4JI8F 2C2KB 4I2PB 3UVJB 2BJ9A 3GSIA 1N56A 1EIYB 4DF4A 2GGPB 1U2FA 2E7VA 3OR2A 2GV1A 3MTKA 4DHVA 1AB8A 2ZWPA 3TQ1A 4USJC 4DL6A 3BBFA 5C5JA 4KE5A 2HHHF 4KKOA 4QOTA 3ZTSA 1Q81T 4ENOA 1U26A 1FKOB 2WB4A 2DGOA 4PXDA 2QFIA 2PD1A 4ZN1A 1BD6A 2EG2A 3R5JB 3TW0A 4XIUA 2EC2A 3CCUS 1IJEB 1ZM2A 2O67A 2NXCA 1AFJA 3PJXA 2ZH2A 1U8WA 2DK2A 3RTVA 2PFFB 2OAUA 2HQGA 4RR5A 1RT6A 4EFAC 3SYZA 2P9GA 4JOUA 3IM9A 1M0SA 3V5RA 1UWBB 4DJBA 2DNOA 4IOAQ 1R8AA 3MEKA 2XMJA 5AE3A 3AXKA 1MWQA 2V4JB 2ROEA 2Q43A 3HD1A 2WBMA 4KO0B 1IXKA 1U1LA 3WHIA 2DNKA 5CXTA 2AQ4A 3BH6B 2X7IA 2J7KA 3QJLA 1F3VA 3AOBA 3DI6A 1T8EA 1PC5A 5LMNJ 4DR7F 1RHQB 5ETOA 3HM9A 5I42B 3PIPQ 2A10A 2UVUA 2YKOA 5KFOA 4F7VA 4G1QB 3CCTA 2W8LA 4YB6A 1QVFR 4ANDA 4DV3F 1H2TZ 2HNDB 4FKXA 1W7WA 1UVIA 4DV1J 3I6PA 1U02A 3M8SA 1FRXA 3AOCA 4O3PA 1SC6A 1XBWA 3VAKA 3W66A 2R7XA 3WZ0A 2ZH4A 1WG1A 4ED8A 2GJIA 1EJ7L 4RNFA 1T03B 3GIJA 5IQQA 1EHWA 2CNKB 2LEPA 4IKAA 1Q8KA 1P1TA 3I82A 5F0WA 3RBEA 1UEUA 4BC7A 1UTAA 4RBTA 4UQTA 1S6PB 3IWXA 2DCUB 4O44A 5M2PA 3IG1B 2H65B 3E01A 1Q7LB 2ZOGA 4KH1B 2R7QA 5K20B 3DRPA 2OMLA 1P9QC 2GHVC 2MZSA 4DG1B 2WBRA 5GAHI 2U2FA 3MOZA 5L39A 5B0FA 1TVRB 3GFYA 4P52A 2HK2A 3OXLA 3P5TL 3EDQB 3K7RA 1WJ9A 5I3PA 3CDUA 2E5LF 2XMWA 2GMLA 1SC3B 1AROP 2RQCA 2QO3A 3IP0A 1CJTA 5F8HA 3SSRA 1WI6A 3ILOA 4CNYA 1BQMB 2FGCA 1SJ3P 3WC2A 4UOCA 4ECQA 3RW6A 5BJRA 2CPDA 1RISA 3ZZOA 2HMIB 4HHHA 2C2OB 2E1PA 4J9QA 2W4PA 5F8MA 4DV7J 3RZAA 2CQPA 1UJ6A 3UPFA 2DNNA 4ZCLA 1CJVA 2ZBRA 4Z37A 2XCPA 4KV8B 3KK2A 3PDNA 1TR0A 3QT6A 2MZTA 5CYMA 3H5UA 1FE0A 4QWBA 4LUBA 4I56A 1RAHB 1FA0A 4M5MA 4P7VA 5M2RA 4DF8A 1C0UB 5L1KA 3G2XA 1FX2A 2VICA 5KFLA 1NZ8A 2W25A 2VQFJ 4CLKA 2XY6A 2K3KA 1KS2A 5D4PA 2CNLB 4ES1A 3C15B 3CCSS 1N0VC 4ZPBA 2U1AA 4TU8A 1HW8A 5IC6B 1DJ0A 4C6AA 2AHOB 4NLTA 4M5IA 4RW8B 2OMOA 2W2QP 2YWWA 2OLWA 5D4OA 2GAHC 4LBPA 1VI7A 2VOPA 4NA3A 1REGX 5L9NA 1QJHA 3H25A 2CQIA 5HVGA 5RUBA 3PR5B 2FJXA 3HXMA 4Y2CA 3LAKA 3CIMA 3G87A 1K9MT 3CWJA 1GT8A 2ZZNA 1PYSB 2DB1A 4AXJA 3CMAS 5K8MA 2JEJA 2BJEA 3KG1A 2HEKA 3HZEA 4IFYB 2M7SA 2QA2A 1KN6A 2ATLA 2YNIB 2VKRA 4QYRA 2WVCA 3KK1A 2DR6A 3BKFA 2HPUA 4ANCA 2KT3A 4U7CA 1XMQF 4JUZA 2CQ2A 3OUYB 2V69A 1UPPA 8ATCB 1HD1A 2IM3A 3M2UB 1IKYB 4DFJA 3AFGA 2HQFA 3ZFVA 2GQ2A 3RG6A 5GAEI 2B56A 4OZ2A 3C6UA 4QQBA 3DDNA 3QT8A 3UD3P 4QIFA 1JLFB 3E8OA 1U09A 3CJ0A 4R0JA 4TKTA 3MR7A 2WTFA 4C9DA 1RTHA 2BQRA 4DSLA 2HHSA 4BWMA 2VZ9A 1IN0A 2RE1A 2ABYA 4WK1A 2KL8A 4J9SA 1RT5A 5E3QA 4OQJA 1RT1A 1PAEX 2HRTA 2XZTB 1RTJB 2DRDA 5BYRA 3KJVB 4NXNF 3HDSA 2MB0B 3KWMA 1HWUA 1GK8A 1S1XA 1IR0A 2MPUA 2NXNA 3D0IE 5LOQA 3W2VA 3VHQA 5KFFA 3QLHB 3T19A 1SKWA 3AODA 4EZ6A 2HKEA 5C24A 1Q5VA 2A6OA 2PEBA 4Y3CA 3LP1B 2KXFA 4L75A 4PPZA 1HI1A 4JI4F 2IHR1 4HDGA 2N4DA 1TL1B 3TJAA 2M70A 1HI0P 4O4RA 1KQKA 1X4GA 1FFSB 5A2QU 2YX1A 2A2CA 1KVIA 1V3RA 1NDLA 2CJAA 1OJ4A 2RQ4A 2J6UA 1GX5A 1R8CA 1VC6A 5A76A 4YB1P 1T9WA 4PG5A 3C2PA 2OD6A 1HI8A 4EO6A 1X4HA 4H4MA 1MMLA 4HTIA 3BSNA 1S12A 4DUYJ 2OEJA 1VBYA 4MTPA 1YRTA 1T05B 1HNZF 2AU0A 1HARA 2FZCB 4ED3A 3R1LA 4F3OA 4RW7B 5E5NA 3H2UB 4N56A 4Y2AA 1LFWA 3H90A 5GAGU 2ZE2B 3N5BA 4FYVB 1S1VA 4S0MA 3FBCA 3HCXA 3QGHA 1KVJA 5BXIA 1FNXH 1TKTB 3OJSA 5BR8F 5IT0A 4DL5A 2BV3A 2DPJA 4GC6A 2JRSA 2ACMA 1N5YA 3DDKA 4J9LA 1S0OA 2X51A 4FNHA 1X5OA 5ETKA 4RU2A 2QLBB 4DL2A 3GTYX 4LRAA 2JZ5A 1NSKL 2FHKA 4CO1A 1MU2A 3PEJA 4QWDA 4DCJB 1DHMA 1FRKA 1HNIB 3GCWP 5DG7A 4KQZA 5C42B 2DR5A 2VD3A 3NMAA 1DZ5A 2VG5B 3O2IA 3CJKB 3U7JA 3VGVA 3GFXA 1BY9A 4NASA 1LEOA 3KLGA 1S59A 1Q86T 4P2MA 2PT0A 1RWOB 3CC7S 2RVJA 3RB3A 2H48B 1NAQA 2ZH3A 3JQMA 1FXDA 2PMZD 3G8TA 2OELA 2DNRA 3UO0A 1E6YA 4GC7A 1HR0J 3QJPA 1S5ZA 3J81j 2VQEJ 1ULRA 1DARA 5DJBA 2DNHA 4NRUA 2YWGA 4ILRA 4U7UD 3SQOP 2UVWA 1RA7A 1IBCB 3G82B 1TZ0A 3NP5A 2BDPA 1P1LA 5K8NA 4B3OB 2V6AA 3AD7C 4OYMA 2FUG9 2LU1A 5DETA 4WIIA 2K2PA 5CH7B 3JSRA 3TOQA 4ICLB 3RAXA 2R8GA 1L5UA 1RZMA 1HHSA 5A8WB 1WTFA 3G96A 1KLMB 2DHHA 2V4JA 4QBUA 4YB7A 4KO0A 1QUVA 3NL0A 8AT1B 2O1PA 1WOOA 3D6MB 4ZVOB 2KI2A 2KZMA 4EBDA 4NA1A 3TUIC 1EETA 2ZUAA 5I42A 3N9UC 4C8OA 4DQRA 3BDPA 1KQFB 1S72S 4EUVA 3MCMA 1YJVA 1F60B 3QIDA 2E5HA 3GIRA 5KG0A 3PHTA 2MLZA 1R8BA 3Q8PB 2CQ1A 4V19X 4DPTA 1HNWJ 2QSWA 4H54A 1W2BR 4Q2MA 2E7WA 1DRZA 2V50A 1GTEA 4GKJJ 4OHYA 3AH6A 1T03A 3OV7A 4ED0A 1QY7A 3W63A 2DH9A 3C16B 4M5KA 1C2PA 5T41A 3AHPA 2V8PA 3NG8A 4YOEA 4C8MA 4C98A 1IUJA 1JLGA 3MCSA 4H4KA 5J2QA 4TU9A 3WQPA 2J9CA 4ED2A 3I0SA 4ECWA 2KYXA 2H5JB 3OL7A 3OW2R 4NI2B 1VQKS 4O3QA 2CDQA 1CQNA 4NL5A 1EKRA 1VRUB 3HHLA 4XO0A 2C3OA 4PAAA 1UKUA 3K57A 4P75A 1KR4A 4DCPB 4F4ZA 2K06A 4IRKA 3D9BA 4JI6F 3AAWB 2B5JA 3H40A 3BPSP 1GMUA 3W1YC 1GXTA 3CGIA 3T41A 4X4NA 1WC6A 2W24A 3IR6B 3SI8A 2A6MA 3JQKA 2AX1A 2AT1B 2CJXB 2KXHA 1DTQB 5HVFA 4UQGA 4XDCA 4N5SA 2KN4A 3CE8A 2AF6A 4PWUA 1O0PA 2DH8A 1L3SA 5F3TA 4OLPA 2YKAA 1MROB 2Q3PA 4C0OC 4WZMA 3BGOP 1D8ZA 2HVEA 1BWEA 2XI2A 4Y28C 1V5IB 4R0EA 3PFEA 2I0XA 2KVIA 1HBOB 4F4XA 1X4BA 1RDRA 5LM7E 5ETLA 1JLEB 4ZPWR 2LA4A 3WBZA 4GVBB 3J7AN 2BKOA 3ZNUA 3MM9A 1WTBA 1U2RA 3KLHB 2MLXA 4K59A 1HL6A 2RRNA 3CEDA 3H5YA 4DFPA 2CQ0A 3MM6B 3OLAA 3OL6A 4CLFA 1X9SA 3THTA 2OPRB 1S7IA 5K9FA 3BO3A 4OZ1A 2CPYA 3NNCA 3PJ9A 4M5JA 2HG4A 5DQGA 4LFCF 1IVZA 4LF2A 2BX6A 3IR7B 2J0SD 3V6DB 4Q2LA 1RAFB 2DBBA 5E33A 1X4FA 2B43A 2Z2YB 4HR2A 4WP9A 2F4FA 5GADI 1KQSR 1RHMB 3D6FB 4LSNA 4HI2A 1S9EA 4IFYA 2DY9A 4ZLJA 2MKSA 2GIQA 2W9BB 1N8RT 1SB6A 4C0HA 2WZ1A 1VQ9S 2YNIA 4LR7A 3KK3A 1IQZA 3TR5A 2FVRA 4OZ5A 1LQ9A 2JDJA 4OYWA 4X64J 3OHBA 3OUYA 2G2ZA 1K1SA 2MTLA 4PYDA 1OMSA 4X4SA 1ELOA 3KYLA 2VFVA 2ADCA 4DXLA 1NPPA 2FLNA 3DU5A 2MY7A 3K5MA 4LRFA 2AJ0A 1RE1B 5HROA 1ITPA 4M5NA 1T9XA 3ZZYA 2GHPA 2HWIA 1X60A 2H3EB 5HK4A 4K4VA 1YJNS 4B3RJ 1RYSA 3DGPB 4WBFA 4K2XA 3FBFA 1RKJA 2MXYA 2CQCA 3A3PB 3E3XA 3MPYA 1N5VA 1DQ8A 1WEYA 2CUYA 4O23A 4DV6J 4DUZF 3T5LA 3ENAA 3ILIA 5B0EA 4OV6A 4QIVA 2GJ2A 2C28A 1VRQC 2MKIA 3Q2SC 4ID5B 5KT5A 4Q43A 4HI1A 3MHYA 4L6V3 2ZUGA 4A8XA 3C66A 1U4BA 1F1BB 4X62J 1KONA 2XHWA 1TL1A 1ICEB 2DO4A 4F50A 2FY8A 4NPOA 3UI3A 3GR0A 2LU2A 3ZZ0A 4DR3J 4N41A 3IC1A 1N6QA 4ZVTB 3FCWA 3US5A 2NQPA 2VG6B 4ZLNA 1S6QA 2WSFC 3TYTA 4IH6A 1ZA1B 1S4EA 1NXIA 2L9DA 2QV6A 4IYQA 4KHPJ 2FC9A 3JSBA 1VLYA 1HR0F 2BKPA 3PZPA 1RHUB 2IRUA 2QLXA 4KAIA 2UXDF 1VDHA 2RDIA 1NK7A 2EFNA 4DR5J 1T05A 4X66J 3H42A 3HHLD 1UEKA 2PO4A 3TAMA 4IDKB 1K0VA 2QE5A 4M1KA 2Q6CA 4OZ3A 4PG7A 2GW8A 1XQIA 1OY8A 3NGDA 3EMTA 1QSSA 2I5JA 2ASJA 2EG1A 4OHXA 2IRXA 1WEZA 1FKPA 3FCHA 3GPAA 3K17A 3PIOQ 3OL9A 4RU9A 4IUFA 5LMUJ 5BYSA 5B0BA 2WW8A 2DO0A 2HS0A 2DR9A 1TU0B 2XSJA 2KHDA 2B3TB 2ZBCA 2YQ0A 3KLIB 1R0BG 5J1EB 1HYSB 4MMOA 3UDVA 1Q8LA 1SKUB 5C42A 1X9WA 1VQLS 1W25A 1N5SA 2NS1B 4K0KJ 2VG5A 4PG8A 1AYEA 3CJKA 2J9EA 1SQEA 4DSJA 5KFGA 5E41A 1YJ9S 4OI6A 2BM1A 2CG8A 1JKHB 2B4PA 1IKVB 2DRAA 1X4CA 4OX6A 2LQBA 3ZNJ1 2VV5A 3VAJA 1GXUA 1IKWA 2JSXA 3D4JA 4JV2A 1TFWA 5KFWA 4DI6A 1O6XA 3MOJB 4PG4A 1HWIA 3DNCA 4G1IA 4WIQA 3EGVA 1NH8A 1YK9A 5E3PA 2YWFA 1SJRA 3WX8A 3J80U 3G82A 3VR1A 4I1TA 4HDHA 4B3OA 1WSRA 1R0AA 3QGPA 1SH2A 5ETPA 3H8YA 3NY0A 3CCJS 4ICLA 4I2QB 2ZZTA 4M63A 3GYNA 2OI2A 4PWDB 1Q82T 1HD0A 2MZ1A 3HVAA 1KLMA 2VBZA 4WFZA 1ZS6A 3LP0B 3EX7B 3CNQP 2DKOB 1H6KX 3GQCA 3W61A 1SQGA 1GMWD 7AT1B 2YQ3A 1YIJS 5KFTA 1XR6A 3IRXA 4ZCIA 1U1QA 2JC0A 5LL6d 5DDQC 3I31A 1UVLA 3CPWR 1K44A 4ECVA 4NX9A 4NWBA 4IRDA 5E0OA 4DU8A 4FYWB 2DR8A 5CCMA 5KG6A 3UW1A 3OPKA 1SQFA 3R2DJ 2M0GB 3Q22A 4J37A 3NCQA 1WWHA 3KMQA 1RWKB 3EVOA 2FJWA 3QRRA 4ZCKA 3K89A 4I67A 1M5OC 3F44A 4ZVGA 4C7QA 1HQEA 1SV5B 2C3UA 4NLUA 3MR5A 4KRWA 4BS2A 2HFOA 5HANA 2JEFA 3SCKE 1LFPA 1UCNA 4QYZK 1CJUB 4A4JA 4J7CA 1IJFB 4ILLA 2KRBA 3NAIA 1R8HA 3JQJA 4MFBA 2ZH8A 3SZ2A 5U47A 3ET6A 4CP5A 2CNNB 3UFCX 2J7WA 3FFIA 3BGRB 4P72A 1B70B 2H54B 3ISND 4LREA 7FD1A 5D3GA 3EM1A 3QYYA 3WDOA 3V4IA 3KUGA 3PW2A 1QDUB 1UAWA 3ITHB 4NI2A 4EGLA 4EK2A 1LKZA 2DRBA 4N76A 3A3OB 4KSEB 3BS9A 4JI1J 2CAJA 1RAGB 2CPZA 3M2RA 1VRUA 5DRKA 3M30B 5J2MB 3G8SA 1JNRB 1L3TA 1VRTA 4OHVA 4M94A 2LKZA 1HBNB 4RUBA 4K5SA 5EGYA 1S9GB 4PYAA 1M5HA 1VK8A 4X64F 1FCAA 2V4QA 4JV5J 3KTQA 2Z8QA 4ZIWA 4ZP6A 3BGLA 4ZPDA 3BR9A 1I51B 2FYXA 4WE1B 2ILZA 3TJ9A 4DLGA 3HZGA 4PG6A 4UTGA 2O3DA 3VAFA 4GKKF 3I32A 3PNIA 1EKSA 4U8VA 2EKYA 1RTDB 2GC8A 4CZCA 4KFBB 4LQ3A 1MROA 5KFBA 4LRDA 2KVQE 2LA6A 4KBIA 2MZRA 2KH9A 2JOQA 2V8HA 4K4SA 1OPIA 2PMWA 4YMEA 1N34J 3KXDA 4E2FB 3MMCA 2N3LA 1B7FA 2V2ZA 4B3RF 1B0TA 2JLEA 3JTPA 3GJQB 3KJQB 1SC4B 1KD1T 3IRWP 4DWIA 3UCGA 1ZM3A 4FP9A 1F3FA 2IA0A 3HO1A 4GVBA 1U6ZA 3KLHA 5EUHA 3DC2A 4DV6F 1F9EB 1R7IA 3MM6A 4HH0A 1WEXA 1CG2A 2FJVA 4B02A 5FIIA 1WOSA 4HTJA 1TL7B 3THPA 1U1KA 4IG0B 4F4WA 1JXEA 3N5FA 3U1MA 2K1RB 2VG7B 5ETSA 2PI5A 3CJ8A 5A6WA 1C1BA 3OTCA 2RF2B 2M8HA 4H4KC 3JB9k 1NHKL 3GFZA 3W2WB 4O0IA 2KYZA 4DR3F 2F1FA 2VC0A 2D9OA 3FBBA 2EPIA 3GSDA 2CWXA 2GMHA 4NLGA 3QIPA 2W9BA 1IBMF 1NCLA 2BXJA 4LIWA 3HHLC 3P4UB 4KHPF 2D41A 3BN4A 5AE2A 1SUQA 1FJEB 3WIUA 4ES2A 3DOLA 3DRRB 2BOAA 2W2PP 1X5PA 3RR8A 2G0IA 2M88A 3DLKB 4OMFG 3L4BC 3TA0A 3EPIA 4PQAA 4X66F 2W4CA 5KT2A 4C4WA 4PKDB 1PKUA 1F5CA 2V2QA 3ZTRA 3NBPB 1EQMA 1S99A 2J6SA 2YWEA 4EBCA 4UY8T 5KFEA 2F3JA 6AT1B 1I94J 4ZS6A 2I2YA 3VV2B 2OFGX 3BO2A 2CQHA 1RAIB 4CO4A 3DGPA 1HBMB 2QEXS 4FYXB 4CLYA 1XR7A 2IYIA 1UVNA 1R0CB 2HNZB 1RI7A 3ENVA 3PKYA 2GA7A 3MM5A 3MFIA 3KMSA 2AX0A 3T5KA 2JC1A 2M4MA 2HFUA 4ID5A 1TTHB 1Y3KA 1CQMA 3KHGA 3O1LA 4UUXA 1JX4A 4G3IA 4K0KF 4X2BA 2JEIA 4MIAA 1SJ4P 3TQEA 1RT3A 2P9CA 2BANB 5CYQB 5HMWA 4X84A 3NWRA 3A8EA 3Q89A 1WC4A 2L3MA 3VAGA 3T1HF 3QWUA 4ZVHA 4Q8FA 1OWXA 2OTLS 3N79A 1PAUB 2KB2A 2K7JA 3MECA 5F0UA 2CNOB 2Z0GA 2AGQA 3PHEA 4F67A 2Q6BA 2F4VJ 1MMDA 5AXKA 2UVRA 4HACB 4TLQA 2PDAA 2RDDA 5ITHA 3HSGA 5CHCB 4RW6B 2P8IA 4JBCA 2FDNA 2HBRB 2UUCJ 2XYGB 3MD3A 1X5TA 4E98A 2AYBA 5I3UB 4I7FB 3OLBA 2VONA 5CQGA 1KWMA 1UZDA 3I96A 2NR0A 3NOCA 4RUHA 4DL7A 5HATA 3RJMB 2ZOFA 5GMKa 2HYIB 2MZQA 3J81U 3GCXP 5E3RA 1WELA 4K2JA 4YP3A 3MR3A 1HNVB 4QU7A 3VCDA 4YUDA 5SUHA 3BREA 2MKJA 2BKNA 1B7YB 3G4SS 2GQCA 4Y2IA 5HQMA 2HGLA 3CXCR 4QYZJ 1JQGA 2I1RA 4MYUA 3KLIA 5J1EA 1NU4A 4DX5A 3SQGB 8RUCA 2DNGA 3VVUA 3R1HA 3K5PA 4DR1F 1VMBA 4OYZA 2MQ8A 1EP4A 3R7NB 1NRKA 5D78A 4NOHA 2FIUA 4JYAJ 4Q7AA 3UDEA 2JLFA 1J5EF 1RCOB 2FJAB 3LF0A 4OYIA 4DU7A 1QSLA 1RUSA 3NOGA 3AA9A 2BRKA 4RKUC 1L3UA 3P49B 3ISNC 2VUGA 2OPQB 2C1EB 3TUPA 1WUUA 3MAHA 4ECRA 2K7KA 1KBRA 3QFWA 3TA2A 2XO7A 3LAMA 2GHWA 3HHEA 1JXVA 4KR0B 4WXWA 2FZKB 2C2DA 2BABA 3QO9A 2UUBJ 4MKAA 2WB1D 5L1JA 3H20A 4XPEA 4LT6A 4EYIB 2CPIA 5C2GA 4PZVA 1TKZB 5A8RA 2H4YB 2V34A 3UN5A 4I2QA 1BLUA 4O4GA 3DXBA 1CULB 1RTIB 1REVB 4GVLA 4CLTA 1YTYA 2BACA 4RJVA 3U27A 1VIOA 3R7SB 2XMMA 4DX7A 3IS9B 4JV5F 3DDIA 5CZVA 3T1YF 4ZPTR 3QGIA 2Y8YA 1NKBA 5IV3A 3W8PA 1ZAXA 2DR7A 2HAFA 4IFVA 3R7BB 4U9RA 5D0GA 2DTJA 2YNGB 5KAKA 1LWCA 2C3YA 4MKYA 4WP3A 3QZ8A 2EFPA 2NXEA 5DO2A 5KFXA 3OR1B 3DLGB 1VQYA 1X7VA 5LXYA 2G9OA 3J7A1 1N34F 2DNLA 3BBCA 2XWYA 1M5SA 1F2HA 2B6AB 5E7OB 4KGVB 1EARA 3I5AA 5IFMA 1CJUA 4X4QA 1Q4RA 2IFXA 3QRQA 3OJUA 3CCWA 3DMJA 1CBKA 4BDPA 4ZHRB 2LQ5A 4LVOP 1KKHA 4EWTA 4AE5A 1CEZA 5C25B 2RQKA 2EI5A 4EU0A 5DLGA 3BGRA 3MCNA 4ZPCA 4TQRA 3Q0AA 1M5VC 1JLCA 3W7BA 2Y1JA 2MGZB 3FKBA 2GO8A 3GWCA 2MDAA 5DZ6A 4DR6J 1BXNA 2DNZA 4LQ9A 5FDLA 3M8WA 4HEA9 3ITHA 2OFHX 2LCWA 5DQIA 3FVYA 3O6QA 3I4HX 3CMES 3R2CJ 3GB0A 4TQSA 3LGNA 1S7HA 4LFAF 3HKZD 2XO6A 5J2MA 4DV0J 4LIRA 3V6JA 3UWTA 4OJ3A 5J2NA 2QTWA 1HBNA 3IGVA 3I5CA 1HBUA 2XSFA 1H73A 4R5PB 2VHGA 3W5YA 5F8GA 4MH8A 1DLOB 3P96A 4H4OB 4WE1A 3E51A 3FSXA 3TARA 3QNWB 4DV4F 5HI7A 3U1LA 5IM0B 1WG5A 2NYHA 1RP5A 4P2XA 3Q8QB 2W7PA 2FVSA 3VWSA 1RWWB 3M9MB 3DLEB 4ZVEA 3T6JA 3DFEA 1I94F 3R5AA 2XLJA 2DGWA 4Y00A 4RX6A 2AGOA 1L3VA 3DM2B 1HMVB 5IT4A 3M8PA 3CC4S 4P71A 2JH3A 1BQNB 4A8YA 4OX9J 1I5OB 4OYOA 4OJ1A 4ZITA 4ELVA 2VDIA 1MN9A 4DEZA 2AZ1A 3JAMU 4M5DA 2HBYB 2HWTA 1NDCA 3R8YA 1TKXB 4CO2A 2EVZA 3NS6A 4XTTA 4F0HA 3ZZZA 3L7OA 1S10A 3RAQA 1U1OA 5IQ6A 1WOPA 3CULA 3KKFA 5HLFB 4JB8B 2VG7A 1ZAVA 4L72B 1AZSB 1IBKF 3DLBA 5CD4H 4NLRA 1VBXA 4LVNP 3W2WA 1U0HB 4YY3F 3W64A 1D09B 2Z57B 1T9YA 4OI0A 1DAXA 2BM0A 5C7PA 3M9NB 3QMQA 3JTOA 1YJRA 2DGSA 1CC7A 3OTBA 4YHHJ 2B4OA 4NXMF 4NZ6A 2R4FA 1S0MA 3ONQA 4ZVPB 4DL0C 4O3RA 1RT7A 2H1YA 3W62A 3SDEA 1NSPA 2DNYA 3DLKA 2HLTA 3BPDA 1IM6A 2DHSA 3UD5A 1YBUA 1IQTA 4RW9B 3Q8RB 1OQ3A 4MKVA 3H4DA 5HP1B 4PUOA 3NBPA 1S77D 3KDOA 3H0PA 1U7LA 2AJ2A 3PTWA 3VAHA 2YX4A 4FNIA 1V9OA 1NJIT 5F41A 3UD4P 2RJZA 2HQDA 1JB0C 3NXZA 3M8QB 1RWNB 2OGUA 2PN6A 1HQUB 1YJTA 4AFFA 4ZJQA 2LYVA 4P6QA 2C2EA 3SCJE 2X3DA 2HNZA 1OSCA 3VGUA 2PE8A 1KHVA 4USUA 2J6TA 2F8HA 1LOUA 1RT2A 4AT1B 2F9JA 1O8BA 1TUWA 4CM2A 3BH7B 3TEGA 1ZETA 5ETMA 1TV6B 3OFFA 3D2WA 4C97A 4CTAB 1LWFB 4DPWA 1D0EA 3MFHA 3PYGA 4OX8A 4FS1A 2W1BA 4DQPA 4CI0B 2ZHAA 1RK8A 1KOOA 3TVKA 5F3ZA 2LEAA 2C22A 3O5TB 2BANA 4CQ1A 2VBWA 1VYAA 3MMAB 2FTRA 5DLFA 3FSYA 3QJJA 1QM9A 1ZYQA 2BQUA 3QSYB 1RSCA 5GVQA 1S97A 2JL9A 3POTB 2MY8A 2KO1A 3PKMA 4EO8A 4TXSA 2QMXA 2G1HA 5LSRA 2SXLA 3LWLA 3A13A 2X1BA 1TMJA 2CQBA 4HACA 4ECYA 3EPGA 4B3SJ 3DKDA 1TK5A 2XCAA 5HBMA 4ECSA 2GVZA 4YN3B 2PMHA 2POKA 2J8SA 3D0GE 1TUVA 3OBIA 3UDLA 4O3OA 5IT9Y 1A0OB
chains in the Genus database with same CATH topology
1K1SA 2CPXA 2Z4PA 2FHJA 2B9YA 4ILMA 1KTVA 1VQ5S 1YHQS 5H1SV 1GXLA 1ZTWA 2HAIA 1RYRA 4W92B 5FLXY 2CJQA 3TAMB 3UDCA 4DN0A 4FPRA 1ELOA 4X4SA 3CC2S 1YSJA 1KOHA 2E44A 2HHTA 3FEZA 2VB6A 3KYLA 2VFVA 2ADCA 2MHNA 3NWGA 3MI7X 1NZAA 4D3GA 1S6OA 4YR0A 2DISA 2GX8A 2KKHA 1UL3A 2Z2LA 4BCAA 4YDDB 3QZ7A 4K4TA 2FLNA 3DU5A 1D8YA 2R8KA 3E2EA 2FJDB 2MY7A 2E7XA 3PX6A 1HQUA 3OFGA 3B78A 1DTTA 3MGJA 3K5MA 4G6VB 3FQKA 2WHOA 1DTQA 4ZPAA 5J2PA 2AJ0A 3N0VA 1QVGR 1C1CB 4YR3A 2I8EA 2I5JB 3MMBA 1SIWB 2CVIA 5HROA 2OJ3A 4ZA1A 1APSA 2L9WA 1U1RA 3MEDA 2KFNA 3ZZYA 2QYCA 2E9TA 2GHPA 2RT3A 4YB5A 1FKPB 2HWIA 3M6VA 2ZDPA 3H2LA 2BUNA 2HS4A 5CYJA 2E1MC 3EXCX 4TU7A 5E3AA 2J76E 3D1QA 4K4VA 1YJNS 4J9NA 2IC3B 3BSOA 1VC0A 1UA1A 3CDWA 3SQGA 2ZNZA 1NB7A 1FD8A 2GCFA 4NLVA 3VQTA 1RYSA 4K2XA 1P8GA 2IBKA 1N48A 1RKJA 1Z1ZA 1VIXA 2JVRA 2XLKA 2MXYA 3VAIA 1RKIA 2CQCA 4Q0BB 4CH0S 1TV6A 1QAYA 5JVHQ 2N4CA 2XSJB 3OTDA 1QLNA 2UXCF 4CTAA 2MJNA 5CYMB 4DS5A 4KJIA 2N3OA 3E3XA 3MPYA 3NGKA 1N5VA 1HBOA 1DQ8A 2EFQA 3V81B 2K3IA 5AXMA 1DQAA 1WEYA 3JSMA 4O23A 4WCEQ 1F9FA 2DPIA 1S1TA 3B4MA 4DUZF 3T5LA 1VBZA 1U25A 2MYFA 2ZC3A 5B0EA 5KT4A 1JLEA 3G9CA 4ED5A 1A9NB 1LW2A 4QZVB 1TFYA 4QIVA 4KGKA 2BJDA 3K0JA 2GJ2A 3S01A 2C28A 4AYBD 2MKIA 2R7TA 5IWAF 5F9LA 2D9PA 2XS5A 3OFEA 4I6AA 5FJ4A 3MMAA 3IGNA 3Q2SC 4ED7A 4B9LA 4LF9F 4ID5B 5KT5A 2J9DA 5JVGQ 3FJ2A 4R8UB 2XBPA 4LF5F 4Q43A 4HI1A 4LF4F 1OSDA 3HHDA 1O5JA 2C3MA 1XMBA 4B9VA 5G0RB 3MHYA 4L6V3 4B9UA 4IQXA 2OPQA 2ZUGA 4A8XA 1LW0A 3C66A 3KNGA 4P7TA 2D3UA 2QSFA 2IVFB 1U4BA 1N54B 2VPWB 1SL1A 3D1HA 4IG3A 3FRYA 1KONA 2XHWA 3DYAA 3TRGA 4C3MA 1TL1A 2LDIA 4F2RA 3NCRA 2OPRA 2VOOA 3RB4A 1N32F 3MEEA 5KG5A 2UUAF 4QR2A 4B3MF 3N4WA 4NCAA 2XI3A 2DO4A 4F50A 4Z2XA 4F02A 3S8SA 3K8VA 4NPOA 1FXRA 2YKQA 3UI3A 5KFAA 3GR0A 2XMUA 2LU2A 4G1PA 3OTOF 3ZZ0A 1S1WB 3M32A 4N41A 4DL3A 3IC1A 3IO1A 1XC9A 5KOWA 4LF8F 1N6QA 4PR6A 4X62F 5E2QA 1X4DA 1P27B 3US5A 2MHEA 2NQPA 2VG6B 3M6XA 1S6QA 2WSFC 4FF2A 2H5EA 1IKWB 3TYTA 3V6DA 3GFHA 2VKZG 3BDEA 4RZRA 4A8FA 4IH6A 2MQOA 1WHXA 3PRDA 3UNGC 4TNOA 2CQGA 5CCLA 2I9SA 4FN5A 1E6VA 4PRFA 3JYTA 5F8NA 2A2DA 5E3CA 2V9WA 3LO3A 2J0WA 2M3DA 2MMYA 2L9DA 2QV6A 1XEZA 1LK5A 4IYQA 4F25A 2R8JA 3CCRS 1QSYA 1WF2A 6FDRA 2FC9A 3PY8A 3JSBA 1VLYA 2DH7A 1HPZA 2EBEA 5KFNA 5A0YA 1HR0F 3PZPA 3ZZPA 3KLEB 2IRUA 1Z4UA 2OPSB 4WU2A 3CD0A 4CT8A 4RUAA 1RT4B 1HWJA 2QLXA 4KAIA 5HQ8A 5FD1A 1FXLA 3L09A 2UXDF 1K8AT 4HT5A 4DV0F 1JWWA 2R7OA 2RDIA 1R0AB 1NK7A 4QCLA 1RTIA 3PJWA 3KLFA 3D28A 3X3UA 2EFNA 1DURA 4DL4A 3HI9A 4WFXA 3HT3A 1R3NA 1T05A 2R7UA 4BBYA 3HHLD 2G13A 2KHCA 3SFGA 3OQ2A 3BO4A 1R27B 2PO4A 2R7VA 1I6JA 3TANA 3I5BA 3ZZTA 1V6HA 3TAMA 3PW4A 4JI3F 2AJ4A 4JI5F 4IDKB 4K4UA 1K0VA 2R2UA 1NK8A 3IXQA 4ELUA 2QE5A 4M1KA 2Q6CA 4J9RA 3KK1B 4DR5F 4WZQA 2CPEA 4PG7A 5DS7A 2GW8A 3P3DA 5KT3A 3MM7B 1FERA 2ZNYA 5LJ5Y 3MURP 3N6LA 4X4VA 4ECTA 1TAUA 2IYGA 1T95A 5EX3A 3NGDA 5DDRC 2KM8B 4DS4A 2JX2A 4IRCA 2XGQA 1QSSA 4PXCA 4WFYA 3J81Y 2WAQD 3O8WA 2WOMA 3CCMS 1J5OA 1C1CA 2MKHA 2I5JA 4NLWA 4GO7X 2ASJA 3TVZA 2EG1A 4DQIA 4WFAQ 3HHNB 4OHXA 2IRXA 4ELTA 4PXBA 4FXWA 4TY8A 2YNGA 1WEZA 2KU7A 2Q79A 1FKPA 1N4LA 3FCHA 3IRXB 3I4PA 5DG9A 3FQLA 2F9DA 4D3HA 2QZ8A 1ZH5A 1Q7YT 1SI9A 1UEVA 2DD8S 3PIOQ 1M5PC 3OL9A 5F8LA 4RU9A 4IUFA 2E5GA 2FB0A 4QR0A 2NSBA 1JLAB 5BYSA 1VC5A 5B0BA 2ZH5A 1B0VA 2HW3A 2WW8A 2RU9A 3I0RB 2DO0A 3MPWA 2HS0A 2DR9A 3H4BA 2XSJA 3F56A 2KHDA 2QA4G 2B6AA 1RTHB 4QW8A 4KGMA 2B3TB 1QE1A 2CFXA 2GO9A 2RS8A 4JI7F 4LFBF 2RH3A 3V81A 2X1AA 3DRSB 3MR6A 5LMUF 2ZBCA 1S0NA 2M8DB 2UVVA 3KLIB 1WG4A 5J1EB 2Y1RI 2ASYA 3IWLA 1RT5B 4QIGA 1B64A 3LANA 4OFZA 1HYSB 4MMOA 3OSPA 2XEXA 1Q8LA 4RW4B 4FVCA 5C42A 1RT1B 1VQMS 4LSLB 3SV4A 1UETA 1RJJA 1X9WA 2FY1A 1HQEB 2RMLA 1TL5A 4URSA 1NK5A 1ZAWA 1VQLS 1W25A 2XWXA 1JK9B 1N5SA 2NS1B 1U49A 3RAMA 2VG5A 4PG8A 2FD2A 5D8HB 1X8DA 1VHFA 3CJKA 3ETOA 1U6BA 2J9EA 3LPYA 1SQEA 4OZ0A 1NK0A 1R31A 5KFIA 3TA1A 4M95A 4DSJA 5KFGA 5E41A 3BB5A 1YJ9S 3T6BA 5G4DA 2ZJPQ 3CJ5A 4OI6A 4B3TF 2BQ3A 3K59A 2ASLA 4KB7A 3AA8A 4I6WA 5HL7Q 2BM1A 2DCLA 2DJWA 3GR1A 4NLPA 1JKHB 4MFBB 2B4PA 1IKVB 2IVMA 2DRAA 4I6YA 1X4CA 4OX6A 1R8PA 2DT9A 2CVEA 2BVZA 5JUMA 2LQBA 3KG4A 3V6KA 3T9NA 3UQSA 1U48A 3OL8A 2XG8A 1FJCA 2VV5A 5K8PA 1TQLA 4HYKA 2ZD1B 5D4NA 1NK9A 3FFIB 3EZUA 4YFUA 2ZH7A 1NH7A 3VAJA 1GXUA 1OPZA 2VG6A 2DNQA 3KLVA 3PV8A 2ZJQQ 2M9KA 1G6BA 1IKWA 3LP2B 2JSXA 4JV2A 1TFWA 1NHUA 4C8YA 5KFWA 5DM6Q 5D3GB 3U02A 2W9CB 3V4IB 5A2QY 4MIBA 4MYTA 2N82B 3C6TB 4C8KA 3MOJB 5DGBA 1PSDA 3J7YU 2QA1A 4PG4A 1HWIA 4C0BA 1SL2A 3VQSA 3IBWA 2CG4A 1IKXB 2P6SA 3DNCA 3HKWA 3I87A 2I38A 3M9OB 4G1IA 2KJVA 2QMWA 1NH8A 3H5SA 5E3PA 1FVSA 3Q24A 1G7CB 2YWFA 3MM8A 5KFPA 1SJRA 1LXJA 3M2VA 3OR2B 5H9EJ 1KEKA 3DU6A 3PFOA