3MURP

Crystal structure of the c92u mutant c-di-gmp riboswith bound to c-di-gmp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
b'RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical determinants of ligand binding by the c-di-GMP riboswitch .
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3murP00
2MJNA 1WHYA 2MQPA 3PIPQ 4CH1A 2AYMA 2J8AA 1NO8A 3UE2A 1NJIT 3CD6S 2MQNA 2D3OR 4WKRA 1N54B 1UW4A 4TU7A 2DGOA 2YH0A 2N3LA 2U1AA 3N9UC 1SXLA 2M2BA 2LEBA 2M9KA 1M5KC 2M88A 2DH9A 2JRSA 2XNRA 2DNYA 2CQDA 1U1QA 1WHWA 1X4BA 1ZH5A 4W92B 2O3DA 3BS9A 2LMIA 1QVGR 1KQSR 1S72S 2JWNA 4LMZA 3BO4A 2A3JA 3CC7S 1YJNS 1U1RA 3P6YC 2KHCA 1KC8T 2NLWA 1IQTA 1KOOA 2KFYA 2VOOA 3Q2TC 1OIAA 3BO3A 2K3KA 2YKAA 2D9OA 4ED5A 4C4WA 1M90T 1YTYA 3MD3A 1SJRA 3V4MA 2I2YA 2JVRA 2MZ1A 4C0OC 3VAFA 2CQBA 2OIHA 5FJ4A 1U1NA 1H2VZ 2G4BA 2KXHA 2M8HA 5H1SV 2HYIB 2PEHA 1QM9A 1DHMA 1JJ2R 2CPIA 3CPWR 1H2TZ 3P3DA 2KG1A 1A9NB 5ITHA 2L41A 3SXLA 2AD9A 5IM0B 1DRZA 3SDEA 1D9AA 3FEXB 2UP1A 2LYVA 3B4MA 2RQCA 3HI9A 2MGZA 2D9PA 2CQCA 1VQOS 2K8GA 3FEYB 5LXYA 1JMTA 3LPYA 4WFNQ 2PE8A 4YOEA 1X4EA 1CVJA 1K8AT 4FXWA 2MY8A 4P6QA 4F26A 5DDQC 5DDPC 2MPUA 1M1KT 1SJ4P 1DZ5A 4UQTA 3S6EA 4RU2A 3R1LA 2KG0A 5GAGU 3THTA 5BJRA 1VBZA 2X1FA 2N82B 2KXFA 2LA4A 3G71S 5CXTA 2RS8A 3ZZYA 3CXCR 1X5OA 5HL7Q 2MJUA 3CC4S 2FC8A 5GVQA 4Z2XA 4FXVA 1VQMS 1WI8A 2N3OA 2KM8C 1M5OC 3VAHA 3UCZP 2CQ0A 1UP1A 3RW7A 2N7CA 1WWHA 3EGZA 2XB2D 2OTLS 2M70A 2EVZA 3CMAS 2ZJQQ 1VC5A 4BS2A 3CULA 1YHQS 5CYJA 1R8PA 3MI7X 2G0CA 2MZTA 2XS7A 2L08A 1FXLA 2VONA 2MHNA 2MXYA 2U2FA 1VC0A 3VAJA 2KRBA 2MGZB 3CMES 1SJ3P 1X4DA 3NNCA 1U1LA 3US5A 1KOHA 3ULHA 2DIVA 2AYBA 2MZQA 1FJCA 1HA1A 2ADBA 5LJ5Y 5IM0A 2DHGA 2CPYA 2MKHA 3MD1A 1ZZFA 1U1MA 1F9FA 2DGUA 1DBDA 2AYEA 2DIUA 3RW6A 2DHSA 2LCWA 2LKZA 4PR6A 2MZJA 3MOJB 1X4CA 2HGLA 2MKJA 5JVHQ 2HGMA 5LSOA 2RQ4A 2FHOB 1VQ8S 4WFAQ 5D78A 3I55S 3I56S 5IQQA 4IUFA 1WHXA 3CCJS 2J0SD 2SXLA 2HVZA 1FJ7A 1OPIA 1WF0A 2DNOA 1RK8A 2HZCA 3VAGA 1Q86T 2CPFA 1VQ5S 4M5DB 2CQIA 2J76E 4YB1P 2OJ3A 1U1OA 1PO6A 1WEYA 4TLQA 2I38A 4YUDA 4IOAQ 2BZ2A 2E5HA 1R8HA 1VQ9S 2CQGA 3CCSS 4CIOA 2RUGA 3IRWP 5D77A 3B4DA 5CA5A 5MLCV 2LA6A 2CQPA 2DNZA 2DNKA 2ADCA 3CTRA 4QQBA 3EGNA 2DGWA 1OO0B 5EN1A 1X0FA 1KD1T 5IFMA 1YITS 2OTJS 1O0PA 1YJWS 1JJ4A 3J7YU 1X5PA 3NS5A 2RNEA 4F02A 4WF9Q 1X4AA 1Q82T 2EK1A 4IO9Q 2LXIA 2YWKA 1FNXH 5GAEU 1G2EA 3CCMS 2ERRA 1NU4A 3JB9k 4F25A 2KN4A 1H6KX 2JVOA 4EGLA 1VQLS 2RRBA 1VQKS 2DNRA 2XS2A 3UD3P 4TU9A 2EK6A 2OSQA 3MUVP 2L9WA 1N52B 3K0JA 1X4FA 1B7FA 1YIJS 5GAHU 4W90B 1VQPS 3G4SS 3CC2S 2LECA 2F9JA 3DLLQ 2E5GA 2CQ1A 4WIIA 2M0GB 2DB1A 2MQQA 1WEZA 2J0QD 1VQNS 3S8SA 3CCRS 3HHNB 2OSRA 1U6FA 1U6BA 3CCLS 1SJFA 3P5TL 1WG5A 3CUNA 2DNLA 2WBRA 2XSFA 2X1BA 1P1TA 1Q81T 1UFWA 1YWXA 1YJ9S 3G8TA 4QU7A 2KT5A 2DK2A 4U67Q 5JVGQ 3H2UB 2MZRA 2MKSA 1PGZA 1WHVA 1FO1A 1K9MT 3EX7B 2ZJRQ 3UD4P 3TP2A 5DETA 4PKDB 2RS2A 3SMZA 1W2BR 4CH0S 2FPHX 4J5OA 3TYTA 1SJQA 2V94A 2HGNA 5LJ3Y 2DO4A 2CPZA 2MZSA 1K73T 4PRFA 1A7GE 2DNNA 2KI2A 1AUDA 2DNHA 3LQVA 4A8XA 2BOPA 4TU8A 1N8RT 2MYFA 3G96A 2M52A 2DNQA 3J7ZT 4LIRA 1VQ7S 2KRRA 1VBYA 1WELA 1XN9A 1RKJA 2MQLA 2RRAA 2F9DA 3BEGB 2XNQA 4OZ0A 2DGQA 2DHXA 2KM8B 2MB0B 2CPEA 1YI2S 4LJMA 3DXBA 2XS5A 2LQ5A 4WCEQ 2CQ3A 1P27B 1WF1A 2KVIA 2DH8A 3PIOQ 1U2FA 2DGSA 1QVFR 5GMKa 2YH1A 1OWXA 2CPXA 1WI6A 1M5PC 3R27A 2CJKA 4CQ1A 2DNGA 3CF5Q 2KH9A 3ZZZA 3CCUS 3OW2R 5DM6Q 3S01A 2DGXA 2MSSA 4QPTA 1U1PA 3CCQS 2AYGA 2DO0A 1HL6A 2MQOA 2ZJPQ 3VAMA 5DM7Q 2M7SA 2NZ4A 3BO2A 2QA4S 1X5SA 2DH7A 2LXUA 2VODA 3D2WA 3S7RA 2CPDA 2MKKA 2KXNB 2E5IA 1FJEB 1S79A 2MMYA 2YTCA 1M5VC 1HD1A 2CPJA 2DNMA 2E44A 3UCUP 1FT8A 2CQ4A 1WTBA 3NS6A 3MUTP 2MKCA 3VAKA 2LEAA 1WG4A 2G1DA 5DDOC 2DGTA 2JX2A 2KYXA 4UY8T 3U1MA 3VALA 1VC6A 3P49B 3G8SA 2QEXS 3THPA 3IWNC 2X1GA 2FY1A 2DISA 2CPHA 1VBXA 2E5JA 2X1AA 3R1HA 3NMRA 2DNPA 3CCES 2GHPA 2MY7A 2MKIA 3H2VE 3VAIA 1X4GA 3U1LA 4OZ1A 3VF0B 2QFJA 5GADU 1VQ6S 1VQ4S 4ZKAA 2RVJA 3MDFA 2RT3A 5LXRA 2KU7A 2MSTA 4Y00A 1D8ZA 1URNA 3NNAA 3UCGA 1X4HA 1U1KA 4QU6A 2CQHA 3L3CA 4WFBQ 1WEXA 2Q79A 1X5TA 4IOCQ 3NNHA 2VOPA 1JJHA 1UAWA 3TO8A 2F3JA 3CCVS 3MURP 5LSLA 1L3KA 5HO4A 1WG1A 3MUMP 1HD0A 2DITA 5DDRC 4C7QA 3UWTA 2FC9A 2GO9A 1ZZNA 1WF2A 1FHTA 4Y0FA 2DGVA 1Q7YT 2CQ2A 2M4MA 4ERDA 1N88A 2M8DB 2B0GA 2DHAA 3G9CA 1BY9A 3G6ES 1H2UX 3Q2SC 4V19X 2MQMA 3SDEB 3MXHP 2RU3A
chains in the Genus database with same CATH superfamily
5GAHI 1XMOJ 3EUNA 3D0IE 4DV2J 1V3RA 2DT9A 4C8KA 2V4JA 1YQHA 2ZH5A 3V4IB 4LSNA 2VG5B 4IG0B 2O3DA 2ZKUA 2QC3A 2VC1A 2IM3A 3Q0AA 1AXQA 1ELOA 4OJ1A 3CC7S 3W64A 1S7IA 3P6YC 4DXLA 1IQTA 2AJ4A 4RNNA 2AKWB 1FJGJ 3QGIA 1EQ0A 2HVHA 1H38A 1RADB 4I69A 2XLIA 1DHMA 5A8KA 3P45B 2BM0A 2C2ZB 3OFEA 3DHXA 1S1XB 1D9AA 4MYUA 3M2UA 1BQMA 4FYYB 2C3UA 1VQSA 5A8RA 1RUSA 2RILA 2D69A 5SZTA 3RZAA 3J7Z5 2GVDA 1M1KT 1Y3JA 5I3QA 3VZHA 4DQSA 4NLVA 4DJBA 2G2YA 2AGOA 4C11A 1F5BA 2KXFA 3NOGA 3CC4S 4K4YA 4PQUB 1TVRB 2AEMA 1IKVA 2ZJQQ 1VC5A 2ZC4A 1F2HA 1LKZA 1RT3A 1B3TA 3MI7X 3RYLA 1V5VA 2VONA 1VC0A 4ZK7M 2GGPA 4EYIB 2DR8A 2MZQA 1PYSB 2W8LA 1GX6A 1UW9A 3L7UA 4H4KC 1M5HA 2DEIA 2IM2A 3MM9B 1X0PA 4HDHA 2D1CA 1FDDA 3FCHA 2PIIA 2PMZD 2NUHA 4KB7A 3GQCA 3HD1A 1XMOF 1S97A 4PZVA 4MK8A 4DV2F 1UVNA 3RB3A 1RTIB 1VRTA 1RT1B 2ZM6J 5HVFA 4C0HA 3DNCA 3AOAA 4C9DA 1Y00A 2OKQA 3DLKA 4IOBA 3HM9A 1X4AA 3OXFA 3OTBA 3PO4A 2MQ8A 2OUGA 2KT2A 1FJGF 4DR6J 4B9VA 1R43A 2MLZA 1BWVA 1WORA 3QATA 3NCRA 4AYBD 2PA8D 2XG8A 4MKBA 2J0QD 3TAQA 2XQCA 3EPGA 1SUQA 4RWWA 1TKXA 2XYPB 4DL7A 2KZMA 5HQMA 4B3OA 3FEZA 5HLFB 3CJ0A 4PG6A 3WHIA 5GADI 3AOBA 3BSOA 3TX8A 5ETMA 4OHZA 1TFYA 3CDEA 2HGNA 3GIRA 3D67A 2ZUGA 4CH7A 1K73T 4DS5A 1TAQA 4IQXA 5KT6A 1HPZA 3MTKA 5KT7A 4TU8A 1NB7A 4LIRA 4UT4A 4J91A 3NOCA 3M8PA 1D1UA 4PXDA 1E6YB 2R8KA 3GJTB 1T9YA 2WB1D 1UFLA 2N4CA 1MMDA 2IIHA 4ITSA 2XI2A 3H98A 2QMWA 2BJ8A 3MFHA 1SKUB 4GMKA 1TL1B 4ECQA 4MTPA 3PDNA 3PEHA 4OHWA 1IUJA 2ZJPQ 1D3WA 4GO7X 4V19J 2IFXA 1NJWA 4M5MA 3S7RA 5MAOA 4FKYA 1S9GB 4KHMA 4MFBA 6FD1A 4IFYB 3KUHA 1S0VA 3RU0A 5C25B 3D6MB 1FKPB 3HHKA 3N79A 3GIMA 4OI4A 3FMWA 3EICA 5LXRA 3VTIA 1GTHA 4EYHB 4ZVSB 5IC6B 2DD8S 1S9EA 2HWHA 3PKYA 1X9MA 2CQHA 4DR6F 3IM8A 3O6QA 1HNZJ 2CZVC 1YRUA 3JYTB 2R4FA 4TLRA 4KGKA 4Y0FA 2NXJA 2Z30B 4CT8A 4DFMA 5KG0A 4MIAA 1Z2ZA 3D0GE 4PWUA 1S0NA 1WHYA 2H3EB 5GAGI 3U1NA 1N34J 1U4BA 2WSCC 2LQBA 4QIWD 4O0IA 1XR5A 4C97A 2BXJA 3HVTA 2IYIA 2R7UA 2DRBA 4BHQA 1JWWA 4ENOA 2KJWA 2RUSA 3A8JA 3H5UA 3W2VA 2VBZA 4H4OB 2KT3A 5IT9U 2J5AA 2K3KA 3L7OA 3R2DJ 1M90T 1YTYA 2JVRA 5KT3A 1HYSA 3GV5B 4J90A 3KK2B 3M4XA 2L3MA 2DHHA 3DMJA 1ZPVA 2KL8A 3V6HA 4LRCA 4KIAA 2MGZA 2D9PA 3U7JA 4ED2A 1HNIA 2ZEJA 4H54A 2PE8A 1ZAWA 2W1BA 4K4WA 5DDPC 1LWCB 5FDLB 3GFZA 3N28A 2RS8A 2DR5A 2MJUA 2BRKA 3EE3A 3KK3A 2MEWA 1M5OC 1FERA 3FSXA 1TTHB 3RB4A 3EGZA 2OTLS 4FYWB 3TQEA 4FKXA 2COLA 4WXWA 2G1HA 3V81B 2BE7D 2Q3PA 4LBIA 4ECUA 1FFSB 2E7XA 1X4DA 3T19A 2IJRA 2ASDA 3BPDA 4AXIA 1HNZF 3TRGA 3HSJA 4C8LA 3D3CJ 2PO4A 2VBYA 2HPUA 3Q24A 2J8SA 5HMXA 3GV8B 5D78A 1N5YA 1SL2A 3VCDA 3X3UA 3SSRA 2CQIA 4K4UA 4JP8A 1N34F 3JQJA 4OHYA 4FYXB 2ZBQA 3MFIA 1KLMA 4LRFA 4G1IA 3CO9A 3CJKA 4RUAA 1AROP 1UMJA 1HW8A 1RAGB 5F3ZA 1KD1T 2BDPA 5IFMA 4YDDB 1S10A 2CNNB 1PYOB 1NKBA 1PJ5A 2ZD1B 3CCMS 2QGFB 4UOFA 2JVOA 3BGRB 5CH7B 2RIJA 3SFUA 2L9WA 1U8SA 4ZVEA 4ED6A 5FLXU 4WU2A 4H4MB 4NLYA 1WEZA 4MH8A 3TUZC 4M5LA 2OSRA 3A1YG 2V68A 2E1CA 3D1OA 3PJXA 2KT5A 3CJ4A 2YWFA 5DETA 3PFOA 1TAUA 4KH0B 2YNIA 3IR6B 1A7GE 4HHUA 3PKMA 2J7KA 1RACB 4ZA1A 1N8RT 5KG1A 2ZZNA 2HAFA 3R9LA 2GMHA 4M5KA 2RSQA 4QIVA 3AJDA 4ZPDA 1ZYQA 3ENQA 4WZQA 3T5JA 1TK8A 4DQIA 4XAKA 3DYAB 3HJVA 1FTRA 1DARA 1S49A 1C0UA 5E7OB 4N47A 1J27A 2DO0A 1ZM4A 2EI5A 4TYAA 1YLXA 3C15B 2JL9A 4NE9C 2FHMA 1S79A 2CQ4A 2BEFA 1S1VB 5C7PA 2ACYA 5CYMB 3MUTP 2MKCA 3VAKA 4WP3A 1UJ4A 3Q8UA 1HHQA 4ID5A 2RU9A 3CDWA 2QLWA 2ZITA 3KG1A 2FLOA 4ZVHA 1KQKA 3MDFA 2EC2A 4DL5A 1XEZA 1URNA 1IKXA 3PCOB 4J9PA 3NNAA 3PYDA 1URRA 2K7KA 3CD7A 3MM6B 4NL5A 2Q79A 3ISNC 4IG0A 3QRQA 3VVTA 4O44A 4Q8FA 2Q66A 2F3JA 2H5JB 2WW8A 1APSA 3NWGA 5DDRC 3TNVA 1FF2A 1OQ3A 2XMVA 1J2VA 1VK8A 4YEAA 3M6VA 4XO0A 4ZP9A 1CULB 2UUCJ 2IYGA 2FZCB 2M2BA 3GJRB 3DDKA 4A8YA 3ZZPA 2FJVA 2XYHB 2C3MA 4ZCIA 1VLOA 3BS9A 2YWEA 1WTFA 4USWA 1UL3A 4M5GA 5B0AA 1LW2B 2XMUA 1DQAA 2QZ8A 3AA8A 5CCMA 1Y5LB 3V4MA 1VJWA 1TVRA 1YBUA 1C4CA 4HI2A 2G4BA 3IGNA 1C1BA 1ULRA 3WZ0A 3EZ5A 3L7PA 4X66J 4DCJB 3VGTA 3SDEA 1A6LA 4DPOA 2JLEA 2QYCA 1HQ2A 3M8SA 1JMTA 3WBZA 3HHLB 3MM5B 4WFNQ 4WFZA 4C3MA 3VHQA 4P6QA 4RBUA 4CLPA 3IM9A 2FVCA 4UTGA 4IO1A 4L3NA 1OY9A 1TKTB 1K1SA 2YNFB 2ZE2B 4QBUA 4FXVA 2Z2YB 2KM8C 3RW7A 4A8SA 5L9XA 3CMAS 2FUG9 2BJDA 1RTIA 1ZTTA 5CYJA 2ATCB 2V34A 2HHPA 1HLWA 3JTPA 2XTJP 3KHRA 1AYEA 3KHGA 2QA4G 2JFDA 3UPFA 2GAGC 1Q7LB 3GU0A 4LF9J 5HVGA 3T1HJ 4JI6J 3LP0A 3MM7B 4WFAQ 3CCJS 1FXDA 2SXLA 4DSKA 3NKYA 4OMFG 3H40A 3R5BA 3HHDA 1FX2A 1IR1A 3BDEA 2HMIB 1WEYA 4TLQA 2UUCF 2I38A 4IOAQ 4AUKA 1CJKB 2CQGA 2IJFA 3R6GB 5D77A 2LA6A 4DPXA 3CDBA 2HFVA 5HLFA 4DBQA 5AE2A 1NK7A 3F0NA 2C3YA 3I9ZA 3G87A 1TL3A 2HHUA 4DUYJ 4ES3A 1PCAA 4ECXA 5KFEA 4RU9A 2CNLB 3GFXA 4OYIA 4ANCA 2FVQA 1CEZA 4U7UD 1N52B 2C2NA 3PYGA 2E1PA 4DEZA 1U0HB 2W2PP 4GC6A 3ZFVA 1Q95G 4X4TA 4X66F 2E5GA 4LQ9A 4JBCA 1U6BA 3P5TL 3IRXB 3AY0A 1Q81T 2DNLA 4M5DA 4ZMMA 3OR2B 3ZNUA 4QU7A 3QSIA 2LFVA 3LO3A 1U8WA 2MZRA 1AUSL 4F4YA 4DPUA 4ELUA 3IGVA 3HVWA 3BSCA 2BA9A 4FVCA 5KFOA 2M5YA 1IR0A 4F2SA 4DX7A 2FPHX 4J5OA 4WIQA 1S9GA 1QAYA 1SJ1A 4CRJA 4IQMA 4IFYA 2MYFA 3GPAA 2ZH8A 1RHMB 4ES2A 5C25A 3J81Y 2H1YA 2DHXA 4TY9A 2JEJA 3MTJA 4ANEA 1FKOB 2XS5A 4HACA 4UF4A 1T11A 1FDAA 3CDUA 1RGVA 4NX9A 2O01C 4DV3J 1TL5A 1F60B 3ZZZA 2NS1B 2AIRB 1S0OA 4ZPCA 2FVSA 4NLDA 2HHSA 4LF9F 1CBKA 5J2MA 3DLJA 3T1HF 4JI6F 4ZPWR 1FJEB 2XMTA 2MMYA 1IN0A 2YTCA 2FGOA 1WC3A 4Y2CA 2WZ1A 4PWDA 3JYTA 5CZXA 4KO0A 3DOKA 3GZ7A 5U47A 3FUYA 3VF0B 1IKWB 3IS9B 2VG6A 3G82B 4U96A 3BPSP 2H65B 2HFSA 3J7A1 4YB5A 5EUHA 4DUYF 2HBYB 3PX4A 1FWKA 4RJVA 3SYZA 4I6WA 4J9SA 2FHKA 2BRLA 3BN7A 4RW8A 5DJBA 2DITA 1S7HA 4JV2A 1FWPA 1TL4A 1FHTA 4ZP7A 4ZPAA 4ERDA 1VIXA 3HZGA 2GMLA 3M6WA 4DFPA 4XDCA 4V19X 4J9LA 1SIZA 1PC5A 2HIYA 1I1GA 4LRAA 1NO8A 2IAJB 2WVEA 3CIZA 1N54B 1SXLA 1KVKA 5G0RA 1UWBA 3O1LA 4CO1A 2DNYA 4B9LA 2FJEB 4D3GA 1FK9B 1PIEA 2OD6A 3PY8A 1U25A 1KOOA 4DF4A 1FD2A 5ETOA 2XO7A 1ZM9A 3FJ2A 4UZBA 1KFDA 4HYKA 3LPEA 4O3NA 4R0JA 2KXHA 2M8HA 4DV3F 3E01A 3RB0A 5M2UA 1CQMA 4F4KA 1H2TZ 1IBMJ 3LALA 5LOQA 1HQUB 4OX8A 4A8OA 3AFGA 3L9ZA 3V81A 3K89A 4DU8A 1Y9OA 3E2EA 4ECSA 3LPYA 3VQSA 2ZUAA 5KFDA 3BGOP 1R6YA 4IH5A 3IA0A 2D3UA 1EKSA 3PNIA 1NZAA 2N82B 1E6VB 5CXTA 5HL7Q 3G8QA 2FC8A 1S1TA 3T5KA 1LXNA 5BYRA 2JEFA 3RBZA 1NH7A 4DL0C 4P7TA 2PSZA 4RZRA 3M8QA 4QWAA 1QY7A 5KFBA 3UDEA 3QFWA 2U2FA 3KLHB 2F65A 1NDKA 4FXDA 3DFEA 5FIIA 3OVBA 1YSJA 1BWEA 2ZOFA 2DHGA 4IG3B 3EM1A 3T9NA 1K44A 5F8IA 4FN5A 2ZD1A 2LKZA 1BE4A 2W7PA 3QLHB 4J9QA 5HMZA 4EEYA 2DR9A 3OFGA 3DGPB 4C8YA 1DTQB 4PXEA 5K8NA 2XHCA 1R6VA 4H4MA 4WBFA 4LUBA 1LWXA 3QT8A 2ZBIA 2GC8A 4EBDA 2N4DA 2QLFB 4A8FA 2AJQA 3I0RB 1I3OB 3IBFB 1X0FA 1NPPA 3WX8A 1YGYA 1SH3A 1YJWS 1YX2A 3DLBA 4N5SA 1VISA 3KG0A 3M9NB 5L1JA 1FI4A 4NLRA 3TVZA 3MMCA 1NU4A 1GTEA 4QIGA 4NZ6A 1SQEA 4OI2A 5IT4A 1RHQB 1U49A 1F3FA 5GAHU 4CTAA 3G6XA 1IBMF 2KJVA 2HFOA 2AGQA 1RCOB 5CYQB 2XLJA 2F5GA 1CC7A 3HP6A 3DRSB 4Q8EA 2VASA 4LF8J 2B9EA 4NXNJ 3H4DA 4F3OA 1RT7B 1MN7A 2P8IA 5KFGA 3S1TA 4CO4A 3T1YJ 4OJGA 4K50A 1RWOB 4A46A 2ZDPA 1SC1B 1S1VA 2MZSA 4ZJOA 4DUZJ 5CYMA 4YY3J 4N76A 3BR8A 2UVWA 3MR7A 2VHGA 4NLXA 4Y2KA 1M0SA 1LWFB 5GMEA 2KFNA 4B9NA 2KM8B 3KLEB 2CG4A 3AD8C 5HN0A 2R42A 1EAYC 2X7IA 5I3PA 4QWDA 3BQ2A 1GXTA 2RQKA 4OLOA 2EC0A 4AXJA 1HBNB 3RR7A 3CF5Q 2KH9A 5KAKA 1G4CA 2Q43A 2NQPA 2ZVIA 2KXNB 4OYAA 1Q8IA 4OQJA 1UEUA 3C2PA 4Y28C 4USJC 4Q0BA 2E9ZA 2QL9B 4OZ3A 3IWNC 3DOLB 4K4SA 1R0AB 1X4GA 3WIUA 1ZTWA 2VD3A 2DPJA 2AEFA 3MEEA 2RVJA 2HQGA 3CJ2A 2C2RA 3CW2C 1GEHA 2IDLA 4OYBA 1XNRJ 1WKJA 1JJCB 2BE2B 1JXLA 1X5TA 4KV8A 2V4RA 3M2RA 3HHLD 3W8PA 1Q5YA 1S5ZA 1BC6A 2EBGA 1Q8LA 1HD0A 1XNQJ 1UVKA 1RXOB 4RO0A 2VJUA 4OLPA 1QAIA 4USTA 4LF8F 3AJ2A 3CD0A 4NXNF 3DOMB 4I56A 3UE2A 2FJAB 3ITHB 1UW4A 2DCUB 2DGOA 4CT9A 2YH0A 2PFFB 3T1YF 4YR0A 3CT9A 3HHLA 5KFKA 3MM5A 4DUZF 2RDDA 3KLGB 5HROA 1KQSR 4YY3F 1JNRB 1DJ0A 4RW9B 2KHCA 2RRNA 1TKTA 3QZ8A 2IM0A 2W2QP 2XULA 3H25A 1NM2A 5D3GA 5IS2A 3VAFA 5SUHA 4OYOA 2C2DA 3O8WA 3H7HB 3QMQA 1H7XA 3TARA 3P3DA 1JLCB 2CDQA 3HXMA 2YVSA 3W9HA 2GQQA 4QIFA 3B4MA 3HI9A 1P6TA 5CZVA 2CQCA 1D09B 4XK8C 1NDPA 1SB6A 1MU2A 1RTJB 1R7IA 3MAAA 2AJ2A 4R8UA 1NK5A 1Q79A 3JSMB 3R1LA 4DL2A 3QWPA 1GH8A 6FDRA 3MM7A 3ZNJ1 4RWXA 7FDRA 2BKPA 3NY0A 4DSEA 3LF0A 1LNQA 1YBTA 3ZZTA 4ATNA 4DWIA 1SKWA 2XB2D 2C2OB 1H3DA 2WONA 3PV8A 3I87A 2JJ4D 3M8WA 2HMIA 5ETKA 3ILIA 3FSYA 3RBXA 4CLYA 2L08A 5JMNA 1XNRF 4U95A 4ZPTR 1RT5A 1J5OB 2B6AB 3LUYA 2DIVA 2WSEC 1MNEA 1QE1B 2B8QA 5IM0A 3UDCA 3DLGB 4O4RA 3EMTA 1DBDA 2AYEA 3FDSA 3TOQA 1XNQF 1RT6B 3Q8RB 3QJLA 2LCWA 1N5QA 3H8YA 1WOPA 2RQ4A 1LXJA 2BABA 2FIUA 4NCAA 4HT7A 1MN9A 1NDLA 1U0HA 5J1NA 4YDXA 1REVB 7FD1A 2DCLA 4K4XA 1QDUB 2RUGA 2YQ3A 3IRXA 3ETOA 5DLFA 4DPYA 3FFIA 5EN1A 2P9CA 2UUTA 3BR9A 1B99A 1X5PA 2OP5A 2HS0A 3UO0A 1FNXH 3FSIA 1VK3A 4F25A 2RDJA 1AB8A 2W4CA 3MMBB 3DU5A 1VQKS 4P74A 3T5LA 3K0JA 1B7FA 3FQKA 2XMJA 1N6QA 1HI1A 4L73A 2WOMB 1NXIA 1FKOA 1RWVB 4YFUA 2LVWA 2B4VA 3DRRB 4NLPA 3T41A 4NLOA 2DR7A 2FZGB 3OQ2A 4F8RA 1W2BR 3M30A 5K14B 3TYTA 4EI2A 3OFHA 3KNGA 6AT1B 2DNHA 1DQ8A 2XHWA 3GYNA 1WOSA 3TZXA 2YX4A 3HULA 2DPIA 1NPRA 3NMAA 4ECVA 3IR7B 4J9KA 1FEEA 3DXBA 3KMQA 2VG7B 1L3UA 2ALZA 2BVZA 1WF1A 3PIOQ 3TR5A 3G82A 1M5SA 3MMAA 1WI6A 3S01A 2HNYA 3BO2A 5DZ6A 3SEOA 3MCOA 4CLLA 5LL6d 1M5VC 1YKWA 1BMQB 1X31C 4BLGA 3NGSA 2ZOMA 5AXLA 1JKHB 2HHWA 3B8HA 2FZKB 4FS1A 3THPA 5HANA 1LFPA 2VC0A 3CCZA 2DNPA 2GHPA 3A8KA 2MKIA 2QFJA 2V4JB 2GIRA 1FNMA 2WTFA 9RUBA 2E29A 2IAJA 2KU7A 2BJEA 4DLGA 3MOZA 5D8HB 3U27A 4QU6A 1JLEA 5T41A 4PUOB 3PX0A 2VV5A 3NNHA 1FK9A 3H42A 3QWUA 5KFUA 1W26A 1WF2A 5A8KB 2LU1A 4N7TA 3W8GA 2B0GA 2R7XA 1G3OA 4PG7A 4M8LA 1NHVA 3E51A 3ET6A 2O67A 3MXHP 4GKKJ 2PT0A 2RU3A 1HWJA 2QFIA 1NRKA 2G9OA 3M2UB 1BQMB 4WWSA 2ZH9A 2D41A 1NJIT 2G2ZA 5A8RB 2DY1A 3OJSA 4F0MA 2O66A 2UUBJ 4PYDA 4CNYA 1L5UA 4ZS6A 1RWPB 4CYUA 2M9KA 2GVDB 1NPKA 1U1QA 1A0OB 1EQMA 2R2TA 4NA3A 3G6VA 2NPFA 3KHLA 3K5PA 3WDOA 2DY9A 3BO4A 5KFLA 2AF6A 5JXSA 3A8IA 3EVMA 5D4PA 2VIHA 4OZLA 1IKVB 2N7YA 4K5SA 4FF4A 3MD3A 1RT3B 1FDBA 2DXDA 2XWYA 4YN3B 5FJ4A 2IY5B 3H90A 2P5VA 4DV1J 1HHSA 4IDKA 5H1SV 1QM9A 2GGPB 1DY3A 3NGKA 2VFTA 2V5HG 4FBTA 3TA0A 4L6V3 2W9BB 1UEKA 3T6JA 3FNNA 3HLUA 3TWZA 2V8HA 5K8MA 2UP1A 2F8HA 3KLHA 3BQ1A 1YJ7A 5K5MA 1CJVA 1UA0A 5LT5A 3C6UA 4WZMA 5DDQC 2JSXA 5B09A 3LWLA 4G1QA 1OSDA 2LP4A 5EWFA 3SCKE 1RAAB 3DGPA 3OTEA 2Y8YA 2OPRA 5KT5A 2B9WA 2P6TA 1DTQA 1VRTB 2W25A 1C1CA 2CJYB 1WWHA 5A76A 1P1LA 3Q89A 2RAQA 5F8JA 2H4WB 2MZTA 1FKAF 3I0RA 4DMZA 2VPYB 4X4RA 5CCLA 5C2CA 1FJCA 2HNZB 2YNHA 3EXYA 2CPYA 1JLAA 1F9FA 2DGUA 2VQFJ 4L3KA 4Y3CA 1H0HB 3FCWA 1S4FA 4OI3A 1RE1B 4C8OA 5JVHQ 4U7UK 4O3SA 3H2LA 3KUGA 3CO0P 1HWLA 3FGVA 1FJ7A 1SUQB 4GKKF 3VR1A 3VAGA 5L9NA 1UZDA 3JTNA 2C2EA 4NEZA 3N0VA 3GWCA 2UUBF 2V67A 4B3OB 5CYQA 2GNKA 1KVJA 3DRSA 3WQPA 1T94A 4QQBA 3EGNA 4Q2MA 4LSLA 1Y5IB 3N5BA 3MGJA 2GVZA 2AJ1A 3D68A 1TUVA 3W1YC 1WC1A 4O3RA 3PYEA 4RNMA 4ZLPA 2OPQA 3TVKA 4DV1F 1YIJS 3LWMA 3O5TB 1VHIA 4FF1A 2V8DA 1CJTA 1H73A 1DFDA 4IR9A 4QYZK 1LWEA 1UFWA 2GA7A 2UXDJ 1HBNA 4F4WA 3SI8A 4MFBB 3HSDA 2QLJB 4CH0S 5B0FA 1Y3KA 2RF2B 2DO4A 3DM2A 1WC5A 2YBVA 3UDVA 2KO1A 3ZTQA 3DHWC 4NRTA 2DGQA 1Y5NB 1T9WA 5I3UA 3OSPA 3ZZUA 2JLGA 5FD1A 1XMBA 2XMKA 4JI8J 4WK1A 5F8HA 1PG5B 2CWXA 2WVCA 1S9EB 3W63A 3DI6A 3HVRA 4X65J 1IXKA 3ZTOA 3CCUS 3CCQS 2PFDA 2MQOA 2RDIA 4B08A 4UZCA 4F4ZA 4RW7A 2H51B 4DV5J 2VQFF 4X62J 2V0NA 2VODA 4UUXA 3F56A 1KS2A 5CD4A 2AGPA 1SC6A 2FLPA 1WG4A 2HHQA 3F41A 1AW0A 3AAWB 4X4NA 4C8NA 2KYXA 3V5RA 2QEXS 2CPHA 5IT9Y 3KDOA 3R1HA 2AEJA 3MF5A 4DR1J 4XPCA 2JC0A 1NSQA 4KAIA 3DOMA 2UXCJ 1VQYA 1YJTA 4Y00A 2KZZA 3GYGA 1T03A 3KUEA 3HZEA 1RAIB 3W2VB 2NXEA 4CLWA 4OZJA 1HYSB 3TEHB 3UWTA 2FC9A 3C46A 1FE4A 3GFHA 4BDPA 2DGVA 1Q7YT 1C2PA 4A8WA 3DC2A 3DMJB 3QT7A 2UXDF 2AYMA 1JLCA 2E1AA 4TU7A 4CM0A 1R8BA 2B51A 4K4VA 2C42A 1WHWA 1V3SA 2LXFA 2OMLA 3IBCB 1QSYA 4U9RA 2ZH2A 4MT1A 3JSMA 3KK3B 2AJ0A 4DR5J 3PW7A 3BO3A 3HFKA 3PEJA 2Y9HA 2JLFA 4JI8F 1TK5A 2CRLA 3PRDA 2UV8G 4X65F 1Q16B 2IMOA 3HFVA 4RNHA 2HRYA 4HTIA 2RQCA 4DV5F 4P73A 1J5OA 2F63A 4X62F 3IN5A 4EU0A 1QE1A 4DQQA 4FXWA 1N5YB 5L46A 2JNJA 1DZ5A 4AFFA 4ZHRA 3SQGB 3ILOA 2X1FA 2UXBJ 4OV6A 3CD5A 2YX1A 4LSZB 4DR1F 2FVRA 2RD5C 1KLMB 4RW4A 2EVZA 2UXCF 3NBPB 3GP9A 1XBWA 5FLXY 3V2UC 2CNOB 3EGWB 1EIYB 2VA2A 5K8OA 2GX8A 2QT7A 3TAMA 2ASJA 2B7CB 4GO5X 2EG1A 4QCLA 2HNDB 2EKNA 3SCJE 4F04B 2HZVA 3PHEA 5AE3A 2EFGA 2I5JB 2NYIA 3I82A 4FDFA 1IM4A 1R8AA 3MMBA 2FHOB 1VQ8S 1WJ9A 3BM7A 2QN6B 2VA3A 4F4AA 4KBIA 2VJVA 2B7BB 5EWEA 4OX7A 1VQ5S 3CJ3A 4QR0A 3SFGA 1U1OA 1PO6A 2OHDA 1Q0NA 2OAUA 1QD1A 2MDAA 2DNZA 2E1RA 2ADCA 1SCJB 3QGPA 2V6AA 1FRIA 2GS8A 1U02A 4DR5F 3QT5A 1DQ9A 4V1Ak 5K14A 3N6MA 4LF1A 5DGBA 4Q7AA 2KN4A 1XJWB 3T9ZA 1H6KX 1Y0HA 3D1HA 1EARA 4ZCKA 4J9RA 2J6UA 4KHPJ 3MUVP 5F3TA 5LMUJ 2F9JA 1C0UB 1HMVA 2MQQA 5B7WA 5HVHA 2YXLA 2Y3YA 3PRVA 5EHHA 1YJ9S 4K8RA 3OV7A 1XIQA 3CJRA 3KTQA 4CLUA 3RJMB 1NDCA 4QW8A 2ZJRQ 3PVXA 3UD4P 3WC0A 3LP2B 4ID5B 2UXBF 1NBEB 4XIUA 2ZBRA 2DNNA 4A8XA 4MAKA 1LW0B 1JKHA 1NSAA 2VZ9A 2LEPA 2FTRA 4F3QA 2XNQA 2LQ8A 4C2MA 1T3OA 4JV1A 1YDLA 3BSAA 1IKXB 2CQ3A 1SC3B 5GMKa 1VR6A 2NCKL 3F44A 4CO2A 2RMLA 5ETQA 4O44B 3TX0A 2VICA 4M1KA 1RHRB 1Y7PA 3KJVA 5HP1B 4PUOA 3EGVA 2HK2A 3DCAA 2Z0GA 2BQ3A 4M5NA 4F3MA 4P2MA 3H59A 2WK4A 2YKQA 2ZVSA 3PM9A 4Y2AA 2CG8A 2V4QA 3WC2A 3RR8A 1S6UA 3R3TA 3NWRA 2FY1A 4DL4A 4TN2A 2FLNA 4JI4J 2QSFA 2UZAA 5DQGA 3J81j 2HQFA 5KFZA 3HT0A 2Z4PA 4NCGB 1F2GA 3RTVA 3POTB 1IVZA 4USUA 3KOAA 1RBOB 4KHPF 3R5JB 3MURP 1KEKA 5LMUF 3T6BA 1C1BB 3HDSA 4LFBJ 2GO9A 3PG9A 2W9AA 4QJVA 4EFAC 4AT1B 2NXUA 3SDEB 5CAAA 3AT1B 2F4VJ 4I1TA 4EUVA 3G2XA 2MQNA 2V2VA 4NLGA 3QIDA 4I7FA 2W9BA 2CJBA 4J9MA 2VUGA 5HMYA 2N3LA 1NHKL 4DUTA 4N41A 2M88A 2B4OA 1GMUA 1R8CA 2CQDA 2R7OA 4LRDA 2YKNB 1OSCA 2VFVA 4DN0A 3BQ0A 1KP6A 2R2SA 1YJNS 5IZHA 2YWGA 2AX0A 3G6YA 3NGRA 3FRZA 1SJRA 3NAIA 4C0OC 1SPBP 1UTAA 2BBEA 3OUYA 2HYIB 1RAHB 2HS4A 4N8OA 4DR3J 3ENWA 2XCPA 2LYVA 3LGHA 1TKZB 1S57A 4P52A 3FQLA 2J0WA 5F41A 2HNZA 3GV7B 3LP0B 1K8AT 1SL0A 1ZM3A 3AODA 2YY3A 1U26A 3BV8A 2B4UA 5KFMA 5BJRA 3H5XA 3BYPA 1HNVA 1NJXA 2AJFE 5GVQA 4Z2XA 3R5AA 4JI4F 3LGMA 3RUBL 3LGNA 3GCXP 3I96A 3CULA 2JFKA 5KFIA 2HKEA 2GO8A 1U48A 3HPOA 1TL3B 1X8DA 3VAJA 1U1LA 4M95A 4PQAA 2R8JA 4OL8A 1RHJB 2A18A 1MROB 1IKYA 2MKHA 3RW6A 3L4BC 4PR6A 4GRSA 2VPXB 4LFBF 2LQ9A 1UWAA 1WHXA 1DLOA 3PX6A 2BJ3A 3IAS9 2FVPA 3KHHA 4O4GB 2F4VF 2MHEA 4M5DB 1RTDA 1PC4A 3HHLC 5A2QU 3OL9A 3H4BA 5MLCV 3R5DA 3A3NB 2XSJA 1YJVA 4P72A 1YITS 2P9GA 4X64F 2AW0A 1RTZA 5A8WA 2LLZA 4AL6A 1B7YB 4ZVPB 4J9UE 2C3PA 4KRWA 3IAM9 4YR3A 1ZM2A 2LXIA 3GMGA 5BYQA 1QAXA 2RF2A 2C2MB 4EGLA 2OSQA 5KT2A 3OLAA 4HACB 4ZCLA 1VCTA 4G1PA 1YG0A 5E3QA 1YZ7A 2A6OA 2IDEA 1MWZA 4A47A 4DR3F 3CCRS 1U6FA 3KKFA 3CCLS 2A2DA 3CCWA 3KXDA 5J2MB 8ATCB 5RUBA 3DRPB 2POKA 2RS2A 4PWDB 3SMZA 4DFJA 1RWWB 5KFAA 4ZVFA 4KO0B 4CLFA 1AUDA 2OGUA 4FVMA 4KY3A 3DOKB 2BOPA 1S6PB 1VQ7S 2VG6B 4TXSA 5E0OA 5ETLA 3ZZRA 2KVIA 1F9EB 4X4OA 3R8YA 2CJKA 3R27A 1MLAA 4CQ1A 5J2QA 1WC4A 3IG1B 3TJ9A 4CNZA 1WSRA 4FP9A 3VAMA 5J1EA 2QA4S 4KGZB 1X5SA 2C3OA 4ES1A 4KSEB 5IV4A 1HBUB 1P9QC 4RW8B 1I94J 3HO1A 4CLZA 2CPJA 3UCUP 3BF4A 2LEAA 4RNOA 3KLIA 2JX2A 2MY7A 2A6MA 2CADA 4OZ1A 4ECRA 3GSDA 5G0RB 1UWBB 2WVBA 1JLQA 2VKRA 1NSKL 1G1XA 3NG8A 3QRPA 4RX6A 1WOOA 3K5LA 2I0XA 4DSIA 1RLCL 2R9LA 1FTCA 3NEKA 2BR0A 3IBWA 2JDJA 3A3PB 2IRXA 4FF2A 4F7VA 4RW6A 4ZLJA 2AWZA 5HO4A 3IWLA 1S9FA 2QMUB 4ZN1A 4P2FA 3E01B 1HNXJ 2M4MA 2IJNA 2DHAA 3Q2SC 5D15A 3NP5A 2D3OR 2LDIA 4QYZJ 4PPDA 2E7VA 2QE5A 2AT1B 3B78A 2HG4A 3GIIA 3W66A 1ZH5A 2LMIA 4OYXA 1RWXB 1S1TB 1R31A 4OYWA 1ZA1B 2NLWA 3SQGA 3M9OB 1T7PA 2VBXA 4B02A 1H74A 2GZOA 2ASLA 3VV2B 4Q44A 1UJ5A 1T0TV 1RA6A 3I0SB 4C4WA 1KSPA 3M8QB 1KQGB 1S6QA 1L3TA 4LT6A 1VS3A 2RE1A 5E3RA 4CO3A 3NBPA 3CPWR 3UQSA 1X7VA 3UN5A 1VRUB 2B4PA 5ITHA 4DSJA 4P10A 2L41A 4KTQA 2AD9A 1KLNA 1HBOB 1V3ZA 1Y11A 3OBIA 1VQOS 1I94F 2W01A 5BXIA 4BC7A 2HNDA 4KFBA 2FJWA 3RAMA 4EZ6A 1UCNA 4UQTA 2BOAA 2I5JA 4NCBA 1OMSA 2WCXA 2GW8A 2YX7A 4J7CA 1ZAVA 2CQ0A 3M9MB 3TANA 2OD4A 1T9XA 2B3TB 1T9VA 4RKUC 2HFNA 1ICEB 2YPZA 1T02A 3MMCB 3R6LB 3MD1A 4QR2A 1U1MA 2Y1IA 4USMA 4CO0A 3MOJB 3OVSA 2CFXA 4CTAB 3HSZA 2FHJD 1HNXF 1RT2A 2A10A 2BYCA 3GG1A 4IFVB 2V8PA 1VBKA 2K3IA 5DQHA 5A0YA 4OX9J 1RK8A 2RB7A 3OR1A 4NWBA 4KPYA 1NB2A 1VQ9S 3CCSS 4C8MA 4DX6A 3AXKA 4AD6A 1C4AA 5KFPA 3DKDA 3UFCX 2OTJS 4TQSA 4P75A 4LVNP 3J7YU 4KHRA 3NS5A 1Q82T 3LP2A 3DLEB 2YWKA 2CJ9A 2W9CA 2FHJA 2ERRA 5HATA 1B0VA 1TMMA 2BJ7A 1LW0A 3LAKA 3CJQA 1H98A 2EFPA 2FYXA 3PXGa 3RRHA 3UD5A 1NK8A 5IOLA 3DLHA 1VQPS 3G4SS 2LECA 4WIIA 5HBMA 1HQEA 3I32A 5C24B 3HHNB 4ZDNA 2NYHA 3CUNA 1S1UA 3CWJA 2ZC3A 1KBRA 5JVGQ 1TZ0A 1F5CA 3U02A 5HP1A 1B4SA 3C66A 3ILJA 4Q0BB 4CZCA 3M6XA 4QOTA 4NLUA 1DTTB 3O44A 2XI3A 3G96A 1L3SA 1WELA 2HHHJ 4LF4J 4M5IA 3MEEB 1TELA 2IVMA 2GCFA 1XR6A 4OYZA 1MMNA 2YKMA 3OJUA 4ECZA 1RKIA 4I0WA 4ZJLA 4KV8B 4ZPBA 3M2RB 3AXMA 2ACMA 4ECYA 2I9SA 3LW5C 5DM7Q 4NCGA 1OPZA 1RAEB 4CI0B 1NH8A 1ZPWX 3B6BA 3POTA 4N8NA 2AHOB 2BANA 5C42A 4LREA 3Q8VA 3W2WA 1CJUA 4LF2A 4OX9F 2IA6A 3GTYX 3U1MA 3VALA 1D8YA 4CDIA 2X1GA 4KKOA 2DISA 3G86A 3IWXA 3NMRA 3MCNA 4ZJQA 2R7SA 2W7OA 3K5MA 4P2XA 4WYWA 1L3VA 2BW2A 1UVLA 5HROB 3UCGA 4LBPA 1EP4B 1X4HA 4HVZA 1W7WA 4OYPA 3QIPB 1EJ7L 2Y0SD 2Z2MA 4PAAA 2YKNA 1NCLA 3K17A 5D3GB 3CCVS 4RLEA 1PJ6A 4C7QA 2QG9B 4PG4A 3P96A 1IWAA 1CG2A 1QTNB 2CQ2A 1H2UX 2XGPA 1KQFB 4MYTA 2HFUA 4CH1A 5HQ8A 2J8AA 3QT6A 2BQRA 2IRUA 2HQ3A 2GMJA 1LEOA 4DOZA 1MU2B 4PABA 3MAAB 4B9MA 2B43A 2LEBA 1TKZA 4NLQA 4R8UB 4ED8A 5B0GA 2ZDOA 2UV8A 1JLBA 2JWNA 3BGFA 1XMQJ 3QO9B 3CDAA 3F73A 2HHHF 4LF4F 4EWTA 4LVOP 3Q2TC 4HHHA 1JIHA 4DF8A 1TR0A 2WONB 1PAEX 3B54A 4ZLNA 4E8UA 4R5PB 2QO3A 5IQ6A 3EZUA 3MPUB 4DHVA 2C2KB 1RT5B 4DS4A 4I6AA 5IM0B 5ETSA 3EPIA 5IXUA 2ILZA 3HJFA 4M63A 4WK3A 1CVJA 3BREA 5G4DA 1MROA 1HWKA 5DZ7A 3PO5A 4PG5A 1J5EJ 3S6EA 1X60A 1RYSA 4A48A 2QL5B 2FDNA 3D5MA 3IFEA 4WJBA 2ALYB 1G7CB 4O4GA 1SVDA 4QR1A 3HKZD 4K4ZA 1F0XA 3Q22A 5J2PB 4BS2A 3FFIB 2YNGB 5E33A 1O6XA 5E3PA 5T14A 2ZZTA 1K47A 4DR2J 4URSA 1QSLA 3VVUA 3FRYA 1TV6B 1O51A 3AQOA 3C14A 3A3OB 3OSNA 2HURA 4YS2A 3MEKA 2VH7A 3ENVA 1WDTA 3HVAA 5AXMA 2EG2A 1X4CA 4NZ0A 1N6QB 4W98A 4QWCA 1Q1KA 2HQIA 3I56S 3R5GA 1SH2A 4ZIVA 2HVZA 3TA1A 2DNOA 4AQYJ 3K7RA 1B0PA 1SC4B 5KFXA 2DVIA 4KJIA 2ILYA 1R8HA 2CJAA 1H72C 3M30B 2CIMA 2CYYA 4DG1A 5HQLA 1RJJA 1LK7A 3DRPA 4MJKA 5E2QA 1XMQF 4WF9Q 3M7VA 5GAEU 1G2EA 2HLTA 4RR5A 1JLFB 1S6PA 2ZBPA 4MKVA 3A8EA 3KJFB 5CABA 5HJYA 5KFYA 4DX5A 3OTOJ 2XO6A 3FVYA 2EBEA 3MMAB 4DR4J 2P2CB 1VQNS 2G0JA 5B0BA 2Y8WA 4MMOA 2HNYB 2WBRA 3LH2S 3TA2A 3BBFA 1I5OB 1PBAA 4U67Q 3IG1A 4X2BA 5DO2A 3LANA 5K9FA 4DCPB 1J5EF 5F8NA 1HBUA 2HW3A 2FJBB 4IH7A 3LOUA 2CVEA 4KR0B 4ZPVR 2J0XA 1LOUA 1RAJA 1RHKB 1HW9A 5B0EA 2AV5A 4ZCMA 4OZ0A 3J80U 4DPTA 4O23A 2CPEA 5KG3A 4DR2F 5LMNJ 3UN3A 2IBKA 3TAPA 3L95X 2DGSA 4X4QA 1JLEB 3I31A 1PSDA 3FCVA 3DN9A 2AYGA 4WP8A 4C8ZA 5KFNA 3X1LB 2DH7A 3BBBA 4RUCA 2Z8QA 2R8GA 3GILA 3ET6B 4AQYF 2G1DA 3DDIA 1GX5A 4K4TA 1KTVA 3CCES 4FS2A 2KKHA 3MHYA 2ATLA 4CYUB 1LFWA 2XY7A 1VQ4S 4ZKAA 2VBWA 2NR0A 2ROPA 1U7LA 2F8EX 2P6SA 3IXQA 4LBHA 4R25A 4IOCQ 4FPRA 3L09A 4ILRA 4P7VA 2J9DE 3VGVA 3M8YA 1LQ9A 3OTOF 4IDKB 1RISA 1UKUA 3I0SA 4DR4F 2V63A 2W2NP 4ICLB 3VGSA 4Q2LA 1M1GA 3FBEA 1VRUA 1CJVB 2ZWPA 4J9NA 1UA1A 5CHCB 5D4NA 1HBOA 2RKIB 3C6UB 1GXUA 5KFTA 1Z4UA 4XPEA 1M5KC 4DCOB 2DH9A 2JRSA 3Q23A 3FK4A 2AMCB 1HBMA 4CO5A 1S77D 3BKTA 1X4BA 4G1QB 3BJYA 4Y65A 4F36A 5EX3A 5DG9A 5B08A 2CJXB 4LMZA 4LF7J 2OPRB 4E0DA 2W2MP 3SCLE 4I64A 1U1RA 1C1CB 3CB4A 5ETRA 2KFYA 2VOOA 2UVVA 2QIFA 1OYEA 4I2QA 5LMNF 1K0VA 4JI3J 3ZXWA 1H2VZ 2Y1JA 2AU0A 2KDOA 2JC1A 2O5DA 4O3PA 4JI5J 1NAQA 2DJWA 3E3XA 1R0CB 2V69A 5L1KA 2YNHB 3ILLA 3MPDA 1JLAB 1IWGA 2ZM6F 3NLCA 2IC3A 1SV5A 2MLYA 1MSWD 5D4OA 3QPIA 4KC5A 2KG0A 2ZWOA 3KJNB 1RQ0A 3ZZYA 3CXCR 5IC4B 2JEGA 2XZWA 4IFVA 4ED3A 4YHHJ 8RUCA 3I5BA 3JQKA 2M70A 4DPWA 2V9KA 3K5OA 3OL7A 4LSLB 2Z2LA 4G65A 4UW2A 4DV6J 3EVWA 3QAUA 4C3KA 2GVZB 1F6TA 2JOQA 3US5A 1NKEA 3ULHA 3JSBA 2ADBA 4NMXA 1SH0A 3UNGC 4CWBA 4ED4A 3C6TB 3NRBA 1ZZFA 1FEHA 3DLEA 4ILLA 2OPQB 4WXOA 4J9VA 3I55S 3AH6A 1CJTB 4PPZA 1YVFA 3BDPA 1NHUA 2ZH7A 1RAOA 4K0KJ 3ZZ0A 2J76E 1OYDA 1LWEB 4OFZA 1V6HA 2BJ9A 3H5SA 2L9DA 5C24A 4UQGA 3PR5B 2WHOA 5J2NB 3IRWP 5CA5A 2VDIA 3JSYA 2CQPA 3CTRA 3GSIA 1X9SA 3DRYA 3MECA 3JS9A 2EFQA 1FNOA 5AXKA 3QZ7A 3WX4A 3JSRA 4LF7F 3DM2B 2EXUA 3LTOA 3KK1B 2I6WA 1FFGB 3TZYA 1DTTA 5I3UB 1NEEA 2EK6A 4JI3F 3KLFA 1S6OA 3TZZA 2DRAA 3KJQB 4CLTA 1R89A 2GIQA 1JQGA 3R7SB 4JI5F 3DI6B 3PW2A 4NZ7A 2Z56B 2BW7A 3HX9A 5T7LA 2XSFA 4RW7B 1CLFA 3OL8A 2XMMA 2DK2A 1GK8A 4USVA 4HR2A 3QYYA 4OX6A 5B0CA 4NYPA 4FYDA 2CPZA 3HD2A 4IKAA 4YHHF 3LP1A 2DNQA 1FWLA 2V8VA 3SCIE 2K06A 1RKJA 1YJRA 3GJSB 4LJMA 4C98A 1T95A 2LQ5A 4G6VB 4OZNA 4B9UA 4DV6F 1P27B 4QW9A 1T03B 4WFXA 2R7TA 1ZBTA 1C0TB 2YH1A 2CPXA 2VPWB 3MEDA 2ABYA 1AFJA 1S12A 5DM6Q 2DGXA 3PR4A 1HL6A 2VQEJ 1EP4A 1RHUB 2NZCA 3QIPA 3LAMA 2NZ4A 5D4LA 5HSPA 3MCMA 2HS3A 3Q86A 2MKKA 2QV6A 2E44A 1FT8A 3EYZA 1BQNA 2EFNA 1UETA 4UOHA 1RB0A 4OIXA 4KGXB 2HK3A 4OHVA 5KG2A 4K0KF 4Y34A 1PILA 5KG6A 4UY8T 1KN6A 4QWEA 2EFOA 5DLGA 5ETNA 3U1LA 5GADU 3BSNA 1EZZB 1VQ6S 1KFSA 3EXCX 4X84A 2Y0BB 2W24A 3HKWA 2XWXA 4K2JA 2QLXA 3A13A 1JXEA 4FNIA 3LA0A 4CLSA 4NYOA 3GIKA 1JJHA 5ETPA 3QO9A 1L3KA 4KGMA 3RRGA 2Z2ZA 5DGAA 1F3VA 4PWWA 1NNDA 5C5JA 4JV5J 3A12A 5E3CA 4R5PA 3E8OA 2MQPA 3PHTA 1JNZB 2H5EA 2BX6A 3JAMU 4MK7A 4RPFA 4DV0J 4I68A 4C0BA 1N56A 3D6HB 2XNRA 1GAOA 1GXLA 1W2IA 2QSWA 2ZBCA 1V5IB 2YWHA 1NUEA 4ZHRB 4W92B 3RAQA 2JH3A 3MEGA 3QRRA 3DXSX 2ZOGA 2ZH4A 3HMJG 1KC8T 1RTHB 3EWGA 3OHAA 1TK0A 2G0IA 4RW4B 2YKAA 2WB4A 1EB0A 5KFRA 1HFEL 2CQBA 3NCQA 4O3OA 4ZVQB 2DXFA 2ZNYA 1XQIA 5J2PA 2YNGA 3QGGA 2BV3A 3D6TB 3NL0A 5KFWA 3TAMB 1KVIA 2XC9A 2V9WA 3SXLA 2VQEF 1IBCB 1TV6A 2ZFHA 4Z7CA 1X4EA 4QYRA 1U45A 3W62A 1FVQA 4RNFA 2AZ3A 3V4IA 1SJ4P 4U8VA 5GAGU 3THTA 2VG5A 1VBZA 2LA4A 3G71S 4DV4J 1VQMS 1S76D 3VAHA 4KT0C 3QJJA 4G3IA 3SIPB 4B9TA 3DGVA 2XGQA 2UUAJ 4NLTA 2RJZA 1SKSA 1YRXA 4PCQA 2CUYA 3M6UA 2MHNA 2J9CA 2GHWA 3VQTA 3QNWB 3CMES 2VF3A 4EBEA 3D7SB 1S1XA 1GQEA 5F0UA 4NLWA 2OO4A 4DV7J 2DIUA 4NRUA 1FXRA 4K59A 2HWTA 4JV5F 2HHXA 1HMVB 1JLFA 4IYQA 1WF0A 4USIA 2AP6A 1Q8BA 4DV0F 3TUJC 4PQUA 4CIOA 2DNKA 3BH7B 2V2KA 2NUUG 3FMBA 1CC8A 3MZIA 4HEA9 2IHR1 4XTTA 4IRCA 2EK1A 2W7AA 1RWNB 3THVA 3JB9k 2E7WA 2RRBA 2NXNA 3R7BB 1UPPA 4M5HA 1X4FA 4HKQA 4ZP8A 3R7NB 2GJIA 3MM9A 5BR8J 1RU1A 4YR2A 4KYZA 1U09A 3C19A 3S8SA 1S59A 1FE0A 3OTDA 2PDAA 4HTJA 4R0EA 1NK0A 3FKBA 4D3HA 1RZMA 2Y1LB 4HHJA 4MIBA 4J37A 3KJVB 4A8MP 2J9EA 3H2UB 4DSLA 4B3MJ 3K8VA 1RT1A 5CQGA 3UW1A 4PKDB 4ETXA 4DR7J 2W4PA 3OHBA 4DV4F 5D6GA 1XN9A 1KKHA 4C3LA 4DQRA 4FF3A 2RRAA 1TQLA 5E3AA 4QIEA 2WVDA 2UUAF 1UVMA 5JJBA 4KPCA 1FX4A 3C16B 4U6PA 4PXCA 1U2FA 3D28A 1T3NA 4DSFA 3AJ1A 4BWJA 2EW9A 1Q5VA 3OW2R 4ZIWA 4NPOA 4OZ2A 4GVBB 3MAQA 4DV7F 2VL1A 1FESA 1G6BA 4WPAA 4AE5A 3D9BA 1NZ8A 2HIQA 2L9NA 4QZVB 5KFHA 3R97A 4ZVRB 1D9DA 1TMJA 3DU6A 3I5AA 2DGTA 4GVLA 1VC6A 3P49B 2R3VA 4KQZA 1W25A 1VBXA 3H5YA 4B3RJ 4I7FB 4ICLA 2H9ZA 2WW4A 1AFIA 2VFSA 1E6YA 4NLSA 3NGTA 2RT3A 4LR7A 4KGVB 4UOGA 1D8ZA 1OS5A 5HK4A 2RKIA 2CAJA 3JTOA 2B8PA 2ZH1A 1TL1A 1VRQC 1WEXA 1U47A 1V9OA 4FYVB 2VOPA 1WNEA 5LM7E 3TZWA 1S4EA 1VGYA 2L48A 3KG4A 1RT4B 4ECWA 3OUYB 2NREA 5BR8F 4OJHA 4O0NA 1UVIA 2B9YA 3MR2A 3G6ES 4EO6A 2D74B 2MJNA 5L1IA 3PIPQ 4NI2B 3MPWA 3BKFA 2WRMA 4RBTA 1Z2LA 1FKPA 4WKRA 1AT1B 2OMOA 2QRRA 2IVFB 3N9UC 4B3MF 2UUWA 4LFCJ 4ANDA 3SZ2A 3Q8PB 1WKLA 1SBRA 3RG6A 3KYLA 3TEGA 4DR7F 1BHNA 1HNVB 2WBMA 2EKYA 2A3JA 1WACA 3IMQJ 5IV3A 1OIAA 2R7RA 3BH6B 2I2YA 2MZ1A 2I8EA 1IM6A 1NMEB 5F8GA 4X4UA 1HNWJ 1ZOTA 3K2YA 2CWKA 4ER8A 4USHA 3NGDA 1IKYB 4B3SJ 5A2QY 5EWGA 3P4UB 2OH2A 2K8GA 2DKOB 2I1RA 1T05B 3C6TA 4ILMA 3BGLA 1TFWA 1CS4B 3M2VB 1DLOB 5H9FK 3NAHA 3M05A 1RBAA 1WC6A 4RL1A 1RTDB 4M94A 4B3RF 3CMQA 1WI8A 2N3OA 1YK9A 4PEOA 2DR6A 1UP1A 4H4OA 1JLGB 2OPPB 1MG7A 2XSJB 2DBBA 2XYGB 3VWSA 5J2NA 5A8WB 1OY6A 2ZH6A 1FXLA 3IP0A 4ETZA 3KK2A 2AYBA 4NXMJ 2LU2A 3KLVA 1GFWB 1RU2A 3KK1A 4LRBA 1FRMA 4AL5A 5LSOA 2YQ0A 1GMVA 5IQQA 4DZ6A 4IUFA 1NLKL 1LWCA 5FDLA 1OPIA 3O3LA 2XCAA 2HZCA 2CPFA 2IA0A 1D0EA 4P71A 2HBQB 3CJSA 4YB1P 1IJFB 2OJ3A 4F0HA 5KFFA 2J7WA 4JI7J 3MR5A 4ED7A 2E5HA 4FZVA 3K57A 1KRPA 4J9OA 4LFCF 1BGXT 2MTLA 1N36J 2DGWA 4FNHA 5L1LA 5DG7A 4OI0A 3CIMA 5I42B 2BM1A 2YKPA 1JJ4A 2MKYA 1KHVA 4IO9Q 4USKA 5K20B 3ISZA 4RUBA 1EHWA 2DNRA 2E66A 2LDYA 4RUHA 4KH1B 2Q1LA 1HNWF 4BBYA 4W90B 2J7UA 1PBUA 1N0VC 3GJQB 4DI6A 3H20A 3PJ9A 5J2QB 2HVEA 2HFZA 3FZBA 3MAHA 5J1EB 1SJFA 4B3SF 1C0TA 4URQU 3O2IA 1YWXA 4ZVUB 4GKJJ 1XR7A 3EZOA 1WKKA 2EWHA 2V8GA 4F67A 3EX7B 3N01A 4JI2J 4ZLLA 4DX8H 1EKRA 3KLIB 5LJ3Y 1WSVA 4LR8A 2KI2A 1U2RA 3LQVA 1BQXA 5KFSA 3J7ZT 3ENAA 2KRRA 1VBYA 2MQLA 2F9DA 4W4MA 4Z37A 1LK5A 2FY8A 5BYSA 1JLQB 3BGRA 2D7SA 3EJMA 5D0RA 5KOXA 2GV1A 3GIJA 2OEKA 3RAXA 3IR5B 1NK9A 2IRYA 2FLLA 3BYRA 1M5PC 3OTCA 3ZZOA 2DNGA 4NXMF 1HARA 3DRXA 1Y10A 4RW6B 4I4BA 3D2WA 3MMJA 1I6JA 1RLDA 2E5IA 1PJ7A 2XMAA 1B64A 2K1RB 3FBFA 4WP9A 5AXNA 1UVJA 1HKAA 3MWBA 2VFRA 2BQUA 2KYZA 1R3NA 4JI7F 4YB6A 4JOUA 2ZHBA 3VAIA 2ZH3A 1IJEB 2H5IB 3PZPA 2YKOA 1N36F 3D0HE 1VMBA 3QQCD 2R7QA 3IC1A 3BB5A 1RAFB 3V6DB 2HWIA 2X51A 1JX4A 1AZSB 2ASYA 2RHQB 2IBOA 5EGYA 1I51B 4TQRA 1P9YA 2BKNA 4CM2A 1U1KA 3DYAA 1K1QA 1JB0C 1HIYA 2DYAA 2UVRA 3R2CJ 4MKYA 1B70B 2X3GA 2CA9A 3TO8A 3C15A 1S6QB 2H4YB 4MKAA 1RTHA 3B82A 4ZN3A 1FRXA 4ELTA 1MMLA 4Y2IA 3K59A 2DTJA 1Q78A 1WD6A 1LV5A 1TP7A 2HAIA 3D54A 4H4KA 2XLKA 2OELA 5HMWA 1VHFA 3I9V9 2VKZG 1NK4A 3Q8SB 4GKJF 2FGCA 4DN9A 1ZAXA 4KFBB 4JI2F 3PJWA 4I2PB 4NEYA 2YQ1A 5DRKA 3I6PA 1S72S 3OFFA 3D1QA 3MM6A 4DL3A 3K5NA 3I5CA 2QLBB 2J6TA 2H54B 2QL7B 1S1WB 1ROFA 5H9EK 1U1NA 3CJ5A 1DURA 5IWAJ 5DS7A 3RRKA 4TY8B 1DRZA 3W9JA 4PXBA 4PYAA 3N5FA 1JK9B 4O3QA 4DFKA 1TL7B 2B5JB 4X4SA 1BD6A 1CULA 2NSBA 3GG0A 4QPXA 2DXEA 2CZ9A 4GC7A 2MY8A 1KHWA 1WUUA 3ZO7A 1RT2B 2MPUA 3NS7B 2R8IA 1N32J 5KG4A 2XY5A 5A0YB 1K0TA 2NXCA 3Q83A 2V50A 3OR1B 1NK6A 3AB2B 3UCZP 1P8GA 1LW2A 1EETB 5KOWA 4NYZA 1RWKB 5KG5A 1NJYA 4IR1A 3MPVA 4JV0A 1WC0A 1NSPA 2G0CA 2XS7A 4WYLA 1S48A 2A1BA 3PTWA 3NNCA 1IBKJ 4U7CA 2W9CB 4ELVA 1HA1A 4FPIA 5DG8A 3ADAC 3VZIA 2Q6CA 4ZITA 3UR0A 4WE1B 4X4VA 1T8EA 1GMWD 3BKUA 4M5JA 3W61A 2HGLA 2VU5A 3R5CA 1VFJA 5LSRA 3D3BJ 2GQ2A 5HBMB 2J0SD 3OD2A 1HQEB 2PEBA 2D3ZA 5DQIA 2YNFA 3AQPA 3FC9A 2PN6A 2ZE2A 3PACA 1FFWB 1S1UB 1KNZA 2IPOB 2JZ5A 3BN4A 3MCSA 4YUDA 2R7WA 3JQMA 4L72B 3JXOA 2V2QA 2DRDA 2IVYA 4ALZA 3CCTA 1OO0B 3D66A 2BMBA 1R27B 4HH1A 3HT3A 3NGUA 1FCAA 1GMWA 3OXGA 3FZ2A 4OHXA 1S99A 2B9XA 1YBAA 4NA1A 5KT4A 3UD3P 2JHEA 1VIOA 5L39A 3CNQP 5GMDA 3ZTSA 1T9TA 2YKMB 5F9NA 2KVQE 5IWAF 2WSFC 3DLLQ 2GJFA 4Q5VA 3TQ1A 3C16A 1TUWA 1YZ6A 4L75A 1XC9A 1OY8A 3TJ8A 5ADZA 3Q8QB 2X1BA 1P1TA 2WVFA 4IH6A 1DAXA 3OLBA 5CD4H 2MKSA 4B3TJ 2LQJA 1CJKA 4GVBA 2V2ZA 1K9MT 2G2OA 1VLYA 2BANB 5C42B 3W2WB 3W60A 1N32F 1CJUB 1FVSA 3M8RA 1QLNA 4IRDA 1U24A 2V94A 2HRUA 4KKOB 2YPYA 2M52A 1Z1ZA 3M1VB 2QX0A 1MWYA 3RGIA 1WDDA 2PGCA 2CZ4A 3TW0A 1SQFA 3OPKA 2OFHX 3ZTRA 2C22A 1IBKF 3CVKA 1XERA 4X64J 2HQCA 2MLXA 3TUPA 4OZ5A 2OPSB 5ETVA 3OR2A 1N4LA 2LXUA 2XBPA 4DLEA 3TUIC 1RCXB 5JUMA 2DNMA 1SI9A 1WTBA 1IR2A 5DDOC 2CDRB 1RT4A 5D0GA 3AOCA 2XMWA 3UI3A 2X1AA 1MW7A 1EX8A 2F7VA 3I4HX 1D9FA 1CPZA 4NI2A 1FD8A 2HBRB 2KFZA 1HWUA 2AX1A 2GIFA 3AB4B 5E5NA 4UUWA 1JLBB 3KMSA 1QTMA 3W5XA 1QJHA 4WFBQ 3HK2A 1PYTA 5KFCA 3UVJB 1F5AA 4F2RA 4ID8A 4CP5A 4WTOB 3HSGA 3QAEA 5LSLA 2Z57B 3J81U 3DDNA 2VFUA 1ZZNA 3MPYA 2UU9J 2M8DB 3W5YA 3G9CA 2ZKTA 4HDGA 2MQMA 2EEYA 4TNOA 2HHTA 2A2CA 3UN2A 3CD6S 2HHVA 4B3TF 2U1AA 1IKWA 4A8KA 3IS9A 3AD9C 3I4PA 1H7WA 3MM8B 2PMHA 3CJTA 1S0MA 5L8RC 4YMEA 3RBDA 4EZ9A 5F0WA 1T05A 3C3LA 1SQGA 2ZZMA 5F8MA 1CS4A 2AZ1A 2HSEB 4F0KA 3M2VA 1RWMB 4B9SA 2XEXA 4YP3A 4F4XA 2YWWA 2H48B 2APOA 1N5SA 2D9OA 3KWMA 2F40A 2K2PA 4ED5A 3BGUA 4EK2A 3M32B 1FRLA 4C48A 4NA2A 4ZP6A 1JLGA 1Y4ZB 2PEHA 2OPPA 3PW5A 1JJ2R 1A9NB 2QMXA 1ITPA 5AT1B 1FRJA 1Q4RA 2F4FA 3C14B 3FEXB 4JI1J 2QJ3A 1VI7A 2G13A 4ZVTB 2HVDA 3QJPA 3FEYB 2Y1RI 1ACMB 3PRBA 4LSNB 3SV4A 4E98A 4YOEA 2NSCA 1AA1B 2X3DA 4F26A 1SL1A 8AT1B 3W65A 4TVAB 2CKWA 2FJDB 4CLKA 4CCHA 1FDNA 1X5OA 3J7YI 1CQNA 2N7CA 1VOMA 1XTZA 3UR3C 2KTQA 2OFGX 2ROGA 4WKYA 1HHTP 3GE9A 1R8PA 4DG1B 1Q53A 1RABB 2EFVA 4LR9A 4C6AA 1SJ3P 4ECTA 3V6KA 1HQUA 2K7JA 5KTQA 5KG7A 5I42A 4N56A 1UEVA 2RHSB 4OI1A 3SV3A 4OJ3A 1UJ6A 4UY85 4MIWA 2MZJA 4C11B 4DZDA 3OVAA 1ZA2B 2UU9F 4Q45A 4ZVOB 2RH3A 4BC9A 2XY6A 3BBCA 3ISND 1E6VA 4LFAJ 1XWLA 3J80Y 2PI5A 2Z58B 4PG8A 5J1PA 3UNYA 1F1BB 2BJ1A 2QA2A 4A8QA 1MWQA 5E41A 5D0EA 3SQOP 3C8YA 1JXVA 2FD2A 1U6ZA 4DL6A 3AD7C 3OXLA 4IG3A 2XS2A 2IMWP 4TU9A 2BKOA 3QFHA 5IT0A 2HQDA 3QLHA 2QA1A 3CC2S 1RA7A 2CQ1A 2M0GB 2DB1A 3M8ZA 2C1EB 4S0MA 2F8MA 4K7QA 4JI1F 3W9IA 2PD1A 3HHEA 1RP5A 3KFWX 2XZDB 3FBCA 1PGZA 1SIWB 2UVUA 3DLKB 3TP2A 5KFQA 2E5LJ 4JI0J 1B0TA 4WFYA 3K8WA 2K1RA 5H9FJ 4P9SA 3W3SA 2PI4A 3QSYB 1OJ4A 3TJAA 3SBMA 2QYGA 4LF6J 4Q43A 1YI2S 5HAOA 2GAHC 4WCEQ 2OI2A 3GONA 1TU0B 1RDRA 2E1MC 1UFKA 1TKXB 1OWXA 1HI8A 3V6DA 2CVIA 4JYAJ 1KWMA 1AZSA 2MSSA 4QPTA 1U1PA 2M7SA 3RBEA 3EDQB 5AJ3J 2VB6A 3QGHA 5EX0A 2A0FB 1RT7A 5KFJA 3NXZA 4Y6IA 4FBUA 2R2UA 1FRHA 1HPZB 5F8LA 2C28A 3TI0A 3MR3A 5K8PA 3T1AA 4LFAF 1GT8A 4NASA 3M8PB 3OT9A 3G8SA 5I4MA 2EPIA 3ETMA 3H2VE 4NMLA 2HZAA 2O1PA 2KB2A 1LWFA 3GLJA 4L74A 1HBMB 3PFEA 3KLEA 1SKRA 4I2PA 3L3CA 2HVIA 2HBZB 9ATCB 4OI6A 3IO1A 2PC6A 2GFFA 4I2QB 1UAWA 3FBBA 1OQ6A 1WG1A 1IQZA 4F50A 1TKDA 4DQPA 5M2RA 1S1WA 2VDHA 2B56A 4EMDA 5AE1A 3KDNA 1FA0A 4P2SA 1KTQA 5F9LA 3WIVA 3N6NA 1FRKA 2IC3B 3DOLA 1SV5B 1VDHA 3NCPA 1R0AA 1HR0J 3GFYA 4TY8A 1TL7A 2B5JA 3ONQA 1T9UA 3CSKA 2GQCA 2E5LF 2BUNA 4JI0F 1QVGR 1RSCA 3RB6A 2CNKB 2BE2A 4LF6F 4I6YA 2XZTB 5M2PA 4YB7A 2OIHA 1EETA 1F9HA 1PAUB 2CPIA 4JYAF 2KG1A 4HI1A 2D3O1 1QUPA 1N48A 3HVTB 5AJ3F 1HI0P 2ZNZA 5LXYA 3J7AN 3ITHA 3P5BP 1XK8A 3GB0A 4L76A 1HWIA 4RBVA 2WAQD 4WE1A 4RU2A 5L38A 1UZHA 5A6PA 1N5TA 3KLGA 3CJ8A 1ZS6A 4RW9A 5C2GA 4EBCA 2ZHOA 3VGUA 2GJ2A 5GAEI 3HFZB 4I67A 3GR0A 1RWUA 2VPZB 2Q6BA 1YHQS 4HT5A 3OL6A 3MECB 1NJZA 2FB0A 4DDFA 4NOHA 3QBCA 1VYAA 2MXYA 1YJUA 5EDWA 2KRBA 3MR6A 2MGZB 2W4DA 1KOHA 2CXEA 5B0DA 1HNIB 3HCXA 5LJ5Y 2QTWA 4K5RA 3UDLA 3KLFB 1UPMB 2R8HA 2DHSA 4EO8A 4JUZA 4TKTA 1RTJA 2MKJA 2CJQA 2HGMA 5ETTA 4AL7A 1Q8KA 4ED0A 3PW4A 2HRTA 3P8BB 1Q86T 5T7LB 4E2FB 4WTYA 4B17A 1NKCA 4ZOSA 1N33J 1HR0F 2J6SA 4TYBA 2BZ2A 1N0UA 4OYMA 3SSQA 3TVYA 1IBLJ 3B4DA 1U0SA 4LF5J 3A4TA 4U8YA 1N5VA 1RBLA 1O0PA 2R2RA 4DU7A 1QUVA 2OEJA 2RNEA 4F02A 2B6AA 2DEJA 3LP1B 3N6LA 1KR4A 2ZHAA 4WU3A 2XM3A 1VQLS 3DLGA 1KONA 1RT6A 2PA3A 1YRTA 3T5HA 1RYRA 4Y2MA 3M1VA 1O8BA 5H9EJ 1CSJA 1GNKA 3MEDB 2F1FA 3SSSA 2RQMA 5THWA 1WG5A 2AQ4A 3CJKB 2PMWA 3G8TA 3EDRB 1REVA 4Z7YA 2HLUA 1BUXA 3AA9A 4BWMA 2OLWA 1WHVA 2FQQB 3PW0A 3HF5A 2OPSA 1FO1A 2OEMA 1BQNB 3CEDA 3CE8A 1BLUA 1SJQA 4QWBA 4N77A 1RI7A 4PRFA 4KE5A 4OV1A 4HLBA 5HI7A 3ICLA 2E9TA 3BEGB 2GHVC 4K2XA 2MB0B 2IM1A 2JEIA 4XDDA 4MK9A 2J9DA 1QSSA 2DH8A 3GR1A 3W5ZA 2R7VA 1QVFR 4YQWA 2WOMA 2BE9B 3T3FA 3D4JA 3CGIA 2W2OP 2KHDA 3Q8YA 3JAMY 4ZVGA 3GCWP 1O5JA 4JB8B 1PKUA 2CPDA 2YNIB 3UVJA 1HD1A 3DRRA 3EVOA 4LIWA 2W8KA 4A4JA 3KNAA 4LQ3A 3W7BA 1U2CA 4HH0A 3ELHA 3NS6A 2M3DA 3ZC4A 3GYXB 1M1HA 1KDNA 1TUGB 1REGX 1N33F 2E5JA 3PYFA 7AT1B 1QAJA 5A6WA 2ROEA 1IBLF 4IRKA 3K58A 4X4PA 2FJXA 2E9RX 3ZTPA 4LF5F 2NPIA 2MSTA 2VG7A 3MEGB 3MM8A 3H0PA 2BACA 3N4WA 1ZETA 3D6FB 3BZQA 3V6JA 2HEKA 4URGA 4HL9A 1BXNA 2P9EA 5HJXA 1VJQA 3MUMP 1R0BG 4BCAA 4ED1A 1N88A 4UOCA 3M32A 1BY9A 5D0HA 5KFVA 3AHPA 1X9WA
chains in the Genus database with same CATH topology
2MJNA 5L1IA 3PIPQ 5GAHI 4LF8F 3AJ2A 3CD0A 4NXNF 3MPWA 3EUNA 4I56A 2WRMA 3D0IE 3UE2A 2FJAB 3NP5A 2D3OR 4RBTA 1Z2LA 1FKPA 1UW4A 1V3RA 2DCUB 2LDIA 3ITHB 4QYZJ 2DGOA 2DT9A 2OMOA 2QRRA 2YH0A 4CT9A 4C8KA 2IVFB 4PPDA 3N9UC 4B3MF 2V4JA 1YQHA 2PFFB 2UUWA 2ZH5A 2QE5A 3B78A 2HG4A 3SZ2A 3V4IB 3Q8PB 3GIIA 4YR0A 3T1YF 3CT9A 1SBRA 3HHLA 2VG5B 4LSNA 3MM5A 5KFKA 1ZH5A 3KYLA 4IG0B 2O3DA 4DR7F 4DUZF 2ZKUA 3KLGB 2LMIA 2VC1A 2IM3A 5HROA 1HNVB 1KQSR 3Q0AA 2WBMA 1AXQA 4YY3F 2EKYA 1ELOA 1S1TB 4OJ1A 1JNRB 1R31A 2A3JA 3CC7S 1WACA 1DJ0A 3P6YC 4RW9B 2KHCA 2RRNA 1TKTA 2NLWA 3QZ8A 3SQGA 1IQTA 3M9OB 2IM0A 1T7PA 2VBXA 4B02A 1OIAA 2XULA 3H25A 2AJ4A 4RNNA 2ASLA 4Q44A 2R7RA 1UJ5A 3QGIA 1RA6A 3I0SB 4C4WA 1KSPA 3M8QB 5D3GA 2I2YA 1KQGB 1S6QA 5IS2A 2MZ1A 3VAFA 5SUHA 1L3TA 1H38A 2HVHA 2I8EA 4I69A 4LT6A 1VS3A 2C2DA 3O8WA 2RE1A 5E3RA 4CO3A 5F8GA 2XLIA 4X4UA 3QMQA 1H7XA 3TARA 1DHMA 1ZOTA 3NBPA 5A8KA 3K2YA 1X7VA 3UQSA 3P3DA 3CPWR 1JLCB 2CDQA 3HXMA 1VRUB 2B4PA 2BM0A 2YVSA 5ITHA 4DSJA 2L41A 4KTQA 2GQQA 3OFEA 4USHA 3DHXA 4QIFA 3NGDA 2AD9A 1S1XB 1KLNA 1D9AA 1HBOB 4MYUA 3B4MA 1V3ZA 1IKYB 3HI9A 3M2UA 1BQMA 1P6TA 5A2QY 5CZVA 5EWGA 2CQCA 2C3UA 1VQSA 3OBIA 4XK8C 1VQOS 2OH2A 2K8GA 5A8RA 1I94F 1SB6A 2I1RA 1MU2A 1RTJB 4BC7A 1R7IA 2RILA 5SZTA 2HNDA 4KFBA 3RZAA 1T05B 2FJWA 3C6TA 3J7Z5 3RAMA 4R8UA 1NK5A 1Q79A 1M1KT 4ILMA 4EZ6A 1Y3JA 3JSMB 3BGLA 5I3QA 1TFWA 4UQTA 3VZHA 4DQSA 2I5JA 3M2VB 1DLOB 4NLVA 4DL2A 3R1LA 4NCBA 4DJBA 2AGOA 3QWPA 4C11A 1GH8A 6FDRA 1F5BA 3NAHA 3MM7A 2KXFA 3M05A 4RWXA 7FDRA 2WCXA 1RTDB 3CC4S 2GW8A 2YX7A 4M94A 4B3RF 1ZAVA 4DSEA 1WI8A 3LF0A 2N3OA 4K4YA 2CQ0A 4PQUB 1TVRB 1UP1A 3M9MB 4H4OA 3ZZTA 4ATNA 4DWIA 3TANA 1SKWA 1JLGB 2XB2D 1IKVA 1H3DA 2ZJQQ 1VC5A 2OD4A 2OPPB 2B3TB 2WONA 2XSJB 3I87A 2DBBA 2JJ4D 2ZC4A 3PV8A 1LKZA 1RT3A 2HMIA 3MI7X 3VWSA 5J2NA 5A8WB 3RYLA 3FSYA 2L08A 2ZH6A 1XNRF 1FXLA 4RKUC 2VONA 4ZPTR 2HFNA 1RT5A 4ETZA 4ZK7M 1VC0A 2GGPA 1J5OB 2B6AB 4EYIB 3LUYA 3KK2A 2DIVA 2WSEC 1MNEA 1QE1B 2DR8A 1T02A 2MZQA 3MMCB 2AYBA 2W8LA 5IM0A 3UDCA 3DLGB 2LU2A 4O4RA 3KLVA 1GX6A 3MD1A 4QR2A 1U1MA 1DBDA 2AYEA 3FDSA 2Y1IA 3TOQA 1XNQF 1RT6B 4CO0A 3Q8RB 3QJLA 3KK1A 2LCWA 4H4KC 3MOJB 1M5HA 2IM2A 3OVSA 2CFXA 4CTAB 1FRMA 1N5QA 3H8YA 4AL5A 2FHJD 5LSOA 2RQ4A 1LXJA 2BABA 3MM9B 1HNXF 1X0PA 1RT2A 2A10A 5IQQA 4IUFA 2FIUA 4HDHA 2D1CA 4NCAA 1LWCA 2BYCA 3GG1A 1FDDA 4IFVB 5FDLA 3FCHA 1OPIA 4HT7A 2PIIA 2K3IA 3O3LA 2PMZD 2XCAA 5DQHA 5A0YA 2NUHA 1RK8A 2HZCA 4KB7A 2CPFA 2IA0A 3GQCA 5J1NA 2RB7A 1XMOF 1D0EA 1S97A 4YB1P 1IJFB 2OJ3A 4MK8A 4YDXA 4DV2F 1REVB 1UVNA 3RB3A 3OR1A 4NWBA 7FD1A 1RTIB 2J7WA 5KFFA 1VRTA 3MR5A 4ED7A 2DCLA 4K4XA 4KPYA 2E5HA 4FZVA 3K57A 1VQ9S 1KRPA 3CCSS 2RUGA 2YQ3A 4C8MA 3IRXA 4J9OA 4LFCF 1C4AA 1RT1B 1BGXT 3ETOA 5DLFA 3FFIA 2DGWA 4FNHA 5EN1A 5L1LA 4C0HA 3DNCA 2P9CA 5KFPA 5DG7A 4OI0A 4C9DA 3UFCX 3CIMA 2UUTA 3BR9A 5I42B 2OTJS 4TQSA 1Y00A 2BM1A 4LVNP 2YKPA 1JJ4A 3J7YU 1X5PA 2OKQA 3DLKA 2OP5A 4IOBA 4KHRA 1KHVA 2HS0A 3NS5A 3HM9A 1X4AA 1Q82T 3LP2A 3DLEB 3OXFA 3OTBA 4IO9Q 3PO4A 2YWKA 1FNXH 2CJ9A 2W9CA 2FHJA 2ERRA 3FSIA 1VK3A 4F25A 2KT2A 1FJGF 2RDJA 3ISZA 1B0VA 2W4CA 3MMBB 4B9VA 1R43A 3DU5A 1VQKS 2DNRA 1LW0A 2E66A 2LDYA 3LAKA 1H98A 2EFPA 3PXGa 3NCRA 3RRHA 4RUHA 3T5LA 3K0JA 1B7FA 1NK8A 3FQKA 2Q1LA 4AYBD 2XMJA 4BBYA 1N6QA 1HNWF 1HI1A 3DLHA 2J7UA 2WOMB 1VQPS 3G4SS 4W90B 2LECA 2PA8D 1N0VC 4WIIA 1FKOA 2XG8A 5HBMA 4MKBA 3H20A 2J0QD 5J2QB 3TAQA 1HQEA 3I32A 3EPGA 5C24B 1SUQA 2HFZA 4RWWA 3HHNB 3FZBA 4ZDNA 3MAHA 5J1EB 1SJFA 4B3SF 4YFUA 1TKXA 3CUNA 1C0TA 4URQU 1S1UA 3O2IA 4DL7A 1YWXA 2KZMA 3CWJA 2LVWA 2B4VA 2ZC3A 5JVGQ 1XR7A 4B3OA 1TZ0A 2EWHA 3FEZA 3DRRB 4NLPA 4A8KA 5HLFB 3CJ0A 1F5CA 3U02A 2V8GA 4F67A 4NLOA 3EX7B 3N01A 4PG6A 2DR7A 5GADI 3OQ2A 5HP1A 3BSOA 3TX8A 4DX8H 4F8RA 1W2BR 3C66A 3M30A 5K14B 3KLIB 4Q0BB 4OHZA 3TYTA 1TFYA 3CDEA 3OFHA 2HGNA 5LJ3Y 3KNGA 4CZCA 2ZUGA 4CH7A 1K73T 3M6XA 4DS5A 2KI2A 1U2RA 1TAQA 4NLUA 2DNHA 3LQVA 4QOTA 1DQ8A 4IQXA 1DTTB 1BQXA 3O44A 2XI3A 2XHWA 5KT6A 1HPZA 3MTKA 5KT7A 5KFSA 4TU8A 3G96A 1NB7A 3GYNA 4LIRA 3J7ZT 2KRRA 1VBYA 1WELA 1L3SA 2YX4A 2MQLA 2F9DA 3M8PA 1LK5A 4Z37A 1D1UA 2DPIA 5BYSA 4PXDA 1E6YB 3MEEB 2R8KA 1JLQB 3BGRA 2D7SA 3NMAA 4ECVA 2WB1D 3IR7B 1UFLA 2N4CA 2IVMA 4J9KA 5KOXA 1FEEA 2GCFA 3DXBA 1XR6A 1MMDA 2GV1A 3KMQA 2VG7B 1L3UA 3GIJA 4ITSA 1MMNA 2XI2A 2YKMA 3RAXA 3H98A 2ALZA 2BVZA 1WF1A 2QMWA 3PIOQ 3MFHA 3TR5A 3OJUA 3IR5B 1NK9A 2IRYA 1M5SA 1RKIA 1TL1B 4GMKA 4ECZA 3MMAA 2FLLA 4I0WA 4ECQA 1WI6A 1M5PC 4MTPA 3OTCA 3ZZOA 3PDNA 2DNGA 3PEHA 4KV8B 4OHWA 4ZPBA 4NXMF 3M2RB 3S01A 1IUJA 4ECYA 1HARA 2I9SA 2ZJPQ 3LW5C 3DRXA 5DM7Q 1D3WA 2HNYA 4GO7X 4NCGA 3BO2A 4V19J 1OPZA 4RW6B 4I4BA 2IFXA 3SEOA 1NJWA 3D2WA 3MMJA 3S7RA 5LL6d