3MURP

Crystal structure of the c92u mutant c-di-gmp riboswith bound to c-di-gmp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and biochemical determinants of ligand binding by the c-di-GMP riboswitch .
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3murP00
1A7GE 4EGLA 2X1FA 2G4BA 2LECA 3CULA 2CPYA 2LXIA 2G0CA 1R8PA 1YI2S 1S79A 2MGZB 1KD1T 3CD6S 2F9DA 1Q7YT 3G8SA 1A9NB 2RQ4A 3VAIA 3NS6A 4CIOA 3U1MA 2MJNA 2D9OA 1URNA 2I38A 2LA4A 2E5GA 2MPUA 3VF0B 3B4DA 1U1OA 5BJRA 1WG4A 4TU7A 2BOPA 5HO4A 1VC0A 1K8AT 4CH0S 3SMZA 2DNHA 2DH7A 2XB2D 2N3OA 3RW7A 4C0OC 3DLLQ 3NNHA 2YH0A 1X5OA 2CPIA 2HGLA 3S01A 3VAMA 4LIRA 3G71S 3BEGB 3G6ES 2KG1A 3NNCA 2O3DA 4QQBA 1W2BR 1P27B 1VQMS 1WEYA 3TO8A 1PGZA 2DNZA 1F9FA 2JX2A 1DRZA 4WFAQ 1VQ9S 2M4MA 2LCWA 5CXTA 1X4DA 1OO0B 1M5OC 3PIPQ 2CPXA 1FNXH 2OTLS 1QVGR 3ZZZA 2DGXA 2PE8A 3P49B 3D2WA 3BO4A 4IUFA 2MZQA 1QM9A 2LKZA 4WFNQ 2HZCA 2F9JA 2M8HA 5LXYA 3G4SS 2DIUA 3CUNA 1YTYA 3OW2R 5IQQA 2KU7A 3MXHP 3Q2SC 2AYMA 3EGZA 3THPA 1VQLS 2M0GB 4C7QA 2MQMA 1WG1A 3CCVS 1KQSR 3UD3P 4WIIA 2MMYA 2DISA 3CC4S 2CPEA 2KM8B 2KG0A 1KOHA 5IM0A 2M9KA 4TU8A 3SDEA 1WEZA 1N52B 4W92B 4F02A 1DBDA 2XS7A 3K0JA 2MKJA 1NO8A 2OTJS 3B4MA 2MKHA 3MUTP 2MKCA 2KXFA 5D78A 5DDQC 1VQPS 4IOCQ 3EX7B 3MD3A 1FJEB 1X4HA 2RRBA 2LQ5A 2QFJA 2X1GA 3SXLA 1L3KA 2CPJA 3CCMS 3I56S 3I55S 2YWKA 2DGQA 3IRWP 3IWNC 2HVZA 5DM6Q 1JJ2R 2DNYA 2DITA 4F25A 1U1LA 5ITHA 1X4BA 2B0GA 2XSFA 5MLCV 4IO9Q 4WF9Q 1HD1A 5CA5A 2MZSA 2DGWA 2E5JA 2DO0A 3HI9A 2KRRA 1VBZA 3S7RA 2AD9A 2L41A 2VOOA 2KI2A 1Q81T 3TYTA 2CQGA 1FXLA 1U1PA 3CPWR 4FXVA 1M5KC 1WHWA 5JVGQ 2I2YA 2RS8A 1N88A 1SXLA 2DIVA 1SJQA 1X4AA 3BO3A 2MQPA 3H2VE 2OIHA 3P6YC 1U6FA 1Q86T 2J8AA 2D9PA 4F26A 1VQ6S 5GAGU 2FY1A 2MHNA 5EN1A 1BY9A 2DNNA 2DNMA 2OJ3A 1D9AA 2PEHA 3P5TL 4M5DB 2VOPA 1OIAA 2MQLA 1SJ3P 4TLQA 1UFWA 3ZZYA 2N7CA 2MYFA 1VBXA 3V4MA 2LEBA 2EVZA 3N9UC 4RU2A 3BO2A 3U1LA 1SJRA 2JRSA 2ZJPQ 1VQ4S 1WHYA 1P1TA 4LJMA 2QA4S 2KHCA 1R8HA 2DNKA 1IQTA 2MKSA 1UW4A 4PKDB 1CVJA 1HA1A 2K3KA 2MY7A 5DDRC 4A8XA 2MQOA 4CQ1A 4C4WA 1VQKS 2EK1A 5CYJA 2MGZA 1N8RT 5LXRA 2M7SA 1M1KT 2XNQA 3LQVA 3CC7S 4OZ0A 2LYVA 2ZJQQ 3NMRA 5IFMA 2DO4A 4UY8T 5LJ3Y 2J76E 1H2UX 2RS2A 2NZ4A 4TU9A 2KVIA 2LMIA 2A3JA 2M52A 2WBRA 2RRAA 1B7FA 2M70A 4QPTA 3CXCR 1UP1A 5JVHQ 2JWNA 1U1MA 2E44A 4UQTA 1K9MT 4ERDA 2X1AA 3CCLS 4PR6A 1HL6A 1VC6A 5LJ5Y 3UCGA 1VC5A 3VAKA 4LMZA 4Y0FA 2J0SD 1M90T 2KXHA 3VAJA 1YJ9S 3MUVP 2DGSA 2KRBA 1YWXA 1X5PA 2DGTA 1AUDA 2DNOA 2M8DB 2HYIB 1DHMA 1H6KX 2CQCA 3UD4P 4YOEA 2CQ2A 2DNQA 3FEYB 2CPZA 3PIOQ 2M2BA 5GVQA 2DNRA 3VAGA 2RT3A 5DM7Q 2ADCA 1QVFR 2E5IA 3NS5A 2DHGA 2KH9A 1WI6A 3TP2A 1K73T 1WHVA 3CCQS 1YITS 1U1RA 1H2VZ 2D3OR 1X0FA 3BS9A 2DGOA 2N82B 1X4CA 2FHOB 1H2TZ 2DB1A 2HGMA 2ADBA 2ZJRQ 2DGVA 3HHNB 1WHXA 2SXLA 3G96A 1JJHA 2JVOA 2AYBA 1WF1A 5H1SV 3CC2S 3CCES 3S6EA 1NJIT 3UWTA 1U1KA 2OSRA 4FXWA 2E5HA 4ZKAA 3CCJS 2RU3A 1VQ8S 3CMES 2CQ4A 3THTA 1X5TA 2LA6A 1U1QA 1FJ7A 3J7YU 2AYGA 2DHAA 2KXNB 3P3DA 4WKRA 4BS2A 1VQ5S 2LXUA 2CQIA 3CF5Q 3MDFA 2MJUA 2KYXA 1VBYA 4CH1A 2XS2A 3UE2A 2G1DA 2XS5A 2MQQA 2GO9A 4P6QA 2CQ3A 3DXBA 3S8SA 1WTBA 2VODA 1SJ4P 2MXYA 1PO6A 1UAWA 2MZJA 2FPHX 2KN4A 3MURP 3R1HA 1KOOA 2DK2A 1YHQS 2N3LA 5DETA 1YJWS 3JB9k 1U2FA 1ZH5A 3H2UB 1X5SA 5IM0B 4V19X 1VQNS 3SDEB 1D8ZA 4W90B 2U1AA 3MUMP 2U2FA 3CCUS 2X1BA 1SJFA 3CCSS 1KC8T 3FEXB 2VONA 1S72S 2L9WA 4IOAQ 3VAHA 4WFBQ 2DHSA 1RKJA 2L08A 1X4GA 3UCZP 2K8GA 3NNAA 2DGUA 4J5OA 2JVRA 4Y00A 1DZ5A 5FJ4A 2CPHA 2CQBA 1WF2A 1YJNS 1FT8A 2RUGA 1WG5A 2J0QD 5D77A 2CJKA 2Q79A 2NLWA 5GAEU 2DHXA 1WI8A 1FO1A 2CQPA 2DNLA 2DNGA 2RNEA 2QEXS 5LSLA 2MZ1A 3ULHA 2FC8A 2KT5A 3CTRA 3R1LA 4YUDA 2KM8C 1U1NA 2CPFA 2CQ1A 1JMTA 1WF0A 3G8TA 3Q2TC 5GMKa 3R27A 2YTCA 2LEAA 1M5VC 1RK8A 3CCRS 3VAFA 3US5A 1WWHA 1YIJS 2MB0B 5DDPC 2EK6A 1FHTA 3VALA 5LSOA 2M88A 3G9CA 1WEXA 1OWXA 1JJ4A 3MD1A 2AYEA 4QU6A 3LPYA 1XN9A 1NU4A 2YH1A 2FC9A 2RQCA 3MI7X 4PRFA 1G2EA 1U6BA 1FJCA 2CQDA 2GHPA 1ZZNA 2MKKA 5GADU 1VQOS 2DH8A 5GAHU 3EGNA 2MSTA 4WCEQ 1O0PA 2CPDA 4ED5A 1WELA 4U67Q 2YKAA 3J7ZT 2DNPA 2MSSA 1OPIA 2MZTA 4OZ1A 3RW6A 2MQNA 5DDOC 2CQHA 5HL7Q 3MOJB 1X4EA 1VQ7S 2XNRA 1N54B 2OSQA 2DH9A 2RVJA 1M5PC 2UP1A 2MY8A 1X4FA 2F3JA 4QU7A 1HD0A 3UCUP 2MZRA 2ERRA 3CMAS 1ZZFA 2V94A 1Q82T 2MKIA 2HGNA 4YB1P 3L3CA 2KFYA 2CQ0A 4Z2XA 2BZ2A
chains in the Genus database with same CATH superfamily
3W9JA 2G4BA 2LECA 1U2CA 2K7KA 2OPRB 1VQSA 1TL1A 2ILZA 4DLEA 2YNGB 1A9NB 2XCAA 4OYPA 2HHHJ 4DWIA 1EQMA 2W9BB 1URNA 3M1VA 1UW9A 4F7VA 3M8PA 3ZTOA 2VU5A 2MTLA 2BYCA 1K0VA 1J5EJ 2Y8WA 4CLYA 4PPDA 5A6PA 2MHEA 3RB4A 3PKYA 1U8WA 2H54B 4M5KA 4IOBA 1DTTB 5JUMA 2L9NA 4F04B 3OSPA 3ILLA 2VZ9A 2UXBJ 1RWMB 1SIWB 3OXGA 2HBYB 3QSIA 1U24A 2HAIA 4WFZA 1IKXA 3NP5A 2VPXB 4FKYA 1U26A 2RHQB 2XLJA 4OJHA 1T02A 4URQU 4DQSA 2MKJA 4OZ5A 5E2QA 5B0BA 3AJDA 3DOMA 3CDUA 3H42A 3M7VA 3FSYA 4F8RA 1S9GA 2O66A 3MD3A 1PILA 1IXKA 1HBMA 3LOUA 4DJBA 5I3PA 4Y65A 5ITHA 1X4BA 2B0GA 2AJFE 4LQ3A 4IO9Q 1LWFB 2ZVSA 3QNWB 4NLPA 1NK6A 3KOAA 4LQ9A 2W8LA 4IDKA 3NGSA 2KRRA 2E9TA 3PW5A 2CQGA 2AJ0A 2GHWA 5BYSA 5A8KA 1UTAA 1RT2A 2J6UA 3ET6B 2DIVA 1SJQA 1PYOB 1WDDA 4NEZA 3LUYA 3KFWX 4CCHA 1YBUA 3J80U 2RE1A 3RBDA 4AL5A 1JKHA 2EVZA 2B4OA 3BO2A 2ZJPQ 5AXKA 1WHYA 3QLHA 2DR8A 1FDAA 4JI5J 1CVJA 2CAJA 2MY7A 2IM1A 4FYXB 1KHWA 4LSZB 2NPFA 1H2UX 4PCQA 5T7LB 1JLQA 4QPTA 1S1VB 1FWKA 1VC6A 2XULA 3PXGa 2E66A 3QRQA 1BXNA 3BPDA 4WE1A 2FZCB 5D0GA 1N34F 3EDRB 2ZH7A 3W2WB 3FEZA 3RRKA 2Y3YA 2CPZA 3QRRA 5HLFB 2YNHA 2KT2A 3FKBA 4RBTA 4BC7A 2N7YA 1T94A 4O3RA 3EXCX 4YB7A 2ZJRQ 1K0TA 4WP8A 4ELVA 1FKOB 1YDLA 1D9DA 4WFYA 1C1BB 1FJ7A 2P9CA 2VUGA 5KFNA 2O67A 1GX5A 3CF5Q 5CZVA 2AHOB 1S1TA 3KLHA 2GO9A 3H8YA 5K20B 4OHZA 2CQ3A 2NREA 3DXBA 5THWA 4WJBA 3ETMA 3TX8A 5FLXY 4KY3A 1PO6A 2GVZA 3FZ2A 1RDRA 4Y3CA 1FTCA 3UR0A 2N3LA 3FC9A 1VQNS 5GAEI 1WSVA 1NDKA 3AA8A 2UUBF 4JI8F 4Q7AA 3LANA 2YKMA 3QRPA 2HIYA 4ILMA 2HBRB 3I5AA 3QQCD 2BV3A 1X7VA 4EYHB 1F5CA 2WVEA 4JV1A 1JIHA 3DLHA 1S1WB 5KOXA 4LFCF 1U1NA 1JMTA 2DEJA 1IBMF 2YTCA 1VJQA 5M2PA 4O4GA 1WWHA 2NXNA 2DY1A 3TVKA 2M88A 3VR1A 1XNRF 1Q5YA 4AT1B 4M5JA 2FC9A 2A1BA 1AW0A 4ED3A 5RUBA 4ZN1A 1PG5B 3T5KA 1TAUA 1HNVA 3IM8A 3RGIA 3UPFA 3DLEA 3I4HX 3I0RB 4NI2B 4CO2A 4RZRA 4DV1J 4KH1B 1KLNA 4H4OB 2HGNA 4Z2XA 2BZ2A 3AOBA 3NOGA 2EFNA 2IJRA 3CCWA 4XIUA 2H4WB 1I51B 3TQ1A 4CIOA 3RB6A 5ETVA 3HMJG 2B9YA 4CLUA 5B09A 3DI6B 1G6BA 3SMZA 1Q1KA 3KJVA 2YH0A 2VH7A 3VAMA 1V9OA 5HK4A 3G71S 5BYRA 4PYAA 5C7PA 2VDIA 1W2BR 1P27B 5DJBA 2PMZD 2ZD1B 1BHNA 1DRZA 4LRFA 2QA4G 2LCWA 3W66A 3K5LA 5CXTA 4K2XA 1FEHA 1M0SA 4DF8A 2DGXA 1Z2LA 1TL3A 4Q0BA 3VV2B 2Y8YA 4AXIA 4KH0B 1F9EB 4HLBA 1WKKA 3TA2A 2MDAA 5J2NB 2BKNA 4DL7A 3WHIA 3MPVA 2LFVA 4EK2A 4HR2A 4URSA 5IM0A 5AXNA 4YP3A 5H9EJ 4USWA 4YR2A 3V2UC 1GT8A 3LPEA 4DL4A 3K0JA 1S0MA 2C42A 5A0YB 3OTOJ 5EWGA 3D67A 4PXCA 3HHEA 5E0OA 4N76A 4GVLA 3ADAC 3EX7B 4QCLA 4OX9F 3MPUB 3HKWA 2CDRB 1L3VA 1LWEB 3MMAA 3KUGA 1C0UA 4CO5A 3ZXWA 5BR8F 4KRWA 2R2RA 2F4VJ 2ILYA 3D6TB 2ACMA 2IY5B 3DDNA 1TTHB 1Q81T 4UF4A 5I42B 3MR5A 3NS7B 2KJWA 2QX0A 3DOKB 3SCLE 1NJWA 4QWEA 3TA0A 2VIHA 2MHNA 2R7RA 1SJ1A 4JI1F 2OD6A 3A1YG 3CJRA 4OMFG 4IRKA 1QUVA 3HD2A 4LJMA 4GC7A 1WJ9A 5A2QU 2V34A 4PG6A 4K50A 2OPRA 5DZ7A 4CQ1A 2YNGA 3NG8A 2HPUA 3H59A 2ZH6A 4P52A 4QW8A 2W9BA 4PG8A 1AZSB 4JI3J 3MCNA 2M70A 3EUNA 3LWMA 2BR0A 1KEKA 3AOCA 3OVSA 1H7XA 2GAHC 3ZNUA 3ILIA 4LF9F 3VAKA 3UN3A 2VFUA 3MMCB 3I82A 2KRBA 5G0RB 3NGKA 5T14A 4NLOA 3O8WA 2IM3A 4LRDA 2FGOA 3NAHA 4DCJB 2CQ2A 2CIMA 2DXFA 4NA2A 3PIOQ 2V4JB 3M9MB 2BUNA 4MKAA 2Z57B 3MM6B 2E5IA 3OL8A 1Q4RA 1YITS 3IXQA 2YPYA 2HGMA 2D74B 1MNEA 3ZZUA 1RXOB 1FNMA 1JLEB 2FVQA 1X5TA 3CDWA 3J7YU 2DHAA 3C8YA 4WKRA 5D3GB 4A8OA 2W4CA 4YDXA 2MJUA 2NUHA 4R25A 1R0BG 2EFPA 2L3MA 5FD1A 3AAWB 5DETA 3JB9k 2BW7A 3MEEA 2YX4A 4C8LA 2ASLA 1LWFA 2ALYB 2U2FA 3UNGC 3PM9A 2J5AA 1RBAA 2H5EA 2HWTA 3KG1A 3WDOA 1RKJA 5EX3A 3CO0P 5B0EA 3AOAA 2K8GA 2DGUA 4K4XA 2HSEB 4DUYF 2BE9B 2HFVA 3W5ZA 2NLWA 3ET6A 5GAEU 4JI6J 4DPTA 5GADI 3L4BC 1NCLA 2KFZA 2Y9HA 2GZOA 4KV8B 1Q8BA 2VQEF 3R27A 3UO0A 4G3IA 2B43A 2RKIB 1TK0A 3PY8A 4B9VA 4R0EA 2XMUA 4ES3A 2EK6A 3BR9A 1LWXA 2XYPB 2NQPA 4EUVA 3BKUA 3CJKB 1TL4A 1G2EA 4J9VA 3U1NA 1IQZA 2MSSA 4HL9A 1FXRA 3U7JA 4Q43A 2VASA 1RWNB 5CYQB 4QW9A 3NMAA 2MY8A 1ZTWA 1XNQJ 4HTJA 2ERRA 1ZZFA 3KJQB 5DQIA 1S1VA 1UJ4A 3TJ9A 4USJC 2R2UA 3O1LA 4C0HA 3PW2A 2BJ7A 2CPYA 1Y10A 2PA8D 3OV7A 1T05B 1AB8A 2RQKA 2IM0A 3IR5B 3W2WA 3X3UA 1Q95G 2FJXA 2CNNB 2W8KA 5HLFA 2ROEA 4XDCA 2PI4A 1LFPA 4X66F 3TJAA 1WOPA 3SSQA 2WVCA 3VZHA 2EWHA 5BJRA 4NLRA 3BYRA 5HO4A 5L38A 5LMNJ 2DH7A 2B9WA 2GHVC 1FKOA 4LIRA 1G1XA 1C1BA 4A8SA 4DR3J 4DCOB 1I5OB 2Z30B 1OO0B 4NLXA 1N5YB 3PIPQ 4NYPA 4A48A 3MCSA 2WW4A 4NMXA 3CJ2A 1YJVA 3THVA 2E5LF 4QJVA 5E5NA 1CQNA 4OYZA 4L73A 4B17A 2F65A 3Q2SC 3C6TB 4L3KA 2V68A 2MQMA 1YKWA 5ETPA 4B9TA 1CULB 3UD3P 4RW6B 4W92B 2HHQA 1ELOA 4AQYJ 2LVWA 3KLIA 5B08A 4RBUA 3OJUA 3SZ2A 2JH3A 1X9MA 4NXMF 3I5CA 2HHSA 3BGFA 3D28A 5D78A 1VQPS 2OI2A 3MFIA 4K0KF 1KTQA 1R31A 4D3GA 3F56A 4CRJA 2CFXA 1T11A 4QIFA 1LEOA 2GIRA 2HHTA 1NJXA 4ZIWA 4YQWA 2XI2A 1S1WA 4F25A 4LFBF 4LF7J 1UVNA 3QPIA 4WBFA 2DO0A 3K5NA 2LDYA 2FZGB 3NEKA 1B7YB 4MK9A 3V5RA 2RS8A 1N36F 4ED1A 4USIA 4Q45A 4C9DA 3FMBA 1Q86T 1OQ6A 4EYIB 2D9PA 2XMWA 3I0RA 4PUOB 2V2VA 4NI2A 3TUZC 4O0NA 5KFTA 3IS9B 4FF4A 2NR0A 1JLFB 4PXBA 4EBCA 1B64A 2VICA 2BQUA 3QT6A 3LP2B 1FESA 1FRHA 1LXJA 4DR6F 4DQRA 2VPZB 4DG1B 4ICLB 2ZOMA 4RR5A 3BGOP 4CLLA 5CCLA 3WIUA 2HWHA 4JI4F 2UXDF 3DI6A 4DR7J 4NA1A 3T5HA 1W2IA 2CDQA 1HNWJ 4K8RA 3CJ5A 4FZVA 2BXJA 2CQCA 2A18A 4YOEA 2ZD1A 5IXUA 4JBCA 3Q24A 3OUYA 2J9EA 2C2RA 3BGRB 2D3ZA 3CCQS 3QWPA 4DPUA 5L9NA 1FXDA 3FBCA 5KAKA 1ZM2A 1R43A 4FXWA 2E5HA 3MGJA 3CMES 4F0HA 2AYGA 5IOLA 2ASYA 4LF5F 2L48A 5A0YA 4MH8A 2D3O1 3W9IA 2CWXA 1RT5B 3N6LA 3PRDA 2XO6A 4YS2A 1NSPA 2MZJA 1F60B 1CQMA 1LWEA 2UUCJ 5KG2A 1TK8A 3PFOA 4OI3A 3ONQA 1PAEX 1S72S 2Z2MA 1XMQJ 5I42A 3IBWA 3UVJB 1U49A 3DOKA 2V9WA 2YQ0A 2EC2A 2QEXS 5CHCB 3GMGA 1VRTB 3R1LA 1JLGA 1FDNA 1WC3A 5HQMA 2VG5B 3R2CJ 3V6KA 2BJ3A 4YDDB 3W5YA 2ATCB 4B9UA 5GADU 5KFCA 1RA7A 3HHLB 3IRXB 4ED5A 3CGIA 2ZH3A 9ATCB 3OR2B 4IRCA 3MOJB 4LF2A 3CSKA 4DDFA 2C2OB 1X4FA 4PG4A 1AZSA 4WKYA 1MWZA 1FEEA 3OTCA 4QYRA 3BKTA 3BKFA 1KHVA 4Z7YA 3J81Y 4DV7F 1S1XA 4EMDA 1FJGJ 2HQDA 4GO7X 4D3HA 2BEFA 1RYSA 5G0RA 1QD1A 4RKUC 2V2KA 4DS5A 1OQ3A 2V4JA 4P73A 2NSCA 2R8HA 2WVFA 3MM6A 4QIWD 3WBZA 4DSFA 2DRAA 1Y00A 2WSFC 2HMIB 2XHWA 4CH0S 3BREA 3PO5A 3LGNA 3AB4B 3KHGA 3T5JA 4C0OC 1RAIB 1JNRB 2Z2YB 4M94A 3G6ES 4PG7A 4LFAF 4QQBA 2B4VA 5HJXA 2FLNA 3MMJA 5D3GA 1HI1A 4IG3A 1TR0A 5K8NA 1FNXH 3JQMA 4QWDA 3KLEB 2V8DA 3G4SS 4WP9A 5KFZA 2AYMA 3ZFVA 1T9TA 2W9AA 1IBKF 1HIYA 2CPEA 4I2QB 2YX1A 3WC0A 1NBEB 2Y0SD 3H2LA 2XS7A 1NO8A 3EZUA 3EE3A 4DL3A 1KQKA 4J9UE 2C22A 1FJEB 2D7SA 4OI4A 4F4YA 5F8NA 2V9KA 4NASA 3W7BA 4CYUA 3GCXP 5KFOA 4KV8A 2EXUA 1HD1A 4G6VB 3OLBA 5M2UA 1HNZJ 2HRYA 1MMNA 9RUBA 2Q66A 4GVBB 3CJKA 3PVXA 5IT4A 3DM2A 1JWWA 2YQ1A 2PD1A 1U09A 1X4AA 3B82A 3GIRA 2J8AA 3M6WA 1B70B 3TI0A 1SH0A 2LQBA 1QTMA 3R3TA 1SKUB 4B9SA 5CYQA 4CNYA 1VJWA 4ZOSA 2H5IB 5ETSA 3QYYA 3ZC4A 1O5JA 3VZIA 2LU2A 4QYZJ 4HTIA 5G4DA 1R8HA 1T05A 1NMEB 3P45B 2MQOA 3DLBA 1Q8IA 2QA2A 2OPQA 2I9SA 1LW2B 3W9HA 2UUWA 2JC0A 2XYGB 4TYBA 3I32A 1WSRA 5D4OA 1AXQA 1IVZA 3OL9A 2LMIA 4K4ZA 1UWAA 5JVHQ 2K2PA 4DXLA 4K4SA 1JK9B 1TQLA 4RUAA 4V19J 4B3TJ 5F0WA 2M2BA 2DNRA 5GVQA 2ZKTA 4DQIA 1N5YA 3NS5A 2DHGA 2KH9A 3G6VA 3D3CJ 1Q16B 3H5SA 4NZ7A 1WHXA 2W4PA 2XMMA 4DX7A 2KKHA 3DOLA 3S6EA 1CULA 3AQOA 3GCWP 3EZ5A 3DU6A 4LVNP 2CXEA 1RTDB 4RW6A 2W01A 3RJMB 3KK3B 3VTIA 4DSEA 2LXUA 2PO4A 4K2JA 1NDLA 4CH1A 3M30A 4HDGA 2F7VA 4L3NA 2VQFF 1YHQS 1UVJA 1U2FA 1HW9A 3MM5B 4V19X 1N5VA 2FQQB 3GR0A 3H5YA 5D0EA 1NK7A 3IGNA 1HR0F 2R7UA 3OSNA 5ETLA 1N5SA 3CT9A 3IWXA 4ZS6A 3QMQA 4OI2A 3T41A 2YQ3A 1WI8A 1IKWB 3T6BA 1HFEL 3CTRA 2R8KA 4P71A 5IT9U 4PUOA 4ZDNA 5GMKa 4QZVB 4JP8A 2B6AB 3IS9A 1SKSA 1JLFA 4OX7A 1WEXA 3FCHA 2CJQA 5F8GA 2HQ3A 4LVOP 1YBTA 1LW0B 2JL9A 4A46A 3LP2A 3LAKA 4DG1A 1LFWA 2FHJA 3K2YA 4O3OA 2CPDA 2IMWP 3J7ZT 2MZTA 2OPSB 4YB6A 4JI2F 5HL7Q 1MMDA 2OSQA 3MAHA 2QLBB 3DNCA 5ETMA 1UA1A 5EDWA 4C11B 1XK8A 3HHKA 1ZAXA 1KDNA 2EEYA 3PYDA 2B56A 4N7TA 3W2VB 1UVLA 2HQGA 1HWJA 3SFGA 5H9EK 1HBUB 3NRBA 2I38A 5D4PA 5KFHA 3UQSA 1WG4A 3PZPA 2BOPA 5FLXU 3C6UB 5LMUJ 4C6AA 2IDEA 1VIXA 4KGMA 1WNEA 1RLDA 2CNOB 1Y7PA 1IBLF 2KG1A 3NNCA 3CD0A 4NLTA 2UUTA 4PPZA 2JOQA 4C98A 5I3UA 1QVGR 2HZCA 1RT5A 2M8HA 2RIJA 3HVRA 3HFZB 2DR7A 5KFGA 3GTYX 3EGZA 2RJZA 1S6PB 2YKNB 3G82A 4ZPVR 1ZOTA 1IWGA 3QFWA 4WIIA 3AD9C 2ZVIA 2M9KA 1Y5LB 3PDNA 3H20A 3RBEA 4PAAA 1BE4A 3MWBA 1FE0A 2MKHA 1XMOJ 4DV2F 2KB2A 2RQMA 2XY7A 5DDQC 3T1AA 1FFSB 4O4RA 4C3LA 3PX6A 6FDRA 1L3KA 4DV0J 3CCMS 2BOAA 3SCJE 2ZWOA 5ETKA 1SIZA 2DNYA 4K4YA 1VRTA 4NXNF 2FD2A 3NCRA 5IC6B 5CA5A 4N5SA 1S1UB 2VG5A 1VGYA 3RR7A 4ITSA 4WZQA 1LOUA 3M8WA 3CPWR 2PFDA 3TR5A 1WHWA 2I5JB 4ZP9A 1B0PA 1S57A 3HHLA 3IRXA 4ZPCA 5GAGU 5U47A 2OD4A 4IRDA 2GCFA 1SC1B 4I69A 2DNNA 1NAQA 1Y11A 1M5SA 1RWOB 3JYTA 1VIOA 3DDIA 2PMWA 2QA4S 2B7BB 1M5HA 2XLKA 2VKZG 1S6OA 4NMLA 5LXRA 2APOA 1CLFA 1S7IA 1U02A 1QSSA 1EARA 5CYMA 3M6XA 2QFIA 4QR2A 2HMIA 5LT5A 3O2IA 4DFMA 4W4MA 1NK0A 2JWNA 5BYQA 3HXMA 3QGHA 4XK8C 3D5MA 1TP7A 3EM1A 4PABA 3JXOA 1QAYA 5KG1A 5HN0A 4ETXA 2CNKB 2B5JB 2Y1IA 2RF2B 1DAXA 2HBZB 2C3MA 4QIGA 1NB7A 3DMJB 2VC0A 1CBKA 4A8QA 3TP2A 3KHHA 4DHVA 4DPWA 3OTEA 4V1Ak 3KLEA 2ZH8A 2NXCA 3ISNC 3UR3C 4R0JA 1U25A 2NPIA 4JV0A 2FJBB 1RBOB 1ZAWA 5I3QA 4FS1A 2NZCA 3IO1A 4I2QA 2BE2B 4NEYA 1VQ8S 3THTA 4OHYA 4N8NA 1NPRA 1TFWA 4WFXA 4MTPA 1FE4A 2FLPA 2F8HA 1SBRA 2J0WA 1VHIA 4RBVA 4BBYA 4DN9A 1ZH5A 4FP9A 4NZ6A 3A3NB 4DCPB 5L39A 3W5XA 1OSDA 4RUHA 1SJFA 4TXSA 4USMA 3K8WA 3EPGA 2BJ9A 2HWIA 2UZAA 4OIXA 4IOAQ 1PJ7A 2L08A 3UCZP 4GVBA 4CWBA 2CQBA 5B0AA 1JXEA 2UUAJ 1RAHB 4AXJA 3QAEA 4U8VA 2EPIA 5F0UA 3KXDA 3FNNA 2HHXA 4X64J 4OYAA 5DRKA 2C2ZB 4B3MJ 1YX2A 2NUUG 1MSWD 3PW7A 4ECTA 1LV5A 1XN9A 4CNZA 4B08A 2CQDA 3KLFB 4ZCMA 3R7BB 1LW2A 2N4DA 4DV3J 4AYBD 4ZVSB 2KHDA 5A8RB 3F0NA 3OFFA 1CJVA 2ALZA 2CQHA 1UFKA 5LOQA 3W63A 4ZVTB 1N32J 2RVJA 3OBIA 4DUZJ 3ELHA 1DQAA 3MOZA 5M2RA 4DL2A 1FWPA 4ZLNA 2R2SA 2W2PP 4OLPA 3AD7C 3A8IA 1SVDA 1GK8A 4QWBA 3IR7B 4O3PA 3AXMA 2MPUA 5L1LA 4X4QA 4NLDA 4DR5F 3AHPA 2CADA 4IFYA 2N3OA 2PT0A 3NY0A 3RUBL 4ZK7M 4DR2F 3LP0B 5HANA 3P8BB 5E7OB 1RTDA 1HBOB 1RHQB 3M9OB 3KK3A 1RU1A 3CCTA 4RUCA 2F9JA 1FRIA 1OYDA 1YTYA 3MPDA 4X65F 2M0GB 1N33J 1TUWA 4DX8H 1HARA 3CJ0A 3QATA 3MM5A 2RD5C 1ZTTA 1S6QB 3NCPA 3B4MA 1B99A 3K5PA 1RT1B 1PJ5A 3UFCX 3MEGA 1DLOB 1KQFB 1YLXA 2ZKUA 2W7PA 1R6YA 4QPXA 1KKHA 1NLKL 2CPJA 1FD2A 4ZVRB 1IKWA 2N4CA 3IWNC 1JJ2R 2LXFA 1P9YA 3CDEA 4GO5X 4DL0C 1IM4A 3DLJA 1B3TA 3IAM9 4KPYA 3GB0A 3GYNA 4ECRA 2JEGA 2FY8A 5KFRA 1OY9A 4NLGA 1LW0A 1U2RA 2XC9A 4DU7A 3ITHB 2JC1A 4RW7A 5HATA 1SXLA 3BO3A 4NLYA 1MLAA 2HZAA 1ZPWX 2OPSA 2UXCF 1D9AA 3P5TL 4MYTA 3V4MA 2VBWA 1HPZB 3N9UC 1UJ5A 3U1LA 4E2FB 4C11A 1KBRA 1P1TA 1NKCA 1RKIA 2BVZA 3BR8A 4PKDB 1HA1A 3AD8C 5DDRC 4A8XA 3JTPA 1CJUA 1RTZA 3QIDA 4DZ6A 2AJQA 4J9OA 2AF6A 3W2VA 1N48A 1RTHB 1RABB 4IO1A 1XTZA 4X4RA 3NMRA 4ZITA 3GIIA 1HBUA 3JSMA 3OT9A 3VHQA 1T95A 3R5BA 2A3JA 3CXCR 2Z2LA 3ICLA 4JUZA 4NCBA 3WC2A 3KMQA 3C6UA 5LJ5Y 2C2DA 2IBOA 2R42A 4Y2KA 2DGTA 1TFYA 2EC0A 1KONA 4LUBA 2QLXA 3VAGA 1EP4B 1XR7A 4TYAA 1T3NA 1RWWB 2XWYA 3M2UA 2QYCA 1HQUB 5D6GA 1WI6A 3NGDA 5CCMA 1WHVA 4YB5A 4WIQA 4X4TA 1U1RA 1KFSA 1Q7LB 4AUKA 2DGVA 1NK4A 4I7FB 2YKNA 2AYBA 3UWTA 4HYKA 2UVWA 2YWEA 5KT5A 2OSRA 3SQOP 3MM9B 1LK7A 1HQEA 2VL1A 1EZZB 1PC5A 2HFNA 5KT2A 3AXKA 4JYAJ 5A8WB 3FFIB 2XS5A 4LBHA 3UDEA 4FXDA 2UUBJ 5SZTA 4JI8J 3MHYA 3PRBA 1IJEB 4USHA 2CZVC 2G0JA 4U7UK 4LRCA 3QO9A 1FKPB 3KG4A 4NLUA 2V4QA 2AZ3A 4NCGA 4H4MB 3JS9A 4KBIA 2JSXA 4GKKJ 3MEKA 1S1UA 3EDQB 5C2CA 4ENOA 2R7SA 1S76D 4RW4B 2X51A 2FVCA 5IV3A 3QFHA 4LFCJ 2I5JA 4USVA 1IBMJ 2V69A 2V50A 3GQCA 1XNRJ 4I67A 2VBXA 4F50A 2VFRA 4DR1F 1Y5IB 3PNIA 5KFBA 2W2MP 1FHTA 2VFSA 4U6PA 1IR0A 4ELTA 5K8PA 2YKQA 5KFAA 1FJCA 1ZZNA 3PYGA 3QGIA 4U67Q 4ZVHA 1TVRB 1VQ7S 1N54B 4YY3F 2ZZTA 5B7WA 1HD0A 1URRA 1RHJB 1JNZB 4YHHJ 2B5JA 4Q8FA 2G0CA 3O5TB 1T9UA 4U7CA 4Q8EA 1TMJA 2RF2A 4CO1A 4AD6A 2K3IA 3Q8VA 1O51A 3DMJA 2QA1A 3MFHA 4K4UA 3FK4A 3U1MA 2VA3A 1CEZA 1V6HA 4I2PB 3M8SA 3KNAA 5EHHA 2DNHA 4C3KA 4XPEA 3D3BJ 2CPIA 2GMLA 5DQGA 4RUBA 3DC2A 2ZEJA 2DCUB 2BE2A 1S0NA 3R5AA 1WKLA 2DNZA 3M32B 2HW3A 2JX2A 2F8EX 1NKBA 2DRDA 1UWBA 3ZZZA 3WIVA 4DV4F 3W8GA 3C19A 3VGVA 3ZZ0A 2GV1A 1JX4A 3CUNA 3W62A 1UMJA 1WC5A 3OW2R 5IQQA 1OMSA 5K9FA 3RAMA 3KKFA 3CCVS 3DFEA 4WZMA 4OX9J 3VWSA 2OFHX 3DLGB 3H4BA 2Y1RI 4OYBA 4UOGA 2XY5A 4I0WA 2AGOA 4QYZK 2XGPA 2X1GA 2HK3A 3HULA 1U47A 5KFXA 2Z0GA 2BRKA 4EU0A 1N5TA 3OLAA 4C3MA 1V3SA 2HURA 1WOSA 4DV6J 1RTJA 5GMEA 3HLUA 3E01B 1XNQF 2Z56B 2AKWB 3ZTRA 2AD9A 2RMLA 3TYTA 1FXLA 1U1PA 2DPJA 3BGLA 4ZJOA 5JVGQ 3KLFA 2G2OA 5F8IA 4JI1J 1RAGB 5A8RA 4B9LA 3J80Y 2FY1A 3B6BA 1E6VA 4C8ZA 2DEIA 4KKOA 1VBXA 2AU0A 3BH7B 3CJQA 3Q8YA 4IG0B 3KLGB 5K8OA 3D6FB 2AEJA 2HNYB 3CNQP 4IKAA 3LQVA 1BQXA 4DR3F 1OPZA 4ZCLA 4LF9J 2ZJQQ 5HAOA 2DO4A 2BW2A 4NLQA 2ZFHA 2GJFA 2F1FA 3GIJA 4I6YA 2X1AA 2OPPB 1VC5A 3BN4A 3E51A 3N5BA 4ZJLA 2PSZA 2J0SD 5K5MA 4OI1A 1YWXA 4P2XA 2FJWA 1X5PA 2YKOA 4WYWA 2ZM6F 3W65A 3WX8A 2R8GA 1HBOA 5HP1A 3D0IE 4GKJF 1D3WA 2ADCA 3C16B 3N6MA 3IM9A 1K73T 1NK9A 3BS9A 1QDUB 1JQGA 3W64A 1GMVA 1UPPA 5AE2A 2SXLA 5J1EA 3EGVA 4WWSA 3CIZA 2B8QA 3CCES 2F8MA 2VHGA 3FBFA 1VK8A 1Y9OA 1S6QA 2P9GA 3P3DA 5E3CA 1JLCA 1RT1A 1DLOA 3J7A1 1BWVA 1HW8A 5E41A 1UA0A 2JFDA 3R97A 2AP6A 4DEZA 2FUG9 4I64A 1D8YA 4ID8A 3K7RA 4KR0B 1KC8T 4MIAA 2E29A 3VAHA 3D4JA 1RB0A 2DHSA 1SC4B 4AL7A 5IWAJ 1DZ5A 3UD5A 2B51A 1FT8A 2QZ8A 3FQKA 3TEGA 1RHRB 4C8NA 5KG7A 3D0GE 1RT6B 3US5A 1BGXT 5E3AA 3DKDA 1FK9B 2QL9B 1HPZA 5FDLB 4ZVFA 4DR7F 5CH7B 2HEKA 2BJEA 3R5GA 4TNOA 4MFBB 2MKKA 3A12A 2BJDA 4Q2MA 4ED6A 1WORA 2MQNA 4OZNA 1WDTA 4BWMA 1RTHA 4CM0A 1EETB 4EBDA 3GFXA 3H0PA 2DJWA 3MM7B 1T03A 1F5AA 2MZRA 3CMAS 1Q82T 4ED7A 1EX8A 2KFYA 3AA9A 4C48A 4EGLA 4X66J 1IKYB 4NA3A 3T6JA 1KD1T 2F9DA 1IM6A 3DHWC 1VI7A 1SC3B 1EP4A 1NB2A 3GU0A 1I6JA 3CEDA 2PGCA 1QAXA 3H40A 4KB7A 5KFIA 4RWXA 4EBEA 4X4PA 3IWLA 2DXEA 3V6DA 1O8BA 4O23A 2GVDB 1OJ4A 1GMWD 2ZBPA 1B0VA 3MM9A 5LL6d 2UUCF 4IH7A 3G2XA 4WFAQ 1VQ9S 1MW7A 1AUSL 2PE8A 4URGA 1QM9A 3ZTQA 1JLAB 3TJ8A 1RJJA 3FFIA 5LXYA 4K7QA 1I1GA 2B3TB 4NXMJ 1VRUB 3EICA 3JAMU 1FKPA 1KQSR 2R7XA 1XR5A 5C25B 2MMYA 2Z4PA 4H4MA 2JLGA 3H90A 5EX0A 4K0KJ 4WPAA 3LP1B 5DG8A 3I9ZA 4ECSA 1WACA 1X31C 2DT9A 2FLLA 4RNHA 2WVDA 4RW4A 3CB4A 4LFBJ 4ECZA 1ZM3A 3N79A 1RP5A 4MK7A 1RHUB 3B78A 1F0XA 2HIQA 3I55S 4ECWA 1QE1A 3DGPB 4QWAA 3F44A 3KJNB 4PQUB 4KYZA 3R5CA 1S5ZA 2VB6A 2KDOA 1N36J 4G1IA 4PXDA 3K5MA 4FPIA 3IGVA 1VCTA 2AT1B 2XMVA 1JXVA 3OPKA 5HQLA 5HBMA 2VDHA 1H98A 2QIFA 2GQ2A 1KLMB 1TVRA 4DR6J 5I4MA 3GZ7A 4ECXA 1D0EA 4M5DB 1OIAA 4TLQA 1EIYB 4NPOA 5A2QY 2MYFA 2JEJA 3QZ8A 2G9OA 1R0AA 3MECB 4X84A 2JRSA 3Q89A 2DNKA 2MKSA 1HWUA 2W25A 2UXDJ 2PFFB 2HLTA 2QJ3A 3LAMA 2ZDPA 4TKTA 3FJ2A 2HNZB 2QG9B 2LYVA 4OHWA 4UY8T 4USUA 2HBQB 2M52A 2WBRA 2VJUA 5JXSA 4KTQA 3AB2B 1NPKA 1RU2A 3OTDA 5DLFA 3L9ZA 4CT9A 3GJRB 1YJ9S 1H72C 3GR1A 4HDHA 5EGYA 4J7CA 4Q2LA 4E0DA 1AUDA 2DNQA 3M32A 4NRUA 3IAS9 2W2NP 2GMJA 5J2MA 4K4TA 3H4DA 4DLGA 2YWFA 1UZDA 3H5UA 1O6XA 2BJ8A 2C3OA 2E1CA 1Y3KA 1LKZA 2ZWPA 4ZLLA 2B9XA 4KJIA 7FDRA 4LF5J 3L95X 3AY0A 3OQ2A 1YJRA 2OP5A 3PACA 1BQNB 1REGX 2PA3A 2JLFA 5CAAA 4CLPA 2XI3A 3K5OA 2KXNB 2O01C 5AXMA 4LR8A 2CQIA 3DLGA 1X8DA 4PG5A 5CZXA 5KFDA 5HROB 3HD1A 3TAQA 2OAUA 3UE2A 5HJYA 4G1QB 3GFZA 2PIIA 5F3ZA 3CVKA 1VFJA 1Q8LA 2KN4A 2IJFA 1YQHA 3QT7A 1J5OB 2XSJB 5E33A 3GYGA 3IMQJ 3EXYA 4I1TA 3MAQA 1CJKB 3EVOA 5ETRA 3FEXB 5C42B 2V5HG 1U45A 4ES2A 1X4GA 1RAFB 5CD4H 1H0HB 2VG6B 1A0OB 2CZ4A 2MLZA 3V81B 3TZWA 3C66A 1PKUA 4RO0A 2UU9J 3TUIC 2ZUAA 1XJWB 1BWEA 2HVEA 3ETOA 2WK4A 4FN5A 1M5VC 1RK8A 1YJUA 4FBTA 1FDBA 4BC9A 2H5JB 1OWXA 2FVPA 4IG0A 2C2MB 3WQPA 2VG7B 2AX0A 5DS7A 4U8YA 4B3TF 3M8PB 4MKBA 4BHQA 4DV7J 3J7AN 4N77A 2UP1A 2RB7A 4FYWB 2OHDA 1VMBA 4OV6A 7FD1A 3SCIE 2KO1A 1TU0B 2OPPA 2L9DA 4OI0A 2F40A 2GQQA 2QE5A 3FSIA 3FRZA 1YI2S 3G87A 2Z2ZA 1S9EA 4DUTA 4LF6F 4ETZA 3M8YA 4IFVB 4BCAA 2ACYA 3C16A 5K14B 3M2RB 3NCQA 3EMTA 4LFAJ 4QR0A 4TU7A 1RBLA 1HLWA 4S0MA 2C2KB 3NNHA 2IMOA 1YG0A 2ROGA 4WP3A 1RT7A 1X5OA 3P96A 1H74A 1HMVB 2PDAA 3DOMB 4RJVA 5F3TA 4JI7F 4RW8B 4O44B 4DSKA 1VLOA 2WONB 4Y2CA 1PBUA 1I94F 1SKWA 1IBKJ 1EHWA 3DN9A 2CJXB 3FZBA 2CVEA 2AQ4A 4KO0B 2V0NA 4JI0F 4KE5A 5KFFA 4IDKB 1XIQA 2IRYA 4KPCA 4DSIA 4YFUA 3TNVA 5EWEA 1KVIA 4WU2A 1VR6A 2OTJS 3A8EA 3OTBA 4R8UB 3O44A 4O3QA 2KXFA 4O0IA 2UVRA 3UW1A 1YSJA 2EW9A 1FFGB 5HMZA 4X4SA 2QFJA 1DTTA 2R7QA 5F8MA 3KJFB 1EKSA 2YWKA 1JKHB 3D54A 2IIHA 4M63A 1UVMA 3QLHB 2YVSA 2RUSA 2ZOFA 1VOMA 1G3OA 3HI9A 1FK9A 4ZMMA 1VBZA 3S7RA 2J8SA 4Y2AA 4OZLA 5KT4A 4ZHRB 3LWLA 1EB0A 3PKMA 2I2YA 3F41A 2F63A 2MQPA 2R8IA 5CABA 3MAAB 2XTJP 1EETA 8RUCA 4FVMA 2DNMA 2KZZA 5ETQA 2PEHA 5B0CA 2VOPA 3MM7A 2OLWA 2N7CA 2UV8A 2F5GA 5DGBA 3TA1A 5E3QA 2ZC4A 3UN2A 4ANDA 3LO3A 1VQKS 4CLKA 1NNDA 4H4KA 1L5UA 3CC7S 2NXEA 3IA0A 3KWMA 4DV5F 3T1YF 2P8IA 3GWCA 3QJPA 1BQMB 3R8YA 2XYHB 4PR6A 1V5IB 2JLEA 3HK2A 2V2QA 2GVDA 2RDDA 2IAJB 4J9MA 4F2RA 4NWBA 4KGKA 5KTQA 3BV8A 4CLTA 4OZ2A 1U0HB 2QN6B 5E3PA 4EZ6A 2BANB 2V63A 1XMOF 4Z37A 4HI2A 3I5BA 5DG7A 1Q79A 2R7OA 2Y1LB 2AZ1A 1PSDA 2J0XA 3W3SA 4N47A 5KFSA 3SV3A 4AE5A 5T7LA 3VCDA 2LA6A 3LP1A 1U1QA 2HZVA 4BS2A 3Q22A 4CLWA 2HFZA 2ZDOA 3T9ZA 1VBYA 3D1HA 2HVDA 2E7VA 3NWRA 2WW8A 5L1JA 1SJ4P 5A6WA 3T1HJ 2QO3A 4O4GB 2GC8A 4PQUA 3HT0A 1RLCL 3C3LA 1IJFB 1OY6A 4L76A 2U1AA 4U9RA 3MUMP 4RWWA 3OFEA 2AJ2A 2V6AA 3KG0A 4NRTA 2VONA 2CA9A 1FKAF 4ZLPA 2G13A 2EKYA 3A13A 2IVMA 4USKA 3MPWA 1RCOB 3PO4A 2JEIA 2CQPA 2VC1A 3RG6A 3ULHA 3PYFA 5F9LA 2KT5A 2IFXA 1KLMA 1WF0A 4KHRA 3IP0A 1ZYQA 4M5DA 1MU2B 4HACB 1R3NA 2E1AA 1Q5VA 3G9CA 1HHQA 1U7LA 1VBKA 2XQCA 4JI2J 2COLA 2YH1A 4X62F 3HVAA 4DSJA 3D9BA 1FDDA 3N28A 4B9NA 1PJ6A 1TKZB 2RU9A 3HJFA 4ZPWR 2HNZA 2IA6A 2E9ZA 3SEOA 3KJVB 2NSBA 4DL5A 3HF5A 1TV6B 2XG8A 3NXZA 1SV5B 1RHKB 4J37A 4ANEA 1OY8A 2MKIA 3L3CA 4NOHA 1S4EA 3CULA 2ZC3A 2W2OP 2QTWA 4ZP6A 2EFGA 4ED8A 3TVZA 3L7PA 3MR2A 2RQ4A 4TLRA 1QUPA 1IBLJ 2XBPA 3DYAB 4ZA1A 4FVCA 1S49A 2LLZA 2J6TA 1EKRA 1YZ6A 3DRPB 3DLLQ 3LTOA 2XZTB 4AFFA 1QSYA 3D6HB 4KAIA 2W7AA 3PEJA 1BQNA 2O3DA 2HFSA 4H4OA 4DR4F 1K44A 1F9FA 2JDJA 3BSOA 3TRGA 1M5OC 3BO4A 5HROA 1C0UB 5LM7E 4G1QA 3CJSA 4E8UA 2HS4A 3HP6A 3VVTA 5AE1A 4A4JA 4DV2J 4J91A 2BE7D 1J5OA 4LT6A 1WEZA 2VA2A 2OUGA 3EVWA 4YMEA 3AJ2A 2HQIA 1DBDA 4X64F 2PC6A 1CJKA 3AQPA 3MUTP 4B3MF 5C42A 1HWIA 1R0CB 1B0TA 1T9WA 2QL5B 4NXNJ 4R5PB 4CZCA 3AFGA 2HLUA 2MKYA 2HQFA 3R7NB 3V81A 4U96A 1CC8A 3J7Z5 2P5VA 1Z2ZA 1FRJA 2V8VA 4DV3F 1FF2A 2QMWA 5MLCV 3DRRB 1SL2A 1N32F 5J2NA 3GFHA 1NXIA 2E5JA 2VJVA 5IS2A 4DUZF 1YZ7A 2EI5A 3Q86A 2L41A 1Q78A 5L1IA 4F4WA 2YWWA 3R2DJ 1YRTA 2VG7A 2OIHA 4GC6A 4DN0A 2OJ3A 3ILJA 3QT5A 2OEMA 4OFZA 4DX5A 4MKYA 4TY8B 4P7VA 2A6OA 2KHCA 5KFKA 1IWAA 4K4WA 2B4UA 1FCAA 4C4WA 1OS5A 4DPYA 5CYJA 1L3UA 2XNQA 3JTOA 4IFVA 3L7UA 1NDCA 2J76E 2RS2A 2NZ4A 5K14A 3M2RA 5B0DA 3K59A 3H25A 4CLSA 1U1MA 1TKTB 5IV4A 1S0VA 3LA0A 4LMZA 2H4YB 3VAJA 3CWJA 3HZEA 1N33F 1HMVA 2HHVA 2FVRA 1FRMA 3T19A 4RW8A 4O44A 2OFGX 2WONA 4OYMA 3JSRA 1YRUA 2H48B 4NL5A 3CD7A 4BWJA 3MEEB 1R6VA 2J6SA 2FHOB 3L09A 2ADBA 4KO0A 3HHNB 4DPXA 1M1HA 1UVKA 3D66A 2LP4A 4ZKAA 3CCJS 2CJYB 2RU3A 4I6AA 4B3RF 2CQ4A 3TZZA 3AJ1A 5HVFA 3OL6A 1DURA 3EGWB 3MMCA 1VQ5S 4R8UA 3HSGA 3NBPB 3BYPA 3OJSA 1FFWB 4JB8B 2XS2A 1QAIA 1JB0C 1ZAVA 1AFIA 4ZPTR 4M5LA 1KOOA 2DK2A 2RSQA 2K7JA 3FDSA 3FCVA 3JTNA 4ZVUB 3TX0A 1DFDA 3C15B 4ID5B 5AJ3J 3MPYA 1JLEA 1TAQA 1SQFA 2Z8QA 2JVRA 2FHKA 1FX2A 4ZHRA 2CPHA 2HS0A 1YJNS 2RUGA 1WG5A 5KFWA 3IC1A 2BKPA 3GSDA 5IT9Y 2Q43A 4F4KA 2AJ1A 2DCLA 3MAAA 3QBCA 3IFEA 2KM8C 2EFQA 3POTB 3G86A 3G8TA 3Q8UA 4HT7A 3UNYA 1L3SA 4JOUA 1F9HA 3VAFA 3N6NA 3GG1A 2CJAA 3EPIA 2AYEA 5KG3A 2FYXA 3RAQA 3EJMA 4UW2A 5D15A 5MAOA 3KDNA 3PR5B 4CT8A 3J7YI 4F3MA 1O0PA 1SUQB 3M05A 1OPIA 3DXSX 4IQXA 4LF8F 1R8AA 4ZP7A 1GX6A 3KMSA 3M4XA 1HWLA 1D1UA 1BQMA 1FNOA 1TK5A 4Y34A 4LR9A 1VLYA 1RI7A 4UQGA 1E6YB 3RBXA 2RKIA 2IYIA 3GV7B 2IAJA 2J7UA 2QYGA 4L75A 4Y2MA 4DR5J 3BSNA 1S99A 3G8SA 2J7WA 1U0HA 3R7SB 2D9OA 2YBVA 3VF0B 4DR2J 2BANA 4M5HA 4G1PA 3QSYB 3QWUA 1VC0A 4JYAF 3K58A 4OZJA 2QC3A 4ER8A 4NX9A 3KLIB 1HYSB 3CJTA 2NYIA 3BEGB 2NYHA 3OVBA 4LF4F 4GKKF 4X65J 2JZ5A 4A8YA 4F0KA 4P75A 4WFNQ 1D09B 5CD4A 3PJWA 4WYLA 2D1CA 4Y6IA 2KU7A 4MMOA 2WB1D 4H54A 3THPA 1P6TA 1TKDA 1WG1A 4NLSA 4PEOA 2DISA 4TQSA 1N52B 1FRXA 1OSCA 2FTRA 2KTQA 3HSZA 3NWGA 1T7PA 5HVHA 3BJYA 2IA0A 5H9FJ 2RRBA 1PYSB 4M1KA 3SXLA 6FD1A 4N56A 3HVWA 4RU9A 2DITA 2KJVA 1JXLA 1J2VA 2WSCC 3GLJA 1MU2A 4HACA 3C6TA 2DTJA 4UUXA 4OZ3A 4KFBB 3MTKA 2UXCJ 4EI2A 1C0TB 3TANA 1TL7B 3FCWA 4YHHF 2EBGA 1N88A 1TKZA 5F8HA 3GFYA 2OMLA 1XWLA 2GMHA 4M5MA 3U02A 4ED0A 1DARA 3Q8QB 1TV6A 2MQLA 1N6QB 1SV5A 1UFWA 3ZZYA 4HH0A 3CJ8A 4RU2A 2D3UA 1VQ4S 4U95A 3OUYB 4KGZB 2MQ8A 3MCMA 5L46A 2EK1A 2XWXA 4KIAA 2IRUA 2LDIA 5D0HA 3QGPA 1YRXA 2LQJA 2R8JA 3NOCA 5KG4A 4YR0A 3DYAA 3EVMA 1UP1A 5T41A 3Q8SB 1HL6A 3KDOA 1VQYA 3DRPA 2HS3A 4EO6A 2H65B 2KXHA 1X9SA 1PC4A 3HDSA 2R2TA 2DNOA 2E1MC 2O5DA 3FMWA 3ZTSA 2H3EB 2POKA 1HI8A 4BDPA 5KG5A 3AH6A 2AW0A 4ICLA 3ISND 3IR6B 3GV5B 2LU1A 4YR3A 3D7SB 2ZNZA 2XMTA 1RAOA 4F4XA 1K47A 2PN6A 4DFPA 2DXDA 2KVQE 1BUXA 2C3PA 2UVVA 1L3TA 3GJTB 1RE1B 3G96A 2GIQA 4CLFA 2AIRB 3CC2S 1HKAA 1U1KA 5FIIA 1APSA 3ISZA 5DGAA 4DV6F 2ZH1A 3ZTPA 3FRYA 3HM9A 3FSXA 3RR8A 4XTTA 3MDFA 1RWVB 5KFUA 4B3SF 4R5PA 3ZNJ1 1ZA2B 4CLZA 1JLGB 2MQQA 3TZYA 2VBYA 1U6ZA 3BGRA 2FHMA 4QIVA 3R1HA 4ED2A 5HMXA 3AT1B 1UKUA 3I0SB 2DYAA 1NUEA 3SDEB 3GPAA 4X2BA 3LW5C 3DRRA 3GP9A 2UVUA 2FJAB 3NLCA 2DBBA 1WC6A 2DR5A 4A8FA 2DD8S 4CO4A 1HWKA 4Y00A 4F4AA 3HVTB 4DR1J 4HHHA 4J9KA 3MR3A 4KHPF 4J9QA 3SBMA 4OYIA 4PWDB 1SC6A 5KT7A 2MZ1A 1NHUA 1S1XB 5GAHI 1QJHA 2I6WA 1YIJS 1Q0NA 5ETNA 2WVBA 3BB5A 2Y0BB 4B3OB 1Y5NB 4C8OA 4TY8A 1FRLA 1RT4B 4WXOA 2RQCA 4YY3J 1F2HA 5DZ6A 5HQ8A 1RAEB 3Q0AA 4RNFA 4FF1A 1X60A 4OZ1A 3M8QB 2LQ9A 3UVJA 2F3JA 3A3OB 4QU7A 4ES1A 1IBCB 2WSEC 3UCUP 4USTA 3I31A 1TKTA 4GRSA 1Q8KA 4XPCA 4IG3B 5HVGA 5KG0A 3MMBB 4JV5F 2V67A 5B0FA 4RW9B 1Q7YT 2Z58B 3NS6A 2LA4A 4HHJA 4ATNA 4MT1A 3O6QA 2CRLA 1UEKA 3G8QA 3OR2A 2W7OA 1WOOA 4DFKA 2XB2D 3RW7A 2HHHF 1RCXB 1ZA1B 6AT1B 4DV4J 2FIUA 4XO0A 4P74A 4NYOA 1J5EF 3PX4A 2OEKA 2W2QP 1NZ8A 2OTLS 3NBPA 5J2PB 2X3GA 2GJIA 2C28A 1DJ0A 1PIEA 1KQGB 1S77D 4CYUB 5IWAF 4CP5A 5C2GA 3K8VA 1NSAA 3FVYA 2C1EB 2MLYA 1SPBP 2NXUA 4DX6A 1RWKB 2UXBF 4TU8A 2B7CB 5EWFA 4OX6A 3BBFA 3C15A 3MTJA 4ID5A 3DM2B 3ZZOA 2GQCA 4UT4A 2MKCA 4C8KA 5C24B 1ZM4A 1X4HA 3MR6A 2LQ5A 3MCOA 4LIWA 2OO4A 2HNDB 4PXEA 4OQJA 1YJTA 3BQ0A 4OYOA 3POTA 2R9LA 2XEXA 1OYEA 4C0BA 3HCXA 4F3QA 2RDJA 2E9RX 2AWZA 2GW8A 2OPQB 3PJXA 3OVAA 1HHSA 2NS1B 2VFVA 4ZVQB 4IH5A 3N5FA 3LALA 2IHR1 4Y2IA 1XQIA 2XO7A 3KUHA 4FYVB 1HNXJ 2IC3B 3GJSB 1SUQA 1VQ6S 1PAUB 2AMCB 1IN0A 2WB4A 2E7XA 3GJQB 2YNFB 2GIFA 4OJ1A 4WK3A 2LEBA 3NGTA 2J9CA 1UJ6A 2HKEA 4RX6A 5IT0A 3BDPA 1E6YA 1IQTA 1KP6A 2K3KA 3W1YC 2DKOB 5ADZA 4UUWA 4OZ0A 1VISA 2MEWA 5IFMA 2YXLA 4JI5F 4TU9A 2FDNA 3DOLB 2KVIA 1VHFA 4P2MA 3Q23A 2ZM6J 3ZO7A 2A2DA 2WBMA 1UVIA 1VS3A 4M5GA 4ED4A 2CYYA 3T5LA 4GKJJ 4NE9C 3MM8B 3TARA 1HYSA 1Z1ZA 4Y0FA 3TW0A 2HRTA 3BH6B 1T8EA 1QY7A 3NGRA 1IKVB 3M30B 4OHXA 3A3PB 3FEYB 4ZVOB 1WC4A 2RRNA 2ZZNA 1H2VZ 2D3OR 2I1RA 5ETOA 1YVFA 1RHMB 3RZAA 1AT1B 2P2CB 2GGPB 2BBEA 5KFYA 4J9PA 3I87A 3BSAA 2CJBA 3KYLA 4YEAA 2BABA 4B9MA 4KT0C 1GAOA 2XMKA 1N4LA 1HNIB 2ZH9A 1UFLA 1SL1A 3DRSB 3BBBA 1PBAA 2MXYA 3MURP 3Q8PB 1YJWS 3OR1B 3BPSP 2B4PA 1CJTB 3KNGA 3KUEA 4ZVEA 2EBEA 2CWKA 2NCKL 4LBIA 1FX4A 5J1NA 4PYDA 1NHKL 1FI4A 4KFBA 2LQ8A 4IR1A 1C0TA 4HI1A 1HHTP 1TL7A 1RWPB 3PW4A 2R7WA 2ASDA 2XGQA 4WTYA 1A6LA 5LSLA 1HBNB 3F73A 1KTVA 2QL7B 3CJ3A 2IDLA 1N6QA 3NKYA 3CDAA 4RNOA 1WC0A 2GFFA 2AV5A 5AXLA 4OYWA 2QSFA 1NU4A 5D4LA 3MI7X 3HO1A 2AEMA 2DH8A 5GAHU 1S0OA 4WCEQ 3RRHA 5L9XA 1WELA 5HI7A 5A76A 2EG1A 1SQEA 3TVYA 1X4EA 2GA7A 1M5PC 3GONA 1NH8A 1YJ7A 1ACMB 1TL5A 3SCKE 4H4KC 2AGPA 5I3UB 1K1QA 2B6AA 2MGZB 3CD6S 4DV1F 2DPIA 2G0IA 4LRBA 4F3OA 3VAIA 4QIEA 1R89A 1BD6A 3G82B 2X7IA 2WOMB 1UEUA 2CKWA 4WU3A 1LWCB 4A8WA 4ILLA 3BSCA 2KYZA 1JLBB 1NRKA 1WC1A 5B0GA 3E8OA 4I6WA 4AL6A 3RB0A 3C2PA 1WTFA 1Q53A 1R8CA 5C5JA 1VRQC 2CPXA 1TMMA 3P49B 5KFEA 2QLFB 3DHXA 1N0VC 2PI5A 2H9ZA 1LQ9A 2DIUA 3BDEA 4I68A 2ABYA 4C7QA 2QGFB 1N34J 4HKQA 4HH1A 3I0SA 2UU9F 2CG8A 3SDEA 1DY3A 1YGYA 1RADB 4KSEB 3N4WA 2Q3PA 3A8JA 3OXFA 2BKOA 1QLNA 3R9LA 3MF5A 5F8LA 3HVTA 3H7HB 2VD3A 2ZBCA 1ROFA 1RWXB 1XBWA 1V5VA 2DGQA 4PWDA 1M1GA 3JYTB 1CC7A 3OTOF 2XLIA 5F8JA 3QIPB 2K1RB 3JSYA 1S6PA 4ZVGA 2DGWA 1BLUA 4B3OA 2VOOA 4XDDA 4ANCA 1RT4A 3VGSA 1RUSA 5CYMB 2F4VF 3KK1B 1FVQA 1R7IA 4WXWA 1UL3A 2B8PA 4MIWA 1H38A 1MG7A 4OYXA 5HMWA 1XMBA 4FBUA 1XC9A 3M8QA 5GMDA 1NM2A 4J9RA 1ULRA 2GNKA 1CSJA 1AROP 1SJ3P 1SQGA 2R4FA 1RQ0A 2DR6A 3IBFB 1GXTA 3TZXA 3ENWA 1UW4A 4OHVA 1RTIB 3MMBA 3H98A 3M2VB 3FUYA 3N0VA 4RW9A 2M7SA 2G2YA 4NYZA 5D4NA 1KN6A 5LJ3Y 2EKNA 3PHTA 2RILA 2RRAA 1B7FA 2FVSA 4RL1A 2BX6A 3CCLS 1KRPA 4HVZA 4OL8A 3NAIA 4JI3F 1HI0P 4KC5A 4MAKA 3CD5A 2ZBIA 3I96A 2RT3A 3DU5A 1ZBTA 5J2PA 4M8LA 4PWWA 4P2SA 1IR2A 1T9VA 2HQCA 2DGOA 1NK8A 4G65A 2DB1A 2V4RA 4MKVA 5GAGI 5KFPA 1WF1A 2O1PA 4CH7A 5L8RC 3CO9A 1G4CA 4Q44A 4LSNB 1S6UA 7AT1B 1GH8A 2GO8A 3HFVA 5C24A 2ATLA 5BXIA 1MWQA 2G1HA 2P6TA 4ZCKA 2R7VA 2OH2A 1B4SA 3W8PA 3S8SA 2HNDA 1VK3A 2ZITA 4DOZA 4OI6A 3OHAA 4EO8A 5KOWA 1W7WA 1FERA 2RDIA 1CJVB 2WHOA 3SSSA 2MLXA 1C1CB 5D77A 2QRRA 2BJ1A 4K59A 2IC3A 2DNGA 4GMKA 4KGVB 3V6JA 3PW0A 4UY85 5J1PA 4YUDA 3KK2B 2LEAA 5JJBA 3B54A 4JI6F 2YNFA 1AA1B 1T0TV 1H3DA 1QSLA 4QU6A 1NKEA 2GHPA 1VQOS 5EUHA 1SKRA 2DNPA 4IFYB 5BR8J 4DFJA 3W60A 2W9CB 4FF3A 1QTNB 4LSLB 4EZ9A 1G7CB 2A0FB 1RAJA 2ZZMA 2XCPA 4LF6J 3UN5A 3TWZA 2PMHA 3MM8A 4FDFA 4OJ3A 3J81U 2IYGA 1T9YA 1W25A 1NZAA 2RAQA 1IKVA 5IC4B 1AFJA 2ZH4A 4UOFA 1ZPVA 1AYEA 4TN2A 4ZCIA 2YX7A 3PYEA 3R5DA 4DU8A 3C14B 5KFQA 4JI7J 3JQJA 3QZ7A 2JJ4D 4Q5VA 2VF3A 1I94J 5H9FK 2ZBQA 2W24A 2GGPA 3K57A 3T1HF 5KG6A 3MEGB 4ZPBA 2A2CA 2X3DA 5LMNF 2QLWA 3MZIA 2DHHA 4JI0J 2VBZA 1X4DA 1F2GA 5F41A 3GIKA 2G2ZA 2FB0A 2VKRA 2J9DA 3D2WA 1Y0HA 5DG9A 2MZQA 5KT3A 1IR1A 1W26A 3JAMY 2BDPA 1HNIA 3DRSA 4ZLJA 2HK2A 4DPOA 2JNJA 3HJVA 4Y28C 4A8KA 1H73A 3OR1A 1S97A 1KOHA 1CJTA 1KS2A 4RW7B 1RGVA 1RZMA 3Q8RB 3LP0A 1NEEA 1EQ0A 3FQLA 2ZNYA 4OV1A 2IVYA 2KT3A 2ZE2B 2IBKA 1WUUA 4NZ0A 4AQYF 2OEJA 3B8HA 3CE8A 1S59A 1HBNA 3HZGA 3SQGB 4ALZA 4WF9Q 4FYDA 2V8PA 1U0SA 1CJUB 2HHWA 3CW2C 3I4PA 2XHCA 2BA9A 2BACA 4K5RA 4FXVA 2EG2A 1M5KC 1GXUA 1N0UA 2I0XA 1D9FA 3DLKB 3H5XA 3JSMB 2KFNA 2ROPA 4LF7F 4P9SA 1TUGB 3R5JB 2KL8A 3P4UB 4CM2A 4DMZA 4DZDA 3RAXA 1NSKL 4DSLA 3CIMA 3TQEA 5EN1A 1REVB 3M6VA 2FHJD 4F2SA 4TQRA 4LR7A 3G6YA 4TY9A 2C3YA 1ZETA 1SJRA 2W4DA 4DV5J 4DI6A 4DUYJ 4UZBA 3M2UB 3T1YJ 2MGZA 1N8RT 3J81j 4W98A 4DS4A 3TUJC 3PRVA 2M5YA 2VQEJ 3ITHA 1KVKA 1MWYA 4O3NA 1RA6A 2WOMA 1KR4A 1LWCA 2HHUA 1YK9A 1HQEB 2E44A 1K9MT 1JLBA 4PWUA 3FBBA 1Z4UA 1M90T 3KHLA 3V4IB 2BQ3A 3G6XA 1YBAA 2VFTA 3ZZTA 1DHMA 3GIMA 3UD4P 2IM2A 3M9NB 3RRGA 5DM7Q 2BMBA 1HNWF 1UCNA 3QO9B 2OGUA 3FGVA 4NCGB 1X0FA 2N82B 1GMWA 1TELA 1IUJA 3UDVA 4MJKA 3GG0A 2EFVA 5H1SV 5KFMA 4KHMA 5KFJA 2HAFA 3RBZA 4A47A 3KLVA 4X4VA 2VPWB 2OMOA 3GILA 1NDPA 2JFKA 4I4BA 3BQ1A 2Y1JA 4P6QA 1T3OA 1UETA 4K4VA 2QT7A 1HQUA 1UAWA 2QLJB 2FPHX 3QJJA 1S7HA 1X5SA 1XR6A 4C97A 1FTRA 3W61A 3U27A 3QIPA 2WRMA 2K1RA 4I7FA 3SFUA 2B9EA 4PQAA 3ZZPA 4M5IA 3PFEA 4DBQA 1U48A 3K89A 3HSDA 2E5LJ 3E2EA 4WK1A 4J5OA 2P6SA 3M8ZA 3KK1A 5HMYA 2ZHBA 2Q79A 4RNNA 1NH7A 5AT1B 1Y4ZB 4QOTA 4K5SA 5DLGA 5IZHA 2FC8A 1XMQF 5A8WA 4X62J 2CPFA 1GXLA 4ZP8A 3HHLD 3VQSA 4JV2A 3DGVA 2AX1A 3GV8B 3OHBA 4CTAB 2MB0B 1BC6A 2E7WA 4MK8A 3TAMB 1SL0A 4CO0A 2YY3A 2R3VA 2CJ9A 3EGNA 1RTIA 3M2VA 2H51B 2YKAA 3I9V9 5E3RA 5DDOC 2RHSB 2BM1A 3GYXB 4P2FA 2I8EA 1F5BA 1NJYA 1GFWB 1KFDA 1S48A 2ZH2A 2C3UA 1A7GE 2Q6CA 2LXIA 1LXNA 3HSJA 1UWBB 2D41A 1S79A 4ECQA 5KFVA 2A6MA 4ZN3A 2YWGA 1RT3B 2WAQD 1R27B 1FJGF 4X4NA 2MJNA 3DCAA 2PEBA 1PYTA 1U1OA 2DY9A 3EWGA 3OFHA 3UDLA 3HT3A 4DR4J 1BMQB 2Q1LA 1LK5A 2CZ9A 3D0HE 5J2QB 1HQ2A 3N01A 3SSRA 3S01A 4U7UD 3L7OA 4L74A 1VQMS 3TO8A 5KT6A 4LSNA 2M4MA 1VDHA 3WX4A 5AJ3F 4X4UA 4JI4J 5D8HB 2FZKB 8AT1B 4IUFA 1EJ7L 1RTJB 4XAKA 4M95A 1VQLS 1JJCB 3PHEA 1TUVA 2WZ1A 4I2PA 3CC4S 2KM8B 4ECUA 3JSBA 4F02A 1F1BB 2HG4A 4TVAB 1Y3JA 4CDIA 4CI0B 3CCZA 1UEVA 1ICEB 3ENQA 1DTQB 3VGUA 1RWUA 1CS4B 1TKXB 4M5NA 2V2ZA 1C1CA 1E6VB 4RPFA 3I56S 3IRWP 4KKOB 3PG9A 5DM6Q 2XY6A 2BQRA 4NCAA 4FS2A 4FYYB 2WTFA 1MROB 1V3ZA 3KK2A 3LH2S 2KI2A 4FNIA 3V6HA 1FD8A 2XMJA 3A4TA 4OLOA 1GMUA 3SYZA 3R6GB 3IG1B 1HNZF 2DR9A 3P6YC 3T3FA 3ZZRA 4F67A 5KFLA 2V8GA 1NK5A 2W9CA 4UOCA 4F0MA 3OFGA 3UDCA 2OKQA 2AGQA 4LSLA 3CMQA 2FJDB 4DQPA 3SV4A 5HP1B 2YNIB 3PV8A 2KZMA 1X0PA 3E01A 4P7TA 4FNHA 1GTHA 8ATCB 1M1KT 1SH2A 4L72B 2HRUA 5IQ6A 5J1EB 1WKJA 2C2EA 3C46A 1VYAA 3MEDB 2AJ4A 3C14A 3O3LA 3M6UA 1C4AA 3RYLA 4UQTA 2ZHOA 4OX8A 2CG4A 2GS8A 3QT8A 5SUHA 1JLCB 4Z7CA 1P1LA 4LBPA 1TL1B 2DGSA 3OD2A 2M8DB 4LRAA 3HHLC 1DQ9A 3KLGA 1XERA 3SIPB 1QVFR 3HKZD 3M1VB 2HNYA 1U8SA 4B3RJ 1H2TZ 4F4ZA 1K1SA 1MN7A 3D1QA 1SCJB 1F3VA 4EEYA 5DO2A 5F9NA 4UOHA 4NLWA 3MR7A 2KYXA 3RU0A 4P72A 1J27A 4P10A 2G1DA 4DF4A 3FBEA 2ZE2A 2GAGC 2LEPA 3GSIA 1IKXB 4UTGA 4QBUA 1UPMB 3H2UB 4BLGA 3EYZA 1T9XA 1D8ZA 3SQGA 3SI8A 3CCUS 4IYQA 2X1BA 3CCSS 5D0RA 1LNQA 4KGXB 4F36A 3HPOA 4IH6A 1S9GB 4WFBQ 3PCOB 2XZDB 3I6PA 1C4CA 3S1TA 2ASJA 3NNAA 5FJ4A 1WF2A 3DLKA 1HBMB 3QGGA 2XMAA 4J9LA 1T03B 4J9SA 1FO1A 1QAJA 1GQEA 2RNEA 1REVA 2CQ1A 2ZOGA 3R6LB 2EFOA 5DDPC 3BGUA 5LSOA 4LF8J 1KSPA 3LPYA 3HHDA 2GX8A 4EFAC 4PRFA 5A8KB 2P9EA 1U6BA 1RT2B 4FKXA 1RAAB 3VGTA 2WCXA 3GE9A 3RW6A 2HHPA 3ILOA 1FA0A 2XNRA 4FPRA 1MN9A 3V6DB 1NSQA 1NPPA 1R8BA 3BF4A 1S9FA 2ZBRA 2V94A 4B02A 4YB1P 2QMUB 2CQ0A 3IBCB 3Q83A 3M8RA 2FLOA 2X1FA 3BZQA 2W1BA 1PCAA 1RT6A 1R8PA 2IVFB 4E98A 3V4IA 1S4FA 5FDLA 1UZHA 2VPYB 3D6MB 4J90A 2A10A 3K17A 4MFBA 2E5GA 2CNLB 3B4DA 2NXJA 1JLQB 3PTWA 5L1KA 1K8AT 2IPOB 4LF4J 4HHUA 1CPZA 3VQTA 3LF0A 3HX9A 2HGLA 3AODA 4WE1B 2HFOA 1TZ0A 2BRLA 1WEYA 4NLVA 3P5BP 1PGZA 2ZHAA 4ELUA 2GJ2A 1MMLA 5LMUF 4EWTA 1IKYA 2M3DA 2YNHB 4LREA 1QE1B 2HVHA 2LKZA 3BQ2A 1GEHA 4WTOB 1EAYC 3DDKA 3MXHP 4MYUA 1X9WA 3DRXA 3A8KA 2XZWA 2E1PA 2KG0A 4ZJQA 1KWMA 2K06A 4O3SA 4C2MA 1RYRA 3TAPA 5HBMB 3CJ4A 1S10A 1FVSA 1S1TB 4IOCQ 4OJGA 3KLHB 1ZS6A 3OXLA 3TUPA 2BM0A 3IN5A 2GVZB 1WD6A 5JMNA 2HVZA 1JLAA 1U1LA 4YN3B 1R0AB 2XSFA 1ITPA 1N5QA 2MZSA 1VRUA 1XEZA 2YKMB 4DV0F 3HFKA 4CTAA 4MIBA 5C25A 5DQHA 4ECVA 3TAMA 3NL0A 1GTEA 2VQFJ 5CQGA 3H2VE 2QSWA 1U6FA 1H7WA 2CUYA 1FRKA 4IQMA 3BN7A 4F26A 1BY9A 1RSCA 1HR0J 4UZCA 3DGPA 4HT5A 3TEHB 5J2MB 3LGHA 3TOQA 5AE3A 2OELA 3D1OA 1HNVB 3DLEB 3DRYA 3D68A 4N41A 1RACB 1RT3A 3NGUA 2YWHA 2CVIA 4QR1A 3KHRA 2HFUA 3LGMA 5ETTA 4ERDA 4ECYA 2C2NA 4C8MA 2HVIA 3UCGA 1N56A 5J2QA 3PEHA 2IRXA 2IJNA 2V8HA 4ZIVA 3OL7A 2F4FA 2R7TA 3MUVP 2HYIB 1H6KX 3CDBA 3MECA 2FJVA 4LF1A 2AEFA 1C2PA 3RTVA 2RH3A 4DL6A 1RISA 1X4CA 1I3OB 2XM3A 1CG2A 2FGCA 1JJHA 2JVOA 1NJIT 1F3FA 2ZH5A 4B3SJ 3BM7A 3PR4A 4A8MP 1V3RA 4CO3A 1DQ8A 3UI3A 4RNMA 1NHVA 5K8MA 4IR9A 2H1YA 4ZPDA 2FJEB 1TL3B 1DTQA 4Q0BB 1CS4A 1TKXA 3E3XA 4L6V3 1WTBA 1F6TA 2VODA 2DVIA 3JQKA 5HSPA 1HNXF 1SI9A 3KTQA 4PZVA 1NJZA 1GNKA 5IM0B 1MROA 4W90B 4QWCA 4KHPJ 4ZPAA 4DQQA 1P9QC 2L9WA 2UV8G 1S12A 1U4BA 4HEA9 3QJLA 2QMXA 3QAUA 1ZM9A 2J0QD 2CJKA 4N8OA 3IG1A 4ZVPB 3EZOA 2ZUGA 2E1RA 2DHXA 3WZ0A 2DNLA 4KQZA 3MMAB 2J7KA 2DRBA 4RLEA 2VV5A 2JHEA 4FF2A 2JEFA 3ENVA 3Q2TC 2YKPA 2UUAF 3CCRS 3X1LB 3VALA 3T9NA 1JJ4A 2J9DE 3MD1A 3PJ9A 2XSJA 1S9EB 2YNIA 2Q6BA 2MSTA 4I56A 1KVJA 1P8GA 1SB6A 3RB3A 4C8YA 4J9NA 2YPZA 4ILRA 5LSRA 1KNZA 3PX0A 2DH9A 3ENAA 2VG6A 1RT7B 3MEDA 4X4OA 3BBCA 4JV5J 1FWLA 2QV6A 3VVUA 2D69A 1SH3A
chains in the Genus database with same CATH topology
2GQQA 2G4BA 2LECA 3HHKA 2QE5A 3FSIA 2K7KA 2OPRB 3FRZA 2AGPA 1VQSA 5I3UB 1YI2S 1TL1A 1K1QA 1ZAXA 2B6AA 2MGZB 2B56A 2ILZA 3CD6S 4DV1F 3W2VB 2DPIA 1UVLA 4DLEA 2YNGB 1S9EA 2XCAA 4LF6F 4F3OA 1A9NB 4ETZA 1HWJA 4IFVB 3SFGA 4BCAA 3VAIA 4DWIA 2W9BB 1HBUB 4QIEA 1R89A 2ACYA 2I38A 3NRBA 1URNA 5K14B 3M2RB 1BD6A 5D4PA 3NCQA 3M1VA 5KFHA 2WOMB 3UQSA 1WG4A 1UEUA 2CKWA 4QR0A 1LWCB 4WU3A 4TU7A 4A8WA 3PZPA 2BOPA 3M8PA 4ILLA 3BSCA 2KYZA 3C6UB 2BYCA 1K0VA 1JLBB 1NRKA 3NNHA 2IMOA 5B0GA 1YG0A 2ROGA 3E8OA 1RT7A 1X5OA 3P96A 4PPDA 1VIXA 5A6PA 2MHEA 1HMVB 4I6WA 4KGMA 2PDAA 1WNEA 1Y7PA 1IBLF 2KG1A 4AL6A 3RB0A 3RB4A 3NNCA 5F3TA 3C2PA 3PKYA 4JI7F 4RW8B 4O44B 4DSKA 4Y2CA 2WONB 3CD0A 1WTFA 4IOBA 1I94F 4NLTA 2UUTA 1Q53A 1DTTB 4PPZA 1R8CA 1SKWA 5C5JA 5JUMA 2CPXA 2JOQA 2L9NA 4C98A 5I3UA 1QVGR 3P49B 5KFEA 3OSPA 3DN9A 2VZ9A 3DHXA 1N0VC 2PI5A 1SIWB 2HZCA 2H9ZA 3OXGA 1LQ9A 1RT5A 3FZBA 2M8HA 2RIJA 2CVEA 2AQ4A 2DIUA 3BDEA 3HVRA 2DR7A 4KO0B 5KFGA 2V0NA 4I68A 1U24A 2ABYA 3EGZA 2RJZA 1S6PB 2HAIA 2YKNB 4WFZA 4JI0F 4KE5A 5KFFA 4C7QA 4IDKB 1IKXA 1ZOTA 4ZPVR 3NP5A 2IRYA 2VPXB 4HKQA 4WIIA 4DSIA 4HH1A 3I0SA 1U26A 2UU9F 2M9KA 1Y5LB 3SDEA 4YFUA 3TNVA 5EWEA 1KVIA 2XLJA 1YGYA 4KSEB 3N4WA 3PDNA 4OJHA 2Q3PA 1T02A 4URQU 4DQSA 4WU2A 2MKJA 3OXFA 2OTJS 3A8EA 3H20A 4OZ5A 3RBEA 5E2QA 1QLNA 3MWBA 3OTBA 4R8UB 1FE0A 2MKHA 5B0BA 3DOMA 3CDUA 3O44A 4O3QA 3FSYA 4F8RA 1S9GA 4DV2F 2O66A 2KXFA 2KB2A 3MF5A 4O0IA 2RQMA 2XY7A 2UVRA 5DDQC 3UW1A 1YSJA 3T1AA 5F8LA 2EW9A 4O4RA 4C3LA 3MD3A 5HMZA 3HVTA 1PILA 1IXKA 2VD3A 2ZBCA 6FDRA 3PX6A 4X4SA 1HBMA 1ROFA 2QFJA 1DTTA 3LOUA 1L3KA 2R7QA 5F8MA 4DJBA 3CCMS 1XBWA 5I3PA 2YWKA 2DGQA 4PWDA 3JYTB 3SCJE 4Y65A 1CC7A 1JKHB 3D54A 1SIZA 3OTOF 4M63A 2XLIA 5F8JA 2DNYA 4K4YA 1VRTA 5ITHA 4NXNF 1UVMA 1X4BA 2B0GA 2FD2A 2AJFE 4LQ3A 3NCRA 3QLHB 4IO9Q 1LWFB 2YVSA 3QIPB 2K1RB 2ZOFA 5CA5A 4N5SA 1S1UB 2ZVSA 3JSYA 1S6PA 4ZVGA 2VG5A 1VOMA 1G3OA 4NLPA 1NK6A 2DGWA 3KOAA 1VGYA 4LQ9A 2W8LA 3HI9A 4IDKA 1FK9A 1BLUA 4ZMMA 2KRRA 1VBZA 3RR7A 2E9TA 4ITSA 3S7RA 3PW5A 4XDDA 1LOUA 2VOOA 4B3OA 4WZQA 2CQGA 4Y2AA 3CPWR 4OZLA 1RT4A 5KT4A 3TR5A 2AJ0A 1WHWA 2GHWA 2I5JB 5BYSA 5CYMB 4ZHRB 5A8KA 3LWLA 3KK1B 2F4VF 1FVQA 4ZP9A 3PKMA 1B0PA 1RT2A 2I2YA 1R7IA 2J6UA 3F41A 4WXWA 1UL3A 2DIVA 1SJQA 2MQPA 2R8IA 4MIWA 1H38A 3HHLA 3IRXA 5HMWA 4ZPCA 1XMBA 4FBUA 3LUYA 5GAGU 1XC9A 3M8QA 3KFWX 5U47A 4CCHA 2OD4A 1EETA 4IRDA 2GCFA 4J9RA 4FVMA 4I69A 2DNNA 2DNMA 2KZZA 1ULRA 2GNKA 1CSJA 1NAQA 2PEHA 1AROP 5B0CA 2VOPA 3MM7A 2OLWA 1SJ3P 2RE1A 3RBDA 2R4FA 1M5SA 2N7CA 4AL5A 3JYTA 2UV8A 5DGBA 1JKHA 3TA1A 2EVZA 2B4OA 1RQ0A 3BO2A 1VIOA 5E3QA 1GXTA 2ZJPQ 5AXKA 1WHYA 2QA4S 2ZC4A 3QLHA 2DR8A 1FDAA 2B7BB 1M5HA 3ENWA 2XLKA 1UW4A 4OHVA 1CVJA 2MY7A 2IM1A 3LO3A 1VQKS 1RTIB 1S6OA 3MMBA 2VKZG 3H98A 3M2VB 1NNDA 1KHWA 4NMLA 5LXRA 2APOA 3N0VA 4H4KA 4RW9A 2M7SA 1CLFA 1L5UA 3CC7S 4NYZA 1QSSA 3IA0A 3KWMA 4DV5F 5D4NA 2NPFA 1KN6A 5LJ3Y 5CYMA 1H2UX 3M6XA 3T1YF 4PCQA 2RILA 3GWCA 3QJPA 5T7LB 4QR2A 1BQMB 1JLQA 2RRAA 2HMIA 5LT5A 4QPTA 1B7FA 3O2IA 4DFMA 2FVSA 1NK0A 2JWNA 5BYQA 3HXMA 3QGHA 3CCLS 4PR6A 4XK8C 1S1VB 2JLEA 3D5MA 1KRPA 1VC6A 3HK2A 1TP7A 4HVZA 2XULA 1QAYA 5KG1A 5HN0A 4ETXA 3PXGa 2B5JB 2E66A 4OL8A 2Y1IA 3NAIA 4WE1A 4JI3F 1N34F 1HI0P 2RF2B 2IAJB 4J9MA 4F2RA 1DAXA 4KC5A 2ZH7A 3W2WB 2C3MA 4NWBA 3FEZA 3RRKA 4MAKA 2CPZA 3CD5A 4KGKA 4QIGA 1NB7A 3DMJB 2ZBIA 5KTQA 5HLFB 2VC0A 3I96A 2RT3A 3DU5A 2YNHA 5E3PA 2KT2A 4RBTA 4BC7A 4EZ6A 1ZBTA 2N7YA 4A8QA 2BANB 3TP2A 3KHHA 5J2PA 4DHVA 4M8LA 1T94A 4O3RA 1XMOF 4P2SA 3OTEA 4Z37A 3KLEA 3EXCX 2DGOA 4HI2A 1NK8A 4YB7A 2ZH8A 3ISNC 2DB1A 3I5BA 3UR3C 4R0JA 1U25A 5DG7A 2ZJRQ 2NPIA 1Q79A 4JV0A 1K0TA 2R7OA 2FJBB 2V4RA 1PSDA 1ZAWA 5GAGI 4ELVA 2J0XA 5I3QA 5KFPA 3W3SA 4N47A 1WF1A 5KFSA 1FKOB 4FS1A 2O1PA 4CH7A 3SV3A 4AE5A 5T7LA 4WFYA 1D9DA 5L8RC 3VCDA 3IO1A 4I2QA 2BE2B 1C1BB 1VQ8S 3CO9A 3THTA 2LA6A 3LP1A 1U1QA 1FJ7A 4OHYA 4N8NA 2P9CA 4Q44A 4LSNB 1S6UA 2VUGA 4BS2A 5KFNA 1GH8A 2O67A 3Q22A 1TFWA 1GX5A 3CF5Q 2HFZA 2ZDOA 2GO8A 4WFXA 3T9ZA 5C24A 1VBYA 4MTPA 3D1HA 2ATLA 5CZVA 1FE4A 2FLPA 2F8HA 1SBRA 1S1TA 2J0WA 3KLHA 2P6TA 2GO9A 3H8YA 4ZCKA 2R7VA 4OHZA 2CQ3A 2WW8A 3DXBA 5THWA 3S8SA 4RBVA 5L1JA 2NREA 2OH2A 4WJBA 4BBYA 3TX8A 5A6WA 5FLXY 1SJ4P 2HNDA 1PO6A 2QO3A 4O4GB 2GC8A 4DN9A 1VK3A 3FZ2A 1RDRA 4Y3CA 1FTCA 2ZITA 2N3LA 3UR0A 1ZH5A 4DOZA 4PQUA 4FP9A 1VQNS 5GAEI 3C3LA 4NZ6A 1IJFB 4OI6A 2U1AA 3AA8A 5L39A 4U9RA 1OSDA 3OHAA 3MUMP 2UUBF 4JI8F 4RWWA 3OFEA 4RUHA 1SJFA 4Q7AA 4TXSA 4EO8A 3LANA 2YKMA 3K8WA 3EPGA 3KG0A 4NRTA 5KOWA 2VONA 1FKAF 2HWIA 2UZAA 4ZLPA 4OIXA 4IOAQ 2G13A 2L08A 1FERA 2RDIA 3UCZP 4ILMA 2WHOA 2EKYA 3I5AA 3SSSA 2CQBA 2BV3A 5B0AA 1X7VA 1C1CB 2IVMA 1JXEA 5D77A 3MPWA 2QRRA 4EYHB