1O51A

Crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
89
Chain Sequence
HHMKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative PII-like signaling protein (TM0021) from Thermotoga maritima at 2.5 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
molecule keywords Hypothetical protein TM0021
total genus 19
structure length 89
sequence length 102
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02641 DUF190 Uncharacterized ACR, COG1993
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o51A00
4RX6A 4WK1A 4YB5A 2J9DE 4YB7A 2EG1A 4CO5A 4C3MA 1UMJA 3TA0A 4RLEA 3TA1A 2XULA 3NCRA 2EG2A 1PILA 5DRKA 4CNZA 1Q1KA 3OPKA 1V9OA 3LF0A 5DS7A 4D3HA 1V3RA 3GSDA 4CO0A 3M05A 3NCPA 1V6HA 1NZAA 4Y6IA 4ZK7M 2O66A 3N5BA 5D4LA 4CO4A 2RD5C 2GNKA 3X3UA 4C3KA 5D4PA 4CO2A 3MHYA 4WK3A 1UL3A 2NS1B 2ZFHA 4D3GA 4RWWA 2XBPA 4OZJA 3T9ZA 1J2VA 1NAQA 5D4NA 3AH6A 1XK8A 2NUUG 2ZOMA 1QY7A 3TA2A 1NH7A 2GW8A 4IYQA 2O67A 3L7PA 2VD3A 4CNYA 2XG8A 3BZQA 4AFFA 5L9NA 1O5JA 2PIIA 4OZLA 3HLUA 4NYPA 2J9EA 2GX8A 2E66A 1O51A 1HWUA 3DFEA 4RWXA 1P1LA 4YB6A 1OSCA 1UKUA 1VFJA 4USIA 4OZNA 5D4OA 2J9DA 1V3SA 3AA8A 4CO1A 4E98A 1H3DA 2JJ4D 2J9CA 4C3LA 4R25A 1VHFA 3AA9A 3O8WA 3AHPA 3NCQA 2NUHA 2V5HG 2CZ4A 2DCLA 1UFLA 3CE8A 1NH8A 3O5TB 4USJC 2XZWA 1GNKA 4USHA 4CO3A 4NYOA 4Y65A 1KR4A 2Z0GA
chains in the Genus database with same CATH superfamily
1RHMB 2GCFA 5B0BA 3MR7A 1CJTB 1MN9A 2LEBA 1RBOB 2RSQA 1CULB 1QE1A 3B82A 1HIYA 3LH2S 4NLRA 4USMA 1UEVA 2HNZB 4AUKA 5KFCA 3Q8RB 1Y3KA 4O3SA 1TKZA 3DXSX 1PCAA 2E1RA 2X7IA 2OIHA 1P6TA 2R8JA 4LF4J 4LFBF 2BX6A 1T03B 2I38A 4LRCA 3IG1A 3HFKA 5LOQA 4HR2A 2VOOA 4OYWA 4UUXA 3HZEA 2OD4A 3OR1A 5EUHA 3H98A 4TQRA 4QPXA 2C3PA 3S7RA 5LM7E 3ZTSA 4NLOA 1BE4A 2B3TB 3SIPB 3W66A 5KOWA 4C8MA 4QU6A 2WB1D 5BYQA 4DCOB 1QSSA 4XPEA 4Q2MA 2DD8S 3M8PA 2K2PA 2VIHA 4DQIA 4XO0A 3JYTA 3GSDA 4HTJA 5B7WA 1HD0A 1NZ8A 1T3NA 3I6PA 1KLNA 3N79A 2MQNA 2M0GB 3DDIA 3ULHA 2V4JB 5SUHA 1S1VB 5LMUF 1RTIA 3OUYA 3UN5A 4DJBA 1LWXA 2GJIA 2LMIA 1JQGA 3IM8A 4KHPJ 3SMZA 3OVSA 4JI5J 5KT7A 2CJAA 3EM1A 4KV8B 3H4DA 3DMJA 3NS7B 4TYBA 4DL2A 2KTQA 4OJHA 3J81j 2R9LA 3U7JA 2WSCC 1CS4B 4FBTA 1RP5A 3O1LA 3HVTA 2PFDA 1S9FA 2B4OA 4C4WA 3SQGB 4DZDA 4YMEA 1B0VA 2MJNA 3M6VA 4HI2A 3V6DB 6FDRA 1MMNA 4UTGA 2UZAA 5CYMA 4WFBQ 2ABYA 3CC7S 4IR9A 4LF9F 3BR9A 6FD1A 1NNDA 3CDUA 1WTFA 1N34F 3ZNUA 1ZS6A 2DY9A 1YLXA 4IFVB 3HM9A 4JI4F 1PYOB 1R89A 1TKTB 2LVWA 4ECVA 2ZM6F 1SJ4P 4ALZA 4C8ZA 4OHYA 3IGNA 4NLYA 1MWQA 1PC4A 1E6VA 3TUIC 4EK2A 3PACA 3NWRA 1UAWA 2D69A 3A8JA 3R7BB 4RU9A 1FKOA 1T7PA 3DI6A 1HWLA 3D28A 2MHEA 5AT1B 1IM4A 4ID5B 1R0AB 1EB0A 1X0PA 1CJKA 2QL7B 8AT1B 5BXIA 4F0MA 1ULRA 2RF2A 3PYFA 2XS5A 3T5LA 4PG5A 2OFHX 1X0FA 3U02A 1VC5A 2R7TA 3MMAB 4IH6A 3CF5Q 4C8KA 3RB0A 1RB0A 4M5MA 2ROEA 2KZMA 2WBRA 1TU0B 3UDLA 5DQGA 2VBXA 1FVSA 2HYIB 1U48A 2OPSB 4K2XA 2Y0SD 3QQCD 3FMWA 3P5TL 2V8PA 2KXHA 1HKAA 3CCES 2J7UA 4EO8A 5DDPC 3MUTP 4DSJA 4K4XA 3PV8A 4URSA 4IUFA 3AA9A 2C1EB 4CZCA 4RUBA 2CQCA 4F4YA 1OPIA 3D68A 4TQSA 3W3SA 5K8OA 2PDAA 5L46A 2CJXB 4FYXB 2AYGA 2B8PA 1U24A 2P9GA 2VONA 4QCLA 2RAQA 3OLAA 2HNYA 4ID5A 2DO4A 1OWXA 1WHVA 3VAIA 3SEOA 4OYZA 4EBEA 4ECYA 1IKVB 1W26A 5FIIA 2XNRA 4USHA 1OO0B 3JTNA 4IOBA 5GAHI 3QWUA 1C2PA 5D15A 1RAOA 5IOLA 1VRTB 4USWA 2OJ3A 3SXLA 2MSTA 2KT2A 4OI1A 4IFVA 4BC7A 2Z2ZA 5GAGU 3G2XA 2W7OA 3HULA 4M5KA 2XSFA 3VQSA 1EKSA 4IO1A 4LBHA 1QJHA 4YFUA 5CABA 3EVWA 3R7NB 3L09A 1WOPA 3C19A 3NAHA 4P10A 2DKOB 2NLWA 1VC6A 1DQAA 2UUWA 4C0HA 1FESA 1PIEA 2D74B 1DRZA 4AQYF 3AQPA 5KAKA 1S9EB 5KFTA 3G96A 4DV5F 2CXEA 2FJVA 1VQOS 3AOCA 1WD6A 2E5JA 3K8VA 1SV5B 1T95A 4OYMA 2JLGA 4J9KA 1G2EA 3TVYA 4DV4J 1V3RA 1O6XA 4F4WA 4K4VA 2MKSA 4ICLB 4KGZB 4CO0A 1X4DA 3OHBA 3CDBA 2LQBA 2XZDB 2C2ZB 3QAUA 4PAAA 1WACA 1NZAA 2NZCA 4TKTA 3M2UB 4NZ6A 4TN2A 2O66A 3JYTB 3KHHA 4LFCF 5HAOA 2W1BA 1OY9A 4PWDB 1DURA 4TXSA 3JSRA 5KFXA 3NOGA 1FWKA 4CLKA 4K4UA 4R8UB 2CVIA 2ILZA 3JSMB 2EFOA 4YR3A 4NRTA 2PGCA 1U25A 2QSFA 4H4KC 2X51A 3SCJE 3M2VB 4P2XA 5M2UA 2X1AA 2GQQA 3RGIA 2UUAF 1GTEA 4LF5F 2HS3A 2U1AA 1VGYA 5A6PA 4DV2F 1CC7A 2XBPA 2GHWA 1PBAA 4FXVA 2MKHA 1GXUA 1FKOB 3Q83A 1N32F 3CD0A 1RE1B 1PYTA 2DH8A 2W2MP 4ZP8A 3GFXA 4ZPBA 3THTA 3AH6A 1XK8A 1U45A 4OYAA 5JMNA 2DR9A 3KNGA 1ZYQA 2CIMA 4J9SA 1PJ5A 4DF8A 4B9VA 1E6YA 4ZN1A 4URGA 1U1LA 1RU2A 1RT1A 3SBMA 3W65A 3THPA 4LSNB 3DRRA 2N4DA 3R5AA 2DGWA 3HD1A 2GVDB 1Y11A 2DNKA 2CJ9A 2M52A 3MAAA 4P52A 4ZDNA 3GV5B 1UA1A 4B9MA 2AEMA 4WU3A 1S9EA 4CNYA 4RW9A 2ZHBA 3QYYA 1T9UA 1XMBA 3FCVA 3ZZZA 2PA3A 3HT3A 4DR5J 2QA4S 1N5YA 2FHJD 4J7CA 3W2VA 3MM9A 2Z58B 3NS6A 2OEJA 4ES2A 5HLFA 1RT3A 1WG1A 2DJWA 2J7WA 2YQ3A 5IM0A 1Q86T 2VBWA 4LREA 3TRGA 3I0SA 3VZHA 3T5KA 4LR9A 1S6UA 2XYHB 2W9AA 4QWCA 2UU9F 1HW8A 1Z4UA 5LMNF 4KGMA 1IJEB 3VCDA 4E98A 4N8NA 2OPPB 3OFEA 5D78A 3I5BA 2YH1A 4OYBA 3VVUA 4A8XA 4OZ1A 1TMMA 1VQLS 1HNVA 1TQLA 2IYGA 3CCTA 3HF5A 2XHWA 4ZVOB 2MQMA 3RBDA 3D1HA 4F04B 4LFAJ 2UUBF 1LK7A 1MSWD 2BM0A 2C3MA 2RRBA 3EGNA 3L9ZA 3O8WA 1FFWB 4TNOA 2OPQA 4ZVHA 1J5OA 4OJGA 2EC2A 2NUHA 3D4JA 2J7KA 2CPHA 3EGVA 1NMEB 4OHZA 2XI2A 2X1GA 3RRKA 2Z30B 1F3VA 2MLXA 4C11B 1TKZB 2UVRA 5EN1A 3SSSA 4RW6B 4NXMF 4KR0B 4OFZA 2XZWA 4CQ1A 4WKYA 3MM6B 3M2VA 2HLTA 1FRIA 1S1UA 3NG8A 4K4ZA 2M9KA 1NDLA 1W25A 2CDRB 3DYAA 3EMTA 3HHLB 1D1UA 4RX6A 3A3OB 3GONA 4FF4A 4AE5A 4YOEA 1M5HA 3IR7B 4NMXA 2CJYB 4LVOP 4DV6J 3PNIA 4PUOA 1ZH5A 4DR3J 1LWCB 3BH7B 5HANA 2ZH1A 2AGOA 3E01A 4NLGA 2V4QA 2A18A 3DM2A 2GQ2A 5H1SV 4C3MA 5IZHA 3UNYA 1TFYA 2EK1A 4C0OC 1TL3A 1KFSA 2LA6A 4ZITA 1IKYA 2HK3A 3LGMA 5ETKA 2UXBF 2HWTA 4WP3A 5CYJA 3CMAS 4ILLA 3L95X 1DAXA 3CUNA 1V5IB 2HIYA 4P7TA 2IAJB 2X3DA 3AXMA 3N0VA 4YY3J 4GKKF 2ZBRA 3H5SA 1S77D 1N5TA 1CS4A 2BJEA 3LANA 1WTBA 2D9OA 3E8OA 1HMVB 3V5RA 5J2PB 3KXDA 3NGSA 4XDDA 1RWOB 4KY3A 4NLQA 4D3HA 3Q24A 4DDFA 4A8YA 1JLCA 4DSLA 2FDNA 4KV8A 4RKUC 2Y0BB 1TK5A 3NCPA 4AT1B 1U2CA 3TO8A 1D09B 2MSSA 3UR3C 4DFMA 1IBKJ 2FB0A 2UXDJ 2W7AA 3QJPA 5ETOA 4LF6F 1XWLA 3M8WA 3IBFB 1HBOA 2FZCB 3KDNA 4RW8A 3OTEA 3VHQA 3OTOF 5D4PA 2Y8WA 1N5VA 3I31A 2J5AA 3B4MA 5CCMA 4K4WA 4WK3A 4KC5A 4JUZA 5K20B 2FJAB 5KFAA 5HO4A 2DTJA 2KVIA 4D3GA 5C5JA 1EQ0A 1HBMB 3KDOA 4LJMA 4KQZA 4ZKAA 2NZ4A 1ZM2A 2E7WA 4CI0B 4IDKB 3OBIA 4JB8B 2HGLA 3F56A 1BWEA 3EZOA 3Q23A 1HQUB 3RB4A 1RTHA 2R3VA 3GIJA 4QYZK 3DM2B 3HI9A 5FLXU 3AD7C 1QTNB 2XEXA 2G9OA 3Q8UA 4NZ0A 5I3PA 2C2MB 2CQ1A 3V4IA 4USKA 1IR0A 2VG6B 5G0RB 5KG4A 1MG7A 4QBUA 1PGZA 4LF4F 1GQEA 4UY85 1M5OC 2KVQE 3HHLA 2FVPA 3I32A 3R97A 3BSCA 5E3CA 3RYLA 4HYKA 2W8LA 1RWWB 4QJVA 2OKQA 5EHHA 1NB7A 3N6MA 5F3ZA 4PG6A 4A48A 1FD2A 2GX8A 1XMQJ 2K3KA 4YUDA 3QRRA 2MHNA 2GC8A 2WW4A 1NK8A 3H20A 3BKTA 2WHOA 4ER8A 1IBCB 1OSCA 3EJMA 2PA8D 5D4OA 3QAEA 4UQTA 3M9MB 5DDOC 4MK8A 5D77A 2YBVA 4ILRA 4C8LA 5D0EA 1AFIA 2W25A 1KP6A 1YG0A 1UEKA 3N4WA 1UVMA 2QL9B 4TLQA 1Y10A 5HQLA 2W2OP 4JI5F 2MJUA 1S1TA 4HHJA 4ZJQA 4DPOA 4U6PA 3C15A 2ASLA 4LF7F 1KHVA 4PEOA 4ZMMA 2BRLA 3GFZA 1HI8A 1IKXB 2JWNA 2YNGA 2ZBPA 5JJBA 5I3UA 1VDHA 2PMZD 4DZ6A 3QJJA 3MR6A 2FVQA 5FJ4A 4DUZJ 2XWXA 2Z56B 4I7FB 4Y2CA 4C0BA 3J7Z5 2HIQA 3QWPA 2BANB 3PIOQ 1W7WA 2R2RA 4DR7F 3QNWB 4I56A 3MI7X 5C25B 1N34J 1CJVB 2YNHB 1BLUA 3ILOA 2KM8C 1S4EA 2J6SA 3A8KA 3Q22A 1ZM9A 4JI4J 5HMXA 3M7VA 5AE2A 3IP0A 5IT4A 3CB4A 3CW2C 1U0HA 2XY5A 4I6WA 4R5PB 4CO3A 2DY1A 2RNEA 3DU5A 1KR4A 1RTJB 2ZVSA 3EICA 2Z0GA 3QT5A 3R7SB 4CYUB 4O3PA 2HKEA 2LU2A 2GVDA 3K17A 4MJKA 1FDBA 5KFRA 4LSNA 2O5DA 3GZ7A 3L4BC 2D9PA 2QE5A 3QGPA 4MT1A 4OX6A 2OFGX 2DB1A 3D0IE 2RQMA 5D3GA 2JRSA 1J27A 2DNZA 3I96A 3J80U 2M7SA 3H5YA 1WORA 2YKMB 5C42B 3WIVA 3D0HE 1IKWB 5K8NA 5IWAJ 3BQ2A 1FJ7A 1KDNA 3SCIE 5HQ8A 4A8SA 1ZZFA 3IRWP 3NS5A 5ETLA 3GIRA 3KJFB 5KFLA 4KRWA 3BO4A 2E5IA 5E3PA 2IA0A 1NJYA 2KM8B 2FLPA 2NREA 2BVZA 3HO1A 1B7FA 2OMLA 2KXNB 2D7SA 5F9NA 3CWJA 4CH0S 1H6KX 2IJRA 5F8GA 4PQUB 3Q2SC 2V2VA 3LF0A 4L72B 4FYVB 4K2JA 2OUGA 2Q6CA 4WFZA 2CQPA 1VQ9S 5B09A 2MTLA 3J7YU 2XNQA 3MEEA 3CCSS 1PYSB 2E9ZA 4EEYA 1F1BB 2N4CA 4ICLA 1FTCA 2VQEF 1RYSA 5AXKA 2GFFA 2XWYA 1L3SA 3MHYA 4ED2A 3KLGA 2VG7A 3JXOA 1FRJA 1KBRA 3DRYA 4E2FB 3N28A 4G1PA 4ETZA 4N56A 2EVZA 4J37A 1ACMB 4QYRA 4DOZA 5KTQA 3NBPA 4DV0F 1M1GA 4M5DA 4CT9A 3HVTB 1XERA 2KL8A 3IWLA 4LUBA 2OEKA 1B0TA 2DGXA 1DTQB 3CGIA 5A2QY 1HHSA 2VFSA 5DO2A 2Q6BA 5I3QA 1RT4B 4IRKA 1FRHA 3OVBA 2CQHA 3M2RB 4JV5J 2X3GA 4BWJA 2A10A 4NCAA 2KU7A 3J7ZT 4ZPCA 2IJNA 3ZC4A 2HS4A 1MMDA 2Q3PA 1WOOA 3KK1A 2E1MC 4IO9Q 3FC9A 3M8PB 2HHUA 1U1MA 2DH7A 2C42A 4Q8FA 4AQYJ 1H0HB 2DIVA 4I2PB 2CVEA 2J0WA 4N8OA 4TY8A 2PIIA 1B0PA 2DHXA 3DHXA 4DV5J 1X4CA 2BM1A 4Q2LA 2CQIA 3IFEA 3MURP 4FF2A 3Q8YA 2HRTA 3HX9A 2I5JA 3LWLA 1ZA1B 1R6YA 1YJNS 1NJZA 1EIYB 4NX9A 3M8QB 5L1JA 2IHR1 2AW0A 2MPUA 3S1TA 2MGZB 3I5CA 3IG1B 3I56S 3MPYA 4HT5A 4WF9Q 2G13A 3CMQA 2ZOGA 4IG0A 1NO8A 3KKFA 1FK9A 1YRUA 4USUA 7FD1A 4N5SA 2ZC4A 3RAQA 3DLHA 2YPZA 2BJ1A 3BPSP 3HSDA 4PZVA 4LFCJ 3FRYA 1FEHA 4XAKA 2B9YA 3MR2A 1KN6A 2H4YB 5M2RA 4OI2A 3WX4A 5GADU 3RR8A 1TFWA 3GCXP 4Y2IA 2QLXA 1HYSB 1TUGB 3T5JA 5IT9U 1U49A 2HHWA 5H9FJ 2QYCA 4F50A 3PX0A 1F5CA 4LF5J 3PX6A 1UA0A 1NKEA 1VHIA 2EBEA 2QLWA 4L74A 1HL6A 4QZVB 4N47A 5KG3A 1QSLA 1KOHA 1URNA 3POTB 3KLHA 4WFNQ 3BGRB 4ZPVR 1HNIA 2F4FA 2QO3A 2YWWA 4ECUA 1EP4A 4DCPB 1VQ7S 3M30A 4NLTA 4XIUA 2FVRA 2DNPA 3W2WA 1VCTA 2E9RX 1UWAA 4C9DA 2HQIA 2OSQA 1RAHB 2JEGA 2QIFA 2FHMA 2CA9A 2XGQA 3W63A 2DEIA 1GNKA 2ZJPQ 5HK4A 1NJWA 1WHWA 1NK7A 5K14B 3J80Y 1PSDA 2M8HA 4KPCA 2IVYA 1M5VC 2BMBA 2ZH7A 2F4VF 4LR7A 4LRAA 3UR0A 3G6YA 1Q7LB 1BHNA 2KKHA 4P6QA 2XS7A 4NL5A 1F9EB 1NLKL 2F9DA 3SDEA 4Q44A 3J81Y 4JV2A 3NOCA 5EGYA 2C28A 2CWXA 1TKTA 2B7CB 3VWSA 4Z2XA 2V4RA 3W1YC 2HAFA 3RG6A 1NJXA 2CPYA 5F8HA 1ZPVA 2NXUA 3CCVS 3VAJA 2WB4A 1KRPA 3HK2A 4ED3A 3CSKA 5GAEU 1WG5A 2V68A 3BGFA 1GX6A 4ZP7A 5C24B 4RPFA 3TYTA 4ZIWA 4WCEQ 1PJ7A 2PSZA 1VOMA 2VFVA 1N36F 3PJ9A 3OQ2A 2AJ4A 2R8HA 1FRMA 1UW9A 2WK4A 2DIUA 2YX1A 3W62A 5LMNJ 3CIZA 2UU9J 2CPIA 2KJVA 3FSIA 3QO9B 3W5XA 3ZNJ1 3MECB 2VA3A 2XLKA 3PW5A 4W98A 1LXNA 4WU2A 5DS7A 1IXKA 3ISNC 3MR5A 2ASYA 1VBZA 4QYZJ 3TX8A 2LQ8A 2DGTA 4F4KA 3NY0A 7AT1B 5J2QA 1NHUA 2UUBJ 3FZ2A 4LFAF 4RNNA 1JLAB 2ZZNA 2OD6A 1UZDA 2OPRA 3EX7B 3PJWA 4UOGA 1R8PA 4OJ3A 3BQ0A 3DLEA 1UTAA 3HSGA 4Z7YA 4XDCA 5KG2A 3GILA 1S59A 1GEHA 4I1TA 5KT3A 2V8HA 2P5VA 4GRSA 4ZVQB 8RUCA 5I42A 4B17A 4TY9A 2MQLA 3AD9C 4KAIA 3M8RA 3TANA 1X4EA 4NXMJ 2HNDA 4DR1F 5KFDA 5I42B 3C16A 1U02A 3V4MA 1NAQA 1U1OA 1S0NA 2MYFA 1RWKB 1Y5LB 3ZZTA 3ELHA 2UP1A 5GVQA 3K5NA 3DRXA 2R2TA 1FJCA 4FZVA 2H48B 4F3OA 4B3OA 1WDDA 3JTOA 3VVTA 2PC6A 3K5LA 2Q79A 4NLSA 4V1Ak 4IOCQ 3PW7A 3QLHA 2K3IA 1EETB 3TJAA 2GMLA 2YQ0A 4A8WA 3CD5A 3OJSA 5KFSA 4MKBA 2LLZA 4X4QA 1CJTA 2B5JB 3H90A 4X4PA 2ZUAA 3KJQB 1REGX 3DXBA 4XPCA 2YWEA 2YH0A 3ITHB 1BY9A 4OZ3A 2UXBJ 3TI0A 3MMCB 1FF2A 5DG9A 2QEXS 2R4FA 4YY3F 3FDSA 4NYPA 4GKKJ 1C1BB 2KFYA 3DOKB 4CM2A 2ZITA 1X9WA 1CG2A 1FE4A 1Q78A 5HMYA 3I0RB 3KJNB 2OMOA 4G1QA 1BQNA 3ZZ0A 5KFVA 4A8KA 2CUYA 4B02A 4RUHA 1RSCA 4U8YA 1H73A 1IR2A 3L3CA 2HZVA 3WBZA 1G1XA 2ALYB 2PO4A 1IBKF 3D67A 1TR0A 1OSDA 3FCHA 4NA3A 3ZZRA 4DV7F 1HNWF 1SCJB 4LF6J 1DQ8A 3PEHA 3UDVA 3OTOJ 4CTAB 3R5CA 2VA2A 4MKYA 2E9TA 2A6MA 4IFYB 4I68A 1R8CA 3W5ZA 4WYLA 3IM9A 3AFGA 2A2DA 3GJQB 4ED7A 5HVGA 4A8OA 1NDPA 2LCWA 4F3MA 2LXUA 5HMZA 1KWMA 2QGFB 3EXCX 5HQMA 1DTTA 2F1FA 5AJ3F 1N0UA 2CZ4A 2HHSA 3HD2A 3S8SA 4A8QA 4RU2A 3KLFA 3CCWA 5F8IA 1IBMJ 2HQ3A 2FLNA 3DN9A 2PD1A 3N6NA 3N5FA 3KLVA 1S6QA 3M6XA 3EUNA 2FVCA 4MFBB 4MKVA 5HVHA 5K8MA 3G71S 4H4OA 2ATCB 2AD9A 2VC0A 2ATLA 3D1QA 1U26A 3X1LB 2YWHA 3ZZYA 2OTJS 1WC0A 2FHOB 1VI7A 3ILJA 1L3VA 1KTVA 5LSRA 2J9DE 3GYXB 4N76A 2AJFE 1FXRA 4M5GA 1F3FA 4YB7A 2O1PA 4WXOA 2AIRB 3D9BA 3KUHA 4OYPA 4LIWA 4WXWA 2XSJB 1X31C 3R8YA 4DV1J 5EWEA 1XMQF 4AL7A 5CD4A 5IC6B 3UNGC 3PZPA 2JSXA 1WNEA 1SPBP 4UZCA 2CPEA 3T6BA 1B70B 3TARA 1TKXB 4KH1B 1B3TA 4Q0BB 1DLOA 5K5MA 2GVZA 4KO0B 2EBGA 3MCMA 3R6GB 4QIVA 1WOSA 2VFRA 1JNRB 2YNFA 3JSBA 3QZ7A 4I0WA 3ZTQA 3ZTRA 4EBDA 1S0VA 4X66J 3H2VE 5EWGA 2R7UA 1WELA 3DGPA 1KS2A 4LF7J 2PEBA 1SJ3P 3RW6A 3DOMB 1VMBA 3FQLA 4A4JA 2HQGA 4JI1F 1V6HA 3MM5B 4MYTA 1WG4A 2GS8A 3N5BA 4K5SA 4DSKA 1RAGB 4N77A 4OYXA 4DUZF 4DL3A 4B9UA 1H2TZ 2B4UA 4KTQA 4OL8A 1XR7A 3UD3P 2ZH5A 1YJ7A 5KG1A 3AJDA 3EPIA 1T8EA 3BSOA 4DR7J 2AP6A 3H5UA 2HHPA 4PXCA 3KHGA 2L3MA 4ZLPA 4O3QA 3W61A 2XYPB 1TV6A 3HP6A 2R2UA 1I3OB 1TV6B 2CZVC 3DCAA 4HKQA 1M1HA 4RWWA 4O3OA 1S7HA 1J2VA 2HVZA 2K7JA 5IFMA 2LP4A 3KLGB 1H38A 2UVVA 4HDGA 4USVA 4F3QA 1RKJA 3HHLD 2B5JA 3CT9A 2KG0A 4PRFA 4FBUA 3IWNC 2ZOFA 2EFNA 3SDEB 3GJTB 1RAJA 3D1OA 2CNNB 4S0MA 4ERDA 4ZJOA 1QDUB 3BBCA 2PE8A 4KHMA 5A8RA 2IRYA 4ZVUB 1FDNA 2NXJA 1SH3A 2Y1LB 1X9SA 2FYXA 3R3TA 1B99A 1U7LA 1K47A 3IBWA 4YHHJ 5IWAF 3A3PB 1YJ9S 2WSEC 3FNNA 3MGJA 4EGLA 2O67A 2UXCJ 4FPIA 2XZTB 4ANDA 3R1HA 2CPFA 2HNDB 4ZVRB 1TKXA 2HHXA 4I6YA 4DU8A 4H4OB 4ZJLA 3TUZC 3IN5A 2W9BB 1VQ5S 1R0CB 3TAMB 2W01A 1JLQA 3ETOA 1B4SA 3RBXA 2B9XA 2XC9A 5JVHQ 1D8YA 3Q2TC 3K8WA 1F0XA 1IKWA 4KGXB 1TTHB 3R27A 5DETA 3QSYB 3DOLB 2QTWA 4WBFA 4BC9A 1T9YA 3QRPA 4FXWA 4RW4B 3I4PA 3T5HA 2OTLS 1HYSA 1F2GA 4H4MA 3W60A 1JX4A 2PFFB 2EXUA 2YX7A 2VHGA 1NPPA 1QAXA 2B4VA 2BKPA 2K1RB 3A8EA 4HHUA 4PCQA 2UVWA 1S6OA 5DM6Q 2VQEJ 2V6AA 2R8KA 1SC6A 2JJ4D 1VQYA 1MNEA 3F0NA 1S6QB 3PHEA 4C3LA 2H4WB 1RTDA 1SUQB 2HFZA 3G82A 4ES1A 1S97A 4ZIVA 5I4MA 1KEKA 1HWJA 4DV0J 5B0FA 2BBEA 4Y0FA 2H54B 2RQCA 2VQFF 2BANA 2DNLA 1YJVA 3OFFA 3BYRA 5FD1A 3T9NA 2I1RA 2XMMA 3NEKA 1NKCA 3R2DJ 1S4FA 4HACA 1FNMA 2JLEA 4JV5F 1VQKS 4M8LA 2N3LA 2W4DA 1EZZB 4NMLA 4G1IA 4P7VA 4AXJA 1VQPS 4C97A 2FVSA 2E1PA 3FVYA 4YR2A 1HLWA 4WWSA 4ELVA 1KTQA 2ZH2A 4CWBA 1Q8LA 4OLPA 1AROP 3A3NB 3FBFA 3MMJA 2DHAA 2HFVA 3GB0A 1X5TA 2QN6B 4KH0B 2IRUA 2EG1A 2GGPB 1IJFB 4M5JA 2K1RA 2RIJA 4K4YA 1N56A 2BE2A 2H51B 4ZP6A 3OR2A 4LBIA 4WP9A 1PAUB 2JHEA 2ZKTA 3TA0A 4GKJJ 3DOKA 4DX7A 3G87A 1AB8A 3HHEA 3LP2B 3DOLA 1VBYA 2XULA 1MW7A 2JC0A 4DWIA 1VLOA 1ZTTA 2Y3YA 3MMCA 1TUVA 1H2UX 5C7PA 2BABA 5KG7A 2D3ZA 3DRPA 4CNZA 6AT1B 1V9OA 3R5JB 4FYWB 2GO8A 3PEJA 3M6WA 2Y9HA 2BEFA 1XN9A 1Z1ZA 2BOAA 5J2MB 2FGOA 4NYZA 1UP1A 1QTMA 1QUPA 2AQ4A 2MZRA 4GO5X 3PR4A 1N54B 2VJVA 2RT3A 1S72S 4MIWA 1RKIA 2GQCA 1RCOB 3ONQA 5B0DA 4PYDA 2YQ1A 3C16B 4WIIA 3OSPA 3U27A 2PMHA 5ETNA 1UETA 3DLLQ 3MPWA 3P4UB 4IH5A 5KFQA 3EDQB 4RUCA 3LQVA 1WEZA 1Q8KA 2ZBQA 2R8IA 5GAEI 1Q5YA 1IBLF 1NHKL 4NI2A 3GCWP 3GSIA 4YDXA 2VFUA 4F2SA 1RI7A 2YKMA 5C42A 2OPRB 4RUAA 2F4VJ 3TJ9A 1H98A 1NKBA 3GV8B 1JLEB 2DCUB 2JL9A 2QSWA 1N88A 1T9VA 3OFHA 3RAMA 1RU1A 2VG5A 2ZOMA 3QIPB 1QUVA 1YJUA 2BE2B 3RU0A 2EI5A 1C0UB 2F7VA 2MQPA 1QY7A 5E2QA 3MFHA 1NK4A 4ED5A 3ZO7A 2KZZA 4RL1A 1QM9A 4Q45A 4IYQA 4KE5A 3Q89A 3C66A 2DYAA 3U1NA 2IA6A 2BJ8A 2WCXA 4FYDA 3BO2A 2MY8A 2NQPA 1MN7A 4LQ3A 1U1NA 1N36J 3ZXWA 2AEJA 2HS0A 2ZE2A 1ZM3A 2MLYA 1HWUA 4NLVA 4OHVA 4RWXA 4G65A 4MIBA 4F67A 1TK8A 3QMQA 5CA5A 3DLKB 4FPRA 3U1MA 4OZNA 4DS4A 4DFPA 2GHVC 4B3TJ 5H9EJ 3CVKA 2OO4A 1UJ5A 2DHSA 2WOMA 4GMKA 1TL1B 1ZOTA 4DHVA 5HP1B 1DBDA 4ZCIA 1LOUA 2VDHA 2WSFC 4CO1A 3BDPA 3FEZA 4P2FA 3BBFA 1RTDB 1WC1A 1RHQB 4NEYA 1IQZA 2XMWA 3BQ1A 4DQPA 2NPIA 3MAHA 3CJ2A 2POKA 2RDDA 5B0EA 2HVIA 2FD2A 2BXJA 2VBZA 1VHFA 5HL7Q 3W2WB 4GC6A 2BDPA 2BZ2A 3CJRA 4OZ5A 3B54A 3H7HB 5E3AA 2XO6A 2F40A 1HNIB 1RBLA 4C11A 1D9FA 1FWPA 4DR1J 4DSIA 2C3OA 4J9LA 2DR7A 1N33F 3RTVA 2DCLA 2HFUA 3ET6B 1FEEA 2X1FA 2I0XA 1ZETA 2OPQB 2E7XA 1MROB 1PBUA 3HSJA 4KB7A 1U47A 1KQSR 5AE1A 2B9EA 4LRDA 2YKOA 3BN7A 3NWGA 4NCGA 1WC3A 5L1LA 4HH0A 4BS2A 4B9NA 3JSYA 3C2PA 3OL9A 5KFMA 4Y65A 1HNVB 4ZPDA 1CQMA 3MEGA 1GTHA 3BM7A 2AKWB 4MK7A 3OXLA 3OHAA 2QLJB 2QMWA 2J8SA 4EZ6A 1KFDA 1XMOJ 1W2IA 1N0VC 3GTYX 2ZDOA 2VZ9A 3Q0AA 2AJ2A 5IM0B 1VQ6S 3M4XA 4DG1B 3MOZA 3OSNA 2B51A 4RLEA 2GJ2A 3MM9B 4G1QB 3W2VB 1C1CA 2H5IB 4WIQA 4I2PA 4FXDA 2L9NA 3BR8A 2UUCJ 3C3LA 2HQCA 4JI6F 4DPYA 1S99A 2CZ9A 2FC9A 3TAQA 3LAKA 2RHSB 5HJXA 2DNQA 1U2RA 4RR5A 2DNMA 3UCGA 1RBAA 1XQIA 4OQJA 4EUVA 3KJVB 4ED8A 4DV7J 1HNWJ 1FFSB 2FJWA 2MKYA 4CLZA 1J5EF 3EXYA 1GT8A 2QC3A 2W9CB 3P6YC 4O23A 3GV7B 3TVKA 3SV4A 1SJFA 2ACMA 1HMVA 3FKBA 1DTQA 1FFGB 2BW7A 2YKNB 1BXNA 3MEEB 1X5PA 1X4GA 2XTJP 3PX4A 1Y9OA 2AV5A 1VRUB 2KT5A 2ZEJA 3E2EA 4M5DB 4XTTA 5AJ3J 3AD8C 1WEYA 3EE3A 2A0FB 3UW1A 3D0GE 1X60A 5EWFA 3BN4A 4WPAA 1IBMF 3MUVP 2CADA 5LSOA 4PQUA 2VG7B 2VU5A 4WKRA 2WZ1A 1RDRA 2C2NA 3W7BA 3O44A 4W90B 3VGUA 2C3UA 2E1CA 3K2YA 2KRRA 3G86A 3OVAA 3MAQA 2G1HA 3AOBA 3BGRA 2BJ3A 1O0PA 2PI5A 2ZUGA 3BKUA 3CJQA 2HQDA 5DM7Q 3WC0A 2J0SD 1R3NA 1W2BR 1SC3B 4M63A 4U67Q 4CRJA 5LXRA 2G4BA 1R6VA 4EI2A 4F02A 1ZAXA 5LT5A 4KJIA 1EARA 1HQUA 2RQKA 4IG3A 3E3XA 4OZ2A 2B6AB 1DARA 1KKHA 1MU2B 2DXEA 4DV1F 2R7XA 1R7IA 4LIRA 3CEDA 1WC6A 4FKXA 2BQRA 3LPYA 2V94A 4QOTA 2PEHA 2YY3A 1VQ8S 1XTZA 4O44A 1FK9B 1WF0A 4ECSA 2J9EA 5MLCV 3CJ4A 4ZHRA 1VK3A 2YKAA 5ETMA 3V81A 1KVJA 2W24A 3O6QA 1WC4A 2IM0A 2GMHA 1HBOB 5ETQA 3W8PA 4DX8H 4X66F 1FJGJ 4W92B 2G0CA 1AXQA 3MDFA 5G4DA 4GO7X 3HVWA 4YR0A 4JI1J 1HWKA 3DDKA 1V3SA 2DNRA 2IJFA 2ZBCA 5BYRA 4ZVSB 1ZBTA 2UUTA 5D8HB 3UFCX 1WHXA 2R7QA 3OUYB 2BE9B 3KUEA 3Q8VA 2C2RA 3B4DA 5J2PA 1Q5VA 3LOUA 3F44A 4USTA 2LYVA 1S1TB 3T6JA 3V6JA 1HR0F 1SBRA 2L9WA 3KLIB 5IC4B 1CBKA 2DITA 3GG0A 2KJWA 1FKAF 4RJVA 3NNHA 3DRSA 3AHPA 3FQKA 2QA1A 2AU0A 5IQQA 4OX7A 4LFBJ 1HD1A 4C2MA 4UT4A 2KYZA 1EHWA 4HEA9 4A46A 4GVLA 3H25A 2GO9A 2XYGB 1RT7B 4PKDB 4M94A 1L3KA 4USJC 3JQJA 1M1KT 3R9LA 4ZA1A 2Q66A 3D7SB 3BYPA 3G8SA 4A47A 3R2CJ 1SJ1A 1AUSL 4YHHF 2Q43A 4DLEA 2MQ8A 3J7YI 1K44A 2UXCF 2CAJA 4NLPA 4TVAB 4EWTA 1TMJA 3O2IA 5THWA 2DO0A 2VC1A 1AUDA 2I8EA 3QLHB 4M5IA 5L9XA 1RXOB 2CQ0A 4QR0A 4ZVPB 3ADAC 1F6TA 1AZSA 1S9GB 2RU9A 2QMXA 2RF2B 2A2CA 4DX6A 2CJBA 1NBEB 3D3BJ 2MGZA 3CCQS 4F36A 2P9CA 2V0NA 2LQJA 3ENQA 4DV3J 1CJKB 1NU4A 3G6ES 3CNQP 5CAAA 2G2OA 3UO0A 3IS9B 5F8MA 1N6QA 1YVFA 4QPTA 3QATA 2Y8YA 5HBMB 1WI8A 3GP9A 4TY8B 1SC1B 2HQFA 3MM7A 3BV8A 3OPKA 5FDLA 3GQCA 1RT6B 3MPDA 1K1QA 4KT0C 3UDCA 3V4IB 2DPJA 2E5LF 3MR3A 2CQGA 3M8ZA 4QR1A 2IBKA 2HW3A 1M5SA 3ZTPA 3TQ1A 3PCOB 4OHXA 3U1LA 3KWMA 4PWUA 3FUYA 1NCLA 1RTHB 2JEIA 1TAUA 5IT0A 5J2QB 1GAOA 2F65A 1RK8A 2EFPA 3RB6A 4DCJB 2G2YA 3TW0A 1I51B 2LDIA 2GNKA 4IDKA 4WE1B 4ZS6A 1N48A 3ZZUA 1HHTP 1HNXJ 2E1AA 2VQFJ 4G3IA 2R42A 5CYMB 4PPDA 1JLBB 2ZWOA 4EFAC 3OW2R 3RBEA 2FPHX 2IC3B 3R5GA 4R5PA 3ZZPA 4CIOA 1HNZF 1CPZA 4KFBB 2V8DA 3T1HJ 1TKDA 1S12A 2B8QA 2YKPA 3TZWA 1N5SA 2AGPA 2JVOA 3MZIA 4CT8A 2EFGA 5KFPA 1FT8A 4E0DA 2Q1LA 3CCJS 5HVFA 2YNHA 3VAKA 1Q7YT 4OHWA 2WVDA 3TEGA 1IN0A 1NPKA 2CQ2A 2MKJA 3CTRA 4J91A 4R0JA 3VTIA 1B64A 1DHMA 5A0YB 4TU9A 1E6YB 2M3DA 3C14A 7FDRA 2N7CA 5IS2A 5I3UB 3CCMS 3R5DA 1VRQC 2K7KA 2GZOA 3D54A 2LFVA 3CJ3A 3E01B 2QG9B 1KOOA 5CD4H 4NXNJ 1LW0B 1WSRA 2VPZB 5J1EA 5KFBA 2E5HA 1BGXT 2VPYB 3T41A 5K14A 3KUGA 4MIAA 2EPIA 4J9RA 2X1BA 3M9NB 2OELA 3IS9A 2B4PA 1RHUB 1S1UB 2HRYA 4O4RA 3OR1B 2KFZA 3P45B 2AEFA 3BKFA 3UDEA 3DFEA 1P1LA 1FCAA 2JVRA 3ISND 2W4CA 1S9GA 3POTA 5DJBA 4Q43A 1U1PA 3QJLA 5E7OB 2DGQA 4PUOB 1FO1A 1FKPA 1FX2A 1NPRA 2V34A 1FWLA 1SH2A 1WSVA 1NM2A 3TR5A 2RH3A 3M32B 2H1YA 2EC0A 4HLBA 4ECXA 2V8GA 2YX4A 4GVBA 2KHDA 1U6FA 2F5GA 2E7VA 4X4SA 3SFGA 3UN2A 5KT6A 3KMSA 2ERRA 4X4NA 3PM9A 5CHCB 4X4VA 3DGVA 2CG4A 1RT7A 1YJTA 4CCHA 3CIMA 2DBBA 4X4RA 3OL7A 3LALA 4JI0J 1IBLJ 2FLLA 4ZVFA 4B9TA 1RWNB 3MWBA 5F0WA 1JKHB 2QV6A 2Z2YB 3VALA 2G0IA 3MFIA 2XY6A 1VBKA 4C8OA 2RMLA 1KHWA 5AXNA 4GKJF 4KKOA 1UZHA 1HWIA 5C2CA 3CC4S 4C8NA 4O0NA 4CLYA 3KLEA 2E44A 4I7FA 2RS8A 4DFJA 2DR8A 1Q8BA 4LVNP 2KO1A 1LW0A 2DNNA 3A8IA 4LRFA 2HWIA 1VRTA 1A0OB 3I9V9 4F25A 5RUBA 1E6VB 1DJ0A 3ILLA 1HFEL 1T11A 1KQFB 1LXJA 4RW8B 3OL6A 2AYBA 3NKYA 4IRCA 3K0JA 2BRKA 3MAAB 4DSEA 4NRUA 5A0YA 2L48A 1RT1B 2DHHA 2IM3A 2BW2A 2XMUA 1HPZA 1KLMA 3AB4B 4FN5A 3D66A 3FMBA 1D9DA 3GIKA 4NLUA 4G6VB 2J8AA 1LWFB 2DGSA 3SSRA 1NSAA 2KT3A 4B3TF 3OFGA 5DDQC 2EG2A 1UCNA 1BWVA 5BR8J 4DBQA 2MDAA 3CJ5A 3P3DA 3D6FB 2B43A 3LPEA 3KK3A 3PO5A 2IY5B 4FP9A 1X4HA 1IKYB 1JMTA 1Q1KA 5E3QA 1YSJA 3HVAA 4IOAQ 4RNOA 4ZK7M 4FYYB 4ZN3A 5LJ3Y 1C0TA 3FK4A 3PHTA 3QFWA 5D4LA 5DZ7A 5KFYA 3TJ8A 4B9SA 1C0TB 3M2UA 2M8DB 2HBQB 1JJ2R 2XS2A 4Q5VA 1J5OB 4I2QB 4ZVTB 4CO2A 3F41A 3OLBA 3S01A 1N33J 4DUYF 5A8KA 1Q53A 1DQ9A 1FRXA 1SI9A 1HI1A 1ZAWA 1JLFA 2G1DA 2BV3A 3IBCB 3C6UA 4P2MA 2RKIA 4RW6A 2MLZA 4L3NA 4CDIA 1K0TA 4R8UA 2YPYA 3MUMP 4I2QA 4ED0A 5D0HA 3IO1A 2OEMA 4O0IA 3BO3A 1X4AA 3TAPA 3HJFA 3P96A 4PWDA 1L3UA 3FRZA 4NE9C 2DR6A 3VAFA 1OPZA 4HVZA 1YBUA 4KBIA 3RW7A 4P72A 1SC4B 5E41A 4RO0A 2NXEA 1TAQA 2CG8A 4NA1A 4PQAA 1KLMB 3GFYA 5DZ6A 3TWZA 2ZJRQ 1R27B 2LQ5A 1XMOF 4DR2F 1M90T 2OLWA 3LAMA 5J1NA 1XC9A 1KVKA 2FC8A 4BCAA 1N5QA 2GW8A 5A76A 2CNOB 3RBZA 4HTIA 5KG6A 4CYUA 2MXYA 3PKYA 4UQGA 2VD3A 2ROGA 3M1VA 3T19A 5KG5A 2XG8A 3CJ0A 1LV5A 2UUCF 4JYAF 1U0HB 3G8QA 3DLGB 5L9NA 1GMWD 4JI6J 3SQOP 1JXLA 3I0SB 1IKVA 3PVXA 3DMJB 4ED6A 4KSEB 2XGPA 4DR6F 2C22A 5L38A 4JI7J 5HLFB 2CYYA 4USIA 1Q82T 1J5EJ 2XMVA 1RTIB 1U2FA 4TLRA 2F8EX 2A3JA 1RWXB 2CPXA 3AA8A 3GU0A 1HA1A 2RB7A 4RW9B 2PT0A 2YNGB 3G6VA 1FNOA 3D6TB 2OAUA 1RT6A 3C15B 1QAYA 3B78A 3EZUA 4M5NA 4Y2KA 4JV0A 2KYXA 5JXSA 3D6MB 1S5ZA 4C7QA 3D6HB 3KLEB 4UZBA 1HQEB 2F9JA 1LW2B 1UJ6A 3M32A 3SSQA 4CM0A 1RWPB 3WC2A 2HNYB 4OJ1A 2OPSA 1B7YB 1ZAVA 1F2HA 1RGVA 1BQMB 1VQSA 4P75A 3NCQA 4WFXA 4DFKA 3CDAA 1RQ0A 3ET6A 2YVSA 1ELOA 4ECRA 1SKRA 3VZIA 2XQCA 2HK2A 4F26A 3G6XA 2IM1A 4AD6A 5L8RC 4IKAA 4IH7A 4Y28C 2ZBIA 2J6UA 2DISA 3HCXA 3HT0A 4PG4A 1SXLA 2HNZA 4N7TA 1CULA 2QLFB 1R0AA 2J6TA 2HMIB 3N01A 4MTPA 4YS2A 5DGBA 3GG1A 4MK9A 1KD1T 2IM2A 1S49A 2KDOA 3MMAA 3Q86A 3OT9A 4CH1A 2WOMB 3VGVA 1IWAA 2CNKB 2HEKA 4KGKA 4ELUA 1UMJA 4CLTA 3BBBA 4OI3A 1RT2B 2DNGA 2I6WA 2CDQA 3EDRB 4X84A 1CEZA 2XMJA 4P9SA 4QIFA 2A1BA 5LL6d 1IWGA 1HBUA 3CXCR 1SV5A 2HGMA 3TP2A 2C3YA 1HHQA 2HVDA 2RS2A 1FJGF 3KK3B 1YDLA 3UCUP 2DEJA 1GMVA 1N5YB 1QAIA 2HHHF 1GH8A 3DLGA 2HFOA 3A4TA 3BS9A 4MYUA 2YKNA 3WHIA 3T1YF 2CPDA 2IC3A 1TVRB 4URQU 3M1VB 5E3RA 3RRGA 1HR0J 2WW8A 2XCAA 1NRKA 3P49B 1LQ9A 3NMAA 2Y1RI 3HHKA 1U8WA 2NCKL 1R43A 2E29A 2Z8QA 3AB2B 1S1VA 1ZPWX 2EK6A 4OZ0A 4EYHB 3N6LA 1JLCB 1U1KA 3MPVA 4B3RJ 3QBCA 4C3KA 4YN3B 2DNOA 3SQGA 3V6DA 2I9SA 1K9MT 1N52B 3EGZA 4WFAQ 1UL3A 3QPIA 2NS1B 5FDLB 3JAMU 2XO7A 4KGVB 3BGLA 4K0KF 2RUSA 1PC5A 3CCLS 3QIDA 2CQ4A 1DZ5A 4F0KA 2JOQA 4DU7A 2NR0A 3DDNA 3NGRA 2LECA 2OSRA 3L7UA 2RKIB 1HBUB 2W4PA 2FHJA 1JLFB 1SL0A 1Y7PA 2B6AA 2CRLA 2PN6A 1UVKA 2V4JA 1RWUA 5LSLA 1OJ4A 1AZSB 1S76D 3PG9A 1S0OA 1N4LA 5DQIA 1HQ2A 1HARA 1LWCA 3ENVA 1NSKL 4WFYA 5GMDA 5J1PA 3K59A 1S6PA 2QRRA 3BGOP 2RILA 4DN0A 1QE1B 1F5AA 5HBMA 4F7VA 3HVRA 2R2SA 5K8PA 3CPWR 1AA1B 3L7PA 2HMIA 1URRA 3BZQA 4DV3F 2O3DA 3RB3A 3G4SS 2HHVA 1Y5NB 2CKWA 3A12A 4OZLA 2O01C 1ZM4A 2VPWB 3HLUA 3MD3A 4UOCA 4X65J 4QW9A 3QT8A 4DS5A 1T03A 4C8YA 1C4CA 2SXLA 3V6KA 1ZTWA 3RAXA 2LEPA 4YB6A 1LWFA 2VB6A 3H2UB 1TZ0A 2E5LJ 4K5RA 2KI2A 4DMZA 4OYIA 3RZAA 3OL8A 1FDAA 5KT4A 2VUGA 4V19X 2MQQA 4ITSA 1H3DA 1LW2A 1C4AA 4ENOA 3KLIA 1HNXF 4A8MP 3VAHA 4NLWA 4F0HA 1S1WA 2FTRA 2OPPA 4YEAA 1HNZJ 3BSAA 4FF1A 3GWCA 5KFEA 3T1HF 3C46A 2AGQA 4HACB 4KYZA 4F8RA 3LUYA 2ROPA 2YNIB 1XNRJ 4UOFA 3OV7A 1X7VA 3KOAA 4PWWA 3R1LA 3PW2A 3E51A 5JUMA 4U96A 4ED4A 3DRSB 1LK5A 1MMLA 1SIZA 1ZA2B 2HLUA 3PJXA 4YB1P 3PIPQ 1SL2A 4UUWA 1JKHA 4WTYA 1NH8A 2D1CA 5ADZA 2MZTA 2RRNA 2V63A 1RUSA 4KFBA 4ZCKA 3K5OA 1I5OB 5HJYA 2FJXA 3GFHA 2V9KA 4O44B 4DX5A 3I55S 2UV8A 2YXLA 4X4UA 4K4TA 1RT5A 1KQKA 4NXNF 3H59A 4WE1A 2VPXB 3DRRB 3EWGA 1C0UA 3M6UA 3R6LB 4FS1A 4M5HA 1YZ6A 3WIUA 1VBXA 4CO5A 2DGOA 2GIQA 1X4FA 1T3OA 1X9MA 4DL7A 4Y2AA 4KPYA 1FKPB 3V81B 2DRAA 1Y5IB 4ZHRB 3PR5B 4FKYA 3IMQJ 2XMAA 3MM7B 1JLQB 1SJRA 2ADBA 2BUNA 3NGDA 2QT7A 2BQUA 2QMUB 2GAGC 3FGVA 1WKLA 4CLWA 2BYCA 1N6QB 2WRMA 4QW8A 1XNQJ 3PRDA 1SQEA 3C6UB 1RJJA 3I87A 4JI3J 4ANCA 1MU2A 1S10A 3CJ8A 5B0AA 5CCLA 5IV3A 2LA4A 4DQQA 2JNJA 5IXUA 2FGCA 2AJQA 4MH8A 1FRKA 2ZHOA 2D3O1 2BKOA 3M05A 3PO4A 1IQTA 4CP5A 2WONA 1TL1A 1EAYC 3PTWA 2HFNA 3MMBB 5GADI 5HP1A 2RVJA 3GYGA 4JI0F 3DRPB 2EWHA 2J0QD 1CJUB 1P8GA 2K8GA 2AWZA 3B6BA 2ASDA 2VL1A 4WTOB 3MEDB 5DG7A 1HI0P 2JH3A 1X8DA 3OXFA 3ZZOA 3OTBA 3KJVA 2YWFA 2G0JA 2FY8A 1X5OA 4OZJA 3T9ZA 5HI7A 3C6TA 3I4HX 2ZH3A 5D4NA 2D3UA 1L3TA 4PPZA 1S7IA 1VLYA 4ZOSA 2WVEA 1HPZB 3I9ZA 3H40A 3UD4P 1EQMA 3IRXB 2V2ZA 2VG5B 3TAMA 2GAHC 1SKUB 2CPJA 1LKZA 4I64A 3G9CA 1VS3A 4QWEA 2IIHA 2QA4G 4FNHA 4TU7A 1P9QC 3D5MA 2ZVIA 2FHKA 4Y34A 5J2NA 1VJWA 3MEGB 2GVZB 4KO0A 3HSZA 1Y0HA 2DR5A 1NDKA 1C1CB 4ZCMA 2QJ3A 5BR8F 4L3KA 4CLSA 2QYGA 2YTCA 3DNCA 3I82A 4DPWA 4YDDB 4B9LA 2BQ3A 2XMTA 1JXEA 1PKUA 3A1YG 2AZ1A 1VFJA 3BPDA 4OYOA 1ITPA 3I5AA 1IUJA 2JEFA 1NDCA 5HATA 1OYDA 3KG4A 1UFWA 2EW9A 3CDEA 4HDHA 4A8FA 2R7VA 2G2ZA 3HXMA 2UVUA 3M8YA 4GVBB 3CMES 5HSPA 2IMOA 5FLXY 1Z2LA 3LP1A 4JP8A 2ASJA 4WZQA 4H4MB 3PRVA 1TL7A 4RBVA 3WDOA 1T9XA 4DUYJ 2JFKA 1RWVB 3BEGB 5SZTA 1JJ4A 2ZZMA 4RBTA 5KFZA 3D3CJ 3NGKA 5GMEA 5DLFA 2VDIA 3CD7A 1RLCL 3HKZD 5T41A 2OGUA 2HHQA 4F4ZA 1OIAA 4JV1A 1LWEA 1DTTB 5CZVA 1RAIB 1UFLA 1IVZA 3FZBA 5ETPA 3FSXA 4TYAA 2RUGA 4Y00A 2PI4A 4I69A 1Q95G 3KK2A 1U8SA 2PMWA 2V8VA 3A13A 4J9UE 4LF2A 4U8VA 5BYSA 3KHRA 4DR2J 4FVCA 3DI6B 3EVOA 1UVNA 4NLDA 1H74A 5J1EB 2MY7A 1FVQA 4DEZA 4ELTA 2DRDA 3OXGA 3MEKA 2M2BA 1XR5A 4J9MA 5AXMA 4JYAJ 3AY0A 1TP7A 3C14B 2AYMA 2W9CA 3LGHA 4LSZB 4C48A 1OQ6A 3G8TA 3HDSA 3JTPA 5A2QU 2ZE2B 4DR6J 3VR1A 4JI7F 4NA2A 3IC1A 1RACB 1F9HA 2AYEA 3AJ1A 4ZPAA 4DPTA 1LEOA 2DPIA 4DR4J 2J0XA 1JNZB 2HBRB 2FJBB 2HG4A 2RDIA 2CWKA 2JZ5A 1SKWA 1SUQA 1APSA 2GIFA 4U95A 5DRKA 2IDLA 3HPOA 1OY8A 1AW0A 2NYIA 1JLBA 1SVDA 5CYQB 2ZD1B 3CDWA 2AX0A 4J5OA 4LMZA 2VKZG 2EFQA 2BKNA 4ECWA 3MM5A 1SL1A 3SYZA 4X62F 3AQOA 1LFWA 3BDEA 3ENWA 4QWDA 1JLEA 4RW4A 5D0GA 3DGPB 3HHDA 5E5NA 3ICLA 4FF3A 4C98A 4F4XA 2RRAA 2RQ4A 2VICA 4JI2J 1GXLA 5H9EK 4CO4A 2RD5C 4X2BA 2QLBB 4LSLA 4NI2B 2DGVA 3V2UC 3VV2B 3K58A 4HT7A 3VGTA 2MZJA 2XCPA 1DLOB 1V5VA 2HZCA 1BC6A 2C2KB 5DQHA 3P5BP 4RNFA 5GMKa 2AZ3A 3ILIA 4X64F 2ZH9A 4J9OA 4NCGB 1JLGA 2M88A 4DF4A 1NSPA 1MROA 2ZH4A 2W2QP 4AL5A 3BF4A 2P8IA 1I94F 3MPUB 3LP0B 1FNXH 3MCOA 1JLAA 1CC8A 3B8HA 4L73A 3QRQA 4M95A 1JK9B 3GR1A 1KONA 3K5MA 3QFHA 1BD6A 4AXIA 2P2CB 3FEXB 2FY1A 1VQMS 3IXQA 3VGSA 4B3MJ 2FJDB 1UPPA 3TEHB 3QO9A 4PR6A 3MCNA 2HURA 4EBCA 3MF5A 4WYWA 2L41A 3T1AA 1DY3A 3QGHA 4DSFA 4LQ9A 3PYGA 3J81U 2KH9A 4QU7A 1O5JA 3MXHP 3NGTA 1IM6A 2HGNA 1PAEX 2HHHJ 4F2RA 2E66A 3LP2A 3H4BA 5KT5A 2ALZA 3IGVA 2VV5A 4LF1A 3CJTA 3NMRA 3DLKA 3S6EA 4QWAA 3T1YJ 1WF1A 4JI8F 3NGUA 1TL4A 1WWHA 4ZCLA 2HVEA 2DNHA 1REVB 2GGPA 3FFIA 2F63A 5KG0A 3GLJA 5KFJA 3EYZA 2XLJA 2LKZA 1ZZNA 3CULA 1DFDA 2XHCA 2D41A 2HWHA 3CO9A 1L5UA 4K50A 4W4MA 1VISA 1FI4A 3DOMA 4FNIA 4NOHA 3M9OB 3QGIA 1RHRB 3G82B 1YRTA 2BJDA 2DHGA 2VODA 4B3RF 4CLPA 2V2KA 2WVBA 3DKDA 2RDJA 3FSYA 3UQSA 2AJ1A 4ETXA 4B3SJ 3EPGA 5ETRA 1JWWA 4FS2A 1WDTA 1UJ4A 4OX9F 2V9WA 4K0KJ 1XEZA 3QT6A 3QIPA 1S1XA 2DH9A 2HBYB 3PKMA 1FX4A 4R0EA 1Q8IA 3GJRB 3WQPA 2KXFA 2KHCA 3KLHB 2NSCA 3PXGa 1NK6A 2XSJA 9RUBA 2IMWP 1HW9A 4WP8A 1RAEB 2M4MA 1X5SA 1ROFA 2FQQB 3ITHA 5D6GA 4RNHA 4H4KA 4LF8F 1KVIA 5EX3A 3P8BB 2HVHA 4RNMA 3MM8B 3SI8A 3AT1B 1RISA 2MZQA 4EU0A 1CLFA 1UWBA 4I4BA 1TL5A 3UVJA 1T9TA 2FJEB 4YB5A 4DL5A 4IG3B 4ECZA 2C2DA 4MFBA 1P1TA 3R5BA 3LP0A 2NXCA 4JBCA 1F9FA 1OY6A 3QZ8A 5F8LA 5L1IA 4IG0B 4RW7A 4X65F 1S48A 2LXIA 1FHTA 1Y3JA 5D0RA 3UI3A 1A6LA 1KQGB 4Q8EA 1YITS 2MEWA 2WAQD 2JDJA 1WF2A 2HRUA 3GE9A 3CJKA 4DUTA 1NK5A 1R31A 3TUPA 4DQSA 4K4SA 2EKYA 2LDYA 1FJEB 3GMGA 4ZVEA 5T7LA 1T05B 4CLFA 3NCRA 4TU8A 5GAGI 3O3LA 2IVFB 3LGNA 1G6BA 1LFPA 5U47A 2MQOA 3Q8SB 3GIIA 1RAFB 4LBPA 5J2NB 1VIOA 1S79A 4PXDA 3EZ5A 2MKCA 5KFUA 2CPZA 2LQ9A 4IFYA 1VC0A 2QL5B 3ISZA 2LEAA 1OYEA 1JJHA 1VRUA 4ZPTR 1EX8A 4UF4A 2IPOB 2BJ7A 3K5PA 4H54A 2NYHA 4DPUA 2B7BB 3FFIB 3HFZB 3MECA 3W64A 3KFWX 1XNRF 2ACYA 3IR5B 1CSJA 1FERA 5E0OA 1YKWA 3VAGA 5KFOA 1QVGR 1X4BA 2ZFHA 4QIGA 2C2OB 1VYAA 2F3JA 3HJVA 4PABA 4AYBD 1BUXA 3WX8A 2XB2D 3MEDA 5A8WB 5KOXA 1YIJS 4C6AA 3TZXA 1GMUA 5L39A 3LA0A 3SCKE 1CQNA 1SJQA 3TVZA 3TNVA 5HROA 3NXZA 3PYEA 2P6TA 2N3OA 5F9LA 4DG1A 1FE0A 3CO0P 1R8AA 1VK8A 3H42A 2R7SA 1T05A 2KFNA 5F8JA 1XR6A 1UVJA 1GMWA 4RW7B 2QX0A 4B3OB 1WKKA 2B9WA 3HKWA 3IAS9 1YTYA 2YNFB 1WI6A 2AF6A 2HAIA 4WJBA 1VQ4S 5DGAA 2GMJA 2ZKUA 5EX0A 1WUUA 3UVJB 3K89A 5ETVA 3W9HA 4DL6A 3TZYA 3OJUA 3L7OA 4AFFA 1UFKA 1UPMB 4K7QA 3LO3A 5KFHA 1HBNA 5BJRA 2WVFA 1S0MA 3H2LA 1XNQF 1UVIA 4JI3F 2XI3A 1O51A 4NWBA 4O3NA 1OS5A 5KFWA 4J9PA 5T14A 4ILMA 1S57A 1NB2A 1SH0A 3DLEB 2Z57B 1UKUA 3DU6A 1F60B 5F0UA 5KFGA 1YBAA 1VQNS 4P71A 1NUEA 4YP3A 3BREA 4MMOA 1HBNB 2J9DA 4OI0A 3Q8QB 2E5GA 4P73A 2QA2A 2COLA 2W7PA 1PJ6A 2YWGA 1EJ7L 5F41A 3NNCA 2XM3A 3PFEA 2V67A 3UD5A 1M5PC 4UOHA 2ZWPA 3SZ2A 1SQGA 1VJQA 5CYQA 2K06A 1RTJA 2IYIA 4DI6A 4CTAA 2VBYA 1RABB 4J9VA 1R8BA 1YRXA 1MWZA 2FZKB 5LMUJ 5F3TA 3MCSA 3NAIA 1KC8T 2DK2A 2RJZA 4WZMA 5DDRC 4CLLA 3GYNA 1GX5A 4O4GA 2H5JB 3CD6S 4KHPF 4HI1A 3OTCA 4LRBA 5C25A 3GIMA 1YGYA 1REVA 1TUWA 1WKJA 5LJ5Y 1S1XB 2N82B 2WBMA 4PXEA 5ETTA 3LW5C 4ES3A 5A8WA 2R7WA 2B0GA 4MKAA 2R7RA 3NNAA 4O4GB 1IKXA 4JOUA 1PO6A 1P9YA 2AMCB 3AOAA 4NYOA 3DLBA 1AYEA 4LF9J 2CQBA 2AX1A 4CLUA 2XLIA 3OTDA 2NSBA 4IRDA 3HZGA 3M2RA 4DL0C 5E33A 4OV6A 2M5YA 5B0GA 1QVFR 2OH2A 4ATNA 2ZM6J 1RT4A 2VH7A 1BQXA 5DLGA 1V3ZA 1EETA 3H8YA 1D8ZA 1FRLA 2IDEA 2J76E 4Y3CA 2VFTA 4V19J 2FLOA 1SIWB 3TA1A 3VQTA 5K9FA 1RA6A 9ATCB 1NEEA 3K57A 1Q0NA 5CXTA 1FXLA 4M1KA 2ZH6A 3FBCA 1PILA 5DG8A 2W9BA 4Q0BA 2NPFA 2VASA 1JJCB 1JLGB 1TL7B 3AJ2A 2U2FA 5A6WA 4OI6A 5T7LB 2Z2LA 3TX0A 1YHQS 3PW0A 1GK8A 5KFKA 4HHHA 2C2EA 2HHTA 4YQWA 1RHJB 4HH1A 3BJYA 1AFJA 3AXKA 1WEXA 1AT1B 3HHLC 4MAKA 4PG7A 5KFFA 2AT1B 1T02A 2BOPA 2JEJA 2DT9A 2I2YA 2JX2A 4OMFG 2ILYA 1XJWB 2V2QA 2W8KA 2HFSA 3ZTOA 1RHKB 5J2MA 1GXTA 5F8NA 2YWKA 3NP5A 3NLCA 1PG5B 2IFXA 2IVMA 5HROB 1HBMA 1R8HA 4PG8A 2APOA 4Z7CA 5LXYA 2BE7D 4ZVGA 3TOQA 2AHOB 1Q79A 2CNLB 4I6AA 4J9QA 5H9FK 2GV1A 3KG1A 3QGGA 3SFUA 1YQHA 2LU1A 2ADCA 2VF3A 1RLDA 3ZFVA 1SB6A 3W9IA 3AODA 2MB0B 3N9UC 3OR2B 1QD1A 4LT6A 2BACA 4U9RA 1T94A 4NLXA 3M8SA 4DLGA 3DLJA 1NH7A 1RT5B 2CJKA 1OQ3A 1H7WA 4GC7A 3KNAA 4X4TA 4U7UK 1A9NB 1CVJA 3T3FA 4QQBA 4DXLA 2IAJA 1RWMB 2JLFA 4DR4F 4KHRA 2MZ1A 3C8YA 4OX8A 4BHQA 2UV8G 3CCRS 1MLAA 1IR1A 2ZC3A 3PYDA 2EKNA 1UVLA 2OI2A 1OMSA 3NL0A 3GJSB 2QZ8A 4KIAA 1TL3B 4NPOA 4NZ7A 4Q7AA 5IV4A 5EDWA 2QFJA 2P6SA 1M5KC 1RT2A 1C1BA 1RTZA 2VOPA 4BDPA 4EZ9A 4K59A 2H3EB 3MMBA 1S1WB 3SCLE 4EMDA 1MWYA 1RZMA 4X62J 3H0PA 1U1RA 1FDDA 1FD8A 1G4CA 3BH6B 1QAJA 3THVA 3MOJB 4M5LA 4JI2F 5AE3A 5B0CA 3PY8A 1QLNA 3FEYB 2OHDA 4DV4F 3JS9A 2A6OA 1RA7A 3LP1B 3NRBA 4LR8A 3JAMY 1UWBB 4X4OA 2DGUA 3MTJA 4X64J 2CFXA 3GR0A 3MM8A 4ECTA 1XIQA 3VAMA 1U6ZA 1SQFA 4LF8J 1WJ9A 2ZH8A 2FZGB 3KLFB 1D0EA 3D2WA 1I94J 1BQMA 2L08A 1I6JA 2BJ9A 2EEYA 2UUAJ 2DNYA 3PDNA 4ZLNA 3PW4A 4DV2J 4CH7A 2WTFA 2CJQA 4OI4A 1BMQB 1N8RT 4ED1A 8ATCB 2MKIA 2VG6A 5G0RA 1KSPA 1N32J 3TZZA 2MMYA 3VF0B 4B3MF 3SV3A 4I67A 4WK1A 4LSLB 1WC5A 3RJMB 3KHLA 5CQGA 1RADB 1TELA 1D3WA 1FXDA 1WHYA 3K7RA 5CH7B 2GHPA 5A8RB 1M0SA 2MKKA 1ICEB 4IQMA 1FTRA 3UE2A 5KT2A 1U4BA 1Y4ZB 1U6BA 3M8QA 5C2GA 3IRXA 4HL9A 3KYLA 1NJIT 4BLGA 2GJFA 5HN0A 5HMWA 4NASA 1BQNB 4JI8J 2R8GA 1Q4RA 1K8AT 2V69A 4UY8T 2HSEB 4RBUA 3BGUA 3JQMA 4DR5F 1A7GE 1FA0A 3KK1B 1H7XA 1U1QA 1D9AA 4U7UD 1UEUA 1T0TV 4L76A 3Q8PB 5C24A 1NSQA 2KG1A 2CQ3A 2Y1JA 3BSNA 5ETSA 1JIHA 4B08A 3FBEA 3ENAA 1O8BA 3CCZA 4F4AA 2H5EA 3KG0A 3TQEA 1CJUA 1NXIA 3GPAA 4QIEA 5IQ6A 3RRHA 3UN3A 3UCZP 4B3SF 1U0SA 1JB0C 3UPFA 4Y6IA 4OX9J 4J9NA 4Y2MA 4N41A 3AAWB 5CZXA 4Z37A 4ECQA 1TVRA 2VKRA 1YK9A 2DXFA 2WONB 2Z4PA 3JQKA 3LTOA 4DN9A 4O3RA 2BA9A 3X3UA 1P27B 5M2PA 3QSIA 1YX2A 3NBPB 2ZNZA 3PRBA 1UW4A 1K73T 1Q16B 5IT9Y 2F8HA 3KK2B 4P2SA 4L6V3 2N7YA 3IR6B 2JC1A 3FCWA 1U09A 3EVMA 3OD2A 1QSYA 5A8KB 3JSMA 1EP4B 2P9EA 4BWMA 4PYAA 5JVGQ 3MD1A 4UW2A 1EKRA 1LWEB 5ITHA 2R7OA 2IBOA 2NXNA 1RAAB 1S6PB 2GA7A 4QWBA 3CJKB 5B08A 4PXBA 2NUUG 2ZHAA 4OIXA 3JB9k 4OV1A 4E8UA 1F5BA 3J7AN 3F73A 2DVIA 3TA2A 2HPUA 2B56A 4FVMA 3CC2S 3WZ0A 1YI2S 2WVCA 5D3GB 1H72C 1R0BG 2FIUA 3DYAB 2ZZTA 3EGWB 5GAHU 1Y00A 3MM6A 1YJWS 1G7CB 2RE1A 4J90A 1KNZA 4K8RA 2F8MA 3TUJC 3W9JA 2YKQA 2ZD1A 4P74A 2QFIA 4DV6F 4DR3F 4ZPWR 2LXFA 2BR0A 2IRXA 3ETMA 2H65B 2JFDA 4DQRA 4ANEA 4IR1A 3H5XA 5AXLA 4IQXA 1YJRA 3HFVA 1JXVA 2AJ0A 4FDFA 4L75A 3CJSA 5L1KA 4EYIB 3W8GA 4OLOA 1VR6A 3IWXA 1RCXB 3HMJG 1YWXA 3UWTA 3KTQA 4NCBA 3HHNB 1GFWB 2MZSA 2I5JB 2KB2A 2L9DA 4XK8C 1LNQA 1RYRA 3RUBL 2OP5A 2GIRA 2VJUA 1HQEA 2DXDA 3MTKA 3DC2A 2ZNYA 2HBZB 1K1SA 4ZLJA 2Z2MA 3US5A 5MAOA 2RHQB 4ID8A 1VIXA 4AL6A 1H2VZ 1G3OA 1SKSA 5KFNA 2J9CA 2V50A 3PFOA 4ZLLA 4U7CA 3J7A1 1Z2ZA 1XBWA 4R25A 4QIWD 2W2NP 2EFVA 4KKOB 2ZJQQ 1CJVA 2ZDPA 2DRBA 3IA0A 3DHWC 3QT7A 5KFIA 1RT3B 1YZ7A 2UXDF 3KMQA 1I1GA 2KRBA 3I0RA 4DPXA 2XY7A 2Y1IA 3FBBA 2V5HG 2YNIA 1TK0A 3W5YA 3M30B 1T9WA 1YBTA 2RU3A 3C6TB 1NK0A 2H9ZA 2HZAA 2XMKA 4ZP9A 1Q81T 1K0VA 3FJ2A 3CE8A 3RR7A 3O5TB 2FUG9 4RZRA 3V6HA 2CQDA 2M70A 3LWMA 4EO6A 1NHVA 1NK9A 2D3OR 4DL4A 4BBYA 4QR2A 3IAM9 4NEZA 2KN4A 3BB5A 2W2PP 3CCUS
chains in the Genus database with same CATH topology
2GCFA 5B0BA 2LEBA 2RSQA 3B82A 1QE1A 3LH2S 4NLRA 3Q8RB 1UEVA 2HNZB 4AUKA 5KFCA 1Y3KA 4O3SA 1TKZA 3DXSX 2E1RA 2OIHA 1P6TA 4LFBF 1T03B 2I38A 3IG1A 3HFKA 2VOOA 4UUXA 3HZEA 2OD4A 3OR1A 5EUHA 3H98A 4TQRA 4QPXA 2C3PA 3S7RA 4NLOA 2B3TB 5KOWA 4C8MA 4QU6A 2WB1D 5BYQA 1QSSA 4XPEA 4Q2MA 2DD8S 3M8PA 2K2PA 4DQIA 4XO0A 3JYTA 3GSDA 4HTJA 5B7WA 1HD0A 1T3NA 3I6PA 1KLNA 3N79A 2MQNA 2M0GB 3ULHA 2V4JB 5SUHA 1S1VB 5LMUF 1RTIA 3OUYA 4DJBA 1VQ7S 2GJIA 2LMIA 3SMZA 3OVSA 5KT7A 2CJAA 4KV8B 3H4DA 3DMJA 4TYBA 4DL2A 2KTQA 4OJHA 2R9LA 3U7JA 2WSCC 4FBTA 1RP5A 3O1LA 3HVTA 4C4WA 1S9FA 2B4OA 3SQGB 4YMEA 3V6DB 1B0VA 2MJNA 3M6VA 4HI2A 3CC7S 6FDRA 1MMNA 5CYMA 2UZAA 4WFBQ 4IR9A 2ABYA 4LF9F 3BR9A 6FD1A 1NNDA 3CDUA 1WTFA 1N34F 3HM9A 4IFVB 4JI4F 1R89A 1TKTB 2LVWA 4ECVA 2ZM6F 1SJ4P 4ALZA 4C8ZA 4OHYA 3IGNA 4NLYA 1PC4A 1E6VA 3TUIC 3PACA 1UAWA 4RU9A 1FKOA 1T7PA 3DI6A 1HWLA 3D28A 2MHEA 1IM4A 4ID5B 1R0AB 1X0PA 1ULRA 2RF2A 3T5LA 4PG5A 2OFHX 1X0FA 3U02A 1VC5A 3MMAB 4IH6A 3CF5Q 4C8KA 3RB0A 2ROEA 2KZMA 2WBRA 3UDLA 5DQGA 2VBXA 1FVSA 2HYIB 1U48A 2OPSB 4K2XA 2Y0SD 3FMWA 3P5TL 2KXHA 3CCES 2J7UA 4EO8A 5DDPC 3MUTP 4DSJA 4K4XA 3PV8A 4URSA 4IUFA 3AA9A 4CZCA 4F4YA 2CQCA 1OPIA 4TQSA 3W3SA 5K8OA 2PDAA 2AYGA 1U24A 2P9GA 2VONA 4QCLA 3OLAA 2HNYA 4ID5A 2DO4A 1OWXA 1WHVA 4EBEA 3SEOA 4ECYA 1IKVB 5FIIA 2XNRA 4USHA 1OO0B 3JTNA 4IOBA 5GAHI 3QWUA 1C2PA 2OJ3A 1VRTB 3SXLA 2MSTA 2KT2A 4OI1A 4IFVA 4BC7A 5GAGU 2W7OA 2XSFA 3VQSA 4IO1A 4YFUA 1QJHA 3L09A 3NAHA 2NLWA 1VC6A 1DQAA 2UUWA 4C0HA 1FESA 2D74B 1DRZA 4AQYF 3AQPA 5KAKA 1S9EB 5KFTA 3G96A 4DV5F 2FJVA 1VQOS 1WD6A 2E5JA 3K8VA 1SV5B 1T95A 2JLGA 4J9KA 1G2EA 3TVYA 1V3RA 4F4WA 4K4VA 2MKSA 4ICLB 4CO0A 1X4DA 3OHBA 3CDBA 2LQBA 3QAUA 4TKTA 1J5OA 1WACA 1NZAA 3KHHA 4LFCF 3M2UB 4NZ6A 4TN2A 2O66A 3JYTB 4PWDB 1DURA 4TXSA 3JSRA 5KFXA 4K4UA 4R8UB 2CVIA 2ILZA 3JSMB 2EFOA 4YR3A 4NRTA 2PGCA 1U25A 2QSFA 4H4KC 2X51A 3SCJE 3M2VB 5M2UA 3MR6A 2X1AA 2GQQA 2UUAF 4LF5F 1GTEA 2HS3A 2U1AA 1VGYA 5A6PA 4DV2F 1CC7A 2XBPA 2GHWA 4FXVA 2MKHA 1GXUA 1FKOB 1N32F 3CD0A 4ZP8A 2DH8A 3GFXA 4ZPBA 3THTA 3AH6A 1XK8A 1U45A 2DR9A 3KNGA 1ZYQA 2CIMA 4J9SA 4DF8A 4B9VA 1E6YA 4URGA 1U1LA 1RT1A 3THPA 4LSNB 3DRRA 2N4DA 3R5AA 2DGWA 1U1KA 1UA1A 2DNKA 2CJ9A 2M52A 4ZDNA 3GV5B 4B9MA 4WU3A 1S9EA 4CNYA 4RW9A 2ZHBA 3QYYA 1XMBA 3ZZZA 2PA3A 3HT3A 2QA4S 1N5YA 2FHJD 3W2VA 3MM9A 5HLFA 3NS6A 4ES2A 1RT3A 1WG1A 2DJWA 2J7WA 2YQ3A 5IM0A 1Q86T 2VBWA 3TRGA 3T5KA 3I0SA 1S6UA 2W9AA 4QWCA 2UU9F 1HW8A 1Z4UA 5LMNF 4KGMA 1IJEB 3VCDA 4E98A 4N8NA 2OPPB 3OFEA 5D78A 3I5BA 2YH1A 4A8XA 4OZ1A 1VQLS 1HNVA 1TQLA 3CCTA 2IYGA 3HF5A 2XHWA 2MQMA 3RBDA 3D1HA 2UUBF 1LK7A 2BM0A 2C3MA 2RRBA 3EGNA 3O8WA 4TNOA 4ZVHA 2OPQA 4OJGA 2NUHA 2J7KA 2CPHA 4OHZA 2XI2A 2X1GA 3RRKA 4C11B 1TKZB 2UVRA 5EN1A 3SSSA 4RW6B 4NXMF 4KR0B 4OFZA 2XZWA 4CQ1A 4WKYA 3MM6B 3M2VA 2HLTA 1FRIA 1S1UA 3NG8A 4K4ZA 2M9KA 3DYAA 1W25A 3HHLB 1D1UA 4RX6A 4FF4A 4AE5A 4YOEA 1M5HA 3IR7B 4LVOP 4PUOA 3PNIA 1ZH5A 1LWCB 2ZH1A 2AGOA 3E01A 4NLGA 2V4QA 2A18A 3DM2A 2GQ2A 5H1SV 4C3MA 5IZHA 1TFYA 2EK1A 4C0OC 1TL3A 1KFSA 2LA6A 1IKYA 3LGMA 2UXBF 2HWTA 3CMAS 5CYJA 4ILLA 3L95X 1DAXA 3CUNA 4P7TA 2IAJB 3N0VA 4GKKF 3H5SA 1S77D 1N5TA 2BJEA 3LANA 1WTBA 2D9OA 3E8OA 1HMVB 3V5RA 5J2PB 4D3HA 4XDDA 3Q24A 4DSLA 4NLQA 4A8YA 4DDFA 1JLCA 2FDNA 4KV8A 4RKUC 1TK5A 3NCPA 3TO8A 2MSSA 3UR3C 4DFMA 2FB0A 2W7AA 4LF6F 1XWLA 3OTOF 1HBOA 4RW8A 3OTEA 5D4PA 1N5VA 3I31A 2J5AA 3B4MA 5CCMA 4K4WA 4WK3A 4KC5A 4JUZA 5HO4A 2FJAB 5KFAA 5C5JA 2DTJA 2KVIA 4D3GA 1HBMB 4LJMA 4KQZA 4ZKAA 2NZ4A 1ZM2A 2E7WA 4CI0B 4IDKB 3OBIA 2HGLA 3F56A 1BWEA 3Q23A 1HQUB 3RB4A 1RTHA 3GIJA 3DM2B 3HI9A 2XEXA 2G9OA 4NZ0A 5I3PA 2CQ1A 3V4IA 1IR0A 2VG6B 5G0RB 5KG4A 4QBUA 1PGZA 4LF4F 1GQEA 4UY85 1M5OC 2FVRA 3HHLA 2FVPA 3I32A 3RYLA 3BSCA 5E3CA 4HYKA 2W8LA 4QJVA 2OKQA 5EHHA 1NB7A 3N6MA 5F3ZA 4PG6A 4A48A 1FD2A 2GX8A 2K3KA 4YUDA 2MHNA 2GC8A 1NK8A 3H20A 2WHOA 1OSCA 2PA8D 5D4OA 3QAEA 4UQTA 3M9MB 5DDOC 4MK8A 5D77A 4C8LA 4ILRA 1AFIA 2W25A 1YG0A 3N4WA 1UVMA 4TLQA 4JI5F 2MJUA 1S1TA 4HHJA 4DPOA 4U6PA 2ASLA 4LF7F 1KHVA 4ZMMA 5JJBA 2BRLA 3GFZA 2YNGA 1HI8A 1IKXB 2JWNA 3QJJA 5I3UA 2PMZD 2FVQA 5FJ4A 2XWXA 4I7FB 4Y2CA 4C0BA 3J7Z5 2HIQA 3QWPA 2BANB 3PIOQ 2R2RA 4DR7F 4I56A 3MI7X 5C25B 2KM8C 2YNHB 1BLUA 2J6SA 3Q22A 1ZM9A 5HMXA 5AE2A 5IT4A 3CB4A 2XY5A 4I6WA 4R5PB 4CO3A 2RNEA 3DU5A 1KR4A 1RTJB 2ZVSA 2Z0GA 4O3PA 2LU2A 4MJKA 1FDBA 5KFRA 4LSNA 2O5DA 3GZ7A 2D9PA 2QE5A 3QGPA 4OX6A 2OFGX 2DB1A 3D0IE 2RQMA 5D3GA 2JRSA 2DNZA 3I96A 2M7SA 3H5YA 2YKMB 5C42B 3D0HE 1IKWB 5K8NA 3BQ2A 1FJ7A 3SCIE 5HQ8A 4A8SA 1ZZFA 3IRWP 3NS5A 5KFLA 4KRWA 3BO4A 2E5IA 5E3PA 2IA0A 1NJYA 2KM8B 2FLPA 2NREA 2BVZA 3HO1A 1B7FA 2OMLA 2KXNB 2D7SA 5F9NA 3CWJA 4CH0S 1H6KX 4PQUB 5F8GA 3Q2SC 3LF0A 4L72B 2Q6CA 4WFZA 2CQPA 1VQ9S 5B09A 3J7YU 2XNQA 3MEEA 3CCSS 2E9ZA 4EEYA 2N4CA 4ICLA 1FTCA 2VQEF 1RYSA 5AXKA 2GFFA 2XWYA 1L3SA 3MHYA 4ED2A 3KLGA 2VG7A 1FRJA 3DRYA 3N28A 4G1PA 4ETZA 4N56A 2EVZA 4J37A 4QYRA 4DOZA 5KTQA 3NBPA 4DV0F 4M5DA 4CT9A 3HVTB 1XERA 3IWLA 4LUBA 1B0TA 2DGXA 1DTQB 3CGIA 5A2QY 1HHSA 2VFSA 5DO2A 2Q6BA 5I3QA 1RT4B 4IRKA 1FRHA 3OVBA 2CQHA 3M2RB 2X3GA 4BWJA 2A10A 4NCAA 2KU7A 3J7ZT 4ZPCA 2IJNA 3ZC4A 2HS4A 1MMDA 2Q3PA 3KK1A 2E1MC 4IO9Q 3M8PB 2HHUA 1U1MA 2DH7A 2C42A 4Q8FA 3TARA 1H0HB 2DIVA 4I2PB 2CVEA 2J0WA 4N8OA 4TY8A 2PIIA 1B0PA 2DHXA 3DHXA 1X4CA 2BM1A 4Q2LA 2CQIA 3IFEA 3MURP 4FF2A 3HX9A 1YJNS 2I5JA 3LWLA 1R6YA 1NJZA 4NX9A 3M8QB 5L1JA 2IHR1 2AW0A 2MPUA 3S1TA 2MGZB 3I5CA 3IG1B 3I56S 3MPYA 4HT5A 4WF9Q 2G13A 2ZOGA 4IG0A 1NO8A 3KKFA 1FK9A 1YRUA 7FD1A 4N5SA 3RAQA 2ZC4A 3DLHA 3PO5A 3FRYA 1FEHA 4XAKA 2B9YA 3MR2A 1KN6A 5M2RA 4OI2A 3WX4A 5GADU 3RR8A 1TFWA 4Y2IA 2QLXA 1HYSB 3T5JA 1U49A 2HHWA 5H9FJ 2QYCA 4F50A 3PX0A 1F5CA 3PX6A 1UA0A 1NKEA 2QLWA 2EBEA 5KG3A 4N47A 1HL6A 4QZVB 1QSLA 1URNA 1KOHA 3POTB 3KLHA 4WFNQ 3BGRB 4ZPVR 1HNIA 4ECUA 2QO3A 3NL0A 1EP4A 3M30A 4NLTA 4XIUA 2DNPA 3W2WA 4C9DA 2HQIA 2OSQA 2JEGA 2QIFA 2FHMA 2XGQA 1GNKA 2ZJPQ 1NJWA 1WHWA 1NK7A 5K14B 3J80Y 2M8HA 1PSDA 2IVYA 1M5VC 2ZH7A 2F4VF 3UR0A 3G6YA 1Q7LB 2KKHA 4P6QA 2XS7A 4NL5A 2F9DA 3SDEA 4Q44A 4JV2A 3J81Y 5EGYA 2C28A 1TKTA 2B7CB 3VWSA 4Z2XA 2V4RA 1NJXA 2CPYA 5F8HA 1ZPVA 2NXUA 3CCVS 1KRPA 2WB4A 3HK2A 4ED3A 3CSKA 5GAEU 1WG5A 3BGFA 1GX6A 4ZP7A 5C24B 3TYTA 4WCEQ 2PSZA 1VOMA 2VFVA 1N36F 3OQ2A 2AJ4A 2R8HA 1FRMA 2WK4A 2YX1A 2DIUA 3CIZA 2CPIA 2KJVA 3FSIA 3QO9B 3MECB 2XLKA 3PW5A 4WU2A 1LXNA 5DS7A 1IXKA 3ISNC 3MR5A 2ASYA 1VBZA 4QYZJ 3TX8A 2DGTA 4F4KA 5J2QA 4LFAF 1NHUA 3FZ2A 4RNNA 1JLAB 2ZZNA 2OD6A 2OPRA 3EX7B 3PJWA 1R8PA 4OJ3A 3BQ0A 3DLEA 3GILA 4XDCA 5KG2A 4I1TA 5KT3A 2V8HA 2P5VA 5I42A 4B17A 4TY9A 2MQLA 4KAIA 3M8RA 3TANA 1X4EA 2HNDA 4DR1F 5KFDA 5I42B 1U1OA 1S0NA 3V4MA 1NAQA 2MYFA 1Y5LB 3ZZTA 2UP1A 5GVQA 3K5NA 3DRXA 2R2TA 1FJCA 4FZVA 4F3OA 4B3OA 3JTOA 3K5LA 2PC6A 3PW7A 2Q79A 4NLSA 4IOCQ 3QLHA 2K3IA 1EETB 2GMLA 4A8WA 3CD5A 3OJSA 5KFSA 4MKBA 2LLZA 4X4QA 2B5JB 4X4PA 3DXBA 4XPCA 2YWEA 2YH0A 3ITHB 1BY9A 3TI0A 3MMCB 1FF2A 5DG9A 2QEXS 2R4FA 4YY3F 3FDSA 4NYPA 1C1BB 2KFYA 3DOKB 2ZITA 1X9WA 1CG2A 1FE4A 1Q78A 5HMYA 3I0RB 4G1QA 2OMOA 4A8KA 1BQNA 3ZZ0A 5KFVA 4B02A 4RUHA 3L3CA 3WBZA 1G1XA 2PO4A 1IBKF 1TR0A 1OSDA 3FCHA 4NA3A 3ZZRA 4DV7F 1HNWF 1DQ8A 3PEHA 2VA2A 4CTAB 3R5CA 4MKYA 2E9TA 4IFYB 4I68A 1R8CA 4WYLA 2A2DA 4ED7A 4A8OA 2LCWA 4F3MA 2LXUA 5HMZA 3EXCX 1DTTA 2F1FA 5AJ3F 1N0UA 2CZ4A 2HHSA 3S8SA 4A8QA 4RU2A 3KLFA 3CCWA 5F8IA 2HQ3A 2FLNA 3DN9A 2PD1A 3N6NA 3N5FA 3KLVA 1S6QA 3M6XA 3EUNA 2FVCA 4MFBB 5K8MA 2AD9A 3G71S 2ATLA 4H4OA 3X1LB 2VC0A 3D1QA 1U26A 2OTJS 2YWHA 3ZZYA 1VI7A 2FHOB 1L3VA 1KTVA 5LSRA 2J9DE 3GYXB 4N76A 2AJFE 1FXRA 4YB7A 2O1PA 4WXOA 4LIWA 4WXWA 2XSJB 1XMQF 5EWEA 4AL7A 3UNGC 3PZPA 2JSXA 1WNEA 2CPEA 3T6BA 1TKXB 4Q0BB 1DLOA 5K5MA 4KO0B 2EBGA 4QIVA 2VFRA 1JNRB 2YNFA 3JSBA 3QZ7A 4I0WA 4EBDA 1S0VA 3H2VE 5EWGA 2R7UA 1WELA 3DGPA 1KS2A 1SJ3P 3RW6A 4JI1F 1VMBA 3FQLA 4A4JA 1V6HA 3MM5B 4MYTA 1WG4A 3N5BA 4K5SA 4DSKA 4N77A 4DUZF 4DL3A 4B9UA 4KTQA