1O51A

Crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
89
Chain Sequence
HHMKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative PII-like signaling protein (TM0021) from Thermotoga maritima at 2.5 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
molecule keywords Hypothetical protein TM0021
total genus 19
structure length 89
sequence length 102
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02641 DUF190 Uncharacterized ACR, COG1993
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o51A00
3TA1A 4C3MA 2XULA 3NCQA 1UKUA 1V9OA 1VHFA 4CNYA 2GNKA 4D3GA 2ZFHA 2ZOMA 2J9CA 4Y65A 4CO4A 5DRKA 1PILA 2DCLA 1KR4A 3AHPA 3M05A 2O67A 4D3HA 1UFLA 2V5HG 3L7PA 3AH6A 3TA0A 4E98A 2NUUG 3GSDA 4RLEA 3CE8A 1O5JA 1J2VA 2J9DE 2EG1A 4NYOA 3BZQA 3MHYA 5D4PA 1XK8A 4R25A 4RWXA 1NZAA 2GW8A 2VD3A 2XZWA 2E66A 1NH7A 4IYQA 5D4NA 4C3KA 1UL3A 5DS7A 4RWWA 4OZLA 4ZK7M 5D4LA 3X3UA 5D4OA 4WK3A 1O51A 2PIIA 4AFFA 3NCRA 4NYPA 4CO3A 4RX6A 4USIA 2GX8A 3O8WA 1NAQA 2NUHA 4CO5A 1UMJA 1VFJA 4CO2A 1GNKA 1QY7A 4OZNA 3T9ZA 2JJ4D 1P1LA 1V3SA 4USHA 1Q1KA 4C3LA 4YB7A 3N5BA 1V6HA 4CO0A 3OPKA 1V3RA 5L9NA 4YB6A 2NS1B 2EG2A 2XG8A 4CNZA 2XBPA 3LF0A 3NCPA 4OZJA 1HWUA 3AA9A 4CO1A 3O5TB 2RD5C 3AA8A 3HLUA 1OSCA 4USJC 3TA2A 4YB5A 3DFEA 1H3DA 2Z0GA 2CZ4A 2J9EA 4Y6IA 4WK1A 2O66A 2J9DA 1NH8A
chains in the Genus database with same CATH superfamily
2W4PA 2X1BA 3EPGA 1HFEL 1Y11A 1WSVA 4M5KA 3G8TA 3HHDA 4NLXA 3FCHA 2HFNA 1NB2A 4IQXA 4OHVA 3NGTA 1SUQB 5LSRA 2NCKL 2DISA 2OFHX 5AJ3J 4F2RA 1KNZA 1S7IA 3UPFA 2PSZA 4CO4A 5D0GA 2GO8A 1HNWJ 2XM3A 3G6YA 2VODA 1VMBA 3W7BA 4HHJA 4ECZA 3TAMA 4OL8A 2ADCA 1RT2B 2Z2ZA 4A46A 3MWBA 2JHEA 2CQDA 4QWAA 2ZWPA 4KO0B 3DOLB 2CNKB 3KNGA 3WIVA 4OYBA 4B08A 2V8PA 1D8ZA 2M70A 2ZZNA 1QUPA 5LJ3Y 4ERDA 5EWGA 3PZPA 1J2VA 2WAQD 5FLXY 3OJUA 3CT9A 1GXTA 2B9EA 1GXLA 3KHLA 5GMDA 4NLVA 2VG5B 5D4PA 2W2MP 2OD6A 3TJ8A 4CP5A 1XK8A 8AT1B 4YDDB 2W7OA 5IZHA 4R25A 1C1BA 1UZDA 2VDIA 2GCFA 4RW9A 2UVWA 3MEEA 3MDFA 3DXBA 4ZCLA 2VQEJ 2JVRA 2HWTA 2Y1RI 4DQIA 4LQ3A 5AXMA 1RAIB 1YZ7A 2V8VA 4DXLA 4B3OB 3LAMA 1D9AA 2PMWA 3HD2A 1JLBB 4H4OB 3AT1B 1FF2A 1PBUA 3H25A 2XSFA 4J5OA 4CT9A 2UUCF 2ZM6J 3D54A 2ROGA 4TNOA 5L1IA 4A8MP 2Z30B 1T9UA 5CCMA 1LV5A 1VBZA 2V50A 2IAJA 2UVRA 3CCWA 2Q1LA 2R2UA 1S1UA 5HROA 2GAHC 2HBYB 3PY8A 4AQYJ 3P6YC 4WP8A 1HYSA 2RHQB 1JJHA 1JKHB 4Q8EA 4WWSA 3T6JA 2YNGB 5J2NB 1AUSL 1WC5A 1F0XA 4OFZA 1NJWA 3K0JA 1SH2A 2LQBA 3OFHA 2R8KA 2UUCJ 3UN5A 2HMIA 3ZZ0A 1JJ4A 4DCJB 3NBPB 1DFDA 1V3SA 2RKIB 3VVTA 2XMUA 2PMHA 2GO9A 3D9BA 3EZOA 2K3IA 1U48A 1X9SA 2VB6A 5KG5A 1Q1KA 1N5YA 7FDRA 1VQ7S 4JI2J 3CXCR 3H98A 1VLYA 4KPCA 3VTIA 2NZ4A 4M63A 1NNDA 1F2HA 3BBCA 1IBKF 2WVCA 4QQBA 2CIMA 4Y2IA 1IKVB 1NK8A 5D77A 4DU7A 2CVIA 2DRDA 2ZBCA 1HI1A 3A3PB 4WIQA 4QWBA 3IRXB 5IXUA 4IDKB 3OV7A 5F9LA 1IKXB 1T9VA 2NS1B 4DV2F 1KC8T 3JTNA 2HHXA 3OTDA 1VRUB 4KGKA 3OTBA 4KYZA 4NA2A 2OPPB 3EGZA 2IC3A 2Y3YA 2ZWOA 1YJNS 2DKOB 5EX3A 3OUYA 4FP9A 1R8HA 4FYWB 4A47A 3KLFB 3G82B 3KLHB 2DRBA 2L48A 4Y34A 1RHMB 5D0HA 3FJ2A 1U45A 3HVTB 4R8UA 4C0HA 2YKQA 2OKQA 4K4ZA 2FJVA 1IBKJ 3IA0A 2ZD1A 1XEZA 3PO4A 3LGMA 1HBOB 1SCJB 3L95X 5KFPA 4RU2A 4DQRA 3MCMA 2ZBRA 1BQNA 1VJQA 2KI2A 3FBBA 1S0NA 1H3DA 1L5UA 4B3TF 3ZXWA 3QJPA 5IQ6A 2BRKA 3FC9A 2E1CA 5K9FA 2LXFA 1HD0A 3O1LA 3W8PA 4NZ6A 2GHVC 4OYWA 3RB4A 4B3MJ 3M9NB 2AYEA 2GGPA 1Q16B 3SZ2A 5IS2A 2ZITA 3SQGB 4NCAA 5CYMB 2V94A 1YRTA 4H4OA 4KGMA 4CLYA 3KLIA 3T19A 4DL5A 5DLFA 3P3DA 2CQPA 1RISA 5E3QA 3BQ2A 1RTJA 4OJHA 3J81j 3OBIA 1FK9B 3CIZA 5EHHA 3THPA 4DV5J 2KO1A 3TOQA 4I2PB 4PG4A 5K5MA 3F56A 2VICA 1L3KA 2WSEC 1HWLA 4H4MA 4LSNA 2BKOA 4R5PB 4B3RF 4BLGA 1N0UA 3BBFA 1U1MA 4DSLA 3HSGA 2B0GA 3J80Y 4O3QA 1DY3A 1X5PA 3AAWB 1TK8A 2YH1A 3EE3A 2V2ZA 3RUBL 1VI7A 4OQJA 1KQFB 1B64A 1R27B 2LU2A 2YH0A 3MMCB 4TKTA 1Q79A 4WXOA 4LT6A 2C3OA 5EX0A 2C28A 1C0UA 3MAAB 4ZVFA 1U1QA 1F3VA 4RO0A 4X66F 4YHHJ 4P2FA 2BW7A 5GAEU 1RJJA 1Y9OA 1TR0A 1T11A 2J8SA 2HVZA 4MK8A 3A8KA 3CDBA 5ETNA 3Q8RB 4DR1J 4P2SA 2FQQB 2N7YA 4U8VA 3F44A 4U96A 4C8LA 2A2DA 2ZBIA 1PYOB 4C8OA 3C15A 4A48A 3VVUA 4A8FA 3M8PB 2V4QA 2XTJP 2DIVA 3HT0A 2J6SA 5ETVA 2GQCA 2ZJPQ 3P5BP 4XDDA 1Q8IA 3IFEA 4H54A 5G0RB 1H38A 2DGOA 4OYIA 3OTCA 5D4LA 1H6KX 1HHTP 4OZ1A 5D4OA 3GYXB 4K5SA 1MW7A 4ZS6A 4IG0A 4ZP8A 3ULHA 3OFEA 2W8LA 1RT7B 2CUYA 1URNA 4OX7A 1WC1A 4WBFA 3TEGA 5IT0A 4FKYA 5FJ4A 3HJVA 2V8GA 1GMWD 2IVYA 1S49A 3MPUB 2BQRA 2G4BA 2XNRA 2MY7A 3DLBA 2CPHA 1HNVB 2YXLA 4LVNP 2GQQA 3OLAA 2DB1A 1RHQB 4DR3F 3DLLQ 1N5VA 2IM3A 3H0PA 1Y3JA 4I2QB 3D5MA 4R0JA 3GQCA 4NCGB 1RT1B 4M5JA 2WSCC 4ILRA 5EUHA 1UFKA 4RUHA 3V6JA 1VQNS 4ILMA 2UXBF 1S1XB 1HPZB 2RJZA 3MGJA 5L39A 2RAQA 2WW8A 2VKZG 4J37A 1VQPS 1IJFB 2GMJA 2EEYA 4C8YA 3MM8A 4DSIA 4QCLA 5DGBA 3NS6A 3OFGA 1RAAB 1LWFB 4FPRA 1SJFA 4QW9A 3O44A 4CM2A 1N34F 1ZM4A 2H48B 4OV6A 2QYCA 1Z2LA 4BS2A 2EKYA 3OPKA 2B6AB 5HN0A 1VCTA 1H74A 1TL4A 2G1HA 1QE1B 1XERA 2H1YA 2XMVA 4TYBA 5F3TA 3W65A 4DG1A 1HBUA 1T95A 1FRXA 1OMSA 3BGLA 1RA6A 3D6HB 3OTEA 2XG8A 2IVMA 4USTA 3NEKA 4ZKAA 5HVHA 4FF1A 1PSDA 4RBUA 3NMAA 2XBPA 3OLBA 1U09A 4NLPA 3DRXA 1HWUA 2RDDA 4HVZA 4OZJA 4L76A 4WU2A 4ZPAA 1U25A 2LP4A 4MH8A 3U27A 5SZTA 1ZS6A 2R3VA 1CJVB 2DNLA 4DUZJ 2FVPA 1BWEA 2KT5A 1GTHA 2HYIB 4JI6J 4MKAA 5HLFA 3BEGB 2J8AA 1UP1A 3EX7B 2XQCA 2F8MA 5DDPC 1UW9A 2DHHA 4IOAQ 2CQGA 2K8GA 4N7TA 2XC9A 1PKUA 4NLQA 2VIHA 1ZTWA 4OJ1A 5DLGA 4PQUB 4C4WA 4KY3A 4ID5B 2V6AA 3OXLA 2V9KA 3AODA 2CQIA 2Q3PA 1TKXA 3RG6A 2AP6A 3O3LA 4ALZA 2PEHA 1CJUB 4P10A 3D1OA 5KFWA 2OEKA 1TAQA 1VQ8S 2LEAA 3ETMA 5FIIA 3TWZA 5HO4A 4FF4A 3W63A 2BRLA 1T7PA 2R2RA 4BC7A 4IH5A 3P96A 3QAEA 2EW9A 3MPYA 3QATA 2DPIA 2OTLS 2NPFA 1WEZA 4CLPA 3KXDA 4MFBB 1NU4A 2A0FB 5GADI 4MYUA 1SH3A 2ZH1A 1QVGR 3IAS9 1F9EB 4JP8A 3TAPA 3UN3A 2VG5A 1N56A 1F9FA 1WC3A 1EZZB 4LR8A 2HIYA 5BXIA 3M9OB 2ILZA 1ZTTA 1JLFA 4WTYA 3UR3C 5KTQA 3IWLA 3KWMA 1JB0C 3FMBA 2E1AA 5MAOA 2IA6A 3NAIA 3TYTA 2E5IA 2WRMA 2XYGB 2BJEA 1FTRA 3D67A 3R1HA 1TKDA 2LXUA 4NL5A 1R43A 2ROEA 1RCXB 1EQMA 2B9XA 2MLZA 4WIIA 3SIPB 5HVFA 3KOAA 2DNYA 2HW3A 3QGPA 2GAGC 3OR1A 2VFRA 1RT4B 4Y00A 2XZWA 3PXGa 5IQQA 3SV4A 3KK3A 4ZPDA 1YJUA 4P2MA 1RK8A 4W4MA 2QLXA 4DU8A 3CCTA 5LM7E 2RQCA 4C8KA 5DS7A 2MQLA 4HACA 4YP3A 3RRGA 3TO8A 3TVYA 1VS3A 1WKJA 3DI6B 2J0XA 3K5OA 4F25A 3I5CA 1CJVA 4PABA 2D7SA 1C1CB 4W98A 2YQ0A 1WTBA 1U49A 1YSJA 4K50A 1MSWD 2J76E 4RX6A 3DM2B 1IKYB 2JH3A 3ET6B 2FHJD 2VA3A 2ADBA 2VONA 2F1FA 4DN0A 1X0FA 3NS5A 1UMJA 1B7FA 2J0SD 4ZA1A 5F8JA 1IKVA 3H4DA 1XNRJ 2PDAA 2HBRB 3VGTA 1S10A 2VG7A 5F8LA 4WE1B 2AZ1A 4USHA 1TL1A 4KFBB 3M8RA 4WZMA 5HQLA 3E8OA 3DRRB 2IM0A 5F9NA 2IM1A 1L3UA 4I64A 3MM5B 3SCLE 5BYSA 1LWCA 4F67A 3V4IA 3WBZA 3PVXA 2UUWA 3R6GB 3A3NB 5I3QA 4MK7A 1YRUA 3RRHA 4DMZA 4K4VA 1SIZA 2E5JA 3T6BA 3OVAA 2HQGA 5CHCB 2OH2A 1X60A 1NRKA 5IWAF 5AXLA 2L9WA 4TY8A 2CAJA 1C0TA 3M6UA 3ZZTA 4DL6A 1EAYC 1XNQF 4JYAJ 4CNZA 1M5PC 5DQGA 3IN5A 4IH6A 1TL7B 3CW2C 3FCVA 4B3RJ 1RT3A 2RRAA 1VQ9S 4AE5A 4DCPB 2DITA 4JI3F 1FKAF 2BDPA 1UJ6A 1B0VA 1GT8A 3I0RA 4ES1A 4OIXA 1WDDA 4OX6A 2KT3A 2DGWA 1FRIA 1LQ9A 3PJ9A 4CWBA 3EGNA 3M8QA 4IO1A 3CCLS 1H73A 2N7CA 3L7OA 3SYZA 3UD4P 5B0GA 3HHKA 1WI6A 3VGSA 4PG5A 5A8RB 1YJTA 3AB4B 1OPIA 1XTZA 1RHJB 3ZC4A 3KJVB 2QSFA 2I0XA 3CJSA 3SXLA 1HQUB 3AOAA 2ALYB 3VQTA 2OPQB 4BC9A 4ZCIA 1RXOB 3UW1A 2JEGA 3F0NA 1ROFA 1S72S 3HF5A 3BN7A 4RUBA 4F4XA 2CZ9A 2MXYA 4RBVA 2LA4A 4DPWA 4ES3A 3GG0A 3B4DA 5A2QU 4ECTA 4IUFA 4FPIA 4AYBD 1SQFA 1Q8BA 1HBOA 5IV4A 4DV4F 2RS8A 1S57A 2A1BA 4O4GB 4EI2A 1FNXH 4X62F 2CPDA 1W2IA 4P73A 2PGCA 1RKIA 3R5DA 2HQ3A 2KT2A 2JFDA 2HRTA 2YPYA 3HD1A 3PHEA 2YWKA 4DR5F 1FRMA 1VIXA 1QSSA 5IC6B 1TL3B 4ZPTR 4B9TA 2C3YA 4M5GA 2F4VJ 3WHIA 2MHEA 4KE5A 4WYWA 1A7GE 1NKCA 3PIPQ 3QRPA 1N52B 3AHPA 4JI4F 3C15B 1UFLA 2DHXA 2QL7B 5JMNA 1U1RA 1MROA 2V2VA 3M8PA 1FK9A 3A13A 3TW0A 2MQPA 4NXMF 1D9FA 1SXLA 3ISNC 1C4CA 1F9HA 5L46A 1FEHA 3LP0A 3L3CA 3EGVA 4L73A 5HBMB 3HM9A 1O5JA 3D0GE 4RW4B 3THTA 4WCEQ 2J7KA 1J5EF 3D0HE 4N56A 1GMVA 2MMYA 2WB1D 2MHNA 3MXHP 3I32A 1HQEA 4UY8T 3L7UA 4ZVTB 4OX9F 2XI3A 4G3IA 4LF1A 3JB9k 2AEMA 3DHXA 4RBTA 3J81Y 1M5SA 1NH7A 4M5MA 3FFIB 4TQRA 4LSZB 5F8HA 1UAWA 2CJBA 2QLBB 2YVSA 1RU1A 3LUYA 3CVKA 3ZNJ1 4DJBA 2MSTA 4AT1B 5KFGA 3WX8A 2J5AA 2ZH6A 4P6QA 1Y7PA 4AFFA 4LFCF 2HWIA 3WZ0A 2RILA 3PTWA 4UOHA 3B78A 4J9VA 2KVIA 1AUDA 2XY5A 4OI4A 1Z4UA 2C2OB 4DV3F 1K47A 4OYXA 4CO5A 3HFZB 2EFOA 3HZGA 2CRLA 1RACB 4OYPA 3BDPA 3I9V9 3RBEA 3M2RA 2V4JA 1SC3B 3D6MB 5AE2A 2BMBA 4KGVB 4I7FA 2G9OA 2KVQE 5ETSA 1FWPA 2KRRA 3DGPA 1XMOF 5B0DA 3HP6A 4ZN1A 1LKZA 2QRRA 2VBXA 3ZZPA 4URGA 3MR5A 1LK5A 2NSBA 3GR0A 3QWUA 1U1LA 1T05B 4CCHA 3A8JA 2XLIA 4DV3J 2W2NP 4ZCMA 4JV5F 5CH7B 1NK7A 2UU9J 2WCXA 2WK4A 1LEOA 3J7A1 4JI1J 3QGHA 2XS7A 2MKYA 1S9GB 3GFXA 5KFZA 4GRSA 1GMWA 2DNHA 3T1HF 2XYHB 4OHYA 1SJ3P 1J27A 1SPBP 1OSDA 3VR1A 1O8BA 4Z7YA 3DU5A 1VRTA 3Q8VA 3ILJA 3MUMP 5KT4A 3E01A 4USWA 4DV6J 4EYIB 2C2DA 1I6JA 1F1BB 1RTZA 1S7HA 3MPVA 4N8OA 2ZJQQ 4E8UA 3AA9A 1TKXB 4ZVPB 5ETTA 3ELHA 1WEXA 2F5GA 2CJYB 1RQ0A 1U4BA 2B4VA 3AA8A 4XIUA 3C6TB 5ETRA 2X1AA 3R3TA 1ZH5A 1FNOA 5J2MB 1HNIA 2DXEA 4CH0S 5IT9Y 3UNGC 2ZEJA 4DOZA 2PC6A 1CJTA 4ETXA 1LFPA 2J9EA 2FLLA 4DV6F 3MD1A 4KSEB 4Y6IA 4HKQA 2HHVA 1OY8A 2J9DA 1ZA2B 2AV5A 2CQ4A 4NLDA 4NMXA 3FEZA 1D8YA 2YX7A 3NNAA 3V4MA 2MPUA 2R4FA 2VL1A 5IM0A 2OPRB 3BKFA 3KMSA 2RIJA 2HNZB 4NLTA 4ECXA 1JLGA 2IPOB 1XJWB 4V19J 4FVCA 1K0VA 1YBAA 2W9CA 5KFBA 3QMQA 4XDCA 2AGQA 2DGQA 3CF5Q 3KTQA 1FJGJ 2EFPA 1LXNA 1VHFA 1JLFB 3DHWC 3J7YU 3I5AA 4OHXA 5J1PA 2ZH2A 3R5GA 5CCLA 1UW4A 4Y65A 2YWWA 3CDWA 5DRKA 4F0HA 2ZH9A 4FNIA 2ZVIA 4C0BA 4DL3A 1RI7A 1HMVB 3PFOA 1S0VA 4B9UA 1GEHA 3GP9A 4EMDA 2BKPA 4DEZA 5K8NA 3M32A 5K20B 3G6VA 2ALZA 3EDRB 1W25A 3GFHA 1FJGF 5H9EJ 2OMOA 2KTQA 3ZTOA 4DUYJ 5CYQA 4KV8B 3GSDA 2C42A 3FEXB 3PRVA 1R6YA 1RZMA 3GZ7A 2EFGA 5J2PB 1S9EA 3PW4A 1NHKL 4DCOB 2PN6A 4HH0A 4UOGA 1T05A 4HACB 4USUA 2KM8B 1KKHA 3BQ1A 1HA1A 3I56S 4X65J 4YOEA 4DV1F 2EG1A 2EXUA 2F4FA 1LWXA 2QT7A 4NYOA 2KFZA 2PT0A 1REVA 4J9KA 1FDNA 1RT2A 4DS5A 2AD9A 1OPZA 3BR8A 4LVOP 2GW8A 5EGYA 2ZHBA 2E66A 2LFVA 4CYUA 1H2VZ 1LWEB 1NPRA 1TMJA 1W26A 1WKLA 3DOLA 2I5JB 3NOCA 3SFUA 1KFSA 1T3OA 4C98A 5B0BA 1VQ4S 5BYRA 1WJ9A 1QD1A 2HBZB 4P2XA 2H4YB 2MKKA 3DGVA 3NS7B 3RR7A 1XNQJ 4JYAF 2VOOA 1RAOA 4Q45A 4DV1J 5E3RA 2HFZA 3TUIC 5CABA 3RTVA 2XS5A 3T9NA 4DF8A 4BBYA 4Q43A 1NMEB 2OTJS 3CCZA 5A2QY 4CO3A 2R2SA 2VJUA 3PYFA 2DH9A 1CJKB 3LA0A 2XB2D 4F02A 3LGHA 2BJ9A 1H2UX 2W1BA 3TX8A 4QU7A 2H3EB 3LGNA 2O01C 3DLEB 3MECB 1HW9A 1R8AA 3DMJA 3MM9B 5HJXA 4JBCA 3T9ZA 1FJCA 2HPUA 2JJ4D 4NLSA 4JI0F 3VWSA 2LMIA 1KONA 2BBEA 5IT4A 2O5DA 2MDAA 3BDEA 1VISA 3SSSA 2YWHA 3KUEA 3CD7A 1EQ0A 3EYZA 3R2DJ 2HVIA 4IFYA 4E2FB 3QFWA 4M5DB 4RPFA 1NXIA 3SV3A 1QSYA 3N0VA 1QUVA 3QLHB 1WHXA 2CJAA 1OYEA 2DEJA 5HQ8A 3T5KA 2F9DA 2QMXA 3RYLA 3D1QA 3HHLC 3IR6B 5SUHA 2W2PP 1V3RA 2QSWA 2V63A 2H5EA 4OZ0A 5JXSA 3UNYA 3HSJA 4WE1A 4JI0J 5HVGA 2K06A 1TL1B 4KFBA 1NZ8A 4RNNA 2SXLA 2B3TB 4QR1A 1PAEX 2FLPA 4GKJF 5G4DA 3R5AA 2Z2LA 4O44B 1HWJA 2FC8A 3PJXA 3O5TB 3ZTSA 1H7WA 4TU9A 5J2PA 4B9MA 4FXDA 3FMWA 1VC6A 1YLXA 2B7BB 2OELA 4O4GA 3BB5A 3NG8A 4TY8B 2Z56B 4H4KC 1PBAA 4WF9Q 3PYEA 1VQSA 4TN2A 1JLAA 1ZM2A 2C22A 4IR1A 3G86A 3GCXP 3KLGA 2FB0A 5T7LA 4YMEA 2RQKA 2Y1JA 3I0RB 5KFOA 4UUXA 3M8YA 3GJRB 1NPKA 3EM1A 1JLBA 2JL9A 1N0VC 1SJQA 4C3MA 3RB0A 2DR7A 3HPOA 2HVHA 3IMQJ 1Y10A 3AOBA 4NYZA 2CDRB 2BVZA 5A8RA 1UPPA 1K1QA 4CNYA 3GIJA 4NLRA 4QW8A 2IJNA 1HYSB 5DG8A 2G2ZA 4QJVA 4FS1A 4B3SF 4LFCJ 2QA4G 4NLOA 3K5MA 2F9JA 3OR2B 1EIYB 4QU6A 2VHGA 3Q23A 3RBDA 3DDIA 2AKWB 3FRYA 5IV3A 3ZZYA 1Q78A 1SIWB 4ZIVA 1CEZA 1HNZJ 3M8ZA 4ZITA 5CXTA 1IXKA 2CQ2A 4LSLA 2Y0SD 3AH6A 3TA0A 2HS3A 1OIAA 1X4FA 2GIFA 2NUUG 4ECYA 1K73T 1L3VA 4NXNF 2QYGA 4ECVA 1E6VA 3SDEB 3C66A 4ES2A 4I6AA 4ZPVR 4JV0A 3CE8A 1IQTA 1N33J 3MF5A 3M6WA 2ACYA 1RWVB 3NWRA 5DETA 4YY3J 1FKPB 5KFMA 2ZOFA 3ZNUA 2NYHA 2E1MC 3IBFB 4UZCA 4B17A 2XMTA 4KGZB 2FPHX 1U0SA 4QIWD 5DDOC 4HI2A 2HSEB 2XYPB 1YRXA 2HG4A 1FRJA 4IDKA 4ZVGA 2D3ZA 2UU9F 4PXEA 4CLKA 4DL2A 4JB8B 3CJTA 2WONA 1DJ0A 3ENWA 1RWXB 1WG5A 2IC3B 3IR7B 3LW5C 4MT1A 4W92B 2QX0A 2IJRA 2LLZA 4WP9A 1APSA 3AQOA 3CO9A 3JSMA 2CJKA 3V6DB 3FCWA 4ZPBA 3CEDA 4WK3A 3M8WA 2PIIA 4GVBA 3TUZC 2KG0A 4NEZA 3M9MB 2ZH7A 2C3MA 1SI9A 3S8SA 5DZ6A 1BQNB 3S01A 1NAQA 2DY9A 3BSNA 3NGRA 3KKFA 2ZNZA 1YG0A 4RW8B 5K14A 1JLAB 1TUGB 1TUWA 3LAKA 1LNQA 1RAJA 2J7UA 1N5TA 2HNYA 3DDKA 1R89A 2ASYA 2D9OA 3BH6B 3KUHA 5DG9A 2JDJA 3QGGA 1RCOB 1A6LA 2RH3A 4NI2B 1B70B 3TZZA 2AJ1A 2G13A 3GWCA 1ICEB 3K89A 1SV5A 4FKXA 4LIRA 3G96A 4I1TA 1RTJB 1DQAA 1FRHA 1TUVA 3FSIA 2BQUA 1CVJA 4EFAC 3Q8PB 1D09B 2XNQA 5KT5A 1UETA 2HRUA 4CRJA 2YNFB 4WFNQ 1Z2ZA 1TV6B 1PGZA 5GAEI 3WC0A 3GE9A 1RT6B 4I2QA 4DHVA 4PG7A 1RT1A 2LDYA 4ANDA 3MR6A 1HBMA 2ZH3A 5F8NA 1LK7A 1LFWA 1VC5A 2EC2A 3SCJE 1RLDA 3DGPB 3SCKE 3OHAA 2XHWA 2UXCF 1BHNA 2M7SA 2DNQA 4QYZK 3KG0A 4M5HA 3RW7A 1ZA1B 3R27A 2GVZB 1UVIA 1TKZB 3AB2B 4Z7CA 1KVIA 2DD8S 4PUOB 4AUKA 4FBTA 1UVNA 1H2TZ 1SKUB 2B51A 1N88A 4PXDA 2VV5A 4RL1A 1FEEA 4X4PA 4CLTA 1FFSB 3EVMA 2DO4A 3FVYA 2Y9HA 3R6LB 1FXLA 3BQ0A 3G9CA 3MMJA 3MEGA 3I55S 4RR5A 1WUUA 2MY8A 2YNHA 3IO1A 1G2EA 1VBYA 5E7OB 4DFPA 2YKNA 5ETKA 5JVHQ 1JK9B 2HS0A 2CXEA 2E5GA 1JLEB 1ZZFA 4C11A 1KLNA 2V0NA 2XO7A 1ZZNA 1AB8A 2HHHJ 1IKWA 5CD4A 4Q0BB 1SJRA 1WEYA 3SCIE 5A0YB 4A8KA 2N82B 2M8DB 3EZ5A 2DNZA 4HI1A 4IG0B 3QQCD 4P52A 5CQGA 5GAGU 1RT7A 1TVRB 3KLEA 4J9LA 3UD3P 1HHQA 2ASJA 3K5LA 2RMLA 2FJXA 3UCUP 1KQKA 1CC7A 1FI4A 4MYTA 5GMEA 2Y8YA 5J1EB 1Q82T 3MM6B 4IR9A 4O23A 1YWXA 2VBZA 4H4KA 5EWFA 1S1VA 3CNQP 3GV5B 2QV6A 4YR3A 3OTOJ 4K4XA 1U1NA 1VQ6S 4PWDB 2CPJA 4HDHA 2VDHA 4F3OA 2DIUA 4UT4A 3CC2S 4DUYF 3KLHA 4F7VA 4DV7F 1KSPA 3K8VA 4DR2F 2JEFA 1KQGB 1Y5IB 1NKBA 2L9NA 2PFFB 3MM8B 4KH0B 4ZVUB 5GADU 4QR0A 5HQMA 3J81U 1U6BA 1FDBA 2KJWA 4DSKA 1PG5B 3GV7B 1TV6A 2AJ2A 3WC2A 3G8QA 2RB7A 4KR0B 1NJYA 3MMAB 3OSNA 3U1LA 2W7PA 2IJFA 2E5HA 3H2LA 4KHRA 1S1WB 2UUAJ 1NZAA 2VD3A 3M1VA 1VR6A 4DV7J 3DNCA 5KG4A 4DL7A 5LSLA 2Y1LB 3BYRA 3HKWA 5CYQB 1F2GA 1GMUA 4K5RA 1S9EB 1F6TA 1RTHB 3MM9A 2LKZA 1WHVA 2R7OA 3AY0A 3I31A 2H5IB 5GAGI 2R2TA 2AJ0A 1REVB 3GJSB 3TNVA 3AJDA 4HHHA 2JWNA 1DTQA 2B7CB 2HQCA 2BANA 2DH8A 2KDOA 4EO6A 3VAJA 1S1TB 1N6QA 4EZ9A 5B7WA 1GAOA 2KXFA 3QO9B 3N79A 4LF4J 4DR6F 3R5JB 4H4MB 4LSNB 4QPXA 4R5PA 2DGSA 5AE3A 1WWHA 2YNHB 4HEA9 1OQ3A 3K5PA 1WDTA 2K7KA 4IOBA 4OV1A 1NBEB 3LP1B 3JTOA 2FHKA 5F0WA 2KU7A 2KHCA 1RTIB 4YN3B 2IRYA 2DXFA 4Z2XA 3C16A 3CCQS 3PYDA 4F26A 1U2CA 5I42B 3OW2R 2LQ8A 2BOPA 1NDKA 1TP7A 1U26A 2E7XA 2I8EA 2VKRA 1WORA 2FJDB 1JLQA 3PFEA 4GMKA 4O0NA 1NHUA 3FBEA 4L74A 4PXCA 5DO2A 5D6GA 3D2WA 1GK8A 1UZHA 2M52A 1AXQA 4WJBA 4CQ1A 5DZ7A 4FYYB 4JI1F 3VCDA 3QJJA 4I69A 2OSRA 4UW2A 2R8IA 2FTRA 3MUTP 3HHLB 2RRNA 3GFZA 1VLOA 5L1LA 2HKEA 2ZM6F 2QG9B 4B3SJ 3S6EA 5D0RA 3LF0A 4TQSA 1VQMS 2C1EB 2BX6A 3Q8UA 4MJKA 2P9CA 3MFIA 1NK0A 2WVDA 4NPOA 3A8IA 4N76A 4DR7J 3T3FA 2VOPA 4L6V3 3NGSA 5KFIA 1HNZF 2HFVA 3GB0A 1I94J 4I68A 4LMZA 1AA1B 5AT1B 2PEBA 1GX5A 2MYFA 4OI2A 4N5SA 4M5NA 3BREA 2DGXA 3M2VA 3JQKA 2QA4S 1GQEA 1S6PA 2D41A 5E33A 1TAUA 3CTRA 5C24B 1UEVA 2JC0A 3HJFA 2A6MA 2KZZA 2OFGX 3SBMA 1BXNA 3JAMY 2XI2A 3CD0A 3CIMA 2XCAA 3KK3B 5GAHU 3MCNA 4DR4J 4F04B 3HK2A 1CULA 3CCJS 1NDPA 3VAMA 2ZBPA 3D3CJ 3DI6A 2RQ4A 2GIRA 3Q89A 1X4BA 4ZHRA 5LT5A 1V9OA 2GJ2A 1OYDA 2IAJB 3CDEA 2MGZB 2ATLA 1HLWA 4J7CA 3R9LA 1X0PA 5FLXU 3Q22A 2YKPA 3O2IA 4NZ0A 2UUBF 4LRAA 1P6TA 4GVLA 3CULA 4DV5F 1RT5A 1QE1A 2P8IA 4PCQA 3ENVA 2JZ5A 3W2WA 3PHTA 4KC5A 3M05A 5KOXA 2FGOA 1M1GA 1ZPVA 2DNGA 4M5IA 2BACA 4X4TA 3ICLA 1JNRB 3MD3A 5E3AA 2RDJA 1T8EA 2P9EA 3VAHA 1XIQA 3H4BA 1N5YB 2KFNA 1N5QA 1U02A 1YDLA 2GJIA 2RE1A 4OLOA 3DLKB 4CI0B 1NK5A 1M90T 1KHWA 3NOGA 4WXWA 5DG7A 5HJYA 2JOQA 1T02A 2MKSA 3BZQA 2BE9B 3B4MA 2LEPA 4NOHA 2HRYA 1SKWA 2V8DA 2DPJA 3W64A 4JI3J 1UVMA 5DQIA 4LUBA 3RJMB 1IWAA 1NSKL 2KKHA 1MU2B 3UR0A 2LDIA 1PJ5A 5AXKA 4CIOA 2CZVC 2VBYA 2UXCJ 1YJVA 3ONQA 5M2RA 3W3SA 1XR6A 2P5VA 3SSQA 4TVAB 5AE1A 2KG1A 3RB3A 1S97A 2HFOA 2PD1A 1JQGA 4USKA 2N4DA 3M2VB 3BO4A 3ZZOA 4A8QA 1RWKB 2OO4A 3GJQB 2MSSA 5KFSA 3FSXA 1V5VA 4HTIA 4OI3A 2JVOA 1HQUA 1MMNA 5F41A 2G0CA 1SC1B 5KFTA 2AWZA 1VFJA 1MN9A 2VPWB 2KZMA 1GNKA 1FXRA 3BGOP 3ZZUA 5HANA 4IOCQ 3BKTA 3C6UB 4LF9J 2HEKA 3JQMA 2AYMA 5CYMA 5THWA 1UCNA 2QL5B 1V3ZA 3POTB 4OLPA 5K8MA 2EKNA 1TK0A 2YPZA 3UE2A 3JSRA 2BV3A 5HI7A 1P27B 2CNNB 4I56A 2EC0A 1XC9A 1MWZA 4TLQA 4ZHRB 4CLSA 4YDXA 3WX4A 2C2RA 4J91A 1N4LA 3W1YC 1TZ0A 1WF2A 1RWMB 2HZAA 3UD5A 4B02A 3Q0AA 2NLWA 4ZVRB 1RYRA 2FY1A 4LF7F 3IRWP 4ED8A 1EETA 3W62A 3M4XA 1ZETA 1RA7A 1QM9A 1RB0A 3H5SA 2VASA 2V4RA 3VZIA 2AYGA 5H1SV 4A8WA 3D0IE 4ECUA 2PI4A 1FWLA 3I6PA 2AT1B 2BXJA 4U95A 1SV5B 5HL7Q 1M0SA 2YQ3A 3V81A 1U1KA 3HVRA 4LR9A 1UWBB 2M88A 4PYAA 3NCPA 1MROB 3B82A 2YKNB 2M9KA 5KFKA 3OTOF 4J9UE 2GHWA 3CJ0A 3VAKA 5ETOA 4JI7J 2DNNA 2FJWA 1S0OA 1C0UB 3MAAA 5B0EA 4X4SA 4KIAA 1ZM3A 3H2UB 2GIQA 1KVKA 1WI8A 4PPZA 4YB5A 2XY7A 3VALA 1T3NA 2B4PA 3OQ2A 2CG4A 4IFVA 1AROP 2R9LA 1ELOA 1NO8A 4A4JA 4KPYA 4KQZA 1N5SA 1S99A 2GVZA 2RF2B 2JNJA 3B6BA 4MK9A 5J1EA 2E9ZA 1YI2S 3MM6A 4CZCA 2VG6A 2CPYA 1PJ7A 4Y2AA 1DZ5A 3ILIA 1VBKA 1WKKA 3CJQA 3JYTA 2FVSA 3KDOA 1WC6A 3DC2A 3RAMA 4EYHB 2LQJA 1CG2A 3C2PA 3BS9A 1NSAA 3TQ1A 1XQIA 1I51B 3QWPA 1UVLA 3UDLA 3GU0A 3T41A 3C14A 1IR1A 4TXSA 1KOOA 2FYXA 2GNKA 1VQKS 3U1MA 2BUNA 2PO4A 5F0UA 1RHUB 4OYAA 2HQDA 2MLXA 2EK6A 3CJKA 2AJ4A 2X1FA 1T0TV 4PXBA 4C11B 1C0TB 1S59A 1YK9A 2XY6A 2D3OR 4NASA 4X4VA 1DQ8A 3WIUA 3KMQA 4U9RA 1SQGA 3SSRA 3TVKA 3UWTA 2IIHA 3L7PA 3CCSS 3HFVA 2FDNA 1TVRA 3BGRB 1X9MA 8RUCA 3W5YA 1ULRA 1H0HB 1VOMA 4DI6A 1C4AA 1DTTB 5KFDA 3R97A 6FD1A 3K57A 3ZO7A 3QAUA 3EXYA 5DDQC 1VRQC 4FN5A 5RUBA 3RW6A 4LRFA 1LW2A 4AL7A 4X4QA 1KRPA 1NDLA 2IY5B 2L9DA 2AF6A 1KP6A 2EFNA 2L08A 2GZOA 3M32B 3QSYB 1S48A 1SC4B 3LP2A 1JKHA 3CCES 4GKKJ 2RSQA 3IAM9 2G0IA 3PW7A 3MOJB 3E01B 1S4FA 3R7BB 3TX0A 1NJIT 1X4GA 3MZIA 2YNIB 2AX1A 2YWFA 5JVGQ 1JWWA 4AXIA 3KLVA 4WYLA 4WFXA 5A6PA 4KHMA 1O6XA 4OZ5A 2RDIA 1NK6A 4YEAA 4PKDB 4AXJA 4WFAQ 2V2QA 4LQ9A 3GFYA 4XO0A 3PKMA 3MEEB 3O8WA 2VQEF 4UF4A 1Q86T 2RU3A 3NNHA 4NRTA 4B3OA 4EU0A 1CPZA 1M1HA 1XR5A 3ADAC 2NXCA 3B8HA 3MI7X 4ZOSA 4XPEA 2RF2A 4OYOA 5C42B 2MQNA 4HT7A 4K4YA 2X51A 3JYTB 1W2BR 2G2OA 2V34A 4C48A 3EJMA 2DNMA 2VBWA 1VRUA 1Y5NB 2OPPA 1S1UB 4NEYA 1SJ4P 3FRZA 1PIEA 3I4PA 3LP0B 1KWMA 4NLYA 3G82A 2YNGA 5J2NA 1N8RT 4ZN3A 1BY9A 4FXWA 3K58A 4OHWA 3OL7A 1BD6A 3MMBA 4G65A 4CO0A 3H5YA 2FLOA 3DOKB 4X4RA 3D66A 1RKJA 3CJKB 5L9NA 3H40A 4EEYA 1MWQA 2HHWA 1RTIA 3LO3A 1CQNA 2EG2A 3C16B 4X4UA 1DLOA 4EZ6A 2VF3A 2XSJA 4K4UA 1EKSA 3IM8A 4C9DA 4M5DA 2J0WA 1BWVA 5E3PA 5ETMA 1S6QA 2HK2A 2UUAF 2DR5A 3RRKA 4MKVA 2LXIA 3C3LA 1CULB 1PCAA 1YBTA 1OSCA 1WOSA 1IM4A 2DXDA 2AHOB 2UUTA 3UVJA 2UP1A 3CD6S 4YFUA 1HHSA 4DV2J 5HAOA 5D78A 1MG7A 1P8GA 2LQ5A 4JI8F 4ER8A 4O3RA 4JUZA 3ETOA 3I87A 4JV2A 2C2EA 2OAUA 1RT4A 3IWNC 2MZQA 2MEWA 1TU0B 3CMAS 5KG1A 4M94A 2DHAA 3NWGA 3OD2A 3QIPA 1S4EA 1HI8A 2C2KB 2XULA 3EWGA 4P75A 3W2WB 2D1CA 4PEOA 1X4DA 3DLHA 4MKYA 5F8IA 4LF6F 3EUNA 4EBDA 1S6PB 3I0SB 3LWLA 1WNEA 2M8HA 3K2YA 2ILYA 3GIIA 4LF8F 1OY9A 4ZVEA 1IKYA 4YHHF 4B9VA 2ZBQA 1YKWA 3M8SA 3JXOA 1RBLA 1C2PA 3CC4S 2AU0A 1K44A 1PILA 1FTCA 4N41A 3DRSA 3UDEA 4JI7F 2NXUA 2WOMB 3KFWX 4CM0A 3MCOA 4QWEA 1VJWA 1IVZA 3BYPA 1BQMB 3GTYX 4BWMA 4CTAB 4TU8A 4DPYA 4HYKA 1QSLA 4CH7A 4G1QA 2C2NA 4ICLA 5KFRA 4LF6J 3PX4A 2WHOA 4ED5A 4EWTA 4P9SA 1MU2A 3FNNA 1Q8KA 2B9WA 2VPZB 3DRRA 3IGNA 3DOMB 4CDIA 3C8YA 2J0QD 2J6TA 4LF9F 3UFCX 3CJ8A 2LA6A 4RUCA 4ELVA 2CPEA 3C19A 3M30A 3H90A 4LRCA 1Y00A 2NSCA 2ACMA 4N47A 1NJXA 3R5BA 3RAXA 2HLTA 4U7CA 1DHMA 1JLCB 4KT0C 1S6UA 5LMUJ 1J5OB 2XO6A 2F8HA 4C97A 1N54B 3J80U 1D1UA 1SL1A 2QTWA 4ZJQA 4MIWA 2F7VA 2M5YA 2XWYA 1HNVA 5E5NA 1R0AB 1YGYA 4ZVHA 3G87A 4ZP9A 1VC0A 3TAQA 2KXHA 4DSEA 4ZDNA 3VAFA 1RTDA 5HK4A 4OZ3A 4NCGA 4ZIWA 3VAGA 2R7XA 1AFJA 1PYSB 2DR6A 3CO0P 3TARA 3CC7S 1HL6A 1W7WA 1HPZA 3N28A 1RWNB 2KL8A 2PFDA 3CJRA 5CD4H 3QZ8A 1JIHA 2HHHF 5LMUF 4FS2A 1IM6A 1LWFA 4LFAJ 1E6YB 3TUJC 1TELA 2ZVSA 4QIFA 4AD6A 1EETB 2HGLA 3FQKA 7AT1B 1EARA 1OO0B 3Q8QB 4ED2A 1RBAA 2B43A 4NX9A 4C8MA 1YVFA 5C2GA 4F50A 2IYGA 4OI1A 4DPXA 5T14A 4KB7A 2JEJA 1RABB 2ZOGA 3F41A 3OFFA 2MKHA 3MURP 3PCOB 2BZ2A 1WHWA 3M2UB 3NAHA 4WPAA 5I3PA 1U1PA 4FNHA 2XWXA 4EK2A 2HVDA 3AXKA 1ZOTA 3JSBA 5A76A 1WG1A 1X8DA 3TEHB 1D9DA 6AT1B 2IRUA 3DLGA 2BEFA 2OEJA 2ZH4A 4DFJA 3AD8C 3UQSA 2ZC4A 3HSDA 5HLFB 3J7AN 2N3OA 1C1BB 2UXBJ 1DARA 1NK9A 5BR8F 3N9UC 5E3CA 1F5AA 2EWHA 1UA1A 1HNXF 2RT3A 3H2VE 5CAAA 2I5JA 2QLFB 4CTAA 3RR8A 2V9WA 4LR7A 3A12A 2Q79A 5LJ5Y 3KYLA 4DL0C 1HNWF 3GCWP 4TYAA 2VPYB 4I0WA 3W60A 1S0MA 4MIAA 5CA5A 2AYBA 4DX5A 4QIGA 3NNCA 2W9BB 1N34J 3IP0A 1SL2A 4ZLLA 2B6AA 2JLEA 3HXMA 1SKSA 4RNHA 1NDCA 3H8YA 5B09A 2FVQA 2MB0B 3NGUA 4DFMA 1NM2A 4U7UK 2ATCB 1IBMJ 3GONA 3QPIA 1G3OA 5U47A 3W2VA 3P45B 3SI8A 2WONB 1S12A 5KG2A 2DHSA 3MPWA 1KVJA 3K7RA 3QSIA 4NRUA 2P9GA 2JX2A 3DN9A 4PZVA 5DJBA 4F3MA 1JXEA 4KJIA 3NCQA 4UOFA 1QTNB 2DNKA 1FDDA 2DGTA 2IA0A 2OD4A 2CJXB 3DYAA 2QIFA 1OS5A 9ATCB 4P74A 2HHSA 3MEGB 1JX4A 3BV8A 4PQUA 3MEDB 3BGRA 4QYRA 5KFAA 1FERA 5KG3A 4Z37A 4OJGA 2VUGA 5C2CA 1NKEA 4QZVB 2ZOMA 1DTTA 3ILOA 4Q7AA 3W61A 2CQ3A 2VG6B 1R8CA 2DCLA 2QO3A 1FE4A 4RW8A 4IRCA 3AD9C 4I67A 2ZUAA 2KFYA 5A8WA 3V2UC 1IKWB 1B7YB 3GJTB 2FZGB 2V4JB 2Z2MA 4UQGA 2QN6B 4XPCA 1Q81T 3OR1B 1FJ7A 1IWGA 2XMJA 3PG9A 4LBPA 5KG6A 3OUYB 2RUSA 2VFTA 2LU1A 2ZH5A 1GH8A 4ED4A 5BJRA 4C8NA 2FC9A 4USVA 1RAGB 4I4BA 5A6WA 1UA0A 3M2UA 5ETPA 3DDNA 4BDPA 3D68A 4DN9A 3I5BA 5M2PA 4IG3B 5D3GA 4FDFA 1T03A 3DLGB 2YNFA 2JRSA 3W66A 1VBXA 4JI2F 1S6OA 1T9TA 4AL6A 3F73A 2YKMA 1NK4A 1EJ7L 3LALA 2DVIA 4RWXA 2F65A 3EMTA 3KLGB 3A8EA 4X4OA 7FD1A 4F4ZA 2BQ3A 2FLNA 4RW7B 1VRTB 1IBCB 2C3PA 2VZ9A 4URQU 2WVEA 4DBQA 1UL3A 5C42A 3I4HX 2CFXA 2I6WA 2NYIA 4TLRA 1Y0HA 2CNOB 2OP5A 3UCZP 4DR4F 4KTQA 1RAFB 5ITHA 4U6PA 5GVQA 2DTJA 3UDCA 1Q53A 1VDHA 3HHEA 5KT7A 4XK8C 2GX8A 2R7VA 3M1VB 4ZJOA 3L4BC 2Z2YB 2X3DA 1N36F 1YJ9S 1RDRA 1X5OA 2E5LF 2OJ3A 3KUGA 2POKA 2Y8WA 2AX0A 1U24A 2GV1A 2YNIA 1TMMA 2UV8G 3W2VB 3DOKA 4YS2A 3CCMS 3AOCA 1FX2A 1P1LA 3OXFA 3OVBA 4LSLB 3K5NA 1VYAA 4PWWA 3BSOA 2X3GA 2ZE2A 3BSCA 2DK2A 1E6VB 2ZUGA 3TJ9A 4F3QA 2W9CB 4DL4A 1K0TA 1U8WA 1DBDA 4YB7A 4PWUA 3THVA 1Q7YT 1UWAA 1NB7A 3MTKA 2W01A 3ILLA 2CG8A 4HR2A 3V6HA 2E5LJ 4ATNA 5LMNF 1XN9A 3CMQA 3IG1B 1UFWA 1UEKA 2A10A 5HMWA 2CPFA 1IJEB 2D69A 4Y0FA 2WSFC 3G6XA 4DQPA 4F4YA 5EN1A 2CQBA 4DR2J 3ISZA 2ASLA 2KH9A 4C6AA 3PRDA 1SQEA 4ID8A 2AW0A 4FVMA 2V2KA 4LBIA 5ADZA 1QVFR 1RAEB 1VK3A 4DPTA 1QTMA 3GILA 2HZVA 2WVFA 1ZYQA 2EPIA 3PJWA 4FXVA 2R42A 1HARA 4KO0A 5G0RA 4PG8A 2FGCA 2QA1A 2UV8A 4KBIA 1LWCB 2CNLB 2WB4A 4KV8A 2WZ1A 5CZXA 5D15A 2RD5C 1HIYA 3CJ5A 3G2XA 1NSQA 2MLYA 4L75A 1U47A 3FGVA 5GAHI 3FBFA 2VFUA 2DCUB 3CJ4A 4OX8A 4UUWA 2Z57B 4RW6A 3UI3A 2AGPA 2NREA 4NWBA 1B99A 4WK1A 1FRKA 5KT3A 4O0IA 2ZJRQ 1RT3B 1R3NA 3ZTQA 3CMES 3HCXA 3MM7B 4K8RA 1U1OA 2H65B 2M4MA 2MZSA 3VAIA 3CDAA 2H54B 4KHPF 1R8PA 1X4CA 1RTHA 1YX2A 3M8QB 2DEIA 5J1NA 2BJ1A 2MTLA 2KRBA 5F8MA 3UVJB 1QAIA 4Q44A 4LF2A 4G1QB 4ICLB 4JV1A 1WOOA 4FYDA 1ZPWX 2DNOA 3ENQA 1QJHA 3EVOA 3KJVA 4K0KJ 1I3OB 3VGUA 1P9QC 1CQMA 3SEOA 3DOMA 1F5BA 2XHCA 3PDNA 2MZRA 3OHBA 2HQFA 4K7QA 2CPIA 4YR2A 4DSJA 3CD5A 1K1SA 4OMFG 4DDFA 4KHPJ 4OX9J 2R7RA 2W2QP 4DV4J 3H5UA 2B4UA 2XGQA 1R0CB 3LP1A 2IM2A 1RLCL 2CJ9A 2V5HG 1FVQA 3HI9A 3OT9A 3I0SA 3QNWB 1TKZA 5KG7A 2UVUA 3UO0A 2Y1IA 3BR9A 1AW0A 3BF4A 3U02A 2BE7D 4RNOA 4IFYB 4RLEA 3JAMU 2MQ8A 2U2FA 4KAIA 1TQLA 2CQHA 3FUYA 2LCWA 1RT5B 5KOWA 5F8GA 2OUGA 1HKAA 1VIOA 3PKYA 4L3KA 1N33F 1HQ2A 2D9PA 2WOMA 3MHYA 1U2RA 1XWLA 4M8LA 1KN6A 3GPAA 1BQMA 4J9SA 4CT8A 4JI4J 2AMCB 3HHLA 4LFBJ 3W9JA 5GMKa 1FKOB 2D3UA 2JC1A 4FZVA 4ZP7A 1X7VA 3N6MA 4USMA 4OI0A 3IS9B 5KT2A 4J9RA 3HMJG 4ECWA 1JLEA 2JFKA 1CJUA 4K59A 4RKUC 4C3KA 4ZP6A 3DLKA 5H9FJ 4RW4A 3ITHB 5KFHA 1HNXJ 2BOAA 1G4CA 2JEIA 2DH7A 1XMQF 3KK1B 4NYPA 1FRLA 1JLCA 3E3XA 3KNAA 3OL6A 1F5CA 1R31A 2KB2A 1KLMA 4QOTA 4BWJA 4RW6B 1IR2A 2EFVA 4LFAF 2BM1A 2EI5A 4IH7A 1CC8A 2B56A 2MKCA 1R6VA 3D6FB 4ZVOB 2GVDA 3M6XA 5L38A 1S1VB 2R8GA 3PACA 5EWEA 3JTPA 4JOUA 2PA3A 2QMUB 4CO2A 5AJ3F 2XCPA 1S9GA 2HIQA 2MKIA 2V8HA 3RB6A 2AEJA 3MTJA 4URSA 4DPOA 2FHOB 3T1HJ 3SQGA 2W7AA 1MWYA 2MQMA 3Q8YA 3SMZA 3I9ZA 1T9WA 5KT6A 3QYYA 2LVWA 5CYJA 2BR0A 2KN4A 2MJUA 1MMDA 3J7YI 4DPUA 2HFUA 2MGZA 4B9NA 1ZAXA 3X1LB 4HHUA 4P72A 3IM9A 3JQJA 4ZPCA 1NSPA 2M2BA 3G71S 5KFFA 4I2PA 4PUOA 2QE5A 1RWPB 3M2RB 1M5HA 4JI5F 1HW8A 1RWWB 5B0AA 4J9MA 1HNIB 4X2BA 5KFLA 1F3FA 1BGXT 1MLAA 2E7VA 3MUVP 1FX4A 4O3NA 1SL0A 2LEBA 3PW2A 2C2ZB 1NHVA 4S0MA 1Y3KA 3ZTRA 4IKAA 2WTFA 2EFQA 2NXEA 1ZAVA 2DJWA 2ZNYA 2VFSA 2VC0A 4M1KA 3IBWA 2IMOA 5T41A 4ED1A 4GKKF 4JV5J 2FIUA 4LREA 3SDEA 1URRA 2RNEA 2HNZA 3D28A 2RHSB 3HLUA 3KDNA 3LTOA 2YKOA 3GIRA 3OXGA 1DTQB 3HHNB 3DM2A 1RYSA 2G0JA 2NQPA 3NLCA 2HGMA 3ET6A 1YBUA 3DFEA 1NJZA 2HBQB 3JS9A 1IBMF 3DLJA 3MEDA 4G1PA 2DGUA 4RU9A 3NY0A 2HHUA 2CVEA 1OJ4A 1P9YA 1FKOA 1SB6A 5E0OA 5IOLA 5KFVA 1FFGB 1FT8A 3UN2A 5B08A 5HMXA 1TTHB 2QFJA 2HMIB 3V5RA 4DLEA 1YJ7A 2NXNA 1PC4A 4ZJLA 3C6TA 3TAMB 3TA1A 1T9YA 5ETQA 4HDGA 3KHRA 1UKUA 4C7QA 4LF5F 1EB0A 1ZM9A 1A0OB 2FUG9 3EXCX 5ETLA 1HI0P 4FF2A 4ED6A 1WOPA 1VK8A 3KK1A 4P7TA 5KFUA 3VQSA 1YTYA 2ZDOA 3US5A 2ZFHA 1KLMB 3FBCA 1K9MT 4L3NA 2CADA 3ZZRA 1UVKA 1I5OB 2G2YA 3LH2S 1UJ4A 3T5LA 4X65F 4WZQA 4PYDA 1CS4B 3P5TL 1B0PA 2IMWP 2RUGA 3UDVA 5M2UA 1KTQA 3H7HB 4RW9B 2XMAA 2F40A 1S1XA 4I6WA 3C14B 4YB1P 5A8KB 2ZH8A 2IYIA 2BJ8A 3CCVS 4LF7J 4BCAA 5C5JA 2YQ1A 2HZCA 5FDLB 4KKOB 1X5TA 4O4RA 1SJ1A 3VZHA 2HAFA 5BYQA 2DYAA 3CJ3A 2PMZD 4FYVB 3SFGA 2YX4A 4NLWA 3S7RA 5LL6d 3J7ZT 1HR0J 4NCBA 5HROB 5JUMA 1R8BA 2ABYA 3LQVA 2E9RX 1HBUB 2K7JA 2CJQA 4U8YA 1GX6A 3ZTPA 1FO1A 1VGYA 3QT8A 5LMNJ 1B3TA 9RUBA 2BE2A 2MZTA 2FZCB 3MECA 1KTVA 2A18A 3W5ZA 1UWBA 2F8EX 3GG1A 5D4NA 3HKZD 4QBUA 5D0EA 1QLNA 4BHQA 1GXUA 3N4WA 1EP4A 1NEEA 3IWXA 4IG3A 4RJVA 4RWWA 4ZCKA 5D3GB 4ELUA 3TUPA 2HHTA 2DO0A 3H20A 5L8RC 1UPMB 3KJQB 1HR0F 3FKBA 1U7LA 4USIA 3GIMA 1TFWA 2PE8A 3QGIA 2FD2A 2Z8QA 1B0TA 1LWEA 3OSPA 4DX6A 3WQPA 5KFJA 3K8WA 1A9NB 3MOZA 2FJAB 3IG1A 5HP1B 5HMYA 4QYZJ 3KHGA 1L3TA 2AEFA 2YX1A 3D4JA 3A1YG 2AQ4A 3T1YF 1X9WA 3CJ2A 3LANA 4XTTA 4Q0BA 2RU9A 1U8SA 3CSKA 5A0YA 1S9FA 4KH1B 4GKJJ 3EZUA 4K2JA 3KLFA 4B9SA 2APOA 2GHPA 5D8HB 3DLEA 1IBLJ 4E0DA 1V6HA 2Y0BB 3MCSA 1V5IB 4K4SA 2ZD1B 3TZYA 2GFFA 3DU6A 1Y4ZB 4NE9C 1IQZA 3CGIA 1KBRA 1CS4A 4QIVA 4YB6A 4DR5J 4PWDA 2U1AA 1WTFA 3BGUA 1MMLA 1AT1B 1JMTA 4C8ZA 3GMGA 4DZDA 5EDWA 4ECRA 2F4VF 5HMZA 2V68A 2JSXA 5A8KA 3MM7A 2GGPB 5HATA 3E51A 2MZJA 4CO1A 4ZMMA 3MR3A 1UVJA 2KJVA 2MQQA 5FDLA 2D3O1 3KLIB 4F4AA 4MAKA 2W25A 3HFKA 1FCAA 4NLUA 1N48A 2OHDA 2BKNA 2J7WA 2WBMA 4ZLNA 4NA1A 1TKTB 4K4WA 1Q0NA 2M3DA 2ZZMA 1WSRA 2DGVA 2K3KA 2CZ4A 1QAXA 4WFBQ 2XSJB 1NPPA 2XS2A 3QRQA 1S1WA 2BW2A 2VC1A 2YWGA 3NGDA 4PRFA 1JXLA 2N4CA 3N6NA 1Y5LB 1M5OC 3FZBA 1AZSB 1ACMB 4MIBA 3R7SB 4X62J 4ZPWR 1RWOB 3M7VA 3D6TB 2F3JA 2EVZA 3PO5A 3U7JA 2VQFJ 5IC4B 2GQ2A 3T5JA 1U0HA 1C1CA 4UTGA 4ZVSB 4IRDA 3B54A 3T5HA 3PW0A 4NXNJ 2R7SA 3MMCA 1S76D 2D74B 2Z4PA 4D3GA 4MTPA 2GMHA 3QFHA 5DM7Q 4CLUA 3AQPA 4K4TA 2J9CA 1Q8LA 1SBRA 4LRBA 3TVZA 4IRKA 4O3SA 1F60B 1PJ6A 4OHZA 3T1AA 2NZCA 4L72B 3BPSP 3VF0B 2XGPA 4F2SA 3NGKA 1NCLA 2OMLA 2X7IA 3GLJA 1JJ2R 4X64J 4NXMJ 1X4AA 4Y2CA 3GYGA 2MQOA 2NR0A 4ECSA 4E98A 4TY9A 4MKBA 5J2QA 1UTAA 2XLJA 3FQLA 5CZVA 1FFWB 1XNRF 1G6BA 1NUEA 2A2CA 2BM0A 2KYXA 2A3JA 3JSYA 3JSMB 3OR2A 2J9DE 2WVBA 2HAIA 3AD7C 4G1IA 3V4IB 1MNEA 1OY6A 5KFEA 4N8NA 4GVBB 1N32J 3MMBB 4V1Ak 2GJFA 3MFHA 1P1TA 1RP5A 3DKDA 1HBNB 4ZLJA 4WU3A 3P8BB 1ITPA 2FHMA 3HVWA 4HT5A 3NXZA 4ID5A 1KQSR 5C25A 3KK2B 1NLKL 3BKUA 3G6ES 2GVDB 1DLOB 5K14B 2I2YA 2Q6BA 1TL7A 2E29A 5IM0B 1FJEB 2H51B 4WKRA 2IDLA 1XMQJ 4OZLA 4Y28C 4B3TJ 1U6FA 2XEXA 3OJSA 2FJEB 2V69A 1O51A 4YY3F 2UUBJ 2XMKA 3ZFVA 1Q4RA 1FESA 2DNRA 2MJNA 3NCRA 4WTOB 4DS4A 2XLKA 3PEHA 1QDUB 1TKTA 3QBCA 3RBXA 2V67A 3RZAA 3IS9A 2H5JB 4MFBA 4XAKA 4DX8H 1S77D 1WC4A 2CWXA 1FVSA 2OPQA 2O3DA 4JI6F 3RU0A 4M5LA 1RT6A 4OZNA 3U1NA 1RTDB 1O0PA 4DSFA 3EICA 3V6DA 1XMOJ 3NMRA 4R0EA 1FHTA 3EPIA 4DG1B 2KHDA 1AZSA 3FSYA 5B0CA 3CPWR 3V6KA 3MR7A 3RGIA 4QR2A 3VGVA 5AXNA 3TANA 4LF8J 5KFCA 2KM8C 4C3LA 3TZXA 2R8JA 3W5XA 4HLBA 2DR9A 2EBGA 1S79A 4LF5J 4JI5J 1PC5A 1OWXA 2HVEA 3D1HA 2KXNB 1LW2B 2UXDJ 2HNYB 4A8OA 3ZZZA 1TL3A 3A4TA 4CLZA 2IBKA 1XR7A 2QJ3A 1JJCB 2IHR1 3HX9A 1KD1T 2H9ZA 2M0GB 3LP2B 3Q86A 4ILLA 3DRPB 1AYEA 2QEXS 4N77A 2FY8A 2BABA 4NZ7A 3EGWB 3HDSA 4NMLA 4X66J 4GC7A 2ASDA 1WACA 1QAJA 2VH7A 4DZ6A 3BSAA 4EUVA 4A8YA 1G7CB 3AFGA 5H9FK 1RE1B 2FJBB 2FVCA 4DFKA 3GR1A 1HD1A 3LPYA 4ZLPA 3QRRA 2HQIA 1KEKA 1WG4A 5I3UB 4RZRA 2B8QA 2BJ7A 1CLFA 3GV8B 3ISND 2CDQA 2OPSA 3PR4A 1LXJA 2CPXA 3TA2A 2RRBA 4WFZA 1CJKA 3VV2B 4F8RA 2BJDA 1X5SA 2GS8A 2H4WB 1B4SA 2B9YA 2L3MA 2OGUA 2QFIA 3H42A 3HHLD 2DT9A 2Z0GA 3HULA 4OI6A 3KLEB 1SUQA 3BJYA 2VPXB 1J5OA 3IR5B 4LBHA 1NH8A 1WELA 1RGVA 2B5JB 2AIRB 2G1DA 1R0AA 2VG7B 1ZBTA 4Y3CA 1N36J 2EK1A 2YTCA 3PM9A 2FHJA 1RAHB 3QT6A 4I6YA 1Q5VA 5E2QA 2XMMA 4AL5A 4ED7A 3NP5A 1FWKA 5IFMA 2W4DA 1EKRA 2PA8D 1YHQS 3BGFA 1BMQB 1IUJA 2C2MB 2K1RB 2P6SA 4Y2KA 3NL0A 3PX0A 1DQ9A 2L41A 1E6YA 3FZ2A 2HURA 3FDSA 2Z58B 2Q6CA 3MMAA 4DQQA 5MLCV 4QIEA 2GA7A 2YBVA 3C6UA 2EBEA 3LOUA 3W9IA 1RHRB 1T9XA 3BO2A 3POTA 2CWKA 4Q2LA 4UOCA 4RNFA 5IWAJ 3SQOP 3PIOQ 3HVAA 1FNMA 2BE2B 2Q43A 1GFWB 2NPIA 1S6QB 2ZZTA 3A3OB 4O44A 2FZKB 4U67Q 2NXJA 4DX7A 1QAYA 2W2OP 4YUDA 4ECQA 2OLWA 1T94A 3FK4A 2W9AA 4F4WA 5BR8J 2ZKUA 4W90B 4IO9Q 3HSZA 2ZHAA 2XZDB 1KOHA 2ZHOA 3UCGA 2QA2A 5C7PA 5IT9U 4GO5X 4K2XA 4PQAA 2DR8A 2E9TA 3DRPA 4DR6J 1XMBA 1VQOS 4EGLA 4CLFA 3V81B 4IYQA 4WKYA 4QWDA 1FA0A 3S1TA 3R1LA 2IBOA 1BE4A 2COLA 4KKOA 5HP1A 1Z1ZA 3KJFB 3RBZA 3VHQA 4NLGA 3OL9A 2HK3A 1HWIA 1LW0B 4F36A 5I3UA 3CDUA 2QMWA 5LOQA 1AFIA 2P6TA 2YKMB 1Q7LB 2OPSB 4IQMA 2GC8A 1SH0A 4Q2MA 5J2MA 1BQXA 3MEKA 4P71A 2CKWA 4A8XA 1CJTB 5B0FA 1PAUB 4ED3A 4DWIA 3E2EA 3MM5A 3PYGA 2E44A 5FD1A 2NUHA 1BC6A 1UEUA 1X4HA 4RW7A 2IFXA 3QT7A 2O1PA 3R2CJ 3MAQA 2B5JA 1EP4B 3N6LA 1WF0A 5KFYA 4ZVQB 3R7NB 4J90A 3T1YJ 2HNDB 4EBEA 1DURA 5HSPA 1IKXA 1WF1A 2OPRA 2IVFB 3CCUS 4DLGA 4X4NA 3TI0A 5DM6Q 2I1RA 2OIHA 5DQHA 4UQTA 2YKAA 2JLGA 1IBLF 3PW5A 1TFYA 1BUXA 2Q66A 2X1GA 3N5BA 3QO9A 3MPDA 4LF4F 5KFQA 4R8UB 2AJFE 4FYXB 4CLWA 1X4EA 1YQHA 2W4CA 1I94F 3Q2TC 2VFVA 1LOUA 2ROPA 2J6UA 3EDQB 4A8SA 3O6QA 1IN0A 3NBPA 2FVRA 1FXDA 2W8KA 1GTEA 3LPEA 4DQSA 2I38A 5A8WB 5KFNA 2QLWA 2LQ9A 1H7XA 2B4OA 1M5VC 2CQCA 2ZE2B 4QPTA 5C24A 3H59A 1SVDA 4O3OA 3W9HA 5I42A 1VQLS 3BN4A 3BBBA 1PYTA 3GYNA 3M6VA 5LSOA 3CCRS 1JLQB 1YIJS 5H9EK 2E1RA 2HGNA 4U7UD 2CQ1A 4AQYF 2MKJA 4X64F 4F0KA 3QT5A 3J7Z5 1X31C 3C46A 4WP3A 2QZ8A 5JJBA 3G8SA 4J9NA 3HO1A 1T03B 4Q8FA 3IRXA 3L09A 1KDNA 1M5KC 1U0HB 2WW4A 3PRBA 1ZAWA 4P7VA 3G4SS 1KS2A 1I1GA 2XMWA 4ELTA 5L1KA 1EHWA 2HS4A 2UZAA 1KFDA 2R7WA 1M1KT 2HFSA 3HVTA 4DR7F 3TJAA 4B3MF 4QWCA 1HWKA 4NI2A 3HZEA 3KJNB 4I7FB 3Q24A 4J9OA 2VQFF 2WBRA 3NKYA 2ZKTA 5KFXA 4GC6A 3PV8A 4YQWA 5E41A 3HT3A 2VA2A 4HTJA 1LW0A 1S5ZA 1YITS 2DHGA 1VQ5S 3CWJA 3LWMA 3KHHA 4MMOA 3D7SB 5J2QB 2K2PA 3TQEA 5LXRA 2HWHA 4J9PA 2I9SA 3Q2SC 4G6VB 3TP2A 2CA9A 1YJRA 2YWEA 5HBMA 3TRGA 1CSJA 3P49B 4PAAA 3IC1A 1FDAA 4PPDA 1HBMB 4ANEA 3QJLA 3DMJB 5L1JA 1OQ6A 3I96A 3P4UB 3QZ7A 2B8PA 4RUAA 1HQEB 2R8HA 2F63A 3BPDA 1KR4A 3AJ1A 1HBNA 4PG6A 2HNDA 2O67A 3WDOA 2OSQA 4D3HA 4TU7A 3BO3A 4DF4A 2RVJA 3KG1A 5K8PA 4ETZA 3KK2A 2XZTB 3W8GA 3TZWA 3R8YA 2CPZA 3FFIA 4EO8A 2W9BA 4DV0J 2C3UA 4JI8J 1RHKB 1N32F 1BLUA 3DCAA 3NRBA 4B9LA 3R5CA 4C2MA 3QLHA 4HH1A 3CUNA 4EBCA 1CBKA 3N5FA 2QLJB 3QIDA 3OL8A 1VHIA 5DGAA 2AGOA 2DNPA 2DY1A 4WFYA 3RAQA 2DRAA 3BH7B 6FDRA 2YY3A 4F4KA 2UXDF 3K59A 1L3SA 4ENOA 1G1XA 4PR6A 2BYCA 3N01A 2DBBA 2LYVA 4DV0F 1H98A 1WHYA 3AXMA 2LECA 1KHVA 2RQMA 2VU5A 3I82A 4ZK7M 3OVSA 1JXVA 3X3UA 3GIKA 5I4MA 3DRYA 3BM7A 3DYAB 3EVWA 3Q8SB 4J9QA 4M95A 1TL5A 1RBOB 4ED0A 1YZ6A 4OYZA 3KG4A 2OEMA 1MN7A 5K8OA 2RS2A 1FD8A 4YR0A 2QGFB 2QC3A 5L9XA 2AZ3A 5C25B 1DRZA 2CQ0A 2HLUA 2AJQA 5KAKA 2HHPA 2P2CB 4LIWA 1D3WA 1HMVA 4X84A 2BJ3A 2ERRA 4CH1A 5T7LB 2R7TA 1QY7A 1RUSA 3ITHA 4ANCA 4DR3J 4HL9A 1RADB 2IDEA 1YJWS 4LRDA 4RNMA 1D0EA 2R7UA 3QIPB 1IR0A 2R7QA 4K0KF 5LXYA 3IGVA 8ATCB 2E7WA 4OJ3A 4DUTA 4F0MA 4UY85 3AJ2A 1DAXA 2HHQA 1RU2A 1U6ZA 4DR1F 3IBCB 1SC6A 1WC0A 2MZ1A 1UJ5A 2KYZA 1WD6A 1Q95G 1TK5A 4ITSA 2UVVA 3FEYB 4Y2MA 2PI5A 3GSIA 1JNZB 3L9ZA 1R7IA 2IRXA 2QL9B 1RWUA 2CYYA 3PR5B 3DRSB 2E1PA 4CYUB 1RSCA 4IFVB 3MR2A 2GMLA 4FBUA 1PO6A 1U2FA 1H72C 4KGXB 3H5XA 4UZBA 1EX8A 4KRWA 1VQYA 5KG0A 4LJMA 3TR5A 3CB4A 1J5EJ 4CLLA 2A6OA 3MAHA 3DXSX 4O3PA 3PNIA 4NA3A 3IXQA 2ZDPA 4LFBF 3Q83A 4OZ2A 4FF3A 1REGX 1JLGB 4V19X 1Q5YA 4USJC 4DUZF 2BANB 3ENAA 3K17A 1FKPA 3M30B 1S1TA 4C0OC 5DDRC 1FD2A 1N6QB 2OI2A 1R0BG 4GO7X 4OYMA 2W24A 1SKRA 2VJVA 1XBWA 2O66A 2BA9A 3PX6A 2K1RA 3D3BJ 2N3LA 1FE0A 2RKIA 2JLFA 5F3ZA 3PEJA 1K8AT 4Q5VA 2ZC3A
chains in the Genus database with same CATH topology
2W4PA 2X1BA 3EPGA 1HFEL 3G8TA 3HHDA 4NLXA 3FCHA 2HFNA 4IQXA 4OHVA 1SUQB 5LSRA 2DISA 2OFHX 4F2RA 1KNZA 3UPFA 2PSZA 4CO4A 2GO8A 3G6YA 2VODA 1VMBA 3W7BA 4HHJA 4ECZA 3TAMA 4OL8A 2ADCA 1RT2B 4A46A 3MWBA 2JHEA 2CQDA 4QWAA 4KO0B 3DOLB 3KNGA 4B08A 1D8ZA 2M70A 2ZZNA 1QUPA 5LJ3Y 4ERDA 5EWGA 3PZPA 1J2VA 2WAQD 5FLXY 3OJUA 3CT9A 1GXTA 1GXLA 3KHLA 4NLVA 2VG5B 5D4PA 2R7SA 2OD6A 2W7OA 1XK8A 4YDDB 2UVWA 5IZHA 4R25A 1C1BA 4RW9A 2GCFA 3MEEA 3MDFA 3DXBA 4ZCLA 2JVRA 2HWTA 2Y1RI 4DQIA 4LQ3A 5AXMA 2V8VA 4B3OB 3LAMA 1D9AA 4H4OB 1JLBB 3H25A 2UUCF 1FF2A 2XSFA 4J5OA 4CT9A 3D54A 2ROGA 4TNOA 5L1IA 4A8MP 1LV5A 2UVRA 5CCMA 1VBZA 2IAJA 3CCWA 2Q1LA 2R2UA 1S1UA 5HROA 3P6YC 3PY8A 1HYSA 1JJHA 1JKHB 4Q8EA 3T6JA 2YNGB 5J2NB 1F0XA 4OFZA 1NJWA 3K0JA 1SH2A 2LQBA 3OFHA 2R8KA 2HMIA 3ZZ0A 1JJ4A 3NBPB 1DFDA 1V3SA 2RKIB 2XMUA 2PMHA 2GO9A 2K3IA 1U48A 1X9SA 2VB6A 5KG5A 1Q1KA 1N5YA 7FDRA 1VQ7S 3CXCR 3H98A 1VLYA 3VTIA 4M63A 1NNDA 1IBKF 4QQBA 2CIMA 4Y2IA 1IKVB 1NK8A 5D77A 5DM7Q 2CVIA 5IXUA 2ZBCA 1HI1A 4QWBA 3IRXB 4IDKB 3OV7A 5F9LA 1IKXB 2NS1B 4DV2F 1KC8T 3JTNA 2HHXA 3OTDA 1VRUB 4KGKA 3OTBA 4NA2A 3EGZA 2OPPB 2IC3A 1YJNS 5EX3A 3OUYA 4FP9A 1R8HA 4A47A 3KLFB 3KLHB 4KTQA 2DRBA 2L48A 4Y34A 1U45A 3FJ2A 3HVTB 4R8UA 4C0HA 2YKQA 2OKQA 4K4ZA 2FJVA 3IA0A 2ZD1A 1XEZA 3PO4A 3LGMA 1HBOB 5KFPA 3L95X 4RU2A 4DQRA 4B3TF 1BQNA 2KI2A 1S0NA 1L5UA 1H3DA 3QJPA 5IQ6A 2BRKA 2E1CA 5K9FA 2LXFA 1HD0A 3O1LA 3RB4A 4NZ6A 2GHVC 3M9NB 2AYEA 2GGPA 1Q16B 3SZ2A 5IS2A 2ZITA 3SQGB 4NCAA 5CYMB 2V94A 1YRTA 4H4OA 4KGMA 3KLIA 3T19A 4DL5A 5DLFA 3P3DA 2CQPA 1RISA 5E3QA 3BQ2A 1RTJA 4OJHA 3OBIA 1FK9B 3CIZA 5EHHA 3THPA 2KO1A 3TOQA 4I2PB 4PG4A 5K5MA 3F56A 1L3KA 2WSEC 1HWLA 4H4MA 4LSNA 4R5PB 4B3RF 1N0UA 1U1MA 4DSLA 2B0GA 3J80Y 4O3QA 1X5PA 3AAWB 1TK8A 2YH1A 1VI7A 4OQJA 1KQFB 1B64A 1R27B 2LU2A 2YH0A 3MMCB 4TKTA 1Q79A 4WXOA 4LT6A 2C3OA 5EX0A 2C28A 1C0UA 1U1QA 4ZVFA 4PUOA 4X66F 5GAEU 1RJJA 1Y9OA 1TR0A 3Q8RB 2HVZA 3CDBA 4P2SA 2N7YA 3F44A 4C8LA 2A2DA 2ZBIA 4C8OA 4A48A 4A8FA 3M8PB 2V4QA 2DIVA 2J6SA 2GQCA 2ZJPQ 4XDDA 1Q8IA 3IFEA 4H54A 5G0RB 1H38A 2DGOA 3OTCA 5D4LA 1H6KX 1HHTP 4OZ1A 5D4OA 3GYXB 4K5SA 1MW7A 4ZS6A 4IG0A 4ZP8A 3ULHA 3OFEA 2W8LA 1RT7B 1URNA 5FJ4A 4OX7A 5IT0A 2V8GA 2IVYA 2G4BA 1S49A 2BQRA 2XNRA 2MY7A 3DLBA 2CPHA 1HNVB 3DLLQ 4LVNP 2GQQA 3OLAA 2DB1A 4DR3F 1N5VA 2IM3A 1Y3JA 4I2QB 3D5MA 4R0JA 3GQCA 4NCGB 1RT1B 2UXBF 2WSCC 4ILRA 5EUHA 4RUHA 3V6JA 1VQNS 4ILMA 1S1XB 1HPZB 2RJZA 3MGJA 5L39A 2WW8A 2VKZG 4J37A 1VQPS 1IJFB 2GMJA 3MM8A 4DSIA 4QCLA 5DGBA 3NS6A 3OFGA 1LWFB 4FPRA 1SJFA 4QW9A 3O44A 1N34F 1ZM4A 4BS2A 2QYCA 1Z2LA 2EKYA 3OPKA 2B6AB 5HN0A 1TL4A 4TYBA 1QE1B 2ALZA 1XERA 2XMVA 5F3TA 4JI1F 2NZ4A 4DG1A 1HBUA 1T95A 1FRXA 3BGLA 1RA6A 3OTEA 2XG8A 2IVMA 4ZKAA 3NMAA 4FF1A 1PSDA 4RBUA 2XBPA 3OLBA 1U09A 4NLPA 3DRXA 1HWUA 4OZJA 4HVZA 4WU2A 4ZPAA 4AL5A 2HHSA 1U25A 4MH8A 3U27A 5SZTA 2DNLA 2FVPA 1BWEA 2KT5A 1GTHA 4MKAA 5HLFA 3BEGB 2J8AA 1UP1A 3EX7B 2F8MA 5DDPC 4IOAQ 2CQGA 2K8GA 2XC9A 1ZTWA 4NLQA 4PQUB 4OJ1A 5DLGA 4C4WA 4ID5B 3OXLA 2V9KA 2CQIA 2Q3PA 1TKXA 2AP6A 3O3LA 4ALZA 2PEHA 3D1OA 5KFWA 1TAQA 1VQ8S 2LEAA 5FIIA 4FF4A 5HO4A 2BRLA 1T7PA 2R2RA 4BC7A 4IH5A 3P96A 3QAEA 2EW9A 3MPYA 2DPIA 2OTLS 2NPFA 1WEZA 4MFBB 1NU4A 5GADI 4MYUA 1SH3A 2ZH1A 1QVGR 3IAS9 3TAPA 1N56A 2VG5A 1F9FA 3M9OB 2ILZA 1ZTTA 1JLFA 4WTYA 3UR3C 5KTQA 3IWLA 3KWMA 1JB0C 3FMBA 2E1AA 5MAOA 2IA6A 3NAIA 3TYTA 2E5IA 2WRMA 3R1HA 2BJEA 1FTRA 1TKDA 2LXUA 4NL5A 1R43A 2ROEA 4WIIA 2B9XA 3KOAA 2DNYA 2HW3A 3QGPA 3OR1A 2VFRA 1RT4B 4Y00A 2XZWA 3PXGa 5IQQA 3SV4A 3KK3A 4ZPDA 1YJUA 1RK8A 2QLXA 2RQCA 3CCTA 5DS7A 2MQLA 4YP3A 3RRGA 3TO8A 3TVYA 1VS3A 3DI6B 2J0XA 3K5OA 4F25A 3I5CA 2D7SA 1C1CB 1WTBA 1U49A 1YSJA 4K50A 1MSWD 2J76E 4RX6A 3DM2B 1IKYB 2JH3A 2FHJD 2VA3A 2ADBA 2VONA 2F1FA 4DN0A 1X0FA 3NS5A 1UMJA 1B7FA 2J0SD 4ZA1A 5F8JA 1IKVA 3H4DA 2PDAA 1S10A 2VG7A 5F8LA 4WE1B 4USHA 1TL1A 4KFBB 3M8RA 4WZMA 3E8OA 3DRRB 2IM0A 5F9NA 2IM1A 1L3UA 4I64A 3MM5B 3SCLE 5BYSA 1LWCA 4F67A 3V4IA 3WBZA 3PVXA 2UUWA 5I3QA 4MK7A 1YRUA 3RRHA 4DMZA 4K4VA 1SIZA 2E5JA 3T6BA 3OVAA 5CHCB 2OH2A 5IWAF 1NRKA 5AXLA 2L9WA 4TY8A 4DL6A 1C0TA 3M6UA 3ZZTA 1XNQF 4CNZA 1M5PC 5DQGA 3IN5A 4IH6A 1RT3A 2RRAA 1VQ9S 4AE5A 2DITA 4JI3F 1FKAF 2BDPA 1UJ6A 1B0VA 1GT8A 3I0RA 4ES1A 4OIXA 4OX6A 2KT3A 2DGWA 1FRIA 1LQ9A 3CCLS 3EGNA 3M8QA 4IO1A 2N7CA 3L7OA 3SYZA 3UD4P 5B0GA 3HHKA 1WI6A 4PG5A 5A8RB 1YJTA 3AB4B 1OPIA 1XTZA 3ZC4A 3KJVB 2QSFA 2I0XA 3SXLA 1HQUB 4BC9A 3VQTA 2OPQB 2JEGA 4ZCIA 3UW1A 1ROFA 1S72S 3HF5A 3BN7A 2MXYA 4PRFA 4RBVA 2LA4A 4ES3A 4IUFA 3GG0A 3B4DA 4ECTA 4AYBD 1Q8BA 1HBOA 4DV4F 2RS8A 4O4GB 2A1BA 1FNXH 4X62F 2CPDA 1W2IA 2PGCA 1RKIA 3R5DA 2HQ3A 2KT2A 2JFDA 4DR5F 3PHEA 2YWKA 1FRMA 1VIXA 1QSSA 4B9TA 1TL3B 4ZPTR 2C3YA 2MHEA 4KE5A 4WYWA 1A7GE 1NKCA 3PIPQ 1N52B 3AHPA 4JI4F 1UFLA 2DHXA 1MROA 3M8PA 1FK9A 3TW0A 2MQPA 4NXMF 1D9FA 1SXLA 3ISNC 1C4CA 1FEHA 3LP0A 3L3CA 3HM9A 3G9CA 5HBMB 1O5JA 3D0GE 4RW4B 3THTA 4WCEQ 2J7KA 1J5EF 3D0HE 4N56A 2WB1D 2MMYA 3MXHP 2MHNA 3I32A 1HQEA 4UY8T 4OX9F 2XI3A 4G3IA 3JB9k 3DHXA 4RBTA 3J81Y 1M5SA 1NH7A 3FFIB 4TQRA 5F8HA 1UAWA 2CJBA 2YVSA 3LUYA 3CVKA 4DJBA 2MSTA 5KFGA 2J5AA 2ZH6A 4P6QA 1Y7PA 4AFFA 4LFCF 2HWIA 3WZ0A 2RILA 3B78A 1AUDA 2KVIA 2XY5A 4OI4A 1Z4UA 4DV3F 4CO5A 2EFOA 3HZGA 2CRLA 3BDPA 3I9V9 3RBEA 3M2RA 2V4JA 5AE2A 4I7FA 2G9OA 1XMOF 2KRRA 3DGPA 5B0DA 3HP6A 1LKZA 2QRRA 2VBXA 3ZZPA 4URGA 3MR5A 1LK5A 2NSBA 3GR0A 3QWUA 1U1LA 1T05B 4CCHA 2XLIA 4ZCMA 4JV5F 5CH7B 1NK7A 3J7A1 2WCXA 2WK4A 3QGHA 2XS7A 1S9GB 3GFXA 5KFZA 2DNHA 3T1HF 4OHYA 1SJ3P 1OSDA 3VR1A 1O8BA 3DU5A 1VRTA 3MUMP 2C2DA 1I6JA 5KT4A 3E01A 4EYIB 1S7HA 3MPVA 4N8OA 2ZJQQ 4E8UA 3AA9A 1TKXB 1WEXA 1RQ0A 1U4BA 2B4VA 3AA8A 4XIUA 3C6TB 2X1AA 3R3TA 1ZH5A 1FNOA 5J2MB 1HNIA 4CH0S 5IT9Y 3UNGC 4ETXA 4DOZA 2PC6A 1LFPA 2J9EA 2FLLA 4DV6F 3MD1A 4KSEB 4Y6IA 4HKQA 2HHVA 2AV5A 2J9DA 2CQ4A 4NLDA 3FEZA 1D8YA 2YX7A 3NNAA 3V4MA 2MPUA 2R4FA 2VL1A 5IM0A 2OPRB 3KMSA 2RIJA 2HNZB 4NLTA 4ECXA 1JLGA 4V19J 4FVCA 1YBAA 2W9CA 5KFBA 3QMQA 4XDCA 2AGQA 2DGQA 3CF5Q 3KTQA 2EFPA 1LXNA 1VHFA 1JLFB 3DHWC 3J7YU 3I5AA 4OHXA 5J1PA 2ZH2A 5CCLA 1UW4A 4Y65A 3CDWA 5DRKA 2ZH9A 4DL3A 4FNIA 4C0BA 1RI7A 1HMVB 3PFOA 1S0VA 4B9UA 3G6VA 4DEZA 5K8NA 3M32A 1W25A 3GFHA 1FJGF 5H9EJ 2OMOA 2KTQA 5CYQA 4KV8B 3GSDA 2C42A 3FEXB 1R6YA 3GZ7A 3PW4A 2EFGA 5J2PB 1S9EA 1T05A 2PN6A 4HH0A 2KM8B 3BQ1A 4YOEA 1HA1A 3I56S 4DV1F 2EG1A 2QT7A 2KFZA 4NYOA 2PT0A 1REVA 4J9KA 1FDNA 1RT2A 4DS5A 2AD9A 1OPZA 3BR8A 4LVOP 2GW8A 5EGYA 2ZHBA 2E66A 1TAUA 1H2VZ 1LWEB 3DOLA 3SFUA 2I5JB 1KFSA 1T3OA 4C98A 5B0BA 1VQ4S 5BYRA 2MKKA 4JYAF 3RR7A 2VOOA 4Q45A 5E3RA 2HFZA 3TUIC 3RTVA 2XS5A 3T9NA 4DF8A 4BBYA 4Q43A 2OTJS 3CCZA 5A2QY 4CO3A 2R2SA 2XB2D 2DH9A 4F02A 1H2UX 3TX8A 4QU7A 3LGNA 2O01C 3DLEB 3MECB 1HW9A 1R8AA 3DMJA 3MM9B 4JBCA 3T9ZA 1FJCA 2HPUA 2JJ4D 4NLSA 4JI0F 3VWSA 2LMIA 1KONA 2BBEA 5IT4A 2O5DA 2MDAA 3BDEA 3SSSA 2YWHA 3CD7A 3EYZA 2HVIA 4IFYA 4M5DB 3SV3A 1QSYA 3N0VA 1QUVA 3QLHB 1WHXA 2CJAA 5HQ8A 3T5KA 2F9DA 2QMXA 3RYLA 3D1QA 3HHLC 3IR6B 5SUHA 1V3RA 2QSWA 5JXSA 2H5EA 4OZ0A 4WE1A 1TL1B 4KFBA 4RNNA 2SXLA 2B3TB 4QR1A 2FLPA 4GKJF 5G4DA 3R5AA 2Z2LA 4O44B 1HWJA 2FC8A 3PJXA 3O5TB 4B9MA 1H7WA 4TU9A 5J2PA 4FXDA 3FMWA 1VC6A 2B7BB 4O4GA 3BB5A 3NG8A 4TY8B 4H4KC 4WF9Q 1VQSA 4TN2A 1JLAA 1ZM2A 2C22A 4IR1A 3G86A 3KLGA 2FB0A 5T7LA 4YMEA 2RQKA 2Y1JA 3I0RB 5KFOA 4UUXA 1JLBA 2JL9A 1N0VC 1SJQA 4C3MA 3RB0A 2DR7A 3HPOA 2HVHA 4NYZA 2BVZA 5A8RA 3GIJA 1K1QA 4CNYA 4NLRA 4QW8A 2IJNA 1HYSB 5DG8A 4QJVA 4FS1A 4B3SF 2QA4G 4NLOA 3K5MA 2F9JA 3OR2B 4QU6A 3Q23A 3RBDA 3FRYA 3ZZYA 1Q78A 1SIWB 1CEZA 5CXTA 1IXKA 2CQ2A 4LSLA 2Y0SD 3AH6A 3TA0A 2HS3A 1OIAA 1X4FA 1K73T 2NUUG 4ECYA 1L3VA 4NXNF 4ECVA 1E6VA 3SDEB 3C66A 4ES2A 4I6AA 4ZPVR 4JV0A 3CE8A 1IQTA 3MF5A 3M6WA 2ACYA 5DETA 5KFMA 1FKPB 2ZOFA 2E1MC 4B17A 2XMTA 2FPHX 4QIWD 5DDOC 4HI2A 1YRXA 2HG4A 1FRJA 4IDKA 4ZVGA 2D3ZA 2UU9F 4PXEA 4DL2A 2WONA 1DJ0A 3ENWA 3IR7B 1WG5A 2IC3B 3LW5C 4W92B 2LLZA 3AQOA 3CO9A