1O51A

Crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
89
Chain Sequence
b'HHMKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TM0021
publication title Crystal structure of a putative PII-like signaling protein (TM0021) from Thermotoga maritima at 2.5 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 19
structure length 89
sequence length 102
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02641 DUF190 Uncharacterized ACR, COG1993
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o51A00
4C3KA 4RLEA 4YB7A 1UL3A 2CZ4A 1VFJA 5D4OA 2XBPA 1NH7A 3NCPA 4OZJA 1GNKA 4USHA 2Z0GA 1J2VA 4CO2A 4Y65A 2EG2A 3MHYA 4C3MA 2VD3A 2GW8A 1PILA 4D3HA 3HLUA 4CO4A 3NCRA 1UFLA 3O5TB 4CO5A 3TA1A 2XULA 2J9DA 4RX6A 4E98A 3NCQA 4NYOA 1P1LA 2XZWA 4WK3A 3T9ZA 5L9NA 2NUHA 3DFEA 2PIIA 2E66A 4ZK7M 1UMJA 1V3RA 3GSDA 5D4NA 4YB6A 1UKUA 1NAQA 1V6HA 4WK1A 4IYQA 3AA9A 2NS1B 1NH8A 5D4LA 4CO1A 4CO3A 3X3UA 1VHFA 1XK8A 4OZNA 4D3GA 2XG8A 4RWXA 2NUUG 2V5HG 3CE8A 3OPKA 4AFFA 3N5BA 1OSCA 2O66A 2GX8A 2ZFHA 5D4PA 1HWUA 3LF0A 4YB5A 2EG1A 4USIA 5DRKA 3O8WA 4Y6IA 2O67A 4CNYA 1O51A 1V9OA 3L7PA 4R25A 1Q1KA 2DCLA 3M05A 3TA2A 4OZLA 3AH6A 4USJC 4CO0A 2GNKA 3AA8A 4RWWA 3TA0A 2J9CA 2JJ4D 2J9EA 1H3DA 1NZAA 4NYPA 5DS7A 3AHPA 4C3LA 2RD5C 2J9DE 3BZQA 1O5JA 2ZOMA 1KR4A 1QY7A 4CNZA 1V3SA
chains in the Genus database with same CATH superfamily
2R7TA 3DYAB 1R7IA 4AL6A 3HSJA 4HYKA 4F4KA 3PW7A 2AYMA 4IFYB 3QATA 1UVLA 5KFDA 3M2UA 2D74B 4F25A 2JLEA 5LMUF 3NMAA 1RHJB 3CJTA 4YY3J 2EG2A 3EGWB 3MMCB 3I0SA 2LCWA 4TY9A 4MJKA 1RHKB 4QPTA 1JJCB 1HD1A 4NCGB 3LW5C 1Q0NA 2QO3A 3TUJC 1FWLA 2YKQA 3U7JA 2B9EA 4MIBA 4UY85 5HLFA 1FRLA 3NGRA 1SV5A 2HGNA 4ZVPB 4CT9A 3R7SB 2C3YA 2K1RA 1BY9A 1T9TA 2VBXA 2A2CA 3LP0B 3OJUA 2NXJA 4F4ZA 3KTQA 4K8RA 4NLWA 2UV8G 2E7WA 1H7WA 1HWUA 4JI3F 3PNIA 3ISZA 1X31C 2N3LA 4N47A 2DTJA 2E5LJ 5FIIA 5HO4A 1FJCA 4IH6A 1T3NA 4RBTA 2PMHA 2DRBA 2R3VA 2X1AA 2O1PA 3OHBA 5DG8A 3IO1A 1HQEA 2WW4A 3NY0A 1ZTWA 4WKRA 3H5XA 4OZ5A 2R7SA 1YJRA 2EEYA 5B0AA 1NKBA 1FDNA 4AQYJ 3HD2A 2XZTB 4EYIB 1S9GA 2M0GB 3G6ES 7FD1A 1Q82T 3PW2A 2NUHA 2N7YA 1XEZA 3LGHA 4KPCA 4Y3CA 4OMFG 3TP2A 2R8GA 1UW9A 2MJNA 2OMOA 3EVOA 3AB4B 1N34J 2MMYA 4RW9B 3FC9A 1AZSB 2DB1A 1RWPB 1CQNA 1NKCA 4YB5A 3KLGB 1OPZA 5CCMA 4FVCA 1DZ5A 3KWMA 1JLBB 3RR7A 3L9ZA 4WFAQ 2DNPA 2B4UA 1H3DA 3PV8A 5HVHA 1JLAA 2GMHA 3K5NA 4HI1A 2L3MA 2J9DE 1ZBTA 4OZ3A 3DLJA 3ZTQA 4DF4A 4JI5F 3VAJA 2CZ4A 2DO0A 4ETZA 2PMZD 1SJ1A 3MURP 1FRIA 4OYAA 3WC2A 2MKHA 1QJHA 2M70A 5HQLA 2VASA 8ATCB 4YUDA 3V81A 4B3RF 5ETLA 2OP5A 3I0RB 2XMTA 3J80Y 4DFPA 2ZOFA 5D0EA 3NBPB 2H3EB 2CUYA 1RACB 4DR4F 2MQNA 2V68A 1VQMS 1R31A 4H4OB 4O3NA 5HQ8A 2YPZA 5BYQA 1M5VC 1MW7A 2B5JA 2R2UA 4LF9J 3HJFA 2XSJA 4HACA 1FT8A 3I9V9 2N4DA 5L39A 1HWKA 1UP1A 5IZHA 2FB0A 5IC4B 2DNGA 3W3SA 3FK4A 3VAGA 2HQDA 1K44A 1JKHB 2KVIA 2AV5A 4WFYA 3L95X 2FZGB 3UI3A 4USTA 2R7WA 2QT7A 2WB1D 1D8YA 2ZOMA 3GYNA 2Q66A 2B9WA 1KVIA 8RUCA 3D9BA 1M5KC 1ITPA 2JWNA 3FFIB 2OTLS 1YRTA 4EUVA 3MUMP 1OS5A 5IC6B 2W1BA 2ZH6A 2JEIA 1VLYA 1EIYB 3R6GB 4GVLA 1FCAA 1AUDA 4FF2A 2W2NP 1Y0HA 2J0SD 4MK7A 5D4LA 3CJ0A 2XMKA 3KJVB 3M32A 3TW0A 4NXMJ 1CJTB 5IQ6A 3CMES 3OUYA 1VIXA 1VIOA 5DQHA 5CAAA 2L9DA 5C42B 3Q86A 3HHLB 5EWFA 2BJDA 1RA7A 5CQGA 5J1EB 4FXDA 2JVRA 2IJRA 4U6PA 3V4IB 4NLQA 2V2QA 1CJKB 1XNRF 1HPZA 5CYQB 3R7BB 3WDOA 1FDAA 4USUA 1N5YB 5F3ZA 1S1VA 5J2MB 4ECTA 1RKJA 3AJ2A 3GFZA 4XTTA 3GB0A 1YBAA 4BDPA 3NWGA 3OTCA 2RIJA 5I42A 1FHTA 2HRUA 2GVDB 3KLVA 2ZBRA 1R0AA 3PHEA 1QUPA 3GIIA 3DHWC 2KZZA 1NJIT 4ZMMA 2FHOB 2M88A 1S1WA 3VR1A 4ETXA 3EZ5A 5ETMA 5HBMB 2PGCA 2PD1A 3RJMB 4XK8C 4CLLA 4JI8F 2V6AA 3TX0A 3TNVA 3B82A 1RAAB 3DHXA 1B0PA 2YKOA 1DTTA 5E2QA 1X5OA 3PO5A 4BCAA 3THTA 4NLXA 1RT6A 3DLKB 4M5KA 4FF1A 2OFGX 1RWUA 2JEJA 2G2OA 3VGVA 3CD6S 3CJ4A 2ASJA 1XMOF 3B4MA 4KQZA 4K4UA 2P2CB 2E5IA 3R5AA 4ZHRA 5LSRA 1DQ9A 2DY1A 1WI6A 2BVZA 2VFRA 1HWLA 2CPHA 3W65A 2D9PA 1RT4A 2LEAA 5FLXY 3EE3A 1JMTA 3QAUA 4LT6A 2QMXA 4J7CA 4EO8A 1Q78A 4OI3A 1TL1B 2J5AA 2VV5A 2ROGA 1VBXA 5DDRC 4DV0F 4MAKA 2MJUA 2YBVA 4DG1B 2FVQA 1OYEA 5DQIA 3DXBA 4OX9F 4DV5J 4O3PA 1N32F 1MMLA 4DR7F 1H7XA 3SDEB 2YKNB 1VK8A 1XIQA 1NK9A 4FN5A 2HBQB 3M6UA 3Q8QB 4KO0B 5C25A 2GV1A 2EKYA 2UXBJ 1GFWB 2GFFA 1UL3A 1HW8A 4P9SA 4N8NA 2ZBIA 2VG7B 2UZAA 4LF5J 3AJDA 1LV5A 5B0CA 5CYMB 4QWAA 5IT4A 4I2QB 2ZE2A 3MMAA 2MKJA 1JX4A 4OYPA 4CH7A 2PIIA 4F4YA 5IWAJ 2ZC4A 3I87A 1N5VA 3KFWX 2HHXA 2FGOA 4ZJLA 1HARA 2CQIA 6FDRA 1SQFA 3BYRA 1IQZA 1ZAXA 2YNIA 1LNQA 1RXOB 4WFBQ 4NXNF 1UPPA 4DN0A 2BRKA 3W60A 3LOUA 3ENQA 4PWDB 2D69A 2ACMA 4MYTA 1HBUB 3DNCA 5GADU 2W4DA 3E01B 1N6QA 3MUVP 1YRUA 4NX9A 3HVRA 4G1PA 4MIAA 1EETA 4V1Ak 2PE8A 4C0HA 3JSMB 2Y0SD 4DSFA 3I9ZA 4PQUB 4V19X 4QOTA 2XLKA 1WHYA 2V4JB 3CCJS 1IVZA 3KXDA 3QLHA 2W8LA 3ZTSA 3HKZD 3RYLA 1S4EA 1JLFB 1ZM2A 2JVOA 2ACYA 4K2JA 2ALZA 3W7BA 4ZVUB 3ZZRA 1HNWF 3PX4A 4CLWA 2EC0A 2W9CB 4OYOA 2QA4S 4P7TA 1HBNB 4M5DA 3SMZA 2ZNYA 2XGPA 2V9WA 3D0HE 2VPZB 1X4GA 2EG1A 3CD7A 5BYSA 1MROA 4NLUA 1S1TA 4OX6A 1KFDA 3H98A 3TA2A 3E2EA 1FX4A 5K14A 3N01A 3RGIA 2HFNA 2XI3A 3FQKA 5AXKA 4HDGA 2K3KA 1FX2A 1HBMA 3Q23A 1Y7PA 1FA0A 4CZCA 2F63A 2RAQA 4ZVQB 2WZ1A 3FUYA 4M63A 1S9FA 2GVZB 4KRWA 3CCRS 4DMZA 3MUTP 3CCWA 3G82A 1AT1B 3TA1A 2CQPA 1QTNB 2J9DA 2E7XA 3QYYA 4J9RA 2I38A 1CC8A 2BABA 3IP0A 3D5MA 2XYPB 2N4CA 1AFIA 4PRFA 1N33J 2G0CA 2NQPA 4Y0FA 4RWXA 1RT1A 2NZ4A 3GMGA 2OHDA 4ID8A 1C4AA 2HFOA 3LP1A 4WFXA 1YK9A 1NK5A 3QAEA 4TN2A 1IKXB 2VPWB 3BN4A 1NHUA 3BSNA 2YNFB 2Z56B 2CA9A 3LAMA 2GA7A 4R0EA 4X4OA 1FRXA 2V2ZA 2AGQA 2CNNB 2LXFA 2EC2A 3M8PA 2XWXA 2E1AA 3PCOB 3CUNA 3ZZPA 2HQFA 1IBLJ 2QFJA 1LW2A 3OD2A 4ZVRB 1FK9B 2W9BA 3FSIA 1K9MT 3EGNA 3ILLA 1RA6A 3HD1A 3FEYB 2CAJA 1UFLA 4YEAA 3CJ2A 3UCGA 1C0UB 4W4MA 3GR0A 1N4LA 4DR3F 4TQRA 1C4CA 1T9VA 2XS2A 4K7QA 3TAMB 4Q43A 1J5EJ 3O1LA 5IQQA 1S6QA 3CJKB 4CLZA 4NA1A 2UXCF 5DZ7A 2WOMB 4ED3A 1WKKA 1T94A 3ICLA 2ZHOA 5JMNA 4M5HA 4X66F 3K59A 2W2MP 5DM7Q 1S1UA 4WTYA 3JQMA 2FJDB 2D3ZA 2OGUA 3SCLE 2HNYA 2VG6A 4IRCA 3L7PA 2IM0A 4URQU 4JUZA 2M5YA 3CC7S 1JLGA 2I5JB 2YQ0A 2GJ2A 2VG5A 1XTZA 1JK9B 3LP2A 1RAJA 2OPSA 2Y3YA 2VC0A 5IFMA 3GV7B 2RJZA 4NLTA 3MZIA 4W92B 4RL1A 2VONA 3V6KA 3V6DA 4NL5A 2CG8A 3AFGA 4F3MA 4ED0A 4ALZA 2RHSB 1W2IA 3NCQA 1D9AA 1Y10A 2XZWA 1FJGF 2DNKA 3M6XA 4LUBA 3JS9A 2IVYA 5D3GB 3MM9B 2H5JB 2VQFF 2E1PA 4G3IA 4YHHF 4MH8A 3ZNJ1 4HL9A 1RLCL 1U1NA 3QFHA 3NS5A 2MKSA 1RI7A 4FVMA 4F8RA 1V5VA 3KHHA 1T9XA 1DFDA 5G0RB 1WF0A 2XWYA 4CM2A 1A0OB 2H65B 4YB1P 1D1UA 2DY9A 3FBEA 3QT5A 1RT3A 2G0IA 1Q1KA 5CHCB 1Q7LB 3T3FA 2LQJA 3G9CA 1UWBB 1TFWA 2CXEA 4A8MP 1RAFB 5KFTA 4E8UA 4C3LA 2QSWA 3HKWA 2F65A 4DR5F 1CVJA 4B3TJ 4FPRA 4CM0A 3MPDA 2X1FA 3C6UA 1KVJA 1ZTTA 2AX1A 4KKOA 2KM8C 1NZ8A 2DEJA 3M8QB 3PJWA 2JLGA 4ED5A 5GVQA 5EGYA 4DL0C 2KVQE 2WONA 4NZ7A 4PKDB 4J90A 4AUKA 4IO1A 4CYUB 3M8RA 1X0PA 4UOGA 4QW8A 4ZVEA 4PR6A 5DG9A 2MYFA 1VQKS 3JAMU 4ES2A 2OAUA 3Q8UA 2ABYA 1RWOB 4NA2A 1NSAA 4F67A 1I94F 1HFEL 4ZCIA 2Q79A 3SSQA 3N28A 3TWZA 5LJ5Y 7FDRA 4Y28C 1S0MA 3CIMA 4K4TA 4FZVA 4AFFA 1TZ0A 1HR0F 1FTRA 2RSQA 2BM1A 2B4OA 2WBRA 1OY8A 3QGIA 1S0OA 1RGVA 4ITSA 4N5SA 1WACA 4EU0A 1KS2A 5ADZA 5F41A 5MLCV 1RTDA 1HYSB 2Q3PA 4LBIA 1BQNA 1CJVB 3GJQB 2GAGC 1HW9A 3HZEA 3ZZTA 5CYJA 1WOSA 1TMJA 5KG7A 4K0KF 4DZDA 2KT2A 3O5TB 4ZKAA 5KAKA 2RRNA 3DU5A 2K2PA 2NLWA 4ZPAA 2B43A 1PC4A 1Q8BA 4F50A 2AYBA 2E44A 1RTZA 4KPYA 1N88A 1EARA 2YWGA 3JSYA 5L8RC 4ILMA 2NUUG 2RHQB 1S9EB 2BJ7A 2RRBA 2KXHA 2VHGA 3IBWA 2VBYA 2HFZA 3W9JA 5T41A 1YRXA 2BR0A 2KJWA 1NRKA 4NMLA 4WZQA 3CXCR 3C14A 3CGIA 1QE1B 3ITHA 2BKNA 1BC6A 3NGKA 3GZ7A 4DV6J 5CA5A 1U1RA 2V2KA 3HMJG 4F3QA 4L72B 4XAKA 1C0TB 2ZC3A 1RAOA 4O23A 4CLSA 1X4FA 2DGXA 2BXJA 1HI8A 3MR6A 1K1SA 5HATA 2DNHA 3LPYA 2LU1A 3ZFVA 2AYGA 5D4OA 2V4QA 1WTBA 1NPPA 3PKMA 4I2PB 2MKCA 2COLA 3EUNA 4OI6A 2HLTA 4ERDA 1QSLA 4O3OA 3O44A 3R7NB 3MECB 1IN0A 1UKUA 4YY3F 4A46A 2KFNA 2OSRA 1XK8A 2ZOGA 2QYCA 1KN6A 2IYIA 1Z2LA 2DISA 2H1YA 1QD1A 3J81Y 3U1LA 3T1YJ 4JV2A 2IDLA 1NHVA 1FEEA 3PEJA 3K58A 3VVUA 3KLHB 2P6TA 5A0YA 1N5SA 5D0RA 2GNKA 4IUFA 4NLYA 4QPXA 4HTIA 3PACA 3KLIA 2ALYB 2QLJB 4S0MA 5SUHA 3GE9A 1V3SA 4WWSA 1HQUA 4ECXA 2H51B 3IS9A 2E5LF 2ATLA 4RKUC 5EX3A 2UUTA 4PUOB 3GJSB 1IKYA 1R8HA 2PFFB 4N56A 2VOOA 3KOAA 3BKUA 3QWPA 3BSCA 2IRUA 4OYIA 4BS2A 4DV7J 3J81j 1HBOB 2HMIB 1UZDA 2ZM6J 2MQPA 3T6JA 1S6UA 2PO4A 1GTEA 2C2OB 4KH1B 2G2YA 2ZVIA 1JJ4A 2AJ4A 3DGPA 3EM1A 2MB0B 1JLEA 1SC4B 4AQYF 1XNQJ 1ZH5A 2CWKA 3TZYA 2JEFA 4BLGA 1ZA2B 3MMBA 2DGTA 2HWTA 3MAAA 1JJ2R 2O3DA 5KG6A 2PT0A 3UN3A 2J7WA 4A8FA 2RQCA 2Z4PA 2HNZB 3ELHA 3ZNUA 3TANA 1N34F 3R1LA 3M1VB 1KQKA 4WZMA 4ZLLA 2IMWP 5EWGA 1QSYA 1VQ9S 3OTDA 4Y34A 1O5JA 2FVSA 1ZS6A 4F4WA 1XBWA 5L1LA 3RBZA 2W9AA 4NMXA 3NCPA 1ZM3A 5IOLA 3RTVA 1T9YA 3QT6A 2OUGA 3BH6B 4X65J 3DM2B 3C8YA 4ECWA 2RS2A 4IFVA 2DR6A 1J5OA 3V4MA 3VGTA 3OTOJ 1VC5A 2FHJA 3D67A 4QR2A 4I6YA 2J0QD 4RBVA 1LEOA 4F02A 3S1TA 5KFJA 1RP5A 1WF2A 4LF8J 3UVJA 2V63A 4JB8B 2IYGA 4ZPWR 1NJWA 2XHWA 1RTJB 4MK9A 4DUYF 5CCLA 4EWTA 3KHGA 4K4XA 1WUUA 5LOQA 1S6OA 1CBKA 1FF2A 3G6VA 4GKKF 2LQBA 4BWMA 4QWBA 5E3QA 1FKOB 1IXKA 1WD6A 3IM8A 4RNOA 5I4MA 4LF9F 4C8ZA 2LVWA 5L1KA 2DYAA 5KT4A 3HSZA 2J9EA 4AE5A 2VA3A 5H9EJ 4DZ6A 4ZVSB 4ZPVR 1NJYA 2ZDOA 1RU1A 3KHLA 5KFUA 1VHIA 2X3GA 1WHVA 2ATCB 4I68A 4ZP9A 3ET6A 2MQ8A 2FYXA 2BJ3A 3HHKA 4O3SA 3UCZP 2HVIA 2XMAA 4PZVA 4DR6J 2IAJB 1A7GE 2GMJA 2O01C 4KSEB 2CRLA 1RDRA 3NNCA 4C0BA 5A8WA 1S1XB 3TEGA 1GMWD 5DO2A 4NRUA 5EX0A 2C2MB 2NYIA 2EVZA 2A2DA 1W25A 1T03A 2EBEA 4DUZJ 4RW7B 2MDAA 1I3OB 3BSAA 1J27A 5AE1A 2HGMA 2KH9A 2PA8D 2DPJA 4OJHA 3IRXB 3IG1A 4WIIA 5M2RA 4E2FB 3CD5A 2UV8A 4IO9Q 2CPYA 3TZXA 2I0XA 3FGVA 2ZJPQ 2CKWA 5DS7A 2C2NA 1GXTA 4KV8A 1PYOB 2W4CA 3WZ0A 4MKAA 4JI6J 4I67A 4YB7A 1F9HA 2FQQB 2E7VA 2PC6A 2HQIA 1S12A 2ZD1A 3O3LA 4EZ6A 2ZBQA 3ENVA 4YN3B 4RX6A 4MT1A 1Y3JA 5FD1A 2VDIA 1TKXA 3KUEA 2HAFA 3J7A1 4OIXA 4MMOA 1VBZA 1U1LA 3QGGA 2OFHX 2DR9A 2D9OA 4ZLPA 4ED4A 1RQ0A 2CQHA 2L9WA 3UO0A 4P72A 5HK4A 4IOCQ 2HK2A 1E6YB 1HNZF 3MOZA 3M8WA 3RB6A 2GHVC 1GAOA 4PG4A 4JV5J 3RW7A 2MHEA 5KG3A 2HZAA 4RZRA 4TQSA 2HWIA 2XLIA 1Y3KA 1UETA 1UVJA 4WBFA 3HVTB 4Z7CA 4Q2MA 3KJFB 4IOBA 2C2RA 1RBLA 3QO9B 3W2WB 2I8EA 4JBCA 1UJ6A 2MSTA 1U1OA 5L9XA 3KUGA 4BWJA 4RLEA 3N5FA 3VV2B 1R43A 1FFGB 2RE1A 2FJBB 1L3VA 4QQBA 3P6YC 3GU0A 2LQ8A 4U8YA 1RT2B 2P8IA 4DS4A 1NK7A 4ICLB 2JRSA 4DU8A 4ZPTR 4A48A 1L5UA 4H4MA 1MWQA 1X4HA 5A2QU 3SCJE 2AYEA 1SUQA 2KM8B 3L09A 2RU9A 2E5GA 4G1QB 3RRGA 1QUVA 1ZAWA 3VAMA 1JXVA 3EVMA 4M5GA 3KK2A 3MEKA 1N48A 2K7KA 2IHR1 2RF2B 4J37A 5HMYA 2AW0A 4RO0A 3CDBA 4B02A 5J2PB 5H1SV 2XMWA 3Q8YA 1WEZA 9ATCB 3PYFA 2KI2A 3BV8A 3MMJA 5IV3A 2N82B 2IJFA 5E3CA 8AT1B 1U4BA 3POTA 1GMVA 3CD0A 1T7PA 1EZZB 4J9MA 4KHRA 1TL3A 1A9NB 3KDNA 3K0JA 6FD1A 3SZ2A 3TZZA 2E9RX 2Y1LB 4HKQA 4R5PA 4DV5F 1FRHA 3DYAA 3MM8B 2VODA 3CF5Q 1D8ZA 1S99A 1UFWA 1KBRA 3IC1A 5G4DA 1VJQA 2MLYA 3SEOA 4TYAA 3NWRA 2RU3A 3J7YU 3MMCA 4WXOA 4GO5X 5HVGA 2NYHA 5THWA 2Z2YB 3K8VA 3C3LA 3OJSA 2UXBF 4P52A 4M95A 3DU6A 5DDPC 4NCGA 2B6AB 1EHWA 1HA1A 1VMBA 3DFEA 1S6PB 3DKDA 1VQ6S 3QRQA 4WK1A 4LVOP 1AA1B 2VJUA 2DHHA 1NUEA 4C8MA 1KQGB 1RJJA 4WFZA 3AOBA 3LP0A 2ZBCA 2KYXA 1YJVA 4N41A 3SQGB 4X4TA 4OZ0A 2IA0A 4OZLA 3AXMA 3PG9A 5D6GA 5F8GA 1M1GA 1U7LA 3HXMA 4QR0A 2PI5A 1RABB 1DY3A 4TXSA 2QMWA 3MEDB 3BF4A 4DV4J 2JDJA 3FKBA 5J2NB 3MCNA 1X4AA 1FFWB 1Z2ZA 1RHQB 3ULHA 4B3MF 2A3JA 2M2BA 5KFVA 3GFYA 1FRMA 4C8LA 3SFGA 1NK8A 1EP4B 3W5XA 1RU2A 3K8WA 2C2DA 3CTRA 3DMJA 3P4UB 4OLOA 3T5HA 3ZZYA 2ILZA 2BZ2A 7AT1B 4O3QA 1AZSA 5LMNJ 3KLGA 1U26A 2C42A 4LSLB 3U02A 2DNOA 3ISNC 1TKDA 1JLCB 1JLBA 4OZ1A 3KK1B 4B9SA 4CLUA 4URGA 3KMQA 4NPOA 4KHPJ 5J1NA 2ZHAA 3UD4P 3PJXA 1I51B 2OI2A 4OI1A 2CNOB 1H72C 1P6TA 4Y2AA 4KFBB 1BWEA 3MF5A 4B9LA 1IKVB 3H4BA 2BUNA 4QU7A 4AL5A 3L4BC 4YDDB 3I0RA 4R0JA 1AW0A 1NB2A 3NMRA 1FVSA 4Q5VA 1DLOB 3NBPA 2ASLA 3BH7B 3JTOA 3MAHA 4QIEA 2AD9A 1UMJA 2HLUA 3H59A 3DOKB 4FPIA 2XY6A 1G6BA 1B7FA 2XNQA 2EK6A 4H4OA 1NM2A 2H5EA 2JC1A 3H5SA 2BEFA 4U67Q 1GTHA 1F60B 1KQSR 3OSNA 4PXEA 2HNDB 2XSFA 1NDLA 3SI8A 2O66A 1O8BA 3IR6B 2WVEA 4DFMA 3EXYA 2PA3A 1UVIA 4OJGA 1N33F 2V8VA 3K57A 3ETOA 4DN9A 3M32B 4N77A 1JKHA 3DLEB 5IM0B 2KFZA 1T95A 5F0WA 2QL5B 4DX8H 4G6VB 5KFYA 3D1QA 1U8WA 3EYZA 3W1YC 2MQQA 4LFCF 1BQMB 3FFIA 1Q8IA 4UY8T 5DLGA 4C0OC 4O3RA 3UDEA 3D3CJ 4ZJOA 4I7FA 4GMKA 4YMEA 3M9MB 3IA0A 2HGLA 4NYOA 4C11B 4C4WA 4WFNQ 3BQ2A 4PWUA 1S10A 2OEKA 1UW4A 4GC7A 3PR4A 4MFBB 4WYLA 2UXDF 4DFKA 2HS0A 2GIFA 4ZOSA 2NXCA 2F4FA 3KJVA 4PYDA 2HVHA 1UFKA 4OJ1A 1YJNS 1CJTA 3FVYA 1MN7A 4ZVFA 2CQDA 5C42A 2IY5B 3HHLA 4OYZA 1J5EF 2IA6A 3IWXA 2J0WA 4ANCA 4DL5A 3BQ1A 1MU2B 5J1EA 2KHDA 3R2DJ 4OQJA 4YDXA 5AE2A 1NO8A 3V4IA 3BGRB 3EDQB 1F0XA 1CJKA 2V34A 4DPUA 1N5YA 3D6HB 4KE5A 1VFJA 4QWEA 3AD9C 5JVGQ 2UVVA 5J2MA 4LBHA 1QVGR 5IS2A 1X60A 5CABA 2GVDA 3OLBA 3T5KA 4O44B 1LWFB 3WHIA 3HHNB 4FS2A 1SQGA 1TQLA 1Q86T 4DQQA 3HT0A 1FRJA 4YR3A 4LFBJ 2EFOA 5DDQC 2IVFB 3M30B 1SH0A 2BOPA 2IBKA 3X3UA 4JV1A 4P75A 4B3OB 5HBMA 3D0GE 2LYVA 3FMWA 1EB0A 1KKHA 3OL6A 1QM9A 4FS1A 4WF9Q 4PAAA 4AXIA 4UQTA 2Z57B 2CYYA 4A8WA 4UT4A 2LLZA 1P9YA 4HT5A 2POKA 3OVSA 4DL7A 3M05A 2UVWA 3QGHA 4U7UK 3PW0A 1R89A 2DR5A 2D3OR 3MEEB 2FJWA 4LRDA 1R6VA 4HH1A 1B70B 2HHHJ 2Y1IA 2V8GA 3FMBA 3DLKA 3P45B 3SCKE 3KLFB 2J76E 2QG9B 5AJ3J 1FTCA 1VRTB 3K7RA 3M6WA 1HKAA 2ZUGA 2GW8A 2R9LA 5E41A 2GQCA 1U1QA 3SYZA 3AB2B 4B3TF 1ZM4A 2FGCA 1IBKJ 3D0IE 4M5MA 4C8KA 2NSBA 1YG0A 1JQGA 5DJBA 1F5CA 1TKZB 3OXLA 4EI2A 3B4DA 3VGSA 2CQ1A 3OBIA 1Y9OA 2V69A 2NPFA 2FZCB 1TL1A 3TJAA 5KTQA 4TU8A 4DG1A 4AL7A 4JI3J 5D4PA 1B99A 2MKIA 2M4MA 3H20A 1TR0A 1HI1A 3SDEA 4ZVGA 2YKNA 3GPAA 2BOAA 4DPTA 4UTGA 2ZITA 4KO0A 2FHKA 2OLWA 2AHOB 2AGOA 1RAHB 2KXNB 5J2QB 2HQCA 2FHJD 2VG7A 3WX8A 3T41A 2OIHA 3MTJA 2OPRB 1RWNB 3RAXA 2YWWA 5CYMA 1YWXA 3FQLA 2X7IA 4I2QA 2BKPA 2MQMA 2H9ZA 1C1CB 3T5LA 3H2UB 3AD8C 3HJVA 2YNGB 1Q81T 4HH0A 4P74A 2ROPA 4ZP6A 5BXIA 3RBEA 4J9OA 5DZ6A 5AXLA 1IJEB 5LXYA 3MM5B 2VOPA 1FNOA 4ZLJA 1PAUB 1WC3A 3A8EA 4NI2B 4UF4A 5C5JA 2CJXB 1V3ZA 3OTBA 4ELVA 1YDLA 4OI2A 1HLWA 2LP4A 4CCHA 4XO0A 1OQ3A 1UA1A 3PX0A 4X62F 3P3DA 4QR1A 2HKEA 3B78A 5GAGU 4PWDA 5B08A 2AT1B 4F0HA 2B4PA 1GMUA 1HBUA 2AF6A 5LSOA 1W2BR 3E01A 1URNA 1R0BG 3TI0A 1YZ7A 2GHPA 1S49A 4I64A 3JSMA 2ZHBA 4EEYA 4RNHA 4PQUA 4CLKA 2QRRA 4ZP8A 2C22A 3MM7B 1N8RT 1NDCA 2CQBA 2V4JA 3BKFA 4QIWD 4B3RJ 4B9TA 2VPXB 4IOAQ 1WC5A 5KFQA 3R2CJ 1FVQA 1GXLA 4DR2F 1JLFA 1Q16B 4LSZB 2G2ZA 2DITA 5GMDA 4DR4J 5L1JA 1FESA 1UCNA 3AY0A 3FNNA 4NLPA 4A8SA 3M9NB 2BM0A 4CO1A 2CPEA 2W9CA 5JJBA 2XQCA 1HBNA 1WSVA 1RYRA 2C3MA 1XJWB 3PRDA 1RB0A 4JI7F 1JLQB 3FJ2A 1JB0C 2YNHB 4LQ9A 1HHTP 1XQIA 1NDKA 1HNXF 5L38A 4CI0B 2IPOB 2QEXS 4KYZA 5LT5A 3MDFA 3DDNA 3KNGA 2CPZA 4UW2A 2F5GA 2GIRA 5F9NA 1YJWS 4LRBA 1S57A 4ED2A 4XDCA 3I31A 4I4BA 1E6VB 1TAQA 4JI4F 3ZZUA 5LM7E 4C48A 3UE2A 2D1CA 2GVZA 1PC5A 3DRSB 4L75A 3F44A 3PRVA 3NCRA 4DOZA 2BANB 1NEEA 1T05B 4ED6A 3J7Z5 3DI6B 2E5HA 4N7TA 4WE1B 1UJ5A 3R5JB 2BJ8A 3ZXWA 3DC2A 3TQ1A 3PVXA 4FYYB 4L3NA 3ZZ0A 3K5PA 4DLGA 3EGVA 3UWTA 1YJUA 1KRPA 1IM6A 1BD6A 4EZ9A 2ZM6F 3MWBA 2HZVA 2GX8A 2QX0A 1JXLA 4QIVA 3SQOP 1IKXA 2V94A 4KB7A 5IT0A 2AZ3A 3VVTA 2YNFA 2XI2A 2BRLA 4DSJA 3AH6A 5ETQA 1FNMA 1VJWA 5A6WA 2QC3A 1NJXA 3LAKA 1FE0A 4DV3F 1GQEA 4Y2MA 1YGYA 1FK9A 1F2GA 3W66A 3JTNA 3FBFA 1VBKA 2DXEA 4OV6A 2JX2A 2F9JA 4C3MA 1UTAA 1RHUB 2EBGA 3LWLA 3JSRA 3JAMY 4CTAB 4ZN1A 1C0UA 4ILRA 4WK3A 1I1GA 2DHXA 4CP5A 5KFEA 1WNEA 1QLNA 4U95A 4KJIA 1QDUB 2ADCA 3GTYX 3TAMA 4X65F 5FDLB 1F1BB 3CJKA 2RILA 1HNIB 3AODA 3M8YA 2WOMA 1F5AA 2CWXA 2KHCA 4EK2A 2FD2A 4DL3A 5E0OA 4MKVA 5L1IA 3T5JA 1X5PA 1WG1A 4LF8F 2D3O1 4JI1J 3PM9A 1PCAA 1M0SA 1NZAA 3CCMS 4DF8A 2VB6A 2U2FA 3VCDA 2J6SA 1H6KX 1RE1B 1K8AT 2I5JA 2WVFA 2PN6A 4DR1J 2W4PA 5B0FA 3P49B 3GFXA 2J0XA 2WRMA 2E1RA 4JP8A 2Z2LA 4LRFA 2QLWA 3CVKA 3HFKA 3T1HJ 5JXSA 1JWWA 4JYAF 2UU9J 3HHDA 5D3GA 4QZVB 2YX4A 3MM9A 4LF2A 2NS1B 1VGYA 1D09B 1ULRA 2LQ5A 3OPKA 4DV0J 2DIUA 4DI6A 2D3UA 2YVSA 1HNVB 1LKZA 4X2BA 5G0RA 1IWGA 4M5NA 5D0GA 4NLGA 1UVNA 3OR2B 4MK8A 4LF4J 2A1BA 3WIUA 1ACMB 2HQ3A 4PXDA 2FLOA 5HMXA 1DQAA 2Y1JA 4NLRA 1I5OB 4ILLA 1XWLA 1UWBA 2R2TA 3W9IA 1H2UX 2W25A 2FHMA 1FWPA 4WP9A 3OLAA 1CEZA 1M90T 2H48B 3CCVS 1S0VA 3PDNA 2NXUA 2HIYA 3D7SB 2RKIB 3M8QA 4EMDA 4C7QA 3MHYA 1S76D 2EXUA 3GIKA 4CYUA 1XMBA 3CJ5A 2PFDA 1IKWB 4RR5A 4DPOA 1CC7A 3BBBA 1TK0A 2BE2B 4A47A 4FYVB 5KFRA 2FZKB 2FVCA 3QMQA 3RAQA 2W8KA 2BJ1A 4ED7A 2XG8A 2WSEC 4MTPA 3KHRA 1KONA 1TL5A 4NXNJ 5C24B 1WC6A 3SCIE 1XC9A 3PKYA 4RUHA 1H98A 4Q44A 3NLCA 2UUCF 4I6WA 3M8ZA 2HHWA 4Y6IA 5M2PA 2XEXA 3FCVA 2GQ2A 1LFWA 2P9EA 1SI9A 4K4VA 1R6YA 2YWFA 4L3KA 1TKTB 1HYSA 1CULB 3IAM9 4ECYA 1LFPA 4G65A 1CJVA 3QIDA 1Q79A 3HSDA 5M2UA 5D8HB 5IXUA 1WOPA 1IQTA 2RDIA 1T3OA 3GJTB 2GC8A 3HLUA 5KG1A 3HPOA 2YTCA 3S7RA 3I4HX 4TLQA 5E33A 4P2XA 3DXSX 3NGUA 5A8KB 1F2HA 3D1HA 3EXCX 3RBDA 2HS4A 5KFFA 2OPPB 4DPYA 4RUAA 1PJ5A 3AOCA 5GAHU 1REVB 1VHFA 2I6WA 1XR7A 1S9EA 4BBYA 2LEPA 2DJWA 1LWXA 3DRRB 2OJ3A 3GIRA 2E1MC 2HK3A 4K4YA 1QE1A 2K3IA 1DAXA 2MXYA 4RWWA 3UQSA 4CLPA 2JJ4D 2C1EB 1WORA 2W7PA 2BACA 3KKFA 1C0TA 4PWWA 4DPXA 3I55S 2W01A 1MG7A 1TFYA 3OL7A 2PEBA 2FY8A 4XPEA 3A1YG 1TV6B 5A8RB 4I2PA 5HJXA 2CQ4A 3GYGA 3JQKA 2YQ3A 3E3XA 1KC8T 1HQUB 1NNDA 3A8JA 2V4RA 3R27A 4ECQA 3JYTB 3MECA 2EFPA 5EN1A 2HPUA 2OO4A 3IRWP 3HHLD 2CQGA 3D4JA 2VBZA 4WKYA 1WEXA 2R2RA 3DDKA 1X4DA 2YKMB 3R5CA 3MM6B 2P6SA 2ERRA 1H38A 4WXWA 3KLEB 1WELA 4L74A 5B0DA 1X4CA 2B3TB 2IFXA 2UP1A 3KLHA 4ZPCA 3FDSA 1WC0A 4X4NA 3M9OB 3HSGA 3X1LB 5KFNA 3K5OA 2VFSA 2V67A 2AEMA 4C97A 2MKKA 1TUWA 3IAS9 1U1MA 1U0SA 1LWCB 2EW9A 1ZPVA 2OEMA 1Y4ZB 3MPYA 3W2VB 5ETNA 3Q24A 3KK3B 3GG1A 2DNYA 1RUSA 4B9UA 3CEDA 3A3PB 4PUOA 4DCOB 1G7CB 2BKOA 1YITS 4JI0F 1MWYA 2OPQB 1HQ2A 1UEKA 2EPIA 3UW1A 3F41A 1HBOA 2HMIA 4DR3J 3S6EA 4DV4F 4OL8A 4EGLA 5KFAA 4QJVA 5MAOA 1JNRB 2V8PA 4IDKB 1TUVA 3Q8VA 3H2LA 2F7VA 2X1GA 3DOMB 1KTVA 2HNZA 4PQAA 4DS5A 4K59A 3RR8A 3CCQS 3M1VA 2ZNZA 2KRBA 1M1HA 5T7LB 2KG0A 5HN0A 4DQSA 2QLXA 4LRAA 2QIFA 1WKLA 3DLBA 1KP6A 3DRPB 3M2RB 1O6XA 2BQUA 1WC4A 4LREA 2I9SA 4ECRA 2DNZA 5CXTA 3PHTA 3T9NA 1FEHA 4LF6F 2HRTA 4CO4A 5D78A 2UUWA 1MSWD 3DM2A 4WJBA 4KHPF 2QA1A 4OI4A 3BB5A 5KFBA 1B0TA 1Q95G 5FJ4A 2R8IA 1G3OA 2HVZA 1OPIA 2FJXA 4CT8A 5CD4H 4WCEQ 3CDWA 4Q0BB 3G4SS 1QAJA 1RTJA 2XMMA 4ANEA 2F4VJ 2LXUA 2RS8A 2M7SA 4OLPA 3R3TA 4RW6B 1IBMJ 2B0GA 1FKOA 2ZH5A 2YKAA 4WP3A 4UZCA 1B7YB 1TELA 3UD3P 5I3UB 3CIZA 4LF7J 1VQ5S 3BZQA 1AXQA 1RBOB 1KSPA 3N9UC 4N8OA 3DLHA 1SJ3P 1WEYA 3LA0A 2XBPA 2J8AA 3IMQJ 5ITHA 1G4CA 5AT1B 1VK3A 1RT7B 2F8EX 1SCJB 2QL7B 2CJBA 2IAJA 1KDNA 5A2QY 2VD3A 2LDYA 4Z2XA 3BSOA 5DM6Q 4X64F 2AJ2A 3F73A 3PYDA 5H9EK 3F56A 1NU4A 2ZUAA 2RH3A 1TVRB 4QWCA 4FF3A 3BO2A 1S1XA 3BKTA 3K5LA 4DL4A 2BW2A 3D54A 1F6TA 4M94A 3MTKA 4PYAA 3FRZA 2G13A 2VFUA 3QIPB 4LIRA 4J9LA 1HR0J 4RW7A 1WTFA 4YR0A 2IBOA 4IG3B 1IWAA 3Q22A 3GSIA 3LQVA 2LMIA 4RW4B 3FZBA 1RWVB 4BHQA 3MCMA 4P6QA 2B9XA 2H54B 3GIMA 1PO6A 1EKRA 2IMOA 3KUHA 4KGXB 5GADI 3GONA 3V6HA 4EFAC 4KC5A 2VPYB 4NYZA 1KD1T 5AXNA 3TAPA 1S77D 1MMDA 3FBBA 1CSJA 1UA0A 2DNLA 1UPMB 4DFJA 4A8YA 3G8QA 4Z37A 4ID5B 4K0KJ 1H2VZ 3JXOA 1JNZB 5HL7Q 2XMVA 1P9QC 5DGBA 5KFGA 2HQGA 1C1BB 1FKPB 1CS4B 4DWIA 3CDUA 5E7OB 4ZK7M 3CDEA 3DDIA 2PMWA 5D4NA 2ZH2A 5HP1B 3PXGa 3AT1B 3OQ2A 4I0WA 3GR1A 2DNNA 4UUWA 2IIHA 2AX0A 3WQPA 1LWEB 1APSA 3A12A 1E6YA 3UN2A 3OXFA 3A4TA 1UAWA 4DV2J 1EX8A 2BE9B 1VRUB 4DSLA 3MFHA 1RKIA 5D0HA 1TUGB 3CJQA 1GEHA 5HVFA 1V9OA 1X9WA 3HVTA 2M3DA 1S59A 2V8HA 3Q83A 4OHYA 3UN5A 3QO9A 3W2WA 2QE5A 1SC3B 4OYXA 2FLNA 4P2FA 5KOXA 2FC9A 1DRZA 4F0MA 1H2TZ 4LFAJ 5DDOC 1U25A 5EUHA 3MXHP 3VAIA 4IG0B 4PABA 1RT2A 5BR8J 4PPDA 3CJSA 1ZPWX 2HHHF 4ICLA 2XYGB 2JNJA 3RZAA 1SJ4P 5AJ3F 4V19J 1KOHA 3V6JA 4ECUA 3IBCB 3ENWA 4USMA 4G1QA 3LO3A 3TARA 5KG5A 1HMVB 1UVKA 4NRTA 2HFUA 1U6ZA 3CE8A 2W7OA 1IBKF 2RF2A 3PYEA 2LECA 4TLRA 5J2PA 3ZTPA 3UPFA 4IRDA 1Q7YT 5HI7A 3IN5A 1UWAA 3R5DA 1VBYA 1KLMB 3THPA 4GVBB 4ECZA 4R25A 2J8SA 4FKXA 2NZCA 3IWNC 5K9FA 4WTOB 2XTJP 4ZJQA 2V9KA 2KB2A 1G2EA 4FNHA 4C3KA 2MEWA 1FKAF 3LTOA 1T9WA 3MM8A 4LR7A 2MZSA 3W5ZA 2R7UA 2XCAA 1J2VA 1DARA 4IH7A 2Q6BA 4JV0A 3ZZOA 3C16B 3M2VB 1VCTA 4H54A 4RNNA 3ILJA 3B6BA 2M9KA 1RTIB 2G4BA 2B6AA 3C6TB 4KBIA 1BHNA 1S6PA 4YFUA 1XMQF 1YLXA 5A6PA 2XO6A 4ANDA 2VF3A 1XR6A 3NRBA 3MPWA 2DCUB 5GMEA 4ENOA 4QCLA 1L3TA 3K5MA 2A0FB 2HIQA 3K89A 1Z4UA 5B7WA 5HROB 3SQGA 3BDEA 3DMJB 1Z1ZA 3HFVA 2Z30B 3AQPA 4O0NA 2CJQA 1LK5A 3HFZB 3KDOA 1Y5IB 3OL9A 4LR9A 4KR0B 1FERA 1QAIA 3ETMA 2CIMA 2Y9HA 1TL4A 2F8HA 2WTFA 1N5QA 1YQHA 2LU2A 2CZ9A 4FYDA 5KFWA 3MEDA 2IC3B 5E3RA 3QZ8A 1TK8A 5J2NA 4DX7A 2Y8WA 1U02A 2W7AA 3Q0AA 4WYWA 4ER8A 3BGUA 3QWUA 2AP6A 1SKRA 4E98A 3VHQA 4NLOA 1YI2S 4NEYA 2R42A 1EP4A 3RU0A 1SH3A 3LGNA 3SSRA 2GMLA 3TZWA 2XO7A 3H42A 1Y5NB 2FC8A 3GFHA 4DSKA 3N6MA 2FDNA 3W9HA 3G96A 4C9DA 4DUYJ 4OZNA 4D3GA 3DLLQ 4GKKJ 1KQFB 5KFPA 3CPWR 2GO8A 1RLDA 4HLBA 2FVPA 3QJPA 3ADAC 1BMQB 2BMBA 4LSLA 2IDEA 1BLUA 2E9TA 4IR9A 1VI7A 4RBUA 4DLEA 1T9UA 1JLCA 4GO7X 3KK1A 1HI0P 1VQOS 4KTQA 1GH8A 3OFHA 2C3OA 3R8YA 1KR4A 4F4AA 3AOAA 5F3TA 1SPBP 4FYXB 2JL9A 4AXJA 3ILIA 4J9SA 4P2MA 4NA3A 1U0HB 2OSQA 2OKQA 4KFBA 1PILA 1IKVA 2RB7A 2ZKUA 4P71A 4HVZA 2WHOA 2KTQA 3O6QA 3R1HA 1DLOA 2FIUA 1VQSA 2KN4A 2CDRB 3DOKA 2XY7A 2HHVA 2DGQA 2CPDA 4TVAB 3G6XA 2RNEA 3IGVA 4I7FB 1FJEB 2XGQA 1I6JA 5LL6d 1YVFA 2HNDA 2BA9A 2HBRB 4HTJA 1WDDA 4X4PA 1WHWA 4CLYA 4DPWA 4USIA 4NLSA 1NBEB 2E29A 1F3FA 1U2FA 2FLLA 3BR9A 1IBCB 3SBMA 3DLEA 2Q6CA 1IM4A 1WG5A 5IM0A 3PX6A 4ZP7A 5K5MA 2H4WB 1S7IA 1VISA 3A3OB 1LW0B 4DUTA 1GX5A 1VQNS 3PZPA 3CC4S 4RW8B 1NH7A 3MFIA 2ZWPA 4USHA 2DNMA 1BQMA 4UOCA 2VQEJ 1ZZFA 5KFIA 4EBCA 3RAMA 2QL9B 2XULA 3MEGB 4O4GA 1NSQA 3W64A 4C11A 4B17A 3ONQA 1RCOB 3VAHA 1L3KA 5I3PA 3HVAA 2RDJA 4MFBA 1M5HA 2KL8A 1S4FA 1YIJS 3NOCA 1HNZJ 3KG4A 2AMCB 2VBWA 3H5YA 1NK4A 2ZWOA 1R27B 3FCWA 3GILA 2YQ1A 2ZFHA 4G1IA 3QSIA 4CQ1A 1IUJA 1K47A 2BDPA 3Q8RB 1VC0A 2NCKL 1KHWA 1O51A 2AQ4A 2JFKA 1ELOA 1R3NA 5KFLA 3TYTA 4ZITA 1MU2A 2ZDPA 4F3OA 4A8KA 1FXDA 3GLJA 3BGRA 4U7CA 4F0KA 4Q8EA 3EVWA 4EBEA 4OV1A 3HO1A 5IT9U 3QRPA 4JI1F 3SFUA 4F2RA 1SKWA 1IR1A 3CJ3A 4L76A 3NG8A 4DR1F 2GGPB 3WBZA 4RUCA 3VF0B 4UZBA 4O44A 2GHWA 2HURA 3LWMA 1LWFA 1XN9A 4BC7A 3FBCA 3H8YA 1SIZA 3M30A 2XCPA 2GCFA 2DGUA 4A4JA 3T1HF 5B0BA 4B3OA 2UU9F 3ZTOA 1NMEB 1U6BA 5KT5A 2DIVA 3UDVA 4C8YA 4HEA9 1EQ0A 3HULA 4EBDA 2GQQA 2HBYB 4C98A 3H7HB 2UUBJ 3M6VA 4K4SA 1MNEA 3O2IA 4DU7A 3UR0A 1BUXA 2AEFA 4AYBD 4J9QA 3MEEA 4KHMA 4KGZB 3W5YA 3DOLB 2APOA 4NASA 4FF4A 4U7UD 4XDDA 3KLFA 4QIGA 2BV3A 3IWLA 4LF4F 5KG2A 3C15B 3AXKA 1VS3A 1VRTA 3BPDA 3QNWB 3FEXB 1SL1A 4R8UB 1U49A 1Y11A 4Y2CA 3TR5A 2M52A 3I4PA 3L7OA 2VJVA 3CT9A 1REGX 1HHQA 2ASYA 4X84A 1HWIA 5LXRA 2BBEA 2UVRA 2MZRA 1TL7B 1NSKL 1AUSL 2L48A 1TKZA 1K1QA 3UCUP 3NS6A 2QGFB 1RT5B 3H5UA 5HMWA 1DBDA 4LSNB 3OFGA 4DL6A 3EMTA 2V5HG 3Q8SB 5DG7A 1ICEB 1SC1B 3I96A 4NXMF 1LXJA 1DURA 4L6V3 2L41A 1RAGB 1DTQB 1F9EB 2AU0A 3I56S 3S8SA 1F3VA 3DGVA 3NNAA 3FRYA 3VZIA 4PCQA 1QAYA 5HAOA 2HFSA 4P73A 2LEBA 5KT3A 3B54A 1UEUA 1NXIA 4KGKA 2W2PP 3R5BA 4WPAA 4RNFA 4QIFA 5KOWA 1GMWA 2MLZA 2MGZB 4OJ3A 5J2QA 2KXFA 1NPKA 1NSPA 2UUAJ 2P5VA 1B4SA 1T02A 1PJ7A 2OPRA 1CJUB 4DV1J 4B3MJ 3I82A 3V5RA 3TO8A 6AT1B 3MCSA 2ZZTA 3EZOA 2MZJA 4LR8A 1C1CA 2CQCA 2J6TA 1KNZA 4Z7YA 2CNKB 3L3CA 2QV6A 2YNGA 5B0EA 1RWMB 3FSXA 2CNLB 3MR2A 3MR3A 2C28A 4F4XA 9RUBA 1RTHB 4Q2LA 2R7RA 3H4DA 4ED8A 2LFVA 3MM5A 3S01A 2ZZMA 4NI2A 4LQ3A 2SXLA 3DLGB 1HWJA 3TVYA 3OR1B 3CC2S 2ZVSA 3CO0P 2MHNA 3TJ9A 3MPUB 4TY8B 4DHVA 2A6OA 2DHAA 2QTWA 1Y5LB 2HHSA 1OQ6A 1RADB 4NCAA 5DQGA 2CDQA 5L46A 3HVWA 3NGSA 1JJHA 4UOFA 4OI0A 2DNQA 3H25A 5A76A 4PG7A 5ETSA 3CCZA 1WC1A 3M2UB 3MM7A 2YX1A 1NDPA 1N54B 2VFVA 2Z2MA 4TU9A 3BJYA 3I0SB 1LXNA 3OFFA 4P10A 1MN9A 2XMJA 1YJTA 2NREA 4U8VA 3RB3A 1W7WA 2YH0A 2IJNA 2ZKTA 3MR5A 5HLFB 5KG4A 3ZTRA 2Q43A 1SV5B 4I1TA 1X9MA 2K1RB 2EFGA 1YBTA 1M5PC 1NLKL 4OHZA 2QFIA 1Q5VA 2V50A 1JLQA 3A13A 1OSDA 1PGZA 3NEKA 4HDHA 2YNHA 1Y00A 2VL1A 5BYRA 2MTLA 2DCLA 3JB9k 1F9FA 3M7VA 2DH8A 4IFYA 1U24A 3KMSA 3BQ0A 1EQMA 2BQ3A 2XS7A 1QAXA 2LKZA 4F36A 4O0IA 1BWVA 4NZ6A 2B8QA 4PG8A 3VAKA 1E6VA 4B3SJ 4RUBA 2WVDA 4LFCJ 1HQEB 2ZH9A 1QTMA 3R6LB 3HX9A 3LGMA 4CO2A 4LF5F 1XERA 3K2YA 3G86A 3DRSA 5K8MA 2OEJA 4U96A 3HM9A 2BANA 1ROFA 2KKHA 1T05A 1ZAVA 3OSPA 4NLDA 3BDPA 4A8XA 1S9GB 3DI6A 3RB4A 1PKUA 4WE1A 2OELA 2E5JA 5IWAF 4MYUA 3OHAA 3OFEA 2UXDJ 1GT8A 4OYMA 2AWZA 3AA9A 4CO3A 3G2XA 3MOJB 4C2MA 1NK0A 4Q7AA 3CDAA 2GS8A 5HJYA 2DR8A 3ILOA 4YQWA 1OSCA 2DNRA 4CLTA 3VWSA 3CCLS 1TU0B 4WIQA 5HANA 2JFDA 3AA8A 2EFVA 3HDSA 1JLAB 1WJ9A 3ZZZA 1VQYA 1N36J 2DGOA 4M1KA 4RU9A 3BO4A 1RAIB 3T6BA 4ZDNA 4LF1A 3W62A 4HT7A 5ETRA 3P8BB 2AJQA 3UD5A 3V81B 2KZMA 3BREA 2PDAA 3PW4A 4CTAA 1Q5YA 1U47A 2HSEB 4AT1B 4RW9A 3PTWA 1RZMA 1CQMA 2XYHB 2LA6A 3RUBL 3OV7A 4W90B 3A8IA 1LOUA 4RU2A 2OMLA 2CZVC 4LIWA 5FDLA 2B5JB 2ZH1A 3TJ8A 1HNIA 2XSJB 2B8PA 3BGFA 4NEZA 2RUGA 4HACB 3TVZA 2ZH8A 2O5DA 1U2RA 1KOOA 3PRBA 3SSSA 4EYHB 3CCSS 3PFEA 1JIHA 2RMLA 1JXEA 3TUPA 4PXCA 4HI2A 2R2SA 1C2PA 2G0JA 4ZLNA 1H74A 2F9DA 2F4VF 1U6FA 2WK4A 1R8CA 1P1TA 5DETA 5D77A 4DDFA 3Q89A 2MLXA 3VZHA 2HAIA 1IBMF 2GJFA 2R4FA 4B08A 3F0NA 4MIWA 2VH7A 5ETTA 2AJFE 4TU7A 4K5SA 4JI2J 4IKAA 4F04B 4LF7F 2VA2A 2HBZB 3J7YI 2LXIA 1DHMA 2HZCA 2HFVA 3RW6A 1FRKA 3Q8PB 1U2CA 2J6UA 1ZOTA 1XR5A 1PIEA 3CULA 4FXWA 4WP8A 1LQ9A 3DRYA 3NAHA 1U8SA 1HNVA 1FE4A 4F2SA 1ZYQA 2LDIA 3OUYB 1YJ9S 2B9YA 2JLFA 4KH0B 3NL0A 4AD6A 3OR2A 2DHGA 2O67A 3UDCA 2XHCA 3BPSP 2CVIA 4CO0A 3H2VE 3ZO7A 4DJBA 2QYGA 1RBAA 3CCUS 1SJQA 3AHPA 2JC0A 4KIAA 3TUIC 1IBLF 1HPZB 3NAIA 3J7ZT 3BBCA 1O0PA 4J9KA 1N0VC 1S1VB 3JQJA 4DQRA 1WOOA 4LBPA 4ECVA 2ZH7A 1K0VA 1X9SA 1SB6A 4J91A 2RKIA 1TK5A 3OT9A 4ATNA 5I42B 3K17A 3THVA 4Q45A 3OL8A 1R0AB 5F8LA 3D2WA 4XIUA 1IKWA 2HVEA 2ZH3A 1BXNA 3W61A 1N56A 3I32A 2BE2A 1S1WB 2IRXA 2QJ3A 3J80U 3BR8A 4ECSA 4CWBA 2AEJA 4TKTA 1B0VA 1PG5B 2VKZG 4RPFA 3HT3A 1UZHA 1P8GA 5C24A 1S72S 4X62J 1V5IB 3QJJA 2YWEA 3CNQP 3N0VA 1OMSA 1DTTB 2DH9A 3O8WA 5CYQA 2KO1A 1S97A 1OYDA 4Q8FA 4IQXA 2L9NA 4X4SA 1SVDA 3T19A 4DV2F 3DCAA 1P27B 1RT6B 1TKTA 1M5SA 1CULA 1QY7A 4P2SA 1FXLA 4GKJJ 3HP6A 2HHUA 2N3OA 4ZHRB 2IM1A 1VQ8S 2FJEB 1S5ZA 4M5JA 5E3AA 2CG4A 4U9RA 4I6AA 2R8JA 2VUGA 4DR2J 2HWHA 1SJRA 2LQ9A 4X4UA 5A8KA 2OH2A 4LFAF 1RT4B 1NPRA 3D3BJ 2OPPA 5J1PA 4P7VA 4IR1A 4DX5A 2J7UA 2WAQD 5BR8F 2VZ9A 1REVA 3AQOA 3PJ9A 1OJ4A 2LA4A 2DR7A 4NCBA 1AYEA 5LSLA 1T11A 3DRRA 4JI7J 3I6PA 3MAQA 3PIPQ 2ZZNA 3ZC4A 2A18A 5EHHA 5LJ3Y 4OHXA 3CSKA 1HNXJ 3L7UA 4QYZK 1RHRB 5LMUJ 1PBUA 5C25B 1CG2A 2W2QP 4B9MA 2U1AA 2PSZA 4FBUA 1OY9A 4JI4J 1TP7A 1TV6A 4NWBA 5A8RA 2G9OA 3DN9A 1BE4A 1WG4A 2AJ0A 3MD3A 2ZE2B 1KEKA 3MMAB 1KWMA 1RCXB 5IV4A 5DGAA 3H40A 1BQXA 3PEHA 4X4QA 2E66A 1V3RA 3JYTA 2RT3A 3CO9A 1NKEA 5B09A 5EWEA 3GWCA 2N7CA 4J9NA 2UVUA 3PIOQ 3CCES 2YNIB 3J7AN 4FDFA 2YKMA 3MM6A 2RQKA 3VALA 3DRXA 3E51A 2D7SA 3PR5B 4ZA1A 3KLEA 1CLFA 5F9LA 1PYTA 4LMZA 1N6QB 2M8HA 3N4WA 2WW8A 1EETB 2VKRA 2YY3A 3G87A 4NYPA 2J7KA 4ZCLA 4KT0C 4DV3J 1R8AA 5JUMA 1WHXA 3HZGA 3GV8B 3FZ2A 2RVJA 1LWCA 3W2VA 3D6MB 4USVA 3KK3A 2A6MA 2DPIA 2JHEA 3UDLA 2DVIA 3EPIA 3QLHB 2OPQA 5H9FK 4QYRA 3NP5A 5F8NA 2DGVA 2DK2A 1WWHA 2JZ5A 2DBBA 1CPZA 1YSJA 2OTJS 1OO0B 2F3JA 1SXLA 4DCPB 1EKSA 2IM3A 2ROEA 3G71S 1RWWB 4ZVHA 5FLXU 4ZIWA 1Q53A 2MQLA 3IR5B 4IDKA 4M5DB 1SL0A 2JEGA 2C2ZB 3CJ8A 1RAEB 3DOMA 3KG1A 4JI5J 4FP9A 1MROB 1WF1A 5RUBA 1S1TB 1VLOA 4QU6A 1RWXB 2GO9A 4MKYA 5K14B 5T14A 4ZPDA 2C3UA 1UVMA 4DCJB 4DV6F 3HCXA 3QBCA 5T7LA 2XLJA 4ELTA 4FXVA 1HBMB 2MZQA 2QSFA 3DRPA 3M2RA 3TRGA 4X4RA 1YTYA 1U45A 1LK7A 4GRSA 1RK8A 2YX7A 1X8DA 4A8QA 4OZJA 1SKUB 2KDOA 2FTRA 5C7PA 2HVDA 4F7VA 3G82B 4PG5A 4JYAJ 3BM7A 1FJ7A 1ZETA 1VR6A 1OWXA 1Q4RA 5L9NA 2R8KA 2R7QA 3JTPA 1S0NA 4OX8A 3NNHA 5E3PA 4YOEA 3Q2TC 3MD1A 3RRKA 4Q0BA 1IR0A 2X1BA 2NSCA 1RT1B 5CH7B 4L73A 3LP1B 4IRKA 2RUSA 4J5OA 3T1YF 1SC6A 4ZCKA 4RW6A 4DXLA 3EX7B 2AIRB 3OVAA 2GJIA 1TAUA 5KFOA 1U1PA 3QT8A 5I3UA 3QZ7A 3M8PB 2F40A 2MPUA 3P96A 2P9GA 4J9VA 1LW2B 2R7XA 3G6YA 2BX6A 2NR0A 5KFXA 2EFNA 2W9BB 3KJQB 4GC6A 1FD2A 3QFWA 4KGVB 1RT7A 2W2OP 3QSYB 2MZTA 3D1OA 2ZJQQ 4DV7F 4Y2KA 1TVRA 4ZVOB 2X51A 1H73A 3ENAA 2VQEF 3KNAA 2E9ZA 1S6QB 1VQ4S 5D15A 2BW7A 3QIPA 1XNQF 4QWDA 2FJAB 3OXGA 4K4ZA 3BEGB 1M1KT 4NE9C 4USKA 4ES1A 4C8OA 5KFSA 3EPGA 2DT9A 4IG3A 1S1UB 1XNRJ 2UUCJ 4RW4A 1L3SA 4NLVA 2HNYB 2VG6B 3BGOP 5GAGI 2Z58B 3GP9A 4KGMA 3AAWB 3PFOA 1D9DA 3T1AA 2QN6B 1JLGB 2AGPA 2FY1A 2VG5B 1TMMA 3LP2B 2OPSB 4ES3A 5KT6A 2MQOA 4TNOA 5F8JA 1DQ8A 3GCWP 2Z0GA 2FPHX 4ID5A 1FI4A 3V6DB 1GX6A 2B56A 2NXEA 1UEVA 3CCTA 3BO3A 2QMUB 2KYZA 5I3QA 1B64A 4JI8J 4XPCA 2W24A 1C1BA 1FKPA 1CS4A 2XMUA 3OTOF 1K0TA 3RRHA 5HP1A 2RQ4A 4YB6A 2DEIA 2QA2A 4JOUA 2VFTA 3KYLA 4M5LA 1ZZNA 4PPZA 3P5BP 2F1FA 1LWEA 3I5AA 3FEZA 1VYAA 3C66A 1QVFR 1FDDA 4HR2A 3P5TL 3VGUA 1VRUA 2XY5A 3NS7B 3QJLA 2E1CA 4K2XA 2QA4G 4YP3A 1VQ7S 1S79A 1SKSA 1XMOJ 1RT3B 1VQLS 3W63A 3CMQA 1VDHA 2YWKA 4E0DA 1WDTA 3VTIA 2RQMA 3IGNA 3MR7A 5KT2A 2HW3A 1NHKL 1OIAA 4DQIA 3E8OA 1RISA 3NOGA 3WX4A 5CZXA 2ZBPA 3BN7A 4K5RA 3FCHA 2UUBF 3C6UB 1WI8A 2CPJA 2Y8YA 4KKOB 2IVMA 4IG0A 2IRYA 2KRRA 1YKWA 4DR6F 2XNRA 2WCXA 5CD4A 3N79A 2WONB 1R0CB 2MY7A 3BYPA 4DX6A 2DO4A 3FSYA 4OX9J 4OYBA 2ADBA 2ZH4A 1WKJA 1N32J 4DR7J 4CIOA 1A6LA 1BGXT 3GIJA 4J9PA 1HMVA 4QW9A 2XB2D 3GJRB 1YJ7A 4DUZF 4M8LA 1TTHB 1NCLA 4W98A 5U47A 4HHJA 2AKWB 1SQEA 5F8MA 1X0FA 2F8MA 3ISND 2EK1A 1KLMA 4GVBA 3UNGC 3NGDA 2CJAA 2WVCA 1RTDB 4QBUA 2Z2ZA 3GV5B 1BQNB 3LALA 3W8PA 2MY8A 3RB0A 2FJVA 3SIPB 4ELUA 3TUZC 1SJFA 2H5IB 4JI6F 3SV3A 2GIQA 3LPEA 4OHVA 3CB4A 4UQGA 1YBUA 3EWGA 4OX7A 1X5SA 4FYWB 3V2UC 4Y65A 2ASDA 5SZTA 3C16A 4JI0J 2CQ2A 2CPXA 3M2VA 1FXRA 3BGLA 2Y1RI 5GAEU 1P1LA 1RTIA 2KG1A 1FDBA 1ZA1B 5ETPA 2FVRA 2CADA 5KT7A 1N0UA 2R7VA 3D66A 1F5BA 2UUAF 3C6TA 3GSDA 3GG0A 1X4BA 3CMAS 1V6HA 1DJ0A 5AXMA 4DV1F 1RSCA 1IR2A 2HS3A 3I5CA 3LUYA 4NOHA 1SL2A 1SIWB 1WSRA 4H4KA 5EDWA 5K8PA 2MZ1A 3N6LA 4I56A 1MMNA 2JSXA 3G8SA 5HROA 4JV5F 3G8TA 3C14B 3TVKA 1R8PA 3ITHB 3B8HA 2QLBB 2DXDA 2D41A 4OFZA 1Q8LA 3WIVA 2ZEJA 3D28A 4DSEA 3I5BA 1M5OC 2JH3A 3U1NA 2RDDA 4H4KC 2IC3A 2HG4A 4TYBA 1W26A 2CFXA 1HNWJ 3RG6A 3GQCA 2YKPA 4LF6J 4WU3A 2BE7D 3QT7A 5ETKA 3TQEA 5HQMA 3EGZA 4QYZJ 5B0GA 3PO4A 1FWKA 1GXUA 1URRA 2CJKA 5ETVA 3GCXP 1GK8A 1NK6A 1YZ6A 1EJ7L 3QPIA 2G1HA 2EKNA 2YWHA 1KHVA 5KFHA 1KVKA 1IJFB 3N5BA 3LANA 4OYWA 1PSDA 5DLFA 2OD6A 2HHPA 2IM2A 1NJZA 2C2KB 2HHQA 5A0YB 4WU2A 2DRAA 1RWKB 3D68A 3IFEA 4YS2A 3KLIB 2DD8S 3MCOA 4A8OA 5IT9Y 4HHUA 4OHWA 2BJEA 1MLAA 4IH5A 4EO6A 2V2VA 2H4YB 2EFQA 2K7JA 3IS9B 2R8HA 2C2EA 3NXZA 1NB7A 1IKYB 1U0HA 5KFCA 2XZDB 4OZ2A 3C46A 3QQCD 2WBMA 3SXLA 2NPIA 4X64J 5BJRA 2CQ0A 3D6TB 1U1KA 2V0NA 1B3TA 3R9LA 3QRRA 2I1RA 4B3SF 3PY8A 5F8IA 1N52B 1OY6A 4PXBA 4NZ0A 2YXLA 3IM9A 3Q2SC 3AJ1A 3DGPB 3A8KA 4F26A 3HK2A 1JLEB 5KG0A 4O4GB 1VRQC 2YH1A 3UNYA 4Y2IA 5GAEI 3MMBB 1VQPS 3NGTA 3EJMA 3MAAB 5H9FJ 2AJ1A 2B51A 1ZM9A 3RBXA 5DRKA 2X3DA 3M4XA 3H90A 2VDHA 2Q1LA 4CRJA 2KT3A 2R7OA 4ZS6A 2RD5C 2QZ8A 5KFZA 2EWHA 4DL2A 3PW5A 1FO1A 4B9NA 1LW0A 3EICA 3C19A 3US5A 4RW8A 5K8NA 2L08A 3C2PA 2BYCA 3R5GA 4CO5A 1N36F 4DSIA 2UXCJ 3MEGA 4PG6A 2RRAA 2MKYA 4IFVB 3T9ZA 1J5OB 4X66J 2GZOA 1U09A 3WC0A 3OTEA 4I69A 2DGSA 3UVJB 3A3NB 4FKYA 2K06A 1NH8A 5GAHI 3HHLC 3JSBA 5GMKa 2BQRA 4RNMA 5C2GA 1YX2A 1UJ4A 1VC6A 2WB4A 3D6FB 2FLPA 1Q8KA 5LMNF 4M5IA 2DHSA 3J81U 4O4RA 3U1MA 2CQ3A 4USJC 2CPIA 3CWJA 4DQPA 2KJVA 1PBAA 2J9CA 2VICA 4MKBA 3TOQA 2VC1A 3TEHB 2XC9A 3N6NA 1FD8A 2HHTA 3ET6B 3U27A 2OD4A 1FJGJ 1X7VA 2G1DA 4USWA 1GNKA 2AZ1A 4UUXA 4KAIA 2MSSA 2VQFJ 1X4EA 4YHHJ 1KFSA 1RYSA 4B9VA 2GGPA 5AE3A 3LH2S 3MI7X 2DGWA 2QLFB 5A8WB 3AD7C 4CLFA 4JI2F 1G1XA 2WSFC 4ZN3A 2FUG9 3OVBA 1U48A 4HHHA 2M8DB 2DRDA 2WVBA 1T03B 4DBQA 4URSA 3TAQA 3IR7B 1R8BA 4FBTA 4ED1A 2V8DA 1FNXH 4DR5J 2DH7A 3UFCX 2P9CA 4BC9A 2I2YA 2B7CB 3IG1B 2Z8QA 3PYGA 1AROP 2B7BB 1EAYC 3TA0A 1QSSA 4UOHA 2HYIB 1AFJA 3DOLA 3W8GA 4KV8B 1N5TA 5F8HA 1D9FA 4LJMA 2DKOB 3C15A 3VQSA 4ZPBA 1HL6A 1PAEX 3SV4A 3KG0A 4R8UA 4IQMA 2ZD1B 5F0UA 1I94J 1S7HA 1H0HB 2CJYB 2VU5A 1HIYA 4D3HA 4DEZA 2JOQA 4CH0S 1TKXB 1AB8A 3IXQA 2XS5A 4PEOA 1TL7A 1XMQJ 4CDIA 1PYSB 4IYQA 4K4WA 2VIHA 2XM3A 1RT5A 3IRXA 4LSNA 1HD0A 1D0EA 2PEHA 5E5NA 1T0TV 2A10A 1L3UA 5HMZA 1HHSA 1DTQA 3GYXB 2K8GA 3LF0A 4C8NA 3IBFB 4J9UE 4CNYA 3QGPA 1VOMA 1MWZA 3OW2R 4ZVTB 3KJNB 3CJRA 4FNIA 3NKYA 1PJ6A 4ZCMA 5KFMA 1D3WA 2MGZA 1FFSB 3EZUA 4CH1A 2WSCC 3M8SA 3R97A 1KLNA 2KU7A 1CJUA 3MGJA 1K73T 2B4VA 2CJ9A 2C3PA 2HRYA 2YPYA 5KFKA 2ZJRQ 4H4MB 4KY3A 3H0PA 3BS9A 4N76A 3EDRB 4GKJF 2KT5A 1RHMB 3VAFA 2PI4A 1SUQB 1S48A 4YR2A 4Y00A 1T8EA 1NAQA 4LFBF 1RTHA 3TX8A 4C6AA 3MPVA 3KK2B 5ETOA 2BJ9A 3HI9A 3HHEA 4K50A 4RJVA 4X4VA 2GAHC 3HF5A 1X5TA 2CVEA 3DLGA 2DXFA 5K20B 5HSPA 3OR1A 3BBFA 1KTQA 1SH2A 2NXNA 3UR3C 4TY8A 1SBRA 4LVNP 5CZVA 2CPFA 2EI5A 3POTB 4ZIVA 5C2CA 2KFYA 1YHQS 3VQTA 1TL3B 2ILYA 2Y0BB 4LRCA 5JVHQ 5K8OA 4R5PB 2HEKA 4CNZA 3CW2C
chains in the Genus database with same CATH topology
2R7TA 2X3GA 1TFYA 2R4FA 1WHVA 3DYAB 4I68A 4ZP9A 4B08A 1R7IA 4AL6A 4HYKA 4F4KA 4MIWA 3PW7A 3OL7A 2AYMA 3HHKA 2VH7A 4IFYB 4O3SA 2AJFE 4XPEA 3A1YG 5KFDA 3UCZP 1UVLA 3M2UA 2D74B 1TV6B 4F25A 2JLEA 5LMUF 4TU7A 2HVIA 4K5SA 5A8RB 3NMAA 4IKAA 2IAJB 4I2PA 1A7GE 2EG2A 3EGWB 2CQ4A 3MMCB 3I0SA 4LF7F 2LCWA 2VA2A 4TY9A 3J7YI 2LXIA 4MJKA 4QPTA 1DHMA 2YQ3A 2HZCA 3E3XA 1KC8T 3RW6A 1HD1A 1FRKA 2GMJA 4NCGB 2O01C 3Q8PB 1HQUB 3LW5C 4KSEB 1NNDA 2J6UA 2CRLA 2QO3A 1RDRA 3NNCA 3TUJC 4C0BA 2V4RA 3R27A 2YKQA 4ECQA 1ZOTA 3U7JA 5A8WA 3JYTB 1S1XB 3MECA 2EFPA 5DO2A 1XR5A 5EN1A 2HPUA 2OO4A 3IRWP 4MIBA 4NRUA 5EX0A 3HHLD 2CQGA 4UY85 3CULA 5HLFA 1FRLA 2NYIA 4FXWA 1SV5A 2HGNA 2EVZA 2VBZA 4CT9A 4WKYA 1LQ9A 1WEXA 2C3YA 2K1RA 2R2RA 3DRYA 3NAHA 1U8SA 2A2DA 3DDKA 1BY9A 2VBXA 1X4DA 1W25A 1T03A 2EBEA 2YKMB 3R5CA 3MM6B 2P6SA 4RW7B 2MDAA 2A2CA 3LP0B 2ERRA 3BSAA 3OJUA 1H38A 1HNVA 4F4ZA 3KTQA 1FE4A 4NLWA 2UV8G 5AE1A 4F2SA 1ZYQA 2LDIA 4WXWA 2HGMA 3OUYB 3KLEB 1WELA 2E7WA 1YJ9S 1H7WA 5B0DA 2KH9A 1HWUA 1X4CA 2B3TB 4JI3F 2B9YA 3PNIA 2PA8D 2JLFA 2IFXA 2DPJA 3NL0A 2UP1A 3KLHA 3OR2A 4OJHA 3ISZA 4ZPCA 3FDSA 2DHGA 4X4NA 3IRXB 2O67A 3IG1A 2N3LA 4N47A 3UDCA 4WIIA 3M9OB 3X1LB 5M2RA 5KFNA 2DTJA 2CVIA 4CO0A 3H2VE 3CD5A 3K5OA 2VFSA 2UV8A 4DJBA 4IO9Q 2CPYA 3CCUS 5FIIA 4C97A 5HO4A 1SJQA 2I0XA 3FGVA 2ZJPQ 2CKWA 2MKKA 1FJCA 4IH6A 5DS7A 1T3NA 3AHPA 2JC0A 4RBTA 4KIAA 3TUIC 1GXTA 2PMHA 4KV8A 1IBLF 1HPZB 3NAIA 3IAS9 2W4CA 3J7ZT 1U1MA 3WZ0A 1LWCB 2EW9A 1ZPVA 1O0PA 4MKAA 4I67A 1Y4ZB 3MPYA 4YB7A 3W2VB 3Q24A 3KK3B 4J9KA 1N0VC 1S1VB 2X1AA 2DRBA 4DQRA 2O1PA 3GG1A 3OHBA 2DNYA 5DG8A 4B9UA 4ECVA 2PC6A 3IO1A 2ZH7A 1HQEA 3CEDA 1K0VA 2HQIA 1ZTWA 1X9SA 4PUOA 1SB6A 2ZD1A 3O3LA 3H5XA 4WKRA 2RKIA 1G7CB 4OZ5A 2R7SA 1YJRA 1TK5A 1YITS 4EZ6A 4JI0F 1MWYA 4ATNA 3ENVA 2OPQB 5B0AA 5I42B 1NKBA 1FDNA 4RX6A 3THVA 4Q45A 1Y3JA 2EPIA 5FD1A 3OL8A 3UW1A 3F41A 1R0AB 4EYIB 1TKXA 1S9GA 2M0GB 3G6ES 5F8LA 3J7A1 7FD1A 3D2WA 1HBOA 4OIXA 4XIUA 1Q82T 2HMIA 3S6EA 4MMOA 3PW2A 1IKWA 2NUHA 1VBZA 4DV4F 1U1LA 3QGGA 2OFHX 2ZH3A 2DR9A 4OL8A 2D9OA 1N56A 2N7YA 3I32A 4ZLPA 1XEZA 1RQ0A 2BE2A 1S1WB 2CQHA 2L9WA 4EGLA 2IRXA 4Y3CA 3BR8A 5KFAA 4ECSA 4QJVA 4OMFG 3TP2A 5MAOA 2R8GA 1JNRB 2MJNA 2OMOA 3AB4B 4IOCQ 4TKTA 1E6YB 1B0VA 4IDKB 1HNZF 2MMYA 3MOZA 4RW9B 2VKZG 3RB6A 1TUVA 2GHVC 3HT3A 1P8GA 3H2LA 5C24A 1GAOA 1S72S 2DB1A 2F7VA 2X1GA 4PG4A 1CQNA 3QJJA 2YWEA 3RW7A 2MHEA 1NKCA 4YB5A 3N0VA 5KG3A 3KLGB 1KTVA 1OPZA 1DTTB 4RZRA 2DH9A 5CCMA 3O8WA 4FVCA 5CYQA 4TQSA 2HNZA 2KO1A 4PQAA 2HWIA 1S97A 2XLIA 1DZ5A 1Y3KA 4DS5A 1UETA 1UVJA 4K59A 3RR8A 3HVTB 4Q8FA 3CCQS 3KWMA 1JLBB 3M1VA 3RR7A 2ZNZA 4Q2MA 4IQXA 2KRBA 4WFAQ 2L9NA 4X4SA 2DNPA 4IOBA 3T19A 2B4UA 1H3DA 3PV8A 5T7LB 2C2RA 2KG0A 3QO9B 3DCAA 5HN0A 4DV2F 3W2WB 1JLAA 1P27B 2GMHA 4DQSA 1RT6B 2I8EA 3K5NA 1TKTA 2QLXA 4HI1A 1M5SA 2L3MA 4JBCA 2J9DE 2QIFA 1ZBTA 3DLBA 3DRPB 3M2RB 3DLJA 1UJ6A 2MSTA 1QY7A 4DF4A 5L9XA 2BQUA 1U1OA 4JI5F 4BWJA 4P2SA 3VAJA 4RLEA 1FXLA 2CZ4A 3N5FA 1R43A 2RE1A 2DO0A 2I9SA 4ETZA 2PMZD 1SJ1A 2FJBB 1L3VA 4QQBA 3P6YC 4ECRA 2DNZA 3MURP 3HP6A 5CXTA 2HHUA 1FRIA 2N3OA 1RT2B 4ZHRB 3WC2A 2IM1A 2MKHA 1QJHA 2M70A 2VASA 4YUDA 1VQ8S 4DS4A 3T9NA 1FEHA 4LF6F 1NK7A 2FJEB 3V81A 4ICLB 2JRSA 4B3RF 5E3AA 4CO4A 2CG4A 2OP5A 4U9RA 4I6AA 4ZPTR 5D78A 3I0RB 4A48A 2UUWA 2XMTA 3DM2A 1MSWD 4WJBA 1L5UA 2R8JA 4KHPF 2QA1A 2VUGA 4H4MA 3J80Y 4OI4A 2HWHA 3BB5A 5KFBA 1SJRA 2LQ9A 2ZOFA 4DFPA 1X4HA 4X4UA 1B0TA 3NBPB 5A8KA 3SCJE 5FJ4A 2AYEA 2OH2A 4LFAF 1RT4B 2R8IA 1G3OA 1SUQA 1OPIA 2HVZA 2KM8B 2OPPA 3L09A 2FJXA 2RU9A 5J1PA 2E5GA 4P7VA 4IR1A 4DR4F 4G1QB 2J7UA 2MQNA 3RRGA 1QUVA 2WAQD 4CT8A 5BR8F 4WCEQ 5CD4H 3CDWA 1VQMS 1R31A 4H4OB 4O3NA 1ZAWA 4Q0BB 2VZ9A 5HQ8A 3G4SS 1QAJA 1REVA 3AQOA 3VAMA 1RTJA 5BYQA 1M5VC 3KK2A 3MEKA 1MW7A 2XMMA 1N48A 2LA4A 2B5JA 2R2UA 2K7KA 3HJFA 2IHR1 2XSJA 2LXUA 2DR7A 2RF2B 4J37A 2RS8A 4NCBA 2M7SA 5HMYA 1FT8A 2AW0A 3I9V9 2N4DA 3CDBA 5LSLA 4B02A 4OLPA 3R3TA 5L39A 3DRRA 5H1SV 4RW6B 2XMWA 5J2PB 1HWKA 1UP1A 5IZHA 3I6PA 1WEZA 2B0GA 3MAQA 1FKOA 3PIPQ 2ZZNA 2KI2A 3ZC4A 2A18A 3MMJA 2ZH5A 2FB0A 5EHHA 2YKAA 2N82B 2IJFA 2DNGA 5E3CA 3W3SA 5LJ3Y 4OHXA 3CSKA 3VAGA 1U4BA 3UD3P 3POTA 1JKHB 2KVIA 3CD0A 2AV5A 5I3UB 1T7PA 4WFYA 3L95X 3CIZA 4KHRA 4J9MA 1TL3A 1A9NB 3UI3A 3K0JA 2R7WA 5C25B 2QT7A 6FD1A 1CG2A 4B9MA 2WB1D 3SZ2A 1VQ5S 2E9RX 3BZQA 1D8YA 1AXQA 2ZOMA 4HKQA 2U1AA 4R5PA 4DV5F 1KSPA 1FRHA 3GYNA 3N9UC 2PSZA 4FBUA 4N8OA 3DYAA 3DLHA 2Q66A 2B9WA 3MM8B 1SJ3P 2VODA 3CF5Q 1D8ZA 1KVIA 1WEYA 1S99A 2XBPA 1UFWA 2J8AA 5ITHA 1TP7A 1M5KC 3IC1A 5G4DA 1TV6A 1VK3A 2JWNA 3FFIB 1RT7B 4NWBA 2F8EX 5A8RA 3SEOA 4TYAA 2G9OA 2CJBA 3DN9A 2IAJA 2OTLS 2RU3A 1YRTA 5A2QY 2VD3A 2LDYA 3J7YU 1WG4A 4Z2XA 3MMCA 4WXOA 4GO5X 4EUVA 2AJ0A 3MD3A 2ZE2B 3K8VA 5THWA 1KEKA 3OJSA 1OS5A 5DM6Q 3MUMP 3BSOA 3C3LA 4X64F 2UXBF 4M95A 3DU6A 3F73A 5DDPC 3MMAB 2ZH6A 4NCGA 2JEIA 3F56A 1NU4A 5DGAA 2B6AB 2RH3A 1VLYA 1TVRB 4QWCA 3H40A 1HA1A 1BQXA 1VMBA 3DFEA 3BO2A 4FF3A 3PEHA 4X4QA 2E66A 1FCAA 1S6PB 1V3RA 3JYTA 1AUDA 1S1XA 1VQ6S 2RT3A 3CO9A 3K5LA 4DL4A 4FF2A 2BW2A 1NKEA 4WK1A 3D54A 5B09A 5EWEA 1Y0HA 3GWCA 4LVOP 2N7CA 2J0SD 4MK7A 5D4LA 4J9NA 4M94A 2UVUA 3MTKA 3FRZA 3PIOQ 4C8MA 3CJ0A 2G13A 1KQGB 2VFUA 1RJJA 3QIPB 3CCES 2XMKA 2YNIB 4LIRA 4J9LA 3KJVB 4WFZA 3M32A 2YKMA 3TW0A 3MM6A 4RW7A 2RQKA 3LP0A 1WTFA 3VALA 4YR0A 2ZBCA 2IBOA 2KYXA 1YJVA 4IG3B 3DRXA 5IQ6A 4N41A 3E51A 3CMES 2D7SA 3Q22A 3PR5B 4ZA1A 3SQGB 3OUYA 3KLEA 3LQVA 1VIXA 1VIOA 2LMIA 5DQHA 2L9DA 4RW4B 5C42B 3FZBA 4BHQA 1CLFA 3HHLB 2B9XA 4P6QA 4X4TA 5EWFA 4OZ0A 2BJDA 3GIMA 5F9LA 2IA0A 1PO6A 2IMOA 1RA7A 4OZLA 5CQGA 4LMZA 1N6QB 5GADI 2M8HA 5J1EB 4FXDA 3N4WA 5D6GA 3V6HA 5F8GA 2WW8A 2JVRA 4EFAC 1EETB 2VKRA 2YY3A 1U7LA 4NYPA 4U6PA 3V4IB 2J7KA 4ZCLA 4NLQA 4KT0C 4KC5A 3HXMA 2VPYB 1R8AA 5JUMA 1WHXA 4QR0A 2PI5A 3HZGA 3GV8B 1XNRF 4NYZA 1HPZA 1KD1T 5AXNA 3FZ2A 2RVJA 4TXSA 3TAPA 1LWCA 5CYQB 1S77D 3WDOA 1FDAA 1N5YB 3W2VA 2QMWA 1MMDA 3MEDB 1CSJA 3KK3A 5F3ZA 2DPIA 1S1VA 3BF4A 2JDJA 5J2MB 4ECTA 1RKJA 3AJ2A 1UA0A 5J2NB 2DNLA 2JHEA 3GFZA 4DFJA 1X4AA 4A8YA 3G8QA 1Z2ZA 4Z37A 4ID5B 3UDLA 2DVIA 3GB0A 3ULHA 1H2VZ 1YBAA 3EPIA 4BDPA 4B3MF 1JNZB 2A3JA 3NWGA 3QLHB 3OTCA 2RIJA 2XMVA 5HL7Q 2OPQA 5I42A 2M2BA 1FHTA 5KFVA 2HRUA 1P9QC 4QYRA 3GFYA 1FRMA 5DGBA 3KLVA 1R0AA 3PHEA 5KFGA 3NP5A 4C8LA 5F8NA 2DGVA 1QUPA 1WWHA 2DK2A 1EP4B 3SFGA 3GIIA 1NK8A 3DHWC 2KZZA 1C1BB 2JZ5A 1NJIT 2DBBA 1FKPB 1CPZA 4ZMMA 4DWIA 2FHOB 3CDUA 1YSJA 5E7OB 2M88A 3CDEA 4ZK7M 1S1WA 2ZH2A 5D4NA 1OO0B 3K8WA 2OTJS 5HP1B 2C2DA 2F3JA 3PXGa 1SXLA 3CTRA 3VR1A 4ETXA 3DMJA 3EZ5A 2IM3A 2ROEA 3OQ2A 4I0WA 3GR1A 2DNNA 4UUWA 3G71S 2AX0A 4ZVHA 1Q53A 4OLOA 2MQLA 3IR5B 1LWEB 5HBMB 2PGCA 2PD1A 1APSA 1E6YA 3T5HA 4IDKA 4M5DB 4XK8C 3OXFA 4JI8F 3ZZYA 1SL0A 1UAWA 2ILZA 2BZ2A 4O3QA 2JEGA 3TNVA 3B82A 1VRUB 4DSLA 3MFHA 3DHXA 3DOMA 1RKIA 1B0PA 3KG1A 4FP9A 3KLGA 1MROB 1WF1A 2YKOA 1U26A 1DTTA 2C42A 4LSLB 5E2QA 1S1TB 4QU6A 3U02A 2DNOA 2GO9A 1V9OA 1X9WA 3ISNC 4MKYA 3HVTA 5K14B 2M3DA 5T14A 4ZPDA 1TKDA 1JLCB 1JLBA 2C3UA 2V8HA 4OZ1A 3KK1B 4B9SA 1UVMA 1X5OA 4DV6F 3PO5A 4OHYA 4URGA 5T7LA 3THTA 4BCAA 3QO9A 2XLJA 3KMQA 4NLXA 3W2WA 2QE5A 1RT6A 4NPOA 4FXVA 4ELTA 3DLKB 4FF1A 1HBMB 2FLNA 2OFGX 1RWUA 2MZQA 5KOXA 2QSFA 3DRPA 2FC9A 3M2RA 5J1NA 3TRGA 2JEJA 3CD6S 4X4RA 2ZHAA 3CJ4A 3UD4P 1YTYA 1U45A 1DRZA 2ASJA 3PJXA 1XMOF 1LK7A 1H2TZ 5DDOC 1U25A 3B4MA 1RK8A 4KQZA 5EUHA 2YX7A 3MXHP 1X8DA 3VAIA 4OI1A 4K4UA 4A8QA 4IG0B 4OZJA 2KDOA 2FTRA 2E5IA 3R5AA 1RT2A 4ZHRA 5LSRA 1P6TA 4PPDA 1DQ9A 1ZPWX 4Y2AA 4KFBB 1BWEA 3MF5A 2HHHF 4B9LA 1IKVB 4ICLA 3H4BA 2BUNA 4PG5A 4QU7A 4AL5A 4YDDB 3I0RA 4R0JA 3BM7A 3RZAA 1FJ7A 1SJ4P 1ZETA 5AJ3F 1AW0A 3NMRA 1FVSA 1WI6A 2BVZA 4Q5VA 1Q4RA 1HWLA 1OWXA 1DLOB 2CPHA 2VFRA 3NBPA 5L9NA 2ASLA 4V19J 3JTOA 2D9PA 1RT4A 3MAHA 4QIEA 2R8KA 1KOHA 2LEAA 2R7QA 5FLXY 3V6JA 2AD9A 1UMJA 3JTPA 4ECUA 1S0NA 3ENWA 2HLUA 3H59A 4G1QA 3LO3A 3DOKB 2XY6A 1G6BA 4OX8A 3TARA 1B7FA 3NNHA 1JMTA 3QAUA