1O51A

Crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
89
Chain Sequence
HHMKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Hypothetical protein TM0021
publication title Crystal structure of a putative PII-like signaling protein (TM0021) from Thermotoga maritima at 2.5 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
total genus 19
structure length 89
sequence length 102
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02641 DUF190 Uncharacterized ACR, COG1993
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o51A00
3CE8A 4R25A 3TA1A 4ZK7M 1UFLA 1H3DA 1UL3A 4D3GA 4CO4A 5D4PA 4RWXA 3TA2A 2V5HG 3X3UA 4YB7A 1V9OA 2E66A 5L9NA 2XZWA 3BZQA 5D4LA 3OPKA 5DRKA 3NCPA 1GNKA 1QY7A 4YB5A 4OZNA 4Y6IA 4C3KA 4USIA 4NYOA 2ZFHA 1P1LA 2J9DE 4USJC 5D4OA 3TA0A 2XULA 1UMJA 2J9CA 1XK8A 1VHFA 4CO3A 3LF0A 4CO5A 3O5TB 2NS1B 2NUHA 4C3MA 4IYQA 2XG8A 1NAQA 4CO0A 2O67A 3AHPA 3HLUA 2NUUG 4RX6A 1OSCA 1V6HA 3O8WA 4OZJA 4YB6A 4USHA 4Y65A 4CNYA 2GNKA 3AH6A 4E98A 4AFFA 1UKUA 1VFJA 2ZOMA 3T9ZA 2J9DA 2PIIA 3AA8A 1NZAA 2GW8A 1V3SA 4CO2A 4WK1A 3DFEA 1J2VA 3NCRA 4WK3A 3GSDA 1Q1KA 1V3RA 1NH7A 1O5JA 2DCLA 3L7PA 4CO1A 2J9EA 3N5BA 3M05A 2Z0GA 2EG1A 4C3LA 3NCQA 4NYPA 3MHYA 2CZ4A 5D4NA 4RWWA 4RLEA 5DS7A 1O51A 2XBPA 2EG2A 1NH8A 2VD3A 2JJ4D 1PILA 4OZLA 4CNZA 1HWUA 4D3HA 3AA9A 2O66A 1KR4A 2GX8A 2RD5C
chains in the Genus database with same CATH superfamily
1MMLA 4KAIA 1WC3A 1Q7LB 2W8KA 1OSDA 1T9YA 2FPHX 2BRKA 1GH8A 4OHXA 3TQ1A 2JHEA 2JFKA 1WD6A 3DOMA 4IO1A 2ZHBA 4DI6A 2W4DA 2M7SA 1HBMA 4ZVUB 2NXJA 1C1BB 4Y6IA 3T6BA 1SH3A 2EFOA 5I42A 1TVRB 4FKYA 4ED0A 1ZPVA 2LVWA 2PSZA 2HHXA 3IC1A 5KFWA 2WW4A 4QWBA 2Z2LA 1PAUB 3JQMA 2NZ4A 3GTYX 2Y1LB 4O44B 4WK3A 4CLUA 1H98A 2AQ4A 3EXCX 2R2UA 3WDOA 3CC7S 3DGPA 2DISA 3LGHA 2VG5B 3HHLD 2DGQA 3CMQA 3DLKA 2B4VA 2P9EA 4V19J 3WZ0A 4ZS6A 4DSFA 1N34F 4LSLB 3MUTP 2CPFA 2XHCA 3TVKA 3AJ1A 2VF3A 1HIYA 4ANCA 2Y3YA 2KJWA 5AXNA 2R4FA 2MY8A 2OFHX 4DX5A 4LF9J 2QIFA 3R1HA 2RRAA 3MD1A 4F4AA 1X5SA 3NXZA 3JYTA 4MT1A 2O1PA 5A8KA 4DUZJ 5L9NA 2NSBA 1SUQB 3H7HB 4IOCQ 3C66A 3U1LA 2M9KA 2RB7A 1EETA 1P1LA 2C2KB 2GVZA 3GJQB 4DR5J 5HLFA 2HNZA 4IG3B 5FDLA 4ZLLA 3DU5A 2X3GA 4NLRA 2YNGA 4ZHRB 2MB0B 1WWHA 4P2XA 3ZFVA 3HXMA 2ALYB 2WSCC 1RQ0A 2MZJA 3VZHA 3LH2S 4DPUA 1L3TA 2CQDA 4PABA 4FYYB 1WHYA 2J6UA 4G3IA 4WU3A 1UWAA 4FYVB 4ZPDA 4QIVA 1G1XA 3C6UA 4DR2F 1J27A 4ZPCA 2W8LA 2Y0SD 3D3BJ 1TKTA 2XNQA 1WC4A 1H72C 4A4JA 1Q95G 1U48A 1LK5A 3MZIA 4DV5J 1MWZA 4WBFA 1G3OA 5LSRA 2XZTB 1GT8A 2L08A 2LU2A 1BWVA 3M2VA 5C25A 4QR0A 1ZOTA 3PYGA 4EYIB 1R0AB 2Y0BB 4DR3J 4AL6A 1I51B 3HI9A 1NRKA 4NWBA 2ZH8A 1RT7B 3MPYA 1NJYA 1RWMB 1ZETA 2VOPA 3OTOJ 4X64F 3VGVA 3OTEA 2R7RA 3M2UB 2XGQA 4ZITA 1HPZA 1HBOB 4OHVA 1X5TA 4OI6A 4ANEA 1T7PA 4DR4J 2BW2A 3K59A 4CYUA 5KFVA 1RKIA 1FVQA 1L3SA 4Q2LA 1RT4A 5FIIA 4HDHA 1JJ4A 3EZUA 1CC8A 3D28A 2FYXA 4V19X 4KHPJ 3GYNA 2LECA 2YKNB 1R31A 2KRBA 3C14A 4WIIA 3RG6A 3G9CA 1X9MA 4JV1A 4C98A 1GXLA 2HLTA 3I5CA 3IMQJ 2R7WA 3PX0A 2MZRA 3NNHA 2F7VA 2DH8A 3EVOA 4OJ1A 4ED3A 1OO0B 2ZH9A 4HEA9 5HMZA 1YRXA 3FBCA 3FCVA 4CLFA 3ZTOA 2HRUA 4NCGA 4ES3A 1VFJA 3KLEB 3AD8C 2FLLA 5LMUJ 1T05B 4YHHF 3W2WB 2MLYA 4FF3A 4Y0FA 2ILYA 3IM9A 5E7OB 1IBMF 5JMNA 3MPWA 5DS7A 2FY1A 4JYAJ 2HGMA 3M30A 2XHWA 2G0CA 2E9RX 1WF1A 3PYDA 1HQ2A 5C2CA 1VQ9S 2QTWA 2PMWA 1CS4A 4JI3F 4LSNB 3M9MB 3WQPA 1N36J 5GADI 4G1QA 3PTWA 1YQHA 2DJWA 4N76A 1OY6A 3CJ3A 1QE1B 1Z1ZA 3UFCX 2HHVA 4UF4A 1TR0A 3CPWR 4J9QA 1H74A 2DY9A 1FE4A 3W66A 2EBGA 3MR7A 4H54A 2KZZA 3S01A 1S79A 4RX6A 4NEYA 2C2ZB 1KEKA 2ZH1A 4NPOA 3F44A 3R5AA 5IWAF 3CDEA 2GO9A 3HD1A 3KKFA 5EX0A 2ZH3A 3MFHA 2HVIA 2R8GA 4NASA 4OIXA 3EUNA 4DPXA 2CPIA 2G13A 3ZTRA 3J81U 3HJFA 2E7XA 3C15A 1JLCB 4ZJLA 1DY3A 2VZ9A 4NA1A 1D8YA 4U96A 1TKZB 2LXFA 4M95A 4R8UA 2HVZA 4KR0B 2MHEA 5RUBA 4OYWA 2C2OB 1T11A 1H6KX 3LPEA 4MFBB 5E0OA 4CCHA 2KH9A 2ATCB 5DRKA 1RKJA 2U1AA 5F9LA 1IKWA 3FUYA 1N32J 1A9NB 1RWUA 3DMJB 5KG0A 1JMTA 1TAUA 3O5TB 2KRRA 2HBYB 2V4JA 2V67A 1K1QA 2IVMA 4WJBA 2JZ5A 3PW0A 3LAKA 5KFPA 4LF2A 5IV4A 2L9DA 2MGZA 2WRMA 1FKPB 3PR5B 1VRTB 2P2CB 4LRBA 3QATA 4PPDA 4AXIA 3K5MA 3DRSA 1R8CA 2F4VJ 2CXEA 3NGRA 4K4WA 2LXUA 4X2BA 2IHR1 1VK8A 4Q7AA 4IFVB 2FUG9 3MM5A 1XNRF 5CZVA 3MD3A 1DARA 2UP1A 3BKFA 2EFVA 2GIQA 1JXVA 2CQHA 3P5BP 2CDRB 1ZM3A 1WNEA 1UW9A 1S9GA 3ILJA 2P9CA 4JOUA 3IS9B 4ERDA 2H54B 5LM7E 1LWFB 2ZWPA 1WC6A 4A8MP 2M8HA 2Z8QA 3W9HA 1HNWJ 1SBRA 4B9SA 1VLOA 4I0WA 2WB1D 4LF8F 1BQMB 1RT1B 2HRYA 3GQCA 3V6DA 3SFUA 5HP1B 1YIJS 4UOFA 1JLBB 4KPYA 1VLYA 3BPDA 4Q45A 1RA7A 5D3GB 1ZBTA 2A6OA 1S6QA 2KHCA 2FQQB 3WC2A 1J5OA 3MM6B 2RQMA 4KSEB 4LSZB 6AT1B 4V1Ak 3OJSA 2VONA 4I69A 2CJYB 2CVEA 3G82B 2IJFA 2I6WA 2E5HA 2QO3A 1KVIA 3FSIA 4KHMA 4GVBB 2LEPA 1AFJA 3C6TA 3G8SA 3E2EA 3ISNC 3SV4A 3MEKA 4CO4A 2EKNA 1XC9A 2ACMA 2AYMA 3A3NB 2GIFA 3M6WA 3NS6A 3HHEA 1S4FA 1VQOS 3EGZA 2BE2A 2L3MA 4H4OA 1FNXH 2WTFA 4FVMA 2J9DE 4DPOA 5D77A 3EGWB 4ZIVA 3NMAA 3OTCA 3BR9A 3TEHB 4ZMMA 1IKVA 2XSJA 2E44A 4DFKA 2JEJA 4AQYJ 1KFSA 4NLWA 5HJXA 5ETRA 3BPSP 2UV8G 3S6EA 4QQBA 1HNXF 2W7PA 2E7VA 3MMBA 2XY5A 4YP3A 4CLZA 3GIRA 2RRBA 4A8WA 1U02A 3GSIA 2HHHJ 4PWUA 3BGFA 5KG2A 3M9OB 2P5VA 4ZP9A 4OZ1A 2HNYB 4X66J 4OMFG 2ZJQQ 3L4BC 2VQEJ 2AV5A 5CABA 2XB2D 1VIOA 1KD1T 4ED1A 1SV5B 3THPA 2GO8A 1HMVA 1YJRA 4B3TJ 3C16B 3ZZTA 3M8QA 4TYAA 2RKIA 4OJGA 3KHRA 1VR6A 2DGOA 5F9NA 3TA0A 3CD5A 1FCAA 1S1TB 3MAAB 4ZPTR 1UWBA 2BM1A 3KJVB 1NHKL 5F3ZA 2JRSA 1RT2A 3IG1A 3NEKA 4YB6A 2RS2A 2VG6B 3TAQA 1YLXA 2W2PP 3G6XA 5A0YA 1WKLA 4OZ0A 1KNZA 4J90A 3ISND 4YUDA 5CD4H 2UXCF 4EU0A 4DN9A 2P6SA 5K8NA 3C2PA 4OLPA 3RR8A 3A3PB 2OELA 2L9NA 2FJXA 1YBTA 1BE4A 3W8GA 4IG0A 1VS3A 2F1FA 3JSBA 3DN9A 1M5HA 3LGMA 5KFYA 4ZKAA 2NCKL 3OL8A 2IM2A 1KHVA 1NXIA 1RGVA 1L3VA 1RU1A 2DRDA 2SXLA 1R0CB 1D0EA 2AJ0A 4TU8A 4IOAQ 4USKA 4PR6A 1FJGJ 1R43A 1OMSA 4OZ5A 2VQFF 4LIRA 3QSYB 1FKOA 5HMXA 3C3LA 4FYWB 1JJCB 3CXCR 2CJAA 3RB6A 1S6PB 1MNEA 3Q24A 1K44A 3ZZPA 1I1GA 3DOLB 4DUTA 1N5QA 1NNDA 1RAGB 3Q8PB 1LNQA 3VAIA 2C3YA 2J6TA 2YKPA 1I94J 3LW5C 3JB9k 1O51A 1RHQB 1VC6A 3R3TA 3EGVA 5EDWA 3TR5A 2H1YA 3IA0A 4UZCA 2YWGA 5C2GA 2ZH2A 3E01B 2BVZA 1U1NA 4QIEA 5K14A 2RQCA 4CLTA 3I0SB 4IR1A 2ASYA 2W9BA 3WX4A 2DIVA 3LPYA 4M63A 5I3UB 2OAUA 4X62F 4CO0A 1U45A 1OSCA 4KGKA 2VODA 5KFGA 2MEWA 4RBVA 3NNAA 2CPJA 2K3IA 3Q8SB 1WEXA 2XGPA 4JB8B 3LQVA 3G6VA 2MKHA 3R6GB 2OIHA 4I64A 3HVWA 2NYIA 1YBAA 3M05A 1TL1A 3GIIA 3V4IA 3CB4A 3VCDA 2AGOA 3MEDB 1RHJB 2RVJA 3N9UC 3ENVA 1N0VC 1DTTB 5IC4B 4K4ZA 1X31C 2E1MC 1T9VA 4CH7A 4PWDA 4A46A 2AU0A 2W2QP 3KTQA 2CNKB 3K5NA 3W7BA 1Q8IA 2I5JA 3MEGA 2I0XA 3HSZA 2D3O1 4ZOSA 3BR8A 1M0SA 1FEEA 4O0NA 1OYEA 3NBPA 2DB1A 1N34J 2R3VA 1IR0A 3TJ9A 3H8YA 2BKOA 3UCGA 3R5GA 4LMZA 1G2EA 4ES1A 3M1VB 4HHJA 1LW0B 2IRUA 5A8KB 4B3SF 3RW7A 5GVQA 1U1QA 1RXOB 2VPWB 2UZAA 5J2PA 4XPCA 1EKRA 3RBZA 4EZ9A 4ALZA 3QT5A 2HNZB 1HNVB 3RAQA 4ED2A 2P6TA 2JJ4D 4G6VB 2UVWA 2CPYA 2G0IA 3VQSA 2PD1A 3CE8A 3WBZA 3W8PA 1JWWA 2QYGA 3IGVA 1AROP 2XS7A 5KFSA 3UDVA 2QLFB 2XCPA 1V3ZA 3IBCB 3PFOA 5T14A 4UTGA 5HROA 3FBFA 5H9EJ 5D4LA 5BYSA 4O4GA 3JSMB 4FS2A 2R7TA 4ZVEA 3CJQA 4HH0A 2K7KA 2LDYA 3LTOA 4URGA 2IA0A 2K3KA 1HQUB 2YNFB 1F9EB 4KIAA 2FJVA 5I3PA 3T9ZA 1M5VC 3DLJA 1RLCL 4OLOA 4CP5A 4WK1A 5C25B 4UQTA 1MWYA 3M8ZA 2HG4A 3CCZA 4IRDA 3ZZUA 3K5LA 4JI1F 1N5YB 5JUMA 1RTHA 4NLSA 3TUJC 1GTEA 5A2QU 4OI3A 1F1BB 1T8EA 1NM2A 4M5HA 3KK2B 3NWRA 1EJ7L 1RBAA 4XAKA 5CH7B 2Y1IA 4QZVB 3W5XA 4C8YA 1P8GA 4LBPA 4Z7YA 4MKVA 4Y3CA 1CC7A 1ZAVA 4CYUB 2FB0A 3GZ7A 3PHTA 2VA3A 1RE1B 3OVSA 1QJHA 1RT4B 1F60B 1CULA 1JXEA 2KYZA 2WVFA 1UA1A 4HYKA 3UVJB 3Q8VA 2W9CA 2HMIA 4TXSA 3UDEA 5HBMB 2JNJA 2K06A 2E7WA 3P3DA 2YKQA 1NKEA 4Q43A 4IQMA 4I7FB 1WDTA 1KP6A 3ADAC 1M90T 2ZNYA 3M8SA 4RO0A 1HNIB 2HHWA 3BDPA 4C97A 1TL7A 3OR1A 1Y10A 1MMDA 3BREA 3G4SS 1S1UA 5JXSA 3CULA 1L5UA 4JV5F 1QUVA 4CQ1A 2MKYA 2C22A 4LFBF 1C0UA 4RJVA 2BQRA 3FKBA 1O8BA 3ILOA 4I6WA 2IBOA 1RHKB 4YDXA 1YJUA 5D4PA 1ZS6A 3ILIA 1Y5NB 2Y1JA 5KFDA 2RHSB 4QWDA 3RAXA 4YHHJ 4LF6F 4XO0A 2ZZNA 2ZJRQ 3J7YI 2H5EA 1T03B 1IBMJ 3TJAA 2AJ2A 4M1KA 3BH6B 4OYOA 3N4WA 1U1LA 2F9DA 4C8NA 2MZTA 3CCSS 4NYOA 1NB7A 4YQWA 1JLGA 5HSPA 5CXTA 4RNOA 2FDNA 1CS4B 1HBNA 2JFDA 5KFZA 4I4BA 4JI3J 4PG7A 2XMUA 5J2MA 2GNKA 3DDKA 3UD5A 1QTMA 1IWAA 1UW4A 3FMWA 1T9XA 5G0RB 4QR2A 4GKKF 2GZOA 1FHTA 2O3DA 1A7GE 4FBUA 4QOTA 2DNPA 1LWXA 4ITSA 1KTQA 2CNLB 2OPSB 4OX8A 1FESA 1BD6A 4MKAA 1FI4A 1UVIA 2FC9A 5BYRA 5IWAJ 5K8MA 2MXYA 4A8YA 2C2NA 3X3UA 2B3TB 1YK9A 4M8LA 3MEEB 4NZ7A 4RW8B 3V81B 5E2QA 3JTPA 2CZVC 2DRAA 2NR0A 3OPKA 5K8OA 5GMDA 2X3DA 5D8HB 2GJIA 1T02A 2ROEA 3C15B 4LQ3A 1CBKA 1VHFA 5A76A 1RTDA 3CCJS 1TKXB 4FNIA 4CLPA 5GAHU 1NAQA 1W26A 1N52B 1EARA 4DQRA 2B7BB 1UEVA 1G6BA 4OZJA 1ZAWA 1OY8A 4RBTA 5E33A 2DT9A 3SEOA 4CO2A 4IH5A 2D3ZA 3CGIA 3CCQS 3VAGA 1VQLS 3U02A 2FJAB 3PIOQ 1KRPA 4Y00A 3L7PA 1IKWB 1S9EA 4WYLA 1RHUB 2YX4A 5FLXY 1QUPA 2ZBIA 2VJVA 1QAXA 5DLGA 5DDQC 4DDFA 4J9PA 4DL7A 2B4OA 2QYCA 1UEKA 2VH7A 2VG7A 1CJKA 1FRIA 3KLGB 2V63A 2KFZA 3PX6A 3HSJA 2MGZB 5C5JA 3BGLA 2XLKA 3KMSA 4F04B 4M5MA 3HT3A 1N54B 3W2VB 2DITA 3M8PA 4KPCA 2EFQA 1IQZA 4ELVA 5KFNA 2KXNB 2OTJS 2A0FB 4EO6A 2RU9A 2JL9A 4N8OA 3MM5B 2Q3PA 1X4CA 3VVUA 1XNRJ 2MYFA 5A8WB 2MZQA 1QLNA 2ZKTA 4M5NA 4RW6B 2C3PA 2ZOMA 2PO4A 3ENWA 3HHLB 3GYGA 2VUGA 2GW8A 4ED4A 1IUJA 1DTQB 3IRWP 1X4AA 1CSJA 1QAJA 5IZHA 1JJHA 1TVRA 1M5SA 5E3AA 2W24A 1B70B 5HL7Q 1IBLF 2FGOA 3M32B 2G1HA 1EZZB 1NHVA 5D0EA 2QLXA 5LJ5Y 4NRUA 5DETA 3EICA 5D0HA 1VQ8S 2CQ2A 1WDDA 4O44A 4LF8J 1VQ6S 2ZUAA 2ZZMA 2NSCA 3MPUB 3ZTSA 3BQ2A 4F4KA 3TZZA 4WCEQ 1J5OB 3H2UB 4B9NA 3NGUA 3HULA 3LA0A 1Q86T 2XO6A 2IJNA 2W2NP 5EWFA 1SL1A 2NXUA 1TK0A 1VOMA 2VKZG 2F8MA 4EWTA 4LSLA 3B82A 5LXRA 1Z2LA 4DU7A 2WBMA 3EPGA 2V4QA 3LP0A 4Q44A 1NCLA 1IN0A 2B6AA 2DR5A 3QWUA 4MTPA 4KB7A 1UP1A 4DUZF 3U1NA 1UFWA 2PI5A 1SUQA 1ZZNA 3MCOA 2LQ5A 4R0EA 4ER8A 2DEIA 2ZZTA 3D4JA 4OYIA 1C4AA 4DR5F 1U0SA 2KDOA 3QPIA 4FKXA 5HN0A 1NK4A 1T94A 1N5SA 4MK8A 1RI7A 3N5BA 3UDCA 4IG3A 5BR8J 2UUAJ 1FD2A 3CJ2A 3B4MA 4J9OA 1URRA 4ZHRA 1ZA2B 2BMBA 1PILA 2XSJB 3MOJB 3ZNUA 4JI8F 4P52A 3CMAS 1QAYA 3TO8A 2YVSA 2B9YA 3Q8YA 2HSEB 4RU2A 3ITHB 1XBWA 3CIZA 1IJFB 1YI2S 4O0IA 5CA5A 5ETPA 3NLCA 3P5TL 3Q23A 4G1PA 3MWBA 5LSLA 3DXSX 1GMWD 1FXLA 1EHWA 2AP6A 4C0OC 5DDOC 1LOUA 4TLRA 2ZVIA 2RUSA 5KFRA 1UZDA 2ZC4A 1EIYB 3ENAA 2ZBCA 2QMUB 3A12A 4KGVB 4Y65A 4QPTA 4LVOP 2VC1A 4DR3F 1R0AA 3KWMA 1JLAA 2ERRA 2RKIB 2HFSA 4OYPA 1HI0P 2WCXA 5GAGI 1RT7A 1EB0A 3KLFB 1T9UA 3HD2A 2H3EB 5ITHA 1NH8A 3IG1B 1HQEB 4LRCA 5KFFA 5K9FA 3L9ZA 1RYSA 2CNNB 3M2UA 3PR4A 4K4VA 5JVGQ 1C1CB 1HBOA 2J8AA 2QL9B 5EUHA 5E41A 4ED8A 4K5RA 1T3OA 1SCJB 3NRBA 2O01C 2UXCJ 3O3LA 1N56A 3H59A 1N0UA 2PN6A 1M5OC 3SSRA 4PQAA 3D5MA 4PUOB 4IDKB 1RACB 3C8YA 2HNDA 1JQGA 3IR5B 3DCAA 1CVJA 3FBBA 1PAEX 2YX1A 4NMXA 5BYQA 1RAAB 3CD0A 5D4OA 4IUFA 1FO1A 1EX8A 3K7RA 2YKNA 5KAKA 2B8QA 4DBQA 3G2XA 2DHHA 3TJ8A 4F26A 3EX7B 2RMLA 2HQGA 1ZA1B 3GP9A 3OVAA 1YRUA 4K8RA 2DR6A 4ZJOA 2B9WA 5IOLA 4K4TA 1FD8A 4F3OA 1X0PA 5DGBA 2FJWA 1YJWS 5ETOA 4NA2A 5M2PA 1Y7PA 1IBKJ 2VQFJ 3CTRA 4DX8H 5IV3A 2BANB 3CO0P 3KLEA 3VGSA 2ACYA 1U8WA 1T05A 1IVZA 5F8IA 2HFZA 4DFJA 3FSXA 5KFOA 4I2PA 2NQPA 4N5SA 1JNRB 3BO2A 4DV0F 4P2SA 3G71S 2HEKA 1M1GA 3QAUA 1F9HA 5IT9U 2WHOA 4LSNA 2MLXA 1UVNA 4P6QA 3SCKE 1SPBP 4KV8B 3PY8A 4U7CA 4URSA 3O1LA 1NUEA 4NLOA 4CNYA 1S77D 2WVEA 2I9SA 3R7SB 4URQU 3I31A 3A13A 2XS5A 2NPIA 2CQGA 2AYGA 1D1UA 1LQ9A 4LJMA 2GMLA 2IRXA 4Q0BA 1HNZJ 4LBIA 1SL2A 1RT3B 1SKRA 4B9UA 2ZE2B 3EE3A 1PSDA 1NSQA 4X62J 4ED5A 3X1LB 2V69A 1EAYC 1CJTB 3MPDA 2NZCA 2Z57B 1TL4A 4LF4J 4WXOA 3W65A 4OYBA 2CQCA 1T95A 1TELA 4DL3A 4UY85 1KKHA 2BV3A 2VBWA 3HT0A 1DQAA 4JBCA 3Q22A 3ULHA 2GJFA 3W62A 1MSWD 2DY1A 3NCPA 1JLCA 5CZXA 4DS5A 4F0KA 3EXYA 3E8OA 4USVA 3D1HA 3BJYA 1I3OB 1TKZA 3KXDA 4O3PA 1NJXA 3ZZYA 4GO7X 3RBEA 2MKKA 4A8KA 5GMEA 2W2OP 4MFBA 2GGPB 1WOOA 2ZBRA 4Y2KA 4J9VA 1M1KT 2BJEA 3DMJA 1UVJA 3GJSB 2ASJA 4M5KA 5DO2A 3NBPB 4IO9Q 3GFXA 3VZIA 1Y0HA 3S8SA 1HI8A 3MM8A 1XMQF 1HYSB 2AEJA 5KG6A 4KRWA 1NK7A 1C2PA 5AE2A 1RAHB 1RT5A 1VHIA 1FKPA 3T5JA 1VRTA 4B3SJ 2F4VF 3D6FB 2ILZA 3HFKA 2B9EA 3CDUA 5DG7A 3R5BA 1CJVB 3KK3A 3IN5A 3K58A 2R2TA 3NGDA 2DEJA 2RH3A 4CI0B 1G7CB 2D41A 2HAIA 2ADCA 4I1TA 1T9TA 4K59A 3M7VA 3K0JA 1GMUA 3J7Z5 1AW0A 4PG6A 4NYZA 2UUWA 5AJ3J 3IS9A 1VISA 3D6MB 4P2FA 2X1BA 2H5IB 1J5EF 1LWFA 2XLIA 4ED6A 2C2EA 4XIUA 4YN3B 4DR1F 1QVGR 1ZPWX 3D66A 4NXMF 2JX2A 1BQMA 2MQNA 4EBEA 1RT1A 3V5RA 1FRJA 1K47A 5D0RA 4HHUA 5HP1A 2HAFA 4TLQA 2EK1A 4C7QA 5LOQA 4HI2A 3BBCA 3OR2A 3VAJA 3AY0A 1PJ6A 4M5LA 5L1IA 2LQ9A 4P10A 3MM6A 1X9WA 4HH1A 3TA2A 3OSPA 4A48A 4DPTA 3G82A 2PMHA 4JI1J 2RDIA 1AYEA 2R9LA 4P2MA 2FVPA 4F0HA 4O4RA 4GVBA 2R7SA 2FTRA 1OQ3A 3V6KA 4HT5A 3E3XA 4OZNA 4FP9A 3IP0A 4L72B 4USJC 2C28A 3PKMA 2YNHB 4CLKA 3F41A 3F73A 3RB3A 3QGHA 1ACMB 3PIPQ 4M5GA 5L8RC 3TARA 1W7WA 3BBBA 1U1KA 3H0PA 3BV8A 3WC0A 3RUBL 3DLHA 4HT7A 4BWMA 3RRGA 2I38A 4ZDNA 1RCOB 1LW2B 4B3MF 2FIUA 4AQYF 3ICLA 2ZH6A 3M2RB 3RU0A 2XYGB 2GQQA 3GCWP 4TY8B 4DQIA 4HVZA 3VHQA 4X4UA 4HLBA 1XEZA 4GC6A 2IM3A 3D0HE 2LLZA 4QU7A 1PBUA 3C46A 1PGZA 3GWCA 2ZDPA 2N7YA 1ULRA 3NS5A 3WHIA 1PYSB 3TX0A 2GFFA 3CO9A 2HNYA 4AL7A 4C11B 3QZ7A 2YNIA 2FVSA 2BQ3A 1UPMB 1SV5A 2FGCA 5GADU 3OV7A 2ZITA 3Q86A 4FNHA 1FRKA 3EYZA 4B3TF 4HI1A 2ZH4A 3DU6A 5LMNF 2IC3A 4IRCA 2LP4A 2F63A 4J9MA 2CPEA 2P9GA 2B43A 3MTKA 4FPRA 3NOGA 1Q1KA 2GHPA 3QGIA 3V4MA 4NLTA 1S1TA 3MAAA 2B8PA 1OWXA 2OSQA 3ILLA 1JLGB 3ZO7A 2RU3A 4JUZA 2MQLA 2NXEA 1I5OB 2OPPA 2VG6A 4X4NA 2VC0A 4DOZA 3ELHA 3Q89A 5J2MB 2E1CA 3PRVA 1KR4A 2BOAA 1FVSA 1HR0F 4DMZA 3QBCA 2R7UA 2KJVA 3AJ2A 4IFYB 3FZ2A 1GEHA 5L1LA 4ZIWA 2V9WA 1S1VA 5KFTA 4DCOB 1O6XA 1KVJA 2HVHA 1Y11A 4GKKJ 3UI3A 2NREA 2Z58B 4TVAB 3M6VA 4F4ZA 2KFNA 1HARA 1DLOB 2HIYA 1I6JA 2UUCF 4P9SA 1OIAA 1UA0A 4ID8A 3OJUA 3EMTA 3T6JA 1NJIT 2VFSA 2WK4A 3H40A 3RGIA 4AT1B 4KY3A 3VAFA 1FKAF 2E5GA 2ASLA 1MROA 5H9EK 3GSDA 4Y28C 1BWEA 1BHNA 1H7XA 4ELUA 3OLBA 2MTLA 4C2MA 4A8QA 1QSLA 2XMWA 3I9V9 1DFDA 3SSQA 2Q43A 2L41A 1M1HA 1KVKA 1WG5A 3DOKB 1NEEA 2HW3A 3OQ2A 4L73A 1S6PA 4DU8A 3HHLC 1R8PA 4YR0A 3QRQA 4KH0B 2KB2A 1MG7A 2D9OA 2HWHA 3DOLA 4JI0J 2LEBA 1OJ4A 1KQKA 3PRDA 3CDWA 1XMOF 1TMMA 5A6WA 1D8ZA 4DR6F 5B0GA 2Y9HA 1PCAA 1S9EB 3AD7C 1WACA 3FJ2A 3TZWA 5L39A 2GIRA 3DDIA 3CJKA 5D0GA 2GHWA 2VG7B 2D3UA 4H4KC 3T3FA 3E01A 4RW4A 3IWXA 2NUUG 2PFDA 2M0GB 1BLUA 4KH1B 2CPHA 1UKUA 3I0SA 4NCBA 5EHHA 2KM8B 5I3UA 2W2MP 1SVDA 2LQ8A 3OFGA 3ZC4A 4PRFA 3NGTA 2OH2A 3GIKA 4F4XA 1P6TA 5ETMA 2BJ8A 3TVYA 2ZDOA 1SJFA 1HHTP 1WHXA 4JI4F 1K0TA 2PA3A 3NAHA 2LCWA 4MKBA 2R42A 2PC6A 3RRKA 3KHLA 3C19A 3EGNA 3A1YG 2VB6A 5E5NA 3D7SB 1SIWB 2PFFB 5IFMA 1VJQA 1NK6A 4OX9F 5KFMA 5KT2A 3HKZD 2YKOA 2UXBJ 4X4PA 3MEDA 3SCLE 1IBLJ 1FRXA 1JKHB 3QZ8A 1DTTA 1VQPS 3K8WA 3HPOA 3KK1B 2MLZA 2A18A 1A6LA 4DSEA 1H2TZ 2BDPA 1FA0A 1PC4A 1WI6A 2ZH5A 1VBZA 1RABB 2XI2A 2QA4S 1U1RA 1JLEB 5AXKA 3UCZP 2AJFE 1EQ0A 4EZ6A 2GMJA 3LP0B 3OVBA 2QX0A 2YTCA 2E1RA 1REGX 2B6AB 4R5PB 3N28A 1F2GA 4B02A 3CVKA 4WKRA 2MQOA 2V2ZA 3AB4B 3A4TA 2BJ7A 4FXDA 3M1VA 3MURP 4KE5A 1LW0A 3FMBA 2B0GA 5LL6d 1IM4A 3ZZ0A 1WG1A 2Y8YA 1UZHA 9RUBA 3PJ9A 1X9SA 5F0WA 5DZ7A 3SMZA 3BGRB 2R8JA 5HO4A 3ZZOA 1XMBA 5HQMA 1HNVA 4CH1A 4W4MA 4DV2F 4KGMA 3Q2TC 1X4FA 3BGOP 1PO6A 2XULA 4EUVA 2UU9J 4ZCIA 4U8YA 2B9XA 4DLGA 4JI8J 2KTQA 4DV6F 1LXNA 3MM7A 1NZ8A 5CYMB 3MTJA 4X4TA 3GYXB 2MKIA 1RCXB 1R7IA 1RYRA 3TZXA 2OPQB 4M5JA 3M8RA 1XR7A 4OI0A 1Y00A 3JSMA 5LSOA 2Z4PA 3AODA 5SZTA 2W7AA 2RF2B 2WB4A 1SQFA 2EG1A 3QGPA 1HQUA 3IRXB 2YNFA 1IWGA 4TQSA 3CC4S 3RZAA 3KLIB 5HATA 4K2JA 1M5PC 3FQLA 2UV8A 1U24A 1S48A 2LMIA 2AZ1A 5B08A 5DM6Q 1WKJA 1N5YA 3ZTQA 1JLAB 1WTBA 2GJ2A 5KFAA 1YSJA 4NA3A 2B51A 3TYTA 1N4LA 3I9ZA 5U47A 2NYHA 3KK2A 4Z7CA 3VGUA 2XYPB 3J81j 3TVZA 3SCIE 1JJ2R 4NI2A 2V8DA 4PYDA 1BXNA 4EBCA 3VF0B 3CJ5A 3BO4A 4IYQA 1YVFA 1SI9A 2YX7A 2FZGB 2DTJA 4LBHA 4L76A 1VQ7S 1NPPA 1U09A 3GONA 3N79A 1UVKA 3W64A 2HNDB 3GLJA 2MKCA 1WOSA 2E29A 3M8YA 3SCJE 1D9AA 1VBYA 4YMEA 2QRRA 3UVJA 1B3TA 4DV1F 2MMYA 3LP1B 2XMVA 3FCHA 4RLEA 4NZ6A 2K7JA 5HBMA 1ITPA 4ECQA 1Q5YA 4Z37A 2W4PA 4I7FA 3JTOA 4OV1A 4P71A 4NLGA 4J7CA 1BUXA 1HNIA 4RW9B 3NL0A 1SB6A 1WC5A 4N7TA 2WOMB 5DG8A 2FVQA 1GXTA 2IVFB 5DDPC 1FNMA 2XS2A 2YWFA 1Q0NA 1Y4ZB 2LEAA 5KFBA 1MLAA 3FFIA 4XTTA 3LF0A 4C3MA 4CH0S 3HHDA 2CWXA 1X4EA 3IAS9 1MMNA 1T03A 3LP2B 4I2PB 1FRHA 1XN9A 2BACA 1KFDA 3RYLA 3NY0A 3VAKA 4S0MA 4DV0J 2HS3A 1WG4A 2G9OA 3FVYA 4NYPA 3CF5Q 3GG0A 3UNGC 2P8IA 4J5OA 3PV8A 2AGPA 2VPZB 3L7OA 2ZUGA 1E6VB 4UW2A 3W9JA 3QNWB 1VQYA 1H3DA 2HBQB 5G0RA 4NRTA 2XC9A 4USUA 4F02A 1ZYQA 5L9XA 4Q0BB 3H98A 3JQKA 5G4DA 4UY8T 3MXHP 4C9DA 4WZQA 2KHDA 3KG0A 5A6PA 1AZSB 2OPSA 2AJ4A 1OYDA 4B17A 1N5TA 2XNRA 1D09B 3PG9A 2NUHA 2RIJA 2BXJA 4QYRA 3G6ES 4PXDA 4PEOA 3MEEA 3FC9A 4RW8A 3V81A 3BGUA 1PJ7A 1GXUA 1CQMA 2M8DB 4DV3F 4J37A 4Q8EA 1U6ZA 1RADB 3PO5A 1TKXA 1S97A 2CWKA 1FFWB 3H5YA 3KJFB 5DQHA 5KTQA 1YJ9S 4H4MA 2VBZA 1B7YB 1IKYA 1VRUA 2OO4A 4OJ3A 1B99A 1F5AA 3TUPA 3FNNA 4NLYA 1REVB 4ENOA 3EM1A 3KUHA 2UVUA 2XZWA 3AFGA 4FBTA 3MM8B 5EWGA 4YR3A 1FNOA 3UN3A 4DN0A 4F7VA 4U7UD 1XMQJ 3FDSA 3KLGA 3S1TA 1RWPB 3N0VA 2UUBF 3KDNA 4DCJB 2VFTA 1RT5B 2DGSA 4WFAQ 4QYZJ 3I5AA 5T7LA 3AHPA 3M4XA 4JV0A 4FPIA 5C24B 3VWSA 2BM0A 2RE1A 5J1EB 2BE9B 2KT2A 3BSCA 4I56A 4ECRA 3W2VA 1WF2A 3F56A 2QT7A 2RQKA 3KK3B 2YWWA 3DRPA 2CA9A 1SH2A 2JC1A 4R0JA 1UTAA 3J7ZT 3MUVP 2AF6A 1CQNA 1RTJB 2CJKA 1FWPA 1QAIA 4B3RF 4N77A 3H2VE 4KQZA 1F9FA 2DHSA 5A8WA 2R7VA 2E9ZA 1TZ0A 5L38A 3BQ1A 3GJRB 5IM0B 4RW6A 1HD1A 3HHLA 2HHUA 3QO9B 5CYJA 3D9BA 1DTQA 2YY3A 4ZA1A 3GFHA 4TU7A 2VL1A 3W1YC 1G4CA 1J5EJ 3IBFB 4UUXA 4MMOA 2FY8A 3M32A 3CEDA 3MF5A 2IAJB 4ZVRB 4DR1J 1FX2A 2V50A 5J2QA 1JLQB 4NXMJ 2KVQE 4XK8C 3UR0A 1U1PA 1GNKA 2VASA 2EI5A 2DO4A 3OR2B 1Q8LA 2R7OA 2DGXA 3H90A 4H4KA 1O0PA 2C1EB 5KT7A 3GPAA 2JEFA 1JLFB 3LUYA 1F6TA 2AJ1A 4AFFA 2N7CA 1SQGA 3DLGA 4ZVSB 3SFGA 3Q2SC 3BS9A 4DV7F 4B9MA 2I8EA 1DURA 1B0TA 1O5JA 3FRYA 2V34A 3KFWX 3HP6A 4HL9A 2JC0A 4DPWA 3W61A 2Z0GA 4RPFA 2CZ9A 3SI8A 4DSJA 2N4DA 4W90B 4G1IA 3EWGA 2HQDA 2OMLA 4KHRA 1VMBA 1XWLA 4I2QB 1UCNA 2KT3A 4BLGA 3RJMB 4XDDA 1S72S 2KZMA 2BA9A 3Q8QB 4R25A 5BR8F 2UUAF 4L75A 3MECB 2HHQA 4O23A 2UVRA 3PW7A 3ETMA 1T3NA 5I4MA 1GFWB 1U6BA 3GV7B 4EO8A 3PEJA 4WFBQ 2V2QA 1V5VA 4B3MJ 2C3OA 2MY7A 5KG7A 2LKZA 4HKQA 1QDUB 1UAWA 4LFCJ 1XK8A 4WU2A 3JAMU 3UWTA 3ITHA 5CCMA 3J7YU 2MQPA 2CQ0A 3CWJA 1P1TA 2CJQA 2N3LA 5KOXA 4WFXA 4ZPAA 5E3CA 3QSIA 4DL4A 4C8MA 1WHVA 2PI4A 4WYWA 2YNIB 2KKHA 2H48B 1PG5B 1WORA 1LFPA 4K4SA 1WTFA 2M3DA 4PXEA 3H42A 2IC3B 5B0DA 2XWXA 2WBRA 1Q82T 3AOBA 2HQFA 4NOHA 2HVEA 2MKJA 5LMNJ 1SQEA 4P73A 1CJUA 5KFXA 2BABA 4U6PA 1VQMS 2ZKUA 3TNVA 2VA2A 1UFLA 1YG0A 1AA1B 4CLLA 4D3GA 2A3JA 3A8IA 4RU9A 2HGLA 3KLFA 1S6OA 1VQNS 3MR5A 1RAOA 1OS5A 4Q8FA 1HQEA 2J8SA 4PYAA 5ETLA 2OPPB 1PJ5A 3I6PA 1C1CA 1PC5A 3J81Y 3GR0A 1VJWA 3B6BA 5B0AA 1TP7A 2AYBA 1HR0J 4OHYA 3MCMA 3SSSA 1FFSB 3AH6A 4PUOA 3KLHB 4IDKA 1S1VB 5F8NA 2W01A 2BR0A 1APSA 2DNLA 3LANA 3S7RA 1SC6A 3VAHA 2Q6CA 4BBYA 2ALZA 1XIQA 1U2RA 5B0FA 3D0GE 4B9LA 4F0MA 4KO0A 2UUCJ 3HDSA 4P74A 2YWEA 4MYUA 4NLQA 1Q8BA 2MQ8A 2WONA 1F3VA 2KM8C 3HVAA 4KFBB 2NLWA 4E0DA 1VK3A 2HRTA 1KTVA 8ATCB 3P8BB 3BKUA 1MROB 1JX4A 3VR1A 1VQKS 1CG2A 1IBKF 1R89A 3KG4A 1FWKA 1HWIA 3OBIA 3MI7X 2FLPA 3TQEA 2QA1A 2IPOB 2ROPA 2BANA 5B0EA 3IAM9 1AUDA 1P9QC 1S9FA 2DKOB 1YTYA 1DJ0A 2K1RB 3CW2C 5CHCB 1BGXT 1RWWB 4WPAA 4DCPB 4PXBA 1V5IB 1KQFB 4ZVGA 1U4BA 1XMOJ 3NKYA 2Q79A 4DR6J 4DFMA 3HO1A 2XYHB 1S49A 3NCRA 2COLA 3BO3A 5IS2A 2VFUA 4ILLA 3CJKB 1X4DA 2QJ3A 4I6AA 3K5OA 3WIUA 1ZM9A 3O6QA 1U8SA 3M9NB 4DG1B 4KV8A 4RW4B 4J9SA 3FEYB 5DLFA 4FF4A 2OEMA 4D3HA 1XQIA 3RB0A 1SL0A 4Z2XA 2VDIA 1UJ5A 2JLEA 2I2YA 2R8KA 4DQQA 2J0WA 1HNZF 2L9WA 3HVTB 1DZ5A 3EDRB 1NB2A 4FYXB 2GQ2A 1AB8A 3W3SA 1RT3A 2ZE2A 3GB0A 4AXJA 4O3RA 2D3OR 4LF4F 2EBEA 1CJTA 3GJTB 4TU9A 5FJ4A 2BOPA 2YBVA 4FYDA 3JTNA 2AX0A 3DYAB 1UETA 1U0HB 3PACA 4JI4J 3QJJA 1V6HA 4N47A 1FTCA 1L3KA 1R8AA 4C8LA 1KSPA 3DLBA 2D74B 4L6V3 2YXLA 2BQUA 5HK4A 2B5JB 4OX9J 3HKWA 5JJBA 1R0BG 1TUWA 2WSEC 5AXMA 1KN6A 3BH7B 2XY7A 2RAQA 3MPVA 4ZCLA 4IH7A 1HD0A 4ZCMA 2GGPA 3AA9A 3L7UA 3OSNA 3GIMA 1S1XB 2QC3A 4DWIA 2B7CB 1E6YB 2YQ3A 3G6YA 3Q0AA 3M8WA 2DNYA 3JAMY 1HYSA 3G87A 3HF5A 1X0FA 3CCUS 3VV2B 3F0NA 4UT4A 3TUIC 1SJ4P 2OUGA 5KFIA 1S0OA 1LWCB 3PCOB 4QR1A 3AJDA 3OFEA 4N56A 2CQIA 3W5YA 4B3OB 1K73T 3OUYB 1TTHB 1CJVA 1AT1B 3BBFA 3DI6B 2VOOA 2Y1RI 3OL6A 1TL3B 4L3KA 1V3SA 3OD2A 4M5DB 4USMA 4K0KF 3MGJA 3QIDA 3VTIA 1NH7A 4DV2J 4RUBA 4GMKA 1RWOB 2CDQA 4CLSA 3K17A 4J9LA 3RBDA 4WP9A 3QIPB 4KYZA 2KN4A 3O44A 1Q53A 2C2RA 5F8GA 4EYHB 1LFWA 5AJ3F 3PDNA 1RWXB 1RHRB 3UN5A 3MM7B 1WSRA 2QEXS 1RJJA 3POTB 1NBEB 2BJDA 2QFIA 1HWUA 4DV6J 1R8BA 4J9NA 1NK5A 5GAGU 4IKAA 2HWIA 1YZ7A 4UOHA 4BS2A 1RAJA 4K2XA 3NP5A 4GC7A 1H7WA 2U2FA 4YFUA 4FF2A 1TU0B 4F3QA 3CJ8A 1UMJA 4DSLA 4PCQA 2V8VA 5M2RA 3QRPA 3FZBA 3M6XA 4W92B 2VFVA 2XY6A 2FHKA 4WXWA 3BM7A 2HK2A 1S99A 4ES2A 4NE9C 1HW8A 4WZMA 1NHUA 4A8XA 4ED7A 1NSKL 4GRSA 3UD4P 2AIRB 4HHHA 4NI2B 2YNHA 1TL5A 2CZ4A 2DXFA 3ET6B 4EBDA 2B4PA 4DSIA 1Q4RA 1F5BA 4PQUB 2DHAA 5GMKa 2O66A 2GX8A 3N01A 3T19A 4LF7J 1Y9OA 2N3OA 3R2DJ 2ZD1B 4ZK7M 1H2UX 3UQSA 3SQGB 3D67A 4DL0C 4X65J 1T9WA 1LW2A 4DF8A 4K7QA 4AL5A 3M2RA 4KT0C 2JH3A 4TY8A 1HBUB 1RTZA 1YRTA 3FGVA 4DV1J 2V9KA 4J91A 2IDEA 1OY9A 2HPUA 2ZHOA 4J9RA 2QL7B 3VGTA 2EFNA 2Z30B 1XNQF 4ZPBA 4ETZA 5ETQA 3QRRA 3I82A 2O67A 3ETOA 2QV6A 3OTDA 2V94A 5AT1B 2H4YB 4OX7A 2CG4A 2CQ4A 5DQIA 1U2FA 4Q5VA 1DQ8A 4C11A 3PW2A 1RBOB 1AFIA 2AT1B 1MW7A 4E2FB 5BJRA 7AT1B 1ZM4A 3DDNA 2OHDA 1ZTTA 2V2KA 3B54A 3TX8A 1CPZA 3FFIB 4C8ZA 1NMEB 4OZ3A 3SDEB 2XBPA 3MAQA 4O3SA 3IFEA 6FD1A 1YBUA 2HGNA 4LRFA 4K50A 2CRLA 2KO1A 2F8HA 1S1WB 3R8YA 4AE5A 1NDCA 4LF5F 3GIJA 2IM0A 1MU2B 2IY5B 5KFKA 2CJXB 1X5OA 4HACB 2J7WA 3DXBA 3DNCA 2DHXA 1YDLA 4KTQA 1VQ4S 4JI7J 2YKMB 3OL9A 4X4OA 3OHBA 2YPZA 5D78A 2EVZA 4NX9A 1QY7A 4Q2MA 4QWEA 1F5CA 2BJ9A 4C3KA 4NLXA 5GAEU 1AXQA 4IFYA 1R3NA 3NAIA 4AYBD 8AT1B 1NDKA 3DRYA 3K57A 3I0RB 2IDLA 3Q8UA 4ECZA 4E98A 1AUSL 2KI2A 3FEXB 2BUNA 4RW7B 1GK8A 1TK8A 4LRDA 5SUHA 4PG5A 3ZNJ1 4ID5B 1DLOA 4LF1A 3QQCD 4FZVA 2BKPA 4ATNA 3QLHB 2EW9A 2KVIA 2D7SA 3OL7A 1TFWA 2EG2A 4ZVHA 3T1HJ 4A8FA 3HFVA 1YZ6A 1R27B 4JP8A 3MR3A 1RBLA 2IIHA 2WW8A 4DUYF 2G4BA 5THWA 5FD1A 4CTAB 2DNOA 3AOAA 3K5PA 1BQNB 1F0XA 3OTBA 1S7HA 1S4EA 1B0VA 1UVLA 4DV3J 4IRKA 5HJYA 2CQ1A 1GX5A 3D3CJ 4YB7A 1MN9A 3DOKA 1N5VA 2QZ8A 3QYYA 2HFUA 4KKOB 4JI0F 1FXDA 1RT6B 2EXUA 4MK9A 2CNOB 5F8JA 4H4MB 3DHXA 1IKYB 3R2CJ 1VRUB 2RUGA 1FJEB 3NS7B 4C0BA 2HS0A 4JI5F 4DX7A 3O8WA 3T1YF 1TUVA 3T5LA 5HMWA 3V6HA 2ZM6J 2F9JA 2OI2A 5J1PA 3D2WA 2QMXA 2PEHA 1YJNS 3LWLA 2E5LJ 2E9TA 4O3OA 2KT5A 2DR8A 1DQ9A 2MKSA 5T7LB 2UUBJ 4ZVTB 2V8HA 2IA6A 3OW2R 2CPDA 3FCWA 4OFZA 2N82B 1VI7A 3HZGA 3OXGA 2O5DA 2DGTA 4ICLB 1LWEB 3TUZC 3DRPB 5F3TA 4LFAF 3D6TB 1FDAA 1NSAA 4U8VA 2BEFA 1V9OA 3GU0A 2EWHA 2EPIA 4B3RJ 3ZXWA 4JI6F 2RS8A 1DRZA 3UDLA 2VU5A 3CCWA 3MMAB 5KFUA 5A2QY 4UZBA 4MK7A 4UUWA 1FT8A 2DXEA 4CIOA 2UXBF 2IRYA 2IYIA 1IR2A 3J7AN 2RHQB 5KT6A 2XM3A 5J2QB 1YJTA 1X4GA 2Z2MA 1JKHA 3V2UC 1B4SA 3KK1A 4OI2A 4F8RA 1L3UA 1ZAXA 3I4HX 3VVTA 2RDJA 3CUNA 4RUAA 5CD4A 3D6HB 5HANA 4F4WA 3DLEB 1H2VZ 3EZ5A 2OTLS 2L48A 4ZLNA 1JLEA 5HVHA 2OPRB 3DLGB 4NLDA 2GA7A 4PG8A 2ADBA 4DR7F 3GMGA 3UCUP 2HHPA 4ZP8A 5AE1A 4K4XA 1X4HA 1DBDA 4R5PA 1WELA 2QLBB 2HFOA 4DV7J 2AX1A 5A8RB 5ETVA 2HZCA 2DH7A 2HHTA 2VPYB 1BY9A 5B0BA 2QFJA 1WC1A 5KFHA 3OXFA 5EX3A 1A0OB 4F25A 4WFZA 3FK4A 5KFEA 4OV6A 3CNQP 2FVRA 3BGRA 3RAMA 5KG5A 4ZVQB 2QSFA 4A8SA 1QD1A 3GG1A 4GKJF 3SIPB 3HVRA 4JI2J 4OHZA 4TY9A 1J2VA 2XWYA 5H9FJ 4OI4A 2UU9F 1RAIB 4FXVA 4FVCA 3RB4A 2A6MA 5B0CA 1YHQS 4PPZA 4K4UA 4CO1A 2E5JA 3TRGA 1X60A 3OFHA 1N88A 2JSXA 4BC9A 1SIZA 5CYMA 3A3OB 3OT9A 1FRLA 3MR2A 2AEFA 3RTVA 4PKDB 1S10A 2OPQA 4YOEA 2ZOGA 3TI0A 2VJUA 3CCMS 2GVDB 4X4SA 2B56A 2IVYA 2RF2A 3HHNB 2G2ZA 4F2SA 3RBXA 2V2VA 3IRXA 1KLMA 1RP5A 2A10A 3AT1B 3KLIA 1IBCB 1HWKA 3I32A 2DNMA 4ECVA 1EQMA 1W25A 3P96A 3SBMA 2DR9A 1CJUB 2OKQA 2W4CA 3IBWA 3MM9B 2XG8A 2BJ3A 1JNZB 5CYQB 3I87A 3G8TA 3HZEA 2PIIA 1N33J 1RAEB 2IFXA 2PE8A 4EK2A 2ASDA 4ILMA 1S7IA 3TAMA 5KT4A 4QYZK 4O3NA 1N6QB 1UFKA 1Q16B 3GILA 3KDOA 3CMES 4QJVA 4A47A 2EFPA 5F8LA 1HA1A 1VC5A 2IYGA 4CT8A 5L46A 3D54A 2QLWA 2HURA 3KHHA 1CEZA 5E3RA 3CCVS 4LR8A 3GCXP 3LP1A 1NDLA 4CM0A 3PW5A 3R1LA 3BYRA 1TV6B 2FHOB 5C42B 2XMKA 3JXOA 2ZBPA 4KO0B 3HX9A 1HI1A 4HDGA 2WONB 1KLNA 2HK3A 4RW9A 2WOMA 2MZ1A 2ZVSA 2J0XA 3V6JA 1YGYA 1SJ3P 1D9FA 5KFJA 4OL8A 5DG9A 2DH9A 1Q5VA 3BN7A 4RNHA 3DRXA 2MSTA 2OD6A 3LGNA 1S6UA 1GQEA 3CCRS 1RHMB 1FK9B 4USWA 2J0SD 5IQQA 2BKNA 1C0TB 1FF2A 3LP2A 3PEHA 4M94A 2E1PA 3T41A 5T41A 4QCLA 3WIVA 3NGKA 4QU6A 3T1AA 3FBEA 2NXNA 2ZC3A 3ZTPA 2KFYA 3KYLA 4Y2CA 1KS2A 5KG1A 1RSCA 1GAOA 1FERA 2XI3A 2DPIA 1EP4B 2R7QA 1GX6A 1HWJA 4DJBA 1VQSA 2XSFA 2H65B 1IKXB 4YEAA 3P4UB 1KDNA 2MZSA 2GV1A 1E6VA 4U95A 4KGXB 4CLYA 3BSAA 3J7A1 3DRRB 4NXNJ 2HWTA 3CD7A 1WHWA 5EN1A 4BWJA 3KG1A 2UVVA 3KUEA 2IMOA 3LOUA 5I3QA 4UOCA 1ZZFA 1AZSA 2Q66A 4WIQA 3TAPA 4FDFA 2OGUA 1HWLA 3GR1A 2DPJA 4L3NA 5LJ3Y 5B7WA 1GMVA 1S76D 3HHKA 2DVIA 5GAEI 3DOMB 4K4YA 4A8OA 4JV2A 3PFEA 2HYIB 4NZ0A 1HBMB 2AGQA 3MMJA 4DL2A 2CADA 1VCTA 4YB1P 2IBKA 5I42B 4GO5X 1M5KC 2MJUA 3Q8RB 3K8VA 2YQ1A 2HZVA 2A2DA 1XJWB 2HKEA 3K89A 1WJ9A 4FXWA 3H5XA 2HVDA 2QL5B 2WZ1A 5KFCA 3DGPB 1REVA 2YWKA 1NKCA 3TANA 3DLKB 4DL6A 1FDDA 4LQ9A 2ZJPQ 2VICA 4PZVA 2HBZB 2UXDF 1YJ7A 2XMJA 1S59A 4PG4A 1Y5LB 3OFFA 3T9NA 1P27B 1H38A 4ZN1A 2M70A 1WF0A 3EVMA 3JYTB 4DLEA 5C24A 2DNHA 5B09A 5J1EA 4DSKA 1PYOB 2DGUA 1WKKA 3BDEA 3CIMA 1SC3B 4HTJA 1EETB 2RNEA 4DX6A 4EFAC 2X51A 2D9PA 2GVZB 2OEJA 1RWVB 5HLFB 1RTJA 7FDRA 2V4RA 6FDRA 2OMOA 5FDLB 2C3UA 4K0KJ 4ZJQA 2DO0A 2YNGB 1OPZA 1NSPA 5IM0A 4WFNQ 2KG1A 4WE1A 3QAEA 3GFYA 3QO9A 2OJ3A 4ZLPA 2IJRA 4UQGA 2MDAA 5FLXU 4UOGA 2YKAA 4CO3A 2FJEB 4BHQA 4ETXA 1S0NA 2B4UA 3KLVA 3C6UB 1PYTA 1U1MA 2IAJA 2PT0A 2JVOA 1TKTB 1QM9A 4DR2J 1JLQA 3LWMA 1X7VA 1FJCA 5CAAA 2DCLA 1SJ1A 4LUBA 3DM2A 2CQBA 1U25A 2JOQA 2DGVA 4RWWA 1VQ5S 1JLFA 3U7JA 3N6NA 2G2OA 3M2VB 2M5YA 3G86A 4LT6A 1Y3JA 1TAQA 3BB5A 2KYXA 5ETTA 5L1KA 2ZBQA 2BJ1A 5CQGA 3H20A 2QSWA 1Y5IB 1H0HB 2F65A 4DV4F 4X64J 1HW9A 1X4BA 4DXLA 5BXIA 4I2QA 1HPZB 3D1QA 3RW6A 2J7KA 4U9RA 4C6AA 2C2MB 2ROGA 2F5GA 1C4CA 1GMWA 3MECA 1RTIA 3PJXA 1VBKA 3L3CA 4CWBA 1KQSR 3U1MA 4MYTA 3WX8A 3PYFA 1S5ZA 1Q78A 4LFCF 2HQ3A 4NLVA 2IMWP 2GAHC 2V6AA 3PXGa 3RRHA 1YITS 3CDAA 1XTZA 1FDBA 2M88A 3HFZB 2CUYA 3C14B 2DNGA 4IH6A 1S0MA 1XNQJ 5IT9Y 4DEZA 3KJQB 3R5JB 4NCAA 4YY3F 2EEYA 2VDHA 1S57A 1RZMA 1KC8T 5H1SV 2HZAA 4P75A 1NK9A 1LV5A 2ZOFA 3I4PA 1N8RT 3UPFA 4NCGB 4F2RA 2XZDB 2GAGC 1RWKB 3B78A 2YPYA 2IM1A 3AD9C 3THTA 5J2NA 2V68A 4Y34A 1HKAA 2FD2A 2RRNA 2HBRB 4LF5J 3ONQA 4DQSA 3TOQA 4DF4A 3M30B 1U49A 3W60A 4ZPVR 3AXKA 3MMCA 5AE3A 1V3RA 5IXUA 2CJBA 3EZOA 4ZVPB 1QSYA 2A2CA 4G1QB 4B9TA 4FN5A 4WP8A 2DYAA 5HQ8A 5L1JA 2NPFA 3KLHA 1RUSA 4CLWA 2GS8A 2RD5C 3E51A 4L74A 4RNFA 3GV5B 2W1BA 2K2PA 2VFRA 4RNMA 4MIAA 2J5AA 1VGYA 4J9KA 9ATCB 1X5PA 2XTJP 4K5SA 3AAWB 4KFBA 2OP5A 3IWNC 2JWNA 2QMWA 3ENQA 2JLFA 3NWGA 4F36A 2RILA 3FSYA 1NK0A 3DKDA 3U27A 4DUYJ 2G2YA 4USHA 1WOPA 2CVIA 3I56S 2QE5A 4DS4A 2JEGA 1NDPA 3N6LA 1B7FA 2MJNA 5ETSA 2M4MA 1MN7A 2XMAA 2WAQD 5ETKA 5C7PA 2K1RA 4ZP6A 4R8UB 3EPIA 2AMCB 3IM8A 5D4NA 3NNCA 2WSFC 1P9YA 4LREA 1FRMA 3TP2A 4EMDA 2BE7D 2W25A 1X8DA 1FFGB 1ELOA 1U7LA 2HFVA 1VIXA 2DNKA 4IQXA 2OLWA 4JI5J 3T1YJ 2KU7A 1RAFB 2FLOA 7FD1A 3NG8A 3JQJA 5LXYA 1U26A 1UL3A 2V4JB 3H25A 4DG1A 1WEZA 2MPUA 1U6FA 5K8PA 2CQ3A 3QWPA 4MKYA 1RDRA 5DQGA 4NL5A 1NK8A 2AWZA 4QIWD 4EGLA 1IJEB 3DHWC 2EC0A 5DJBA 3MAHA 4WTYA 3HVTA 3G96A 4U7UK 3G8QA 4OYXA 3DRSB 1PIEA 3EJMA 2LFVA 2FLNA 4W98A 3US5A 2X1FA 1ROFA 4LFAJ 3KJNB 4LRAA 2Y8WA 1YWXA 1EKSA 3R6LB 1URNA 2DNQA 3BF4A 1IXKA 5HVFA 4ZP7A 3K2YA 1H73A 4X4QA 3DYAA 2OD4A 4JI6J 1U0HA 4MH8A 3IR7B 3FQKA 1QSSA 2DGWA 3D68A 4RR5A 1Q81T 1CLFA 1S9GB 3IXQA 3H5SA 2VD3A 2QGFB 4CT9A 4ELTA 3J80U 2ZEJA 1RLDA 2GC8A 1C1BA 2RDDA 1SKWA 2DCUB 2B5JA 2CPXA 4ECYA 4CZCA 1SKUB 1YX2A 4TNOA 3TZYA 2DR7A 4FF1A 4P7VA 1HLWA 2ZNZA 2A1BA 5IT4A 3V6DB 2E66A 1VYAA 3PNIA 1WEYA 4ANDA 3IWLA 1Z4UA 4TN2A 3HSGA 3GFZA 2FC8A 4RBUA 4YB5A 1UPPA 1S6QB 2H5JB 4GVLA 4BDPA 2QLJB 4ECTA 4DL5A 2VG5A 1S1XA 1E6YA 2XMTA 3DGVA 4DFPA 1DAXA 4I68A 3EDQB 1FEHA 2YH0A 3HLUA 4DR7J 3R97A 2JVRA 3D0IE 3I55S 4G65A 3HK2A 1RA6A 2LA6A 3BQ0A 3C6TB 4LF9F 2JEIA 2DRBA 3FEZA 3HCXA 2DBBA 1LWCA 5KT3A 2FZKB 4P72A 4B3OA 1YJVA 3OUYA 1SJRA 2ZWOA 3QT7A 4OHWA 3OXLA 1KONA 2LDIA 3DI6A 2C2DA 1TUGB 2XEXA 2DIUA 1TL3A 1VC0A 3QFHA 4M5DA 2AYEA 2BE2B 4GKJJ 2CFXA 4H4OB 2Z2ZA 1HFEL 3QIPA 3CC2S 1PBAA 4DQPA 1FX4A 2R8IA 1IKVB 2C42A 4C8OA 1SJQA 2VBYA 4WWSA 3SQOP 1ZM2A 4AD6A 1UVMA 3PVXA 5J1NA 3POTA 3I96A 5IT0A 4WF9Q 4RUHA 4OX6A 2CQPA 3MMBB 3PYEA 1ZTWA 1HNXJ 1F2HA 4TYBA 2NS1B 2YWHA 1S0VA 3TWZA 3BEGB 1RISA 2HS4A 1K8AT 4DV5F 1KLMB 3MCSA 2MSSA 1NJZA 3P45B 3PKYA 1UJ6A 2AW0A 4ZPWR 3UE2A 3BSOA 2XMMA 2AD9A 1HMVB 4RUCA 4NLPA 1JXLA 2FVCA 2HQCA 3M8QB 2JLGA 3UR3C 2CJ9A 2EKYA 1JIHA 1F3FA 2KG0A 4MAKA 1FWLA 2KXFA 3T5HA 3OTOF 3TA1A 4EI2A 1UWBB 2GQCA 4ECWA 1BMQB 3TAMB 4QWCA 1RT2B 1WSVA 3ET6A 1IQTA 2XQCA 4MJKA 1ICEB 3CSKA 5A0YB 4LF7F 2VBXA 3QT6A 4DR4F 4PQUA 2QG9B 3H4DA 3QJLA 2WVDA 2ZH7A 4X65F 2G0JA 2ZD1A 5KFLA 3SQGA 1FXRA 1YKWA 4DZDA 3DLLQ 1XR6A 4ECXA 4ZCKA 3SXLA 1FE0A 1HBUA 4IG0B 4KHPF 3DFEA 1VRQC 2POKA 5KG4A 2APOA 3B8HA 4OI1A 4OQJA 1BQXA 3H5UA 2BRLA 4HTIA 4AUKA 3CJ4A 1QVFR 2LQBA 2FZCB 2H51B 1XR5A 4PXCA 2EFGA 4OZLA 1TK5A 4YDDB 1IM6A 3MDFA 2X1AA 3Q83A 2RQ4A 1FKOB 2EC2A 1U1OA 2VKRA 3FRZA 2C3MA 3SDEA 2Q6BA 3JS9A 1VDHA 5LMUF 3IO1A 4IR9A 8RUCA 1KHWA 4ECSA 4QW9A 3LAMA 3QT8A 3W2WA 3IGNA 1S1WA 4I67A 4JYAF 2YQ0A 1K1SA 1MU2A 2OEKA 3BN4A 3QMQA 4JI7F 4HACA 2LQJA 4LVNP 2GMHA 2YKMA 4ZN3A 3OLAA 1N36F 4RL1A 3W5ZA 5F41A 4C4WA 2BX6A 2CIMA 3HM9A 4CM2A 5F8MA 3J80Y 4OYMA 3R9LA 1RU2A 3OHAA 2I1RA 2V0NA 2X7IA 1KOHA 3R5CA 2VV5A 4C3LA 3NCQA 5K14B 1QTNB 1QE1A 1U2CA 3I0RA 2V8GA 3KOAA 4DZ6A 3VAMA 2R2SA 2UUTA 2WVBA 2DHGA 4RW7A 2W9BB 3LALA 5LT5A 3PRBA 1NU4A 3MUMP 1HL6A 2X1GA 5H9FK 4ID5A 3I5BA 3HJVA 3L95X 2AHOB 2ABYA 3QLHA 4C0HA 3PX4A 3T1HF 3NOCA 2QA2A 5D6GA 3UO0A 2LYVA 3CJTA 5MAOA 3MOZA 4CTAA 3BSNA 4OZ2A 1BQNA 2XO7A 1N48A 1TL1B 1VBXA 1WC0A 3A8EA 3V4IB 3H2LA 1W2IA 4F67A 2R7XA 3MR6A 4KKOA 3HMJG 2FHJD 3AA8A 3KHGA 1RT6A 1UEUA 2Z56B 5DDRC 3T5KA 1JB0C 3N5FA 2PDAA 1TKDA 3P6YC 4PWDB 3PZPA 1GTHA 2HHSA 1NJWA 2ATLA 1IR1A 2QN6B 4QWAA 4WTOB 1Q7YT 1LK7A 2I5JB 2J76E 1N32F 2PGCA 2ZM6F 2BYCA 3MEGB 4QIGA 3H4BA 4F3MA 4USTA 5D15A 2E5LF 2J7UA 4OYAA 4F4YA 2UXDJ 4NLUA 3CT9A 2OFGX 2D1CA 1Q79A 2KXHA 2GCFA 4YS2A 5GAHI 4C8KA 1SC1B 1FTRA 1LEOA 1S12A 4QIFA 2VPXB 4J9UE 2AKWB 4U67Q 1BC6A 1SH0A 4ICLA 5J2PB 1LWEA 2J9CA 4CO5A 3W9IA 3KNAA 3DC2A 3MFIA 3D1OA 2CAJA 2CG8A 4IFVA 3PHEA 5IQ6A 2DNZA 3SV3A 4NMLA 1WI8A 3AXMA 3R27A 2J6SA 2M2BA 3MMAA 3R5DA 4LR7A 4WE1B 5HAOA 1T0TV 1Y3KA 2FHMA 1Z2ZA 1SC4B 1OPIA 1HHSA 2XLJA 4O3QA 4N41A 3PM9A 4QPXA 2CYYA 5DZ6A 1TFYA 2E1AA 4DHVA 1PKUA 4TQRA 5HROB 2OSRA 2HQIA 2Q1LA 3PJWA 1HNWF 1Q8KA 4O4GB 2F40A 2BBEA 1NO8A 5F8HA 4RWXA 3KUGA 2BW7A 2V5HG 1XERA 3DM2B 2LXIA 2MQMA 1K0VA 1WUUA 3DLEA 1JLBA 2AEMA 2K8GA 4KBIA 5D3GA 4XPEA 5JVHQ 3CJ0A 2FJDB 2OPRA 2DD8S 3UD3P 3EVWA 4ECUA 4KGZB 1TQLA 5ETNA 1RTHB 2YH1A 4HR2A 2N4CA 5F0UA 3AQPA 4E8UA 5A8RA 1NKBA 2AZ3A 4MIWA 2J9DA 2EK6A 4FS1A 3CCES 2R8HA 4PAAA 3MCNA 4DV4J 3CCTA 4CRJA 5DM7Q 3BKTA 2DK2A 1NPRA 4CDIA 1NPKA 2LA4A 2W9AA 3PW4A 3MHYA 3B4DA 4JI2F 5KT5A 5EGYA 1RTIB 2PEBA 3TW0A 3CJRA 1ZH5A 4NEZA 1CULB 3CD6S 2DXDA 2GHVC 1OQ6A 1RB0A 2DNNA 3JSRA 2W9CB 2D69A 4ZVOB 2HMIB 3PO4A 4EEYA 5ADZA 2BZ2A 3BZQA 3ISZA 4X84A 4P7TA 5AXLA 3A8KA 2CPZA 4LIWA 2AJQA 2HHHF 2FJBB 4USIA 2GVDA 3NMRA 4X66F 1TL7B 3OR1B 4YY3J 2HIQA 5HMYA 2VQEF 1B64A 3UW1A 1S1UB 2RT3A 3CDBA 1W2BR 2G1DA 3JSYA 4JV5J 2CKWA 2QA4G 1NZAA 5DGAA 1C0UB 4WP3A 4OYZA 4Y2AA 1LXJA 2J9EA 4LFBJ 3C16A 3MM9A 2MQQA 3IR6B 5J2NB 1KOOA 5CYQA 3THVA 5K5MA 4F50A 4PWWA 4BCAA 1N33F 3RR7A 5IC6B 3SYZA 4OJHA 4LF6J 2H9ZA 4ZLJA 1KWMA 4MIBA 4C48A 3O2IA 3KJVA 3MMCB 1R6VA 2HFNA 3N6MA 2V8PA 3NGSA 5CCLA 1FDNA 3LO3A 1HBNB 2M52A 5HI7A 5KFQA 1N6QA 1MWQA 3VQTA 2E5IA 1UJ4A 2JDJA 5E3PA 2F8EX 2Z2YB 3UNYA 4IOBA 4KC5A 4QW8A 4QBUA 4RZRA 2PMZD 2H4WB 3AQOA 5KG3A 2WVCA 2F3JA 5KOWA 1HHQA 3QJPA 4RKUC 2VIHA 1TV6A 3KNGA 4YR2A 2F4FA 1JK9B 4Y2MA 5C42A 5EWEA 1D9DA 1U47A 4ZVFA 2HLUA 3TEGA 4KJIA 1NLKL 3GE9A 4I6YA 3SZ2A 5K20B 3ZZRA 1KBRA 1KQGB 4B08A 3A8JA 3W63A 2R2RA 4WFYA 4ILRA 4X4VA 2XCAA 1FJGF 5M2UA 5HVGA 2LU1A 1R6YA 4DPYA 3ZZZA 2RJZA 1RTDB 3AB2B 1SXLA 1FK9A 1SKSA 1RWNB 1C0TA 3R7NB 3AOCA 4N8NA 4WKYA 3M6UA 3BYPA 3CJSA 1I94F 2ZFHA 2MHNA 2VHGA 2NXCA 2KL8A 1R8HA 4Y2IA 1RK8A 4XDCA 1K9MT 3CCLS 1TMJA 1LKZA 1EP4A 4LR9A 3R7BB 2RSQA 4BC7A 3QFWA 2DNRA 1IKXA 1CJKB 4TKTA 5E3QA 4B9VA 4M5IA 2PA8D 3UN2A 2J0QD 4NXNF 1FJ7A 1D3WA 5HQLA 3QGGA 3DRRA 3GV8B 5MLCV 4X4RA 3VALA 2W7OA 3L09A 3P49B 3M8PB 3KMQA 4CNZA 1B0PA 4RNNA 2FHJA 3HSDA 2ZHAA 1DHMA
chains in the Genus database with same CATH topology
4YB1P 2KFZA 1MMLA 3PX6A 1IKYA 4KAIA 1VRUA 2OO4A 5I42B 2IBKA 4GO5X 4OJ3A 2MGZB 1M5KC 1Q7LB 2W8KA 1F5AA 1OSDA 2MJUA 3FNNA 3Q8RB 3K8VA 2FPHX 4NLYA 5C5JA 1REVB 3BGLA 2XLKA 2BRKA 1GH8A 4OHXA 3TQ1A 2A2DA 3KMSA 2UVUA 2JHEA 2JFKA 1WD6A 3DOMA 3HT3A 1N54B 4IO1A 3W2VB 2XZWA 4FBTA 2DITA 3M8PA 2ZHBA 3MM8B 2EFQA 5EWGA 1IQZA 4YR3A 1FNOA 4ELVA 2W4DA 5KFNA 2KXNB 2OTJS 2M7SA 4DN0A 1HBMA 4EO6A 4FXWA 2RU9A 3H5XA 3FDSA 3KLGA 3S1TA 1C1BB 4Y6IA 2JL9A 3T6BA 3N0VA 4N8OA 2UUBF 1SH3A 3MM5B 2EFOA 2VFTA 1RT5B 2DGSA 2Q3PA 1TVRB 4WFAQ 5I42A 1X4CA 4QYZJ 5KFCA 3I5AA 5T7LA 4ED0A 1REVA 1ZPVA 2LVWA 3AHPA 2YWKA 3M4XA 4JV0A 1NKCA 3TANA 5C24B 3VWSA 2MYFA 2BM0A 2PSZA 5A8WB 3IC1A 3DLKB 2MZQA 5KFWA 4DL6A 2HHXA 1QLNA 1FDDA 2RE1A 5J1EB 4QWBA 2ZKTA 2Z2LA 2KT2A 3BSCA 4I56A 4LQ9A 2ZJPQ 4ECRA 3W2VA 4RW6B 1WF2A 2NZ4A 2C3PA 2ZOMA 2PO4A 3ENWA 3F56A 3HHLB 2UXDF 2QT7A 2RQKA 2XMJA 3KK3B 2VUGA 2GW8A 1IUJA 1DTQB 3DRPA 4O44B 3IRWP 1X4AA 1SH2A 4WK3A 2JC1A 4R0JA 1H98A 4PG4A 1CSJA 2AQ4A 3J7ZT 3MUVP 2AF6A 1QAJA 1Y5LB 3OFFA 1JJHA 5IZHA 3T9NA 1TVRA 1P27B 1M5SA 5E3AA 3EXCX 1CQNA 1RTJB 2W24A 2CJKA 2R2UA 3WDOA 3CC7S 3DGPA 1QAIA 4B3RF 2DISA 4N77A 1H38A 5HL7Q 2M70A 1WF0A 2VG5B 3H2VE 4KQZA 3JYTB 1IBLF 3HHLD 2FGOA 4DLEA 2DGQA 5C24A 1F9FA 2DNHA 3M32B 2DHSA 5A8WA 3DLKA 2B4VA 2E9ZA 1TZ0A 2R7VA 2P9EA 5B09A 5J1EA 4V19J 5L38A 4DSKA 3BQ1A 3WZ0A 4ZS6A 5IM0B 4DSFA 2DGUA 1NHVA 3BDEA 4RW6A 1N34F 3CIMA 4LSLB 1HD1A 3HHLA 3MUTP 2QLXA 5LJ5Y 4NRUA 2CPFA 4HTJA 5DETA 2HHUA 1VQ8S 2CQ2A 3QO9B 5CYJA 3TVKA 1DTQA 3AJ1A 4O44A 1VQ6S 2YY3A 1EETB 4ZA1A 2RNEA 2ZZMA 3GFHA 4EFAC 2KJWA 2NSCA 2X51A 5AXNA 2D9PA 2R4FA 3BQ2A 2MY8A 4TU7A 2OFHX 4F4KA 5HLFB 2QIFA 1RTJA 2VL1A 7FDRA 2V4RA 3R1HA 2RRAA 6FDRA 2OMOA 3MD1A 4WCEQ 1X5SA 5FDLB 3H2UB 2C3UA 1J5OB 4B9NA 3JYTA 4UUXA 1Q86T 4MMOA 2DO0A 3M32A 3CEDA 2O1PA 3MF5A 5A8KA 2IAJB 2IJNA 2YNGB 5EWFA 1SL1A 5L9NA 2NXUA 2NSBA 1OPZA 1TK0A 5IM0A 1VOMA 5J2QA 1SUQB 2VKZG 2F8MA 4EWTA 4WFNQ 2KG1A 4WE1A 4LSLA 4IOCQ 3C66A 3QAEA 3B82A 1JLQB 5LXRA 1Z2LA 3GFYA 3U1LA 3QO9A 4XK8C 3UR0A 2WBMA 2M9KA 4ZLPA 3EPGA 1U1PA 2OJ3A 4UQGA 2RB7A 1GNKA 2MDAA 3LP0A 2V4QA 2VASA 4Q44A 1EETA 1IN0A 2EI5A 2YKAA 2DO4A 2B6AA 2DR5A 3OR2B 1P1LA 3QWUA 1Q8LA 2R7OA 4MTPA 2DGXA 4CO3A 2FJEB 4BHQA 4H4KA 5HLFA 1O0PA 4KB7A 4ETXA 1UP1A 2HNZA 4IG3B 5KT7A 4DUZF 1S0NA 5FDLA 2B4UA 3DU5A 2X3GA 3U1NA 4NLRA 3KLVA 3C6UB 2JEFA 1U1MA 2IAJA 1JLFB 2YNGA 4ZHRB 2PT0A 3LUYA 2MB0B 1WWHA 1TKTB 1UFWA 2AJ1A 2JVOA 1QM9A 1SUQA 4AFFA 1ZZNA 2PI5A 2N7CA 2LQ5A 3DLGA 3ZFVA 3HXMA 1JLQA 4R0EA 3SFGA 3Q2SC 1C4AA 2WSCC 1RQ0A 4DR5F 3LWMA 2MZJA 3BS9A 2KDOA 3VZHA 4DV7F 3QPIA 2I8EA 5HN0A 1NK4A 1T94A 4B9MA 1DURA 1X7VA 1N5SA 1B0TA 1FJCA 1O5JA 1SJ1A 2DCLA 3FRYA 4LUBA 1RI7A 3LH2S 4MK8A 3KFWX 3HP6A 4HL9A 2JC0A 3N5BA 1L3TA 3DM2A 2CQDA 2CQBA 1U25A 2Z0GA 3UDCA 4IG3A 1WHYA 3SI8A 2J6UA 2JOQA 4DSJA 4G3IA 1FD2A 4WU3A 3CJ2A 2DGVA 2N4DA 4ZPDA 4QIVA 3B4MA 4RWWA 1VQ5S 1G1XA 4J9OA 3C6UA 4DR2F 1URRA 4ZPCA 1JLFA 3U7JA 4ZHRA 2W8LA 3N6NA 2Y0SD 4W90B 4G1IA 1TKTA 3M2VB 2M5YA 1PILA 2XSJB 3G86A 2OMLA 4KHRA 4LT6A 1VMBA 3MOJB 1XWLA 2XNQA 4I2QB 1Y3JA 4JI8F 4A4JA 3CMAS 1U48A 1TAQA 3BB5A 2KYXA 1QAYA 1LK5A 2KT3A 4XDDA 1S72S 2KZMA 2BA9A 3TO8A 3Q8QB 4R25A 2YVSA 2B9YA 5L1KA 3MZIA 5BR8F 2UUAF 1MWZA 1G3OA 4RU2A 5LSRA 3ITHB 3MECB 5CQGA 3H20A 1XBWA 3CIZA 1GT8A 2HHQA 2L08A 1IJFB 1YI2S 2QSWA 2LU2A 4O23A 2UVRA 1Y5IB 3PW7A 4O0IA 5CA5A 1T3NA 1H0HB 5I4MA 3NLCA 3M2VA 3P5TL 4DV4F 5C25A 1U6BA 3GV7B 4EO8A 3PEJA 4WFBQ 4QR0A 3Q23A 1HW9A 1X4BA 1ZOTA 4EYIB 4G1PA 3MWBA 4I2QA 5LSLA 1HPZB 1R0AB 2C3OA 3D1QA 3DXSX 3RW6A 2MY7A 5KG7A 2LKZA 1FXLA 2J7KA 4HKQA 2AP6A 4C0OC 1UAWA 5DDOC 1XK8A 4U9RA 4WU2A 1LOUA 4TLRA 4AL6A 3HI9A 2ROGA 1NRKA 1C4CA 4NWBA 2ZH8A 3UWTA 3ITHA 1RT7B 3MECA 5CCMA 5KFRA 3MPYA 2ZC4A 1NJYA 1RTIA 1ZETA 3PJXA 2VOPA 3J7YU 3L3CA 2MQPA 1KQSR 2ZBCA 4X64F 2CQ0A 3CWJA 1P1TA 3U1MA 4Y65A 4MYTA 4QPTA 3OTEA 4LVOP 2R7RA 2CJQA 2N3LA 5KOXA 2VC1A 3M2UB 4WFXA 4DR3F 2XGQA 1HPZA 4ZPAA 5E3CA 1R0AA 1Q78A 4LFCF 3KWMA 1HBOB 1JLAA 2ERRA 2HQ3A 4DL4A 2RKIB 1WHVA 4C8MA 4NLVA 2PI4A 4WYWA 2IMWP 2YNIB 2KKHA 4OHVA 3PXGa 1X5TA 1HI0P 4OI6A 3RRHA 1T7PA 2WCXA 5GAGI 1YITS 1RT7A 3CDAA 2BW2A 3K59A 1XTZA 1FDBA 2M88A 1LFPA 4K4SA 5KFVA 1WTFA 2M3DA 4PXEA 3KLFB 2DNGA 1RKIA 2IC3B 1FVQA 4IH6A 5ITHA 5B0DA 1S0MA 2XWXA 2WBRA 1NH8A 1Q82T 5IT9Y 1L3SA 3IG1B 4DEZA 1HQEB 5KFFA 4NOHA 4Q2LA 5K9FA 2MKJA 1RT4A 5FIIA 1RYSA 1SQEA 3M2UA 3PR4A 4NCAA 4YY3F 4K4VA 5KFXA 4HDHA 2BABA 5JVGQ 1C1CB 1HBOA 1JJ4A 2J8AA 4U6PA 1VQMS 5EUHA 3EZUA 5E41A 2ZKUA 3TNVA 4ED8A 1KC8T 1CC8A 3D28A 5H1SV 2VA2A 1UFLA 4K5RA 1T3OA 4V19X 1YG0A 1NK9A 3GYNA 2LECA 3NRBA 2YKNB 4D3GA 2A3JA 4RU9A 2O01C 3O3LA 2HGLA 1LV5A 2ZOFA 1N56A 3I4PA 3H59A 1N0UA 1R31A 2PN6A 2KRBA 3KLFA 1N8RT 1M5OC 3SSRA 4PQAA 4WIIA 3UPFA 4NCGB 3G9CA 1S6OA 1VQNS 1X9MA 4F2RA 3D5MA 4JV1A 4C98A 4PUOB 3MR5A 4Q8FA 1OS5A 4IDKB 1HQEA 3C8YA 1GXLA 2HNDA 2HLTA 2OPPB 3I5CA 3IR5B 2R7WA 2MZRA 3DCAA 3PX0A 3I6PA 1CVJA 3NNHA 2F7VA 3B78A 1C1CA 2DH8A 2YX1A 5BYQA 3CD0A 4OJ1A 5D4OA 4IUFA 4ED3A 2IM1A 1OO0B 1FO1A 1PC5A 4HEA9 5HMZA 3J81Y 2ZH9A 3GR0A 3THTA 1VJWA 5J2NA 5B0AA 1YRXA 3K7RA 4Y34A 2YKNA 5KAKA 1TP7A 4DBQA 2AYBA 2FD2A 2RRNA 2HRUA 4OHYA 3ONQA 4DQSA 4NCGA 3TOQA 4F26A 4DF4A 3EX7B 3SSSA 3AH6A 4PUOA 3KLHB 4ES3A 2RMLA 3M30B 4IDKA 1S1VB 1VFJA 1U49A 5F8NA 2BR0A 3OVAA 1APSA 1YRUA 4ZPVR 2DNLA 3MMCA 3KLEB 5AE3A 1V3RA 3LANA 5IXUA 2CJBA 3S7RA 2FLLA 2B9WA 4K4TA 1T05B 1SC6A 4YHHF 3W2WB 3VAHA 2Q6CA 4FF3A 1QSYA 4BBYA 1FD8A 2A2CA 4Y0FA 4G1QB 2ILYA 4F3OA 2ALZA 4B9TA 5E7OB 1IBMF 3MPWA 1U2RA 1X0PA 5DGBA 2FJWA 4FN5A 5B0FA 3D0GE 1YJWS 4B9LA 4NA2A 5DS7A 5M2PA 2FY1A 1Y7PA 5HQ8A 2HGMA 4KO0A 5L1JA 2NPFA 3KLHA 3CTRA 2XHWA 3HDSA 3M30A 4DX8H 2YWEA 4MYUA 2G0CA 4NLQA 1Q8BA 2BANB 2E9RX 2WONA 1WF1A 2KM8C 3KLEA 3HVAA 4KFBB 2NLWA 4E0DA 2RD5C 3E51A 1VQ9S 1VK3A 1KTVA 2ACYA 1MROB 4JI3F 1T05A 4LSNB 3M9MB 4RNFA 5F8IA 5GADI 3GV5B 2HFZA 4G1QA 1JX4A 3VR1A 2K2PA 1VQKS 1YQHA 1CG2A 2DJWA 1R89A 1IBKF 2VFRA 4RNMA 4MIAA 4DFJA 3KG4A 4N76A 1HWIA 3FSXA 5KFOA 4I2PA 3OBIA 2J5AA 2NQPA 4N5SA 3CJ3A 3MI7X 1JNRB 1VGYA 3BO2A 1QE1B 1Z1ZA 4J9KA 2FLPA 3UFCX 4DV0F 2QA1A 2HHVA 1X5PA 1TR0A 2ROPA 4P2SA 3G71S 3CPWR 2BANA 4K5SA 3AAWB 5B0EA 4KFBA 3IAM9 4J9QA 2OP5A 3QAUA 1AUDA 3IWNC 2JWNA 1P9QC 2QMWA 1S9FA 2WHOA 4LSNA 3ENQA 1FE4A 1UVNA 2EBGA 4P6QA 1DJ0A 2JLFA 1YTYA 2K1RB 3SCKE 3NWGA 2RILA 3FSYA 4H54A 1NK0A 2KZZA 5CHCB 3S01A 1S79A 1BGXT 3U27A 4KV8B 4RX6A 3PY8A 4U7CA 4PXBA 4URSA 3O1LA 1KQFB 4ZVGA 1U4BA 4USHA 4NLOA 4CNYA 1S77D 3NKYA 1KEKA 2CVIA 3I56S 2ZH1A 2QE5A 4DS4A 2JEGA 4NPOA 3F44A 2Q79A 2I9SA 3R5AA 5IWAF 4DFMA 3HO1A 4URQU 3CDEA 1S49A 2GO9A 3KKFA 5EX0A 3NCRA 3I31A 3N6LA 1B7FA 2MJNA 2COLA 2M4MA 3BO3A 2XS5A 2ZH3A 3MFHA 5IS2A 2VFUA 2NPIA 2WAQD 3CJKB 4ILLA 2HVIA 1X4DA 2R8GA 4I6AA 3K5OA 4OIXA 2CQGA 2AYGA 1D1UA 1ZM9A 3O6QA 2K1RA 1LQ9A 4LJMA 4ZP6A 4R8UB 3EPIA 1U8SA 3M9NB 2GMLA 2IRXA 3EUNA 4DG1B 4Q0BA 2CPIA 4KV8A 4RW4B 2WSFC 5D4NA 3NNCA 2G13A 4J9SA 1SL2A 1RT3B 3FEYB 1SKRA 4B9UA 2ZE2B 1FRMA 3TP2A 5DLFA 4FF4A 2W25A 3HJFA 1PSDA 4ED5A 1X8DA 1ELOA 1U7LA 3X1LB 1VIXA 2DNKA 2E7XA 4D3HA 4IQXA 1JLCB 2OLWA 1TL4A 3RB0A 2VZ9A 4WXOA 2KU7A 4Z2XA 1SL0A 4NA1A 2FLOA 2CQCA 1UJ5A 1T95A 2JLEA 7FD1A 1D8YA 2I2YA 2R8KA 3NG8A 4DQQA 2J0WA 4DL3A 1HNZF 4UY85 1TKZB 2L9WA 2LXFA 3HVTB 5LXYA 1U26A 4M95A 1UL3A 4R8UA 2HVZA 1DZ5A 2BV3A 2V4JB 4KR0B 3H25A 4DG1A 2VBWA 2MHEA 2GQ2A 1WEZA 2MPUA 1U6FA 1RT3A 5K8PA 3W3SA 2ZE2A 3GB0A 2CQ3A 3QWPA 4AXJA 4MKYA 4O3RA 2D3OR 1RDRA 5DQGA 1H6KX 4NL5A 1DQAA 4JBCA 3Q22A 4LF4F 4MFBB 5E0OA 3ULHA 2EBEA 2KH9A 1NK8A 4CCHA 2AWZA 5DRKA 1RKJA 1MSWD 2U1AA 3NCPA 4QIWD 1JLCA 5CZXA 4EGLA 5F9LA 4TU9A 5FJ4A 1IJEB 4DS5A 1IKWA 3DHWC 3EXYA 2EC0A 3E8OA 2BOPA 1A9NB 5DJBA 1RWUA 4FYDA 3DMJB 5KG0A 1JMTA 3D1HA 1TAUA 3JTNA 3BJYA 2AX0A 3DYAB 3MAHA 1UETA 4WTYA 1TKZA 3HVTA 3O5TB 3G96A 4O3PA 2KRRA 4U7UK 1NJXA 3ZZYA 3G8QA 4GO7X 2V4JA 3DRSB 3PACA 3RBEA 1K1QA 3QJJA 1V6HA 4N47A 2IVMA 2MKKA 4WJBA 2JZ5A 4A8KA