1O51A

Crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
89
Chain Sequence
HHMKLLKIYLGEKDKHSGKPLFEYLVKRAYELGMKGVTVYRGIMGFGHPDLPIVLEIVDEEERINLFLKEIDNIDFDGLVFTADVNVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TM0021
publication title Crystal structure of a putative PII-like signaling protein (TM0021) from Thermotoga maritima at 2.5 A resolution
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Signaling protein
total genus 19
structure length 89
sequence length 102
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02641 DUF190 Uncharacterized ACR, COG1993
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1o51A00
4OZNA 1O5JA 4IYQA 3AA9A 5DRKA 3BZQA 3MHYA 1V3SA 4RWXA 4C3KA 3NCRA 4CO5A 4RLEA 3LF0A 2V5HG 2XZWA 3OPKA 2EG1A 2PIIA 2O66A 4C3MA 3TA1A 1P1LA 5D4PA 4OZLA 5DS7A 2J9DA 1HWUA 4CO0A 1H3DA 4CO3A 1NH8A 4RX6A 2GW8A 4C3LA 1XK8A 4ZK7M 4NYOA 3AA8A 2ZFHA 4USJC 4OZJA 4CO1A 1UFLA 4YB6A 1V9OA 1V3RA 2CZ4A 3DFEA 2RD5C 2XULA 1PILA 1UKUA 1O51A 3O5TB 5D4LA 1KR4A 5D4NA 1GNKA 3TA0A 2O67A 4Y6IA 2J9EA 1UMJA 4D3HA 1NH7A 2NUHA 2XBPA 2GX8A 4D3GA 1NAQA 1NZAA 4AFFA 4YB7A 3N5BA 1Q1KA 2ZOMA 4WK3A 2JJ4D 4CNZA 3T9ZA 4USHA 5L9NA 4WK1A 4USIA 2NUUG 2EG2A 4R25A 2VD3A 3HLUA 4YB5A 3NCPA 1V6HA 3O8WA 2DCLA 4CNYA 3CE8A 1VHFA 2J9CA 1VFJA 2E66A 5D4OA 3L7PA 4Y65A 1OSCA 4E98A 3M05A 3X3UA 2GNKA 4NYPA 4CO4A 2Z0GA 4RWWA 2NS1B 3TA2A 1UL3A 3AH6A 3AHPA 2J9DE 1QY7A 1J2VA 3NCQA 4CO2A 3GSDA 2XG8A
chains in the Genus database with same CATH superfamily
4ZP9A 2MLZA 2CDQA 4F04B 1DAXA 4DR5F 5DM6Q 2VUGA 4G6VB 2PA8D 4CO3A 2K3IA 2FZGB 1O8BA 3MM9A 5K8PA 4F0KA 4B3RF 4C9DA 2FTRA 4F67A 2GCFA 1KLNA 2HHQA 4NXNF 4O23A 1LNQA 1VBKA 5M2PA 1T95A 3TUPA 3LAMA 3EM1A 3TW0A 3HVTA 4MKVA 1DJ0A 4LUBA 2V4JB 5KG4A 2O3DA 4ECRA 1D9DA 3LH2S 1CJKB 4F36A 3U02A 2V68A 3GV8B 2BKNA 1FCAA 5IZHA 5J2QA 2HQIA 4L75A 4DN9A 2MHNA 2KFZA 1RWVB 3D6TB 4LRCA 2DR7A 4USMA 2UUTA 2UXCF 3KLVA 4C48A 3CJKA 2BJ9A 4N47A 1UWBB 4LF2A 2B5JA 3KLHB 2XY6A 2V8PA 4FNHA 4B3RJ 1WEYA 4W92B 3JSRA 2DNGA 2R4FA 2EI5A 4NXNJ 1VQ4S 2QGFB 2AJ1A 3PJXA 1REVB 2D41A 4X66J 4OIXA 2G0JA 2BKOA 4DR2F 4WKYA 1UVMA 3HFZB 3PRVA 5ADZA 2HYIB 2YQ3A 3KK2A 4YB6A 2MZQA 3MZIA 4WP9A 4DL2A 2VJUA 2I6WA 4I6AA 1QAJA 1I94F 4B3TJ 4A4JA 4M95A 1XNQF 2R8IA 3HD2A 2Q43A 4UOCA 3DM2B 1EHWA 2OPQA 1P8GA 4OLPA 1NK5A 4CNYA 4B3OB 4DPOA 1FJGF 1IBKF 3QZ8A 2FJWA 1U1MA 3POTA 3HMJG 2DD8S 4DUYF 5D3GA 2H1YA 5C24A 1VQ8S 1SJFA 3NS6A 1GMVA 3AOBA 4EO6A 3UN5A 4MK9A 4QQBA 2I2YA 4M63A 2ILZA 3SV3A 4NLGA 2PFDA 5CH7B 1GX6A 3THTA 4JI6J 3NG8A 2DY9A 3OL6A 5ETMA 5BJRA 4AYBD 1FXRA 4PZVA 2OPPB 3M2UB 4ED7A 2M88A 2W8LA 4LT6A 1BQNB 3THPA 2FJVA 2PDAA 3CW2C 4DQRA 4OX9F 5F9NA 4ZOSA 2CQ3A 1ZM3A 1C4AA 2KZMA 2R7SA 3KLFB 3ZNUA 2HRUA 1WI8A 2KFNA 4O3RA 4F25A 3N0VA 5E33A 4DUYJ 5FLXY 2B7CB 1HNZJ 1HBOA 4B9UA 4C8MA 5B0BA 1NKEA 3DU6A 1JLEA 2C2RA 3OLAA 4L72B 4HT7A 1NJWA 1I6JA 2WVEA 4ITSA 4OI6A 4L76A 4ALZA 1EETA 1XR6A 2A18A 4NI2B 4ED5A 2RNEA 2BUNA 4DV7J 3LP1B 1Y4ZB 4CO5A 2IRXA 4X84A 2M9KA 2ZNYA 1TL7B 2LQ8A 3VGUA 4EUVA 3KJNB 5IC6B 1HMVB 2E5LJ 2RRBA 5DDOC 1FKPA 2UU9F 1LW2A 2GHPA 4DL6A 5F8JA 2QLBB 2CJAA 4LJMA 2RD5C 1TL3A 2AZ1A 4CLWA 4KHPF 1NPKA 1GQEA 2VG7A 5C2GA 2VPWB 5HVFA 4E2FB 1YJRA 5LMUF 1U1QA 2CZVC 4J91A 2QYGA 1GH8A 5EN1A 4OYBA 2MGZB 1WORA 1DZ5A 4CYUB 5L38A 4JI1F 1MU2A 2YVSA 3TX0A 2LA6A 4G1IA 2ZH1A 2UV8G 1HNIA 4AL5A 2OD4A 5KFWA 1ZETA 3WZ0A 1NRKA 1YSJA 3KHHA 1O5JA 4NZ6A 2VASA 2Y1IA 2FLPA 4DFJA 1UW9A 1O0PA 2YKMB 2J0QD 3IR6B 1DURA 1X9SA 3O6QA 5DG9A 2HNDA 3SCIE 1F6TA 1A0OB 2DIVA 2W7OA 4P75A 1CLFA 3GSIA 1S9EA 4EYHB 4KQZA 2J7WA 3QIPA 3RR8A 1KHVA 1D3WA 4JBCA 5GMEA 1T8EA 2OAUA 1S1UB 1NJIT 1GX5A 2M5YA 3KG1A 1W2BR 3DN9A 2WB1D 4J9QA 3MM5B 2MKJA 1DBDA 1RUSA 1U6ZA 1I5OB 1LK5A 4HT5A 3ZXWA 4ZITA 4NA1A 3PEJA 3TQEA 2KFYA 1GFWB 2W25A 3LGNA 2KU7A 1YJUA 3O3LA 1JXEA 4M5MA 1KQKA 2UVRA 1OJ4A 5GADU 1U0HA 2CWKA 2NLWA 4XPCA 1RK8A 2YKNB 1J5EJ 4DV1J 4CQ1A 3BYRA 3HSZA 3BV8A 4DV3J 4F2RA 3OR1A 5B09A 5IFMA 3D3CJ 2Y1JA 4HVZA 4ZCIA 3OPKA 5DZ6A 1LXNA 2YNFA 3NKYA 2RU9A 5KT5A 2AYMA 3BSAA 4RUAA 2ZE2B 4I67A 1RXOB 1AT1B 3UR3C 5DGBA 1F5CA 5LMNF 4NYOA 3GIMA 3D68A 4ZLLA 1ICEB 1V3ZA 3GTYX 4QJVA 2PE8A 3RTVA 3KUEA 3UI3A 2HIYA 5G0RA 3RUBL 4KBIA 3R6LB 1XWLA 2O67A 4DSLA 4Q2LA 2VG6B 2XZDB 5K8NA 1TUGB 1HHQA 2OELA 2VA2A 1U1PA 1U02A 4PUOA 2HQCA 1PBUA 1M90T 1XMBA 3O44A 3UDEA 3LQVA 2KHCA 4YEAA 5FJ4A 2ZHOA 1WC4A 1QDUB 5A8WA 3C2PA 2WRMA 5L1LA 2VZ9A 1VRTA 4NLSA 4F0HA 2J8AA 3BPSP 2HWIA 4RUBA 1HL6A 3QAUA 1UFWA 1F9FA 1VCTA 1SJQA 3MM8A 2VL1A 2SXLA 5E0OA 4GVLA 4RW9A 2V94A 5DQHA 1SKRA 4EZ9A 5ETNA 4UW2A 1Q4RA 4KAIA 3JQJA 3MDFA 4RW6A 3OSPA 2OPSA 4RZRA 4K2XA 1F3FA 3Q8YA 3DLKB 4IRDA 3ENAA 1OYEA 1PO6A 3TZXA 2Y8YA 2CQ1A 2D3O1 3MI7X 4A8QA 2HLTA 1NPRA 3I32A 2POKA 1UJ6A 2HBRB 3S01A 2HEKA 1RWMB 4QCLA 3LP2B 4N56A 1IM4A 3VWSA 1Y3JA 3GPAA 3J7A1 1SVDA 4CRJA 4CLPA 4DPUA 1WD6A 2YNIB 3PW5A 2F9JA 3IWXA 4HHJA 3BH7B 1NLKL 2RUSA 4ZPCA 2NXCA 2F8MA 3UR0A 2DBBA 1WG4A 1WF2A 3AY0A 4X4RA 2VFSA 3TANA 2UUAJ 1U1OA 2LKZA 4KGMA 2DNRA 1DRZA 1RAEB 4GRSA 2XWXA 3H5UA 4ZPBA 2QA4S 4OHZA 4F3OA 4B9TA 4ECUA 1YX2A 3DRPA 1VRUB 1YRUA 5F3ZA 4I64A 1YBUA 4QPXA 1Q5YA 4PQUB 4UT4A 2C2OB 3QO9B 2CZ4A 3ISZA 4PRFA 4RUCA 4Q7AA 1RTJB 2WONA 2D74B 3AXMA 4KFBB 5HBMA 4ZS6A 1TL4A 3MM6A 2NXEA 3CJ8A 4X4NA 3C15B 2FHOB 5KFAA 1CVJA 5GMKa 1B4SA 3JYTA 5HMWA 4ZVTB 3CCQS 3CCWA 4O4GA 3ZTSA 2W01A 2E7VA 2HS3A 5L39A 3R2DJ 3IC1A 2MKCA 2GVZB 4QU7A 1AROP 1EAYC 3VAJA 2HKEA 4F3QA 3BZQA 4JV5F 1RJJA 4C6AA 5KG0A 2RUGA 4S0MA 3HULA 2P2CB 5JVHQ 3KUHA 1Y7PA 3PVXA 1QE1B 3T1HF 1CQNA 3BGRA 2ZM6F 1IBMF 2OSQA 4UUWA 3CD5A 1RT4B 3T5HA 2AKWB 3R97A 5L9XA 2MQOA 1EB0A 4BHQA 2UZAA 4JYAJ 3C46A 2FPHX 3OVSA 3W60A 1URNA 2MHEA 1CULA 3IG1B 4U7UD 2XSJA 2VBWA 5IXUA 2ZUAA 1APSA 2YWHA 4LBHA 4NRUA 1K9MT 1U4BA 1HQUB 5DZ7A 1H7XA 3W5ZA 5CAAA 2RS8A 2GJIA 5IT4A 2EFVA 3J7YI 3DLLQ 2Z2YB 3LPEA 3VF0B 5K5MA 2ZC4A 4DG1A 4FVCA 3W66A 2ASYA 1VQ7S 3IR5B 2MDAA 3BEGB 2H5JB 1L3SA 2GIQA 3Q8VA 4KR0B 2R2RA 4JI0F 4LF9F 3UO0A 5KFUA 2EFPA 4KGKA 3R5CA 3G9CA 2H5EA 2IC3A 1H7WA 1RCOB 1YG0A 2KZZA 3ICLA 3RB3A 4PG4A 3D0HE 3R3TA 4KE5A 5LJ3Y 3CDAA 5DG7A 1OYDA 2W4CA 2ZOMA 3BGOP 4DU7A 3TP2A 3HFKA 1S77D 3GV5B 4NWBA 3FEXB 4J90A 2BQUA 4DL3A 4KB7A 3D3BJ 2IYGA 3MWBA 2MKYA 2FJAB 2WAQD 1IBLF 3CJ0A 3DI6A 4IDKB 4KV8B 1RAAB 4ZP8A 1VQKS 5E41A 3FQKA 2XMMA 4DR1F 4LBPA 1OQ3A 1AZSB 4QWDA 1Q82T 4QPTA 2DGVA 3TUZC 2V4JA 1NK7A 3A8EA 4X4SA 4DR4F 3PYDA 1KP6A 1DLOB 2FGOA 2R8JA 1CJKA 2HW3A 3MMAB 3W9JA 5HN0A 1NJYA 1RU2A 5KFQA 2MKIA 2OLWA 1PJ5A 3K17A 4CH0S 1GXTA 1OY8A 2QYCA 4NL5A 3BQ2A 1VQMS 1KTQA 4ECQA 3OTEA 1UWBA 3FEYB 4F2SA 3KLHA 3D28A 2GMHA 3T9ZA 5KFSA 3GYGA 1T9XA 2GMJA 2ZDOA 3Q8RB 2IY5B 2AEMA 4P52A 3J7Z5 4YN3B 1WHXA 4HR2A 1N48A 1REVA 4ZVFA 1RHKB 1N5VA 1NJZA 5E7OB 2XNRA 2VQEJ 2QA1A 4CH7A 1JLCB 4RUHA 4YY3J 1RAHB 3JSBA 2FGCA 5BXIA 3NNHA 4CLFA 3M6WA 3OLBA 3GSDA 2ZOFA 2XLIA 2IVYA 1HI1A 4JI4F 2VFTA 1S5ZA 1RT7A 2HVHA 3TA1A 2FJXA 2XSFA 3KJVB 1K73T 1HBMB 1U47A 3DM2A 4DLGA 4XAKA 2MMYA 2DHAA 3HDSA 4B3OA 2LU1A 2ZH9A 3MECB 2F8EX 4MIBA 3BSNA 3RW6A 2A0FB 4OI2A 3ZNJ1 3M2VB 3OBIA 3VR1A 4DWIA 3FFIB 1SUQB 3LPYA 2E1MC 1U2FA 4FXWA 2G2ZA 1X60A 1YJ9S 4DOZA 1CS4B 1OY9A 3OW2R 1JLFB 5H1SV 1K8AT 3G6XA 2JSXA 4ZHRB 2EVZA 2M8HA 3C16B 4J37A 2CNOB 1X5TA 2ACMA 2F1FA 3E51A 3HD1A 2DTJA 5D4OA 4Y65A 5KG2A 2BYCA 3EZ5A 1YZ7A 2OPPA 2N4DA 3G6YA 2PO4A 4PKDB 1BQNA 4KHMA 4KRWA 1U6BA 1SL1A 1DQ8A 5AJ3F 3BQ1A 4K2JA 4WTYA 2FY8A 1NSQA 8AT1B 1MSWD 1R0BG 5DQGA 2CJXB 2HFUA 2C28A 5EHHA 3VHQA 4DLEA 2VQFF 1WC0A 3JAMU 1YJNS 4B9VA 3T9NA 5KFMA 1N8RT 3NS7B 2JEFA 3GR1A 2RJZA 1FDDA 3K8WA 4ZIVA 4M1KA 2OH2A 1WKKA 4V1Ak 1N4LA 4HYKA 4NI2A 1QUPA 4ZVUB 5D6GA 4PAAA 5EWFA 2BRKA 2ACYA 1WSVA 1TFWA 1IKXB 3MUVP 3MAAB 1VQ5S 4B9NA 4CNZA 2OJ3A 3LP1A 3PACA 4UQGA 3HLUA 5AJ3J 1TL7A 4J9RA 4WZMA 4MIWA 1RDRA 1HMVA 4RU2A 3UCGA 2UP1A 4R0JA 4K4SA 1ZOTA 3RJMB 1N0VC 2HFVA 3NL0A 3EE3A 2QTWA 4HH0A 1ULRA 2XMUA 2HFZA 1FVQA 5SUHA 3I9ZA 5F3TA 2VICA 1FERA 3LF0A 4C3MA 4F02A 2N3LA 1RHJB 4TQRA 2IA0A 4W98A 3KYLA 2B9EA 3VVUA 3K7RA 1ZM9A 2HHPA 2MGZA 1N33F 1EX8A 1BLUA 2AGOA 2XEXA 4CYUA 4U96A 2AYBA 2H4WB 1HNWF 2WCXA 2JHEA 3G71S 4C8ZA 2C3YA 3SQOP 1ZBTA 2VBYA 4F4AA 4GKJJ 1MN7A 4ZN1A 2MQPA 2YKMA 4KYZA 3DLEB 2F8HA 4A8MP 2Y0SD 3WHIA 2K7JA 1M1HA 1S4FA 1G7CB 1LQ9A 3TJ9A 4GC7A 4Q2MA 1S48A 2XLKA 3TZYA 3VAMA 4M5GA 2ZBCA 4RJVA 2VV5A 3Q89A 2IA6A 3SSRA 1S1UA 3ETMA 3K5PA 2CQIA 2FZKB 1QSYA 3SDEB 1B0PA 1PBAA 2VPXB 4DDFA 4WJBA 3MM5A 3G8QA 3MCSA 3TEHB 3EGVA 1X4AA 2GV1A 2JLEA 3QGGA 4DEZA 5H9EK 1AFIA 4DX5A 4AL7A 3P96A 4JV2A 1RAIB 2BW7A 3LWMA 3EMTA 2OI2A 3FRZA 1UP1A 3OL9A 3CB4A 4DF8A 2YKNA 5AE3A 2X1AA 1VQYA 2FZCB 3ILJA 1RLDA 2VFUA 2CJQA 1XTZA 4ZJQA 3CC7S 4GC6A 3GIKA 5J2PB 1KSPA 2OEJA 3OTCA 1FEEA 3RRKA 2ZE2A 3AAWB 2HVZA 1SJ4P 2UXBJ 3M32B 4FPIA 4F4XA 3DDKA 1Q7LB 5A8KB 3FCVA 2DNZA 3QWPA 2DGSA 2LYVA 1JMTA 3UWTA 1H2VZ 2VG6A 3NP5A 3VGVA 2CPYA 1NEEA 1Q8IA 2P8IA 3OFGA 5D0EA 2BE7D 3GMGA 3MPYA 1BGXT 3PRBA 2DT9A 2XI3A 2H5IB 2X1BA 4PXDA 4RBUA 1WOOA 3U1NA 1LKZA 3M8YA 4MK8A 2GGPB 2NXUA 2DKOB 5M2UA 3J81Y 3CJQA 5KFVA 2OEMA 4AFFA 3C6UB 1NDLA 5BYQA 2KG0A 4R0EA 3BN7A 2MSSA 4O3NA 4MAKA 3BDEA 1VHIA 1KC8T 5BR8J 2UVUA 3GG1A 3UCUP 2J9CA 5HL7Q 2NPFA 3G4SS 2BDPA 2OMOA 2G1HA 1KVKA 3TA2A 2V9WA 4H4MA 1TZ0A 2DEJA 5CHCB 2KO1A 1OY6A 3DLKA 2YX7A 2PMHA 1R8PA 3IA0A 1YQHA 5KG7A 3RZAA 3G6ES 4FNIA 3E01B 3Q8UA 1SV5B 4F7VA 3C8YA 2J9DA 5FIIA 2C2EA 1Q78A 4ED0A 3M4XA 3SIPB 3LP2A 2Z4PA 1OS5A 3DLGB 2YH0A 1KFDA 2B0GA 4UOHA 4NCAA 4ZMMA 1U45A 1TP7A 3GFHA 2YNIA 3Q86A 5AE1A 4NE9C 3F44A 4D3GA 1T9VA 2K2PA 2F3JA 4DQSA 3TAQA 2BABA 2NUUG 4X64J 1G1XA 1AB8A 5IWAF 2BJ3A 4A48A 4LSZB 4DR7F 4KGXB 1PYTA 2PMWA 1DQAA 4KHRA 2EBEA 4QWBA 1VRUA 3E8OA 4PQUA 1FFGB 3AODA 1WC1A 3AHPA 3QO9A 2IDLA 2CDRB 2OPRB 3CJRA 4J7CA 1ZYQA 4A8SA 3G87A 4RWXA 2FHKA 3TRGA 1FTCA 1RTJA 4KH0B 2XZWA 2WOMB 5F8MA 4MFBB 1WJ9A 1XMOJ 1WDTA 5GADI 1F2GA 2JH3A 2YWGA 3SXLA 2IVMA 3TARA 1ZTTA 3NAHA 1GTEA 2VFRA 4C4WA 2VH7A 2DNLA 4X4VA 3PY8A 2VBZA 1FDBA 1N32J 2JLGA 1RBAA 2HGLA 2Q3PA 2WSCC 3UDLA 2HAIA 4JI2J 1S97A 2GVZA 4Y2AA 2EEYA 1NXIA 4OV6A 4ED1A 4P2SA 4USUA 5IM0B 3BBFA 1Y10A 1Z4UA 1WNEA 2D3OR 1QUVA 3FMBA 4ED3A 5KOXA 1REGX 1TU0B 4FN5A 4OZ0A 1KQFB 2G0CA 4DQIA 2QG9B 2XO6A 3HT3A 3B4DA 4DFMA 4J9VA 3A8KA 1SC4B 5IS2A 2F4VJ 4YR3A 3BYPA 1RT4A 3KDOA 5KFLA 4U8VA 4DL4A 2HWTA 2V2KA 1V3SA 4WZQA 2D7SA 3K0JA 3Q2SC 3TVKA 3IG1A 3TUIC 3M6XA 1JB0C 1X4BA 1XMQF 3MD3A 1HBUB 4MH8A 1HQUA 4O44B 3MUTP 4IFVB 5KFPA 1MG7A 3GYXB 1X0FA 1N54B 1KEKA 1QVGR 4K4UA 1N0UA 3HSGA 4PG5A 4WFXA 2B9YA 4K4WA 2GA7A 4ENOA 1URRA 2XYGB 1SIWB 2X1FA 1TK8A 4M5JA 4V19J 3J80Y 1TELA 3B78A 3R7BB 3RR7A 4AQYF 5A8RB 3EX7B 1VQOS 4DV2J 1Y11A 4NLVA 1R8CA 4LQ3A 3KFWX 3RB6A 2ZDPA 3BR8A 1ZAXA 3Q8QB 3HKWA 3QIDA 1LK7A 4Q8EA 4OZLA 4Y0FA 4P73A 5D0HA 4BBYA 1RWNB 1TKTB 2MQQA 1ZH5A 3DDIA 3H5YA 2UUCJ 4F26A 2XS7A 3DC2A 4FXDA 4OYOA 1T11A 2DCUB 4OZ1A 1IQTA 2COLA 3MGJA 1FESA 4ELUA 5KFKA 4KV8A 5KFBA 2B4OA 1Z1ZA 1YWXA 4WP3A 2W9BB 1KVJA 2NZCA 3OFHA 2Q79A 1LFPA 1AZSA 2LMIA 2W1BA 1HBOB 1DLOA 3VALA 3GFXA 1RWWB 1S4EA 2PI4A 5CYMB 2QLJB 3VAHA 3AB4B 2D1CA 1QAYA 2BM0A 1D8ZA 1X5OA 3LW5C 1Q81T 3WIVA 3UNGC 3RGIA 1WKJA 4U7CA 4QR1A 4YQWA 3IRWP 1QAXA 2J7KA 5CYJA 2C42A 4HHUA 4G3IA 2AT1B 1T9TA 4PR6A 1RKJA 1WACA 1MMLA 4DJBA 4ED8A 2ZOGA 4ECZA 1S7HA 2OP5A 4MYUA 3K5NA 1JNRB 1JLCA 2E5IA 3DOLB 1FE0A 4U95A 1QTNB 3LP0B 4WK1A 2CUYA 1FNMA 1BY9A 3D1OA 1NHKL 1YRXA 3DRYA 2HHWA 1WC6A 2BQRA 1DY3A 3VAKA 3UPFA 1R6VA 3MECA 2CKWA 3AH6A 1DTTB 1QY7A 2DGQA 4TKTA 1N34F 2B4PA 1RGVA 4DF4A 3EXYA 3M2VA 4B3SJ 1TV6B 3FFIA 1SUQA 4N8OA 2M2BA 2MQNA 3H0PA 3UDVA 1E6YB 3FSIA 1CS4A 3C3LA 1JLFA 4HTJA 5HK4A 2ZWPA 4EI2A 4ZHRA 5IT0A 3P3DA 2R8HA 3C16A 1P9QC 5EX0A 4GVBB 4A46A 1N5YB 4ZPVR 4USJC 4LFCJ 2BMBA 4CZCA 2RF2B 5HP1A 1S9EB 4PXCA 1F9HA 2BQ3A 2FLLA 4J9LA 5CCMA 2FVRA 4FXVA 1YGYA 1HR0J 3K5LA 4XIUA 2HIQA 2VDHA 3IBWA 4U8YA 1PJ7A 4X65J 4OHWA 1YI2S 3WDOA 3OL7A 2K7KA 2QMUB 3M9NB 2IHR1 1RTHB 3FCWA 4DCOB 7FD1A 4Z7YA 2NXNA 2AF6A 2HHXA 2Z2MA 2D3ZA 3J7ZT 3HHDA 1GEHA 3W2VB 1S6QB 3A13A 1CJUB 1OMSA 3M8QB 3PG9A 3U7JA 1F1BB 1R8BA 1AA1B 2DGUA 1IKXA 3MAAA 3V2UC 2MSTA 4R8UB 2V50A 3IRXB 1H3DA 2XMVA 2CQBA 5I4MA 4RX6A 2AIRB 1RT6A 2ZH7A 2ATLA 1HW8A 4DV5F 1X7VA 3V6HA 5CZXA 3KK3B 3EGZA 3EZOA 3RYLA 2OO4A 2Y9HA 1RKIA 2QC3A 3ET6B 2YH1A 2OTJS 3EWGA 2VDIA 1XQIA 5J1EB 5D8HB 4IO1A 2J6SA 3IR7B 4RNHA 2VKZG 4AT1B 3T1AA 2DCLA 3B6BA 3RRHA 4O4RA 2LXUA 1TVRB 4TLRA 2JFDA 2XMKA 2R2SA 5LXYA 1S1TB 3PV8A 4Q45A 3BSOA 1M1GA 4FS2A 3SSSA 4KIAA 4LF8F 1GMWA 2WBMA 5KG3A 5CYQB 2LU2A 1JK9B 2CPDA 5ITHA 3GQCA 2L9DA 2BEFA 4KT0C 3NCRA 1NU4A 2Y0BB 4XPEA 3CJ2A 2G0IA 4HEA9 5CXTA 1IUJA 4ZN3A 4LSLB 3GIRA 2RS2A 5DLFA 2AV5A 2JWNA 5IV3A 3DLEA 1NKBA 1WUUA 1FT8A 4RW9B 4WIQA 2FUG9 4MJKA 3UD3P 1WTBA 4NOHA 2B9WA 2CQPA 3LALA 1Q7YT 1VC0A 3QRQA 4IRKA 4F4WA 3QYYA 3RW7A 4ZCMA 2OPSB 4AE5A 2HHSA 1TKXB 5I3QA 1EKRA 3M7VA 4R25A 3SDEA 1RLCL 1X5SA 3ISND 2DXDA 1K1QA 1H72C 2IRYA 4FKXA 1FKAF 1VBYA 1IM6A 5CD4H 4EGLA 1U8WA 2E1CA 5I3UB 3EUNA 1ZZNA 2HHHF 4WF9Q 3MR7A 2Y1RI 1HNXF 3HX9A 1N5TA 4RW8B 4UY8T 2V63A 3N6NA 3GILA 3VAIA 2FIUA 3MAQA 2EG1A 2EFOA 4F3MA 3HHEA 2R7XA 9RUBA 1Y5NB 2AX0A 1GXUA 3O2IA 2XZTB 1KFSA 5J2PA 5A2QY 2KXHA 4QIGA 2RT3A 1UKUA 3BH6B 2MZTA 4ZPTR 2QV6A 2FVCA 1L3VA 4WU2A 2RKIB 3H90A 3M32A 2QN6B 3FGVA 4I4BA 5IC4B 4DMZA 4KO0B 4AXIA 1FO1A 5D0GA 4P9SA 3ZZYA 2OFGX 5LT5A 4LVOP 5AXLA 4DR6F 1YK9A 3I4HX 5KFHA 2E66A 1FI4A 4WFZA 1RB0A 3R8YA 1S1WB 2NPIA 3NRBA 3EXCX 1HFEL 3QLHB 4LR9A 1X5PA 4LF4J 3DXSX 4O4GB 3OV7A 1UETA 2GGPA 3OSNA 3D2WA 2AWZA 4GKKF 4HACB 4LBIA 1WC3A 4M5IA 3NY0A 3C6UA 2HGMA 2DRDA 3AFGA 1Y0HA 3CT9A 5DO2A 4A47A 3LOUA 1PGZA 3MMCB 2DO0A 4NCGB 4DX6A 1FKOA 3QT6A 2XS2A 4BC7A 2LQJA 5E3RA 4TXSA 4DV6J 2DGWA 3QFWA 2CVEA 3HZEA 3K58A 4OYPA 3JTNA 1WF0A 3FUYA 4JV0A 4TU9A 2KXNB 2GX8A 2YPZA 1ZTWA 3OXFA 5EWGA 4IKAA 1Y00A 4KTQA 2VFVA 3ILOA 3QSIA 3E01A 1HD0A 1YJVA 4URQU 1SV5A 1CULB 1MWZA 1RAOA 1RACB 4JUZA 3FSYA 3OUYB 4TYAA 4ZPDA 5CQGA 3A3OB 2N3OA 4HL9A 1NDKA 4C2MA 6AT1B 5B08A 5E3AA 1N36J 3MCNA 1WHWA 3IGNA 3DLGA 2Q6BA 2EBGA 5DGAA 1GMWD 3KLIB 1Q86T 1EQ0A 2XMJA 2XMTA 5J1NA 4K4XA 1KNZA 1RAGB 2IVFB 2CJ9A 2UXDF 4PG8A 1RADB 1BC6A 1R0CB 2FHJA 2HHTA 1B3TA 4DG1B 1HLWA 2ABYA 4J9UE 1VIOA 2LDYA 5H9FJ 4F4ZA 2FVPA 5D78A 4N77A 4NMLA 4ECXA 4ILMA 1B7FA 2DR5A 3G82B 5LXRA 5I3PA 5D4LA 3A12A 2JZ5A 5KFNA 5JMNA 2UUBJ 1M5KC 3R7SB 2NYHA 3ONQA 2OPRA 2ZBPA 1NBEB 1GT8A 4BDPA 1KOHA 3ELHA 3N6LA 3CCTA 4DV0J 3D66A 2WOMA 4MFBA 4X62J 2XY7A 3V81B 2QSFA 3I0SA 3FBFA 4ZLPA 2W9CB 3GONA 2DR9A 4XTTA 2W7PA 3A8IA 4LFAJ 1MROA 4USKA 4ILRA 1SL0A 2LEAA 2P5VA 2ZH5A 5B0EA 3OTBA 1MW7A 1BWEA 2JL9A 3SBMA 1B0VA 2WBRA 6FDRA 1UCNA 3DI6B 4LF7F 1P1LA 3BO3A 9ATCB 1UFKA 5IM0A 2H9ZA 4M5KA 3EICA 4NA3A 1NH8A 4E0DA 4IG3B 5ETPA 2M0GB 4ELVA 2NZ4A 3V6DA 2PGCA 2IJFA 2VG5B 4TU7A 3I5AA 3VVTA 1O51A 2HBQB 4LF6J 3TA0A 2A6MA 2UVWA 1SH3A 1TKDA 1NDCA 1PCAA 3ENQA 3P45B 1XNRF 2HZCA 4DR5J 1R3NA 2YKOA 4ZJLA 1GXLA 4FF3A 3UFCX 2R9LA 3BN4A 4LSNB 1WSRA 3CCSS 1NZ8A 2C2NA 3C6TB 2IFXA 2FJBB 1DTQB 1B70B 4BWJA 3CTRA 2W7AA 3FBBA 3RBDA 4WXOA 4WKRA 3DRSB 2EFQA 2BKPA 1HBUA 2CWXA 5T14A 4O44A 4IFVA 1R43A 2IIHA 3MD1A 2MZ1A 3TR5A 1OSDA 3TJ8A 1EQMA 2PEBA 2DXEA 3EVOA 2CRLA 1S72S 4Y3CA 1X9WA 3ILIA 2IBKA 3PO5A 3W1YC 3ZZRA 4CO0A 3M2RB 2GIFA 1RT7B 4KH1B 1M0SA 1CPZA 1S59A 4ZK7M 2UXCJ 2E7WA 5IT9U 2V34A 3O5TB 2PEHA 2MY7A 3ISNC 2MTLA 3T5JA 3WBZA 2RQCA 5A8RA 2LP4A 4NLOA 4ZLNA 1AXQA 4PYAA 4NLTA 3N28A 3CCES 5L9NA 3GIIA 1IR2A 3GJSB 4DR2J 2CNLB 1WHYA 1VC6A 4K4TA 5DLGA 4HTIA 2IM1A 4CLUA 3S1TA 1J27A 4L74A 1T9UA 1TKTA 3CJ4A 3D1QA 3OTOF 1I94J 2B6AB 3E2EA 3R2CJ 4FYDA 2RH3A 2CQCA 2V69A 4QIEA 1XNQJ 4N5SA 2GO8A 2OSRA 3U1MA 2IRUA 4K5RA 4LRFA 4ZVOB 2MKKA 2JDJA 2FHJD 2ALYB 5HMZA 1T94A 2YNHB 3D1HA 1VR6A 2W9BA 1FJGJ 1N6QB 5LSRA 1IBKJ 4R5PB 4WCEQ 4OYXA 3G6VA 1YIJS 4U67Q 2V67A 3CSKA 2GW8A 2W2MP 2CIMA 1PAUB 2B56A 4DX8H 3AXKA 3MR3A 2HHVA 2YPYA 2HQGA 2XTJP 5C2CA 5D4NA 4WPAA 2ASDA 1F9EB 3R6GB 4YHHF 1CJTB 3DNCA 4LR8A 3W64A 3R5BA 5CYMA 4DHVA 3HSDA 4ERDA 4GO7X 2J0WA 2NQPA 3OTDA 3GFYA 5DDRC 2DIUA 3Q24A 4Q8FA 4KGVB 4LFBF 1UVKA 3NGSA 4FDFA 4Y2MA 5EUHA 1DARA 4ZLJA 1S1VB 4OX9J 3NMAA 2R8KA 3HFVA 2CNKB 1JLGB 4C8OA 4A8KA 1VK8A 4CT8A 4YS2A 3TUJC 1YLXA 1YVFA 1RAFB 4B3MF 4FYYB 3B82A 3DOLA 4M5DB 2CPEA 2YWKA 3I56S 3KMQA 3J81j 1S76D 4YDDB 3QQCD 3LP0A 3VQSA 4BWMA 1RAJA 1X4EA 3T41A 1BQMB 4EK2A 4LFBJ 1AUDA 3L7UA 4EBEA 3RBZA 2V4QA 3W2WB 2UUWA 4BLGA 2OGUA 2RDJA 4IQXA 1EP4B 1LWEB 2AP6A 1VBXA 1HNVB 4FBUA 1DTTA 2NCKL 1YRTA 1WG5A 2QMWA 5EDWA 4YP3A 1SI9A 2WW4A 4E8UA 2PMZD 4OJ3A 1NM2A 2BE2B 4PPDA 1TV6A 3TVYA 1YJWS 3D6MB 2UU9J 4LF5F 3MXHP 1NCLA 1XR7A 3TVZA 1E6YA 1VHFA 1FWKA 2GQCA 3AD8C 1JQGA 2ASJA 2AGQA 4KHPJ 4GMKA 1UVIA 1JXVA 4GVBA 1N5YA 1FRLA 4H4OB 4CO2A 4NLPA 2RF2A 2QE5A 4JI8F 1T03B 1KOOA 5LMUJ 3HHKA 2YX4A 3FZBA 4K8RA 4ANDA 1FK9B 2V8VA 3TYTA 1XR5A 1HWUA 1FRKA 4JI1J 1MN9A 4JI3F 2U1AA 4WYLA 4EWTA 3AJ2A 1HD1A 5J2MA 3MAHA 2YWEA 2JEGA 5KG1A 2NSCA 1RTHA 2X3DA 1KS2A 3UE2A 3FK4A 3AOAA 3MURP 2I0XA 2MZSA 1JXLA 3W2VA 1S6QA 1NZAA 1CJUA 1PKUA 2WVFA 5E2QA 2XYPB 4NA2A 3M8QA 1CC8A 4ZKAA 3N9UC 4DSFA 2ERRA 1ZAVA 3OD2A 2EFNA 4C98A 3HVRA 4LREA 2HZVA 1S1XB 3T5KA 4R8UA 4K4ZA 3IRXA 2RILA 2Z0GA 2NSBA 2ZNZA 4B02A 3JB9k 3HJVA 3MR5A 1T05B 1TMMA 3KK3A 1LWXA 2HVIA 1S49A 2QFIA 4EYIB 4DSEA 1D0EA 4DV4F 4DL5A 3ET6A 1FX2A 4FYWB 4PXEA 5J1EA 3TAMB 1JIHA 3JTOA 3DOMB 5DDPC 1VIXA 1IR1A 4DPTA 4WFNQ 3ADAC 5JJBA 3H2UB 2VA3A 3C66A 3CEDA 3CO9A 1G2EA 1TVRA 4ZVQB 3ETOA 4ZDNA 4UF4A 1S1TA 2BOPA 2CPHA 4EEYA 1R0AB 3H4BA 4RO0A 2MYFA 4CI0B 5LOQA 4TYBA 5CYQA 1UVJA 2N4CA 3CCJS 1I3OB 3NGUA 3QJPA 4ETZA 3G2XA 1VBZA 5AXNA 4DV4J 5LMNJ 1VQNS 2OD6A 1RT5B 4LSLA 3NGRA 5MAOA 2ZD1B 1LFWA 2Z2LA 5KFTA 5CD4A 3PYGA 4ZA1A 4C8YA 2GNKA 4DR3F 4L3NA 2RHSB 5KFYA 4IG0B 1GAOA 1FRHA 4EMDA 3BQ0A 5T41A 2YQ0A 4OX7A 1UEVA 5LSOA 4H4MB 2KHDA 4PG6A 2EFGA 3QATA 2XWYA 3Q83A 2NXJA 3CNQP 5RUBA 1TUWA 2XMWA 2HQFA 4IQMA 1TKXA 3EVMA 3GJRB 4CP5A 5ETOA 2EW9A 4X2BA 3UW1A 4IH7A 2MLYA 2DNQA 4LRAA 1V5IB 4Q43A 3HVWA 4WFBQ 3BF4A 5HLFB 2ALZA 2RVJA 4ANCA 3W65A 2R2UA 5I3UA 4PABA 3M30B 4DR3J 2KXFA 2DITA 2HNZB 1RT1B 4I2PB 4QR2A 2JJ4D 4RW8A 3MFIA 3GP9A 3QWUA 3CCRS 2W9AA 2XO7A 3DLJA 2DVIA 1PSDA 3V6KA 1EKSA 1SQEA 2L08A 1N56A 2W2QP 2DGOA 2H4YB 2QA4G 1VFJA 2YKAA 4RBVA 3BBCA 3VQTA 4I69A 1SJ3P 3X3UA 1U0SA 4CLYA 4USVA 1HQEB 3S7RA 1X31C 1Q53A 2J6UA 2OMLA 1VDHA 1X4FA 1Q16B 2IM3A 2RKIA 3RBXA 3KK1B 2ZHBA 4J9KA 2BA9A 3GU0A 4KO0A 3EPGA 1A6LA 3G8SA 3D0IE 2Y8WA 1PAEX 2KI2A 4WFYA 1V3RA 1TTHB 5A6WA 4HHHA 3FBCA 1S1WA 2WVDA 2A1BA 3UVJB 1UPPA 1CBKA 1B0TA 4OJ1A 4O0IA 3QLHA 3QBCA 1S9GB 4WBFA 3BM7A 2M4MA 3M8ZA 3TZWA 4HACA 1W26A 3QJLA 2FYXA 4QW8A 1FXLA 1JLQA 4DUZF 2XB2D 5HI7A 4OX8A 3VAFA 3QMQA 2ZEJA 2JC0A 5ETRA 3IFEA 2AQ4A 4DL0C 5F8NA 2L3MA 3MMCA 4K7QA 4NCGA 4QU6A 2EKYA 3KG4A 4OLOA 1BHNA 1S99A 4ZVEA 3FBEA 4B17A 1T3OA 3BSCA 3DHXA 1S6UA 5AT1B 3JTPA 2DB1A 2V0NA 2QLWA 5B0GA 3IBFB 1H2TZ 3KJFB 3AQPA 4ZVPB 2YY3A 3OUYA 2KB2A 3QGHA 4NXMF 1GNKA 1RWUA 1KQGB 1RTDB 1H0HB 4JV5J 1FEHA 3KLIA 1SIZA 2V4RA 3LA0A 4L73A 3NCPA 2MZJA 1FNOA 4WTOB 3T1HJ 4C97A 2AD9A 2ZM6J 1IBMJ 2KVQE 3RG6A 2VKRA 4FPRA 4QWCA 4NYZA 4JI5F 5C25B 2EKNA 3G82A 1Q8KA 4H4KA 4K0KF 4NZ7A 3BPDA 4JI7F 3SCJE 4G1QA 3CDUA 3DLBA 5KG5A 3T1YF 4OI4A 2EK1A 5KOWA 4MT1A 4FF2A 4K4VA 3DMJB 4PWDB 3FCHA 3ZTPA 5IV4A 2V2QA 5GAEU 1NHVA 1IR0A 2XMAA 4HI1A 4ILLA 1ZAWA 4CLTA 4ECWA 2HSEB 3V81A 3W3SA 1RWKB 2DGXA 2W9CA 4AXJA 4Q44A 3QSYB 2HBYB 4TLQA 3CDBA 2CJBA 3PHEA 3B4MA 1NJXA 2R7UA 2FJDB 3KUGA 2OKQA 4IFYB 2OIHA 4C0OC 1VQSA 4G65A 4JI0J 4YB1P 2AJ4A 4LF9J 1TK0A 1FFSB 2BE9B 2CZ9A 2QA2A 2NREA 1H73A 2EK6A 4IG3A 4ELTA 2J76E 5ETLA 2VG5A 3VAGA 3KDNA 2Z2ZA 3D54A 3DGVA 1KWMA 3ITHB 1T9YA 3AA9A 5DRKA 3WX4A 1Y5IB 2KH9A 3R5AA 2AHOB 2XQCA 5CCLA 1YITS 3SCLE 3TNVA 4LRDA 1TKZB 4LSNA 2OEKA 2Q1LA 1RTZA 2XLJA 2KL8A 4C3LA 3C6TA 4C8LA 2LEPA 5L1KA 1DTQA 2E9ZA 1IBLJ 1K0VA 3DRSA 2GS8A 1PYOB 2W2OP 1HQ2A 2MB0B 3IAM9 3SYZA 4DR1J 1WG1A 4I7FB 4A8FA 4LIRA 2GO9A 1W25A 1NK8A 1XBWA 4WXWA 1IN0A 4DR4J 5KFJA 2ADBA 3DCAA 4N76A 5DQIA 5GVQA 2KT2A 3HHNB 5KG6A 2C2DA 3I6PA 4O3PA 4KJIA 3HXMA 4X66F 2MY8A 3M2RA 2O5DA 3PFOA 1HI8A 5ETVA 3HHLB 3R9LA 3UDCA 2B4VA 4OFZA 4IYQA 3DRRB 4NX9A 4WFAQ 3GCXP 1YDLA 1Z2ZA 4B3TF 4TY9A 2ZZTA 3KJQB 4J9PA 3H25A 5G4DA 3I4PA 2R7RA 4P10A 1F5AA 1HYSB 3OT9A 5M2RA 1NK0A 4LF1A 5F9LA 3DHWC 2FJEB 1C1CB 1M5VC 4K5SA 1UVNA 2LXIA 3N6MA 2XULA 2RB7A 4X4PA 1DQ9A 2XGQA 1H98A 1NB2A 1IJFB 3MR2A 5C5JA 1FD2A 2KJVA 2B6AA 2ATCB 4CIOA 3R5JB 1BUXA 4JI4J 1NAQA 1IKVA 5HP1B 1AW0A 2Z56B 2FC8A 4CTAB 3O8WA 3N01A 1D9AA 4JI6F 1NK6A 2YNHA 2G13A 5SZTA 1M5OC 1R7IA 5F0WA 2G2OA 2BACA 1N6QA 4R5PA 1GK8A 1RT2A 1JLAB 3M8RA 2ZJQQ 3QT7A 2HRYA 3W5YA 4I2QB 4Z37A 2WK4A 4N41A 2AJQA 3TI0A 4P7VA 2PSZA 4J9MA 2GIRA 4CLKA 1CJTA 1MNEA 2DNYA 2X3GA 2A6OA 1WTFA 3MF5A 2EC0A 1RSCA 1WI6A 2LCWA 5JUMA 1HNZF 5FLXU 4X4QA 5HVGA 4ANEA 2PFFB 3RAQA 4OJGA 1HWKA 3K89A 1WEZA 2YTCA 4C11B 1OIAA 4MTPA 1RI7A 1S1VA 3T19A 3CCMS 5DETA 1TR0A 1RT6B 1JLGA 2WHOA 2DRAA 4MIAA 4OZ5A 4IOAQ 2AGPA 1PC4A 3PKYA 3N5BA 2ROPA 4DV7F 1LW0B 2J6TA 2HS0A 3JAMY 2VQFJ 2HK2A 3QRPA 4PPZA 4M5DA 5LM7E 1VQLS 3CE8A 2ROGA 3GR0A 2F7VA 1FFWB 2E5LF 3L7OA 1BQMA 2QL9B 1VQ6S 1P9YA 3IWLA 5GAHU 2HMIB 3W2WA 3HSJA 2KM8B 1D9FA 3CO0P 2VPZB 4A8YA 4BC9A 1EP4A 1VK3A 1LWEA 1HNVA 3DLHA 3CCZA 4USTA 3NLCA 3BS9A 3PXGa 4O3QA 3K8VA 5ETKA 1NSPA 1EJ7L 1HPZB 2BE2A 1JWWA 1XC9A 3KHRA 1R6YA 2C2KB 5CZVA 2U2FA 1L3KA 5KT3A 5KT2A 1YJ7A 1BD6A 2CQGA 4H4OA 2GJFA 2AW0A 4Y2IA 1T03A 1AYEA 4YR0A 4AUKA 1CSJA 3CDWA 2R2TA 1N33J 1FK9A 1HIYA 1FWPA 4EO8A 4DS5A 1NHUA 1TL1A 3MTKA 1HNWJ 2Y1LB 4DS4A 2DEIA 2CPXA 1SBRA 1KD1T 2OUGA 3NEKA 3NWGA 4DPWA 3LANA 3NOCA 4I56A 1LOUA 1X4CA 4CDIA 3ZZOA 2B8PA 2GAGC 1UEUA 3DYAB 3K59A 1SC6A 4I6WA 4QIVA 2F9DA 2ZFHA 4P2XA 5B0CA 1S1XA 1S0MA 2M7SA 1AFJA 1VI7A 1CC7A 2Z57B 3I87A 3L9ZA 5ETTA 2J9EA 2KRRA 1J5EF 4DV1F 1T05A 4DV3F 4P74A 4DI6A 2GFFA 1K47A 1N52B 5KFEA 1FJEB 1JJHA 4YB5A 3TAMA 2CPIA 1S10A 2ZH4A 3L95X 3FZ2A 1QD1A 1ZPWX 3M6UA 4FVMA 4OYIA 3DOMA 1OSCA 3EPIA 5KFCA 3EVWA 5HQMA 1C1BB 1TMJA 3I96A 4ZCKA 4USWA 3SEOA 2E5GA 5HMYA 3V4IB 1UTAA 2CQ2A 1HKAA 2M3DA 4I1TA 1HWIA 3NGKA 4N8NA 2F63A 1NNDA 2MQ8A 5A6PA 2KTQA 1R0AA 3RU0A 2DNOA 4PQAA 3PX6A 4K50A 4WU3A 2W4DA 4DCJB 5AXKA 3IN5A 5GMDA 3OHBA 5AE2A 5E5NA 5KFFA 1RT5A 4WYWA 2ZD1A 4NLQA 4L3KA 1CG2A 3M8PA 1VLOA 4DUTA 4LMZA 4CLSA 4IG0A 5KT6A 2EXUA 3AB2B 4ETXA 3W9HA 3EDQB 3P4UB 1FKOB 4LVNP 1HA1A 1RYSA 3FVYA 2DHHA 3QT8A 3ZZPA 2WSFC 1H6KX 1QSSA 4USIA 5KFDA 3T5LA 2OFHX 5E3QA 2L9NA 3D6FB 3W8PA 5KFRA 4IH6A 3M9OB 2FVSA 3HO1A 1EARA 2H65B 2V9KA 3MFHA 4OQJA 2NR0A 3KG0A 3P5BP 3IS9B 1N88A 2VOOA 4ICLB 2HLUA 3FMWA 2APOA 3BGUA 5HLFA 3RAMA 4LQ9A 5C7PA 1C0TB 5A0YB 4O0NA 3M30A 1H74A 2VF3A 2FHMA 3OXGA 2WZ1A 2HNZA 1RT1A 4I2PA 5DS7A 3F0NA 3HI9A 2LLZA 4KGZB 1T0TV 2R7QA 1KLMB 5F0UA 8ATCB 2V6AA 2V8GA 2BJ1A 4IOCQ 3FEZA 2ZWOA 3TAPA 2IYIA 1HQEA 4OJHA 1RISA 4OHXA 2IJNA 1H2UX 3BDPA 2BOAA 3KK1A 5KAKA 4H4KC 2XYHB 2UUAF 1X4HA 1J5OA 2ZH3A 2BJ7A 5JXSA 4CLLA 3EGNA 4M94A 4MK7A 4EBDA 1U1NA 4KPCA 4OI0A 5KFGA 3GFZA 3I0SB 2JC1A 4IUFA 3PEHA 1RWXB 4L6V3 2KVIA 1MROB 1SH0A 4RKUC 3UVJA 1IVZA 2RDDA 3BO4A 2GQQA 2B9XA 1QLNA 1S9GA 5C42B 5IWAJ 2IPOB 4OX6A 1NO8A 2MPUA 3B54A 3K5MA 1FX4A 3VGTA 4DR7J 5K9FA 2MQLA 4F50A 3LWLA 2FY1A 1PIEA 1D1UA 1UA0A 3TQ1A 3DGPB 2OHDA 3DU5A 5BYSA 1HBNB 4YUDA 1RTIB 4PYDA 1NMEB 5CA5A 3N4WA 2HGNA 3V6DB 1ZPVA 2XBPA 2C1EB 5GAGU 2I5JB 4U9RA 1ZS6A 2QL7B 1QSLA 2OTLS 3WC2A 1JKHB 1SH2A 5J2NB 2R7TA 4ZVHA 2I1RA 3W63A 1MLAA 4Q0BB 2IM0A 2W24A 4UUXA 4QYRA 1ACMB 4ED6A 1B64A 3DDNA 3TO8A 4YR2A 1LXJA 2JNJA 5D0RA 3W8GA 4B9MA 4UZCA 2GJ2A 1TQLA 1SQFA 4NCBA 2KDOA 1QTMA 1T9WA 3MHYA 5H9FK 4JYAF 3JQKA 3NAIA 1RTDA 2ILYA 4RNFA 2KJWA 2N7YA 4U7UK 2UV8A 4RNOA 2HG4A 2G2YA 5HSPA 5JVGQ 1S79A 5K8OA 2RSQA 3M6VA 4PWUA 1RP5A 4U6PA 2VPYB 2AJ2A 1O6XA 2O01C 2QX0A 4OI1A 4P72A 4NLXA 2DH7A 1FTRA 3T6BA 2MXYA 5J1PA 2I9SA 1RWPB 1HW9A 1JNZB 4DPXA 2DR6A 3BGLA 3SQGB 3SZ2A 4URGA 3CF5Q 2AYEA 3IBCB 2HBZB 5C25A 1FDNA 4ATNA 3OHAA 3W7BA 3R5GA 2RQMA 1M1KT 4HDHA 2VD3A 4ZP6A 1M5PC 1XMQJ 2HNYB 3DMJA 4PWDA 4Y2KA 3CMES 3JSMB 1RHUB 3O1LA 1VJWA 2E1PA 4RL1A 2Z30B 4Q5VA 3P6YC 1U25A 2C3MA 3I82A 3QNWB 2GC8A 3DOKB 2DH8A 3NOGA 4J9OA 3PJ9A 4P6QA 4ECTA 2M8DB 1X9MA 4X4TA 2CXEA 3NS5A 4IR9A 1R89A 3NXZA 2RU3A 1FHTA 3LAKA 2J0SD 1L3TA 1RA7A 2LECA 3MOJB 4IFYA 2B4UA 4CT9A 3D5MA 3AT1B 1B7YB 3QZ7A 1V5VA 5FD1A 4RR5A 4AQYJ 1MMDA 1JJCB 1PILA 4ZPAA 5HQ8A 3BREA 2WSEC 1JX4A 1UMJA 3LGHA 5EGYA 2ZKTA 2GHWA 3FSXA 4MKBA 4KSEB 1JLBB 1ROFA 4PWWA 4EZ6A 1NUEA 3ITHA 3T3FA 2ZBIA 5LL6d 4CM0A 2CYYA 3ZO7A 4IH5A 5B0FA 5HJYA 1S0VA 1RHMB 2JVRA 3GB0A 2E1AA 4QWEA 1B99A 2KRBA 3PIPQ 3PJWA 3AD7C 1RT3B 1TKZA 2CQDA 2MEWA 2RDIA 4OHYA 1OPZA 3W5XA 1SKUB 3VGSA 1DHMA 2XC9A 4F4YA 3MM7B 3P8BB 3U1LA 2PIIA 4I7FA 3LTOA 1SXLA 2DHGA 5D4PA 1S0OA 3VV2B 3ZZUA 4URSA 2C3PA 1VQPS 1SKWA 1G6BA 4P2MA 5E3PA 1RQ0A 4DSIA 3HPOA 4OZ3A 4ED2A 2DRBA 1HWJA 2QLXA 5FDLB 4IR1A 2VQEF 4ZVGA 3HHLA 3HF5A 3AOCA 4YY3F 2YXLA 1NDPA 1BE4A 2GVDB 2E9TA 1KHWA 4RW4B 1Q1KA 1LEOA 1KQSR 3DRRA 3TX8A 2J7UA 3WC0A 3G86A 1PYSB 4TY8B 1HYSA 3KNGA 4JB8B 3BJYA 4M5HA 2XM3A 2YWFA 5KFOA 1C1CA 3IAS9 1OWXA 2VC0A 2J5AA 3QPIA 3NCQA 4O3SA 2EPIA 2CFXA 4B9SA 3CPWR 4OZNA 4DZ6A 4DFPA 3IMQJ 4Y34A 4ID8A 2YKPA 4KKOB 2GAHC 1SQGA 3FC9A 5DDQC 4UOGA 1L5UA 2DNMA 2G4BA 2B8QA 1Y3KA 1FDAA 2A10A 2Z8QA 2PT0A 4BCAA 3H20A 1FJ7A 4CTAA 3PCOB 3FKBA 3UQSA 2BANB 2LDIA 4OYAA 2IBOA 1JLAA 1IKYB 3PYFA 1N34J 1SCJB 4I2QA 3PYEA 5GAEI 4FF1A 3GE9A 5J2MB 3NNAA 3G8TA 1U7LA 3J7AN 3MPVA 1W7WA 1IWAA 4YFUA 3IGVA 2CQHA 1FXDA 3CJ3A 4ECSA 1RYRA 2G9OA 3M1VB 1N5SA 3BR9A 2ZZNA 4QIFA 1T3NA 2W4PA 3EZUA 3OL8A 1M5HA 4C11A 2KKHA 2VJVA 4DSKA 2RRAA 2VOPA 3FDSA 4FBTA 3GCWP 4KY3A 3GZ7A 1FWLA 4BS2A 3M2UA 1OO0B 2JFKA 1N5QA 3GYNA 1LW0A 4F0MA 4F4KA 3H98A 3HKZD 4JP8A 1CJVB 3HJFA 2ZC3A 3KLFA 3N79A 4IRCA 2HAFA 3EGWB 1U8SA 4RBTA 3HK2A 3KLEB 2V2ZA 3TWZA 1FJCA 3D4JA 2BZ2A 1S7IA 4P2FA 4AL6A 2QLFB 2HMIA 2QIFA 3FNNA 4WE1B 3R1HA 5KFXA 2E9RX 3GJQB 2YNGB 1UAWA 4ES2A 3LUYA 3K57A 2LVWA 1IKWB 4DV5J 4I0WA 4YDXA 5K14B 1HPZA 2XGPA 4RPFA 1ZA2B 2KT5A 1M5SA 2J9DE 2AEJA 2KN4A 4M5NA 4UY85 2RRNA 2I8EA 1YZ6A 2DNPA 3MEGB 4GKJF 2M52A 7AT1B 1Z2LA 3F41A 2IMWP 1ZZFA 2RQKA 1U1LA 2QZ8A 4X4OA 1YTYA 3ILLA 1KONA 1FE4A 4LF8J 2C2ZB 5EWEA 2R7VA 2YBVA 3Q8PB 3H8YA 4MKAA 3HHLD 4D3HA 2AJFE 2WVBA 3UD5A 4M5LA 3N5FA 4F8RA 1U09A 2H3EB 4UTGA 3DRXA 3OR2B 3ULHA 1U48A 2NYIA 2HWHA 2C3UA 3SV4A 3KMSA 4IO9Q 3MEDB 5KFZA 1E6VB 1ZA1B 3DYAA 2K1RB 3L3CA 3NNCA 2N7CA 3OVBA 3S6EA 1R8AA 3KOAA 3BKTA 1XEZA 4NZ0A 4P7TA 5DG8A 2ZJRQ 4G1PA 4RLEA 4LIWA 2W2NP 2VONA 2DO4A 1KDNA 2HFSA 1LWCB 1Y5LB 2GQ2A 1S6PB 4N7TA 1KVIA 7FDRA 2E1RA 2RE1A 2V8HA 1R31A 2E29A 2H51B 2HHHJ 1C1BA 3H7HB 1HNXJ 2Q66A 3TZZA 2UXBF 3PX0A 2B3TB 3TEGA 3QGIA 3FJ2A 3I0RB 3MCOA 3V4IA 2LA4A 4I6YA 2HVDA 3JQMA 3PX4A 4CCHA 1RCXB 2DH9A 3MUMP 1LWFB 3P49B 3FRYA 4FYXB 4MYTA 1VJQA 1SC1B 3PR4A 1GTHA 1F60B 2F40A 4RW7B 1YBTA 4LR7A 1JLQB 2AZ3A 1IJEB 4M8LA 1D09B 1R27B 1HI0P 4XDCA 3PZPA 3UNYA 2MJUA 4ER8A 2DNNA 3KHLA 1HHSA 1FRIA 3P5TL 2P9GA 1WC5A 4TU8A 1U49A 3SFUA 2O1PA 1K44A 4C8KA 3H4DA 1MWYA 3J81U 3CWJA 1WF1A 4DR6J 1NB7A 4CH1A 2O66A 1KBRA 2X1GA 1UJ4A 2HZAA 3G96A 3ZTRA 2RIJA 3BO2A 2WB4A 3C14B 1Q0NA 5GAHI 2IM2A 3RB4A 5BR8F 3PFEA 2HPUA 1Y9OA 5F8LA 3HCXA 3CD0A 4EFAC 3WX8A 4GKKJ 3CIMA 1C0UB 1NH7A 4K4YA 2QEXS 2I38A 2G1DA 2NUHA 3IS9A 3W62A 4ICLA 3GJTB 3PM9A 4WK3A 4CM2A 3MPUB 4USHA 4C0BA 2D3UA 1C0TA 5A0YA 3PW7A 1X4GA 3CC4S 4NLYA 2E7XA 4DCPB 4Z7CA 3MR6A 3MPWA 4NEYA 1Q8LA 3QAEA 2DISA 5I42B 1KLMA 4A8WA 2ROEA 2IAJB 3UN2A 4RNMA 3VCDA 2XY5A 4J5OA 4ED4A 3MMBB 3CIZA 4C0HA 4QBUA 3F56A 5THWA 2KT3A 4RNNA 3X1LB 4X4UA 3MEEB 4TNOA 4G1QB 4W4MA 2ZZMA 1YJTA 4WIIA 4X64F 2L48A 2HHUA 4B08A 2XCPA 1L3UA 1Q79A 1FRMA 3D0GE 3CC2S 1PC5A 4PG7A 4TQSA 1HARA 1JJ2R 4EU0A 2UXDJ 1W2IA 4ID5B 5HROB 1NKCA 4QOTA 1FF2A 1HHTP 1ZM2A 3KLGB 3EJMA 2JX2A 5C42A 4K59A 1XMOF 2JOQA 3MTJA 2MKHA 4YMEA 2JRSA 1RHRB 3CDEA 4O3OA 4Y28C 2IDEA 3BB5A 3V4MA 3A8JA 3DGPA 2XS5A 2EWHA 1HBNA 2VB6A 5CABA 1EIYB 1RTIA 1U26A 3M8WA 1N32F 2BM1A 2YX1A 5IQQA 2AEFA 3DKDA 2CG8A 2FLNA 2IJRA 3OFEA 2V5HG 4JI2F 2Q6CA 1I51B 5T7LB 4A8OA 2DGTA 3NBPB 2I5JA 3U27A 1TAUA 2RQ4A 1JKHA 3PW2A 3QGPA 5J2NA 2DXFA 1RE1B 3CCLS 3IM9A 4HI2A 4Q0BA 3I5CA 2JEJA 2R42A 2LQ5A 4KFBA 1R8HA 5B7WA 1KR4A 2C22A 1S12A 1Q5VA 3C15A 3SSQA 2F4VF 3R7NB 1PJ6A 4LF7J 4OL8A 4DQPA 2EC2A 2EG2A 2F4FA 3L09A 1P27B 2CQ4A 4FKYA 3MM9B 1MMNA 3MPDA 3ENVA 1S9FA 1C4CA 2CNNB 3PR5B 4XO0A 3A4TA 4RWWA 3HT0A 1FRJA 3UN3A 1KRPA 3GIJA 2XHCA 1XNRJ 1FNXH 2DHSA 3SQGA 3HVTB 3W9IA 1IBCB 2LEBA 1UZHA 2ZBRA 2FLOA 1BMQB 2DK2A 3KWMA 3PTWA 3HHLC 1QE1A 1FRXA 3CCUS 5J2QB 1WWHA 2QT7A 3HP6A 4QYZK 2DJWA 3QFHA 4NLUA 5KT4A 4OZ2A 1YHQS 3GV7B 2HNYA 2QSWA 1X0PA 2F65A 3AA8A 3NGTA 4OZJA 3JSMA 3CVKA 2LQBA 3CJKB 4NLDA 5HVHA 2QFJA 4H54A 2B5JB 3J80U 2FVQA 2D69A 3RB0A 1QVFR 3CMAS 3ZC4A 3WQPA 3HZGA 4DV2F 3DOKA 3M9MB 1RABB 3IXQA 4ZJOA 3SCKE 1WELA 2MLXA 3IWNC 3Q0AA 1V6HA 2XCAA 1IKVB 4ES3A 3KK2B 1TL5A 5IT9Y 4A8XA 2X51A 1G3OA 2RMLA 2XHWA 2UUCF 4HKQA 5KFIA 4NYPA 3Q22A 2C2MB 4CLZA 2AYGA 1U1KA 3H40A 1XN9A 5L46A 3PW4A 2ASLA 2ZITA 3W61A 1ITPA 1RT2B 8RUCA 2ZVIA 1F3VA 2PD1A 3TJAA 4DSJA 3A1YG 2ZHAA 2OPQB 4OMFG 1JLBA 4FYVB 1UW4A 2AX1A 4RU9A 2JLFA 1BWVA 1UWAA 4HDGA 4TVAB 3ZZTA 3POTB 2BBEA 2BXJA 1XK8A 2DY1A 3OTOJ 2V8DA 5D3GB 5C24B 3QJJA 2VC1A 4B9LA 1RT3A 3PDNA 1KN6A 3I9V9 2J8SA 4KPYA 1IXKA 1MWQA 3I55S 3EYZA 1D8YA 1LV5A 2YQ1A 2B43A 4YB7A 3MM7A 5BYRA 3SMZA 2V2VA 4LRBA 1SJ1A 1IQZA 5D77A 3RRGA 4DZDA 3SFGA 3K2YA 2H54B 5KT7A 5HQLA 5F8IA 1T7PA 5ETSA 2ZH8A 2J0XA 4IDKA 4NLRA 3HVAA 5GAGI 4YHHJ 1U6FA 5FDLA 2MJNA 5L1IA 2P9EA 3H5SA 4OI3A 1WDDA 3JXOA 2D9OA 2CPZA 4C3KA 4OYWA 4HLBA 2RHQB 4ZCLA 1XERA 2Z58B 2GVDA 4Y00A 4UQTA 3MMAA 4ZVSB 1JLEB 4RW4A 2D9PA 2CADA 1TK5A 1EETB 2LQ9A 2KM8C 2P6SA 4TY8A 5A76A 2ZBQA 2HFOA 1SB6A 2HS4A 4ZPWR 2DR8A 4OV1A 3VZIA 2E5JA 4I68A 3RBEA 4B3MJ 2ZH2A 2BJ8A 2K8GA 3LO3A 3T6JA 3MOZA 2N82B 1VS3A 1Q8BA 2WVCA 4B3SF 4KKOA 1VC5A 1S0NA 5IQ6A 1K1SA 2QMXA 4ZVRB 1FKPB 3PHTA 1LW2B 1TL3B 3Q8SB 3R1LA 2WW8A 4OYMA 2NS1B 3I31A 2BANA 2VG7B 4LFCF 2K3KA 1A9NB 1IKYA 3KJVA 1HBMA 1F2HA 4DX7A 1TL1B 5F8GA 3PIOQ 1VLYA 3E3XA 2HK3A 4JV1A 1WHVA 1HR0F 2ZKUA 3R5DA 4LF5J 5U47A 4J9SA 5HO4A 1BQXA 1RWOB 3K5OA 1MU2B 3MCMA 4X65F 2UVVA 3US5A 1HNIB 2CQ0A 1QJHA 1FD8A 5HATA 3M1VA 1BXNA 1TAQA 1X8DA 4JI8J 3OXLA 3PO4A 2L41A 1YKWA 3ZTQA 3FQLA 1SC3B 5HAOA 2HNDB 3LGMA 3H59A 4JI3J 4UOFA 1PG5B 3QIPB 2HFNA 2CPJA 1OQ6A 1F0XA 2BW2A 1CJVA 1T02A 3JSYA 1NSKL 1RU1A 1NK4A 1WKLA 1UL3A 2BJEA 2GZOA 5F41A 1AUSL 4XK8C 4NMXA 3CJ5A 3KLEA 4V19X 5EX3A 2L9WA 2PN6A 4ECVA 2R7OA 1Q95G 3CCVS 1S57A 2CJYB 3GLJA 1SPBP 4WE1A 3PNIA 3V5RA 4NASA 1RBLA 4GO5X 2B7BB 3IM8A 2YNGA 1U0HB 1RA6A 2XNQA 1IKWA 2A3JA 3UCZP 1UFLA 2KYZA 2K06A 5K14A 3BKFA 4Y6IA 3OR1B 1DFDA 3H2VE 3F73A 5H9EJ 4DBQA 2CVIA 3M8PB 4OHVA 2YNFB 2M70A 1TFYA 2DNKA 1KTVA 5LSLA 3D7SB 3MMJA 3NGDA 2R7WA 3WIUA 2XI2A 2HQDA 3MEGA 2F5GA 5G0RB 2JVOA 4AD6A 1WEXA 1UPMB 1P6TA 2CA9A 3A3NB 2FD2A 2HURA 3JS9A 4MMOA 4DN0A 3ZTOA 1H38A 2VU5A 1U1RA 3VZHA 4PUOB 4CWBA 1YBAA 1RHQB 2ZVSA 3EDRB 4NPOA 4WWSA 3AJ1A 5A8WB 3L4BC 2BJDA 3OR2A 1SKSA 1VRTB 1VOMA 4DQQA 1CQMA 2BVZA 3PW0A 2ZUGA 2HVEA 2GHVC 1XJWB 2YKQA 4CO1A 3MEDA 2DPIA 2LXFA 4ZP7A 3KTQA 1E6VA 2R3VA 2AU0A 2Y3YA 2K1RA 4J9NA 2A2CA 5E3CA 1S6OA 2QL5B 4PCQA 3D6HB 3OJSA 1NK9A 2B51A 1RZMA 3UD4P 3MM8B 1KKHA 5IOLA 4MKYA 3J7YU 3AD9C 3PKMA 4FZVA 2ZJPQ 4YOEA 1LWCA 1QM9A 3NMRA 4RW6B 3M05A 2C3OA 5ETQA 1S6PA 1J5OB 5KTQA 3GG0A 1FVSA 1WOPA 2DHXA 5A2QU 3OQ2A 4NRTA 4EBCA 4UZBA 2XG8A 1C2PA 3BKUA 3I0RA 4JOUA 3H42A 1ZM4A 2DPJA 1U2CA 4W90B 1OPIA 4DXLA 1UEKA 5HJXA 1LWFA 2BX6A 2KG1A 2PC6A 3RAXA 4ES1A 4FP9A 3KHGA 3A3PB 1SJRA 1V9OA 3DXBA 3DFEA 4RW7A 3CMQA 3QRRA 2VIHA 2W8KA 3V6JA 3H2LA 2MZRA 2E44A 4NEZA 2DNHA 4LF4F 3B8HA 2QJ3A 3SI8A 1A7GE 4Z2XA 4HH1A 3I5BA 2AJ0A 3S8SA 4QR0A 1SL2A 3THVA 3DRPB 2GMLA 4PEOA 5L1JA 5A8KA 3L7PA 3CUNA 3NWRA 3CULA 5MLCV 3C14A 1G4CA 5K20B 2AMCB 3Q2TC 1UA1A 5D15A 4CO4A 1NSAA 4XDDA 3CD6S 2WONB 1IWGA 3AJDA 5K8MA 1VMBA 5HBMB 2X7IA 2PI5A 1EZZB 3KKFA 3MM6B 4TN2A 4DV6F 1QAIA 4Y2CA 2DYAA 1C0UA 3MEKA 1I1GA 3C19A 4DUZJ 3VTIA 1VISA 3CD7A 3JYTB 3CJSA 1P1TA 1K0TA 3D67A 1HWLA 2QO3A 4DU8A 2P9CA 2A2DA 2JEIA 2E5HA 2PA3A 4NLWA 3PRDA 1VQ9S 2FC9A 2FDNA 5I42A 2IAJA 2R8GA 1N36F 4QZVB 1GMUA 6FD1A 4QW9A 1UZDA 3MMBA 3ZZ0A 1U2RA 4FF4A 3AQOA 1F5BA 1CEZA 3KNAA 2FQQB 4ZIWA 1TUVA 5AXMA 3OJUA 3CXCR 2MKSA 5DJBA 3MEEA 1X4DA 2HQ3A 3BGRB 3H5XA 2VHGA 2BR0A 2RAQA 4NXMJ 5HMXA 1JJ4A 4OYZA 2FB0A 3CJTA 2CG4A 5HANA 4ECYA 1J2VA 2CPFA 5B0DA 5B0AA 5F8HA 2XSJB 3GWCA 4QWAA 3Q23A 1ELOA 2UUBF 4C7QA 4ID5A 5HROA 1VGYA 3CGIA 2CJKA 4WP8A 1WOSA 2BRLA 4QYZJ 4DV0F 3R27A 3KLGA 2H48B 4DL7A 3TOQA 4X62F 4PXBA 1VRQC 1RBOB 4JI5J 2ZH6A 4LFAF 4K0KJ 3BBBA 4JI7J 2ADCA 4P71A 1U24A 3T1YJ 4DFKA 2HRTA 3ZZZA 2W2PP 2WTFA 5L8RC 3KXDA 3BGFA 2CAJA 2P6TA 1NPPA 1UJ5A 2KYXA 3HM9A 4FS1A 2IMOA 3ENWA 3QT5A 5T7LA 3NBPA 5LJ5Y 3M8SA 1UVLA 3IP0A 1XIQA 4IOBA 5DM7Q 4E98A 3ZFVA 2IC3B 2BV3A 2MQMA 3OVAA 2VBXA 3OFFA 2VODA 2QRRA 4C8NA 4DPYA 3IO1A 2YWWA 2LFVA 1FA0A 4KC5A 1VYAA 3D9BA 4QIWD 4LF6F
chains in the Genus database with same CATH topology
3CPWR 2YX7A 4OZNA 2HVIA 1S49A 4ZP9A 4EYIB 2PMHA 4DSEA 4DFPA 1D0EA 1R8PA 4DV4F 4Y34A 4DL5A 2CDQA 3IA0A 4ID8A 2YKPA 4KKOB 1YQHA 5KG7A 4PXEA 5J1EA 3RZAA 1DAXA 3TAMB 4FNIA 3E01B 3G6ES 5DDQC 1JIHA 4DR5F 1L5UA 2DNMA 2G4BA 1Y3KA 1SV5B 1FDAA 2A10A 3C8YA 5DM6Q 2VUGA 2Z8QA 3JTOA 2J9DA 5FIIA 2C2EA 1Q78A 5DDPC 1VIXA 4G6VB 2PT0A 2PA8D 4ED0A 4BCAA 4WFNQ 3M4XA 3H20A 3LP2A 4CO3A 2Z4PA 1FJ7A 5JJBA 3H2UB 4CTAA 2VA3A 3C66A 3CEDA 2K3IA 1OS5A 3DLGB 1O8BA 3MM9A 2YH0A 1KFDA 3CO9A 5K8PA 3UQSA 2BANB 1G2EA 2B0GA 1TVRA 2LDIA 4NCAA 3ETOA 4ZMMA 1U45A 4B3RF 4C9DA 2IBOA 2FTRA 4F67A 1JLAA 4ZDNA 1IKYB 1TP7A 1S1TA 2GCFA 1KLNA 3GFHA 2HHQA 2BOPA 2CPHA 4NXNF 2YNIA 4I2QA 5AE1A 4O23A 4EEYA 3F44A 5GAEI 4FF1A 5M2PA 1T95A 1R0AB 3H4BA 3GE9A 4CI0B 2MYFA 3LAMA 5J2MB 3NNAA 3G8TA 4TYBA 4D3GA 5CYQA 3TW0A 1UVJA 1U7LA 2K2PA 2N4CA 3HVTA 3MPVA 3V6HA 3CCJS 1DJ0A 2F3JA 4DQSA 4LUBA 2V4JB 5KG4A 3QJPA 2O3DA 4YFUA 3TAQA 3IGVA 4ETZA 2CQHA 2BABA 2NUUG 4ECRA 1D9DA 3LH2S 1G1XA 3U02A 3GV8B 1FXDA 5IWAF 3CJ3A 4ECSA 1RYRA 1VBZA 5AXNA 1VQNS 2OD6A 1FCAA 1RT5B 4LSLA 5IZHA 5J2QA 2HQIA 5MAOA 2ZD1B 4A48A 4DN9A 2MHNA 2KFZA 4DR7F 1LFWA 2G9OA 2Z2LA 5KFTA 3M1VB 1DQAA 1N5SA 3BR9A 4KHRA 2EBEA 4QWBA 1VRUA 4ZA1A 4C8YA 2GNKA 2ZZNA 4QIFA 2DR7A 4DR3F 4L3NA 3E8OA 1T3NA 5KFYA 4IG0B 1GAOA 4PQUA 2W4PA 2UUTA 2UXCF 3AHPA 1FRHA 3KLVA 3EZUA 3QO9A 3OL8A 1M5HA 3CJKA 3BQ0A 4C11A 5T41A 4N47A 2OPRB 4OX7A 1UWBB 2KKHA 1UEVA 2B5JA 3KLHB 4DSKA 2RRAA 2VOPA 2XY6A 1ZYQA 4A8SA 3FDSA 5LSOA 4RWXA 2FHKA 4FNHA 3TRGA 1FTCA 1RTJA 2KHDA 4H4MB 4FBTA 4PG6A 2EFGA 1WEYA 4W92B 2XZWA 2XWYA 2WOMB 3GZ7A 3JSRA 2DNGA 5F8MA 4BS2A 4MFBB 3M2UA 2R4FA 2EI5A 5GADI 1OO0B 1VQ4S 2XMWA 2JFKA 1N5QA 2AJ1A 3GYNA 3PJXA 1REVB 1LW0A 2D41A 4IQMA 1TKXA 1F2GA 4OIXA 2JH3A 4F4KA 4DR2F 3H98A 2YWGA 3SXLA 4WKYA 2IVMA 3TARA 1ZTTA 3NAHA 1GTEA 1UVMA 3HKZD 2EW9A 2VFRA 3HJFA 2ZC3A 3KLFA 3N79A 4C4WA 4X2BA 2VH7A 3UW1A 5ADZA 4IRCA 2HYIB 4IH7A 2YQ3A 3KK2A 2DNLA 4YB6A 2MZQA 4X4VA 3PY8A 3MZIA 2DNQA 3EGWB 4DL2A 2VBZA 1U8SA 1FDBA 4Q43A 3HVWA 4RBTA 4WFBQ 3HK2A 2JLGA 4I6AA 1QAJA 3KLEB 3BF4A 2HGLA 5HLFB 2ALZA 1I94F 2Q3PA 2RVJA 1FJCA 2WSCC 2BZ2A 3UDLA 2HAIA 2R2UA 5I3UA 3M30B 4A4JA 1S97A 4AL6A 2HMIA 2QIFA 3FNNA 4Y2AA 4M95A 4ED1A 2R8IA 1XNQF 4WE1B 2KXFA 2DITA 2HNZB 4P2SA 3R1HA 2Q43A 1RT1B 4I2PB 4QR2A 2JJ4D 3DM2B 4UOCA 5KFXA 2E9RX 4RW8A 3MFIA 5IM0B 3QWUA 3CCRS 2W9AA 2XO7A 1Z4UA 2YNGB 1UAWA 2OPQA 3DLJA 3LUYA 4ES2A 1WNEA 1P8GA 2DVIA 1PSDA 4OLPA 3V6KA 3K57A 2D3OR 1QUVA 3FMBA 1NK5A 4CNYA 4ED3A 5KOXA 4B3OB 1SQEA 2L08A 1N56A 2DGOA 2LVWA 4FN5A 1IKWB 2QA4G 4DPOA 4OZ0A 1VFJA 1FJGF 2YKAA 1IBKF 3QZ8A 4I0WA 4RBVA 4YDXA 3VQTA 1KQFB 5K14B 2FJWA 2G0CA 4I69A 1U1MA 4DQIA 1HPZA 3POTA 3HMJG 2XGPA 3X3UA 1SJ3P 3HT3A 3B4DA 2DD8S 4DFMA 4DUYF 5D3GA 2KT5A 1HQEB 3S7RA 1M5SA 2J9DE 5C24A 1VQ8S 5IS2A 1Q53A 2J6UA 4YR3A 1SJFA 2OMLA 2KN4A 3NS6A 1RT4A 1X4FA 4EO6A 5KFLA 4MK9A 1Q16B 4QQBA 4DL4A 2IM3A 2HWTA 2I2YA 2V2KA 2RKIA 4M63A 1V3SA 4WZQA 3KK1B 2ILZA 2RRNA 2ZHBA 2I8EA 4J9KA 3SV3A 4UY85 2BA9A 4NLGA 2D7SA 5CH7B 4KO0A 1GX6A 3THTA 3K0JA 3Q2SC 3EPGA 1A6LA 3NG8A 3TVKA 3IG1A 3TUIC 3M6XA 2DNPA 3OL6A 3MEGB 4GKJF 3G8SA 1JB0C 2M52A 1X4BA 5BJRA 4AYBD 1FXRA 3D0IE 1Z2LA 3F41A 1XMQF 2OPPB 3M2UB 4ED7A 2IMWP 2M88A 3MD3A 1ZZFA 2RQKA 1U1LA 2QZ8A 4X4OA 2W8LA 1YTYA 4LT6A 1KONA 1FE4A 1HBUB 4MH8A 1BQNB 1HQUA 3THPA 2FJVA 2PDAA 4O44B 2KI2A 4IFVB 4WFYA 3MUTP 1V3RA 5KFPA 5EWEA 4DQRA 2R7VA 5A6WA 4OX9F 5F9NA 3Q8PB 4ZOSA 1S1WA 2CQ3A 3GYXB 3H8YA 2A1BA 1C4AA 1ZM3A 4MKAA 2KZMA 2R7SA 3HHLD 1X0FA 3KLFB 4D3HA 1N54B 1B0TA 4OJ1A 4O0IA 2AJFE 1KEKA 2HRUA 3QLHA 1S9GB 1QVGR 4K4UA 1N0UA 3BM7A 1WI8A 3N5FA 4F8RA 2KFNA 4O3RA 4PG5A 4WFXA 2B9YA 3N0VA 1U09A 4F25A 4K4WA 2M4MA 2GA7A 5E33A 5FLXY 3QJLA 1URRA 2B7CB 3DRXA 3OR2B 3ULHA 4QW8A 1HBOA 1SIWB 1FXLA 1JLQA 4DUZF 1U48A 5HI7A 1TK8A 4C8MA 2NYIA 4B9UA 2XB2D 2HWHA 4OX8A 3VAFA 2C3UA 3QMQA 5B0BA 1NKEA 3DU6A 1JLEA 4V19J 2C2RA 2JC0A 3OLAA 4L72B 4HT7A 3KMSA 3SV4A 4IO9Q 3MEDB 1NJWA 1I6JA 3IFEA 1E6VB 4ITSA 5KFZA 4OI6A 2AQ4A 4DL0C 3J80Y 5F8NA 4ALZA 3DYAA 1EETA 2K1RB 2L3MA 3B78A 3L3CA 1XR6A 2A18A 3NNCA 3RR7A 3MMCA 2N7CA 3OVBA 4AQYF 4ED5A 4NCGA 5A8RB 3EX7B 4QU6A 2RNEA 2EKYA 1VQOS 2BUNA 3S6EA 1R8AA 3KG4A 4OLOA 3KOAA 1XEZA 4NLVA 1S99A 1R8CA 4NZ0A 4P7TA 4LQ3A 4ZVEA 3KFWX 3RB6A 2ZDPA 4B17A 1T3OA 3BSCA 3DHXA 3LP1B 1S6UA 3BR8A 5DG8A 2ZJRQ 1Y4ZB 4CO5A 2IRXA 4G1PA 4RLEA 3JTPA 4X84A 1ZAXA 4LIWA 2VONA 2DO4A 2DB1A 3Q8QB 2V0NA 2M9KA 3HKWA 3QIDA 1LK7A 2ZNYA 1LWCB 2QLWA 5B0GA 1Y5LB 4Q8EA 4OZLA 4EUVA 4Y0FA 4BBYA 1TKTB 2MQQA 1H2TZ 2GQ2A 1ZH5A 1S6PB 1HMVB 3AQPA 1KVIA 7FDRA 3H5YA 2RRBA 2YY3A 5DDOC 4F26A 2XS7A 1FKPA 2UU9F 1LW2A 2GHPA 2E1RA 2RE1A 4DL6A 2V8HA 3OUYA 3DC2A 1R31A 4FXDA 2E29A 5F8JA 2CJAA 4LJMA 2KB2A 2RD5C 1TL3A 3QGHA 1C1BA 4NXMF 1GNKA 1RWUA 4KHPF 2Q66A 1KQGB 2UXBF 3PX0A 2B3TB 1GQEA 1RTDB 2DCUB 1H0HB 3QGIA 4OZ1A 2VG7A 1IQTA 3FJ2A 2COLA 3I0RB 3V4IA 1FEHA 2VPWB 3MGJA 1FESA 2LA4A 3KLIA 4ELUA 5KFKA 4I6YA 4KV8A 1YJRA 2B4OA 1SIZA 1Z1ZA 5KFBA 5LMUF 1YWXA 2W9BB 1U1QA 2CZVC 3PX4A 4CCHA 2V4RA 1KVJA 2DH9A 1GH8A 3MUMP 5EN1A 1LWFB 3P49B 3FRYA 3OFHA 3NCPA 2MZJA 2Q79A 1LFPA 1FNOA 2MGZB 4C97A 4MYTA 3PR4A 1GTHA 2AD9A 1DZ5A 1F60B 2LMIA 2F40A 2VKRA 4FPRA 4RW7B 5L38A 4QWCA 4JI1F 1MU2A 1HBOB 2YVSA 1JLQB 2LA6A 1IJEB 1DLOA 4G1IA 4M8LA 2ZH1A 3VALA 3GFXA 1R27B 1HI0P 4NYZA 4XDCA 3PZPA 2UV8G 1HNIA 4AL5A 2OD4A 2PI4A 5KFWA 2MJUA 5C25B 4JI5F 5CYMB 2DNNA 3KHLA 4H4KA 1ZETA 1HHSA 4K0KF 1FRIA 3P5TL 3WZ0A 1NRKA 1YSJA 4NZ7A 3KHHA 3VAHA 4JI7F 2P9GA 3SCJE 4G1QA 1O5JA 3CDUA 4NZ6A 3DLBA 3AB4B 2D1CA 2VASA 5KG5A 4TU8A 2Y1IA 1QAYA 2BM0A 1U49A 1D8ZA 3SFUA 3T1YF 2FLPA 4OI4A 1X5OA 2O1PA 4DFJA 2EK1A 3LW5C 4C8KA 1O0PA 2YKMB 3H4DA 1Q81T 2J0QD 1MWYA 3IR6B 1DURA 1WF1A 3CWJA 5KOWA 1NB7A 1X9SA 4CH1A 2O66A 3O6QA 5DG9A 4FF2A 3DMJB 4K4VA 3UNGC 3FCHA 4PWDB 2X1GA 1UJ4A 3G96A 2HNDA 3SCIE 5GAEU 4U7CA 4QR1A 4YQWA 2RIJA 3IRWP 3BO2A 1QAXA 1NHVA 2WB4A 2DIVA 2J7KA 5CYJA 1IR0A 2C42A 2W7OA 4G3IA 1CLFA 5GAHI 4HI1A 4ILLA 1ZAWA 2IM2A 4ECWA 1S9EA 3V81A 3RB4A 4PR6A 5BR8F 4EYHB 3PFEA 4KQZA 2J7WA 1RKJA 2HPUA 3W3SA 2DGXA 2W9CA 1Y9OA 1WACA 3QIPA 1MMLA 4DJBA 3RR8A 1KHVA 5F8LA 4AXJA 4Q44A 1D3WA 4JBCA 4ED8A 2ZOGA 3CD0A 4ECZA 1S7HA 2OAUA 2OP5A 1T8EA 4TLQA 1S1UB 3CDBA 1NJIT 4MYUA 1GX5A 2M5YA 4EFAC 2CJBA 3CIMA 3PHEA 3K5NA 1C0UB 3B4MA 3KG1A 1JNRB 1JLCA 1NH7A 4K4YA 1W2BR 2QEXS 1NJXA 3DN9A 2E5IA 2WB1D 2I38A 4J9QA 2G1DA 2NUHA 3IS9A 3DOLB 1FE0A 4ICLA 3MM5B 2MKJA 1DBDA 2R7UA 3PM9A 2FJDB 4WK3A 4USHA 2OKQA 3LP0B 4C0BA 4IFYB 4WK1A 2OIHA 1U6ZA 4C0OC 2D3UA 1FNMA 1BY9A 1C0TA 1LK5A 1VQSA 4HT5A 3D1OA 5A0YA 4NA1A 3PW7A 3PEJA 4YB1P 1YRXA 3DRYA 2HHWA 2KFYA 2AJ4A 1X4GA 3CC4S 1TK0A 2W25A 4NLYA 3LGNA 2BQRA 2E7XA 2KU7A 3MR6A 3MPWA 1YJUA 3O3LA 1JXEA 2QA2A 1KQKA 1Q8LA 3QAEA 2DISA 5I42B 2NREA 2UVRA 1KLMA 4A8WA 5GADU 2ROEA 2IAJB 4RNMA 2NLWA 3VCDA 3VAKA 2XY5A 4XPCA 1RK8A 2EK6A 4IG3A 3UPFA 4J5OA 2YKNB 4ELTA 2J76E 3MECA 3MMBB 3CIZA 4C0HA 2CKWA 3AH6A 4CQ1A 1DTTB 1QY7A 4QBUA 2DGQA 2VG5A 3F56A 3VAGA 5THWA 2KT3A 3D54A 3ITHB 4TKTA 3AA9A 5DRKA 4F2RA 3OR1A 3WX4A 5B09A 1Y5IB 4RNNA 2KH9A 1N34F 5IFMA 3X1LB 2B4PA 1RGVA 4DF4A 2Y1JA 3R5AA 3EXYA 3M2VA 4HVZA 4ZCIA 5CCLA 1TV6B 3OPKA 4X4UA 3FFIA 1SUQA 1YITS 3SCLE 4N8OA 1LXNA 2M2BA 3MEEB 3TNVA 2MQNA 2YNFA 3NKYA 2RU9A 4TNOA 4G1QB 1E6YB 5KT5A 3FSIA 3C3LA 2AYMA 3BSAA 1JLFA 2ZZMA 1YJTA 4WIIA 4RUAA 4HTJA 4ZHRA 1TKZB 2ZE2B 2L48A 4LSNA 4X64F 2HHUA 5IT0A 3P3DA 2Q1LA 4I67A 4B08A 2R8HA 3UR3C 1P9QC 2XLJA 5DGBA 1F5CA 5EX0A 4C3LA 3C6TA 4A46A 4C8LA 5LMNF 4NYOA 2XCPA 3GIMA 1N5YB 4ZPVR 2LEPA 5L1KA 1L3UA 1DTQA 1V3ZA 1Q79A 1FRMA 2PE8A 4QJVA 4USJC 3D0GE 3RTVA 2E9ZA 3UI3A 5G0RA 4CZCA 2RF2B 1PC5A 4KBIA 3CC2S 4PG7A 1XWLA 1K0VA 2O67A 5HP1A 3DRSA 1S9EB 4DSLA 4PXCA 4Q2LA 2VG6B 4TQSA 2BQ3A 2FLLA 4J9LA 1HARA 5K8NA 1JJ2R 4EU0A 5CCMA 1W2IA 2MB0B 3IAM9 3SYZA 2FVRA 1WG1A 4FXVA 4I7FB 1YGYA 2VA2A 4ID5B 5HROB 4A8FA 3K5LA 4LIRA 2GO9A 1W25A 1NK8A 1U1PA 4XIUA 1XBWA 1NKCA 4QOTA 4PUOA 1FF2A