3EDQB

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
b'KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
total genus 20
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3edqB00
1PYOB 2P2CB 2H51B 3GJSB 2H5IB 5K20B 3KJQB 2XZTB 1BMQB 1RWXB 2QL5B 1SC4B 2H4YB 3EDQB 2CNOB 1F9EB 1GFWB 1RHRB 1QTNB 2CNNB 1RHKB 4ZVQB 3RJMB 2H54B 4ZVRB 2CNKB 2HBYB 2XYPB 2HBZB 3R7SB 5IC4B 3GJQB 3R6LB 3R7NB 2QLJB 2Y0BB 1PAUB 1ICEB 2HBQB 2C2ZB 1QDUB 3GJRB 2CJYB 2H48B 3QNWB 3P4UB 4DCPB 3P45B 2C2OB 2CDRB 4ZVOB 2XZDB 1RWWB 4ZVPB 4LSZB 3D6FB 1RWMB 3IBCB 1NMEB 2CJXB 2CNLB 2QL9B 3KJNB 3GJTB 2H5JB 1I3OB 2C2MB 3KJFB 3D6MB 1RWNB 2QLBB 2C2KB 2H65B 1RHMB 1SC1B 1RWPB 4JB8B 2H4WB 2QL7B 5IC6B 4DCJB 2FQQB 1RHQB 1RE1B 1RWKB 4ZVSB 3EDRB 1RWVB 4ZVUB 2XYHB 3R5JB 2QLFB 1I51B 3NS7B 1RHJB 2HBRB 3IBFB 1IBCB 1SC3B 1RWOB 2C1EB 4ZVTB 2XYGB 4DCOB 3SIPB 1RHUB 3D6HB 3R6GB 2DKOB 3R7BB 2Y1LB
chains in the Genus database with same CATH superfamily
5A0YA 4KV8B 4J9OA 4ED7A 4IH5A 5KG2A 1U1NA 3PO5A 2QRRA 2YTCA 2RU3A 2VG6A 3VALA 4NRUA 4M5LA 3OXGA 3LTOA 2JH3A 3K58A 1HR0J 3QRPA 3IMQJ 4NA2A 4XO0A 4A8KA 1Q7LB 2C3YA 2HURA 5GMEA 5EWGA 4PG6A 1NJIT 4RBVA 5CYMA 1LWCA 1RKJA 5KT2A 2DNZA 1O8BA 4C8YA 2HWHA 2DYAA 1RHRB 5F9NA 1QTNB 3RUBL 4DLGA 4LSLB 4ID8A 1DQAA 2B7BB 2VB6A 3W60A 3CIZA 3C8YA 2GA7A 3DYAB 3US5A 4ZLNA 4Y65A 5HI7A 3M9NB 4LJMA 2L3MA 4X64J 1VRTB 4Q8FA 1X4FA 2BJ1A 2J8AA 3I5BA 4F26A 3BEGB 3CJQA 2E1CA 2JEIA 2WVFA 1O0PA 4Q0BB 2G2ZA 4OYIA 1S72S 1H0HB 3W66A 2JDJA 4K0KF 5F8LA 3VAGA 3TI0A 2L9DA 3G2XA 2IMOA 4JV5J 4I68A 4WP8A 5C2GA 1QD1A 3MD3A 1S1XB 1YJWS 4ERDA 4ZMMA 5HVFA 4I0WA 2GMHA 1ICEB 1NAQA 2VFVA 1QVGR 1KNZA 2QN6B 4LRBA 3CNQP 4N56A 3GV7B 2OH2A 1FDAA 4PQAA 2HQ3A 3MEDA 4IG3B 3FSIA 4DQIA 1FJGF 1HI8A 2F3JA 3TAMB 3C2PA 2L9NA 1WELA 2WSEC 2GX8A 1MW7A 4P71A 4FYWB 3EPIA 3QJJA 1DTTA 4XPEA 2IRUA 1U1LA 2GHPA 5T41A 2LEBA 1N4LA 1TKTA 5KG0A 2RKIA 4UY8T 5F8NA 3PJ9A 3ZO7A 5L1JA 4DR5F 1Y11A 3OW2R 4FDFA 4M94A 3HVAA 1R31A 2XNRA 1NHVA 3VHQA 2A6OA 2X3DA 1KQFB 3MR6A 2BANB 1YSJA 3P5TL 4Y00A 3IP0A 4KKOA 4A8XA 4CT9A 2IFXA 4IFYA 1KOOA 4URSA 3JSMA 1OYDA 4V19X 3HZGA 1KFDA 2LECA 1CS4B 1UZDA 5DDRC 4DFJA 3I96A 3RYLA 3QO9A 4K4SA 4CDIA 1VCTA 1AYEA 4USTA 2JWNA 1HQ2A 2NYHA 4LR7A 5D4LA 2NS1B 4J9VA 4KAIA 5H1SV 2IPOB 2CJKA 2ZH5A 3T5HA 2CUYA 5L1IA 1RYRA 4X4NA 3MEGA 3BV8A 5THWA 2CPHA 1YJRA 1IBLF 1OY9A 2CVEA 4QIWD 1SC1B 2KHCA 3HJVA 2KFYA 4IG0B 1IWAA 2V2QA 3GTYX 2AGPA 1HNZJ 3KK2B 1M5HA 4PAAA 3H4DA 4DR3F 4ED1A 2X1BA 2Y1RI 5HQMA 3H40A 5ETQA 2NCKL 3QLHA 2W7OA 4JI1F 2Y0SD 4YEAA 3TR5A 3K17A 1XR6A 4DV0F 2FD2A 1RE1B 3ISND 1RK8A 1SV5A 2OO4A 4F3MA 1YX2A 1IKYB 3AD7C 2HLTA 2KJVA 4M5DB 4O3PA 4RW8A 3OL9A 3MAQA 3Q83A 1VBZA 3MM5B 3GV5B 3EGNA 3Q8QB 4NEZA 2HSEB 3PYDA 2DNQA 3EUNA 2LA6A 2ROPA 2AZ1A 2ZKUA 4ITSA 3T9ZA 1PGZA 2XS2A 2HBRB 3MMAB 2GQQA 2B9WA 4OX9J 2LU1A 2YBVA 2WAQD 5G0RB 1RZMA 3CCTA 3LANA 4YB6A 2VA3A 2NUHA 1EJ7L 4ECQA 1VQSA 2RH3A 2MQPA 1PC5A 1QE1B 5B08A 2FDNA 4X62F 1FRXA 2MZTA 1IKVA 5CAAA 1O51A 2AJ2A 3V4IB 3GCXP 4OYXA 1JJHA 3KK3B 2FPHX 2QA4S 4OI3A 5L1KA 1SKSA 1LOUA 3D2WA 3QATA 1U26A 1R27B 4CYUB 1LEOA 2CPEA 4DV1J 4X66J 1RI7A 1GAOA 3JTNA 2C22A 2KL8A 3A8JA 4ZHRB 4EYIB 2B5JB 1TU0B 2QE5A 2NQPA 1X4DA 4JI8J 2MLXA 4FF1A 2PIIA 3DM2B 4DUYJ 2EBEA 5E5NA 2HFZA 1JQGA 3FUYA 3NWGA 2X1FA 1CLFA 2C3MA 1VYAA 2EPIA 4M5GA 5J1PA 2GZOA 3A4TA 1SPBP 2BANA 4FF2A 4FN5A 2GIRA 2PFFB 2ACYA 4BLGA 2UP1A 2LQBA 4F04B 1I5OB 5T14A 2VU5A 2W7PA 4NRTA 5C2CA 1UW9A 2CQGA 4NYOA 4RNMA 4PABA 2JVOA 4RW4B 4RR5A 4ED8A 4I2PA 2XSJA 3BPSP 3RB4A 1AB8A 1D09B 2DGXA 4CYUA 4Z2XA 5K8OA 5DM7Q 1KS2A 2HBQB 4L74A 1TQLA 2J0WA 4USUA 4DSFA 3X1LB 5IT9U 1Q5YA 4AD6A 1N0VC 2GJFA 3PNIA 2R2TA 1YI2S 4KR0B 1ZZNA 3H2UB 1UZHA 1VJWA 4CWBA 1F60B 1UWBB 2HZCA 3BSCA 3UN3A 2IBKA 1RT5B 3NKYA 1C2PA 3IS9B 5BYQA 4QWEA 3G82A 1UEUA 5MLCV 1VQ5S 2DRBA 1WHVA 2DR6A 3QLHB 3K5OA 2R8HA 3DLJA 4I6WA 2BBEA 2ALYB 4M5HA 3ONQA 2BEFA 2J0QD 4QU7A 5GAHI 1JLEA 1FDBA 2FVRA 1B0VA 4NMLA 2LQ8A 4HTIA 5HVGA 3EM1A 1U1QA 5D8HB 1EP4B 3SEOA 1IKYA 1TUGB 2F8HA 4QPTA 1HD0A 1S1WB 2UUWA 3F56A 1NDCA 3G71S 5CQGA 1XMOF 3GJTB 2XI3A 3HX9A 2DVIA 4USJC 1QTMA 1UTAA 2MZSA 3TP2A 3EGZA 2HHHJ 5D15A 2OMLA 6FD1A 2QYCA 4F0MA 2DGUA 2YKAA 2X1AA 5DS7A 3JAMU 4OX9F 4DEZA 4DL5A 2ATCB 3EE3A 2A10A 4KKOB 3NAHA 2BM0A 2OEKA 3FVYA 3H7HB 4CO3A 4DV1F 3DLKA 4RW4A 2H65B 3MMBB 2B9XA 5B7WA 3I87A 2RJZA 2DH9A 4MK8A 2KH9A 2UZAA 3GE9A 1YBTA 1V5IB 2CPFA 5D4OA 2YWHA 1FEHA 2R7XA 5JVGQ 3R1HA 4K2XA 3GIMA 3AJDA 3DNCA 2GVDB 4JI1J 1RT2A 1UWAA 2XCAA 1JWWA 3GR1A 2FGOA 4WK3A 2E5LJ 1U02A 1RWKB 2D3ZA 1RISA 4I6AA 3Q8VA 1W2BR 1HPZB 2WCXA 4MKYA 3FBCA 3N5FA 2NXCA 2VG7A 5B0BA 4TU8A 4ECYA 2OPSB 1RHJB 2PO4A 1AXQA 1S6OA 2OSQA 4DSEA 3CD5A 1XMQJ 3CD0A 3AY0A 4PYAA 4CLSA 4ZLPA 2D7SA 2ZD1A 3M2VB 5ITHA 2R7TA 3K57A 2VQEF 1U49A 1N56A 3HVRA 1R0CB 2BKNA 1HNVA 2B7CB 1YJTA 4CLFA 2BX6A 1RHUB 3NNCA 2DHXA 1XN9A 2V4JA 2C3UA 5EN1A 3BYRA 3N01A 3DLGA 1S12A 2E1MC 3CSKA 5SUHA 2IA0A 4XIUA 1IUJA 4Q0BA 1WC4A 3KWMA 3M9MB 4DX8H 1NZAA 2E44A 3TUZC 4LREA 5CYQB 2XO7A 2IM2A 4FVCA 1HQUB 3DRPA 2YKNA 4I7FB 5ETPA 4IDKB 5GVQA 4XAKA 2QG9B 3KLEB 4OZJA 2HQIA 1EP4A 1B99A 1OMSA 2DR8A 2HQDA 2NSBA 2Z4PA 4CTAA 4C11A 2GNKA 3R5CA 1IM6A 7AT1B 2GQCA 3CCES 4DR7F 1GH8A 5HBMB 2OTLS 2UVRA 2KG1A 2HLUA 4PG4A 4X62J 4OV6A 4M5JA 4ZVQB 2F8EX 4R0EA 4ED0A 3W3SA 3KLVA 3GG0A 2U1AA 1NK0A 2MYFA 2R7SA 2M9KA 3GJQB 1H2VZ 3MF5A 1ITPA 2OKQA 1R3NA 1T3OA 2HQGA 1RACB 5LJ5Y 3NOGA 1S59A 4LF5F 1NPPA 4ALZA 4ZIWA 4JI5J 3DU5A 1FEEA 1UEVA 3MEGB 1WKJA 4ZCKA 3GFXA 3QRQA 1F3VA 4C2MA 1YLXA 4Y2KA 3E51A 1NPRA 3EPGA 3N0VA 3OHAA 1ROFA 1K1SA 2ROGA 1FXRA 1NK8A 1V6HA 1RT7A 2J9EA 5LL6d 5F9LA 1CS4A 1C0TB 2MY7A 4X64F 2UXBF 1R6VA 1U6ZA 1XQIA 1FXLA 1CJUB 3MMJA 2ZWOA 1OQ6A 1EHWA 4J9KA 5EUHA 1LQ9A 2V2VA 4DV5J 2FZCB 4P7VA 4WWSA 3DLHA 1IBLJ 4HYKA 5DQIA 5DO2A 4ZVOB 1U1KA 3N28A 3H59A 1UMJA 1W25A 4TKTA 3GLJA 5KFQA 2E9TA 1VHIA 2JLGA 2VPYB 3D6FB 3SFGA 3PRBA 3FCWA 1FNXH 2FGCA 3MEEA 2ZJPQ 5FLXY 1WI8A 4GO7X 1NH8A 3FMWA 1DQ9A 3NGRA 3ZZYA 1HL6A 5I3PA 2OIHA 4JP8A 3B54A 4BWMA 1VBXA 3DOLA 1UVLA 1NSPA 2RNEA 3W8GA 3BN4A 1YQHA 1HWIA 3NMAA 2BE9B 2EEYA 1G4CA 1YG0A 3E8OA 3PEJA 5ETNA 3CCLS 2XY7A 1C1CB 3Q2TC 5KFUA 2W7AA 2C2KB 1OSDA 2OPRB 2VPWB 4OYZA 2EK6A 4R25A 1WHYA 2IYGA 1UVMA 4K2JA 4DV7J 1UFLA 3E01A 5E2QA 3AODA 1OY8A 3GWCA 1Y00A 4QPXA 2COLA 3KDOA 1UVNA 4DQRA 1FO1A 2DRDA 2F40A 3ZNJ1 5IM0B 3D3BJ 3M6UA 1EIYB 4TY8B 2ZC3A 3B78A 3RBZA 1C1BB 3JB9k 4JI6J 5DRKA 3CCRS 3CC7S 2Z30B 2JNJA 2XYHB 1EQMA 1ELOA 1FK9B 1U0HB 3H20A 2HRUA 1UEKA 3LUYA 3NS7B 3R5JB 4K8RA 4MFBA 5L38A 3J81Y 3I0RB 2NREA 3HHEA 1VK8A 2HZAA 3I4HX 5KG4A 4MJKA 3QQCD 4X65F 4GMKA 2HZVA 1IBCB 3SQGB 3M1VB 4CM0A 4YDXA 1IR2A 2B9EA 1KSPA 2DXFA 4G6VB 2CQ2A 5HK4A 5M2RA 2W9BB 4G3IA 2NR0A 1SB6A 3WX4A 4K4UA 3WIVA 3CEDA 2H1YA 3ETOA 2VJVA 3CULA 1XMBA 4EO8A 2P2CB 1RT7B 3GFHA 2AU0A 4BS2A 5A6WA 1N36J 1LXNA 4KHRA 2RQ4A 2EFVA 1FA0A 2YWGA 2ZFHA 1Q81T 4KGXB 4YQWA 2GJIA 5DLFA 3MPWA 5C7PA 4JI3J 3LP0A 1TV6B 5HLFB 2XSJB 4LF9F 1RWXB 2HNZB 2G4BA 4EK2A 1BY9A 3B8HA 5KFFA 1IVZA 4FYXB 1KDNA 1WEZA 1WG1A 3MGJA 2FHKA 3J81j 1BHNA 1UKUA 2B8QA 3DMJA 1FKPA 4PXBA 4U96A 5A0YB 2UUCJ 1TKTB 3D66A 1VLOA 2CZ9A 5J2QA 1N5YA 2M88A 4TYAA 3MMCA 3PW0A 1NK7A 2WSCC 4KGZB 3T3FA 2F4VF 2XTJP 3NGKA 2HBYB 2DBBA 2QYGA 3FSYA 4KFBA 1MWQA 2O3DA 3O44A 4DPOA 3TAMA 1HHSA 1VIXA 2FY8A 2FVCA 3IA0A 3R27A 1YRTA 2Y1IA 2HVHA 2KFNA 3V81A 2XMJA 2A2CA 1T9UA 2BA9A 2AEMA 3UDVA 5HQ8A 5IXUA 2XGPA 3C46A 2O67A 1WSVA 2VFUA 3V2UC 1L5UA 1BLUA 3M2RB 3L7UA 4ZCIA 1FESA 1WJ9A 5IQ6A 4RW9B 3J80Y 1HW9A 2A18A 3UW1A 1RTHA 4RNNA 3KNAA 9RUBA 1D0EA 4BC7A 4K4ZA 3IRWP 1RBLA 3CJ2A 4FXDA 3I4PA 3PFEA 1GXUA 3KXDA 4C98A 1J27A 3QMQA 3GIJA 3SYZA 4ELUA 4CLTA 1ZOTA 2JEGA 3A12A 3GP9A 1HMVB 2OPPA 4HVZA 3DYAA 4PXEA 2N7CA 4DUTA 1TMMA 4LSLA 4C3KA 3M8RA 3FCHA 1X5OA 2RUGA 3SMZA 3TZWA 3U7JA 2DNMA 1NMEB 2CWXA 3OL6A 3CCWA 3EZOA 1N6QA 3FK4A 3S01A 1RAEB 2XY5A 3BQ1A 2B56A 5L1LA 4FPRA 1X5TA 1N5YB 5AXLA 3VAFA 5D0HA 3EVWA 1X0FA 1QJHA 1NDLA 1TKXA 4LRFA 3U1LA 4DN0A 2E9RX 2V8PA 1S0OA 2HG4A 4UOCA 2DR7A 1S9GB 4B9LA 1NB2A 1Q78A 2B43A 4HH0A 5BYRA 4LBHA 3SCKE 5RUBA 1HYSB 1RAOA 2B4PA 4DU7A 4CIOA 4WU2A 2FJXA 3GG1A 2EVZA 4N76A 3J7A1 3BGRA 5AXMA 4ZPWR 4USWA 1VC5A 4F4AA 2YNIA 5F41A 4O4RA 3W2WB 1SQFA 1U1OA 2CIMA 4WP3A 3AD8C 3NGUA 3PCOB 1FRMA 4ES1A 4HT7A 2EG1A 3BGFA 2AEJA 1CJKB 2FQQB 2X51A 3L7OA 3C6UB 3PJWA 4KSEB 2AHOB 2ZBRA 4PZVA 3KLGA 2BR0A 2DEJA 1C0UA 3NCQA 1Q0NA 4QOTA 5KFNA 2BQUA 4JV2A 4D3HA 4RX6A 1WC1A 4DG1A 3RB0A 3I0SB 4NX9A 4JI0J 3ELHA 4KQZA 3VGTA 1I51B 4ZVFA 3JAMY 5I3UA 2IHR1 1Y5IB 2DHGA 4PEOA 1PJ7A 4LVNP 4C11B 2DHHA 4LRAA 5FLXU 2ZNYA 2HNYB 2QJ3A 4ED5A 2GO9A 4YB5A 2W2PP 5LMNF 4NLYA 2EKNA 2CDQA 1FX2A 2RHQB 5K5MA 2FC8A 3R5BA 5J2PB 2DKOB 4Q45A 4A8MP 1UJ6A 1DJ0A 4L3NA 5HP1A 4LFBF 2OHDA 3DXBA 1IBKF 1TL3A 4P10A 2V4QA 4UOFA 4AL7A 1TK5A 5LOQA 3BF4A 2OMOA 2GAGC 3PKMA 3N6LA 2BXJA 1S0MA 5ETTA 5B09A 1F1BB 3SBMA 4HTJA 1M5VC 4G1QA 1SXLA 3V81B 4K5SA 1SI9A 2BRKA 3NMRA 1U2RA 1SJ1A 2CG4A 4QIGA 2AYEA 2JL9A 3MZIA 1MN9A 4JOUA 3GB0A 4O0NA 4UUXA 4TU9A 2C28A 4NCAA 1YZ6A 2GHWA 3KYLA 2PMHA 1H2TZ 2XZWA 4JI2F 2DR9A 1VI7A 3CDEA 5K14B 3TA0A 3DOMB 2PT0A 1CC8A 2QTWA 2HBZB 3L4BC 3R7SB 3Q8RB 1WC6A 4LQ3A 3GYXB 3TA1A 2OTJS 3I9V9 5KFMA 3R7NB 4X66F 1CVJA 3JTPA 2N4DA 5KFIA 2KXFA 4JV1A 3ZXWA 3KLFA 3KHGA 1HBMA 2ZH6A 1WG4A 2EI5A 3CB4A 4O44B 2HQCA 2WSFC 4O3QA 2BOAA 2CJQA 1LFPA 3GONA 2R7QA 3G87A 5KOWA 1O5JA 1H6KX 1F5BA 3GJRB 3IFEA 4MIWA 4OZ2A 1AROP 1CC7A 1RU2A 1IKVB 4NL5A 4S0MA 4DZ6A 1IR0A 5AE3A 4ICLA 4F50A 3TQ1A 1YRUA 2NYIA 2AGOA 2UXBJ 3BREA 3S6EA 1LW2A 1L3UA 4KC5A 4TY8A 4X4RA 2MKKA 2J6TA 3U1MA 2R7RA 4RZRA 5K8NA 3NXZA 2BV3A 4PWUA 3OUYA 1GX5A 3DLBA 1YBAA 3H98A 4OZ5A 5F0WA 2MTLA 2ZBPA 4LQ9A 2LKZA 5LXRA 5E3RA 4J9QA 4R5PB 2PDAA 4JYAJ 1G1XA 4JI4J 3MR7A 1RWMB 1HFEL 3IRXA 2XLJA 4DR1J 2BQRA 2XB2D 1LK5A 1SVDA 1TL1A 3D7SB 3T19A 3UNGC 2QC3A 4CNZA 3DOKA 4HHHA 4NZ0A 4IO9Q 2XS7A 2MGZA 1ACMB 1TELA 2H5JB 4MAKA 1DURA 1VC0A 2QX0A 4DV2F 1F2HA 1YRXA 2XGQA 3NGDA 5HQLA 3O5TB 3GILA 2ASYA 1ZETA 2PEHA 3KJFB 4BDPA 2LXIA 1H74A 3G8TA 3O1LA 1B0PA 1R0AA 3CT9A 1S6QA 1Y3KA 3G96A 3OV7A 1PBAA 4ZS6A 3CCZA 2IVMA 5EX0A 2R2SA 5DG7A 3DHXA 2O66A 3BGUA 2YX1A 2RAQA 3BZQA 2AEFA 3DN9A 1YJ9S 1N34J 4N41A 3LGNA 2Q3PA 1CG2A 3OHBA 1SJQA 4P74A 3SDEA 4R8UB 2V34A 2XQCA 1SH3A 3OL7A 1X60A 3DRSB 1CULA 4LBPA 4UF4A 3M8YA 2CWKA 4IR1A 4DR6J 1AW0A 1RA6A 3JSMB 4ECTA 5KG1A 5DDOC 4FBTA 3TEHB 1B7YB 3LAMA 5K14A 1RWVB 1QSYA 2PSZA 1HD1A 1S7HA 1GMWA 3PZPA 3OFFA 2MZ1A 2JC0A 3MM8A 1G7CB 2NXUA 2HHSA 3W5ZA 4CO1A 3GQCA 4B3SF 2IVYA 3I56S 2SXLA 1IJFB 2F8MA 4G1QB 1NJZA 2R7VA 3CJ8A 1FJEB 4OQJA 2D3UA 5J1NA 1OSCA 2C1EB 4P72A 3A3NB 2RVJA 4MT1A 2FHJA 2J0XA 5HJYA 5HN0A 2GVDA 3SIPB 4DLEA 4OI6A 3JYTB 2W8KA 2E5LF 4IFVA 3ENAA 1RADB 3BJYA 1FJGJ 5ETOA 1RXOB 3HVTB 2KM8C 3MM9B 3MR5A 2QV6A 2HW3A 1S4EA 1PIEA 2DNOA 2K3IA 3FRZA 2RQCA 2W9CB 3PY8A 3ITHB 4Y34A 1OJ4A 4TN2A 1R0AB 4I1TA 1JKHB 2V9WA 3BKTA 3UCGA 1S99A 1T95A 4AXIA 2XMVA 1M1KT 5IS2A 3VF0B 1FRIA 4J9RA 4K0KJ 2HWIA 2FZKB 1HLWA 1ZZFA 1CQMA 1PBUA 2J9CA 2W2MP 3W9IA 4XDCA 3P8BB 4ZN3A 1AUSL 4IDKA 4P9SA 2MXYA 5GADU 2H54B 5D4PA 4DSLA 2CNKB 4C8ZA 5J2MB 4OLOA 4OYAA 2UUBF 1REVA 3D54A 4CNYA 1HNXJ 1FD8A 2DH7A 3EGVA 2OPQB 2PA3A 2QLWA 1YHQS 4GVBB 4ENOA 5GMKa 2G0CA 2I38A 5ETMA 4X4TA 4RKUC 4DPXA 2CZVC 2QLJB 1RTZA 3GFYA 1Y5NB 1E6YA 2CVIA 4DDFA 3QWUA 3MFIA 2VFTA 2EXUA 3KFWX 4YR2A 1NSKL 4DBQA 3OFHA 3JS9A 2UU9J 4F8RA 2KYXA 2Q66A 4JI3F 2ZOGA 1QDUB 2ASDA 2CFXA 3JSRA 1T05A 4OV1A 2J6SA 4UUWA 3WBZA 4B3MJ 4NXMJ 3CXCR 2V2ZA 5GAGI 3AHPA 1RP5A 2I8EA 5LMNJ 4HHUA 2ZJQQ 3K5MA 1UJ4A 3V5RA 2E5IA 1EKRA 5A76A 5LMUF 1URRA 2DGTA 1XWLA 3EWGA 4IH6A 1CULB 4OYOA 3A8EA 3QT8A 3RU0A 1DHMA 1U48A 4B3TJ 5BXIA 4J9PA 3NWRA 1JX4A 3LF0A 4ZCLA 3BR8A 2CQHA 3VV2B 4ANEA 5F0UA 1QUPA 1BGXT 3PDNA 3VGSA 2YKOA 1YVFA 2LQ5A 2A6MA 1RU1A 1T7PA 1HA1A 2M2BA 2YWEA 3QGIA 1CJUA 5KFTA 4YP3A 1GNKA 3OFEA 1NK6A 3AD9C 3BBCA 3M32A 3PJXA 4WIQA 4ED2A 1NEEA 2BDPA 4B3RF 1RT6B 1H7WA 3CJ4A 3TA2A 3W8PA 4Z7YA 4ZDNA 4WFZA 3RBXA 2YNFB 1FVSA 3K5PA 5LM7E 4ECZA 2YVSA 2EBGA 3PTWA 1QAIA 2HMIA 1G6BA 3H8YA 1TFWA 4C9DA 1T9VA 2FLNA 1JLEB 1MWYA 4C8KA 4PXDA 3TO8A 2WB4A 4UOHA 2H4WB 5K8MA 1I94F 3ILOA 2ZH1A 4ELVA 2HQFA 2WVEA 2ILYA 1T05B 4PG7A 3AAWB 3ILIA 1R89A 2EFNA 2FJBB 4NASA 3G82B 3H5YA 3BSNA 4Y28C 4ZA1A 5GMDA 1Z2ZA 5HANA 2HK2A 2AF6A 2IM1A 5JVHQ 4OL8A 3EYZA 1JLBB 5CCMA 1KHVA 5IQQA 2WB1D 3HMJG 2BJ8A 2B3TB 2KM8B 4IG0A 1UP1A 3TZXA 3IAM9 1S0VA 1R7IA 4X4QA 1Q1KA 3MM7B 1L3KA 4TQRA 4MK7A 1FFWB 3PW7A 1UPPA 1Y9OA 4LBIA 5EHHA 3LP0B 1V9OA 4B02A 1X5SA 4J90A 2CPXA 2HWTA 3PHEA 4DV5F 1S9FA 3SXLA 1MROB 4ZPTR 4C97A 2CPIA 3QGGA 3UCZP 3U1NA 1RT6A 1YBUA 1LWEB 4C8NA 1VQ9S 3M32B 4ZLJA 1OIAA 3RW7A 1MSWD 4TLQA 3AQPA 2E5GA 1FXDA 4CM2A 3BR9A 4PWDB 1JLQB 1FWKA 1K44A 1XBWA 4L6V3 4YUDA 3MR3A 3CD6S 4X65J 3OSPA 1RUSA 2XZTB 3C16B 1TK0A 2AT1B 1HBMB 2DXEA 4IKAA 4DHVA 1GMVA 1SQEA 2OPSA 4DQQA 5HMZA 4EO6A 1PILA 1PSDA 5KFLA 5J2NB 4C3LA 4ETZA 3RBEA 1FK9A 3W2VB 4TNOA 2DNNA 5I3UB 1QAJA 2Z56B 1T0TV 3ETMA 2RDJA 4OYMA 1IKXB 2HAIA 3BO4A 4K4VA 3PYGA 4CO2A 1JXEA 2E1PA 4P75A 5I4MA 2D9PA 1VQ8S 2XLIA 4PQUB 2K7KA 2N82B 1PYSB 2IDEA 4F4XA 2VHGA 4DR7J 1OO0B 5E41A 4OJ1A 3DI6A 1R8AA 3MM6A 4MKBA 4GVLA 3PEHA 3EJMA 2KDOA 2M3DA 2V8DA 2ZDOA 3FEZA 3QT7A 1B4SA 5DQHA 4X4SA 1HNWJ 1HMVA 1WNEA 4UY85 4CZCA 1FFGB 3DLEB 3W63A 5F8MA 3IWXA 3EVOA 4LR8A 1R43A 4KIAA 2AJ1A 3DFEA 2CXEA 3QSIA 2CPYA 1BQXA 4O23A 3M2UB 1S1WA 1WI6A 3JQJA 3SCJE 1FRHA 3CDUA 2AQ4A 2IM0A 5KFWA 1RKIA 1NNDA 2CG8A 2M5YA 2Q1LA 2V5HG 2FJDB 1MMLA 2VQEJ 1BWEA 3AB4B 4IRCA 3OTOF 3TAQA 4NLQA 3I82A 1NRKA 2HFOA 1RCXB 4KY3A 4PXCA 4MTPA 4HI2A 4Y2CA 2I6WA 3UE2A 1JLCA 4KT0C 3GFZA 2AYGA 1MLAA 1FFSB 3LP2A 3MTKA 4DG1B 2JLEA 5ETSA 2HNDB 2R2UA 4C6AA 3IS9A 1RAHB 2WOMB 4PG8A 3D3CJ 4CCHA 3N9UC 3IRXB 2C2MB 3D4JA 3SSQA 4M95A 1C0TA 4U9RA 2J0SD 2BJ7A 2RILA 3UR3C 4C3MA 2EC0A 1CJTA 3UDCA 3I55S 4KBIA 3C19A 3SCLE 4F4YA 3QGHA 1OQ3A 4PRFA 3UD3P 1T8EA 2VFSA 4M5MA 1DLOA 4QR2A 5T7LA 2VG6B 3VR1A 2MKSA 1Z4UA 1NBEB 4EFAC 2YWFA 2AKWB 1WOOA 2JC1A 1TKXB 5GAEI 2BW7A 3QGPA 2XHCA 5EGYA 4USIA 1NKBA 2YWWA 2ZBQA 3OBIA 1R8BA 2F1FA 3D67A 3V6DB 2QFIA 4N8OA 2J6UA 4IRKA 1X4HA 4N77A 1TZ0A 1WF0A 1RBAA 1ZM2A 2KJWA 1IR1A 2FLOA 2ILZA 1DARA 2DGQA 3A1YG 4LRCA 4M5IA 3KLHA 2V4RA 1H38A 4TY9A 1VISA 3BO2A 4DFKA 3EICA 4IG3A 3IR5B 1WSRA 2RKIB 4WYWA 3MI7X 1RAFB 4CI0B 3A3OB 1JIHA 4BHQA 4DQSA 1JJ4A 3G9CA 3NP5A 4ZPCA 3T5LA 3G6ES 4QIFA 5KFPA 2IY5B 2XHWA 5B0AA 1S10A 2MLYA 2NUUG 5IM0A 1JJ2R 2RD5C 3BSAA 3HHLC 2DGWA 2KYZA 4BC9A 3OLAA 4KFBB 3E01B 4OHZA 2VONA 2H51B 4NXMF 2KN4A 1VQYA 5E3CA 1NK5A 1ZA2B 2ZNZA 3VAJA 1U8WA 4FBUA 4DUZJ 5IT0A 4Y6IA 1XMQF 1MWZA 3FDSA 2R8KA 3C66A 1BMQB 3CJ0A 2W4PA 1LKZA 3AJ1A 3MECA 2K7JA 1WTFA 1S9EA 5IWAJ 2JEJA 4LF7F 4ZN1A 3DMJB 1N5SA 4FS1A 4DR4F 1FT8A 3CCJS 3H42A 4FPIA 3K59A 5LXYA 4KHPJ 3FFIB 1REVB 1DY3A 1F3FA 2DD8S 2VG7B 3NCRA 4P2XA 4XDDA 4A4JA 4U67Q 1KQGB 4ZJQA 4F3OA 4I6YA 7FDRA 5KFKA 3T41A 1ZPVA 2JX2A 3VZHA 2XYPB 2JSXA 3Q89A 2UXDF 4CO5A 3JSBA 3LH2S 1ZTTA 1HBOA 2KI2A 4AE5A 2IM3A 3U27A 3R6LB 1U1RA 4CH7A 1RB0A 5DETA 2F63A 3HFZB 2OD6A 1EARA 3M8PA 3L09A 2H3EB 1JKHA 3LQVA 2KXHA 5HAOA 2C42A 4FKXA 3PG9A 4Z7CA 4N47A 3T6BA 4A8QA 2QFJA 3QZ7A 1HW8A 4IQMA 3TANA 1JLAB 4K59A 3G6XA 1P9QC 1MN7A 2AW0A 2ZH3A 3UVJB 2N3LA 3KHLA 3DRYA 3PKYA 1S97A 4DV3F 1SL2A 4B3RJ 3THPA 4QYZJ 1TAQA 2MQNA 3I9ZA 2DCLA 3QYYA 1SJFA 1S49A 3GSIA 1U47A 1S1TA 1NSQA 1KQSR 3C3LA 2MQ8A 1RCOB 1VQ7S 4IFYB 2MHEA 3V6JA 3O2IA 2V0NA 3FZBA 4DSKA 1NCLA 3OTCA 1FTRA 4CRJA 1N32F 2YWKA 4OHYA 1ZH5A 5C25B 1RWWB 4RW6B 5KOXA 2HAFA 1JLFB 1VDHA 2IJRA 4BWJA 1P27B 1ZYQA 1AZSB 2DEIA 4NLUA 1E6VB 2CJXB 1RTIA 2AZ3A 2M70A 3CJ5A 3I32A 3N5BA 2W1BA 2ZWPA 4DL7A 2UVWA 3KUEA 1DTTB 4KB7A 3QT5A 4DN9A 5EWFA 3P6YC 2VIHA 3VWSA 1D8YA 4DR6F 1GMWD 4R8UA 3SDEB 2VD3A 4QIEA 1FHTA 4ED4A 3IM8A 2BJEA 2IC3A 3TEGA 5F3ZA 2VBWA 2W9AA 5I3QA 4OZNA 1HKAA 1YJUA 5BR8F 4NXNF 4H4KC 1WWHA 2D69A 4C0HA 2FHOB 3KDNA 4IO1A 4OJGA 3BSOA 4AUKA 2QO3A 3Q24A 4J9MA 2MKJA 3ADAC 1LWFB 2ADBA 4DSJA 2XY6A 2YNGB 4QZVB 1C4AA 1BE4A 1FKOB 5A6PA 2OGUA 2QA4G 3VTIA 1APSA 4NYPA 5LSLA 2ABYA 3K5NA 4K50A 1VGYA 2CA9A 4DL0C 5KFHA 4E2FB 1MMNA 4ZVSB 2LA4A 3MUMP 4DV6F 1OWXA 1L3VA 1PG5B 4RUCA 1KKHA 3OR2B 4J5OA 3DM2A 2XBPA 1JNRB 5B0GA 9ATCB 1U45A 2UXCF 2MZJA 4RW6A 4I56A 3AQOA 4JYAF 2OELA 5CYMB 1DTQB 3EZUA 3FBBA 3LW5C 2YH1A 2YNIB 4OLPA 5KFSA 2FC9A 1YGYA 4Q43A 1S1VA 5KFRA 3VVTA 1RWOB 1N54B 2CQCA 2DB1A 2GIFA 3MPYA 3VGUA 4EBEA 4QJVA 4LFAJ 3IN5A 2Y8WA 4U6PA 2KO1A 3OSNA 1X9MA 2QZ8A 1R8PA 1WKKA 3D6HB 3ENQA 2WW4A 4KV8A 4ES3A 2DNPA 1Z2LA 1L3TA 3HVWA 4L72B 4B9TA 4OZLA 1PYOB 3DLLQ 2ZHAA 2ZZTA 3QIPA 3HDSA 1NK4A 1UFWA 2LEAA 1KFSA 3KG1A 3SQGA 3HD1A 3L9ZA 2E5HA 5G0RA 3HM9A 2BACA 2FVQA 2KB2A 1JLQA 2GV1A 2Z8QA 3G86A 5JJBA 1BWVA 3M8PB 3RRKA 4WKYA 2HHVA 1NO8A 1RJJA 3J7YI 2H4YB 1Q8LA 3CDWA 4DFMA 2HFNA 4NZ7A 3NG8A 4J9NA 1RA7A 2YPZA 1U1PA 2VG5B 1O6XA 1I1GA 1Q86T 4ZP8A 3DOMA 3S1TA 3TJAA 2MKYA 1TFYA 3RB6A 1FKAF 4IOCQ 1XR7A 1PKUA 2XEXA 2ZC4A 4J7CA 1MU2B 1T11A 4QW8A 3M1VA 2JFKA 3SCIE 1UVIA 1G3OA 2VKZG 2V94A 4PPZA 3DLGB 4HACB 3I0RA 4BBYA 3QJLA 4H4MA 1KN6A 3CO9A 1NKEA 3W9JA 4NCGA 3DLEA 3OL8A 4QR0A 2OPRA 4G1PA 2Y0BB 4NPOA 1KQKA 4QR1A 2EFOA 2QSWA 2OLWA 1EETB 2VBXA 1SCJB 4YN3B 3X3UA 5HMYA 4A8YA 2YQ3A 2RF2A 5A8WA 1YTYA 4PUOA 4X4VA 3DI6B 2W9CA 3GYNA 4ELTA 2P5VA 1FJCA 2QA2A 4LR9A 1K47A 2HIQA 2RHSB 4W98A 5CZXA 1RTDA 3CUNA 3QO9B 4FYDA 4DCPB 3MEKA 1RAAB 4DU8A 5AXKA 3VAKA 2CADA 3ZZZA 4IOAQ 3FJ2A 1LWXA 5KFYA 2BJ3A 1F6TA 2M0GB 5J2QB 1BC6A 5DDQC 2FHMA 2DCUB 3W64A 3AJ2A 3PRDA 4P2SA 3JTOA 5D0EA 1Q4RA 3MM6B 4Q44A 3MCOA 4ZVPB 4NEYA 2E29A 1T9TA 1S0NA 2LQJA 1CJVA 2VC0A 4KE5A 4B08A 1TUVA 4O3NA 1IQTA 2FUG9 3DLKB 1F2GA 1ZM3A 3MHYA 3D1QA 4TXSA 5HLFA 2MJNA 1A0OB 3BBFA 3KLIB 3NBPB 5LSOA 5FDLB 4CP5A 3KJVA 3CF5Q 1QLNA 1A6LA 4JV0A 4P6QA 2CQ4A 1ZM9A 3ISNC 1Y7PA 3HHLB 1Y0HA 3BYPA 3POTA 3QAEA 3TNVA 1HI1A 3W62A 4CLPA 5GADI 1HNZF 1VQNS 2BJDA 2WTFA 2V69A 2PMZD 3RAXA 5T7LB 3K5LA 1VBKA 2Z2YB 3D6MB 1GT8A 2V6AA 4DV3J 2VDHA 2GVZB 5FD1A 2J7WA 4OI4A 1NZ8A 2WBRA 3OT9A 1XNRJ 3HXMA 1RHMB 4HI1A 2HFVA 4WFXA 3ZZOA 2GMJA 2R9LA 3MCSA 3KTQA 4HACA 1QE1A 3TVZA 3WHIA 2LU2A 1GXLA 2O01C 3MWBA 2HFUA 2WOMA 2B9YA 1MROA 4J37A 4FVMA 3T1AA 1HNIB 2KT5A 2R7OA 2OFHX 3H90A 3QFWA 5A8KB 1RHQB 4JI2J 3CCVS 1WTBA 1SKWA 2D1CA 2DNHA 1VQ6S 4Q7AA 5IFMA 4RW7B 2FLPA 1KWMA 1GK8A 2FHJD 3GYGA 2HVZA 1S5ZA 3R3TA 4NLRA 4EEYA 4KHPF 3MM5A 2M4MA 2W9BA 4Q2MA 3MPDA 5KT7A 4ZJLA 4M5DA 1KRPA 2OEJA 5L46A 1KONA 5IWAF 3P49B 1NXIA 4FXWA 4ZIVA 1TKZB 3CVKA 1X9SA 3BGOP 2FZGB 4ECUA 3SI8A 4WKRA 2NZCA 2Q6BA 1Q79A 1BQMB 2HVDA 3THTA 4WFNQ 3LWMA 2J9DE 4CQ1A 2AV5A 3C14A 4Q5VA 1SJ4P 2JLFA 5KFBA 1PC4A 1UPMB 5L39A 5K8PA 4M1KA 5KG6A 2I5JB 3G8QA 1IKXA 2XG8A 3KOAA 3OFGA 3MEEB 4OI2A 2HYIB 1JK9B 4FF4A 1SC4B 2KU7A 3IAS9 2MSTA 4I2PB 5HL7Q 3V6HA 5D3GA 1J2VA 4NLWA 4K7QA 3UDLA 4W4MA 3UDEA 3HCXA 3GMGA 1PCAA 1HPZA 2OJ3A 4X2BA 3DGPA 1C4CA 2VBYA 3JYTA 2ASLA 1UVKA 3OR2A 4NWBA 4WXOA 1RAGB 3HFKA 3D0IE 3RJMB 2J9DA 1W26A 3U02A 1N5TA 3LALA 2ZD1B 3M2VA 2N3OA 4DX6A 5DLGA 1OS5A 2HK3A 4KO0A 3M6WA 7FD1A 4WBFA 3RAQA 1VQMS 3WDOA 2UUCF 3G8SA 3OTBA 4DV7F 1D8ZA 2R8JA 4E0DA 1Q16B 3T9NA 4ZLLA 2C2RA 1FRLA 4J9SA 4K5RA 1VQLS 2X7IA 1YITS 4WZQA 3H2LA 4KH1B 1WC5A 3IWLA 8AT1B 5CCLA 1TL3B 3UO0A 3PYFA 4TYBA 5KFCA 3SV4A 3QJPA 3DKDA 4HT5A 4EU0A 1KHWA 3P4UB 3W2VA 4XPCA 2QEXS 2IRYA 3BO3A 3NOCA 3FKBA 2YKPA 3B82A 1DBDA 4U8YA 5KFXA 2MKIA 2ZHBA 2ZJRQ 1VRUA 1WDDA 2D41A 2UV8G 2CDRB 2G0IA 5D77A 3BBBA 5FIIA 5AJ3F 1LV5A 4OHVA 2M8HA 2C2DA 1Y4ZB 4ID5B 4I2QA 1Q7YT 2IAJA 3BDEA 4DR2J 2N4CA 3M30B 1IKWA 4LSNB 4RW7A 5KT5A 3IBCB 4RW8B 1C1BA 1VHFA 3LPEA 3UWTA 1IBMJ 5BYSA 1C0UB 2BKOA 3G4SS 2MSSA 1KEKA 3KJNB 4DWIA 1UWBA 5CD4H 2HGNA 3KLGB 3WC0A 1UAWA 2CZ4A 3M8ZA 1NJYA 1NH7A 2YY3A 1FRKA 2BRLA 2W01A 2DIVA 3ILJA 3KK2A 4IQXA 4NI2A 5H9EJ 4DPWA 4WE1B 2F7VA 2GAHC 2FYXA 3HHLD 3F44A 4RNFA 2AIRB 3Q8PB 1R0BG 3KLIA 3KJVB 4B3TF 1KR4A 1UW4A 2R7WA 1DZ5A 3DHWC 2HVIA 4WF9Q 2LDYA 5LMUJ 2DR5A 2HPUA 1GXTA 2DO0A 2H5EA 2XMWA 4F4ZA 8ATCB 2ZH4A 2W2OP 4ED6A 2XMTA 1VLYA 4B3OA 3M8SA 4ECSA 2MQMA 1M90T 1WACA 3FGVA 5KAKA 2DTJA 1H73A 2MKHA 3HD2A 2NSCA 3LO3A 5BJRA 1B64A 1EX8A 4B3MF 1BXNA 2K1RB 3DGPB 1VJQA 2VKRA 4C8MA 2O5DA 5HMXA 2ZZMA 4C8LA 1H7XA 5ETLA 2VBZA 3OJUA 5CH7B 2YQ1A 4DI6A 1M5SA 1KVIA 3BKFA 3G6VA 1IQZA 2ZKTA 2XULA 3FBFA 3KUHA 3D0GE 3W61A 3SFUA 2PC6A 3IBFB 3KMSA 4OMFG 3ULHA 4JI7J 2VDIA 3KG0A 3SSRA 1EETA 2VV5A 4B9VA 3CMES 2DIUA 3K8VA 2G1HA 1H72C 3MR2A 2XYGB 3QFHA 1PYTA 2UUTA 3CD7A 2X1GA 5DM6Q 3ISZA 1RAIB 2E7VA 2XCPA 4U7CA 1DAXA 1NHUA 1WOPA 4K4XA 1SL0A 3QSYB 3K89A 4OI0A 4PKDB 3M8WA 1JLGB 3Q2SC 2FJAB 5J2PA 3QT6A 3SQOP 1S1UB 3PXGa 3TVYA 3UD4P 2GCFA 1TL7A 4P73A 5EDWA 5EX3A 4W92B 2G0JA 4ETXA 4M5KA 1S6QB 2RF2B 2GGPA 5A8WB 3J80U 3AXMA 5M2UA 4DMZA 4RBTA 5CABA 1XNRF 3I5AA 2QL5B 4TLRA 4A8WA 1UCNA 1UL3A 4NLPA 3RGIA 3VGVA 4DS4A 2AP6A 4ER8A 2LCWA 2Z57B 3EVMA 2CQDA 1J5EF 4F3QA 3M9OB 2M7SA 2IMWP 1V3ZA 1RHKB 2APOA 2MGZB 1CBKA 2DJWA 3AT1B 3OXLA 5IT9Y 2RT3A 2B4OA 4BCAA 5GAEU 4LF4J 2HGLA 5AXNA 1SBRA 2V50A 1T9WA 3PRVA 2EW9A 2W4CA 3W65A 3C6UA 1T03A 1FDNA 4J9LA 4IUFA 2RRNA 2KT2A 2KRBA 2LMIA 1Q95G 2VG5A 1NSAA 3H0PA 3IO1A 5KFGA 2V67A 5CYJA 4R5PA 4QWAA 3MUVP 3CDAA 3IGNA 2C2NA 2YQ0A 1P6TA 4CLWA 5KFOA 2KHDA 3I0SA 4L75A 2GS8A 4B3SJ 5DZ6A 2BZ2A 2B4UA 1PAUB 2K8GA 2GGPB 4YHHJ 4DF4A 2GVZA 2LVWA 3DRPB 4ILMA 1Y5LB 3IC1A 4RPFA 5AT1B 3NS6A 1SUQB 3MCMA 4QIVA 3OR1B 1AT1B 3HVTA 2AYMA 2AJ4A 1BQNB 1RQ0A 3TX8A 3J7ZT 3Q0AA 4DL2A 4CLYA 3POTB 3T1YJ 4USKA 4L76A 2PEBA 4ZVEA 6AT1B 3VAIA 1T9YA 3F0NA 3J7Z5 3GSDA 4KGVB 3S7RA 1JXVA 5C42B 4NYZA 1UJ5A 3VQSA 2VC1A 2RQMA 3KG4A 4WTYA 2B5JA 1TMJA 1HQEA 3IR7B 3MM8B 3SV3A 1S9GA 1SKUB 4KYZA 4K4WA 1RTJA 1TVRA 2V2KA 2D9OA 2OAUA 2BYCA 5DGBA 2F65A 5BR8J 3DDNA 2F5GA 3NLCA 2Q79A 5C24A 2NPIA 2ZM6F 1TAUA 2CJ9A 3HKZD 4MH8A 3TARA 2OPPB 1YZ7A 1IBKJ 2MQQA 2UV8A 4MIAA 3H5SA 4OHWA 2AWZA 2QIFA 1FWPA 4B3OB 1QY7A 1XNQJ 1FX4A 1FI4A 1CEZA 1SIWB 3C14B 3IG1B 2ACMA 2CJBA 2YPYA 1FKOA 3FSXA 4LF8F 3UN2A 4QU6A 5DQGA 1N8RT 4USHA 1S57A 1V5VA 3PX4A 1NDKA 1S6PB 2E7XA 1S9EB 3PYEA 5A2QY 4O3RA 1GTEA 4DXLA 3NNHA 2XNQA 1ZPWX 2CQ0A 3HLUA 1RTIB 1S1XA 4WU3A 3QPIA 2UXCJ 3QIDA 5DG8A 4RU2A 4JI0F 1DFDA 1WF2A 2XC9A 2IC3B 1X9WA 4AT1B 1XR5A 2W8LA 1DRZA 5IC6B 2ZVSA 2JJ4D 1OY6A 4PG5A 1QAYA 2QLXA 5J2MA 1HIYA 1B0TA 2FB0A 3C15A 3HSDA 2I0XA 4UZBA 2I2YA 1N33F 1YWXA 1V3SA 2WVBA 3EDRB 4ZPAA 3MUTP 2DNRA 4FNIA 4F4KA 1S76D 4ZVUB 2F4FA 3M30A 3N4WA 2VPXB 3C6TB 3QBCA 4LSNA 3W1YC 1S48A 1SL1A 2AYBA 2J7UA 1FKPB 1RLDA 3HHDA 2ZOFA 3RZAA 1QM9A 3HHKA 3PM9A 1F5AA 3ZZTA 3NS5A 1W7WA 3JQKA 3CE8A 3KKFA 1MG7A 3AXKA 3D1OA 3HULA 2G2YA 2FJWA 5HSPA 4DSIA 1LW2B 2R42A 1H2UX 1TL5A 3VCDA 1VFJA 4DV6J 1RAJA 2NLWA 2W24A 3RB3A 2ZZNA 1T02A 2LYVA 2HHXA 2FIUA 3CJRA 1EZZB 3HFVA 5JMNA 2MMYA 4YS2A 1BQNA 3B6BA 2CKWA 2A3JA 3OR1A 4N7TA 1KTQA 1KVKA 3W2WA 2GIQA 5I42B 3TJ8A 4FZVA 1X8DA 5K20B 3T6JA 3JSYA 3RR7A 3MXHP 1RDRA 2BMBA 5KFVA 2IA6A 2R7UA 3B4MA 1N5VA 4FYVB 1TKDA 5U47A 1RSCA 3I31A 4I67A 3M6VA 1P8GA 3EDQB 4URQU 1IN0A 4WTOB 2AGQA 1F9EB 4URGA 2HVEA 1ZBTA 3K8WA 4KH0B 5F8GA 4DUZF 2BQ3A 3LWLA 3R2CJ 5HROA 5LSRA 4QW9A 1JLBA 4WFAQ 3Q8UA 2HS3A 1RT4B 3LOUA 4KHMA 4WJBA 4RU9A 5B0DA 5DGAA 2B8PA 1RBOB 2WRMA 3NRBA 3C15B 5D6GA 5KT6A 1SKRA 1MMDA 5J1EB 4R0JA 3CTRA 4YMEA 3PIOQ 3N79A 5DDPC 3GR0A 2FJVA 4DS5A 4UQTA 2V8HA 4HDHA 2OUGA 2XSFA 2HMIB 1CSJA 3LAKA 3T5KA 2IJNA 3HF5A 2DO4A 2RDDA 3F73A 2YKNB 3KLEA 2DPJA 4KPYA 2LXFA 2WONA 2YX4A 1WG5A 5CYQA 5E7OB 4RUHA 2H48B 1VK3A 4ECVA 1U7LA 3Q8YA 2HHHF 2POKA 2UVUA 3RRHA 3GV8B 1B3TA 1S77D 4OJHA 2OI2A 3NL0A 4DJBA 1XMOJ 2R8GA 2J5AA 2AD9A 3OTEA 3BKUA 3DOKB 4RW9A 3LGHA 3MAHA 3MOJB 1HBUA 1ZAWA 1ZM4A 2HHPA 3DDKA 3MMCB 2WVCA 1FDDA 2E1RA 2YX7A 3MMAA 3UFCX 5A8RB 4ECWA 5E0OA 3THVA 3FQKA 2Y1JA 4WP9A 1M5KC 2NXNA 3FRYA 1JLFA 4CO0A 5EWEA 3OVAA 4LF7J 4RNHA 4Y2MA 3EMTA 2EKYA 3GIIA 4CH0S 1NDPA 4LF2A 2V8GA 4CLKA 2MY8A 4F0KA 5HO4A 3KLHB 1J5OA 4W90B 5H9EK 2QL9B 4UZCA 3I5CA 2N7YA 2Y9HA 1U4BA 4JBCA 2ERRA 1U09A 3OTDA 3QWPA 2DHAA 3UR0A 5JUMA 3VAHA 3HK2A 1FJ7A 1S1TB 4ZP6A 1X4CA 2ALZA 1I3OB 1E6VA 2BABA 2CQPA 3ZTQA 1T9XA 2YNHA 4A46A 4DQPA 1RTJB 1TVRB 1HBNA 3OXFA 4FF3A 3EGWB 4TQSA 3OD2A 1XIQA 2VICA 4F2SA 2JRSA 2FY1A 1V3RA 2YKMB 3HT0A 3O6QA 8RUCA 3BGRB 5HVHA 4DR4J 4QYZK 1YJVA 2UVVA 1I6JA 5F8HA 4GRSA 4MK9A 2P9GA 2YH0A 4ANCA 5CA5A 1HI0P 2JVRA 2FLLA 1E6YB 2Z58B 3OTOJ 2MEWA 4WE1A 5I42A 3N6MA 2R3VA 4OZ1A 4EUVA 4AFFA 3FBEA 1PJ5A 1KOHA 2OPQA 2KFZA 2CQ1A 2MDAA 3LA0A 2R2RA 1WD6A 4YB7A 4A48A 3W7BA 4CLLA 3R5AA 2KG0A 1U6BA 4QWDA 3H5XA 2P8IA 4IOBA 1NJXA 2YKQA 3LP2B 2XWYA 4YOEA 1FNOA 1JLCB 2QLFB 1ZAVA 2PI5A 4C4WA 2IDLA 2Q43A 1P1TA 4CLZA 1VQPS 3Q22A 1HNWF 1R8HA 4NLXA 1SC3B 1VS3A 1M5OC 4XTTA 1F5CA 4V1Ak 5IV3A 2V68A 4J9UE 5M2PA 1YJ7A 4F67A 5L9XA 1VOMA 1W2IA 4HLBA 2DY9A 1EB0A 4NLGA 1A7GE 2AMCB 2Y1LB 4FYYB 2LXUA 2WONB 3W9HA 5E3AA 2VJUA 3MPVA 2VASA 1RT4A 3AB2B 1JJCB 3HHNB 5DG9A 5L9NA 3LGMA 3GPAA 2KTQA 1X4AA 3AFGA 4FNHA 1WEXA 2CRLA 2RS2A 2LP4A 1RGVA 3M7VA 4H54A 2LEPA 2Y8YA 4B9UA 4ZPDA 2P6SA 1GFWB 2MJUA 1N36F 3HKWA 4C48A 2YXLA 3HO1A 4H4KA 2E5JA 1HWKA 1XERA 4HHJA 1LW0B 1WHXA 4DV0J 2ZEJA 4B9SA 1YJNS 1RWUA 4AYBD 4YR3A 4EBDA 2MKCA 5HMWA 2FTRA 4CO4A 2P9CA 1FD2A 4F02A 2Z0GA 2JFDA 4HH1A 4ATNA 5MAOA 1HQEB 3ZTOA 2K2PA 3UPFA 3L95X 4KGMA 4PWWA 3CCUS 5D3GB 3HZEA 3MURP 2GFFA 2I1RA 3TZZA 4JI5F 4OIXA 4ES2A 1YK9A 1OPIA 2RU9A 3T1HF 5D78A 2YKMA 1AUDA 1HR0F 2I5JA 3CMQA 2BW2A 1HBNB 3TJ9A 2CJYB 4DFPA 2QMXA 4DPUA 1F9FA 4FP9A 2HHQA 1HBOB 3CCSS 1U0SA 2RSQA 1GTHA 5D0RA 3L3CA 1P9YA 4YDDB 2OP5A 4LIWA 3NCPA 1BUXA 1NLKL 2AX1A 1AFIA 4F0HA 3R2DJ 1YIJS 3QRRA 5KFEA 1S1VB 3TQEA 2AJQA 3FFIA 4WZMA 3P96A 4CH1A 2RRBA 1IM4A 1HARA 2H9ZA 3FCVA 1KD1T 2FJEB 4O3OA 3ZTSA 4CTAB 1VQ4S 2FVPA 2MHNA 1KLNA 4OYBA 4GKKJ 1HBUB 1KBRA 1SV5B 2GQ2A 4LF6J 2CJAA 2HNDA 4RO0A 4P7TA 2PI4A 2ZE2B 5CD4A 4KJIA 4UT4A 4HEA9 4RWXA 2RS8A 2JOQA 3F41A 4IYQA 3CJ3A 1RTHB 2BUNA 3CW2C 5L8RC 3TAPA 1J5EJ 3TOQA 5HJXA 3A3PB 1UFKA 4UTGA 4E98A 2QLBB 4IR9A 3JXOA 2RE1A 1S6PA 2VZ9A 3BB5A 3PACA 2LDIA 1S7IA 4JV5F 1TL7B 1HHQA 2WVDA 3CMAS 4F25A 1X4BA 3CDBA 5GAGU 4PQUA 3V4MA 3CIMA 3OQ2A 2PA8D 1IXKA 3DRRB 4DCJB 1UA0A 1VC6A 3R8YA 3ZZUA 5KT4A 3M8QA 1WHWA 2ZDPA 3HT3A 3J7AN 4GKKF 1EAYC 4HKQA 2KKHA 4ZP9A 3D68A 4NLVA 3PX0A 2D3O1 2VA2A 1LW0A 4G1IA 2F4VJ 2CPZA 2ZITA 4WFYA 1WF1A 3WX8A 3MAAB 4EBCA 4IRDA 2MQLA 1SJ3P 1Q5VA 3RTVA 3D28A 4OX8A 4JI7F 2E9ZA 4ZHRA 3RG6A 1ZA1B 2KZMA 4KPCA 3PW5A 1WC0A 2GHVC 4J91A 4RBUA 2HIYA 2K1RA 3TYTA 2ZH8A 3OPKA 2DITA 2WBMA 1SQGA 3A8IA 2WZ1A 4RL1A 4DCOB 2M8DB 3J81U 1NB7A 3H25A 4GVBA 4L73A 5J2NA 4OZ3A 4V19J 2E1AA 4C0BA 4MIBA 3PR4A 4OX7A 3W5YA 3T1HJ 4I4BA 2RDIA 1T03B 2HS4A 1TTHB 3DU6A 3H2VE 3CC4S 1VBYA 2FVSA 4EI2A 1REGX 2HFSA 2HHWA 2W4DA 2XM3A 5F3TA 2B6AB 4KRWA 2DHSA 1IKWB 3D6TB 4HDGA 1DQ8A 1F0XA 1LK7A 1N88A 4MFBB 3UCUP 2I9SA 2NPFA 5KFDA 5KG3A 3FEYB 1LWEA 4XK8C 3UD5A 5KG7A 3ET6B 4O4GB 3UI3A 2KRRA 2RMLA 4ZPVR 3HSJA 1BQMA 2CNNB 4NA1A 3SSSA 4CT8A 4K4YA 6FDRA 1AFJA 1HQUA 4I7FA 3PFOA 4ZCMA 3CC2S 2CQBA 2DGSA 3RW6A 2WHOA 4OJ3A 3E2EA 1VQKS 1QUVA 5IC4B 1VR6A 1IBMF 1NPKA 2ZVIA 2B4VA 1HNVB 4DV4F 1UVJA 4O0IA 4OFZA 5KT3A 2C3OA 2IVFB 1D9DA 1HNIA 1S1UA 4YR0A 1FNMA 1RT5A 2G1DA 3NGSA 4M5NA 4RLEA 5ETRA 5AJ3J 4X4PA 1KP6A 2GMLA 4ZK7M 3PIPQ 4GC6A 4EZ9A 3Q8SB 2F9JA 2ZOMA 2EK1A 3BGLA 3EXYA 1B70B 1TK8A 2EC2A 4ZKAA 1T94A 2NXJA 4A47A 3AOBA 2C2OB 1Q8BA 4GO5X 4DL6A 5CXTA 2BE7D 4JI8F 3M8QB 2Z2MA 4O44A 4LRDA 2ZH7A 1RLCL 3KLFB 3QAUA 2UU9F 3HJFA 4PR6A 4RUAA 3T5JA 2KXNB 4ZITA 4DL3A 2XZDB 4Y3CA 2RIJA 4UW2A 4KO0B 1X4EA 3MMBA 3MAAA 1FE4A 4L3KA 3GIKA 4WFBQ 3VQTA 3AA9A 2IYIA 4WXWA 3V6DA 1RT2B 4LIRA 5ADZA 3M4XA 1HNXF 1QSLA 2X3GA 2UUBJ 5SZTA 1WEYA 2HHTA 2R8IA 1N33J 2XS5A 4X84A 1XJWB 3IGVA 2UUAF 2KVQE 1KVJA 2D74B 2JHEA 3E3XA 1JNZB 1SUQA 1M1HA 1R6YA 2A0FB 3RBDA 4YY3F 3MEDB 3ZC4A 1RWNB 1SH0A 2OD4A 2OSRA 4NXNJ 4ILLA 4PUOB 3Q86A 5AE1A 2L48A 2DK2A 3MM7A 4WK1A 2ZH9A 3TRGA 3FNNA 3L7PA 4OI1A 4NI2B 1CQNA 4A8FA 2IAJB 3V4IA 1NHKL 4MYUA 4LF5J 1RTDB 4I2QB 2BE2B 4ID5A 1U8SA 4JB8B 3PW4A 3K2YA 3VAMA 2C3PA 5B0FA 5H9FJ 3O8WA 3OUYB 5LJ3Y 4RJVA 2M52A 2RQKA 2IJFA 4Q2LA 3PHTA 4K4TA 2DRAA 1H98A 3R97A 3TUIC 4DR3J 2GJ2A 3IM9A 1Z1ZA 2QSFA 1X5PA 2VQFF 1N34F 4ZP7A 4NLDA 5HROB 4ICLB 2MLZA 3IWNC 3OVSA 1Y10A 2ATLA 2CQIA 4A8OA 4RUBA 1VMBA 4NOHA 1AA1B 1XEZA 1S4FA 2B6AA 4MYTA 2YNFA 4P2MA 5C5JA 2V9KA 1K9MT 5ETKA 3BQ2A 4LFBJ 1Y3JA 1D3WA 3G6YA 4DV2J 4ZVTB 1TL4A 4JUZA 1JXLA 2VOPA 1CJKA 4QCLA 1HWLA 1WORA 4DPTA 4D3GA 3ET6A 4NE9C 4O4GA 4DUYF 3ENVA 2V4JB 1IJEB 2K3KA 1U2FA 1GX6A 2ADCA 4E8UA 3S8SA 3RAMA 1LWCB 5KFZA 1PO6A 1YKWA 4EWTA 2VF3A 3N6NA 1U2CA 4FKYA 1X31C 3IXQA 1JLAA 3HSGA 3KJQB 2ZH2A 2C2EA 3AOCA 2CAJA 1FVQA 5K9FA 4DPYA 4DR5J 1Q8KA 1CJVB 2HRTA 2U2FA 4ZJOA 2ZBIA 3TVKA 1ULRA 1NK9A 2VL1A 1M5PC 1DTQA 4ZPBA 2CPJA 3KHRA 4Q8EA 2EFPA 1VRQC 2XMUA 3Q23A 3ICLA 2BM1A 1FF2A 4IFVB 1VQOS 3C6TA 4PCQA 1WOSA 2BKPA 3HHLA 4H4OA 4YB1P 2VQFJ 2ASJA 2DXDA 3MCNA 3OVBA 4ZVRB 5FDLA 4ZVHA 4KGKA 1WKLA 4LF4F 3KK3A 1U1MA 1M1GA 4F36A 4C0OC 4OX6A 1XK8A 2L08A 2DGOA 2OFGX 5DZ7A 2GW8A 3I6PA 3FEXB 3DDIA 4JI4F 1F9HA 3C16A 2JEFA 3CCQS 3FMBA 1TKZA 4OHXA 3ZTRA 5IV4A 3CPWR 3IBWA 1QSSA 1C1CA 5A8RA 1N0UA 3P3DA 4AQYF 3CJTA 3UNYA 4ED3A 2LLZA 4A8SA 3RR8A 4LF8J 2HKEA 4USMA 1KC8T 1FWLA 3DRSA 1FCAA 4Y2AA 4NCBA 2CYYA 3DOLB 5CHCB 1UETA 5HP1B 3CJSA 2RUSA 4LUBA 2QGFB 4OYWA 2UUAJ 3P45B 4P52A 1K0VA 1HWUA 4HL9A 5HATA 2ZBCA 2WK4A 4QQBA 5A8KA 2B51A 2ZM6J 1A9NB 4DL4A 3CO0P 1LFWA 3OLBA 2PGCA 3M2RA 1S6UA 2HNYA 4DX5A 4EMDA 2VPZB 5KFJA 3PR5B 3MFHA 3V6KA 3BS9A 1JB0C 1FTCA 2XMMA 2Y3YA 3A13A 4Z37A 4ANDA 4DOZA 4B9NA 4O3SA 4ECRA 2VOOA 5LT5A 2MZQA 3DRXA 2VFRA 2MPUA 4I69A 4LSZB 2AJFE 1ZAXA 3GCWP 4USVA 3WIUA 2A1BA 4U95A 1ZS6A 3DGVA 3K7RA 4WIIA 2CNLB 1D1UA 3DCAA 3GZ7A 2DNYA 1K73T 1VRUB 3AOAA 1VRTA 4LMZA 4FXVA 4OYPA 1B7FA 3ENWA 2V63A 3KHHA 1X7VA 2KVIA 1XTZA 3MM9A 4PYDA 3R5DA 3MTJA 5F8JA 2WW8A 2BE2A 1HYSA 2R4FA 2J76E 3GU0A 3TUJC 3AH6A 3PX6A 3TW0A 4DR1F 3ZZ0A 3UVJA 2VH7A 4AQYJ 2NZ4A 1LNQA 1RT3B 3M6XA 1CPZA 1DLOB 5A2QU 3EX7B 1FE0A 2AJ0A 1TV6A 4M63A 4WYLA 3QZ8A 2Z2LA 4PPDA 1N6QB 3A8KA 1HWJA 3EXCX 3BH7B 4NLTA 2XLKA 2B0GA 4DV4J 4B17A 3BM7A 4YY3J 4CLUA 3NNAA 4TVAB 1U6FA 2QL7B 2ROEA 5JXSA 4YFUA 4AL6A 3RRGA 1TR0A 1KLMB 2QMWA 3BPDA 3NBPA 4G65A 1RT1B 1VIOA 3KK1A 3EZ5A 2G13A 2DT9A 1D9FA 4NLSA 3MPUB 4C8OA 2EWHA 3H4BA 4QYRA 5B0EA 2L41A 3PW2A 4LFAF 2BJ9A 1Q82T 2DNKA 1BD6A 1NU4A 5HBMA 2V8VA 2YNGA 1TUWA 3WQPA 2W2QP 5AE2A 4X4OA 4EZ6A 5IZHA 1H3DA 1SH2A 1U0HA 2ZUGA 4GC7A 4M8LA 3ZZRA 4U7UD 3ILLA 4OZ0A 3PVXA 3MD1A 1TP7A 2DH8A 3T1YF 2VODA 4I64A 2PMWA 1K1QA 3BN7A 3LP1B 1R8CA 3SZ2A 1N52B 3P5BP 1QAXA 3CJKB 1LXJA 2W25A 3HSZA 3NY0A 3WC2A 4X4UA 3R7BB 3NGTA 2G9OA 5J1EA 3BQ0A 3GJSB 4ILRA 1K8AT 1MU2A 4Y2IA 2J7KA 2H5IB 5GAHU 4N5SA 3VVUA 2IBOA 3BH6B 3MECB 5F8IA 4HR2A 4YHHF 3DXSX 1TL1B 4TU7A 1MNEA 2O1PA 3KUGA 3UQSA 4LT6A 2K06A 4NCGB 1NUEA 4NMXA 2MZRA 3D0HE 3LPYA 3ZFVA 4H4MB 2CNOB 4LFCF 5KG5A 2CPDA 3IG1A 4DZDA 2MQOA 4B9MA 1EKSA 4U8VA 4FS2A 3HI9A 2BOPA 2XMAA 1D9AA 1U25A 2PE8A 1GQEA 4N8NA 2HGMA 5IOLA 1S79A 1Q53A 4RWWA 5D4NA 1KLMA 3KK1B 3ZZPA 2E7WA 1IWGA 2A2DA 2PN6A 3DC2A 3D9BA 2DNLA 1XC9A 4NA3A 4P2FA 4GKJJ 2F9DA 2HRYA 1SC6A 3NAIA 1QVFR 1OYEA 1PJ6A 1UA1A 2PFDA 4WPAA 4U7UK 5C42A 3ITHA 1RYSA 1N32J 4GKJF 2LFVA 4MMOA 1Q8IA 2DY1A 1X4GA 1RT1A 2AX0A 2C2ZB 3QIPB 1RT3A 4PWDA 1U24A 3QNWB 4KTQA 2IIHA 3W5XA 2QMUB 3WZ0A 2DNGA 2GC8A 2DGVA 1P1LA 2GO8A 4DX7A 5KTQA 5FJ4A 3VZIA 3R9LA 1WC3A 4LFCJ 3UN5A 3D5MA 5G4DA 4DR2F 1FERA 2DPIA 2DISA 1PAEX 2P9EA 3FC9A 3J7YU 3TUPA 1G2EA 1KTVA 3KNGA 4RNOA 4NZ6A 2W2NP 5E33A 2RRAA 2P6TA 2D3OR 1GEHA 4ZVGA 4AXJA 2L9WA 4WCEQ 1L3SA 2NXEA 2Z2ZA 3OJSA 1WUUA 3ZTPA 4ECXA 1URNA 2RB7A 2XI2A 2KT3A 5D0GA 2BVZA 3TWZA 3IR6B 1HHTP 2UXDJ 2KZZA 4EYHB 4F2RA 1SJRA 3DRRA 1I94J 3M05A 1J5OB 3NEKA 3D1HA 4EGLA 4F7VA 3PV8A 3CJKA 2EFGA 5ETVA 1XNQF 3LP1A 1LWFA 4DF8A 4Y0FA 5E3PA 3GIRA 5H9FK 2CQ3A 1FRJA 3BDPA 3K0JA 2Q6CA 1WDTA 1GMUA 2HHUA 5C24B 1SIZA 2XMKA 2XO6A 2EG2A 4MKVA 1YDLA 1AZSA 2HS0A 1N48A 4LF9J 2ZUAA 3M2UA 3HP6A 2XWXA 1EQ0A 1RWPB 4QWCA 3ZNUA 1JLGA 5C25A 4C7QA 2ZE2A 2QT7A 2E66A 3FQLA 5E3QA 3HPOA 3R1LA 2HEKA 2EFQA 4QBUA 2MB0B 4UQGA 1NM2A 5CZVA 5IT4A 1NJWA 4LF6F 4AL5A 1K0TA 2IRXA 3H5UA 4F4WA 1JMTA 1X0PA 2PD1A 2VUGA 4MKAA 3JQMA 5KFAA 2OEMA 1OPZA 2JZ5A 4LF1A 3O3LA 5DJBA 3KMQA 1RABB 2G2OA 2HNZA 3CWJA 3MDFA 4UOGA 3CCMS 3MOZA 3TX0A 5B0CA 4NLOA 1NKCA 3AA8A 2QA1A 3CGIA 3FZ2A 2LQ9A 3R5GA 1CJTB 4H4OB 4QWBA 2ZHOA 4IH7A 4JI6F 1N5QA 3B4DA 4LVOP 1M0SA 3TZYA 1ZTWA 3R6GB 4ZOSA 2YNHB 3PO4A 1T3NA 2J8SA
chains in the Genus database with same CATH topology
1PYOB 2P2CB 2H51B 3GJSB 2H5IB 5K20B 3KJQB 2XZTB 1BMQB 1RWXB 2QL5B 1SC4B 2H4YB 3EDQB 2CNOB 1F9EB 1GFWB 1RHRB 1QTNB 2CNNB 1RHKB 4ZVQB 3RJMB 2H54B 4ZVRB 2CNKB 2HBYB 2XYPB 2HBZB 3R7SB 5IC4B 3GJQB 3R6LB 3R7NB 2QLJB 2Y0BB 1PAUB 1ICEB 2HBQB 2C2ZB 1QDUB 3GJRB 2CJYB 2H48B 3QNWB 3P4UB 4DCPB 3P45B 2C2OB 2CDRB 4ZVOB 2XZDB 1RWWB 4ZVPB 4LSZB 3D6FB 1RWMB 3IBCB 1NMEB 2CJXB 2CNLB 2QL9B 3KJNB 3GJTB 2H5JB 1I3OB 2C2MB 3KJFB 3D6MB 1RWNB 2QLBB 2C2KB 2H65B 1RHMB 1SC1B 1RWPB 4JB8B 2H4WB 2QL7B 5IC6B 4DCJB 2FQQB 1RHQB 1RE1B 1RWKB 4ZVSB 3EDRB 1RWVB 4ZVUB 2XYHB 3R5JB 2QLFB 1I51B 3NS7B 1RHJB 2HBRB 3IBFB 1IBCB 1SC3B 1RWOB 2C1EB 4ZVTB 2XYGB 4DCOB 3SIPB 1RHUB 3D6HB 3R6GB 2DKOB 3R7BB 2Y1LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYO B;  2P2C B;  2H51 B;  3GJS B;  2H5I B;  5K20 B;  3KJQ B;  2XZT B;  1BMQ B;  1RWX B;  2QL5 B;  1SC4 B;  2H4Y B;  3EDQ B;  2CNO B;  1F9E B;  1GFW B;  1RHR B;  1QTN B;  2CNN B;  1RHK B;  4ZVQ B;  3RJM B;  2H54 B;  4ZVR B;  2CNK B;  2HBY B;  2XYP B;  2HBZ B;  3R7S B;  5IC4 B;  3GJQ B;  3R6L B;  3R7N B;  2QLJ B;  2Y0B B;  1PAU B;  1ICE B;  2HBQ B;  2C2Z B;  1QDU B;  3GJR B;  2CJY B;  2H48 B;  3QNW B;  3P4U B;  4DCP B;  3P45 B;  2C2O B;  2CDR B;  4ZVO B;  2XZD B;  1RWW B;  4ZVP B;  4LSZ B;  3D6F B;  1RWM B;  3IBC B;  1NME B;  2CJX B;  2CNL B;  2QL9 B;  3KJN B;  3GJT B;  2H5J B;  1I3O B;  2C2M B;  3KJF B;  3D6M B;  1RWN B;  2QLB B;  2C2K B;  2H65 B;  1RHM B;  1SC1 B;  1RWP B;  4JB8 B;  2H4W B;  2QL7 B;  5IC6 B;  4DCJ B;  2FQQ B;  1RHQ B;  1RE1 B;  1RWK B;  4ZVS B;  3EDR B;  1RWV B;  4ZVU B;  2XYH B;  3R5J B;  2QLF B;  1I51 B;  3NS7 B;  1RHJ B;  2HBR B;  3IBF B;  1IBC B;  1SC3 B;  1RWO B;  2C1E B;  4ZVT B;  2XYG B;  4DCO B;  3SIP B;  1RHU B;  3D6H B;  3R6G B;  2DKO B;  3R7B B;  2Y1L B; 
#chains in the Genus database with same CATH topology
 5A0Y A;  4KV8 B;  4J9O A;  4ED7 A;  4IH5 A;  5KG2 A;  1U1N A;  3PO5 A;  2QRR A;  2YTC A;  2RU3 A;  2VG6 A;  3VAL A;  4NRU A;  4M5L A;  3OXG A;  3LTO A;  2JH3 A;  3K58 A;  1HR0 J;  3QRP A;  3IMQ J;  4NA2 A;  4XO0 A;  4A8K A;  1Q7L B;  2C3Y A;  2HUR A;  5GME A;  5EWG A;  4PG6 A;  1NJI T;  4RBV A;  5CYM A;  1LWC A;  1RKJ A;  5KT2 A;  2DNZ A;  1O8B A;  4C8Y A;  2HWH A;  2DYA A;  1RHR B;  5F9N A;  1QTN B;  3RUB L;  4DLG A;  4LSL B;  4ID8 A;  1DQA A;  2B7B B;  2VB6 A;  3W60 A;  3CIZ A;  3C8Y A;  2GA7 A;  3DYA B;  3US5 A;  4ZLN A;  4Y65 A;  5HI7 A;  3M9N B;  4LJM A;  2L3M A;  4X64 J;  1VRT B;  4Q8F A;  1X4F A;  2BJ1 A;  2J8A A;  3I5B A;  4F26 A;  3BEG B;  3CJQ A;  2E1C A;  2JEI A;  2WVF A;  1O0P A;  4Q0B B;  2G2Z A;  4OYI A;  1S72 S;  1H0H B;  3W66 A;  2JDJ A;  4K0K F;  5F8L A;  3VAG A;  3TI0 A;  2L9D A;  3G2X A;  2IMO A;  4JV5 J;  4I68 A;  4WP8 A;  5C2G A;  1QD1 A;  3MD3 A;  1S1X B;  1YJW S;  4ERD A;  4ZMM A;  5HVF A;  4I0W A;  2GMH A;  1ICE B;  1NAQ A;  2VFV A;  1QVG R;  1KNZ A;  2QN6 B;  4LRB A;  3CNQ P;  4N56 A;  3GV7 B;  2OH2 A;  1FDA A;  4PQA A;  2HQ3 A;  3MED A;  4IG3 B;  3FSI A;  4DQI A;  1FJG F;  1HI8 A;  2F3J A;  3TAM B;  3C2P A;  2L9N A;  1WEL A;  2WSE C;  2GX8 A;  1MW7 A;  4P71 A;  4FYW B;  3EPI A;  3QJJ A;  1DTT A;  4XPE A;  2IRU A;  1U1L A;  2GHP A;  5T41 A;  2LEB A;  1N4L A;  1TKT A;  5KG0 A;  2RKI A;  4UY8 T;  5F8N A;  3PJ9 A;  3ZO7 A;  5L1J A;  4DR5 F;  1Y11 A;  3OW2 R;  4FDF A;  4M94 A;  3HVA A;  1R31 A;  2XNR A;  1NHV A;  3VHQ A;  2A6O A;  2X3D A;  1KQF B;  3MR6 A;  2BAN B;  1YSJ A;  3P5T L;  4Y00 A;  3IP0 A;  4KKO A;  4A8X A;  4CT9 A;  2IFX A;  4IFY A;  1KOO A;  4URS A;  3JSM A;  1OYD A;  4V19 X;  3HZG A;  1KFD A;  2LEC A;  1CS4 B;  1UZD A;  5DDR C;  4DFJ A;  3I96 A;  3RYL A;  3QO9 A;  4K4S A;  4CDI A;  1VCT A;  1AYE A;  4UST A;  2JWN A;  1HQ2 A;  2NYH A;  4LR7 A;  5D4L A;  2NS1 B;  4J9V A;  4KAI A;  5H1S V;  2IPO B;  2CJK A;  2ZH5 A;  3T5H A;  2CUY A;  5L1I A;  1RYR A;  4X4N A;  3MEG A;  3BV8 A;  5THW A;  2CPH A;  1YJR A;  1IBL F;  1OY9 A;  2CVE A;  4QIW D;  1SC1 B;  2KHC A;  3HJV A;  2KFY A;  4IG0 B;  1IWA A;  2V2Q A;  3GTY X;  2AGP A;  1HNZ J;  3KK2 B;  1M5H A;  4PAA A;  3H4D A;  4DR3 F;  4ED1 A;  2X1B A;  2Y1R I;  5HQM A;  3H40 A;  5ETQ A;  2NCK L;  3QLH A;  2W7O A;  4JI1 F;  2Y0S D;  4YEA A;  3TR5 A;  3K17 A;  1XR6 A;  4DV0 F;  2FD2 A;  1RE1 B;  3ISN D;  1RK8 A;  1SV5 A;  2OO4 A;  4F3M A;  1YX2 A;  1IKY B;  3AD7 C;  2HLT A;  2KJV A;  4M5D B;  4O3P A;  4RW8 A;  3OL9 A;  3MAQ A;  3Q83 A;  1VBZ A;  3MM5 B;  3GV5 B;  3EGN A;  3Q8Q B;  4NEZ A;  2HSE B;  3PYD A;  2DNQ A;  3EUN A;  2LA6 A;  2ROP A;  2AZ1 A;  2ZKU A;  4ITS A;  3T9Z A;  1PGZ A;  2XS2 A;  2HBR B;  3MMA B;  2GQQ A;  2B9W A;  4OX9 J;  2LU1 A;  2YBV A;  2WAQ D;  5G0R B;  1RZM A;  3CCT A;  3LAN A;  4YB6 A;  2VA3 A;  2NUH A;  1EJ7 L;  4ECQ A;  1VQS A;  2RH3 A;  2MQP A;  1PC5 A;  1QE1 B;  5B08 A;  2FDN A;  4X62 F;  1FRX A;  2MZT A;  1IKV A;  5CAA A;  1O51 A;  2AJ2 A;  3V4I B;  3GCX P;  4OYX A;  1JJH A;  3KK3 B;  2FPH X;  2QA4 S;  4OI3 A;  5L1K A;  1SKS A;  1LOU A;  3D2W A;  3QAT A;  1U26 A;  1R27 B;  4CYU B;  1LEO A;  2CPE A;  4DV1 J;  4X66 J;  1RI7 A;  1GAO A;  3JTN A;  2C22 A;  2KL8 A;  3A8J A;  4ZHR B;  4EYI B;  2B5J B;  1TU0 B;  2QE5 A;  2NQP A;  1X4D A;  4JI8 J;  2MLX A;  4FF1 A;  2PII A;  3DM2 B;  4DUY J;  2EBE A;  5E5N A;  2HFZ A;  1JQG A;  3FUY A;  3NWG A;  2X1F A;  1CLF A;  2C3M A;  1VYA A;  2EPI A;  4M5G A;  5J1P A;  2GZO A;  3A4T A;  1SPB P;  2BAN A;  4FF2 A;  4FN5 A;  2GIR A;  2PFF B;  2ACY A;  4BLG A;  2UP1 A;  2LQB A;  4F04 B;  1I5O B;  5T14 A;  2VU5 A;  2W7P A;  4NRT A;  5C2C A;  1UW9 A;  2CQG A;  4NYO A;  4RNM A;  4PAB A;  2JVO A;  4RW4 B;  4RR5 A;  4ED8 A;  4I2P A;  2XSJ A;  3BPS P;  3RB4 A;  1AB8 A;  1D09 B;  2DGX A;  4CYU A;  4Z2X A;  5K8O A;  5DM7 Q;  1KS2 A;  2HBQ B;  4L74 A;  1TQL A;  2J0W A;  4USU A;  4DSF A;  3X1L B;  5IT9 U;  1Q5Y A;  4AD6 A;  1N0V C;  2GJF A;  3PNI A;  2R2T A;  1YI2 S;  4KR0 B;  1ZZN A;  3H2U B;  1UZH A;  1VJW A;  4CWB A;  1F60 B;  1UWB B;  2HZC A;  3BSC A;  3UN3 A;  2IBK A;  1RT5 B;  3NKY A;  1C2P A;  3IS9 B;  5BYQ A;  4QWE A;  3G82 A;  1UEU A;  5MLC V;  1VQ5 S;  2DRB A;  1WHV A;  2DR6 A;  3QLH B;  3K5O A;  2R8H A;  3DLJ A;  4I6W A;  2BBE A;  2ALY B;  4M5H A;  3ONQ A;  2BEF A;  2J0Q D;  4QU7 A;  5GAH I;  1JLE A;  1FDB A;  2FVR A;  1B0V A;  4NML A;  2LQ8 A;  4HTI A;  5HVG A;  3EM1 A;  1U1Q A;  5D8H B;  1EP4 B;  3SEO A;  1IKY A;  1TUG B;  2F8H A;  4QPT A;  1HD0 A;  1S1W B;  2UUW A;  3F56 A;  1NDC A;  3G71 S;  5CQG A;  1XMO F;  3GJT B;  2XI3 A;  3HX9 A;  2DVI A;  4USJ C;  1QTM A;  1UTA A;  2MZS A;  3TP2 A;  3EGZ A;  2HHH J;  5D15 A;  2OML A;  6FD1 A;  2QYC A;  4F0M A;  2DGU A;  2YKA A;  2X1A A;  5DS7 A;  3JAM U;  4OX9 F;  4DEZ A;  4DL5 A;  2ATC B;  3EE3 A;  2A10 A;  4KKO B;  3NAH A;  2BM0 A;  2OEK A;  3FVY A;  3H7H B;  4CO3 A;  4DV1 F;  3DLK A;  4RW4 A;  2H65 B;  3MMB B;  2B9X A;  5B7W A;  3I87 A;  2RJZ A;  2DH9 A;  4MK8 A;  2KH9 A;  2UZA A;  3GE9 A;  1YBT A;  1V5I B;  2CPF A;  5D4O A;  2YWH A;  1FEH A;  2R7X A;  5JVG Q;  3R1H A;  4K2X A;  3GIM A;  3AJD A;  3DNC A;  2GVD B;  4JI1 J;  1RT2 A;  1UWA A;  2XCA A;  1JWW A;  3GR1 A;  2FGO A;  4WK3 A;  2E5L J;  1U02 A;  1RWK B;  2D3Z A;  1RIS A;  4I6A A;  3Q8V A;  1W2B R;  1HPZ B;  2WCX A;  4MKY A;  3FBC A;  3N5F A;  2NXC A;  2VG7 A;  5B0B A;  4TU8 A;  4ECY A;  2OPS B;  1RHJ B;  2PO4 A;  1AXQ A;  1S6O A;  2OSQ A;  4DSE A;  3CD5 A;  1XMQ J;  3CD0 A;  3AY0 A;  4PYA A;  4CLS A;  4ZLP A;  2D7S A;  2ZD1 A;  3M2V B;  5ITH A;  2R7T A;  3K57 A;  2VQE F;  1U49 A;  1N56 A;  3HVR A;  1R0C B;  2BKN A;  1HNV A;  2B7C B;  1YJT A;  4CLF A;  2BX6 A;  1RHU B;  3NNC A;  2DHX A;  1XN9 A;  2V4J A;  2C3U A;  5EN1 A;  3BYR A;  3N01 A;  3DLG A;  1S12 A;  2E1M C;  3CSK A;  5SUH A;  2IA0 A;  4XIU A;  1IUJ A;  4Q0B A;  1WC4 A;  3KWM A;  3M9M B;  4DX8 H;  1NZA A;  2E44 A;  3TUZ C;  4LRE A;  5CYQ B;  2XO7 A;  2IM2 A;  4FVC A;  1HQU B;  3DRP A;  2YKN A;  4I7F B;  5ETP A;  4IDK B;  5GVQ A;  4XAK A;  2QG9 B;  3KLE B;  4OZJ A;  2HQI A;  1EP4 A;  1B99 A;  1OMS A;  2DR8 A;  2HQD A;  2NSB A;  2Z4P A;  4CTA A;  4C11 A;  2GNK A;  3R5C A;  1IM6 A;  7AT1 B;  2GQC A;  3CCE S;  4DR7 F;  1GH8 A;  5HBM B;  2OTL S;  2UVR A;  2KG1 A;  2HLU A;  4PG4 A;  4X62 J;  4OV6 A;  4M5J A;  4ZVQ B;  2F8E X;  4R0E A;  4ED0 A;  3W3S A;  3KLV A;  3GG0 A;  2U1A A;  1NK0 A;  2MYF A;  2R7S A;  2M9K A;  3GJQ B;  1H2V Z;  3MF5 A;  1ITP A;  2OKQ A;  1R3N A;  1T3O A;  2HQG A;  1RAC B;  5LJ5 Y;  3NOG A;  1S59 A;  4LF5 F;  1NPP A;  4ALZ A;  4ZIW A;  4JI5 J;  3DU5 A;  1FEE A;  1UEV A;  3MEG B;  1WKJ A;  4ZCK A;  3GFX A;  3QRQ A;  1F3V A;  4C2M A;  1YLX A;  4Y2K A;  3E51 A;  1NPR A;  3EPG A;  3N0V A;  3OHA A;  1ROF A;  1K1S A;  2ROG A;  1FXR A;  1NK8 A;  1V6H A;  1RT7 A;  2J9E A;  5LL6 d;  5F9L A;  1CS4 A;  1C0T B;  2MY7 A;  4X64 F;  2UXB F;  1R6V A;  1U6Z A;  1XQI A;  1FXL A;  1CJU B;  3MMJ A;  2ZWO A;  1OQ6 A;  1EHW A;  4J9K A;  5EUH A;  1LQ9 A;  2V2V A;  4DV5 J;  2FZC B;  4P7V A;  4WWS A;  3DLH A;  1IBL J;  4HYK A;  5DQI A;  5DO2 A;  4ZVO B;  1U1K A;  3N28 A;  3H59 A;  1UMJ A;  1W25 A;  4TKT A;  3GLJ A;  5KFQ A;  2E9T A;  1VHI A;  2JLG A;  2VPY B;  3D6F B;  3SFG A;  3PRB A;  3FCW A;  1FNX H;  2FGC A;  3MEE A;  2ZJP Q;  5FLX Y;  1WI8 A;  4GO7 X;  1NH8 A;  3FMW A;  1DQ9 A;  3NGR A;  3ZZY A;  1HL6 A;  5I3P A;  2OIH A;  4JP8 A;  3B54 A;  4BWM A;  1VBX A;  3DOL A;  1UVL A;  1NSP A;  2RNE A;  3W8G A;  3BN4 A;  1YQH A;  1HWI A;  3NMA A;  2BE9 B;  2EEY A;  1G4C A;  1YG0 A;  3E8O A;  3PEJ A;  5ETN A;  3CCL S;  2XY7 A;  1C1C B;  3Q2T C;  5KFU A;  2W7A A;  2C2K B;  1OSD A;  2OPR B;  2VPW B;  4OYZ A;  2EK6 A;  4R25 A;  1WHY A;  2IYG A;  1UVM A;  4K2J A;  4DV7 J;  1UFL A;  3E01 A;  5E2Q A;  3AOD A;  1OY8 A;  3GWC A;  1Y00 A;  4QPX A;  2COL A;  3KDO A;  1UVN A;  4DQR A;  1FO1 A;  2DRD A;  2F40 A;  3ZNJ 1;  5IM0 B;  3D3B J;  3M6U A;  1EIY B;  4TY8 B;  2ZC3 A;  3B78 A;  3RBZ A;  1C1B B;  3JB9 k;  4JI6 J;  5DRK A;  3CCR S;  3CC7 S;  2Z30 B;  2JNJ A;  2XYH B;  1EQM A;  1ELO A;  1FK9 B;  1U0H B;  3H20 A;  2HRU A;  1UEK A;  3LUY A;  3NS7 B;  3R5J B;  4K8R A;  4MFB A;  5L38 A;  3J81 Y;  3I0R B;  2NRE A;  3HHE A;  1VK8 A;  2HZA A;  3I4H X;  5KG4 A;  4MJK A;  3QQC D;  4X65 F;  4GMK A;  2HZV A;  1IBC B;  3SQG B;  3M1V B;  4CM0 A;  4YDX A;  1IR2 A;  2B9E A;  1KSP A;  2DXF A;  4G6V B;  2CQ2 A;  5HK4 A;  5M2R A;  2W9B B;  4G3I A;  2NR0 A;  1SB6 A;  3WX4 A;  4K4U A;  3WIV A;  3CED A;  2H1Y A;  3ETO A;  2VJV A;  3CUL A;  1XMB A;  4EO8 A;  2P2C B;  1RT7 B;  3GFH A;  2AU0 A;  4BS2 A;  5A6W A;  1N36 J;  1LXN A;  4KHR A;  2RQ4 A;  2EFV A;  1FA0 A;  2YWG A;  2ZFH A;  1Q81 T;  4KGX B;  4YQW A;  2GJI A;  5DLF A;  3MPW A;  5C7P A;  4JI3 J;  3LP0 A;  1TV6 B;  5HLF B;  2XSJ B;  4LF9 F;  1RWX B;  2HNZ B;  2G4B A;  4EK2 A;  1BY9 A;  3B8H A;  5KFF A;  1IVZ A;  4FYX B;  1KDN A;  1WEZ A;  1WG1 A;  3MGJ A;  2FHK A;  3J81 j;  1BHN A;  1UKU A;  2B8Q A;  3DMJ A;  1FKP A;  4PXB A;  4U96 A;  5A0Y B;  2UUC J;  1TKT B;  3D66 A;  1VLO A;  2CZ9 A;  5J2Q A;  1N5Y A;  2M88 A;  4TYA A;  3MMC A;  3PW0 A;  1NK7 A;  2WSC C;  4KGZ B;  3T3F A;  2F4V F;  2XTJ P;  3NGK A;  2HBY B;  2DBB A;  2QYG A;  3FSY A;  4KFB A;  1MWQ A;  2O3D A;  3O44 A;  4DPO A;  3TAM A;  1HHS A;  1VIX A;  2FY8 A;  2FVC A;  3IA0 A;  3R27 A;  1YRT A;  2Y1I A;  2HVH A;  2KFN A;  3V81 A;  2XMJ A;  2A2C A;  1T9U A;  2BA9 A;  2AEM A;  3UDV A;  5HQ8 A;  5IXU A;  2XGP A;  3C46 A;  2O67 A;  1WSV A;  2VFU A;  3V2U C;  1L5U A;  1BLU A;  3M2R B;  3L7U A;  4ZCI A;  1FES A;  1WJ9 A;  5IQ6 A;  4RW9 B;  3J80 Y;  1HW9 A;  2A18 A;  3UW1 A;  1RTH A;  4RNN A;  3KNA A;  9RUB A;  1D0E A;  4BC7 A;  4K4Z A;  3IRW P;  1RBL A;  3CJ2 A;  4FXD A;  3I4P A;  3PFE A;  1GXU A;  3KXD A;  4C98 A;  1J27 A;  3QMQ A;  3GIJ A;  3SYZ A;  4ELU A;  4CLT A;  1ZOT A;  2JEG A;  3A12 A;  3GP9 A;  1HMV B;  2OPP A;  4HVZ A;  3DYA A;  4PXE A;  2N7C A;  4DUT A;  1TMM A;  4LSL A;  4C3K A;  3M8R A;  3FCH A;  1X5O A;  2RUG A;  3SMZ A;  3TZW A;  3U7J A;  2DNM A;  1NME B;  2CWX A;  3OL6 A;  3CCW A;  3EZO A;  1N6Q A;  3FK4 A;  3S01 A;  1RAE B;  2XY5 A;  3BQ1 A;  2B56 A;  5L1L A;  4FPR A;  1X5T A;  1N5Y B;  5AXL A;  3VAF A;  5D0H A;  3EVW A;  1X0F A;  1QJH A;  1NDL A;  1TKX A;  4LRF A;  3U1L A;  4DN0 A;  2E9R X;  2V8P A;  1S0O A;  2HG4 A;  4UOC A;  2DR7 A;  1S9G B;  4B9L A;  1NB2 A;  1Q78 A;  2B43 A;  4HH0 A;  5BYR A;  4LBH A;  3SCK E;  5RUB A;  1HYS B;  1RAO A;  2B4P A;  4DU7 A;  4CIO A;  4WU2 A;  2FJX A;  3GG1 A;  2EVZ A;  4N76 A;  3J7A 1;  3BGR A;  5AXM A;  4ZPW R;  4USW A;  1VC5 A;  4F4A A;  2YNI A;  5F41 A;  4O4R A;  3W2W B;  1SQF A;  1U1O A;  2CIM A;  4WP3 A;  3AD8 C;  3NGU A;  3PCO B;  1FRM A;  4ES1 A;  4HT7 A;  2EG1 A;  3BGF A;  2AEJ A;  1CJK B;  2FQQ B;  2X51 A;  3L7O A;  3C6U B;  3PJW A;  4KSE B;  2AHO B;  2ZBR A;  4PZV A;  3KLG A;  2BR0 A;  2DEJ A;  1C0U A;  3NCQ A;  1Q0N A;  4QOT A;  5KFN A;  2BQU A;  4JV2 A;  4D3H A;  4RX6 A;  1WC1 A;  4DG1 A;  3RB0 A;  3I0S B;  4NX9 A;  4JI0 J;  3ELH A;  4KQZ A;  3VGT A;  1I51 B;  4ZVF A;  3JAM Y;  5I3U A;  2IHR 1;  1Y5I B;  2DHG A;  4PEO A;  1PJ7 A;  4LVN P;  4C11 B;  2DHH A;  4LRA A;  5FLX U;  2ZNY A;  2HNY B;  2QJ3 A;  4ED5 A;  2GO9 A;  4YB5 A;  2W2P P;  5LMN F;  4NLY A;  2EKN A;  2CDQ A;  1FX2 A;  2RHQ B;  5K5M A;  2FC8 A;  3R5B A;  5J2P B;  2DKO B;  4Q45 A;  4A8M P;  1UJ6 A;  1DJ0 A;  4L3N A;  5HP1 A;  4LFB F;  2OHD A;  3DXB A;  1IBK F;  1TL3 A;  4P10 A;  2V4Q A;  4UOF A;  4AL7 A;  1TK5 A;  5LOQ A;  3BF4 A;  2OMO A;  2GAG C;  3PKM A;  3N6L A;  2BXJ A;  1S0M A;  5ETT A;  5B09 A;  1F1B B;  3SBM A;  4HTJ A;  1M5V C;  4G1Q A;  1SXL A;  3V81 B;  4K5S A;  1SI9 A;  2BRK A;  3NMR A;  1U2R A;  1SJ1 A;  2CG4 A;  4QIG A;  2AYE A;  2JL9 A;  3MZI A;  1MN9 A;  4JOU A;  3GB0 A;  4O0N A;  4UUX A;  4TU9 A;  2C28 A;  4NCA A;  1YZ6 A;  2GHW A;  3KYL A;  2PMH A;  1H2T Z;  2XZW A;  4JI2 F;  2DR9 A;  1VI7 A;  3CDE A;  5K14 B;  3TA0 A;  3DOM B;  2PT0 A;  1CC8 A;  2QTW A;  2HBZ B;  3L4B C;  3R7S B;  3Q8R B;  1WC6 A;  4LQ3 A;  3GYX B;  3TA1 A;  2OTJ S;  3I9V 9;  5KFM A;  3R7N B;  4X66 F;  1CVJ A;  3JTP A;  2N4D A;  5KFI A;  2KXF A;  4JV1 A;  3ZXW A;  3KLF A;  3KHG A;  1HBM A;  2ZH6 A;  1WG4 A;  2EI5 A;  3CB4 A;  4O44 B;  2HQC A;  2WSF C;  4O3Q A;  2BOA A;  2CJQ A;  1LFP A;  3GON A;  2R7Q A;  3G87 A;  5KOW A;  1O5J A;  1H6K X;  1F5B A;  3GJR B;  3IFE A;  4MIW A;  4OZ2 A;  1ARO P;  1CC7 A;  1RU2 A;  1IKV B;  4NL5 A;  4S0M A;  4DZ6 A;  1IR0 A;  5AE3 A;  4ICL A;  4F50 A;  3TQ1 A;  1YRU A;  2NYI A;  2AGO A;  2UXB J;  3BRE A;  3S6E A;  1LW2 A;  1L3U A;  4KC5 A;  4TY8 A;  4X4R A;  2MKK A;  2J6T A;  3U1M A;  2R7R A;  4RZR A;  5K8N A;  3NXZ A;  2BV3 A;  4PWU A;  3OUY A;  1GX5 A;  3DLB A;  1YBA A;  3H98 A;  4OZ5 A;  5F0W A;  2MTL A;  2ZBP A;  4LQ9 A;  2LKZ A;  5LXR A;  5E3R A;  4J9Q A;  4R5P B;  2PDA A;  4JYA J;  1G1X A;  4JI4 J;  3MR7 A;  1RWM B;  1HFE L;  3IRX A;  2XLJ A;  4DR1 J;  2BQR A;  2XB2 D;  1LK5 A;  1SVD A;  1TL1 A;  3D7S B;  3T19 A;  3UNG C;  2QC3 A;  4CNZ A;  3DOK A;  4HHH A;  4NZ0 A;  4IO9 Q;  2XS7 A;  2MGZ A;  1ACM B;  1TEL A;  2H5J B;  4MAK A;  1DUR A;  1VC0 A;  2QX0 A;  4DV2 F;  1F2H A;  1YRX A;  2XGQ A;  3NGD A;  5HQL A;  3O5T B;  3GIL A;  2ASY A;  1ZET A;  2PEH A;  3KJF B;  4BDP A;  2LXI A;  1H74 A;  3G8T A;  3O1L A;  1B0P A;  1R0A A;  3CT9 A;  1S6Q A;  1Y3K A;  3G96 A;  3OV7 A;  1PBA A;  4ZS6 A;  3CCZ A;  2IVM A;  5EX0 A;  2R2S A;  5DG7 A;  3DHX A;  2O66 A;  3BGU A;  2YX1 A;  2RAQ A;  3BZQ A;  2AEF A;  3DN9 A;  1YJ9 S;  1N34 J;  4N41 A;  3LGN A;  2Q3P A;  1CG2 A;  3OHB A;  1SJQ A;  4P74 A;  3SDE A;  4R8U B;  2V34 A;  2XQC A;  1SH3 A;  3OL7 A;  1X60 A;  3DRS B;  1CUL A;  4LBP A;  4UF4 A;  3M8Y A;  2CWK A;  4IR1 A;  4DR6 J;  1AW0 A;  1RA6 A;  3JSM B;  4ECT A;  5KG1 A;  5DDO C;  4FBT A;  3TEH B;  1B7Y B;  3LAM A;  5K14 A;  1RWV B;  1QSY A;  2PSZ A;  1HD1 A;  1S7H A;  1GMW A;  3PZP A;  3OFF A;  2MZ1 A;  2JC0 A;  3MM8 A;  1G7C B;  2NXU A;  2HHS A;  3W5Z A;  4CO1 A;  3GQC A;  4B3S F;  2IVY A;  3I56 S;  2SXL A;  1IJF B;  2F8M A;  4G1Q B;  1NJZ A;  2R7V A;  3CJ8 A;  1FJE B;  4OQJ A;  2D3U A;  5J1N A;  1OSC A;  2C1E B;  4P72 A;  3A3N B;  2RVJ A;  4MT1 A;  2FHJ A;  2J0X A;  5HJY A;  5HN0 A;  2GVD A;  3SIP B;  4DLE A;  4OI6 A;  3JYT B;  2W8K A;  2E5L F;  4IFV A;  3ENA A;  1RAD B;  3BJY A;  1FJG J;  5ETO A;  1RXO B;  3HVT B;  2KM8 C;  3MM9 B;  3MR5 A;  2QV6 A;  2HW3 A;  1S4E A;  1PIE A;  2DNO A;  2K3I A;  3FRZ A;  2RQC A;  2W9C B;  3PY8 A;  3ITH B;  4Y34 A;  1OJ4 A;  4TN2 A;  1R0A B;  4I1T A;  1JKH B;  2V9W A;  3BKT A;  3UCG A;  1S99 A;  1T95 A;  4AXI A;  2XMV A;  1M1K T;  5IS2 A;  3VF0 B;  1FRI A;  4J9R A;  4K0K J;  2HWI A;  2FZK B;  1HLW A;  1ZZF A;  1CQM A;  1PBU A;  2J9C A;  2W2M P;  3W9I A;  4XDC A;  3P8B B;  4ZN3 A;  1AUS L;  4IDK A;  4P9S A;  2MXY A;  5GAD U;  2H54 B;  5D4P A;  4DSL A;  2CNK B;  4C8Z A;  5J2M B;  4OLO A;  4OYA A;  2UUB F;  1REV A;  3D54 A;  4CNY A;  1HNX J;  1FD8 A;  2DH7 A;  3EGV A;  2OPQ B;  2PA3 A;  2QLW A;  1YHQ S;  4GVB B;  4ENO A;  5GMK a;  2G0C A;  2I38 A;  5ETM A;  4X4T A;  4RKU C;  4DPX A;  2CZV C;  2QLJ B;  1RTZ A;  3GFY A;  1Y5N B;  1E6Y A;  2CVI A;  4DDF A;  3QWU A;  3MFI A;  2VFT A;  2EXU A;  3KFW X;  4YR2 A;  1NSK L;  4DBQ A;  3OFH A;  3JS9 A;  2UU9 J;  4F8R A;  2KYX A;  2Q66 A;  4JI3 F;  2ZOG A;  1QDU B;  2ASD A;  2CFX A;  3JSR A;  1T05 A;  4OV1 A;  2J6S A;  4UUW A;  3WBZ A;  4B3M J;  4NXM J;  3CXC R;  2V2Z A;  5GAG I;  3AHP A;  1RP5 A;  2I8E A;  5LMN J;  4HHU A;  2ZJQ Q;  3K5M A;  1UJ4 A;  3V5R A;  2E5I A;  1EKR A;  5A76 A;  5LMU F;  1URR A;  2DGT A;  1XWL A;  3EWG A;  4IH6 A;  1CUL B;  4OYO A;  3A8E A;  3QT8 A;  3RU0 A;  1DHM A;  1U48 A;  4B3T J;  5BXI A;  4J9P A;  3NWR A;  1JX4 A;  3LF0 A;  4ZCL A;  3BR8 A;  2CQH A;  3VV2 B;  4ANE A;  5F0U A;  1QUP A;  1BGX T;  3PDN A;  3VGS A;  2YKO A;  1YVF A;  2LQ5 A;  2A6M A;  1RU1 A;  1T7P A;  1HA1 A;  2M2B A;  2YWE A;  3QGI A;  1CJU A;  5KFT A;  4YP3 A;  1GNK A;  3OFE A;  1NK6 A;  3AD9 C;  3BBC A;  3M32 A;  3PJX A;  4WIQ A;  4ED2 A;  1NEE A;  2BDP A;  4B3R F;  1RT6 B;  1H7W A;  3CJ4 A;  3TA2 A;  3W8P A;  4Z7Y A;  4ZDN A;  4WFZ A;  3RBX A;  2YNF B;  1FVS A;  3K5P A;  5LM7 E;  4ECZ A;  2YVS A;  2EBG A;  3PTW A;  1QAI A;  2HMI A;  1G6B A;  3H8Y A;  1TFW A;  4C9D A;  1T9V A;  2FLN A;  1JLE B;  1MWY A;  4C8K A;  4PXD A;  3TO8 A;  2WB4 A;  4UOH A;  2H4W B;  5K8M A;  1I94 F;  3ILO A;  2ZH1 A;  4ELV A;  2HQF A;  2WVE A;  2ILY A;  1T05 B;  4PG7 A;  3AAW B;  3ILI A;  1R89 A;  2EFN A;  2FJB B;  4NAS A;  3G82 B;  3H5Y A;  3BSN A;  4Y28 C;  4ZA1 A;  5GMD A;  1Z2Z A;  5HAN A;  2HK2 A;  2AF6 A;  2IM1 A;  5JVH Q;  4OL8 A;  3EYZ A;  1JLB B;  5CCM A;  1KHV A;  5IQQ A;  2WB1 D;  3HMJ G;  2BJ8 A;  2B3T B;  2KM8 B;  4IG0 A;  1UP1 A;  3TZX A;  3IAM 9;  1S0V A;  1R7I A;  4X4Q A;  1Q1K A;  3MM7 B;  1L3K A;  4TQR A;  4MK7 A;  1FFW B;  3PW7 A;  1UPP A;  1Y9O A;  4LBI A;  5EHH A;  3LP0 B;  1V9O A;  4B02 A;  1X5S A;  4J90 A;  2CPX A;  2HWT A;  3PHE A;  4DV5 F;  1S9F A;  3SXL A;  1MRO B;  4ZPT R;  4C97 A;  2CPI A;  3QGG A;  3UCZ P;  3U1N A;  1RT6 A;  1YBU A;  1LWE B;  4C8N A;  1VQ9 S;  3M32 B;  4ZLJ A;  1OIA A;  3RW7 A;  1MSW D;  4TLQ A;  3AQP A;  2E5G A;  1FXD A;  4CM2 A;  3BR9 A;  4PWD B;  1JLQ B;  1FWK A;  1K44 A;  1XBW A;  4L6V 3;  4YUD A;  3MR3 A;  3CD6 S;  4X65 J;  3OSP A;  1RUS A;  2XZT B;  3C16 B;  1TK0 A;  2AT1 B;  1HBM B;  2DXE A;  4IKA A;  4DHV A;  1GMV A;  1SQE A;  2OPS A;  4DQQ A;  5HMZ A;  4EO6 A;  1PIL A;  1PSD A;  5KFL A;  5J2N B;  4C3L A;  4ETZ A;  3RBE A;  1FK9 A;  3W2V B;  4TNO A;  2DNN A;  5I3U B;  1QAJ A;  2Z56 B;  1T0T V;  3ETM A;  2RDJ A;  4OYM A;  1IKX B;  2HAI A;  3BO4 A;  4K4V A;  3PYG A;  4CO2 A;  1JXE A;  2E1P A;  4P75 A;  5I4M A;  2D9P A;  1VQ8 S;  2XLI A;  4PQU B;  2K7K A;  2N82 B;  1PYS B;  2IDE A;  4F4X A;  2VHG A;  4DR7 J;  1OO0 B;  5E41 A;  4OJ1 A;  3DI6 A;  1R8A A;  3MM6 A;  4MKB A;  4GVL A;  3PEH A;  3EJM A;  2KDO A;  2M3D A;  2V8D A;  2ZDO A;  3FEZ A;  3QT7 A;  1B4S A;  5DQH A;  4X4S A;  1HNW J;  1HMV A;  1WNE A;  4UY8 5;  4CZC A;  1FFG B;  3DLE B;  3W63 A;  5F8M A;  3IWX A;  3EVO A;  4LR8 A;  1R43 A;  4KIA A;  2AJ1 A;  3DFE A;  2CXE A;  3QSI A;  2CPY A;  1BQX A;  4O23 A;  3M2U B;  1S1W A;  1WI6 A;  3JQJ A;  3SCJ E;  1FRH A;  3CDU A;  2AQ4 A;  2IM0 A;  5KFW A;  1RKI A;  1NND A;  2CG8 A;  2M5Y A;  2Q1L A;  2V5H G;  2FJD B;  1MML A;  2VQE J;  1BWE A;  3AB4 B;  4IRC A;  3OTO F;  3TAQ A;  4NLQ A;  3I82 A;  1NRK A;  2HFO A;  1RCX B;  4KY3 A;  4PXC A;  4MTP A;  4HI2 A;  4Y2C A;  2I6W A;  3UE2 A;  1JLC A;  4KT0 C;  3GFZ A;  2AYG A;  1MLA A;  1FFS B;  3LP2 A;  3MTK A;  4DG1 B;  2JLE A;  5ETS A;  2HND B;  2R2U A;  4C6A A;  3IS9 A;  1RAH B;  2WOM B;  4PG8 A;  3D3C J;  4CCH A;  3N9U C;  3IRX B;  2C2M B;  3D4J A;  3SSQ A;  4M95 A;  1C0T A;  4U9R A;  2J0S D;  2BJ7 A;  2RIL A;  3UR3 C;  4C3M A;  2EC0 A;  1CJT A;  3UDC A;  3I55 S;  4KBI A;  3C19 A;  3SCL E;  4F4Y A;  3QGH A;  1OQ3 A;  4PRF A;  3UD3 P;  1T8E A;  2VFS A;  4M5M A;  1DLO A;  4QR2 A;  5T7L A;  2VG6 B;  3VR1 A;  2MKS A;  1Z4U A;  1NBE B;  4EFA C;  2YWF A;  2AKW B;  1WOO A;  2JC1 A;  1TKX B;  5GAE I;  2BW7 A;  3QGP A;  2XHC A;  5EGY A;  4USI A;  1NKB A;  2YWW A;  2ZBQ A;  3OBI A;  1R8B A;  2F1F A;  3D67 A;  3V6D B;  2QFI A;  4N8O A;  2J6U A;  4IRK A;  1X4H A;  4N77 A;  1TZ0 A;  1WF0 A;  1RBA A;  1ZM2 A;  2KJW A;  1IR1 A;  2FLO A;  2ILZ A;  1DAR A;  2DGQ A;  3A1Y G;  4LRC A;  4M5I A;  3KLH A;  2V4R A;  1H38 A;  4TY9 A;  1VIS A;  3BO2 A;  4DFK A;  3EIC A;  4IG3 A;  3IR5 B;  1WSR A;  2RKI B;  4WYW A;  3MI7 X;  1RAF B;  4CI0 B;  3A3O B;  1JIH A;  4BHQ A;  4DQS A;  1JJ4 A;  3G9C A;  3NP5 A;  4ZPC A;  3T5L A;  3G6E S;  4QIF A;  5KFP A;  2IY5 B;  2XHW A;  5B0A A;  1S10 A;  2MLY A;  2NUU G;  5IM0 A;  1JJ2 R;  2RD5 C;  3BSA A;  3HHL C;  2DGW A;  2KYZ A;  4BC9 A;  3OLA A;  4KFB B;  3E01 B;  4OHZ A;  2VON A;  2H51 B;  4NXM F;  2KN4 A;  1VQY A;  5E3C A;  1NK5 A;  1ZA2 B;  2ZNZ A;  3VAJ A;  1U8W A;  4FBU A;  4DUZ J;  5IT0 A;  4Y6I A;  1XMQ F;  1MWZ A;  3FDS A;  2R8K A;  3C66 A;  1BMQ B;  3CJ0 A;  2W4P A;  1LKZ A;  3AJ1 A;  3MEC A;  2K7J A;  1WTF A;  1S9E A;  5IWA J;  2JEJ A;  4LF7 F;  4ZN1 A;  3DMJ B;  1N5S A;  4FS1 A;  4DR4 F;  1FT8 A;  3CCJ S;  3H42 A;  4FPI A;  3K59 A;  5LXY A;  4KHP J;  3FFI B;  1REV B;  1DY3 A;  1F3F A;  2DD8 S;  2VG7 B;  3NCR A;  4P2X A;  4XDD A;  4A4J A;  4U67 Q;  1KQG B;  4ZJQ A;  4F3O A;  4I6Y A;  7FDR A;  5KFK A;  3T41 A;  1ZPV A;  2JX2 A;  3VZH A;  2XYP B;  2JSX A;  3Q89 A;  2UXD F;  4CO5 A;  3JSB A;  3LH2 S;  1ZTT A;  1HBO A;  2KI2 A;  4AE5 A;  2IM3 A;  3U27 A;  3R6L B;  1U1R A;  4CH7 A;  1RB0 A;  5DET A;  2F63 A;  3HFZ B;  2OD6 A;  1EAR A;  3M8P A;  3L09 A;  2H3E B;  1JKH A;  3LQV A;  2KXH A;  5HAO A;  2C42 A;  4FKX A;  3PG9 A;  4Z7C A;  4N47 A;  3T6B A;  4A8Q A;  2QFJ A;  3QZ7 A;  1HW8 A;  4IQM A;  3TAN A;  1JLA B;  4K59 A;  3G6X A;  1P9Q C;  1MN7 A;  2AW0 A;  2ZH3 A;  3UVJ B;  2N3L A;  3KHL A;  3DRY A;  3PKY A;  1S97 A;  4DV3 F;  1SL2 A;  4B3R J;  3THP A;  4QYZ J;  1TAQ A;  2MQN A;  3I9Z A;  2DCL A;  3QYY A;  1SJF A;  1S49 A;  3GSI A;  1U47 A;  1S1T A;  1NSQ A;  1KQS R;  3C3L A;  2MQ8 A;  1RCO B;  1VQ7 S;  4IFY B;  2MHE A;  3V6J A;  3O2I A;  2V0N A;  3FZB A;  4DSK A;  1NCL A;  3OTC A;  1FTR A;  4CRJ A;  1N32 F;  2YWK A;  4OHY A;  1ZH5 A;  5C25 B;  1RWW B;  4RW6 B;  5KOX A;  2HAF A;  1JLF B;  1VDH A;  2IJR A;  4BWJ A;  1P27 B;  1ZYQ A;  1AZS B;  2DEI A;  4NLU A;  1E6V B;  2CJX B;  1RTI A;  2AZ3 A;  2M70 A;  3CJ5 A;  3I32 A;  3N5B A;  2W1B A;  2ZWP A;  4DL7 A;  2UVW A;  3KUE A;  1DTT B;  4KB7 A;  3QT5 A;  4DN9 A;  5EWF A;  3P6Y C;  2VIH A;  3VWS A;  1D8Y A;  4DR6 F;  1GMW D;  4R8U A;  3SDE B;  2VD3 A;  4QIE A;  1FHT A;  4ED4 A;  3IM8 A;  2BJE A;  2IC3 A;  3TEG A;  5F3Z A;  2VBW A;  2W9A A;  5I3Q A;  4OZN A;  1HKA A;  1YJU A;  5BR8 F;  4NXN F;  4H4K C;  1WWH A;  2D69 A;  4C0H A;  2FHO B;  3KDN A;  4IO1 A;  4OJG A;  3BSO A;  4AUK A;  2QO3 A;  3Q24 A;  4J9M A;  2MKJ A;  3ADA C;  1LWF B;  2ADB A;  4DSJ A;  2XY6 A;  2YNG B;  4QZV B;  1C4A A;  1BE4 A;  1FKO B;  5A6P A;  2OGU A;  2QA4 G;  3VTI A;  1APS A;  4NYP A;  5LSL A;  2ABY A;  3K5N A;  4K50 A;  1VGY A;  2CA9 A;  4DL0 C;  5KFH A;  4E2F B;  1MMN A;  4ZVS B;  2LA4 A;  3MUM P;  4DV6 F;  1OWX A;  1L3V A;  1PG5 B;  4RUC A;  1KKH A;  3OR2 B;  4J5O A;  3DM2 A;  2XBP A;  1JNR B;  5B0G A;  9ATC B;  1U45 A;  2UXC F;  2MZJ A;  4RW6 A;  4I56 A;  3AQO A;  4JYA F;  2OEL A;  5CYM B;  1DTQ B;  3EZU A;  3FBB A;  3LW5 C;  2YH1 A;  2YNI B;  4OLP A;  5KFS A;  2FC9 A;  1YGY A;  4Q43 A;  1S1V A;  5KFR A;  3VVT A;  1RWO B;  1N54 B;  2CQC A;  2DB1 A;  2GIF A;  3MPY A;  3VGU A;  4EBE A;  4QJV A;  4LFA J;  3IN5 A;  2Y8W A;  4U6P A;  2KO1 A;  3OSN A;  1X9M A;  2QZ8 A;  1R8P A;  1WKK A;  3D6H B;  3ENQ A;  2WW4 A;  4KV8 A;  4ES3 A;  2DNP A;  1Z2L A;  1L3T A;  3HVW A;  4L72 B;  4B9T A;  4OZL A;  1PYO B;  3DLL Q;  2ZHA A;  2ZZT A;  3QIP A;  3HDS A;  1NK4 A;  1UFW A;  2LEA A;  1KFS A;  3KG1 A;  3SQG A;  3HD1 A;  3L9Z A;  2E5H A;  5G0R A;  3HM9 A;  2BAC A;  2FVQ A;  2KB2 A;  1JLQ A;  2GV1 A;  2Z8Q A;  3G86 A;  5JJB A;  1BWV A;  3M8P B;  3RRK A;  4WKY A;  2HHV A;  1NO8 A;  1RJJ A;  3J7Y I;  2H4Y B;  1Q8L A;  3CDW A;  4DFM A;  2HFN A;  4NZ7 A;  3NG8 A;  4J9N A;  1RA7 A;  2YPZ A;  1U1P A;  2VG5 B;  1O6X A;  1I1G A;  1Q86 T;  4ZP8 A;  3DOM A;  3S1T A;  3TJA A;  2MKY A;  1TFY A;  3RB6 A;  1FKA F;  4IOC Q;  1XR7 A;  1PKU A;  2XEX A;  2ZC4 A;  4J7C A;  1MU2 B;  1T11 A;  4QW8 A;  3M1V A;  2JFK A;  3SCI E;  1UVI A;  1G3O A;  2VKZ G;  2V94 A;  4PPZ A;  3DLG B;  4HAC B;  3I0R A;  4BBY A;  3QJL A;  4H4M A;  1KN6 A;  3CO9 A;  1NKE A;  3W9J A;  4NCG A;  3DLE A;  3OL8 A;  4QR0 A;  2OPR A;  4G1P A;  2Y0B B;  4NPO A;  1KQK A;  4QR1 A;  2EFO A;  2QSW A;  2OLW A;  1EET B;  2VBX A;  1SCJ B;  4YN3 B;  3X3U A;  5HMY A;  4A8Y A;  2YQ3 A;  2RF2 A;  5A8W A;  1YTY A;  4PUO A;  4X4V A;  3DI6 B;  2W9C A;  3GYN A;  4ELT A;  2P5V A;  1FJC A;  2QA2 A;  4LR9 A;  1K47 A;  2HIQ A;  2RHS B;  4W98 A;  5CZX A;  1RTD A;  3CUN A;  3QO9 B;  4FYD A;  4DCP B;  3MEK A;  1RAA B;  4DU8 A;  5AXK A;  3VAK A;  2CAD A;  3ZZZ A;  4IOA Q;  3FJ2 A;  1LWX A;  5KFY A;  2BJ3 A;  1F6T A;  2M0G B;  5J2Q B;  1BC6 A;  5DDQ C;  2FHM A;  2DCU B;  3W64 A;  3AJ2 A;  3PRD A;  4P2S A;  3JTO A;  5D0E A;  1Q4R A;  3MM6 B;  4Q44 A;  3MCO A;  4ZVP B;  4NEY A;  2E29 A;  1T9T A;  1S0N A;  2LQJ A;  1CJV A;  2VC0 A;  4KE5 A;  4B08 A;  1TUV A;  4O3N A;  1IQT A;  2FUG 9;  3DLK B;  1F2G A;  1ZM3 A;  3MHY A;  3D1Q A;  4TXS A;  5HLF A;  2MJN A;  1A0O B;  3BBF A;  3KLI B;  3NBP B;  5LSO A;  5FDL B;  4CP5 A;  3KJV A;  3CF5 Q;  1QLN A;  1A6L A;  4JV0 A;  4P6Q A;  2CQ4 A;  1ZM9 A;  3ISN C;  1Y7P A;  3HHL B;  1Y0H A;  3BYP A;  3POT A;  3QAE A;  3TNV A;  1HI1 A;  3W62 A;  4CLP A;  5GAD I;  1HNZ F;  1VQN S;  2BJD A;  2WTF A;  2V69 A;  2PMZ D;  3RAX A;  5T7L B;  3K5L A;  1VBK A;  2Z2Y B;  3D6M B;  1GT8 A;  2V6A A;  4DV3 J;  2VDH A;  2GVZ B;  5FD1 A;  2J7W A;  4OI4 A;  1NZ8 A;  2WBR A;  3OT9 A;  1XNR J;  3HXM A;  1RHM B;  4HI1 A;  2HFV A;  4WFX A;  3ZZO A;  2GMJ A;  2R9L A;  3MCS A;  3KTQ A;  4HAC A;  1QE1 A;  3TVZ A;  3WHI A;  2LU2 A;  1GXL A;  2O01 C;  3MWB A;  2HFU A;  2WOM A;  2B9Y A;  1MRO A;  4J37 A;  4FVM A;  3T1A A;  1HNI B;  2KT5 A;  2R7O A;  2OFH X;  3H90 A;  3QFW A;  5A8K B;  1RHQ B;  4JI2 J;  3CCV S;  1WTB A;  1SKW A;  2D1C A;  2DNH A;  1VQ6 S;  4Q7A A;  5IFM A;  4RW7 B;  2FLP A;  1KWM A;  1GK8 A;  2FHJ D;  3GYG A;  2HVZ A;  1S5Z A;  3R3T A;  4NLR A;  4EEY A;  4KHP F;  3MM5 A;  2M4M A;  2W9B A;  4Q2M A;  3MPD A;  5KT7 A;  4ZJL A;  4M5D A;  1KRP A;  2OEJ A;  5L46 A;  1KON A;  5IWA F;  3P49 B;  1NXI A;  4FXW A;  4ZIV A;  1TKZ B;  3CVK A;  1X9S A;  3BGO P;  2FZG B;  4ECU A;  3SI8 A;  4WKR A;  2NZC A;  2Q6B A;  1Q79 A;  1BQM B;  2HVD A;  3THT A;  4WFN Q;  3LWM A;  2J9D E;  4CQ1 A;  2AV5 A;  3C14 A;  4Q5V A;  1SJ4 P;  2JLF A;  5KFB A;  1PC4 A;  1UPM B;  5L39 A;  5K8P A;  4M1K A;  5KG6 A;  2I5J B;  3G8Q A;  1IKX A;  2XG8 A;  3KOA A;  3OFG A;  3MEE B;  4OI2 A;  2HYI B;  1JK9 B;  4FF4 A;  1SC4 B;  2KU7 A;  3IAS 9;  2MST A;  4I2P B;  5HL7 Q;  3V6H A;  5D3G A;  1J2V A;  4NLW A;  4K7Q A;  3UDL A;  4W4M A;  3UDE A;  3HCX A;  3GMG A;  1PCA A;  1HPZ A;  2OJ3 A;  4X2B A;  3DGP A;  1C4C A;  2VBY A;  3JYT A;  2ASL A;  1UVK A;  3OR2 A;  4NWB A;  4WXO A;  1RAG B;  3HFK A;  3D0I E;  3RJM B;  2J9D A;  1W26 A;  3U02 A;  1N5T A;  3LAL A;  2ZD1 B;  3M2V A;  2N3O A;  4DX6 A;  5DLG A;  1OS5 A;  2HK3 A;  4KO0 A;  3M6W A;  7FD1 A;  4WBF A;  3RAQ A;  1VQM S;  3WDO A;  2UUC F;  3G8S A;  3OTB A;  4DV7 F;  1D8Z A;  2R8J A;  4E0D A;  1Q16 B;  3T9N A;  4ZLL A;  2C2R A;  1FRL A;  4J9S A;  4K5R A;  1VQL S;  2X7I A;  1YIT S;  4WZQ A;  3H2L A;  4KH1 B;  1WC5 A;  3IWL A;  8AT1 B;  5CCL A;  1TL3 B;  3UO0 A;  3PYF A;  4TYB A;  5KFC A;  3SV4 A;  3QJP A;  3DKD A;  4HT5 A;  4EU0 A;  1KHW A;  3P4U B;  3W2V A;  4XPC A;  2QEX S;  2IRY A;  3BO3 A;  3NOC A;  3FKB A;  2YKP A;  3B82 A;  1DBD A;  4U8Y A;  5KFX A;  2MKI A;  2ZHB A;  2ZJR Q;  1VRU A;  1WDD A;  2D41 A;  2UV8 G;  2CDR B;  2G0I A;  5D77 A;  3BBB A;  5FII A;  5AJ3 F;  1LV5 A;  4OHV A;  2M8H A;  2C2D A;  1Y4Z B;  4ID5 B;  4I2Q A;  1Q7Y T;  2IAJ A;  3BDE A;  4DR2 J;  2N4C A;  3M30 B;  1IKW A;  4LSN B;  4RW7 A;  5KT5 A;  3IBC B;  4RW8 B;  1C1B A;  1VHF A;  3LPE A;  3UWT A;  1IBM J;  5BYS A;  1C0U B;  2BKO A;  3G4S S;  2MSS A;  1KEK A;  3KJN B;  4DWI A;  1UWB A;  5CD4 H;  2HGN A;  3KLG B;  3WC0 A;  1UAW A;  2CZ4 A;  3M8Z A;  1NJY A;  1NH7 A;  2YY3 A;  1FRK A;  2BRL A;  2W01 A;  2DIV A;  3ILJ A;  3KK2 A;  4IQX A;  4NI2 A;  5H9E J;  4DPW A;  4WE1 B;  2F7V A;  2GAH C;  2FYX A;  3HHL D;  3F44 A;  4RNF A;  2AIR B;  3Q8P B;  1R0B G;  3KLI A;  3KJV B;  4B3T F;  1KR4 A;  1UW4 A;  2R7W A;  1DZ5 A;  3DHW C;  2HVI A;  4WF9 Q;  2LDY A;  5LMU J;  2DR5 A;  2HPU A;  1GXT A;  2DO0 A;  2H5E A;  2XMW A;  4F4Z A;  8ATC B;  2ZH4 A;  2W2O P;  4ED6 A;  2XMT A;  1VLY A;  4B3O A;  3M8S A;  4ECS A;  2MQM A;  1M90 T;  1WAC A;  3FGV A;  5KAK A;  2DTJ A;  1H73 A;  2MKH A;  3HD2 A;  2NSC A;  3LO3 A;  5BJR A;  1B64 A;  1EX8 A;  4B3M F;  1BXN A;  2K1R B;  3DGP B;  1VJQ A;  2VKR A;  4C8M A;  2O5D A;  5HMX A;  2ZZM A;  4C8L A;  1H7X A;  5ETL A;  2VBZ A;  3OJU A;  5CH7 B;  2YQ1 A;  4DI6 A;  1M5S A;  1KVI A;  3BKF A;  3G6V A;  1IQZ A;  2ZKT A;  2XUL A;  3FBF A;  3KUH A;  3D0G E;  3W61 A;  3SFU A;  2PC6 A;  3IBF B;  3KMS A;  4OMF G;  3ULH A;  4JI7 J;  2VDI A;  3KG0 A;  3SSR A;  1EET A;  2VV5 A;  4B9V A;  3CME S;  2DIU A;  3K8V A;  2G1H A;  1H72 C;  3MR2 A;  2XYG B;  3QFH A;  1PYT A;  2UUT A;  3CD7 A;  2X1G A;  5DM6 Q;  3ISZ A;  1RAI B;  2E7V A;  2XCP A;  4U7C A;  1DAX A;  1NHU A;  1WOP A;  4K4X A;  1SL0 A;  3QSY B;  3K89 A;  4OI0 A;  4PKD B;  3M8W A;  1JLG B;  3Q2S C;  2FJA B;  5J2P A;  3QT6 A;  3SQO P;  1S1U B;  3PXG a;  3TVY A;  3UD4 P;  2GCF A;  1TL7 A;  4P73 A;  5EDW A;  5EX3 A;  4W92 B;  2G0J A;  4ETX A;  4M5K A;  1S6Q B;  2RF2 B;  2GGP A;  5A8W B;  3J80 U;  3AXM A;  5M2U A;  4DMZ A;  4RBT A;  5CAB A;  1XNR F;  3I5A A;  2QL5 B;  4TLR A;  4A8W A;  1UCN A;  1UL3 A;  4NLP A;  3RGI A;  3VGV A;  4DS4 A;  2AP6 A;  4ER8 A;  2LCW A;  2Z57 B;  3EVM A;  2CQD A;  1J5E F;  4F3Q A;  3M9O B;  2M7S A;  2IMW P;  1V3Z A;  1RHK B;  2APO A;  2MGZ B;  1CBK A;  2DJW A;  3AT1 B;  3OXL A;  5IT9 Y;  2RT3 A;  2B4O A;  4BCA A;  5GAE U;  4LF4 J;  2HGL A;  5AXN A;  1SBR A;  2V50 A;  1T9W A;  3PRV A;  2EW9 A;  2W4C A;  3W65 A;  3C6U A;  1T03 A;  1FDN A;  4J9L A;  4IUF A;  2RRN A;  2KT2 A;  2KRB A;  2LMI A;  1Q95 G;  2VG5 A;  1NSA A;  3H0P A;  3IO1 A;  5KFG A;  2V67 A;  5CYJ A;  4R5P A;  4QWA A;  3MUV P;  3CDA A;  3IGN A;  2C2N A;  2YQ0 A;  1P6T A;  4CLW A;  5KFO A;  2KHD A;  3I0S A;  4L75 A;  2GS8 A;  4B3S J;  5DZ6 A;  2BZ2 A;  2B4U A;  1PAU B;  2K8G A;  2GGP B;  4YHH J;  4DF4 A;  2GVZ A;  2LVW A;  3DRP B;  4ILM A;  1Y5L B;  3IC1 A;  4RPF A;  5AT1 B;  3NS6 A;  1SUQ B;  3MCM A;  4QIV A;  3OR1 B;  1AT1 B;  3HVT A;  2AYM A;  2AJ4 A;  1BQN B;  1RQ0 A;  3TX8 A;  3J7Z T;  3Q0A A;  4DL2 A;  4CLY A;  3POT B;  3T1Y J;  4USK A;  4L76 A;  2PEB A;  4ZVE A;  6AT1 B;  3VAI A;  1T9Y A;  3F0N A;  3J7Z 5;  3GSD A;  4KGV B;  3S7R A;  1JXV A;  5C42 B;  4NYZ A;  1UJ5 A;  3VQS A;  2VC1 A;  2RQM A;  3KG4 A;  4WTY A;  2B5J A;  1TMJ A;  1HQE A;  3IR7 B;  3MM8 B;  3SV3 A;  1S9G A;  1SKU B;  4KYZ A;  4K4W A;  1RTJ A;  1TVR A;  2V2K A;  2D9O A;  2OAU A;  2BYC A;  5DGB A;  2F65 A;  5BR8 J;  3DDN A;  2F5G A;  3NLC A;  2Q79 A;  5C24 A;  2NPI A;  2ZM6 F;  1TAU A;  2CJ9 A;  3HKZ D;  4MH8 A;  3TAR A;  2OPP B;  1YZ7 A;  1IBK J;  2MQQ A;  2UV8 A;  4MIA A;  3H5S A;  4OHW A;  2AWZ A;  2QIF A;  1FWP A;  4B3O B;  1QY7 A;  1XNQ J;  1FX4 A;  1FI4 A;  1CEZ A;  1SIW B;  3C14 B;  3IG1 B;  2ACM A;  2CJB A;  2YPY A;  1FKO A;  3FSX A;  4LF8 F;  3UN2 A;  4QU6 A;  5DQG A;  1N8R T;  4USH A;  1S57 A;  1V5V A;  3PX4 A;  1NDK A;  1S6P B;  2E7X A;  1S9E B;  3PYE A;  5A2Q Y;  4O3R A;  1GTE A;  4DXL A;  3NNH A;  2XNQ A;  1ZPW X;  2CQ0 A;  3HLU A;  1RTI B;  1S1X A;  4WU3 A;  3QPI A;  2UXC J;  3QID A;  5DG8 A;  4RU2 A;  4JI0 F;  1DFD A;  1WF2 A;  2XC9 A;  2IC3 B;  1X9W A;  4AT1 B;  1XR5 A;  2W8L A;  1DRZ A;  5IC6 B;  2ZVS A;  2JJ4 D;  1OY6 A;  4PG5 A;  1QAY A;  2QLX A;  5J2M A;  1HIY A;  1B0T A;  2FB0 A;  3C15 A;  3HSD A;  2I0X A;  4UZB A;  2I2Y A;  1N33 F;  1YWX A;  1V3S A;  2WVB A;  3EDR B;  4ZPA A;  3MUT P;  2DNR A;  4FNI A;  4F4K A;  1S76 D;  4ZVU B;  2F4F A;  3M30 A;  3N4W A;  2VPX B;  3C6T B;  3QBC A;  4LSN A;  3W1Y C;  1S48 A;  1SL1 A;  2AYB A;  2J7U A;  1FKP B;  1RLD A;  3HHD A;  2ZOF A;  3RZA A;  1QM9 A;  3HHK A;  3PM9 A;  1F5A A;  3ZZT A;  3NS5 A;  1W7W A;  3JQK A;  3CE8 A;  3KKF A;  1MG7 A;  3AXK A;  3D1O A;  3HUL A;  2G2Y A;  2FJW A;  5HSP A;  4DSI A;  1LW2 B;  2R42 A;  1H2U X;  1TL5 A;  3VCD A;  1VFJ A;  4DV6 J;  1RAJ A;  2NLW A;  2W24 A;  3RB3 A;  2ZZN A;  1T02 A;  2LYV A;  2HHX A;  2FIU A;  3CJR A;  1EZZ B;  3HFV A;  5JMN A;  2MMY A;  4YS2 A;  1BQN A;  3B6B A;  2CKW A;  2A3J A;  3OR1 A;  4N7T A;  1KTQ A;  1KVK A;  3W2W A;  2GIQ A;  5I42 B;  3TJ8 A;  4FZV A;  1X8D A;  5K20 B;  3T6J A;  3JSY A;  3RR7 A;  3MXH P;  1RDR A;  2BMB A;  5KFV A;  2IA6 A;  2R7U A;  3B4M A;  1N5V A;  4FYV B;  1TKD A;  5U47 A;  1RSC A;  3I31 A;  4I67 A;  3M6V A;  1P8G A;  3EDQ B;  4URQ U;  1IN0 A;  4WTO B;  2AGQ A;  1F9E B;  4URG A;  2HVE A;  1ZBT A;  3K8W A;  4KH0 B;  5F8G A;  4DUZ F;  2BQ3 A;  3LWL A;  3R2C J;  5HRO A;  5LSR A;  4QW9 A;  1JLB A;  4WFA Q;  3Q8U A;  2HS3 A;  1RT4 B;  3LOU A;  4KHM A;  4WJB A;  4RU9 A;  5B0D A;  5DGA A;  2B8P A;  1RBO B;  2WRM A;  3NRB A;  3C15 B;  5D6G A;  5KT6 A;  1SKR A;  1MMD A;  5J1E B;  4R0J A;  3CTR A;  4YME A;  3PIO Q;  3N79 A;  5DDP C;  3GR0 A;  2FJV A;  4DS5 A;  4UQT A;  2V8H A;  4HDH A;  2OUG A;  2XSF A;  2HMI B;  1CSJ A;  3LAK A;  3T5K A;  2IJN A;  3HF5 A;  2DO4 A;  2RDD A;  3F73 A;  2YKN B;  3KLE A;  2DPJ A;  4KPY A;  2LXF A;  2WON A;  2YX4 A;  1WG5 A;  5CYQ A;  5E7O B;  4RUH A;  2H48 B;  1VK3 A;  4ECV A;  1U7L A;  3Q8Y A;  2HHH F;  2POK A;  2UVU A;  3RRH A;  3GV8 B;  1B3T A;  1S77 D;  4OJH A;  2OI2 A;  3NL0 A;  4DJB A;  1XMO J;  2R8G A;  2J5A A;  2AD9 A;  3OTE A;  3BKU A;  3DOK B;  4RW9 A;  3LGH A;  3MAH A;  3MOJ B;  1HBU A;  1ZAW A;  1ZM4 A;  2HHP A;  3DDK A;  3MMC B;  2WVC A;  1FDD A;  2E1R A;  2YX7 A;  3MMA A;  3UFC X;  5A8R B;  4ECW A;  5E0O A;  3THV A;  3FQK A;  2Y1J A;  4WP9 A;  1M5K C;  2NXN A;  3FRY A;  1JLF A;  4CO0 A;  5EWE A;  3OVA A;  4LF7 J;  4RNH A;  4Y2M A;  3EMT A;  2EKY A;  3GII A;  4CH0 S;  1NDP A;  4LF2 A;  2V8G A;  4CLK A;  2MY8 A;  4F0K A;  5HO4 A;  3KLH B;  1J5O A;  4W90 B;  5H9E K;  2QL9 B;  4UZC A;  3I5C A;  2N7Y A;  2Y9H A;  1U4B A;  4JBC A;  2ERR A;  1U09 A;  3OTD A;  3QWP A;  2DHA A;  3UR0 A;  5JUM A;  3VAH A;  3HK2 A;  1FJ7 A;  1S1T B;  4ZP6 A;  1X4C A;  2ALZ A;  1I3O B;  1E6V A;  2BAB A;  2CQP A;  3ZTQ A;  1T9X A;  2YNH A;  4A46 A;  4DQP A;  1RTJ B;  1TVR B;  1HBN A;  3OXF A;  4FF3 A;  3EGW B;  4TQS A;  3OD2 A;  1XIQ A;  2VIC A;  4F2S A;  2JRS A;  2FY1 A;  1V3R A;  2YKM B;  3HT0 A;  3O6Q A;  8RUC A;  3BGR B;  5HVH A;  4DR4 J;  4QYZ K;  1YJV A;  2UVV A;  1I6J A;  5F8H A;  4GRS A;  4MK9 A;  2P9G A;  2YH0 A;  4ANC A;  5CA5 A;  1HI0 P;  2JVR A;  2FLL A;  1E6Y B;  2Z58 B;  3OTO J;  2MEW A;  4WE1 A;  5I42 A;  3N6M A;  2R3V A;  4OZ1 A;  4EUV A;  4AFF A;  3FBE A;  1PJ5 A;  1KOH A;  2OPQ A;  2KFZ A;  2CQ1 A;  2MDA A;  3LA0 A;  2R2R A;  1WD6 A;  4YB7 A;  4A48 A;  3W7B A;  4CLL A;  3R5A A;  2KG0 A;  1U6B A;  4QWD A;  3H5X A;  2P8I A;  4IOB A;  1NJX A;  2YKQ A;  3LP2 B;  2XWY A;  4YOE A;  1FNO A;  1JLC B;  2QLF B;  1ZAV A;  2PI5 A;  4C4W A;  2IDL A;  2Q43 A;  1P1T A;  4CLZ A;  1VQP S;  3Q22 A;  1HNW F;  1R8H A;  4NLX A;  1SC3 B;  1VS3 A;  1M5O C;  4XTT A;  1F5C A;  4V1A k;  5IV3 A;  2V68 A;  4J9U E;  5M2P A;  1YJ7 A;  4F67 A;  5L9X A;  1VOM A;  1W2I A;  4HLB A;  2DY9 A;  1EB0 A;  4NLG A;  1A7G E;  2AMC B;  2Y1L B;  4FYY B;  2LXU A;  2WON B;  3W9H A;  5E3A A;  2VJU A;  3MPV A;  2VAS A;  1RT4 A;  3AB2 B;  1JJC B;  3HHN B;  5DG9 A;  5L9N A;  3LGM A;  3GPA A;  2KTQ A;  1X4A A;  3AFG A;  4FNH A;  1WEX A;  2CRL A;  2RS2 A;  2LP4 A;  1RGV A;  3M7V A;  4H54 A;  2LEP A;  2Y8Y A;  4B9U A;  4ZPD A;  2P6S A;  1GFW B;  2MJU A;  1N36 F;  3HKW A;  4C48 A;  2YXL A;  3HO1 A;  4H4K A;  2E5J A;  1HWK A;  1XER A;  4HHJ A;  1LW0 B;  1WHX A;  4DV0 J;  2ZEJ A;  4B9S A;  1YJN S;  1RWU A;  4AYB D;  4YR3 A;  4EBD A;  2MKC A;  5HMW A;  2FTR A;  4CO4 A;  2P9C A;  1FD2 A;  4F02 A;  2Z0G A;  2JFD A;  4HH1 A;  4ATN A;  5MAO A;  1HQE B;  3ZTO A;  2K2P A;  3UPF A;  3L95 X;  4KGM A;  4PWW A;  3CCU S;  5D3G B;  3HZE A;  3MUR P;  2GFF A;  2I1R A;  3TZZ A;  4JI5 F;  4OIX A;  4ES2 A;  1YK9 A;  1OPI A;  2RU9 A;  3T1H F;  5D78 A;  2YKM A;  1AUD A;  1HR0 F;  2I5J A;  3CMQ A;  2BW2 A;  1HBN B;  3TJ9 A;  2CJY B;  4DFP A;  2QMX A;  4DPU A;  1F9F A;  4FP9 A;  2HHQ A;  1HBO B;  3CCS S;  1U0S A;  2RSQ A;  1GTH A;  5D0R A;  3L3C A;  1P9Y A;  4YDD B;  2OP5 A;  4LIW A;  3NCP A;  1BUX A;  1NLK L;  2AX1 A;  1AFI A;  4F0H A;  3R2D J;  1YIJ S;  3QRR A;  5KFE A;  1S1V B;  3TQE A;  2AJQ A;  3FFI A;  4WZM A;  3P96 A;  4CH1 A;  2RRB A;  1IM4 A;  1HAR A;  2H9Z A;  3FCV A;  1KD1 T;  2FJE B;  4O3O A;  3ZTS A;  4CTA B;  1VQ4 S;  2FVP A;  2MHN A;  1KLN A;  4OYB A;  4GKK J;  1HBU B;  1KBR A;  1SV5 B;  2GQ2 A;  4LF6 J;  2CJA A;  2HND A;  4RO0 A;  4P7T A;  2PI4 A;  2ZE2 B;  5CD4 A;  4KJI A;  4UT4 A;  4HEA 9;  4RWX A;  2RS8 A;  2JOQ A;  3F41 A;  4IYQ A;  3CJ3 A;  1RTH B;  2BUN A;  3CW2 C;  5L8R C;  3TAP A;  1J5E J;  3TOQ A;  5HJX A;  3A3P B;  1UFK A;  4UTG A;  4E98 A;  2QLB B;  4IR9 A;  3JXO A;  2RE1 A;  1S6P A;  2VZ9 A;  3BB5 A;  3PAC A;  2LDI A;  1S7I A;  4JV5 F;  1TL7 B;  1HHQ A;  2WVD A;  3CMA S;  4F25 A;  1X4B A;  3CDB A;  5GAG U;  4PQU A;  3V4M A;  3CIM A;  3OQ2 A;  2PA8 D;  1IXK A;  3DRR B;  4DCJ B;  1UA0 A;  1VC6 A;  3R8Y A;  3ZZU A;  5KT4 A;  3M8Q A;  1WHW A;  2ZDP A;  3HT3 A;  3J7A N;  4GKK F;  1EAY C;  4HKQ A;  2KKH A;  4ZP9 A;  3D68 A;  4NLV A;  3PX0 A;  2D3O 1;  2VA2 A;  1LW0 A;  4G1I A;  2F4V J;  2CPZ A;  2ZIT A;  4WFY A;  1WF1 A;  3WX8 A;  3MAA B;  4EBC A;  4IRD A;  2MQL A;  1SJ3 P;  1Q5V A;  3RTV A;  3D28 A;  4OX8 A;  4JI7 F;  2E9Z A;  4ZHR A;  3RG6 A;  1ZA1 B;  2KZM A;  4KPC A;  3PW5 A;  1WC0 A;  2GHV C;  4J91 A;  4RBU A;  2HIY A;  2K1R A;  3TYT A;  2ZH8 A;  3OPK A;  2DIT A;  2WBM A;  1SQG A;  3A8I A;  2WZ1 A;  4RL1 A;  4DCO B;  2M8D B;  3J81 U;  1NB7 A;  3H25 A;  4GVB A;  4L73 A;  5J2N A;  4OZ3 A;  4V19 J;  2E1A A;  4C0B A;  4MIB A;  3PR4 A;  4OX7 A;  3W5Y A;  3T1H J;  4I4B A;  2RDI A;  1T03 B;  2HS4 A;  1TTH B;  3DU6 A;  3H2V E;  3CC4 S;  1VBY A;  2FVS A;  4EI2 A;  1REG X;  2HFS A;  2HHW A;  2W4D A;  2XM3 A;  5F3T A;  2B6A B;  4KRW A;  2DHS A;  1IKW B;  3D6T B;  4HDG A;  1DQ8 A;  1F0X A;  1LK7 A;  1N88 A;  4MFB B;  3UCU P;  2I9S A;  2NPF A;  5KFD A;  5KG3 A;  3FEY B;  1LWE A;  4XK8 C;  3UD5 A;  5KG7 A;  3ET6 B;  4O4G B;  3UI3 A;  2KRR A;  2RML A;  4ZPV R;  3HSJ A;  1BQM A;  2CNN B;  4NA1 A;  3SSS A;  4CT8 A;  4K4Y A;  6FDR A;  1AFJ A;  1HQU A;  4I7F A;  3PFO A;  4ZCM A;  3CC2 S;  2CQB A;  2DGS A;  3RW6 A;  2WHO A;  4OJ3 A;  3E2E A;  1VQK S;  1QUV A;  5IC4 B;  1VR6 A;  1IBM F;  1NPK A;  2ZVI A;  2B4V A;  1HNV B;  4DV4 F;  1UVJ A;  4O0I A;  4OFZ A;  5KT3 A;  2C3O A;  2IVF B;  1D9D A;  1HNI A;  1S1U A;  4YR0 A;  1FNM A;  1RT5 A;  2G1D A;  3NGS A;  4M5N A;  4RLE A;  5ETR A;  5AJ3 J;  4X4P A;  1KP6 A;  2GML A;  4ZK7 M;  3PIP Q;  4GC6 A;  4EZ9 A;  3Q8S B;  2F9J A;  2ZOM A;  2EK1 A;  3BGL A;  3EXY A;  1B70 B;  1TK8 A;  2EC2 A;  4ZKA A;  1T94 A;  2NXJ A;  4A47 A;  3AOB A;  2C2O B;  1Q8B A;  4GO5 X;  4DL6 A;  5CXT A;  2BE7 D;  4JI8 F;  3M8Q B;  2Z2M A;  4O44 A;  4LRD A;  2ZH7 A;  1RLC L;  3KLF B;  3QAU A;  2UU9 F;  3HJF A;  4PR6 A;  4RUA A;  3T5J A;  2KXN B;  4ZIT A;  4DL3 A;  2XZD B;  4Y3C A;  2RIJ A;  4UW2 A;  4KO0 B;  1X4E A;  3MMB A;  3MAA A;  1FE4 A;  4L3K A;  3GIK A;  4WFB Q;  3VQT A;  3AA9 A;  2IYI A;  4WXW A;  3V6D A;  1RT2 B;  4LIR A;  5ADZ A;  3M4X A;  1HNX F;  1QSL A;  2X3G A;  2UUB J;  5SZT A;  1WEY A;  2HHT A;  2R8I A;  1N33 J;  2XS5 A;  4X84 A;  1XJW B;  3IGV A;  2UUA F;  2KVQ E;  1KVJ A;  2D74 B;  2JHE A;  3E3X A;  1JNZ B;  1SUQ A;  1M1H A;  1R6Y A;  2A0F B;  3RBD A;  4YY3 F;  3MED B;  3ZC4 A;  1RWN B;  1SH0 A;  2OD4 A;  2OSR A;  4NXN J;  4ILL A;  4PUO B;  3Q86 A;  5AE1 A;  2L48 A;  2DK2 A;  3MM7 A;  4WK1 A;  2ZH9 A;  3TRG A;  3FNN A;  3L7P A;  4OI1 A;  4NI2 B;  1CQN A;  4A8F A;  2IAJ B;  3V4I A;  1NHK L;  4MYU A;  4LF5 J;  1RTD B;  4I2Q B;  2BE2 B;  4ID5 A;  1U8S A;  4JB8 B;  3PW4 A;  3K2Y A;  3VAM A;  2C3P A;  5B0F A;  5H9F J;  3O8W A;  3OUY B;  5LJ3 Y;  4RJV A;  2M52 A;  2RQK A;  2IJF A;  4Q2L A;  3PHT A;  4K4T A;  2DRA A;  1H98 A;  3R97 A;  3TUI C;  4DR3 J;  2GJ2 A;  3IM9 A;  1Z1Z A;  2QSF A;  1X5P A;  2VQF F;  1N34 F;  4ZP7 A;  4NLD A;  5HRO B;  4ICL B;  2MLZ A;  3IWN C;  3OVS A;  1Y10 A;  2ATL A;  2CQI A;  4A8O A;  4RUB A;  1VMB A;  4NOH A;  1AA1 B;  1XEZ A;  1S4F A;  2B6A A;  4MYT A;  2YNF A;  4P2M A;  5C5J A;  2V9K A;  1K9M T;  5ETK A;  3BQ2 A;  4LFB J;  1Y3J A;  1D3W A;  3G6Y A;  4DV2 J;  4ZVT B;  1TL4 A;  4JUZ A;  1JXL A;  2VOP A;  1CJK A;  4QCL A;  1HWL A;  1WOR A;  4DPT A;  4D3G A;  3ET6 A;  4NE9 C;  4O4G A;  4DUY F;  3ENV A;  2V4J B;  1IJE B;  2K3K A;  1U2F A;  1GX6 A;  2ADC A;  4E8U A;  3S8S A;  3RAM A;  1LWC B;  5KFZ A;  1PO6 A;  1YKW A;  4EWT A;  2VF3 A;  3N6N A;  1U2C A;  4FKY A;  1X31 C;  3IXQ A;  1JLA A;  3HSG A;  3KJQ B;  2ZH2 A;  2C2E A;  3AOC A;  2CAJ A;  1FVQ A;  5K9F A;  4DPY A;  4DR5 J;  1Q8K A;  1CJV B;  2HRT A;  2U2F A;  4ZJO A;  2ZBI A;  3TVK A;  1ULR A;  1NK9 A;  2VL1 A;  1M5P C;  1DTQ A;  4ZPB A;  2CPJ A;  3KHR A;  4Q8E A;  2EFP A;  1VRQ C;  2XMU A;  3Q23 A;  3ICL A;  2BM1 A;  1FF2 A;  4IFV B;  1VQO S;  3C6T A;  4PCQ A;  1WOS A;  2BKP A;  3HHL A;  4H4O A;  4YB1 P;  2VQF J;  2ASJ A;  2DXD A;  3MCN A;  3OVB A;  4ZVR B;  5FDL A;  4ZVH A;  4KGK A;  1WKL A;  4LF4 F;  3KK3 A;  1U1M A;  1M1G A;  4F36 A;  4C0O C;  4OX6 A;  1XK8 A;  2L08 A;  2DGO A;  2OFG X;  5DZ7 A;  2GW8 A;  3I6P A;  3FEX B;  3DDI A;  4JI4 F;  1F9H A;  3C16 A;  2JEF A;  3CCQ S;  3FMB A;  1TKZ A;  4OHX A;  3ZTR A;  5IV4 A;  3CPW R;  3IBW A;  1QSS A;  1C1C A;  5A8R A;  1N0U A;  3P3D A;  4AQY F;  3CJT A;  3UNY A;  4ED3 A;  2LLZ A;  4A8S A;  3RR8 A;  4LF8 J;  2HKE A;  4USM A;  1KC8 T;  1FWL A;  3DRS A;  1FCA A;  4Y2A A;  4NCB A;  2CYY A;  3DOL B;  5CHC B;  1UET A;  5HP1 B;  3CJS A;  2RUS A;  4LUB A;  2QGF B;  4OYW A;  2UUA J;  3P45 B;  4P52 A;  1K0V A;  1HWU A;  4HL9 A;  5HAT A;  2ZBC A;  2WK4 A;  4QQB A;  5A8K A;  2B51 A;  2ZM6 J;  1A9N B;  4DL4 A;  3CO0 P;  1LFW A;  3OLB A;  2PGC A;  3M2R A;  1S6U A;  2HNY A;  4DX5 A;  4EMD A;  2VPZ B;  5KFJ A;  3PR5 B;  3MFH A;  3V6K A;  3BS9 A;  1JB0 C;  1FTC A;  2XMM A;  2Y3Y A;  3A13 A;  4Z37 A;  4AND A;  4DOZ A;  4B9N A;  4O3S A;  4ECR A;  2VOO A;  5LT5 A;  2MZQ A;  3DRX A;  2VFR A;  2MPU A;  4I69 A;  4LSZ B;  2AJF E;  1ZAX A;  3GCW P;  4USV A;  3WIU A;  2A1B A;  4U95 A;  1ZS6 A;  3DGV A;  3K7R A;  4WII A;  2CNL B;  1D1U A;  3DCA A;  3GZ7 A;  2DNY A;  1K73 T;  1VRU B;  3AOA A;  1VRT A;  4LMZ A;  4FXV A;  4OYP A;  1B7F A;  3ENW A;  2V63 A;  3KHH A;  1X7V A;  2KVI A;  1XTZ A;  3MM9 A;  4PYD A;  3R5D A;  3MTJ A;  5F8J A;  2WW8 A;  2BE2 A;  1HYS A;  2R4F A;  2J76 E;  3GU0 A;  3TUJ C;  3AH6 A;  3PX6 A;  3TW0 A;  4DR1 F;  3ZZ0 A;  3UVJ A;  2VH7 A;  4AQY J;  2NZ4 A;  1LNQ A;  1RT3 B;  3M6X A;  1CPZ A;  1DLO B;  5A2Q U;  3EX7 B;  1FE0 A;  2AJ0 A;  1TV6 A;  4M63 A;  4WYL A;  3QZ8 A;  2Z2L A;  4PPD A;  1N6Q B;  3A8K A;  1HWJ A;  3EXC X;  3BH7 B;  4NLT A;  2XLK A;  2B0G A;  4DV4 J;  4B17 A;  3BM7 A;  4YY3 J;  4CLU A;  3NNA A;  4TVA B;  1U6F A;  2QL7 B;  2ROE A;  5JXS A;  4YFU A;  4AL6 A;  3RRG A;  1TR0 A;  1KLM B;  2QMW A;  3BPD A;  3NBP A;  4G65 A;  1RT1 B;  1VIO A;  3KK1 A;  3EZ5 A;  2G13 A;  2DT9 A;  1D9F A;  4NLS A;  3MPU B;  4C8O A;  2EWH A;  3H4B A;  4QYR A;  5B0E A;  2L41 A;  3PW2 A;  4LFA F;  2BJ9 A;  1Q82 T;  2DNK A;  1BD6 A;  1NU4 A;  5HBM A;  2V8V A;  2YNG A;  1TUW A;  3WQP A;  2W2Q P;  5AE2 A;  4X4O A;  4EZ6 A;  5IZH A;  1H3D A;  1SH2 A;  1U0H A;  2ZUG A;  4GC7 A;  4M8L A;  3ZZR A;  4U7U D;  3ILL A;  4OZ0 A;  3PVX A;  3MD1 A;  1TP7 A;  2DH8 A;  3T1Y F;  2VOD A;  4I64 A;  2PMW A;  1K1Q A;  3BN7 A;  3LP1 B;  1R8C A;  3SZ2 A;  1N52 B;  3P5B P;  1QAX A;  3CJK B;  1LXJ A;  2W25 A;  3HSZ A;  3NY0 A;  3WC2 A;  4X4U A;  3R7B B;  3NGT A;  2G9O A;  5J1E A;  3BQ0 A;  3GJS B;  4ILR A;  1K8A T;  1MU2 A;  4Y2I A;  2J7K A;  2H5I B;  5GAH U;  4N5S A;  3VVU A;  2IBO A;  3BH6 B;  3MEC B;  5F8I A;  4HR2 A;  4YHH F;  3DXS X;  1TL1 B;  4TU7 A;  1MNE A;  2O1P A;  3KUG A;  3UQS A;  4LT6 A;  2K06 A;  4NCG B;  1NUE A;  4NMX A;  2MZR A;  3D0H E;  3LPY A;  3ZFV A;  4H4M B;  2CNO B;  4LFC F;  5KG5 A;  2CPD A;  3IG1 A;  4DZD A;  2MQO A;  4B9M A;  1EKS A;  4U8V A;  4FS2 A;  3HI9 A;  2BOP A;  2XMA A;  1D9A A;  1U25 A;  2PE8 A;  1GQE A;  4N8N A;  2HGM A;  5IOL A;  1S79 A;  1Q53 A;  4RWW A;  5D4N A;  1KLM A;  3KK1 B;  3ZZP A;  2E7W A;  1IWG A;  2A2D A;  2PN6 A;  3DC2 A;  3D9B A;  2DNL A;  1XC9 A;  4NA3 A;  4P2F A;  4GKJ J;  2F9D A;  2HRY A;  1SC6 A;  3NAI A;  1QVF R;  1OYE A;  1PJ6 A;  1UA1 A;  2PFD A;  4WPA A;  4U7U K;  5C42 A;  3ITH A;  1RYS A;  1N32 J;  4GKJ F;  2LFV A;  4MMO A;  1Q8I A;  2DY1 A;  1X4G A;  1RT1 A;  2AX0 A;  2C2Z B;  3QIP B;  1RT3 A;  4PWD A;  1U24 A;  3QNW B;  4KTQ A;  2IIH A;  3W5X A;  2QMU B;  3WZ0 A;  2DNG A;  2GC8 A;  2DGV A;  1P1L A;  2GO8 A;  4DX7 A;  5KTQ A;  5FJ4 A;  3VZI A;  3R9L A;  1WC3 A;  4LFC J;  3UN5 A;  3D5M A;  5G4D A;  4DR2 F;  1FER A;  2DPI A;  2DIS A;  1PAE X;  2P9E A;  3FC9 A;  3J7Y U;  3TUP A;  1G2E A;  1KTV A;  3KNG A;  4RNO A;  4NZ6 A;  2W2N P;  5E33 A;  2RRA A;  2P6T A;  2D3O R;  1GEH A;  4ZVG A;  4AXJ A;  2L9W A;  4WCE Q;  1L3S A;  2NXE A;  2Z2Z A;  3OJS A;  1WUU A;  3ZTP A;  4ECX A;  1URN A;  2RB7 A;  2XI2 A;  2KT3 A;  5D0G A;  2BVZ A;  3TWZ A;  3IR6 B;  1HHT P;  2UXD J;  2KZZ A;  4EYH B;  4F2R A;  1SJR A;  3DRR A;  1I94 J;  3M05 A;  1J5O B;  3NEK A;  3D1H A;  4EGL A;  4F7V A;  3PV8 A;  3CJK A;  2EFG A;  5ETV A;  1XNQ F;  3LP1 A;  1LWF A;  4DF8 A;  4Y0F A;  5E3P A;  3GIR A;  5H9F K;  2CQ3 A;  1FRJ A;  3BDP A;  3K0J A;  2Q6C A;  1WDT A;  1GMU A;  2HHU A;  5C24 B;  1SIZ A;  2XMK A;  2XO6 A;  2EG2 A;  4MKV A;  1YDL A;  1AZS A;  2HS0 A;  1N48 A;  4LF9 J;  2ZUA A;  3M2U A;  3HP6 A;  2XWX A;  1EQ0 A;  1RWP B;  4QWC A;  3ZNU A;  1JLG A;  5C25 A;  4C7Q A;  2ZE2 A;  2QT7 A;  2E66 A;  3FQL A;  5E3Q A;  3HPO A;  3R1L A;  2HEK A;  2EFQ A;  4QBU A;  2MB0 B;  4UQG A;  1NM2 A;  5CZV A;  5IT4 A;  1NJW A;  4LF6 F;  4AL5 A;  1K0T A;  2IRX A;  3H5U A;  4F4W A;  1JMT A;  1X0P A;  2PD1 A;  2VUG A;  4MKA A;  3JQM A;  5KFA A;  2OEM A;  1OPZ A;  2JZ5 A;  4LF1 A;  3O3L A;  5DJB A;  3KMQ A;  1RAB B;  2G2O A;  2HNZ A;  3CWJ A;  3MDF A;  4UOG A;  3CCM S;  3MOZ A;  3TX0 A;  5B0C A;  4NLO A;  1NKC A;  3AA8 A;  2QA1 A;  3CGI A;  3FZ2 A;  2LQ9 A;  3R5G A;  1CJT B;  4H4O B;  4QWB A;  2ZHO A;  4IH7 A;  4JI6 F;  1N5Q A;  3B4D A;  4LVO P;  1M0S A;  3TZY A;  1ZTW A;  3R6G B;  4ZOS A;  2YNH B;  3PO4 A;  1T3N A;  2J8S A; 
#chains in the Genus database with same CATH homology
 1PYO B;  2P2C B;  2H51 B;  3GJS B;  2H5I B;  5K20 B;  3KJQ B;  2XZT B;  1BMQ B;  1RWX B;  2QL5 B;  1SC4 B;  2H4Y B;  3EDQ B;  2CNO B;  1F9E B;  1GFW B;  1RHR B;  1QTN B;  2CNN B;  1RHK B;  4ZVQ B;  3RJM B;  2H54 B;  4ZVR B;  2CNK B;  2HBY B;  2XYP B;  2HBZ B;  3R7S B;  5IC4 B;  3GJQ B;  3R6L B;  3R7N B;  2QLJ B;  2Y0B B;  1PAU B;  1ICE B;  2HBQ B;  2C2Z B;  1QDU B;  3GJR B;  2CJY B;  2H48 B;  3QNW B;  3P4U B;  4DCP B;  3P45 B;  2C2O B;  2CDR B;  4ZVO B;  2XZD B;  1RWW B;  4ZVP B;  4LSZ B;  3D6F B;  1RWM B;  3IBC B;  1NME B;  2CJX B;  2CNL B;  2QL9 B;  3KJN B;  3GJT B;  2H5J B;  1I3O B;  2C2M B;  3KJF B;  3D6M B;  1RWN B;  2QLB B;  2C2K B;  2H65 B;  1RHM B;  1SC1 B;  1RWP B;  4JB8 B;  2H4W B;  2QL7 B;  5IC6 B;  4DCJ B;  2FQQ B;  1RHQ B;  1RE1 B;  1RWK B;  4ZVS B;  3EDR B;  1RWV B;  4ZVU B;  2XYH B;  3R5J B;  2QLF B;  1I51 B;  3NS7 B;  1RHJ B;  2HBR B;  3IBF B;  1IBC B;  1SC3 B;  1RWO B;  2C1E B;  4ZVT B;  2XYG B;  4DCO B;  3SIP B;  1RHU B;  3D6H B;  3R6G B;  2DKO B;  3R7B B;  2Y1L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...