3EDQB

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 20
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3edqB00
1I51B 5K20B 2H48B 2H54B 2P2CB 3KJQB 3KJNB 2XZTB 1RHMB 1RWPB 2QLBB 3NS7B 4ZVTB 2H4WB 1RHJB 2CNKB 4DCJB 1SC3B 4ZVRB 1RHKB 2C2KB 1NMEB 1F9EB 2CNOB 4DCOB 2QL9B 3D6HB 3P4UB 3SIPB 3D6FB 1PYOB 2HBYB 4ZVUB 3GJRB 3R7SB 3KJFB 3EDQB 4ZVPB 2QL5B 1RWMB 2C2ZB 1RHRB 3D6MB 3RJMB 2Y0BB 1QTNB 1RWWB 1RWXB 2QL7B 3GJTB 4ZVOB 3EDRB 2H5JB 1I3OB 4ZVSB 1IBCB 4ZVQB 1RE1B 2C2MB 5IC6B 1SC4B 2HBZB 3QNWB 3R6LB 1RWOB 2CNNB 3IBFB 1RWKB 2QLJB 2H65B 1PAUB 3IBCB 3R5JB 3R7BB 4LSZB 2H5IB 3GJQB 2CJYB 2DKOB 3GJSB 4DCPB 1BMQB 1GFWB 2XYPB 2C2OB 2XYHB 1RWNB 2CDRB 2HBRB 1SC1B 2XYGB 4JB8B 2Y1LB 5IC4B 2HBQB 1RWVB 2CNLB 2C1EB 3P45B 1QDUB 2XZDB 1ICEB 2FQQB 2QLFB 1RHUB 2CJXB 2H4YB 3R6GB 1RHQB 3R7NB 2H51B
chains in the Genus database with same CATH superfamily
1SQGA 5T14A 3KK1B 5DS7A 3K17A 3P3DA 3CMAS 2AEMA 2AKWB 2HFSA 2AW0A 1H7XA 3ZZUA 4DR1J 3DGPB 3NGRA 2OO4A 3ENVA 2NYHA 2PN6A 2HBYB 2V34A 3MR7A 3IM9A 1FESA 3M4XA 2P8IA 1ZZNA 4L74A 5LJ5Y 4CI0B 2HVHA 1SV5A 2CPXA 3KHLA 3POTA 1IKYB 1N0VC 1AUSL 1CPZA 4ZLJA 3ITHA 3MMJA 1C1BA 1NKCA 3B54A 1T8EA 1S6QB 3FVYA 4OJGA 5IV4A 2XNQA 3ILIA 1DTTA 3R8YA 4TU8A 5DGAA 3WIUA 1JMTA 3JQJA 2HNYB 5ETMA 4BCAA 2NQPA 2JVRA 3VWSA 1R8BA 2BOPA 4WP9A 3SSQA 2ZH3A 5CD4H 3U1MA 2FQQB 1HLWA 2NREA 4JI6J 5BR8F 3Q2SC 3FQLA 3LGNA 1Q8IA 3PY8A 1GMUA 3NWGA 5D78A 1PIEA 3HSZA 4ZPDA 1RBLA 4W92B 4NEZA 1Q7LB 2UVWA 3HD1A 1NK4A 4O3RA 4WF9Q 1P8GA 2MZRA 3HDSA 3X1LB 4URSA 1N5VA 4TQRA 4IDKB 1CVJA 4UY8T 3FNNA 3MPUB 2Y0BB 2G4BA 3CJ4A 3BF4A 4LRBA 3H4DA 2VOOA 2PSZA 4F02A 2VBZA 2XB2D 1K0TA 2ZBQA 2HRUA 2Z2YB 4Z7YA 4NCGB 1S9GA 4OYPA 5I42A 2JLGA 2EEYA 1EJ7L 4DLEA 2LQ8A 1SL1A 4QU7A 3OUYB 2CQ2A 4LFCF 2HNZA 1URNA 1FERA 5A8RB 2CVIA 4O3OA 1T9XA 1Y10A 1NPKA 3MUMP 1VJQA 3NBPA 4O0IA 1GK8A 1RAIB 1IWGA 2LQBA 2QA1A 1G3OA 3NRBA 2VFUA 2YWHA 2ROPA 3NOCA 4DR7J 2OELA 1NO8A 1HWKA 3FBBA 3VQSA 1UVJA 1A9NB 1NK6A 1EP4A 2BQUA 2VASA 3FKBA 1JWWA 3HULA 3D4JA 3VAIA 3M2VA 5D77A 2CQIA 2FYXA 4O44B 1NLKL 3HSDA 4LF1A 4LBPA 4RBTA 4IOAQ 1AZSB 5J1EB 1P27B 1O0PA 4LF9J 3PW0A 1XERA 4TLQA 3CPWR 3A8IA 2OTJS 5IOLA 1TKZB 4ZVPB 1G1XA 3D66A 4PPZA 2BANA 2VV5A 4CH7A 5FLXY 4NYZA 4Q0BA 4DL0C 4IH7A 2EW9A 3OLAA 5IC6B 1OIAA 2HBZB 1HBUB 2HURA 4M5GA 1F3VA 3MR3A 1CEZA 3L95X 3EZ5A 3I5CA 4IO9Q 1C4CA 2EKYA 1SPBP 1S6OA 2CUYA 3M2UA 1FRLA 2GX8A 3CC4S 4OZ5A 3RG6A 1G2EA 2EFVA 1ZTTA 3W9IA 4F2SA 2F4FA 3CCQS 1JJ2R 3LO3A 3M1VA 2DGTA 3EZOA 4J9SA 3W2WA 4LIRA 2O5DA 5I3QA 5LSOA 3CJKB 2K3KA 1RT5B 4DU7A 5A6PA 4PQAA 2WHOA 4C9DA 2I2YA 1SUQA 4LR8A 4TU9A 3WDOA 1C0UB 9ATCB 3BN4A 1H2TZ 3ZXWA 2RRAA 3RB0A 4OZ3A 2RD5C 4ZVUB 2R7TA 4DWIA 4K4ZA 4QWDA 3CJ8A 2Z30B 2AGPA 2BKNA 1DZ5A 3ETOA 2FHOB 3HT3A 2UUTA 5DDQC 5JMNA 2W9CA 1DY3A 2XTJP 4PUOA 2Q3PA 2HPUA 3HFVA 4ZPVR 3MGJA 1XNRJ 4JI1F 3HFKA 3UR0A 3GIMA 2BE2A 2XO6A 4ZPTR 5E3PA 2V50A 4USJC 4ZIWA 5ETSA 1HI8A 4EUVA 3OTOF 1Q81T 1S4FA 4YR0A 5KG5A 3AQPA 1BWEA 1YZ6A 1U0HB 3TVZA 1ZH5A 1F60B 4LVNP 3H2LA 3QGHA 1RADB 4ED3A 1FD8A 2VG5B 3BYPA 3MM5B 3HI9A 2IY5B 2NPIA 2UV8G 1YHQS 4PXDA 1M5SA 3PCOB 2VL1A 4B9UA 4ZCIA 4DCOB 2AJ4A 3A8KA 1U45A 2Q79A 3PW7A 4I4BA 1U49A 4DQIA 2G9OA 4DV1F 1Q0NA 2UXDJ 2ZH7A 3JYTB 3GIKA 1HA1A 2KVIA 4YEAA 5KFGA 1MMDA 2UU9F 4NLDA 2XY5A 3RR8A 4R5PB 3K59A 3EMTA 2BXJA 1D8YA 2P5VA 4YB7A 4LR7A 2WOMB 4JV0A 2DKOB 3QGIA 4USMA 4P2XA 1KP6A 3FCHA 3MEDA 1C2PA 5K5MA 1NH8A 1RACB 3W63A 2HHPA 4A8MP 5ETVA 4M5NA 3OR2B 1IQTA 3V4IA 1WC4A 2KO1A 2DNNA 6AT1B 5AJ3F 3DOKB 3AJ2A 2VKRA 4ECZA 3CCSS 2VQEF 5LM7E 2H4WB 2R7WA 2PFFB 1WI8A 1GX5A 5FIIA 1QD1A 1LXNA 4Q2MA 1OSCA 4QR2A 3E51A 2QIFA 2W2PP 4DI6A 4R8UB 1WOOA 3AOAA 4UOFA 1T11A 1YQHA 2AX1A 4OHYA 1U1MA 1UEUA 2IDLA 2IVMA 3KHGA 5K8NA 1RT7B 1RZMA 1IBKF 4DF8A 4WU3A 1RTDB 4AQYF 2AYBA 1X31C 3PEJA 3HVAA 1SJFA 5HQ8A 2GC8A 3CCVS 1S1XB 4EYIB 5L39A 1N88A 3ENQA 3AFGA 3MPWA 1S9FA 4U9RA 4WE1B 3VV2B 5L9NA 4HACB 1DJ0A 4OI0A 3GV5B 5DO2A 3LQVA 1G4CA 2PD1A 2B6AB 2YX1A 3UDVA 4WXWA 1AROP 1HHSA 1EKRA 3HMJG 4J9UE 1VQOS 4RZRA 2WVEA 4HTIA 3M8QB 3W62A 2KXNB 4WZQA 3SSSA 5KFIA 2D41A 5F9NA 4HH0A 2GNKA 3FEYB 1H0HB 2MDAA 4FYVB 2V4QA 3ZNJ1 1RYRA 3AXMA 5KFYA 2ZOMA 2OP5A 4IR1A 4C97A 4ED5A 2VFSA 4OV6A 3LP0A 5KFXA 5CYQA 3AA8A 2FVQA 1WDTA 4HHUA 5KG3A 3HSGA 1S1TB 4DPTA 1D1UA 1K1SA 1EETA 4LF7J 3Q8UA 2V6AA 1HNIA 3WC0A 2OHDA 2JVOA 2M2BA 2UUWA 3EXYA 3CCJS 2XBPA 3KOAA 4FVMA 1B7FA 1HBNB 5HATA 2CNNB 1UVLA 2HAFA 3M8ZA 2K06A 3R7BB 4ECWA 2CPDA 3OV7A 2LU2A 1HWLA 2BJ9A 4USHA 4IRCA 3A1YG 2QSFA 3ONQA 1CG2A 2HWHA 1NHUA 2WW4A 2AGQA 3K5LA 1KNZA 5A8WA 2FVPA 3Q8VA 2BR0A 5J2QA 3LAMA 5E2QA 1RAGB 2DNHA 3BGUA 2QRRA 2RF2A 1LWCA 3BSAA 3AAWB 3TO8A 3AB4B 4NZ6A 5L46A 4NRUA 1OQ6A 2B7BB 1JKHA 4B3TJ 1OSDA 4Y0FA 4LF8J 2L41A 2W4PA 3DU6A 4RW8B 5DQGA 3MM6B 1RB0A 2OPPA 4LT6A 1D9DA 1Q8BA 1ELOA 4CLSA 2V67A 2DY9A 3GE9A 2CWXA 1IM6A 1SJ1A 2ZZTA 3A4TA 3U27A 4DPOA 1D9AA 2DXEA 1DFDA 4CNZA 5HMZA 4LF6F 1HD1A 2AEJA 2EXUA 4DFJA 2Z56B 4FNIA 3PV8A 2QMWA 3M8RA 1U25A 2E5LF 2WONB 3DRXA 2C3UA 2E5HA 2R7XA 1S57A 4ANEA 5C25B 4CYUB 1UVMA 1NMEB 2EFOA 4Q8EA 5EDWA 5FD1A 2WTFA 3TYTA 3CF5Q 4X64J 4MFBB 1HYSB 2AHOB 1TKXA 5GAGI 3EVOA 3MEGA 4LSNB 1IBLJ 4K8RA 4OZ2A 4ZVOB 5BJRA 1HNWF 3QIPA 2W7OA 2GGPB 2CJKA 5T7LA 3HX9A 1FFSB 4XO0A 4USWA 2IBOA 1Y3JA 2G1DA 3JSRA 3HKZD 2ZH8A 1Q95G 3QZ7A 3AY0A 3OT9A 4NLQA 4MIBA 1NZAA 2VBXA 3IC1A 4EYHB 3UVJB 4F50A 4HI2A 2VIHA 1T7PA 1TL3B 3S01A 3D2WA 3VR1A 2IVFB 5U47A 2MPUA 1MU2A 1C1CA 1N32J 2F9DA 1QSLA 2WSCC 1RHKB 4QW9A 2PMZD 3WZ0A 1RT6A 3V6HA 2W01A 2VBYA 5A2QU 4NMLA 1RBOB 3Q83A 3EDQB 4IH5A 3OFEA 5H9EJ 3KMQA 2XZWA 2XEXA 2BE7D 2RQMA 4QZVB 5EX0A 4KT0C 1I3OB 3BGFA 4ZVQB 1S7IA 4L75A 4KGMA 1HR0F 1IR1A 4CO5A 4LSLA 3A3PB 1TMJA 3Q8QB 4LUBA 3VGUA 3D0IE 3Q8SB 1TV6B 4NLTA 1HPZA 3KG0A 3HKWA 4O44A 2Y3YA 4H4KC 4IFVB 1REVB 3T6BA 3KUGA 3GR1A 2HNDB 2E1PA 2JDJA 5IT4A 5HJYA 2FHMA 3DHWC 3O6QA 3BZQA 2FPHX 2UUAF 2L9DA 5A0YB 5C24B 3CUNA 1JJ4A 1XC9A 3KNAA 3Q24A 2DRAA 3HZEA 4RWWA 1OYEA 4MIAA 3I82A 2LA6A 1CC8A 4P6QA 2B43A 1VRUB 2ZH2A 5J2PA 2CQHA 4NPOA 1RLCL 3QRQA 2YKMA 4ZN3A 4M5DA 4JI7J 8ATCB 1VBKA 3CMES 3O1LA 3UE2A 2V2VA 2ATCB 4F4KA 3OHBA 6FD1A 3NCQA 3IR5B 3HPOA 1KTVA 1FO1A 5DLGA 1ZAWA 3A13A 2WBMA 4OYOA 3EUNA 2FLLA 1XBWA 3SQGB 3M2RA 2EKNA 4E2FB 3FRYA 1N56A 2C3MA 2XMKA 1LW2B 4I2QB 3M9NB 4ZVHA 1JXLA 1S99A 3M8WA 1EZZB 2EK1A 3KDNA 5E7OB 2R2UA 2DXDA 2ZDPA 1K9MT 4NXNF 1M1HA 1NSAA 3OR1B 2OTLS 2YQ0A 1YKWA 2YNFA 3OSNA 2WVBA 4IG0A 3PJ9A 2NPFA 1I1GA 4LFAF 1Q8KA 3DI6A 1LEOA 3H5XA 2CG4A 4JI8J 1Y11A 1F2GA 2RDJA 3ZZRA 3CCZA 1YJTA 1W25A 2MQMA 2F1FA 4GVLA 2N7CA 3MAAA 4DV7J 2HHVA 2XNRA 3PTWA 1A6LA 1N5QA 2AD9A 4YQWA 1OS5A 4JI0F 2MQQA 4FS2A 1GFWB 3V5RA 4CO4A 4RR5A 4RW9A 2YWEA 1YJWS 4C3KA 2MJUA 4BS2A 4OZJA 2HK2A 5KFBA 4KFBB 2QT7A 2IYIA 2HFUA 2LVWA 1NHVA 3M8SA 2B7CB 4RX6A 1FKPB 1X0FA 2Z2LA 3BKFA 2ASYA 2DTJA 4DR4J 4CLLA 4JYAF 1PYSB 5HVFA 3DDKA 2R9LA 4RO0A 2NUHA 4YN3B 1WG1A 3G6VA 3DCAA 4DSEA 2WAQD 2RAQA 2C2ZB 1QVFR 3WQPA 4K50A 3L4BC 3OL6A 4F3MA 1OQ3A 5EHHA 1NZ8A 2MLXA 3MEEA 1N34F 1TL5A 3TR5A 5DDPC 4X4VA 3TUJC 1J5EF 5BR8J 3ZZYA 1FWKA 3DU5A 1R6VA 4EBEA 3J80U 2CPYA 5HP1B 4KYZA 5K14B 5F8LA 2D9PA 4QPXA 3BGRA 4JI4J 1BUXA 2IPOB 3TRGA 4UF4A 3PVXA 3T6JA 3G82A 4TLRA 1L3UA 2G0IA 5SZTA 2IRUA 2BUNA 2HG4A 4FXWA 2ZD1A 3FC9A 1KHWA 2YXLA 2RSQA 5FDLB 3H40A 2PI4A 1V3ZA 2XI2A 5IT9Y 2C22A 4WYWA 5HO4A 4RNFA 3TX8A 3L3CA 2M0GB 1R0AB 2FY1A 2CRLA 4HR2A 3KK2A 2KZZA 4P2MA 1E6VB 1UW4A 3QRPA 3UDLA 1YI2S 1DQAA 3EVMA 2R7OA 3D0HE 3MI7X 4J5OA 1EQ0A 1JQGA 3H20A 4GC6A 1R0CB 3KLGA 5HROA 4UW2A 4CM0A 2UXCJ 3TNVA 2Y9HA 2FC9A 4ES2A 2BABA 1GEHA 2KT3A 1PJ6A 4TY8A 1PJ5A 3J81U 3SSRA 1S0OA 1S1UB 4WIIA 2BMBA 2D3ZA 2LDIA 1N5YA 1SKUB 2NSCA 4RW7A 3CD0A 5G0RA 3ET6B 5E0OA 3SFGA 1NDCA 4DR2J 3D6TB 3KLHA 3DLHA 2RT3A 2CG8A 3J7YI 4I68A 4K4WA 3M05A 1VQ8S 1TTHB 3CWJA 2F8HA 2C3YA 2WK4A 4DL2A 1GAOA 4D3HA 5IXUA 2KDOA 2MZTA 4JV1A 1N48A 4YS2A 3CIMA 1ZA2B 1VQMS 1TU0B 3KK3B 4NLWA 2BJ7A 3DRRA 1SJQA 2GFFA 4I6WA 2JEFA 2LYVA 3RB4A 3TZWA 4ZOSA 2DYAA 4PXBA 4FPIA 3GPAA 2BJDA 1VBYA 3ZTSA 3TA1A 1EQMA 2CPZA 4A8FA 2IAJA 1Q82T 2VG7A 5IQQA 2VJVA 5KT7A 3IRWP 1RTJA 1KONA 3GFXA 3C6TB 3AQOA 4B9TA 5I3UB 1FNXH 5D4NA 3GFZA 1ZBTA 1PBAA 1R3NA 2BRLA 2J8AA 1KWMA 1BWVA 3EYZA 4U95A 3MUTP 3JAMU 3SQOP 3SI8A 3MCMA 3UPFA 3HF5A 2Z4PA 4K0KJ 2DNGA 2HFZA 2VG6B 2QEXS 4AUKA 4CH1A 4DR1F 1U02A 4J9KA 1T9TA 3W2VA 3QWUA 3LF0A 3C16B 4B9NA 2ZVIA 4AD6A 2CJBA 2HS3A 3MAQA 2J0WA 2XGQA 2Z0GA 1RT2A 2RH3A 2MKSA 2H5JB 3PYDA 1WF1A 4CLZA 4IR9A 2MZJA 1SC4B 3CCES 3UDCA 1RWOB 3DMJA 3IRXB 3JQMA 2LU1A 1T03B 3HVTA 3D67A 2KI2A 3OXGA 3ZZ0A 3BBFA 3PO5A 5RUBA 2W2OP 4MIWA 3BDEA 2ASJA 2E1MC 5BXIA 1DTQB 3MF5A 1MG7A 2M3DA 4UTGA 1HI0P 4GO5X 4PZVA 4YFUA 1QAXA 5DETA 4F0HA 1UFKA 3ZTRA 3O2IA 4ECQA 5JXSA 2BV3A 2FDNA 3MZIA 1O5JA 1CJVA 2OFHX 4JI6F 2V8PA 4I2PB 2UU9J 3PX6A 3FGVA 4K7QA 1RAOA 1JXVA 1FCAA 3PIOQ 5LXRA 2MHEA 1QM9A 1LQ9A 2YWGA 4LQ3A 1FA0A 1JLGA 1S0VA 1DAXA 4ELTA 2BZ2A 3WX4A 3IG1A 1D3WA 1HMVB 2EBGA 5F8HA 2ZZNA 1XMQF 2DO4A 2W7AA 1Q53A 2CPJA 2W9BB 2ZH4A 4AL5A 2RRBA 3VAMA 4KO0A 4EO6A 2VQEJ 1XK8A 3I4HX 3NMAA 4C8MA 2G2OA 1IWAA 1U2RA 3CJRA 4KV8A 4MTPA 4EEYA 4WIQA 1J5OB 2D9OA 4NZ0A 3NCPA 3QZ8A 2W2QP 1RGVA 4X4QA 4NLPA 4AQYJ 3HHLD 3JS9A 1SBRA 3GCXP 4H4MB 1RTIA 1Y00A 1J2VA 4DX8H 4CO0A 1MROA 2Y1IA 3BKUA 1UWBA 3V81A 3M6VA 3KJVA 2P6TA 3DRSA 4GRSA 2WW8A 3TZZA 3OJUA 1VRTA 2IC3B 4LFBF 2VZ9A 4PYAA 1BQNB 2BOAA 2B4PA 1U7LA 1YZ7A 1WKJA 3GG1A 3LTOA 4DSIA 3OVSA 3HHLA 2DB1A 5F0UA 5KFWA 2KJVA 3T9NA 3GJSB 4QR1A 2NZCA 1NH7A 4DL5A 1M1KT 4NRTA 3GCWP 2OEJA 5I3PA 3I9V9 1HHQA 4A8SA 4ETZA 2DT9A 2LQ5A 1VQ4S 4ALZA 2VA2A 3DLLQ 4X4SA 4HDHA 1IKVA 1VIOA 2LLZA 3M7VA 4MK7A 4ED7A 2IDEA 2PEHA 4MH8A 3FCVA 1HQUA 2OPSA 2YNIB 2GMHA 2B9YA 1S1WA 2B5JB 3JTOA 4OX6A 2DIVA 1CJTA 2WB1D 3JTNA 5CAAA 1X9SA 1KLMA 3HXMA 4OQJA 4IUFA 4M5JA 1NKBA 4FXDA 1NDLA 1NK0A 4JI2F 2NR0A 1TQLA 1VQ6S 1PYTA 4CLPA 3IAM9 3SXLA 3R1LA 1AFJA 3OTDA 4B9SA 5D4PA 4AT1B 3MXHP 2DNRA 4GKKJ 1OY8A 1V6HA 4L73A 5KFQA 1N6QA 3LWLA 2E66A 2DCLA 4DR5J 3SZ2A 3BPDA 2ZJQQ 2DR7A 5IC4B 2AYEA 3OJSA 1LFWA 5KG4A 3H42A 2E7WA 4DV2F 1WC5A 3G71S 1T02A 4NI2A 4A8YA 3QLHB 4JV5F 1W2BR 1FT8A 2HS4A 3ZTOA 3RBDA 3KUHA 2K1RA 4J91A 4OI1A 4ECTA 4DSLA 1IKWB 3N79A 2GIRA 4CLUA 3I0RA 4ES1A 1WEZA 1TUGB 2NXCA 4J9LA 3BS9A 1MWQA 4HI1A 3TJ8A 1S1VB 2YNHB 1RT3A 3CD6S 1WC0A 2C42A 4MYUA 2HMIA 4CLTA 2UXDF 2Z58B 3C14B 2N82B 4YR3A 2HGNA 3BN7A 5K8OA 1TK5A 2QLWA 1V9OA 3M32B 2QLJB 2E5LJ 4K5RA 1ZPWX 4RUCA 1IKXA 2H5IB 1R31A 5GVQA 2YQ3A 4W4MA 3OHAA 1SB6A 3OSPA 2ZDOA 3TANA 1IJEB 3TUZC 2XMAA 1PG5B 3T1AA 2PGCA 4KGZB 4XPCA 2YWWA 5EWEA 4G3IA 4W98A 3W61A 2JHEA 3GIJA 3OQ2A 4QWAA 3D7SB 3KJNB 1RK8A 4OI4A 1ZTWA 2CNKB 4OLOA 4C98A 2KKHA 4DG1A 3ISND 2NXUA 1H2VZ 4I6YA 4M8LA 2HHTA 1FDBA 3PIPQ 1F1BB 2QL5B 4DX7A 1S9EA 3TOQA 3GYNA 2QL7B 4I6AA 2ZZMA 1VR6A 3T1YJ 3TEHB 1GMWD 1YJ9S 1KRPA 1HBOB 4DN0A 4EMDA 3PW2A 4EFAC 3GYXB 1RCXB 1RU2A 2ASDA 2DD8S 4FDFA 3SDEB 2XCPA 3OFHA 2BACA 3RW7A 4WZMA 5J2MA 3JB9k 3PXGa 4TVAB 5ETTA 3KHHA 2BJ1A 2IJFA 1VFJA 2KH9A 2NCKL 3FSIA 4C11B 2VC0A 3MMCA 1S0MA 4PR6A 1A7GE 1H72C 2DNLA 2VD3A 1JLAB 1CS4A 5GADU 4TU7A 1GMWA 2P9CA 4ZP7A 4HHHA 2AYGA 3A8JA 3N5BA 4DUZF 3EVWA 1X4HA 3H5YA 3VVUA 1IJFB 1RLDA 4IFYB 3PW4A 2Y1JA 1BQMB 3C15A 3N6LA 3NGKA 2AEFA 4N76A 5IWAJ 1BHNA 5DG9A 2JFKA 2DGUA 3UCGA 3HJFA 3TAMB 5DQIA 4LF7F 2KL8A 5HLFB 2X1AA 3B4DA 1T05A 3ZZZA 1LW0B 4PG4A 4EK2A 3P6YC 1HNVA 1TFYA 4F3OA 2FGCA 3F44A 4RU2A 2GVZB 4G6VB 4ZIVA 5HBMA 4CO1A 2HIYA 3QIDA 4DXLA 4CLFA 2RS8A 5EWFA 3V2UC 4TNOA 2XSJB 3E01A 2MZSA 5J2NA 1UZDA 1QDUB 4Y6IA 1IR2A 2BEFA 1WWHA 5IT0A 3G6XA 2ZE2A 3J7Z5 3O8WA 5EWGA 1YJNS 3LP2B 2HHXA 2E1CA 3I5BA 3OL7A 1TUWA 3RW6A 3DN9A 2QMUB 5B09A 4X4UA 3I0SB 2OGUA 4FS1A 2F9JA 5I4MA 5A6WA 3D3BJ 4RPFA 4OL8A 5EN1A 1GXTA 2C2EA 2M52A 3JSMB 5F8JA 1NK5A 2GZOA 4KY3A 3DDNA 3G8QA 3CJ0A 2ZBPA 5GMDA 3M6UA 2OPQB 3NOGA 2XWXA 2MZ1A 2F65A 4J9VA 3MCNA 2DGSA 1BE4A 1YG0A 3QFWA 3FUYA 2R7RA 3BH6B 1U6ZA 3RRGA 4OYWA 2C2DA 3CC2S 4KGXB 2XYHB 3J7YU 3I5AA 3AH6A 3A3NB 2XMTA 1FKOB 4OYBA 1F0XA 5E33A 2BRKA 4P10A 4ILLA 4FXVA 5DM7Q 3UNGC 4L6V3 4ICLB 1Y0HA 4C0OC 4P72A 4ZPAA 1KS2A 3J80Y 2KXHA 8AT1B 2A1BA 1FE0A 1SIZA 4DR3J 1PC5A 3QAUA 2Y0SD 1JLFA 2ZOFA 4Q45A 1Q8LA 2V9KA 1TAQA 3BV8A 4LRFA 1ROFA 4IG3B 3TWZA 3L7PA 1CJKB 2M8HA 3BB5A 3H7HB 4F4ZA 3EZUA 4JI0J 4TQSA 4DUYJ 1VQ5S 4GVBA 3S7RA 4KKOB 3VZIA 1VMBA 3AODA 3EDRB 5B0AA 4QWEA 1S48A 4I0WA 3QAEA 2V63A 3M30B 1B64A 2LKZA 4DFMA 5EUHA 3F73A 3I31A 3A12A 5IFMA 2XMWA 3CDBA 3T5JA 4J37A 4Y2MA 2B56A 2HEKA 2JL9A 1XR7A 4MJKA 3T9ZA 1ULRA 1Z1ZA 4U67Q 2AQ4A 2ZM6J 1NJZA 1NJYA 1X4FA 2VDIA 2W25A 2IMWP 1NCLA 3Q89A 2H4YB 1X5SA 2OMOA 4PWDB 3GV8B 1XN9A 2DNKA 2B3TB 1S97A 1C0TA 3MPDA 1F9FA 2I5JB 2ZEJA 3OBIA 4X84A 4YB1P 4AXJA 3BDPA 3PR4A 4IKAA 4U96A 2Q66A 1HMVA 2DNZA 1J5EJ 3G86A 3UN3A 4XAKA 1RP5A 1PKUA 1N32F 1FRHA 3DLKB 1RT1A 2E5GA 3D0GE 4LJMA 4IOCQ 3KFWX 4OYXA 2R8IA 1WC6A 3ZZOA 3CO9A 2COLA 2FLPA 2G2YA 4NMXA 1B0TA 4PG8A 5AXNA 4FNHA 2GAGC 4RNMA 2ZHOA 5D3GB 4LREA 3R6LB 3MWBA 2DGWA 1JXEA 1SKSA 3IBCB 3IS9B 1RAAB 2GVDA 5K8MA 1GTEA 2WB4A 4CTAB 1UVNA 3EPGA 1NHKL 2MYFA 2YKPA 1KDNA 2O3DA 2IM2A 2MKYA 1FJ7A 2W2NP 4ID5A 5HN0A 5T41A 2P9EA 4UY85 2B4OA 4WCEQ 3TUIC 1CJUA 3HHKA 3L7UA 3PFEA 1JLCB 2GMLA 2R8HA 2MKCA 3P4UB 2R2RA 5L1JA 5KFOA 3KLEB 1RHRB 4C8ZA 4X65J 1TL1A 2J76E 2ROEA 4FYXB 1UTAA 3CC7S 4A4JA 2J6SA 3TQEA 3JAMY 3WX8A 3QT6A 1AXQA 2HQCA 4ZCKA 4RKUC 2Y1RI 1MN9A 4JI7F 2H65B 1T3NA 3T19A 3ZTQA 4CCHA 2UVVA 1TL7B 4Y28C 1L3TA 3OXLA 1KOHA 4ED0A 3NXZA 2YKNB 1D0EA 4FPRA 2DY1A 2AJFE 1MMNA 1HBMA 2RQCA 1ICEB 2CQ1A 2VC1A 4USTA 1VHIA 3KG1A 3W1YC 5LSLA 1HL6A 3VALA 3QYYA 5DJBA 4CDIA 3CCTA 3PJWA 1APSA 1NBEB 4DQSA 3N6MA 2HSEB 2IA0A 4G1QA 4H54A 2CQ3A 3MM8A 2F63A 4XIUA 2NUUG 3UN5A 4C6AA 1X8DA 2EK6A 3DLGB 2DCUB 2HZAA 4ZDNA 3CCRS 1X9MA 3VZHA 2N7YA 2ZOGA 4OJ3A 2EC2A 3PJXA 5ETRA 2FJAB 4B3RJ 5KT4A 1PGZA 4B02A 4PABA 4Y2AA 1U8SA 3RYLA 5KFZA 2FZGB 3H2VE 2H3EB 1RAHB 2DRDA 1CULA 3PYFA 4JI8F 4U8VA 4R25A 1RTHA 3CD5A 3TZXA 3MFHA 1N5TA 2O66A 2RRNA 2XY7A 2IJRA 5A8KB 4AXIA 4CP5A 2VFTA 3CULA 1IUJA 2DISA 2CPFA 5KTQA 5K8PA 4FF2A 2H9ZA 5DDRC 3MAHA 4DMZA 2QE5A 2EFGA 4NE9C 2CQ4A 1M90T 2LXFA 1KKHA 3CCMS 3PDNA 1SQEA 4WFAQ 4PPDA 2FZCB 4JI5F 2DGXA 2IRXA 3C8YA 1J27A 2V4RA 1S6PA 3UD4P 3TA2A 2MHNA 2CXEA 5B0CA 3HSJA 2HVEA 2CPIA 3UCUP 4DR4F 3BM7A 1HQEA 5KFNA 1PYOB 3T5LA 2N4DA 1WHVA 4Z7CA 1TVRB 4OI3A 4V19J 1R8HA 5IM0A 3FCWA 1N33F 2W4DA 3OW2R 2QLXA 4DSKA 1M5HA 4GKJJ 3OVBA 1WOPA 2AZ3A 1VQYA 3R5JB 2BKOA 5C42A 2FY8A 3DOLB 4X4TA 5L9XA 1XNQJ 2XYPB 2NSBA 3CDUA 3GSIA 1QE1B 2BW2A 3LP1B 4JP8A 4JI4F 4A8KA 3CVKA 1Q7YT 2B9EA 2E9RX 4FF3A 3MCOA 4I67A 1XQIA 3L09A 3I55S 1TKTA 2ZBRA 2OD6A 5DLFA 4ZVTB 1XMQJ 3Q8PB 1FDDA 4PCQA 1D9FA 2XG8A 2IMOA 3PX4A 5HQMA 1JLBB 2JOQA 1UETA 2QA2A 1UA1A 2EFQA 5CA5A 3KLIA 1S5ZA 1SL0A 3RJMB 1UFLA 3I87A 3M8PB 1SIWB 4PXEA 3R3TA 2XM3A 3MM7B 4ZHRA 2PT0A 4ZK7M 4BDPA 2YNGB 2ALYB 5E5NA 1GXLA 4B3SJ 4X4PA 2YKQA 1KFSA 3DGVA 3G6ES 1GT8A 2UXCF 2XY6A 3NGDA 1S77D 1JLQA 3QBCA 2B51A 2QFJA 2BDPA 4DLGA 4P71A 1RT4B 4WXOA 5L1IA 1UL3A 4ZCLA 1I94J 4EI2A 3DYAA 2GO9A 4DQPA 1JNZB 2MSSA 3C46A 1Q79A 2JC1A 3MMBA 1N0UA 1FK9A 3HVRA 3K57A 2A6MA 3CJ5A 4P9SA 3SEOA 3FZ2A 1VQKS 4FF1A 2BX6A 3KJQB 2A2CA 4DR2F 3KMSA 3BQ1A 4USUA 3GFYA 1LWFB 5GAHU 4LFBJ 1SC3B 2JJ4D 4RW6A 3KLVA 2CZVC 2C2KB 2VPXB 3DLEA 4E0DA 1B99A 1Q78A 1DLOB 2QL9B 3D28A 3R5BA 4IQMA 2DR8A 4HH1A 3DRPB 4K4UA 2J6UA 1BGXT 1OPZA 3CIZA 5B08A 3KYLA 2DR5A 2UXBJ 4ZP6A 2AYMA 5CYMA 1JJCB 2OPRA 1U6BA 2VONA 1MMLA 4X4OA 2V69A 2LCWA 1PAUB 2ACYA 1VCTA 4UUXA 1RABB 2E29A 3TI0A 2J9DE 2CKWA 4CIOA 2J0QD 2D69A 4ERDA 2RKIA 1TK0A 1UJ6A 5KFRA 1SV5B 3PACA 2QN6B 3POTB 1KSPA 4P7VA 1KLNA 3W5YA 1VJWA 1ZS6A 4ZLNA 5CD4A 3ITHB 1C1BB 4JI2J 2MXYA 2CIMA 4LF4J 4ZVRB 3LW5C 2V4JA 3BGLA 3FBEA 4RJVA 1UJ5A 3MMAA 2HK3A 2HVDA 1DTTB 3ILLA 4FKXA 3GJRB 4K0KF 3QT8A 1FDNA 1LWEA 2OKQA 3RBEA 4X4RA 1GTHA 3T3FA 3CD7A 3GJTB 1QAJA 2NYIA 1YTYA 1IXKA 4DV2J 5AE3A 2PMHA 4NA2A 2DNMA 1F5AA 1TELA 5LMUJ 1N5SA 2RU3A 3PRVA 1S49A 4JV5J 4HKQA 2ZWOA 4OI2A 2YH1A 2KRRA 1S59A 4DHVA 3UD3P 1N54B 4TXSA 1WDDA 1R89A 2VDHA 4XDDA 2FJDB 1RAEB 1NK9A 4NCAA 3EM1A 2EFNA 4ZITA 4DOZA 4CO3A 2YWKA 4RW4A 1FI4A 1VQPS 3NAIA 4YOEA 4AL7A 1E6YA 1S9GB 2QLBB 4K4XA 4AE5A 5I42B 2LP4A 2GIFA 4QIEA 1Y7PA 4XPEA 3NY0A 4ZPWR 2FJEB 8RUCA 3DOMA 1RTZA 2FJBB 4RBVA 4H4OA 2DGVA 4IH6A 1IVZA 1R27B 3NBPB 2MZQA 4NOHA 1P9YA 3MD1A 2AGOA 2GJ2A 1VQ7S 5KFJA 4B9LA 3J7AN 1RDRA 2CFXA 2FIUA 1EP4B 4JV2A 2FGOA 2DH9A 3V6DA 2A2DA 4C0HA 1SJ4P 3KKFA 2GS8A 3UQSA 3M2VB 4DX6A 2OFGX 2CADA 1NPPA 3LALA 2GW8A 2Z2MA 2MSTA 3FEZA 3DM2A 1NUEA 5KOXA 5LMNJ 4USIA 3F0NA 2XS2A 1R8AA 4O4GA 1Y9OA 4ZLPA 1AUDA 4CLYA 5GAEU 1VS3A 2BANB 2R42A 3MECA 1YBAA 1NEEA 4Q0BB 4DZDA 2H48B 4F04B 4IOBA 1T95A 4UQTA 5AXLA 3R9LA 2MKKA 4ES3A 3FSYA 3SBMA 4DFPA 1S10A 3V6KA 2K7KA 4ZJQA 4K4VA 3D6FB 1Q16B 3F41A 1XR6A 4G65A 2YY3A 4UQGA 4QWCA 3M2UB 4QPTA 1FX2A 3QO9A 4DN9A 3W60A 2XLJA 2DR6A 4KGVB 3LAKA 3HP6A 1PSDA 3M1VB 2J9EA 1MW7A 2AWZA 2MTLA 2DK2A 3W2WB 3ZTPA 4ED4A 2ZNZA 4NLRA 2ZH1A 2EI5A 2P9GA 1QAYA 3TARA 2KN4A 4O0NA 5KT5A 3Q2TC 2J7UA 2HHWA 1SUQB 4LSZB 3KNGA 5HJXA 4LF2A 3CDWA 5ETLA 1QUPA 4DUZJ 2I1RA 1PO6A 3W9JA 3OL8A 2HBRB 2HZVA 1S7HA 1WJ9A 3UN2A 3QPIA 2SXLA 4B3OA 1P9QC 1X4BA 2YVSA 5F8GA 1UCNA 4N7TA 2F8MA 2Z8QA 2W9CB 1DQ9A 4ZMMA 4PUOB 1YLXA 2E1RA 3MM9A 5HVHA 3K2YA 2BE2B 2AZ1A 1NU4A 1FVQA 3QMQA 2BE9B 2WVDA 2J9DA 3KLFA 2GCFA 4QBUA 1FNMA 3ISNC 3AJ1A 2DIUA 4TN2A 3L9ZA 2MGZA 2VUGA 1PBUA 3CCWA 4ZVSB 2C2MB 1O6XA 1IQZA 3BR9A 2CQ0A 3TX0A 2CYYA 3MCSA 3QGPA 1HWJA 3WHIA 4ZVGA 4PAAA 3B8HA 1UZHA 1UPPA 1WF0A 1RWNB 4GKKF 2QA4G 2AJQA 4JB8B 3NKYA 4M5MA 2DHXA 5L8RC 1IBMJ 2YX7A 1Z2LA 2M7SA 4DR5F 1SH2A 1LFPA 2G13A 2H51B 2JWNA 4PQUA 1VC5A 4IYQA 4F36A 4IRKA 2QA4S 3QGGA 2M70A 4N41A 4OHXA 3IBWA 5C2GA 3MEDB 3PKMA 2OAUA 3DXSX 5H9EK 3N01A 3C6UA 4ZCMA 3V4IB 1WC1A 2RS2A 1EKSA 3KK1A 4C8LA 2RDIA 3TEGA 2HHQA 4UZCA 1PCAA 3CJTA 2CZ4A 2ZBCA 3PR5B 3TAPA 3H2UB 3DGPA 3B4MA 5M2PA 4J9PA 1REGX 1KQKA 1EB0A 2DGQA 4AYBD 2R8JA 1UPMB 1DBDA 4WFNQ 1SC1B 3VVTA 5D0GA 4J9RA 1D8ZA 2JEGA 2HBQB 5HMWA 2AF6A 4ZJOA 1IKYA 5CZXA 2F5GA 2L08A 1KTQA 2AT1B 2E9ZA 1SC6A 4WFBQ 3C2PA 1S6QA 3R2CJ 3AOCA 4C3MA 2RUGA 3EJMA 4P73A 4N56A 1KFDA 1WC3A 4NXMJ 4OHZA 1FKAF 1FVSA 5ETNA 2HNYA 4QU6A 1I6JA 3DFEA 1U6FA 3TZYA 1VDHA 1CQMA 2HIQA 2MLZA 4X66J 4O3NA 3RUBL 2QMXA 2HAIA 3BREA 4Y2CA 5KFVA 1AW0A 5D8HB 2WVFA 2DO0A 3OTEA 4DDFA 3T1YF 3IO1A 4QYZJ 2LDYA 4DL3A 1DARA 4IDKA 2D3O1 3LP0B 1RI7A 2POKA 1Q86T 5CYQB 2RE1A 2Y1LB 3IMQJ 3WC2A 1EETB 3D1OA 4NCGA 2J0SD 5KFPA 1HNIB 1TKDA 4C8OA 4PXCA 3OUYA 3PO4A 3QATA 4F67A 1TR0A 5A8RA 4N8NA 1S4EA 4MKAA 2ATLA 3IA0A 3DXBA 2XMUA 3TQ1A 4RUBA 4F7VA 1VOMA 4NLGA 4NASA 3OVAA 4U7UK 4L3NA 2KYZA 1JIHA 4MMOA 4ANDA 2PEBA 3IAS9 1UEKA 4LMZA 4M5HA 1OPIA 1ZETA 5IWAF 1CQNA 5A8WB 3S1TA 4HLBA 5J2QB 1Y4ZB 2FLOA 4DV6F 2RF2B 1LWCB 4I64A 1AZSA 5J1EA 1FTRA 2MJNA 4Q5VA 3P8BB 4ECYA 4QR0A 3S8SA 1TKZA 2L9NA 2X3DA 2JEIA 1JKHB 2U2FA 2Z2ZA 3HK2A 2KT5A 4O3QA 4WK1A 3OLBA 3NEKA 1NSKL 4MKVA 4TKTA 2O01C 5KFHA 2V2ZA 5D0EA 2B4VA 2OPPB 4Z2XA 1HBUA 4WFZA 2PA8D 3W65A 2CAJA 2PC6A 4MKYA 4MYTA 4OX7A 4V1Ak 5DZ7A 4X2BA 2HKEA 1R8PA 1SXLA 2ZKTA 4DL6A 2MQPA 1XEZA 4M5KA 5B0DA 4QIVA 3ENWA 3G2XA 3VHQA 2M5YA 2X1FA 4P74A 2HVIA 2CQCA 1NSQA 4KR0B 3CJKA 5L1LA 1RT5A 1DRZA 5G4DA 5JVHQ 4QCLA 3AA9A 3ADAC 4EZ6A 2YBVA 1K73T 3PG9A 3PYEA 3VAGA 5CHCB 3MTJA 1WHWA 2GQCA 2LQ9A 2MQLA 1C0UA 1U26A 2MEWA 1KBRA 3KG4A 4PG5A 3RAQA 1YK9A 2NXNA 4UZBA 3HLUA 2X51A 1WEXA 1FWPA 3I6PA 1N52B 4ID8A 2C28A 4ETXA 1R7IA 3PEHA 1TKXB 2DEJA 2V8DA 3MEGB 3K5MA 1LK7A 2EG2A 1K0VA 1NB7A 4HDGA 3TVKA 4KE5A 1Y5LB 3QIPB 2VODA 2DGOA 4ZPBA 3PRBA 5T7LB 1JLEB 4OYZA 5H9FJ 4DR6F 1NJXA 4NEYA 4DR3F 1Y5NB 4DPYA 3SIPB 3FRZA 5E3CA 2CPEA 2MKJA 4RUHA 3RBXA 5CABA 1U0HA 1X0PA 5IQ6A 2OH2A 2C2NA 2XWYA 4P52A 2VG5A 4DUYF 3TJAA 5C2CA 1WACA 3MM5A 3GTYX 4ZJLA 1DURA 2AU0A 3VGSA 3HT0A 2OI2A 1DQ8A 1WOSA 1MU2B 4JI5J 1C1CB 3UI3A 1SKWA 1WTFA 1ZAVA 3TJ9A 2LA4A 4UUWA 1GXUA 1JX4A 1U8WA 1W2IA 1RT6B 4P2SA 4DV4J 2V2KA 3HCXA 4QIWD 1NK8A 3JYTA 3M6XA 2KFZA 1MSWD 3PX0A 1RUSA 4QIGA 2HQDA 2ZM6F 2ZJPQ 4R5PA 1GQEA 3ZZPA 4FP9A 2P2CB 4JBCA 1N33J 1F5CA 2HYIB 4K5SA 3CO0P 4Y3CA 5GADI 2E44A 4K2JA 2E5JA 2WOMA 3MTKA 4LSLB 3AD9C 2HRTA 1X4CA 1B4SA 3KWMA 3MR2A 1SH0A 4NLVA 2BQ3A 2ASLA 4DX5A 1F2HA 1HPZB 3OR2A 2HHHF 3EX7B 3T1HF 1FD2A 4B9VA 4X4NA 3BSCA 2JSXA 3DOKA 1WEYA 1EIYB 1KOOA 2U1AA 4RLEA 3E2EA 4A8QA 2LECA 3HHDA 4K2XA 4DPWA 4GO7X 1RE1B 1M5OC 3FJ2A 4CWBA 3EE3A 1C4AA 3NG8A 4DZ6A 4FVCA 4V19X 3GB0A 2CJYB 1RBAA 1EARA 4R8UA 3TA0A 2ILZA 3Q86A 3ILJA 1H73A 4CNYA 2JLFA 1WKKA 1WHYA 5J2PB 1RT7A 1RTDA 1AB8A 4NZ7A 2E5IA 1HWUA 5F3TA 3TW0A 1OMSA 2YKMB 5HL7Q 4M5DB 5IT9U 1XTZA 3QT5A 1S1XA 2P6SA 4OYMA 2FVCA 1YJVA 4WE1A 2B4UA 2VQFF 4HACA 4C8NA 2MQOA 1URRA 2E9TA 2B6AA 2V0NA 4LR9A 2BM1A 2GA7A 4ZPCA 1HARA 4YDDB 4OJHA 1R0BG 1FEEA 2WSFC 2ZHBA 1U1KA 3M8QA 1G7CB 1NPRA 4QOTA 1SI9A 2QJ3A 3M2RB 1N36J 1MN7A 4KAIA 2KYXA 4OX8A 4ZVFA 1HIYA 5HI7A 3RBZA 3IR6B 3CJQA 4X65F 2OUGA 2IM1A 2RB7A 2OEMA 4ER8A 5D4LA 5J1PA 3NCRA 4QW8A 5FJ4A 2YTCA 3SMZA 1T9YA 1HNZJ 3NNCA 2PIIA 2DH8A 5J1NA 5DDOC 4FYDA 1VISA 1S1TA 2R7QA 2YNFB 4ED8A 4XTTA 3CCLS 4IG0B 1BXNA 2VU5A 3P45B 3DI6B 3BPSP 5KFSA 2RVJA 4ILRA 1HBNA 1UVIA 4OHVA 2XCAA 1RHJB 3PYGA 4PEOA 3MAAB 1NJIT 1EX8A 4NCBA 3W64A 2BJEA 3MURP 1HNXF 4A8WA 4DSFA 2M88A 3IFEA 4NX9A 4RW9B 4O23A 3GMGA 3VAFA 1RJJA 2R7UA 4BWMA 3R5GA 2LXUA 3THTA 3SCLE 4M1KA 4B3RF 2C2RA 3LPEA 3UR3C 5ETOA 4JI3F 5D6GA 2XQCA 4XK8C 1OJ4A 2QGFB 1U09A 5HVGA 5F0WA 3PM9A 3SCKE 1QY7A 1UMJA 3HM9A 5E3AA 4QYRA 2FLNA 1MWZA 4RW8A 4F4WA 5B0BA 1UW9A 2IRYA 2C1EB 2V8GA 3MM6A 2W8LA 2LEBA 2OSRA 2W4CA 3K5OA 2HFOA 3R7NB 2HLTA 1U1QA 4NA1A 3MEEB 4YY3J 1KN6A 4W90B 2XZTB 1U1OA 3CXCR 1XMOJ 1LV5A 3GV7B 1YGYA 5KT2A 2QG9B 3GG0A 1QJHA 2I38A 2RIJA 3BGRB 2CJAA 2HQFA 5KG2A 3CW2C 4EWTA 3G82B 1RWWB 4C2MA 2WONA 2JNJA 3JQKA 3SYZA 3JSYA 4FN5A 5THWA 2L3MA 2ZD1B 5KFMA 3THVA 2MQ8A 2NLWA 3OPKA 5C25A 4Q7AA 2QV6A 4CYUA 1FRJA 4GKJF 4EBDA 2M4MA 3MEKA 1YDLA 3CGIA 4TYAA 4C8YA 4WP3A 1HHTP 2GJFA 4MFBA 1HYSA 2EVZA 3ILOA 3KK2B 4OZNA 1QLNA 3HFZB 3CJ3A 3BQ0A 1XNQF 4LSNA 3VAJA 2KM8C 2DPIA 3QWPA 2PDAA 2GGPA 2IJNA 5HROB 3KLGB 4N77A 3NMRA 1NNDA 4YB5A 3GLJA 3MDFA 2RILA 1SQFA 2RHQB 2EC0A 2GHPA 4USVA 5KG1A 3W5XA 4J9NA 1N8RT 3QJLA 1B7YB 3D1HA 1JK9B 4TY8B 3C3LA 4PG7A 3KUEA 4WKRA 1F9HA 2XHWA 3IN5A 1SJ3P 1VK3A 1CSJA 4K4TA 3UVJA 3RAMA 1M0SA 1N5YB 1ZYQA 1QTMA 4RW7B 5G0RB 1TL3A 2Q6BA 3TUPA 3KLHB 2J7WA 4PKDB 3FK4A 3D68A 2VA3A 3AD7C 2ZNYA 2B8PA 4B3SF 4I56A 1ZPVA 5BYSA 4DV0F 3H4BA 4OV1A 1S72S 5D4OA 4FYWB 5IZHA 3NS6A 5L1KA 3H5UA 3VF0B 5CH7B 2LMIA 1YRUA 1YITS 1I94F 4M94A 4F8RA 2RUSA 1NXIA 1UVKA 2HRYA 1BY9A 1X9WA 3DRRB 3M9MB 2JX2A 4LRCA 3MR6A 2VB6A 4DV5J 3CNQP 1RWPB 2MLYA 2HWIA 1R6YA 2W1BA 1VC6A 2FTRA 3RZAA 3DNCA 3NAHA 3N28A 1NJWA 3B82A 1TV6A 3AB2B 4ELVA 4HT7A 2CZ9A 1LK5A 4DSJA 2G0JA 5KFEA 5LXYA 1HW8A 2IAJB 1FF2A 4QJVA 1RWMB 5AXKA 3RB3A 3BJYA 4IFVA 1REVA 1VIXA 3E8OA 2VG7B 3LGHA 1RTJB 2HNDA 4RNNA 1FJGF 2ZJRQ 5A0YA 5C24A 2KFNA 2UXBF 1UJ4A 1ZZFA 4RNOA 5DM6Q 3AXKA 3LWMA 2AJ1A 2DEIA 1VRUA 2ALZA 3G4SS 2R2SA 5DRKA 4LF5J 4YUDA 4HHJA 4DPUA 1RSCA 5KFKA 3W2VB 3T5KA 2R4FA 1HD0A 3K58A 5BYRA 5KG6A 1RHQB 4BC9A 3G8TA 2FJWA 2HGMA 1RT2B 3AD8C 5KG0A 2W7PA 2MY8A 4WFYA 1KVKA 3DMJB 4KHMA 1S76D 2GO8A 3HVTB 4X62F 3SQGA 4LF4F 4M5IA 1LW2A 4I2QA 1RU1A 2YKAA 3TVYA 1K44A 1WG4A 2O67A 2HS0A 3U7JA 1H38A 6FDRA 2X7IA 1CJVB 2DJWA 3OR1A 1PC4A 1RXOB 3D1QA 1VBZA 5LMUF 3N5FA 1V3SA 2RJZA 2DNOA 4R0JA 4J9QA 1JLGB 4WKYA 2LQJA 1ACMB 1JLEA 4MAKA 4OLPA 3Q23A 2O1PA 2CJQA 1MWYA 3IG1B 5KT3A 1CLFA 2EPIA 4JOUA 2XLKA 4Y65A 5KOWA 1YBUA 2D1CA 1DHMA 3FFIB 3F56A 5DZ6A 5DG8A 1WG5A 4WYLA 5GMKa 3VTIA 2L48A 4Y00A 4KO0B 3BO2A 3EGVA 3HHEA 4L3KA 4IRDA 2AIRB 1B70B 5KAKA 3H90A 4KV8B 1F6TA 5KFCA 4KRWA 5A2QY 3RGIA 4KFBA 4OX9F 5F3ZA 3QJJA 1U1NA 1FKPA 2ZUAA 2DHSA 4YHHJ 1RISA 1WSRA 3BR8A 3R5DA 4GC7A 3J81j 2IM0A 4WWSA 4I7FB 1TP7A 1GX6A 3NS5A 3FEXB 1PJ7A 3JXOA 1RTIB 2QZ8A 5C5JA 3Q22A 1MROB 4ECVA 4J9OA 1UWBB 3V81B 4CT8A 4ZVEA 5LMNF 3KJVB 2GQQA 2VJUA 3DRSB 1ZM3A 2GQ2A 1VQSA 2UUCJ 1JJHA 1VRTB 4LRDA 1RAJA 5MAOA 2B9XA 2J5AA 1UA0A 3NL0A 5HP1A 5K14A 5GAHI 1JNRB 2HFVA 2XSFA 3HHLB 2AMCB 1IR0A 1F3FA 2VPYB 2C3OA 1TK8A 4WPAA 2XMJA 2FD2A 2FC8A 5ETPA 2NS1B 4KBIA 2JEJA 2PO4A 3J7A1 2CA9A 1H74A 1OO0B 1IN0A 3DDIA 5FDLA 1IKVB 1QSYA 4DL4A 2ROGA 2H1YA 1LKZA 5E3QA 1XIQA 2XLIA 7FDRA 2XC9A 1R0AA 4BC7A 3IM8A 1HQUB 5EX3A 2OPSB 2F4VF 1E6VA 2ACMA 1H2UX 1S1WB 4KHRA 3RRKA 2I8EA 4MT1A 1UAWA 2PA3A 4ED2A 1P6TA 1CJTB 3VAHA 1RAFB 3O44A 3BH7B 4I69A 2XO7A 1KLMB 4Q8FA 2W8KA 2GV1A 1TFWA 2QX0A 3CSKA 5JJBA 3A3OB 1NSPA 2H5EA 2WBRA 4O4RA 3VGTA 4WP8A 2XGPA 4FBTA 5C7PA 1VRQC 1S1UA 4DV6J 2XMVA 5ETKA 2HQGA 4WU2A 3AJDA 5ETQA 4ZN1A 2UUBJ 1N6QB 2WVCA 3ET6A 3W66A 3CMQA 2UP1A 4MK8A 3RB6A 3K7RA 4O3SA 3CE8A 4F0KA 4NI2B 2OJ3A 4ZKAA 5HANA 4MKBA 5DGBA 4B3MJ 1VHFA 1S12A 2K1RB 5E41A 2OMLA 3K89A 4DCPB 2KHCA 3CT9A 3NNAA 1VYAA 2C2OB 2ZFHA 3I0RB 3ZC4A 2B0GA 2ZWPA 1VQNS 3KK3A 3FBCA 4WBFA 2HZCA 1X4AA 2ZHAA 1T3OA 2KRBA 4C0BA 3RU0A 3ENAA 1RT3B 2HMIB 1NDPA 1IBMF 2FVSA 3OTCA 3PKYA 3KHRA 2CJ9A 3MUVP 5M2RA 4F25A 5L38A 1A0OB 2VOPA 3PW5A 1F9EB 1FEHA 4DUTA 1IKXB 1RCOB 4U7UD 2F3JA 1V5IB 3C6TA 4DV3F 4Y2IA 5I3UA 4M63A 4K4SA 3ETMA 4CQ1A 2NXEA 5LT5A 1GMVA 4ILMA 1TL4A 2ZITA 2B9WA 5KT6A 4HVZA 2CWKA 2YX4A 3OFFA 3MOZA 3QNWB 4URGA 2ZBIA 4ENOA 1YX2A 2NZ4A 1S6UA 2IHR1 4UT4A 3VQTA 1BLUA 3K0JA 2VG6A 4DG1B 2ABYA 2QSWA 5F8IA 4L76A 4DR6J 4OMFG 3C16A 3GP9A 2CVEA 3TP2A 3K8WA 2J6TA 4OFZA 4HT5A 1W26A 1T9UA 3JSBA 1S9EB 2GHWA 3FQKA 2DHHA 5GAEI 3AOBA 3UWTA 1FJEB 1FX4A 3IRXA 4TYBA 4PRFA 2PFDA 1T03A 1RYSA 1F5BA 3IP0A 2EFPA 2KJWA 1FRMA 2I6WA 2JZ5A 4NXMF 2DBBA 3PFOA 2HGLA 1DTQA 2YH0A 3UCZP 5J2MB 4F4AA 5D15A 1TZ0A 3KDOA 4UOHA 2AX0A 4DQQA 4Y2KA 3QSYB 2QO3A 3MMCB 3O3LA 4LFCJ 4I2PA 4X66F 5M2UA 3IR7B 1FJCA 1CS4B 3VCDA 4OZLA 1Z2ZA 2V8HA 2V8VA 2LEPA 1SCJB 2CPHA 3LGMA 2UVRA 1X60A 4EU0A 4F4YA 3J81Y 3U02A 3CDAA 1M5PC 1M5VC 3EXCX 4E98A 3C15B 2W9AA 2RHSB 2QLFB 5DG7A 1TAUA 1YJUA 2FHJD 2HHHJ 3T1HJ 3NGSA 3LANA 2W9BA 5K20B 2H54B 4LVOP 1KC8T 2HFNA 2CDQA 3BO3A 1T05B 1OY9A 1HNVB 4OYIA 3RR7A 3P96A 2V5HG 1FFWB 2ZUGA 5HBMB 2IVYA 4Q2LA 1Q4RA 5B0GA 2K7JA 2OEKA 4XDCA 1RWUA 2VBWA 1J5OA 2N3OA 3IWNC 2PI5A 2QYCA 3E01B 1AFIA 4KHPF 2JRSA 1Y5IB 2DVIA 5J2NB 3THPA 1ZOTA 2ZE2B 2V9WA 4PG6A 4YDXA 2FHJA 3RAXA 4U6PA 4H4MA 3PHEA 4EZ9A 3T41A 2A18A 2LXIA 1BD6A 1Q1KA 2VQFJ 4WTOB 4CRJA 2EBEA 1YBTA 1I5OB 1H3DA 2VFVA 1BMQB 3CEDA 4CZCA 2N3LA 2W2MP 5H1SV 2CQPA 1YJ7A 3OFGA 2X1GA 5F9LA 2GAHC 2VH7A 3H0PA 3DC2A 4CLWA 2XMMA 2IC3A 3W7BA 1WD6A 1BQNA 3US5A 2R7SA 3H8YA 4M95A 1WKLA 3FZBA 4FYYB 1L3KA 3LH2S 2Q6CA 1WNEA 5F8NA 1FXDA 4J90A 2W24A 3BBBA 5CQGA 1Q5VA 5F41A 1U1LA 5JVGQ 4PWWA 1XJWB 4HL9A 3D5MA 2R7VA 5HAOA 2DHAA 3HO1A 2G1HA 1KVJA 4JI1J 4KB7A 4KQZA 3IGVA 2KTQA 4EGLA 2YNIA 2A0FB 1JLFB 3B6BA 2B5JA 3OTOJ 4R0EA 1Z4UA 1VQ9S 4S0MA 5A76A 3BEGB 3IWLA 1V3RA 4YMEA 1VBXA 1HNXJ 3CDEA 4GVBB 4C3LA 3S6EA 3Q8YA 4NWBA 1YSJA 1G6BA 4OZ0A 5KFDA 3DRYA 4DEZA 1P1LA 1FRIA 2R3VA 2MKHA 3T5HA 4DV1J 2CNOB 4JI3J 3BSNA 5EGYA 1WTBA 1OWXA 2KVQE 3R1HA 3MPVA 3P5TL 2UVUA 1KQSR 1YIJS 4LQ9A 3QQCD 4P7TA 3I4PA 4OHWA 4ELUA 1AA1B 3QLHA 5D0RA 4RBUA 3FSXA 3HD2A 1KEKA 1ZAXA 1VI7A 2XS7A 1WSVA 1C0TB 1UEVA 2G2ZA 3CB4A 1IKWA 2OIHA 5DQHA 5LSRA 2R8GA 4KSEB 1FNOA 1CC7A 2JFDA 1O51A 2APOA 1S1VA 4BLGA 3QT7A 3V6JA 3MR5A 1RT1B 1ZA1B 2XYGB 2YNHA 5AJ3J 3FFIA 2N4CA 3AT1B 3EGNA 4DV4F 2XZDB 1SJRA 1OYDA 3C14A 4RWXA 1NK7A 3M32A 3P49B 3C19A 3W9HA 3FBFA 4LIWA 4P75A 4ED6A 2FUG9 4OZ1A 3K5NA 3IXQA 1Q5YA 2GVDB 4YP3A 4DL7A 2MQNA 2RQ4A 4RL1A 4DR7F 1IBKJ 4I7FA 1OY6A 1B0VA 5SUHA 5CZVA 3KXDA 3B78A 4CH0S 5GAGU 3GU0A 5HK4A 2RMLA 3DLBA 4B9MA 4ID5B 2KB2A 2KG1A 1VLOA 1VGYA 4C4WA 2XULA 1CJUB 2KU7A 2WSEC 4LF9F 2J0XA 3HZGA 4K59A 1S79A 1X4EA 1B3TA 3H25A 5KFUA 1XWLA 5AT1B 4K4YA 3QFHA 2K8GA 3C66A 1T9WA 4FF4A 1TL1B 2F40A 3P5BP 1YRXA 3R6GB 1HBOA 1UWAA 2MY7A 3QJPA 1FE4A 1RKJA 1N4LA 3SDEA 4O3PA 1QAIA 4RUAA 1UKUA 4KJIA 1YWXA 1HQ2A 1M1GA 1U2CA 1X5OA 1RA6A 4DV0J 3EICA 1O8BA 1QVGR 2Z57B 4C11A 2V2QA 3I32A 4EBCA 1WF2A 2DPJA 1JLAA 3BBCA 1HBMB 2X3GA 2BA9A 3JTPA 4A47A 1EAYC 1N36F 1JB0C 3GR0A 1AT1B 2J9CA 5B0EA 2M8DB 3X3UA 4C48A 3TAQA 1VQLS 1WHXA 2F7VA 4IFYA 3NGTA 1K8AT 1BQMA 4G1QB 3Q8RB 2VPWB 1HNZF 3HHNB 3U1LA 3MM8B 1KHVA 3GZ7A 5CCMA 2BJ3A 4CT9A 3TAMA 3HVWA 4NA3A 1X7VA 5HLFA 3D3CJ 2RNEA 1XNRF 1LW0A 3I56S 2RU9A 1TMMA 5FLXU 2M9KA 4JUZA 1Y3KA 3RRHA 2UZAA 2GVZA 1FJGJ 1CULB 4DCJB 2WZ1A 3VAKA 1S0NA 1RTHB 5B7WA 2ZH9A 2IFXA 2ILYA 1GNKA 4UOGA 3CJSA 2ZH5A 2AV5A 4QQBA 4F26A 2XSJA 2DR9A 1KQFB 4F4XA 2KG0A 3G9CA 2GJIA 2ZH6A 3D6MB 1FHTA 3LA0A 2DNPA 2KXFA 2HW3A 5F8MA 4P2FA 3W8PA 2Q43A 3LP2A 2CQGA 5KFLA 4ED1A 5HMYA 1RQ0A 1QSSA 3W5ZA 2IM3A 4G1IA 3I0SA 1NDKA 4LF6J 4CO2A 3DKDA 1S6PB 1MNEA 1HW9A 3H59A 3A8EA 1HQEB 5E3RA 4KIAA 4DU8A 5HSPA 4X62J 1D09B 3JSMA 2NXJA 2HHUA 1U1RA 2BVZA 2WCXA 3IWXA 5IM0B 4NLYA 4G1PA 2I0XA 4HEA9 2CQBA 3LPYA 4LRAA 3HHLC 4UOCA 2OPQA 2BBEA 4NYPA 2X1BA 2L9WA 4YY3F 2A10A 2ZKUA 5C42B 2KHDA 4ECXA 1XMOF 4D3GA 3GIIA 1FKOA 1TUVA 2JH3A 4LBHA 3QRRA 2BKPA 4KH0B 2E7VA 4J7CA 2FJXA 7FD1A 4ICLA 1HNWJ 1XMBA 2YKOA 5CXTA 1LOUA 2FVRA 3R5AA 1U48A 4ECSA 2OLWA 4AL6A 4A46A 5LL6d 2PE8A 3SCIE 1L3SA 1RWKB 1H98A 1TKTB 4QIFA 3OXFA 3UDEA 1GH8A 5KFFA 4IG3A 4EO8A 2OSQA 3N6NA 5KG7A 1CJKA 4F2RA 2B8QA 1NB2A 1EHWA 2GIQA 2DNYA 4FZVA 4ZS6A 4KKOA 2FB0A 1PAEX 3KLIB 2YPZA 1RHUB 2E7XA 4CLKA 2HNZB 4ATNA 3SV3A 4ZHRB 2VFRA 3M30A 1YRTA 4OX9J 4A8XA 2RQKA 1WUUA 4KTQA 4OI6A 1BQXA 4L72B 3MOJB 4HTJA 3PRDA 2K2PA 1T94A 1U24A 1HFEL 1JLQB 3UO0A 3GIRA 4A48A 3NWRA 4HYKA 3M6WA 1R8CA 1NRKA 1FXRA 5HQLA 3DYAB 1QUVA 1X5PA 2E1AA 1QTNB 4PWDA 2I9SA 4ZP9A 3BYRA 3MMBB 3GWCA 2D3OR 1RKIA 1HR0J 1FK9B 4F3QA 2MKIA 2I5JA 1IBCB 5B0FA 4NYOA 2YWFA 4GMKA 3OD2A 2EG1A 1VK8A 1W7WA 1H6KX 1FFGB 2R2TA 5AE2A 2DHGA 3DLKA 4RW6B 4N47A 3DLEB 3BSOA 2C3PA 2WRMA 1RA7A 2CDRB 1UFWA 3EGZA 1FXLA 1U4BA 1P1TA 1R43A 1LWXA 2Q1LA 3SV4A 4NLSA 1L3VA 2J7KA 2UUAJ 5HMXA 5D3GA 3DLJA 2VHGA 3GONA 2KFYA 5CYMB 2GMJA 4I1TA 2OPRB 3IS9A 3GQCA 1YJRA 5KFTA 3U1NA 2BJ8A 4WFXA 1LXJA 2HQIA 1UP1A 4CTAA 4KH1B 4DV5F 2MB0B 3R5CA 4IQXA 4J9MA 2J8SA 3UFCX 1HKAA 3N0VA 4MK9A 1WI6A 1PILA 1H7WA 3R7SB 1SH3A 3BQ2A 3O5TB 2F4VJ 4M5LA 4DS4A 3FMBA 3QSIA 4PWUA 4Q43A 2RKIB 4B08A 1ITPA 5KFAA 2ERRA 3SFUA 2ADCA 1NKEA 3MFIA 2ZC3A 1JLCA 4B3TF 4WJBA 2KT2A 4QWBA 1SL2A 1M5KC 3GJQB 2V4JB 4LF8F 2BYCA 2VF3A 3MMAB 3G96A 3KLEA 3UNYA 1X4GA 4OYAA 3NLCA 3ELHA 2D74B 5LOQA 1LWEB 2KM8B 4LF5F 3ZZTA 2HVZA 2A6OA 3M8YA 4NXNJ 2DITA 4TY9A 4DFKA 3KTQA 4NLXA 1RHMB 2IA6A 1TL7A 5JUMA 4FKYA 4LFAJ 4C7QA 2K3IA 3D6HB 7AT1B 5D0HA 1CBKA 3L7OA 3UW1A 2YKNA 3N4WA 1VC0A 2AP6A 2D3UA 3MPYA 3NNHA 4RNHA 2VICA 2LFVA 3EPIA 4RU9A 5IS2A 2A3JA 3NGUA 1HI1A 3AHPA 3K5PA 1FRXA 3W8GA 4DF4A 4KPCA 3IGNA 4RW4B 3IBFB 2HWTA 4DJBA 3DHXA 1E6YB 2QFIA 4X64F 1VLYA 4QYZK 3H98A 4U8YA 3DLGA 3DOMB 4DBQA 2BW7A 1ZM9A 2D7SA 1IBLF 4LBIA 1FDAA 3GSDA 4H4OB 3GILA 2V68A 5CYJA 2DH7A 4DV3J 2CJXB 3I96A 2DXFA 3OL9A 4URQU 3FMWA 1KQGB 3HJVA 4JYAJ 1LNQA 2R8KA 4ECUA 4B17A 3D54A 4KC5A 4ANCA 1U47A 3V6DB 3EWGA 3NS7B 4Y34A 2XS5A 1FWLA 5A8KA 2F8EX 1ZM2A 4AFFA 1T9VA 4DS5A 2AJ0A 4BWJA 3FDSA 4F0MA 3ZNUA 2UV8A 4H4KA 3DM2B 1X4DA 3KJFB 4E8UA 1B0PA 3LOUA 3VGVA 4OJ1A 1N34J 1AYEA 3BGOP 3ISZA 4NLOA 2IBKA 3N9UC 4ITSA 4O4GB 3H5SA 3W3SA 3MECB 2FZKB 2HLUA 4KGKA 3ZFVA 5IV3A 3ULHA 5CCLA 4WK3A 3ZO7A 4YHHF 3RTVA 2FHKA 1K47A 2MMYA 5LJ3Y 3SCJE 4OIXA 1TVRA 4USKA 5MLCV 3WBZA 2BQRA 4YR2A 2ZC4A 3PZPA 2YPYA 3QO9B 3LUYA 5AXMA 4KPYA 1NM2A 1WORA 2XI3A 2JLEA 4PYDA 1X5TA 2RDDA 2IYGA 3DOLA 2UUCF 4A8OA 5ADZA 1FTCA 3PHTA 2HHSA 3MD3A 4IO1A 2Y8WA 4Q44A 1QE1A 1L5UA 3PNIA 3LP1A 3Q0AA 3G8SA 1KD1T 1ZM4A 2G0CA 4ECRA 3J7ZT 4ZLLA 3EGWB 3R2DJ 4NL5A 3K8VA 3D9BA 2VPZB 3CJ2A 4B3OB 1RWXB 5AE1A 4DQRA 2LEAA 4N5SA 4NLUA 3R27A 1YVFA 1HWIA 2YQ1A 2FJVA 1XR5A 4FBUA 3MHYA 2QYGA 5GMEA 4WTYA 3BO4A 3M9OB 1JLBA 3MM9B 4C8KA 2QTWA 1NAQA 3KLFB 3CTRA 4DPXA 3M8PA 2ZVSA 2CNLB 3UD5A 3MM7A 5ITHA 2OD4A 5K9FA 2YNGA 1MLAA 2VKZG 2HQ3A 2ADBA 3G6YA 3GFHA 1SVDA 1I51B 2MGZB 2JC0A 4KHPJ 2CQDA 3BKTA 4N8OA 2AJ2A 2EWHA 2KZMA 3WIVA 1RT4A 5H9FK 3G87A 4U7CA 1U1PA 1FRKA 1K1QA 4BHQA 9RUBA 3OTBA 4ZP8A 2GHVC 2DNQA 2IIHA 3ICLA 1WELA 2PMWA 2UUBF 2BM0A 3NP5A 1KR4A 3E3XA 3V4MA 1KVIA 1LWFA 5BYQA 4PQUB 2QC3A 1DLOA 2XHCA 2DRBA 4ZA1A 1U2FA 2V94A 3I9ZA 1SKRA 1IM4A 4B3MF 3R97A 4CM2A 1BC6A 3DRPA 4Z37A 1V5VA 2Y8YA 1T0TV 4YB6A 1RWVB 3CCUS 3GYGA 4BBYA 3C6UB 1U0SA 4DV7F
chains in the Genus database with same CATH topology
1I51B 5K20B 2H48B 2H54B 2P2CB 3KJQB 3KJNB 2XZTB 1RHMB 1RWPB 2QLBB 3NS7B 4ZVTB 2H4WB 1RHJB 2CNKB 4DCJB 1SC3B 4ZVRB 1RHKB 2C2KB 1NMEB 1F9EB 2CNOB 4DCOB 2QL9B 3D6HB 3P4UB 3SIPB 3D6FB 1PYOB 2HBYB 4ZVUB 3GJRB 3R7SB 3KJFB 3EDQB 4ZVPB 2QL5B 1RWMB 2C2ZB 1RHRB 3D6MB 3RJMB 2Y0BB 1QTNB 1RWWB 1RWXB 2QL7B 3GJTB 4ZVOB 3EDRB 2H5JB 1I3OB 4ZVSB 1IBCB 4ZVQB 1RE1B 2C2MB 5IC6B 1SC4B 2HBZB 3QNWB 3R6LB 1RWOB 2CNNB 3IBFB 1RWKB 2QLJB 2H65B 1PAUB 3IBCB 3R5JB 3R7BB 4LSZB 2H5IB 3GJQB 2CJYB 2DKOB 3GJSB 4DCPB 1BMQB 1GFWB 2XYPB 2C2OB 2XYHB 1RWNB 2CDRB 2HBRB 1SC1B 2XYGB 4JB8B 2Y1LB 5IC4B 2HBQB 1RWVB 2CNLB 2C1EB 3P45B 1QDUB 2XZDB 1ICEB 2FQQB 2QLFB 1RHUB 2CJXB 2H4YB 3R6GB 1RHQB 3R7NB 2H51B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I51 B;  5K20 B;  2H48 B;  2H54 B;  2P2C B;  3KJQ B;  3KJN B;  2XZT B;  1RHM B;  1RWP B;  2QLB B;  3NS7 B;  4ZVT B;  2H4W B;  1RHJ B;  2CNK B;  4DCJ B;  1SC3 B;  4ZVR B;  1RHK B;  2C2K B;  1NME B;  1F9E B;  2CNO B;  4DCO B;  2QL9 B;  3D6H B;  3P4U B;  3SIP B;  3D6F B;  1PYO B;  2HBY B;  4ZVU B;  3GJR B;  3R7S B;  3KJF B;  3EDQ B;  4ZVP B;  2QL5 B;  1RWM B;  2C2Z B;  1RHR B;  3D6M B;  3RJM B;  2Y0B B;  1QTN B;  1RWW B;  1RWX B;  2QL7 B;  3GJT B;  4ZVO B;  3EDR B;  2H5J B;  1I3O B;  4ZVS B;  1IBC B;  4ZVQ B;  1RE1 B;  2C2M B;  5IC6 B;  1SC4 B;  2HBZ B;  3QNW B;  3R6L B;  1RWO B;  2CNN B;  3IBF B;  1RWK B;  2QLJ B;  2H65 B;  1PAU B;  3IBC B;  3R5J B;  3R7B B;  4LSZ B;  2H5I B;  3GJQ B;  2CJY B;  2DKO B;  3GJS B;  4DCP B;  1BMQ B;  1GFW B;  2XYP B;  2C2O B;  2XYH B;  1RWN B;  2CDR B;  2HBR B;  1SC1 B;  2XYG B;  4JB8 B;  2Y1L B;  5IC4 B;  2HBQ B;  1RWV B;  2CNL B;  2C1E B;  3P45 B;  1QDU B;  2XZD B;  1ICE B;  2FQQ B;  2QLF B;  1RHU B;  2CJX B;  2H4Y B;  3R6G B;  1RHQ B;  3R7N B;  2H51 B; 
#chains in the Genus database with same CATH topology
 1SQG A;  5T14 A;  3KK1 B;  5DS7 A;  3K17 A;  3P3D A;  3CMA S;  2AEM A;  2AKW B;  2HFS A;  2AW0 A;  1H7X A;  3ZZU A;  4DR1 J;  3DGP B;  3NGR A;  2OO4 A;  3ENV A;  2NYH A;  2PN6 A;  2HBY B;  2V34 A;  3MR7 A;  3IM9 A;  1FES A;  3M4X A;  2P8I A;  1ZZN A;  4L74 A;  5LJ5 Y;  4CI0 B;  2HVH A;  1SV5 A;  2CPX A;  3KHL A;  3POT A;  1IKY B;  1N0V C;  1AUS L;  1CPZ A;  4ZLJ A;  3ITH A;  3MMJ A;  1C1B A;  1NKC A;  3B54 A;  1T8E A;  1S6Q B;  3FVY A;  4OJG A;  5IV4 A;  2XNQ A;  3ILI A;  1DTT A;  3R8Y A;  4TU8 A;  5DGA A;  3WIU A;  1JMT A;  3JQJ A;  2HNY B;  5ETM A;  4BCA A;  2NQP A;  2JVR A;  3VWS A;  1R8B A;  2BOP A;  4WP9 A;  3SSQ A;  2ZH3 A;  5CD4 H;  3U1M A;  2FQQ B;  1HLW A;  2NRE A;  4JI6 J;  5BR8 F;  3Q2S C;  3FQL A;  3LGN A;  1Q8I A;  3PY8 A;  1GMU A;  3NWG A;  5D78 A;  1PIE A;  3HSZ A;  4ZPD A;  1RBL A;  4W92 B;  4NEZ A;  1Q7L B;  2UVW A;  3HD1 A;  1NK4 A;  4O3R A;  4WF9 Q;  1P8G A;  2MZR A;  3HDS A;  3X1L B;  4URS A;  1N5V A;  4TQR A;  4IDK B;  1CVJ A;  4UY8 T;  3FNN A;  3MPU B;  2Y0B B;  2G4B A;  3CJ4 A;  3BF4 A;  4LRB A;  3H4D A;  2VOO A;  2PSZ A;  4F02 A;  2VBZ A;  2XB2 D;  1K0T A;  2ZBQ A;  2HRU A;  2Z2Y B;  4Z7Y A;  4NCG B;  1S9G A;  4OYP A;  5I42 A;  2JLG A;  2EEY A;  1EJ7 L;  4DLE A;  2LQ8 A;  1SL1 A;  4QU7 A;  3OUY B;  2CQ2 A;  4LFC F;  2HNZ A;  1URN A;  1FER A;  5A8R B;  2CVI A;  4O3O A;  1T9X A;  1Y10 A;  1NPK A;  3MUM P;  1VJQ A;  3NBP A;  4O0I A;  1GK8 A;  1RAI B;  1IWG A;  2LQB A;  2QA1 A;  1G3O A;  3NRB A;  2VFU A;  2YWH A;  2ROP A;  3NOC A;  4DR7 J;  2OEL A;  1NO8 A;  1HWK A;  3FBB A;  3VQS A;  1UVJ A;  1A9N B;  1NK6 A;  1EP4 A;  2BQU A;  2VAS A;  3FKB A;  1JWW A;  3HUL A;  3D4J A;  3VAI A;  3M2V A;  5D77 A;  2CQI A;  2FYX A;  4O44 B;  1NLK L;  3HSD A;  4LF1 A;  4LBP A;  4RBT A;  4IOA Q;  1AZS B;  5J1E B;  1P27 B;  1O0P A;  4LF9 J;  3PW0 A;  1XER A;  4TLQ A;  3CPW R;  3A8I A;  2OTJ S;  5IOL A;  1TKZ B;  4ZVP B;  1G1X A;  3D66 A;  4PPZ A;  2BAN A;  2VV5 A;  4CH7 A;  5FLX Y;  4NYZ A;  4Q0B A;  4DL0 C;  4IH7 A;  2EW9 A;  3OLA A;  5IC6 B;  1OIA A;  2HBZ B;  1HBU B;  2HUR A;  4M5G A;  1F3V A;  3MR3 A;  1CEZ A;  3L95 X;  3EZ5 A;  3I5C A;  4IO9 Q;  1C4C A;  2EKY A;  1SPB P;  1S6O A;  2CUY A;  3M2U A;  1FRL A;  2GX8 A;  3CC4 S;  4OZ5 A;  3RG6 A;  1G2E A;  2EFV A;  1ZTT A;  3W9I A;  4F2S A;  2F4F A;  3CCQ S;  1JJ2 R;  3LO3 A;  3M1V A;  2DGT A;  3EZO A;  4J9S A;  3W2W A;  4LIR A;  2O5D A;  5I3Q A;  5LSO A;  3CJK B;  2K3K A;  1RT5 B;  4DU7 A;  5A6P A;  4PQA A;  2WHO A;  4C9D A;  2I2Y A;  1SUQ A;  4LR8 A;  4TU9 A;  3WDO A;  1C0U B;  9ATC B;  3BN4 A;  1H2T Z;  3ZXW A;  2RRA A;  3RB0 A;  4OZ3 A;  2RD5 C;  4ZVU B;  2R7T A;  4DWI A;  4K4Z A;  4QWD A;  3CJ8 A;  2Z30 B;  2AGP A;  2BKN A;  1DZ5 A;  3ETO A;  2FHO B;  3HT3 A;  2UUT A;  5DDQ C;  5JMN A;  2W9C A;  1DY3 A;  2XTJ P;  4PUO A;  2Q3P A;  2HPU A;  3HFV A;  4ZPV R;  3MGJ A;  1XNR J;  4JI1 F;  3HFK A;  3UR0 A;  3GIM A;  2BE2 A;  2XO6 A;  4ZPT R;  5E3P A;  2V50 A;  4USJ C;  4ZIW A;  5ETS A;  1HI8 A;  4EUV A;  3OTO F;  1Q81 T;  1S4F A;  4YR0 A;  5KG5 A;  3AQP A;  1BWE A;  1YZ6 A;  1U0H B;  3TVZ A;  1ZH5 A;  1F60 B;  4LVN P;  3H2L A;  3QGH A;  1RAD B;  4ED3 A;  1FD8 A;  2VG5 B;  3BYP A;  3MM5 B;  3HI9 A;  2IY5 B;  2NPI A;  2UV8 G;  1YHQ S;  4PXD A;  1M5S A;  3PCO B;  2VL1 A;  4B9U A;  4ZCI A;  4DCO B;  2AJ4 A;  3A8K A;  1U45 A;  2Q79 A;  3PW7 A;  4I4B A;  1U49 A;  4DQI A;  2G9O A;  4DV1 F;  1Q0N A;  2UXD J;  2ZH7 A;  3JYT B;  3GIK A;  1HA1 A;  2KVI A;  4YEA A;  5KFG A;  1MMD A;  2UU9 F;  4NLD A;  2XY5 A;  3RR8 A;  4R5P B;  3K59 A;  3EMT A;  2BXJ A;  1D8Y A;  2P5V A;  4YB7 A;  4LR7 A;  2WOM B;  4JV0 A;  2DKO B;  3QGI A;  4USM A;  4P2X A;  1KP6 A;  3FCH A;  3MED A;  1C2P A;  5K5M A;  1NH8 A;  1RAC B;  3W63 A;  2HHP A;  4A8M P;  5ETV A;  4M5N A;  3OR2 B;  1IQT A;  3V4I A;  1WC4 A;  2KO1 A;  2DNN A;  6AT1 B;  5AJ3 F;  3DOK B;  3AJ2 A;  2VKR A;  4ECZ A;  3CCS S;  2VQE F;  5LM7 E;  2H4W B;  2R7W A;  2PFF B;  1WI8 A;  1GX5 A;  5FII A;  1QD1 A;  1LXN A;  4Q2M A;  1OSC A;  4QR2 A;  3E51 A;  2QIF A;  2W2P P;  4DI6 A;  4R8U B;  1WOO A;  3AOA A;  4UOF A;  1T11 A;  1YQH A;  2AX1 A;  4OHY A;  1U1M A;  1UEU A;  2IDL A;  2IVM A;  3KHG A;  5K8N A;  1RT7 B;  1RZM A;  1IBK F;  4DF8 A;  4WU3 A;  1RTD B;  4AQY F;  2AYB A;  1X31 C;  3PEJ A;  3HVA A;  1SJF A;  5HQ8 A;  2GC8 A;  3CCV S;  1S1X B;  4EYI B;  5L39 A;  1N88 A;  3ENQ A;  3AFG A;  3MPW A;  1S9F A;  4U9R A;  4WE1 B;  3VV2 B;  5L9N A;  4HAC B;  1DJ0 A;  4OI0 A;  3GV5 B;  5DO2 A;  3LQV A;  1G4C A;  2PD1 A;  2B6A B;  2YX1 A;  3UDV A;  4WXW A;  1ARO P;  1HHS A;  1EKR A;  3HMJ G;  4J9U E;  1VQO S;  4RZR A;  2WVE A;  4HTI A;  3M8Q B;  3W62 A;  2KXN B;  4WZQ A;  3SSS A;  5KFI A;  2D41 A;  5F9N A;  4HH0 A;  2GNK A;  3FEY B;  1H0H B;  2MDA A;  4FYV B;  2V4Q A;  3ZNJ 1;  1RYR A;  3AXM A;  5KFY A;  2ZOM A;  2OP5 A;  4IR1 A;  4C97 A;  4ED5 A;  2VFS A;  4OV6 A;  3LP0 A;  5KFX A;  5CYQ A;  3AA8 A;  2FVQ A;  1WDT A;  4HHU A;  5KG3 A;  3HSG A;  1S1T B;  4DPT A;  1D1U A;  1K1S A;  1EET A;  4LF7 J;  3Q8U A;  2V6A A;  1HNI A;  3WC0 A;  2OHD A;  2JVO A;  2M2B A;  2UUW A;  3EXY A;  3CCJ S;  2XBP A;  3KOA A;  4FVM A;  1B7F A;  1HBN B;  5HAT A;  2CNN B;  1UVL A;  2HAF A;  3M8Z A;  2K06 A;  3R7B B;  4ECW A;  2CPD A;  3OV7 A;  2LU2 A;  1HWL A;  2BJ9 A;  4USH A;  4IRC A;  3A1Y G;  2QSF A;  3ONQ A;  1CG2 A;  2HWH A;  1NHU A;  2WW4 A;  2AGQ A;  3K5L A;  1KNZ A;  5A8W A;  2FVP A;  3Q8V A;  2BR0 A;  5J2Q A;  3LAM A;  5E2Q A;  1RAG B;  2DNH A;  3BGU A;  2QRR A;  2RF2 A;  1LWC A;  3BSA A;  3AAW B;  3TO8 A;  3AB4 B;  4NZ6 A;  5L46 A;  4NRU A;  1OQ6 A;  2B7B B;  1JKH A;  4B3T J;  1OSD A;  4Y0F A;  4LF8 J;  2L41 A;  2W4P A;  3DU6 A;  4RW8 B;  5DQG A;  3MM6 B;  1RB0 A;  2OPP A;  4LT6 A;  1D9D A;  1Q8B A;  1ELO A;  4CLS A;  2V67 A;  2DY9 A;  3GE9 A;  2CWX A;  1IM6 A;  1SJ1 A;  2ZZT A;  3A4T A;  3U27 A;  4DPO A;  1D9A A;  2DXE A;  1DFD A;  4CNZ A;  5HMZ A;  4LF6 F;  1HD1 A;  2AEJ A;  2EXU A;  4DFJ A;  2Z56 B;  4FNI A;  3PV8 A;  2QMW A;  3M8R A;  1U25 A;  2E5L F;  2WON B;  3DRX A;  2C3U A;  2E5H A;  2R7X A;  1S57 A;  4ANE A;  5C25 B;  4CYU B;  1UVM A;  1NME B;  2EFO A;  4Q8E A;  5EDW A;  5FD1 A;  2WTF A;  3TYT A;  3CF5 Q;  4X64 J;  4MFB B;  1HYS B;  2AHO B;  1TKX A;  5GAG I;  3EVO A;  3MEG A;  4LSN B;  1IBL J;  4K8R A;  4OZ2 A;  4ZVO B;  5BJR A;  1HNW F;  3QIP A;  2W7O A;  2GGP B;  2CJK A;  5T7L A;  3HX9 A;  1FFS B;  4XO0 A;  4USW A;  2IBO A;  1Y3J A;  2G1D A;  3JSR A;  3HKZ D;  2ZH8 A;  1Q95 G;  3QZ7 A;  3AY0 A;  3OT9 A;  4NLQ A;  4MIB A;  1NZA A;  2VBX A;  3IC1 A;  4EYH B;  3UVJ B;  4F50 A;  4HI2 A;  2VIH A;  1T7P A;  1TL3 B;  3S01 A;  3D2W A;  3VR1 A;  2IVF B;  5U47 A;  2MPU A;  1MU2 A;  1C1C A;  1N32 J;  2F9D A;  1QSL A;  2WSC C;  1RHK B;  4QW9 A;  2PMZ D;  3WZ0 A;  1RT6 A;  3V6H A;  2W01 A;  2VBY A;  5A2Q U;  4NML A;  1RBO B;  3Q83 A;  3EDQ B;  4IH5 A;  3OFE A;  5H9E J;  3KMQ A;  2XZW A;  2XEX A;  2BE7 D;  2RQM A;  4QZV B;  5EX0 A;  4KT0 C;  1I3O B;  3BGF A;  4ZVQ B;  1S7I A;  4L75 A;  4KGM A;  1HR0 F;  1IR1 A;  4CO5 A;  4LSL A;  3A3P B;  1TMJ A;  3Q8Q B;  4LUB A;  3VGU A;  3D0I E;  3Q8S B;  1TV6 B;  4NLT A;  1HPZ A;  3KG0 A;  3HKW A;  4O44 A;  2Y3Y A;  4H4K C;  4IFV B;  1REV B;  3T6B A;  3KUG A;  3GR1 A;  2HND B;  2E1P A;  2JDJ A;  5IT4 A;  5HJY A;  2FHM A;  3DHW C;  3O6Q A;  3BZQ A;  2FPH X;  2UUA F;  2L9D A;  5A0Y B;  5C24 B;  3CUN A;  1JJ4 A;  1XC9 A;  3KNA A;  3Q24 A;  2DRA A;  3HZE A;  4RWW A;  1OYE A;  4MIA A;  3I82 A;  2LA6 A;  1CC8 A;  4P6Q A;  2B43 A;  1VRU B;  2ZH2 A;  5J2P A;  2CQH A;  4NPO A;  1RLC L;  3QRQ A;  2YKM A;  4ZN3 A;  4M5D A;  4JI7 J;  8ATC B;  1VBK A;  3CME S;  3O1L A;  3UE2 A;  2V2V A;  2ATC B;  4F4K A;  3OHB A;  6FD1 A;  3NCQ A;  3IR5 B;  3HPO A;  1KTV A;  1FO1 A;  5DLG A;  1ZAW A;  3A13 A;  2WBM A;  4OYO A;  3EUN A;  2FLL A;  1XBW A;  3SQG B;  3M2R A;  2EKN A;  4E2F B;  3FRY A;  1N56 A;  2C3M A;  2XMK A;  1LW2 B;  4I2Q B;  3M9N B;  4ZVH A;  1JXL A;  1S99 A;  3M8W A;  1EZZ B;  2EK1 A;  3KDN A;  5E7O B;  2R2U A;  2DXD A;  2ZDP A;  1K9M T;  4NXN F;  1M1H A;  1NSA A;  3OR1 B;  2OTL S;  2YQ0 A;  1YKW A;  2YNF A;  3OSN A;  2WVB A;  4IG0 A;  3PJ9 A;  2NPF A;  1I1G A;  4LFA F;  1Q8K A;  3DI6 A;  1LEO A;  3H5X A;  2CG4 A;  4JI8 J;  1Y11 A;  1F2G A;  2RDJ A;  3ZZR A;  3CCZ A;  1YJT A;  1W25 A;  2MQM A;  2F1F A;  4GVL A;  2N7C A;  3MAA A;  4DV7 J;  2HHV A;  2XNR A;  3PTW A;  1A6L A;  1N5Q A;  2AD9 A;  4YQW A;  1OS5 A;  4JI0 F;  2MQQ A;  4FS2 A;  1GFW B;  3V5R A;  4CO4 A;  4RR5 A;  4RW9 A;  2YWE A;  1YJW S;  4C3K A;  2MJU A;  4BS2 A;  4OZJ A;  2HK2 A;  5KFB A;  4KFB B;  2QT7 A;  2IYI A;  2HFU A;  2LVW A;  1NHV A;  3M8S A;  2B7C B;  4RX6 A;  1FKP B;  1X0F A;  2Z2L A;  3BKF A;  2ASY A;  2DTJ A;  4DR4 J;  4CLL A;  4JYA F;  1PYS B;  5HVF A;  3DDK A;  2R9L A;  4RO0 A;  2NUH A;  4YN3 B;  1WG1 A;  3G6V A;  3DCA A;  4DSE A;  2WAQ D;  2RAQ A;  2C2Z B;  1QVF R;  3WQP A;  4K50 A;  3L4B C;  3OL6 A;  4F3M A;  1OQ3 A;  5EHH A;  1NZ8 A;  2MLX A;  3MEE A;  1N34 F;  1TL5 A;  3TR5 A;  5DDP C;  4X4V A;  3TUJ C;  1J5E F;  5BR8 J;  3ZZY A;  1FWK A;  3DU5 A;  1R6V A;  4EBE A;  3J80 U;  2CPY A;  5HP1 B;  4KYZ A;  5K14 B;  5F8L A;  2D9P A;  4QPX A;  3BGR A;  4JI4 J;  1BUX A;  2IPO B;  3TRG A;  4UF4 A;  3PVX A;  3T6J A;  3G82 A;  4TLR A;  1L3U A;  2G0I A;  5SZT A;  2IRU A;  2BUN A;  2HG4 A;  4FXW A;  2ZD1 A;  3FC9 A;  1KHW A;  2YXL A;  2RSQ A;  5FDL B;  3H40 A;  2PI4 A;  1V3Z A;  2XI2 A;  5IT9 Y;  2C22 A;  4WYW A;  5HO4 A;  4RNF A;  3TX8 A;  3L3C A;  2M0G B;  1R0A B;  2FY1 A;  2CRL A;  4HR2 A;  3KK2 A;  2KZZ A;  4P2M A;  1E6V B;  1UW4 A;  3QRP A;  3UDL A;  1YI2 S;  1DQA A;  3EVM A;  2R7O A;  3D0H E;  3MI7 X;  4J5O A;  1EQ0 A;  1JQG A;  3H20 A;  4GC6 A;  1R0C B;  3KLG A;  5HRO A;  4UW2 A;  4CM0 A;  2UXC J;  3TNV A;  2Y9H A;  2FC9 A;  4ES2 A;  2BAB A;  1GEH A;  2KT3 A;  1PJ6 A;  4TY8 A;  1PJ5 A;  3J81 U;  3SSR A;  1S0O A;  1S1U B;  4WII A;  2BMB A;  2D3Z A;  2LDI A;  1N5Y A;  1SKU B;  2NSC A;  4RW7 A;  3CD0 A;  5G0R A;  3ET6 B;  5E0O A;  3SFG A;  1NDC A;  4DR2 J;  3D6T B;  3KLH A;  3DLH A;  2RT3 A;  2CG8 A;  3J7Y I;  4I68 A;  4K4W A;  3M05 A;  1VQ8 S;  1TTH B;  3CWJ A;  2F8H A;  2C3Y A;  2WK4 A;  4DL2 A;  1GAO A;  4D3H A;  5IXU A;  2KDO A;  2MZT A;  4JV1 A;  1N48 A;  4YS2 A;  3CIM A;  1ZA2 B;  1VQM S;  1TU0 B;  3KK3 B;  4NLW A;  2BJ7 A;  3DRR A;  1SJQ A;  2GFF A;  4I6W A;  2JEF A;  2LYV A;  3RB4 A;  3TZW A;  4ZOS A;  2DYA A;  4PXB A;  4FPI A;  3GPA A;  2BJD A;  1VBY A;  3ZTS A;  3TA1 A;  1EQM A;  2CPZ A;  4A8F A;  2IAJ A;  1Q82 T;  2VG7 A;  5IQQ A;  2VJV A;  5KT7 A;  3IRW P;  1RTJ A;  1KON A;  3GFX A;  3C6T B;  3AQO A;  4B9T A;  5I3U B;  1FNX H;  5D4N A;  3GFZ A;  1ZBT A;  1PBA A;  1R3N A;  2BRL A;  2J8A A;  1KWM A;  1BWV A;  3EYZ A;  4U95 A;  3MUT P;  3JAM U;  3SQO P;  3SI8 A;  3MCM A;  3UPF A;  3HF5 A;  2Z4P A;  4K0K J;  2DNG A;  2HFZ A;  2VG6 B;  2QEX S;  4AUK A;  4CH1 A;  4DR1 F;  1U02 A;  4J9K A;  1T9T A;  3W2V A;  3QWU A;  3LF0 A;  3C16 B;  4B9N A;  2ZVI A;  4AD6 A;  2CJB A;  2HS3 A;  3MAQ A;  2J0W A;  2XGQ A;  2Z0G A;  1RT2 A;  2RH3 A;  2MKS A;  2H5J B;  3PYD A;  1WF1 A;  4CLZ A;  4IR9 A;  2MZJ A;  1SC4 B;  3CCE S;  3UDC A;  1RWO B;  3DMJ A;  3IRX B;  3JQM A;  2LU1 A;  1T03 B;  3HVT A;  3D67 A;  2KI2 A;  3OXG A;  3ZZ0 A;  3BBF A;  3PO5 A;  5RUB A;  2W2O P;  4MIW A;  3BDE A;  2ASJ A;  2E1M C;  5BXI A;  1DTQ B;  3MF5 A;  1MG7 A;  2M3D A;  4UTG A;  1HI0 P;  4GO5 X;  4PZV A;  4YFU A;  1QAX A;  5DET A;  4F0H A;  1UFK A;  3ZTR A;  3O2I A;  4ECQ A;  5JXS A;  2BV3 A;  2FDN A;  3MZI A;  1O5J A;  1CJV A;  2OFH X;  4JI6 F;  2V8P A;  4I2P B;  2UU9 J;  3PX6 A;  3FGV A;  4K7Q A;  1RAO A;  1JXV A;  1FCA A;  3PIO Q;  5LXR A;  2MHE A;  1QM9 A;  1LQ9 A;  2YWG A;  4LQ3 A;  1FA0 A;  1JLG A;  1S0V A;  1DAX A;  4ELT A;  2BZ2 A;  3WX4 A;  3IG1 A;  1D3W A;  1HMV B;  2EBG A;  5F8H A;  2ZZN A;  1XMQ F;  2DO4 A;  2W7A A;  1Q53 A;  2CPJ A;  2W9B B;  2ZH4 A;  4AL5 A;  2RRB A;  3VAM A;  4KO0 A;  4EO6 A;  2VQE J;  1XK8 A;  3I4H X;  3NMA A;  4C8M A;  2G2O A;  1IWA A;  1U2R A;  3CJR A;  4KV8 A;  4MTP A;  4EEY A;  4WIQ A;  1J5O B;  2D9O A;  4NZ0 A;  3NCP A;  3QZ8 A;  2W2Q P;  1RGV A;  4X4Q A;  4NLP A;  4AQY J;  3HHL D;  3JS9 A;  1SBR A;  3GCX P;  4H4M B;  1RTI A;  1Y00 A;  1J2V A;  4DX8 H;  4CO0 A;  1MRO A;  2Y1I A;  3BKU A;  1UWB A;  3V81 A;  3M6V A;  3KJV A;  2P6T A;  3DRS A;  4GRS A;  2WW8 A;  3TZZ A;  3OJU A;  1VRT A;  2IC3 B;  4LFB F;  2VZ9 A;  4PYA A;  1BQN B;  2BOA A;  2B4P A;  1U7L A;  1YZ7 A;  1WKJ A;  3GG1 A;  3LTO A;  4DSI A;  3OVS A;  3HHL A;  2DB1 A;  5F0U A;  5KFW A;  2KJV A;  3T9N A;  3GJS B;  4QR1 A;  2NZC A;  1NH7 A;  4DL5 A;  1M1K T;  4NRT A;  3GCW P;  2OEJ A;  5I3P A;  3I9V 9;  1HHQ A;  4A8S A;  4ETZ A;  2DT9 A;  2LQ5 A;  1VQ4 S;  4ALZ A;  2VA2 A;  3DLL Q;  4X4S A;  4HDH A;  1IKV A;  1VIO A;  2LLZ A;  3M7V A;  4MK7 A;  4ED7 A;  2IDE A;  2PEH A;  4MH8 A;  3FCV A;  1HQU A;  2OPS A;  2YNI B;  2GMH A;  2B9Y A;  1S1W A;  2B5J B;  3JTO A;  4OX6 A;  2DIV A;  1CJT A;  2WB1 D;  3JTN A;  5CAA A;  1X9S A;  1KLM A;  3HXM A;  4OQJ A;  4IUF A;  4M5J A;  1NKB A;  4FXD A;  1NDL A;  1NK0 A;  4JI2 F;  2NR0 A;  1TQL A;  1VQ6 S;  1PYT A;  4CLP A;  3IAM 9;  3SXL A;  3R1L A;  1AFJ A;  3OTD A;  4B9S A;  5D4P A;  4AT1 B;  3MXH P;  2DNR A;  4GKK J;  1OY8 A;  1V6H A;  4L73 A;  5KFQ A;  1N6Q A;  3LWL A;  2E66 A;  2DCL A;  4DR5 J;  3SZ2 A;  3BPD A;  2ZJQ Q;  2DR7 A;  5IC4 B;  2AYE A;  3OJS A;  1LFW A;  5KG4 A;  3H42 A;  2E7W A;  4DV2 F;  1WC5 A;  3G71 S;  1T02 A;  4NI2 A;  4A8Y A;  3QLH B;  4JV5 F;  1W2B R;  1FT8 A;  2HS4 A;  3ZTO A;  3RBD A;  3KUH A;  2K1R A;  4J91 A;  4OI1 A;  4ECT A;  4DSL A;  1IKW B;  3N79 A;  2GIR A;  4CLU A;  3I0R A;  4ES1 A;  1WEZ A;  1TUG B;  2NXC A;  4J9L A;  3BS9 A;  1MWQ A;  4HI1 A;  3TJ8 A;  1S1V B;  2YNH B;  1RT3 A;  3CD6 S;  1WC0 A;  2C42 A;  4MYU A;  2HMI A;  4CLT A;  2UXD F;  2Z58 B;  3C14 B;  2N82 B;  4YR3 A;  2HGN A;  3BN7 A;  5K8O A;  1TK5 A;  2QLW A;  1V9O A;  3M32 B;  2QLJ B;  2E5L J;  4K5R A;  1ZPW X;  4RUC A;  1IKX A;  2H5I B;  1R31 A;  5GVQ A;  2YQ3 A;  4W4M A;  3OHA A;  1SB6 A;  3OSP A;  2ZDO A;  3TAN A;  1IJE B;  3TUZ C;  2XMA A;  1PG5 B;  3T1A A;  2PGC A;  4KGZ B;  4XPC A;  2YWW A;  5EWE A;  4G3I A;  4W98 A;  3W61 A;  2JHE A;  3GIJ A;  3OQ2 A;  4QWA A;  3D7S B;  3KJN B;  1RK8 A;  4OI4 A;  1ZTW A;  2CNK B;  4OLO A;  4C98 A;  2KKH A;  4DG1 A;  3ISN D;  2NXU A;  1H2V Z;  4I6Y A;  4M8L A;  2HHT A;  1FDB A;  3PIP Q;  1F1B B;  2QL5 B;  4DX7 A;  1S9E A;  3TOQ A;  3GYN A;  2QL7 B;  4I6A A;  2ZZM A;  1VR6 A;  3T1Y J;  3TEH B;  1GMW D;  1YJ9 S;  1KRP A;  1HBO B;  4DN0 A;  4EMD A;  3PW2 A;  4EFA C;  3GYX B;  1RCX B;  1RU2 A;  2ASD A;  2DD8 S;  4FDF A;  3SDE B;  2XCP A;  3OFH A;  2BAC A;  3RW7 A;  4WZM A;  5J2M A;  3JB9 k;  3PXG a;  4TVA B;  5ETT A;  3KHH A;  2BJ1 A;  2IJF A;  1VFJ A;  2KH9 A;  2NCK L;  3FSI A;  4C11 B;  2VC0 A;  3MMC A;  1S0M A;  4PR6 A;  1A7G E;  1H72 C;  2DNL A;  2VD3 A;  1JLA B;  1CS4 A;  5GAD U;  4TU7 A;  1GMW A;  2P9C A;  4ZP7 A;  4HHH A;  2AYG A;  3A8J A;  3N5B A;  4DUZ F;  3EVW A;  1X4H A;  3H5Y A;  3VVU A;  1IJF B;  1RLD A;  4IFY B;  3PW4 A;  2Y1J A;  1BQM B;  3C15 A;  3N6L A;  3NGK A;  2AEF A;  4N76 A;  5IWA J;  1BHN A;  5DG9 A;  2JFK A;  2DGU A;  3UCG A;  3HJF A;  3TAM B;  5DQI A;  4LF7 F;  2KL8 A;  5HLF B;  2X1A A;  3B4D A;  1T05 A;  3ZZZ A;  1LW0 B;  4PG4 A;  4EK2 A;  3P6Y C;  1HNV A;  1TFY A;  4F3O A;  2FGC A;  3F44 A;  4RU2 A;  2GVZ B;  4G6V B;  4ZIV A;  5HBM A;  4CO1 A;  2HIY A;  3QID A;  4DXL A;  4CLF A;  2RS8 A;  5EWF A;  3V2U C;  4TNO A;  2XSJ B;  3E01 A;  2MZS A;  5J2N A;  1UZD A;  1QDU B;  4Y6I A;  1IR2 A;  2BEF A;  1WWH A;  5IT0 A;  3G6X A;  2ZE2 A;  3J7Z 5;  3O8W A;  5EWG A;  1YJN S;  3LP2 B;  2HHX A;  2E1C A;  3I5B A;  3OL7 A;  1TUW A;  3RW6 A;  3DN9 A;  2QMU B;  5B09 A;  4X4U A;  3I0S B;  2OGU A;  4FS1 A;  2F9J A;  5I4M A;  5A6W A;  3D3B J;  4RPF A;  4OL8 A;  5EN1 A;  1GXT A;  2C2E A;  2M52 A;  3JSM B;  5F8J A;  1NK5 A;  2GZO A;  4KY3 A;  3DDN A;  3G8Q A;  3CJ0 A;  2ZBP A;  5GMD A;  3M6U A;  2OPQ B;  3NOG A;  2XWX A;  2MZ1 A;  2F65 A;  4J9V A;  3MCN A;  2DGS A;  1BE4 A;  1YG0 A;  3QFW A;  3FUY A;  2R7R A;  3BH6 B;  1U6Z A;  3RRG A;  4OYW A;  2C2D A;  3CC2 S;  4KGX B;  2XYH B;  3J7Y U;  3I5A A;  3AH6 A;  3A3N B;  2XMT A;  1FKO B;  4OYB A;  1F0X A;  5E33 A;  2BRK A;  4P10 A;  4ILL A;  4FXV A;  5DM7 Q;  3UNG C;  4L6V 3;  4ICL B;  1Y0H A;  4C0O C;  4P72 A;  4ZPA A;  1KS2 A;  3J80 Y;  2KXH A;  8AT1 B;  2A1B A;  1FE0 A;  1SIZ A;  4DR3 J;  1PC5 A;  3QAU A;  2Y0S D;  1JLF A;  2ZOF A;  4Q45 A;  1Q8L A;  2V9K A;  1TAQ A;  3BV8 A;  4LRF A;  1ROF A;  4IG3 B;  3TWZ A;  3L7P A;  1CJK B;  2M8H A;  3BB5 A;  3H7H B;  4F4Z A;  3EZU A;  4JI0 J;  4TQS A;  4DUY J;  1VQ5 S;  4GVB A;  3S7R A;  4KKO B;  3VZI A;  1VMB A;  3AOD A;  3EDR B;  5B0A A;  4QWE A;  1S48 A;  4I0W A;  3QAE A;  2V63 A;  3M30 B;  1B64 A;  2LKZ A;  4DFM A;  5EUH A;  3F73 A;  3I31 A;  3A12 A;  5IFM A;  2XMW A;  3CDB A;  3T5J A;  4J37 A;  4Y2M A;  2B56 A;  2HEK A;  2JL9 A;  1XR7 A;  4MJK A;  3T9Z A;  1ULR A;  1Z1Z A;  4U67 Q;  2AQ4 A;  2ZM6 J;  1NJZ A;  1NJY A;  1X4F A;  2VDI A;  2W25 A;  2IMW P;  1NCL A;  3Q89 A;  2H4Y B;  1X5S A;  2OMO A;  4PWD B;  3GV8 B;  1XN9 A;  2DNK A;  2B3T B;  1S97 A;  1C0T A;  3MPD A;  1F9F A;  2I5J B;  2ZEJ A;  3OBI A;  4X84 A;  4YB1 P;  4AXJ A;  3BDP A;  3PR4 A;  4IKA A;  4U96 A;  2Q66 A;  1HMV A;  2DNZ A;  1J5E J;  3G86 A;  3UN3 A;  4XAK A;  1RP5 A;  1PKU A;  1N32 F;  1FRH A;  3DLK B;  1RT1 A;  2E5G A;  3D0G E;  4LJM A;  4IOC Q;  3KFW X;  4OYX A;  2R8I A;  1WC6 A;  3ZZO A;  3CO9 A;  2COL A;  2FLP A;  2G2Y A;  4NMX A;  1B0T A;  4PG8 A;  5AXN A;  4FNH A;  2GAG C;  4RNM A;  2ZHO A;  5D3G B;  4LRE A;  3R6L B;  3MWB A;  2DGW A;  1JXE A;  1SKS A;  3IBC B;  3IS9 B;  1RAA B;  2GVD A;  5K8M A;  1GTE A;  2WB4 A;  4CTA B;  1UVN A;  3EPG A;  1NHK L;  2MYF A;  2YKP A;  1KDN A;  2O3D A;  2IM2 A;  2MKY A;  1FJ7 A;  2W2N P;  4ID5 A;  5HN0 A;  5T41 A;  2P9E A;  4UY8 5;  2B4O A;  4WCE Q;  3TUI C;  1CJU A;  3HHK A;  3L7U A;  3PFE A;  1JLC B;  2GML A;  2R8H A;  2MKC A;  3P4U B;  2R2R A;  5L1J A;  5KFO A;  3KLE B;  1RHR B;  4C8Z A;  4X65 J;  1TL1 A;  2J76 E;  2ROE A;  4FYX B;  1UTA A;  3CC7 S;  4A4J A;  2J6S A;  3TQE A;  3JAM Y;  3WX8 A;  3QT6 A;  1AXQ A;  2HQC A;  4ZCK A;  4RKU C;  2Y1R I;  1MN9 A;  4JI7 F;  2H65 B;  1T3N A;  3T19 A;  3ZTQ A;  4CCH A;  2UVV A;  1TL7 B;  4Y28 C;  1L3T A;  3OXL A;  1KOH A;  4ED0 A;  3NXZ A;  2YKN B;  1D0E A;  4FPR A;  2DY1 A;  2AJF E;  1MMN A;  1HBM A;  2RQC A;  1ICE B;  2CQ1 A;  2VC1 A;  4UST A;  1VHI A;  3KG1 A;  3W1Y C;  5LSL A;  1HL6 A;  3VAL A;  3QYY A;  5DJB A;  4CDI A;  3CCT A;  3PJW A;  1APS A;  1NBE B;  4DQS A;  3N6M A;  2HSE B;  2IA0 A;  4G1Q A;  4H54 A;  2CQ3 A;  3MM8 A;  2F63 A;  4XIU A;  2NUU G;  3UN5 A;  4C6A A;  1X8D A;  2EK6 A;  3DLG B;  2DCU B;  2HZA A;  4ZDN A;  3CCR S;  1X9M A;  3VZH A;  2N7Y A;  2ZOG A;  4OJ3 A;  2EC2 A;  3PJX A;  5ETR A;  2FJA B;  4B3R J;  5KT4 A;  1PGZ A;  4B02 A;  4PAB A;  4Y2A A;  1U8S A;  3RYL A;  5KFZ A;  2FZG B;  3H2V E;  2H3E B;  1RAH B;  2DRD A;  1CUL A;  3PYF A;  4JI8 F;  4U8V A;  4R25 A;  1RTH A;  3CD5 A;  3TZX A;  3MFH A;  1N5T A;  2O66 A;  2RRN A;  2XY7 A;  2IJR A;  5A8K B;  4AXI A;  4CP5 A;  2VFT A;  3CUL A;  1IUJ A;  2DIS A;  2CPF A;  5KTQ A;  5K8P A;  4FF2 A;  2H9Z A;  5DDR C;  3MAH A;  4DMZ A;  2QE5 A;  2EFG A;  4NE9 C;  2CQ4 A;  1M90 T;  2LXF A;  1KKH A;  3CCM S;  3PDN A;  1SQE A;  4WFA Q;  4PPD A;  2FZC B;  4JI5 F;  2DGX A;  2IRX A;  3C8Y A;  1J27 A;  2V4R A;  1S6P A;  3UD4 P;  3TA2 A;  2MHN A;  2CXE A;  5B0C A;  3HSJ A;  2HVE A;  2CPI A;  3UCU P;  4DR4 F;  3BM7 A;  1HQE A;  5KFN A;  1PYO B;  3T5L A;  2N4D A;  1WHV A;  4Z7C A;  1TVR B;  4OI3 A;  4V19 J;  1R8H A;  5IM0 A;  3FCW A;  1N33 F;  2W4D A;  3OW2 R;  2QLX A;  4DSK A;  1M5H A;  4GKJ J;  3OVB A;  1WOP A;  2AZ3 A;  1VQY A;  3R5J B;  2BKO A;  5C42 A;  2FY8 A;  3DOL B;  4X4T A;  5L9X A;  1XNQ J;  2XYP B;  2NSB A;  3CDU A;  3GSI A;  1QE1 B;  2BW2 A;  3LP1 B;  4JP8 A;  4JI4 F;  4A8K A;  3CVK A;  1Q7Y T;  2B9E A;  2E9R X;  4FF3 A;  3MCO A;  4I67 A;  1XQI A;  3L09 A;  3I55 S;  1TKT A;  2ZBR A;  2OD6 A;  5DLF A;  4ZVT B;  1XMQ J;  3Q8P B;  1FDD A;  4PCQ A;  1D9F A;  2XG8 A;  2IMO A;  3PX4 A;  5HQM A;  1JLB B;  2JOQ A;  1UET A;  2QA2 A;  1UA1 A;  2EFQ A;  5CA5 A;  3KLI A;  1S5Z A;  1SL0 A;  3RJM B;  1UFL A;  3I87 A;  3M8P B;  1SIW B;  4PXE A;  3R3T A;  2XM3 A;  3MM7 B;  4ZHR A;  2PT0 A;  4ZK7 M;  4BDP A;  2YNG B;  2ALY B;  5E5N A;  1GXL A;  4B3S J;  4X4P A;  2YKQ A;  1KFS A;  3DGV A;  3G6E S;  1GT8 A;  2UXC F;  2XY6 A;  3NGD A;  1S77 D;  1JLQ A;  3QBC A;  2B51 A;  2QFJ A;  2BDP A;  4DLG A;  4P71 A;  1RT4 B;  4WXO A;  5L1I A;  1UL3 A;  4ZCL A;  1I94 J;  4EI2 A;  3DYA A;  2GO9 A;  4DQP A;  1JNZ B;  2MSS A;  3C46 A;  1Q79 A;  2JC1 A;  3MMB A;  1N0U A;  1FK9 A;  3HVR A;  3K57 A;  2A6M A;  3CJ5 A;  4P9S A;  3SEO A;  3FZ2 A;  1VQK S;  4FF1 A;  2BX6 A;  3KJQ B;  2A2C A;  4DR2 F;  3KMS A;  3BQ1 A;  4USU A;  3GFY A;  1LWF B;  5GAH U;  4LFB J;  1SC3 B;  2JJ4 D;  4RW6 A;  3KLV A;  2CZV C;  2C2K B;  2VPX B;  3DLE A;  4E0D A;  1B99 A;  1Q78 A;  1DLO B;  2QL9 B;  3D28 A;  3R5B A;  4IQM A;  2DR8 A;  4HH1 A;  3DRP B;  4K4U A;  2J6U A;  1BGX T;  1OPZ A;  3CIZ A;  5B08 A;  3KYL A;  2DR5 A;  2UXB J;  4ZP6 A;  2AYM A;  5CYM A;  1JJC B;  2OPR A;  1U6B A;  2VON A;  1MML A;  4X4O A;  2V69 A;  2LCW A;  1PAU B;  2ACY A;  1VCT A;  4UUX A;  1RAB B;  2E29 A;  3TI0 A;  2J9D E;  2CKW A;  4CIO A;  2J0Q D;  2D69 A;  4ERD A;  2RKI A;  1TK0 A;  1UJ6 A;  5KFR A;  1SV5 B;  3PAC A;  2QN6 B;  3POT B;  1KSP A;  4P7V A;  1KLN A;  3W5Y A;  1VJW A;  1ZS6 A;  4ZLN A;  5CD4 A;  3ITH B;  1C1B B;  4JI2 J;  2MXY A;  2CIM A;  4LF4 J;  4ZVR B;  3LW5 C;  2V4J A;  3BGL A;  3FBE A;  4RJV A;  1UJ5 A;  3MMA A;  2HK3 A;  2HVD A;  1DTT B;  3ILL A;  4FKX A;  3GJR B;  4K0K F;  3QT8 A;  1FDN A;  1LWE A;  2OKQ A;  3RBE A;  4X4R A;  1GTH A;  3T3F A;  3CD7 A;  3GJT B;  1QAJ A;  2NYI A;  1YTY A;  1IXK A;  4DV2 J;  5AE3 A;  2PMH A;  4NA2 A;  2DNM A;  1F5A A;  1TEL A;  5LMU J;  1N5S A;  2RU3 A;  3PRV A;  1S49 A;  4JV5 J;  4HKQ A;  2ZWO A;  4OI2 A;  2YH1 A;  2KRR A;  1S59 A;  4DHV A;  3UD3 P;  1N54 B;  4TXS A;  1WDD A;  1R89 A;  2VDH A;  4XDD A;  2FJD B;  1RAE B;  1NK9 A;  4NCA A;  3EM1 A;  2EFN A;  4ZIT A;  4DOZ A;  4CO3 A;  2YWK A;  4RW4 A;  1FI4 A;  1VQP S;  3NAI A;  4YOE A;  4AL7 A;  1E6Y A;  1S9G B;  2QLB B;  4K4X A;  4AE5 A;  5I42 B;  2LP4 A;  2GIF A;  4QIE A;  1Y7P A;  4XPE A;  3NY0 A;  4ZPW R;  2FJE B;  8RUC A;  3DOM A;  1RTZ A;  2FJB B;  4RBV A;  4H4O A;  2DGV A;  4IH6 A;  1IVZ A;  1R27 B;  3NBP B;  2MZQ A;  4NOH A;  1P9Y A;  3MD1 A;  2AGO A;  2GJ2 A;  1VQ7 S;  5KFJ A;  4B9L A;  3J7A N;  1RDR A;  2CFX A;  2FIU A;  1EP4 B;  4JV2 A;  2FGO A;  2DH9 A;  3V6D A;  2A2D A;  4C0H A;  1SJ4 P;  3KKF A;  2GS8 A;  3UQS A;  3M2V B;  4DX6 A;  2OFG X;  2CAD A;  1NPP A;  3LAL A;  2GW8 A;  2Z2M A;  2MST A;  3FEZ A;  3DM2 A;  1NUE A;  5KOX A;  5LMN J;  4USI A;  3F0N A;  2XS2 A;  1R8A A;  4O4G A;  1Y9O A;  4ZLP A;  1AUD A;  4CLY A;  5GAE U;  1VS3 A;  2BAN B;  2R42 A;  3MEC A;  1YBA A;  1NEE A;  4Q0B B;  4DZD A;  2H48 B;  4F04 B;  4IOB A;  1T95 A;  4UQT A;  5AXL A;  3R9L A;  2MKK A;  4ES3 A;  3FSY A;  3SBM A;  4DFP A;  1S10 A;  3V6K A;  2K7K A;  4ZJQ A;  4K4V A;  3D6F B;  1Q16 B;  3F41 A;  1XR6 A;  4G65 A;  2YY3 A;  4UQG A;  4QWC A;  3M2U B;  4QPT A;  1FX2 A;  3QO9 A;  4DN9 A;  3W60 A;  2XLJ A;  2DR6 A;  4KGV B;  3LAK A;  3HP6 A;  1PSD A;  3M1V B;  2J9E A;  1MW7 A;  2AWZ A;  2MTL A;  2DK2 A;  3W2W B;  3ZTP A;  4ED4 A;  2ZNZ A;  4NLR A;  2ZH1 A;  2EI5 A;  2P9G A;  1QAY A;  3TAR A;  2KN4 A;  4O0N A;  5KT5 A;  3Q2T C;  2J7U A;  2HHW A;  1SUQ B;  4LSZ B;  3KNG A;  5HJX A;  4LF2 A;  3CDW A;  5ETL A;  1QUP A;  4DUZ J;  2I1R A;  1PO6 A;  3W9J A;  3OL8 A;  2HBR B;  2HZV A;  1S7H A;  1WJ9 A;  3UN2 A;  3QPI A;  2SXL A;  4B3O A;  1P9Q C;  1X4B A;  2YVS A;  5F8G A;  1UCN A;  4N7T A;  2F8M A;  2Z8Q A;  2W9C B;  1DQ9 A;  4ZMM A;  4PUO B;  1YLX A;  2E1R A;  3MM9 A;  5HVH A;  3K2Y A;  2BE2 B;  2AZ1 A;  1NU4 A;  1FVQ A;  3QMQ A;  2BE9 B;  2WVD A;  2J9D A;  3KLF A;  2GCF A;  4QBU A;  1FNM A;  3ISN C;  3AJ1 A;  2DIU A;  4TN2 A;  3L9Z A;  2MGZ A;  2VUG A;  1PBU A;  3CCW A;  4ZVS B;  2C2M B;  1O6X A;  1IQZ A;  3BR9 A;  2CQ0 A;  3TX0 A;  2CYY A;  3MCS A;  3QGP A;  1HWJ A;  3WHI A;  4ZVG A;  4PAA A;  3B8H A;  1UZH A;  1UPP A;  1WF0 A;  1RWN B;  4GKK F;  2QA4 G;  2AJQ A;  4JB8 B;  3NKY A;  4M5M A;  2DHX A;  5L8R C;  1IBM J;  2YX7 A;  1Z2L A;  2M7S A;  4DR5 F;  1SH2 A;  1LFP A;  2G13 A;  2H51 B;  2JWN A;  4PQU A;  1VC5 A;  4IYQ A;  4F36 A;  4IRK A;  2QA4 S;  3QGG A;  2M70 A;  4N41 A;  4OHX A;  3IBW A;  5C2G A;  3MED B;  3PKM A;  2OAU A;  3DXS X;  5H9E K;  3N01 A;  3C6U A;  4ZCM A;  3V4I B;  1WC1 A;  2RS2 A;  1EKS A;  3KK1 A;  4C8L A;  2RDI A;  3TEG A;  2HHQ A;  4UZC A;  1PCA A;  3CJT A;  2CZ4 A;  2ZBC A;  3PR5 B;  3TAP A;  3H2U B;  3DGP A;  3B4M A;  5M2P A;  4J9P A;  1REG X;  1KQK A;  1EB0 A;  2DGQ A;  4AYB D;  2R8J A;  1UPM B;  1DBD A;  4WFN Q;  1SC1 B;  3VVT A;  5D0G A;  4J9R A;  1D8Z A;  2JEG A;  2HBQ B;  5HMW A;  2AF6 A;  4ZJO A;  1IKY A;  5CZX A;  2F5G A;  2L08 A;  1KTQ A;  2AT1 B;  2E9Z A;  1SC6 A;  4WFB Q;  3C2P A;  1S6Q A;  3R2C J;  3AOC A;  4C3M A;  2RUG A;  3EJM A;  4P73 A;  4N56 A;  1KFD A;  1WC3 A;  4NXM J;  4OHZ A;  1FKA F;  1FVS A;  5ETN A;  2HNY A;  4QU6 A;  1I6J A;  3DFE A;  1U6F A;  3TZY A;  1VDH A;  1CQM A;  2HIQ A;  2MLZ A;  4X66 J;  4O3N A;  3RUB L;  2QMX A;  2HAI A;  3BRE A;  4Y2C A;  5KFV A;  1AW0 A;  5D8H B;  2WVF A;  2DO0 A;  3OTE A;  4DDF A;  3T1Y F;  3IO1 A;  4QYZ J;  2LDY A;  4DL3 A;  1DAR A;  4IDK A;  2D3O 1;  3LP0 B;  1RI7 A;  2POK A;  1Q86 T;  5CYQ B;  2RE1 A;  2Y1L B;  3IMQ J;  3WC2 A;  1EET B;  3D1O A;  4NCG A;  2J0S D;  5KFP A;  1HNI B;  1TKD A;  4C8O A;  4PXC A;  3OUY A;  3PO4 A;  3QAT A;  4F67 A;  1TR0 A;  5A8R A;  4N8N A;  1S4E A;  4MKA A;  2ATL A;  3IA0 A;  3DXB A;  2XMU A;  3TQ1 A;  4RUB A;  4F7V A;  1VOM A;  4NLG A;  4NAS A;  3OVA A;  4U7U K;  4L3N A;  2KYZ A;  1JIH A;  4MMO A;  4AND A;  2PEB A;  3IAS 9;  1UEK A;  4LMZ A;  4M5H A;  1OPI A;  1ZET A;  5IWA F;  1CQN A;  5A8W B;  3S1T A;  4HLB A;  5J2Q B;  1Y4Z B;  2FLO A;  4DV6 F;  2RF2 B;  1LWC B;  4I64 A;  1AZS A;  5J1E A;  1FTR A;  2MJN A;  4Q5V A;  3P8B B;  4ECY A;  4QR0 A;  3S8S A;  1TKZ A;  2L9N A;  2X3D A;  2JEI A;  1JKH B;  2U2F A;  2Z2Z A;  3HK2 A;  2KT5 A;  4O3Q A;  4WK1 A;  3OLB A;  3NEK A;  1NSK L;  4MKV A;  4TKT A;  2O01 C;  5KFH A;  2V2Z A;  5D0E A;  2B4V A;  2OPP B;  4Z2X A;  1HBU A;  4WFZ A;  2PA8 D;  3W65 A;  2CAJ A;  2PC6 A;  4MKY A;  4MYT A;  4OX7 A;  4V1A k;  5DZ7 A;  4X2B A;  2HKE A;  1R8P A;  1SXL A;  2ZKT A;  4DL6 A;  2MQP A;  1XEZ A;  4M5K A;  5B0D A;  4QIV A;  3ENW A;  3G2X A;  3VHQ A;  2M5Y A;  2X1F A;  4P74 A;  2HVI A;  2CQC A;  1NSQ A;  4KR0 B;  3CJK A;  5L1L A;  1RT5 A;  1DRZ A;  5G4D A;  5JVH Q;  4QCL A;  3AA9 A;  3ADA C;  4EZ6 A;  2YBV A;  1K73 T;  3PG9 A;  3PYE A;  3VAG A;  5CHC B;  3MTJ A;  1WHW A;  2GQC A;  2LQ9 A;  2MQL A;  1C0U A;  1U26 A;  2MEW A;  1KBR A;  3KG4 A;  4PG5 A;  3RAQ A;  1YK9 A;  2NXN A;  4UZB A;  3HLU A;  2X51 A;  1WEX A;  1FWP A;  3I6P A;  1N52 B;  4ID8 A;  2C28 A;  4ETX A;  1R7I A;  3PEH A;  1TKX B;  2DEJ A;  2V8D A;  3MEG B;  3K5M A;  1LK7 A;  2EG2 A;  1K0V A;  1NB7 A;  4HDG A;  3TVK A;  4KE5 A;  1Y5L B;  3QIP B;  2VOD A;  2DGO A;  4ZPB A;  3PRB A;  5T7L B;  1JLE B;  4OYZ A;  5H9F J;  4DR6 F;  1NJX A;  4NEY A;  4DR3 F;  1Y5N B;  4DPY A;  3SIP B;  3FRZ A;  5E3C A;  2CPE A;  2MKJ A;  4RUH A;  3RBX A;  5CAB A;  1U0H A;  1X0P A;  5IQ6 A;  2OH2 A;  2C2N A;  2XWY A;  4P52 A;  2VG5 A;  4DUY F;  3TJA A;  5C2C A;  1WAC A;  3MM5 A;  3GTY X;  4ZJL A;  1DUR A;  2AU0 A;  3VGS A;  3HT0 A;  2OI2 A;  1DQ8 A;  1WOS A;  1MU2 B;  4JI5 J;  1C1C B;  3UI3 A;  1SKW A;  1WTF A;  1ZAV A;  3TJ9 A;  2LA4 A;  4UUW A;  1GXU A;  1JX4 A;  1U8W A;  1W2I A;  1RT6 B;  4P2S A;  4DV4 J;  2V2K A;  3HCX A;  4QIW D;  1NK8 A;  3JYT A;  3M6X A;  2KFZ A;  1MSW D;  3PX0 A;  1RUS A;  4QIG A;  2HQD A;  2ZM6 F;  2ZJP Q;  4R5P A;  1GQE A;  3ZZP A;  4FP9 A;  2P2C B;  4JBC A;  1N33 J;  1F5C A;  2HYI B;  4K5S A;  3CO0 P;  4Y3C A;  5GAD I;  2E44 A;  4K2J A;  2E5J A;  2WOM A;  3MTK A;  4LSL B;  3AD9 C;  2HRT A;  1X4C A;  1B4S A;  3KWM A;  3MR2 A;  1SH0 A;  4NLV A;  2BQ3 A;  2ASL A;  4DX5 A;  1F2H A;  1HPZ B;  3OR2 A;  2HHH F;  3EX7 B;  3T1H F;  1FD2 A;  4B9V A;  4X4N A;  3BSC A;  2JSX A;  3DOK A;  1WEY A;  1EIY B;  1KOO A;  2U1A A;  4RLE A;  3E2E A;  4A8Q A;  2LEC A;  3HHD A;  4K2X A;  4DPW A;  4GO7 X;  1RE1 B;  1M5O C;  3FJ2 A;  4CWB A;  3EE3 A;  1C4A A;  3NG8 A;  4DZ6 A;  4FVC A;  4V19 X;  3GB0 A;  2CJY B;  1RBA A;  1EAR A;  4R8U A;  3TA0 A;  2ILZ A;  3Q86 A;  3ILJ A;  1H73 A;  4CNY A;  2JLF A;  1WKK A;  1WHY A;  5J2P B;  1RT7 A;  1RTD A;  1AB8 A;  4NZ7 A;  2E5I A;  1HWU A;  5F3T A;  3TW0 A;  1OMS A;  2YKM B;  5HL7 Q;  4M5D B;  5IT9 U;  1XTZ A;  3QT5 A;  1S1X A;  2P6S A;  4OYM A;  2FVC A;  1YJV A;  4WE1 A;  2B4U A;  2VQF F;  4HAC A;  4C8N A;  2MQO A;  1URR A;  2E9T A;  2B6A A;  2V0N A;  4LR9 A;  2BM1 A;  2GA7 A;  4ZPC A;  1HAR A;  4YDD B;  4OJH A;  1R0B G;  1FEE A;  2WSF C;  2ZHB A;  1U1K A;  3M8Q A;  1G7C B;  1NPR A;  4QOT A;  1SI9 A;  2QJ3 A;  3M2R B;  1N36 J;  1MN7 A;  4KAI A;  2KYX A;  4OX8 A;  4ZVF A;  1HIY A;  5HI7 A;  3RBZ A;  3IR6 B;  3CJQ A;  4X65 F;  2OUG A;  2IM1 A;  2RB7 A;  2OEM A;  4ER8 A;  5D4L A;  5J1P A;  3NCR A;  4QW8 A;  5FJ4 A;  2YTC A;  3SMZ A;  1T9Y A;  1HNZ J;  3NNC A;  2PII A;  2DH8 A;  5J1N A;  5DDO C;  4FYD A;  1VIS A;  1S1T A;  2R7Q A;  2YNF B;  4ED8 A;  4XTT A;  3CCL S;  4IG0 B;  1BXN A;  2VU5 A;  3P45 B;  3DI6 B;  3BPS P;  5KFS A;  2RVJ A;  4ILR A;  1HBN A;  1UVI A;  4OHV A;  2XCA A;  1RHJ B;  3PYG A;  4PEO A;  3MAA B;  1NJI T;  1EX8 A;  4NCB A;  3W64 A;  2BJE A;  3MUR P;  1HNX F;  4A8W A;  4DSF A;  2M88 A;  3IFE A;  4NX9 A;  4RW9 B;  4O23 A;  3GMG A;  3VAF A;  1RJJ A;  2R7U A;  4BWM A;  3R5G A;  2LXU A;  3THT A;  3SCL E;  4M1K A;  4B3R F;  2C2R A;  3LPE A;  3UR3 C;  5ETO A;  4JI3 F;  5D6G A;  2XQC A;  4XK8 C;  1OJ4 A;  2QGF B;  1U09 A;  5HVG A;  5F0W A;  3PM9 A;  3SCK E;  1QY7 A;  1UMJ A;  3HM9 A;  5E3A A;  4QYR A;  2FLN A;  1MWZ A;  4RW8 A;  4F4W A;  5B0B A;  1UW9 A;  2IRY A;  2C1E B;  2V8G A;  3MM6 A;  2W8L A;  2LEB A;  2OSR A;  2W4C A;  3K5O A;  2HFO A;  3R7N B;  2HLT A;  1U1Q A;  4NA1 A;  3MEE B;  4YY3 J;  1KN6 A;  4W90 B;  2XZT B;  1U1O A;  3CXC R;  1XMO J;  1LV5 A;  3GV7 B;  1YGY A;  5KT2 A;  2QG9 B;  3GG0 A;  1QJH A;  2I38 A;  2RIJ A;  3BGR B;  2CJA A;  2HQF A;  5KG2 A;  3CW2 C;  4EWT A;  3G82 B;  1RWW B;  4C2M A;  2WON A;  2JNJ A;  3JQK A;  3SYZ A;  3JSY A;  4FN5 A;  5THW A;  2L3M A;  2ZD1 B;  5KFM A;  3THV A;  2MQ8 A;  2NLW A;  3OPK A;  5C25 A;  4Q7A A;  2QV6 A;  4CYU A;  1FRJ A;  4GKJ F;  4EBD A;  2M4M A;  3MEK A;  1YDL A;  3CGI A;  4TYA A;  4C8Y A;  4WP3 A;  1HHT P;  2GJF A;  4MFB A;  1HYS A;  2EVZ A;  3ILO A;  3KK2 B;  4OZN A;  1QLN A;  3HFZ B;  3CJ3 A;  3BQ0 A;  1XNQ F;  4LSN A;  3VAJ A;  2KM8 C;  2DPI A;  3QWP A;  2PDA A;  2GGP A;  2IJN A;  5HRO B;  3KLG B;  4N77 A;  3NMR A;  1NND A;  4YB5 A;  3GLJ A;  3MDF A;  2RIL A;  1SQF A;  2RHQ B;  2EC0 A;  2GHP A;  4USV A;  5KG1 A;  3W5X A;  4J9N A;  1N8R T;  3QJL A;  1B7Y B;  3D1H A;  1JK9 B;  4TY8 B;  3C3L A;  4PG7 A;  3KUE A;  4WKR A;  1F9H A;  2XHW A;  3IN5 A;  1SJ3 P;  1VK3 A;  1CSJ A;  4K4T A;  3UVJ A;  3RAM A;  1M0S A;  1N5Y B;  1ZYQ A;  1QTM A;  4RW7 B;  5G0R B;  1TL3 A;  2Q6B A;  3TUP A;  3KLH B;  2J7W A;  4PKD B;  3FK4 A;  3D68 A;  2VA3 A;  3AD7 C;  2ZNY A;  2B8P A;  4B3S F;  4I56 A;  1ZPV A;  5BYS A;  4DV0 F;  3H4B A;  4OV1 A;  1S72 S;  5D4O A;  4FYW B;  5IZH A;  3NS6 A;  5L1K A;  3H5U A;  3VF0 B;  5CH7 B;  2LMI A;  1YRU A;  1YIT S;  1I94 F;  4M94 A;  4F8R A;  2RUS A;  1NXI A;  1UVK A;  2HRY A;  1BY9 A;  1X9W A;  3DRR B;  3M9M B;  2JX2 A;  4LRC A;  3MR6 A;  2VB6 A;  4DV5 J;  3CNQ P;  1RWP B;  2MLY A;  2HWI A;  1R6Y A;  2W1B A;  1VC6 A;  2FTR A;  3RZA A;  3DNC A;  3NAH A;  3N28 A;  1NJW A;  3B82 A;  1TV6 A;  3AB2 B;  4ELV A;  4HT7 A;  2CZ9 A;  1LK5 A;  4DSJ A;  2G0J A;  5KFE A;  5LXY A;  1HW8 A;  2IAJ B;  1FF2 A;  4QJV A;  1RWM B;  5AXK A;  3RB3 A;  3BJY A;  4IFV A;  1REV A;  1VIX A;  3E8O A;  2VG7 B;  3LGH A;  1RTJ B;  2HND A;  4RNN A;  1FJG F;  2ZJR Q;  5A0Y A;  5C24 A;  2KFN A;  2UXB F;  1UJ4 A;  1ZZF A;  4RNO A;  5DM6 Q;  3AXK A;  3LWM A;  2AJ1 A;  2DEI A;  1VRU A;  2ALZ A;  3G4S S;  2R2S A;  5DRK A;  4LF5 J;  4YUD A;  4HHJ A;  4DPU A;  1RSC A;  5KFK A;  3W2V B;  3T5K A;  2R4F A;  1HD0 A;  3K58 A;  5BYR A;  5KG6 A;  1RHQ B;  4BC9 A;  3G8T A;  2FJW A;  2HGM A;  1RT2 B;  3AD8 C;  5KG0 A;  2W7P A;  2MY8 A;  4WFY A;  1KVK A;  3DMJ B;  4KHM A;  1S76 D;  2GO8 A;  3HVT B;  4X62 F;  3SQG A;  4LF4 F;  4M5I A;  1LW2 A;  4I2Q A;  1RU1 A;  2YKA A;  3TVY A;  1K44 A;  1WG4 A;  2O67 A;  2HS0 A;  3U7J A;  1H38 A;  6FDR A;  2X7I A;  1CJV B;  2DJW A;  3OR1 A;  1PC4 A;  1RXO B;  3D1Q A;  1VBZ A;  5LMU F;  3N5F A;  1V3S A;  2RJZ A;  2DNO A;  4R0J A;  4J9Q A;  1JLG B;  4WKY A;  2LQJ A;  1ACM B;  1JLE A;  4MAK A;  4OLP A;  3Q23 A;  2O1P A;  2CJQ A;  1MWY A;  3IG1 B;  5KT3 A;  1CLF A;  2EPI A;  4JOU A;  2XLK A;  4Y65 A;  5KOW A;  1YBU A;  2D1C A;  1DHM A;  3FFI B;  3F56 A;  5DZ6 A;  5DG8 A;  1WG5 A;  4WYL A;  5GMK a;  3VTI A;  2L48 A;  4Y00 A;  4KO0 B;  3BO2 A;  3EGV A;  3HHE A;  4L3K A;  4IRD A;  2AIR B;  1B70 B;  5KAK A;  3H90 A;  4KV8 B;  1F6T A;  5KFC A;  4KRW A;  5A2Q Y;  3RGI A;  4KFB A;  4OX9 F;  5F3Z A;  3QJJ A;  1U1N A;  1FKP A;  2ZUA A;  2DHS A;  4YHH J;  1RIS A;  1WSR A;  3BR8 A;  3R5D A;  4GC7 A;  3J81 j;  2IM0 A;  4WWS A;  4I7F B;  1TP7 A;  1GX6 A;  3NS5 A;  3FEX B;  1PJ7 A;  3JXO A;  1RTI B;  2QZ8 A;  5C5J A;  3Q22 A;  1MRO B;  4ECV A;  4J9O A;  1UWB B;  3V81 B;  4CT8 A;  4ZVE A;  5LMN F;  3KJV B;  2GQQ A;  2VJU A;  3DRS B;  1ZM3 A;  2GQ2 A;  1VQS A;  2UUC J;  1JJH A;  1VRT B;  4LRD A;  1RAJ A;  5MAO A;  2B9X A;  2J5A A;  1UA0 A;  3NL0 A;  5HP1 A;  5K14 A;  5GAH I;  1JNR B;  2HFV A;  2XSF A;  3HHL B;  2AMC B;  1IR0 A;  1F3F A;  2VPY B;  2C3O A;  1TK8 A;  4WPA A;  2XMJ A;  2FD2 A;  2FC8 A;  5ETP A;  2NS1 B;  4KBI A;  2JEJ A;  2PO4 A;  3J7A 1;  2CA9 A;  1H74 A;  1OO0 B;  1IN0 A;  3DDI A;  5FDL A;  1IKV B;  1QSY A;  4DL4 A;  2ROG A;  2H1Y A;  1LKZ A;  5E3Q A;  1XIQ A;  2XLI A;  7FDR A;  2XC9 A;  1R0A A;  4BC7 A;  3IM8 A;  1HQU B;  5EX3 A;  2OPS B;  2F4V F;  1E6V A;  2ACM A;  1H2U X;  1S1W B;  4KHR A;  3RRK A;  2I8E A;  4MT1 A;  1UAW A;  2PA3 A;  4ED2 A;  1P6T A;  1CJT B;  3VAH A;  1RAF B;  3O44 A;  3BH7 B;  4I69 A;  2XO7 A;  1KLM B;  4Q8F A;  2W8K A;  2GV1 A;  1TFW A;  2QX0 A;  3CSK A;  5JJB A;  3A3O B;  1NSP A;  2H5E A;  2WBR A;  4O4R A;  3VGT A;  4WP8 A;  2XGP A;  4FBT A;  5C7P A;  1VRQ C;  1S1U A;  4DV6 J;  2XMV A;  5ETK A;  2HQG A;  4WU2 A;  3AJD A;  5ETQ A;  4ZN1 A;  2UUB J;  1N6Q B;  2WVC A;  3ET6 A;  3W66 A;  3CMQ A;  2UP1 A;  4MK8 A;  3RB6 A;  3K7R A;  4O3S A;  3CE8 A;  4F0K A;  4NI2 B;  2OJ3 A;  4ZKA A;  5HAN A;  4MKB A;  5DGB A;  4B3M J;  1VHF A;  1S12 A;  2K1R B;  5E41 A;  2OML A;  3K89 A;  4DCP B;  2KHC A;  3CT9 A;  3NNA A;  1VYA A;  2C2O B;  2ZFH A;  3I0R B;  3ZC4 A;  2B0G A;  2ZWP A;  1VQN S;  3KK3 A;  3FBC A;  4WBF A;  2HZC A;  1X4A A;  2ZHA A;  1T3O A;  2KRB A;  4C0B A;  3RU0 A;  3ENA A;  1RT3 B;  2HMI B;  1NDP A;  1IBM F;  2FVS A;  3OTC A;  3PKY A;  3KHR A;  2CJ9 A;  3MUV P;  5M2R A;  4F25 A;  5L38 A;  1A0O B;  2VOP A;  3PW5 A;  1F9E B;  1FEH A;  4DUT A;  1IKX B;  1RCO B;  4U7U D;  2F3J A;  1V5I B;  3C6T A;  4DV3 F;  4Y2I A;  5I3U A;  4M63 A;  4K4S A;  3ETM A;  4CQ1 A;  2NXE A;  5LT5 A;  1GMV A;  4ILM A;  1TL4 A;  2ZIT A;  2B9W A;  5KT6 A;  4HVZ A;  2CWK A;  2YX4 A;  3OFF A;  3MOZ A;  3QNW B;  4URG A;  2ZBI A;  4ENO A;  1YX2 A;  2NZ4 A;  1S6U A;  2IHR 1;  4UT4 A;  3VQT A;  1BLU A;  3K0J A;  2VG6 A;  4DG1 B;  2ABY A;  2QSW A;  5F8I A;  4L76 A;  4DR6 J;  4OMF G;  3C16 A;  3GP9 A;  2CVE A;  3TP2 A;  3K8W A;  2J6T A;  4OFZ A;  4HT5 A;  1W26 A;  1T9U A;  3JSB A;  1S9E B;  2GHW A;  3FQK A;  2DHH A;  5GAE I;  3AOB A;  3UWT A;  1FJE B;  1FX4 A;  3IRX A;  4TYB A;  4PRF A;  2PFD A;  1T03 A;  1RYS A;  1F5B A;  3IP0 A;  2EFP A;  2KJW A;  1FRM A;  2I6W A;  2JZ5 A;  4NXM F;  2DBB A;  3PFO A;  2HGL A;  1DTQ A;  2YH0 A;  3UCZ P;  5J2M B;  4F4A A;  5D15 A;  1TZ0 A;  3KDO A;  4UOH A;  2AX0 A;  4DQQ A;  4Y2K A;  3QSY B;  2QO3 A;  3MMC B;  3O3L A;  4LFC J;  4I2P A;  4X66 F;  5M2U A;  3IR7 B;  1FJC A;  1CS4 B;  3VCD A;  4OZL A;  1Z2Z A;  2V8H A;  2V8V A;  2LEP A;  1SCJ B;  2CPH A;  3LGM A;  2UVR A;  1X60 A;  4EU0 A;  4F4Y A;  3J81 Y;  3U02 A;  3CDA A;  1M5P C;  1M5V C;  3EXC X;  4E98 A;  3C15 B;  2W9A A;  2RHS B;  2QLF B;  5DG7 A;  1TAU A;  1YJU A;  2FHJ D;  2HHH J;  3T1H J;  3NGS A;  3LAN A;  2W9B A;  5K20 B;  2H54 B;  4LVO P;  1KC8 T;  2HFN A;  2CDQ A;  3BO3 A;  1T05 B;  1OY9 A;  1HNV B;  4OYI A;  3RR7 A;  3P96 A;  2V5H G;  1FFW B;  2ZUG A;  5HBM B;  2IVY A;  4Q2L A;  1Q4R A;  5B0G A;  2K7J A;  2OEK A;  4XDC A;  1RWU A;  2VBW A;  1J5O A;  2N3O A;  3IWN C;  2PI5 A;  2QYC A;  3E01 B;  1AFI A;  4KHP F;  2JRS A;  1Y5I B;  2DVI A;  5J2N B;  3THP A;  1ZOT A;  2ZE2 B;  2V9W A;  4PG6 A;  4YDX A;  2FHJ A;  3RAX A;  4U6P A;  4H4M A;  3PHE A;  4EZ9 A;  3T41 A;  2A18 A;  2LXI A;  1BD6 A;  1Q1K A;  2VQF J;  4WTO B;  4CRJ A;  2EBE A;  1YBT A;  1I5O B;  1H3D A;  2VFV A;  1BMQ B;  3CED A;  4CZC A;  2N3L A;  2W2M P;  5H1S V;  2CQP A;  1YJ7 A;  3OFG A;  2X1G A;  5F9L A;  2GAH C;  2VH7 A;  3H0P A;  3DC2 A;  4CLW A;  2XMM A;  2IC3 A;  3W7B A;  1WD6 A;  1BQN A;  3US5 A;  2R7S A;  3H8Y A;  4M95 A;  1WKL A;  3FZB A;  4FYY B;  1L3K A;  3LH2 S;  2Q6C A;  1WNE A;  5F8N A;  1FXD A;  4J90 A;  2W24 A;  3BBB A;  5CQG A;  1Q5V A;  5F41 A;  1U1L A;  5JVG Q;  4PWW A;  1XJW B;  4HL9 A;  3D5M A;  2R7V A;  5HAO A;  2DHA A;  3HO1 A;  2G1H A;  1KVJ A;  4JI1 J;  4KB7 A;  4KQZ A;  3IGV A;  2KTQ A;  4EGL A;  2YNI A;  2A0F B;  1JLF B;  3B6B A;  2B5J A;  3OTO J;  4R0E A;  1Z4U A;  1VQ9 S;  4S0M A;  5A76 A;  3BEG B;  3IWL A;  1V3R A;  4YME A;  1VBX A;  1HNX J;  3CDE A;  4GVB B;  4C3L A;  3S6E A;  3Q8Y A;  4NWB A;  1YSJ A;  1G6B A;  4OZ0 A;  5KFD A;  3DRY A;  4DEZ A;  1P1L A;  1FRI A;  2R3V A;  2MKH A;  3T5H A;  4DV1 J;  2CNO B;  4JI3 J;  3BSN A;  5EGY A;  1WTB A;  1OWX A;  2KVQ E;  3R1H A;  3MPV A;  3P5T L;  2UVU A;  1KQS R;  1YIJ S;  4LQ9 A;  3QQC D;  4P7T A;  3I4P A;  4OHW A;  4ELU A;  1AA1 B;  3QLH A;  5D0R A;  4RBU A;  3FSX A;  3HD2 A;  1KEK A;  1ZAX A;  1VI7 A;  2XS7 A;  1WSV A;  1C0T B;  1UEV A;  2G2Z A;  3CB4 A;  1IKW A;  2OIH A;  5DQH A;  5LSR A;  2R8G A;  4KSE B;  1FNO A;  1CC7 A;  2JFD A;  1O51 A;  2APO A;  1S1V A;  4BLG A;  3QT7 A;  3V6J A;  3MR5 A;  1RT1 B;  1ZA1 B;  2XYG B;  2YNH A;  5AJ3 J;  3FFI A;  2N4C A;  3AT1 B;  3EGN A;  4DV4 F;  2XZD B;  1SJR A;  1OYD A;  3C14 A;  4RWX A;  1NK7 A;  3M32 A;  3P49 B;  3C19 A;  3W9H A;  3FBF A;  4LIW A;  4P75 A;  4ED6 A;  2FUG 9;  4OZ1 A;  3K5N A;  3IXQ A;  1Q5Y A;  2GVD B;  4YP3 A;  4DL7 A;  2MQN A;  2RQ4 A;  4RL1 A;  4DR7 F;  1IBK J;  4I7F A;  1OY6 A;  1B0V A;  5SUH A;  5CZV A;  3KXD A;  3B78 A;  4CH0 S;  5GAG U;  3GU0 A;  5HK4 A;  2RML A;  3DLB A;  4B9M A;  4ID5 B;  2KB2 A;  2KG1 A;  1VLO A;  1VGY A;  4C4W A;  2XUL A;  1CJU B;  2KU7 A;  2WSE C;  4LF9 F;  2J0X A;  3HZG A;  4K59 A;  1S79 A;  1X4E A;  1B3T A;  3H25 A;  5KFU A;  1XWL A;  5AT1 B;  4K4Y A;  3QFH A;  2K8G A;  3C66 A;  1T9W A;  4FF4 A;  1TL1 B;  2F40 A;  3P5B P;  1YRX A;  3R6G B;  1HBO A;  1UWA A;  2MY7 A;  3QJP A;  1FE4 A;  1RKJ A;  1N4L A;  3SDE A;  4O3P A;  1QAI A;  4RUA A;  1UKU A;  4KJI A;  1YWX A;  1HQ2 A;  1M1G A;  1U2C A;  1X5O A;  1RA6 A;  4DV0 J;  3EIC A;  1O8B A;  1QVG R;  2Z57 B;  4C11 A;  2V2Q A;  3I32 A;  4EBC A;  1WF2 A;  2DPJ A;  1JLA A;  3BBC A;  1HBM B;  2X3G A;  2BA9 A;  3JTP A;  4A47 A;  1EAY C;  1N36 F;  1JB0 C;  3GR0 A;  1AT1 B;  2J9C A;  5B0E A;  2M8D B;  3X3U A;  4C48 A;  3TAQ A;  1VQL S;  1WHX A;  2F7V A;  4IFY A;  3NGT A;  1K8A T;  1BQM A;  4G1Q B;  3Q8R B;  2VPW B;  1HNZ F;  3HHN B;  3U1L A;  3MM8 B;  1KHV A;  3GZ7 A;  5CCM A;  2BJ3 A;  4CT9 A;  3TAM A;  3HVW A;  4NA3 A;  1X7V A;  5HLF A;  3D3C J;  2RNE A;  1XNR F;  1LW0 A;  3I56 S;  2RU9 A;  1TMM A;  5FLX U;  2M9K A;  4JUZ A;  1Y3K A;  3RRH A;  2UZA A;  2GVZ A;  1FJG J;  1CUL B;  4DCJ B;  2WZ1 A;  3VAK A;  1S0N A;  1RTH B;  5B7W A;  2ZH9 A;  2IFX A;  2ILY A;  1GNK A;  4UOG A;  3CJS A;  2ZH5 A;  2AV5 A;  4QQB A;  4F26 A;  2XSJ A;  2DR9 A;  1KQF B;  4F4X A;  2KG0 A;  3G9C A;  2GJI A;  2ZH6 A;  3D6M B;  1FHT A;  3LA0 A;  2DNP A;  2KXF A;  2HW3 A;  5F8M A;  4P2F A;  3W8P A;  2Q43 A;  3LP2 A;  2CQG A;  5KFL A;  4ED1 A;  5HMY A;  1RQ0 A;  1QSS A;  3W5Z A;  2IM3 A;  4G1I A;  3I0S A;  1NDK A;  4LF6 J;  4CO2 A;  3DKD A;  1S6P B;  1MNE A;  1HW9 A;  3H59 A;  3A8E A;  1HQE B;  5E3R A;  4KIA A;  4DU8 A;  5HSP A;  4X62 J;  1D09 B;  3JSM A;  2NXJ A;  2HHU A;  1U1R A;  2BVZ A;  2WCX A;  3IWX A;  5IM0 B;  4NLY A;  4G1P A;  2I0X A;  4HEA 9;  2CQB A;  3LPY A;  4LRA A;  3HHL C;  4UOC A;  2OPQ A;  2BBE A;  4NYP A;  2X1B A;  2L9W A;  4YY3 F;  2A10 A;  2ZKU A;  5C42 B;  2KHD A;  4ECX A;  1XMO F;  4D3G A;  3GII A;  1FKO A;  1TUV A;  2JH3 A;  4LBH A;  3QRR A;  2BKP A;  4KH0 B;  2E7V A;  4J7C A;  2FJX A;  7FD1 A;  4ICL A;  1HNW J;  1XMB A;  2YKO A;  5CXT A;  1LOU A;  2FVR A;  3R5A A;  1U48 A;  4ECS A;  2OLW A;  4AL6 A;  4A46 A;  5LL6 d;  2PE8 A;  3SCI E;  1L3S A;  1RWK B;  1H98 A;  1TKT B;  4QIF A;  3OXF A;  3UDE A;  1GH8 A;  5KFF A;  4IG3 A;  4EO8 A;  2OSQ A;  3N6N A;  5KG7 A;  1CJK A;  4F2R A;  2B8Q A;  1NB2 A;  1EHW A;  2GIQ A;  2DNY A;  4FZV A;  4ZS6 A;  4KKO A;  2FB0 A;  1PAE X;  3KLI B;  2YPZ A;  1RHU B;  2E7X A;  4CLK A;  2HNZ B;  4ATN A;  3SV3 A;  4ZHR B;  2VFR A;  3M30 A;  1YRT A;  4OX9 J;  4A8X A;  2RQK A;  1WUU A;  4KTQ A;  4OI6 A;  1BQX A;  4L72 B;  3MOJ B;  4HTJ A;  3PRD A;  2K2P A;  1T94 A;  1U24 A;  1HFE L;  1JLQ B;  3UO0 A;  3GIR A;  4A48 A;  3NWR A;  4HYK A;  3M6W A;  1R8C A;  1NRK A;  1FXR A;  5HQL A;  3DYA B;  1QUV A;  1X5P A;  2E1A A;  1QTN B;  4PWD A;  2I9S A;  4ZP9 A;  3BYR A;  3MMB B;  3GWC A;  2D3O R;  1RKI A;  1HR0 J;  1FK9 B;  4F3Q A;  2MKI A;  2I5J A;  1IBC B;  5B0F A;  4NYO A;  2YWF A;  4GMK A;  3OD2 A;  2EG1 A;  1VK8 A;  1W7W A;  1H6K X;  1FFG B;  2R2T A;  5AE2 A;  2DHG A;  3DLK A;  4RW6 B;  4N47 A;  3DLE B;  3BSO A;  2C3P A;  2WRM A;  1RA7 A;  2CDR B;  1UFW A;  3EGZ A;  1FXL A;  1U4B A;  1P1T A;  1R43 A;  1LWX A;  2Q1L A;  3SV4 A;  4NLS A;  1L3V A;  2J7K A;  2UUA J;  5HMX A;  5D3G A;  3DLJ A;  2VHG A;  3GON A;  2KFY A;  5CYM B;  2GMJ A;  4I1T A;  2OPR B;  3IS9 A;  3GQC A;  1YJR A;  5KFT A;  3U1N A;  2BJ8 A;  4WFX A;  1LXJ A;  2HQI A;  1UP1 A;  4CTA A;  4KH1 B;  4DV5 F;  2MB0 B;  3R5C A;  4IQX A;  4J9M A;  2J8S A;  3UFC X;  1HKA A;  3N0V A;  4MK9 A;  1WI6 A;  1PIL A;  1H7W A;  3R7S B;  1SH3 A;  3BQ2 A;  3O5T B;  2F4V J;  4M5L A;  4DS4 A;  3FMB A;  3QSI A;  4PWU A;  4Q43 A;  2RKI B;  4B08 A;  1ITP A;  5KFA A;  2ERR A;  3SFU A;  2ADC A;  1NKE A;  3MFI A;  2ZC3 A;  1JLC A;  4B3T F;  4WJB A;  2KT2 A;  4QWB A;  1SL2 A;  1M5K C;  3GJQ B;  2V4J B;  4LF8 F;  2BYC A;  2VF3 A;  3MMA B;  3G96 A;  3KLE A;  3UNY A;  1X4G A;  4OYA A;  3NLC A;  3ELH A;  2D74 B;  5LOQ A;  1LWE B;  2KM8 B;  4LF5 F;  3ZZT A;  2HVZ A;  2A6O A;  3M8Y A;  4NXN J;  2DIT A;  4TY9 A;  4DFK A;  3KTQ A;  4NLX A;  1RHM B;  2IA6 A;  1TL7 A;  5JUM A;  4FKY A;  4LFA J;  4C7Q A;  2K3I A;  3D6H B;  7AT1 B;  5D0H A;  1CBK A;  3L7O A;  3UW1 A;  2YKN A;  3N4W A;  1VC0 A;  2AP6 A;  2D3U A;  3MPY A;  3NNH A;  4RNH A;  2VIC A;  2LFV A;  3EPI A;  4RU9 A;  5IS2 A;  2A3J A;  3NGU A;  1HI1 A;  3AHP A;  3K5P A;  1FRX A;  3W8G A;  4DF4 A;  4KPC A;  3IGN A;  4RW4 B;  3IBF B;  2HWT A;  4DJB A;  3DHX A;  1E6Y B;  2QFI A;  4X64 F;  1VLY A;  4QYZ K;  3H98 A;  4U8Y A;  3DLG A;  3DOM B;  4DBQ A;  2BW7 A;  1ZM9 A;  2D7S A;  1IBL F;  4LBI A;  1FDA A;  3GSD A;  4H4O B;  3GIL A;  2V68 A;  5CYJ A;  2DH7 A;  4DV3 J;  2CJX B;  3I96 A;  2DXF A;  3OL9 A;  4URQ U;  3FMW A;  1KQG B;  3HJV A;  4JYA J;  1LNQ A;  2R8K A;  4ECU A;  4B17 A;  3D54 A;  4KC5 A;  4ANC A;  1U47 A;  3V6D B;  3EWG A;  3NS7 B;  4Y34 A;  2XS5 A;  1FWL A;  5A8K A;  2F8E X;  1ZM2 A;  4AFF A;  1T9V A;  4DS5 A;  2AJ0 A;  4BWJ A;  3FDS A;  4F0M A;  3ZNU A;  2UV8 A;  4H4K A;  3DM2 B;  1X4D A;  3KJF B;  4E8U A;  1B0P A;  3LOU A;  3VGV A;  4OJ1 A;  1N34 J;  1AYE A;  3BGO P;  3ISZ A;  4NLO A;  2IBK A;  3N9U C;  4ITS A;  4O4G B;  3H5S A;  3W3S A;  3MEC B;  2FZK B;  2HLU A;  4KGK A;  3ZFV A;  5IV3 A;  3ULH A;  5CCL A;  4WK3 A;  3ZO7 A;  4YHH F;  3RTV A;  2FHK A;  1K47 A;  2MMY A;  5LJ3 Y;  3SCJ E;  4OIX A;  1TVR A;  4USK A;  5MLC V;  3WBZ A;  2BQR A;  4YR2 A;  2ZC4 A;  3PZP A;  2YPY A;  3QO9 B;  3LUY A;  5AXM A;  4KPY A;  1NM2 A;  1WOR A;  2XI3 A;  2JLE A;  4PYD A;  1X5T A;  2RDD A;  2IYG A;  3DOL A;  2UUC F;  4A8O A;  5ADZ A;  1FTC A;  3PHT A;  2HHS A;  3MD3 A;  4IO1 A;  2Y8W A;  4Q44 A;  1QE1 A;  1L5U A;  3PNI A;  3LP1 A;  3Q0A A;  3G8S A;  1KD1 T;  1ZM4 A;  2G0C A;  4ECR A;  3J7Z T;  4ZLL A;  3EGW B;  3R2D J;  4NL5 A;  3K8V A;  3D9B A;  2VPZ B;  3CJ2 A;  4B3O B;  1RWX B;  5AE1 A;  4DQR A;  2LEA A;  4N5S A;  4NLU A;  3R27 A;  1YVF A;  1HWI A;  2YQ1 A;  2FJV A;  1XR5 A;  4FBU A;  3MHY A;  2QYG A;  5GME A;  4WTY A;  3BO4 A;  3M9O B;  1JLB A;  3MM9 B;  4C8K A;  2QTW A;  1NAQ A;  3KLF B;  3CTR A;  4DPX A;  3M8P A;  2ZVS A;  2CNL B;  3UD5 A;  3MM7 A;  5ITH A;  2OD4 A;  5K9F A;  2YNG A;  1MLA A;  2VKZ G;  2HQ3 A;  2ADB A;  3G6Y A;  3GFH A;  1SVD A;  1I51 B;  2MGZ B;  2JC0 A;  4KHP J;  2CQD A;  3BKT A;  4N8O A;  2AJ2 A;  2EWH A;  2KZM A;  3WIV A;  1RT4 A;  5H9F K;  3G87 A;  4U7C A;  1U1P A;  1FRK A;  1K1Q A;  4BHQ A;  9RUB A;  3OTB A;  4ZP8 A;  2GHV C;  2DNQ A;  2IIH A;  3ICL A;  1WEL A;  2PMW A;  2UUB F;  2BM0 A;  3NP5 A;  1KR4 A;  3E3X A;  3V4M A;  1KVI A;  1LWF A;  5BYQ A;  4PQU B;  2QC3 A;  1DLO A;  2XHC A;  2DRB A;  4ZA1 A;  1U2F A;  2V94 A;  3I9Z A;  1SKR A;  1IM4 A;  4B3M F;  3R97 A;  4CM2 A;  1BC6 A;  3DRP A;  4Z37 A;  1V5V A;  2Y8Y A;  1T0T V;  4YB6 A;  1RWV B;  3CCU S;  3GYG A;  4BBY A;  3C6U B;  1U0S A;  4DV7 F; 
#chains in the Genus database with same CATH homology
 1I51 B;  5K20 B;  2H48 B;  2H54 B;  2P2C B;  3KJQ B;  3KJN B;  2XZT B;  1RHM B;  1RWP B;  2QLB B;  3NS7 B;  4ZVT B;  2H4W B;  1RHJ B;  2CNK B;  4DCJ B;  1SC3 B;  4ZVR B;  1RHK B;  2C2K B;  1NME B;  1F9E B;  2CNO B;  4DCO B;  2QL9 B;  3D6H B;  3P4U B;  3SIP B;  3D6F B;  1PYO B;  2HBY B;  4ZVU B;  3GJR B;  3R7S B;  3KJF B;  3EDQ B;  4ZVP B;  2QL5 B;  1RWM B;  2C2Z B;  1RHR B;  3D6M B;  3RJM B;  2Y0B B;  1QTN B;  1RWW B;  1RWX B;  2QL7 B;  3GJT B;  4ZVO B;  3EDR B;  2H5J B;  1I3O B;  4ZVS B;  1IBC B;  4ZVQ B;  1RE1 B;  2C2M B;  5IC6 B;  1SC4 B;  2HBZ B;  3QNW B;  3R6L B;  1RWO B;  2CNN B;  3IBF B;  1RWK B;  2QLJ B;  2H65 B;  1PAU B;  3IBC B;  3R5J B;  3R7B B;  4LSZ B;  2H5I B;  3GJQ B;  2CJY B;  2DKO B;  3GJS B;  4DCP B;  1BMQ B;  1GFW B;  2XYP B;  2C2O B;  2XYH B;  1RWN B;  2CDR B;  2HBR B;  1SC1 B;  2XYG B;  4JB8 B;  2Y1L B;  5IC4 B;  2HBQ B;  1RWV B;  2CNL B;  2C1E B;  3P45 B;  1QDU B;  2XZD B;  1ICE B;  2FQQ B;  2QLF B;  1RHU B;  2CJX B;  2H4Y B;  3R6G B;  1RHQ B;  3R7N B;  2H51 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...