3EDQB

Crystal structure of caspase-3 with inhibitor ac-ldesd-cho
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for executioner caspase recognition of P5 position in substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
total genus 20
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2008-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3edqB00
3D6FB 2HBZB 2CJYB 1BMQB 2CNOB 4JB8B 4ZVRB 1RHUB 2HBRB 2H4YB 2XZDB 2XZTB 4ZVTB 3R7SB 2H4WB 2H51B 5IC6B 5IC4B 3D6HB 3GJSB 2FQQB 1SC4B 2C1EB 1IBCB 3D6MB 3IBCB 1PYOB 1RWXB 3R5JB 1RWMB 2Y1LB 2XYPB 4ZVPB 3R7NB 4DCOB 2CJXB 3EDQB 2H5JB 3QNWB 3NS7B 1RHQB 4ZVQB 2CNLB 2P2CB 2DKOB 4LSZB 2H5IB 2HBYB 4ZVUB 2H54B 5K20B 1GFWB 3IBFB 2C2MB 2HBQB 2QLFB 4ZVSB 3P45B 2C2KB 2QL5B 3KJFB 1I3OB 1SC3B 2CNKB 1SC1B 2QLJB 1RWNB 1ICEB 1QDUB 3SIPB 1RHKB 2H65B 3GJTB 1RWKB 1NMEB 3GJQB 1I51B 2XYHB 3R6GB 2CNNB 2QLBB 3KJQB 2QL7B 2C2ZB 2QL9B 3R7BB 1RWPB 1PAUB 3KJNB 4DCPB 1RHRB 3R6LB 3GJRB 3P4UB 4DCJB 3RJMB 1RE1B 2H48B 3EDRB 2C2OB 1RWOB 1RHMB 1RWVB 1RWWB 2CDRB 2Y0BB 1RHJB 1F9EB 2XYGB 4ZVOB 1QTNB
chains in the Genus database with same CATH superfamily
2FGCA 3D6FB 2CJYB 4LRBA 1NH8A 2CKWA 1MN9A 3A4TA 4B08A 4JI8F 1QVFR 2AYEA 2D9PA 2HIQA 3A1YG 3LF0A 2G13A 2XO6A 1Y11A 2HQDA 2XGPA 3H25A 4HT7A 1A9NB 2PDAA 3KUEA 1G2EA 5IOLA 4NEZA 4ZVRB 4JI0F 4ED0A 4Y6IA 4J9VA 4TYAA 3R9LA 4IH6A 4YEAA 4EO8A 2HHPA 3KDNA 1FVSA 1BWVA 4IH5A 3PXGa 1F9FA 3UNGC 5EHHA 5KFWA 1R0CB 2M7SA 2CQ2A 2Z0GA 4NEYA 2KXHA 1TL1B 3R7SB 4B9UA 2CIMA 2CPIA 2DNMA 2HSEB 2HK2A 3MMCA 4DV3J 1JLAA 1CLFA 3I0RB 2F5GA 2ZVIA 4DL7A 1TVRB 1TL3A 2K1RA 4ILMA 1FKPA 5HL7Q 4K0KF 2M8DB 2XM3A 4PXBA 4B17A 1SH2A 2GFFA 3DCAA 4ECSA 4CLWA 3A8EA 3KWMA 3H5XA 3DOKA 4CO1A 2MQ8A 2AQ4A 2DIUA 1RB0A 1U09A 1X7VA 3SFGA 4KHPF 2K3IA 3R5JB 4ECWA 3C6TA 1RWMB 4I68A 5BJRA 3KLHB 4B3MF 4M63A 4LF5F 4O44B 2GIRA 1N5YB 3W62A 4G3IA 1C1BB 1SKUB 3ILOA 3KG1A 3TJ8A 4AE5A 3Q2SC 4Q43A 1TKTB 3TEHB 2R7RA 1HBMA 2OMOA 1KOHA 1UFKA 1NEEA 3KLGB 1PYTA 4KT0C 1LWEA 5E33A 3BJYA 3KDOA 3CVKA 4MIAA 2DNLA 2NCKL 3BH7B 4ZHRB 3NWGA 4DUZJ 2YPZA 4AL7A 2B6AA 1RSCA 1WDDA 2BRLA 3BSCA 3C66A 3FSXA 5CQGA 4DV5F 4LF7F 2VDIA 3MECA 1N48A 4FKYA 2XI3A 4F0MA 3IFEA 3MOZA 3QGIA 3MURP 3PKMA 4RUHA 1M1HA 4JI2J 5ADZA 4JI5J 5F8JA 2GHVC 3W65A 3A8IA 5HK4A 1BQMB 5HATA 2MPUA 4K4VA 4AUKA 4MK9A 3MDFA 2YQ3A 3C19A 4ZVSB 2DGVA 4O3PA 1Q16B 2WVFA 4NLXA 1WJ9A 1RT5A 2W2OP 2YWHA 3JTNA 2D3ZA 1IUJA 2GC8A 3QQCD 3R3TA 4LSNB 5K5MA 5THWA 5DM6Q 1RYRA 4W90B 1IKWA 3MFIA 2YNGA 1NKEA 4USTA 4F2RA 4ED5A 1QTMA 1CJUA 4LBPA 3H2LA 3GPAA 1S76D 2Q1LA 2Z8QA 2JNJA 3RB4A 4PUOB 3GWCA 4RUBA 3FFIA 1EP4B 2W24A 4I2PB 1SKSA 3CCES 1I51B 5HSPA 5HAOA 4P72A 2WTFA 2CNNB 1T02A 3M32B 1RT4A 3BQ2A 5E2QA 2VQFF 2CUYA 4MK7A 4A8QA 3D67A 4X62J 1U1RA 1YBTA 2D9OA 3AA8A 2ASDA 5HROB 4ZPCA 1XMQF 1VQ8S 3H5SA 1U47A 2D3UA 4DLGA 2AYMA 4KFBA 1RWUA 1HHSA 2DR5A 2UXBF 2N3OA 1EHWA 5C25B 2LKZA 3I0RA 3DLLQ 2J9CA 4I0WA 2K1RB 5DDQC 1N34F 1EIYB 3MTKA 3RAQA 1R8CA 2K7KA 2HVEA 3BBBA 4RLEA 2ZEJA 2EFVA 1U26A 2D3O1 3JQMA 3ZTPA 1YRUA 1U0HA 2O5DA 5J1NA 1AZSB 1XERA 4KV8A 1OY8A 2BJEA 5L9XA 1UTAA 2FHJA 4ED2A 2UVWA 1S9GA 2BANB 5A8KB 2MDAA 5AJ3F 1JWWA 1Q5VA 1L3KA 2DNOA 1RHJB 2E7VA 3GYNA 5KG6A 4FYXB 3W5YA 1U1OA 1XWLA 2GMHA 4LF1A 1N5YA 1RLCL 3EMTA 5F41A 4K5SA 3W60A 2PN6A 5CYQA 4A8SA 1DARA 2RT3A 3KLEA 2FY1A 3HO1A 2Z2YB 1WC4A 3LW5C 4P2MA 3GIIA 1LQ9A 3TR5A 1W2IA 3GTYX 4IYQA 4Q45A 3VAKA 1RHUB 2RF2A 3T6BA 2AMCB 2H1YA 2ACYA 3DI6B 3FCVA 2W9BB 2XI2A 3CUNA 1S6OA 3NL0A 3MECB 3RBDA 2HHHJ 2DIVA 3D1QA 3VAIA 1RTDB 2WK4A 3HVTB 4ECUA 3RRGA 4ZPAA 4U9RA 5JVHQ 3HP6A 3C46A 4S0MA 1VC5A 2YKNB 2MJNA 3W9IA 4MKYA 3K59A 3CJ3A 4DR1J 1OYDA 2K06A 2C1EB 3KMQA 1BE4A 1VR6A 2FB0A 1WKLA 2DH7A 2VBYA 2A2CA 1AUSL 2Z56B 3D3CJ 3LAMA 4YB7A 2XLIA 3JSMB 3HHLD 3QIPA 1RT5B 2WONB 5EX0A 1YDLA 5F8HA 2AV5A 2RRBA 3B82A 2QGFB 4H4MB 4OJHA 2Q66A 4QW8A 3O44A 5JXSA 4WIIA 1K47A 4NLQA 2Y1LB 5BR8F 1FI4A 4NLWA 4UUWA 4DOZA 1Q8KA 1ZOTA 4ZITA 2CQBA 3D28A 4USUA 1CS4A 3AJ2A 3EDQB 2N7CA 2C2DA 2HMIA 2BJ9A 4NI2B 2PFDA 3HFKA 5LL6d 3B6BA 1RHQB 2F9DA 2CXEA 3BF4A 3JQKA 3PZPA 4YN3B 1VOMA 1VRUA 5HBMB 4YP3A 1CJKA 1P27B 2BE2B 1J5EF 3OBIA 2WVBA 3A12A 1NK0A 4WFZA 2HRTA 1REVB 1R0BG 2XBPA 3GR1A 3NGSA 3UVJA 3OHBA 3W66A 5DDRC 2NR0A 3J80Y 1U2FA 3PCOB 4RWWA 2HHWA 5H1SV 5L8RC 2FLNA 1NK7A 2J7WA 3DYAB 3K5NA 4K50A 1TFYA 2EKNA 2A0FB 2PMWA 4I6WA 4FXVA 2VBZA 5I3PA 2P5VA 4DV1J 3FZ2A 4IOBA 4QWEA 4NLRA 2UV8A 2BJ7A 2ZBRA 4CCHA 4B3SJ 4KO0A 4JI0J 4DHVA 3DRPB 1D3WA 4DL5A 4P7VA 4DL6A 1DTTA 2ZOFA 4OIXA 1S9GB 2M88A 3KJFB 1A0OB 1I3OB 1RAIB 4I1TA 3SSRA 3WBZA 1JJCB 3OXLA 4ZP8A 2JLGA 5BYQA 2PT0A 3EE3A 4FVMA 5CZXA 3ET6B 4ECZA 2ZH4A 4DX6A 4U7UD 2NLWA 3EICA 1SPBP 1AROP 1C4AA 2OO4A 4K0KJ 1RAEB 5KG0A 3BGRA 4IDKB 4HR2A 3GJQB 2E5GA 2MQOA 2M2BA 3HX9A 3R6GB 4KE5A 2GVDB 3V6DA 3TZXA 1Q82T 5HVFA 1UWBA 1NBEB 2OUGA 3DI6A 1U6BA 2V69A 2DHHA 4CH1A 3P5BP 5KFVA 3SYZA 2L3MA 3OLAA 3M2VB 1RZMA 3LP0B 2A18A 3L4BC 2E5LF 4ZPVR 2I5JB 2W7OA 3CC4S 4I56A 1RBLA 1K0VA 4TKTA 3LA0A 2HGLA 4LSLA 1FWKA 1W25A 1X5TA 3IC1A 5DQIA 3BO2A 1WACA 2B5JA 2AWZA 5C24A 3QIDA 4DX5A 4OI2A 5CAAA 4NLOA 1L3SA 6FD1A 3GYXB 1RE1B 1NUEA 2DXDA 4WE1B 3JSMA 1URRA 2DEIA 3TAPA 4Y00A 3IBWA 2RIJA 3M8ZA 4DV5J 2F4VF 2YNHA 3IGVA 4H4KA 4OZ1A 1IKVA 2E7XA 3TARA 3K17A 4YB6A 2EG1A 1ROFA 2MQPA 1NHKL 2G2YA 3NKYA 2WB4A 4HT5A 2HNYB 4MAKA 5DS7A 1N88A 2ZH3A 3CCJS 4A8OA 1AB8A 3O1LA 4O4GA 3T41A 5J2MB 2BJ8A 3G8TA 1CQNA 1TTHB 1J27A 1RT6B 2YH1A 1M1KT 4C8MA 1NZAA 3DLGA 5A8WB 2EFPA 7AT1B 1CJKB 1IXKA 2BE2A 2RAQA 2JLEA 2ZE2B 4P7TA 4RW9B 4Q5VA 3F41A 3I31A 2UUBF 2Y9HA 3LPYA 3EWGA 1XR7A 3AOAA 2MQNA 3OXFA 4XAKA 4Y2IA 2IVFB 2IBKA 3PO5A 2AX0A 5E3PA 5A0YB 4C8LA 2H3EB 3HVWA 3M8PA 1OYEA 4DL4A 4ZVTB 3MGJA 2B6AB 1N36F 4RNMA 4LF4J 5SUHA 1L3UA 3VAHA 5GAEI 2GV1A 5J2PB 1ZM9A 1RLDA 1OY9A 3BS9A 3I9ZA 1PILA 4O4RA 1T05B 2JEGA 3LTOA 4CLUA 1HPZB 4KPCA 2QA1A 1X9WA 3R5AA 4PQUA 4RW8B 2ZD1B 4RNHA 2BW2A 1QSLA 1C1BA 3DMJA 1BQMA 2E1AA 3DHXA 2UXDF 2C3UA 3B4DA 3KXDA 4HDGA 4PABA 3GMGA 1KLNA 3HHNB 1TZ0A 5KFFA 3CCUS 1VGYA 2OI2A 2KZZA 1RADB 2MQQA 4P6QA 2KG1A 3CT9A 1X4CA 1U7LA 4XPCA 4TQSA 3ZFVA 1U0SA 2HFNA 2OPSB 2HAIA 3RUBL 4URGA 1OPZA 2AKWB 3G6YA 2GVDA 3L3CA 1ZS6A 1B70B 2W2QP 4N8NA 1Y3KA 2LEBA 2CQCA 2XMVA 4GKKJ 4LFAF 2B51A 4CRJA 1VQNS 4G1PA 1BQNB 3C6UA 4AXIA 4V19J 4V19X 1GMWA 1KC8T 2V0NA 3D66A 1WI6A 3Q8VA 4OYMA 1Z2ZA 4N41A 3EM1A 5KFYA 4LIRA 1S99A 3JAMU 4J9NA 4QWAA 2BABA 2IM3A 3MM9B 1IBKF 2EKYA 2F4FA 4OYOA 3J7AN 4KIAA 2ATCB 1IKWB 2GIQA 2ATLA 2VBXA 3BSAA 2D1CA 1M5KC 3D6TB 2XB2D 4HKQA 3GZ7A 3PM9A 4NRUA 3V5RA 4HACA 3PJWA 4OI4A 1MMNA 3SBMA 2YKOA 3PX6A 1XMOJ 2OGUA 3ZZOA 1S6QA 3J7YU 1FFSB 2CNKB 4DPYA 4P2FA 4KHMA 2OFHX 3NGDA 2GJFA 4J9PA 2VG5A 1RT6A 4ZIVA 2KT2A 2MZ1A 2YQ1A 2ROGA 4ZCKA 5B0BA 5AE3A 3N5BA 1S1XA 2AJ1A 2DGUA 4F25A 3KK2B 1QLNA 3M6VA 3PYDA 2COLA 2HQIA 4IKAA 4PWUA 1S10A 1L3VA 4JI5F 1F3FA 5M2RA 4QIWD 5E3RA 1YHQS 4KY3A 1HD0A 5DDPC 2FHOB 4KQZA 4LUBA 1UJ5A 4L72B 4U8YA 4RW4B 4B02A 1T9TA 4BCAA 4XIUA 3Q8QB 1KHWA 2CQHA 4J91A 4M95A 2OSRA 3TX8A 1PC5A 2IAJB 1MWQA 2MKJA 2NUUG 1OSDA 1JQGA 2BANA 2ZITA 1PBAA 3ZTRA 4ZN3A 5A8KA 3TYTA 4E98A 2V4RA 3MMBB 2Y8YA 3R1LA 4GC6A 7FDRA 2GVZA 2AEFA 3O5TB 2MTLA 4O3NA 3VAFA 4OV6A 2ZH8A 3QO9A 4X4UA 1RT3A 2JDJA 2L9WA 3EZ5A 1JLQB 1FKAF 4HI1A 4B3TF 1ELOA 2K7JA 3KG4A 3CC2S 3CMQA 4LJMA 3BGLA 4CTAB 5KFOA 3NCPA 1JXLA 1WC3A 4LRFA 1M5VC 3HD1A 4NLVA 2ADBA 2CJKA 1NSAA 1DQAA 2CZ4A 3THTA 4Q44A 3KLVA 2E29A 1EKRA 3CCSS 3PW5A 4W92B 1B0TA 1S6PB 3IN5A 1N52B 1X8DA 2QT7A 2FLLA 2BQRA 4MMOA 2FHJD 3TUIC 1X31C 3VCDA 1U1MA 4WU2A 4R5PB 1XMQJ 4X4PA 5DG7A 4JI3F 2RH3A 4LT6A 3DOLA 1IQZA 3KNAA 4DQIA 2Q79A 4E0DA 2VU5A 2U2FA 2VODA 3UCGA 3CC7S 1FFWB 2ADCA 4M5DA 4ERDA 2ILZA 1JLBA 2ALZA 5D0HA 1S1WB 2DHGA 5IC6B 1EJ7L 2WONA 8AT1B 2F3JA 1WNEA 3QT5A 2V8DA 3UVJB 3AJDA 3HM9A 1O8BA 1I94F 3DDIA 2FQQB 3GJSB 4CZCA 2WSEC 5KFHA 3G96A 1HNIB 3M8QA 2R9LA 1JNZB 4F4KA 2OTJS 2E1RA 3CXCR 2BOAA 3H8YA 5G4DA 2ZBPA 4X4NA 5AXMA 5B0DA 2W25A 4RWXA 3W9JA 4OI6A 4ZPTR 4OL8A 2FGOA 4C0OC 1NPKA 1SB6A 1U2CA 1QSYA 1MG7A 1VQ4S 4WK1A 3QFWA 3Q86A 2BUNA 2E5IA 1RXOB 2H5JB 2PA3A 3QNWB 5HP1A 1S0OA 4B9LA 4ZPBA 3NS7B 4OYBA 3T5LA 1KLMB 1ZPWX 4WP3A 3FSYA 2G0CA 1BQXA 1NDKA 1WWHA 4RUCA 4YB5A 4DQQA 1SXLA 3RB3A 2Y1JA 4DUTA 3MM5A 2XS2A 3VGUA 2VV5A 4C8ZA 4DJBA 1HBOA 4Q2LA 4BBYA 3ZNUA 4PG5A 3BPSP 5ETQA 2PEHA 3BYPA 1OMSA 1XTZA 5DLGA 2J8SA 4IFYB 1WOSA 2XY5A 4EU0A 1K44A 3LP0A 3EYZA 4DQSA 1T94A 2BXJA 2DJWA 4CM2A 2POKA 2X3GA 1GXLA 4CLSA 4M5MA 3UDEA 1QM9A 1UCNA 2AD9A 2B4UA 2OEMA 3AD7C 1IKXA 3T1YF 1WC5A 2HNDB 4HTIA 2Y8WA 4OZJA 1UJ6A 3R2DJ 3N79A 1MROB 1UPMB 1CG2A 3NGRA 5D78A 4UOGA 2MEWA 3PHEA 2KXNB 2J6UA 1FRMA 1U48A 5KFTA 3JYTA 3SIPB 5C42A 4B3OA 1HWLA 1KQKA 3I32A 4DG1A 2DRDA 4A8XA 1C4CA 1NMEB 1KP6A 3G87A 3I56S 5H9FK 1HBUA 2DNNA 4N77A 3THPA 3K5MA 5LMNJ 1N33J 3ZZZA 4NA3A 4OI1A 1AXQA 2VBWA 1S1VA 2LU2A 4M5DB 2IY5B 1IR0A 5D3GB 2VJVA 1WTFA 3FMWA 1OWXA 3H98A 2XCAA 2RDJA 1T3OA 3VAGA 3CJ4A 3EJMA 4MIBA 2MYFA 3FCWA 4F7VA 1T0TV 1BHNA 1Q0NA 2IRYA 2FJEB 2Z2MA 4BWJA 4LFCF 2NZ4A 2PEBA 3DRSA 1SCJB 4DUZF 5E7OB 4F3QA 3VHQA 2E9ZA 3KYLA 3TP2A 2H48B 4EBEA 3ZXWA 2L9NA 2VFTA 5KFJA 2GQ2A 3KHHA 2ZWOA 1T9XA 4OLOA 4QU7A 1VJQA 4EUVA 1L3TA 1YG0A 4JV5J 3UN5A 1F9EB 4JI8J 1O5JA 1EX8A 3K5LA 1WF0A 2FLOA 3GSDA 3ISND 1VBYA 5FDLB 1IBKJ 4PG7A 1AT1B 1BY9A 1ULRA 4CLZA 4AFFA 4DV7F 2VPWB 1KS2A 4OZLA 2XY7A 2XS5A 3M8PB 3OFGA 3HK2A 1RJJA 4QR1A 5B08A 2ZZNA 4Q0BA 2A6OA 5L46A 4L3NA 2CVEA 3FDSA 4O0NA 1P8GA 3MM5B 2I1RA 3CJKB 3AD9C 5DGAA 1NM2A 2R7OA 2I38A 3G2XA 2QA2A 4DR4J 3EGWB 1SUQA 4EBDA 1H2UX 3OQ2A 4A46A 4YDDB 4A8KA 1JJ4A 4XDCA 1WDTA 1LW2B 2HZAA 2HQ3A 2MZJA 4WWSA 3FEYB 1NB7A 1VDHA 1U6ZA 1PC4A 2AZ3A 2F8MA 1VLOA 3HDSA 1YJ7A 3CJ2A 4B9MA 2CQ4A 3LO3A 1IJFB 4JI1J 2JEIA 1VQPS 3BO3A 3MHYA 1SQEA 2LDIA 2IJFA 2B7BB 3AHPA 4ER8A 1M5PC 1XNRF 4WU3A 1D9DA 4PWDB 2GAHC 1XEZA 2OPQB 3NNHA 5DZ6A 3GLJA 2UUAJ 4FN5A 1YBAA 3QJPA 1XJWB 1XMBA 2BJDA 2MKKA 1EETA 3WX4A 3JYTB 4J9MA 4ECYA 4RU2A 2JRSA 4LVNP 4BLGA 2FHKA 1HNZJ 2YWFA 1SVDA 3ZTSA 4ES2A 4JI4J 1IR2A 3RBZA 4CDIA 2LLZA 2WW8A 3SCJE 3HXMA 4LF7J 4AQYJ 2HVDA 3MEDA 1HI8A 2PSZA 4G6VB 4PQAA 2YWEA 3W2WB 2MGZA 2FVPA 3AY0A 3SQGA 4ID8A 2FIUA 3SSSA 4OJ3A 1KQSR 1HA1A 4DV4J 5KT5A 3V81B 4H4OB 4B3RF 2KH9A 4ZVUB 4RW6A 4IQMA 1FKPB 3UWTA 1GFWB 3I55S 2M70A 3G8SA 1UPPA 1WHVA 2YWWA 4QR0A 1JLFB 2WCXA 1HHTP 2MZQA 2HWHA 2D41A 2JJ4D 2PMHA 2W4CA 3LP1A 3IR6B 2CPEA 4NPOA 4PPDA 2W4PA 4ANEA 4ECRA 1FNXH 3H4BA 2D74B 5IT4A 3CJ8A 5GAHI 2QL5B 3LALA 3MMBA 4AT1B 4O44A 5KFKA 3QMQA 2DNQA 1EB0A 4Y3CA 3U1LA 3Q23A 1WF2A 2RILA 1TKTA 2CZVC 2DEJA 3DHWC 4KHRA 4QR2A 2J0XA 3Q83A 4Q7AA 3F0NA 4LFAJ 2I9SA 4C97A 3OV7A 5EN1A 2E1CA 5A76A 1M90T 2Q6CA 4OYXA 2R2RA 2ASYA 2FZGB 3IA0A 1LWCB 3AODA 3UCUP 1NJXA 2JVOA 4DN0A 3EXCX 5KFDA 1NDCA 1OPIA 2KFYA 3VGSA 2FLPA 3MPUB 5HMXA 2WBMA 3MAHA 3LANA 5D8HB 2G4BA 1S6UA 4ZA1A 4QPTA 3PW4A 1FKOA 3P96A 3C15A 5IV3A 5H9EJ 3MXHP 3MZIA 3K8WA 1P9YA 4DR2J 2YX7A 1LW2A 3CW2C 3G82A 2GHWA 4YY3J 1IBLF 2V9KA 3I96A 2L41A 1VBZA 4GKJJ 4TXSA 1HBMB 2LEPA 1RKJA 2X7IA 3HHDA 4FVCA 5GAGU 3OVSA 1ZM4A 2OPRA 5ETNA 2AJFE 1HQUB 1N8RT 4WZMA 4J5OA 1VBKA 5J2NB 1K1QA 1FRJA 1FVQA 4QIEA 3UFCX 3CCRS 2YNGB 2OD4A 2BBEA 5A8RB 5A2QU 3WX8A 2JX2A 3LWLA 1APSA 5ETKA 1SH0A 4P75A 2LECA 4JYAJ 2UXCJ 4A4JA 1UW9A 1YJUA 2Y0SD 4KR0B 3FSIA 3A13A 2ZOMA 3Q8PB 3OL9A 1KSPA 4KYZA 3MEGB 1KOOA 1SJQA 2E66A 3ENQA 4QOTA 4ILRA 5KFAA 4F4ZA 1R0AB 2KYZA 3VZIA 3GB0A 4PRFA 1V5IB 3A8JA 3US5A 1WG5A 1HWJA 2FJBB 3WQPA 1TMMA 4ECTA 4AL5A 2HYIB 1B0VA 2V63A 1AFJA 1HMVA 3W2VB 4DR1F 1JMTA 3IRXB 4PUOA 4KH0B 3X3UA 5B0GA 3TZYA 1HBOB 1WD6A 4YR0A 4B3TJ 3W63A 1B7YB 2ABYA 4ES1A 3TVKA 2KDOA 2X51A 3OFFA 1RA7A 2KN4A 5GAEU 2J8AA 2YKQA 4UQGA 3MD3A 1N0VC 1ZAWA 3HULA 2JSXA 4IG0A 2HLTA 4P9SA 4U8VA 1UWAA 4ZP7A 2VB6A 1IKYB 4OYZA 1Q5YA 4F4AA 2ZZTA 1RWXB 4PPZA 1HWIA 1R8HA 3UW1A 4CH0S 3R7NB 4X65F 4YHHF 1HBNA 1RA6A 4DSEA 1ZM2A 1RT7B 3QPIA 4URQU 3HFVA 2BR0A 1B99A 2W2NP 3U7JA 3OJUA 1TFWA 1U0HB 1K1SA 2O01C 1R89A 3DGPA 4TLRA 4IOCQ 1ZYQA 1FJ7A 4NL5A 2ZDOA 4ZJOA 2UUTA 3W8GA 2W8LA 4KB7A 4RBTA 2VG6A 2DGQA 3DLKA 1F3VA 1JKHB 1P9QC 2AJ0A 1NXIA 3MAAB 3UD4P 4ZLPA 1DTQA 4PYDA 2ZFHA 4IFVB 3ZTOA 4WFAQ 2AIRB 3BKFA 3ETMA 2MXYA 3HHEA 5F0UA 3PX4A 2XMJA 4IH7A 3CJRA 4X62F 1N32J 4QBUA 3M2RA 3QT6A 3RG6A 2DNPA 4ETXA 3FKBA 5LJ5Y 1B7FA 3QIPB 2ZWPA 1N54B 3FZBA 3IAS9 2WSCC 3MM6A 3N01A 4O3RA 1CEZA 2V50A 2PIIA 1HI0P 4B9TA 4NCBA 1SJFA 2HWIA 2VPXB 2GGPA 1Q4RA 3NY0A 4CIOA 2UV8G 3V4IB 3DOKB 3EVWA 1V6HA 2F63A 4MJKA 3C3LA 1LXJA 4I2QB 3C6TB 2OTLS 1GEHA 2V4JA 4ED3A 2BOPA 4RO0A 3TEGA 2HURA 4UOCA 3VQSA 1MSWD 1VRUB 3T1HF 1YK9A 2CQ0A 3S7RA 4DEZA 4EYIB 4FPIA 1TL7A 1X9SA 1Q1KA 4ZK7M 3IM8A 3T5HA 4EEYA 1C2PA 1M1GA 4RL1A 1F5BA 3DRSB 1ZZNA 4IQXA 4P74A 2HRYA 5IV4A 2XY6A 4LF2A 3OHAA 1F9HA 1KD1T 3NMAA 2KYXA 3GP9A 4G1IA 2KRRA 5K8NA 3R6LB 2IVYA 3H0PA 4KO0B 3MUVP 1FA0A 4X4VA 1KVJA 1GX5A 2NZCA 2VASA 4G1QA 1S59A 1R6YA 3QFHA 3QJLA 1G7CB 4MKBA 2E7WA 3BDEA 1HKAA 4QYZJ 1JJHA 2C2OB 3IP0A 1IKYA 1F5AA 2OLWA 5C2CA 4X4TA 1WHYA 2CDRB 1VRTA 4M5HA 3W9HA 4LSNA 5KT7A 1X0FA 4ILLA 2DCLA 3DYAA 5JUMA 1WG1A 2CWKA 4WTYA 3BGRB 3MEEA 2QZ8A 2XSJA 2MLZA 4RBVA 2DXEA 3MCNA 3A3OB 2UUBJ 2UVUA 3BKTA 4FXWA 2O67A 4NLUA 1IQTA 1H6KX 1S0VA 1WC1A 4JB8B 2JVRA 3Q2TC 5B7WA 2ROPA 3H90A 3SDEA 1N36J 3ET6A 1N6QA 3HSDA 5KG3A 1QSSA 2DGTA 4JI7F 2MKCA 5CYJA 4NYPA 5EGYA 4U6PA 2XGQA 1XK8A 1I5OB 3HT3A 2KL8A 3KHRA 1N32F 5C5JA 4A8MP 1XR6A 4WFNQ 3CNQP 3PRBA 4PXEA 2CA9A 4M8LA 1VIOA 4F0KA 2ZH9A 3HZGA 2BJ3A 3J80U 1V5VA 3HZEA 2YNHB 3CD0A 2FVSA 2OJ3A 3BV8A 2FTRA 1XBWA 4MT1A 3V6JA 2QG9B 3AOBA 3NS5A 5I3UA 1RTJB 1JLGB 3MCMA 3UR0A 1QE1B 1AZSA 3LP1B 2I5JA 1DQ8A 2AT1B 1X5SA 1AA1B 4QJVA 4O23A 1RABB 2R7VA 4P73A 1TELA 3DLGB 3DM2B 4LR8A 3DU5A 2XMAA 1C1CA 3C16A 3SXLA 5HROA 3IWNC 3D1OA 3KK1A 2RRNA 2VONA 4IR9A 2AHOB 3ILIA 4ZCIA 4WBFA 4GKKF 2GCFA 2HK3A 5KFLA 1ITPA 2XNQA 1NKBA 4RNOA 2CNLB 3RBEA 5A2QY 5HLFB 1IKVB 4RBUA 3J81j 3CJQA 4LF9F 1FJGF 3K5PA 4C6AA 1B3TA 1C0TA 2X1BA 1X4AA 1Y3JA 2UZAA 1K8AT 1Q95G 2HNYA 2F4VJ 3H59A 3W61A 2R7TA 2DO4A 1R8PA 1ZAXA 2RUSA 3MEKA 3IWXA 3OTBA 4GRSA 1BD6A 1T9UA 4LR9A 4AQYF 3BDPA 2HRUA 1XIQA 1S9EB 1SL0A 5E5NA 5EUHA 3GU0A 1SL1A 4NXNJ 4KGXB 3KUHA 1M5OC 5GAGI 3CJ5A 1Y5IB 5EWEA 4NCAA 2IVMA 1M5SA 1NDPA 5E0OA 5BXIA 2OFGX 1SKWA 3M2UA 3BKUA 3I5AA 2GO9A 2O3DA 4X84A 5H9FJ 2MZRA 1CC8A 3CD5A 2P8IA 3FRZA 2IM1A 3ITHB 4YR2A 4OX8A 1BWEA 4NZ0A 1YKWA 1NO8A 1S1UB 1YX2A 1U1QA 1VBXA 3W5XA 3WIVA 4PXCA 3UNYA 1HR0F 2IMWP 2ZNYA 2YBVA 5CA5A 3O3LA 5HQLA 2NXEA 2QLXA 4YS2A 1TK8A 3I4PA 1QDUB 4I7FB 1OY6A 2CYYA 5J1EA 2QLWA 3GJTB 3J81Y 2V8GA 4CT9A 3V4IA 2NUHA 3EUNA 3KJQB 2W01A 2YX1A 4V1Ak 1VI7A 1PBUA 4J9LA 1X5PA 4C8NA 4UT4A 4EO6A 3IR7B 2QTWA 1HIYA 1NAQA 2G9OA 3MM9A 1HNXF 4CNZA 2W9CB 4ED7A 1YJ9S 3WC2A 1UFLA 5E3CA 3N6LA 3V6KA 3UD5A 3P4UB 2XMKA 2N4DA 3EGVA 4OV1A 2R2UA 3RGIA 1BQNA 1H73A 2B9YA 3C6UB 5B0CA 5L38A 4LFBJ 2A6MA 4WIQA 2RQMA 1WEXA 1NU4A 2CADA 4ZKAA 1WHXA 3NAIA 4HI2A 1QAJA 1RU1A 2LA6A 3VGTA 1RAFB 2WRMA 4UZBA 4L3KA 5L1LA 1REVA 4PZVA 3G6ES 3VZHA 2AYBA 4ZVOB 1LK7A 2LDYA 4PEOA 2BKOA 1VQ9S 2FDNA 3C2PA 2FJDB 1NK5A 3A3PB 3G8QA 1PJ7A 1E6YB 1U25A 1PCAA 2YNFA 4YUDA 4Z2XA 2C2EA 2DPJA 2KFNA 2YX4A 4ZVFA 3T3FA 5AXNA 5DQHA 2LXIA 2E5LJ 2HBRB 5D0RA 4XK8C 4C9DA 2MZTA 3I5CA 3BGOP 1T9WA 5E41A 1XMOF 3M2VA 1RAAB 1R7IA 2JLFA 3BR9A 3FBCA 2FYXA 3F56A 4YFUA 2BRKA 1T3NA 2UVVA 1YGYA 2E1PA 3QSYB 2B5JB 5D0EA 4NLGA 2DXFA 1PG5B 3BQ1A 2Y1IA 3AH6A 2XMWA 4CTAA 2EW9A 4IDKA 3UCZP 1OS5A 1E6VA 4RPFA 2FJXA 2BV3A 3DC2A 3W1YC 1VFJA 3DRRB 4ED1A 2D69A 2UU9F 2C3MA 4EZ6A 1UWBB 2XSFA 2RVJA 4USHA 4J37A 1U2RA 2V68A 3N28A 3FEZA 3OR2A 5ETPA 4ZVPB 2C3OA 2IM0A 4DLEA 2VG6B 1KQGB 3DRXA 4USJC 2V2ZA 2D3OR 4PCQA 4ZP6A 5J2MA 3NNAA 1I1GA 7FD1A 1IN0A 1PKUA 1YITS 3OFHA 4OX7A 3M05A 4IG3A 5C24B 3AXMA 4DS4A 1T9YA 4ECVA 1H3DA 3M2RB 4UQTA 4WE1A 1OSCA 2QRRA 2CG4A 2LQBA 1G3OA 4OX9F 5KOXA 5L9NA 1CPZA 3R5CA 3L7PA 2B7CB 3ENAA 3R5BA 1SL2A 2QIFA 1S6PA 3TNVA 2FVQA 1HWUA 2NS1B 3O6QA 3QGGA 1LFPA 1QUPA 3IBFB 2Z30B 2AU0A 1SJRA 5GMKa 2YTCA 2JL9A 3MUMP 2HZCA 4M5KA 4O4GB 2EFNA 3CDEA 1CBKA 4ANDA 1RP5A 2JC0A 2DD8S 3OFEA 3QT8A 2N7YA 4A48A 4DI6A 2I0XA 1TKZA 1PSDA 4LBIA 4H54A 4ZCMA 1UZHA 5KFMA 4X65J 2RQKA 3ENVA 1HNVB 4YHHJ 3DGVA 3MD1A 3L09A 3VGVA 3WDOA 1YBUA 2ZE2A 1S5ZA 4WPAA 1HQEB 3AFGA 3I0SA 1HW9A 4ECXA 4QYZK 1SC1B 1TL7B 4NCGB 3LH2S 3SEOA 3OJSA 3OTOJ 2HHUA 1TP7A 2FHMA 3QGHA 3WIUA 3CTRA 1TKXB 2CPYA 3NEKA 4NLTA 3TZWA 2UVRA 2HAFA 3IS9A 1VIXA 4OHXA 2KHDA 1LWFA 2H65B 2GQCA 3MOJB 3HVAA 3OXGA 4ZP9A 4CO3A 1I94J 2NPIA 3PYGA 3H7HB 4XO0A 4NLPA 5U47A 4ZJLA 1LV5A 5B0AA 3K57A 1KTQA 1WI8A 2HEKA 3ZO7A 2ZM6J 1U1LA 4KSEB 2WOMB 4HLBA 3JTPA 2R8KA 4JI3J 2KZMA 4DL3A 4FBTA 1WG4A 4GVBA 5DZ7A 4KKOA 2LP4A 5K8OA 5IS2A 2CQGA 3ADAC 3W64A 4DCPB 3GONA 4O3QA 1DBDA 3AAWB 3DXSX 3GJRB 4DCJB 2YXLA 2Z4PA 4F02A 3VR1A 3LUYA 1CQMA 2QE5A 3DDNA 2DNYA 2VC0A 4FF3A 1VQMS 1UP1A 2HNDA 2MKSA 4JV5F 1T11A 1UL3A 2APOA 4AD6A 3GILA 3RB6A 1D8YA 2KB2A 1RTIB 3ICLA 4HACB 2KI2A 2BE7D 4OYIA 1T03B 1YJVA 4LR7A 3DLHA 1PYSB 3T1HJ 4TY8A 1J5OB 2AEJA 5I3UB 3J7Z5 1S6QB 1DURA 1TR0A 2J76E 2RE1A 4W4MA 4L73A 1IWGA 3HHLB 4YQWA 2CQ3A 3PO4A 3RW6A 3LGNA 5ETOA 1SI9A 4JOUA 1Q79A 4ICLB 5T7LB 3KK3B 1VQ5S 5IQ6A 1BGXT 4C3KA 3MR7A 4KGKA 3L9ZA 2W1BA 4MFBA 1VISA 3E01B 3OR1B 2KXFA 2GW8A 1H2TZ 4C48A 1MROA 1TL3B 2BJ1A 3NBPA 1CJTA 5BYRA 1D1UA 1CJVA 3SQOP 2XZDB 4M5GA 1X4GA 3U1MA 1C0TB 5CD4A 1B64A 2H51B 5IC4B 2GJIA 3ZZYA 4Y2KA 4QZVB 1V9OA 3ZZRA 2XNRA 3RAXA 4IO1A 1TKZB 2M3DA 2OAUA 1C1CB 3C16B 1GTEA 2AYGA 3H4DA 2YKMB 2N82B 2CWXA 3HPOA 1JLAB 3UDCA 1IVZA 2R7UA 2V67A 3GIJA 4HHUA 5IZHA 1FXRA 4C3MA 2N3LA 3HMJG 4F67A 2WHOA 1NH7A 5JJBA 4C98A 3M9NB 4USWA 2DVIA 3OL6A 4K4YA 2VPYB 2XS7A 3K7RA 3K58A 2NSBA 2RJZA 4NMLA 2BKNA 4N76A 4KPYA 1UMJA 5CH7B 4DU8A 3C8YA 3OTDA 3HI9A 4USIA 4JI7J 2PI4A 1NSPA 4B3RJ 3CSKA 3JXOA 5E3AA 1WC6A 3G9CA 2DKOB 4RUAA 5J1EB 3GYGA 3DOLB 1N5VA 2HFUA 2QV6A 2XHCA 2H5IB 3M1VB 1R8AA 5HMYA 2Z2LA 4K4XA 3QYYA 1TK0A 3BR8A 6AT1B 3QRQA 3PVXA 5HJXA 4J9UE 2AGPA 4Z7YA 2VQFJ 1MNEA 5MAOA 2WVCA 5L39A 1Q8LA 1MN7A 5D0GA 1TK5A 2NYIA 1RT2B 4LFCJ 2XLJA 3KLFB 1Q78A 4WYWA 4DSLA 2P9EA 4TQRA 1S12A 3RB0A 1NSKL 3G71S 4EBCA 3OUYB 1TU0B 3FFIB 2H5EA 2MB0B 1HNWF 1EETB 1RU2A 2HS4A 2KVQE 4M5NA 1HL6A 3AXKA 3PYEA 1VQYA 2W9AA 2HNZB 4DDFA 3TQ1A 1RT1A 3CMES 1JLBB 1TUGB 5B09A 3H2VE 1TV6B 3W5ZA 4RU9A 1HWKA 2HGMA 3UR3C 2EXUA 3WZ0A 2KKHA 4M5IA 1Y4ZB 5HQ8A 5AJ3J 2YKPA 3BEGB 5C7PA 4ED6A 5HP1B 5HMWA 5FD1A 5J2QB 2G2OA 3ISNC 3DDKA 3KKFA 2NYHA 4JI2F 4KGZB 3EZUA 1NLKL 2ZVSA 5F3ZA 3TW0A 4CYUA 4DPUA 1XNRJ 2QFJA 2LYVA 2R4FA 3R7BB 3ZTQA 1VQLS 4DV0F 2M8HA 1X5OA 1T8EA 1RBAA 3MR6A 1JLFA 1NB2A 4X2BA 2XO7A 5FJ4A 1NPRA 3IM9A 2QMXA 3N5FA 4CLPA 1F5CA 1DLOB 3NS6A 1HFEL 2DGOA 4CLFA 1XC9A 3NWRA 2M5YA 1GXTA 2L9DA 2BMBA 2CJ9A 4X64J 2AJ2A 3FUYA 1WF1A 1K0TA 4JI4F 1RGVA 2K8GA 3L7UA 4CT8A 3FK4A 4J9QA 1MWZA 4MKAA 3ZZTA 2F8EX 2OEKA 2Y0BB 2IC3A 4NOHA 1Y5NB 1LWXA 2F7VA 3ZC4A 2J9DE 2D7SA 2EEYA 4DS5A 3PNIA 2Y1RI 2MSTA 1SH3A 2DY1A 2DH8A 2XQCA 1BXNA 1DHMA 3AB4B 3NRBA 5CYMB 2HVIA 2LQJA 2EBEA 4FBUA 3HJVA 3C15B 1Z1ZA 2WW4A 3M7VA 3NG8A 3A3NB 4FKXA 1FHTA 3T5KA 1GMWD 3WHIA 2ILYA 1DJ0A 4L74A 2IA6A 5AE1A 3EGZA 2R7XA 3IO1A 3G6VA 2KO1A 3RW7A 2PD1A 1U49A 3CB4A 1FE4A 1NPPA 2B8QA 4P10A 5DETA 1E6VB 4GO7X 4PG4A 2HQFA 3PDNA 4CLLA 2ZHBA 3IRWP 2DISA 4H4MA 2CDQA 2Z57B 4ID5A 3GQCA 2BM0A 2DCUB 1FJEB 4CLKA 3POTA 2R2TA 4DG1B 2PO4A 3M6UA 5GADI 1QY7A 3IBCB 3H40A 2ZM6F 1WEZA 1CS4B 3BSOA 2DTJA 1IBMJ 3QBCA 1KVKA 2RKIA 2VG7A 3IG1B 4TNOA 3U27A 5DG9A 3E51A 2YWKA 5D4NA 4X4OA 2W7AA 4IG3B 4CO2A 2M0GB 2VL1A 4QYRA 2HHSA 1HI1A 1RT1B 2XYPB 3GSIA 4RJVA 4DR3F 4IRDA 2BQ3A 4J9RA 2PMZD 1KBRA 5D15A 2ZBIA 1HQUA 3AT1B 5IWAJ 5D77A 2XMTA 4L76A 3M6XA 1BLUA 1TAQA 3IAM9 5ITHA 4DMZA 1HW8A 3TRGA 1HMVB 2IDLA 3EVOA 4DR4F 5IQQA 4IOAQ 4OYPA 1NK9A 4CYUB 3HSJA 2VFVA 1FTCA 3P8BB 2DHSA 3BYRA 1AUDA 2UUCJ 2I2YA 4DSKA 2M9KA 2RDDA 3V4MA 3OTCA 1H2VZ 1T95A 5LM7E 3FCHA 3JB9k 5LSLA 4NZ7A 3MPYA 4NMXA 1VYAA 3JTOA 2F9JA 4PYAA 3CCWA 3JSYA 5RUBA 3O2IA 5F8IA 4RNNA 3G4SS 1IBLJ 4KRWA 4UY85 1ZA1B 2OSQA 2Z58B 1QAXA 4ES3A 1GMUA 4DFJA 1LWFB 4OX6A 1JX4A 1P1LA 2B9XA 2OMLA 4FNHA 1UVJA 1SC3B 3CE8A 4DR7F 3IRXA 4ELTA 2QLJB 2DRAA 1UJ4A 3GE9A 4ZVHA 1T03A 2NSCA 1JLEA 3W7BA 2CJBA 4PWWA 5DLFA 1UZDA 4Q2MA 3HHLA 1WORA 1JKHA 3MAAA 3PACA 3PRDA 3UE2A 3OTOF 2AGOA 5AXKA 2P6SA 2HZVA 2V94A 2XYHB 3D0HE 1QAYA 4F4YA 1LK5A 2IIHA 5KFZA 4F26A 2KVIA 1NHUA 2OKQA 1U24A 4O0IA 4IRKA 3RTVA 5HN0A 4CI0B 1DY3A 4EYHB 2MMYA 1N56A 3KJNB 4RW6B 4R0JA 2DT9A 3IGNA 4OYAA 1S4EA 3HSGA 4BC9A 1NJYA 2GGPB 2VD3A 1VQ6S 1O6XA 1JK9B 4M1KA 1VCTA 3QWPA 2ZC3A 3QGPA 5KFNA 4DQRA 3VF0B 4LSLB 1HQ2A 5KFQA 2VG7B 2EVZA 1RWOB 3IG1A 1RWWB 4BDPA 3B8HA 2CRLA 2EC2A 3Q8SB 3AOCA 2G1DA 4FYVB 3DOMB 1SIWB 2XYGB 4EFAC 3VAJA 3N6NA 2QSFA 3P3DA 1PJ6A 2HFVA 3I6PA 2RS8A 2HBZB 4QWDA 1YSJA 3TVYA 3UN3A 2XC9A 1CJVB 5KFGA 2MKYA 3PKYA 4NWBA 3MTJA 2W7PA 1JNRB 4WFBQ 3JS9A 3CCTA 1KN6A 4Y34A 1HD1A 3HT0A 1ZM3A 2IRUA 3BM7A 2HHTA 4OZ5A 3KFWX 1A6LA 1HPZA 4C7QA 1LW0B 4YB1P 3R2CJ 5DM7Q 4PQUB 1SQFA 2CQIA 1FX4A 3GFXA 2W2MP 3K8VA 8ATCB 3MFHA 5LMUJ 2LMIA 3ONQA 2F1FA 4ATNA 3DMJB 2QA4G 3KOAA 3TJAA 2X3DA 1H7XA 1TUWA 2JZ5A 3C14A 1TKDA 4P2SA 4R8UA 5M2PA 4C8KA 1LEOA 1OIAA 1PIEA 5GVQA 2NPFA 3CCVS 1GQEA 1VS3A 4ZDNA 2WSFC 1NNDA 4MH8A 5A0YA 4DN9A 2V9WA 1KONA 1O51A 4ZLNA 4WKRA 3MMJA 2R7QA 4U96A 3HVRA 2VQEF 4B9SA 5CZVA 5D4PA 3Q0AA 4WP8A 1RT2A 2UXCF 4JYAF 2F65A 3DRYA 3KLFA 2F40A 5DO2A 3QJJA 1W7WA 2MZSA 1KTVA 2IJNA 2VDHA 3CMAS 4Q8FA 4QWBA 4GO5X 3NMRA 2A1BA 2DNHA 4DZ6A 3SSQA 3BPDA 3M1VA 2ZH5A 3R8YA 3GCXP 2QMUB 3EPIA 2GNKA 2ZHAA 4YDXA 1U8WA 3HF5A 3CCMS 1TV6A 4DF8A 2DNKA 1VRTB 3AB2B 5HJYA 5DRKA 3Q8RB 3PV8A 3DNCA 2P9GA 4HVZA 4KAIA 3MWBA 1KDNA 3TUJC 4HL9A 2R7SA 3MEEB 3IWLA 2B4PA 2JC1A 3FGVA 4ECQA 4Z7CA 4NZ6A 1HYSA 2LXFA 5K20B 1UETA 5B0FA 5KT3A 2B9WA 4NLSA 4DSFA 4OHYA 1KR4A 2HS0A 2B9EA 2C2MB 4CWBA 4WZQA 2X1AA 2IA0A 4OZNA 4J9KA 1UEKA 1Z2LA 3ZZUA 2YVSA 4DL0C 4O3SA 1X60A 4JV2A 1MU2A 5ETLA 1YWXA 3DM2A 4EMDA 2NXNA 4CH7A 2ZH6A 3VALA 1Q7YT 3RBXA 1NKCA 4USKA 1S1XB 4LF6J 3KK1B 2WBRA 3MMCB 3SCIE 3DLEA 4XDDA 3PR5B 3W2VA 4URSA 3BH6B 4N5SA 3LPEA 2JFDA 5KFPA 3M9MB 1YI2S 1XQIA 1Y10A 3O8WA 4X66J 3OW2R 2FJVA 2F8HA 2KT5A 3BO4A 1JLGA 3M8SA 3NOCA 2HG4A 2FVCA 5M2UA 4C8YA 1OQ3A 1JIHA 2Q6BA 1CSJA 3RZAA 1ZTTA 2AX1A 3ISZA 2QFIA 2QL9B 3R1HA 3R27A 4NYOA 1TQLA 1QJHA 4GMKA 1Y7PA 2SXLA 2W2PP 4CO0A 1KEKA 2IYIA 3PR4A 4DR3J 1T7PA 2M52A 2C3PA 4A8FA 2CG8A 3TZZA 3LGMA 3TJ9A 4R8UB 3KMSA 4N8OA 1FT8A 1ZTWA 1S9FA 2CPDA 2A10A 1FRXA 2IC3B 5EWFA 5KFRA 3MMAA 5F8GA 5L1IA 1V3SA 2AGQA 1U1PA 1BUXA 4ZLLA 1A7GE 4LBHA 3MM6B 4DR5F 1FK9A 2Q43A 2EK1A 4J9OA 1YIJS 2B0GA 1UVMA 3W8PA 4HTJA 1RK8A 4ITSA 2UUCF 3K2YA 3TAQA 2CPJA 1FDNA 1S97A 1LNQA 1RWVB 3OD2A 8RUCA 1QVGR 4LF9J 1FJGJ 2R8HA 3T9ZA 4EGLA 3MM7B 1U1NA 2DR8A 4MYUA 2UP1A 2HFSA 5KFCA 1RAHB 4I2QA 4LREA 4IR1A 3CJ0A 2ZKUA 4BHQA 3BBFA 3M6WA 3M2UB 1JB0C 1NCLA 2CJAA 1RCXB 1LXNA 4R0EA 3FQLA 3ITHA 3D5MA 3KLGA 3AA9A 4C8OA 4GVLA 4WYLA 4CP5A 1YVFA 2CQDA 1GMVA 4K5RA 2RMLA 2JOQA 4ID5B 2IDEA 2H4YB 3GCWP 4WK3A 1EZZB 4OZ0A 2JFKA 2YPYA 4X64F 3QAUA 1HR0J 1HYSB 4R5PA 3V2UC 2VOPA 5AXLA 1O0PA 2VF3A 3H20A 1V3RA 1F1BB 3DXBA 3I9V9 5D6GA 5AT1B 5KFEA 3M4XA 4N56A 1S72S 3FBBA 1CULA 1LFWA 1WC0A 1ZZFA 1HARA 2CZ9A 2DHAA 5A6WA 2J5AA 5G0RA 4F0HA 2AF6A 1UEVA 2R3VA 3QSIA 2G0IA 1LKZA 5KT6A 5K8MA 3PX0A 1AW0A 1GNKA 2CQPA 3LGHA 3UN2A 3CCQS 2MJUA 3VV2B 1C0UA 1G6BA 4J90A 1HNXJ 5F3TA 1VRQC 1L5UA 4USMA 1B0PA 2QYGA 3D4JA 3JSBA 4I69A 2XSJB 2RHSB 2DNZA 3NXZA 1EP4A 4XPEA 2X1FA 3KJVB 2Z2ZA 2RS2A 1AYEA 2BA9A 1JLEB 1RQ0A 3BB5A 3CEDA 5GADU 3P49B 1KKHA 4KV8B 1ACMB 1RT4B 2KU7A 3UQSA 3VVTA 5CD4H 4IFYA 2P2CB 3W3SA 3T5JA 2DYAA 2EFGA 3K5OA 4LSZB 4OYWA 2KM8C 3BSNA 1IM6A 2LVWA 1R3NA 2VC1A 1N6QB 2B43A 1MMLA 2ZJPQ 4EWTA 1S7IA 1X4DA 4ZLJA 1W2BR 4KFBB 3ZZPA 5C25A 4B9VA 4FYYB 1IBMF 2IJRA 2HKEA 1IKXB 1FERA 2G0JA 4F04B 1AFIA 2VUGA 4F50A 1RYSA 3DRRA 4ED8A 2GZOA 2YQ0A 2XEXA 4XTTA 1YJTA 2DR7A 2IBOA 3OR2B 5LJ3Y 1H0HB 1QE1A 3ILLA 2XWXA 1RKIA 2FUG9 2P9CA 2ZKTA 1FEEA 2DITA 2QC3A 2V34A 4NLDA 3BQ0A 2LQ5A 5LMUF 3PTWA 4K4WA 3OTEA 4ANCA 5JMNA 3N6MA 2BM1A 1VHFA 2VHGA 4KGMA 5KFIA 3BGUA 2EG2A 1ICEB 3KLEB 1WSRA 3FEXB 4J9SA 1URNA 2OPPB 3I5BA 4Y2AA 5KAKA 2DK2A 4TN2A 2EBGA 1Y0HA 2PGCA 2VQEJ 1RTZA 1NJWA 3G86A 3TVZA 1GX6A 4A8YA 4Q8EA 5C42B 3UO0A 3MM8A 4B3OB 1RTDA 4LF5J 2XZWA 2PA8D 2LEAA 1RWPB 5EX3A 5IFMA 2MSSA 5ETRA 1PAUB 5KFUA 1Q8IA 1PO6A 2WVDA 3KNGA 3WC0A 4LF8J 4C2MA 1WOOA 2IPOB 1X4FA 2YKNA 3FRYA 3TWZA 1NK4A 1Q86T 4DWIA 2QO3A 4HEA9 4OJ1A 1IJEB 3T1YJ 1VC0A 2E5HA 5F8LA 5LOQA 3VAMA 4DR7J 3AQOA 2CAJA 3TAMB 4QW9A 2GMLA 3I0SB 2HW3A 4QIVA 2DH9A 1CC7A 2MY7A 3KG0A 4MK8A 1XNQJ 3B78A 3T9NA 1B4SA 1LWEB 5HMZA 3M8RA 2XTJP 4ZHRA 4HHJA 1VC6A 3D1HA 3TA1A 4OX9J 1S1UA 3ILJA 4HH1A 5LT5A 3Q24A 2UU9J 1S77D 2HHVA 4HDHA 5LMNF 4DSIA 2ACMA 1QTNB 4OZ3A 1PJ5A 3S6EA 4A8WA 3HHLC 1TL5A 4C3LA 1S9EA 2PI5A 3NNCA 2KJVA 3GR0A 1WUUA 4NLYA 4UY8T 1N33F 2KHCA 3LAKA 3TUZC 1DTTB 4OHWA 3U02A 2MQLA 3GIKA 3RU0A 3C14B 4K4ZA 1FESA 1HQEA 3EPGA 1UAWA 5FDLA 1CVJA 4RKUC 5SZTA 3QZ7A 4LF6F 2CPHA 2IFXA 3KTQA 2E5JA 3DN9A 3PHTA 4OJGA 1YQHA 2GHPA 1VHIA 3MR2A 2AP6A 1HHQA 2H4WB 2ZH2A 4WFYA 4FZVA 4X66F 2OPQA 2RQ4A 2GA7A 3D6HB 5ETSA 3GV8B 3QWUA 3F73A 1NK6A 2RB7A 3CULA 4NXMF 4LFBF 1RTIA 3GG1A 4RX6A 1KQFB 4D3GA 4I7FA 1SC6A 3V6DB 4DV1F 1REGX 4F3OA 3D6MB 1H7WA 4CQ1A 1FWLA 5F8NA 1YZ6A 4ZPDA 1KVIA 1SJ1A 2HQCA 2XMMA 2DO0A 4USVA 3PEJA 5F9NA 1RTHA 3KHLA 1UVLA 2AJ4A 1WEYA 3DFEA 2I6WA 2PFFB 1W26A 3PY8A 4U7UK 4TY9A 1MU2B 3PJ9A 4NA1A 4WFXA 4QPXA 2W9CA 1N5TA 2A3JA 2KRBA 4MFBB 1MMDA 2WVEA 5F0WA 3MF5A 5DQGA 5DG8A 3I87A 4FF4A 2V4QA 4ZVQB 1RBOB 4DXLA 1E6YA 1EQ0A 4WF9Q 4ETZA 2YNFB 1MLAA 2BW7A 1S0NA 4JV0A 2R7WA 5I42B 5LXYA 1S4FA 2GS8A 2MY8A 3BN4A 3OSPA 4IRCA 2A2DA 2FY8A 3KK3A 1NSQA 2DR6A 1EKSA 2HBYB 2VFRA 4YMEA 2VKRA 3CIMA 5DDOC 3RAMA 2H54B 4M5LA 4U95A 1I6JA 2VA3A 1H72C 1FD2A 2O66A 3CDAA 4N7TA 3AD8C 4DUYF 1HNWJ 2QLFB 3RRHA 3OR1A 3OT9A 4H4OA 2E1MC 4DR2F 2UUAF 1RAOA 2BVZA 1X4HA 2J0QD 2ZZMA 1DFDA 4CO5A 2O1PA 5L1JA 1CJTB 3EVMA 4FXDA 3N9UC 2L08A 5HVGA 4LMZA 2VIHA 3OLBA 4QU6A 1RAGB 3D2WA 4WCEQ 1NJIT 1UA1A 1F2HA 3M8YA 3RRKA 2M4MA 2VJUA 2BEFA 3PRVA 4FYWB 1RWNB 5FLXY 2OEJA 1T05A 4LQ3A 2ZH1A 2WZ1A 3T19A 5J1PA 1JLCB 1OQ6A 2ZD1A 4OHVA 1R6VA 2GMJA 2C2RA 3FBEA 2V2KA 3CJTA 4I6YA 3HFZB 4LVOP 3S1TA 2W8KA 1GT8A 3G82B 1JJ2R 2R8GA 5K14B 4OQJA 4RW9A 3CIZA 1ZBTA 3D0IE 3DU6A 1S1TA 3GIMA 1YRXA 4JI6F 1KRPA 4F8RA 1FE0A 2LFVA 2HVHA 2J0WA 1QD1A 3TQEA 4ELUA 2RF2B 1FRLA 1LWCA 2ZH7A 3TI0A 2GJ2A 1DAXA 1J2VA 5GMEA 2IYGA 2XG8A 1RCOB 1RUSA 2EI5A 2HPUA 3KLIB 3N0VA 4K4TA 2WAQD 3VVUA 1FWPA 4RW8A 2J9DA 1U1KA 1D9AA 4I4BA 5KTQA 3RR8A 1P1TA 1ZPVA 4NI2A 3SCKE 5KT2A 3UDVA 2UXBJ 4CM0A 6FDRA 2CPZA 2HNZA 2R2SA 3ULHA 4BS2A 3CD6S 1OO0B 1WSVA 1PAEX 3T1AA 2OIHA 3KHGA 2G2ZA 4CNYA 1Q7LB 5J2NA 3TUPA 2LQ9A 3T6JA 3SI8A 3IS9B 5A8RA 1SQGA 3GFYA 2OPSA 2GQQA 3QLHB 4D3HA 2N4CA 2BDPA 2MQMA 2ZHOA 5AE2A 4DR6F 4YY3F 2QEXS 3OUYA 3E2EA 3KJVA 2FVRA 3R97A 1V3ZA 3PIOQ 1CULB 1VQSA 2BQUA 2C28A 5HBMA 4FS1A 2ZBQA 5I3QA 1YJWS 1X0PA 3S8SA 1R0AA 1U45A 4NYZA 2MLXA 5GMDA 4ED4A 3HSZA 2HWTA 2DGXA 2ROEA 3U1NA 3VQTA 3OVBA 2FJAB 4IO9Q 3D0GE 5L1KA 4ZJQA 4C11A 1D0EA 4K8RA 3SZ2A 2OHDA 5FIIA 2AZ1A 1YZ7A 3B4MA 4MKVA 2XLKA 4I67A 2RD5C 3NAHA 3KUGA 5IM0B 5KT4A 2VZ9A 2RDIA 4P2XA 3MUTP 4DSJA 2V6AA 4RW4A 2LQ8A 4QQBA 5A6PA 3DRPA 4TYBA 4DV6F 4LF8F 4AL6A 1EARA 5HQMA 1VK3A 4U67Q 4DV0J 1DLOA 3CJSA 4ZS6A 1DQ9A 2CJXB 1FFGB 4IG0B 4ICLA 5T7LA 1DTQB 1S49A 3M30A 5CABA 4IFVA 2NXUA 5KG5A 2J7KA 1FNOA 2MLYA 4Y2MA 4J7CA 2CFXA 5FLXU 1U4BA 4HHHA 1JLQA 4RW7B 2ERRA 3X1LB 3VWSA 1S1TB 4ZVGA 1T9VA 1WTBA 2DB1A 4FP9A 5F8MA 4K4UA 1EQMA 3PJXA 4NRTA 3NBPB 4OFZA 2V2VA 3DGPB 4KC5A 5BYSA 4P52A 4ZPWR 1J5EJ 5KOWA 1U8SA 2IAJA 2V8HA 1FJCA 1RAJA 1XN9A 3MM8B 3MR3A 4DV2F 2XMUA 2ZUAA 3RYLA 5B0EA 3E8OA 4EI2A 4EZ9A 2QA4S 2CPXA 5HI7A 2DHXA 5F9LA 3OVAA 3PG9A 1GAOA 2VFUA 4ZIWA 3H5UA 1NJZA 3NGTA 1F2GA 3JQJA 2XHWA 2OPPA 2YKMA 3AJ1A 1SIZA 2DGWA 3IXQA 3TOQA 4QCLA 4NX9A 1U6FA 3SFUA 4TU8A 4ZOSA 2E44A 4TVAB 4AYBD 4M94A 2Q3PA 3GFHA 3D7SB 4BWMA 2G1HA 2C22A 1M0SA 3PW0A 4NXMJ 5JVGQ 2KFZA 3Q22A 1UFWA 4C0HA 4K4SA 2UUWA 3Q8UA 3Q89A 3SCLE 3THVA 4ENOA 3QRPA 3CD7A 4NA2A 2C42A 2C2ZB 2JWNA 2RSQA 2V4JB 5CCLA 4F4XA 4OLPA 3L95X 3DLBA 2UXDJ 1N5SA 5A8WA 1ZETA 3CDUA 1IM4A 2R42A 2FPHX 3FMBA 4R25A 1K73T 5IT9Y 3TAMA 3HCXA 1VQKS 1S1WA 3GIRA 3PEHA 4DU7A 3VTIA 2NXCA 3QATA 5LSRA 1KLMA 4LRDA 3OL7A 2YNIA 4Y28C 1R27B 1X9MA 2B8PA 3N4WA 4DFMA 1DZ5A 3I4HX 4DBQA 5J2PA 1NHVA 4KJIA 3TO8A 5T41A 2BACA 3MAQA 2AEMA 4DPWA 3CPWR 3SV4A 2HQGA 5KG7A 4IUFA 1K9MT 4KBIA 2YY3A 3PW2A 2KT3A 4G1QB 3G6XA 1VQOS 3J7YI 2E9RX 2HHQA 2LA4A 3SDEB 3J81U 4DQPA 4LRCA 4UOFA 4PR6A 3EXYA 4X4QA 1JXEA 2C2NA 2V8VA 2P6TA 4B3MJ 4EK2A 3H5YA 3J7ZT 5D4LA 1FXDA 5K9FA 5J2QA 2CPFA 2BE9B 2BYCA 3TX0A 9RUBA 5MLCV 4Y0FA 2QSWA 4I64A 1SKRA 4TLQA 1QAIA 5I42A 2KJWA 4JP8A 1RTJA 1VK8A 1R43A 2RU3A 2JH3A 1FO1A 4DZDA 5T14A 1SJ4P 1RTHB 4LRAA 2YWGA 1HBUB 4QWCA 1SBRA 1ZA2B 2GO8A 3NP5A 4LF4F 5I4MA 2VFSA 1FRKA 3UI3A 1MW7A 1FXLA 5C2GA 3NGUA 5LXRA 3TANA 3KK2A 4NXNF 2HHXA 4ELVA 1D9FA 1PYOB 4C4WA 5KG4A 3M9OB 2QMWA 3IMQJ 1X4EA 2FD2A 3NOGA 5HLFA 3ZNJ1 3HKWA 3S01A 1WKKA 3E3XA 1Q81T 2ZOGA 4WP9A 2QX0A 3NCRA 3QT7A 2KG0A 2E9TA 3UD3P 2NREA 2KTQA 1KFDA 1JXVA 1U02A 2HFOA 5ETVA 4A47A 1S79A 3QRRA 2QN6B 2LCWA 5CYMA 5EWGA 2VG5B 3JSRA 1JLCA 5HANA 4ZCLA 4CLTA 3MPWA 5DGBA 1D8ZA 3CO9A 4G65A 3OSNA 2GVZB 3SMZA 1TL1A 2CJQA 4DX8H 1RT3B 3DOMA 5K14A 5D3GA 1S7HA 1XR5A 2IHR1 2RHQB 3FJ2A 4WTOB 5LSOA 1S0MA 4DPXA 4DL2A 2DNRA 3ELHA 4FYDA 2NQPA 5KG1A 1FF2A 2IRXA 2ASJA 4WXWA 3NLCA 4E8UA 2HBQB 3CDBA 3HJFA 2ZBCA 1QUVA 4FPRA 3POTB 2C3YA 3KLIA 4NASA 3MCOA 3P45B 9ATCB 1LW0A 1RACB 2EWHA 2GIFA 2QYCA 2ZUGA 3D3BJ 3BN7A 3P5TL 3LP2A 4MIWA 3KLHA 4DUYJ 3HKZD 1DRZA 4OI0A 3UDLA 1SV5B 3QO9B 4HYKA 4Y2CA 5D4OA 2OP5A 5IWAF 1R8BA 2WB1D 1H38A 3FQKA 3PW7A 3OPKA 1FDDA 2J9EA 1RHKB 5IT0A 1YJNS 2L48A 4DV3F 2I8EA 2BX6A 4PXDA 1FEHA 2OH2A 4B9NA 4DPTA 1KNZA 1D09B 4DV7J 4WJBA 1Z4UA 5KFXA 1HNIA 3M8QB 1S57A 3CJKA 1CJUB 1F60B 1Q53A 3H42A 2YKAA 3QLHA 4KGVB 4K7QA 5HVHA 4DF4A 5H9EK 1G4CA 2HIYA 1KHVA 4LIWA 2W4DA 1SUQB 4WXOA 5DJBA 1RDRA 4Z37A 2PC6A 4H4KC 2RKIB 1MWYA 2HS3A 3EX7B 3J7A1 3K0JA 5CHCB 4KHPJ 1RHRB 1KFSA 2Y3YA 4PAAA 4YOEA 4RNFA 4JI6J 3CCZA 3QAEA 4KTQA 1FD8A 4K2XA 1UW4A 2DPIA 2ZDPA 5KFSA 1VLYA 2ALYB 1YJRA 3RJMB 2ZJQQ 2HHHF 2K3KA 2V5HG 4K2JA 1H98A 3HHKA 4PG6A 4UTGA 4DPOA 3FVYA 3B54A 3PFEA 3MI7X 2EFQA 3EDRB 4DFPA 4JI1F 1FCAA 2U1AA 2XULA 4L75A 3PFOA 3CO0P 1UA0A 4TU7A 4PWDA 3DLEB 2XWYA 1RHMB 1BC6A 2ZNZA 2EK6A 3D54A 1RI7A 4YR3A 1GH8A 2RRAA 4C0BA 4O3OA 4FNIA 4I6AA 2JEJA 2GX8A 1ZAVA 4I2PA 2K2PA 3GG0A 2GAGC 4BC7A 2J6SA 2MKIA 3M32A 1IR1A 4K59A 1N0UA 1BMQB 3H2UB 2BZ2A 2MHEA 2RUGA 4F3MA 2CNOB 4E2FB 2ASLA 2VH7A 2J6TA 3M30B 1N4LA 1NRKA 1FDAA 3R5GA 4GKJF 4ZMMA 3SQGB 4HH0A 3MPDA 4RR5A 1GXUA 2BKPA 1Y5LB 3DKDA 1F0XA 2FZKB 3EGNA 3V6HA 2OELA 1FNMA 4C11B 2XZTB 3CCLS 4F4WA 1UVKA 1VJWA 2HGNA 5IM0A 3A8KA 4QIGA 5GAHU 1ZH5A 2FJWA 4OI3A 2B3TB 1Y9OA 3IR5B 2W9BA 1SC4B 3D68A 4MTPA 1YLXA 2NXJA 3TA0A 3LOUA 4UF4A 1IBCB 1IWAA 4DFKA 3MM7A 1FTRA 2X1GA 2JHEA 5IXUA 3HVTA 1SJ3P 1FKOB 4JBCA 3LP2B 5IT9U 1HLWA 2HVZA 4NE9C 4Y65A 2VPZB 4L6V3 3ENWA 4MYTA 5KG2A 1SV5A 3HD2A 3GV7B 2EC0A 5CYQB 2B4VA 4RW7A 4ZVEA 1YRTA 1S1VB 3CF5Q 4B3SF 2MKHA 4UZCA 4DR6J 4PKDB 2IMOA 4DCOB 3MMAB 4FF1A 2ZC4A 2DY9A 1FK9B 3K89A 2AJQA 1X4BA 3PIPQ 2J0SD 3D9BA 4UUXA 1N34J 2RQCA 3GV5B 1Q8BA 4OMFG 3M8WA 5ETTA 4DR5J 1EAYC 1M5HA 1NDLA 2DGSA 1N5QA 2ZJRQ 2J7UA 4JUZA 3FC9A 1R31A 2OD6A 1FDBA 5ETMA 1PGZA 4F36A 1GTHA 2YH0A 2VKZG 4UW2A 1FRHA 2B56A 4CO4A 4X4RA 3BGFA 4W98A 4FF2A 3FNNA 1HNVA 1WOPA 2PE8A 3AQPA 2XCPA 4GC7A 3CGIA 1TUVA 2CVIA 2IM2A 4QIFA 2OPRB 2RU9A 3HLUA 5EDWA 4NCGA 1TVRA 1TL4A 3P6YC 2LU1A 4DV6J 1NK8A 3NCQA 2H9ZA 2FC8A 2CQ1A 4M5JA 4P71A 1NZ8A 3DLJA 4AXJA 5KFBA 1VMBA 1H74A 2C2KB 1C0UB 4OHZA 1UEUA 4JV1A 1UVNA 2FZCB 3OL8A 2HMIB 1KWMA 2HFZA 3PYFA 2DRBA 1HNZF 3BREA 1OJ4A 3FBFA 3MEGA 2VOOA 3BZQA 3F44A 3R5DA 4ALZA 2WOMA 5CXTA 5G0RB 4DX7A 2DBBA 3QZ8A 1GK8A 2V8PA 5HO4A 3L7OA 4KKOB 1RWKB 4FDFA 3ZZ0A 4X4SA 1LOUA 2LXUA 4RZRA 3LWMA 2MHNA 5K8PA 2QLBB 1YTYA 2QL7B 3ETOA 4WKYA 2DR9A 1TKXA 2R8IA 4DV2J 1TAUA 2YNIB 3NGKA 2V2QA 1WHWA 4N47A 4CLYA 3TA2A 2VICA 4UOHA 4Q0BB 4LQ9A 2EPIA 3Q8YA 1WELA 3SV3A 2RNEA 4FS2A 2DNGA 1G1XA 1RISA 4OZ2A 5CCMA 1UKUA 3UPFA 3CWJA 5BR8J 1VQ7S 1Y00A 3MR5A 4TU9A 1XNQF 4U7CA 3MPVA 4TY8B 4PG8A 4ZN1A 1J5OA 1FX2A 2EFOA 3EZOA 3GFZA 2AW0A 2R8JA 3BBCA 3DLKB 1P6TA 4GVBB 2VA2A 1S48A 2QJ3A 3MCSA 4F2SA 1TMJA 5E3QA 1UVIA 2JEFA 3CDWA 4DV4F 3MEDB 3W2WA 2MGZB 2KM8B 3JAMY 3LQVA 1FRIA 4KH1B 3RR7A 1WKJA 1HBNB 1F6TA 2HLUA 3E01A 3V81A 2B4OA 1RT7A 3I82A 2FC9A
chains in the Genus database with same CATH topology
3D6FB 2HBZB 2CJYB 1BMQB 2CNOB 4JB8B 4ZVRB 1RHUB 2HBRB 2H4YB 2XZDB 2XZTB 4ZVTB 3R7SB 2H4WB 2H51B 5IC6B 5IC4B 3D6HB 3GJSB 2FQQB 1SC4B 2C1EB 1IBCB 3D6MB 3IBCB 1PYOB 1RWXB 3R5JB 1RWMB 2Y1LB 2XYPB 4ZVPB 3R7NB 4DCOB 2CJXB 3EDQB 2H5JB 3QNWB 3NS7B 1RHQB 4ZVQB 2CNLB 2P2CB 2DKOB 4LSZB 2H5IB 2HBYB 4ZVUB 2H54B 5K20B 1GFWB 3IBFB 2C2MB 2HBQB 2QLFB 4ZVSB 3P45B 2C2KB 2QL5B 3KJFB 1I3OB 1SC3B 2CNKB 1SC1B 2QLJB 1RWNB 1ICEB 1QDUB 3SIPB 1RHKB 2H65B 3GJTB 1RWKB 1NMEB 3GJQB 1I51B 2XYHB 3R6GB 2CNNB 2QLBB 3KJQB 2QL7B 2C2ZB 2QL9B 3R7BB 1RWPB 1PAUB 3KJNB 4DCPB 1RHRB 3R6LB 3GJRB 3P4UB 4DCJB 3RJMB 1RE1B 2H48B 3EDRB 2C2OB 1RWOB 1RHMB 1RWVB 1RWWB 2CDRB 2Y0BB 1RHJB 1F9EB 2XYGB 4ZVOB 1QTNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6F B;  2HBZ B;  2CJY B;  1BMQ B;  2CNO B;  4JB8 B;  4ZVR B;  1RHU B;  2HBR B;  2H4Y B;  2XZD B;  2XZT B;  4ZVT B;  3R7S B;  2H4W B;  2H51 B;  5IC6 B;  5IC4 B;  3D6H B;  3GJS B;  2FQQ B;  1SC4 B;  2C1E B;  1IBC B;  3D6M B;  3IBC B;  1PYO B;  1RWX B;  3R5J B;  1RWM B;  2Y1L B;  2XYP B;  4ZVP B;  3R7N B;  4DCO B;  2CJX B;  3EDQ B;  2H5J B;  3QNW B;  3NS7 B;  1RHQ B;  4ZVQ B;  2CNL B;  2P2C B;  2DKO B;  4LSZ B;  2H5I B;  2HBY B;  4ZVU B;  2H54 B;  5K20 B;  1GFW B;  3IBF B;  2C2M B;  2HBQ B;  2QLF B;  4ZVS B;  3P45 B;  2C2K B;  2QL5 B;  3KJF B;  1I3O B;  1SC3 B;  2CNK B;  1SC1 B;  2QLJ B;  1RWN B;  1ICE B;  1QDU B;  3SIP B;  1RHK B;  2H65 B;  3GJT B;  1RWK B;  1NME B;  3GJQ B;  1I51 B;  2XYH B;  3R6G B;  2CNN B;  2QLB B;  3KJQ B;  2QL7 B;  2C2Z B;  2QL9 B;  3R7B B;  1RWP B;  1PAU B;  3KJN B;  4DCP B;  1RHR B;  3R6L B;  3GJR B;  3P4U B;  4DCJ B;  3RJM B;  1RE1 B;  2H48 B;  3EDR B;  2C2O B;  1RWO B;  1RHM B;  1RWV B;  1RWW B;  2CDR B;  2Y0B B;  1RHJ B;  1F9E B;  2XYG B;  4ZVO B;  1QTN B; 
#chains in the Genus database with same CATH topology
 2FGC A;  3D6F B;  2CJY B;  4LRB A;  1NH8 A;  2CKW A;  1MN9 A;  3A4T A;  4B08 A;  4JI8 F;  1QVF R;  2AYE A;  2D9P A;  2HIQ A;  3A1Y G;  3LF0 A;  2G13 A;  2XO6 A;  1Y11 A;  2HQD A;  2XGP A;  3H25 A;  4HT7 A;  1A9N B;  2PDA A;  3KUE A;  1G2E A;  5IOL A;  4NEZ A;  4ZVR B;  4JI0 F;  4ED0 A;  4Y6I A;  4J9V A;  4TYA A;  3R9L A;  4IH6 A;  4YEA A;  4EO8 A;  2HHP A;  3KDN A;  1FVS A;  1BWV A;  4IH5 A;  3PXG a;  1F9F A;  3UNG C;  5EHH A;  5KFW A;  1R0C B;  2M7S A;  2CQ2 A;  2Z0G A;  4NEY A;  2KXH A;  1TL1 B;  3R7S B;  4B9U A;  2CIM A;  2CPI A;  2DNM A;  2HSE B;  2HK2 A;  3MMC A;  4DV3 J;  1JLA A;  1CLF A;  3I0R B;  2F5G A;  2ZVI A;  4DL7 A;  1TVR B;  1TL3 A;  2K1R A;  4ILM A;  1FKP A;  5HL7 Q;  4K0K F;  2M8D B;  2XM3 A;  4PXB A;  4B17 A;  1SH2 A;  2GFF A;  3DCA A;  4ECS A;  4CLW A;  3A8E A;  3KWM A;  3H5X A;  3DOK A;  4CO1 A;  2MQ8 A;  2AQ4 A;  2DIU A;  1RB0 A;  1U09 A;  1X7V A;  3SFG A;  4KHP F;  2K3I A;  3R5J B;  4ECW A;  3C6T A;  1RWM B;  4I68 A;  5BJR A;  3KLH B;  4B3M F;  4M63 A;  4LF5 F;  4O44 B;  2GIR A;  1N5Y B;  3W62 A;  4G3I A;  1C1B B;  1SKU B;  3ILO A;  3KG1 A;  3TJ8 A;  4AE5 A;  3Q2S C;  4Q43 A;  1TKT B;  3TEH B;  2R7R A;  1HBM A;  2OMO A;  1KOH A;  1UFK A;  1NEE A;  3KLG B;  1PYT A;  4KT0 C;  1LWE A;  5E33 A;  3BJY A;  3KDO A;  3CVK A;  4MIA A;  2DNL A;  2NCK L;  3BH7 B;  4ZHR B;  3NWG A;  4DUZ J;  2YPZ A;  4AL7 A;  2B6A A;  1RSC A;  1WDD A;  2BRL A;  3BSC A;  3C66 A;  3FSX A;  5CQG A;  4DV5 F;  4LF7 F;  2VDI A;  3MEC A;  1N48 A;  4FKY A;  2XI3 A;  4F0M A;  3IFE A;  3MOZ A;  3QGI A;  3MUR P;  3PKM A;  4RUH A;  1M1H A;  4JI2 J;  5ADZ A;  4JI5 J;  5F8J A;  2GHV C;  3W65 A;  3A8I A;  5HK4 A;  1BQM B;  5HAT A;  2MPU A;  4K4V A;  4AUK A;  4MK9 A;  3MDF A;  2YQ3 A;  3C19 A;  4ZVS B;  2DGV A;  4O3P A;  1Q16 B;  2WVF A;  4NLX A;  1WJ9 A;  1RT5 A;  2W2O P;  2YWH A;  3JTN A;  2D3Z A;  1IUJ A;  2GC8 A;  3QQC D;  3R3T A;  4LSN B;  5K5M A;  5THW A;  5DM6 Q;  1RYR A;  4W90 B;  1IKW A;  3MFI A;  2YNG A;  1NKE A;  4UST A;  4F2R A;  4ED5 A;  1QTM A;  1CJU A;  4LBP A;  3H2L A;  3GPA A;  1S76 D;  2Q1L A;  2Z8Q A;  2JNJ A;  3RB4 A;  4PUO B;  3GWC A;  4RUB A;  3FFI A;  1EP4 B;  2W24 A;  4I2P B;  1SKS A;  3CCE S;  1I51 B;  5HSP A;  5HAO A;  4P72 A;  2WTF A;  2CNN B;  1T02 A;  3M32 B;  1RT4 A;  3BQ2 A;  5E2Q A;  2VQF F;  2CUY A;  4MK7 A;  4A8Q A;  3D67 A;  4X62 J;  1U1R A;  1YBT A;  2D9O A;  3AA8 A;  2ASD A;  5HRO B;  4ZPC A;  1XMQ F;  1VQ8 S;  3H5S A;  1U47 A;  2D3U A;  4DLG A;  2AYM A;  4KFB A;  1RWU A;  1HHS A;  2DR5 A;  2UXB F;  2N3O A;  1EHW A;  5C25 B;  2LKZ A;  3I0R A;  3DLL Q;  2J9C A;  4I0W A;  2K1R B;  5DDQ C;  1N34 F;  1EIY B;  3MTK A;  3RAQ A;  1R8C A;  2K7K A;  2HVE A;  3BBB A;  4RLE A;  2ZEJ A;  2EFV A;  1U26 A;  2D3O 1;  3JQM A;  3ZTP A;  1YRU A;  1U0H A;  2O5D A;  5J1N A;  1AZS B;  1XER A;  4KV8 A;  1OY8 A;  2BJE A;  5L9X A;  1UTA A;  2FHJ A;  4ED2 A;  2UVW A;  1S9G A;  2BAN B;  5A8K B;  2MDA A;  5AJ3 F;  1JWW A;  1Q5V A;  1L3K A;  2DNO A;  1RHJ B;  2E7V A;  3GYN A;  5KG6 A;  4FYX B;  3W5Y A;  1U1O A;  1XWL A;  2GMH A;  4LF1 A;  1N5Y A;  1RLC L;  3EMT A;  5F41 A;  4K5S A;  3W60 A;  2PN6 A;  5CYQ A;  4A8S A;  1DAR A;  2RT3 A;  3KLE A;  2FY1 A;  3HO1 A;  2Z2Y B;  1WC4 A;  3LW5 C;  4P2M A;  3GII A;  1LQ9 A;  3TR5 A;  1W2I A;  3GTY X;  4IYQ A;  4Q45 A;  3VAK A;  1RHU B;  2RF2 A;  3T6B A;  2AMC B;  2H1Y A;  2ACY A;  3DI6 B;  3FCV A;  2W9B B;  2XI2 A;  3CUN A;  1S6O A;  3NL0 A;  3MEC B;  3RBD A;  2HHH J;  2DIV A;  3D1Q A;  3VAI A;  1RTD B;  2WK4 A;  3HVT B;  4ECU A;  3RRG A;  4ZPA A;  4U9R A;  5JVH Q;  3HP6 A;  3C46 A;  4S0M A;  1VC5 A;  2YKN B;  2MJN A;  3W9I A;  4MKY A;  3K59 A;  3CJ3 A;  4DR1 J;  1OYD A;  2K06 A;  2C1E B;  3KMQ A;  1BE4 A;  1VR6 A;  2FB0 A;  1WKL A;  2DH7 A;  2VBY A;  2A2C A;  1AUS L;  2Z56 B;  3D3C J;  3LAM A;  4YB7 A;  2XLI A;  3JSM B;  3HHL D;  3QIP A;  1RT5 B;  2WON B;  5EX0 A;  1YDL A;  5F8H A;  2AV5 A;  2RRB A;  3B82 A;  2QGF B;  4H4M B;  4OJH A;  2Q66 A;  4QW8 A;  3O44 A;  5JXS A;  4WII A;  1K47 A;  4NLQ A;  2Y1L B;  5BR8 F;  1FI4 A;  4NLW A;  4UUW A;  4DOZ A;  1Q8K A;  1ZOT A;  4ZIT A;  2CQB A;  3D28 A;  4USU A;  1CS4 A;  3AJ2 A;  3EDQ B;  2N7C A;  2C2D A;  2HMI A;  2BJ9 A;  4NI2 B;  2PFD A;  3HFK A;  5LL6 d;  3B6B A;  1RHQ B;  2F9D A;  2CXE A;  3BF4 A;  3JQK A;  3PZP A;  4YN3 B;  1VOM A;  1VRU A;  5HBM B;  4YP3 A;  1CJK A;  1P27 B;  2BE2 B;  1J5E F;  3OBI A;  2WVB A;  3A12 A;  1NK0 A;  4WFZ A;  2HRT A;  1REV B;  1R0B G;  2XBP A;  3GR1 A;  3NGS A;  3UVJ A;  3OHB A;  3W66 A;  5DDR C;  2NR0 A;  3J80 Y;  1U2F A;  3PCO B;  4RWW A;  2HHW A;  5H1S V;  5L8R C;  2FLN A;  1NK7 A;  2J7W A;  3DYA B;  3K5N A;  4K50 A;  1TFY A;  2EKN A;  2A0F B;  2PMW A;  4I6W A;  4FXV A;  2VBZ A;  5I3P A;  2P5V A;  4DV1 J;  3FZ2 A;  4IOB A;  4QWE A;  4NLR A;  2UV8 A;  2BJ7 A;  2ZBR A;  4CCH A;  4B3S J;  4KO0 A;  4JI0 J;  4DHV A;  3DRP B;  1D3W A;  4DL5 A;  4P7V A;  4DL6 A;  1DTT A;  2ZOF A;  4OIX A;  1S9G B;  2M88 A;  3KJF B;  1A0O B;  1I3O B;  1RAI B;  4I1T A;  3SSR A;  3WBZ A;  1JJC B;  3OXL A;  4ZP8 A;  2JLG A;  5BYQ A;  2PT0 A;  3EE3 A;  4FVM A;  5CZX A;  3ET6 B;  4ECZ A;  2ZH4 A;  4DX6 A;  4U7U D;  2NLW A;  3EIC A;  1SPB P;  1ARO P;  1C4A A;  2OO4 A;  4K0K J;  1RAE B;  5KG0 A;  3BGR A;  4IDK B;  4HR2 A;  3GJQ B;  2E5G A;  2MQO A;  2M2B A;  3HX9 A;  3R6G B;  4KE5 A;  2GVD B;  3V6D A;  3TZX A;  1Q82 T;  5HVF A;  1UWB A;  1NBE B;  2OUG A;  3DI6 A;  1U6B A;  2V69 A;  2DHH A;  4CH1 A;  3P5B P;  5KFV A;  3SYZ A;  2L3M A;  3OLA A;  3M2V B;  1RZM A;  3LP0 B;  2A18 A;  3L4B C;  2E5L F;  4ZPV R;  2I5J B;  2W7O A;  3CC4 S;  4I56 A;  1RBL A;  1K0V A;  4TKT A;  3LA0 A;  2HGL A;  4LSL A;  1FWK A;  1W25 A;  1X5T A;  3IC1 A;  5DQI A;  3BO2 A;  1WAC A;  2B5J A;  2AWZ A;  5C24 A;  3QID A;  4DX5 A;  4OI2 A;  5CAA A;  4NLO A;  1L3S A;  6FD1 A;  3GYX B;  1RE1 B;  1NUE A;  2DXD A;  4WE1 B;  3JSM A;  1URR A;  2DEI A;  3TAP A;  4Y00 A;  3IBW A;  2RIJ A;  3M8Z A;  4DV5 J;  2F4V F;  2YNH A;  3IGV A;  4H4K A;  4OZ1 A;  1IKV A;  2E7X A;  3TAR A;  3K17 A;  4YB6 A;  2EG1 A;  1ROF A;  2MQP A;  1NHK L;  2G2Y A;  3NKY A;  2WB4 A;  4HT5 A;  2HNY B;  4MAK A;  5DS7 A;  1N88 A;  2ZH3 A;  3CCJ S;  4A8O A;  1AB8 A;  3O1L A;  4O4G A;  3T41 A;  5J2M B;  2BJ8 A;  3G8T A;  1CQN A;  1TTH B;  1J27 A;  1RT6 B;  2YH1 A;  1M1K T;  4C8M A;  1NZA A;  3DLG A;  5A8W B;  2EFP A;  7AT1 B;  1CJK B;  1IXK A;  2BE2 A;  2RAQ A;  2JLE A;  2ZE2 B;  4P7T A;  4RW9 B;  4Q5V A;  3F41 A;  3I31 A;  2UUB F;  2Y9H A;  3LPY A;  3EWG A;  1XR7 A;  3AOA A;  2MQN A;  3OXF A;  4XAK A;  4Y2I A;  2IVF B;  2IBK A;  3PO5 A;  2AX0 A;  5E3P A;  5A0Y B;  4C8L A;  2H3E B;  3HVW A;  3M8P A;  1OYE A;  4DL4 A;  4ZVT B;  3MGJ A;  2B6A B;  1N36 F;  4RNM A;  4LF4 J;  5SUH A;  1L3U A;  3VAH A;  5GAE I;  2GV1 A;  5J2P B;  1ZM9 A;  1RLD A;  1OY9 A;  3BS9 A;  3I9Z A;  1PIL A;  4O4R A;  1T05 B;  2JEG A;  3LTO A;  4CLU A;  1HPZ B;  4KPC A;  2QA1 A;  1X9W A;  3R5A A;  4PQU A;  4RW8 B;  2ZD1 B;  4RNH A;  2BW2 A;  1QSL A;  1C1B A;  3DMJ A;  1BQM A;  2E1A A;  3DHX A;  2UXD F;  2C3U A;  3B4D A;  3KXD A;  4HDG A;  4PAB A;  3GMG A;  1KLN A;  3HHN B;  1TZ0 A;  5KFF A;  3CCU S;  1VGY A;  2OI2 A;  2KZZ A;  1RAD B;  2MQQ A;  4P6Q A;  2KG1 A;  3CT9 A;  1X4C A;  1U7L A;  4XPC A;  4TQS A;  3ZFV A;  1U0S A;  2HFN A;  2OPS B;  2HAI A;  3RUB L;  4URG A;  1OPZ A;  2AKW B;  3G6Y A;  2GVD A;  3L3C A;  1ZS6 A;  1B70 B;  2W2Q P;  4N8N A;  1Y3K A;  2LEB A;  2CQC A;  2XMV A;  4GKK J;  4LFA F;  2B51 A;  4CRJ A;  1VQN S;  4G1P A;  1BQN B;  3C6U A;  4AXI A;  4V19 J;  4V19 X;  1GMW A;  1KC8 T;  2V0N A;  3D66 A;  1WI6 A;  3Q8V A;  4OYM A;  1Z2Z A;  4N41 A;  3EM1 A;  5KFY A;  4LIR A;  1S99 A;  3JAM U;  4J9N A;  4QWA A;  2BAB A;  2IM3 A;  3MM9 B;  1IBK F;  2EKY A;  2F4F A;  4OYO A;  3J7A N;  4KIA A;  2ATC B;  1IKW B;  2GIQ A;  2ATL A;  2VBX A;  3BSA A;  2D1C A;  1M5K C;  3D6T B;  2XB2 D;  4HKQ A;  3GZ7 A;  3PM9 A;  4NRU A;  3V5R A;  4HAC A;  3PJW A;  4OI4 A;  1MMN A;  3SBM A;  2YKO A;  3PX6 A;  1XMO J;  2OGU A;  3ZZO A;  1S6Q A;  3J7Y U;  1FFS B;  2CNK B;  4DPY A;  4P2F A;  4KHM A;  2OFH X;  3NGD A;  2GJF A;  4J9P A;  2VG5 A;  1RT6 A;  4ZIV A;  2KT2 A;  2MZ1 A;  2YQ1 A;  2ROG A;  4ZCK A;  5B0B A;  5AE3 A;  3N5B A;  1S1X A;  2AJ1 A;  2DGU A;  4F25 A;  3KK2 B;  1QLN A;  3M6V A;  3PYD A;  2COL A;  2HQI A;  4IKA A;  4PWU A;  1S10 A;  1L3V A;  4JI5 F;  1F3F A;  5M2R A;  4QIW D;  5E3R A;  1YHQ S;  4KY3 A;  1HD0 A;  5DDP C;  2FHO B;  4KQZ A;  4LUB A;  1UJ5 A;  4L72 B;  4U8Y A;  4RW4 B;  4B02 A;  1T9T A;  4BCA A;  4XIU A;  3Q8Q B;  1KHW A;  2CQH A;  4J91 A;  4M95 A;  2OSR A;  3TX8 A;  1PC5 A;  2IAJ B;  1MWQ A;  2MKJ A;  2NUU G;  1OSD A;  1JQG A;  2BAN A;  2ZIT A;  1PBA A;  3ZTR A;  4ZN3 A;  5A8K A;  3TYT A;  4E98 A;  2V4R A;  3MMB B;  2Y8Y A;  3R1L A;  4GC6 A;  7FDR A;  2GVZ A;  2AEF A;  3O5T B;  2MTL A;  4O3N A;  3VAF A;  4OV6 A;  2ZH8 A;  3QO9 A;  4X4U A;  1RT3 A;  2JDJ A;  2L9W A;  3EZ5 A;  1JLQ B;  1FKA F;  4HI1 A;  4B3T F;  1ELO A;  2K7J A;  3KG4 A;  3CC2 S;  3CMQ A;  4LJM A;  3BGL A;  4CTA B;  5KFO A;  3NCP A;  1JXL A;  1WC3 A;  4LRF A;  1M5V C;  3HD1 A;  4NLV A;  2ADB A;  2CJK A;  1NSA A;  1DQA A;  2CZ4 A;  3THT A;  4Q44 A;  3KLV A;  2E29 A;  1EKR A;  3CCS S;  3PW5 A;  4W92 B;  1B0T A;  1S6P B;  3IN5 A;  1N52 B;  1X8D A;  2QT7 A;  2FLL A;  2BQR A;  4MMO A;  2FHJ D;  3TUI C;  1X31 C;  3VCD A;  1U1M A;  4WU2 A;  4R5P B;  1XMQ J;  4X4P A;  5DG7 A;  4JI3 F;  2RH3 A;  4LT6 A;  3DOL A;  1IQZ A;  3KNA A;  4DQI A;  2Q79 A;  4E0D A;  2VU5 A;  2U2F A;  2VOD A;  3UCG A;  3CC7 S;  1FFW B;  2ADC A;  4M5D A;  4ERD A;  2ILZ A;  1JLB A;  2ALZ A;  5D0H A;  1S1W B;  2DHG A;  5IC6 B;  1EJ7 L;  2WON A;  8AT1 B;  2F3J A;  1WNE A;  3QT5 A;  2V8D A;  3UVJ B;  3AJD A;  3HM9 A;  1O8B A;  1I94 F;  3DDI A;  2FQQ B;  3GJS B;  4CZC A;  2WSE C;  5KFH A;  3G96 A;  1HNI B;  3M8Q A;  2R9L A;  1JNZ B;  4F4K A;  2OTJ S;  2E1R A;  3CXC R;  2BOA A;  3H8Y A;  5G4D A;  2ZBP A;  4X4N A;  5AXM A;  5B0D A;  2W25 A;  4RWX A;  3W9J A;  4OI6 A;  4ZPT R;  4OL8 A;  2FGO A;  4C0O C;  1NPK A;  1SB6 A;  1U2C A;  1QSY A;  1MG7 A;  1VQ4 S;  4WK1 A;  3QFW A;  3Q86 A;  2BUN A;  2E5I A;  1RXO B;  2H5J B;  2PA3 A;  3QNW B;  5HP1 A;  1S0O A;  4B9L A;  4ZPB A;  3NS7 B;  4OYB A;  3T5L A;  1KLM B;  1ZPW X;  4WP3 A;  3FSY A;  2G0C A;  1BQX A;  1NDK A;  1WWH A;  4RUC A;  4YB5 A;  4DQQ A;  1SXL A;  3RB3 A;  2Y1J A;  4DUT A;  3MM5 A;  2XS2 A;  3VGU A;  2VV5 A;  4C8Z A;  4DJB A;  1HBO A;  4Q2L A;  4BBY A;  3ZNU A;  4PG5 A;  3BPS P;  5ETQ A;  2PEH A;  3BYP A;  1OMS A;  1XTZ A;  5DLG A;  2J8S A;  4IFY B;  1WOS A;  2XY5 A;  4EU0 A;  1K44 A;  3LP0 A;  3EYZ A;  4DQS A;  1T94 A;  2BXJ A;  2DJW A;  4CM2 A;  2POK A;  2X3G A;  1GXL A;  4CLS A;  4M5M A;  3UDE A;  1QM9 A;  1UCN A;  2AD9 A;  2B4U A;  2OEM A;  3AD7 C;  1IKX A;  3T1Y F;  1WC5 A;  2HND B;  4HTI A;  2Y8W A;  4OZJ A;  1UJ6 A;  3R2D J;  3N79 A;  1MRO B;  1UPM B;  1CG2 A;  3NGR A;  5D78 A;  4UOG A;  2MEW A;  3PHE A;  2KXN B;  2J6U A;  1FRM A;  1U48 A;  5KFT A;  3JYT A;  3SIP B;  5C42 A;  4B3O A;  1HWL A;  1KQK A;  3I32 A;  4DG1 A;  2DRD A;  4A8X A;  1C4C A;  1NME B;  1KP6 A;  3G87 A;  3I56 S;  5H9F K;  1HBU A;  2DNN A;  4N77 A;  3THP A;  3K5M A;  5LMN J;  1N33 J;  3ZZZ A;  4NA3 A;  4OI1 A;  1AXQ A;  2VBW A;  1S1V A;  2LU2 A;  4M5D B;  2IY5 B;  1IR0 A;  5D3G B;  2VJV A;  1WTF A;  3FMW A;  1OWX A;  3H98 A;  2XCA A;  2RDJ A;  1T3O A;  3VAG A;  3CJ4 A;  3EJM A;  4MIB A;  2MYF A;  3FCW A;  4F7V A;  1T0T V;  1BHN A;  1Q0N A;  2IRY A;  2FJE B;  2Z2M A;  4BWJ A;  4LFC F;  2NZ4 A;  2PEB A;  3DRS A;  1SCJ B;  4DUZ F;  5E7O B;  4F3Q A;  3VHQ A;  2E9Z A;  3KYL A;  3TP2 A;  2H48 B;  4EBE A;  3ZXW A;  2L9N A;  2VFT A;  5KFJ A;  2GQ2 A;  3KHH A;  2ZWO A;  1T9X A;  4OLO A;  4QU7 A;  1VJQ A;  4EUV A;  1L3T A;  1YG0 A;  4JV5 J;  3UN5 A;  1F9E B;  4JI8 J;  1O5J A;  1EX8 A;  3K5L A;  1WF0 A;  2FLO A;  3GSD A;  3ISN D;  1VBY A;  5FDL B;  1IBK J;  4PG7 A;  1AT1 B;  1BY9 A;  1ULR A;  4CLZ A;  4AFF A;  4DV7 F;  2VPW B;  1KS2 A;  4OZL A;  2XY7 A;  2XS5 A;  3M8P B;  3OFG A;  3HK2 A;  1RJJ A;  4QR1 A;  5B08 A;  2ZZN A;  4Q0B A;  2A6O A;  5L46 A;  4L3N A;  2CVE A;  3FDS A;  4O0N A;  1P8G A;  3MM5 B;  2I1R A;  3CJK B;  3AD9 C;  5DGA A;  1NM2 A;  2R7O A;  2I38 A;  3G2X A;  2QA2 A;  4DR4 J;  3EGW B;  1SUQ A;  4EBD A;  1H2U X;  3OQ2 A;  4A46 A;  4YDD B;  4A8K A;  1JJ4 A;  4XDC A;  1WDT A;  1LW2 B;  2HZA A;  2HQ3 A;  2MZJ A;  4WWS A;  3FEY B;  1NB7 A;  1VDH A;  1U6Z A;  1PC4 A;  2AZ3 A;  2F8M A;  1VLO A;  3HDS A;  1YJ7 A;  3CJ2 A;  4B9M A;  2CQ4 A;  3LO3 A;  1IJF B;  4JI1 J;  2JEI A;  1VQP S;  3BO3 A;  3MHY A;  1SQE A;  2LDI A;  2IJF A;  2B7B B;  3AHP A;  4ER8 A;  1M5P C;  1XNR F;  4WU3 A;  1D9D A;  4PWD B;  2GAH C;  1XEZ A;  2OPQ B;  3NNH A;  5DZ6 A;  3GLJ A;  2UUA J;  4FN5 A;  1YBA A;  3QJP A;  1XJW B;  1XMB A;  2BJD A;  2MKK A;  1EET A;  3WX4 A;  3JYT B;  4J9M A;  4ECY A;  4RU2 A;  2JRS A;  4LVN P;  4BLG A;  2FHK A;  1HNZ J;  2YWF A;  1SVD A;  3ZTS A;  4ES2 A;  4JI4 J;  1IR2 A;  3RBZ A;  4CDI A;  2LLZ A;  2WW8 A;  3SCJ E;  3HXM A;  4LF7 J;  4AQY J;  2HVD A;  3MED A;  1HI8 A;  2PSZ A;  4G6V B;  4PQA A;  2YWE A;  3W2W B;  2MGZ A;  2FVP A;  3AY0 A;  3SQG A;  4ID8 A;  2FIU A;  3SSS A;  4OJ3 A;  1KQS R;  1HA1 A;  4DV4 J;  5KT5 A;  3V81 B;  4H4O B;  4B3R F;  2KH9 A;  4ZVU B;  4RW6 A;  4IQM A;  1FKP B;  3UWT A;  1GFW B;  3I55 S;  2M70 A;  3G8S A;  1UPP A;  1WHV A;  2YWW A;  4QR0 A;  1JLF B;  2WCX A;  1HHT P;  2MZQ A;  2HWH A;  2D41 A;  2JJ4 D;  2PMH A;  2W4C A;  3LP1 A;  3IR6 B;  2CPE A;  4NPO A;  4PPD A;  2W4P A;  4ANE A;  4ECR A;  1FNX H;  3H4B A;  2D74 B;  5IT4 A;  3CJ8 A;  5GAH I;  2QL5 B;  3LAL A;  3MMB A;  4AT1 B;  4O44 A;  5KFK A;  3QMQ A;  2DNQ A;  1EB0 A;  4Y3C A;  3U1L A;  3Q23 A;  1WF2 A;  2RIL A;  1TKT A;  2CZV C;  2DEJ A;  3DHW C;  4KHR A;  4QR2 A;  2J0X A;  3Q83 A;  4Q7A A;  3F0N A;  4LFA J;  2I9S A;  4C97 A;  3OV7 A;  5EN1 A;  2E1C A;  5A76 A;  1M90 T;  2Q6C A;  4OYX A;  2R2R A;  2ASY A;  2FZG B;  3IA0 A;  1LWC B;  3AOD A;  3UCU P;  1NJX A;  2JVO A;  4DN0 A;  3EXC X;  5KFD A;  1NDC A;  1OPI A;  2KFY A;  3VGS A;  2FLP A;  3MPU B;  5HMX A;  2WBM A;  3MAH A;  3LAN A;  5D8H B;  2G4B A;  1S6U A;  4ZA1 A;  4QPT A;  3PW4 A;  1FKO A;  3P96 A;  3C15 A;  5IV3 A;  5H9E J;  3MXH P;  3MZI A;  3K8W A;  1P9Y A;  4DR2 J;  2YX7 A;  1LW2 A;  3CW2 C;  3G82 A;  2GHW A;  4YY3 J;  1IBL F;  2V9K A;  3I96 A;  2L41 A;  1VBZ A;  4GKJ J;  4TXS A;  1HBM B;  2LEP A;  1RKJ A;  2X7I A;  3HHD A;  4FVC A;  5GAG U;  3OVS A;  1ZM4 A;  2OPR A;  5ETN A;  2AJF E;  1HQU B;  1N8R T;  4WZM A;  4J5O A;  1VBK A;  5J2N B;  1K1Q A;  1FRJ A;  1FVQ A;  4QIE A;  3UFC X;  3CCR S;  2YNG B;  2OD4 A;  2BBE A;  5A8R B;  5A2Q U;  3WX8 A;  2JX2 A;  3LWL A;  1APS A;  5ETK A;  1SH0 A;  4P75 A;  2LEC A;  4JYA J;  2UXC J;  4A4J A;  1UW9 A;  1YJU A;  2Y0S D;  4KR0 B;  3FSI A;  3A13 A;  2ZOM A;  3Q8P B;  3OL9 A;  1KSP A;  4KYZ A;  3MEG B;  1KOO A;  1SJQ A;  2E66 A;  3ENQ A;  4QOT A;  4ILR A;  5KFA A;  4F4Z A;  1R0A B;  2KYZ A;  3VZI A;  3GB0 A;  4PRF A;  1V5I B;  3A8J A;  3US5 A;  1WG5 A;  1HWJ A;  2FJB B;  3WQP A;  1TMM A;  4ECT A;  4AL5 A;  2HYI B;  1B0V A;  2V63 A;  1AFJ A;  1HMV A;  3W2V B;  4DR1 F;  1JMT A;  3IRX B;  4PUO A;  4KH0 B;  3X3U A;  5B0G A;  3TZY A;  1HBO B;  1WD6 A;  4YR0 A;  4B3T J;  3W63 A;  1B7Y B;  2ABY A;  4ES1 A;  3TVK A;  2KDO A;  2X51 A;  3OFF A;  1RA7 A;  2KN4 A;  5GAE U;  2J8A A;  2YKQ A;  4UQG A;  3MD3 A;  1N0V C;  1ZAW A;  3HUL A;  2JSX A;  4IG0 A;  2HLT A;  4P9S A;  4U8V A;  1UWA A;  4ZP7 A;  2VB6 A;  1IKY B;  4OYZ A;  1Q5Y A;  4F4A A;  2ZZT A;  1RWX B;  4PPZ A;  1HWI A;  1R8H A;  3UW1 A;  4CH0 S;  3R7N B;  4X65 F;  4YHH F;  1HBN A;  1RA6 A;  4DSE A;  1ZM2 A;  1RT7 B;  3QPI A;  4URQ U;  3HFV A;  2BR0 A;  1B99 A;  2W2N P;  3U7J A;  3OJU A;  1TFW A;  1U0H B;  1K1S A;  2O01 C;  1R89 A;  3DGP A;  4TLR A;  4IOC Q;  1ZYQ A;  1FJ7 A;  4NL5 A;  2ZDO A;  4ZJO A;  2UUT A;  3W8G A;  2W8L A;  4KB7 A;  4RBT A;  2VG6 A;  2DGQ A;  3DLK A;  1F3V A;  1JKH B;  1P9Q C;  2AJ0 A;  1NXI A;  3MAA B;  3UD4 P;  4ZLP A;  1DTQ A;  4PYD A;  2ZFH A;  4IFV B;  3ZTO A;  4WFA Q;  2AIR B;  3BKF A;  3ETM A;  2MXY A;  3HHE A;  5F0U A;  3PX4 A;  2XMJ A;  4IH7 A;  3CJR A;  4X62 F;  1N32 J;  4QBU A;  3M2R A;  3QT6 A;  3RG6 A;  2DNP A;  4ETX A;  3FKB A;  5LJ5 Y;  1B7F A;  3QIP B;  2ZWP A;  1N54 B;  3FZB A;  3IAS 9;  2WSC C;  3MM6 A;  3N01 A;  4O3R A;  1CEZ A;  2V50 A;  2PII A;  1HI0 P;  4B9T A;  4NCB A;  1SJF A;  2HWI A;  2VPX B;  2GGP A;  1Q4R A;  3NY0 A;  4CIO A;  2UV8 G;  3V4I B;  3DOK B;  3EVW A;  1V6H A;  2F63 A;  4MJK A;  3C3L A;  1LXJ A;  4I2Q B;  3C6T B;  2OTL S;  1GEH A;  2V4J A;  4ED3 A;  2BOP A;  4RO0 A;  3TEG A;  2HUR A;  4UOC A;  3VQS A;  1MSW D;  1VRU B;  3T1H F;  1YK9 A;  2CQ0 A;  3S7R A;  4DEZ A;  4EYI B;  4FPI A;  1TL7 A;  1X9S A;  1Q1K A;  4ZK7 M;  3IM8 A;  3T5H A;  4EEY A;  1C2P A;  1M1G A;  4RL1 A;  1F5B A;  3DRS B;  1ZZN A;  4IQX A;  4P74 A;  2HRY A;  5IV4 A;  2XY6 A;  4LF2 A;  3OHA A;  1F9H A;  1KD1 T;  3NMA A;  2KYX A;  3GP9 A;  4G1I A;  2KRR A;  5K8N A;  3R6L B;  2IVY A;  3H0P A;  4KO0 B;  3MUV P;  1FA0 A;  4X4V A;  1KVJ A;  1GX5 A;  2NZC A;  2VAS A;  4G1Q A;  1S59 A;  1R6Y A;  3QFH A;  3QJL A;  1G7C B;  4MKB A;  2E7W A;  3BDE A;  1HKA A;  4QYZ J;  1JJH A;  2C2O B;  3IP0 A;  1IKY A;  1F5A A;  2OLW A;  5C2C A;  4X4T A;  1WHY A;  2CDR B;  1VRT A;  4M5H A;  3W9H A;  4LSN A;  5KT7 A;  1X0F A;  4ILL A;  2DCL A;  3DYA A;  5JUM A;  1WG1 A;  2CWK A;  4WTY A;  3BGR B;  3MEE A;  2QZ8 A;  2XSJ A;  2MLZ A;  4RBV A;  2DXE A;  3MCN A;  3A3O B;  2UUB J;  2UVU A;  3BKT A;  4FXW A;  2O67 A;  4NLU A;  1IQT A;  1H6K X;  1S0V A;  1WC1 A;  4JB8 B;  2JVR A;  3Q2T C;  5B7W A;  2ROP A;  3H90 A;  3SDE A;  1N36 J;  3ET6 A;  1N6Q A;  3HSD A;  5KG3 A;  1QSS A;  2DGT A;  4JI7 F;  2MKC A;  5CYJ A;  4NYP A;  5EGY A;  4U6P A;  2XGQ A;  1XK8 A;  1I5O B;  3HT3 A;  2KL8 A;  3KHR A;  1N32 F;  5C5J A;  4A8M P;  1XR6 A;  4WFN Q;  3CNQ P;  3PRB A;  4PXE A;  2CA9 A;  4M8L A;  1VIO A;  4F0K A;  2ZH9 A;  3HZG A;  2BJ3 A;  3J80 U;  1V5V A;  3HZE A;  2YNH B;  3CD0 A;  2FVS A;  2OJ3 A;  3BV8 A;  2FTR A;  1XBW A;  4MT1 A;  3V6J A;  2QG9 B;  3AOB A;  3NS5 A;  5I3U A;  1RTJ B;  1JLG B;  3MCM A;  3UR0 A;  1QE1 B;  1AZS A;  3LP1 B;  2I5J A;  1DQ8 A;  2AT1 B;  1X5S A;  1AA1 B;  4QJV A;  4O23 A;  1RAB B;  2R7V A;  4P73 A;  1TEL A;  3DLG B;  3DM2 B;  4LR8 A;  3DU5 A;  2XMA A;  1C1C A;  3C16 A;  3SXL A;  5HRO A;  3IWN C;  3D1O A;  3KK1 A;  2RRN A;  2VON A;  4IR9 A;  2AHO B;  3ILI A;  4ZCI A;  4WBF A;  4GKK F;  2GCF A;  2HK3 A;  5KFL A;  1ITP A;  2XNQ A;  1NKB A;  4RNO A;  2CNL B;  3RBE A;  5A2Q Y;  5HLF B;  1IKV B;  4RBU A;  3J81 j;  3CJQ A;  4LF9 F;  1FJG F;  3K5P A;  4C6A A;  1B3T A;  1C0T A;  2X1B A;  1X4A A;  1Y3J A;  2UZA A;  1K8A T;  1Q95 G;  2HNY A;  2F4V J;  3H59 A;  3W61 A;  2R7T A;  2DO4 A;  1R8P A;  1ZAX A;  2RUS A;  3MEK A;  3IWX A;  3OTB A;  4GRS A;  1BD6 A;  1T9U A;  4LR9 A;  4AQY F;  3BDP A;  2HRU A;  1XIQ A;  1S9E B;  1SL0 A;  5E5N A;  5EUH A;  3GU0 A;  1SL1 A;  4NXN J;  4KGX B;  3KUH A;  1M5O C;  5GAG I;  3CJ5 A;  1Y5I B;  5EWE A;  4NCA A;  2IVM A;  1M5S A;  1NDP A;  5E0O A;  5BXI A;  2OFG X;  1SKW A;  3M2U A;  3BKU A;  3I5A A;  2GO9 A;  2O3D A;  4X84 A;  5H9F J;  2MZR A;  1CC8 A;  3CD5 A;  2P8I A;  3FRZ A;  2IM1 A;  3ITH B;  4YR2 A;  4OX8 A;  1BWE A;  4NZ0 A;  1YKW A;  1NO8 A;  1S1U B;  1YX2 A;  1U1Q A;  1VBX A;  3W5X A;  3WIV A;  4PXC A;  3UNY A;  1HR0 F;  2IMW P;  2ZNY A;  2YBV A;  5CA5 A;  3O3L A;  5HQL A;  2NXE A;  2QLX A;  4YS2 A;  1TK8 A;  3I4P A;  1QDU B;  4I7F B;  1OY6 A;  2CYY A;  5J1E A;  2QLW A;  3GJT B;  3J81 Y;  2V8G A;  4CT9 A;  3V4I A;  2NUH A;  3EUN A;  3KJQ B;  2W01 A;  2YX1 A;  4V1A k;  1VI7 A;  1PBU A;  4J9L A;  1X5P A;  4C8N A;  4UT4 A;  4EO6 A;  3IR7 B;  2QTW A;  1HIY A;  1NAQ A;  2G9O A;  3MM9 A;  1HNX F;  4CNZ A;  2W9C B;  4ED7 A;  1YJ9 S;  3WC2 A;  1UFL A;  5E3C A;  3N6L A;  3V6K A;  3UD5 A;  3P4U B;  2XMK A;  2N4D A;  3EGV A;  4OV1 A;  2R2U A;  3RGI A;  1BQN A;  1H73 A;  2B9Y A;  3C6U B;  5B0C A;  5L38 A;  4LFB J;  2A6M A;  4WIQ A;  2RQM A;  1WEX A;  1NU4 A;  2CAD A;  4ZKA A;  1WHX A;  3NAI A;  4HI2 A;  1QAJ A;  1RU1 A;  2LA6 A;  3VGT A;  1RAF B;  2WRM A;  4UZB A;  4L3K A;  5L1L A;  1REV A;  4PZV A;  3G6E S;  3VZH A;  2AYB A;  4ZVO B;  1LK7 A;  2LDY A;  4PEO A;  2BKO A;  1VQ9 S;  2FDN A;  3C2P A;  2FJD B;  1NK5 A;  3A3P B;  3G8Q A;  1PJ7 A;  1E6Y B;  1U25 A;  1PCA A;  2YNF A;  4YUD A;  4Z2X A;  2C2E A;  2DPJ A;  2KFN A;  2YX4 A;  4ZVF A;  3T3F A;  5AXN A;  5DQH A;  2LXI A;  2E5L J;  2HBR B;  5D0R A;  4XK8 C;  4C9D A;  2MZT A;  3I5C A;  3BGO P;  1T9W A;  5E41 A;  1XMO F;  3M2V A;  1RAA B;  1R7I A;  2JLF A;  3BR9 A;  3FBC A;  2FYX A;  3F56 A;  4YFU A;  2BRK A;  1T3N A;  2UVV A;  1YGY A;  2E1P A;  3QSY B;  2B5J B;  5D0E A;  4NLG A;  2DXF A;  1PG5 B;  3BQ1 A;  2Y1I A;  3AH6 A;  2XMW A;  4CTA A;  2EW9 A;  4IDK A;  3UCZ P;  1OS5 A;  1E6V A;  4RPF A;  2FJX A;  2BV3 A;  3DC2 A;  3W1Y C;  1VFJ A;  3DRR B;  4ED1 A;  2D69 A;  2UU9 F;  2C3M A;  4EZ6 A;  1UWB B;  2XSF A;  2RVJ A;  4USH A;  4J37 A;  1U2R A;  2V68 A;  3N28 A;  3FEZ A;  3OR2 A;  5ETP A;  4ZVP B;  2C3O A;  2IM0 A;  4DLE A;  2VG6 B;  1KQG B;  3DRX A;  4USJ C;  2V2Z A;  2D3O R;  4PCQ A;  4ZP6 A;  5J2M A;  3NNA A;  1I1G A;  7FD1 A;  1IN0 A;  1PKU A;  1YIT S;  3OFH A;  4OX7 A;  3M05 A;  4IG3 A;  5C24 B;  3AXM A;  4DS4 A;  1T9Y A;  4ECV A;  1H3D A;  3M2R B;  4UQT A;  4WE1 A;  1OSC A;  2QRR A;  2CG4 A;  2LQB A;  1G3O A;  4OX9 F;  5KOX A;  5L9N A;  1CPZ A;  3R5C A;  3L7P A;  2B7C B;  3ENA A;  3R5B A;  1SL2 A;  2QIF A;  1S6P A;  3TNV A;  2FVQ A;  1HWU A;  2NS1 B;  3O6Q A;  3QGG A;  1LFP A;  1QUP A;  3IBF B;  2Z30 B;  2AU0 A;  1SJR A;  5GMK a;  2YTC A;  2JL9 A;  3MUM P;  2HZC A;  4M5K A;  4O4G B;  2EFN A;  3CDE A;  1CBK A;  4AND A;  1RP5 A;  2JC0 A;  2DD8 S;  3OFE A;  3QT8 A;  2N7Y A;  4A48 A;  4DI6 A;  2I0X A;  1TKZ A;  1PSD A;  4LBI A;  4H54 A;  4ZCM A;  1UZH A;  5KFM A;  4X65 J;  2RQK A;  3ENV A;  1HNV B;  4YHH J;  3DGV A;  3MD1 A;  3L09 A;  3VGV A;  3WDO A;  1YBU A;  2ZE2 A;  1S5Z A;  4WPA A;  1HQE B;  3AFG A;  3I0S A;  1HW9 A;  4ECX A;  4QYZ K;  1SC1 B;  1TL7 B;  4NCG B;  3LH2 S;  3SEO A;  3OJS A;  3OTO J;  2HHU A;  1TP7 A;  2FHM A;  3QGH A;  3WIU A;  3CTR A;  1TKX B;  2CPY A;  3NEK A;  4NLT A;  3TZW A;  2UVR A;  2HAF A;  3IS9 A;  1VIX A;  4OHX A;  2KHD A;  1LWF A;  2H65 B;  2GQC A;  3MOJ B;  3HVA A;  3OXG A;  4ZP9 A;  4CO3 A;  1I94 J;  2NPI A;  3PYG A;  3H7H B;  4XO0 A;  4NLP A;  5U47 A;  4ZJL A;  1LV5 A;  5B0A A;  3K57 A;  1KTQ A;  1WI8 A;  2HEK A;  3ZO7 A;  2ZM6 J;  1U1L A;  4KSE B;  2WOM B;  4HLB A;  3JTP A;  2R8K A;  4JI3 J;  2KZM A;  4DL3 A;  4FBT A;  1WG4 A;  4GVB A;  5DZ7 A;  4KKO A;  2LP4 A;  5K8O A;  5IS2 A;  2CQG A;  3ADA C;  3W64 A;  4DCP B;  3GON A;  4O3Q A;  1DBD A;  3AAW B;  3DXS X;  3GJR B;  4DCJ B;  2YXL A;  2Z4P A;  4F02 A;  3VR1 A;  3LUY A;  1CQM A;  2QE5 A;  3DDN A;  2DNY A;  2VC0 A;  4FF3 A;  1VQM S;  1UP1 A;  2HND A;  2MKS A;  4JV5 F;  1T11 A;  1UL3 A;  2APO A;  4AD6 A;  3GIL A;  3RB6 A;  1D8Y A;  2KB2 A;  1RTI B;  3ICL A;  4HAC B;  2KI2 A;  2BE7 D;  4OYI A;  1T03 B;  1YJV A;  4LR7 A;  3DLH A;  1PYS B;  3T1H J;  4TY8 A;  1J5O B;  2AEJ A;  5I3U B;  3J7Z 5;  1S6Q B;  1DUR A;  1TR0 A;  2J76 E;  2RE1 A;  4W4M A;  4L73 A;  1IWG A;  3HHL B;  4YQW A;  2CQ3 A;  3PO4 A;  3RW6 A;  3LGN A;  5ETO A;  1SI9 A;  4JOU A;  1Q79 A;  4ICL B;  5T7L B;  3KK3 B;  1VQ5 S;  5IQ6 A;  1BGX T;  4C3K A;  3MR7 A;  4KGK A;  3L9Z A;  2W1B A;  4MFB A;  1VIS A;  3E01 B;  3OR1 B;  2KXF A;  2GW8 A;  1H2T Z;  4C48 A;  1MRO A;  1TL3 B;  2BJ1 A;  3NBP A;  1CJT A;  5BYR A;  1D1U A;  1CJV A;  3SQO P;  2XZD B;  4M5G A;  1X4G A;  3U1M A;  1C0T B;  5CD4 A;  1B64 A;  2H51 B;  5IC4 B;  2GJI A;  3ZZY A;  4Y2K A;  4QZV B;  1V9O A;  3ZZR A;  2XNR A;  3RAX A;  4IO1 A;  1TKZ B;  2M3D A;  2OAU A;  1C1C B;  3C16 B;  1GTE A;  2AYG A;  3H4D A;  2YKM B;  2N82 B;  2CWX A;  3HPO A;  1JLA B;  3UDC A;  1IVZ A;  2R7U A;  2V67 A;  3GIJ A;  4HHU A;  5IZH A;  1FXR A;  4C3M A;  2N3L A;  3HMJ G;  4F67 A;  2WHO A;  1NH7 A;  5JJB A;  4C98 A;  3M9N B;  4USW A;  2DVI A;  3OL6 A;  4K4Y A;  2VPY B;  2XS7 A;  3K7R A;  3K58 A;  2NSB A;  2RJZ A;  4NML A;  2BKN A;  4N76 A;  4KPY A;  1UMJ A;  5CH7 B;  4DU8 A;  3C8Y A;  3OTD A;  3HI9 A;  4USI A;  4JI7 J;  2PI4 A;  1NSP A;  4B3R J;  3CSK A;  3JXO A;  5E3A A;  1WC6 A;  3G9C A;  2DKO B;  4RUA A;  5J1E B;  3GYG A;  3DOL B;  1N5V A;  2HFU A;  2QV6 A;  2XHC A;  2H5I B;  3M1V B;  1R8A A;  5HMY A;  2Z2L A;  4K4X A;  3QYY A;  1TK0 A;  3BR8 A;  6AT1 B;  3QRQ A;  3PVX A;  5HJX A;  4J9U E;  2AGP A;  4Z7Y A;  2VQF J;  1MNE A;  5MAO A;  2WVC A;  5L39 A;  1Q8L A;  1MN7 A;  5D0G A;  1TK5 A;  2NYI A;  1RT2 B;  4LFC J;  2XLJ A;  3KLF B;  1Q78 A;  4WYW A;  4DSL A;  2P9E A;  4TQR A;  1S12 A;  3RB0 A;  1NSK L;  3G71 S;  4EBC A;  3OUY B;  1TU0 B;  3FFI B;  2H5E A;  2MB0 B;  1HNW F;  1EET B;  1RU2 A;  2HS4 A;  2KVQ E;  4M5N A;  1HL6 A;  3AXK A;  3PYE A;  1VQY A;  2W9A A;  2HNZ B;  4DDF A;  3TQ1 A;  1RT1 A;  3CME S;  1JLB B;  1TUG B;  5B09 A;  3H2V E;  1TV6 B;  3W5Z A;  4RU9 A;  1HWK A;  2HGM A;  3UR3 C;  2EXU A;  3WZ0 A;  2KKH A;  4M5I A;  1Y4Z B;  5HQ8 A;  5AJ3 J;  2YKP A;  3BEG B;  5C7P A;  4ED6 A;  5HP1 B;  5HMW A;  5FD1 A;  5J2Q B;  2G2O A;  3ISN C;  3DDK A;  3KKF A;  2NYH A;  4JI2 F;  4KGZ B;  3EZU A;  1NLK L;  2ZVS A;  5F3Z A;  3TW0 A;  4CYU A;  4DPU A;  1XNR J;  2QFJ A;  2LYV A;  2R4F A;  3R7B B;  3ZTQ A;  1VQL S;  4DV0 F;  2M8H A;  1X5O A;  1T8E A;  1RBA A;  3MR6 A;  1JLF A;  1NB2 A;  4X2B A;  2XO7 A;  5FJ4 A;  1NPR A;  3IM9 A;  2QMX A;  3N5F A;  4CLP A;  1F5C A;  1DLO B;  3NS6 A;  1HFE L;  2DGO A;  4CLF A;  1XC9 A;  3NWR A;  2M5Y A;  1GXT A;  2L9D A;  2BMB A;  2CJ9 A;  4X64 J;  2AJ2 A;  3FUY A;  1WF1 A;  1K0T A;  4JI4 F;  1RGV A;  2K8G A;  3L7U A;  4CT8 A;  3FK4 A;  4J9Q A;  1MWZ A;  4MKA A;  3ZZT A;  2F8E X;  2OEK A;  2Y0B B;  2IC3 A;  4NOH A;  1Y5N B;  1LWX A;  2F7V A;  3ZC4 A;  2J9D E;  2D7S A;  2EEY A;  4DS5 A;  3PNI A;  2Y1R I;  2MST A;  1SH3 A;  2DY1 A;  2DH8 A;  2XQC A;  1BXN A;  1DHM A;  3AB4 B;  3NRB A;  5CYM B;  2HVI A;  2LQJ A;  2EBE A;  4FBU A;  3HJV A;  3C15 B;  1Z1Z A;  2WW4 A;  3M7V A;  3NG8 A;  3A3N B;  4FKX A;  1FHT A;  3T5K A;  1GMW D;  3WHI A;  2ILY A;  1DJ0 A;  4L74 A;  2IA6 A;  5AE1 A;  3EGZ A;  2R7X A;  3IO1 A;  3G6V A;  2KO1 A;  3RW7 A;  2PD1 A;  1U49 A;  3CB4 A;  1FE4 A;  1NPP A;  2B8Q A;  4P10 A;  5DET A;  1E6V B;  4GO7 X;  4PG4 A;  2HQF A;  3PDN A;  4CLL A;  2ZHB A;  3IRW P;  2DIS A;  4H4M A;  2CDQ A;  2Z57 B;  4ID5 A;  3GQC A;  2BM0 A;  2DCU B;  1FJE B;  4CLK A;  3POT A;  2R2T A;  4DG1 B;  2PO4 A;  3M6U A;  5GAD I;  1QY7 A;  3IBC B;  3H40 A;  2ZM6 F;  1WEZ A;  1CS4 B;  3BSO A;  2DTJ A;  1IBM J;  3QBC A;  1KVK A;  2RKI A;  2VG7 A;  3IG1 B;  4TNO A;  3U27 A;  5DG9 A;  3E51 A;  2YWK A;  5D4N A;  4X4O A;  2W7A A;  4IG3 B;  4CO2 A;  2M0G B;  2VL1 A;  4QYR A;  2HHS A;  1HI1 A;  1RT1 B;  2XYP B;  3GSI A;  4RJV A;  4DR3 F;  4IRD A;  2BQ3 A;  4J9R A;  2PMZ D;  1KBR A;  5D15 A;  2ZBI A;  1HQU A;  3AT1 B;  5IWA J;  5D77 A;  2XMT A;  4L76 A;  3M6X A;  1BLU A;  1TAQ A;  3IAM 9;  5ITH A;  4DMZ A;  1HW8 A;  3TRG A;  1HMV B;  2IDL A;  3EVO A;  4DR4 F;  5IQQ A;  4IOA Q;  4OYP A;  1NK9 A;  4CYU B;  3HSJ A;  2VFV A;  1FTC A;  3P8B B;  2DHS A;  3BYR A;  1AUD A;  2UUC J;  2I2Y A;  4DSK A;  2M9K A;  2RDD A;  3V4M A;  3OTC A;  1H2V Z;  1T95 A;  5LM7 E;  3FCH A;  3JB9 k;  5LSL A;  4NZ7 A;  3MPY A;  4NMX A;  1VYA A;  3JTO A;  2F9J A;  4PYA A;  3CCW A;  3JSY A;  5RUB A;  3O2I A;  5F8I A;  4RNN A;  3G4S S;  1IBL J;  4KRW A;  4UY8 5;  1ZA1 B;  2OSQ A;  2Z58 B;  1QAX A;  4ES3 A;  1GMU A;  4DFJ A;  1LWF B;  4OX6 A;  1JX4 A;  1P1L A;  2B9X A;  2OML A;  4FNH A;  1UVJ A;  1SC3 B;  3CE8 A;  4DR7 F;  3IRX A;  4ELT A;  2QLJ B;  2DRA A;  1UJ4 A;  3GE9 A;  4ZVH A;  1T03 A;  2NSC A;  1JLE A;  3W7B A;  2CJB A;  4PWW A;  5DLF A;  1UZD A;  4Q2M A;  3HHL A;  1WOR A;  1JKH A;  3MAA A;  3PAC A;  3PRD A;  3UE2 A;  3OTO F;  2AGO A;  5AXK A;  2P6S A;  2HZV A;  2V94 A;  2XYH B;  3D0H E;  1QAY A;  4F4Y A;  1LK5 A;  2IIH A;  5KFZ A;  4F26 A;  2KVI A;  1NHU A;  2OKQ A;  1U24 A;  4O0I A;  4IRK A;  3RTV A;  5HN0 A;  4CI0 B;  1DY3 A;  4EYH B;  2MMY A;  1N56 A;  3KJN B;  4RW6 B;  4R0J A;  2DT9 A;  3IGN A;  4OYA A;  1S4E A;  3HSG A;  4BC9 A;  1NJY A;  2GGP B;  2VD3 A;  1VQ6 S;  1O6X A;  1JK9 B;  4M1K A;  1VCT A;  3QWP A;  2ZC3 A;  3QGP A;  5KFN A;  4DQR A;  3VF0 B;  4LSL B;  1HQ2 A;  5KFQ A;  2VG7 B;  2EVZ A;  1RWO B;  3IG1 A;  1RWW B;  4BDP A;  3B8H A;  2CRL A;  2EC2 A;  3Q8S B;  3AOC A;  2G1D A;  4FYV B;  3DOM B;  1SIW B;  2XYG B;  4EFA C;  3VAJ A;  3N6N A;  2QSF A;  3P3D A;  1PJ6 A;  2HFV A;  3I6P A;  2RS8 A;  2HBZ B;  4QWD A;  1YSJ A;  3TVY A;  3UN3 A;  2XC9 A;  1CJV B;  5KFG A;  2MKY A;  3PKY A;  4NWB A;  3MTJ A;  2W7P A;  1JNR B;  4WFB Q;  3JS9 A;  3CCT A;  1KN6 A;  4Y34 A;  1HD1 A;  3HT0 A;  1ZM3 A;  2IRU A;  3BM7 A;  2HHT A;  4OZ5 A;  3KFW X;  1A6L A;  1HPZ A;  4C7Q A;  1LW0 B;  4YB1 P;  3R2C J;  5DM7 Q;  4PQU B;  1SQF A;  2CQI A;  1FX4 A;  3GFX A;  2W2M P;  3K8V A;  8ATC B;  3MFH A;  5LMU J;  2LMI A;  3ONQ A;  2F1F A;  4ATN A;  3DMJ B;  2QA4 G;  3KOA A;  3TJA A;  2X3D A;  1H7X A;  1TUW A;  2JZ5 A;  3C14 A;  1TKD A;  4P2S A;  4R8U A;  5M2P A;  4C8K A;  1LEO A;  1OIA A;  1PIE A;  5GVQ A;  2NPF A;  3CCV S;  1GQE A;  1VS3 A;  4ZDN A;  2WSF C;  1NND A;  4MH8 A;  5A0Y A;  4DN9 A;  2V9W A;  1KON A;  1O51 A;  4ZLN A;  4WKR A;  3MMJ A;  2R7Q A;  4U96 A;  3HVR A;  2VQE F;  4B9S A;  5CZV A;  5D4P A;  3Q0A A;  4WP8 A;  1RT2 A;  2UXC F;  4JYA F;  2F65 A;  3DRY A;  3KLF A;  2F40 A;  5DO2 A;  3QJJ A;  1W7W A;  2MZS A;  1KTV A;  2IJN A;  2VDH A;  3CMA S;  4Q8F A;  4QWB A;  4GO5 X;  3NMR A;  2A1B A;  2DNH A;  4DZ6 A;  3SSQ A;  3BPD A;  3M1V A;  2ZH5 A;  3R8Y A;  3GCX P;  2QMU B;  3EPI A;  2GNK A;  2ZHA A;  4YDX A;  1U8W A;  3HF5 A;  3CCM S;  1TV6 A;  4DF8 A;  2DNK A;  1VRT B;  3AB2 B;  5HJY A;  5DRK A;  3Q8R B;  3PV8 A;  3DNC A;  2P9G A;  4HVZ A;  4KAI A;  3MWB A;  1KDN A;  3TUJ C;  4HL9 A;  2R7S A;  3MEE B;  3IWL A;  2B4P A;  2JC1 A;  3FGV A;  4ECQ A;  4Z7C A;  4NZ6 A;  1HYS A;  2LXF A;  5K20 B;  1UET A;  5B0F A;  5KT3 A;  2B9W A;  4NLS A;  4DSF A;  4OHY A;  1KR4 A;  2HS0 A;  2B9E A;  2C2M B;  4CWB A;  4WZQ A;  2X1A A;  2IA0 A;  4OZN A;  4J9K A;  1UEK A;  1Z2L A;  3ZZU A;  2YVS A;  4DL0 C;  4O3S A;  1X60 A;  4JV2 A;  1MU2 A;  5ETL A;  1YWX A;  3DM2 A;  4EMD A;  2NXN A;  4CH7 A;  2ZH6 A;  3VAL A;  1Q7Y T;  3RBX A;  1NKC A;  4USK A;  1S1X B;  4LF6 J;  3KK1 B;  2WBR A;  3MMC B;  3SCI E;  3DLE A;  4XDD A;  3PR5 B;  3W2V A;  4URS A;  3BH6 B;  4N5S A;  3LPE A;  2JFD A;  5KFP A;  3M9M B;  1YI2 S;  1XQI A;  1Y10 A;  3O8W A;  4X66 J;  3OW2 R;  2FJV A;  2F8H A;  2KT5 A;  3BO4 A;  1JLG A;  3M8S A;  3NOC A;  2HG4 A;  2FVC A;  5M2U A;  4C8Y A;  1OQ3 A;  1JIH A;  2Q6B A;  1CSJ A;  3RZA A;  1ZTT A;  2AX1 A;  3ISZ A;  2QFI A;  2QL9 B;  3R1H A;  3R27 A;  4NYO A;  1TQL A;  1QJH A;  4GMK A;  1Y7P A;  2SXL A;  2W2P P;  4CO0 A;  1KEK A;  2IYI A;  3PR4 A;  4DR3 J;  1T7P A;  2M52 A;  2C3P A;  4A8F A;  2CG8 A;  3TZZ A;  3LGM A;  3TJ9 A;  4R8U B;  3KMS A;  4N8O A;  1FT8 A;  1ZTW A;  1S9F A;  2CPD A;  2A10 A;  1FRX A;  2IC3 B;  5EWF A;  5KFR A;  3MMA A;  5F8G A;  5L1I A;  1V3S A;  2AGQ A;  1U1P A;  1BUX A;  4ZLL A;  1A7G E;  4LBH A;  3MM6 B;  4DR5 F;  1FK9 A;  2Q43 A;  2EK1 A;  4J9O A;  1YIJ S;  2B0G A;  1UVM A;  3W8P A;  4HTJ A;  1RK8 A;  4ITS A;  2UUC F;  3K2Y A;  3TAQ A;  2CPJ A;  1FDN A;  1S97 A;  1LNQ A;  1RWV B;  3OD2 A;  8RUC A;  1QVG R;  4LF9 J;  1FJG J;  2R8H A;  3T9Z A;  4EGL A;  3MM7 B;  1U1N A;  2DR8 A;  4MYU A;  2UP1 A;  2HFS A;  5KFC A;  1RAH B;  4I2Q A;  4LRE A;  4IR1 A;  3CJ0 A;  2ZKU A;  4BHQ A;  3BBF A;  3M6W A;  3M2U B;  1JB0 C;  1NCL A;  2CJA A;  1RCX B;  1LXN A;  4R0E A;  3FQL A;  3ITH A;  3D5M A;  3KLG A;  3AA9 A;  4C8O A;  4GVL A;  4WYL A;  4CP5 A;  1YVF A;  2CQD A;  1GMV A;  4K5R A;  2RML A;  2JOQ A;  4ID5 B;  2IDE A;  2H4Y B;  3GCW P;  4WK3 A;  1EZZ B;  4OZ0 A;  2JFK A;  2YPY A;  4X64 F;  3QAU A;  1HR0 J;  1HYS B;  4R5P A;  3V2U C;  2VOP A;  5AXL A;  1O0P A;  2VF3 A;  3H20 A;  1V3R A;  1F1B B;  3DXB A;  3I9V 9;  5D6G A;  5AT1 B;  5KFE A;  3M4X A;  4N56 A;  1S72 S;  3FBB A;  1CUL A;  1LFW A;  1WC0 A;  1ZZF A;  1HAR A;  2CZ9 A;  2DHA A;  5A6W A;  2J5A A;  5G0R A;  4F0H A;  2AF6 A;  1UEV A;  2R3V A;  3QSI A;  2G0I A;  1LKZ A;  5KT6 A;  5K8M A;  3PX0 A;  1AW0 A;  1GNK A;  2CQP A;  3LGH A;  3UN2 A;  3CCQ S;  2MJU A;  3VV2 B;  1C0U A;  1G6B A;  4J90 A;  1HNX J;  5F3T A;  1VRQ C;  1L5U A;  4USM A;  1B0P A;  2QYG A;  3D4J A;  3JSB A;  4I69 A;  2XSJ B;  2RHS B;  2DNZ A;  3NXZ A;  1EP4 A;  4XPE A;  2X1F A;  3KJV B;  2Z2Z A;  2RS2 A;  1AYE A;  2BA9 A;  1JLE B;  1RQ0 A;  3BB5 A;  3CED A;  5GAD U;  3P49 B;  1KKH A;  4KV8 B;  1ACM B;  1RT4 B;  2KU7 A;  3UQS A;  3VVT A;  5CD4 H;  4IFY A;  2P2C B;  3W3S A;  3T5J A;  2DYA A;  2EFG A;  3K5O A;  4LSZ B;  4OYW A;  2KM8 C;  3BSN A;  1IM6 A;  2LVW A;  1R3N A;  2VC1 A;  1N6Q B;  2B43 A;  1MML A;  2ZJP Q;  4EWT A;  1S7I A;  1X4D A;  4ZLJ A;  1W2B R;  4KFB B;  3ZZP A;  5C25 A;  4B9V A;  4FYY B;  1IBM F;  2IJR A;  2HKE A;  1IKX B;  1FER A;  2G0J A;  4F04 B;  1AFI A;  2VUG A;  4F50 A;  1RYS A;  3DRR A;  4ED8 A;  2GZO A;  2YQ0 A;  2XEX A;  4XTT A;  1YJT A;  2DR7 A;  2IBO A;  3OR2 B;  5LJ3 Y;  1H0H B;  1QE1 A;  3ILL A;  2XWX A;  1RKI A;  2FUG 9;  2P9C A;  2ZKT A;  1FEE A;  2DIT A;  2QC3 A;  2V34 A;  4NLD A;  3BQ0 A;  2LQ5 A;  5LMU F;  3PTW A;  4K4W A;  3OTE A;  4ANC A;  5JMN A;  3N6M A;  2BM1 A;  1VHF A;  2VHG A;  4KGM A;  5KFI A;  3BGU A;  2EG2 A;  1ICE B;  3KLE B;  1WSR A;  3FEX B;  4J9S A;  1URN A;  2OPP B;  3I5B A;  4Y2A A;  5KAK A;  2DK2 A;  4TN2 A;  2EBG A;  1Y0H A;  2PGC A;  2VQE J;  1RTZ A;  1NJW A;  3G86 A;  3TVZ A;  1GX6 A;  4A8Y A;  4Q8E A;  5C42 B;  3UO0 A;  3MM8 A;  4B3O B;  1RTD A;  4LF5 J;  2XZW A;  2PA8 D;  2LEA A;  1RWP B;  5EX3 A;  5IFM A;  2MSS A;  5ETR A;  1PAU B;  5KFU A;  1Q8I A;  1PO6 A;  2WVD A;  3KNG A;  3WC0 A;  4LF8 J;  4C2M A;  1WOO A;  2IPO B;  1X4F A;  2YKN A;  3FRY A;  3TWZ A;  1NK4 A;  1Q86 T;  4DWI A;  2QO3 A;  4HEA 9;  4OJ1 A;  1IJE B;  3T1Y J;  1VC0 A;  2E5H A;  5F8L A;  5LOQ A;  3VAM A;  4DR7 J;  3AQO A;  2CAJ A;  3TAM B;  4QW9 A;  2GML A;  3I0S B;  2HW3 A;  4QIV A;  2DH9 A;  1CC7 A;  2MY7 A;  3KG0 A;  4MK8 A;  1XNQ J;  3B78 A;  3T9N A;  1B4S A;  1LWE B;  5HMZ A;  3M8R A;  2XTJ P;  4ZHR A;  4HHJ A;  1VC6 A;  3D1H A;  3TA1 A;  4OX9 J;  1S1U A;  3ILJ A;  4HH1 A;  5LT5 A;  3Q24 A;  2UU9 J;  1S77 D;  2HHV A;  4HDH A;  5LMN F;  4DSI A;  2ACM A;  1QTN B;  4OZ3 A;  1PJ5 A;  3S6E A;  4A8W A;  3HHL C;  1TL5 A;  4C3L A;  1S9E A;  2PI5 A;  3NNC A;  2KJV A;  3GR0 A;  1WUU A;  4NLY A;  4UY8 T;  1N33 F;  2KHC A;  3LAK A;  3TUZ C;  1DTT B;  4OHW A;  3U02 A;  2MQL A;  3GIK A;  3RU0 A;  3C14 B;  4K4Z A;  1FES A;  1HQE A;  3EPG A;  1UAW A;  5FDL A;  1CVJ A;  4RKU C;  5SZT A;  3QZ7 A;  4LF6 F;  2CPH A;  2IFX A;  3KTQ A;  2E5J A;  3DN9 A;  3PHT A;  4OJG A;  1YQH A;  2GHP A;  1VHI A;  3MR2 A;  2AP6 A;  1HHQ A;  2H4W B;  2ZH2 A;  4WFY A;  4FZV A;  4X66 F;  2OPQ A;  2RQ4 A;  2GA7 A;  3D6H B;  5ETS A;  3GV8 B;  3QWU A;  3F73 A;  1NK6 A;  2RB7 A;  3CUL A;  4NXM F;  4LFB F;  1RTI A;  3GG1 A;  4RX6 A;  1KQF B;  4D3G A;  4I7F A;  1SC6 A;  3V6D B;  4DV1 F;  1REG X;  4F3O A;  3D6M B;  1H7W A;  4CQ1 A;  1FWL A;  5F8N A;  1YZ6 A;  4ZPD A;  1KVI A;  1SJ1 A;  2HQC A;  2XMM A;  2DO0 A;  4USV A;  3PEJ A;  5F9N A;  1RTH A;  3KHL A;  1UVL A;  2AJ4 A;  1WEY A;  3DFE A;  2I6W A;  2PFF B;  1W26 A;  3PY8 A;  4U7U K;  4TY9 A;  1MU2 B;  3PJ9 A;  4NA1 A;  4WFX A;  4QPX A;  2W9C A;  1N5T A;  2A3J A;  2KRB A;  4MFB B;  1MMD A;  2WVE A;  5F0W A;  3MF5 A;  5DQG A;  5DG8 A;  3I87 A;  4FF4 A;  2V4Q A;  4ZVQ B;  1RBO B;  4DXL A;  1E6Y A;  1EQ0 A;  4WF9 Q;  4ETZ A;  2YNF B;  1MLA A;  2BW7 A;  1S0N A;  4JV0 A;  2R7W A;  5I42 B;  5LXY A;  1S4F A;  2GS8 A;  2MY8 A;  3BN4 A;  3OSP A;  4IRC A;  2A2D A;  2FY8 A;  3KK3 A;  1NSQ A;  2DR6 A;  1EKS A;  2HBY B;  2VFR A;  4YME A;  2VKR A;  3CIM A;  5DDO C;  3RAM A;  2H54 B;  4M5L A;  4U95 A;  1I6J A;  2VA3 A;  1H72 C;  1FD2 A;  2O66 A;  3CDA A;  4N7T A;  3AD8 C;  4DUY F;  1HNW J;  2QLF B;  3RRH A;  3OR1 A;  3OT9 A;  4H4O A;  2E1M C;  4DR2 F;  2UUA F;  1RAO A;  2BVZ A;  1X4H A;  2J0Q D;  2ZZM A;  1DFD A;  4CO5 A;  2O1P A;  5L1J A;  1CJT B;  3EVM A;  4FXD A;  3N9U C;  2L08 A;  5HVG A;  4LMZ A;  2VIH A;  3OLB A;  4QU6 A;  1RAG B;  3D2W A;  4WCE Q;  1NJI T;  1UA1 A;  1F2H A;  3M8Y A;  3RRK A;  2M4M A;  2VJU A;  2BEF A;  3PRV A;  4FYW B;  1RWN B;  5FLX Y;  2OEJ A;  1T05 A;  4LQ3 A;  2ZH1 A;  2WZ1 A;  3T19 A;  5J1P A;  1JLC B;  1OQ6 A;  2ZD1 A;  4OHV A;  1R6V A;  2GMJ A;  2C2R A;  3FBE A;  2V2K A;  3CJT A;  4I6Y A;  3HFZ B;  4LVO P;  3S1T A;  2W8K A;  1GT8 A;  3G82 B;  1JJ2 R;  2R8G A;  5K14 B;  4OQJ A;  4RW9 A;  3CIZ A;  1ZBT A;  3D0I E;  3DU6 A;  1S1T A;  3GIM A;  1YRX A;  4JI6 F;  1KRP A;  4F8R A;  1FE0 A;  2LFV A;  2HVH A;  2J0W A;  1QD1 A;  3TQE A;  4ELU A;  2RF2 B;  1FRL A;  1LWC A;  2ZH7 A;  3TI0 A;  2GJ2 A;  1DAX A;  1J2V A;  5GME A;  2IYG A;  2XG8 A;  1RCO B;  1RUS A;  2EI5 A;  2HPU A;  3KLI B;  3N0V A;  4K4T A;  2WAQ D;  3VVU A;  1FWP A;  4RW8 A;  2J9D A;  1U1K A;  1D9A A;  4I4B A;  5KTQ A;  3RR8 A;  1P1T A;  1ZPV A;  4NI2 A;  3SCK E;  5KT2 A;  3UDV A;  2UXB J;  4CM0 A;  6FDR A;  2CPZ A;  2HNZ A;  2R2S A;  3ULH A;  4BS2 A;  3CD6 S;  1OO0 B;  1WSV A;  1PAE X;  3T1A A;  2OIH A;  3KHG A;  2G2Z A;  4CNY A;  1Q7L B;  5J2N A;  3TUP A;  2LQ9 A;  3T6J A;  3SI8 A;  3IS9 B;  5A8R A;  1SQG A;  3GFY A;  2OPS A;  2GQQ A;  3QLH B;  4D3H A;  2N4C A;  2BDP A;  2MQM A;  2ZHO A;  5AE2 A;  4DR6 F;  4YY3 F;  2QEX S;  3OUY A;  3E2E A;  3KJV A;  2FVR A;  3R97 A;  1V3Z A;  3PIO Q;  1CUL B;  1VQS A;  2BQU A;  2C28 A;  5HBM A;  4FS1 A;  2ZBQ A;  5I3Q A;  1YJW S;  1X0P A;  3S8S A;  1R0A A;  1U45 A;  4NYZ A;  2MLX A;  5GMD A;  4ED4 A;  3HSZ A;  2HWT A;  2DGX A;  2ROE A;  3U1N A;  3VQT A;  3OVB A;  2FJA B;  4IO9 Q;  3D0G E;  5L1K A;  4ZJQ A;  4C11 A;  1D0E A;  4K8R A;  3SZ2 A;  2OHD A;  5FII A;  2AZ1 A;  1YZ7 A;  3B4M A;  4MKV A;  2XLK A;  4I67 A;  2RD5 C;  3NAH A;  3KUG A;  5IM0 B;  5KT4 A;  2VZ9 A;  2RDI A;  4P2X A;  3MUT P;  4DSJ A;  2V6A A;  4RW4 A;  2LQ8 A;  4QQB A;  5A6P A;  3DRP A;  4TYB A;  4DV6 F;  4LF8 F;  4AL6 A;  1EAR A;  5HQM A;  1VK3 A;  4U67 Q;  4DV0 J;  1DLO A;  3CJS A;  4ZS6 A;  1DQ9 A;  2CJX B;  1FFG B;  4IG0 B;  4ICL A;  5T7L A;  1DTQ B;  1S49 A;  3M30 A;  5CAB A;  4IFV A;  2NXU A;  5KG5 A;  2J7K A;  1FNO A;  2MLY A;  4Y2M A;  4J7C A;  2CFX A;  5FLX U;  1U4B A;  4HHH A;  1JLQ A;  4RW7 B;  2ERR A;  3X1L B;  3VWS A;  1S1T B;  4ZVG A;  1T9V A;  1WTB A;  2DB1 A;  4FP9 A;  5F8M A;  4K4U A;  1EQM A;  3PJX A;  4NRT A;  3NBP B;  4OFZ A;  2V2V A;  3DGP B;  4KC5 A;  5BYS A;  4P52 A;  4ZPW R;  1J5E J;  5KOW A;  1U8S A;  2IAJ A;  2V8H A;  1FJC A;  1RAJ A;  1XN9 A;  3MM8 B;  3MR3 A;  4DV2 F;  2XMU A;  2ZUA A;  3RYL A;  5B0E A;  3E8O A;  4EI2 A;  4EZ9 A;  2QA4 S;  2CPX A;  5HI7 A;  2DHX A;  5F9L A;  3OVA A;  3PG9 A;  1GAO A;  2VFU A;  4ZIW A;  3H5U A;  1NJZ A;  3NGT A;  1F2G A;  3JQJ A;  2XHW A;  2OPP A;  2YKM A;  3AJ1 A;  1SIZ A;  2DGW A;  3IXQ A;  3TOQ A;  4QCL A;  4NX9 A;  1U6F A;  3SFU A;  4TU8 A;  4ZOS A;  2E44 A;  4TVA B;  4AYB D;  4M94 A;  2Q3P A;  3GFH A;  3D7S B;  4BWM A;  2G1H A;  2C22 A;  1M0S A;  3PW0 A;  4NXM J;  5JVG Q;  2KFZ A;  3Q22 A;  1UFW A;  4C0H A;  4K4S A;  2UUW A;  3Q8U A;  3Q89 A;  3SCL E;  3THV A;  4ENO A;  3QRP A;  3CD7 A;  4NA2 A;  2C42 A;  2C2Z B;  2JWN A;  2RSQ A;  2V4J B;  5CCL A;  4F4X A;  4OLP A;  3L95 X;  3DLB A;  2UXD J;  1N5S A;  5A8W A;  1ZET A;  3CDU A;  1IM4 A;  2R42 A;  2FPH X;  3FMB A;  4R25 A;  1K73 T;  5IT9 Y;  3TAM A;  3HCX A;  1VQK S;  1S1W A;  3GIR A;  3PEH A;  4DU7 A;  3VTI A;  2NXC A;  3QAT A;  5LSR A;  1KLM A;  4LRD A;  3OL7 A;  2YNI A;  4Y28 C;  1R27 B;  1X9M A;  2B8P A;  3N4W A;  4DFM A;  1DZ5 A;  3I4H X;  4DBQ A;  5J2P A;  1NHV A;  4KJI A;  3TO8 A;  5T41 A;  2BAC A;  3MAQ A;  2AEM A;  4DPW A;  3CPW R;  3SV4 A;  2HQG A;  5KG7 A;  4IUF A;  1K9M T;  4KBI A;  2YY3 A;  3PW2 A;  2KT3 A;  4G1Q B;  3G6X A;  1VQO S;  3J7Y I;  2E9R X;  2HHQ A;  2LA4 A;  3SDE B;  3J81 U;  4DQP A;  4LRC A;  4UOF A;  4PR6 A;  3EXY A;  4X4Q A;  1JXE A;  2C2N A;  2V8V A;  2P6T A;  4B3M J;  4EK2 A;  3H5Y A;  3J7Z T;  5D4L A;  1FXD A;  5K9F A;  5J2Q A;  2CPF A;  2BE9 B;  2BYC A;  3TX0 A;  9RUB A;  5MLC V;  4Y0F A;  2QSW A;  4I64 A;  1SKR A;  4TLQ A;  1QAI A;  5I42 A;  2KJW A;  4JP8 A;  1RTJ A;  1VK8 A;  1R43 A;  2RU3 A;  2JH3 A;  1FO1 A;  4DZD A;  5T14 A;  1SJ4 P;  1RTH B;  4LRA A;  2YWG A;  1HBU B;  4QWC A;  1SBR A;  1ZA2 B;  2GO8 A;  3NP5 A;  4LF4 F;  5I4M A;  2VFS A;  1FRK A;  3UI3 A;  1MW7 A;  1FXL A;  5C2G A;  3NGU A;  5LXR A;  3TAN A;  3KK2 A;  4NXN F;  2HHX A;  4ELV A;  1D9F A;  1PYO B;  4C4W A;  5KG4 A;  3M9O B;  2QMW A;  3IMQ J;  1X4E A;  2FD2 A;  3NOG A;  5HLF A;  3ZNJ 1;  3HKW A;  3S01 A;  1WKK A;  3E3X A;  1Q81 T;  2ZOG A;  4WP9 A;  2QX0 A;  3NCR A;  3QT7 A;  2KG0 A;  2E9T A;  3UD3 P;  2NRE A;  2KTQ A;  1KFD A;  1JXV A;  1U02 A;  2HFO A;  5ETV A;  4A47 A;  1S79 A;  3QRR A;  2QN6 B;  2LCW A;  5CYM A;  5EWG A;  2VG5 B;  3JSR A;  1JLC A;  5HAN A;  4ZCL A;  4CLT A;  3MPW A;  5DGB A;  1D8Z A;  3CO9 A;  4G65 A;  3OSN A;  2GVZ B;  3SMZ A;  1TL1 A;  2CJQ A;  4DX8 H;  1RT3 B;  3DOM A;  5K14 A;  5D3G A;  1S7H A;  1XR5 A;  2IHR 1;  2RHQ B;  3FJ2 A;  4WTO B;  5LSO A;  1S0M A;  4DPX A;  4DL2 A;  2DNR A;  3ELH A;  4FYD A;  2NQP A;  5KG1 A;  1FF2 A;  2IRX A;  2ASJ A;  4WXW A;  3NLC A;  4E8U A;  2HBQ B;  3CDB A;  3HJF A;  2ZBC A;  1QUV A;  4FPR A;  3POT B;  2C3Y A;  3KLI A;  4NAS A;  3MCO A;  3P45 B;  9ATC B;  1LW0 A;  1RAC B;  2EWH A;  2GIF A;  2QYC A;  2ZUG A;  3D3B J;  3BN7 A;  3P5T L;  3LP2 A;  4MIW A;  3KLH A;  4DUY J;  3HKZ D;  1DRZ A;  4OI0 A;  3UDL A;  1SV5 B;  3QO9 B;  4HYK A;  4Y2C A;  5D4O A;  2OP5 A;  5IWA F;  1R8B A;  2WB1 D;  1H38 A;  3FQK A;  3PW7 A;  3OPK A;  1FDD A;  2J9E A;  1RHK B;  5IT0 A;  1YJN S;  2L48 A;  4DV3 F;  2I8E A;  2BX6 A;  4PXD A;  1FEH A;  2OH2 A;  4B9N A;  4DPT A;  1KNZ A;  1D09 B;  4DV7 J;  4WJB A;  1Z4U A;  5KFX A;  1HNI A;  3M8Q B;  1S57 A;  3CJK A;  1CJU B;  1F60 B;  1Q53 A;  3H42 A;  2YKA A;  3QLH A;  4KGV B;  4K7Q A;  5HVH A;  4DF4 A;  5H9E K;  1G4C A;  2HIY A;  1KHV A;  4LIW A;  2W4D A;  1SUQ B;  4WXO A;  5DJB A;  1RDR A;  4Z37 A;  2PC6 A;  4H4K C;  2RKI B;  1MWY A;  2HS3 A;  3EX7 B;  3J7A 1;  3K0J A;  5CHC B;  4KHP J;  1RHR B;  1KFS A;  2Y3Y A;  4PAA A;  4YOE A;  4RNF A;  4JI6 J;  3CCZ A;  3QAE A;  4KTQ A;  1FD8 A;  4K2X A;  1UW4 A;  2DPI A;  2ZDP A;  5KFS A;  1VLY A;  2ALY B;  1YJR A;  3RJM B;  2ZJQ Q;  2HHH F;  2K3K A;  2V5H G;  4K2J A;  1H98 A;  3HHK A;  4PG6 A;  4UTG A;  4DPO A;  3FVY A;  3B54 A;  3PFE A;  3MI7 X;  2EFQ A;  3EDR B;  4DFP A;  4JI1 F;  1FCA A;  2U1A A;  2XUL A;  4L75 A;  3PFO A;  3CO0 P;  1UA0 A;  4TU7 A;  4PWD A;  3DLE B;  2XWY A;  1RHM B;  1BC6 A;  2ZNZ A;  2EK6 A;  3D54 A;  1RI7 A;  4YR3 A;  1GH8 A;  2RRA A;  4C0B A;  4O3O A;  4FNI A;  4I6A A;  2JEJ A;  2GX8 A;  1ZAV A;  4I2P A;  2K2P A;  3GG0 A;  2GAG C;  4BC7 A;  2J6S A;  2MKI A;  3M32 A;  1IR1 A;  4K59 A;  1N0U A;  1BMQ B;  3H2U B;  2BZ2 A;  2MHE A;  2RUG A;  4F3M A;  2CNO B;  4E2F B;  2ASL A;  2VH7 A;  2J6T A;  3M30 B;  1N4L A;  1NRK A;  1FDA A;  3R5G A;  4GKJ F;  4ZMM A;  3SQG B;  4HH0 A;  3MPD A;  4RR5 A;  1GXU A;  2BKP A;  1Y5L B;  3DKD A;  1F0X A;  2FZK B;  3EGN A;  3V6H A;  2OEL A;  1FNM A;  4C11 B;  2XZT B;  3CCL S;  4F4W A;  1UVK A;  1VJW A;  2HGN A;  5IM0 A;  3A8K A;  4QIG A;  5GAH U;  1ZH5 A;  2FJW A;  4OI3 A;  2B3T B;  1Y9O A;  3IR5 B;  2W9B A;  1SC4 B;  3D68 A;  4MTP A;  1YLX A;  2NXJ A;  3TA0 A;  3LOU A;  4UF4 A;  1IBC B;  1IWA A;  4DFK A;  3MM7 A;  1FTR A;  2X1G A;  2JHE A;  5IXU A;  3HVT A;  1SJ3 P;  1FKO B;  4JBC A;  3LP2 B;  5IT9 U;  1HLW A;  2HVZ A;  4NE9 C;  4Y65 A;  2VPZ B;  4L6V 3;  3ENW A;  4MYT A;  5KG2 A;  1SV5 A;  3HD2 A;  3GV7 B;  2EC0 A;  5CYQ B;  2B4V A;  4RW7 A;  4ZVE A;  1YRT A;  1S1V B;  3CF5 Q;  4B3S F;  2MKH A;  4UZC A;  4DR6 J;  4PKD B;  2IMO A;  4DCO B;  3MMA B;  4FF1 A;  2ZC4 A;  2DY9 A;  1FK9 B;  3K89 A;  2AJQ A;  1X4B A;  3PIP Q;  2J0S D;  3D9B A;  4UUX A;  1N34 J;  2RQC A;  3GV5 B;  1Q8B A;  4OMF G;  3M8W A;  5ETT A;  4DR5 J;  1EAY C;  1M5H A;  1NDL A;  2DGS A;  1N5Q A;  2ZJR Q;  2J7U A;  4JUZ A;  3FC9 A;  1R31 A;  2OD6 A;  1FDB A;  5ETM A;  1PGZ A;  4F36 A;  1GTH A;  2YH0 A;  2VKZ G;  4UW2 A;  1FRH A;  2B56 A;  4CO4 A;  4X4R A;  3BGF A;  4W98 A;  4FF2 A;  3FNN A;  1HNV A;  1WOP A;  2PE8 A;  3AQP A;  2XCP A;  4GC7 A;  3CGI A;  1TUV A;  2CVI A;  2IM2 A;  4QIF A;  2OPR B;  2RU9 A;  3HLU A;  5EDW A;  4NCG A;  1TVR A;  1TL4 A;  3P6Y C;  2LU1 A;  4DV6 J;  1NK8 A;  3NCQ A;  2H9Z A;  2FC8 A;  2CQ1 A;  4M5J A;  4P71 A;  1NZ8 A;  3DLJ A;  4AXJ A;  5KFB A;  1VMB A;  1H74 A;  2C2K B;  1C0U B;  4OHZ A;  1UEU A;  4JV1 A;  1UVN A;  2FZC B;  3OL8 A;  2HMI B;  1KWM A;  2HFZ A;  3PYF A;  2DRB A;  1HNZ F;  3BRE A;  1OJ4 A;  3FBF A;  3MEG A;  2VOO A;  3BZQ A;  3F44 A;  3R5D A;  4ALZ A;  2WOM A;  5CXT A;  5G0R B;  4DX7 A;  2DBB A;  3QZ8 A;  1GK8 A;  2V8P A;  5HO4 A;  3L7O A;  4KKO B;  1RWK B;  4FDF A;  3ZZ0 A;  4X4S A;  1LOU A;  2LXU A;  4RZR A;  3LWM A;  2MHN A;  5K8P A;  2QLB B;  1YTY A;  2QL7 B;  3ETO A;  4WKY A;  2DR9 A;  1TKX A;  2R8I A;  4DV2 J;  1TAU A;  2YNI B;  3NGK A;  2V2Q A;  1WHW A;  4N47 A;  4CLY A;  3TA2 A;  2VIC A;  4UOH A;  4Q0B B;  4LQ9 A;  2EPI A;  3Q8Y A;  1WEL A;  3SV3 A;  2RNE A;  4FS2 A;  2DNG A;  1G1X A;  1RIS A;  4OZ2 A;  5CCM A;  1UKU A;  3UPF A;  3CWJ A;  5BR8 J;  1VQ7 S;  1Y00 A;  3MR5 A;  4TU9 A;  1XNQ F;  4U7C A;  3MPV A;  4TY8 B;  4PG8 A;  4ZN1 A;  1J5O A;  1FX2 A;  2EFO A;  3EZO A;  3GFZ A;  2AW0 A;  2R8J A;  3BBC A;  3DLK B;  1P6T A;  4GVB B;  2VA2 A;  1S48 A;  2QJ3 A;  3MCS A;  4F2S A;  1TMJ A;  5E3Q A;  1UVI A;  2JEF A;  3CDW A;  4DV4 F;  3MED B;  3W2W A;  2MGZ B;  2KM8 B;  3JAM Y;  3LQV A;  1FRI A;  4KH1 B;  3RR7 A;  1WKJ A;  1HBN B;  1F6T A;  2HLU A;  3E01 A;  3V81 A;  2B4O A;  1RT7 A;  3I82 A;  2FC9 A; 
#chains in the Genus database with same CATH homology
 3D6F B;  2HBZ B;  2CJY B;  1BMQ B;  2CNO B;  4JB8 B;  4ZVR B;  1RHU B;  2HBR B;  2H4Y B;  2XZD B;  2XZT B;  4ZVT B;  3R7S B;  2H4W B;  2H51 B;  5IC6 B;  5IC4 B;  3D6H B;  3GJS B;  2FQQ B;  1SC4 B;  2C1E B;  1IBC B;  3D6M B;  3IBC B;  1PYO B;  1RWX B;  3R5J B;  1RWM B;  2Y1L B;  2XYP B;  4ZVP B;  3R7N B;  4DCO B;  2CJX B;  3EDQ B;  2H5J B;  3QNW B;  3NS7 B;  1RHQ B;  4ZVQ B;  2CNL B;  2P2C B;  2DKO B;  4LSZ B;  2H5I B;  2HBY B;  4ZVU B;  2H54 B;  5K20 B;  1GFW B;  3IBF B;  2C2M B;  2HBQ B;  2QLF B;  4ZVS B;  3P45 B;  2C2K B;  2QL5 B;  3KJF B;  1I3O B;  1SC3 B;  2CNK B;  1SC1 B;  2QLJ B;  1RWN B;  1ICE B;  1QDU B;  3SIP B;  1RHK B;  2H65 B;  3GJT B;  1RWK B;  1NME B;  3GJQ B;  1I51 B;  2XYH B;  3R6G B;  2CNN B;  2QLB B;  3KJQ B;  2QL7 B;  2C2Z B;  2QL9 B;  3R7B B;  1RWP B;  1PAU B;  3KJN B;  4DCP B;  1RHR B;  3R6L B;  3GJR B;  3P4U B;  4DCJ B;  3RJM B;  1RE1 B;  2H48 B;  3EDR B;  2C2O B;  1RWO B;  1RHM B;  1RWV B;  1RWW B;  2CDR B;  2Y0B B;  1RHJ B;  1F9E B;  2XYG B;  4ZVO B;  1QTN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...