3BGFA

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
178
Chain Sequence
CPFGEVFNATKFPSVYAWERKKISNCVADYSVLSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
total genus 33
structure length 178
sequence length 180
chains with identical sequence S
ec nomenclature
pdb deposition date 2007-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgfA01
4L3NA 3BGFA 4L72B 2AJFE 4ZPWR 3SCLE 4ZS6A 3SCKE 4ZPTR 3D0HE 3D0GE 5DO2A 4KR0B 4XAKA 3SCIE 3D0IE 4ZPVR 4KQZA 4QZVB 3SCJE 2GHWA 2GHVC 2DD8S
chains in the Genus database with same CATH superfamily
1SKUB 1TL7B 1SJFA 1ROFA 3FK4A 2V50A 3SXLA 1NZ8A 4X66F 2LQJA 5EX3A 3CO9A 5KFJA 4BDPA 5A6WA 2XZWA 3MR5A 3WQPA 1REVA 1IM4A 1UL3A 1NPRA 2W25A 1E6YB 4ECZA 3PZPA 2IAJB 2V8GA 5BR8J 3CJKA 5F9NA 2E5GA 3MECA 3ZZUA 1I6JA 4B3MF 1KRPA 4DV1F 1U8WA 4ZN3A 3VAJA 5HATA 1RT3A 2YNIA 3TEHB 3A8EA 4RNNA 4V19X 2BEFA 3OHAA 2J7KA 1HQUB 4DV6F 2D9OA 1FK9B 1IR1A 4USMA 4NLPA 2GFFA 2QFIA 1NO8A 2YWHA 3PW2A 5EGYA 5F41A 1T3NA 2YPZA 1N54B 2L08A 1PAUB 1ICEB 2RNEA 2RDJA 3I9V9 1XJWB 1E6VA 4F4XA 4MYUA 5C24A 4F8RA 2VC1A 3QFHA 3PYGA 2B43A 3GB0A 4OI0A 4XAKA 2W9BB 4GVLA 3KTQA 3HFVA 4IOBA 1N5QA 4LF9J 4NLVA 1YWXA 5E3CA 4DFPA 1RTHB 3IBCB 3R6LB 4J5OA 2HHPA 2RDDA 3KHRA 1NAQA 4RUHA 4HHHA 2JEIA 3SI8A 2RJZA 2Y8WA 5K8PA 3VWSA 4FF2A 1R3NA 2AYGA 2J0QD 4DMZA 4TKTA 2XHCA 3LAKA 4JI4F 3D67A 5B0EA 2AYMA 2B0GA 2IVMA 4J9NA 4CO4A 4KJIA 3VV2B 2MKKA 5CQGA 2MEWA 4DFMA 2CPJA 3MUMP 3D7SB 1PAEX 4ILMA 2DHAA 4FS2A 3N0VA 4CLPA 4H4MA 3ZC4A 3TARA 1RTIB 3R5CA 1B0TA 2CZ4A 2E1MC 4YB5A 4K5SA 2Z2YB 1Y0HA 1HBOB 3H42A 1KNZA 2MQLA 1X5PA 3PJXA 4DPXA 3WC0A 3OFHA 3HSZA 3DDKA 3MMJA 3QGGA 2X1GA 2HHSA 2MB0B 1CJVB 3O6QA 3KLHB 1UJ4A 1EKSA 3MMAB 4NXNF 3U27A 2CQCA 3IS9B 3A1YG 3C3LA 4IUFA 2GQ2A 5T7LA 4LBHA 1YJTA 2M70A 1JIHA 1M5OC 1EP4B 3M8SA 4GO5X 2W9CA 4ES3A 4DU7A 2DXEA 3OL6A 1MLAA 4ELUA 2O5DA 1B99A 4JV5F 1K8AT 4PZVA 1EZZB 2EK6A 2OPPA 1WUUA 1PYSB 2R7XA 5L1KA 3MEDA 4CLSA 2H9ZA 1UJ5A 5H9EK 3OL7A 2X1BA 2DGSA 3KJVA 1LWFA 1ZM9A 4ZHRA 3Q86A 2MJUA 2DO4A 1Q81T 2ZHBA 2RS8A 4JI6F 5D3GB 1MU2B 3D0GE 4HKQA 4YMEA 2DY9A 3QBCA 3AXMA 3H0PA 3MMBB 1SL2A 4B9TA 2IM2A 1TMMA 4CP5A 4X65J 2XZTB 3I4HX 3R2DJ 3N9UC 4EGLA 4A8OA 3ONQA 4F4WA 2OPSB 2CUYA 2C3UA 4DV2F 2R3VA 3G6VA 3DLGB 1JNRB 4FZVA 3DN9A 3BSAA 1SQGA 1RJJA 4OX6A 2BR0A 2WSEC 3MD3A 2LXFA 3M2RA 2X3GA 1BQNB 2NQPA 2Y9HA 4R8UA 4WFBQ 1ULRA 1F0XA 1H98A 2LQ9A 3HJVA 3M2VA 3BN7A 2ZH7A 4C0HA 2UV8A 1GMWD 1PYTA 4C3LA 4TU7A 2CZ9A 4DEZA 4HHUA 1PJ5A 1YJ7A 1RBOB 1TTHB 1OJ4A 3G6ES 4GKKJ 2LP4A 2DIVA 3MM9B 3LA0A 2E5HA 2QZ8A 2AW0A 1ZETA 1ZM4A 2QJ3A 2HFZA 1L3VA 4DX8H 3Q0AA 1TL1B 3CIMA 3PJ9A 2KZZA 2B3TB 1RU1A 1XR6A 4ZCMA 4GC7A 4LFAJ 4O0IA 1T05B 2PMHA 4PKDB 1GXLA 4DV7F 3MWBA 1CPZA 3W60A 1A6LA 3RUBL 2WW4A 3J81j 4I2PB 2EVZA 5L1IA 2DHHA 3AJ1A 1N33F 2HQFA 4X62F 1NK7A 1WC3A 5HK4A 3RTVA 4YY3J 1G6BA 3SSSA 1U49A 4NYZA 1U1OA 1VJQA 2JFDA 5T14A 4DSKA 4DPWA 4L72B 1A7GE 1RT1B 3IRWP 4DPOA 2UUWA 3WIVA 4OX8A 3FSIA 1RT2A 1IUJA 4B9MA 2KU7A 3QATA 5CYMA 5A8RB 4B3SF 3K2YA 3I0RB 4RKUC 2CPIA 2Z57B 1JLEA 2H51B 1C1CA 4LR8A 3SSQA 4WJBA 3OW2R 1SKSA 4IRDA 2B7CB 1UWBA 3EZOA 3N28A 4EU0A 2HMIA 2E9TA 3OXLA 2CWXA 3DLHA 3BGLA 4LRBA 2EPIA 3UVJB 3UD5A 1ZTWA 3ITHA 1RHJB 4HI2A 4ZVPB 4UY8T 3CF5Q 2HHUA 1NCLA 3I9ZA 4RLEA 4ZMMA 3W9HA 5KG4A 2ALYB 2DNGA 2RH3A 4C3KA 2W2OP 3SZ2A 3QRQA 2B4VA 3HI9A 1VHFA 4CO5A 4ECQA 2XLJA 4E98A 2HBYB 2A1BA 4UQTA 1OYDA 4CH0S 2R2RA 1ITPA 4A8QA 2I9SA 1V5VA 2BJDA 3CJQA 2IVFB 4DCJB 5K20B 4Q0BB 4FXWA 1KVJA 2XWYA 3WHIA 3VAHA 4LFBJ 5KFVA 1M5SA 1NEEA 1HARA 2N7YA 3AQOA 1SC4B 4K8RA 1MG7A 3FMWA 2E7WA 4DL7A 8ATCB 3VGTA 3EDQB 2XMAA 4X66J 5GVQA 3N5BA 1IKVB 4Q43A 1TFYA 2PSZA 2DKOB 4GVBB 4KGZB 2XI3A 4CRJA 3DYAB 2RF2B 3OQ2A 3PR4A 3NNCA 4DV4F 4B3MJ 3MPWA 4DV1J 3I5CA 3PIPQ 4IO9Q 4UOHA 2MQMA 3UDLA 3QSYB 1DHMA 3S7RA 4ZITA 1N56A 4DV6J 3RW7A 5THWA 2RSQA 3EGNA 1FI4A 5KT4A 1HBNB 3J81Y 3NP5A 4OHWA 1U8SA 1HR0F 2B56A 1LWEB 1NM2A 4ICLA 4L74A 2I1RA 4J9PA 3BGFA 4MKVA 3UE2A 1RT4B 2V8PA 3OR2A 1SJ4P 1ZS6A 4Y2AA 4WE1B 3LAMA 2N3LA 1Q7YT 3R7SB 3CEDA 2FB0A 4KYZA 2PE8A 4NXMF 4J9MA 4CCHA 4NLSA 2VDIA 4DX7A 2E9RX 1VLOA 1TKZB 1NU4A 1HNWF 2FHOB 4OYMA 3QAEA 3Q83A 4Q7AA 2AT1B 1U1PA 4EYIB 1S5ZA 5ETQA 1J5OB 4CLZA 1YRXA 2FJEB 1Q53A 5IQQA 2OPRA 7AT1B 3D68A 3HZEA 3ENQA 2HFUA 2B4OA 4OYOA 4OJHA 2HS4A 4JI4J 5HLFB 5ITHA 4U95A 4RPFA 2H5IB 3KHGA 2ZUGA 3WDOA 1DQ8A 4J9UE 1LXJA 2HHVA 4QPXA 2MPUA 3P5TL 1IVZA 3AD7C 3H7HB 1WTFA 3PX0A 3EGWB 2N4CA 2AZ3A 3CD0A 3EPGA 2CJXB 2IMWP 4PABA 1R27B 3F56A 1S1XA 2CJAA 2CPXA 1KR4A 2FJBB 2V2ZA 1HI8A 3GYNA 2GMJA 3HKZD 2M9KA 3W5XA 4X4VA 5J2QB 2HHHF 2VFVA 2DH8A 4HTJA 1VQ5S 2DNMA 1F3VA 3CT9A 2FY8A 4PUOB 4NXNJ 2AJ4A 1UZDA 4IOAQ 2DGUA 1N5YB 2B5JA 2OTJS 2ZE2B 3TUZC 3HVRA 2ZBPA 2Q6CA 2VPXB 4KV8A 4M5IA 2HRUA 4TU8A 3OLBA 3FCVA 1NKCA 2M88A 2E7VA 4DL5A 2FC8A 2VJUA 4DLGA 2CQBA 4NLUA 2KL8A 5CZVA 4RW7B 1VQ4S 1R0AA 3U02A 1LOUA 4JV5J 4C2MA 2BA9A 4WU3A 2BZ2A 1VQ6S 4M5LA 4DPYA 4F7VA 1TKXB 2KM8B 2M2BA 2C2RA 1RBLA 4AT1B 1PIEA 2F7VA 3D5MA 1JKHB 4FDFA 2OD6A 5IWAF 2EG1A 1DY3A 3ISNC 1IBCB 3FCWA 4B9SA 1S48A 1N0VC 1S49A 3HVTA 1PILA 4CNZA 1DBDA 4ED4A 3PR5B 3W2VA 3BGRA 3QIDA 3FSYA 4JI6J 1W25A 3K5NA 3NCQA 2RQMA 1XNQF 3MEKA 4FF4A 2DY1A 5RUBA 4C6AA 3WC2A 3DRSB 1W2BR 3A12A 1YBUA 1V5IB 1SVDA 4HDGA 5HL7Q 4DV2J 2FLPA 1OSCA 2Y1IA 3NNAA 2V63A 2AX0A 3G71S 2EW9A 3V81B 4IFVB 3I87A 2EK1A 2M52A 2CPZA 4DG1A 5B08A 3TX8A 1WHVA 4RW8A 5BYSA 3D1OA 3QSIA 4IFYA 3CPWR 5BJRA 2ROGA 4X4TA 4CO0A 3PRDA 2V8DA 1MSWD 2DNZA 1IBKF 2YKMB 2PEHA 1MWQA 2YX7A 1QTNB 3M30B 4Z7YA 1SJQA 3HFKA 3MCOA 3BQ0A 2R7UA 4KSEB 2HBZB 2CA9A 5H9EJ 4IO1A 2Z0GA 3LWMA 2OSRA 2PFDA 5KFEA 2QSWA 3NOGA 4FF1A 1YJVA 3H8YA 2G0CA 3IWLA 2OFHX 1O5JA 3L3CA 1KLMA 1ZA2B 1RT6A 1EQMA 1FDDA 2LU2A 2YX4A 4DV7J 2LDYA 2YQ3A 4I2QB 4B08A 2XNRA 3VAFA 3PACA 3NS6A 3IRXB 3R5GA 2R2UA 2P6TA 2LVWA 1N33J 5E5NA 4PXBA 4N56A 4X62J 1QY7A 1LXNA 1NH7A 3KLVA 1EJ7L 1Y7PA 2R2TA 1S9EB 3RAXA 4ELVA 1RWNB 3Q2TC 4ZVEA 4B3SJ 4Z37A 2BW2A 2W2PP 5B0BA 3CC4S 5F8NA 2Y1LB 2L9NA 4YP3A 4PQUB 2KXHA 3M6UA 5KFBA 5DM7Q 2LXIA 2GO9A 2MSSA 3QO9A 3IXQA 1HI0P 1YJWS 2GW8A 1AZSA 1ZOTA 3MURP 2ROPA 1NLKL 3JSMB 2HFOA 3LPYA 2DNPA 4IH5A 4DN0A 1R8HA 3CJ3A 2DVIA 2ZHOA 5G0RA 3CDBA 1X0PA 2NYIA 1ACMB 3W7BA 2OIHA 2AYBA 1UFLA 3T3FA 1NJYA 5KG3A 2VICA 2X1FA 2Z4PA 3T1HF 1VJWA 3MAHA 3HHDA 3H5SA 4LBIA 4FN5A 2XYGB 2QFJA 1K73T 4MIAA 1XR5A 4ANCA 1ZPWX 3BBFA 2VL1A 4OV1A 1YIJS 5EX0A 5IS2A 4RW9B 2DTJA 3BGUA 3TZXA 2DIUA 3PEHA 4RO0A 2BOAA 1HHQA 2YNGA 4ZK7M 3PG9A 5GMEA 1RAEB 3ILOA 1N5TA 4DS5A 2ABYA 4EBDA 2G0IA 5C42B 4PXDA 1BUXA 1Z2LA 2ATLA 4DDFA 3OSNA 2YWWA 1CJKA 4QW8A 4DV4J 4UY85 4TYBA 3MUVP 1WI8A 4PRFA 3QGHA 2X3DA 2CQ0A 2L9DA 2DT9A 3L95X 1BQMB 1HBMA 4M5JA 4NWBA 3GQCA 2JC0A 3IO1A 4LQ9A 2BQRA 4Q8FA 1SPBP 1H2UX 1P9YA 2ZC3A 2YXLA 1MWYA 1JXLA 1RCOB 1S1UA 4WK1A 1QE1B 2UXDJ 1MWZA 2CJYB 1RAGB 1HR0J 4AE5A 2JLEA 3H5YA 1VCTA 2DNKA 2A10A 4DX5A 5M2RA 2EBGA 3P6YC 1JLBA 1QUVA 2H4YB 5I3PA 3MOZA 4RWXA 1X9SA 2QLWA 2RUGA 3CMQA 2LEAA 3J7ZT 2MQNA 4NXMJ 2IJFA 1Q7LB 1QVFR 2SXLA 3F0NA 1WOOA 4F04B 1HNWJ 4IG3B 3HKWA 5IM0A 2E1CA 1FXDA 1VYAA 4BC7A 5HMXA 2P9GA 3I0SB 1Y3JA 1Q4RA 1YLXA 1IKYA 5KG2A 5ETNA 1H7WA 4KT0C 5B0AA 2XO6A 2W8LA 2RQKA 3KFWX 2QMWA 4I67A 3G4SS 4F4ZA 1WSRA 4HR2A 4RL1A 3M9OB 1IBMF 4WTYA 3EMTA 3BKFA 2PN6A 5DDQC 2QLBB 5KFTA 1TVRB 1UETA 3D6MB 2P9CA 4ID8A 2G2ZA 5B0DA 4HTIA 1PO6A 3CMES 2ZOFA 4JV2A 1R89A 2CADA 3C16B 5DDPC 5HVHA 5HO4A 1X7VA 5AE1A 2OP5A 4KHMA 4ES2A 3K59A 1WC1A 2PI5A 2C3PA 2KYZA 3HCXA 4J9RA 1B3TA 4L75A 2VU5A 1UWAA 3FFIA 4ZLPA 4M5DB 3FBFA 4AL6A 3KLFA 1Q5YA 2HHHJ 2A18A 1UA1A 2YVSA 1T3OA 2K8GA 3ET6A 4USKA 1S76D 2J76E 4JUZA 2MQPA 3NOCA 1RZMA 2ADBA 4RNFA 2GHWA 4C98A 2C3MA 2R8GA 2WZ1A 3ZZOA 2ZBIA 3DOMA 2D1CA 2XCPA 1H72C 4OZ5A 1TL4A 1C0TB 1YBAA 2RHSB 3DKDA 4OZ1A 3L7OA 3CJTA 4J91A 1U2FA 4NLXA 1K1SA 2QE5A 3DGVA 1W26A 4ZP8A 3RGIA 1OIAA 5IWAJ 1TL7A 2AEJA 3LO3A 3GP9A 2VFUA 5DGBA 1RHMB 1RWWB 3MM8A 5C5JA 1FWLA 3ENAA 4F4KA 2K1RB 2G2YA 1XNQJ 2BKOA 4Q45A 3VAKA 2A0FB 1E6YA 3THPA 2IAJA 2HGMA 1U6FA 2MHNA 5KFRA 1NB2A 2G13A 1FFSB 2ZKTA 3H5UA 1RWXB 4OHYA 1NHVA 2HVDA 1DZ5A 4D3HA 4USTA 4JI8F 3GCXP 2J9DE 5DM6Q 4TNOA 1HQUA 1WHXA 3KHLA 3RR7A 1FK9A 2BOPA 2DNQA 4NASA 3V5RA 4LRAA 3TVKA 3TX0A 2MGZB 4C8ZA 2M3DA 5AXKA 2CZVC 1MROB 2F3JA 2VG6B 4TU9A 3OSPA 1A9NB 4R5PB 3CWJA 1S7IA 3GFZA 1YJ9S 1JXVA 3G8SA 3GWCA 4K7QA 1VK8A 5CYQB 2W1BA 4PEOA 1PBAA 4LUBA 1IBKJ 1V3RA 1RP5A 1Q86T 2W9BA 3BO4A 2VBYA 4K2XA 3LGNA 4UOGA 1BWEA 2CRLA 5I3UB 3GSIA 2KB2A 1RTHA 2GC8A 2HNYB 1QAIA 5H9FK 4EI2A 6AT1B 2VONA 3W1YC 3A8JA 2JJ4D 4YS2A 1QSSA 5EN1A 3M4XA 2JVOA 4WBFA 4WP8A 3HPOA 5D0HA 2HQDA 4LRCA 3TAQA 1SIZA 2HVEA 1I94F 2HYIB 3WIUA 1X4FA 2EC0A 2MKYA 4V1Ak 2B8QA 1RYRA 1CC8A 3HZGA 4ATNA 3S01A 3QZ8A 1B7YB 2LFVA 4U6PA 1Q8BA 2DHSA 3SCKE 4TLRA 3DOKB 1VC6A 3UNYA 2V9KA 2GJ2A 3LPEA 1JLCB 1NK5A 1N4LA 1PJ6A 4PYDA 2M8DB 1RTIA 5D4LA 3HHNB 2HZAA 4K5RA 5L9XA 4ECXA 1FHTA 1FRXA 3ZTPA 1OPIA 1HBOA 1VBKA 2NUHA 2Y8YA 3R2CJ 4UW2A 4LSNB 2ZZMA 3SQOP 1CJVA 1HQEB 3KLHA 1AUSL 3KK3B 3MMAA 1S1TB 2BQUA 2BUNA 4IQMA 1VQPS 3IS9A 3HHKA 1PJ7A 2HRTA 4G1PA 3CCLS 3NCRA 2UZAA 4TY8B 5EHHA 1F9FA 3IN5A 1EP4A 2HWIA 1NK0A 1RWMB 3IAS9 3TW0A 4OI4A 3PX6A 4NCBA 2XMMA 2C2NA 3BSNA 3PFEA 3M8PB 1U1LA 1T8EA 3LANA 4DLEA 3T1HJ 2GV1A 3T5JA 4F4YA 1IQTA 3OPKA 2KRBA 2KHDA 5F8HA 4DQPA 1RT5B 1C1BB 3MAQA 4QR0A 5L9NA 1N8RT 2KO1A 4DL3A 3PW4A 3MDFA 1IQZA 2DNOA 2KVIA 1YX2A 2E44A 2AJFE 4CTAB 4B17A 1UVMA 5D3GA 3TQ1A 1MU2A 1EX8A 2HWTA 1KQKA 1I3OB 2F40A 2UV8G 2E9ZA 2B9WA 3HJFA 1VRQC 3MMBA 2GVDB 1RB0A 2R8JA 2KT2A 3KMQA 3W63A 2ZJQQ 2YTCA 3B8HA 2JOQA 3PYFA 3KLIB 5B0FA 2OPSA 5L1JA 3DHXA 2K3KA 4RUBA 4CO2A 3DLGA 3O3LA 3AB2B 3OVAA 1RHUB 2AWZA 1L3TA 1PC5A 3BV8A 4CT9A 4OYPA 3CJ0A 2RAQA 1NDCA 4FS1A 4ZP7A 2VBXA 3RB0A 1BQNA 4URGA 2ASLA 2GAHC 1FRHA 3K5LA 5U47A 5B0GA 5A76A 3RB4A 5BXIA 2ZFHA 2HGNA 2LCWA 2C1EB 2VKRA 2Z2ZA 2CPDA 5E3PA 1X31C 3Q2SC 3MM9A 3T19A 3AOBA 3M6XA 1AA1B 6FDRA 4WZMA 4HH1A 1TL1A 3KUEA 2R7VA 1C4CA 5ETKA 3NCPA 1Q1KA 1D9FA 1YQHA 4KY3A 1T03B 3Q89A 4FVMA 3TRGA 4HDHA 4WPAA 4O4RA 4ZS6A 1HLWA 2XSFA 7FDRA 1T05A 3AOCA 2WBRA 2ZJPQ 1S97A 2W4CA 2JHEA 1SH3A 1WF2A 2HEKA 1UW4A 3P96A 2XYPB 2BW7A 2WAQD 2D9PA 2UUBF 2HW3A 4I2PA 2AEMA 1AW0A 1FF2A 2OMLA 4NLDA 2PMZD 2ZH5A 2FZKB 1NSQA 4PAAA 5B7WA 2I5JB 3M05A 1D8YA 3F73A 3BO3A 2I8EA 2ATCB 1HWKA 4M94A 2X1AA 3GIIA 2HAIA 4ZVSB 1IBMJ 1RT1A 3THVA 3HVAA 3IR6B 5DLFA 4P6QA 4Y34A 3PO5A 5A8RA 3PXGa 3I0RA 4EK2A 1ZYQA 1L3SA 3CDEA 1TAUA 2GX8A 4MTPA 5E41A 1DTTB 2D69A 4JI5F 1DJ0A 1P9QC 4JV1A 3BDPA 4OV6A 2JVRA 3DOLB 1FRJA 3NGUA 4DL2A 1U45A 5LM7E 5D6GA 3UVJA 2PO4A 5HANA 3CCSS 3J7Z5 2XHWA 2CQ4A 3TVZA 3FJ2A 1EARA 1M1GA 2LQBA 3TZYA 3CJ8A 3TEGA 3K0JA 3VALA 3B4DA 3S6EA 4WFYA 4WK3A 3IBWA 1WG1A 3ZTQA 3CCMS 1O0PA 4XPCA 4P10A 4DWIA 3MR3A 2GJFA 1SJ1A 5HBMB 5E3AA 1RUSA 4Q0BA 2AYEA 4DV5F 4OZJA 1KEKA 1VQ7S 3LP1B 4WP9A 4OQJA 2RB7A 3IMQJ 3GG0A 3UCGA 3DXBA 3H98A 1OQ3A 4K4XA 2NZ4A 1VIXA 3T6BA 4ZPWR 1IKVA 1IJEB 1VQMS 2WVDA 3FUYA 2PI4A 3QWPA 3GTYX 4LSZB 2W7PA 4B9NA 3R8YA 3HLUA 4GVBA 3CULA 3FQKA 2Q79A 5ETRA 1Q8LA 1R7IA 3DYAA 2RF2A 2KRRA 3DC2A 3PEJA 3CDWA 4CH1A 2VHGA 2B6AB 1T11A 3DLJA 3PYEA 5GMKa 1T95A 2BE7D 4JI8J 2KM8C 3EVMA 5KT2A 4QYZK 4DS4A 3PV8A 2HVIA 5I42B 4FKXA 1WACA 1RT7B 3PFOA 1HBNA 1MN9A 3TA0A 2UUCF 1LWEA 4DUZF 2ZKUA 2EBEA 3G96A 2EI5A 4QR2A 4M5GA 3H2VE 4M63A 2MY7A 1RT4A 2F4FA 2PMWA 3X3UA 4WE1A 3R27A 5KT3A 1NRKA 2NSBA 1X0FA 2B9YA 3E51A 1FEEA 1B7FA 2CDRB 4CLTA 3GSDA 4HEA9 2DH7A 1M1KT 4J9OA 2RMLA 1Q82T 1TKZA 3NAIA 4LREA 2Z30B 3NWRA 3DRPB 4DR4J 1VC5A 3UCZP 4J90A 1WDDA 1J2VA 1YRTA 3D3BJ 1J5OA 3C19A 4ZDNA 4NLWA 1XK8A 2Z58B 1P6TA 3LTOA 3D54A 1ZA1B 5BYQA 3HMJG 2G2OA 5D4PA 3KLGB 4XPEA 1I94J 3T1YF 5IV3A 5HLFA 4CDIA 5D8HB 1U25A 3Q23A 3MCNA 4Y65A 3Q24A 2BBEA 1SBRA 3TA1A 4X2BA 4EZ6A 1IWGA 1VQNS 1ZM3A 3BZQA 3UN2A 3N5FA 5KFGA 3VCDA 4PWUA 1VS3A 4USHA 1YVFA 4DBQA 4I68A 1NKEA 3GV5B 2CPHA 3ZTRA 4DZ6A 1FXLA 3D2WA 2J8AA 1OPZA 3LGMA 2DJWA 2VA2A 1NK8A 3SCLE 1TL5A 3R5BA 2GJIA 3A3PB 5KT7A 5J2QA 1RAFB 2YQ1A 2L48A 3FEXB 4OHZA 5T41A 1QD1A 2XMUA 3DM2B 5I3QA 4ECRA 1N48A 1XQIA 4PUOA 5E3QA 2VJVA 1N5YA 3N6LA 4IG0B 4KTQA 4OHVA 2ZE2A 3GFXA 2K06A 3NMRA 1RTJB 4ID5B 3HSGA 2Y1RI 2E66A 2I2YA 4ZJLA 2BRLA 4RW7A 1RKIA 1JLAB 4Q5VA 4KHRA 2FVPA 5H9FJ 2V4QA 3T1AA 2GHPA 4MAKA 2PDAA 5KFZA 3I5AA 4QWBA 1HPZB 1H2VZ 1GTEA 1TKXA 3N01A 2QLFB 3NGKA 4RX6A 4DOZA 3UN5A 4F3QA 1JKHA 1NJZA 2F5GA 1DARA 5CD4A 3OR1B 3EXCX 3UDVA 1NJXA 5CXTA 1KC8T 2ZH9A 2VODA 5DRKA 1VC0A 2IRXA 2FTRA 1M1HA 4CLUA 4YFUA 4AD6A 1WEZA 2V0NA 4MK8A 1SIWB 2CG4A 3BR9A 4C8YA 2Y1JA 2DR5A 4K50A 4OLPA 1HYSB 4OI2A 5KTQA 2AX1A 2VOOA 2RE1A 2EFOA 3DRSA 5IT0A 5A8KB 4HT5A 2YNFB 1F5AA 9ATCB 3CC7S 3EWGA 1U09A 1RAHB 1PG5B 3D6HB 3KUGA 1AXQA 2HURA 1REGX 2LECA 3PKYA 3SDEB 3V81A 2CQIA 5IXUA 4IFVA 4RBTA 4NRUA 1WHWA 5F3TA 4F36A 4FBTA 4P2SA 3G82B 1H2TZ 2L41A 2DNYA 2BJ7A 1D9AA 3DI6A 2IVYA 2GIFA 3E01B 4NLYA 3OVSA 2YKMA 4OJ1A 1BHNA 1FE0A 2QLXA 2ZHAA 3OXGA 3BYRA 3SYZA 3M30A 3FQLA 1VDHA 1DTQB 2DCLA 4I6YA 4RU9A 3CE8A 4JV0A 5HI7A 3BYPA 4TY9A 4A8XA 1GNKA 1CLFA 5EWEA 2BE9B 2DEJA 5KFLA 1ZPVA 4ZOSA 1F5BA 2DR6A 3R5DA 4ITSA 4DPTA 3PJWA 4AQYF 1MMLA 1LW2B 1HMVB 2AEFA 4I2QA 4TQRA 1XC9A 5ETSA 2XG8A 2UUBJ 3P3DA 1QDUB 5A2QY 4J9QA 5ETPA 3GV7B 1YG0A 2MZJA 3BREA 1D0EA 1UVNA 1R8PA 1YJNS 1BMQB 1UEKA 2AJ0A 1S9EA 2HRYA 3DLKB 3W9JA 2J5AA 4YR2A 1EETB 1FE4A 1RISA 1X4BA 1YGYA 3HHEA 4XTTA 2XQCA 1Y4ZB 4PQUA 2ACYA 2XS7A 4CT8A 1Z1ZA 2VH7A 2V4JB 4C9DA 4A4JA 4JI5J 5D77A 3NG8A 4OYXA 3JSMA 3M8WA 2J9EA 1PCAA 1HQ2A 1YJRA 3TZWA 1U24A 2OAUA 5F8JA 1TR0A 3QNWB 1EQ0A 1TZ0A 3TA2A 3O2IA 6FD1A 2QN6B 1U2RA 2AU0A 2HG4A 4P74A 2DPIA 4P75A 1DRZA 3K5MA 1VRUB 2W4DA 1LWXA 1AB8A 2Y0BB 4ZPBA 1HWJA 1IWAA 1T9YA 1JLQB 2LEBA 3MEEB 4C7QA 2CQPA 5CCMA 3JTPA 3V6DB 1GMWA 2CVEA 1B0VA 2L3MA 2W01A 4PPDA 2MZQA 2GO8A 5KG0A 3P8BB 3HM9A 2R7SA 4QIGA 4RW9A 1TV6B 4DV5J 5M2UA 1KS2A 3K17A 4DR1F 1U48A 2LMIA 2ZD1B 4DR5F 3CD6S 1HNIB 2MTLA 4PG8A 3DLEB 3OXFA 1WKKA 1WC6A 4K4WA 2F1FA 1WJ9A 1FDNA 2XO7A 1S12A 4PXCA 3AAWB 2W2NP 2F9JA 4OZ2A 3C46A 5C42A 3J7YU 2XSJB 2AHOB 5DS7A 4N8NA 3CCWA 3G6XA 1S9FA 4NL5A 2MZSA 5LSLA 4O4GB 4C0BA 3MM6B 3G87A 4QYRA 5CYJA 1RCXB 4KHPF 2VA3A 2E1PA 2H5EA 2FHMA 4AXIA 4JP8A 3GILA 3OL9A 4NMLA 4TXSA 1H7XA 2XB2D 1BQMA 2CJ9A 1VBZA 5KT6A 2IRYA 1HWIA 1FTCA 4G1QB 2M8HA 2XGPA 2EWHA 2FJAB 2RU9A 2BJ9A 1FRMA 4PWWA 1K9MT 2R7RA 1KP6A 2VF3A 1TELA 1QE1A 2ZBRA 3VQSA 1G4CA 4P72A 2FJDB 4P71A 1VK3A 2UUCJ 2KZMA 4FVCA 4DUZJ 1H6KX 2MXYA 2C42A 5CZXA 2VG5B 3DU5A 1BWVA 4M95A 1K1QA 2LA4A 3CJRA 2JEJA 3CJ5A 2G4BA 4OYAA 1AT1B 2V2QA 1BXNA 1QTMA 3GLJA 4OI6A 3JSRA 3ETOA 4EBEA 2FJXA 4OIXA 2GIRA 4IG3A 4N47A 2XS5A 2J0XA 2KG1A 3I0SA 1UAWA 3JAMU 3OBIA 4FF3A 4GKJF 5ETLA 3NKYA 4M5HA 2QL7B 2FHJA 1CS4B 4U8YA 1GTHA 1FRKA 2XLKA 2P8IA 3QYYA 1NHUA 1N34F 5A2QU 1K47A 2ALZA 3TNVA 3UD4P 4KB7A 4ALZA 2F8HA 3CIZA 2VBZA 4QU6A 3T1YJ 5D0GA 1TVRA 3DRRB 4DV0F 2V94A 2ZJRQ 2UP1A 3FRYA 3NWGA 3H90A 1XTZA 3R1HA 3BR8A 4EYHB 3EE3A 1TU0B 1JQGA 2ZNYA 3C16A 2F4VF 3CJSA 5KFOA 2OMOA 4QYZJ 4LT6A 1T02A 2X7IA 4WYLA 2N3OA 4NX9A 1L3UA 1CJUB 5KFDA 2NCKL 4C11B 4CQ1A 4DQRA 3GYGA 2PC6A 3FEYB 4DSFA 4IR9A 3OLAA 2IDEA 3MEGB 3PNIA 3QFWA 4M5DA 3H40A 3SMZA 3K5PA 2C2DA 3ILJA 4B3TF 4C8MA 1KOHA 3X1LB 1CULB 4CWBA 3CCZA 4TYAA 1RABB 1KHWA 1V3SA 4XDCA 3VQTA 3T9NA 3K8WA 2K2PA 5KFFA 2V8VA 4KE5A 2HK3A 4HH0A 4ZPCA 1RI7A 2YQ0A 4O23A 1KBRA 1S59A 3MPUB 1HL6A 4OL8A 3CB4A 5GAGU 2V9WA 3UW1A 1X4HA 2ZZNA 4ENOA 1RSCA 2WHOA 1FCAA 4YOEA 4JI2F 1C0TA 3J7YI 2HFVA 2QA2A 1Q8KA 4NLTA 2MKJA 1HD0A 3PDNA 4CI0B 2ZH2A 1C4AA 3FBCA 1HKAA 1ZBTA 3D4JA 4L3KA 4MYTA 3ETMA 4C8KA 2OEMA 4DU8A 1FJGF 3OFEA 1SQFA 2R2SA 1X4EA 2K1RA 1UW9A 3JQKA 2HNDB 2O01C 3UDEA 1RAIB 1FVQA 4K4UA 2MQOA 5AXNA 4N5SA 2JNJA 2Y3YA 4FYYB 2Z2LA 3QGIA 4ECYA 3HT0A 4KPYA 3GE9A 4ZLLA 3CD7A 1RTDB 3G2XA 3GJTB 4DR3F 1NJIT 1Z4UA 1MNEA 2MGZA 1S1VA 1MROA 5F9LA 2VG6A 2DGWA 4R5PA 3IR5B 2LEPA 3CCQS 2XMVA 3T5HA 1AROP 1XEZA 5DDRC 1VI7A 4DCPB 2BJEA 3GFYA 2NS1B 2YWGA 5CYQA 5KT5A 4ZPTR 4LRFA 3KKFA 3KLEB 1XIQA 4C0OC 4K2JA 1VR6A 3IAM9 3VAIA 1MW7A 4NI2B 4DF4A 2AD9A 3BSCA 4LSLB 1GXUA 5LXRA 4WFZA 3I32A 4IYQA 4OI3A 5DLGA 1I5OB 5C2CA 1UMJA 1R6VA 4H4OB 5HVGA 2AF6A 5I3UA 1MMDA 2C22A 1UFKA 2DR8A 1RAOA 4KKOB 3PRBA 3VVUA 3ZTSA 2G1DA 5KOWA 1VIOA 4F0KA 2HNYA 1SQEA 2CNKB 1BC6A 4IR1A 3OJSA 3CCTA 1FJ7A 4EMDA 2XMWA 4DSJA 4AQYJ 3P4UB 3P45B 4Y2KA 3D0HE 2FY1A 4LF8F 1S6UA 4JB8B 1U6ZA 3TUJC 2ASJA 3JYTB 4L73A 2HK2A 1BQXA 1UJ6A 4QWCA 4U7CA 4UT4A 3CCJS 5GADU 8RUCA 2UVVA 2KKHA 2OGUA 2OSQA 4HLBA 2CPFA 4XIUA 4QW9A 3TOQA 3DOKA 4LFCF 2C2ZB 3R7NB 3HHLD 5B0CA 1LK7A 1JLCA 3H25A 1YTYA 3GCWP 3OD2A 1RLDA 4F0HA 4YUDA 4UTGA 1X8DA 1QAYA 1WWHA 2QO3A 3RRKA 2VPYB 2KH9A 2FVRA 3E2EA 2B9EA 1FNOA 5J1EA 3NGRA 2L9WA 5GAGI 2RRNA 4LSNA 2FHJD 1I51B 1HQEA 1SJRA 3KK3A 1S1TA 4USIA 2CVIA 4KGMA 4PCQA 3QT6A 2C3OA 3T5KA 4I56A 2OFGX 4ZPAA 4K4VA 4TY8A 3AFGA 1OS5A 2D74B 1J5EF 3M7VA 1SH2A 1WKLA 4RBVA 1Q0NA 2DITA 1KD1T 3M8PA 4P2MA 2BDPA 4UUWA 3MM7B 1HBUB 3MR2A 2CWKA 2BM0A 4BWMA 2YKPA 5K8NA 1GXTA 1RT5A 3MMCB 3PTWA 1C1BA 3W8GA 1VQYA 2DB1A 1SV5B 2H3EB 3L9ZA 2FLLA 2V8HA 4CTAA 1X9MA 4OFZA 4XDDA 4DR1J 4DR5J 4WFNQ 1RU2A 4AYBD 3P5BP 2JRSA 2N4DA 4DX6A 2IHR1 1SI9A 1FNXH 4ED7A 4JI3F 2GVDA 2WOMB 4EO8A 4IH7A 5LL6d 2P6SA 4RU2A 3SFUA 3ZNJ1 3PKMA 3SQGB 2DXDA 3MXHP 1RHQB 2DD8S 2OPQB 1FX4A 3KLIA 3QAUA 2ZUAA 3ZZTA 2CPEA 2UXDF 4X4RA 4E0DA 1BD6A 2DR9A 2BANB 4KHPJ 1RWVB 1HHTP 2APOA 3K89A 3G6YA 2WSFC 3OVBA 3MM5B 3M6WA 1GMUA 1CC7A 1OO0B 2MHEA 3BDEA 2W7AA 5LMNF 2UXBF 2JLFA 1FXRA 5DQHA 2FIUA 3B82A 3FC9A 5IT9Y 4DN9A 2KT5A 2QYCA 4F25A 2YKNB 1B0PA 3FBEA 3KNAA 3MTJA 4ZCKA 3AA8A 4HHJA 1LW0B 5SZTA 3IP0A 2EFNA 2B51A 3EDRB 2V6AA 1NSPA 2H65B 2UVUA 1FTRA 2F9DA 4MMOA 1W2IA 1T03A 2Q66A 2RT3A 2GQQA 4S0MA 2RRBA 5GADI 2QLJB 3M8RA 1FVSA 2LLZA 2FGOA 5E7OB 1S79A 2WTFA 1X60A 1Q95G 1YRUA 4L3NA 5MLCV 5F0UA 2HVZA 1T7PA 2E5JA 3T6JA 3NGSA 2MJNA 2J6TA 4DFKA 2RKIB 3W9IA 4GKJJ 4P7VA 5K9FA 3I4PA 3POTB 2I5JA 3Q8YA 3F44A 4DQIA 2WVEA 1I1GA 2EFGA 2W7OA 1N34J 2IM1A 3C14B 1P1TA 4DL4A 3HD1A 1QSYA 1NUEA 4X4OA 1JXEA 1S57A 1RA7A 4DV0J 3EICA 2MQ8A 1AYEA 1HHSA 4MFBB 3AJDA 2N7CA 3GU0A 5L46A 3NGDA 2HBRB 2F4VJ 3C15B 2PGCA 1WKJA 2CFXA 2MZ1A 1YDLA 3FMBA 1DTTA 4KGKA 3VZIA 1UTAA 1FKAF 1UVJA 3CNQP 2D3O1 1UEUA 3ADAC 3CJ2A 5J2NB 2DRDA 4I64A 1NK9A 4B3TJ 2OHDA 4RNMA 2YH0A 5HN0A 5JUMA 2HSEB 5LJ3Y 4WXOA 1CG2A 1N36F 4E8UA 1UPPA 1RADB 3L7UA 4R0JA 4O0NA 1HIYA 5HBMA 1HD1A 3QRRA 5J2MB 1QJHA 4KO0B 3A13A 3NGTA 4CLFA 4A8MP 5C25B 2J7UA 2HIQA 1FDBA 4BS2A 2O66A 4JI2J 4NRTA 1AUDA 4AXJA 4I7FB 3DDNA 3LP1A 4O44B 4CLKA 4K0KF 1OY8A 4O3PA 1BLUA 3TJAA 1FO1A 3IWXA 4NE9C 2NLWA 1FJGJ 2QX0A 2R4FA 2RRAA 2P2CB 1LEOA 4O3SA 4A48A 4EUVA 2XYHB 4EO6A 4LQ3A 2XGQA 3JSBA 2AGOA 4ZKAA 2VDHA 4O3OA 2HHQA 2ZBQA 4JYAF 3G86A 1YK9A 5D0RA 2I0XA 1S6QB 1TKTB 4USUA 2B6AA 1OQ6A 4IDKB 3LP0B 4K4YA 1U47A 2ASYA 1IXKA 3J81U 2QTWA 4X4QA 1VGYA 3CCUS 4J37A 3IM9A 3MD1A 4DCOB 5I42A 5E33A 3ZZ0A 4DR3J 4F02A 4ED3A 1O51A 2AJQA 2ZOGA 4Q44A 2H1YA 3K7RA 1RT7A 3FBBA 1R8BA 3AB4B 1UA0A 3NAHA 1JLGB 2P9EA 5M2PA 3DOMB 4N41A 3HF5A 5IT9U 4QU7A 2D3UA 3W66A 3KDNA 3PIOQ 5DDOC 2J9CA 2VFTA 1IJFB 2XLIA 1F2HA 4GRSA 3AJ2A 1M5VC 5HVFA 2HIYA 3N79A 8AT1B 1WHYA 2ZC4A 3QJJA 4OX9F 1FFGB 3MM8B 1YZ6A 3DRPA 4PG5A 5KFIA 3SEOA 4QBUA 4UUXA 1RYSA 5K14B 2DCUB 2C28A 4FYXB 1IKWB 2MZTA 3TANA 1LQ9A 3QWUA 4LF8J 1TQLA 4R0EA 1VHIA 3KLGA 1FEHA 3VF0B 3V2UC 2HS3A 3RBZA 2EC2A 3QMQA 2WW8A 2C2KB 4BBYA 1GAOA 4ILRA 1PGZA 4LFCJ 3GONA 2XY7A 4KPCA 4O3RA 3GG1A 3I55S 2J0SD 2OKQA 2CNLB 1T94A 4LF6F 3VGVA 1WELA 1N32F 1SJ3P 2NPIA 4LRDA 4MH8A 1LV5A 2XY5A 4NA1A 1C2PA 4W90B 2ZITA 1NMEB 1KVKA 4G6VB 3GR1A 1VQSA 3IG1B 1PKUA 1RWPB 1JLFB 2ZBCA 5EUHA 2D41A 3DM2A 3RAMA 4AL5A 4V19J 1U6BA 3SBMA 1DFDA 2AP6A 4IG0A 4OHXA 2QC3A 3D3CJ 4HACB 3UDCA 2MLYA 1RTJA 4KRWA 1LNQA 4ID5A 1HNXF 1G3OA 4DR6F 4RZRA 2ZH6A 3GJQB 2QA4S 1XNRF 1UKUA 1J5EJ 4IH6A 3H5XA 2FUG9 2GAGC 5IFMA 2LA6A 1JLAA 2GNKA 1UP1A 1Q78A 3OTOF 1R0CB 4RW6B 1U1KA 2DBBA 4EWTA 3C6TB 1HPZA 2VFRA 4DSEA 3V4IB 5IQ6A 5CABA 2PT0A 2FVCA 3IBFB 4E2FB 5LXYA 5JVGQ 3OR1A 2LKZA 5A0YB 3ZXWA 3D6FB 1JB0C 1T9UA 3J7AN 3QLHB 3QRPA 2OO4A 3IM8A 4P73A 1DAXA 2COLA 4KBIA 2PEBA 1NNDA 5H1SV 4JI3J 5SUHA 2BKNA 3TAMB 1HYSA 3NS5A 7FD1A 1YHQS 3UR0A 4OJ3A 1B4SA 3R7BB 2YKOA 5A8KA 2VIHA 2YNFA 2DHGA 3ZO7A 2D3ZA 3M8YA 3AD9C 2QGFB 1ZAXA 3MAAB 2QG9B 4G1IA 4URQU 3U1LA 5HMZA 3SDEA 3DDIA 4ZVFA 1TK5A 2HLTA 5HJYA 5EDWA 2H5JB 3C6UB 2ZH3A 2LU1A 5JMNA 5LMNJ 1OY9A 2UXBJ 3HHLB 1U1MA 3PM9A 3IGNA 3O5TB 1O6XA 3G82A 1K44A 2W2QP 2CPYA 3BKUA 2VC0A 1QM9A 3FZ2A 2W24A 2NZCA 4CYUB 1C0UB 3E01A 1DLOB 1RDRA 2VQEF 4HI1A 3FKBA 1NHKL 3LWLA 2IY5B 2IBKA 1DTQA 3RB6A 2FC9A 2MZRA 1RWOB 2HVHA 4N77A 2JDJA 1FKPB 4I4BA 1MN7A 2WBMA 4X4NA 3BGOP 1N5SA 2DNNA 2YWFA 3L09A 5FD1A 3TVYA 3M2UB 2MKIA 1LK5A 4DR2F 1LW2A 4P2XA 1HMVA 3OTBA 2VFSA 1VRTB 1SC6A 3BF4A 2CG8A 2E7XA 2RQCA 3H4BA 1RACB 2VV5A 3DLBA 4Y00A 5KFNA 5KOXA 1IN0A 4B3RJ 2DK2A 3FEZA 1KKHA 1NDLA 1HNVB 1IR0A 5D78A 3ENVA 4F50A 1ZAWA 3BBBA 1HW9A 2AIRB 2B4UA 4WYWA 4WIQA 3MCSA 5E0OA 3DLKA 5LMUF 4BC9A 2YNHB 1EETA 1TAQA 1WOPA 1Y5NB 4ES1A 3A4TA 5LSOA 3V4MA 3M8QB 3KK1B 1NDPA 3MI7X 2PD1A 1NK6A 2MKHA 2Q1LA 3TUPA 2V4JA 1SKRA 2JEFA 4IKAA 4CLYA 2ROEA 3K5OA 3KK2B 3HP6A 1KOOA 1WEYA 2LQ8A 3EYZA 5KFKA 5JVHQ 4RJVA 5KG7A 3UFCX 1SXLA 4WP3A 4IQXA 3NMAA 4B9LA 3ILIA 1T9XA 3IR7B 1VRUA 4YB6A 1NBEB 2AJ1A 3RBXA 5F8LA 2KJVA 1LFPA 2KG0A 4DSIA 1JLQA 2CJKA 3MEEA 3M8ZA 1N36J 3W5YA 4F26A 3V6DA 1LKZA 4Y2IA 1BE4A 3RYLA 1U1QA 1FRLA 5GAHU 3QT8A 4DR7F 4NLRA 3ZZZA 3CC2S 3M6VA 2LXUA 2XMKA 1TV6A 5CH7B 3BB5A 2PIIA 2ZD1A 1FWPA 3LP2B 4A8KA 2V68A 1HNIA 4KIAA 4UF4A 1WF0A 3DLEA 1SB6A 4DPUA 3IWNC 4KGVB 4K0KJ 2YY3A 4NCGB 1TMJA 4WCEQ 3B54A 3BQ1A 1DQ9A 2E1AA 3Q8RB 4RW4B 4MIBA 1MMNA 2MDAA 1T9VA 2CQ1A 4ZJOA 1NDKA 3NL0A 1WOSA 1P8GA 2XSJA 3RG6A 1WF1A 2GGPB 4PG7A 2GA7A 2ZH4A 1N6QB 5LT5A 1RLCL 5CAAA 1G2EA 5FDLB 1JJ2R 4O4GA 4JYAJ 2Q43A 3MM6A 4LBPA 4A8FA 4W4MA 3ISZA 3D28A 2V67A 2YPYA 2XC9A 3GIRA 2UU9F 3MOJB 3GJSB 2JSXA 1D8ZA 2B4PA 3ZZYA 1UFWA 2I38A 2QIFA 3VGSA 4G1QA 1VISA 3Q8VA 2PA8D 4DHVA 2WVFA 1AFIA 4ZCIA 3KOAA 4WTOB 4B9UA 3NBPB 4L76A 1LFWA 4DR4F 2QMXA 3C66A 3KJFB 4PG4A 4DI6A 3QT7A 1CJTB 1ZM2A 4UQGA 4P2FA 3I96A 2NYHA 1KWMA 1F2GA 2VG5A 2FJWA 1H74A 3JSYA 2MQQA 4BWJA 2ZZTA 4RWWA 2XS2A 3KG4A 4NZ0A 4OX9J 3VAMA 2HNZB 2D7SA 3W64A 4F3OA 2MKCA 1WC5A 4LF1A 4C8LA 1JJ4A 2CXEA 2R7WA 4U9RA 2ASDA 2G9OA 1SH0A 4PG6A 4OYZA 3HSDA 2ZM6F 3CVKA 1Q5VA 2ZH1A 2BVZA 3EX7B 2JH3A 4UOCA 3C8YA 1CS4A 4JI1F 4JI7F 1ZZNA 3MPYA 2ZH8A 1TFWA 4EBCA 4JI0F 5F8GA 2Z2MA 3EXYA 1UPMB 2H4WB 4DV3F 2XTJP 3DRRA 1D09B 2Z8QA 2GS8A 2BJ1A 2ADCA 5IZHA 3AXKA 2E1RA 3GJRB 2WCXA 2IRUA 4DF8A 3EPIA 1J27A 2H54B 1FD2A 4CLLA 1APSA 1RK8A 4M8LA 1VQ9S 4P7TA 5CA5A 2KN4A 2GVZB 4L6V3 1CJUA 2C3YA 2VQFF 1SL1A 1TUVA 4C11A 1Y5IB 4LF6J 4XK8C 1N32J 5J1NA 1V3ZA 4RNOA 2YWEA 3LQVA 3MEGA 1RHKB 1U26A 2A6MA 4I1TA 4QIVA 2IC3B 1CULA 5GAHI 1T0TV 1LWCB 5HJXA 2OD4A 4X4SA 4PQAA 3QZ7A 3MFHA 2H48B 1QAJA 2HHWA 2R7OA 2D3OR 3PYDA 4OZLA 3KMSA 3M1VB 1HNXJ 4DR6J 1XNRJ 1YJUA 1NZAA 3J7A1 2BABA 4FBUA 1K0TA 4Q2MA 2EFQA 1H38A 3OTOJ 2RVJA 2YKQA 1YI2S 5KG5A 5LSRA 2MSTA 2M7SA 3I31A 3OTCA 4C48A 2BJ3A 4FYWB 2CQGA 4C8NA 4BCAA 3EM1A 4FYDA 2AGQA 1IKXB 5E3RA 1GX5A 4FPRA 3QQCD 1X4CA 5AT1B 3PW7A 5ETOA 4A8WA 3LF0A 3RBEA 1HA1A 2HNDA 1IM6A 1R0BG 2DNLA 5J2PB 2KFNA 1SKWA 2FDNA 1U1RA 2XI2A 1S6PB 2FHKA 2ZDPA 4M5NA 4K4ZA 1N52B 3H2UB 2KYXA 2FPHX 1RTDA 3ULHA 3GMGA 4YDXA 1FKOB 3LH2S 1D1UA 2JX2A 2QSFA 1GFWB 3S1TA 1O8BA 1XR7A 1M5KC 2BRKA 4DQSA 1Y5LB 3W2WB 2F65A 1Y9OA 2VZ9A 3A3OB 2QMUB 3NLCA 3ZNUA 1KFDA 2CQDA 4QCLA 3R5AA 2BE2B 4QWEA 2HFSA 4PWDB 2AQ4A 2RILA 3KLEA 4FNIA 2FYXA 2IYGA 3DNCA 4NI2A 2E29A 3MPVA 4LSLA 2E5LF 5KFYA 2VQEJ 5CCLA 1G1XA 3QT5A 4YB7A 2BX6A 4H4OA 2A6OA 3BH7B 1D9DA 3FCHA 3QIPB 4KKOA 2ZDOA 3JXOA 1U0HB 2G1HA 2KXNB 4CIOA 1RGVA 4C3MA 3OUYB 3PO4A 3LW5C 2VOPA 3AQPA 1RAAB 1SC3B 4DR2J 1S0MA 2O3DA 1EB0A 4MK7A 2EG2A 2OJ3A 4XO0A 5I4MA 4NZ7A 5F0WA 3JYTA 1XBWA 2FVQA 1WC4A 2QA4G 4C8OA 5HP1B 1TL3B 3M32B 1U7LA 4NOHA 3O8WA 3EGVA 3OTEA 3LUYA 3E8OA 5KG6A 3MTKA 1HWLA 1YKWA 1TK0A 1PC4A 3MFIA 2HQCA 3E3XA 3EZUA 2HQ3A 1L3KA 4OJGA 3R97A 2VASA 4RNHA 4F67A 1HW8A 2EEYA 5LMUJ 1FT8A 3HO1A 3CGIA 3HFZB 2ERRA 1M5PC 1WEXA 4D3GA 3DI6B 3RRHA 2VG7B 1SUQB 5HROB 2I6WA 1SL0A 3JQMA 5A8WB 2Q6BA 5DO2A 2ZWOA 2MY8A 2HAFA 3WBZA 5IOLA 5AJ3F 3GV8B 4YQWA 3QJLA 1S72S 2HZVA 4TN2A 4KFBB 3VAGA 2GCFA 2YKAA 3TZZA 1XN9A 3CCVS 4B3OB 2UXCF 4F2SA 3D6TB 1NSKL 4Y0FA 4ED1A 3TO8A 2BJ8A 2VD3A 2O67A 4YR3A 3PX4A 5J1PA 3T5LA 3Q8QB 3MM7A 1HBUA 2NPFA 4WWSA 3BM7A 3EVOA 4ZP6A 3DGPB 3GIKA 1FD8A 3MMCA 1NSAA 2WONB 3L4BC 4DR7J 2R7TA 2KXFA 1SV5A 4LR9A 1U4BA 4ILLA 2K3IA 1BGXT 3MGJA 4ELTA 4NCAA 1RBAA 2ILZA 3KXDA 2B9XA 1OY6A 2WOMA 3B6BA 1FX2A 2U1AA 3MPDA 3K58A 3UPFA 2WSCC 2LYVA 4URSA 3SQGA 2R7QA 2AKWB 3DMJB 2RHQB 2OPQA 1S9GB 3S8SA 3VZHA 2HWHA 1EAYC 4Y6IA 1XMBA 4ZA1A 4ZVQB 3IFEA 4LIWA 2BANA 4A46A 4NMXA 4YEAA 4QJVA 4TLQA 5C2GA 4F4AA 2DGXA 3MM5A 2M5YA 2UU9J 4QIFA 1QAXA 2WK4A 3W65A 2CJQA 1R8AA 1S1WB 1P27B 4PR6A 2IJNA 4MJKA 1S6OA 4J9LA 3VHQA 3GFHA 2OEKA 2YKNA 4YN3B 4EZ9A 1R31A 3G8QA 1XWLA 4DUYF 4AUKA 4WFXA 1KONA 1F1BB 3Q8PB 1LW0A 1REVB 5L1LA 1QSLA 1S99A 4HYKA 1OWXA 2O1PA 3QGPA 1QLNA 1FA0A 3CJKB 3MECB 2AGPA 3IC1A 5B09A 4LVNP 5AXMA 2CYYA 2NXNA 2U2FA 2CQ3A 1RT3B 4UZBA 2YNIB 2DPJA 3PHTA 4ECUA 2J6UA 4OMFG 2VPZB 3UCUP 3W3SA 4FYVB 5DG7A 4YHHF 4QIWD 5DZ6A 1NKBA 1YZ7A 2RUSA 5AE2A 1GEHA 4I0WA 3CJ4A 2DXFA 4OZ0A 2ZM6J 2IDLA 1V9OA 2W2MP 2RKIA 3JS9A 4CH7A 1S7HA 4U7UK 3POTA 2KJWA 2DGTA 4JI1J 2C2EA 4JI7J 1JNZB 1E6VB 5F8IA 3C14A 2RU3A 4JI0J 2YWKA 1GQEA 5C24B 3ZFVA 2JZ5A 3IA0A 1U1NA 4DUTA 3GYXB 4DV3J 4X64F 3HD2A 4P52A 1NH8A 3UN3A 4CO3A 3MCMA 4MFBA 1Q79A 2KHCA 2NSCA 5KFQA 3C15A 2KFZA 2BV3A 1VQKS 1PSDA 5GAEU 2DHXA 1Q8IA 2VQFJ 1KQFB 1HWUA 3ELHA 3CUNA 1EIYB 4HL9A 2DNHA 2DNRA 2A3JA 2RQ4A 3RB3A 5J2NA 2OI2A 3AHPA 4LF7F 4M5MA 4J9SA 4K4SA 3Q8SB 4HT7A 2MKSA 4KGXB 1NPKA 3SV3A 1R6YA 5IV4A 5HQLA 2FD2A 3WX8A 3TWZA 3FRZA 1F5CA 2R8HA 4H4MB 3EJMA 2VPWB 2FVSA 2OTLS 5CHCB 2R8KA 5J2MA 4KO0A 4LF5F 1KTVA 2BKPA 3G8TA 2FLNA 1X5SA 4U8VA 5C25A 2XNQA 1GK8A 2QA1A 4I7FA 4ECVA 4F2RA 1S10A 4O44A 3BQ2A 4U67Q 4Y28C 1M0SA 3DU6A 4NEZA 1PBUA 1T9TA 4M5KA 4EEYA 5T7LB 3Q8UA 5FJ4A 4ZPVR 3THTA 1S0VA 1FERA 3DLLQ 4ZP9A 2QYGA 2W9CB 1X4GA 5KFXA 2BXJA 4PYAA 4RUAA 2OEJA 1HNZF 1S6QA 1TKTA 1B64A 3ILLA 4CM0A 4BHQA 2UUAF 2BYCA 2OPPB 4UZCA 1N0UA 3NEKA 4IDKA 3MR6A 3LP0A 3MEDB 2EKYA 3PRVA 1JJCB 3KJVB 2OUGA 1LWFB 4ZHRB 2RS2A 1NJWA 2JLGA 2YBVA 2C2MB 5DQGA 5K5MA 1S1WA 2IMOA 3P49B 2Z56B 2GHVC 4W92B 1VMBA 4KH0B 3BEGB 2CNNB 1JWWA 1JLGA 3CCRS 1H3DA 5BYRA 3H20A 3IGVA 4KH1B 3ISND 3HSJA 3HK2A 5KFMA 3IRXA 1WI6A 4ZLNA 3BSOA 2JL9A 2E5LJ 5GMDA 3KDOA 1DQAA 4O3NA 3WX4A 3EZ5A 3M2RB 4R8UB 5K14A 3HT3A 2VBWA 3D0IE 2QT7A 4KQZA 5L39A 3M2VB 1IKWA 3HHLC 4ECWA 3D1QA 3RW6A 2V5HG 5L8RC 1UVIA 4AFFA 1GX6A 5GAEI 4FNHA 4QZVB 3M9MB 3WZ0A 3CDUA 3BH6B 1S1VB 2JWNA 4GC6A 1CBKA 4LVOP 2AZ1A 4Z2XA 3SIPB 4ED2A 2CAJA 1VQLS 3FZBA 1BY9A 5G4DA 1TKDA 2GQCA 5IC6B 1R8CA 3VR1A 2DR7A 1RXOB 2J9DA 4WXWA 3PVXA 3IG1A 4U96A 3R5JB 3HDSA 1JLFA 3DRYA 4DL6A 5DETA 5AJ3J 3PW5A 5KFUA 3CO0P 4ZIVA 4OYIA 1M5HA 4BLGA 5HMYA 1U0SA 2DGQA 1RTZA 2ZOMA 1NPPA 1S77D 3US5A 1F9HA 4MIWA 4HACA 2GIQA 2UXCJ 3N4WA 4ZJQA 2HPUA 1JJHA 2XBPA 1RT2B 3FNNA 4ETZA 3KHHA 5CYMB 2GZOA 5AE3A 4LR7A 2PA3A 2IPOB 4RW6A 2MLXA 2BACA 3HULA 1OSDA 1JLEB 1C1CB 3C6TA 1JX4A 2KT3A 1T9WA 1UWBB 3V4IA 2QL5B 2ZVSA 2HMIB 3EVWA 2N82B 5A0YA 3BN4A 3JTOA 4OYWA 2BMBA 3DHWC 4NLGA 2XULA 4OX7A 3J80Y 1WG5A 5ETVA 3R9LA 3QLHA 3ITHB 4M1KA 4A8YA 3KYLA 2W4PA 5KFPA 4LIRA 2VUGA 4ZVOB 1X4DA 3FDSA 5J1EB 3H59A 4YDDB 3AA9A 1VFJA 1A0OB 2OH2A 3TAMA 2DYAA 1M90T 1G7CB 4USVA 2J6SA 4ZVGA 1UZHA 2HS0A 3NXZA 2KVQE 4I6WA 4ED5A 2R9LA 2ZVIA 1F3FA 1VLYA 3DCAA 3MAAA 3BBCA 2NXUA 1XMOF 3JB9k 5C7PA 3TP2A 3TR5A 3C6UA 3KJQB 2HFNA 1X9WA 5KG1A 4MT1A 2YX1A 3MZIA 4DFJA 3HHLA 5KFSA 3HVWA 5CD4H 1HI1A 5JXSA 4CYUA 1XMQF 4DUYJ 3BPSP 1C0UA 1DLOA 1NB7A 3NNHA 1CEZA 2HGLA 2WVCA 4FKYA 3PHEA 1Y10A 4J9VA 3R6GB 3I56S 3W8PA 1KVIA 1FKPA 1R43A 3OL8A 5KFCA 3M2UA 2DRBA 1JMTA 2EXUA 1TUWA 1Z2ZA 2J0WA 1DURA 4X84A 2DH9A 1VRTA 4YHHJ 3CTRA 3CSKA 3O1LA 2FQQB 1TUGB 4LF4F 2DGOA 4NPOA 3W5ZA 3DFEA 3Q22A 1RQ0A 1CSJA 1UVKA 2AV5A 2MMYA 2EFVA 2IA6A 2IA0A 2F8EX 1HNVA 4ICLB 3SCIE 3R1LA 1FDAA 2R8IA 2BM1A 2DISA 2RIJA 3OR2B 2CKWA 3A8IA 4MKYA 2RD5C 3ENWA 3BO2A 4X64J 4NYPA 3KNGA 2YNHA 5A6PA 1WNEA 4J7CA 5HMWA 3U1NA 3ZZPA 1FESA 3C2PA 3M8QA 3KK1A 3AH6A 4ETXA 3GPAA 2Y0SD 3TI0A 2NXEA 2NXJA 4H4KC 3OTDA 4K59A 4Y3CA 2QV6A 3KK2A 5JJBA 2KI2A 2OLWA 4DQQA 2OPRB 1FJCA 1ZTTA 3GIJA 1GH8A 4PPZA 4ZIWA 1IBLF 3D66A 2J8SA 2IFXA 5DGAA 4MKBA 1F9EB 5FLXY 4ECSA 4G65A 1RHRB 1OYEA 1B70B 4GO7X 2HHTA 4RUCA 2HKEA 2VB6A 1N5VA 4LF7J 1X5OA 4EFAC 2F63A 3NS7B 2OELA 1XERA 2XCAA 2CIMA 2ZWPA 1VOMA 5E2QA 3CMAS 3N6NA 2ZEJA 2NREA 3SFGA 3FSXA 4IOCQ 4WKRA 3V6HA 1TK8A 4WFAQ 4NA2A 3BPDA 3DXSX 2EKNA 2HHXA 3UNGC 3TJ8A 2DEIA 3JQJA 4R25A 1S1XB 4LF5J 1UVLA 3KWMA 1WSVA 2K7JA 2V34A 4FPIA 2XWXA 3LP2A 4OZ3A 4ANDA 1WD6A 2DGVA 2UVWA 5F8MA 2XEXA 1ZH5A 4NCGA 2B7BB 4RW4A 3H4DA 3J80U 2B5JB 1WDTA 4KV8B 4RBUA 1P1LA 2A2CA 2GGPA 3OT9A 1N6QA 3TUIC 1KTQA 3I5BA 5FDLA 3H2LA 1RE1B 1R0AB 1HNZJ 3OJUA 3UD3P 4ZPDA 4X4UA 1RWKB 2UUAJ 2NR0A 2PFFB 3I6PA 5ETMA 4A8SA 2W9AA 2M4MA 1KDNA 5K8OA 3DRXA 2ACMA 4Q8EA 4KR0B 1OMSA 4QWAA 2QRRA 2ILYA 4IRCA 2HBQB 3HVTB 5KFHA 1S4FA 3W2VB 3NBPA 3BGRB 3W62A 3RBDA 2IIHA 1S0OA 2KTQA 4OYBA 5HSPA 3B4MA 1SCJB 1CJTA 1NXIA 3BJYA 4WKYA 2GMLA 3T41A 1CQMA 5BR8F 5MAOA 2JC1A 3PY8A 1QVGR 1PYOB 3HXMA 3TYTA 3O44A 2AJ2A 3A8KA 2FZGB 1Y11A 4JOUA 2HNZA 4FXVA 3K8VA 4H4KA 2HLUA 5LOQA 4N7TA 3EUNA 2NXCA 3V6KA 3UI3A 2JEGA 2HQGA 4DG1B 1FJEB 1UEVA 2RDIA 1HFEL 4RW8B 4O3QA 4IFYB 4WF9Q 4Y2MA 3CCES 2B8PA 1H73A 3F41A 4QOTA 2GMHA 2UUTA 1RA6A 1UCNA 3AODA 4B02A 1CQNA 1URNA 4ERDA 3TJ9A 4J9KA 3MHYA 3OHBA 3RJMB 4NEYA 3N6MA 5D15A 3LALA 3B78A 1K0VA 4NA3A 1TP7A 2UVRA 3QPIA 3RU0A 4QWDA 4LF9F 4H54A 4Z7CA 3KG0A 5KFAA 5D4OA 3VVTA 4OLOA 1KSPA 2GVZA 5EWFA 3AT1B 2R42A 1KLMB 3MUTP 4ED6A 5IC4B 3R3TA 1RT6B 2WVBA 5KAKA 3MF5A 4QQBA 1KFSA 5EWGA 1V6HA 1L5UA 2POKA 4CLWA 1F60B 2IM3A 2IC3A 4CO1A 4P9SA 4USWA 1LWCA 4TQSA 2FLOA 1ZAVA 2HQIA 3LOUA 5FLXU 5FIIA 1EKRA 3AOAA 4ZLJA 4ED0A 3UQSA 2BQ3A 4RR5A 1Q16B 3M1VA 2E5IA 1URRA 4WZQA 3NY0A 2C2OB 2LDIA 3D1HA 4OZNA 3QJPA 4U7UD 1U02A 3TAPA 3QO9B 4I6AA 2XY6A 1AZSB 1SC1B 3GIMA 5LJ5Y 1GMVA 5IT4A 2EFPA 5HAOA 4JBCA 1F6TA 1ZZFA 1X4AA 3FVYA 4FP9A 3SSRA 1IKXA 4CM2A 5G0RB 4ER8A 2A2DA 3VTIA 2KFYA 2FJVA 2YH1A 5J2PA 4C97A 3GZ7A 1S6PA 2Q3PA 4F3MA 4NLOA 2J7WA 1H0HB 4ZVRB 1AFJA 2CJBA 4CNYA 3UWTA 3ZZRA 3OFGA 5DG9A 4K4TA 1FKOA 4N76A 2WRMA 4OI1A 1EHWA 4Q2LA 2F8MA 5K8MA 4HVZA 1XMOJ 3SCJE 5ADZA 4ED8A 3W2WA 1YSJA 5HQ8A 3U7JA 2YNGB 3OV7A 1KLNA 4UOFA 4ZCLA 2CQ2A 4Y2CA 2BE2A 2QEXS 1W7WA 4ZN1A 4X65F 4QIEA 4QPTA 1FRIA 3CXCR 3CD5A 4PWDA 3ICLA 2KDOA 3U1MA 1XMQJ 3W61A 3FGVA 3KG1A 2JFKA 1WTBA 4B9VA 4LMZA 1CJKB 4B3RF 4G3IA 9RUBA 1S4EA 3QIPA 2CQHA 1U0HA 3HX9A 4I69A 3OUYA 3RR8A 4USJC 1X5TA 2V2KA 4CZCA 4AL7A 4PXEA 1QUPA 4F0MA 1VBYA 2LQ5A 1HBMB 2V2VA 1RKJA 2P5VA 4KAIA 3RAQA 3NRBA 2MYFA 5HP1A 2XMTA 4LF4J 4GKKF 1TL3A 5KFWA 3M32A 1S1UB 1YBTA 1IR2A 3KJNB 4DZDA 3TQEA 1GT8A 4X4PA 3T9ZA 2FZCB 3ZTOA 1CVJA 4NZ6A 1KQGB 3BS9A 3AD8C 3DOLA 3UR3C 4WU2A 1JLBB 4MK9A 1D3WA 3VGUA 2CNOB 4ZVTB 4LFAF 4IRKA 3PCOB 4LJMA 1WORA 3M9NB 5DG8A 3A3NB 2VG7A 2XM3A 1SUQA 5HROA 2M0GB 1FWKA 5A8WA 5DJBA 5IM0B 2DO0A 2WB4A 5D0EA 1RAJA 1YITS 1IKYB 5F3ZA 3RRGA 5AXLA 4YY3F 2HZCA 4FXDA 4KFBA 3SV4A 4DJBA 2IBOA 1IBLJ 3LGHA 4B3OA 3OFFA 4WIIA 3JAMY 2VKZG 4QR1A 4LF2A 5L38A 3BKTA 1WG4A 4A47A 5DQIA 2IYIA 2FGCA 4DL0C 2XMJA 5DZ7A 3L7PA 3DGPA 4GMKA 3EGZA 2V4RA 3CDAA 4TVAB 1FNMA 1KN6A 1Y00A 2V69A 2WONA 2X51A 4ZVUB 2ZNZA 3KUHA 1KHVA 2NUUG 4W98A 3D9BA 2MLZA 3G9CA 3CW2C 2G0JA 3FFIB 4N8OA 1VQ8S 1ELOA 1FFWB 3KLFB 3I82A 3RZAA 2CDQA 1KQSR 2IM0A 2WB1D 1S0NA 3V6JA 4DSLA 5ETTA 2XZDB 3JTNA 3ET6B 3K57A 1NK4A 3DMJA 2DRAA 2QL9B 1S9GA 2IJRA 4NLQA 4YR0A 4MKAA 5D4NA 1VBXA 2K7KA 4YB1P 3UO0A 3AY0A 3PW0A 4ANEA 4C4WA 1Y3KA 4KC5A 3GR0A 1RWUA 4DXLA 4NYOA 4LFBF 1JK9B 4ZVHA 1N88A 1VQOS 2W8KA 3MR7A 1U2CA 5HQMA 1WC0A 2AMCB 4ECTA
chains in the Genus database with same CATH topology
1LK7A 1JLCA 2WONB 1SJFA 1ROFA 3H25A 2R7TA 1YTYA 3SXLA 4X66F 2LQJA 2KXFA 1SV5A 4LUBA 5EX3A 4YUDA 3CO9A 1V3RA 1X8DA 1QAYA 5KFJA 1WWHA 4BDPA 1RP5A 2QO3A 1Q86T 1U4BA 2W9BA 5A6WA 2XZWA 3BO4A 3MR5A 4ILLA 3RRKA 2K3IA 2VPYB 2KH9A 2FVRA 3E2EA 2VBYA 1FNOA 4K2XA 1REVA 1IM4A 1BGXT 1UL3A 3MGJA 5J1EA 3LGNA 2W25A 4ELTA 4NCAA 1E6YB 4ECZA 3PZPA 1BWEA 2CRLA 2ILZA 5I3UB 2IAJB 2V8GA 3CJKA 2L9WA 5F9NA 2E5GA 2RRNA 3MECA 3ZZUA 5GAGI 2KB2A 1I6JA 4B3MF 1KRPA 4LSNA 2B9XA 2FHJD 1RTHA 4DV1F 2GC8A 2WOMA 1HQEA 1SJRA 2U1AA 3K58A 3KK3A 1S1TA 2HNYB 2WSCC 3UPFA 1QAIA 2LYVA 4USIA 3VAJA 2CVIA 1RT3A 4KGMA 4PCQA 2YNIA 4URSA 3SQGA 2VONA 2R7QA 2C3OA 2JJ4D 3DMJB 3A8EA 4RNNA 2OPQA 3T5KA 4I56A 1QSSA 5EN1A 2OFGX 3M4XA 2JVOA 3HPOA 4V19X 3OHAA 1S9GB 4ZPAA 4K4VA 4TY8A 2J7KA 1HQUB 3S8SA 3VZHA 4DV6F 2HWHA 3TAQA 1SIZA 1OS5A 2D9OA 2D74B 4Y6IA 1FK9B 1J5EF 1I94F 1SH2A 1XMBA 4ZA1A 2HYIB 4NLPA 2GFFA 1X4FA 4RBVA 1NO8A 3IFEA 4LIWA 2BANA 4A46A 2DITA 4YEAA 2EC0A 4QJVA 2YWHA 1KD1T 3PW2A 3M8PA 4TLQA 5EGYA 5F41A 1RYRA 1CC8A 3HZGA 4ATNA 3S01A 2DGXA 2BDPA 3QZ8A 3MM5A 3MM7B 4UUWA 1T3NA 4U6PA 1HBUB 3MR2A 1Q8BA 2DHSA 2M5YA 1N54B 3SCKE 2L08A 2RNEA 2RDJA 4QIFA 4TLRA 1QAXA 2BM0A 3DOKB 2WK4A 1VC6A 4BWMA 3I9V9 2CJQA 2YKPA 5K8NA 1R8AA 1GXTA 1RT5A 2V9KA 1S1WB 2GJ2A 1E6VA 1P27B 3MMCB 1C1BA 5B0CA 4PR6A 1JLCB 1NK5A 2IJNA 4MJKA 4F4XA 4MYUA 1N4LA 1S6OA 4J9LA 5C24A 4F8RA 1VQYA 2M8DB 2DB1A 3GFHA 2VC1A 2YKNA 1SV5B 4EZ9A 1R31A 1RTIA 3G8QA 2FLLA 1XWLA 2B43A 2V8HA 4CTAA 5D4LA 4AUKA 4DUYF 4WFXA 3HHNB 4K5RA 1X9MA 1KONA 3GB0A 5L9XA 4OI0A 4OFZA 4XAKA 4XDDA 4ECXA 2W9BB 1FHTA 3Q8PB 1FRXA 1OPIA 1HBOA 4WFNQ 1LW0A 4AYBD 1REVB 2JRSA 5L1LA 1QSLA 3KTQA 4IOBA 1S99A 4HYKA 2N4DA 2NUHA 1N5QA 1OWXA 2IHR1 4NLVA 2O1PA 3QGPA 1QLNA 1YWXA 1SI9A 1FNXH 1FA0A 5E3CA 3CJKB 3MECB 4DFPA 4ED7A 4UW2A 4LSNB 2AGPA 4JI3F 3IC1A 2ZZMA 5B09A 1RTHB 4LVNP 5AXMA 2WOMB 1HQEB 4EO8A 3KLHA 4IH7A 4J5OA 2CYYA 5LL6d 3KK3B 3MMAA 2HHPA 2P6SA 1S1TB 2U2FA 4RU2A 2BQUA 3SFUA 2BUNA 4IQMA 3KHRA 3PKMA 2CQ3A 1RT3B 1VQPS 2YNIB 3IS9A 1NAQA 3SQGB 4RUHA 3HHKA 3MXHP 4G1PA 2JEIA 3SI8A 2DD8S 3CCLS 2RJZA 2OPQB 2DPJA 4ECUA 3KLIA 2J6UA 3QAUA 4OMFG 2VPZB 3UCUP 3NCRA 2UZAA 3ZZTA 3W3SA 4TY8B 5EHHA 5DG7A 2CPEA 1F9FA 5K8PA 3VWSA 4FF2A 4YHHF 3IN5A 1R3NA 2UXDF 4X4RA 2AYGA 1EP4A 4QIWD 2J0QD 2HWIA 1NKBA 4E0DA 4DMZA 4TKTA 1NK0A 1BD6A 3LAKA 3IAS9 5AE2A 4I0WA 3CJ4A 4JI4F 3TW0A 4OI4A 5B0EA 2AYMA 3PX6A 4NCBA 2XMMA 2B0GA 4OZ0A 2DR9A 2BANB 3BSNA 1HHTP 2APOA 2IVMA 3PFEA 3M8PB 4J9NA 3G6YA 2WSFC 1U1LA 1V9OA 1T8EA 3OVBA 2RKIA 3LANA 3MM5B 4CH7A 4CO4A 4DLEA 4KJIA 2MKKA 2GV1A 5CQGA 3M6WA 1CC7A 3T5JA 1S7HA 4U7UK 1OO0B 3POTA 3OPKA 2KRBA 4F4YA 1IQTA 2KHDA 2KJWA 5F8HA 4DQPA 2MHEA 3BDEA 2DGTA 2W7AA 5LMNF 4DFMA 2C2EA 2UXBF 2JLFA 1FXRA 5DQHA 2CPJA 1RT5B 1JNZB 3MUMP 1E6VB 4ILMA 2FIUA 1C1BB 2DHAA 3B82A 5F8IA 4FS2A 3N0VA 3MAQA 4QR0A 2RU3A 5L9NA 1N8RT 2KO1A 5IT9Y 4DL3A 4H4MA 2YWKA 1GQEA 2KT5A 4DN9A 5C24B 3PW4A 3ZFVA 2QYCA 1IQZA 3MDFA 4F25A 2JZ5A 2DNOA 3IA0A 3ZC4A 1U1NA 2KVIA 2YKNB 3GYXB 2E44A 4X64F 3TARA 1B0PA 1RTIB 2AJFE 1NH8A 3R5CA 4CTAB 1B0TA 3KNAA 2CZ4A 2E1MC 4B17A 3MTJA 4ZCKA 4YB5A 3AA8A 4CO3A 4K5SA 4MFBA 1Q79A 1Y0HA 2KHCA 2NSCA 4HHJA 1UVMA 1HBOB 1LW0B 5D3GA 3TQ1A 5SZTA 1KNZA 1MU2A 2MQLA 5KFQA 1X5PA 3PJXA 2HWTA 2EFNA 1KQKA 3WC0A 2B51A 2F40A 2UV8G 2E9ZA 2B9WA 2KFZA 3OFHA 3DDKA 3MMJA 3QGGA 3HJFA 2BV3A 2X1GA 1VQKS 2UVUA 1FTRA 1PSDA 2HHSA 5GAEU 2DHXA 3MMBA 2F9DA 2MB0B 1Q8IA 4MMOA 1W2IA 3O6QA 3KLHB 1T03A 2Q66A 2RT3A 2GQQA 1UJ4A 2R8JA 3MMAB 4NXNF 3U27A 1KQFB 1HWUA 2KT2A 3KMQA 2RRBA 2CQCA 3CUNA 2ZJQQ 3IS9B 2YTCA 5GADI 3M8RA 1FVSA 2LLZA 3A1YG 3C3LA 3B8HA 4HL9A 2DNHA 2DNRA 2FGOA 2JOQA 5E7OB 4IUFA 2GQ2A 3KLIB 5T7LA 2A3JA 2RQ4A 5B0FA 1S79A 2OPSA 5L1JA 1YJTA 2M70A 2WTFA 3DHXA 2K3KA 3RB3A 1JIHA 1YRUA 4L3NA 4CO2A 1M5OC 5MLCV 3DLGA 1EP4B 2HVZA 3AB2B 3O3LA 5F0UA 3M8SA 5J2NA 3OVAA 1T7PA 2E5JA 4GO5X 2AWZA 1L3TA 1PC5A 4CT9A 2W9CA 4ES3A 3OL6A 3CJ0A 3T6JA 2MJNA 4ELUA 3AHPA 2J6TA 2O5DA 4J9SA 4ZP7A 3Q8SB 4FS1A 4LF7F 4K4SA 2VBXA 4JV5F 3RB0A 1BQNA 4HT7A 4DFKA 1K8AT 4URGA 2RKIB 2MKSA 2ASLA 1FRHA 2EK6A 2OPPA 3K5LA 4P7VA 5K9FA 3I4PA 3POTB 3SV3A 2I5JA 2R7XA 5U47A 5L1KA 1R6YA 5B0GA 3MEDA 3F44A 4DQIA 1I1GA 2EFGA 2FD2A 2W7OA 3RB4A 2H9ZA 1UJ5A 2IM1A 3OL7A 2X1BA 3FRZA 2DGSA 1F5CA 2R8HA 2ZFHA 4H4MB 2VPWB 2FVSA 2OTLS 3KJVA 2HGNA 1P1TA 2LCWA 4DL4A 1LWFA 1ZM9A 4ZHRA 1QSYA 4X4OA 5CHCB 2R8KA 1JXEA 2VKRA 5J2MA 1RA7A 2MJUA 2CPDA 5E3PA 4KO0A 4LF5F 2DO4A 3Q2SC 1KTVA 1Q81T 2ZHBA 3G8TA 2RS8A 3MM9A 1HHSA 2FLNA 1X5SA 3T19A 4MFBB 2N7CA 5C25A 4JI6F 5D3GB 3M6XA 1MU2B 6FDRA 3D0GE 2XNQA 3NGDA 4HKQA 4WZMA 4HH1A 4YMEA 1TL1A 2QA1A 2R7VA 1C4CA 2PGCA 3NCPA 4I7FA 2CFXA 4ECVA 1Q1KA 2MZ1A 4F2RA 1S10A 3FMBA 1D9FA 1DTTA 1SL2A 3MMBB 4O44A 3BQ2A 4B9TA 2IM2A 1YQHA 4KGKA 1T03B 3VZIA 4U67Q 4FVMA 3TRGA 4Y28C 4HDHA 1M0SA 3DU6A 4O4RA 3I4HX 4ZS6A 1FKAF 2XSFA 7FDRA 1T05A 4EEYA 1UVJA 2WBRA 3N9UC 4EGLA 4A8OA 3ONQA 2ZJPQ 1UEUA 1S97A 5T7LB 4F4WA 2OPSB 2W4CA 5FJ4A 2JHEA 2C3UA 4ZPVR 3THTA 4DV2F 1SH3A 3CJ2A 3G6VA 1S0VA 1WF2A 3DLGB 1JNRB 4FZVA 1FERA 5J2NB 1UW4A 3DN9A 3BSAA 3P96A 4I64A 3DLLQ 4ZP9A 2WAQD 2D9PA 1NK9A 2W9CB 1RJJA 2UUBF 2HW3A 4OX6A 4RNMA 4I2PA 1X4GA 2BR0A 5KFXA 2BXJA 2YH0A 4RUAA 5HN0A 5JUMA 2WSEC 3MD3A 2LXFA 1HNZF 1FF2A 1AW0A 1S6QA 1TKTA 3M2RA 2OMLA 2X3GA 1BQNB 4NLDA 2PMZD 5LJ3Y 2ZH5A 2NQPA 4BHQA 1B64A 2UUAF 2BYCA 4R8UA 4WXOA 2OPPB 4WFBQ 1ULRA 1F0XA 1H98A 1N0UA 5B7WA 4IDKA 3MR6A 1CG2A 2I5JB 3LP0A 3M05A 1D8YA 1N36F 2LQ9A 3F73A 3MEDB 3BO3A 2I8EA 2EKYA 1HWKA 4E8UA 4M94A 3M2VA 3BN7A 2ZH7A 2X1AA 4C0HA 2UV8A 3GIIA 2HAIA 4C3LA 4TU7A 1RT1A 4R0JA 3THVA 3HVAA 3KJVB 4DEZA 3IR6B 5HBMA 1LWFB 5DLFA 4ZHRB 2RS2A 1HD1A 1NJWA 2JLGA 5J2MB 3G6ES 4P6QA 5DQGA 1QJHA 4KO0B 5K5MA 4Y34A 3PO5A 2IMOA 5A8RA 2DIVA 3P49B 3PXGa 3MM9B 3I0RA 2E5HA 2GHVC 2QZ8A 4A8MP 1VMBA 4W92B 3BEGB 2AW0A 5C25B 1ZETA 2J7UA 2HIQA 1JWWA 1FDBA 1ZM4A 1ZYQA 1L3SA 4BS2A 3CDEA 1JLGA 2O66A 4NRTA 3CCRS 2HFZA 1L3VA 4DX8H 3Q0AA 1TL1B 3CIMA 1TAUA 1AUDA 1H3DA 5BYRA 4AXJA 4I7FB 2KZZA 2GX8A 3DDNA 4MTPA 5E41A 3H20A 1DTTB 2B3TB 3LP1A 4O44B 4K0KF 4JI5F 1DJ0A 1P9QC 4O3PA 1XR6A 1BLUA 4ZCMA 4GC7A 4JV1A 3BDPA 3IGVA 4O0IA 2JVRA 3DOLB 1FRJA 1FO1A 3IWXA 3ISND 1T05B 2NLWA 2PMHA 4PKDB 4DL2A 1GXLA 2R4FA 2RRAA 3HK2A 4DV7F 5KFMA 3IRXA 4O3SA 4A48A 1WI6A 4EUVA 3BSOA 2JL9A 3MWBA 1U45A 4EO6A 5D6GA 1CPZA 4LQ3A 2XGQA 2PO4A 3JSBA 2AGOA 1A6LA 4ZKAA 3CCSS 3J7Z5 4O3OA 2HHQA 2XHWA 2CQ4A 4I2PB 4JYAF 3G86A 3TVZA 1DQAA 3FJ2A 2EVZA 2I0XA 4O3NA 2LQBA 5L1IA 3WX4A 3EZ5A 1N33F 3AJ1A 1S6QB 1TKTB 3M2RB 2B6AA 4X62F 1NK7A 3RTVA 1OQ6A 4R8UB 3K0JA 5K14A 4IDKB 3VALA 3HT3A 1G6BA 2VBWA 3LP0B 4K4YA 3SSSA 3B4DA 3S6EA 4WFYA 1U47A 4WK3A 2ASYA 3D0IE 2QT7A 1IXKA 3IBWA 4KQZA 1U49A 5L39A 4NYZA 4X4QA 3M2VB 1U1OA 1WG1A 2JFDA 1IKWA 5T14A 3CCMS 1O0PA 3HHLC 4XPCA 1VGYA 3CCUS 4DSKA 4ECWA 4DWIA 4L72B 4J37A 1A7GE 3MD1A 1RT1B 3MR3A 3D1QA 3RW6A 2V5HG 5L8RC 1SJ1A 5I42A 1UVIA 5E33A 3ZZ0A 5HBMB 3IRWP 4DPOA 2UUWA 5E3AA 4AFFA 1GX6A 4OX8A 4F02A 4ED3A 1O51A 3FSIA 5GAEI 1RT2A 1IUJA 4B9MA 2KU7A 5CYMA 2AJQA 4Q0BA 5A8RB 4B3SF 2AYEA 2ZOGA 4Q44A 3K2YA 3K7RA 1RT7A 4DV5F 4FNHA 3I0RB 1R8BA 4QZVB 3M9MB 3AB4B 3WZ0A 4RKUC 2CPIA 3NAHA 4OZJA 1UA0A 1JLGB 2P9EA 5M2PA 1KEKA 3CDUA 4N41A 1JLEA 3HF5A 1S1VB 2JWNA 1C1CA 3SSQA 4GC6A 4WJBA 3OW2R 4QU7A 4LVOP 1SKSA 1VQ7S 3LP1B 4Z2XA 4IRDA 2B7CB 1UWBA 4OQJA 2RB7A 2D3UA 4ED2A 3N28A 3PIOQ 4EU0A 5DDOC 2J9CA 2VFTA 3GG0A 3UCGA 3DXBA 3H98A 1IJFB 1VQLS 1OQ3A 4K4XA 2XLIA 2HMIA 2NZ4A 3AJ2A 1M5VC 2E9TA 3OXLA 3FZBA 1VIXA 1BY9A 3T6BA 5G4DA 4ZPWR 1TKDA 3N79A 3DLHA 1IKVA 1IJEB 2GQCA 1VQMS 1WHYA 2ZC4A 2PI4A 3BGLA 3QJJA 1R8CA 3QWPA 4OX9F 2W7PA 2EPIA 4B9NA 3VR1A 2DR7A 3HLUA 1ZTWA 3ITHA 3CULA 3FQKA 4HI2A 2J9DA 4WXWA 3PVXA 2Q79A 4UY8T 3CF5Q 3IG1A 3MM8B 1Q8LA 1R7IA 3DYAA 2HHUA 2RF2A 2KRRA 3DC2A 3I9ZA 3HDSA 3PEJA 4RLEA 3DRPA 4PG5A 5KG4A 3CDWA 5KFIA 1JLFA 3DRYA 2DNGA 4DL6A 5DETA 4CH1A 2B6AB 3PW5A 2RH3A 3SEOA 5KFUA 4C3KA 4QBUA 4UUXA 3SZ2A 1RYSA 2B4VA 5K14B 2DCUB 1M5HA 5HMYA 3HI9A 1VHFA 4CO5A 2DGQA 4ECQA 3DLJA 4E98A 2XLJA 2A1BA 2ZOMA 5GMKa 1T95A 2C28A 1S77D 3US5A 1IKWB 2MZTA 4UQTA 3TANA 2KM8C 4MIWA 5KT2A 1LQ9A 3QWUA 2GIQA 4CH0S 2R2RA 4DS4A 3N4WA 4A8QA 3PV8A 2I9SA 2HVIA 2HPUA 2BJDA 5I42B 1JJHA 2IVFB 1TQLA 4R0EA 3KLGA 2XBPA 1RT2B 3FNNA 4ETZA 3KHHA 5CYMB 1FEHA 4Q0BB 4FXWA 5AE3A 3VF0B 3V2UC 1WACA 1RT7B 2HS3A 3PFOA 3QMQA 1KVJA 2XWYA 3VAHA 1HBNA 2PA3A 4RW6A 2WW8A 2BACA 3TA0A 2UUCF 1LWEA 1OSDA 5KFVA 4BBYA 4DUZF 1M5SA 1GAOA 1JLEB 1NEEA 1C1CB 3C6TA 1JX4A 4ILRA 1PGZA 2KT3A 2ZKUA 2EBEA 3G96A 1HARA 2EI5A 2XY7A 2N7YA 3AQOA 1UWBB 4QR2A 3V4IA 2ZVSA 4O3RA 3GG1A