3BGFA

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
178
Chain Sequence
CPFGEVFNATKFPSVYAWERKKISNCVADYSVLSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein/immune system
total genus 33
structure length 178
sequence length 180
chains with identical sequence S
ec nomenclature
pdb deposition date 2007-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgfA01
4ZPVR 4QZVB 2GHVC 4KR0B 4ZPTR 5DO2A 3SCLE 3SCIE 4L3NA 4L72B 3BGFA 4KQZA 3D0GE 3D0IE 3D0HE 2DD8S 2GHWA 4XAKA 3SCJE 3SCKE 2AJFE 4ZS6A 4ZPWR
chains in the Genus database with same CATH superfamily
1NK9A 3KJVA 2VPYB 1UA1A 3OR2B 4NLPA 5G4DA 2XM3A 4OJ3A 3KK1A 2YNFB 1Q8KA 1XNQJ 2DBBA 4YN3B 5IWAJ 4ZLLA 1F1BB 4EGLA 1VRQC 3CPWR 4TLQA 4ZMMA 2RH3A 3OFHA 3NOGA 3POTB 3QT8A 1MMDA 2OGUA 3ZTRA 1S72S 2KU7A 4NZ0A 1M1HA 2Q66A 2CUYA 3D5MA 2V4JB 5L1KA 1YJRA 3IR5B 1DQAA 1AT1B 2AJFE 4ZK7M 1X4FA 3R5CA 1K47A 4LBIA 3EGVA 1WEXA 5HAOA 1TV6B 1VHIA 4ECSA 2CIMA 4DR3F 1UVIA 1I1GA 1WUUA 4GVBB 1OSCA 4KYZA 2R8IA 1N8RT 1CJKA 4CM2A 4ZKAA 3TA0A 1HQ2A 3KJVB 2FIUA 4DUYF 1KQKA 4ID8A 3KK1B 4CLTA 1X7VA 4URQU 2JJ4D 4JI1J 2YQ0A 3A3OB 2MQNA 3I87A 2RAQA 2HS3A 1RWVB 2QLBB 1NB2A 1XNRF 1VRUB 1FX4A 2CG8A 4QWDA 3VQSA 3CWJA 3HVAA 1TL4A 1WJ9A 4J9OA 3V2UC 3KMSA 1IJEB 1NPPA 3MUMP 2RHSB 3OVSA 4I1TA 2MGZA 3FQLA 1OYDA 2AGOA 3VZHA 2IJNA 1S59A 2UU9J 2LEBA 5B0CA 2R7UA 4DL5A 2W24A 1QD1A 1IBKF 5F9LA 2K7JA 2ZUGA 4CYUA 3J81U 1TK0A 4W92B 3LAMA 2BKOA 3T6JA 3TAMA 1CJKB 1OMSA 1S0OA 1H0HB 5F8LA 3J80U 5IM0A 3NNHA 4X4RA 1H2VZ 3LWLA 3MEDA 4K8RA 3I4PA 1N32J 4JYAJ 2GVDA 4K0KF 4GC6A 1JIHA 1SUQB 1VC0A 3NNAA 1SB6A 2XZWA 1LW2A 2JNJA 3Q2TC 3HDSA 4DSEA 4C0OC 1GX6A 4FPIA 3A1YG 1X9WA 4ZPAA 2DHGA 2V8PA 2XMAA 3MOZA 4NA2A 2VKZG 3BO3A 2EFVA 2JDJA 1AYEA 1DURA 3R6GB 3QJJA 4L6V3 3H7HB 1JJ4A 2YPZA 1NPKA 2ASLA 1Q53A 1RA6A 2XSJA 4KGKA 1F5CA 4DQSA 1ZAWA 1NSPA 3DRSB 4OL8A 3EVWA 4GKKF 1NHVA 4CYUB 1NK0A 4M5DA 4WIIA 3CIMA 3TAMB 2QSWA 3V6JA 2ZFHA 3Q8RB 1FKOA 4AFFA 3C46A 3MEDB 1TL3A 1VIXA 2GVDB 3PO4A 4M5NA 1RUSA 4EO6A 5K8PA 3CO9A 4AXIA 2C1EB 5K14A 1LW2B 2JSXA 2YWHA 1HBOA 2B8PA 2HNZA 3P96A 4MH8A 4I6AA 4XIUA 2D41A 3GIKA 1UWBA 3JQJA 1K0TA 1VDHA 4K4YA 3PCOB 2NR0A 1GFWB 3C6TB 4LF4J 4M5KA 4FBTA 2BRKA 2AJ2A 4ECUA 2A3JA 4TY9A 1YJVA 4EBEA 2HQ3A 3C6UA 4AL5A 3T9NA 3ULHA 2KL8A 1VHFA 2E1PA 2ASYA 4A8WA 2YKAA 5KT6A 3RBDA 4IDKA 3ISND 3MF5A 1U6ZA 4A46A 3HX9A 2M8HA 3HJVA 1SPBP 5K9FA 2OEJA 3W63A 2F3JA 4M5DB 4YY3J 4ZVRB 4JI0F 4LUBA 3VZIA 2FVSA 1FKOB 1E6VB 1XJWB 2QMWA 4DR4J 1WG4A 1S4EA 2CZ4A 3UNGC 2F8HA 3DLJA 4OYWA 1RT6B 1WOOA 3D9BA 1VOMA 1ZH5A 4QOTA 2GVZA 3BGLA 5A8KA 5K14B 2ZM6J 2MYFA 3OV7A 1HBOB 2HBYB 4O44A 1T3NA 4EFAC 3SCJE 2HNZB 2DR8A 2E5GA 3CXCR 5HP1A 1VQ6S 4ZPCA 3RAXA 3RB3A 1KBRA 1HL6A 5ETSA 2F7VA 2DGSA 4LF1A 2KM8B 3C6UB 3ETOA 3B4DA 3VAKA 2X3GA 1GXTA 3K5OA 2CVEA 4IDKB 4DX6A 2EFOA 2ACYA 4W98A 1VCTA 1SC1B 2KHCA 4QWBA 1AUSL 3QAEA 3MMJA 3PFOA 1DBDA 2G0JA 4RW7A 3SQGB 1HWUA 2IC3A 3LALA 1TUGB 2KM8C 4WE1A 3AOAA 3HSJA 2YX7A 3GYXB 4OX7A 1FDDA 2MZJA 4G65A 3MM8A 1XMOJ 2DT9A 2ROEA 3NWGA 4MFBB 1PILA 5DDRC 1NH7A 2RQKA 3M2VA 2GVZB 2EXUA 4DR6J 1HPZA 5A8KB 4OX9F 1CJVA 4O44B 4DQIA 1UVMA 3NWRA 4I6YA 4X62F 5HP1B 2HFUA 4TQSA 4UQGA 2JRSA 3PO5A 4OYPA 4LT6A 2HRYA 1FESA 2WHOA 2CQIA 4CLUA 5KG4A 3OL6A 1KNZA 2JL9A 4PWWA 1NHUA 1M1KT 1U45A 3BQ1A 5CABA 1NZAA 2UVRA 4IFYA 5SUHA 1WSRA 5DM7Q 2ZH6A 2IC3B 1X5TA 2XNQA 3HK2A 3VQTA 2VC1A 2DIUA 1MU2B 5KTQA 2KJWA 4A4JA 4XO0A 4PAAA 3DGPA 1UZDA 1X4AA 3D1QA 1HI1A 1U2RA 2JHEA 1NDLA 3BGRA 2EBEA 1S12A 1OYEA 1HPZB 1WOPA 1CJVB 3Q24A 3HFKA 2E5JA 2ZHBA 3MPYA 2K3IA 3GIIA 1L3UA 3HVWA 2P9GA 3QFHA 1Q0NA 5KAKA 1RHKB 3W2VA 1UW9A 1TP7A 1M5OC 4ZPDA 2R8JA 4F4XA 4DFPA 4CT9A 2JVRA 2W2QP 2J7WA 4DOZA 3VF0B 5F0UA 2RS8A 3QATA 1HR0J 2RQ4A 4IFYB 2BYCA 3VAJA 2A2DA 3BKTA 4OI2A 5EN1A 7FDRA 4DV1J 5A2QY 4RUBA 1PJ5A 2JWNA 3MMAA 2HHWA 2W1BA 3DGPB 1OS5A 3M05A 2AQ4A 3NL0A 1C0TA 3R5DA 2E7WA 2M0GB 4R0JA 1PAEX 2L9DA 3N6NA 2CQ2A 2HBQB 3BGRB 3G6YA 4MIBA 4DUZJ 2QMUB 2I8EA 2KFNA 4CLPA 4JI8J 1X60A 3DRYA 4DR2J 2BJEA 5BYQA 2VPXB 3HLUA 3Q8SB 2BM0A 2XGPA 4RW9B 3LTOA 3PKMA 1YSJA 4K4SA 1PCAA 2XZTB 3UCGA 2VBZA 1RWMB 1QSYA 5A8WA 4YDXA 3UE2A 3F44A 5J2NB 1S79A 1V6HA 2MZQA 1FE4A 5ETVA 1GMUA 3MFIA 1FJGJ 3D3BJ 1XK8A 4B3OB 1UJ4A 3NGDA 5SZTA 1JB0C 1VQ5S 1WKLA 2IRYA 4S0MA 4P73A 2B5JA 5J1EA 3K8WA 3R7SB 4M5MA 1F9HA 3N5FA 4JV0A 5KFPA 2R8HA 3QPIA 2GV1A 1UA0A 2CQCA 3HULA 1QDUB 3K58A 2C3UA 3ETMA 2DXFA 3CDEA 1FWLA 1KSPA 3IP0A 1W2IA 2DNOA 4R8UA 3KLFA 2NREA 4DX7A 1S99A 1UFLA 2V69A 2XS5A 3CT9A 1WG1A 4BLGA 3UDLA 4J9SA 2NXJA 2R7RA 5A8WB 2ZH3A 1YJ7A 2YNGB 2DPJA 1PSDA 1G1XA 3RTVA 2HVZA 1BXNA 3CCUS 1L3KA 3IRXA 3PYGA 3GLJA 2FLOA 1WG5A 3UPFA 2HFNA 2HGNA 3LGMA 3OTDA 3QQCD 1Q5VA 4CO4A 1FRXA 3TEHB 3VTIA 1UKUA 2UUCJ 4KGVB 2MSSA 3F56A 3QFWA 3DLEA 3ZXWA 3WHIA 4F67A 4F04B 4B3RJ 3DU6A 5AT1B 1VIOA 2IA6A 4NLWA 1OWXA 2RDIA 3H5YA 3BSAA 1HNZF 3FVYA 2H65B 1NKCA 3BV8A 1Y5NB 1WC1A 1WI6A 4ZVQB 3TJ8A 2FJEB 4R8UB 5F8HA 2XMJA 5BR8J 3H2LA 3UVJA 4U67Q 2CAJA 4YMEA 4U8YA 2CPEA 1KVJA 2BE7D 2UP1A 5C2GA 4ED4A 2M9KA 4QZVB 2BXJA 3FCHA 4HDGA 1ZPWX 3IRXB 1ZZNA 2VONA 3MM9A 4NWBA 1T9YA 4DFMA 3ZO7A 2UUWA 4LFCF 4NE9C 3R7BB 4X4SA 4ZS6A 3PTWA 1ZPVA 2RQCA 1F3FA 3RUBL 3TO8A 4HYKA 4RZRA 2X1BA 3DLEB 3A3PB 2QFIA 2QTWA 2NQPA 3V5RA 1AROP 3GCWP 4DLGA 5LMNJ 3H4BA 4PQUA 1GTHA 4Y2MA 1LOUA 4ZJOA 1RBLA 2R2UA 2G2ZA 4KHRA 3DLKA 3GFZA 2LA6A 4ECZA 4OJ1A 3CB4A 1R7IA 2HBZB 3QWPA 1NU4A 1SH2A 5KOWA 1J5OA 4ES3A 2W9BA 4B3MF 4LF6J 4RW8A 1YX2A 3MD3A 5LMUJ 2XLKA 1KHWA 4PXBA 2MLXA 1R0AA 4EO8A 4NRUA 4OHXA 2W2NP 1LFWA 5KFMA 2NUHA 1T94A 4QQBA 4TVAB 1HHTP 4AYBD 2HWHA 3GILA 2XMKA 4TQRA 2XLJA 3JSRA 4CT8A 3MM9B 3JQKA 3VV2B 5CYMB 2Q6CA 3GB0A 4PG4A 3GYGA 1X5SA 4KHPJ 1G6BA 3MPVA 3EVMA 3R8YA 4MKVA 4CDIA 1LWCA 3PYFA 1VI7A 1J5EF 4OJHA 1XN9A 1FF2A 4PQUB 3C66A 3IWNC 4ZVGA 4I2PA 3EMTA 3OJUA 4RNMA 2BUNA 3OJSA 2DRDA 4ZVUB 3Q2SC 4K5SA 2Y1JA 4EZ6A 2AIRB 3HHDA 1J5OB 4Y00A 5KG3A 4WTYA 2CQPA 4RW8B 1RISA 2XYHB 3GFYA 3A12A 1R0AB 4IQXA 3RZAA 2OD6A 2HAFA 3QJPA 3KNAA 2UVWA 5HMXA 3CJ3A 4QBUA 2HFOA 2GJ2A 3KLEA 3L9ZA 4ECXA 4LJMA 2PMWA 1ULRA 2IDEA 1N5YB 2JEGA 2GQQA 5B0DA 4ED6A 2RUSA 5MAOA 3SV4A 4OI0A 1UFKA 2J8SA 2V9WA 4CTAB 4J9PA 3FSYA 4X4PA 5IV3A 4KR0B 2K8GA 5IOLA 5E2QA 2GC8A 4JI6F 4I2PB 2G0CA 2W4PA 2ZD1A 2W9AA 2RQMA 4QWEA 5ETNA 3PW2A 4DCJB 5M2UA 1E6YA 1FEHA 2EWHA 3KJNB 1N56A 4WP8A 2DNNA 4CLYA 4R5PA 4LSLB 1NO8A 4LR7A 3NY0A 3I0SA 2HMIA 1C2PA 4J7CA 4RWWA 4DV7F 3C15A 2DR9A 3CTRA 4XPCA 4LR9A 3KLEB 1FTCA 2VKRA 3KHGA 1NB7A 4N41A 1SL1A 1IKXA 2PC6A 1EARA 1S9GB 4P72A 4WF9Q 1BQNA 3AB4B 3Q0AA 4P10A 5DDOC 2CPJA 3TVYA 2BR0A 2HIYA 3TAQA 2QLWA 4P7VA 2CJAA 4I6WA 2PMZD 4RW4A 2DB1A 5F8MA 2NS1B 4DV3F 2XYGB 2ZD1B 4E0DA 1RACB 3LPYA 3QIDA 2VQFJ 4NXNF 1MG7A 2ZVIA 2XG8A 1R8HA 3M9OB 4ED8A 3J7AN 3DXSX 1EIYB 3KOAA 1HBUA 4OI3A 3MUTP 4DN0A 1TAQA 3I4HX 3AA9A 2NYIA 1U25A 3LP2B 4JI2J 2WW4A 4CO1A 1B99A 3DRRA 1EETA 4ZCLA 3C15B 4YB5A 2BBEA 3AFGA 1IWGA 2A0FB 1T9XA 4B3TJ 4CCHA 5B0AA 2PO4A 1VQKS 1S1VA 3EDRB 4DQRA 1QAIA 2VG6A 3VR1A 1IKXB 3G6ES 1YTYA 2OIHA 1BQNB 1N52B 3W8GA 3DOLA 1X8DA 2Z2ZA 5GMDA 2G9OA 2HVHA 2E66A 4ILLA 2RUGA 2OPQA 3LP0A 4FS2A 3VGVA 3BO4A 2DNZA 3OTEA 2E7VA 2BANB 2GQCA 3AXKA 3D68A 4EBDA 4USHA 1YBAA 2ZH2A 4OHVA 3L95X 5DDPC 1L3VA 1B70B 3CD0A 3VAFA 5F9NA 1RTHA 3OR1A 1MLAA 2KTQA 3J7A1 4C0HA 3NMRA 4JI4F 4A8SA 2DCUB 4C11B 1I6JA 1HBUB 1S0MA 4GKJJ 2VG7B 4ZP7A 2HRTA 3JB9k 2CRLA 3DRRB 5LXYA 2DNPA 2M70A 3MMCA 3BBFA 3EDQB 4F02A 3I9V9 3CCSS 3C3LA 4LRCA 1GT8A 2VG6B 2WSFC 3UQSA 5B09A 3JS9A 3NBPA 4JI5F 4RBTA 4MAKA 2IYIA 4I68A 3DOLB 4J9RA 2VB6A 1VBXA 1VQMS 2YWKA 1FA0A 3HPOA 2BOAA 2OPQB 3C16A 3ZTSA 2C2DA 4FS1A 4DR5J 3LP1A 4P52A 5JJBA 7FD1A 1WHXA 1Q78A 4E2FB 3JAMY 2OH2A 3R7NB 3PW0A 1I94J 4FNIA 1R43A 1SH0A 2ADBA 1FT8A 4UQTA 1IR1A 3D66A 3OUYA 1H98A 5KFAA 3OR1B 4CM0A 2D69A 3DDKA 1PG5B 3DRXA 4PUOA 3M7VA 4DS5A 4ICLA 4Y65A 4DS4A 2IVFB 5JVHQ 5D0EA 1HW8A 1HIYA 4QIVA 3F73A 1KFDA 2CQ0A 5J2MA 3H20A 4XPEA 1Y3KA 5T7LB 3RBEA 4UZCA 2ZOFA 2LQ9A 2LQBA 2PGCA 4EMDA 5IT0A 3NBPB 4B3TF 2E5LJ 1RKJA 4K2JA 2KO1A 2JOQA 1JXEA 3GSDA 2GQ2A 5D4PA 3UD4P 3LWMA 4RW6A 2F1FA 3C16B 3MWBA 3QO9A 2XCPA 5AJ3F 5C25A 3LP1B 2Y0BB 3RRKA 2DYAA 4B02A 4BDPA 2B4OA 1SQFA 4CLKA 1LWEA 2EFPA 1LQ9A 5IC6B 5K20B 4PUOB 2GO9A 2H4WB 1HNWF 4B9UA 4ICLB 4LBHA 4NA3A 2ZDOA 1IKVA 1U26A 1FNXH 4N77A 1VQ9S 5KG2A 3IO1A 1RAOA 4X4OA 5J2MB 1IBMF 2KXFA 1GNKA 1CVJA 4ZIWA 1M5PC 3K2YA 4RX6A 3NGRA 1S1XA 3PRBA 2QYGA 3J81Y 3X3UA 2PD1A 2L9NA 4ZOSA 4ANDA 3ELHA 4OHZA 1ZS6A 4RNFA 4CH1A 1A9NB 1X4HA 3P5TL 4FNHA 5C25B 3ICLA 1VMBA 1S1WA 1R3NA 1FRLA 1NBEB 2ZZTA 1HARA 3FUYA 1FDAA 2E1CA 3MR6A 3PV8A 5KG7A 2WBRA 4ELTA 5D15A 4HH0A 4WCEQ 1L5UA 2R3VA 3DKDA 2XO6A 1AFJA 1JNRB 4UY8T 5IT9U 1V3RA 3T1YF 5T41A 2YBVA 2Q79A 3M8YA 3W7BA 3NGUA 1NZ8A 1VC6A 2RU9A 4OV6A 4LF7J 1S1XB 5KFSA 2UXCJ 4P2SA 2I1RA 2AJQA 2KZZA 2E5LF 4UOHA 3LOUA 2DITA 4Q8FA 2ZHAA 3QGHA 1VQ7S 5E41A 4ZPVR 2HHPA 4DPYA 2W2OP 3UDEA 5HATA 2BMBA 2MB0B 1VLYA 4JI7F 3EPGA 4JUZA 1FXDA 5HROA 1OY6A 2XMUA 1NDKA 5LM7E 3AODA 4Y2IA 5CA5A 1RABB 4ZVFA 3LW5C 2FY1A 4J5OA 2B4PA 2GW8A 3GR0A 4OMFG 1V5IB 1N34F 1T9WA 4DPOA 1IBCB 2QA2A 4F36A 2W2PP 2VFUA 2HIQA 1RWXB 4CNYA 2ILYA 3N0VA 4UUWA 2NXNA 3M6XA 5CYQA 3TX0A 4G1QB 4C8LA 2ABYA 4UZBA 4Y2KA 2B6AA 5A6PA 5AXKA 1XQIA 2Y1LB 2RRBA 1WWHA 2HS4A 4F7VA 3DOMB 3RU0A 2M8DB 2FC9A 1MWYA 5DGBA 3QBCA 3IGVA 5L9NA 3O5TB 3MM7A 2DRBA 2XY5A 4HKQA 2CQHA 1BMQB 1PJ6A 2HHSA 5HROB 1H3DA 5B0EA 3SSRA 1CLFA 4F4ZA 4ELUA 4M5HA 1AZSA 4DBQA 1ACMB 4DSFA 3AQOA 1HBNB 3G8SA 4DU7A 4YR3A 3E51A 2FLNA 4ECYA 1P9QC 4KTQA 3UCUP 1OPZA 1UEUA 1P1LA 1CEZA 3EXYA 3D6MB 2OTLS 4RU9A 4LF9J 2BW2A 2B6AB 1BUXA 4H4KA 2EEYA 4LF5F 1M5HA 2CJ9A 2Z8QA 3NEKA 2UXCF 2DH7A 2W7OA 2QGFB 2BEFA 3PW5A 5CXTA 3F0NA 1FVQA 2DVIA 2L08A 4OHYA 4U7UD 3AT1B 2C2NA 4HT5A 1SCJB 4AQYJ 4WYWA 3T5KA 1RHRB 2HVEA 1WC3A 2YWGA 2UV8G 3PYEA 1RBAA 3CSKA 3ZTPA 4MIWA 5CD4H 3DMJA 3KG4A 4ER8A 3V81A 1N33F 1Q5YA 3TAPA 2QC3A 1UJ5A 4ZPWR 2E44A 3KK2A 3KUEA 4RWXA 3K57A 2VPWB 2AYBA 5LJ3Y 5K5MA 3AQPA 1N88A 3CCLS 3OT9A 2FVPA 2OFHX 1REVA 3UWTA 1NLKL 2FHOB 1GEHA 5G0RB 2JX2A 1TZ0A 3MPWA 3KYLA 3NCRA 5JVGQ 1S1UB 3AOCA 5EWFA 4C4WA 4WK3A 1QY7A 3TNVA 2J0QD 2N4CA 2WONA 5ETPA 2AYEA 1FKPB 1IQTA 2AU0A 5KT2A 3JQMA 1EX8A 1TL1A 3C19A 3P49B 3MGJA 3I31A 1S6PA 3SIPB 2COLA 3SDEA 4DSJA 4IQMA 3TUIC 3MD1A 2ILZA 2HEKA 2DNKA 2V50A 5B7WA 5LJ5Y 4I2QA 2QLJB 3D6FB 1AFIA 3U27A 5MLCV 4A8YA 4P2XA 3KK2B 1HNIA 1R0CB 1H2TZ 3US5A 2P5VA 1N54B 2OAUA 2V9KA 1RHJB 1CS4A 2D3O1 4ZCMA 3HHEA 4TU8A 2J6SA 2IJFA 5CCMA 5JMNA 2XS7A 2RU3A 5JUMA 2Z2LA 1RT7A 3MPUB 2KHDA 2PEBA 1PC4A 4DU8A 2LXFA 1U1MA 2WW8A 4USIA 1TL1B 5I3QA 4D3HA 3MM6A 3FK4A 5DG8A 1NJWA 4EYIB 3SDEB 1V9OA 1UMJA 3S7RA 1WEZA 5DM6Q 2ZBIA 3GSIA 4I2QB 3QIPB 4RU2A 3QSIA 1X0PA 2F4FA 1RWPB 1HNIB 1SIZA 1HI0P 5EHHA 2N7CA 1MN9A 2RD5C 2OUGA 1NSQA 1LW0A 1CS4B 1F3VA 3KUHA 5D78A 3KUGA 2X1AA 3W2WB 3H59A 2HYIB 2AEFA 5HLFA 1KLMB 5EWEA 1SJ1A 3SQOP 4J9NA 1KVIA 1IM6A 3M4XA 2QFJA 2GAHC 3EGWB 2HQGA 2EW9A 4KGXB 4EK2A 1XERA 1XIQA 4LFBJ 3GQCA 1WHVA 1H72C 3ZTOA 5F8IA 3D6TB 2H9ZA 3PR4A 3MM6B 2JC0A 2XGQA 4X2BA 4O23A 4V1Ak 4YB7A 5E33A 8ATCB 2CYYA 4YB6A 3OL9A 5L9XA 2UVVA 4EUVA 3WZ0A 3D28A 4FYVB 4Q2MA 2BA9A 3EUNA 5GADU 4DV5F 4RBVA 5KT4A 3G4SS 2EPIA 3M9MB 3UFCX 3H5SA 4PZVA 1QTNB 1YI2S 4K7QA 1D1UA 1SBRA 3ET6A 2C22A 3RB4A 4WTOB 2YVSA 1JJ2R 3Q8VA 3QZ8A 3MMBB 4N8OA 4Q0BA 2GAGC 4K5RA 2FB0A 4ECVA 1TK8A 2O67A 3HFZB 2G4BA 1T11A 3U1MA 1S7HA 3WC0A 3W62A 4NCGB 4YHHF 4A8FA 3CNQP 4J9VA 2YPYA 1L3TA 4DEZA 4C2MA 2I5JB 1G4CA 1Q81T 4I64A 1UVNA 1AUDA 4Y0FA 3SCIE 3KJFB 1URNA 3W8PA 3CD5A 3R5GA 4ZP8A 3EXCX 3UCZP 1XR7A 4DFKA 2VF3A 1EB0A 1YHQS 2CJBA 3R6LB 1RWWB 5EX3A 2RNEA 1TVRA 1N0VC 3ET6B 3TX8A 3D0IE 1UVLA 2P6TA 3RR8A 1SIWB 4NLRA 4OFZA 4K59A 4LFAJ 4WK1A 4Q0BB 2PN6A 2VD3A 2FDNA 1HNXJ 2OHDA 5KFLA 5GVQA 3OSNA 2MQ8A 3HF5A 5J2PA 3U02A 3H40A 2FJDB 3AD8C 1FD8A 4NOHA 4KKOB 1U24A 4WP3A 3BN7A 2G1HA 1EQ0A 1NSAA 4MJKA 2AEJA 4OYIA 3N4WA 4O4GB 3CCMS 2LEPA 2EFGA 4J9KA 3J7YU 2WSEC 4QR0A 2DGXA 2ZEJA 4YB1P 3NAIA 3IM8A 2C3MA 3MEEB 5E3RA 1KQSR 2V8DA 3H4DA 4L73A 1U47A 2YQ1A 4FF2A 5ETQA 3TVZA 2FGCA 2GO8A 3BR8A 1A7GE 3UNYA 2R7XA 5F8JA 1JX4A 4NYOA 3I0RA 3T1HF 5K8OA 5HMWA 3JYTA 3RJMB 4WU3A 2C2KB 1FE0A 2F4VF 3PJ9A 4H4MA 3CD7A 2OJ3A 2MY8A 3IC1A 4LSNA 1MWQA 4YFUA 4X66J 1W25A 2F8EX 1SJQA 1UW4A 1VJWA 4DR1J 4MT1A 2DNYA 3BSNA 3I82A 2VH7A 1W2BR 4DX5A 1FFGB 3IBWA 4XAKA 1F0XA 3PEJA 1S48A 2L48A 1S1TA 1RYSA 1OY8A 3NOCA 2C28A 4ES1A 1N5SA 5CD4A 2GIQA 2W01A 3FEZA 2EK1A 3BO2A 4PXCA 4ZIVA 2UUBJ 1P9YA 4IYQA 4X4NA 1XC9A 2U2FA 2XMTA 3MDFA 4Y3CA 4NZ7A 2FZGB 2EC0A 2ZHOA 2ALYB 5F3TA 3IFEA 3BSCA 3QJLA 3PR5B 4AUKA 2PA8D 3MEKA 4DL2A 3R97A 4O3QA 3G8QA 1HBMB 2GJIA 3DYAA 3MZIA 2FHKA 4B9LA 1MROA 2AZ1A 1QVGR 2OI2A 4ZDNA 4OYOA 2BE2A 3HKWA 4RNNA 4DV2F 1DJ0A 4KE5A 1G2EA 3R5JB 2AYGA 3L09A 1U1NA 1REGX 5FJ4A 3N28A 5GAEU 1X9MA 3HHKA 3E01A 2HZVA 1FFSB 3OPKA 2KXNB 3OVBA 3DLBA 3D67A 4X64F 4YUDA 1TR0A 3OLBA 3HMJG 1IR2A 1DZ5A 5B0GA 4G3IA 1S77D 2PIIA 1KOOA 1RWNB 2NYHA 1APSA 3PDNA 1PYSB 4J9QA 4C0BA 1X5OA 2A6MA 2E5HA 4OQJA 4D3GA 4ED0A 7AT1B 3EPIA 1PKUA 4HDHA 4DR3J 1ZM9A 2B7CB 1Q8BA 2CQDA 5KFYA 4DLEA 1MROB 1T05A 5KG1A 4CZCA 4R25A 3DRPA 3B54A 4IOBA 5H9EK 2ZWPA 3SXLA 3D3CJ 3HVTA 2B9EA 3IG1A 4RUCA 1KN6A 3IWXA 5D3GB 1URRA 1TFYA 3MI7X 4FYDA 3KLHA 4IH7A 3PZPA 3E01B 3A3NB 4ILMA 4WZMA 1IQZA 3RBZA 3QLHB 2IAJA 4AE5A 3MHYA 1XNRJ 1TFWA 1KONA 4RNHA 3GV8B 5DQGA 3POTA 4OYMA 3BREA 1RT3A 2X3DA 2ZC3A 2UUBF 1NDPA 1C4CA 5E0OA 3NXZA 4RUAA 2CNOB 2VC0A 4URSA 4ZN3A 3P3DA 1FD2A 3VAGA 2DGOA 4FXVA 1WTFA 2NPIA 4HR2A 4WFZA 2KFZA 2LQ5A 1FRMA 2KDOA 3NGKA 4IOCQ 2ROPA 1IBKJ 1TV6A 2ZNYA 1T05B 4DSIA 3DRPB 1BY9A 4MKBA 1NPRA 4FZVA 3TQ1A 2KG0A 2PSZA 2MHNA 3HVTB 3M32A 2LQJA 1U6BA 2Q6BA 2EKNA 4LVOP 5D4OA 4K0KJ 1D9AA 2PFDA 1Q86T 2PT0A 3KDNA 3D54A 4Q43A 3EJMA 3NS6A 1SC4B 2IAJB 3L3CA 1TL7B 4DJBA 2UZAA 4P7TA 4FDFA 1HMVA 2VJUA 2XY6A 3HHLC 2G1DA 1S6UA 2NXEA 4QW8A 4C98A 3E3XA 1RT3B 1VRUA 1D8ZA 2QEXS 2XHWA 2HW3A 3ENVA 3CCWA 4TYBA 2UVUA 5DG7A 2QLFB 1K1SA 3M2RB 3QAUA 4TLRA 2XQCA 4FF1A 2JZ5A 2XI3A 1PBAA 3OTCA 1SKSA 2PI4A 3GONA 3WC2A 1RE1B 2AJ0A 2C42A 3C2PA 4O4RA 3V6DA 1FHTA 5ETMA 2O01C 4XTTA 3GPAA 2LDIA 3DGVA 4GKKJ 4CLZA 3QMQA 2VFSA 5KFNA 1SXLA 1KDNA 1U1QA 2GX8A 4WYLA 2FLLA 3MPDA 5F41A 3QGPA 3M32B 1J2VA 3LUYA 4RNOA 4URGA 1NHKL 2EC2A 2H1YA 3WDOA 2Z30B 3PRDA 2DGQA 2OSRA 3NGSA 2IM1A 1M0SA 3FRYA 2BJ7A 1SUQA 2ZOGA 1HMVB 4CLSA 3MAAA 2AGQA 1Q79A 3CCZA 4PXDA 2VOPA 2CPFA 2E1MC 1K73T 4CWBA 4DPUA 3CC7S 2YNIA 5DLFA 2OPSB 5ADZA 4AD6A 2DH9A 3M8QA 1HKAA 4PKDB 3BBCA 3GV5B 4RKUC 3QNWB 4ZVPB 2K1RB 4NLQA 4OX8A 1FJ7A 4WPAA 4IRCA 3V6DB 1T7PA 1PAUB 2J5AA 5I42A 2YNHA 2A1BA 1ROFA 4JI0J 4K2XA 3HSZA 3DRSA 1Q8LA 2Y9HA 1UEVA 2CDQA 4PG7A 4FKYA 4JV5F 3DDNA 3M8WA 3PG9A 1FWKA 3U1LA 3BKFA 4K50A 4TKTA 4M63A 4XDDA 2JEJA 3UN3A 4OI1A 2Z4PA 2FJVA 4JV2A 2RT3A 2ZJRQ 2D1CA 3MAAB 3UN5A 1N5VA 3IM9A 1RLCL 3NS7B 1SI9A 3LO3A 1SV5B 5CQGA 4WXOA 2AF6A 3MAQA 4NEYA 4L74A 2JFDA 2FVQA 2YNIB 3MOJB 4CQ1A 2LEAA 3D7SB 3C6TA 2PDAA 4F0HA 2C3YA 1B3TA 3M8QB 1U1LA 2FJAB 2V63A 3OTOF 2VICA 3JTOA 2FJBB 4ZLPA 4ECTA 1U1RA 4U7CA 3BYRA 3HD1A 1ZM4A 2DO0A 2HWIA 2IM0A 5I42B 2YNHB 2CZ9A 4BCAA 4X4UA 3BH6B 2F63A 1DFDA 2CQBA 3ENWA 1WKKA 1S6QB 2RB7A 4F3OA 2H5IB 2F9JA 1E6VA 2VUGA 3PVXA 1S9EB 4CLWA 4M8LA 1H2UX 3CD6S 3I55S 4OX9J 1RT6A 4CRJA 4Z2XA 3RAMA 1RU1A 4X62J 2IDLA 4WIQA 3IAM9 4BHQA 2AKWB 5GAGI 2GJFA 1U6FA 1FERA 2HQIA 2DHSA 3K7RA 2ADCA 3JTPA 2B56A 1NEEA 1WELA 3TZZA 1SJRA 2Y8WA 4ZPBA 2B7BB 1JWWA 4KIAA 1QM9A 1M5SA 2FYXA 3KLVA 1UVKA 4IG3B 4RBUA 3EZOA 1YGYA 4LREA 1FNMA 2R7OA 1ZAVA 3WX8A 4USVA 4F4YA 4ITSA 3HVRA 4ED3A 4DR7F 5FLXY 3SQGA 1KKHA 2QJ3A 3J7ZT 1B64A 1VQPS 2OMLA 1BC6A 4CO0A 1BE4A 4OJGA 2ZJPQ 5KFIA 4KO0B 3HP6A 5DS7A 3M1VA 3G82A 4MFBA 4C8ZA 3OL8A 3W9IA 1RT4A 2O3DA 1PC5A 2WVFA 1ZZFA 2ALZA 3ISZA 4IFVA 5ITHA 4F25A 1S0NA 3KHLA 2EKYA 2P2CB 2IJRA 4FF4A 1QE1A 4LIWA 1IKYA 2WVDA 3B82A 2XHCA 4B08A 5KOXA 1YJ9S 3G9CA 4F3QA 4KH0B 3TARA 4LIRA 4LR8A 2BRLA 2BV3A 2IVYA 3DC2A 4IO1A 3WIUA 5EX0A 4A48A 5HBMB 4M5JA 2C2MB 3NG8A 3K17A 2ATCB 5L46A 2CXEA 1XMQJ 2BQRA 1MU2A 2FD2A 3TA1A 3KXDA 2LECA 1DAXA 4IKAA 5IV4A 4DL0C 2FJWA 2I9SA 1VISA 3R27A 3M1VB 3G82B 3DHXA 4LVNP 3S1TA 2DTJA 1CJUA 4C97A 1IUJA 1MWZA 3IGNA 4CIOA 3GJTB 4B9TA 2XZDB 5DJBA 5CH7B 3UW1A 1RT4B 2CNLB 4LRDA 4M1KA 1B0TA 3GV7B 4B3SF 3HI9A 3UD3P 4IFVB 1U02A 1JKHB 2J0SD 2QA4G 2KKHA 4B9MA 4CO5A 1WC6A 3OTBA 3VALA 1QE1B 2NXUA 3MURP 1BQXA 3EZUA 1IKYB 1NJYA 1T9UA 4I69A 4LF8F 3JXOA 3CJKB 4KBIA 1T9VA 1Q7YT 4C8OA 2M5YA 1G3OA 3FZ2A 4ECRA 1JLBB 4NLDA 3QT7A 3I9ZA 2XO7A 4UW2A 1RTZA 3RYLA 1RTJA 4N7TA 4DHVA 1B7YB 2HFSA 3M6UA 5KFKA 2EK6A 1VQYA 2VHGA 2DRAA 1KFSA 4Y28C 3BH7B 5AE1A 2OPPB 3MEGB 3O3LA 2VZ9A 4FXDA 2IY5B 2WSCC 1R8CA 2CQ3A 2DGUA 3BQ2A 1CJUB 2OKQA 1KC8T 1NAQA 4P74A 4Y2CA 2KH9A 1V5VA 3BYPA 3OHBA 2VFTA 2UUTA 2LKZA 1YQHA 1B7FA 1VQSA 4DSLA 1RSCA 4RW9A 2V2QA 2DK2A 4WBFA 2D74B 4GRSA 2MKJA 5J2NA 4KSEB 2U1AA 2MDAA 3GIJA 4UOGA 3SFUA 1KTVA 1TAUA 2NSBA 5ETLA 2ZZNA 2UUAF 1WF0A 2AX1A 2MKHA 2RF2A 5E3PA 4B3OA 2RRNA 1LFPA 2MXYA 3PFEA 4MIAA 1DTTB 2V5HG 2V8HA 4NLOA 1SL2A 1RTJB 3SYZA 1HNZJ 1TUVA 1U0HB 2VV5A 1GXUA 1AA1B 1NMEB 3QT6A 4GC7A 1ZM3A 4P6QA 1XMQF 4FKXA 4DQPA 1R8PA 3SV3A 3DFEA 5D6GA 4ETXA 4NMLA 3PYDA 3UI3A 2FUG9 1C1CB 3T19A 5GAGU 3LANA 4G1PA 4C3MA 1O0PA 3NAHA 4NI2B 4NLGA 4LSZB 4KHMA 3MR2A 4RPFA 5FD1A 4I4BA 2YNGA 4A8OA 3Q8PB 2GGPB 4LFCJ 4O3NA 2DHHA 2RF2B 4OX6A 3V4IA 4J9LA 3IA0A 3GYNA 2MJUA 2HVIA 1HD0A 5KFCA 3DLGA 3AD9C 4JV1A 2BE9B 1WC0A 5BXIA 2R7WA 3MTKA 1YIJS 2CPZA 2AJ4A 2GA7A 1Q82T 4ED1A 5DQIA 2BKPA 2ZBCA 4F0KA 3PJXA 2FVCA 4IR1A 5CAAA 2XLIA 3Q8YA 3NCQA 4B3MJ 3P45B 4LRAA 1N5TA 3M2UA 4USKA 1U8SA 3OQ2A 4U7UK 3TVKA 2JLFA 5CZXA 3R5AA 2DXEA 1M5VC 5HQLA 4BWJA 1TUWA 3RW7A 3VAMA 1BWVA 3A13A 3VHQA 3EM1A 4ZHRA 1NJXA 1KTQA 1UFWA 2C2OB 3V6KA 4DF8A 2OEMA 2LFVA 1JXVA 1XMBA 1NM2A 3GFXA 3OBIA 2DY9A 3V4IB 1WD6A 3Q23A 1F2HA 3L4BC 1SL0A 2R7TA 1A6LA 3DLGB 1F5AA 1ZTWA 4L3NA 4JI3F 1NK5A 1J5EJ 1P8GA 4DZDA 2WBMA 2J9CA 4KAIA 2XEXA 4MKAA 3UR0A 5F0WA 1D8YA 3MCSA 4M95A 1VBKA 4P2FA 2CDRB 2KI2A 2POKA 2J9EA 2P8IA 3M2UB 1RAFB 2HGMA 4N5SA 1W7WA 2MQPA 2AGPA 2QRRA 1JLEB 3ENAA 1U48A 1NUEA 2B3TB 2FHJD 2B9XA 2W2MP 3FRZA 2EBGA 3AH6A 2PE8A 3BGUA 1O51A 2XI2A 4ZHRB 4DV4F 4QWAA 4KY3A 3X1LB 3NS5A 3N01A 2GHPA 1RKIA 2RJZA 3O44A 3TA2A 1IJFB 2R8GA 4L72B 1EQMA 3BR9A 2VU5A 5CYMA 2VODA 3GFHA 4U95A 2HHVA 1SKUB 3G6XA 2NSCA 2ZWOA 4KPYA 1MNEA 3IS9B 3NKYA 3K59A 2VA3A 1K8AT 1ZM2A 1TK5A 4OZ1A 4DG1A 4JI6J 3OD2A 5CZVA 1GAOA 2AD9A 2LCWA 1WDDA 2B51A 1U1KA 2V4QA 3S6EA 1YG0A 3W64A 3WQPA 1VBYA 1VS3A 1VK3A 3FMWA 1CULA 2J9DA 1FJEB 2BJ8A 4R0EA 1RWOB 1U2FA 3M8SA 6AT1B 2O66A 1UCNA 4IUFA 1X5PA 3FMBA 8AT1B 4DV7J 2M4MA 3LAKA 3A8KA 3ADAC 4DX8H 1M5KC 1HNVB 3H5UA 4M94A 2XNRA 3SCKE 4DV0F 5KFRA 4W4MA 1NK4A 3WX4A 2E1AA 3FQKA 4YR2A 2J6UA 1IBLF 1N5YA 1TU0B 1S5ZA 5KG0A 5E3AA 2KG1A 4OZ2A 1ZBTA 4C8MA 2GZOA 1WKJA 2IA0A 4K4TA 4ZITA 8RUCA 2KT5A 4DG1B 4DV3J 4CTAA 3PKYA 1V3SA 5D8HB 3PHTA 2N82B 4NXNJ 3O2IA 2OSQA 3WIVA 1CULB 2WRMA 3KK3B 4NXMF 3ZZOA 1Y00A 4USJC 3HT0A 3Q8QB 1TKZA 3O6QA 2DY1A 3ENQA 3BJYA 5H9FK 4N8NA 2GS8A 1IM4A 1JQGA 2NUUG 2V6AA 4ATNA 3TRGA 4LSLA 5IQQA 2R7QA 1KR4A 5J2QB 3Q8UA 3W5ZA 5KT3A 2UXDJ 2J9DE 3JAMU 1GMWD 2DHAA 2VFVA 1H6KX 1LV5A 4KC5A 1CPZA 1S9GA 1C0UB 3T5LA 3FZBA 4OLOA 2H3EB 3IN5A 1O8BA 2W9CA 3G87A 1QSLA 1I51B 1QLNA 1O5JA 2HFVA 1EHWA 5ETRA 3PACA 3IBFB 2MQMA 3ZZ0A 2Q43A 4JI4J 2PFFB 2AYMA 4WFYA 1T3OA 1TKZB 1S10A 5C7PA 2R2RA 3B6BA 1KLNA 1QSSA 4WKRA 1DTQA 1S97A 4QYRA 2KN4A 1UTAA 1WNEA 3CJTA 3LP2A 3W9HA 3IWLA 4UOCA 4QJVA 4FVCA 3NP5A 4JI5J 1BQMA 2OLWA 3B8HA 1UL3A 1HD1A 4UUXA 1PO6A 2DEIA 2W9CB 1F9FA 4LQ9A 2RMLA 3IRWP 1QJHA 2ROGA 1HWLA 3VGSA 4DCOB 2MZSA 1X4EA 2CA9A 4F3MA 4XDCA 4Q44A 4DL7A 4EYHB 1RAGB 4OZ0A 3EYZA 2HAIA 2BANA 2DR7A 2GMHA 2YWWA 3G86A 2LYVA 2VJVA 5LXRA 5L1LA 1DTQB 2L41A 2VG5A 4C11A 2QSFA 4JOUA 1NH8A 2ZITA 4QW9A 3KFWX 2HURA 4C3KA 2VG7A 1TKTA 1KOHA 2OD4A 1VBZA 3WBZA 2JEFA 4UTGA 2ZZMA 2OP5A 1VGYA 3KLIA 2FHJA 3NMAA 1SQEA 2CJXB 3R5BA 2GHWA 3G6VA 1OPIA 1BQMB 1N36F 3C14A 2ASDA 1AXQA 2KZMA 1XNQF 4DWIA 2IMOA 2UXDF 4AL6A 2APOA 2V68A 2J8AA 2IPOB 5IWAF 2BJDA 3NLCA 2D9OA 2CPXA 5AJ3J 2SXLA 4CO2A 4YOEA 2JFKA 1GTEA 2JLGA 3CDAA 4OYAA 1B4SA 1NSKL 4FVMA 2MGZB 1UVJA 2R7SA 5GMEA 1YJWS 1X4GA 1HNWJ 2V67A 1ZETA 3CUNA 1T0TV 2L3MA 2VG5B 3Q83A 2HHXA 2V94A 1FTRA 5KFXA 5D0RA 1IBMJ 1WORA 3UDVA 1TKTB 4BS2A 1N36J 3QRQA 5IM0B 5AXLA 3UDCA 3R2DJ 1U1PA 2HPUA 3Q89A 4WZQA 3KLIB 1FRIA 4HLBA 4ED7A 1AB8A 4Y6IA 5T7LA 5KFJA 2XWXA 3HD2A 1YDLA 1HLWA 2IBOA 2W4CA 3C14B 2IBKA 3ITHA 2GIFA 4IOAQ 2DR5A 4J9MA 5AXNA 4L76A 4JI1F 2FZCB 1Y10A 2LDYA 2V2VA 4ZP6A 2FC8A 2KFYA 1U8WA 2CNNB 5J1PA 1OY9A 2J7KA 2BJ1A 1CQNA 4H54A 1S76D 2IIHA 2EI5A 1NKBA 2IM2A 4ECQA 4WFBQ 2XSJB 4B9NA 4KB7A 2YH1A 2QT7A 2UU9F 2FTRA 4UT4A 4PG6A 3BSOA 1EP4A 1IN0A 3T1YJ 2DD8S 3FEYB 4NZ6A 1FDNA 3FDSA 3GR1A 4YDDB 1YLXA 2HQCA 1TL3B 4ZA1A 3T1AA 2LP4A 5HO4A 3RB0A 1N32F 4I7FA 5C42A 4WXWA 4JYAF 3ITHB 1GMWA 1ZYQA 1TTHB 1WOSA 1UWBB 3KWMA 4JI7J 1SVDA 1FI4A 3QWUA 3FBCA 2P6SA 3LH2S 3AJ1A 3KTQA 3KNGA 2HQDA 1CC7A 4LMZA 1JLFA 4LRFA 4DUTA 2HQFA 3ZZRA 3TR5A 2RILA 4F2SA 1BGXT 1H7WA 3RW6A 4HT7A 4OLPA 1EP4B 1N34J 1VJQA 5EUHA 1H74A 3BZQA 3H5XA 1VQ4S 5ETKA 4UOFA 3M6WA 2I38A 3KG0A 1DLOA 2I6WA 1G7CB 1WF1A 4Y2AA 4I7FB 5C42B 5KFGA 1BLUA 4RLEA 1C4AA 5DG9A 5D4NA 2HZCA 1EAYC 3K5NA 3TEGA 5U47A 2W25A 2FY8A 4U9RA 4DL4A 3J80Y 2X51A 3QZ7A 2PA3A 3ZFVA 1RT2A 5H9FJ 5HVFA 4BC9A 2R8KA 4IH6A 4YEAA 2JVOA 1UPMB 4LF4F 3ILJA 1JLFB 2ZKTA 2I2YA 1PIEA 3EZ5A 2V8GA 2NZ4A 3DOKA 3FBFA 1YITS 3SI8A 4RW7B 2CQ4A 4WE1B 4O0IA 4ECWA 3CE8A 2HHHJ 4C9DA 2GMJA 4YY3F 2OPRA 5DO2A 2MQOA 2EVZA 1X4CA 3MM8B 1DLOB 3TZWA 2XBPA 1OO0B 4B17A 1X4BA 4DR4F 3NNCA 3M2VB 2JC1A 3KKFA 5EWGA 4IH5A 1RHUB 4IO9Q 1DY3A 3GE9A 1LEOA 4A8QA 4G1QA 5HMYA 4DF4A 1XTZA 4LF5J 2OFGX 1FRHA 2HSEB 1YZ7A 2YKMA 3BBBA 4ZN1A 2R2TA 3ZZYA 2ZM6F 4QYZK 3DOMA 1RT2B 1M1GA 3H2UB 4QR1A 4NCAA 3TI0A 4WKYA 3CCQS 2KT3A 2E7XA 2M88A 3EX7B 2CWKA 4DCPB 2ZUAA 2CPHA 4L75A 1Q8IA 4GVLA 1D3WA 4KPCA 2B9WA 2J0XA 3MCMA 4CLFA 2ZJQQ 3PIPQ 1N33J 2V0NA 4BC7A 3HKZD 4P71A 3CEDA 2HHQA 3DOKB 2HLTA 2GHVC 3R2CJ 3TOQA 1WC4A 4ZLJA 2ZVSA 4ZJQA 1QAJA 3GG1A 1HBNA 2HKEA 3FBEA 1RTDA 5D0GA 2OPRB 1HI8A 3EE3A 1SC6A 4NL5A 2E9TA 4EWTA 1HQEA 4DZ6A 1FNOA 5HQ8A 1KVKA 5LOQA 5I4MA 1Q7LB 3G2XA 1Y5IB 1N0UA 2VBWA 1XMOF 2DEJA 2V2KA 3D0HE 4OYZA 1CBKA 2K06A 2YKMB 5HN0A 1RAIB 1S49A 4DR6F 3H0PA 5KFFA 4FN5A 4FP9A 4ZCKA 5DDQC 3GWCA 2L9WA 1QTMA 3A8IA 3W2VB 4CO3A 4ZVSB 2ZKUA 2RKIA 1S0VA 2DJWA 1VQ8S 3S01A 3VWSA 3TANA 5A6WA 1DQ8A 1X31C 4ZVOB 2A18A 3SEOA 2QX0A 1N48A 1MMNA 3K8VA 4AXJA 2YX1A 1WHWA 3DLLQ 1RTDB 5E3QA 3MMAB 3R3TA 4HI2A 5L1IA 1C0TB 2EG1A 1HYSA 3VCDA 1HQEB 2HHHF 2V34A 2ZBRA 1CQMA 3I32A 2F8MA 4G1IA 5G0RA 2R42A 1S6OA 1WDTA 2QG9B 4NX9A 5BYRA 1RZMA 1S1UA 3A8JA 2H51B 4NYZA 2Y0SD 1UAWA 2HK2A 2R4FA 3OXGA 2R2SA 2RE1A 3A4TA 2YWEA 1KEKA 1FKPA 1GX5A 2MSTA 3PW4A 1HWIA 4K4VA 4V19J 2RKIB 2ZH5A 2AZ3A 2JH3A 1T02A 2ZE2A 2W7PA 3H90A 4NLSA 1K9MT 2H4YB 2VFRA 1AW0A 1R8BA 2MHEA 1LK5A 2F40A 2WVEA 4N76A 4DSKA 3E8OA 4UY85 2DNRA 3CW2C 1YJNS 4WFNQ 2DHXA 3GJRB 1HR0F 2W4DA 2B5JB 3ONQA 5J1EB 3I6PA 1Q16B 1YZ6A 3OSPA 2O5DA 4DV1F 5DZ6A 4O3OA 1UP1A 1HYSB 5RUBA 3ISNC 2MTLA 4X65J 2MJNA 5A0YA 3J81j 2YXLA 3W5XA 3B78A 1WEYA 3CDUA 2ACMA 5CYJA 3KLFB 4DUZF 5CHCB 4JI8F 4FYYB 4DR2F 1U0SA 2BX6A 2AMCB 4MTPA 4HI1A 4G6VB 2GMLA 3DHWC 3FEXB 4ZLNA 3I5AA 2A2CA 2CQ1A 1J27A 2ZE2B 3CO0P 5HANA 5D4LA 2CPYA 3NRBA 2VA2A 4ERDA 3W3SA 3SSSA 1S7IA 1ICEB 4JBCA 1FJGF 1T95A 2YKQA 4DV5J 4OZ3A 3QIPA 2IVMA 1DARA 2B0GA 2K2PA 1CSJA 1FRKA 2J7UA 2LQ8A 3ZC4A 3CJ2A 1QUPA 1ITPA 3O1LA 2MLYA 1U09A 2VQEJ 4O3SA 1HWJA 2VDIA 1RJJA 1BD6A 5A0YB 4FPRA 3QYYA 4ZVEA 4FYWB 1D09B 4USMA 4U6PA 3W2WA 2D9PA 1NKEA 1KLMA 3UVJB 4WWSA 2KRRA 5BJRA 4NLVA 2HVDA 4YHHJ 3M9NB 2FZKB 1Z2ZA 4USTA 4DI6A 3THPA 4GMKA 1YBTA 2DXDA 4Z37A 3FNNA 3SBMA 2QE5A 1Y0HA 1R6VA 4DL3A 2DIVA 5HQMA 2MKCA 4I67A 3OFFA 3W61A 5LSOA 3MTJA 4QPXA 1FFWB 2HBRB 1N5QA 3OLAA 4ES2A 2X1FA 1Z1ZA 3OHAA 4RUHA 3ILLA 3RG6A 2NCKL 3R1LA 1EZZB 2V8VA 1Z4UA 4KGZB 1RHMB 4TU9A 2UUCF 2QMXA 5HMZA 3KHHA 2MMYA 2QO3A 1NNDA 1ZAXA 2P9CA 3DLKB 4HHUA 4B3RF 4EEYA 5JXSA 2LLZA 1CJTA 1KP6A 3MMBA 4A8MP 4NLXA 4X65F 3A8EA 2W9BB 3RGIA 2D3OR 1MMLA 4Z7CA 5BR8F 4OYXA 3OFEA 4KGMA 2WK4A 2AX0A 4NCGA 3B4MA 3P5BP 4Z7YA 1LWXA 1IKWA 1IR0A 3BKUA 4ZVTB 1NK6A 2MZRA 3AY0A 2HRUA 4DV6J 2EFNA 1HA1A 3R9LA 4C8YA 4KRWA 1LXNA 2LXIA 3NCPA 4H4OA 2Y8YA 2AV5A 1UJ6A 2LMIA 2CPIA 3LF0A 4ZCIA 1L3SA 1TKXA 2RSQA 2I5JA 1YJUA 5H1SV 3RRGA 3CJQA 2HLUA 2FHMA 3T5HA 1LWCB 1RGVA 4QYZJ 2CADA 1VQOS 2CKWA 2HHUA 1RXOB 4MK7A 1FWPA 2OTJS 3T1HJ 2N3OA 5LMNF 1CJTB 4KJIA 2IYGA 3I5CA 2Y3YA 2F4VJ 2K7KA 3L7OA 2CJKA 2VQEF 1FJCA 1X9SA 1GXLA 2AP6A 3ZZTA 2DKOB 3AOBA 3HHLD 2BOPA 4DPXA 5GAHI 3HFVA 4LF6F 5K8MA 2CG4A 1F9EB 5LMUF 3CMQA 3NGTA 3GG0A 4KKOA 3RAQA 1IKWB 1CC8A 4F0MA 1MW7A 4DQQA 3CCJS 3JSBA 4ZP9A 3THTA 2XTJP 1HHQA 2HZAA 4O4GA 1F6TA 4H4OB 2CZVC 1TKXB 1VQNS 2OELA 1Q1KA 2VPZB 3MEEA 3BF4A 4KHPF 3BGFA 5KT5A 2NXCA 1YRUA 3FBBA 4F26A 2DISA 2AJ1A 1QVFR 2BZ2A 5DETA 4M5GA 1NCLA 4NA1A 3CJ5A 1FX2A 2QN6B 3P6YC 1U1OA 5HSPA 3TUPA 3N6LA 4PG8A 1Q4RA 1B0PA 4IRDA 2XMWA 1E6YB 2MPUA 1VK8A 4DV2J 4CH7A 1NJZA 4ENOA 4AL7A 3HCXA 2XCAA 1WF2A 4R5PB 3K5MA 3I0SB 2HMIB 3GJQB 3SSQA 4DPWA 3ZZPA 1TMMA 3BDPA 2N7YA 4DDFA 2G13A 4HL9A 4ANCA 1RA7A 4ZJLA 4X64J 3U1NA 3P4UB 2ZC4A 3BN4A 4TNOA 2HHTA 3DI6A 4DV6F 2YKPA 3KMQA 5C5JA 5E3CA 4E8UA 3RB6A 3BDEA 2H48B 4X4VA 2Y1RI 2VOOA 3OFGA 4RW4B 2WVCA 1FVSA 4O0NA 4DL6A 4V19X 4CLLA 2HWTA 2KVQE 2M52A 3AA8A 1RLDA 4YQWA 1HBMA 4MMOA 3FCWA 2Y1IA 4AT1B 3PIOQ 3CMAS 1JNZB 1XR5A 3T9ZA 1JLGA 1YRTA 4KH1B 1F2GA 1OJ4A 2AHOB 1EETB 1CG2A 3DCAA 4ZVHA 1S1VB 5BYSA 4TN2A 3PHEA 1KD1T 3MR7A 2Q1LA 2KXHA 3K89A 5LT5A 2QL9B 3IR7B 2VL1A 2PMHA 4EBCA 3DI6B 5AE3A 1YWXA 3HM9A 4LF2A 2N4DA 3HZGA 3EVOA 2XYPB 1JJCB 2OEKA 3LP0B 4PXEA 4Q8EA 5D77A 3PXGa 5L8RC 4A8XA 2XC9A 3JSYA 3DU5A 1NDCA 2DCLA 2FQQB 3HXMA 3OVAA 2FGOA 5J1NA 1NJIT 1WSVA 3TYTA 4DPTA 1YKWA 2DNLA 3RBXA 1RTHB 5AE2A 4OI4A 1U49A 1I5OB 2VQFF 2KB2A 4CI0B 4B9VA 3UD5A 1P1TA 3N5BA 3T5JA 2G2OA 1DHMA 1JLGB 5FDLA 4U8VA 2G2YA 3MMCB 2YX4A 1FRJA 5D3GA 4JI2F 2BDPA 2JEIA 4C6AA 2N3LA 1OIAA 4HACA 2CWXA 4C3LA 5T14A 2MZTA 4J37A 2W7AA 5LSRA 3MCNA 2WB1D 5THWA 3QLHA 3R1HA 3QRPA 1Y4ZB 1WI8A 4F2RA 2H5JB 2AT1B 3W5YA 1RT5A 1UEKA 3OL7A 4C7QA 2JLEA 2KJVA 2GCFA 4LQ3A 4C8NA 3H2VE 3GIRA 1B0VA 3EGNA 2LU2A 5M2RA 3H98A 2ZDPA 4F8RA 3OUYB 5IFMA 5HVGA 2QV6A 3W1YC 2QA1A 5KFEA 1HWKA 2OO4A 1JXLA 2YQ3A 3F41A 3TJ9A 4Q2LA 4PPZA 2BABA 4KV8A 5GAHU 4RL1A 5FDLB 2QA4S 2IRUA 4C48A 3IBCB 3HHLA 4HHHA 4GKJF 1Y7PA 5HL7Q 1PYTA 2Q3PA 1IWAA 4ETZA 1GH8A 4FBUA 3RRHA 4HACB 4K4XA 9ATCB 4DFJA 1TL7A 2ZH8A 1XR6A 2DNQA 4P2MA 4RW6B 4WJBA 3UR3C 3QSYB 1RT5B 3QO9B 1H7XA 2XB2D 1WACA 1SJ4P 2A10A 4A8KA 3SMZA 3E2EA 1K0VA 3M2RA 1VYAA 4QU7A 1LWEB 4NCBA 1RAEB 4DR5F 2RIJA 2AEMA 3PNIA 1T8EA 1I94F 4YP3A 3VAIA 2NLWA 1KQFB 1IKVB 2PEHA 1ZTTA 4KV8B 3CDWA 4JV5J 4QIGA 3TW0A 4BWMA 1S57A 1PJ7A 2IMWP 1KQGB 1T9TA 1W26A 3HHLB 4GO7X 2B8QA 2HNYA 1RCXB 5ETOA 2D3ZA 2DNHA 2D3UA 1RAHB 3PRVA 3DDIA 1HQUA 1RWUA 2WOMA 2ZOMA 1QAYA 2C3OA 5KFUA 2YH0A 4PG5A 1MN7A 2CQGA 1N6QA 4LRBA 3QGIA 4YR0A 2YTCA 1MSWD 1TKDA 1QUVA 2W8LA 1U7LA 2IFXA 3CCRS 4F4KA 1RQ0A 3OTOJ 1OQ6A 2BVZA 2OPSA 4A47A 1S1WB 3KJQB 2ASJA 5FLXU 1S9FA 1GK8A 4OZNA 2ZBQA 2HNDA 3TZXA 2K1RA 2YY3A 2G0IA 3MM5A 1NRKA 3UO0A 1LKZA 3IAS9 1Z2LA 3HSDA 4K4WA 1WHYA 4X4QA 5IXUA 3N79A 2XSFA 4P9SA 1D0EA 3LPEA 3GIMA 2E9ZA 1O6XA 2DGTA 2HNYB 5KFZA 2HG4A 3SCLE 4M5IA 3MCOA 1ELOA 2IHR1 3ZTQA 5KFVA 3PJWA 3M6VA 1HQUB 2WOMB 1S4FA 5KG6A 4MYTA 2XMMA 2E1RA 1N6QB 3DXBA 2PI5A 1SV5A 1U4BA 1IXKA 1OQ3A 2MKIA 2H5EA 2M2BA 1ZOTA 2RS2A 1YK9A 2HFZA 1IVZA 4QIWD 1SC3B 4CH0S 2HNDB 4LBPA 2ZNZA 3TWZA 3MM5B 5KFOA 2Z2YB 2RHQB 4DR7J 2ZBPA 4NRTA 4W90B 2WCXA 5KFDA 3BS9A 3GP9A 4BBYA 3ILIA 5GADI 2EG2A 5F8GA 4HTIA 3FGVA 3MAHA 3AXMA 1S6QA 1NXIA 4I0WA 1S9EA 1QAXA 1ZA2B 5CYQB 1BWEA 2LA4A 5HI7A 3IR6B 1P6TA 4LF7F 4CP5A 2ZH1A 1HHSA 3W65A 3O8WA 4OYBA 4ZPTR 2BJ3A 1D9FA 3BM7A 3MM7B 1JMTA 3FSIA 3M30A 3V4MA 2MEWA 1RT1A 4NPOA 1VR6A 2YKOA 5LL6d 4TXSA 1AZSB 1X0FA 1JLAA 4IG3A 1RDRA 2KYXA 2GIRA 4Q5VA 3H42A 2J76E 4KQZA 3ILOA 2LVWA 1PYOB 4MK8A 4UF4A 4OZ5A 3BPSP 3PX6A 3KG1A 1RHQB 4HH1A 1VFJA 4KO0A 1EJ7L 1UETA 5LSLA 5DGAA 1RBOB 3GCXP 4MK9A 5B08A 3K5LA 1RK8A 5ETTA 3VGUA 1SJFA 4J90A 4B3SJ 5E5NA 2R7VA 4Q45A 3D1OA 5IT9Y 4PQAA 1OSDA 2DO4A 3CC2S 3DLHA 3PY8A 5DZ7A 3LGHA 5KFBA 3M30B 2DNGA 4CNZA 2VASA 4LF8J 4PYAA 2CPDA 3CDBA 3PW7A 3JSMA 1RT1B 5A2QU 4H4KC 3GU0A 3J7YI 3V6HA 3DMJB 2XULA 3V81B 1Q95G 3AHPA 1JLAB 4XK8C 1Y5LB 1X4DA 3M8PA 5HBMA 5CCLA 4C8KA 5IQ6A 3PM9A 3AAWB 3TZYA 5AXMA 1GMVA 3CCTA 3P8BB 3BPDA 5E7OB 1REVB 3FC9A 3THVA 2V2ZA 4RR5A 2QYCA 1JLQA 1M90T 2CVIA 3S8SA 3D6HB 2K3KA 4NLUA 2RRAA 2XS2A 3PX4A 4LF9F 5B0BA 3CMES 5HJYA 3N6MA 3CJ8A 2WONB 4DMZA 1KHVA 2MKKA 4NEZA 4NLTA 6FD1A 1ZA1B 2KT2A 1JKHA 3DNCA 5H9EJ 4PEOA 3BB5A 3HJFA 3IXQA 2IM3A 3MXHP 1K44A 3JSMB 2UUAJ 1N4LA 3CJ4A 1S6PB 3D0GE 1FEEA 1FO1A 3U7JA 2WB4A 3BGOP 1H38A 4AQYF 2QLXA 2J6TA 3CJKA 3MR3A 1NK7A 3CJSA 4Q7AA 2FVRA 3AD7C 3C8YA 2QIFA 4Y34A 1SJ3P 1SKRA 3I5BA 2ZH4A 3CC4S 1LK7A 2F65A 3M8PB 3GJSB 5F3ZA 4IG0A 1JLBA 5M2PA 9RUBA 3AB2B 4F4WA 1R6YA 2BM1A 4EU0A 2FJXA 2YKNA 1SH3A 2BW7A 4HEA9 4E98A 1VLOA 1JLQB 2GFFA 3TUZC 2WTFA 2OPPA 3MEGA 3BEGB 3TJAA 1RP5A 1RI7A 3VVTA 2CJQA 2KVIA 5IT4A 4KFBA 4O3RA 5KT7A 4ID5A 1RT7B 3MECA 1FXRA 3D4JA 4QWCA 1TMJA 2MKSA 4USUA 1TELA 3FKBA 2V4RA 5GAEI 2UXBJ 2ZH9A 1UPPA 4NASA 3M8ZA 5EDWA 4ED5A 2P9EA 3TQEA 2BQUA 4F4AA 3AJDA 4HTJA 1XWLA 2XY7A 1JLCA 3MUVP 4K4ZA 4QIEA 4QR2A 2BJ9A 3I56S 2QL5B 2VIHA 5FIIA 4IG0B 5DRKA 2Z58B 3PEHA 1DTTA 5EGYA 3HT3A 2WVBA 2YKNB 1FDBA 4OZLA 5KFTA 3EGZA 1U0HA 4OV1A 1LW0B 3L7UA 4PCQA 2FLPA 3G96A 2A6OA 3K0JA 5HLFB 2M3DA 5D0HA 3CIZA 1XEZA 4PABA 1YRXA 4KFBB 5KFQA 5KFWA 5IC4B 4ID5B 4IR9A 3MECB 1FKAF 1C1CA 2MLZA 1EKRA 2CFXA 1Y3JA 4TU7A 1F60B 4M5LA 4O3PA 2OMOA 4NI2A 3T41A 1C1BA 2DR6A 4DN9A 1NK8A 1H73A 3HSGA 2E29A 2MY7A 1FXLA 5L39A 1U2CA 3TUJC 4OZJA 2GGPA 2DH8A 4I56A 3W60A 1WC5A 5HVHA 5HJXA 4RJVA 1LWFA 4X84A 4NMXA 2VDHA 1WTBA 1JLCB 1V3ZA 2D7SA 3J7Z5 4FXWA 2DPIA 4JI3J 2NPFA 3W66A 1VRTA 3T3FA 1RTIA 3OXFA 3ZNUA 3HZEA 2EFQA 4MKYA 1R27B 1R0BG 4IRKA 3D1HA 1TQLA 3ZNJ1 2FPHX 1SQGA 2C3PA 2LU1A 1HFEL 3H25A 4P75A 2C2EA 6FDRA 3KLGA 3HHNB 3UN2A 1VQLS 1DRZA 3SFGA 4PR6A 5C2CA 2XWYA 3KHRA 4B9SA 2Z2MA 4WFXA 1C1BB 4DV4J 3CJRA 4WP9A 3CJ0A 3SZ2A 3I96A 4LFBF 2QL7B 2DGWA 3JTNA 2BKNA 4NYPA 4ILRA 4DXLA 3RR7A 2WAQD 1LWFB 2UXBF 2KYZA 2RDJA 3N9UC 2BACA 4FYXB 4ELVA 2B43A 1VRTB 3ZZUA 2CNKB 5F8NA 1RTIB 2WZ1A 5IZHA 4RO0A 2X1GA 1TVRB 1KS2A 2MQQA 2W8KA 3OW2R 2AW0A 3LA0A 2Z0GA 1JK9B 1RWKB 2LXUA 1PBUA 4L3KA 2RVJA 3KLGB 4HVZA 4WU2A 1LNQA 5A76A 4HHJA 3TP2A 2C2RA 2GNKA 2QZ8A 4PWDA 1UWAA 5J2PB 5L1JA 3VGTA 3CF5Q 5C24A 4QIFA 3GTYX 1JLEA 1RU2A 3CGIA 3G71S 4KT0C 1K1QA 3HO1A 5KFHA 4DV0J 1R31A 1YJTA 3FFIA 4PYDA 4JP8A 2MKYA 5L38A 3MFHA 3D2WA 1IBLJ 2C2ZB 1PGZA 4J9UE 4N56A 4MYUA 1RAJA 2H54B 2HK3A 1UZHA 3LQVA 3MR5A 2Z57B 2B4VA 1F5BA 2ATLA 3DN9A 3IS9A 4N47A 4OI6A 3EWGA 3M8RA 3OXLA 1FK9A 1RAAB 1P27B 4NXMJ 3I0RB 3JYTB 1YVFA 2DGVA 3Q86A 3AJ2A 5DQHA 1YBUA 4H4MB 3BQ0A 1RYRA 4LFAF 4U96A 3FSXA 4PWDB 5IS2A 4LSNB 5I3PA 3Q22A 1HNXF 2E9RX 5C24B 3QT5A 4ALZA 3CCES 3KDOA 2B9YA 2HS0A 3W9JA 4PWUA 4QCLA 4QPTA 1S1TB 1A0OB 3L7PA 1HW9A 1HNVA 3FFIB 1KRPA 1JJHA 2UV8A 1R89A 2F5GA 2CJYB 1D9DA 1LXJA 3QGGA 3CCVS 2E5IA 3IMQJ 1FCAA 3T6BA 1KWMA 1GQEA 3G8TA 2X7IA 4J91A 1BHNA 2RDDA 1RB0A 3DM2A 4FF3A 4PPDA 2ERRA 3EICA 1VC5A 4TY8A 1FK9B 5A8RA 3H8YA 5HK4A 3VAHA 4OHWA 1I3OB 1RCOB 3DYAB 2Z56B 2DNMA 3KK3A 1SKWA 2VBYA 4ED2A 4F50A 2BE2B 4OIXA 3PX0A 4NLYA 3ZZZA 5I3UA 1Y11A 2R9LA 2O1PA 4EZ9A 4DUYJ 2NZCA 1DQ9A 2I0XA 4X66F 1T03A 4DR1F 4QU6A 2HGLA 5J2QA 3OR2A 1Y9OA 5DLGA 2AWZA 4JB8B 2YNFA 5KG5A 2J0WA 1RADB 4PRFA 4USWA 5B0FA 4WFAQ 1C0UA 5K8NA 3VVUA 4ANEA 2M7SA 2XMVA 2F9DA 2YWFA 2ZH7A 1EKSA 2V4JA 2MQLA 3DM2B 3CVKA 4TY8B 2KRBA 5A8RB 2BQ3A 4X4TA 1R8AA 3GMGA 3GZ7A 4YS2A 1TL5A 3FJ2A 4EI2A 3FCVA 3CULA 2VBXA 4GVBA 2MZ1A 5I3UB 2B4UA 1XBWA 2IRXA 3IG1B 4GO5X 4TYAA 3QRRA 3LGNA 4K4UA 3K5PA 5GMKa 1T03B 3KLHB
chains in the Genus database with same CATH topology
1NK9A 3KJVA 2LXIA 2VPYB 3FZ2A 3OR2B 1UA1A 3NCPA 4H4OA 1JNRB 1AFJA 2AV5A 1UJ6A 4NLPA 5G4DA 2LMIA 2CPIA 3LF0A 4OJ3A 4ZCIA 1L3SA 1TKXA 3KK1A 2YNFB 4ECRA 2RSQA 2I5JA 4UY8T 1JLBB 1YJUA 4NLDA 5H1SV 3RRGA 2DBBA 2HLUA 1V3RA 2FHMA 3T1YF 3T5HA 3I9ZA 5T41A 2XO7A 4UW2A 4EGLA 2Q79A 3W7BA 3RYLA 1RTJA 3CPWR 4TLQA 4ZMMA 1LWCB 4DHVA 1VC6A 2RU9A 1RGVA 3M6UA 5KFKA 1S1XB 2RH3A 3OFHA 2EK6A 3POTB 1VQYA 4QYZJ 5KFSA 2DRAA 1KFSA 1MMDA 4Y28C 5AE1A 1VQOS 2CKWA 2OPPB 3MEGB 3O3LA 2VZ9A 4FXDA 2HHUA 2WSCC 1S72S 1R8CA 2KU7A 4MK7A 2CQ3A 2DGUA 4NZ0A 4P2SA 3BQ2A 2I1RA 2Q66A 2AJQA 2OTJS 2KZZA 2N3OA 3D5MA 2V4JB 2E5LF 5L1KA 2OKQA 1YJRA 3LOUA 2DITA 3IR5B 1KC8T 1DQAA 2AJFE 5LMNF 4ZK7M 4Q8FA 1NAQA 1X4FA 4Y2CA 2ZHAA 4KJIA 2KH9A 2IYGA 3I5CA 3QGHA 1VQ7S 5E41A 3OHBA 4ZPVR 2HHPA 2VFTA 2K7KA 3L7OA 3R5CA 2UUTA 2LKZA 1YQHA 2CJKA 1B7FA 1VQSA 2VQEF 4DSLA 4RW9A 2MB0B 1FJCA 1VLYA 4JI7F 3EPGA 1X9SA 1WEXA 2DK2A 1TV6B 4ECSA 1GXLA 2AP6A 2CIMA 3ZZTA 3HHLD 4JUZA 4DR3F 1FXDA 5HROA 2XMUA 2BOPA 1UVIA 5GAHI 2D74B 4LF6F 5J2NA 1I1GA 2MKJA 5K8MA 4KSEB 2U1AA 2MDAA 4Y2IA 3GIJA 2CG4A 5CA5A 4ZVFA 3SFUA 1KTVA 5LMUF 1TAUA 1OSCA 2NSBA 2R8IA 3LW5C 3GG0A 4KKOA 1N8RT 3RAQA 2ZZNA 1IKWB 2FY1A 2UUAF 1CC8A 1WF0A 2AX1A 4J5OA 2MKHA 2B4PA 1MW7A 4DQQA 2GW8A 3GR0A 2RF2A 3CCJS 3JSBA 4ZP9A 3THTA 4OMFG 4ZKAA 5E3PA 4O4GA 3TA0A 3KJVB 2FIUA 4B3OA 2RRNA 4H4OB 1N34F 1LFPA 4DPOA 4DUYF 1KQKA 2CZVC 4ID8A 2MXYA 1TKXB 3KK1B 2QA2A 3PFEA 1VQNS 4MIAA 1Q1KA 1X7VA 4URQU 2VFUA 1DTTB 2HIQA 2JJ4D 4CNYA 2ILYA 2V5HG 2V8HA 3N0VA 4NLOA 1SL2A 2VPZB 4UUWA 3MEEA 1RTJB 2MQNA 3BF4A 4KHPF 3BGFA 5KT5A 3I87A 3SYZA 1TUVA 1YRUA 2HS3A 3M6XA 4F26A 2DISA 2AJ1A 2VV5A 1QVFR 1GXUA 5CYQA 2BZ2A 4GC7A 5DETA 4G1QB 1XNRF 1ZM3A 4C8LA 1VRUB 4NA1A 4P6QA 2ABYA 4Y2KA 4QWDA 3CJ5A 2B6AA 5A6PA 3VQSA 1XMQF 5AXKA 4DQPA 1R8PA 3CWJA 3HVAA 1TL4A 3SV3A 2RRBA 3P6YC 1WWHA 2HS4A 4J9OA 3DFEA 5D6GA 4ETXA 1U1OA 3RU0A 4NMLA 2M8DB 2FC9A 3V2UC 3KMSA 1IJEB 3N6LA 3UI3A 4PG8A 1Q4RA 1MWYA 2FUG9 1C1CB 3T19A 5DGBA 3MUMP 1B0PA 5GAGU 3LANA 4G1PA 4IRDA 3IGVA 4C3MA 1O0PA 5L9NA 3O5TB 2XMWA 3MM7A 3NAHA 3OVSA 1E6YB 4I1TA 2MPUA 2DRBA 2MGZA 4NLGA 3FQLA 2XY5A 1VK8A 4CH7A 2AGOA 4HKQA 3VZHA 2CQHA 2IJNA 1NJZA 4KHMA 4AL7A 2LEBA 2XCAA 2HHSA 1WF2A 3MR2A 5FD1A 5HROB 1H3DA 5B0CA 2R7UA 4DL5A 5B0EA 4I4BA 2YNGA 2W24A 4R5PB 3SSRA 3K5MA 3I0SB 4A8OA 2HMIB 3Q8PB 3SSQA 1IBKF 5F9LA 2GGPB 2K7JA 4F4ZA 2ZUGA 1CLFA 1TK0A 4W92B 4ELUA 3LAMA 3ZZPA 3BDPA 3T6JA 2N7YA 3TAMA 4DBQA 4DDFA 4DSFA 4O3NA 2RF2B 1S0OA 4OX6A 3AQOA 1H0HB 5F8LA 2G13A 3V4IA 5IM0A 4HL9A 4J9LA 3NNHA 3IA0A 1HBNB 4X4RA 1RA7A 3GYNA 1H2VZ 3U1NA 3LWLA 3MEDA 3G8SA 2MJUA 3I4PA 2HVIA 4YR3A 1HD0A 2ZC4A 5KFCA 3E51A 3BN4A 4TNOA 2HHTA 3DLGA 3DI6A 2FLNA 4DV6F 4ECYA 2YKPA 3KMQA 4K0KF 4JV1A 4GC6A 1P9QC 5C5JA 1JIHA 1SUQB 5E3CA 2R7WA 3MTKA 1VC0A 4KTQA 3UCUP 3NNAA 1YIJS 1OPZA 1SB6A 4E8UA 3RB6A 1UEUA 2CPZA 2AJ4A 2XZWA 2GA7A 1LW2A 1P1LA 3BDEA 3EXYA 1Q82T 1CEZA 2OTLS 4X4VA 4RU9A 4ED1A 2Y1RI 3Q2TC 3HDSA 2BW2A 5DQIA 2VOOA 4DSEA 3OFGA 2ZBCA 4RW4B 4C0OC 2B6AB 1FVSA 3PJXA 2FVCA 4IR1A 2XLIA 3NCQA 1GX6A 3A1YG 4H4KA 4DL6A 4V19X 1X9WA 4ZPAA 4LF5F 1M5HA 2DHGA 2CJ9A 2Z8QA 2UXCF 2HWTA 1N5TA 2M52A 3AA8A 3M2UA 3MOZA 4NA2A 2DH7A 2VKZG 2W7OA 3BO3A 1U8SA 3OQ2A 4U7UK 3TVKA 3PW5A 5CXTA 2EFVA 1FVQA 4YQWA 2JLFA 2DVIA 2L08A 2JDJA 1DURA 3QJJA 5CZXA 4L6V3 4OHYA 1HBMA 3R5AA 4MMOA 1JJ4A 4HT5A 2Y1IA 2ASLA 1M5VC 1Q53A 1RA6A 4BWJA 2XSJA 4KGKA 4WYWA 3T5KA 1F5CA 3PIOQ 3CMAS 1JNZB 1XR5A 3RW7A 3VAMA 4DQSA 3T9ZA 1JLGA 2YWGA 1YRTA 2UV8G 1F2GA 1ZAWA 3CSKA 3DRSB 4ZHRA 4OL8A 1NJXA 1KTQA 4MIWA 1EETB 4GKKF 1UFWA 1NHVA 1NK0A 4M5DA 5CD4H 4WIIA 3V6KA 3CIMA 4DF8A 1CG2A 3DCAA 3DMJA 3KG4A 3TAMB 2QSWA 3V81A 1N33F 1XMBA 3GFXA 4ZVHA 3OBIA 1S1VB 2ZFHA 5BYSA 3V6JA 4TN2A 3Q8RB 1FKOA 3V4IB 3TAPA 1WD6A 3PHEA 4AFFA 1UJ5A 1KD1T 3Q23A 4ZPWR 3C46A 3MEDB 2Q1LA 2KXHA 5LT5A 1SL0A 2R7TA 2E44A 3IR7B 2VL1A 3KK2A 2PMHA 4EBCA 1A6LA 4RWXA 3DLGB 3DI6B 1TL3A 5AE3A 1F5AA 1VIXA 2VPWB 3K57A 1ZTWA 1YWXA 4L3NA 2AYBA 4JI3F 3HM9A 3PO4A 1NK5A 5LJ3Y 2N4DA 3HZGA 5K5MA 1P8GA 3AQPA 4EO6A 5K8PA 2WBMA 1N88A 2J9CA 3CCLS 3CO9A 4AXIA 2FVPA 2OFHX 4KAIA 1REVA 2XEXA 3UWTA 2FHOB 4MKAA 1LW2B 5K14A 3LP0B 4PXEA 3UR0A 2JSXA 4Q8EA 2YWHA 5F0WA 1HBOA 1D8YA 5D77A 3PXGa 3MCSA 5L8RC 5G0RB 2JX2A 2HNZA 3P96A 4MH8A 1TZ0A 4A8XA 4I6AA 2XC9A 3MPWA 3JSYA 4XIUA 2D41A 3KYLA 3NCRA 3GIKA 1UWBA 5JVGQ 4M95A 1K0TA 3DU5A 4K4YA 2DCLA 1S1UB 2NR0A 3HXMA 3C6TB 5EWFA 4C4WA 3OVAA 2FGOA 2KI2A 4FBTA 4WK3A 5J1NA 1NJIT 1QY7A 2BRKA 3TNVA 3TYTA 2J0QD 2N4CA 2POKA 2DNLA 2WONA 2J9EA 4ECUA 1RTHB 5AE2A 3M2UB 4OI4A 2AYEA 1FKPB 1U49A 2A3JA 1IQTA 2HGMA 4TY9A 1YJVA 4EBEA 4N5SA 2HQ3A 3C6UA 2MQPA 2AGPA 2VQFF 2QRRA 4AL5A 2KB2A 1JLEB 3T9NA 3ULHA 2AU0A 4CI0B 4B9VA 1VHFA 2ASYA 4A8WA 2YKAA 5KT6A 1U48A 3RBDA 1P1TA 2B3TB 5KT2A 2FHJD 3N5BA 2B9XA 4IDKA 3FRZA 3T5JA 1TL1A 2EBGA 3ISND 3P49B 3AH6A 3MF5A 1DHMA 1U6ZA 1JLGB 5FDLA 3MGJA 3HX9A 3I31A 4A46A 1S6PA 2M8HA 2PE8A 3BGUA 1O51A 2XI2A 4ZHRB 5K9FA 4QWAA 4DV4F 2COLA 3SDEA 4DSJA 3X1LB 3NS5A 4IQMA 2F3JA 3N01A 3TUIC 3MMCB 3MD1A 2YX4A 2ILZA 4M5DB 2GHPA 1FRJA 1RKIA 2DNKA 5B7WA 4JI0F 5D3GA 5LJ5Y 2RJZA 4LUBA 4JI2F 2BDPA 3VZIA 2JEIA 3O44A 4I2QA 2FVSA 3TA2A 1IJFB 2N3LA 2R8GA 4L72B 1OIAA 1AFIA 1FKOB 1E6VB 2QMWA 3U27A 3BR9A 4C3LA 5T14A 5CYMA 2VODA 2MZTA 1WG4A 4J37A 2W7AA 5LSRA 5MLCV 4A8YA 2CZ4A 3GFHA 2WB1D 3KK2B 5THWA 1HNIA 2HHVA 3UNGC 2F8HA 2NSCA 3G6XA 3QLHA 3DLJA 1RT6B 1H2TZ 3R1HA 4KPYA 1MNEA 3IS9B 3NKYA 3K59A 2VA3A 1VOMA 3US5A 1ZM2A 1K8AT 1ZH5A 4QOTA 2P5VA 1Y4ZB 1WI8A 1TK5A 4F2RA 1N54B 3BGLA 2OAUA 4OZ1A 4DG1A 2V9KA 1RT5A 5CZVA 5A8KA 3NNCA 5K14B 1GAOA 2MYFA 3OL7A 4C7QA 2JLEA 2AD9A 4ZCMA 1HBOB 4O44A 3OV7A 1T3NA 2KJVA 2LCWA 4EFAC 3SCJE 2HNZB 2GCFA 2B51A 4LQ3A 3HHEA 4TU8A 4C8NA 2DR8A 1U1KA 2E5GA 2V4QA 3CXCR 3H2VE 3S6EA 2J6SA 5HP1A 1YG0A 2IJFA 1VBYA 1B0VA 1VS3A 1VQ6S 1VK3A 3EGNA 2LU2A 3FMWA 4ZPCA 5M2RA 5CCMA 3RAXA 2J9DA 3H98A 1FJEB 2ZDPA 2XS7A 2RU3A 4R0EA 5JUMA 3RB3A 2Z2LA 1U2FA 4F8RA 1HL6A 1RT7A 3OUYB 3M8SA 2F7VA 5IFMA 2DGSA 2KHDA 2O66A 2KM8B 1PC4A 3C6UB 2QV6A 3ETOA 4IUFA 1X5PA 3FMBA 2QA1A 3B4DA 2LXFA 5KFEA 1HWKA 3VAKA 2OO4A 2X3GA 1GXTA 1U1MA 3K5OA 2CVEA 4IDKB 2WW8A 4USIA 1JXLA 2M4MA 2YQ3A 3F41A 4Q2LA 3LAKA 1TL1B 2EFOA 4PPZA 2ACYA 2BABA 4KV8A 2KHCA 5I3QA 4D3HA 4QWBA 5GAHU 3MM6A 5FDLB 4DX8H 2QA4S 5DG8A 1NJWA 3QAEA 1M5KC 1HNVB 2IRUA 4EYIB 3H5UA 4M94A 3MMJA 3HHLA 3SDEB 1V9OA 2XNRA 3SCKE 3PFOA 1UMJA 3S7RA 1DBDA 4GKJF 1WEZA 5DM6Q 1Y7PA 2ZBIA 5HL7Q 5KFRA 4DV0F 4RW7A 3SQGB 1HWUA 2IC3A 2Q3PA 3LALA 1NK4A 2KM8C 4I2QB 3QIPB 4WE1A 3WX4A 2E1AA 4RU2A 3FQKA 4ETZA 2YX7A 4YR2A 1GH8A 4FBUA 2J6UA 3GYXB 1IBLF 4OX7A 3RRHA 1X0PA 4K4XA 1N5YA 1FDDA 2MZJA 5KG0A 1HNIB 4DFJA 3MM8A 1SIZA 2DT9A 1HI0P 5E3AA 2KG1A 1ZBTA 2ROEA 5EHHA 3NWGA 4C8MA 4MFBB 1PILA 2IA0A 4K4TA 2N7CA 5DDRC 1NH7A 2ZH8A 2RQKA 1XR6A 3M2VA 2DNQA 2RD5C 4RW6B 2KT5A 4DG1B 4WJBA 3UR3C 1RT5B 4CTAA 1HPZA 1LW0A 1V3SA 3QO9B 5A8KB 4OX9F 3PKYA 5D8HB 5D78A 1H7XA 4O44B 2X1AA 2XB2D 1WACA 2N82B 4DQIA 1SJ4P 2A10A 1UVMA 3O2IA 4A8KA 2OSQA 3W2WB 3H59A 2HYIB 5HLFA 1KLMB 4I6YA 4X62F 5HP1B 5EWEA 3SMZA 3E2EA 1SJ1A 1K0VA 4EBDA 2WRMA 4TQSA 3M2RA 4QU7A 1LWEB 4J9NA 1KVIA 4NCBA 4UQGA 2JRSA 3KK3B 4NXMF 4DR5F 3ZZOA 3PO5A 1Y00A 4USJC 2RIJA 3M4XA 4LT6A 3Q8QB 1TKZA 2QFJA 3O6QA 2HRYA 3EGWB 2EW9A 3PNIA 1T8EA 1FESA 2WHOA 1XERA 2CQIA 1I94F 3ENQA 4YP3A 3BJYA 4N8NA 3GQCA 3VAIA 5KG4A 2NLWA 3OL6A 1WHVA 1KQFB 1IKVB 1IM4A 2PEHA 1KNZA 5F8IA 2NUUG 2H9ZA 4ATNA 1ZTTA 2JL9A 4KV8B 3TRGA 4LSLA 1NHUA 5IQQA 3PR4A 3CDWA 3MM6B 3BQ1A 1U45A 1M1KT 2R7QA 1KR4A 5J2QB 1NZAA 4QIGA 3TW0A 2JC0A 4BWMA 2UVRA 4IFYA 5SUHA 2IMWP 5DM7Q 1KQGB 3HHLB 2ZH6A 2XGQA 4X2BA 4GO7X 5KT3A 2HNYA 4O23A 2J9DE 4YB7A 5E33A 2CYYA 2D3ZA 2IC3B 1X5TA 4YB6A 2DNHA 2XNQA 3HK2A 3VQTA 3OL9A 2D3UA 2DHAA 5L9XA 2VFVA 2UVVA 1H6KX 4EUVA 2VC1A 3WZ0A 1LV5A 3D28A 4KC5A 2DIUA 1CPZA 1S9GA 4Q2MA 1MU2B 5KTQA 1C0UB 2KJWA 2BA9A 3T5LA 3EUNA 4A4JA 3FZBA 4XO0A 1HQUA 1RWUA 2WOMA 4OLOA 5GADU 2ZOMA 1O8BA 1QAYA 3IN5A 2C3OA 3DGPA 2W9CA 4DV5F 4RBVA 5KFUA 2YH0A 4PG5A 5KT4A 2EPIA 3G4SS 3M9MB 3UFCX 3H5SA 1X4AA 2CQGA 3D1QA 1HI1A 1QSLA 1U2RA 1N6QA 1YI2S 1QLNA 2JHEA 3QGIA 1D1UA 1SBRA 3BGRA 2EBEA 4YR0A 2C22A 1O5JA 2YTCA 3RB4A 1HPZB 1TKDA 1MSWD 1QUVA 2W8LA 2YVSA 1U7LA 1JJ2R 3Q24A 3QZ8A 2IFXA 3MMBB 3HFKA 3PACA 2MQMA 4N8OA 2E5JA 2ZHBA 1RQ0A 3CCRS 4F4KA 4Q0BA 3MPYA 2K3IA 1OQ6A 2BVZA 3ZZ0A 2Q43A 2OPSA 4A47A 3GIIA 1L3UA 1S1WB 4K5RA 2FB0A 4ECVA 2PFFB 1TK8A 2AYMA 3HVWA 4WFYA 2ASJA 2O67A 1T3OA 1S9FA 2G4BA 3U1MA 2P9GA 1TKZB 1S7HA 1S10A 4OZNA 3KLHB 2R2RA 1KLNA 2HNDA 3WC0A 2K1RA 4NCGB 4YHHF 5KAKA 1QSSA 4WKRA 1DTQA 2YY3A 3W2V