3BGFA

X-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
180
structure length
178
Chain Sequence
b'CPFGEVFNATKFPSVYAWERKKISNCVADYSVLSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spike protein S1
publication title Structural insights into immune recognition of the severe acute respiratory syndrome coronavirus S protein receptor binding domain.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein/immune system
total genus 33
structure length 178
sequence length 180
chains with identical sequence S
ec nomenclature
pdb deposition date 2007-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bgfA01
3SCLE 2DD8S 4KR0B 4L72B 4L3NA 2AJFE 5DO2A 4KQZA 4QZVB 4ZPWR 3D0HE 3SCKE 3D0IE 2GHVC 4ZPTR 4XAKA 3BGFA 3SCIE 2GHWA 3SCJE 4ZS6A 4ZPVR 3D0GE
chains in the Genus database with same CATH superfamily
1SKUB 1N36J 1KC8T 3IO1A 4GO5X 1T0TV 4QWAA 4KHRA 5GAEI 3HMJG 5F0WA 1VQOS 3HO1A 5D4NA 5D78A 1SC3B 1JXVA 4AL6A 2IM3A 3GIIA 1Z1ZA 3T3FA 4QU7A 1YJ7A 4LVNP 4RW6A 4MYUA 1VBKA 4H4KA 1R27B 3PX6A 3TVYA 1QAJA 3WIVA 4NA1A 3L09A 3MEKA 1WOPA 1HBUA 4ID5B 2R2TA 4WTOB 4NYPA 4ATNA 2CUYA 5HMZA 2Z57B 5C2GA 2BJEA 2QMUB 1NEEA 5B0FA 1XR6A 2JVRA 2WOMA 1FJ7A 1Q78A 4ECYA 3HZGA 1HL6A 1RHMB 1H6KX 2RRAA 3UNGC 4IH7A 1LEOA 4HTJA 4C0OC 3FCHA 3SV4A 4EK2A 3FRYA 1WDDA 2AX0A 3R5CA 4NCBA 3M8PA 3M1VB 2LQ5A 1KQKA 5DGAA 3BYRA 2Q6CA 5HROA 1BLUA 4ICLB 4RWXA 5KG2A 2MPUA 4ILRA 1LWXA 2IA6A 2CVIA 3LP0B 4ETXA 3K8WA 2BJ8A 4DV5J 2UUBJ 5FDLB 2QYCA 4HACB 2CQHA 2MGZA 4DX6A 2X51A 1LQ9A 1FKPB 1HNZF 1TL7B 4TNOA 2NR0A 2HZVA 5KFKA 2AWZA 2Y1IA 3J80Y 3BO3A 1RT4A 2RQCA 4ZDNA 1K73T 5KFXA 2ZM6F 2BZ2A 4DSKA 3I0RB 4AXIA 2QLWA 4RW9A 3BSNA 4DR7F 1PAUB 1MN9A 2ZEJA 5HMXA 2ZHAA 4EO6A 4OZ5A 3F56A 1OPIA 5HQ8A 2AW0A 3DOMA 2JC1A 1KEKA 1FE0A 4ELVA 3I32A 4X4OA 1UVNA 5IC6B 1CJTB 1SKWA 1E6VB 5F3ZA 2AGPA 2XS2A 2BMBA 5J2NB 5AE1A 2DXFA 1RK8A 2XYHB 2D3O1 4WIQA 1GTHA 3FSIA 2K06A 3HPOA 2RHQB 3J7YU 1D9DA 3B82A 3LPEA 1S1XB 3K57A 1BWEA 3HI9A 2IMWP 5M2UA 2R8IA 1C0TA 2NUHA 5F8MA 3MF5A 3TZWA 4TU7A 1F5BA 2CG8A 3KUEA 4FBUA 1QSSA 3H90A 2V9WA 3H8YA 3J81U 1Y3JA 3BSAA 2IY5B 3C16B 3RAMA 2W8LA 4P2XA 1HI8A 2DNHA 3LANA 1RTIA 2R42A 1NXIA 2GMHA 3JSMB 3GJQB 2RDIA 3Q8VA 3OVSA 2OO4A 3CMQA 2AP6A 3VVTA 2KT3A 4AFFA 1YBTA 2BACA 4DR4J 1TFYA 5EN1A 4DV3J 4LQ3A 4OV6A 4RX6A 2VKZG 1VHIA 4ES2A 3FRZA 4Q2LA 3WX4A 2E1RA 4NLRA 2MSSA 5DQGA 2VC1A 4P74A 5F8HA 5I3QA 2C3YA 3OSNA 4F4ZA 1XEZA 1YRXA 4JP8A 3VAGA 3RAQA 4NASA 1R89A 4WFBQ 4LR8A 5CCLA 3R6GB 5KAKA 1S7HA 5K20B 5C42B 3BREA 2HIQA 4IO9Q 3NWRA 2N82B 5ETOA 5A8WA 2Q79A 3QLHB 4LRFA 1R0AB 2ILYA 2KZMA 4USIA 2B9EA 3K5NA 1WC6A 1Q5YA 2VFSA 1VQ5S 2VODA 1N5YA 5DM6Q 3O1LA 3BV8A 1L3TA 1S6PA 2MXYA 1WHXA 4ED5A 3CJTA 1S9GA 4DPOA 1NM2A 1S59A 2F1FA 1FTCA 2V68A 1N34F 3KDOA 3CCTA 1YWXA 3Q24A 4J7CA 3BQ2A 4K4YA 4ZIVA 3G87A 2CWXA 3JQJA 1WF0A 1TL5A 3KHRA 4DHVA 2B51A 1SJ1A 4Y2AA 3BYPA 2ASDA 4C4WA 1N6QB 4P2FA 2IM1A 3V4MA 2L08A 2C3OA 2WCXA 1DQAA 2H65B 2NS1B 3CC2S 1JX4A 3UD4P 4F67A 1VRQC 2CQ0A 1BQNB 4DV1J 3DI6A 1MROB 3THVA 4DWIA 5KFIA 3DLEB 3W2WB 4ER8A 1NB2A 2GCFA 2HK2A 4ZCLA 3LTOA 3DOLA 1EZZB 4ZCIA 4DS4A 5D6GA 3D67A 3PW2A 4TQSA 3FEYB 2RH3A 1FWPA 1YJNS 1TUGB 2QLBB 1U48A 2HNYB 4NYZA 5T7LB 1PC5A 4F7VA 2AGOA 4HT5A 1LW0A 3SCIE 1B0VA 3H59A 2GC8A 3P5BP 4IFYA 2YKNB 3CJKB 4EMDA 4F4AA 1YITS 4FF2A 2CWKA 1O6XA 1RHKB 2OAUA 1N4LA 2DNZA 3VR1A 3ITHB 3ZZZA 4G1QA 4NLWA 1FCAA 2PA8D 4JI0F 4N76A 2PFFB 5IM0A 1HBMA 3C6TA 3W65A 2QV6A 2XZDB 4PWDA 3PG9A 3OJUA 2WVBA 1T7PA 2V5HG 1RXOB 2VQFJ 2OUGA 3MHYA 2DNGA 4F4XA 2XLKA 2XZTB 2XMMA 1X4FA 1VBZA 3IS9A 3AD7C 1UA0A 2FYXA 3M32A 4MK7A 3BSCA 4K4ZA 1FWLA 2OFGX 1LWFA 4DPWA 5D3GA 3NOGA 3CCMS 4RNNA 4NLSA 3J7ZT 2P9GA 4WP8A 1SV5A 2BBEA 1WC4A 4ZN3A 1B0TA 4AUKA 3KG1A 3Q89A 4CLTA 1BXNA 2XHWA 4KGXB 1JLFB 2ABYA 5D4PA 4PQUA 2BM1A 4K0KF 2JHEA 2WZ1A 2DHSA 3V5RA 2ZVSA 3H5YA 1S99A 2JNJA 1SPBP 4OJGA 3K2YA 4TXSA 4JI4F 1IXKA 4S0MA 1VCTA 4X4RA 2X7IA 1CSJA 3I5CA 4OHVA 2YWWA 3OT9A 4LRCA 2V2KA 1QJHA 1R8CA 1RHUB 1WORA 2B5JA 2IC3A 2A1BA 4DV1F 5IFMA 2IM0A 1FK9B 1CQNA 4CNYA 3PYFA 2BABA 2DH9A 3MR6A 2RRBA 1IKXB 2EG2A 1CULB 2E9TA 1HD0A 2AIRB 3BBFA 3PTWA 2EFOA 2ZFHA 4ZCKA 5JUMA 2GAHC 3K58A 1M5VC 2OTLS 3V6DB 1N33J 4F2SA 1RHRB 5CYJA 1J5OB 2JC0A 2J6UA 2ZOGA 2W9BB 1C2PA 3HJFA 2CDQA 4CT9A 2JEGA 1TTHB 1RGVA 4UW2A 2Y9HA 2HS4A 4NA2A 5A2QU 1GXUA 4GVBB 2HBYB 3CD0A 1F1BB 3RBDA 1B4SA 1RE1B 3ZNJ1 1FF2A 3KLEB 1X5SA 3PX0A 4ID5A 2WAQD 2K7JA 2E29A 1H3DA 1XR7A 4FNHA 1NH7A 1RACB 3BN4A 4DU8A 1NDPA 3AHPA 2OPSB 2K3IA 4O3RA 3KUGA 1C1CB 2HFZA 1U1OA 2WVDA 2YNGB 4FYXB 3N6NA 4LUBA 2WVFA 1ZBTA 4WYLA 1BUXA 5E7OB 5J2QB 2ZBQA 5DJBA 3IGNA 4Q44A 2XYPB 2Y0SD 1UVKA 1PILA 4IFVB 2FD2A 1TELA 1WKLA 5GMKa 3TVZA 2U1AA 5AXKA 3CC4S 2MZ1A 2E5GA 4NE9C 4A8XA 2V94A 2MZJA 2HBQB 2OIHA 4A8YA 1JNZB 2GAGC 3TEGA 1Y10A 2MYFA 1U1KA 3LP0A 3PRVA 3MAHA 4DR6J 3P8BB 2NXUA 4FF1A 4Y28C 1WUUA 2CQ4A 3UR0A 1SC1B 1FKPA 2BKPA 4V19X 3K5LA 3UE2A 2LXIA 5H9FJ 5HATA 3FZBA 3TJ9A 3PYGA 4KKOB 3SSRA 4HKQA 2JL9A 3OHAA 5DO2A 2XGQA 3GIMA 2YWFA 3G4SS 1YKWA 1YZ7A 1I3OB 3BS9A 1NAQA 3O6QA 1NK6A 3I0RA 2H5EA 4DX7A 4NZ7A 2M7SA 5DG8A 3IM8A 1RWUA 1TR0A 2IPOB 2IMOA 3SQGB 2CQ1A 4AYBD 2MKYA 3HHLD 4I56A 2YPYA 4MAKA 2YVSA 3DU5A 3KOAA 2OMLA 1VQSA 2GZOA 3CD6S 3ZZYA 7FD1A 3DHXA 2DR8A 5ETPA 1AZSB 5ETMA 1E6VA 3HVTA 1U0HB 1S4EA 2ZBRA 1QAXA 4C6AA 3PW5A 1EAYC 3UI3A 4H4MA 2ZZMA 2W4PA 3DRXA 5HP1B 5EWFA 4NXMJ 2G2YA 4LF8J 3Q8YA 3EICA 1S0OA 1KOOA 3A3OB 4HI1A 3VQTA 2C3PA 4C48A 1IR2A 4O3OA 3CJSA 2OEMA 3TP2A 3PIPQ 3JTNA 3C16A 4O3NA 2HFUA 3N28A 1U09A 4YHHF 1RAFB 3Q2TC 3AXKA 4UUXA 1YG0A 4WE1B 3JSMA 3AA9A 3D0HE 2DHGA 4LF4F 4LF7J 3T5JA 5EX0A 1KTVA 3OTOF 4PYDA 5ETTA 2PMZD 5B0BA 1AROP 2V4JB 3AQPA 1JIHA 3TR5A 4L72B 1FE4A 2R8JA 2Z2ZA 4B3RJ 5L9XA 2BOPA 1ICEB 8ATCB 1TMJA 1VLYA 4CDIA 5I3UB 4QOTA 1S6OA 1WELA 3W64A 5ETLA 4CWBA 2DGSA 2FVQA 1BC6A 4RKUC 5B0GA 2PEHA 2LCWA 3HKZD 1H7WA 2UXCF 1FESA 3LA0A 1P1LA 2DO4A 2XWXA 3NCQA 4PWWA 2FLPA 2EW9A 3I31A 2MY7A 2Y8YA 5C42A 1CQMA 4B9VA 5IS2A 2QYGA 1T11A 4IUFA 1X9MA 5CXTA 3CCRS 3BKUA 4KV8B 2E44A 3A8JA 3QLHA 4RWWA 2B6AB 2PEBA 1K47A 4XPCA 4B08A 3W5XA 2O1PA 4ZPBA 1H2UX 1FXDA 4DPTA 4G1PA 2KYXA 3WQPA 1Q53A 4ED2A 4DR6F 2W2QP 1D9AA 1X4AA 1VOMA 3CD7A 4DR2F 1VDHA 1AYEA 5HVFA 1RHJB 4X4TA 1LK7A 3U1LA 3MCNA 1FRIA 3O8WA 4ZVEA 3H4DA 2YPZA 3IXQA 3ZZUA 1RSCA 2CQ3A 1QE1B 4FVCA 3UDVA 4ERDA 2D7SA 3RB6A 2J7WA 1N6QA 1K8AT 3CJ0A 2OPRA 1DAXA 3TANA 4P2MA 4O4RA 1FJGF 4I68A 1I94J 3CO9A 1JLQB 4USJC 2FVCA 3KG0A 1RDRA 3W9JA 1FNXH 4ILMA 1KVJA 1BQNA 5CAAA 2AGQA 2QRRA 4USTA 4PG7A 3US5A 3H25A 1NPKA 4TYBA 2J9DE 5HVHA 1LV5A 3G96A 5H1SV 3T1AA 2XMWA 3W2WA 4JV5F 4NXMF 2W9CA 3PW0A 3OFGA 4NX9A 4LF8F 1R8BA 4TN2A 1NK8A 2H3EB 5IT4A 4NXNF 2IIHA 5T7LA 4CT8A 2AX1A 3BBBA 5JJBA 4U8YA 2HHVA 4L75A 3T9ZA 2BJ3A 2Z2LA 4PUOA 1ZM9A 1UFWA 1VC6A 2M88A 1IBLF 1QTNB 1UW9A 4JI6J 1NPPA 1UMJA 1XMOF 1DTTB 3ITHA 4UT4A 2CNOB 1IM4A 1S48A 3JTOA 2RU9A 2J76E 5BR8F 2MLZA 3OXLA 1VJWA 5KFHA 2WB1D 3GFXA 3B54A 4J90A 3J7AN 4PPDA 3I56S 3K59A 2M70A 4HLBA 3NY0A 2BA9A 4CP5A 2PIIA 4C11B 2MLYA 2ZBCA 1JJ2R 1YHQS 2KFNA 2M4MA 4HI2A 3DM2A 4DZ6A 2PA3A 3MOJB 1ZA1B 4J9NA 2EI5A 2EFVA 5GAHI 1RU2A 3ZC4A 4X4NA 5T41A 4Z7CA 2EK1A 1G6BA 2KYZA 4MJKA 5EWGA 3VHQA 1NO8A 2FB0A 3P4UB 3T19A 4CO1A 3G9CA 4OZ3A 4N47A 2HFOA 5HQLA 3FZ2A 2LECA 1HI1A 1IBKF 2GX8A 3FEZA 2HGMA 2BR0A 2HQIA 4NLYA 3ENWA 2YNFB 2IVYA 4M5MA 3R5AA 4N5SA 4A8KA 4OHZA 4TY9A 3P96A 2PMHA 2UVRA 3MURP 3LW5C 1ZZFA 3J7Z5 1L3VA 4RL1A 4K50A 1PYOB 3OL8A 3G6XA 2J9CA 1RYRA 4ANCA 2HKEA 3I4PA 5AXLA 1HHTP 2N7YA 2KO1A 1URNA 3ONQA 2ZNYA 5EUHA 2H48B 2R8GA 4DL5A 3VAJA 1FFSB 1NHKL 4R8UB 3W2VB 1NB7A 3CCZA 4ZLPA 2F9JA 1N8RT 2VG5B 3PYEA 2BQ3A 3IA0A 1CULA 5A6PA 2MQNA 2GA7A 2IA0A 4EZ9A 3IG1B 1FD2A 5LL6d 2G1HA 4ZVHA 1U24A 1HA1A 3M4XA 3S1TA 1J5OA 1LWEB 3DGVA 4CLSA 3A3NB 1X4BA 2LLZA 4LSZB 4ZK7M 5CZVA 2H4WB 4F2RA 4WZQA 1RT2A 2CJ9A 4NCGB 1JLGB 3PNIA 4GVBA 2DK2A 4U6PA 1QVFR 5G0RB 2UV8G 1CG2A 3QBCA 3FEXB 4EGLA 4B9UA 1HIYA 2A0FB 4UOFA 1IKWA 3KLEA 2DHHA 4JI6F 4P2SA 4OZJA 4O4GB 5F8GA 2D3ZA 4HDGA 2HFSA 2KG0A 1MWQA 2HSEB 3VGVA 1QTMA 2OPSA 2NCKL 2NXNA 3EMTA 2LU2A 1SJFA 3FKBA 3A8EA 2R3VA 1GFWB 4ECZA 2FZKB 5J2QA 3LAKA 1VFJA 4TYAA 3PW4A 1S4FA 3Q8PB 4CLYA 3QAEA 4IFVA 3QJLA 4LF6J 5EHHA 1NJWA 1SL2A 5CYQB 3TYTA 1AFJA 3GTYX 4WFXA 4LRBA 4L73A 3P49B 1L3SA 2BJ9A 3EXYA 3KYLA 3KG4A 1RT5B 4NLGA 4OL8A 2ILZA 1XMBA 3DU6A 3K5PA 4Y2IA 3FSYA 1EARA 5H9EJ 4KC5A 2MQ8A 3KTQA 4P52A 1VC5A 4F36A 4N8OA 3CULA 3FVYA 4BS2A 3IM9A 2VJVA 5C24B 1TKTB 2E7WA 1GH8A 4XDCA 4DV0F 3UCUP 1WKJA 4KKOA 2CKWA 2RS8A 5E41A 4RBUA 4DEZA 3HHDA 5K8MA 2W4CA 3GQCA 2F40A 2RNEA 4NRUA 1YJ9S 2QJ3A 2UXDF 2BE7D 4EEYA 3MI7X 4L76A 3VV2B 3MEGB 1LKZA 4ED4A 4YP3A 3A4TA 3SQGA 5D8HB 3RB0A 5FD1A 4EBDA 1Q95G 2HW3A 3LP2B 1RKIA 3CF5Q 2CADA 2QA4G 4ECTA 4I0WA 2PMWA 1U0HA 2B9YA 1F6TA 1P9QC 3GONA 3DRRB 4ZVRB 4PXCA 1CS4A 3QGHA 1IVZA 3KDNA 2FJWA 4DLGA 1Q8BA 2HVEA 2WBRA 3MPDA 4LFBJ 3EYZA 3KLHB 1SIWB 3DLHA 5HMYA 4LSNB 1KHWA 3MTKA 2CPHA 4RW8B 4OFZA 4MIAA 2MZQA 2HWTA 4LF2A 5IT0A 3JS9A 3HHLB 2YTCA 3Q22A 3QO9A 5D0RA 3M30B 2ACYA 4OHXA 1VK3A 4KPCA 2FHOB 2V2VA 5GAGU 3KHLA 2V4JA 4O3SA 2AJ2A 3EDRB 4OI0A 5ETNA 2HMIB 2F7VA 4ECQA 3KJVB 3QZ7A 3AA8A 2MMYA 4DX8H 2VPYB 1X4DA 5I3UA 3GJRB 3CDAA 3D6FB 2QL9B 1NUEA 2WONB 5HBMB 2VUGA 2F4VJ 2GQ2A 2VQEJ 2PDAA 4WXWA 3M6VA 2NPFA 1PG5B 3N5BA 3QAUA 2L41A 1BHNA 4Q45A 1FNOA 3AJ1A 1OSDA 4A8MP 4KV8A 2FDNA 3PZPA 2LMIA 2YNHB 2JH3A 3NNCA 3KK3A 4DCPB 2U2FA 2WB4A 3TQ1A 2VL1A 1KFSA 4KYZA 4DQPA 4RLEA 4PR6A 3D9BA 4HHJA 4A8SA 4EBCA 2DGOA 2ASLA 4JI2J 1WJ9A 4OJ1A 1T03A 5BYQA 3T5LA 1MWYA 1YZ6A 4RJVA 1QE1A 2ZJPQ 3OHBA 2JDJA 2BJ7A 2XZWA 3G2XA 3ZZPA 4MK9A 1TV6B 1JLQA 3TX8A 3T9NA 3WDOA 1FRLA 4U9RA 4J9SA 2O01C 1C4CA 1N0UA 3N6MA 2C1EB 5KG5A 2FLNA 4DFMA 3QYYA 3KLVA 5ETQA 4LFCJ 3POTA 1D8YA 4WU2A 4NI2A 1U02A 2IFXA 2BDPA 1KNZA 3AT1B 5EGYA 3OQ2A 4UF4A 4WKRA 4KE5A 2EBGA 2HWIA 2A2CA 3JQMA 1NRKA 2ALYB 4OJHA 3IWXA 3GSDA 1WEXA 3HK2A 1AUDA 3TA2A 3NGTA 3LAMA 4DLEA 4QJVA 3MMAB 2VBWA 3OFEA 3FUYA 3D54A 3MFIA 1WI6A 2CFXA 4ZS6A 3EVOA 3IRWP 4LF9F 3TX0A 1DTTA 2HQ3A 3MTJA 1FO1A 1C1BA 4NEZA 1G3OA 5E0OA 4J9PA 1NK4A 4DS5A 3JAMU 4ECWA 4CTAB 2I6WA 2UXBF 4DL6A 3SV3A 5M2RA 1AXQA 3QGGA 2D3UA 1MMNA 2BE2B 1U8WA 1JLBA 1HWUA 1WHYA 3KJQB 1PIEA 4P7TA 4C11A 3W1YC 3HULA 1DFDA 1WHVA 4PWUA 2HYIB 1MMLA 1RWVB 1M5KC 2AHOB 4ES1A 1HI0P 3MD1A 3TEHB 4ZIWA 3V6KA 5KFWA 4J37A 8RUCA 3GR0A 4CLKA 2CJBA 3G6VA 3EZUA 4ZVFA 3CDBA 2VG7A 4LFAF 3UDCA 2UUTA 3M8WA 1FTRA 3GV5B 1S49A 5C2CA 4DI6A 1Y9OA 1Q8LA 5KFQA 4P6QA 5J2PB 3FFIB 3CSKA 3VAMA 4LIWA 2YNFA 4CO3A 2CA9A 2B0GA 4F50A 4I6AA 1RWXB 2B7BB 3Q8UA 5HL7Q 4P73A 3NEKA 2ZC4A 1KDNA 1Q4RA 4OX9F 2MQQA 1RCXB 1RAEB 4EYHB 1XWLA 1SJ4P 3DLGA 1HW9A 5GMDA 2YNIB 1Q81T 1RJJA 1DLOB 2B4PA 2FJXA 4DR3J 1KKHA 2HQCA 3L7UA 1YDLA 3D5MA 3DRPB 3H7HB 2UU9F 4DOZA 2PSZA 1IN0A 4HL9A 2LU1A 1KBRA 1FX2A 1FVQA 2ZBPA 3R3TA 3W2VA 4UOGA 2X1GA 4DUYJ 1HMVA 4X66J 1NZAA 2UVVA 3GJTB 2VG5A 1IWGA 3DCAA 1LFWA 1XNQF 1HBOB 1Y5LB 3AJDA 1HBNB 2XLIA 1A6LA 3RBEA 1VQ7S 4DFPA 3IG1A 4Q8FA 2E1MC 4DSFA 1LWEA 4C8LA 4IR9A 1Y5NB 3OR1B 2VBYA 2GO9A 2ASJA 2AYGA 5LXYA 2CQCA 2XY7A 4GKKJ 3IBWA 2I0XA 1H72C 2CPEA 4WU3A 1RAAB 2KVIA 4NCGA 2KH9A 2H5IB 1P9YA 5G0RA 3HX9A 5CZXA 2AMCB 1T9WA 3THTA 4DX5A 1NSKL 1UW4A 4CQ1A 2DTJA 1LXJA 1H2TZ 3LGMA 3O2IA 1VQ8S 5KT5A 1S9EB 3WZ0A 1KQGB 3C8YA 3EUNA 2MJNA 5FLXY 2CQBA 3CEDA 1F0XA 3OPKA 2YX7A 4TQRA 2B8QA 3C14B 4U8VA 4DPYA 4G3IA 2CQ2A 1TVRB 4LBPA 2P9CA 3BQ1A 4DFJA 5SZTA 1TQLA 1NKBA 4ENOA 4A48A 1TAUA 2RQKA 4RW7A 4Z2XA 1HNXF 5CYQA 4IG0B 1NDCA 4X65F 2R2SA 2EBEA 2BW2A 5E5NA 2DGVA 4F4WA 1J2VA 3TJ8A 2VONA 2DHAA 2CQIA 3TZXA 2F63A 3D0GE 1XJWB 1RT3A 3PACA 1CJVA 1B7FA 2COLA 5K8PA 1S57A 5C24A 1TKTA 4PAAA 4QCLA 1RKJA 2VA2A 4JB8B 3T5HA 1URRA 2ALZA 3Q2SC 1UA1A 1C0UB 1KQSR 1RAHB 4Y34A 4TLRA 5KT4A 3VAIA 5HLFB 3MEGA 1TKXA 4UUWA 1WC1A 2K2PA 1PYSB 3GLJA 4BC7A 3MM8B 4WPAA 4F4KA 3GU0A 2NSBA 3LP2A 4YN3B 4XIUA 2W1BA 3VZIA 1VGYA 4URSA 2ZKUA 3N79A 3GPAA 3AAWB 4DUYF 3DRRA 2IJNA 4ZP6A 1UEVA 2EPIA 2WBMA 3NP5A 1AB8A 3CNQP 3ETOA 2PN6A 4LSNA 2QLJB 3T1HJ 5KFYA 5HN0A 3D6HB 2CPFA 3GV8B 1FEHA 3HLUA 1WHWA 5LXRA 3AODA 2ZDPA 2VDHA 2C2ZB 1RLDA 2KJVA 1F60B 2DNLA 1UVJA 3FBCA 4CO5A 3HHLA 5U47A 4GKKF 2APOA 4A8OA 2CQDA 2VIHA 4WK3A 1X9WA 1FNMA 3M30A 1W26A 2B7CB 1DHMA 1UAWA 1U6FA 5I42B 3DDNA 2HGNA 3K7RA 1Q8IA 3BGRB 2QGFB 2AYEA 3T6JA 2Z2YB 2GQQA 2R7OA 5ITHA 4M95A 1NKEA 5DDPC 4NMXA 1S7IA 4YS2A 3KJVA 4ITSA 3PR4A 2CNLB 3RAXA 2J9EA 5D4OA 2FPHX 3NGDA 2AKWB 3DOKB 4KFBA 1IR0A 4CLPA 2M8HA 1WNEA 4A8FA 1UVIA 4LJMA 3IC1A 3VAFA 2HHXA 1IBMF 2HRUA 4FKYA 3GCWP 1MU2B 4QPTA 3VGUA 4YOEA 5CYMB 4EU0A 2HLUA 1UFKA 1HHQA 3BQ0A 1CJUB 3QSYB 3TW0A 2YNHA 1UPPA 4DV6J 3SSQA 4ZP9A 3KHHA 1JJCB 3CW2C 4P71A 3RR8A 5DZ7A 1KLMB 4HR2A 2C2DA 3EZ5A 4WIIA 1PAEX 4MYTA 2B4OA 5B08A 4B9TA 3N01A 3OSPA 2C2MB 4FPRA 1TKDA 2YH0A 1VJQA 2XG8A 4DV7J 4OV1A 4URGA 1H0HB 2O66A 2GVDB 2R2UA 1BY9A 4OX7A 3NCRA 1TV6A 3RBXA 3FBBA 1A9NB 4OI1A 3EGNA 2DCUB 4L3NA 1YRUA 1WTBA 3MM7A 1NDKA 4ED8A 2YKQA 3SYZA 5LT5A 2FC9A 3THPA 2KU7A 2FJAB 3GIRA 3H20A 2HVDA 1MG7A 1DRZA 2I8EA 3R1LA 1D0EA 2M52A 3J81j 2DR5A 1L5UA 2RB7A 5BXIA 3TUJC 4IDKB 3PFOA 2VD3A 2GGPA 4XDDA 2G0CA 2KDOA 4PEOA 3BGFA 1RWNB 4FKXA 3ILOA 1PBUA 2CVEA 5DETA 1BGXT 3R5GA 3J81Y 2FGOA 4FNIA 3PRDA 3GFZA 3W8GA 1ZOTA 5GADI 1K44A 4DG1A 1N88A 3DRSB 4DV4J 1S1WA 4WXOA 2ZITA 2QLXA 4IOBA 3OTBA 1WC5A 1ZH5A 2JJ4D 4H4KC 3VVUA 1TK8A 2A6MA 3V6HA 2DNKA 3I82A 4ZPCA 2XHCA 4DL0C 1KN6A 4B3OB 1APSA 1I51B 4LF5F 4CTAA 1SH0A 5A8KB 4ZN1A 4CLWA 4DUTA 1OJ4A 2DIVA 3ETMA 3NBPB 2LDIA 3HHKA 3FCVA 2LVWA 2R2RA 3NRBA 3KLIB 3BH6B 4QWCA 2G0JA 2CRLA 3N4WA 4FP9A 2MHEA 5KOWA 1IKYB 1RT7B 1R0BG 5AE3A 2R7SA 3NNAA 5D0EA 1HNZJ 4U96A 3L95X 3Q83A 1RTJB 4DV6F 2JOQA 1VHFA 3GIJA 5HMWA 5J2PA 3FFIA 2ZM6J 1U6BA 1VYAA 2IVFB 1RT6B 4DR7J 1HWJA 1LW2A 4JI7J 2HQFA 3HFZB 1HPZB 3NAHA 1SQGA 2F8HA 1OS5A 2MQLA 3EVWA 4M5NA 4KGKA 2XMJA 3TZZA 2YKMB 4IYQA 2FJDB 1HWKA 5D77A 5KTQA 3MR2A 1RA7A 2MQMA 4LF1A 5K5MA 2YNIA 5FIIA 1ZZNA 4PRFA 3BR8A 3LWLA 2Z56B 1V3RA 3W63A 3K8VA 4RPFA 1VQPS 2DXEA 3BJYA 4A47A 1Z4UA 3M8SA 5KT3A 1RWWB 2BE9B 5KFLA 3M9NB 4HH0A 1HBOA 2YQ0A 3QZ8A 5KG3A 1HBNA 2KKHA 1CJKB 2X3GA 4RO0A 2OLWA 1KTQA 2KHDA 2WSFC 4OI6A 1T05B 1UJ6A 4Y2CA 2F5GA 3M6UA 3M8YA 2PI5A 4YFUA 3AOBA 2DY1A 2N3OA 1KD1T 2HHPA 1QSLA 4WBFA 3UNYA 4M5DB 2IRXA 4DV4F 1BQXA 1X4HA 4Y00A 2QFIA 3PY8A 1KR4A 3HZEA 2QC3A 4B9SA 2IAJA 2QN6B 3V81B 1T8EA 3HVWA 4RU9A 4NA3A 1JXEA 3QT5A 2P8IA 4EYIB 3DYAA 3AD9C 1C4AA 2RE1A 4CM2A 3DMJB 1S1VB 4KSEB 4FS2A 2QX0A 5J2MB 3CCUS 2Z30B 3B8HA 3C14A 3S01A 3LH2S 2CPIA 2JZ5A 3MEEA 2OP5A 1TVRA 2AV5A 4IRDA 2V67A 2E5HA 3FNNA 4F0MA 4Y0FA 4J9KA 1HQEA 6FD1A 3OBIA 1EHWA 3UD5A 2KT5A 4K4SA 3JSRA 4I2QB 2BVZA 1SC6A 1ZA2B 5DGBA 1U6ZA 4JI3F 4Q5VA 3BKTA 3R97A 1TAQA 5RUBA 1N34J 3MPVA 2RUSA 2QA2A 5B09A 3KMQA 1REVA 1NJYA 3FMWA 4XPEA 3HF5A 2RU3A 2VDIA 4X4UA 1QAIA 1R8AA 4CH1A 3WC0A 1Q0NA 2ZE2B 1JK9B 1GMUA 1VRTA 1MMDA 4Q7AA 4JI7F 1MSWD 2B4UA 2RS2A 1YGYA 4K2JA 3W62A 4CLZA 5L1IA 1C0UA 2CPDA 3IBCB 2VICA 1KHVA 3MPUB 3U1MA 2HHSA 3IMQJ 5HLFA 1N32F 1ROFA 2PD1A 5L8RC 3FJ2A 1S0VA 3H5XA 3MM8A 5AXNA 3BM7A 4LIRA 3B6BA 3QIDA 4CI0B 1NJZA 4E2FB 4RR5A 4B3MF 2W7OA 3ZTOA 1WF2A 1NPRA 5L1LA 2BUNA 3ISNC 3NL0A 3PV8A 3H42A 3OFFA 2C3MA 2OSQA 3E8OA 1XR5A 2A18A 2W2MP 3D1HA 1R0CB 1NJXA 1Q16B 1VQ6S 1RBAA 2V8GA 4OI2A 1HLWA 5A2QY 3PIOQ 2HHUA 3IRXB 1M90T 1DQ8A 4TU8A 1XK8A 2NLWA 4KBIA 7AT1B 1PJ7A 5KG7A 1VQLS 3TUPA 4JI0J 3HDSA 5I42A 4M5JA 5K9FA 5IQQA 3BGRA 2J7UA 5F0UA 4WK1A 3T1YF 1WC0A 1Z2ZA 4L3KA 2XYGB 2LFVA 4ZJLA 1S1UB 5GAEU 4MKBA 5AE2A 3CDUA 3DOKA 3C2PA 4OLOA 1NU4A 3NXZA 7FDRA 4IOAQ 2RQMA 4HT7A 3P6YC 1JLAB 1GX5A 1ITPA 5IV4A 2FHKA 4C9DA 3PXGa 5E3QA 1LOUA 1T9YA 1MU2A 3RJMB 5CYMA 2FVRA 4B3TF 3OW2R 2DIUA 3CMAS 4MFBB 4K4UA 1CJUA 2VBXA 4B3SF 2RT3A 4V1Ak 3IGVA 1DURA 1WG4A 5LM7E 3P5TL 2UUCF 2MZTA 4K0KJ 2NZCA 3HFKA 1KLMA 3D3CJ 3LOUA 2H5JB 3UW1A 4OI4A 1VIXA 1NSQA 4JI4J 2YQ3A 3RBZA 2FVPA 4DN9A 2RDJA 3OVBA 1YBAA 1FRHA 3G6YA 2GVDA 4FPIA 2GMLA 1Y4ZB 3SCLE 4B17A 3KLFB 2V8HA 2DR9A 3FC9A 4X4PA 2QTWA 3T5KA 2NXEA 4I2PA 1UFLA 2MKKA 2DRBA 4ELUA 2GIQA 1R43A 3D7SB 3CVKA 2BKOA 4CIOA 1DY3A 4LREA 3SSSA 3CO0P 5KFDA 4UZCA 4R0JA 5GMEA 1SB6A 1TKZA 4IDKA 1F3VA 4F4YA 4LR9A 1R31A 2P6SA 2E5LF 2PE8A 3C19A 3DNCA 2CIMA 3I87A 1FRJA 3A3PB 2FTRA 3CXCR 3MZIA 4ZPAA 2O5DA 3M8PB 1HNVA 2KM8B 4O0NA 3DXBA 2X1AA 2D3OR 4QZVB 2ZHBA 3U7JA 1OY9A 1X4EA 4OLPA 2DNYA 4CRJA 4N41A 4KB7A 2POKA 1XMQF 4FXDA 3DRSA 4F3MA 3OXFA 3MUVP 4ED6A 3NLCA 9ATCB 3BN7A 4USKA 1Q82T 3RTVA 4XO0A 4F8RA 1H73A 3ISZA 1CC8A 1T9XA 3S6EA 3QSIA 2YBVA 2R7QA 3UR3C 3BPSP 5HJXA 4FYVB 3W66A 2AYBA 1RT4B 2OPPB 4B3OA 3BGOP 3QGIA 4J9MA 5A8KA 3CJ4A 1D8ZA 2I1RA 4X62J 3NBPA 4RW9B 1DTQB 2MZSA 4DR5F 5AJ3F 2EVZA 5LOQA 4KO0A 4CZCA 3MMJA 4I6WA 1F9FA 4RBVA 4Q43A 2XMUA 1Y0HA 3TA0A 4BWMA 2RDDA 1UJ4A 1RCOB 4KR0B 5EX3A 4CH0S 1TL4A 1P27B 2DCLA 1IKYA 1F5AA 1EIYB 4ECRA 2YWKA 4D3HA 3R7NB 1RT7A 4EFAC 1EX8A 2ZH5A 2W24A 4EI2A 1DBDA 2QMWA 1RTJA 3UDLA 1S12A 3BGLA 2WW8A 3C6UB 4EUVA 3E2EA 1WKKA 1NZ8A 3ILLA 3R5JB 4QR0A 3GP9A 1RA6A 3ZNUA 1C0TB 2J0QD 1RT6A 5ETSA 2JFKA 1HPZA 4YY3F 4RUCA 5A6WA 3R9LA 2PT0A 2B9WA 1RTIB 1J5EF 1W7WA 2YKMA 3IWNC 4K4VA 2ERRA 2FZCB 1XC9A 1GQEA 2ZUGA 2C2RA 2XQCA 1H74A 1S1TB 3NGRA 1WF1A 3CDEA 5KG4A 4AXJA 3OFHA 3TARA 2AD9A 4DPXA 2V9KA 1TUWA 4JYAF 3WIUA 4YMEA 2JLGA 1FJEB 1FRKA 2J7KA 1K9MT 2FUG9 2K8GA 1E6YB 5HQMA 4PABA 1NMEB 3HHEA 4NRTA 2LA6A 3SEOA 2O3DA 2O67A 2B3TB 2CPYA 4K5SA 1WTFA 1RAGB 1SIZA 4DUZJ 1CJKA 1RAJA 2JLFA 3NS7B 3N6LA 3CTRA 4YHHJ 1V5VA 2NXJA 3EDQB 1HR0F 4R5PB 2IYGA 2ZJQQ 4LF4J 3JTPA 1TUVA 5KFEA 1VQ9S 3RB4A 3KKFA 5A8WB 2FC8A 3OTOJ 3D2WA 2IYIA 2JRSA 1T02A 1MW7A 4OYWA 1X5TA 3RRKA 4UQTA 2AJFE 4LT6A 1QVGR 4DMZA 1N5YB 3NMAA 3KLGB 3V81A 2ZH9A 4M5GA 4MKYA 3PKMA 1FA0A 3FBEA 3G86A 4J91A 2UZAA 3I5BA 2UXCJ 3DMJA 1XNRF 1S1VA 2JFDA 4DV2J 5B0EA 4X62F 3M1VA 2D69A 2CAJA 2I5JB 3ZTQA 4ZVPB 3QFHA 4A8QA 4ICLA 4I64A 3ULHA 3KUHA 4NZ6A 2H1YA 2Z4PA 3IR5B 2VC0A 5B0DA 4I2QA 5FDLA 1IUJA 4MTPA 4C8YA 4HACA 3D1QA 3DLBA 3ENAA 4DR2J 1TL7A 4F25A 2RMLA 4B02A 3HCXA 2E66A 1U0SA 4PG5A 3BB5A 3PJWA 3MR7A 4IO1A 5CH7B 4OYZA 2HHTA 4AQYF 1FJGJ 1LW0B 4IFYB 2BJDA 3TNVA 1HYSB 3B4MA 3EGVA 3QT7A 3BH7B 2ZJRQ 5DDQC 5JVGQ 3CIZA 3QQCD 1CJTA 4HH1A 2XY5A 2MHNA 3LO3A 2XO6A 2KL8A 5L39A 2HWHA 4E8UA 3KK2B 2XNRA 1UL3A 1ULRA 3BPDA 4ETZA 5J2NA 1S76D 1Q7LB 1FX4A 4ZOSA 4G1QB 4O44B 2XCPA 4JV5J 4BHQA 1J27A 5J1NA 3OVAA 3N5FA 5JMNA 4B9NA 5CCMA 5JXSA 5KFZA 1S1XA 1VS3A 2FVSA 1G7CB 3L3CA 4D3GA 3DLLQ 4NXNJ 3HT0A 3KJFB 2EFNA 4DSLA 2EC2A 1GMVA 5A0YB 2E5IA 2HVZA 5I3PA 4DUZF 1FHTA 3D1OA 4K4WA 1YJVA 4WF9Q 1ZPWX 4DXLA 1IBLJ 2ZH6A 2H4YB 3IRXA 3MCSA 1XMOJ 1GXLA 2A2DA 5LSLA 5CQGA 4C0HA 1FDBA 1OO0B 3ZZTA 5BR8J 2K7KA 2V34A 1VRUB 2EKNA 1U2RA 3CCQS 4JI8F 2WSCC 1K0TA 4DQSA 2OPQB 4YQWA 3R8YA 2V8VA 3PO4A 2JVOA 3MCOA 3MXHP 1RTZA 1RZMA 1ZYQA 3UCZP 3DLKB 2HS3A 4FBTA 4H4OB 1S1UA 2N7CA 3M2UB 2E7VA 3LUYA 4M63A 2J0SD 2ZZNA 4DV2F 2GVZB 1S6QB 2Q43A 4V19J 2DNRA 1F2HA 4E98A 4ZPWR 3SI8A 4JV2A 3OLBA 2QA4S 3LF0A 4URQU 3RB3A 2B5JB 1R0AA 3RR7A 5IT9U 1WC3A 1RHQB 2J0WA 1N48A 3FMBA 9RUBA 1IBKJ 3CE8A 4MFBA 4DF8A 1LFPA 1TZ0A 3MWBA 3P3DA 2GW8A 3G6ES 1U7LA 4OQJA 3RU0A 3VTIA 1P8GA 2RF2B 4C97A 1HW8A 4Y2MA 4A8WA 2IDLA 3BSOA 1Q1KA 2YX4A 1PGZA 2C42A 1SC4B 2R7RA 3DXSX 3OR2B 4KRWA 2BJ1A 4RNFA 2E5JA 4O0IA 2C22A 1YRTA 4HYKA 1ZAWA 3FK4A 2HRYA 2YWGA 3OXGA 5LMUF 1OY8A 3CJRA 1MROA 3IR6B 1B3TA 3KLFA 3ILIA 3I96A 4GKJF 3ZTRA 2EG1A 2ROGA 4O3PA 1DQ9A 3DLEA 3I5AA 2ZH8A 5B0AA 2HZCA 1O0PA 5DLFA 2DNMA 1A7GE 2DH7A 4X84A 4GC6A 1KP6A 4QIFA 4KIAA 3H40A 1R7IA 2ZUAA 1K0VA 5IWAF 2HNYA 2KXNB 3CPWR 1H2VZ 2H54B 3AJ2A 2ASYA 2G4BA 5LMNF 1R6VA 2RHSB 2YKNA 3DC2A 2V6AA 4QIVA 2AZ1A 3CJKA 4KQZA 3SCKE 1ZM2A 4QYZK 2KHCA 2Y1JA 2DISA 4RZRA 3HJVA 2CJKA 1HNIB 2LQ9A 4C8ZA 1YTYA 2EFPA 3EWGA 2UV8A 5CABA 5HANA 1U1NA 2HHHJ 3FGVA 2HAFA 3N9UC 2OPPA 2FJEB 3I4HX 3QIPB 1R8PA 2KFZA 3DKDA 4F0HA 1T9TA 1QAYA 1DTQA 5LSRA 4EWTA 1B99A 3VF0B 3MMBB 4X64F 2ZZTA 1R8HA 2E7XA 1JWWA 1X8DA 1T94A 5ETVA 3B78A 3D3BJ 3HVTB 5D0GA 2ZWOA 1UWBB 3H98A 5D0HA 3AFGA 2VOPA 2YWEA 2MKSA 2VG6B 4H4MB 1RLCL 4C8KA 4OHYA 2RSQA 2MDAA 4WYWA 1JLFA 4DV0J 2DRAA 3C6UA 2XC9A 1RTDB 3PYDA 1AUSL 3QT8A 4YB1P 1N36F 3Q8QB 3VGSA 3W60A 5IXUA 1NHVA 4J9VA 5HI7A 3GR1A 2DB1A 2XI2A 4P75A 2UXDJ 1XN9A 3MUTP 1GAOA 4CM0A 2JEJA 4PPZA 1F5CA 1NHUA 3O44A 5KFAA 3TWZA 2KXHA 4OYPA 2UUWA 4QYRA 2YXLA 2QEXS 3MPWA 3BBCA 3BF4A 3UQSA 1FK9A 3QRQA 3MD3A 2R9LA 1S1TA 4QWEA 1O51A 4QW9A 4I6YA 3R2DJ 1IKXA 3M6WA 4ED7A 3HKWA 2V63A 4Q0BB 2BQRA 2YKAA 4OIXA 5KFVA 2OH2A 3V6DA 3ZO7A 5HJYA 1MN7A 3MECB 3QRRA 1E6YA 4JV1A 1EKSA 5A8RB 1MLAA 2XGPA 2W9BA 3W5ZA 4RUAA 1D3WA 5DDOC 3NNHA 4CO4A 3M2RB 4QQBA 4FYDA 4R5PA 4M5HA 1KLNA 4ZLNA 5F3TA 1FERA 1MNEA 2V0NA 1QD1A 4CH7A 1B70B 4C7QA 4DV5F 2FHMA 2UUBF 4OYXA 2P2CB 3KLGA 2AJ1A 2BV3A 3JAMY 1X7VA 1ZTWA 2C2EA 4P9SA 2HHHF 1C1CA 1NJIT 4ANEA 1RI7A 2YNGA 2KFYA 3CCSS 1OQ6A 3AY0A 2RD5C 5F9NA 3G8TA 4W90B 1AA1B 1UEKA 2OEKA 1YLXA 2DNOA 3ENVA 5I4MA 2KVQE 1O8BA 4OI3A 4NCAA 2OPRB 2AEFA 1RAIB 4TKTA 5F8NA 2HQGA 3ENQA 3R2CJ 2I5JA 2ZH4A 3GG1A 2HVIA 4PXDA 3TA1A 5IC4B 4YEAA 4ZITA 2I38A 4W98A 4ZKAA 4IRKA 3H2UB 1RWPB 1ACMB 4FXVA 4NLTA 2VBZA 2DPJA 1RUSA 3Q8RB 4X2BA 1UPMB 2KG1A 4QWDA 3TVKA 1IR1A 2ROPA 1BQMB 1EJ7L 1N0VC 4LRAA 3H5SA 1JQGA 3X1LB 1OMSA 5LJ3Y 2VJUA 2BYCA 2DT9A 4ALZA 2W9CB 3ET6B 3OJSA 4ZMMA 2VZ9A 3TQEA 2JEIA 2CNKB 4F26A 2GMJA 4C98A 1TL1B 3HVRA 4MMOA 2JX2A 5E3RA 1L3UA 1TK0A 2L9NA 1LNQA 2V2QA 4OZ1A 2F8EX 2VV5A 3GSIA 1HYSA 5GAHU 4PUOB 2FZGB 3EE3A 1PCAA 2FHJD 3EM1A 2OSRA 4LMZA 2KN4A 1AZSA 2YH1A 5KFTA 4YR2A 4DR1J 4WWSA 4PXBA 2DGQA 1QM9A 2D9PA 2DR6A 3KK2A 2V50A 1GNKA 4ZJOA 2VKRA 4DR4F 1I1GA 4O44A 5HP1A 2RKIB 2HBZB 4DV3F 1T9VA 1U1PA 1M5OC 3F73A 3LP1B 1JB0C 4M94A 3K5OA 3NKYA 1JXLA 4J5OA 1TP7A 1HD1A 5A0YA 2HS0A 2DBBA 3DM2B 4IH5A 1PBAA 2NSCA 6FDRA 1WSRA 4WE1A 4N8NA 2XMKA 2D1CA 3P45B 4XTTA 4LF9J 1SJQA 1NK0A 3CMES 2OI2A 3QJJA 2HFVA 3UDEA 5IV3A 1S0MA 3D4JA 4QIWD 3G8SA 3VWSA 4ZHRB 2OFHX 1VRUA 2UXBJ 3ZXWA 3G71S 2LEPA 4GRSA 2MKJA 2OPQA 4IOCQ 3LGNA 3J80U 4WFYA 1ZETA 1NLKL 1ZPVA 3M8ZA 1QDUB 5LJ5Y 2XULA 1Y7PA 1YX2A 2M5YA 3DLKA 2ROEA 3CD5A 4H4OA 2VFRA 2AYMA 2CQGA 3M2UA 2ZBIA 5KFUA 4Z37A 2XI3A 5HO4A 4ED1A 1P6TA 4LR7A 2GVZA 5KG1A 2Q3PA 1S6QA 4U95A 1EP4B 2WVCA 2IRUA 4YR0A 1UVMA 2E1PA 2CYYA 3M9MB 3DDKA 4OYAA 2B6AA 4LFAJ 3RRHA 2MKHA 2RJZA 8AT1B 3CCWA 1U1MA 4DL4A 4DQIA 3C66A 3LGHA 3TAMB 1RWMB 1U1LA 2PC6A 4JI1J 4PYAA 2X1BA 4WCEQ 2DNNA 2HURA 1ZTTA 4O3QA 1T3NA 1YQHA 4FYWB 3GB0A 1BD6A 1YJRA 2K3KA 4CO0A 3V6JA 3UN2A 2P6TA 2EC0A 2RF2A 4OX9J 1REGX 2M2BA 4J9OA 3CUNA 3OUYB 2P9EA 2C2NA 1X9SA 1OY6A 2VFUA 3Q86A 4NEYA 2DGUA 3UCGA 1RT2B 3OR2A 3X3UA 1N5VA 2UU9J 3NS5A 2NYHA 2DEJA 4ZP8A 4ZCMA 1IKWB 4C0BA 4K2XA 3AH6A 2LKZA 4DR1F 2FGCA 3M05A 2RILA 3K89A 2XWYA 1IQTA 1XNQJ 1WOOA 1FRMA 2ADCA 3KMSA 2V2ZA 2ATLA 2F9DA 1KQFB 4P10A 3AD8C 5EDWA 4NLXA 2LYVA 2KTQA 4M1KA 4C8NA 1AFIA 5C7PA 3M2VB 2LDYA 1IJEB 1ZS6A 1U2CA 2H51B 3GV7B 2VQFF 3OLAA 4C2MA 3GG0A 4PG8A 5D15A 1NCLA 1KSPA 2N3LA 4NLUA 5E3AA 5DZ6A 1XIQA 3S8SA 1Q5VA 2G13A 1HNIA 3BDEA 2BX6A 2Z0GA 5HK4A 4KPYA 2PO4A 1UWAA 2UVUA 2R7WA 1SCJB 5KFJA 1FD8A 4JI5J 1CVJA 3UVJB 1PJ6A 4LSLB 4WJBA 3F41A 3QIPA 4MIWA 1T3OA 1IJFB 3PO5A 2NZ4A 2DXDA 1AW0A 2KRRA 1HNXJ 3RG6A 4WKYA 4X65J 2WSEC 3PJXA 2HPUA 5FJ4A 3MMBA 3KJNB 3CDWA 4FF3A 3HT3A 2GV1A 3PX4A 1M1KT 2V69A 5L46A 5HVGA 4BDPA 4FDFA 3W7BA 2E1AA 5DQHA 2IDEA 5J1PA 1UWBA 3ZZ0A 2VG6A 1CS4B 1EQ0A 1RT1B 3DLJA 3R5DA 4JI1F 1VQNS 1RWKB 4P72A 2I2YA 2V4RA 1M5SA 1CLFA 3GWCA 1RTDA 3PEHA 4NWBA 1N33F 3Q0AA 2KB2A 4ID8A 3MM6B 4JV0A 1TL3B 3PJ9A 2VOOA 4M5KA 4NYOA 1H98A 4K7QA 4DSJA 5IQ6A 3CCLS 3L4BC 4USVA 4NL5A 3HSDA 2C2KB 5B7WA 2W4DA 1QY7A 1JLEB 3QO9B 1S79A 2RRNA 1JJHA 5KT7A 2GHPA 4LBIA 4R8UA 3TUIC 2Z8QA 3MAAB 1HWLA 4M5IA 3T41A 1X5PA 2G9OA 3NGUA 4Q0BA 3FQLA 2EKYA 3MECA 2W2NP 1G4CA 3F0NA 4M8LA 5A8RA 2ZOFA 4ZVSB 2B43A 1SL0A 1G1XA 4QIEA 4K5RA 4LBHA 3S7RA 2Q6BA 3E3XA 1FXLA 2Z2MA 3M2RA 1JLGA 4MKVA 3GZ7A 3UN3A 5H9FK 5E2QA 1ZM3A 2G2OA 3U1NA 3KK3B 3PEJA 1YI2S 1M5HA 4O4GA 2XBPA 4X4QA 2HNDB 3IWLA 3CJ5A 4U7UD 3HHLC 1RABB 5THWA 1I6JA 4M5LA 1KWMA 3QJPA 2AJ4A 4JI5F 3M8QB 4ES3A 1T03B 4KGVB 1IBMJ 1YK9A 1XQIA 3NCPA 1FKAF 2KI2A 4LRDA 1GMWD 5KFCA 2L48A 3ZZRA 4PG4A 1O5JA 1SBRA 1Q86T 2AU0A 1RT5A 3IAM9 2X1FA 3JXOA 3A8KA 2XO7A 1NK9A 4USUA 2DYAA 1WWHA 2JSXA 2LQ8A 1CBKA 3POTB 1BQMA 1VK8A 2I9SA 3AXMA 3VALA 4NI2B 5KFSA 2NREA 4IH6A 3DDIA 3MGJA 4PQAA 4MH8A 1EB0A 5KFFA 2OMOA 4HVZA 2R8HA 4JBCA 1XTZA 1VI7A 4DN0A 3EJMA 3ET6A 2XSJB 2OELA 1HARA 3VQSA 1TL1A 2ZDOA 4YB6A 1GT8A 2MJUA 1Q79A 5K8OA 2DGTA 1UVLA 4YDDB 3A13A 3W9HA 3BKFA 1N54B 4YUDA 5B0CA 5KFRA 1X4CA 4ZPTR 4LF7F 4MIBA 1RBLA 4RUBA 3MMCB 4Y2KA 4UOCA 1YVFA 1HQUB 4YB7A 3PCOB 2CPJA 1C1BB 2DPIA 2DJWA 4USWA 2Q1LA 4B3RF 2RKIA 4CLLA 3KLHA 1U49A 4DF4A 1Y3KA 2Z58B 1HWIA 4CYUB 2OEJA 3LP1A 4OX6A 3FSXA 2CZVC 4YB5A 3NOCA 3C15B 4RW8A 1JLBB 3SXLA 1UETA 2LP4A 5AXMA 2DNPA 2R7TA 4H54A 2HHWA 4ZLJA 2QG9B 2AQ4A 2J5AA 3A8IA 1SI9A 4BBYA 1SKSA 1WACA 3IAS9 2MTLA 2ZHOA 1FKOB 1KFDA 1V5IB 2HNZB 4I7FB 4FVMA 1SH2A 2AJ0A 3A12A 2QO3A 3NMRA 3CCVS 3PM9A 2DNQA 5IZHA 3OL7A 3EZOA 2VG7B 1TK5A 2NXCA 3R7BB 3GFYA 2FIUA 5KG6A 2CXEA 2HMIA 5SUHA 2HGLA 5C25B 2OKQA 4LF5J 1ELOA 3DN9A 1JKHB 4ZHRA 1ZM4A 1FI4A 3MM5B 3IFEA 2XCAA 1YIJS 4TLQA 3VZHA 3MAQA 1RQ0A 4RW4B 2QT7A 2F4FA 2WONA 5HBMA 2UP1A 3NGSA 2GJ2A 3LQVA 5MLCV 2QA1A 3M9OB 1EETB 3UWTA 3ILJA 2FQQB 4DDFA 4ELTA 1QLNA 1LWCB 3DLGB 2MQPA 1EP4A 1I94F 1WI8A 2GO8A 4AL7A 2B8PA 1W2BR 2AT1B 5GAGI 2M3DA 1QSYA 2XB2D 2V4QA 4WFNQ 4NLVA 1FVSA 4BC9A 1A0OB 4JUZA 2BW7A 5DDRC 2YY3A 2DH8A 2DO0A 1HMVB 3WBZA 3EXCX 2XM3A 3TAMA 2R7VA 1M5PC 1UJ5A 4ECSA 3CJQA 1F2GA 3TOQA 5CA5A 4OX8A 3IR7B 1SXLA 2Q66A 3BR9A 2BXJA 3C46A 3KXDA 4F3OA 3OUYA 2WHOA 5E3CA 3PKYA 4B9MA 5CHCB 3SFGA 1FFWB 2IVMA 2ZC3A 3FQKA 2VPZB 2B4VA 1OPZA 2EEYA 2CNNB 4O23A 4NZ0A 3VAHA 2MLXA 1SQFA 4NLQA 2XMVA 3EGZA 2H9ZA 1T95A 3JYTB 2W9AA 1NSAA 2BEFA 4OYIA 2YKPA 2F65A 2W01A 2CZ4A 2BOAA 2VFTA 1W25A 1SJ3P 1SQEA 3D6MB 4WFAQ 1UCNA 4QWBA 5F41A 1B64A 1U1RA 1SKRA 4E0DA 4R0EA 1IQZA 2BQUA 3M2VA 1N5SA 3MCMA 4MT1A 4EBEA 2D41A 2MZRA 5JVHQ 2YKOA 1S10A 4RW7B 4UY8T 4KAIA 1D1UA 2BANB 2HZAA 2DD8S 3MMAA 3J7A1 4BWJA 2HBRB 2DR7A 2WTFA 4DJBA 2HFNA 3KNAA 1X5OA 2HAIA 1VQKS 2QE5A 2XEXA 2ZWPA 1X4GA 3MPYA 3BEGB 2OJ3A 3V4IB 3H0PA 2DVIA 1RT3B 1CJVB 4FZVA 3CCES 4OHWA 2K1RB 3ZFVA 1XBWA 4MKAA 1RB0A 3BZQA 1DJ0A 2W25A 4DL7A 2BE2A 3FDSA 4IKAA 2DHXA 3U27A 1V3SA 3CWJA 3UVJA 1X31C 4LSLA 3QGPA 3D68A 2Y1RI 3PDNA 3RW7A 2KJWA 4RNOA 1SUQB 5HAOA 4CCHA 4PXEA 1TKXB 3MEDB 1KOHA 1NDLA 3UD3P 2EK6A 3AB4B 4JI3J 4WZMA 3ZZOA 3TJAA 5L38A 4ED3A 5KFPA 3CCJS 4NLPA 3KNGA 1B0PA 3PW7A 3VAKA 2ZNZA 1RT1A 3N0VA 1NH8A 3RW6A 3PFEA 4BCAA 2ZKTA 4HTIA 2VASA 4FS1A 1Y11A 4IG3B 4OJ3A 3MM6A 3M6XA 2MY8A 1KVIA 3WX8A 3MDFA 4RNMA 4TY8B 1TL3A 5LSOA 4RU2A 2RIJA 3G82B 1N32J 1TU0B 3CIMA 4IQXA 2W8KA 1M1HA 2JLEA 4FN5A 2F8MA 1DLOA 2RUGA 3DRYA 4GMKA 1S5ZA 1UEUA 1JLEA 1RU1A 3DRPA 1VIOA 3SQOP 4B3MJ 1UZDA 4Y3CA 1WG5A 1CEZA 3MAAA 2Y0BB 4L6V3 1KVKA 2ZD1B 2FJBB 2GJIA 3LALA 4J9UE 2UUAJ 4A46A 5F8IA 3HVAA 1L3KA 1G2EA 1PKUA 2VH7A 3LPYA 1VLOA 4UQGA 4JOUA 1HKAA 4N7TA 2GIRA 2HK3A 4KFBB 4B9LA 3QRPA 2MQOA 4OZ2A 1UP1A 1TFWA 4C3LA 5H9EK 3OR1A 4YR3A 1WOSA 3ZTSA 4C8OA 3JSBA 3ISND 4LF6F 1BMQB 3PHTA 4CLFA 4HHHA 3F44A 1SL1A 4WFZA 2G1DA 2GHVC 2CJYB 3IN5A 2FJVA 4FF4A 4ZVUB 5T14A 3T1YJ 2HNDA 3EPGA 3DFEA 1HHSA 1YBUA 1S9EA 4F3QA 3CJ2A 2YX1A 3U02A 2VA3A 2PFDA 1CC7A 5BJRA 4GC7A 3O3LA 2VB6A 3D28A 4KHPJ 5L1KA 4EZ6A 3OTDA 2OD6A 3M8QA 2XS5A 1UKUA 2ZH7A 5KFNA 4ZVTB 3ELHA 2D74B 4MK8A 4C3KA 4NLDA 2AZ3A 3MOZA 3HD1A 2HIYA 3WHIA 1UTAA 4IQMA 3T6BA 2W7AA 3HFVA 5GADU 4IG0A 4B3TJ 4UOHA 3PR5B 4WP9A 1U4BA 3KWMA 3R1HA 2UVWA 1VR6A 1RWOB 3MM7B 4B3SJ 4KT0C 3BGUA 2PI4A 2J0XA 4R25A 1OYDA 2GFFA 3SBMA 2UUCJ 3HM9A 2YWHA 1M1GA 2SXLA 1UZHA 5L9NA 3OV7A 4X4SA 1RADB 2KXFA 2CJAA 2CPZA 4J9LA 2BRKA 2MB0B 1IKVB 2GGPB 5K14B 1ZAVA 4WP3A 4C3MA 1KONA 3SCJE 2J6TA 4LFBF 4PZVA 3MFHA 4DSEA 3KHGA 3MM9B 2J8SA 4HEA9 2XSJA 2GS8A 1FXRA 3PVXA 2N4CA 1GX6A 2VFVA 4KH0B 4NOHA 4OZ0A 1NNDA 2FLLA 2GIFA 3TAPA 2GNKA 4Z7YA 4DG1B 5DQIA 1S1WB 2NPIA 2KT2A 2QSFA 5KFOA 3NS6A 4ZPDA 1VISA 2EWHA 1K1SA 1JLCB 3K17A 1NK7A 2RQ4A 1YJWS 3MMCA 3HD2A 1VBXA 1KRPA 1ZAXA 5AT1B 2JEFA 1HQUA 2HQDA 1Q8KA 2UUAF 1SH3A 2E5LJ 1FFGB 2MEWA 4KTQA 1S6UA 2A3JA 3GJSB 3I9V9 1H38A 3GYNA 2HG4A 3H5UA 4CYUA 1Y5IB 2W7PA 3C15A 5KFMA 1OQ3A 4DFKA 3SZ2A 1MWZA 1V9OA 3CB4A 5ADZA 3QWUA 4DL2A 5J1EB 1XMQJ 2F4VF 5DLGA 2QMXA 2VQEF 1RTHB 1FEEA 4P7VA 3QPIA 1FKOA 2HNZA 4I7FA 4RBTA 3HXMA 3GE9A 3IBFB 2FHJA 3O5TB 2AJQA 2XSFA 4N77A 3GMGA 4DQQA 5IOLA 5KOXA 2EXUA 5C25A 4QU6A 1JKHA 3MM5A 3DGPB 4C8MA 3TI0A 1PYTA 2F3JA 1LW2B 2IJRA 4KHPF 5ETKA 4RW4A 2DY9A 3KK1B 4DPUA 2R8KA 4JI2F 4DR5J 3JB9k 5AJ3J 1JMTA 3L7OA 2ZH3A 3M7VA 3L9ZA 4BLGA 3EX7B 3W5YA 2L9DA 4ANDA 1EETA 1X60A 1XERA 1EQMA 2GHWA 4ECVA 2NUUG 1OSCA 4ZPVR 5KT2A 3SDEB 1LWCA 3I0SB 1V3ZA 4Y65A 4G6VB 2L3MA 4OYMA 2DGXA 4ZJQA 5G4DA 3E01B 4DL3A 3QWPA 2PGCA 4NPOA 1NKCA 5A76A 1S0NA 4QW8A 4F02A 4IR1A 2WK4A 3M8RA 3BDPA 4J9QA 1VQYA 4LFCF 4FYYB 3OL6A 2NQPA 1WD6A 4YY3J 1N52B 2X3DA 2C2OB 3RYLA 4XK8C 3CJ8A 1J5EJ 4RW6B 3JSYA 1NSPA 2ACMA 4UZBA 1HBUB 3KFWX 4J9RA 1HNWJ 3NG8A 3VCDA 4I1TA 3W8PA 2AEMA 2WOMB 3CT9A 4ECXA 2IAJB 4JYAJ 1GXTA 3JYTA 1F3FA 3QT6A 1WG1A 4CNZA 5L1JA 5KT6A 3R5BA 1BWVA 2IHR1 3K0JA 2YQ1A 4ZVOB 3BO4A 2XY6A 3DYAB 2VU5A 3I6PA 3D0IE 1AT1B 1VBYA 5M2PA 3VGTA 3RZAA 1FWKA 2N4DA 1S97A 3D66A 3C3LA 1OWXA 2QL5B 1HR0J 4KGMA 3PHEA 2OGUA 3MEEB 5E3PA 4OYOA 3QFWA 1WEYA 4F0KA 5HROB 4IRCA 1Y00A 1HQEB 2CPXA 3GCXP 4TVAB 5BYSA 1WSVA 1YSJA 4QR2A 2HVHA 1HFEL 2BANA 1D09B 4RUHA 4Q2MA 4K8RA 2ZH1A 2MGZB 3JQKA 1PJ5A 3Q23A 2IJFA 1SVDA 3IP0A 2HHQA 4U67Q 3EGWB 5F9LA 2J9DA 3GIKA 5EWEA 3RRGA 2VPXB 4U7UK 3CGIA 3V4IA 2HLTA 1QUPA 2XNQA 1B7YB 4NMLA 2K1RA 1REVB 1FRXA 1X0FA 1XNRJ 4OZNA 4UY85 4OZLA 1P1TA 2M8DB 1HQ2A 2EFQA 2R7XA 4G1IA 3I55S 1VRTB 2C28A 2MKCA 3D6TB 3RUBL 3DOMB 3KLIA 2IBKA 2J6SA 1TMMA 2XTJP 3AOCA 1VC0A 4YDXA 1SUQA 1QUVA 2MSTA 4DU7A 3ZTPA 5IT9Y 3MEDA 1H7XA 3NWGA 2FY1A 1DZ5A 3HSGA 3CJ3A 1Q7YT 4PG6A 4DR3F 4QIGA 1U26A 3R6LB 3GYGA 1RISA 2DEIA 4Q8EA 2DRDA 3OL9A 1RAOA 3W61A 4ZLLA 2KRBA 4X66F 4G65A 1EKRA 4NLOA 1FJCA 1U8SA 4AQYJ 1X0PA 1U25A 2QIFA 4TU9A 2D9OA 5MAOA 1M0SA 2LQBA 3HSJA 2LEBA 3SFUA 5DRKA 3BO2A 1F9EB 4USHA 3FCWA 4IG3A 4L74A 4TY8A 4K4TA 2NYIA 3G82A 2HRTA 4DQRA 2BRLA 4PCQA 1RYSA 1S72S 2M9KA 1HNWF 1U2FA 2Y8WA 4ZVQB 3TUZC 2CG4A 5GVQA 1I5OB 4CLUA 1FT8A 4QR1A 4EO8A 1FDAA 3E51A 4OYBA 3EVMA 2LQJA 2E9RX 2Y3YA 5CD4A 2P5VA 1KS2A 2ZD1A 3TAQA 1LK5A 2QSWA 2M0GB 3TO8A 3R7SB 4UTGA 4LVOP 3W9IA 1T05A 4DCJB 4KHMA 4LQ9A 4WTYA 2IBOA 1IM6A 1IWAA 4M5DA 1N5QA 1W2IA 2JWNA 1R6YA 4I4BA 4DZDA 3W3SA 5ETRA 1U45A 4GO7X 2A6OA 4JI8J 2G0IA 1S6PB 4OMFG 1S9GB 2C3UA 2XLJA 1DARA 4X4VA 3SIPB 2XMTA 1OIAA 3ADAC 5HSPA 2ZH2A 2IM2A 1YJUA 1VQ4S 4RNHA 2DGWA 2L9WA 2R7UA 1R3NA 1YJTA 2OHDA 5J2MA 4F04B 4K4XA 1GK8A 2VF3A 1RP5A 1WEZA 3ICLA 1K1QA 1F9HA 5E33A 2LXUA 1LXNA 2WRMA 4ZVGA 5D4LA 2CZ9A 5BYRA 1GTEA 2BM0A 2QZ8A 4QBUA 4ZP7A 3TZYA 4ED0A 3DI6B 3LWMA 3B4DA 4W92B 2EFGA 1PC4A 4I2PB 2ADBA 2CJQA 4AL5A 4K59A 3AOAA 3WC2A 5KFBA 2B56A 4HHUA 1Z2LA 5C5JA 1U1QA 2GJFA 3DOLB 5K8NA 1TKZB 1VMBA 2B9XA 1IKVA 2A10A 4Y6IA 5K14A 4XAKA 1VQMS 1D9FA 1S9FA 2ZE2A 5KG0A 4CO2A 3MM9A 4KH1B 3EPIA 3H2LA 3T1HF 1N56A 2AEJA 1HNVB 2G2ZA 2ZOMA 5DS7A 3HP6A 1PO6A 5LMUJ 2VPWB 1GMWA 4HDHA 5F8LA 2RVJA 4QPXA 3L7PA 3MR3A 2E9ZA 4KGZB 3SMZA 3UPFA 4GKJJ 3DHWC 2ATCB 2XMAA 2OTJS 1JLCA 2RAQA 3NGKA 2V8DA 3QMQA 4N56A 3QNWB 1SJRA 1WDTA 2QLFB 5DM7Q 3MUMP 3MR5A 4KY3A 3I9ZA 5IM0B 1HBMB 2LA4A 3C6TB 2W2OP 1U47A 2QFJA 2WW4A 4PWDB 3GFHA 5IWAJ 1T9UA 3AB2B 4AT1B 2BKNA 5FLXU 3R27A 5LMNJ 4DSIA 4USMA 2WVEA 2FY8A 1IBCB 5DG9A 3IS9B 4FXWA 3HHNB 2ZVIA 3M32B 2AF6A 4KO0B 3UO0A 1LWFB 5CD4H 5J1EA 4AE5A 1RTHA 1GEHA 2CDRB 1JJ4A 5D3GB 4W4MA 2XS7A 4U7CA 6AT1B 1BE4A 4ECUA 1SV5B 2R4FA 3UFCX 2KM8C 2LXFA 3TRGA 3RGIA 3K5MA 3J7YI 3GYXB 2LEAA 1NBEB 3A1YG 2VHGA 1PSDA 3FBFA 3OD2A 4PQUB 2GQCA 4QYZJ 2HEKA 3OTCA 4AD6A 1V6HA 1NK5A 3H2VE 3CC7S 3UN5A 4I69A 3DGPA 1S77D 2OD4A 4ZA1A 2FLOA 4PKDB 1RBOB 2J8AA 2Y1LB 1N5TA 3Q8SB 3KK1A 4ILLA 1JNRB 4X64J 5DG7A 4DCOB 2IRYA 1JLAA 2CJXB 2W2PP 3H4BA 3QATA 4DV7F 1FDDA 4KJIA 3PRBA 3V2UC 5F8JA 2MKIA 2DITA 4DBQA 2E1CA 3SDEA 3OTEA 2IC3B 2DKOB 3I0SA 2QL7B 2CQPA 5KFGA 4GVLA 2V8PA 1CPZA 3G8QA 1OYEA 3NAIA 3E01A 3HSZA 3AQOA 1FDNA 4A4JA 4I67A 2KZZA 3GILA
chains in the Genus database with same CATH topology
3UR3C 5KFCA 1KC8T 5IT0A 3IO1A 2L48A 3ZZRA 4GO5X 4PG4A 4QWAA 3HHLB 2AYBA 1RT4B 2OPPB 1O5JA 2YTCA 3Q22A 1SBRA 4KHRA 5GAEI 1Q86T 2AU0A 3HMJG 4B3OA 5F0WA 1VQOS 3QGIA 3HO1A 3QO9A 5D4NA 4J9MA 1RT5A 5D78A 3M30B 3IAM9 2X1FA 5A8KA 2ACYA 3CJ4A 4OHXA 1D8ZA 4AL6A 2I1RA 1VK3A 2XO7A 3NBPA 2FHOB 4RW9B 2IM3A 5GAGU 3KHLA 2V4JA 1DTQB 3GIIA 1Z1ZA 4O3SA 3T3FA 1NK9A 4OI0A 4QU7A 1WWHA 4LVNP 2HMIB 2JSXA 2F7VA 2MZSA 4DR5F 4ECQA 5AJ3F 4RW6A 2EVZA 3POTB 4MYUA 4KO0A 4H4KA 4CZCA 3MMJA 4I6WA 1F9FA 1BQMA 1R27B 1VK8A 4RBVA 2I9SA 4Q43A 3KJVB 3VALA 3PX6A 5KFSA 3TVYA 4IH6A 3QZ7A 3AA8A 1QAJA 3MGJA 3L09A 4NA1A 4PQAA 4MH8A 2MMYA 2XMUA 1Y0HA 4DX8H 5KFFA 2OMOA 3MEKA 2VPYB 4HVZA 2R8HA 1HBUA 1X4DA 4ID5B 1XTZA 4JBCA 2R2TA 3TA0A 4BWMA 5I3UA 1VI7A 4DN0A 1UJ4A 4NYPA 4ATNA 3CDAA 4KR0B 5HMZA 2XSJB 5EX3A 4CH0S 1TL4A 2BJEA 2WONB 1NEEA 1P27B 2DCLA 5B0FA 1IKYA 5HBMB 1F5AA 4ECRA 2YWKA 4D3HA 1XR6A 2JVRA 1RT7A 2VUGA 2WOMA 1HARA 3VQSA 4EFAC 1FJ7A 1TL1A 1Q78A 2GQ2A 2ZDOA 2PDAA 2ZH5A 4WXWA 3M6VA 4ECYA 2W24A 3HZGA 1HL6A 2NPFA 4YB6A 1DBDA 2QMWA 1RTJA 1H6KX 1GT8A 2MJUA 3UDLA 3BGLA 2RRAA 3N5BA 1Q79A 2WW8A 3C6UB 3QAUA 4EUVA 2L41A 5K8OA 3E2EA 2DGTA 1UVLA 3UNGC 4YDDB 4IH7A 4Q45A 1FNOA 4HTJA 3AJ1A 1OSDA 4A8MP 4C0OC 3FCHA 4QR0A 3SV4A 1RA6A 1N54B 1C0TB 2FDNA 3FRYA 4KV8A 5KFRA 1X4CA 2LMIA 2YNHB 4ZPTR 4YUDA 5B0CA 3PZPA 2J0QD 2AX0A 4LF7F 4MIBA 3R5CA 2JH3A 3NNCA 3KK3A 1RT6A 3MMCB 2U2FA 2WB4A 2JFKA 4Y2KA 3TQ1A 2VL1A 1HPZA 4UOCA 4NCBA 4YY3F 3M8PA 3M1VB 1YVFA 4RUCA 1HQUB 4YB7A 2LQ5A 1KQKA 2CPJA 5A6WA 1C1BB 2DPIA 5DGAA 1KFSA 2PT0A 2Q6CA 5HROA 4DQPA 1BLUA 2B9WA 2DJWA 4ICLB 1RTIB 1J5EF 2Q1LA 4RWXA 5KG2A 4B3RF 2MPUA 4RLEA 2RKIA 4PR6A 2YKMA 4ILRA 3IWNC 4HHJA 4K4VA 4A8SA 3KLHA 1U49A 2IA6A 4EBCA 1Y3KA 4DF4A 2ERRA 1XC9A 1GQEA 1HWIA 2ZUGA 2DGOA 2CVIA 2C2RA 3LP0B 3LP1A 4ETXA 4OX6A 2ASLA 3FSXA 2CZVC 3K8WA 1S1TB 4YB5A 4OJ1A 4RW8A 5FDLB 1T03A 2QYCA 1JLBB 5BYQA 1WF1A 3SXLA 3CDEA 5KG4A 3T5LA 4AXJA 2CQHA 3OFHA 3TARA 2MGZA 1MWYA 2X51A 1UETA 1QE1A 5AXMA 2AD9A 1LQ9A 2ZJPQ 2DNPA 2R7TA 4H54A 2JDJA 1FKPB 3OHBA 2XZWA 2HHWA 3ZZPA 1HNZF 2V9KA 2AQ4A 4JYAF 2J5AA 4TNOA 2NR0A 4MK9A 4YMEA 2JLGA 1SI9A 1TV6B 1FJEB 4BBYA 5KFKA 1JLQA 1SKSA 1WACA 3TX8A 1FRKA 2AWZA 2J7KA 3IAS9 1K9MT 2FUG9 3J80Y 2K8GA 2Y1IA 3BO3A 1E6YB 1RT4A 3T9NA 2ZHOA 1FKOB 1KFDA 3WDOA 2RQCA 2HNZB 4I7FB 1FRLA 4FVMA 1SH2A 2AJ0A 3HHEA 4NRTA 2LA6A 4U9RA 3SEOA 4J9SA 4ZDNA 2O3DA 2O67A 1K73T 5KFXA 2O01C 2B3TB 2ZM6F 1C4CA 2CPYA 1N0UA 4K5SA 2BZ2A 4DSKA 2QO3A 3NMRA 1WTFA 3N6MA 3CCVS 3I0RB 3PM9A 2DNQA 4AXIA 1SIZA 5IZHA 5KG5A 2QLWA 3OL7A 2FLNA 1RAJA 2JLFA 4RW9A 3BSNA 2VG7B 4DFMA 3N6LA 4DR7F 3CTRA 1TK5A 3QYYA 5HMXA 3GFYA 2FIUA 2ZHAA 5KG6A 4EO6A 3KLVA 4OZ5A 2HMIA 3F56A 1OPIA 5SUHA 1HR0F 4R5PB 5HQ8A 2IYGA 2HGLA 2ZJQQ 5C25B 2OKQA 1ELOA 3POTA 3DN9A 1JKHB 2AW0A 3DOMA 1ZM4A 2JC1A 4ZHRA 1FE0A 1KEKA 1D8YA 4WU2A 3I32A 3JTPA 4ELVA 3MM5B 1TUVA 5KFEA 4X4OA 3IFEA 2XCAA 3RB4A 4TLQA 1YIJS 1VQ9S 3KKFA 3VZHA 5A8WB 2FC8A 3MAQA 1UVNA 3D2WA 1RQ0A 2IFXA 2BDPA 1SKWA 2IYIA 1KNZA 1E6VB 4RW4B 5EGYA 3OQ2A 2JRSA 1T02A 1MW7A 4WKRA 5F3ZA 2QT7A 4KE5A 1X5TA 2AGPA 2EBGA 2WONA 3RRKA 2HWIA 4UQTA 5HBMA 2AJFE 2A2CA 2XS2A 2UP1A 5J2NB 5AE1A 4LT6A 1QVGR 2GJ2A 3LQVA 4DMZA 1N5YB 1RK8A 5MLCV 3NMAA 2QA1A 3KLGB 3V81A 3M9OB 2ZH9A 1EETB 1GTHA 3FSIA 1NRKA 3UWTA 4OJHA 4MKYA 3HPOA 3IWXA 3GSDA 4DDFA 4ELTA 1WEXA 3PKMA 1FA0A 3J7YU 1D9DA 3B82A 3G86A 3HK2A 1AUDA 2UZAA 1S1XB 1LWCB 3TA2A 3DLGB 3LAMA 2MQPA 3K57A 1QLNA 1BWEA 1EP4A 3HI9A 4DLEA 4QJVA 1I94F 1WI8A 2GO8A 3MMAB 2IMWP 2VBWA 3OFEA 3I5BA 3D54A 4AL7A 3DMJA 5M2UA 3MFIA 1C0TA 2NUHA 2R8IA 1XNRF 1WI6A 1W2BR 1S1VA 3MF5A 5F8MA 4TU7A 5GAGI 1F5BA 2JFDA 2M3DA 4FBUA 1QSSA 1QSYA 2CFXA 2XB2D 4ZS6A 2V9WA 5B0EA 2V4QA 3IRWP 4WFNQ 4NLVA 1FVSA 3H8YA 4BC9A 1Y3JA 3BSAA 4LF9F 3RAMA 2W8LA 4JUZA 4X62F 3M1VA 1DTTA 1HI8A 5DDRC 2HQ3A 3MTJA 2YY3A 1FO1A 1C1BA 2DH8A 2I5JB 1G3OA 1HMVB 2DO0A 5E0OA 3EXCX 3WBZA 2DNHA 3LANA 4A8QA 4ICLA 1RTIA 4J9PA 2GMHA 3TAMA 1NK4A 3JSMB 4DS5A 2R7VA 1M5PC 2RDIA 4I64A 4ECWA 3ULHA 4CTAB 1UJ5A 2UXBF 3OVSA 2OO4A 4NZ6A 4ECSA 4DL6A 3SV3A 5M2RA 1F2GA 1AXQA 2AP6A 3QGGA 2Z4PA 3TOQA 2D3UA 3IR5B 1MMNA 4OX8A 5CA5A 3IR7B 1SXLA 2BE2B 2KT3A 2VC0A 4AFFA 2BACA 5B0DA 4I2QA 3BR9A 2Q66A 5FDLA 1IUJA 4MTPA 1JLBA 1HWUA 1WHYA 4C8YA 2BXJA 3D1QA 3C46A 4P7TA 4C11A 4F3OA 1TFYA 3DLBA 5EN1A 3OUYA 4LQ3A 1DFDA 1WHVA 2WHOA 5E3CA 3PKYA 4PWUA 4RX6A 2HYIB 1MMLA 2VKZG 4B9MA 5CHCB 3SFGA 4ES2A 4F25A 1M5KC 2IVMA 3FRZA 2ZC3A 4Q2LA 3FQKA 2VPZB 3WX4A 2RMLA 4ES1A 2B4VA 1OPZA 1HI0P 3MD1A 4B02A 2E1RA 4NLRA 4O23A 3V6KA 2MSSA 2E66A 4NZ0A 3VAHA 5DQGA 4NLQA 2XMVA 2VC1A 5F8HA 5KFWA 4J37A 4PG5A 5I3QA 2C3YA 3BB5A 3OSNA 4F4ZA 3EGZA 2H9ZA 3GR0A 1XEZA 3PJWA 2CJBA 1T95A 4IO1A 1YRXA 3G6VA 3VAGA 3RAQA 3EZUA 5CH7B 4ZVFA 2HHTA 3JYTB 2W9AA 4AQYF 1R89A 4WFBQ 3CDBA 1LW0B 2VG7A 4LFAF 5CCLA 5KAKA 4IFYB 2YKPA 2BJDA 1S7HA 2UUTA 3UDCA 5C42B 3BREA 1FTRA 3GV5B 3TNVA 1S49A 2HIQA 1HYSB 4IO9Q 1Y9OA 3B4MA 2N82B 2CZ4A 1Q8LA 5KFQA 4P6QA 5J2PB 3FFIB 2VFTA 2ZJRQ 5A8WA 5DDQC 1W25A 5JVGQ 3CSKA 3CIZA 3VAMA 1SJ3P 2Q79A 4HH1A 1SQEA 4LIWA 2YNFA 2XY5A 3QLHB 4CO3A 2MHNA 3LO3A 1R0AB 2ILYA 4WFAQ 2KZMA 5L39A 2HWHA 4E8UA 4QWBA 2B0GA 4USIA 4F50A 5F41A 4I6AA 3KK2B 1B64A 3K5NA 1UL3A 1ULRA 2B7BB 5HL7Q 2XNRA 4ETZA 2VFSA 2ZC4A 1VQ5S 5J2NA 2VODA 1N5YA 1S76D 1Q7LB 5DM6Q 1U1RA 3O1LA 1SKRA 1Q4RA 4E0DA 4R0EA 1IQZA 4OX9F 2MQQA 4ZOSA 2BQUA 1L3TA 4G1QB 3M2VA 4EYHB 4O44B 1N5SA 1S6PA 2XCPA 2MXYA 1WHXA 4EBEA 4BHQA 5J1NA 2D41A 2MZRA 3OVAA 4ED5A 3N5FA 4B9NA 1XWLA 1S9GA 4DPOA 5CCMA 1SJ4P 5JVHQ 5JXSA 2YKOA 5KFZA 1S10A 4RW7B 1S1XA 1VS3A 2F1FA 1FTCA 3DLGA 4KAIA 1N34F 1D1UA 2FVSA 1HW9A 2BANB 1G7CB 3CCTA 1YWXA 2DD8S 2YNIB 3MMAA 4D3GA 3L3CA 3Q24A 3DLLQ 3BQ2A 4K4YA 1Q81T 3J7A1 1RJJA 4BWJA 1DLOB 2B4PA 2DR7A 2FJXA 2EFNA 1WF0A 4DSLA 2WTFA 4DJBA 1TL5A 2HFNA 3KHRA 3KNAA 4DHVA 1X5OA 1SJ1A 2B51A 2HAIA 4Y2AA 2QE5A 3DRPB 3D5MA 5A0YB 1VQKS 2UU9F 2E5IA 2XEXA 4DOZA 2ASDA 4C4WA 2HVZA 2PSZA 1N6QB 1IN0A 2IM1A 4HL9A 1X4GA 5I3PA 4DUZF 3MPYA 2LU1A 3V4MA 1FVQA 3R3TA 2L08A 3W2VA 3BEGB 1FHTA 2X1GA 2C3OA 2WCXA 2OJ3A 3V4IB 3D1OA 1DQAA 2DVIA 1HMVA 1RT3B 1NZAA 2NS1B 4FZVA 3CC2S 4K4WA 3CCES 1YJVA 4OHWA 2UVVA 4WF9Q 2K1RB 1ZPWX 2VG5A 1JX4A 3ZFVA 1XBWA 3UD4P 2ZH6A 4MKAA 3DCAA 1LFWA 3IRXA 1XNQF 3BZQA 1HBOB 1DJ0A 1Y5LB 4F67A 3MCSA 2CQ0A 1HBNB 1BQNB 2W25A 2XLIA 1A6LA 4DL7A 3RBEA 1VQ7S 1GXLA 3DI6A 2BE2A 3FDSA 2A2DA 4DFPA 1MROB 5LSLA 3IG1A 4IKAA 2DHXA 5CQGA 3U27A 4C0HA 4Q8FA 1FDBA 1OO0B 1V3SA 3ZZTA 3CWJA 2E1MC 3THVA 4LSLA 2K7KA 4DSFA 4DWIA 1LWEA 1VRUB 3QGPA 4C8LA 5KFIA 1U2RA 3DLEB 3W2WB 3CCQS 4IR9A 4JI8F 1Y5NB 2WSCC 1K0TA 3OR1B 2GCFA 2Y1RI 3PDNA 3RW7A 2VBYA 4DQSA 2GO9A 2KJWA 2ASJA 4ZCLA 2AYGA 4RNOA 1SUQB 5LXYA 2OPQB 2CQCA 4YQWA 3DOLA 4ZCIA 4DS4A 5D6GA 4CCHA 3PW2A 2V8VA 2XY7A 4PXEA 1TKXB 3PO4A 4TQSA 3IBWA 3MEDB 2JVOA 2I0XA 1KOHA 2CPEA 4WU3A 3FEYB 2RH3A 3UD3P 3MXHP 2KVIA 4NCGA 2KH9A 1ZYQA 2EK6A 3AB4B 1YJNS 3UCZP 5G0RA 3DLKB 3HX9A 4WZMA 2HS3A 3ZZOA 4FBTA 4H4OB 1U48A 2HNYB 1S1UA 4NYZA 5CZXA 5T7LB 2N7CA 1PC5A 3M2UB 5L38A 2AGOA 4HT5A 3LUYA 3THTA 4ED3A 1LW0A 4M63A 3SCIE 5KFPA 2J0SD 1B0VA 3H59A 2GC8A 2ZZNA 4IFYA 3CCJS 4NLPA 4DV2F 3KNGA 1UW4A 1B0PA 4CQ1A 2DTJA 1LXJA 1H2TZ 3LGMA 1S6QB 2Q43A 2YKNB 3PW7A 4V19J 2DNRA 3VAKA 3O2IA 2ZNZA 5KT5A 4E98A 1VQ8S 3CJKB 1S9EB 4ZPWR 3SI8A 3WZ0A 1KQGB 4JV2A 1YITS 4FF2A 3OLBA 3C8YA 3EUNA 1RT1A 2QA4S 3N0VA 1NH8A 3LF0A 2MJNA 2OAUA 5FLXY 3RW6A 2CQBA 3CEDA 1N4LA 1F0XA 3OPKA 3PFEA 2YX7A 4BCAA 4URQU 4TQRA 2B5JB 3RB3A 1R0AA 2DNZA 2ZKTA 3VR1A 3RR7A 4HTIA 3ITHB 2VASA 4FS1A 4G3IA 2J0WA 1N48A 3FMBA 2CQ2A 4IG3B 1TVRB 2P9CA 4OJ3A 3BQ1A 3CE8A 4MFBA 3ZZZA 3MM6A 3M6XA 2MY8A 4G1QA 4DF8A 1KVIA 4RNMA 1LFPA 1TZ0A 3MDFA 4DFJA 5SZTA 1TQLA 4TY8B 1TL3A 5LSOA 1NKBA 3MWBA 4RU2A 4NLWA 3P3DA 1FCAA 2GW8A 2RIJA 4A48A 2PA8D 4JI0F 1TAUA 3G6ES 2RQKA 4N76A 4RW7A 4Z2XA 1HNXF 2PFFB 1U7LA 3CIMA 5CYQA 1HBMA 3C6TA 4OQJA 5IM0A 3RU0A 4IQXA 4IG0B 3VTIA 2QV6A 2W8KA 4X65F 2R2SA 2JLEA 4FN5A 2F8MA 1DLOA 4PWDA 1P8GA 2RUGA 3DRYA 2EBEA 2RF2B 2BW2A 4GMKA 4C97A 1UEUA 5E5NA 3OJUA 1JLEA 2DGVA 1HW8A 4Y2MA 4F4WA 1J2VA 3BSOA 4A8WA 1T7PA 3DRPA 2VONA 1VIOA 2DHAA 2V5HG 1Q1KA 2YX4A 2CQIA 3MHYA 1PGZA 4Y3CA 3D0GE 1WG5A 2DNGA 4F4XA 2C42A 1CEZA 2XLKA 4L6V3 2XMMA 1RT3A 1X4FA 3PACA 1VBZA 3IS9A 2UUCF 2ZD1B 1B7FA 2FJBB 2GJIA 3LALA 4A46A 2COLA 2R7RA 1UA0A 5K8PA 3DXSX 3OR2B 5F8IA 3HVAA 3M32A 4MK7A 1L3KA 3BSCA 4KRWA 4RNFA 4K4ZA 1G2EA 2E5JA 2OFGX 4O0IA 2C22A 1LWFA 1YRTA 2VH7A 3LPYA 5C24A 1TKTA 4HYKA 4UQGA 4JOUA 1ZAWA 2GIRA 2HRYA 2YWGA 3OXGA 4QCLA 5LMUF 1RKJA 5D3GA 2VA2A 4KFBB 3IR6B 1MROA 3KLFA 3CCMS 4B9LA 4RNNA 3T5HA