2GVDB

Complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with tnp-atp and mn
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
189
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 54
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvdB00
2QV6A 1WC5A 4CLUA 1TL7A 1WC6A 3ET6A 4WP9A 4USTA 4OZ3A 3R5GA 4WP3A 1CJTB 1WC4A 1YK9A 2GVDB 4OYXA 1U0HA 4OYZA 3MR7A 4NI2A 4OYPA 5D0GA 1AB8A 1CJKB 4CM2A 5D0RA 4CLKA 3C15B 1CULA 1CJTA 3MAAB 4OYAA 4CLWA 4WP8A 1CJUB 1FX4A 4OZ2A 3C16A 1CJVA 1WC3A 4USVA 4OYBA 4CLFA 4CLYA 3G82B 3C14B 5D0HA 1AZSB 4CLSA 4P2FA 4P2XA 4WPAA 1Y10A 4OYMA 1YBUA 1Y11A 1TL7B 2GVDA 4OYWA 3ET6B 4USWA 4P2MA 2BW7A 1YBTA 1CS4B 1CJKA 4NI2B 3C14A 1AZSA 4OYIA 5D0EA 2W01A 3UVJB 2GVZB 4CLTA 3C15A 3MAAA 2WZ1A 1WC1A 4CLLA 4CLZA 1CULB 1CJUA 4OYOA 1CS4A 4USUA 4CLPA 4CM0A 1U0HB 5IV4A 1FX2A 3UVJA 3C16B 3G82A 2GVZA 5IV3A 1WC0A 1CJVB 5D15A
chains in the Genus database with same CATH superfamily
4DV7J 4OI3A 1QY7A 3ZZTA 3OR2A 1NPPA 4Y00A 3PFEA 2NQPA 3GSDA 1NJZA 4B02A 4USMA 4ZVRB 4DN0A 1KTVA 3ENWA 4NE9C 3BKFA 2HHWA 1GFWB 1ZH5A 4C11A 1PSDA 9RUBA 2NXNA 5F8MA 2YWKA 3RB4A 4I67A 1HKAA 4PEOA 3A8EA 5ETVA 5GADU 1ZA1B 5KFIA 2ZVIA 2Z0GA 1PKUA 2JJ4D 3BM7A 2YPZA 3TAQA 1QSSA 3T1AA 4C6AA 2B5JA 4HL9A 3ZZPA 3BPSP 1S1TA 3DYAA 2H4WB 4GRSA 2ZFHA 1FE0A 3E51A 3PZPA 4DR7J 4DCPB 2MJUA 1APSA 2BMBA 4KPCA 1WG4A 5ETKA 5HLFA 2QFIA 1ZTWA 2HNZA 3NNCA 2G9OA 2HNYA 2H5JB 2BDPA 4LR9A 1WEZA 2XLJA 1TQLA 2GHPA 2IRUA 4RW8A 3DFEA 5IM0A 1JLCB 1FJGF 4LVNP 3P3DA 4NLQA 2EWHA 4WJBA 4X62J 4Q0BA 3B6BA 4X64J 4DX6A 3RR7A 2XMWA 4LBPA 2LKZA 1X4BA 2MPUA 1RWMB 3N01A 1IR2A 2L48A 4PCQA 3AA8A 1HBOA 2BE2A 4F25A 1N34J 3TZYA 1Y7PA 3G8QA 3VAKA 2J0QD 1DFDA 4QPXA 1SL2A 4DSJA 2VFUA 2BW7A 3NY0A 1RTZA 3DHXA 4MKAA 1AZSA 5B09A 2X7IA 3FFIB 3CC2S 3BSCA 4ZPVR 1FTCA 2CQ2A 1GNKA 1TMMA 1LFPA 2E1AA 1JLAA 2IYGA 1M5KC 1JNRB 1LWCB 4CH1A 1JIHA 2R4FA 1FRHA 4U8YA 1S1XB 1U2RA 2MB0B 1HNVB 3RUBL 5LSOA 7AT1B 3PV8A 3SDEA 5GAHI 1RSCA 4C98A 5DDRC 4DQPA 1Q81T 4FXDA 3KG0A 4ZPBA 4HEA9 2ZWOA 5HBMB 5F3TA 1J5EF 2DJWA 3LP1B 4ZS6A 4KV8B 1NKCA 2MLYA 3M30B 2HMIA 4ZVUB 2FVPA 5T41A 3M4XA 3LQVA 1IBLJ 2P5VA 1Q53A 3MUTP 1ZAXA 4B3OA 3UE2A 2WBMA 1D9FA 5KG1A 2DXFA 2YXLA 4USKA 3C66A 3NEKA 1RTDA 1TL1B 4USWA 4J9SA 4K50A 4GC7A 3GIIA 1Q1KA 1EB0A 4P75A 2I2YA 2VFTA 2RDDA 3CO9A 6FD1A 3ADAC 3THVA 1HBUA 1NM2A 3BSAA 4DUYF 2HHSA 2EKYA 1WOOA 1VJQA 2VPXB 2L3MA 3GG0A 3G82A 1YJ9S 4R5PA 1DTQA 1YRTA 2IPOB 4NA3A 1KP6A 3CC4S 5HK4A 5A2QU 2E1PA 2CPZA 4XTTA 5KFBA 1WG1A 2H51B 5F8HA 1X4AA 1TFYA 4A8WA 3J81j 3M8PA 1WF1A 4LREA 4C8YA 3TARA 3VGTA 4KGXB 1N32F 1LQ9A 2HRUA 3DXBA 4ZCKA 3Q8QB 1N0UA 3MOJB 1PJ6A 1WTBA 4J9KA 1FRLA 1IBLF 2E5JA 4DR6J 2HVZA 4QWCA 4RW4A 3UCZP 2QT7A 4PQAA 2UXDJ 3CF5Q 4PQUB 4EBDA 4JI8J 1VI7A 2AYMA 4X4RA 4RW7B 1VHFA 1FWKA 4FF4A 3T5JA 1CPZA 3Q2TC 4LIWA 2KXNB 2CAJA 3OFHA 1RHMB 1SH0A 5B0EA 3GV7B 1VK3A 2DO4A 2BKOA 3T9NA 4DL0C 2O01C 4DSIA 2XG8A 2KT5A 3DXSX 2Z57B 3JTNA 3BS9A 5DLFA 3M1VA 2V2VA 1VRTB 3JAMU 4UTGA 1NB2A 1R43A 3ULHA 2KTQA 1PYOB 3KK2B 1S1UB 2HHQA 2VUGA 2FIUA 4J90A 2DITA 2YQ3A 1RT3B 1EP4B 1U1LA 3S01A 5H9EK 2ACMA 3I82A 3IBWA 4EYHB 3NRBA 2FY1A 4P74A 2BRKA 1S1VB 5AE1A 2JEIA 4LQ9A 1O51A 3LH2S 3TJAA 2OEMA 2MDAA 1U09A 2D1CA 3NWRA 4V19X 4N41A 4A8OA 3W2WA 1RWPB 1CQMA 4ZP9A 2WB4A 2I1RA 3NNHA 1GMWD 4ZOSA 2HWIA 2MJNA 1A9NB 2FHOB 2ZOFA 1VYAA 4O3PA 1X9WA 3HVRA 3ILIA 3KDNA 1D0EA 2B9XA 3H59A 4LSZB 1DHMA 2AT1B 4LFAF 5DRKA 2Q6BA 4DJBA 2V2QA 3FFIA 3AQOA 2AX0A 2M88A 5AT1B 5CHCB 4GC6A 2PI4A 1SVDA 1BWEA 4LF9F 1TUVA 4IQMA 3PKYA 3KOAA 3T5HA 3IM8A 2XB2D 4OZ5A 1S1XA 4OI0A 1TK8A 1HNVA 1FRXA 3PACA 4Y65A 5D0HA 3IBFB 1VC5A 3GCXP 2V9WA 1IKYB 2DNOA 1QSYA 4ED8A 3NG8A 1SJ4P 3BPDA 1VQ4S 4DV1F 1JLFB 4P2MA 3RR8A 5HBMA 2Q43A 1ZYQA 3LP1A 1U1QA 4CO1A 1UW9A 3VAMA 4KV8A 2HFSA 3R7BB 3MMCA 2J5AA 4MTPA 3MM7B 1V3RA 2MHNA 3TQEA 2MSTA 2DR5A 2BJDA 3EVWA 3A3PB 1N5QA 4EI2A 2BXJA 2NYHA 5HQLA 2PI5A 4IKAA 3DRYA 2R7UA 3QT8A 4JV0A 4OYPA 1N5VA 5LJ3Y 2VPYB 1RHRB 1RT6B 4DPTA 2PGCA 2R7XA 1IXKA 2DGSA 3IWNC 1IBKJ 2GJ2A 3ISZA 4RJVA 4WFAQ 2QLBB 2C3PA 3HJVA 3BB5A 2H5EA 4MAKA 3IGNA 4C7QA 4Q44A 5KFOA 4K0KF 4DCJB 4OI1A 4F3OA 4I69A 5AE3A 2LQ5A 2CADA 1ZM3A 4NLPA 2JFKA 4DFKA 1X4DA 1UKUA 1JLGB 2CPYA 2C3MA 2BM1A 1QUVA 1Q0NA 2RQMA 3KFWX 2K2PA 1N48A 4F02A 5KFYA 3AODA 1FNOA 3UVJA 1CVJA 4HTJA 3THTA 4P9SA 4F0HA 5J1EB 4DR5F 4PQUA 4CT9A 2KRRA 4RW7A 3MECB 4DU8A 3K5MA 3G6YA 5D77A 1GK8A 3VVUA 2M2BA 3ETMA 1G4CA 3O1LA 4B3SF 2BA9A 4Y3CA 5J2QB 2HQIA 5C24B 2MYFA 1EETB 4PAAA 2EFVA 5KFAA 4IH6A 3OXFA 1RAOA 5D8HB 1R3NA 2V94A 3BGOP 2ZH8A 2KHCA 3EUNA 4H4KA 1AUDA 4KH0B 1D1UA 1VRTA 2WVBA 3QJPA 3EPIA 3KG4A 1IBKF 2JL9A 5KFHA 4G6VB 4RWWA 1KOHA 3KK2A 1S1UA 2VFSA 1RCOB 3U7JA 1VS3A 3T3FA 4ECXA 1T7PA 2V68A 4CLLA 1G6BA 4PXBA 3PYDA 4CZCA 1U8WA 4AL6A 1W25A 3MMAB 1FT8A 4MIAA 4EZ6A 1HNWJ 2RJZA 4JI5F 3P96A 1S1VA 2XSJA 1VQ5S 4MMOA 4QWBA 4HHHA 1UAWA 3KMQA 5AXLA 3VWSA 4O3OA 4O23A 3P8BB 1SH3A 1U0HA 3J7YI 1W26A 5BYQA 2HFVA 3CCRS 2AD9A 5IT9U 3ZTQA 2I0XA 2X3DA 2N7YA 5D4PA 5KG7A 5BYSA 1BY9A 5KFLA 3MPVA 2L9DA 4G1QB 2JZ5A 5D3GA 4ZP8A 2BJ9A 2OLWA 2PO4A 1FWPA 2KI2A 4NLUA 2UUBF 4FF2A 5KG0A 3HSDA 5AJ3J 3GYNA 2B9EA 4JB8B 4F4XA 1MW7A 4W92B 2E9RX 3L4BC 3M9OB 4ZLPA 4XAKA 2JLFA 3U1NA 5DQGA 4KFBB 1N5SA 4R0EA 5HN0A 3ENQA 1FTRA 3GWCA 2HGMA 2IJFA 1OO0B 2JLEA 1J5OB 3RB6A 1FO1A 3VCDA 2V8GA 1Q8LA 3EM1A 1MN7A 4DUZF 4JI7F 1IKYA 3R5JB 2IA0A 4TLQA 2ZNYA 1O5JA 3S8SA 2HVDA 3MOZA 1JLFA 4Y2IA 2B4UA 3DLBA 3HZGA 2R2RA 2EC2A 1Q4RA 3L95X 4RNMA 1WSRA 5HMZA 1BQNA 1K44A 5LSLA 3MM7A 1IR0A 2DBBA 3RYLA 1MNEA 3Q23A 2ZHOA 3BBBA 2NS1B 3VGUA 1Y9OA 1U1PA 1H7WA 2WK4A 2HHPA 5E41A 1T8EA 2HLTA 5LJ5Y 1T9YA 3N28A 3DHWC 2MXYA 3AY0A 4NXMJ 4N7TA 2RF2B 4R8UB 1RT6A 2CJXB 3G86A 2MKHA 3W2VB 2R42A 3QJLA 2BEFA 2F5GA 3PFOA 3MFIA 1PGZA 3G71S 3SV4A 4C9DA 1KFDA 1B0PA 1RHUB 3ILLA 2AGQA 3QIPB 3F56A 1XNQJ 2MLXA 4DG1B 4OX9F 4IOCQ 1U1KA 1EAYC 3GJRB 3UNYA 1FKOA 1VK8A 2PA3A 4ED3A 3TR5A 3ZZYA 3RBXA 4C8KA 1HQUB 4O4GB 2OAUA 3TJ8A 3VGVA 4ZVOB 2HWHA 1VQPS 4QR2A 1KVKA 1NEEA 4CM2A 1N8RT 1WJ9A 1XNRJ 1T94A 3H42A 2HIYA 1JLGA 1T05B 1UWBB 5IT0A 3DMJA 2UUCJ 3AFGA 2JVOA 1YKWA 4KIAA 3TEHB 3N0VA 1U1OA 3KLIB 2CA9A 4XPEA 1NJIT 5J1EA 1VC0A 3MECA 4ECQA 5HMYA 4NXNJ 2OPQA 5C25B 3MM8B 3DM2B 3OD2A 3D3CJ 3T1HJ 4ITSA 5J2QA 1EETA 4WE1B 2HWTA 3SQOP 2V2ZA 4LMZA 4UOGA 5M2PA 4AQYJ 1YRXA 4JYAJ 3JTOA 4MJKA 2ZNZA 2VD3A 4Y2KA 4CM0A 2UXBF 2Y8YA 3V4IB 3OW2R 3H2VE 2QN6B 3JS9A 1FFSB 3CJTA 1GMUA 2DGTA 4GO5X 2ASLA 4I2PB 5B0BA 2IY5B 1YI2S 2DB1A 3VALA 3VTIA 2EXUA 2HBRB 3MI7X 3GIRA 4KSEB 3KUHA 1VRQC 1O6XA 1VISA 1YG0A 5L1IA 3V6KA 2MKYA 1WOPA 3R2CJ 2DHSA 4NZ0A 5FLXY 5EWEA 2E9TA 2CQBA 1SJQA 4DR2J 1UL3A 1Y3KA 4P7VA 5ETSA 4YFUA 1F9EB 3IM9A 3GJSB 2OPSB 1SXLA 3K17A 4TKTA 4URQU 3P49B 2WB1D 2LLZA 1KLNA 3G2XA 2R8HA 2KFYA 2V8HA 5DM7Q 4G1QA 2MQ8A 2CQ0A 2UVVA 1QJHA 5LOQA 3G6ES 2QGFB 4JYAF 1W2BR 4JI0J 2J9DA 4YS2A 4K5RA 3HMJG 3QLHB 4XDCA 2ZUGA 3R5DA 5C2CA 2IRXA 4UY85 3R5GA 4DFJA 3QO9A 1RTJB 2AEJA 4KFBA 2D9PA 1PILA 4OI2A 4KH1B 3PDNA 3NL0A 3BV8A 1VQ8S 2KG0A 1L3TA 1J5OA 4H4OA 4MH8A 2KU7A 2F9JA 3PO4A 2HS4A 4CWBA 2CNLB 5LMNJ 4ELTA 2LQ9A 3D1OA 3KLFB 1P9QC 2W7OA 1SCJB 1P6TA 1VBYA 4B9TA 2E1CA 1QLNA 4CDIA 4JI2F 5DZ6A 4ZVSB 3I31A 1SJ1A 3KK3A 2XMTA 3NGTA 4KJIA 1UEKA 2AZ1A 3CEDA 5ETLA 4OJHA 1SV5B 1U2FA 4IG0B 1RBAA 1G1XA 2RSQA 3DLGB 8ATCB 5HP1B 4IFVB 2BQRA 2C2RA 2VONA 1RAJA 2EVZA 4KQZA 4JI0F 1S72S 3H5XA 1FA0A 4WK1A 3WC0A 1TK5A 3C19A 2E29A 2RF2A 2WVDA 3AAWB 4R8UA 4JOUA 4MYTA 3ZNJ1 1Y5NB 4OX7A 3WQPA 1JJHA 3W2VA 5GVQA 2KM8C 1RT7B 1KC8T 2FY8A 1A7GE 2FTRA 3QIPA 1WHYA 5KFSA 4DG1A 2Z2YB 3KLVA 4J9UE 1S9GB 1NKEA 1IBCB 1S9EB 1KD1T 3Q83A 3G87A 4U7UD 3PNIA 2VQEJ 4CH0S 1RGVA 4DR3J 1RWXB 1HQUA 5D6GA 4L6V3 1MWQA 1CS4B 2VA3A 4WCEQ 1XMQJ 1NDKA 2Y1LB 1EZZB 1H3DA 1NZ8A 2H48B 4ECYA 2IMOA 1T05A 1UWBA 3HHLC 1N56A 3SCKE 3UWTA 3KLIA 4NEYA 2VL1A 4TU9A 1KONA 1SC4B 1MROB 3W1YC 2FJAB 2VASA 2Y1IA 5KTQA 5C25A 4B3MJ 3MXHP 2B8PA 2AJ4A 1NK7A 3DM2A 4LBIA 4B3RF 3T1YF 3R1LA 1BWVA 2PFDA 2E7WA 2HGNA 1UPPA 2DNKA 4OHWA 4LF4J 3PX4A 2RE1A 3V4IA 3GZ7A 1S1WB 1WC3A 2A10A 1C0TB 3TI0A 3H4BA 1Q82T 2E1MC 3UQSA 1ZPWX 3PX6A 5HQ8A 1MSWD 3TJ9A 2LU1A 3SV3A 4DEZA 5B0FA 2Y1RI 1OWXA 4I4BA 3IWXA 2LDIA 1HFEL 3HSJA 1YBTA 8RUCA 3HHKA 1UEUA 4NI2B 3FSYA 4NZ7A 4TYAA 4CLTA 5AXMA 2A0FB 3AHPA 4Q2LA 5FJ4A 4PG4A 4FVCA 3SSRA 5IXUA 4B08A 2KZMA 2RVJA 2XMKA 2J8AA 5DZ7A 1HR0J 2GVZA 2LDYA 1CSJA 2DPIA 2CDQA 3T6BA 4NLVA 2H65B 4DV6J 2ZH4A 2OPSA 4FYDA 4DV3F 3GFZA 4JI4F 1J27A 2OIHA 1ZM2A 4OIXA 4EZ9A 2FHMA 1OY8A 2FLNA 3D6FB 3UFCX 4F36A 4HACB 2W2OP 2GO8A 2B6AB 1LWFB 1YJWS 2IFXA 1X9MA 3HHLD 5E0OA 3QLHA 3SSSA 5GMKa 4P2FA 3SQGB 3TWZA 4RKUC 2RUSA 2RQKA 3CE8A 4CI0B 1RTJA 1FVQA 2B4OA 2Q79A 4C0HA 2QIFA 1V3SA 1H98A 4DQSA 3DCAA 1RHJB 2BKNA 2OPPB 2R2SA 1RDRA 2VG7B 5C42A 2F9DA 3J81Y 4FNHA 1S0VA 2V9KA 3FGVA 1BLUA 4DWIA 1HR0F 4ZPDA 3OTEA 2XC9A 2HK2A 4G3IA 2ZM6F 1VQNS 3QQCD 1AFIA 1R6YA 1X0PA 1SQEA 2JEJA 1WTFA 1OQ3A 4DX5A 4S0MA 1SI9A 1V5IB 2DXDA 1SV5A 2ZWPA 3AXMA 4M5NA 2Y1JA 2JFDA 1PYSB 3DLGA 4LRBA 5HP1A 4IFVA 4OYBA 1R31A 1UJ5A 5HO4A 2AHOB 2C2KB 3HULA 4P72A 3QT5A 3MR3A 1NCLA 3HT3A 3M2RB 4O44B 2YPYA 4ZMMA 4NLGA 1MWYA 3SZ2A 2C1EB 4DL7A 1Y3JA 2B4PA 1E6VB 2RHQB 4AL5A 1EQ0A 1HI8A 3BREA 1RYSA 2XMJA 2QX0A 3NCPA 4DV0J 1S7IA 1S9GA 1XERA 1TFWA 1C4CA 1BD6A 3D0GE 2XLKA 2BE9B 1FKAF 1DZ5A 2JOQA 2LFVA 2XLIA 4JP8A 3PVXA 2J6UA 2CUYA 2YQ1A 2AEFA 3EWGA 3JB9k 1WUUA 4LF6J 2W8LA 1VLYA 5KFZA 2AYGA 1RA7A 1KHWA 4ZPCA 1GMWA 1ZM9A 3IS9B 3V5RA 4ZPTR 3V4MA 3MEEA 3KHRA 1S49A 3M9NB 5HANA 4YN3B 3W5ZA 4D3GA 3EGVA 4USVA 4NASA 4W4MA 1MROA 3QPIA 5B0AA 5ITHA 3GIMA 4TQSA 4KGMA 2Z30B 3CD0A 4JV2A 3HD1A 2HZVA 1M1KT 3Q2SC 4LFBJ 2PDAA 1GXTA 2DNZA 3CDAA 3D6HB 4CCHA 1NJWA 2HQDA 2O5DA 1YQHA 2X1AA 4DHVA 2RIJA 5KAKA 3J7AN 4BCAA 1JJ4A 3IR5B 3O5TB 2L41A 2MKCA 1NH8A 2V8DA 2N7CA 5F0UA 4X4VA 1FDDA 1C0TA 1RE1B 4L72B 2X1GA 4IRCA 2NYIA 3HKZD 1EKRA 4I6WA 2VC0A 1XEZA 2KFNA 1ACMB 1RACB 1Q79A 1REVB 2XHCA 3CT9A 4NI2A 1Y0HA 4K4XA 2B9WA 4K4SA 3L09A 1NSKL 5DGAA 3OTOJ 4LF6F 2E5LJ 1PCAA 1X4HA 2DR9A 5IC6B 2GC8A 2V69A 2EG2A 4K5SA 3PCOB 3BO2A 4M63A 3OUYB 2DEIA 2P2CB 3ZZOA 3PR4A 5E5NA 1S79A 3CIZA 3AQPA 1UEVA 3HHEA 2ZH5A 2ZBPA 3DRXA 1UWAA 2ATCB 4Q2MA 5K8NA 4HACA 4ZCMA 1RLDA 2B6AA 2M8DB 2N4CA 1LWFA 2AYBA 2HAIA 3ZZ0A 3RTVA 3OSNA 4CH7A 5GADI 5IV4A 3OV7A 3WZ0A 2AU0A 3SQGA 3TUIC 1FEEA 1X5SA 1JLQB 2RDIA 4JI3F 1DARA 1HIYA 3PW4A 3RGIA 4TLRA 1UFKA 2FGCA 3B54A 4A8YA 1RAHB 3MCOA 4RZRA 3M9MB 2YKAA 2GGPA 2GQ2A 2HAFA 2MY8A 2OPPA 4FS1A 1IQTA 2DHHA 4MKBA 3MR5A 3FRZA 1IKVB 2ZZNA 1I94F 4DV5J 4ECUA 1HW9A 4OZ0A 2M5YA 2JWNA 4DSFA 1C1BA 4TQRA 3BDEA 2P9GA 3CGIA 4URSA 2VICA 1I6JA 1VQLS 4DQRA 3RU0A 2QMWA 1KNZA 4ZVFA 2RB7A 3TUZC 4ED6A 2H3EB 2W9CA 3CD5A 2R7SA 2QJ3A 3RBDA 4CLZA 3K8WA 2L9WA 5FLXU 1N0VC 2WTFA 4OYOA 1FRIA 5KFWA 3J7Z5 4YEAA 5MAOA 4ZN3A 4PWUA 1CJVB 2HURA 3IN5A 2LXUA 2GQCA 3IRXB 2EEYA 4OHYA 2XMVA 4ZIWA 5LM7E 1LW2B 2QZ8A 3M2RA 3KKFA 2FLLA 4O44A 5EGYA 3FCVA 4DF4A 3ITHB 4FPRA 1E6VA 2WW8A 3F44A 1RQ0A 2M7SA 2W2PP 3Q8SB 4NPOA 1QAJA 5RUBA 3M8ZA 1LK7A 4GKKF 4OZJA 4CLSA 1GQEA 4PWDB 4I2QB 5T14A 2CYYA 2VFRA 1YLXA 3LGHA 3PW7A 2OI2A 2YNIB 3DOLB 1WSVA 3TEGA 3CJ2A 2EBEA 1H2UX 4KYZA 3PXGa 4M8LA 1XR5A 3IS9A 2CNNB 3CWJA 4A8FA 2W25A 1F9FA 4GKJJ 4FZVA 1S77D 2OFGX 4NEZA 1RT4B 3X3UA 4ALZA 2ROGA 4EGLA 3B4MA 4ETZA 2ALYB 1AW0A 1HD1A 3ETOA 3TVZA 3PTWA 1Q8IA 2VOOA 3AD8C 2HPUA 3I5AA 1TELA 3ILJA 1RT2B 2IIHA 5ETPA 1WHVA 3MWBA 1F5AA 5DETA 2R7VA 3I6PA 3M32B 3BH7B 4L75A 3KLEA 4BWMA 4CO0A 4W98A 4A47A 1TAQA 4LR8A 1MLAA 4DS5A 1REVA 4X4SA 1NHKL 4F3QA 4IR1A 3I4PA 1F9HA 1N5YA 4I1TA 2W8KA 4HT5A 3W7BA 4ZVPB 1OY6A 3OUYA 3UDEA 2FJXA 1N36J 2ZVSA 2DIVA 2YX4A 3K7RA 4U7UK 1V9OA 4YR0A 4MFBA 2MQPA 3E01A 4K2XA 1XMBA 3CXCR 4C8LA 1TAUA 3N6NA 3MEDB 2W9BB 3AB4B 4EUVA 3CMQA 4CP5A 2P6TA 4A8MP 4DSEA 1H73A 3THPA 3H4DA 3TX8A 3J80U 2EPIA 2FJWA 3BQ1A 3OJSA 3FUYA 1V3ZA 2NXUA 3MCMA 1DRZA 5DGBA 1KSPA 3SEOA 4RW6B 2PIIA 1XBWA 4M5MA 2KRBA 3QJJA 1JLQA 1M5HA 2YWFA 3BDPA 3HSZA 3W9HA 2QA1A 1VQMS 2M70A 1HL6A 3F73A 1U48A 2VKZG 1WKJA 4RLEA 5BXIA 4OJGA 4G65A 3RZAA 5C7PA 1IKVA 3N4WA 4H4MB 3CCES 2DT9A 2QC3A 1CC7A 3OFFA 1HBNA 3OR1B 5IT4A 3GR1A 3W61A 5E3QA 1M5SA 2O66A 3K5PA 2E66A 3W64A 4JUZA 1F3FA 4ED2A 3PIPQ 4CLKA 3ZO7A 4YOEA 4ENOA 5CZVA 2C2EA 1IWAA 4LIRA 3OHBA 2Q1LA 4M1KA 3R7SB 3PJ9A 2IVMA 1CJVA 1SL0A 1CG2A 2G1HA 4AL7A 3D68A 3W9JA 2ILYA 2WSFC 3IRXA 3GU0A 2W4PA 3IP0A 3ET6B 2O67A 1NB7A 1LW2A 1HNZJ 4DR4J 3UD3P 3C6TA 1SJFA 3MURP 4YDXA 3ITHA 4X65F 2V0NA 4DXLA 1H0HB 2KB2A 4OV1A 5FIIA 5T7LB 4WZQA 2AP6A 4USUA 1UFWA 1UMJA 3MM9B 1S5ZA 3D54A 2H5IB 2QLJB 4OI4A 3EDQB 4PWDA 4I2QA 4L74A 4RUCA 5IQQA 3NOGA 1DTTB 2ZBIA 4K4WA 2G2ZA 2YNIA 3NGUA 3DOLA 1OY9A 4LF8F 3GR0A 2DRDA 3MAQA 3QGHA 2I9SA 2MLZA 1RJJA 7FDRA 4ZCLA 4ETXA 3F0NA 3J81U 3ZZRA 4Z7CA 2RQ4A 1KVJA 3MPYA 2Z4PA 4PPDA 2G2OA 4NOHA 3R3TA 5KFRA 2VJVA 2G13A 2B7BB 3HHLB 3HFVA 2VPZB 1M0SA 4DPYA 1RT4A 2B3TB 3E3XA 4USIA 5HMWA 4X84A 2R2UA 3C14B 4JV5J 4U7CA 2GIFA 3FZ2A 2IRYA 1KS2A 1RP5A 2HKEA 3I4HX 2F4VF 1LFWA 2UV8G 2ZE2A 2FJVA 3UDLA 3D66A 1HNZF 2VH7A 4ECRA 4QR0A 4DR4F 1RT2A 3CW2C 1VBXA 1REGX 1B7FA 3JQJA 1OYDA 4ECTA 3TZXA 3DLEA 2HVEA 1NU4A 2YBVA 2DGUA 3NGKA 2VJUA 4UZCA 1JK9B 2LQBA 4OYZA 3PJXA 2H1YA 1DQ8A 5HJXA 2UUWA 3DGPB 2DO0A 1I5OB 3ISND 2Y9HA 4OYAA 4EYIB 4C8ZA 3GP9A 2BRLA 2JNJA 4TY8B 4M5HA 2CNKB 5M2RA 4ANCA 2AJ1A 2NCKL 2K7JA 5DQHA 3MGJA 4KHPF 1UVLA 4U95A 4XK8C 4C2MA 1NDPA 3PYGA 1PBAA 3LP0B 3MF5A 3W65A 4LRAA 4B9UA 4WXWA 3MEDA 3R1HA 3HM9A 3I5BA 1NDCA 2DGWA 3UNGC 5E3CA 5L1KA 4CO2A 1YJUA 3IXQA 4CO5A 1AA1B 3NXZA 1N52B 3DRRB 4RU2A 3HX9A 1GEHA 3Q24A 3D1HA 4QJVA 4DMZA 5EN1A 2AX1A 3UCGA 3CCUS 1SIWB 2RKIA 5EX3A 1TZ0A 1WC0A 3FQLA 1UVIA 1JB0C 2JHEA 5I3UB 1URNA 2RNEA 4ZPAA 1QD1A 3A3OB 1XJWB 3D5MA 3TRGA 1UJ6A 5F9LA 1U26A 4J9PA 3A4TA 1GXLA 4UOFA 2ZOGA 2YKQA 3RBEA 4NLTA 3IMQJ 1YX2A 3I55S 2WVCA 3CB4A 1S59A 1U6ZA 3M8QB 1S99A 4ZP7A 2E1RA 1S6QB 2DY9A 3HSGA 3L3CA 3M05A 3BKTA 3QZ7A 4H4MA 1T9UA 2ZZMA 2LQ8A 5A8KA 3GSIA 2D9OA 3GIJA 2BUNA 1T3NA 4KHMA 1Y11A 2GV1A 4YUDA 3M7VA 2DCUB 4CRJA 2FHKA 2AMCB 4ZLLA 2AJQA 3D9BA 1YDLA 3KYLA 2C2MB 5D78A 1FJGJ 2CQDA 2NZ4A 2DYAA 2MZJA 3GE9A 1KTQA 3VZHA 3HLUA 3Q86A 2J6SA 3CCMS 4YDDB 4NLRA 2C42A 1OMSA 1NUEA 3ET6A 3DOKB 2JEGA 4USTA 4HLBA 4MT1A 3G6XA 2LU2A 3BGRB 3VAHA 1S7HA 1RKJA 1AFJA 5CYMA 2GJIA 3A8IA 3PM9A 3FCWA 2J0WA 5A6PA 2C2OB 3RAXA 1NMEB 2KT3A 1RLCL 4KC5A 5JVHQ 5T7LA 9ATCB 1WELA 4K4YA 1VIXA 2HK3A 4O0NA 2VU5A 2MTLA 1HNIB 3MM9A 4JI6F 3SXLA 4ZHRA 5J2PA 4DR1F 4YR3A 3KDOA 1DTTA 3SMZA 4KBIA 2M9KA 1TL7B 2YKNB 1YBAA 5IS2A 2GAHC 3AOAA 4BS2A 3ILOA 1MWZA 2ZBRA 4DOZA 3EZUA 4RBVA 1F3VA 4JBCA 5IQ6A 2N82B 4TU7A 1Z2ZA 2MQQA 2AYEA 2WRMA 1ZAWA 3ENVA 2DVIA 5KFFA 4F0KA 4QU6A 3HHLA 3I96A 4GVLA 1K0VA 3HT0A 3W60A 1J5EJ 2HW3A 2R7OA 4PG6A 4DI6A 1I51B 3K89A 1WC6A 4OI6A 1KLMB 3IGVA 4U96A 2DR7A 5CD4H 3CPWR 2EI5A 4M5IA 4NZ6A 4QWAA 1DBDA 4TU8A 2MZQA 3V6HA 3M2UA 1NK6A 1HPZB 4RNOA 2GO9A 3AH6A 1S6OA 4R0JA 1PG5B 5A0YB 4LF5J 3HK2A 1ELOA 4I68A 3NGDA 1YVFA 2CJBA 4PWWA 1KHVA 4DUYJ 3GG1A 2K3KA 3WHIA 1D9AA 2ASJA 1QAXA 3EVOA 4MYUA 1I3OB 3GFXA 4KY3A 1HBMB 4RL1A 2GFFA 4C48A 1OSDA 2JSXA 1JLEA 1TKXB 3HVTB 1HQEB 2DGVA 2YH1A 3DGPA 2CQCA 1K1SA 4DPXA 2WZ1A 2Z8QA 1E6YA 1I1GA 3CO0P 1RT5A 1OYEA 2FJDB 4E0DA 1D8ZA 2EFOA 4P10A 3BJYA 1N32J 1S97A 3LP0A 4H54A 2KVIA 1WC5A 1U7LA 4YB5A 3TNVA 5KFUA 1CC8A 3H7HB 1R0AB 1UTAA 3LPEA 2Z58B 3QT7A 3UDCA 1CJKB 3DRRA 2VBYA 2QMXA 1Q16B 3C15B 1CJTA 3QGPA 4X4QA 3PG9A 2HLUA 3MTKA 2EFGA 3MM5B 4N76A 1CJUB 2PE8A 5L38A 2XCAA 5I3UA 1R8PA 3H2LA 3A1YG 2KZZA 2DNNA 4LF5F 2D41A 3CJ0A 3OL7A 2RH3A 3MMJA 2G0IA 4HI2A 1U45A 1N5TA 1YJ7A 1NK4A 4LJMA 3NCQA 4K4VA 5GMDA 5B0GA 3OJUA 3M8QA 3F41A 2V8PA 5F0WA 1S6QA 1S12A 2FUG9 5HVHA 5KFVA 1W2IA 3BYRA 5F8NA 4OLPA 2RAQA 1K9MT 2HQFA 2XS7A 3LTOA 4NYZA 3POTB 3OXGA 3OTCA 1NK9A 5ETOA 5A8WA 3CDEA 1AYEA 2KHDA 2NXEA 1D09B 3ICLA 2HG4A 1RA6A 4U6PA 2J7WA 4TVAB 4WZMA 5KT2A 1ZBTA 4LSNB 3PW0A 4KGZB 2KN4A 3FDSA 1UA0A 3G6VA 3FEZA 3D0IE 4ZLJA 4QU7A 1SPBP 1KOOA 1G7CB 4KO0B 1VC6A 1LW0B 2W9AA 3TX0A 3PO5A 2ACYA 4L76A 1KQKA 1F2GA 3TYTA 2OP5A 1T03B 4FS2A 3QAUA 4EMDA 3DOKA 1NJYA 1GT8A 1XTZA 3BGRA 2FPHX 4PYAA 3ZC4A 2CJYB 1OSCA 4H4KC 4LFAJ 4B3TF 4O3NA 5IWAF 2NR0A 2DGXA 5DO2A 1UVMA 2H54B 2O3DA 4IDKB 4OJ1A 1S6UA 4DV2F 1N33F 3KG1A 1S57A 2BE7D 4LF9J 1WWHA 2H9ZA 2SXLA 4DFPA 4NCGB 1ZETA 1TL7A 2YKNA 5E3RA 1WF0A 2ZUAA 1T9TA 2BJEA 1NK5A 1RBLA 3WIVA 1YJTA 1XWLA 2XGQA 4ED5A 4KR0B 1RKIA 4DV1J 3KLHB 4N8NA 4XO0A 1DQ9A 2P8IA 2QA2A 2VZ9A 1JLCA 2J0SD 2K8GA 4A8QA 4Y6IA 3BGFA 4P73A 2EK1A 1XMOF 4CLFA 1UZDA 1HMVB 5HATA 4C0BA 4JV1A 2CPFA 1KLMA 5SUHA 3OT9A 3B82A 2QYGA 3V81B 3U27A 4QZVB 3LPYA 1KQSR 4IQXA 5C2GA 1IBMF 1SJ3P 4OX8A 1VHIA 5J1NA 4K4TA 2WBRA 2Z2LA 2OUGA 3CULA 2ZC4A 1RISA 4K2JA 2HRTA 1LWCA 2BBEA 1TKXA 3HVTA 1AB8A 2BYCA 1HQEA 1XK8A 2RS2A 2HHTA 4PYDA 4K0KJ 3BBFA 1RCXB 2N3OA 2IA6A 3T5LA 5KFNA 2AGOA 2IM1A 3M30A 5MLCV 1UZHA 2WCXA 3CNQP 1RWKB 4TN2A 1JLBB 2YKMB 4DR5J 3BN7A 3KMSA 1CJKA 1F60B 4DL5A 4M5DB 1M1HA 1KFSA 3C15A 4C3KA 1TL1A 1ZAVA 1IVZA 4M95A 4K4UA 4B3SJ 4WK3A 1CJUA 4LF1A 2J9EA 4FBUA 5BR8F 1X5OA 4Y2MA 2BW2A 3CC7S 5LSRA 1CLFA 4ELUA 3M8SA 1OPZA 2M3DA 5G4DA 2LMIA 4WYLA 2FJBB 3V2UC 4J9NA 2G4BA 2YKOA 3NCRA 1RAIB 4XPCA 4FXVA 2FD2A 2YNFB 1NSQA 5L39A 2EBGA 2DNQA 1LWEB 2RT3A 2HSEB 1WG5A 4CLWA 1FNMA 1RHQB 4NA1A 3K2YA 1YTYA 2XY6A 3MPDA 1JNZB 1T9WA 4G1PA 4DUTA 3POTA 2QSFA 4WXOA 3J7ZT 1U47A 3PRDA 1T3OA 2ROPA 4Y34A 4JI5J 3UN3A 1TKZB 3HFKA 1SC1B 4LSNA 3JYTB 1FVSA 2UU9F 3MPWA 4RNFA 4P6QA 3W66A 3KWMA 2B0GA 2CXEA 2BZ2A 3QRQA 4KO0A 1P1LA 2DGOA 1N4LA 3AOCA 2R8IA 3LAMA 3OTDA 4B17A 2YWEA 3C16B 3OFGA 2JH3A 1NK0A 4NYPA 4O3RA 3WX8A 2HHHF 2ERRA 2BOAA 5L8RC 2AQ4A 4Q7AA 2UUBJ 4WFBQ 1EQMA 2JEFA 2E7XA 3RG6A 1VQKS 5IC4B 3BQ2A 2DY1A 4EU0A 4RUHA 2CIMA 2F8HA 2GIRA 4IDKA 2NPFA 1B0TA 1RT3A 1EP4A 4X4OA 1S1TB 2JRSA 2UZAA 4NCGA 2DH7A 4CO4A 1HA1A 2RU9A 4DUZJ 4JI7J 2KFZA 1HD0A 2D7SA 2OPRB 2XY5A 1QDUB 2UXCF 1RWOB 3DLKB 2QL7B 3J7A1 2B7CB 1BE4A 2U2FA 3EDRB 4LRDA 4HH1A 2COLA 1TMJA 2W7PA 5HROB 1DLOB 1HMVA 4MK9A 4F26A 3E8OA 1F5CA 4J9QA 1FRJA 4ZITA 2OD6A 2E7VA 2CJAA 1KR4A 3V81A 1WC4A 3V6JA 2VDIA 1S9FA 3Q8YA 3MD1A 2D3UA 4ZCIA 3VAFA 1NPRA 4HR2A 2NPIA 3NAHA 3GFYA 3KLGB 4LFCF 1B99A 3BO4A 2UUAF 2CPJA 3HFZB 1AZSB 3AJDA 4WPAA 1YBUA 1JLAB 2VPWB 5LMUF 5KG6A 2RRBA 5KFDA 2OSRA 4OX9J 5F41A 3KNGA 4IRKA 2PN6A 2GIQA 3CSKA 3T41A 4HHJA 2AEMA 2NUHA 4LUBA 3HPOA 1SBRA 2OEJA 5BYRA 3T19A 1RAAB 1TUGB 3P45B 1HWKA 2YY3A 1Q95G 1O0PA 1QM9A 2HRYA 2EW9A 1WEYA 3DN9A 3US5A 2XI3A 2FVRA 5CAAA 2YKMA 4YP3A 4PXEA 1QE1B 3M8WA 4M5DA 4PXCA 4B3OB 4FPIA 2VV5A 2W4DA 2M52A 3EVMA 3IO1A 4FP9A 1RZMA 1U25A 2BM0A 2LA6A 2M4MA 2CQIA 3K5OA 1VIOA 5HMXA 1R0BG 4NLYA 2NREA 2CKWA 3RB0A 1HLWA 2GW8A 2GMLA 2ILZA 3NKYA 2UXBJ 3DLLQ 2ZJQQ 1HBUB 5K9FA 3UN5A 2IM2A 4ED7A 4BBYA 1C1CB 2YNFA 3KUEA 1YITS 4IRDA 4IUFA 3DNCA 4KB7A 3O8WA 1DTQB 5DG7A 4M5LA 3FEYB 4HVZA 4B9LA 3G9CA 5CH7B 2ZH6A 1XC9A 4ANDA 3HI9A 1LKZA 3MUMP 5DS7A 4HI1A 1TTHB 2AJ0A 1TKZA 1LXJA 3PYEA 5KFPA 3MAHA 2GCFA 3W8GA 2R8GA 3CDUA 4AE5A 2VQFF 3EYZA 1EARA 1KEKA 4WKRA 3QMQA 1H2VZ 1L3SA 4RW4B 1S4FA 2YX7A 3IA0A 1S4EA 3DU5A 4HDGA 1U1NA 3C16A 1M5VC 2WVEA 4Q5VA 5CYJA 5C24A 5GAEU 3TANA 1SKRA 1EKSA 2GAGC 3OBIA 1YWXA 2CRLA 4YB6A 5THWA 2QL5B 2DH9A 2AIRB 4I56A 3W5XA 3BF4A 1RADB 4EK2A 4AXJA 2I5JB 3ENAA 3M1VB 5K5MA 3SFGA 4FKYA 1SC3B 1Z1ZA 1WEXA 4QW9A 1DQAA 1UA1A 4ED1A 2POKA 1X0FA 4DPUA 3FC9A 1RAFB 2FDNA 2EG1A 3MMAA 2W2QP 2OPRA 4YHHF 4PZVA 3DLKA 4Q45A 3GIKA 2BQUA 3ZTOA 4JI2J 4X4NA 5LL6d 1M90T 2PC6A 5B08A 3MZIA 1RB0A 1YJRA 5L46A 4DV7F 4WFNQ 5HROA 1L5UA 3MTJA 2G0JA 1DLOA 1U49A 4CQ1A 3HD2A 4WKYA 2IVYA 4CIOA 4B9SA 3W2WB 4OZNA 2LQJA 4ES2A 3SFUA 2LXIA 4ZDNA 4CNYA 2Z2MA 1G3OA 2OSQA 2MZTA 2XYGB 3D67A 2ZH9A 2ZH2A 1N6QB 3H40A 5K8MA 2V4QA 3HO1A 4N8OA 2OD4A 1Y5LB 3KLGA 4F7VA 5E3PA 4E8UA 3AD9C 2OFHX 4F04B 4ZN1A 1LEOA 5CCMA 2JLGA 1NJXA 1VQ9S 4KGVB 4L3KA 1FHTA 2XWYA 4J9MA 1IKWB 4UW2A 2XWXA 4U9RA 3ZTPA 4B9NA 2HVHA 1RU1A 4WP9A 3QFWA 2MHEA 1VJWA 1B70B 1Q78A 4DR7F 3TA1A 3MM6B 3KJVB 4QW8A 1FJEB 1OS5A 5KT5A 5AE2A 3D6TB 3IBCB 3EGWB 2MQNA 3DDIA 4ZJLA 1B3TA 1PBUA 1X9SA 2CZ4A 3WX4A 5F9NA 2L9NA 1FDNA 4N5SA 3HVWA 4X62F 4X64F 4NLXA 2MQLA 4CO3A 1VLOA 2WAQD 4DS4A 4USJC 3MMCB 2FZCB 4IYQA 1QE1A 4DZDA 1N88A 3L7UA 4Y2AA 1RABB 2IC3B 3K8VA 4B3RJ 3T1YJ 1UVNA 4F4WA 4LRCA 1H74A 1N34F 2OKQA 4AYBD 5KFCA 1YJVA 4EFAC 2B4VA 1JWWA 3D3BJ 2R9LA 3R7NB 2BJ7A 2FHJD 1YIJS 4FYVB 1C1CA 2M8HA 2HZCA 1X8DA 3K58A 1ZTTA 2K06A 4CYUB 4O4GA 3IFEA 3HCXA 2YNHB 4ICLB 3TUJC 1RAGB 3CD7A 2AW0A 2AZ3A 3IRWP 1Y10A 2ZEJA 2R8JA 1SH2A 3M6WA 3LWMA 2D3O1 1LWXA 1MMDA 3J80Y 1MU2B 1EHWA 3NP5A 5D0EA 1HARA 1RXOB 2W01A 2W2NP 3FKBA 4C8NA 4HHUA 1KN6A 3UVJB 4DV3J 1SQGA 2YTCA 3FCHA 2K7KA 1WC1A 1Q7YT 1V6HA 4JI4J 1JXVA 2HHXA 3VAGA 1TKTB 1B7YB 1C2PA 4F0MA 3MM8A 3AT1B 1ROFA 2HZAA 4DQQA 2W2MP 4WE1A 3D0HE 3FNNA 3P6YC 4YR2A 5B0DA 2KYXA 3C3LA 3SIPB 1R6VA 3NMRA 1NLKL 4KT0C 3H5UA 2I5JA 1TL4A 1YZ7A 2CZ9A 2YNGB 1VRUB 3FSIA 4QPTA 3I5CA 5KT4A 4WU3A 3BSNA 3FBCA 4I2PA 4QYZJ 4OZ2A 2DHXA 2ROEA 4C8MA 2KH9A 5K8OA 3T6JA 2F8EX 1U0SA 1BUXA 4PRFA 5D4NA 1T02A 3M8YA 3UO0A 4L3NA 3DDKA 2X51A 3GLJA 2X3GA 5HJYA 4KHRA 2OGUA 3RBZA 2DGQA 3U02A 2WVFA 2ZM6J 5J2NB 2XSJB 1DAXA 3D28A 4DR6F 5K20B 5F8IA 4F4AA 2AKWB 1U0HB 5I42B 2UXDF 1DURA 4JI8F 1HQ2A 3PX0A 3EZOA 1UVJA 1WORA 2FVQA 2EFNA 4CLUA 3CDBA 3EJMA 4PG8A 1YK9A 4OFZA 1Q8BA 2DNPA 4X66J 4ANEA 1N6QA 3OL9A 1EIYB 3CJQA 3BGLA 2D74B 5D3GB 1L3VA 1Q8KA 2XMMA 2V34A 4CTAB 1PJ7A 5GAGI 2MEWA 3KJFB 1PYTA 5L9NA 4LQ3A 2AJFE 3H90A 3VQSA 1IKWA 2Z2ZA 3ELHA 2C3OA 2ADBA 3D4JA 4KKOB 3OSPA 1T95A 4OZLA 1Q86T 4DSLA 3UN2A 2J9DE 3CCWA 4V19J 1JX4A 3MM6A 5L1JA 3KJVA 3KLFA 2VOPA 2IBKA 1X7VA 2RHSB 3PHEA 4ZVHA 1M5PC 2EFPA 2JDJA 1Q7LB 1S10A 3QNWB 3LP2B 1BQNB 3P5TL 4RBUA 2DIUA 2MGZB 3ZXWA 3FRYA 3ZTSA 2C28A 4IG0A 1Y5IB 4IG3B 4IFYB 1U24A 5KFEA 2Y8WA 2FJEB 4E2FB 3HVAA 1AXQA 3N79A 4X66F 4Q8FA 5H1SV 4D3HA 2IC3A 1C0UB 2YWGA 1ZOTA 2UVUA 2A2DA 1URRA 2RDJA 2A2CA 2HFZA 2QTWA 1CEZA 3T9ZA 1RT7A 1O8BA 4WFZA 2DR6A 4QIWD 5KFMA 2Y3YA 1VR6A 3KXDA 3L7PA 2OTJS 4OL8A 4A46A 5EHHA 2E5GA 4QOTA 4K7QA 1S9EA 3VV2B 3O3LA 2V6AA 4QWDA 4F3MA 1TL3B 2FGOA 4CYUA 1WHWA 2YNHA 2MQOA 4ICLA 3R9LA 4KGKA 1FKOB 4PUOB 1CS4A 2VIHA 4BDPA 3CD6S 7FD1A 1L3KA 1T9VA 2B8QA 2D3ZA 1DJ0A 3VHQA 3EX7B 2ZC3A 2PA8D 3NMAA 3BYPA 5CD4A 2VB6A 4NLWA 1MU2A 4O4RA 3DMJB 2A1BA 2QG9B 2HHUA 1KVIA 4M5JA 2GQQA 2PD1A 1WI6A 3BBCA 5D4OA 1HI1A 3CIMA 1TKTA 1BXNA 3PW5A 3R6GB 2F3JA 1SC6A 2OPQB 3TVKA 1FJCA 1WD6A 2LA4A 1A0OB 2DNHA 1IJEB 2PEBA 3I87A 4OYMA 2FLOA 1DY3A 2RS8A 2WONB 4ZJQA 3KK1B 1F5BA 1KRPA 2Q3PA 1Z4UA 2V67A 3G96A 4JI3J 3N9UC 1S1WA 2DTJA 3LWLA 1RK8A 1NSPA 3P4UB 2MQMA 2WSCC 2XO7A 2YNGA 1VRUA 2DRBA 1Q5YA 3QGIA 4FYYB 4RW9B 1VQOS 3WDOA 3TO8A 1R7IA 2X1FA 2RQCA 3NWGA 1I94J 2E5IA 4N47A 2FVCA 5E3AA 5L9XA 1SKWA 3TVYA 3TUPA 4ERDA 2NZCA 4PKDB 3BQ0A 3GCWP 4ZK7M 1NKBA 2IM0A 4CT8A 2VF3A 3Q8UA 3MEKA 5J2NA 3AJ1A 4ECSA 2VG6B 2MZRA 1VOMA 3SCLE 1FESA 2VA2A 4O0IA 4B9VA 4QWEA 5I42A 4M94A 3CJKB 2R7QA 2F4FA 4CLYA 5DLGA 2DK2A 2VDHA 4PABA 3IG1B 4WIIA 1R8BA 3G8TA 2QRRA 3Q8PB 4LVOP 2DISA 4WFYA 1QSLA 2LEPA 2YWHA 1RWUA 3GTYX 2Q66A 4CTAA 2VHGA 1HWLA 3JTPA 1FEHA 4FN5A 3QFHA 3L7OA 4UUXA 4YY3J 3JSMB 3TA2A 3UCUP 2XZWA 4Y28C 2XCPA 2KXHA 2NSBA 3QO9B 4KKOA 2F65A 1D3WA 3SYZA 2MZSA 2VG7A 2HGLA 2VG5B 4FYWB 3JXOA 3BO3A 2LEAA 4GKKJ 2MSSA 1Y00A 3A12A 4H4OB 4R25A 2K3IA 2LXFA 3P5BP 2HBZB 1RUSA 3QSIA 5DG9A 5D0RA 1ZA2B 2ABYA 4F4YA 1HNWF 3ZNUA 2OO4A 4J9OA 2GX8A 4NMLA 2A3JA 2B9YA 5K8PA 3PEJA 4I7FB 2DD8S 4C3MA 4DLGA 2HVIA 1ZZNA 3LP2A 3SBMA 2CJKA 4MKVA 2FQQB 3HDSA 3RAMA 2MGZA 3KK3B 3PEHA 5HVGA 4W90B 5DJBA 4IG3A 4IFYA 4MIWA 2CPHA 1B4SA 4IO9Q 4QIEA 1FKPB 3QYYA 1C0UA 2A18A 3HZEA 5EWFA 2IJRA 4LR7A 3I0SB 1PIEA 3SSQA 3KHHA 4ED0A 2ADCA 1GTEA 2UV8A 5F8GA 4P71A 5AJ3F 2D69A 3CDWA 4EEYA 4YY3F 5HAOA 1SJRA 2GJFA 1HWJA 2XTJP 3MUVP 2ZH1A 4DV4J 3N6LA 3UR3C 4XIUA 3CCTA 3MR7A 2W4CA 3OPKA 4WBFA 3R5CA 2IM3A 5HQMA 2JX2A 3K57A 1TL3A 4ES3A 3GFHA 2IJNA 4ZA1A 4K8RA 4PUOA 3FK4A 4FKXA 2NXJA 4ZVQB 4WP8A 2PT0A 5H9EJ 1IN0A 3EMTA 1R8HA 3NNAA 1X4GA 2ZJRQ 1NRKA 2B56A 4U67Q 5KFGA 4AT1B 3FSXA 4ER8A 4X4UA 3JQKA 4OYWA 1JKHB 3AXKA 2N3LA 2HQ3A 1XQIA 5GAHU 5E7OB 5HI7A 2J76E 4TXSA 3I9V9 3CJ8A 3A8JA 1NXIA 2CQ4A 2M0GB 3DGVA 3I9ZA 2FZKB 4ELVA 1KDNA 3HHDA 3QBCA 2P6SA 1S0NA 4EO6A 1X31C 1GX5A 4ES1A 4NXMF 3GV8B 3R2DJ 2WONA 3H20A 3KK1A 1H38A 3MPUB 3PKMA 1QAIA 3UPFA 3IWLA 4J5OA 4GO7X 4DV4F 4PG7A 3JSRA 1IKXB 4A8SA 2G0CA 4OMFG 1NH7A 1XNQF 2HQCA 4ATNA 2R3VA 2Y0SD 1RU2A 1UPMB 3LAKA 3KTQA 4RW9A 1J2VA 4A8XA 1B0VA 2KO1A 3H0PA 1XR7A 5D4LA 1W7WA 4C97A 1FFWB 2HHVA 4WYWA 2AF6A 1F0XA 4NMXA 3TAMB 4BC7A 4LBHA 1R89A 4DLEA 2UVWA 1XNRF 2V4JB 4FVMA 5KFXA 5JJBA 2Q6CA 1VQ6S 2VG6A 2UUCF 2GVZB 5DDOC 3CVKA 2ALZA 6FDRA 2CQ1A 1BC6A 5J2MB 4HT7A 1TV6B 4RUBA 3CJKA 1RTHB 5AXKA 4FNIA 2AGPA 3QWPA 2J8SA 3ZTRA 3TA0A 4MKYA 3IG1A 4NXNF 1PAUB 2QV6A 1X5PA 4YMEA 4X4PA 1RWVB 4GMKA 3T1HF 4KPYA 2OH2A 4RO0A 1TK0A 3H5SA 5KOXA 1BMQB 2C3YA 3EGNA 3PR5B 2E5HA 1SB6A 4AXIA 2ZH7A 4PG5A 4AQYF 3TP2A 1D8YA 2A6MA 1WDDA 1YGYA 3DLJA 1FI4A 3H2UB 4DPOA 3MAAB 2HYIB 2QLFB 3JSMA 1K73T 4QBUA 2V5HG 3LOUA 4X65J 1WNEA 3C6UB 4N56A 3OL6A 1RT1B 2I6WA 3JSBA 2VG5A 2K1RB 3TAPA 2JC0A 1ITPA 1ULRA 5C42B 4YB7A 2PMHA 4JI1J 3M6XA 3NS6A 3CTRA 4TY9A 1Q5VA 2LVWA 3OLBA 4OYIA 4LF8J 3H5YA 4NRUA 1NHUA 5A76A 1VBZA 1GH8A 2XULA 1BQMB 1K47A 4I7FA 2WW4A 1HHSA 2V63A 1ZS6A 3H98A 4DR2F 2XS5A 3L9ZA 1AROP 2F8MA 3KNAA 3OVSA 2KXFA 4J37A 1OQ6A 3UDVA 4WP3A 2GMJA 2NLWA 3DKDA 1A6LA 3FJ2A 3E2EA 3GQCA 1FKPA 3FMBA 2F4VJ 3X1LB 3O44A 4TNOA 4ZP6A 2CPEA 3I0SA 4LRFA 1WACA 3LANA 3C8YA 3MR6A 3K0JA 2P9CA 4HKQA 1HW8A 4UQTA 2BOPA 2XMUA 2KM8B 3NGSA 3IC1A 4FYXB 1FF2A 3KJNB 2DHGA 2C22A 2JVRA 5FD1A 1X60A 1P9YA 3VR1A 2VKRA 4F8RA 2DNYA 2IYIA 3R6LB 4WTOB 4JI1F 3OQ2A 3RRHA 3NLCA 1HHQA 5LMNF 3QRPA 2IAJB 1CULB 3DDNA 2OELA 4N77A 2CZVC 1CBKA 4ZVGA 3V6DB 4QR1A 1OIAA 1U1MA 1HWIA 1PAEX 1QVGR 1JKHA 4KHPJ 5EX0A 3OVBA 3RB3A 4F50A 1SL1A 3MEEB 3HJFA 3MD3A 1FXRA 4I64A 5KG2A 4O3SA 4Q8EA 4ECZA 3HKWA 3RAQA 2RRNA 3QWUA 3G4SS 3D7SB 2IBOA 2C2NA 1T11A 2XNQA 2Y0BB 2PMZD 3LA0A 3M2VB 3DLHA 1NDLA 3DOMB 4P2XA 4EBEA 5KOWA 1JXLA 1HYSB 2DRAA 4F2SA 3M32A 4NA2A 5BJRA 1YSJA 4I6AA 1K1QA 1IKXA 3OVAA 4OHVA 5LXRA 2BVZA 4OX6A 2O1PA 2VBXA 1NPKA 2CG4A 2QEXS 2WHOA 2HBYB 1AT1B 3B4DA 2VQEF 2OHDA 4F2RA 3K59A 4DR3F 4UF4A 3S1TA 2CQGA 4BLGA 3DC2A 2QSWA 3NAIA 3SCJE 3TAMA 2R8KA 3W5YA 4NWBA 1XMQF 5ETRA 2V4JA 3K5LA 3FVYA 5L1LA 3NOCA 1F1BB 4C3LA 4DL3A 4KE5A 3UD5A 2GMHA 4P7TA 5J2MA 4Y0FA 2W9BA 1ZPVA 3AJ2A 4MK8A 1TV6A 1YJNS 4LF7J 3PJWA 1RTHA 1FX4A 1FERA 1K0TA 3NGRA 4EBCA 5G0RB 2IDLA 2B51A 4B3MF 3EGZA 2R7RA 1XR6A 4I6YA 3LF0A 2OMLA 3W3SA 1Z2LA 2EK6A 2FHJA 4RW6A 2RMLA 4O3QA 5LT5A 2WOMB 5I3PA 5EUHA 3JSYA 4LF4F 3BGUA 3DI6B 1IWGA 3MAAA 4ID8A 2WSEC 3B8HA 3U1LA 2BANB 4ZLNA 3LUYA 3QSYB 1HWUA 1G2EA 2VBZA 3UD4P 2R7TA 3C6UA 1TL5A 1Y4ZB 1RT1A 1S0MA 3B78A 4RX6A 3UR0A 2GGPB 1VDHA 4NL5A 2LCWA 4JI6J 2K1RA 2XQCA 2QMUB 2JC1A 1SKSA 3MMBB 4DR1J 2MMYA 2IHR1 5E33A 5CABA 3HF5A 5F8LA 1QAYA 3PHTA 3OLAA 2QO3A 3N6MA 3BSOA 2DXEA 4QQBA 4LF2A 3KHGA 1LXNA 1HNXJ 2CG8A 2N4DA 4P2SA 3OR1A 1NHVA 1T9XA 2QLWA 2VFVA 3D6MB 1BQMA 1LNQA 1NZAA 2J6TA 1C1BB 4QIVA 4ILLA 4DV6F 4J7CA 4LF7F 1TR0A 2V4RA 3FQKA 1XIQA 2W9CB 2OTLS 1FDBA 1FDAA 2BR0A 3GYGA 2LYVA 2ZH3A 1S48A 3J7YU 3FBEA 2BX6A 5IZHA 3GV5B 1NAQA 1U4BA 4K4ZA 3M6VA 1VCTA 2ZITA 3W63A 4AUKA 3N5BA 3FBFA 3SCIE 4J9RA 5H9FK 1VQYA 3KHLA 4OHZA 3VQTA 3PYFA 2CDRB 3A13A 2ZDPA 3Q8RB 3UI3A 3HXMA 2XEXA 2NUUG 4K59A 2RRAA 3FBBA 1KBRA 2CPDA 4NLSA 1U6FA 3IR6B 1TVRB 4DFMA 2J7KA 1R0CB 3U1MA 1S6PB 2CWKA 2HNDB 4URGA 1SQFA 3RRKA 2IAJA 1CULA 2MKSA 1N54B 1H7XA 2J9CA 1HNXF 2CPIA 4AD6A 2C2DA 1QUPA 2EFQA 2I8EA 3CJRA 1FD8A 1AUSL 3LGMA 3MDFA 3V6DA 1FXLA 2DPJA 2AV5A 4ZPWR 2DH8A 1UP1A 1WOSA 3MEGB 5JUMA 2XY7A 3BH6B 3CMAS 2PFFB 4USHA 4EO8A 1EX8A 3AA9A 4ID5B 3C14A 4QYRA 2AJ2A 1RAEB 1PC5A 2HS0A 4LSLB 4GVBB 4ZVEA 5KFJA 4ECVA 2ZBQA 4RPFA 3TW0A 3M2VA 4QCLA 2KJWA 3DOMA 2R7WA 2I38A 1FFGB 4Q43A 4DX8H 4HYKA 1L3UA 1HYSA 3R27A 1YRUA 2VBWA 2PMWA 3R5BA 4DCOB 2MY7A 2BACA 2A6OA 4DL6A 2BQ3A 3WIUA 4ECWA 5B7WA 3KLEB 5CZXA 4DN9A 1FRKA 1P8GA 4DV0F 5KT7A 3W9IA 6AT1B 1FD2A 3GJTB 4IOBA 4DU7A 2DHAA 3CCQS 1X4CA 4UOHA 1U2CA 3EZ5A 3RJMB 1N5YB 4OZ1A 4TYBA 4TY8A 4ZIVA 5DM6Q 1X5TA 2KL8A 3GONA 4DSKA 2GS8A 5CA5A 1GTHA 3D2WA 1RWWB 3A3NB 1ZM4A 4MFBB 1SKUB 3E01B 5EDWA 4NYOA 2RILA 3I32A 5GAEI 3ZZUA 5G0RA 4C8OA 2QE5A 1JQGA 5ETTA 3RW7A 4NLOA 4LFBF 2MKKA 2FYXA 3DRSB 4G1IA 1C4AA 4MK7A 2CPXA 1BQXA 2AWZA 2WOMA 2KVQE 1R8CA 2XZDB 2YVSA 2FC8A 1P27B 1KQFB 4IR9A 3DI6A 5A6WA 3BEGB 3GJQB 2APOA 3O6QA 2ZKTA 3GPAA 1YZ6A 2BANA 2ZKUA 1M5OC 4B3TJ 2YWWA 3I0RB 5IWAJ 3PRVA 4A4JA 1OJ4A 2ZDOA 3BKUA 3NS7B 3M8RA 5AXNA 2ZD1B 3RW6A 4OQJA 3W8PA 4C0OC 4DZ6A 1UJ4A 3MMBA 4DV2J 1N33J 1U8SA 3RRGA 3OTOF 4BHQA 2E5LF 1IQZA 2IMWP 3EXCX 1IUJA 3H25A 2HQGA 3QRRA 3AOBA 3WC2A 4X2BA 2IVFB 1RHKB 1HBNB 2XSFA 1GX6A 2CFXA 4WF9Q 4FXWA 1FNXH 3PY8A 1F2HA 2B43A 3I56S 3C2PA 1FK9B 4UQGA 2FVSA 4WIQA 3PRBA 1QVFR 5ADZA 2DNGA 5U47A 2R2TA 1XMOJ 2GVDB 4PPZA 4WTYA 5LXYA 4HTIA 2D3OR 4RR5A 4ED4A 5D0GA 1XN9A 2F63A 2KT2A 2HIQA 2YQ0A 1RTIB 3CMES 2HFOA 3IR7B 1NK8A 2F40A 3R97A 3GILA 4ZVTB 1IR1A 2QA4S 2W7AA 1WKKA 3TOQA 5B0CA 2UP1A 4IO1A 1IBMJ 1KWMA 2MZ1A 3C6TB 1B64A 2KJVA 1FXDA 2W24A 3MCNA 3LALA 5HL7Q 1HNIA 5EWGA 1H72C 1RYRA 1TVRA 2F7VA 2KKHA 5F3ZA 1S6PA 2XMAA 2HNDA 2CQPA 3MR2A 1U02A 4DV5F 2CQHA 3CJ4A 3UW1A 2V50A 4UOCA 3CJ3A 4QIGA 1SIZA 3CCJS 5FDLB 4CLPA 2ZJPQ 3EXYA 4KRWA 3BZQA 1R27B 1VQ7S 1D9DA 3MEGA 3LO3A 2NSCA 5IOLA 3DRPB 1TU0B 2X1BA 2GHWA 3AD7C 5K14B 2UVRA 4OZ3A 4OYXA 5A8RB 4F4ZA 4ID5A 2GA7A 1H6KX 1WI8A 3QATA 1QTMA 1KKHA 4LSLA 4KAIA 1JJCB 4GVBA 4IH5A 2QLXA 4WWSA 4M5GA 4LT6A 1GXUA 1FRMA 1WHXA 5J1PA 2UUTA 1MG7A 3CCLS 4WU2A 1ICEB 3Q0AA 1NBEB 2MKIA 2ZE2B 3OHAA 2MKJA 1UVKA 1SUQB 2ZBCA 5BR8J 2E44A 1HPZA 1VMBA 1YHQS 4OLOA 2DNMA 5A0YA 1FWLA 2LEBA 1UW4A 1VFJA 3BR9A 2VODA 3DLEB 2XZTB 5A2QY 1ZZFA 1HBMA 3O2IA 4BWJA 3TZWA 5DQIA 4Y2CA 4E98A 2FZGB 2ASDA 1T0TV 5CYQB 5DDQC 1X4EA 2QL9B 3QAEA 4FF3A 3Q8VA 1JMTA 4DQIA 4GKJF 3NBPB 1VGYA 3MHYA 3C46A 3K5NA 4DL4A 1R0AA 4UT4A 1UETA 3EE3A 5HSPA 2UU9J 2BABA 2J0XA 1F6TA 3IAM9 2CJ9A 3CCSS 3ONQA 2NXCA 2GHVC 3WBZA 3DRSA 4V1Ak 5C5JA 3MM5A 2XYPB 1LV5A 1HHTP 4RBTA 2HHHJ 2EC0A 3GMGA 3CCVS 3JAMY 5H9FJ 4IH7A 4M5KA 3R5AA 2RKIB 4UUWA 5DG8A 1PJ5A 4A8KA 2FB0A 4MIBA 1M1GA 2XM3A 2L08A 3I0RA 3DU6A 2ATLA 2V2KA 5ETMA 5JMNA 2ZD1A 1GAOA 3NS5A 2QA4G 4KTQA 2YH0A 4F4KA 2RU3A 2CJQA 3H8YA 5KT6A 3QIDA 5A8KB 1TP7A 5I4MA 1OPIA 1N36F 5CQGA 4WFXA 2ZHBA 1UCNA 2UXCJ 3VAJA 3QGGA 4DBQA 2BJ8A 2HS3A 2ASYA 1FK9A 2F1FA 1NSAA 2CQ3A 2G1DA 2GNKA 4DL2A 4HDHA 1TUWA 4U8VA 2QFJA 3Q89A 4Z7YA 5CXTA 2U1AA 3GYXB 4RU9A 2CVEA 2GVDA 3OR2B 3G8SA 1LW0A 1FJ7A 2LECA 5KFQA 2BKPA 2C3UA 2KG1A 1T03A 1U6BA 4DDFA 2DNRA 1RTIA 2OMOA 5SZTA 4C11B 3M6UA 3HHNB 2XYHB 2E9ZA 4CNZA 1FX2A 5F8JA 4NCBA 1PO6A 2C2ZB 4NX9A 1NO8A 5D15A 5CYMB 2HBQB 5KFKA 3ZFVA 3ISNC 4LFCJ 2XI2A 2Z56B 4YQWA 4Z37A 3PW2A 2UUAJ 2ZHAA 4UZBA 1HI0P 2VC1A 4L73A 4RUAA 3JQMA 5GAGU 4NRTA 1S0OA 5KG4A 3VVTA 2B5JB 2DNLA 1KQGB 5ETNA 2QYCA 5LMUJ 3DYAB 4ZHRB 5J2PB 2XS2A 3TQ1A 2XHWA 2XGPA 1P1TA 1CQNA 1S76D 3FMWA 4ILRA 1TKDA 3VAIA 5FDLA 1RBOB 1LK5A 1WF2A 1R8AA 2KYZA 4F67A 3KJQB 3MCSA 2LP4A 5KG3A 3QT6A 5HLFB 2HNZB 3KUGA 3KLHA 4IOAQ 2HNYB 1K8AT 3DRPA 5K14A 8AT1B 4PR6A 4FDFA 5A8RA 4RW8B 4FF1A 5IM0B 4Q0BB 1MMLA 3T5KA 5GMEA 1H2TZ 3LGNA 3PIOQ 2IDEA 1JXEA 3FEXB 1LOUA 3OXLA 2W1BA 4YB1P 3HP6A 3CUNA 5KT3A 1PC4A 5IV3A 3BR8A 1HBOB 2BE2B 3OTBA 1SUQA 3A8KA 2PEHA 3VGSA 1RWNB 3S7RA 1V5VA 1MN9A 2XNRA 4HH0A 1FCAA 1WDTA 2RUGA 3M2UB 1GMVA 3S6EA 2J7UA 1FE4A 2BV3A 5I3QA 4RNNA 4QYZK 1WKLA 4AFFA 3EICA 4OJ3A 4ZKAA 3GB0A 3VZIA 2CNOB 3BN4A 3W62A 2BJ1A 4J9LA 2YKPA 1JLEB 4FBTA 4ZJOA 5CYQA 2OJ3A 2DR8A 4OV6A 4DX7A 1E6YB 2RD5C 1VBKA 5KG5A 3SDEB 5CCLA 1RT5B 1IM4A 4I0WA 1X4FA 3NBPA 1EJ7L 1VQSA 1BHNA 2YX1A 5JVGQ 2HMIB 2OEKA 4PXDA 1JLBA 4JV5F 1JJ2R 2VQFJ 1RI7A 2FC9A 2GZOA 4NCAA 4UY8T 2CWXA 2HFUA 1NNDA 4X4TA 3CJSA 2HEKA 1MMNA 3IAS9 5DDPC 2ZOMA 4QIFA 1RTDB 1CJTB 2CVIA 5M2UA 1IM6A 2XO6A 5IFMA 3FZBA 3OFEA 4NLDA 2XBPA 4XDDA 3LW5C 1U1RA 3Q22A 5ETQA 3CCZA 4Z2XA 3TZZA 3D1QA 4A48A 4J9VA 4B9MA 3CJ5A 3QZ8A 2ZZTA 3ZZZA 3G82B 4R5PB 4ILMA 1LWEA 4J91A 3R8YA 2KDOA 4P52A 4C4WA 2BJ3A 3MFHA 3AB2B 2P9EA 4OHXA 2DEJA 3SI8A 2FLPA 2G2YA 5KFTA 4BC9A 4RNHA 3EPGA 2EKNA 4DF8A 2DCLA 1UFLA 1BGXT 2DKOB 4DPWA 3OL8A 3M8PB 4YHHJ 4RWXA 5JXSA 5HVFA 2PSZA 5A8WB 3VF0B 1IJFB 2H4YB 5E2QA 5IT9Y 3JYTA 3N5FA 4EWTA 2HFNA 2V8VA 1QTNB
chains in the Genus database with same CATH topology
2QV6A 1WC5A 4CLUA 1TL7A 1WC6A 3ET6A 4WP9A 4USTA 4OZ3A 3R5GA 4WP3A 1CJTB 1WC4A 1YK9A 2GVDB 4OYXA 1U0HA 4OYZA 3MR7A 4NI2A 4OYPA 5D0GA 1AB8A 1CJKB 4CM2A 5D0RA 4CLKA 3C15B 1CULA 1CJTA 3MAAB 4OYAA 4CLWA 4WP8A 1CJUB 1FX4A 4OZ2A 3C16A 1CJVA 1WC3A 4USVA 4OYBA 4CLFA 4CLYA 3G82B 3C14B 5D0HA 1AZSB 4CLSA 4P2FA 4P2XA 4WPAA 1Y10A 4OYMA 1YBUA 1Y11A 1TL7B 2GVDA 4OYWA 3ET6B 4USWA 4P2MA 2BW7A 1YBTA 1CS4B 1CJKA 4NI2B 3C14A 1AZSA 4OYIA 5D0EA 2W01A 3UVJB 2GVZB 4CLTA 3C15A 3MAAA 2WZ1A 1WC1A 4CLLA 4CLZA 1CULB 1CJUA 4OYOA 1CS4A 4USUA 4CLPA 4CM0A 1U0HB 5IV4A 1FX2A 3UVJA 3C16B 3G82A 2GVZA 5IV3A 1WC0A 1CJVB 5D15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QV6 A;  1WC5 A;  4CLU A;  1TL7 A;  1WC6 A;  3ET6 A;  4WP9 A;  4UST A;  4OZ3 A;  3R5G A;  4WP3 A;  1CJT B;  1WC4 A;  1YK9 A;  2GVD B;  4OYX A;  1U0H A;  4OYZ A;  3MR7 A;  4NI2 A;  4OYP A;  5D0G A;  1AB8 A;  1CJK B;  4CM2 A;  5D0R A;  4CLK A;  3C15 B;  1CUL A;  1CJT A;  3MAA B;  4OYA A;  4CLW A;  4WP8 A;  1CJU B;  1FX4 A;  4OZ2 A;  3C16 A;  1CJV A;  1WC3 A;  4USV A;  4OYB A;  4CLF A;  4CLY A;  3G82 B;  3C14 B;  5D0H A;  1AZS B;  4CLS A;  4P2F A;  4P2X A;  4WPA A;  1Y10 A;  4OYM A;  1YBU A;  1Y11 A;  1TL7 B;  2GVD A;  4OYW A;  3ET6 B;  4USW A;  4P2M A;  2BW7 A;  1YBT A;  1CS4 B;  1CJK A;  4NI2 B;  3C14 A;  1AZS A;  4OYI A;  5D0E A;  2W01 A;  3UVJ B;  2GVZ B;  4CLT A;  3C15 A;  3MAA A;  2WZ1 A;  1WC1 A;  4CLL A;  4CLZ A;  1CUL B;  1CJU A;  4OYO A;  1CS4 A;  4USU A;  4CLP A;  4CM0 A;  1U0H B;  5IV4 A;  1FX2 A;  3UVJ A;  3C16 B;  3G82 A;  2GVZ A;  5IV3 A;  1WC0 A;  1CJV B;  5D15 A; 
#chains in the Genus database with same CATH topology
 4DV7 J;  4OI3 A;  1QY7 A;  3ZZT A;  3OR2 A;  1NPP A;  4Y00 A;  3PFE A;  2NQP A;  3GSD A;  1NJZ A;  4B02 A;  4USM A;  4ZVR B;  4DN0 A;  1KTV A;  3ENW A;  4NE9 C;  3BKF A;  2HHW A;  1GFW B;  1ZH5 A;  4C11 A;  1PSD A;  9RUB A;  2NXN A;  5F8M A;  2YWK A;  3RB4 A;  4I67 A;  1HKA A;  4PEO A;  3A8E A;  5ETV A;  5GAD U;  1ZA1 B;  5KFI A;  2ZVI A;  2Z0G A;  1PKU A;  2JJ4 D;  3BM7 A;  2YPZ A;  3TAQ A;  1QSS A;  3T1A A;  4C6A A;  2B5J A;  4HL9 A;  3ZZP A;  3BPS P;  1S1T A;  3DYA A;  2H4W B;  4GRS A;  2ZFH A;  1FE0 A;  3E51 A;  3PZP A;  4DR7 J;  4DCP B;  2MJU A;  1APS A;  2BMB A;  4KPC A;  1WG4 A;  5ETK A;  5HLF A;  2QFI A;  1ZTW A;  2HNZ A;  3NNC A;  2G9O A;  2HNY A;  2H5J B;  2BDP A;  4LR9 A;  1WEZ A;  2XLJ A;  1TQL A;  2GHP A;  2IRU A;  4RW8 A;  3DFE A;  5IM0 A;  1JLC B;  1FJG F;  4LVN P;  3P3D A;  4NLQ A;  2EWH A;  4WJB A;  4X62 J;  4Q0B A;  3B6B A;  4X64 J;  4DX6 A;  3RR7 A;  2XMW A;  4LBP A;  2LKZ A;  1X4B A;  2MPU A;  1RWM B;  3N01 A;  1IR2 A;  2L48 A;  4PCQ A;  3AA8 A;  1HBO A;  2BE2 A;  4F25 A;  1N34 J;  3TZY A;  1Y7P A;  3G8Q A;  3VAK A;  2J0Q D;  1DFD A;  4QPX A;  1SL2 A;  4DSJ A;  2VFU A;  2BW7 A;  3NY0 A;  1RTZ A;  3DHX A;  4MKA A;  1AZS A;  5B09 A;  2X7I A;  3FFI B;  3CC2 S;  3BSC A;  4ZPV R;  1FTC A;  2CQ2 A;  1GNK A;  1TMM A;  1LFP A;  2E1A A;  1JLA A;  2IYG A;  1M5K C;  1JNR B;  1LWC B;  4CH1 A;  1JIH A;  2R4F A;  1FRH A;  4U8Y A;  1S1X B;  1U2R A;  2MB0 B;  1HNV B;  3RUB L;  5LSO A;  7AT1 B;  3PV8 A;  3SDE A;  5GAH I;  1RSC A;  4C98 A;  5DDR C;  4DQP A;  1Q81 T;  4FXD A;  3KG0 A;  4ZPB A;  4HEA 9;  2ZWO A;  5HBM B;  5F3T A;  1J5E F;  2DJW A;  3LP1 B;  4ZS6 A;  4KV8 B;  1NKC A;  2MLY A;  3M30 B;  2HMI A;  4ZVU B;  2FVP A;  5T41 A;  3M4X A;  3LQV A;  1IBL J;  2P5V A;  1Q53 A;  3MUT P;  1ZAX A;  4B3O A;  3UE2 A;  2WBM A;  1D9F A;  5KG1 A;  2DXF A;  2YXL A;  4USK A;  3C66 A;  3NEK A;  1RTD A;  1TL1 B;  4USW A;  4J9S A;  4K50 A;  4GC7 A;  3GII A;  1Q1K A;  1EB0 A;  4P75 A;  2I2Y A;  2VFT A;  2RDD A;  3CO9 A;  6FD1 A;  3ADA C;  3THV A;  1HBU A;  1NM2 A;  3BSA A;  4DUY F;  2HHS A;  2EKY A;  1WOO A;  1VJQ A;  2VPX B;  2L3M A;  3GG0 A;  3G82 A;  1YJ9 S;  4R5P A;  1DTQ A;  1YRT A;  2IPO B;  4NA3 A;  1KP6 A;  3CC4 S;  5HK4 A;  5A2Q U;  2E1P A;  2CPZ A;  4XTT A;  5KFB A;  1WG1 A;  2H51 B;  5F8H A;  1X4A A;  1TFY A;  4A8W A;  3J81 j;  3M8P A;  1WF1 A;  4LRE A;  4C8Y A;  3TAR A;  3VGT A;  4KGX B;  1N32 F;  1LQ9 A;  2HRU A;  3DXB A;  4ZCK A;  3Q8Q B;  1N0U A;  3MOJ B;  1PJ6 A;  1WTB A;  4J9K A;  1FRL A;  1IBL F;  2E5J A;  4DR6 J;  2HVZ A;  4QWC A;  4RW4 A;  3UCZ P;  2QT7 A;  4PQA A;  2UXD J;  3CF5 Q;  4PQU B;  4EBD A;  4JI8 J;  1VI7 A;  2AYM A;  4X4R A;  4RW7 B;  1VHF A;  1FWK A;  4FF4 A;  3T5J A;  1CPZ A;  3Q2T C;  4LIW A;  2KXN B;  2CAJ A;  3OFH A;  1RHM B;  1SH0 A;  5B0E A;  3GV7 B;  1VK3 A;  2DO4 A;  2BKO A;  3T9N A;  4DL0 C;  2O01 C;  4DSI A;  2XG8 A;  2KT5 A;  3DXS X;  2Z57 B;  3JTN A;  3BS9 A;  5DLF A;  3M1V A;  2V2V A;  1VRT B;  3JAM U;  4UTG A;  1NB2 A;  1R43 A;  3ULH A;  2KTQ A;  1PYO B;  3KK2 B;  1S1U B;  2HHQ A;  2VUG A;  2FIU A;  4J90 A;  2DIT A;  2YQ3 A;  1RT3 B;  1EP4 B;  1U1L A;  3S01 A;  5H9E K;  2ACM A;  3I82 A;  3IBW A;  4EYH B;  3NRB A;  2FY1 A;  4P74 A;  2BRK A;  1S1V B;  5AE1 A;  2JEI A;  4LQ9 A;  1O51 A;  3LH2 S;  3TJA A;  2OEM A;  2MDA A;  1U09 A;  2D1C A;  3NWR A;  4V19 X;  4N41 A;  4A8O A;  3W2W A;  1RWP B;  1CQM A;  4ZP9 A;  2WB4 A;  2I1R A;  3NNH A;  1GMW D;  4ZOS A;  2HWI A;  2MJN A;  1A9N B;  2FHO B;  2ZOF A;  1VYA A;  4O3P A;  1X9W A;  3HVR A;  3ILI A;  3KDN A;  1D0E A;  2B9X A;  3H59 A;  4LSZ B;  1DHM A;  2AT1 B;  4LFA F;  5DRK A;  2Q6B A;  4DJB A;  2V2Q A;  3FFI A;  3AQO A;  2AX0 A;  2M88 A;  5AT1 B;  5CHC B;  4GC6 A;  2PI4 A;  1SVD A;  1BWE A;  4LF9 F;  1TUV A;  4IQM A;  3PKY A;  3KOA A;  3T5H A;  3IM8 A;  2XB2 D;  4OZ5 A;  1S1X A;  4OI0 A;  1TK8 A;  1HNV A;  1FRX A;  3PAC A;  4Y65 A;  5D0H A;  3IBF B;  1VC5 A;  3GCX P;  2V9W A;  1IKY B;  2DNO A;  1QSY A;  4ED8 A;  3NG8 A;  1SJ4 P;  3BPD A;  1VQ4 S;  4DV1 F;  1JLF B;  4P2M A;  3RR8 A;  5HBM A;  2Q43 A;  1ZYQ A;  3LP1 A;  1U1Q A;  4CO1 A;  1UW9 A;  3VAM A;  4KV8 A;  2HFS A;  3R7B B;  3MMC A;  2J5A A;  4MTP A;  3MM7 B;  1V3R A;  2MHN A;  3TQE A;  2MST A;  2DR5 A;  2BJD A;  3EVW A;  3A3P B;  1N5Q A;  4EI2 A;  2BXJ A;  2NYH A;  5HQL A;  2PI5 A;  4IKA A;  3DRY A;  2R7U A;  3QT8 A;  4JV0 A;  4OYP A;  1N5V A;  5LJ3 Y;  2VPY B;  1RHR B;  1RT6 B;  4DPT A;  2PGC A;  2R7X A;  1IXK A;  2DGS A;  3IWN C;  1IBK J;  2GJ2 A;  3ISZ A;  4RJV A;  4WFA Q;  2QLB B;  2C3P A;  3HJV A;  3BB5 A;  2H5E A;  4MAK A;  3IGN A;  4C7Q A;  4Q44 A;  5KFO A;  4K0K F;  4DCJ B;  4OI1 A;  4F3O A;  4I69 A;  5AE3 A;  2LQ5 A;  2CAD A;  1ZM3 A;  4NLP A;  2JFK A;  4DFK A;  1X4D A;  1UKU A;  1JLG B;  2CPY A;  2C3M A;  2BM1 A;  1QUV A;  1Q0N A;  2RQM A;  3KFW X;  2K2P A;  1N48 A;  4F02 A;  5KFY A;  3AOD A;  1FNO A;  3UVJ A;  1CVJ A;  4HTJ A;  3THT A;  4P9S A;  4F0H A;  5J1E B;  4DR5 F;  4PQU A;  4CT9 A;  2KRR A;  4RW7 A;  3MEC B;  4DU8 A;  3K5M A;  3G6Y A;  5D77 A;  1GK8 A;  3VVU A;  2M2B A;  3ETM A;  1G4C A;  3O1L A;  4B3S F;  2BA9 A;  4Y3C A;  5J2Q B;  2HQI A;  5C24 B;  2MYF A;  1EET B;  4PAA A;  2EFV A;  5KFA A;  4IH6 A;  3OXF A;  1RAO A;  5D8H B;  1R3N A;  2V94 A;  3BGO P;  2ZH8 A;  2KHC A;  3EUN A;  4H4K A;  1AUD A;  4KH0 B;  1D1U A;  1VRT A;  2WVB A;  3QJP A;  3EPI A;  3KG4 A;  1IBK F;  2JL9 A;  5KFH A;  4G6V B;  4RWW A;  1KOH A;  3KK2 A;  1S1U A;  2VFS A;  1RCO B;  3U7J A;  1VS3 A;  3T3F A;  4ECX A;  1T7P A;  2V68 A;  4CLL A;  1G6B A;  4PXB A;  3PYD A;  4CZC A;  1U8W A;  4AL6 A;  1W25 A;  3MMA B;  1FT8 A;  4MIA A;  4EZ6 A;  1HNW J;  2RJZ A;  4JI5 F;  3P96 A;  1S1V A;  2XSJ A;  1VQ5 S;  4MMO A;  4QWB A;  4HHH A;  1UAW A;  3KMQ A;  5AXL A;  3VWS A;  4O3O A;  4O23 A;  3P8B B;  1SH3 A;  1U0H A;  3J7Y I;  1W26 A;  5BYQ A;  2HFV A;  3CCR S;  2AD9 A;  5IT9 U;  3ZTQ A;  2I0X A;  2X3D A;  2N7Y A;  5D4P A;  5KG7 A;  5BYS A;  1BY9 A;  5KFL A;  3MPV A;  2L9D A;  4G1Q B;  2JZ5 A;  5D3G A;  4ZP8 A;  2BJ9 A;  2OLW A;  2PO4 A;  1FWP A;  2KI2 A;  4NLU A;  2UUB F;  4FF2 A;  5KG0 A;  3HSD A;  5AJ3 J;  3GYN A;  2B9E A;  4JB8 B;  4F4X A;  1MW7 A;  4W92 B;  2E9R X;  3L4B C;  3M9O B;  4ZLP A;  4XAK A;  2JLF A;  3U1N A;  5DQG A;  4KFB B;  1N5S A;  4R0E A;  5HN0 A;  3ENQ A;  1FTR A;  3GWC A;  2HGM A;  2IJF A;  1OO0 B;  2JLE A;  1J5O B;  3RB6 A;  1FO1 A;  3VCD A;  2V8G A;  1Q8L A;  3EM1 A;  1MN7 A;  4DUZ F;  4JI7 F;  1IKY A;  3R5J B;  2IA0 A;  4TLQ A;  2ZNY A;  1O5J A;  3S8S A;  2HVD A;  3MOZ A;  1JLF A;  4Y2I A;  2B4U A;  3DLB A;  3HZG A;  2R2R A;  2EC2 A;  1Q4R A;  3L95 X;  4RNM A;  1WSR A;  5HMZ A;  1BQN A;  1K44 A;  5LSL A;  3MM7 A;  1IR0 A;  2DBB A;  3RYL A;  1MNE A;  3Q23 A;  2ZHO A;  3BBB A;  2NS1 B;  3VGU A;  1Y9O A;  1U1P A;  1H7W A;  2WK4 A;  2HHP A;  5E41 A;  1T8E A;  2HLT A;  5LJ5 Y;  1T9Y A;  3N28 A;  3DHW C;  2MXY A;  3AY0 A;  4NXM J;  4N7T A;  2RF2 B;  4R8U B;  1RT6 A;  2CJX B;  3G86 A;  2MKH A;  3W2V B;  2R42 A;  3QJL A;  2BEF A;  2F5G A;  3PFO A;  3MFI A;  1PGZ A;  3G71 S;  3SV4 A;  4C9D A;  1KFD A;  1B0P A;  1RHU B;  3ILL A;  2AGQ A;  3QIP B;  3F56 A;  1XNQ J;  2MLX A;  4DG1 B;  4OX9 F;  4IOC Q;  1U1K A;  1EAY C;  3GJR B;  3UNY A;  1FKO A;  1VK8 A;  2PA3 A;  4ED3 A;  3TR5 A;  3ZZY A;  3RBX A;  4C8K A;  1HQU B;  4O4G B;  2OAU A;  3TJ8 A;  3VGV A;  4ZVO B;  2HWH A;  1VQP S;  4QR2 A;  1KVK A;  1NEE A;  4CM2 A;  1N8R T;  1WJ9 A;  1XNR J;  1T94 A;  3H42 A;  2HIY A;  1JLG A;  1T05 B;  1UWB B;  5IT0 A;  3DMJ A;  2UUC J;  3AFG A;  2JVO A;  1YKW A;  4KIA A;  3TEH B;  3N0V A;  1U1O A;  3KLI B;  2CA9 A;  4XPE A;  1NJI T;  5J1E A;  1VC0 A;  3MEC A;  4ECQ A;  5HMY A;  4NXN J;  2OPQ A;  5C25 B;  3MM8 B;  3DM2 B;  3OD2 A;  3D3C J;  3T1H J;  4ITS A;  5J2Q A;  1EET A;  4WE1 B;  2HWT A;  3SQO P;  2V2Z A;  4LMZ A;  4UOG A;  5M2P A;  4AQY J;  1YRX A;  4JYA J;  3JTO A;  4MJK A;  2ZNZ A;  2VD3 A;  4Y2K A;  4CM0 A;  2UXB F;  2Y8Y A;  3V4I B;  3OW2 R;  3H2V E;  2QN6 B;  3JS9 A;  1FFS B;  3CJT A;  1GMU A;  2DGT A;  4GO5 X;  2ASL A;  4I2P B;  5B0B A;  2IY5 B;  1YI2 S;  2DB1 A;  3VAL A;  3VTI A;  2EXU A;  2HBR B;  3MI7 X;  3GIR A;  4KSE B;  3KUH A;  1VRQ C;  1O6X A;  1VIS A;  1YG0 A;  5L1I A;  3V6K A;  2MKY A;  1WOP A;  3R2C J;  2DHS A;  4NZ0 A;  5FLX Y;  5EWE A;  2E9T A;  2CQB A;  1SJQ A;  4DR2 J;  1UL3 A;  1Y3K A;  4P7V A;  5ETS A;  4YFU A;  1F9E B;  3IM9 A;  3GJS B;  2OPS B;  1SXL A;  3K17 A;  4TKT A;  4URQ U;  3P49 B;  2WB1 D;  2LLZ A;  1KLN A;  3G2X A;  2R8H A;  2KFY A;  2V8H A;  5DM7 Q;  4G1Q A;  2MQ8 A;  2CQ0 A;  2UVV A;  1QJH A;  5LOQ A;  3G6E S;  2QGF B;  4JYA F;  1W2B R;  4JI0 J;  2J9D A;  4YS2 A;  4K5R A;  3HMJ G;  3QLH B;  4XDC A;  2ZUG A;  3R5D A;  5C2C A;  2IRX A;  4UY8 5;  3R5G A;  4DFJ A;  3QO9 A;  1RTJ B;  2AEJ A;  4KFB A;  2D9P A;  1PIL A;  4OI2 A;  4KH1 B;  3PDN A;  3NL0 A;  3BV8 A;  1VQ8 S;  2KG0 A;  1L3T A;  1J5O A;  4H4O A;  4MH8 A;  2KU7 A;  2F9J A;  3PO4 A;  2HS4 A;  4CWB A;  2CNL B;  5LMN J;  4ELT A;  2LQ9 A;  3D1O A;  3KLF B;  1P9Q C;  2W7O A;  1SCJ B;  1P6T A;  1VBY A;  4B9T A;  2E1C A;  1QLN A;  4CDI A;  4JI2 F;  5DZ6 A;  4ZVS B;  3I31 A;  1SJ1 A;  3KK3 A;  2XMT A;  3NGT A;  4KJI A;  1UEK A;  2AZ1 A;  3CED A;  5ETL A;  4OJH A;  1SV5 B;  1U2F A;  4IG0 B;  1RBA A;  1G1X A;  2RSQ A;  3DLG B;  8ATC B;  5HP1 B;  4IFV B;  2BQR A;  2C2R A;  2VON A;  1RAJ A;  2EVZ A;  4KQZ A;  4JI0 F;  1S72 S;  3H5X A;  1FA0 A;  4WK1 A;  3WC0 A;  1TK5 A;  3C19 A;  2E29 A;  2RF2 A;  2WVD A;  3AAW B;  4R8U A;  4JOU A;  4MYT A;  3ZNJ 1;  1Y5N B;  4OX7 A;  3WQP A;  1JJH A;  3W2V A;  5GVQ A;  2KM8 C;  1RT7 B;  1KC8 T;  2FY8 A;  1A7G E;  2FTR A;  3QIP A;  1WHY A;  5KFS A;  4DG1 A;  2Z2Y B;  3KLV A;  4J9U E;  1S9G B;  1NKE A;  1IBC B;  1S9E B;  1KD1 T;  3Q83 A;  3G87 A;  4U7U D;  3PNI A;  2VQE J;  4CH0 S;  1RGV A;  4DR3 J;  1RWX B;  1HQU A;  5D6G A;  4L6V 3;  1MWQ A;  1CS4 B;  2VA3 A;  4WCE Q;  1XMQ J;  1NDK A;  2Y1L B;  1EZZ B;  1H3D A;  1NZ8 A;  2H48 B;  4ECY A;  2IMO A;  1T05 A;  1UWB A;  3HHL C;  1N56 A;  3SCK E;  3UWT A;  3KLI A;  4NEY A;  2VL1 A;  4TU9 A;  1KON A;  1SC4 B;  1MRO B;  3W1Y C;  2FJA B;  2VAS A;  2Y1I A;  5KTQ A;  5C25 A;  4B3M J;  3MXH P;  2B8P A;  2AJ4 A;  1NK7 A;  3DM2 A;  4LBI A;  4B3R F;  3T1Y F;  3R1L A;  1BWV A;  2PFD A;  2E7W A;  2HGN A;  1UPP A;  2DNK A;  4OHW A;  4LF4 J;  3PX4 A;  2RE1 A;  3V4I A;  3GZ7 A;  1S1W B;  1WC3 A;  2A10 A;  1C0T B;  3TI0 A;  3H4B A;  1Q82 T;  2E1M C;  3UQS A;  1ZPW X;  3PX6 A;  5HQ8 A;  1MSW D;  3TJ9 A;  2LU1 A;  3SV3 A;  4DEZ A;  5B0F A;  2Y1R I;  1OWX A;  4I4B A;  3IWX A;  2LDI A;  1HFE L;  3HSJ A;  1YBT A;  8RUC A;  3HHK A;  1UEU A;  4NI2 B;  3FSY A;  4NZ7 A;  4TYA A;  4CLT A;  5AXM A;  2A0F B;  3AHP A;  4Q2L A;  5FJ4 A;  4PG4 A;  4FVC A;  3SSR A;  5IXU A;  4B08 A;  2KZM A;  2RVJ A;  2XMK A;  2J8A A;  5DZ7 A;  1HR0 J;  2GVZ A;  2LDY A;  1CSJ A;  2DPI A;  2CDQ A;  3T6B A;  4NLV A;  2H65 B;  4DV6 J;  2ZH4 A;  2OPS A;  4FYD A;  4DV3 F;  3GFZ A;  4JI4 F;  1J27 A;  2OIH A;  1ZM2 A;  4OIX A;  4EZ9 A;  2FHM A;  1OY8 A;  2FLN A;  3D6F B;  3UFC X;  4F36 A;  4HAC B;  2W2O P;  2GO8 A;  2B6A B;  1LWF B;  1YJW S;  2IFX A;  1X9M A;  3HHL D;  5E0O A;  3QLH A;  3SSS A;  5GMK a;  4P2F A;  3SQG B;  3TWZ A;  4RKU C;  2RUS A;  2RQK A;  3CE8 A;  4CI0 B;  1RTJ A;  1FVQ A;  2B4O A;  2Q79 A;  4C0H A;  2QIF A;  1V3S A;  1H98 A;  4DQS A;  3DCA A;  1RHJ B;  2BKN A;  2OPP B;  2R2S A;  1RDR A;  2VG7 B;  5C42 A;  2F9D A;  3J81 Y;  4FNH A;  1S0V A;  2V9K A;  3FGV A;  1BLU A;  4DWI A;  1HR0 F;  4ZPD A;  3OTE A;  2XC9 A;  2HK2 A;  4G3I A;  2ZM6 F;  1VQN S;  3QQC D;  1AFI A;  1R6Y A;  1X0P A;  1SQE A;  2JEJ A;  1WTF A;  1OQ3 A;  4DX5 A;  4S0M A;  1SI9 A;  1V5I B;  2DXD A;  1SV5 A;  2ZWP A;  3AXM A;  4M5N A;  2Y1J A;  2JFD A;  1PYS B;  3DLG A;  4LRB A;  5HP1 A;  4IFV A;  4OYB A;  1R31 A;  1UJ5 A;  5HO4 A;  2AHO B;  2C2K B;  3HUL A;  4P72 A;  3QT5 A;  3MR3 A;  1NCL A;  3HT3 A;  3M2R B;  4O44 B;  2YPY A;  4ZMM A;  4NLG A;  1MWY A;  3SZ2 A;  2C1E B;  4DL7 A;  1Y3J A;  2B4P A;  1E6V B;  2RHQ B;  4AL5 A;  1EQ0 A;  1HI8 A;  3BRE A;  1RYS A;  2XMJ A;  2QX0 A;  3NCP A;  4DV0 J;  1S7I A;  1S9G A;  1XER A;  1TFW A;  1C4C A;  1BD6 A;  3D0G E;  2XLK A;  2BE9 B;  1FKA F;  1DZ5 A;  2JOQ A;  2LFV A;  2XLI A;  4JP8 A;  3PVX A;  2J6U A;  2CUY A;  2YQ1 A;  2AEF A;  3EWG A;  3JB9 k;  1WUU A;  4LF6 J;  2W8L A;  1VLY A;  5KFZ A;  2AYG A;  1RA7 A;  1KHW A;  4ZPC A;  1GMW A;  1ZM9 A;  3IS9 B;  3V5R A;  4ZPT R;  3V4M A;  3MEE A;  3KHR A;  1S49 A;  3M9N B;  5HAN A;  4YN3 B;  3W5Z A;  4D3G A;  3EGV A;  4USV A;  4NAS A;  4W4M A;  1MRO A;  3QPI A;  5B0A A;  5ITH A;  3GIM A;  4TQS A;  4KGM A;  2Z30 B;  3CD0 A;  4JV2 A;  3HD1 A;  2HZV A;  1M1K T;  3Q2S C;  4LFB J;  2PDA A;  1GXT A;  2DNZ A;  3CDA A;  3D6H B;  4CCH A;  1NJW A;  2HQD A;  2O5D A;  1YQH A;  2X1A A;  4DHV A;  2RIJ A;  5KAK A;  3J7A N;  4BCA A;  1JJ4 A;  3IR5 B;  3O5T B;  2L41 A;  2MKC A;  1NH8 A;  2V8D A;  2N7C A;  5F0U A;  4X4V A;  1FDD A;  1C0T A;  1RE1 B;  4L72 B;  2X1G A;  4IRC A;  2NYI A;  3HKZ D;  1EKR A;  4I6W A;  2VC0 A;  1XEZ A;  2KFN A;  1ACM B;  1RAC B;  1Q79 A;  1REV B;  2XHC A;  3CT9 A;  4NI2 A;  1Y0H A;  4K4X A;  2B9W A;  4K4S A;  3L09 A;  1NSK L;  5DGA A;  3OTO J;  4LF6 F;  2E5L J;  1PCA A;  1X4H A;  2DR9 A;  5IC6 B;  2GC8 A;  2V69 A;  2EG2 A;  4K5S A;  3PCO B;  3BO2 A;  4M63 A;  3OUY B;  2DEI A;  2P2C B;  3ZZO A;  3PR4 A;  5E5N A;  1S79 A;  3CIZ A;  3AQP A;  1UEV A;  3HHE A;  2ZH5 A;  2ZBP A;  3DRX A;  1UWA A;  2ATC B;  4Q2M A;  5K8N A;  4HAC A;  4ZCM A;  1RLD A;  2B6A A;  2M8D B;  2N4C A;  1LWF A;  2AYB A;  2HAI A;  3ZZ0 A;  3RTV A;  3OSN A;  4CH7 A;  5GAD I;  5IV4 A;  3OV7 A;  3WZ0 A;  2AU0 A;  3SQG A;  3TUI C;  1FEE A;  1X5S A;  1JLQ B;  2RDI A;  4JI3 F;  1DAR A;  1HIY A;  3PW4 A;  3RGI A;  4TLR A;  1UFK A;  2FGC A;  3B54 A;  4A8Y A;  1RAH B;  3MCO A;  4RZR A;  3M9M B;  2YKA A;  2GGP A;  2GQ2 A;  2HAF A;  2MY8 A;  2OPP A;  4FS1 A;  1IQT A;  2DHH A;  4MKB A;  3MR5 A;  3FRZ A;  1IKV B;  2ZZN A;  1I94 F;  4DV5 J;  4ECU A;  1HW9 A;  4OZ0 A;  2M5Y A;  2JWN A;  4DSF A;  1C1B A;  4TQR A;  3BDE A;  2P9G A;  3CGI A;  4URS A;  2VIC A;  1I6J A;  1VQL S;  4DQR A;  3RU0 A;  2QMW A;  1KNZ A;  4ZVF A;  2RB7 A;  3TUZ C;  4ED6 A;  2H3E B;  2W9C A;  3CD5 A;  2R7S A;  2QJ3 A;  3RBD A;  4CLZ A;  3K8W A;  2L9W A;  5FLX U;  1N0V C;  2WTF A;  4OYO A;  1FRI A;  5KFW A;  3J7Z 5;  4YEA A;  5MAO A;  4ZN3 A;  4PWU A;  1CJV B;  2HUR A;  3IN5 A;  2LXU A;  2GQC A;  3IRX B;  2EEY A;  4OHY A;  2XMV A;  4ZIW A;  5LM7 E;  1LW2 B;  2QZ8 A;  3M2R A;  3KKF A;  2FLL A;  4O44 A;  5EGY A;  3FCV A;  4DF4 A;  3ITH B;  4FPR A;  1E6V A;  2WW8 A;  3F44 A;  1RQ0 A;  2M7S A;  2W2P P;  3Q8S B;  4NPO A;  1QAJ A;  5RUB A;  3M8Z A;  1LK7 A;  4GKK F;  4OZJ A;  4CLS A;  1GQE A;  4PWD B;  4I2Q B;  5T14 A;  2CYY A;  2VFR A;  1YLX A;  3LGH A;  3PW7 A;  2OI2 A;  2YNI B;  3DOL B;  1WSV A;  3TEG A;  3CJ2 A;  2EBE A;  1H2U X;  4KYZ A;  3PXG a;  4M8L A;  1XR5 A;  3IS9 A;  2CNN B;  3CWJ A;  4A8F A;  2W25 A;  1F9F A;  4GKJ J;  4FZV A;  1S77 D;  2OFG X;  4NEZ A;  1RT4 B;  3X3U A;  4ALZ A;  2ROG A;  4EGL A;  3B4M A;  4ETZ A;  2ALY B;  1AW0 A;  1HD1 A;  3ETO A;  3TVZ A;  3PTW A;  1Q8I A;  2VOO A;  3AD8 C;  2HPU A;  3I5A A;  1TEL A;  3ILJ A;  1RT2 B;  2IIH A;  5ETP A;  1WHV A;  3MWB A;  1F5A A;  5DET A;  2R7V A;  3I6P A;  3M32 B;  3BH7 B;  4L75 A;  3KLE A;  4BWM A;  4CO0 A;  4W98 A;  4A47 A;  1TAQ A;  4LR8 A;  1MLA A;  4DS5 A;  1REV A;  4X4S A;  1NHK L;  4F3Q A;  4IR1 A;  3I4P A;  1F9H A;  1N5Y A;  4I1T A;  2W8K A;  4HT5 A;  3W7B A;  4ZVP B;  1OY6 A;  3OUY A;  3UDE A;  2FJX A;  1N36 J;  2ZVS A;  2DIV A;  2YX4 A;  3K7R A;  4U7U K;  1V9O A;  4YR0 A;  4MFB A;  2MQP A;  3E01 A;  4K2X A;  1XMB A;  3CXC R;  4C8L A;  1TAU A;  3N6N A;  3MED B;  2W9B B;  3AB4 B;  4EUV A;  3CMQ A;  4CP5 A;  2P6T A;  4A8M P;  4DSE A;  1H73 A;  3THP A;  3H4D A;  3TX8 A;  3J80 U;  2EPI A;  2FJW A;  3BQ1 A;  3OJS A;  3FUY A;  1V3Z A;  2NXU A;  3MCM A;  1DRZ A;  5DGB A;  1KSP A;  3SEO A;  4RW6 B;  2PII A;  1XBW A;  4M5M A;  2KRB A;  3QJJ A;  1JLQ A;  1M5H A;  2YWF A;  3BDP A;  3HSZ A;  3W9H A;  2QA1 A;  1VQM S;  2M70 A;  1HL6 A;  3F73 A;  1U48 A;  2VKZ G;  1WKJ A;  4RLE A;  5BXI A;  4OJG A;  4G65 A;  3RZA A;  5C7P A;  1IKV A;  3N4W A;  4H4M B;  3CCE S;  2DT9 A;  2QC3 A;  1CC7 A;  3OFF A;  1HBN A;  3OR1 B;  5IT4 A;  3GR1 A;  3W61 A;  5E3Q A;  1M5S A;  2O66 A;  3K5P A;  2E66 A;  3W64 A;  4JUZ A;  1F3F A;  4ED2 A;  3PIP Q;  4CLK A;  3ZO7 A;  4YOE A;  4ENO A;  5CZV A;  2C2E A;  1IWA A;  4LIR A;  3OHB A;  2Q1L A;  4M1K A;  3R7S B;  3PJ9 A;  2IVM A;  1CJV A;  1SL0 A;  1CG2 A;  2G1H A;  4AL7 A;  3D68 A;  3W9J A;  2ILY A;  2WSF C;  3IRX A;  3GU0 A;  2W4P A;  3IP0 A;  3ET6 B;  2O67 A;  1NB7 A;  1LW2 A;  1HNZ J;  4DR4 J;  3UD3 P;  3C6T A;  1SJF A;  3MUR P;  4YDX A;  3ITH A;  4X65 F;  2V0N A;  4DXL A;  1H0H B;  2KB2 A;  4OV1 A;  5FII A;  5T7L B;  4WZQ A;  2AP6 A;  4USU A;  1UFW A;  1UMJ A;  3MM9 B;  1S5Z A;  3D54 A;  2H5I B;  2QLJ B;  4OI4 A;  3EDQ B;  4PWD A;  4I2Q A;  4L74 A;  4RUC A;  5IQQ A;  3NOG A;  1DTT B;  2ZBI A;  4K4W A;  2G2Z A;  2YNI A;  3NGU A;  3DOL A;  1OY9 A;  4LF8 F;  3GR0 A;  2DRD A;  3MAQ A;  3QGH A;  2I9S A;  2MLZ A;  1RJJ A;  7FDR A;  4ZCL A;  4ETX A;  3F0N A;  3J81 U;  3ZZR A;  4Z7C A;  2RQ4 A;  1KVJ A;  3MPY A;  2Z4P A;  4PPD A;  2G2O A;  4NOH A;  3R3T A;  5KFR A;  2VJV A;  2G13 A;  2B7B B;  3HHL B;  3HFV A;  2VPZ B;  1M0S A;  4DPY A;  1RT4 A;  2B3T B;  3E3X A;  4USI A;  5HMW A;  4X84 A;  2R2U A;  3C14 B;  4JV5 J;  4U7C A;  2GIF A;  3FZ2 A;  2IRY A;  1KS2 A;  1RP5 A;  2HKE A;  3I4H X;  2F4V F;  1LFW A;  2UV8 G;  2ZE2 A;  2FJV A;  3UDL A;  3D66 A;  1HNZ F;  2VH7 A;  4ECR A;  4QR0 A;  4DR4 F;  1RT2 A;  3CW2 C;  1VBX A;  1REG X;  1B7F A;  3JQJ A;  1OYD A;  4ECT A;  3TZX A;  3DLE A;  2HVE A;  1NU4 A;  2YBV A;  2DGU A;  3NGK A;  2VJU A;  4UZC A;  1JK9 B;  2LQB A;  4OYZ A;  3PJX A;  2H1Y A;  1DQ8 A;  5HJX A;  2UUW A;  3DGP B;  2DO0 A;  1I5O B;  3ISN D;  2Y9H A;  4OYA A;  4EYI B;  4C8Z A;  3GP9 A;  2BRL A;  2JNJ A;  4TY8 B;  4M5H A;  2CNK B;  5M2R A;  4ANC A;  2AJ1 A;  2NCK L;  2K7J A;  5DQH A;  3MGJ A;  4KHP F;  1UVL A;  4U95 A;  4XK8 C;  4C2M A;  1NDP A;  3PYG A;  1PBA A;  3LP0 B;  3MF5 A;  3W65 A;  4LRA A;  4B9U A;  4WXW A;  3MED A;  3R1H A;  3HM9 A;  3I5B A;  1NDC A;  2DGW A;  3UNG C;  5E3C A;  5L1K A;  4CO2 A;  1YJU A;  3IXQ A;  4CO5 A;  1AA1 B;  3NXZ A;  1N52 B;  3DRR B;  4RU2 A;  3HX9 A;  1GEH A;  3Q24 A;  3D1H A;  4QJV A;  4DMZ A;  5EN1 A;  2AX1 A;  3UCG A;  3CCU S;  1SIW B;  2RKI A;  5EX3 A;  1TZ0 A;  1WC0 A;  3FQL A;  1UVI A;  1JB0 C;  2JHE A;  5I3U B;  1URN A;  2RNE A;  4ZPA A;  1QD1 A;  3A3O B;  1XJW B;  3D5M A;  3TRG A;  1UJ6 A;  5F9L A;  1U26 A;  4J9P A;  3A4T A;  1GXL A;  4UOF A;  2ZOG A;  2YKQ A;  3RBE A;  4NLT A;  3IMQ J;  1YX2 A;  3I55 S;  2WVC A;  3CB4 A;  1S59 A;  1U6Z A;  3M8Q B;  1S99 A;  4ZP7 A;  2E1R A;  1S6Q B;  2DY9 A;  3HSG A;  3L3C A;  3M05 A;  3BKT A;  3QZ7 A;  4H4M A;  1T9U A;  2ZZM A;  2LQ8 A;  5A8K A;  3GSI A;  2D9O A;  3GIJ A;  2BUN A;  1T3N A;  4KHM A;  1Y11 A;  2GV1 A;  4YUD A;  3M7V A;  2DCU B;  4CRJ A;  2FHK A;  2AMC B;  4ZLL A;  2AJQ A;  3D9B A;  1YDL A;  3KYL A;  2C2M B;  5D78 A;  1FJG J;  2CQD A;  2NZ4 A;  2DYA A;  2MZJ A;  3GE9 A;  1KTQ A;  3VZH A;  3HLU A;  3Q86 A;  2J6S A;  3CCM S;  4YDD B;  4NLR A;  2C42 A;  1OMS A;  1NUE A;  3ET6 A;  3DOK B;  2JEG A;  4UST A;  4HLB A;  4MT1 A;  3G6X A;  2LU2 A;  3BGR B;  3VAH A;  1S7H A;  1RKJ A;  1AFJ A;  5CYM A;  2GJI A;  3A8I A;  3PM9 A;  3FCW A;  2J0W A;  5A6P A;  2C2O B;  3RAX A;  1NME B;  2KT3 A;  1RLC L;  4KC5 A;  5JVH Q;  5T7L A;  9ATC B;  1WEL A;  4K4Y A;  1VIX A;  2HK3 A;  4O0N A;  2VU5 A;  2MTL A;  1HNI B;  3MM9 A;  4JI6 F;  3SXL A;  4ZHR A;  5J2P A;  4DR1 F;  4YR3 A;  3KDO A;  1DTT A;  3SMZ A;  4KBI A;  2M9K A;  1TL7 B;  2YKN B;  1YBA A;  5IS2 A;  2GAH C;  3AOA A;  4BS2 A;  3ILO A;  1MWZ A;  2ZBR A;  4DOZ A;  3EZU A;  4RBV A;  1F3V A;  4JBC A;  5IQ6 A;  2N82 B;  4TU7 A;  1Z2Z A;  2MQQ A;  2AYE A;  2WRM A;  1ZAW A;  3ENV A;  2DVI A;  5KFF A;  4F0K A;  4QU6 A;  3HHL A;  3I96 A;  4GVL A;  1K0V A;  3HT0 A;  3W60 A;  1J5E J;  2HW3 A;  2R7O A;  4PG6 A;  4DI6 A;  1I51 B;  3K89 A;  1WC6 A;  4OI6 A;  1KLM B;  3IGV A;  4U96 A;  2DR7 A;  5CD4 H;  3CPW R;  2EI5 A;  4M5I A;  4NZ6 A;  4QWA A;  1DBD A;  4TU8 A;  2MZQ A;  3V6H A;  3M2U A;  1NK6 A;  1HPZ B;  4RNO A;  2GO9 A;  3AH6 A;  1S6O A;  4R0J A;  1PG5 B;  5A0Y B;  4LF5 J;  3HK2 A;  1ELO A;  4I68 A;  3NGD A;  1YVF A;  2CJB A;  4PWW A;  1KHV A;  4DUY J;  3GG1 A;  2K3K A;  3WHI A;  1D9A A;  2ASJ A;  1QAX A;  3EVO A;  4MYU A;  1I3O B;  3GFX A;  4KY3 A;  1HBM B;  4RL1 A;  2GFF A;  4C48 A;  1OSD A;  2JSX A;  1JLE A;  1TKX B;  3HVT B;  1HQE B;  2DGV A;  2YH1 A;  3DGP A;  2CQC A;  1K1S A;  4DPX A;  2WZ1 A;  2Z8Q A;  1E6Y A;  1I1G A;  3CO0 P;  1RT5 A;  1OYE A;  2FJD B;  4E0D A;  1D8Z A;  2EFO A;  4P10 A;  3BJY A;  1N32 J;  1S97 A;  3LP0 A;  4H54 A;  2KVI A;  1WC5 A;  1U7L A;  4YB5 A;  3TNV A;  5KFU A;  1CC8 A;  3H7H B;  1R0A B;  1UTA A;  3LPE A;  2Z58 B;  3QT7 A;  3UDC A;  1CJK B;  3DRR A;  2VBY A;  2QMX A;  1Q16 B;  3C15 B;  1CJT A;  3QGP A;  4X4Q A;  3PG9 A;  2HLU A;  3MTK A;  2EFG A;  3MM5 B;  4N76 A;  1CJU B;  2PE8 A;  5L38 A;  2XCA A;  5I3U A;  1R8P A;  3H2L A;  3A1Y G;  2KZZ A;  2DNN A;  4LF5 F;  2D41 A;  3CJ0 A;  3OL7 A;  2RH3 A;  3MMJ A;  2G0I A;  4HI2 A;  1U45 A;  1N5T A;  1YJ7 A;  1NK4 A;  4LJM A;  3NCQ A;  4K4V A;  5GMD A;  5B0G A;  3OJU A;  3M8Q A;  3F41 A;  2V8P A;  5F0W A;  1S6Q A;  1S12 A;  2FUG 9;  5HVH A;  5KFV A;  1W2I A;  3BYR A;  5F8N A;  4OLP A;  2RAQ A;  1K9M T;  2HQF A;  2XS7 A;  3LTO A;  4NYZ A;  3POT B;  3OXG A;  3OTC A;  1NK9 A;  5ETO A;  5A8W A;  3CDE A;  1AYE A;  2KHD A;  2NXE A;  1D09 B;  3ICL A;  2HG4 A;  1RA6 A;  4U6P A;  2J7W A;  4TVA B;  4WZM A;  5KT2 A;  1ZBT A;  4LSN B;  3PW0 A;  4KGZ B;  2KN4 A;  3FDS A;  1UA0 A;  3G6V A;  3FEZ A;  3D0I E;  4ZLJ A;  4QU7 A;  1SPB P;  1KOO A;  1G7C B;  4KO0 B;  1VC6 A;  1LW0 B;  2W9A A;  3TX0 A;  3PO5 A;  2ACY A;  4L76 A;  1KQK A;  1F2G A;  3TYT A;  2OP5 A;  1T03 B;  4FS2 A;  3QAU A;  4EMD A;  3DOK A;  1NJY A;  1GT8 A;  1XTZ A;  3BGR A;  2FPH X;  4PYA A;  3ZC4 A;  2CJY B;  1OSC A;  4H4K C;  4LFA J;  4B3T F;  4O3N A;  5IWA F;  2NR0 A;  2DGX A;  5DO2 A;  1UVM A;  2H54 B;  2O3D A;  4IDK B;  4OJ1 A;  1S6U A;  4DV2 F;  1N33 F;  3KG1 A;  1S57 A;  2BE7 D;  4LF9 J;  1WWH A;  2H9Z A;  2SXL A;  4DFP A;  4NCG B;  1ZET A;  1TL7 A;  2YKN A;  5E3R A;  1WF0 A;  2ZUA A;  1T9T A;  2BJE A;  1NK5 A;  1RBL A;  3WIV A;  1YJT A;  1XWL A;  2XGQ A;  4ED5 A;  4KR0 B;  1RKI A;  4DV1 J;  3KLH B;  4N8N A;  4XO0 A;  1DQ9 A;  2P8I A;  2QA2 A;  2VZ9 A;  1JLC A;  2J0S D;  2K8G A;  4A8Q A;  4Y6I A;  3BGF A;  4P73 A;  2EK1 A;  1XMO F;  4CLF A;  1UZD A;  1HMV B;  5HAT A;  4C0B A;  4JV1 A;  2CPF A;  1KLM A;  5SUH A;  3OT9 A;  3B82 A;  2QYG A;  3V81 B;  3U27 A;  4QZV B;  3LPY A;  1KQS R;  4IQX A;  5C2G A;  1IBM F;  1SJ3 P;  4OX8 A;  1VHI A;  5J1N A;  4K4T A;  2WBR A;  2Z2L A;  2OUG A;  3CUL A;  2ZC4 A;  1RIS A;  4K2J A;  2HRT A;  1LWC A;  2BBE A;  1TKX A;  3HVT A;  1AB8 A;  2BYC A;  1HQE A;  1XK8 A;  2RS2 A;  2HHT A;  4PYD A;  4K0K J;  3BBF A;  1RCX B;  2N3O A;  2IA6 A;  3T5L A;  5KFN A;  2AGO A;  2IM1 A;  3M30 A;  5MLC V;  1UZH A;  2WCX A;  3CNQ P;  1RWK B;  4TN2 A;  1JLB B;  2YKM B;  4DR5 J;  3BN7 A;  3KMS A;  1CJK A;  1F60 B;  4DL5 A;  4M5D B;  1M1H A;  1KFS A;  3C15 A;  4C3K A;  1TL1 A;  1ZAV A;  1IVZ A;  4M95 A;  4K4U A;  4B3S J;  4WK3 A;  1CJU A;  4LF1 A;  2J9E A;  4FBU A;  5BR8 F;  1X5O A;  4Y2M A;  2BW2 A;  3CC7 S;  5LSR A;  1CLF A;  4ELU A;  3M8S A;  1OPZ A;  2M3D A;  5G4D A;  2LMI A;  4WYL A;  2FJB B;  3V2U C;  4J9N A;  2G4B A;  2YKO A;  3NCR A;  1RAI B;  4XPC A;  4FXV A;  2FD2 A;  2YNF B;  1NSQ A;  5L39 A;  2EBG A;  2DNQ A;  1LWE B;  2RT3 A;  2HSE B;  1WG5 A;  4CLW A;  1FNM A;  1RHQ B;  4NA1 A;  3K2Y A;  1YTY A;  2XY6 A;  3MPD A;  1JNZ B;  1T9W A;  4G1P A;  4DUT A;  3POT A;  2QSF A;  4WXO A;  3J7Z T;  1U47 A;  3PRD A;  1T3O A;  2ROP A;  4Y34 A;  4JI5 J;  3UN3 A;  1TKZ B;  3HFK A;  1SC1 B;  4LSN A;  3JYT B;  1FVS A;  2UU9 F;  3MPW A;  4RNF A;  4P6Q A;  3W66 A;  3KWM A;  2B0G A;  2CXE A;  2BZ2 A;  3QRQ A;  4KO0 A;  1P1L A;  2DGO A;  1N4L A;  3AOC A;  2R8I A;  3LAM A;  3OTD A;  4B17 A;  2YWE A;  3C16 B;  3OFG A;  2JH3 A;  1NK0 A;  4NYP A;  4O3R A;  3WX8 A;  2HHH F;  2ERR A;  2BOA A;  5L8R C;  2AQ4 A;  4Q7A A;  2UUB J;  4WFB Q;  1EQM A;  2JEF A;  2E7X A;  3RG6 A;  1VQK S;  5IC4 B;  3BQ2 A;  2DY1 A;  4EU0 A;  4RUH A;  2CIM A;  2F8H A;  2GIR A;  4IDK A;  2NPF A;  1B0T A;  1RT3 A;  1EP4 A;  4X4O A;  1S1T B;  2JRS A;  2UZA A;  4NCG A;  2DH7 A;  4CO4 A;  1HA1 A;  2RU9 A;  4DUZ J;  4JI7 J;  2KFZ A;  1HD0 A;  2D7S A;  2OPR B;  2XY5 A;  1QDU B;  2UXC F;  1RWO B;  3DLK B;  2QL7 B;  3J7A 1;  2B7C B;  1BE4 A;  2U2F A;  3EDR B;  4LRD A;  4HH1 A;  2COL A;  1TMJ A;  2W7P A;  5HRO B;  1DLO B;  1HMV A;  4MK9 A;  4F26 A;  3E8O A;  1F5C A;  4J9Q A;  1FRJ A;  4ZIT A;  2OD6 A;  2E7V A;  2CJA A;  1KR4 A;  3V81 A;  1WC4 A;  3V6J A;  2VDI A;  1S9F A;  3Q8Y A;  3MD1 A;  2D3U A;  4ZCI A;  3VAF A;  1NPR A;  4HR2 A;  2NPI A;  3NAH A;  3GFY A;  3KLG B;  4LFC F;  1B99 A;  3BO4 A;  2UUA F;  2CPJ A;  3HFZ B;  1AZS B;  3AJD A;  4WPA A;  1YBU A;  1JLA B;  2VPW B;  5LMU F;  5KG6 A;  2RRB A;  5KFD A;  2OSR A;  4OX9 J;  5F41 A;  3KNG A;  4IRK A;  2PN6 A;  2GIQ A;  3CSK A;  3T41 A;  4HHJ A;  2AEM A;  2NUH A;  4LUB A;  3HPO A;  1SBR A;  2OEJ A;  5BYR A;  3T19 A;  1RAA B;  1TUG B;  3P45 B;  1HWK A;  2YY3 A;  1Q95 G;  1O0P A;  1QM9 A;  2HRY A;  2EW9 A;  1WEY A;  3DN9 A;  3US5 A;  2XI3 A;  2FVR A;  5CAA A;  2YKM A;  4YP3 A;  4PXE A;  1QE1 B;  3M8W A;  4M5D A;  4PXC A;  4B3O B;  4FPI A;  2VV5 A;  2W4D A;  2M52 A;  3EVM A;  3IO1 A;  4FP9 A;  1RZM A;  1U25 A;  2BM0 A;  2LA6 A;  2M4M A;  2CQI A;  3K5O A;  1VIO A;  5HMX A;  1R0B G;  4NLY A;  2NRE A;  2CKW A;  3RB0 A;  1HLW A;  2GW8 A;  2GML A;  2ILZ A;  3NKY A;  2UXB J;  3DLL Q;  2ZJQ Q;  1HBU B;  5K9F A;  3UN5 A;  2IM2 A;  4ED7 A;  4BBY A;  1C1C B;  2YNF A;  3KUE A;  1YIT S;  4IRD A;  4IUF A;  3DNC A;  4KB7 A;  3O8W A;  1DTQ B;  5DG7 A;  4M5L A;  3FEY B;  4HVZ A;  4B9L A;  3G9C A;  5CH7 B;  2ZH6 A;  1XC9 A;  4AND A;  3HI9 A;  1LKZ A;  3MUM P;  5DS7 A;  4HI1 A;  1TTH B;  2AJ0 A;  1TKZ A;  1LXJ A;  3PYE A;  5KFP A;  3MAH A;  2GCF A;  3W8G A;  2R8G A;  3CDU A;  4AE5 A;  2VQF F;  3EYZ A;  1EAR A;  1KEK A;  4WKR A;  3QMQ A;  1H2V Z;  1L3S A;  4RW4 B;  1S4F A;  2YX7 A;  3IA0 A;  1S4E A;  3DU5 A;  4HDG A;  1U1N A;  3C16 A;  1M5V C;  2WVE A;  4Q5V A;  5CYJ A;  5C24 A;  5GAE U;  3TAN A;  1SKR A;  1EKS A;  2GAG C;  3OBI A;  1YWX A;  2CRL A;  4YB6 A;  5THW A;  2QL5 B;  2DH9 A;  2AIR B;  4I56 A;  3W5X A;  3BF4 A;  1RAD B;  4EK2 A;  4AXJ A;  2I5J B;  3ENA A;  3M1V B;  5K5M A;  3SFG A;  4FKY A;  1SC3 B;  1Z1Z A;  1WEX A;  4QW9 A;  1DQA A;  1UA1 A;  4ED1 A;  2POK A;  1X0F A;  4DPU A;  3FC9 A;  1RAF B;  2FDN A;  2EG1 A;  3MMA A;  2W2Q P;  2OPR A;  4YHH F;  4PZV A;  3DLK A;  4Q45 A;  3GIK A;  2BQU A;  3ZTO A;  4JI2 J;  4X4N A;  5LL6 d;  1M90 T;  2PC6 A;  5B08 A;  3MZI A;  1RB0 A;  1YJR A;  5L46 A;  4DV7 F;  4WFN Q;  5HRO A;  1L5U A;  3MTJ A;  2G0J A;  1DLO A;  1U49 A;  4CQ1 A;  3HD2 A;  4WKY A;  2IVY A;  4CIO A;  4B9S A;  3W2W B;  4OZN A;  2LQJ A;  4ES2 A;  3SFU A;  2LXI A;  4ZDN A;  4CNY A;  2Z2M A;  1G3O A;  2OSQ A;  2MZT A;  2XYG B;  3D67 A;  2ZH9 A;  2ZH2 A;  1N6Q B;  3H40 A;  5K8M A;  2V4Q A;  3HO1 A;  4N8O A;  2OD4 A;  1Y5L B;  3KLG A;  4F7V A;  5E3P A;  4E8U A;  3AD9 C;  2OFH X;  4F04 B;  4ZN1 A;  1LEO A;  5CCM A;  2JLG A;  1NJX A;  1VQ9 S;  4KGV B;  4L3K A;  1FHT A;  2XWY A;  4J9M A;  1IKW B;  4UW2 A;  2XWX A;  4U9R A;  3ZTP A;  4B9N A;  2HVH A;  1RU1 A;  4WP9 A;  3QFW A;  2MHE A;  1VJW A;  1B70 B;  1Q78 A;  4DR7 F;  3TA1 A;  3MM6 B;  3KJV B;  4QW8 A;  1FJE B;  1OS5 A;  5KT5 A;  5AE2 A;  3D6T B;  3IBC B;  3EGW B;  2MQN A;  3DDI A;  4ZJL A;  1B3T A;  1PBU A;  1X9S A;  2CZ4 A;  3WX4 A;  5F9N A;  2L9N A;  1FDN A;  4N5S A;  3HVW A;  4X62 F;  4X64 F;  4NLX A;  2MQL A;  4CO3 A;  1VLO A;  2WAQ D;  4DS4 A;  4USJ C;  3MMC B;  2FZC B;  4IYQ A;  1QE1 A;  4DZD A;  1N88 A;  3L7U A;  4Y2A A;  1RAB B;  2IC3 B;  3K8V A;  4B3R J;  3T1Y J;  1UVN A;  4F4W A;  4LRC A;  1H74 A;  1N34 F;  2OKQ A;  4AYB D;  5KFC A;  1YJV A;  4EFA C;  2B4V A;  1JWW A;  3D3B J;  2R9L A;  3R7N B;  2BJ7 A;  2FHJ D;  1YIJ S;  4FYV B;  1C1C A;  2M8H A;  2HZC A;  1X8D A;  3K58 A;  1ZTT A;  2K06 A;  4CYU B;  4O4G A;  3IFE A;  3HCX A;  2YNH B;  4ICL B;  3TUJ C;  1RAG B;  3CD7 A;  2AW0 A;  2AZ3 A;  3IRW P;  1Y10 A;  2ZEJ A;  2R8J A;  1SH2 A;  3M6W A;  3LWM A;  2D3O 1;  1LWX A;  1MMD A;  3J80 Y;  1MU2 B;  1EHW A;  3NP5 A;  5D0E A;  1HAR A;  1RXO B;  2W01 A;  2W2N P;  3FKB A;  4C8N A;  4HHU A;  1KN6 A;  3UVJ B;  4DV3 J;  1SQG A;  2YTC A;  3FCH A;  2K7K A;  1WC1 A;  1Q7Y T;  1V6H A;  4JI4 J;  1JXV A;  2HHX A;  3VAG A;  1TKT B;  1B7Y B;  1C2P A;  4F0M A;  3MM8 A;  3AT1 B;  1ROF A;  2HZA A;  4DQQ A;  2W2M P;  4WE1 A;  3D0H E;  3FNN A;  3P6Y C;  4YR2 A;  5B0D A;  2KYX A;  3C3L A;  3SIP B;  1R6V A;  3NMR A;  1NLK L;  4KT0 C;  3H5U A;  2I5J A;  1TL4 A;  1YZ7 A;  2CZ9 A;  2YNG B;  1VRU B;  3FSI A;  4QPT A;  3I5C A;  5KT4 A;  4WU3 A;  3BSN A;  3FBC A;  4I2P A;  4QYZ J;  4OZ2 A;  2DHX A;  2ROE A;  4C8M A;  2KH9 A;  5K8O A;  3T6J A;  2F8E X;  1U0S A;  1BUX A;  4PRF A;  5D4N A;  1T02 A;  3M8Y A;  3UO0 A;  4L3N A;  3DDK A;  2X51 A;  3GLJ A;  2X3G A;  5HJY A;  4KHR A;  2OGU A;  3RBZ A;  2DGQ A;  3U02 A;  2WVF A;  2ZM6 J;  5J2N B;  2XSJ B;  1DAX A;  3D28 A;  4DR6 F;  5K20 B;  5F8I A;  4F4A A;  2AKW B;  1U0H B;  5I42 B;  2UXD F;  1DUR A;  4JI8 F;  1HQ2 A;  3PX0 A;  3EZO A;  1UVJ A;  1WOR A;  2FVQ A;  2EFN A;  4CLU A;  3CDB A;  3EJM A;  4PG8 A;  1YK9 A;  4OFZ A;  1Q8B A;  2DNP A;  4X66 J;  4ANE A;  1N6Q A;  3OL9 A;  1EIY B;  3CJQ A;  3BGL A;  2D74 B;  5D3G B;  1L3V A;  1Q8K A;  2XMM A;  2V34 A;  4CTA B;  1PJ7 A;  5GAG I;  2MEW A;  3KJF B;  1PYT A;  5L9N A;  4LQ3 A;  2AJF E;  3H90 A;  3VQS A;  1IKW A;  2Z2Z A;  3ELH A;  2C3O A;  2ADB A;  3D4J A;  4KKO B;  3OSP A;  1T95 A;  4OZL A;  1Q86 T;  4DSL A;  3UN2 A;  2J9D E;  3CCW A;  4V19 J;  1JX4 A;  3MM6 A;  5L1J A;  3KJV A;  3KLF A;  2VOP A;  2IBK A;  1X7V A;  2RHS B;  3PHE A;  4ZVH A;  1M5P C;  2EFP A;  2JDJ A;  1Q7L B;  1S10 A;  3QNW B;  3LP2 B;  1BQN B;  3P5T L;  4RBU A;  2DIU A;  2MGZ B;  3ZXW A;  3FRY A;  3ZTS A;  2C28 A;  4IG0 A;  1Y5I B;  4IG3 B;  4IFY B;  1U24 A;  5KFE A;  2Y8W A;  2FJE B;  4E2F B;  3HVA A;  1AXQ A;  3N79 A;  4X66 F;  4Q8F A;  5H1S V;  4D3H A;  2IC3 A;  1C0U B;  2YWG A;  1ZOT A;  2UVU A;  2A2D A;  1URR A;  2RDJ A;  2A2C A;  2HFZ A;  2QTW A;  1CEZ A;  3T9Z A;  1RT7 A;  1O8B A;  4WFZ A;  2DR6 A;  4QIW D;  5KFM A;  2Y3Y A;  1VR6 A;  3KXD A;  3L7P A;  2OTJ S;  4OL8 A;  4A46 A;  5EHH A;  2E5G A;  4QOT A;  4K7Q A;  1S9E A;  3VV2 B;  3O3L A;  2V6A A;  4QWD A;  4F3M A;  1TL3 B;  2FGO A;  4CYU A;  1WHW A;  2YNH A;  2MQO A;  4ICL A;  3R9L A;  4KGK A;  1FKO B;  4PUO B;  1CS4 A;  2VIH A;  4BDP A;  3CD6 S;  7FD1 A;  1L3K A;  1T9V A;  2B8Q A;  2D3Z A;  1DJ0 A;  3VHQ A;  3EX7 B;  2ZC3 A;  2PA8 D;  3NMA A;  3BYP A;  5CD4 A;  2VB6 A;  4NLW A;  1MU2 A;  4O4R A;  3DMJ B;  2A1B A;  2QG9 B;  2HHU A;  1KVI A;  4M5J A;  2GQQ A;  2PD1 A;  1WI6 A;  3BBC A;  5D4O A;  1HI1 A;  3CIM A;  1TKT A;  1BXN A;  3PW5 A;  3R6G B;  2F3J A;  1SC6 A;  2OPQ B;  3TVK A;  1FJC A;  1WD6 A;  2LA4 A;  1A0O B;  2DNH A;  1IJE B;  2PEB A;  3I87 A;  4OYM A;  2FLO A;  1DY3 A;  2RS8 A;  2WON B;  4ZJQ A;  3KK1 B;  1F5B A;  1KRP A;  2Q3P A;  1Z4U A;  2V67 A;  3G96 A;  4JI3 J;  3N9U C;  1S1W A;  2DTJ A;  3LWL A;  1RK8 A;  1NSP A;  3P4U B;  2MQM A;  2WSC C;  2XO7 A;  2YNG A;  1VRU A;  2DRB A;  1Q5Y A;  3QGI A;  4FYY B;  4RW9 B;  1VQO S;  3WDO A;  3TO8 A;  1R7I A;  2X1F A;  2RQC A;  3NWG A;  1I94 J;  2E5I A;  4N47 A;  2FVC A;  5E3A A;  5L9X A;  1SKW A;  3TVY A;  3TUP A;  4ERD A;  2NZC A;  4PKD B;  3BQ0 A;  3GCW P;  4ZK7 M;  1NKB A;  2IM0 A;  4CT8 A;  2VF3 A;  3Q8U A;  3MEK A;  5J2N A;  3AJ1 A;  4ECS A;  2VG6 B;  2MZR A;  1VOM A;  3SCL E;  1FES A;  2VA2 A;  4O0I A;  4B9V A;  4QWE A;  5I42 A;  4M94 A;  3CJK B;  2R7Q A;  2F4F A;  4CLY A;  5DLG A;  2DK2 A;  2VDH A;  4PAB A;  3IG1 B;  4WII A;  1R8B A;  3G8T A;  2QRR A;  3Q8P B;  4LVO P;  2DIS A;  4WFY A;  1QSL A;  2LEP A;  2YWH A;  1RWU A;  3GTY X;  2Q66 A;  4CTA A;  2VHG A;  1HWL A;  3JTP A;  1FEH A;  4FN5 A;  3QFH A;  3L7O A;  4UUX A;  4YY3 J;  3JSM B;  3TA2 A;  3UCU P;  2XZW A;  4Y28 C;  2XCP A;  2KXH A;  2NSB A;  3QO9 B;  4KKO A;  2F65 A;  1D3W A;  3SYZ A;  2MZS A;  2VG7 A;  2HGL A;  2VG5 B;  4FYW B;  3JXO A;  3BO3 A;  2LEA A;  4GKK J;  2MSS A;  1Y00 A;  3A12 A;  4H4O B;  4R25 A;  2K3I A;  2LXF A;  3P5B P;  2HBZ B;  1RUS A;  3QSI A;  5DG9 A;  5D0R A;  1ZA2 B;  2ABY A;  4F4Y A;  1HNW F;  3ZNU A;  2OO4 A;  4J9O A;  2GX8 A;  4NML A;  2A3J A;  2B9Y A;  5K8P A;  3PEJ A;  4I7F B;  2DD8 S;  4C3M A;  4DLG A;  2HVI A;  1ZZN A;  3LP2 A;  3SBM A;  2CJK A;  4MKV A;  2FQQ B;  3HDS A;  3RAM A;  2MGZ A;  3KK3 B;  3PEH A;  5HVG A;  4W90 B;  5DJB A;  4IG3 A;  4IFY A;  4MIW A;  2CPH A;  1B4S A;  4IO9 Q;  4QIE A;  1FKP B;  3QYY A;  1C0U A;  2A18 A;  3HZE A;  5EWF A;  2IJR A;  4LR7 A;  3I0S B;  1PIE A;  3SSQ A;  3KHH A;  4ED0 A;  2ADC A;  1GTE A;  2UV8 A;  5F8G A;  4P71 A;  5AJ3 F;  2D69 A;  3CDW A;  4EEY A;  4YY3 F;  5HAO A;  1SJR A;  2GJF A;  1HWJ A;  2XTJ P;  3MUV P;  2ZH1 A;  4DV4 J;  3N6L A;  3UR3 C;  4XIU A;  3CCT A;  3MR7 A;  2W4C A;  3OPK A;  4WBF A;  3R5C A;  2IM3 A;  5HQM A;  2JX2 A;  3K57 A;  1TL3 A;  4ES3 A;  3GFH A;  2IJN A;  4ZA1 A;  4K8R A;  4PUO A;  3FK4 A;  4FKX A;  2NXJ A;  4ZVQ B;  4WP8 A;  2PT0 A;  5H9E J;  1IN0 A;  3EMT A;  1R8H A;  3NNA A;  1X4G A;  2ZJR Q;  1NRK A;  2B56 A;  4U67 Q;  5KFG A;  4AT1 B;  3FSX A;  4ER8 A;  4X4U A;  3JQK A;  4OYW A;  1JKH B;  3AXK A;  2N3L A;  2HQ3 A;  1XQI A;  5GAH U;  5E7O B;  5HI7 A;  2J76 E;  4TXS A;  3I9V 9;  3CJ8 A;  3A8J A;  1NXI A;  2CQ4 A;  2M0G B;  3DGV A;  3I9Z A;  2FZK B;  4ELV A;  1KDN A;  3HHD A;  3QBC A;  2P6S A;  1S0N A;  4EO6 A;  1X31 C;  1GX5 A;  4ES1 A;  4NXM F;  3GV8 B;  3R2D J;  2WON A;  3H20 A;  3KK1 A;  1H38 A;  3MPU B;  3PKM A;  1QAI A;  3UPF A;  3IWL A;  4J5O A;  4GO7 X;  4DV4 F;  4PG7 A;  3JSR A;  1IKX B;  4A8S A;  2G0C A;  4OMF G;  1NH7 A;  1XNQ F;  2HQC A;  4ATN A;  2R3V A;  2Y0S D;  1RU2 A;  1UPM B;  3LAK A;  3KTQ A;  4RW9 A;  1J2V A;  4A8X A;  1B0V A;  2KO1 A;  3H0P A;  1XR7 A;  5D4L A;  1W7W A;  4C97 A;  1FFW B;  2HHV A;  4WYW A;  2AF6 A;  1F0X A;  4NMX A;  3TAM B;  4BC7 A;  4LBH A;  1R89 A;  4DLE A;  2UVW A;  1XNR F;  2V4J B;  4FVM A;  5KFX A;  5JJB A;  2Q6C A;  1VQ6 S;  2VG6 A;  2UUC F;  2GVZ B;  5DDO C;  3CVK A;  2ALZ A;  6FDR A;  2CQ1 A;  1BC6 A;  5J2M B;  4HT7 A;  1TV6 B;  4RUB A;  3CJK A;  1RTH B;  5AXK A;  4FNI A;  2AGP A;  3QWP A;  2J8S A;  3ZTR A;  3TA0 A;  4MKY A;  3IG1 A;  4NXN F;  1PAU B;  2QV6 A;  1X5P A;  4YME A;  4X4P A;  1RWV B;  4GMK A;  3T1H F;  4KPY A;  2OH2 A;  4RO0 A;  1TK0 A;  3H5S A;  5KOX A;  1BMQ B;  2C3Y A;  3EGN A;  3PR5 B;  2E5H A;  1SB6 A;  4AXI A;  2ZH7 A;  4PG5 A;  4AQY F;  3TP2 A;  1D8Y A;  2A6M A;  1WDD A;  1YGY A;  3DLJ A;  1FI4 A;  3H2U B;  4DPO A;  3MAA B;  2HYI B;  2QLF B;  3JSM A;  1K73 T;  4QBU A;  2V5H G;  3LOU A;  4X65 J;  1WNE A;  3C6U B;  4N56 A;  3OL6 A;  1RT1 B;  2I6W A;  3JSB A;  2VG5 A;  2K1R B;  3TAP A;  2JC0 A;  1ITP A;  1ULR A;  5C42 B;  4YB7 A;  2PMH A;  4JI1 J;  3M6X A;  3NS6 A;  3CTR A;  4TY9 A;  1Q5V A;  2LVW A;  3OLB A;  4OYI A;  4LF8 J;  3H5Y A;  4NRU A;  1NHU A;  5A76 A;  1VBZ A;  1GH8 A;  2XUL A;  1BQM B;  1K47 A;  4I7F A;  2WW4 A;  1HHS A;  2V63 A;  1ZS6 A;  3H98 A;  4DR2 F;  2XS5 A;  3L9Z A;  1ARO P;  2F8M A;  3KNA A;  3OVS A;  2KXF A;  4J37 A;  1OQ6 A;  3UDV A;  4WP3 A;  2GMJ A;  2NLW A;  3DKD A;  1A6L A;  3FJ2 A;  3E2E A;  3GQC A;  1FKP A;  3FMB A;  2F4V J;  3X1L B;  3O44 A;  4TNO A;  4ZP6 A;  2CPE A;  3I0S A;  4LRF A;  1WAC A;  3LAN A;  3C8Y A;  3MR6 A;  3K0J A;  2P9C A;  4HKQ A;  1HW8 A;  4UQT A;  2BOP A;  2XMU A;  2KM8 B;  3NGS A;  3IC1 A;  4FYX B;  1FF2 A;  3KJN B;  2DHG A;  2C22 A;  2JVR A;  5FD1 A;  1X60 A;  1P9Y A;  3VR1 A;  2VKR A;  4F8R A;  2DNY A;  2IYI A;  3R6L B;  4WTO B;  4JI1 F;  3OQ2 A;  3RRH A;  3NLC A;  1HHQ A;  5LMN F;  3QRP A;  2IAJ B;  1CUL B;  3DDN A;  2OEL A;  4N77 A;  2CZV C;  1CBK A;  4ZVG A;  3V6D B;  4QR1 A;  1OIA A;  1U1M A;  1HWI A;  1PAE X;  1QVG R;  1JKH A;  4KHP J;  5EX0 A;  3OVB A;  3RB3 A;  4F50 A;  1SL1 A;  3MEE B;  3HJF A;  3MD3 A;  1FXR A;  4I64 A;  5KG2 A;  4O3S A;  4Q8E A;  4ECZ A;  3HKW A;  3RAQ A;  2RRN A;  3QWU A;  3G4S S;  3D7S B;  2IBO A;  2C2N A;  1T11 A;  2XNQ A;  2Y0B B;  2PMZ D;  3LA0 A;  3M2V B;  3DLH A;  1NDL A;  3DOM B;  4P2X A;  4EBE A;  5KOW A;  1JXL A;  1HYS B;  2DRA A;  4F2S A;  3M32 A;  4NA2 A;  5BJR A;  1YSJ A;  4I6A A;  1K1Q A;  1IKX A;  3OVA A;  4OHV A;  5LXR A;  2BVZ A;  4OX6 A;  2O1P A;  2VBX A;  1NPK A;  2CG4 A;  2QEX S;  2WHO A;  2HBY B;  1AT1 B;  3B4D A;  2VQE F;  2OHD A;  4F2R A;  3K59 A;  4DR3 F;  4UF4 A;  3S1T A;  2CQG A;  4BLG A;  3DC2 A;  2QSW A;  3NAI A;  3SCJ E;  3TAM A;  2R8K A;  3W5Y A;  4NWB A;  1XMQ F;  5ETR A;  2V4J A;  3K5L A;  3FVY A;  5L1L A;  3NOC A;  1F1B B;  4C3L A;  4DL3 A;  4KE5 A;  3UD5 A;  2GMH A;  4P7T A;  5J2M A;  4Y0F A;  2W9B A;  1ZPV A;  3AJ2 A;  4MK8 A;  1TV6 A;  1YJN S;  4LF7 J;  3PJW A;  1RTH A;  1FX4 A;  1FER A;  1K0T A;  3NGR A;  4EBC A;  5G0R B;  2IDL A;  2B51 A;  4B3M F;  3EGZ A;  2R7R A;  1XR6 A;  4I6Y A;  3LF0 A;  2OML A;  3W3S A;  1Z2L A;  2EK6 A;  2FHJ A;  4RW6 A;  2RML A;  4O3Q A;  5LT5 A;  2WOM B;  5I3P A;  5EUH A;  3JSY A;  4LF4 F;  3BGU A;  3DI6 B;  1IWG A;  3MAA A;  4ID8 A;  2WSE C;  3B8H A;  3U1L A;  2BAN B;  4ZLN A;  3LUY A;  3QSY B;  1HWU A;  1G2E A;  2VBZ A;  3UD4 P;  2R7T A;  3C6U A;  1TL5 A;  1Y4Z B;  1RT1 A;  1S0M A;  3B78 A;  4RX6 A;  3UR0 A;  2GGP B;  1VDH A;  4NL5 A;  2LCW A;  4JI6 J;  2K1R A;  2XQC A;  2QMU B;  2JC1 A;  1SKS A;  3MMB B;  4DR1 J;  2MMY A;  2IHR 1;  5E33 A;  5CAB A;  3HF5 A;  5F8L A;  1QAY A;  3PHT A;  3OLA A;  2QO3 A;  3N6M A;  3BSO A;  2DXE A;  4QQB A;  4LF2 A;  3KHG A;  1LXN A;  1HNX J;  2CG8 A;  2N4D A;  4P2S A;  3OR1 A;  1NHV A;  1T9X A;  2QLW A;  2VFV A;  3D6M B;  1BQM A;  1LNQ A;  1NZA A;  2J6T A;  1C1B B;  4QIV A;  4ILL A;  4DV6 F;  4J7C A;  4LF7 F;  1TR0 A;  2V4R A;  3FQK A;  1XIQ A;  2W9C B;  2OTL S;  1FDB A;  1FDA A;  2BR0 A;  3GYG A;  2LYV A;  2ZH3 A;  1S48 A;  3J7Y U;  3FBE A;  2BX6 A;  5IZH A;  3GV5 B;  1NAQ A;  1U4B A;  4K4Z A;  3M6V A;  1VCT A;  2ZIT A;  3W63 A;  4AUK A;  3N5B A;  3FBF A;  3SCI E;  4J9R A;  5H9F K;  1VQY A;  3KHL A;  4OHZ A;  3VQT A;  3PYF A;  2CDR B;  3A13 A;  2ZDP A;  3Q8R B;  3UI3 A;  3HXM A;  2XEX A;  2NUU G;  4K59 A;  2RRA A;  3FBB A;  1KBR A;  2CPD A;  4NLS A;  1U6F A;  3IR6 B;  1TVR B;  4DFM A;  2J7K A;  1R0C B;  3U1M A;  1S6P B;  2CWK A;  2HND B;  4URG A;  1SQF A;  3RRK A;  2IAJ A;  1CUL A;  2MKS A;  1N54 B;  1H7X A;  2J9C A;  1HNX F;  2CPI A;  4AD6 A;  2C2D A;  1QUP A;  2EFQ A;  2I8E A;  3CJR A;  1FD8 A;  1AUS L;  3LGM A;  3MDF A;  3V6D A;  1FXL A;  2DPJ A;  2AV5 A;  4ZPW R;  2DH8 A;  1UP1 A;  1WOS A;  3MEG B;  5JUM A;  2XY7 A;  3BH6 B;  3CMA S;  2PFF B;  4USH A;  4EO8 A;  1EX8 A;  3AA9 A;  4ID5 B;  3C14 A;  4QYR A;  2AJ2 A;  1RAE B;  1PC5 A;  2HS0 A;  4LSL B;  4GVB B;  4ZVE A;  5KFJ A;  4ECV A;  2ZBQ A;  4RPF A;  3TW0 A;  3M2V A;  4QCL A;  2KJW A;  3DOM A;  2R7W A;  2I38 A;  1FFG B;  4Q43 A;  4DX8 H;  4HYK A;  1L3U A;  1HYS A;  3R27 A;  1YRU A;  2VBW A;  2PMW A;  3R5B A;  4DCO B;  2MY7 A;  2BAC A;  2A6O A;  4DL6 A;  2BQ3 A;  3WIU A;  4ECW A;  5B7W A;  3KLE B;  5CZX A;  4DN9 A;  1FRK A;  1P8G A;  4DV0 F;  5KT7 A;  3W9I A;  6AT1 B;  1FD2 A;  3GJT B;  4IOB A;  4DU7 A;  2DHA A;  3CCQ S;  1X4C A;  4UOH A;  1U2C A;  3EZ5 A;  3RJM B;  1N5Y B;  4OZ1 A;  4TYB A;  4TY8 A;  4ZIV A;  5DM6 Q;  1X5T A;  2KL8 A;  3GON A;  4DSK A;  2GS8 A;  5CA5 A;  1GTH A;  3D2W A;  1RWW B;  3A3N B;  1ZM4 A;  4MFB B;  1SKU B;  3E01 B;  5EDW A;  4NYO A;  2RIL A;  3I32 A;  5GAE I;  3ZZU A;  5G0R A;  4C8O A;  2QE5 A;  1JQG A;  5ETT A;  3RW7 A;  4NLO A;  4LFB F;  2MKK A;  2FYX A;  3DRS B;  4G1I A;  1C4A A;  4MK7 A;  2CPX A;  1BQX A;  2AWZ A;  2WOM A;  2KVQ E;  1R8C A;  2XZD B;  2YVS A;  2FC8 A;  1P27 B;  1KQF B;  4IR9 A;  3DI6 A;  5A6W A;  3BEG B;  3GJQ B;  2APO A;  3O6Q A;  2ZKT A;  3GPA A;  1YZ6 A;  2BAN A;  2ZKU A;  1M5O C;  4B3T J;  2YWW A;  3I0R B;  5IWA J;  3PRV A;  4A4J A;  1OJ4 A;  2ZDO A;  3BKU A;  3NS7 B;  3M8R A;  5AXN A;  2ZD1 B;  3RW6 A;  4OQJ A;  3W8P A;  4C0O C;  4DZ6 A;  1UJ4 A;  3MMB A;  4DV2 J;  1N33 J;  1U8S A;  3RRG A;  3OTO F;  4BHQ A;  2E5L F;  1IQZ A;  2IMW P;  3EXC X;  1IUJ A;  3H25 A;  2HQG A;  3QRR A;  3AOB A;  3WC2 A;  4X2B A;  2IVF B;  1RHK B;  1HBN B;  2XSF A;  1GX6 A;  2CFX A;  4WF9 Q;  4FXW A;  1FNX H;  3PY8 A;  1F2H A;  2B43 A;  3I56 S;  3C2P A;  1FK9 B;  4UQG A;  2FVS A;  4WIQ A;  3PRB A;  1QVF R;  5ADZ A;  2DNG A;  5U47 A;  2R2T A;  1XMO J;  2GVD B;  4PPZ A;  4WTY A;  5LXY A;  4HTI A;  2D3O R;  4RR5 A;  4ED4 A;  5D0G A;  1XN9 A;  2F63 A;  2KT2 A;  2HIQ A;  2YQ0 A;  1RTI B;  3CME S;  2HFO A;  3IR7 B;  1NK8 A;  2F40 A;  3R97 A;  3GIL A;  4ZVT B;  1IR1 A;  2QA4 S;  2W7A A;  1WKK A;  3TOQ A;  5B0C A;  2UP1 A;  4IO1 A;  1IBM J;  1KWM A;  2MZ1 A;  3C6T B;  1B64 A;  2KJV A;  1FXD A;  2W24 A;  3MCN A;  3LAL A;  5HL7 Q;  1HNI A;  5EWG A;  1H72 C;  1RYR A;  1TVR A;  2F7V A;  2KKH A;  5F3Z A;  1S6P A;  2XMA A;  2HND A;  2CQP A;  3MR2 A;  1U02 A;  4DV5 F;  2CQH A;  3CJ4 A;  3UW1 A;  2V50 A;  4UOC A;  3CJ3 A;  4QIG A;  1SIZ A;  3CCJ S;  5FDL B;  4CLP A;  2ZJP Q;  3EXY A;  4KRW A;  3BZQ A;  1R27 B;  1VQ7 S;  1D9D A;  3MEG A;  3LO3 A;  2NSC A;  5IOL A;  3DRP B;  1TU0 B;  2X1B A;  2GHW A;  3AD7 C;  5K14 B;  2UVR A;  4OZ3 A;  4OYX A;  5A8R B;  4F4Z A;  4ID5 A;  2GA7 A;  1H6K X;  1WI8 A;  3QAT A;  1QTM A;  1KKH A;  4LSL A;  4KAI A;  1JJC B;  4GVB A;  4IH5 A;  2QLX A;  4WWS A;  4M5G A;  4LT6 A;  1GXU A;  1FRM A;  1WHX A;  5J1P A;  2UUT A;  1MG7 A;  3CCL S;  4WU2 A;  1ICE B;  3Q0A A;  1NBE B;  2MKI A;  2ZE2 B;  3OHA A;  2MKJ A;  1UVK A;  1SUQ B;  2ZBC A;  5BR8 J;  2E44 A;  1HPZ A;  1VMB A;  1YHQ S;  4OLO A;  2DNM A;  5A0Y A;  1FWL A;  2LEB A;  1UW4 A;  1VFJ A;  3BR9 A;  2VOD A;  3DLE B;  2XZT B;  5A2Q Y;  1ZZF A;  1HBM A;  3O2I A;  4BWJ A;  3TZW A;  5DQI A;  4Y2C A;  4E98 A;  2FZG B;  2ASD A;  1T0T V;  5CYQ B;  5DDQ C;  1X4E A;  2QL9 B;  3QAE A;  4FF3 A;  3Q8V A;  1JMT A;  4DQI A;  4GKJ F;  3NBP B;  1VGY A;  3MHY A;  3C46 A;  3K5N A;  4DL4 A;  1R0A A;  4UT4 A;  1UET A;  3EE3 A;  5HSP A;  2UU9 J;  2BAB A;  2J0X A;  1F6T A;  3IAM 9;  2CJ9 A;  3CCS S;  3ONQ A;  2NXC A;  2GHV C;  3WBZ A;  3DRS A;  4V1A k;  5C5J A;  3MM5 A;  2XYP B;  1LV5 A;  1HHT P;  4RBT A;  2HHH J;  2EC0 A;  3GMG A;  3CCV S;  3JAM Y;  5H9F J;  4IH7 A;  4M5K A;  3R5A A;  2RKI B;  4UUW A;  5DG8 A;  1PJ5 A;  4A8K A;  2FB0 A;  4MIB A;  1M1G A;  2XM3 A;  2L08 A;  3I0R A;  3DU6 A;  2ATL A;  2V2K A;  5ETM A;  5JMN A;  2ZD1 A;  1GAO A;  3NS5 A;  2QA4 G;  4KTQ A;  2YH0 A;  4F4K A;  2RU3 A;  2CJQ A;  3H8Y A;  5KT6 A;  3QID A;  5A8K B;  1TP7 A;  5I4M A;  1OPI A;  1N36 F;  5CQG A;  4WFX A;  2ZHB A;  1UCN A;  2UXC J;  3VAJ A;  3QGG A;  4DBQ A;  2BJ8 A;  2HS3 A;  2ASY A;  1FK9 A;  2F1F A;  1NSA A;  2CQ3 A;  2G1D A;  2GNK A;  4DL2 A;  4HDH A;  1TUW A;  4U8V A;  2QFJ A;  3Q89 A;  4Z7Y A;  5CXT A;  2U1A A;  3GYX B;  4RU9 A;  2CVE A;  2GVD A;  3OR2 B;  3G8S A;  1LW0 A;  1FJ7 A;  2LEC A;  5KFQ A;  2BKP A;  2C3U A;  2KG1 A;  1T03 A;  1U6B A;  4DDF A;  2DNR A;  1RTI A;  2OMO A;  5SZT A;  4C11 B;  3M6U A;  3HHN B;  2XYH B;  2E9Z A;  4CNZ A;  1FX2 A;  5F8J A;  4NCB A;  1PO6 A;  2C2Z B;  4NX9 A;  1NO8 A;  5D15 A;  5CYM B;  2HBQ B;  5KFK A;  3ZFV A;  3ISN C;  4LFC J;  2XI2 A;  2Z56 B;  4YQW A;  4Z37 A;  3PW2 A;  2UUA J;  2ZHA A;  4UZB A;  1HI0 P;  2VC1 A;  4L73 A;  4RUA A;  3JQM A;  5GAG U;  4NRT A;  1S0O A;  5KG4 A;  3VVT A;  2B5J B;  2DNL A;  1KQG B;  5ETN A;  2QYC A;  5LMU J;  3DYA B;  4ZHR B;  5J2P B;  2XS2 A;  3TQ1 A;  2XHW A;  2XGP A;  1P1T A;  1CQN A;  1S76 D;  3FMW A;  4ILR A;  1TKD A;  3VAI A;  5FDL A;  1RBO B;  1LK5 A;  1WF2 A;  1R8A A;  2KYZ A;  4F67 A;  3KJQ B;  3MCS A;  2LP4 A;  5KG3 A;  3QT6 A;  5HLF B;  2HNZ B;  3KUG A;  3KLH A;  4IOA Q;  2HNY B;  1K8A T;  3DRP A;  5K14 A;  8AT1 B;  4PR6 A;  4FDF A;  5A8R A;  4RW8 B;  4FF1 A;  5IM0 B;  4Q0B B;  1MML A;  3T5K A;  5GME A;  1H2T Z;  3LGN A;  3PIO Q;  2IDE A;  1JXE A;  3FEX B;  1LOU A;  3OXL A;  2W1B A;  4YB1 P;  3HP6 A;  3CUN A;  5KT3 A;  1PC4 A;  5IV3 A;  3BR8 A;  1HBO B;  2BE2 B;  3OTB A;  1SUQ A;  3A8K A;  2PEH A;  3VGS A;  1RWN B;  3S7R A;  1V5V A;  1MN9 A;  2XNR A;  4HH0 A;  1FCA A;  1WDT A;  2RUG A;  3M2U B;  1GMV A;  3S6E A;  2J7U A;  1FE4 A;  2BV3 A;  5I3Q A;  4RNN A;  4QYZ K;  1WKL A;  4AFF A;  3EIC A;  4OJ3 A;  4ZKA A;  3GB0 A;  3VZI A;  2CNO B;  3BN4 A;  3W62 A;  2BJ1 A;  4J9L A;  2YKP A;  1JLE B;  4FBT A;  4ZJO A;  5CYQ A;  2OJ3 A;  2DR8 A;  4OV6 A;  4DX7 A;  1E6Y B;  2RD5 C;  1VBK A;  5KG5 A;  3SDE B;  5CCL A;  1RT5 B;  1IM4 A;  4I0W A;  1X4F A;  3NBP A;  1EJ7 L;  1VQS A;  1BHN A;  2YX1 A;  5JVG Q;  2HMI B;  2OEK A;  4PXD A;  1JLB A;  4JV5 F;  1JJ2 R;  2VQF J;  1RI7 A;  2FC9 A;  2GZO A;  4NCA A;  4UY8 T;  2CWX A;  2HFU A;  1NND A;  4X4T A;  3CJS A;  2HEK A;  1MMN A;  3IAS 9;  5DDP C;  2ZOM A;  4QIF A;  1RTD B;  1CJT B;  2CVI A;  5M2U A;  1IM6 A;  2XO6 A;  5IFM A;  3FZB A;  3OFE A;  4NLD A;  2XBP A;  4XDD A;  3LW5 C;  1U1R A;  3Q22 A;  5ETQ A;  3CCZ A;  4Z2X A;  3TZZ A;  3D1Q A;  4A48 A;  4J9V A;  4B9M A;  3CJ5 A;  3QZ8 A;  2ZZT A;  3ZZZ A;  3G82 B;  4R5P B;  4ILM A;  1LWE A;  4J91 A;  3R8Y A;  2KDO A;  4P52 A;  4C4W A;  2BJ3 A;  3MFH A;  3AB2 B;  2P9E A;  4OHX A;  2DEJ A;  3SI8 A;  2FLP A;  2G2Y A;  5KFT A;  4BC9 A;  4RNH A;  3EPG A;  2EKN A;  4DF8 A;  2DCL A;  1UFL A;  1BGX T;  2DKO B;  4DPW A;  3OL8 A;  3M8P B;  4YHH J;  4RWX A;  5JXS A;  5HVF A;  2PSZ A;  5A8W B;  3VF0 B;  1IJF B;  2H4Y B;  5E2Q A;  5IT9 Y;  3JYT A;  3N5F A;  4EWT A;  2HFN A;  2V8V A;  1QTN B; 
#chains in the Genus database with same CATH homology
 2QV6 A;  1WC5 A;  4CLU A;  1TL7 A;  1WC6 A;  3ET6 A;  4WP9 A;  4UST A;  4OZ3 A;  3R5G A;  4WP3 A;  1CJT B;  1WC4 A;  1YK9 A;  2GVD B;  4OYX A;  1U0H A;  4OYZ A;  3MR7 A;  4NI2 A;  4OYP A;  5D0G A;  1AB8 A;  1CJK B;  4CM2 A;  5D0R A;  4CLK A;  3C15 B;  1CUL A;  1CJT A;  3MAA B;  4OYA A;  4CLW A;  4WP8 A;  1CJU B;  1FX4 A;  4OZ2 A;  3C16 A;  1CJV A;  1WC3 A;  4USV A;  4OYB A;  4CLF A;  4CLY A;  3G82 B;  3C14 B;  5D0H A;  1AZS B;  4CLS A;  4P2F A;  4P2X A;  4WPA A;  1Y10 A;  4OYM A;  1YBU A;  1Y11 A;  1TL7 B;  2GVD A;  4OYW A;  3ET6 B;  4USW A;  4P2M A;  2BW7 A;  1YBT A;  1CS4 B;  1CJK A;  4NI2 B;  3C14 A;  1AZS A;  4OYI A;  5D0E A;  2W01 A;  3UVJ B;  2GVZ B;  4CLT A;  3C15 A;  3MAA A;  2WZ1 A;  1WC1 A;  4CLL A;  4CLZ A;  1CUL B;  1CJU A;  4OYO A;  1CS4 A;  4USU A;  4CLP A;  4CM0 A;  1U0H B;  5IV4 A;  1FX2 A;  3UVJ A;  3C16 B;  3G82 A;  2GVZ A;  5IV3 A;  1WC0 A;  1CJV B;  5D15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...