2GVDB

Complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with tnp-atp and mn
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
189
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase
molecule keywords Adenylate cyclase type 5
total genus 54
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvdB00
4OYWA 3C16A 4CLWA 4P2XA 2GVZB 4CLLA 3C16B 3R5GA 4OYXA 4WP8A 5D0EA 3MR7A 4P2MA 4CLFA 1WC1A 4CM2A 5IV4A 1YK9A 4OYOA 2GVDB 4OYMA 1WC5A 1CJUA 4CLUA 4OZ3A 1CS4A 4CLSA 4USWA 1WC0A 2GVDA 4OYPA 1FX4A 4CLZA 1CJUB 1CS4B 4NI2B 4OYAA 4USTA 5D0RA 4OZ2A 2W01A 4NI2A 4CLKA 1FX2A 1Y10A 4WP9A 1CULA 3C14B 1U0HA 1CULB 1Y11A 4USVA 3C14A 1U0HB 1CJKB 4WP3A 1CJVB 3MAAA 4CLPA 1CJKA 1CJVA 1TL7B 3MAAB 4OYIA 4CM0A 1YBTA 1AB8A 1TL7A 4WPAA 1CJTA 4OYZA 3UVJA 2QV6A 1AZSA 5D0GA 1CJTB 3UVJB 2BW7A 1AZSB 3C15B 1YBUA 4OYBA 3C15A 4P2FA 4CLTA 4CLYA 1WC3A 3ET6B 2WZ1A 1WC6A 1WC4A 3ET6A 4USUA 3G82B 5D15A 5D0HA 3G82A 2GVZA 5IV3A
chains in the Genus database with same CATH superfamily
3VGVA 1O0PA 3UQSA 3TUPA 4JV2A 2F3JA 1Q8KA 3MEKA 5ETPA 1UPMB 3W9HA 3HCXA 4WFXA 3BQ2A 2OGUA 4HR2A 1FJEB 3GIKA 1WDDA 3JYTA 1AW0A 4K7QA 4PXCA 3NGKA 3BPSP 1BQMA 4DZ6A 4J9PA 1UVLA 3QWPA 4B3OA 2HQCA 3MURP 3MR7A 4C0BA 1K44A 3FBBA 4R5PB 3SZ2A 4Y2AA 3J80Y 3KK1A 2X3GA 2PN6A 3W8GA 3HM9A 2G2OA 3CO0P 5L9NA 1B64A 1X5OA 5E7OB 3K5NA 1CC8A 2MKJA 3LP1B 4X62J 4RNOA 1JLCA 1IQTA 2F4VJ 2FUG9 1S0OA 2P2CB 4X66F 4DQPA 2CNNB 2XMJA 2LMIA 4CLUA 2G4BA 1FJ7A 2CPEA 1RWMB 4CO0A 1S49A 1BQXA 3TW0A 1O6XA 2V8HA 3DLKA 2MZRA 1KEKA 5A2QU 5J2PA 1V3RA 1ZYQA 4Y2MA 1DLOB 4C8LA 4A47A 2RE1A 4HT7A 2EC0A 5AJ3F 4IOCQ 1M90T 3TVYA 5K14A 5KFOA 2MQQA 2W7AA 1X4EA 5T14A 2IYIA 2GMLA 4QIEA 5F9LA 1QJHA 2IC3B 3QZ7A 2DR7A 2NR0A 2LDIA 5D8HB 4H4MB 3J7ZT 2Y8YA 2HNDB 2VKRA 5IC4B 4YUDA 1XJWB 4B3MJ 4DJBA 4KGKA 3ETOA 3NOGA 1EB0A 1R7IA 1XR6A 5KG1A 1OPZA 5FD1A 2GFFA 4ECVA 2ATLA 3QJPA 3B6BA 1ZM2A 2RSQA 5A6WA 4ZJQA 3CUNA 1REGX 5DDRC 3R5CA 1IVZA 3M4XA 2F5GA 1RAEB 3MCOA 1LV5A 3KJVA 4U8YA 1VMBA 5A8RB 1SUQB 1U0HB 2NSCA 1OMSA 4H4OA 4KFBB 3TQEA 4DLEA 3ZTSA 3OVBA 2OEKA 1JLGA 3BBBA 2DNQA 3POTB 4C0HA 3ZZZA 2XZTB 3D6HB 4CRJA 3BYRA 2JLGA 4QOTA 3MDFA 4CQ1A 4ZK7M 3GYGA 1FWKA 5KT5A 1FE4A 1R8HA 3IWNC 3MXHP 3KLIB 2QMWA 4ECSA 4O3PA 4LSNA 5M2PA 2WTFA 1TL7A 1ZAWA 5BR8J 1R0AA 4A46A 3CO9A 3TR5A 3WDOA 4K4YA 3DI6B 5LMUJ 3MOZA 2QC3A 1N6QB 2L08A 3HX9A 1U47A 4N8OA 1FD2A 4USJC 1RT7B 1YX2A 2P9CA 3SXLA 3UVJB 2W9CB 1T9WA 2OPSA 2J0WA 1JXLA 1AZSB 2KB2A 1LWEA 1B0PA 2AP6A 3I9V9 1FDAA 1HBMB 3PDNA 5KFBA 2IY5B 3T3FA 2BDPA 1RAJA 4MTPA 3UDEA 4Q2MA 4C98A 3MWBA 1M5OC 2NREA 5EUHA 1ZA2B 5ETVA 4EZ9A 1JJHA 4M5MA 4NXMJ 3C15A 1SC4B 5KFAA 2MJNA 2VODA 3MMAA 3GSDA 1Q86T 3M8PA 1HA1A 3Q8RB 2ADBA 2AGPA 2UV8G 2ZZNA 1IKWB 5CYJA 5HQLA 2XGQA 4FS1A 4AQYF 3KMQA 3M9MB 4TY8A 2HFOA 3UE2A 1HBUA 3FKBA 4NZ0A 3W2WA 1R3NA 3K58A 2HBRB 4NLUA 3DLEB 4X4TA 4KH1B 2GO9A 4HTIA 2FVCA 4HH0A 3M1VA 2BE2A 2KU7A 2JC0A 1R8CA 4AT1B 4ECYA 2F9JA 1AYEA 1VS3A 4WU2A 2YWKA 4Z2XA 3TAPA 1U1QA 2LA4A 1UW4A 3D6MB 4RKUC 1I3OB 1EJ7L 1Y3JA 2HZCA 4UUXA 2AT1B 2VPZB 3M6VA 4KYZA 3IG1A 2BVZA 5CHCB 4I69A 3A8JA 4C8NA 3PR4A 3PW0A 3GCXP 3DMJA 1NKEA 1UJ4A 1H38A 1WEXA 2A18A 1J5EF 3H20A 4C2MA 2FJAB 2LA6A 4ILRA 5L38A 3H5SA 3PHTA 4CZCA 3EJMA 3HHLD 2H54B 4BBYA 3M7VA 2EKNA 1RI7A 3J80U 4AYBD 1XR7A 2DXFA 5BYSA 5AXKA 2MKCA 1HNIA 1JLQB 2XGPA 4CO3A 3JTPA 4DV5J 3MMCA 1N5TA 1GMVA 1VBZA 4HDGA 5SUHA 1UPPA 3TRGA 1YG0A 4B9TA 1S1TB 4B9UA 2E5GA 4KE5A 5DDQC 3GIMA 1FD8A 5CCLA 5JMNA 4LIRA 1RTJB 1FX4A 3DOKA 1S59A 2QX0A 3M30B 4JI4J 2E7XA 5DDOC 3EVOA 2F8HA 5LJ5Y 5JUMA 2GGPB 4RBUA 2IBKA 4EFAC 5E3PA 1T95A 2VKZG 5DQGA 4NLPA 1SKUB 1OY8A 2DYAA 3DLGB 3M2VB 2CJKA 1VQ4S 3VQSA 3T19A 1SI9A 1YWXA 5IC6B 3ZZYA 3LGNA 4W92B 2UXBF 3NCQA 2BKNA 1U1KA 2VFSA 4DX7A 1X4AA 2VC0A 1K8AT 3LP0A 2QSFA 1BD6A 4LR8A 1T9XA 2DB1A 3DKDA 3G2XA 1GTEA 3BSOA 2XSFA 1AA1B 5CYQB 1S6PA 4ED7A 5A2QY 3QO9B 3CC2S 3MZIA 2XMVA 4OZLA 4X4UA 3O8WA 1HL6A 2VG7A 1IKXA 3R5JB 4ZVSB 3EZ5A 4DV2J 3HF5A 4OX8A 3R6GB 3DM2B 4DPWA 2LXIA 3IWXA 2J6TA 2Z4PA 3DU6A 4OZ5A 3BSNA 1HI0P 2HG4A 2JL9A 3NGSA 1FJGF 4OHYA 4USIA 3B78A 5KFYA 2FDNA 2ZD1A 3KLGB 1NB7A 2K06A 3CMES 1S1XA 1C1CB 3CW2C 3IAS9 1U26A 4PWWA 4Y28C 4FNIA 5IM0B 3D2WA 2YX4A 5ETRA 4UT4A 3MM5A 1IBMF 3I82A 4B3SF 3RU0A 2DNGA 2E29A 2E1PA 1RTHB 3S8SA 3IS9B 4ZP8A 4C3LA 3J81U 4GKKJ 2OFGX 3AJ1A 2J7KA 2Z2LA 4DV3J 3H90A 4GC6A 1D8ZA 3OTCA 3K5LA 4ILMA 2B9XA 4XIUA 4LF9J 5AE3A 2CA9A 3NWRA 3BBFA 4ELUA 2DGQA 3BKFA 1Q8BA 2E5HA 2LLZA 3S7RA 3T41A 2VQFF 1LW0A 1JJ2R 2ALYB 2LQJA 4LJMA 1UWAA 4F50A 3DN9A 1TL3B 4GKJF 4AD6A 3B8HA 3MAQA 1L3VA 5ETKA 1RZMA 4KGZB 3SIPB 4WKYA 1WC3A 2VDHA 4F4AA 5HQMA 2OMLA 3HD1A 4FDFA 2LDYA 2WOMA 5T7LB 4RNNA 2HURA 4LF4J 2PEHA 4I64A 4USUA 5LM7E 4ZVHA 4K4ZA 2OI2A 3M8QB 2MY7A 3T9NA 3M2RB 1YBAA 3W64A 4EGLA 4ZPVR 5A8WA 4M94A 1LWCB 4ECZA 5D0HA 5A6PA 4AFFA 4DR3F 4B3MF 3HFVA 3LANA 1PJ7A 4G1QA 2UUCJ 3PACA 4DXLA 2FVQA 2N82B 2AJ0A 5T41A 2J9DA 2MJUA 2OTLS 3KLEA 3F0NA 1RT6A 1IUJA 1LFWA 4PKDB 3KK2B 4Y0FA 3FNNA 4UQGA 5D78A 3CCZA 3R5AA 2XLIA 4H54A 4A48A 5DJBA 4F36A 3NKYA 2KFNA 2HFVA 1IJFB 2KKHA 1IKYB 5ETLA 3SQGA 4DL3A 1DAXA 1S5ZA 4G1PA 2ZUGA 2V5HG 5HMYA 3DRRB 2DBBA 2CQCA 2NCKL 2XMTA 3LAMA 1NU4A 3T1HJ 5GMEA 3OW2R 4I2QA 4F25A 4BWJA 2KHCA 4DBQA 3G6YA 1Y4ZB 3QJJA 4I7FB 3ONQA 3EPIA 3AA8A 2PO4A 1S7IA 2FJVA 4RW9A 2XTJP 1DTQA 4DPYA 5E3RA 1NBEB 3AH6A 3KK3B 3VVTA 2MY8A 3P4UB 2VONA 1MWZA 4QYZK 2GVDA 1JNZB 4GVBA 4WYWA 2WVEA 4OHVA 5D3GB 1Q1KA 2BE9B 1FKPB 2M0GB 4MAKA 2RQMA 1H7XA 5B0CA 4U6PA 3OLBA 4OJ1A 4KGXB 5LMNF 3H5XA 2C1EB 2E5IA 3WIUA 3OSPA 3O44A 2C2MB 3VCDA 1NJIT 2DEJA 1CVJA 5LXRA 2XMWA 4ZS6A 3GV7B 1RT1A 3NGDA 2P6SA 4NLDA 1N36J 3L7UA 2DGVA 3H59A 1GQEA 1YJ7A 2DNKA 2UUTA 1VQSA 3A1YG 3N0VA 4HH1A 4NA2A 4DQQA 2E1RA 2G0JA 1DQAA 5HJXA 2PGCA 3EE3A 5U47A 2KM8B 1R6VA 3Q8UA 1SJ3P 4UF4A 1HNZJ 1SH2A 3GYNA 3JSMB 2SXLA 2ZC4A 3M6WA 5ETOA 3SCJE 4PWDB 3DU5A 2D41A 1BY9A 4PWUA 2YWWA 2Z56B 2UUWA 5LMUF 5EHHA 1FNOA 2CDQA 2WW4A 3EDQB 3N6LA 4PYAA 2ALZA 3I0RA 3SCIE 3ZNUA 4F3MA 2RKIA 4TU8A 2FGCA 3IGNA 3TX8A 2V9WA 4PRFA 1P8GA 2FZGB 2EW9A 2V63A 3ITHA 5RUBA 1R31A 3BM7A 2BOPA 4LF7F 4RUAA 3HP6A 2XNRA 4NXMF 2BX6A 1TV6B 3R6LB 1JLFA 1HNVA 2HVDA 3E01B 4K2JA 4LBHA 1NUEA 4MIAA 4I6YA 1VYAA 4WJBA 4DSIA 5HANA 1YJTA 2FY8A 2QV6A 3M8ZA 2K7JA 4NYPA 1D9FA 2HHHJ 3DLBA 2E5LJ 1Q4RA 1JKHA 1OQ6A 1U6ZA 1OSDA 2QO3A 3JB9k 3ZZUA 4NCGB 1JB0C 2NSBA 1KHVA 5HMXA 1VJQA 2COLA 2XBPA 3HPOA 3T1YF 1IQZA 5KFGA 1RHKB 5J2NB 2B51A 3DRSA 4CDIA 2ZEJA 1LKZA 2XHWA 3P6YC 5FDLA 4B17A 1H3DA 4P2FA 4YFUA 2EFGA 5F3ZA 2FVSA 2J76E 5F8MA 3UFCX 1KBRA 1TKXB 1XMBA 4NL5A 3MEDA 3GR0A 4X4NA 2XYHB 2OPQA 4OI1A 2NYIA 3IN5A 1VRTB 1KLNA 2MXYA 2BBEA 4DR1F 1WC4A 2VBYA 4JI2F 2C2EA 2L3MA 3MAHA 5C24B 3QWUA 1YHQS 4LF8F 1JK9B 4LR7A 4ZVGA 1DHMA 5KFXA 1QLNA 3GILA 1H6KX 3GYXB 3P5TL 4DUZJ 5HMZA 2BJ8A 4YB7A 1TFWA 3NBPB 2VA2A 3DHWC 3M2UB 1JMTA 2VIHA 4I67A 2GVZA 1S48A 1RT4B 3HVWA 4L72B 3X3UA 4TKTA 3LWLA 1UVJA 2HNYB 5HATA 2H9ZA 4A8XA 3QGHA 5C25B 1N88A 5B0GA 2IDLA 4QPXA 2HHUA 2V4JA 1S9GA 5F3TA 3ZZTA 4LF1A 4CLLA 3CNQP 1C4CA 3PW2A 2DR6A 2R9LA 1SV5A 3PW4A 3PX6A 3T5JA 4ZJOA 1R8PA 4I4BA 2W9BB 1JJ4A 7FD1A 2BQRA 4DZDA 3I6PA 3OJSA 3HVTB 3I0SA 2FZKB 2HAFA 5ETNA 3VAJA 4PCQA 1YZ7A 3HVAA 5L1KA 4FXDA 1T03B 2X7IA 4HHHA 5KFSA 2V8VA 4IG0A 2IRXA 3PRDA 4F7VA 2E9ZA 3DOLA 3EX7B 1WC1A 3JXOA 5EWGA 4DX8H 2NXNA 3QAEA 4A8OA 2ZH3A 3H40A 3QJLA 4KJIA 3I96A 3I4PA 3EZUA 4GKKF 1UEVA 1VLYA 4XPEA 1QSLA 4KPYA 2GO8A 3D1QA 1U1LA 4M5DB 3H7HB 1WEZA 3CB4A 3HXMA 2RF2A 3TVKA 4MFBB 4RW6B 4YDDB 2AX0A 9RUBA 5LSLA 4F0HA 4MK9A 5LJ3Y 1YRUA 2BUNA 4OHXA 2EK1A 2Q66A 2XMUA 2JHEA 2ASLA 2XG8A 3V6DA 2E5LF 4Y2KA 1HQUA 4Q8FA 5KFTA 2HHQA 2EI5A 4DV5F 2XY7A 4OMFG 2ZHOA 1YDLA 3T6JA 4GKJJ 8RUCA 2MPUA 2DGOA 2HRTA 3PRBA 3BF4A 4LRAA 2UXDJ 3V4IA 1HR0J 2LQ5A 4GMKA 2UXDF 4K4SA 2HFZA 1A7GE 1YRTA 1RTDB 3GTYX 7AT1B 4ER8A 4K2XA 2YKNB 1S57A 4NMLA 4JI8F 3GFYA 3KLVA 4NXNJ 3MPVA 1Z2ZA 2A3JA 3BR8A 3I5AA 4L73A 3I56S 1RKJA 2QRRA 1DZ5A 2NYHA 3HZGA 1X0PA 1HD1A 2HFUA 1TUVA 1Y11A 2V69A 4RW8A 4ZIVA 3TP2A 4C11B 3TZYA 1RT3B 1N8RT 1XNRF 4R0EA 2WONA 2KDOA 1RTIB 2AJ1A 5E2QA 2MQMA 3TAQA 4WP3A 3F56A 3TEGA 2KYXA 4NE9C 1UFWA 2Y1LB 3M8SA 3PX0A 1RB0A 4ZLNA 2FLPA 1CJKA 1MROA 3OXFA 2A1BA 1UVIA 3FEZA 4OYIA 2V8DA 2V50A 3NAHA 2HVIA 3AHPA 2O1PA 3LPYA 2W8LA 1N0UA 2EVZA 2YKQA 4Y34A 4DR6J 3M8RA 3H98A 2FGOA 3OVAA 1HPZB 1TUWA 2QA4G 3OFEA 2P5VA 3CD0A 2L41A 4ANDA 3C66A 2KT5A 1CJTB 2DIVA 3TA1A 4QIFA 1F3VA 4LF2A 4N77A 4ZP6A 4DFPA 5HLFA 1KONA 1U24A 2CJAA 1K0TA 6AT1B 2JFKA 2LQ8A 5SZTA 1HHTP 2HS0A 2O5DA 3LP2B 4UOHA 2IDEA 3RAQA 2DJWA 1RE1B 2H5EA 2ROGA 2I38A 2I2YA 2DY9A 2DD8S 4DEZA 2AQ4A 4LMZA 1WG1A 3UDLA 2P9EA 3G71S 1NRKA 2QEXS 3TWZA 1CC7A 5IFMA 1W25A 3G87A 4YQWA 3V6HA 1I5OB 2YKMA 4M5NA 4PG6A 3K0JA 3GCWP 1NSQA 3AA9A 3ENQA 5C2GA 2DEIA 2HQGA 2IM0A 3EVMA 1BQNA 3VGTA 4G3IA 1RWOB 1VRUA 2GMHA 5K9FA 1WHWA 3GJRB 4WK1A 2YH1A 3HHEA 1TL4A 1S77D 4OX6A 4MK8A 1FRKA 1RA7A 3H4BA 3BQ0A 1FNXH 4B3TF 4ILLA 4A8YA 2C2DA 1AUDA 4TQSA 5AT1B 3MR2A 1YIJS 5HO4A 4O0IA 3MFHA 1RYSA 4IRKA 4ICLB 2RS8A 5EWFA 4YS2A 3Q8VA 1JLEA 2DR5A 1JLBA 3JTNA 4V19J 1H0HB 1SXLA 2K3IA 2NXCA 5DRKA 2M9KA 1CQMA 4URGA 4AXIA 2F65A 1E6YB 1NDCA 5JXSA 2MGZB 3BZQA 1FFWB 1FDDA 3KG0A 1M0SA 1QAXA 3LOUA 5DG8A 1F2GA 3W5ZA 4YY3J 5KT2A 4JI3F 4YY3F 1ELOA 4C8YA 1RAAB 3N28A 3VWSA 2DGUA 4PABA 2XMAA 2DH8A 5FIIA 3MFIA 3JAMU 4NASA 4QIWD 3WX4A 2UXCJ 2ASYA 3FMBA 2DISA 3MM7A 3J81j 1SC6A 2HIQA 3IO1A 3NCPA 4KPCA 3DLJA 3QGPA 3QAUA 3KLHB 1CG2A 5JVHQ 2D9OA 4FVCA 2YQ0A 1JLCB 3FZ2A 4N56A 2XY5A 5DQHA 1FNMA 3CDAA 3DGVA 4K4WA 3LQVA 3Q83A 3CWJA 3THVA 1Q8IA 4QR0A 2RHSB 1FXLA 5CA5A 2AWZA 2D3ZA 4MK7A 4O44B 1LWXA 5GAGU 4USTA 5AJ3J 2FVRA 2ZZTA 4YN3B 2RILA 3BDEA 4YB5A 4FXVA 2HHXA 2FHJD 3G4SS 2VFRA 2WBMA 3W9JA 3PVXA 1IR1A 2PMZD 1HW8A 4CT8A 2GQ2A 1YTYA 3UR3C 2ZHBA 2MZSA 4ITSA 4ED2A 2DHHA 2PFDA 2H3EB 3MECB 4PXDA 4FNHA 4LVOP 1C2PA 1CULA 1H98A 5KG3A 1VIXA 5GADI 2P6TA 3K57A 1UA1A 2Y0BB 2JLEA 1UFKA 4CO5A 1JQGA 3KHLA 3C14B 2AHOB 3R7SB 1OSCA 4OZNA 2CZ4A 4DX6A 5KT7A 3BJYA 4DCPB 1LXJA 5J1EA 5IT9U 4KHMA 2L9WA 4FBUA 2DT9A 3SFUA 4IG3B 2QLBB 4DDFA 2ZBIA 3TUJC 3C3LA 3W61A 4NCBA 4B3RJ 2FIUA 3WX8A 2G2YA 4RNHA 3M9OB 2I9SA 1HBNB 4ZP7A 1REVB 1NKCA 4X4RA 4KRWA 1S0MA 1SJRA 1T8EA 3FEYB 3T1HF 1CSJA 1AXQA 3R1HA 4C8OA 4M5GA 5BR8F 1Z4UA 2QSWA 4PPZA 4CTAB 1PAEX 3D54A 3DYAA 3QBCA 1SH3A 2VC1A 5CCMA 1TZ0A 3VAHA 1KR4A 1UEUA 2YPYA 5IT0A 4RUCA 1VRQC 3DGPA 4TY9A 3KTQA 3KYLA 4QPTA 5F8HA 1NPKA 1U7LA 5BYQA 4N47A 2RHQB 1HI1A 3OFHA 3QT8A 1NEEA 2FJDB 1ZZFA 1VHIA 3BGUA 1RT7A 3MUVP 2W9CA 4A4JA 1UKUA 3AOAA 5IS2A 2OPSB 3HHDA 3KUGA 1I94J 2HS4A 2B43A 1LWEB 4LT6A 1FFGB 5GAEI 4U67Q 4WU3A 1HNXF 3B4DA 1C0UB 2CPIA 4W4MA 3W2VA 3EICA 3WZ0A 4CLYA 1S0VA 3E8OA 2EBGA 2HPUA 3A3NB 3FUYA 4L3KA 2M5YA 2W2MP 1R8BA 1WF1A 1YKWA 2J9DE 4LRBA 2ATCB 2HGNA 1QM9A 3GMGA 4YDXA 2VHGA 1XTZA 5ETSA 2MKSA 4AQYJ 3ILOA 5B0DA 2DO0A 4R8UB 4A8WA 3C6UA 2GQQA 2RU9A 3BH6B 1QAJA 4FN5A 2BYCA 1SL0A 4NLWA 2F63A 4K59A 3UI3A 4OFZA 3BQ1A 1NK0A 3H2LA 1ULRA 3GB0A 3CEDA 1YJNS 2Q6CA 1KD1T 2W4PA 2PI5A 3NXZA 5ETMA 4DFMA 4OYWA 3W9IA 5KFJA 1UETA 2BE2B 3EXCX 3J7YI 1RLCL 1RXOB 5J1PA 2LKZA 4J9RA 1H2VZ 1X5SA 4ECWA 1VQNS 3QRRA 3CJKB 4LFBF 1MSWD 3FBEA 5L1LA 2HMIA 4R25A 2LEAA 3CJ8A 3K17A 5A0YB 2HBQB 2HKEA 4IDKB 1RT2A 4UTGA 1XMQJ 3DMJB 1LW2B 4EBEA 3WQPA 1J5OA 2IPOB 2CJ9A 1WI8A 3QNWB 4P52A 5D4NA 4DUZF 5J2QA 3OLAA 1ZZNA 4K4VA 5KT4A 4FP9A 3IXQA 4C8MA 1TK5A 1WDTA 3MR5A 4LRDA 1N4LA 1WHVA 3MF5A 5I3UA 2QL5B 2VDIA 4ZVRB 3SSRA 5C2CA 5KFUA 1T0TV 4YEAA 2GA7A 2E7WA 4ZJLA 1MU2B 4MT1A 2YNHA 2UVUA 4X4OA 2C42A 5K8MA 3FQKA 1YJUA 1D9DA 3G8SA 4UOCA 4M1KA 1XR5A 2OJ3A 4P6QA 2OAUA 1CS4A 4CLSA 4A8MP 2PFFB 1UMJA 1WC0A 2LQBA 3E2EA 3M32B 5K8PA 2ZE2B 4NLGA 3S6EA 1RADB 3N6NA 3W66A 1A0OB 3M30A 1JLAA 2G0IA 4F02A 3H8YA 3P5BP 3J7Z5 3SSQA 2GJIA 1U6BA 3SMZA 1SCJB 3HZEA 1RWXB 1G7CB 1URRA 3J7A1 2JJ4D 5KFFA 3C2PA 1N52B 4EO6A 3AQPA 3U02A 2E7VA 1S6QB 4MKAA 3EGWB 1RISA 2LVWA 3QLHA 4Y6IA 3H42A 2ZH5A 3NGRA 4K5RA 4F8RA 1TL5A 1SQGA 3A4TA 3EUNA 1TVRA 5CYQA 3FSIA 2DNYA 2NLWA 1NK6A 1I6JA 4B9SA 5D3GA 2GAGC 4IH6A 1HWJA 2VG5B 3BGRA 2HGMA 1HKAA 2VG7B 2P8IA 3AQOA 4DV6J 3V6KA 4DL5A 2Y8WA 1RU2A 2BZ2A 1SC3B 2XCAA 3CD6S 4X64J 4DR2F 1UWBB 5B7WA 4DL7A 3CJRA 3QGIA 5B0BA 1U4BA 2LU1A 2OSRA 4TU7A 3MMBA 1CJVA 1Q0NA 4S0MA 2J7UA 2JC1A 2ZD1B 3HHLA 1N5QA 3GIJA 2B9EA 3LO3A 4DF8A 3FBCA 1KQGB 3CD5A 5L46A 2VFUA 1K9MT 4U7UD 3GFHA 1Y3KA 1T11A 1K47A 2OEMA 2QE5A 2Y0SD 2ZNYA 3D6FB 3DCAA 3MM5B 3VAIA 3VALA 4EYHB 3RB6A 2UU9F 2XCPA 5GMKa 1J5EJ 1CPZA 1KFSA 1S9EA 2CJYB 3AOBA 2HW3A 5CD4A 3KHHA 2ASJA 2VQFJ 1RWNB 2C3YA 1S7HA 1UEKA 2IYGA 4M5HA 2R7QA 3HJVA 4RLEA 3GR1A 1EIYB 2F4VF 2YX1A 4LFCF 2DCUB 2ZUAA 3ISNC 1H74A 3H5UA 1C0TB 4EEYA 1X5PA 4EZ6A 1LW0B 3AODA 1PAUB 5B0EA 2CDRB 1QE1B 4QIGA 1TL3A 3EVWA 4RNMA 4OJHA 4MKVA 3BGFA 3OR1A 1C1BB 3C8YA 2GNKA 3N4WA 2HBZB 4TYBA 2ZH4A 4JV5F 4RW4B 4DPXA 2AYGA 4DUYJ 1F9EB 5KFDA 2LYVA 3DFEA 2VV5A 1MMLA 3CSKA 3HHKA 4J9SA 1NJYA 3KNGA 1IXKA 2ILZA 2OIHA 4DSJA 4MKYA 2HHVA 2CPXA 1ZBTA 1LWFB 1GXLA 2MKYA 2NXEA 2AZ3A 4Y00A 3M8QA 2B5JB 5IV3A 4B9VA 1Y00A 3CE8A 3AJ2A 3EGVA 4RW7B 2ZH6A 1ZAXA 1LWCA 3MEGB 1VQMS 2B7CB 2BQ3A 1RYRA 4F4ZA 4IO9Q 2J0QD 1TFYA 3DRPB 3ILLA 2Q6BA 5D0EA 4TYAA 3TA2A 2MYFA 4JI5F 1EHWA 3Q2TC 3GZ7A 4ELVA 2KXNB 1LFPA 2CPHA 2DKOB 3HT0A 4J9OA 4XO0A 2KI2A 3SEOA 4DU7A 2OH2A 4B3RF 3P3DA 4WE1A 3W62A 1Q8LA 1S6UA 1VR6A 4DV4J 4ZHRB 5D77A 2X1BA 3MM9A 1HLWA 3SQGB 3J7YU 1EETA 2XS7A 2DNLA 3MM6A 2IM2A 2ZWOA 4CLFA 1RTZA 1VLOA 1YK9A 4X64F 3CMAS 2ZDOA 1U45A 4WFBQ 3DXBA 3IP0A 2XWXA 3R9LA 1N0VC 2N7CA 2RU3A 2Z2ZA 4I2PB 3A3PB 4I2QB 2I1RA 1WKLA 2QA1A 3Q8QB 3CCQS 1CBKA 1CJUA 3M6UA 1U6FA 2U1AA 3OR2A 2LFVA 4OX9F 3W5XA 4CH1A 4OYPA 1DTQB 4PPDA 4F4KA 4OX9J 3LPEA 1LK7A 3KK3A 4TU9A 3FZBA 5CZXA 3QRQA 4WF9Q 3D3BJ 3FFIB 5D0RA 2VJVA 2LEPA 4JUZA 1NK8A 3GG0A 1RK8A 3DOMA 2G9OA 4HTJA 2PSZA 3CTRA 3CJ0A 4NLSA 4DR5F 3KWMA 1TKZB 2VG6A 1VC5A 1N36F 3BN7A 5J2MB 1RWUA 3TUIC 2YNFA 2W8KA 2QFJA 1Q79A 2OHDA 4DPOA 3DNCA 3R5BA 1LEOA 4QJVA 2BQUA 1UW9A 4B3TJ 2YX7A 3ETMA 4AL7A 2DGSA 2HS3A 4V1Ak 3VGUA 2B8PA 1KC8T 4ZLJA 4X65J 2YNIB 3DLHA 3JSMA 5EX3A 3SSSA 2K8GA 2BKPA 3VAKA 3AXMA 2CWXA 3E3XA 1KWMA 4CYUB 2VF3A 4IFYA 2U2FA 4ATNA 2M3DA 2R8KA 4EWTA 1S97A 1JX4A 2VOPA 4ZN1A 4ZPWR 1WNEA 1V3SA 1ZA1B 1VOMA 3I0RB 3RR8A 1M5SA 2AX1A 4KV8A 1YLXA 2J7WA 3MAAB 1NDLA 3RYLA 2VL1A 4UQTA 4OJGA 1AB8A 3MUTP 4DV7F 4JI0J 1BXNA 2XSJB 4C9DA 4IKAA 1HQEA 1WOPA 4NA3A 5F9NA 3SV3A 3RZAA 3V6JA 3RG6A 4K50A 5G0RA 4AUKA 2DPJA 4RBVA 2M8HA 1U09A 2HNZB 1U1MA 3V81A 2AJ2A 5CAAA 2BOAA 4DSLA 3AT1B 2CQ0A 2HBYB 2ZBCA 5DZ7A 3U27A 3CF5Q 1BLUA 1BMQB 1PYTA 4NCGA 3GQCA 1VFJA 4A8FA 2CNKB 2CPYA 2YKOA 5IWAJ 4Q5VA 4N8NA 2HYIB 2C22A 5HROA 2PC6A 2RUGA 4B02A 4X4SA 2MSTA 2MKIA 3TVZA 3OUYA 1DTTA 3PYEA 4IRCA 2KXFA 4O4GB 1CLFA 1T9YA 4UY8T 2ZVSA 4CI0B 2HQ3A 3CCLS 3CD7A 4QQBA 5KG2A 2ZJQQ 5EGYA 3UO0A 5CZVA 2UUAJ 4JI2J 2RUSA 4QYZJ 1N33F 1F60B 2JOQA 2YNGB 2R2UA 2OPQB 3D9BA 2W4CA 3T6BA 2QA4S 1Q5YA 3N6MA 2F8EX 2IVMA 1MWYA 4TN2A 3NGUA 3R2CJ 2IFXA 5DDPC 3QQCD 4DHVA 3TAMB 3UN5A 3DHXA 4UOGA 4FS2A 3R1LA 2BV3A 3C6TA 2DITA 1FHTA 4G6VB 3NRBA 3NBPA 2OUGA 2XY6A 1MMNA 1N56A 3DXSX 2VB6A 2CZ9A 2GVZB 3AB4B 1TK0A 4M5LA 4Y2CA 3RJMB 1VQ6S 3BKUA 3PY8A 4CH0S 1KNZA 1O51A 1T94A 1S1UA 1UTAA 3D66A 5FJ4A 1RCXB 3LF0A 2XB2D 3L7PA 4B9NA 3X1LB 4FYDA 2XNQA 4JYAJ 3MUMP 4PUOA 4BDPA 2IJNA 3MCMA 2Y1JA 1BQMB 5E3CA 4JV0A 7FDRA 4ED3A 1MN9A 2V8GA 5EDWA 1HMVA 2RT3A 2VBWA 4J37A 1X4CA 4JI7F 1VC0A 2EK6A 3NG8A 3VGSA 2UVVA 2PMWA 3CJ3A 2R7TA 2R3VA 4B08A 5E41A 3CC7S 2HK2A 3MD1A 4NMXA 5I4MA 3R7BB 3DOLB 3H0PA 1DURA 1MW7A 2IAJB 5E33A 4CT9A 1DBDA 2DGXA 4OQJA 5AE1A 2XM3A 1EP4B 2VUGA 1GXTA 3N5BA 3PYFA 2C3MA 2YWHA 2X51A 5KG5A 1QVGR 1SC1B 1NSKL 4ECXA 4LF5F 3M05A 1HW9A 1WEYA 5C42A 2LU2A 4YHHF 3BBCA 2KG0A 1EARA 1WG5A 2QTWA 3OD2A 1X8DA 2R7WA 4EI2A 4ZCMA 3BEGB 3AD9C 2H4YB 5BJRA 1O5JA 4R0JA 3JTOA 1MMDA 3IBCB 2CG4A 1QSYA 1FJGJ 2A2CA 2RRAA 2VFTA 4HHUA 4DCOB 4B3SJ 4ZIWA 3W3SA 1F5AA 3N5FA 3NS5A 1H2TZ 3P8BB 3UDCA 1DQ9A 1NB2A 1PILA 1HYSB 4Q0BB 2WRMA 5L1JA 3CIZA 2ROEA 2IC3A 2YVSA 3PYGA 5KT6A 3RRHA 4H4MA 2OFHX 2QMXA 2FB0A 4JI8J 4NXNF 4RPFA 4DN9A 2DHXA 1GAOA 4IOBA 2ASDA 4P72A 1AT1B 4MKBA 1M5VC 1SJQA 3H2VE 3O3LA 4P74A 4DR1J 1NDPA 3TUZC 2JWNA 1Q78A 3GFZA 4RW8B 1XMQF 4QU7A 4FF2A 2BMBA 2CVIA 4Y65A 2WONB 2UXCF 1XMOF 5A8RA 1XC9A 3V4MA 3NL0A 1GT8A 3IRXB 3RTVA 1RAIB 4OZ1A 5EWEA 3SDEB 4DG1B 1P6TA 3POTA 3HK2A 2XI3A 4WZQA 4F4YA 1MROB 4L74A 3VAFA 3ZZPA 2YTCA 3LGHA 3W8PA 3RR7A 4DV2F 1X9MA 1T9UA 2WAQD 4DR4F 2I8EA 4NYZA 1W2BR 4MYUA 2A2DA 1QTMA 1NJZA 4I6WA 2XHCA 3PFEA 4DV6F 1SL1A 1XNQJ 3DI6A 3P49B 1MN7A 1V5VA 2QZ8A 4M5JA 1N6QA 3TA0A 3OHAA 3I32A 2DRBA 5HLFB 2PT0A 4NYOA 1VQYA 4ZVOB 5I42A 1SQEA 1HBMA 4FXWA 1KQFB 4CO4A 2GHWA 4EUVA 3PIOQ 4OI3A 3VHQA 3D68A 1FDBA 3LP2A 3RRKA 1X4GA 1SBRA 4AL6A 3RW7A 3GIRA 4NLOA 3R8YA 3RBEA 4P71A 1FKOA 4C0OC 1FFSB 4KKOB 1IM6A 1MG7A 2Z0GA 1EQMA 2H48B 4EBDA 1WC6A 2G13A 3QIPB 1X5TA 4N5SA 4LF5J 4MJKA 2BKOA 2IHR1 1YITS 2HK3A 4J9KA 4DV0J 3MEEA 4RUHA 3MTJA 1HWKA 2F7VA 2QLFB 1OO0B 1E6VA 1P9QC 3CCSS 4OI2A 3A12A 1YSJA 3EMTA 5BXIA 1BQNB 1OIAA 1S1VB 1WORA 2CXEA 2DH7A 3W2WB 4A8QA 4OI0A 2RH3A 3OFFA 5KFQA 3JSYA 3US5A 3DLEA 4NRUA 2ZBPA 4J9LA 1Q82T 2AV5A 4AXJA 3C16A 2AEJA 3L09A 4HL9A 4NEZA 4DFKA 1SJ1A 3C46A 2AD9A 1PC4A 1S12A 2YKAA 3S01A 5KFRA 4WCEQ 2FVPA 2MKKA 2JH3A 2XZDB 4ICLA 5LSRA 3AAWB 2R7SA 3L95X 4ENOA 2D74B 2FYXA 3FMWA 5HBMB 3EPGA 1BGXT 2K1RA 1FWPA 2QYCA 4D3HA 5M2UA 4LFAJ 3TEHB 3OT9A 3RGIA 1JLQA 2DNHA 3T5LA 5I3QA 2EKYA 4OYOA 3MMCB 4F0MA 1WC5A 2H5IB 3IFEA 2HQIA 2L9DA 3U1MA 2OPRB 3DDKA 1S1TA 2C2NA 5IQ6A 1VQ7S 4DR6F 1NK4A 2QYGA 5K5MA 4BS2A 3R5DA 2DHSA 4LBIA 2MQOA 4NLQA 3KLHA 1W26A 2EFPA 4NI2B 2R2SA 1RTJA 4Q45A 3B54A 2Z58B 3DOKB 5E3QA 1ZM3A 1F5BA 1VBKA 2ZNZA 1B7YB 3JQMA 1WOSA 1B3TA 3GU0A 3PYDA 1LNQA 3IAM9 1YJVA 4JI6F 3OJUA 1G2EA 3DLGA 1M1KT 3UCZP 2HRUA 3VAGA 4C8ZA 2HWIA 2UUCF 4LQ9A 3KXDA 1N33J 4QWBA 3LAKA 3CCWA 3OL6A 2J5AA 4KO0A 1KTQA 2UUBJ 2GAHC 1PBAA 1WKJA 3LP0B 4E2FB 2FD2A 1MNEA 1XBWA 5H9EK 1OPIA 1HD0A 5KFMA 2YWGA 5F8IA 2DXDA 5D4LA 4KHPJ 4I56A 4KHPF 2CAJA 3C14A 5M2RA 3FCWA 4DR5J 5J1EB 4L76A 3DM2A 4ZDNA 1ROFA 2BJ7A 3ZTPA 4O3QA 1FVSA 3MD3A 1UVNA 2DIUA 2R7OA 4CM0A 1NHKL 2OEJA 4ID5A 4RWXA 2BANA 1C1CA 1TAQA 1WG4A 4YR3A 1JXEA 2KVQE 1GX6A 4DL4A 1Q81T 1UJ5A 3ZNJ1 1ZPVA 2GHVC 2CJBA 1IN0A 3QSYB 3MM8B 4ZLLA 4CTAA 1B70B 1EX8A 1GMWD 4ALZA 4EU0A 4L6V3 3IS9A 2PA8D 2M8DB 4QWCA 2AJQA 4LF6J 2OLWA 4DS5A 3NNCA 1F5CA 1FTCA 3LA0A 3DGPB 4P9SA 3KG4A 1FRMA 1YBUA 4BC7A 2OELA 1Y9OA 5LT5A 3BV8A 3LWMA 1NSPA 1GFWB 2VPYB 2I5JA 1S1WB 1S6OA 1T9VA 2V2QA 3TJ9A 4A8SA 5DG9A 4O3RA 2F9DA 2QLJB 4K4UA 3NOCA 2IIHA 1VISA 4M5KA 2VPWB 3A8IA 3ET6B 5AE2A 3W2VB 3HDSA 4ZOSA 3GV5B 1WSRA 2M52A 4G1IA 1NAQA 1S79A 3ISZA 2ZH2A 2H51B 2DK2A 4DQIA 4F2SA 1J2VA 2HZAA 4PXEA 4DR2J 3NNAA 3AFGA 3EM1A 5C7PA 1NHUA 5KFPA 1HWUA 1KVJA 1NM2A 1TU0B 2NUHA 5KOXA 1FI4A 5A76A 1ZOTA 4JI7J 1YJRA 3BGOP 4YR0A 5HMWA 2GS8A 2LXUA 3LH2S 4M63A 3E51A 3FVYA 1R0BG 2R7VA 2DH9A 1K0VA 4WIIA 4IR1A 3NGTA 5E0OA 3I4HX 4B3OB 4KB7A 1RT6B 5HI7A 2L9NA 1N48A 1PKUA 2UUBF 2K7KA 4DQRA 3PW5A 4OI4A 5E5NA 4ES2A 3KK1B 3IC1A 5A0YA 1RT2B 3Q22A 3HKWA 2J0SD 4JP8A 4DCJB 2EC2A 4AL5A 4OHWA 1IKYA 1FEEA 5J2QB 2BM1A 2OP5A 3BO3A 1F9HA 1OY6A 2FJEB 3D0HE 2QT7A 4WFNQ 1I51B 5IWAF 4KGVB 2ZM6F 2OKQA 1P9YA 1RWVB 3DLKB 1K1SA 4IYQA 1Y7PA 1MU2A 2OD4A 4M5IA 4C7QA 4JV5J 4NLTA 3Q0AA 4CLZA 1OS5A 2EXUA 1C4AA 2IMOA 3A3OB 5K14B 2VASA 2M88A 2POKA 4GVBB 4OYAA 5HL7Q 2W2NP 3OTBA 4U7UK 4URQU 3TJ8A 3CJ5A 3BO2A 1S4EA 4E98A 4IOAQ 1FKPA 2CQDA 4RL1A 2HNDA 1KN6A 3JS9A 1JLAB 3VF0B 2EEYA 2BJDA 3MR6A 2JZ5A 3SCLE 3GIIA 1TL1B 5KFKA 1T05A 2V94A 3PM9A 4DQSA 1JNRB 3HVRA 4WP9A 3TQ1A 4EMDA 2UZAA 4ED0A 3Q23A 2V68A 4Z37A 3QLHB 2PE8A 2E66A 2BRLA 2YKPA 1U0HA 2YQ3A 3HSZA 4H4OB 4HACB 3G6VA 4LSZB 1QTNB 2B7BB 3CIMA 8ATCB 2UP1A 5EN1A 2Q1LA 1N34J 2H4WB 2CPDA 2NUUG 3O1LA 4LRCA 8AT1B 3T5HA 2R7XA 2CNOB 4LUBA 4C8KA 1IKVA 2VG5A 3KHGA 3KLIA 3LUYA 4LSNB 1R0AB 1SJ4P 1FK9A 4CNZA 1Q16B 1QDUB 5F8NA 2XYPB 5DQIA 2M2BA 3ITHB 2AKWB 1VIOA 4PAAA 3S1TA 1WJ9A 4IFVA 5CYMB 3UVJA 3HHLB 2ADCA 2F40A 4H4KC 2A6OA 2XLKA 1XWLA 1F6TA 2LCWA 5A8KB 2ZJPQ 1SB6A 4CNYA 2DNMA 2LEBA 4KGMA 1XNRJ 4WFZA 4V19X 4TVAB 3TI0A 3CDUA 2B6AA 4GO5X 4ZN3A 4IO1A 4ETZA 3OPKA 4LFAF 4DV0F 2IRUA 5AXLA 1ZAVA 3KMSA 1S9EB 2RQ4A 3IR7B 4LVNP 5THWA 1ACMB 5L9XA 4M95A 1R0CB 3TANA 1GX5A 2M7SA 4IQMA 4F04B 4X66J 4CLTA 1RHMB 2B8QA 1A6LA 2IA0A 2V4RA 3I55S 2KZZA 2QL9B 2CKWA 2CJQA 3VV2B 5DM6Q 4URSA 1HBUB 4DN0A 4C48A 1PO6A 1RJJA 1QE1A 1WF2A 3MEDB 4MIWA 4OLPA 5KFIA 3M1VB 1SPBP 3WC0A 2GCFA 4NCAA 2AGQA 2HZVA 1C1BA 1AUSL 2RDIA 4LSLB 4JI6J 2W7OA 3FDSA 1UAWA 3MPUB 4WFAQ 2R2RA 4PG5A 1JIHA 2J8SA 3SQOP 4YB6A 2BRKA 1KRPA 4FPIA 2BW7A 1WOOA 3ZTQA 1S99A 4ERDA 3VZHA 2HRYA 2W2QP 1UJ6A 1FXRA 3M2UA 4NLXA 2RQCA 2E1CA 1NJXA 1RQ0A 1FT8A 5MAOA 1RACB 4G65A 2DNZA 4OYXA 2ZBQA 4QBUA 1VQOS 1Y5LB 5C25A 3OVSA 3DRPA 2CUYA 4GRSA 3D7SB 2DXEA 4QCLA 3CCUS 1RT5A 1FXDA 2OSQA 2UV8A 4DSEA 2Z57B 3TARA 2MB0B 4P7TA 3D4JA 1M1GA 2ZJRQ 1UVMA 4O3NA 1V6HA 3OL7A 1L3KA 4PYDA 4RO0A 4ZHRA 1F9FA 1KLMA 4RUBA 3MM6B 2EFOA 3HHNB 4PEOA 1U2CA 5GAEU 2E5JA 3VAMA 2DNRA 3FSYA 3MGJA 3CULA 2GGPA 3BSAA 3HSJA 4U95A 1GTHA 3TZZA 1LXNA 2J6SA 4CP5A 4LF6F 3SYZA 3FGVA 2HFNA 2R8JA 4NRTA 2RF2B 5KT3A 4MFBA 3ILJA 4RW6A 5DGBA 2UU9J 1RA6A 4OZ2A 4ZVEA 1IJEB 2V4QA 5IQQA 3GONA 1N5YB 4L75A 2V2ZA 3FFIA 3GE9A 3HO1A 1HQUB 3HHLC 4ETXA 3TO8A 1U8WA 2Q43A 2DVIA 4DWIA 1DQ8A 1NPRA 6FD1A 2I0XA 1TKZA 2JX2A 1N54B 2VFVA 1YQHA 1IR0A 1EAYC 2VG6B 3ILIA 1RWKB 5F0UA 3CXCR 1WKKA 1D0EA 4RZRA 2G0CA 3BPDA 2G2ZA 2ABYA 4O4RA 4K0KF 2HSEB 2NPFA 4W90B 3OTDA 2YKNA 2HEKA 2VZ9A 4ZPCA 3EZOA 1U02A 4ZKAA 1BC6A 2OTJS 1T7PA 3G6XA 5IXUA 4B9LA 4FKXA 3KLGA 1RUSA 2HHWA 4LF4F 1TR0A 2QG9B 3M8YA 2YH0A 1N5SA 2KJWA 4DL2A 1FWLA 4IUFA 4WXOA 3I5BA 3QT7A 1VK8A 4O3OA 3JAMY 5IM0A 2AEMA 5F8GA 1UA0A 4IFYB 1U48A 1B7FA 2ACYA 4UZCA 3W7BA 4ES1A 3GFXA 5LSOA 4I6AA 5D6GA 4XPCA 3H5YA 4JI3J 1VDHA 1IBKF 2VA3A 1U0SA 3GWCA 1U2RA 3CT9A 1GH8A 2BJ3A 2MQLA 2WSEC 2W2OP 3D5MA 3ENVA 4I1TA 4KV8B 4P75A 5I3PA 3RB0A 1AFIA 1S9FA 4JI0F 3KLFA 4TQRA 2B4PA 2MLZA 1TQLA 2W2PP 1ZS6A 5D0GA 1NCLA 1HQEB 3HT3A 1IM4A 3TZWA 1X9SA 2GHPA 3D28A 3AB2B 1JXVA 1WF0A 2W25A 4ZA1A 1U1PA 4ECTA 1L3UA 2MZQA 4QW9A 3D67A 3CPWR 3BH7B 4DV4F 1X4HA 2IBOA 4N7TA 4HYKA 3V81B 4PQUA 2EPIA 1KOOA 3PR5B 1DFDA 4ZPAA 4TXSA 4ANEA 1HBOA 5F8JA 1GMWA 2G1DA 2XQCA 2E9TA 2BJ9A 2WOMB 3QATA 4NEYA 3DLLQ 3NMRA 4HI2A 2FLNA 1VQKS 1TKTB 2DY1A 2XEXA 3UR0A 2M4MA 5HROB 2ZH9A 4J9QA 3WIVA 1IWAA 2C2KB 2HGLA 5GMDA 3HMJG 4O4GA 4EK2A 4YR2A 2JLFA 2GW8A 2N4CA 3Q86A 4ED4A 5KTQA 2DNOA 1VHFA 5KFNA 4LF8J 5F0WA 3PEJA 2E1MC 2IM1A 1RHQB 2MQ8A 3PTWA 1PGZA 3FEXB 3CCTA 1X4BA 2GX8A 2XI2A 4MIBA 4Z7CA 2W7PA 5LMNJ 1DRZA 1RABB 3PNIA 3LGMA 3KLEB 5GAHU 1T02A 5DLFA 3D1HA 2A6MA 4WKRA 3KK2A 3ZZ0A 4NA1A 3D3CJ 1R27B 4QWEA 2BM0A 3N79A 1SKRA 1RGVA 1ZH5A 3B82A 4MH8A 3HLUA 4EYIB 3ZC4A 2ZOFA 2VQEF 2C2RA 2FHOB 2AJFE 4WP8A 2ZM6J 2B4VA 3KUEA 3MPDA 3F41A 1VQ9S 3OTEA 5DGAA 4UOFA 1KVKA 2O66A 1NKBA 1JLEB 1JLBB 4UUWA 1WSVA 3DRRA 2DO4A 1BHNA 1HNWJ 3AD7C 3BB5A 4ID8A 4ZCLA 5AXMA 4RU9A 5ETQA 1E6YA 2D1CA 2C28A 1S0NA 4IRDA 4PUOB 2V6AA 2AGOA 1X7VA 3WC2A 3NAIA 1ZM4A 3NY0A 2GVDB 4ZVUB 1WACA 4P7VA 2IRYA 1HHQA 4ZPBA 2YY3A 3VR1A 4YOEA 3MM7B 3CJQA 4USWA 3BREA 3KJNB 3UCGA 3OQ2A 3SI8A 1EP4A 3PJXA 2JFDA 3FQLA 1HARA 4MMOA 1GEHA 2ZBRA 2MZJA 5HK4A 5C42B 1S10A 4J7CA 1W7WA 2EBEA 2FHKA 5JJBA 2B9YA 3UNGC 2HHSA 3AXKA 1PSDA 2KO1A 2OPPA 4DL0C 1N34F 3LTOA 1FKAF 1HR0F 2Z2MA 3PW7A 1HFEL 2Z30B 2IA6A 1NK5A 3PKMA 1IR2A 3W63A 2JRSA 3H2UB 2C3UA 2KZMA 2OO4A 3VZIA 3CCJS 1VBXA 1IWGA 4PWDA 1I1GA 3KUHA 3PKYA 2QJ3A 1G4CA 4HDHA 2KRRA 4Q0BA 2RDDA 4OIXA 2AYBA 3MECA 3QGGA 1NMEB 2XULA 4LIWA 1CULB 1NZAA 2J0XA 3EYZA 2UUAF 2DGTA 2A0FB 2EG1A 4RWWA 5KG4A 2HQFA 3NS6A 3Q24A 5ITHA 2RNEA 2Y1RI 4JV1A 4OV1A 3M6XA 1N32F 3DRYA 4DUTA 4O0NA 2H65B 4KR0B 4DSKA 3ZTRA 1RSCA 1JJCB 4IG3A 4FKYA 1TV6A 2ZOMA 2D3UA 1X60A 1RWPB 3E01A 3EDRB 1WHXA 3CJTA 1VGYA 1KS2A 4L3NA 1NK7A 4KTQA 1EKSA 2QN6B 2KTQA 3IRXA 2R8HA 2YWEA 2AJ4A 2C2ZB 2EFQA 3L7OA 4WPAA 3SDEA 2CPZA 2E44A 4X4QA 4DFJA 2HVZA 1GMUA 5IT9Y 2ZWPA 3QIDA 1HQ2A 2K2PA 3JSRA 4XDCA 4I0WA 4ZP9A 3T9ZA 1K1QA 4PQAA 5J2NA 3K5MA 1D3WA 1QVFR 2KG1A 1KHWA 5FDLB 1D8YA 4X2BA 3EGZA 4OL8A 2EG2A 3MR3A 4U7CA 2WVCA 3D1OA 4J5OA 3RBDA 4UY85 1GNKA 2KJVA 2RD5C 4BCAA 3UD3P 2UXBJ 2LXFA 3VQTA 5I42B 5HP1B 4CO2A 2DRDA 1VRTA 2BR0A 2Y9HA 2GZOA 1HHSA 2WZ1A 3PJWA 4LR9A 3JQJA 4MYTA 1B4SA 1M5PC 4ZLPA 1ZTTA 1SH0A 5KFCA 1KVIA 4DL6A 2V2VA 3O6QA 1FKOB 2IVFB 3KNAA 4ED8A 1M1HA 2ZKTA 3G82B 4GO7X 5CABA 3ZO7A 1VC6A 1WHYA 3BS9A 3CMQA 2HNYA 1XN9A 5D15A 1DJ0A 3MEEB 4ES3A 2D9PA 4TLQA 1SQFA 3CVKA 3CGIA 3L3CA 2XO7A 1S1VA 3A13A 4P2XA 3JYTB 2JEJA 1SL2A 4FVMA 4JBCA 1HWLA 3BKTA 1U1OA 2W9BA 2N7YA 3EWGA 3TOQA 2D3O1 3C16B 5DZ6A 3HVTA 4DV1J 3I0SB 3CDEA 2B4UA 1H72C 4DV1F 2Z8QA 1TUGB 1S4FA 3HKZD 3UNYA 3IWLA 1UL3A 1Q5VA 4R5PA 2CVEA 3BYPA 2WB1D 3QFHA 4IG0B 3H4DA 3CCRS 1OY9A 1R89A 4IDKA 2IJFA 4J9MA 4C3KA 4NLYA 2RVJA 1U8SA 3LP1A 4FYWB 4J90A 3GP9A 4EBCA 1J5OB 1IBKJ 3PO4A 4LF9F 1X31C 2KHDA 5IV4A 3IM8A 3ZFVA 1NHVA 1RLDA 2YBVA 1P1LA 1FRJA 1Q53A 2MHNA 2V9KA 1ICEB 5GAGI 4K4TA 4JI5J 4P73A 1ZETA 5J2PB 4USMA 4QZVB 2R42A 2VD3A 1DLOA 2YNHB 3V6DB 4FYXB 4LBPA 4Q43A 2J6UA 2OPRA 1Z2LA 3TZXA 5MLCV 3GSIA 1CS4B 3OBIA 4FPRA 3BR9A 1ITPA 4IR9A 2P9GA 2ZE2A 3V4IB 3OXGA 2VICA 1RAHB 2V67A 2HIYA 4NI2A 3OTOF 2HFSA 1PJ6A 1FF2A 4AE5A 5FLXY 4KHRA 2ZKUA 2J9CA 5K20B 3KFWX 4X4PA 1X9WA 3EXYA 3FC9A 3Q8YA 2R7UA 1SKWA 1Y10A 4DX5A 3PIPQ 4CWBA 3QFWA 2ZOGA 3A8KA 5K8NA 4C11A 1D9AA 3THTA 4KY3A 3KJVB 2CNLB 1RTIA 1G3OA 2N4DA 1SUQA 2B4OA 1FRXA 1PCAA 3BSCA 1FRLA 4KFBA 4KO0B 3SFGA 1XQIA 2GIRA 1TMMA 3K2YA 1JLGB 2PI4A 4PG4A 4CIOA 4OV6A 1CJKB 4PXBA 1OYEA 1NO8A 4JB8B 4WBFA 4Y3CA 1L3SA 4NZ7A 4BLGA 1APSA 3BGLA 5KFVA 4C6AA 4CLPA 5B08A 3R27A 2XZWA 2NPIA 4RNFA 2RJZA 4OX7A 1TL7B 2WK4A 3I87A 3U7JA 3UW1A 1WUUA 3K8WA 3FSXA 2Y3YA 5DLGA 2AIRB 3FRZA 5B0FA 2JEIA 3O5TB 4U96A 3MMBB 3TNVA 2FQQB 4FF4A 2O01C 4Q8EA 1CJTA 4OYZA 5IOLA 3PFOA 2BANB 1AZSA 2CQ2A 2CQHA 1RHUB 1V3ZA 2AW0A 3CDWA 4HVZA 5DG7A 2FC9A 3MM8A 1B0VA 3MCSA 1QUVA 3C15B 3RRGA 3R3TA 4IH7A 1NXIA 4N76A 3MMAB 2KYZA 3M8PB 4OZJA 4E0DA 2VH7A 4A8KA 1X4DA 2NXUA 2I6WA 2VBXA 3V5RA 1FRHA 2XLJA 4ED1A 3NMAA 2QL7B 2BA9A 2YKMB 1IKWA 2NS1B 1L5UA 2CRLA 3WBZA 4TY8B 1C0TA 1NH7A 2HHHF 2O67A 2DCLA 2Y1IA 1VRUB 2QLXA 2VQEJ 3W1YC 3EGNA 3I31A 3UWTA 4QWDA 2MTLA 2GIQA 3ET6A 5GAHI 5KG6A 2JDJA 2CZVC 3W60A 2QMUB 3P96A 4NOHA 3V2UC 4X65F 4DSFA 1QUPA 4O3SA 1XERA 4OZ0A 3Q8SB 2E9RX 4JYAF 1Q7YT 4RW4A 1TKDA 5B0AA 2KXHA 1FCAA 2W9AA 3IR6B 4WYLA 2PEBA 3KHRA 3HFZB 2KVIA 3IG1B 2FLLA 5HJYA 1NSAA 1TTHB 1LWFA 2JVRA 2PIIA 4CLWA 2JEGA 4OHZA 3PHEA 1P1TA 1RAOA 2B5JA 2DR9A 2R8IA 1NNDA 4Q44A 1W2IA 1Y5IB 4RW7A 4WTYA 3FJ2A 3RUBL 1S76D 4XDDA 3B4MA 1WTFA 1UZHA 3C19A 4Q2LA 4DV3F 3QT6A 2MGZA 3M8WA 1F1BB 3SV4A 1H73A 1HNIB 5D4OA 5J1NA 3CCES 1UZDA 4ZITA 4P2MA 5L1IA 3GPAA 3MPYA 4NX9A 4TLRA 3HJFA 2QIFA 4HLBA 1G1XA 2MMYA 1PC5A 5HSPA 1QAIA 1RKIA 3G6ES 2CQPA 1EETB 2HLTA 3OHBA 3KG1A 2FY1A 2AYEA 4WIQA 1B0TA 3MPWA 5CQGA 3VVUA 2X1FA 2G1HA 2WVDA 4WTOB 2D69A 4ZPDA 2W4DA 4JI1F 4ED6A 4O44A 2XS5A 4I2PA 1DARA 1F0XA 3ICLA 1CJUB 4F2RA 1IBLJ 3M2VA 2IMWP 1YVFA 3Q8PB 3THPA 2ILYA 4DPTA 5IZHA 4DR3J 2IM3A 1K73T 1UFLA 3CJSA 4PZVA 1N32J 1OQ3A 4F3QA 1YRXA 3GLJA 3CCMS 3IA0A 3DOMB 1KSPA 1I94F 3R2DJ 3NCRA 3BDPA 1S6PB 2CADA 2GIFA 4DMZA 2DHAA 2RQKA 3QO9A 1VQPS 5J2MA 3Q89A 2BJ1A 4NPOA 3ZXWA 2YNFB 3Q2SC 1TL1A 2HWTA 1IKXB 2L48A 2VJUA 1T05B 5E3AA 5DM7Q 4HKQA 2NQPA 2FC8A 2FHJA 4C3MA 1GK8A 4QU6A 1RBLA 2WBRA 1D1UA 4ZPTR 1TK8A 3OL9A 4DR4J 1U49A 1Y0HA 1PBUA 1HBNA 2DTJA 2ROPA 1NLKL 1S1XB 2XWYA 1REVA 2CIMA 2YNIA 3MTKA 4HACA 2EFVA 5FLXU 3UCUP 5H9FK 2F8MA 3PEHA 3DDIA 4CYUA 1WD6A 2RRBA 2RRNA 2CQGA 3GJSB 1RU1A 3DYAB 3WHIA 1RTHA 1SKSA 1YBTA 1JWWA 1IKVB 4FYVB 2XMMA 3HD2A 2QLWA 3QRPA 1FK9B 4U8VA 5HVGA 3FK4A 4PG7A 2CQ3A 2CQ1A 3K5OA 4YB1P 2X1GA 4H4KA 2MZ1A 5HQ8A 1T3NA 2PDAA 5KFZA 2CQBA 4P10A 1NZ8A 2AF6A 2RIJA 4IFVB 5CYMA 5HVFA 5KFLA 1WELA 3UDVA 1KP6A 5A8KA 4ZVFA 3FCHA 2KH9A 2HVEA 4KH0B 1XMOJ 1C0UA 3OFGA 3QZ8A 1S72S 4K4XA 2HNZA 3PRVA 2B6AB 1FDNA 4QR2A 3N9UC 1LQ9A 1KQKA 3U1LA 3K7RA 4OJ3A 1WWHA 2O3DA 3GG1A 1BE4A 1RAGB 2KRBA 4WFYA 3K59A 2EWHA 4O23A 4ANCA 2ZFHA 4C97A 3NP5A 2DNNA 2DNPA 3ELHA 4UW2A 5T7LA 1U1NA 5KAKA 4C4WA 1OYDA 4R8UA 4DU8A 3C6UB 2KM8C 2MLYA 5LXYA 1DTTB 4ZVPB 3O2IA 4JI1J 3FCVA 3M2RA 2HHPA 5A8WB 3ZZRA 4DUYF 1PJ5A 3OTOJ 3AOCA 4OI6A 3CCVS 2BE7D 4OLOA 4G1QB 1FJCA 2MSSA 2YNGA 4FF1A 1RAFB 1HIYA 3OL8A 1YJWS 2ACMA 4TNOA 1Y5NB 1L3TA 2YXLA 4LSLA 1FVQA 1MLAA 3U1NA 3CJKA 2HMIB 3TAMA 3M9NB 2JVOA 5IT4A 4ECRA 1UP1A 1FRIA 4KC5A 3R5GA 3ZZOA 5EX0A 4DLGA 1LW2A 2DRAA 3DRXA 4WXWA 2FHMA 4FF3A 2QA2A 4XAKA 1Q95G 1CQNA 2DHGA 3R97A 2B56A 2M70A 4K5SA 2RS2A 1S1UB 2C2OB 1RP5A 3MI7X 2APOA 2Q79A 2V2KA 5AXNA 3G96A 5I3UB 3RBXA 2RDJA 2CQIA 1O8BA 2D3OR 2NZ4A 1LK5A 2GMJA 1RT5B 5F8LA 4I7FA 4CO1A 4GC7A 4LREA 5BYRA 5KG7A 2CYYA 2OD6A 2CWKA 4HHJA 4RW9B 4CM2A 3IBFB 1FE0A 4ED5A 1U2FA 1V5IB 1HMVB 2X3DA 4XTTA 2Z2YB 4GVLA 2F4FA 2YPZA 3M32A 3QPIA 2VU5A 4X84A 2ZHAA 4OZ3A 1KLMB 1R6YA 2PMHA 2IAJA 4HT5A 1VI7A 1VQ5S 5LL6d 4DOZA 2DGWA 2IJRA 3RBZA 4ECUA 2PA3A 1G6BA 1SJFA 2ZVIA 5HAOA 1HWIA 3CJ4A 3OSNA 4F4XA 1RT1B 4KSEB 4ZCIA 3RB3A 3NLCA 2W01A 3CDBA 4FBTA 1FTRA 1S6QA 1B99A 2MQNA 3W5YA 4ZCKA 2H1YA 3MOJB 2EFNA 2BEFA 4USHA 5KFHA 5CH7B 2N3LA 2WVBA 1N5YA 3RAMA 2AEFA 2PD1A 1KTVA 1H2UX 3PJ9A 3UPFA 2FTRA 3RAXA 1SIWB 3ULHA 3UN2A 2MKHA 1HYSA 2GQCA 1R8AA 1TVRB 2KL8A 2V0NA 3K89A 1NPPA 2MLXA 3K8VA 1TELA 2RB7A 3JSBA 4Y2IA 2XO6A 2ZH8A 4K0KJ 3BGRB 2RKIB 5KFEA 3F44A 4RU2A 2RMLA 2J9EA 3PO5A 4IQXA 1AFJA 1QD1A 5KOWA 1RBAA 5KG0A 1UWBA 1VBYA 4UZBA 1ZTWA 2K3KA 1CJVB 3TX0A 2WW8A 3TYTA 2ZZMA 1D09B 1N5VA 1NH8A 1SIZA 1T3OA 1JLFB 1HNVB 4LFBJ 2ZH1A 4F3OA 3PZPA 2ERRA 2DPIA 1IBCB 5DETA 1HNXJ 1M5KC 2MEWA 2FPHX 4LRFA 4ZVTB 5H1SV 3DC2A 4DV7J 3NNHA 1F2HA 4DG1A 1JKHB 2FLOA 2W24A 4K8RA 4M8LA 2ZH7A 1J27A 3HULA 1URNA 1VJWA 5G4DA 3KLFB 4KIAA 3A8EA 3BO4A 1QY7A 2MQPA 1OJ4A 1YI2S 3DRSB 2FJXA 2VPXB 4PG8A 2QGFB 3BN4A 5GADU 4NLRA 3QMQA 4KQZA 3FBFA 4NWBA 3N01A 4RBTA 1M5HA 3NS7B 3QT5A 4OYBA 4WK3A 5B09A 1TKXA 1F3FA 3D6TB 1DY3A 3MHYA 3PCOB 4F26A 2BACA 2NZCA 3IGVA 1NK9A 4PQUB 1ZM9A 1FO1A 3KDNA 3OR1B 9ATCB 1WI6A 1R43A 3L9ZA 4WWSA 2KFZA 1HBOB 5C24A 1EQ0A 3MMJA 1U1RA 1UVKA 4QR1A 2V34A 3QYYA 4CCHA 4FZVA 4J9VA 1XK8A 1TKTA 3MCNA 2R4FA 4J9UE 2B0GA 4KKOA 1ZPWX 3T5KA 4N41A 1RBOB 2CJXB 2AU0A 1RT4A 1KFDA 3QIPA 3HI9A 2GJFA 4KAIA 3SCKE 1QSSA 2R8GA 3MEGA 2A10A 4KBIA 3SBMA 2AYMA 4F67A 1E6VB 2GJ2A 1S9GB 2H5JB 2V4JB 4ZVQB 4NLVA 1TP7A 5L8RC 1SV5B 3UD4P 1VQ8S 1RDRA 3AD8C 1KOHA 3QSIA 2OMOA 3TJAA 3D0IE 4DF4A 5K8OA 1HI8A 1UCNA 2KN4A 2WSFC 2LECA 1HNZF 4QW8A 3K5PA 4WE1B 3UD5A 3IR5B 2JEFA 4HI1A 3T1AA 3PG9A 3I5CA 1T03A 2R7RA 3G86A 1XNQF 4WZMA 3PXGa 2JSXA 4LQ3A 3MM9B 3J81Y 1Q7LB 1NDKA 3NEKA 4DI6A 2KFYA 2HHTA 3R7NB 1LOUA 2F1FA 2B3TB 2ZDPA 4DR7F 2BJEA 2X1AA 1RWWB 2GC8A 4ELTA 4YP3A 3KJQB 1VK3A 3IM9A 1VQLS 1WTBA 2CPJA 5HBMA 5L39A 3PX4A 1IBMJ 1KKHA 2K1RB 3FRYA 1V9OA 3OR2B 2FZCB 4IH5A 1P27B 4M5DA 4OYMA 4CH7A 3RW6A 2KT3A 2WHOA 5CD4H 2WCXA 3UN3A 4DPUA 4QWAA 4QYRA 2V8PA 2D7SA 2RAQA 3NWGA 3G9CA 2WSCC 4YHHJ 2XS2A 2CPFA 3ISND 3GJQB 4JOUA 2MHEA 3T1YJ 4X4VA 1TAUA 4F0KA 1BWEA 3HSDA 3PV8A 1X0FA 2JNJA 1XEZA 3ZTOA 1NJWA 2HQDA 4Q7AA 3KOAA 3H25A 1CEZA 4LFCJ 3AY0A 1FA0A 1RCOB 4Z7YA 6FDRA 2GV1A 3ADAC 4QIVA 4CLKA 3OV7A 1FX2A 5H9EJ 1RTDA 3IRWP 5HVHA 4USKA 1PG5B 4HEA9 3J7AN 2J8AA 2OPPB 2XYGB 3G8QA 3VTIA 3P45B 5GVQA 1FERA 2Q3PA 4RR5A 5KFWA 1RT3A 4J9NA 1IBLF 2WB4A 3LW5C 5C5JA 1SVDA 2VOOA 3L4BC 1PYSB 4USVA 1XIQA 1PIEA 3ENWA 3F73A 1BWVA 1YJ9S 5ETTA 3AJDA 3I9ZA 2BW2A 3HFKA 3MAAA 2UVWA 5ADZA 1YGYA 2IVYA 2BXJA 4X62F 1FESA 1BUXA 3CC4S 2XSJA 2NXJA 3KKFA 2HVHA 1HPZA 3DDNA 2KT2A 1Z1ZA 4J91A 5G0RB 3G8TA 2MDAA 5CXTA 5JVGQ 2BABA 4ID5B 4EO8A 1H7WA 2QFIA 2YQ1A 2C3OA 1VCTA 2WVFA 2DR8A 4NZ6A 2R2TA 3KDOA 1FEHA 2HLUA 4P2SA 4XK8C 4E8UA 4JI4F 3ENAA 4BC9A 1X4FA 4KT0C 1KQSR 1HNWF 1A9NB 2CFXA 1KDNA 4DR7J 2W1BA 3IMQJ 1TMJA 3IBWA 3HSGA 3OUYB 3W65A 3D0GE 5HN0A 1EKRA 2HWHA 2MZTA 1PYOB 2HAIA 2XMKA 5DO2A 4ECQA 2FJWA 1YZ6A 4U9RA 4PR6A 2AZ1A 2FJBB 2VBZA 2N3OA 1T9TA 4B9MA 4BWMA 2I5JB 1S1WA 2E1AA 3JQKA 1MWQA 5F41A 4D3GA 2ZC3A 2UVRA 4LF7J 2ZITA 2LP4A 4I68A 5HP1A 3GJTB 1AROP 4BHQA 2B9WA 4RJVA 4RX6A 2AMCB 4DS4A 1U25A 3LALA 2XC9A 2LQ9A 1RHRB 2YWFA 5H9FJ 3RB4A 4FYYB 2CG8A 2C3PA 2CQ4A 5DS7A 1QAYA 3C6TB 4W98A 4ZMMA 5LOQA 4F4WA 3GV8B 1OWXA 1GXUA 3G82A 4YMEA 3OXLA 1EZZB 3KJFB 3CJ2A 5D4PA 1RHJB
chains in the Genus database with same CATH topology
4OYWA 3C16A 4CLWA 4P2XA 2GVZB 4CLLA 3C16B 3R5GA 4OYXA 4WP8A 5D0EA 3MR7A 4P2MA 4CLFA 1WC1A 4CM2A 5IV4A 1YK9A 4OYOA 2GVDB 4OYMA 1WC5A 1CJUA 4CLUA 4OZ3A 1CS4A 4CLSA 4USWA 1WC0A 2GVDA 4OYPA 1FX4A 4CLZA 1CJUB 1CS4B 4NI2B 4OYAA 4USTA 5D0RA 4OZ2A 2W01A 4NI2A 4CLKA 1FX2A 1Y10A 4WP9A 1CULA 3C14B 1U0HA 1CULB 1Y11A 4USVA 3C14A 1U0HB 1CJKB 4WP3A 1CJVB 3MAAA 4CLPA 1CJKA 1CJVA 1TL7B 3MAAB 4OYIA 4CM0A 1YBTA 1AB8A 1TL7A 4WPAA 1CJTA 4OYZA 3UVJA 2QV6A 1AZSA 5D0GA 1CJTB 3UVJB 2BW7A 1AZSB 3C15B 1YBUA 4OYBA 3C15A 4P2FA 4CLTA 4CLYA 1WC3A 3ET6B 2WZ1A 1WC6A 1WC4A 3ET6A 4USUA 3G82B 5D15A 5D0HA 3G82A 2GVZA 5IV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYW A;  3C16 A;  4CLW A;  4P2X A;  2GVZ B;  4CLL A;  3C16 B;  3R5G A;  4OYX A;  4WP8 A;  5D0E A;  3MR7 A;  4P2M A;  4CLF A;  1WC1 A;  4CM2 A;  5IV4 A;  1YK9 A;  4OYO A;  2GVD B;  4OYM A;  1WC5 A;  1CJU A;  4CLU A;  4OZ3 A;  1CS4 A;  4CLS A;  4USW A;  1WC0 A;  2GVD A;  4OYP A;  1FX4 A;  4CLZ A;  1CJU B;  1CS4 B;  4NI2 B;  4OYA A;  4UST A;  5D0R A;  4OZ2 A;  2W01 A;  4NI2 A;  4CLK A;  1FX2 A;  1Y10 A;  4WP9 A;  1CUL A;  3C14 B;  1U0H A;  1CUL B;  1Y11 A;  4USV A;  3C14 A;  1U0H B;  1CJK B;  4WP3 A;  1CJV B;  3MAA A;  4CLP A;  1CJK A;  1CJV A;  1TL7 B;  3MAA B;  4OYI A;  4CM0 A;  1YBT A;  1AB8 A;  1TL7 A;  4WPA A;  1CJT A;  4OYZ A;  3UVJ A;  2QV6 A;  1AZS A;  5D0G A;  1CJT B;  3UVJ B;  2BW7 A;  1AZS B;  3C15 B;  1YBU A;  4OYB A;  3C15 A;  4P2F A;  4CLT A;  4CLY A;  1WC3 A;  3ET6 B;  2WZ1 A;  1WC6 A;  1WC4 A;  3ET6 A;  4USU A;  3G82 B;  5D15 A;  5D0H A;  3G82 A;  2GVZ A;  5IV3 A; 
#chains in the Genus database with same CATH topology
 3VGV A;  1O0P A;  3UQS A;  3TUP A;  4JV2 A;  2F3J A;  1Q8K A;  3MEK A;  5ETP A;  1UPM B;  3W9H A;  3HCX A;  4WFX A;  3BQ2 A;  2OGU A;  4HR2 A;  1FJE B;  3GIK A;  1WDD A;  3JYT A;  1AW0 A;  4K7Q A;  4PXC A;  3NGK A;  3BPS P;  1BQM A;  4DZ6 A;  4J9P A;  1UVL A;  3QWP A;  4B3O A;  2HQC A;  3MUR P;  3MR7 A;  4C0B A;  1K44 A;  3FBB A;  4R5P B;  3SZ2 A;  4Y2A A;  3J80 Y;  3KK1 A;  2X3G A;  2PN6 A;  3W8G A;  3HM9 A;  2G2O A;  3CO0 P;  5L9N A;  1B64 A;  1X5O A;  5E7O B;  3K5N A;  1CC8 A;  2MKJ A;  3LP1 B;  4X62 J;  4RNO A;  1JLC A;  1IQT A;  2F4V J;  2FUG 9;  1S0O A;  2P2C B;  4X66 F;  4DQP A;  2CNN B;  2XMJ A;  2LMI A;  4CLU A;  2G4B A;  1FJ7 A;  2CPE A;  1RWM B;  4CO0 A;  1S49 A;  1BQX A;  3TW0 A;  1O6X A;  2V8H A;  3DLK A;  2MZR A;  1KEK A;  5A2Q U;  5J2P A;  1V3R A;  1ZYQ A;  4Y2M A;  1DLO B;  4C8L A;  4A47 A;  2RE1 A;  4HT7 A;  2EC0 A;  5AJ3 F;  4IOC Q;  1M90 T;  3TVY A;  5K14 A;  5KFO A;  2MQQ A;  2W7A A;  1X4E A;  5T14 A;  2IYI A;  2GML A;  4QIE A;  5F9L A;  1QJH A;  2IC3 B;  3QZ7 A;  2DR7 A;  2NR0 A;  2LDI A;  5D8H B;  4H4M B;  3J7Z T;  2Y8Y A;  2HND B;  2VKR A;  5IC4 B;  4YUD A;  1XJW B;  4B3M J;  4DJB A;  4KGK A;  3ETO A;  3NOG A;  1EB0 A;  1R7I A;  1XR6 A;  5KG1 A;  1OPZ A;  5FD1 A;  2GFF A;  4ECV A;  2ATL A;  3QJP A;  3B6B A;  1ZM2 A;  2RSQ A;  5A6W A;  4ZJQ A;  3CUN A;  1REG X;  5DDR C;  3R5C A;  1IVZ A;  3M4X A;  2F5G A;  1RAE B;  3MCO A;  1LV5 A;  3KJV A;  4U8Y A;  1VMB A;  5A8R B;  1SUQ B;  1U0H B;  2NSC A;  1OMS A;  4H4O A;  4KFB B;  3TQE A;  4DLE A;  3ZTS A;  3OVB A;  2OEK A;  1JLG A;  3BBB A;  2DNQ A;  3POT B;  4C0H A;  3ZZZ A;  2XZT B;  3D6H B;  4CRJ A;  3BYR A;  2JLG A;  4QOT A;  3MDF A;  4CQ1 A;  4ZK7 M;  3GYG A;  1FWK A;  5KT5 A;  1FE4 A;  1R8H A;  3IWN C;  3MXH P;  3KLI B;  2QMW A;  4ECS A;  4O3P A;  4LSN A;  5M2P A;  2WTF A;  1TL7 A;  1ZAW A;  5BR8 J;  1R0A A;  4A46 A;  3CO9 A;  3TR5 A;  3WDO A;  4K4Y A;  3DI6 B;  5LMU J;  3MOZ A;  2QC3 A;  1N6Q B;  2L08 A;  3HX9 A;  1U47 A;  4N8O A;  1FD2 A;  4USJ C;  1RT7 B;  1YX2 A;  2P9C A;  3SXL A;  3UVJ B;  2W9C B;  1T9W A;  2OPS A;  2J0W A;  1JXL A;  1AZS B;  2KB2 A;  1LWE A;  1B0P A;  2AP6 A;  3I9V 9;  1FDA A;  1HBM B;  3PDN A;  5KFB A;  2IY5 B;  3T3F A;  2BDP A;  1RAJ A;  4MTP A;  3UDE A;  4Q2M A;  4C98 A;  3MWB A;  1M5O C;  2NRE A;  5EUH A;  1ZA2 B;  5ETV A;  4EZ9 A;  1JJH A;  4M5M A;  4NXM J;  3C15 A;  1SC4 B;  5KFA A;  2MJN A;  2VOD A;  3MMA A;  3GSD A;  1Q86 T;  3M8P A;  1HA1 A;  3Q8R B;  2ADB A;  2AGP A;  2UV8 G;  2ZZN A;  1IKW B;  5CYJ A;  5HQL A;  2XGQ A;  4FS1 A;  4AQY F;  3KMQ A;  3M9M B;  4TY8 A;  2HFO A;  3UE2 A;  1HBU A;  3FKB A;  4NZ0 A;  3W2W A;  1R3N A;  3K58 A;  2HBR B;  4NLU A;  3DLE B;  4X4T A;  4KH1 B;  2GO9 A;  4HTI A;  2FVC A;  4HH0 A;  3M1V A;  2BE2 A;  2KU7 A;  2JC0 A;  1R8C A;  4AT1 B;  4ECY A;  2F9J A;  1AYE A;  1VS3 A;  4WU2 A;  2YWK A;  4Z2X A;  3TAP A;  1U1Q A;  2LA4 A;  1UW4 A;  3D6M B;  4RKU C;  1I3O B;  1EJ7 L;  1Y3J A;  2HZC A;  4UUX A;  2AT1 B;  2VPZ B;  3M6V A;  4KYZ A;  3IG1 A;  2BVZ A;  5CHC B;  4I69 A;  3A8J A;  4C8N A;  3PR4 A;  3PW0 A;  3GCX P;  3DMJ A;  1NKE A;  1UJ4 A;  1H38 A;  1WEX A;  2A18 A;  1J5E F;  3H20 A;  4C2M A;  2FJA B;  2LA6 A;  4ILR A;  5L38 A;  3H5S A;  3PHT A;  4CZC A;  3EJM A;  3HHL D;  2H54 B;  4BBY A;  3M7V A;  2EKN A;  1RI7 A;  3J80 U;  4AYB D;  1XR7 A;  2DXF A;  5BYS A;  5AXK A;  2MKC A;  1HNI A;  1JLQ B;  2XGP A;  4CO3 A;  3JTP A;  4DV5 J;  3MMC A;  1N5T A;  1GMV A;  1VBZ A;  4HDG A;  5SUH A;  1UPP A;  3TRG A;  1YG0 A;  4B9T A;  1S1T B;  4B9U A;  2E5G A;  4KE5 A;  5DDQ C;  3GIM A;  1FD8 A;  5CCL A;  5JMN A;  4LIR A;  1RTJ B;  1FX4 A;  3DOK A;  1S59 A;  2QX0 A;  3M30 B;  4JI4 J;  2E7X A;  5DDO C;  3EVO A;  2F8H A;  5LJ5 Y;  5JUM A;  2GGP B;  4RBU A;  2IBK A;  4EFA C;  5E3P A;  1T95 A;  2VKZ G;  5DQG A;  4NLP A;  1SKU B;  1OY8 A;  2DYA A;  3DLG B;  3M2V B;  2CJK A;  1VQ4 S;  3VQS A;  3T19 A;  1SI9 A;  1YWX A;  5IC6 B;  3ZZY A;  3LGN A;  4W92 B;  2UXB F;  3NCQ A;  2BKN A;  1U1K A;  2VFS A;  4DX7 A;  1X4A A;  2VC0 A;  1K8A T;  3LP0 A;  2QSF A;  1BD6 A;  4LR8 A;  1T9X A;  2DB1 A;  3DKD A;  3G2X A;  1GTE A;  3BSO A;  2XSF A;  1AA1 B;  5CYQ B;  1S6P A;  4ED7 A;  5A2Q Y;  3QO9 B;  3CC2 S;  3MZI A;  2XMV A;  4OZL A;  4X4U A;  3O8W A;  1HL6 A;  2VG7 A;  1IKX A;  3R5J B;  4ZVS B;  3EZ5 A;  4DV2 J;  3HF5 A;  4OX8 A;  3R6G B;  3DM2 B;  4DPW A;  2LXI A;  3IWX A;  2J6T A;  2Z4P A;  3DU6 A;  4OZ5 A;  3BSN A;  1HI0 P;  2HG4 A;  2JL9 A;  3NGS A;  1FJG F;  4OHY A;  4USI A;  3B78 A;  5KFY A;  2FDN A;  2ZD1 A;  3KLG B;  1NB7 A;  2K06 A;  3CME S;  1S1X A;  1C1C B;  3CW2 C;  3IAS 9;  1U26 A;  4PWW A;  4Y28 C;  4FNI A;  5IM0 B;  3D2W A;  2YX4 A;  5ETR A;  4UT4 A;  3MM5 A;  1IBM F;  3I82 A;  4B3S F;  3RU0 A;  2DNG A;  2E29 A;  2E1P A;  1RTH B;  3S8S A;  3IS9 B;  4ZP8 A;  4C3L A;  3J81 U;  4GKK J;  2OFG X;  3AJ1 A;  2J7K A;  2Z2L A;  4DV3 J;  3H90 A;  4GC6 A;  1D8Z A;  3OTC A;  3K5L A;  4ILM A;  2B9X A;  4XIU A;  4LF9 J;  5AE3 A;  2CA9 A;  3NWR A;  3BBF A;  4ELU A;  2DGQ A;  3BKF A;  1Q8B A;  2E5H A;  2LLZ A;  3S7R A;  3T41 A;  2VQF F;  1LW0 A;  1JJ2 R;  2ALY B;  2LQJ A;  4LJM A;  1UWA A;  4F50 A;  3DN9 A;  1TL3 B;  4GKJ F;  4AD6 A;  3B8H A;  3MAQ A;  1L3V A;  5ETK A;  1RZM A;  4KGZ B;  3SIP B;  4WKY A;  1WC3 A;  2VDH A;  4F4A A;  5HQM A;  2OML A;  3HD1 A;  4FDF A;  2LDY A;  2WOM A;  5T7L B;  4RNN A;  2HUR A;  4LF4 J;  2PEH A;  4I64 A;  4USU A;  5LM7 E;  4ZVH A;  4K4Z A;  2OI2 A;  3M8Q B;  2MY7 A;  3T9N A;  3M2R B;  1YBA A;  3W64 A;  4EGL A;  4ZPV R;  5A8W A;  4M94 A;  1LWC B;  4ECZ A;  5D0H A;  5A6P A;  4AFF A;  4DR3 F;  4B3M F;  3HFV A;  3LAN A;  1PJ7 A;  4G1Q A;  2UUC J;  3PAC A;  4DXL A;  2FVQ A;  2N82 B;  2AJ0 A;  5T41 A;  2J9D A;  2MJU A;  2OTL S;  3KLE A;  3F0N A;  1RT6 A;  1IUJ A;  1LFW A;  4PKD B;  3KK2 B;  4Y0F A;  3FNN A;  4UQG A;  5D78 A;  3CCZ A;  3R5A A;  2XLI A;  4H54 A;  4A48 A;  5DJB A;  4F36 A;  3NKY A;  2KFN A;  2HFV A;  1IJF B;  2KKH A;  1IKY B;  5ETL A;  3SQG A;  4DL3 A;  1DAX A;  1S5Z A;  4G1P A;  2ZUG A;  2V5H G;  5HMY A;  3DRR B;  2DBB A;  2CQC A;  2NCK L;  2XMT A;  3LAM A;  1NU4 A;  3T1H J;  5GME A;  3OW2 R;  4I2Q A;  4F25 A;  4BWJ A;  2KHC A;  4DBQ A;  3G6Y A;  1Y4Z B;  3QJJ A;  4I7F B;  3ONQ A;  3EPI A;  3AA8 A;  2PO4 A;  1S7I A;  2FJV A;  4RW9 A;  2XTJ P;  1DTQ A;  4DPY A;  5E3R A;  1NBE B;  3AH6 A;  3KK3 B;  3VVT A;  2MY8 A;  3P4U B;  2VON A;  1MWZ A;  4QYZ K;  2GVD A;  1JNZ B;  4GVB A;  4WYW A;  2WVE A;  4OHV A;  5D3G B;  1Q1K A;  2BE9 B;  1FKP B;  2M0G B;  4MAK A;  2RQM A;  1H7X A;  5B0C A;  4U6P A;  3OLB A;  4OJ1 A;  4KGX B;  5LMN F;  3H5X A;  2C1E B;  2E5I A;  3WIU A;  3OSP A;  3O44 A;  2C2M B;  3VCD A;  1NJI T;  2DEJ A;  1CVJ A;  5LXR A;  2XMW A;  4ZS6 A;  3GV7 B;  1RT1 A;  3NGD A;  2P6S A;  4NLD A;  1N36 J;  3L7U A;  2DGV A;  3H59 A;  1GQE A;  1YJ7 A;  2DNK A;  2UUT A;  1VQS A;  3A1Y G;  3N0V A;  4HH1 A;  4NA2 A;  4DQQ A;  2E1R A;  2G0J A;  1DQA A;  5HJX A;  2PGC A;  3EE3 A;  5U47 A;  2KM8 B;  1R6V A;  3Q8U A;  1SJ3 P;  4UF4 A;  1HNZ J;  1SH2 A;  3GYN A;  3JSM B;  2SXL A;  2ZC4 A;  3M6W A;  5ETO A;  3SCJ E;  4PWD B;  3DU5 A;  2D41 A;  1BY9 A;  4PWU A;  2YWW A;  2Z56 B;  2UUW A;  5LMU F;  5EHH A;  1FNO A;  2CDQ A;  2WW4 A;  3EDQ B;  3N6L A;  4PYA A;  2ALZ A;  3I0R A;  3SCI E;  3ZNU A;  4F3M A;  2RKI A;  4TU8 A;  2FGC A;  3IGN A;  3TX8 A;  2V9W A;  4PRF A;  1P8G A;  2FZG B;  2EW9 A;  2V63 A;  3ITH A;  5RUB A;  1R31 A;  3BM7 A;  2BOP A;  4LF7 F;  4RUA A;  3HP6 A;  2XNR A;  4NXM F;  2BX6 A;  1TV6 B;  3R6L B;  1JLF A;  1HNV A;  2HVD A;  3E01 B;  4K2J A;  4LBH A;  1NUE A;  4MIA A;  4I6Y A;  1VYA A;  4WJB A;  4DSI A;  5HAN A;  1YJT A;  2FY8 A;  2QV6 A;  3M8Z A;  2K7J A;  4NYP A;  1D9F A;  2HHH J;  3DLB A;  2E5L J;  1Q4R A;  1JKH A;  1OQ6 A;  1U6Z A;  1OSD A;  2QO3 A;  3JB9 k;  3ZZU A;  4NCG B;  1JB0 C;  2NSB A;  1KHV A;  5HMX A;  1VJQ A;  2COL A;  2XBP A;  3HPO A;  3T1Y F;  1IQZ A;  5KFG A;  1RHK B;  5J2N B;  2B51 A;  3DRS A;  4CDI A;  2ZEJ A;  1LKZ A;  2XHW A;  3P6Y C;  5FDL A;  4B17 A;  1H3D A;  4P2F A;  4YFU A;  2EFG A;  5F3Z A;  2FVS A;  2J76 E;  5F8M A;  3UFC X;  1KBR A;  1TKX B;  1XMB A;  4NL5 A;  3MED A;  3GR0 A;  4X4N A;  2XYH B;  2OPQ A;  4OI1 A;  2NYI A;  3IN5 A;  1VRT B;  1KLN A;  2MXY A;  2BBE A;  4DR1 F;  1WC4 A;  2VBY A;  4JI2 F;  2C2E A;  2L3M A;  3MAH A;  5C24 B;  3QWU A;  1YHQ S;  4LF8 F;  1JK9 B;  4LR7 A;  4ZVG A;  1DHM A;  5KFX A;  1QLN A;  3GIL A;  1H6K X;  3GYX B;  3P5T L;  4DUZ J;  5HMZ A;  2BJ8 A;  4YB7 A;  1TFW A;  3NBP B;  2VA2 A;  3DHW C;  3M2U B;  1JMT A;  2VIH A;  4I67 A;  2GVZ A;  1S48 A;  1RT4 B;  3HVW A;  4L72 B;  3X3U A;  4TKT A;  3LWL A;  1UVJ A;  2HNY B;  5HAT A;  2H9Z A;  4A8X A;  3QGH A;  5C25 B;  1N88 A;  5B0G A;  2IDL A;  4QPX A;  2HHU A;  2V4J A;  1S9G A;  5F3T A;  3ZZT A;  4LF1 A;  4CLL A;  3CNQ P;  1C4C A;  3PW2 A;  2DR6 A;  2R9L A;  1SV5 A;  3PW4 A;  3PX6 A;  3T5J A;  4ZJO A;  1R8P A;  4I4B A;  2W9B B;  1JJ4 A;  7FD1 A;  2BQR A;  4DZD A;  3I6P A;  3OJS A;  3HVT B;  3I0S A;  2FZK B;  2HAF A;  5ETN A;  3VAJ A;  4PCQ A;  1YZ7 A;  3HVA A;  5L1K A;  4FXD A;  1T03 B;  2X7I A;  4HHH A;  5KFS A;  2V8V A;  4IG0 A;  2IRX A;  3PRD A;  4F7V A;  2E9Z A;  3DOL A;  3EX7 B;  1WC1 A;  3JXO A;  5EWG A;  4DX8 H;  2NXN A;  3QAE A;  4A8O A;  2ZH3 A;  3H40 A;  3QJL A;  4KJI A;  3I96 A;  3I4P A;  3EZU A;  4GKK F;  1UEV A;  1VLY A;  4XPE A;  1QSL A;  4KPY A;  2GO8 A;  3D1Q A;  1U1L A;  4M5D B;  3H7H B;  1WEZ A;  3CB4 A;  3HXM A;  2RF2 A;  3TVK A;  4MFB B;  4RW6 B;  4YDD B;  2AX0 A;  9RUB A;  5LSL A;  4F0H A;  4MK9 A;  5LJ3 Y;  1YRU A;  2BUN A;  4OHX A;  2EK1 A;  2Q66 A;  2XMU A;  2JHE A;  2ASL A;  2XG8 A;  3V6D A;  2E5L F;  4Y2K A;  1HQU A;  4Q8F A;  5KFT A;  2HHQ A;  2EI5 A;  4DV5 F;  2XY7 A;  4OMF G;  2ZHO A;  1YDL A;  3T6J A;  4GKJ J;  8RUC A;  2MPU A;  2DGO A;  2HRT A;  3PRB A;  3BF4 A;  4LRA A;  2UXD J;  3V4I A;  1HR0 J;  2LQ5 A;  4GMK A;  2UXD F;  4K4S A;  2HFZ A;  1A7G E;  1YRT A;  1RTD B;  3GTY X;  7AT1 B;  4ER8 A;  4K2X A;  2YKN B;  1S57 A;  4NML A;  4JI8 F;  3GFY A;  3KLV A;  4NXN J;  3MPV A;  1Z2Z A;  2A3J A;  3BR8 A;  3I5A A;  4L73 A;  3I56 S;  1RKJ A;  2QRR A;  1DZ5 A;  2NYH A;  3HZG A;  1X0P A;  1HD1 A;  2HFU A;  1TUV A;  1Y11 A;  2V69 A;  4RW8 A;  4ZIV A;  3TP2 A;  4C11 B;  3TZY A;  1RT3 B;  1N8R T;  1XNR F;  4R0E A;  2WON A;  2KDO A;  1RTI B;  2AJ1 A;  5E2Q A;  2MQM A;  3TAQ A;  4WP3 A;  3F56 A;  3TEG A;  2KYX A;  4NE9 C;  1UFW A;  2Y1L B;  3M8S A;  3PX0 A;  1RB0 A;  4ZLN A;  2FLP A;  1CJK A;  1MRO A;  3OXF A;  2A1B A;  1UVI A;  3FEZ A;  4OYI A;  2V8D A;  2V50 A;  3NAH A;  2HVI A;  3AHP A;  2O1P A;  3LPY A;  2W8L A;  1N0U A;  2EVZ A;  2YKQ A;  4Y34 A;  4DR6 J;  3M8R A;  3H98 A;  2FGO A;  3OVA A;  1HPZ B;  1TUW A;  2QA4 G;  3OFE A;  2P5V A;  3CD0 A;  2L41 A;  4AND A;  3C66 A;  2KT5 A;  1CJT B;  2DIV A;  3TA1 A;  4QIF A;  1F3V A;  4LF2 A;  4N77 A;  4ZP6 A;  4DFP A;  5HLF A;  1KON A;  1U24 A;  2CJA A;  1K0T A;  6AT1 B;  2JFK A;  2LQ8 A;  5SZT A;  1HHT P;  2HS0 A;  2O5D A;  3LP2 B;  4UOH A;  2IDE A;  3RAQ A;  2DJW A;  1RE1 B;  2H5E A;  2ROG A;  2I38 A;  2I2Y A;  2DY9 A;  2DD8 S;  4DEZ A;  2AQ4 A;  4LMZ A;  1WG1 A;  3UDL A;  2P9E A;  3G71 S;  1NRK A;  2QEX S;  3TWZ A;  1CC7 A;  5IFM A;  1W25 A;  3G87 A;  4YQW A;  3V6H A;  1I5O B;  2YKM A;  4M5N A;  4PG6 A;  3K0J A;  3GCW P;  1NSQ A;  3AA9 A;  3ENQ A;  5C2G A;  2DEI A;  2HQG A;  2IM0 A;  3EVM A;  1BQN A;  3VGT A;  4G3I A;  1RWO B;  1VRU A;  2GMH A;  5K9F A;  1WHW A;  3GJR B;  4WK1 A;  2YH1 A;  3HHE A;  1TL4 A;  1S77 D;  4OX6 A;  4MK8 A;  1FRK A;  1RA7 A;  3H4B A;  3BQ0 A;  1FNX H;  4B3T F;  4ILL A;  4A8Y A;  2C2D A;  1AUD A;  4TQS A;  5AT1 B;  3MR2 A;  1YIJ S;  5HO4 A;  4O0I A;  3MFH A;  1RYS A;  4IRK A;  4ICL B;  2RS8 A;  5EWF A;  4YS2 A;  3Q8V A;  1JLE A;  2DR5 A;  1JLB A;  3JTN A;  4V19 J;  1H0H B;  1SXL A;  2K3I A;  2NXC A;  5DRK A;  2M9K A;  1CQM A;  4URG A;  4AXI A;  2F65 A;  1E6Y B;  1NDC A;  5JXS A;  2MGZ B;  3BZQ A;  1FFW B;  1FDD A;  3KG0 A;  1M0S A;  1QAX A;  3LOU A;  5DG8 A;  1F2G A;  3W5Z A;  4YY3 J;  5KT2 A;  4JI3 F;  4YY3 F;  1ELO A;  4C8Y A;  1RAA B;  3N28 A;  3VWS A;  2DGU A;  4PAB A;  2XMA A;  2DH8 A;  5FII A;  3MFI A;  3JAM U;  4NAS A;  4QIW D;  3WX4 A;  2UXC J;  2ASY A;  3FMB A;  2DIS A;  3MM7 A;  3J81 j;  1SC6 A;  2HIQ A;  3IO1 A;  3NCP A;  4KPC A;  3DLJ A;  3QGP A;  3QAU A;  3KLH B;  1CG2 A;  5JVH Q;  2D9O A;  4FVC A;  2YQ0 A;  1JLC B;  3FZ2 A;  4N56 A;  2XY5 A;  5DQH A;  1FNM A;  3CDA A;  3DGV A;  4K4W A;  3LQV A;  3Q83 A;  3CWJ A;  3THV A;  1Q8I A;  4QR0 A;  2RHS B;  1FXL A;  5CA5 A;  2AWZ A;  2D3Z A;  4MK7 A;  4O44 B;  1LWX A;  5GAG U;  4UST A;  5AJ3 J;  2FVR A;  2ZZT A;  4YN3 B;  2RIL A;  3BDE A;  4YB5 A;  4FXV A;  2HHX A;  2FHJ D;  3G4S S;  2VFR A;  2WBM A;  3W9J A;  3PVX A;  1IR1 A;  2PMZ D;  1HW8 A;  4CT8 A;  2GQ2 A;  1YTY A;  3UR3 C;  2ZHB A;  2MZS A;  4ITS A;  4ED2 A;  2DHH A;  2PFD A;  2H3E B;  3MEC B;  4PXD A;  4FNH A;  4LVO P;  1C2P A;  1CUL A;  1H98 A;  5KG3 A;  1VIX A;  5GAD I;  2P6T A;  3K57 A;  1UA1 A;  2Y0B B;  2JLE A;  1UFK A;  4CO5 A;  1JQG A;  3KHL A;  3C14 B;  2AHO B;  3R7S B;  1OSC A;  4OZN A;  2CZ4 A;  4DX6 A;  5KT7 A;  3BJY A;  4DCP B;  1LXJ A;  5J1E A;  5IT9 U;  4KHM A;  2L9W A;  4FBU A;  2DT9 A;  3SFU A;  4IG3 B;  2QLB B;  4DDF A;  2ZBI A;  3TUJ C;  3C3L A;  3W61 A;  4NCB A;  4B3R J;  2FIU A;  3WX8 A;  2G2Y A;  4RNH A;  3M9O B;  2I9S A;  1HBN B;  4ZP7 A;  1REV B;  1NKC A;  4X4R A;  4KRW A;  1S0M A;  1SJR A;  1T8E A;  3FEY B;  3T1H F;  1CSJ A;  1AXQ A;  3R1H A;  4C8O A;  4M5G A;  5BR8 F;  1Z4U A;  2QSW A;  4PPZ A;  4CTA B;  1PAE X;  3D54 A;  3DYA A;  3QBC A;  1SH3 A;  2VC1 A;  5CCM A;  1TZ0 A;  3VAH A;  1KR4 A;  1UEU A;  2YPY A;  5IT0 A;  4RUC A;  1VRQ C;  3DGP A;  4TY9 A;  3KTQ A;  3KYL A;  4QPT A;  5F8H A;  1NPK A;  1U7L A;  5BYQ A;  4N47 A;  2RHQ B;  1HI1 A;  3OFH A;  3QT8 A;  1NEE A;  2FJD B;  1ZZF A;  1VHI A;  3BGU A;  1RT7 A;  3MUV P;  2W9C A;  4A4J A;  1UKU A;  3AOA A;  5IS2 A;  2OPS B;  3HHD A;  3KUG A;  1I94 J;  2HS4 A;  2B43 A;  1LWE B;  4LT6 A;  1FFG B;  5GAE I;  4U67 Q;  4WU3 A;  1HNX F;  3B4D A;  1C0U B;  2CPI A;  4W4M A;  3W2V A;  3EIC A;  3WZ0 A;  4CLY A;  1S0V A;  3E8O A;  2EBG A;  2HPU A;  3A3N B;  3FUY A;  4L3K A;  2M5Y A;  2W2M P;  1R8B A;  1WF1 A;  1YKW A;  2J9D E;  4LRB A;  2ATC B;  2HGN A;  1QM9 A;  3GMG A;  4YDX A;  2VHG A;  1XTZ A;  5ETS A;  2MKS A;  4AQY J;  3ILO A;  5B0D A;  2DO0 A;  4R8U B;  4A8W A;  3C6U A;  2GQQ A;  2RU9 A;  3BH6 B;  1QAJ A;  4FN5 A;  2BYC A;  1SL0 A;  4NLW A;  2F63 A;  4K59 A;  3UI3 A;  4OFZ A;  3BQ1 A;  1NK0 A;  3H2L A;  1ULR A;  3GB0 A;  3CED A;  1YJN S;  2Q6C A;  1KD1 T;  2W4P A;  2PI5 A;  3NXZ A;  5ETM A;  4DFM A;  4OYW A;  3W9I A;  5KFJ A;  1UET A;  2BE2 B;  3EXC X;  3J7Y I;  1RLC L;  1RXO B;  5J1P A;  2LKZ A;  4J9R A;  1H2V Z;  1X5S A;  4ECW A;  1VQN S;  3QRR A;  3CJK B;  4LFB F;  1MSW D;  3FBE A;  5L1L A;  2HMI A;  4R25 A;  2LEA A;  3CJ8 A;  3K17 A;  5A0Y B;  2HBQ B;  2HKE A;  4IDK B;  1RT2 A;  4UTG A;  1XMQ J;  3DMJ B;  1LW2 B;  4EBE A;  3WQP A;  1J5O A;  2IPO B;  2CJ9 A;  1WI8 A;  3QNW B;  4P52 A;  5D4N A;  4DUZ F;  5J2Q A;  3OLA A;  1ZZN A;  4K4V A;  5KT4 A;  4FP9 A;  3IXQ A;  4C8M A;  1TK5 A;  1WDT A;  3MR5 A;  4LRD A;  1N4L A;  1WHV A;  3MF5 A;  5I3U A;  2QL5 B;  2VDI A;  4ZVR B;  3SSR A;  5C2C A;  5KFU A;  1T0T V;  4YEA A;  2GA7 A;  2E7W A;  4ZJL A;  1MU2 B;  4MT1 A;  2YNH A;  2UVU A;  4X4O A;  2C42 A;  5K8M A;  3FQK A;  1YJU A;  1D9D A;  3G8S A;  4UOC A;  4M1K A;  1XR5 A;  2OJ3 A;  4P6Q A;  2OAU A;  1CS4 A;  4CLS A;  4A8M P;  2PFF B;  1UMJ A;  1WC0 A;  2LQB A;  3E2E A;  3M32 B;  5K8P A;  2ZE2 B;  4NLG A;  3S6E A;  1RAD B;  3N6N A;  3W66 A;  1A0O B;  3M30 A;  1JLA A;  2G0I A;  4F02 A;  3H8Y A;  3P5B P;  3J7Z 5;  3SSQ A;  2GJI A;  1U6B A;  3SMZ A;  1SCJ B;  3HZE A;  1RWX B;  1G7C B;  1URR A;  3J7A 1;  2JJ4 D;  5KFF A;  3C2P A;  1N52 B;  4EO6 A;  3AQP A;  3U02 A;  2E7V A;  1S6Q B;  4MKA A;  3EGW B;  1RIS A;  2LVW A;  3QLH A;  4Y6I A;  3H42 A;  2ZH5 A;  3NGR A;  4K5R A;  4F8R A;  1TL5 A;  1SQG A;  3A4T A;  3EUN A;  1TVR A;  5CYQ A;  3FSI A;  2DNY A;  2NLW A;  1NK6 A;  1I6J A;  4B9S A;  5D3G A;  2GAG C;  4IH6 A;  1HWJ A;  2VG5 B;  3BGR A;  2HGM A;  1HKA A;  2VG7 B;  2P8I A;  3AQO A;  4DV6 J;  3V6K A;  4DL5 A;  2Y8W A;  1RU2 A;  2BZ2 A;  1SC3 B;  2XCA A;  3CD6 S;  4X64 J;  4DR2 F;  1UWB B;  5B7W A;  4DL7 A;  3CJR A;  3QGI A;  5B0B A;  1U4B A;  2LU1 A;  2OSR A;  4TU7 A;  3MMB A;  1CJV A;  1Q0N A;  4S0M A;  2J7U A;  2JC1 A;  2ZD1 B;  3HHL A;  1N5Q A;  3GIJ A;  2B9E A;  3LO3 A;  4DF8 A;  3FBC A;  1KQG B;  3CD5 A;  5L46 A;  2VFU A;  1K9M T;  4U7U D;  3GFH A;  1Y3K A;  1T11 A;  1K47 A;  2OEM A;  2QE5 A;  2Y0S D;  2ZNY A;  3D6F B;  3DCA A;  3MM5 B;  3VAI A;  3VAL A;  4EYH B;  3RB6 A;  2UU9 F;  2XCP A;  5GMK a;  1J5E J;  1CPZ A;  1KFS A;  1S9E A;  2CJY B;  3AOB A;  2HW3 A;  5CD4 A;  3KHH A;  2ASJ A;  2VQF J;  1RWN B;  2C3Y A;  1S7H A;  1UEK A;  2IYG A;  4M5H A;  2R7Q A;  3HJV A;  4RLE A;  3GR1 A;  1EIY B;  2F4V F;  2YX1 A;  4LFC F;  2DCU B;  2ZUA A;  3ISN C;  1H74 A;  3H5U A;  1C0T B;  4EEY A;  1X5P A;  4EZ6 A;  1LW0 B;  3AOD A;  1PAU B;  5B0E A;  2CDR B;  1QE1 B;  4QIG A;  1TL3 A;  3EVW A;  4RNM A;  4OJH A;  4MKV A;  3BGF A;  3OR1 A;  1C1B B;  3C8Y A;  2GNK A;  3N4W A;  2HBZ B;  4TYB A;  2ZH4 A;  4JV5 F;  4RW4 B;  4DPX A;  2AYG A;  4DUY J;  1F9E B;  5KFD A;  2LYV A;  3DFE A;  2VV5 A;  1MML A;  3CSK A;  3HHK A;  4J9S A;  1NJY A;  3KNG A;  1IXK A;  2ILZ A;  2OIH A;  4DSJ A;  4MKY A;  2HHV A;  2CPX A;  1ZBT A;  1LWF B;  1GXL A;  2MKY A;  2NXE A;  2AZ3 A;  4Y00 A;  3M8Q A;  2B5J B;  5IV3 A;  4B9V A;  1Y00 A;  3CE8 A;  3AJ2 A;  3EGV A;  4RW7 B;  2ZH6 A;  1ZAX A;  1LWC A;  3MEG B;  1VQM S;  2B7C B;  2BQ3 A;  1RYR A;  4F4Z A;  4IO9 Q;  2J0Q D;  1TFY A;  3DRP B;  3ILL A;  2Q6B A;  5D0E A;  4TYA A;  3TA2 A;  2MYF A;  4JI5 F;  1EHW A;  3Q2T C;  3GZ7 A;  4ELV A;  2KXN B;  1LFP A;  2CPH A;  2DKO B;  3HT0 A;  4J9O A;  4XO0 A;  2KI2 A;  3SEO A;  4DU7 A;  2OH2 A;  4B3R F;  3P3D A;  4WE1 A;  3W62 A;  1Q8L A;  1S6U A;  1VR6 A;  4DV4 J;  4ZHR B;  5D77 A;  2X1B A;  3MM9 A;  1HLW A;  3SQG B;  3J7Y U;  1EET A;  2XS7 A;  2DNL A;  3MM6 A;  2IM2 A;  2ZWO A;  4CLF A;  1RTZ A;  1VLO A;  1YK9 A;  4X64 F;  3CMA S;  2ZDO A;  1U45 A;  4WFB Q;  3DXB A;  3IP0 A;  2XWX A;  3R9L A;  1N0V C;  2N7C A;  2RU3 A;  2Z2Z A;  4I2P B;  3A3P B;  4I2Q B;  2I1R A;  1WKL A;  2QA1 A;  3Q8Q B;  3CCQ S;  1CBK A;  1CJU A;  3M6U A;  1U6F A;  2U1A A;  3OR2 A;  2LFV A;  4OX9 F;  3W5X A;  4CH1 A;  4OYP A;  1DTQ B;  4PPD A;  4F4K A;  4OX9 J;  3LPE A;  1LK7 A;  3KK3 A;  4TU9 A;  3FZB A;  5CZX A;  3QRQ A;  4WF9 Q;  3D3B J;  3FFI B;  5D0R A;  2VJV A;  2LEP A;  4JUZ A;  1NK8 A;  3GG0 A;  1RK8 A;  3DOM A;  2G9O A;  4HTJ A;  2PSZ A;  3CTR A;  3CJ0 A;  4NLS A;  4DR5 F;  3KWM A;  1TKZ B;  2VG6 A;  1VC5 A;  1N36 F;  3BN7 A;  5J2M B;  1RWU A;  3TUI C;  2YNF A;  2W8K A;  2QFJ A;  1Q79 A;  2OHD A;  4DPO A;  3DNC A;  3R5B A;  1LEO A;  4QJV A;  2BQU A;  1UW9 A;  4B3T J;  2YX7 A;  3ETM A;  4AL7 A;  2DGS A;  2HS3 A;  4V1A k;  3VGU A;  2B8P A;  1KC8 T;  4ZLJ A;  4X65 J;  2YNI B;  3DLH A;  3JSM A;  5EX3 A;  3SSS A;  2K8G A;  2BKP A;  3VAK A;  3AXM A;  2CWX A;  3E3X A;  1KWM A;  4CYU B;  2VF3 A;  4IFY A;  2U2F A;  4ATN A;  2M3D A;  2R8K A;  4EWT A;  1S97 A;  1JX4 A;  2VOP A;  4ZN1 A;  4ZPW R;  1WNE A;  1V3S A;  1ZA1 B;  1VOM A;  3I0R B;  3RR8 A;  1M5S A;  2AX1 A;  4KV8 A;  1YLX A;  2J7W A;  3MAA B;  1NDL A;  3RYL A;  2VL1 A;  4UQT A;  4OJG A;  1AB8 A;  3MUT P;  4DV7 F;  4JI0 J;  1BXN A;  2XSJ B;  4C9D A;  4IKA A;  1HQE A;  1WOP A;  4NA3 A;  5F9N A;  3SV3 A;  3RZA A;  3V6J A;  3RG6 A;  4K50 A;  5G0R A;  4AUK A;  2DPJ A;  4RBV A;  2M8H A;  1U09 A;  2HNZ B;  1U1M A;  3V81 A;  2AJ2 A;  5CAA A;  2BOA A;  4DSL A;  3AT1 B;  2CQ0 A;  2HBY B;  2ZBC A;  5DZ7 A;  3U27 A;  3CF5 Q;  1BLU A;  1BMQ B;  1PYT A;  4NCG A;  3GQC A;  1VFJ A;  4A8F A;  2CNK B;  2CPY A;  2YKO A;  5IWA J;  4Q5V A;  4N8N A;  2HYI B;  2C22 A;  5HRO A;  2PC6 A;  2RUG A;  4B02 A;  4X4S A;  2MST A;  2MKI A;  3TVZ A;  3OUY A;  1DTT A;  3PYE A;  4IRC A;  2KXF A;  4O4G B;  1CLF A;  1T9Y A;  4UY8 T;  2ZVS A;  4CI0 B;  2HQ3 A;  3CCL S;  3CD7 A;  4QQB A;  5KG2 A;  2ZJQ Q;  5EGY A;  3UO0 A;  5CZV A;  2UUA J;  4JI2 J;  2RUS A;  4QYZ J;  1N33 F;  1F60 B;  2JOQ A;  2YNG B;  2R2U A;  2OPQ B;  3D9B A;  2W4C A;  3T6B A;  2QA4 S;  1Q5Y A;  3N6M A;  2F8E X;  2IVM A;  1MWY A;  4TN2 A;  3NGU A;  3R2C J;  2IFX A;  5DDP C;  3QQC D;  4DHV A;  3TAM B;  3UN5 A;  3DHX A;  4UOG A;  4FS2 A;  3R1L A;  2BV3 A;  3C6T A;  2DIT A;  1FHT A;  4G6V B;  3NRB A;  3NBP A;  2OUG A;  2XY6 A;  1MMN A;  1N56 A;  3DXS X;  2VB6 A;  2CZ9 A;  2GVZ B;  3AB4 B;  1TK0 A;  4M5L A;  4Y2C A;  3RJM B;  1VQ6 S;  3BKU A;  3PY8 A;  4CH0 S;  1KNZ A;  1O51 A;  1T94 A;  1S1U A;  1UTA A;  3D66 A;  5FJ4 A;  1RCX B;  3LF0 A;  2XB2 D;  3L7P A;  4B9N A;  3X1L B;  4FYD A;  2XNQ A;  4JYA J;  3MUM P;  4PUO A;  4BDP A;  2IJN A;  3MCM A;  2Y1J A;  1BQM B;  5E3C A;  4JV0 A;  7FDR A;  4ED3 A;  1MN9 A;  2V8G A;  5EDW A;  1HMV A;  2RT3 A;  2VBW A;  4J37 A;  1X4C A;  4JI7 F;  1VC0 A;  2EK6 A;  3NG8 A;  3VGS A;  2UVV A;  2PMW A;  3CJ3 A;  2R7T A;  2R3V A;  4B08 A;  5E41 A;  3CC7 S;  2HK2 A;  3MD1 A;  4NMX A;  5I4M A;  3R7B B;  3DOL B;  3H0P A;  1DUR A;  1MW7 A;  2IAJ B;  5E33 A;  4CT9 A;  1DBD A;  2DGX A;  4OQJ A;  5AE1 A;  2XM3 A;  1EP4 B;  2VUG A;  1GXT A;  3N5B A;  3PYF A;  2C3M A;  2YWH A;  2X51 A;  5KG5 A;  1QVG R;  1SC1 B;  1NSK L;  4ECX A;  4LF5 F;  3M05 A;  1HW9 A;  1WEY A;  5C42 A;  2LU2 A;  4YHH F;  3BBC A;  2KG0 A;  1EAR A;  1WG5 A;  2QTW A;  3OD2 A;  1X8D A;  2R7W A;  4EI2 A;  4ZCM A;  3BEG B;  3AD9 C;  2H4Y B;  5BJR A;  1O5J A;  4R0J A;  3JTO A;  1MMD A;  3IBC B;  2CG4 A;  1QSY A;  1FJG J;  2A2C A;  2RRA A;  2VFT A;  4HHU A;  4DCO B;  4B3S J;  4ZIW A;  3W3S A;  1F5A A;  3N5F A;  3NS5 A;  1H2T Z;  3P8B B;  3UDC A;  1DQ9 A;  1NB2 A;  1PIL A;  1HYS B;  4Q0B B;  2WRM A;  5L1J A;  3CIZ A;  2ROE A;  2IC3 A;  2YVS A;  3PYG A;  5KT6 A;  3RRH A;  4H4M A;  2OFH X;  2QMX A;  2FB0 A;  4JI8 J;  4NXN F;  4RPF A;  4DN9 A;  2DHX A;  1GAO A;  4IOB A;  2ASD A;  4P72 A;  1AT1 B;  4MKB A;  1M5V C;  1SJQ A;  3H2V E;  3O3L A;  4P74 A;  4DR1 J;  1NDP A;  3TUZ C;  2JWN A;  1Q78 A;  3GFZ A;  4RW8 B;  1XMQ F;  4QU7 A;  4FF2 A;  2BMB A;  2CVI A;  4Y65 A;  2WON B;  2UXC F;  1XMO F;  5A8R A;  1XC9 A;  3V4M A;  3NL0 A;  1GT8 A;  3IRX B;  3RTV A;  1RAI B;  4OZ1 A;  5EWE A;  3SDE B;  4DG1 B;  1P6T A;  3POT A;  3HK2 A;  2XI3 A;  4WZQ A;  4F4Y A;  1MRO B;  4L74 A;  3VAF A;  3ZZP A;  2YTC A;  3LGH A;  3W8P A;  3RR7 A;  4DV2 F;  1X9M A;  1T9U A;  2WAQ D;  4DR4 F;  2I8E A;  4NYZ A;  1W2B R;  4MYU A;  2A2D A;  1QTM A;  1NJZ A;  4I6W A;  2XHC A;  3PFE A;  4DV6 F;  1SL1 A;  1XNQ J;  3DI6 A;  3P49 B;  1MN7 A;  1V5V A;  2QZ8 A;  4M5J A;  1N6Q A;  3TA0 A;  3OHA A;  3I32 A;  2DRB A;  5HLF B;  2PT0 A;  4NYO A;  1VQY A;  4ZVO B;  5I42 A;  1SQE A;  1HBM A;  4FXW A;  1KQF B;  4CO4 A;  2GHW A;  4EUV A;  3PIO Q;  4OI3 A;  3VHQ A;  3D68 A;  1FDB A;  3LP2 A;  3RRK A;  1X4G A;  1SBR A;  4AL6 A;  3RW7 A;  3GIR A;  4NLO A;  3R8Y A;  3RBE A;  4P71 A;  1FKO A;  4C0O C;  1FFS B;  4KKO B;  1IM6 A;  1MG7 A;  2Z0G A;  1EQM A;  2H48 B;  4EBD A;  1WC6 A;  2G13 A;  3QIP B;  1X5T A;  4N5S A;  4LF5 J;  4MJK A;  2BKO A;  2IHR 1;  1YIT S;  2HK3 A;  4J9K A;  4DV0 J;  3MEE A;  4RUH A;  3MTJ A;  1HWK A;  2F7V A;  2QLF B;  1OO0 B;  1E6V A;  1P9Q C;  3CCS S;  4OI2 A;  3A12 A;  1YSJ A;  3EMT A;  5BXI A;  1BQN B;  1OIA A;  1S1V B;  1WOR A;  2CXE A;  2DH7 A;  3W2W B;  4A8Q A;  4OI0 A;  2RH3 A;  3OFF A;  5KFQ A;  3JSY A;  3US5 A;  3DLE A;  4NRU A;  2ZBP A;  4J9L A;  1Q82 T;  2AV5 A;  4AXJ A;  3C16 A;  2AEJ A;  3L09 A;  4HL9 A;  4NEZ A;  4DFK A;  1SJ1 A;  3C46 A;  2AD9 A;  1PC4 A;  1S12 A;  2YKA A;  3S01 A;  5KFR A;  4WCE Q;  2FVP A;  2MKK A;  2JH3 A;  2XZD B;  4ICL A;  5LSR A;  3AAW B;  2R7S A;  3L95 X;  4ENO A;  2D74 B;  2FYX A;  3FMW A;  5HBM B;  3EPG A;  1BGX T;  2K1R A;  1FWP A;  2QYC A;  4D3H A;  5M2U A;  4LFA J;  3TEH B;  3OT9 A;  3RGI A;  1JLQ A;  2DNH A;  3T5L A;  5I3Q A;  2EKY A;  4OYO A;  3MMC B;  4F0M A;  1WC5 A;  2H5I B;  3IFE A;  2HQI A;  2L9D A;  3U1M A;  2OPR B;  3DDK A;  1S1T A;  2C2N A;  5IQ6 A;  1VQ7 S;  4DR6 F;  1NK4 A;  2QYG A;  5K5M A;  4BS2 A;  3R5D A;  2DHS A;  4LBI A;  2MQO A;  4NLQ A;  3KLH A;  1W26 A;  2EFP A;  4NI2 B;  2R2S A;  1RTJ A;  4Q45 A;  3B54 A;  2Z58 B;  3DOK B;  5E3Q A;  1ZM3 A;  1F5B A;  1VBK A;  2ZNZ A;  1B7Y B;  3JQM A;  1WOS A;  1B3T A;  3GU0 A;  3PYD A;  1LNQ A;  3IAM 9;  1YJV A;  4JI6 F;  3OJU A;  1G2E A;  3DLG A;  1M1K T;  3UCZ P;  2HRU A;  3VAG A;  4C8Z A;  2HWI A;  2UUC F;  4LQ9 A;  3KXD A;  1N33 J;  4QWB A;  3LAK A;  3CCW A;  3OL6 A;  2J5A A;  4KO0 A;  1KTQ A;  2UUB J;  2GAH C;  1PBA A;  1WKJ A;  3LP0 B;  4E2F B;  2FD2 A;  1MNE A;  1XBW A;  5H9E K;  1OPI A;  1HD0 A;  5KFM A;  2YWG A;  5F8I A;  2DXD A;  5D4L A;  4KHP J;  4I56 A;  4KHP F;  2CAJ A;  3C14 A;  5M2R A;  3FCW A;  4DR5 J;  5J1E B;  4L76 A;  3DM2 A;  4ZDN A;  1ROF A;  2BJ7 A;  3ZTP A;  4O3Q A;  1FVS A;  3MD3 A;  1UVN A;  2DIU A;  2R7O A;  4CM0 A;  1NHK L;  2OEJ A;  4ID5 A;  4RWX A;  2BAN A;  1C1C A;  1TAQ A;  1WG4 A;  4YR3 A;  1JXE A;  2KVQ E;  1GX6 A;  4DL4 A;  1Q81 T;  1UJ5 A;  3ZNJ 1;  1ZPV A;  2GHV C;  2CJB A;  1IN0 A;  3QSY B;  3MM8 B;  4ZLL A;  4CTA A;  1B70 B;  1EX8 A;  1GMW D;  4ALZ A;  4EU0 A;  4L6V 3;  3IS9 A;  2PA8 D;  2M8D B;  4QWC A;  2AJQ A;  4LF6 J;  2OLW A;  4DS5 A;  3NNC A;  1F5C A;  1FTC A;  3LA0 A;  3DGP B;  4P9S A;  3KG4 A;  1FRM A;  1YBU A;  4BC7 A;  2OEL A;  1Y9O A;  5LT5 A;  3BV8 A;  3LWM A;  1NSP A;  1GFW B;  2VPY B;  2I5J A;  1S1W B;  1S6O A;  1T9V A;  2V2Q A;  3TJ9 A;  4A8S A;  5DG9 A;  4O3R A;  2F9D A;  2QLJ B;  4K4U A;  3NOC A;  2IIH A;  1VIS A;  4M5K A;  2VPW B;  3A8I A;  3ET6 B;  5AE2 A;  3W2V B;  3HDS A;  4ZOS A;  3GV5 B;  1WSR A;  2M52 A;  4G1I A;  1NAQ A;  1S79 A;  3ISZ A;  2ZH2 A;  2H51 B;  2DK2 A;  4DQI A;  4F2S A;  1J2V A;  2HZA A;  4PXE A;  4DR2 J;  3NNA A;  3AFG A;  3EM1 A;  5C7P A;  1NHU A;  5KFP A;  1HWU A;  1KVJ A;  1NM2 A;  1TU0 B;  2NUH A;  5KOX A;  1FI4 A;  5A76 A;  1ZOT A;  4JI7 J;  1YJR A;  3BGO P;  4YR0 A;  5HMW A;  2GS8 A;  2LXU A;  3LH2 S;  4M63 A;  3E51 A;  3FVY A;  1R0B G;  2R7V A;  2DH9 A;  1K0V A;  4WII A;  4IR1 A;  3NGT A;  5E0O A;  3I4H X;  4B3O B;  4KB7 A;  1RT6 B;  5HI7 A;  2L9N A;  1N48 A;  1PKU A;  2UUB F;  2K7K A;  4DQR A;  3PW5 A;  4OI4 A;  5E5N A;  4ES2 A;  3KK1 B;  3IC1 A;  5A0Y A;  1RT2 B;  3Q22 A;  3HKW A;  2J0S D;  4JP8 A;  4DCJ B;  2EC2 A;  4AL5 A;  4OHW A;  1IKY A;  1FEE A;  5J2Q B;  2BM1 A;  2OP5 A;  3BO3 A;  1F9H A;  1OY6 A;  2FJE B;  3D0H E;  2QT7 A;  4WFN Q;  1I51 B;  5IWA F;  4KGV B;  2ZM6 F;  2OKQ A;  1P9Y A;  1RWV B;  3DLK B;  1K1S A;  4IYQ A;  1Y7P A;  1MU2 A;  2OD4 A;  4M5I A;  4C7Q A;  4JV5 J;  4NLT A;  3Q0A A;  4CLZ A;  1OS5 A;  2EXU A;  1C4A A;  2IMO A;  3A3O B;  5K14 B;  2VAS A;  2M88 A;  2POK A;  4GVB B;  4OYA A;  5HL7 Q;  2W2N P;  3OTB A;  4U7U K;  4URQ U;  3TJ8 A;  3CJ5 A;  3BO2 A;  1S4E A;  4E98 A;  4IOA Q;  1FKP A;  2CQD A;  4RL1 A;  2HND A;  1KN6 A;  3JS9 A;  1JLA B;  3VF0 B;  2EEY A;  2BJD A;  3MR6 A;  2JZ5 A;  3SCL E;  3GII A;  1TL1 B;  5KFK A;  1T05 A;  2V94 A;  3PM9 A;  4DQS A;  1JNR B;  3HVR A;  4WP9 A;  3TQ1 A;  4EMD A;  2UZA A;  4ED0 A;  3Q23 A;  2V68 A;  4Z37 A;  3QLH B;  2PE8 A;  2E66 A;  2BRL A;  2YKP A;  1U0H A;  2YQ3 A;  3HSZ A;  4H4O B;  4HAC B;  3G6V A;  4LSZ B;  1QTN B;  2B7B B;  3CIM A;  8ATC B;  2UP1 A;  5EN1 A;  2Q1L A;  1N34 J;  2H4W B;  2CPD A;  2NUU G;  3O1L A;  4LRC A;  8AT1 B;  3T5H A;  2R7X A;  2CNO B;  4LUB A;  4C8K A;  1IKV A;  2VG5 A;  3KHG A;  3KLI A;  3LUY A;  4LSN B;  1R0A B;  1SJ4 P;  1FK9 A;  4CNZ A;  1Q16 B;  1QDU B;  5F8N A;  2XYP B;  5DQI A;  2M2B A;  3ITH B;  2AKW B;  1VIO A;  4PAA A;  3S1T A;  1WJ9 A;  4IFV A;  5CYM B;  3UVJ A;  3HHL B;  2ADC A;  2F40 A;  4H4K C;  2A6O A;  2XLK A;  1XWL A;  1F6T A;  2LCW A;  5A8K B;  2ZJP Q;  1SB6 A;  4CNY A;  2DNM A;  2LEB A;  4KGM A;  1XNR J;  4WFZ A;  4V19 X;  4TVA B;  3TI0 A;  3CDU A;  2B6A A;  4GO5 X;  4ZN3 A;  4IO1 A;  4ETZ A;  3OPK A;  4LFA F;  4DV0 F;  2IRU A;  5AXL A;  1ZAV A;  3KMS A;  1S9E B;  2RQ4 A;  3IR7 B;  4LVN P;  5THW A;  1ACM B;  5L9X A;  4M95 A;  1R0C B;  3TAN A;  1GX5 A;  2M7S A;  4IQM A;  4F04 B;  4X66 J;  4CLT A;  1RHM B;  2B8Q A;  1A6L A;  2IA0 A;  2V4R A;  3I55 S;  2KZZ A;  2QL9 B;  2CKW A;  2CJQ A;  3VV2 B;  5DM6 Q;  4URS A;  1HBU B;  4DN0 A;  4C48 A;  1PO6 A;  1RJJ A;  1QE1 A;  1WF2 A;  3MED B;  4MIW A;  4OLP A;  5KFI A;  3M1V B;  1SPB P;  3WC0 A;  2GCF A;  4NCA A;  2AGQ A;  2HZV A;  1C1B A;  1AUS L;  2RDI A;  4LSL B;  4JI6 J;  2W7O A;  3FDS A;  1UAW A;  3MPU B;  4WFA Q;  2R2R A;  4PG5 A;  1JIH A;  2J8S A;  3SQO P;  4YB6 A;  2BRK A;  1KRP A;  4FPI A;  2BW7 A;  1WOO A;  3ZTQ A;  1S99 A;  4ERD A;  3VZH A;  2HRY A;  2W2Q P;  1UJ6 A;  1FXR A;  3M2U A;  4NLX A;  2RQC A;  2E1C A;  1NJX A;  1RQ0 A;  1FT8 A;  5MAO A;  1RAC B;  4G65 A;  2DNZ A;  4OYX A;  2ZBQ A;  4QBU A;  1VQO S;  1Y5L B;  5C25 A;  3OVS A;  3DRP A;  2CUY A;  4GRS A;  3D7S B;  2DXE A;  4QCL A;  3CCU S;  1RT5 A;  1FXD A;  2OSQ A;  2UV8 A;  4DSE A;  2Z57 B;  3TAR A;  2MB0 B;  4P7T A;  3D4J A;  1M1G A;  2ZJR Q;  1UVM A;  4O3N A;  1V6H A;  3OL7 A;  1L3K A;  4PYD A;  4RO0 A;  4ZHR A;  1F9F A;  1KLM A;  4RUB A;  3MM6 B;  2EFO A;  3HHN B;  4PEO A;  1U2C A;  5GAE U;  2E5J A;  3VAM A;  2DNR A;  3FSY A;  3MGJ A;  3CUL A;  2GGP A;  3BSA A;  3HSJ A;  4U95 A;  1GTH A;  3TZZ A;  1LXN A;  2J6S A;  4CP5 A;  4LF6 F;  3SYZ A;  3FGV A;  2HFN A;  2R8J A;  4NRT A;  2RF2 B;  5KT3 A;  4MFB A;  3ILJ A;  4RW6 A;  5DGB A;  2UU9 J;  1RA6 A;  4OZ2 A;  4ZVE A;  1IJE B;  2V4Q A;  5IQQ A;  3GON A;  1N5Y B;  4L75 A;  2V2Z A;  3FFI A;  3GE9 A;  3HO1 A;  1HQU B;  3HHL C;  4ETX A;  3TO8 A;  1U8W A;  2Q43 A;  2DVI A;  4DWI A;  1DQ8 A;  1NPR A;  6FD1 A;  2I0X A;  1TKZ A;  2JX2 A;  1N54 B;  2VFV A;  1YQH A;  1IR0 A;  1EAY C;  2VG6 B;  3ILI A;  1RWK B;  5F0U A;  3CXC R;  1WKK A;  1D0E A;  4RZR A;  2G0C A;  3BPD A;  2G2Z A;  2ABY A;  4O4R A;  4K0K F;  2HSE B;  2NPF A;  4W90 B;  3OTD A;  2YKN A;  2HEK A;  2VZ9 A;  4ZPC A;  3EZO A;  1U02 A;  4ZKA A;  1BC6 A;  2OTJ S;  1T7P A;  3G6X A;  5IXU A;  4B9L A;  4FKX A;  3KLG A;  1RUS A;  2HHW A;  4LF4 F;  1TR0 A;  2QG9 B;  3M8Y A;  2YH0 A;  1N5S A;  2KJW A;  4DL2 A;  1FWL A;  4IUF A;  4WXO A;  3I5B A;  3QT7 A;  1VK8 A;  4O3O A;  3JAM Y;  5IM0 A;  2AEM A;  5F8G A;  1UA0 A;  4IFY B;  1U48 A;  1B7F A;  2ACY A;  4UZC A;  3W7B A;  4ES1 A;  3GFX A;  5LSO A;  4I6A A;  5D6G A;  4XPC A;  3H5Y A;  4JI3 J;  1VDH A;  1IBK F;  2VA3 A;  1U0S A;  3GWC A;  1U2R A;  3CT9 A;  1GH8 A;  2BJ3 A;  2MQL A;  2WSE C;  2W2O P;  3D5M A;  3ENV A;  4I1T A;  4KV8 B;  4P75 A;  5I3P A;  3RB0 A;  1AFI A;  1S9F A;  4JI0 F;  3KLF A;  4TQR A;  2B4P A;  2MLZ A;  1TQL A;  2W2P P;  1ZS6 A;  5D0G A;  1NCL A;  1HQE B;  3HT3 A;  1IM4 A;  3TZW A;  1X9S A;  2GHP A;  3D28 A;  3AB2 B;  1JXV A;  1WF0 A;  2W25 A;  4ZA1 A;  1U1P A;  4ECT A;  1L3U A;  2MZQ A;  4QW9 A;  3D67 A;  3CPW R;  3BH7 B;  4DV4 F;  1X4H A;  2IBO A;  4N7T A;  4HYK A;  3V81 B;  4PQU A;  2EPI A;  1KOO A;  3PR5 B;  1DFD A;  4ZPA A;  4TXS A;  4ANE A;  1HBO A;  5F8J A;  1GMW A;  2G1D A;  2XQC A;  2E9T A;  2BJ9 A;  2WOM B;  3QAT A;  4NEY A;  3DLL Q;  3NMR A;  4HI2 A;  2FLN A;  1VQK S;  1TKT B;  2DY1 A;  2XEX A;  3UR0 A;  2M4M A;  5HRO B;  2ZH9 A;  4J9Q A;  3WIV A;  1IWA A;  2C2K B;  2HGL A;  5GMD A;  3HMJ G;  4O4G A;  4EK2 A;  4YR2 A;  2JLF A;  2GW8 A;  2N4C A;  3Q86 A;  4ED4 A;  5KTQ A;  2DNO A;  1VHF A;  5KFN A;  4LF8 J;  5F0W A;  3PEJ A;  2E1M C;  2IM1 A;  1RHQ B;  2MQ8 A;  3PTW A;  1PGZ A;  3FEX B;  3CCT A;  1X4B A;  2GX8 A;  2XI2 A;  4MIB A;  4Z7C A;  2W7P A;  5LMN J;  1DRZ A;  1RAB B;  3PNI A;  3LGM A;  3KLE B;  5GAH U;  1T02 A;  5DLF A;  3D1H A;  2A6M A;  4WKR A;  3KK2 A;  3ZZ0 A;  4NA1 A;  3D3C J;  1R27 B;  4QWE A;  2BM0 A;  3N79 A;  1SKR A;  1RGV A;  1ZH5 A;  3B82 A;  4MH8 A;  3HLU A;  4EYI B;  3ZC4 A;  2ZOF A;  2VQE F;  2C2R A;  2FHO B;  2AJF E;  4WP8 A;  2ZM6 J;  2B4V A;  3KUE A;  3MPD A;  3F41 A;  1VQ9 S;  3OTE A;  5DGA A;  4UOF A;  1KVK A;  2O66 A;  1NKB A;  1JLE B;  1JLB B;  4UUW A;  1WSV A;  3DRR A;  2DO4 A;  1BHN A;  1HNW J;  3AD7 C;  3BB5 A;  4ID8 A;  4ZCL A;  5AXM A;  4RU9 A;  5ETQ A;  1E6Y A;  2D1C A;  2C28 A;  1S0N A;  4IRD A;  4PUO B;  2V6A A;  2AGO A;  1X7V A;  3WC2 A;  3NAI A;  1ZM4 A;  3NY0 A;  2GVD B;  4ZVU B;  1WAC A;  4P7V A;  2IRY A;  1HHQ A;  4ZPB A;  2YY3 A;  3VR1 A;  4YOE A;  3MM7 B;  3CJQ A;  4USW A;  3BRE A;  3KJN B;  3UCG A;  3OQ2 A;  3SI8 A;  1EP4 A;  3PJX A;  2JFD A;  3FQL A;  1HAR A;  4MMO A;  1GEH A;  2ZBR A;  2MZJ A;  5HK4 A;  5C42 B;  1S10 A;  4J7C A;  1W7W A;  2EBE A;  2FHK A;  5JJB A;  2B9Y A;  3UNG C;  2HHS A;  3AXK A;  1PSD A;  2KO1 A;  2OPP A;  4DL0 C;  1N34 F;  3LTO A;  1FKA F;  1HR0 F;  2Z2M A;  3PW7 A;  1HFE L;  2Z30 B;  2IA6 A;  1NK5 A;  3PKM A;  1IR2 A;  3W63 A;  2JRS A;  3H2U B;  2C3U A;  2KZM A;  2OO4 A;  3VZI A;  3CCJ S;  1VBX A;  1IWG A;  4PWD A;  1I1G A;  3KUH A;  3PKY A;  2QJ3 A;  1G4C A;  4HDH A;  2KRR A;  4Q0B A;  2RDD A;  4OIX A;  2AYB A;  3MEC A;  3QGG A;  1NME B;  2XUL A;  4LIW A;  1CUL B;  1NZA A;  2J0X A;  3EYZ A;  2UUA F;  2DGT A;  2A0F B;  2EG1 A;  4RWW A;  5KG4 A;  2HQF A;  3NS6 A;  3Q24 A;  5ITH A;  2RNE A;  2Y1R I;  4JV1 A;  4OV1 A;  3M6X A;  1N32 F;  3DRY A;  4DUT A;  4O0N A;  2H65 B;  4KR0 B;  4DSK A;  3ZTR A;  1RSC A;  1JJC B;  4IG3 A;  4FKY A;  1TV6 A;  2ZOM A;  2D3U A;  1X60 A;  1RWP B;  3E01 A;  3EDR B;  1WHX A;  3CJT A;  1VGY A;  1KS2 A;  4L3N A;  1NK7 A;  4KTQ A;  1EKS A;  2QN6 B;  2KTQ A;  3IRX A;  2R8H A;  2YWE A;  2AJ4 A;  2C2Z B;  2EFQ A;  3L7O A;  4WPA A;  3SDE A;  2CPZ A;  2E44 A;  4X4Q A;  4DFJ A;  2HVZ A;  1GMU A;  5IT9 Y;  2ZWP A;  3QID A;  1HQ2 A;  2K2P A;  3JSR A;  4XDC A;  4I0W A;  4ZP9 A;  3T9Z A;  1K1Q A;  4PQA A;  5J2N A;  3K5M A;  1D3W A;  1QVF R;  2KG1 A;  1KHW A;  5FDL B;  1D8Y A;  4X2B A;  3EGZ A;  4OL8 A;  2EG2 A;  3MR3 A;  4U7C A;  2WVC A;  3D1O A;  4J5O A;  3RBD A;  4UY8 5;  1GNK A;  2KJV A;  2RD5 C;  4BCA A;  3UD3 P;  2UXB J;  2LXF A;  3VQT A;  5I42 B;  5HP1 B;  4CO2 A;  2DRD A;  1VRT A;  2BR0 A;  2Y9H A;  2GZO A;  1HHS A;  2WZ1 A;  3PJW A;  4LR9 A;  3JQJ A;  4MYT A;  1B4S A;  1M5P C;  4ZLP A;  1ZTT A;  1SH0 A;  5KFC A;  1KVI A;  4DL6 A;  2V2V A;  3O6Q A;  1FKO B;  2IVF B;  3KNA A;  4ED8 A;  1M1H A;  2ZKT A;  3G82 B;  4GO7 X;  5CAB A;  3ZO7 A;  1VC6 A;  1WHY A;  3BS9 A;  3CMQ A;  2HNY A;  1XN9 A;  5D15 A;  1DJ0 A;  3MEE B;  4ES3 A;  2D9P A;  4TLQ A;  1SQF A;  3CVK A;  3CGI A;  3L3C A;  2XO7 A;  1S1V A;  3A13 A;  4P2X A;  3JYT B;  2JEJ A;  1SL2 A;  4FVM A;  4JBC A;  1HWL A;  3BKT A;  1U1O A;  2W9B A;  2N7Y A;  3EWG A;  3TOQ A;  2D3O 1;  3C16 B;  5DZ6 A;  3HVT A;  4DV1 J;  3I0S B;  3CDE A;  2B4U A;  1H72 C;  4DV1 F;  2Z8Q A;  1TUG B;  1S4F A;  3HKZ D;  3UNY A;  3IWL A;  1UL3 A;  1Q5V A;  4R5P A;  2CVE A;  3BYP A;  2WB1 D;  3QFH A;  4IG0 B;  3H4D A;  3CCR S;  1OY9 A;  1R89 A;  4IDK A;  2IJF A;  4J9M A;  4C3K A;  4NLY A;  2RVJ A;  1U8S A;  3LP1 A;  4FYW B;  4J90 A;  3GP9 A;  4EBC A;  1J5O B;  1IBK J;  3PO4 A;  4LF9 F;  1X31 C;  2KHD A;  5IV4 A;  3IM8 A;  3ZFV A;  1NHV A;  1RLD A;  2YBV A;  1P1L A;  1FRJ A;  1Q53 A;  2MHN A;  2V9K A;  1ICE B;  5GAG I;  4K4T A;  4JI5 J;  4P73 A;  1ZET A;  5J2P B;  4USM A;  4QZV B;  2R42 A;  2VD3 A;  1DLO A;  2YNH B;  3V6D B;  4FYX B;  4LBP A;  4Q43 A;  2J6U A;  2OPR A;  1Z2L A;  3TZX A;  5MLC V;  3GSI A;  1CS4 B;  3OBI A;  4FPR A;  3BR9 A;  1ITP A;  4IR9 A;  2P9G A;  2ZE2 A;  3V4I B;  3OXG A;  2VIC A;  1RAH B;  2V67 A;  2HIY A;  4NI2 A;  3OTO F;  2HFS A;  1PJ6 A;  1FF2 A;  4AE5 A;  5FLX Y;  4KHR A;  2ZKU A;  2J9C A;  5K20 B;  3KFW X;  4X4P A;  1X9W A;  3EXY A;  3FC9 A;  3Q8Y A;  2R7U A;  1SKW A;  1Y10 A;  4DX5 A;  3PIP Q;  4CWB A;  3QFW A;  2ZOG A;  3A8K A;  5K8N A;  4C11 A;  1D9A A;  3THT A;  4KY3 A;  3KJV B;  2CNL B;  1RTI A;  1G3O A;  2N4D A;  1SUQ A;  2B4O A;  1FRX A;  1PCA A;  3BSC A;  1FRL A;  4KFB A;  4KO0 B;  3SFG A;  1XQI A;  2GIR A;  1TMM A;  3K2Y A;  1JLG B;  2PI4 A;  4PG4 A;  4CIO A;  4OV6 A;  1CJK B;  4PXB A;  1OYE A;  1NO8 A;  4JB8 B;  4WBF A;  4Y3C A;  1L3S A;  4NZ7 A;  4BLG A;  1APS A;  3BGL A;  5KFV A;  4C6A A;  4CLP A;  5B08 A;  3R27 A;  2XZW A;  2NPI A;  4RNF A;  2RJZ A;  4OX7 A;  1TL7 B;  2WK4 A;  3I87 A;  3U7J A;  3UW1 A;  1WUU A;  3K8W A;  3FSX A;  2Y3Y A;  5DLG A;  2AIR B;  3FRZ A;  5B0F A;  2JEI A;  3O5T B;  4U96 A;  3MMB B;  3TNV A;  2FQQ B;  4FF4 A;  2O01 C;  4Q8E A;  1CJT A;  4OYZ A;  5IOL A;  3PFO A;  2BAN B;  1AZS A;  2CQ2 A;  2CQH A;  1RHU B;  1V3Z A;  2AW0 A;  3CDW A;  4HVZ A;  5DG7 A;  2FC9 A;  3MM8 A;  1B0V A;  3MCS A;  1QUV A;  3C15 B;  3RRG A;  3R3T A;  4IH7 A;  1NXI A;  4N76 A;  3MMA B;  2KYZ A;  3M8P B;  4OZJ A;  4E0D A;  2VH7 A;  4A8K A;  1X4D A;  2NXU A;  2I6W A;  2VBX A;  3V5R A;  1FRH A;  2XLJ A;  4ED1 A;  3NMA A;  2QL7 B;  2BA9 A;  2YKM B;  1IKW A;  2NS1 B;  1L5U A;  2CRL A;  3WBZ A;  4TY8 B;  1C0T A;  1NH7 A;  2HHH F;  2O67 A;  2DCL A;  2Y1I A;  1VRU B;  2QLX A;  2VQE J;  3W1Y C;  3EGN A;  3I31 A;  3UWT A;  4QWD A;  2MTL A;  2GIQ A;  3ET6 A;  5GAH I;  5KG6 A;  2JDJ A;  2CZV C;  3W60 A;  2QMU B;  3P96 A;  4NOH A;  3V2U C;  4X65 F;  4DSF A;  1QUP A;  4O3S A;  1XER A;  4OZ0 A;  3Q8S B;  2E9R X;  4JYA F;  1Q7Y T;  4RW4 A;  1TKD A;  5B0A A;  2KXH A;  1FCA A;  2W9A A;  3IR6 B;  4WYL A;  2PEB A;  3KHR A;  3HFZ B;  2KVI A;  3IG1 B;  2FLL A;  5HJY A;  1NSA A;  1TTH B;  1LWF A;  2JVR A;  2PII A;  4CLW A;  2JEG A;  4OHZ A;  3PHE A;  1P1T A;  1RAO A;  2B5J A;  2DR9 A;  2R8I A;  1NND A;  4Q44 A;  1W2I A;  1Y5I B;  4RW7 A;  4WTY A;  3FJ2 A;  3RUB L;  1S76 D;  4XDD A;  3B4M A;  1WTF A;  1UZH A;  3C19 A;  4Q2L A;  4DV3 F;  3QT6 A;  2MGZ A;  3M8W A;  1F1B B;  3SV4 A;  1H73 A;  1HNI B;  5D4O A;  5J1N A;  3CCE S;  1UZD A;  4ZIT A;  4P2M A;  5L1I A;  3GPA A;  3MPY A;  4NX9 A;  4TLR A;  3HJF A;  2QIF A;  4HLB A;  1G1X A;  2MMY A;  1PC5 A;  5HSP A;  1QAI A;  1RKI A;  3G6E S;  2CQP A;  1EET B;  2HLT A;  3OHB A;  3KG1 A;  2FY1 A;  2AYE A;  4WIQ A;  1B0T A;  3MPW A;  5CQG A;  3VVU A;  2X1F A;  2G1H A;  2WVD A;  4WTO B;  2D69 A;  4ZPD A;  2W4D A;  4JI1 F;  4ED6 A;  4O44 A;  2XS5 A;  4I2P A;  1DAR A;  1F0X A;  3ICL A;  1CJU B;  4F2R A;  1IBL J;  3M2V A;  2IMW P;  1YVF A;  3Q8P B;  3THP A;  2ILY A;  4DPT A;  5IZH A;  4DR3 J;  2IM3 A;  1K73 T;  1UFL A;  3CJS A;  4PZV A;  1N32 J;  1OQ3 A;  4F3Q A;  1YRX A;  3GLJ A;  3CCM S;  3IA0 A;  3DOM B;  1KSP A;  1I94 F;  3R2D J;  3NCR A;  3BDP A;  1S6P B;  2CAD A;  2GIF A;  4DMZ A;  2DHA A;  2RQK A;  3QO9 A;  1VQP S;  5J2M A;  3Q89 A;  2BJ1 A;  4NPO A;  3ZXW A;  2YNF B;  3Q2S C;  1TL1 A;  2HWT A;  1IKX B;  2L48 A;  2VJU A;  1T05 B;  5E3A A;  5DM7 Q;  4HKQ A;  2NQP A;  2FC8 A;  2FHJ A;  4C3M A;  1GK8 A;  4QU6 A;  1RBL A;  2WBR A;  1D1U A;  4ZPT R;  1TK8 A;  3OL9 A;  4DR4 J;  1U49 A;  1Y0H A;  1PBU A;  1HBN A;  2DTJ A;  2ROP A;  1NLK L;  1S1X B;  2XWY A;  1REV A;  2CIM A;  2YNI A;  3MTK A;  4HAC A;  2EFV A;  5FLX U;  3UCU P;  5H9F K;  2F8M A;  3PEH A;  3DDI A;  4CYU A;  1WD6 A;  2RRB A;  2RRN A;  2CQG A;  3GJS B;  1RU1 A;  3DYA B;  3WHI A;  1RTH A;  1SKS A;  1YBT A;  1JWW A;  1IKV B;  4FYV B;  2XMM A;  3HD2 A;  2QLW A;  3QRP A;  1FK9 B;  4U8V A;  5HVG A;  3FK4 A;  4PG7 A;  2CQ3 A;  2CQ1 A;  3K5O A;  4YB1 P;  2X1G A;  4H4K A;  2MZ1 A;  5HQ8 A;  1T3N A;  2PDA A;  5KFZ A;  2CQB A;  4P10 A;  1NZ8 A;  2AF6 A;  2RIJ A;  4IFV B;  5CYM A;  5HVF A;  5KFL A;  1WEL A;  3UDV A;  1KP6 A;  5A8K A;  4ZVF A;  3FCH A;  2KH9 A;  2HVE A;  4KH0 B;  1XMO J;  1C0U A;  3OFG A;  3QZ8 A;  1S72 S;  4K4X A;  2HNZ A;  3PRV A;  2B6A B;  1FDN A;  4QR2 A;  3N9U C;  1LQ9 A;  1KQK A;  3U1L A;  3K7R A;  4OJ3 A;  1WWH A;  2O3D A;  3GG1 A;  1BE4 A;  1RAG B;  2KRB A;  4WFY A;  3K59 A;  2EWH A;  4O23 A;  4ANC A;  2ZFH A;  4C97 A;  3NP5 A;  2DNN A;  2DNP A;  3ELH A;  4UW2 A;  5T7L A;  1U1N A;  5KAK A;  4C4W A;  1OYD A;  4R8U A;  4DU8 A;  3C6U B;  2KM8 C;  2MLY A;  5LXY A;  1DTT B;  4ZVP B;  3O2I A;  4JI1 J;  3FCV A;  3M2R A;  2HHP A;  5A8W B;  3ZZR A;  4DUY F;  1PJ5 A;  3OTO J;  3AOC A;  4OI6 A;  3CCV S;  2BE7 D;  4OLO A;  4G1Q B;  1FJC A;  2MSS A;  2YNG A;  4FF1 A;  1RAF B;  1HIY A;  3OL8 A;  1YJW S;  2ACM A;  4TNO A;  1Y5N B;  1L3T A;  2YXL A;  4LSL A;  1FVQ A;  1MLA A;  3U1N A;  3CJK A;  2HMI B;  3TAM A;  3M9N B;  2JVO A;  5IT4 A;  4ECR A;  1UP1 A;  1FRI A;  4KC5 A;  3R5G A;  3ZZO A;  5EX0 A;  4DLG A;  1LW2 A;  2DRA A;  3DRX A;  4WXW A;  2FHM A;  4FF3 A;  2QA2 A;  4XAK A;  1Q95 G;  1CQN A;  2DHG A;  3R97 A;  2B56 A;  2M70 A;  4K5S A;  2RS2 A;  1S1U B;  2C2O B;  1RP5 A;  3MI7 X;  2APO A;  2Q79 A;  2V2K A;  5AXN A;  3G96 A;  5I3U B;  3RBX A;  2RDJ A;  2CQI A;  1O8B A;  2D3O R;  2NZ4 A;  1LK5 A;  2GMJ A;  1RT5 B;  5F8L A;  4I7F A;  4CO1 A;  4GC7 A;  4LRE A;  5BYR A;  5KG7 A;  2CYY A;  2OD6 A;  2CWK A;  4HHJ A;  4RW9 B;  4CM2 A;  3IBF B;  1FE0 A;  4ED5 A;  1U2F A;  1V5I B;  1HMV B;  2X3D A;  4XTT A;  2Z2Y B;  4GVL A;  2F4F A;  2YPZ A;  3M32 A;  3QPI A;  2VU5 A;  4X84 A;  2ZHA A;  4OZ3 A;  1KLM B;  1R6Y A;  2PMH A;  2IAJ A;  4HT5 A;  1VI7 A;  1VQ5 S;  5LL6 d;  4DOZ A;  2DGW A;  2IJR A;  3RBZ A;  4ECU A;  2PA3 A;  1G6B A;  1SJF A;  2ZVI A;  5HAO A;  1HWI A;  3CJ4 A;  3OSN A;  4F4X A;  1RT1 B;  4KSE B;  4ZCI A;  3RB3 A;  3NLC A;  2W01 A;  3CDB A;  4FBT A;  1FTR A;  1S6Q A;  1B99 A;  2MQN A;  3W5Y A;  4ZCK A;  2H1Y A;  3MOJ B;  2EFN A;  2BEF A;  4USH A;  5KFH A;  5CH7 B;  2N3L A;  2WVB A;  1N5Y A;  3RAM A;  2AEF A;  2PD1 A;  1KTV A;  1H2U X;  3PJ9 A;  3UPF A;  2FTR A;  3RAX A;  1SIW B;  3ULH A;  3UN2 A;  2MKH A;  1HYS A;  2GQC A;  1R8A A;  1TVR B;  2KL8 A;  2V0N A;  3K89 A;  1NPP A;  2MLX A;  3K8V A;  1TEL A;  2RB7 A;  3JSB A;  4Y2I A;  2XO6 A;  2ZH8 A;  4K0K J;  3BGR B;  2RKI B;  5KFE A;  3F44 A;  4RU2 A;  2RML A;  2J9E A;  3PO5 A;  4IQX A;  1AFJ A;  1QD1 A;  5KOW A;  1RBA A;  5KG0 A;  1UWB A;  1VBY A;  4UZB A;  1ZTW A;  2K3K A;  1CJV B;  3TX0 A;  2WW8 A;  3TYT A;  2ZZM A;  1D09 B;  1N5V A;  1NH8 A;  1SIZ A;  1T3O A;  1JLF B;  1HNV B;  4LFB J;  2ZH1 A;  4F3O A;  3PZP A;  2ERR A;  2DPI A;  1IBC B;  5DET A;  1HNX J;  1M5K C;  2MEW A;  2FPH X;  4LRF A;  4ZVT B;  5H1S V;  3DC2 A;  4DV7 J;  3NNH A;  1F2H A;  4DG1 A;  1JKH B;  2FLO A;  2W24 A;  4K8R A;  4M8L A;  2ZH7 A;  1J27 A;  3HUL A;  1URN A;  1VJW A;  5G4D A;  3KLF B;  4KIA A;  3A8E A;  3BO4 A;  1QY7 A;  2MQP A;  1OJ4 A;  1YI2 S;  3DRS B;  2FJX A;  2VPX B;  4PG8 A;  2QGF B;  3BN4 A;  5GAD U;  4NLR A;  3QMQ A;  4KQZ A;  3FBF A;  4NWB A;  3N01 A;  4RBT A;  1M5H A;  3NS7 B;  3QT5 A;  4OYB A;  4WK3 A;  5B09 A;  1TKX A;  1F3F A;  3D6T B;  1DY3 A;  3MHY A;  3PCO B;  4F26 A;  2BAC A;  2NZC A;  3IGV A;  1NK9 A;  4PQU B;  1ZM9 A;  1FO1 A;  3KDN A;  3OR1 B;  9ATC B;  1WI6 A;  1R43 A;  3L9Z A;  4WWS A;  2KFZ A;  1HBO B;  5C24 A;  1EQ0 A;  3MMJ A;  1U1R A;  1UVK A;  4QR1 A;  2V34 A;  3QYY A;  4CCH A;  4FZV A;  4J9V A;  1XK8 A;  1TKT A;  3MCN A;  2R4F A;  4J9U E;  2B0G A;  4KKO A;  1ZPW X;  3T5K A;  4N41 A;  1RBO B;  2CJX B;  2AU0 A;  1RT4 A;  1KFD A;  3QIP A;  3HI9 A;  2GJF A;  4KAI A;  3SCK E;  1QSS A;  2R8G A;  3MEG A;  2A10 A;  4KBI A;  3SBM A;  2AYM A;  4F67 A;  1E6V B;  2GJ2 A;  1S9G B;  2H5J B;  2V4J B;  4ZVQ B;  4NLV A;  1TP7 A;  5L8R C;  1SV5 B;  3UD4 P;  1VQ8 S;  1RDR A;  3AD8 C;  1KOH A;  3QSI A;  2OMO A;  3TJA A;  3D0I E;  4DF4 A;  5K8O A;  1HI8 A;  1UCN A;  2KN4 A;  2WSF C;  2LEC A;  1HNZ F;  4QW8 A;  3K5P A;  4WE1 B;  3UD5 A;  3IR5 B;  2JEF A;  4HI1 A;  3T1A A;  3PG9 A;  3I5C A;  1T03 A;  2R7R A;  3G86 A;  1XNQ F;  4WZM A;  3PXG a;  2JSX A;  4LQ3 A;  3MM9 B;  3J81 Y;  1Q7L B;  1NDK A;  3NEK A;  4DI6 A;  2KFY A;  2HHT A;  3R7N B;  1LOU A;  2F1F A;  2B3T B;  2ZDP A;  4DR7 F;  2BJE A;  2X1A A;  1RWW B;  2GC8 A;  4ELT A;  4YP3 A;  3KJQ B;  1VK3 A;  3IM9 A;  1VQL S;  1WTB A;  2CPJ A;  5HBM A;  5L39 A;  3PX4 A;  1IBM J;  1KKH A;  2K1R B;  3FRY A;  1V9O A;  3OR2 B;  2FZC B;  4IH5 A;  1P27 B;  4M5D A;  4OYM A;  4CH7 A;  3RW6 A;  2KT3 A;  2WHO A;  5CD4 H;  2WCX A;  3UN3 A;  4DPU A;  4QWA A;  4QYR A;  2V8P A;  2D7S A;  2RAQ A;  3NWG A;  3G9C A;  2WSC C;  4YHH J;  2XS2 A;  2CPF A;  3ISN D;  3GJQ B;  4JOU A;  2MHE A;  3T1Y J;  4X4V A;  1TAU A;  4F0K A;  1BWE A;  3HSD A;  3PV8 A;  1X0F A;  2JNJ A;  1XEZ A;  3ZTO A;  1NJW A;  2HQD A;  4Q7A A;  3KOA A;  3H25 A;  1CEZ A;  4LFC J;  3AY0 A;  1FA0 A;  1RCO B;  4Z7Y A;  6FDR A;  2GV1 A;  3ADA C;  4QIV A;  4CLK A;  3OV7 A;  1FX2 A;  5H9E J;  1RTD A;  3IRW P;  5HVH A;  4USK A;  1PG5 B;  4HEA 9;  3J7A N;  2J8A A;  2OPP B;  2XYG B;  3G8Q A;  3VTI A;  3P45 B;  5GVQ A;  1FER A;  2Q3P A;  4RR5 A;  5KFW A;  1RT3 A;  4J9N A;  1IBL F;  2WB4 A;  3LW5 C;  5C5J A;  1SVD A;  2VOO A;  3L4B C;  1PYS B;  4USV A;  1XIQ A;  1PIE A;  3ENW A;  3F73 A;  1BWV A;  1YJ9 S;  5ETT A;  3AJD A;  3I9Z A;  2BW2 A;  3HFK A;  3MAA A;  2UVW A;  5ADZ A;  1YGY A;  2IVY A;  2BXJ A;  4X62 F;  1FES A;  1BUX A;  3CC4 S;  2XSJ A;  2NXJ A;  3KKF A;  2HVH A;  1HPZ A;  3DDN A;  2KT2 A;  1Z1Z A;  4J91 A;  5G0R B;  3G8T A;  2MDA A;  5CXT A;  5JVG Q;  2BAB A;  4ID5 B;  4EO8 A;  1H7W A;  2QFI A;  2YQ1 A;  2C3O A;  1VCT A;  2WVF A;  2DR8 A;  4NZ6 A;  2R2T A;  3KDO A;  1FEH A;  2HLU A;  4P2S A;  4XK8 C;  4E8U A;  4JI4 F;  3ENA A;  4BC9 A;  1X4F A;  4KT0 C;  1KQS R;  1HNW F;  1A9N B;  2CFX A;  1KDN A;  4DR7 J;  2W1B A;  3IMQ J;  1TMJ A;  3IBW A;  3HSG A;  3OUY B;  3W65 A;  3D0G E;  5HN0 A;  1EKR A;  2HWH A;  2MZT A;  1PYO B;  2HAI A;  2XMK A;  5DO2 A;  4ECQ A;  2FJW A;  1YZ6 A;  4U9R A;  4PR6 A;  2AZ1 A;  2FJB B;  2VBZ A;  2N3O A;  1T9T A;  4B9M A;  4BWM A;  2I5J B;  1S1W A;  2E1A A;  3JQK A;  1MWQ A;  5F41 A;  4D3G A;  2ZC3 A;  2UVR A;  4LF7 J;  2ZIT A;  2LP4 A;  4I68 A;  5HP1 A;  3GJT B;  1ARO P;  4BHQ A;  2B9W A;  4RJV A;  4RX6 A;  2AMC B;  4DS4 A;  1U25 A;  3LAL A;  2XC9 A;  2LQ9 A;  1RHR B;  2YWF A;  5H9F J;  3RB4 A;  4FYY B;  2CG8 A;  2C3P A;  2CQ4 A;  5DS7 A;  1QAY A;  3C6T B;  4W98 A;  4ZMM A;  5LOQ A;  4F4W A;  3GV8 B;  1OWX A;  1GXU A;  3G82 A;  4YME A;  3OXL A;  1EZZ B;  3KJF B;  3CJ2 A;  5D4P A;  1RHJ B; 
#chains in the Genus database with same CATH homology
 4OYW A;  3C16 A;  4CLW A;  4P2X A;  2GVZ B;  4CLL A;  3C16 B;  3R5G A;  4OYX A;  4WP8 A;  5D0E A;  3MR7 A;  4P2M A;  4CLF A;  1WC1 A;  4CM2 A;  5IV4 A;  1YK9 A;  4OYO A;  2GVD B;  4OYM A;  1WC5 A;  1CJU A;  4CLU A;  4OZ3 A;  1CS4 A;  4CLS A;  4USW A;  1WC0 A;  2GVD A;  4OYP A;  1FX4 A;  4CLZ A;  1CJU B;  1CS4 B;  4NI2 B;  4OYA A;  4UST A;  5D0R A;  4OZ2 A;  2W01 A;  4NI2 A;  4CLK A;  1FX2 A;  1Y10 A;  4WP9 A;  1CUL A;  3C14 B;  1U0H A;  1CUL B;  1Y11 A;  4USV A;  3C14 A;  1U0H B;  1CJK B;  4WP3 A;  1CJV B;  3MAA A;  4CLP A;  1CJK A;  1CJV A;  1TL7 B;  3MAA B;  4OYI A;  4CM0 A;  1YBT A;  1AB8 A;  1TL7 A;  4WPA A;  1CJT A;  4OYZ A;  3UVJ A;  2QV6 A;  1AZS A;  5D0G A;  1CJT B;  3UVJ B;  2BW7 A;  1AZS B;  3C15 B;  1YBU A;  4OYB A;  3C15 A;  4P2F A;  4CLT A;  4CLY A;  1WC3 A;  3ET6 B;  2WZ1 A;  1WC6 A;  1WC4 A;  3ET6 A;  4USU A;  3G82 B;  5D15 A;  5D0H A;  3G82 A;  2GVZ A;  5IV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...