2GVDB

Complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with tnp-atp and mn
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
189
Chain Sequence
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAIRQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase
total genus 54
structure length 189
sequence length 199
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvdB00
1Y10A 5D15A 1CJUA 1WC0A 4USVA 4CLFA 1TL7A 4NI2A 2GVZB 1Y11A 5IV3A 1AZSB 2WZ1A 1CS4A 3MR7A 1CJTA 4WP3A 3R5GA 4OYAA 4USUA 4WPAA 4CM2A 3C14A 4OYZA 4CLUA 5IV4A 3MAAB 4OYXA 1CJKA 1U0HA 2BW7A 2GVZA 1YK9A 4WP8A 4CLWA 3ET6A 1WC3A 3C16B 1YBUA 3MAAA 4P2MA 5D0GA 1CJVA 4OYBA 4USTA 2GVDB 5D0RA 3G82B 1FX4A 1AZSA 4CLPA 1FX2A 4NI2B 5D0EA 5D0HA 4CLYA 1WC6A 1YBTA 3C16A 1CS4B 3UVJB 4CLLA 4CLSA 1WC1A 3C14B 1CULB 3G82A 3C15B 1CJKB 1WC4A 4P2FA 2QV6A 1U0HB 4WP9A 1CJUB 4CLTA 4OYIA 4OZ2A 3UVJA 1TL7B 4CLKA 4OZ3A 4P2XA 4USWA 1AB8A 1WC5A 4OYWA 4CLZA 3ET6B 1CJTB 4OYMA 4OYOA 4CM0A 1CULA 4OYPA 1CJVB 3C15A 2GVDA 2W01A
chains in the Genus database with same CATH superfamily
2DIUA 3G8QA 1ACMB 4QW9A 1T9VA 2A2CA 1LWXA 4HHHA 3O2IA 1K44A 1WSRA 2C2NA 2QZ8A 4TQSA 2HVZA 2MJNA 4HT5A 2IJFA 4CO4A 3RZAA 4RWWA 3GTYX 3KMSA 4ZP6A 4JYAJ 4PWDA 1T8EA 3B4MA 2AZ1A 4N47A 3QIPA 1HW9A 2XNQA 1NPPA 2AKWB 3LGNA 3UWTA 4M95A 1IKXA 5EX0A 5K14A 4OL8A 4ZIVA 2X3GA 2YX4A 1YJNS 4RW6B 4JI7J 1Q8IA 3W66A 1NH7A 5ETNA 2DGUA 3MM5B 1U45A 1QSLA 3CMQA 2HQGA 1EP4B 3M32B 1QM9A 3KJVB 1JNRB 1JNZB 2HHPA 1UTAA 2BJ1A 2LEBA 4J9VA 2GCFA 1SJRA 2B4PA 1Q0NA 1FJCA 2ZDPA 3MEEB 1GAOA 2W2NP 1N6QA 2VJVA 4QPTA 5D77A 2FQQB 1HIYA 1Z1ZA 4YY3F 4YEAA 2AYGA 4PG5A 3ZC4A 1ZZNA 3QT6A 2R2TA 1OY6A 3KK3A 1XMOJ 1HNVA 5DM6Q 2YNFB 3VQSA 1E6YB 1DTQA 4DZ6A 2RU3A 4EWTA 4ED0A 2DB1A 1GX6A 1GMWA 2P6SA 1MN9A 1OYDA 2R3VA 2R7VA 1Q16B 3J81j 1YLXA 4N5SA 1N48A 2DCUB 2AJ2A 3CDWA 2HFZA 2RKIA 4F26A 1XBWA 1VS3A 5M2PA 2QV6A 5J2QA 4RW9B 3D66A 2XHCA 4K5RA 2GS8A 2HZVA 1SQFA 2WW8A 3GJRB 1Y5NB 5L46A 3I5CA 1RT1A 4ANCA 3RBXA 4LRBA 2HMIB 4F3MA 1R0CB 4ELVA 1IKVB 3FKBA 2YNHA 1S1UA 2DGQA 5HL7Q 3G6XA 4LSLB 4JI6J 2KYXA 5J2NA 3IFEA 5GAGU 2OPSA 4OHWA 2R8JA 2JWNA 1UVKA 3AAWB 3SYZA 1NSAA 1SC3B 4IR9A 4DI6A 4DV2J 3W9IA 2YH0A 5IT9U 4LVOP 4K5SA 3E3XA 1W7WA 3JAMU 3M7VA 4QCLA 1AW0A 1N36J 2DH7A 2BUNA 1VQLS 4R8UA 4LRFA 3TP2A 1VQ6S 4P52A 1LXJA 1ZAVA 4PPZA 4OX9J 4CIOA 2XY5A 1EJ7L 3ILOA 2DR7A 3PHTA 1NK8A 3POTB 2MQQA 4HTIA 2NZ4A 3MMJA 4OHXA 1Q8KA 3C6UA 1H7XA 3PRVA 3I4PA 4C9DA 3KLIB 1WC5A 2ACYA 1KQKA 3HPOA 1LFWA 3DDNA 5FJ4A 2I5JA 3CCES 3G6ES 3QFHA 3TEGA 3TAQA 2QE5A 3MMCA 4USVA 1CQNA 4PYAA 4WU2A 1UVNA 2PMWA 2HEKA 4PWWA 3GIRA 4M1KA 3SSRA 4PPDA 2E5LJ 1HBOA 3C14A 2H3EB 1SVDA 7FDRA 1TKTA 1TK8A 1LXNA 2DNPA 3EE3A 2F40A 1CJKA 2YTCA 2DBBA 4WTYA 1N4LA 1HD1A 1FNOA 2BOPA 4LFCF 1H3DA 2ZOMA 1VLOA 2R7TA 1RAJA 4ED1A 2X1GA 1T3NA 1EIYB 2D3OR 2ZNYA 3I0SA 3G2XA 2G1DA 3T5JA 5B08A 1FX2A 3OFFA 4LR9A 2V4QA 5KFLA 1UEVA 1X5SA 4IFYB 3UD4P 1ULRA 3W2VA 1RWPB 2AMCB 2QT7A 4HI2A 2V4JA 3IR5B 3MECB 1CVJA 3BSCA 1YX2A 4YOEA 3OUYA 2BJEA 1FXDA 3HDSA 5HLFB 1UCNA 4ZP7A 4K50A 3DXBA 3W2WB 5CYMA 2C2RA 2HVIA 3A8IA 3UN2A 1TKXB 3W64A 1EETB 2K2PA 3MR7A 3VCDA 2IBKA 3AD7C 4IYQA 5FLXY 2DT9A 5I42B 2IMWP 2MY7A 1H7WA 2R7QA 3FSXA 4X4VA 1RYSA 2M52A 3R1LA 4FBTA 1N54B 1T02A 4L76A 4KV8A 3GPAA 1K47A 3QZ8A 3ISNC 4M8LA 3ZZOA 2WVBA 2XSJA 3C6TB 4O3QA 2BA9A 1KQFB 3PW2A 1WHYA 3PM9A 2R7RA 5E3AA 1VI7A 4U96A 5M2UA 2PDAA 1ZS6A 4H4KC 2LKZA 3IGVA 2GJIA 4LF9J 1VRUA 4PUOB 2BJ7A 1Z2ZA 3LGMA 3VVTA 1ZYQA 4ID5A 2KM8C 1U2CA 1I94F 2YKMA 1UPPA 3WDOA 2RSQA 2Q1LA 1KR4A 3EZ5A 3AA9A 1BQNB 4HHUA 4WYLA 5B0EA 4NXMF 5E7OB 2RS2A 2FJVA 5KFJA 3P3DA 1JXLA 3HHLA 2AJFE 1RI7A 1OPIA 3MAAB 3OTCA 4BC7A 3QGHA 2HS0A 4IG3B 4K4UA 3PYDA 4A47A 5ETOA 3MCSA 4NXMJ 3J7Z5 4TY8B 1RAIB 4KPYA 3VTIA 3DRRA 2DO0A 1F3VA 4EO8A 3PW4A 2YKQA 4DUYJ 3G82B 3LP2A 3MAQA 1QSYA 1RWVB 4TYBA 3C16A 1SKWA 4HT7A 2R9LA 1FE4A 3KK1A 2HZCA 2IFXA 4YDDB 2VC0A 1A7GE 2YWKA 1CJUB 4UUXA 4ZMMA 1EKRA 2W4PA 2DGTA 1SIWB 1XTZA 3TAMA 4DV1F 4HDHA 4F3OA 3OL6A 4FDFA 3SQGB 3H4DA 1GMWD 1FXLA 1IR1A 2GC8A 1J5EF 4ZLNA 2GGPA 1CSJA 3I82A 3ENWA 1P27B 4PXBA 5F9LA 2B51A 3E01A 2VU5A 1IVZA 1H2TZ 4QR2A 2MB0B 4IG0A 4O3PA 3IS9A 4Z7YA 3M8RA 1G3OA 1U8SA 4C2MA 1VIXA 3UN5A 2JJ4D 2A10A 4ES2A 1MW7A 3THTA 5LMNJ 1RHKB 3U7JA 3DLEB 3FBCA 1N5QA 2YNGA 4DR3F 3N79A 3DKDA 2BM0A 3TWZA 4I56A 4OI3A 1ZM3A 2F65A 1N0UA 1KBRA 3SDEB 3V81B 1JJ2R 3QRRA 1Q1KA 1CG2A 5RUBA 2NS1B 4V19J 3MUVP 1RTIA 3QWUA 2QMXA 3MI7X 5KG2A 1YG0A 3EDRB 4FXWA 1NNDA 4DS5A 2OPQA 3I0RA 3HVTB 4AXJA 3H2VE 4Q8EA 5B0FA 2DR9A 1H98A 1N5SA 1TFWA 2UXCF 2L9WA 1PG5B 2W9AA 4K4XA 2XTJP 4CLUA 1VMBA 2DNQA 4RW4A 1VBKA 4ECTA 4J9QA 4QIGA 4QWDA 4DQIA 2WAQD 4K4SA 4G1QA 4FF4A 4DCOB 5FDLB 4ZK7M 3IR6B 3IBWA 4Q5VA 3U02A 1W26A 3QRPA 3C66A 4BDPA 3MEKA 3A3OB 3W3SA 1RHJB 3HVRA 2W7PA 3M4XA 2M88A 1G7CB 2QFIA 4GMKA 2FLPA 2BX6A 3W5XA 2VASA 4LT6A 4HL9A 4Y34A 5KT2A 2J9DA 3MMAB 3TOQA 4ZOSA 3BN4A 1RWMB 1NKEA 1GXTA 2UXDJ 4RO0A 2EEYA 1K1SA 1P8GA 3IG1A 3V6JA 1S76D 4C4WA 3CC7S 2CPEA 4CO0A 1KSPA 1XNQJ 4K2XA 3TZWA 3DLKB 1V9OA 1Z4UA 4DCJB 3EXYA 4ZLJA 4O44B 2GVZB 1HBMB 1M0SA 2XS7A 3GQCA 2E5HA 3KWMA 4DQQA 4BCAA 2XMAA 1Y0HA 1REVB 3VZIA 3QPIA 4J9MA 4URGA 3HULA 2DPJA 4RLEA 2AYEA 1NLKL 1NB2A 3SBMA 4DSLA 2KZMA 1DRZA 1U1RA 3HZEA 1CLFA 4B17A 1JKHA 2FC8A 3CIZA 2HK3A 1XR7A 1S97A 5HN0A 4LQ9A 2A18A 4J9KA 1PYSB 3M8QA 4A4JA 2GA7A 1G6BA 2OEMA 3CT9A 1NJIT 4PR6A 4DR7J 2CDRB 3O5TB 3K7RA 3CO0P 5HROA 1JJHA 1NK4A 1C0TB 1FFGB 2P9EA 4I7FA 4PRFA 5E5NA 3IRXA 5IV3A 1CS4A 4YFUA 3BR9A 5AXLA 3ZZPA 4ZVOB 4XPCA 4MIBA 1YGYA 4DQSA 3EDQB 2Y1JA 2U2FA 1LWEA 4Y2KA 2BW7A 2XLIA 1FEEA 4UT4A 4ZPCA 2M8HA 4WYWA 3QAUA 2YWEA 2DKOB 1DQ8A 4ZHRA 2XLKA 2IJRA 3MEGB 1XNRJ 2QSFA 4ZCKA 2CNKB 4NRUA 2ASLA 3EVMA 1CC7A 1IQZA 5B7WA 4J9RA 1MLAA 2W9BB 1SKUB 1EZZB 5FIIA 4J9SA 5L1KA 2O5DA 4I2QA 2RILA 3L9ZA 3RB4A 3OSNA 1SJFA 4DLGA 3TUIC 3QT8A 5LSOA 3HD2A 3GIMA 2ASJA 3DOMB 3CGIA 4KSEB 1FRLA 3ZFVA 1CJTB 3GR1A 5C42B 2W24A 4XO0A 3N5FA 3UCZP 1NUEA 3DDIA 1GX5A 8ATCB 2JFDA 2DNZA 3HLUA 3N6LA 3FSYA 2J9DE 2MMYA 2V94A 3SZ2A 3MD3A 2Y0SD 1FRIA 2C2KB 2MDAA 2MGZA 4XDCA 2QLBB 5A76A 3ET6A 2FZKB 1D0EA 2CQBA 2CZVC 3J81Y 1K1QA 3BYPA 5J2PB 1HHSA 2LDYA 3Q83A 4IOAQ 2W25A 4AYBD 1R8PA 1VRQC 4FNIA 1MWYA 1HW8A 4CH7A 3RGIA 3LTOA 2EFVA 4YR2A 1IUJA 4HH0A 4J5OA 2FJXA 3H25A 5HBMA 4WXWA 5AXNA 1IQTA 4WFYA 1FRKA 1SJQA 1UMJA 1KLMB 2GW8A 4JI3J 3BBCA 1DBDA 1YIJS 3GIKA 1O0PA 3QMQA 2OP5A 3WZ0A 4DMZA 5F8IA 4Y65A 4LMZA 2E5JA 3QIPB 3WX8A 3NNAA 2J9EA 1PC4A 2VV5A 1OJ4A 5EHHA 1IKXB 1RAGB 5K14B 4B9MA 1R6VA 5KFQA 3HM9A 2V0NA 4IUFA 2AYMA 4NEYA 3OTDA 1PAUB 1TAQA 3KLFA 4LREA 4ZVFA 1JLFA 2QA2A 3KDOA 1FI4A 1VK3A 4MFBB 3H2LA 1N32F 4CYUB 1U0HB 2JLEA 3FVYA 4P75A 2GJ2A 1XN9A 2G2OA 5ETMA 1NDKA 4Z2XA 2QMWA 1LWCB 2NYIA 4U67Q 3R7SB 2DHAA 2GQ2A 3NGUA 3BO2A 2DGOA 2C2OB 1RWNB 3ZNUA 2FD2A 2KVIA 1S6QA 4P7TA 2QRRA 3ZZYA 3SFGA 1BQMA 1OY8A 1HNVB 4O4RA 1NPKA 4P71A 2C2EA 3KNAA 5J1EA 3T1YJ 3FJ2A 2B43A 3MOZA 1RHRB 1W2IA 3PHEA 3HF5A 2KJWA 3IXQA 2NZCA 4G1PA 1TK5A 2J8AA 4X62J 3QAEA 1QJHA 3G8SA 2HIQA 2RKIB 1LWFA 3CE8A 5J2QB 1KQGB 2ZH7A 1RWUA 2KDOA 4CLLA 2FVSA 5L8RC 3Q8YA 2JC1A 1RT1B 5EDWA 2CPIA 2WSFC 5HAOA 2VZ9A 1KTVA 2ZEJA 2XO7A 1JLGB 4KKOB 2PA3A 1GTHA 2AWZA 3L95X 1T94A 2WB1D 2YNHB 1JLCB 5IQQA 1X4HA 1X9WA 1D3WA 4B3SF 4Y2CA 2OPSB 3P5BP 3BSAA 2OTJS 2FB0A 2LLZA 4Y2MA 4NLXA 1UVLA 2AGQA 1JXEA 4QIVA 1FTRA 2RIJA 3CMAS 4HEA9 2HHXA 5B0DA 2XGQA 1U6BA 2M2BA 2XGPA 4BLGA 3M8SA 4NZ6A 2OHDA 4LF7F 3LALA 3CCZA 2HPUA 3D0GE 3GJSB 4EBEA 1M1GA 1NHKL 4JP8A 4R8UB 4ECSA 4KTQA 5HMYA 4DR2J 1NEEA 2BZ2A 3AB4B 3DLJA 3NCPA 2BMBA 2C3YA 1OQ3A 4KB7A 4R0JA 2G0IA 3C6UB 1T95A 2E9TA 4QYZK 2BVZA 3H5SA 4QYRA 2B9EA 4O0NA 2V63A 3MURP 1YDLA 3V4MA 1WG1A 4YHHJ 4USIA 2DPIA 1PAEX 1HD0A 2KL8A 5DGAA 2OO4A 2KKHA 3SCJE 1E6VB 4ZPVR 2I1RA 1Q8BA 2EWHA 2XS2A 3OXFA 1TVRB 3KKFA 1I6JA 1URNA 5AT1B 2GIQA 4DFJA 2ZDOA 3PVXA 2LDIA 4OYPA 2PT0A 1TKTB 2U1AA 4PQUB 5D15A 3MPUB 2LVWA 3LPEA 3FC9A 3TQEA 2JLFA 1D9DA 4USUA 2RDDA 4F2SA 3FRYA 3D6FB 4RUCA 2BRLA 1YK9A 3TA2A 5IWAJ 3I0SB 2VDIA 4K0KJ 5F8HA 4DR1F 2HQDA 2LQ5A 4XK8C 1X9SA 2GMLA 4JV5J 2JX2A 1XJWB 5SUHA 3TVYA 3W65A 5CAAA 2R2RA 4B9NA 2OJ3A 2H54B 2XMWA 3NCQA 4CRJA 3DLBA 1S0OA 2FJBB 2RD5C 2IM0A 2P9CA 4RUHA 4MJKA 4OX8A 2HAFA 3BH6B 1FNXH 1KRPA 2V4JB 4DR1J 2OSQA 1AXQA 2HQ3A 3PJ9A 5CYMB 2MZSA 4NLWA 3QIDA 2LQJA 1RWWB 5D78A 1N5YB 4GKJF 2DNLA 2DH8A 2LCWA 3NXZA 2F4VF 2BW2A 3JSBA 1QD1A 2FLOA 3RBZA 3IWNC 1DLOA 2ZJQQ 4QR1A 1HI0P 4AT1B 4KV8B 4DUTA 4F25A 4WPAA 2B8PA 4OYZA 1VQYA 4CNYA 2XSJB 2EFNA 2CZ4A 3PW7A 1IJFB 3D6MB 2ZUGA 3MFIA 2SXLA 1YRXA 2OLWA 2WW4A 1ROFA 3CC2S 1HNXF 4Q7AA 4QJVA 3KJQB 3J7AN 5DG7A 3OVAA 2GIFA 4KYZA 4OIXA 4USHA 1OIAA 1KC8T 1S0MA 1X5PA 2M5YA 2F8MA 1PYOB 2IA0A 2IY5B 2YKMB 3C19A 3VALA 5HO4A 2UVUA 2YX7A 4ZPWR 4BS2A 4RJVA 1M5PC 1TL3A 1IBKF 3HHKA 4KGZB 2DHGA 2GHPA 4RNHA 2QLWA 4Y28C 3HHLB 3OL7A 2OMLA 2VIHA 1U48A 1S1TA 3MM8A 2HVHA 3RB6A 2WVFA 9ATCB 3THPA 2WHOA 1AUDA 1S9EA 2RQ4A 3DRRB 3I9ZA 1HMVA 3R5BA 3LP2B 3K5NA 5KFTA 2AQ4A 3UR3C 1N0VC 1S5ZA 3M9OB 3C16B 4I1TA 1AFJA 1O51A 2GVDB 4DV5F 4LIRA 1MMNA 5D6GA 2BJDA 3TAMB 1RT4A 1TU0B 3I31A 4PZVA 4N7TA 3CC4S 4DR6J 1TL5A 3OFGA 5GMEA 2B9WA 3MM7A 4M5MA 2QO3A 1VCTA 4PXEA 2ZZNA 1MROA 1OSCA 3E01B 1TV6A 2E5GA 4F02A 2F8HA 4P2SA 3IS9B 2V8PA 2VFUA 1Y11A 2VB6A 2NR0A 5LT5A 4P72A 3KLHA 3IA0A 2ZH1A 3MEDA 1RDRA 3K59A 4F0HA 2XY7A 3Q8SB 4DPOA 4QIFA 3K5MA 1VBYA 2KG1A 1NSQA 1IBLJ 2DNHA 1PJ7A 4NEZA 2YWFA 3IAS9 4WCEQ 1RT6B 4DR4J 5E3QA 3PR4A 1KWMA 4KE5A 3UI3A 2ADBA 2ZBPA 2ROGA 4OZ0A 5CCLA 4QPXA 1S1WB 3VAJA 2AHOB 4FVMA 1Q5VA 2C2ZB 3KLGA 4P73A 1S6PA 5F8JA 5KFFA 4DX5A 4DPWA 2VG5A 1RHUB 1TKDA 4RBTA 2IA6A 2HGMA 2MZ1A 2OPQB 3I0RB 3KMQA 2K7KA 5MAOA 5KOWA 2W7AA 5BYRA 2QA4S 1UA1A 5HK4A 1WHXA 2H5IB 1PGZA 4F8RA 2WONA 5AJ3J 4N77A 2XCAA 2W2QP 3ENVA 2B4UA 3HT0A 4WXOA 2MKCA 2MSSA 3WIVA 1TFYA 1SJ1A 5LMUF 1PSDA 4B3RF 4DPUA 4X2BA 3K8WA 1JMTA 1JLQA 2LXIA 1FEHA 5J1NA 2LEPA 1ZAXA 3ZTRA 3R97A 3DOKA 1L5UA 3HZGA 4LRDA 2ZUAA 3H59A 3Q24A 2PFFB 1JXVA 1J5OA 2F9DA 4DL0C 4U6PA 1YZ6A 3GG0A 3RYLA 2VBWA 3GU0A 2VKZG 3GV5B 4LVNP 2A1BA 3RAQA 4WWSA 3BB5A 1FKAF 1JJCB 3OFEA 1QVGR 4CLYA 1S9GB 5JXSA 3J7YU 3ETOA 4DV7J 1KFSA 4GO7X 1REGX 1S4FA 1URRA 2VPXB 5JVGQ 1P1LA 1WOSA 1VQMS 1HNWJ 2UUAF 1JLBB 1PC5A 2ZJRQ 1RAEB 2R7WA 3RG6A 4AL5A 3MAHA 3MM9A 3M2RA 3UNYA 2FLLA 2DXDA 4PG7A 2VL1A 4H4KA 4NYPA 3QT5A 4WIIA 4PXDA 3CF5Q 2HHQA 1LKZA 3RTVA 2CAJA 2B4VA 2WBMA 2Y1IA 4S0MA 5C24A 1DTTB 4DJBA 4MT1A 4G6VB 4ED4A 5IV4A 2WSEC 2V50A 2IPOB 1PJ5A 3GYXB 2IVMA 1PO6A 5A2QY 1ZTWA 2Z58B 1JKHB 4CH0S 2R4FA 3A12A 4C97A 3J7YI 3ICLA 5KFAA 5KG3A 3OR1B 3M8QB 2DY1A 2KTQA 1XMQF 3AB2B 1TQLA 2OD4A 2D3ZA 3LF0A 1F9FA 1FO1A 3EXCX 4X84A 4LFBJ 1WG5A 1XMBA 4JV2A 5IM0A 2FJDB 2W1BA 3LA0A 1XWLA 1X4FA 4DDFA 3T1HJ 1XQIA 4ECYA 4I7FB 2HNDA 2V8VA 2ZBCA 2FGCA 1ZM4A 1KHWA 4X4PA 3TR5A 3ZTQA 2APOA 3ITHA 1M5KC 2IBOA 3R6GB 4PXCA 3G6YA 2OI2A 4Y2AA 1RCXB 2DNYA 3OTOF 5K5MA 2OEJA 1RZMA 3R5GA 4ZHRB 3W8PA 3EJMA 1VRTA 5K8PA 3VAFA 1VQ7S 4WE1B 3PTWA 5H9FJ 1RHQB 3AOCA 1YTYA 2I38A 4C0HA 2CQCA 2L41A 2DIVA 3EM1A 1WWHA 3MTKA 4X64F 4USTA 4YB5A 1FERA 3SV4A 1NZ8A 2F3JA 4WBFA 4FXVA 3HFKA 4NI2B 2YXLA 4ERDA 3UNGC 4K4WA 3PYGA 2HZAA 3MF5A 1WC4A 2QL9B 3VAGA 2CYYA 1WHVA 1MMDA 1ITPA 3PX0A 1VHIA 1IKYA 2A3JA 4TQRA 1ZBTA 1EARA 1FNMA 3BPSP 3JSMA 2UVWA 3CJKA 3UCGA 5KG7A 4K59A 2VA3A 1CJVB 2MLYA 4GC6A 3T9NA 4X4SA 1LV5A 1SH2A 2HFVA 5HP1A 2DO4A 3M8YA 4R5PB 1RP5A 3U1LA 2ADCA 2ZD1A 2MZRA 2XBPA 2J0QD 2MQLA 2BACA 2B0GA 3M2UA 3TVKA 1S10A 1MG7A 1QVFR 1OWXA 5CYJA 2RRNA 3N6MA 2E1MC 3MM6B 2OMOA 1R8AA 5I3UA 1H72C 1RK8A 1GQEA 4IFVA 2RJZA 1C1CA 2VONA 4NLDA 1NPRA 2IM2A 2XZWA 2H5EA 4FYYB 5DG9A 4WK1A 4RU9A 2C42A 2AEJA 4CO5A 5F0UA 3CCUS 1RT2A 2FTRA 4IO1A 2ZZMA 1BHNA 5FLXU 2AJ1A 5H9EJ 3PV8A 1S77D 1Y5IB 4O3NA 3DMJA 1P9QC 4D3GA 1KQSR 2CXEA 3CD0A 1RAFB 3E51A 3G71S 4QWBA 4DV6F 4JI4J 4LSZB 4M5DA 4AFFA 3KJNB 1RA6A 2O3DA 2GFFA 1JLAA 2V2KA 3KLVA 3VHQA 5GAHU 4DL2A 5GMKa 2KB2A 2GHWA 4CO3A 4DQRA 4G65A 2IAJB 2WOMA 1HI8A 1YJ9S 2IYGA 4KC5A 1M90T 2W9CA 1RB0A 2KXNB 4NLRA 2DGWA 4TLRA 3ZZ0A 4ED3A 4WP8A 2VPYB 3JAMY 3J80U 2FHKA 5ETVA 5K9FA 4X65J 4ZCLA 4RWXA 2JVOA 2XCPA 2ZC4A 1JLFB 2RF2B 5KFCA 5CABA 3W9JA 1VYAA 4YB7A 2GO9A 1HHTP 5L1IA 2Y9HA 1H0HB 1RE1B 2CPJA 3V6KA 1I1GA 1APSA 2EK6A 5C7PA 1U1NA 3MCNA 3KLEA 1S6OA 4EBDA 4N56A 2OGUA 2VBZA 3F56A 1HQUA 3FNNA 3AA8A 1RBAA 5B0CA 2HNZA 2BE7D 2CQ4A 1C0UA 2EW9A 4MKBA 4F4AA 2E7VA 1RTDA 2C3MA 2W4DA 1S6QB 1Q5YA 2GV1A 1BQMB 1C4AA 3NS6A 1RA7A 1TL7A 1SB6A 1SUQB 2VBYA 5IT0A 3TZZA 2CWKA 3V4IA 1FVSA 3NBPA 2CPXA 4C8NA 1X4AA 1Q78A 2X51A 4AQYJ 2X1FA 3G87A 4QIEA 3C2PA 5DDQC 4JBCA 2VG7A 2E5IA 3UO0A 1HQEA 1HNIA 3AJ2A 4WZQA 1YVFA 1RT5A 1ZM9A 1LWFB 4NPOA 2AJQA 1VOMA 4OZJA 4LF2A 2QLJB 3Q0AA 3AT1B 4ZP8A 3THVA 1FJGF 1DARA 3E2EA 5D3GB 3RBDA 3TJ8A 5LOQA 3SXLA 5D0EA 3NNHA 2WBRA 5T41A 4IRKA 2G9OA 5C5JA 2DD8S 3K89A 4A8XA 3QLHA 3TZYA 3NGRA 3PG9A 5JVHQ 3BEGB 3K5OA 3CB4A 1RU1A 5HJXA 3LP1B 4I0WA 3PFEA 1I3OB 4F36A 1FWPA 2NXJA 2HRTA 2ROPA 4QWEA 1WTFA 3T5LA 1NB7A 3G6VA 4N41A 4EYHB 4KHPJ 1QTNB 1R0AB 4B3OA 5DDPC 2C2DA 3RR8A 3ULHA 3VQTA 2BKOA 4BBYA 4QQBA 2VHGA 2XQCA 3DLGB 2HHVA 3KHHA 2RUGA 4JI5J 2D3O1 2WVCA 4JI2F 4JI0J 1SXLA 2B9XA 2E44A 1WKKA 3LUYA 3T3FA 5C25B 2M0GB 2NXUA 1HNZF 1YBTA 4Q0BA 3IWLA 4K4ZA 1S7IA 3FEZA 2HLUA 5KFNA 1FKPA 1U6ZA 4JI2J 4L72B 5HJYA 4H4MA 4CP5A 1F2GA 1MMLA 4ID8A 1R27B 2BANA 3PEJA 1K8AT 4FPIA 1P1TA 1YKWA 4DS4A 4ITSA 1ELOA 1LNQA 5A8RA 5A8KA 1MU2A 5ETLA 2EBGA 1FCAA 1SC4B 3GLJA 4ES1A 5CQGA 2HWTA 4ED5A 2N7YA 1UKUA 4ZVTB 3IC1A 1HBUA 2RHSB 4XDDA 2B8QA 1B99A 4ETXA 2QYCA 3FZ2A 4GC7A 2E1AA 1U2FA 4K2JA 4M94A 2PMZD 4DV0J 1UVJA 3VV2B 3QO9A 1SC6A 1BE4A 2B9YA 2LQ9A 1Q79A 2AYBA 4DV4F 2IVYA 2D1CA 3TUPA 2HS4A 3M2VA 4XTTA 2ZH8A 2C3PA 1QUPA 5IC6B 4PWUA 1RTJA 2WB4A 3P49B 5E41A 2O67A 2BQ3A 5KG6A 2OFGX 1FDNA 2DNKA 5IFMA 2KXFA 5DRKA 3OD2A 2XNRA 3BPDA 3HVAA 8AT1B 2MQOA 4O3OA 4M5GA 2CPDA 3PR5B 3VAMA 1GEHA 4NLGA 1H74A 2K1RB 1RYRA 2OPRA 1SQGA 2R8GA 1NZAA 1TL4A 3DNCA 3JQJA 5AXKA 3UFCX 2CPHA 5LL6d 2UZAA 2AT1B 1VIOA 4ZVUB 2DRAA 5IQ6A 1B0PA 4GKKJ 3BYRA 4DEZA 3CJTA 2UUBJ 3MWBA 3OFHA 3R1HA 2PEBA 9RUBA 3BGFA 1DFDA 4UY8T 5L1JA 2UXBF 3CNQP 1HBNA 5KFRA 4P9SA 4FNHA 4USMA 3HSZA 4MH8A 2DY9A 1XR5A 1FESA 1X9MA 3S01A 3DI6B 1WHWA 4OLOA 3SMZA 3NMRA 2LQ8A 4ZCIA 3CCWA 2UU9F 1U49A 3OPKA 3I55S 4ILMA 2QN6B 1VDHA 1IWGA 1TUGB 7FD1A 3JXOA 3DHXA 2HWIA 4NCGB 2BKNA 2ERRA 2XYPB 1FA0A 2Q66A 2AGPA 3UE2A 4CCHA 4HACA 4CTAA 2XWXA 4NL5A 1S1TB 3MM8B 4LF4F 3DC2A 5KFGA 4DHVA 3FFIA 3DLHA 2CNOB 3FCHA 2RE1A 4Y6IA 4Q8FA 1S9EB 2J0SD 3DOLA 1Y10A 4LF5J 1U25A 2YBVA 1HMVB 1DZ5A 1M5VC 4K4VA 3FCWA 2ZKTA 4IOCQ 3PEHA 4RW6A 2ZVIA 5IC4B 3LW5C 4CM2A 3PO4A 3FEXB 2VJUA 3MM5A 4RBUA 5CD4H 3EVOA 3M32A 1I5OB 1NAQA 2PA8D 3CJSA 1JIHA 4RW7A 3MGJA 1RT4B 2D9PA 3CXCR 4N76A 3QSYB 3VAIA 2D7SA 5D0RA 2QLXA 2YNIA 1KVJA 2Z2MA 1YBAA 4ICLB 5D4NA 5L9NA 3MM7B 4IOBA 2BKPA 1YQHA 5KFHA 3MEEA 2HVEA 1XEZA 3TANA 1MROB 3W5YA 1FFWB 1NJWA 1AT1B 4ED6A 2J0WA 1RJJA 2D69A 1WELA 4U7UK 4PG4A 3KLHB 3L3CA 3D1HA 5KFWA 3MEDB 1U4BA 1WKLA 3J81U 2YNFA 3NS5A 1E6YA 4LF8F 2XG8A 1AZSB 3A8KA 5K8NA 2QL5B 4OJ3A 3HHLC 5FD1A 4J9LA 4KBIA 3UDLA 4RW9A 4W98A 3TQ1A 1NXIA 4C8YA 1GT8A 2CDQA 3W1YC 1Q53A 3MPVA 4XIUA 3KLGB 2QC3A 4YY3J 1S6PB 2YWWA 3OW2R 2VG5B 5DZ7A 4ANDA 3ZNJ1 1UL3A 3MPDA 2CIMA 4B9VA 1F5AA 3MDFA 1IKVA 1D1UA 1H2VZ 4LSLA 4LBHA 2CVEA 1TKZA 1AFIA 1U47A 3M8ZA 3R3TA 1B0VA 4OZ1A 2VG6B 5KFOA 4C11A 4I68A 2GNKA 3MR5A 2DITA 4KFBB 1GMVA 3LQVA 3BH7B 3CEDA 4USWA 2P2CB 2L9DA 4QW8A 2GX8A 1JLQB 1FT8A 2GAHC 3MD1A 1Q7LB 1IXKA 1YJRA 3DOKB 4NZ7A 4A8SA 4WFNQ 3M9MB 4ZLLA 3SI8A 2JNJA 4CO1A 4G3IA 1NK9A 3LAMA 1J5OB 2HFNA 4B9SA 3BSNA 4ANEA 4DUZF 4Q2MA 4KPCA 5F3TA 4MIAA 5F8LA 3POTA 4ZPAA 2FZGB 4EZ9A 3MMBB 1RHMB 3GG1A 1HHQA 3U27A 6FD1A 4DL3A 1NMEB 3LP0B 5KT4A 3ZXWA 2PO4A 3QGIA 4F0KA 3CCQS 2RB7A 1BGXT 5T7LB 4Z7CA 1FFSB 2VPZB 1NK7A 4QWAA 2H65B 1T9UA 2NPIA 3M2RB 4MKAA 3D28A 1OS5A 2W4CA 4OLPA 5GAGI 1TR0A 3KYLA 2KRRA 2JOQA 4NX9A 2CJBA 1X7VA 2A0FB 3OL8A 4FS2A 5LXYA 4CLKA 4A8WA 2ALZA 3D2WA 4KY3A 3H5UA 4ZCMA 5C24B 1R7IA 3PACA 3E8OA 1R43A 2DXEA 2BRKA 3C15A 5BR8F 2CPFA 5ETSA 2V69A 4CT8A 3AOAA 4WTOB 2RMLA 3EYZA 4TY9A 4TXSA 1WF0A 5KFMA 4OFZA 2W2OP 1DURA 3D3CJ 2ZJPQ 1F9HA 4UOFA 1U1QA 1SL1A 1RKIA 1RT7B 2RVJA 3T5HA 4FN5A 4ZVQB 3CJ0A 3GV7B 3BDEA 1SL2A 1WOOA 3C3LA 4QIWD 2OPPB 4KQZA 1NSPA 1QAIA 2AJ4A 1FK9B 3DRSA 4RW8B 3MECA 1T3OA 2L08A 4ZIWA 1SQEA 4LFCJ 5G4DA 2G2YA 2L3MA 2AF6A 3PW5A 1K0VA 2BQRA 2BJ8A 2ZBIA 1NJZA 4B3TF 3HFVA 4C0BA 2Q6CA 4DZDA 2CUYA 2HNDB 4UZCA 5I42A 2FZCB 2JEJA 2G2ZA 2RU9A 1OQ6A 3ITHB 3AY0A 5CXTA 4NLPA 1WD6A 5ITHA 4DWIA 1HWIA 1BY9A 4NA2A 2HG4A 2FC9A 2KT5A 1SV5A 3VAHA 3ZTSA 2B7CB 2ASDA 4B3TJ 2C2MB 4U95A 2ATLA 4WFZA 4EFAC 1RTHA 2J6UA 2HIYA 2Q6BA 4B3MF 2CADA 4AD6A 3T19A 5ETPA 3US5A 3KK2B 4PUOA 2AU0A 2R7SA 3QJLA 4JI8F 4O0IA 5IZHA 4OMFG 3R5CA 4DL6A 3AQPA 2WTFA 2IHR1 2AJ0A 1DY3A 2DTJA 4IO9Q 2ASYA 4DX6A 1B3TA 1F5BA 3VVUA 4C8MA 1M5SA 4UUWA 4DCPB 4I6YA 1HYSB 2KVQE 4J9UE 4WF9Q 3I9V9 4C6AA 1OMSA 2OKQA 3NOGA 4FF2A 3SSSA 1F0XA 3NG8A 4J7CA 2MKKA 3M8WA 4JI1F 3S6EA 3G9CA 1XIQA 3DYAB 4K7QA 1KN6A 2N4CA 2RUSA 5HP1B 3AODA 2CQ2A 4BWMA 3GFHA 2YH1A 3PYEA 1LW0A 2ZD1B 4QU6A 1I94J 3DGVA 3M2UB 5DZ6A 1PBAA 2Z56B 4ZVPB 4RPFA 5ADZA 1Y00A 3H42A 3OTEA 2LFVA 4IFVB 4ZDNA 3KJFB 4NA3A 1A0OB 3FQKA 1X8DA 3M05A 2IVFB 3EGVA 5D8HB 3O1LA 3B82A 2M70A 2EFQA 1IKWB 4NLUA 4I4BA 2I8EA 1T9TA 2KYZA 3KOAA 2X7IA 3PZPA 2HVDA 4LRAA 2HAIA 3R27A 4FYWB 1WSVA 5KFKA 1U1MA 3H40A 5A6WA 1AYEA 2Q3PA 4ZN1A 2EC2A 3B6BA 5KOXA 3ONQA 1A6LA 2WOMB 2ABYA 4DV1J 4ED7A 1KD1T 1U1KA 1KVIA 3DRPB 2W9CB 5IT4A 3IN5A 1HPZA 1GTEA 1NKCA 4DR5F 1VHFA 5ETKA 5U47A 3N0VA 2V8DA 1J5EJ 1BD6A 2FPHX 4CI0B 3P6YC 4M5NA 3SDEA 3V81A 1WI8A 4H54A 2NXNA 4C8OA 3SSQA 1UJ6A 3VAKA 3GSIA 2B5JB 4L3NA 2E1RA 4WIQA 2F8EX 2HKEA 1L3VA 1VQPS 1KTQA 1LK7A 1WF2A 2RQCA 1C4CA 2BE9B 1Q8LA 4P2MA 3DLLQ 1UPMB 2EFPA 4OYBA 3GCWP 3TUZC 1FTCA 2OELA 3KLEB 4EZ6A 1UW9A 1NBEB 2NCKL 5DETA 1C2PA 3ZTPA 2CPZA 4J90A 4ECRA 1RAAB 3JTOA 4DR3J 1FDBA 4OI6A 1MNEA 1G1XA 4IRDA 2JRSA 1JK9B 4LFAF 3OSPA 1VBZA 1R8HA 1R31A 4UQGA 1A9NB 5FDLA 2MKJA 1TL7B 5HSPA 4UOGA 1Q86T 1RABB 3V4IB 2EFOA 4MYUA 4RZRA 2W7OA 1X4EA 4HTJA 4F4YA 4OV6A 2YQ0A 1HQEB 1T05B 1HNIB 5KTQA 4U7CA 2FIUA 3WC2A 4LSNA 3TJ9A 1SKSA 2UXCJ 2EG2A 1RT3B 3QGPA 3M8PA 1FVQA 1RBOB 1N33F 4UOCA 3OXLA 4GRSA 2RHQB 3BKTA 1Y5LB 2RDIA 1WC3A 4CO2A 5D0GA 4X66F 2XMUA 5CZVA 4FS1A 4XAKA 4A8OA 1RWKB 3QLHB 2W2MP 2QL7B 3Q2TC 1FX4A 2MTLA 1HBMA 3T9ZA 1L3KA 3JYTA 1X5TA 1YJUA 1VQ5S 5L1LA 4I69A 1REVA 4I2PB 4BC9A 1S79A 3GIJA 5I4MA 3IWXA 4I6AA 5KFUA 3HHNB 1RU2A 1JWWA 2G4BA 1GH8A 2ZOGA 1M5HA 1AA1B 4C3LA 4WZMA 2XLJA 4NZ0A 4DSEA 2QA1A 2YKPA 3CDBA 2O01C 2NUUG 2ZH5A 2QFJA 4LRCA 3Q8RB 3T6JA 3ILLA 2DNGA 1EHWA 4OI2A 2CWXA 3SIPB 4NXNF 2QLFB 4O4GA 4WFXA 2B6AB 3HCXA 3ZZZA 5H1SV 2XB2D 1J27A 4TN2A 1SI9A 3Q22A 3BBFA 2Q43A 4Q0BB 1PKUA 4ZPBA 3NWRA 5KFEA 1QAJA 4ECVA 1C0TA 4X4QA 5CYQB 3BS9A 3TA1A 1KOOA 2PEHA 3HO1A 3BDPA 2V34A 2AEMA 2XMMA 2BANB 2R8KA 4KGMA 4HH1A 4TNOA 2NXCA 2UUTA 5LXRA 5HQMA 1Y7PA 2D41A 3BKUA 3B78A 1MU2B 2YX1A 3BN7A 5K20B 4TU9A 4DFKA 3MEGA 4OJHA 5HVGA 3KFWX 5F9NA 1HBUB 3RU0A 2FJAB 2Z0GA 2IC3B 4ZA1A 1VC5A 1G4CA 2GAGC 2ZE2B 2VFSA 4TYAA 2GJFA 4DF4A 1OO0B 3QO9B 1KKHA 3PX4A 3UD5A 1U7LA 4DN9A 4ED8A 2XZTB 3M2VB 3G86A 3CDUA 3BGLA 2WRMA 1RTJB 2UUCF 2RH3A 5C42A 2PI5A 1XK8A 2BE2A 2RRBA 1WACA 2AEFA 3AXMA 2VQFF 3DCAA 2A2DA 2R2SA 4F4ZA 2YKNB 3BREA 3WQPA 6AT1B 3A1YG 1MWZA 4LF6F 3CJ5A 3H7HB 3DXSX 3QWPA 2HHUA 3FRZA 2MZJA 2CNLB 5A2QU 4ZVSB 1QAXA 3Q8VA 4P2XA 2FJWA 4J9OA 3OLAA 2EBEA 3QFWA 4CM0A 1RBLA 2AGOA 1CULA 4RNOA 4GVBB 1S9FA 1UJ5A 1IN0A 1XR6A 3IP0A 4OZ5A 4LF6J 2VKRA 3MOJB 2ILZA 1SIZA 1JLEB 2MYFA 1U09A 2DR6A 2UP1A 4FPRA 1LW2B 5ETRA 2DR8A 1F3FA 1S1VA 1V3RA 3DGPB 4TLQA 3M9NB 2G0CA 4B02A 5IS2A 4JYAF 3DHWC 5KFSA 1U2RA 3Q8PB 1TL1A 1ZA1B 1RWOB 4CQ1A 2JL9A 1N56A 3EPGA 1NO8A 5LM7E 3JSRA 3T6BA 3GMGA 4OI1A 4RKUC 5KT7A 2AP6A 4LBPA 4RNNA 3W60A 4JI7F 1KLMA 4HACB 4CTAB 3HI9A 3R2DJ 2F1FA 3EZOA 5F8NA 3FFIB 1KOHA 4PCQA 1RTZA 3CO9A 3H2UB 2EKNA 3EICA 3DOLB 1WJ9A 2CJ9A 3EVWA 4PWDB 1NU4A 2J0XA 3R9LA 4OYOA 5CZXA 4JOUA 2VICA 3FQLA 1FXRA 3HHDA 4F2RA 2OEKA 2CQ3A 2R8IA 3KHGA 1S57A 3KUGA 4MFBA 4RW7B 2RRAA 4CYUA 2QJ3A 3PRDA 3Q8UA 1U0HA 4AUKA 5DDOC 2YNIB 3W9HA 2EK1A 1HWUA 1XMOF 3JB9k 1LWCA 3GILA 1QE1A 3ZTOA 3D5MA 5KG4A 4OZNA 2XO6A 3V6HA 4J91A 3P45B 2Z2LA 2CFXA 1X4GA 1T03A 2O66A 2WSCC 3GSDA 2VOPA 1N6QB 1N32J 3UDCA 4O23A 5J1PA 4ZLPA 3CJ4A 4F4WA 2MKSA 1UJ4A 3LGHA 3R6LB 3SCIE 3KK3B 3CTRA 5C2CA 2IRYA 5M2RA 2KN4A 3BR8A 4JI6F 1N5VA 1DTQB 2MLXA 2RQMA 2EC0A 3L4BC 3Q8QB 2KH9A 3N28A 3D0IE 4A8FA 2Z2YB 3CUNA 1LK5A 1NKBA 4DV2F 1JLGA 4KKOA 3SFUA 4CZCA 3FDSA 2VQEF 4IDKA 1HWKA 1JLCA 3CCSS 2HFSA 2F63A 1TKZB 3BGRA 3CULA 2Z8QA 2I0XA 3KG4A 4H4OA 1N36F 3KDNA 2HQFA 4C11B 5C2GA 1WC6A 4OX9F 2CNNB 1S1UB 5J2NB 2VQEJ 1VJQA 3CJQA 1HWLA 5KFDA 2WVEA 3I6PA 4C8KA 5L38A 1S49A 3N5BA 4NMXA 2QIFA 3PY8A 2XZDB 5KT3A 1X4CA 3KUHA 1UEUA 1B4SA 3CJ2A 3O6QA 2PE8A 4B3SJ 1SCJB 2VPWB 3M30A 2E5LF 3GE9A 2R42A 2E7WA 3PJXA 3A3NB 2V9KA 2YWGA 1L3TA 2OUGA 1NK0A 1E6VA 2HQIA 2HFUA 2KZZA 1U6FA 4ZVEA 1TVRA 1U8WA 2CG8A 4LF7J 4L74A 4DOZA 1K73T 5D4PA 5KFIA 2QSWA 3TI0A 1YHQS 3MCMA 4PQUA 4DSFA 2I5JB 1S0NA 3MMCB 2J7UA 4ZPDA 3PYFA 1V6HA 3CD6S 5E3PA 2B56A 4DN0A 4ZVGA 3NGTA 4CLSA 1HBOB 3C14B 2OSRA 2YKAA 3C15B 4B9TA 1CJKB 4OI0A 1OYEA 4RU2A 3G96A 4IQMA 3MXHP 5DM7Q 3TX8A 2HFOA 3OHBA 4I6WA 4QYZJ 5HMXA 4WK3A 3CCJS 4AXIA 3QATA 1HI1A 3CPWR 3RAMA 3EGNA 1YJ7A 3DRSB 1WEXA 3TAPA 4X4UA 4EO6A 2CQGA 4DSIA 3ZZTA 1KVKA 1R8BA 3N6NA 4OHVA 1PYTA 1JJ4A 4CLWA 2F4FA 3W2VB 2EVZA 1RLDA 2RT3A 3PNIA 1N5YA 3OUYB 4IR1A 2A6OA 3QZ7A 2XS5A 2FVQA 1F2HA 2MQPA 2W8KA 1VC0A 4UY85 3CCVS 4LF9F 1SV5B 3PW0A 3OLBA 4ECZA 3W61A 2CJAA 1VFJA 1VLYA 2GZOA 1QLNA 5A8WA 2MPUA 4F4KA 2EPIA 2MJUA 1RTHB 1KHVA 2PI4A 4FYVB 1UVMA 2HW3A 4WFAQ 1FD8A 2FJEB 3K8VA 1WORA 1NHUA 3CIMA 4WFBQ 1H2UX 3IM9A 1YRUA 2HBYB 1JQGA 4GKJJ 2ZM6F 3AFGA 4YS2A 2F4VJ 3J80Y 1N8RT 1GFWB 4M63A 4KRWA 1M5OC 3QRQA 3A8EA 3CVKA 1VRUB 5HMWA 1WG4A 2CPYA 1X4DA 2DGVA 2QX0A 2BR0A 1NSKL 1ZPVA 3H4BA 2KHDA 1X31C 2ZBRA 2HURA 2ZM6J 4QR0A 3UPFA 4ID5B 2BXJA 3LAKA 2C28A 4DUYF 2MY8A 1ZM2A 2VOOA 1HNXJ 3DM2A 2E9RX 1KDNA 5DDRC 3TARA 5D0HA 2MQMA 2FVPA 3R5JB 2CQIA 2DGXA 2DNNA 1WC1A 3GP9A 3CD7A 1LW0B 1UZDA 4IH7A 2ZC3A 3PKMA 2LXUA 1HLWA 1LOUA 2IDEA 4WP9A 1NM2A 2HRUA 2QEXS 3GZ7A 1HA1A 3LPYA 2XHWA 2E66A 1NJXA 1IBKJ 3GIIA 3QBCA 2R2UA 4NOHA 3BSOA 2GVDA 5L39A 2FYXA 4DXLA 1NDLA 1KLNA 3F44A 4E98A 4A8YA 1QDUB 4FYDA 2UUWA 3HFZB 5JMNA 3FGVA 4MKYA 2JEIA 4N8NA 4WP3A 4WKYA 3D1QA 3SCLE 4TVAB 3KK1B 2HGLA 2QYGA 3IGNA 2QA4G 5DQIA 1EX8A 4KJIA 4V19X 2KFNA 5IOLA 2C3OA 3AOBA 3V2UC 2PFDA 5A6PA 2IRXA 3NLCA 4MYTA 1ZTTA 1Q82T 4HHJA 5LMNF 4F4XA 3PX6A 3MUMP 1BUXA 3CCMS 4YQWA 4MK9A 2GGPB 3L7UA 4DV5J 4ZJOA 3O8WA 3A3PB 3PDNA 2LP4A 4FKYA 4IG0B 4USJC 4DFMA 4YN3B 4NYOA 2DCLA 1HPZB 2HS3A 2P9GA 4CLTA 5THWA 2DHSA 1V5VA 3RJMB 1RT6A 4E0DA 2HSEB 4KH1B 5HATA 3HJVA 2MKIA 3Q2SC 3S1TA 5GMDA 4Y3CA 1VGYA 1V5IB 2UV8G 2BJ3A 1S1WA 4EMDA 5KT6A 2YNGB 1VISA 1NH8A 3D6HB 4KT0C 1PCAA 3IM8A 4YUDA 3DDKA 1R89A 1WDTA 4NLYA 4C98A 4M5JA 4A8MP 2IIHA 3UDEA 1K9MT 1LQ9A 1RTIB 1WKJA 3GFYA 4NYZA 2V2ZA 4DLEA 2H4YB 4L3KA 3MUTP 3M1VA 3CCTA 4RX6A 2VFTA 4ELTA 1VJWA 1UP1A 3GWCA 1WEYA 2HHTA 5DQHA 4DPYA 1YJVA 1U1LA 2UXDF 2H48B 2J5AA 1HQ2A 5B0AA 2RDJA 3ADAC 2GMHA 3NL0A 4URSA 4C8LA 3RRHA 5DS7A 4RW4B 2DEIA 3G8TA 4G1QB 1XNQF 4UF4A 4F0MA 2Y1RI 5GADU 1TUWA 4LQ3A 4LSNB 5G0RA 3NKYA 4K4TA 3M8PB 2J6SA 2CJQA 4DF8A 2LEAA 2ILYA 1YI2S 3KHLA 2C22A 1S9GA 5E33A 4MAKA 3OL9A 5BYQA 2Y1LB 3GONA 3FMWA 4O3SA 2JHEA 2FY8A 2JZ5A 5LMUJ 4B3RJ 4KIAA 1JLBA 1IR2A 1GXLA 1S6UA 1FHTA 3IG1B 4CT9A 2Z4PA 3JYTB 3IBCB 2W8LA 4Q44A 4A8KA 2DR5A 1FRHA 2VFVA 2MLZA 3U1NA 4EK2A 2K06A 4P6QA 4MMOA 1DTTA 4JUZA 2MKYA 3GJQB 1TP7A 5GADI 4B9UA 2KI2A 1WOPA 2XI3A 5GAEU 1R8CA 3RRKA 2PD1A 5B0GA 2BV3A 2UUAJ 1FE0A 1RAOA 4DR7F 1YITS 4WJBA 3TRGA 2VC1A 4C48A 3SEOA 2GQCA 1FWKA 4O4GB 3OR1A 3A4TA 3TNVA 5CA5A 3DU5A 5EWGA 2D3UA 2NYHA 4Y2IA 1X5OA 4URQU 2X1BA 4IH6A 3RAXA 3P5TL 4USKA 4RNMA 4MK7A 1Y3JA 1XNRF 5KFBA 2YY3A 3VR1A 4R25A 1WDDA 3HSJA 1IWAA 3V5RA 5HROB 4NCBA 4DX8H 4DL5A 5GAEI 3BO3A 3LH2S 3B54A 4CWBA 1OY9A 1CEZA 2HBQB 4OX7A 3IRXB 3IBFB 3CMES 2BDPA 1CS4B 2JVRA 4OJGA 1XMQJ 4FYXB 4KHRA 4QOTA 4WE1A 1LWEB 3OV7A 4ZVHA 3HHLD 3FZBA 3UVJA 5I3PA 4HKQA 3I87A 4OJ1A 1RLCL 5F8MA 4DU8A 2KT3A 3FBBA 3HX9A 1VQNS 2PGCA 3VZHA 2VODA 5F41A 3I5BA 4CLFA 4NI2A 2DRDA 4P7VA 4I2QB 3OTOJ 3K57A 1HL6A 3D6TB 1DQ9A 1Y4ZB 3W7BA 2WCXA 3P96A 4U9RA 1C1BA 2BE2B 1Q7YT 3ETMA 3TUJC 5CCMA 1CJVA 1HFEL 2NUHA 2ZH9A 1TMJA 3OVSA 4X64J 3PIPQ 1R0BG 4BWJA 4Z37A 1VQ9S 2HGNA 4QZVB 3CDEA 4C8ZA 5CD4A 4R5PA 4ILRA 3TW0A 4L75A 4W92B 1IJEB 1IM6A 1CULB 1BMQB 1SJ3P 3RR7A 2P6TA 2R7UA 2C3UA 2P8IA 4UW2A 3B4DA 3IMQJ 2MGZB 1WI6A 1U1PA 2BEFA 2B3TB 3MM6A 1WEZA 1VBXA 1RADB 2EKYA 3V6DA 3ET6B 1UFLA 1B7FA 3DRXA 1S1VB 4ER8A 4JI3F 3ZO7A 4ECUA 2WK4A 1ZZFA 5J2MA 1TL1B 2JLGA 4F67A 3OR2A 5EWEA 2RS8A 5T14A 3NGSA 2Q79A 1B64A 3OQ2A 3U1MA 2YPYA 5B09A 3F41A 3TVZA 3WBZA 2CQ0A 3S8SA 5BYSA 4ECWA 1FWLA 4HVZA 1IBCB 1FJ7A 2B4OA 2DNOA 2YVSA 3BV8A 4ETZA 2JH3A 3JTPA 2LYVA 3L7OA 3OXGA 3VWSA 4M5IA 2ZKUA 5HBMB 2CG4A 5I3QA 2JEGA 2MEWA 2ZHAA 3M6VA 2IAJA 3BF4A 5CH7B 3VGVA 3QGGA 3OVBA 3NEKA 4BHQA 4HI1A 2OAUA 4TU7A 2JC0A 1P6TA 1BQXA 1YRTA 4L73A 3KG0A 3NNCA 4DV3F 4DV6J 5E3CA 5IT9Y 2RF2A 1T9XA 3OBIA 3R7NB 3F73A 3CCRS 1KEKA 3KLFB 2DH9A 1NRKA 3HSGA 2HYIB 3MHYA 4CH1A 2Z2ZA 4U8VA 4X4NA 2CJXB 2ROEA 3K0JA 1FF2A 1SH0A 1WNEA 2L48A 4OYXA 2OD6A 4DV3J 3VF0B 4UTGA 1QE1B 3T1YF 2UVVA 3HSDA 4Q43A 3OHAA 3VGSA 1G2EA 1H73A 3RB3A 2LA4A 1IM4A 3CJ3A 2QTWA 4X62F 1PIEA 5KFPA 2HRYA 3OTBA 2K7JA 5GAHI 4LBIA 1F1BB 1RACB 2V67A 1T03B 4X4RA 2YKOA 5KG0A 1D9AA 3UN3A 3WIUA 5F0WA 4IQXA 1SUQA 5BJRA 1ICEB 5AE2A 4Y00A 3UD3P 3N4WA 1KP6A 5F8GA 1N52B 2DVIA 3ISND 4JV0A 3M6UA 1T9YA 3KHRA 4ZP9A 2VD3A 1MWQA 5J1EB 5KFXA 2HNYA 3D7SB 1S99A 3H90A 3N9UC 3LANA 3LWLA 4ZKAA 2WVDA 4LJMA 3K5LA 4RR5A 3WHIA 5D3GA 3GFXA 2EXUA 3AQOA 1D9FA 4CNZA 2LQBA 2QG9B 1FKOA 4A46A 2VUGA 1B0TA 4O3RA 3Q89A 4OYAA 4IDKB 1I51B 3BGRB 1UWBA 2E1CA 2E29A 4H4OB 4ZVRB 1RXOB 4UOHA 4DR2F 3PFOA 2CA9A 3LP1A 3LO3A 1XC9A 1MSWD 2HBRB 1FJGJ 4WU3A 3NOCA 2FDNA 4YHHF 4JV1A 1L3UA 5D4LA 2Z57B 2N3OA 1R0AA 1FRJA 3TZXA 2KHCA 2ZHBA 3FBFA 3HP6A 5D4OA 2GHVC 3DLGA 4OYIA 2JSXA 3M30B 2NSCA 3CD5A 5DLGA 1F5CA 1RGVA 2MQNA 4ED2A 1GXUA 5C25A 5LSRA 4F7VA 2KO1A 3K17A 2EFGA 3OT9A 1ZH5A 2ZVSA 3TEHB 3AXKA 1CPZA 5IWAF 4K0KF 4YDXA 1YJTA 2KG0A 3C8YA 4JV5F 4EBCA 2NREA 4JB8B 1VQ4S 3P8BB 1U1OA 1PBUA 3D67A 2XC9A 4J9NA 1KS2A 3CDAA 4J37A 1HNZJ 5LJ3Y 4E8UA 5AE3A 3I5AA 5AXMA 1F6TA 3GB0A 4FVCA 2ZFHA 2AX1A 2EG1A 1U26A 1HWJA 3IO1A 5DQGA 5AE1A 1EQMA 4OYWA 4OHYA 1LFPA 3AH6A 1F60B 1X4BA 4DG1A 4ZS6A 1NDPA 2M9KA 1CQMA 2R7XA 3BGOP 5EN1A 3PRBA 1DAXA 3AD8C 2JDJA 3KTQA 1AROP 2LECA 1T0TV 2P5VA 2J6TA 5A0YA 2YPZA 2XMKA 2J76E 2K1RA 4L6V3 5DGBA 2H9ZA 2XMJA 2GO8A 3IR7B 3ZZRA 4OHZA 4K8RA 2HWHA 4YB1P 3X3UA 5A8WB 4DV4J 4OV1A 8RUCA 1DLOB 1JB0C 4D3HA 2K3IA 4XPEA 3GV8B 1FDAA 4NCAA 3R7BB 4KO0A 2CVIA 4P2FA 2XY6A 2DHXA 4NWBA 2F7VA 1N88A 1S1XA 3QYYA 2LU1A 4ENOA 3BJYA 1N5TA 2N4DA 1TUVA 3GR0A 4DQPA 3DI6A 3A8JA 3K2YA 1W25A 3VGTA 2IYIA 2NSBA 2XMVA 3VGUA 4DPTA 1B7YB 2V8GA 5HMZA 2B7BB 5KFYA 4NCGA 4DFPA 4Q2LA 2ZBQA 2MZQA 4RL1A 3DM2B 3JS9A 1TL3B 5K8OA 3D0HE 2XEXA 4AE5A 2UXBJ 1N34F 1Q95G 3FUYA 3H5XA 2CZ9A 3QNWB 1Y3KA 2N3LA 5KG5A 1T11A 4DR6F 3TYTA 5HVHA 2UU9J 4FF3A 5E3RA 1SC1B 1ZOTA 2E1PA 2MHNA 3SQOP 3H98A 1ZAWA 2FUG9 4ZITA 3D9BA 1N34J 4OZ3A 4X4OA 3IAM9 1QSSA 3RW7A 4LF4J 1YJWS 4KH0B 2CQPA 1EP4A 1EAYC 3R5DA 2CJYB 4ICLA 1YSJA 1RSCA 3MPWA 3KJVA 2WZ1A 4ZJLA 3J7ZT 2R7OA 2DNMA 1IBLF 4ZJQA 1IBMF 4NRTA 3BBBA 5F3ZA 3EUNA 2PC6A 4DR4F 2K3KA 1W2BR 2F5GA 4DU7A 5E2QA 2Y8WA 2ATCB 3HKZD 2XMTA 3SCKE 1VQOS 1TV6B 2YWHA 3FMBA 3L7PA 3BKFA 2J7WA 1TELA 5HQ8A 4KGKA 3JQKA 1AZSA 2DXFA 3H8YA 2BJ9A 1PILA 1IBMJ 3RB0A 2V9WA 2M8DB 3HVWA 1NK6A 5DJBA 2D74B 4N8OA 3TJAA 2NLWA 1UW4A 2IDLA 3L09A 2J7KA 1GNKA 2RNEA 3W62A 4P10A 3NGDA 5AJ3F 3EGWB 3ZZUA 2PSZA 1QY7A 5EWFA 3UQSA 2MXYA 4C7QA 2CJKA 2HHWA 4EEYA 3HD1A 1SPBP 1ZA2B 2FGOA 4LF8J 1H38A 4QBUA 4X4TA 3BQ1A 1OSDA 4A48A 1RAHB 6FDRA 2ZH3A 1RWXB 3M1VB 3W8GA 1VQ8S 1SJ4P 4OQJA 2HMIA 2VG6A 1T7PA 5DLFA 4PYDA 4KFBA 3BZQA 4UZBA 5HQLA 1ZPWX 1X60A 2V68A 1DQAA 2BYCA 1TZ0A 2YQ3A 2VA2A 3X1LB 4E2FB 2WONB 1VC6A 1UFKA 1FRXA 4DV7F 2JFKA 1HNWF 4LUBA 4J9PA 2NPFA 2AW0A 1NJYA 3TA0A 4AL6A 5G0RB 1K0TA 3MMBA 3PCOB 3B8HA 4YB6A 4OZ2A 3LP0A 1AB8A 1FD2A 4OYMA 2Y3YA 2DEJA 2ALYB 3O44A 4NA1A 5T7LA 2COLA 4MKVA 3NGKA 4PG8A 4B9LA 1V3ZA 3KLIA 1BXNA 4NMLA 2CQHA 2AV5A 4RNFA 5K8MA 1DHMA 2GIRA 4NASA 3O3LA 1Y9OA 4M5KA 4MK8A 2ACMA 4F50A 2M4MA 5HI7A 2VF3A 2ZWPA 2M7SA 3FK4A 4DUZJ 3MM9B 2CRLA 2HHHF 4G1IA 2J9CA 3Q23A 1F9EB 5ETQA 4LR7A 3MFHA 4PG6A 3EWGA 1WF1A 4V1Ak 1Z2LA 4CLPA 4FXDA 3DFEA 2AD9A 2FVRA 4W90B 4LFBF 3FEYB 2KU7A 2IMOA 1RT7A 3EMTA 1M1HA 3IRWP 4F3QA 1RKJA 2HHHJ 3T1HF 2KM8B 3HT3A 3DN9A 2OPPA 3BQ2A 4DSKA 1FK9A 1SKRA 3N01A 2FHJA 4RW8A 4QWCA 4ALZA 4CLZA 3Q86A 4FKXA 4ZN3A 1CC8A 2CQDA 2J8SA 5H9FK 1CBKA 4IFYA 5BR8J 3HK2A 1NDCA 2LMIA 3UW1A 5LSLA 3UDVA 3FBEA 4NLQA 2C1EB 3RW6A 2UV8A 5HLFA 5KFVA 2BBEA 3MPYA 3W2WA 5IM0B 4AL7A 2W2PP 1B70B 4ILLA 1TKXA 1HKAA 3QT7A 1EETA 1GK8A 2KJVA 2IM3A 2MZTA 5GVQA 3NS7B 2DK2A 4HLBA 3AD9C 4A8QA 3ISZA 2V5HG 1FDDA 2O1PA 3TX0A 3ENQA 5L9XA 2MSTA 3SV3A 4B08A 1VR6A 1HARA 2OH2A 1NCLA 2IJNA 3UVJB 4PAAA 1BC6A 3KK2A 1U24A 4DL4A 4ELUA 1NHVA 1VRTB 3C6TA 2H4WB 4FP9A 3ELHA 1EKSA 2V2QA 4KGXB 2M3DA 4I64A 4HYKA 2KXHA 2I2YA 4M5HA 2RAQA 1S7HA 2X1AA 1D09B 3PIOQ 3BO4A 2NXEA 2AIRB 1AUSL 3MR6A 1KONA 3KNGA 1X0FA 4TU8A 2ZH4A 5HVFA 4LIWA 1C1BB 4UQTA 4LF1A 1UFWA 2PN6A 1QUVA 5HANA 4B3MJ 1HYSA 3BGUA 5DO2A 1RQ0A 3GYNA 4ECQA 7AT1B 1BQNA 2PMHA 1YWXA 4OX6A 2H1YA 3I4HX 3JSYA 2V8HA 2UVRA 1UEKA 4MIWA 3DYAA 5JJBA 5H9EK 2JEFA 1IKYB 4JI8J 3PO5A 3S7RA 3MAAA 3EPIA 3GJTB 3JSMB 4EI2A 1TAUA 3CJKB 4C3MA 4IG3A 1HR0F 4IRCA 4KHMA 1H6KX 4GVLA 4TKTA 2BQUA 4C0OC 3R8YA 4TY8A 4R0EA 1UAWA 3V6DB 3A13A 3GCXP 2HBZB 3BQ0A 3OJUA 4JI4F 3G82A 3OJSA 3KG1A 3FSIA 3BM7A 1ZETA 1HR0J 4YMEA 2F9JA 2OFHX 4OZLA 5J2MB 5I3UB 4JI1J 1C1CB 3OR2B 2W01A 1XERA 5BXIA 2G13A 3D1OA 1CJUA 1Q4RA 2CKWA 2N7CA 1IKWA 2IRUA 2FHMA 2CQ1A 5B0BA 1RT2B 3SQGA 1S4EA 3P4UB 4U8YA 2ZH6A 1BWVA 4DBQA 5KT5A 4RUAA 3DMJB 2FLNA 2ZWOA 1U0SA 4X65F 3MR2A 3WX4A 4PKDB 1LEOA 1JX4A 2DRBA 1SBRA 2GQQA 3T5KA 1R6YA 4M5DB 4OI4A 3LOUA 3EX7B 1JLAB 2HQCA 3DRPA 2V4RA 1OPZA 1NK5A 1R3NA 3HXMA 2DNRA 1TK0A 1IR0A 1D8ZA 1WTBA 3I56S 4Q45A 3DLEA 2B5JA 1V3SA 1EQ0A 4FF1A 2D9OA 3K5PA 1FJEB 4PABA 3ILIA 3D3BJ 3AJ1A 2ZH2A 3CWJA 3R2CJ 1O6XA 4DX7A 4HR2A 1S72S 3QSIA 2EI5A 2X3DA 4FBUA 1KNZA 4DR5J 4AQYF 2E7XA 1TTHB 3HVTA 1SL0A 2VFRA 5MLCV 4NLTA 5DG8A 2OIHA 1QAYA 1VQKS 3CW2C 4RUBA 5EGYA 2AZ3A 1PJ6A 1HQUB 3UR0A 2GMJA 1BLUA 2HNZB 4C3KA 1YBUA 2RQKA 1C0UB 1O5JA 3AJDA 2VDHA 3CJRA 1RTDB 1D8YA 2FVCA 2ZNZA 5IXUA 3LWMA 1T05A 2FHOB 2KFYA 3AHPA 4DSJA 3K58A 4EUVA 4KR0B 1L3SA 1UZHA 5KFZA 3PJWA 2HNYB 3NBPB 1GMUA 1RT3A 3NAIA 3NCRA 4K4YA 2Z30B 3KUEA 4KGVB 2VG7B 3D54A 2MHEA 3EZUA 3QJPA 1RT5B 4LFAJ 3MMAA 4I67A 1FKOB 4MTPA 3MCOA 3RRGA 2DJWA 2I9SA 5LJ5Y 2XYGB 2N82B 3M6XA 4PQAA 3C46A 2H5JB 1X0PA 3R5AA 1UWBB 3T1AA 1SH3A 2DISA 1UWAA 3HMJG 1UA0A 4KHPF 5CHCB 2FHJD 2QGFB 3D4JA 4I2PA 3DLKA 2I6WA 3GFZA 2BM1A 1DJ0A 4O44A 2GVZA 4RBVA 3T41A 2BOAA 2XWYA 3JTNA 4NE9C 4JI5F 1N33J 4F04B 4JI0F 2ZZTA 3MZIA 5KG1A 2BABA 3I96A 2XSFA 2R8HA 5JUMA 2ZITA 3MR3A 1MN7A 3JQMA 4X66J 4ECXA 5ETTA 2G0JA 3D68A 2VH7A 3PKYA 1T9WA 1TMMA 2B6AA 1KFDA 4HDGA 4ATNA 1VK8A 4B3OB 4YP3A 4W4MA 2HHSA 4WKRA 1UETA 4NLVA 3ENAA 2FY1A 2DYAA 2POKA 4DPXA 4YR0A 4EYIB 4M5LA 3CJ8A 3HHEA 5CYQA 1RUSA 4NLOA 1WC0A 4ES3A 2DGSA 4CDIA 4EU0A 2Y8YA 1S59A 3W63A 3HJFA 2DHHA 3F0NA 3MTJA 3NWGA 4NXNJ 1FKPB 4DV0F 2A6MA 3I32A 2OTLS 4H4MB 1U02A 3TO8A 2ZOFA 4FZVA 3NRBA 3NMAA 1UVIA 3QJJA 2IM1A 5E0OA 3NY0A 3UCUP 2IC3A 5A8RB 2LU2A 5A8KB 3GYGA 2H51B 2ZE2A 4IKAA 5EX3A 3DRYA 1EB0A 2MKHA 1YZ7A 1VQSA 3CSKA 4GO5X 3H20A 4P74A 2Y0BB 2KFZA 1S0VA 4IH5A 3NAHA 3M6WA 4U7UD 2HK2A 2XYHB 3J7A1 4DG1B 2L9NA 2G1HA 3RBEA 2ZHOA 4NLSA 2W9BA 4Y0FA 3G4SS 1S48A 2V6AA 2HLTA 3NP5A 2AX0A 3EGZA 1Q81T 2PIIA 5A0YB 2XULA 3DOMA 2YKNA 4GKKF 1QTMA 3HKWA 1CJTA 3KXDA 2E9ZA 2UUBF 1RCOB 4EGLA 3H0PA 4KAIA 1J2VA 4DL7A 2XM3A 1S12A 1BWEA 3PXGa 2QMUB 2LA6A 2KRBA 3ILJA 4PEOA 2V2VA 3FCVA 5KAKA 3H5YA 4QU7A 2KT2A 3W5ZA 2UUCJ 4GVBA 2NQPA 1M1KT 2OPRB 1FRMA 3QQCD 1JLEA 1P9YA 4KO0B 2VBXA 3WC0A 5EUHA 2VQFJ 1LW2A 3DU6A 1S1XB 4YR3A 3DGPA 2K8GA 2LXFA 5SZTA 4ZPTR 3RUBL 2XI2A 5J2PA 2YQ1A 1RISA 3CCLS 2MQ8A 1HBNB 4LR8A 4LF5F 1O8BA 1WUUA
chains in the Genus database with same CATH topology
1Y10A 5D15A 1CJUA 1WC0A 4USVA 4CLFA 1TL7A 4NI2A 2GVZB 1Y11A 5IV3A 1AZSB 2WZ1A 1CS4A 3MR7A 1CJTA 4WP3A 3R5GA 4OYAA 4USUA 4WPAA 4CM2A 3C14A 4OYZA 4CLUA 5IV4A 3MAAB 4OYXA 1CJKA 1U0HA 2BW7A 2GVZA 1YK9A 4WP8A 4CLWA 3ET6A 1WC3A 3C16B 1YBUA 3MAAA 4P2MA 5D0GA 1CJVA 4OYBA 4USTA 2GVDB 5D0RA 3G82B 1FX4A 1AZSA 4CLPA 1FX2A 4NI2B 5D0EA 5D0HA 4CLYA 1WC6A 1YBTA 3C16A 1CS4B 3UVJB 4CLLA 4CLSA 1WC1A 3C14B 1CULB 3G82A 3C15B 1CJKB 1WC4A 4P2FA 2QV6A 1U0HB 4WP9A 1CJUB 4CLTA 4OYIA 4OZ2A 3UVJA 1TL7B 4CLKA 4OZ3A 4P2XA 4USWA 1AB8A 1WC5A 4OYWA 4CLZA 3ET6B 1CJTB 4OYMA 4OYOA 4CM0A 1CULA 4OYPA 1CJVB 3C15A 2GVDA 2W01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y10 A;  5D15 A;  1CJU A;  1WC0 A;  4USV A;  4CLF A;  1TL7 A;  4NI2 A;  2GVZ B;  1Y11 A;  5IV3 A;  1AZS B;  2WZ1 A;  1CS4 A;  3MR7 A;  1CJT A;  4WP3 A;  3R5G A;  4OYA A;  4USU A;  4WPA A;  4CM2 A;  3C14 A;  4OYZ A;  4CLU A;  5IV4 A;  3MAA B;  4OYX A;  1CJK A;  1U0H A;  2BW7 A;  2GVZ A;  1YK9 A;  4WP8 A;  4CLW A;  3ET6 A;  1WC3 A;  3C16 B;  1YBU A;  3MAA A;  4P2M A;  5D0G A;  1CJV A;  4OYB A;  4UST A;  2GVD B;  5D0R A;  3G82 B;  1FX4 A;  1AZS A;  4CLP A;  1FX2 A;  4NI2 B;  5D0E A;  5D0H A;  4CLY A;  1WC6 A;  1YBT A;  3C16 A;  1CS4 B;  3UVJ B;  4CLL A;  4CLS A;  1WC1 A;  3C14 B;  1CUL B;  3G82 A;  3C15 B;  1CJK B;  1WC4 A;  4P2F A;  2QV6 A;  1U0H B;  4WP9 A;  1CJU B;  4CLT A;  4OYI A;  4OZ2 A;  3UVJ A;  1TL7 B;  4CLK A;  4OZ3 A;  4P2X A;  4USW A;  1AB8 A;  1WC5 A;  4OYW A;  4CLZ A;  3ET6 B;  1CJT B;  4OYM A;  4OYO A;  4CM0 A;  1CUL A;  4OYP A;  1CJV B;  3C15 A;  2GVD A;  2W01 A; 
#chains in the Genus database with same CATH topology
 2DIU A;  3G8Q A;  1ACM B;  4QW9 A;  1T9V A;  2A2C A;  1LWX A;  4HHH A;  3O2I A;  1K44 A;  1WSR A;  2C2N A;  2QZ8 A;  4TQS A;  2HVZ A;  2MJN A;  4HT5 A;  2IJF A;  4CO4 A;  3RZA A;  4RWW A;  3GTY X;  3KMS A;  4ZP6 A;  4JYA J;  4PWD A;  1T8E A;  3B4M A;  2AZ1 A;  4N47 A;  3QIP A;  1HW9 A;  2XNQ A;  1NPP A;  2AKW B;  3LGN A;  3UWT A;  4M95 A;  1IKX A;  5EX0 A;  5K14 A;  4OL8 A;  4ZIV A;  2X3G A;  2YX4 A;  1YJN S;  4RW6 B;  4JI7 J;  1Q8I A;  3W66 A;  1NH7 A;  5ETN A;  2DGU A;  3MM5 B;  1U45 A;  1QSL A;  3CMQ A;  2HQG A;  1EP4 B;  3M32 B;  1QM9 A;  3KJV B;  1JNR B;  1JNZ B;  2HHP A;  1UTA A;  2BJ1 A;  2LEB A;  4J9V A;  2GCF A;  1SJR A;  2B4P A;  1Q0N A;  1FJC A;  2ZDP A;  3MEE B;  1GAO A;  2W2N P;  1N6Q A;  2VJV A;  4QPT A;  5D77 A;  2FQQ B;  1HIY A;  1Z1Z A;  4YY3 F;  4YEA A;  2AYG A;  4PG5 A;  3ZC4 A;  1ZZN A;  3QT6 A;  2R2T A;  1OY6 A;  3KK3 A;  1XMO J;  1HNV A;  5DM6 Q;  2YNF B;  3VQS A;  1E6Y B;  1DTQ A;  4DZ6 A;  2RU3 A;  4EWT A;  4ED0 A;  2DB1 A;  1GX6 A;  1GMW A;  2P6S A;  1MN9 A;  1OYD A;  2R3V A;  2R7V A;  1Q16 B;  3J81 j;  1YLX A;  4N5S A;  1N48 A;  2DCU B;  2AJ2 A;  3CDW A;  2HFZ A;  2RKI A;  4F26 A;  1XBW A;  1VS3 A;  5M2P A;  2QV6 A;  5J2Q A;  4RW9 B;  3D66 A;  2XHC A;  4K5R A;  2GS8 A;  2HZV A;  1SQF A;  2WW8 A;  3GJR B;  1Y5N B;  5L46 A;  3I5C A;  1RT1 A;  4ANC A;  3RBX A;  4LRB A;  2HMI B;  4F3M A;  1R0C B;  4ELV A;  1IKV B;  3FKB A;  2YNH A;  1S1U A;  2DGQ A;  5HL7 Q;  3G6X A;  4LSL B;  4JI6 J;  2KYX A;  5J2N A;  3IFE A;  5GAG U;  2OPS A;  4OHW A;  2R8J A;  2JWN A;  1UVK A;  3AAW B;  3SYZ A;  1NSA A;  1SC3 B;  4IR9 A;  4DI6 A;  4DV2 J;  3W9I A;  2YH0 A;  5IT9 U;  4LVO P;  4K5S A;  3E3X A;  1W7W A;  3JAM U;  3M7V A;  4QCL A;  1AW0 A;  1N36 J;  2DH7 A;  2BUN A;  1VQL S;  4R8U A;  4LRF A;  3TP2 A;  1VQ6 S;  4P52 A;  1LXJ A;  1ZAV A;  4PPZ A;  4OX9 J;  4CIO A;  2XY5 A;  1EJ7 L;  3ILO A;  2DR7 A;  3PHT A;  1NK8 A;  3POT B;  2MQQ A;  4HTI A;  2NZ4 A;  3MMJ A;  4OHX A;  1Q8K A;  3C6U A;  1H7X A;  3PRV A;  3I4P A;  4C9D A;  3KLI B;  1WC5 A;  2ACY A;  1KQK A;  3HPO A;  1LFW A;  3DDN A;  5FJ4 A;  2I5J A;  3CCE S;  3G6E S;  3QFH A;  3TEG A;  3TAQ A;  2QE5 A;  3MMC A;  4USV A;  1CQN A;  4PYA A;  4WU2 A;  1UVN A;  2PMW A;  2HEK A;  4PWW A;  3GIR A;  4M1K A;  3SSR A;  4PPD A;  2E5L J;  1HBO A;  3C14 A;  2H3E B;  1SVD A;  7FDR A;  1TKT A;  1TK8 A;  1LXN A;  2DNP A;  3EE3 A;  2F40 A;  1CJK A;  2YTC A;  2DBB A;  4WTY A;  1N4L A;  1HD1 A;  1FNO A;  2BOP A;  4LFC F;  1H3D A;  2ZOM A;  1VLO A;  2R7T A;  1RAJ A;  4ED1 A;  2X1G A;  1T3N A;  1EIY B;  2D3O R;  2ZNY A;  3I0S A;  3G2X A;  2G1D A;  3T5J A;  5B08 A;  1FX2 A;  3OFF A;  4LR9 A;  2V4Q A;  5KFL A;  1UEV A;  1X5S A;  4IFY B;  3UD4 P;  1ULR A;  3W2V A;  1RWP B;  2AMC B;  2QT7 A;  4HI2 A;  2V4J A;  3IR5 B;  3MEC B;  1CVJ A;  3BSC A;  1YX2 A;  4YOE A;  3OUY A;  2BJE A;  1FXD A;  3HDS A;  5HLF B;  1UCN A;  4ZP7 A;  4K50 A;  3DXB A;  3W2W B;  5CYM A;  2C2R A;  2HVI A;  3A8I A;  3UN2 A;  1TKX B;  3W64 A;  1EET B;  2K2P A;  3MR7 A;  3VCD A;  2IBK A;  3AD7 C;  4IYQ A;  5FLX Y;  2DT9 A;  5I42 B;  2IMW P;  2MY7 A;  1H7W A;  2R7Q A;  3FSX A;  4X4V A;  1RYS A;  2M52 A;  3R1L A;  4FBT A;  1N54 B;  1T02 A;  4L76 A;  4KV8 A;  3GPA A;  1K47 A;  3QZ8 A;  3ISN C;  4M8L A;  3ZZO A;  2WVB A;  2XSJ A;  3C6T B;  4O3Q A;  2BA9 A;  1KQF B;  3PW2 A;  1WHY A;  3PM9 A;  2R7R A;  5E3A A;  1VI7 A;  4U96 A;  5M2U A;  2PDA A;  1ZS6 A;  4H4K C;  2LKZ A;  3IGV A;  2GJI A;  4LF9 J;  1VRU A;  4PUO B;  2BJ7 A;  1Z2Z A;  3LGM A;  3VVT A;  1ZYQ A;  4ID5 A;  2KM8 C;  1U2C A;  1I94 F;  2YKM A;  1UPP A;  3WDO A;  2RSQ A;  2Q1L A;  1KR4 A;  3EZ5 A;  3AA9 A;  1BQN B;  4HHU A;  4WYL A;  5B0E A;  4NXM F;  5E7O B;  2RS2 A;  2FJV A;  5KFJ A;  3P3D A;  1JXL A;  3HHL A;  2AJF E;  1RI7 A;  1OPI A;  3MAA B;  3OTC A;  4BC7 A;  3QGH A;  2HS0 A;  4IG3 B;  4K4U A;  3PYD A;  4A47 A;  5ETO A;  3MCS A;  4NXM J;  3J7Z 5;  4TY8 B;  1RAI B;  4KPY A;  3VTI A;  3DRR A;  2DO0 A;  1F3V A;  4EO8 A;  3PW4 A;  2YKQ A;  4DUY J;  3G82 B;  3LP2 A;  3MAQ A;  1QSY A;  1RWV B;  4TYB A;  3C16 A;  1SKW A;  4HT7 A;  2R9L A;  1FE4 A;  3KK1 A;  2HZC A;  2IFX A;  4YDD B;  2VC0 A;  1A7G E;  2YWK A;  1CJU B;  4UUX A;  4ZMM A;  1EKR A;  2W4P A;  2DGT A;  1SIW B;  1XTZ A;  3TAM A;  4DV1 F;  4HDH A;  4F3O A;  3OL6 A;  4FDF A;  3SQG B;  3H4D A;  1GMW D;  1FXL A;  1IR1 A;  2GC8 A;  1J5E F;  4ZLN A;  2GGP A;  1CSJ A;  3I82 A;  3ENW A;  1P27 B;  4PXB A;  5F9L A;  2B51 A;  3E01 A;  2VU5 A;  1IVZ A;  1H2T Z;  4QR2 A;  2MB0 B;  4IG0 A;  4O3P A;  3IS9 A;  4Z7Y A;  3M8R A;  1G3O A;  1U8S A;  4C2M A;  1VIX A;  3UN5 A;  2JJ4 D;  2A10 A;  4ES2 A;  1MW7 A;  3THT A;  5LMN J;  1RHK B;  3U7J A;  3DLE B;  3FBC A;  1N5Q A;  2YNG A;  4DR3 F;  3N79 A;  3DKD A;  2BM0 A;  3TWZ A;  4I56 A;  4OI3 A;  1ZM3 A;  2F65 A;  1N0U A;  1KBR A;  3SDE B;  3V81 B;  1JJ2 R;  3QRR A;  1Q1K A;  1CG2 A;  5RUB A;  2NS1 B;  4V19 J;  3MUV P;  1RTI A;  3QWU A;  2QMX A;  3MI7 X;  5KG2 A;  1YG0 A;  3EDR B;  4FXW A;  1NND A;  4DS5 A;  2OPQ A;  3I0R A;  3HVT B;  4AXJ A;  3H2V E;  4Q8E A;  5B0F A;  2DR9 A;  1H98 A;  1N5S A;  1TFW A;  2UXC F;  2L9W A;  1PG5 B;  2W9A A;  4K4X A;  2XTJ P;  4CLU A;  1VMB A;  2DNQ A;  4RW4 A;  1VBK A;  4ECT A;  4J9Q A;  4QIG A;  4QWD A;  4DQI A;  2WAQ D;  4K4S A;  4G1Q A;  4FF4 A;  4DCO B;  5FDL B;  4ZK7 M;  3IR6 B;  3IBW A;  4Q5V A;  3U02 A;  1W26 A;  3QRP A;  3C66 A;  4BDP A;  3MEK A;  3A3O B;  3W3S A;  1RHJ B;  3HVR A;  2W7P A;  3M4X A;  2M88 A;  1G7C B;  2QFI A;  4GMK A;  2FLP A;  2BX6 A;  3W5X A;  2VAS A;  4LT6 A;  4HL9 A;  4Y34 A;  5KT2 A;  2J9D A;  3MMA B;  3TOQ A;  4ZOS A;  3BN4 A;  1RWM B;  1NKE A;  1GXT A;  2UXD J;  4RO0 A;  2EEY A;  1K1S A;  1P8G A;  3IG1 A;  3V6J A;  1S76 D;  4C4W A;  3CC7 S;  2CPE A;  4CO0 A;  1KSP A;  1XNQ J;  4K2X A;  3TZW A;  3DLK B;  1V9O A;  1Z4U A;  4DCJ B;  3EXY A;  4ZLJ A;  4O44 B;  2GVZ B;  1HBM B;  1M0S A;  2XS7 A;  3GQC A;  2E5H A;  3KWM A;  4DQQ A;  4BCA A;  2XMA A;  1Y0H A;  1REV B;  3VZI A;  3QPI A;  4J9M A;  4URG A;  3HUL A;  2DPJ A;  4RLE A;  2AYE A;  1NLK L;  1NB2 A;  3SBM A;  4DSL A;  2KZM A;  1DRZ A;  1U1R A;  3HZE A;  1CLF A;  4B17 A;  1JKH A;  2FC8 A;  3CIZ A;  2HK3 A;  1XR7 A;  1S97 A;  5HN0 A;  4LQ9 A;  2A18 A;  4J9K A;  1PYS B;  3M8Q A;  4A4J A;  2GA7 A;  1G6B A;  2OEM A;  3CT9 A;  1NJI T;  4PR6 A;  4DR7 J;  2CDR B;  3O5T B;  3K7R A;  3CO0 P;  5HRO A;  1JJH A;  1NK4 A;  1C0T B;  1FFG B;  2P9E A;  4I7F A;  4PRF A;  5E5N A;  3IRX A;  5IV3 A;  1CS4 A;  4YFU A;  3BR9 A;  5AXL A;  3ZZP A;  4ZVO B;  4XPC A;  4MIB A;  1YGY A;  4DQS A;  3EDQ B;  2Y1J A;  2U2F A;  1LWE A;  4Y2K A;  2BW7 A;  2XLI A;  1FEE A;  4UT4 A;  4ZPC A;  2M8H A;  4WYW A;  3QAU A;  2YWE A;  2DKO B;  1DQ8 A;  4ZHR A;  2XLK A;  2IJR A;  3MEG B;  1XNR J;  2QSF A;  4ZCK A;  2CNK B;  4NRU A;  2ASL A;  3EVM A;  1CC7 A;  1IQZ A;  5B7W A;  4J9R A;  1MLA A;  2W9B B;  1SKU B;  1EZZ B;  5FII A;  4J9S A;  5L1K A;  2O5D A;  4I2Q A;  2RIL A;  3L9Z A;  3RB4 A;  3OSN A;  1SJF A;  4DLG A;  3TUI C;  3QT8 A;  5LSO A;  3HD2 A;  3GIM A;  2ASJ A;  3DOM B;  3CGI A;  4KSE B;  1FRL A;  3ZFV A;  1CJT B;  3GR1 A;  5C42 B;  2W24 A;  4XO0 A;  3N5F A;  3UCZ P;  1NUE A;  3DDI A;  1GX5 A;  8ATC B;  2JFD A;  2DNZ A;  3HLU A;  3N6L A;  3FSY A;  2J9D E;  2MMY A;  2V94 A;  3SZ2 A;  3MD3 A;  2Y0S D;  1FRI A;  2C2K B;  2MDA A;  2MGZ A;  4XDC A;  2QLB B;  5A76 A;  3ET6 A;  2FZK B;  1D0E A;  2CQB A;  2CZV C;  3J81 Y;  1K1Q A;  3BYP A;  5J2P B;  1HHS A;  2LDY A;  3Q83 A;  4IOA Q;  2W25 A;  4AYB D;  1R8P A;  1VRQ C;  4FNI A;  1MWY A;  1HW8 A;  4CH7 A;  3RGI A;  3LTO A;  2EFV A;  4YR2 A;  1IUJ A;  4HH0 A;  4J5O A;  2FJX A;  3H25 A;  5HBM A;  4WXW A;  5AXN A;  1IQT A;  4WFY A;  1FRK A;  1SJQ A;  1UMJ A;  1KLM B;  2GW8 A;  4JI3 J;  3BBC A;  1DBD A;  1YIJ S;  3GIK A;  1O0P A;  3QMQ A;  2OP5 A;  3WZ0 A;  4DMZ A;  5F8I A;  4Y65 A;  4LMZ A;  2E5J A;  3QIP B;  3WX8 A;  3NNA A;  2J9E A;  1PC4 A;  2VV5 A;  1OJ4 A;  5EHH A;  1IKX B;  1RAG B;  5K14 B;  4B9M A;  1R6V A;  5KFQ A;  3HM9 A;  2V0N A;  4IUF A;  2AYM A;  4NEY A;  3OTD A;  1PAU B;  1TAQ A;  3KLF A;  4LRE A;  4ZVF A;  1JLF A;  2QA2 A;  3KDO A;  1FI4 A;  1VK3 A;  4MFB B;  3H2L A;  1N32 F;  4CYU B;  1U0H B;  2JLE A;  3FVY A;  4P75 A;  2GJ2 A;  1XN9 A;  2G2O A;  5ETM A;  1NDK A;  4Z2X A;  2QMW A;  1LWC B;  2NYI A;  4U67 Q;  3R7S B;  2DHA A;  2GQ2 A;  3NGU A;  3BO2 A;  2DGO A;  2C2O B;  1RWN B;  3ZNU A;  2FD2 A;  2KVI A;  1S6Q A;  4P7T A;  2QRR A;  3ZZY A;  3SFG A;  1BQM A;  1OY8 A;  1HNV B;  4O4R A;  1NPK A;  4P71 A;  2C2E A;  3KNA A;  5J1E A;  3T1Y J;  3FJ2 A;  2B43 A;  3MOZ A;  1RHR B;  1W2I A;  3PHE A;  3HF5 A;  2KJW A;  3IXQ A;  2NZC A;  4G1P A;  1TK5 A;  2J8A A;  4X62 J;  3QAE A;  1QJH A;  3G8S A;  2HIQ A;  2RKI B;  1LWF A;  3CE8 A;  5J2Q B;  1KQG B;  2ZH7 A;  1RWU A;  2KDO A;  4CLL A;  2FVS A;  5L8R C;  3Q8Y A;  2JC1 A;  1RT1 B;  5EDW A;  2CPI A;  2WSF C;  5HAO A;  2VZ9 A;  1KTV A;  2ZEJ A;  2XO7 A;  1JLG B;  4KKO B;  2PA3 A;  1GTH A;  2AWZ A;  3L95 X;  1T94 A;  2WB1 D;  2YNH B;  1JLC B;  5IQQ A;  1X4H A;  1X9W A;  1D3W A;  4B3S F;  4Y2C A;  2OPS B;  3P5B P;  3BSA A;  2OTJ S;  2FB0 A;  2LLZ A;  4Y2M A;  4NLX A;  1UVL A;  2AGQ A;  1JXE A;  4QIV A;  1FTR A;  2RIJ A;  3CMA S;  4HEA 9;  2HHX A;  5B0D A;  2XGQ A;  1U6B A;  2M2B A;  2XGP A;  4BLG A;  3M8S A;  4NZ6 A;  2OHD A;  4LF7 F;  3LAL A;  3CCZ A;  2HPU A;  3D0G E;  3GJS B;  4EBE A;  1M1G A;  1NHK L;  4JP8 A;  4R8U B;  4ECS A;  4KTQ A;  5HMY A;  4DR2 J;  1NEE A;  2BZ2 A;  3AB4 B;  3DLJ A;  3NCP A;  2BMB A;  2C3Y A;  1OQ3 A;  4KB7 A;  4R0J A;  2G0I A;  3C6U B;  1T95 A;  2E9T A;  4QYZ K;  2BVZ A;  3H5S A;  4QYR A;  2B9E A;  4O0N A;  2V63 A;  3MUR P;  1YDL A;  3V4M A;  1WG1 A;  4YHH J;  4USI A;  2DPI A;  1PAE X;  1HD0 A;  2KL8 A;  5DGA A;  2OO4 A;  2KKH A;  3SCJ E;  1E6V B;  4ZPV R;  2I1R A;  1Q8B A;  2EWH A;  2XS2 A;  3OXF A;  1TVR B;  3KKF A;  1I6J A;  1URN A;  5AT1 B;  2GIQ A;  4DFJ A;  2ZDO A;  3PVX A;  2LDI A;  4OYP A;  2PT0 A;  1TKT B;  2U1A A;  4PQU B;  5D15 A;  3MPU B;  2LVW A;  3LPE A;  3FC9 A;  3TQE A;  2JLF A;  1D9D A;  4USU A;  2RDD A;  4F2S A;  3FRY A;  3D6F B;  4RUC A;  2BRL A;  1YK9 A;  3TA2 A;  5IWA J;  3I0S B;  2VDI A;  4K0K J;  5F8H A;  4DR1 F;  2HQD A;  2LQ5 A;  4XK8 C;  1X9S A;  2GML A;  4JV5 J;  2JX2 A;  1XJW B;  5SUH A;  3TVY A;  3W65 A;  5CAA A;  2R2R A;  4B9N A;  2OJ3 A;  2H54 B;  2XMW A;  3NCQ A;  4CRJ A;  3DLB A;  1S0O A;  2FJB B;  2RD5 C;  2IM0 A;  2P9C A;  4RUH A;  4MJK A;  4OX8 A;  2HAF A;  3BH6 B;  1FNX H;  1KRP A;  2V4J B;  4DR1 J;  2OSQ A;  1AXQ A;  2HQ3 A;  3PJ9 A;  5CYM B;  2MZS A;  4NLW A;  3QID A;  2LQJ A;  1RWW B;  5D78 A;  1N5Y B;  4GKJ F;  2DNL A;  2DH8 A;  2LCW A;  3NXZ A;  2F4V F;  2BW2 A;  3JSB A;  1QD1 A;  2FLO A;  3RBZ A;  3IWN C;  1DLO A;  2ZJQ Q;  4QR1 A;  1HI0 P;  4AT1 B;  4KV8 B;  4DUT A;  4F25 A;  4WPA A;  2B8P A;  4OYZ A;  1VQY A;  4CNY A;  2XSJ B;  2EFN A;  2CZ4 A;  3PW7 A;  1IJF B;  3D6M B;  2ZUG A;  3MFI A;  2SXL A;  1YRX A;  2OLW A;  2WW4 A;  1ROF A;  3CC2 S;  1HNX F;  4Q7A A;  4QJV A;  3KJQ B;  3J7A N;  5DG7 A;  3OVA A;  2GIF A;  4KYZ A;  4OIX A;  4USH A;  1OIA A;  1KC8 T;  1S0M A;  1X5P A;  2M5Y A;  2F8M A;  1PYO B;  2IA0 A;  2IY5 B;  2YKM B;  3C19 A;  3VAL A;  5HO4 A;  2UVU A;  2YX7 A;  4ZPW R;  4BS2 A;  4RJV A;  1M5P C;  1TL3 A;  1IBK F;  3HHK A;  4KGZ B;  2DHG A;  2GHP A;  4RNH A;  2QLW A;  4Y28 C;  3HHL B;  3OL7 A;  2OML A;  2VIH A;  1U48 A;  1S1T A;  3MM8 A;  2HVH A;  3RB6 A;  2WVF A;  9ATC B;  3THP A;  2WHO A;  1AUD A;  1S9E A;  2RQ4 A;  3DRR B;  3I9Z A;  1HMV A;  3R5B A;  3LP2 B;  3K5N A;  5KFT A;  2AQ4 A;  3UR3 C;  1N0V C;  1S5Z A;  3M9O B;  3C16 B;  4I1T A;  1AFJ A;  1O51 A;  2GVD B;  4DV5 F;  4LIR A;  1MMN A;  5D6G A;  2BJD A;  3TAM B;  1RT4 A;  1TU0 B;  3I31 A;  4PZV A;  4N7T A;  3CC4 S;  4DR6 J;  1TL5 A;  3OFG A;  5GME A;  2B9W A;  3MM7 A;  4M5M A;  2QO3 A;  1VCT A;  4PXE A;  2ZZN A;  1MRO A;  1OSC A;  3E01 B;  1TV6 A;  2E5G A;  4F02 A;  2F8H A;  4P2S A;  3IS9 B;  2V8P A;  2VFU A;  1Y11 A;  2VB6 A;  2NR0 A;  5LT5 A;  4P72 A;  3KLH A;  3IA0 A;  2ZH1 A;  3MED A;  1RDR A;  3K59 A;  4F0H A;  2XY7 A;  3Q8S B;  4DPO A;  4QIF A;  3K5M A;  1VBY A;  2KG1 A;  1NSQ A;  1IBL J;  2DNH A;  1PJ7 A;  4NEZ A;  2YWF A;  3IAS 9;  4WCE Q;  1RT6 B;  4DR4 J;  5E3Q A;  3PR4 A;  1KWM A;  4KE5 A;  3UI3 A;  2ADB A;  2ZBP A;  2ROG A;  4OZ0 A;  5CCL A;  4QPX A;  1S1W B;  3VAJ A;  2AHO B;  4FVM A;  1Q5V A;  2C2Z B;  3KLG A;  4P73 A;  1S6P A;  5F8J A;  5KFF A;  4DX5 A;  4DPW A;  2VG5 A;  1RHU B;  1TKD A;  4RBT A;  2IA6 A;  2HGM A;  2MZ1 A;  2OPQ B;  3I0R B;  3KMQ A;  2K7K A;  5MAO A;  5KOW A;  2W7A A;  5BYR A;  2QA4 S;  1UA1 A;  5HK4 A;  1WHX A;  2H5I B;  1PGZ A;  4F8R A;  2WON A;  5AJ3 J;  4N77 A;  2XCA A;  2W2Q P;  3ENV A;  2B4U A;  3HT0 A;  4WXO A;  2MKC A;  2MSS A;  3WIV A;  1TFY A;  1SJ1 A;  5LMU F;  1PSD A;  4B3R F;  4DPU A;  4X2B A;  3K8W A;  1JMT A;  1JLQ A;  2LXI A;  1FEH A;  5J1N A;  2LEP A;  1ZAX A;  3ZTR A;  3R97 A;  3DOK A;  1L5U A;  3HZG A;  4LRD A;  2ZUA A;  3H59 A;  3Q24 A;  2PFF B;  1JXV A;  1J5O A;  2F9D A;  4DL0 C;  4U6P A;  1YZ6 A;  3GG0 A;  3RYL A;  2VBW A;  3GU0 A;  2VKZ G;  3GV5 B;  4LVN P;  2A1B A;  3RAQ A;  4WWS A;  3BB5 A;  1FKA F;  1JJC B;  3OFE A;  1QVG R;  4CLY A;  1S9G B;  5JXS A;  3J7Y U;  3ETO A;  4DV7 J;  1KFS A;  4GO7 X;  1REG X;  1S4F A;  1URR A;  2VPX B;  5JVG Q;  1P1L A;  1WOS A;  1VQM S;  1HNW J;  2UUA F;  1JLB B;  1PC5 A;  2ZJR Q;  1RAE B;  2R7W A;  3RG6 A;  4AL5 A;  3MAH A;  3MM9 A;  3M2R A;  3UNY A;  2FLL A;  2DXD A;  4PG7 A;  2VL1 A;  4H4K A;  4NYP A;  3QT5 A;  4WII A;  4PXD A;  3CF5 Q;  2HHQ A;  1LKZ A;  3RTV A;  2CAJ A;  2B4V A;  2WBM A;  2Y1I A;  4S0M A;  5C24 A;  1DTT B;  4DJB A;  4MT1 A;  4G6V B;  4ED4 A;  5IV4 A;  2WSE C;  2V50 A;  2IPO B;  1PJ5 A;  3GYX B;  2IVM A;  1PO6 A;  5A2Q Y;  1ZTW A;  2Z58 B;  1JKH B;  4CH0 S;  2R4F A;  3A12 A;  4C97 A;  3J7Y I;  3ICL A;  5KFA A;  5KG3 A;  3OR1 B;  3M8Q B;  2DY1 A;  2KTQ A;  1XMQ F;  3AB2 B;  1TQL A;  2OD4 A;  2D3Z A;  3LF0 A;  1F9F A;  1FO1 A;  3EXC X;  4X84 A;  4LFB J;  1WG5 A;  1XMB A;  4JV2 A;  5IM0 A;  2FJD B;  2W1B A;  3LA0 A;  1XWL A;  1X4F A;  4DDF A;  3T1H J;  1XQI A;  4ECY A;  4I7F B;  2HND A;  2V8V A;  2ZBC A;  2FGC A;  1ZM4 A;  1KHW A;  4X4P A;  3TR5 A;  3ZTQ A;  2APO A;  3ITH A;  1M5K C;  2IBO A;  3R6G B;  4PXC A;  3G6Y A;  2OI2 A;  4Y2A A;  1RCX B;  2DNY A;  3OTO F;  5K5M A;  2OEJ A;  1RZM A;  3R5G A;  4ZHR B;  3W8P A;  3EJM A;  1VRT A;  5K8P A;  3VAF A;  1VQ7 S;  4WE1 B;  3PTW A;  5H9F J;  1RHQ B;  3AOC A;  1YTY A;  2I38 A;  4C0H A;  2CQC A;  2L41 A;  2DIV A;  3EM1 A;  1WWH A;  3MTK A;  4X64 F;  4UST A;  4YB5 A;  1FER A;  3SV4 A;  1NZ8 A;  2F3J A;  4WBF A;  4FXV A;  3HFK A;  4NI2 B;  2YXL A;  4ERD A;  3UNG C;  4K4W A;  3PYG A;  2HZA A;  3MF5 A;  1WC4 A;  2QL9 B;  3VAG A;  2CYY A;  1WHV A;  1MMD A;  1ITP A;  3PX0 A;  1VHI A;  1IKY A;  2A3J A;  4TQR A;  1ZBT A;  1EAR A;  1FNM A;  3BPS P;  3JSM A;  2UVW A;  3CJK A;  3UCG A;  5KG7 A;  4K59 A;  2VA3 A;  1CJV B;  2MLY A;  4GC6 A;  3T9N A;  4X4S A;  1LV5 A;  1SH2 A;  2HFV A;  5HP1 A;  2DO4 A;  3M8Y A;  4R5P B;  1RP5 A;  3U1L A;  2ADC A;  2ZD1 A;  2MZR A;  2XBP A;  2J0Q D;  2MQL A;  2BAC A;  2B0G A;  3M2U A;  3TVK A;  1S10 A;  1MG7 A;  1QVF R;  1OWX A;  5CYJ A;  2RRN A;  3N6M A;  2E1M C;  3MM6 B;  2OMO A;  1R8A A;  5I3U A;  1H72 C;  1RK8 A;  1GQE A;  4IFV A;  2RJZ A;  1C1C A;  2VON A;  4NLD A;  1NPR A;  2IM2 A;  2XZW A;  2H5E A;  4FYY B;  5DG9 A;  4WK1 A;  4RU9 A;  2C42 A;  2AEJ A;  4CO5 A;  5F0U A;  3CCU S;  1RT2 A;  2FTR A;  4IO1 A;  2ZZM A;  1BHN A;  5FLX U;  2AJ1 A;  5H9E J;  3PV8 A;  1S77 D;  1Y5I B;  4O3N A;  3DMJ A;  1P9Q C;  4D3G A;  1KQS R;  2CXE A;  3CD0 A;  1RAF B;  3E51 A;  3G71 S;  4QWB A;  4DV6 F;  4JI4 J;  4LSZ B;  4M5D A;  4AFF A;  3KJN B;  1RA6 A;  2O3D A;  2GFF A;  1JLA A;  2V2K A;  3KLV A;  3VHQ A;  5GAH U;  4DL2 A;  5GMK a;  2KB2 A;  2GHW A;  4CO3 A;  4DQR A;  4G65 A;  2IAJ B;  2WOM A;  1HI8 A;  1YJ9 S;  2IYG A;  4KC5 A;  1M90 T;  2W9C A;  1RB0 A;  2KXN B;  4NLR A;  2DGW A;  4TLR A;  3ZZ0 A;  4ED3 A;  4WP8 A;  2VPY B;  3JAM Y;  3J80 U;  2FHK A;  5ETV A;  5K9F A;  4X65 J;  4ZCL A;  4RWX A;  2JVO A;  2XCP A;  2ZC4 A;  1JLF B;  2RF2 B;  5KFC A;  5CAB A;  3W9J A;  1VYA A;  4YB7 A;  2GO9 A;  1HHT P;  5L1I A;  2Y9H A;  1H0H B;  1RE1 B;  2CPJ A;  3V6K A;  1I1G A;  1APS A;  2EK6 A;  5C7P A;  1U1N A;  3MCN A;  3KLE A;  1S6O A;  4EBD A;  4N56 A;  2OGU A;  2VBZ A;  3F56 A;  1HQU A;  3FNN A;  3AA8 A;  1RBA A;  5B0C A;  2HNZ A;  2BE7 D;  2CQ4 A;  1C0U A;  2EW9 A;  4MKB A;  4F4A A;  2E7V A;  1RTD A;  2C3M A;  2W4D A;  1S6Q B;  1Q5Y A;  2GV1 A;  1BQM B;  1C4A A;  3NS6 A;  1RA7 A;  1TL7 A;  1SB6 A;  1SUQ B;  2VBY A;  5IT0 A;  3TZZ A;  2CWK A;  3V4I A;  1FVS A;  3NBP A;  2CPX A;  4C8N A;  1X4A A;  1Q78 A;  2X51 A;  4AQY J;  2X1F A;  3G87 A;  4QIE A;  3C2P A;  5DDQ C;  4JBC A;  2VG7 A;  2E5I A;  3UO0 A;  1HQE A;  1HNI A;  3AJ2 A;  4WZQ A;  1YVF A;  1RT5 A;  1ZM9 A;  1LWF B;  4NPO A;  2AJQ A;  1VOM A;  4OZJ A;  4LF2 A;  2QLJ B;  3Q0A A;  3AT1 B;  4ZP8 A;  3THV A;  1FJG F;  1DAR A;  3E2E A;  5D3G B;  3RBD A;  3TJ8 A;  5LOQ A;  3SXL A;  5D0E A;  3NNH A;  2WBR A;  5T41 A;  4IRK A;  2G9O A;  5C5J A;  2DD8 S;  3K89 A;  4A8X A;  3QLH A;  3TZY A;  3NGR A;  3PG9 A;  5JVH Q;  3BEG B;  3K5O A;  3CB4 A;  1RU1 A;  5HJX A;  3LP1 B;  4I0W A;  3PFE A;  1I3O B;  4F36 A;  1FWP A;  2NXJ A;  2HRT A;  2ROP A;  4QWE A;  1WTF A;  3T5L A;  1NB7 A;  3G6V A;  4N41 A;  4EYH B;  4KHP J;  1QTN B;  1R0A B;  4B3O A;  5DDP C;  2C2D A;  3RR8 A;  3ULH A;  3VQT A;  2BKO A;  4BBY A;  4QQB A;  2VHG A;  2XQC A;  3DLG B;  2HHV A;  3KHH A;  2RUG A;  4JI5 J;  2D3O 1;  2WVC A;  4JI2 F;  4JI0 J;  1SXL A;  2B9X A;  2E44 A;  1WKK A;  3LUY A;  3T3F A;  5C25 B;  2M0G B;  2NXU A;  1HNZ F;  1YBT A;  4Q0B A;  3IWL A;  4K4Z A;  1S7I A;  3FEZ A;  2HLU A;  5KFN A;  1FKP A;  1U6Z A;  4JI2 J;  4L72 B;  5HJY A;  4H4M A;  4CP5 A;  1F2G A;  1MML A;  4ID8 A;  1R27 B;  2BAN A;  3PEJ A;  1K8A T;  4FPI A;  1P1T A;  1YKW A;  4DS4 A;  4ITS A;  1ELO A;  1LNQ A;  5A8R A;  5A8K A;  1MU2 A;  5ETL A;  2EBG A;  1FCA A;  1SC4 B;  3GLJ A;  4ES1 A;  5CQG A;  2HWT A;  4ED5 A;  2N7Y A;  1UKU A;  4ZVT B;  3IC1 A;  1HBU A;  2RHS B;  4XDD A;  2B8Q A;  1B99 A;  4ETX A;  2QYC A;  3FZ2 A;  4GC7 A;  2E1A A;  1U2F A;  4K2J A;  4M94 A;  2PMZ D;  4DV0 J;  1UVJ A;  3VV2 B;  3QO9 A;  1SC6 A;  1BE4 A;  2B9Y A;  2LQ9 A;  1Q79 A;  2AYB A;  4DV4 F;  2IVY A;  2D1C A;  3TUP A;  2HS4 A;  3M2V A;  4XTT A;  2ZH8 A;  2C3P A;  1QUP A;  5IC6 B;  4PWU A;  1RTJ A;  2WB4 A;  3P49 B;  5E41 A;  2O67 A;  2BQ3 A;  5KG6 A;  2OFG X;  1FDN A;  2DNK A;  5IFM A;  2KXF A;  5DRK A;  3OD2 A;  2XNR A;  3BPD A;  3HVA A;  8AT1 B;  2MQO A;  4O3O A;  4M5G A;  2CPD A;  3PR5 B;  3VAM A;  1GEH A;  4NLG A;  1H74 A;  2K1R B;  1RYR A;  2OPR A;  1SQG A;  2R8G A;  1NZA A;  1TL4 A;  3DNC A;  3JQJ A;  5AXK A;  3UFC X;  2CPH A;  5LL6 d;  2UZA A;  2AT1 B;  1VIO A;  4ZVU B;  2DRA A;  5IQ6 A;  1B0P A;  4GKK J;  3BYR A;  4DEZ A;  3CJT A;  2UUB J;  3MWB A;  3OFH A;  3R1H A;  2PEB A;  9RUB A;  3BGF A;  1DFD A;  4UY8 T;  5L1J A;  2UXB F;  3CNQ P;  1HBN A;  5KFR A;  4P9S A;  4FNH A;  4USM A;  3HSZ A;  4MH8 A;  2DY9 A;  1XR5 A;  1FES A;  1X9M A;  3S01 A;  3DI6 B;  1WHW A;  4OLO A;  3SMZ A;  3NMR A;  2LQ8 A;  4ZCI A;  3CCW A;  2UU9 F;  1U49 A;  3OPK A;  3I55 S;  4ILM A;  2QN6 B;  1VDH A;  1IWG A;  1TUG B;  7FD1 A;  3JXO A;  3DHX A;  2HWI A;  4NCG B;  2BKN A;  2ERR A;  2XYP B;  1FA0 A;  2Q66 A;  2AGP A;  3UE2 A;  4CCH A;  4HAC A;  4CTA A;  2XWX A;  4NL5 A;  1S1T B;  3MM8 B;  4LF4 F;  3DC2 A;  5KFG A;  4DHV A;  3FFI A;  3DLH A;  2CNO B;  3FCH A;  2RE1 A;  4Y6I A;  4Q8F A;  1S9E B;  2J0S D;  3DOL A;  1Y10 A;  4LF5 J;  1U25 A;  2YBV A;  1HMV B;  1DZ5 A;  1M5V C;  4K4V A;  3FCW A;  2ZKT A;  4IOC Q;  3PEH A;  4RW6 A;  2ZVI A;  5IC4 B;  3LW5 C;  4CM2 A;  3PO4 A;  3FEX B;  2VJU A;  3MM5 A;  4RBU A;  5CD4 H;  3EVO A;  3M32 A;  1I5O B;  1NAQ A;  2PA8 D;  3CJS A;  1JIH A;  4RW7 A;  3MGJ A;  1RT4 B;  2D9P A;  3CXC R;  4N76 A;  3QSY B;  3VAI A;  2D7S A;  5D0R A;  2QLX A;  2YNI A;  1KVJ A;  2Z2M A;  1YBA A;  4ICL B;  5D4N A;  5L9N A;  3MM7 B;  4IOB A;  2BKP A;  1YQH A;  5KFH A;  3MEE A;  2HVE A;  1XEZ A;  3TAN A;  1MRO B;  3W5Y A;  1FFW B;  1NJW A;  1AT1 B;  4ED6 A;  2J0W A;  1RJJ A;  2D69 A;  1WEL A;  4U7U K;  4PG4 A;  3KLH B;  3L3C A;  3D1H A;  5KFW A;  3MED B;  1U4B A;  1WKL A;  3J81 U;  2YNF A;  3NS5 A;  1E6Y A;  4LF8 F;  2XG8 A;  1AZS B;  3A8K A;  5K8N A;  2QL5 B;  4OJ3 A;  3HHL C;  5FD1 A;  4J9L A;  4KBI A;  3UDL A;  4RW9 A;  4W98 A;  3TQ1 A;  1NXI A;  4C8Y A;  1GT8 A;  2CDQ A;  3W1Y C;  1Q53 A;  3MPV A;  4XIU A;  3KLG B;  2QC3 A;  4YY3 J;  1S6P B;  2YWW A;  3OW2 R;  2VG5 B;  5DZ7 A;  4AND A;  3ZNJ 1;  1UL3 A;  3MPD A;  2CIM A;  4B9V A;  1F5A A;  3MDF A;  1IKV A;  1D1U A;  1H2V Z;  4LSL A;  4LBH A;  2CVE A;  1TKZ A;  1AFI A;  1U47 A;  3M8Z A;  3R3T A;  1B0V A;  4OZ1 A;  2VG6 B;  5KFO A;  4C11 A;  4I68 A;  2GNK A;  3MR5 A;  2DIT A;  4KFB B;  1GMV A;  3LQV A;  3BH7 B;  3CED A;  4USW A;  2P2C B;  2L9D A;  4QW8 A;  2GX8 A;  1JLQ B;  1FT8 A;  2GAH C;  3MD1 A;  1Q7L B;  1IXK A;  1YJR A;  3DOK B;  4NZ7 A;  4A8S A;  4WFN Q;  3M9M B;  4ZLL A;  3SI8 A;  2JNJ A;  4CO1 A;  4G3I A;  1NK9 A;  3LAM A;  1J5O B;  2HFN A;  4B9S A;  3BSN A;  4ANE A;  4DUZ F;  4Q2M A;  4KPC A;  5F3T A;  4MIA A;  5F8L A;  3POT A;  4ZPA A;  2FZG B;  4EZ9 A;  3MMB B;  1RHM B;  3GG1 A;  1HHQ A;  3U27 A;  6FD1 A;  4DL3 A;  1NME B;  3LP0 B;  5KT4 A;  3ZXW A;  2PO4 A;  3QGI A;  4F0K A;  3CCQ S;  2RB7 A;  1BGX T;  5T7L B;  4Z7C A;  1FFS B;  2VPZ B;  1NK7 A;  4QWA A;  2H65 B;  1T9U A;  2NPI A;  3M2R B;  4MKA A;  3D28 A;  1OS5 A;  2W4C A;  4OLP A;  5GAG I;  1TR0 A;  3KYL A;  2KRR A;  2JOQ A;  4NX9 A;  2CJB A;  1X7V A;  2A0F B;  3OL8 A;  4FS2 A;  5LXY A;  4CLK A;  4A8W A;  2ALZ A;  3D2W A;  4KY3 A;  3H5U A;  4ZCM A;  5C24 B;  1R7I A;  3PAC A;  3E8O A;  1R43 A;  2DXE A;  2BRK A;  3C15 A;  5BR8 F;  2CPF A;  5ETS A;  2V69 A;  4CT8 A;  3AOA A;  4WTO B;  2RML A;  3EYZ A;  4TY9 A;  4TXS A;  1WF0 A;  5KFM A;  4OFZ A;  2W2O P;  1DUR A;  3D3C J;  2ZJP Q;  1F9H A;  4UOF A;  1U1Q A;  1SL1 A;  1RKI A;  1RT7 B;  2RVJ A;  3T5H A;  4FN5 A;  4ZVQ B;  3CJ0 A;  3GV7 B;  3BDE A;  1SL2 A;  1WOO A;  3C3L A;  4QIW D;  2OPP B;  4KQZ A;  1NSP A;  1QAI A;  2AJ4 A;  1FK9 B;  3DRS A;  4RW8 B;  3MEC A;  1T3O A;  2L08 A;  4ZIW A;  1SQE A;  4LFC J;  5G4D A;  2G2Y A;  2L3M A;  2AF6 A;  3PW5 A;  1K0V A;  2BQR A;  2BJ8 A;  2ZBI A;  1NJZ A;  4B3T F;  3HFV A;  4C0B A;  2Q6C A;  4DZD A;  2CUY A;  2HND B;  4UZC A;  5I42 A;  2FZC B;  2JEJ A;  2G2Z A;  2RU9 A;  1OQ6 A;  3ITH B;  3AY0 A;  5CXT A;  4NLP A;  1WD6 A;  5ITH A;  4DWI A;  1HWI A;  1BY9 A;  4NA2 A;  2HG4 A;  2FC9 A;  2KT5 A;  1SV5 A;  3VAH A;  3ZTS A;  2B7C B;  2ASD A;  4B3T J;  2C2M B;  4U95 A;  2ATL A;  4WFZ A;  4EFA C;  1RTH A;  2J6U A;  2HIY A;  2Q6B A;  4B3M F;  2CAD A;  4AD6 A;  3T19 A;  5ETP A;  3US5 A;  3KK2 B;  4PUO A;  2AU0 A;  2R7S A;  3QJL A;  4JI8 F;  4O0I A;  5IZH A;  4OMF G;  3R5C A;  4DL6 A;  3AQP A;  2WTF A;  2IHR 1;  2AJ0 A;  1DY3 A;  2DTJ A;  4IO9 Q;  2ASY A;  4DX6 A;  1B3T A;  1F5B A;  3VVU A;  4C8M A;  1M5S A;  4UUW A;  4DCP B;  4I6Y A;  1HYS B;  2KVQ E;  4J9U E;  4WF9 Q;  3I9V 9;  4C6A A;  1OMS A;  2OKQ A;  3NOG A;  4FF2 A;  3SSS A;  1F0X A;  3NG8 A;  4J7C A;  2MKK A;  3M8W A;  4JI1 F;  3S6E A;  3G9C A;  1XIQ A;  3DYA B;  4K7Q A;  1KN6 A;  2N4C A;  2RUS A;  5HP1 B;  3AOD A;  2CQ2 A;  4BWM A;  3GFH A;  2YH1 A;  3PYE A;  1LW0 A;  2ZD1 B;  4QU6 A;  1I94 J;  3DGV A;  3M2U B;  5DZ6 A;  1PBA A;  2Z56 B;  4ZVP B;  4RPF A;  5ADZ A;  1Y00 A;  3H42 A;  3OTE A;  2LFV A;  4IFV B;  4ZDN A;  3KJF B;  4NA3 A;  1A0O B;  3FQK A;  1X8D A;  3M05 A;  2IVF B;  3EGV A;  5D8H B;  3O1L A;  3B82 A;  2M70 A;  2EFQ A;  1IKW B;  4NLU A;  4I4B A;  2I8E A;  1T9T A;  2KYZ A;  3KOA A;  2X7I A;  3PZP A;  2HVD A;  4LRA A;  2HAI A;  3R27 A;  4FYW B;  1WSV A;  5KFK A;  1U1M A;  3H40 A;  5A6W A;  1AYE A;  2Q3P A;  4ZN1 A;  2EC2 A;  3B6B A;  5KOX A;  3ONQ A;  1A6L A;  2WOM B;  2ABY A;  4DV1 J;  4ED7 A;  1KD1 T;  1U1K A;  1KVI A;  3DRP B;  2W9C B;  5IT4 A;  3IN5 A;  1HPZ A;  1GTE A;  1NKC A;  4DR5 F;  1VHF A;  5ETK A;  5U47 A;  3N0V A;  2V8D A;  1J5E J;  1BD6 A;  2FPH X;  4CI0 B;  3P6Y C;  4M5N A;  3SDE A;  3V81 A;  1WI8 A;  4H54 A;  2NXN A;  4C8O A;  3SSQ A;  1UJ6 A;  3VAK A;  3GSI A;  2B5J B;  4L3N A;  2E1R A;  4WIQ A;  2F8E X;  2HKE A;  1L3V A;  1VQP S;  1KTQ A;  1LK7 A;  1WF2 A;  2RQC A;  1C4C A;  2BE9 B;  1Q8L A;  4P2M A;  3DLL Q;  1UPM B;  2EFP A;  4OYB A;  3GCW P;  3TUZ C;  1FTC A;  2OEL A;  3KLE B;  4EZ6 A;  1UW9 A;  1NBE B;  2NCK L;  5DET A;  1C2P A;  3ZTP A;  2CPZ A;  4J90 A;  4ECR A;  1RAA B;  3JTO A;  4DR3 J;  1FDB A;  4OI6 A;  1MNE A;  1G1X A;  4IRD A;  2JRS A;  1JK9 B;  4LFA F;  3OSP A;  1VBZ A;  1R8H A;  1R31 A;  4UQG A;  1A9N B;  5FDL A;  2MKJ A;  1TL7 B;  5HSP A;  4UOG A;  1Q86 T;  1RAB B;  3V4I B;  2EFO A;  4MYU A;  4RZR A;  2W7O A;  1X4E A;  4HTJ A;  4F4Y A;  4OV6 A;  2YQ0 A;  1HQE B;  1T05 B;  1HNI B;  5KTQ A;  4U7C A;  2FIU A;  3WC2 A;  4LSN A;  3TJ9 A;  1SKS A;  2UXC J;  2EG2 A;  1RT3 B;  3QGP A;  3M8P A;  1FVQ A;  1RBO B;  1N33 F;  4UOC A;  3OXL A;  4GRS A;  2RHQ B;  3BKT A;  1Y5L B;  2RDI A;  1WC3 A;  4CO2 A;  5D0G A;  4X66 F;  2XMU A;  5CZV A;  4FS1 A;  4XAK A;  4A8O A;  1RWK B;  3QLH B;  2W2M P;  2QL7 B;  3Q2T C;  1FX4 A;  2MTL A;  1HBM A;  3T9Z A;  1L3K A;  3JYT A;  1X5T A;  1YJU A;  1VQ5 S;  5L1L A;  4I69 A;  1REV A;  4I2P B;  4BC9 A;  1S79 A;  3GIJ A;  5I4M A;  3IWX A;  4I6A A;  5KFU A;  3HHN B;  1RU2 A;  1JWW A;  2G4B A;  1GH8 A;  2ZOG A;  1M5H A;  1AA1 B;  4C3L A;  4WZM A;  2XLJ A;  4NZ0 A;  4DSE A;  2QA1 A;  2YKP A;  3CDB A;  2O01 C;  2NUU G;  2ZH5 A;  2QFJ A;  4LRC A;  3Q8R B;  3T6J A;  3ILL A;  2DNG A;  1EHW A;  4OI2 A;  2CWX A;  3SIP B;  4NXN F;  2QLF B;  4O4G A;  4WFX A;  2B6A B;  3HCX A;  3ZZZ A;  5H1S V;  2XB2 D;  1J27 A;  4TN2 A;  1SI9 A;  3Q22 A;  3BBF A;  2Q43 A;  4Q0B B;  1PKU A;  4ZPB A;  3NWR A;  5KFE A;  1QAJ A;  4ECV A;  1C0T A;  4X4Q A;  5CYQ B;  3BS9 A;  3TA1 A;  1KOO A;  2PEH A;  3HO1 A;  3BDP A;  2V34 A;  2AEM A;  2XMM A;  2BAN B;  2R8K A;  4KGM A;  4HH1 A;  4TNO A;  2NXC A;  2UUT A;  5LXR A;  5HQM A;  1Y7P A;  2D41 A;  3BKU A;  3B78 A;  1MU2 B;  2YX1 A;  3BN7 A;  5K20 B;  4TU9 A;  4DFK A;  3MEG A;  4OJH A;  5HVG A;  3KFW X;  5F9N A;  1HBU B;  3RU0 A;  2FJA B;  2Z0G A;  2IC3 B;  4ZA1 A;  1VC5 A;  1G4C A;  2GAG C;  2ZE2 B;  2VFS A;  4TYA A;  2GJF A;  4DF4 A;  1OO0 B;  3QO9 B;  1KKH A;  3PX4 A;  3UD5 A;  1U7L A;  4DN9 A;  4ED8 A;  2XZT B;  3M2V B;  3G86 A;  3CDU A;  3BGL A;  2WRM A;  1RTJ B;  2UUC F;  2RH3 A;  5C42 A;  2PI5 A;  1XK8 A;  2BE2 A;  2RRB A;  1WAC A;  2AEF A;  3AXM A;  2VQF F;  3DCA A;  2A2D A;  2R2S A;  4F4Z A;  2YKN B;  3BRE A;  3WQP A;  6AT1 B;  3A1Y G;  1MWZ A;  4LF6 F;  3CJ5 A;  3H7H B;  3DXS X;  3QWP A;  2HHU A;  3FRZ A;  2MZJ A;  2CNL B;  5A2Q U;  4ZVS B;  1QAX A;  3Q8V A;  4P2X A;  2FJW A;  4J9O A;  3OLA A;  2EBE A;  3QFW A;  4CM0 A;  1RBL A;  2AGO A;  1CUL A;  4RNO A;  4GVB B;  1S9F A;  1UJ5 A;  1IN0 A;  1XR6 A;  3IP0 A;  4OZ5 A;  4LF6 J;  2VKR A;  3MOJ B;  2ILZ A;  1SIZ A;  1JLE B;  2MYF A;  1U09 A;  2DR6 A;  2UP1 A;  4FPR A;  1LW2 B;  5ETR A;  2DR8 A;  1F3F A;  1S1V A;  1V3R A;  3DGP B;  4TLQ A;  3M9N B;  2G0C A;  4B02 A;  5IS2 A;  4JYA F;  3DHW C;  5KFS A;  1U2R A;  3Q8P B;  1TL1 A;  1ZA1 B;  1RWO B;  4CQ1 A;  2JL9 A;  1N56 A;  3EPG A;  1NO8 A;  5LM7 E;  3JSR A;  3T6B A;  3GMG A;  4OI1 A;  4RKU C;  5KT7 A;  2AP6 A;  4LBP A;  4RNN A;  3W60 A;  4JI7 F;  1KLM A;  4HAC B;  4CTA B;  3HI9 A;  3R2D J;  2F1F A;  3EZO A;  5F8N A;  3FFI B;  1KOH A;  4PCQ A;  1RTZ A;  3CO9 A;  3H2U B;  2EKN A;  3EIC A;  3DOL B;  1WJ9 A;  2CJ9 A;  3EVW A;  4PWD B;  1NU4 A;  2J0X A;  3R9L A;  4OYO A;  5CZX A;  4JOU A;  2VIC A;  3FQL A;  1FXR A;  3HHD A;  4F2R A;  2OEK A;  2CQ3 A;  2R8I A;  3KHG A;  1S57 A;  3KUG A;  4MFB A;  4RW7 B;  2RRA A;  4CYU A;  2QJ3 A;  3PRD A;  3Q8U A;  1U0H A;  4AUK A;  5DDO C;  2YNI B;  3W9H A;  2EK1 A;  1HWU A;  1XMO F;  3JB9 k;  1LWC A;  3GIL A;  1QE1 A;  3ZTO A;  3D5M A;  5KG4 A;  4OZN A;  2XO6 A;  3V6H A;  4J91 A;  3P45 B;  2Z2L A;  2CFX A;  1X4G A;  1T03 A;  2O66 A;  2WSC C;  3GSD A;  2VOP A;  1N6Q B;  1N32 J;  3UDC A;  4O23 A;  5J1P A;  4ZLP A;  3CJ4 A;  4F4W A;  2MKS A;  1UJ4 A;  3LGH A;  3R6L B;  3SCI E;  3KK3 B;  3CTR A;  5C2C A;  2IRY A;  5M2R A;  2KN4 A;  3BR8 A;  4JI6 F;  1N5V A;  1DTQ B;  2MLX A;  2RQM A;  2EC0 A;  3L4B C;  3Q8Q B;  2KH9 A;  3N28 A;  3D0I E;  4A8F A;  2Z2Y B;  3CUN A;  1LK5 A;  1NKB A;  4DV2 F;  1JLG A;  4KKO A;  3SFU A;  4CZC A;  3FDS A;  2VQE F;  4IDK A;  1HWK A;  1JLC A;  3CCS S;  2HFS A;  2F63 A;  1TKZ B;  3BGR A;  3CUL A;  2Z8Q A;  2I0X A;  3KG4 A;  4H4O A;  1N36 F;  3KDN A;  2HQF A;  4C11 B;  5C2G A;  1WC6 A;  4OX9 F;  2CNN B;  1S1U B;  5J2N B;  2VQE J;  1VJQ A;  3CJQ A;  1HWL A;  5KFD A;  2WVE A;  3I6P A;  4C8K A;  5L38 A;  1S49 A;  3N5B A;  4NMX A;  2QIF A;  3PY8 A;  2XZD B;  5KT3 A;  1X4C A;  3KUH A;  1UEU A;  1B4S A;  3CJ2 A;  3O6Q A;  2PE8 A;  4B3S J;  1SCJ B;  2VPW B;  3M30 A;  2E5L F;  3GE9 A;  2R42 A;  2E7W A;  3PJX A;  3A3N B;  2V9K A;  2YWG A;  1L3T A;  2OUG A;  1NK0 A;  1E6V A;  2HQI A;  2HFU A;  2KZZ A;  1U6F A;  4ZVE A;  1TVR A;  1U8W A;  2CG8 A;  4LF7 J;  4L74 A;  4DOZ A;  1K73 T;  5D4P A;  5KFI A;  2QSW A;  3TI0 A;  1YHQ S;  3MCM A;  4PQU A;  4DSF A;  2I5J B;  1S0N A;  3MMC B;  2J7U A;  4ZPD A;  3PYF A;  1V6H A;  3CD6 S;  5E3P A;  2B56 A;  4DN0 A;  4ZVG A;  3NGT A;  4CLS A;  1HBO B;  3C14 B;  2OSR A;  2YKA A;  3C15 B;  4B9T A;  1CJK B;  4OI0 A;  1OYE A;  4RU2 A;  3G96 A;  4IQM A;  3MXH P;  5DM7 Q;  3TX8 A;  2HFO A;  3OHB A;  4I6W A;  4QYZ J;  5HMX A;  4WK3 A;  3CCJ S;  4AXI A;  3QAT A;  1HI1 A;  3CPW R;  3RAM A;  3EGN A;  1YJ7 A;  3DRS B;  1WEX A;  3TAP A;  4X4U A;  4EO6 A;  2CQG A;  4DSI A;  3ZZT A;  1KVK A;  1R8B A;  3N6N A;  4OHV A;  1PYT A;  1JJ4 A;  4CLW A;  2F4F A;  3W2V B;  2EVZ A;  1RLD A;  2RT3 A;  3PNI A;  1N5Y A;  3OUY B;  4IR1 A;  2A6O A;  3QZ7 A;  2XS5 A;  2FVQ A;  1F2H A;  2MQP A;  2W8K A;  1VC0 A;  4UY8 5;  3CCV S;  4LF9 F;  1SV5 B;  3PW0 A;  3OLB A;  4ECZ A;  3W61 A;  2CJA A;  1VFJ A;  1VLY A;  2GZO A;  1QLN A;  5A8W A;  2MPU A;  4F4K A;  2EPI A;  2MJU A;  1RTH B;  1KHV A;  2PI4 A;  4FYV B;  1UVM A;  2HW3 A;  4WFA Q;  1FD8 A;  2FJE B;  3K8V A;  1WOR A;  1NHU A;  3CIM A;  4WFB Q;  1H2U X;  3IM9 A;  1YRU A;  2HBY B;  1JQG A;  4GKJ J;  2ZM6 F;  3AFG A;  4YS2 A;  2F4V J;  3J80 Y;  1N8R T;  1GFW B;  4M63 A;  4KRW A;  1M5O C;  3QRQ A;  3A8E A;  3CVK A;  1VRU B;  5HMW A;  1WG4 A;  2CPY A;  1X4D A;  2DGV A;  2QX0 A;  2BR0 A;  1NSK L;  1ZPV A;  3H4B A;  2KHD A;  1X31 C;  2ZBR A;  2HUR A;  2ZM6 J;  4QR0 A;  3UPF A;  4ID5 B;  2BXJ A;  3LAK A;  2C28 A;  4DUY F;  2MY8 A;  1ZM2 A;  2VOO A;  1HNX J;  3DM2 A;  2E9R X;  1KDN A;  5DDR C;  3TAR A;  5D0H A;  2MQM A;  2FVP A;  3R5J B;  2CQI A;  2DGX A;  2DNN A;  1WC1 A;  3GP9 A;  3CD7 A;  1LW0 B;  1UZD A;  4IH7 A;  2ZC3 A;  3PKM A;  2LXU A;  1HLW A;  1LOU A;  2IDE A;  4WP9 A;  1NM2 A;  2HRU A;  2QEX S;  3GZ7 A;  1HA1 A;  3LPY A;  2XHW A;  2E66 A;  1NJX A;  1IBK J;  3GII A;  3QBC A;  2R2U A;  4NOH A;  3BSO A;  2GVD A;  5L39 A;  2FYX A;  4DXL A;  1NDL A;  1KLN A;  3F44 A;  4E98 A;  4A8Y A;  1QDU B;  4FYD A;  2UUW A;  3HFZ B;  5JMN A;  3FGV A;  4MKY A;  2JEI A;  4N8N A;  4WP3 A;  4WKY A;  3D1Q A;  3SCL E;  4TVA B;  3KK1 B;  2HGL A;  2QYG A;  3IGN A;  2QA4 G;  5DQI A;  1EX8 A;  4KJI A;  4V19 X;  2KFN A;  5IOL A;  2C3O A;  3AOB A;  3V2U C;  2PFD A;  5A6P A;  2IRX A;  3NLC A;  4MYT A;  1ZTT A;  1Q82 T;  4HHJ A;  5LMN F;  4F4X A;  3PX6 A;  3MUM P;  1BUX A;  3CCM S;  4YQW A;  4MK9 A;  2GGP B;  3L7U A;  4DV5 J;  4ZJO A;  3O8W A;  3A3P B;  3PDN A;  2LP4 A;  4FKY A;  4IG0 B;  4USJ C;  4DFM A;  4YN3 B;  4NYO A;  2DCL A;  1HPZ B;  2HS3 A;  2P9G A;  4CLT A;  5THW A;  2DHS A;  1V5V A;  3RJM B;  1RT6 A;  4E0D A;  2HSE B;  4KH1 B;  5HAT A;  3HJV A;  2MKI A;  3Q2S C;  3S1T A;  5GMD A;  4Y3C A;  1VGY A;  1V5I B;  2UV8 G;  2BJ3 A;  1S1W A;  4EMD A;  5KT6 A;  2YNG B;  1VIS A;  1NH8 A;  3D6H B;  4KT0 C;  1PCA A;  3IM8 A;  4YUD A;  3DDK A;  1R89 A;  1WDT A;  4NLY A;  4C98 A;  4M5J A;  4A8M P;  2IIH A;  3UDE A;  1K9M T;  1LQ9 A;  1RTI B;  1WKJ A;  3GFY A;  4NYZ A;  2V2Z A;  4DLE A;  2H4Y B;  4L3K A;  3MUT P;  3M1V A;  3CCT A;  4RX6 A;  2VFT A;  4ELT A;  1VJW A;  1UP1 A;  3GWC A;  1WEY A;  2HHT A;  5DQH A;  4DPY A;  1YJV A;  1U1L A;  2UXD F;  2H48 B;  2J5A A;  1HQ2 A;  5B0A A;  2RDJ A;  3ADA C;  2GMH A;  3NL0 A;  4URS A;  4C8L A;  3RRH A;  5DS7 A;  4RW4 B;  2DEI A;  3G8T A;  4G1Q B;  1XNQ F;  4UF4 A;  4F0M A;  2Y1R I;  5GAD U;  1TUW A;  4LQ3 A;  4LSN B;  5G0R A;  3NKY A;  4K4T A;  3M8P B;  2J6S A;  2CJQ A;  4DF8 A;  2LEA A;  2ILY A;  1YI2 S;  3KHL A;  2C22 A;  1S9G A;  5E33 A;  4MAK A;  3OL9 A;  5BYQ A;  2Y1L B;  3GON A;  3FMW A;  4O3S A;  2JHE A;  2FY8 A;  2JZ5 A;  5LMU J;  4B3R J;  4KIA A;  1JLB A;  1IR2 A;  1GXL A;  1S6U A;  1FHT A;  3IG1 B;  4CT9 A;  2Z4P A;  3JYT B;  3IBC B;  2W8L A;  4Q44 A;  4A8K A;  2DR5 A;  1FRH A;  2VFV A;  2MLZ A;  3U1N A;  4EK2 A;  2K06 A;  4P6Q A;  4MMO A;  1DTT A;  4JUZ A;  2MKY A;  3GJQ B;  1TP7 A;  5GAD I;  4B9U A;  2KI2 A;  1WOP A;  2XI3 A;  5GAE U;  1R8C A;  3RRK A;  2PD1 A;  5B0G A;  2BV3 A;  2UUA J;  1FE0 A;  1RAO A;  4DR7 F;  1YIT S;  4WJB A;  3TRG A;  2VC1 A;  4C48 A;  3SEO A;  2GQC A;  1FWK A;  4O4G B;  3OR1 A;  3A4T A;  3TNV A;  5CA5 A;  3DU5 A;  5EWG A;  2D3U A;  2NYH A;  4Y2I A;  1X5O A;  4URQ U;  2X1B A;  4IH6 A;  3RAX A;  3P5T L;  4USK A;  4RNM A;  4MK7 A;  1Y3J A;  1XNR F;  5KFB A;  2YY3 A;  3VR1 A;  4R25 A;  1WDD A;  3HSJ A;  1IWA A;  3V5R A;  5HRO B;  4NCB A;  4DX8 H;  4DL5 A;  5GAE I;  3BO3 A;  3LH2 S;  3B54 A;  4CWB A;  1OY9 A;  1CEZ A;  2HBQ B;  4OX7 A;  3IRX B;  3IBF B;  3CME S;  2BDP A;  1CS4 B;  2JVR A;  4OJG A;  1XMQ J;  4FYX B;  4KHR A;  4QOT A;  4WE1 A;  1LWE B;  3OV7 A;  4ZVH A;  3HHL D;  3FZB A;  3UVJ A;  5I3P A;  4HKQ A;  3I87 A;  4OJ1 A;  1RLC L;  5F8M A;  4DU8 A;  2KT3 A;  3FBB A;  3HX9 A;  1VQN S;  2PGC A;  3VZH A;  2VOD A;  5F41 A;  3I5B A;  4CLF A;  4NI2 A;  2DRD A;  4P7V A;  4I2Q B;  3OTO J;  3K57 A;  1HL6 A;  3D6T B;  1DQ9 A;  1Y4Z B;  3W7B A;  2WCX A;  3P96 A;  4U9R A;  1C1B A;  2BE2 B;  1Q7Y T;  3ETM A;  3TUJ C;  5CCM A;  1CJV A;  1HFE L;  2NUH A;  2ZH9 A;  1TMJ A;  3OVS A;  4X64 J;  3PIP Q;  1R0B G;  4BWJ A;  4Z37 A;  1VQ9 S;  2HGN A;  4QZV B;  3CDE A;  4C8Z A;  5CD4 A;  4R5P A;  4ILR A;  3TW0 A;  4L75 A;  4W92 B;  1IJE B;  1IM6 A;  1CUL B;  1BMQ B;  1SJ3 P;  3RR7 A;  2P6T A;  2R7U A;  2C3U A;  2P8I A;  4UW2 A;  3B4D A;  3IMQ J;  2MGZ B;  1WI6 A;  1U1P A;  2BEF A;  2B3T B;  3MM6 A;  1WEZ A;  1VBX A;  1RAD B;  2EKY A;  3V6D A;  3ET6 B;  1UFL A;  1B7F A;  3DRX A;  1S1V B;  4ER8 A;  4JI3 F;  3ZO7 A;  4ECU A;  2WK4 A;  1ZZF A;  5J2M A;  1TL1 B;  2JLG A;  4F67 A;  3OR2 A;  5EWE A;  2RS8 A;  5T14 A;  3NGS A;  2Q79 A;  1B64 A;  3OQ2 A;  3U1M A;  2YPY A;  5B09 A;  3F41 A;  3TVZ A;  3WBZ A;  2CQ0 A;  3S8S A;  5BYS A;  4ECW A;  1FWL A;  4HVZ A;  1IBC B;  1FJ7 A;  2B4O A;  2DNO A;  2YVS A;  3BV8 A;  4ETZ A;  2JH3 A;  3JTP A;  2LYV A;  3L7O A;  3OXG A;  3VWS A;  4M5I A;  2ZKU A;  5HBM B;  2CG4 A;  5I3Q A;  2JEG A;  2MEW A;  2ZHA A;  3M6V A;  2IAJ A;  3BF4 A;  5CH7 B;  3VGV A;  3QGG A;  3OVB A;  3NEK A;  4BHQ A;  4HI1 A;  2OAU A;  4TU7 A;  2JC0 A;  1P6T A;  1BQX A;  1YRT A;  4L73 A;  3KG0 A;  3NNC A;  4DV3 F;  4DV6 J;  5E3C A;  5IT9 Y;  2RF2 A;  1T9X A;  3OBI A;  3R7N B;  3F73 A;  3CCR S;  1KEK A;  3KLF B;  2DH9 A;  1NRK A;  3HSG A;  2HYI B;  3MHY A;  4CH1 A;  2Z2Z A;  4U8V A;  4X4N A;  2CJX B;  2ROE A;  3K0J A;  1FF2 A;  1SH0 A;  1WNE A;  2L48 A;  4OYX A;  2OD6 A;  4DV3 J;  3VF0 B;  4UTG A;  1QE1 B;  3T1Y F;  2UVV A;  3HSD A;  4Q43 A;  3OHA A;  3VGS A;  1G2E A;  1H73 A;  3RB3 A;  2LA4 A;  1IM4 A;  3CJ3 A;  2QTW A;  4X62 F;  1PIE A;  5KFP A;  2HRY A;  3OTB A;  2K7J A;  5GAH I;  4LBI A;  1F1B B;  1RAC B;  2V67 A;  1T03 B;  4X4R A;  2YKO A;  5KG0 A;  1D9A A;  3UN3 A;  3WIU A;  5F0W A;  4IQX A;  1SUQ A;  5BJR A;  1ICE B;  5AE2 A;  4Y00 A;  3UD3 P;  3N4W A;  1KP6 A;  5F8G A;  1N52 B;  2DVI A;  3ISN D;  4JV0 A;  3M6U A;  1T9Y A;  3KHR A;  4ZP9 A;  2VD3 A;  1MWQ A;  5J1E B;  5KFX A;  2HNY A;  3D7S B;  1S99 A;  3H90 A;  3N9U C;  3LAN A;  3LWL A;  4ZKA A;  2WVD A;  4LJM A;  3K5L A;  4RR5 A;  3WHI A;  5D3G A;  3GFX A;  2EXU A;  3AQO A;  1D9F A;  4CNZ A;  2LQB A;  2QG9 B;  1FKO A;  4A46 A;  2VUG A;  1B0T A;  4O3R A;  3Q89 A;  4OYA A;  4IDK B;  1I51 B;  3BGR B;  1UWB A;  2E1C A;  2E29 A;  4H4O B;  4ZVR B;  1RXO B;  4UOH A;  4DR2 F;  3PFO A;  2CA9 A;  3LP1 A;  3LO3 A;  1XC9 A;  1MSW D;  2HBR B;  1FJG J;  4WU3 A;  3NOC A;  2FDN A;  4YHH F;  4JV1 A;  1L3U A;  5D4L A;  2Z57 B;  2N3O A;  1R0A A;  1FRJ A;  3TZX A;  2KHC A;  2ZHB A;  3FBF A;  3HP6 A;  5D4O A;  2GHV C;  3DLG A;  4OYI A;  2JSX A;  3M30 B;  2NSC A;  3CD5 A;  5DLG A;  1F5C A;  1RGV A;  2MQN A;  4ED2 A;  1GXU A;  5C25 A;  5LSR A;  4F7V A;  2KO1 A;  3K17 A;  2EFG A;  3OT9 A;  1ZH5 A;  2ZVS A;  3TEH B;  3AXK A;  1CPZ A;  5IWA F;  4K0K F;  4YDX A;  1YJT A;  2KG0 A;  3C8Y A;  4JV5 F;  4EBC A;  2NRE A;  4JB8 B;  1VQ4 S;  3P8B B;  1U1O A;  1PBU A;  3D67 A;  2XC9 A;  4J9N A;  1KS2 A;  3CDA A;  4J37 A;  1HNZ J;  5LJ3 Y;  4E8U A;  5AE3 A;  3I5A A;  5AXM A;  1F6T A;  3GB0 A;  4FVC A;  2ZFH A;  2AX1 A;  2EG1 A;  1U26 A;  1HWJ A;  3IO1 A;  5DQG A;  5AE1 A;  1EQM A;  4OYW A;  4OHY A;  1LFP A;  3AH6 A;  1F60 B;  1X4B A;  4DG1 A;  4ZS6 A;  1NDP A;  2M9K A;  1CQM A;  2R7X A;  3BGO P;  5EN1 A;  3PRB A;  1DAX A;  3AD8 C;  2JDJ A;  3KTQ A;  1ARO P;  2LEC A;  1T0T V;  2P5V A;  2J6T A;  5A0Y A;  2YPZ A;  2XMK A;  2J76 E;  2K1R A;  4L6V 3;  5DGB A;  2H9Z A;  2XMJ A;  2GO8 A;  3IR7 B;  3ZZR A;  4OHZ A;  4K8R A;  2HWH A;  4YB1 P;  3X3U A;  5A8W B;  4DV4 J;  4OV1 A;  8RUC A;  1DLO B;  1JB0 C;  4D3H A;  2K3I A;  4XPE A;  3GV8 B;  1FDA A;  4NCA A;  3R7B B;  4KO0 A;  2CVI A;  4P2F A;  2XY6 A;  2DHX A;  4NWB A;  2F7V A;  1N88 A;  1S1X A;  3QYY A;  2LU1 A;  4ENO A;  3BJY A;  1N5T A;  2N4D A;  1TUV A;  3GR0 A;  4DQP A;  3DI6 A;  3A8J A;  3K2Y A;  1W25 A;  3VGT A;  2IYI A;  2NSB A;  2XMV A;  3VGU A;  4DPT A;  1B7Y B;  2V8G A;  5HMZ A;  2B7B B;  5KFY A;  4NCG A;  4DFP A;  4Q2L A;  2ZBQ A;  2MZQ A;  4RL1 A;  3DM2 B;  3JS9 A;  1TL3 B;  5K8O A;  3D0H E;  2XEX A;  4AE5 A;  2UXB J;  1N34 F;  1Q95 G;  3FUY A;  3H5X A;  2CZ9 A;  3QNW B;  1Y3K A;  2N3L A;  5KG5 A;  1T11 A;  4DR6 F;  3TYT A;  5HVH A;  2UU9 J;  4FF3 A;  5E3R A;  1SC1 B;  1ZOT A;  2E1P A;  2MHN A;  3SQO P;  3H98 A;  1ZAW A;  2FUG 9;  4ZIT A;  3D9B A;  1N34 J;  4OZ3 A;  4X4O A;  3IAM 9;  1QSS A;  3RW7 A;  4LF4 J;  1YJW S;  4KH0 B;  2CQP A;  1EP4 A;  1EAY C;  3R5D A;  2CJY B;  4ICL A;  1YSJ A;  1RSC A;  3MPW A;  3KJV A;  2WZ1 A;  4ZJL A;  3J7Z T;  2R7O A;  2DNM A;  1IBL F;  4ZJQ A;  1IBM F;  4NRT A;  3BBB A;  5F3Z A;  3EUN A;  2PC6 A;  4DR4 F;  2K3K A;  1W2B R;  2F5G A;  4DU7 A;  5E2Q A;  2Y8W A;  2ATC B;  3HKZ D;  2XMT A;  3SCK E;  1VQO S;  1TV6 B;  2YWH A;  3FMB A;  3L7P A;  3BKF A;  2J7W A;  1TEL A;  5HQ8 A;  4KGK A;  3JQK A;  1AZS A;  2DXF A;  3H8Y A;  2BJ9 A;  1PIL A;  1IBM J;  3RB0 A;  2V9W A;  2M8D B;  3HVW A;  1NK6 A;  5DJB A;  2D74 B;  4N8O A;  3TJA A;  2NLW A;  1UW4 A;  2IDL A;  3L09 A;  2J7K A;  1GNK A;  2RNE A;  3W62 A;  4P10 A;  3NGD A;  5AJ3 F;  3EGW B;  3ZZU A;  2PSZ A;  1QY7 A;  5EWF A;  3UQS A;  2MXY A;  4C7Q A;  2CJK A;  2HHW A;  4EEY A;  3HD1 A;  1SPB P;  1ZA2 B;  2FGO A;  4LF8 J;  1H38 A;  4QBU A;  4X4T A;  3BQ1 A;  1OSD A;  4A48 A;  1RAH B;  6FDR A;  2ZH3 A;  1RWX B;  3M1V B;  3W8G A;  1VQ8 S;  1SJ4 P;  4OQJ A;  2HMI A;  2VG6 A;  1T7P A;  5DLF A;  4PYD A;  4KFB A;  3BZQ A;  4UZB A;  5HQL A;  1ZPW X;  1X60 A;  2V68 A;  1DQA A;  2BYC A;  1TZ0 A;  2YQ3 A;  2VA2 A;  3X1L B;  4E2F B;  2WON B;  1VC6 A;  1UFK A;  1FRX A;  4DV7 F;  2JFK A;  1HNW F;  4LUB A;  4J9P A;  2NPF A;  2AW0 A;  1NJY A;  3TA0 A;  4AL6 A;  5G0R B;  1K0T A;  3MMB A;  3PCO B;  3B8H A;  4YB6 A;  4OZ2 A;  3LP0 A;  1AB8 A;  1FD2 A;  4OYM A;  2Y3Y A;  2DEJ A;  2ALY B;  3O44 A;  4NA1 A;  5T7L A;  2COL A;  4MKV A;  3NGK A;  4PG8 A;  4B9L A;  1V3Z A;  3KLI A;  1BXN A;  4NML A;  2CQH A;  2AV5 A;  4RNF A;  5K8M A;  1DHM A;  2GIR A;  4NAS A;  3O3L A;  1Y9O A;  4M5K A;  4MK8 A;  2ACM A;  4F50 A;  2M4M A;  5HI7 A;  2VF3 A;  2ZWP A;  2M7S A;  3FK4 A;  4DUZ J;  3MM9 B;  2CRL A;  2HHH F;  4G1I A;  2J9C A;  3Q23 A;  1F9E B;  5ETQ A;  4LR7 A;  3MFH A;  4PG6 A;  3EWG A;  1WF1 A;  4V1A k;  1Z2L A;  4CLP A;  4FXD A;  3DFE A;  2AD9 A;  2FVR A;  4W90 B;  4LFB F;  3FEY B;  2KU7 A;  2IMO A;  1RT7 A;  3EMT A;  1M1H A;  3IRW P;  4F3Q A;  1RKJ A;  2HHH J;  3T1H F;  2KM8 B;  3HT3 A;  3DN9 A;  2OPP A;  3BQ2 A;  4DSK A;  1FK9 A;  1SKR A;  3N01 A;  2FHJ A;  4RW8 A;  4QWC A;  4ALZ A;  4CLZ A;  3Q86 A;  4FKX A;  4ZN3 A;  1CC8 A;  2CQD A;  2J8S A;  5H9F K;  1CBK A;  4IFY A;  5BR8 J;  3HK2 A;  1NDC A;  2LMI A;  3UW1 A;  5LSL A;  3UDV A;  3FBE A;  4NLQ A;  2C1E B;  3RW6 A;  2UV8 A;  5HLF A;  5KFV A;  2BBE A;  3MPY A;  3W2W A;  5IM0 B;  4AL7 A;  2W2P P;  1B70 B;  4ILL A;  1TKX A;  1HKA A;  3QT7 A;  1EET A;  1GK8 A;  2KJV A;  2IM3 A;  2MZT A;  5GVQ A;  3NS7 B;  2DK2 A;  4HLB A;  3AD9 C;  4A8Q A;  3ISZ A;  2V5H G;  1FDD A;  2O1P A;  3TX0 A;  3ENQ A;  5L9X A;  2MST A;  3SV3 A;  4B08 A;  1VR6 A;  1HAR A;  2OH2 A;  1NCL A;  2IJN A;  3UVJ B;  4PAA A;  1BC6 A;  3KK2 A;  1U24 A;  4DL4 A;  4ELU A;  1NHV A;  1VRT B;  3C6T A;  2H4W B;  4FP9 A;  3ELH A;  1EKS A;  2V2Q A;  4KGX B;  2M3D A;  4I64 A;  4HYK A;  2KXH A;  2I2Y A;  4M5H A;  2RAQ A;  1S7H A;  2X1A A;  1D09 B;  3PIO Q;  3BO4 A;  2NXE A;  2AIR B;  1AUS L;  3MR6 A;  1KON A;  3KNG A;  1X0F A;  4TU8 A;  2ZH4 A;  5HVF A;  4LIW A;  1C1B B;  4UQT A;  4LF1 A;  1UFW A;  2PN6 A;  1QUV A;  5HAN A;  4B3M J;  1HYS A;  3BGU A;  5DO2 A;  1RQ0 A;  3GYN A;  4ECQ A;  7AT1 B;  1BQN A;  2PMH A;  1YWX A;  4OX6 A;  2H1Y A;  3I4H X;  3JSY A;  2V8H A;  2UVR A;  1UEK A;  4MIW A;  3DYA A;  5JJB A;  5H9E K;  2JEF A;  1IKY B;  4JI8 J;  3PO5 A;  3S7R A;  3MAA A;  3EPI A;  3GJT B;  3JSM B;  4EI2 A;  1TAU A;  3CJK B;  4C3M A;  4IG3 A;  1HR0 F;  4IRC A;  4KHM A;  1H6K X;  4GVL A;  4TKT A;  2BQU A;  4C0O C;  3R8Y A;  4TY8 A;  4R0E A;  1UAW A;  3V6D B;  3A13 A;  3GCX P;  2HBZ B;  3BQ0 A;  3OJU A;  4JI4 F;  3G82 A;  3OJS A;  3KG1 A;  3FSI A;  3BM7 A;  1ZET A;  1HR0 J;  4YME A;  2F9J A;  2OFH X;  4OZL A;  5J2M B;  5I3U B;  4JI1 J;  1C1C B;  3OR2 B;  2W01 A;  1XER A;  5BXI A;  2G13 A;  3D1O A;  1CJU A;  1Q4R A;  2CKW A;  2N7C A;  1IKW A;  2IRU A;  2FHM A;  2CQ1 A;  5B0B A;  1RT2 B;  3SQG A;  1S4E A;  3P4U B;  4U8Y A;  2ZH6 A;  1BWV A;  4DBQ A;  5KT5 A;  4RUA A;  3DMJ B;  2FLN A;  2ZWO A;  1U0S A;  4X65 F;  3MR2 A;  3WX4 A;  4PKD B;  1LEO A;  1JX4 A;  2DRB A;  1SBR A;  2GQQ A;  3T5K A;  1R6Y A;  4M5D B;  4OI4 A;  3LOU A;  3EX7 B;  1JLA B;  2HQC A;  3DRP A;  2V4R A;  1OPZ A;  1NK5 A;  1R3N A;  3HXM A;  2DNR A;  1TK0 A;  1IR0 A;  1D8Z A;  1WTB A;  3I56 S;  4Q45 A;  3DLE A;  2B5J A;  1V3S A;  1EQ0 A;  4FF1 A;  2D9O A;  3K5P A;  1FJE B;  4PAB A;  3ILI A;  3D3B J;  3AJ1 A;  2ZH2 A;  3CWJ A;  3R2C J;  1O6X A;  4DX7 A;  4HR2 A;  1S72 S;  3QSI A;  2EI5 A;  2X3D A;  4FBU A;  1KNZ A;  4DR5 J;  4AQY F;  2E7X A;  1TTH B;  3HVT A;  1SL0 A;  2VFR A;  5MLC V;  4NLT A;  5DG8 A;  2OIH A;  1QAY A;  1VQK S;  3CW2 C;  4RUB A;  5EGY A;  2AZ3 A;  1PJ6 A;  1HQU B;  3UR0 A;  2GMJ A;  1BLU A;  2HNZ B;  4C3K A;  1YBU A;  2RQK A;  1C0U B;  1O5J A;  3AJD A;  2VDH A;  3CJR A;  1RTD B;  1D8Y A;  2FVC A;  2ZNZ A;  5IXU A;  3LWM A;  1T05 A;  2FHO B;  2KFY A;  3AHP A;  4DSJ A;  3K58 A;  4EUV A;  4KR0 B;  1L3S A;  1UZH A;  5KFZ A;  3PJW A;  2HNY B;  3NBP B;  1GMU A;  1RT3 A;  3NAI A;  3NCR A;  4K4Y A;  2Z30 B;  3KUE A;  4KGV B;  2VG7 B;  3D54 A;  2MHE A;  3EZU A;  3QJP A;  1RT5 B;  4LFA J;  3MMA A;  4I67 A;  1FKO B;  4MTP A;  3MCO A;  3RRG A;  2DJW A;  2I9S A;  5LJ5 Y;  2XYG B;  2N82 B;  3M6X A;  4PQA A;  3C46 A;  2H5J B;  1X0P A;  3R5A A;  1UWB B;  3T1A A;  1SH3 A;  2DIS A;  1UWA A;  3HMJ G;  1UA0 A;  4KHP F;  5CHC B;  2FHJ D;  2QGF B;  3D4J A;  4I2P A;  3DLK A;  2I6W A;  3GFZ A;  2BM1 A;  1DJ0 A;  4O44 A;  2GVZ A;  4RBV A;  3T41 A;  2BOA A;  2XWY A;  3JTN A;  4NE9 C;  4JI5 F;  1N33 J;  4F04 B;  4JI0 F;  2ZZT A;  3MZI A;  5KG1 A;  2BAB A;  3I96 A;  2XSF A;  2R8H A;  5JUM A;  2ZIT A;  3MR3 A;  1MN7 A;  3JQM A;  4X66 J;  4ECX A;  5ETT A;  2G0J A;  3D68 A;  2VH7 A;  3PKY A;  1T9W A;  1TMM A;  2B6A A;  1KFD A;  4HDG A;  4ATN A;  1VK8 A;  4B3O B;  4YP3 A;  4W4M A;  2HHS A;  4WKR A;  1UET A;  4NLV A;  3ENA A;  2FY1 A;  2DYA A;  2POK A;  4DPX A;  4YR0 A;  4EYI B;  4M5L A;  3CJ8 A;  3HHE A;  5CYQ A;  1RUS A;  4NLO A;  1WC0 A;  4ES3 A;  2DGS A;  4CDI A;  4EU0 A;  2Y8Y A;  1S59 A;  3W63 A;  3HJF A;  2DHH A;  3F0N A;  3MTJ A;  3NWG A;  4NXN J;  1FKP B;  4DV0 F;  2A6M A;  3I32 A;  2OTL S;  4H4M B;  1U02 A;  3TO8 A;  2ZOF A;  4FZV A;  3NRB A;  3NMA A;  1UVI A;  3QJJ A;  2IM1 A;  5E0O A;  3NY0 A;  3UCU P;  2IC3 A;  5A8R B;  2LU2 A;  5A8K B;  3GYG A;  2H51 B;  2ZE2 A;  4IKA A;  5EX3 A;  3DRY A;  1EB0 A;  2MKH A;  1YZ7 A;  1VQS A;  3CSK A;  4GO5 X;  3H20 A;  4P74 A;  2Y0B B;  2KFZ A;  1S0V A;  4IH5 A;  3NAH A;  3M6W A;  4U7U D;  2HK2 A;  2XYH B;  3J7A 1;  4DG1 B;  2L9N A;  2G1H A;  3RBE A;  2ZHO A;  4NLS A;  2W9B A;  4Y0F A;  3G4S S;  1S48 A;  2V6A A;  2HLT A;  3NP5 A;  2AX0 A;  3EGZ A;  1Q81 T;  2PII A;  5A0Y B;  2XUL A;  3DOM A;  2YKN A;  4GKK F;  1QTM A;  3HKW A;  1CJT A;  3KXD A;  2E9Z A;  2UUB F;  1RCO B;  4EGL A;  3H0P A;  4KAI A;  1J2V A;  4DL7 A;  2XM3 A;  1S12 A;  1BWE A;  3PXG a;  2QMU B;  2LA6 A;  2KRB A;  3ILJ A;  4PEO A;  2V2V A;  3FCV A;  5KAK A;  3H5Y A;  4QU7 A;  2KT2 A;  3W5Z A;  2UUC J;  4GVB A;  2NQP A;  1M1K T;  2OPR B;  1FRM A;  3QQC D;  1JLE A;  1P9Y A;  4KO0 B;  2VBX A;  3WC0 A;  5EUH A;  2VQF J;  1LW2 A;  3DU6 A;  1S1X B;  4YR3 A;  3DGP A;  2K8G A;  2LXF A;  5SZT A;  4ZPT R;  3RUB L;  2XI2 A;  5J2P A;  2YQ1 A;  1RIS A;  3CCL S;  2MQ8 A;  1HBN B;  4LR8 A;  4LF5 F;  1O8B A;  1WUU A; 
#chains in the Genus database with same CATH homology
 1Y10 A;  5D15 A;  1CJU A;  1WC0 A;  4USV A;  4CLF A;  1TL7 A;  4NI2 A;  2GVZ B;  1Y11 A;  5IV3 A;  1AZS B;  2WZ1 A;  1CS4 A;  3MR7 A;  1CJT A;  4WP3 A;  3R5G A;  4OYA A;  4USU A;  4WPA A;  4CM2 A;  3C14 A;  4OYZ A;  4CLU A;  5IV4 A;  3MAA B;  4OYX A;  1CJK A;  1U0H A;  2BW7 A;  2GVZ A;  1YK9 A;  4WP8 A;  4CLW A;  3ET6 A;  1WC3 A;  3C16 B;  1YBU A;  3MAA A;  4P2M A;  5D0G A;  1CJV A;  4OYB A;  4UST A;  2GVD B;  5D0R A;  3G82 B;  1FX4 A;  1AZS A;  4CLP A;  1FX2 A;  4NI2 B;  5D0E A;  5D0H A;  4CLY A;  1WC6 A;  1YBT A;  3C16 A;  1CS4 B;  3UVJ B;  4CLL A;  4CLS A;  1WC1 A;  3C14 B;  1CUL B;  3G82 A;  3C15 B;  1CJK B;  1WC4 A;  4P2F A;  2QV6 A;  1U0H B;  4WP9 A;  1CJU B;  4CLT A;  4OYI A;  4OZ2 A;  3UVJ A;  1TL7 B;  4CLK A;  4OZ3 A;  4P2X A;  4USW A;  1AB8 A;  1WC5 A;  4OYW A;  4CLZ A;  3ET6 B;  1CJT B;  4OYM A;  4OYO A;  4CM0 A;  1CUL A;  4OYP A;  1CJV B;  3C15 A;  2GVD A;  2W01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...