1WG1A

Solution structure of rna binding domain in bab13405(homolog exc-7)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
88
structure length
88
Chain Sequence
GSSGSSGILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords KIAA1579 protein
publication title Solution structure of RNA binding domain in BAB13405(homolog EXC-7)
rcsb
source organism Homo sapiens
total genus 12
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wg1A01
1CVJA 3K0JA 2YH1A 2DGSA 1X5OA 4Y0FA 1K8AT 1L3KA 1UAWA 1X4GA 2EK1A 2KM8B 3G8TA 2MQQA 1M90T 3NS5A 3R1LA 2F9JA 4Y00A 1X4EA 3TO8A 2MQPA 2YTCA 1VQ7S 2XS7A 1M5PC 3MUMP 2HGMA 3V4MA 2RT3A 1VQ6S 2DHGA 2KXHA 3CC2S 2N82B 5LXRA 3S01A 3P6YC 1N88A 3OW2R 2M4MA 1M5KC 1YJ9S 1X5PA 2G4BA 4ERDA 2DNQA 2E5HA 4QU6A 1W2BR 2HYIB 5FJ4A 4IOCQ 4WFBQ 2DH7A 2JX2A 2DO0A 2DGOA 2FPHX 3CCMS 2MMYA 2CPHA 3CCSS 2OSQA 2KRRA 2X1BA 1Q81T 2F3JA 2M2BA 4BS2A 1KOHA 2HGNA 2DH8A 4YB1P 3UD3P 5H1SV 3VAIA 2DNKA 2U1AA 4EGLA 4YOEA 2E5GA 4LJMA 3VF0B 1OO0B 2MKJA 1SJFA 3CPWR 1SJQA 2DNPA 3S7RA 2CPDA 1FJCA 3P49B 3UCUP 3DLLQ 5ITHA 1VQMS 2J8AA 5DM7Q 3HI9A 2DGXA 3FEXB 2MZ1A 4TU7A 1Q82T 1D9AA 1FJEB 4RU2A 3BO4A 3G9CA 1U6FA 2MKSA 2NLWA 2E5IA 2CPIA 2XSFA 2MSTA 2O3DA 3BEGB 2OIHA 3J7YU 2DNRA 3CTRA 3RW6A 2N3LA 5LSLA 3UD4P 2K3KA 2LXUA 3ZZYA 1WG5A 1X0FA 1B7FA 4PKDB 2GO9A 3CMAS 2RVJA 5GMKa 2MY7A 1M1KT 1O0PA 1JJ4A 4Z2XA 2LCWA 4U67Q 1ZH5A 1YTYA 2EVZA 2CPZA 5GAGU 2CQCA 1K73T 2K8GA 2Q79A 2J76E 2RQCA 1X4CA 2JVOA 1WHWA 3U1MA 1WF2A 1YJWS 1AUDA 1U1OA 2UP1A 2J0SD 1BY9A 2BZ2A 2MQNA 3H2VE 2VOPA 2DGQA 3R1HA 1X5SA 2KU7A 2GHPA 3ULHA 2XS5A 3UCGA 2MHNA 3BO2A 1JMTA 2RNEA 2MB0B 3NNCA 2ZJPQ 1WI8A 2SXLA 2X1FA 2ZJQQ 4J5OA 2LQ5A 2PEHA 2OTLS 3EGZA 2L08A 1VC6A 3TYTA 2KN4A 2FC9A 2LXIA 1R8PA 2DNNA 5DETA 1U1RA 4UQTA 5IQQA 1NJIT 2M88A 3CCES 5BJRA 3SDEA 3Q2SC 4IO9Q 3VAJA 3EGNA 1G2EA 1KOOA 2CQ3A 5HL7Q 1WEYA 3CF5Q 2DNGA 1VQNS 1U1MA 2J0QD 1U1QA 2LECA 4CQ1A 2M9KA 5GAEU 1S72S 2DGUA 2MQLA 3NS6A 2B0GA 4P6QA 4C0OC 2ERRA 1VC0A 4ED5A 2MJUA 3CCLS 2M8HA 1XN9A 1NU4A 2DNZA 1KQSR 4CH1A 1KD1T 3Q2TC 2QA4S 2U2FA 1YJNS 1HL6A 3MDFA 3MUVP 5D78A 3SXLA 4FXWA 5LXYA 5CYJA 2CQDA 2MGZA 3CCUS 2CPEA 2DNYA 5LSOA 2RS8A 3SDEB 1VQ8S 1YITS 3NNHA 1H2VZ 1U2FA 2QFJA 3PIOQ 3VAMA 5HO4A 3G6ES 4UY8T 3VAGA 2DNHA 2CQGA 2DGVA 2KFYA 3B4MA 3CULA 1U1LA 3S6EA 1WELA 3IRWP 1SXLA 1Q7YT 1VQKS 2VODA 2DNMA 2M70A 1VBXA 2MGZB 5JVGQ 1K9MT 1S79A 2FY1A 4PR6A 3PIPQ 2MY8A 2YH0A 1DBDA 1DRZA 1WG1A 2DGTA 4F25A 3CUNA 2DHXA 2KG1A 2E5JA 2ZJRQ 2MZJA 1A7GE 2QEXS 2KVIA 2KT5A 3VAFA 3VALA 2AYMA 2DNLA 3HHNB 3S8SA 3N9UC 1P1TA 2YWKA 1N54B 1N52B 1JJHA 3UE2A 1VQLS 2DK2A 4CIOA 1FXLA 2HGLA 2MXYA 5GADU 5IFMA 2CQIA 1VQ5S 1X4DA 2MKCA 1IQTA 1FO1A 1VQ4S 2NZ4A 1RKJA 4TLQA 5IM0A 2JWNA 3J7ZT 2DIVA 1D8ZA 1KC8T 2CQBA 5D77A 2G1DA 1HD0A 5DDPC 2N7CA 3I56S 2D3OR 1QVGR 1N8RT 1NO8A 2RU3A 2DISA 3CXCR 2PE8A 2N3OA 3H2UB 3MI7X 3EX7B 1WHXA 2E44A 1HD1A 2A3JA 3UCZP 4WKRA 4W90B 2AYBA 2DIUA 2BOPA 4TU9A 2XS2A 2KRBA 1WF1A 1URNA 5MLCV 4V19X 4W92B 1X4FA 5DDRC 1FJ7A 2KM8C 1UFWA 5IM0B 3CCVS 1U1NA 1H6KX 4FXVA 3D2WA 1YWXA 1F9FA 1QM9A 2HZCA 3ZZZA 4YUDA 1OIAA 5JVHQ 4ZKAA 1R8HA 3G71S 1WEZA 2CPXA 3LPYA 4CH0S 2WBRA 2CQ0A 5DDOC 2MYFA 2D9PA 1WEXA 1X4BA 3TP2A 2M8DB 4LMZA 3R27A 4M5DB 1SJ3P 2KI2A 2FHOB 3G96A 2MQOA 2FC8A 1Q86T 2AYEA 1VQPS 1WI6A 1M5VC 2RRBA 3MXHP 1HA1A 2I38A 2MZSA 4QQBA 1FT8A 1RK8A 4IUFA 3I55S 1ZZNA 4WCEQ 1ZZFA 4LIRA 3MUTP 1SJRA 2DHAA 3MD3A 2MZTA 1PGZA 2M52A 3BS9A 1VC5A 5GAHU 2MQMA 2MKHA 2OTJS 2LKZA 3VAKA 1M5OC 2M7SA 2MZQA 3CCRS 2MZRA 1PO6A 3THPA 2KXNB 3CC4S 4C7QA 2RS2A 3UWTA 2XNQA 4OZ1A 3SMZA 2CPJA 2I2YA 2DO4A 2ADCA 5CA5A 2DGWA 2AD9A 2JRSA 1U6BA 2HVZA 4A8XA 1DHMA 3MURP 3CCJS 3MOJB 3U1LA 2CQPA 3FEYB 2CPYA 2RUGA 2AYGA 3NMRA 1QVFR 1VQOS 2DHSA 3CMES 1OPIA 5CXTA 2RQ4A 1WHYA 3P3DA 2KHCA 1SJ4P 2DNOA 1FHTA 4WIIA 2DB1A 2LA6A 2MKIA 1WWHA 2MKKA 3G8SA 2CPFA 5LJ3Y 4WFNQ 2YKAA 2L9WA 2DH9A 3VAHA 2CQ2A 3THTA 4PRFA 2MJNA 2ADBA 2EK6A 2KH9A 1X4HA 2D9OA 5EN1A 3RW7A 2F9DA 2LA4A 2X1AA 2G0CA 3BO3A 3L3CA 3CC7S 1A9NB 1WF0A 4WFAQ 1OWXA 1WG4A 3IWNC 2XNRA 1H2UX 2X1GA 4QPTA 5LJ5Y 4TU8A 2KXFA 3LQVA 1YI2S 4F02A 2DITA 2LEAA 2M0GB 1UW4A 2OSRA 2OJ3A 2MSSA 2CQ4A 2XB2D 1FNXH 2RRAA 3DXBA 1VBZA 3CCQS 3B4DA 4F26A 3MD1A 4C4WA 5DDQC 2JVRA 1U1KA 5GVQA 5DM6Q 1YHQS 3NNAA 1JJ2R 2LEBA 4WF9Q 3US5A 1P27B 1H2TZ 1X4AA 3JB9k 2VONA 3CD6S 1VBYA 1X5TA 2MPUA 2LYVA 2VOOA 1DZ5A 2CJKA 1U1PA 1UP1A 1YIJS 4QU7A 3P5TL 1WHVA 2KG0A 4IOAQ 2CQHA 2KYXA 4OZ0A 3G4SS 2L41A 2LMIA 1WTBA 1VQ9S 2V94A 2CQ1A
chains in the Genus database with same CATH superfamily
2CZ4A 1HNXF 2HAFA 1F0XA 1QAIA 3KDOA 3KLVA 1PCAA 3E51A 3V6DB 3PFEA 3FDSA 3R3TA 1JIHA 1IKYA 1SKSA 5ETLA 1TL5A 2FJDB 4J9SA 2OPSB 3IAM9 2AEFA 1VRTA 3I9ZA 4KBIA 3M2VB 1KDNA 2PSZA 3CCZA 3IC1A 1HI1A 4OYBA 5DJBA 3CD7A 2MKJA 1SJFA 3ZZPA 5THWA 2JFKA 2W2QP 1UPMB 5A8RA 4RO0A 1W26A 4ZA1A 4PABA 2MLYA 4DF8A 2H4WB 1B70B 2VB6A 2OAUA 3CB4A 1YTYA 3G87A 3W2VA 4M1KA 5GAGU 2CQCA 3D4JA 3Q8SB 4JI6F 2A2DA 4WK1A 2J0SD 2Z2MA 1BUXA 1RT4A 2GHPA 2Q1LA 3BO2A 4K2XA 2IHR1 1VC6A 1U09A 2ASLA 1Q1KA 2DNNA 1S1UA 1YSJA 5KFDA 2QGFB 2C3UA 1BWVA 2HHQA 2ZH7A 3L9ZA 3T1YF 2J0QD 1TQLA 4DSLA 3DI6A 4C8LA 2ERRA 3FKBA 1JK9B 2RSQA 3WC0A 4USMA 4CH1A 3TI0A 4HL9A 5HQMA 4PWWA 1BMQB 1U0SA 2VDIA 1JX4A 5LSOA 2RJZA 2KJVA 5CZVA 2DNHA 2CQGA 3PJWA 4O3RA 1I94J 2R3VA 1VRUA 4Y65A 4A8WA 3M7VA 2HVEA 1Q8IA 4RX6A 1RQ0A 3GTYX 2PFDA 5AE3A 3OQ2A 1FVSA 4F25A 3C15B 1G3OA 2E7XA 4YB5A 3T6JA 3ZTRA 2G2ZA 4CIOA 1L3UA 1ZTTA 3OSPA 1NSKL 3NY0A 1ZPVA 2RE1A 3D6FB 2DRAA 4F4ZA 4LBPA 3CO0P 2OD6A 3H2UB 1U2CA 2DIUA 3SCJE 4NCGB 3F44A 4X4UA 1FEEA 3PX0A 2PT0A 4D3GA 3GJQB 3VGUA 3FUYA 1H6KX 4DV7J 2BJ9A 2GMHA 1I1GA 2XHCA 5D3GA 3R2DJ 2MQ8A 2BOAA 1DLOA 3G96A 1OSCA 3M32B 2ZH4A 3MMJA 4PXBA 2I38A 1FKOA 3DOLB 2XI3A 2BRLA 4P2FA 4K4SA 3N01A 2J7WA 4IG3B 3MM7B 1LWEB 4OV6A 2M52A 1MNEA 4KB7A 1YRUA 1PO6A 3HP6A 1FWPA 2ADCA 1WNEA 2BJ8A 3T5KA 1UCNA 1WSVA 4QIEA 4PWDB 1JQGA 3MOJB 1VQOS 1FX2A 1QE1A 3D3CJ 2DNOA 2A18A 1FJGJ 1VLYA 2D3O1 6AT1B 3NGSA 1K44A 3UNYA 4C3MA 3WDOA 2FGCA 1YK9A 1A0OB 2ZEJA 5BYQA 2VG6A 2ZH9A 1DTQA 2LA4A 4M5JA 1SV5B 1PYTA 2GVZB 3HHKA 5E3RA 4RJVA 1RZMA 2BE7D 3T5JA 2OSRA 3M8QA 1QUPA 4FKXA 1RAFB 1F3VA 1BQMA 2AV5A 1Y3KA 1H72C 2OO4A 3H0PA 3HD1A 2MPUA 2EBEA 5IWAF 4JOUA 1UP1A 3AQOA 1NHKL 1WHVA 3TRGA 3OV7A 3BSAA 4M5LA 2BM1A 3AODA 1TVRA 4NYOA 4ED0A 1NK6A 3DRRB 3TUJC 5KT4A 4JYAJ 1L3KA 2UVUA 4O4GB 1M90T 2PMZD 4PQUB 2CG4A 2ZH3A 1R27B 4DUYJ 1Y9OA 3NBPA 3OW2R 4BWJA 2EC0A 1CQMA 3HSJA 2YKNB 2J0XA 4KIAA 3AJ2A 4WJBA 2FHJA 4WTOB 3CCSS 4FP9A 2LQJA 2V4RA 3CSKA 1SB6A 4QW8A 1SKRA 4ED4A 3CVKA 3HFVA 2PN6A 3QT8A 1GMWD 1T9YA 2UXDJ 5IXUA 3P49B 1QSLA 3HI9A 4TU7A 3CDBA 1X9WA 2GGPA 3SSRA 3J7YI 3VZHA 3X1LB 2R7SA 4OYIA 1S4EA 5KFAA 2G2OA 3PDNA 1NJYA 4PQAA 2ALYB 1FF2A 1O0PA 3HMJG 1ZH5A 2YPZA 4P2XA 4K5SA 3DNCA 3HHDA 2BBEA 1T0TV 1WHWA 3RBXA 3GIMA 5HANA 1WKKA 2VOPA 3KJFB 5L9XA 2EG1A 3R9LA 4KT0C 2W2PP 1P1LA 2PEHA 3PW5A 2KFZA 3PRDA 2ZOGA 2DYAA 1FK9A 1RT3A 4J90A 1NHVA 4ICLA 1WEYA 4ZP6A 5J1PA 3L4BC 1GT8A 4IDKB 3LGMA 4K7QA 3HHLC 3I5AA 2MJUA 5HMZA 1LWFA 2BKNA 2GVDB 2BE9B 4UZCA 4B02A 1LK7A 1KRPA 4Y2AA 1ZOTA 4RBUA 4DQIA 1RHUB 4NLDA 3A3NB 1WELA 3DOKA 1RT2A 1UZDA 1C1BA 4OHWA 3AA8A 1HQ2A 4I69A 3WBZA 4KSEB 3M4XA 1T8EA 1LW0B 5AJ3F 2QEXS 2KVIA 3QAUA 4ALZA 2DNLA 4I6YA 3T9NA 1DAXA 4F0HA 1DTTA 5GADU 1KFDA 1FRJA 2A1BA 2V8VA 3KJVB 2ZD1A 1VQ4S 2B8PA 5KFQA 2IMOA 1B7YB 3FZ2A 4RR5A 3KLHA 3QIPB 4F7VA 3H2LA 1AT1B 3TX0A 4DEZA 1KTQA 1WF1A 4NZ6A 1CS4B 4V19X 1U24A 2JOQA 1IBCB 2IYIA 4BCAA 2ZE2A 5GMDA 1F9FA 2HZCA 1B64A 5M2UA 1CSJA 5K20B 2VKZG 1RT7B 3OD2A 4LMZA 4OLOA 4DQPA 2OGUA 2MZSA 2J6SA 4MT1A 1FNMA 3GYXB 3H4BA 2HVIA 2ZZTA 2QIFA 4PPZA 2Y0SD 2GA7A 1Z2ZA 4QWEA 3QIDA 2EPIA 2OTJS 4FXDA 3CCWA 2YKPA 2KXNB 4B08A 2Q6BA 2DO4A 3ETOA 4KPYA 3TAPA 3IBWA 3R7NB 3W8GA 3NMRA 1RHQB 4LUBA 3AOBA 1NKCA 4FNIA 1BXNA 8ATCB 2AJFE 5J2PA 1SJ4P 1RU1A 2V68A 2YX1A 1JKHA 3UVJA 3WX8A 4FF2A 1FCAA 4QR2A 3THTA 5CABA 1ZETA 2BUNA 2EK6A 3HULA 5KFEA 2G0CA 4ZOSA 2XWXA 5JJBA 2YNFB 1H2UX 2K7JA 3DGPA 4PPDA 2DITA 3HSGA 4XIUA 2CQ4A 3OL6A 3DXBA 1GTHA 3LP2B 2XLKA 5J2NA 1CEZA 5DM6Q 3D1HA 2APOA 4H4KA 1P27B 1V9OA 2MEWA 3DLEB 3MZIA 4MFBB 2XCPA 2CQHA 4ECZA 2GIRA 4OZ0A 3O8WA 4RUHA 5AXLA 2LXFA 5FDLB 3IMQJ 2NXUA 1CVJA 1WC4A 2L48A 1X5OA 5HQLA 3KG0A 1GTEA 4DR4F 2D41A 4DPXA 3V6KA 3G8TA 2YX7A 3M30A 1X4EA 2MQPA 3KOAA 3N0VA 1E6YB 1D1UA 3TVZA 5HK4A 3J81Y 1EZZB 3M2RA 3M8YA 4AE5A 2W9CB 3D7SB 3C2PA 3F0NA 1TUWA 4LQ9A 4MKBA 2DVIA 4DI6A 4NI2B 5E0OA 2N7YA 4A8YA 2DH7A 1YGYA 4UOFA 4U7UD 4ED2A 1IBKF 3KK2A 1F2GA 2H5JB 2DNKA 2U1AA 4OI3A 4CT9A 4B3TJ 3SBMA 4UY85 1FXDA 3GIJA 2CPDA 3W2WA 2BMBA 5D4LA 3M2UA 5KG1A 5D4NA 4QBUA 5A2QU 4DS4A 3U27A 3PR4A 2W4CA 1N36J 4NL5A 4PUOB 3OTEA 3HZEA 2RVJA 2MY7A 3CJ5A 3NP5A 4H4MB 4DFPA 3PCOB 4W98A 1YZ6A 4ZP8A 1UWBA 2QL5B 4IR1A 3IG1B 4LRCA 2B4PA 4NASA 1FFWB 2BZ2A 2IJFA 5M2RA 3NAHA 2P9GA 1EKRA 2V4QA 4IKAA 2CJXB 1OY6A 1RXOB 1L3VA 5KFHA 2B7BB 3SV4A 2GQCA 4B3SJ 4GRSA 1FRIA 1OSDA 2BW2A 1VQSA 2W24A 4C2MA 3RB6A 3TUPA 2BW7A 2MTLA 3CJTA 5ETPA 4BC7A 2EFOA 1XN9A 1LNQA 5GAHI 2DXDA 2VICA 1F1BB 2IRUA 4WXWA 3L7OA 2JEJA 2FVRA 2O1PA 1SL1A 3R5AA 2V8HA 4URSA 3T41A 5DG9A 1EKSA 3QT7A 4QPXA 3DU5A 4OLPA 1C2PA 2IJRA 4XK8C 2L9NA 4OHVA 2YWHA 3IN5A 4RUAA 2FY1A 5E3PA 3WX4A 2EKNA 4LREA 4TLRA 2UUTA 2HNZB 1IKVA 2GQ2A 4ZPCA 1CJUA 3IBCB 5F3ZA 5DG7A 1FO1A 1HFEL 5E3CA 1S0OA 1HBMB 3GP9A 3KNAA 1D8ZA 3MM5A 1R31A 1S0NA 3OL8A 1OQ6A 4N5SA 4KKOB 4IRDA 4ZCLA 3GMGA 1S7IA 3LOUA 4WPAA 3MPUB 2CVIA 3O1LA 2HSEB 1MWQA 1CPZA 1QY7A 2W9BB 5IM0B 3CCVS 4CLLA 1TKTB 1QM9A 4Y6IA 3ZZZA 2ROGA 1IXKA 4HLBA 4CM0A 3LA0A 4WK3A 4NZ7A 2FHOB 2QLWA 2UUBJ 4DFJA 2RMLA 4Q44A 4AT1B 3DRYA 3M8PB 3T1AA 1U6ZA 5EX3A 3THVA 3CGIA 1H98A 3MD3A 2Z0GA 5IC6B 2MQMA 2FVPA 3TAQA 4TQSA 1HNWJ 1FVQA 4I7FA 5LOQA 4M5GA 3I82A 3UWTA 4RW9A 1JLQB 4GO5X 4F50A 3ZTSA 5A76A 3B6BA 3MURP 1ZAVA 3U1LA 3FEYB 2AYGA 2RUGA 4HR2A 3TQ1A 3KLFB 2E1RA 1J5OA 3BH6B 2IVYA 4B3MJ 3HKZD 4DV0J 4WFYA 4BC9A 1LWCB 2AIRB 3G82A 1HBUB 3G8SA 1U7LA 4KH0B 3RJMB 4DPTA 1YBTA 1S6QA 2CUYA 4DV4J 1CULB 1I5OB 1A9NB 1RYSA 1KEKA 3IO1A 4QIFA 1JLEA 3LP0A 3OSNA 1UW4A 4ZIWA 3GG1A 1TK5A 4DV1J 1VHIA 4ECYA 4DR7J 3PV8A 3BBFA 4P7VA 3QJJA 3CJQA 1RSCA 3POTA 2ROPA 1FRHA 1NCLA 1NK8A 1N5YA 3KK1A 1DZ5A 3KUHA 1U1PA 3MM8A 4F36A 2WAQD 4JI5J 4MKVA 2KG0A 8RUCA 2CWXA 3DLKA 4X4RA 3K5MA 5KG7A 2CQ1A 4RW4B 3OFHA 1Y7PA 5KFUA 3BBCA 2WONB 2H5IB 1UAWA 4J37A 4KO0B 2V69A 1U0HA 3MTKA 1VQ7S 2QLXA 2B9EA 3OHAA 3G6VA 3DLBA 3NCQA 3W66A 2B56A 3CMQA 2IDLA 1S1TB 3BF4A 2IRYA 1KKHA 4QWCA 5KFGA 1M5KC 2HQIA 2YWEA 1TL7B 4QU6A 2V63A 3OR1A 3T5LA 3OR2B 2FJWA 3W9IA 1REVB 3EXYA 5F8HA 2IC3B 5H1SV 3A1YG 1HPZA 3A13A 3R6GB 5J2QB 2AHOB 4FYXB 1FJCA 4QYZK 5BR8F 4DLEA 4M5NA 1Y5NB 5KOWA 2ZHBA 1J2VA 4CLUA 2XSFA 2E29A 2MSTA 4DX6A 4F8RA 2QC3A 4I2PB 4JYAF 1RTDB 3FK4A 3C6UB 4MK8A 5DLFA 1IKWA 3DCAA 1QTMA 2BE2A 4DUYF 1MSWD 1K73T 2R2UA 3HO1A 2EW9A 2F40A 4C8YA 3PJ9A 5K14B 3R1HA 4YR3A 3RRKA 2BEFA 2GAGC 2IVFB 2MB0B 5B7WA 3NNCA 4HI1A 3CJKB 1WI8A 3EMTA 1DURA 3N79A 2R8HA 4N7TA 3KTQA 4OYWA 3NKYA 1LW2A 4M5KA 2HHPA 4M94A 2WW8A 3MEGA 1SC1B 1F6TA 2D3UA 2MQLA 1XR7A 3HHLA 1NPKA 1NU4A 4C9DA 1HL6A 3CO9A 3ENAA 1PILA 2CQDA 1RISA 3NNHA 1DLOB 3F41A 5B0DA 1VS3A 4Y2IA 3PIOQ 4J91A 1PC5A 4K8RA 2HG4A 3R5GA 4B9MA 4EUVA 3E2EA 1UPPA 2D74B 3CULA 4RNMA 2B5JA 4TVAB 4ZK7M 2MGZB 1FX4A 3D54A 1EARA 2MY8A 4OIXA 2YWFA 5HLFA 2VQEJ 5L39A 4USUA 3A8JA 1QTNB 1N5VA 3S8SA 1P1TA 4HT5A 1V3SA 2CQIA 3RR8A 1IQTA 3KLIB 2V8GA 2W2MP 2G1DA 2E66A 5DDPC 4EEYA 4K0KF 5AT1B 4DV6J 1M5HA 2GV1A 3EDQB 1ZYQA 4IFYA 3K5PA 2AYBA 2ZFHA 3JTNA 5KFCA 3W62A 4DR5J 4LF5J 2R8JA 2DPJA 5G0RB 3M9NB 3ENVA 5JXSA 4C97A 1BQXA 3M8QB 1K0VA 4UUWA 3UQSA 1RAEB 3MAAB 3K5NA 4DV2J 3BV8A 1RK8A 4KQZA 3I55S 4UTGA 4JBCA 2DHAA 4MIBA 4I64A 4FNHA 3RGIA 3QT6A 1FRLA 1M5OC 2M7SA 2MZQA 3VGSA 1PAUB 5I3UB 2PA8D 3CC4S 4C7QA 2I2YA 2Q6CA 1UFLA 3M6WA 2NXCA 1RWUA 2HS0A 4R8UB 1XEZA 1XMBA 5AXKA 1U8SA 2RKIB 2QV6A 4ES3A 4KV8B 2IBKA 4WWSA 4L73A 4AL5A 3T19A 1XQIA 2QE5A 2ZM6F 2KHCA 2DB1A 2QA4G 4DSIA 4NLQA 2DH9A 4A48A 4X64J 3B82A 2B6AB 3BN7A 2J7KA 1JWWA 1KLMB 1FKAF 3CC7S 4EU0A 2XI2A 3UDVA 1JXVA 3JSMA 2YKMA 1GFWB 2VPYB 3CD0A 5EWFA 4DL6A 4ZP9A 3PRVA 3S1TA 3JSRA 3H8YA 2DBBA 4RNOA 2VC0A 1H2TZ 3V6DA 4K50A 2GZOA 4TY8A 2YWWA 3P5TL 4IOAQ 3OJUA 2C3MA 3TNVA 2HHVA 3AXKA 2LMIA 1VQ9S 4YB7A 2OPSA 2DGSA 4WP9A 1Y11A 4K4WA 4JV5J 2EK1A 4B9SA 3M2VA 5IT4A 4ZS6A 3CJ2A 2KT2A 2CIMA 2DHGA 4LBHA 1HARA 4ZCMA 3R7BB 2AGQA 2F8MA 3VTIA 4J9QA 2CXEA 4IH5A 4XPEA 4CM2A 5B0BA 1T9UA 4B17A 2X3DA 3HF5A 2HHXA 4AD6A 4DWIA 1MWZA 3TZZA 5F41A 1HR0J 1N56A 2DRDA 3LW5C 4DR3J 3PVXA 1X31C 2WW4A 2RH3A 2W01A 4JI0J 2VH7A 2LVWA 3DDIA 1LFPA 4N56A 2NLWA 1XMQJ 3K2YA 2PI4A 3D68A 4J9VA 1D9FA 2GMJA 2J7UA 2AGOA 5KFVA 3CMAS 1QSYA 4DPYA 1XNQF 3KKFA 1FXRA 3ILIA 5IOLA 3T3FA 3LH2S 3H25A 4EMDA 3HXMA 3GJRB 4OJHA 2QTWA 2RQCA 1QAJA 1YVFA 2R42A 3I0SB 2DY1A 4DZ6A 2DJWA 1LOUA 5D15A 3SCIE 1CJTB 3GR1A 1VGYA 4U8VA 4X4NA 1U26A 4AL7A 1H0HB 3EGZA 2GC8A 1K0TA 5L1LA 4QIVA 3ZZOA 3AA9A 4OYAA 2IIHA 2EFPA 5D8HB 5L1JA 4E8UA 3AHPA 1EETB 4L74A 2W8KA 3EVWA 2JC1A 2DNZA 2QA4S 1IVZA 5HATA 4UOHA 4K2JA 3EZ5A 2OLWA 1N36F 3QNWB 1T9XA 2E7WA 2EBGA 3ZNUA 3ZO7A 3C15A 1SPBP 1W7WA 2DR9A 2XULA 1LXNA 1U2RA 3QAEA 4NLVA 1TELA 4DFKA 1GX5A 1NJZA 4OI1A 2IM1A 3HZGA 4ED3A 3HJFA 3AJ1A 1GAOA 2YWKA 2RD5C 1JJHA 2HGLA 3MCMA 4NCGA 5KFPA 5IFMA 2CA9A 4B3SF 2BJ3A 1Q4RA 4TLQA 2WRMA 4I4BA 3T1HJ 2N7CA 2GHWA 1WC5A 5HN0A 2XMAA 4F4YA 4DN9A 1HIYA 1S7HA 3MI7X 3FBFA 4NA3A 4OX9J 3MEEB 3MR2A 2BOPA 4DDFA 2OD4A 3M32A 1KTVA 3V81A 3GB0A 2A10A 1FRKA 2XMTA 5MLCV 4AXJA 4ZITA 5CZXA 3DOLA 5DZ6A 2KM8C 2VF3A 4KGVB 3TEGA 3H90A 2VZ9A 1W2IA 2BYCA 4P52A 3RAQA 4IG3A 3MM7A 1LWEA 3CJSA 4YUDA 4MK7A 5B0AA 3UDEA 3A12A 4J9PA 2QX0A 5A0YB 1L3SA 1M5VC 4M5HA 4QIGA 1ZTWA 4CLKA 1HNZJ 3BPSP 4LRAA 3BSCA 4PWDA 5L8RC 3BS9A 3UW1A 3EGWB 4F4AA 4L76A 2LKZA 2PGCA 2W9AA 3ICLA 2Z2YB 2XNQA 4OZ1A 1S0VA 2ASJA 2VV5A 5E3QA 1SV5A 1RB0A 2GVZA 5HMXA 2HWHA 2B4VA 3K89A 2KT3A 4G65A 1YJRA 1C0TB 4NXNJ 2I9SA 1ZAXA 4KGKA 2D9OA 3BO3A 1UMJA 3A3PB 1HI0P 3NEKA 1IN0A 3KK2B 3Q86A 2BV3A 4CT8A 2AQ4A 5LMUJ 2LEAA 1RBAA 3P4UB 2Z4PA 3OUYB 3MECB 3LGNA 2BACA 2X51A 4J9UE 2QLJB 3DRRA 2VBXA 3PYGA 2W2NP 2C42A 4O4GA 1HNWF 1IJFB 4PQUA 1VBYA 4X65J 2UV8A 1WOPA 3KHGA 3Q24A 2ZH8A 3BKTA 1VI7A 2Y1JA 2FYXA 4EI2A 4DV0F 2P6SA 2YKNA 1KVKA 5KG5A 3TO8A 4WP8A 3TR5A 5KFSA 3MUMP 1F3FA 3CW2C 3M9MB 2XQCA 1NEEA 3CCTA 2IM2A 2KXHA 1TKXA 3WIVA 2PO4A 3ITHB 2NSBA 3DFEA 5D0HA 5AXNA 3QT5A 1AFIA 1X5PA 4DUZJ 2IRXA 2HYIB 2JDJA 2WVBA 4AUKA 3R97A 3IR5B 3CWJA 1ZA1B 2JJ4D 1VIOA 3C16B 3GFYA 4WE1B 1F5BA 1X9MA 1DY3A 2DNPA 3KUEA 1UJ6A 2Z57B 3F73A 2LU1A 2LQBA 2IPOB 1S6OA 5C25B 4Q2MA 4RBTA 3QO9B 3CDUA 3J7YU 2PFFB 3Q8UA 3RW6A 3BDPA 2QSWA 2VFSA 1BQNB 1PYSB 1RHKB 2JL9A 4ECQA 1JLFB 5E7OB 3D3BJ 2K8GA 2HBYB 1WF2A 3MMAB 4C8KA 1IKVB 2FUG9 4DR6J 1B99A 4AFFA 1S9FA 1CJUB 1H74A 3DKDA 3C8YA 4IDKA 1O6XA 3LAMA 4JI2F 1SH2A 3GWCA 2PMWA 4DJBA 3V5RA 5HVHA 2GVDA 1Q53A 3Q2SC 1GMWA 3EGNA 3VAJA 3Q8PB 4JI8J 1S76D 4HDGA 4CQ1A 1S72S 2YNIB 2UUCJ 2UV8G 3TWZA 5KG2A 3AD8C 5D78A 3CCUS 3J81j 4LR7A 3FQKA 1LV5A 4KFBB 4Q43A 3BDEA 1TFYA 5D0EA 5CCLA 1RACB 4LSLB 2OPPB 1LW0A 3BSNA 4WFXA 2OPQB 2WSEC 3WHIA 2HHHJ 2RHQB 3IGNA 3OVSA 3W1YC 1UA0A 3KJVA 1WD6A 4NX9A 1VQKS 4P2MA 1HNIB 1PSDA 5L1IA 5D0RA 3I32A 1VBXA 3AXMA 2NPIA 4GVLA 2VBWA 2N4CA 3HHNB 2XLIA 3QIPA 3VAFA 4JI3J 4F4XA 1FXLA 2G0JA 4EFAC 1CS4A 2HNDB 2W25A 1FDDA 3M8RA 2F7VA 4PXCA 2J6UA 3FSIA 1NDCA 2KJWA 4P71A 4ETZA 1C4CA 4YMEA 3PYEA 1FRMA 1RT7A 5EGYA 5SZTA 4FBUA 2A3JA 5CH7B 1TL3B 1F9EB 2E7VA 3R5CA 4RW6B 3TANA 5H9EJ 1VDHA 2VFVA 2DRBA 7FDRA 2IDEA 2NUHA 4FXVA 1FDNA 1YWXA 4JI4F 3SQOP 1Z2LA 3HVAA 2HNYA 4CLSA 3D1OA 2D9PA 2DPIA 1RUSA 4ILMA 2BANB 3MXHP 1LKZA 2AEJA 1ZZNA 2VQEF 2NYHA 3MUTP 1GQEA 3CE8A 1L3TA 5KAKA 2R7TA 3QRPA 1BD6A 5C2CA 4NMLA 3ET6B 1B3TA 2NREA 2AU0A 4DV6F 1WOSA 4YEAA 1OS5A 4DU7A 3TZWA 1SJ1A 2YNFA 4WIIA 4DR5F 4LF5F 1WWHA 3N28A 4ZVOB 4A47A 2VG5A 3DYAB 3MWBA 2C2ZB 4DPUA 3ENWA 1XJWB 3LP2A 3PEJA 4LVOP 3RW7A 2VD3A 3ONQA 4Q8FA 1S1WB 4W4MA 4LF2A 5F8MA 2QT7A 3DLEA 2BQ3A 4DV2F 2EFNA 4DV3F 1F5CA 4HACB 4O0NA 4BBYA 3GU0A 2RRAA 3UR3C 1U8WA 4K4ZA 5FDLA 1APSA 3GE9A 4Y2MA 4O4RA 1WKLA 2Y1RI 1GMVA 1E6YA 2HRYA 1V5IB 2J9DE 3KLGB 3D0HE 2KYXA 1YJUA 2W9CA 4CNYA 2P5VA 4U7CA 3UN2A 4C3LA 2VA2A 4GKKF 2AWZA 4Y0FA 1K8AT 1OJ4A 5C7PA 1SQGA 4QWBA 4LF1A 4R5PB 3EM1A 1KVJA 4L72B 2VASA 1KONA 3IP0A 2HHSA 3QJLA 3MTJA 1WDTA 2E5HA 1W2BR 2YVSA 2JX2A 1RTHB 2FPHX 2MMYA 4FF3A 4OHZA 2GJ2A 5E33A 5F9LA 3IGVA 3BJYA 2GQQA 3SCKE 4DN0A 2R2RA 3HM9A 2AP6A 1N34J 4PUOA 5K9FA 3S7RA 5IQ6A 1IWAA 4MYUA 3UCUP 4IYQA 4H4MA 4RBVA 2G1HA 5D4PA 1TV6A 2QJ3A 3IG1A 4C0BA 2CJQA 1NLKL 4QYRA 2O5DA 5EHHA 2BX6A 5HMWA 1RP5A 4ZVEA 4UW2A 4Z2XA 2LCWA 2VA3A 3QBCA 4DSFA 2ZBCA 5KFJA 2Q79A 3B54A 3J7Z5 1YBAA 4ECWA 1AUDA 2XLJA 2MQNA 2V8PA 1X5SA 3ULHA 2AJ4A 3PHTA 2RNEA 1FKPB 4DS5A 2LQ5A 1HR0F 2GO8A 4UQTA 2B4OA 4P2SA 3BQ2A 3FQLA 5HL7Q 4DR3F 3MR6A 2LECA 2ZBQA 3KK3A 1VC0A 4MAKA 4QR0A 1KQSR 3BREA 2U2FA 3EYZA 1HNVB 3OTOJ 1XMQF 5LXYA 1VISA 2RQMA 3GYGA 4RU9A 2C2KB 2OPRB 2G2YA 2NPFA 5T14A 4YY3J 4FKYA 1XR5A 2HNZA 3PKYA 2PMHA 4OYMA 3ILOA 4USHA 3DM2B 4NPOA 3J7A1 2VODA 2YXLA 2M70A 4FVCA 4PG8A 1HBMA 5JVGQ 1S79A 5DRKA 3NL0A 3HKWA 5KFIA 4FF1A 4KKOA 1A7GE 3I0RB 3N9UC 1QDUB 2CYYA 4P74A 3MHYA 2ASDA 2W9BA 5IM0A 4X4OA 6FDRA 1TKTA 1FA0A 4OX8A 4LRBA 1KHVA 3FGVA 4OYZA 1N5SA 2B43A 1IBMJ 3RB0A 1NK4A 3V6JA 3TX8A 4D3HA 3PX6A 3RBZA 3MPDA 5ETQA 3W3SA 4H4KC 3M8PA 5ETRA 5L1KA 3QGIA 4KPCA 4LT6A 1TP7A 2YKMB 4C8NA 4ZKAA 1R8HA 4LR8A 2J9CA 2CPXA 3NLCA 2MYFA 5DDOC 3TP2A 4M5DB 4IH7A 4RNNA 1JLQA 3Q22A 2ZWOA 1CBKA 1SH3A 2KDOA 4LRFA 1HQEB 4OZ5A 3C14A 1T95A 3MPVA 4TY8B 3KLFA 4A4JA 4NLPA 2Q3PA 2E9TA 3J80U 2WTFA 1LWCA 1RWVB 3NCPA 1RCOB 1HBUA 1YX2A 3T1HF 2JRSA 1TMMA 2HFVA 1CULA 1IKXB 1MMNA 1WUUA 4DOZA 3CMES 3W5ZA 3N4WA 1T11A 5A2QY 4CCHA 2V4JB 3D9BA 1S4FA 1FHTA 4B3OB 2E1PA 3NGDA 2HHTA 1FFGB 4ID5A 3OLAA 5T7LB 2W4DA 3BQ1A 2LEPA 2AEMA 2Q66A 1WG4A 4PEOA 4F2SA 3DN9A 2X1GA 5LL6d 3GILA 3QPIA 1HNZF 3ZZ0A 1FWKA 4UOGA 2MSSA 2ZZNA 4HHJA 3CJ4A 5IC4B 4BLGA 2BM0A 3GCXP 1OY8A 2FLPA 1NMEB 1R6YA 4RW4A 1GXLA 2WONA 3RUBL 1H38A 1NPPA 5B0EA 2LEBA 4KO0A 2YQ0A 2HWTA 3JSYA 2VOOA 3RU0A 4E2FB 1FWLA 1SVDA 1S1TA 3G4SS 2JEGA 4NXMJ 1YRTA 2KO1A 3FBEA 4Q7AA 1TL7A 2BJDA 3A8IA 1JNZB 3EE3A 5A8WB 5AE2A 2MQQA 3R1LA 2F9JA 4NMXA 1HW8A 4A8KA 4NXNF 4C3KA 1EAYC 3OR2A 1REVA 1VQ6S 2IC3A 1CLFA 4CNZA 3LTOA 5J2QA 1JXLA 3BN4A 4M8LA 2G4BA 4ERDA 1BC6A 4OI0A 3RB3A 1TZ0A 1UVJA 5LMUF 1U48A 3CCMS 2CPHA 4C6AA 1F9HA 2DCLA 4YN3B 3UR0A 2HGNA 2L3MA 4NEYA 5I3PA 4MK9A 4I2PA 1RTDA 3C6UA 3UDLA 4X65F 2ZITA 2J8AA 4HTJA 4USKA 1FJEB 4RU2A 3G9CA 3QRQA 5K14A 3ISZA 1X9SA 3ZZYA 4UQGA 3KMQA 3CJKA 4DU8A 4R0EA 3AB2B 3GSIA 5ADZA 3U1MA 4GKJF 2AF6A 4Q2LA 3IWLA 2F5GA 2X7IA 4R0JA 4DUZF 1J27A 3SQGB 4OJ1A 2WVCA 4K59A 2MHNA 3UO0A 1FEHA 4DR1F 3N6NA 2J6TA 4NLGA 5CYMB 4ZLPA 1IM6A 1U1RA 4Y2KA 3R6LB 3H5XA 4IO9Q 4ANCA 2FVCA 1SC3B 2AX0A 2DR6A 4C8MA 2XM3A 1ICEB 3V81B 2FVSA 4TYBA 2DGUA 4FYYB 1XNRF 3A3OB 4JI6J 3R8YA 2WSCC 2ILZA 2FLNA 3VWSA 2QYCA 4XPCA 2MGZA 4X2BA 2HKEA 4DL5A 1T05B 4KGZB 3OTDA 2MLZA 3MMCB 4QW9A 5IS2A 2UU9J 3CDAA 1S9EB 4DL2A 4DX7A 1R0CB 1U1LA 2UUAF 4Q8EA 3KLIA 5KG6A 3UN5A 4DR6F 3FZBA 5HSPA 2PI5A 1IR0A 1UEKA 3N5FA 1WC3A 3TAMB 4X62F 2DGTA 4CLFA 2KG1A 2MZJA 3O6QA 2UXCJ 2JFDA 2DK2A 2XMVA 1B0VA 2MXYA 1SKUB 3Q8QB 1VQ5S 4ZMMA 3TUZC 3BBBA 2XY7A 4ZPVR 2DIVA 3JTPA 1VIXA 5AXMA 1WC1A 5G0RA 3I56S 1QVGR 4JV0A 2RU3A 1G6BA 1WHXA 2E44A 2UUCF 1NJXA 1MW7A 4W90B 4DBQA 1NAQA 4IQMA 2COLA 3MAAA 4KRWA 5DDRC 4DL7A 3Q23A 1N32J 1U1NA 4IH6A 2RB7A 3DDNA 2H48B 2B3TB 4P75A 1KR4A 3ILJA 2VFRA 5JVHQ 3MCOA 1NDKA 3KMSA 2CQ0A 4L3NA 5KT7A 1WEXA 1Q5VA 5I3UA 2VPZB 2MQOA 4DG1B 4C11B 2CAJA 3H98A 1HA1A 1PG5B 2YNHB 4R8UA 4WYLA 1ZZFA 1L5UA 1HKAA 1EP4B 2RKIA 4MH8A 2AZ3A 4KV8A 4JI3F 4PYAA 4ZLJA 4CO4A 4I56A 3IR7B 2ZH5A 3THPA 1VR6A 1HMVB 4FN5A 2OELA 1HQUB 2AD9A 4UZBA 2HVZA 4A8XA 1XBWA 2WB4A 1R89A 2B6AA 1Q8BA 2CQPA 1KLMA 2HBRB 1QVFR 4ZJLA 1SQFA 5CQGA 3GONA 1TKXB 3IXQA 2EFVA 2MKKA 1JLBB 1JXEA 5EWGA 1SI9A 1KP6A 1SC6A 4LF9F 4H54A 3K57A 2Z2LA 2CQ2A 4ZPAA 2R9LA 4LBIA 2KH9A 4EBCA 4IOBA 2X1AA 4ECUA 3L3CA 4TNOA 1RTJB 2HFNA 6FD1A 2Z30B 3OT9A 3LQVA 1DFDA 4CLPA 3AY0A 4B9VA 1S9GB 2RAQA 1FNXH 2Y0BB 3QWPA 3HVRA 4ANDA 2GIQA 2Q43A 3GJSB 5CYQB 2VPXB 3JB9k 2PD1A 1M1HA 3JAMY 1RWNB 3FFIB 2GCFA 5K8NA 5LMNJ 3E8OA 1Q7LB 1JLGB 2ZHOA 4Y2CA 1WTBA 2QN6B 3UDCA 3M8SA 2V2VA 4NLTA 1G1XA 2HGMA 1CC8A 2AMCB 5J1EB 2QZ8A 4NLWA 3IAS9 1RBLA 1TUGB 1FESA 2I6WA 5IWAJ 2HMIB 2H5EA 2JH3A 2DNQA 2VPWB 3HX9A 3QLHB 4EO8A 4IOCQ 2QG9B 4NOHA 3PR5B 3DRPB 3P45B 3FMBA 2F3JA 1HWUA 4BS2A 4OZ2A 3Q8VA 4CDIA 3GFZA 4F04B 4EGLA 2PIIA 2CDQA 1OO0B 3L7UA 2B9WA 4NWBA 3ETMA 2JHEA 1VQMS 3UPFA 4X66J 4MIAA 1FDAA 3L09A 4ZIVA 3I0SA 4ZCKA 3PW7A 4ZVHA 3LALA 3IBFB 1CJTA 4I6WA 1HLWA 5C42A 1WG5A 4USVA 3H7HB 2IA0A 2IA6A 3U02A 1M1KT 3K5LA 2WOMB 2CPZA 1YKWA 2JVOA 4DQQA 2HAIA 4IO1A 2KHDA 1FI4A 1RAHB 1NZ8A 2XC9A 2F1FA 5HMYA 5GMEA 3ZXWA 1EETA 2LQ9A 1UFKA 2X1FA 1R8AA 2XMMA 4ZLNA 4DV5F 2KVQE 2LXIA 4ES2A 3M1VA 2F4VJ 1NJIT 4ZHRB 1HWIA 3G6XA 1PJ7A 3CCES 1N34F 4Q45A 1KFSA 3PYFA 3I4PA 3PFOA 1VQNS 3D0IE 5AE1A 2ZH6A 1NB7A 3DRSB 1AFJA 1HWLA 5B0FA 3CCLS 3NCRA 3KJQB 2KKHA 3D6TB 3TA2A 4ANEA 4NLXA 4KHPJ 2HNYB 3VCDA 1CJKB 1X7VA 2RS8A 2V0NA 2QFJA 2GFFA 4E98A 1XERA 1U02A 1T9TA 3BGLA 2JLGA 2DNMA 2F4FA 1QJHA 4LF4F 1T9WA 3PXGa 2WVEA 4FYWB 2E5JA 4GVBB 3CJ3A 1VHFA 3MEEA 2DR7A 2RIJA 1N4LA 2B51A 4J9OA 3BPDA 4ZPBA 2MKCA 1WOOA 1FDBA 3GIKA 2O66A 3D6MB 2HLUA 3MM6B 2XBPA 2ZH1A 2DISA 2N3OA 5C2GA 3EX7B 2VG5B 1BE4A 5A0YA 2OMLA 5KFLA 1RAJA 3SI8A 4YY3F 2ZOFA 4N77A 3PKMA 3PW4A 4OI2A 4CLYA 1MROB 3PZPA 1LEOA 3BB5A 5KFOA 3GLJA 1IJEB 3HVWA 4IUFA 3TARA 3K17A 2FJVA 4LIRA 1N5TA 4OZ3A 3HVTB 5DQGA 1VC5A 4DSJA 3K5OA 1C0UB 1GXTA 1SL0A 3GV7B 1C0TA 3SMZA 1S1VB 3I4HX 4DXLA 3PACA 2IBOA 1IBMF 5A6PA 4DSKA 2FZGB 2ZDOA 1AB8A 2OH2A 5CXTA 4L3KA 2IM3A 3P3DA 4FPRA 1DQAA 3B8HA 4XTTA 2CPFA 2F8EX 3OUYA 3MECA 4QWDA 2R7WA 3V6HA 5KFYA 2MJNA 4DFMA 4J9RA 1X4HA 3EZOA 2Y8YA 1HWKA 1KN6A 5F0UA 4WFAQ 5LJ5Y 4TU8A 3W9JA 2IMWP 4DL3A 3B4DA 3IWXA 5GVQA 3NNAA 1TV6B 3AFGA 4WF9Q 3US5A 4OQJA 1X4AA 1OQ3A 3OFFA 5FLXU 2CJKA 2QMWA 5U47A 2HRTA 4F4WA 3TVYA 3C19A 4CO1A 1I3OB 2H4YB 2ZDPA 1N0VC 1C1CB 3H4DA 2VDHA 3W64A 3ITHA 2I5JB 1XK8A 2EKYA 5T41A 2OFHX 2OEKA 5H9FJ 4ECRA 1TL4A 5HVGA 2HZVA 1S12A 3TUIC 4U96A 3C16A 1ACMB 3H59A 4WE1A 2O67A 2DTJA 1EQMA 2K3IA 3EJMA 3GJTB 1BLUA 3MMBB 1S59A 3SIPB 4OFZA 2PC6A 1NSQA 5M2PA 5C25A 2ZKUA 4ZVFA 5I42A 3QO9A 3KK3B 2C2DA 4DR4J 4YOEA 4KR0B 1BQNA 2XY5A 5KFMA 4HEA9 5DM7Q 1JLFA 3QRRA 2H51B 2HEKA 3BKUA 3JS9A 2MKSA 3FNNA 4NXMF 1TMJA 3MMAA 1MU2B 5LSLA 3UD4P 2K3KA 1OY9A 4RLEA 4JI7J 5DS7A 4NZ0A 3T5HA 4A8SA 3DOMB 2AT1B 4JI1J 5J2MB 1OPZA 2E1CA 3HLUA 4G1QB 3KUGA 2R7XA 3V4IA 1IBLJ 3DC2A 2D1CA 2YNIA 2V8DA 1EIYB 2VFUA 3O5TB 2RDDA 4NE9C 3AOAA 3KDNA 3LGHA 2OTLS 2L08A 3G8QA 5CAAA 3AD9C 4KFBA 4DPOA 2M88A 3DLGB 1I94F 3ZZRA 3CF5Q 4LSLA 2OPPA 5GAEI 1FD8A 2XY6A 3KJNB 3NS6A 2B0GA 1RAGB 2OPQA 2ZBIA 1MN7A 3WZ0A 2V2QA 1NDLA 3Q2TC 1YJNS 4R25A 1HNIA 3EUNA 4DL4A 2GJIA 1VBKA 1T03B 5DQHA 3WIUA 4RUBA 1TK0A 1YITS 2RQKA 1Y10A 3G86A 4JB8B 5HO4A 3W9HA 1Q0NA 3KG1A 3C14B 2HNDA 4LF6J 1REGX 3OFGA 4K4YA 4PR6A 2FY8A 4TQRA 2H1YA 3UI3A 4N8NA 4PG6A 1WG1A 1VCTA 4F0MA 3I31A 3GZ7A 4QWAA 2W8LA 4DV7F 1TL3A 1RAAB 4RW6A 1DQ8A 1X4DA 2JC0A 2E5LJ 2D7SA 2JWNA 1H7XA 2J8SA 1YJTA 2YPYA 2GW8A 2K1RB 1NRKA 5FD1A 1KS2A 3UCZP 2VU5A 4WKRA 1VLOA 4ID5B 3P96A 3I5BA 2BANA 2Z56B 1KQKA 1RT5B 1Y4ZB 2AZ1A 3HJVA 4LR9A 2WZ1A 2UZAA 4UF4A 2UU9F 3EVOA 4CH0S 2HLTA 1T02A 1S77D 3W5YA 4CI0B 3ET6A 1WI6A 1VYAA 2RRBA 3OXLA 4X4PA 4WCEQ 3MFHA 1FJGF 2DEIA 2YBVA 2R8KA 1SC4B 2UXCF 3A8EA 1Q8LA 3FC9A 2MKHA 3U1NA 1HHSA 4PZVA 4CYUB 1R0AB 1RYRA 2CPJA 3DYAA 4DR2J 1R7IA 2R7OA 1NKEA 2K7KA 5I3QA 1S48A 3D67A 4WYWA 3U7JA 1S1WA 4MIWA 5ETSA 3QWUA 4I6AA 2QLBB 5K5MA 1N32F 4HACA 5RUBA 3QGHA 2M3DA 3DMJB 1X60A 2R2SA 1O8BA 1SIWB 4HHHA 3OXGA 5DG8A 2XMJA 1UEVA 4F02A 3KLGA 3TQEA 3DXSX 4F26A 5DDQC 4O44A 2OMOA 2ZHAA 1NPRA 5A8KB 1HBNB 1Q78A 1GX6A 3Q8RB 4ZVGA 1PKUA 2UVWA 3I96A 4R5PA 3Q83A 2H65B 1TAQA 3MR7A 1NSAA 4I2QB 2C3OA 2OKQA 4LFAJ 3EPGA 2YH1A 4NRUA 2DY9A 5CD4A 3MOZA 1RTHA 1NXIA 1M5PC 2HS3A 5DO2A 3JAMU 3RAMA 2UXDF 2GJFA 4USIA 4C98A 2CNOB 4N8OA 4ZVSB 1RWOB 4KGMA 1RLCL 2P2CB 1C4AA 3X3UA 2OSQA 3AH6A 5HVFA 3CD5A 4EBDA 3A4TA 4OYOA 3IRXA 4QCLA 2FQQB 2QO3A 8AT1B 1N6QB 4NEZA 1FD2A 4ZN1A 1V3RA 2MZ1A 5LMNF 3RZAA 1JLCB 1S6PB 1RKIA 1PBAA 3TEHB 1B7FA 2GO9A 1FKPA 3JQKA 4CO2A 1RT6B 1LQ9A 4NA2A 1LK5A 2FJXA 3MEDB 4RW7B 4K5RA 3BGOP 3PTWA 1RLDA 2C28A 3H2VE 1TAUA 1KHWA 5BR8J 2VUGA 1G4CA 4EBEA 2ZJQQ 4RW8B 1HHQA 2O01C 1HNVA 3MM9B 4OZNA 1ULRA 2OEJA 2Z2ZA 3BYRA 5H9EK 3FVYA 3PHEA 2XHWA 3HCXA 4YDDB 1N48A 2OPRA 4PCQA 1VFJA 4ES1A 4JV2A 3K7RA 2M9KA 3PX4A 3W65A 3NGUA 2BABA 3FCHA 4X66F 2FD2A 2YQ3A 3FJ2A 3HHEA 1LXJA 3DM2A 5LSRA 3MUVP 5CYJA 3D0GE 5KFTA 2CPEA 1XIQA 1UVNA 4I67A 1V3ZA 2BJ7A 3BKFA 3I0RA 3LP1B 4YP3A 3MCNA 3OL9A 4RL1A 1RHRB 5HROB 4WZQA 3VQSA 5HBMA 1SXLA 4USWA 3GCWP 3G6YA 4OX6A 4QJVA 4Q0BB 4J9NA 1K9MT 2YH0A 3GIRA 4MJKA 1U45A 5KFZA 2CRLA 3TVKA 2KT5A 3VALA 2AJ0A 3NS7B 1FERA 5A6WA 3UE2A 4RWXA 1UZHA 2NYIA 2F4VF 1UJ4A 3LANA 4DF4A 1RKJA 2CJAA 4E0DA 4ED8A 3H42A 5I4MA 1Y00A 4M5DA 1RWWB 4EZ9A 2XS2A 2KRBA 4FDFA 1WDDA 5KFWA 4QIWD 4KHPF 2EXUA 2K06A 1FJ7A 1UFWA 1NBEB 4NLYA 1HQEA 2FZKB 3Q89A 4X4TA 5E3AA 1ROFA 3D66A 4F0KA 2C2EA 1WEZA 2DKOB 2CWKA 4ED7A 2Y1LB 1Y3JA 4ID8A 1Q86T 4K0KJ 1NUEA 1YDLA 3ELHA 2XWYA 4AL6A 5IV4A 1PJ6A 1PGZA 3EGVA 1IKXA 2VG7B 3M8WA 4RNFA 2CJ9A 1H7WA 4CLWA 4CO0A 2YX4A 2W7AA 2QFIA 2HZAA 2V4JA 4PG4A 2RF2B 4IFVB 4F2RA 2DHHA 4B3OA 5CA5A 4IG0B 5T7LA 3NAIA 2V2ZA 2V9KA 1NNDA 5IV3A 2XG8A 1TL1B 1YRXA 2EEYA 2YKAA 3KHHA 1AZSA 1D09B 4IR9A 2HK3A 1WF0A 1OWXA 1SUQB 3QSIA 2KXFA 3RYLA 3LUYA 3BZQA 2M0GB 2CVEA 3CT9A 4ER8A 1RA7A 3MAQA 3K59A 4Q5VA 2ZM6J 5KFKA 5A8WA 1T3OA 3FMWA 4YR2A 1EJ7L 2P9EA 1NK9A 2HPUA 1S1XB 3QMQA 5C42B 2A6MA 3E01B 5B09A 4DCOB 1D9DA 2ACMA 3OJSA 3DU6A 4G1PA 1NM2A 4B3TF 1YJVA 2V9WA 5E41A 4KAIA 1VQYA 2E1MC 2QSFA 4IQXA 4YB6A 2HFSA 3IS9B 3UNGC 1OYDA 2LDIA 4GO7X 2ZKTA 1IR1A 3GQCA 3M1VB 3R5DA 3GV8B 1TFWA 4DCJB 2V2KA 2POKA 4LFBJ 4IRKA 1WJ9A 2X1BA 3NXZA 3TOQA 1ITPA 5L38A 5KG4A 1CJVB 3SCLE 4LJMA 3VF0B 4DCPB 1PAEX 2KFNA 2DT9A 1RJJA 4ITSA 3D1QA 3T9ZA 1URRA 4F67A 2ROEA 4I0WA 5HP1B 1KLNA 2CPIA 2V67A 1F60B 1SBRA 3EVMA 3SQGA 4NYPA 2WVDA 1R43A 2HQGA 1DJ0A 3BGRB 4MYTA 5CYMA 3QGGA 2EVZA 3PO4A 1J5EJ 2RDJA 1YJWS 1U1OA 3CJ0A 1MMDA 1CC7A 3H5YA 2HVHA 4WU3A 4BDPA 1K47A 3TYTA 2P6TA 1T05A 5BJRA 4B9TA 4O3SA 1KOOA 3J80Y 3MMCA 1XNQJ 5ETKA 2NUUG 1S9EA 4OHXA 4X4QA 2NSCA 3NWRA 1RWXB 1UVKA 2I8EA 4LRDA 1RGVA 4I1TA 3BM7A 1BGXT 3QJPA 3SDEB 3TAMA 2QA2A 1MG7A 3SZ2A 4JI7F 4UY8T 3D5MA 3KFWX 4P72A 5LM7E 3VAGA 2DGVA 2R7RA 2R2TA 2OHDA 4JI1F 3IRWP 3PY8A 3CEDA 1IM4A 2XSJB 2NXEA 2QA1A 5F9NA 2RHSB 4QZVB 1IBLF 5KTQA 1LFWA 4ZVTB 5DLGA 4QOTA 2GIFA 4L75A 3L7PA 3SEOA 4NLOA 4KE5A 2DD8S 1N8RT 4N41A 2UUBF 4O3OA 1RA6A 2EG2A 1TR0A 1M1GA 4DG1A 4C11A 1D3WA 3PG9A 4W92B 4AXIA 4J9MA 2AGPA 3WQPA 2YNHA 2B7CB 1S97A 1EP4A 4AQYJ 4XAKA 1VOMA 2G0IA 2GX8A 4LF6F 4X4VA 3C6TB 5K8PA 4QR1A 1HMVA 1HQUA 1HHTP 4QQBA 4B3MF 2XMKA 3Q8YA 3MAHA 3W60A 3CDEA 1UKUA 2G13A 3KLEB 4A8MP 3D6HB 1AROP 4G1IA 4DX8H 4DV4F 4ED6A 1V5VA 3CCRS 2E5LF 2IAJB 1JLBA 4WZMA 4A8FA 4ZJOA 4CRJA 3K58A 1IUJA 4LSNB 1U6BA 3BYPA 4MKYA 4KH1B 1ZM4A 3TJ8A 2NXNA 5CCMA 3W5XA 4DV1F 1U4BA 3HK2A 1RTJA 2XZTB 1XMOJ 5ETMA 4DR7F 4F3MA 3H5UA 3RAXA 3K8VA 4DL0C 4JP8A 3FCWA 5LJ3Y 1S9GA 2ABYA 3OBIA 2ADBA 2BQUA 1WTFA 4JI5F 2YY3A 5CYQA 1VK8A 2HK2A 3IWNC 4ZPWR 2XNRA 5I42B 4QPTA 4P73A 7FD1A 3FFIA 2C22A 3AD7C 1JLGA 3TZXA 1VBZA 1RDRA 5C24B 2JVRA 1U1KA 3C3LA 3BR8A 1JJ2R 5F8IA 4WTYA 3ZTQA 2FLLA 1GK8A 3N6MA 1RHMB 4DR2F 5J1EA 3FCVA 1E6VB 4ZDNA 4CTAB 3L95X 2L41A 1KSPA 2V94A 2A2CA 2NXJA 3DHWC 2HMIA 1X4GA 4LSZB 2KM8B 3QLHA 1RTIB 3W63A 1SH0A 2C2RA 1JLAB 3DRPA 2HBQB 2IY5B 3QFHA 2HW3A 4MTPA 2RILA 5KT6A 3V4IB 2EFGA 2HHWA 1TKZB 2C2OB 4CO5A 1P8GA 3DGVA 2CADA 5B08A 4C0HA 3M6UA 5IT0A 1YQHA 3VV2B 3IR6B 2DXFA 5FJ4A 4WFBQ 1FNOA 1UVLA 3M9OB 4S0MA 3RG6A 3JYTA 4YB1P 3OTCA 3HT0A 3UD3P 1IKYB 1AA1B 2CG8A 2E5GA 5DZ7A 1VRTB 3HDSA 3DLLQ 4B9NA 4URGA 1Q82T 4TN2A 2J9EA 2WOMA 3PRBA 4J9KA 4LIWA 4LFAF 2R8GA 2O3DA 3ZC4A 2F8HA 2DNRA 1CQNA 4FVMA 1QD1A 2LXUA 1NZAA 3IA0A 1UEUA 2LDYA 5GMKa 4L6V3 1JJ4A 1ZAWA 1P6TA 4JUZA 3TZYA 4OZJA 5GAGI 3UFCX 1QSSA 4ZHRA 1XTZA 2J76E 1RHJB 1EB0A 3A8KA 3O44A 3BSOA 4B9LA 5A8RB 1BY9A 1R0BG 1R3NA 4KTQA 2KU7A 3DRSA 3M05A 2SXLA 4J5OA 1MLAA 1BHNA 3JQMA 3W2VB 1SIZA 4WIQA 1R8PA 1CJKA 1I51B 3GG0A 3NRBA 1U1MA 1RT4B 5F3TA 2M5YA 4ED5A 3VHQA 4G6VB 1KD1T 3AB4B 1NK7A 2BKOA 4F3OA 1S1UB 5BXIA 4JI2J 2YWGA 4NCAA 4LF8J 1RT1A 2NQPA 3AOCA 3K8WA 3OPKA 2B9YA 5D6GA 1U2FA 2HIQA 1XWLA 3B78A 5K8MA 2N4DA 4CZCA 4GVBA 3DI6B 2C2MB 1UETA 3FSYA 2QLFB 1NK0A 3OXFA 1DBDA 1YG0A 3MM6A 4PWUA 1S99A 3CUNA 1NDPA 2ZJRQ 2J9DA 3LPEA 1N54B 1N52B 2HFOA 2VFTA 1VQLS 3I87A 2GAHC 3ZFVA 2FJBB 2CZVC 4Z7YA 3ISND 1VRUB 5IT9Y 2BJ1A 1WKJA 5D0GA 3GYNA 5D77A 1KNZA 2XZWA 2V6AA 4RZRA 4P9SA 3PNIA 3CXCR 1MROA 1MN9A 1HD1A 5D4OA 2HQFA 4ELVA 2ZZMA 4O3QA 3GV5B 3HVTA 2KL8A 4ZJQA 3KHLA 3LPYA 3GSDA 1C0UA 1HBOA 2FJEB 2FB0A 1D0EA 2V34A 2EI5A 4O44B 2PEBA 5CD4H 4AYBD 2R7UA 4LVNP 4FS2A 2OEMA 1VJWA 1Q8KA 1S1VA 4NLRA 3PO5A 4OZLA 3NOCA 5D3GB 1PJ5A 4X64F 2D69A 3LAKA 4OI4A 3RBDA 3HPOA 1SCJB 3PEHA 4JI4J 5JUMA 4B3RJ 1KQFB 4J9LA 1FKOB 5KFXA 4BWMA 4KGXB 3IM8A 2BVZA 5FIIA 5E5NA 3LWMA 2UUWA 4WBFA 2CJYB 4LFCJ 2VJUA 2XCAA 4IRCA 2F63A 3VGVA 4M63A 4A8QA 4YQWA 2F65A 7AT1B 4WFNQ 1Q95G 4G3IA 4HTIA 2L9WA 4M95A 4PRFA 1OYEA 3RRHA 1VRQC 1NK5A 3VR1A 2K2PA 2CDRB 2F9DA 3LF0A 2BDPA 4XDCA 1QE1B 3IRXB 3KNGA 2YQ1A 2HVDA 1YI2S 1MMLA 4JV5F 3OLBA 2ZC4A 1YJ7A 4ELUA 2J0WA 2AJQA 2FHJD 2GHVC 3CCQS 1C1CA 3SV3A 4C4WA 3MGJA 1W25A 2I5JA 2VG6B 1DTQB 2UXBJ 1X0PA 1GNKA 4H4OA 4Z7CA 2H3EB 3BQ0A 2JLEA 4OJ3A 3W7BA 2HQCA 3C66A 2CNLB 3PW0A 3NG8A 1S49A 2WK4A 2HBZB 2Y3YA 1O5JA 3EZUA 1BQMB 4UT4A 1SQEA 4XO0A 3CIMA 1RAIB 4DV3J 1QLNA 3MMBA 1RCXB 5CHCB 4DQSA 4Y00A 2WVFA 3DDKA 2ASYA 2VL1A 4NLSA 1H73A 2RT3A 3N5BA 4JI0F 3S01A 3ENQA 4YR0A 1TVRB 1EQ0A 1NH8A 4U7UK 3E3XA 2M4MA 1SL2A 1IQZA 1HYSA 5IZHA 4UUXA 1S57A 2LLZA 5KFRA 1NSPA 2D3ZA 2KRRA 4GKKJ 4O0IA 2DH8A 1RE1B 2YNGA 3VAIA 1N0UA 2WCXA 1MU2A 4YHHJ 3NBPB 2KTQA 2CNKB 3N6LA 2OI2A 3ZZUA 5ETVA 1X8DA 3CPWR 4K4XA 2YKOA 3GFHA 5KG3A 4OJGA 1F5AA 1SKWA 3EXCX 2H54B 3DOMA 2DGXA 2FJAB 3H40A 3QSYB 3HFKA 5J2MA 4U6PA 3T6BA 4I68A 2OIHA 4G1QA 2CFXA 5KG0A 2QL9B 5HBMB 2A0FB 1NKBA 4B9UA 1QAXA 4OMFG 5KFFA 4DLGA 1RAOA 4EO6A 1P9QC 4U95A 1PYOB 2GGPB 3DLGA 4USJC 1M0SA 3MPYA 4PXEA 2DGQA 3KG4A 2XS5A 4M5IA 1KVIA 4LFBF 2AKWB 2C3PA 1WSRA 1RBOB 5EDWA 2KN4A 5DGBA 2E1AA 4NA1A 1T03A 5ETOA 3P8BB 1P9YA 3J7AN 5HAOA 2ZBPA 2DNGA 5BYRA 4RUCA 1U1QA 3W61A 5GAEU 2R7VA 3M6VA 4C0OC 4FYVB 2RRNA 2V5HG 4FXWA 2DNYA 1FK9B 1RT3B 4ICLB 2HURA 4ILRA 3J81U 2XMWA 4UOCA 4ZVRB 2KFYA 1LWFB 1J5EF 2UVRA 3FEZA 2VQFJ 4OX9F 4EK2A 4OI6A 5HJXA 3MCSA 5SUHA 2DHXA 2K1RA 4Y3CA 5BYSA 1WORA 3BR9A 2MLXA 2AYMA 4PXDA 1TKDA 5GADI 2OP5A 4CLZA 4CP5A 3DOKB 4ELTA 4LQ3A 1RT2B 4HDHA 1RT5A 4EZ6A 1C1BB 1LWXA 3RBEA 2D3OR 1NO8A 4GC6A 5FLXY 4O23A 4LF7J 3GFXA 3RTVA 2BJEA 1AZSB 1DTTB 4J7CA 1JJCB 5F8GA 4OYXA 2VC1A 2ZD1B 1X4FA 4N47A 1U47A 3QGPA 1HW9A 1KBRA 1YBUA 1N33J 2CZ9A 1G7CB 2FDNA 3KLHB 3HSDA 1X4BA 2FGOA 2B9XA 2W2OP 4CYUA 1R0AA 3NGRA 1PIEA 3R2CJ 4C8OA 4K4TA 2ZVIA 2XYPB 2ZE2B 3DLHA 2MZTA 1FFSB 3H5SA 3QZ8A 2LQ8A 1R6VA 3VAKA 1GEHA 3ZTPA 2XO7A 5H9FK 1UW9A 2JEFA 2R7QA 4DZDA 4KJIA 2RS2A 2X3GA 3PM9A 3CJRA 1JB0C 1O51A 4KHRA 2DEJA 3DMJA 3LWLA 4HYKA 4OHYA 2DHSA 1R8BA 1HNXJ 1OPIA 2RQ4A 1WHYA 3I6PA 5F8LA 1Y5IB 5ETNA 4AQYF 3R7SB 4O3NA 2BXJA 2NR0A 4WXOA 5A8KA 1HBNA 3NGKA 3VZIA 3SYZA 3OVAA 4DSEA 1TTHB 1S10A 5J2PB 3RRGA 3HD2A 1JKHB 3UVJB 2MKYA 1ELOA 4I2QA 5MAOA 4V1Ak 1FE0A 4FPIA 1CG2A 5L46A 3SFGA 3QATA 5ETTA 4ZPTR 4PAAA 1X5TA 3DGPB 1RADB 1EHWA 3IM9A 1PC4A 4Y28C 4K4UA 2BKPA 2Y8WA 1XR6A 5J2NB 3K0JA 1M5SA 2Y1IA 1XMOF 4KY3A 1UA1A 4TYAA 2AX1A 2RDIA 9RUBA 2W1BA 3V4MA 4GMKA 2N82B 2XYGB 5LXRA 3QYYA 1V6HA 1N6QA 3ADAC 3EWGA 1YJ9S 3FBCA 2FHMA 5JMNA 3M30B 2DO0A 3Q0AA 1WACA 3R5JB 1JLCA 3RB4A 1Q81T 1S6PA 2E9RX 3M2RB 4KYZA 3GR0A 4URQU 4F3QA 2FLOA 2XGPA 2ZC3A 2EWHA 3NMAA 1SJQA 3T1YJ 3BH7B 3VGTA 1RT6A 1T9VA 2XZDB 2BA9A 3MFIA 3MEDA 4RW7A 3GIIA 1K1SA 4ZCIA 3BO4A 4CO3A 1U6FA 5F8NA 3BEGB 3OL7A 2ALZA 3KYLA 4ZLLA 5E2QA 2ATLA 1ZPWX 2N3LA 3PYDA 1X0FA 5DQIA 4F4KA 1B4SA 2KZMA 4JI8F 4RW8A 3W2WB 3M2UB 5HI7A 4MKAA 3MM9A 2OUGA 1WC6A 3JQJA 3NWGA 4FF4A 2UP1A 5F0WA 4HI2A 3MEKA 2XTJP 4WU2A 2HWIA 1TK8A 3KXDA 1JMTA 3TA0A 3AQPA 2CJBA 2AW0A 2MHEA 2HHHF 1UWBB 1AUSL 2ATCB 1G2EA 3HSZA 3FRYA 3NOGA 1ZM2A 4MMOA 2OFGX 2XMUA 4ATNA 3LP1A 4P6QA 2EFQA 2M8HA 3I9V9 2IYGA 4GKJJ 5HROA 4FS1A 3MR3A 3MDFA 3BGFA 3ZNJ1 4Q0BA 3D28A 3IFEA 1TUVA 2VBZA 4DR1J 1VQ8S 1AXQA 2NZCA 1RU2A 3JTOA 2GS8A 4ZP7A 3G6ES 3CIZA 2FHKA 4QYZJ 3KHRA 1UVMA 5C5JA 2G9OA 2HRUA 3B4MA 3DRXA 3S6EA 4N76A 4ECXA 1Q7YT 1T7PA 4DPWA 3PIPQ 1XNRJ 4HKQA 4ED1A 3RR7A 1DRZA 1FTCA 2UVVA 1RWMB 4OV1A 2R8IA 2I0XA 4ENOA 1S6UA 3HT3A 2ZOMA 4EYHB 4ECTA 5EX0A 1HWJA 3CDWA 2CQBA 2HFUA 2FZCB 3KWMA 3OHBA 4ECVA 2UUAJ 1GH8A 2AJ1A 4PG7A 2GMLA 4TKTA 3OTBA 4TU9A 2V50A 4X62J 1URNA 5IT9U 4LF8F 4YDXA 2B4UA 1Z1ZA 2ZNZA 3MM5B 2IFXA 2ILYA 4V19J 2NS1B 2VG7A 2XGQA 1OIAA 3TJ9A 2PA3A 2IVMA 1PBUA 1UTAA 2QL7B 1F2HA 1VJQA 2VKRA 2M8DB 4JV1A 1SJ3P 2RF2A 5KT5A 4IFVA 2FC8A 2AYEA 4DMZA 3O3LA 1Z4UA 1H3DA 3MPWA 5F8JA 2HS4A 1GMUA 4IG0A 4A8OA 1SJRA 1MWYA 1YLXA 2LFVA 3ISNC 3JSBA 4EYIB 1D8YA 3ZTOA 1TL1A 1ZM9A 2J5AA 3TW0A 3QQCD 2DGWA 3QZ7A 4RWWA 3TA1A 5K8OA 1DHMA 4CH7A 3CCJS 1BWEA 1SUQA 4X4SA 2WSFC 5LT5A 2JLFA 3SSQA 4I7FB 4RW9B 2CNNB 2W4PA 4HH0A 2NCKL 2YKQA 1VMBA 1B0PA 3O2IA 1I6JA 3JYTB 1IWGA 1J5OB 5B0CA 2L9DA 1EX8A 1S1XA 3WC2A 3G82B 3VQTA 2HQDA 2OJ3A 4NCBA 4K4VA 1S6QB 3E01A 2QYGA 3MD1A 5KT3A 1S5ZA 4U9RA 3M8ZA 5HQ8A 4HVZA 4USTA 1RWKB 1T3NA 3SSSA 1FTRA 3CD6S 4LF9J 1YZ7A 4B3RF 1JLEB 4P7TA 3LP0B 1YIJS 4HT7A 2ZUAA 4RPFA 2FTRA 3IS9A 4X84A 1ZBTA 5B0GA 4LFCF 1NB2A 2HIYA 1Y0HA 1U49A 3LO3A 3AT1B 2CKWA 4WP3A 3NS5A 3POTB 4HHUA 3V2UC 2YTCA 1QUVA 2XS7A 1N5YB 3KK1B 3MM8B 4BHQA 3CC2S 4ZVUB 1CJVA 4DHVA 3DLKB 3P6YC 1T94A 1N88A 2KB2A 3AJDA 4U8YA 5KFBA 2B8QA 1RI7A 2JNJA 3MF5A 1Q5YA 2QMUB 2I1RA 4CLTA 1U0HB 4TXSA 4Z37A 2DGOA 3R5BA 4NRTA 2IJNA 3CJ8A 1RABB 2M2BA 1KOHA 5HP1A 1NHUA 2UXBF 2Z8QA 2GNKA 2DR8A 3BGRA 4OYPA 2VJVA 2ZWPA 1FRXA 5ITHA 1RT1B 4PG5A 3OR1B 3FEXB 2XO6A 1D9AA 3HHLD 2IM0A 4ZPDA 2E5IA 2HHUA 3CNQP 3F56A 4MFBA 3CTRA 1HPZB 3OFEA 3UD5A 2QRRA 4FZVA 3DHXA 2W7PA 4PKDB 1UL3A 5G4DA 3OVBA 4EWTA 4U67Q 1ZM3A 2ZNYA 1X4CA 4DQRA 4C8ZA 2AJ2A 3OTOF 3H20A 4C48A 1IKWB 3UCGA 1KWMA 4DUTA 5AJ3J 2ZJPQ 3EDRB 2BE2B 2C2NA 1DQ9A 3AAWB 5KFNA 2FC9A 4NI2A 5DETA 5IQQA 2VHGA 4YHHF 2VIHA 2ACYA 2HFZA 1HI8A 3SDEA 2CQ3A 2JSXA 1UVIA 1WC0A 2H9ZA 1GXUA 4M5MA 1ZA2B 3I5CA 4GC7A 1Y5LB 2Y9HA 4YS2A 3SXLA 2FVQA 1LW2B 2XSJA 1HBOB 4PYDA 1AYEA 2W7OA 2JEIA 1UWAA 3MEGB 1H2VZ 3UN3A 4DV5J 3VAMA 4Y34A 3M6XA 3FBBA 3HHLB 4WFZA 2HQ3A 1ZS6A 3FSXA 5L9NA 2VBYA 2QMXA 2DXEA 5EUHA 3C46A 3ZZTA 1RTZA 1K1QA 2MDAA 2KZZA 2XEXA 4P10A 3G2XA 2RU9A 4ZN3A 2B5JB 2NZ4A 2P8IA 2WHOA 3J7ZT 1KC8T 1HD0A 5HLFB 1Q79A 4TY9A 2PE8A 2C1EB 5EWEA 4RNHA 3C6TA 1TU0B 4LF4J 2Z58B 3BGUA 1VK3A 3HFZB 2C3YA 1Q16B 1U25A 1KQGB 1QAYA 1NH7A 3D2WA 3QFWA 2ZH2A 3KLEA 2LP4A 3G71S 2EC2A 3EICA 4KC5A 2WBRA 1JNRB 4ECSA 4IFYB 3R27A 3GPAA 2ZVSA 2VQFF 4ILLA 2KI2A 3DLJA 2IAJA 1VQPS 3PW2A 3VVUA 3ILLA 4ZVPB 1FT8A 4LSNA 5DGAA 4FYDA 3FRZA 3NGTA 2JZ5A 4H4OB 3P5BP 2E9ZA 3SFUA 1AW0A 1RWPB 5GAHU 4O3PA 2FIUA 2PDAA 3EPIA 1OMSA 2MZRA 4XDDA 4OX7A 1IR2A 4ZVQB 3W8PA 2DR5A 2BRKA 4NYZA 3MR5A 2P9CA 1N5QA 4OL8A 4WKYA 2CPYA 4LF7F 4CWBA 3PJXA 1FE4A 4ETXA 5KT2A 2WB1D 1UJ5A 2LA6A 2MKIA 3TJAA 2A6OA 4KHMA 1HYSB 4FBTA 2R4FA 1N33F 3VAHA 4A46A 5C24A 4NLUA 5EN1A 2RUSA 4DX5A 4YFUA 1B0TA 2YNGB 9ATCB 3JXOA 5J1NA 2KYZA 1A6LA 2XB2D 5KOXA 1E6VA 1R8CA 4CTAA 1IBKJ 3VVTA 2ZBRA 4HH1A 4RKUC 1S0MA 1YHQS 2LU2A 2DCUB 2XYHB 2BR0A 1NJWA 5HJYA 2VONA 1RTIA 2BQRA 3JSMB 2WBMA 2LYVA 1JLAA 4QU7A 1TKZA 1DARA 2ZUGA 1XC9A
chains in the Genus database with same CATH topology
2CZ4A 2OPSA 3DHWC 1HNXF 2DGSA 2HMIA 1F0XA 4K4WA 1X4GA 2EK1A 3UDCA 1QAIA 4B9SA 3M8SA 2KM8B 4NLTA 3QLHA 3KLVA 3E51A 3V6DB 1G1XA 1RTIB 3M2VA 1SH0A 3PFEA 2C2RA 1JLAB 5IT4A 3DRPA 2HGMA 4ZS6A 3CJ2A 1CC8A 3FDSA 2KT2A 5J1EB 2HW3A 4MTPA 2RILA 5KT6A 3R3TA 2CIMA 2QZ8A 2EFGA 3V4IB 2DHGA 1HARA 4ZCMA 2HHWA 1TKZB 4CO5A 2AGQA 1JIHA 2F8MA 1P8GA 4NLWA 1IKYA 3IAS9 1SKSA 1TL5A 2FJDB 1FESA 3VTIA 4J9SA 5B08A 2OPSB 4J9QA 2HMIB 3IAM9 4C0HA 3M6UA 5IT0A 2H5EA 2JH3A 1YQHA 2DNQA 4IH5A 2VPWB 4XPEA 3HX9A 5B0BA 1VRTA 3QLHB 3IR6B 4EO8A 4B17A 5FJ4A 4IOCQ 4WFBQ 3HF5A 3I9ZA 4NOHA 4KBIA 3M2VB 3PR5B 1FNOA 2HHXA 2PSZA 1UVLA 4DWIA 3M9OB 3CCZA 1MWZA 1HI1A 3DRPB 3IC1A 3FMBA 2F3JA 5F41A 3JYTA 1HWUA 4BS2A 4YB1P 3OTCA 3UD3P 1N56A 3GFZA 4EGLA 1IKYB 5DJBA 3CD7A 2E5GA 2PIIA 2CDQA 1OO0B 2MKJA 1SJFA 3LW5C 3ZZPA 2B9WA 5THWA 2JFKA 3PVXA 4NWBA 2RH3A 2JHEA 1VRTB 3HDSA 2VH7A 3DLLQ 1VQMS 2LVWA 4B9NA 3UPFA 4MIAA 4URGA 1FDAA 4TN2A 1Q82T 2J9EA 3L09A 2WOMA 1LFPA 4N56A 3PRBA 4J9KA 4LIWA 2NLWA 4LFAF 5A8RA 2R8GA 3I0SA 4ZCKA 2O3DA 3PW7A 3ZC4A 2F8HA 4ZVHA 3LALA 2DNRA 1CQNA 3K2YA 4I6WA 4FVMA 2PI4A 5C42A 2LXUA 1NZAA 4ZA1A 3IA0A 1WG5A 1UEUA 2IA0A 2GMJA 1D9FA 4DF8A 2J7UA 2AGOA 5KFVA 2IA6A 3CMAS 2LDYA 5GMKa 3U02A 4L6V3 1QSYA 1XNQF 1M1KT 2VB6A 3KKFA 1JJ4A 2OAUA 1FXRA 1ZAWA 1P6TA 4JUZA 3CB4A 1YTYA 4OZJA 3T3FA 3W2VA 5GAGI 3LH2S 3H25A 3K5LA 2WOMB 4M1KA 3HXMA 2CPZA 3UFCX 5GAGU 1QSSA 2CQCA 4ZHRA 1XTZA 4OJHA 2J76E 3Q8SB 2RQCA 2JVOA 4JI6F 4DQQA 1YVFA 3O44A 3BSOA 5A8RB 1QAJA 3I0SB 4B9LA 2A2DA 2HAIA 4WK1A 2J0SD 1BY9A 1R3NA 4IO1A 2DJWA 1LOUA 2KHDA 2Z2MA 3GR1A 3SCIE 2XC9A 4KTQA 2F1FA 5HMYA 1RT4A 1EETA 1VGYA 2KU7A 2GHPA 2LQ9A 2Q1LA 3DRSA 3BO2A 4X4NA 4K2XA 3M05A 1U26A 4AL7A 2X1FA 1H0HB 2SXLA 1R8AA 2XMMA 4J5OA 4DV5F 2IHR1 3EGZA 2GC8A 1VC6A 1U09A 2ASLA 1Q1KA 3W2VB 1SIZA 2LXIA 1R8PA 1S1UA 2DNNA 4ES2A 1K0TA 1YSJA 3M1VA 5L1LA 1NJIT 4ZHRB 1HWIA 5KFDA 3G6XA 2C3UA 3CCES 4QIVA 1N34F 3ZZOA 4Q45A 3AA9A 3GG0A 1KFSA 5D8HB 2EFPA 3NRBA 2HHQA 3I4PA 3PFOA 2ZH7A 5L1JA 1U1MA 1VQNS 3D0IE 5AE1A 2ZH6A 3T1YF 2J0QD 4E8UA 3AHPA 1RT4B 1EETB 1TQLA 5F3TA 3DI6A 1NB7A 3DRSB 4DSLA 2M5YA 1AFJA 4C8LA 1HWLA 2ERRA 5B0FA 4ED5A 3CCLS 2W8KA 4G6VB 3NCRA 1JK9B 2JC1A 2KKHA 2RSQA 3WC0A 2DNZA 4CH1A 1KD1T 2QA4S 3TA2A 3AB4B 3TI0A 4HL9A 1NK7A 4F3OA 1S1UB 4NLXA 2HNYB 2YWGA 3VCDA 4NCAA 1RT1A 1JX4A 5LSOA 2NQPA 3EZ5A 1X7VA 2OLWA 2RS8A 3K8WA 1N36F 3OPKA 2RJZA 2V0NA 2B9YA 5D6GA 1U2FA 2E7WA 2EBGA 2QFJA 2HIQA 1XWLA 2GFFA 2KJVA 3B78A 5K8MA 4E98A 2N4DA 5CZVA 1XERA 4CZCA 3DI6B 2DNHA 2CQGA 1UETA 3PJWA 4O3RA 2DR9A 3FSYA 2XULA 1NK0A 1LXNA 1U2RA 1VRUA 3BGLA 4Y65A 2JLGA 2DNMA 4A8WA 3QAEA 3OXFA 4NLVA 1QJHA 1Q8IA 4RX6A 4LF4F 1RQ0A 1DBDA 1YG0A 4DFKA 3PXGa 3MM6A 5AE3A 1GX5A 4PWUA 1S99A 3OQ2A 1FVSA 4F25A 3CUNA 1NJZA 2E5JA 4OI1A 2ZJRQ 2IM1A 3HZGA 2J9DA 4ED3A 3HJFA 3AJ1A 1G3OA 3CJ3A 1GAOA 2E7XA 2YWKA 1N54B 1N52B 1VHFA 2HFOA 2RD5C 1JJHA 2VFTA 2RIJA 3MEEA 3I87A 3T6JA 1VQLS 2DR7A 4CIOA 3ZFVA 2HGLA 5KFPA 4NCGA 1N4LA 2FJBB 1L3UA 2B51A 2CZVC 1ZTTA 4J9OA 3OSPA 5IFMA 3ISND 1VRUB 4ZPBA 1ZPVA 2MKCA 4B3SF 1FDBA 1Q4RA 2RE1A 5IT9Y 2DRAA 4TLQA 4F4ZA 3GIKA 2WRMA 4I4BA 2O66A 2HLUA 3GYNA 5D77A 3MM6B 2N7CA 2GHWA 1KNZA 2XBPA 2XZWA 4RZRA 5HN0A 3PNIA 2ZH1A 2OD6A 2DISA 4DN9A 4F4YA 3CXCR 1S7HA 2N3OA 3H2UB 1MROA 3MI7X 3EX7B 4NA3A 2VG5B 1HD1A 5D4OA 3MEEB 3MR2A 2DIUA 2BOPA 3SCJE 4DDFA 2OD4A 4NCGB 5A0YA 3F44A 3M32A 1FEEA 1KTVA 3V81A 4X4UA 3GB0A 2A10A 2OMLA 3PX0A 1FRKA 2XMTA 2PT0A 5MLCV 4AXJA 4D3GA 5CZXA 5KFLA 3DOLA 2KM8C 1RAJA 2VZ9A 3SI8A 1W2IA 2BYCA 4ELVA 2ZZMA 3RAQA 1H6KX 4YY3F 2ZOFA 3MM7A 1LWEA 4IG3A 4O3QA 2GMHA 4N77A 4YUDA 3GV5B 1I1GA 3HVTA 3PKMA 4MK7A 3PW4A 5B0AA 4OI2A 5D3GA 3KHLA 3LPYA 3GSDA 1C0UA 1HBOA 1MROB 3PZPA 3BB5A 2FJEB 2FB0A 1DLOA 1D0EA 4J9PA 3G96A 5A0YB 5KFOA 1OSCA 3M32B 2EI5A 2ZH4A 4O44B 1L3SA 3MMJA 4PXBA 5CD4H 1M5VC 4QIGA 4AYBD 2R7UA 4LVNP 2I38A 1FKOA 4FS2A 1IJEB 1ZTWA 1VJWA 3DOLB 2XI3A 3HVWA 4IUFA 3TARA 1S1VA 2BRLA 4NLRA 3PO5A 4OZLA 4K4SA 3N01A 2FJVA 2J7WA 4LIRA 1N5TA 4IG3B 3MM7B 1LWEB 3BSCA 4PWDA 5L8RC 2M52A 1MNEA 3BS9A 3HVTB 3UW1A 5DQGA 1VC5A 4DSJA 3EGWB 5D3GB 3K5OA 1C0UB 1GXTA 1YRUA 4KB7A 4X64F 2LKZA 1SL0A 3LAKA 2PGCA 4OI4A 1PO6A 3RBDA 3HPOA 2W9AA 3ICLA 3HP6A 3PEHA 3GV7B 1C0TA 2XNQA 4OZ1A 3SMZA 5JUMA 1KQFB 4J9LA 2ADCA 1FKOB 1S0VA 1WNEA 5KFXA 4BWMA 2ASJA 2VV5A 3T5KA 5E3QA 1S1VB 3I4HX 4QIEA 3PACA 2BVZA 2IBOA 5FIIA 5E5NA 1IBMF 4PWDB 3LWMA 3MOJB 2UUWA 5A6PA 4DSKA 1SV5A 1VQOS 2ZDOA 5HMXA 2XCAA 2OH2A 1QE1A 2HWHA 5CXTA 2B4VA 4IRCA 2IM3A 3P3DA 4FPRA 2KT3A 1DQAA 2DNOA 3B8HA 2A18A 1VLYA 1YJRA 4M63A 4A8QA 4YQWA 1C0TB 2CPFA 2F8EX 2I9SA 3OUYA 3MECA 4WFNQ 1ZAXA 4QWDA 4C3MA 4G3IA 4HTIA 2L9WA 4M95A 4KGKA 2R7WA 3V6HA 5KFYA 3WDOA 4PRFA 2MJNA 2FGCA 3RRHA 4DFMA 1NK5A 4J9RA 1X4HA 2D9OA 3VR1A 5BYQA 2VG6A 1HWKA 2K2PA 2ZH9A 1DTQA 2F9DA 2LA4A 3BO3A<