3B4MA

Crystal structure of human pabpn1 rrm
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
b'ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and possible dimerization of the single RRM of human PABPN1
pubmed doi rcsb
molecule keywords Polyadenylate-binding protein 2
source organism Homo sapiens
molecule tags Rna binding protein
total genus 19
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3b4mA00
2MJNA 4Z2XA 1VBZA 3ZZZA 3G4SS 2OSRA 3HHNB 2L41A 1NJIT 2HZCA 2KVIA 2CQ3A 3VAJA 2DHAA 2A3JA 4WIIA 2NLWA 2ERRA 3TP2A 5LXYA 2CQDA 4IOCQ 3UE2A 2RU3A 3G8TA 4V19X 3CTRA 3RW6A 1KOHA 4M5DB 2MQQA 3ULHA 3G6ES 4FXVA 4QPTA 3UCGA 2YH1A 2RRBA 2I38A 1N52B 1S79A 3CCES 1X4AA 1M1KT 4IO9Q 3MOJB 2AYEA 2SXLA 1OIAA 2E5GA 3CCRS 2OTLS 5FJ4A 2JVRA 2DH7A 4U67Q 2NZ4A 4PR6A 2D3OR 1A9NB 1DHMA 1WEYA 1VQMS 2OTJS 1WG5A 2XNQA 3US5A 2ADBA 1VQKS 1VQ4S 2KRRA 1CVJA 2XS7A 3H2VE 2CQBA 2LQ5A 1VQLS 3CCJS 2DIVA 2MYFA 2VONA 1S72S 2M52A 2M88A 2DNKA 3MUVP 1FXLA 1JJ4A 1QVGR 1WF1A 2F3JA 4CIOA 1UAWA 1QVFR 2LMIA 1VQOS 1H6KX 1H2TZ 2MKJA 1K8AT 2MZSA 2MJUA 2J8AA 5DDPC 2ZJRQ 1UW4A 2DHXA 2MZRA 1SJ3P 2MMYA 3VAIA 2KH9A 1U1RA 1WG4A 3G8SA 1N8RT 3P6YC 5LJ5Y 3CCLS 2XB2D 3PIPQ 3BO3A 2DGTA 5GAGU 5LSLA 3VAMA 2CPEA 2CQ0A 5GAHU 1WWHA 3BEGB 1X5TA 1WHYA 2QEXS 2DNPA 2CPIA 2DGSA 1U1NA 2MKHA 3U1LA 2M2BA 1D9AA 3FEXB 2CPDA 1PGZA 3K0JA 2MZ1A 2LXIA 2LECA 2DNMA 3CC4S 4PRFA 2X1GA 4C7QA 3G71S 2CPZA 4J5OA 3L3CA 1VQ7S 4EGLA 1Q7YT 2RT3A 2CPXA 1ZH5A 1PO6A 4F02A 2FHOB 1SJFA 2DGUA 1U1KA 1OO0B 1YWXA 1H2VZ 3R27A 2M4MA 2LCWA 2DH8A 1X4BA 1X5PA 2F9DA 2MB0B 2LXUA 1URNA 1HA1A 4QQBA 2N7CA 2U2FA 1DBDA 1YTYA 2N3OA 1U1PA 2KXNB 2EVZA 3MXHP 1FJ7A 1DRZA 5LSOA 2CPFA 2VOPA 1DZ5A 2LEAA 1M5VC 1F9FA 1KQSR 3MUMP 2HVZA 5IM0B 2U1AA 3SDEA 3UCUP 1G2EA 3HI9A 4C0OC 4CQ1A 1RK8A 2KM8B 3VAHA 4CH0S 3P5TL 5LJ3Y 1WEXA 1WTBA 1FJEB 1FJCA 1VBYA 5JVHQ 1YI2S 5BJRA 2J0QD 1WELA 2E44A 2CPHA 3D2WA 4OZ1A 2M8HA 2YTCA 2PEHA 2JRSA 3P3DA 5CA5A 5DM6Q 3EGNA 2MKSA 2UP1A 3VAKA 1U1OA 2EK1A 4TLQA 4LJMA 2RS2A 4UY8T 2RQCA 2RQ4A 1WI6A 3PIOQ 4BS2A 2CPYA 4YOEA 1X4HA 2LYVA 3CPWR 4FXWA 1K9MT 1U6BA 4IOAQ 1X4CA 1WHXA 2MQOA 5CYJA 3UWTA 3LPYA 3THTA 1RKJA 3NNAA 5IQQA 1FO1A 3CULA 2G1DA 2MSTA 3H2UB 1N54B 1M90T 2DGOA 2KN4A 1XN9A 1Q82T 2YH0A 2J76E 2X1FA 1M5PC 2HGNA 3OW2R 2CQ2A 3NS6A 2KM8C 1VQNS 1VC6A 1ZZFA 3CXCR 2DNZA 1X4GA 4WFNQ 2GHPA 3S8SA 2MY7A 1R8PA 2K3KA 1R8HA 1B7FA 3MD1A 2VOOA 2CQHA 3MUTP 1VC0A 3VF0B 4CH1A 4YUDA 3CC2S 3Q2SC 5GVQA 3UD4P 3UCZP 3RW7A 1Q81T 1WHWA 2DNGA 2HGMA 2PE8A 4F25A 2KHCA 4QU7A 3V4MA 2JX2A 2FY1A 4TU7A 3I56S 2D9PA 2DGQA 2KG1A 2KI2A 3SXLA 1X5SA 1U1MA 1X4DA 3VAFA 2L08A 4A8XA 2MQLA 2MQNA 2D9OA 3TO8A 2HYIB 2O3DA 4ERDA 2Q79A 4Y0FA 1WG1A 2ZJPQ 1KOOA 2QA4S 2DO4A 1FT8A 2L9WA 3BO4A 1WF2A 2MZJA 1VBXA 4PKDB 4WFBQ 3CCQS 1HD1A 3NNHA 2RVJA 3VAGA 1SJ4P 2K8GA 3THPA 5ITHA 3G96A 2KFYA 2RUGA 5LXRA 3IWNC 3CMAS 2M7SA 5D78A 2KYXA 2B0GA 1U1QA 5HL7Q 5CXTA 3DXBA 3R1LA 2E5JA 2AD9A 4TU8A 2X1AA 3ZZYA 1U2FA 3DLLQ 2CQ1A 2KXFA 1X4FA 2MXYA 1OPIA 2OSQA 3CCUS 2M9KA 2MPUA 1X4EA 2VODA 2KU7A 1WF0A 2DK2A 2DITA 2KRBA 3P49B 4TU9A 2DNOA 1K73T 2XS5A 4RU2A 5DETA 2FC8A 1YJ9S 3CCVS 5IFMA 2XSFA 3VALA 2DNHA 1ZZNA 1N88A 1SJQA 2E5IA 3R1HA 2EK6A 5MLCV 2DGVA 4QU6A 2DB1A 3S01A 5DDRC 2X1BA 4ZKAA 3NS5A 1KD1T 2MQPA 3IRWP 1VC5A 2CQIA 2JWNA 3FEYB 1KC8T 3MDFA 2LKZA 2FC9A 1X0FA 2N82B 2MGZA 1VQ5S 3SMZA 5EN1A 1L3KA 1VQ6S 3TYTA 1A7GE 2LEBA 1U1LA 2AYGA 4LIRA 2G0CA 3MD3A 1Q86T 4UQTA 2CQPA 2DGXA 2KG0A 1M5KC 2MZQA 1UP1A 1WI8A 3S7RA 2G4BA 4C4WA 2GO9A 2MSSA 5GMKa 2I2YA 5H1SV 1U6FA 2RRAA 1D8ZA 1HD0A 5DDQC 3Q2TC 2CQ4A 1BY9A 2DH9A 2XNRA 3CC7S 3CD6S 2XS2A 4OZ0A 2YKAA 3B4MA 1YIJS 3CUNA 1FNXH 1WEZA 5IM0A 1W2BR 1HL6A 2JVOA 3BO2A 2DNYA 2DNRA 2CPJA 2AYBA 2MY8A 2DHSA 2DHGA 2MKCA 3CCMS 4YB1P 3S6EA 5DDOC 1AUDA 1P27B 3LQVA 4Y00A 1P1TA 2ZJQQ 3BS9A 2DNNA 2E5HA 1JJ2R 2M8DB 2FPHX 2MZTA 3U1MA 1M5OC 2QFJA 3CF5Q 2KT5A 3N9UC 1YITS 1IQTA 1VQ9S 4P6QA 2YWKA 2MKKA 2AYMA 3SDEB 2DIUA 2DGWA 4ED5A 5DM7Q 2M0GB 2RS8A 1O0PA 5D77A 1JJHA 4WKRA 2J0SD 2F9JA 2DISA 2N3LA 3G9CA 3MI7X 4WF9Q 3UD3P 1UFWA 2DNQA 2BZ2A 5GADU 3J7ZT 3NNCA 2M70A 2CQCA 1NU4A 1OWXA 1H2UX 4IUFA 2MHNA 4WFAQ 1QM9A 2DNLA 1VQ8S 1NO8A 5HO4A 2MGZB 3J7YU 1YHQS 1JMTA 1SXLA 2V94A 2ADCA 2DO0A 4WCEQ 2OJ3A 2WBRA 3EGZA 2HGLA 4W92B 2LA6A 3I55S 1VQPS 4LMZA 3CCSS 1YJNS 2RNEA 3MURP 1X5OA 2OIHA 5GAEU 3CMES 2CJKA 2MKIA 2BOPA 1SJRA 2CQGA 4W90B 2KXHA 5JVGQ 1WHVA 3NMRA 2LA4A 4F26A 3EX7B 1FHTA 2MQMA 1YJWS 3JB9k 3B4DA
chains in the Genus database with same CATH superfamily
1KQFB 1RTJB 4P71A 3GIKA 4TQRA 2OPQA 4MH8A 1B3TA 2JEFA 2KJWA 2ZDOA 2RSQA 4IQMA 5LXYA 3UDVA 1N4LA 4UOCA 2CJXB 3ICLA 4KKOB 3KDNA 1FJGF 4PCQA 2IJFA 4OZ2A 5KFQA 2CWKA 1S79A 3MR3A 3NL0A 3CCRS 2DJWA 3TR5A 1FVQA 2EFNA 3QGPA 4CLLA 1YLXA 2V68A 4ECVA 1FDNA 3IMQJ 1ZAWA 4DR4F 1JLEB 3W2VB 1TAUA 1KR4A 4QZVB 4PYDA 2R8JA 3LO3A 1S7HA 3HJFA 1S57A 3L7PA 5DDPC 2IRUA 3I9ZA 1S7IA 4LFBF 4DEZA 3K58A 3M32B 2BACA 1N8RT 2YKNB 3ADAC 3DDKA 4CM0A 2V8HA 1JQGA 2DNPA 1ZS6A 4ZCMA 2BE9B 3FRYA 1Y5LB 4YR0A 1YBUA 2Y9HA 2MZ1A 4LBIA 1V3RA 2Z2YB 2E9RX 4GRSA 1RTDA 1S99A 1TFYA 3KLFA 2FHJD 1R8CA 2XEXA 3IBFB 3N6LA 1I6JA 1Y3JA 7AT1B 3DFEA 3RBDA 3IAS9 2AJQA 2IAJB 2JZ5A 3G82A 2DXFA 4XDCA 1O6XA 3WX4A 2N4DA 4ZVOB 4C8MA 4O3PA 1RWMB 3J81Y 2M8HA 1YVFA 2YKPA 5DM6Q 2JOQA 4A47A 3IR5B 1XR6A 3PIOQ 1E6YB 4F0HA 2R2UA 2W1BA 4ZVHA 3T5LA 3FQKA 5IQQA 5AT1B 5H9FJ 1NZ8A 2A1BA 2WOMB 1S0NA 4KFBA 2HGNA 3OW2R 4A8YA 4PQAA 5J2PB 5AXKA 2IRXA 1QJHA 3AOCA 2HBQB 2IC3A 4H4MB 2Z0GA 5KFIA 4K7QA 3BSAA 1WKLA 2P9EA 3DRPA 5HVHA 1BLUA 3PNIA 3BDEA 2L08A 1XMOF 1XMQJ 5KFHA 1S10A 2IYIA 3HT0A 5HMYA 1RACB 2KDOA 4OLPA 2GMLA 3CO0P 4WFBQ 3TWZA 3NRBA 2RVJA 1RSCA 2BRLA 4TVAB 3VCDA 2G9OA 1SCJB 4OZJA 5LMNJ 1R43A 3CJ8A 2QTWA 2YNIA 3KK2A 1FNMA 2YNGA 2V2KA 2KU7A 5DLFA 5HMWA 2BDPA 2KVQE 2XS5A 1YDLA 3Q0AA 3NS7B 4NEYA 2YWWA 3ISZA 4Q43A 2UUCF 1AUSL 1TK5A 1Z2ZA 3D7SB 3NS5A 3CEDA 1BQMA 1R6VA 2AGPA 4RUAA 1XBWA 1SUQB 1TK0A 4ZPBA 5KG7A 1A7GE 2AYGA 1YBTA 3M8PB 2KG0A 1WI8A 1XNQJ 4WPAA 2I2YA 2XHWA 4HH1A 3BZQA 5B0DA 1UA1A 3SBMA 2RAQA 2QO3A 3CC7S 1LW2B 1MU2A 3DOKB 3EZOA 2Z56B 4PWUA 5G0RA 1WC6A 2Z2LA 3PTWA 3MM8B 2K7JA 1EHWA 3WIUA 3DOLB 1BXNA 4YB1P 1P9YA 1FX2A 2GAGC 3CDUA 2NUUG 5HROA 3Q8RB 2FZCB 5HMZA 2D1CA 3MMBA 1WC1A 3PVXA 2F1FA 2GA7A 4OL8A 2CNOB 1VMBA 2XMAA 2V0NA 4DS5A 3L09A 3OR2A 1PAEX 1X9SA 4X64F 4Y2KA 1NU4A 3AFGA 1VJQA 2K1RB 3J7YU 3N0VA 1HWKA 3H42A 3DKDA 5IT4A 1OY6A 4DR7F 4IFVA 1Y9OA 2CQGA 4AXJA 5KT4A 3BGOP 2G0IA 1REVA 2ZBRA 4YQWA 1U2RA 3MMCA 1NZAA 3WBZA 4HLBA 2E1MC 1S1UA 4PXBA 4WFXA 4E8UA 4FVMA 1F2GA 3CTRA 2JLEA 4QCLA 1TUWA 4AUKA 3CO9A 1GXLA 4DSIA 4IO1A 4C97A 1B4SA 4EZ6A 4NRUA 1M1KT 2SXLA 4YS2A 2XCAA 2B3TB 2E5GA 1YJTA 3BGFA 4F2RA 3VVTA 1VQMS 5DO2A 1V6HA 3OQ2A 2WB4A 3DHWC 3OUYB 2HURA 4IR9A 1LQ9A 1ULRA 2XHCA 3SSSA 1TV6A 2M52A 4C48A 3C46A 5KFAA 2B6AA 3AXMA 1U02A 4QBUA 4O4RA 3DDNA 2GC8A 1CJTB 4NX9A 2J8AA 2OH2A 5H9FK 2MZRA 2DR6A 4B3OB 2IBKA 3TJ8A 4TQSA 4QIEA 2DGTA 1SC6A 1BUXA 1VRTB 3OFEA 1PYTA 4MKBA 4OJHA 4JI2F 2MKHA 4X62J 2X1GA 1VQ7S 4DQIA 3IS9B 5LM7E 3HHLB 5EWGA 2R7UA 3GU0A 3JQMA 1EZZB 1URNA 2VL1A 2VBWA 1Q8IA 1RUSA 2CPFA 3QJPA 4B02A 3MUMP 3CT9A 4CLFA 1QD1A 3JTNA 4U8YA 4QPXA 2GJIA 3E8OA 1NHVA 1IWAA 5THWA 4LF5F 1FRHA 2C3PA 4IKAA 1QAYA 2XMWA 2OMLA 3EGNA 1NEEA 4ECZA 4MT1A 3BJYA 4LJMA 2R9LA 3A8EA 4DF8A 2F63A 3V6JA 4RW8A 3BBBA 3QATA 2HIQA 1TL7A 3K2YA 3NY0A 3UN5A 2G1DA 3MHYA 4RR5A 3EJMA 4F67A 5CAAA 2V50A 2X1FA 2KM8C 1RDRA 3S8SA 2MY7A 1RTJA 2H3EB 4LRCA 4HYKA 2WBMA 4NLDA 2F5GA 2XI2A 4TY9A 4CH1A 2V6AA 3CJ3A 3IP0A 4NZ0A 3N6NA 2WVBA 3OSNA 2DGQA 4KKOA 1YBAA 3CW2C 1U1MA 2BX6A 5KFWA 5KG2A 1NDPA 3UNYA 4ZMMA 1HWLA 2D9OA 4Y2MA 2ZJPQ 3KMSA 1YZ7A 3KTQA 1FTRA 1T9UA 3IBCB 2XO7A 2IBOA 5T7LB 1YKWA 4A8WA 3GIIA 2B0GA 2WTFA 5HL7Q 1JLEA 3W2VA 5LSRA 2OD4A 3WQPA 4DFPA 4HACB 2QLXA 5IZHA 4K4VA 1Q5YA 5IWAF 3M32A 2YKNA 3FZ2A 2BRKA 3MR5A 1U2CA 3SFGA 1KS2A 1ELOA 1TVRB 2ATLA 5EWEA 1MNEA 2YPZA 1L3VA 1EJ7L 2EFGA 3TUPA 4K4XA 4LIRA 3MD3A 2QYGA 4RUHA 4K5SA 3HX9A 3NEKA 2XCPA 5GMKa 2OPRB 5DDQC 3AB2B 4BC7A 4LFAF 4PG5A 4CLYA 3D3BJ 4O23A 4FN5A 2IAJA 3POTB 3FRZA 2EKYA 1RTHB 2DHGA 4DCJB 5DDOC 3EPGA 2VJVA 1YJUA 2FPHX 2YKQA 2BJ7A 2ALYB 2BKNA 4RX6A 5B0AA 4UF4A 5F0UA 3A3PB 2P9CA 2D3UA 3B54A 2N3LA 3L4BC 5CHCB 1E6YA 1AFJA 1R0CB 1UFWA 1D1UA 4GMKA 3T6JA 4URSA 2HRYA 4J9NA 3HFKA 2FJEB 4O3RA 5KAKA 1F9HA 2WOMA 2YWHA 4WCEQ 4OX9F 1HNVB 2HGLA 3CJ4A 4ZVUB 5J2PA 1TL5A 2ROGA 3AOBA 4ECXA 1H0HB 4H4MA 3ZZPA 2MKIA 4OX8A 1TELA 1N36J 4F26A 3R5BA 3G4SS 2P8IA 3M6XA 1S1XB 2VZ9A 3UE2A 4NLWA 4LRBA 1G6BA 1WOSA 4L3KA 4OHXA 2POKA 5D3GB 3N4WA 3K5LA 2YWFA 2P6TA 1JLGB 4QW9A 4RNHA 1GMUA 4PR6A 1PG5B 2BKOA 4P75A 3KLGB 1SJ1A 1FFSB 3JYTB 4I2QB 1IUJA 2CQBA 1UL3A 2KFNA 1T3OA 2PEBA 1I5OB 1WC0A 3ZZTA 3OTOJ 2HVIA 1SUQA 2V8PA 4ZVPB 3TA2A 1IR1A 4FNIA 4HT5A 3OPKA 1KWMA 2PIIA 4PQUB 3PZPA 1AZSB 4X2BA 3G8SA 1FF2A 1FTCA 3M8PA 3EM1A 4ELUA 2VBZA 3QWUA 1WWHA 3OL7A 3AQPA 2HMIB 3GJRB 3T6BA 3C19A 1RHUB 2B9XA 1FKPB 5ADZA 3AH6A 4N8OA 3G71S 4NA3A 1LW2A 4C8YA 4B9UA 1I1GA 1IR0A 3G8QA 4FS1A 3DOKA 4ILRA 4MIBA 4MYUA 3MM8A 4R8UA 3DOLA 4IR1A 4H4OB 2F9DA 2RDDA 1Q53A 1H3DA 4M5KA 4OI2A 4F4AA 3N6MA 3VWSA 1F9FA 4EBEA 2V2QA 2U1AA 5HMXA 1SB6A 2AF6A 4C0OC 2QA2A 4J9SA 2VKRA 1FKOB 1HARA 2FJAB 3M8QB 3DLEB 1WELA 4OV1A 3J80U 3J7A1 4I7FB 2XI3A 2JRSA 1JLFB 2K1RA 2PI4A 3TUZC 1D9FA 3E2EA 4DU7A 1X60A 3C66A 1OQ3A 2C3MA 2ZNZA 1N32F 2MQOA 4DV7J 1LEOA 1FVSA 3CULA 3MEKA 2AJFE 1ZPVA 1ZA1B 2KB2A 3S1TA 1KVIA 4NMLA 4K4WA 1VC6A 4WFNQ 1VK3A 4RW7B 1D8YA 1DLOB 5KG1A 2EBEA 3Q2SC 2XZTB 3G6XA 2BM1A 2YKOA 4BWMA 4ZVRB 2EBGA 1EP4B 4NA1A 4YR3A 1VJWA 4C11B 4YB5A 2E1RA 2KZZA 2BMBA 4O3SA 3EVWA 3ZXWA 1VBXA 3NGUA 3OFFA 1SH2A 1SJ4P 5CZXA 2KFYA 4C3KA 2RUGA 3GV5B 2XWXA 3CMAS 3OUYA 5JJBA 5KT2A 5L1LA 3ZZYA 3SCLE 2W7AA 3GJQB 3R97A 1WF0A 3IM9A 4IOBA 2Q6CA 1VBKA 1CJTA 3CCVS 2HWTA 2QLBB 1SJQA 1Y11A 1LK7A 4PUOB 5J2QA 4U7UD 1SQGA 3S01A 4B3OA 3Q23A 2B4UA 4OI3A 2MQPA 1C0TB 3FZBA 1UA0A 4N8NA 4JUZA 5IT0A 1VRTA 1X0FA 2N82B 1Q8KA 1UWAA 5KG6A 1WSRA 3D0HE 3IS9A 3M6UA 3QO9B 2EC2A 2E5LF 2VC1A 3WZ0A 1TL3B 2B7BB 5E3AA 3ENVA 2BKPA 3HHLA 4K4ZA 3TAPA 2MSSA 2ALZA 2CJ9A 1RADB 5KFNA 1K0VA 1HR0J 3PW4A 3LAKA 4GKJJ 1X8DA 2KO1A 3BBFA 1LWCB 4Y65A 4OX7A 1S0MA 3D0GE 5KT6A 1NLKL 4DX6A 2HRTA 4B9SA 2OAUA 5E3QA 2RS8A 1MN7A 2HVHA 2BZ2A 5GADU 1F5AA 5L1KA 2AJ2A 3Q24A 3NGTA 1SXLA 1T9XA 2BW7A 2OJ3A 4B9MA 5HK4A 1VQPS 3HSGA 4DHVA 1XTZA 3K8WA 3QIDA 3I82A 4DZDA 5HQ8A 5B0BA 3HKWA 4WIQA 4OFZA 2XMVA 1JNRB 1FHTA 1U24A 4G1QB 3ZC4A 1EAYC 3TAQA 2IMWP 4K8RA 3ZZZA 2CZVC 4V1Ak 2DHHA 5FIIA 1KN6A 1J5OB 2VBXA 3HD1A 2ZC4A 2A6MA 4N56A 1KOHA 5T7LA 3QT5A 5DZ6A 4WK1A 3FFIB 1ZM4A 1J5EF 4JI0F 4PXCA 1HPZB 4WXWA 4HVZA 3DOMB 4HACA 1A9NB 2ZH2A 4X4PA 2ILYA 3TARA 2UUAF 2HG4A 2RILA 1SH0A 1Q78A 4FYDA 2DNKA 4FP9A 5KT3A 3HM9A 3MPDA 1QVFR 1HWJA 4EO6A 4LRFA 1TVRA 3QZ8A 1TMJA 2EWHA 1VIXA 4UOHA 1UETA 3VAIA 4AQYF 3H90A 4ECUA 2YVSA 1I94F 2ZOGA 3PIPQ 4JI5F 1NM2A 2NR0A 4L75A 2OPRA 1VQSA 3M8ZA 4FYYB 3KHRA 3KJVB 2CPDA 1PGZA 2J6UA 1QUVA 3L3CA 2FHOB 1OO0B 4DOZA 3POTA 3MPYA 2D7SA 1H2VZ 4KB7A 3R27A 4HH0A 5A0YB 1RTHA 4UZBA 3GCXP 3OXGA 3DLHA 1MSWD 4ED2A 2LEAA 3BM7A 3PG9A 3D5MA 3KG0A 4QYZJ 2KM8B 2HHPA 3HHEA 3K5NA 4QOTA 4IH5A 4IH6A 2Z8QA 5D15A 1RA7A 3FBFA 4H4KC 1XC9A 1XIQA 2EK1A 5D4PA 4A48A 1HNVA 1DFDA 4DXLA 2F65A 4LVNP 4ENOA 2K3IA 2RHQB 3UWTA 4OYBA 4DDFA 2Y1IA 2VFTA 3I32A 4R0JA 1ZZFA 2ZD1B 4ZIVA 1S1XA 4A8KA 3IN5A 2XTJP 2RF2B 1RI7A 5GVQA 3RW7A 2RHSB 2M3DA 1LW0B 2HZAA 4LFCF 1RT1B 3OXLA 2XZWA 4FF2A 1C4CA 5D3GA 2FJWA 4C8OA 2ZKUA 1TAQA 2XYGB 2BJ1A 2PD1A 4KHPF 2WAQD 2CDRB 3KLGA 1XNRF 3JYTA 5LXRA 5B0FA 2D69A 1NSAA 4I2QA 5K20B 2X1AA 1P8GA 1D9DA 5DGAA 4U8VA 4NLRA 2KRBA 1NMEB 5IFMA 4LRAA 1JKHB 1UPPA 4PQUA 1MLAA 1AZSA 4X4OA 2CNNB 4U6PA 3FSIA 3A12A 3EXCX 4ANCA 1FRKA 1S76D 2FJBB 1U7LA 1FRJA 1UPMB 2HMIA 3MDFA 2AZ1A 1XWLA 4HL9A 5ETNA 2LKZA 2COLA 1FKPA 1UVJA 2K7KA 4ZPTR 3M8YA 5F41A 3W5XA 4ZLNA 2NQPA 5KTQA 4H4OA 2VPYB 1IBMF 3Q2TC 2XNRA 5J1PA 1RA6A 3J7YI 2BQUA 1UJ6A 1RTIB 3D67A 3CUNA 4E0DA 3PRBA 3BSOA 2NYIA 3MTJA 2JVOA 5BYRA 3GONA 3ILIA 3EUNA 2J8SA 4FYWB 1FKOA 1HQ2A 1KNZA 1IVZA 1P1TA 3M8QA 3RRGA 3DLEA 3FCWA 3M9MB 1VLOA 4Q8FA 4I7FA 4P6QA 2V8GA 2EEYA 1JLFA 3ZNUA 3DN9A 2F9JA 2BQRA 4ZLPA 3A8JA 3R7SB 1QTNB 1FJGJ 3GR0A 4WE1B 1FXRA 2HNYB 4PPDA 1EX8A 3LW5C 3Q8YA 4I4BA 3HK2A 4W92B 1B0VA 1WDTA 1FEEA 5ETMA 4RW7A 1DLOA 2BOPA 1BC6A 4B9LA 2DEJA 4JV5F 3R6GB 4DR4J 3H4DA 5D8HB 1RT5B 4ED4A 3ETMA 3P4UB 1RWVB 1EP4A 2MJNA 3EXYA 4D3GA 4C11A 4ETZA 3OL8A 5ETVA 1NJIT 2MQ8A 4P2SA 2O66A 5K8NA 2BANB 4LFBJ 2CQ3A 5B0GA 1CC7A 4OYMA 2KL8A 4QWEA 3QGGA 4FPIA 3ULHA 1NPKA 3QWPA 4QYZK 1AFIA 4MK9A 1RWWB 1CBKA 4DPXA 3AD7C 1KLMB 2IIHA 4DL2A 2AHOB 3O2IA 2NZ4A 1A6LA 2HSEB 4ED7A 2OTJS 3US5A 2HNDB 1AT1B 1VQ4S 2HHQA 1S6OA 4J9MA 4WJBA 4PUOA 3OV7A 2VONA 2Y1RI 3MPVA 3CMQA 3LP1B 3O5TB 3T5JA 2LEPA 1NJWA 1C0TA 3CJ0A 3JAMY 1Q4RA 2ZOMA 2LMIA 4NI2B 2ZJRQ 4Y2IA 5KOWA 4RNFA 1SKRA 1YG0A 2A2CA 3QO9A 2V34A 1TL3A 3HP6A 2CQ0A 2WRMA 2A6OA 2OD6A 2BE7D 3KUHA 4KT0C 2RQKA 4XO0A 4I0WA 3UD5A 4ILMA 3DRRB 3PR4A 4B08A 4NL5A 1W25A 4PXEA 1I3OB 2J9CA 4QYRA 2LDIA 4CLSA 4JV1A 4M5GA 3QBCA 2DEIA 1LWCA 5M2RA 1HA1A 2N7CA 4JI8F 2EVZA 1PJ5A 4EBCA 1XEZA 4ZITA 2H65B 3UCUP 2E9ZA 2HRUA 1YSJA 1VQYA 4CH0S 1V5VA 3P5TL 1T9YA 1IWGA 2OPSB 3D4JA 4MK7A 3VZIA 5JVHQ 1YI2S 3D6HB 3BPDA 2JHEA 1XMOJ 4A8FA 2IM1A 1U47A 2PEHA 3CSKA 5C5JA 2PGCA 1UKUA 5DG9A 1K9MT 4IOAQ 1SBRA 2YKMB 4KTQA 2GVDB 4A46A 3R8YA 4QR1A 2WVFA 2BJDA 2W7OA 4YY3F 2DGOA 4NYZA 4OQJA 2KN4A 4G1QA 2D74B 3W1YC 2GHPA 1CJUB 3MM7B 2CQHA 2UUCJ 3T19A 1J5OA 5CD4H 1TUVA 3DLBA 5JUMA 3UDEA 5KFBA 2KI2A 3FFIA 3ILLA 4ZN3A 1UEVA 1B70B 2GIQA 4MYTA 3MMJA 3JSMB 2NXJA 4LIWA 4OJ1A 2YNFB 1HPZA 5SZTA 1WC5A 4J91A 3PX0A 2WB1D 4MKAA 1HD1A 1RAJA 3DOMA 1IM6A 2WCXA 3HXMA 1PBUA 1VIOA 2QL7B 1H7WA 2OSQA 5D4NA 4ITSA 3CCUS 2IM2A 4TKTA 4XIUA 3NCRA 2DNHA 2Y1LB 5MLCV 3DHXA 4WXOA 4LF9F 2DR5A 3N5FA 5DDRC 1U25A 4B9TA 5L1JA 3HKZD 3FEYB 3KUGA 1RT2B 1B64A 4RW9B 2MGZA 1WNEA 3CDWA 3RU0A 3KJVA 4X4NA 1UEUA 5CABA 4X64J 2ATCB 4LQ9A 1TUGB 2V9KA 4OZ5A 2F40A 3UR3C 5A0YA 1RE1B 3J7Z5 3QRQA 2X3GA 3MEGB 3BPSP 2FB0A 4QWBA 2V4QA 4K5RA 4DR7J 3CDEA 3GIJA 5L8RC 2H48B 2UZAA 2L9DA 3RAXA 4HTIA 2DD8S 1MMLA 2V8DA 1HHQA 2XMUA 4ER8A 3T9ZA 4PYAA 3MAQA 3DI6B 4DSKA 1UTAA 3MI7X 1NSKL 3H25A 1UFKA 3GTYX 4FF4A 1BQNB 3PCOB 1ICEB 2CQCA 2RQMA 5E7OB 4GC6A 1UMJA 2DNLA 1R8BA 5K14B 4FBTA 3KDOA 2K2PA 3FBCA 1F3VA 3R5AA 4LMZA 1CQNA 4ECYA 4RWWA 2ZD1A 3M6WA 4CNZA 2OIHA 2NREA 5J2MB 2HS4A 5KFJA 2RF2A 4B3SF 3PY8A 4NXMF 2HFOA 3TW0A 4A8QA 4WU3A 3GV7B 2IA0A 1LW0A 1RT1A 4LF1A 3SCIE 1KHWA 4YFUA 3WC0A 2ZWPA 3PO4A 2RU3A 5HJXA 1RWNB 4J9QA 2YNHB 4X4VA 1ZETA 2HBRB 3G6ES 1RBOB 4QPTA 2CADA 4JI2J 1KQGB 4O44B 5M2UA 2ZWOA 3MOJB 1RU1A 3A8IA 2FVRA 1NJZA 4CNYA 4ATNA 4C2MA 2KRRA 4CLUA 3OLAA 1JKHA 3PW0A 5K8MA 2KZMA 3AAWB 1JXLA 4L72B 3ENQA 1MMNA 3MUVP 3PW5A 1T94A 1QVGR 3ITHB 1X7VA 1H2TZ 1RCXB 4I2PB 1K8AT 2W01A 3CCZA 2PC6A 2XB2D 4KGKA 4P52A 4LF5J 3AODA 5SUHA 3VAMA 3Q86A 2OPQB 4O4GB 1D3WA 2YWGA 3H2LA 3NBPB 2C3OA 3OTEA 3P5BP 2LXIA 4UUXA 3O6QA 2UUBF 1RTIA 5E33A 1ZH5A 3MEEB 4DR1J 3EYZA 2CAJA 4M1KA 2YPYA 2F4VF 3TVZA 1RYRA 3ILOA 1U1PA 3PHEA 3R7BB 4GKKF 2NUHA 4J37A 1FRLA 4DV3F 4OX6A 4RWXA 3HI9A 3V6HA 4FF3A 3VAHA 2C42A 2PMHA 7FD1A 5EX0A 2KTQA 2L48A 2XYPB 4WE1A 5KFXA 3TZWA 4WKYA 1M0SA 4MKVA 4ZP7A 8ATCB 2HNYA 1WKKA 3OHAA 4LRDA 2RQCA 1HBOB 4ZVGA 4M5NA 2LYVA 1RAGB 3LPYA 4DR5F 1ZM2A 3ET6B 3Q8UA 1RT5A 1LKZA 1XN9A 1Q82T 2GS8A 1VQNS 2DNZA 1X4GA 4EBDA 4JI4F 1EETB 2VOOA 4OYIA 2BANA 5IWAJ 4YUDA 2OPPB 1DY3A 1GTHA 2AX0A 1P1LA 1FX4A 1X4DA 4AT1B 4UT4A 4KO0B 2CZ4A 4DSLA 2B56A 3TVKA 5HI7A 1O8BA 4DX7A 1KLMA 3BN4A 4IH7A 3FSYA 5AE3A 1UFLA 4RW6B 3LP0B 1ZM3A 4WYWA 5K9FA 2HNDA 1X9MA 4LFAJ 5I3UA 2KXFA 2UVVA 3JAMU 2VODA 4K50A 3TOQA 3WC2A 5C25B 1E6VB 4NI2A 4LBHA 1V3ZA 3W9IA 4QU6A 1PJ7A 4X4UA 1KD1T 2FJVA 3SQGB 2KT3A 1SPBP 2FVSA 4Q44A 1C1BB 2GV1A 1URRA 3DRRA 1VQ6S 3TYTA 2APOA 4ID8A 3BSNA 1FRIA 4ZHRB 2UXDF 3MR6A 2IJNA 4LF6F 2JLFA 5GADI 2CNLB 2RRAA 1D8ZA 4OX9J 4EMDA 4K4YA 3ZZ0A 3CD6S 5I3QA 1FNXH 1WJ9A 5A8WA 1W2BR 1IBLF 1Y7PA 2OPSA 4ECRA 2LXFA 3S6EA 3QJLA 4NEZA 3IWXA 2PT0A 3TA0A 1S1WB 2PI5A 1RLCL 4I64A 3RGIA 3RZAA 1S77D 3R3TA 2VG7B 2LVWA 2B51A 4DL6A 2DY9A 2YKMA 2GVDA 1N0UA 1RGVA 2DO0A 1U8SA 3MM9B 5B08A 4WTOB 5L9NA 3OTDA 1CJUA 3MM7A 1H98A 2R8GA 1N5TA 2EFPA 1LWFB 4DBQA 3EX7B 2W2PP 1YJWS 4J9UE 5C24A 1U0HB 1VBZA 4WP3A 3TANA 1X0PA 3A3OB 3OVSA 2HHHF 2PMWA 4XK8C 2Y8YA 3HFZB 3JQKA 3AD8C 3JSMA 2YNFA 4V19J 2AX1A 2CKWA 3W5YA 2HFUA 2QA1A 1JLQB 3UCGA 2W2MP 3HHLC 1RYSA 2AYEA 1RAHB 3ZZOA 2DH7A 2W4PA 4DJBA 3AJ2A 4CLZA 3IC1A 1RBLA 2B8QA 2Z2ZA 1AROP 2MYFA 1Y10A 2HK3A 4LSZB 3TX0A 5DLGA 4JB8B 1RT2A 4JI1F 4NLTA 1UW4A 4RW9A 2DHXA 2FJDB 4CLWA 4USIA 5B7WA 3T1AA 4LF7F 4QIVA 5J1EB 4CT8A 2BYCA 5GAHU 3IR7B 2KYZA 4OLOA 4FYXB 2ZH4A 4X4RA 1JLBB 2LQBA 1S1UB 1NSQA 5F8MA 1QSYA 4DFJA 2DPIA 4PRFA 4USUA 4KE5A 3MEGA 3M4XA 2ZBCA 1N32J 1HQEB 4FXDA 2Z2MA 4UY85 2PA8D 4NXNF 2OFHX 4NYPA 4I6AA 3AQOA 2R7RA 2QZ8A 3C14B 4ZPCA 3DI6A 5IM0B 1N5YB 1G2EA 1ACMB 1SVDA 5KFSA 1R27B 2Q1LA 1B99A 4KQZA 2V2ZA 4ZP6A 4G1IA 2E44A 3KOAA 1BQNA 1Y00A 4Y3CA 4F36A 4QW8A 2NXUA 3OBIA 3T9NA 3BGRB 1U1OA 2R8KA 2B9EA 5K14A 3M30B 4MJKA 3BKFA 3NCQA 4EYIB 1PCAA 3IWLA 4YOEA 4C0HA 3TRGA 4NZ6A 2ZH1A 5J2MA 2QLJB 3H2UB 3L7UA 2ZHAA 2NXEA 5E41A 1YJRA 4HEA9 3HHLD 3QMQA 1R8PA 1R8HA 3FVYA 1WTFA 1U26A 3MUTP 4DV0F 4K0KF 4OJGA 3GIRA 3IGVA 4ZPWR 4A8MP 2PO4A 3PM9A 4C3MA 2YNHA 3QT8A 1DQAA 5KFGA 3ZTRA 3T1HF 3V6KA 3RB3A 3TO8A 2VD3A 2HYIB 2KFZA 2E5LJ 3TQEA 3AD9C 1QY7A 4LF2A 5CQGA 3THPA 5HBMB 2BXJA 3KG4A 2KKHA 2CQ1A 2Y0SD 2MXYA 1KVKA 1OPIA 3W3SA 2ASYA 3NCPA 4OHWA 3ITHA 4RW8B 2V5HG 4DN9A 4I2PA 2XMMA 4LR7A 3UVJB 4ZJQA 1ZZNA 1IXKA 3GYGA 1TU0B 3BB5A 2Z4PA 2RB7A 3LGMA 3IRWP 4OI0A 4OV6A 3D28A 1YQHA 2JWNA 4URGA 4O4GA 4UQGA 3LA0A 2AGOA 3NBPA 4K4UA 3HHDA 5IS2A 1F2HA 4H4KA 1OMSA 4KGMA 2B7CB 1Q8LA 3MEEA 9RUBA 3TEGA 5FLXY 3K57A 1IBKF 1HNXF 3OJUA 3BQ1A 3CD5A 2N7YA 1RISA 4NLUA 3A4TA 3V5RA 2HVDA 3P45B 5HP1B 2DNNA 2H1YA 2ZH8A 1CJVB 4NPOA 2DIUA 2GMJA 4FZVA 1R0AB 1S49A 1S9EB 2UU9F 1HFEL 1PJ6A 1HBOA 1PKUA 4F0MA 4C8NA 4H54A 5A2QU 1J5EJ 1CPZA 4GC7A 3A8KA 3ZTOA 4OI6A 4CWBA 1VQ8S 3ET6A 1JMTA 5J2NB 1KTQA 2LA6A 3GZ7A 4HT7A 1F6TA 1EETA 4CRJA 2C2ZB 2UUAJ 2OPPA 3NMRA 1SC3B 2ZZMA 3VHQA 2MQMA 2CJQA 2QN6B 3OD2A 2C2NA 3U02A 2BV3A 2L41A 4KO0A 5F8IA 4WIIA 1HBUB 2DT9A 4AQYJ 5D0HA 4JI7F 1I94J 3VGTA 3MR7A 4C3LA 3Q8QB 2UV8A 2G2YA 3RW6A 3DU5A 1FNOA 3GFHA 4JI5J 4RW6A 3LP0A 5M2PA 5F3TA 2VA2A 4ZJOA 1IQZA 3I0RB 4JOUA 4U7UK 3NGKA 2E7WA 4X84A 5C25A 4J9LA 4DF4A 1E6VA 2R2RA 3MAHA 3JTPA 1JXEA 3H2VE 1VQLS 4JI3F 2LQJA 2DIVA 5H9EJ 4OI4A 3SQGA 4BCAA 1JJ4A 3KKFA 2ZKTA 4CIOA 3EGVA 3F44A 1RU2A 3W9JA 2GHWA 3GIMA 1C1BA 2MZSA 5DRKA 3QPIA 3D6MB 2G13A 2MMYA 3OR1B 3C15B 2JFDA 4F4XA 2I1RA 3GE9A 4RNNA 5GAGU 2GVZB 4ZHRA 3MCOA 2E1CA 1UZDA 4TYBA 3R5JB 1UWBB 5HLFB 1BHNA 5DZ7A 2ACMA 2CZ9A 2R4FA 4X65F 2CPZA 4RBUA 2RT3A 2CPXA 2IRYA 3D3CJ 1U1KA 2DGUA 3RYLA 1ZAVA 3UPFA 1RHMB 3KHLA 1REGX 4PPZA 4XTTA 5EUHA 2Y3YA 4DU8A 1Y0HA 3E01B 2V9WA 4DR2F 2VOPA 3CD7A 4B3TJ 1S1WA 3W64A 3SYZA 3EGWB 3QLHB 2ABYA 2VG7A 4CP5A 3EPIA 4LFCJ 2OHDA 3E51A 3WHIA 1AB8A 3F41A 1RHRB 1S59A 2HWIA 3D9BA 4KHPJ 1WOPA 3MM9A 4MFBB 1Z1ZA 2IVMA 2XMTA 3SIPB 1XNRJ 1WHXA 2GIRA 4C8LA 3NNAA 3FCVA 4LVOP 1LWFA 2YH0A 3NS6A 1U0HA 2MLXA 4J90A 2GQCA 4R8UB 3AJ1A 3CC2S 1GK8A 2PE8A 2KHCA 3JQJA 3RG6A 3HSDA 2FY1A 1UVMA 2D9PA 4L73A 4OYZA 4CO3A 1UW9A 2R7SA 5KFRA 2HHXA 1JLQA 2MEWA 1SL2A 2Q79A 1WG1A 1KOOA 3H98A 4MTPA 1LWXA 3X3UA 1H74A 3NGRA 2BW2A 3KLVA 3OT9A 1IBMJ 3DXBA 3B78A 3U27A 2ZH6A 2AD9A 3WIVA 4CLKA 3SCJE 2R2TA 3HCXA 4PG4A 4UTGA 1NSPA 2NCKL 1YJ9S 3DRSB 1KKHA 1S6QB 3MTKA 2ROEA 5EWFA 2C2EA 3W9HA 5J1EA 5CZVA 1KSPA 1QUPA 5IOLA 2HLUA 3IXQA 1JLBA 4BHQA 2HKEA 4HKQA 3HFVA 3IBWA 4IFYA 1FD2A 1Q86T 1S1TB 1HQEA 5IV4A 5HSPA 1PILA 2G4BA 3IR6B 4E2FB 1VFJA 3MFHA 3PX6A 5IT9U 4WZQA 4KV8B 6AT1B 4DFMA 1EIYB 2HHUA 4DQSA 2C2MB 3HD2A 3C14A 1T02A 3H5UA 4OYWA 5IM0A 2CA9A 1N5YA 4JV5J 2HWHA 8RUCA 3BO2A 2YBVA 3UDCA 3LOUA 3K17A 3ZTPA 2ILZA 5HATA 3TQ1A 5E2QA 3CF5Q 2KT5A 1YITS 2P5VA 2Y8WA 3BGRA 1Y3KA 3M30A 1O0PA 3G6YA 1T0TV 5J2QB 5H9EK 1SIZA 1U45A 1WKJA 3HSJA 4RNMA 2M70A 5LL6d 1H2UX 1O5JA 3SZ2A 4RLEA 3PYFA 1TTHB 1VR6A 2WBRA 3I55S 5AE2A 3L9ZA 2Q66A 3CJSA 5GAEU 2VBYA 2WVCA 3DCAA 3NAIA 4USMA 3KLIB 2YX7A 2VQFF 3TA1A 4IRKA 4F3QA 3W5ZA 3GB0A 2VASA 5KFTA 3OVAA 2QG9B 4M63A 4Y34A 3M9NB 3N5BA 2ERRA 4U9RA 4F4YA 3CNQP 1F0XA 3TUIC 3TX8A 5J1NA 2B43A 2C22A 4FBUA 3GYNA 5HBMA 2MQQA 3RRKA 5G4DA 2HZVA 4OI1A 1N52B 3CCES 1IN0A 4DPOA 1LNQA 3TJ9A 3DYAB 2JVRA 1GMWD 2WSCC 1HLWA 2UVRA 2AQ4A 2XNQA 1VDHA 3UVJA 1H73A 4JI8J 4JV2A 1IM4A 2ASJA 2I5JB 2L3MA 2YX4A 3UN3A 3THVA 4U96A 1GX6A 2YX1A 1VQOS 4M8LA 3HHKA 2HIYA 5AJ3F 2WVEA 1NH7A 2VFUA 4U95A 3M9OB 5CYQB 5LJ5Y 3BO3A 4XPCA 3GPAA 4LR8A 4U7CA 3BF4A 1WHYA 3VV2B 2EI5A 4F50A 2FYXA 1U1NA 2CVEA 2ZITA 2LECA 3QRPA 2IHR1 2XGPA 4EGLA 1SJFA 4JP8A 4KRWA 1RABB 3MAAB 4YY3J 2GGPA 2GAHC 5HP1A 3RUBL 4CLTA 1NJXA 1VOMA 1DZ5A 3A1YG 2FY8A 5T14A 1CJVA 2V4RA 2Z58B 3DMJB 4P74A 1R0AA 2JNJA 1S9EA 1Y5NB 4K2XA 5LJ3Y 1FJCA 2IJRA 3BBCA 4PZVA 1SL0A 4DG1B 2CPHA 3QSIA 1VYAA 3UR0A 2W9AA 3P3DA 1WC3A 2MKSA 2UP1A 1BD6A 5J2NA 2RS2A 3CGIA 3R2CJ 2BOAA 4FXWA 4ES3A 4DL4A 2O1PA 4KC5A 4YB6A 3C3LA 3MEDB 6FDRA 3NOCA 1WOOA 1S6UA 1HBUA 1IR2A 3ZTSA 3ENAA 1WHWA 2DNGA 4LF9J 2R7QA 1JK9B 1MMDA 3KUEA 3U1NA 4YEAA 4R0EA 4KPCA 2NS1B 3J81U 4NLGA 1T95A 2MQLA 5T41A 4ZCLA 3I0RA 1I51B 2MZJA 3MM5B 3MOZA 2I9SA 4QIGA 2AT1B 4DUZF 1RAAB 4WFZA 2J0WA 5AXNA 2M7SA 3ETOA 3FNNA 2E5JA 4TNOA 4ZA1A 4OHYA 3RJMB 4RBTA 3NGDA 3H5YA 1UJ5A 1L3TA 1PC4A 2QIFA 2HHSA 1XMBA 3C6TB 3OR1A 1MG7A 4N76A 3C15A 1OJ4A 2B9WA 2B9YA 4I67A 2GVZA 3IAM9 1OY8A 3UQSA 4RPFA 4ELVA 3RR7A 1UWBA 5HLFA 2GZOA 5EN1A 3JSBA 4NLSA 4ZJLA 3TVYA 2XYHB 1K44A 4NLPA 2VQEF 3DLJA 3HZEA 4MK8A 1KBRA 1SQFA 3E01A 5LOQA 4ZVEA 3B4MA 1HQUB 1U6ZA 4B3SJ 2XMKA 3T1YF 4NXMJ 4HDHA 3QLHA 3PRDA 3Q89A 3A3NB 1N6QB 4OZNA 1AUDA 2ACYA 4Y00A 2ZM6F 1TKTB 2MKKA 3SDEB 3R6LB 1EQ0A 4ECTA 2AZ3A 2CDQA 4RL1A 1AW0A 2CJYB 3GQCA 1OYEA 4ETXA 4YB7A 2FVQA 4WF9Q 3G9CA 4MFBA 4B3RF 4DS4A 3UD3P 4HHHA 3KJNB 4ECWA 4X66F 1NPPA 4NLQA 5KFKA 2DCUB 3EZUA 4RUBA 2HHTA 1NKEA 2CJBA 1M1GA 4KH0B 3CVKA 1YJNS 5C7PA 4AE5A 5CCLA 3CCTA 2CJKA 3CJ2A 1CSJA 1GX5A 2IM0A 3HVAA 4ICLB 1Q95G 2J6TA 1XERA 3IO1A 5KFFA 1DQ8A 1HNIB 1S9FA 3JB9k 4LF4F 4EO8A 5IC4B 4AXIA 2JDJA 2DHAA 2CWXA 3EE3A 3VGUA 4HI2A 2UXCF 4YP3A 1WSVA 2PN6A 2J7KA 1RBAA 3RB0A 5GAHI 2CRLA 2FJXA 4F4KA 2H5IB 2UUBJ 2JL9A 3CJQA 1OPZA 2D3OR 2XMJA 4L76A 1N33F 2BJ8A 2F4VJ 2C28A 3DRSA 4NA2A 2JSXA 2VFVA 1S6QA 1EQMA 3CD0A 4KJIA 3VTIA 4GKKJ 4AL7A 2GIFA 1XQIA 1UEKA 3RB4A 2OI2A 1WG4A 4NLYA 1CJKB 3W8PA 4CO0A 3P6YC 3CCLS 5I3PA 4O3NA 1UZHA 3ZO7A 1S1TA 1ZTWA 2AEMA 4NZ7A 2MDAA 2W8KA 4ED8A 3IFEA 3PRVA 4J9KA 4RW4B 4KV8A 4WK3A 2Z30B 3NWGA 2GMHA 3QYYA 4DR5J 4RU9A 2WW4A 2F8EX 4XDDA 2RRNA 1X5PA 4ZIWA 4PWWA 2R7OA 2J9DA 2XLKA 1F5BA 4JI4J 1FJ7A 3MXHP 4FKXA 3LGHA 2H5EA 1OY9A 3FKBA 3L7OA 2D41A 4FDFA 2QRRA 2J5AA 5D4OA 3GFZA 1NDCA 4C98A 2YQ1A 1X31C 1D0EA 3LANA 2HQCA 5LMUF 1MN9A 1X4HA 3QSYB 2FVPA 4F4WA 4DUYF 2JFKA 2ZBIA 1TL1B 1DTTB 4YMEA 3I4PA 3GFYA 3KLIA 3W60A 3NKYA 1KLNA 1VISA 2K3KA 3H20A 2OFGX 1NB2A 3RAQA 5KT7A 4F25A 1GH8A 3Q22A 2HS3A 3AHPA 3SXLA 5FD1A 2OP5A 3B6BA 4CO2A 4FYVB 1SL1A 3QT6A 2DO4A 3DYAA 2UXDJ 3GV8B 3G96A 4LF6J 5KFZA 2UVWA 1RJJA 2KYXA 2QL5B 4F4ZA 4DUTA 5DQHA 4I56A 4P7TA 2I5JA 3DLKB 1N34F 3PYEA 3GG1A 2HVEA 2A2DA 2MPUA 1X4EA 2RU9A 3FQLA 1S6PB 1NXIA 2DY1A 2XSFA 1IBLJ 5HANA 3BQ2A 2GHVC 5CYQA 4UZCA 2W9BB 3D6FB 3NGSA 1T03A 2CQIA 1KC8T 1L3UA 4K59A 3TUJC 4GO7X 1FRMA 2UUTA 5CCMA 4DQQA 4M5HA 4P2FA 2VUGA 4ZOSA 4Q2LA 1L3KA 2W2NP 4ANEA 3O8WA 2DGXA 2MZQA 1F5CA 3MAAA 3IGNA 1ZYQA 1WDDA 4OZ0A 2C1EB 2AEJA 3MCMA 1HL6A 3GLJA 4HTJA 3DMJA 1F3FA 1SI9A 2MY8A 2G2ZA 5DGBA 1SIWB 3F56A 4Q5VA 2R3VA 4MMOA 3BS9A 1HBNB 3H5SA 4LT6A 1JJ2R 4EU0A 1QSSA 2HHHJ 4DG1A 1TKZB 1PAUB 3HVRA 1XR5A 2W25A 2C2OB 4ED5A 5DM7Q 4TYAA 5L39A 4ZPAA 1SKWA 1WUUA 2DNQA 4QR0A 4M94A 1U0SA 3BGUA 2JEGA 3AT1B 3HMJG 2MGZB 2V94A 2CFXA 3MEDA 1UCNA 4YHHF 3BH7B 2Q43A 2DRDA 3PDNA 1X5OA 3F73A 1QAJA 2ZE2B 4RKUC 1NUEA 1M1HA 1SC4B 4K2JA 3B4DA 2KJVA 2FGCA 4JI1J 4G65A 3RBEA 2HZCA 2ZOFA 3C16B 2RMLA 3VAJA 3M2VB 2VFSA 1JXVA 1FFGB 3VQSA 3MM5A 4LF7J 4IYQA 3OJSA 5GAGI 1XR7A 5F8NA 1HWIA 1R8AA 3M8WA 2XULA 1JLCB 3DNCA 1DHMA 4O0IA 1WG5A 4HHUA 3C6TA 4DR6F 4NXNJ 1GXUA 2NSBA 4ZLJA 4ED6A 1SKSA 4DV1J 2F3JA 1GNKA 5D0EA 4ZVFA 2O67A 4ZPDA 1Q7LB 4LF8F 3IA0A 1VRUB 1G1XA 5GMDA 2CPEA 3J80Y 4KR0B 3BEGB 4QR2A 4W4MA 2DGSA 1NHUA 3FEXB 5ETQA 4C7QA 1Q7YT 1Z2LA 2IMOA 1HQUA 4USTA 2XY5A 4O0NA 1HWUA 1X4BA 4QQBA 5E0OA 2LQ8A 1N6QA 2F4FA 2U2FA 4LR9A 2IVFB 1TKTA 2E66A 2CG8A 3K5MA 4DV0J 4K0KJ 2AV5A 3CJRA 1RAFB 3SDEA 2VICA 5BYSA 2I0XA 1FEHA 2JC0A 2HEKA 5EHHA 3M05A 1VBYA 4DL3A 3T1HJ 5E3RA 2O01C 3EWGA 5CA5A 2EFOA 4TLQA 4PWDB 5L46A 3CJKB 2RQ4A 4Y2CA 4ED1A 1FK9B 2J6SA 4KPYA 3CJTA 2PMZD 5FDLB 3HO1A 1NJYA 4F8RA 3PX4A 4AYBD 3NP5A 4DPYA 5F8GA 4DWIA 1SC1B 4ICLA 1HIYA 2R7VA 1M90T 1OSCA 3R9LA 1HNIA 2DR8A 2MHEA 2AJ1A 2XM3A 2ZZTA 1Q8BA 1S4FA 2HGMA 4TU7A 1DJ0A 1BWVA 3I5BA 3VAFA 4A8XA 2MQNA 4NCAA 4A4JA 2DRAA 4Y0FA 1T9WA 2QA4S 4DLEA 1NH8A 2IVYA 2DTJA 2HFNA 5IXUA 2IDLA 5ITHA 4DZ6A 4I6YA 1EKRA 1RLDA 1IBKJ 3GSIA 1D09B 3HT3A 4MKYA 1HNXJ 3D66A 1HNZF 3GWCA 2P2CB 2ZH7A 3H0PA 3K7RA 1RB0A 1RWUA 2MLZA 1YZ6A 2UV8G 4EEYA 4CZCA 4RU2A 3M8SA 3FSXA 4DV4F 2JEJA 3I87A 1CJKA 4RUCA 2D3O1 1KONA 1W7WA 4ZKAA 2Y1JA 4TY8B 3H8YA 2FC9A 3DGPB 2UU9J 1PYOB 3NWRA 4RW4A 3TEHB 1TKDA 1IKYB 4DV5F 4DR1F 1RAEB 1YRUA 2XS2A 1APSA 4P9SA 4USKA 4DPTA 2B4PA 1AA1B 5GAEI 5I3UB 4MAKA 1VGYA 4J9RA 4DV6F 4ZP9A 3OHBA 2M8DB 3G6VA 1ROFA 2MZTA 3U1MA 2R42A 3M2UB 4PEOA 2QFJA 1BWEA 1OYDA 3GCWP 1GT8A 2VHGA 2WSFC 5HVFA 2M0GB 4JI7J 2DISA 1YK9A 3DC2A 3J7ZT 3RTVA 4DLGA 1N5SA 1SH3A 4G1PA 5DG7A 1TL1A 1DTTA 1NB7A 2ZEJA 2V2VA 2GQQA 5L1IA 4OJ3A 2VV5A 3FCHA 2AP6A 1FE0A 2ZUAA 3BR8A 3M1VB 4M5MA 3CMES 3BYPA 4JI3J 1WHVA 5BR8F 3KHHA 3LWMA 4DV2F 4CO5A 3T5HA 3DGVA 1TL4A 5A8WB 5F0WA 1ZPWX 3LAMA 2O5DA 2D3ZA 3G8TA 3U7JA 1T9VA 2AEFA 1EKSA 2PA3A 3K89A 1GMWA 2C3YA 5C42B 1F1BB 2J0XA 2C3UA 4XAKA 3DLKA 4X65J 3V81B 4I6WA 1NNDA 3LP2B 3MCNA 5KFVA 2GX8A 1S6PA 1WEYA 3BREA 4DX8H 1CVJA 2EXUA 3MPWA 4ECQA 3GP9A 2X7IA 4WU2A 5A8RB 4ANDA 4WFYA 3FJ2A 4DR2J 2W9BA 2LU2A 1OSDA 4CO4A 4OYXA 4LSNB 2K06A 2VDHA 3W65A 4ZCKA 4NCBA 1SJ3P 4JI6F 2OEJA 2BM0A 2R7TA 2I8EA 2NSCA 5B0CA 5C24B 4B9NA 3LTOA 2OEMA 2E7VA 4CYUB 4ZVSB 2J7UA 2BJ3A 2QEXS 3W62A 2FUG9 3K0JA 2F7VA 4F02A 1YX2A 1S5ZA 2XBPA 3A13A 4P2MA 4B3MF 1NK9A 5ETSA 1RT3B 1RAIB 2M4MA 1DTQB 5KFOA 4OZ3A 4WBFA 4EI2A 3WX8A 2VH7A 3HVTB 3KK1B 1HBNA 2N3OA 1YRTA 5LSOA 5EX3A 2MLYA 2GJ2A 3LUYA 1TKZA 1H72C 4NLOA 4IRCA 3O44A 5KFDA 2XGQA 1PC5A 5ETOA 2HQFA 3PYDA 4I1TA 1KHVA 1Q79A 3WDOA 1WEXA 3MMAB 5BJRA 2HPUA 4OZ1A 2QJ3A 2RD5C 2PSZA 4C0BA 4PG6A 3W7BA 1TK8A 4GVBB 4DR3F 2CXEA 4DPUA 3TJAA 4BS2A 2LU1A 5HQLA 3JSRA 3CPWR 3JS9A 1SQEA 1L3SA 1X4CA 2Y0BB 2VG6B 3QRRA 1FXDA 5HN0A 2Q6BA 2LP4A 2DR9A 2ZE2A 5KFYA 1RWOB 1N54B 2IY5B 2CQ2A 1R7IA 3KLEB 3EICA 1B7FA 2YQ3A 3IRXB 1VC0A 3C16A 2EFQA 3M2VA 3DLGB 3B82A 2NXNA 2XLJA 4F3OA 4URQU 4QU7A 3V4IB 3B8HA 3TAMB 3QGIA 4F2SA 2XQCA 5JMNA 3R2DJ 2AWZA 1HW8A 3M2RB 4CH7A 2WSEC 2L9WA 4ZS6A 3VAGA 3ISNC 1JLCA 3G86A 3GJTB 3H5XA 1DURA 3MZIA 2CG4A 4ZPVR 3IM8A 1RT6B 2ZDPA 3PFOA 2M9KA 3HSZA 3KJFB 3KLHB 3P49B 4LQ3A 4NMXA 2QX0A 2QLWA 2E5IA 2EK6A 1VRUA 2DB1A 1KP6A 1R0BG 2X1BA 5E3CA 3NLCA 3W2WB 1W26A 3BKUA 5A76A 4WTYA 1JX4A 1S1VB 2JC1A 4RNOA 1S48A 2RUSA 5CD4A 4WZMA 3T41A 1G3OA 3DXSX 4J9VA 1NK7A 3QZ7A 1Q5VA 3PKYA 1NK6A 1SKUB 1R89A 4ZN1A 1SV5B 3D68A 3I6PA 4ZVTB 3J7AN 2DNYA 2DYAA 4Q45A 4M5IA 2VQFJ 4JYAF 3ZTQA 3KFWX 5B0EA 3MF5A 2E5HA 9ATCB 3NAHA 1AYEA 1M5OC 1VK8A 4A8OA 1IQTA 1JIHA 3V2UC 2UVUA 2I6WA 4N47A 2RKIB 2DGWA 3BV8A 3SI8A 5HAOA 4USHA 4PWDA 5CYMB 4WKRA 2J0SD 5A8KB 3CJKA 4F3MA 2R8IA 2E29A 5D6GA 1CQMA 1TR0A 1FK9A 4HHJA 1TZ0A 5FDLA 1QSLA 4ID5B 3H59A 4DSFA 2JJ4D 1YHQS 2ADCA 2OO4A 1NCLA 3MCSA 3EGZA 1RT4B 4KIAA 5BYQA 3N79A 5K8PA 3H7HB 3BSCA 1FWPA 3MWBA 2KXHA 3ISND 1MWYA 2BQ3A 2LA4A 4LREA 1HNWF 3PR5B 4X4SA 1AXQA 1KEKA 3R5CA 5D0RA 3HHNB 5AJ3J 1Y5IB 4IOCQ 2QC3A 4LSLB 4LUBA 3FBBA 2R7XA 4DQRA 3M8RA 1Q16B 2H5JB 5C2CA 2VA3A 2W9CB 1ZTTA 1P9QC 2H51B 3JSYA 4OHVA 3HVWA 3QNWB 2FHMA 4IG0B 2G2OA 4LBPA 2EG2A 4U67Q 3SSRA 1TQLA 1N0VC 2ROPA 1NKBA 4ZLLA 4L6V3 1QTMA 3OTCA 2UXBF 2IM3A 5KOXA 4TY8A 3SV3A 1FXLA 3BGLA 4YN3B 3FMBA 1H6KX 5C2GA 2MKJA 4ELTA 3DGPA 1X9WA 5KFLA 4WP8A 3VGSA 1IKYA 2B5JB 4RO0A 4ZVQB 2PDAA 3FC9A 5LSLA 3GR1A 1NAQA 2CPIA 2HBZB 5DS7A 3CC4S 2VF3A 2IFXA 3D6TB 4N77A 3Q8SB 1FWKA 1YWXA 4AFFA 1RHQB 2DH8A 2MB0B 1BMQB 2LXUA 4QWDA 1U09A 1DBDA 1YTYA 4PXDA 2KXNB 4HI1A 1DRZA 3Q8VA 3M2UA 1NPRA 1M5VC 4KAIA 4CM2A 4YR2A 1T7PA 2HFSA 2FIUA 2HBYB 1KRPA 1IKXB 1N56A 3SV4A 3W63A 2HS0A 4Q8EA 3MFIA 4CTAB 2NPIA 3CDAA 4S0MA 2VDIA 4M5LA 2RH3A 4ES2A 5KFEA 4UY8T 3BH6B 3ELHA 5KFCA 3KWMA 1C1CB 4DUZJ 1YJVA 3GG0A 1K1SA 1MWQA 3M1VA 4F04B 1OQ6A 1K1QA 2HNZB 3TZYA 2VG5B 2ZBPA 3F0NA 1CULB 1YRXA 1FRXA 3OFHA 2QL9B 3MECB 2ASLA 5E3PA 4D3HA 2P9GA 1K0TA 4K4SA 2GO8A 4RBVA 1CS4B 4ED3A 4ZCIA 2KG1A 3W61A 1T9TA 1X5SA 4IDKB 5C42A 4ES1A 5L38A 1EARA 3QFWA 2DR7A 2HFZA 2FHJA 3V81A 4RZRA 3ENWA 3PV8A 3LP2A 3CCWA 5IC6B 3AA9A 4IQXA 2NXCA 2VQEJ 3KYLA 3UDLA 4DX5A 1U1QA 4USJC 1UVIA 3OL9A 4L74A 4TU8A 5A8RA 2FLOA 1C4AA 2BBEA 3CJ5A 3D54A 2R7WA 3X1LB 2DXEA 1F9EB 3HLUA 4LSNA 3T3FA 4IG3B 2ZFHA 4HR2A 3T1YJ 2GNKA 3O1LA 5GMEA 3V6DB 1RT7B 4Z37A 1FD8A 2ZHBA 1FKAF 3QGHA 1C0UB 2ZM6J 3D1HA 4CYUA 2QMXA 5LT5A 1FFWB 4ILLA 2H54B 4J9OA 1XMQF 1JJCB 4NLXA 4B3RJ 4Z7YA 1U1LA 3GILA 2G0CA 4PG8A 4FS2A 4X66J 2WK4A 1GQEA 4UQTA 1HI1A 4A8SA 1UP1A 1DQ9A 3UO0A 2BA9A 1RT3A 3NOGA 2GO9A 1DTQA 3D0IE 1U6FA 2EKNA 3EDQB 2XY6A 3HVTA 2CQ4A 5LMNF 2DH9A 3KK1A 5B09A 1T11A 3KMQA 3GYXB 4B3TF 1WEZA 2E1PA 2EW9A 2CUYA 5AXLA 3K5OA 3AA8A 3CCMS 1NK0A 4LF4J 3MMAA 3RBZA 2ZHOA 1GXTA 4OYPA 3N9UC 4ZP8A 3FDSA 2AYMA 3VR1A 4GVBA 2AIRB 2RJZA 5D77A 1JLGA 2UXCJ 4AL5A 2V4JB 3CDBA 4FNHA 2V69A 2VG6A 2VIHA 1XNQF 3CE8A 1V5IB 1NO8A 3RB6A 4EZ9A 3BQ0A 4CI0B 4IFYB 1CC8A 3QJJA 1HHTP 2RNEA 3KLEA 1N33J 3R7NB 1ZAXA 2J9DE 1CLFA 1R6YA 3IRXA 4FKYA 4KY3A 3DLGA 3UN2A 3V4IA 4C8ZA 4DN0A 3TAMA 2ZH3A 5D4LA 4AL6A 4Z2XA 5IQ6A 2IYGA 1HW9A 4UOGA 4P73A 5ETRA 3M2RA 2A3JA 4OHZA 4N5SA 2NLWA 1S0OA 2AJ0A 3PEHA 2BR0A 5RUBA 4OMFG 2A18A 1ZOTA 4M5DB 1R31A 4FXVA 2LDYA 1U49A 5F3ZA 2OGUA 4EWTA 1PBAA 4Y2AA 2G0JA 4Y6IA 1RT6A 4CT9A 2L9NA 2R8HA 5KFPA 1N48A 1OIAA 2XO6A 3KLHA 2VU5A 2BJ9A 1KDNA 1BQXA 4DCPB 3QIPB 4O3OA 3PKMA 1Z4UA 2XWYA 6FD1A 3CCJS 4YDXA 1UVLA 4NLVA 1RCOB 2VFRA 1ZBTA 3W2WA 1WF1A 4MIWA 4NYOA 1UAWA 3OLBA 1VLYA 2BE2B 2W4DA 2MJUA 8AT1B 1QLNA 1S1VA 4CO1A 5ETTA 2H4YB 5F9LA 3PFEA 2B4VA 1W2IA 2KH9A 1U1RA 4R5PB 3PXGa 2XSJB 3KNAA 3Q83A 1LFPA 3NXZA 1BGXT 2QYCA 1TKXB 4KGZB 1SV5A 5LMUJ 5F8HA 2DNMA 1HI8A 1LWEB 3KK3B 3EDRB 4DUYJ 5D0GA 3BKTA 3P8BB 1PO6A 1DAXA 3OXFA 2BJEA 1KFDA 1MROB 1PIEA 4EYHB 2VB6A 5IV3A 2IA6A 2ZVSA 5KG4A 1S0VA 3OTBA 3SFUA 2RKIA 4J9PA 2B4OA 4MIAA 5CYMA 4EFAC 5A8KA 2JH3A 1WTBA 1S9GB 2J0QD 1HMVB 2Z57B 3FK4A 5K5MA 2YTCA 4IRDA 4ID5A 4ZK7M 4OYOA 3ILJA 2CJAA 3ZZUA 4X62F 2CPYA 1RT4A 3ZNJ1 3IG1B 4USWA 5CYJA 4JBCA 1FO1A 5MAOA 2GW8A 2VC0A 1N34J 4JV0A 4FPRA 2J76E 2JLGA 3DRYA 3CXCR 2QV6A 2HAFA 2H4WB 4QIWD 3MD1A 2NYHA 1GFWB 3VF0B 1RP5A 3UD4P 2GGPB 4LSLA 3RAMA 3DRXA 1V9OA 2VPWB 2JX2A 2VKZG 3PW2A 2W9CA 4Q0BB 4E98A 4ERDA 2QSFA 3C8YA 2FZGB 1S12A 1WF2A 4IG0A 3CCQS 4DL7A 3T5KA 2C2DA 2AMCB 2FDNA 2FLLA 4JI0J 2NZCA 4WWSA 1L5UA 2DVIA 5CXTA 2FTRA 1UVKA 1WORA 2QA4G 2DKOB 2W24A 4O3QA 1U2FA 4DL5A 3DLLQ 1LV5A 2E7XA 2AJ4A 3QAUA 5I42B 2DNOA 4TU9A 5DETA 2FC8A 4BBYA 3VALA 4RJVA 2QE5A 3C6UB 1HBMB 3R1HA 2B5JA 4NRTA 1RHJB 5BXIA 3CIZA 2LQ9A 2HFVA 5KFUA 5ETLA 3FBEA 1IJEB 1VQ5S 1QAIA 4DMZA 2RE1A 4X4QA 4Z7CA 1OS5A 4I68A 3UFCX 3S7RA 5H1SV 1U8WA 4ALZA 4YHHJ 4UUWA 2YKAA 1YIJS 2IDEA 3HULA 3SEOA 2HHVA 2P6SA 1NKCA 1HHSA 2CPJA 2V8VA 2AYBA 1BE4A 1IKXA 5EDWA 1GAOA 1O51A 1VRQC 4NCGB 1NK8A 4CTAA 3I0SB 4EUVA 3HPOA 3VGVA 3GMGA 1JJHA 3H4BA 1PSDA 1C1CA 2C2RA 3FMWA 1MW7A 1RWPB 3NNCA 2R2SA 2HQDA 2HNZA 2VG5A 3PJ9A 4WFAQ 4GO5X 2UUWA 3BN7A 4DSJA 5HO4A 4F7VA 1CULA 4KHMA 4F0KA 2W4CA 2OELA 2WW8A 3I31A 1FDDA 3MECA 2A10A 3MURP 1XK8A 1GTEA 4DR6J 3AB4B 1UJ4A 3PHTA 4WYLA 1H7XA 3GJSB 4QWAA 1CS4A 3E3XA 4TN2A 2BABA 2OSRA 4IDKA 4LF8J 1XJWB 3OL6A 2HAIA 2KVIA 3TP2A 5KG0A 2CQDA 5HVGA 2OKQA 2E9TA 3W66A 1C2PA 4BDPA 4AD6A 2FZKB 5EGYA 3UNGC 3RR8A 2RRBA 2CYYA 4W98A 3SCKE 4QWCA 5AE1A 3QFHA 5FJ4A 5F9NA 2EG1A 4DQPA 5DG8A 3LGNA 2ADBA 4IG3A 1CG2A 3AY0A 3V6DA 1RT7A 4BC9A 1LFWA 2KT2A 4C8KA 1C0UA 1N36F 1LOUA 1S72S 2VPXB 2ZUGA 3LPEA 1HYSB 1KTVA 2ZZNA 2HK2A 1WACA 2ZH9A 1RQ0A 2PFDA 2E1AA 3SQOP 3QT7A 2JEIA 3G2XA 1Y4ZB 4I69A 1IKVB 4UW2A 4OZLA 4DSEA 2GCFA 2QFIA 2GQ2A 2WONB 1DARA 3QQCD 4B9VA 1LK5A 3OVBA 3U1LA 2M2BA 3R5GA 4J5OA 1RTZA 3MM6B 3HZGA 2FLNA 1LXNA 1FCAA 2AW0A 3DM2B 5U47A 5DQIA 2F8HA 2LCWA 3OFGA 3TZXA 3VZHA 3W8GA 3P96A 1QE1B 2DBBA 1JB0C 3OTOF 1KQSR 4DL0C 2HVZA 1T05B 4C6AA 1U4BA 2V4JA 3DU6A 3VVUA 1Q0NA 3AXKA 1U48A 4WP9A 2OEKA 1S97A 1FERA 1WI6A 3VQTA 1TFWA 1KVJA 1U6BA 1IKWB 2NPFA 1RKJA 4NE9C 3K59A 1RWXB 1HNZJ 3HF5A 1M5PC 1F60B 3BDPA 3TI0A 3KJQB 4DV4J 2YQ0A 2YWEA 1QDUB 3UCZP 3RBXA 1JLAB 2ZNYA 2C2KB 3I56S 2DPJA 4KSEB 4M5DA 3LH2S 2O3DA 3I96A 2QMUB 1IJFB 1FT8A 1NBEB 4DV5J 3MPUB 3BO4A 1G7CB 2AKWB 3NNHA 2CNKB 4NOHA 2V67A 2K8GA 2AU0A 2W7PA 4KHRA 4DV7F 3QIPA 2H9ZA 2J9EA 4DI6A 3H40A 4CLPA 1V3SA 3DDIA 3KNGA 2DK2A 5A6WA 1K73T 4Y28C 2BE2A 3BYRA 4PAAA 2QGFB 1LXJA 3I4HX 3UI3A 1TMMA 4R5PA 4DV6J 1GEHA 3M7VA 5I4MA 2XSJA 2HQGA 2LFVA 2RIJA 1TKXA 4L3NA 2XZDB 2MKYA 1LWEA 3KK3A 4R25A 3RRHA 1J2VA 2CQPA 3I9V9 5A2QY 5KFMA 5KG5A 2B8PA 2FQQB 4N41A 1MROA 4KBIA 1BY9A 1Q1KA 4P10A 2WVDA 1VHIA 5HJYA 2HHWA 1RTDB 2W2OP 2QT7A 2W8LA 5BR8J 3KLFB 3KG1A 3PYGA 2DHSA 3K5PA 2MKCA 4DV2J 3PEJA 3ONQA 4TXSA 2HW3A 3CWJA 2CVIA 1P27B 3LQVA 2HQ3A 2ZJQQ 1S9GA 3FGVA 1HMVA 2ASDA 4KGVB 2YY3A 4XPEA 2MTLA 3G82B 4EK2A 3UW1A 1UVNA 2XG8A 2OUGA 1VI7A 5DJBA 1S4EA 1ZA2B 2HLTA 3N28A 3IG1A 4OYAA 1FA0A 3MR2A 1T03B 5FLXU 3ZFVA 5KG3A 1HR0F 3LP1A 4FF1A 2QLFB 2ZH5A 4GKJF 4B17A 3EZ5A 1JNZB 4M5JA 2N4CA 1B0TA 2EFVA 4KFBB 3C2PA 1NK5A 2IC3B 3D1QA 4ZDNA 4Q0BA 2BVZA 3GSDA 4JI6J 1IBCB 4QJVA 3PACA 1NRKA 4V19X 1RWKB 1EB0A 3DRPB 2EC0A 1YGYA 3PW7A 3FEZA 1M5HA 4P2XA 2YH1A 4CDIA 2I38A 1X4AA 4IO9Q 1K47A 1RHKB 2OTLS 2KHDA 5I42A 3HDSA 4B3MJ 1KFSA 1VHFA 4NWBA 3HJVA 1VQKS 2FGOA 4OIXA 2XS7A 2LQ5A 4PG7A 1M5SA 3C6UA 1HBMA 2YNIB 3KK2B 3ZZRA 2M88A 2YNGB 5CH7B 3G87A 1WD6A 1WC4A 2WZ1A 4NASA 1N5QA 1QAXA 1G4CA 4DCOB 1BQMB 4FVCA 1X5TA 2M5YA 2VPZB 4DR3J 4P72A 1GMVA 3LF0A 1D9AA 4GVLA 3EVMA 3N01A 3R5DA 2X3DA 2YXLA 1B0PA 1PYSB 2FHKA 1HI0P 3CIMA 4DPWA 2FLPA 2HQIA 1MU2B 2RDJA 4NCGA 2W2QP 1FWLA 2XLIA 3I0SA 2VJUA 5G0RB 5F8JA 4N7TA 4CQ1A 1RK8A 1HKAA 2XC9A 2V63A 1FJEB 2FD2A 4X4TA 3NMAA 5HROB 2BUNA 3D2WA 3MGJA 3MMBB 2A0FB 1R3NA 2AGQA 3VAKA 2PFFB 2LLZA 1TP7A 1YJ7A 3OSPA 2QSWA 2DCLA 1VCTA 3OR2B 3FUYA 2IPOB 3THTA 3Q8PB 1N5VA 3O3LA 2XY7A 2F8MA 2MSTA 1ZM9A 3I5AA 3SSQA 4USVA 1VS3A 4ECSA 4IFVB 3L95X 3K8VA 2Q3PA 2J7WA 1Q81T 2ZBQA 1JWWA 3V4MA 2G1HA 1REVB 5DQGA 1ITPA 4YDDB 3D1OA 1J27A 3MMCB 4KH1B 4KGXB 1NK4A 4M95A 1FESA 3AOAA 5ETPA 3PO5A 1RAOA 4PKDB 1B7YB 4HDGA 2GJFA 3PJXA 3AJDA 3TZZA 1MWZA 3IWNC 3J81j 5D78A 4PABA 3JTOA 4UOFA 3R1LA 1T3NA 5IT9Y 1X4FA 4Q2MA 1HYSA 2DITA 3BR9A 4DV1F 2BEFA 7FDRA 1FDBA 4BWJA 1P6TA 4JYAJ 1N88A 1CEZA 3PJWA 4CCHA 3NG8A 2DGVA 4G3IA 5AXMA 1TV6B 5KT5A 1IKVA 5L9XA 2ZC3A 4DFKA 5JXSA 2B6AB 2WONA 1VC5A 3M6VA 3EMTA 2RDIA 3SMZA 3I5CA 2LEBA 3MM6A 4BLGA 1H38A 4G6VB 2ZVIA 5E5NA 1RZMA 1M5KC 3DM2A 4C4WA 3JXOA 2DXDA 1HD0A 1FDAA 3LALA 3GFXA 1QE1A 2WHOA 1T05A 2DNRA 2X51A 2GFFA 5ETKA 2DRBA 1HNWJ 1A0OB 4Q7AA 1RXOB 2EPIA 4DV3J 1VQ9S 1NDLA 2OLWA 2YWKA 5A6PA 4O44A 2OMOA 2QMWA 5HQMA 3EVOA 1FE4A 4J7CA 1T8EA 4C9DA 3KHGA 1NDKA 3QAEA 1IKWA 4K4TA 3TNVA 1FI4A 1OWXA 5K8OA 4IUFA 2MHNA 1QM9A 4QIFA 4TLRA 1KQKA 2FVCA 3LWLA 1RKIA 2CIMA 3KXDA 3CCSS 4KYZA 4ED0A 1TL7B 1SJRA 4W90B 5JVGQ 3CB4A 5F8LA 2UXBJ 1JLAA 1NHKL 4P7VA
chains in the Genus database with same CATH topology
2MJNA 3R5CA 1KQFB 2VASA 3EXYA 5KFTA 1RTJB 4D3GA 4C11A 4ETZA 3GIKA 3OL8A 3OVAA 3HHNB 4TQRA 2OPQA 1NJIT 4MH8A 4M63A 4Y34A 3M9NB 4P2SA 5K8NA 2O66A 2JEFA 2BANB 2KJWA 3N5BA 2CQ3A 1Y5IB 2ZDOA 2RSQA 4IQMA 2ERRA 4U9RA 4F4YA 5LXYA 5B0GA 4IOCQ 1F0XA 4LSLB 3TUIC 1N4LA 4LUBA 1CC7A 4UOCA 3TX8A 5J1NA 2R7XA 4DQRA 4QWEA 3ICLA 4KKOB 2B43A 1FJGF 3M8RA 1Q16B 2C22A 3GYNA 3QGGA 2VA3A 4FBUA 5HBMA 2W9CB 4PCQA 2MQQA 2IJFA 3RRKA 3ULHA 1ZTTA 5G4DA 5KFQA 3QWPA 1P9QC 4OI1A 1AFIA 4MK9A 1N52B 1S79A 3JSYA 3MR3A 3CCES 1IN0A 4OHVA 3HVWA 4DPOA 2FHMA 4IG0B 1KLMB 3NL0A 4DL2A 3CCRS 2DJWA 3TR5A 1FVQA 2EFNA 3DYAB 2EG2A 2JVRA 4U67Q 3O2IA 3SSRA 2NZ4A 1TQLA 1A6LA 2WSCC 1N0VC 3QGPA 2UVRA 2AQ4A 4ED7A 4ECVA 2OTJS 2ROPA 1FDNA 2XNQA 3US5A 1NKBA 2HNDB 1VQ4S 4L6V3 1QTMA 3OTCA 1ZAWA 2HHQA 1S6OA 4DR4F 4J9MA 4WJBA 1IM4A 1JLEB 4JV2A 2ASJA 2I5JB 3OV7A 2L3MA 3W2VB 4PUOA 2VONA 2UXBF 2IM3A 1KR4A 1TAUA 4QZVB 5KOXA 2Y1RI 2YX4A 3MPVA 3LP1B 3O5TB 3T5JA 2LEPA 1NJWA 4TY8A 3SV3A 1FXLA 2R8JA 1C0TA 3CJ0A 3BGLA 3JAMY 1Q4RA 3THVA 3LO3A 2ZOMA 1GX6A 1S7HA 2LMIA 3HJFA 2YX1A 1VQOS 3FMBA 1H6KX 4M8LA 2MKJA 3HHKA 4ELTA 3L7PA 3DGPA 4Y2IA 2IRUA 3I9ZA 5KOWA 5DDPC 2ZJRQ 5AJ3F 1X9WA 5KFLA 1NH7A 2VFUA 4LFBF 4DEZA 4RNFA 3K58A 1SKRA 1IKYA 1YG0A 2A2CA 2B5JB 2BACA 3M32B 3M9OB 4WF9Q 1N8RT 3QO9A 5CYQB 5LJ5Y 1TL3A 2YKNB 3BO3A 2PDAA 4XPCA 3DDKA 5LSLA 3HP6A 4U7CA 2CQ0A 3BF4A 3GR1A 2WRMA 2V8HA 1WHYA 2EI5A 2DNPA 2OD6A 1NAQA 2CPIA 4F50A 4ZCMA 4KT0C 3FRYA 1Y5LB 2RQKA 4XO0A 1U1NA 4I0WA 5DS7A 4ILMA 4YR0A 2CVEA 2ZITA 3DRRB 3PR4A 2MZ1A 2LECA 4B08A 4NL5A 1W25A 3CC4S 2IHR1 2IFXA 2XGPA 1V3RA 4PXEA 4EGLA 2J9CA 4QYRA 2LDIA 4N77A 1SJFA 3Q8SB 2E9RX 1RTDA 1S99A 1YWXA 1TFYA 4KRWA 4AFFA 3KLFA 4JV1A 2FHJD 2DH8A 1LWCA 1R8CA 2GGPA 5M2RA 2MB0B 2XEXA 2LXUA 1HA1A 2N7CA 5HP1A 3N6LA 1NJXA 4JI8F 1I6JA 4QWDA 1U09A 1VOMA 1DBDA 1Y3JA 4PXDA 1YTYA 2KXNB 2EVZA 3DFEA 4HI1A 1DRZA 3RBDA 4EBCA 1DZ5A 3IAS9 1XEZA 3M2UA 3A1YG 1M5VC 2AJQA 4KAIA 5T14A 2IAJB 2JZ5A 2V4RA 3UCUP 4XDCA 4YR2A 2E9ZA 2HRUA 1T7PA 1YSJA 3DMJB 1VQYA 1R0AA 2FIUA 4C8YA 4CH0S 1S9EA 3WX4A 1Y5NB 3P5TL 2OPSB 1IKXB 1N56A 4K2XA 1KRPA 5LJ3Y 1FJCA 2N4DA 4MK7A 3VZIA 5JVHQ 1YI2S 4C8MA 3SV4A 4O3PA 1SL0A 2HS0A 2JHEA 4Q8EA 4DG1B 2CPHA 4CTAB 3MFIA 4A8FA 3J81Y 2IM1A 2M8HA 2NPIA 1U47A 1YVFA 3UR0A 4LMZA 2YKPA 2PEHA 5DM6Q 3P3DA 2W9AA 3CSKA 3CDAA 2MKSA 2UP1A 1BD6A 2JOQA 2RH3A 4A47A 5J2NA 3IR5B 4ES2A 5C5JA 5KFEA 2RS2A 1XR6A 2PGCA 1UKUA 3CGIA 4UY8T 3PIOQ 5DG9A 5KFCA 3KWMA 1C1CB 1E6YB 1K9MT 4FXWA 4IOAQ 2R2UA 1SBRA 4ZVHA 1YJVA 3T5LA 3GG0A 1K1SA 2YKMB 3M1VA 4KTQA 4A46A 3FQKA 5IQQA 1OQ6A 4ES3A 1K1QA 4DL4A 2HNZB 4QR1A 2O1PA 2VG5B 2BJDA 5H9FJ 2W7OA 4YY3F 2A1BA 2WOMB 1S0NA 2DGOA 4KFBA 4KC5A 4NYZA 2KN4A 4OQJA 4G1QA 4YB6A 3C3LA 2D74B 3MEDB 2HGNA 3OW2R 4A8YA 1YRXA 4PQAA 1FRXA 3OFHA 6FDRA 5J2PB 2GHPA 5AXKA 3MECB 2IRXA 1QJHA 3MM7B 2IC3A 2ASLA 4H4MB 2CQHA 2Z0GA 1S6UA 5E3PA 1HBUA 5KFIA 4D3HA 3T19A 1J5OA 2P9GA 5CD4H 1WHWA 2DNGA 4K4SA 1K0TA 1TUVA 3BSAA 3DLBA 2GO8A 4RBVA 2R7QA 1JK9B 4ED3A 1MMDA 3U1NA 4ZCIA 2P9EA 4YEAA 5JUMA 4R0EA 5KFBA 2KG1A 2KI2A 3DRPA 1X5SA 1BLUA 2NS1B 3PNIA 3BDEA 4IDKB 2L08A 4NLGA 1XMOF 3FFIA 1T95A 1UEVA 2MQLA 5T41A 5C42A 5KFHA 2GIQA 4ZCLA 4ES1A 5L38A 1S10A 4MYTA 2IYIA 3MMJA 2HFZA 3JSMB 2DR7A 4LIWA 3I0RA 2FHJA 3V81A 4OJ1A 4RZRA 2YNFB 1HPZA 3ENWA 2KDOA 4OLPA 5HMYA 5SZTA 3PV8A 2GMLA 2MZJA 3LP2A 3MM5B 3CCWA 4WFBQ 3PX0A 2WB1D 4MKAA 1HD1A 3MOZA 1RAJA 2I9SA 2RVJA 3AA9A 3NRBA 3DOMA 4QIGA 4IQXA 4DUZF 2BRLA 4WFZA 2J0WA 3VCDA 3KYLA 2WCXA 5AXNA 2G9OA 2M7SA 3ETOA 3UDLA 1UVIA 1U1QA 4USJC 3FNNA 3OL9A 3HXMA 2E5JA 4TNOA 4OZJA 4TU8A 1R43A 1VIOA 5A8RA 2YNIA 4ZA1A 2FLOA 1C4AA 3KK2A 1FNMA 4OHYA 1H7WA 2OSQA 2YNGA 4ITSA 2BBEA 3CJ5A 5D4NA 3CCUS 2V2KA 3D54A 2R7WA 4RBTA 2IM2A 2KU7A 3X1LB 3NGDA 3H5YA 4TKTA 5DLFA 5HMWA 2BDPA 2XS5A 1UJ5A 1L3TA 1PC4A 2QIFA 2HHSA 4XIUA 3Q0AA 3NCRA 3HLUA 4LSNA 3T3FA 1XMBA 4IG3B 2ZFHA 3C6TB 2DNHA 2GNKA 3O1LA 3OR1A 3V6DB 1RT7B 4Z37A 1FD8A 3ISZA 4Q43A 2ZHBA 2UUCF 4N76A 1FKAF 3QGHA 5MLCV 1C0UB 2B9WA 1TK5A 3DHXA 4WXOA 4LF9F 2DR5A 1Z2ZA 3N5FA 5DDRC 2B9YA 1U25A 4B9TA 4I67A 3D1HA 3NS5A 3CEDA 1BQMA 3IAM9 5L1JA 2AGPA 3HKZD 4RUAA 2QMXA 1XBWA 1SUQB 3FEYB 5LT5A 1RT2B 1B64A 4ILLA 3UQSA 1TK0A 4J9OA 1XMQF 4RW9B 4ELVA 2MGZA 1WNEA 3RR7A 1UWBA 4ZPBA 4NLXA 3CDWA 5HLFA 3RU0A 5KG7A 3KJVA 4X4NA 5EN1A 1A7GE 1U1LA 2AYGA 3JSBA 2G0CA 4NLSA 4PG8A 3GILA 1UEUA 4FS2A 2WK4A 1GQEA 4UQTA 3M8PB 1HI1A 2KG0A 4LQ9A 4A8SA 3TVYA 1UP1A 2V9KA 1WI8A 1DQ9A 4OZ5A 4NLPA 2BA9A 2VQEF 1RT3A 2F40A 2GO9A 1DTQA 2XHWA 3DLJA 4HH1A 3BZQA 3D0IE 5A0YA 3UR3C 3HZEA 1U6FA 5B0DA 1UA1A 2XY6A 4MK8A 3HVTA 2CQ4A 3E01A 5LMNF 2DH9A 3KK1A 2QO3A 3J7Z5 1LW2B 3CC7S 5B09A 2X3GA 3MEGB 1MU2A 2FB0A 4QWBA 4ZVEA 3B4MA 3DOKB 2V4QA 4PWUA 5G0RA 3KMQA 3GYXB 1HQUB 4K5RA 4B3TF 1WEZA 1U6ZA