5CH7B

Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
total genus 86
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ch7B00
4XDCA 1SIWB 2WSCC 3MMAA 7FDRA 1GAOA 2FD2A 3MM9B 2VPZB 3MM7B 4KT0C 2VPYB 3MM7A 1DURA 3HKZD 4AYBD 5FD1A 1SIZA 2XSJB 2XSJA 2V2KA 7FD1A 1FXDA 3OR1A 1FRKA 2C3OA 3IR6B 2WAQD 1FEHA 3MM9A 1BD6A 2C42A 5BYQA 1ROFA 1GTEA 3IR5B 3IR7B 1FRMA 1FTCA 3LW5C 1GT8A 3MM6B 3EUNA 3MM8A 4XK8C 3MMBA 3MMAB 1B0PA 1G3OA 1DFDA 1B0VA 1FF2A 2V4JA 1B0TA 4OMFG 2WB1D 1F5BA 5BYRA 1KQGB 2Y0SD 2FJBB 2GMHA 4DHVA 1FDAA 1BC6A 4RKUC 1K0TA 1R27B 2FJEB 3MM5B 1FRHA 1Y5IB 4YDDB 2PA8D 1FXRA 1IR0A 2C3UA 1DAXA 1SJ1A 3EXYA 4ID8A 1HFEL 2C3YA 1FERA 1FRJA 1RGVA 1Y4ZB 2VPWB 1FDNA 5E7OB 1JNRB 1F5CA 5L8RC 1FDBA 4L6V3 3MMCB 1PC4A 1BLUA 2FJDB 3OR2A 5CH7B 2O01C 1H7XA 1C4AA 1Y5LB 2WSEC 3MMCA 1FRLA 1VJWA 2C3PA 1FD2A 3EGWB 1FCAA 2C3MA 3C8YA 2GMJA 3OR2B 3PNIA 6FDRA 1G6BA 1FRIA 2VKRA 4CI0B 1XERA 1FDDA 1D3WA 2FGOA 1PC5A 1KEKA 1IQZA 4OV1A 1C4CA 4Y28C 1Y5NB 2PDAA 2V4JB 1H98A 3GYXB 2FJAB 5BYSA 2UZAA 1CLFA 1BQXA 3MMBB 6FD1A 2Z8QA 1JB0C 2VPXB 2IVFB 1WTFA 2ZVSA 3OR1B 4XDDA 1KQFB 1AXQA 1A6LA 3MM5A 1GTHA 1BWEA 5CHCB 1H7WA 1JNZB 3MM6A 2PMZD 1Q16B 3MM8B 1F2GA 1H0HB 2FDNA 1FRXA 2WSFC
chains in the Genus database with same CATH superfamily
4BWJA 1RADB 2GQQA 1ZM3A 1XR7A 3CD5A 5E0OA 3HULA 5GMEA 1S0MA 4KGVB 3SQOP 2E66A 3ZNUA 3OTOF 2NZCA 2CZVC 2VBZA 1N52B 3IO1A 4N8OA 2VPYB 3JB9k 2ASJA 1MN7A 1RAJA 4A8OA 4USMA 3OTOJ 2MJNA 5KT6A 4CLYA 3OLBA 3RRKA 4F50A 1J5OB 2XSJB 4F4KA 1D9FA 2MKSA 2DNOA 3C15A 2R8JA 3OR1A 2R7VA 4ZJQA 3BH7B 3S1TA 1LW0B 2CWXA 5GAGI 1HR0J 1KFDA 4R5PB 3NMRA 2DH8A 2R3VA 1NKCA 4YHHJ 2RU9A 4J91A 2EBEA 1U7LA 3RAQA 4IRKA 2R7UA 3OD2A 1LXNA 3HKWA 5B0FA 2EBGA 1FTCA 3PW7A 3EUNA 4MK7A 4GO7X 4EYHB 2DCLA 3GJSB 2LXUA 2HNDB 1T05B 3QAUA 3CGIA 1S6UA 5DDRC 2K1RA 2X1AA 2C2MB 3GYGA 3CD7A 1K8AT 2QL9B 4YMEA 5KOXA 2R7RA 2LQ5A 4N47A 3H2UB 3P3DA 1U1KA 3CWJA 2GMHA 4DCPB 1URRA 5B7WA 2VQEJ 1S0OA 4XIUA 4AL5A 1B4SA 2DRDA 4C0OC 2CZ4A 1RAHB 3TX0A 3FDSA 1XQIA 4F4AA 1HNZF 4LREA 5KFRA 4ELTA 2PSZA 4CCHA 1EJ7L 2M9KA 5A0YA 4N76A 1PYSB 1VRTB 4USWA 4JI4J 3F0NA 4XTTA 1LW2B 3E51A 4ELVA 2BBEA 2ZNZA 4FN5A 4RW9B 1YQHA 3JQKA 4DV5J 3HM9A 2NS1B 4YB7A 1SJ1A 3G6XA 2B9YA 4YEAA 4FKXA 4I7FB 3MCSA 4C11B 5LT5A 1FWLA 4RWWA 2VUGA 2E1RA 4CLKA 1YIJS 3D1QA 2XMKA 2AYEA 2MHEA 4QW9A 2DNLA 3MI7X 2IC3A 3PHEA 4FF2A 4LVOP 1AB8A 1BGXT 4Y34A 1JQGA 2XYHB 2ADBA 2UXBJ 4DI6A 4P6QA 3QT7A 1LOUA 4HI2A 2HQIA 3TNVA 3PIOQ 4IFVA 1X0FA 1RACB 1YJVA 1LWEB 2IJRA 3TJ9A 4A4JA 4NXMJ 4IG0B 1Y9OA 1NZ8A 4RW8A 5IWAF 3GV7B 3TI0A 2IJNA 4FYXB 2QLWA 2HZAA 1FD2A 4RNFA 1FJGJ 2NPFA 4CP5A 2R8HA 2C3MA 2UUBF 3CJ3A 3IFEA 2YQ3A 3DRPA 4P9SA 2YVSA 2WBMA 4ES3A 2UUBJ 4C3KA 2VQFF 2K7KA 4J9PA 1LKZA 4PXEA 1WG5A 3GFXA 3PVXA 2M4MA 3R7BB 2QMWA 3FVYA 4B3OA 4ECUA 4Y65A 2OKQA 3QGHA 1G2EA 2ASYA 2OEMA 3CMQA 3HSGA 4YUDA 4CH1A 2QSFA 1S9EB 1S4FA 2AEJA 2V4JB 2PDAA 3MCNA 4OX9F 1F2HA 1MW7A 3DLKA 3MAAA 3DKDA 3SBMA 5KFWA 4YR3A 2WONB 3SDEA 3D6FB 2UZAA 2XZWA 5IFMA 1N34J 2QEXS 1CLFA 1KOHA 2HBZB 5J2MA 3KLHB 1IWAA 5AE1A 4TYBA 1JLCB 3FMWA 4DV3F 4L3NA 3CIMA 4J9RA 1H74A 3I0SA 1XWLA 2BE9B 4RL1A 3V4MA 2BR0A 1XMOF 1KONA 3LWMA 1M1KT 3KG4A 3HSZA 3G6YA 2YWKA 1HNZJ 1TKZB 2AYGA 1F3FA 2MY8A 5H9FJ 2D9PA 2RF2B 4DV1F 1U8WA 3BN7A 3BSAA 5KFSA 1UW4A 3CCTA 1J5EJ 2W9BA 4ID5A 5HP1A 4LRCA 4TQSA 2MDAA 3AXMA 5BR8J 3OUYB 4X4UA 3KLGB 2M88A 2VOOA 2E1PA 4DN9A 4HDHA 1SIZA 1NJZA 3LPYA 5KFYA 1FX2A 4X4SA 2ZM6J 5C25A 4OHZA 3D67A 2E5JA 2BX6A 1LWCA 4DPYA 3TAPA 4IFYB 1HQUA 2RSQA 2C42A 5D4OA 2HSEB 3JXOA 3UWTA 3CCES 3P5BP 4QOTA 4NZ0A 2B5JA 4K4SA 3SSRA 4A8FA 1EHWA 3TZYA 3W1YC 2WBRA 2L41A 1FE0A 1RT5A 2RJZA 2DITA 3B54A 1ELOA 2ZKUA 2V8GA 5JUMA 2XB2D 1SKRA 3DDNA 1B0VA 2ERRA 4AE5A 1DLOB 2OAUA 5HBMA 1W26A 3W62A 2FC8A 1MU2B 2IDLA 3M2UB 4A46A 1GXUA 1MROA 5J2MB 2FHKA 1AUSL 1Q5YA 1BQNA 2P9GA 2XMJA 3A8KA 4KGMA 3T41A 3B6BA 3CUNA 1UJ5A 3ZZPA 1WKKA 1RE1B 2DIUA 4ALZA 1CS4B 3J81Y 3O1LA 3AD7C 3AHPA 3EVMA 3POTB 2NZ4A 3D7SB 4X4RA 1SKWA 4UOHA 1SQGA 4KAIA 4XPEA 4WFYA 3TUZC 1F60B 3OTBA 2EI5A 3ZZUA 1M0SA 1HLWA 3W5ZA 2ZJRQ 1NK0A 3CTRA 1IVZA 4Q44A 2AJ2A 1VS3A 1EP4B 2ZH4A 1A0OB 5EX0A 3UD3P 3CJ0A 2DHHA 2KVIA 2DR8A 2FGCA 3QIPA 4PUOA 4NXMF 3PO5A 4KSEB 2AP6A 1SB6A 3QIPB 3IG1A 1J27A 1S1UB 3U1MA 2F7VA 2KHCA 2EK1A 4OYBA 1LEOA 1XR5A 1VQ4S 3GB0A 3ILOA 4CO3A 2B4OA 4USIA 1RT7A 4DL7A 1C4AA 4NLTA 4WIIA 4YFUA 1VQYA 2MZQA 1R0AB 1JWWA 4OYWA 2WB4A 3WIUA 3GIJA 3VCDA 4GMKA 3B82A 2AYMA 2VKZG 3CF5Q 4W98A 4OV6A 3A4TA 3QYYA 4ZITA 1QDUB 4TQRA 1YI2S 5KFLA 3I31A 4DN0A 1RT4B 5K9FA 2CVIA 5CABA 1K47A 3BEGB 3T5HA 3PEHA 4YB1P 3QGIA 2R7TA 1BQNB 2LMIA 4ED6A 2HK2A 1R31A 3LP1A 1NDPA 2VF3A 3TQEA 1LW2A 3UN2A 1D8ZA 1OWXA 1R3NA 3T1AA 3IM8A 2VJUA 3M6XA 1UWBA 4N5SA 1HW8A 3N4WA 2L9DA 4NLRA 4F67A 1RUSA 1N5YB 1VC0A 3OXFA 4F4XA 3P8BB 4QYRA 2YH1A 4B9LA 4UZBA 4O0IA 4LF7F 4ED5A 3RB6A 2MKCA 1SC6A 3ONQA 3ZZOA 6FD1A 3V6KA 1VJQA 2Q79A 2OMLA 4HR2A 1L3VA 2DNNA 3UE2A 2YXLA 1QVFR 1FK9A 4FNIA 4OJHA 2H5IB 5F9LA 2AX0A 4NE9C 3R8YA 3LGHA 3WX8A 2A10A 2VA3A 2OLWA 1X31C 4ZLPA 3NS5A 4DFPA 1L3TA 4I67A 2V8DA 4HT5A 1F0XA 1JNZB 2VG5A 4ECYA 2BJ8A 1X4CA 4DX5A 3CCMS 3M6UA 1B64A 1UJ6A 3FSYA 5LXRA 1X60A 3BKFA 5E41A 3MR7A 2XMWA 3DLLQ 4EWTA 1CBKA 1N54B 3T9ZA 4KQZA 4DSIA 4NMXA 4RW4A 4R5PA 1U49A 2ZZTA 7FDRA 2C22A 2UU9J 1LK5A 3X3UA 1GAOA 4DFKA 1KR4A 2PD1A 4DPUA 4YS2A 2L9WA 3I0RA 2D1CA 1X5PA 4OZ1A 1DHMA 1C0TB 3NGKA 3NWGA 3P5TL 2XM3A 3LAKA 3FCWA 2UUWA 4ECWA 3QMQA 4PABA 1J2VA 1FKPA 2AD9A 4A8WA 4F3OA 2F65A 1OY8A 1FRKA 1PSDA 1S1XA 3LQVA 2I1RA 3F41A 2W4CA 3SFGA 4AXJA 2KO1A 3X1LB 1N33J 2AGQA 1NUEA 4LF5J 2EWHA 5A8WA 2QA1A 1UETA 2H5JB 2X1GA 2EVZA 4FZVA 2QA2A 1CS4A 2RHSB 3QNWB 3SEOA 8RUCA 2W2NP 2QGFB 1GMUA 1YJTA 3MZIA 1FFGB 1S6OA 2K7JA 4LT6A 2C28A 5H9EJ 1R7IA 1JLQB 4FYWB 4Z37A 3DLKB 1TVRB 3EVOA 1S9EA 2ACYA 5CYQB 2Z2ZA 2ZM6F 1Q82T 3M30B 1K9MT 4NCBA 5BYRA 1KQGB 2GAGC 2IRXA 2C2ZB 2H51B 4DL4A 1H38A 2DB1A 1XMQJ 2GNKA 1FWKA 4M5IA 2FVPA 2Z58B 3FKBA 3R7NB 4ZK7M 2BKNA 4PWDA 2W7AA 3UO0A 1FKAF 1BE4A 1QAJA 2AQ4A 4F8RA 2Z0GA 4J7CA 2BJ7A 4OZJA 3ZZ0A 3EX7B 1H73A 2C3UA 2MZJA 1HNVA 5IQ6A 3PV8A 2QN6B 2MZRA 1R8AA 4M5MA 5IT0A 2Z2YB 2OPPB 3AOAA 3DFEA 2MQPA 2FLLA 3DHWC 1GX6A 2VH7A 4NA2A 3HZEA 4IG3A 4DL0C 1X4FA 4TU7A 2HFOA 2EFPA 2Q43A 2FJVA 1RT3A 2H3EB 4ED7A 4NLGA 2LVWA 1T95A 3MECB 3SQGB 1YJNS 1IKVB 3HFVA 1IBKF 2UUAJ 4X66J 2O01C 3WC2A 3QT6A 4BCAA 2RNEA 1VQ8S 3H7HB 1IM4A 1T94A 2FUG9 3R7SB 4I1TA 2CG8A 2QLBB 3GCWP 2V6AA 3RUBL 5KG4A 5KG3A 4A8XA 4WTOB 3TAMA 1S1VB 3RRHA 2HHHJ 3ZTPA 2ZH1A 3M2UA 2LKZA 1VC6A 2RKIA 3CO0P 1BWVA 2FZKB 1T9YA 2LDIA 3FRZA 3HJVA 3JQJA 4BLGA 5C24A 5KFKA 3K5OA 3SQGA 1IKYA 1G6BA 3QT5A 3AOCA 3D6TB 1RT3B 4ZVFA 4LR9A 1M5PC 3G82B 3BKTA 3PYFA 3HVTA 1R8PA 2I38A 1VFJA 2V8HA 4OHWA 2RIJA 5ETMA 4DJBA 2J76E 1UEVA 2ATLA 4LF5F 4Q2MA 3U27A 2IVMA 3DCAA 3FUYA 2CQ2A 2QV6A 3NOGA 3VAHA 4GKKJ 2ZOMA 1UEUA 1RLDA 2EK6A 5L9NA 2JLFA 1A7GE 5GAEU 5DGAA 1F9HA 3FCVA 3JSBA 1VHFA 3QFWA 4J37A 3QATA 3CJKA 5DM6Q 2DNGA 2CQBA 3MR6A 1WTFA 2DO0A 3CJ2A 1D1UA 3OL9A 1S0NA 1EKSA 4LFAF 1YKWA 1SL1A 5C25B 2D69A 2RUGA 4G1PA 2G2ZA 4ECSA 4NZ6A 3NP5A 2HHWA 3CNQP 2XNRA 3M1VB 2V5HG 3CD0A 1N6QA 1HD1A 4QIFA 1TK0A 1V3RA 1LFPA 1NHVA 2B9XA 3FK4A 3M30A 1SJ4P 2M8DB 2J0SD 1RWNB 1WKJA 2WSFC 4TY8B 3R6GB 1SIWB 4C8LA 2G13A 3MPWA 5GADI 3QJPA 2VV5A 2DGWA 2NLWA 2DHGA 4JI3J 1RU1A 3MMAA 3LALA 4DXLA 4DR5J 3HHEA 3UN5A 1FJGF 3MM7B 3SIPB 2KM8B 1HNWJ 1FWPA 4EBEA 4IRDA 3TUJC 2DNMA 5A8WB 1GMWA 2GCFA 2OFHX 2P9CA 5LL6d 2YWGA 4EK2A 3OJSA 4KGZB 4CLTA 1I51B 1NK9A 4JV5J 3T6BA 4QYZJ 1JLGB 2DGXA 1R89A 2ACMA 2NYIA 3GZ7A 3MPDA 4FPRA 2CQ4A 5A6WA 3DRYA 1S99A 3AA9A 3W66A 3PR4A 5H9EK 4OX9J 2KM8C 1QJHA 1YZ7A 1BD6A 2KJWA 1TQLA 1UAWA 3I87A 3NNAA 1Y10A 1OIAA 2CJAA 2CJ9A 2WONA 2YBVA 4JP8A 3NCRA 2OGUA 3GE9A 3SDEB 3DDIA 1H72C 3J7ZT 2QX0A 4DR1F 1HR0F 4MFBB 1HQ2A 4ZPWR 2FHMA 4WFNQ 1KS2A 3D1HA 3KUHA 1HBUA 4DUZJ 2HYIB 3IBCB 3I9V9 4ZCMA 3HHLA 2BW7A 1N6QB 3BDEA 4RBUA 5CCLA 3PX6A 8AT1B 4ZP9A 3OTDA 1WHYA 3EWGA 3TJ8A 4NLWA 3GIIA 4DV0F 1U45A 1VBXA 4NEZA 3SMZA 4ZDNA 1HHSA 4O4GB 4AQYF 2W4DA 3AFGA 3TOQA 3DRPB 3FZBA 3CIZA 3ZTSA 2P8IA 1T3OA 1KQKA 4DBQA 5A2QY 3D3CJ 2VHGA 4U67Q 4F7VA 4A8KA 2QO3A 3N6MA 4KHPF 1N33F 4DSJA 1SXLA 2OEJA 2ASDA 1KLNA 5KG5A 1T02A 3AJ1A 3WHIA 2B4PA 1VISA 4UF4A 2DGQA 1KLMB 4DUYJ 3IBFB 4HTIA 1RBAA 4OHXA 4HEA9 5G0RA 2YNGB 5THWA 4DPXA 3EXYA 3M2RB 5IM0A 3TVKA 3T5LA 3BS9A 1KFSA 2HMIB 1S0VA 1HYSA 2C3YA 3IGNA 3OSNA 2EC2A 3OL8A 3HVRA 4LR8A 1UCNA 3FBEA 1WJ9A 2XMMA 4ZPVR 2VASA 3LP2B 5B0CA 3CSKA 3MTJA 4I2QA 3CCVS 3HFZB 3BO3A 1YG0A 3NWRA 3KFWX 4I2QB 3AD8C 4RW9A 4A48A 2W1BA 2UP1A 2FJDB 5IQQA 3MEEB 4ZVRB 3TEGA 3WC0A 4DR4F 3ILIA 3IM9A 3J7Z5 4F0KA 3MOJB 3M8ZA 3V6DB 3MR5A 1DBDA 2JDJA 3VAKA 4ZMMA 1HKAA 3WBZA 4DL5A 3RBEA 4C9DA 3Q8PB 2ZD1B 3JAMY 2UUCJ 2RB7A 3TR5A 1WACA 1RHUB 1YGYA 2HFUA 2V0NA 4YY3J 1EQ0A 4KO0B 3F73A 3TWZA 1VC5A 5DZ6A 4AQYJ 3PX0A 1HBOB 2FY8A 2GO9A 3GJRB 2FGOA 3K5PA 3OQ2A 4PEOA 2X3DA 3RBDA 4IH6A 2NXEA 1YJWS 2JJ4D 1C1BA 4FVCA 4RPFA 1H98A 3L9ZA 3GYXB 4ZHRA 1UPMB 2DNQA 2AKWB 2GX8A 1FKOA 3SI8A 1E6VA 2OI2A 3G6VA 1RTZA 1UJ4A 4DSFA 2MY7A 5AE3A 1JJ2R 5ETTA 3CEDA 1R6VA 4Q43A 4DR2F 3FJ2A 3OR1B 3T1HJ 2RUSA 1ZM2A 1M1HA 1R8CA 1TVRA 1NH7A 2AIRB 4RNNA 1NKEA 3CVKA 3K5MA 1NJIT 5HVHA 1MLAA 1OYDA 4USTA 5I3PA 4B3RJ 3QO9B 4DPOA 4NL5A 4NYPA 3PFOA 4RNHA 5L1LA 5DDQC 2ILZA 2CPFA 5ETOA 4B9SA 4F04B 3ENAA 4B02A 3PXGa 1T9XA 1YITS 2LQ9A 3GR0A 2CNOB 2QRRA 3FZ2A 4E0DA 2GIFA 4RUHA 1WWHA 1CVJA 1E6YA 2ZNYA 3MM7A 1HBNB 2R42A 1JXEA 3QGPA 3DLHA 2Q66A 1LWXA 3CJSA 5AXMA 5A8KA 3FQLA 4DLGA 3R2CJ 1X4EA 2FQQB 1VQLS 2QLJB 4UUXA 2VC0A 3TEHB 1OS5A 4DR6F 3QBCA 1EX8A 3B4MA 2MEWA 3E3XA 4UY8T 1P9YA 2RE1A 2ZH5A 1E6VB 5I42A 2IM0A 4G1QB 3M1VA 3BJYA 2K3IA 1YWXA 1NU4A 1Q8IA 3VZHA 1UVMA 1SQFA 4I0WA 2PI4A 4URSA 4P10A 3VVUA 3AH6A 2W9CA 3J7YU 4NCAA 4FP9A 2HGLA 1RWUA 1KNZA 1K1SA 4UW2A 1H2VZ 1R8HA 2MQQA 1Q78A 2D41A 4U9RA 1HBOA 4KV8A 2QMXA 2NUHA 2MQOA 1U48A 2ZKTA 4KFBA 1RP5A 1VHIA 3IWLA 3HP6A 2RRAA 3CCWA 4QJVA 1TKZA 5KFPA 3M8RA 4I6YA 3BO4A 1HMVB 5DETA 1SJQA 2MQNA 2QFIA 3V5RA 3ZFVA 1REVB 5HVFA 5CYJA 5DGBA 1NJXA 3O8WA 4OZNA 4DSKA 4JI7J 4X4VA 2ZUGA 1ICEB 5F8JA 1S5ZA 2ZUAA 2E29A 2M70A 3UCZP 2OMOA 3N5FA 3AJDA 3P96A 4CLWA 4YDDB 2JEJA 4JYAF 1SQEA 2GAHC 2Y0BB 4J9SA 5F8HA 3AQPA 3NGUA 1CPZA 1FI4A 2A2DA 3H59A 5E3RA 3SSSA 1WD6A 3KDOA 4V1Ak 2W4PA 3ISNC 4ED3A 3T1HF 2BABA 2FC9A 4GC7A 1LV5A 2VG6A 3VAIA 2LU2A 2IA0A 4UOFA 3PRDA 4KGKA 3KHLA 4P7TA 1QTMA 4WXOA 1NSKL 1WEYA 1DRZA 1JXLA 5C2CA 4B3OB 4D3GA 1HYSB 3TA2A 4RU9A 3W9HA 4CM2A 2BOPA 4DZDA 2KFZA 3M32B 2Q1LA 2OD4A 3TJAA 1B3TA 4U8VA 1NAQA 1RHQB 1JLBB 1S1WB 3K17A 3JQMA 2CXEA 3BBCA 3BYPA 1RA7A 1WC3A 2K06A 2Y1JA 3NNCA 2ZZMA 4FXWA 1KQSR 3RAXA 1HQEB 2MXYA 2HGMA 1WHXA 2AV5A 3NBPA 4CLUA 1UL3A 2RDDA 4HI1A 2YKNA 1VI7A 1JLEA 4ITSA 5L1IA 4O4GA 1XR6A 1N56A 2QZ8A 3WIVA 2O67A 5D8HB 3HXMA 3AXKA 1RB0A 3BZQA 4I2PA 3LAMA 3BKUA 2ZHOA 5HROB 4OL8A 2XHCA 4L75A 2VKRA 4C4WA 4CI0B 2V2ZA 4WFAQ 3HD2A 1KEKA 3QFHA 2LA6A 4DQSA 4KPCA 2D3O1 1GXTA 4Y28C 4DV6F 4K5RA 5CYQA 3RTVA 2C2NA 2PIIA 4OI2A 5D6GA 1N32F 4K59A 1SC1B 5F3ZA 3PJWA 4DV6J 3VGSA 4BS2A 4AL6A 1DTTB 3FRYA 2G1HA 1MU2A 2J9EA 5F8LA 2XGPA 3BQ1A 2R2TA 2MKJA 5DZ7A 5J1EB 3P45B 4USJC 3DI6A 3W60A 1FESA 4QQBA 2JWNA 4XO0A 1REVA 2BUNA 4WE1A 5D4PA 2GQCA 4FPIA 2HVDA 4DG1A 2KG0A 1AYEA 2JVOA 3OTCA 3M9OB 2EW9A 1X8DA 1RTHA 2KFYA 1RTDB 3R1HA 1KVKA 2WSCC 2ZC3A 4WFZA 2JL9A 3ILJA 4DQPA 5GMDA 2QYCA 3I5CA 1ACMB 2OFGX 4DUZF 1JK9B 2WCXA 4F4YA 3CJTA 4YR2A 3BQ2A 2MGZA 1TV6B 1FO1A 4J9VA 1NJYA 2O3DA 1G4CA 1S7IA 2ZEJA 1Y7PA 3DXBA 3BQ0A 3MF5A 4ZJLA 3TA1A 1QM9A 4LRBA 3FGVA 4HYKA 1APSA 4RNMA 5J1PA 1SPBP 4X4NA 3I6PA 4K5SA 3PKYA 2XI3A 4IOCQ 4EBDA 1RDRA 4Y6IA 4D3HA 2GC8A 3FQKA 4OZ0A 2ZHAA 3IR7B 2OELA 3R3TA 1I5OB 1GT8A 3MM6B 4C8OA 3CDAA 3ADAC 4N41A 1YVFA 2QC3A 2MKIA 3DI6B 5K20B 3R5JB 5B0BA 3PFEA 4QWDA 3G87A 4F36A 4Y0FA 2NYHA 1N5YA 5EHHA 1VIOA 2GV1A 3WZ0A 1B0TA 1TK5A 2E5LJ 4UZCA 5F8NA 3PACA 3OXGA 4DX7A 1TR0A 1ZZFA 2OPQB 5ETRA 5B0GA 5KFHA 3U7JA 1TKTB 3KLHA 1K73T 4DF8A 1W2BR 5KFBA 1HHQA 2GQ2A 4IRCA 1K0VA 3JTNA 1YZ6A 2DRBA 3NCQA 3MTKA 1YK9A 2GVDB 2E5GA 4U7CA 4O3PA 4LSLA 4ETZA 1KVIA 1TK8A 1N8RT 3LANA 3W61A 3UDEA 1O5JA 2XC9A 2E9TA 1N0VC 1CJKA 3JTPA 1IN0A 2DR6A 2XWYA 3VAJA 4ILLA 2V63A 5I3UB 1IBMF 3P4UB 3OVSA 1Z1ZA 1H3DA 2VB6A 4EBCA 4R8UA 1RGVA 5KFGA 2X7IA 1Q8LA 1WI8A 4HL9A 2XY5A 2DH9A 3VF0B 2VC1A 4BDPA 4JI8J 4HT7A 3OXLA 3IG1B 1JNRB 1HQEA 1PJ6A 2AJ4A 2GIQA 4HDGA 4MAKA 3G2XA 2RRNA 2J9DE 4WZQA 4KKOA 2GS8A 1TMJA 1Y3KA 1ZOTA 4F0MA 4WP9A 4ZPDA 1YJ9S 4RW8B 3TP2A 3JS9A 2OIHA 2HVHA 3PRBA 5H1SV 4ANCA 3BPDA 1YLXA 2GW8A 4LIRA 1T9TA 4B9NA 2F9DA 3CJQA 1TUVA 3BM7A 4U7UK 3TAQA 1HBMA 3PIPQ 2YX1A 3PKMA 4M5KA 4C11A 2LDYA 4JB8B 1XJWB 1YTYA 4NLXA 6FDRA 2Z56B 3KYLA 2OTJS 3NG8A 2IY5B 1NPKA 3W5XA 2CWKA 4ANDA 1OJ4A 1MROB 4N7TA 4OV1A 1ZPVA 2V94A 3GSDA 2YNIB 3A13A 2I6WA 1VBKA 1Y5NB 1GXLA 2YQ0A 4KB7A 4QWBA 1D9AA 4DV1J 4OQJA 2RU3A 3QRQA 2Z30B 5E33A 2KVQE 1WORA 2J0WA 3P49B 4GKKF 5F0UA 4UQGA 1TKXA 2KTQA 2AEMA 3CJ5A 4NZ7A 2XS7A 2BOAA 1TP7A 2XLJA 5EGYA 2FHOB 3U02A 1ZAVA 4YY3F 3THVA 3TYTA 2L3MA 2IRYA 3D4JA 3Q8UA 4LSNB 1XBWA 5CAAA 2OTLS 1BWEA 5L39A 1HQUB 2MYFA 3MEKA 3RRGA 4DR4J 2HIYA 3H5YA 4TKTA 2Z2MA 2RDIA 4UOCA 1WDDA 3MOZA 3OT9A 1R0CB 2R2SA 4B3TF 4B3RF 4QCLA 4I6AA 1OSDA 4OI3A 4DR6J 2CJYB 3HMJG 4PPZA 4TN2A 1HARA 3K89A 1LW0A 3FFIB 3MM9B 1ZTWA 1T03B 3VAFA 9ATCB 2PE8A 2ZOGA 4L76A 3R97A 1DURA 2OEKA 3D6HB 3T5JA 3OFHA 4UTGA 1ULRA 4CLPA 5FD1A 2HZVA 1M5KC 4ECVA 4LSNA 5FJ4A 1VQSA 2W24A 5ETVA 5SUHA 4AXIA 3EZOA 2V2KA 1NM2A 5A8KB 2RS2A 1MWQA 4ZVHA 3DLJA 3UCGA 1SJ3P 2LFVA 4ZIWA 4NRUA 2IMOA 4IKAA 3MUVP 2DXDA 2HZCA 2L9NA 2NSCA 4CTAB 1PAUB 3M7VA 3CCUS 4Q8EA 1U1NA 1VR6A 5KT5A 5DDPC 5BYQA 3LH2S 1MSWD 5T7LB 2ZWPA 2F4VJ 1VRUA 1BUXA 4O0NA 1X4AA 2XS2A 4OYPA 4B3MJ 2GJ2A 2Q3PA 2YPZA 4P74A 3TZXA 4IR9A 1RWVB 3D28A 3N01A 3TVZA 2W2PP 3MMAB 4PAAA 1X4GA 1NDCA 2OD6A 3SYZA 2DO4A 2LEBA 1TUWA 4HKQA 2BZ2A 4KPYA 2B43A 2V4JA 2ROEA 1IKXB 4WK3A 4ZVOB 4Y2CA 1FNOA 4ERDA 1UFWA 2A0FB 1VDHA 4HACA 2VG7A 4F0HA 2YWHA 1KC8T 5CD4A 2IJFA 3H5SA 1K44A 1RHMB 3M6WA 1FKOB 5RUBA 1SV5A 4NWBA 5KFFA 4IYQA 2CPYA 5CA5A 1V6HA 1GEHA 3ET6A 3MM5B 3KK3B 3W2WB 3MEDA 2IBKA 2J7UA 2PA8D 2RILA 1R43A 4MKBA 4PZVA 4QR2A 5D4NA 3THPA 5BXIA 3D1OA 5KFUA 5C42A 3EZUA 1U4BA 3AB2B 1FXRA 3IRXB 4NLOA 4ZPAA 5D0RA 2E1CA 4LFCJ 2DGOA 2MLYA 1OMSA 2MLXA 4BC9A 4DUYF 3S8SA 4B17A 5J2NB 2IDEA 1DQAA 1UKUA 1IKWB 5LM7E 1TFYA 1FDNA 2BQ3A 2AF6A 1VQKS 2DBBA 2E1MC 2MZSA 3HLUA 1VBYA 1V3ZA 5LSLA 3MGJA 3CW2C 3KLIB 1TFWA 4E98A 1HNIB 3UN3A 5CH7B 4JI3F 4ICLA 3CDBA 1XNRJ 3EE3A 2CNKB 1FRLA 1LQ9A 1S1VA 3RBZA 3EGWB 1WG1A 2J0XA 5K8NA 1AFJA 4EUVA 2DEJA 2CQ1A 1WOPA 1MMNA 2QA4G 4USUA 2UXCF 2AU0A 3R2DJ 4Q7AA 3P6YC 3LP2A 4GC6A 4CO5A 2ZJPQ 3IS9B 3EDQB 3OHBA 2E1AA 1L3KA 1UTAA 2HAFA 5B0AA 2QLFB 1T0TV 4ZKAA 2VL1A 2F8EX 1CULA 4FYYB 2XGQA 3BSCA 3C6UB 3Q8SB 2GJIA 2GO8A 4LRFA 4MK8A 2PC6A 1U25A 2B5JB 1XK8A 3K2YA 4X64J 4G3IA 3OV7A 4CIOA 2BMBA 2HQDA 2HHQA 4OZ3A 2MZ1A 3J80Y 1Q7LB 4X4QA 3MXHP 5FLXU 4GKJF 1YBUA 2JHEA 4K0KF 2PMWA 4S0MA 3MEDB 1RI7A 4QR0A 3GP9A 4DPTA 2LXFA 3DOLA 1U1RA 4Q0BB 3SV4A 3CJ4A 4ZP8A 3UW1A 1VQMS 3KLGA 1PGZA 3BGRA 5A8RB 4Q5VA 2JSXA 1S49A 4C3LA 1M5OC 4JI1J 4ZP6A 3HDSA 2O5DA 3R9LA 4M1KA 3R5GA 2V68A 1M5SA 3DGVA 1UA1A 5A76A 4DV2F 4DV7F 1RTDA 2MHNA 3AB4B 1VBZA 2NR0A 4IOAQ 1JKHA 2AJFE 1MWZA 1WG4A 3I5BA 4LBHA 1HBNA 5BJRA 3KMSA 1GFWB 2CA9A 4ECZA 2DRAA 4WKRA 2ZBCA 3K7RA 4F2SA 4NPOA 4WYLA 3PCOB 3KJFB 2KFNA 2ZH7A 1S6PB 1VRUB 3Q8QB 4DUTA 4ED0A 1UP1A 1S6PA 2CJQA 3PYDA 2BA9A 4PG7A 3PO4A 1RWPB 3DOLB 3IP0A 5B0EA 4ZPCA 2KB2A 2WAQD 1ZA1B 4P7VA 4LR7A 2DNRA 3L95X 4C8ZA 2CYYA 1L3UA 4CT9A 3E01A 4I69A 2W25A 4OYZA 2ZJQQ 4YB6A 4U8YA 2RQKA 3EGNA 1VYAA 2VICA 4L73A 1SKUB 1VCTA 3K57A 3NGRA 3DRRA 3EMTA 3ISND 5LOQA 1XEZA 3S01A 4JI6F 4J9QA 3PG9A 4LF6F 3IWXA 1C1BB 3TANA 1JLEB 4UY85 2W2QP 5GADU 2VG5B 2EG2A 2VFRA 1FDAA 3LUYA 3WX4A 2VZ9A 4DWIA 1RSCA 4DCOB 2CPIA 5F8GA 1NNDA 3EPGA 2FJEB 2C2OB 4PWWA 2HGNA 3OPKA 3UD4P 2FVQA 2HRUA 1N4LA 3E2EA 3K0JA 2YKQA 2E44A 2HPUA 4X64F 2H9ZA 1JLBA 1S1WA 4CLZA 2ZD1A 4I64A 4DQQA 2H54B 4UOGA 3HO1A 2VDHA 1HNXF 4ID8A 4DL2A 1CQNA 3LTOA 1GMVA 4JV0A 4ER8A 4LF1A 1NSPA 1FRJA 3EM1A 3FC9A 3C46A 5AXKA 5FLXY 3H25A 4DS5A 3MHYA 4ECRA 1OY6A 4QIEA 2OPRA 2GHWA 4OYIA 2R7SA 2CQ3A 1BQMA 3CCQS 3R27A 4ED1A 1U1OA 4RU2A 1HNIA 4A8SA 1WTBA 1U1PA 4QWCA 2QL5B 3OFEA 2D9OA 5KAKA 4B9MA 4O3RA 1VJWA 2HBRB 1FCAA 2BKPA 3HZGA 4CQ1A 4OX6A 1CEZA 3QT8A 1TAUA 5EX3A 2E5LF 1S72S 2RAQA 4DV5F 3PY8A 4K4ZA 3EGZA 4Q2LA 1EARA 3C3LA 3EVWA 2XYPB 3PNIA 1WOOA 2XI2A 3PRVA 3UNGC 4RW6B 2EPIA 3TRGA 4KHPJ 1KWMA 2HS0A 3G71S 3K58A 5KT3A 4U95A 2G2OA 1FDDA 3VV2B 1RTJA 2GHVC 5DLGA 4RW7B 3MUTP 1C1CA 3HI9A 4OHVA 1N5SA 2V34A 4MIAA 4DOZA 1I94J 2B7BB 3KLFB 2N4CA 2NXNA 4EYIB 4G1QA 2MKHA 2XTJP 1RWMB 5SZTA 4JI2J 4TNOA 1WSVA 1JLAA 2VG7B 2Z8QA 3UDCA 4ES1A 2D3UA 1HBUB 3AT1B 3HT0A 4M5NA 3UFCX 4JI5J 4O44B 5HATA 5DS7A 3V81B 3VQTA 1WUUA 2GVDA 1AXQA 2DNZA 2UV8G 2AGPA 4M5LA 4ES2A 2GGPA 2IAJA 4NLUA 2XMTA 1CJTB 4KH1B 1WEZA 4CH7A 4ZIVA 4LRAA 2XQCA 4X2BA 3MM8B 5J2PB 5KFNA 1VRQC 5M2UA 3AY0A 3VALA 4CO2A 2J0QD 3IAS9 2R7XA 1NHUA 4LF4J 4XDCA 2B9WA 2GJFA 1U1MA 3QRRA 1RAOA 3BGFA 3D54A 4TU8A 1TL7A 2YPYA 4DDFA 3KDNA 2VU5A 2HFNA 2JFDA 1S1XB 3MD3A 1RT2B 4P72A 2XG8A 3QO9A 3PJXA 1CJTA 1JKHB 2HEKA 1C2PA 3EYZA 2BE2A 2KXHA 2VDIA 4H54A 1HNWF 4CDIA 2KYXA 1NK4A 1FXDA 4DR7J 2GVZB 3M2VA 3KHGA 4V19X 2C3OA 2M7SA 3KWMA 1OQ3A 4ATNA 3MM9A 1KOOA 2FVCA 2MQMA 4KIAA 3ZTRA 3CCJS 2HQGA 4A8QA 4RW4B 2HQFA 2B8PA 4HHUA 1NSQA 4O3NA 3KLFA 1VQ5S 1CJVB 2J5AA 3NAIA 3UDVA 2WK4A 1N32J 3D0IE 1VOMA 1N36J 1BY9A 3T5KA 2VBYA 3M05A 2CQGA 2O1PA 1TU0B 3CJKB 2J7WA 3SCIE 3SCKE 4RUBA 2G2YA 2OHDA 1G3OA 1DFDA 2JRSA 1HWKA 1C0UB 3Q83A 3M8PA 2E5HA 3NGTA 5I4MA 2APOA 4MT1A 4O3OA 3Q22A 4J9LA 3C6UA 4USVA 5IZHA 3TA0A 5JVGQ 4JV5F 3VQSA 1G1XA 2GHPA 2RD5C 1IR2A 3H20A 3M4XA 1U0HB 2WHOA 3HVTB 3ENQA 1B7FA 3ZTOA 2ILYA 4URQU 1T9WA 2BEFA 2OPSB 2XWXA 4KC5A 4ETXA 3V6DA 2XO7A 1R27B 2X1FA 5GAHI 3OFGA 1NPPA 4CLFA 3V6JA 4E8UA 3LGNA 3HVWA 2KHDA 2XZTB 5JVHQ 4IH7A 4PRFA 2HQCA 3RB3A 3KMQA 3BF4A 2PMHA 4USHA 5GVQA 3D2WA 2BXJA 4ZVGA 3FSIA 2BQUA 3TVYA 1F3VA 2P5VA 2WW8A 4Q8FA 1I94F 2CVEA 3MAAB 1S59A 4JI2F 2RHQB 3FMBA 4IOBA 4OJ1A 3KKFA 4DX6A 3KK1A 5DG7A 1HBMB 2ATCB 2MSTA 3LF0A 5J2QB 4NXNJ 4OZ2A 2CJXB 2CZ9A 1X4BA 1DJ0A 1U6FA 2E7WA 3BR8A 2XHWA 5ETSA 3QPIA 3NGDA 1IJFB 4WBFA 4ZPTR 3U1LA 5J2NA 2Y8WA 2Y8YA 4JYAJ 3SFUA 3TZWA 2JC1A 1RT1B 4X4PA 3KLVA 3ZZZA 3G4SS 1RT1A 3ZZTA 2J6TA 4KH0B 5HAOA 3D0HE 3C8YA 3DXSX 4BBYA 2NREA 4DQIA 4FF4A 4FXVA 4ZVSB 3GU0A 4B9UA 3IWNC 3A8IA 4K2XA 1KHVA 1U8SA 3VHQA 4M5HA 1EP4A 4IFVB 4PPDA 4DEZA 3M32A 1SV5B 1HL6A 1VK3A 2JEIA 4K4XA 2F9JA 2CRLA 1PC5A 1O6XA 5L1JA 1AA1B 1Z2LA 4LSLB 4CM0A 4KHRA 4P52A 4ZVQB 1RU2A 2RQMA 4MFBA 4DV4J 1CC7A 1ZAXA 4FNHA 5AXNA 1AUDA 1TTHB 5B09A 3PW4A 4PG4A 4WIQA 1RKIA 1CJUA 4ZCIA 2UVWA 1WSRA 2ZE2B 5CYMA 2OPQA 1YBTA 1H2UX 2ZDPA 5KT4A 4WP8A 3PW5A 2MQLA 1KDNA 1RTIB 1RT6A 2B56A 5DLFA 2CQIA 3C14B 3QLHA 2DPJA 2DR7A 3IC1A 4LF2A 2KT5A 1H7WA 4K7QA 4N77A 4PYDA 5KOWA 3K5NA 1U0HA 1BXNA 3I96A 5D15A 4JI0F 3J80U 2W8LA 1TKDA 2YNHB 5HMZA 2W8KA 2JVRA 4IO9Q 1MG7A 4ZPBA 4MYUA 3GWCA 1P8GA 3D66A 5ETLA 4KFBB 5LJ3Y 2HNYB 1OSCA 2HNDA 1HHTP 1XMQF 3KXDA 2KG1A 1O51A 1HA1A 2NUUG 2PA3A 3DM2A 4J90A 4PXDA 4TU9A 3HT3A 2ADCA 1N34F 3A8EA 2VPZB 3ETMA 1VQ9S 1ZBTA 3FFIA 2AWZA 3S6EA 2YWWA 4IQMA 2BYCA 5KFIA 4AYBD 2R4FA 2BRKA 4ZP7A 2KN4A 4PR6A 3R1LA 1Q95G 7FD1A 3G9CA 4ZN1A 4OJGA 1H6KX 1U2CA 2BKOA 2RQ4A 2FZCB 2J7KA 4OI1A 2R2RA 4DFMA 2FVRA 3MPVA 1B7YB 2ALYB 4G6VB 3UR3C 1OPIA 3UD5A 3B8HA 5DQHA 2FY1A 3L7PA 5HLFB 1ROFA 1U6BA 1GTEA 4C6AA 3PTWA 2VBXA 4NYOA 4GVBB 1IWGA 3IR5B 2KXNB 2CQCA 1J5OA 2Q6BA 2DYAA 5ETKA 4M94A 4MKYA 2WTFA 1KTQA 3ZZYA 4LUBA 3MAQA 5KFTA 2W01A 4EMDA 2W2OP 3I0SB 1GX5A 1FHTA 3GFZA 2FLNA 4NCGA 3FBCA 2XLKA 5CZXA 2E5IA 5KG6A 4DMZA 2NPIA 3CMES 2R2UA 2HHHF 4W92B 2UXDJ 2B8QA 3N28A 2RKIB 4EZ9A 1F5BA 4C48A 4EGLA 3AOBA 1SH2A 5CYMB 3LP1B 1UPPA 2B51A 1DTQA 3DGPA 5A6PA 4RKUC 2DGSA 1IUJA 2YY3A 5EDWA 3RR8A 3I5AA 5L9XA 1X7VA 4QU7A 4ZVUB 1RBOB 1R6YA 1S79A 3KLIA 4H4MB 3J81j 3NL0A 3CULA 3J7YI 3RW6A 4ZVTB 5HO4A 3OSPA 1HFEL 1YJUA 4K4TA 2DXFA 2RS8A 5ETQA 5K14B 2WVCA 1B70B 1RT7B 1X0PA 2GIRA 2V50A 3QWPA 3NXZA 5K8OA 2CPXA 4FS1A 5EWEA 2ZH2A 5KFXA 3L09A 3PM9A 2YKOA 3RAMA 5T14A 5L1KA 4QWAA 2EC0A 4J9NA 3T3FA 2FJWA 2VFTA 1OO0B 4MTPA 1PC4A 1PBUA 4G1IA 2CPEA 3OR2A 2ABYA 2MZTA 3QJLA 1VMBA 5C7PA 2R7QA 1RXOB 1PYOB 3OTEA 1RJJA 4EI2A 4DR5F 5J2QA 3ILLA 3B4DA 3MCOA 5D77A 4IDKB 5KT7A 2XLIA 1XNRF 4XPCA 3TUIC 3UR0A 1SJRA 2QJ3A 3SCLE 2A6MA 4MKAA 5HMYA 4ED4A 2XO6A 3VWSA 1YX2A 5B0DA 2CFXA 4FBUA 1NB2A 1ZM9A 5EUHA 5F9NA 3QSYB 1KRPA 2KJVA 2KZZA 3H4BA 3CCSS 1NO8A 4OIXA 2VQFJ 2HHXA 3CD6S 2LA4A 3B78A 2IVYA 3G8SA 3PDNA 4B9VA 4LF8F 1QAYA 4TLQA 3W65A 5J1NA 5GMKa 1FXLA 4WFXA 4BC7A 1TL5A 1FD8A 5T7LA 5DQIA 5D0HA 1EETB 1SJFA 1U0SA 1BQXA 5IM0B 5KFQA 5ETNA 4A8YA 3BBFA 3HHNB 4YOEA 3BSOA 2VPXB 1RT5B 1QD1A 2LECA 1URNA 2PFFB 4KRWA 4LIWA 1SUQA 2HQ3A 1FKPB 2R9LA 4FYDA 3IA0A 4OYXA 3TW0A 1C0UA 2MLZA 3BO2A 4KV8B 1UFLA 5IT4A 4C7QA 1QUPA 4AT1B 1YBAA 5KFDA 2FTRA 2DK2A 3VAGA 1KTVA 1CJVA 3JSYA 4NLDA 4Y3CA 1ZTTA 1S76D 4QYZK 2FLPA 4PCQA 1NZAA 1TMMA 2JEGA 3HHLB 4JOUA 2MGZB 4OHYA 2ZBQA 1ZS6A 1NBEB 2PN6A 2YWEA 3BYRA 3VGUA 2EFQA 4OZLA 2OSQA 4RNOA 3MR3A 3A8JA 3DM2B 3HKZD 1TZ0A 3KJNB 4M5JA 1IM6A 4LFAJ 3CCLS 1U1QA 3FBFA 4N56A 3N0VA 4XAKA 1S57A 4OJ3A 1AZSA 3BGUA 3Q8RB 4F4ZA 1KD1T 2I0XA 3FEXB 4ZCKA 2N82B 2YKMA 2K2PA 1F5AA 1TL3A 1PJ7A 1ZPWX 3GLJA 1QTNB 1RAAB 3IR6B 5HMWA 3IGVA 1WHWA 2IM2A 2OO4A 1FFWB 1TUGB 5E3CA 2XY7A 2G4BA 5DG9A 4ZA1A 4TY9A 4MIBA 4PXCA 3MDFA 4OYMA 4DU8A 4PQUA 3W7BA 5H9FK 4FS2A 2IM1A 2Q6CA 4XK8C 2DH7A 4I68A 3W2VB 3PYEA 3MMBA 2NXJA 4CYUB 5HL7Q 4DV0J 1ZH5A 2V9WA 4RLEA 2MJUA 4P75A 5KFAA 1WC1A 2AJQA 2EFGA 3GV5B 2MQ8A 2GZOA 1O8BA 4RBVA 2IIHA 2CQHA 3GYNA 2WOMA 4EO6A 2Y0SD 3V4IB 4DHVA 4QIVA 5GAHU 1IBLJ 2HHUA 1N88A 1WDTA 2DKOB 4F3QA 3DOMA 3I55S 3OVAA 2KYZA 2EFVA 1R0AA 1I1GA 2CKWA 3ETOA 4QR1A 4M63A 1Y5IB 4ZLLA 2YH0A 4JI7F 1NCLA 1XTZA 1U1LA 1M5VC 4RW7A 2EFOA 4B3MF 5M2RA 3RBXA 5B08A 5JXSA 1Q53A 2DJWA 4C8YA 4PUOB 4GKJJ 2DNYA 2GMLA 2XYGB 4P2XA 4W4MA 2N7CA 4F2RA 3NAHA 2ZZNA 5GAGU 4IG0A 5D0EA 3KHRA 3M8YA 2L08A 4LRDA 1QUVA 2VPWB 5K14A 3IAM9 3W8PA 5EWGA 3K59A 3MMJA 1YSJA 2MTLA 1AT1B 3W9JA 4DSLA 3IN5A 3HCXA 1AW0A 1OQ6A 1RAFB 4PG8A 1V5IB 6AT1B 1BLUA 4QPXA 5HJYA 5AJ3F 5CCMA 3OFFA 1Y5LB 1PJ5A 1EB0A 4K2JA 5AJ3J 2OPRB 4E2FB 4I7FA 1VQ7S 4J9MA 2H4WB 3OJUA 3W9IA 4M5DB 1VRTA 3VGTA 4RWXA 3K5LA 1XC9A 3DLGB 4K8RA 4DR7F 2AJ0A 4X84A 4DS4A 1FRIA 3M2RA 1WF1A 3LP0A 2DVIA 2HMIA 3R5CA 2CG4A 1WOSA 3S7RA 2ZHBA 1UW9A 2YKAA 1WF2A 3CCZA 3G8QA 1O0PA 5IC6B 3GQCA 2V9KA 1OYEA 4HTJA 3R6LB 4GVBA 3IMQJ 4Z7CA 2JZ5A 2G0IA 2BQRA 2JLEA 3RU0A 5HQ8A 2ROPA 5KG7A 3Q89A 1QSLA 1PAEX 1S4EA 4LBIA 4K4VA 2QG9B 3EGVA 2W7PA 2VODA 2NQPA 4GO5X 2IYIA 3DLEA 4FYVB 2HBYB 4RR5A 4OLPA 5HSPA 4P2SA 3MM5A 5E5NA 3JAMU 3KUGA 3KK3A 5K8PA 1T3NA 2XS5A 3R5BA 1XNQJ 3Q2SC 4DPWA 2NXCA 2XZDB 2KRRA 2YKPA 2I2YA 4C8MA 3NS6A 3H5XA 1YRXA 4HACB 1RBLA 4RBTA 2C1EB 4BHQA 1IKXA 3C15B 1J5EF 2BDPA 3G86A 1QVGR 3US5A 2HNYA 4I6WA 4JI0J 4DL6A 3UVJA 2RF2A 2BJDA 3CJ8A 4HLBA 1FA0A 1RT2A 1SH3A 3W2VA 2D3OR 1SKSA 3OHAA 3VAMA 4LF9F 2F1FA 2ZWOA 1UZHA 1PG5B 2IRUA 4DF4A 4OI0A 3DYAB 3IBWA 5IXUA 3KJQB 1FNXH 1W25A 2HVIA 4CLLA 3R5AA 2JLGA 4ZVEA 3HK2A 5EN1A 3ELHA 3NEKA 3RYLA 1FJEB 2GA7A 3ENWA 3OBIA 1AZSB 3IRWP 2IAJB 4JI1F 1N5TA 1Q5VA 2HWHA 3M6VA 3CT9A 1KVJA 2CPHA 3ITHB 5KT2A 2IHR1 1C0TA 3MFIA 3MPUB 2R7WA 2BRLA 1AROP 2HFVA 4O44A 1SH0A 5FIIA 1FRMA 1Y00A 2IFXA 3H42A 2XMVA 2OP5A 4ILRA 4CNZA 5JJBA 4X62J 2ZH3A 4DFJA 3ZZRA 2JFKA 4PYAA 1N48A 4KJIA 2A2CA 1B0PA 1M5HA 5LSRA 3C6TB 1RABB 3RB0A 2ZVIA 1QLNA 4NA1A 1T11A 1REGX 5KG0A 5C2GA 4YDXA 9RUBA 1FE4A 1HI1A 2HWIA 1WHVA 2M0GB 3N9UC 1GH8A 3JSMA 2BVZA 2V4RA 3HFKA 4LF4F 1WC4A 5DO2A 2DIVA 2QYGA 2H48B 2DISA 1XMBA 3GJQB 1JJCB 3LOUA 2ASLA 2HVZA 3MAHA 1IR0A 5HVGA 2AEFA 1DAXA 4YP3A 1ZYQA 3RGIA 2J6SA 2DHAA 2EEYA 1IKYB 5LXYA 3DLGA 3I9ZA 3L3CA 2KI2A 5D3GB 1UWBB 2EKNA 3A12A 3TO8A 3GTYX 1CC8A 3MD1A 1HPZB 1Y4ZB 5FDLB 2O66A 1NLKL 1UVLA 1BQMB 2NSBA 3TAMB 2DY1A 4YHHF 1SL0A 2F5GA 5E3AA 5L8RC 1JX4A 1LNQA 5A2QU 3KK2A 4KBIA 2HFSA 5KFMA 2FB0A 3GPAA 1RT4A 3HD1A 2V2VA 5D3GA 3T19A 1H7XA 1XN9A 3HSDA 1IKVA 1RYSA 3HJFA 3A1YG 4C2MA 4O4RA 1W7WA 3I4HX 3PYGA 4FF1A 2OPSA 2LLZA 3HPOA 2MB0B 4C8NA 2DXEA 3NOCA 4HVZA 1KLMA 5DDOC 3KUEA 1Y0HA 2IMWP 4IUFA 3FEYB 3DDKA 3H2VE 4DLEA 4RX6A 2J6UA 1T9VA 2BJ3A 3OR2B 5F41A 2KH9A 2BE7D 2UXDF 1N5VA 4CWBA 2HS4A 3JSMB 2QTWA 1X5TA 2FIUA 2C2RA 4ELUA 1D3WA 1QE1A 2FZGB 2KT2A 2VD3A 2F8HA 3UNYA 1T7PA 2EG1A 3BDPA 1HD0A 4CZCA 3OLAA 2FYXA 4ANEA 3W2WA 2BANA 3KG1A 4NI2B 2F63A 2HURA 2ZFHA 1VLOA 2HVEA 2DNPA 4NLVA 4WCEQ 1T8EA 5IT9Y 2G9OA 5IT9U 1QY7A 1NK5A 1KKHA 4JV2A 4FF3A 1RQ0A 1RLCL 3A3NB 2IVFB 3M9MB 2RMLA 2GVZA 3L7UA 1S1TA 3M2VB 4OI6A 4CO1A 3Q8YA 4L74A 2V8PA 5D0GA 2CPDA 4DZ6A 1SC3B 3E01B 3PJ9A 2YNFA 4IO1A 1X4HA 2YWFA 2VOPA 2Z4PA 4AUKA 3GJTB 2B9EA 1Q16B 4OYOA 5LSOA 2DHXA 4TLRA 1V3SA 2B6AA 1JLGA 2QL7B 1FEEA 4F26A 1TL7B 4H4OA 3DYAA 3I4PA 3FEZA 3HHLD 4H4OB 3C2PA 2LP4A 3NS7B 2XY6A 2PEBA 2F3JA 5DJBA 2FD2A 2JC0A 4NLYA 4ECXA 4Y00A 3I82A 2RH3A 1NSAA 3QQCD 5T41A 3CDUA 4CO4A 5DG8A 3G6ES 2GGPB 2YQ1A 4JI5F 1AFIA 3UVJB 1WF0A 3HSJA 1K1QA 2DT9A 4JI8F 4OX8A 1IBCB 1RAIB 4TY8A 2SXLA 4DV3J 3V81A 1D9DA 1XNQF 3I0RB 3DOKA 3CCRS 5LMNF 1T03A 1FEHA 2HRYA 1YJRA 2HLUA 5U47A 3PX4A 2M8HA 3DHXA 4RO0A 3BH6B 5KFOA 4X66F 5LMNJ 3DC2A 2BACA 3C66A 3LGMA 4DX8H 3KNAA 1S10A 2UUTA 2IBOA 1IR1A 1Q8KA 1RWXB 2Z2LA 4DSEA 4EFAC 2JOQA 3HHDA 3LW5C 2F4FA 1IBKJ 1Q1KA 4ECQA 3BSNA 4LMZA 2W2MP 2FPHX 2W9BB 2LQ8A 3DRSA 5HP1B 1UVNA 3WDOA 3J81U 3SZ2A 4U7UD 3AODA 3CMAS 2RVJA 1FT8A 3SCJE 2A1BA 2R8IA 4OX7A 2I8EA 4WE1B 4NEYA 1PILA 1RHRB 2OUGA 3KJVB 2U1AA 4KYZA 3G82A 4DV2J 3UQSA 2XMAA 3CC2S 1S9GA 5IV3A 4DV7J 1NK6A 2DGTA 1L3SA 1BC6A 2WW4A 4X4TA 1VQ6S 2DR9A 1RT6B 1RTIA 3DU5A 5L38A 1CQMA 2UU9F 3NRBA 3GSIA 2HKEA 1SC4B 4OFZA 3KG0A 2WVBA 2V69A 3D68A 3O44A 4GRSA 1N36F 4W90B 1DTTA 3EICA 2H65B 1ZAWA 2UVVA 4JUZA 1VQPS 1HPZA 4ICLB 5FDLA 2I5JA 3GG0A 3PW2A 1V5VA 2CADA 1YRUA 1S97A 2HNZB 4F25A 4DR1J 2YNGA 3QWUA 2R8KA 2AW0A 4OYAA 1B99A 2ZC4A 4Y2KA 1S12A 5HROA 3N79A 1X9WA 2BM0A 4QIWD 2DGVA 4QWEA 2QFJA 5KTQA 2HLTA 1HWIA 2B4UA 2OPPA 2PFDA 3VGVA 3F56A 2BW2A 3GFYA 2IM3A 3N5BA 4U6PA 5KG1A 4IQXA 1N5QA 2D74B 3EZ5A 3CB4A 2CIMA 5HK4A 1NJWA 4LFBJ 3KHHA 3CDEA 4PWDB 2DEIA 2A18A 1VQNS 1X5OA 2ZH9A 3H98A 3SSQA 3Q2TC 3R5DA 2XNQA 3PHTA 4CT8A 4DCJB 3G8TA 3DOMB 2DGUA 5IV4A 3WQPA 3LA0A 4HH1A 1XERA 3M8QA 4DV4F 2XMUA 4JI4F 2D3ZA 2IC3B 2QE5A 4H4MA 5CQGA 4C0HA 3QZ8A 2LCWA 1M1GA 3ISZA 1WNEA 4Z7YA 1TL4A 2CPZA 4JBCA 2IYGA 3DMJA 2DNKA 4ZLNA 1FX4A 3MMBB 5KFEA 2ZH6A 3VR1A 4QW8A 3GFHA 3MR2A 2L48A 4WK1A 2OH2A 3HX9A 1GTHA 4WZMA 2JH3A 1NPRA 4NCGB 2KDOA 4O23A 1PO6A 3W63A 3DLBA 2PI5A 2UV8A 5IWAJ 3KJVA 3MM6A 4BWMA 4CRJA 1BHNA 4R25A 3CXCR 2FDNA 5HANA 3EPIA 4IH5A 4KHMA 2BJEA 3M8PB 4MIWA 4MMOA 1T05A 3AA8A 1R8BA 2N3LA 1A9NB 4ZOSA 1NH8A 2K3KA 5HN0A 2R8GA 4IFYA 4KT0C 1X4DA 2CQPA 2VBWA 2UXCJ 5D4LA 2E7VA 4Q0BA 2G0JA 2A6OA 1FNMA 2VFSA 4ZS6A 4X65J 1TV6A 2B7CB 2CPJA 3RZAA 2LQBA 4Y2IA 3DLEB 3TQ1A 1M90T 4PG5A 3DOKB 3H8YA 4M95A 2WVFA 1F9EB 2WVDA 3V6HA 4WU2A 1RWKB 2KXFA 4A8MP 1RTHB 2E7XA 4K50A 1FK9B 1P6TA 1SUQB 4DG1B 2CAJA 2YNHA 2AYBA 1N0UA 2QMUB 2ZBRA 3KLEB 4Y2MA 3BBBA 4LFBF 1RHJB 1KHWA 3RW7A 3LP0B 2UVUA 4LF9J 1BMQB 1JJHA 1RAEB 2K8GA 1JLCA 2D7SA 3K8VA 3L4BC 1FF2A 2U2FA 5LMUF 2F40A 3DN9A 3IS9A 3OW2R 2FLOA 2HRTA 2WB1D 4M5DA 2FHJD 3GIKA 5DQGA 4JI6J 1CJUB 2XCAA 2Y1RI 3D0GE 3DMJB 3NNHA 4WP3A 3RR7A 3CO9A 1HWLA 3GONA 4NRTA 1IBLF 1S1TB 1YDLA 4TYAA 3SXLA 3MEGA 2QSWA 4URGA 2N7YA 3MECA 1JLAB 2A3JA 1I6JA 1EIYB 3AQOA 2JNJA 1U2RA 2QLXA 1SCJB 4IDKA 2KKHA 3VTIA 3PR5B 4DR2J 2P2CB 4ZLJA 3Q0AA 2XCPA 4I2PB 1JLFA 3Q8VA 1FERA 1IKWA 1IXKA 1WI6A 3F44A 4LBPA 4MKVA 3JYTB 1Q0NA 2HHVA 1NK7A 1Q4RA 3I56S 2M52A 4DU7A 1RTJB 5E7OB 3H4DA 1QE1B 2AMCB 3NBPB 5E2QA 1XMOJ 2UUAF 2MSSA 2DPIA 2PO4A 4L6V3 2JEFA 1Q81T 2CDQA 3NLCA 5DRKA 1TELA 4KO0A 2AGOA 3TUPA 4YB5A 3ZO7A 4NYZA 4R8UB 1TL1B 1ITPA 2WSEC 3JYTA 3ET6B 4I4BA 4YN3B 5GAEI 3SV3A 2M3DA 1FTRA 4RJVA 4KE5A 3M8WA 2QT7A 3RB4A 2HNZA 3W3SA 5KFZA 3VZIA 1JIHA 2GMJA 4L72B 1P1LA 4WXWA 3POTA 4WFBQ 1OPZA 3E8OA 4LF6J 2ZDOA 2V2QA 4EU0A 2C2DA 3O3LA 4LQ9A 1DY3A 3DNCA 4C0BA 4CYUA 3BB5A 3ENVA 1UA0A 4ENOA 1KP6A 1HW9A 2HFZA 3GCXP 5HBMB 5A0YB 1EZZB 3H40A 1HNXJ 2G0CA 4QBUA 1Z4UA 5AT1B 5D78A 2FJAB 3ULHA 2XSFA 3T6JA 2KZMA 3MCMA 2LQJA 2P6TA 4TVAB 2P6SA 2IA6A 4C3MA 1U02A 2ZOFA 1MMDA 4FKYA 3ZNJ1 4CTAA 2YKMB 5JMNA 1HMVA 3KLEA 3CC7S 4JV1A 4KTQA 3A3OB 2MMYA 4X4OA 1A6LA 1PCAA 1SI9A 2FJXA 2Y3YA 2J9DA 2RT3A 4NXNF 5MAOA 2KRBA 4QU6A 5CHCB 1GNKA 2ALZA 1V9OA 2HBQB 5KFCA 4PWUA 2V4QA 3QJJA 3K8WA 2EFNA 2W9CB 1X9SA 4WF9Q 1QSYA 4EO8A 1F2GA 4R0JA 1S7HA 5F3TA 1D09B 3DRRB 4Z2XA 5E3QA 4USKA 1U26A 4EZ6A 2AX1A 2YTCA 1KBRA 4ZVPB 3GR1A 4AD6A 1F6TA 1T9UA 4R0EA 4K4YA 3OL7A 3MURP 4WYWA 2AHOB 5AE2A 1PKUA 2XSJA 1Q79A 2B4VA 1Q8BA 3BGLA 1UMJA 5G4DA 1HI8A 1NHKL 3HVAA 3O6QA 2G1DA 3V2UC 1L5UA 1UVJA 4ZCLA 5K5MA 1TKXB 2MKYA 1FVSA 3NGSA 4PQAA 1MMLA 5J1EA 3Q24A 4DQRA 3C14A 3QLHB 3D9BA 3QRPA 5HI7A 2B6AB 2LXIA 1H2TZ 4NOHA 3MM8A 4L3KA 3MWBA 5J2PA 4ILMA 1LWFB 3L7OA 2ZE2A 3NMAA 1IBMJ 1YRTA 1WKLA 3PZPA 1ZZNA 2HWTA 1Z2ZA 4O3QA 1GQEA 1S9FA 2VONA 4KY3A 1FJ7A 3TX8A 4OMFG 4X65F 4J5OA 5F0WA 5ADZA 3RG6A 3N6LA 3BGRB 5A8RA 5AXLA 1VLYA 2FJBB 1Y11A 1CSJA 4GVLA 3UCUP 2LYVA 2VA2A 4IR1A 4RZRA 1EQMA 4DL3A 4NI2A 4Y2AA 1FRHA 4ZHRB 1S6QB 1TL1A 4F4WA 1RKJA 3FNNA 2HHTA 3EXCX 1C1CB 4H4KC 4FBTA 1YJ7A 2YKNB 2CQ0A 2VFUA 4OLOA 4P2MA 5LJ5Y 3TARA 4KKOB 4K4UA 4RUCA 4DR3J 3DU6A 4QZVB 1U2FA 4CLSA 4WKYA 3MUMP 2UUCF 1S77D 2YX7A 4M5GA 3JTOA 4FXDA 1IQTA 3QIDA 1KN6A 2CQDA 5KFVA 4RUAA 2ZH8A 4DR3F 4UQTA 3KTQA 5ITHA 1CULB 2AT1B 3MPYA 5C5JA 1JLFB 5DM7Q 3W8GA 1HI0P 4B3SF 2PT0A 2RRBA 3FCHA 3RJMB 1F5CA 4ED8A 1CJKB 2JX2A 1FDBA 1ZA2B 2IPOB 2WZ1A 3HHLC 3N6NA 3O5TB 4I56A 2YX4A 4P73A 4C97A 3MMCB 3T9NA 1WC0A 3MEGB 5C24B 3CPWR 5EWFA 3H2LA 3MEEA 4MH8A 3KK1B 4PXBA 2VG6B 4P2FA 4PKDB 1WC5A 5IOLA 2FVSA 2QIFA 1S48A 1SVDA 3KNGA 2M5YA 2H4YB 2WVEA 2HG4A 3ICLA 1UVKA 4MJKA 1DTQB 3DGPB 3H0PA 4LQ3A 1ZETA 1JXVA 2BV3A 4ZN3A 3G96A 1KSPA 4K0KJ 4KR0B 3M8SA 1SBRA 4Q45A 1Q7YT 5BR8F 4FDFA 3QGGA 2KU7A 3UPFA 2F8MA 2RDJA 2C2KB 2KL8A 1TAQA 2PGCA 5G0RB 4IG3B 4AFFA 3DRXA 2DTJA 3J7AN 1C4CA 1W2IA 4TXSA 3LPEA 2K1RB 3C16B 3FSXA 3I32A 4YQWA 1FFSB 1QAIA 1U24A 5CD4H 2HS3A 1HNVB 1NKBA 5HLFA 2VJVA 2HIQA 4EEYA 3IRXA 2XEXA 5F8MA 4K4WA 1LK7A 1LWCB 4J9OA 4ECTA 1Y3JA 2B0GA 2ZVSA 3NY0A 4XDDA 1KQFB 1FJCA 1S6QA 4PG6A 2ZITA 1NXIA 4NLPA 3GMGA 3C6TA 4KGXB 4MYTA 1U09A 3CJRA 5I42B 4HH0A 4NMLA 3Q23A 1X9MA 1OY9A 4OZ5A 2ROGA 1R0BG 5KG2A 3OUYA 2PMZD 3LO3A 2WOMB 1XIQA 4WPAA 2DD8S 2Y1IA 1H0HB 4YR0A 1FRXA 4B08A 2DHSA 4ID5B 2F4VF 1P9QC 2LU1A 3ITHA 4FVMA 1EAYC 1PBAA 1EKRA 1JLQA 2BE2B 1JMTA 4HHHA 4WWSA 5KFJA 3MFHA 3T1YJ 4B3TJ 1LWFA 1P1TA 1WELA 2WRMA 3AJ2A 3EJMA 4F3MA 1E6YB 1HIYA 1X5SA 3H90A 3UDLA 4B9TA 4P71A 1NMEB 1WEXA 2J8AA 3W64A 1RWWB 5MLCV 4J9UE 1GK8A 4QIGA 2CDRB 1RZMA 3FBBA 3U1NA 1HWUA 3GILA 2V67A 1RAGB 2N4DA 1TL3B 1UFKA 1NB7A 5HQLA 1VGYA 3GG1A 3THTA 5CXTA 4CNYA 1RISA 2OSRA 3QZ7A 4QPTA 2BM1A 4NLQA 2H5EA 2YNFB 4ED2A 2MKKA 4X62F 1FVQA 3GIRA 1PYTA 3IXQA 1MWYA 3CDWA 1GMWD 2AZ1A 2NXUA 3D5MA 2AJ1A 2DCUB 4V19J 3OVBA 2X51A 3M8QB 4ZJOA 1VK8A 3PW0A 5F8IA 2POKA 1U47A 1I3OB 1UVIA 2E9ZA 3BV8A 3M9NB 3W5YA 1D8YA 1LFWA 1LXJA 1RK8A 2BANB 2BJ1A 2DY9A 4LFCF 3CC4S 2HHPA 4O3SA 4AL7A 3Q86A 4LVNP 4CO0A 3H5UA 2UXBF 2NCKL 1JJ4A 5IS2A 2HHSA 3LWLA 5K8MA 3C19A 1P27B 1UEKA 1K0TA 4RW6A 4U96A 1IJEB 2EXUA 3C16A 3PEJA 3J7A1 1RA6A 2H1YA 4NX9A 1U6ZA 3EDRB 3BR9A 1LWEA 4WJBA 3TZZA 2BJ9A 2P9EA 3T1YF 2UVRA 1UZDA 3BREA 1RHKB 3OL6A 1EETA 1ZM4A 3AAWB 3NCPA 5M2PA 4C98A 4NASA 2B3TB 4N8NA 1F1BB 3UI3A 2I5JB 4H4KA 4LF7J 2YNIA 2DNHA 1NK8A 2X3GA 4HHJA 2Y9HA 3KK2B 1NDLA 2CUYA 2X1BA 2RQCA 2XBPA 2GFFA 3HHKA 4MK9A 5HMXA 4NA3A 3JSRA 3VVTA 1G7CB 1D0EA 2V8VA 2QA4S 3BPSP 5IC4B 2C2EA 2M2BA 3MMCA 3HF5A 1SL2A 2C3PA 1UWAA 1MNEA 1S9GB 1CG2A 1NDKA 2R7OA 3D3BJ 1MN9A 2Z57B 1HWJA 2KT3A 2Y1LB 4WU3A 1QAXA 1NEEA 5I3QA 2CNLB 1RCOB 2EKYA 2J9CA 2ZBIA 4OI4A 4UUWA 3GIMA 3GV8B 2HAIA 5LMUJ 2E9RX 1S1UA 2J8SA 4B3SJ 3A3PB 4CH0S 3DRSB 1DZ5A 3O2IA 7AT1B 2W7OA 4F02A 2COLA 2ZBPA 2DR5A 4A47A 2VQEF 3BGOP 3QAEA 1IQZA 2HW3A 1PIEA 4C8KA 3KOAA 5C42B 4G65A 2PEHA 4J9KA 1VIXA 4M8LA 4NLSA 3ZXWA 2N3OA 2VIHA 1RCXB 2LEPA 1RYRA 1F9FA 8ATCB 5I3UA 2MPUA 4WTYA 1WC6A 5E3PA 5BYSA 4UT4A 2CJKA 2OJ3A 5CZVA 4LF8J 2CNNB 5HJXA 3V4IA 5HQMA 1NRKA 1RWOB 1JB0C 3ZTQA 1YHQS 4LSZB 1QSSA 3D6MB 2AZ3A 5ETPA 5L46A 3NKYA 1DQ9A 2HK3A 3QSIA 2XULA 2I9SA 3ZC4A 2CJBA 1TKTA 1DQ8A 2LEAA 1Q86T 3BN4A 2FHJA 1VQOS 1DARA 4PQUB 3CE8A 2W9AA 1DLOA 4LJMA 2VFVA 3AD9C
chains in the Genus database with same CATH topology
4BWJA 2GQQA 1ZM3A 1XR7A 3CD5A 5E0OA 1S0MA 2E66A 3OTOF 2CZVC 2VBZA 1N52B 3IO1A 4N8OA 2VPYB 3JB9k 2ASJA 1RAJA 4A8OA 1J5OB 2MJNA 5KT6A 3OLBA 4F4KA 3RRKA 4F50A 2XSJB 1D9FA 2MKSA 2DNOA 2R8JA 3OR1A 2R7VA 3S1TA 1LW0B 5GAGI 1KFDA 4R5PB 3NMRA 2DH8A 1NKCA 2RU9A 2EBEA 1U7LA 3RAQA 4IRKA 2R7UA 1LXNA 3HKWA 5B0FA 2EBGA 1FTCA 3PW7A 3EUNA 4MK7A 4GO7X 4EYHB 2DCLA 2LXUA 2HNDB 1T05B 3QAUA 3CGIA 1S6UA 5DDRC 2K1RA 2X1AA 3CD7A 1K8AT 5KOXA 4YMEA 2R7RA 2LQ5A 4N47A 3H2UB 3P3DA 1U1KA 3CWJA 2GMHA 5B7WA 1URRA 1S0OA 4AL5A 4XIUA 4C0OC 2CZ4A 1HNZF 4ELTA 3FDSA 5KFRA 2PSZA 2M9KA 5A0YA 4N76A 1VRTB 1LW2B 3E51A 4ELVA 2BBEA 2ZNZA 4FN5A 4RW9B 1YQHA 3HM9A 2NS1B 4YB7A 1SJ1A 3G6XA 2B9YA 4YEAA 4I7FB 3MCSA 4C11B 5LT5A 4RWWA 2VUGA 2E1RA 1YIJS 3D1QA 2XMKA 2AYEA 2MHEA 4QW9A 2DNLA 3MI7X 2IC3A 3PHEA 4FF2A 4LVOP 1BGXT 4Y34A 2ADBA 4P6QA 1LOUA 4HI2A 2HQIA 3TNVA 3PIOQ 4IFVA 1X0FA 1YJVA 2FJXA 1LWEB 4A4JA 4IG0B 1Y9OA 4RW8A 5IWAF 3TI0A 3GV7B 2IJNA 2QLWA 1FD2A 4RNFA 2NPFA 2R8HA 2C3MA 2UUBF 3CJ3A 3IFEA 2YQ3A 3DRPA 2YVSA 2WBMA 4ES3A 4C3KA 2VQFF 2K7KA 4J9PA 1LKZA 4PXEA 1WG5A 3GFXA 3PVXA 2M4MA 4B3OA 2QMWA 3FVYA 4ECUA 4Y65A 2OKQA 3QGHA 1G2EA 2ASYA 4YUDA 4CH1A 2QSFA 1S9EB 1S4FA 2PDAA 2V4JB 4OX9F 1MW7A 3DLKA 5KFWA 4YR3A 4DR6F 2WONB 3SDEA 2QEXS 2UZAA 2XZWA 5IFMA 1CLFA 1KOHA 5J2MA 3KLHB 5AE1A 4TYBA 1JLCB 3FMWA 4DV3F 4L3NA 3CIMA 4J9RA 3I0SA 1XWLA 3V4MA 2BR0A 1XMOF 1KONA 3LWMA 1M1KT 3KG4A 3G6YA 2YWKA 1TKZB 2AYGA 2MY8A 5H9FJ 2D9PA 2RF2B 4DV1F 3BSAA 3BN7A 5KFSA 1UW4A 3CCTA 2W9BA 4ID5A 5HP1A 4TQSA 2MDAA 3OUYB 4X4UA 3KLGB 2M88A 2VOOA 4DN9A 4HDHA 1SIZA 1NJZA 3LPYA 5KFYA 4X4SA 5C25A 4OHZA 2E5JA 1LWCA 3TAPA 4IFYB 1HQUA 2RSQA 2C42A 5D4OA 3UWTA 3CCES 4QOTA 4NZ0A 2B5JA 4K4SA 3SSRA 4A8FA 2WBRA 2L41A 1FE0A 1RT5A 2RJZA 2DITA 1ELOA 2ZKUA 2V8GA 5JUMA 2XB2D 1SKRA 3DDNA 1B0VA 2ERRA 4AE5A 1DLOB 2OAUA 5HBMA 2FC8A 1MU2B 4A46A 3M2UB 1GXUA 1MROA 5J2MB 2FHKA 1BQNA 2P9GA 2XMJA 4KGMA 3CUNA 1UJ5A 3ZZPA 3J81Y 2DIUA 4ALZA 2NZ4A 3O1LA 3AHPA 3POTB 1SKWA 4X4RA 4KAIA 4XPEA 4WFYA 3TUZC 1F60B 3OTBA 2EI5A 3ZZUA 1M0SA 2ZJRQ 1NK0A 3CTRA 4Q44A 1VS3A 1EP4B 2ZH4A 5EX0A 3UD3P 3CJ0A 2KVIA 2DR8A 2FGCA 3QIPA 4PUOA 4NXMF 3PO5A 4KSEB 2AP6A 1SB6A 3QIPB 3IG1A 1S1UB 3U1MA 2F7VA 2KHCA 2EK1A 1VQ4S 1XR5A 3GB0A 4CO3A 2B4OA 4USIA 1RT7A 4DL7A 1C4AA 4NLTA 4WIIA 4YFUA 1VQYA 2MZQA 1R0AB 1JWWA 2WB4A 3GIJA 3VCDA 4GMKA 3B82A 2AYMA 2VKZG 3CF5Q 3QYYA 4TQRA 1YI2S 5KFLA 3I31A 4DN0A 1RT4B 5K9FA 2CVIA 3BEGB 3T5HA 3PEHA 4YB1P 3QGIA 2R7TA 1BQNB 2LMIA 4ED6A 1R31A 3LP1A 1LW2A 1D8ZA 1OWXA 1R3NA 3T1AA 3M6XA 1UWBA 4N5SA 1HW8A 3N4WA 2L9DA 4NLRA 4F67A 1N5YB 1VC0A 3OXFA 4F4XA 4QYRA 2YH1A 4B9LA 4O0IA 4LF7F 4ED5A 3RB6A 2MKCA 1SC6A 3ONQA 3ZZOA 6FD1A 3V6KA 2Q79A 1QVFR 2OMLA 1L3VA 2DNNA 3UE2A 1FK9A 4FNIA 4OJHA 5F9LA 2AX0A 2A10A 2VA3A 2OLWA 4ZLPA 3NS5A 4DFPA 1L3TA 2V8DA 4HT5A 1F0XA 1JNZB 2VG5A 4ECYA 1X4CA 3CCMS 1B64A 3M6UA 1UJ6A 3FSYA 5LXRA 5E41A 2XMWA 3DLLQ 4EWTA 1N54B 3T9ZA 4KQZA 4DSIA 4RW4A 4R5PA 1U49A 7FDRA 2C22A 1LK5A 3X3UA 1GAOA 4DFKA 1KR4A 2PD1A 2L9WA 3I0RA 2D1CA 1X5PA 4OZ1A 1DHMA 1C0TB 3NGKA 3NWGA 3P5TL 3LAKA 2UUWA 4ECWA 3QMQA 1J2VA 1FKPA 2AD9A 4A8WA 3LQVA 1FRKA 1PSDA 1S1XA 2I1RA 3F41A 2W4CA 3SFGA 4AXJA 2KO1A 3X1LB 2AGQA 2EWHA 5A8WA 2QA1A 1UETA 2X1GA 2EVZA 4FZVA 2QA2A 3SEOA 1YJTA 3MZIA 1S6OA 2K7JA 4LT6A 2C28A 5H9EJ 1R7IA 1JLQB 4Z37A 3DLKB 1TVRB 1S9EA 2ACYA 5CYQB 2ZM6F 1Q82T 1K9MT 3M30B 4NCBA 5BYRA 1KQGB 2IRXA 1H38A 4DL4A 2DB1A 2GNKA 2FVPA 4ZK7M 2W7AA 1FKAF 1QAJA 2AQ4A 4F8RA 2Z0GA 4OZJA 3ZZ0A 3EX7B 2C3UA 2MZJA 1HNVA 5IQ6A 3PV8A 2MZRA 1R8AA 5IT0A 2OPPB 3DFEA 2MQPA 2FLLA 3DHWC 1GX6A 2VH7A 4NA2A 3HZEA 4IG3A 4DL0C 1X4FA 4TU7A 2EFPA 2HFOA 2Q43A 2FJVA 1RT3A 4ED7A 4NLGA 2LVWA 1T95A 3MECB 3SQGB 1YJNS 1IKVB 1IBKF 2O01C 3WC2A 4BCAA 2RNEA 1VQ8S 1IM4A 1T94A 2FUG9 4I1TA 5KG4A 5KG3A 3RRHA 4A8XA 3TAMA 1S1VB 2ZH1A 3M2UA 2LKZA 1VC6A 2RKIA 2LDIA 3FRZA 5KFKA 5C24A 3K5OA 3SQGA 1IKYA 1G6BA 1RT3B 4ZVFA 1M5PC 3HVTA 1R8PA 2I38A 1VFJA 2V8HA 4OHWA 2RIJA 4DJBA 2ATLA 2J76E 1UEVA 4LF5F 4Q2MA 3U27A 2IVMA 3DCAA 3VAHA 2CQ2A 2QV6A 2ZOMA 1UEUA 2EK6A 2JLFA 1A7GE 5GAEU 5DGAA 3JSBA 1QSSA 4J37A 1VHFA 3CJKA 5DM6Q 2DNGA 2CQBA 3MR6A 1WTFA 2DO0A 3CJ2A 1D1UA 3OL9A 1S0NA 4LFAF 1SL1A 5C25B 2RUGA 4G1PA 4ECSA 2HHWA 4NZ6A 3NP5A 2XNRA 3M1VB 2V5HG 3CD0A 1N6QA 1HD1A 4QIFA 1TK0A 1V3RA 1LFPA 1NHVA 2B9XA 3M30A 1SJ4P 2M8DB 2J0SD 2WSFC 4TY8B 4C8LA 1SIWB 2G13A 3MPWA 5GADI 3QJPA 2VV5A 2DGWA 2NLWA 2DHGA 3MMAA 3LALA 3HHEA 1FJGF 3MM7B 2KM8B 4EBEA 4IRDA 3TUJC 2DNMA 5A8WB 2GCFA 2OFHX 5LL6d 2P9CA 2YWGA 3OJSA 1NK9A 3T6BA 4QYZJ 1JLGB 2DGXA 1R89A 2NYIA 3GZ7A 5A6WA 4FPRA 2UXBF 2CQ4A 3DRYA 1S99A 3AA9A 3PR4A 2KM8C 1QJHA 3NNAA 1BD6A 2KJWA 1TQLA 1UAWA 3I87A 1OIAA 2CJAA 2CJ9A 2WONA 3SDEB 3J7ZT 3NCRA 3MR3A 3GE9A 4ECXA 4DR1F 1HR0F 4MFBB 4ZPWR 4WFNQ 2FHMA 1KS2A 3D1HA 1HBUA 2HYIB 3I9V9 4ZCMA 3HHLA 1N6QB 3BDEA 4RBUA 5CCLA 3PX6A 4ZP9A 3OTDA 1WHYA 3GIIA 4NLWA 4DV0F 1U45A 1VBXA 3SMZA 4ZDNA 1HHSA 4O4GB 4AQYF 2W4DA 3TOQA 3DRPB 3FZBA 3CIZA 5A2QY 1T3OA 1KQKA 4DBQA 4U67Q 4A8KA 2QO3A 3N6MA 4KHPF 1N33F 4DSJA 1SXLA 2ASDA 1KLNA 5KG5A 1T02A 3AJ1A 2B4PA 2DGQA 1KLMB 1NK5A 4HTIA 5IM0A 4OHXA 4HEA9 5G0RA 2YNGB 5THWA 3EXYA 3M2RB 3T5LA 3TVKA 1KFSA 3BS9A 2HMIB 1S0VA 1HYSA 2C3YA 3IGNA 3OSNA 3OL8A 3HVRA 5B0CA 2XMMA 4ZPVR 2VASA 3LP2B 3CSKA 3MTJA 4I2QA 3CCVS 3BO3A 1YG0A 3KFWX 4I2QB 4RW9A 4A48A 2UP1A 2FJDB 5IQQA 3MEEB 3WC0A 4DR4F 3J7Z5 3MOJB 3V6DB 3MR5A 1DBDA 2JDJA 3VAKA 4ZMMA 3WBZA 4DL5A 3RBEA 3Q8PB 2ZD1B 3JAMY 2RB7A 3TR5A 1WACA 1YGYA 2V0NA 4KO0B 3F73A 1VC5A 3PX0A 1HBOB 2GO9A 3OQ2A 2FGOA 3K5PA 3RBDA 4IH6A 1YJWS 2JJ4D 1C1BA 4FVCA 4ZHRA 1H98A 3GYXB 2DNQA 2GX8A 1FKOA 3SI8A 1E6VA 3G6VA 1UJ4A 4DSFA 2MY7A 5AE3A 1JJ2R 3CEDA 4Q43A 4DR2F 3FJ2A 3OR1B 1ZM2A 1TVRA 1R8CA 4RNNA 1NH7A 1NKEA 3CVKA 3K5MA 1NJIT 5I3PA 3QO9B 4DPOA 4NL5A 4NYPA 3PFOA 4RNHA 5L1LA 5DDQC 2ILZA 2CPFA 4B9SA 4B02A 3PXGa 4E0DA 1YITS 2LQ9A 3GR0A 2QRRA 3FZ2A 4RUHA 1WWHA 1CVJA 1E6YA 2ZNYA 3MM7A 1HBNB 1JXEA 3QGPA 3DLHA 2Q66A 5AXMA 5A8KA 3FQLA 4DLGA 1X4EA 1VQLS 4UUXA 2VC0A 1OS5A 3B4MA 3E3XA 4UY8T 2RE1A 2ZH5A 1E6VB 5I42A 2IM0A 4G1QB 3M1VA 3BJYA 2K3IA 1YWXA 1NU4A 1Q8IA 3VZHA 1UVMA 4I0WA 2PI4A 4URSA 3AH6A 2W9CA 3J7YU 4NCAA 4FP9A 2HGLA 1RWUA 1KNZA 1K1SA 4UW2A 1H2VZ 1R8HA 2MQQA 1Q78A 2D41A 4U9RA 1HBOA 4KV8A 2QMXA 2NUHA 2MQOA 1U48A 2ZKTA 4KFBA 1RP5A 3IWLA 3HP6A 2RRAA 3CCWA 4QJVA 1TKZA 5KFPA 3M8RA 4I6YA 3BO4A 1HMVB 5DETA 1SJQA 2MQNA 5CYJA 3V5RA 3ZFVA 1REVB 5DGBA 1NJXA 3O8WA 4OZNA 4DSKA 4X4VA 2ZUGA 5F8JA 2E29A 2M70A 3UCZP 2OMOA 3N5FA 3P96A 4YDDB 2JEJA 4JYAF 1SQEA 4J9SA 5F8HA 3AQPA 1CPZA 4CCHA 2A2DA 3H59A 5E3RA 3SSSA 1WD6A 4ED3A 2W4PA 3ISNC 3T1HF 2BABA 2FC9A 4GC7A 1LV5A 2VG6A 3VAIA 2LU2A 2IA0A 3KHLA 3PRDA 4KGKA 1QTMA 4P7TA 4WXOA 1WEYA 1DRZA 1JXLA 4B3OB 4D3GA 1HYSB 3TA2A 4RU9A 2BOPA 2KFZA 3M32B 2Q1LA 2OD4A 1NAQA 1JLBB 1S1WB 1RA7A 2Y1JA 3NNCA 2ZZMA 4FXWA 1KQSR 3RAXA 1HQEB 2MXYA 2HGMA 1WHXA 2AV5A 3NBPA 4K4UA 1UL3A 4HI1A 2YKNA 1VI7A 1JLEA 4ITSA 5L1IA 4O4GA 1XR6A 1N56A 2QZ8A 5D8HB 2O67A 3HXMA 3BZQA 4I2PA 3LAMA 5HROB 2ZHOA 4OL8A 2VKRA 4C4WA 4CI0B 4WFAQ 1KEKA 2LA6A 4DQSA 1GXTA 4Y28C 4DV6F 4K5RA 5CYQA 3RTVA 2PIIA 4OI2A 5D6GA 1N32F 4K59A 5F3ZA 3PJWA 4BS2A 4AL6A 1DTTB 3FRYA 1MU2A 2J9EA 5F8LA 2XGPA 3BQ1A 2R2TA 2MKJA 5J1EB 4USJC 3DI6A 1FESA 4QQBA 2JWNA 4XO0A 1REVA 2BUNA 4WE1A 5D4PA 2GQCA 4DG1A 2KG0A 2JVOA 3M9OB 2EW9A 1X8DA 1RTHA 2KFYA 1RTDB 3R1HA 2WSCC 2ZC3A 4WFZA 2JL9A 4DQPA 2QYCA 3I5CA 2OFGX 4DUZF 1JK9B 2WCXA 4F4YA 4YR2A 3BQ2A 2MGZA 1TV6B 1FO1A 1NJYA 2O3DA 1Y7PA 3DXBA 3BQ0A 3MF5A 3TA1A 1QM9A 4HYKA 3FGVA 1APSA 4RNMA 5J1PA 4X4NA 3I6PA 4K5SA 3PKYA 2XI3A 4IOCQ 4EBDA 1RDRA 4Y6IA 4D3HA 2GC8A 3FQKA 4OZ0A