5CH7B

Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 86
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ch7B00
1JB0C 1B0VA 1PC4A 1FDDA 1FEHA 1BQXA 1C4AA 1FXDA 1FXRA 2VPWB 2VPYB 2FJDB 1SIWB 1Y4ZB 2V4JA 1SJ1A 1FRKA 3MMCA 1G6BA 1Q16B 1KEKA 3HKZD 5BYQA 1SIZA 3IR6B 5BYRA 3OR1B 2ZVSA 1FRHA 4AYBD 1VJWA 2WSFC 3MMBB 3PNIA 2FGOA 2XSJA 4KT0C 3EUNA 5CH7B 3MM6B 1FRMA 1HFEL 3MM9A 4L6V3 2FJAB 1IQZA 3OR2A 2O01C 3MMAA 4XDCA 1GTHA 1FERA 2FJEB 3EGWB 2GMHA 4OV1A 2IVFB 2C3MA 3EXYA 3MM7B 1H7XA 1PC5A 2FDNA 1A6LA 3MM5A 3IR5B 3MM8A 3OR1A 1BWEA 1Y5NB 2WAQD 1G3OA 2C3UA 1H98A 1F2GA 1R27B 1DFDA 1F5CA 1H0HB 1KQGB 3MM6A 6FD1A 1BC6A 3LW5C 1GT8A 1BD6A 1FRLA 1FTCA 1CLFA 4ID8A 1GTEA 1WTFA 4DHVA 4Y28C 1RGVA 1JNZB 1C4CA 2VPZB 3MM7A 5BYSA 2C3OA 2XSJB 1AXQA 5CHCB 4OMFG 1F5BA 1FDBA 5FD1A 1FRXA 1FDAA 4XDDA 2FJBB 3MM9B 1FD2A 3MMBA 1B0TA 3OR2B 1FF2A 3MMAB 2C3YA 1FRIA 1IR0A 2C3PA 1BLUA 7FDRA 2PA8D 2V4JB 5L8RC 3IR7B 1FRJA 6FDRA 1Y5IB 1XERA 1DAXA 1JNRB 2VKRA 2VPXB 4CI0B 1Y5LB 3MMCB 2GMJA 2Z8QA 3C8YA 1D3WA 1FDNA 2WSCC 2FD2A 2PDAA 4RKUC 5E7OB 2C42A 2WSEC 7FD1A 1DURA 1K0TA 3MM5B 2WB1D 3GYXB 3MM8B 1B0PA 4YDDB 1FCAA 2PMZD 2Y0SD 1KQFB 2UZAA 4XK8C 1ROFA 2V2KA 1GAOA 1H7WA
chains in the Genus database with same CATH superfamily
2YBVA 5FLXU 3R6GB 2I1RA 1I6JA 3S7RA 3F41A 3DRPA 4WYWA 1S1WB 4NLSA 3AODA 1VC5A 4Q45A 2DNHA 1S76D 4C2MA 2WBRA 3L3CA 3ZZOA 1JLEB 3FRYA 2ZDOA 4DV4F 1X4HA 4QQBA 3FRZA 3W64A 4ECTA 2MTLA 1CS4A 1RT7A 5CYQB 4G3IA 4KQZA 3I9ZA 1Y7PA 3DMJB 2B7BB 3BYRA 1A0OB 3GG0A 2HIQA 1SC1B 3TUJC 3I0RA 1S1WA 5KT7A 4J5OA 5RUBA 1HNXJ 5D4OA 1TKZB 2IIHA 1DQAA 3D66A 5ITHA 3SCJE 2FY1A 3QGIA 1SH0A 3FSIA 5A2QU 1LKZA 2KYXA 3IM9A 1YRUA 2J6UA 3VAHA 2RVJA 4IRDA 1SH3A 4IRKA 2P6SA 3FKBA 2RE1A 2XMUA 4ICLB 2WONB 5L9NA 4KSEB 2QA2A 1YSJA 3R1HA 5LMNF 2VF3A 4RW8B 4ECZA 3Q24A 3CCQS 1JMTA 3AJ2A 4X65F 2BJEA 3WHIA 1URNA 4OHWA 3PTWA 1R6YA 5DQHA 2G13A 5D8HB 3P5TL 5DDRC 2Q1LA 2W9CB 4Y0FA 4DL3A 2WAQD 2DNLA 1G3OA 5DQGA 1TL5A 2XMAA 1RWXB 4IG0B 2CWXA 3ILOA 2QN6B 3NOGA 4ZJLA 3V6JA 4HKQA 1RWWB 4RJVA 5KG4A 4UQTA 2C3OA 3W3SA 5HSPA 5LSLA 2WONA 4K4WA 3G8QA 2D1CA 3OR2B 1U6BA 4GVLA 1W26A 2VBWA 2D3OR 2MLYA 1UJ6A 1FNOA 3RBEA 5LOQA 1WJ9A 2OLWA 4GMKA 3BO4A 2M8HA 1TVRB 3BH6B 2VPWB 4JUZA 5KT6A 2EKNA 1SKRA 3FEXB 2YKPA 4IG0A 1VQ8S 4C8MA 3HDSA 3KJFB 3GFZA 5HANA 1DRZA 2KRBA 1S6UA 2E1RA 2B51A 4EYIB 2N7YA 1JIHA 3D0GE 3BSNA 2K3IA 2GQQA 4OI4A 3I9V9 3GONA 3OR2A 2G9OA 2NYIA 3E8OA 1W7WA 3I4HX 2ABYA 3JYTA 3QIDA 1ZTWA 1S0VA 1WSRA 3IRXB 3LP0B 1UKUA 3IA0A 4O44A 1OQ6A 1TVRA 3G9CA 1UFWA 2XMKA 4ZP9A 3DYAA 5IM0A 3QO9B 2EBGA 4MYTA 1MW7A 2APOA 3RB3A 3H0PA 2YKMB 1CQMA 3FGVA 4CLYA 3K5OA 5H9EJ 4HACB 3QRRA 2KXHA 3BQ0A 4AQYJ 1K1SA 4Y34A 4USHA 5KT5A 2RMLA 2FC9A 3B54A 2PI5A 1FEEA 5LMUF 1IUJA 1LWFB 3A3NB 4DZDA 1H2VZ 3R7BB 2CZVC 1B0PA 2EXUA 1H2UX 1GAOA 2ROGA 1KDNA 4OV6A 3LP0A 1RHMB 4IR9A 4X4UA 2QE5A 4WE1B 5HVFA 4EI2A 1Y9OA 4JP8A 3BGOP 4PXCA 2W9BB 1H3DA 2CQ0A 3IR6B 4X4VA 2XWYA 5EWGA 1UEVA 2YKMA 1KTQA 1WC4A 5KG7A 4P71A 3DGPB 4ES3A 4HACA 2M7SA 3I87A 3MR7A 4B3OB 2E1AA 2CQ4A 4NPOA 4K2JA 3CJRA 3KNAA 1LWFA 3M6WA 1RWPB 4FF2A 3IR5B 1FX2A 4I6AA 1Z1ZA 2GS8A 4F8RA 3Q83A 1RAAB 4ZLPA 4BS2A 5BJRA 3M2UA 4WE1A 1OJ4A 3VAJA 3G6ES 2W9BA 3P96A 4CH1A 1B0TA 3SYZA 1IR0A 2RS2A 2W9AA 4BHQA 2KKHA 4DPYA 3DGPA 1X9SA 4B3OA 3GYNA 3MUVP 4QIFA 4URGA 1IKWB 3MHYA 3EXCX 1P1TA 1WNEA 3D1HA 2F4VF 1NSPA 2GC8A 3OXFA 1TUVA 3H2LA 1UTAA 1PYTA 2BQRA 1H2TZ 4F36A 4I1TA 4QWEA 4CT9A 1S6PA 4NEYA 3T6JA 2R8HA 5IV3A 1I51B 2KFZA 2UXCJ 2KM8C 4EU0A 1VHFA 2WSFC 1X9WA 4DF4A 1MSWD 3W9JA 2ZEJA 3T6BA 4ID5B 2G0CA 3A8EA 1ELOA 4YR0A 2Y0BB 2HHXA 4DQQA 2YPZA 5IT9U 4Z7CA 1ZPVA 1MU2A 4OLOA 3TAPA 3CMQA 2HK3A 5DRKA 4DR4F 1OY8A 1M5KC 1FVSA 4NLPA 3RAXA 3H59A 5E0OA 1RKIA 5HATA 4HDGA 2B8QA 3D67A 3PHTA 1NLKL 1FF2A 5E3RA 2JLGA 2W24A 3WBZA 3J80U 3OTDA 3V6KA 1RTHB 1F1BB 4ECVA 2JLFA 3S6EA 3MPYA 2OPQB 1SJ1A 3FCHA 1PKUA 1U1OA 1U1NA 3AOCA 2HVDA 4YR2A 2ZVSA 1X0FA 3PJWA 2LQ9A 3DRRB 1KVKA 4ZHRA 1AB8A 4ELVA 2HFUA 1CJVA 2R7QA 2JWNA 1CQNA 2YQ1A 3M6VA 4WTYA 4K0KF 3R97A 4A4JA 5KFOA 2BUNA 2CQIA 2V69A 1RTHA 4IG3B 4U7CA 2C3UA 3BEGB 1Q5VA 3AY0A 1GT8A 2CA9A 4EZ6A 2KTQA 3VAIA 1ITPA 1KQSR 2OPQA 4O0NA 3LH2S 1RAOA 2E5LF 3LGMA 2LDYA 3R5DA 1VQLS 3TO8A 2ZH6A 3DRRA 1JXVA 4FZVA 1U2RA 2AX1A 4F25A 2DRAA 4IFYB 2EPIA 1UEKA 3KG1A 5IC6B 4V19J 4LRBA 1E6YB 2R4FA 1IVZA 4U8VA 4DV3F 5KOXA 1QVGR 3H4BA 2W8LA 3A8JA 2F9DA 3F44A 4TQRA 1N88A 1B0VA 1Q82T 1FDDA 4IG3A 3BGUA 3D1QA 1JLBA 1T3OA 4KBIA 5ETRA 4DCJB 3BZQA 5KG6A 1EJ7L 4B3SF 1G2EA 2RRBA 5MLCV 2OPSA 2Z58B 2J0QD 5DG9A 1ZAWA 3ISZA 2K2PA 4I2PB 1E6YA 3M05A 5DJBA 4U7UD 3LUYA 2IYIA 3PACA 3ZTRA 1F5CA 2CNKB 2QO3A 4RZRA 1BD6A 4ZVPB 2XGQA 1VLOA 2VC1A 2ASYA 4ID8A 2OO4A 1Q79A 3PHEA 1JJCB 1NJZA 1RJJA 3JQMA 4RUAA 4A46A 2D9OA 2HIYA 1S7IA 2MJUA 2XZDB 4P7VA 5B0DA 5IOLA 3RR8A 1DURA 1GMUA 4LSLB 3CWJA 4YDDB 2DRBA 2I0XA 1XNRF 1YQHA 2CVEA 2VIHA 4PRFA 1R8PA 2FJDB 5DDPC 1KONA 2DCLA 3PY8A 2MLXA 4HLBA 3MEEB 3PW2A 2RQCA 2AJQA 2GV1A 5AT1B 2X1BA 1EQMA 2EVZA 2R2TA 1B7YB 1VC6A 4CLUA 1ZH5A 4G1IA 4MTPA 1TK5A 2DNOA 3TJ9A 5AE3A 1B64A 4LSLA 2K8GA 1NPKA 3CJTA 2MKSA 4LF9J 3BF4A 2YKAA 1WG1A 4JV2A 3H20A 1ZA1B 2BBEA 1S97A 4Y28C 5KFQA 1TKXB 1GX6A 2MQLA 5M2UA 2J7KA 1WC3A 2WVEA 1RHJB 3MMAB 5EWEA 2L9NA 3R8YA 2FZKB 2ZDPA 4N7TA 3CMES 5D4PA 1SC4B 4CIOA 1X0PA 4FVCA 3CCLS 4JI1J 3VQTA 3BGFA 4EGLA 3X1LB 3KUGA 3EZ5A 1M1KT 1N4LA 3I32A 1X5TA 2AJ0A 1C4AA 2MKJA 3BYPA 1C0UA 3RBDA 3JXOA 3UCUP 4DLEA 2L9DA 4PG4A 4CYUA 3CPWR 2BRLA 5HQ8A 1I94J 3A12A 2DIVA 4Q0BB 3MMAA 1H72C 2ACMA 2IM2A 3GR0A 3FCWA 4C7QA 1V3RA 3O2IA 3KLGA 1YJUA 3K5PA 3TOQA 3FSXA 3ELHA 1JLFA 2JC0A 4K50A 4ZVRB 4JYAF 3PJXA 4LVOP 4NZ0A 2VQEJ 1W2IA 2DH7A 2E5JA 2IM3A 1Z4UA 2FC8A 3H5UA 3T19A 3IBWA 2UU9J 2FHOB 5DGAA 1FDBA 3QWPA 1NSQA 4M5DB 4K4TA 2C3PA 4WWSA 3OT9A 1ZPWX 3M8WA 1QVFR 3OPKA 4RKUC 3RAQA 1R43A 3OTOJ 3M6XA 5F0UA 3KK2B 3P4UB 2M70A 1UA0A 1KVJA 4JBCA 1FKPB 3ISNC 1FT8A 3VVUA 4CTAB 3G8SA 2HQ3A 4H4MB 2ZOFA 3S1TA 1N36F 2LQJA 3K5LA 1UMJA 3T1HJ 1V5VA 1WKJA 3AD7C 3TZXA 2XULA 3DXBA 3T1YJ 1R6VA 4DUZJ 4NX9A 2ZWOA 1YJRA 3KK2A 5KFLA 1IKVB 2YQ0A 3BSOA 4CTAA 2JFDA 5BXIA 1GFWB 1OY9A 2AGQA 2CQDA 3D28A 5J2QA 2HQIA 4ZVHA 1T95A 4WJBA 3ZO7A 3Q8PB 2W01A 1KVIA 2JEIA 3NEKA 1DAXA 1ZM4A 1XTZA 4NLWA 2R8IA 1MMDA 1SBRA 2VJVA 2GAHC 2AKWB 3MAAA 1EKSA 4DFJA 1NPRA 4HL9A 3G82A 4HVZA 3OFFA 1QAIA 1IKVA 5B7WA 4LT6A 2ZUAA 3OTCA 4PPDA 1YJVA 2R7SA 4UOFA 4RW9B 5BYQA 4M8LA 2Y1JA 1GEHA 1QM9A 4IFVB 4RUBA 5CYMB 2I2YA 1EETA 2AEFA 1N5YB 4JV0A 4NLYA 2EFGA 4UTGA 5F8IA 1R0CB 5J1EA 3O3LA 3C3LA 2J9EA 3HHDA 3RBZA 4GC6A 2BE2B 5GMKa 1Q8KA 2E44A 5KFYA 1NJWA 1XNQJ 4ZPAA 2AGOA 3R7NB 1FHTA 1VJQA 5L39A 3HHLC 4FF1A 4X66J 1M1GA 3P8BB 1BGXT 2VPZB 3RTVA 4A8XA 3GWCA 4RW9A 3THTA 2JEJA 2QSFA 3FBEA 1W25A 4MIBA 4KJIA 3RR7A 4ALZA 5CYMA 3K57A 2ILZA 4WYLA 1Y5LB 1NHUA 1OYEA 1N5YA 2CQ1A 1IBKJ 2IY5B 4PAAA 1HQEB 2PEBA 4L75A 2RH3A 3ET6B 2BE2A 2EFPA 3D7SB 3I82A 4DPXA 1I5OB 1WF0A 2CYYA 2CQCA 2PO4A 2R2UA 2EKYA 3MMBB 1JJHA 1KKHA 1XIQA 3ILLA 3ZNUA 1RWKB 2UV8G 2IMWP 4M5LA 2AWZA 2G2ZA 2DO0A 2LU1A 1PC5A 2MQNA 3H40A 3HFZB 3ZZYA 3MI7X 1S9FA 2L41A 1QSSA 1HQEA 1Z2LA 1DFDA 3I31A 4KIAA 3D68A 1I1GA 1EIYB 4IO9Q 2XM3A 1EKRA 4AUKA 3CJQA 3V81B 3P6YC 2OEKA 4D3HA 4P2XA 3AH6A 4LRDA 1ZZNA 2ERRA 2QT7A 2PD1A 3MMBA 2A1BA 3RYLA 3CCUS 1WDTA 5HMXA 5KFEA 2VDIA 3BO2A 4RNOA 2LLZA 3CXCR 4Y2KA 5I42B 2Y3YA 3CCMS 1WG5A 4YS2A 1H38A 1FXDA 5E3QA 2HZCA 4O0IA 4P75A 3QZ8A 3M9NB 2Y8YA 2G1HA 2HHSA 3PIPQ 1HNWF 4DWIA 4NMXA 5A8RB 3I5AA 4RBTA 4YR3A 3SFGA 1SQGA 1EAYC 3N28A 4QW8A 1TZ0A 4C8KA 1FVQA 1RXOB 5LSRA 2BA9A 3R5CA 2BV3A 4QW9A 5I42A 3PJ9A 2HQFA 4GO5X 3TI0A 2MLZA 4DHVA 1JXEA 4USKA 4O4RA 3QYYA 4B9UA 2R2RA 1RB0A 4ER8A 4RW6B 3G87A 2XLIA 3F0NA 5A8RA 1YJ9S 1QE1B 1L3UA 4PWWA 3I4PA 2R7RA 2LXIA 1RACB 3DM2A 2M4MA 3OVAA 1YLXA 4I4BA 1SJRA 2NUUG 3KLHA 2WBMA 5ETNA 5HQLA 1S0MA 1TMJA 3UR0A 3TWZA 4NXMF 4F67A 5E3PA 4DV6F 2CRLA 1SI9A 2DYAA 4EYHB 4RLEA 1VK3A 3J7Z5 4PYDA 4YHHJ 1JLQB 3R2CJ 4RW6A 4G65A 5CQGA 3G6VA 1NO8A 3U1NA 4WZQA 2EWHA 1QE1A 2GCFA 1YRXA 1VQSA 4GRSA 4RR5A 2OJ3A 1HI0P 4DPWA 1H73A 2NQPA 4MKVA 3M9MB 4JI7J 4QYRA 1XWLA 3N6LA 1YBAA 3MR5A 3IM8A 3TA0A 4PCQA 5A6PA 2YWHA 1X5SA 2W2NP 3CULA 4EMDA 5EX0A 2UUCJ 4DX5A 4FDFA 1T9WA 3QGPA 1YG0A 2A3JA 2QMXA 5L8RC 3IWXA 4DUTA 2VPXB 4KHPF 1BY9A 1JLQA 4WU3A 2LDIA 3IP0A 1FKOA 2WSEC 3GIIA 3GYXB 4LF8F 2O3DA 3G6YA 2OEJA 4F3OA 1QAYA 2FZCB 4X62J 4WIQA 2B4OA 5KFAA 4O3PA 1RTDA 1KHVA 2A6MA 5CA5A 3WIUA 3OVBA 3GPAA 1WD6A 2VG5B 5LSOA 3A3PB 2AGPA 5GVQA 5FLXY 5KAKA 2U1AA 2DHGA 4GKKJ 2BMBA 3TUIC 3SDEA 2KFNA 1ZS6A 2Z2LA 2Q3PA 1TL1A 5ETLA 3PR4A 3KHRA 1VQYA 1SC3B 2N3LA 3J81U 2K1RB 3BSCA 3ETOA 5J2MB 2HBRB 3BBBA 4NLGA 5E3AA 1U49A 2NXUA 2DNYA 2XMVA 2DR5A 2HRYA 5E2QA 1TL7A 3MD1A 1R0AB 1T02A 2DXDA 2MZ1A 3T1YF 2V50A 1WTBA 1X4EA 2VG5A 1D0EA 2IHR1 2OTLS 1FRIA 4WU2A 3OXLA 3CD6S 4X4SA 2FLOA 2EG1A 4BWMA 2XC9A 1J2VA 1KLNA 1V3SA 4DR7F 5HBMB 1MWQA 2DHSA 3EGNA 4DSFA 2RJZA 4OYBA 3M30A 3DRSB 5J2MA 3QT6A 3VAGA 3POTB 2FQQB 2MHEA 5HROB 3GILA 2PN6A 2ILYA 2LQ5A 4M5JA 3FMBA 3QRQA 3ZTSA 2HAFA 1T7PA 1NDCA 2LECA 2V2VA 4R8UB 1LFPA 3CD5A 2YNGB 3EGWB 3LPYA 3EPIA 2IDEA 2PC6A 3GR1A 5KFPA 1UVMA 3CDWA 1D1UA 2XMMA 5HBMA 2P2CB 4OYPA 3R5JB 1UAWA 3BQ1A 2C28A 1VK8A 1LWEA 1H0HB 5D3GB 1DLOB 1VISA 2DGOA 3BS9A 4N56A 1UEUA 4Q43A 1JNZB 4ZPCA 4C0BA 3M8PA 1RAGB 3POTA 5HROA 4CQ1A 5ETVA 2KO1A 1JQGA 1N33J 2IBKA 4P7TA 4B3MJ 4DQSA 3D6MB 5J2PA 2CNOB 2O5DA 2ZKTA 2Z8QA 4R8UA 4MFBA 1F3VA 1GMWD 3TAQA 1YK9A 3MD3A 2AW0A 2KVQE 2FJWA 3HM9A 3M1VB 5KG3A 1V9OA 4X66F 1JJ4A 5DG8A 1KFDA 1FXRA 1RSCA 2HHPA 5KFMA 3RB0A 1HKAA 3HXMA 1SCJB 3WIVA 3PEHA 4DR2J 2FHKA 4AFFA 1IBKF 2XYPB 2ZD1B 3K8WA 4TU9A 3KMSA 4L3NA 4L6V3 2OIHA 4NRTA 1CC7A 2Z2MA 5L1LA 1GH8A 4LFBJ 3SQGB 4LF6J 1OYDA 1FA0A 4LFAJ 1VQ4S 2V6AA 5I3QA 4J9PA 1NK7A 1NKCA 1KLMB 1FD8A 4NLDA 2ROPA 5KG5A 2MJNA 1VMBA 1IBLJ 1U1KA 3H90A 1WF1A 2MDAA 3TUZC 4RUHA 1REVB 4JI3F 1NBEB 3KHLA 3KFWX 3N0VA 2JC1A 3MM7A 4FYDA 5T14A 3HFVA 2DT9A 4DN0A 3OVSA 2DTJA 4LUBA 2ZD1A 1UFLA 2LYVA 2DR6A 2DEIA 4OJHA 1PBUA 2M0GB 4N8OA 2YX1A 1FCAA 2QFJA 2BJ3A 3SQGA 5KFTA 1YZ6A 5B09A 1M5SA 2GGPB 1KOHA 2Y1IA 4JI0J 3JTPA 1Y4ZB 5G4DA 1XK8A 4ILRA 3CB4A 3CIZA 1S49A 1BHNA 4JV5F 2CJAA 4ZN3A 1TK8A 1MNEA 4I6WA 1FX4A 2AV5A 4D3GA 4R5PA 1N5VA 3OTEA 2DXEA 1RYSA 4DFPA 2LEPA 4Y2CA 4F0KA 3KXDA 2JDJA 2ZM6J 3B8HA 2G2YA 5JJBA 4HH0A 1OPZA 2YKNB 1KQGB 2OSRA 3IAS9 2BVZA 4A48A 2VZ9A 3RRKA 4Y6IA 2NUHA 2F40A 3SSSA 1WTFA 4FN5A 3D9BA 1SC6A 3KLIB 2K7JA 2CNLB 2YH0A 3W1YC 2WVBA 4H4OB 4Q44A 4KGKA 3OXGA 2DB1A 4KV8B 3LALA 4WPAA 4CCHA 5LL6d 1SKSA 3W65A 1FI4A 5C2CA 2VG7B 3IO1A 3KKFA 4A8QA 1TUWA 3BN7A 3CGIA 3HMJG 2POKA 2QYGA 3CW2C 3TZZA 3W8PA 2DHXA 2ZH9A 2CUYA 3GCXP 4I0WA 2YKNA 3M2VB 1CC8A 2IC3B 1ZAVA 3DRXA 3NGDA 3OJUA 3K89A 3WC0A 3CC7S 4K4UA 4DEZA 4H4OA 5LJ3Y 1XN9A 4KV8A 2CPIA 2RDJA 1YKWA 3G8TA 5IXUA 3Q8VA 4MH8A 4KRWA 2QEXS 1Q7LB 2DO4A 1YHQS 4NXNF 5KFCA 4HHJA 4DV7J 5B0FA 2EFVA 1YJTA 4ETZA 1CJUB 3NS5A 4PQUB 4YHHF 1RT1A 1S77D 3BBFA 3M2VA 4DOZA 2Z56B 2IC3A 1VQKS 5EDWA 3D0IE 3RUBL 1X4CA 2HW3A 3BGRA 3NGSA 1N34F 2GJFA 3BN4A 3Q8QB 4V1Ak 4WP9A 4Y2IA 2WB1D 5L1JA 3CE8A 3UD5A 1FEHA 5D0GA 3J80Y 2OPPB 4USMA 5DG7A 4RNNA 3DOKB 1FFSB 1HBMB 1NSAA 3V5RA 1CJUA 4PQUA 1CJTB 1NK6A 1NDPA 4ZA1A 1W2BR 2MY8A 4M5MA 3W7BA 1HBOA 3FCVA 1Q78A 2KXNB 3CC4S 1BUXA 3DFEA 1FERA 1NZAA 3GCWP 3QPIA 3LOUA 4RPFA 5KG1A 3EDQB 4OYMA 1LFWA 5D78A 1BQMB 1U2CA 3TQEA 2H5EA 3FJ2A 4KGXB 2ZH5A 2BJ1A 2GX8A 1HBMA 3C66A 1C0TA 1EB0A 3RRGA 1WEYA 1VRTB 4O3RA 3J7AN 3HZEA 5B08A 4B9VA 2VOOA 3RG6A 2H4WB 1FDNA 4C0OC 2KDOA 1YIJS 3NAHA 2OAUA 2VG6A 2MZJA 1WSVA 6AT1B 2XMJA 1Q53A 4OIXA 4DZ6A 2MQOA 2XWXA 2HAIA 5D0RA 1REGX 1BE4A 2DK2A 1S4EA 2G0IA 1QTMA 3TAMA 2UUAF 1GMVA 4PG7A 3I5CA 2LXFA 3UD4P 1QSLA 2JHEA 1HL6A 3QFHA 4G6VB 2JVRA 3RZAA 2BE9B 1VRTA 1DJ0A 3JS9A 3DDKA 2EW9A 4QU6A 3FBBA 5ADZA 3OR1A 4LF5J 1S0OA 3PIOQ 4FF4A 1NXIA 1Q86T 2G1DA 3QBCA 4CLWA 1IN0A 2VBXA 2F4FA 3KLFA 2BXJA 3DC2A 4NYOA 5EN1A 4ANDA 4UW2A 2VA3A 5A8KA 4JI6F 2V9KA 2WRMA 1ZM9A 4QR1A 2AX0A 4TLQA 2YWWA 3W5XA 4DV1J 4OYIA 3DLLQ 3LP2B 2DY9A 2J9DE 4J9NA 4MAKA 1T9VA 4CM0A 1OSCA 4NA3A 4DL5A 2R8KA 1UWAA 1J5EF 5IWAJ 5A8WB 4J9KA 2NZ4A 1Q81T 2JSXA 3VCDA 4F0HA 3FNNA 4U67Q 4CO5A 2YWEA 2MPUA 2J5AA 4YQWA 3SXLA 1XMOJ 4LIWA 3PG9A 5GAHI 1NDLA 4V19X 3LTOA 4M5NA 3HSDA 5KFWA 2HNZA 1WDDA 2DIUA 2DH9A 3ZTQA 3N4WA 5L38A 3DLEA 1J5OB 1U8SA 1C2PA 3KK1B 2FLPA 2KT2A 3AD9C 2RF2B 1RTZA 3LO3A 3S01A 3UWTA 4QJVA 1FTCA 1IWGA 5A8WA 2NXJA 2NREA 3PKMA 2JNJA 3D5MA 3HVRA 1QY7A 2CKWA 3HVTB 1PSDA 1S99A 4ERDA 4KC5A 3LANA 4FF3A 4ZCIA 4CNYA 2NXEA 1AA1B 5HI7A 4B9SA 2M2BA 4DV4J 5C25A 1RQ0A 4AT1B 2B56A 1CSJA 3KK1A 2RF2A 2D74B 1UJ4A 2KU7A 3IBCB 2V63A 4NYPA 2DXFA 5THWA 4Z2XA 2J8SA 2FHJD 4RNMA 1RT2B 3KNGA 3H4DA 4NYZA 4DL6A 1GXUA 4DR1F 3ZZRA 4PWDB 3CCTA 3BB5A 1U48A 2MKCA 3OFEA 3KTQA 2X3DA 2XS5A 2W2PP 4CZCA 1DBDA 1HYSA 2ZBRA 4OX9F 3PO5A 3MUMP 1XR6A 5LMNJ 1RISA 2HRUA 3M7VA 2XSFA 3TJAA 1OPIA 1AXQA 2YNIA 3MPVA 3ZZUA 1U6ZA 1RT2A 3U1MA 4ZCKA 1D9DA 1UPMB 1H74A 4PWDA 2DNQA 4OHYA 2M3DA 4E0DA 2M5YA 4J7CA 4FYVB 2XHWA 3PW5A 2DISA 4Q8EA 4P52A 2HBQB 2W4DA 2XMWA 2MEWA 1WEXA 3QT8A 2EC2A 1PYOB 2B5JB 5GAGI 3NXZA 2C22A 2RKIB 3PO4A 2BKOA 4ZJOA 1H7XA 4LBPA 1B3TA 2CIMA 5F8JA 2HEKA 1VOMA 1VLYA 2GO8A 5E41A 2IA0A 1CVJA 2D3ZA 3JSYA 4ETXA 4WFYA 1C4CA 3KWMA 2HBYB 1RHQB 3OW2R 2HKEA 3W66A 1JLAB 4ANEA 1N6QB 4ZPBA 1N56A 3BBCA 3NCPA 2NXNA 2B5JA 1RCOB 5C42B 4QWBA 4K4SA 4GVBB 2W25A 4BDPA 2KB2A 3CJ3A 1LW0B 1WORA 1DARA 1RP5A 2RDIA 4DFMA 4F7VA 3BKTA 5BYRA 2MHNA 2XLKA 4HR2A 5LMUJ 1X5PA 2FJAB 2N4CA 4ZVOB 3T9NA 2OHDA 1YVFA 3CSKA 3GE9A 5A0YB 3E01B 1YJWS 2FPHX 4Q5VA 3T5KA 3U02A 1D8ZA 2LQ8A 2GJ2A 4L74A 4C11A 3BJYA 1NH8A 2OI2A 5C42A 3QJLA 2AEMA 4GVBA 1SXLA 1KS2A 1UA1A 5HMWA 1Y11A 2N3OA 1X4BA 2ZC4A 3DLGA 2E5IA 5KFIA 1PILA 2XY7A 1BLUA 4F0MA 4RW4A 1P8GA 2OMOA 1IKYA 3V4MA 4DPTA 1YX2A 2RU9A 4IDKA 3M32B 2PMZD 5A0YA 3E01A 4LRAA 5K8PA 2MB0B 3KUEA 1RDRA 5CD4H 3NNAA 3ZZPA 2MGZA 4OX8A 3THPA 2QLXA 4ED1A 3MMCA 1HI1A 2YWGA 4ED7A 2BQ3A 2NXCA 3NBPA 4CWBA 5D0HA 5DZ7A 4TY8B 2HFZA 3FZBA 2EFQA 1JXLA 2E1PA 4BC9A 2BEFA 2L9WA 4XDCA 5AXMA 4KKOB 3ONQA 2BZ2A 3T41A 2ZH2A 2F4VJ 3QAUA 4PXBA 2UVUA 2HGLA 4F2RA 2ZHOA 3M8QB 4WFZA 4ZIVA 3HSGA 3M32A 2H65B 2X7IA 2DVIA 5DM6Q 1Q8BA 4WP3A 4PXEA 1NJYA 3MEKA 2PGCA 4PG8A 4ED0A 3LP1A 2BDPA 2HWIA 2HFNA 5FD1A 1M0SA 4H54A 1Q4RA 5HLFB 1Y3JA 4YFUA 1TMMA 2V4JB 4TY8A 5IC4B 2A18A 1N0UA 2VKRA 1O8BA 3VWSA 2GMJA 4ECSA 2NPFA 2FVSA 4KKOA 2KJVA 4USVA 3LGNA 1HLWA 2P6TA 4DR4J 3M8QA 1FE0A 2HNDA 1ZM3A 4F04B 1HR0F 2HLTA 5DLGA 2FJXA 3PEJA 1NHKL 1PJ5A 4KPYA 2NSBA 4FBUA 3OFHA 3AT1B 2CWKA 3ICLA 2M88A 3MPDA 2AF6A 4KO0B 2ASLA 2W7PA 2QLJB 4TXSA 1WHXA 5HLFA 4IH6A 2C1EB 5IWAF 3GLJA 3EXYA 2NPIA 2KG0A 1RHRB 5E3CA 1HWKA 1H98A 2JX2A 1XMOF 2CQPA 5CCLA 1T0TV 1HQUB 4AL5A 2IJFA 2JEFA 3CO0P 2XNRA 4LIRA 2X1FA 3C6TB 4RX6A 5JXSA 2E7WA 4BCAA 3DGVA 4BLGA 3D0HE 4KO0A 4ITSA 2B4VA 1Y5IB 3VV2B 4K0KJ 2OEMA 4ECWA 5H9FK 2WSCC 3N6MA 4DPUA 3Q0AA 3QJPA 3IS9B 1RTIA 5GAGU 3MZIA 3V6DA 5CXTA 4UOGA 1RWOB 4ZK7M 2OFGX 2E5LJ 1TL4A 2DPIA 2HHWA 2E9RX 2JEGA 3HO1A 1HQUA 2V5HG 1HHQA 4CLPA 2BR0A 3C6TA 3I96A 5M2RA 3DLKB 1RU2A 2KT5A 3TX8A 4DV3J 3ZTPA 4E2FB 4TU8A 2IVFB 1CJKB 4X4RA 2AHOB 4CT8A 1RABB 5DGBA 4K5RA 4W92B 3IS9A 1YTYA 3R7SB 3RAMA 3EPGA 1T05B 4B3SJ 1JLEA 2FVPA 2ROEA 2RIJA 2WVCA 4DSKA 1IKXB 5D4NA 4CLLA 1PAEX 2H9ZA 1NM2A 1S57A 2BJDA 5CYQA 1NJIT 3PCOB 1VI7A 2AQ4A 3DMJA 1MN7A 2IRXA 2EC0A 3DLKA 3C8YA 1T8EA 4H4KC 1CJKA 2XYGB 3NP5A 2VD3A 2J7UA 3VGSA 2J0SD 2HG4A 3KJVB 2ZNZA 2K7KA 2YX4A 3R5AA 4ES2A 4XTTA 1TKZA 3WC2A 4DN9A 5F8NA 1F9HA 2QGFB 4QWDA 3TA2A 3JAMU 3ZC4A 2M9KA 5KFNA 1V5IB 4M94A 1XNRJ 2YNFB 4ELTA 4JI2F 4ICLA 2GAGC 3PKYA 1M5VC 2HURA 2VA2A 2SXLA 4RW8A 2HVIA 1KC8T 3G96A 4HT5A 4ELUA 4EUVA 2E9TA 3T5LA 1SV5B 3AOAA 1JJ2R 1RT3B 4TU7A 1UW4A 2W9CA 2BM1A 3L7PA 3W9IA 2WOMB 1X4FA 1JLGB 3UO0A 3Q2SC 1DHMA 2XZWA 4O3OA 3IRWP 1OO0B 3QLHB 3TNVA 2EFOA 2YNFA 1HWUA 4QU7A 2MQPA 1KQFB 4KFBB 1N32F 3AFGA 5GADI 2LU2A 2UUBF 3PW4A 2PIIA 5CABA 1QTNB 2PMWA 1SV5A 3VF0B 1ZZFA 4HT7A 2DNMA 1Q8LA 2BACA 5K8OA 3LF0A 5EX3A 1P6TA 4IUFA 1JLGA 4KHRA 2ZOMA 2HZAA 4MIWA 2I5JB 2N82B 4W98A 3QLHA 4L73A 4P6QA 2H4YB 4KFBA 4K4VA 4HDHA 1L3VA 1NEEA 2J9CA 2W2OP 3MF5A 4WIIA 3JQJA 2CDRB 1FO1A 4A8SA 2FY8A 3FQLA 4RU9A 3IRXA 2GIQA 2V9WA 1S9EB 3SBMA 1IJEB 3UQSA 4IOCQ 2XNQA 3M9OB 2NCKL 2VFVA 3QO9A 2CPYA 4JYAJ 2H3EB 2R2SA 4C4WA 2ZZTA 3D6FB 4DV2F 1RWVB 1NB2A 3CTRA 4DR5J 2B4PA 2VPYB 1ACMB 3PW0A 5T41A 3M2RB 4P73A 3RW6A 2DKOB 4A8OA 3AXKA 1XBWA 1FE4A 4YUDA 3QQCD 4N41A 2XEXA 3AB2B 1RLCL 3MM6B 2NYHA 4PABA 3EVOA 4ZPDA 2B9WA 2ZBIA 1WI6A 4O23A 3D6HB 4KYZA 2EK1A 5LT5A 3RB6A 2F63A 1T9UA 3I6PA 2IVMA 1N36J 1RT6B 2NSCA 5KFBA 2V8PA 1UW9A 3IWNC 3EVWA 1RHUB 3HT0A 1IBCB 1TAUA 4M63A 5EGYA 5B0EA 1U25A 3MEGB 3DN9A 1K0TA 4NMLA 3UDCA 4ECYA 3IGNA 4DLGA 4DXLA 1H7WA 2QA1A 4PZVA 2BKPA 3H5SA 3VTIA 4LF1A 2I6WA 1FK9B 1AW0A 4URSA 3BDPA 2JFKA 2FYXA 1IKWA 1JKHB 2FGOA 4DSIA 1UPPA 4RBUA 1LXNA 2FVRA 1FXLA 2VBZA 1KHWA 2HQGA 3QJJA 4DR6F 3E2EA 2RHQB 2V67A 2V2QA 3CCJS 3LA0A 1RAHB 2Q43A 4ID5A 4TVAB 3TR5A 4B17A 3PZPA 1FK9A 2W2QP 4I64A 1HD1A 5ETTA 3T5HA 3JSMB 2UUTA 5KT4A 3VAKA 1JKHA 4L3KA 2DNKA 2WVFA 2XB2D 4CI0B 1LXJA 3GQCA 3AD8C 1VQPS 4EZ9A 2B9EA 4LF7F 2ZH4A 3FEZA 4USJC 2HBZB 4FS2A 2BX6A 1ZETA 4AD6A 4XAKA 3CDAA 2XCAA 2NLWA 2XCPA 1GMWA 1MROB 1SH2A 4DX8H 1RUSA 3O5TB 4FYWB 1M1HA 1RLDA 3VQSA 2IA6A 4J91A 3TVKA 3A4TA 8ATCB 8AT1B 2QX0A 1O0PA 5GAEI 4KY3A 3OLAA 4HHUA 2HFVA 3NNCA 3G6XA 3CT9A 2A0FB 4TNOA 4Q2LA 3DDIA 4YDXA 4NA2A 3L4BC 1HNIB 5GADU 3H42A 4J9QA 3EGVA 2JVOA 5HN0A 3WQPA 2UVRA 2WVDA 3K0JA 2GO9A 1U1PA 1L5UA 2Y1RI 1XEZA 2CPHA 3NWRA 4J37A 2QMWA 3CVKA 3TZYA 1R7IA 3OSPA 3EVMA 2HS4A 4WFBQ 3Q8RB 4OZJA 5AJ3F 3BR8A 3HHNB 2HVZA 2Z57B 3I5BA 5KFSA 4IFYA 4DQPA 1LEOA 2B3TB 4C6AA 2A2DA 2W2MP 3G2XA 2IM1A 4CDIA 1HNIA 4O4GB 5JMNA 3MFIA 3K2YA 4JI5F 4E98A 3OL9A 4CO0A 3CNQP 4RWWA 4YEAA 3TRGA 1VQ9S 1SB6A 4QR2A 5FIIA 5HK4A 3GTYX 5GMDA 2LXUA 4L76A 4DBQA 2UXDF 4F26A 1HNWJ 1CLFA 2L3MA 5JUMA 4F4WA 4OJ3A 4MMOA 2R9LA 3MTJA 2XSJB 1S7HA 4I2PA 1IR2A 2CZ9A 3HF5A 2AJFE 3NL0A 1S1XB 4O4GA 4CLSA 3TANA 1PJ6A 3NS7B 1KD1T 4X4OA 2GQCA 2GVDB 2KZMA 4M95A 3CJKB 5F41A 3GIMA 2C42A 2MMYA 3NRBA 4RNFA 2H48B 2OH2A 3ADAC 4MIAA 2DNPA 1LQ9A 4URQU 5GMEA 5C24B 1X4AA 2GNKA 5HL7Q 3GIJA 3NKYA 1Q7YT 3C15B 2OD4A 1NK0A 2NR0A 2R42A 2K3KA 4UZBA 1GK8A 4XO0A 1VJWA 3HI9A 4UF4A 2XSJA 4PEOA 1J27A 1TR0A 3TW0A 4ZPWR 1QDUB 2EFNA 1EP4B 2GVDA 1SL2A 2VODA 3MEEA 3CJKA 4K4ZA 3OUYB 1VR6A 4NLXA 2B8PA 4NXMJ 4C97A 3EZOA 1O5JA 5C24A 1S6QB 5DQIA 4DV6J 4X4TA 2UUWA 4G1QB 3HK2A 4JI8F 3C15A 2LKZA 2AP6A 4IQMA 4RNHA 1K73T 2HHHF 4ATNA 2WHOA 2VJUA 4NLVA 1AFJA 3PW7A 4NA1A 3RGIA 4DQRA 2UXBF 2F5GA 1EP4A 2P8IA 2YWFA 2BM0A 3QSIA 3KJQB 4ZDNA 2CQHA 1TKXA 4YB7A 4J9VA 4NLTA 3SCKE 2GQ2A 3OUYA 2AJ4A 5HAOA 5IQQA 3D1OA 1S6QA 3K58A 3UNGC 1UVLA 2GHVC 2HWHA 1WI8A 4KHPJ 1D8YA 2G2OA 1UFKA 1MWZA 2FHMA 4LF8J 4DR5F 1OIAA 2B7CB 1LV5A 1MG7A 4BBYA 1X9MA 4DSLA 5AE1A 4X4NA 2BABA 3UR3C 3NOCA 4WFNQ 1O51A 3O1LA 4OZLA 1VIXA 4Q0BA 3MOZA 3JQKA 3M8RA 4ED8A 4ZLNA 5CAAA 1UCNA 2R7VA 2KT3A 2DGXA 3FVYA 1KOOA 3FFIB 2I38A 2ZVIA 1PAUB 5DS7A 3PM9A 6FDRA 4FKXA 3HULA 4B9NA 1Y10A 3ZFVA 2ZJRQ 4OYOA 2NS1B 5KT3A 5F3TA 4YB1P 3MR2A 4M5DA 1KNZA 3OL8A 5GAEU 4OHXA 2CPEA 3K5MA 4DV0F 3THVA 3NLCA 4ANCA 3FFIA 5BR8F 4KH1B 1FKPA 4ECUA 4DR7J 1F60B 4C8NA 4C8LA 4DV5F 3BSAA 3VVTA 1S0NA 1UZDA 4O3SA 4NZ7A 4ZMMA 3LAKA 4H4MA 4L72B 2BRKA 2XY5A 3AQOA 1S4FA 2BJ9A 5I4MA 2W7OA 4FYYB 3P45B 3IAM9 1AYEA 2OELA 2J9DA 3LWLA 4LF2A 2KG1A 3ENAA 2F9JA 4DR3F 1M5HA 1XC9A 1OSDA 3DOMB 2XMTA 3C14B 3IR7B 3TP2A 4OQJA 2PMHA 3ENWA 1LNQA 2MXYA 3T3FA 1RBLA 3HD1A 2DR7A 2FLLA 4G1PA 1ZA2B 5K20B 5EUHA 3K8VA 2PEHA 3TX0A 3CD7A 4UOHA 1GX5A 1SIZA 3W62A 2VONA 2F1FA 1IBMJ 4YN3B 5J2NB 4H4KA 5SUHA 2HZVA 1JLCB 3DOMA 4OJGA 4J9MA 3C14A 1DZ5A 2UP1A 2GMHA 3ULHA 3I0RB 4PG5A 5IT0A 4UUXA 1K9MT 3ETMA 2VUGA 2AIRB 1BWEA 1Z2ZA 2DITA 3AJ1A 4IFVA 3KK3B 1FRLA 4LBIA 4YB5A 2YVSA 2M8DB 4NCAA 3AJDA 1AZSB 2D9PA 4MJKA 3MAQA 2WCXA 1U1MA 3H98A 2KH9A 2RS8A 2FGCA 1RE1B 2D3UA 5J2NA 2JL9A 1JLCA 2QIFA 2ZNYA 1RI7A 1NUEA 4I69A 1X8DA 2XZTB 2PSZA 4HHHA 2ZE2B 1NRKA 4OZ2A 3BQ2A 1RWUA 4JI3J 2ZH1A 3KK3A 1LWXA 1Y3KA 1KBRA 4CLZA 1TK0A 1D09B 1AZSA 3NNHA 2C2RA 3QRPA 1LW2B 3UFCX 2W8KA 2CG8A 1HNZF 2Z2ZA 1HARA 3ET6A 2CPFA 1ULRA 3M6UA 1WF2A 4YY3F 1DTTB 3KJNB 3PDNA 5K8MA 1U0SA 2V4QA 4QYZJ 2ZE2A 3CEDA 2ZHBA 1TQLA 2E7XA 4JI4F 3LW5C 1S9GB 1FJGF 2FHJA 4RO0A 4NLQA 4JV5J 2VICA 4LFCF 3J7ZT 3SV4A 2EG2A 3VZIA 5C7PA 1RAJA 1LW2A 3SQOP 5EWFA 3DKDA 3HT3A 3Q8YA 3DLBA 3QWUA 1D9AA 1WHWA 4F4KA 3V81A 1IR1A 1DTTA 5H9FJ 2RQ4A 2QL7B 4WCEQ 4LREA 2AJ1A 2FLNA 2V2ZA 3QT7A 1SIWB 3JYTB 1NMEB 4TYBA 1S9GA 5H1SV 1LWCB 3OJSA 1APSA 1R8BA 2HFSA 2OFHX 3N79A 4FNIA 2OSQA 4CLKA 2AYBA 2AJ2A 4CO3A 4O44B 1P9YA 3AOBA 2AEJA 4F3MA 3DYAB 4CNZA 3PRVA 5IM0B 3HVAA 2DNGA 4LQ9A 4FXWA 1K47A 4EBDA 1UWBB 3ISND 5LJ5Y 3LWMA 2DNNA 3CJ8A 2C2MB 2QG9B 3O6QA 5EHHA 3L95X 2M52A 1MLAA 2HVHA 3A8KA 3RU0A 5HMZA 5F8GA 4ED3A 4B9MA 3DNCA 3SCIE 5JVGQ 4USTA 3TUPA 4UUWA 1UJ5A 1LWCA 3E51A 3SZ2A 2GVZB 1FRXA 5K9FA 1FJ7A 1HD0A 2DRDA 1B7FA 1A9NB 5KFFA 2OKQA 2FD2A 5E7OB 4NXNJ 1UWBA 4DCOB 2QYCA 4ED6A 4U95A 4CO2A 4F02A 2DNZA 1XR5A 3GV7B 1YBTA 5D0EA 3SV3A 3D3CJ 3HX9A 4F50A 1TU0B 1CG2A 3UPFA 3CJ4A 1N34J 3TARA 2GVZA 3NGUA 4OFZA 1ZTTA 1GTHA 2CJQA 3M2UB 5F3ZA 2Z0GA 4LRFA 4OV1A 4NZ6A 2V8DA 3GJRB 3V4IB 3EX7B 4EBEA 1WOSA 1VQ6S 4FS1A 1GXTA 1VRUB 1R27B 4B9LA 2YKQA 2B9YA 1FKAF 3QAEA 1JX4A 1FWKA 1VQMS 2KJWA 3EICA 3FBCA 2XG8A 2COLA 4DS4A 5L9XA 2F7VA 3PRBA 3U27A 1S6PB 5D4LA 4X2BA 3TYTA 4OHZA 3PX6A 1UL3A 4KH0B 1RK8A 2WW4A 3C46A 2V4RA 2E29A 2R7UA 5L1KA 4NL5A 3KHHA 3HHLD 5AXKA 3V4IA 1VRUA 3L7UA 2IAJB 4IQXA 1I3OB 2W7AA 1MU2B 2RUSA 4HTJA 1TV6B 2N4DA 2R7XA 4C8OA 1BMQB 5A6WA 2C2ZB 3WDOA 4XPEA 2KN4A 2LMIA 4MK7A 3AQPA 2D7SA 4ZP8A 4XPCA 3KDOA 1A6LA 4PR6A 1HPZB 2KXFA 2C2OB 3FEYB 2UV8A 1VBYA 2RAQA 4I67A 2VDHA 2PE8A 2IAJA 4WKRA 2UUAJ 2MZRA 2MKIA 2QLFB 4ZCMA 5CHCB 2HHVA 3IGVA 1R8AA 4P74A 1TV6A 4MYUA 1SVDA 2W1BA 2K1RA 1GXLA 5I3UB 1KN6A 4X4QA 2AYEA 4DDFA 2ASJA 3CMAS 3WZ0A 2CJBA 2V8HA 5A2QY 4R0EA 4B3TJ 3C16B 4X4PA 1R0AA 1U47A 4ZHRB 2K06A 1TTHB 4DF8A 1CJVB 1HPZA 2VQFF 4LQ3A 4DU7A 4NCBA 4JI6J 4U8YA 3IFEA 2Y1LB 1WHYA 2H54B 3W63A 4ECRA 1TAQA 4A8MP 1FRHA 3PNIA 2DGTA 5CYJA 3LPEA 2HNYB 3UN5A 3DRSA 2F8MA 1WG4A 2KZZA 1N5QA 3NY0A 1SKUB 5I3UA 2AU0A 1XMQF 3EGZA 2OPRB 3AHPA 3JAMY 4QBUA 1J5EJ 2ATLA 4OZ5A 1WKLA 3H2UB 3C16A 2HRTA 4ZPVR 1RTJB 2CADA 4C8YA 1IBMF 1RADB 1GTEA 3R9LA 2YNGA 1VQ5S 2CAJA 5BYSA 2LVWA 2QSWA 3LAMA 5ETOA 1FD2A 3R2DJ 1JLBB 1U4BA 1EX8A 4LR8A 2HNYA 1D3WA 5D3GA 1DLOA 2OPRA 2HGNA 2OPSB 4N5SA 1RTJA 1IXKA 2XS7A 2VFUA 2VU5A 2RT3A 3PRDA 2P5VA 3L9ZA 4FXVA 3DU5A 3J81j 3MFHA 5CZVA 1FWPA 3HD2A 3EUNA 3M1VA 1RWNB 3P49B 1HFEL 3HHKA 2RNEA 1N54B 3GFXA 3ZZTA 3K5NA 1AUSL 1RYRA 1EARA 5IQ6A 1HNXF 4I56A 1CBKA 4ZP6A 2XI2A 1AT1B 3CCRS 3W2VB 1ZYQA 4EO8A 2QL5B 1U6FA 3MXHP 2XI3A 2PFFB 1DQ8A 4ZVQB 1RKJA 4B02A 4Z37A 1BWVA 3CCVS 2AYGA 4DL4A 1NJXA 3D2WA 4EBCA 2ZUGA 2VKZG 1KLMA 2HHTA 4ILMA 4DR1J 5C2GA 2VL1A 1REVA 3TEGA 2Y9HA 4OX9J 3L7OA 3TQ1A 3H2VE 3W2VA 2DGSA 3TJ8A 1HWLA 4LR9A 4I7FB 1RA7A 4WXWA 3PFOA 4F4YA 2DY1A 2Z4PA 2WK4A 3GU0A 4MKAA 2GGPA 5IT4A 2RILA 2YTCA 2JZ5A 3TZWA 2FB0A 3GYGA 2VOPA 4ZJQA 3RW7A 2JOQA 3NS6A 3AB4B 1IWAA 2WTFA 4I7FA 2LCWA 1FDAA 4M5KA 5F9LA 4N8NA 2DHHA 4Y65A 1C0UB 2QFIA 4OX6A 2CPDA 1QUVA 1S6OA 5DO2A 5KG2A 3MM8B 4CYUB 5K5MA 3BPSP 4PPZA 1BQNB 5KG0A 3HHEA 2HS3A 3KLIA 2HSEB 3E3XA 4OZ0A 2B9XA 3QGHA 2B6AB 2KYZA 4KPCA 2LEBA 3MDFA 3VGVA 5HO4A 3KLGB 3LQVA 3TEHB 1JLFB 1N52B 2VG7A 2H5JB 5B0BA 1KTVA 3UNYA 4JOUA 5KFDA 2Q6CA 3CC2S 5IT9Y 2QRRA 4AQYF 1FWLA 2OTJS 4M1KA 3MGJA 1VQOS 3MM8A 3B4DA 3AA8A 1BQNA 1U1LA 2GA7A 3FQKA 3OL7A 1OMSA 1X5OA 2B6AA 1WC6A 3NGTA 1K1QA 3D4JA 2AZ1A 3EMTA 2DNRA 3MPWA 3X3UA 4K59A 1VS3A 3L09A 2J6SA 3HCXA 2L08A 4OYXA 3DXSX 2R3VA 3Q23A 1N48A 4NE9C 5C5JA 1S5ZA 5K14B 3NGKA 1F9FA 2HPUA 2H5IB 1ICEB 2CJXB 4NCGB 3KG4A 1KFSA 2MQMA 4KGZB 1SJ4P 2R7TA 3P5BP 3Q22A 2E1MC 3SSQA 3PYFA 3UW1A 2IM0A 4MKBA 4QIEA 1PYSB 3CUNA 3IXQA 2V34A 3O8WA 2KRRA 5JVHQ 3Q2TC 4J9UE 3FK4A 2NZCA 2P9GA 1BXNA 2C2NA 2OPPA 4ENOA 2IDLA 3DOKA 3VGTA 2LEAA 1TKTB 1Q1KA 5T7LB 1CJTA 5J2QB 5K14A 3HP6A 4NEZA 3CF5Q 2J6TA 4NCGA 3US5A 4AXIA 2HLUA 2VFSA 3MAAB 4X64J 4EFAC 4B08A 2KVIA 4YMEA 1F5BA 5J1NA 3G82B 1A7GE 3N9UC 4OZ1A 2UXCF 7FDRA 2HQDA 4LBHA 1BQMA 2RDDA 1FNMA 4FKYA 3VAMA 4IOBA 1VFJA 1LK7A 1TKTA 1XR7A 1R3NA 5T7LA 4ZKAA 1EETB 3NCRA 1HHTP 2ZJPQ 3B82A 5J1EB 3UN2A 3KG0A 1NK4A 1UZHA 3H25A 4OZ3A 4B3TF 4PKDB 4K5SA 1R31A 4EEYA 3HJFA 5A76A 3R27A 1HW9A 4O3QA 2DEJA 2RQMA 1NAQA 3MURP 9RUBA 1P9QC 3NCQA 1HR0J 4K8RA 3UCGA 2ADCA 2RRAA 5CD4A 2GIRA 2QZ8A 3PYDA 2XLJA 3KMQA 3R1LA 1VQ7S 2LP4A 3VAFA 3PX4A 3W2WB 3P3DA 3ENQA 1N5SA 4WK3A 3U1LA 4I2QB 3DHWC 2CPXA 4ZIWA 4IR1A 5F8MA 3WX8A 2HVEA 1WUUA 3DLJA 4LSZB 4I68A 3BKFA 1ZM2A 2Q6BA 3LP2A 2W4PA 3QMQA 2YWKA 1U7LA 4QIWD 4KHMA 4DQIA 1NHVA 1FRMA 1NU4A 4N76A 5G0RB 2XQCA 3W2WA 4I2QA 3GFYA 3HPOA 4C3KA 3BREA 5B0AA 4EO6A 4HYKA 4K7QA 3CCWA 3FDSA 3QFWA 4PYAA 1SPBP 1SUQB 1K8AT 2IVYA 2X3GA 3EWGA 4F2SA 3SI8A 1J5OA 2Z2YB 1TP7A 2C3YA 2RU3A 2PA8D 2YXLA 2MZQA 5CZXA 2VBYA 1JNRB 3PYEA 2JH3A 5G0RA 1HA1A 4DCPB 2DGUA 3FSYA 2IYGA 3HVTA 4P9SA 1MN9A 2R8JA 2KFYA 5FJ4A 2R8GA 1C1CB 1NSKL 2J7WA 4M5GA 5DDQC 2FJVA 1WC0A 5ETQA 2I8EA 2RRNA 3UDLA 4KGVB 1SUQA 4J9RA 1VGYA 1NDKA 3G4SS 4F4XA 2RD5C 1LK5A 4J9SA 2ZJQQ 4ZVFA 4ZCLA 1PG5B 2O01C 4Y2AA 1U1QA 2FJEB 3NMRA 4OJ1A 1S10A 1FTRA 2MSTA 4X84A 4ED5A 2XO6A 1C1CA 1QUPA 3DM2B 3KYLA 3MCOA 1HQ2A 3CJ2A 5ETPA 3WX4A 1PJ7A 5E33A 1R89A 2CQ3A 3ZZ0A 1T9TA 3KLHB 2ZH7A 1QAJA 4JI2J 4OYZA 4LR7A 3GSDA 2B43A 2ZZNA 3CIMA 1FJEB 1SJFA 3PYGA 2DR8A 4IH7A 5DDOC 2V2KA 1OY6A 5AE2A 5KFJA 4OYWA 1SQEA 4JV1A 1NZ8A 2DH8A 3D6TB 3ILIA 1KR4A 2VB6A 4QWAA 2DGVA 1NCLA 2CVIA 3W8GA 4DJBA 3SFUA 1X4DA 4LF9F 2J8AA 2ZBQA 5KFXA 4P2SA 2FVQA 1WELA 3SEOA 2BKNA 2ASDA 3JSBA 4KT0C 1ZAXA 3A3OB 2KM8B 3HLUA 1MMNA 4OZNA 3G71S 2U2FA 1N32J 2GZOA 2CDQA 5SZTA 4IH5A 2UUBJ 3QT5A 4JI1F 2B0GA 1Y5NB 3RBXA 1Q95G 4Z7YA 4NLRA 1U02A 1SJQA 1TELA 3RJMB 1QD1A 2H1YA 1G4CA 1HMVB 2QLBB 3O44A 4DSEA 1FKOB 5KOWA 1OQ3A 2RKIA 3OV7A 4A8YA 2ZH8A 1PBAA 1NB7A 4Q2MA 3CDUA 3TVZA 3UDEA 4XDDA 2FJBB 3AA9A 3DI6B 1RTDB 4K4XA 1I94F 4J90A 4NRUA 1WACA 1ZOTA 1WEZA 5M2PA 4A8WA 3GIKA 4C3MA 2CQBA 4ZLJA 4N77A 1JB0C 4BC7A 4U6PA 1JLAA 4N47A 3CCSS 2EI5A 1HI8A 1N6QA 3SDEB 4ZVUB 1XQIA 1TL1B 2PFDA 2VQEF 1HMVA 4KE5A 1G6BA 2XO7A 2VH7A 2A6OA 2UVVA 4QPXA 2UU9F 4OLPA 1R8HA 2YH1A 3ZXWA 3DI6A 1URRA 3RRHA 5HJYA 5IV4A 1RAIB 1TL7B 3GG1A 4FPIA 1T9YA 4OI6A 4GKJJ 4DV2J 1LW0A 2AMCB 1QLNA 2YQ3A 1CULB 2QMUB 2YY3A 3NMAA 3OTOF 4KR0B 3DU6A 3K17A 4B9TA 4ILLA 1AROP 4LVNP 3MCNA 5GAHU 1YWXA 2GHPA 2J0XA 4DS5A 3M30B 1FFWB 1TFYA 1HBUB 2FVCA 3T1HF 1QJHA 4MK8A 1T9XA 1VBXA 3A1YG 3CO9A 2IJNA 4X64F 2ZHAA 4DUZF 4YP3A 1CULA 3IC1A 1BQXA 4KTQA 2J0WA 2AD9A 3CJ5A 4DG1B 4DFKA 1V6HA 4ECXA 4B3RJ 4NOHA 3GB0A 4C9DA 2ZWPA 4P10A 4U9RA 4F3QA 1PCAA 1FNXH 1LWEB 2CJYB 1PO6A 4UZCA 1TKDA 4CLFA 1U8WA 4QIGA 4R0JA 1HBUA 1DY3A 4Q8FA 3M8PB 1HWIA 3ZZZA 4W90B 3HKWA 3BKUA 2KI2A 2ZOGA 1VCTA 4HH1A 4I6YA 5J2PB 4MFBB 1TUGB 3K59A 3OD2A 3GJQB 5AXLA 3T9ZA 4NLOA 1S48A 1RAFB 2HGMA 4DG1A 4Y2MA 4PWUA 4TKTA 2DD8S 1S1TB 4RWXA 2VFRA 4QPTA 2P9EA 1YI2S 4DR6J 1F2HA 3T5JA 7FD1A 1M90T 3DRYA 3MTKA 4KGMA 5IS2A 2RSQA 3J7YI 3AAWB 3B4MA 1R0BG 1G7CB 2CQ2A 3QZ7A 2V4JA 2GHWA 2O66A 2VV5A 4J9OA 3MCSA 1XNQF 5L46A 1UVNA 2UVWA 1T94A 1DTQB 3OQ2A 2IBOA 4QZVB 3N6NA 1HNVB 4J9LA 2OP5A 3CDBA 1S1TA 1IQZA 3A13A 1UETA 3C2PA 4LF7J 3MM7B 4ZPTR 2QJ3A 1R8CA 3PX0A 4P2MA 1P27B 4AL6A 1E6VB 1X31C 5LM7E 1BC6A 2WZ1A 4DU8A 1KRPA 1WOPA 2MYFA 3CDEA 4ZVGA 4Y3CA 3BGLA 1DTQA 4M5IA 4GC7A 1NKBA 1HNVA 2QC3A 4ES1A 2DJWA 4DUYJ 2FTRA 2V94A 4FXDA 2OD6A 3MM5B 3NG8A 1QAXA 4FVMA 5LXYA 4DPOA 1IM6A 2XYHB 1S12A 1S1VB 2D41A 4R5PB 3IG1B 2PA3A 4PXDA 1NKEA 4DSJA 1E6VA 1YRTA 3A8IA 2VC0A 4WTOB 3LGHA 4LJMA 2GIFA 2G0JA 2KHCA 4WP8A 3JB9k 4CH0S 2D69A 3HVWA 2KL8A 2ACYA 4RW7B 4TLRA 2HWTA 1T11A 3I55S 5HVHA 2QTWA 3PXGa 5IFMA 5KFKA 1FESA 2VFTA 3MUTP 3ENVA 1RZMA 3KDNA 5ETKA 3F73A 3MM5A 3MAHA 2J76E 5AJ3J 4E8UA 4RUCA 1VHIA 1S1VA 2OGUA 3B78A 3IG1A 5KFZA 3BDEA 5H9EK 4JI5J 1HW8A 3KLVA 3Q8UA 1KQKA 4MT1A 4OX7A 1S79A 2IPOB 2P9CA 4RW7A 1XERA 2LA4A 3JSRA 1T05A 1Q0NA 2MKHA 3H5YA 2UXDJ 1IKXA 3UE2A 2JRSA 2BYCA 2F8EX 4OI0A 1NK9A 4ED2A 2YKOA 4ZS6A 3BV8A 1PGZA 1FJCA 3M8YA 3TA1A 3Q89A 1QSYA 4YB6A 1VBZA 1F3FA 1X60A 2HHQA 1VDHA 3KJVA 1WKKA 1RT1B 5DLFA 4WKYA 1RU1A 1CPZA 4FP9A 3UVJB 3EYZA 3R3TA 2IFXA 5KFHA 4C0HA 3J81Y 3MOJB 3BGRB 3OHBA 3SCLE 2ZH3A 1KWMA 3KLEB 3VR1A 3GJSB 2HS0A 1F0XA 2W4CA 1EHWA 3PVXA 3D54A 3JTOA 2AT1B 4ED4A 7AT1B 1RGVA 4EWTA 1XJWB 2B4UA 3SIPB 2MZSA 5KFGA 2YX7A 4USUA 3QSYB 1SKWA 4OL8A 1Y0HA 1UVKA 3GJTB 3OTBA 2CJ9A 4WXOA 5L1IA 2CFXA 1SL1A 1RT3A 3KHGA 2DGQA 3UVJA 1HBOB 2BANB 4HEA9 3N5FA 2WOMA 5B0GA 3KLEA 4JI8J 4JI7F 2CQGA 2HMIB 2HHHJ 1IJFB 1NK8A 3DOLB 1U0HB 2I9SA 4LF4J 1L3TA 4O3NA 2UXBJ 3W61A 3MPUB 2UUCF 2DCUB 2OMLA 1T3NA 4ZITA 3HZGA 1HHSA 3IBFB 1C0TB 3MCMA 3BR9A 2MKYA 1GQEA 4HI1A 2E1CA 4JB8B 2MY7A 2BANA 3UN3A 4X62F 3DCAA 1TFWA 1OS5A 2WW8A 1VC0A 1N0VC 3DHXA 4PQAA 3BO3A 2I5JA 2VG6B 2HMIA 3HHLB 2C2DA 4WF9Q 2C2KB 4GKJF 3J7YU 3DOLA 1U0HA 1IM4A 4IO1A 2BQUA 3G86A 3VHQA 3OFGA 1WHVA 2BW2A 3MR6A 3RB4A 5LXRA 4GKKF 3TAMB 2C2EA 2ZITA 1C1BB 1S9EA 3MMJA 5B0CA 2BOAA 3CCZA 5KTQA 3N01A 2HK2A 2E5HA 1S59A 3OR1B 1GNKA 1U2FA 4DX7A 4DMZA 3HHLA 4TQSA 3OLBA 3V2UC 3KLFB 4F4ZA 4CM2A 5A8KB 3M2RA 3BH7B 4CP5A 2G4BA 3KOAA 2DR9A 4CRJA 4B3RF 1EZZB 3NWGA 5J1PA 3BM7A 3GV8B 1M5OC 6FD1A 3MM6A 4DV0J 4ZN1A 3V6HA 2BE7D 5MAOA 1Q8IA 1C1BA 2ZBCA 2CPJA 2DGWA 5BR8J 4U96A 4MKYA 2A10A 3PV8A 5F8HA 2Y8WA 4DV5J 2YNHB 4PUOB 3MR3A 3W60A 1ZBTA 4FPRA 1LOUA 2MZTA 1CEZA 5F8LA 4HI2A 1RT6A 3CJ0A 5F9NA 1MWYA 4QR0A 3EE3A 1RBAA 2HNZB 3R6LB 3FC9A 4DR3J 3OL6A 1K44A 4F4AA 1B70B 2OUGA 2XBPA 2X1AA 1N5TA 1WWHA 3R5BA 3HJVA 2E7VA 1L3SA 3DLEB 4QOTA 4C8ZA 4FYXB 1Q16B 1KEKA 3ILJA 3HKZD 3M4XA 4ZLLA 4OI3A 3C6UB 1WC5A 3EZUA 3MEGA 4C48A 3FMWA 1F6TA 4YOEA 1S1UB 2QL9B 3KUHA 1KSPA 3M8SA 2YNHA 4PUOA 4IKAA 2ALZA 4LMZA 2R7OA 1N33F 1JWWA 4ZVSB 4RL1A 2ZKUA 1TL3B 4B3MF 5KFUA 4P72A 3VGUA 2EBEA 4A8KA 5K8NA 2ZFHA 2RQKA 5C25B 4LSNB 1YITS 3ZTOA 3N5BA 1RBOB 4LRCA 1Q5YA 5D15A 3W5YA 3C6UA 4WFAQ 3MM9B 1S1UA 1RAEB 4A47A 4RU2A 4DR2F 1FRJA 2A2CA 8RUCA 2CZ4A 5E5NA 1YGYA 2F65A 1G1XA 2BOPA 3GMGA 4GO7X 3GV5B 4W4MA 2FZGB 4USIA 1TL3A 4XK8C 1AUDA 2LA6A 1M5PC 5HJXA 4LFBF 3JSMA 4LF6F 3AXMA 4LFAF 2RHSB 4AE5A 2XS2A 2MSSA 3M8ZA 1HBNB 3GFHA 2CG4A 4DUYF 4LSNA 2GW8A 1IBLF 5ETSA 2ZZMA 3I0SB 2FUG9 1U24A 2ADBA 1HYSB 4U7UK 4XIUA 3QATA 3HSZA 2HYIB 1X7VA 3GSIA 1N8RT 3MM9A 4C98A 4ZVEA 2C3MA 1KP6A 2FDNA 3QIPB 4Q7AA 1MROA 2YNIB 1VBKA 2CJKA 1F5AA 3T1AA 2GMLA 3OSNA 1MMLA 1HBNA 3QNWB 1RA6A 4JI0F 1HNZJ 1PIEA 3I0SA 3GP9A 5HMYA 2IRUA 2O67A 4YY3J 1L3KA 2XTJP 3J7A1 3ZNJ1 3HFKA 2Q79A 3MECB 3CJSA 4X65J 3QIPA 4JI4J 4ECQA 1V3ZA 2X1GA 1FJGJ 4KB7A 2HQCA 1AFIA 2VASA 3U7JA 2ZM6F 2VHGA 1YZ7A 4K2XA 4LFCJ 5DZ6A 2CXEA 4WBFA 1EQ0A 2ALYB 1NNDA 4AYBD 1YJ7A 2O1PA 2DHAA 4OYAA 4DL0C 4IYQA 5CCMA 5HVGA 2F8HA 4C3LA 5D6GA 2Z30B 3Q8SB 2BJ8A 2QA4G 5F0WA 2RB7A 1WC1A 3MECA 1RT4B 2PT0A 4BWJA 5D77A 1F2GA 4NASA 3H5XA 3DLHA 3IWLA 1VYAA 2HHUA 2E9ZA 2WB4A 4PG6A 2JJ4D 2MQ8A 3TVYA 3NAIA 1S72S 2LQBA 1P1LA 1IQTA 3PFEA 2IRYA 2AYMA 2PDAA 1RT5B 4CO4A 4ZVTB 2CPZA 2Y0SD 3FUYA 2V0NA 1FFGB 1ROFA 3QGGA 1U26A 1RT4A 2D3O1 5I3PA 1B4SA 4USWA 1S1XA 1SJ3P 1H6KX 2QA4S 5DM7Q 5AXNA 4DV7F 3MWBA 2H51B 3F56A 2V68A 4EK2A 2KHDA 4OI1A 4C11B 3GZ7A 5IZHA 2XGPA 4ZOSA 4ZP7A 2QLWA 4P2FA 2EEYA 1NPPA 4DL7A 4A8FA 3SSRA 3DLGB 3BPDA 1RT5A 4WFXA 1VQNS 1B99A 4RW4B 4LF4F 1IKYB 5KFRA 3B6BA 4M5HA 4KAIA 1YJNS 4IDKB 3OHAA 4UY8T 4OMFG 2GJIA 1RCXB 4MK9A 2ZBPA 4NWBA 4IRCA 3GIRA 4UOCA 2MGZB 5KFVA 2V8GA 3S8SA 3MMCB 3R5GA 1OWXA 4G1QA 3NBPB 3EDRB 1PC4A 1RHKB 4DI6A 4TY9A 3C19A 3UDVA 3HSJA 1NH7A 1K0VA 2JLEA 1NK5A 4WK1A 2QV6A 3I56S 2PI4A 2CNNB 5CH7B 3K7RA 2BJ7A 4FBTA 2GFFA 3FBFA 4UT4A 3OBIA 1U1RA 3LP1B 4TYAA 2Q66A 3MEDB 3EJMA 3H7HB 3DDNA 4Y00A 2DPJA 2MKKA 4IOAQ 1O6XA 2ATCB 3NGRA 5FDLB 2EK6A 1WOOA 2AZ3A 2IMOA 4OI2A 4QWCA 3SMZA 4UQGA 1SQFA 1DQ9A 1UVIA 2LFVA 3PR5B 5DETA 2X51A 1XMBA 2HNDB 2FIUA 4HTIA 2ZC3A 1UP1A 4R25A 1D9FA 1HWJA 3IMQJ 5HP1B 2XHCA 3IN5A 2L48A 1VIOA 2N7CA 1VRQC 3UCZP 2E66A 3MEDA 4NI2B 3ITHB 4AL7A 4FNHA 4UY85 4DX6A 5FDLA 1YDLA 2V8VA 4LF5F 4K4YA 2MQQA 2IJRA 5U47A 1U09A 1FRKA 1SL0A 1YBUA 3UD3P 5HQMA 4OHVA 4S0MA 3EM1A 3W9HA 2BW7A 3H8YA 2YPYA 3JTNA 1X4GA 4CLTA 4AXJA 5HP1A 1F9EB 5ETMA 1T03B 4DV1F 4DL2A 2VQFJ 4CO1A 1UVJA 3CD0A 2E5GA 3UI3A 3CCES 4NI2A 3DRPB 4CH7A 1U45A 3ITHA 3Q86A 2HFOA 3FZ2A 2DBBA 1HIYA 2XY6A 1JK9B 4NLUA 4QYZK 4WZMA 3VALA 1RTIB 1RWMB 2R7WA 1Y00A 4RBVA 3VZHA 3V6DB 1XMQJ 2RUGA 9ATCB 4TN2A 5KT2A 1CS4B 2F3JA 3D3BJ 3W5ZA 1RT7B 1T03A 4QCLA 2UZAA 4QIVA
chains in the Genus database with same CATH topology
1V9OA 4X66F 1JJ4A 4I68A 5DG8A 1KFDA 2I1RA 1I6JA 3S7RA 3F41A 1FXRA 4FS2A 2HHPA 1ZETA 3DRPA 5KFMA 1ZM2A 3RB0A 4WYWA 4XAKA 2Q6BA 3LP2A 3CDAA 2XCAA 2NLWA 2W4PA 3HXMA 2XCPA 1S1WB 1MROB 3QMQA 4NLSA 3PEHA 1SH2A 2YWKA 4DX8H 1VC5A 4Q45A 2FHKA 2DNHA 1U7LA 4QIWD 4AFFA 4C2MA 1IBKF 3O5TB 1S76D 4KHMA 4DQIA 1NHVA 2ZD1B 2WBRA 1FRMA 1NU4A 3K8WA 4TU9A 3KMSA 3L3CA 3ZZOA 4L3NA 4L6V3 4N76A 5G0RB 1JLEB 3W2WA 2OIHA 3FRYA 4NRTA 2ZDOA 3VQSA 2IA6A 3TVKA 1CC7A 2Z2MA 5L1LA 4I2QA 1O0PA 4DV4F 3SQGB 1GH8A 3GFYA 5GAEI 1X4HA 4QQBA 3HPOA 1FA0A 1VQ4S 3OLAA 3FRZA 5I3QA 4J9PA 1NK7A 4ECTA 4C3KA 1NKCA 1RT7A 5CYQB 1KLMB 3BREA 4G3IA 1FD8A 5B0AA 4KQZA 3I9ZA 4NLDA 4EO6A 4HYKA 3G6XA 3NNCA 2ROPA 1Y7PA 3CT9A 3CCWA 4TNOA 5KG5A 3DMJB 2MJNA 1VMBA 3FDSA 2B7BB 4Q2LA 4YDXA 1U1KA 4NA2A 1WF1A 2MDAA 3TUZC 1SUQB 2HIQA 3GG0A 4RUHA 2IVYA 1K8AT 1REVB 4JI3F 2X3GA 3KHLA 3TUJC 1HNIB 3KFWX 3N0VA 3I0RA 2JC1A 3MM7A 4FYDA 5GADU 5T14A 1S1WA 4F2SA 5KT7A 4J9QA 3SI8A 2JVOA 4J5OA 1J5OA 5HN0A 2DT9A 2UVRA 4DN0A 3OVSA 3K0JA 2DTJA 1TP7A 2GO9A 2C3YA 1U1PA 2RU3A 2PA8D 4LUBA 2MZQA 2ZD1A 5CZXA 5D4OA 1UFLA 2VBYA 1JNRB 1TKZB 1L5UA 2Y1RI 2LYVA 2JH3A 1DQAA 5G0RA 1XEZA 5ITHA 3SCJE 4OJHA 2FY1A 2M0GB 2CPHA 4N8OA 3QGIA 2YX1A 1SH0A 1FCAA 2QFJA 1HA1A 3FSIA 4J37A 2QMWA 3SQGA 5KFTA 3CVKA 2DGUA 3FSYA 2IYGA 3HVTA 1LKZA 5B09A 1R7IA 2KYXA 3OSPA 2R8JA 1M5SA 2GGPB 2KFYA 2HS4A 4WFBQ 2R8GA 5FJ4A 3Q8RB 1KOHA 1C1CB 4OZJA 2J7WA 2Y1IA 1YRUA 3JTPA 3BR8A 5DDQC 5AJ3F 2HVZA 2RVJA 3I5BA 3VAHA 1Y4ZB 2FJVA 3HHNB 4IRDA 5G4DA 5KFSA 1XK8A 2I8EA 4IFYA 1SH3A 2RRNA 4DQPA 4IRKA 2P6SA 4ILRA 2RE1A 2XMUA 3UDLA 2B3TB 4ICLB 3CB4A 2A2DA 2WONB 5L9NA 1SUQA 2IM1A 4J9RA 4KSEB 2QA2A 3CIZA 1S49A 1YSJA 3R1HA 1VGYA 1HNIA 2CJAA 5LMNF 4O4GB 4JV5F 4RW8B 3G4SS 4F4XA 4ECZA 3Q24A 3CCQS 1TK8A 1MNEA 1JMTA 3K2YA 4I6WA 3MFIA 3AJ2A 4JI5F 2AV5A 2RD5C 4D3GA 4X65F 1LK5A 4E98A 4J9SA 2ZJQQ 3OL9A 2BJEA 4CO0A 4ZVFA 4ZCLA 1URNA 2O01C 4Y2AA 4R5PA 1U1QA 1N5VA 4OHWA 4RWWA 2FJEB 3OTEA 1R6YA 4YEAA 1RYSA 5DQHA 3TRGA 4DFPA 2LEPA 4Y2CA 2G13A 1VQ9S 5D8HB 1SB6A 4QR2A 5FIIA 3P5TL 5DDRC 2Q1LA 2W9CB 2JDJA 3NMRA 3B8HA 4OJ1A 4Y0FA 5JJBA 4DL3A 1S10A 1FTRA 2LXUA 2WAQD 4HH0A 2DNLA 4DBQA 2UXDF 2MSTA 1G3OA 1OPZA 1TL5A 5DQGA 4F26A 2YKNB 1KQGB 2OSRA 4X84A 3IAS9 2BVZA 4IG0B 4A48A 2VZ9A 4ED5A 1CLFA 2L3MA 3RRKA 1C1CA 4Y6IA 5JUMA 2NUHA 4F4WA 4OJ3A 4MMOA 3V6JA 4HKQA 1QUPA 2F40A 3DM2B 1WTFA 3SSSA 3KYLA 2R9LA 4FN5A 3MTJA 3CJ2A 4UQTA 5KG4A 3WX4A 2C3OA 2XSJB 1S7HA 1SC6A 2K7JA 3KLIB 1R89A 2CQ3A 5E33A 2WONA 5LSLA 3ZZ0A 4I2PA 2YH0A 4K4WA 3HF5A 2AJFE 3NL0A 4H4OB 3G8QA 1S1XB 2D1CA 3KLHB 4O4GA 2ZH7A 4Q44A 4KGKA 3OR2B 1U6BA 3TANA 3OXGA 1QAJA 2VBWA 2DB1A 1KD1T 4KV8B 3LALA 4X4OA 2D3OR 3GSDA 2B43A 1UJ6A 2ZZNA 2GQCA 3CIMA 4CCHA 5LL6d 2KZMA 4M95A 1FNOA 3RBEA 1FJEB 1SJFA 3CJKB 5F41A 3GIMA 2C42A 2MMYA 3NRBA 1SKSA 2OLWA 4GMKA 2DR8A 4IH7A 4RNFA 2VG7B 3IO1A 5DDOC 2OH2A 3KKFA 4A8QA 2V2KA 3BO4A 2M8HA 3BN7A 3CGIA 4MIAA 5KFJA 5AE2A 2DNPA 1LQ9A 1TVRB 4URQU 3HMJG 1SQEA 4JV1A 5C24B 2POKA 2DHXA 1X4AA 2GNKA 2VPWB 4JUZA 2DH8A 5HL7Q 2ZH9A 5KT6A 4I0WA 2YKNA 1KR4A 2VB6A 3FEXB 2YKPA 4QWAA 3NKYA 3GIJA 1SKRA 4IG0A 1VQ8S 2DGVA 3M2VB 4C8MA 1CC8A 3HDSA 2CVIA 1Q7YT 2IC3B 2OD4A 4DJBA 3GFZA 3SFUA 1X4DA 4LF9F 1NK0A 2NR0A 1ZAVA 2J8AA 3DRXA 2K3KA 1DRZA 5KFXA 4P2SA 2FVQA 1WELA 2KRBA 4XO0A 3NGDA 1VJWA 1S6UA 3SEOA 2E1RA 3OJUA 3HI9A 2ASDA 3JSBA 2XSJA 4KT0C 1TR0A 2B51A 3WC0A 1ZAXA 4EYIB 2N7YA 1JIHA 3D0GE 3BSNA 3CC7S 2K3IA 2KM8B 4K4UA 4DEZA 2GQQA 4H4OA 4OI4A 3TW0A 3HLUA 3I9V9 3OR2A 5LJ3Y 2G9OA 4ZPWR 2EFNA 1EP4B 2NYIA 1MMNA 3E8OA 4OZNA 1XN9A 4KV8A 3I4HX 2ABYA 3G71S 2U2FA 2CPIA 3JYTA 1SL2A 2VODA 2CDQA 3QIDA 2RDJA 3MEEA 3CJKA 1ZTWA 5SZTA 1S0VA 3IRXB 3LP0B 4IH5A 1UKUA 3G8TA 5IXUA 4MH8A 4KRWA 2B0GA 1Y5NB 3IA0A 4JI1F 4K4ZA 4O44A 1Q7LB 2DO4A 2QEXS 3OUYB 1YHQS 4NXNF 5KFCA 4HHJA 4NLXA 5B0FA 1OQ6A 4NLRA 1TVRA 3G9CA 1SJQA 1UFWA 2XMKA 4ZP9A 4C97A 1O5JA 5C24A 3DYAA 1S6QB 1HMVB 2EFVA 3O44A 1YJTA 5DQIA 4DSEA 4ETZA 5IM0A 1FKOB 3NS5A 3QO9B 2EBGA 4PQUB 4X4TA 4MYTA 5KOWA 4YHHF 1MW7A 2APOA 2UUWA 1OQ3A 2RKIA 4G1QB 1RT1A 1S77D 3RB3A 3OV7A 3HK2A 3M2VA 4JI8F 4A8YA 4DOZA 2ZH8A 2IC3A 2YKMB 2LKZA 1CQMA 1NB7A 3FGVA 1VQKS 4Q2MA 5EDWA 3D0IE 3CDUA 2AP6A 4IQMA 4RNHA 3TVZA 1X4CA 4XDDA 1K73T 2HHHF 2FJBB 3K5OA 5H9EJ 2KXHA 3AA9A 2HW3A 4ATNA 3DI6B 2WHOA 3BGRA 4NLVA 3BQ0A 1K1SA 1RTDB 4Y34A 4USHA 5KT5A 1AFJA 3PW7A 4NA1A 1N34F 2RMLA 2FC9A 4K4XA 2PI5A 1FEEA 4DQRA 1I94F 2UXBF 4NRUA 5LMUF 1IUJA 1LWFB 1WACA 1H2VZ 1EP4A 1ZOTA 3BN4A 3Q8QB 4LF7F 1WEZA 4Y2IA 2YWFA 5M2PA 2CZVC 2WB1D 4A8WA 2BM0A 1B0PA 3GIKA 1H2UX 4ZDNA 2CQHA 1TKXA 2CQBA 4C3MA 5L1JA 1GAOA 4N77A 2ROGA 4YB7A 1JB0C 4BC7A 4U6PA 3CE8A 1JLAA 4NLTA 3SCKE 3LP0A 4N47A 3CCSS 4IR9A 2EI5A 1HI8A 1FEHA 4X4UA 2GQ2A 1N6QA 3OUYA 3J80Y 3SDEB 2AJ4A 2OPPB 5DG7A 2QE5A 4WE1B 4RNNA 5IQQA 3D1OA 3DOKB 1Y9OA 1HBMB 1TL1B 2VQEF 1S6QA 1HMVA 4KE5A 3K58A 3V5RA 1G6BA 3UNGC 4PXCA 2W9BB 1UVLA 4PQUA 1H3DA 2CQ0A 2GHVC 1NK6A 3IR6B 2XO7A 4X4VA 2XWYA 4ZA1A 1W2BR 2VH7A 5EWGA 1UEVA 2MY8A 2HWHA 2UVVA 3W7BA 2YKMA 4QPXA 1WI8A 1KTQA 2UU9F 1HBOA 1D8YA 5KG7A 1Q78A 4ES3A 4OLPA 2KXNB 1R8HA 2YH1A 3CC4S 3DI6A 2M7SA 3I87A 3DFEA 1MWZA 2FHMA 1FERA 4DR5F 1OIAA 1URRA 1NZAA 2E1AA 4B3OB 3RRHA 2B7CB 3QPIA 1LV5A 3GG1A 2CQ4A 4NPOA 3LOUA 4OI6A 3KNAA 4BBYA 5KG1A 1LWFA 1X9MA 1LW0A 3M6WA 4FF2A 1QLNA 4DSLA 5AE1A 4X4NA 2YQ3A 3IR5B 2J6UA 3NMAA 2YY3A 3OTOF 2BABA 3UR3C 1LFWA 4WFNQ 4I6AA 1Z1ZA 1O51A 4KR0B 3DU6A 3O1LA 5D78A 1BQMB 4OZLA 4F8RA 1VIXA 4B9TA 4Q0BA 4ILLA 3MOZA 2H5EA 3FJ2A 3M8RA 2ZH5A 4ED8A 4ZLPA 4BS2A 1AROP 5BJRA 4LVNP 3M2UA 2R7VA 2KT3A 4WE1A 2DGXA 3FVYA 2GX8A 1HBMA 3VAJA 1KOOA 5GAHU 3FFIB 1YWXA 2GHPA 2J0XA 3C66A 3G6ES 2I38A 4DS5A 2W9BA 3P96A 1C0TA 4CH1A 3M30B 3RRGA 1B0TA 1WEYA 3SYZA 1IR0A 1VRTB 4O3RA 3HZEA 2RS2A 1TFYA 5DS7A 3PM9A 5B08A 2W9AA 4BHQA 1HBUB 2KKHA 2FVCA 3DGPA 6FDRA 4B9VA 3T1HF 2VOOA 1QJHA 4MK8A 1VBXA 1X9SA 1FDNA 4B9NA 4B3OA 3GYNA 3MUVP 4QIFA 3A1YG 4URGA 4C0OC 1IKWB 2KDOA 3MHYA 1YIJS 3EXCX 3NAHA 3CO9A 3ZFVA 1P1TA 2OAUA 2VG6A 2NS1B 5KT3A 2IJNA 2ZJRQ 2MZJA 3D1HA 1WNEA 2F4VF 4X64F 2ZHAA 2GC8A 3OXFA 1TUVA 2XMJA 4DUZF 1Q53A 5F3TA 4YB1P 3H2LA 4YP3A 3IC1A 3MR2A 4M5DA 4OIXA 1KNZA 2MQOA 1BQXA 1H2TZ 2HAIA 2XWXA 4I1TA 4QWEA 2BQRA 4KTQA 2J0WA 4CT9A 2AD9A 1S6PA 2DK2A 3T6JA 2R8HA 3CJ5A 3OL8A 5GAEU 4DG1B 4OHXA 4DFKA 2CPEA 2KFZA 1V6HA 4ECXA 3K5MA 4DV0F 4NOHA 3GB0A 3THVA 4C9DA 3NLCA 1QTMA 2KM8C 4EU0A 3TAMA 1VHFA 4F3QA 2WSFC 4U9RA 1X9WA 2UUAF 3FFIA 1FNXH 5BR8F 4PG7A 4DF4A 1LWEB 1MSWD 3I5CA 2LXFA 3UD4P 1PO6A 3T6BA 1QSLA 4ID5B 2JHEA 1HL6A 4G6VB 2JVRA 1FKPA 2G0CA 4ECUA 1TKDA 1F60B 3A8EA 4C8NA 3RZAA 1VRTA 4C8LA 1ELOA 4YR0A 1DJ0A 4QIGA 4DV5F 3BSAA 2HHXA 4R0JA 1HBUA 4DQQA 1S0NA 4O3SA 4Q8FA 4NZ7A 3DDKA 4ZMMA 3M8PB 3LAKA 2EW9A 4H4MA 1HWIA 3ZZZA 4QU6A 4W90B 1ZPVA 1MU2A 4L72B 3HKWA 2BRKA 5ADZA 2KI2A 3OR1A 2XY5A 1S0OA 3AQOA 4OLOA 3TAPA 3PIOQ 4FF4A 1S4FA 5I4MA 2ZOGA 2W7OA 5DRKA 4DR4F 3IAM9 4HH1A 1Q86T 2J9DA 2G1DA 4I6YA 3LWLA 5J2PB 4MFBB 2KG1A 1IN0A 2VBXA 3KLFA 3K59A 2BXJA 2F9JA 3DC2A 5AXLA 3T9ZA 4DR3F 4NLOA 4NYOA 1S48A 1M5KC 4DG1A 1FVSA 2HGMA 4NLPA 5EN1A 3RAXA 1M5HA 4UW2A 2VA3A 4Y2MA 5A8KA 4JI6F 3H59A 5E0OA 1RKIA 1XC9A 4HDGA 2V9KA 1OSDA 1ZM9A 2WRMA 4PWUA 4QR1A 4TKTA 2DD8S 1S1TB 2AX0A 4RWXA 1FF2A 4TLQA 2VFRA 5E3RA 4QPTA 2XMTA 2JLGA 3IR7B 2W24A 3WBZA 3DLLQ 2P9EA 3LP2B 3TP2A 3OTDA 3V6KA 2J9DE 4OQJA 1YI2S 2PMHA 3ENWA 2MXYA 3T5JA 7FD1A 4J9NA 1RTHB 3T3FA 4MAKA 1M90T 3DRYA 1OSCA 3MTKA 4NA3A 4DL5A 2DR7A 4KGMA 2FLLA 2R8KA 5IS2A 4ECVA 4G1PA 1J5EF 2JLFA 2RSQA 3J7YI 3AAWB 3B4MA 3S6EA 1G7CB 5A8WB 4J9KA 2CQ2A 2NZ4A 5EUHA 3MPYA 1Q81T 3QZ7A 2JSXA 2PEHA 2OPQB 2V4JA 3CD7A 3K8VA 2GHWA