5CH7B

Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
total genus 86
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ch7B00
2PMZD 1PC5A 2ZVSA 2VPZB 1FD2A 2WSFC 3MMBA 2FJEB 3EUNA 2UZAA 1FDNA 5FD1A 3IR7B 5BYSA 1BQXA 1B0VA 2Y0SD 1F5BA 3OR1A 2VPXB 2PDAA 5CH7B 2C3OA 1FRIA 4OMFG 1F5CA 3MMBB 1C4AA 7FD1A 1H0HB 1WTFA 2PA8D 1DAXA 2FD2A 1FXDA 2VPYB 1PC4A 3C8YA 3LW5C 1BWEA 2VPWB 1H7XA 2C3YA 1KQGB 4DHVA 1HFEL 1JB0C 1JNRB 5L8RC 6FDRA 4L6V3 2Z8QA 2V4JB 1FRLA 1FRMA 1FDBA 3IR6B 1B0TA 4Y28C 3OR2A 4AYBD 4XDCA 1FTCA 3MM5A 3HKZD 1KEKA 2VKRA 3MM5B 3MM8B 1FEHA 1GAOA 1Q16B 1G3OA 1Y5LB 1DFDA 3MM9A 3MM9B 4XK8C 3MM6A 3EGWB 4RKUC 1A6LA 2V2KA 3MMAB 3IR5B 1G6BA 1FDDA 1VJWA 3OR1B 1B0PA 3MM8A 1SIZA 3EXYA 2WB1D 1SIWB 1H98A 2O01C 2C3UA 1GTHA 2V4JA 2WAQD 4KT0C 1GT8A 1FDAA 1Y5NB 2XSJA 2IVFB 1XERA 2FDNA 5CHCB 2C3MA 2C3PA 4XDDA 3PNIA 1C4CA 1RGVA 1IR0A 1DURA 2WSCC 1FRHA 2FJDB 1F2GA 2GMHA 3MM6B 1JNZB 1SJ1A 1AXQA 4OV1A 1Y5IB 5BYQA 3MM7A 1D3WA 4YDDB 6FD1A 1CLFA 2GMJA 1BC6A 1FRXA 1IQZA 2FJBB 1GTEA 1KQFB 2FJAB 2XSJB 5E7OB 1FF2A 2C42A 3OR2B 1H7WA 1FRKA 1ROFA 3MM7B 1R27B 1FRJA 1FCAA 1BD6A 2FGOA 5BYRA 3GYXB 4ID8A 1Y4ZB 1BLUA 3MMCB 3MMCA 7FDRA 1FXRA 1FERA 2WSEC 1K0TA 3MMAA 4CI0B
chains in the Genus database with same CATH superfamily
4N47A 3J80U 4BDPA 1HBUB 4F4KA 2HFSA 4A8KA 2PEBA 4QR0A 1HQ2A 1YJWS 3BQ1A 3GIJA 4I2QB 2NSBA 3BSAA 5FD1A 2FJWA 4I0WA 3E2EA 2QSFA 1NH7A 1S6PA 3CE8A 4KFBB 3T9ZA 5KT5A 3QSYB 2ZDOA 1QAIA 3CEDA 1TUGB 3GJTB 1QE1B 2Q6BA 4YQWA 1IVZA 2MQNA 1HBOA 2CJBA 2HZCA 2IYIA 1DTTA 2G2ZA 3O2IA 2YVSA 2FVCA 2F40A 4WFAQ 2V4RA 2H9ZA 1HBMA 3CDBA 3VALA 2M7SA 3BDPA 1KOOA 3DCAA 2NS1B 4PQAA 4TN2A 3CCJS 1HI1A 1FXDA 1UJ6A 1YJUA 3E3XA 3IN5A 4B9SA 4LF7J 5KG1A 4B9MA 2GJIA 4URSA 3QJLA 4ILRA 3HSJA 4Q0BB 2QA4S 1S5ZA 3OTOJ 1CEZA 4B17A 1OPIA 5D3GA 1ZAWA 3TQEA 5L8RC 3OVSA 2U2FA 2YNHA 4LF4J 2F7VA 2V4JB 4ICLB 4M5GA 2AGPA 2ZC4A 3OXFA 4NXMJ 2VBWA 2F4VF 3PYDA 4Y28C 1WACA 2R3VA 3OR2A 4A8WA 1NMEB 4OI6A 1TL4A 1S6QA 3HKZD 3H8YA 3SCLE 5A0YB 1URRA 2X1BA 3I0RA 3CD7A 3KNGA 3MCNA 1KWMA 4DEZA 3CCTA 3QIPB 1HYSB 3RUBL 3IP0A 2CQ0A 4ED5A 1U8WA 3G82B 4ETXA 4HTIA 2CQCA 2MMYA 4O44A 2E5IA 3OXLA 4P52A 2A6MA 5KT3A 3V4IA 2DXEA 2GAHC 1UCNA 2DISA 2BA9A 3P3DA 3US5A 2ZM6F 1U48A 3CD6S 4WZQA 2KO1A 4Z7YA 2LA6A 1RAJA 2QLBB 1C0TB 3ZZYA 4NXMF 2OD6A 2AYEA 1VDHA 5IWAF 1J5OB 1IKYA 1HLWA 2D9PA 1IKYB 1ZPWX 2VB6A 4LF4F 1Q78A 4NXNF 2XNRA 3W2WB 2WAQD 4IG0A 3TJ9A 3W2WA 3W66A 2CQ3A 2RE1A 1RWOB 5B0EA 4C8MA 3EVOA 3UO0A 2I1RA 3OTOF 3PW2A 5T41A 1YJNS 2QL5B 5J2MB 4HVZA 2LLZA 5A6WA 1HI8A 4HLBA 3C2PA 4K4UA 3BREA 4P75A 3LTOA 2C3MA 4WK1A 1WHVA 2XYHB 2GNKA 1HNVB 1GFWB 3BYRA 3FQKA 2DIUA 4G65A 3EWGA 3CJKA 5HMXA 2R8GA 4C3MA 5ETRA 1DTQB 5DG9A 3KLHA 3AOAA 1IKVB 4X4QA 2GMHA 2DRDA 2JLGA 5IFMA 4DL3A 2IMOA 3LP2B 1UW9A 4Q2MA 4KHRA 2F9DA 2QFIA 4BC9A 1FE0A 4OV1A 1C2PA 2Z2ZA 4OFZA 1CS4A 2CRLA 3L3CA 1FNXH 4JI0J 3RRKA 3FKBA 1RJJA 4UTGA 4ENOA 2UUCJ 4CLSA 4GKJF 4B3RF 3NS6A 2XY5A 2UV8G 1SPBP 1QSLA 1N5VA 1JLFA 1IQZA 1GQEA 4IFVA 2VIHA 4IR9A 3I5CA 3EGVA 1S59A 4CO1A 2NXCA 4EGLA 3WC0A 4X4PA 1U1NA 1A9NB 4RNNA 3UNYA 3CJ8A 1DQAA 1GMUA 3QO9B 3Q8PB 1Q5VA 4PQUA 4MKBA 3GYXB 1RAOA 1TZ0A 4ID8A 4OYWA 4FS2A 4RUCA 5C25B 2HQFA 1JK9B 2WBRA 3MMCB 3UQSA 5HVGA 1S1VA 1S4FA 1C0UB 3DOMB 4DL7A 1MWQA 3DRPA 3I0SA 1SJQA 3ICLA 3MTJA 2X7IA 5BJRA 3NKYA 5HO4A 4P10A 2QLJB 3Q89A 2XEXA 1ZZFA 1JX4A 2B4VA 3PHEA 2FB0A 1EX8A 2ILYA 1YBTA 3CJ3A 3D7SB 3PEHA 3ZZOA 4DUYJ 3D6TB 1HNVA 1FD2A 3CJKB 1IWGA 2WSFC 4ZOSA 4LFBF 5HJYA 2WRMA 2FPHX 2C22A 2FJEB 1ICEB 1VBZA 4LUBA 2A2DA 4B9NA 2GGPA 2BBEA 3TX8A 3MUTP 3DI6A 1ZA1B 2IDLA 4FPIA 4TXSA 5F8HA 2D1CA 3MTKA 1VRUB 4ZLLA 4C97A 3OR1A 4KE5A 2VQEF 1N5QA 3AD7C 5L9XA 3VGUA 4CH7A 3CCUS 2AMCB 3M2RA 4MYTA 2YX7A 2BZ2A 2LQ9A 3M2RB 1R0AA 4LVNP 3J7Z5 4QIGA 1C4AA 2C2ZB 3L95X 3UR3C 5EX0A 3UR0A 1YBAA 4ZJQA 2VA3A 1VRTB 2GW8A 3QT6A 5HATA 3RYLA 1WC4A 2APOA 4DFMA 2GS8A 2KRBA 3NBPB 3UDEA 2ZOMA 3ILOA 3PYFA 1QUPA 2A2CA 4U6PA 4M5JA 3RBXA 3LWMA 1TVRA 1VRQC 1WDTA 3I0RB 2J0WA 5F0UA 1HQEB 4P73A 1DJ0A 3NCRA 2AYMA 1WDDA 5DQHA 5T14A 4PPZA 4RW8B 4OX9F 4DMZA 4C6AA 3A8JA 1RK8A 1RWPB 2X1FA 3K57A 4FKXA 2IDEA 1U1RA 3FRYA 3KJQB 3ZTRA 1IM4A 2G1HA 2DBBA 4C8KA 2CWXA 2BJ9A 5K8PA 3C16B 2BACA 4F4XA 1AROP 5ADZA 1N33F 4DR4J 2YWWA 3M8YA 3NLCA 1U1LA 2CPHA 3MEGB 3KK3A 4RKUC 3UE2A 1NK5A 4LF5J 4ZVHA 3NMRA 1HD0A 1X31C 4KC5A 1RDRA 5D0GA 2YWGA 5AE2A 3H2UB 5K14A 3MGJA 3KK1A 4OZ3A 2A6OA 3AHPA 4ZKAA 1RTJB 4DR7J 4CIOA 4DSJA 3DGVA 5B0CA 2J8AA 2M2BA 4PG4A 5DETA 4QU7A 2L3MA 1UJ5A 1JLGB 3C6UA 3HFZB 2ZH2A 1S6PB 1WOPA 3C15B 3CIMA 3NAHA 1YZ7A 4CLUA 1X0FA 2V8GA 2FVQA 3GYNA 2XC9A 4QR2A 2KM8C 3T9NA 3IG1A 4DV6F 3NP5A 3OT9A 3D3CJ 3PRVA 2RU3A 1TVRB 1RCXB 1S1UB 3DLBA 1S1WB 1U49A 1UVIA 3IWNC 4O4RA 4Y2KA 1KQSR 2GX8A 1RT3A 1RISA 3KDNA 2AJFE 2ZEJA 2AJ0A 5KT2A 2D3O1 2WVFA 2HNYA 3DLEB 3V4MA 1PGZA 5A2QY 3UW1A 4USMA 2OTLS 2L41A 2EG2A 3TJAA 4RL1A 3MPUB 1XMOF 2GZOA 1HL6A 2MY8A 2WCXA 1MU2B 2LEPA 2LQBA 1K0VA 1HBUA 4YDDB 3VR1A 2ZNZA 4ZDNA 2GMJA 2BV3A 1SJ4P 2OPSA 2R7VA 3FC9A 3D1QA 1HI0P 1VC5A 2DCLA 4R8UA 4NLXA 3FBCA 2MDAA 3NNAA 1V3ZA 1TKTB 5HI7A 4XIUA 2HHUA 4I64A 2XSJB 2C42A 5C2CA 2DR9A 4MKYA 3MM7B 1R27B 4QOTA 1HNIA 5ETTA 2FGOA 3FJ2A 5BYRA 3X3UA 4DR6F 1R0BG 4M94A 4B3SF 3DKDA 3QFHA 3OSNA 3JSMB 1M0SA 5EX3A 1FERA 4O44B 1W2BR 3IS9B 5KTQA 3CD0A 2VOPA 2HZVA 2QYCA 3CUNA 3H59A 2JZ5A 2F8HA 2HBQB 4NYOA 1NDKA 2KHCA 2ZBCA 3QPIA 2L48A 3KK1B 3J7A1 5HP1B 5D3GB 1RAIB 3CD5A 4RZRA 2IYGA 4RNOA 3GIIA 3M2VB 4UY85 5HMWA 1NLKL 4AFFA 3ISZA 2MZ1A 1PSDA 1FDNA 2P6TA 1Y3KA 4DZ6A 3GCXP 1N0VC 2ASYA 3OPKA 3R9LA 3M8RA 4ID5A 2HLTA 1T7PA 3PYEA 3DLHA 4USUA 3GSDA 5FJ4A 1QDUB 4X62J 2MKIA 1YITS 1KHVA 3GILA 3LALA 1QAXA 2I5JA 1X8DA 2IJRA 2Y1JA 4OX8A 4TYAA 2PA8D 4EK2A 4DI6A 3UCZP 4F36A 2DNPA 4NA2A 4WTOB 2R7WA 4HACA 4LT6A 5CZXA 3SCJE 3PX0A 2C28A 1TL3A 1TQLA 4DPOA 4CO5A 1F0XA 1KQGB 1EB0A 1HFEL 1KLMB 2AEFA 3D0GE 5A8RA 3CMAS 1ZZNA 5KFPA 2DGXA 2F8MA 4A8FA 3RBZA 4JI6J 5A2QU 4QWAA 5I3PA 3S8SA 5HROB 2UVRA 3BJYA 1NK7A 1WG4A 2DKOB 2O66A 2V69A 3CJRA 5THWA 3G71S 2Z56B 1IBMJ 1FX2A 2RMLA 2CQPA 5A6PA 5AE1A 5I3UA 2OPSB 3A8EA 3UVJB 4GC7A 4K4YA 1S4EA 4LFCF 4ZVPB 4OYPA 4DX5A 1BQNA 3KDOA 3OTEA 4DCPB 1V5IB 4E2FB 5LXRA 4DUZF 4PG5A 3RW7A 2AWZA 1HQUA 4QYZK 3KLVA 1WG1A 5SUHA 2HHWA 1IM6A 2XS2A 2KFYA 1S6OA 2JFDA 2AIRB 3N4WA 3KNAA 1B0PA 1CQMA 1YJ7A 3GONA 2N3LA 2RD5C 2IA0A 1UAWA 2WVCA 5KFIA 3EZ5A 1BHNA 2DHHA 2A1BA 4QJVA 4HDHA 4LF5F 4TVAB 4CLTA 2RS2A 2C3UA 2H4WB 2M3DA 4B3SJ 2CJAA 2GGPB 2ZBQA 4MK8A 4ZVQB 1KRPA 4N76A 1LK7A 2J0SD 1UL3A 1RWNB 3MR3A 5KFVA 2W2OP 1BWVA 2B8PA 1LEOA 4I6YA 1FWPA 1K9MT 4A4JA 3QQCD 2DEIA 3UDVA 4ZN3A 3Q22A 3VAKA 4DV5F 4NLYA 3RB3A 4G1PA 4XDDA 1SJ3P 3FMBA 2QX0A 2DHSA 2DY1A 4RW9A 4A8SA 1PIEA 1TL5A 2H48B 3AQPA 3DOMA 2XMWA 1A0OB 4KPCA 4IFVB 3OL7A 2LQ5A 4ED8A 1S0MA 2EG1A 3IBWA 4ECUA 4CLFA 4PRFA 1KDNA 2OH2A 1R6VA 2BKNA 3AD9C 3H2VE 3TA1A 3UPFA 4EBDA 2J8SA 2VG6A 2DCUB 2W01A 3BPSP 1B7FA 2VBXA 1FI4A 3J7YI 3K5MA 1RAGB 1OMSA 1WSVA 5IV3A 2AYGA 2B8QA 2HVZA 2YKOA 3NNCA 2DR7A 3SV3A 2DPJA 1HD1A 2P5VA 2N3OA 4ED2A 1L3TA 2BYCA 3VTIA 4OZ0A 2I6WA 3PRBA 2W9AA 3AA8A 2DR6A 3EDQB 2HVIA 4K5SA 1XQIA 2Y1RI 4P72A 4DLGA 4CYUA 1U45A 4PKDB 1ROFA 2FHJA 2RT3A 1TV6B 3DFEA 3GYGA 4B3TF 4CQ1A 2O67A 3FEZA 5IV4A 3CW2C 1JIHA 3DMJA 5GMKa 3OLAA 1S97A 3D5MA 4GVLA 5A8KB 2MLXA 1I5OB 1FXRA 2VG5B 3GTYX 1RTHA 4L74A 4NZ7A 5C5JA 2BOPA 4ERDA 5DG7A 4FXDA 5KFRA 1VRTA 5KFHA 8ATCB 3NGRA 3M8QA 2VBYA 5D4LA 2R2UA 1XNQF 4R0EA 1SCJB 2QTWA 4RU2A 1NO8A 1RAEB 5I3UB 2HQ3A 2VPZB 4CLLA 1WEXA 5ETMA 5IT4A 2E9TA 3DOLB 3EMTA 4J9NA 4NLQA 2HBZB 1OO0B 5FDLB 1XK8A 5GADI 2U1AA 5DLFA 3IR7B 2ZZNA 2ALYB 2RRAA 5FIIA 1QLNA 4P2MA 1S0VA 4Y2CA 5J2PB 4FZVA 2CYYA 1EIYB 1S1UA 3G8SA 1CQNA 2KYXA 3BBBA 3CNQP 4IG3B 4L3KA 2K2PA 4MT1A 2K8GA 3R1HA 2Y8YA 4OMFG 4M5DA 4KJIA 4O3OA 3CULA 3HF5A 5KFUA 2BJDA 3AQOA 2H5JB 2CPEA 4USHA 2FD2A 1SKUB 4FNIA 2QO3A 5DDQC 5IOLA 1YTYA 4NCAA 1S0NA 4EBCA 2X1GA 4PR6A 2DJWA 3P5BP 4F0MA 1H7XA 2VJUA 3Q0AA 1HHTP 2SXLA 5C24A 2HVEA 3Q83A 5CZVA 1R3NA 2KG0A 1FRLA 3T6BA 2LXUA 2G4BA 3QATA 1T05A 4OIXA 1FFSB 3IR6B 4IO9Q 4OL8A 3GCWP 4U9RA 1K1QA 1OIAA 1FTRA 1EJ7L 4LSLB 2HHPA 2JEGA 4LFAJ 1NSQA 2GQQA 5J2QB 4IR1A 3EICA 4E98A 2Q79A 1FJGF 4KTQA 5LMNJ 2IBKA 3ONQA 3ILIA 3TOQA 4LF8F 1Y00A 1IKVA 4GKKJ 4LFBJ 3GFHA 3KYLA 2DIVA 2J9DE 2V68A 3IS9A 4XK8C 4KV8A 3QWUA 3FBFA 2KJVA 4DF8A 2V2KA 3OHAA 1NZAA 1MSWD 4DFKA 2CPDA 4KYZA 3DN9A 2NSCA 1HPZA 1WF1A 3JQJA 2VC0A 2XBPA 3VAJA 3WIUA 2JVOA 1P1TA 4PUOB 1TFWA 2EW9A 4HH0A 1IXKA 2AZ3A 1GT8A 1EETA 4B9LA 2PGCA 1M5PC 3DU5A 2N4CA 3RRGA 1U24A 2XSJA 3D0IE 4RPFA 3BBFA 1WTBA 2H65B 2JDJA 1M1KT 2CG8A 2E1CA 4OYMA 3BQ2A 1FD8A 2MQ8A 2L9DA 4DFPA 2K3IA 4LVOP 2UU9J 4CM2A 4DPYA 4DR2J 1H3DA 1SC1B 2H54B 4B3RJ 1P9QC 2MY7A 3MEDB 4DR5F 2DT9A 3SZ2A 5J2NA 5H9EJ 1TTHB 2UUCF 4UT4A 2UP1A 3AJDA 3NOGA 3QNWB 4OZ2A 4U67Q 4RW4B 1X4CA 2AJ2A 2ZBRA 3QT5A 3LAMA 3I32A 4DF4A 1D9DA 2IAJA 3ENVA 1YJRA 2Z2YB 3BDEA 1LWCB 3FK4A 3I5BA 1HARA 3KHRA 3DRYA 1HA1A 2XS7A 5HVFA 4R0JA 1LWEA 4F3MA 1SL0A 3TX0A 2FJAB 2B4UA 1B4SA 3V6JA 1N32F 3HJVA 4Q45A 2PFDA 1U8SA 2R2RA 3EGNA 3MEEA 4IRKA 2JEIA 5HVHA 2BANB 4J9LA 2DVIA 2OPRA 2PFFB 3V6HA 4NCGB 4NXNJ 2YKNA 5JUMA 1JLEA 1JLEB 2VFRA 4HHUA 4RWXA 3ULHA 3BR9A 4JV2A 1E6VB 4DPXA 4YUDA 3HVRA 3MMAA 4NI2B 4O4GA 4PPDA 5MAOA 1JLCA 3K17A 3MOZA 1ZBTA 2YKQA 4ZCKA 2ZH6A 3T5JA 1CS4B 4J9OA 2BJ7A 4DOZA 3H90A 1TAUA 2EFNA 2H4YB 3AOBA 3UWTA 4K2XA 2RUGA 4G3IA 1F1BB 1JXLA 1TFYA 5E3CA 1JLAB 3HT3A 2X3DA 1B3TA 4FYWB 2Y1IA 2ZD1A 3L7OA 4M5LA 4WPAA 2R42A 4USVA 3JAMY 5CH7B 1VLYA 1RHUB 5I42A 3GR0A 1SKSA 2FLPA 1U26A 1UZDA 2FC8A 5L1KA 2HS3A 1B7YB 3MAHA 4UUXA 1REVB 4JBCA 3HD2A 2YXLA 4RW6B 4UF4A 3HCXA 3HVWA 3H4BA 3L9ZA 4ZMMA 4LF7F 1N32J 4H4OA 3SYZA 2EC0A 4ELVA 2ZH1A 4NA1A 3UVJA 1OQ3A 1LKZA 1R0AB 3OVBA 4I56A 1R8AA 2HFOA 3SIPB 2R7OA 3KOAA 2M70A 1FA0A 3G4SS 2R7RA 1R0CB 2AX1A 2HIYA 1WHWA 1O51A 2VV5A 4WK3A 4DHVA 3OTDA 1N5TA 2GMLA 3F56A 2BJEA 4FKYA 3T6JA 1FKOA 1UW4A 3CF5Q 2CPJA 1Q0NA 1Q16B 2EEYA 2MGZB 1T9YA 2XGQA 2AJQA 2BX6A 3SBMA 3HDSA 3MM9A 4H4KA 2LDYA 2W9BA 2IM3A 4DR2F 4KKOB 2XYPB 3FZBA 3MMAB 4NI2A 1MMDA 2RHQB 4NZ6A 3PO5A 4M95A 1J27A 1W26A 2FGCA 4ZCIA 4RBUA 1D9AA 1UWBB 1WOSA 2V4JA 4HI2A 4IO1A 3QRPA 1BQMB 3RZAA 5L1LA 2J7UA 4MFBA 3E01A 3W9JA 4C48A 1APSA 3PZPA 2XWXA 3M05A 4RW7A 1SJFA 3LWLA 5ITHA 2RVJA 3ZZRA 4HT7A 4WP8A 1ZAXA 3PIPQ 2VF3A 1RT2A 4WIQA 2ADCA 2JEJA 3T19A 4DPWA 2OMLA 2QRRA 1C4CA 4RBTA 4GKKF 5K5MA 3OJUA 2BKOA 1DTQA 1WI8A 5LMNF 2MKHA 1SH0A 4WF9Q 3SXLA 4DV0F 2R7QA 1D9FA 2IM0A 5IT0A 1LWEB 4J9QA 1B70B 1R6YA 4PWUA 5KT7A 5FLXY 2LEBA 3IRXB 3LA0A 2JEFA 4OV6A 1QE1A 4LF9F 4QU6A 3MEKA 3NRBA 5BYQA 2Z2MA 4DR1J 8RUCA 4H4MB 4HI1A 1CPZA 3M6XA 1OWXA 4QPTA 1VBKA 3M32A 4Y2AA 1VQ6S 4I67A 3N01A 5G4DA 4RNMA 4A46A 2IHR1 5E3QA 1MWZA 4ECRA 2CJXB 3A13A 4YY3F 3G86A 3GMGA 5FDLA 1EAYC 1U2FA 1Y9OA 4AD6A 2R2TA 4O3RA 3RAMA 4GMKA 2PO4A 4RW6A 4P6QA 3HULA 1NNDA 3PR5B 3NGUA 2DGWA 4HT5A 5G0RA 2H3EB 2ZC3A 1PYTA 2AZ1A 3K8WA 4CLWA 5IT9U 3HPOA 1PAUB 2W7PA 3FSXA 4ZPVR 2E1AA 2QLWA 3DLEA 2PT0A 4DBQA 3KUEA 4K2JA 5B7WA 2ZOFA 2LXIA 1NH8A 2XI3A 3I4HX 2ZE2A 3GWCA 1WC3A 4Q7AA 4A8YA 4OYIA 3RB4A 2ZD1B 3BGRA 1M1GA 4I2PA 4QIFA 1R8PA 2RILA 4CO3A 5A8RB 4ZVSB 1HYSA 4DJBA 1L3KA 3MMBA 1KC8T 2FVPA 5K8MA 2YKAA 3VV2B 4K4XA 3B78A 4N8NA 1S1XB 4W4MA 2IPOB 1U1KA 3NEKA 1RHMB 1BQXA 3T5HA 2X1AA 2WONA 4DV4J 4K4VA 3QO9A 2DHAA 4LSNA 3MECA 2VPXB 1TU0B 5D0HA 3GR1A 2ZBIA 5J2QA 1WEZA 1FRIA 2CPYA 1LW0B 1VQOS 3BKTA 2AU0A 1X4EA 2MZSA 2L9WA 1KS2A 3H0PA 1U2RA 1Y10A 3GLJA 3CCES 2XS5A 4DU7A 1AZSB 1QM9A 1IWAA 4B3TJ 2RNEA 5CD4A 5B08A 1PC4A 3JS9A 3QJJA 4DSKA 1TR0A 3M9MB 2NCKL 2VL1A 1RAAB 3D6FB 2IMWP 2P6SA 1J5EF 4DSEA 1RT5A 4AUKA 2ZJQQ 3KLHB 4XPCA 1NK4A 4B3MJ 1REGX 3DRSA 1TMMA 4MYUA 2UUBF 3IBCB 3FCVA 2XHCA 2WW4A 3JQKA 2KL8A 5J1PA 5DO2A 4C98A 2J6SA 3GPAA 2NXUA 2KYZA 2QN6B 1VBXA 3MM8B 1Q7YT 2WVDA 1ZM2A 1LW2B 3AFGA 2GQ2A 3BKFA 3PJXA 5KFDA 3OXGA 3MEDA 2XLKA 3CJ0A 1U0SA 4NL5A 4LF6J 1Y11A 1YHQS 4LRAA 4MAKA 3LP0B 1N88A 1P9YA 3MM6A 1SI9A 4DR3F 4WIIA 3CJ5A 3H4DA 3IAM9 5FLXU 4ECWA 3TAMB 4J7CA 2GVDA 3L7PA 3FGVA 4Z2XA 2YQ3A 2M4MA 1VQMS 2B6AB 3ZZZA 3MHYA 3L09A 1X5OA 2BE2B 2RQKA 2ZWPA 3D66A 3POTB 5AXLA 1RWKB 3PXGa 5KAKA 5JVHQ 4EEYA 4DX8H 2Z58B 2E9ZA 4JB8B 1RI7A 2VFTA 2LQJA 3N6MA 1XTZA 3Q8QB 4B9TA 3FRZA 3CJQA 5KG0A 3I55S 2XMJA 3DLGA 3JQMA 1HPZB 1T9VA 2KN4A 3HD1A 4EO8A 5DGAA 3PNIA 1RT3B 2Z2LA 1HNZJ 1RT5B 1NEEA 1IR0A 3GG1A 1JLBB 5CYMB 3Q2SC 3ZC4A 2G1DA 4LFCJ 3WX8A 2DGOA 4LF2A 3W2VB 4F4WA 5KT4A 1E6VA 3MUVP 1NCLA 2LVWA 1T0TV 1GXUA 1O0PA 1YQHA 4ZPBA 1AXQA 5GMDA 5HANA 1IBMF 4F2SA 4DL5A 4ID5B 3D28A 3BYPA 2D41A 4DV2F 3QSIA 2RKIA 2HBYB 3TA0A 4A47A 1URNA 3MR6A 4K4WA 1IR2A 1QSYA 4PWDB 4C2MA 2YPZA 3KKFA 1VK3A 4TNOA 3R8YA 2CG4A 2XYGB 4DN9A 5KFOA 4DSFA 4UQGA 2OIHA 4X2BA 4P7TA 2HHTA 2PSZA 2K7KA 1XNRF 1SUQA 4OHYA 1S99A 1FF2A 3NCPA 1S76D 4AL5A 3M6UA 1TKXA 2B7BB 3E51A 5LL6d 3GJSB 1FCAA 3TW0A 5ETVA 3WIVA 3MAAB 3C14A 2BJ8A 1PJ6A 3NY0A 3TZZA 3MAQA 4AL7A 5JJBA 4NX9A 4ZLNA 2WSEC 4LRBA 2RQCA 2F5GA 1EKSA 2N4DA 3CO0P 3PTWA 4Y34A 5I3QA 2UXBF 2I38A 1U1MA 4OYBA 1ZM9A 2B9YA 2CZ4A 1RABB 5K20B 1UVMA 2GJ2A 4V1Ak 1U0HA 1B99A 1T02A 5ETPA 3GFYA 4J9MA 1RYSA 3QMQA 2NXJA 1NJIT 4HHHA 3DRRB 2HHVA 2XI2A 2BABA 1RYRA 3IM9A 2XO6A 1ZTTA 4LRFA 3CWJA 3GIMA 3KMSA 2GO9A 3BN7A 4CTAA 3TEGA 4CTAB 2JSXA 3BSOA 2HVHA 4K4ZA 3M8QB 3N9UC 4PZVA 3KLIB 2PD1A 4TLRA 2CNLB 2Y0SD 3R5BA 4C0OC 3DGPA 3F44A 3DDNA 2HFNA 4KHPF 3I82A 2M5YA 2QA2A 4OHWA 4CNYA 4PEOA 2EFVA 4R5PB 5EWGA 1HNXJ 1K73T 5E41A 3A3OB 1TP7A 4FBTA 5KFMA 3P45B 4DR6J 4ER8A 3PFOA 3CCZA 3TA2A 4F50A 1UPMB 3CMES 4U8YA 5E3RA 2CVEA 4PABA 1NJWA 2ZUGA 5D15A 1T03B 5KFWA 2C2MB 1EQMA 3O8WA 3THVA 4ZPCA 5F8JA 4JI3J 3C14B 2VQFF 1HMVA 4ED1A 3LH2S 3T1AA 4WKYA 2DGVA 4HHJA 1GMVA 4G6VB 1VS3A 3C19A 3AT1B 2IBOA 5KOWA 4MFBB 4ZITA 2J7KA 3HZGA 3PW0A 2CQIA 1SQFA 3D4JA 3W8PA 3HVAA 3NMAA 2Y1LB 3QBCA 2VKRA 5L38A 2BQ3A 2HK3A 2PEHA 2V63A 1FEHA 4DV1J 2OSQA 2YX1A 4DX6A 1XR5A 3KLGA 4JI5J 4DL4A 3TAPA 4NRTA 2F63A 2ZZTA 4WE1A 1VQ8S 3PM9A 4Z7CA 3MM9B 4X4UA 4ZHRB 2D7SA 3EGWB 5KT6A 4NLUA 2DNMA 3D1HA 1CULA 2EKNA 1T11A 4ZCLA 2RJZA 3MR7A 3PV8A 2F3JA 1SIZA 4ZPDA 1DTTB 5HQMA 3CC2S 3MOJB 1SIWB 1FKOB 4WZMA 2O01C 1I51B 1GTHA 4LRCA 4NEZA 2V9KA 4KT0C 2M8HA 4U96A 3WDOA 1S7HA 3CCLS 1NRKA 3CCWA 2BVZA 2J9CA 3PG9A 3H25A 4V19X 4K4TA 4M1KA 1RWMB 4DQRA 4DZDA 2OJ3A 1RT6B 3M30B 1UKUA 1CSJA 3OBIA 4DR4F 4A48A 1VMBA 1Y7PA 2HSEB 3MR2A 4C4WA 1OS5A 3M1VA 2Q6CA 3C46A 1RU1A 1TL7A 2YY3A 2G2OA 4M5MA 1PJ7A 5HLFA 1N48A 2F1FA 1EKRA 4OX9J 2DNRA 3LF0A 1V3SA 4X66J 5KFBA 3ILLA 3OJSA 1KVIA 2KHDA 3ELHA 4YR0A 1CC7A 1TL1A 2FIUA 3MPWA 2B7CB 1BC6A 2V2ZA 2OTJS 1RZMA 1K1SA 3FEXB 4KAIA 5ETKA 3TVZA 1ZYQA 5DM7Q 3O6QA 4QIEA 1VHIA 4M63A 1AFIA 5EWFA 4IUFA 3ENAA 2R8IA 3H98A 1Y4ZB 2CQ1A 4L72B 1N36J 4WFYA 1N8RT 4JI2J 5KOXA 2FHKA 3BSCA 1VQSA 2YNHB 4AT1B 3RAQA 3EZUA 3MMCA 3O44A 4ALZA 2O5DA 4JI3F 1H73A 3MPVA 4BWJA 3ZXWA 4DQPA 1X4DA 4Q8EA 4HR2A 2W25A 3IRWP 3JTPA 5KG6A 1TK0A 3AODA 4LSNB 4A8XA 2M9KA 2J5AA 4OLPA 2IVYA 4H4KC 3R7SB 5F8MA 2OLWA 2OELA 4PXEA 1QAJA 1D8YA 4ZP7A 3P6YC 1CJKA 2DH9A 4KHPJ 2VDHA 2ZH5A 1NHKL 5IM0A 1U47A 2IA6A 5BYSA 3CC4S 3D1OA 1Q7LB 3QT8A 2HWTA 4KGVB 4YR3A 3V2UC 4DUYF 3K8VA 1X5TA 3ET6B 4CLZA 4NLTA 2E7XA 2JVRA 3MEEB 4IFYA 1NZ8A 2RQMA 5AE3A 3Q8SB 3IGNA 1TUWA 3FSIA 1NXIA 4BC7A 5HP1A 4M5DB 4IRCA 1D1UA 3HHDA 5U47A 1SC4B 3MMBB 2F8EX 4NLOA 1VQ4S 3Q23A 3GSIA 2KTQA 2QL9B 4NLRA 3R1LA 2YPYA 2AYBA 3HJFA 1GX5A 5F9LA 1TKZB 1FVQA 3J81U 4MTPA 5J2PA 1BWEA 4EWTA 2UXBJ 2UUAF 2WK4A 3W63A 2AHOB 1OY8A 1AYEA 3BN4A 3DOLA 4I69A 4X84A 4LF1A 4AXIA 4GKJJ 4LSZB 2CPZA 2P8IA 2Z8QA 4KPYA 2ABYA 1L5UA 5IC4B 3AOCA 4JI0F 1PKUA 1PILA 1LV5A 5H9FK 2YH1A 1G7CB 3AA9A 2B43A 3K5NA 1F5AA 1PG5B 2BDPA 2BKPA 2HNZA 1NK0A 4AQYJ 1JLQB 3PYGA 2W4CA 1G1XA 4WKRA 1N6QA 3PVXA 1VYAA 2EBGA 4H4OB 4ZVGA 3W9IA 4OI0A 2OPQA 1UVNA 3NL0A 2LECA 1FESA 1WC0A 2YNIA 4OX6A 4PAAA 4W98A 1G3OA 2NUUG 2PC6A 4O3PA 3RR7A 1DFDA 2MJNA 3WX4A 3DC2A 4C7QA 3DRSB 4IH7A 1RUSA 3BH7B 1ZM4A 2FC9A 3GIRA 3IR5B 2J0XA 1P27B 1JMTA 4CYUB 2K1RA 2VKZG 3OLBA 2IC3B 3G6XA 2ZH4A 3V6KA 4USIA 1TKDA 3G2XA 2YNGB 1ZOTA 4OZNA 5GAGU 5C25A 4G1IA 1XC9A 1VQKS 1HNZF 5IWAJ 2YKPA 3B4MA 1VQPS 3J81Y 3C15A 3HSGA 2Y3YA 3U7JA 2MKKA 2ZM6J 2XZTB 2FJVA 2JJ4D 1VR6A 2KVQE 4ZP9A 4OZJA 3TJ8A 4F4AA 5M2UA 1X9WA 2HRYA 4IYQA 4MK7A 4QYRA 2DO0A 3DLJA 3PCOB 2DXDA 4J91A 2MQQA 2VG7A 2YWKA 1UWBA 4XTTA 4YMEA 1JLBA 1RA7A 5CYMA 1CJVB 3HMJG 5H1SV 1KVJA 1MWYA 4OI1A 1OPZA 1JLFB 4YHHF 3T5LA 1S57A 1DLOA 4D3GA 2RB7A 3BV8A 2QC3A 3VVTA 4F0KA 5CAAA 4B9VA 2QT7A 3DLGB 3JSRA 4DR3J 4ED0A 4D3HA 1VQ5S 2QE5A 3NS7B 4P71A 4IG3A 5IQQA 2ZH7A 6FD1A 3PKMA 2F4FA 3OUYB 5IT9Y 2R8HA 4ITSA 4LF6F 4E0DA 1Q8BA 5GAGI 2R8KA 3OTBA 3RR8A 1TAQA 4YEAA 1VISA 2IRXA 1HR0F 3U02A 3MCMA 1LFPA 1TKTA 4CT8A 3GIKA 1HQUB 2NYIA 4PWWA 2ZJPQ 3TYTA 1HWIA 1W2IA 1S6UA 3B54A 1MNEA 3WC2A 4OLOA 1GH8A 3EPGA 2GHPA 2UUBJ 2LYVA 2YBVA 3R5JB 2N7CA 4B3MF 5CXTA 1ZA2B 3BEGB 1J5EJ 1RCOB 1RTDB 2RUSA 1RTDA 4DSIA 5E3AA 5KG5A 1MROB 3B8HA 4DL2A 2E9RX 1HW9A 2FHMA 2AEJA 2MJUA 2HS0A 2VU5A 1B64A 4MK9A 5HROA 3N28A 2W2MP 3KLIA 3V81A 3S7RA 2ERRA 1CJTA 1N5YA 2PA3A 2KT5A 1RT4A 2RF2B 2PMZD 4X4TA 4DLEA 2ZVSA 3SSRA 4KHMA 1YRUA 1Y0HA 2KDOA 2OI2A 3H5SA 3IC1A 1KLMA 3LGNA 3LPYA 2UXCF 2KT3A 1UWAA 2C2NA 3VWSA 2ATLA 1VBYA 2Y9HA 3ADAC 1FKPA 3P8BB 1GNKA 1WHXA 4KR0B 3NCQA 1SJRA 3BR8A 4KV8B 4KSEB 1UETA 5KFSA 1U1QA 4DV4F 2DNGA 5F8NA 1LOUA 4RBVA 4BCAA 1J2VA 2AF6A 3DXBA 3LGMA 2ZHOA 3IM8A 2MQPA 4PXDA 4NASA 2X51A 5AJ3J 3K5OA 1KR4A 1Q79A 3RG6A 3P96A 7FD1A 1JLGA 4L3NA 4MIBA 1FFGB 2MEWA 4OHXA 4YP3A 2C2RA 3D2WA 1NSAA 4ED7A 4C8OA 1ZAVA 5KFKA 3JXOA 1SQEA 4TKTA 4EBEA 1BGXT 4X4SA 1E6YA 3LAKA 4OJGA 2BMBA 2J7WA 2EFPA 2OHDA 3DRXA 1RTIA 4JYAJ 3DU6A 2DK2A 4UOGA 1VQYA 5LJ3Y 4BHQA 1S1XA 4Y3CA 3VCDA 4JI7J 2R7UA 3R27A 3UDCA 4L76A 3KHLA 4FS1A 3R5GA 1WJ9A 2IAJB 2XULA 3UN2A 1T03A 5M2PA 2K7JA 1N34F 5E33A 1GXLA 1P8GA 1RT7B 1LWCA 4NPOA 4C0HA 5DM6Q 4EZ6A 3J7AN 2G0JA 5GMEA 1QSSA 1Y5LB 2OMOA 2RQ4A 2HPUA 2JH3A 4RO0A 4RNFA 1S7IA 1UP1A 1S1TB 1RWXB 4UUWA 5E5NA 4CM0A 4X64F 3CPWR 3LP2A 2HQIA 3CCQS 2BQRA 4OQJA 2FYXA 4I6AA 4UOCA 4ZPTR 4NLDA 1RKIA 2HVDA 2QLXA 2DH7A 4JI7F 1AB8A 1IJFB 3BF4A 4ANCA 3QZ7A 2HG4A 3EXYA 1AT1B 2QL7B 4LRDA 9RUBA 1NSPA 2HLUA 4QIVA 3EDRB 3OQ2A 4YDXA 5B0BA 1VQ7S 2M52A 4BS2A 1S12A 3FFIB 2Y8WA 2GVZA 1RB0A 1S9EB 3M8PA 7AT1B 1LK5A 2CJ9A 4ILLA 4GO7X 2COLA 3AJ2A 4NA3A 2BOAA 4ECVA 2FY8A 3R3TA 4PG6A 3ZO7A 3OFFA 1RGVA 4OZ1A 4QYZJ 4I7FA 4PUOA 1YSJA 2WB4A 1VK8A 3RBDA 2FJDB 2P9GA 2BM0A 1G4CA 2VG5A 1YI2S 1BUXA 3GFXA 4NZ0A 2V0NA 4OI2A 3QFWA 2FHJD 3IRXA 3VF0B 4B08A 4CWBA 4X65J 4UZBA 2UXDF 2AP6A 3X1LB 3MZIA 2KVIA 5T7LA 4LSLA 3G6YA 2PI5A 1JQGA 3U1NA 2VICA 1RT2B 1Q53A 3NG8A 3LO3A 4RUHA 5HSPA 4JI4F 2H51B 4QPXA 3C3LA 4FYVB 2EBEA 3DHWC 4ZJLA 2CPFA 3N6LA 4QWEA 1FRXA 3KWMA 3L7UA 2HHHF 2HW3A 2MZTA 2O3DA 2W24A 3PACA 3BKUA 3C6UB 3QAUA 3PW4A 4Y2MA 1UFLA 1T05B 1JJHA 2MHEA 2EFGA 5E7OB 4QWBA 5F9NA 3MFHA 1UTAA 4ED6A 2NR0A 2RS8A 2NPFA 4NLGA 3OFHA 3KJFB 5I4MA 2FVRA 2ILZA 2RKIB 4CO2A 2FLNA 3BM7A 2IVMA 1F2HA 2QG9B 1X60A 4MIAA 3KLEA 3CVKA 1BE4A 2HQDA 4JI8J 2X3GA 3H7HB 2W9BB 2DHXA 5C42A 2Q3PA 3RGIA 3Q8VA 1P1LA 2DGSA 3I6PA 4J90A 2PMHA 2IIHA 5KFJA 3VAMA 2XZWA 4ZVUB 8AT1B 4FF2A 2MKSA 2CA9A 2HGLA 1HWJA 1HQEA 2D3UA 2DEJA 4NOHA 2B9XA 2DGQA 2UZAA 4ZP8A 3T1YF 2KZZA 1IQTA 3W60A 4DV7F 4KO0B 2H1YA 4ATNA 3TUZC 2L08A 2IRUA 3D6HB 2XLIA 2E5LF 1H74A 2W4DA 3I87A 3NBPA 5IS2A 4K4SA 2CQHA 4YHHJ 1JJ4A 1X4HA 3ISND 2MQMA 5D77A 4DUTA 4YR2A 5LOQA 2HRUA 3V5RA 4J9SA 1JXEA 2HNDB 2KXHA 2LU2A 4IQMA 1OY6A 5MLCV 2W1BA 2MQOA 1WTFA 2GVZB 3VHQA 1OJ4A 5RUBA 3SI8A 1NKBA 3UD3P 3V4IB 4X4VA 5A8WB 2XNQA 2QFJA 1N56A 1Q4RA 4X62F 3JYTB 1YKWA 2G13A 1TV6A 3NAIA 4NLSA 5F3ZA 1Q8KA 1MMNA 2VFSA 3DMJB 1RT7A 4DQIA 4F8RA 2MTLA 5KFAA 2MSTA 2YQ0A 2JLFA 3FDSA 3IO1A 5A8KA 3G96A 3WZ0A 1U2CA 2DGUA 3TWZA 2A18A 3KK2A 3L4BC 2UVVA 1FDBA 5IC6B 3ISNC 4LR7A 2VG6B 1DQ9A 5GAHU 3QJPA 3HVTB 2HKEA 3K5PA 4UOFA 1UZHA 1SV5A 3G8TA 2D9OA 3FUYA 2DNZA 2HGNA 4Q2LA 4B9UA 2VG7B 3K0JA 3IWLA 3Q2TC 2KKHA 3AXMA 3DLKA 1V5VA 1CJVA 4NYZA 4B02A 4Q43A 4ZJOA 5AXNA 1YWXA 2UUWA 2EVZA 4ZVFA 3UCGA 3R7NB 1G6BA 1FDDA 1I94J 2JX2A 1NJZA 3W3SA 2CWKA 1MLAA 1XMQJ 1KSPA 3UDLA 4NRUA 4ZVRB 2RRBA 5E2QA 3VAGA 4OYXA 1S0OA 2W2QP 3K7RA 4P2FA 5KG4A 4U95A 2UU9F 4X4NA 2DNQA 1DHMA 1OSCA 3FVYA 3EXCX 5E0OA 3M2UA 2FDNA 3BGRB 4I2PB 3HFKA 3FEYB 4O0IA 4HYKA 4WU2A 2V34A 5B0GA 4J9RA 1F9FA 2OPPA 2CQ2A 2YKMB 2J9EA 2XZDB 3A8IA 3BZQA 3S6EA 1K44A 2NQPA 1F2GA 3HP6A 3R2DJ 4ZPWR 3FSYA 1HHSA 4M5IA 5J2MA 4Q5VA 3QT7A 1AW0A 5K9FA 1I3OB 4R25A 1HNIB 1SL1A 2XMVA 3DGPB 1LNQA 3H42A 4AXJA 4LF8J 3DLLQ 3TVYA 1N52B 2JLEA 1K8AT 1UFKA 3KG1A 4WJBA 1DQ8A 1ZPVA 3OTCA 4LFAF 2EI5A 3C6TA 1PBAA 2HQGA 5DDOC 4C8ZA 1WKKA 4Q44A 4DQSA 2AGOA 4NLPA 1F3VA 1T94A 1KVKA 1FRJA 1MU2A 3AD8C 1RAFB 4ZVEA 3SFUA 1C0TA 5D4PA 1HBNA 2JWNA 2XG8A 1EP4A 2POKA 4NLWA 3VZHA 2RSQA 3ENWA 4F0HA 3OUYA 4K0KF 3CO9A 1FWLA 2YNFA 4HH1A 1ZM3A 2ZBPA 4FYYB 4JI2F 2HBRB 1N36F 1JKHB 3H20A 4ES3A 2CJKA 2J76E 2MZRA 4EFAC 1WEYA 9ATCB 2KI2A 1WKJA 3HHLD 4NMXA 4ZVTB 4OI4A 1M5OC 1SKWA 4FXVA 1CJUB 4FNHA 4H54A 2J6UA 2KFNA 2W7AA 2F4VJ 4PQUB 3HHLC 1VCTA 4DG1A 3PDNA 4U8VA 3VVUA 3ZNUA 1E6YB 1UVKA 2A10A 5LSOA 4HKQA 2I5JB 2HWIA 1C0UA 1L3SA 2BQUA 1X4BA 4DPUA 4J9UE 1YVFA 4O0NA 5EHHA 4X66F 1RHRB 4V19J 1N54B 2BUNA 1IBKJ 2K06A 1LXJA 2W7OA 1B0VA 2PE8A 3M8WA 3MD3A 4C0BA 2OEJA 1F5BA 2D69A 3EYZA 4WWSA 5D6GA 1FKAF 2C3OA 1VFJA 4LR8A 1S9FA 5C24B 3QGHA 4HTJA 2A3JA 3N0VA 4X4OA 1FJEB 2QGFB 5HJXA 1F6TA 1H0HB 1OYDA 2LP4A 3TAQA 1CVJA 3RW6A 1S49A 1YRTA 1Q8IA 2AEMA 2LA4A 1DAXA 3J80Y 2IJFA 4N5SA 1H6KX 2B4PA 3CDUA 1RWUA 1SKRA 1SB6A 3ZZPA 5T7LB 4K50A 3TZWA 4DV2J 4F26A 4TY8A 5F3TA 2ATCB 2DD8S 3EVMA 3V6DB 1EP4B 2DH8A 1JNRB 4TU8A 3M7VA 2YNFB 4LQ9A 5H9FJ 4F3OA 2HYIB 4RX6A 4I4BA 3ZNJ1 3IGVA 1U02A 3HFVA 2MKCA 1NBEB 1Z2ZA 4P74A 3R5CA 3MAAA 3MI7X 2QIFA 4KGXB 1W25A 2ROGA 1ELOA 4BLGA 5HQLA 1IBKF 3AAWB 3I56S 4KQZA 4C11A 2DGTA 3ILJA 3SSSA 2NZCA 3OVAA 4C8NA 4B3OA 4JI5F 4DCJB 2HNYB 4DV1F 3HHKA 1DRZA 2UV8A 2YH0A 4EYIB 3GZ7A 1S1TA 3DI6B 4ZN1A 1T9XA 3S01A 1EARA 2ACYA 2VASA 3MM8A 4KY3A 3MUMP 2XO7A 1WF0A 3RAXA 5H9EK 2CZVC 2KG1A 2XMKA 5L1IA 4CLKA 1BMQB 3A1YG 1D0EA 4ES2A 4CCHA 4K0KJ 1DY3A 3BGLA 5ETOA 3AJ1A 3TUIC 1LWFB 4EU0A 1MMLA 2J9DA 3THPA 4DV5J 2OD4A 4JV1A 4USTA 3QAEA 1HWLA 1R31A 2V2QA 2D74B 2V94A 3JTOA 1KFSA 2XMAA 2IJNA 2GHVC 2KZMA 1FRHA 1XR7A 3LQVA 2XY7A 3KJVA 1L3UA 3KJVB 2L9NA 3MEGA 3NGTA 4RWWA 1SJ1A 3KK3B 1JJ2R 2ZDPA 1U6BA 2JNJA 3TUPA 4WXOA 4IOCQ 3M8ZA 1HBOB 1RAHB 3P5TL 1CLFA 1FX4A 2MB0B 3TANA 4PYDA 4PXBA 2CQDA 4ANEA 5F8LA 1EQ0A 1LW0A 2MGZA 2R9LA 3C16A 5GVQA 2ASJA 1HBMB 4GO5X 2ASDA 2QMUB 3VGSA 1X7VA 2FJBB 3KK2B 5HL7Q 1UJ4A 4JV5F 3NGKA 2MZJA 5CCLA 4DS4A 2GJFA 3ZFVA 5JMNA 3UNGC 5CA5A 4Y65A 4JI6F 4OZLA 3OL6A 2V8PA 3DDIA 5CYQA 4URGA 2ZUAA 3O1LA 4I2QA 3H5UA 3FBBA 2Q1LA 1RBOB 1YLXA 1X4FA 3W5ZA 3TARA 1X9SA 1TL7B 2DTJA 2UVUA 5A8WA 1LXNA 3IMQJ 2ROPA 5KFLA 3I4PA 1NPPA 5ETQA 3HXMA 1XNRJ 1KOHA 3W8GA 1R89A 1RE1B 4C11B 2LFVA 2OPQB 5HBMB 5BR8F 3JSBA 4ED3A 4HDGA 2XMUA 1U1OA 2ZKUA 3QGIA 1FT8A 1NU4A 3G87A 2BEFA 5LSLA 1HIYA 1RADB 2LQ8A 4O3QA 1RQ0A 2YWFA 4IG0B 1Q8LA 5F8GA 1U7LA 4JP8A 4NYPA 3GE9A 3LP0A 4IH5A 3TO8A 3SCIE 4J9PA 1REVA 2XY6A 2AGQA 3TVKA 3OSPA 1FHTA 2AW0A 2CJYB 2YQ1A 3GFZA 4USWA 5KFYA 4H4MA 4L73A 1VC6A 2BR0A 4TY8B 3V6DA 3DRRA 3ITHB 1VHFA 1IUJA 2ZKTA 2AJ4A 4FXWA 1YDLA 3IXQA 4QR1A 4GC6A 4P2SA 4EZ9A 4A8QA 2BRKA 1EHWA 1OSDA 1NPRA 1RLCL 4GVBB 4MMOA 5EN1A 3DYAA 1T3NA 3ET6A 4F67A 3IG1B 3PHTA 4LJMA 2VPWB 3B6BA 4OYZA 1S6QB 4RUBA 3W9HA 3GV8B 2AX0A 1Q86T 2C3YA 1U25A 1Q1KA 3M4XA 2EPIA 2R7SA 2F65A 4U7UD 4E8UA 2HFVA 1WWHA 2MSSA 3ENQA 3E8OA 2BE7D 1Z2LA 2EKYA 2HK2A 3MDFA 4DV3J 2B4OA 5KFQA 3SDEB 3OV7A 1PBUA 2B5JB 3LUYA 2GFFA 2OSRA 4RW7B 3W65A 1YJ9S 3TUJC 4N41A 2E5LJ 4U7CA 1QY7A 1PJ5A 4ZPAA 3T1YJ 3G8QA 1HHQA 1RT1A 4ECYA 4NE9C 4IKAA 4YB6A 1JWWA 4ZLPA 2HMIA 1QVFR 3UD5A 5A76A 4QZVB 2Q43A 3GQCA 1Q95G 2OEKA 4CH1A 1SVDA 4K5RA 1A6LA 1KN6A 3WBZA 1HWKA 2E29A 3LP1B 2K1RB 3TNVA 3PR4A 3VAFA 4ZIWA 4F2RA 1M90T 4LMZA 2CAJA 2G0CA 2AQ4A 1BXNA 2GAGC 1U6ZA 3LPEA 1CG2A 1MN9A 2G9OA 5D4OA 5J2NB 4S0MA 3MFIA 3HX9A 2RU9A 2Q66A 4K59A 2CPIA 3GP9A 1XJWB 1UEKA 2PMWA 4OZ5A 2WVBA 2QJ3A 3ZZ0A 1OQ6A 2HNZB 4ECQA 4LR9A 1U09A 5KFEA 1HKAA 1T9WA 3GV7B 3MR5A 1WKLA 5G0RB 2PN6A 4XPEA 4FF1A 1NB2A 3NGSA 1VIXA 4FVCA 3KXDA 4JI4J 4DWIA 2IY5B 1RKJA 1RTHB 1IN0A 1ZS6A 1IR1A 2YWEA 1RU2A 4P2XA 4USKA 1I6JA 3MF5A 3HHNB 1VIOA 3IFEA 3W1YC 2LU1A 1TKZA 2KM8B 4Z37A 4X65F 2CQBA 4ELUA 3PO4A 1M5SA 4YB7A 2XLJA 4P9SA 4YB5A 2FJXA 4ETZA 2HMIB 5B0FA 2KXFA 3WQPA 3R7BB 2LKZA 1UPPA 5EUHA 1GTEA 1KQFB 4KGMA 1JLAA 3OR2B 4W90B 2B0GA 1HNWJ 1H2UX 3SEOA 2MQLA 4YOEA 2Y0BB 2GC8A 4KB7A 5EGYA 1BLUA 1RT1B 1C1CA 4NCBA 4Y0FA 4ZVOB 3G6ES 2GQCA 3FCWA 4ZHRA 1K0TA 2B5JA 2G2YA 2H5IB 4M5HA 1S72S 1YGYA 1FNMA 2M8DB 3D3BJ 2BW2A 1KHWA 1CJUA 3R5DA 4FF4A 2CNKB 4X64J 2HGMA 5GAHI 2KRRA 2KXNB 3CJ4A 1U1PA 1HMVB 4NCGA 1R7IA 3BQ0A 4OYAA 1FKPB 4DX7A 3W2VA 3AXKA 1Y3JA 2VQEJ 1N34J 1SH3A 4KFBA 3KUGA 4GVBA 4LF9J 2EK1A 2GIRA 3CC7S 1N0UA 3D68A 1RT4B 4ECXA 2DR8A 1U4BA 3JSYA 3CJSA 4JYAF 2HHSA 3BGFA 4TU9A 1O6XA 2OO4A 3FFIA 3M1VB 4BBYA 1OYEA 5D0RA 1HNWF 3N5FA 1X9MA 1CJTB 2Z30B 2JHEA 5GAEI 3KLFA 4WYLA 3J7ZT 3DOKB 1RBLA 2CXEA 1WC5A 2XMTA 4MKAA 4OJ1A 2EFOA 3M8SA 3FCHA 3M30A 5DS7A 1JB0C 1KONA 2HNDA 3FZ2A 3IWXA 5DQGA 3CCMS 3TZXA 4CT9A 1AFJA 2RDJA 2XM3A 4QQBA 4OHVA 3G9CA 3HI9A 3BGUA 4OJHA 1H2TZ 4TQSA 3H5YA 2LDIA 4G1QB 2F9JA 2CDQA 1TELA 1UMJA 2JOQA 2WVEA 2DO4A 3FBEA 1B0TA 4EO6A 4ECTA 1QVGR 4AYBD 5E3PA 4KH0B 5BXIA 2ZFHA 2VFVA 3VQTA 1KEKA 3I31A 1NJYA 1A7GE 2XCAA 4Y00A 3M9NB 1FK9A 1N4LA 4FYXB 1GAOA 3ETMA 1NB7A 1OY9A 1RWVB 2DNYA 3T3FA 2QMWA 2B9WA 5EDWA 1VJQA 1X5PA 3CT9A 3VGTA 2XGPA 1L3VA 2UXCJ 3AB2B 4WTYA 2C2EA 2VONA 2VD3A 4LBIA 3MPYA 4PG8A 1RHQB 4DL6A 1RXOB 2CUYA 2VDIA 3SCKE 1MW7A 2CADA 5DGBA 3MURP 3CXCR 4IFYB 1GEHA 4FPRA 1S79A 4DCOB 3BS9A 4F25A 2DRAA 2WB1D 3OL8A 1K47A 5F0WA 1H98A 5LSRA 4DQQA 3PJ9A 1WNEA 1FNOA 1XBWA 3DLKB 2NXEA 4DS5A 3BO4A 4NMLA 3RTVA 2H5EA 5D0EA 4YN3B 4O23A 4QW8A 4ECSA 4WYWA 2XMMA 3K2YA 2IVFB 4HEA9 1KLNA 4Q0BA 2HRTA 3BPDA 2W9CA 4HL9A 5L9NA 1HR0J 2C3PA 4N7TA 4UY8T 1ZH5A 4ILMA 3G6VA 1KTQA 2CJQA 2V2VA 3VGVA 2WSCC 5CQGA 3ZTPA 3BSNA 3TQ1A 1GX6A 2IM2A 2R8JA 1FFWB 2KT2A 1JKHA 3F0NA 4DDFA 3O5TB 1VGYA 4CNZA 3P4UB 1WC1A 5IZHA 3CCSS 4KBIA 2B9EA 2JFKA 2DPIA 5DQIA 2P2CB 1YG0A 3DYAB 5B09A 5GADU 3ZTOA 1IKXA 1N6QB 2LCWA 3MM7A 3A12A 3CCVS 1D3WA 4DV3F 1NJXA 3CDEA 1XEZA 3LGHA 3AB4B 1AUSL 4R5PA 4N8OA 1NK9A 3CDAA 1YK9A 2EXUA 1VI7A 4EI2A 2OFHX 4ELTA 1RSCA 1X0PA 3QLHB 1S9EA 3M8PB 4FN5A 3RB0A 2JRSA 4FYDA 2VOOA 4G1QA 4Y2IA 2XB2D 5DRKA 3KLFB 2OEMA 1JLQA 2UUTA 2V6AA 3UI3A 3W7BA 1KNZA 2ZZMA 4LQ3A 4K7QA 1BD6A 1Q5YA 1U0HB 2OGUA 2FZCB 2JC0A 5HBMA 1SH2A 2I2YA 1LFWA 3TZYA 2XHWA 5J1NA 3HO1A 2DYAA 2RRNA 4K8RA 5CYQB 3RBEA 3M6WA 3MXHP 2FY1A 2XCPA 5KG3A 1O5JA 1FJCA 4UW2A 1VRUA 2FZGB 1VQ9S 5KFXA 3GJRB 4PCQA 1VQLS 1RT6A 3TEHB 3F73A 2WOMA 2AJ1A 3J7YU 1IKWB 3NOCA 1X5SA 1DARA 3D9BA 4JUZA 3R97A 2R2SA 2HQCA 1TK8A 5BR8J 1CJKB 1NUEA 2RAQA 3EX7B 2EFQA 1GMWD 3R6LB 3B82A 1QJHA 5M2RA 1JLCB 1SUQB 4CO0A 2XWYA 5K8NA 2C2KB 4AQYF 3KTQA 4DXLA 1FE4A 2VZ9A 1WC6A 4M5KA 3SQGB 2C2OB 2W9CB 3OW2R 1WUUA 3KLEB 1X4AA 2YKNB 4DR5J 2NXNA 5AT1B 3HM9A 1YX2A 2CKWA 3DHXA 5KFGA 5CABA 2NLWA 2W4PA 1PCAA 3BGOP 3OL9A 4LIWA 3U27A 2N82B 2UUAJ 2VPYB 3K58A 5C2GA 2HHXA 4F7VA 4JV5J 2FZKB 3AH6A 4C9DA 3Q8YA 2CPXA 2IC3A 4ZK7M 2N7YA 3MD1A 3MECB 3KUHA 2VHGA 1WHYA 4QWDA 2IFXA 3ITHA 4L6V3 1YBUA 4CH0S 1UVJA 2HHQA 4RNHA 1AUDA 2IM1A 2VH7A 2IRYA 3H5XA 1LWFA 4WU3A 3DM2B 3HHLB 1NK6A 3D67A 5HK4A 3MPDA 4ED4A 2I8EA 5LT5A 4QCLA 2I0XA 2JL9A 3CIZA 1N5YB 4XDCA 2AD9A 1FTCA 1CC8A 3EVWA 2XQCA 1RWWB 4A8OA 1M5VC 3JB9k 1ULRA 1IBLJ 3SV4A 4RJVA 2B6AA 1RLDA 2E1RA 1TL1B 4OHZA 2W2NP 3I5AA 4EUVA 1T9TA 1FJGJ 2M88A 1P6TA 1W7WA 1WI6A 2NYHA 5HAOA 3M9OB 5IXUA 4FBUA 3PIOQ 3U1LA 4QIWD 1Z4UA 3C6TB 1M5HA 2RDIA 3EE3A 3KJNB 1D09B 2GA7A 1T8EA 2E7VA 3N79A 3OR1B 2KJWA 4FVMA 5DZ6A 2AT1B 1JXVA 3EPIA 4IOAQ 4LBHA 1T3OA 2E44A 4O3NA 4QWCA 3A8KA 4ECZA 2E1PA 4JOUA 4WFNQ 2E1MC 3HT0A 2MHNA 4XO0A 4EYHB 2E5HA 2CIMA 1S9GB 3CGIA 1IKXB 1TL3B 2O1PA 4F02A 2ASLA 4DU8A 2RIJA 4AL6A 1VQNS 2RH3A 4N77A 2OPPB 2HFUA 1PO6A 2VA2A 1KQKA 3QIPA 4F4ZA 2Z4PA 1PYOB 3NS5A 3TR5A 3DRPB 3I0SB 4WE1B 4XAKA 5IM0B 4U7UK 4TU7A 3H40A 3GU0A 5AXMA 1RTZA 5B0DA 1R8CA 4ZIVA 5CYJA 3H2LA 4TYBA 4WP9A 3HKWA 2HAFA 4C8YA 4GRSA 1S10A 3CJ2A 1R8HA 1XMBA 3SQGA 3EM1A 5EWEA 4PYAA 3MMJA 1NHUA 1DBDA 3W61A 1UFWA 5KFCA 3M2VA 2DITA 4ZP6A 2V8VA 3UN5A 1XR6A 3VZIA 5DZ7A 5KFZA 3E01B 1O8BA 3K89A 1EZZB 1ZETA 2BW7A 2CQ4A 2XTJP 1XNQJ 1QTNB 3J81j 5IQ6A 4I1TA 1WSRA 2OUGA 1Q81T 2BJ3A 2BANA 1SXLA 4KH1B 1PYSB 2YNGA 4N56A 2EK6A 1FEEA 2V8HA 3UCUP 4YFUA 2BXJA 5D78A 2ACMA 3IBFB 4CO4A 1V6HA 1NK8A 1YRXA 3DXSX 4MKVA 4FP9A 5LXYA 3EZOA 3OHBA 3R6GB 4IDKB 3GV5B 2E5GA 2AKWB 3MCSA 4CI0B 5L39A 1QTMA 2D3OR 1KTVA 3SMZA 5KG7A 2RF2A 4DL0C 1PC5A 2YX4A 2CVIA 1VLOA 3O3LA 2KH9A 3PW5A 4A8MP 1KBRA 1HWUA 3HLUA 2YNIB 2ZHBA 2PIIA 2JC1A 3HSZA 3PW7A 3EUNA 3ETOA 4MIWA 3I9ZA 1UA0A 2OFGX 3KG0A 3W5YA 3FNNA 2OAUA 4M8LA 4J5OA 2NZ4A 4OJ3A 1UEVA 5HQ8A 3P49B 2E66A 1MG7A 2B3TB 2QSWA 4UQTA 1SC3B 4ES1A 4IQXA 2PDAA 5I42B 1H72C 4EMDA 5DDRC 1F5CA 1N5SA 2HIQA 3QGGA 2R7TA 4PXCA 2VQFJ 2D3ZA 2P9CA 2WBMA 3CB4A 3DM2A 2KU7A 2DHGA 3HHLA 1TUVA 2ZITA 5KG2A 2VJVA 2MLYA 4HACB 3BO2A 1UEUA 1RBAA 3M2UB 3OFEA 5A0YA 5D8HB 4URQU 2QV6A 3ZTQA 3QRQA 2R4FA 1LQ9A 5CCMA 3NWRA 3PFEA 6FDRA 5LMUF 1HNXF 1GK8A 4ICLA 4X4RA 2ZOGA 3A3NB 1KKHA 1FRMA 2ADBA 4RR5A 4O4GB 1R8BA 3W5XA 1YZ6A 5C42B 1NPKA 3TRGA 1PAEX 1CULB 5L1JA 1IBCB 2CNOB 3MM5A 3MM5B 2ZHAA 2K3KA 5K14B 4DUZJ 1ZTWA 3QRRA 3KHGA 4Q8FA 4C3LA 2WW8A 1BY9A 1RTJA 5JXSA 3IA0A 4RW9B 3GG0A 2DRBA 4JI1F 3SSQA 5D4NA 2RHSB 2EC2A 2GIQA 3LOUA 1CBKA 4CLYA 2GV1A 1NKCA 3U1MA 2QZ8A 4WFBQ 1LWXA 3T1HJ 1VJWA 5DG8A 3CCRS 2GHWA 2OPRB 5C7PA 2WOMB 5J1EB 3RU0A 4DG1B 2PI4A 3KMQA 4CLPA 2YWHA 1XMQF 1V9OA 1H2VZ 5SZTA 4OX7A 1VOMA 2HS4A 1I94F 3B4DA 4RW4A 5K8OA 1Q82T 2CZ9A 5HLFB 3JYTA 1XERA 5DJBA 1TMJA 2DNKA 3C66A 3MWBA 5CHCB 3TAMA 2FHOB 3W64A 1R43A 3PEJA 4CZCA 3PKYA 3K59A 4FF3A 2R7XA 3ZZTA 3S1TA 4B3OB 3BH6B 5KFFA 1MROA 2MKYA 1WELA 3PX6A 3RB6A 1MN7A 2BM1A 4JV0A 4DFJA 4C8LA 3MM6B 2QEXS 1U6FA 1F60B 3T1HF 3CMQA 4O3SA 1NDCA 3EJMA 2VUGA 1Z1ZA 3KG4A 4KIAA 4WP3A 2HZAA 3SQOP 1T9UA 3Q86A 4USJC 3ZTSA 1LW2A 2YKMA 3W62A 4JI1J 1DZ5A 4WFXA 5HMYA 5DLGA 3D0HE 5LJ5Y 2MLZA 2WTFA 1NHVA 4F3QA 4OI3A 2FLOA 2LMIA 2HAIA 2ZWOA 4BWMA 5JVGQ 1FXLA 4ANDA 1H7WA 2GIFA 1FRKA 3MCOA 3QWPA 4LREA 2A0FB 3CDWA 4J37A 4LBPA 3BB5A 5GAEU 2OKQA 5J1EA 1SL2A 1S1WA 1QUVA 2ZH3A 5LMUJ 1S1VB 3NNHA 4ZCMA 7FDRA 5AXKA 1GMWA 2LXFA 3TI0A 1UVLA 4WBFA 3QZ8A 1F9HA 3FMWA 4ZS6A 3SDEA 4M5NA 1FJ7A 5HMZA 1TKXB 3JTNA 2QA1A 3DNCA 2Z0GA 2CDRB 5F8IA 2GO8A 4DV7J 2FQQB 2ALZA 1KD1T 2EWHA 4CRJA 1RHKB 3T5KA 3HK2A 1C1CB 1WORA 1F3FA 2CQGA 1NDLA 2DNLA 4ZA1A 2QMXA 1JJCB 3ZZUA 3I9V9 4RU9A 4PWDA 3THTA 1NAQA 1G2EA 1BQMA 2VODA 1YIJS 4KKOA 5L46A 2B51A 2MKJA 3CSKA 2QLFB 3NWGA 1FO1A 1TK5A 2MPUA 2ROEA 2WONB 3UD4P 1XMOJ 4CP5A 3A4TA 2CNNB 4TQRA 2C1EB 3HZEA 2UVWA 3K5LA 2DNOA 1FK9B 2W2PP 1F9EB 3HVTA 3M6VA 4NWBA 4P7VA 4JI8F 4AE5A 4WCEQ 4YB1P 2MYFA 3WHIA 4KRWA 2ZH9A 1GXTA 4DSLA 1IKWA 4ZLJA 2HFZA 1YJTA 4WFZA 1NKEA 2CFXA 3JSMA 4NLVA 4RLEA 3PX4A 2FLLA 4QBUA 4RW8A 4DV6J 2BE9B 1S48A 2ZE2B 1T95A 3C8YA 3PJWA 3LW5C 5F41A 2W8KA 3RJMB 4CDIA 2NUHA 1KP6A 3V81B 3PRDA 1SQGA 1IJEB 1WG5A 2Z57B 1D8ZA 2GCFA 1HBNB 2HEKA 4C3KA 4I7FB 3N5BA 5ETLA 2HHHJ 4J9VA 4NEYA 4DR7F 2BRLA 2YTCA 3HSDA 4Y6IA 3BBCA 4L75A 1BQNB 2QYGA 4TY9A 3BO3A 3D54A 3KFWX 2V50A 3IAS9 1XIQA 1AA1B 4F04B 1M1HA 3HHEA 1YJVA 2NPIA 3AY0A 5B0AA 3UN3A 3EGZA 1RP5A 2UXDJ 1QAYA 1I1GA 3M32B 3NGDA 1C1BB 2MXYA 2LEAA 1N33J 3VAIA 1ITPA 2RDDA 4I68A 1H38A 2DR5A 5CD4H 2V8DA 2C2DA 3KHHA 1WD6A 1KFDA 4IDKA 1QD1A 4KO0A 4TLQA 2VFUA 3NXZA 1XWLA 3LP1A 4LIRA 2NREA 3F41A 5KFNA 4MJKA 1FVSA 3Q24A 4YS2A 4W92B 2KB2A 2E7WA 2ZH8A 3QIDA 2FUG9 2G0IA 3R5AA 4PG7A 5KFTA 1RTIB 3OFGA 1AZSA 4RUAA 3OD2A 3QGPA 1DLOB 2I9SA 1FDAA 1V3RA 1Y5NB 2XSFA 4IOBA 1VC0A 2AV5A 2HURA 1WOOA 2FTRA 3CTRA 4F4YA 1S77D 2J6TA 2BJ1A 3QYYA 1RHJB 1NM2A 3LANA 5LM7E 2OP5A 3VQSA 4YY3J 5DDPC 4J9KA 2V5HG 3PY8A 2ZNYA 2P9EA 3DDKA 1DURA 3TP2A 4UOHA 1NDPA 3KLGB 2V4QA 2FVSA 2VC1A 2J0QD 2ZJRQ 2DY9A 3FQLA 4FDFA 4DR1F 2M0GB 4IH6A 4OYOA 3N6NA 1JNZB 3T41A 1X4GA 3Q8RB 4IRDA 1S9GA 1SBRA 1Y5IB 1RA6A 4DN0A 3Q8UA 1FWKA 5ETSA 1NSKL 3R2CJ 4DV0J 1SV5B 4I6WA 2KFZA 5HN0A 2BE2A 3POTA 3D6MB 4KGZB 2DB1A 2VBZA 2WZ1A 1IBLF 3RRHA 3GJQB 2HWHA 2E5JA 1UA1A 2MZQA 3VAHA 1SC6A 3DOKA 2WHOA 3UFCX 2B56A 2GVDB 6AT1B 3JAMU 1M5KC 2ZVIA 3A3PB 4KGKA 4WXWA 3I96A 2V9WA 4UZCA 1C1BA 3SFGA 3CJTA 1J5OA 3GB0A 1RACB 5ETNA 5AJ3F 1HW8A 4QW9A 2DNNA 3QLHA 4MH8A 2QA4G 4R8UB 1EETB 1XN9A 2DNHA 4DPTA 1WF2A 2W8LA 1ACMB 3G82A 2DXFA 2V67A
chains in the Genus database with same CATH topology
4N47A 4BDPA 1HBUB 4F4KA 4A8KA 4QR0A 1YJWS 3BQ1A 3GIJA 4I2QB 2NSBA 3BSAA 5FD1A 2FJWA 4I0WA 3E2EA 2QSFA 1NH7A 1S6PA 3CE8A 4KFBB 3T9ZA 5KT5A 1QAIA 2ZDOA 3CEDA 1QE1B 2Q6BA 4YQWA 2MQNA 1HBOA 2CJBA 2HZCA 2IYIA 1DTTA 3O2IA 2YVSA 2FVCA 2F40A 4WFAQ 2V4RA 2H9ZA 1HBMA 3CDBA 3VALA 2M7SA 3BDPA 1KOOA 3DCAA 2NS1B 4PQAA 4TN2A 3CCJS 1HI1A 1FXDA 1UJ6A 1YJUA 3E3XA 3IN5A 4B9SA 5KG1A 4B9MA 2GJIA 4URSA 3QJLA 4ILRA 4Q0BB 2QA4S 1CEZA 4B17A 1OPIA 5D3GA 1ZAWA 5L8RC 3OVSA 2U2FA 2YNHA 2F7VA 2V4JB 4ICLB 2ZC4A 3OXFA 2VBWA 2F4VF 4Y28C 1WACA 3OR2A 4A8WA 4OI6A 1TL4A 1S6QA 3HKZD 3H8YA 3SCLE 5A0YB 1URRA 2X1BA 3I0RA 3CD7A 3KNGA 4DEZA 3CCTA 3QIPB 1HYSB 2CQ0A 4ED5A 4ETXA 4HTIA 2CQCA 2MMYA 4O44A 2E5IA 3OXLA 5KT3A 3V4IA 2FVRA 4WZQA 2DISA 2BA9A 3P3DA 3US5A 2ZM6F 1U48A 3CD6S 2KO1A 4NXMF 2LA6A 1RAJA 1C0TB 3ZZYA 2OD6A 2AYEA 5IWAF 1J5OB 4LF4F 1IKYA 2D9PA 1IKYB 1ZPWX 2VB6A 2XNRA 1Q78A 4NXNF 3W2WB 2WAQD 4IG0A 3W2WA 3NGDA 3OTOF 2CQ3A 2RE1A 5B0EA 4C8MA 2I1RA 3PW2A 5T41A 1YJNS 5J2MB 4HVZA 2LLZA 5A6WA 1HI8A 4HLBA 3C2PA 4K4UA 3BREA 2C3MA 4WK1A 1WHVA 3FQKA 2GNKA 1HNVB 3CJKA 2R8GA 2DIUA 5HMXA 4C3MA 1DTQB 5DG9A 3KLHA 1IKVB 4X4QA 2GMHA 2JLGA 5IFMA 4DL3A 2IMOA 3LP2B 4Q2MA 4KHRA 2F9DA 4BC9A 1FE0A 4OV1A 1C2PA 3L3CA 4OFZA 1FNXH 2CRLA 3RRKA 1RJJA 4GKJF 4B3RF 3NS6A 2XY5A 2UV8G 1QSLA 1N5VA 1JLFA 1IQZA 1GQEA 4IFVA 4IR9A 2G4BA 3I5CA 4CO1A 4EGLA 4X4PA 1U1NA 3X1LB 3WC0A 1A9NB 4RNNA 3QO9B 1DQAA 3Q8PB 4PQUA 4MKBA 3GYXB 4ID8A 1TZ0A 4FS2A 4RUCA 5C25B 1JK9B 2WBRA 3MMCB 3UQSA 1S1VA 1S4FA 1C0UB 4DL7A 3MTJA 3DRPA 3I0SA 1SJQA 3ICLA 5BJRA 3NKYA 5HO4A 2XEXA 1ZZFA 1JX4A 2B4VA 3PHEA 2FB0A 2ILYA 3CJ3A 3PEHA 3ZZOA 1HNVA 1FD2A 3CJKB 4LFBF 2WSFC 4ZOSA 2C22A 2WRMA 2FPHX 2FJEB 1VBZA 4LUBA 2A2DA 4B9NA 2GGPA 2BBEA 3TX8A 3MUTP 3DI6A 4TXSA 5F8HA 2D1CA 3MTKA 1VRUB 4C97A 3OR1A 4KE5A 2VQEF 1N5QA 5L9XA 4CH7A 3M2RA 4MYTA 2YX7A 2BZ2A 2LQ9A 3M2RB 1R0AA 4LVNP 3J7Z5 4QIGA 1C4AA 3L95X 3UR3C 3UR0A 5EX0A 1YBAA 2VA3A 1VRTB 2GW8A 3RYLA 2APOA 4DFMA 2KRBA 3NBPB 2ZOMA 4U6PA 3LWMA 1QUPA 2A2CA 2AGPA 1TVRA 3I0RB 2J0WA 5F0UA 1HQEB 1DJ0A 3NCRA 2AYMA 5DQHA 5T14A 4PPZA 4RW8B 4OX9F 4DMZA 1RK8A 2X1FA 3K57A 1U1RA 3FRYA 1IM4A 2DBBA 4C8KA 5K8PA 2BACA 4F4XA 1AROP 5ADZA 1N33F 3NLCA 1U1LA 2CPHA 3MEGB 3KK3A 4RKUC 3UE2A 1NK5A 4ZVHA 3NMRA 1HD0A 4KC5A 1RDRA 2YWGA 5AE2A 3H2UB 5K14A 3MGJA 3KK1A 3AHPA 4ZKAA 1RTJB 4CIOA 4DSJA 5B0CA 5DETA 2J8AA 2M2BA 4PG4A 4QU7A 2L3MA 1UJ5A 1JLGB 3C6UA 2ZH2A 1S6PB 1X0FA 3CIMA 3NAHA 2V8GA 2FVQA 3GYNA 2XC9A 4QR2A 2KM8C 3T9NA 3IG1A 4DV6F 3NP5A 2RU3A 1UVIA 3IWNC 1TVRB 1S1UB 3DLBA 1S1WB 1U49A 4O4RA 4Y2KA 1KQSR 2GX8A 1RT3A 1RISA 2AJFE 2AJ0A 5KT2A 3DLEB 2HNYA 3V4MA 1PGZA 5A2QY 3UW1A 2L41A 2EG2A 1XMOF 1HL6A 2MY8A 2WCXA 1MU2B 2LEPA 2LQBA 1K0VA 1HBUA 4YDDB 3VR1A 2ZNZA 4ZDNA 2GMJA 2BV3A 1SJ4P 2OPSA 2R7VA 3D1QA 1VC5A 2DCLA 4R8UA 4NLXA 2MDAA 3NNAA 1V3ZA 1TKTB 5HI7A 4XIUA 2HHUA 4I64A 2XSJB 2C42A 4MKYA 3MM7B 1R27B 4QOTA 1HNIA 5BYRA 2FGOA 3FJ2A 3X3UA 4DR6F 4M94A 4B3SF 3OSNA 3JSMB 1M0SA 5EX3A 1FERA 4O44B 1W2BR 3IS9B 5KTQA 3CD0A 2VOPA 2QYCA 3CUNA 3H59A 2JZ5A 2F8HA 4NYOA 2KHCA 2ZBCA 3QPIA 2L48A 3KK1B 3J7A1 5HP1B 5D3GB 3CD5A 4RZRA 4RNOA 2IYGA 3GIIA 3M2VB 4UY85 5HMWA 4AFFA 3ISZA 2MZ1A 1PSDA 1FDNA 2P6TA 1Y3KA 1N0VC 2ASYA 3OPKA 3M8RA 4ID5A 2HLTA 1T7PA 3DLHA 3GSDA 5FJ4A 2MKIA 1YITS 1KHVA 3GILA 3LALA 1QAXA 2I5JA 1X8DA 2Y1JA 4OX8A 4TYAA 2PA8D 3UCZP 2DNPA 4NA2A 2R7WA 4LT6A 5CZXA 3SCJE 3PX0A 2C28A 1TL3A 1TQLA 4DPOA 4CO5A 1F0XA 1KQGB 3CMAS 1HFEL 1KLMB 3D0GE 5A8RA 1ZZNA 5KFPA 2DGXA 2F8MA 4A8FA 4QWAA 5I3PA 3S8SA 5HROB 2UVRA 3BJYA 1NK7A 1WG4A 2O66A 5THWA 3G71S 2RMLA 2CQPA 5A6PA 5AE1A 5I3UA 2OPSB 3A8EA 4GC7A 4K4YA 4LFCF 1BQNA 3OTEA 5LXRA 4DUZF 1ZYQA 4PG5A 3RW7A 2AWZA 1HQUA 3KLVA 1WG1A 5SUHA 2HHWA 2XS2A 2KFYA 1S6OA 2JFDA 3N4WA 3KNAA 1B0PA 1CQMA 2N3LA 2RD5C 2IA0A 1UAWA 5KFIA 3EZ5A 4QJVA 2A1BA 4HDHA 4LF5F 2RS2A 2C3UA 2M3DA 2CJAA 2GGPB 4MK8A 1KRPA 4N76A 1LK7A 2J0SD 1UL3A 3MR3A 5KFVA 4I6YA 1K9MT 4A4JA 3Q22A 4DV5F 3VAKA 4NLYA 3RB3A 4G1PA 4XDDA 1SJ3P 3FMBA 2DHSA 4RW9A 4A8SA 1TL5A 4ED8A 3AQPA 3DOMA 2XMWA 1S0MA 4IFVB 3OL7A 2LQ5A 4PRFA 2EG1A 3IBWA 4ECUA 2OH2A 3TA1A 3H2VE 4EBDA 3UPFA 2VG6A 2DCUB 1B7FA 2VBXA 3K5MA 3J7YI 2AYGA 2YKOA 2HVZA 3NNCA 2DR7A 3SV3A 2DPJA 1HD1A 2P5VA 2N3OA 4ED2A 1L3TA 2BYCA 3VTIA 4OZ0A 3PRBA 2W9AA 3AA8A 2HVIA 4K5SA 2Y1RI 2IBKA 4DLGA 1U45A 4PKDB 1ROFA 2FHJA 2RT3A 1TV6B 3DFEA 4B3TF 4CQ1A 2O67A 3FEZA 1JIHA 3DMJA 5GMKa 3OLAA 1S97A 3D5MA 5A8KB 1FXRA 2VG5B 4NZ7A 1RTHA 2BOPA 4ERDA 5C5JA 4FXDA 5DG7A 5KFRA 1VRTA 5KFHA 3M8QA 2VBYA 5D4LA 2R2UA 1XNQF 4R0EA 4RU2A 1NO8A 5I3UB 2HQ3A 2VPZB 2E9TA 1WEXA 5IT4A 3DOLB 4J9NA 4NLQA 1OO0B 5FDLB 1XK8A 5GADI 2U1AA 5DLFA 3IR7B 2ZZNA 2RRAA 5FIIA 1QLNA 1S0VA 4Y2CA 5J2PB 4FZVA 2CYYA 1S1UA 3G8SA 1CQNA 2KYXA 4IG3B 2K2PA 3R1HA 2K8GA 4OMFG 4M5DA 4KJIA 4O3OA 3CULA 3HF5A 5KFUA 2BJDA 3AQOA 2CPEA 4USHA 2FD2A 5DDQC 4FNIA 2QO3A 1YTYA 4NCAA 1S0NA 4EBCA 2X1GA 4PR6A 2DJWA 1HHTP 4KTQA 1H7XA 3Q0AA 2SXLA 5C24A 5CZVA 1R3NA 2KG0A 1FRLA 3T6BA 2LXUA 1T05A 4OIXA 3IR6B 4IO9Q 4OL8A 4U9RA 1K1QA 1OIAA 1FTRA 4LSLB 2HHPA 2JEGA 2GQQA 5J2QB 4IR1A 4E98A 2Q79A 1FJGF 3ONQA 3TOQA 4LF8F 1Y00A 1IKVA 3GFHA 3KYLA 2DIVA 2J9DE 3IS9A 4XK8C 4KV8A 3QWUA 2KJVA 4DF8A 2V2KA 1NZAA 1MSWD 4DFKA 2CPDA 3DN9A 2NSCA 1HPZA 1WF1A 2VC0A 2XBPA 3VAJA 2JVOA 1P1TA 4PUOB 1TFWA 2EW9A 4HH0A 1IXKA 1GT8A 1EETA 4B9LA 2PGCA 1M5PC 3DU5A 2N4CA 3RRGA 1U24A 3D0IE 2XSJA 1WTBA 1M1KT 2JDJA 2E1CA 3BQ2A 4DFPA 1FD8A 2KFZA 2L9DA 2K3IA 4LVOP 1H3DA 1P9QC 2MY7A 3MEDB 4DR5F 2DT9A 3SZ2A 5J2NA 5H9EJ 2UUCF 2UP1A 4U67Q 4RW4B 1X4CA 3LAMA 3I32A 4DF4A 1D9DA 2IAJA 3ENVA 1YJRA 3BDEA 1LWCB 3I5BA 1HARA 3KHRA 3DRYA 1HA1A 2XS7A 4R0JA 1LWEA 4F3MA 1SL0A 2FJAB 2B4UA 3V6JA 1N32F 4Q45A 1U8SA 2R2RA 3EGNA 3MEEA 4IRKA 2JEIA 2BANB 4J9LA 2DVIA 2OPRA 2PFFB 3V6HA 4NCGB 2YKNA 5JUMA 1JLEA 1JLEB 2VFRA 4RWXA 3ULHA 3BR9A 4JV2A 1E6VB 4YUDA 3HVRA 3MMAA 4O4GA 4PPDA 5MAOA 1JLCA 3MOZA 1ZBTA 2YKQA 4ZCKA 2ZH6A 4J9OA 4DOZA 1TAUA 2EFNA 3UWTA 4K2XA 2RUGA 4G3IA 1JXLA 1TFYA 5E3CA 1JLAB 3HT3A 2Y1IA 2ZD1A 3L7OA 3JAMY 5CH7B 1VLYA 5I42A 3GR0A 1SKSA 2FLPA 1U26A 2FC8A 5L1KA 2HS3A 3MAHA 4UUXA 1REVB 4JBCA 4RW6B 4LF7F 3HVWA 3H4BA 4ZMMA 4H4OA 3SYZA 2EC0A 4ELVA 2ZH1A 4NA1A 1OQ3A 1LKZA 1R0AB 3OVBA 4I56A 1R8AA 2HFOA 2R7OA 3KOAA 2M70A 1FA0A 3G4SS 2R7RA 2AX1A 1WHWA 1O51A 2VV5A 4WK3A 3OTDA 1N5TA 2GMLA 3F56A 2BJEA 3CF5Q 3T6JA 1FKOA 1UW4A 2CPJA 1Q16B 2MGZB 2XGQA 2AJQA 3HDSA 3MM9A 4H4KA 2LDYA 2W9BA 2IM3A 4DR2F 4KKOB 3FZBA 3MMAB 1MMDA 4NZ6A 3PO5A 4M95A 2FGCA 4ZCIA 4RBUA 1D9AA 1UWBB 2V4JA 4HI2A 4IO1A 1BQMB 3RZAA 5L1LA 2J7UA 4MFBA 3E01A 1APSA 3PZPA 2XWXA 3M05A 4RW7A 1SJFA 3LWLA 5ITHA 2RVJA 3ZZRA 4HT7A 3PIPQ 1ZAXA 1RT2A 2ADCA 2JEJA 3T19A 2OMLA 2QRRA 1C4CA 4RBTA 4GKKF 5K5MA 3OJUA 1DTQA 1WI8A 5LMNF 2MKHA 1SH0A 4WF9Q 3SXLA 4DV0F 2R7QA 1D9FA 2IM0A 5IT0A 1LWEB 4J9QA 1R6YA 4DSKA 4PWUA 5KT7A 5FLXY 2LEBA 3IRXB 2JEFA 1QE1A 4LF9F 4QU6A 3MEKA 3NRBA 5BYQA 2Z2MA 4H4MB 4HI1A 1CPZA 3M6XA 1OWXA 4QPTA 3M32A 4Y2AA 1VQ6S 4I67A 3N01A 5G4DA 4RNMA 4A46A 2IHR1 5E3QA 1MWZA 4ECRA 4YY3F 3G86A 3GMGA 5FDLA 1U2FA 1Y9OA 2R2TA 4O3RA 3RAMA 4GMKA 2PO4A 4RW6A 4P6QA 1NNDA 3PR5B 2DGWA 4HT5A 5G0RA 2ZC3A 3K8WA 3HPOA 2W7PA 3FSXA 4ZPVR 2E1AA 2QLWA 3DLEA 2PT0A 4DBQA 5B7WA 2ZOFA 2LXIA 1NH8A 2XI3A 3I4HX 2ZE2A 3GWCA 4Q7AA 4A8YA 3RB4A 2ZD1B 3BGRA 4I2PA 4QIFA 1R8PA 2RILA 4CO3A 5A8RB 1HYSA 4DJBA 1L3KA 3MMBA 1KC8T 2FVPA 5K8MA 2YKAA 4K4XA 3B78A 4N8NA 1S1XB 1U1KA 1BQXA 3T5HA 2X1AA 2WONA 4K4VA 3QO9A 2DHAA 4LSNA 3MECA 2VPXB 3GR1A 2ZBIA 5J2QA 1WEZA 1FRIA 2CPYA 1LW0B 1VQOS 2AU0A 1X4EA 2MZSA 2L9WA 1KS2A 1U2RA 3CCES 2XS5A 1QM9A 2RNEA 5B08A 1PC4A 3QJJA 1TR0A 3M9MB 2VL1A 2IMWP 2P6SA