5CH7B

Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
total genus 86
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ch7B00
1XERA 1G6BA 1BD6A 1JNRB 1K0TA 2O01C 1H7XA 3OR2A 2Z8QA 2C3MA 1FXDA 1FRLA 1BQXA 1F5BA 3EGWB 2FD2A 3EXYA 3MMCB 1GTEA 1BWEA 1FRMA 4RKUC 6FD1A 1GT8A 3OR2B 1JNZB 2VPXB 1FDAA 1FTCA 3MM6A 3MM9B 3MM7A 2WAQD 2WSCC 2V4JA 3MM8B 1SIWB 4XDDA 4CI0B 5BYSA 1KQFB 1A6LA 1VJWA 2FJAB 2Y0SD 2C3UA 5FD1A 3LW5C 1FF2A 4L6V3 2C42A 1Y5LB 1KQGB 1DAXA 1Y4ZB 2FJBB 1DFDA 2FGOA 5CH7B 3MM7B 1WTFA 1FDDA 1D3WA 4AYBD 1FCAA 1B0TA 1JB0C 5CHCB 1BLUA 2WB1D 4OV1A 4KT0C 6FDRA 3OR1B 2C3OA 1H98A 2VKRA 1Y5NB 1H7WA 3EUNA 1AXQA 2XSJA 2PMZD 1FD2A 1FRKA 2XSJB 2V2KA 1GAOA 1B0VA 4Y28C 1FEHA 3MM5B 1G3OA 1CLFA 2UZAA 3MM5A 3GYXB 2PDAA 1Y5IB 4DHVA 1FRJA 1R27B 1RGVA 4ID8A 3MMBA 2VPWB 3C8YA 3PNIA 5BYQA 1ROFA 2VPYB 3MMBB 1GTHA 1PC4A 3IR7B 4XK8C 1F5CA 3MMCA 1FRHA 2FJEB 2PA8D 1IR0A 1BC6A 2C3PA 1SIZA 4OMFG 2GMHA 3MMAB 2ZVSA 1DURA 5L8RC 7FD1A 3MMAA 1PC5A 3MM8A 1SJ1A 5BYRA 1FRIA 1KEKA 3IR6B 1C4CA 1FXRA 1FERA 1IQZA 1FDNA 3HKZD 3OR1A 2VPZB 5E7OB 7FDRA 4XDCA 1HFEL 2C3YA 1Q16B 2FJDB 1H0HB 2FDNA 3IR5B 2WSFC 2WSEC 3MM6B 4YDDB 1C4AA 2GMJA 1FDBA 1F2GA 2V4JB 3MM9A 2IVFB 1FRXA 1B0PA
chains in the Genus database with same CATH superfamily
4F4XA 5IV4A 3BGRB 4JB8B 1WI6A 1WWHA 2YPZA 2JJ4D 5THWA 3DHXA 3PR5B 4J91A 2QV6A 2VOPA 2PMHA 2KRBA 5L39A 2JEJA 5BJRA 2ALZA 2C3MA 5B09A 3V6JA 1BQXA 2QMUB 2OP5A 2YNIA 3N5FA 4DL4A 2E29A 3B82A 4YDXA 1HW8A 1YK9A 1FJCA 1Q79A 1VFJA 1UJ5A 2EG2A 3ETMA 1Q8KA 2F7VA 3GIMA 3SEOA 1TK5A 3ENQA 4DV2J 2HHUA 1FDAA 1S1VA 3DYAA 2Y1RI 3KJVA 1HQEA 2W4CA 2UUTA 2WAQD 5A8KA 3JQKA 2ZKUA 2DGOA 1VGYA 2LA4A 4PUOB 3UO0A 4WWSA 2HLTA 4RW8A 1RCOB 1VIOA 1XTZA 2N3OA 3RB4A 1Y11A 2BR0A 2QGFB 3NCRA 4ZIVA 3G82B 3HP6A 1HLWA 4HYKA 4DLGA 3V81B 1HBMB 4OYBA 1VDHA 2RUSA 3PYDA 2A0FB 1Y3JA 3LTOA 4O4RA 4JV1A 5ETSA 2J0XA 3KUHA 2KI2A 3R7NB 3ZZ0A 1PJ7A 2O66A 3ZTOA 2RQMA 1PAUB 2FGOA 4M1KA 2DRAA 2JSXA 2AW0A 5A8KB 4IO9Q 2FY1A 1O8BA 5AJ3F 1YWXA 1XQIA 3CMQA 3UR0A 5KG5A 3FC9A 4F2SA 1PBAA 2ZWOA 3NS6A 3TZYA 2MHEA 1H98A 4USIA 4M5LA 2QA2A 2XYGB 1XMOJ 2PMZD 3EDQB 4NYPA 3JYTB 4J9MA 3RTVA 1FD2A 4CDIA 3ET6A 4KRWA 1GAOA 3PHEA 3RU0A 1GXTA 1WF2A 4DUYJ 4NMXA 4U6PA 1S97A 4AL6A 4CLTA 4DV4J 4C8OA 2IM0A 2DNZA 3NNCA 2BE2A 4DF4A 4LRFA 4ES2A 4IKAA 1X0PA 2LEAA 5LL6d 3V4IB 2CPZA 5EHHA 2Q43A 2VPWB 2A18A 3C8YA 1MWQA 3F44A 3FZ2A 2GV1A 3R7BB 4ZVEA 3KLGA 1N5YA 3HM9A 1GTHA 4OX6A 1N4LA 1G2EA 2EKNA 1CC7A 2HWTA 4J9QA 3W63A 5KFNA 4C8NA 2HS3A 3IC1A 1N6QB 1IR0A 1P9QC 4DV1F 1ZZNA 2AU0A 4K0KJ 3I0SA 4U8YA 2AYMA 4YFUA 1NHKL 4BCAA 1LEOA 2XWXA 3S01A 4ELUA 1N88A 4NCBA 4PCQA 4M95A 3LANA 2YWGA 5D4NA 4DR5J 1KFDA 2QLXA 3OFEA 1HWIA 3OQ2A 4WKYA 4DV7J 1XMQJ 3ETOA 4ZPVR 1RHMB 2YQ1A 3SZ2A 4EO6A 2VG7B 2KG1A 2RUGA 3SQOP 1N6QA 2VBWA 4OZJA 3J81j 3IBFB 3MI7X 2K2PA 2IRUA 2LP4A 4ZCMA 3RGIA 2ZH5A 5HSPA 4ZVQB 2AEFA 4MH8A 1XMBA 2DGVA 3Q8VA 4F50A 4O44A 3MOJB 3TUZC 2C28A 5KG0A 1RJJA 1SCJB 2XLKA 1TVRB 3LAKA 4C48A 5J2NA 4B9NA 4CCHA 4FXDA 4DV5J 5T7LA 4XAKA 3ZTRA 2I38A 1F3VA 1Q7YT 3TW0A 5C2GA 1FKOB 2YKAA 3DRRA 4PXBA 4C11B 2HVZA 2QYGA 4MMOA 5E3QA 5L9XA 4QWBA 5C25A 4WZQA 4LF8F 3EDRB 3R1HA 2CNKB 3G6VA 1YBAA 4DR2J 1HHQA 1F2GA 2BRKA 1HBOA 4GKKF 2B4OA 2YX4A 3D6TB 3X1LB 2HS4A 1SV5A 2LLZA 2XWYA 3KG0A 5IWAF 3RZAA 1HIYA 1WEYA 2R2UA 1U0HB 4Q2MA 5EWGA 3EICA 1P6TA 4WCEQ 4RUAA 3ICLA 2RMLA 5DLGA 2HHHJ 1QTMA 1U2CA 2ZZMA 2BKOA 4IFYA 3RRKA 1R8PA 4QZVB 4YP3A 1UL3A 1SB6A 2ASDA 4JV5J 3IAS9 1NKBA 1FXDA 3DXBA 1X60A 3GFHA 2HKEA 4IH6A 3PX6A 1R0AB 2BM1A 3M32A 1E6VB 3P5TL 4OI2A 4RNNA 4KFBA 2HLUA 2MYFA 2Z56B 4DS4A 4X4NA 3OHAA 4F4ZA 4QIEA 4I56A 2ZBPA 3Q8UA 4P71A 1LKZA 2CQPA 2BJ1A 4X64J 3C6TA 3CVKA 4IOBA 1M1KT 2Q66A 4QYZJ 3KNGA 5A0YB 3CCWA 4MIAA 4DR5F 2IHR1 3AA8A 1X5PA 3FCHA 4DWIA 1J5EF 2IIHA 1HWKA 4C8YA 2YBVA 2R7VA 3BGUA 1XC9A 4U9RA 2L9DA 1WHYA 3J80U 3CIZA 4TY8A 4IOCQ 2HYIB 2KVIA 2J8SA 4A8WA 4FF4A 4C4WA 1R6YA 2F9DA 4Y2CA 2N82B 2BA9A 1TU0B 1GH8A 5HL7Q 2QA4G 2HGNA 3E01B 4NA1A 5CZXA 3FMWA 1OQ3A 4RW4B 5A8WB 4ZP9A 1PGZA 4LRAA 4ZP6A 1V3SA 2KN4A 2E5IA 2IRYA 5IZHA 1I51B 1VQSA 2CDQA 3DOKA 3J7ZT 3CCES 1G7CB 1FK9B 1DRZA 5DM6Q 1VISA 4RW7B 4IR9A 4N7TA 3L7UA 5C42B 3CD7A 1U1LA 1R6VA 1C1CA 4UOGA 4JOUA 3MD1A 4QCLA 4I2QA 1BQMB 2OLWA 3R6LB 4L75A 3TVZA 3VAGA 1JLAB 2BOPA 4DR4F 2QL9B 2V4RA 1E6VA 1VBZA 3ENAA 3KKFA 3U27A 4J9KA 2DH8A 1Y5IB 3TUJC 3DLLQ 3QSYB 1B99A 3UN3A 4JI7F 4X65J 1T9XA 2IC3A 3M2UA 3OTBA 3CC2S 4A8MP 4JI1F 2AGPA 2ZH3A 3C6UA 2RB7A 3KHRA 1S6UA 2K1RA 3DGVA 3Q86A 1S72S 5CA5A 4DSIA 5J1EB 2NXJA 4JI8J 2H5JB 4X4TA 1FKPB 3D0GE 2W9BB 5GVQA 4FYYB 4U95A 4Q5VA 2FIUA 4PG8A 3D7SB 3KHLA 2PA8D 2CQHA 4HH0A 2IAJB 4JI2F 5ETMA 2CQIA 4H4MB 4MIWA 4IG3A 3BO4A 1PKUA 4CYUB 5HP1B 1ZA2B 3POTA 1X4EA 4C7QA 2VG6A 1S9EB 1TMMA 2NYIA 2VC1A 4NLOA 1RT5B 4KPCA 5HANA 1RA7A 2CXEA 2E7VA 1RT6A 2H65B 4Y65A 5KFSA 2R7SA 5J2QA 1KC8T 1WHVA 1RU2A 1CBKA 4IQXA 1FKPA 3SYZA 1TELA 3HDSA 5IC6B 4KPYA 5CYQB 1JXEA 4UY8T 1RKIA 1IQZA 3HHLC 1FDNA 3OR1A 7FDRA 1LW2A 3GV7B 2R2SA 2QTWA 1VQLS 2YKOA 3T6JA 5DDOC 5E0OA 2I8EA 1RT6B 1KDNA 1BQMA 1GQEA 1JLFA 1WSRA 2A6MA 2HQDA 4EZ6A 1T3NA 4EYHB 3Q89A 5ETVA 4P2FA 4KO0B 2BBEA 3H5YA 4L76A 5K9FA 3BPSP 2KJWA 3A3NB 4I4BA 4CH0S 2KT2A 4ZHRB 5D3GB 3MM9A 4TQSA 9ATCB 3FKBA 3N0VA 3BQ2A 2KO1A 2XNQA 4A8KA 3HXMA 4JI0J 2RHSB 4F67A 5IFMA 3GP9A 1LXJA 2HHTA 1L3UA 1TKTA 3P5BP 2AX0A 1UVIA 2HHXA 1RTJA 4DPYA 4OYMA 1ZH5A 3KMQA 2R7OA 1JNRB 4NI2B 1LV5A 1YQHA 5D0GA 1YJRA 2HQIA 3AODA 3EVWA 5E3AA 2YNFB 5GMDA 3KMSA 2PMWA 1OJ4A 1I1GA 4X66F 2OH2A 3TUPA 3Q8SB 3MMCB 4ZCKA 3NNHA 1FJEB 4X4SA 4EO8A 2W2QP 3NCPA 5AT1B 2R7TA 1DTTB 1TKTB 2LVWA 1OY8A 1U2RA 4I1TA 2XZDB 4NLVA 5DQHA 1IJFB 1VQ6S 3MECB 5B08A 1TAQA 2OO4A 4NX9A 2V34A 3CCZA 4Y2KA 1UEVA 2ZFHA 4LF9J 2B4PA 3HHNB 3GIIA 1SC1B 1DQ9A 4WP3A 3SBMA 4CLYA 1T0TV 2GAGC 5L9NA 4YB1P 3QNWB 2CVEA 3OXLA 1IBCB 1RB0A 3AD8C 1DY3A 3N9UC 4M5KA 3VR1A 2MQOA 4CO4A 1NM2A 3LW5C 1FF2A 3KLVA 4EBCA 2ZM6J 2C42A 1VRUA 3QPIA 2YKQA 1RLCL 5KG6A 1Q86T 1VRQC 2BOAA 1P1LA 3GFZA 3DKDA 2KFYA 4OYOA 2N7CA 2ZH9A 4RR5A 4RZRA 4FBTA 5GAHU 2KT3A 5DDQC 2E7XA 4LF7F 1U0SA 3GJQB 3QGIA 6FDRA 5A8RA 2UVRA 1XIQA 2X3DA 3NWRA 3PO5A 3QIDA 1DBDA 4LR7A 2V2VA 1KONA 3EUNA 2WBMA 2EPIA 1LWEA 3PXGa 4K50A 5L1KA 3OLAA 4K5RA 3F0NA 1XNRJ 2ZJPQ 2BACA 2RIJA 1X31C 4HHJA 3J7YI 4LBHA 4KGZB 4RW7A 2H3EB 3H40A 3UVJB 3ZO7A 5D77A 1N5SA 2JOQA 4IG3B 2BQRA 1VC6A 1WNEA 4ZPTR 2AIRB 2R7UA 1ZAWA 5D4LA 5HQMA 3ZFVA 1F3FA 3JS9A 1FT8A 1S0OA 4U7CA 1H38A 1HI0P 5KG7A 3W2WB 5IWAJ 1APSA 2NSBA 4K2JA 3CJ3A 3HZEA 3VTIA 3OPKA 4DPTA 1TL3B 3L7PA 4C3LA 3CTRA 1IKWB 1BQNA 2I5JA 2K3KA 2YVSA 4CO3A 3PRBA 2W7AA 4IH7A 1S6QB 2AYBA 1RWNB 4LVNP 2L48A 2BW7A 3HHLB 1KVKA 5F8MA 4Y3CA 3TANA 1XMQF 1RWUA 2PI5A 3LWLA 5KG3A 4NXNJ 1ICEB 1U4BA 5I42B 2LQ5A 2GJFA 3CNQP 2DR7A 4HKQA 2V94A 3VZHA 3D3BJ 2OEMA 2XG8A 2CJAA 4H4OB 3JQJA 2HNYB 3EE3A 3MEGB 3Q83A 3H0PA 3EM1A 4ICLB 1PILA 4ZPAA 2OMLA 4J9PA 1UCNA 4O4GB 2Y1JA 4A47A 4ZLNA 3KDNA 4ANEA 1IBMJ 4A8FA 1XNQF 2FJDB 2YH0A 4LF7J 2DRBA 1RYRA 3D6FB 1NSAA 4USWA 5CCMA 3L7OA 4TYAA 1RBAA 4JI1J 2EFQA 1HYSB 3Q22A 4JI3J 2GMJA 4Y34A 4PQUB 1HNWF 5F8LA 1RTHB 2I1RA 4AFFA 2J6TA 1U1OA 1RE1B 1TL1B 1RTZA 2CPJA 1VQ9S 4LF2A 2CZVC 1IBMF 2WCXA 5KFHA 3GPAA 3PEHA 4PPDA 1QY7A 2H4YB 4QPTA 1NDKA 3CC4S 1X8DA 2VFSA 2HHHF 4NCAA 4ETZA 1DTTA 1UWAA 4O0IA 2RT3A 2POKA 3OR2A 4ID5B 4DFMA 1AB8A 4OZNA 4C0BA 3THVA 1RUSA 4CLLA 1FRLA 2CAJA 2EC2A 1GMWA 2XC9A 2NZ4A 4KFBB 2FHJD 2R42A 1UW9A 4U67Q 4O3QA 4DDFA 4XTTA 3MR7A 3CWJA 1VOMA 4HEA9 3SI8A 4LFAJ 2VG7A 3EZUA 3EPIA 2VPXB 3CGIA 2UXCF 5T14A 3B78A 4P9SA 3N79A 4M63A 3UNGC 5C7PA 1CULA 2GIFA 3KJFB 5EWFA 3TNVA 5JVGQ 4OLPA 3C2PA 2D3ZA 3SMZA 2ZE2A 4F26A 4RUCA 4XDDA 4CI0B 4CLUA 5T41A 2GHPA 5GAHI 3KLHB 1WEXA 4X84A 3W3SA 3KK2A 2C3UA 1Y0HA 3I32A 3MEEB 4R8UA 3UN2A 3JB9k 2F40A 4J9OA 1CSJA 2A1BA 2FJBB 4NLSA 1M5HA 2NUHA 2YX1A 1N32F 4LF6F 2JNJA 4C8ZA 1FJGJ 1KN6A 4PKDB 2V2QA 2ZE2B 5ADZA 1MSWD 3ILOA 4P74A 1IM6A 2BABA 3DLKB 4OV1A 2VA2A 3V4MA 4UT4A 4JI4J 5CYQA 1RTIB 1V3RA 2OPRB 3AH6A 3C19A 4UOFA 4B3MJ 2OHDA 4ZK7M 4C0HA 1IM4A 3FFIB 3PJ9A 5KFKA 1UP1A 3K89A 1WDTA 2RDIA 4N8OA 3CD0A 4KAIA 5KFMA 1J5OB 1FJGF 5AJ3J 1NKCA 2RQCA 4U96A 1IWAA 1PBUA 3LP1A 4H4MA 3D2WA 1N5QA 2EXUA 3GIRA 1S5ZA 2FVCA 4DX8H 1SJFA 1LWXA 4QR2A 4NLRA 3NP5A 4DU8A 3DM2B 3M8PB 1N8RT 1WC5A 2VB6A 3H5UA 2W9BA 2FJXA 4IRDA 5IQ6A 2HFNA 3T9NA 4CLZA 3FDSA 3ZNJ1 3EJMA 5B0EA 1IBKF 3TA2A 4KIAA 3US5A 4JI2J 3HSGA 1U1RA 1FKAF 3I56S 2ZVSA 3NGTA 2OEJA 5L8RC 2ROPA 4DG1A 1R8BA 4C2MA 2UXCJ 4DR1F 1GEHA 2RH3A 3OTDA 2F4VF 3EWGA 3VAJA 4A8OA 2QJ3A 2PFFB 4ZLLA 3ET6B 2G1DA 2XGQA 4DSJA 1T9YA 4PYDA 2V8VA 1S1XA 2QE5A 4I64A 1NBEB 3BBFA 1X4CA 8AT1B 4DV6J 2V9KA 3LF0A 4B3RJ 1HNVB 4LRBA 2OD6A 3OTOJ 3TARA 2GAHC 1T94A 2J6SA 2ZD1A 4EEYA 4KHMA 2H1YA 4ZHRA 5D3GA 1MROA 4FZVA 3BPDA 4TYBA 3BH6B 4LF9F 2C2MB 4P73A 4RW4A 4USKA 3UFCX 3IGNA 3PFOA 4P52A 1I3OB 1CQMA 1H0HB 2FDNA 2XO6A 3OJSA 1Q95G 1F9EB 4KH1B 4JI4F 2J9CA 2MKSA 4LSLB 1R8HA 4JI5J 3FEZA 1OSCA 2XQCA 4RX6A 6AT1B 3ZZRA 1FEEA 1H3DA 3KUGA 4A48A 3X3UA 2ZJQQ 1K0TA 5KT7A 3WX4A 1EKRA 1BWEA 4KTQA 1P27B 2BE7D 2ZC4A 4OIXA 4CRJA 1YG0A 1H2UX 2IA0A 2JZ5A 4DU7A 2VODA 3T19A 2CDRB 2J7KA 4EGLA 2R2RA 3TP2A 5I4MA 5H9EJ 2BDPA 2JEFA 1CJUB 2HAIA 1S7IA 3UDLA 1U1MA 3AOCA 3SV4A 5GMKa 1RT5A 1SQGA 5B0BA 2GFFA 1RADB 4FS2A 3FBBA 1KQKA 1NEEA 1CJVB 2X7IA 2HAFA 4MFBB 3RB6A 5GAEI 1RWWB 4DR3J 3OR2B 2B5JA 4ID5A 3M8YA 4PG6A 4USTA 4LF4J 2Y1LB 4DR1J 2HFUA 5A76A 2IY5B 3LGNA 2MKHA 3DLHA 4JV5F 1J27A 4OI3A 3CCMS 1N0UA 2MZJA 1Q7LB 4WK1A 2YNHA 2V50A 3DMJB 3MTJA 3MZIA 5J1NA 3FMBA 4K7QA 2PGCA 1RP5A 2HRUA 1RWMB 4LSLA 2BANB 2PO4A 2WZ1A 3QLHB 4TQRA 3MPVA 4L6V3 2CA9A 1V5IB 2FZKB 2IM3A 1WKKA 4CNZA 3AT1B 3OLBA 1HNWJ 1WTFA 3R5DA 3ZNUA 1KQSR 2OJ3A 1PAEX 3WQPA 5KT3A 4Q44A 4I68A 2WTFA 4XPEA 4J9UE 3LPEA 4OFZA 4K4WA 2CFXA 2MXYA 3LP1B 1JLBA 2LCWA 2AV5A 3DRSB 3HHEA 3HT3A 1N32J 4QU7A 1U26A 3VGSA 1A9NB 1LW0B 3BREA 4ECQA 4P2XA 3W9HA 2DNMA 2JVRA 1FRKA 1KOOA 1YLXA 2XSJB 4YS2A 5HMXA 4MKYA 3F41A 2QRRA 2J7WA 1K44A 2YWFA 3Q0AA 1EIYB 4QYRA 5J2PB 4I2PA 1NJXA 4LR9A 3A1YG 3SFGA 4NXNF 1FRJA 3Q8YA 4GVBA 2B8PA 4M5JA 2M70A 3M9MB 2GZOA 1DARA 5DJBA 3IG1B 5F8IA 2X1GA 3TEHB 4DEZA 1TAUA 1TKZB 4ZPCA 4WIIA 3W2WA 1G1XA 1LWCA 2Y8WA 1JLEA 2CQ1A 2J0WA 3GFXA 5ETPA 3OVSA 4ZS6A 3CUNA 1JJCB 4CZCA 3ELHA 4H54A 1DZ5A 3JSRA 2DJWA 1NCLA 2DNKA 3N01A 2ADBA 2E5LJ 2J7UA 4K4TA 3M8QA 2M8HA 2HRTA 3I4HX 3UR3C 5J2MA 3PG9A 3QO9B 3VAMA 1PC5A 2ZBQA 1W25A 5DG8A 1JLCA 1R8AA 4G1PA 4ES3A 2Y3YA 2Z30B 3MUVP 5HROA 3THTA 4FDFA 4LIRA 3KK3A 1HNZJ 4WZMA 2QMWA 1YKWA 3DLGA 3Q2SC 2FJVA 5GMEA 4ECYA 2V69A 3DHWC 2KFZA 3QZ8A 1F5AA 2CVIA 2GO9A 2O3DA 2XYHB 3AY0A 4EI2A 5A8RB 3HMJG 4J9RA 4TN2A 2UVWA 2OFHX 2VBXA 2ZUGA 5B7WA 1UPMB 2J0QD 2HQ3A 1F9HA 1LNQA 3MR6A 4C8KA 4K4SA 2K7JA 3AXKA 2J6UA 3BDPA 2CNOB 1WDDA 4UZBA 1FKOA 5J2NB 3GSDA 2HHPA 4NYOA 4TU9A 1RLDA 2DO0A 1QVGR 1ZPVA 4UW2A 4DN9A 2BX6A 1C4AA 3BBCA 2E9ZA 2AEMA 4HT5A 4F8RA 1S99A 3C46A 4OJ1A 2DR5A 3AOBA 4O3PA 1UTAA 1TL1A 2UUCF 4DQIA 4IRCA 1HI8A 4L73A 5JXSA 3PDNA 4K2XA 3L3CA 4B9LA 1LWFB 2XY5A 2KYXA 3KLIB 3NAHA 1R89A 2O67A 2WK4A 5CD4H 1OPIA 1N0VC 1R31A 1QE1B 3O44A 1H7XA 1NH8A 3AAWB 4ATNA 2OTJS 1LK7A 4J5OA 1CQNA 1WEZA 2ALYB 2F9JA 3Q23A 2D9OA 3CJSA 2FPHX 4A46A 3KNAA 2HZCA 1VHIA 2OPSA 4YB7A 5K8OA 4WFZA 3JQMA 3TJ9A 2ZEJA 2MKKA 3KK1A 1IBLF 2DB1A 4RKUC 1KTVA 2QLWA 3QSIA 1BE4A 1DTQA 2ZOMA 4C9DA 3GMGA 2DNRA 1T9UA 5MAOA 1JNZB 2HHSA 2HNZB 1PSDA 4ILRA 1C0UA 3A12A 3W1YC 2LDYA 2AZ1A 3IP0A 4DX7A 2F5GA 3OVAA 1NPKA 2DEIA 3GCXP 1KWMA 1RA6A 1JIHA 1KBRA 5K14A 2KJVA 3TYTA 3ZZZA 5EGYA 3JSMA 5BR8F 1TZ0A 2OAUA 1NK8A 1A6LA 4WU3A 2E44A 1Z1ZA 2FJAB 5LMUF 4FN5A 4OI4A 4F4WA 5U47A 3W7BA 2W9CA 3HFZB 2FQQB 4HH1A 4OL8A 1F1BB 3WDOA 2X1FA 3QJLA 2UUAJ 2DY9A 1D9FA 5H9EK 4IFVB 4BWJA 2B9WA 4DFJA 4Z7CA 2DNPA 2M5YA 4AYBD 1VS3A 1FCAA 1B70B 1YRXA 5EWEA 1ITPA 3DLKA 4UZCA 3MMJA 1LWFA 4ECUA 4KKOB 2V2ZA 2JHEA 2C3OA 4DV1J 2A2CA 4WKRA 2RU3A 2DO4A 4LF1A 3B6BA 2EWHA 2QMXA 5GADU 3IGVA 2C1EB 3VGTA 3I96A 5E3CA 2D3OR 3GR1A 1JLGB 3MM5B 4H4KC 4F0KA 3K5MA 4QIVA 3GV8B 4HTJA 3NGKA 2M52A 4Z37A 3QLHA 4RJVA 3D6HB 4B3RF 3T9ZA 3QGGA 1I94J 1R27B 1TV6A 2ZBCA 3PO4A 2QT7A 3WC0A 5BYQA 3OFHA 4Y2MA 1HMVB 1Q53A 3TX0A 1HNIA 4RNFA 2BQ3A 1NO8A 2VIHA 2APOA 4AQYF 3BQ0A 4CH1A 3CPWR 1FI4A 4F2RA 1WF0A 2LQ9A 2JEGA 4ZJOA 4DF8A 4AUKA 4RNOA 5E5NA 5C25B 2ZBRA 2W2PP 4TLRA 3CMES 2AEJA 3NEKA 4DQSA 4OI6A 5G4DA 3SSQA 5HMZA 3U02A 2YWWA 4Y0FA 4DR2F 2ASLA 4DV6F 3QT6A 3I5BA 1UVKA 2FC8A 1WC3A 1R43A 2SXLA 2PSZA 3OL6A 1URNA 3LPYA 2LMIA 2DD8S 4RO0A 4CM2A 4GVBB 4FYWB 3CJQA 3CDAA 4R25A 3HVWA 3DGPB 3O3LA 1UJ4A 4BBYA 3N6LA 4LRCA 3OJUA 1RAAB 3MEDB 2JLGA 4M5IA 3R8YA 4CTAA 3M8RA 1FD8A 3QJPA 4RBUA 3BYRA 1HR0J 1LK5A 2I5JB 2BJ7A 4Q7AA 2CUYA 2Q79A 1RYSA 3TX8A 4PR6A 1GXUA 2NSCA 4GVLA 3OFGA 2XLIA 1WC6A 2GS8A 5LSOA 4NMLA 1SH0A 3KJNB 1XBWA 1FRXA 3R5CA 1D1UA 2DKOB 3AFGA 3KYLA 2KVQE 2FY8A 4URQU 3UVJA 1BD6A 3RUBL 4DOZA 4TU7A 5DG7A 2UXBF 1C2PA 1WF1A 1M5KC 1RABB 2J9DA 2N3LA 2YKNB 3I31A 2HVIA 1FTRA 3T5HA 2C2EA 3AQPA 3FZBA 4NRUA 5DZ7A 1SL0A 2YNHB 3DMJA 4DN0A 4M94A 2M2BA 1HNZF 1YJUA 4AQYJ 1FRMA 1TL3A 2YKMB 3M8WA 4BC7A 2BANA 4DSLA 3BSOA 3FEXB 3NGSA 1OSDA 1NDCA 2CADA 3TAMB 2NR0A 4LSZB 2H51B 4ZP7A 2UXBJ 4LJMA 1RBLA 1HQUA 1I5OB 3MM6A 2GVZA 1NPPA 2CZ4A 2W4PA 5FLXU 4N76A 4RW9A 2V5HG 3FUYA 3QT7A 2VJUA 4ECZA 5FJ4A 4KGXB 1UFWA 2AJ4A 1S0NA 1YVFA 4CO1A 2O1PA 1SBRA 3DC2A 4OJGA 1CC8A 3L4BC 3CSKA 4NZ0A 5KFQA 2XLJA 2EEYA 1NK4A 2W8KA 1RTDB 2ZD1B 5ETQA 2DHSA 2GMLA 4MKVA 1DFDA 2QG9B 4PABA 3R9LA 3WBZA 2JEIA 4DFKA 2V6AA 1Q8LA 3K2YA 2NXNA 2XMKA 5AXMA 2B7BB 1B0TA 2I0XA 1A7GE 1QD1A 2BM0A 1AZSA 4LREA 3SV3A 2XYPB 1ZM2A 1VCTA 1N34J 1WACA 5KFTA 1NJYA 5FLXY 4PQUA 3K5PA 1Y5NB 3B4DA 1D0EA 1RT4A 2XSJA 4RWXA 5J2QB 2CPEA 2ZZTA 3JYTA 2G0IA 1TVRA 2V2KA 1B0VA 3ITHB 3M2RA 1FEHA 4F3MA 4FF2A 5D8HB 1JXVA 3ISZA 4DL5A 4OI0A 3GU0A 1RHQB 3BBBA 3VVTA 5KFXA 3KK2B 2EFOA 2W2OP 4DFPA 3C16B 2VBYA 3ILIA 5E3RA 3D4JA 2MKIA 5G0RB 1IKXB 5LXYA 2G13A 4F4KA 3ENVA 3K5OA 5JJBA 1NHUA 1PC4A 1RT2B 4HL9A 4KHPJ 4QR0A 3N5BA 1DHMA 2FJEB 3M2RB 2D3O1 2MKJA 1J5EJ 3TEGA 3GFYA 3O1LA 1X4BA 4GMKA 5KFOA 4HI1A 3D1HA 5CQGA 4I67A 3MMAB 4WFNQ 2B7CB 4V19X 1REGX 1RCXB 4NCGA 3FGVA 4NPOA 2OPRA 1WKJA 2L9WA 4IR1A 3HVAA 4X4PA 3MCMA 1EHWA 3C15B 1K8AT 3PW2A 2LEPA 2GQ2A 2RILA 3D1QA 4ZPBA 2E1RA 3CEDA 2ZWPA 3K59A 3T1HF 1PYSB 4PYAA 1UZHA 3ZZPA 3BB5A 4UOHA 3C6TB 2LECA 3PCOB 4DV4F 3BGOP 2W8LA 3CJ8A 3D66A 3OL8A 2AYGA 1UVLA 1CEZA 2KXNB 4ZIWA 4ZVOB 1AUSL 2ROEA 1Q16B 2CWKA 5H9FJ 2DIUA 1QAXA 2MJUA 4KSEB 4NA2A 4Y6IA 1B4SA 2R8HA 3KTQA 3ISND 1JX4A 2I2YA 2CPHA 3D1OA 2W01A 3VWSA 2DNOA 1WG1A 3NOGA 3CJTA 4RPFA 4D3HA 1CS4A 5LOQA 1O5JA 1SUQB 2NS1B 2XO7A 4JBCA 1RU1A 3GZ7A 2LQ8A 2F4VJ 4OZ1A 2GGPA 3DOMB 3LGHA 3I82A 2HNDB 3CCLS 2UUBJ 2PC6A 3HHKA 1NNDA 4WE1A 3K7RA 3P8BB 1PYOB 3GG0A 1TFWA 2MLXA 2AP6A 3BN7A 3FEYB 5KFDA 3UN5A 4OYAA 3R2CJ 4TXSA 4WIQA 1MNEA 1EARA 1IUJA 1S6OA 4GKKJ 2VDHA 1BWVA 2JWNA 1JK9B 2VHGA 3L95X 1S7HA 2QYCA 2HQCA 3EXYA 4IG0A 1T03B 1IBLJ 2PFDA 2NPIA 1NK6A 5IQQA 2WVBA 4ZN3A 3M9OB 4N56A 2IPOB 2P6TA 1IKVA 1HKAA 3FSIA 3QFHA 4Y2IA 3MFIA 4DV0J 2PI4A 4B3TJ 3UD5A 1AYEA 4AT1B 3TA0A 1NB2A 1NAQA 2HZAA 3BJYA 3MAQA 1RAFB 2E5JA 4LMZA 2QC3A 1HMVA 1S1XB 3QT5A 3UCGA 4PRFA 1RAHB 5LJ3Y 2XNRA 5F0WA 4F4AA 4C8LA 4OHVA 2Y0SD 5EX0A 2ACYA 1HW9A 4RU2A 3I9ZA 3NGRA 4OX7A 3HKWA 1QAJA 3PKMA 1Y5LB 2F8EX 1FE0A 1VMBA 1FX4A 4H4OA 2ZH7A 4WP8A 2VFRA 4XPCA 3ONQA 1PIEA 2LA6A 4RBVA 3R27A 2RRAA 5DQGA 3H4DA 4C0OC 2LQJA 1RT7B 2CQCA 4KKOA 1XEZA 2MDAA 1HPZA 1CJVA 3DOKB 4LFBF 1NLKL 3CXCR 2UU9J 2WB4A 4B3SF 1S76D 1MMNA 4KV8A 3S6EA 3QRQA 4LF4F 3C16A 5D0HA 4DCJB 1QTNB 4DR6F 3FFIA 1NHVA 1NDPA 2NXCA 2KXFA 4PQAA 4EU0A 2IM2A 2MB0B 4DR4J 8ATCB 3H2UB 3J81Y 1Q5YA 5D6GA 4ZOSA 1JKHB 1KTQA 2XULA 1TTHB 2RD5C 2MPUA 4K5SA 3GYXB 2CQ2A 5CABA 2FUG9 3G87A 3V5RA 3LALA 1WOSA 2MHNA 3D54A 3M4XA 4K8RA 4ZDNA 5FDLA 4ID8A 4ICLA 2MSSA 1H72C 2Z0GA 1NK0A 4UUXA 2RNEA 1HARA 4A8QA 1RACB 1ROFA 3MMBB 1IR1A 1FVQA 1NRKA 4EZ9A 3IR7B 3M30A 4F0HA 5I42A 1VQNS 3HF5A 3M1VB 3H20A 3SDEA 4B3OB 1RT1B 1T9TA 3DLJA 4O3OA 2ROGA 2AHOB 1NUEA 2KHCA 2BUNA 2C3PA 4HDGA 5IM0A 3BQ1A 1BC6A 1ZYQA 2M88A 1S9FA 1OIAA 1Y3KA 2V8PA 2XMUA 3RBEA 1Q81T 3H90A 4LVOP 4AL5A 1NB7A 4M5MA 2M4MA 3H2VE 2QLJB 3A8KA 2UV8A 3POTB 2XCAA 3R6GB 2FVPA 1DQAA 4JI3F 2MEWA 2OPPB 4WTOB 4LFCJ 1JQGA 3E51A 3PRVA 1KEKA 2I6WA 3IXQA 3VQSA 1HNVA 3CJ0A 4DV5F 5IOLA 2B6AB 3DI6A 1ZBTA 2R3VA 3RJMB 1N34F 3HKZD 3CCQS 2MQNA 5E7OB 4JV0A 2NQPA 1R7IA 4NLPA 3TZWA 3K58A 2VDIA 3TJ8A 2ASJA 3MF5A 3TQ1A 3R3TA 2CPYA 3O2IA 1S57A 3OBIA 4IDKB 1VQMS 1EKSA 1Y7PA 2IJNA 2KYZA 3W9JA 3Q2TC 1NMEB 1KRPA 3R2DJ 3G82A 2IJFA 3TI0A 1V5VA 2D9PA 4YB6A 1HBMA 2WVDA 3NS7B 1CJTB 3ZTSA 3TZZA 3R5JB 1D9AA 2HBYB 3T5LA 2V4JB 2YQ3A 2XZTB 4KY3A 3LP0B 1GX5A 3SDEB 5KFGA 2YKMA 3G4SS 1K47A 2K7KA 4EBDA 1HBNB 3M30B 2FB0A 3P4UB 3W9IA 3DDKA 3LO3A 1D09B 4MYUA 4CNYA 5CYMA 2MQPA 3BF4A 3DDIA 3H2LA 3Q24A 4QIFA 2BZ2A 2HWHA 2R7XA 2MLYA 4B08A 2MZTA 1RHRB 1N54B 3O5TB 3VAHA 4E8UA 2HFSA 1FE4A 4F3QA 3M7VA 4ZPWR 1HBUA 2E1CA 4USMA 2DH9A 2DEJA 3EGWB 4JP8A 2VZ9A 2CJBA 4O4GA 5D0RA 1ZTWA 2WONB 4K4UA 4CLKA 5EN1A 1S1TA 3BEGB 6FD1A 1DLOB 5D4PA 2BKPA 5KTQA 4ZVFA 1S6PB 1TL7A 1ZZFA 3BSCA 4WXOA 5KT5A 2RKIB 5KFLA 4E0DA 3A3PB 5EDWA 4DPOA 2MQ8A 4G3IA 2PN6A 3W2VB 2VUGA 1HD0A 2Z4PA 4JYAF 2E9RX 3GIJA 3P3DA 1QAIA 3KWMA 3N28A 3NG8A 4FPRA 3T41A 1GMUA 3DU5A 3I0RA 4I0WA 5E2QA 1FFWB 1KQFB 2DHGA 3BZQA 2DXDA 4EWTA 5LJ5Y 2AJ2A 3L09A 4PWDA 3J80Y 4DCPB 1PJ6A 3WC2A 1CPZA 1GXLA 4NCGB 2VFVA 2DNNA 4DPWA 1FFSB 1JJHA 1T95A 4F0MA 3KJVB 1E6YB 2E5HA 1ZAVA 4HACB 1H74A 4NEYA 3TA1A 1FO1A 5BR8J 3G6XA 2DISA 4NWBA 3IO1A 1FVSA 3A13A 2DPJA 3KXDA 5KFYA 1S4FA 2HMIA 2HK3A 4FYVB 2ZJRQ 1SJ4P 2HPUA 2UUAF 3TO8A 4B3MF 2CRLA 4CYUA 4KGKA 4UTGA 5HP1A 3LP2B 2F4FA 1K1QA 3ITHA 1HBUB 1EQMA 1NXIA 1LWEB 3R5AA 1AW0A 5T7LB 2JLEA 3NCQA 5F41A 4WBFA 5D4OA 1MWZA 4F04B 3MXHP 5A6WA 4DHVA 1NK5A 4LF8J 1VQ7S 1VC5A 2RDDA 2OPQA 2KB2A 2HSEB 1HQEB 1O0PA 1TKZA 2BYCA 1WTBA 2K8GA 1S1VB 1IVZA 2QN6B 2CQGA 2Q1LA 4LBIA 1OY9A 1WOOA 2ZOGA 4UQTA 4DZ6A 1J2VA 2UUBF 2EK1A 5AXNA 4YUDA 3BKUA 2CQ4A 2N7YA 3QYYA 2HURA 2P8IA 1U7LA 3M8QB 3D0HE 3EVMA 2ILYA 2KM8C 4DQQA 3U1LA 3EYZA 2QA1A 5KFFA 1NJZA 4IO1A 4KYZA 1RT3B 3PW0A 1KKHA 4NLUA 1HNXJ 2R7WA 1SC3B 1YTYA 4HACA 4DUZF 2IAJA 4WFXA 4N77A 2R7RA 4BS2A 5DS7A 2DTJA 3IWNC 2RJZA 4IFVA 2VKZG 5K20B 4RU9A 2VPZB 4C97A 2EC0A 2FHOB 2KL8A 2Y0BB 4ER8A 1T9VA 2IFXA 1B7YB 3G71S 2OPPA 1S6QA 2C3YA 3QBCA 3CJ2A 4I69A 3IWLA 1FWLA 1U1KA 4W92B 3OVBA 4FS1A 4RLEA 4DR7F 1IN0A 1SI9A 1K0VA 2XMJA 5FIIA 1VR6A 4L74A 2BQUA 1RTJB 4X62F 1UWBB 2P9CA 2D69A 3NXZA 4ALZA 3HSJA 4YDDB 4DL7A 2HVEA 3MCOA 1LW0A 1IKXA 2Q6BA 1LOUA 1IJEB 1ZOTA 2XHWA 1TKXB 3EZOA 2GQCA 3OTCA 2CG4A 3PTWA 4OHZA 2BV3A 2CQBA 2X51A 1OS5A 3S7RA 3VCDA 3ZZUA 1GMVA 1IKVB 1FK9A 2FLPA 3PVXA 1V9OA 4OZ5A 3A8JA 4KO0A 1DLOA 3SSSA 5LMNF 1U6BA 4ETXA 4F36A 2EFNA 2O01C 2FLOA 4HHUA 2RSQA 2HIYA 2HQFA 2DHXA 5CD4A 1JLQA 1VHFA 3AJ2A 3BDEA 3RBXA 4P2SA 3KLFA 4AD6A 5D0EA 1WELA 2FD2A 4JV2A 3LQVA 3T3FA 2JX2A 2XSFA 4V1Ak 3T1YF 4CTAB 4CIOA 2XEXA 4DV7F 5D78A 1SJQA 1D9DA 7AT1B 2F3JA 1XNQJ 2OUGA 1M5SA 1WOPA 4NI2A 3CDWA 4TKTA 3SFUA 2VQFF 2Z58B 4P7TA 3Q8PB 3SQGA 4AL7A 2HZVA 2IA6A 3FSXA 4ZJQA 3NNAA 5KFJA 3LP0A 3MHYA 4RL1A 2PA3A 4OYXA 1MG7A 1Y10A 2BMBA 4AXIA 4DJBA 3MM8B 4CLWA 5HQLA 3TVKA 1SPBP 1VJWA 5HROB 1FA0A 4WTYA 4QIGA 5FD1A 4N41A 3PACA 2B4UA 1MU2B 2KT5A 3MEEA 4M5DA 4R8UB 1X5TA 4B9MA 1S9EA 1P9YA 5DETA 2XBPA 2HMIB 1KLNA 1C1BA 2YQ0A 1SKUB 3DOLB 1CJUA 2YXLA 1CULB 2QLBB 5CH7B 1UA1A 3BSNA 2HIQA 5KFEA 5HMYA 4LF5F 5E33A 4X2BA 2HEKA 1JLEB 2ACMA 1XNRF 1BLUA 3ZZTA 3HFVA 3HZGA 5GAGI 3OR1B 5EX3A 2CG8A 2Y9HA 2E1MC 2VKRA 1ZA1B 4M5DB 4RBTA 5ETOA 1JWWA 5RUBA 3TWZA 4OX9F 1VIXA 2MSTA 1QVFR 3PYEA 1OO0B 1G3OA 3PM9A 3DDNA 1JLGA 3MM5A 5IM0B 2OIHA 1W2BR 3V81A 4N47A 3H5XA 4IDKA 2UUWA 1UFKA 3QAEA 3NMAA 2IYGA 3SQGB 2FHMA 3HX9A 2FHJA 2Z57B 4PEOA 5DZ6A 3MMBA 3I4PA 5DRKA 5M2RA 4ECRA 4JI6J 2CJKA 1S1WB 1UETA 2OGUA 2VG5A 2GA7A 4NA3A 4W98A 3NGDA 2R8GA 2R8KA 4UY85 2ATLA 3NMRA 1J5OA 2WHOA 3FCWA 2NYHA 4DV3F 3LAMA 2XI3A 3RAMA 2GMHA 1X9SA 4M8LA 4HDHA 2UVUA 2VONA 4ZLJA 4FF1A 3FNNA 2DRDA 3H42A 4R0EA 1B3TA 2DNQA 1GK8A 4UF4A 5B0FA 5KT4A 4RW6B 4R5PB 1PYTA 2EFGA 2F65A 3HJVA 3O8WA 4HLBA 2H5IB 4LFCF 5IT0A 2V8GA 1REVA 2EBGA 2VG5B 5BYRA 1C4CA 1QJHA 5DM7Q 5L46A 4YY3F 4OYWA 2DITA 2Z2YB 2EFVA 1YJ7A 4ED4A 2ZVIA 4WPAA 2XMTA 3IM9A 4NRTA 2AMCB 5LXRA 3HHLA 2C2DA 1HHSA 4FNIA 1KVJA 2EK6A 1BMQB 3IG1A 1MLAA 1T11A 3QT8A 3MURP 4X4QA 3NWGA 4MT1A 5CCLA 2AF6A 3G96A 1C0TB 3W64A 1PCAA 3IN5A 4P72A 4KHPF 4D3GA 3QQCD 2ZH4A 2KKHA 4J90A 3FBFA 2JLFA 2QSWA 3C66A 2GHWA 4DSFA 3CULA 3GE9A 4X65F 3MTKA 2GO8A 5KG1A 4ZA1A 4B02A 5J1EA 1R0CB 3FRZA 4NLDA 3GTYX 2K1RB 2ZH1A 3MAHA 1KHWA 3MEKA 2OFGX 4J9LA 2VA3A 1RWPB 3R5BA 2XCPA 4JI5F 4NLGA 1CJKB 1H2VZ 2GIRA 2DBBA 1R3NA 1TUGB 3DRRB 4C11A 4CP5A 2E5GA 2L41A 3PV8A 4MK9A 5LMUJ 2VBZA 1YRTA 3LGMA 2V4QA 1PO6A 1JJ4A 4J7CA 4P2MA 2U2FA 1DQ8A 3W5XA 3W5ZA 1UEUA 2Z8QA 2AJ1A 4TVAB 2IYIA 5AE3A 5AXKA 4A4JA 5K8PA 2KFNA 2QO3A 3ZC4A 4KH0B 2J5AA 2RVJA 2G2OA 4WFYA 2DT9A 3PYFA 4YR0A 1GT8A 3NGUA 2HBQB 5CXTA 2ATCB 4ECXA 4IFYB 3UDCA 3J81U 4O0NA 1N48A 1FTCA 4YR3A 3GQCA 1X4AA 2B0GA 3D5MA 4CO0A 3OV7A 2FZGB 4B17A 2DK2A 4NZ6A 1JLCB 3MFHA 4XO0A 2LU1A 3IRXB 4NZ7A 2VQEJ 2DNHA 3VZIA 1VLYA 1VC0A 1L3TA 5HVGA 1VQYA 1YBTA 4YY3J 2BRLA 3A8EA 4X64F 4B9TA 1WC0A 1M0SA 2A10A 3MCNA 1UKUA 2CNLB 4URGA 1YGYA 3MAAB 4FBUA 3E3XA 1KP6A 3GLJA 4P75A 4BWMA 1U45A 1XK8A 3FQLA 2F63A 2JH3A 3EGVA 1HQ2A 5B0AA 1H73A 1URRA 4KQZA 5HAOA 4ANDA 1NZAA 5HN0A 1RT1A 3WHIA 1RWVB 2X1AA 1SKWA 4I7FB 2BJ3A 1TMJA 1TP7A 2MY8A 3PY8A 2AX1A 2BE2B 5LMNJ 3BGRA 2DGXA 2DR9A 1IR2A 3I87A 2NREA 3K0JA 2CQ3A 2MQMA 1BGXT 3IAM9 4W4MA 1W2IA 3MR5A 1JJ2R 4B3TF 3OXGA 3ZTQA 1H7WA 3UDEA 5KG4A 3OUYB 2YNFA 3JAMY 1OYDA 1M5OC 2FLNA 2D3UA 1NJIT 3GONA 4KJIA 3T1YJ 4L3KA 1UPPA 2PEBA 2UZAA 1NDLA 2YX7A 5DDPC 3PIPQ 3SCLE 1QE1A 4QOTA 5F8GA 5CAAA 1U6ZA 2FGCA 3MPYA 4F25A 2MZSA 3VGVA 3RW6A 1EQ0A 5L1JA 1U2FA 3I55S 2LEBA 4DR7J 3PNIA 4DR6J 1MROB 2RQ4A 1Q78A 4ENOA 3CMAS 4O3RA 4XK8C 1QSLA 2DGTA 1XR7A 1AFIA 2PT0A 4Y00A 2OSRA 1SIZA 3BM7A 1GNKA 2OI2A 5K8MA 3J7YU 3EX7B 3F73A 4NLQA 3RAXA 1CJTA 2YKPA 3MPDA 2CPDA 5HQ8A 4EBEA 3GJRB 3I6PA 1T9WA 2V8DA 2BJEA 3C15A 5HBMA 1SVDA 2OEKA 3CJKB 4FXVA 5KFVA 2MJNA 5JMNA 3JAMU 4ELVA 1HBNA 3KG1A 4ZPDA 1D8YA 1FXLA 2R4FA 4F02A 3IR6B 4RW8B 3MOZA 5MLCV 3KLEB 4K4YA 1B7FA 3OD2A 4DX5A 4ZCIA 5M2PA 5I3UB 3TZXA 1Z4UA 1EB0A 4XIUA 1EETB 1H2TZ 5ETRA 3UNYA 2CKWA 3N6NA 3ENWA 1RTDA 4LSNB 4E2FB 2V68A 4TU8A 1SKRA 3EVOA 3H5SA 2B9YA 2DHHA 5J2MB 2YNIB 1N33F 2N4CA 2YNGB 1WKLA 3O6QA 1X4HA 3MGJA 4JUZA 3U1MA 4DL0C 3KLHA 1NSKL 2VD3A 1OY6A 2VC0A 4DXLA 3PJXA 4USVA 2W9CB 3V6KA 4YHHF 1KFSA 2ZZNA 2CPFA 3P49B 4DUTA 3J7A1 4J9VA 4BLGA 2GX8A 5DGAA 1U1NA 4KGMA 1QUPA 2HFZA 3MM6B 1I94F 2XS2A 1YSJA 3P45B 2GVZB 4AE5A 3AOAA 3R97A 1U24A 2QFJA 1ZS6A 2HNDA 3G2XA 4UQGA 1FFGB 2MLZA 5C24A 1S9GA 4IH5A 3MUTP 4DV3J 4DL6A 1TV6B 3UD3P 3HI9A 2K06A 2X1BA 3W8GA 3CDUA 3EZ5A 3C14A 2UP1A 3D68A 3IWXA 4PG5A 3CJKA 4CM0A 2UUCJ 1U02A 1HYSA 5IT9U 3KG4A 1ZTTA 1C1CB 3BKTA 2X3GA 5SUHA 4DUYF 3M1VA 4TNOA 1NKEA 3GR0A 1H6KX 5B0GA 5B0DA 2W9AA 5EUHA 1Q1KA 5KT2A 1T3OA 4ES1A 2Y8YA 2P5VA 3FJ2A 2DY1A 3JSYA 2FTRA 3EGNA 4OQJA 4FXWA 4PPZA 4A8YA 4X66J 4U7UD 3MM9B 5A8WA 4U8VA 1LQ9A 5K8NA 4DL2A 3UDVA 1PJ5A 2PE8A 2BJDA 2MZRA 3MCSA 2V8HA 3DRPB 4DPUA 1IBKJ 4BDPA 2D1CA 2HVDA 4W90B 2DGUA 2G0CA 1XWLA 1SJRA 3PZPA 2VOOA 4DBQA 2BEFA 2ZOFA 1VQ8S 4YOEA 2B9XA 3VQTA 3MD3A 4IOAQ 4QYZK 4R0JA 1LXNA 2EI5A 5JUMA 1VBYA 1Y4ZB 4H4KA 1QSYA 3K17A 3MEDA 3AB2B 3MM7B 2K3IA 3DLEB 2COLA 3NBPA 3PHTA 5K14B 4LUBA 1GX6A 4DQRA 1YX2A 3NLCA 2Z2LA 3CD5A 3DRPA 4UOCA 5CHCB 3G8SA 3JXOA 3B8HA 4QWCA 1YJVA 3NL0A 2RU9A 2WRMA 1T02A 3TAPA 4WFBQ 3ZXWA 3W2VA 5CYJA 3M8PA 3GSIA 4NOHA 2KU7A 4OHWA 4CLFA 4K4XA 1FX2A 3MUMP 1AROP 4PZVA 4J37A 1WJ9A 1XN9A 4OJ3A 4USUA 1X9WA 3BYPA 1U8SA 1WHXA 5KFPA 4V19J 4OX8A 5I3PA 3CT9A 5KAKA 3OT9A 1YITS 1CLFA 3VALA 3B54A 1JLFB 1Q4RA 1AUDA 1U09A 4K59A 1Q8IA 1X5OA 2W4DA 2BW2A 4M5NA 1S1UA 4ED8A 3M2VA 1HHTP 1OMSA 1RGVA 3C6UB 5HVFA 3G6ES 3V6DB 1VQOS 2YTCA 5GAEU 4ECVA 2AQ4A 2IBKA 1PG5B 3G8QA 3THPA 1S1WA 3DFEA 2VPYB 3GWCA 5F8HA 5A0YA 4OYPA 5A2QU 4B9SA 2XM3A 2NXUA 1RI7A 1FNOA 2RF2B 5HATA 3Q8QB 4BC9A 1YZ6A 2B4VA 1YZ7A 4PG7A 1Z2LA 2AYEA 2MKYA 2XTJP 4ZVPB 5J2PA 3AXMA 1SUQA 2P9GA 3RBZA 2RRBA 3M2VB 1QSSA 4QIWD 1VYAA 2ZBIA 2QX0A 3A3OB 3N6MA 1BXNA 4M5GA 1SJ1A 1D8ZA 1S12A 1FRIA 2GGPB 3DOMA 2JVOA 1IKWA 1BQNB 2LXIA 2V63A 3M8ZA 3QGHA 4DR3F 5F0UA 1K73T 2LQBA 1ELOA 3JTOA 1TL4A 1NK9A 2IVMA 2QEXS 3MECA 2HGMA 4N8NA 4NLWA 4C6AA 2Y1IA 1KVIA 1E6YA 2HVHA 1EP4A 2RS8A 3IS9A 4KHRA 1U47A 1HD1A 1BY9A 1C0TA 1SC6A 2ZHAA 3BR9A 2DR6A 2N4DA 3SCKE 3HSZA 3TOQA 3QZ7A 4B9VA 1V3ZA 3ULHA 2J0SD 1EZZB 3IA0A 2XGPA 2WSEC 1FNXH 4F7VA 4ZN1A 2HNYA 1YDLA 3QATA 1RWKB 4FKYA 2HNZA 1FDBA 3DGPA 2ZNZA 4ZVSB 4DX6A 5KT6A 4ZKAA 2IVFB 3WIUA 1RWOB 3W60A 2AT1B 1TL5A 3PJWA 1B0PA 4OHXA 5F9NA 3ILJA 3KK1B 1TKDA 2GC8A 4DSEA 1G6BA 5F9LA 2QA4S 2MGZA 4KBIA 2AJ0A 5J1PA 3U7JA 4QWEA 4X4VA 1TQLA 3BO3A 4HI2A 5FDLB 5IC4B 2QZ8A 1ZM4A 4CQ1A 1SH3A 1N5TA 1U49A 1BHNA 2W2MP 3DN9A 3HFKA 2W7PA 2IVYA 4M5HA 3KOAA 1YIJS 2L08A 3IRXA 2WONA 1U6FA 4TLQA 3KLIA 3AB4B 1RHKB 1S49A 2BE9B 2ZKTA 5B0CA 3UCUP 4K4VA 5CZVA 4PWWA 2E66A 3I0SB 3BR8A 1HR0F 5HK4A 3BN4A 2W25A 4MKAA 3C14B 1HPZB 2H48B 3DRXA 4EK2A 2HFVA 4WU2A 4KGVB 2DNGA 3EXCX 4B3OA 4PWUA 1P1TA 4NL5A 3MR2A 2LFVA 1VRTA 2KZZA 2WSCC 2MTLA 2CPIA 1S59A 3AA9A 4C98A 4LR8A 5L1LA 4QW8A 1SIWB 2HQGA 5BYSA 2VQEF 3CCUS 1VBXA 2DCLA 2QL7B 1M1GA 4J9SA 4Q2LA 5HMWA 3LOUA 2ZC3A 1Q82T 2UXDJ 2HHVA 4USJC 5LSRA 2W2NP 1DAXA 4MIBA 1AA1B 5GAGU 3EPGA 3J7AN 4JYAJ 1X9MA 4WYWA 1EJ7L 2M3DA 2QLFB 1GMWD 1FDDA 3OW2R 1S4EA 3KK3B 2BKNA 2PEHA 1RAOA 1WSVA 2DR8A 3PW5A 4DZDA 2JC0A 2KTQA 3VAFA 1JXLA 3DLGB 3AD9C 2FHKA 4NE9C 5AE2A 5E41A 2VG6B 1HWLA 3GILA 1HBOB 2HBZB 4YEAA 4YMEA 4EYIB 2DNYA 2A6OA 3VAIA 1N33J 2VU5A 2EW9A 4Y28C 4Q45A 2YNGA 4OYZA 4MYTA 2OTLS 2Z2ZA 4JI7J 4YHHJ 4FYXB 2NPFA 3HVTB 2H54B 3QFWA 1MW7A 3HSDA 2HG4A 2LDIA 1FNMA 3KLGB 1IKYA 2B51A 3D9BA 3JSBA 3DLEA 3NBPB 4TY9A 3OFFA 4WJBA 1VI7A 3QMQA 4C3KA 4OX9J 2ZH2A 1RTHA 4DPXA 4OYIA 2CJYB 2XI2A 2V9WA 3MMCA 5H1SV 3MR3A 1RKJA 2RAQA 1S1TB 2KZMA 1S1UB 2DH7A 1MN7A 4OV6A 2DVIA 3GCWP 2MQLA 3TVYA 3WIVA 7FD1A 4QU6A 1W7WA 3G86A 3MMAA 1SC4B 4NXMJ 5HVHA 5C42A 2QIFA 3FVYA 2G2ZA 2MQQA 2GJ2A 3KJQB 2MGZB 2G4BA 1CVJA 1F2HA 3KDOA 5GADI 2M0GB 1WG4A 4OZ3A 5H9FK 2YY3A 2JFDA 1NJWA 4WXWA 3RBDA 3OL7A 5CYMB 1VLOA 2XZWA 2G2YA 2FZCB 1JLBB 4OJHA 4OZ0A 1OPZA 3BGFA 4FVMA 1FERA 2AZ3A 2WW4A 3NY0A 3I9V9 1RXOB 2DHAA 2HBRB 1Q0NA 2IDEA 2JC1A 3E01A 1WHWA 1NZ8A 1FESA 3CW2C 4PXEA 4LFBJ 3JTPA 5KFAA 1SKSA 4I6WA 2FVSA 1N52B 4GRSA 2M9KA 2MZQA 3PIOQ 3T1HJ 4LF5J 2B3TB 2GVDA 1QLNA 4I2PB 2DGQA 3BGLA 2RE1A 4ED1A 2AJQA 4G6VB 1ZM9A 3RW7A 3P6YC 3IFEA 4GKJF 4L3NA 4N5SA 2CJ9A 2YWKA 1N5VA 3ZZOA 1FJ7A 3W5YA 3RYLA 3DYAB 1RT2A 1WC4A 2YWHA 4GO7X 3KUEA 4WK3A 2HGLA 3OSPA 1NK7A 1U0HA 3CB4A 1K1SA 5IV3A 1N56A 5IT9Y 1XERA 2EVZA 4ZLPA 1YBUA 2DGWA 5ITHA 3HO1A 1WORA 1IWGA 1KS2A 3MAAA 2BVZA 4FPIA 2VFUA 1WUUA 4CH7A 4LFAF 5L1IA 1L3SA 2RRNA 2OD4A 1Z2ZA 2DCUB 3C3LA 3HPOA 4NLXA 2P9EA 1HWJA 3VHQA 2EG1A 3PX0A 4MAKA 1GTEA 3IBCB 3G8TA 4IG0B 1U1PA 2WOMA 2PD1A 4ILMA 4NASA 4LIWA 2VJVA 4FP9A 4QJVA 5I3UA 3HHDA 2V67A 4PG4A 3U1NA 1YJNS 4NXMF 2CJQA 4ZCLA 2VL1A 3MM7A 1S79A 4ZVGA 4IRKA 1WC1A 5HJXA 3TR5A 3GJTB 2V4JA 4NLYA 3HT0A 2D7SA 2HWIA 4CLSA 2KH9A 3AD7C 5LT5A 5F8NA 2AJFE 2WOMB 1RSCA 3GJSB 5DQIA 1AT1B 1CS4B 2JFKA 1VQKS 2ZH6A 9RUBA 1KQGB 5BXIA 5M2UA 2NZCA 3BH7B 4ANCA 5DGBA 5HLFA 3IRWP 1SQEA 3MEGA 4QR1A 4RW9B 2BXJA 2ERRA 1D3WA 3H7HB 2A2DA 4I6AA 5KG2A 3M8SA 2GHVC 2AKWB 3RG6A 3KHHA 3CO0P 3H98A 3WX8A 3UE2A 4P6QA 3TJAA 5F3TA 4DMZA 2R9LA 2ADCA 2CQDA 2GJIA 2GW8A 4DQPA 2C2ZB 5D15A 1TUVA 2G1HA 1UFLA 3DCAA 4G1QA 1QM9A 3UW1A 1QAYA 4X4RA 4I2QB 1VBKA 3OTOF 3OSNA 1IQTA 3VF0B 1Y00A 4PXDA 2PDAA 3I0RB 3K8VA 2HK2A 1P8GA 4RNMA 1XR5A 5C24B 2CPXA 1TFYA 4EUVA 4IQMA 4ZMMA 3DM2A 5HJYA 3NAIA 3LWMA 3DXSX 4NEZA 4P10A 5DG9A 4S0MA 1RAIB 1U1QA 3RB3A 1UMJA 3M6XA 5L38A 1UVMA 3UCZP 2ASYA 4ITSA 3CD6S 3QRRA 1VQPS 4OHYA 3M32B 1S6PA 1TL7B 2GQQA 2PIIA 3FQKA 4ZVUB 2D41A 4OZ2A 4CWBA 2W1BA 4OMFG 2GIQA 3S8SA 4F3OA 1R8CA 1RWXB 2KHDA 1UWBA 1UVJA 2UU9F 3SIPB 3Q8RB 2WBRA 5LM7E 4B3SJ 2GCFA 4DL3A 4ZJLA 3CO9A 3M9NB 4C8MA 5DLFA 5KOXA 1SV5B 1S9GB 4EMDA 2C2RA 2VICA 4WE1B 3A4TA 1X4FA 5AE1A 3ZTPA 3T5JA 1HL6A 1MWYA 1RAEB 4O23A 2E5LF 4PXCA 2J76E 4RNHA 4Q8FA 1IKYB 1KSPA 2EFPA 2LU2A 4LRDA 2OPQB 1MMLA 3KLFB 2GNKA 1HA1A 3RR8A 4HTIA 1R0AA 2P6SA 1WI8A 1WD6A 2RDJA 3BKFA 4YB5A 3RRGA 2FYXA 4Q0BA 2WW8A 1RAJA 3D67A 3IR5B 2HHQA 1UA0A 2CJXB 3EMTA 2HHWA 2IRXA 2OSQA 1RQ0A 2LYVA 3LP2A 4LQ9A 2ZDOA 4LF6J 4WP9A 2J8AA 2NUUG 2NXEA 2Z2MA 3DU6A 3H4BA 3CCTA 4ZVRB 4MK8A 5A2QY 2JDJA 3I5AA 3CJ5A 1HNIB 5ETTA 4E98A 5DDRC 2B8QA 4U7UK 4IUFA 3B4MA 3FSYA 1X5SA 3DNCA 3VV2B 1NU4A 1ZM3A 4MJKA 4ZP8A 3TAMA 3KLEA 1FWPA 1U48A 3LA0A 1SL1A 3RB0A 1B64A 1MU2A 2DPIA 4RWWA 1RISA 3W66A 1BUXA 2CZ9A 2F1FA 1KLMB 1RHJB 4KC5A 2FVRA 3A8IA 2F8HA 2NCKL 4FKXA 4YQWA 2DNLA 3BO2A 2VH7A 4O44B 2VV5A 2GVDB 3S1TA 3UI3A 5C5JA 3PR4A 4DS5A 4FF3A 1HNXF 2VASA 3CF5Q 2DXFA 3W8PA 4RUHA 4EFAC 4QPXA 5KFBA 4QW9A 1DJ0A 1S0VA 2ZNYA 5K5MA 4O3NA 2IMOA 3V4IA 2XY7A 3BS9A 1HI1A 1VRTB 1M5VC 4X4UA 1YI2S 3MPUB 2OELA 5AXLA 3VGUA 5LSLA 3GG1A 1M90T 3D3CJ 2WVCA 3GYGA 3T1AA 1TKXA 4DSKA 4Z7YA 1X7VA 4OI1A 3M6UA 2KRRA 5I3QA 1GFWB 1X0FA 5KOWA 3PKYA 4BHQA 4CT8A 3P96A 1JMTA 2CIMA 3MWBA 3UD4P 1S0MA 2B56A 1RT4B 5KFZA 2DYAA 2XMWA 2RS2A 1RK8A 1YRUA 2IBOA 1VK3A 2LXUA 5KFUA 3K57A 2JL9A 2XMAA 4CT9A 1FWKA 2B9EA 3QIPB 5IT4A 2KG0A 3HD1A 2A3JA 4I7FA 2WB1D 3HVTA 2MZ1A 1N36J 3QJJA 3CCJS 4KT0C 4GC7A 1LFPA 1X4DA 1ZAXA 3PRDA 2BJ8A 1RAGB 1U25A 1UZDA 3MPWA 2ZHOA 4G1IA 2XS7A 1AXQA 1F0XA 4RUBA 2M7SA 1A0OB 1KLMA 4JI8F 8RUCA 3NS5A 2IJRA 1REVB 1UAWA 1Q8BA 4RW6A 1XR6A 1UW4A 2Q3PA 4R5PA 4JI0F 1UEKA 4ZITA 1VQ4S 4DI6A 2CWXA 1TUWA 3HCXA 2DXEA 4MK7A 1XJWB 1CJKA 2F8MA 3CC7S 2MY7A 1WG5A 2RQKA 4HHHA 5E3PA 4GO5X 2DGSA 4GKJJ 2LKZA 3NRBA 4NYZA 4YR2A 1KHVA 3TQEA 2VQFJ 1KR4A 2FC9A 4UUWA 1TK8A 1HQUB 1U8WA 4FVCA 3FCVA 4A8SA 1SL2A 4MTPA 4LQ3A 4ED0A 2R2TA 1F5CA 4NLTA 2DIVA 2HFOA 4CO5A 3PYGA 1FRHA 3R5GA 4WYLA 2W7OA 2OMOA 2UV8G 1S48A 3W61A 1SXLA 4PWDB 2I9SA 4J9NA 1UJ6A 4K0KF 1R0BG 2EKYA 3R1LA 1ZETA 5HBMB 1NH7A 3QAUA 1UVNA 1S77D 4ED6A 1SJ3P 3MM8A 1KNZA 4HT7A 3ISNC 4ILLA 3QGPA 3QIPA 2E1AA 4DV0F 2P2CB 3AJ1A 1AZSB 4P7VA 2FLLA 1DTQB 1F9FA 3V6DA 3PW4A 1IXKA 1M5PC 2HRYA 1VRUB 3UPFA 1F6TA 5SZTA 1XMOF 2XB2D 3D0IE 1ZPWX 1Y9OA 2CQ0A 4IYQA 4DUZJ 2E1PA 3CCRS 4YN3B 1T05A 4X4OA 3M6VA 4TY8B 2IDLA 3E2EA 2KDOA 1N36F 2UVVA 3QRPA 1Q5VA 1RZMA 2ILZA 2J9EA 2JRSA 3LUYA 2OKQA 2QL5B 4DG1B 3IMQJ 2CNNB 3FK4A 1L3VA 1N5YB 2IM1A 1M1HA 1YJWS 1L3KA 1W26A 3DRYA 4OZLA 3DLBA 2XMMA 1AFJA 5KFCA 1RT7A 1V6HA 1LWCB 5F8JA 3EGZA 3ZZYA 4X62J 5ETKA 5IXUA 4QQBA 2EBEA 5ETNA 3KFWX 1C0UB 3PEJA 3SCIE 1SQFA 4QWAA 2FJWA 3HJFA 1VJQA 2XMVA 2RHQB 3OL9A 3ADAC 2MKCA 4QBUA 1OYEA 3IS9B 2OPSB 3QWUA 4AXJA 3PW7A 2AGOA 3AJDA 1F5BA 1JLQB 4G1QB 3D6MB 1JKHA 1EP4B 2W24A 3T6BA 3W62A 4ECWA 4ED7A 1KD1T 3HULA 3N4WA 4I6YA 4ED2A 3FRYA 3OHBA 3OXFA 2C2KB 1RHUB 2J9DE 3DRSA 3H59A 5HO4A 4Q43A 2XS5A 4ZVTB 2ZM6F 2ZITA 3IBWA 4KB7A 1OQ6A 2C2OB 3CCSS 2WVEA 3K5LA 2AD9A 1TR0A 3FBCA 3HHLD 1QDUB 3I5CA 3TUIC 4CLPA 2ZH8A 2AWZA 3M05A 1ACMB 1QUVA 3AHPA 3D28A 2QFIA 4URSA 4DCOB 1T05B 4Q8EA 1YJTA 2XHCA 1YJ9S 4Y2AA 1S10A 2C22A 4L72B 1LW2B 3TRGA 3L9ZA 2E9TA 4DLEA 1RDRA 3RAQA 1EETA 3CCVS 2G9OA 3H8YA 2Q6CA 4ECTA 3T5KA 3QWPA 3CDBA 3K5NA 4FNHA 4PUOA 3F56A 5A6PA 3HD2A 3H25A 2HS0A 2H4WB 3NOCA 4QWDA 1T7PA 1JB0C 3PX4A 2ZDPA 2B5JB 3UQSA 2E7WA 2YH1A 4MFBA 1EAYC 4GC6A 1HWUA 2B6AA 1NSPA 3DI6B 2VF3A 3QO9A 3WZ0A 4ZVHA 2O5DA 1KOHA 3CIMA 2XY6A 1C1BB 3DOLA 3BSAA 2IMWP 1X4GA 3HVRA 1YHQS 5KFIA 2HW3A 4CO2A 2H5EA 3G6YA 4PAAA 1OWXA 2D74B 2YWEA 2R8IA 1T03A 1I6JA 5DO2A 4Q0BB 2B43A 2ZHBA 2ABYA 2VFTA 3GB0A 4HR2A 4LT6A 3W65A 4O3SA 3K8WA 2MMYA 4LSNA 1CG2A 2G0JA 2IC3B 3M2UB 1RBOB 3SSRA 2UXDF 4LBPA 2V0NA 2RF2A 3E8OA 1FHTA 1JLAA 3HLUA 4A8XA 2L9NA 3JTNA 3GIKA 2NLWA 1MMDA 1EX8A 2QSFA 3CDEA 3SCJE 3V6HA 3G9CA 1DURA 3V2UC 4K4ZA 4ED5A 4G65A 4MKBA 4DV2F 4JI6F 3LH2S 4B9UA 1VQ5S 1K9MT 2YKNA 2H9ZA 1TK0A 3KHGA 1O51A 2LXFA 1G4CA 1T8EA 3ILLA 2KXHA 4KE5A 1L5UA 1NPRA 3J7Z5 3GYNA 4FYDA 4OLOA 3SXLA 1FXRA 1LFWA 5KFRA 4ECSA 2KM8B 2R7QA 3GV5B 1SH2A 2FVQA 2AGQA 2BJ9A 4Z2XA 4ED3A 3TAQA 3NKYA 4KV8B 2RKIA 3PFEA 1NSQA 1MN9A 5G0RA 1VK8A 4USHA 5ETLA 5KFWA 3RRHA 1RT3A 5C2CA 3CJ4A 4XDCA 3RR7A 4HVZA 1HFEL 3BV8A 3FBEA 5HLFB 5JVHQ 3R7SB 4ELTA 4WF9Q 3VAKA 3UWTA 1F60B 2WVFA 4ERDA 4WFAQ 3VVUA 3MDFA 3IM8A 2WSFC 5HI7A 4C3MA 1O6XA 1RTIA 2M8DB 2R8JA 3OTEA 3M6WA 3CJRA 2CYYA 3OUYA 2YPYA 1ULRA 2C2NA 3JSMB 5F3ZA 3CE8A 2U1AA 5IS2A 3HK2A 3AQOA 4KR0B 4F4YA 2L3MA 2ZUAA
chains in the Genus database with same CATH topology
4F4XA 3BGRB 5THWA 1WI6A 1WWHA 3PR5B 2JJ4D 3DHXA 2QV6A 2VOPA 2PMHA 2KRBA 5L39A 2JEJA 5BJRA 2ALZA 2C3MA 5B09A 3V6JA 1BQXA 2OP5A 2YNIA 3N5FA 4DL4A 2E29A 3B82A 4YDXA 1HW8A 1FJCA 1Q79A 1VFJA 1UJ5A 2EG2A 2F7VA 3GIMA 3SEOA 1TK5A 3ENQA 2HHUA 1FDAA 1S1VA 3DYAA 2Y1RI 3KJVA 1HQEA 2W4CA 2UUTA 2WAQD 5A8KA 2ZKUA 2DGOA 1VGYA 2LA4A 4PUOB 2HLTA 4RW8A 2N3OA 1VIOA 1XTZA 3RB4A 2BR0A 3NCRA 3HP6A 4HYKA 4DLGA 3V81B 1HBMB 4O4RA 1Y3JA 4JV1A 2J0XA 2KI2A 3ZZ0A 2O66A 2DRAA 2RQMA 2FGOA 4M1KA 2JSXA 2AW0A 5A8KB 4IO9Q 2FY1A 1O8BA 5AJ3F 1YWXA 3UR0A 5KG5A 4F2SA 3NS6A 2MHEA 1H98A 4USIA 2QA2A 2PMZD 3JYTB 4NYPA 4J9MA 3RTVA 1FD2A 4KRWA 1GAOA 3PHEA 3RU0A 1GXTA 1WF2A 4U6PA 4C8OA 4AL6A 2IM0A 2DNZA 3NNCA 2BE2A 4DF4A 4ES2A 4IKAA 1X0PA 2LEAA 5LL6d 3V4IB 2CPZA 5EHHA 2Q43A 2VPWB 2A18A 3C8YA 3F44A 4ZVEA 3FZ2A 2GV1A 3KLGA 3CULA 1N5YA 3HM9A 1GTHA 4OX6A 1N4LA 1G2EA 2HWTA 1CC7A 2R7TA 4J9QA 5KFNA 4C8NA 2HS3A 3IC1A 1N6QB 1IR0A 1P9QC 4DV1F 1ZZNA 2AU0A 3I0SA 2AYMA 4YFUA 4BCAA 2XWXA 3S01A 4ELUA 1N88A 4NCBA 4PCQA 4M95A 3LANA 2YWGA 5D4NA 1KFDA 2QLXA 3OFEA 1HWIA 3OQ2A 4WKYA 3ETOA 4ZPVR 3SZ2A 4EO6A 2VG7B 2KG1A 2RUGA 1N6QA 2VBWA 4OZJA 3MI7X 2K2PA 2IRUA 4ZCMA 2ZH5A 4MH8A 1XMBA 2DGVA 3MOJB 4F50A 4O44A 3TUZC 2C28A 5KG0A 1RJJA 2XLKA 1TVRB 3LAKA 4CCHA 5J2NA 4B9NA 4FXDA 5T7LA 4XAKA 2I38A 1Q7YT 3TW0A 1FKOB 2YKAA 3DRRA 4PXBA 4C11B 2HVZA 4MMOA 5E3QA 5L9XA 5C25A 4QWBA 4WZQA 4LF8F 3R1HA 3G6VA 1YBAA 1F2GA 2BRKA 1HBOA 4GKKF 2B4OA 2YX4A 3X1LB 2HS4A 1SV5A 2LLZA 2XWYA 3KG0A 5IWAF 3RZAA 2R2UA 1WEYA 4Q2MA 5EWGA 1P6TA 4WCEQ 4RUAA 3ICLA 2RMLA 5DLGA 1QTMA 2ZZMA 4IFYA 3RRKA 1R8PA 4QZVB 4YP3A 1UL3A 1SB6A 3IAS9 1NKBA 1FXDA 3DXBA 3GFHA 3PX6A 1R0AB 4IH6A 2BM1A 3M32A 1E6VB 3P5TL 4OI2A 4RNNA 4KFBA 2HLUA 2MYFA 4DS4A 4X4NA 3OHAA 4F4ZA 4QIEA 4I56A 1LKZA 2CQPA 3C6TA 3CVKA 4IOBA 1M1KT 2Q66A 4QYZJ 3KNGA 5A0YB 3CCWA 4MIAA 4DR5F 2IHR1 3AA8A 1X5PA 3FCHA 4DWIA 1J5EF 4C8YA 1HWKA 2R7VA 3BGUA 1XC9A 4U9RA 2L9DA 1WHYA 3CIZA 4TY8A 4IOCQ 2HYIB 2KVIA 4A8WA 4FF4A 1R6YA 2F9DA 4Y2CA 2N82B 2BA9A 1GH8A 5HL7Q 2QA4G 2HGNA 3E01B 4NA1A 5CZXA 3FMWA 1OQ3A 4RW4B 5A8WB 1PGZA 4ZP6A 1V3SA 2KN4A 2E5IA 2IRYA 5IZHA 3J7ZT 1VQSA 2CDQA 3DOKA 3CCES 1DRZA 1G7CB 1FK9B 5DM6Q 4RW7B 4IR9A 5C42B 3CD7A 1U1LA 1C1CA 4JOUA 3MD1A 4QCLA 4I2QA 1BQMB 2OLWA 3TVZA 3VAGA 2BOPA 4DR4F 1JLAB 2V4RA 1E6VA 1VBZA 3KKFA 4J9KA 3U27A 3DLLQ 2DH8A 1Y5IB 3TUJC 4JI7F 2IC3A 3M2UA 3OTBA 3CC2S 4A8MP 4JI1F 2AGPA 2ZH3A 3C6UA 2RB7A 3KHRA 1S6UA 2K1RA 1S72S 5CA5A 4DSIA 5J1EB 4X4TA 2W9BB 1FKPB 3D0GE 5GVQA 4Q5VA 2FIUA 4PG8A 3KHLA 2PA8D 2CQHA 4HH0A 2IAJB 4JI2F 2CQIA 4H4MB 4MIWA 4IG3A 3BO4A 5HP1B 3POTA 1X4EA 4C7QA 2VG6A 1S9EB 2NYIA 2VC1A 4NLOA 1RT5B 5KFSA 1RA7A 1RT6A 4Y65A 2R7SA 5J2QA 1KC8T 1WHVA 4IQXA 1FKPA 3SYZA 3HDSA 5CYQB 1JXEA 4UY8T 1RKIA 1IQZA 3HHLC 1FDNA 3OR1A 7FDRA 1LW2A 3GV7B 2R2SA 1VQLS 2YKOA 3T6JA 5DDOC 5E0OA 2I8EA 1RT6B 1BQMA 1GQEA 1JLFA 1T3NA 4EYHB 4KO0B 2BBEA 3H5YA 5K9FA 2KJWA 4CH0S 4I4BA 2KT2A 4ZHRB 5D3GB 3MM9A 4TQSA 3N0VA 4A8KA 3BQ2A 2KO1A 2XNQA 2HHTA 3HXMA 5F8JA 4F67A 5IFMA 1LXJA 1L3UA 1TKTA 2AX0A 1UVIA 2HHXA 1RTJA 1ZH5A 3KMQA 2R7OA 1JNRB 1LV5A 1YQHA 1YJRA 2HQIA 5E3AA 3KMSA 2YNFB 1I1GA 4X66F 2OH2A 3Q8SB 3MMCB 4ZCKA 3NNHA 1FJEB 4X4SA 4EO8A 3NCPA 1DTTB 1TKTB 2LVWA 1U2RA 5DQHA 4I1TA 4NLVA 1IJFB 1VQ6S 3MECB 5B08A 1TAQA 2OO4A 4NX9A 3CCZA 4Y2KA 1UEVA 2ZFHA 3HHNB 2B4PA 4QU6A 3GIIA 1DQ9A 5L9NA 4YB1P 2CVEA 3OXLA 3N9UC 3VR1A 2MQOA 4CO4A 3LW5C 1FF2A 3KLVA 4EBCA 1VRUA 2C42A 3QPIA 2YKQA 5KG6A 1Q86T 2KFYA 1P1LA 3GFZA 2N7CA 2ZH9A 4RZRA 4FBTA 5GAHU 2KT3A 5DDQC 2E7XA 4LF7F 3QGIA 6FDRA 5A8RA 2UVRA 3PO5A 3QIDA 1DBDA 1KONA 3EUNA 2WBMA 2EPIA 1LWEA 3PXGa 4K50A 5L1KA 3OLAA 4K5RA 2ZJPQ 2BACA 2RIJA 3J7YI 4HHJA 3H40A 4RW7A 5D77A 1N5SA 2JOQA 4IG3B 2BQRA 1VC6A 1WNEA 4ZPTR 2R7UA 1ZAWA 5D4LA 3ZFVA 1FT8A 1S0OA 4U7CA 1H38A 1HI0P 5KG7A 3W2WB 1APSA 2NSBA 3CJ3A 3HZEA 3VTIA 3OPKA 1TL3B 3L7PA 4C3LA 3CTRA 1IKWB 1BQNA 2I5JA 2K3KA 2YVSA 4CO3A 3PRBA 2W7AA 4IH7A 1S6QB 2AYBA 4LVNP 2L48A 3HHLB 5F8MA 4Y3CA 3TANA 1XMQF 1RWUA 2PI5A 3LWLA 5KG3A 1U4BA 2LQ5A 2DR7A 4HKQA 2V94A 3VZHA 2XG8A 2CJAA 4H4OB 2HNYB 3MEGB 4ZPAA 4ICLB 1PILA 2OMLA 4J9PA 4O4GB 2Y1JA 4A47A 4A8FA 1XNQF 2FJDB 2YH0A 2DRBA 1RYRA 5CCMA 3L7OA 4TYAA 1HYSB 2EFQA 3Q22A 2GMJA 4Y34A 4PQUB 1HNWF 5F8LA 1RTHB 2I1RA 4AFFA 1U1OA 1TL1B 2CPJA 1VQ9S 2CZVC 1IBMF 2WCXA 5KFHA 4PPDA 3PEHA 4QPTA 1QY7A 4NCAA 3CC4S 2HHSA 1X8DA 2VFSA 2HHHF 4ETZA 1DTTA 4O0IA 2RT3A 2POKA 3OR2A 4ID5B 4DFMA 4OZNA 4C0BA 3THVA 1FRLA 2XC9A 2NZ4A 4KFBB 2FHJD 4U67Q 4O3QA 4DDFA 3SI8A 4HEA9 3CWJA 1VOMA 2VG7A 3EZUA 3EPIA 2VPXB 3CGIA 2UXCF 5T14A 3B78A 3UNGC 3N79A 4M63A 5EWFA 5JVGQ 1NK0A 3TNVA 4OLPA 3C2PA 2D3ZA 3SMZA 2ZE2A 4F26A 4RUCA 4XDDA 4CI0B 5GAHI 5T41A 2GHPA 3KLHB 1WEXA 4X84A 3W3SA 3KK2A 2C3UA 1Y0HA 3I32A 3MEEB 4R8UA 3JB9k 2F40A 4J9OA 1CSJA 2A1BA 2FJBB 4NLSA 1M5HA 2NUHA 2YX1A 4LF6F 4C8ZA 1KN6A 4PKDB 2ZE2B 5ADZA 1MSWD 2BABA 3DLKB 4OV1A 2VA2A 3V4MA 5CYQA 1RTIB 1V3RA 2OPRB 3AH6A 4ZK7M 4C0HA 1IM4A 3FFIB 5KFKA 5KT7A 1UP1A 2RDIA 4N8OA 5KFMA 3CD0A 4KAIA 1J5OB 1FJGF 1NKCA 2RQCA 3LP1A 4H4MA 3D2WA 1N5QA 2FVCA 1SJFA 4DX8H 4QR2A 4NLRA 3NP5A 3DM2B 3M8PB 1N8RT 2VB6A 3H5UA 2W9BA 2FJXA 4IRDA 5IQ6A 2HFNA 3T9NA 3FDSA 5B0EA 1IBKF 3TA2A 4KIAA 3US5A 1FKAF 1U1RA 3I56S 2ZVSA 5L8RC 4DG1A 2ROPA 4C2MA 1R8BA 4DR1F 2RH3A 3OTDA 2F4VF 3VAJA 4A8OA 2PFFB 2G1DA 2XGQA 4DSJA 3QJLA 2V8VA 1S1XA 2QE5A 4I64A 1X4CA 2V9KA 3LF0A 1HNVB 2OD6A 3TARA 1T94A 2J6SA 2ZD1A 4EEYA 4KHMA 4ZHRA 5D3GA 1MROA 4FZVA 4TYBA 4LF9F 4RW4A 3UFCX 3IGNA 3PFOA 1CQMA 1H0HB 2FDNA 3OJSA 4JI4F 2J9CA 2MKSA 4LSLB 1R8HA 3FEZA 1OSCA 4RX6A 3ZZRA 1FEEA 1H3DA 4A48A 3X3UA 2ZJQQ 1K0TA 3WX4A 1BWEA 4KTQA 1P27B 2ZC4A 4OIXA 1YG0A 1H2UX 2IA0A 2JZ5A 2VODA 3T19A 2J7KA 4EGLA 5H9EJ 2R2RA 3TP2A 5I4MA 2BDPA 2JEFA 2HAIA 3UDLA 1U1MA 3SV4A 5GMKa 1RT5A 5B0BA 2GFFA 4FS2A 1KQKA 1NEEA 4MFBB 3RB6A 5GAEI 3OR2B 2B5JA 4ID5A 4PG6A 3LGNA 2MKHA 3DLHA 4JV5F 4OI3A 3CCMS 1N0UA 2MZJA 1Q7LB 4WK1A 2YNHA 3DMJB 5J1NA 3MTJA 3MZIA 3FMBA 2PGCA 1RP5A 2HRUA 4LSLA 2BANB 2PO4A 3QLHB 4TQRA 3MPVA 4L6V3 2IM3A 4CNZA 3OLBA 1WTFA 3R5DA 1KQSR 2OJ3A 2WTFA 5KT3A 4Q44A 4I68A 4XPEA 4K4WA 4OFZA 2CFXA 2MXYA 3LP1B 1JLBA 2LCWA 2AV5A 3DRSB 3HHEA 3HT3A 1U26A 1A9NB 1LW0B 3BREA 4ECQA 1FRKA 1KOOA 2DNMA 2JVRA 2XSJB 5HMXA 4MKYA 3F41A 2QRRA 2J7WA 2YWFA 3Q0AA 4QYRA 5J2PB 4I2PA 1NJXA 4NXNF 3A1YG 3SFGA 1FRJA 2M70A 3M9MB 1DARA 5DJBA 3IG1B 5F8IA 2X1GA 1TAUA 4DEZA 1TKZB 4ZPCA 4WIIA 3W2WA 1G1XA 1LWCA 1JLEA 2CQ1A 2J0WA 3GFXA 3OVSA 4ZS6A 3CUNA 4CZCA 1DZ5A 4H54A 3JSRA 2DJWA 2DNKA 3N01A 2ADBA 2J7UA 4K4TA 3M8QA 2M8HA 3I4HX 3UR3C 5J2MA 4K4VA 3QO9B 3VAMA 1PC5A 1W25A 5DG8A 1JLCA 1R8AA 4G1PA 4ES3A 3MUVP 5HROA 4EZ6A 4WZMA 3THTA 4LIRA 3KK3A 2QMWA 3DLGA 3Q2SC 2FJVA 4ECYA 3DHWC 2KFZA 1F5AA 2CVIA 2GO9A 2O3DA 3AY0A 5A8RB 3HMJG 4J9RA 4TN2A 2UVWA 2OFHX 2VBXA 2ZUGA 5B7WA 2J0QD 2HQ3A 3MR6A 4C8KA 2K7JA 2J6UA 3BDPA 1FKOA 5J2NB 3GSDA 2HHPA 4NYOA 4TU9A 2DO0A 1QVGR 1ZPVA 4UW2A 4DN9A 1C4AA 2E9ZA 4F8RA 4HT5A 3C46A 1S99A 4OJ1A 2DR5A 4O3PA 2UUCF 1TL1A 4DQIA 4IRCA 1HI8A 5JXSA 3PDNA 4K2XA 3L3CA 4B9LA 1LWFB 2XY5A 2KYXA 3KLIB 3NAHA 1R89A 2O67A 2WK4A 5CD4H 1OPIA 1N0VC 1R31A 1QE1B 3O44A 1H7XA 1NH8A 3AAWB 4ATNA 2OTJS 1LK7A 4J5OA 1CQNA 1WEZA 2F9JA 3Q23A 2D9OA 2FPHX 4A46A 3KNAA 2HZCA 2OPSA 4YB7A 5K8OA 4WFZA 1IBLF 2MKKA 3KK1A 2DB1A 4RKUC 1KTVA 2QLWA 1DTQA 2ZOMA 4C9DA 3GMGA 2DNRA 5MAOA 1JNZB 2HNZB 1PSDA 4ILRA 1C0UA 3OVAA 2LDYA 1RA6A 5K14A 1JIHA 3ZZZA 5EGYA 2KJVA 3TYTA 3JSMA 5BR8F 1TZ0A 2OAUA 1NK8A 1A6LA 4WU3A 2E44A 1Z1ZA 2FJAB 5LMUF 4FN5A 4OI4A 4F4WA 5U47A 3W7BA 2W9CA 4HH1A 4OL8A 3WDOA 2X1FA 1D9FA 4IFVB 4BWJA 2B9WA 4DFJA 2DNPA 2M5YA 4AYBD 1VS3A 1FCAA 1YRXA