5CH7B

Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
b'MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 86
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ch7B00
1FRLA 1FEHA 1GTHA 3GYXB 1GAOA 1BC6A 2FJEB 4XDCA 1B0PA 1FDDA 3MM8B 2WSCC 1FXRA 6FD1A 2WSFC 1DAXA 1BD6A 1F5CA 4YDDB 3MMCA 1R27B 3MM9B 1SJ1A 2C3YA 1IR0A 3LW5C 3MMAB 1H98A 4Y28C 4XDDA 3EXYA 2VPYB 7FDRA 3OR2A 7FD1A 1IQZA 3MM6A 5BYQA 1FDBA 4OMFG 2C3OA 3EUNA 4ID8A 3MM5A 3PNIA 1K0TA 1DURA 1AXQA 2C3PA 2WAQD 1F5BA 2FJDB 1JNZB 3OR1A 5E7OB 1ROFA 1GT8A 2VPXB 2C42A 4XK8C 1FRIA 2XSJB 1D3WA 2VPWB 2V2KA 2FDNA 6FDRA 1HFEL 1Y4ZB 1B0VA 3MM7A 1C4AA 1H7WA 1Q16B 4RKUC 2V4JA 3MMBA 5CHCB 2C3UA 3EGWB 1C4CA 2FGOA 3IR6B 3MMCB 1XERA 2C3MA 3IR7B 1FCAA 1KQGB 4L6V3 1FTCA 1KEKA 1Y5LB 2Z8QA 1Y5IB 4KT0C 3HKZD 2WB1D 1H7XA 1PC4A 1FRXA 1PC5A 3MM8A 3OR2B 3MM6B 1H0HB 2FD2A 3IR5B 2FJAB 3MM5B 5BYSA 3MM9A 1BLUA 1BWEA 1GTEA 1FDNA 3MMAA 1CLFA 5CH7B 3OR1B 1FRMA 2ZVSA 3C8YA 2FJBB 1SIWB 4OV1A 1WTFA 1F2GA 1JNRB 1Y5NB 2UZAA 1FXDA 1FERA 2O01C 1DFDA 1FRKA 1VJWA 5BYRA 3MM7B 1FD2A 2GMHA 2IVFB 1FRJA 1KQFB 2WSEC 2V4JB 2PDAA 1FDAA 3MMBB 1SIZA 2VKRA 4CI0B 1A6LA 4AYBD 2PMZD 2Y0SD 2GMJA 1FF2A 1JB0C 2XSJA 1RGVA 2VPZB 5FD1A 1G6BA 5L8RC 1B0TA 1FRHA 4DHVA 1BQXA 2PA8D 1G3OA
chains in the Genus database with same CATH superfamily
3SYZA 3TUZC 3CJSA 5KOXA 3R27A 5DZ7A 2WHOA 1Z4UA 2HIQA 4L3NA 3HM9A 2CG8A 2MSTA 1VMBA 1X4FA 1Q7LB 1WF2A 3SCKE 3BKUA 3R5AA 1WC0A 1HYSA 2FB0A 4IRDA 2MKJA 3PRDA 1HFEL 4R5PA 2WBMA 4ZN1A 4IRCA 1RHMB 2LP4A 3H40A 4L6V3 3PX6A 2Q79A 1NDCA 1ZM3A 2Q43A 4XTTA 2CJAA 2OD4A 2GC8A 3ZNUA 4XIUA 3K17A 2FJAB 4B9LA 2BQRA 2JFDA 2VBXA 4DV6J 1UEUA 4H4KA 1TKZB 3OR1B 1I6JA 3O5TB 1X5OA 1D1UA 3ISNC 1SH0A 3TWZA 1HBUB 4I68A 1UVKA 3UCGA 5AE1A 4K4TA 3L7UA 5LMNF 3MMBB 5ETRA 2UVRA 1VQ4S 1YI2S 3KUEA 3BKFA 2ZKUA 3TVZA 1NKCA 2DNRA 2C2NA 4ECZA 3F41A 1DZ5A 4XO0A 2DYAA 2HVEA 1AB8A 4U7UD 5D4NA 1RWUA 2XHCA 1CJUB 3MOZA 2QE5A 2EG1A 1YJ9S 4NLVA 1MROB 4YB5A 3Q89A 4CM0A 5GAEI 1RT2B 2C42A 3A1YG 3FNNA 3C15B 3SSSA 4GKKJ 3HVWA 2DCUB 2UV8A 2C3UA 1R8HA 1WI6A 3R3TA 1UP1A 4OZJA 4MKYA 2R7UA 1T3NA 5HVHA 2DGSA 2C2DA 2AJ0A 3OL9A 4PPZA 4LF6F 2DR6A 4PEOA 4ZP7A 2BDPA 1HYSB 2MQNA 5IFMA 4M5NA 2UUCJ 3TEHB 2XNRA 3L4BC 2GVDA 4K4YA 4NZ0A 4R5PB 3M6UA 2HFUA 3VGUA 4DL7A 2RRBA 2AZ1A 5ETQA 3W3SA 5K8NA 2V2QA 2P6SA 2DNZA 2BANA 4D3HA 3DKDA 4KGKA 1W2BR 3RB0A 3TA2A 2ZBRA 1RCXB 2QZ8A 4ANDA 5CCLA 1N5VA 2UXBF 4DJBA 3KJFB 4CNYA 2ZJQQ 4OX8A 4ECQA 1R0AA 2RU9A 4KTQA 1TR0A 4CLWA 4BWJA 4E8UA 3GJSB 1TAUA 1Q5VA 5J2NA 4CH1A 3FZBA 3PRBA 4F67A 5KFOA 1LK7A 1Y3KA 4B9VA 2MKKA 4CO2A 3JS9A 3I5CA 5BR8J 2A0FB 1WHWA 2DXEA 1VC0A 1S77D 2CQDA 4CCHA 5KFYA 1WHVA 5KAKA 1N88A 1YZ7A 4X4VA 4LFCF 4RO0A 3ZZUA 4X4NA 2AGQA 1KNZA 2ROGA 3TZWA 1S7HA 5EX0A 1VC6A 2B5JA 1GFWB 3P6YC 2GIQA 1D9DA 1HARA 3ZTQA 4JV2A 2GVDB 2I1RA 1DURA 1S6PA 3IP0A 5CYJA 3AOCA 1JNZB 3CJ8A 3HHLA 3RBXA 2VPXB 3ENAA 2N4DA 1DY3A 4EO8A 3GG0A 2QT7A 1MLAA 1NRKA 5DJBA 2EFNA 3C19A 4QIGA 4Y2AA 4RNOA 2GFFA 2BANB 3I4PA 2W9AA 3ADAC 1NK8A 1NH7A 3GYNA 1PGZA 1L5UA 1WEYA 2HHTA 1KHVA 3B6BA 1VQ8S 4ANCA 1NZ8A 3SSQA 5K8MA 4AFFA 4HEA9 5HMWA 3JQKA 1RAEB 3PW2A 4ZPAA 4JBCA 1R0AB 3CIMA 3K5NA 4LF8F 3ULHA 2BABA 2YX1A 4DV4J 4WFAQ 4C8LA 3S01A 4J9KA 5J2NB 1LV5A 1QAYA 1R8PA 2BMBA 2VV5A 1F0XA 2G13A 3M2UA 5EWGA 1N4LA 5K14A 2MJNA 1YJ7A 2GV1A 3T6BA 3B4MA 1YHQS 3KMSA 2XS2A 1RWPB 4MK9A 1TUVA 2CVIA 4R0JA 1KVIA 2HAIA 3GSIA 4DUZF 4W98A 2B9YA 3MM7A 1S1WA 2JC0A 2JZ5A 3LTOA 1S12A 2B5JB 2YKMA 1XERA 3NGKA 4EU0A 2IFXA 4C8MA 1PJ7A 3DYAA 4B3SJ 3BGRB 2OPRA 1S6PB 4DQSA 4I69A 3MCNA 3O6QA 2Y8YA 2YKQA 3HHLB 4Y00A 3SSRA 1T9UA 3OL8A 3EYZA 4ES2A 4WTOB 5KFBA 4ID5A 4LR9A 4DSJA 2GJ2A 1ZA2B 3D0HE 5KG5A 1N5YA 3MEGA 2FIUA 2OPSA 3GV8B 3DXSX 1NKBA 4N47A 2M3DA 3KLIA 3CIZA 2GCFA 3TX0A 2VG5A 1JIHA 1U47A 4J9RA 1DQ9A 4MK8A 2KT3A 1YWXA 3TOQA 2XY7A 5A2QY 1X5PA 2GO9A 4UT4A 3GIJA 2AEFA 5AE2A 2UUAJ 3DCAA 5IV3A 1GQEA 1SH3A 3MCMA 3BJYA 1CVJA 2E5LJ 2NPIA 2ATCB 2BJ7A 3MAHA 4TNOA 1RWWB 3M2UB 1TUGB 3MPDA 1H74A 1NJZA 5K14B 5E3RA 4PPDA 1N33F 2GHWA 3PZPA 1EB0A 2V68A 1O0PA 4ED0A 3RR7A 3CJ3A 4K4VA 4D3GA 3QT7A 3UN5A 2NUHA 4L74A 3MM7B 4ZOSA 1S1WB 3M6WA 1ZPWX 2H5EA 3H25A 2M52A 1NDKA 2YNIA 4MAKA 2YKMB 2AEMA 3OFHA 4DR5F 2WVBA 4QZVB 1WG1A 5DG8A 3DYAB 3W2WA 2D69A 2VFTA 3EVMA 2OPRB 2G2ZA 3R97A 3CC2S 3QMQA 5C2CA 4PG5A 7FDRA 2BA9A 4U7CA 4KB7A 4ID5B 4F3MA 1F5BA 2EXUA 2LVWA 2HBYB 2D7SA 1F3VA 2YXLA 3DU6A 1N5YB 3MEGB 2OPSB 2QN6B 3CD5A 2NYIA 3V6KA 3KLIB 2YVSA 1SI9A 4J9OA 4LRBA 1U24A 4MYUA 1NHUA 5C25A 2SXLA 2VG5B 4Y2CA 4ELVA 1BQMA 1T9VA 1Y5LB 2R7OA 2JLGA 1CG2A 2BJ1A 3TAQA 2E7WA 1SJ3P 1O51A 4DFJA 4ANEA 3MMAA 4DX6A 2IYGA 3W9IA 2FJBB 1T0TV 4BC9A 2COLA 1EARA 4ECXA 2KVQE 2QEXS 2F4VJ 4I64A 3DRXA 1XR5A 2IJRA 1WSVA 1N0UA 1FA0A 4CLTA 2M8DB 3MPYA 4IUFA 2DR5A 4FYVB 4ECWA 3NWGA 2HHVA 2XGQA 2K1RA 4DQIA 1VFJA 3CDUA 2FJWA 3EUNA 1FE0A 3NGTA 5B0BA 3P5BP 2WAQD 1CEZA 5KFVA 4AQYF 4JI1F 2YNIB 3R5CA 5CA5A 4JUZA 4DV2J 3PEHA 6FDRA 2J9DA 4USKA 5DDOC 1I3OB 3OHBA 1E6VA 2DR9A 2HAFA 1R43A 3BDEA 3W2WB 3K5MA 2CA9A 4C3LA 3CCSS 2KG1A 3FQLA 1P9QC 4C0HA 5F8GA 4A8XA 2DNQA 4E2FB 5F8NA 2R7QA 1PO6A 1N8RT 4FYWB 5BYRA 3TJAA 4IH6A 4Y2MA 1MNEA 1S99A 2W8LA 5I3QA 2ZUAA 1RACB 5C25B 1UVMA 2Y0SD 3CJ5A 1LWFA 3E51A 2KHCA 3VAGA 3EDRB 4JI6J 1BQMB 3TYTA 2V67A 1AUDA 3WX8A 2ZJPQ 2DHGA 4OLOA 3CJ0A 4B3RJ 4TU7A 1Y0HA 5A8RA 2G9OA 2HNYA 1IBKF 3MMAB 1NPKA 3CULA 5D77A 3KJNB 4FYXB 4P2XA 5KFMA 3MM5A 2IRXA 1U0SA 3MCSA 1AT1B 3AFGA 2VJUA 4OJGA 4IQMA 2OFHX 3T19A 5HAOA 2KFZA 1KVKA 4I7FA 1B0VA 2LDYA 3D6TB 1RT4A 3W60A 1RTIA 4ED1A 2K1RB 3Q83A 2Z8QA 4HR2A 4F3OA 2CJQA 2BOAA 3ETMA 1IKXA 2GIFA 2ZNZA 1C1BA 4M5IA 2GHVC 2AX0A 2HS4A 3IM9A 4GC7A 1RYRA 4WFBQ 1URNA 4CLSA 1E6VB 5BXIA 4WFXA 2V8DA 4XAKA 4P74A 3TQEA 1RCOB 3ZXWA 4RW8A 3JAMY 1YG0A 4OHYA 2HFZA 2GGPA 5B08A 1IKYA 3HZEA 2HHHF 1T9YA 3Q8RB 2DJWA 3BV8A 1X4DA 2ZFHA 4UOHA 4IH5A 2IY5B 3M6XA 3GPAA 2EW9A 2XM3A 2EWHA 5DM7Q 4WK3A 3TO8A 2E1RA 1I51B 4ED5A 3GQCA 1LWFB 1D0EA 4HL9A 3ITHA 2DNYA 4PRFA 2G0JA 2KZMA 1Z2ZA 3TANA 2HMIA 4CTAA 5IT9U 2KZZA 4A8QA 5A8RB 3G82A 4F4AA 2HNYB 1H72C 4WIQA 3HKZD 2QV6A 1Q8LA 3HFVA 3NNCA 4ILMA 3MM5B 3SV3A 3EPGA 3K59A 5FJ4A 4AL7A 5H9EJ 1HPZA 4ERDA 1SQGA 1RSCA 4Q2LA 4I7FB 1YBTA 4ECSA 2HRUA 4F0HA 1HNXJ 4X64J 2PA3A 1RT4B 1RTIB 3J7YU 5D15A 1MMNA 1KTQA 1FRLA 2I0XA 3D7SB 3R5DA 1GXLA 2DNOA 3GLJA 2XG8A 4WCEQ 1C1BB 2CYYA 1WOSA 2VASA 3LW5C 1WSRA 1Y9OA 2QSFA 3F56A 1B7YB 1WNEA 2CPHA 3VQSA 2VHGA 2LXUA 3CD0A 3RYLA 3RGIA 2B6AA 1KDNA 1HKAA 1XC9A 3MD1A 2RHQB 1ELOA 1O6XA 3MAQA 3EVWA 2N82B 3UQSA 5A6PA 4ECRA 4RW8B 2GGPB 2HGMA 3AOBA 1IKYB 2EFOA 4I6AA 4ZVHA 2D3ZA 2MLZA 2W2NP 3IR7B 1OJ4A 1NB2A 3MWBA 2ERRA 5KT7A 4ECVA 1OY8A 3QGGA 1U0HA 1V9OA 5DO2A 3VZIA 1F6TA 1R8AA 3MMJA 2GHPA 5F9NA 3U27A 4NLRA 3ITHB 3GZ7A 4ZCMA 3ISND 3DLBA 1JJ4A 3TZZA 2N3LA 2HMIB 4CTAB 3HT0A 1OWXA 3G82B 2DHAA 4CWBA 2O5DA 2WK4A 2WSFC 3CCES 1ZA1B 2J8AA 1UVIA 1YDLA 2VG6A 4NZ7A 1HPZB 4OX7A 2C2EA 3M8RA 1X60A 2GAGC 2ZVIA 1BHNA 3P49B 4MKAA 3JSMA 4ZVUB 4WYWA 1L3SA 3QWPA 2FHJD 4EUVA 3SDEA 4DR1J 2F1FA 3QRRA 3FSYA 1REGX 1C4CA 1JXLA 5LSRA 1S7IA 5D6GA 5G0RA 3K8VA 4J9PA 3N0VA 3MM9A 3D54A 5LMUJ 1R3NA 2KG0A 2B6AB 3ENQA 5DQGA 4DPUA 2O01C 1TK8A 1MU2A 4A46A 4CI0B 2YNGA 1FRHA 3T1HJ 1MWYA 4MMOA 3NMRA 4A8OA 1U0HB 2XI2A 3R7NB 1ZM4A 4DCJB 4ID8A 4IOCQ 4N8OA 1RTDA 1IVZA 3VCDA 4DV5F 4I2QA 4JYAF 1IKVA 3I96A 4R25A 2LCWA 4H4KC 1PYTA 2DR7A 2RQKA 3R1HA 2PEHA 3A8IA 4RUAA 3HHNB 4RNHA 2VG6B 3MFIA 5A8KA 1S4FA 5C7PA 4KH0B 4FXDA 3E8OA 4FXVA 3P4UB 1BLUA 1T8EA 1IXKA 2IRYA 3JSMB 1RUSA 1S0NA 2QO3A 4WJBA 3D68A 4QPXA 3PO4A 2HIYA 4Y0FA 1JK9B 4OYIA 4LMZA 3SDEB 3FCWA 1U1LA 3AJDA 4DL3A 2XSJA 1GXUA 2OO4A 1N56A 3H42A 4NLQA 3M4XA 5FDLA 4PWUA 2DR8A 5G0RB 4KPYA 3WDOA 1MN7A 2W01A 3MM9B 4B3TF 5AE3A 1C1CA 5B0GA 3LP2A 1C0TA 4IYQA 4XDDA 3B8HA 3U1MA 1Q78A 3MECA 4NLWA 2QFJA 3ZZYA 5IWAJ 4HT7A 2RF2A 3W66A 1MU2B 3H4BA 2AGOA 2YNGB 2WB4A 2IRUA 4F0MA 4P73A 3TARA 5ETLA 2VG7A 4LREA 4WP9A 1HWLA 1DTTA 3BGLA 1QVGR 1LW2A 3GIIA 5HROA 3M8QA 2IA6A 2G4BA 5F9LA 2DH9A 5E3CA 3UD4P 2LU2A 2CQ4A 1RTDB 2DHXA 2L9DA 2B3TB 3PACA 4I2QB 3TA0A 3C8YA 1IKVB 2HURA 2MB0B 2DGTA 2CKWA 2ASLA 3R2DJ 3HVAA 1UAWA 3VAFA 5KFRA 5DQHA 1TU0B 1XTZA 5J1NA 1IN0A 2HVDA 4J5OA 3QT5A 5A8KB 3D6FB 4NLTA 3KWMA 1U1QA 2M8HA 1NSPA 4P7VA 5H9FK 3FVYA 3POTA 1URRA 3HHKA 5CZXA 3OR2A 4F3QA 4DDFA 2AKWB 3J81Y 2J0SD 4DSLA 1GT8A 3HDSA 5FLXU 1SL0A 2XSJB 3BYRA 3IAS9 3LQVA 4OX9F 4DSFA 5FDLB 2ZH3A 3OVSA 3J81j 1S6UA 3DDNA 2D74B 2GW8A 3LP1A 1C1CB 3QGPA 3LP2B 1C0TB 2LFVA 3MECB 1HWJA 2RF2B 2XULA 3LAKA 2AEJA 3HCXA 4QW9A 4OYPA 1ULRA 2HNZA 2VG7B 3R7BB 2KH9A 5HQMA 3HSGA 1DTTB 1LW2B 2UXDJ 5HROB 3M8QB 1BQXA 2E5JA 4EMDA 4NCAA 4MT1A 1ZZFA 2C2KB 1FJGF 3HHLC 4PYAA 4QQBA 1KP6A 2NR0A 4QR2A 2IA0A 5DGBA 4Y28C 3HMJG 4DV1F 1RBOB 4KC5A 4X4PA 1MMLA 2VFVA 3QIDA 3JTNA 1YBUA 3BH6B 4QWEA 4O3NA 2IVYA 4FP9A 3L3CA 4J9QA 3ILIA 3M9NB 4F50A 2O66A 1Y4ZB 4FF3A 1UWBA 4ICLA 5HMYA 1YQHA 4HKQA 1KC8T 2B9WA 2BEFA 2L9NA 4JI8F 1L3TA 3G6YA 4JB8B 3POTB 4PWDA 3OR2B 3LGHA 2UXCF 2QJ3A 5HLFA 1GNKA 3AQPA 3FCVA 3GIRA 2HYIB 2NYHA 4UUXA 2ACMA 1I94J 1P6TA 3PYEA 3W5XA 2UVWA 1LXNA 1T9TA 3OXLA 4QYZJ 2AT1B 4C8OA 2GMJA 3WC2A 1M1KT 3LP1B 1T02A 1FFWB 3IRWP 4AL5A 2CADA 3DU5A 1B3TA 3TJ9A 2W7OA 3CDAA 1NZAA 3Q0AA 4N76A 4JI4J 1ICEB 4G3IA 1UTAA 2YWGA 1PJ5A 2DEJA 4KPCA 3T41A 3MAAA 1VR6A 1LOUA 1EKRA 2HNZB 4AT1B 1SV5A 4ZCIA 4RW6A 4P2SA 1S4EA 3SQGA 5J2QA 1GX5A 3J7A1 3HP6A 1FVSA 2OTLS 1RISA 1XR6A 4ZIWA 1QD1A 2LXIA 1C2PA 5K5MA 2UVUA 1W25A 2HEKA 4DI6A 2CZVC 1WUUA 1RAIB 1X5TA 5CZVA 4QWAA 1FNOA 4USIA 2LEBA 3NOGA 2CJBA 4CH0S 1RWVB 4DX7A 2CRLA 2I8EA 3VAHA 2HQCA 3OV7A 4HHJA 2GA7A 1UWBB 4ICLB 4NMXA 1RT3A 3ET6A 4USTA 3UNGC 2IDEA 4C8NA 4Y2IA 4PWDB 2HS0A 3BM7A 3UDVA 5HLFB 4CP5A 2VFRA 1HI1A 1Q8IA 4Q45A 1M5PC 3WZ0A 2CPYA 1T03A 2ZZNA 2DTJA 2DXFA 4DL6A 4IR9A 4FBTA 3QJJA 2MQPA 4Z7CA 3RRHA 3PW5A 1C4AA 1CC8A 4NCBA 1H7WA 1X0PA 4V19J 2BRKA 2XNQA 5IC6B 3MD3A 1FHTA 4KT0C 2CPFA 1RHJB 5A6WA 4FPIA 2UUBJ 1EQMA 3MAAB 5CQGA 1SV5B 4RW6B 3SQGB 1MG7A 5J2QB 1Y00A 4TXSA 5F41A 5I4MA 2IJNA 1FRJA 3THPA 5DDQC 3HXMA 1KFDA 1SIZA 3SCLE 4K0KJ 2R7RA 2VA3A 2RRNA 1AA1B 1R7IA 1FXRA 2BKNA 2DRDA 4O3RA 4RUHA 2CPZA 4IG0A 2J7UA 2W24A 4NLXA 1HNZJ 1S97A 4DUYJ 1TAQA 5T14A 3MTKA 3HK2A 3BQ0A 1AZSA 3MHYA 3HPOA 2DHSA 1RT3B 2Z57B 1YGYA 1Q0NA 2RSQA 1B99A 1NK0A 5AXMA 3ET6B 1IBMJ 1Q7YT 4UY8T 3PO5A 1G7CB 3QPIA 4WYLA 1N5TA 1OQ3A 2RT3A 4OZ5A 4ZPCA 5GADI 2XLKA 1S49A 1QJHA 3PR4A 2DIVA 2L9WA 5DQIA 1T03B 5BYSA 2F63A 4EZ6A 4BDPA 1LQ9A 4O4RA 2GAHC 2OIHA 4M5KA 4JI5F 4DV3J 4ZP8A 3AQOA 2W2PP 3O1LA 3MR2A 2L08A 2F7VA 3EGVA 4F4ZA 2UU9J 2F8EX 1FDAA 2HVIA 2J6TA 5ETOA 4DL4A 1BGXT 3V6DA 2RE1A 1JLGA 3UN3A 2HZCA 2KYXA 2NSCA 2X51A 1XMOJ 1KVJA 2BW7A 4KKOA 2Y1RI 4DR7J 2AHOB 2R4FA 1H2VZ 2R8KA 2RHSB 4LBPA 3CVKA 2YBVA 1SCJB 3EGWB 1X4CA 4ZLNA 4IG0B 1N36J 2V4RA 1IBLJ 5LSLA 2AYMA 1FRXA 3O8WA 2YKPA 4GO5X 2DY9A 1NNDA 4DV4F 1JJCB 2I2YA 2NXEA 4B17A 1AZSB 2KXHA 1X4EA 1FXLA 1UJ6A 1NJIT 2HK3A 2IVFB 1QSYA 3CJ2A 2MJUA 2WSEC 5KFDA 4Q44A 4BCAA 5B0EA 5BJRA 2X1GA 3EPIA 3QGHA 3I32A 3H5YA 1M1GA 1GAOA 1PSDA 2F3JA 2GIRA 3ZTRA 4DUTA 4KHMA 3PYFA 4WFNQ 4A8WA 3RUBL 2PI4A 3VZHA 1N5QA 3LGNA 9ATCB 2A10A 2NXCA 1R89A 3H5SA 3NOCA 2HZVA 2ZH2A 1KS2A 2W9BA 3VVUA 4DV7J 2MZ1A 4G1PA 3V6DB 4B3SF 1TTHB 1OO0B 1JLGB 4EBEA 1YITS 1SJRA 2V4JA 1X4AA 3IWNC 2QLXA 3D2WA 3A13A 1U1NA 1IM6A 2EC0A 1TFYA 4A8SA 3IGNA 2WVCA 3H0PA 3R6LB 1FTRA 2VKZG 3PW7A 1JLFA 2LQ8A 2NZCA 3TZYA 2ASDA 4GKJJ 3GP9A 4K50A 1F9EB 1KOOA 4MTPA 4KKOB 4P10A 4DXLA 1HNIA 4NXMJ 3ZNJ1 2J0QD 2ZC3A 1YJUA 1ZS6A 2PDAA 4PZVA 2HHXA 2DO0A 4NI2A 2PI5A 4DBQA 4ER8A 4RX6A 2RVJA 4F02A 1NU4A 2Q6CA 3BBBA 1Q79A 1YBAA 2MGZA 3GE9A 4ZCLA 4ZJLA 2DGUA 5IV4A 4NL5A 4DOZA 5J2MA 4IR1A 2Y1JA 2B9EA 3RAMA 1SBRA 3B82A 1UWAA 3BBFA 3FRZA 3PRVA 3C6TA 4NRTA 2EC2A 5LXYA 2WOMA 2BJ8A 2KT2A 3T1YJ 4H4MA 2VC0A 5LXRA 4K4SA 2QLBB 3GYGA 1U45A 3ONQA 3K0JA 4YP3A 4F36A 2C2MB 1HHSA 3BR8A 2N7CA 2W9BB 2EFPA 1VDHA 4YN3B 3A3PB 3KYLA 2FJXA 2W2MP 5F3ZA 2EG2A 4LSZB 1PG5B 2YX7A 3SXLA 2H3EB 3RR8A 4H4OA 2V4JB 5E3PA 2HWTA 3HO1A 3E2EA 1FE4A 2JOQA 8AT1B 2RKIA 1K1QA 4OL8A 1U25A 3TNVA 3FQKA 5D0RA 3NS6A 5C5JA 1FEHA 4UQGA 3T3FA 1S9GA 5ETKA 4N7TA 2RQ4A 2AWZA 2VFUA 5KT4A 3PM9A 1JLFB 3VGVA 5KFQA 4IH7A 3B4DA 3OW2R 3UN2A 5KFFA 1HNIB 2HQGA 2LA4A 4DPWA 2CDQA 4DF8A 3BDPA 1RWMB 4NI2B 4KSEB 2XMKA 1NK6A 4A8YA 5LMNJ 2V2VA 3ISZA 5F8IA 2MGZB 4ZVQB 3KLEA 5DG7A 3SFUA 1G2EA 4ES3A 3DNCA 2GO8A 5J2MB 6AT1B 3N5FA 2HRYA 2ZKTA 2HHSA 3IC1A 3K89A 1S59A 4DR2J 2H5JB 3C6TB 3KMQA 2ZDOA 1FWPA 1YKWA 2WOMB 4H4MB 5KFJA 2QTWA 1XNQJ 4IO9Q 1IBCB 1VCTA 4WE1A 1VBKA 5F3TA 4DV2F 1U2RA 2PSZA 2AJ2A 4P9SA 3AD7C 4OZLA 4TY9A 2DPIA 3GIKA 1VIOA 4JI2F 2POKA 3ZZ0A 4BLGA 3HZGA 4DMZA 4FYYB 3K58A 3OQ2A 4H4OB 4A4JA 3UD3P 3UCUP 2RKIB 2V9WA 1J5EF 3CCRS 3AT1B 1S9GB 2D9OA 1JXVA 3H59A 1NMEB 4IFVA 2PIIA 5EDWA 3BBCA 4KV8A 1V3ZA 1YK9A 2ASJA 2ZOGA 2ZHAA 1BWEA 3QNWB 4L73A 3HI9A 4MJKA 2YQ0A 4B3RF 4DR4F 2E66A 3P45B 1NHVA 3BREA 2ZH4A 1NB7A 3PW0A 1RHRB 2IJFA 4USHA 2H51B 4I6WA 2FVCA 2C1EB 2UXBJ 2ZBIA 3KLGA 4ZPDA 3QFWA 3CMAS 1GXTA 2XGPA 1KQSR 3KLEB 3T5LA 2CNNB 3JSYA 5C24A 1B0PA 2OELA 3LO3A 3R7SB 1Q8KA 1RU2A 2MY7A 3M8PA 2VOPA 1Q81T 4EYHB 2DVIA 5CXTA 3WC0A 3U7JA 2VFSA 3ZTPA 2LMIA 2K2PA 2E7VA 4S0MA 2PFDA 3MZIA 1PYOB 1FI4A 1FRIA 3AXKA 3TP2A 2ZH7A 3N9UC 4UZBA 5EX3A 4WE1B 1PBUA 3WIUA 3CCUS 1XNRF 5DLFA 3IWLA 3PJWA 2FC9A 4LFCJ 2IM0A 2XMUA 2XY5A 1UVJA 2MKIA 4C3MA 3FEYB 4C8ZA 1HBMA 4P6QA 5L38A 5JJBA 1Q95G 4ZVTB 3RBZA 4OYXA 1KSPA 4AXJA 1YX2A 3CB4A 2JRSA 2W25A 3AA8A 4KFBA 2Z56B 1AUSL 3PX0A 2JDJA 3U02A 2VQEJ 4J91A 3CGIA 2GMHA 1OMSA 3DFEA 5F8JA 2OTJS 1ZM9A 4IOBA 1NAQA 4IFVB 3V4IA 4KV8B 3HHLD 2QA4S 4G6VB 1UJ5A 2XC9A 3B78A 1X7VA 3DDKA 2KTQA 2E44A 2ZH9A 4UF4A 4ZLLA 5HVGA 5EWEA 4XPEA 3CTRA 4QCLA 3Q24A 3V4MA 4C97A 3KLGB 2HBQB 1S79A 3UFCX 2FHKA 5C24B 2MLYA 4LF8J 2A2DA 2FGOA 4WBFA 3M8PB 1U09A 3DLHA 3PV8A 1Y5IB 1HNXF 3QQCD 2ZOMA 3NXZA 4NPOA 3EE3A 2QYGA 4MH8A 2G0IA 3TAMA 2KVIA 1SJQA 1KONA 2HBZB 2QX0A 5KFEA 1RHKB 3QJLA 1FFSB 3UO0A 2MHNA 2OP5A 2ZNYA 1O5JA 3BEGB 5J2PA 4N41A 4DCOB 1WKLA 2PFFB 1HBMB 2JWNA 3BGOP 2H4YB 4ZIVA 1FK9A 5LT5A 1X9SA 1QY7A 3BQ1A 3M8WA 4KRWA 2CNOB 1NK4A 1RXOB 2EBEA 1LFWA 4KFBB 1Q53A 3PNIA 3VHQA 2AW0A 3HSDA 2CPJA 4DN9A 5DRKA 4J90A 1RA6A 3CC7S 3NS7B 2VPWB 4WU3A 2HQIA 2ILZA 4QPTA 3HFZB 1S1VA 3V4IB 4EWTA 1BY9A 1YTYA 4RZRA 5JVHQ 1LFPA 2DGWA 2R2TA 4LFBF 3CSKA 1VQ7S 2J76E 4CLUA 3DGPA 3W2VA 1NBEB 4QIWD 2FY8A 4RWWA 2YWKA 2BJEA 2W4DA 2XBPA 3A3OB 1VYAA 2VOOA 1VC5A 2R3VA 3TQ1A 4YFUA 1NUEA 4C7QA 4E98A 4DFMA 3CDWA 3ZC4A 3G2XA 1QAJA 5I3UA 4NLSA 1QE1A 3TAMB 4WKYA 1VQ9S 2RS8A 3UR3C 4KHPF 1N33J 2OLWA 4TQSA 3OXFA 4JV5F 4ATNA 3JYTA 1RAHB 3HULA 2AJFE 3AHPA 4NE9C 5J2PB 4ZCKA 4TLRA 3OXGA 4G1QA 3CCTA 5LMUF 1HD0A 2VDIA 2ATLA 3KTQA 2WW4A 1FK9B 5I3PA 2W4PA 1CQMA 1S9EA 2BJ3A 1R6YA 4YR3A 5H9EK 4DR5J 3S1TA 1TV6A 3S7RA 3MR6A 1RE1B 4YR2A 2ZDPA 3GFYA 1TUWA 2NS1B 4DR3J 2Y1LB 3T1HF 5KG3A 3TVYA 4OLPA 2BBEA 5SUHA 3BS9A 4KBIA 2PN6A 1F2GA 4AL6A 4USVA 3KJVA 2B51A 3HJFA 1S1VB 5HN0A 2B7BB 2EK1A 2QL9B 2ZITA 4ZPWR 4I1TA 1Z1ZA 4ZP6A 2VPZB 4C3KA 5LJ5Y 4LF9F 3GJTB 3GFHA 2WSCC 4LF7F 3DOLA 1PYSB 1DBDA 2I38A 3DGPB 5D4OA 1WC1A 3W2VB 2LXFA 2EBGA 5T7LA 5GAHU 2W9CA 5KFZA 5ETNA 3QJPA 4CO0A 2DB1A 3NRBA 2DPJA 4NLGA 1CJKA 4TLQA 3VVTA 3PFOA 3IAM9 3AH6A 4OI3A 3AB4B 2OKQA 5I3UB 3RRKA 1QE1B 1SC6A 3HHEA 5JMNA 4ELUA 4AD6A 4JV0A 3C14A 3ILOA 4ECYA 3W8GA 3K5OA 3NGRA 3IWXA 2HGNA 3JYTB 3J7YI 1VISA 3IXQA 2HVZA 4NA1A 3KG1A 1VK8A 4CLLA 1VQKS 4G1QB 1VQ6S 2CWXA 1FD2A 2IC3A 3DHXA 3FJ2A 4LFAJ 3UR0A 3MGJA 3RTVA 4JI1J 2M9KA 1FKPA 1S9EB 1VIXA 2K7JA 5FD1A 1L3UA 2BYCA 1VQSA 1VRUA 1RAFB 3CCWA 1TV6B 3EDQB 4I6YA 2DGVA 1FJEB 2FJEB 3Q8YA 4MKBA 1VOMA 1JLBA 2K8GA 2DITA 2U2FA 4DSEA 3KDNA 4JP8A 5CCMA 3G8TA 3GCWP 5B7WA 3ZZPA 2YNHA 2FLOA 1KFSA 2H1YA 3KJVB 2VODA 1C0UA 1F9HA 4QBUA 1OS5A 1OY6A 3BSAA 4LRAA 3OFEA 5EUHA 1YRTA 1X9MA 4E0DA 2NUUG 3CEDA 3MTJA 5E3AA 4DQPA 3DRRA 3FSIA 3EJMA 3DOLB 5CD4A 1KEKA 5KFIA 2LDIA 4LBIA 5T7LB 2W9CB 3W5YA 3HT3A 1IBKJ 1WHXA 2PGCA 1CJKB 4QW8A 3DM2A 2V4QA 2JEFA 3NS5A 3D28A 3K7RA 4QIFA 4EZ9A 2BUNA 4H54A 1K1SA 2QL7B 2MQMA 1RGVA 3WBZA 4LIRA 3BGRA 4G1IA 3C14B 3HHDA 1SQEA 3N4WA 1FDDA 4EEYA 5JVGQ 3GJQB 3FMWA 1GEHA 3TRGA 3QRPA 3CJKA 1QSSA 4WXWA 2AV5A 4DPYA 3KFWX 3VAJA 4FNIA 3GJRB 4ILLA 2IC3B 1CS4A 1RWOB 4PG7A 3BN4A 2JEGA 5KT6A 2V0NA 4FNHA 2YWHA 1FKPB 1P9YA 1TL4A 1Q86T 3LALA 3I4HX 2PE8A 4M5JA 3I55S 2MZJA 1U1KA 1VRUB 2XYHB 1XMQF 1JLBB 4CO5A 5K8PA 1H2UX 1FWKA 5IOLA 2GQ2A 1KQGB 1RZMA 5DDRC 2YNHB 1RT1A 2YQ3A 2J6UA 3MM8A 2UV8G 3P96A 1YZ6A 1SJ4P 1C0UB 4Q7AA 4B9SA 3MPUB 3IRXA 2E1CA 4JI0F 2PMHA 3CJ4A 5E5NA 4KJIA 4L76A 4CYUA 2BQ3A 2YQ1A 3W9HA 3DRRB 2VZ9A 2IVMA 2L3MA 2FZKB 3T9ZA 1BC6A 2M0GB 2CNKB 2W2OP 1HR0J 4TN2A 4LR8A 2RUSA 3N6MA 5HMZA 4OIXA 1IQTA 4NYPA 1DRZA 2ZWOA 1GMUA 5SZTA 3DM2B 3KNAA 2YWWA 1PAEX 3GR1A 2R7XA 2J9CA 4LIWA 4FYDA 1I94F 5KG6A 1RQ0A 2C22A 2JVOA 4X4TA 3CJKB 2EPIA 5HI7A 2NREA 4LF4J 4OYAA 5KFKA 5LL6d 2C2OB 3C16A 1SH2A 1ZYQA 1IR1A 3K8WA 1ZZNA 1CS4B 2OSRA 4I56A 1LWEA 3DOKA 1U1PA 4LJMA 4ZVEA 1GMWA 1QTMA 2DXDA 1FXDA 2ABYA 3W1YC 2EFVA 2P5VA 1OY9A 1M5OC 4MIBA 4YR0A 4DR6F 4GVLA 3PIOQ 1RT1B 1SC4B 3MM8B 3OVAA 5L9XA 4USMA 2A6MA 2KM8C 3KDOA 1H98A 5KT2A 3FGVA 3IRXB 5DDPC 1M90T 5KT5A 3C6UA 2E1MC 4RNNA 2DY1A 2H65B 1HA1A 3L09A 4CYUB 2XTJP 2HBRB 2P9GA 2OEMA 3QZ7A 3AD9C 1BQNA 4CIOA 4LF5J 5KFPA 4J9LA 3DHWC 3I87A 3KK3A 2V63A 3RAXA 1I1GA 4X62F 1REVA 1HLWA 3ZO7A 3OSNA 5K20B 1HWUA 1T11A 2MKSA 3MEKA 3A8EA 2Q66A 1WELA 4YB7A 1RA7A 1XEZA 4K8RA 3Q8SB 2EK6A 4C2MA 1NLKL 3DLGA 2Y0BB 3FBCA 1FT8A 2QLWA 4TY8A 3HD1A 2XY6A 1VHFA 5C2GA 3SQOP 2MZQA 1KRPA 4URSA 3C16B 4B9UA 3JTPA 1LWEB 3DOKB 4X4OA 1LW0A 1HNWF 2ZH5A 4CT9A 2CDRB 3NMAA 3X1LB 3D1HA 2KU7A 4B9TA 2QLJB 4NLPA 2FDNA 3WQPA 1DHMA 3GONA 4LVNP 5ETPA 1S10A 3RAQA 2XS5A 4ED7A 4YHHJ 4RNMA 5HP1A 1OSCA 3UCZP 2BR0A 2CPXA 2E7XA 2E9ZA 1JX4A 1EAYC 2CQGA 3VWSA 5H9FJ 3C6UB 3OFGA 3ZFVA 2ZC4A 3MR7A 4EBDA 3VGTA 2IM1A 5KOWA 1VBXA 2V8HA 2FPHX 1BQNB 2KFYA 3US5A 3C46A 1APSA 4NEZA 4O0IA 3EXCX 4DX8H 2MEWA 3KK3B 3LUYA 2ZE2A 1N0VC 3L9ZA 3OHAA 1NSKL 1Q1KA 1REVB 2H48B 3QWUA 2R7TA 4Y3CA 3MUMP 5A2QU 1IBMF 4NCGA 4USWA 4RW9A 2N4CA 3UDEA 4FBUA 3GFXA 2LKZA 1D8YA 4IOAQ 4URQU 2CPEA 1EX8A 2KHDA 4OI2A 2A1BA 3DLGB 2FTRA 2CQ0A 3RB4A 4TY8B 3RB6A 1V3SA 4QIVA 5AJ3F 2MQOA 1OYDA 4DV3F 1JQGA 3NLCA 2RIJA 4TU9A 2BVZA 3H20A 2A6OA 5F8HA 2GVZA 1ZAWA 3CD7A 3AA9A 4N8NA 2EKNA 5LJ3Y 2DEIA 1LW0B 4DX5A 4B3TJ 4WP8A 2J5AA 3VF0B 4FZVA 4N5SA 1H38A 5KFUA 2OFGX 1RAOA 5L1LA 2RB7A 1XMOF 3RW6A 3IO1A 1TKTA 1JXEA 5HP1B 5D0GA 4RUBA 1RWNB 2R8HA 1SKSA 6FD1A 4DR7F 4DL2A 4YDDB 4DQQA 1XMBA 2XHWA 4M5DA 1BE4A 3EXYA 4TYBA 4X4UA 1YJNS 3MPVA 1IQZA 1FDBA 2C3OA 1TL3A 4IO1A 1IBLF 2MQLA 2FJDB 2AGPA 3AD8C 3MEDA 2EKYA 3JSRA 1E6YA 2ZE2B 3QATA 1W26A 5EHHA 3ELHA 4BC7A 3G9CA 1NDPA 3M7VA 2CVEA 1TL1A 4Y65A 1VQ5S 4YOEA 1KD1T 2ZM6F 4NCGB 2CJYB 2KJWA 4RW9B 4J9VA 4RR5A 3FCHA 1IR2A 3PKMA 1HWKA 2ZH8A 1ZH5A 2DNKA 3UNYA 2W8KA 5AXNA 4YQWA 1F60B 1SC1B 2DISA 1UPMB 1SIWB 2XZWA 2JEJA 3A8KA 4PCQA 5B0AA 2YTCA 2YKAA 3RB3A 4HYKA 2E29A 3I0RA 1Y7PA 2GVZB 4TVAB 4OX9J 3QAUA 1HHQA 2BE2A 1RT7A 2ZHOA 4KQZA 4N77A 4LQ9A 1NH8A 2LLZA 4OZ3A 3EWGA 5CD4H 2VB6A 3DLEA 1Q5YA 2VQFF 1QM9A 3M9OB 4QYRA 4X66J 3Q2TC 1AFIA 2AF6A 4RWXA 3BN7A 1VQLS 3ETOA 1TKTB 2V8VA 5HATA 4UQTA 1BWVA 5IXUA 4LSNA 2AYEA 3TVKA 3VV2B 4GKJF 4FXWA 3FRYA 2EVZA 4NLYA 3FBFA 4CZCA 4OYZA 3O44A 1ZM2A 1EQ0A 1N32F 3G8SA 2QGFB 4M5DB 5E3QA 2OGUA 1KKHA 1ACMB 2DHHA 1TL3B 4CT8A 3CPWR 3CXCR 3MEDB 1N34F 3T5HA 1E6YB 4UZCA 4OV1A 1MWZA 4WIIA 3A8JA 2OHDA 1JMTA 2M5YA 2HHWA 2J7KA 1TL1B 4Q43A 5L1JA 1HQUA 4QR1A 5D4LA 5GMDA 3PXGa 3ICLA 5KG4A 5D0HA 2XMWA 5DZ6A 4EFAC 3MMCA 4P2FA 2C3YA 4FF1A 1QUVA 2JFKA 4NWBA 4M5LA 4Q5VA 2UXCJ 3DRYA 1DQ8A 4HT5A 3L95X 3I0RB 2H5IB 3FBEA 5GVQA 2X3GA 1RLCL 4NXNJ 2BE2B 2HQ3A 1RTZA 4QU7A 4RKUC 1RT7B 4IKAA 4P75A 4L72B 2MDAA 5KFCA 1VRQC 2FC8A 3LA0A 4KGMA 1M5SA 2QFIA 5ADZA 4KGXB 2F40A 3DLEB 3H2LA 4MKVA 2NPFA 3CCVS 2MKYA 3J7Z5 4LSNB 2MY8A 4DEZA 4OI4A 2WTFA 3LAMA 3LH2S 1M5VC 3JAMU 3IGVA 3X3UA 1RBAA 2RU3A 4OI6A 2HVHA 1FKAF 3BB5A 2K7KA 1J5OA 4FS2A 2BE7D 1HW8A 4L75A 2F5GA 2KRBA 2A3JA 1NK7A 5G4DA 2G1DA 4RW4A 1R0BG 1WC3A 1AXQA 2FY1A 1HQUB 3MPWA 2ZWPA 4C6AA 1GX6A 4V1Ak 2P8IA 4DR2F 4K4ZA 1NCLA 2XLIA 3MMCB 2B4VA 3BO2A 1RWKB 2MZTA 2CPIA 1UCNA 3PHTA 2VBWA 2IBOA 2R2RA 1XNQF 1H0HB 1HL6A 3RZAA 3BGFA 4P2MA 5HO4A 3GILA 1K73T 1D8ZA 3R8YA 1V5VA 5A76A 2ZUGA 4J9UE 3G96A 5KG7A 4LF2A 1TK5A 5D0EA 2XZTB 2R7SA 1XK8A 4IFYA 1U1RA 5E41A 3M30A 2IBKA 2HSEB 3SI8A 5M2RA 4R0EA 4OZ2A 1JJHA 4WK1A 2RQCA 2DRBA 1S57A 1UFKA 3U1LA 1IR0A 3GB0A 4CO3A 4ZJQA 4X65J 2CWKA 3UWTA 4NLDA 2JX2A 1VS3A 2P2CB 4UOCA 2MKCA 2XMAA 1BMQB 2GMLA 2R7VA 3PYGA 5ETVA 4BWMA 4BHQA 2KB2A 3A4TA 1LKZA 4F2RA 2HLUA 1XIQA 1J5OB 2RMLA 4JI7F 1SL2A 4RW4B 1IKWA 1FDNA 2VIHA 5KG1A 3QT6A 7AT1B 1S72S 2IM2A 4LRDA 4YY3J 1U26A 5IC4B 5ETSA 4U8VA 1D09B 1RTJA 2DIUA 1X8DA 4JV1A 3QT8A 2KXFA 4DV0F 5D4PA 1NK5A 4UTGA 3SEOA 4F0KA 2CQ2A 2EFGA 1O8BA 4O4GA 5KFGA 5GAGU 4WWSA 2ZOFA 3NEKA 1S0OA 4W90B 4X4QA 4PR6A 1S1XA 4DS5A 1UMJA 3G4SS 4JI5J 2V9KA 4P72A 3DMJA 3AXMA 4IFYB 3M30B 3KHLA 5C42A 1IJEB 4P71A 4J7CA 2VQEF 1U6FA 2KXNB 4CLZA 2R2UA 1NK9A 5DS7A 1NPPA 4OI1A 2WB1D 2XWYA 3GFZA 2R8GA 4DF4A 3ENWA 4WXOA 3CJTA 4ZHRA 1NO8A 1WEXA 2GJFA 4O0NA 3IS9A 2AQ4A 3DOMA 2C2ZB 2M70A 2CQIA 2F8MA 1FO1A 1WTFA 2JJ4D 3G8QA 1IWAA 2K06A 3OTEA 3CF5Q 2HK2A 2FLLA 1IUJA 3MR5A 4P7TA 3NGUA 1B0TA 4EK2A 2CZ4A 5AT1B 3KLVA 3T9NA 2ZBQA 4KHRA 1W2IA 4XDCA 2VC1A 2MMYA 2V69A 3IA0A 4RBTA 1IKWB 2PC6A 3OTDA 3D66A 4K7QA 5DG9A 4NYZA 4B3MJ 2KKHA 1ROFA 1IM4A 1XBWA 4CO4A 4XK8C 3PIPQ 1NHKL 2V2KA 1MSWD 1RTJB 4NYOA 4J9SA 2AP6A 1XR7A 2B8QA 2JLEA 2HHQA 4OYBA 4U8YA 5IT0A 4DPOA 4XPCA 1F3FA 2DGXA 3OSPA 4O4GB 4BBYA 3SCJE 5J1PA 2B43A 4ZKAA 1UZHA 5U47A 1Y3JA 1S1XB 3I5BA 5IS2A 4A8MP 3DMJB 1JNRB 4ES1A 4KY3A 5C42B 2E1AA 3TUPA 1S9FA 4PG4A 4X4SA 3NGDA 3PHEA 4NA2A 4ZHRB 3IS9B 3DOMB 1DLOA 2V8GA 2N7YA 3CW2C 4U7UK 2VL1A 4QWBA 2C3PA 1J27A 2N3OA 5LSOA 4M94A 3K2YA 4OJ3A 1WOPA 3MURP 1VJQA 4HHHA 4OFZA 1CPZA 4RBVA 1SKRA 2FLPA 4KE5A 1NJYA 4U9RA 2QYCA 3OD2A 1LWXA 3G87A 2Q1LA 1QLNA 2E1PA 3EM1A 3TI0A 1WKKA 1B7FA 1WACA 2HHUA 2B56A 1IJFB 1FWLA 1W7WA 1H2TZ 3S6EA 3KK2A 4NZ6A 2UUWA 1Y5NB 5JXSA 4K2XA 1DFDA 1RKJA 3F0NA 4C11A 1T9XA 3M8ZA 5F8MA 3VAIA 4QWCA 2OI2A 4ZK7M 4KGZB 3GYXB 4DV6F 3J81U 1N5SA 5GMKa 3MUVP 1S48A 3KUGA 5HJXA 4Q8FA 4Z37A 1JWWA 3VGSA 4USJC 1ZBTA 3CWJA 1VBYA 4CO1A 1UFLA 3UVJA 2OPQA 4DR3F 4ZITA 4ZMMA 4HHUA 2JH3A 4M1KA 2RJZA 3KKFA 5KT3A 3NY0A 4JI3J 2I5JA 3NAHA 1JLCA 3KUHA 2FLNA 3H5UA 5KFTA 4O23A 1DLOB 2HFVA 2VUGA 2BKOA 3H90A 3LF0A 5CYQA 2HWIA 4ZLJA 2AX1A 4GO7X 4RU9A 5HBMA 5CH7B 2XCPA 2JVRA 1WWHA 4DU7A 2M7SA 1K9MT 3FZ2A 1CULA 2XO6A 4GKKF 3MI7X 3JQJA 3W61A 2WW8A 2Z2ZA 3QYYA 1KWMA 2CQHA 1Q8BA 2VBZA 2KFNA 1WF1A 3PDNA 2AU0A 2PO4A 4GC6A 1B4SA 4ZP9A 4ELTA 2BW2A 3KK2B 2D3UA 4NOHA 3I9V9 2P9CA 2UUCF 2CUYA 1JKHA 1Q4RA 3I5AA 4C11B 4KO0A 5LOQA 2ZH6A 2FJVA 2OPPA 1X4GA 5DGAA 2WVFA 4URGA 4ZVRB 2CPDA 1UA1A 4OI0A 5MAOA 3LPEA 4LFAF 1UVNA 1NEEA 4DQRA 1GK8A 1S1UA 5IT9Y 1WF0A 2AD9A 1ZAVA 2VONA 3LWMA 2D3OR 4R8UA 1QDUB 3D0GE 3UVJB 2OPQB 1VK3A 2B4PA 4JI2J 1SL1A 3N6NA 5GMEA 3CD6S 2AYBA 4OYOA 1KQFB 1RJJA 2I5JB 1JLCB 1OIAA 2L41A 1YJRA 4ETZA 1VRTA 1J5EJ 1H6KX 2G2YA 1ITPA 3CCLS 2HFNA 1GTHA 2MHEA 2R2SA 5CYQB 1XN9A 5L1IA 2A18A 5HBMB 1S6OA 4NEYA 3BZQA 4O3QA 5BR8F 3DLJA 1Y11A 1CULB 2KDOA 2UUTA 4B9NA 2ALYB 4YS2A 1NPRA 5E7OB 3GIMA 4DLGA 3CC4S 4DR4J 2AZ3A 4X84A 1VQMS 2FVPA 2V50A 4X2BA 4RNFA 2XMMA 4DZDA 3DLKA 3D0IE 2YPYA 2ADBA 4UOFA 3ZTOA 2OUGA 3RW7A 1FX2A 4V19X 4WF9Q 2BJ9A 3J80U 3IFEA 2RS2A 3PJ9A 3CDEA 5RUBA 4M95A 3BGUA 1F9FA 1JKHB 4QOTA 2FZGB 3KK1A 4KO0B 1EHWA 2F9JA 3T5JA 2XYPB 2OPPB 2XMVA 3HX9A 1DJ0A 3R6GB 4WFYA 4ZPTR 1TL7A 4QIEA 5M2PA 2J8SA 1XNRJ 1S1UB 1X4HA 1SVDA 1VQPS 1UFWA 4EBCA 4N56A 4ZA1A 2B4OA 4R8UB 1WORA 1RADB 2WONA 3J7AN 3N79A 2K3IA 3M32A 3KLHA 3AY0A 1VI7A 4ECUA 3DRSA 3TW0A 3S8SA 2CAJA 2OJ3A 1VRTB 3UDLA 4RUCA 1T05A 1RHUB 1R31A 2OD6A 5F0UA 2XCAA 1HQEA 5GAEU 4RL1A 3CCQS 3F44A 2AJ1A 5EWFA 1HW9A 2V5HG 3KHHA 2W4CA 1TKDA 3IG1A 3R5GA 1HR0F 2HLTA 4L3KA 1RHQB 1UL3A 1RYSA 3KOAA 3DLKB 3HF5A 2VKRA 4NLUA 1ZTTA 1Q82T 2JEIA 5GAHI 2HQDA 4F26A 3OJSA 4W92B 4LF1A 4WP3A 2QLFB 4K5RA 4ZVGA 4QJVA 2LQ5A 2WZ1A 3OTOJ 1KHWA 1T7PA 5A0YA 1WKJA 4IQXA 1U49A 4MK7A 4AUKA 3W8PA 3MXHP 1XJWB 3KK1B 3NCQA 2DH8A 7FD1A 5D8HB 2MTLA 2DRAA 2FVQA 1IKXB 4LF4F 3D1OA 3ZZZA 2AYGA 4CQ1A 3AODA 3WHIA 1TL7B 4OHVA 4U95A 1KQKA 2Q6BA 3HLUA 2NCKL 5FIIA 3IR6B 1U8WA 2Y9HA 4M5GA 4Y2KA 2QIFA 2Y3YA 4K5SA 2WONB 2YPZA 2FVRA 1HD1A 1NXIA 3M32B 3KLHB 1S6QA 2UUAF 2VF3A 3DRSB 3O2IA 3GG1A 3SMZA 3DN9A 1X0FA 4CNZA 5H1SV 4MIAA 2E5LF 2HWHA 1T05B 2Y8WA 1JLAA 1TQLA 1UA0A 5THWA 1G3OA 1HQEB 1D9FA 1KLMA 4LF5F 1CJTA 1V3RA 4ZVFA 3CMQA 3IG1B 1U2FA 1EP4A 4LFBJ 1ZETA 3PJXA 2XMJA 1K0TA 2BX6A 2DNNA 3OBIA 4Z2XA 3SV4A 2IHR1 5IT4A 3NGSA 5KTQA 2QSWA 2CJKA 3R5BA 5D3GA 4ZPVR 3MUTP 2F65A 2JNJA 3WX4A 3CNQP 5A0YB 3HJVA 1KOHA 1G1XA 2IAJA 3GU0A 4YDXA 1RWXB 2BXJA 2W2QP 2P9EA 3C2PA 3QFHA 4RPFA 3OUYA 3CUNA 1N48A 2Z4PA 4OJ1A 3W5ZA 4O3PA 2EFQA 2EEYA 2ADCA 3MCOA 4KHPJ 4P52A 2I6WA 3H8YA 2RDJA 4GVBA 1M1HA 3BO4A 3ZZTA 1JLEA 4JV5J 3BPSP 2HHPA 1AROP 2QMWA 4WU2A 3RRGA 2XB2D 1T9WA 1RI7A 8ATCB 4K4WA 3UE2A 3OTBA 5D78A 1OYEA 1WI8A 2QG9B 4DFKA 1TMMA 2PA8D 2KN4A 5HSPA 3JSBA 1MW7A 4KR0B 3P3DA 1WG5A 3QGIA 1TMJA 2BKPA 4CRJA 1S6QB 2X1BA 2PMWA 4OV6A 1RDRA 5K8OA 4YHHF 2R42A 1QSLA 2F4VF 3FDSA 4YMEA 2DGQA 4DS4A 4USUA 3N5BA 3QZ8A 3UI3A 1JLAB 1L3KA 2NXJA 1YJWS 5FLXY 3LPYA 1KLMB 1JLQA 4ED8A 1CJTB 4WZQA 1A0OB 4KAIA 2EI5A 1EP4B 4OHXA 1RLDA 2ALZA 4KH1B 3TJ8A 4LF9J 1PC5A 3Q8UA 5CABA 1H3DA 4LF7J 3IR5B 1MMDA 2ROPA 1RP5A 1MN9A 1ZTWA 3H7HB 3FC9A 5D3GB 2D41A 1SUQA 1CBKA 2LA6A 3UW1A 2C28A 1NKEA 2IAJB 4FDFA 4BS2A 4FVCA 3V81A 3IM8A 3OL7A 2O3DA 4HACA 3OUYB 4LF6J 3QSIA 3GCXP 5HANA 3CDBA 2GQQA 1R27B 2JSXA 2XI3A 4F4XA 1YJTA 3FBBA 4GVBB 2WVEA 5KFHA 4JOUA 1JLEB 3QSYB 4ZPBA 1PBAA 4OYMA 5KFLA 4NA3A 1PAUB 5IZHA 3G6VA 3WIVA 1FNMA 4RLEA 1XWLA 1EJ7L 1D3WA 1I5OB 1FVQA 3M05A 3M9MB 4JI6F 2MYFA 1BXNA 3OLAA 4DLEA 4FF2A 2Z30B 3G6ES 3BF4A 3C66A 3QIPA 3D5MA 2CJ9A 3MEEA 3PTWA 2HKEA 4I2PA 1X31C 5IQ6A 3V2UC 1YRXA 4CLYA 1KR4A 3W9JA 2MQQA 2APOA 2YY3A 3SIPB 3VAMA 4ZLPA 2NQPA 2LU1A 1VHIA 1HNVA 1SKWA 3PY8A 4EI2A 1JLQB 1HBOA 1RAGB 2UP1A 4CLPA 3I31A 2PT0A 1RT6A 1BD6A 3IBCB 3HVTA 2BE9B 2J9EA 2MKHA 3TUJC 4ZVOB 2BOPA 1LEOA 2UVVA 3K5LA 4DN0A 2GQCA 4U6PA 5BYQA 3NKYA 2O67A 2MXYA 3JXOA 1SUQB 4M63A 4NMLA 2PEBA 2IPOB 3R2CJ 3DI6A 1HI0P 2XS7A 3V81B 1QVFR 3N6LA 1NJWA 3NP5A 4HACB 4ILRA 3NNAA 2WCXA 2CJXB 3RU0A 3PYDA 3D1QA 1GH8A 1RTHA 2GJIA 1PC4A 3A3NB 1U2CA 1UW9A 3R1LA 2JHEA 2Z2MA 1FD8A 2B8PA 2QMXA 1OPZA 3BKTA 4HDHA 4PG8A 1NSQA 5KFSA 5L1KA 5E33A 5ETTA 5IQQA 4HI2A 2QMUB 2FHOB 2ZHBA 1A6LA 4F4WA 2ZD1A 4X66F 3CJQA 2J6SA 4HTIA 3QIPB 3MEEB 4DL5A 1XMQJ 3PX4A 2VU5A 4I2PB 2YWEA 2CXEA 1SJ1A 1Z2LA 4C8KA 2QRRA 1OPIA 2V94A 3KG0A 2Z2YB 4HTJA 4K2JA 4DFPA 1HNVB 3R5JB 4X64F 4C98A 5E0OA 2E5GA 4ETXA 4JI0J 1KBRA 1HBOB 4LT6A 2IYIA 4YUDA 3GV5B 2ZBCA 5HQLA 3VALA 2BQUA 4ZJOA 4WZMA 1QAXA 1RT6B 1WTBA 3HVTB 1DTQA 2DO4A 2HQFA 4RU2A 2G1HA 1B70B 2D1CA 5HJYA 4PKDB 4ZVPB 2QA2A 1RAAB 4DUZJ 1UEKA 4J9NA 2R8IA 3ZTSA 1SJFA 3EVOA 1VQNS 3DI6B 1FERA 1J2VA 1HIYA 1RU1A 1QUPA 1WEZA 2GS8A 5EGYA 1X4BA 2BRLA 2HNDA 4LR7A 1RTHB 4O44A 3EZ5A 3D67A 3L7PA 3H5XA 2NLWA 2V6AA 4I67A 2CNLB 2WBRA 2FZCB 3SBMA 3Q8PB 4NXNF 1OSDA 4C8YA 1NM2A 4HH1A 5M2UA 1U48A 4LRCA 2RAQA 3NNHA 1YRUA 4IG3A 1TL5A 4QR0A 1K0VA 4HI1A 1VQOS 2X1AA 3FSXA 2Z0GA 2ZD1B 1U7LA 2HPUA 3D4JA 2ROEA 3AJ1A 3IBWA 1FFGB 3DGVA 2K3KA 3RBDA 1GMWD 1U6BA 3SFGA 2XYGB 1VQYA 1PILA 4DR6J 1D9AA 2DGOA 2FHJA 2KT5A 1FNXH 4PQAA 4WPAA 2CG4A 5T41A 1P1TA 2CQ1A 5KFWA 2LYVA 3VTIA 3W7BA 2M2BA 2BV3A 4DR1F 4DPXA 1N52B 3BR9A 2Z2LA 1DTQB 3ILJA 3J80Y 4C4WA 4CDIA 3PCOB 4FVMA 1EIYB 1R8BA 2GZOA 4UOGA 4X62J 5J1EA 3TAPA 4MYTA 2VPYB 3VR1A 4UW2A 2LEAA 3FFIA 4O3SA 3M8YA 1RK8A 3DLLQ 1WG4A 2Z58B 2DT9A 1VBZA 4Q0BA 3V5RA 2HNDB 4B02A 2LQBA 4O44B 3QLHA 1V6HA 3CO0P 4A48A 4CLFA 2JC1A 3MOJB 2XEXA 3MR3A 3I56S 4J9MA 1TVRA 2HS3A 2J7WA 9RUBA 2MSSA 3P5TL 3LWLA 3THTA 2DNLA 4C0OC 4NRUA 4F04B 3QRQA 3I9ZA 4ED2A 3DXBA 4OQJA 2H9ZA 1PIEA 5B0FA 4IG3B 1S0MA 1HNWJ 2GX8A 2DBBA 3HVRA 2CQCA 1UETA 2KYZA 3E01A 1G6BA 4X65F 3NAIA 2OAUA 2XZDB 4DSIA 4LQ3A 3ZZOA 2MZSA 4ED4A 3M8SA 2ASYA 5I42A 3BSCA 5HVFA 4J37A 4M5HA 2O1PA 2XO7A 4TU8A 4OMFG 4WTYA 3EX7B 2RH3A 2U1AA 4PWWA 4WFZA 3W63A 3KHGA 1WDDA 3CCZA 5K9FA 4OJHA 1F1BB 4ZDNA 5L46A 1FEEA 2F4FA 1WC4A 1KN6A 2HGLA 1RBLA 3KHRA 2LQJA 4F2SA 4YB1P 2VA2A 1FJCA 3FEXB 2YKOA 1DQAA 4AXIA 2BM0A 1VLOA 3I82A 5J1EB 4YY3F 2BZ2A 3EMTA 4AQYJ 4RJVA 2RILA 3FFIB 5KG2A 3T6JA 3NG8A 2YWFA 3B54A 5IWAF 3GV7B 3PEJA 1XQIA 4Q0BB 1WJ9A 2XSFA 1R0CB 2B9XA 5KFNA 3QLHB 2AJ4A 4M8LA 1WHYA 2E5IA 1TVRB 4RW7A 1YLXA 2PMZD 5DM6Q 2V8PA 2DKOB 4W4MA 1YSJA 2W1BA 5AJ3J 4FKYA 2OMLA 2VD3A 3OL6A 1SC3B 4Y34A 2P6TA 2HFOA 3DRPA 4G65A 2DNMA 1MWQA 1SB6A 3EZOA 1DARA 4HVZA 3D3CJ 3KNGA 2D3O1 1S1TA 3UD5A 2OMOA 3IN5A 2ZZMA 1S0VA 1RAJA 4F4YA 4Q8EA 3E01B 4PAAA 3DDIA 2HFSA 2NXUA 1GMVA 5I42B 3CCJS 5KFAA 3TR5A 1SPBP 3KJQB 2F8HA 5ETMA 3RBEA 3EGNA 1FKOA 2Q3PA 1GTEA 3E3XA 4F7VA 4OZNA 4C48A 2G0CA 2YX4A 4CH7A 2M88A 4I4BA 2HZAA 3CE8A 2ZJRQ 2NZ4A 2CQ3A 4PG6A 4B3MF 1RKIA 4OHZA 4PYDA 1CJVA 3RJMB 3M2VA 1CQNA 4TYAA 2ZM6J 3G6XA 1WD6A 1F2HA 2DNHA 2NXNA 2CQPA 1UPPA 1T3OA 4NX9A 4C9DA 3O3LA 2AJQA 2B7CB 2X3DA 5LM7E 3TX8A 1RT5A 4PXBA 2CIMA 4RW7B 1UEVA 2V34A 1T94A 2UXDF 3CCMS 2HHHJ 2BM1A 8RUCA 4OX6A 4TKTA 4F4KA 2IMWP 2KRRA 2C3MA 1FCAA 3DRPB 1AFJA 3Q86A 3OVBA 3SCIE 3W64A 1CC7A 2VJVA 4LBHA 1TELA 1U8SA 5IM0A 1S1TB 2RRAA 4DG1A 2DH7A 1L3VA 1FRMA 1PJ6A 4FS1A 2IDLA 3HSZA 4A47A 4U67Q 2VQFJ 4HDGA 1OQ6A 2VICA 3FKBA 5DLGA 3TA1A 4YB6A 1SXLA 1FF2A 1U1OA 2RDDA 4LVOP 4WKRA 4DPTA 3Q8VA 3W65A 3BQ2A 3RG6A 3BPDA 4X4RA 2RD5C 1A9NB 1N32J 2WRMA 5F8LA 2QA1A 1FKOB 3PFEA 4RBUA 5E2QA 4K4UA 3UPFA 1TFWA 4A8KA 1NSAA 3R9LA 2JLFA 1N34J 3MFHA 1S5ZA 2DNPA 4KYZA 1VLYA 2FYXA 3HKWA 1CJVB 3M2VB 2BACA 3LGMA 3ZZRA 5DETA 2R8JA 1HHTP 3AB2B 1HWIA 3JTOA 4JI4F 1YIJS 3N28A 3AJ2A 1UZDA 3LOUA 1RT5B 1QTNB 5A8WA 1LNQA 4NASA 1TK0A 2DNGA 2V2ZA 3UDCA 4F8RA 4ED6A 3M2RA 3OT9A 3JB9k 1N6QA 3GMGA 3FK4A 2DK2A 2E5HA 5GAGI 3BSOA 3EZUA 2FUG9 1UKUA 4DHVA 5KG0A 4EGLA 3I0SA 1SQFA 3K5PA 5B09A 2XLJA 5HL7Q 2L48A 3VQTA 3NL0A 2KM8B 5IM0B 1F5CA 2VBYA 3A12A 1JJ2R 2RNEA 3F73A 4DG1B 2IM3A 4JI3F 4B3OA 1TKXA 4Z7YA 3V6JA 1BUXA 3EICA 4UY85 3MM6A 2I9SA 2KO1A 4FPRA 1ZPVA 4KGVB 1G4CA 4UUWA 1NJXA 5ITHA 2AMCB 2FHMA 2YKNA 4TQRA 1S76D 3QO9A 5CHCB 1KTVA 2XQCA 3Q22A 4LUBA 1FTCA 1B64A 3OLBA 3H2UB 3ENVA 1FJ7A 1HQ2A 2CQBA 1UVLA 3OTCA 4DSKA 2FD2A 1FESA 2R7WA 2HRTA 4OZ1A 1UJ4A 1LWCA 2ZVSA 4ZN3A 4PABA 5HQ8A 2QL5B 2J9DE 4OHWA 2IMOA 3PW4A 3W62A 4OYWA 4GRSA 2B0GA 4YEAA 1SKUB 5L8RC 3M6VA 3IMQJ 2W7AA 2RQMA 4DU8A 3BO3A 2DD8S 3P8BB 3CT9A 1RABB 5B0CA 3Q2SC 2UUBF 4NLOA 3CJRA 2NSBA 5A8WB 4ITSA 4O3OA 4DL0C 4ZVSB 2X1FA 4HH0A 3GWCA 3M2RB 3KG4A 1LXJA 5MLCV 1N6QB 2KI2A 2QA4G 1HBNA 5JUMA 2MPUA 4K0KF 1A7GE 5CYMA 3I0SB 1WC5A 4QYZK 3TEGA 1Q16B 4MIWA 2QC3A 1TZ0A 3PG9A 4ED3A 2H4WB 4IDKA 2DCLA 3HD2A 4A8FA 1YJVA 4DV5J 4B3OB 1TKXB 1HNZF 4DUYF 4JYAJ 3AAWB 3MM6B 4IRKA 2ZZTA 1CLFA 4HLBA 3VAKA 4Y6IA 1HMVA 3MF5A 1WDTA 1Y10A 1EKSA 4C0BA 1VJWA 4B9MA 2YKNB 1LK5A 1M0SA 4KIAA 3QO9B 3G86A 4PQUA 3NWRA 5AXKA 4LSLA 3NCPA 3HFKA 3J7ZT 3EGZA 3T1AA 3KXDA 4AE5A 2Y1IA 2M4MA 3H98A 3DC2A 3JQMA 1YVFA 1UW4A 1FX4A 4ECTA 4PUOA 1WC6A 2E9TA 3NBPA 1P27B 3D6HB 3U1NA 1LWCB 3K57A 3OPKA 4MFBA 1HI8A 3IBFB 4JI7J 2PD1A 5HMXA 3MDFA 2UU9F 2X7IA 4PXCA 4DWIA 1U4BA 3BSNA 2CZ9A 2AIRB 3PVXA 5EN1A 3OJUA 2XWXA 2MLXA 3AOAA 3Q23A 2OH2A 1P8GA 2VDHA 3LP0A 4PXDA 4F25A 2GNKA 3LANA 2BJDA 4DV0J 2HG4A 4I0WA 3G71S 3PKYA 1PKUA 1HBNB 3HSJA 4CM2A 1KLNA 1K47A 5CYMB 2G2OA 4DCPB 4U96A 2J0WA 1EETA 2MZRA 5B0DA 4EO6A 4AYBD 2YNFA 5HK4A 2B4UA 1R8CA 3T5KA 4IDKB 4ENOA 2H54B 1RB0A 1N36F 3ILLA 4QWDA 1R6VA 1U6ZA 4ALZA 3THVA 2ACYA 3TUIC 1U1MA 2ZH1A 1HMVB 2R9LA 5KFXA 3H2VE 2CFXA 4CLKA 3FUYA 3KLFA 3D9BA 2LEPA 1X5SA 2FGCA 2IIHA 2RDIA 1EZZB 1PCAA 4PQUB 2WVDA 3OFFA 4LSLB 3M1VA 3BH7B 5AXLA 2OSQA 2LECA 2C2RA 4PUOB 1AYEA 5L9NA 1T95A 2OEJA 3NBPB 3BYPA 4MFBB 1M5HA 2W7PA 2ZEJA 4Q2MA 3GR0A 3OTOF 1TP7A 4DV7F 1K8AT 1N54B 2KL8A 1AW0A 1K44A 3H4DA 4FKXA 2OEKA 3L7OA 3FMBA 4FF4A 2HW3A 4PXEA 2J0XA 2VH7A 2F9DA 1WOOA 3LP0B 4EYIB 5CAAA 3TZXA 2ILYA 3CMES 3Q8QB 1ZAXA 2D9PA 2XMTA 3V6HA 1DAXA 3PR5B 1P1LA 1QAIA 2FVSA 3NCRA 1M5KC 1CSJA 4NXMF 4OZ0A 5F0WA 1TKZA 3OR1A 3CO9A 3FEZA 1FJGJ 1EETB 2YNFB 4B08A 1HBUA 2KJVA 2MQ8A 3MMBA 1ZOTA 4DV1J 1F5AA 1V5IB 1VGYA 1IWGA 2YH0A 4GMKA 4DZ6A 4QU6A 3SZ2A 1H7XA 3C3LA 1X9WA 2LQ9A 3QBCA 2JL9A 5L39A 3KLFB 2RUGA 1NDLA 1CJUA 4FN5A 3GSDA 3GTYX 4M5MA 2YH1A 2UZAA 3D3BJ 3M1VB 5GADU 3D6MB 1MROA 1FRKA 1U02A 2ZBPA 3I6PA 4JI8J 2E9RX 1H73A 1RT2A 3T1YF 1JB0C 2A2CA 3N01A 4ZS6A 3C15A 4K59A 2FQQB 4LRFA 4K4XA 3QAEA
chains in the Genus database with same CATH topology
3SYZA 4DR6F 3TUZC 3PIOQ 1D9FA 1KLMA 1RT1B 5KOXA 3DU5A 3R27A 4LF5F 3MM8B 3OVAA 1V3RA 4ZVFA 5L9XA 2WHOA 1Z4UA 2KM8C 3IG1B 2W7OA 3CDAA 2HIQA 4L3NA 3HM9A 1U2FA 1NZAA 1EP4A 3Q0AA 1ZETA 1H98A 4N76A 3PJXA 5KT2A 2XMJA 2MSTA 1VMBA 1X4FA 3FGVA 3IRXB 5DDPC 1Q7LB 1M90T 5KT5A 3C6UA 1WF2A 4G3IA 2E1MC 4RNNA 1K0TA 2YWGA 3SCKE 1HA1A 3L09A 2DNNA 3OBIA 1LOUA 3R5AA 4Z2XA 3SV4A 2HNZB 2P9GA 2IHR1 5IT4A 1SV5A 2FB0A 4ZCIA 1HYSA 4RW6A 4P2SA 3QZ7A 4IRDA 5KTQA 1BQNA 2QSWA 3SQGA 4CIOA 5J2QA 2CJKA 3R5BA 1GX5A 2MKJA 3PRDA 5KFPA 5D3GA 3J7A1 4ZPVR 1HFEL 4J9LA 3MUTP 3HP6A 3DHWC 3WX4A 4R5PA 3I87A 1FVSA 2WBMA 3KK3A 2OTLS 1RISA 1XR6A 5A0YB 1KOHA 4IRCA 1G1XA 3RAXA 2IAJA 1I1GA 2LXIA 4X62F 4YDXA 1REVA 1C2PA 3H40A 2BXJA 5K5MA 4L6V3 2P9EA 2UVUA 3C2PA 1W25A 3PX6A 2Q79A 3OSNA 3OUYA 3CUNA 1ZM3A 1HWUA 1N48A 2Q43A 2CJAA 2OD4A 2MKSA 2Z4PA 2GC8A 4OJ1A 3MEKA 3A8EA 2CZVC 2Q66A 4XIUA 2FJAB 4B9LA 4O3PA 2EFQA 1X5TA 5CZVA 2BQRA 2JFDA 2VBXA 4QWAA 1FNOA 2ADCA 1UEUA 4H4KA 1WELA 1TKZB 4YB7A 4USIA 3OR1B 2LEBA 3H8YA 2RDJA 1RA7A 1XEZA 2CJBA 1I6JA 4CH0S 3O5TB 1X5OA 3BO4A 3ZZTA 1JLEA 2CRLA 2I8EA 1D1UA 2HHPA 3ISNC 3VAHA 1SH0A 1HBUB 1AROP 4I68A 1UVKA 3OV7A 4HHJA 2QMWA 4WU2A 3Q8SB 3RRGA 2GA7A 2XB2D 1RI7A 1UWBB 3UCGA 2EK6A 4K4WA 5AE1A 4ICLB 4K4TA 5LMNF 3MMBB 4C2MA 2UVRA 1RT3A 3DLGA 1VQ4S 3UE2A 3OTBA 5D78A 1YI2S 1WI8A 1FT8A 4DFKA 2QLWA 4TY8A 2ZKUA 2XY6A 3TVZA 2PA8D 2KN4A 3UNGC 1VHFA 1NKCA 2DNRA 3JSBA 4ECZA 3F41A 4C8NA 4XO0A 1DZ5A 1MW7A 2MZQA 4Y2IA 1KRPA 4KR0B 4PWDB 3P3DA 1WG5A 4URSA 3QGIA 2HS0A 3BM7A 4B9UA 5HLFB 5D4NA 1S6QB 1RWUA 2X1BA 3JTPA 1RDRA 1LWEB 5K8OA 3DOKB 4X4OA 2VFRA 1HI1A 3MOZA 4YHHF 1Q8IA 1LW0A 2QE5A 4Q45A 2EG1A 3WZ0A 1M5PC 2CPYA 1T03A 1YJ9S 1HNWF 1QSLA 4NLVA 2ZH5A 2ZZNA 1MROB 2DTJA 4YB5A 4CT9A 2F4VF 4DL6A 3NMAA 3X1LB 4IR9A 3D1HA 3FDSA 5GAEI 2KU7A 4YMEA 4FBTA 2DGQA 3QJJA 2MQPA 1RT2B 2C42A 3A1YG 4DS4A 4B9TA 3FNNA 3N5BA 4NLPA 3QZ8A 2FDNA 3UI3A 1JLAB 3RRHA 3PW5A 1L3KA 1C4AA 1CC8A 4NCBA 1YJWS 3SSSA 1DHMA 1H7WA 1X0PA 4LVNP 3LPYA 5FLXY 3HVWA 1S10A 3RAQA 1KLMB 2XS5A 4ED7A 2DCUB 2UV8A 4V19J 2C3UA 2BRKA 1R8HA 1JLQA 4ED8A 1WI6A 4RNMA 5HP1A 4WZQA 1OSCA 3R3TA 2XNQA 3UCZP 3MD3A 4KAIA 2BR0A 2CPXA 2E7XA 1UP1A 2E9ZA 4OZJA 4MKYA 2EI5A 1EP4B 1JX4A 4OHXA 4KT0C 1FHTA 2R7UA 2CQGA 1T3NA 2ALZA 2CPFA 2DGSA 5A6WA 3VWSA 1PC5A 5H9FJ 2C2DA 2AJ0A 1H3DA 3C6UB 3IR5B 1MMDA 3OFGA 3ZFVA 2ROPA 2ZC4A 3OL9A 1RP5A 4EBDA 4PPZA 4LF6F 2IM1A 5CQGA 5KOWA 1VBXA 2V8HA 1ZTWA 4ZP7A 2BDPA 2FPHX 1SV5B 2MQNA 1HYSB 4RW6B 3K57A 1BQNB 3SQGB 5J2QB 5IFMA 2KFYA 3US5A 1Y00A 4TXSA 5F41A 5I4MA 5D3GB 2XNRA 2D41A 3C46A 1APSA 4K4YA 1SUQA 4NZ0A 4O0IA 2LA6A 4R5PB 2IJNA 1FRJA 3EXCX 4DX8H 3M6UA 3THPA 3KK3B 5DDQC 3UW1A 3HXMA 2C28A 1KFDA 1SIZA 3LUYA 2ZE2A 1NKEA 1N0VC 2IAJB 3SCLE 3OHAA 4BS2A 4FVCA 2R7RA 3V81A 2RRNA 1Q1KA 1REVB 2VA3A 1R7IA 3OL7A 2O3DA 3QWUA 2R7TA 3OUYB 4DL7A 2RRBA 4Y3CA 3MUMP 1FXRA 3W3SA 1IBMF 5K8NA 3CDBA 2P6SA 2GQQA 4NCGA 1R27B 2JSXA 4O3RA 2DNZA 4RUHA 2CPZA 2BANA 4IG0A 4RW9A 4D3HA 2XI3A 4KGKA 2N4CA 2J7UA 4F4XA 1YJTA 4FBUA 2W24A 4NLXA 1W2BR 1S97A 3GFXA 1TAQA 2LKZA 5KFHA 4JOUA 1JLEB 4ZPBA 5T14A 1D8YA 3RB0A 4IOAQ 3TA2A 5KFLA 4URQU 3MTKA 4NA3A 3HK2A 3BQ0A 2CPEA 3MHYA 3HPOA 2DHSA 2QZ8A 5IZHA 3G6VA 1FNMA 2KHDA 4OI2A 1RT3B 2A1BA 3DLGB 1YGYA 4RLEA 2FTRA 2RSQA 1NK0A 1XWLA 2CQ0A 5AXMA 5CCLA 1N5VA 3RB4A 1D3WA 2UXBF 4TY8B 4DJBA 1FVQA 3M05A 3M9MB 3RB6A 4CNYA 4JI6F 1V3SA 1Q7YT 2ZJQQ 4OX8A 2MYFA 4UY8T 4ECQA 3PO5A 1R0AA 1G7CB 4QIVA 3QPIA 5AJ3F 2MQOA 4WYLA 2RU9A 4KTQA 4DV3F 1TR0A 3OLAA 3NLCA 2RIJA 4TU9A 1N5TA 1OQ3A 2BVZA 4BWJA 4E8UA 4DLEA 2RT3A 4OZ5A 3H20A 1TAUA 4ZPCA 5F8HA 4FF2A 5GADI 2XLKA 1ZAWA 3CD7A 5J2NA 1S49A 4CH1A 1QJHA 3BF4A 3AA9A 3G6ES 3C66A 4N8NA 3FZBA 3QIPA 3D5MA 2CJ9A 3MEEA 5LJ3Y 3PR4A 3PRBA 4F67A 2DIVA 2L9WA 1LW0B 4I2PA 5KFOA 5DQIA 5IQ6A 1T03B 3V2UC 1LK7A 1Y3KA 4B9VA 2MKKA 5BYSA 1YRXA 4EZ6A 4BDPA 4CO2A 1LQ9A 4O4RA 2OIHA 3I5CA 2J5AA 1KR4A 3VF0B 1WHWA 4JI5F 2MQQA 2APOA 1VC0A 1S77D 4FZVA 5B7WA 4N5SA 2CQDA 4ZP8A 3AQOA 1H38A 5KFUA 2OFGX 3O1LA 2YY3A 5L1LA 4CCHA 3MR2A 2L08A 5KFYA 1WHVA 2F7VA 4ZLPA 3VAMA 2NQPA 2RB7A 2LU1A 5KAKA 1XMOF 3RW6A 4F4ZA 1N88A 1HNVA 2F8EX 1FDAA 3IO1A 1SKWA 2J6TA 2HVIA 1TKTA 4DL4A 3PY8A 1BGXT 4X4VA 4LFCF 3V6DA 1JLQB 1JXEA 5HP1B 2RE1A 3ZZUA 4X4NA 1HBOA 1JLGA 2AGQA 2UP1A 1KNZA 2ROGA 3I31A 2HZCA 2R8HA 1SKSA 1S7HA 2PT0A 5EX0A 1RT6A 6FD1A 1VC6A 2KYXA 2B5JA 1BD6A 4DL2A 4DR7F 3HVTA 4YDDB 2NSCA 4DQQA 1XMBA 2J9EA 2MKHA 2X51A 3P6YC 3TUJC 2BOPA 2XHWA 4M5DA 1KVJA 2GIQA 2UVVA 3K5LA 3EXYA 1D9DA 4DN0A 2GQCA 1HARA 4U6PA 4TYBA 4X4UA 1YJNS 3MPVA 1IQZA 5BYQA 1FDBA 3NKYA 2O67A 4JV2A 2C3OA 2MXYA 1TL3A 4IO1A 1SUQB 2I1RA 1IBLF 1DURA 1S6PA 2MQLA 4M63A 2FJDB 5CYJA 2AGPA 1JNZB 3MEDA 4NMLA 2EKYA 3HHLA 3JSRA 4KKOA 1E6YA 2ZE2B 2VPXB 2N4DA 3DI6A 4EO8A 5EHHA 4BC7A 2Y1RI 3V81B 1HI0P 2XS7A 1QVFR 3GG0A 2R4FA 1H2VZ 3N6LA 1NJWA 2R8KA 3G9CA 3NP5A 2CVEA 4ILRA 2QT7A 3NNAA 3CVKA 1TL1A 1NRKA 5DJBA 4Y65A 2WCXA 2EFNA 1VQ5S 4YOEA 4QIGA 3RU0A 4Y2AA 2ZM6F 1KD1T 3EGWB 1X4CA 4NCGB 3D1QA 1GH8A 1RTHA 4RNOA 2KJWA 2GJIA 2GFFA 2BANB 4IG0B 4RW9B 2V4RA 3I4PA 2W9AA 5LSLA 2AYMA 1PC4A 1FRXA 3FCHA 2YKPA 3O8WA 1NK8A 4GO5X 1NH7A 1NNDA 3R1LA 4DV4F 3GYNA 1PGZA 3PKMA 1L5UA 2JHEA 1WEYA 2HHTA 2I2YA 1KHVA 2Z2MA 1FD8A 1HWKA 2ZH8A 4B17A 1ZH5A 2DNKA 2KXHA 1VQ8S 2W8KA 5AXNA 1X4EA 4YQWA 1F60B 2QMXA 3SSQA 2DISA 1OPZA 5K8MA 4HDHA 1FXLA 1UJ6A 1SIWB 4AFFA 2XZWA 4PG8A 2JEJA 5KFSA 5L1KA 4HEA9 4PCQA 5B0AA 5HMWA 5E33A 1NJIT 3PW2A 5IQQA 2YTCA 2YKAA 4ZPAA 2IVFB 3RB3A 4HI2A 1QSYA 4JBCA 1R0AB 3CIMA 2FHOB 2ZHBA 3CJ2A 2MJUA 2WSEC 4HYKA 5KFDA 3K5NA 4Q44A 2E29A 4LF8F 1A6LA 3ULHA 4F4WA 2BABA 2YX1A 2ZD1A 4X66F 4WFAQ 4BCAA 5B0EA 3I0RA 5BJRA 4C8LA 1Y7PA 2X1GA 3S01A 4J9KA 2J6SA 5J2NB 3EPIA 1LV5A 1QAYA 3QGHA 3QAUA 2BE2A 4HTIA 3QIPB 3I32A 3MEEB 3H5YA 4DL5A 1RT7A 1R8PA 2ZHOA 4KQZA 3PX4A 1GAOA 2VV5A 4I2PB 1F0XA 1PSDA 2YWEA 2G13A 2F3JA 2GIRA 3M2UA 1SJ1A 4KHMA 4N77A 4LQ9A 5EWGA 1Z2LA 1N4LA 4C8KA 4WFNQ 1NH8A 2LLZA 4A8WA 5K14A 2PI4A 5CD4H 2QRRA 2MJNA 3VZHA 1OPIA 2V94A 2VB6A 1N5QA 3KG0A 4HTJA 3DLEA 4DFPA 2GV1A 3T6BA 3B4MA 2VQFF 1YHQS 3KMSA 1QM9A 3LGNA 2A10A 3M9OB 4QYRA 1R89A 3H5SA 2XS2A 3Q2TC 1AFIA 2AF6A 2ZH2A 4RWXA 3BN7A 1KS2A 1VQLS 3ETOA 1TUVA 4MK9A 1HNVB 2CVIA 2W9BA 4R0JA 1KVIA 1TKTB 2V8VA 4X64F 2HAIA 4UQTA 2MZ1A 4G1PA 4DUZF 4C98A 3V6DB 5IXUA 5E0OA 4LSNA 4B3SF 2E5GA 4ETXA 2AYEA 1HBOB 1OO0B 1JLGB 4LT6A 4EBEA 2IYIA 1YITS 3TVKA 4YUDA 4GKJF 2B9YA 1SJRA 3MM7A 3GV5B 4FXWA 2ZBCA 3FRYA 1S1WA 2EVZA 3VALA 2V4JA 2JC0A 4NLYA 2BQUA 1X4AA 2JZ5A 4CZCA 1QAXA 4WZMA 1RT6B 1WTBA 3IWNC 2QLXA 3D2WA 3O44A 1ZM2A 1U1NA 2B5JB 2YKMA 3HVTB 1N32F 1DTQA 2DO4A 2EC0A 1XERA 1TFYA 4A8SA 4RU2A 2D1CA 3NGKA 4EU0A 3G8SA 2IFXA 4M5DB 5E3QA 3IGNA 4PKDB 1FTRA 2VKZG 4C8MA 2QA2A 3DYAA 4J9NA 3PW7A 1TL3B 4CT8A 3BGRB 1JLFA 2OPRA 2R8IA 1S6PB 4DQSA 4I69A 2ASDA 4K50A 3O6QA 3CPWR 3CXCR 1KOOA 3MEDB 1SJFA 4MTPA 1N34F 2YKQA 3HHLB 3T5HA 4KKOB 1VQNS 1E6YB 4Y00A 3ZZPA 4OV1A 3SSRA 3OL8A 1MWZA 3DI6B 1HNIA 4WIIA 1FERA 3EYZA 1J2VA 4ES2A 1JMTA 5KFBA 4ID5A 2ZC3A 2J0QD 2M5YA 2HHWA 1YJUA 2J7KA 1TL1B 1QUPA 1WEZA 2GJ2A 2PDAA 4DSJA 4Q43A 5EGYA 5L1JA 1X4BA 3D0HE 5KG5A 2BRLA 3MEGA 1N5YA 1HQUA 4QR1A 2HHXA 2DO0A 2HNDA 2FIUA 5D4LA 3PXGa 2PI5A 1RTHB 3ICLA 4O44A 2OPSA 3GV8B 5KG4A 3EZ5A 3DXSX 3L7PA 3H5XA 4DBQA 2NLWA 4N47A 2M3DA 1NKBA 3KLIA 4RX6A 2RVJA 4F02A 4I67A 1NU4A 3CIZA 2XMWA 2GCFA 2Q6CA 2VG5A 2WBRA 1Q79A 1JIHA 1YBAA 4EFAC 1U47A 3MMCA 2MGZA 3GE9A 3Q8PB 4J9RA 1DQ9A 4NXNF 4ZCLA 2C3YA 4MK8A 4FF1A 1OSDA 2KT3A 4C8YA 1YWXA 3TOQA 2DGUA 2XY7A 4HH1A 1QUVA 5A2QY 4NL5A 5M2UA 2JFKA 4DOZA 1U48A 1X5PA 3NNHA 4NWBA 1YRUA 5J2MA 4Q5VA 2GO9A 3GIJA 4IR1A 4IG3A