5CH7B

Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
329
structure length
329
Chain Sequence
MKAPRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLGYPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRPSPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYKREQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQGVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNVFYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREKKMKGLASDLMDVLIGRRSTDMMISPLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DMSO reductase family type II enzyme, molybdopterin subunit
publication title Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
pubmed doi rcsb
total genus 86
structure length 329
sequence length 329
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2015-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13247 Fer4_11 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ch7B00
2XSJB 1GT8A 1F5BA 4OMFG 1KEKA 1JB0C 3OR2A 2V2KA 3MM6B 1FTCA 2XSJA 2C3MA 2VPWB 6FD1A 1FRMA 2GMHA 4DHVA 3OR1B 1KQFB 1VJWA 2GMJA 1H0HB 2WB1D 2C3PA 3MM6A 2FJAB 3PNIA 1FXDA 1ROFA 2C42A 1SIZA 1C4CA 3MM7A 1FRXA 1Y4ZB 3MMAA 1FRJA 1FRLA 3MMCB 1A6LA 3MM8B 1FCAA 1HFEL 2ZVSA 5L8RC 1CLFA 5FD1A 4AYBD 2WSFC 1C4AA 1GAOA 1GTEA 4XDCA 5BYSA 4Y28C 5BYRA 2FGOA 3MMBB 3IR7B 5BYQA 1R27B 2VKRA 1WTFA 1AXQA 1B0TA 3MMBA 1FD2A 1H7WA 3MM5B 1FDNA 3OR1A 2Y0SD 2VPYB 2IVFB 1F5CA 1Y5LB 3GYXB 4L6V3 1KQGB 1G6BA 1DAXA 2FDNA 2V4JB 2C3YA 1FERA 1B0VA 3MM5A 3MM9B 5CHCB 4XK8C 2FD2A 4OV1A 1FDBA 1JNZB 1GTHA 3MMCA 3EUNA 1PC4A 2FJEB 3MM8A 2FJBB 7FD1A 1BWEA 1Y5NB 2O01C 1FDDA 3LW5C 4YDDB 1K0TA 1DFDA 4XDDA 2FJDB 2PMZD 1BQXA 2WAQD 2UZAA 4RKUC 1B0PA 3EXYA 1IR0A 4ID8A 1G3OA 2C3UA 1SJ1A 1BD6A 2WSCC 1Y5IB 1FF2A 1FRIA 3HKZD 3IR5B 1FRKA 1JNRB 1PC5A 2Z8QA 5CH7B 1F2GA 1BC6A 1FEHA 2WSEC 7FDRA 1D3WA 1IQZA 1FXRA 2VPXB 2VPZB 1DURA 5E7OB 2V4JA 3MM7B 1FRHA 3MMAB 3MM9A 2PA8D 1BLUA 1Q16B 1RGVA 3C8YA 4KT0C 1XERA 1FDAA 2C3OA 3IR6B 3OR2B 4CI0B 1H7XA 1H98A 1SIWB 2PDAA 3EGWB 6FDRA
chains in the Genus database with same CATH superfamily
3ZTSA 2XY5A 5BJRA 2KFYA 1X4FA 3GJSB 1SCJB 1N36F 2DRBA 1RT3B 2V2VA 3JYTA 4JP8A 3BKTA 1I5OB 3MPYA 4M63A 1TUGB 1FCAA 3OUYA 2P9GA 3PZPA 3GG0A 1WUUA 4CLUA 3TO8A 4JI8J 2F40A 1D9DA 4RPFA 1LW2A 1H2TZ 2QLFB 5CHCB 3FCWA 4YS2A 3OSNA 5IM0B 1R0BG 1HWUA 2GO9A 4PXCA 4ICLA 2C3UA 3B6BA 1U2FA 4YN3B 1ACMB 1DURA 1OY6A 2KFNA 1XEZA 3FMWA 3CCRS 1B7FA 2OO4A 1YI2S 2J9DA 2OEKA 5LOQA 1X60A 5IOLA 2N3OA 4IH6A 4CM2A 4PEOA 1R0AB 3W9IA 1YDLA 3G6VA 2ZOMA 5GMEA 5D6GA 4NCGA 4YMEA 2HAIA 1FRLA 1U25A 2M88A 3EPIA 2E1MC 4J9NA 1JLAA 1MROA 4DSLA 3KK3A 1WHWA 2DY9A 1A0OB 1U0HB 4P2FA 3TP2A 4KHRA 4DQSA 3OJSA 3NAHA 9ATCB 2XO6A 3LPYA 1CULA 4YEAA 4E98A 3FBBA 5JUMA 1HBUB 1JNZB 1VRTA 4PPZA 1NSQA 4ZVTB 3L7OA 3M4XA 1IKVB 1IQTA 1T3NA 4OZ2A 1RTJB 4LF8F 3RG6A 3EDQB 3M6XA 4HHUA 5J1EB 3R1HA 3UQSA 1FFSB 3I0RA 5ADZA 1IWGA 2WTFA 2G13A 4IG0B 2ATCB 3GFXA 3RBDA 4M5GA 2DNMA 4OYBA 4DSJA 4ZHRB 2MKHA 4Z7YA 1N5YB 4HYKA 5D4PA 4CDIA 1XNQF 3Q8QB 3QATA 3C66A 2KT2A 1S10A 2WBRA 1SIZA 2F9JA 5C2CA 1Y00A 1RT7B 1PSDA 3PJXA 4V19J 1O0PA 1HKAA 1URNA 5AE1A 1VI7A 4R8UB 3T1AA 4M5KA 5KOWA 4ZLNA 2AYGA 1M5HA 2UU9F 3DC2A 3IGVA 1S0NA 4CH1A 4WP9A 2VQEJ 3CCVS 3OHAA 3BDEA 2XI3A 4N56A 2HFOA 1FNMA 2XS2A 1YKWA 3FSXA 3OL8A 2V8GA 4FN5A 5LJ5Y 1HBNB 5D0EA 1WC5A 1FDDA 3VALA 5CA5A 2GIRA 1WSVA 5F3TA 2KG1A 3UD3P 2M70A 3R6GB 5KFGA 1U1MA 1V6HA 1R8BA 4X4UA 2V4JA 4RR5A 3D7SB 3HD2A 2JVRA 4I64A 4NX9A 3J80U 2HRYA 4HT7A 3LQVA 1BQMA 4DPTA 3OXGA 3TARA 2OFGX 2GMHA 2QA2A 1E6VB 1QVFR 3HVTB 2XNQA 2D1CA 1Y4ZB 4EI2A 2JDJA 1NB2A 4H4KC 5KT2A 3EXCX 1VIOA 1GNKA 2QRRA 3V6DA 4NCBA 4PWWA 4O3NA 3RBZA 4DUYF 3PX6A 2GCFA 1YTYA 3MEGB 4HI1A 1RT3A 3KHGA 2WVBA 2J7KA 2AP6A 1N8RT 2BACA 2HHQA 3WC0A 4P7TA 3QT7A 3M8WA 2FHMA 4CO1A 4ED7A 1RZMA 4E2FB 1RWOB 1Q78A 2CKWA 1LWFA 2GMLA 1K73T 2ZM6J 1IBMF 2MKKA 2P6SA 3D5MA 3O6QA 4X65J 4NOHA 1N4LA 1JLGB 4F7VA 2KHCA 4CIOA 1TUVA 4F4YA 3QGIA 5IM0A 4PCQA 2RUGA 2GIQA 3MR7A 3MPWA 5DLGA 2DY1A 2PI4A 1FRMA 2BA9A 4A8MP 3AT1B 3D4JA 2ZDPA 2Q6BA 5A2QY 3LWLA 3W2VA 4DV6J 3CO9A 3KHLA 1SI9A 5F3ZA 3PW4A 1FT8A 4DQPA 3D2WA 1Y10A 1R0AA 5K14B 3HO1A 4Q2LA 3A13A 2Z2MA 4JBCA 4BS2A 3S7RA 2N7YA 3AB2B 4K0KF 2ASLA 3ICLA 4LF6J 4LF4J 5KFVA 3ZFVA 3VAGA 1V5VA 4BCAA 2MY8A 1N6QB 3KMSA 5CYMB 4CO2A 3DI6B 5LT5A 2AGOA 3QGPA 2J0QD 1RAEB 3LP0B 3UE2A 5KTQA 3IR5B 2KB2A 2HNYA 1D3WA 1S79A 4N8NA 1IKYB 1M90T 1LWXA 2BJ8A 3MMAB 2QX0A 1HBUA 5HVHA 5D0HA 3D0HE 4PABA 5G4DA 4MYUA 5D4NA 2HZVA 2HWTA 3GV8B 3M8RA 1IKVA 5DJBA 5KFUA 5G0RB 4FP9A 2XZDB 2O1PA 2B5JB 4MK7A 1RTJA 1VC0A 2E44A 3KOAA 1IUJA 3VVTA 2CUYA 2C3PA 2A3JA 3CCMS 2DJWA 4K4YA 5J2MB 1RWPB 1I1GA 3I9ZA 1P8GA 3M2UB 3QAUA 3ONQA 1QD1A 4Q5VA 2UXBF 1FWKA 2IM3A 2BKPA 4ZHRA 1N5YA 4FKYA 3EYZA 3E2EA 2E66A 2CPZA 1G6BA 3NNCA 3H2VE 2OMOA 2HWIA 1RT7A 3RRGA 4YR3A 3G9CA 1KLMA 5BR8J 2KM8B 1F6TA 3AODA 4R8UA 2DHHA 4OI2A 1D0EA 3PHTA 3KUGA 1X5SA 1YLXA 1DQ9A 3JSMA 2QC3A 2F4VJ 5KOXA 3HKZD 4WJBA 2LVWA 4NEYA 2PT0A 5DETA 2IRUA 4ZVUB 1N5QA 1KVKA 2UXDJ 4NXMF 3VWSA 3G4SS 3N79A 1HBNA 4NPOA 3FC9A 4OX9F 4QU6A 5DZ6A 4L3KA 4K2JA 1FTCA 3QIPB 4FYVB 2YNHB 3KJNB 3CJKB 1S9FA 1HBMA 2QT7A 3DRSB 1JXLA 3BH7B 5B08A 5A6PA 3RGIA 2CQ0A 4DSFA 8RUCA 4FPIA 4NLYA 4QZVB 3OTOF 2NXEA 2L9WA 3CEDA 4PUOB 4NLXA 1OQ3A 3FVYA 4RUCA 1NAQA 2V63A 1S1WA 1GXTA 1E6VA 1FERA 3HVTA 1HQ2A 3TWZA 2ZH2A 5F8NA 3ZZ0A 4YDDB 3PIPQ 5A2QU 3NGTA 2FIUA 5SZTA 2Q3PA 3N6LA 3NCQA 3MEGA 1IJFB 4KH1B 4XPEA 1F9HA 1YG0A 3ITHA 3ZC4A 3UO0A 1GT8A 4DV1F 1VK3A 1GH8A 4MKVA 4GRSA 4OI0A 3F41A 3G2XA 3KG1A 1RYSA 2ZOFA 1JLGA 2DISA 2HFZA 4F26A 4I0WA 1T9VA 3KKFA 3FZ2A 5KG3A 4L74A 2W7AA 4J9LA 4BC7A 8AT1B 4K7QA 4PXDA 2V2ZA 1CJTB 4JUZA 1AA1B 4NZ6A 3FBFA 4KGMA 5J2NB 3EUNA 1JLQB 3LW5C 2BOAA 4FXWA 3HVWA 1MW7A 1SH3A 2OTLS 2ZE2B 3KNAA 5H9FK 2HQDA 2VH7A 1T9WA 3JQMA 2CG4A 1FRIA 5K14A 3ZXWA 1R7IA 4HR2A 1YRXA 2VG5B 3POTB 2CPYA 1QUVA 4TKTA 4ZVHA 4PKDB 1U2CA 3FFIB 1N6QA 2DNZA 3DI6A 2CWKA 2L3MA 4LREA 2IA6A 2KXNB 4ZN3A 4ECYA 3THPA 2XQCA 5FLXY 3DU5A 2MLYA 2FLNA 2B43A 5AT1B 2OPPB 1IKYA 3EGNA 5KT5A 3MMAA 1X4DA 1TMJA 3K0JA 1A6LA 3UN2A 4C0BA 3EE3A 1ZS6A 2JC1A 2FVPA 2FGOA 2CNNB 5CABA 1T3OA 5G0RA 1NZAA 4ZLJA 2B5JA 3V5RA 1FJCA 2FC9A 1PAEX 2H4WB 2HGNA 3D54A 3HT0A 6AT1B 3E3XA 2XZWA 4JI6J 5C24B 2GVDB 2P5VA 5A0YB 3FDSA 3K5PA 2XZTB 2WB4A 4JI8F 3E51A 3M32B 3M2UA 1UL3A 2J8AA 3DOMB 2DRDA 3TAMB 2B7BB 2DPJA 4LR7A 2BZ2A 2EFOA 3SCKE 1RBOB 4EYIB 4X4VA 1YJWS 3R27A 3ETOA 2W25A 3ENAA 3EZUA 4QPTA 2ZKUA 3ZTQA 4F36A 1TV6A 3N5BA 3L95X 1NEEA 1OYDA 1SJ3P 3M8ZA 4FBTA 4DQIA 1N5VA 4JV0A 3LUYA 2IYGA 2BQRA 4C8KA 1J27A 1N54B 1Q82T 2DK2A 5E3RA 2AJ4A 4Y28C 3OW2R 2R9LA 3QIPA 2YNHA 1ZA2B 3CIZA 2CJKA 2VICA 2I5JB 3CJKA 2RAQA 3QQCD 3DRSA 1P27B 2F4FA 4ES2A 5KT4A 5I42B 3SFGA 1FWLA 2HIYA 5H9FJ 5HP1B 1G3OA 4ZPVR 4PUOA 1JXEA 4C8MA 1CEZA 1GQEA 4O4RA 4LF5F 2DGSA 4K4XA 1HHQA 5HROB 2VPZB 1J5EJ 4KE5A 2YKNB 5KFAA 2DNNA 3U27A 1F60B 4LBIA 4OYAA 4J9VA 3RB4A 4FF4A 3W8PA 2YPZA 1F5AA 1AZSA 3BS9A 4MMOA 4ILRA 3QNWB 3PXGa 3DM2B 2ZBIA 4MFBA 4UOCA 2HNDB 1RUSA 1RAIB 4BHQA 2RIJA 2W9BB 3HZEA 2W7PA 2ZH5A 2XYGB 5EHHA 2B4PA 4TNOA 1Q95G 3GJRB 3Q2SC 2X3DA 2V69A 5LSOA 2FVRA 3IG1B 2FGCA 5B0CA 2VQEF 1PBUA 4USMA 1RCOB 2DHAA 1TFYA 1N52B 4QR2A 2LQJA 3UCUP 3G96A 1KP6A 5KFBA 4Y65A 4U7UD 1VJQA 1RHUB 5ETVA 1CJTA 1KHVA 3ZZOA 1WWHA 4EYHB 4DR6J 2DR5A 1JLQA 1RT6B 1HR0J 4YOEA 2BR0A 2VC0A 3MWBA 3VGTA 2FVQA 2ZE2A 3PM9A 2HHTA 3H20A 3RBXA 1MWYA 1X8DA 3R7SB 3C19A 2VG5A 3POTA 3D3BJ 4ECVA 2QMUB 2F9DA 1WTBA 1N5SA 2XLJA 1RA7A 3FFIA 3W61A 3PEHA 3BJYA 2LXUA 2HHWA 3KHRA 3DU6A 4IG3B 1UW9A 2RH3A 4A8OA 1VS3A 2OD4A 4ETZA 1D1UA 2C28A 1H7WA 2IFXA 3ULHA 2YH1A 1WC0A 1WC6A 2OPPA 2EFGA 2FDNA 2E9RX 1EB0A 2L41A 4DG1A 3GG1A 1Z4UA 3CDBA 3CIMA 4DDFA 2OPQB 4RW4B 4CNZA 4XPCA 3FCVA 1L3TA 1UVKA 2QYCA 4NLQA 3LWMA 2LEPA 5L1IA 1JNRB 3K8VA 2XYHB 3OTCA 4A8XA 2ZUAA 5C24A 2GVDA 3N9UC 5A0YA 3LP2B 3K5NA 1RADB 1S6UA 4BWJA 3M32A 3MECB 3U7JA 2ZM6F 3DOMA 1O5JA 2EW9A 4X65F 4JV2A 2OLWA 3W65A 1U4BA 3TAMA 1NB7A 5E3CA 1AROP 4LFBJ 4OZ0A 2ZWPA 4OYMA 2N4CA 2QLXA 2XMKA 2N7CA 3OR1B 4WYWA 1RHKB 2CQ3A 4O3SA 5EN1A 4DSIA 2AU0A 1XTZA 3QWPA 1EARA 2WSFC 2G0IA 1GTEA 2RQMA 4O3QA 4B9VA 4ZVPB 4DV6F 3M8PB 4LSZB 4CZCA 3U02A 3V6HA 1KQGB 3JTPA 1HWIA 1BMQB 1J5OB 2QG9B 2QLJB 5F8LA 3Q0AA 2ILYA 3EMTA 1V3RA 1Q79A 2KJWA 4YR2A 1L3VA 1M5OC 1XWLA 4S0MA 3JQKA 3TR5A 3CJ4A 3K58A 2K1RB 4OQJA 1RA6A 5C25B 4DV4J 1BY9A 2Z8QA 2RILA 1EIYB 3OBIA 2AJFE 4ENOA 1C0TB 2I5JA 1SL0A 1S5ZA 3LO3A 4OJ3A 2BE2B 3KFWX 1QTNB 2E5LJ 5I42A 1NJZA 1TVRA 1TL3B 2Q1LA 5ETKA 4F0MA 5HP1A 2PI5A 3SQGB 3GIMA 1NJXA 2HFVA 1YITS 2ZJPQ 2VV5A 4YUDA 3AFGA 2B0GA 5HROA 4P73A 1DBDA 2YKNA 5BXIA 4KY3A 3NKYA 1VBZA 2XMAA 2BABA 3RW7A 3QGGA 3W7BA 2CQDA 5BYSA 3GSDA 3KK1B 4ECZA 3A1YG 2DCUB 3DM2A 3L4BC 4X84A 3GCWP 3C6UB 2HNDA 3I56S 3B4MA 2DH9A 3GB0A 2W9BA 1CS4B 1G1XA 1KVIA 1CC8A 4E8UA 3FSIA 4G3IA 1CJUB 2XHCA 5KG2A 4ZCLA 2HQ3A 4DPWA 2ZD1B 2E9TA 2DNRA 3SCJE 3UPFA 5BR8F 2JH3A 2KO1A 1U6FA 4OHZA 1FHTA 4F8RA 1U09A 2HHHF 4HACB 4FXDA 3IG1A 1YJRA 4FXVA 2QA4G 1BLUA 2HPUA 3IBCB 4AL5A 2F4VF 1IKWB 1VBYA 4J9SA 1PKUA 2XSJB 1Q7YT 3MAAA 2UXDF 2J7WA 2GGPB 3A3NB 1GMVA 1YJTA 4CLZA 2MKYA 2WONA 1RXOB 2OSQA 3H59A 5E33A 1K0VA 3AJ2A 3EVMA 1RT6A 1H38A 2YH0A 1RWKB 2PN6A 3OLBA 1IR1A 2F8HA 3MPDA 4DV5F 5KFRA 2H51B 2Y8YA 1S6OA 4RL1A 3Q24A 3CD7A 3HDSA 2CZVC 4M5IA 4CQ1A 1B4SA 1RT4B 3K57A 1RABB 1GTHA 3DHWC 2FJBB 1RI7A 3ILJA 3TYTA 1RQ0A 4IG3A 4PYDA 1X4HA 1JJ2R 2MJUA 1ZZFA 2CZ9A 3CC2S 2CPHA 5E3QA 3FQLA 3H40A 3OQ2A 1XC9A 3PDNA 3M2RB 1WHVA 2I38A 3FNNA 1NK5A 4B3OA 2OPQA 2MZRA 4RW4A 2NUHA 1WG1A 1AYEA 1EQMA 5DG9A 5KFCA 3IA0A 1M1HA 1C4CA 4OV6A 4P6QA 1YJUA 3LP2A 3MAHA 3MECA 4NLSA 4ZN1A 4AYBD 2MSTA 3H2LA 3EGVA 2W9AA 1R27B 3W5XA 1YRUA 4PG7A 1WOOA 3I6PA 2EBEA 2QMXA 1SPBP 3NGRA 3OR1A 1VYAA 2E1RA 5FJ4A 3QRPA 3MGJA 4B9LA 1SB6A 4K4ZA 2VBZA 4DXLA 2LKZA 2XTJP 4ID8A 4MJKA 2KN4A 3TJ8A 3W60A 2BUNA 3JQJA 4J9UE 1LK7A 1HNWJ 1M1GA 4IQXA 2RKIB 1J5OA 1YX2A 1TU0B 3CTRA 2E29A 3VGSA 2OUGA 4DS4A 2FHJA 1F5BA 1ZAVA 1F9FA 3KJVB 5ETRA 4TLRA 3MM6B 4DS5A 2XGQA 3OV7A 2K1RA 2VOPA 1D9FA 1S1UA 5IXUA 2YKOA 1JKHB 3VCDA 1C0TA 1JLFB 1SJRA 4H4KA 4NLDA 1FFGB 2CIMA 1IBLF 2BE2A 2F7VA 4FYYB 3WIVA 2W2QP 1U6BA 1RT5B 1XK8A 4J9OA 1TL3A 3T6JA 3SQGA 1F0XA 3J81U 1KVJA 5LXYA 2GO8A 3H4BA 1U1QA 1S0OA 3GIRA 3D28A 4O4GB 1WHXA 3BBBA 1OIAA 4J91A 2G1DA 2DGOA 4FZVA 2UZAA 5LMUJ 5KFXA 5AJ3J 2GQCA 3KK1A 3MEEB 1S12A 2OFHX 2AMCB 3VZIA 3RRHA 1CQNA 5L9XA 1LW0B 3HKWA 3G6YA 3BGOP 2PO4A 5E7OB 4LQ9A 4DFPA 1JX4A 2EFPA 5JVHQ 1VQ6S 1Q8BA 1RE1B 4TQRA 5SUHA 2OMLA 1CS4A 1ZETA 4Y2KA 1CJUA 4K4TA 4K4UA 3QSIA 2EWHA 1DTQB 1G4CA 2ZD1A 2DEJA 4USTA 2OAUA 3BDPA 5MAOA 4QW8A 5EUHA 4HACA 5A8KA 4Q8EA 2R3VA 1U45A 1U8SA 1XBWA 5I3QA 3CJQA 1IKWA 1UFKA 3AB4B 2MY7A 3QBCA 4JI5J 3HHEA 3V4IB 3RR8A 2F3JA 5D78A 2VOOA 4NWBA 2CVIA 2GGPA 3Q8VA 2D69A 1ZZNA 3M6WA 4PG8A 4EWTA 1H3DA 1B0VA 3HFKA 2LMIA 3NCPA 1B99A 3W5YA 2UP1A 3BO3A 5ETTA 4PG4A 1EJ7L 1PJ5A 3GP9A 3M30B 2K06A 2JJ4D 4DX6A 4C8YA 4Y3CA 5T14A 3DLGB 1PC5A 1B3TA 1F1BB 4ALZA 1X0PA 1RT4A 4D3GA 3HT3A 2ZHAA 3DMJB 1J5EF 1LXNA 4R0JA 4NE9C 9RUBA 1K8AT 3AXMA 3FZBA 5CCMA 4RNHA 4DOZA 4TVAB 3B8HA 2FJAB 3DDNA 1P6TA 2IC3B 4PR6A 2HVZA 3N6NA 4O23A 1OS5A 1UA0A 2HK2A 1HFEL 1YJ7A 3M2RA 4HT5A 2VL1A 3KYLA 4P10A 4WXWA 5F8JA 2ZZMA 3M7VA 2CQBA 3MMBA 1P1LA 2BANB 4RBUA 4ZMMA 2C2NA 4Z7CA 1WHYA 1HIYA 2UVWA 1QAXA 1Z1ZA 2HBRB 5ETOA 1MU2A 1TL7B 1R8PA 1DY3A 5EGYA 1KHWA 2R2TA 4M94A 2IIHA 1WI8A 4OJHA 2FJDB 4CLYA 2VA3A 3D68A 4OL8A 1EETB 3RU0A 4F04B 2VFTA 2AQ4A 5DZ7A 1UKUA 2MQ8A 4LVNP 1NH8A 5I3UA 2D3O1 2NPFA 2CJBA 4J5OA 3GR0A 1X9WA 4WP3A 3PFOA 1X7VA 3SV3A 1H7XA 1FVSA 3PEJA 1EQ0A 2CXEA 3OTDA 1PG5B 1FX4A 4PWDB 3NGDA 4DR6F 2YWEA 2VBXA 3ZTOA 1HR0F 3SFUA 3AD9C 3VGVA 3IS9B 2BW2A 2C42A 3PW5A 3LAKA 2RKIA 2B4OA 2YWWA 4NA2A 3MUVP 2W4PA 4LT6A 4P75A 1VDHA 2GIFA 4N77A 2DNGA 5DG8A 2HVDA 2LP4A 1M5VC 2YX4A 2YQ1A 2CPFA 3H8YA 2MQMA 1FVQA 4HH1A 1NO8A 2CQ1A 3UFCX 3NOCA 1JKHA 3PG9A 3M9MB 1JLFA 3UI3A 2CPJA 5KG6A 1RT5A 3MUMP 4UZBA 1TK8A 4O3RA 1UP1A 4DX5A 4ZPWR 4ZOSA 3QAEA 1KRPA 3K59A 3HHNB 2DNYA 2CQPA 2RE1A 4C8ZA 5CH7B 3GFZA 4AUKA 1KWMA 4O4GA 1Q8KA 3OXLA 4ED5A 4A4JA 5DDPC 1A7GE 3TX0A 1X31C 2QSFA 1KEKA 1UEKA 1ZYQA 3MEEA 2UV8G 2GX8A 4KGXB 3DOLB 3I5AA 1SV5B 2ZJQQ 1LW0A 2GAHC 2K3IA 3LGNA 4CWBA 1MMLA 5IV4A 3QYYA 4LFBF 2B8PA 3UR0A 4TY9A 1Q1KA 2OJ3A 1S76D 4KAIA 1UW4A 3HZGA 2IJFA 2R8HA 4LF8J 4YY3J 1IJEB 2ZKTA 1WTFA 2DXEA 2DGVA 3EJMA 2C22A 1ITPA 1JK9B 4DX8H 3MCNA 4N7TA 1BXNA 4MIWA 1XR5A 4PXBA 1T7PA 2BKOA 3TI0A 3IM9A 5EDWA 3U1NA 4TY8B 3NAIA 1S0VA 4I56A 4PPDA 2Y1JA 4WU2A 1NU4A 2LQ9A 2KVQE 2QIFA 3HHLD 4X66J 4IOAQ 3J7YU 1U1RA 2ZZNA 1UVMA 2ZC4A 4F50A 2V67A 3X3UA 4QCLA 3D1QA 1FRKA 3CB4A 3EICA 2LDIA 1LKZA 1LWCB 1TKTB 1HW9A 2HQCA 4HI2A 4O0NA 4F4XA 4G6VB 4NYPA 3BO4A 1Q81T 2YWKA 2NXJA 3QMQA 4LRAA 3M30A 3C46A 3WX4A 1D9AA 1FKOB 4GC7A 4DHVA 2E5LF 1RU1A 1IWAA 1SQFA 2XLIA 1RBLA 3CGIA 4F4ZA 5K5MA 3BH6B 4USKA 3DMJA 4TQSA 3B4DA 2R8KA 1U1OA 1H2VZ 1QVGR 3UN3A 4K2XA 1SL2A 5H1SV 1CSJA 5IT9Y 3PJWA 3EVOA 2W8LA 2B8QA 3T6BA 3QT6A 2IC3A 3CCTA 3PRVA 2NQPA 5K9FA 3BB5A 1T9UA 3BPSP 2I0XA 2BX6A 2CAJA 3Q8SB 1QUPA 4B3TJ 4M1KA 4QOTA 1ZOTA 3DRRB 2CNLB 4NLGA 2KH9A 3CJ8A 2BANA 2V34A 3PJ9A 1FXRA 2CDRB 3BM7A 1VC6A 5KFPA 1ZM9A 1Q16B 2D9OA 1ZH5A 4KGKA 4DUYJ 2V4RA 4ANCA 2IM1A 3SDEA 3JSYA 4QU7A 2XG8A 2FLOA 1Y11A 2QSWA 1ZPWX 1EETA 2M7SA 4C98A 5IWAJ 1FNOA 1SKWA 2F63A 4KHPJ 4H4OB 4F67A 2F65A 1CVJA 4GKKJ 5F8IA 3DRXA 3P96A 5K8MA 1KLNA 3MFIA 4PWDA 1TL4A 1ZTWA 2FQQB 4OYIA 2YKPA 3SSRA 2FYXA 2MTLA 3BGRB 2UUWA 3UN5A 3DNCA 2FD2A 4GO5X 4DV3J 2R2RA 2HYIB 3ZZUA 4MIBA 2OP5A 4P2SA 1HNIB 1T9YA 3R5GA 2APOA 5A8WB 1NKEA 2PC6A 1T8EA 4KH0B 3C14B 1S97A 4UTGA 2M8DB 4LFCJ 5I4MA 4N76A 1NK9A 5LMNJ 3DYAB 4WFBQ 3NMAA 3AQOA 1UVNA 2CJYB 5HQ8A 2B6AA 4NXNJ 5K8PA 2IM0A 1QAIA 3JTOA 3CCWA 5C42B 4Q0BB 4W90B 2LECA 2DD8S 1RHRB 4NL5A 1MN9A 2WW8A 4TN2A 2OI2A 4FNHA 4CRJA 4CLTA 5ETLA 4J90A 1NHUA 3T9ZA 2IBOA 2B9YA 1RT1B 4ZVOB 5HAOA 4KV8B 2UUTA 2KG0A 2DBBA 1CLFA 4P74A 2JNJA 1L3KA 4J9QA 3SYZA 4YQWA 3O1LA 2QLWA 1ZAXA 1C1BB 3D1OA 2YPYA 4ED6A 4DR2J 1XR6A 4U8YA 2EKNA 3T3FA 3IWLA 2RHQB 4LRFA 1FJGJ 2GC8A 2KI2A 3T5HA 5D0RA 1V5IB 2KDOA 3IMQJ 2IMWP 1DLOB 1W26A 4NCAA 1NDCA 4MH8A 4ELTA 2ZH6A 3GE9A 3KWMA 3MM7B 4TY8A 2CJQA 3QFHA 1APSA 1FESA 3OT9A 4UOGA 2L9NA 4A48A 3MR6A 4NLVA 1HNWF 2LDYA 1NM2A 2EK1A 2HHPA 1RAOA 4I1TA 1YJVA 3THTA 3WZ0A 1QDUB 4I7FB 1LQ9A 1TKTA 3R8YA 2V0NA 1FA0A 4A8FA 5IQQA 1PYTA 3OLAA 2G9OA 4PG5A 2EBGA 3ILLA 3ISND 1WORA 5IQ6A 1JIHA 1HW8A 1S1TB 2R4FA 1FKOA 2E1CA 3Q8YA 4NXMJ 4HHJA 4A8KA 3LGMA 4ZITA 1Y5LB 1XR7A 4RU2A 1NJWA 4OX9J 1LV5A 3H5UA 3UW1A 4NLOA 3KDNA 2MB0B 2WCXA 3N28A 3W62A 4HH0A 3I4PA 4OLPA 3BPDA 3CXCR 3PKYA 2MXYA 2X3GA 2H5EA 2BKNA 1OSDA 2IPOB 2OTJS 1J2VA 4ZCKA 5LMUF 1JLCB 5AJ3F 4Y2CA 2C2EA 2GA7A 3V6KA 1NK0A 5RUBA 1O8BA 3HFZB 5LM7E 3AD8C 4HTJA 2HFSA 4HDGA 4ZVSB 3D6FB 3M8QB 4Z37A 2V2KA 5KFHA 3NG8A 4U8VA 2NLWA 1KQFB 3DRRA 2ROPA 3KJFB 5KFJA 1QM9A 2J9CA 3IGNA 4NLTA 2M2BA 2VG6B 4E0DA 1DHMA 4RUHA 2W2OP 1ZM3A 3GV7B 3R5BA 4IFVA 2VA2A 1NCLA 3M6VA 2GQ2A 3BR8A 4QBUA 3BKUA 4Q8FA 2YBVA 3PX0A 3K5MA 1NRKA 4DL6A 1RSCA 2LU2A 4F0KA 1REVB 1UTAA 5FDLB 5B0FA 1HQEB 4JI5F 4ECRA 1M0SA 4O44B 4PWUA 1BGXT 4KRWA 1T03B 4H4OA 1PC4A 3D6TB 2B9WA 2PFFB 2IJRA 4WWSA 1V3ZA 3K17A 3J7ZT 4FNIA 2BRKA 1FEHA 4QJVA 3FGVA 3BGRA 4IOBA 2XM3A 1HMVB 4EEYA 3M9NB 2I1RA 3JAMY 4AD6A 1SC4B 4NA1A 4KFBB 1RACB 4I67A 4DX7A 1TKDA 1AFIA 2E7XA 3BGUA 4ZVFA 3O2IA 5KFWA 3DYAA 5CD4A 1R8HA 1UJ5A 2ADBA 2Z2YB 1VOMA 2HRTA 2CRLA 4CCHA 5C42A 4Q0BA 3FEXB 2WW4A 3DHXA 3QZ8A 3CCLS 2EC0A 2RF2B 2IVFB 2RUSA 3CDAA 4ZJQA 5F0UA 1RT1A 1KTQA 3MEDB 4KV8A 3NWGA 4B17A 1T9TA 5KFDA 1M5SA 4LBPA 2XY6A 2WAQD 3DXBA 2XMTA 2WSCC 2C2ZB 4CTAB 1C1BA 4BC9A 1XNRJ 4ZP9A 3KUHA 4K59A 3GJQB 2RB7A 2AJ2A 3LAMA 3P6YC 3O3LA 3BSNA 2UXCJ 2XO7A 2DNOA 4QWCA 3B82A 1VISA 4WIQA 4CLKA 1DLOA 5KG1A 1SKRA 4Y0FA 3BBFA 1H0HB 3D0GE 2DKOB 1ROFA 1XJWB 3MM7A 2CQGA 4DR1J 1WELA 2JWNA 2HVEA 4ANDA 4YHHJ 2MHNA 4D3HA 1VFJA 5F8HA 2BMBA 2BJ7A 5KFTA 3ZTPA 3UD4P 2HAFA 1H72C 2DHSA 5B0AA 1Y7PA 4I7FA 3D66A 5GADI 3MCSA 4I6WA 2GAGC 1LK5A 4PQAA 1N32J 4IQMA 3Q89A 2DH7A 3PW7A 1R0CB 1S1TA 3KLIB 2ZHOA 3TZYA 1SJ1A 2H9ZA 2EG1A 2VPXB 4C8NA 4EU0A 1S77D 2DHXA 2E5IA 2U1AA 5LXRA 3BYPA 2WOMB 1UZHA 2A0FB 4IUFA 3O44A 4CI0B 1TZ0A 4B9MA 3CCZA 5DM7Q 4EZ6A 2HFUA 6FD1A 4IOCQ 2HWHA 3ISZA 3MAQA 2E1PA 4OZJA 1JLCA 1FRXA 2KXHA 2ZJRQ 4Z2XA 3DGPB 4M95A 1AUDA 2W4CA 2XMVA 4WF9Q 4LF5J 3IR7B 5BYQA 3M8QA 1X4BA 2X1BA 3RRKA 4B3MJ 5GVQA 4F4WA 3EWGA 4B3RF 2ASYA 2D3UA 2ERRA 1WEYA 1H2UX 4YY3F 3GPAA 2KYXA 2VG6A 5HN0A 4JV5J 1KSPA 5KG5A 4DR7F 2HIQA 4KPCA 3KMQA 4CLWA 2UUAJ 3A3OB 3RAMA 4HDHA 3HSDA 4ED8A 5FDLA 4OHYA 1HQEA 3TA0A 4V1Ak 1YHQS 4X66F 4O44A 2JEFA 1QSSA 2BDPA 4KGVB 1RHMB 3HSZA 4KC5A 4P2MA 2BE7D 3TX8A 1T03A 4JI2J 4G1IA 4F2SA 4UQTA 3TUPA 4FDFA 2C3OA 2HRUA 2DR9A 4KB7A 2YWGA 4OMFG 3H42A 1GEHA 2KT3A 3SV4A 3CO0P 1S9EB 2D41A 1XQIA 1FXDA 2AEJA 3BREA 3N5FA 2HHSA 1FKPB 1HMVA 1YBUA 2ASDA 3BZQA 3PYEA 1T9XA 4EZ9A 4WIIA 4AL7A 1GAOA 1NPKA 3EGZA 4LBHA 2K7JA 4KFBA 4J9KA 5CYQB 2EG2A 3SXLA 3MM5B 4YB5A 2MKJA 3GYXB 4RLEA 4OZ3A 2WVDA 1SH0A 1HARA 2BBEA 4C3LA 4Y34A 4Q45A 4TYBA 1HNZJ 4KO0B 2M8HA 1EP4B 2DT9A 2RF2A 3QJLA 1OMSA 2FVCA 4B3TF 4ED3A 1FFWB 4F3QA 3CD0A 1K1SA 5D3GB 3BGFA 4U9RA 4DV2J 3VTIA 5KFIA 2DXFA 5D8HB 5KFSA 3OR2A 4EFAC 4QWDA 3G71S 4F4KA 4CTAA 1WDDA 3N4WA 1N48A 1O6XA 2R7UA 3I55S 2DH8A 3I4HX 3WHIA 5IWAF 1UJ4A 1JJHA 4GVLA 3G8QA 2WK4A 4XIUA 4OZNA 2MEWA 4KHPF 2Z30B 4DL0C 4GKKF 1FD2A 2B9XA 3I5BA 4DPOA 4I69A 2KZZA 4URQU 3US5A 1NPPA 3TZXA 5GAGI 1QSLA 2AV5A 1Z2LA 3GLJA 3R5DA 1SJQA 4URSA 4QIEA 4OI6A 1FK9B 3ADAC 1HPZB 4BBYA 4JOUA 2ALYB 1CPZA 3G8SA 1WF1A 3PYGA 4DV3F 1XMOF 2GQQA 2GHVC 1C0UB 4AL6A 5F8GA 4K8RA 4FF1A 3I82A 1EKRA 2YY3A 2IVYA 4LFCF 2E5HA 2UUCJ 3MTKA 5ETQA 5K20B 5LMNF 1QSYA 4USVA 4ZJLA 2FHKA 4G1PA 4NXNF 1M1KT 3KLIA 3JTNA 2DGWA 4WFAQ 3AH6A 4NLUA 1PBAA 5IT4A 4CP5A 1PJ7A 3JSRA 2OKQA 1CQMA 2WOMA 1H74A 2CFXA 2X1GA 2PEBA 3MI7X 5KFOA 4FPRA 2KFZA 3MZIA 3PKMA 2W2PP 2H5IB 2XHWA 2Y8WA 2W9CB 4O3PA 3AHPA 5HQMA 1U0HA 2YKAA 2W8KA 2QTWA 3BSAA 1R8CA 1NSKL 3G8TA 2CQIA 4N47A 3B54A 5T7LB 1VK8A 5DQGA 2HBZB 1YJ9S 3WX8A 2HS3A 2DNKA 3AOAA 1MG7A 3P49B 2HZAA 3GV5B 3DGPA 3IAM9 1FWPA 4DR2F 5K8NA 3BKFA 3GSIA 4HL9A 1FJGF 1EHWA 1X5OA 2VFVA 4X4SA 4AT1B 2V8VA 4ECSA 3NGKA 2DNPA 2WBMA 5J1EA 2Q6CA 2IDLA 1CJVB 3MR3A 2JVOA 4IRDA 3TUZC 3KXDA 4IG0A 5L1KA 2DNQA 3PRDA 2Y1IA 3BYRA 2AX0A 3S6EA 4CH0S 1BE4A 4C6AA 3MMCB 4ES1A 3MURP 1NKCA 2FZKB 1NHKL 2PSZA 5HVGA 4AXJA 3V4MA 3FQKA 2HHHJ 3K5OA 3CJ3A 2XY7A 1S9EA 8ATCB 2JC0A 4ZVEA 1FKPA 2A18A 5DDOC 2K3KA 5ETPA 2DTJA 4AQYJ 3CSKA 3LH2S 2JLGA 5CYQA 3Q2TC 1YBTA 1PAUB 2HNZB 3DDKA 3CJ5A 1GFWB 1TUWA 1GMWD 1SKSA 5CQGA 4OZ1A 3NRBA 1NK4A 4DV5J 3P4UB 4KO0A 1KN6A 1NSPA 3PY8A 4WP8A 3VVUA 2HGLA 2VU5A 3DKDA 2VDIA 2DYAA 2BJ1A 2CJ9A 2CJAA 4KJIA 4I2QB 1VQ7S 5D3GA 1QLNA 4NI2B 5EWGA 4TLQA 4GO7X 2Q66A 1S1XB 1NLKL 2IDEA 3HM9A 2BM1A 2JZ5A 4ATNA 1ELOA 2A6MA 4QIFA 3I0SB 2AJ0A 1KD1T 4EBEA 4WKRA 3TVYA 3NGUA 2QGFB 2CQ2A 2DCLA 2AD9A 3CCJS 1OO0B 4DV0J 1FJ7A 2ZFHA 7FD1A 2JX2A 3OFFA 3BSOA 2CQ4A 3DOKB 2XNRA 1RLDA 3OTBA 3FCHA 2GW8A 1KQKA 4DFKA 3HSJA 2IAJB 2QN6B 3KK2B 2N4DA 3BQ2A 3PX4A 4RX6A 2FJXA 3C8YA 2H3EB 2RRNA 1X4CA 2NXNA 1FK9A 4QWAA 2ABYA 4YB7A 3FEZA 2FZGB 2ZDOA 1ULRA 4DF8A 4RWWA 3W5ZA 1C0UA 3W66A 4RU9A 1TP7A 2DNLA 3DLLQ 1S1VB 4Y2IA 4LF7J 2CZ4A 1F3FA 4P2XA 1YZ7A 4M5MA 1KQSR 1D8ZA 1NJYA 5IFMA 2ILZA 5L1JA 1RK8A 2RHSB 2H4YB 3MEKA 2V9KA 2BQ3A 3HJVA 2Z56B 1ZM4A 3ZNUA 2QEXS 4CNYA 4R25A 3ET6B 4WZQA 1P1TA 1IN0A 2J0WA 5E3PA 4Y6IA 4C8OA 5CYMA 1IBKJ 2E9ZA 5H9EK 2W9CA 3AD7C 4ZLLA 1U2RA 2GHWA 4J9PA 4RBTA 1IBLJ 4P9SA 1OPZA 4DBQA 3THVA 1X9SA 2A2DA 3LP0A 3A8IA 4GKJJ 2CADA 1LNQA 3IO1A 3IWXA 1P9QC 5JVGQ 1XNRF 4B9SA 1HWKA 4X4PA 1HWJA 3CCQS 4YB6A 2RQKA 3RJMB 2RDDA 2UXCF 1OY9A 2J0XA 2AIRB 1SBRA 2GMJA 2V5HG 2BJ3A 2B7CB 4ZVGA 5KFLA 1CBKA 4KIAA 3MPUB 5CD4H 1NPRA 1JLAB 3HXMA 1NZ8A 5J2MA 1NBEB 2DO4A 4MT1A 2VG7B 1CJVA 3KLVA 1X4AA 2CPXA 1DRZA 4DR1F 4OYZA 2VKRA 5IZHA 2C1EB 4YHHF 3NS6A 4UUWA 2GHPA 3BF4A 4TXSA 1VRTB 2G2ZA 3MMCA 3T5JA 1RDRA 2WVFA 1VQMS 5ETSA 4EGLA 2G0JA 3EM1A 1B0PA 3DCAA 1MLAA 3CMQA 2F8MA 3SSQA 4B08A 4F3OA 1ZTTA 2PE8A 3R2DJ 1N32F 3AAWB 1TKXB 1VR6A 4TU9A 3HHLC 2DGUA 1PCAA 2CPDA 2VF3A 3IR6B 4I6YA 3GQCA 2H5JB 3Q23A 1RYRA 2VIHA 2HW3A 3J7AN 3A8KA 3G6XA 1DARA 3KLEB 1FRJA 4LRCA 3PRBA 5HMWA 5LSLA 4QQBA 4DL7A 2QL9B 4TU7A 1I51B 2FTRA 4U6PA 4DPXA 4RW9B 1JQGA 1X0FA 4EO8A 5JJBA 4DU8A 2HSEB 2W2MP 1W25A 3AJDA 5GAEI 2HFNA 1HA1A 1F9EB 4LSLB 1N0VC 4X4OA 1T0TV 2AKWB 1W7WA 4I2QA 4B3MF 2RJZA 1VGYA 3OVAA 4NI2A 1JLBB 4AXIA 4H4MB 1RLCL 3AQPA 3OL7A 5H9EJ 2ZZTA 2HS4A 2PA3A 1CJKB 4JV5F 5LL6d 2ZBPA 1ZA1B 3I0SA 4W92B 1MN7A 1M5PC 2UUAF 5HJXA 5AE3A 3OL6A 1NK6A 1SC1B 3F73A 4GVBB 2EXUA 1U6ZA 2ZEJA 4JI2F 4F25A 5KFEA 2IAJA 1RAGB 2ZNZA 3KK2A 4F2RA 1UETA 3HCXA 1HHTP 3V6DB 2N82B 2HVHA 1NUEA 1DJ0A 4CM0A 4NZ0A 1G7CB 4DQRA 4DL2A 5FLXU 1RISA 2W4DA 3F0NA 4OFZA 1VQYA 4JI1J 3CF5Q 1WG4A 1AXQA 2B56A 2RDIA 3TAQA 1U48A 1S1VA 4BWMA 2MZTA 4U67Q 1V9OA 5IS2A 4C11B 4FS1A 5J2NA 3GONA 2H1YA 3W63A 4CO3A 4ZPTR 1LWFB 4UT4A 2ROGA 3J80Y 3QO9B 2V4QA 2JFDA 3MUTP 4P52A 3WIUA 2XWYA 2R42A 3T1HF 3RAXA 1KFSA 1HNZF 1IVZA 1U24A 1KTVA 5KG0A 1N88A 4CH7A 1NXIA 2XI2A 2DIVA 2C2RA 2ZNYA 2IJNA 4MK9A 3ET6A 1IR2A 4NASA 3PYDA 4Y00A 3OFEA 1D8YA 3KLGB 5B09A 2DO0A 2XS5A 1B70B 2L48A 3W2VB 4DV2F 2J5AA 1VQLS 2E7VA 3K2YA 1FEEA 4W98A 4KKOB 2DITA 2CPIA 2AF6A 1UVLA 2BYCA 3RB0A 2W1BA 1S7HA 3OHBA 5IC6B 5DLFA 2KL8A 3CDUA 3ETMA 3C16B 2F5GA 4HHHA 2A1BA 1OQ6A 1AFJA 1T95A 2CWXA 3J7A1 2ACMA 2CQHA 3NS5A 3M1VB 4QR0A 4OHVA 4ZLPA 1U02A 1HWLA 1BWEA 1LWEB 3TA1A 3QGHA 2VG7A 2QYGA 3NS7B 3KLFB 2HNYB 1VRQC 4YFUA 2LQ8A 4DPYA 3AA8A 4ITSA 3BEGB 4A8SA 4ZKAA 2E5GA 4DZDA 3AJ1A 4MIAA 2I2YA 3RUBL 2YX1A 5D77A 1RTIB 4ILLA 1HD1A 2BE9B 4J7CA 2Z4PA 3QRQA 2IYIA 3IAS9 2UUCF 2OPSB 1U49A 2U2FA 4ZDNA 5GMKa 2DHGA 1TKXA 3ILIA 3LTOA 4WK3A 1WOSA 4FBUA 2W2NP 2FHOB 3F44A 5L1LA 2FY1A 4C3MA 3A8JA 4LR9A 2Y3YA 2IRXA 3PACA 4NEZA 2YX7A 4MKBA 4USWA 3EZ5A 1KLMB 4JI3J 3KLEA 2XB2D 4MKYA 3ISNC 4OHWA 1YWXA 2VJUA 2EK6A 4A8WA 1Q8LA 3JSMB 1IR0A 2XBPA 4RW9A 2AYBA 5LJ3Y 2P2CB 4QWBA 3PW0A 2X7IA 2M52A 3PYFA 4LSLA 4IYQA 5J1NA 1Q0NA 2DIUA 2A10A 1N56A 3QT5A 3LANA 4ZPCA 1JLBA 4JI7F 4H4MA 1VCTA 1GK8A 2IHR1 3R6LB 2P8IA 1RAJA 1CJKA 3W3SA 1S6QB 2NR0A 4ECWA 3PR5B 2LXIA 4FYXB 1VJWA 1HBMB 3QRRA 1RU2A 3MDFA 2LCWA 2IY5B 3MR2A 2HMIB 4K5RA 2FJWA 2VQFJ 2LEAA 4GVBA 1WEZA 2LU1A 3TAPA 4F0HA 4CO4A 2B4UA 1S1WB 3PFEA 2HHUA 1HLWA 2YNIB 5CZXA 2HG4A 3GWCA 1ICEB 4QW9A 3MCOA 1QAJA 3BV8A 1YIJS 2V6AA 4RNFA 1QE1B 4IO1A 5KFFA 5B0EA 4I4BA 2QFIA 5HBMB 1MMNA 3ZZRA 2J6TA 4HLBA 4WYLA 3AOBA 4ZVRB 2AX1A 3KUEA 4WK1A 1VQ5S 4RBVA 4AQYF 5L9NA 3ITHB 3IBFB 4DU7A 1WOPA 5HATA 4X4RA 4WZMA 1RWMB 4LVOP 4C11A 2FZCB 1SJ4P 3NWRA 1FJEB 4F3MA 1S6PB 3QO9A 4X62J 3HP6A 1UWAA 4YR0A 4WFYA 3SBMA 2J76E 4DQQA 2GS8A 3CDWA 1DQ8A 3SIPB 2W24A 3KLGA 4DLEA 1R6YA 2QA4S 1HQUB 4NRUA 2P9CA 1VQPS 1F5CA 4IFYB 3IP0A 4C3KA 3FRYA 4KKOA 1WACA 2CDQA 2DGTA 2PFDA 1KOOA 2Z2LA 2X1FA 4ES3A 2C2OB 3VF0B 3TOQA 1FD8A 1HI1A 2C2MB 2ZUGA 5CAAA 4DR3J 4QPXA 4DV0F 3KJQB 4GC6A 1IBCB 3C16A 4UZCA 5DO2A 1RP5A 2EKYA 1KNZA 4OIXA 3M1VA 2MLZA 1F2HA 1H6KX 2MZ1A 5DS7A 1LWEA 1VQSA 4WKYA 4ZA1A 1MNEA 2NYIA 3KLFA 2PGCA 4K4SA 1DZ5A 2D3ZA 4USHA 3M8YA 3HHDA 1U1LA 4JYAJ 4X2BA 4AE5A 5JXSA 2OH2A 3CD6S 3MOJB 5GAHU 1RTIA 4J9MA 4ZP7A 1VQKS 1WF2A 2YNGB 5GMDA 4RZRA 4LF7F 2GNKA 2LXFA 3I96A 2OPSA 4CYUB 3M8PA 5J2QB 2CG8A 3Q86A 4XK8C 2NSCA 4Q43A 4LIRA 2BV3A 4RO0A 2O5DA 4KGZB 3C3LA 1LEOA 3SCLE 5U47A 1L3UA 3QLHB 1RHJB 2YKMB 1WKKA 4NLWA 1MSWD 4M5HA 4WFZA 5C25A 2RU3A 1TV6B 2LEBA 1IBKF 4R5PB 3RAQA 1WSRA 2K8GA 1N33J 4GKJF 2CA9A 4FYWB 3SZ2A 4DFJA 4RWXA 1KR4A 4LRDA 2H65B 2GJFA 3VQSA 4X64J 2R8JA 1W2BR 1C4AA 4ILMA 4A47A 4NYOA 2QJ3A 3UD5A 1KFDA 1S6QA 1F3VA 4JV1A 2JL9A 4OX7A 2ZH4A 1HNXJ 3C6UA 4USUA 2AZ3A 1VQ8S 3LPEA 2FY8A 2DXDA 2HMIA 4JI0J 4M5LA 3BSCA 2EC2A 3GIJA 2MZSA 1WG5A 4ZIWA 5D0GA 2HEKA 2IM2A 3TANA 1FO1A 2ACYA 2YNIA 4UY85 4USJC 3T19A 1IKXB 5HLFB 4J9RA 3R97A 1AZSB 3CPWR 2HZCA 1QE1A 3KNGA 5DG7A 2QLBB 4B02A 3DLEB 1VQ4S 5HBMA 4MFBB 1JWWA 3J7Z5 1KOHA 2V50A 2XSJA 4C7QA 2A6OA 3IFEA 4B9TA 3F56A 4LUBA 4BLGA 3W9JA 3NOGA 5B0DA 3T1YJ 1U0SA 3DLKB 4XDCA 1SXLA 3UDCA 3BBCA 1S6PA 2R7OA 2DR6A 4ZCIA 2JHEA 1S57A 3P8BB 1WEXA 1UFWA 3JSBA 5A76A 5KFYA 4WBFA 4PXEA 4DV7J 1PGZA 4RNMA 2V8PA 1JLEB 2DNHA 4K4VA 3UDVA 3NL0A 2BQUA 3M05A 1MWZA 2YQ0A 2K7KA 1PYOB 3VAJA 4C2MA 2R7WA 4EO6A 4DUZJ 1C2PA 2AT1B 3T5LA 3Q8UA 1HQUA 4OYPA 3NNHA 2HS0A 3VAKA 4C9DA 3EX7B 4IFYA 4M5DB 3BO2A 1RWVB 3ZZYA 2IRYA 4OLOA 1UMJA 3FUYA 3MOZA 2WVEA 5M2UA 4MTPA 4CLLA 2W7OA 4OI3A 1QTMA 2UVVA 2EVZA 4LMZA 3CJSA 2V2QA 5L39A 1YJNS 2RS2A 3HVRA 2E1AA 1K9MT 4C97A 2JRSA 3HULA 5AE2A 4UUXA 2LYVA 4QIWD 4WU3A 2BXJA 2JFKA 3H5YA 2BEFA 2OPRB 2PIIA 3AXKA 4DG1B 1DAXA 4L3NA 1S49A 3HHLB 3QFWA 4JI1F 3D67A 2FVSA 2CYYA 4PQUB 1V3SA 4ELUA 4WTYA 1VC5A 3VV2B 2KHDA 2HBYB 1U26A 2G4BA 5HMZA 2FLLA 3MD3A 2YNGA 2XGPA 4LR8A 1BD6A 2V8HA 4CYUA 5J2QA 2KRBA 5M2PA 1RKJA 2R2UA 4FF2A 3S1TA 4MK8A 4LQ3A 3Q8PB 3N01A 2ZHBA 4XAKA 4ZK7M 3QLHA 2YKMA 2NPIA 3KJVA 3MM6A 1EX8A 5KT7A 2VASA 4TU8A 4ZPDA 4R5PA 2IMOA 3K5LA 2HHVA 4LRBA 5FD1A 4N41A 3CMAS 1GMUA 4NRTA 3GMGA 4M5NA 3DRYA 2MQOA 2KZMA 5J1PA 3D6MB 3OFGA 5KT6A 3GFYA 2YXLA 4DMZA 1YBAA 4AFFA 2NS1B 3T5KA 5HSPA 1WC3A 2Y9HA 1UAWA 2G0CA 2YQ3A 3UCZP 2V94A 3PHEA 2R7RA 5F41A 2ZH8A 3EPGA 1WKJA 1AW0A 2NREA 2NCKL 2JEIA 2Y0BB 2MQPA 1Y0HA 2KU7A 5AXMA 1OSCA 2OSRA 1FRHA 1S4EA 1RGVA 1TVRB 2H48B 2B3TB 4HTIA 2LQBA 2MSSA 2PDAA 2MZQA 4I2PB 1U1NA 3O5TB 4B3RJ 1YZ6A 3HVAA 4DCOB 1DTQA 2MZJA 1K44A 1W2IA 2O67A 4DR7J 1IKXA 5HLFA 2OGUA 1Z2ZA 5L8RC 3MXHP 3R7NB 4C0OC 4XO0A 3CDEA 5IT0A 3DLEA 3OL9A 2XCPA 1TELA 3V4IA 3S01A 4IR1A 2X51A 5B0BA 1Y3JA 2AEFA 4NMLA 5I3PA 3V2UC 4WXOA 2W01A 1Y5NB 4RUBA 3DLKA 4LJMA 4K4WA 2HK3A 2D7SA 3C6TB 1NK7A 4JI3F 3JS9A 2ZWOA 4KYZA 1TKZB 3OPKA 2J6UA 2E7WA 1SC3B 3G6ES 1RWUA 2JSXA 1VMBA 3ENVA 7FDRA 2PMWA 2Q43A 3Q22A 3IN5A 3DLGA 1JLEA 1GX5A 2EFNA 1TL1B 2HGMA 4WFXA 3MAAB 4EBDA 3R5CA 3UVJB 1AUSL 3IBWA 3FMBA 4ZP6A 4LSNB 2VPWB 2I6WA 1R6VA 3E01B 2WONB 3VAIA 2RT3A 2BVZA 2HURA 3SCIE 3KTQA 3NP5A 2PMHA 1FKAF 1WD6A 7AT1B 3V6JA 4M5DA 3EVWA 3L7UA 1NNDA 3NNAA 2RD5C 3HHKA 3BN7A 2VB6A 2Y1LB 2CPEA 4CLPA 2XEXA 4UOFA 2ROEA 2VQFF 3VAHA 2QZ8A 1URRA 1TMMA 3IRXB 3M9OB 3VAFA 3GZ7A 2B4VA 3K7RA 2DGXA 3LGHA 1TL7A 3A8EA 1HYSB 5L38A 2PMZD 3TUJC 3D0IE 1FF2A 3IM8A 2DR7A 2R2SA 2UUBJ 1UEUA 4RW6B 3I87A 2OPRA 2IA0A 1UEVA 3HHLA 2XULA 4PQUA 3L9ZA 4NMXA 4B3OB 4KT0C 3PTWA 1BQNB 3HD1A 4RW8B 1SUQB 2KT5A 2I9SA 1NSAA 1P9YA 2LQ5A 2J0SD 3P5TL 2GV1A 2WB1D 4UW2A 4I6AA 3S8SA 1TTHB 3JXOA 5E2QA 3TEGA 4X62F 1SKUB 3IS9A 3I31A 4LIWA 1U1PA 3MM8B 4LF1A 4QR1A 1XMOJ 2V9WA 3TQ1A 4OX6A 4PRFA 2AYEA 2CNOB 2R7XA 2MHEA 3UWTA 2HLUA 3CVKA 4M5JA 1B0TA 4ZPAA 4DPUA 4B3SJ 2G2OA 2XYPB 5DGBA 1WC4A 2C3YA 2E5JA 4YB1P 4P71A 2L08A 4WTOB 3DRPB 2HQFA 2KRRA 4W4MA 2DRAA 3K8WA 2R7TA 3PO4A 2F1FA 1S0MA 2OEMA 4DN9A 1XN9A 3G87A 1JMTA 3KLHB 1HI8A 1I94J 4IRCA 3GYNA 1VBXA 2MJNA 1U7LA 4DR3F 2VODA 4O0IA 1NKBA 4LF4F 4LF6F 3VZHA 3H90A 4GMKA 3SQOP 5KFMA 4ANEA 2BJDA 1S1UB 2ZH3A 1X5PA 3RB3A 2LFVA 3CCES 1LXJA 2P6TA 3DOLA 4U7CA 1SV5A 4KTQA 1DTTB 4DCJB 1FTRA 4WE1B 5B0GA 1UZDA 2ZH9A 4JYAF 5A6WA 1RCXB 2VFUA 5DGAA 4HEA9 4I2PA 2GFFA 3SI8A 2EEYA 2KXFA 2GJIA 1NDLA 3B78A 2ATLA 4JI4J 4ERDA 1RB0A 2VPYB 4DJBA 2FLPA 3WQPA 3H98A 1TFWA 5KG7A 5IT9U 1EAYC 4MAKA 5D4LA 2XLKA 1S48A 1Q53A 4NLRA 2CNKB 1SL1A 4RNOA 1Y9OA 2MDAA 1GXUA 3O8WA 1NHVA 1LWCA 2FB0A 3EDRB 2AJQA 2MQNA 5FIIA 4ED2A 1NDPA 1NK8A 1MWQA 3C6TA 1B64A 1NJIT 1TKZA 4FVCA 3NY0A 5A8KB 3R5AA 1BHNA 1N33F 1VQ9S 5ETNA 3WBZA 4PAAA 5KG4A 4OYXA 1SC6A 3KG4A 5CCLA 3CE8A 2Z0GA 3J81Y 3BR9A 2MKIA 1TL1A 2PEHA 5CZVA 1T02A 3UVJA 2Z57B 1BWVA 4RJVA 3JB9k 3BQ1A 4X64F 3WC2A 5E41A 4LSNA 3E01A 4DN0A 4MKAA 2ALZA 2VBWA 4G1QB 4KPYA 3FKBA 3DXSX 4KHMA 3HI9A 5GADU 1HNXF 1BQXA 2VONA 1LFPA 2RMLA 3OXFA 4URGA 2C2KB 4ZJOA 1Y5IB 2A2CA 5DDQC 4JI0F 4ELVA 2MPUA 3OSPA 3T41A 4NA3A 2FHJD 4DR5J 4LF9J 3IRXA 3MF5A 1Q7LB 4IRKA 1YK9A 1AB8A 3NCRA 1YGYA 5AXKA 3G82B 3CNQP 3GYGA 4DR4J 1YVFA 1HYSA 1H73A 1TAUA 3VHQA 2M3DA 1WKLA 3R2CJ 4RW6A 3H25A 4OZ5A 4OYOA 3IRWP 3CJTA 5M2RA 4UY8T 2HLTA 2ZVSA 2POKA 4ED0A 1BQNA 4RW8A 3A4TA 3QZ7A 1SUQA 1VRUB 3MMBB 4EMDA 4LFAJ 2ZH1A 3T1YF 3HPOA 1MU2B 4OZLA 3SSSA 3GR1A 3FBEA 5HO4A 4G65A 3MM8A 4NYZA 1UVJA 4ZS6A 4DV7F 1DQAA 1HNIA 5HJYA 3G86A 5A8WA 2HQGA 1D09B 1RT2B 4I68A 4BDPA 4X4QA 3C14A 5I3UB 5E0OA 1QAYA 4R0EA 4DCPB 1O51A 3GILA 4DUZF 3DRPA 2ZC3A 1PYSB 4OHXA 1KS2A 3EGWB 2V68A 5KFKA 2QA1A 3H4DA 4QYZK 3TQEA 3NMRA 2DGQA 4V19X 1KBRA 2JLFA 3HX9A 3RB6A 3KLHA 5KFQA 1LFWA 4L76A 3E8OA 2OD6A 4Q7AA 1FX2A 1S72S 4QWEA 3D9BA 3DLBA 3UDEA 3VAMA 3MHYA 3TJ9A 5HVFA 5HMYA 3A12A 4KR0B 1OJ4A 2BW7A 4ED1A 2Y0SD 2HVIA 2M5YA 2Q79A 2RQ4A 1DTTA 5ETMA 3N6MA 4WE1A 2X1AA 2FJEB 3MTJA 2O01C 3CULA 2RRBA 1DFDA 2XSFA 3C2PA 2NZ4A 4IR9A 3QIDA 4K5SA 2AJ1A 5DM6Q 3MPVA 3CJ0A 1RWXB 5KAKA 2MGZB 3UNYA 4JB8B 3UDLA 2J7UA 2M9KA 2J9EA 4JI6F 1X4EA 4DSKA 3RYLA 1RWWB 1SIWB 1GX6A 2YWHA 5DRKA 2G1HA 3UCGA 3WDOA 1TAQA 4CT9A 2VD3A 1R89A 1REGX 3L09A 2MQLA 3HMJG 3OJUA 3NXZA 2ZITA 3VR1A 4PYAA 1WJ9A 2MMYA 1S4FA 3NBPB 4OI4A 3CC4S 1JJ4A 1FE4A 2O66A 3GJTB 2XCAA 3X1LB 5EX0A 4DL5A 3CD5A 2V8DA 1I6JA 3FEYB 4FKXA 2D9PA 4DZ6A 3DLJA 5GAGU 2J9DE 2BRLA 5D4OA 2HHXA 2HQIA 1WC1A 1S7IA 3ZTRA 3CJRA 4UOHA 4MYTA 3CCSS 4G1QA 3TVZA 5EWFA 1R31A 3LOUA 3A3PB 4ETXA 4YP3A 4ECTA 3M2VB 3CWJA 1HBOB 1XMQJ 1RKIA 4DL3A 4QYZJ 1OYEA 4DI6A 2OELA 4DF4A 1Q4RA 2NYHA 4EUVA 3MR5A 3TZWA 3JAMU 2XWXA 2CJXB 2RDJA 4YDXA 1SH2A 2RU9A 3GTYX 3G82A 1MMDA 4X4TA 5BYRA 5KFNA 5IC4B 5GAHI 1UVIA 2GJ2A 4WPAA 3D1HA 1VIXA 1NH7A 1REVA 4EK2A 1VHFA 5A8RB 5J2PB 2EI5A 1K0TA 2COLA 1JJCB 1VRUA 1K47A 3R1LA 1N34J 3R7BB 1CC7A 3HF5A 1RTHB 2QE5A 1S9GB 1RJJA 4XTTA 2RVJA 4L73A 4FF3A 2RRAA 2DEIA 2YNFB 3SDEB 3V81B 2LA4A 1EZZB 2BJ9A 4TYAA 1N36J 3OTEA 2KYZA 4WFNQ 2Z2ZA 1HHSA 4OYWA 1R43A 1WDTA 2C3MA 1RT2A 2PD1A 3LA0A 1U8WA 2ASJA 1OY8A 1N0UA 3MFHA 3VGUA 3GIIA 2GVZB 1XIQA 1L3SA 2KTQA 4KQZA 3T9NA 1HD0A 3T1HJ 3QJPA 3W64A 2NSBA 2JEGA 1NDKA 5AXLA 2GZOA 3BGLA 4HKQA 4DWIA 2NZCA 3BQ0A 2ZH7A 4ECXA 3DLHA 3W9HA 2XC9A 4U7UK 3ZZTA 3CMES 3MEDA 3I5CA 3SMZA 1FXLA 4Y2AA 3L7PA 2AW0A 2FC8A 2B6AB 2MLXA 5T41A 3UR3C 3PVXA 1SQGA 2UUBF 1HL6A 3ENWA 3ELHA 3GCXP 1WF0A 5E3AA 2NUUG 1TR0A 3NEKA 1ZAWA 3M6UA 4QIGA 1ZBTA 2RSQA 2MGZA 4A8QA 2EFQA 2ZOGA 3RR7A 5C7PA 2DPIA 4NLPA 3K89A 3TRGA 4K50A 4CO0A 1QY7A 1SVDA 3QPIA 1AT1B 1KC8T 4IH7A 2OHDA 3FSYA 2G2YA 2D74B 2KKHA 1IM6A 4ECUA 2JLEA 4ED4A 3H7HB 2AHOB 3DGVA 4UF4A 2J6SA 1EKSA 1TL5A 2N3LA 4OV1A 3Q8RB 2HBQB 2UV8A 4HVZA 1KDNA 2AGQA 4B3SF 4DEZA 4Y2MA 5KFZA 3EXYA 2BJEA 1XMBA 3NBPA 2RQCA 3KHHA 4OJGA 4IKAA 4CT8A 3RBEA 3HJFA 2BM0A 2MKCA 2B9EA 1RHQB 4F4AA 1OPIA 1FI4A 4L72B 3KDOA 1XNQJ 2Y1RI 3H2UB 2KJVA 2VFSA 1I94F 3GU0A 1BC6A 2VFRA 1JB0C 3DN9A 1TQLA 1CG2A 3QSYB 1HI0P 3NLCA 2R7SA 1S59A 2UU9J 3PCOB 4N8OA 4DV4F 4A46A 3W8GA 4FVMA 2WRMA 2OEJA 3M2VA 3PW2A 1HBOA 4B9NA 2ZVIA 4ID5B 2EPIA 2YVSA 4L6V3 3HLUA 2XMUA 4NZ7A 1IM4A 3MM9B 4JI7J 3OVBA 1FDBA 3TNVA 5D15A 4O3OA 4IDKB 2XMWA 4DFMA 4JI4F 2XMJA 3ZZZA 2EFVA 1FNXH 5K8OA 5C2GA 3W1YC 3C15B 3H5XA 2XS7A 3D3CJ 3TUIC 4KBIA 2NXCA 1IQZA 3Q83A 2F8EX 3FRZA 5DQHA 2OIHA 5A8RA 1RWNB 1UJ6A 1M5KC 5J2PA 1RTDB 4DUTA 3LALA 1LOUA 2SXLA 1ZPVA 1FDAA 2RNEA 2M4MA 3FJ2A 5F8MA 5AXNA 2JEJA 3PR4A 1UPMB 3U1MA 1RTHA 1T94A 2ZBCA 4RW7B 3TJAA 1S9GA 3ENQA 2R7VA 2I8EA 4RNNA 1T05B 3PO5A 2YNFA 4IFVB 1VQNS 1OWXA 3CJ2A 1Y3KA 5E5NA 3V81A 3QJJA 4ZP8A 4IH5A 3LF0A 2O3DA 4N5SA 1RAFB 2QL7B 3W2WB 2VKZG 5C5JA 3HSGA 1K1QA 3MM5A 1UWBB 2GVZA 4EBCA 2AYMA 2IVMA 1QJHA 2QFJA 1IBMJ 3ILOA 3I9V9 3HK2A 2WHOA 3BN4A 4H54A 1EP4A 2WSEC 3P5BP 5DDRC 3QT8A 3D6HB 3LP1B 2PA8D 3AY0A 1UFLA 1C1CB 2KM8C 4DR5F 4LF9F 3M8SA 5MLCV 1A9NB 1E6YB 2IBKA 5L46A 1U47A 1YSJA 4DR4F 3AOCA 4C48A 4QIVA 3TA2A 5DQIA 4OX8A 3RTVA 2QO3A 3IC1A 3OFHA 3I32A 2CVEA 1T11A 5HI7A 1HNVB 3VQTA 3ZNJ1 4K0KJ 1X4GA 1X9MA 4OI1A 1YQHA 4CLSA 2L9DA 4Q2MA 1FDNA 3U1LA 5CXTA 2QV6A 1VLYA 3DDIA 3HFVA 2AZ1A 4LFAF 3J7YI 5GAEU 2D3OR 1PO6A 3QWUA 4RKUC 4CO5A 3IWNC 1HPZA 1Q86T 4FS2A 3JYTB 2MYFA 2P9EA 2R8IA 4DLGA 3UNGC 3RZAA 4C0HA 2VBYA 1RBAA 3OUYB 2K2PA 4P72A 4IO9Q 1RAAB 1JXVA 5ITHA 6FDRA 1YRTA 3NGSA 1GMWA 2BOPA 3H0PA 1R3NA 5HANA 2ADCA 2FJVA 2UXBJ 1LW2B 3PNIA 1U1KA 3H5SA 1UCNA 2R8GA 5EX3A 4B9UA 3MMJA 4OJ1A 4ZIVA 3CT9A 4ECQA 2ZBQA 1ZM2A 2KVIA 4ICLB 1PILA 3SEOA 3CW2C 1VBKA 1RTZA 3N0VA 2NXUA 1R8AA 2DVIA 4C4WA 3ZZPA 2WVCA 3R5JB 5JMNA 5T7LA 2C2DA 2DR8A 3IXQA 2JOQA 1WNEA 2YWFA 1SQEA 4A8YA 4ID5A 2VJVA 4J37A 2J8SA 3R9LA 4NCGB 2AWZA 2M0GB 3MM9A 3AA9A 4QYRA 4ZPBA 4IDKA 1XERA 2VZ9A 1MROB 4Q44A 3KK3B 1KKHA 4RUAA 3C15A 5F9NA 2Z58B 2H54B 1S99A 3CUNA 1CULB 5F0WA 1N5TA 3EZOA 3PIOQ 3OTOJ 3GFHA 2YTCA 2B51A 3OVSA 1RTDA 3TW0A 2MKSA 2XMMA 3L3CA 2YKQA 4P7VA 3RW6A 3FBCA 2UVUA 4RW7A 5F9LA 4L75A 2QL5B 2VUGA 2VDHA 1TK0A 1UPPA 4CLFA 1T05A 3I0RB 2MQQA 4M8LA 5HMXA 1VLOA 1B7YB 5LSRA 4ZCMA 3P45B 4XDDA 1RAHB 4ZVQB 3MD1A 1Q8IA 4PG6A 1Q5VA 5CYJA 3W2WA 1VQOS 3CC7S 1VHIA 4USIA 3TZZA 4U96A 4DV1J 2HNZA 1UWBA 2WZ1A 5KT3A 2FUG9 3J81j 2QMWA 3GIKA 1H98A 2LA6A 1PIEA 4FYDA 5IV3A 1IXKA 2VHGA 1SJFA 1X5TA 2UVRA 1G2EA 1NMEB 1TK5A 1Q5YA 5THWA 1XMQF 3LP1A 2R7QA 1UA1A 1L5UA 3DFEA 1KONA 4C8LA 2CQCA 5EWEA 1C1CA 4F02A 1E6YA 2ZBRA 4U95A 1S1XA 3P3DA 4PZVA 3PV8A 4ER8A 5HQLA 4DL4A 5B7WA 3MCMA 1GXLA 2V4JB 2DB1A 2HKEA 2RS8A 3KG0A 2LLZA 2FPHX 4UQGA 4X4NA 1HNVA 2VC1A 1BQMB 4DSEA 1BUXA 4KSEB 5HK4A 3TVKA 3DOKA 2AGPA 1PJ6A 1F2GA 3ZO7A 4WCEQ 2AEMA 1I3OB 4LF2A 1N34F 1WI6A 3R3TA 1FE0A 3OD2A 3OR2B 3CCUS 3TEHB 3FK4A 5HL7Q
chains in the Genus database with same CATH topology
2FHJA 4IRDA 1F5BA 3TUZC 3IBWA 3FMBA 1ZAVA 2XY5A 4ZP6A 1F9FA 3KJVB 5BJRA 4IG0A 4TLRA 5L1KA 3MM6B 2KFYA 4DS5A 4LSNB 2DNQA 2XGQA 3OV7A 2K1RA 3PRDA 2Y1IA 1X4FA 2VPWB 2AX0A 1N36F 2VOPA 2DRBA 3E01B 3S6EA 4CH0S 1RT3B 2WONB 3JYTA 3VAIA 2RT3A 1D9FA 2BVZA 1S1UA 5IXUA 3SCIE 3KTQA 2YKOA 1JKHB 3VCDA 1C0TA 1JLFB 3NP5A 1SJRA 4H4KA 3MPYA 4NLDA 2CIMA 2PMHA 1IBLF 1FKAF 2BE2A 2F7VA 3MMCB 4ES1A 1WD6A 4M63A 3V6JA 4M5DA 3MURP 1FCAA 1NKCA 1U6BA 1NNDA 3OUYA 2P9GA 3PZPA 1RT5B 3NNAA 2RD5C 1XK8A 4J9OA 3GG0A 3HHKA 3BN7A 2VB6A 2PSZA 1TL3A 4AXJA 2CPEA 3T6JA 3V4MA 3FQKA 3TO8A 3SQGA 2XEXA 2F40A 3K5OA 3CJ3A 2ROEA 2XY7A 2VQFF 1S9EA 1D9DA 3VAHA 1F0XA 2QZ8A 1KVJA 5LXYA 1URRA 2GO8A 1LW2A 3IRXB 1H2TZ 3H4BA 1U1QA 3M9OB 1S0OA 3VAFA 3GZ7A 2B4VA 2JC0A 5CHCB 4ZVEA 3K7RA 2DGXA 1FKPA 3D28A 2A18A 4O4GB 1WHXA 5DDOC 1OIAA 3OSNA 2K3KA 2DTJA 2G1DA 5IM0B 3CSKA 3LH2S 1HWUA 3A8EA 1HYSB 2GO9A 5L38A 2PMZD 2DGOA 4FZVA 2UZAA 5KFXA 3TUJC 4PXCA 2JLGA 4ICLA 2GQCA 3KK1A 3MEEB 5CYQA 2C3UA 3Q2TC 3D0IE 2OFHX 1FF2A 3RRHA 3VZIA 2DR7A 1CQNA 2R2SA 5L9XA 1LW0B 3HKWA 2HNZB 3G6YA 1UEUA 4RW6B 3I87A 1U2FA 2OPRA 2PO4A 3DDKA 3CJ5A 1DURA 5E7OB 2IA0A 4LQ9A 4DFPA 1JX4A 2KFNA 1UEVA 3HHLA 1XEZA 2EFPA 3FMWA 5JVHQ 1VQ6S 2XULA 3CCRS 1B7FA 1Q8BA 2OO4A 1SKSA 5CQGA 4OZ1A 3NRBA 4TQRA 4PQUA 1NK4A 5SUHA 4B3OB 1YI2S 4KT0C 2J9DA 2OMLA 1BQNB 4RW8B 1ZETA 4Y2KA 2N3OA 1SUQB 4K4TA 4IH6A 4K4UA 2EWHA 2KT5A 1DTQB 2I9SA 4KO0A 1KN6A 2ZD1A 1R0AB 2LQ5A 2J0SD 3PY8A 3P5TL 2OAUA 2GV1A 2HGLA 2WB1D 3G6VA 4UW2A 3BDPA 5MAOA 2ZOMA 4QW8A 5D6GA 5EUHA 4I6AA 5A8KA 3S8SA 4Q8EA 1U45A 4NCGA 4YMEA 2CJ9A 1U8SA 2HAIA 1XBWA 1FRLA 1U25A 2CJAA 5E2QA 2M88A 4LIWA 3IS9A 3I31A 4I2QB 4X62F 4KJIA 1U1PA 5I3QA 3MM8B 3EPIA 1VQ7S 1IKWA 4QR1A 5D3GA 1QLNA 3AB4B 5EWGA 2E1MC 2V9WA 4TLQA 3TQ1A 4OX6A 2MY7A 4J9NA 4PRFA 1JLAA 2AYEA 3HHEA 1MROA 3V4IB 4GO7X 4DSLA 2Q66A 3KK3A 2R7XA 3RR8A 1WHWA 2MHEA 2F3JA 1S1XB 5D78A 2VOOA 3UWTA 4NWBA 2HLUA 3HM9A 2BM1A 2JZ5A 2CVIA 4ATNA 3TP2A 1ELOA 3CVKA 1B0TA 2GGPA 4KHRA 4ZPAA 4QIFA 4DQSA 1ZZNA 3I0SB 3NAHA 3OJSA 2AJ0A 3M6WA 4PG8A 1KD1T 4EWTA 5DGBA 4EBEA 3LPYA 2C3YA 4YEAA 2E5JA 1H3DA 1B0VA 3TVYA 4E98A 4YB1P 4WKRA 5JUMA 2CQ2A 2L08A 1HBUB 3HFKA 1JNZB 2DCLA 2AD9A 2LMIA 3CCJS 3NCPA 1OO0B 1FJ7A 1VRTA 2ZFHA 3DRPB 7FD1A 2JX2A 2KRRA 2UP1A 3BO3A 4PPZA 4PG4A 2DRAA 3OFFA 3BSOA 3K8WA 2R7TA 3L7OA 2CQ4A 3DOKB 3M30B 3M4XA 3PO4A 1IKVB 1IQTA 2F1FA 2JJ4D 2XNRA 1T3NA 1S0MA 3OTBA 3FCHA 4C8YA 2GW8A 1KQKA 4DFKA 1RTJB 4Y3CA 4DN9A 4LF8F 5T14A 2IAJB 1XN9A 3DLGB 1PC5A 3KK2B 2N4DA 3BQ2A 1JMTA 3PX4A 3KLHB 3M6XA 1HI8A 4ALZA 4IRCA 5J1EB 3R1HA 3GYNA 1VBXA 3UQSA 2MJNA 1X0PA 1RT4A 1U7LA 4RX6A 2FJXA 3I0RA 3C8YA 4DR3F 2RRNA 4D3GA 1X4CA 2VODA 5ADZA 2WTFA 3HT3A 2ZHAA 2G13A 4IG0B 4O0IA 1FK9A 3DMJB 3GFXA 3RBDA 1NKBA 3VZHA 4LF4F 4QWAA 4LF6F 2ABYA 4GMKA 1J5EF 1LXNA 4YB7A 2DNMA 5KFMA 3FEZA 2BJDA 4DSJA 2ZDOA 4R0JA 1ULRA 4ZHRB 4DF8A 4RWWA 1S1UB 2MKHA 1N5YB 1K8AT 2ZH3A 3FZBA 1C0UA 4HYKA 5D4PA 1X5PA 5CCMA 1XNQF 4RNHA 3Q8QB 3RB3A 3C66A 4DOZA 3CCES 1LXJA 2KT2A 3B8HA 2FJAB 2WBRA 1S10A 2P6TA 4RU9A 1TP7A 3DDNA 2DNLA 1P6TA 3DLLQ 1S1VB 1SIZA 2IC3B 1SV5A 2HVZA 3DOLA 3N6NA 4PR6A 4U7CA 4Y2IA 1DTTB 4KTQA 2F9JA 1Y00A 1RT7B 1PSDA 1FTRA 3PJXA 4V19J 1O0PA 4O23A 1OS5A 4WE1B 5AE1A 1UA0A 1URNA 1VI7A 1HFEL 4R8UB 3T1AA 2CZ4A 5B0GA 5KOWA 2ZH9A 4JYAF 3M2RA 5A6WA 2AYGA 2VFUA 1M5HA 5DGAA 2UU9F 4HT5A 3DC2A 2VL1A 3IGVA 1S0NA 1KQSR 1D8ZA 4HEA9 4I2PA 2GFFA 4CH1A 3KYLA 1NJYA 5IFMA 3SI8A 4WXWA 5F8JA 2KXFA 2ILZA 3CCVS 3OHAA 3BDEA 2GJIA 2XI3A 5L1JA 2ZZMA 3B78A 1RK8A 2CQBA 2ATLA 4N56A 4ERDA 3MMBA 1P1LA 3MEKA 2V9KA 2BANB 2HFOA 2VPYB 4RBUA 2BQ3A 1FNMA 2XS2A 4ZMMA 1WHYA 2UVWA 1ZM4A 4DJBA 1QAXA 2FLPA 2QEXS 1Z1ZA 3FSXA 4CNYA 3OL8A 1MU2A 2V8GA 3H98A 4FN5A 5LJ5Y 1HBNB 1R8PA 4R25A 4WZQA 1TFWA 5EGYA 1FDDA 3VALA 1KHWA 2R2TA 4M94A 1WI8A 1P1TA 1IN0A 4OJHA 2FJDB 2J0WA 5KG7A 2VA3A 5E3PA 4Y6IA 5CA5A 4MAKA 5CYMA 4C8OA 2E9ZA 4OL8A 5D4LA 1EETB 2W9CA 2GIRA 3RU0A 1U2RA 2GHWA 2VFTA 5F3TA 2KG1A 4J9PA 2XLKA 1S48A 4RBTA 3UD3P 2AQ4A 1Q53A 2M70A 4NLRA 1OPZA 4DBQA 3THVA 1X9SA 2A2DA 5KFGA 1U1MA 3LP0A 1SL1A 4RNOA 1UKUA 1V6HA 1Y9OA 2MDAA 1R8BA 4X4UA 2V4JA 1NH8A 4LVNP 5I3UA 1GXUA 3O8WA 2NPFA 1NHVA 2CJBA 3IO1A 3IWXA 4J5OA 3GR0A 1LWCA 1P9QC 2FB0A 2JVRA 1X9WA 3PFOA 4I64A 4NX9A 5JVGQ 1XNRF 2AJQA 4B9SA 1X7VA 2HRYA 2MQNA 5FIIA 1HWKA 4ED2A 3SV3A 1H7XA 4X4PA 1FVSA 1NK8A 4HT7A 3PEJA 1HWJA 3CCQS 3LQVA 3C6TA 1BQMA 4YB6A 2RQKA 1B64A 3OTDA 4PWDB 3OXGA 1NJIT 1TKZA 3NGDA 4DR6F 2YWEA 3TARA 2UXCF 2OFGX 2GMHA 4FVCA 2QA2A 2VBXA 2J0XA 5A8KB 1HR0F 3R5AA 1SBRA 3SFUA 1N33F 1VQ9S 2GMJA 1E6VB 2V5HG 3WBZA 3IS9B 2B7CB 2BW2A 4ZVGA 1QVFR 5KFLA 5KG4A 3HVTB 4KIAA 2XNQA 2C42A 3PW5A 1SC6A 2D1CA 3KG4A 1Y4ZB 3LAKA 2RKIA 5CCLA 5CD4H 3CE8A 2Z0GA 3J81Y 2B4OA 3BR9A 4NA2A 1JLAB 2JDJA 3HXMA 2MKIA 3MUVP 4H4KC 1TL1A 2PEHA 2W4PA 4LT6A 5KT2A 5J2MA 3EXCX 1VIOA 2DO4A 1GNKA 2QRRA 3V6DA 5CZVA 2VG7B 4N77A 3KLVA 4NCBA 1X4AA 1T02A 2CPXA 2DNGA 4O3NA 5DG8A 3JB9k 4DUYF 1M5VC 1DRZA 3BQ1A 4DR1F 4X64F 3WC2A 2VKRA 3PX6A 5IZHA 5E41A 4LSNA 2YX4A 2CPFA 2GCFA 3H8YA 1YTYA 4YHHF 2MQMA 3E01A 3MEGB 3NS6A 4HI1A 4DN0A 1RT3A 3KHGA 1FVQA 4MKAA 4HH1A 4UUWA 2ALZA 1NO8A 2CQ1A 2GHPA 2J7KA 3UFCX 2AP6A 2VBWA 3BF4A 4TXSA 1N8RT 1JKHA 1VRTB 3M9MB 1JLFA 2BACA 4G1QB 3UI3A 4KPYA 2HHQA 3MMCA 2CPJA 3WC0A 3T5JA 1RDRA 3DXSX 4KHMA 4P7TA 5KG6A 3HI9A 1VQMS 1RT5A 4EGLA 2FHMA 4CO1A 5GADU 3MUMP 1TK8A 4ED7A 1HNXF 1BQXA 2VONA 4O3RA 1UP1A 1B0PA 3DCAA 4ZPWR 1LFPA 2RMLA 3OXFA 4ZOSA 4URGA 3QAEA 1KRPA 3K59A 3HHNB 1Q78A 2CKWA 1Y5IB 2A2CA 1LWFA 2DNYA 2F8MA 2GMLA 4JI0F 3SSQA 5DDQC 4B08A 4F3OA 2CQPA 1ZTTA 1K73T 2RE1A 2PE8A 4ELVA 2MPUA 1IBMF 2MKKA 2P6SA 3D5MA 5CH7B 4C8ZA 3GFZA 4AUKA 3O6QA 3OSPA 4NA3A 1N32F 2FHJD 4NOHA 1N4LA 3IRXA 3MF5A 1Q7LB 3AAWB 4IRKA 1TKXB 1JLGB 3NCRA 2KHCA 4CIOA 4TU9A 3HHLC 4O4GA 2DGUA 1YGYA 1TUVA 5AXKA 2CPDA 3OXLA 4F4YA 4ED5A 3QGIA 4A4JA 5IM0A 3IR6B 4I6YA 5DDPC 3GQCA 1A7GE 4PCQA 3Q23A 1YVFA 1HYSA 2RUGA 1RYRA 2QSFA 2GIQA 1KEKA 1TAUA 1ZYQA 3MPWA 2M3DA 3MEEA 2UV8G 5DLGA 2GX8A 2HW3A 2PI4A 1FRMA 2BA9A 3DOLB 3I5AA 1SV5B 4A8MP 2ZJQQ 1LW0A 3G6XA 4RW6A 1DARA 2ZDPA 3H25A 2Q6BA 2K3IA 3LGNA 5A2QY 3KLEB 3LWLA 4OZ5A 1MMLA 3IRWP 1FRJA 3QYYA 5M2RA 3W2VA 4UY8T 4LFBF 3CO9A 2HLTA 3UR0A 3KHLA 3PRBA 4TY9A 1Q1KA 2ZVSA 1SI9A 5HMWA 2OJ3A 5LSLA 1S76D 4KAIA 1UW4A 2POKA 4QQBA 5F3ZA 3HZGA 4DL7A 3PW4A 4ED0A 1BQNA 4RW8A 1FT8A 4TU7A 2IJFA 2FTRA 4DQPA 3QZ7A 2R8HA 1SUQA 3D2WA 4U6PA 1VRUB 3MMBB 1IJEB 2ZKTA 4RW9B 1X0FA 1WTFA 1R0AA 5K14B 2DGVA 3HO1A 4Q2LA 2C22A 1JK9B 2ZH1A 3T1YF 4EO8A 5JJBA 3HPOA 4DX8H 2Z2MA 4JBCA 4BS2A 4MIWA 1MU2B 1XR5A 4PXBA 4OZLA 3S7RA 1W25A 3SSSA 5GAEI 3TI0A 1T7PA 2N7YA 3AB2B 5EDWA 2HFNA 3U1NA 3GR1A 4TY8B 1HA1A 3NAIA 4LSLB 4K0KF 5HO4A 1N0VC 1S0VA 2ASLA 4X4OA 3ICLA 5KFVA 3ZFVA 3VAGA 4I56A 4PPDA 4I2QA 2Y1JA 3MM8A 4BCAA 4B3MF 2MY8A 2RJZA 1VGYA 4NYZA 3OVAA 1N6QB 1UVJA 3KMSA 4WU2A 1JLBB 5CYMB 4CO2A 3DI6B 5LT5A 4AXIA 1NU4A 2LQ9A 4H4MB 4ZS6A 4DV7F 2QIFA 3AQPA 1DQAA 2AGOA 3OL7A 3HHLD 3QGPA 5H9EJ 1HNIA 2HS4A 3G86A 2J0QD 4IOAQ 3J7YU 1U1RA 5A8WA 1UVMA 2ZZNA 2PA3A 2ZC4A 4F50A 4JV5F 5LL6d 5KTQA 3LP0B 3UE2A 1RT2B 3X3UA 4QCLA 3D1QA 4I68A 4BDPA 3IR5B 2KB2A 1FRKA 3CB4A 5I3UB 4X4QA 2HNYA 3I0SA 4W92B 2LDIA 1D3WA 1LKZA 1S79A 1LWCB 1IKYB 4N8NA 1TKTB 5E0OA 1M90T 1M5PC 1HW9A 1QAYA 4R0EA 2UUAF 3MMAB 1HBUA 5AE3A 3OL6A 4HI2A 1O51A 1NK6A 3GILA 4DUZF 4F4XA 3F73A 3D0HE 3DRPA 4G6VB 4NYPA 3BO4A 5G4DA 1Q81T 2YWKA 2ZC3A 4MYUA 4OHXA 5D4NA 1KS2A 2HWTA 3EGWB 3GV8B 3QMQA 3M8RA 5KFKA 3M30A 3C46A 1IKVA 1U6ZA 2QA1A 5DJBA 5KFUA 3WX4A 3H4DA 1D9AA 5G0RB 4FP9A 1FKOB 3NMRA 2DGQA 2O1PA 4V19X 2B5JB 4JI2F 4F25A 4MK7A 4GC7A 1RTJA 1VC0A 2E44A