2NZCA

The structure of uncharacterized protein tm1266 from thermotoga maritima.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
80
structure length
80
Chain Sequence
EKRFYILTIVVEDREKAYRQVNELLHNFSEDILLRVGYPVREENMAIIFLVLKTDNDTIGALSGKLGQISGVRVKTVPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title The structure of uncharacterized protein TM1266 from Thermotoga maritima.
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics/unknown function
total genus 23
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2nzcA00
1Q5VA 2BJ9A 2F1FA 2WVFA 2WVCA 3OD2A 2WVEA 2BJ7A 2BJ8A 2Y3YA 2CADA 2WVBA 2NZCA 3BKUA 3LGHA 3BKFA 2CA9A 2WVDA 2CAJA 2BJ1A 2BJ3A 2HZAA 2HZVA 2PC6A 3BKTA 3PHTA 2FGCA 1Q5YA 3QSIA
chains in the Genus database with same CATH superfamily
4ETZA 3MTJA 1NNDA 3OFGA 2RUSA 3DDKA 4NL5A 2IY5B 3D28A 3H5YA 1Z2ZA 1HWLA 3K5OA 2UVWA 2MLXA 2YPYA 2HK2A 2OTLS 1FRMA 4ELVA 2B56A 1U6ZA 2CDQA 1WC0A 1VQ6S 2ZD1B 3SSQA 4N77A 5HQLA 3N9UC 5DDPC 3DRSB 2YBVA 4ZPDA 1PYOB 2J0SD 2J6UA 1KOOA 2HWIA 1HWJA 3GCWP 4WE1A 3WHIA 2C3MA 2GW8A 2BQRA 4RUBA 3I5AA 5HLFB 4ED7A 1HBNB 2ZOGA 3NGTA 4ZPVR 3PNIA 1RTHA 3W62A 3M9OB 2LDIA 2O67A 1L3TA 4PG4A 4DHVA 2RVJA 2ZH3A 1S9EA 2ZOMA 3KG0A 3MXHP 3OL6A 2I1RA 5HL7Q 1E6VA 3KUEA 2AT1B 3TZYA 1X9MA 1VK8A 1DJ0A 2ABYA 1WC4A 4OV6A 1GXUA 2DHSA 4CIOA 2H5JB 3FC9A 8ATCB 3AOBA 3H25A 2F9DA 1Q8IA 4WE1B 4ILMA 2C2NA 3GB0A 1HR0J 5J2MA 2DHHA 2V69A 4OI0A 3TYTA 1S1WA 4X4UA 2AJ4A 1RUSA 1RTHB 1KDNA 2KXFA 4FKYA 3ENAA 4HACB 3IM8A 3AXMA 2MKKA 3FFIA 1WHXA 1S9EB 2MGZA 4PXEA 5I3QA 1JXLA 4FNHA 3P3DA 4PZVA 2E9RX 5IC6B 1C4AA 2PO4A 1UEUA 1RU2A 2PN6A 3W3SA 3MAAB 4Y0FA 4Y3CA 1UEVA 3W61A 3FZ2A 3CCES 3UE2A 2V9WA 4ZOSA 5ETQA 2QTWA 2AGPA 1JLGA 1S1WB 2Z2YB 4OQJA 4KAIA 3OR2B 4C8OA 3TNVA 4EBCA 4NLQA 1IBCB 2HZAA 5DG9A 2DGVA 3UCGA 2H9ZA 4JYAF 2NXUA 2PA8D 2MGZB 3THPA 2W2NP 5HMYA 1VQPS 2ZNZA 3RRKA 3Q8UA 2A18A 3VAKA 1ZH5A 3A8EA 4DR7J 1CSJA 2V8DA 1RT2A 2C2EA 3EYZA 2AGQA 4J9OA 2Q3PA 1N56A 4P9SA 2ZVSA 4NA3A 3W9JA 2R4FA 1SKUB 1NHVA 1DURA 1G6BA 1TR0A 1WDTA 1PKUA 1S9GB 3ZZ0A 2NCKL 5LJ5Y 4CM0A 5B0EA 4IO9Q 3H5XA 3CD7A 3W60A 5B0CA 5L46A 4I69A 4TQRA 4FYVB 5KFXA 3ULHA 1KNZA 3FUYA 4WXOA 4H4MB 2DNRA 4DU8A 5D4PA 2D9PA 1GX5A 1RAAB 1UAWA 4L6V3 4R5PA 5F8IA 3HKWA 4DS5A 1Q81T 3WC2A 3HHLA 1WG4A 3IO1A 1BQNA 2ATLA 1KP6A 4N8NA 4Y00A 5KFVA 4LF2A 3MM5B 1D9FA 2E1MC 3IN5A 2P6TA 3DRXA 1YJTA 3MPDA 4CT9A 2JFDA 2M4MA 2FPHX 4XPCA 2VG5A 2OGUA 4EWTA 5FDLA 2B4UA 3HHEA 2CJAA 4KGKA 2FY8A 5A8KA 4A8FA 3OJSA 4RUCA 3IBWA 5GMDA 4R5PB 2WVFA 1RYSA 2CQ3A 3HHLB 1HQUA 1CPZA 2YWKA 2XI2A 2KXHA 2BZ2A 4EYHB 2FJBB 1Q8LA 3OFEA 2XNRA 1QSSA 4U7CA 4P7VA 2HGNA 3B4MA 4DLEA 4AQYF 2HYIB 3N5FA 4B3SF 5J1PA 3OXFA 1ZAVA 1WKLA 3K0JA 3G2XA 3MMCA 2RDJA 2VG5B 2IMOA 2JVRA 4DI6A 4YR2A 1S1UA 2L9WA 1FDDA 1IBLF 5HBMA 4DV7J 2G2YA 5A8KB 3GV7B 1AZSA 2DR5A 3GJSB 1EP4B 3ISND 4N47A 2A2DA 2J7WA 3UDEA 2E5LJ 4IFYA 1HQUB 1IR0A 2HSEB 1FXRA 3DXSX 3HZGA 3SMZA 3W5XA 1LK5A 1FTCA 1YZ6A 3RB3A 1EHWA 1EQMA 3QRPA 2M5YA 4Y2AA 2RU9A 1J2VA 4LF9J 1XNRJ 3R7BB 5DDRC 3MMCB 1OSCA 3CDAA 2KZMA 2Q66A 1G7CB 4Q8EA 3MEGA 3UPFA 1CJTB 1S1UB 3UDVA 1TUWA 5HBMB 3CJ5A 2J9EA 4USIA 1IJEB 3K5PA 4QW8A 2HNZA 4J7CA 5A6PA 3LP1B 2ZH1A 2BE7D 4JI8J 2HFZA 5J1EA 4RBTA 2W2OP 2NS1B 4B9LA 3CDUA 2LVWA 2D41A 2V6AA 3VF0B 5HVGA 1T8EA 1TTHB 5GADI 3TAQA 2FJDB 2BABA 1VK3A 4PWWA 1U6FA 3WIUA 5J1NA 4AE5A 2B8PA 3MEGB 1HBUB 3U1LA 4F0KA 1RLDA 4NLGA 4NYOA 3PJXA 3GJQB 4X64J 2CUYA 2HNZB 4Q43A 4LVOP 3D6FB 5RUBA 2XYGB 3NNCA 2DGUA 3PM9A 5KFQA 3BSOA 4UZBA 1QVGR 4Y65A 3AHPA 2HBZB 1VGYA 2ILYA 2OEKA 4CLWA 1U26A 1F9EB 1QD1A 3ILJA 4Q2MA 1Z1ZA 2BJ8A 2DY9A 3TVZA 4ED5A 1XTZA 3OXGA 2HS4A 2KN4A 4CO0A 2J7KA 2NYIA 1SUQA 1Y4ZB 3VQSA 2IJRA 4U9RA 3E3XA 1N0VC 1O5JA 1I1GA 1S6PA 2DXDA 5GMEA 4DPUA 2GFFA 4DS4A 2ZE2A 2QL7B 4K2JA 4DV4J 2XCAA 2PC6A 2J9CA 1U6BA 3N0VA 4MTPA 3OLBA 1UZHA 5B0DA 3CJ2A 3OTEA 1N6QA 1FEEA 1N48A 5L1LA 4TKTA 2IVMA 4CH0S 2IM1A 1U8WA 2Z58B 2DHAA 4I6WA 3QJLA 1NPKA 3MPVA 4GC7A 2YWGA 2BX6A 1ZZFA 4K59A 1PAUB 3DCAA 4JV2A 2KHCA 3DLEB 2VPWB 2RB7A 4PG5A 5F41A 4L3NA 4UOHA 3QMQA 3M32A 2N82B 3EGZA 3LGMA 1PBUA 2ZKTA 2CRLA 2DB1A 5KOWA 4DN0A 1RWWB 1R8CA 4JI3F 4R25A 2MKCA 1CJUB 1S79A 4TY9A 3PY8A 1JJ4A 1T9TA 3IWLA 3JTNA 2NREA 4IG0A 1NJIT 2Z0GA 1AXQA 1F3VA 2HQFA 1K44A 3C19A 2F8EX 4I1TA 1SJ3P 4DDFA 2CJXB 1RYRA 1BUXA 5LMNJ 2BM1A 3C6TA 5E3RA 4PG6A 1AFIA 4J9LA 2VDIA 2ZZTA 2RHSB 3UO0A 3T1YJ 3B4DA 3M32B 4QPXA 3TVKA 5HMWA 3BN4A 3DYAB 4IH6A 1Y11A 2OIHA 1X5SA 2FVRA 2J6TA 3V6HA 1RACB 2JEIA 2IVYA 4DL6A 3R5DA 2A3JA 2WRMA 1N52B 3I32A 2VASA 4DR5J 1YDLA 4XDCA 3HPOA 3M2RA 2AYMA 2J76E 4X65F 1QUVA 1LWEB 3IR6B 2EFNA 3RB4A 4IFVA 4ZVTB 3HHKA 2VOOA 4DR4J 3Q8VA 4Q0BA 3RAXA 1N36F 1HW8A 3C6UB 2UU9F 4EGLA 3R6LB 3H2UB 4UT4A 1JNZB 1HI0P 1KQGB 4M5LA 5DG7A 4LF6J 1VQYA 1VS3A 2G0JA 1XMQF 4DF8A 5ETPA 2GZOA 4WTYA 1S7HA 3SV4A 1T0TV 4TU8A 1Q7LB 2J8AA 3Q22A 1FA0A 2XZTB 2P9EA 1T3OA 2E1PA 3NXZA 3WQPA 1HI1A 1HKAA 2UXCF 1NK8A 2HHSA 2BVZA 4Q0BB 1CULB 1FFGB 1KLMB 2BJ3A 1RA7A 3O8WA 2WZ1A 1N5VA 3CEDA 1VRTB 1SQEA 4IRDA 4WZMA 3LQVA 1F3FA 4F3MA 2MY8A 2XY7A 2H51B 4Y6IA 4KV8B 2ASJA 3D3BJ 1SCJB 4CNYA 1IQZA 4PXBA 2Y3YA 3Q24A 2KM8B 2JZ5A 1ICEB 3TAMA 4L72B 3TZZA 1KHWA 3OHAA 2KHDA 1EB0A 1U25A 1RB0A 3NBPA 3I96A 5KFTA 9ATCB 2HPUA 1LW2A 3K2YA 2IJNA 4ZKAA 5M2RA 2XC9A 2FHJA 4RX6A 4RZRA 2FVQA 2UUBJ 2XS5A 4U67Q 2G4BA 3HT3A 3TEGA 4ZVFA 1CJKA 4AL5A 4HI1A 1HMVA 5DM7Q 4LT6A 2HW3A 3CDBA 1HQ2A 1VQMS 3HF5A 4DR3J 3EVWA 5LJ3Y 1QY7A 2YWFA 1VQ4S 3JSBA 3TAMB 2HNYB 1LFWA 3GP9A 4YQWA 5KFZA 5KFCA 1BD6A 1RBAA 1AUDA 4QWEA 2VG7A 3PW4A 4YS2A 1ITPA 3NBPB 1V9OA 1SC4B 3Q0AA 3DFEA 3Q8PB 5DS7A 1LW2B 1QAIA 2DNKA 4NI2A 1EKRA 2FQQB 3G82A 1VQSA 4W92B 2F4VJ 4F2RA 1WJ9A 2EWHA 2HHWA 3T19A 1RBLA 1HMVB 3RG6A 1K9MT 1FCAA 4IOCQ 2HLTA 3D66A 3ILLA 3IG1A 2X3GA 5E3AA 6AT1B 1S1TA 1FO1A 1B64A 2Y9HA 3IGNA 1RU1A 5D77A 1C0UB 1VHIA 2X51A 2NZ4A 1MROA 1CS4A 2VG7B 1T7PA 2Y8YA 3ITHA 3DHWC 3NGRA 1FERA 1PILA 3ZZYA 4NI2B 4C11B 1FWKA 4F26A 2FZGB 3MR2A 3G82B 1D09B 4KFBB 1RTJA 1N5SA 3MM7A 1FDBA 3AFGA 3VGVA 5D0HA 1RAFB 1MWYA 3UR0A 4DUTA 4C4WA 3UN5A 3OLAA 2MKSA 2XSJB 4FN5A 2D9OA 3DLGB 3TA1A 5FD1A 3IG1B 3VHQA 3UD4P 1S1TB 4QR2A 3UDCA 2VBWA 5KT3A 5EGYA 1JIHA 2DJWA 2EG1A 1YGYA 4P72A 3W65A 1GTEA 2FJVA 2M88A 3VCDA 4ECYA 3HD2A 1UA1A 2GMLA 3DRPB 3DHXA 2RQMA 2XSFA 3MM7B 1VQKS 3ZZRA 1C1BA 4DWIA 3SDEA 2OHDA 2DGTA 1KWMA 2YKMB 3QBCA 1HNXF 4O0NA 1NHKL 3ADAC 4L76A 5DGBA 1NK6A 1LWXA 4DQSA 3KKFA 2BXJA 4OHZA 1QUPA 4UUWA 1OO0B 2XYHB 2MQLA 2J6SA 4L73A 3GSIA 5J2NA 3QYYA 2YKPA 1FX2A 3OW2R 4TVAB 1MSWD 2DT9A 5IM0A 4O4RA 1S57A 2AEJA 1IR1A 4NOHA 3IAS9 1UWAA 1VOMA 1S48A 3A8JA 4OJ1A 2EC2A 2VH7A 1U1LA 1I5OB 2GJ2A 3EGNA 1EAYC 1CC7A 5HAOA 6FDRA 1ZAXA 1G2EA 4JOUA 3VV2B 1A6LA 4G6VB 3S8SA 2W2QP 5J2NB 3QO9B 2UVUA 4NE9C 1U09A 1VISA 5IM0B 5LMUF 4V19J 1FJEB 3FRZA 3FBCA 4M94A 1L5UA 2VFUA 2CJYB 1XERA 5B7WA 3R1HA 5LM7E 4ANCA 1TELA 2LKZA 1XR7A 2G0IA 4UZCA 4CI0B 4KY3A 2KZZA 1XR5A 2E5GA 4HI2A 2MQ8A 4NZ0A 5K8MA 4B3TJ 2VJVA 3CXCR 2DRBA 3VR1A 2W25A 4I2PA 2ZJRQ 4K7QA 3CJRA 1FNOA 4ZVUB 4USWA 4LF7F 1UJ4A 5CCMA 3DOLA 2M9KA 1N33F 1K8AT 3KUGA 2WSCC 1S7IA 2W9BA 1I6JA 1IKVA 2D7SA 1PJ5A 4YY3J 3I55S 1L3SA 3RAMA 3J7YI 1F60B 4LF1A 1V5IB 3C3LA 3GV8B 4XO0A 2FUG9 1NSQA 1RT3A 2OUGA 4LIWA 1S0VA 3SQGA 3NLCA 3GU0A 1RCOB 2I8EA 3DOKA 1H2TZ 2YNFA 2QFJA 1MU2A 2DEJA 2AIRB 5KFSA 2Z30B 4KKOA 2KVIA 2LU2A 3CULA 3S7RA 4KO0B 1KFDA 3R6GB 1JWWA 3J81U 1FDNA 2I5JA 1NK4A 1IKVB 4WBFA 3JYTA 1HNZJ 2DGQA 1APSA 1WDDA 3AXKA 3MGJA 3UFCX 2ACMA 4LRBA 2D3UA 3HVRA 3U1MA 2IRXA 4LJMA 5F8LA 4X4PA 3R5BA 4DG1A 1FRXA 2CNNB 4GKKF 1RWPB 3SQGB 5KFHA 2MYFA 3H90A 2LQ5A 4C3KA 4FPRA 3QSIA 1FWLA 4B3OA 2F8HA 4USUA 1WUUA 3SIPB 4KKOB 1D9DA 3CMES 7FDRA 3RUBL 5KG5A 3PO5A 2QL9B 1QTNB 3Q2TC 3BKTA 3LUYA 1N5TA 2IAJA 4TYBA 2I5JB 3UNYA 1U0SA 2V50A 1QSLA 4JI0F 3JYTB 4Y2KA 4F7VA 3QWUA 2BKPA 5ETLA 1IVZA 5D4LA 4RBVA 4WJBA 5AJ3J 3IBCB 2Z57B 3AH6A 1F2HA 2MQNA 4AL7A 2HHXA 3ISZA 3K57A 5I3UA 2L08A 3UNGC 3V6DA 3A12A 4B3OB 2F8MA 4GKJF 4O3RA 4G65A 2DCLA 2CZ9A 4A48A 3NMRA 3NGSA 2IAJB 3G86A 1NK5A 2E5JA 4HDHA 2ZNYA 4NMXA 3JQJA 4OX9J 2FTRA 4DZ6A 1TL4A 2Y8WA 3MHYA 2HQIA 3J81Y 3KMQA 3MAHA 2QA4G 2AQ4A 2C2MB 4B9VA 4DR2F 1B4SA 1RT1B 1KBRA 3QLHA 4DUYJ 2KI2A 2GIFA 1TZ0A 1U1OA 4Z7CA 3OJUA 5MAOA 4FYXB 1IBMF 3W9IA 1HPZB 3DKDA 2K7JA 5D0RA 1HI8A 5KT7A 3CJ3A 1S10A 2QGFB 4X62J 4I4BA 4NLUA 3I9V9 3N28A 4OYIA 3T5JA 4USKA 5JXSA 4DX6A 2YVSA 4PG8A 3MCOA 3QLHB 2F5GA 2XLIA 1B70B 1TL7B 3M8PA 3MR7A 2JEJA 2YNIB 2MSTA 2ZH5A 1F5BA 3DMJA 3MTKA 4ICLA 3PKYA 4TLRA 2JLGA 3OUYB 2HWTA 1SB6A 2VB6A 2HHQA 3OR1A 1FHTA 1T02A 1N5YA 6FD1A 2VBYA 1NM2A 1KONA 4NCGA 4J9QA 3EUNA 5A0YA 5I3PA 1S1XB 3NCPA 3HFKA 1GT8A 2BANA 4W98A 2XZDB 1M0SA 1ROFA 4D3HA 1GQEA 4YB5A 3QQCD 1RWMB 1D3WA 4TYAA 4YFUA 4ICLB 5L1IA 1PYTA 1SL2A 4DOZA 2N3LA 1C1CA 5BR8J 5IQQA 4F02A 3OR1B 2CQGA 1N4LA 4DV5J 2RIJA 1R0CB 8AT1B 3H98A 3BJYA 4P52A 5KFRA 3H5UA 4QYRA 3HSZA 2UV8G 1ELOA 3BS9A 3MM6A 3PW7A 1G4CA 1W26A 5AT1B 2LEBA 1XMOJ 1NJZA 2BEFA 3BO4A 3G8QA 4DF4A 1ZA2B 1RCXB 1C1CB 2JLEA 4K4TA 3BBBA 5GAGU 1SV5A 4C3MA 1UW9A 1IQTA 3QT5A 1GX6A 5HVFA 2HS0A 4RW9A 2KFNA 1HR0F 4J9VA 3AAWB 2KO1A 2CQ4A 3K5MA 1Z2LA 1FXLA 3E01B 1HD0A 2YKQA 1N34J 4K4SA 5H9FJ 4P7TA 1F6TA 1RK8A 2ZUGA 2V0NA 3IC1A 2DPJA 2UP1A 2KH9A 2IA0A 1U2RA 3M8ZA 2XCPA 3HVWA 4LREA 3M30A 4DR1J 2OFGX 3TX0A 2XLJA 3BPSP 1VHFA 4OX7A 1RGVA 2GVZA 1VBXA 2DNGA 2FHJD 5KG2A 3M8RA 4E2FB 1VDHA 1Y7PA 1UVLA 4CT8A 1RTIA 4MIWA 2HNDA 1X8DA 4ZLNA 2A6MA 3H2LA 4QWBA 3BGUA 5EHHA 5B08A 4WYWA 3UVJA 1OYDA 3M30B 1WTBA 2N4DA 4ZJOA 4DR7F 5C42B 3LH2S 3FSIA 4WWSA 3BQ1A 2XY6A 2GAHC 2GVZB 5IXUA 3BF4A 1VQ7S 3NAHA 1UWBA 1JKHA 2VPYB 2E5HA 4ILRA 1HBOA 4YMEA 3KJQB 2HNDB 2BR0A 4WK3A 3QSYB 4EFAC 5KG6A 2B7CB 4C8NA 2BV3A 2E29A 3MPWA 2CPYA 5GAHI 4YN3B 4FBUA 3N4WA 2MDAA 1VBYA 1Q1KA 3HSGA 4NEYA 1EIYB 5HROA 3UVJB 4J5OA 4EI2A 1EETB 2XMKA 3FMWA 5E33A 3LP2A 3MD3A 4KH0B 1YJVA 1ZTTA 4EBEA 3MD1A 5IWAJ 4F3OA 5IOLA 3I4HX 1U45A 4X4VA 1HBOB 3EGVA 1S1VA 2MKIA 3DM2A 3NGUA 2KJVA 1Q95G 3KJNB 1HQEA 5KAKA 2A0FB 4KJIA 3GMGA 4DL4A 3UWTA 5C2CA 1BQXA 5HROB 1UTAA 3VAJA 3HKZD 2HFOA 4DU7A 3PYEA 2CQ2A 5AXNA 3ZTQA 2R8JA 1P27B 2XGQA 5AE2A 2OP5A 3KLEA 3LP2B 2AD9A 2G2ZA 4M5IA 2V2QA 2VFSA 5HI7A 1FXDA 2IC3B 2EFOA 4OZNA 2P5VA 4X65J 5KFAA 2BRLA 2BJ1A 2ALYB 3D1OA 3EWGA 4WXWA 3AT1B 2LXUA 3NMAA 1M5PC 4OLOA 1JLEB 4WU2A 3KK1A 5MLCV 3UD5A 2UU9J 3I0RA 4O4GB 1D0EA 4WF9Q 1R8HA 2H5IB 1HNIA 1FKOA 5A8RA 2PT0A 2M70A 3FCVA 3R1LA 1M1KT 2JEGA 4DV7F 3IXQA 3ISNC 3B6BA 5KFLA 4MH8A 3KOAA 3GE9A 3LP0A 2ZC4A 3OT9A 1R31A 5F8JA 3H59A 2RKIA 2E5LF 3DU6A 2QLJB 3KHLA 4J9RA 1P9QC 5ITHA 2HIYA 2VPZB 1XEZA 2HURA 1LFPA 4CDIA 2KTQA 3DGPB 4M8LA 3I0RB 1MNEA 2FLLA 3CNQP 4LF9F 2F40A 2R7SA 1HNIB 4ZVPB 5LXRA 1XNRF 1FKOB 3GYNA 5A8RB 1TMMA 4I7FA 4KGMA 2JWNA 2O5DA 4DL0C 1RADB 1K1SA 4NRUA 2V4QA 2LYVA 1K73T 2RUGA 1HNVA 3KLIB 2W7OA 3BGFA 1RKJA 2RKIB 1XBWA 3D0GE 3D6HB 4RR5A 4A8YA 2M7SA 4JI8F 5ETOA 1HARA 3G9CA 5L39A 3LAKA 4YB6A 5KFFA 1RI7A 2HZVA 3VAGA 2WHOA 3M4XA 3LW5C 4XDDA 3AY0A 1IKXA 2PI5A 4I7FB 2U1AA 4ZS6A 1YRXA 2K3IA 3HM9A 4DEZA 4B08A 4ED2A 1WKKA 2Y0SD 5C24B 1B0TA 4RPFA 2FLPA 4HTIA 2QEXS 2LQ8A 4X64F 4N56A 3H40A 4ZIWA 2FHKA 2OPPA 4BBYA 3BH7B 4RBUA 5KFEA 4PWUA 4X4QA 3PTWA 2MTLA 2RMLA 1YTYA 2H65B 2W9CA 2D3OR 4M5MA 4K2XA 4K4ZA 4QWDA 5DETA 4WCEQ 5IS2A 4FPIA 1VQ9S 3HVTA 1SC1B 2IYIA 2LQ9A 2APOA 3PKMA 2PEHA 2ZM6J 4P2MA 2Q79A 2WBMA 4RKUC 3POTA 4NLYA 2BJ7A 3LF0A 4RU2A 4ED6A 4OHVA 4R0EA 4CZCA 1YJ7A 4ES2A 4YHHJ 4DV4F 3Q83A 2DHGA 1HLWA 3ZO7A 4DL5A 1PG5B 5KFBA 5D15A 1N8RT 4J90A 3Q89A 2W9CB 5F3ZA 1UP1A 2WOMB 1F9FA 4FXWA 3VZIA 4K4UA 5DDOC 1O8BA 2CZVC 3I6PA 2NPFA 3N01A 5LSRA 1H74A 4CLZA 4LR7A 1JXVA 2YKNA 2VJUA 3NGKA 1U47A 1HBMA 2VICA 3POTB 3SV3A 2HVEA 4WKYA 4OYZA 4DPYA 4OI2A 4UOCA 4ZVRB 4IH7A 1U02A 2C22A 1RDRA 4DR6J 2XMJA 1WKJA 2E7VA 2VPXB 3D54A 3I0SA 2AW0A 3E8OA 2B0GA 3MI7X 2B5JA 1ZBTA 3T5HA 3EX7B 2EC0A 2VQEJ 4C2MA 4ED8A 1G1XA 4J9MA 2HHPA 2HS3A 2MJNA 4ANDA 2A10A 2BDPA 4J91A 3C16A 2GAGC 2VQFJ 4O3SA 4N76A 2YKNB 3HP6A 3RTVA 4X66J 4G1QA 4MIBA 1HBMB 1XNQJ 3NWRA 4R8UB 2R7QA 1KHVA 5LMNF 4PCQA 2R7XA 3MM8A 3NEKA 1UL3A 3MFHA 1DBDA 2JEFA 1OQ6A 3T1YF 1TKZA 2B5JB 5KFYA 4EEYA 4IQXA 2X7IA 2GQ2A 3L09A 4NLSA 1FWPA 1DTTA 4DFPA 5IQ6A 3KLHA 3TO8A 1REVA 2DR9A 1DQAA 4DV1J 1PC5A 4W4MA 1T9VA 4RW7A 5E3QA 1TU0B 1M1HA 2V8VA 4DR5F 3BGRA 2BA9A 5K9FA 2B4OA 3C15A 4USJC 4U8VA 2FVPA 4ZP7A 4NLVA 1LXJA 2RAQA 3MM8B 2DK2A 3W63A 3MECA 1BMQB 2R8HA 4DR4F 4WP3A 2CPXA 9RUBA 2WW8A 3KLHB 5AXLA 1R0AB 3GCXP 1REVB 3GJTB 1YWXA 2KDOA 4FBTA 4WZQA 4LF6F 5EX3A 1P8GA 3CIZA 3D5MA 1SC6A 4JI6J 2OMLA 3T41A 4RW7B 3KNGA 2ZBPA 4QBUA 4RNHA 5F8NA 3BGRB 1KVIA 3C15B 4MYTA 1SJQA 2QA4S 1YJRA 5IFMA 4ZCKA 2EEYA 1NLKL 1XIQA 4NLWA 4B9TA 5KFJA 3ZC4A 3FMBA 3T6JA 2NYHA 4O0IA 3GLJA 3I5BA 2KYZA 5HJYA 2DH8A 3CO9A 1FKAF 4MJKA 3SBMA 5L9XA 1RAGB 1N33J 5ETRA 2OJ3A 4ZJQA 2VL1A 3JQMA 3QT8A 2DRAA 2V63A 2FD2A 3BV8A 1OQ3A 4OYPA 3TEHB 2LXFA 2XHWA 4KPCA 2AJ0A 2OLWA 3GIMA 2YNGA 3CCMS 2R8KA 2HEKA 5CYJA 2J9DA 3CC4S 3IS9B 3PW2A 4P74A 5KTQA 2UUBF 2VV5A 1DZ5A 3I56S 2QSWA 4RW8A 4J9UE 5L38A 3GG1A 4I6AA 1DQ9A 3C14A 2FYXA 2MZQA 4P75A 3L95X 1RT7A 4CO2A 4DR3F 2BQ3A 3NRBA 2EKNA 1URRA 4F2SA 1HYSA 3IBFB 2HGMA 2I38A 1HFEL 2HHHJ 1H3DA 3WDOA 3SCKE 2HRTA 3B82A 2GQQA 1FFSB 3QIPA 4QCLA 2E9TA 3RU0A 1WG5A 2CNOB 4C8MA 3K8WA 2F4VF 2XG8A 2MZRA 2DIUA 3QAEA 2NPIA 3UCZP 2WVBA 4YOEA 3J7AN 1RTDA 1RZMA 3UI3A 2B6AA 2QC3A 2HVIA 3MPYA 2XQCA 1GMVA 5K8OA 2V8GA 3BDEA 4ER8A 3Q8SB 3MMAA 3L7UA 1WC5A 1UPPA 3J7ZT 2AU0A 4M5NA 4M1KA 4BCAA 5E7OB 1AT1B 2AHOB 1YBAA 3A8IA 4YP3A 1XQIA 3MMBB 1LWFA 2Z2ZA 2RILA 2CVIA 4ZCLA 4OI3A 5IC4B 4N7TA 2XBPA 1RTDB 2ZH7A 2RNEA 2XHCA 1YJNS 3D68A 4LRCA 3MEKA 1TL1B 4CYUA 2R8GA 2DYAA 1QAXA 1A0OB 3LO3A 1U48A 5AE1A 2L48A 5D78A 1K0VA 3KLGB 4KSEB 1T05A 1LWFB 1OSDA 3RR7A 4X2BA 1N32J 1MW7A 4AD6A 2ZBRA 5IT0A 2R3VA 3HD1A 3BZQA 3KUHA 3WZ0A 4ZN1A 5G0RB 4V19X 3CIMA 3FEXB 4BLGA 3V81A 2QLBB 1IJFB 4CYUB 1SIZA 4F4AA 4M63A 5FIIA 2EW9A 4B9UA 4RW4A 5F9NA 4M5DA 2HVZA 2RQCA 4EZ9A 5JUMA 1S12A 1KN6A 1ZOTA 2V2VA 3DRRA 4OI4A 2GX8A 1YSJA 3PW5A 1H2UX 3PJWA 3HHLC 1WC3A 4ECRA 3AA9A 5LL6d 4JP8A 3GZ7A 2XEXA 3RBEA 3MURP 1SJRA 3KMSA 3CMAS 4XTTA 3CUNA 5D0GA 4NX9A 2QMXA 4WFBQ 1WOOA 2DNOA 4USVA 4RW4B 4J9PA 3MM9A 1X5OA 3R5AA 2DITA 4Y28C 4M5KA 1SBRA 1D8ZA 1SIWB 2VD3A 5HQ8A 4DSKA 1XWLA 2GJIA 3KHRA 1YKWA 4EYIB 3TA0A 3IWNC 2LQBA 1Q86T 3G6YA 1UPMB 2IJFA 1H38A 2NXJA 3FNNA 5DLFA 3D3CJ 5T7LB 1PO6A 2QMUB 2BKOA 3CC2S 2D3O1 4B3TF 4NLRA 3CWJA 4PQAA 2PSZA 3S01A 3EZ5A 4G3IA 1YRUA 2AF6A 4LUBA 1SJ1A 4QIFA 4LMZA 4Y34A 1SVDA 2JJ4D 3HFVA 5GAEI 2YKAA 4YY3F 2K2PA 5CCLA 3M2UA 2B9YA 2GO8A 1RHQB 2X3DA 4F0HA 2BACA 4ELUA 1S97A 3MUTP 2H3EB 5KFOA 1VRUA 1VIXA 1M90T 3FK4A 1IKYA 4MK9A 4DSJA 1XMBA 3LTOA 4X84A 2HGLA 4ECXA 3IAM9 3PR5B 5FLXU 5I42A 3DDNA 3A13A 1X0FA 5HO4A 4K8RA 3FBEA 1YJUA 4B9MA 2UVRA 2VF3A 1NRKA 2KXNB 4RWWA 4PKDB 2OTJS 4DUZJ 3K8VA 1AA1B 1S59A 2HQ3A 3JQKA 1HNZF 4OYBA 1GH8A 2H5EA 1E6VB 1CVJA 4EZ6A 3TJ9A 1F2GA 3M2UB 1O51A 3UCUP 3ZZTA 4RNOA 1VRUB 1TK5A 1WTFA 3RBDA 1IKYB 3RYLA 4MKAA 3FVYA 4F4XA 2CPIA 2DHXA 5J2MB 5I42B 4QYZJ 1GMWD 3PYFA 4WIQA 5HP1A 2CWXA 2EI5A 2C3UA 3FFIB 2MLZA 3SQOP 3MWBA 3O1LA 2KT2A 5F0WA 1WORA 2EG2A 2KT5A 3K5NA 4HKQA 2LDYA 2YX7A 3EZOA 5AJ3F 1G3OA 4IG3A 3NL0A 4JB8B 4HR2A 1NPPA 4OYXA 1UA0A 3R27A 3F41A 1JLGB 1YBTA 1UEKA 3AA8A 4HHHA 1WHYA 2WONA 5DO2A 5HP1B 1UCNA 4JI2J 1M5OC 5SUHA 4DN9A 3QRQA 3M8SA 4CH1A 2ZDOA 1RP5A 4OX9F 4MAKA 1RAIB 1JLBA 5DZ6A 1RT2B 5HANA 3W8GA 1SXLA 2K3KA 2L9DA 3EJMA 1U8SA 4C98A 4HH0A 3PEHA 5CD4H 1K47A 5KFUA 3AQPA 4DUYF 1BWVA 3OBIA 1LWCA 3J7Z5 4LRFA 4S0MA 2B9WA 3ZTSA 2HVHA 3PIOQ 4WYLA 1RTZA 2FJAB 2AWZA 4C3LA 3NNAA 4GVBA 3HJVA 3G8SA 3PG9A 1JLBB 2BUNA 3I9ZA 2ACYA 3BGLA 5HQMA 4X62F 1Q4RA 3L7OA 3GV5B 3AD9C 1OPIA 2C1EB 5LT5A 1BQNB 2ZHOA 1EARA 3F73A 1LWCB 2GGPA 4OI6A 4FF1A 3AJDA 4IQMA 4NYPA 4EO6A 2SXLA 4LSNA 3CJSA 1I94J 3J81j 2VUGA 2QSFA 3VVUA 1PAEX 2ZHBA 2N3OA 4HL9A 4OFZA 2Z56B 1S72S 4K5RA 2QIFA 1ZM2A 3FQLA 1CJVA 2F9JA 5FDLB 2QL5B 2LEAA 3L7PA 1CC8A 3BPDA 1FK9A 1QE1A 4LFBJ 3B54A 3NG8A 4EUVA 1A7GE 4OZLA 4F4KA 3MUMP 1RHMB 2GGPB 3Q8YA 5EDWA 4X4NA 2CXEA 4LSNB 3P96A 3U02A 2YWWA 2I9SA 3KWMA 5BR8F 1WF1A 2FLNA 4GO5X 2XYPB 3TJ8A 4ZPAA 1YJWS 2F63A 4MKVA 4DV5F 1CJVB 1AUSL 2UZAA 1SC3B 1AZSB 3OSPA 3RR8A 3BKFA 4F67A 4DFMA 2R7VA 4B3MJ 1ZM4A 4F4WA 4IFYB 2OAUA 2C2DA 5B0AA 2KM8C 1B3TA 5F8GA 1XMOF 2Z4PA 4C97A 4Z2XA 2HVDA 5KFKA 1RKIA 2HBRB 3Q2SC 5C7PA 3CVKA 2R7RA 4YUDA 2U2FA 3IP0A 3TZWA 5K8NA 2BJDA 4KC5A 3FSXA 2FVCA 1YX2A 1NB7A 1NSKL 2NR0A 1NZAA 3TA2A 4A8OA 1WHVA 4MK7A 4DV0J 1ZA1B 4HT7A 3OXLA 2PI4A 2A2CA 3M9NB 1N34F 4FF4A 3PYGA 5KG7A 5J1EB 1S0NA 2VKRA 3FZBA 2QX0A 3D7SB 4NYZA 2W2PP 2XB2D 1S6UA 3ZTRA 4DR1F 2CPJA 2HHUA 1OMSA 4RW6A 1OJ4A 5AXKA 2OFHX 1Y3JA 2EXUA 2JH3A 5H9EJ 1Y0HA 4PXCA 4LRDA 3JB9k 1H6KX 2ZFHA 3SCJE 4CM2A 4U7UD 3PRBA 3CTRA 5D0EA 3VALA 4DQPA 2JRSA 4O3PA 2ZH8A 1Y9OA 1BLUA 4C8ZA 1H98A 3BBCA 4JV1A 1Q0NA 1XR6A 3ENVA 3TOQA 3GQCA 4KH1B 4A46A 1AROP 1GAOA 1FT8A 3E2EA 1OY6A 2QG9B 1P1TA 2FLOA 1ZYQA 1SUQB 1FVSA 4JI7J 4IYQA 1S6PB 1P1LA 4CTAA 4BS2A 1UVIA 2ZE2B 1SPBP 3FRYA 2CZ4A 2E5IA 1TAUA 4DPXA 2RF2A 3M7VA 1K0TA 2VBZA 3TAPA 3PO4A 1MG7A 4J9KA 4CWBA 1RLCL 2KFYA 4FVCA 4FF2A 1N6QB 1TFYA 5D6GA 1EJ7L 3HI9A 3K17A 2AX1A 2FC8A 2Y0BB 4RNMA 3DN9A 1S76D 5EWEA 5IWAF 4KYZA 3KK2A 2QLWA 2QLFB 1IR2A 2KRBA 1S6QA 2WB1D 3BQ2A 3PX6A 5KG3A 1KTVA 3AOAA 4DX7A 2YH1A 4JI1J 5GMKa 3MEEA 2MZ1A 3P8BB 1QDUB 1A9NB 5JVHQ 4ED0A 2RF2B 3DOMA 1UFKA 2YNHA 3EVMA 1TUVA 2YX4A 2C2RA 3R5GA 2XZWA 3BREA 3G6XA 4J37A 2BKNA 4QZVB 4ITSA 4NRTA 2K06A 3K89A 3TW0A 3ET6A 5HVHA 3KHHA 3K58A 3OFHA 4IG0B 5CHCB 4TLQA 2QRRA 1H7WA 3G4SS 1BQMA 4XK8C 1JLAA 1BXNA 1RE1B 4JI4J 1X4FA 2DXFA 3C6TB 4UOGA 2W8LA 4HHUA 3OV7A 2CQDA 2R7WA 4YB1P 3DOMB 1U2FA 4M95A 2YQ1A 1VQOS 1U1PA 2PMZD 1MWZA 5LSLA 4TQSA 5IV3A 1KFSA 2ASDA 2C3YA 2O66A 2OO4A 4I0WA 1F5AA 2MY7A 3RRGA 3M2RB 4PWDA 2EBGA 2Q1LA 1JLAB 3MOJB 4KHPJ 4FKXA 3CCSS 1GTHA 2N4CA 3TP2A 4E98A 1NCLA 1NXIA 4WP8A 2AJFE 4IFVB 1HHTP 1RHRB 2MZTA 1DY3A 2J0XA 2B51A 4XAKA 4DFJA 4IDKA 1WWHA 3O44A 2RJZA 4DSFA 3PJ9A 4LQ9A 2VIHA 3ZTOA 2ZVIA 3TQEA 1QLNA 4RUAA 1SQFA 4DFKA 4WP9A 1Q8BA 2PFDA 3LA0A 3KJVA 2W01A 2GNKA 1YLXA 2H48B 5EWGA 4FYWB 1FE0A 5SZTA 3EDQB 1OWXA 2J0QD 1GEHA 1IUJA 1T03A 1FVQA 5E3PA 1RAOA 2H54B 4ED4A 3CO0P 5KFDA 3U1NA 3S1TA 2R2TA 4EU0A 4CLUA 5EWFA 1RT5A 2OH2A 3BEGB 2HQGA 3OTBA 4ECUA 2XS7A 2DPIA 1RISA 4Y2IA 5CQGA 2CJKA 2VA2A 4QIVA 4N8OA 3UN2A 1C0TA 5IT4A 1N88A 3KJVB 2GV1A 2AZ3A 3OVSA 3DU5A 1CLFA 2G13A 5C2GA 3THVA 2D74B 2XMVA 4NMLA 2ADCA 4YB7A 1NUEA 3M8YA 2PMWA 1CQNA 1R7IA 2WSFC 4ED1A 2DO0A 2C2ZB 3G87A 3PFOA 2ZM6F 2C2OB 4ES1A 3DLBA 1CJKB 2OSQA 4IOAQ 1SKRA 4GO7X 3PV8A 2B4VA 4NCAA 2BW7A 1SI9A 1PGZA 2FJXA 2QA2A 4MMOA 3TI0A 3GIIA 2VONA 1KR4A 4YHHF 4K50A 1X9SA 2RQ4A 3PIPQ 1F1BB 3ETMA 1FJCA 4RJVA 1T9WA 2G1DA 1E6YA 2FGCA 1VIOA 2V68A 3RB6A 1J5EJ 1S77D 1WD6A 5C5JA 5F3TA 4DSIA 3NY0A 4DL3A 1J27A 3GPAA 2WBRA 2OSRA 2J5AA 1K1QA 1MMLA 2KU7A 3HCXA 1NJXA 1O0PA 1KEKA 4USTA 2XMTA 1TK0A 4DR6F 2ZD1A 2PDAA 4EBDA 1MROB 1CS4B 3T1HJ 3GYGA 3BN7A 3ITHB 3VTIA 1XJWB 2AJQA 3TVYA 4CO1A 4ID8A 1FRIA 2VQEF 1E6YB 3CCZA 1Q5VA 3H4DA 2KG1A 1RTJB 2R7OA 2VDHA 4LSLA 2VQFF 2CQIA 5HLFA 2POKA 4X66F 3P5BP 1VC6A 4B9SA 1HBNA 1XNQF 1MWQA 3GR0A 4ECQA 1WI8A 2YQ0A 4CO3A 4DPOA 3R2DJ 4H4KA 4OHYA 1QJHA 4LVNP 3WBZA 2KG0A 2KJWA 3H42A 1Y10A 2AEFA 3O3LA 4OHXA 3EGWB 3H20A 2XS2A 2ROEA 1TUGB 1X0PA 2MXYA 4DV1F 2ATCB 2WW4A 4RNNA 1JMTA 3RW6A 2HKEA 4LSLB 1VQLS 2B9EA 4CLTA 1C1BB 3L3CA 3SDEB 1YRTA 3HHLD 5FJ4A 2CJQA 1FFWB 4OV1A 4HACA 2F7VA 2R2SA 3QWPA 1TKTA 1VI7A 2FJEB 2VOPA 5DQGA 2R8IA 3JTPA 4DV3J 1M5KC 2DR6A 5CD4A 2K1RA 5DQHA 5JMNA 3F0NA 3PCOB 3QGGA 3EZUA 3KXDA 3IRWP 4LQ3A 1YHQS 4B3RJ 3VAIA 3OVBA 3MAAA 2VHGA 4JI6F 4TY8A 2MZSA 3V5RA 1SJ4P 3OR2A 2ZWPA 2MZJA 2QN6B 2CYYA 1KKHA 1TKTB 2B7BB 2QV6A 4KHRA 4BHQA 3N6LA 4DV6J 2K1RB 2PFFB 3SSRA 4NPOA 4A47A 5KFMA 5DDQC 1V3RA 4LBPA 1WI6A 4KRWA 2W4DA 1VQ5S 1BWEA 2XO7A 1UZDA 2EK1A 4I68A 2LFVA 1WSVA 2Y1IA 2YX1A 2MHEA 5A6WA 1Q53A 4FYYB 4HTJA 2VFRA 4TY8B 5DRKA 4QW9A 1ZETA 4NEZA 2DEIA 1C4CA 3VGUA 2JSXA 2W24A 3KYLA 4NCBA 2E1AA 2EPIA 1ACMB 1NDPA 3CPWR 1S9GA 5THWA 1Y5LB 1U1NA 3A1YG 2CDRB 4ZJLA 2BYCA 1GK8A 3OVAA 4LFCJ 4QR0A 1IBKJ 3NOCA 4I2PB 4U96A 3TARA 5HATA 3KJFB 3MR5A 2BJEA 4H4MA 5U47A 4U7UK 3DOLB 3QFWA 4X4OA 3HMJG 3WX8A 1U1MA 2GMHA 3J80U 2HAIA 2W9BB 3D4JA 1U2CA 2IIHA 4CLPA 1SKSA 4QPTA 3FBBA 4USMA 3NGDA 1YITS 2J8SA 1SH2A 2PIIA 3FJ2A 2HFSA 4I56A 2LLZA 2HHHF 1ULRA 4Q8FA 5D4NA 1RT3B 4Z37A 3MM5A 2W9AA 2PMHA 4LF5J 3CJQA 3DOKB 2YNFB 3CDWA 1MU2B 2W2MP 1R3NA 4A8KA 2AYGA 4LR8A 5BYQA 2MSSA 1NAQA 2H1YA 3ETOA 3CC7S 4CP5A 4ZN3A 1TL5A 5GVQA 2RT3A 3SYZA 2WB4A 2F3JA 3K59A 3ZNUA 3I5CA 5KFWA 2DIVA 1FJ7A 4DG1B 3K5LA 4ES3A 4DMZA 3D6MB 4ZVQB 3EPGA 4X4TA 2BJ9A 4CLYA 3EVOA 5E2QA 2V67A 4JI5J 3IRXA 3UD3P 2RH3A 1S0MA 2W7AA 3QATA 4ECTA 2C2KB 2QT7A 2WCXA 1EP4A 2W7PA 2M3DA 1DHMA 4LF4J 3NNHA 4NXNJ 1RABB 5GADU 1VFJA 1T3NA 2CVEA 5E5NA 5BXIA 4O3NA 3J80Y 2WVEA 2P2CB 1U7LA 3HHNB 1TKDA 1NKCA 5I3UB 3V6DB 2MKJA 3NWGA 1CJTA 3IRXB 3OTOF 1QSYA 1NEEA 1N32F 3F44A 5DM6Q 4GRSA 4QIGA 4CLFA 4Q2LA 1LW0A 3DNCA 3LP1A 3GWCA 1VCTA 5DZ7A 5KT5A 2FB0A 1ZPWX 4F4YA 2C3PA 3M6XA 2QYGA 2RE1A 1HA1A 3W66A 1LK7A 2NUUG 3LOUA 2MQQA 2ASLA 1PC4A 1PCAA 2GIRA 4NXMJ 4A8WA 3FBFA 1PJ7A 2ZBCA 4ZPWR 1HBUA 2HHVA 4L3KA 3CT9A 1FJGJ 5KT4A 2KFZA 1LW0B 1OY8A 4UW2A 3FEYB 1BY9A 5AE3A 2ADBA 1KC8T 5CABA 5BYSA 1SL0A 2R42A 4WTOB 2VKZG 3MZIA 3OPKA 3V4MA 1B0VA 2NXNA 3GFXA 3I4PA 1CG2A 4BWJA 3AJ1A 1V3SA 4KTQA 2UUWA 2EFPA 4X4SA 4FXDA 4YDXA 3DC2A 4QU7A 5KG0A 3M8PB 2DY1A 1XC9A 2RQKA 1Q8KA 1LQ9A 3DMJB 5I4MA 4U6PA 3CF5Q 2FZKB 2HAFA 2XLKA 2Z2LA 4OZJA 1R0BG 2NSCA 2HK3A 1N5YB 4DLGA 1I51B 1RQ0A 2COLA 1JJCB 3R97A 2XO6A 3SFUA 4NCGB 2DNNA 1FNMA 3PEJA 1UVKA 5A0YB 2DGWA 1GMUA 3DLHA 4M5HA 3BQ0A 2BANB 3RBXA 2M8DB 2FGOA 3CGIA 2MQMA 5A76A 2FY1A 1NDLA 3D1HA 3CCRS 2IBKA 2RRBA 3MDFA 3DLEA 1TMJA 2DGSA 3RBZA 4IUFA 2FC9A 2UXDJ 3CJ0A 2DRDA 3UW1A 1M5SA 4URQU 2HMIA 3FEZA 3T9NA 4UQGA 1CJUA 4HVZA 2PEBA 4GMKA 1OPZA 3MM6B 5CA5A 1NSPA 3KLVA 3UR3C 3F56A 3GONA 2BOPA 4RU9A 2NXCA 4DUZF 1ZM3A 1YIJS 3R2CJ 1OYEA 1S99A 2GVDA 4FS2A 1NO8A 2KYXA 5KOXA 1RAHB 4FZVA 5H1SV 1SV5B 3OSNA 4Q5VA 2UUCJ 1VJWA 4F4ZA 3AODA 4BWMA 4RW9B 1PIEA 3NS5A 1NSAA 2P9CA 5H9FK 3DYAA 4N41A 2HQDA 1VYAA 1XK8A 1PYSB 2HMIB 4A4JA 4URGA 2AX0A 3I82A 2PD1A 1NK9A 1JJHA 4Y2MA 3CD0A 4OJHA 2NZCA 2ZEJA 2X1BA 2GVDB 1LWEA 1PBAA 2OEMA 3CCLS 1SH3A 1RHJB 2HWHA 2QA1A 1YK9A 1M1GA 3C6UA 1JJ2R 2X1AA 1WF0A 3VWSA 3LGHA 5GAGI 1UVJA 2GQCA 1RWUA 1RTIB 4DBQA 2DNLA 3KHGA 2JVOA 3DLLQ 1VBKA 3ENWA 5C25A 4WFAQ 4FNIA 2CQBA 3ILIA 3KLFA 2BRKA 4JI2F 3ZTPA 4DX8H 4CNZA 1SH0A 3CB4A 2LECA 1D9AA 2GO9A 2MHNA 3HZEA 3HULA 3G8TA 4CLKA 4KGZB 4RL1A 1CULA 3GR1A 1KLMA 3QJPA 3U7JA 1FD8A 4WFNQ 1NKBA 1UWBB 3RB0A 1JKHB 4LFAJ 1H0HB 1VRTA 1SQGA 1CEZA 2FDNA 3AD7C 1N0UA 4OYAA 1L3UA 1FRKA 5C25B 1JK9B 2V8PA 2WVDA 4KV8A 4QWAA 3QZ7A 3KLFB 1U1KA 1R8PA 2N7YA 5ETKA 3WIVA 4I6YA 4NLXA 4QIWD 5L8RC 4DV2J 2MKHA 2DBBA 2FJWA 3EM1A 1NDKA 2LA6A 3CCQS 1IM6A 1MMNA 4K0KJ 3PHTA 2B9XA 2DNZA 1HNWJ 5KFNA 2ZBIA 4WPAA 4WU3A 2WVCA 1DTQA 1KVJA 1S1VB 1FNXH 3DM2B 1FF2A 7AT1B 3PX0A 1HQEB 4X4RA 5IT9U 2O01C 5E0OA 5B0GA 1I94F 3HDSA 2IM0A 3W64A 1GXTA 2CAJA 2HNYA 2L9NA 3KLEB 3CW2C 2RS8A 2QJ3A 3LGNA 1C2PA 1KQFB 2NXEA 2CQ1A 1DTQB 4ECWA 5DGAA 4LFBF 4LSZB 1TKXA 2WAQD 2UXBJ 1CQMA 1RT4A 4KQZA 2HQCA 2GA7A 1RAJA 1R8BA 1REGX 4FDFA 4DPTA 1JNRB 3KK1B 1H7XA 2A1BA 2M0GB 2RRAA 3HK2A 2X1GA 1R6YA 4GVLA 1C0UA 4NLOA 4DSLA 3TJAA 3MPUB 3W5YA 5CAAA 1Q78A 2IPOB 3OL9A 1Y5IB 5ETVA 4KGVB 2DD8S 3LP0B 4C11A 2AYEA 1MMDA 3EICA 5T41A 1X31C 4B3MF 4KFBA 4F0MA 1TKXB 2H4YB 1RT4B 2VFTA 3FSYA 4F8RA 2B8QA 4KIAA 3P45B 2XSJA 1NZ8A 3DLGA 2IA6A 5KFGA 4PPZA 4QWCA 1FRJA 1AB8A 1PSDA 2OEJA 2R2RA 2EFQA 1IWGA 4C0BA 4JUZA 4CRJA 4ZPBA 5IT9Y 4KHMA 3A4TA 4DV0F 2V94A 3US5A 3ZZZA 4ZVSB 4CCHA 4ZLLA 2DISA 2GMJA 3C66A 3N79A 1HNVB 3TX8A 3EXCX 2DKOB 3DRPA 1Y3KA 2NQPA 4K4VA 3GG0A 4FYDA 1U1RA 4B9NA 1NPRA 2YKMA 5A8WA 4L74A 4OL8A 2J7UA 3BSCA 4FXVA 3VGSA 2PA3A 3KTQA 1Q5YA 2E7XA 3O6QA 3FGVA 3C46A 2E44A 2BQUA 5HK4A 1IKXB 1KTQA 1SJFA 3TR5A 3LPYA 4KBIA 4PYAA 4BC9A 4NZ7A 4LF8J 2VBXA 1RXOB 1S9FA 5CZVA 4GC6A 2JHEA 2YWEA 2XI3A 1B99A 3BYRA 3H8YA 5CYQA 2OPPB 4LR9A 4JV5J 1WOPA 1JLQA 1VC5A 4U8YA 2OPRA 1EX8A 2XMUA 3PACA 5A8WB 3IFEA 3ZZUA 4O3OA 2WK4A 4CLLA 5IV4A 1HD1A 4ECSA 3HVTB 2R7TA 4M5JA 2JX2A 3QO9A 3CD5A 2CJ9A 3M6UA 1Y5NB 4JI7F 5IZHA 2OD4A 4TXSA 2LP4A 5CYQB 4HYKA 4WFYA 1BC6A 3HLUA 3J7YU 1JLQB 2OPRB 4OJGA 4JV0A 4G1IA 2EFVA 3G6ES 2HRYA 3NS6A 1RBOB 3AQOA 4ID5A 1P6TA 4RLEA 4C9DA 2YXLA 1IN0A 3TQ1A 4DCOB 4MT1A 2ZBQA 5KG4A 2DR7A 1T9UA 4MIAA 2OMOA 4OZ2A 1VBZA 4ZIVA 1KVKA 4TNOA 1AYEA 1UFWA 1QTMA 1BE4A 1S49A 4ZDNA 4IR9A 4JI1F 3R7SB 5AXMA 2MJUA 3W9HA 3NS7B 2QMWA 3IA0A 3I0SB 2YTCA 3PFEA 3WX4A 4ID5B 4NASA 3BB5A 2B43A 3L9ZA 5F8HA 4NLDA 3PXGa 5EUHA 2DVIA 1LEOA 3I31A 3GIKA 4C48A 4ZP6A 4HEA9 2Q43A 2IMWP 3C16B 4JBCA 4ZPCA 1N5QA 2K8GA 2KB2A 4G1QB 4PR6A 2ROGA 3NAIA 5BJRA 4KO0A 4JI4F 1WSRA 1U1QA 3B78A 1T9XA 1WC6A 2Y1RI 4K5SA 2VC0A 2CG8A 2AZ1A 2Z8QA 5HMXA 1TKZB 2F4FA 4IR1A 2A6OA 2XY5A 1VMBA 4I67A 1DTTB 3GJRB 4ZP9A 5LSOA 2VA3A 3N5BA 1OIAA 1WG1A 3EPIA 4FF3A 4FP9A 4UUXA 2CPEA 3SZ2A 2LMIA 2J9DE 4FS1A 1LV5A 1EQ0A 2R7UA 2CG4A 4A8MP 1RWKB 3P4UB 4KHPF 1DAXA 3MECB 2ZUAA 4DL7A 2HZCA 4EO8A 1R43A 4PG7A 3O2IA 3Q23A 2HBQB 1WHWA 1ZPVA 4KE5A 3KG1A 3HXMA 4LBIA 4ZVHA 3HVAA 4WFZA 1KLNA 2Y1JA 2IM3A 3ZNJ1 3PDNA 3FKBA 5CYMA 5E3CA 3JS9A 4F50A 3D1QA 1X5TA 4OMFG 2UV8A 4DQRA 2YKOA 2XMWA 3T5KA 1R89A 1DRZA 4UY8T 2IDLA 5M2PA 3DLJA 3PYDA 1TQLA 4IH5A 2L3MA 3BYPA 4JYAJ 3WC0A 2OPSA 1ZTWA 4WIIA 2BE9B 3R9LA 3VAMA 4WFXA 1DARA 1TL3A 3VAHA 2ZOFA 1D8YA 2JLFA 1TVRA 4O44A 3MOZA 1S0OA 1FDAA 5CYMB 1X4EA 2GC8A 3GTYX 2ERRA 2R9LA 4DSEA 5M2UA 5L9NA 1UJ5A 1RT1A 2JC0A 3KG4A 4QJVA 4H54A 1XN9A 5B09A 3M2VA 2IVFB 1VC0A 2ZH2A 4ECVA 3CE8A 2OPSB 3A3OB 2YNGB 2W8KA 3HSJA 4A8QA 3QNWB 1S5ZA 1HPZA 1TL3B 1ZM9A 2EBEA 4ILLA 1TVRB 4O44B 2V5HG 5ETNA 4M5GA 1U24A 1RSCA 2ZJPQ 1WEYA 1B7FA 4P6QA 4RW8B 3H2VE 3QAUA 5JVGQ 4P2XA 3C14B 3OL7A 3M9MB 1RT7B 2AJ1A 3M2VB 1TL7A 3LPEA 1VR6A 1HYSB 2QZ8A 4I64A 3P6YC 2EVZA 2YNIA 1S6OA 3P5TL 3S6EA 4DJBA 3NCRA 2OKQA 3OUYA 4YR0A 4AUKA 3QIPB 1JXEA 4NWBA 4KT0C 5K5MA 5A2QU 1J5EF 3QPIA 2WSEC 4RNFA 2KRRA 4RWXA 3DRYA 4HDGA 1UVMA 1S1XA 1YJ9S 2B6AB 4Q45A 3BM7A 3OFFA 3H0PA 2MKYA 1QAYA 3QIDA 3THTA 2RD5C 2UUAF 2KL8A 1WC1A 3OQ2A 3MMAB 1TAQA 4ERDA 1EKSA 3T1HF 1WELA 2D1CA 1F0XA 3VZHA 4AQYJ 1JLCA 1WEXA 3QGPA 4B3SJ 5KT2A 4ZPTR 2CQHA 1URNA 4ZA1A 3TZXA 1RAEB 2ILZA 3G96A 1UETA 3SXLA 1IBLJ 4URSA 1AFJA 4MK8A 3OTOJ 5ETSA 3PRVA 5LOQA 3BR8A 3IR5B 1HL6A 1H2VZ 1ZAWA 2ASYA 2ZJQQ 4MFBA 4ATNA 4E0DA 3G6VA 1QAJA 2HG4A 2HRUA 2ZWOA 2GHWA 3OTCA 3UQSA 2WTFA 2BM0A 3KNAA 1YVFA 4QR1A 1UVNA 1RWVB 1JLCB 2QLXA 3B8HA 1T05B 3DLKA 1M5HA 4H4OA 4AXIA 3DGVA 4XPEA 4Q7AA 2VODA 3PHEA 3QJJA 5G4DA 2IYGA 2IBOA 5ADZA 4IRKA 1Q79A 8RUCA 2HFUA 2G0CA 3E01A 4N5SA 3V81B 5KG1A 4MFBB 2V4RA 2PGCA 2ROPA 4DCJB 5A2QY 4Y2CA 3GILA 4DV3F 3W7BA 4RO0A 2OPQA 4F3QA 2M8HA 5L1JA 4M5DB 3BKUA 4TU9A 1RWXB 1KQSR 3MMJA 3TUIC 3DLKB 4H4OB 3DRRB 3VAFA 3LWLA 1NBEB 4B3RF 3FQKA 3M8WA 1IM4A 3P49B 4AT1B 4RUHA 1NH7A 1RT6A 1B0PA 3ZZOA 4E8UA 2LU1A 2O1PA 4LRAA 3PVXA 3V2UC 1WEZA 4OIXA 5GAHU 2NSBA 1UFLA 2JFKA 3RJMB 4O23A 1VJQA 2V4JA 5J2QA 4OX8A 2GCFA 4OI1A 3BO3A 5CZXA 4DV6F 3UN3A 2OPQB 1I3OB 4K4XA 4QIEA 3K7RA 1X4DA 4HLBA 4B02A 5C42A 2M52A 4ZMMA 2G1HA 3MM9B 3EE3A 2CPZA 3D9BA 3RGIA 2AGOA 4P2FA 1RT6B 2XGPA 1X5PA 3LALA 1ZS6A 2IHR1 4OYOA 3FDSA 4ZCIA 2RU3A 3R8YA 3X1LB 4OZ1A 4P2SA 1FD2A 1LKZA 2KT3A 3V6KA 2V4JB 3FCHA 3W2WA 5J2QB 3BH6B 3AJ2A 3QFHA 4V1Ak 4ZP8A 2E9ZA 4LFCF 2EFGA 2HBYB 1W2BR 2V9KA 1IBKF 2MQPA 3KK3A 2LCWA 5D3GA 4OZ5A 2YY3A 1EETA 1H72C 4ZVEA 3SSSA 1IXKA 4LIRA 4J9NA 4MKBA 1UJ6A 3HHDA 1U49A 4BDPA 3TWZA 1X4BA 3JSYA 4UF4A 1NH8A 2VFVA 4CO4A 3CJ4A 2ZH4A 4ZHRA 3PZPA 3DDIA 1J5OA 2AKWB 3ZZPA 3W2WB 1WOSA 2X1FA 3HJFA 3R7NB 2FIUA 4PEOA 2XMMA 5DQIA 1NK0A 2HLUA 1FRLA 1HHQA 3KDOA 4R0JA 1IWAA 3KFWX 2AP6A 2YH0A 2XM3A 1X60A 3ENQA 3KK3B 4LF5F 4UY85 2Z2MA 1F5CA 1P9YA 5D3GB 4LBHA 4L75A 4O3QA 3W2VA 4JI3J 1NMEB 3D67A 2CPDA 1X4HA 1JX4A 2IC3A 2JNJA 3D0IE 4U95A 4ZHRB 1J5OB 4C0HA 2B3TB 3TUJC 1FEHA 3GSDA 1Q82T 4QYZK 1JLEA 2RRNA 1RWOB 2DNMA 2C42A 2I6WA 1R6VA 4O4GA 1T95A 4C0OC 3BSAA 4F04B 2CPHA 2CPFA 3QRRA 5B0FA 2HHTA 3W2VB 4UTGA 4JI5F 5KT6A 5F0UA 2UUTA 3UDLA 3IWXA 3N6MA 4WK1A 1MLAA 1JLFA 3QT7A 2C3OA 2I0XA 1LOUA 2DGXA 5FLXY 4LF4F 4AL6A 1TP7A 4NXNF 3H7HB 3R5JB 1WF2A 4IG3B 3OHBA 3ZXWA 1N36J 3ELHA 2QYCA 3DGPA 2GIQA 1FRHA 4C8YA 3EMTA 4DZDA 3CSKA 1KQKA 1KSPA 4Z7YA 1U0HA 2WONB 1KD1T 1XMQJ 1O6XA 1RHKB 2CFXA 1JLFB 2LXIA 2GS8A 1N54B 2CA9A 4OYWA 3CCWA 3KLIA 2R2UA 4ED3A 2XULA 3Q8RB 3D2WA 5T14A 4AFFA 4NA2A 2M2BA 1L3VA 2UXCJ 4DL2A 3TRGA 4DQQA 4DPWA 3NCQA 1RHUB 4PABA 3U27A 2AMCB 3AB2B 4NXMF 4HH1A 2Y1LB 1MN9A 3HFZB 2CWKA 1YI2S 1QM9A 4PUOA 4OX6A 4OZ0A 2JOQA 1U0HB 3GIRA 5C24A 3JXOA 3KDNA 1Q7YT 2N7CA 2RDIA 4NZ6A 1FJGF 1R27B 2RSQA 1GFWB 5HSPA 4CLSA 1FESA 3BSNA 4GVBB 3EXYA 1X4AA 1NU4A 3AD8C 1L3KA 5HJXA 2IM2A 2MQOA 4HT5A 4IRCA 1X9WA 4DCPB 4YR3A 1RA6A 2MPUA 3VQTA 4PUOB 1R8AA 3VGTA 2XWXA 1GMWA 2MMYA 2D3ZA 4CO5A 3MCNA 1T11A 4ZLPA 5EX0A 3NKYA 2JL9A 3CJKA 2W4PA 3BO2A 2HFVA 3ZFVA 1NK7A 2G9OA 2VC1A 1T9YA 2D69A 2VZ9A 3MUVP 3NOGA 4USHA 1HWIA 2WOMA 4A8XA 4OYMA 1FK9B 3T6BA 3HO1A 3CCVS 2IRUA 5B0BA 1QE1B 2VG6A 1F9HA 4MYUA 3W5ZA 2XWYA 2GHVC 4OJ3A 3M05A 1VQ8S 3MAQA 3JTOA 1MN7A 3Q8QB 2FHMA 4CQ1A 2BE2A 3MR3A 2IFXA 1DLOA 2AV5A 1HWUA 3CJKB 3BDPA 2P8IA 3M8QA 4FVMA 3BR9A 2GJFA 3HX9A 3IMQJ 2QO3A 4BC7A 1GNKA 1NKEA 2UXDF 2BOAA 2ZC3A 3GIJA 2IRYA 5EN1A 2JC1A 2VG6B 2ZHAA 3CDEA 4DXLA 2JDJA 2RHQB 4G1PA 3PW0A 4C7QA 2XNQA 3SI8A 2DNPA 2BE2B 5DJBA 3M1VA 1DLOB 4R8UA 1TV6A 2K7KA 2GHPA 5ETTA 3TUPA 2XMAA 3M8QB 2QE5A 3CJ8A 1NHUA 2UUCF 3OTDA 4ZK7M 4K4WA 1WNEA 2W4CA 5HN0A 2F65A 2CQ0A 4ZVOB 5KFPA 3SCIE 2MLYA 3QGHA 4TU7A 3T9ZA 2J0WA 3I87A 3MF5A 4C8KA 2G2OA 1YQHA 4HHJA 1HIYA 1NDCA 2ZZNA 5J2PA 5E41A 4EMDA 3T3FA 3M1VB 2H4WB 1HNXJ 3EDRB 1TV6B 4OLPA 5H9EK 4EK2A 1X7VA 2LQJA 4RW6B 1AW0A 1CBKA 3O5TB 1Z4UA 1FKPA 2BW2A 2DGOA 3PR4A 1YBUA 3JSRA 3Q86A 2ZZMA 3QZ8A 5DLGA 1OS5A 1R0AA 2V2KA 2W1BA 3GFZA 1OY9A 2AEMA 2CNLB 2DTJA 3W1YC 2VU5A 5J2PB 2QFIA 3GFYA 3MR6A 1NB2A 2E66A 4NLPA 4J9SA 4OZ3A 3OD2A 3RRHA 4CH7A 4PRFA 3L4BC 2OELA 3M6WA 4ZLJA 1VLYA 1D1UA 3ICLA 1FKPB 5BYRA 4A8SA 2DNQA 3BGOP 4ALZA 1W7WA 2PE8A 4LFAF 5K8PA 1H73A 4IKAA 1SL1A 2ZH9A 5CH7B 5LMUJ 2OD6A 4K4YA 1KS2A 2FVSA 4CTAB 4D3GA 4ENOA 2P9GA 1GXLA 3X3UA 4ZCMA 1PJ6A 4P71A 5JJBA 2NLWA 2CJBA 4DV2F 1X4CA 4KPYA 5DG8A 3GYXB 2E7WA 1LXNA 3DI6A 1BGXT 3C8YA 5K20B 4K0KF 1W25A 1HNWF 3NP5A 2F1FA 1YG0A 4B17A 5HMZA 2UVVA 3PRDA 2AJ2A 3KK2B 2O3DA 3IS9A 1LNQA 2YQ3A 1S6QB 3AOCA 3TUZC 4LF7J 3D6TB 2CIMA 2DR8A 3TANA 2MEWA 3MEEB 4ELTA 2V2ZA 2ZKUA 4H4KC 4P10A 4NLTA 2CQPA 1FI4A 2YNHB 3MFIA 4NA1A 2LA4A 2EKYA 1S4FA 3PX4A 1IKWA 5F8MA 3V6JA 2BBEA 4ETXA 3IGVA 1SKWA 3DI6B 3T5LA 3CCUS 3ET6B 1TK8A 2DNHA 1WACA 3RAQA 1U4BA 1BQMB 1JB0C 3J7A1 4KB7A 3CJTA 1HW9A 4MKYA 4YEAA 4UOFA 2UXBF 3V4IA 3JAMU 4AYBD 5ETMA 3SCLE 5KFIA 4PQUA 3MCMA 5K14A 4Q44A 2OI2A 1T94A 1B7YB 1BHNA 1IKWB 5CXTA 1QVFR 4ECZA 2Q6CA 1UMJA 4KR0B 2MB0B 3R5CA 2DNYA 1V3ZA 1HHSA 4GKKJ 3N6NA 4DX5A 1KOHA 1JQGA 1FX4A 4PWDB 3SEOA 3MMBA 1FTRA 2KVQE 2AYBA 2C28A 1YZ7A 2V8HA 2KKHA 1UW4A 3LWMA 4PPDA 4TN2A 3T1AA 3V4IB 1V6HA 3H4BA 4QOTA 4JI0J 2IDEA 1KRPA 4PQUB 4F36A 5K14B 3CCTA 1EZZB 4IDKB 4P73A 3SFGA 1TL1A 2RS2A 1W2IA 2CNKB 2L41A 2DCUB 3LAMA 1V5VA 2ZDPA 3HT0A 1NJWA 4C8LA 4PYDA 4PXDA 3MEDA 4IOBA 3GFHA 4ANEA 1FE4A 3M6VA 3KLGA 4GKJJ 2LEPA 3MCSA 1S4EA 2CADA 2V34A 2ZITA 4PAAA 5L1KA 1TFWA 3E51A 1X4GA 4W90B 3HSDA 1Q16B 4XIUA 2NUHA 2CKWA 2Q6BA 1T03B 1M5VC 5G0RA 3A3PB 4I2QA 3AB4B 1VRQC 1VLOA 7FD1A 2DXEA 3A8KA 1HWKA 3BBFA 4QQBA 4YDDB 4KGXB 1RT5B 1Y00A 3JAMY 3ONQA 4DQIA 4LF8F 4DR2J 1RJJA 3MEDB 1C0TB 3IM9A 3FCWA 2EK6A 1ZZNA 3ILOA 3QGIA 3H5SA 4F25A 2ZH6A 3DXBA 4JV5F 2E1RA 2CQCA 1DQ8A 4C6AA 5LXYA 4ZVGA 3JSMA 1NJYA 2E1CA 2YPZA 3IR7B 3CCJS 4I2QB 1IBMJ 2ALZA 3RW7A 4OHWA 3G71S 3D0HE 4ZITA 1DFDA 2XTJP 3LANA 2RDDA 3C2PA 2BMBA 3CMQA 2P6SA 2DH9A 2HFNA 4WKRA 5D8HB 5D4OA 3A3NB 3OL8A 3QT6A 2FHOB 4UQTA 5GAEU 3W8PA 2I2YA 3CD6S 2B4PA 3VVTA 4AXJA 2UUAJ 2FZCB 5F9LA 4IO1A 2YWHA 2HIQA 3RZAA 3DRSA 1RWNB 1VQNS 2DH7A 2DO4A 3JSMB 3R3TA 4QU6A 5T7LA 1UKUA
chains in the Genus database with same CATH topology
1Q5VA 2BJ9A 2F1FA 2WVFA 2WVCA 3OD2A 2WVEA 2BJ7A 2BJ8A 2Y3YA 2CADA 2WVBA 2NZCA 3BKUA 3LGHA 3BKFA 2CA9A 2WVDA 2CAJA 2BJ1A 2BJ3A 2HZAA 2HZVA 2PC6A 3BKTA 3PHTA 2FGCA 1Q5YA 3QSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q5V A;  2BJ9 A;  2F1F A;  2WVF A;  2WVC A;  3OD2 A;  2WVE A;  2BJ7 A;  2BJ8 A;  2Y3Y A;  2CAD A;  2WVB A;  2NZC A;  3BKU A;  3LGH A;  3BKF A;  2CA9 A;  2WVD A;  2CAJ A;  2BJ1 A;  2BJ3 A;  2HZA A;  2HZV A;  2PC6 A;  3BKT A;  3PHT A;  2FGC A;  1Q5Y A;  3QSI A; 
#chains in the Genus database with same CATH topology
 4ETZ A;  3MTJ A;  1NND A;  3OFG A;  2RUS A;  3DDK A;  4NL5 A;  2IY5 B;  3D28 A;  3H5Y A;  1Z2Z A;  1HWL A;  3K5O A;  2UVW A;  2MLX A;  2YPY A;  2HK2 A;  2OTL S;  1FRM A;  4ELV A;  2B56 A;  1U6Z A;  2CDQ A;  1WC0 A;  1VQ6 S;  2ZD1 B;  3SSQ A;  4N77 A;  5HQL A;  3N9U C;  5DDP C;  3DRS B;  2YBV A;  4ZPD A;  1PYO B;  2J0S D;  2J6U A;  1KOO A;  2HWI A;  1HWJ A;  3GCW P;  4WE1 A;  3WHI A;  2C3M A;  2GW8 A;  2BQR A;  4RUB A;  3I5A A;  5HLF B;  4ED7 A;  1HBN B;  2ZOG A;  3NGT A;  4ZPV R;  3PNI A;  1RTH A;  3W62 A;  3M9O B;  2LDI A;  2O67 A;  1L3T A;  4PG4 A;  4DHV A;  2RVJ A;  2ZH3 A;  1S9E A;  2ZOM A;  3KG0 A;  3MXH P;  3OL6 A;  2I1R A;  5HL7 Q;  1E6V A;  3KUE A;  2AT1 B;  3TZY A;  1X9M A;  1VK8 A;  1DJ0 A;  2ABY A;  1WC4 A;  4OV6 A;  1GXU A;  2DHS A;  4CIO A;  2H5J B;  3FC9 A;  8ATC B;  3AOB A;  3H25 A;  2F9D A;  1Q8I A;  4WE1 B;  4ILM A;  2C2N A;  3GB0 A;  1HR0 J;  5J2M A;  2DHH A;  2V69 A;  4OI0 A;  3TYT A;  1S1W A;  4X4U A;  2AJ4 A;  1RUS A;  1RTH B;  1KDN A;  2KXF A;  4FKY A;  3ENA A;  4HAC B;  3IM8 A;  3AXM A;  2MKK A;  3FFI A;  1WHX A;  1S9E B;  2MGZ A;  4PXE A;  5I3Q A;  1JXL A;  4FNH A;  3P3D A;  4PZV A;  2E9R X;  5IC6 B;  1C4A A;  2PO4 A;  1UEU A;  1RU2 A;  2PN6 A;  3W3S A;  3MAA B;  4Y0F A;  4Y3C A;  1UEV A;  3W61 A;  3FZ2 A;  3CCE S;  3UE2 A;  2V9W A;  4ZOS A;  5ETQ A;  2QTW A;  2AGP A;  1JLG A;  1S1W B;  2Z2Y B;  4OQJ A;  4KAI A;  3OR2 B;  4C8O A;  3TNV A;  4EBC A;  4NLQ A;  1IBC B;  2HZA A;  5DG9 A;  2DGV A;  3UCG A;  2H9Z A;  4JYA F;  2NXU A;  2PA8 D;  2MGZ B;  3THP A;  2W2N P;  5HMY A;  1VQP S;  2ZNZ A;  3RRK A;  3Q8U A;  2A18 A;  3VAK A;  1ZH5 A;  3A8E A;  4DR7 J;  1CSJ A;  2V8D A;  1RT2 A;  2C2E A;  3EYZ A;  2AGQ A;  4J9O A;  2Q3P A;  1N56 A;  4P9S A;  2ZVS A;  4NA3 A;  3W9J A;  2R4F A;  1SKU B;  1NHV A;  1DUR A;  1G6B A;  1TR0 A;  1WDT A;  1PKU A;  1S9G B;  3ZZ0 A;  2NCK L;  5LJ5 Y;  4CM0 A;  5B0E A;  4IO9 Q;  3H5X A;  3CD7 A;  3W60 A;  5B0C A;  5L46 A;  4I69 A;  4TQR A;  4FYV B;  5KFX A;  3ULH A;  1KNZ A;  3FUY A;  4WXO A;  4H4M B;  2DNR A;  4DU8 A;  5D4P A;  2D9P A;  1GX5 A;  1RAA B;  1UAW A;  4L6V 3;  4R5P A;  5F8I A;  3HKW A;  4DS5 A;  1Q81 T;  3WC2 A;  3HHL A;  1WG4 A;  3IO1 A;  1BQN A;  2ATL A;  1KP6 A;  4N8N A;  4Y00 A;  5KFV A;  4LF2 A;  3MM5 B;  1D9F A;  2E1M C;  3IN5 A;  2P6T A;  3DRX A;  1YJT A;  3MPD A;  4CT9 A;  2JFD A;  2M4M A;  2FPH X;  4XPC A;  2VG5 A;  2OGU A;  4EWT A;  5FDL A;  2B4U A;  3HHE A;  2CJA A;  4KGK A;  2FY8 A;  5A8K A;  4A8F A;  3OJS A;  4RUC A;  3IBW A;  5GMD A;  4R5P B;  2WVF A;  1RYS A;  2CQ3 A;  3HHL B;  1HQU A;  1CPZ A;  2YWK A;  2XI2 A;  2KXH A;  2BZ2 A;  4EYH B;  2FJB B;  1Q8L A;  3OFE A;  2XNR A;  1QSS A;  4U7C A;  4P7V A;  2HGN A;  3B4M A;  4DLE A;  4AQY F;  2HYI B;  3N5F A;  4B3S F;  5J1P A;  3OXF A;  1ZAV A;  1WKL A;  3K0J A;  3G2X A;  3MMC A;  2RDJ A;  2VG5 B;  2IMO A;  2JVR A;  4DI6 A;  4YR2 A;  1S1U A;  2L9W A;  1FDD A;  1IBL F;  5HBM A;  4DV7 J;  2G2Y A;  5A8K B;  3GV7 B;  1AZS A;  2DR5 A;  3GJS B;  1EP4 B;  3ISN D;  4N47 A;  2A2D A;  2J7W A;  3UDE A;  2E5L J;  4IFY A;  1HQU B;  1IR0 A;  2HSE B;  1FXR A;  3DXS X;  3HZG A;  3SMZ A;  3W5X A;  1LK5 A;  1FTC A;  1YZ6 A;  3RB3 A;  1EHW A;  1EQM A;  3QRP A;  2M5Y A;  4Y2A A;  2RU9 A;  1J2V A;  4LF9 J;  1XNR J;  3R7B B;  5DDR C;  3MMC B;  1OSC A;  3CDA A;  2KZM A;  2Q66 A;  1G7C B;  4Q8E A;  3MEG A;  3UPF A;  1CJT B;  1S1U B;  3UDV A;  1TUW A;  5HBM B;  3CJ5 A;  2J9E A;  4USI A;  1IJE B;  3K5P A;  4QW8 A;  2HNZ A;  4J7C A;  5A6P A;  3LP1 B;  2ZH1 A;  2BE7 D;  4JI8 J;  2HFZ A;  5J1E A;  4RBT A;  2W2O P;  2NS1 B;  4B9L A;  3CDU A;  2LVW A;  2D41 A;  2V6A A;  3VF0 B;  5HVG A;  1T8E A;  1TTH B;  5GAD I;  3TAQ A;  2FJD B;  2BAB A;  1VK3 A;  4PWW A;  1U6F A;  3WIU A;  5J1N A;  4AE5 A;  2B8P A;  3MEG B;  1HBU B;  3U1L A;  4F0K A;  1RLD A;  4NLG A;  4NYO A;  3PJX A;  3GJQ B;  4X64 J;  2CUY A;  2HNZ B;  4Q43 A;  4LVO P;  3D6F B;  5RUB A;  2XYG B;  3NNC A;  2DGU A;  3PM9 A;  5KFQ A;  3BSO A;  4UZB A;  1QVG R;  4Y65 A;  3AHP A;  2HBZ B;  1VGY A;  2ILY A;  2OEK A;  4CLW A;  1U26 A;  1F9E B;  1QD1 A;  3ILJ A;  4Q2M A;  1Z1Z A;  2BJ8 A;  2DY9 A;  3TVZ A;  4ED5 A;  1XTZ A;  3OXG A;  2HS4 A;  2KN4 A;  4CO0 A;  2J7K A;  2NYI A;  1SUQ A;  1Y4Z B;  3VQS A;  2IJR A;  4U9R A;  3E3X A;  1N0V C;  1O5J A;  1I1G A;  1S6P A;  2DXD A;  5GME A;  4DPU A;  2GFF A;  4DS4 A;  2ZE2 A;  2QL7 B;  4K2J A;  4DV4 J;  2XCA A;  2PC6 A;  2J9C A;  1U6B A;  3N0V A;  4MTP A;  3OLB A;  1UZH A;  5B0D A;  3CJ2 A;  3OTE A;  1N6Q A;  1FEE A;  1N48 A;  5L1L A;  4TKT A;  2IVM A;  4CH0 S;  2IM1 A;  1U8W A;  2Z58 B;  2DHA A;  4I6W A;  3QJL A;  1NPK A;  3MPV A;  4GC7 A;  2YWG A;  2BX6 A;  1ZZF A;  4K59 A;  1PAU B;  3DCA A;  4JV2 A;  2KHC A;  3DLE B;  2VPW B;  2RB7 A;  4PG5 A;  5F41 A;  4L3N A;  4UOH A;  3QMQ A;  3M32 A;  2N82 B;  3EGZ A;  3LGM A;  1PBU A;  2ZKT A;  2CRL A;  2DB1 A;  5KOW A;  4DN0 A;  1RWW B;  1R8C A;  4JI3 F;  4R25 A;  2MKC A;  1CJU B;  1S79 A;  4TY9 A;  3PY8 A;  1JJ4 A;  1T9T A;  3IWL A;  3JTN A;  2NRE A;  4IG0 A;  1NJI T;  2Z0G A;  1AXQ A;  1F3V A;  2HQF A;  1K44 A;  3C19 A;  2F8E X;  4I1T A;  1SJ3 P;  4DDF A;  2CJX B;  1RYR A;  1BUX A;  5LMN J;  2BM1 A;  3C6T A;  5E3R A;  4PG6 A;  1AFI A;  4J9L A;  2VDI A;  2ZZT A;  2RHS B;  3UO0 A;  3T1Y J;  3B4D A;  3M32 B;  4QPX A;  3TVK A;  5HMW A;  3BN4 A;  3DYA B;  4IH6 A;  1Y11 A;  2OIH A;  1X5S A;  2FVR A;  2J6T A;  3V6H A;  1RAC B;  2JEI A;  2IVY A;  4DL6 A;  3R5D A;  2A3J A;  2WRM A;  1N52 B;  3I32 A;  2VAS A;  4DR5 J;  1YDL A;  4XDC A;  3HPO A;  3M2R A;  2AYM A;  2J76 E;  4X65 F;  1QUV A;  1LWE B;  3IR6 B;  2EFN A;  3RB4 A;  4IFV A;  4ZVT B;  3HHK A;  2VOO A;  4DR4 J;  3Q8V A;  4Q0B A;  3RAX A;  1N36 F;  1HW8 A;  3C6U B;  2UU9 F;  4EGL A;  3R6L B;  3H2U B;  4UT4 A;  1JNZ B;  1HI0 P;  1KQG B;  4M5L A;  5DG7 A;  4LF6 J;  1VQY A;  1VS3 A;  2G0J A;  1XMQ F;  4DF8 A;  5ETP A;  2GZO A;  4WTY A;  1S7H A;  3SV4 A;  1T0T V;  4TU8 A;  1Q7L B;  2J8A A;  3Q22 A;  1FA0 A;  2XZT B;  2P9E A;  1T3O A;  2E1P A;  3NXZ A;  3WQP A;  1HI1 A;  1HKA A;  2UXC F;  1NK8 A;  2HHS A;  2BVZ A;  4Q0B B;  1CUL B;  1FFG B;  1KLM B;  2BJ3 A;  1RA7 A;  3O8W A;  2WZ1 A;  1N5V A;  3CED A;  1VRT B;  1SQE A;  4IRD A;  4WZM A;  3LQV A;  1F3F A;  4F3M A;  2MY8 A;  2XY7 A;  2H51 B;  4Y6I A;  4KV8 B;  2ASJ A;  3D3B J;  1SCJ B;  4CNY A;  1IQZ A;  4PXB A;  2Y3Y A;  3Q24 A;  2KM8 B;  2JZ5 A;  1ICE B;  3TAM A;  4L72 B;  3TZZ A;  1KHW A;  3OHA A;  2KHD A;  1EB0 A;  1U25 A;  1RB0 A;  3NBP A;  3I96 A;  5KFT A;  9ATC B;  2HPU A;  1LW2 A;  3K2Y A;  2IJN A;  4ZKA A;  5M2R A;  2XC9 A;  2FHJ A;  4RX6 A;  4RZR A;  2FVQ A;  2UUB J;  2XS5 A;  4U67 Q;  2G4B A;  3HT3 A;  3TEG A;  4ZVF A;  1CJK A;  4AL5 A;  4HI1 A;  1HMV A;  5DM7 Q;  4LT6 A;  2HW3 A;  3CDB A;  1HQ2 A;  1VQM S;  3HF5 A;  4DR3 J;  3EVW A;  5LJ3 Y;  1QY7 A;  2YWF A;  1VQ4 S;  3JSB A;  3TAM B;  2HNY B;  1LFW A;  3GP9 A;  4YQW A;  5KFZ A;  5KFC A;  1BD6 A;  1RBA A;  1AUD A;  4QWE A;  2VG7 A;  3PW4 A;  4YS2 A;  1ITP A;  3NBP B;  1V9O A;  1SC4 B;  3Q0A A;  3DFE A;  3Q8P B;  5DS7 A;  1LW2 B;  1QAI A;  2DNK A;  4NI2 A;  1EKR A;  2FQQ B;  3G82 A;  1VQS A;  4W92 B;  2F4V J;  4F2R A;  1WJ9 A;  2EWH A;  2HHW A;  3T19 A;  1RBL A;  1HMV B;  3RG6 A;  1K9M T;  1FCA A;  4IOC Q;  2HLT A;  3D66 A;  3ILL A;  3IG1 A;  2X3G A;  5E3A A;  6AT1 B;  1S1T A;  1FO1 A;  1B64 A;  2Y9H A;  3IGN A;  1RU1 A;  5D77 A;  1C0U B;  1VHI A;  2X51 A;  2NZ4 A;  1MRO A;  1CS4 A;  2VG7 B;  1T7P A;  2Y8Y A;  3ITH A;  3DHW C;  3NGR A;  1FER A;  1PIL A;  3ZZY A;  4NI2 B;  4C11 B;  1FWK A;  4F26 A;  2FZG B;  3MR2 A;  3G82 B;  1D09 B;  4KFB B;  1RTJ A;  1N5S A;  3MM7 A;  1FDB A;  3AFG A;  3VGV A;  5D0H A;  1RAF B;  1MWY A;  3UR0 A;  4DUT A;  4C4W A;  3UN5 A;  3OLA A;  2MKS A;  2XSJ B;  4FN5 A;  2D9O A;  3DLG B;  3TA1 A;  5FD1 A;  3IG1 B;  3VHQ A;  3UD4 P;  1S1T B;  4QR2 A;  3UDC A;  2VBW A;  5KT3 A;  5EGY A;  1JIH A;  2DJW A;  2EG1 A;  1YGY A;  4P72 A;  3W65 A;  1GTE A;  2FJV A;  2M88 A;  3VCD A;  4ECY A;  3HD2 A;  1UA1 A;  2GML A;  3DRP B;  3DHX A;  2RQM A;  2XSF A;  3MM7 B;  1VQK S;  3ZZR A;  1C1B A;  4DWI A;  3SDE A;  2OHD A;  2DGT A;  1KWM A;  2YKM B;  3QBC A;  1HNX F;  4O0N A;  1NHK L;  3ADA C;  4L76 A;  5DGB A;  1NK6 A;  1LWX A;  4DQS A;  3KKF A;  2BXJ A;  4OHZ A;  1QUP A;  4UUW A;  1OO0 B;  2XYH B;  2MQL A;  2J6S A;  4L73 A;  3GSI A;  5J2N A;  3QYY A;  2YKP A;  1FX2 A;  3OW2 R;  4TVA B;  1MSW D;  2DT9 A;  5IM0 A;  4O4R A;  1S57 A;  2AEJ A;  1IR1 A;  4NOH A;  3IAS 9;  1UWA A;  1VOM A;  1S48 A;  3A8J A;  4OJ1 A;  2EC2 A;  2VH7 A;  1U1L A;  1I5O B;  2GJ2 A;  3EGN A;  1EAY C;  1CC7 A;  5HAO A;  6FDR A;  1ZAX A;  1G2E A;  4JOU A;  3VV2 B;  1A6L A;  4G6V B;  3S8S A;  2W2Q P;  5J2N B;  3QO9 B;  2UVU A;  4NE9 C;  1U09 A;  1VIS A;  5IM0 B;  5LMU F;  4V19 J;  1FJE B;  3FRZ A;  3FBC A;  4M94 A;  1L5U A;  2VFU A;  2CJY B;  1XER A;  5B7W A;  3R1H A;  5LM7 E;  4ANC A;  1TEL A;  2LKZ A;  1XR7 A;  2G0I A;  4UZC A;  4CI0 B;  4KY3 A;  2KZZ A;  1XR5 A;  2E5G A;  4HI2 A;  2MQ8 A;  4NZ0 A;  5K8M A;  4B3T J;  2VJV A;  3CXC R;  2DRB A;  3VR1 A;  2W25 A;  4I2P A;  2ZJR Q;  4K7Q A;  3CJR A;  1FNO A;  4ZVU B;  4USW A;  4LF7 F;  1UJ4 A;  5CCM A;  3DOL A;  2M9K A;  1N33 F;  1K8A T;  3KUG A;  2WSC C;  1S7I A;  2W9B A;  1I6J A;  1IKV A;  2D7S A;  1PJ5 A;  4YY3 J;  3I55 S;  1L3S A;  3RAM A;  3J7Y I;  1F60 B;  4LF1 A;  1V5I B;  3C3L A;  3GV8 B;  4XO0 A;  2FUG 9;  1NSQ A;  1RT3 A;  2OUG A;  4LIW A;  1S0V A;  3SQG A;  3NLC A;  3GU0 A;  1RCO B;  2I8E A;  3DOK A;  1H2T Z;  2YNF A;  2QFJ A;  1MU2 A;  2DEJ A;  2AIR B;  5KFS A;  2Z30 B;  4KKO A;  2KVI A;  2LU2 A;  3CUL A;  3S7R A;  4KO0 B;  1KFD A;  3R6G B;  1JWW A;  3J81 U;  1FDN A;  2I5J A;  1NK4 A;  1IKV B;  4WBF A;  3JYT A;  1HNZ J;  2DGQ A;  1APS A;  1WDD A;  3AXK A;  3MGJ A;  3UFC X;  2ACM A;  4LRB A;  2D3U A;  3HVR A;  3U1M A;  2IRX A;  4LJM A;  5F8L A;  4X4P A;  3R5B A;  4DG1 A;  1FRX A;  2CNN B;  4GKK F;  1RWP B;  3SQG B;  5KFH A;  2MYF A;  3H90 A;  2LQ5 A;  4C3K A;  4FPR A;  3QSI A;  1FWL A;  4B3O A;  2F8H A;  4USU A;  1WUU A;  3SIP B;  4KKO B;  1D9D A;  3CME S;  7FDR A;  3RUB L;  5KG5 A;  3PO5 A;  2QL9 B;  1QTN B;  3Q2T C;  3BKT A;  3LUY A;  1N5T A;  2IAJ A;  4TYB A;  2I5J B;  3UNY A;  1U0S A;  2V50 A;  1QSL A;  4JI0 F;  3JYT B;  4Y2K A;  4F7V A;  3QWU A;  2BKP A;  5ETL A;  1IVZ A;  5D4L A;  4RBV A;  4WJB A;  5AJ3 J;  3IBC B;  2Z57 B;  3AH6 A;  1F2H A;  2MQN A;  4AL7 A;  2HHX A;  3ISZ A;  3K57 A;  5I3U A;  2L08 A;  3UNG C;  3V6D A;  3A12 A;  4B3O B;  2F8M A;  4GKJ F;  4O3R A;  4G65 A;  2DCL A;  2CZ9 A;  4A48 A;  3NMR A;  3NGS A;  2IAJ B;  3G86 A;  1NK5 A;  2E5J A;  4HDH A;  2ZNY A;  4NMX A;  3JQJ A;  4OX9 J;  2FTR A;  4DZ6 A;  1TL4 A;  2Y8W A;  3MHY A;  2HQI A;  3J81 Y;  3KMQ A;  3MAH A;  2QA4 G;  2AQ4 A;  2C2M B;  4B9V A;  4DR2 F;  1B4S A;  1RT1 B;  1KBR A;  3QLH A;  4DUY J;  2KI2 A;  2GIF A;  1TZ0 A;  1U1O A;  4Z7C A;  3OJU A;  5MAO A;  4FYX B;  1IBM F;  3W9I A;  1HPZ B;  3DKD A;  2K7J A;  5D0R A;  1HI8 A;  5KT7 A;  3CJ3 A;  1S10 A;  2QGF B;  4X62 J;  4I4B A;  4NLU A;  3I9V 9;  3N28 A;  4OYI A;  3T5J A;  4USK A;  5JXS A;  4DX6 A;  2YVS A;  4PG8 A;  3MCO A;  3QLH B;  2F5G A;  2XLI A;  1B70 B;  1TL7 B;  3M8P A;  3MR7 A;  2JEJ A;  2YNI B;  2MST A;  2ZH5 A;  1F5B A;  3DMJ A;  3MTK A;  4ICL A;  3PKY A;  4TLR A;  2JLG A;  3OUY B;  2HWT A;  1SB6 A;  2VB6 A;  2HHQ A;  3OR1 A;  1FHT A;  1T02 A;  1N5Y A;  6FD1 A;  2VBY A;  1NM2 A;  1KON A;  4NCG A;  4J9Q A;  3EUN A;  5A0Y A;  5I3P A;  1S1X B;  3NCP A;  3HFK A;  1GT8 A;  2BAN A;  4W98 A;  2XZD B;  1M0S A;  1ROF A;  4D3H A;  1GQE A;  4YB5 A;  3QQC D;  1RWM B;  1D3W A;  4TYA A;  4YFU A;  4ICL B;  5L1I A;  1PYT A;  1SL2 A;  4DOZ A;  2N3L A;  1C1C A;  5BR8 J;  5IQQ A;  4F02 A;  3OR1 B;  2CQG A;  1N4L A;  4DV5 J;  2RIJ A;  1R0C B;  8AT1 B;  3H98 A;  3BJY A;  4P52 A;  5KFR A;  3H5U A;  4QYR A;  3HSZ A;  2UV8 G;  1ELO A;  3BS9 A;  3MM6 A;  3PW7 A;  1G4C A;  1W26 A;  5AT1 B;  2LEB A;  1XMO J;  1NJZ A;  2BEF A;  3BO4 A;  3G8Q A;  4DF4 A;  1ZA2 B;  1RCX B;  1C1C B;  2JLE A;  4K4T A;  3BBB A;  5GAG U;  1SV5 A;  4C3M A;  1UW9 A;  1IQT A;  3QT5 A;  1GX6 A;  5HVF A;  2HS0 A;  4RW9 A;  2KFN A;  1HR0 F;  4J9V A;  3AAW B;  2KO1 A;  2CQ4 A;  3K5M A;  1Z2L A;  1FXL A;  3E01 B;  1HD0 A;  2YKQ A;  1N34 J;  4K4S A;  5H9F J;  4P7T A;  1F6T A;  1RK8 A;  2ZUG A;  2V0N A;  3IC1 A;  2DPJ A;  2UP1 A;  2KH9 A;  2IA0 A;  1U2R A;  3M8Z A;  2XCP A;  3HVW A;  4LRE A;  3M30 A;  4DR1 J;  2OFG X;  3TX0 A;  2XLJ A;  3BPS P;  1VHF A;  4OX7 A;  1RGV A;  2GVZ A;  1VBX A;  2DNG A;  2FHJ D;  5KG2 A;  3M8R A;  4E2F B;  1VDH A;  1Y7P A;  1UVL A;  4CT8 A;  1RTI A;  4MIW A;  2HND A;  1X8D A;  4ZLN A;  2A6M A;  3H2L A;  4QWB A;  3BGU A;  5EHH A;  5B08 A;  4WYW A;  3UVJ A;  1OYD A;  3M30 B;  1WTB A;  2N4D A;  4ZJO A;  4DR7 F;  5C42 B;  3LH2 S;  3FSI A;  4WWS A;  3BQ1 A;  2XY6 A;  2GAH C;  2GVZ B;  5IXU A;  3BF4 A;  1VQ7 S;  3NAH A;  1UWB A;  1JKH A;  2VPY B;  2E5H A;  4ILR A;  1HBO A;  4YME A;  3KJQ B;  2HND B;  2BR0 A;  4WK3 A;  3QSY B;  4EFA C;  5KG6 A;  2B7C B;  4C8N A;  2BV3 A;  2E29 A;  3MPW A;  2CPY A;  5GAH I;  4YN3 B;  4FBU A;  3N4W A;  2MDA A;  1VBY A;  1Q1K A;  3HSG A;  4NEY A;  1EIY B;  5HRO A;  3UVJ B;  4J5O A;  4EI2 A;  1EET B;  2XMK A;  3FMW A;  5E33 A;  3LP2 A;  3MD3 A;  4KH0 B;  1YJV A;  1ZTT A;  4EBE A;  3MD1 A;  5IWA J;  4F3O A;  5IOL A;  3I4H X;  1U45 A;  4X4V A;  1HBO B;  3EGV A;  1S1V A;  2MKI A;  3DM2 A;  3NGU A;  2KJV A;  1Q95 G;  3KJN B;  1HQE A;  5KAK A;  2A0F B;  4KJI A;  3GMG A;  4DL4 A;  3UWT A;  5C2C A;  1BQX A;  5HRO B;  1UTA A;  3VAJ A;  3HKZ D;  2HFO A;  4DU7 A;  3PYE A;  2CQ2 A;  5AXN A;  3ZTQ A;  2R8J A;  1P27 B;  2XGQ A;  5AE2 A;  2OP5 A;  3KLE A;  3LP2 B;  2AD9 A;  2G2Z A;  4M5I A;  2V2Q A;  2VFS A;  5HI7 A;  1FXD A;  2IC3 B;  2EFO A;  4OZN A;  2P5V A;  4X65 J;  5KFA A;  2BRL A;  2BJ1 A;  2ALY B;  3D1O A;  3EWG A;  4WXW A;  3AT1 B;  2LXU A;  3NMA A;  1M5P C;  4OLO A;  1JLE B;  4WU2 A;  3KK1 A;  5MLC V;  3UD5 A;  2UU9 J;  3I0R A;  4O4G B;  1D0E A;  4WF9 Q;  1R8H A;  2H5I B;  1HNI A;  1FKO A;  5A8R A;  2PT0 A;  2M70 A;  3FCV A;  3R1L A;  1M1K T;  2JEG A;  4DV7 F;  3IXQ A;  3ISN C;  3B6B A;  5KFL A;  4MH8 A;  3KOA A;  3GE9 A;  3LP0 A;  2ZC4 A;  3OT9 A;  1R31 A;  5F8J A;  3H59 A;  2RKI A;  2E5L F;  3DU6 A;  2QLJ B;  3KHL A;  4J9R A;  1P9Q C;  5ITH A;  2HIY A;  2VPZ B;  1XEZ A;  2HUR A;  1LFP A;  4CDI A;  2KTQ A;  3DGP B;  4M8L A;  3I0R B;  1MNE A;  2FLL A;  3CNQ P;  4LF9 F;  2F40 A;  2R7S A;  1HNI B;  4ZVP B;  5LXR A;  1XNR F;  1FKO B;  3GYN A;  5A8R B;  1TMM A;  4I7F A;  4KGM A;  2JWN A;  2O5D A;  4DL0 C;  1RAD B;  1K1S A;  4NRU A;  2V4Q A;  2LYV A;  1K73 T;  2RUG A;  1HNV A;  3KLI B;  2W7O A;  3BGF A;  1RKJ A;  2RKI B;  1XBW A;  3D0G E;  3D6H B;  4RR5 A;  4A8Y A;  2M7S A;  4JI8 F;  5ETO A;  1HAR A;  3G9C A;  5L39 A;  3LAK A;  4YB6 A;  5KFF A;  1RI7 A;  2HZV A;  3VAG A;  2WHO A;  3M4X A;  3LW5 C;  4XDD A;  3AY0 A;  1IKX A;  2PI5 A;  4I7F B;  2U1A A;  4ZS6 A;  1YRX A;  2K3I A;  3HM9 A;  4DEZ A;  4B08 A;  4ED2 A;  1WKK A;  2Y0S D;  5C24 B;  1B0T A;  4RPF A;  2FLP A;  4HTI A;  2QEX S;  2LQ8 A;  4X64 F;  4N56 A;  3H40 A;  4ZIW A;  2FHK A;  2OPP A;  4BBY A;  3BH7 B;  4RBU A;  5KFE A;  4PWU A;  4X4Q A;  3PTW A;  2MTL A;  2RML A;  1YTY A;  2H65 B;  2W9C A;  2D3O R;  4M5M A;  4K2X A;  4K4Z A;  4QWD A;  5DET A;  4WCE Q;  5IS2 A;  4FPI A;  1VQ9 S;  3HVT A;  1SC1 B;  2IYI A;  2LQ9 A;  2APO A;  3PKM A;  2PEH A;  2ZM6 J;  4P2M A;  2Q79 A;  2WBM A;  4RKU C;  3POT A;  4NLY A;  2BJ7 A;  3LF0 A;  4RU2 A;  4ED6 A;  4OHV A;  4R0E A;  4CZC A;  1YJ7 A;  4ES2 A;  4YHH J;  4DV4 F;  3Q83 A;  2DHG A;  1HLW A;  3ZO7 A;  4DL5 A;  1PG5 B;  5KFB A;  5D15 A;  1N8R T;  4J90 A;  3Q89 A;  2W9C B;  5F3Z A;  1UP1 A;  2WOM B;  1F9F A;  4FXW A;  3VZI A;  4K4U A;  5DDO C;  1O8B A;  2CZV C;  3I6P A;  2NPF A;  3N01 A;  5LSR A;  1H74 A;  4CLZ A;  4LR7 A;  1JXV A;  2YKN A;  2VJU A;  3NGK A;  1U47 A;  1HBM A;  2VIC A;  3POT B;  3SV3 A;  2HVE A;  4WKY A;  4OYZ A;  4DPY A;  4OI2 A;  4UOC A;  4ZVR B;  4IH7 A;  1U02 A;  2C22 A;  1RDR A;  4DR6 J;  2XMJ A;  1WKJ A;  2E7V A;  2VPX B;  3D54 A;  3I0S A;  2AW0 A;  3E8O A;  2B0G A;  3MI7 X;  2B5J A;  1ZBT A;  3T5H A;  3EX7 B;  2EC0 A;  2VQE J;  4C2M A;  4ED8 A;  1G1X A;  4J9M A;  2HHP A;  2HS3 A;  2MJN A;  4AND A;  2A10 A;  2BDP A;  4J91 A;  3C16 A;  2GAG C;  2VQF J;  4O3S A;  4N76 A;  2YKN B;  3HP6 A;  3RTV A;  4X66 J;  4G1Q A;  4MIB A;  1HBM B;  1XNQ J;  3NWR A;  4R8U B;  2R7Q A;  1KHV A;  5LMN F;  4PCQ A;  2R7X A;  3MM8 A;  3NEK A;  1UL3 A;  3MFH A;  1DBD A;  2JEF A;  1OQ6 A;  3T1Y F;  1TKZ A;  2B5J B;  5KFY A;  4EEY A;  4IQX A;  2X7I A;  2GQ2 A;  3L09 A;  4NLS A;  1FWP A;  1DTT A;  4DFP A;  5IQ6 A;  3KLH A;  3TO8 A;  1REV A;  2DR9 A;  1DQA A;  4DV1 J;  1PC5 A;  4W4M A;  1T9V A;  4RW7 A;  5E3Q A;  1TU0 B;  1M1H A;  2V8V A;  4DR5 F;  3BGR A;  2BA9 A;  5K9F A;  2B4O A;  3C15 A;  4USJ C;  4U8V A;  2FVP A;  4ZP7 A;  4NLV A;  1LXJ A;  2RAQ A;  3MM8 B;  2DK2 A;  3W63 A;  3MEC A;  1BMQ B;  2R8H A;  4DR4 F;  4WP3 A;  2CPX A;  9RUB A;  2WW8 A;  3KLH B;  5AXL A;  1R0A B;  3GCX P;  1REV B;  3GJT B;  1YWX A;  2KDO A;  4FBT A;  4WZQ A;  4LF6 F;  5EX3 A;  1P8G A;  3CIZ A;  3D5M A;  1SC6 A;  4JI6 J;  2OML A;  3T41 A;  4RW7 B;  3KNG A;  2ZBP A;  4QBU A;  4RNH A;  5F8N A;  3BGR B;  1KVI A;  3C15 B;  4MYT A;  1SJQ A;  2QA4 S;  1YJR A;  5IFM A;  4ZCK A;  2EEY A;  1NLK L;  1XIQ A;  4NLW A;  4B9T A;  5KFJ A;  3ZC4 A;  3FMB A;  3T6J A;  2NYH A;  4O0I A;  3GLJ A;  3I5B A;  2KYZ A;  5HJY A;  2DH8 A;  3CO9 A;  1FKA F;  4MJK A;  3SBM A;  5L9X A;  1RAG B;  1N33 J;  5ETR A;  2OJ3 A;  4ZJQ A;  2VL1 A;  3JQM A;  3QT8 A;  2DRA A;  2V63 A;  2FD2 A;  3BV8 A;  1OQ3 A;  4OYP A;  3TEH B;  2LXF A;  2XHW A;  4KPC A;  2AJ0 A;  2OLW A;  3GIM A;  2YNG A;  3CCM S;  2R8K A;  2HEK A;  5CYJ A;  2J9D A;  3CC4 S;  3IS9 B;  3PW2 A;  4P74 A;  5KTQ A;  2UUB F;  2VV5 A;  1DZ5 A;  3I56 S;  2QSW A;  4RW8 A;  4J9U E;  5L38 A;  3GG1 A;  4I6A A;  1DQ9 A;  3C14 A;  2FYX A;  2MZQ A;  4P75 A;  3L95 X;  1RT7 A;  4CO2 A;  4DR3 F;  2BQ3 A;  3NRB A;  2EKN A;  1URR A;  4F2S A;  1HYS A;  3IBF B;  2HGM A;  2I38 A;  1HFE L;  2HHH J;  1H3D A;  3WDO A;  3SCK E;  2HRT A;  3B82 A;  2GQQ A;  1FFS B;  3QIP A;  4QCL A;  2E9T A;  3RU0 A;  1WG5 A;  2CNO B;  4C8M A;  3K8W A;  2F4V F;  2XG8 A;  2MZR A;  2DIU A;  3QAE A;  2NPI A;  3UCZ P;  2WVB A;  4YOE A;  3J7A N;  1RTD A;  1RZM A;  3UI3 A;  2B6A A;  2QC3 A;  2HVI A;  3MPY A;  2XQC A;  1GMV A;  5K8O A;  2V8G A;  3BDE A;  4ER8 A;  3Q8S B;  3MMA A;  3L7U A;  1WC5 A;  1UPP A;  3J7Z T;  2AU0 A;  4M5N A;  4M1K A;  4BCA A;  5E7O B;  1AT1 B;  2AHO B;  1YBA A;  3A8I A;  4YP3 A;  1XQI A;  3MMB B;  1LWF A;  2Z2Z A;  2RIL A;  2CVI A;  4ZCL A;  4OI3 A;  5IC4 B;  4N7T A;  2XBP A;  1RTD B;  2ZH7 A;  2RNE A;  2XHC A;  1YJN S;  3D68 A;  4LRC A;  3MEK A;  1TL1 B;  4CYU A;  2R8G A;  2DYA A;  1QAX A;  1A0O B;  3LO3 A;  1U48 A;  5AE1 A;  2L48 A;  5D78 A;  1K0V A;  3KLG B;  4KSE B;  1T05 A;  1LWF B;  1OSD A;  3RR7 A;  4X2B A;  1N32 J;  1MW7 A;  4AD6 A;  2ZBR A;  5IT0 A;  2R3V A;  3HD1 A;  3BZQ A;  3KUH A;  3WZ0 A;  4ZN1 A;  5G0R B;  4V19 X;  3CIM A;  3FEX B;  4BLG A;  3V81 A;  2QLB B;  1IJF B;  4CYU B;  1SIZ A;  4F4A A;  4M63 A;  5FII A;  2EW9 A;  4B9U A;  4RW4 A;  5F9N A;  4M5D A;  2HVZ A;  2RQC A;  4EZ9 A;  5JUM A;  1S12 A;  1KN6 A;  1ZOT A;  2V2V A;  3DRR A;  4OI4 A;  2GX8 A;  1YSJ A;  3PW5 A;  1H2U X;  3PJW A;  3HHL C;  1WC3 A;  4ECR A;  3AA9 A;  5LL6 d;  4JP8 A;  3GZ7 A;  2XEX A;  3RBE A;  3MUR P;  1SJR A;  3KMS A;  3CMA S;  4XTT A;  3CUN A;  5D0G A;  4NX9 A;  2QMX A;  4WFB Q;  1WOO A;  2DNO A;  4USV A;  4RW4 B;  4J9P A;  3MM9 A;  1X5O A;  3R5A A;  2DIT A;  4Y28 C;  4M5K A;  1SBR A;  1D8Z A;  1SIW B;  2VD3 A;  5HQ8 A;  4DSK A;  1XWL A;  2GJI A;  3KHR A;  1YKW A;  4EYI B;  3TA0 A;  3IWN C;  2LQB A;  1Q86 T;  3G6Y A;  1UPM B;  2IJF A;  1H38 A;  2NXJ A;  3FNN A;  5DLF A;  3D3C J;  5T7L B;  1PO6 A;  2QMU B;  2BKO A;  3CC2 S;  2D3O 1;  4B3T F;  4NLR A;  3CWJ A;  4PQA A;  2PSZ A;  3S01 A;  3EZ5 A;  4G3I A;  1YRU A;  2AF6 A;  4LUB A;  1SJ1 A;  4QIF A;  4LMZ A;  4Y34 A;  1SVD A;  2JJ4 D;  3HFV A;  5GAE I;  2YKA A;  4YY3 F;  2K2P A;  5CCL A;  3M2U A;  2B9Y A;  2GO8 A;  1RHQ B;  2X3D A;  4F0H A;  2BAC A;  4ELU A;  1S97 A;  3MUT P;  2H3E B;  5KFO A;  1VRU A;  1VIX A;  1M90 T;  3FK4 A;  1IKY A;  4MK9 A;  4DSJ A;  1XMB A;  3LTO A;  4X84 A;  2HGL A;  4ECX A;  3IAM 9;  3PR5 B;  5FLX U;  5I42 A;  3DDN A;  3A13 A;  1X0F A;  5HO4 A;  4K8R A;  3FBE A;  1YJU A;  4B9M A;  2UVR A;  2VF3 A;  1NRK A;  2KXN B;  4RWW A;  4PKD B;  2OTJ S;  4DUZ J;  3K8V A;  1AA1 B;  1S59 A;  2HQ3 A;  3JQK A;  1HNZ F;  4OYB A;  1GH8 A;  2H5E A;  1E6V B;  1CVJ A;  4EZ6 A;  3TJ9 A;  1F2G A;  3M2U B;  1O51 A;  3UCU P;  3ZZT A;  4RNO A;  1VRU B;  1TK5 A;  1WTF A;  3RBD A;  1IKY B;  3RYL A;  4MKA A;  3FVY A;  4F4X A;  2CPI A;  2DHX A;  5J2M B;  5I42 B;  4QYZ J;  1GMW D;  3PYF A;  4WIQ A;  5HP1 A;  2CWX A;  2EI5 A;  2C3U A;  3FFI B;  2MLZ A;  3SQO P;  3MWB A;  3O1L A;  2KT2 A;  5F0W A;  1WOR A;  2EG2 A;  2KT5 A;  3K5N A;  4HKQ A;  2LDY A;  2YX7 A;  3EZO A;  5AJ3 F;  1G3O A;  4IG3 A;  3NL0 A;  4JB8 B;  4HR2 A;  1NPP A;  4OYX A;  1UA0 A;  3R27 A;  3F41 A;  1JLG B;  1YBT A;  1UEK A;  3AA8 A;  4HHH A;  1WHY A;  2WON A;  5DO2 A;  5HP1 B;  1UCN A;  4JI2 J;  1M5O C;  5SUH A;  4DN9 A;  3QRQ A;  3M8S A;  4CH1 A;  2ZDO A;  1RP5 A;  4OX9 F;  4MAK A;  1RAI B;  1JLB A;  5DZ6 A;  1RT2 B;  5HAN A;  3W8G A;  1SXL A;  2K3K A;  2L9D A;  3EJM A;  1U8S A;  4C98 A;  4HH0 A;  3PEH A;  5CD4 H;  1K47 A;  5KFU A;  3AQP A;  4DUY F;  1BWV A;  3OBI A;  1LWC A;  3J7Z 5;  4LRF A;  4S0M A;  2B9W A;  3ZTS A;  2HVH A;  3PIO Q;  4WYL A;  1RTZ A;  2FJA B;  2AWZ A;  4C3L A;  3NNA A;  4GVB A;  3HJV A;  3G8S A;  3PG9 A;  1JLB B;  2BUN A;  3I9Z A;  2ACY A;  3BGL A;  5HQM A;  4X62 F;  1Q4R A;  3L7O A;  3GV5 B;  3AD9 C;  1OPI A;  2C1E B;  5LT5 A;  1BQN B;  2ZHO A;  1EAR A;  3F73 A;  1LWC B;  2GGP A;  4OI6 A;  4FF1 A;  3AJD A;  4IQM A;  4NYP A;  4EO6 A;  2SXL A;  4LSN A;  3CJS A;  1I94 J;  3J81 j;  2VUG A;  2QSF A;  3VVU A;  1PAE X;  2ZHB A;  2N3O A;  4HL9 A;  4OFZ A;  2Z56 B;  1S72 S;  4K5R A;  2QIF A;  1ZM2 A;  3FQL A;  1CJV A;  2F9J A;  5FDL B;  2QL5 B;  2LEA A;  3L7P A;  1CC8 A;  3BPD A;  1FK9 A;  1QE1 A;  4LFB J;  3B54 A;  3NG8 A;  4EUV A;  1A7G E;  4OZL A;  4F4K A;  3MUM P;  1RHM B;  2GGP B;  3Q8Y A;  5EDW A;  4X4N A;  2CXE A;  4LSN B;  3P96 A;  3U02 A;  2YWW A;  2I9S A;  3KWM A;  5BR8 F;  1WF1 A;  2FLN A;  4GO5 X;  2XYP B;  3TJ8 A;  4ZPA A;  1YJW S;  2F63 A;  4MKV A;  4DV5 F;  1CJV B;  1AUS L;  2UZA A;  1SC3 B;  1AZS B;  3OSP A;  3RR8 A;  3BKF A;  4F67 A;  4DFM A;  2R7V A;  4B3M J;  1ZM4 A;  4F4W A;  4IFY B;  2OAU A;  2C2D A;  5B0A A;  2KM8 C;  1B3T A;  5F8G A;  1XMO F;  2Z4P A;  4C97 A;  4Z2X A;  2HVD A;  5KFK A;  1RKI A;  2HBR B;  3Q2S C;  5C7P A;  3CVK A;  2R7R A;  4YUD A;  2U2F A;  3IP0 A;  3TZW A;  5K8N A;  2BJD A;  4KC5 A;  3FSX A;  2FVC A;  1YX2 A;  1NB7 A;  1NSK L;  2NR0 A;  1NZA A;  3TA2 A;  4A8O A;  1WHV A;  4MK7 A;  4DV0 J;  1ZA1 B;  4HT7 A;  3OXL A;  2PI4 A;  2A2C A;  3M9N B;  1N34 F;  4FF4 A;  3PYG A;  5KG7 A;  5J1E B;  1S0N A;  2VKR A;  3FZB A;  2QX0 A;  3D7S B;  4NYZ A;  2W2P P;  2XB2 D;  1S6U A;  3ZTR A;  4DR1 F;  2CPJ A;  2HHU A;  1OMS A;  4RW6 A;  1OJ4 A;  5AXK A;  2OFH X;  1Y3J A;  2EXU A;  2JH3 A;  5H9E J;  1Y0H A;  4PXC A;  4LRD A;  3JB9 k;  1H6K X;  2ZFH A;  3SCJ E;  4CM2 A;  4U7U D;  3PRB A;  3CTR A;  5D0E A;  3VAL A;  4DQP A;  2JRS A;  4O3P A;  2ZH8 A;  1Y9O A;  1BLU A;  4C8Z A;  1H98 A;  3BBC A;  4JV1 A;  1Q0N A;  1XR6 A;  3ENV A;  3TOQ A;  3GQC A;  4KH1 B;  4A46 A;  1ARO P;  1GAO A;  1FT8 A;  3E2E A;  1OY6 A;  2QG9 B;  1P1T A;  2FLO A;  1ZYQ A;  1SUQ B;  1FVS A;  4JI7 J;  4IYQ A;  1S6P B;  1P1L A;  4CTA A;  4BS2 A;  1UVI A;  2ZE2 B;  1SPB P;  3FRY A;  2CZ4 A;  2E5I A;  1TAU A;  4DPX A;  2RF2 A;  3M7V A;  1K0T A;  2VBZ A;  3TAP A;  3PO4 A;  1MG7 A;  4J9K A;  4CWB A;  1RLC L;  2KFY A;  4FVC A;  4FF2 A;  1N6Q B;  1TFY A;  5D6G A;  1EJ7 L;  3HI9 A;  3K17 A;  2AX1 A;  2FC8 A;  2Y0B B;  4RNM A;  3DN9 A;  1S76 D;  5EWE A;  5IWA F;  4KYZ A;  3KK2 A;  2QLW A;  2QLF B;  1IR2 A;  2KRB A;  1S6Q A;  2WB1 D;  3BQ2 A;  3PX6 A;  5KG3 A;  1KTV A;  3AOA A;  4DX7 A;  2YH1 A;  4JI1 J;  5GMK a;  3MEE A;  2MZ1 A;  3P8B B;  1QDU B;  1A9N B;  5JVH Q;  4ED0 A;  2RF2 B;  3DOM A;  1UFK A;  2YNH A;  3EVM A;  1TUV A;  2YX4 A;  2C2R A;  3R5G A;  2XZW A;  3BRE A;  3G6X A;  4J37 A;  2BKN A;  4QZV B;  4ITS A;  4NRT A;  2K06 A;  3K89 A;  3TW0 A;  3ET6 A;  5HVH A;  3KHH A;  3K58 A;  3OFH A;  4IG0 B;  5CHC B;  4TLQ A;  2QRR A;  1H7W A;  3G4S S;  1BQM A;  4XK8 C;  1JLA A;  1BXN A;  1RE1 B;  4JI4 J;  1X4F A;  2DXF A;  3C6T B;  4UOG A;  2W8L A;  4HHU A;  3OV7 A;  2CQD A;  2R7W A;  4YB1 P;  3DOM B;  1U2F A;  4M95 A;  2YQ1 A;  1VQO S;  1U1P A;  2PMZ D;  1MWZ A;  5LSL A;  4TQS A;  5IV3 A;  1KFS A;  2ASD A;  2C3Y A;  2O66 A;  2OO4 A;  4I0W A;  1F5A A;  2MY7 A;  3RRG A;  3M2R B;  4PWD A;  2EBG A;  2Q1L A;  1JLA B;  3MOJ B;  4KHP J;  4FKX A;  3CCS S;  1GTH A;  2N4C A;  3TP2 A;  4E98 A;  1NCL A;  1NXI A;  4WP8 A;  2AJF E;  4IFV B;  1HHT P;  1RHR B;  2MZT A;  1DY3 A;  2J0X A;  2B51 A;  4XAK A;  4DFJ A;  4IDK A;  1WWH A;  3O44 A;  2RJZ A;  4DSF A;  3PJ9 A;  4LQ9 A;  2VIH A;  3ZTO A;  2ZVI A;  3TQE A;  1QLN A;  4RUA A;  1SQF A;  4DFK A;  4WP9 A;  1Q8B A;  2PFD A;  3LA0 A;  3KJV A;  2W01 A;  2GNK A;  1YLX A;  2H48 B;  5EWG A;  4FYW B;  1FE0 A;  5SZT A;  3EDQ B;  1OWX A;  2J0Q D;  1GEH A;  1IUJ A;  1T03 A;  1FVQ A;  5E3P A;  1RAO A;  2H54 B;  4ED4 A;  3CO0 P;  5KFD A;  3U1N A;  3S1T A;  2R2T A;  4EU0 A;  4CLU A;  5EWF A;  1RT5 A;  2OH2 A;  3BEG B;  2HQG A;  3OTB A;  4ECU A;  2XS7 A;  2DPI A;  1RIS A;  4Y2I A;  5CQG A;  2CJK A;  2VA2 A;  4QIV A;  4N8O A;  3UN2 A;  1C0T A;  5IT4 A;  1N88 A;  3KJV B;  2GV1 A;  2AZ3 A;  3OVS A;  3DU5 A;  1CLF A;  2G13 A;  5C2G A;  3THV A;  2D74 B;  2XMV A;  4NML A;  2ADC A;  4YB7 A;  1NUE A;  3M8Y A;  2PMW A;  1CQN A;  1R7I A;  2WSF C;  4ED1 A;  2DO0 A;  2C2Z B;  3G87 A;  3PFO A;  2ZM6 F;  2C2O B;  4ES1 A;  3DLB A;  1CJK B;  2OSQ A;  4IOA Q;  1SKR A;  4GO7 X;  3PV8 A;  2B4V A;  4NCA A;  2BW7 A;  1SI9 A;  1PGZ A;  2FJX A;  2QA2 A;  4MMO A;  3TI0 A;  3GII A;  2VON A;  1KR4 A;  4YHH F;  4K50 A;  1X9S A;  2RQ4 A;  3PIP Q;  1F1B B;  3ETM A;  1FJC A;  4RJV A;  1T9W A;  2G1D A;  1E6Y A;  2FGC A;  1VIO A;  2V68 A;  3RB6 A;  1J5E J;  1S77 D;  1WD6 A;  5C5J A;  5F3T A;  4DSI A;  3NY0 A;  4DL3 A;  1J27 A;  3GPA A;  2WBR A;  2OSR A;  2J5A A;  1K1Q A;  1MML A;  2KU7 A;  3HCX A;  1NJX A;  1O0P A;  1KEK A;  4UST A;  2XMT A;  1TK0 A;  4DR6 F;  2ZD1 A;  2PDA A;  4EBD A;  1MRO B;  1CS4 B;  3T1H J;  3GYG A;  3BN7 A;  3ITH B;  3VTI A;  1XJW B;  2AJQ A;  3TVY A;  4CO1 A;  4ID8 A;  1FRI A;  2VQE F;  1E6Y B;  3CCZ A;  1Q5V A;  3H4D A;  2KG1 A;  1RTJ B;  2R7O A;  2VDH A;  4LSL A;  2VQF F;  2CQI A;  5HLF A;  2POK A;  4X66 F;  3P5B P;  1VC6 A;  4B9S A;  1HBN A;  1XNQ F;  1MWQ A;  3GR0 A;  4ECQ A;  1WI8 A;  2YQ0 A;  4CO3 A;  4DPO A;  3R2D J;  4H4K A;  4OHY A;  1QJH A;  4LVN P;  3WBZ A;  2KG0 A;  2KJW A;  3H42 A;  1Y10 A;  2AEF A;  3O3L A;  4OHX A;  3EGW B;  3H20 A;  2XS2 A;  2ROE A;  1TUG B;  1X0P A;  2MXY A;  4DV1 F;  2ATC B;  2WW4 A;  4RNN A;  1JMT A;  3RW6 A;  2HKE A;  4LSL B;  1VQL S;  2B9E A;  4CLT A;  1C1B B;  3L3C A;  3SDE B;  1YRT A;  3HHL D;  5FJ4 A;  2CJQ A;  1FFW B;  4OV1 A;  4HAC A;  2F7V A;  2R2S A;  3QWP A;  1TKT A;  1VI7 A;  2FJE B;  2VOP A;  5DQG A;  2R8I A;  3JTP A;  4DV3 J;  1M5K C;  2DR6 A;  5CD4 A;  2K1R A;  5DQH A;  5JMN A;  3F0N A;  3PCO B;  3QGG A;  3EZU A;  3KXD A;  3IRW P;  4LQ3 A;  1YHQ S;  4B3R J;  3VAI A;  3OVB A;  3MAA A;  2VHG A;  4JI6 F;  4TY8 A;  2MZS A;  3V5R A;  1SJ4 P;  3OR2 A;  2ZWP A;  2MZJ A;  2QN6 B;  2CYY A;  1KKH A;  1TKT B;  2B7B B;  2QV6 A;  4KHR A;  4BHQ A;  3N6L A;  4DV6 J;  2K1R B;  2PFF B;  3SSR A;  4NPO A;  4A47 A;  5KFM A;  5DDQ C;  1V3R A;  4LBP A;  1WI6 A;  4KRW A;  2W4D A;  1VQ5 S;  1BWE A;  2XO7 A;  1UZD A;  2EK1 A;  4I68 A;  2LFV A;  1WSV A;  2Y1I A;  2YX1 A;  2MHE A;  5A6W A;  1Q53 A;  4FYY B;  4HTJ A;  2VFR A;  4TY8 B;  5DRK A;  4QW9 A;  1ZET A;  4NEZ A;  2DEI A;  1C4C A;  3VGU A;  2JSX A;  2W24 A;  3KYL A;  4NCB A;  2E1A A;  2EPI A;  1ACM B;  1NDP A;  3CPW R;  1S9G A;  5THW A;  1Y5L B;  1U1N A;  3A1Y G;  2CDR B;  4ZJL A;  2BYC A;  1GK8 A;  3OVA A;  4LFC J;  4QR0 A;  1IBK J;  3NOC A;  4I2P B;  4U96 A;  3TAR A;  5HAT A;  3KJF B;  3MR5 A;  2BJE A;  4H4M A;  5U47 A;  4U7U K;  3DOL B;  3QFW A;  4X4O A;  3HMJ G;  3WX8 A;  1U1M A;  2GMH A;  3J80 U;  2HAI A;  2W9B B;  3D4J A;  1U2C A;  2IIH A;  4CLP A;  1SKS A;  4QPT A;  3FBB A;  4USM A;  3NGD A;  1YIT S;  2J8S A;  1SH2 A;  2PII A;  3FJ2 A;  2HFS A;  4I56 A;  2LLZ A;  2HHH F;  1ULR A;  4Q8F A;  5D4N A;  1RT3 B;  4Z37 A;  3MM5 A;  2W9A A;  2PMH A;  4LF5 J;  3CJQ A;  3DOK B;  2YNF B;  3CDW A;  1MU2 B;  2W2M P;  1R3N A;  4A8K A;  2AYG A;  4LR8 A;  5BYQ A;  2MSS A;  1NAQ A;  2H1Y A;  3ETO A;  3CC7 S;  4CP5 A;  4ZN3 A;  1TL5 A;  5GVQ A;  2RT3 A;  3SYZ A;  2WB4 A;  2F3J A;  3K59 A;  3ZNU A;  3I5C A;  5KFW A;  2DIV A;  1FJ7 A;  4DG1 B;  3K5L A;  4ES3 A;  4DMZ A;  3D6M B;  4ZVQ B;  3EPG A;  4X4T A;  2BJ9 A;  4CLY A;  3EVO A;  5E2Q A;  2V67 A;  4JI5 J;  3IRX A;  3UD3 P;  2RH3 A;  1S0M A;  2W7A A;  3QAT A;  4ECT A;  2C2K B;  2QT7 A;  2WCX A;  1EP4 A;  2W7P A;  2M3D A;  1DHM A;  4LF4 J;  3NNH A;  4NXN J;  1RAB B;  5GAD U;  1VFJ A;  1T3N A;  2CVE A;  5E5N A;  5BXI A;  4O3N A;  3J80 Y;  2WVE A;  2P2C B;  1U7L A;  3HHN B;  1TKD A;  1NKC A;  5I3U B;  3V6D B;  2MKJ A;  3NWG A;  1CJT A;  3IRX B;  3OTO F;  1QSY A;  1NEE A;  1N32 F;  3F44 A;  5DM6 Q;  4GRS A;  4QIG A;  4CLF A;  4Q2L A;  1LW0 A;  3DNC A;  3LP1 A;  3GWC A;  1VCT A;  5DZ7 A;  5KT5 A;  2FB0 A;  1ZPW X;  4F4Y A;  2C3P A;  3M6X A;  2QYG A;  2RE1 A;  1HA1 A;  3W66 A;  1LK7 A;  2NUU G;  3LOU A;  2MQQ A;  2ASL A;  1PC4 A;  1PCA A;  2GIR A;  4NXM J;  4A8W A;  3FBF A;  1PJ7 A;  2ZBC A;  4ZPW R;  1HBU A;  2HHV A;  4L3K A;  3CT9 A;  1FJG J;  5KT4 A;  2KFZ A;  1LW0 B;  1OY8 A;  4UW2 A;  3FEY B;  1BY9 A;  5AE3 A;  2ADB A;  1KC8 T;  5CAB A;  5BYS A;  1SL0 A;  2R42 A;  4WTO B;  2VKZ G;  3MZI A;  3OPK A;  3V4M A;  1B0V A;  2NXN A;  3GFX A;  3I4P A;  1CG2 A;  4BWJ A;  3AJ1 A;  1V3S A;  4KTQ A;  2UUW A;  2EFP A;  4X4S A;  4FXD A;  4YDX A;  3DC2 A;  4QU7 A;  5KG0 A;  3M8P B;  2DY1 A;  1XC9 A;  2RQK A;  1Q8K A;  1LQ9 A;  3DMJ B;  5I4M A;  4U6P A;  3CF5 Q;  2FZK B;  2HAF A;  2XLK A;  2Z2L A;  4OZJ A;  1R0B G;  2NSC A;  2HK3 A;  1N5Y B;  4DLG A;  1I51 B;  1RQ0 A;  2COL A;  1JJC B;  3R97 A;  2XO6 A;  3SFU A;  4NCG B;  2DNN A;  1FNM A;  3PEJ A;  1UVK A;  5A0Y B;  2DGW A;  1GMU A;  3DLH A;  4M5H A;  3BQ0 A;  2BAN B;  3RBX A;  2M8D B;  2FGO A;  3CGI A;  2MQM A;  5A76 A;  2FY1 A;  1NDL A;  3D1H A;  3CCR S;  2IBK A;  2RRB A;  3MDF A;  3DLE A;  1TMJ A;  2DGS A;  3RBZ A;  4IUF A;  2FC9 A;  2UXD J;  3CJ0 A;  2DRD A;  3UW1 A;  1M5S A;  4URQ U;  2HMI A;  3FEZ A;  3T9N A;  4UQG A;  1CJU A;  4HVZ A;  2PEB A;  4GMK A;  1OPZ A;  3MM6 B;  5CA5 A;  1NSP A;  3KLV A;  3UR3 C;  3F56 A;  3GON A;  2BOP A;  4RU9 A;  2NXC A;  4DUZ F;  1ZM3 A;  1YIJ S;  3R2C J;  1OYE A;  1S99 A;  2GVD A;  4FS2 A;  1NO8 A;  2KYX A;  5KOX A;  1RAH B;  4FZV A;  5H1S V;  1SV5 B;  3OSN A;  4Q5V A;  2UUC J;  1VJW A;  4F4Z A;  3AOD A;  4BWM A;  4RW9 B;  1PIE A;  3NS5 A;  1NSA A;  2P9C A;  5H9F K;  3DYA A;  4N41 A;  2HQD A;  1VYA A;  1XK8 A;  1PYS B;  2HMI B;  4A4J A;  4URG A;  2AX0 A;  3I82 A;  2PD1 A;  1NK9 A;  1JJH A;  4Y2M A;  3CD0 A;  4OJH A;  2NZC A;  2ZEJ A;  2X1B A;  2GVD B;  1LWE A;  1PBA A;  2OEM A;  3CCL S;  1SH3 A;  1RHJ B;  2HWH A;  2QA1 A;  1YK9 A;  1M1G A;  3C6U A;  1JJ2 R;  2X1A A;  1WF0 A;  3VWS A;  3LGH A;  5GAG I;  1UVJ A;  2GQC A;  1RWU A;  1RTI B;  4DBQ A;  2DNL A;  3KHG A;  2JVO A;  3DLL Q;  1VBK A;  3ENW A;  5C25 A;  4WFA Q;  4FNI A;  2CQB A;  3ILI A;  3KLF A;  2BRK A;  4JI2 F;  3ZTP A;  4DX8 H;  4CNZ A;  1SH0 A;  3CB4 A;  2LEC A;  1D9A A;  2GO9 A;  2MHN A;  3HZE A;  3HUL A;  3G8T A;  4CLK A;  4KGZ B;  4RL1 A;  1CUL A;  3GR1 A;  1KLM A;  3QJP A;  3U7J A;  1FD8 A;  4WFN Q;  1NKB A;  1UWB B;  3RB0 A;  1JKH B;  4LFA J;  1H0H B;  1VRT A;  1SQG A;  1CEZ A;  2FDN A;  3AD7 C;  1N0U A;  4OYA A;  1L3U A;  1FRK A;  5C25 B;  1JK9 B;  2V8P A;  2WVD A;  4KV8 A;  4QWA A;  3QZ7 A;  3KLF B;  1U1K A;  1R8P A;  2N7Y A;  5ETK A;  3WIV A;  4I6Y A;  4NLX A;  4QIW D;  5L8R C;  4DV2 J;  2MKH A;  2DBB A;  2FJW A;  3EM1 A;  1NDK A;  2LA6 A;  3CCQ S;  1IM6 A;  1MMN A;  4K0K J;  3PHT A;  2B9X A;  2DNZ A;  1HNW J;  5KFN A;  2ZBI A;  4WPA A;  4WU3 A;  2WVC A;  1DTQ A;  1KVJ A;  1S1V B;  1FNX H;  3DM2 B;  1FF2 A;  7AT1 B;  3PX0 A;  1HQE B;  4X4R A;  5IT9 U;  2O01 C;  5E0O A;  5B0G A;  1I94 F;  3HDS A;  2IM0 A;  3W64 A;  1GXT A;  2CAJ A;  2HNY A;  2L9N A;  3KLE B;  3CW2 C;  2RS8 A;  2QJ3 A;  3LGN A;  1C2P A;  1KQF B;  2NXE A;  2CQ1 A;  1DTQ B;  4ECW A;  5DGA A;  4LFB F;  4LSZ B;  1TKX A;  2WAQ D;  2UXB J;  1CQM A;  1RT4 A;  4KQZ A;  2HQC A;  2GA7 A;  1RAJ A;  1R8B A;  1REG X;  4FDF A;  4DPT A;  1JNR B;  3KK1 B;  1H7X A;  2A1B A;  2M0G B;  2RRA A;  3HK2 A;  2X1G A;  1R6Y A;  4GVL A;  1C0U A;  4NLO A;  4DSL A;  3TJA A;  3MPU B;  3W5Y A;  5CAA A;  1Q78 A;  2IPO B;  3OL9 A;  1Y5I B;  5ETV A;  4KGV B;  2DD8 S;  3LP0 B;  4C11 A;  2AYE A;  1MMD A;  3EIC A;  5T41 A;  1X31 C;  4B3M F;  4KFB A;  4F0M A;  1TKX B;  2H4Y B;  1RT4 B;  2VFT A;  3FSY A;  4F8R A;  2B8Q A;  4KIA A;  3P45 B;  2XSJ A;  1NZ8 A;  3DLG A;  2IA6 A;  5KFG A;  4PPZ A;  4QWC A;  1FRJ A;  1AB8 A;  1PSD A;  2OEJ A;  2R2R A;  2EFQ A;  1IWG A;  4C0B A;  4JUZ A;  4CRJ A;  4ZPB A;  5IT9 Y;  4KHM A;  3A4T A;  4DV0 F;  2V94 A;  3US5 A;  3ZZZ A;  4ZVS B;  4CCH A;  4ZLL A;  2DIS A;  2GMJ A;  3C66 A;  3N79 A;  1HNV B;  3TX8 A;  3EXC X;  2DKO B;  3DRP A;  1Y3K A;  2NQP A;  4K4V A;  3GG0 A;  4FYD A;  1U1R A;  4B9N A;  1NPR A;  2YKM A;  5A8W A;  4L74 A;  4OL8 A;  2J7U A;  3BSC A;  4FXV A;  3VGS A;  2PA3 A;  3KTQ A;  1Q5Y A;  2E7X A;  3O6Q A;  3FGV A;  3C46 A;  2E44 A;  2BQU A;  5HK4 A;  1IKX B;  1KTQ A;  1SJF A;  3TR5 A;  3LPY A;  4KBI A;  4PYA A;  4BC9 A;  4NZ7 A;  4LF8 J;  2VBX A;  1RXO B;  1S9F A;  5CZV A;  4GC6 A;  2JHE A;  2YWE A;  2XI3 A;  1B99 A;  3BYR A;  3H8Y A;  5CYQ A;  2OPP B;  4LR9 A;  4JV5 J;  1WOP A;  1JLQ A;  1VC5 A;  4U8Y A;  2OPR A;  1EX8 A;  2XMU A;  3PAC A;  5A8W B;  3IFE A;  3ZZU A;  4O3O A;  2WK4 A;  4CLL A;  5IV4 A;  1HD1 A;  4ECS A;  3HVT B;  2R7T A;  4M5J A;  2JX2 A;  3QO9 A;  3CD5 A;  2CJ9 A;  3M6U A;  1Y5N B;  4JI7 F;  5IZH A;  2OD4 A;  4TXS A;  2LP4 A;  5CYQ B;  4HYK A;  4WFY A;  1BC6 A;  3HLU A;  3J7Y U;  1JLQ B;  2OPR B;  4OJG A;  4JV0 A;  4G1I A;  2EFV A;  3G6E S;  2HRY A;  3NS6 A;  1RBO B;  3AQO A;  4ID5 A;  1P6T A;  4RLE A;  4C9D A;  2YXL A;  1IN0 A;  3TQ1 A;  4DCO B;  4MT1 A;  2ZBQ A;  5KG4 A;  2DR7 A;  1T9U A;  4MIA A;  2OMO A;  4OZ2 A;  1VBZ A;  4ZIV A;  1KVK A;  4TNO A;  1AYE A;  1UFW A;  1QTM A;  1BE4 A;  1S49 A;  4ZDN A;  4IR9 A;  4JI1 F;  3R7S B;  5AXM A;  2MJU A;  3W9H A;  3NS7 B;  2QMW A;  3IA0 A;  3I0S B;  2YTC A;  3PFE A;  3WX4 A;  4ID5 B;  4NAS A;  3BB5 A;  2B43 A;  3L9Z A;  5F8H A;  4NLD A;  3PXG a;  5EUH A;  2DVI A;  1LEO A;  3I31 A;  3GIK A;  4C48 A;  4ZP6 A;  4HEA 9;  2Q43 A;  2IMW P;  3C16 B;  4JBC A;  4ZPC A;  1N5Q A;  2K8G A;  2KB2 A;  4G1Q B;  4PR6 A;  2ROG A;  3NAI A;  5BJR A;  4KO0 A;  4JI4 F;  1WSR A;  1U1Q A;  3B78 A;  1T9X A;  1WC6 A;  2Y1R I;  4K5S A;  2VC0 A;  2CG8 A;  2AZ1 A;  2Z8Q A;  5HMX A;  1TKZ B;  2F4F A;  4IR1 A;  2A6O A;  2XY5 A;  1VMB A;  4I67 A;  1DTT B;  3GJR B;  4ZP9 A;  5LSO A;  2VA3 A;  3N5B A;  1OIA A;  1WG1 A;  3EPI A;  4FF3 A;  4FP9 A;  4UUX A;  2CPE A;  3SZ2 A;  2LMI A;  2J9D E;  4FS1 A;  1LV5 A;  1EQ0 A;  2R7U A;  2CG4 A;  4A8M P;  1RWK B;  3P4U B;  4KHP F;  1DAX A;  3MEC B;  2ZUA A;  4DL7 A;  2HZC A;  4EO8 A;  1R43 A;  4PG7 A;  3O2I A;  3Q23 A;  2HBQ B;  1WHW A;  1ZPV A;  4KE5 A;  3KG1 A;  3HXM A;  4LBI A;  4ZVH A;  3HVA A;  4WFZ A;  1KLN A;  2Y1J A;  2IM3 A;  3ZNJ 1;  3PDN A;  3FKB A;  5CYM A;  5E3C A;  3JS9 A;  4F50 A;  3D1Q A;  1X5T A;  4OMF G;  2UV8 A;  4DQR A;  2YKO A;  2XMW A;  3T5K A;  1R89 A;  1DRZ A;  4UY8 T;  2IDL A;  5M2P A;  3DLJ A;  3PYD A;  1TQL A;  4IH5 A;  2L3M A;  3BYP A;  4JYA J;  3WC0 A;  2OPS A;  1ZTW A;  4WII A;  2BE9 B;  3R9L A;  3VAM A;  4WFX A;  1DAR A;  1TL3 A;  3VAH A;  2ZOF A;  1D8Y A;  2JLF A;  1TVR A;  4O44 A;  3MOZ A;  1S0O A;  1FDA A;  5CYM B;  1X4E A;  2GC8 A;  3GTY X;  2ERR A;  2R9L A;  4DSE A;  5M2U A;  5L9N A;  1UJ5 A;  1RT1 A;  2JC0 A;  3KG4 A;  4QJV A;  4H54 A;  1XN9 A;  5B09 A;  3M2V A;  2IVF B;  1VC0 A;  2ZH2 A;  4ECV A;  3CE8 A;  2OPS B;  3A3O B;  2YNG B;  2W8K A;  3HSJ A;  4A8Q A;  3QNW B;  1S5Z A;  1HPZ A;  1TL3 B;  1ZM9 A;  2EBE A;  4ILL A;  1TVR B;  4O44 B;  2V5H G;  5ETN A;  4M5G A;  1U24 A;  1RSC A;  2ZJP Q;  1WEY A;  1B7F A;  4P6Q A;  4RW8 B;  3H2V E;  3QAU A;  5JVG Q;  4P2X A;  3C14 B;  3OL7 A;  3M9M B;  1RT7 B;  2AJ1 A;  3M2V B;  1TL7 A;  3LPE A;  1VR6 A;  1HYS B;  2QZ8 A;  4I64 A;  3P6Y C;  2EVZ A;  2YNI A;  1S6O A;  3P5T L;  3S6E A;  4DJB A;  3NCR A;  2OKQ A;  3OUY A;  4YR0 A;  4AUK A;  3QIP B;  1JXE A;  4NWB A;  4KT0 C;  5K5M A;  5A2Q U;  1J5E F;  3QPI A;  2WSE C;  4RNF A;  2KRR A;  4RWX A;  3DRY A;  4HDG A;  1UVM A;  1S1X A;  1YJ9 S;  2B6A B;  4Q45 A;  3BM7 A;  3OFF A;  3H0P A;  2MKY A;  1QAY A;  3QID A;  3THT A;  2RD5 C;  2UUA F;  2KL8 A;  1WC1 A;  3OQ2 A;  3MMA B;  1TAQ A;  4ERD A;  1EKS A;  3T1H F;  1WEL A;  2D1C A;  1F0X A;  3VZH A;  4AQY J;  1JLC A;  1WEX A;  3QGP A;  4B3S J;  5KT2 A;  4ZPT R;  2CQH A;  1URN A;  4ZA1 A;  3TZX A;  1RAE B;  2ILZ A;  3G96 A;  1UET A;  3SXL A;  1IBL J;  4URS A;  1AFJ A;  4MK8 A;  3OTO J;  5ETS A;  3PRV A;  5LOQ A;  3BR8 A;  3IR5 B;  1HL6 A;  1H2V Z;  1ZAW A;  2ASY A;  2ZJQ Q;  4MFB A;  4ATN A;  4E0D A;  3G6V A;  1QAJ A;  2HG4 A;  2HRU A;  2ZWO A;  2GHW A;  3OTC A;  3UQS A;  2WTF A;  2BM0 A;  3KNA A;  1YVF A;  4QR1 A;  1UVN A;  1RWV B;  1JLC B;  2QLX A;  3B8H A;  1T05 B;  3DLK A;  1M5H A;  4H4O A;  4AXI A;  3DGV A;  4XPE A;  4Q7A A;  2VOD A;  3PHE A;  3QJJ A;  5G4D A;  2IYG A;  2IBO A;  5ADZ A;  4IRK A;  1Q79 A;  8RUC A;  2HFU A;  2G0C A;  3E01 A;  4N5S A;  3V81 B;  5KG1 A;  4MFB B;  2V4R A;  2PGC A;  2ROP A;  4DCJ B;  5A2Q Y;  4Y2C A;  3GIL A;  4DV3 F;  3W7B A;  4RO0 A;  2OPQ A;  4F3Q A;  2M8H A;  5L1J A;  4M5D B;  3BKU A;  4TU9 A;  1RWX B;  1KQS R;  3MMJ A;  3TUI C;  3DLK B;  4H4O B;  3DRR B;  3VAF A;  3LWL A;  1NBE B;  4B3R F;  3FQK A;  3M8W A;  1IM4 A;  3P49 B;  4AT1 B;  4RUH A;  1NH7 A;  1RT6 A;  1B0P A;  3ZZO A;  4E8U A;  2LU1 A;  2O1P A;  4LRA A;  3PVX A;  3V2U C;  1WEZ A;  4OIX A;  5GAH U;  2NSB A;  1UFL A;  2JFK A;  3RJM B;  4O23 A;  1VJQ A;  2V4J A;  5J2Q A;  4OX8 A;  2GCF A;  4OI1 A;  3BO3 A;  5CZX A;  4DV6 F;  3UN3 A;  2OPQ B;  1I3O B;  4K4X A;  4QIE A;  3K7R A;  1X4D A;  4HLB A;  4B02 A;  5C42 A;  2M52 A;  4ZMM A;  2G1H A;  3MM9 B;  3EE3 A;  2CPZ A;  3D9B A;  3RGI A;  2AGO A;  4P2F A;  1RT6 B;  2XGP A;  1X5P A;  3LAL A;  1ZS6 A;  2IHR 1;  4OYO A;  3FDS A;  4ZCI A;  2RU3 A;  3R8Y A;  3X1L B;  4OZ1 A;  4P2S A;  1FD2 A;  1LKZ A;  2KT3 A;  3V6K A;  2V4J B;  3FCH A;  3W2W A;  5J2Q B;  3BH6 B;  3AJ2 A;  3QFH A;  4V1A k;  4ZP8 A;  2E9Z A;  4LFC F;  2EFG A;  2HBY B;  1W2B R;  2V9K A;  1IBK F;  2MQP A;  3KK3 A;  2LCW A;  5D3G A;  4OZ5 A;  2YY3 A;  1EET A;  1H72 C;  4ZVE A;  3SSS A;  1IXK A;  4LIR A;  4J9N A;  4MKB A;  1UJ6 A;  3HHD A;  1U49 A;  4BDP A;  3TWZ A;  1X4B A;  3JSY A;  4UF4 A;  1NH8 A;  2VFV A;  4CO4 A;  3CJ4 A;  2ZH4 A;  4ZHR A;  3PZP A;  3DDI A;  1J5O A;  2AKW B;  3ZZP A;  3W2W B;  1WOS A;  2X1F A;  3HJF A;  3R7N B;  2FIU A;  4PEO A;  2XMM A;  5DQI A;  1NK0 A;  2HLU A;  1FRL A;  1HHQ A;  3KDO A;  4R0J A;  1IWA A;  3KFW X;  2AP6 A;  2YH0 A;  2XM3 A;  1X60 A;  3ENQ A;  3KK3 B;  4LF5 F;  4UY8 5;  2Z2M A;  1F5C A;  1P9Y A;  5D3G B;  4LBH A;  4L75 A;  4O3Q A;  3W2V A;  4JI3 J;  1NME B;  3D67 A;  2CPD A;  1X4H A;  1JX4 A;  2IC3 A;  2JNJ A;  3D0I E;  4U95 A;  4ZHR B;  1J5O B;  4C0H A;  2B3T B;  3TUJ C;  1FEH A;  3GSD A;  1Q82 T;  4QYZ K;  1JLE A;  2RRN A;  1RWO B;  2DNM A;  2C42 A;  2I6W A;  1R6V A;  4O4G A;  1T95 A;  4C0O C;  3BSA A;  4F04 B;  2CPH A;  2CPF A;  3QRR A;  5B0F A;  2HHT A;  3W2V B;  4UTG A;  4JI5 F;  5KT6 A;  5F0U A;  2UUT A;  3UDL A;  3IWX A;  3N6M A;  4WK1 A;  1MLA A;  1JLF A;  3QT7 A;  2C3O A;  2I0X A;  1LOU A;  2DGX A;  5FLX Y;  4LF4 F;  4AL6 A;  1TP7 A;  4NXN F;  3H7H B;  3R5J B;  1WF2 A;  4IG3 B;  3OHB A;  3ZXW A;  1N36 J;  3ELH A;  2QYC A;  3DGP A;  2GIQ A;  1FRH A;  4C8Y A;  3EMT A;  4DZD A;  3CSK A;  1KQK A;  1KSP A;  4Z7Y A;  1U0H A;  2WON B;  1KD1 T;  1XMQ J;  1O6X A;  1RHK B;  2CFX A;  1JLF B;  2LXI A;  2GS8 A;  1N54 B;  2CA9 A;  4OYW A;  3CCW A;  3KLI A;  2R2U A;  4ED3 A;  2XUL A;  3Q8R B;  3D2W A;  5T14 A;  4AFF A;  4NA2 A;  2M2B A;  1L3V A;  2UXC J;  4DL2 A;  3TRG A;  4DQQ A;  4DPW A;  3NCQ A;  1RHU B;  4PAB A;  3U27 A;  2AMC B;  3AB2 B;  4NXM F;  4HH1 A;  2Y1L B;  1MN9 A;  3HFZ B;  2CWK A;  1YI2 S;  1QM9 A;  4PUO A;  4OX6 A;  4OZ0 A;  2JOQ A;  1U0H B;  3GIR A;  5C24 A;  3JXO A;  3KDN A;  1Q7Y T;  2N7C A;  2RDI A;  4NZ6 A;  1FJG F;  1R27 B;  2RSQ A;  1GFW B;  5HSP A;  4CLS A;  1FES A;  3BSN A;  4GVB B;  3EXY A;  1X4A A;  1NU4 A;  3AD8 C;  1L3K A;  5HJX A;  2IM2 A;  2MQO A;  4HT5 A;  4IRC A;  1X9W A;  4DCP B;  4YR3 A;  1RA6 A;  2MPU A;  3VQT A;  4PUO B;  1R8A A;  3VGT A;  2XWX A;  1GMW A;  2MMY A;  2D3Z A;  4CO5 A;  3MCN A;  1T11 A;  4ZLP A;  5EX0 A;  3NKY A;  2JL9 A;  3CJK A;  2W4P A;  3BO2 A;  2HFV A;  3ZFV A;  1NK7 A;  2G9O A;  2VC1 A;  1T9Y A;  2D69 A;  2VZ9 A;  3MUV P;  3NOG A;  4USH A;  1HWI A;  2WOM A;  4A8X A;  4OYM A;  1FK9 B;  3T6B A;  3HO1 A;  3CCV S;  2IRU A;  5B0B A;  1QE1 B;  2VG6 A;  1F9H A;  4MYU A;  3W5Z A;  2XWY A;  2GHV C;  4OJ3 A;  3M05 A;  1VQ8 S;  3MAQ A;  3JTO A;  1MN7 A;  3Q8Q B;  2FHM A;  4CQ1 A;  2BE2 A;  3MR3 A;  2IFX A;  1DLO A;  2AV5 A;  1HWU A;  3CJK B;  3BDP A;  2P8I A;  3M8Q A;  4FVM A;  3BR9 A;  2GJF A;  3HX9 A;  3IMQ J;  2QO3 A;  4BC7 A;  1GNK A;  1NKE A;  2UXD F;  2BOA A;  2ZC3 A;  3GIJ A;  2IRY A;  5EN1 A;  2JC1 A;  2VG6 B;  2ZHA A;  3CDE A;  4DXL A;  2JDJ A;  2RHQ B;  4G1P A;  3PW0 A;  4C7Q A;  2XNQ A;  3SI8 A;  2DNP A;  2BE2 B;  5DJB A;  3M1V A;  1DLO B;  4R8U A;  1TV6 A;  2K7K A;  2GHP A;  5ETT A;  3TUP A;  2XMA A;  3M8Q B;  2QE5 A;  3CJ8 A;  1NHU A;  2UUC F;  3OTD A;  4ZK7 M;  4K4W A;  1WNE A;  2W4C A;  5HN0 A;  2F65 A;  2CQ0 A;  4ZVO B;  5KFP A;  3SCI E;  2MLY A;  3QGH A;  4TU7 A;  3T9Z A;  2J0W A;  3I87 A;  3MF5 A;  4C8K A;  2G2O A;  1YQH A;  4HHJ A;  1HIY A;  1NDC A;  2ZZN A;  5J2P A;  5E41 A;  4EMD A;  3T3F A;  3M1V B;  2H4W B;  1HNX J;  3EDR B;  1TV6 B;  4OLP A;  5H9E K;  4EK2 A;  1X7V A;  2LQJ A;  4RW6 B;  1AW0 A;  1CBK A;  3O5T B;  1Z4U A;  1FKP A;  2BW2 A;  2DGO A;  3PR4 A;  1YBU A;  3JSR A;  3Q86 A;  2ZZM A;  3QZ8 A;  5DLG A;  1OS5 A;  1R0A A;  2V2K A;  2W1B A;  3GFZ A;  1OY9 A;  2AEM A;  2CNL B;  2DTJ A;  3W1Y C;  2VU5 A;  5J2P B;  2QFI A;  3GFY A;  3MR6 A;  1NB2 A;  2E66 A;  4NLP A;  4J9S A;  4OZ3 A;  3OD2 A;  3RRH A;  4CH7 A;  4PRF A;  3L4B C;  2OEL A;  3M6W A;  4ZLJ A;  1VLY A;  1D1U A;  3ICL A;  1FKP B;  5BYR A;  4A8S A;  2DNQ A;  3BGO P;  4ALZ A;  1W7W A;  2PE8 A;  4LFA F;  5K8P A;  1H73 A;  4IKA A;  1SL1 A;  2ZH9 A;  5CH7 B;  5LMU J;  2OD6 A;  4K4Y A;  1KS2 A;  2FVS A;  4CTA B;  4D3G A;  4ENO A;  2P9G A;  1GXL A;  3X3U A;  4ZCM A;  1PJ6 A;  4P71 A;  5JJB A;  2NLW A;  2CJB A;  4DV2 F;  1X4C A;  4KPY A;  5DG8 A;  3GYX B;  2E7W A;  1LXN A;  3DI6 A;  1BGX T;  3C8Y A;  5K20 B;  4K0K F;  1W25 A;  1HNW F;  3NP5 A;  2F1F A;  1YG0 A;  4B17 A;  5HMZ A;  2UVV A;  3PRD A;  2AJ2 A;  3KK2 B;  2O3D A;  3IS9 A;  1LNQ A;  2YQ3 A;  1S6Q B;  3AOC A;  3TUZ C;  4LF7 J;  3D6T B;  2CIM A;  2DR8 A;  3TAN A;  2MEW A;  3MEE B;  4ELT A;  2V2Z A;  2ZKU A;  4H4K C;  4P10 A;  4NLT A;  2CQP A;  1FI4 A;  2YNH B;  3MFI A;  4NA1 A;  2LA4 A;  2EKY A;  1S4F A;  3PX4 A;  1IKW A;  5F8M A;  3V6J A;  2BBE A;  4ETX A;  3IGV A;  1SKW A;  3DI6 B;  3T5L A;  3CCU S;  3ET6 B;  1TK8 A;  2DNH A;  1WAC A;  3RAQ A;  1U4B A;  1BQM B;  1JB0 C;  3J7A 1;  4KB7 A;  3CJT A;  1HW9 A;  4MKY A;  4YEA A;  4UOF A;  2UXB F;  3V4I A;  3JAM U;  4AYB D;  5ETM A;  3SCL E;  5KFI A;  4PQU A;  3MCM A;  5K14 A;  4Q44 A;  2OI2 A;  1T94 A;  1B7Y B;  1BHN A;  1IKW B;  5CXT A;  1QVF R;  4ECZ A;  2Q6C A;  1UMJ A;  4KR0 B;  2MB0 B;  3R5C A;  2DNY A;  1V3Z A;  1HHS A;  4GKK J;  3N6N A;  4DX5 A;  1KOH A;  1JQG A;  1FX4 A;  4PWD B;  3SEO A;  3MMB A;  1FTR A;  2KVQ E;  2AYB A;  2C28 A;  1YZ7 A;  2V8H A;  2KKH A;  1UW4 A;  3LWM A;  4PPD A;  4TN2 A;  3T1A A;  3V4I B;  1V6H A;  3H4B A;  4QOT A;  4JI0 J;  2IDE A;  1KRP A;  4PQU B;  4F36 A;  5K14 B;  3CCT A;  1EZZ B;  4IDK B;  4P73 A;  3SFG A;  1TL1 A;  2RS2 A;  1W2I A;  2CNK B;  2L41 A;  2DCU B;  3LAM A;  1V5V A;  2ZDP A;  3HT0 A;  1NJW A;  4C8L A;  4PYD A;  4PXD A;  3MED A;  4IOB A;  3GFH A;  4ANE A;  1FE4 A;  3M6V A;  3KLG A;  4GKJ J;  2LEP A;  3MCS A;  1S4E A;  2CAD A;  2V34 A;  2ZIT A;  4PAA A;  5L1K A;  1TFW A;  3E51 A;  1X4G A;  4W90 B;  3HSD A;  1Q16 B;  4XIU A;  2NUH A;  2CKW A;  2Q6B A;  1T03 B;  1M5V C;  5G0R A;  3A3P B;  4I2Q A;  3AB4 B;  1VRQ C;  1VLO A;  7FD1 A;  2DXE A;  3A8K A;  1HWK A;  3BBF A;  4QQB A;  4YDD B;  4KGX B;  1RT5 B;  1Y00 A;  3JAM Y;  3ONQ A;  4DQI A;  4LF8 F;  4DR2 J;  1RJJ A;  3MED B;  1C0T B;  3IM9 A;  3FCW A;  2EK6 A;  1ZZN A;  3ILO A;  3QGI A;  3H5S A;  4F25 A;  2ZH6 A;  3DXB A;  4JV5 F;  2E1R A;  2CQC A;  1DQ8 A;  4C6A A;  5LXY A;  4ZVG A;  3JSM A;  1NJY A;  2E1C A;  2YPZ A;  3IR7 B;  3CCJ S;  4I2Q B;  1IBM J;  2ALZ A;  3RW7 A;  4OHW A;  3G71 S;  3D0H E;  4ZIT A;  1DFD A;  2XTJ P;  3LAN A;  2RDD A;  3C2P A;  2BMB A;  3CMQ A;  2P6S A;  2DH9 A;  2HFN A;  4WKR A;  5D8H B;  5D4O A;  3A3N B;  3OL8 A;  3QT6 A;  2FHO B;  4UQT A;  5GAE U;  3W8P A;  2I2Y A;  3CD6 S;  2B4P A;  3VVT A;  4AXJ A;  2UUA J;  2FZC B;  5F9L A;  4IO1 A;  2YWH A;  2HIQ A;  3RZA A;  3DRS A;  1RWN B;  1VQN S;  2DH7 A;  2DO4 A;  3JSM B;  3R3T A;  4QU6 A;  5T7L A;  1UKU A; 
#chains in the Genus database with same CATH homology
 1Q5V A;  2BJ9 A;  2F1F A;  2WVF A;  2WVC A;  3OD2 A;  2WVE A;  2BJ7 A;  2BJ8 A;  2Y3Y A;  2CAD A;  2WVB A;  2NZC A;  3BKU A;  3LGH A;  3BKF A;  2CA9 A;  2WVD A;  2CAJ A;  2BJ1 A;  2BJ3 A;  2HZA A;  2HZV A;  2PC6 A;  3BKT A;  3PHT A;  2FGC A;  1Q5Y A;  3QSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...