2NZCA

The structure of uncharacterized protein tm1266 from thermotoga maritima.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
80
structure length
80
Chain Sequence
b'EKRFYILTIVVEDREKAYRQVNELLHNFSEDILLRVGYPVREENMAIIFLVLKTDNDTIGALSGKLGQISGVRVKTVPLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title The structure of uncharacterized protein TM1266 from Thermotoga maritima.
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics/unknown function
total genus 23
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 2nzcA00
2WVCA 2HZVA 2PC6A 2HZAA 3BKUA 2WVDA 2CAJA 2BJ7A 2Y3YA 3QSIA 1Q5YA 3LGHA 2BJ9A 2F1FA 3BKTA 2BJ1A 2FGCA 3BKFA 3OD2A 2WVBA 2WVEA 2BJ3A 3PHTA 2BJ8A 2WVFA 1Q5VA 2CADA 2NZCA 2CA9A
chains in the Genus database with same CATH superfamily
2O5DA 2RUGA 1WEZA 2KO1A 3K0JA 5KFNA 2HYIB 1VQ8S 1YJNS 2CQ4A 5IZHA 3U7JA 3AA8A 3LUYA 3VGTA 2VFVA 3NKYA 4JI5J 4ZVPB 3KHHA 4IR9A 2W4DA 3QLHA 1F5AA 3BGRA 2VG7A 3TYTA 2WVFA 2OPPB 4JI0J 1UL3A 3NOGA 2EPIA 5ETSA 1RHRB 1WC0A 3C16B 4NLPA 1X5TA 1QTMA 4MK9A 2D9OA 4B3OA 5LT5A 3TX0A 3ZTQA 2W4CA 5ETNA 2HQFA 3K5PA 3HHLD 4GVLA 1L3UA 2CAJA 2F9JA 4KTQA 3OR1A 4FBTA 3HVRA 4Y2AA 2HQCA 1OY6A 1VQNS 2GFFA 1HNIB 1S1TB 4WU3A 3LGMA 1DTQA 1BQMA 4HTIA 3F44A 5KFMA 4N47A 4NASA 5LOQA 3NMRA 1NAQA 2UU9J 4TU9A 2QA4G 2CJ9A 4PQUA 4OHWA 3VAGA 3KKFA 5C24B 4ZN3A 2IBKA 4CLLA 4WKRA 2Q6BA 3QIPB 5LM7E 1Q78A 3IR6B 3ZZZA 2I5JA 1KQKA 1HBNB 5KFKA 2YX4A 3AJ2A 2OPQB 4Q2LA 5I4MA 4HI2A 2CPDA 3ELHA 4DLGA 1I6JA 3MCOA 4LSZB 3MFHA 2HBQB 3UCUP 4NCBA 2W8LA 2RRAA 1H2VZ 7FD1A 3O44A 3SBMA 2D41A 1HFEL 4QBUA 4YMEA 3DGPA 4PG5A 4P6QA 2RKIB 1QE1A 4M5MA 5KFIA 1JKHB 1QDUB 2PMWA 3MM5B 3OLAA 4LR7A 2CQHA 3KTQA 5KFHA 2QLXA 3E01A 1RGVA 1WC6A 1HMVA 1H6KX 3FBEA 3W2VB 1FWKA 4U7UK 2AEMA 2YKQA 4EZ6A 5ADZA 5HMWA 1L5UA 3ZTSA 1SKWA 4ECXA 1N5VA 3OSPA 3ZO7A 3ILIA 2UVRA 1Y11A 3T5LA 4DR7F 4H4KA 1NM2A 1M1KT 4Y00A 1R8HA 4DU7A 1NPPA 1NPRA 5E5NA 5FDLA 1JB0C 5E0OA 3NAIA 4DQIA 2J7WA 2Y0SD 2LVWA 1PYTA 4U9RA 1X5SA 2GGPA 3N0VA 4DS5A 2QRRA 4K4VA 4QPTA 2V0NA 1JNZB 5DO2A 3TO8A 5A8KB 4ZN1A 3MMBB 4PG6A 2MLXA 2NQPA 1GXTA 2VUGA 5J2MA 1V9OA 4G1QA 4M5HA 4FDFA 1ZA1B 2GJFA 4CWBA 2ZD1B 3HI9A 1U0SA 5HJXA 4BCAA 1OS5A 2E29A 3T1AA 3UDEA 2AWZA 3D1OA 4WU2A 5BJRA 2J6TA 2Q1LA 2N7CA 4MFBB 4LVNP 2DGSA 4WFAQ 2J0SD 3I0RB 5GMEA 1RSCA 4O3QA 4NE9C 2BRKA 3JXOA 2XSJA 3JAMU 2ABYA 3HHLC 4OI2A 1XMQJ 1ELOA 3DLHA 3OL6A 2VFRA 4HH1A 5KFRA 1TKXB 4AD6A 4A8KA 3HFVA 4YR0A 5HSPA 2YNIA 2FHMA 1VGYA 4BHQA 1IKYA 3C2PA 4JI7J 2H5IB 2UXDF 1XQIA 2H5JB 2WVEA 1LOUA 1VR6A 3R8YA 1SVDA 1C2PA 4FVMA 2QL7B 4OYBA 2NUHA 2HVDA 2XMWA 1NDPA 1S76D 4USWA 1R8PA 4HL9A 2W7PA 4C0BA 2BKPA 2KRBA 1RADB 5CYQA 2IIHA 3RGIA 3HT3A 4LF5J 1PJ6A 1LWCA 3ILLA 3ENVA 1XMOF 4NRUA 4TU7A 4CO0A 2YQ0A 5LXRA 3K5MA 1MWZA 3BR9A 2O66A 1PC4A 5F0WA 3AB4B 4ZA1A 1SQGA 3IC1A 3KG4A 4KHMA 1VBKA 5J2PA 2Z2ZA 3RUBL 2AV5A 1SCJB 2HNZB 1RAFB 2BANB 1RTZA 3CT9A 2VQEF 2NLWA 4P74A 1NSAA 1NK5A 1X5OA 3IBCB 4OV6A 4M5DB 4QYZJ 4JI0F 2LP4A 2CUYA 2FJVA 1TFYA 3ZNJ1 3CSKA 4O4GB 3FCVA 4O4RA 1VQMS 4F25A 1N34J 3RR8A 1FKOA 2I38A 4ED4A 1RYRA 1N88A 2ATLA 3O8WA 1YQHA 3MCSA 2KZZA 3GJQB 1ZOTA 1FK9A 1S59A 2MYFA 1FHTA 1EHWA 3MM9B 4YUDA 3PJ9A 4DDFA 3EM1A 2CPHA 2AD9A 2E5HA 5KG0A 4ECVA 5J2QB 4GKKJ 5J1EB 2OP5A 4WYWA 4LRFA 5KFQA 3JQJA 2HVEA 4KBIA 1MMDA 3KJVB 1JLAB 1WHXA 2RDIA 2I6WA 3AXMA 1S6UA 4FKXA 4L72B 4OLOA 4NL5A 1S6OA 4Y2IA 3MD1A 3S6EA 1GK8A 2OFGX 3TZZA 2IC3A 4PWDB 2QGFB 2E1CA 3LF0A 4DZ6A 2YKOA 1SH0A 3MEDA 2UXBJ 4F0MA 3WZ0A 1HKAA 3O6QA 4PZVA 5LJ5Y 4KH1B 3VVTA 5CYMA 2J6SA 1KBRA 1RT2A 1MU2A 1XIQA 2HHUA 4DX5A 1HBOA 5C25B 3JSYA 4B3SJ 4U8VA 3D3CJ 3HSZA 4M5GA 4Y6IA 3VAHA 1HNWJ 4XK8C 1W25A 1WSVA 3FQLA 4OZNA 2W2PP 3W7BA 2FVSA 3ISND 3W8PA 4IH7A 3CUNA 3ETMA 2BJ8A 3FFIA 2B43A 1DQAA 2EG1A 3W5XA 1UJ4A 1HQEA 2BMBA 3CCJS 3WIVA 2VG6B 4WTOB 1HYSB 4NI2B 1T3NA 2M7SA 4ZJQA 1RTDB 3ITHB 2AEJA 2ZOFA 3TNVA 4I2PB 2C2OB 3R5GA 2ERRA 1MWQA 2BEFA 2ZBQA 4YFUA 1VQ5S 1T02A 2HZAA 2MLZA 4W98A 4QOTA 2JFDA 2BRLA 5KFAA 4U8YA 1VJQA 4C8LA 5SZTA 4DPYA 1VK8A 5CZVA 2UUTA 1WF1A 3MPWA 1SV5B 2NPIA 3FDSA 4BC9A 4K4TA 1URNA 2XI3A 4X64F 4ZVFA 1FRLA 4Y34A 4DZDA 2DNYA 5HMYA 1NDKA 2DHAA 3OXGA 3G87A 1PBAA 4DS4A 3CJTA 3DMJB 1TL1A 1UFKA 1B3TA 1LW0B 1R0AA 5BYQA 2W9BB 4YY3J 2NYIA 1DJ0A 1XEZA 2AT1B 5AE3A 3ISZA 2XSFA 2DRBA 1N8RT 2OIHA 4DPXA 5C42A 3QFWA 2RDJA 1XMQF 2RQKA 2HHWA 4M95A 1HI1A 3ILOA 2CPYA 2F4FA 1QUVA 4EBDA 3M7VA 2W7OA 4PG4A 1KN6A 3S8SA 4I7FA 2LQ9A 1R6YA 1DARA 3CJ8A 5CH7B 2VD3A 1YRXA 3LP0A 1RZMA 3IA0A 2G0JA 4IDKB 3Q2TC 1S77D 4J5OA 3DRPB 4CYUB 4JV0A 3VVUA 3DLKB 1GX5A 2YNFA 3Q8RB 3KLHA 2PFFB 1CJTA 2JNJA 1U2FA 1HNVB 3T1YJ 3DU6A 2GX8A 4URGA 1X9WA 4OHZA 2YVSA 2BKOA 4FXVA 4ZVOB 3PX4A 5B0BA 1X0FA 3MHYA 4ILLA 1LKZA 4TLQA 3V2UC 1HNZJ 5L9XA 3EICA 3P3DA 2FZKB 2NCKL 4DV6J 2XZTB 4RW8A 5F8LA 3HHNB 1D1UA 2HAIA 2EBEA 5IWAJ 3HZEA 3CJ4A 4NPOA 2LQBA 2F8HA 4ZHRB 5KAKA 3DOKA 4IUFA 1J2VA 5LSOA 3MFIA 3PV8A 4B9UA 2WHOA 5A6PA 1N0VC 5BXIA 7FDRA 3OTOJ 3KYLA 3EDQB 3CGIA 3TVZA 4FN5A 4ED3A 1S1WB 3R5DA 2B6AB 3HJFA 4F2SA 3HF5A 1B0VA 3ISNC 1N34F 4HT7A 3ZZUA 5H1SV 3A3OB 2NXEA 2E5LF 1K0VA 1TL4A 4HHUA 5CHCB 1AYEA 4K4YA 3A8IA 1YKWA 3U1NA 3ZZ0A 5KG1A 1Q95G 4CTAB 5A8WA 4LR8A 4KC5A 4LRDA 1XR6A 4GKKF 1ZM2A 4A48A 4Q8FA 2RU9A 4ZKAA 4YS2A 2M52A 3IWLA 1I5OB 2C22A 3I0SA 2IJFA 1RHMB 3KNAA 4OJ3A 5T14A 2PI4A 1V6HA 2QG9B 5K8PA 2J76E 1RA7A 2W9CA 4CQ1A 2G0CA 3MF5A 1CJKB 1CJUB 2M8DB 4B9MA 1MROA 3TA0A 4HYKA 1P27B 4UY8T 3HD1A 5IXUA 4O44A 3KWMA 3W64A 1PG5B 4UZBA 3HLUA 5CA5A 2UXBF 1J5EJ 3PNIA 2NS1B 1TV6B 4UW2A 1SJ1A 3IWNC 1IBLF 4DCOB 4O3OA 1S9GB 2XMMA 1U1LA 4KHPF 4EYHB 4O3NA 2GIFA 4LRBA 2B56A 2IVMA 1E6YA 1FFGB 3HVTA 4L73A 3DLGA 3PW4A 1HR0J 1H72C 4M8LA 2GAHC 5KG5A 2BQ3A 3M2RA 2ZUGA 1KOOA 4F4KA 4FXDA 2MQLA 1OMSA 3SXLA 1WHWA 1D9AA 1YBUA 2DGQA 1G6BA 5LL6d 4JI6F 4R5PA 3RZAA 1VRQC 3T9ZA 3MPDA 4H4MA 4I68A 3R7NB 1RB0A 4KRWA 3EGVA 3T41A 2VPYB 2XS5A 1GX6A 4P2FA 4U95A 4FKYA 2OD6A 2KHDA 4LJMA 4RW9A 4RW6A 3TVYA 1RAJA 1M0SA 4USTA 3W8GA 3S1TA 1HBMB 2ALZA 1HQUB 5EWEA 4NZ6A 1UCNA 2AGQA 1C0TB 4P71A 1M90T 4X2BA 2ZHAA 1UVNA 3M8QA 4MH8A 3U27A 1J27A 4ECZA 1CULA 1S0OA 1TFWA 3DKDA 2HIYA 2CWKA 4USJC 1H73A 4CLZA 2VODA 4YB6A 1N5YA 2G1DA 1R27B 4YY3F 4J9RA 2JDJA 2EKYA 1U25A 1HWIA 4LR9A 1GMVA 2B4PA 2MY8A 3MECA 4ECSA 3NG8A 5H9EJ 1B7YB 4EMDA 2UXCJ 3QZ7A 4M63A 5I3UB 5HN0A 3H5XA 2M3DA 4DOZA 1OPZA 2CWXA 3KHRA 4DR2F 3GCWP 2J8SA 1RT4B 4WIIA 4KY3A 3UD3P 4ID8A 2VL1A 2Z2LA 2BA9A 1Q4RA 3QMQA 4LBIA 3G8TA 3WHIA 3T1YF 3RG6A 2R7WA 2Q79A 2VQFF 2EK6A 4USHA 2KZMA 1EETA 4UOFA 3PX6A 1DQ9A 2C3OA 2HNYB 5DM7Q 1QAIA 2CQGA 3THVA 2Y8WA 1S79A 4WK3A 1VI7A 1KVJA 2ROEA 1LNQA 1PKUA 3EXCX 2F40A 3DDNA 2BJ1A 1U09A 1UVIA 1S6PB 3G6ES 2E66A 3EYZA 3MAAB 1N6QB 3HMJG 3BO3A 4N76A 1WSRA 3HP6A 1UVKA 2DNMA 3S01A 2GJ2A 3KXDA 4DSEA 1AXQA 3CDWA 4CLPA 4DPWA 2QZ8A 3T9NA 3Q2SC 1LWFB 1IWAA 3CVKA 3GPAA 4ZJLA 1VBXA 1ZA2B 4ZCMA 2LEAA 2JVOA 3NBPB 3I32A 2YPZA 4ED1A 1NK6A 4DUZJ 1WUUA 1XJWB 1D8YA 5F8JA 2O1PA 4ZLNA 2RDDA 2YKAA 5F8HA 3W62A 1VQ6S 4ED6A 4F4WA 2MSTA 3ZZPA 1KTVA 2AF6A 4FF3A 1UZHA 1WELA 3QIDA 2APOA 2DNRA 1IXKA 3V5RA 2OH2A 1YJTA 4DBQA 4WFBQ 4RW7A 2BE2A 3FUYA 1QVFR 3M2UB 3QRQA 1TVRB 2FHOB 1F0XA 3G82A 1XBWA 1TKTA 2DR6A 3LWLA 1RU1A 2WBRA 4IYQA 4C8YA 4LMZA 1S0NA 1GMUA 2JLFA 2QA2A 4CO2A 5A2QY 3V81B 1YJRA 1RXOB 1K8AT 4N41A 1F9HA 3PX0A 1SC1B 1X4DA 2BM1A 2U1AA 3TX8A 3M2VA 3H5YA 6AT1B 1AW0A 4M5JA 1UFWA 4KKOA 2CQPA 1S9EB 1G3OA 4TY8B 3HX9A 1NK8A 5I42A 5JJBA 3BQ0A 5FD1A 1F5CA 2RUSA 5DZ7A 4AXIA 2WZ1A 4IRKA 2NSBA 4P10A 2OJ3A 1VQLS 4NA1A 2XMVA 1M5SA 1R0BG 2FTRA 5DLFA 3DM2B 1HR0F 1KONA 5E3PA 3IBWA 1WJ9A 3BGOP 4ETXA 4DUYJ 5DQIA 3DRRA 2Q3PA 3D0GE 1TUVA 4H4OA 1VQSA 4DI6A 4JI4J 1HWLA 4OYZA 4EYIB 3HSGA 2QT7A 1D0EA 4WKYA 3I4PA 3GFXA 4J9SA 4PABA 2ZH7A 4OI3A 1H2UX 2OTJS 3J7AN 2R7XA 2FIUA 2B9YA 1RHJB 1JJ2R 1RE1B 2YKMB 4OZ0A 1X9SA 4YP3A 3UQSA 3OVBA 2ZBPA 4QPXA 1AFIA 1ACMB 2FVRA 2UV8A 2B9WA 5K8OA 3PFEA 4RLEA 4U67Q 2FY8A 2E9RX 3BSNA 2VHGA 3OHAA 4ICLB 4LSLB 4JBCA 1RA6A 2V8GA 2GO8A 2HHPA 3C66A 4NXMF 1N4LA 3H7HB 3QJJA 4RL1A 1M5PC 2MHNA 3ZTPA 2RS2A 4DV0F 2X1AA 2L08A 3CIMA 3QRRA 4ZJOA 4EI2A 2LDYA 1J5OB 2H48B 4CI0B 1JQGA 5KG6A 1S72S 1IJEB 3TANA 4CT9A 3ZFVA 3EZUA 4F3OA 2J0XA 2V8HA 3VALA 3PVXA 2OPPA 2HAFA 2IVYA 2VBWA 2VF3A 3TVKA 2B0GA 3J80Y 1ZAXA 3GIIA 2L41A 1KDNA 4RW4B 1RWOB 2IYIA 3C16A 4DCJB 1EJ7L 2FQQB 4QYZK 2CVIA 4W4MA 2FHKA 1PGZA 2EC0A 4ER8A 1U1OA 2Y8YA 4FPRA 3OV7A 5GMKa 3D68A 5CCLA 2IVFB 1TKZB 1YZ6A 2QL5B 1GXUA 3QT7A 1HNIA 5IQQA 2EFGA 1SL2A 1RP5A 5KFGA 2XTJP 1TP7A 4B9LA 1ICEB 2KYXA 3EX7B 3BQ2A 5D4LA 3ZZYA 4K4UA 3VZHA 5KFLA 1UMJA 2XY7A 4YN3B 3CDUA 5C24A 2F8EX 3QIPA 4DXLA 2K7JA 1HBNA 1AROP 2B8PA 5D0RA 2OPQA 1MLAA 4DUZF 5IV4A 1FESA 3MMAB 2V4QA 1IBMF 3GV8B 2BQRA 2B4UA 3CO0P 4U7CA 1KEKA 3IGVA 3M8YA 1JKHA 3M9NB 3MM5A 2VPXB 4ES3A 2RU3A 1XERA 3PZPA 3TZXA 3D1QA 2BKNA 2E9ZA 1MWYA 3AD9C 1HNXJ 2B3TB 3WX4A 3W2VA 5HI7A 1MNEA 2IM1A 3RTVA 1SKUB 3ZTOA 3M6UA 4Q2MA 3N79A 4KGKA 5AE1A 1TL7B 1RACB 3Q0AA 2GHVC 3CEDA 4HDHA 1WC4A 2GZOA 3Q89A 2CPXA 5KOWA 2D74B 2MDAA 3PFOA 1GTHA 2GAGC 5KT5A 3CCVS 1ZTWA 1NJWA 3AJ1A 4P73A 1X5PA 3BSCA 2UVWA 3JTOA 4DF8A 2JEIA 1RWMB 3FZBA 1T0TV 2CZ9A 1I1GA 3DLEB 3MMBA 2CQDA 2HRTA 2J7KA 3UCGA 1GMWA 2E9TA 2KFYA 1VOMA 3W1YC 4K5RA 3F73A 2ZD1A 2ZDPA 4DUYF 3IRWP 5M2PA 3NWGA 2V9KA 3LWMA 3MZIA 5E3QA 5K14B 1SB6A 2KDOA 2AYMA 2QSWA 4NZ7A 1RWVB 1EKSA 3NGKA 2ILYA 4MFBA 3MTJA 2DHHA 3I0RA 3PG9A 2AEFA 3CDBA 2L9NA 4LQ9A 1Y0HA 3VAIA 1TKXA 3ILJA 2GIQA 3LANA 5E41A 3A4TA 2C3YA 5F0UA 3J7YI 4JI2J 3RB3A 4TY9A 2A3JA 4Z2XA 1IKVB 2CNOB 1FWLA 2H51B 4IFVB 2CQIA 1VQYA 5D77A 4NXNJ 4NMLA 1S4FA 1WNEA 2CQ0A 2JEGA 3HHEA 4ZOSA 2W4PA 2PEBA 1NJIT 2N3OA 3RB4A 1WTFA 2QMWA 3C3LA 2GQ2A 2WRMA 3MM6B 2VPZB 1BWEA 1NZ8A 5IT0A 3BSAA 3BDPA 1WDTA 3J81Y 2DNNA 4HTJA 1U7LA 1BY9A 1YRUA 2HFZA 2HBYB 3PW7A 3FEZA 2E7VA 1DHMA 3WDOA 3N5BA 2HNZA 1JXVA 4CIOA 3AOCA 2BANA 3EVWA 5LJ3Y 2DY1A 3C19A 2G0IA 4RJVA 3PIPQ 5C5JA 3GONA 1YITS 4M5DA 1UEVA 3HCXA 4NLOA 3BB5A 1T05B 2HFNA 5E3RA 3M4XA 4O4GA 3D0IE 2RIJA 2CQCA 3QWPA 4ELVA 1FRHA 3HK2A 1YLXA 2FYXA 3B8HA 3TUIC 5EWFA 1TK5A 3P4UB 2QLBB 1U4BA 2EXUA 1HBUB 2BABA 1HW9A 4RZRA 4LQ3A 3MM9A 4NZ0A 1N36J 1QSSA 1JJHA 1IKWB 2YTCA 2R42A 3BQ1A 3CJ3A 2D3OR 3M6XA 2V5HG 3VGSA 2FLOA 1GEHA 4NOHA 5LXYA 2KFZA 5J2QA 4RX6A 1REVB 3UD5A 4CDIA 4EBCA 3QNWB 1NO8A 3DRYA 3W9JA 3KJVA 2POKA 3Q8VA 1JLAA 4MIAA 5JMNA 3QRPA 2G9OA 1SKSA 3D3BJ 2Y1LB 4ATNA 3KK1B 1TTHB 5KG4A 3B6BA 5C7PA 2H4WB 5KT6A 1F9EB 1TUWA 4OYXA 2JLEA 2DGVA 2FJBB 3RW6A 1Z2ZA 2LCWA 4QJVA 1T03B 4PWDA 2BZ2A 3MUMP 2JHEA 1ZPWX 3KG0A 2IHR1 4NEZA 2GO9A 3HKZD 3OUYB 1OJ4A 5A6WA 4O3SA 2HURA 1RBOB 1KQSR 4M1KA 2UUAJ 3IMQJ 4JV1A 4WIQA 4YHHJ 4LF7F 2FLPA 1LWXA 4RNMA 4PWUA 5C25A 3MMCB 3UWTA 2J0WA 4Y0FA 2H9ZA 3HPOA 1JLQB 2IMOA 4HHJA 1HNXF 1V3ZA 1RT3B 4RPFA 1KQGB 2QC3A 4LFAJ 4DL2A 1YJVA 4E0DA 4OX9F 2R7RA 2IPOB 4L3NA 4DR5J 3PY8A 3KJQB 1W2IA 3IBFB 5DDQC 2B4VA 4OV1A 1UJ6A 1MG7A 4QU6A 1EIYB 2VG6A 1KP6A 1HYSA 1FTRA 4NI2A 1RTDA 3CJ5A 3G8QA 3DFEA 3DI6B 1KTQA 3ITHA 1M5HA 4O3PA 4I2PA 3EXYA 3I9ZA 3H5SA 2FZCB 1X4HA 1NK0A 3L7UA 3NGTA 5T7LB 2DNLA 4OZ3A 4ERDA 2IFXA 4DV3J 1GAOA 3QT6A 5F8IA 5RUBA 3QT8A 1SV5A 5KFVA 1HHTP 1B7FA 4N8OA 1VQKS 1VQOS 2OEKA 1FJGF 2RQ4A 1U1QA 1M5VC 4MYUA 2C2KB 4IOCQ 3MD3A 1SC6A 3IGNA 3IS9B 5LMNJ 2FJWA 3L9ZA 3DMJA 3AHPA 2CXEA 3PRDA 3D2WA 3GFZA 3A8EA 1LW0A 4J9UE 2W9BA 2PD1A 3QFHA 3DYAB 5A0YB 3NCQA 2W2NP 2LQJA 4KFBA 1H0HB 3EMTA 1CVJA 3L09A 2NZCA 2CA9A 4Y2KA 1HWKA 3GIJA 4OI0A 5KFZA 2DCLA 3Q8UA 2DR7A 1EP4B 2VJVA 2R7TA 1YGYA 4ZP9A 5ETQA 5H9EK 3QO9B 5AJ3J 2NR0A 2WW4A 4IDKA 4UUWA 3CB4A 3DRPA 4CYUA 2J9DE 3DLKA 4NYOA 2V69A 2UV8G 4F04B 1HNVA 2YWWA 1IJFB 4A8OA 3CULA 4WFYA 4E8UA 4NLSA 3RRKA 3OBIA 5IC6B 4TKTA 4LF6J 2M2BA 3K89A 2H65B 5HMZA 2LU2A 5KFEA 3W3SA 1P9QC 5HK4A 3SEOA 4MAKA 6FD1A 4JP8A 1Q8KA 2DGXA 3G8SA 1YIJS 4ZHRA 2CZVC 3UO0A 4B3TF 2RHSB 2IAJB 4CO4A 2V8VA 2ZVSA 4IG0B 4N7TA 2EW9A 2FB0A 1LXJA 3FEXB 3UN5A 2KVIA 5M2UA 1ZM3A 3IN5A 5DQGA 1S1WA 2F9DA 4ZVTB 4F3QA 1U26A 2B6AA 5HQLA 2OPSB 1PC5A 3T5KA 5BR8J 2VBXA 4ZPWR 1PAUB 5A8RB 4DL7A 2UUCJ 4IG3B 3HFZB 4HLBA 3U1MA 1N36F 3R2CJ 3M32A 1WACA 4CTAA 5CCMA 3W9IA 2ZH5A 1RAAB 4FPIA 4LF9F 4F2RA 4AE5A 1N32F 1HI0P 2AJ4A 3RBDA 1RCOB 1KLNA 1ITPA 1N33J 3LO3A 2CG8A 2XMUA 1U1KA 4I6AA 3TEGA 1QLNA 5FLXY 1R6VA 2VJUA 1T9TA 1CJKA 4CM0A 1CJUA 4QWEA 2F7VA 2B9EA 1U6FA 1RKIA 2WVDA 5D6GA 4FNIA 3JYTB 5DGAA 1UEUA 4WBFA 5BYRA 2BE7D 4RWXA 2FJXA 1NUEA 2KXHA 3BGLA 3QYYA 2FJAB 1Q7YT 2R7QA 1TV6A 2AGPA 2XS2A 1S1VB 1FI4A 3U02A 4CH0S 1S9GA 3QWUA 5GAEU 4YHHF 3CCES 4DR4J 2FLNA 4H4KC 1XTZA 2ASJA 1KLMB 2Y3YA 2VKRA 5GAHU 2UP1A 3DOMB 3J80U 4LFAF 4TXSA 2UUBJ 2GVZB 4DR5F 1VQ4S 3MI7X 1Q79A 3ICLA 5L8RC 2ZE2B 4DEZA 2R2UA 4LF4J 5ETOA 3POTB 4MMOA 1S1UB 3MEGB 2B5JB 3O1LA 4IO9Q 2AHOB 3SV3A 2YNGB 3GSIA 4FYYB 1LK7A 5H9FJ 5THWA 5LSRA 1SQFA 1SL1A 1DRZA 2CPIA 2Z0GA 2H1YA 1YG0A 1NK4A 3PKYA 5KT7A 3I5AA 2ZOMA 4BC7A 1RAOA 2Z2YB 1S49A 2V8DA 2NSCA 1HBMA 1HQUA 4OHXA 2AGOA 1C0TA 3G6XA 2AJ0A 2LA4A 3TZYA 3SFUA 3KLIB 5F9NA 1FEEA 1D9FA 3KK2B 1WI6A 3BBFA 2HWIA 4RNHA 2OPRB 2I8EA 3I9V9 4S0MA 1AT1B 4X62J 3LP1B 5E7OB 2FY1A 4ENOA 2DGOA 3CC2S 4LF2A 2CADA 3MR5A 1QD1A 1UWBB 3JQMA 3D6MB 2FVPA 3PR4A 4NYZA 4PKDB 3EPGA 1JK9B 5CQGA 1PO6A 4AQYJ 4WE1B 4P2SA 5I3UA 2XCAA 1IR2A 2E5GA 1WF2A 3NS7B 2QO3A 2HG4A 3TUZC 1U8WA 3ONQA 2AYBA 1RT4A 4ZP7A 3KOAA 4X65J 4WCEQ 1F3FA 3EUNA 2AKWB 4C0HA 1FJEB 2R8GA 1VIOA 1B64A 2KB2A 1Q8LA 1FRMA 4DR6J 5CYJA 3AT1B 4MKVA 2HSEB 2PI5A 2JEFA 1FKPB 3GILA 1PCAA 2J9EA 2HNYA 3Q8PB 2K06A 4KGZB 3GP9A 4OJ1A 4QIGA 2VDHA 4OI4A 2QYGA 1LXNA 1C0UB 4OZJA 1D3WA 3PKMA 2G4BA 3NAHA 4J9QA 4QIEA 2DNHA 2LDIA 1JX4A 2ZZTA 3MR7A 1UW4A 2AP6A 3MPUB 1S6PA 2XULA 3WBZA 3MAAA 1N6QA 2CJQA 2HNDA 4P2XA 2DXFA 2MZJA 1I51B 3GYGA 3T5HA 3NLCA 1VQ9S 1GH8A 3PEJA 3OHBA 3MPYA 4NLWA 2AQ4A 1IN0A 2ZM6J 4QW8A 2BUNA 3L4BC 4B3RF 3C8YA 1LWFA 2WTFA 4Q0BB 2HKEA 1S0MA 5BR8F 3NBPA 2VONA 4OYOA 4JI1J 2UUCF 1Y00A 2FHJA 4PEOA 1NK9A 5ETVA 2V50A 3V4MA 1Q16B 4NX9A 4BWMA 4LRAA 3A1YG 2AX1A 2LQ8A 3GYXB 4MK7A 4P52A 1ZBTA 1N33F 2OSQA 3OXLA 2CQ3A 1T94A 2GMLA 1GT8A 3Q8YA 3MM7B 1RLCL 4CLUA 1F60B 3TAMB 2ZH4A 1O6XA 4UY85 3UI3A 4JI8J 3R27A 4RUAA 1XMBA 3M2UA 1TVRA 2ZBRA 4Y28C 2DR8A 5AXNA 2ZKUA 1FRXA 4LBHA 2FVQA 2C2RA 2W8KA 3NGSA 3DCAA 1X4GA 2WCXA 3A3NB 3CIZA 3V81A 2LKZA 2J0QD 1RWKB 2BV3A 2BQUA 4KV8B 4OHYA 4C3KA 1WHVA 1CQNA 1O51A 1MW7A 1S9EA 1N56A 4TY8A 4WFZA 1IUJA 4DR4F 2E7XA 5I3QA 1A6LA 5HATA 1UJ5A 4X4SA 4JV5F 2UUWA 2Q43A 4FF2A 2ZHBA 3OPKA 2X7IA 2UUBF 4HH0A 3DM2A 2MQQA 3S7RA 3MEDB 3PW5A 3ZZTA 2XEXA 1YZ7A 4C48A 4PYDA 4ZLJA 3KMQA 5CD4H 2HVHA 2CNKB 2KJVA 1CC7A 2MXYA 4A8QA 1OYDA 4OYWA 2LECA 1S4EA 2FD2A 4F02A 4ANDA 2AW0A 1UZDA 1SH2A 4ED2A 1Q1KA 1JNRB 1S10A 3G2XA 3IRXB 5HQMA 1WF0A 2FUG9 2DISA 5AXLA 2MSSA 3QSIA 3PEHA 2HHHJ 1S57A 4PUOB 1F2GA 1RLDA 3EVMA 1H98A 5B09A 3OW2R 5L39A 4ES2A 3V6HA 2YKMA 3PYEA 4ZCIA 2G2YA 1JMTA 2CIMA 1OYEA 2MZRA 2ZH9A 2KT5A 1UP1A 2NUUG 4CNZA 4ES1A 1HWJA 3NRBA 1NSPA 1BWVA 4ETZA 3D6HB 4DPOA 4XIUA 2DNQA 2RF2B 2CG4A 4ICLA 3MOJB 4LSLA 3HULA 3WC0A 4HT5A 2MGZB 2X1FA 2B9XA 1PYOB 3QBCA 3EGWB 4EO6A 2R2SA 4KGVB 1YSJA 4QIFA 3AY0A 3VAMA 3GYNA 2IRUA 3OJUA 4RU2A 1FF2A 1SH3A 5B08A 3TARA 4IQXA 3KLFB 3IR5B 3ZZOA 4X66J 1X9MA 4G6VB 4K59A 3AB2B 4DV1J 3DLLQ 1RBAA 1TQLA 5DRKA 2XGPA 4DR6F 2D3UA 5HROB 4RW4A 1I94J 1BQXA 1UW9A 5CD4A 2VC1A 3JTPA 4GO5X 2CKWA 2DPJA 1N0UA 4RWWA 3UR3C 1YTYA 2PDAA 1SIZA 5HMXA 4DQPA 1ZZFA 2ZJQQ 4B08A 3C15B 4J37A 4DR1F 4DL0C 4JYAJ 1S1XB 4KE5A 3A8JA 3BR8A 1V5VA 1P1TA 1C4AA 2DPIA 4OHVA 2IDEA 1TKZA 4I2QB 2DVIA 4OX8A 4ELUA 5K8NA 1JLGB 4GVBB 1WDDA 1D8ZA 3PW2A 1SJ4P 2ZH2A 3N6MA 2DBBA 1C1BB 2XZWA 1CS4B 3SDEB 2QLJB 4CCHA 2P2CB 4NLVA 1ZTTA 1R0CB 5AXMA 1EQMA 1LWEB 2M8HA 4O3RA 1B0TA 1A0OB 3H42A 4MTPA 5D8HB 5GAEI 1VFJA 2C3MA 3Q8SB 2HS4A 2P8IA 2MKHA 3F41A 4JI1F 3R5BA 5GAHI 1WHYA 2BOPA 4NEYA 1HQ2A 3B4MA 4FBUA 2WVCA 3KJNB 4P2MA 5HL7Q 2EVZA 3GQCA 3HHLB 4JI5F 4URSA 1B99A 4PYAA 5B0CA 3CJSA 3M8RA 1F5BA 3QGHA 4UTGA 1R8CA 4DV2J 3RBEA 5GAGI 4KO0B 4EU0A 5SUHA 4ECUA 3C46A 4MYTA 4LT6A 4PG7A 2SXLA 2DO0A 4QW9A 3G96A 3R7BB 2RVJA 4R8UB 1VC6A 1FTCA 4X4UA 3EE3A 3JAMY 2IDLA 4OYAA 5D15A 4AL7A 2JLGA 3T1HJ 4YDXA 5IT4A 2ASLA 4F67A 4PPZA 1FKAF 3VAJA 3HSJA 4AT1B 2B8QA 3R1HA 4C7QA 2GCFA 1K44A 2D69A 4IOAQ 1IQZA 3SQGB 1DTTB 5LMUJ 1T9UA 2UU9F 3OL9A 2XI2A 4DV4J 3K5NA 3UFCX 3VGUA 3MM8B 2KFNA 4MIWA 1M1HA 4C8MA 4WFXA 3CCUS 3DRXA 1LEOA 4WF9Q 3ETOA 4ID5B 1RI7A 2K3IA 2HWTA 2W1BA 5K14A 3LAMA 1VLOA 2MZ1A 1IM6A 4C4WA 2JZ5A 2EFNA 4LVOP 3OL7A 2V68A 3M6VA 1HLWA 3O2IA 4C6AA 3I55S 3BEGB 4A8SA 2C3PA 1KOHA 1CBKA 1JLFB 3CTRA 4WJBA 5FLXU 2DXDA 2QE5A 3DHWC 1X4CA 2VFTA 1IKVA 4IFVA 3Q86A 1RWPB 3B4DA 2RRBA 2OSRA 4DL4A 1FERA 3VR1A 3KLVA 2CDRB 2D7SA 1VISA 3PW0A 4FXWA 3E3XA 1SJFA 4DSJA 2DYAA 2JVRA 4KR0B 3MM6A 4DQSA 2HHXA 1X4EA 1VRTB 5KFDA 1U6BA 2N3LA 2ZBIA 2DGTA 3R6LB 2DCUB 2DNKA 4ZPAA 5HVFA 2Y0BB 1OQ6A 5KFBA 3FCHA 2JRSA 1NDLA 1YDLA 2RB7A 2VPWB 4B17A 4X66F 1FRIA 3TJ9A 2OI2A 4TLRA 2RH3A 3HD2A 4DV1F 1T05A 1FXRA 3T5JA 2DD8S 1TELA 2M5YA 2YKNB 1VCTA 1YWXA 1WC5A 1APSA 3N01A 4ZPDA 3GIRA 3CJRA 1NSKL 4FYVB 1HI8A 3UCZP 4X84A 2RMLA 1IKWA 3DOLB 5JXSA 3MCNA 1Q8BA 4BLGA 3LH2S 4LIWA 2MHEA 2QFJA 3NCRA 5L1KA 3RBZA 4O0IA 4USKA 4JI7F 1REVA 3BH7B 1R8AA 3FEYB 3MR6A 2E7WA 2G13A 3M05A 4F36A 4RNFA 3BM7A 2VFUA 3C6UB 2ZFHA 1TR0A 2FZGB 3UD4P 4QR1A 1B4SA 4CRJA 4LF5F 3KK1A 4EGLA 5AT1B 1T11A 3CCTA 2RJZA 1T03A 1NEEA 1X0PA 1NJZA 4FF4A 3DN9A 2V67A 2ILZA 1N5SA 1TMMA 2CJYB 1FCAA 1TL3B 3OUYA 4HACB 1Q5YA 2MEWA 5DS7A 1TZ0A 2KM8C 1NJYA 2G1HA 3BPDA 2CVEA 2ZNZA 2XWYA 2WSEC 2Z30B 2XLJA 3PIOQ 3MMCA 4CLKA 2PN6A 1FJ7A 4E2FB 3VZIA 1VDHA 2J8AA 4Q44A 4QIVA 1JLQA 4F50A 4YOEA 4KIAA 1RT3A 2DNPA 2JFKA 1QSLA 5D3GB 1RYSA 2MB0B 2WOMB 1HARA 3WC2A 1AB8A 1XR7A 2VA3A 3FMBA 4TQRA 4G1PA 4DX7A 2F65A 5CZXA 1T95A 2IY5B 1KR4A 2R8JA 4X4TA 2FJDB 4K4SA 4CZCA 3T6JA 3DI6A 2YH1A 5FIIA 4K4XA 3D1HA 1H38A 4RW7B 3HM9A 4ZLPA 4C8NA 2OFHX 2LA6A 2AYEA 3C6TB 2HRUA 2PMHA 2Y1JA 3ADAC 4WYLA 5H9FK 2XS7A 3NNAA 4G3IA 5T7LA 1UVJA 1ZAWA 4DSLA 4TYAA 3NNCA 1JJCB 4XDDA 1YBTA 3OTCA 1RABB 3A3PB 3K5LA 1AZSB 1U2RA 1BLUA 2QSFA 3PYFA 1ZAVA 2GJIA 4P75A 4G1IA 4WFNQ 3P5BP 4J9KA 2IA0A 4NCGB 2QFIA 2UVUA 3IS9A 4PQAA 3V6DB 2XB2D 2E5JA 4PG8A 1NHUA 1Y3JA 3DYAA 5A0YA 2LXFA 2P6TA 1T8EA 3HVWA 4HR2A 1T7PA 5DG8A 2O01C 5DG7A 2YH0A 3T6BA 4LSNB 3RU0A 3H4DA 3BN4A 2IJRA 4JOUA 4ZVUB 3H98A 1URRA 1EP4A 1IBKJ 4KH0B 4B3SF 3QO9A 2R7VA 3HHDA 3H2LA 1SL0A 1HNWF 2BJ9A 2HEKA 1Y10A 4K50A 1H2TZ 4KYZA 5GVQA 2Z56B 4CP5A 4L76A 8AT1B 1GFWB 4K8RA 1UWAA 3TI0A 2ZJRQ 3GV5B 2C1EB 4J91A 3MUTP 5L38A 5HAOA 1L3KA 4FZVA 1RDRA 4WP8A 2YXLA 3TQEA 1GMWD 2OEMA 2L48A 4TYBA 2OELA 3Q83A 1Q86T 1GTEA 2XHWA 3W5YA 1XR5A 3H2UB 3UVJB 3SSRA 1K9MT 3PYGA 3AQPA 2ZH6A 3CE8A 3TEHB 3SCIE 4J7CA 3G6VA 4I64A 4JI3J 2OD4A 4P7VA 2IAJA 1U2CA 3I82A 2J5AA 4IG0A 4NYPA 2XZDB 4ZK7M 4K2JA 2MKIA 4PXEA 2HK2A 3O5TB 3MCMA 2PFDA 1P6TA 2QMXA 1R8BA 3NS5A 4DL3A 3G6YA 1T3OA 4DSFA 3TJ8A 2OPSA 1ZYQA 2I9SA 2RT3A 3A13A 2B51A 2QL9B 4ED0A 3K57A 5A8RA 5L9NA 1ZM4A 1Q8IA 3MGJA 1DFDA 4IG3A 2HZVA 2OGUA 2WSCC 5I3PA 4OLPA 2VQEJ 2DITA 1NSQA 2XNRA 1ZS6A 3RJMB 2N4CA 2DGUA 3FGVA 1IM4A 1CEZA 1RUSA 3K59A 2KTQA 4NA2A 4HI1A 3KG1A 3N6NA 5J1NA 2I0XA 2VIHA 1MSWD 2HQGA 2VDIA 2GV1A 3SFGA 2XC9A 2XWXA 1U1MA 1WORA 2DIVA 3FMWA 1G7CB 4X4NA 4PAAA 1FO1A 1UVMA 2RRNA 1L3TA 1Y7PA 3GR0A 3JYTA 2I1RA 2DTJA 3OTBA 1HNZF 1YHQS 4DV6F 5KFJA 5HO4A 3UN2A 2CNNB 2M4MA 2JC0A 3EJMA 5IWAF 3ENAA 4OFZA 4OYIA 2NXCA 4X4OA 4NLXA 2KI2A 3AAWB 3NS6A 2RSQA 1S1VA 1Y9OA 1CJVB 3CMES 3LTOA 4Y2CA 3GB0A 1F2HA 2VICA 4NCAA 1KLMA 2YWFA 3FRZA 2MQOA 3OTOF 4UOGA 3R1LA 2RNEA 3MAQA 3DOMA 5ETRA 2JH3A 4GMKA 3NMAA 1SC3B 4GO7X 2X3GA 2GVZA 3SI8A 3FCWA 1FRJA 2WB4A 3IG1B 3CD5A 2ZE2A 2CYYA 3KHLA 4C0OC 1N52B 3POTA 1NNDA 2HHTA 4C2MA 1S1UA 3MEGA 4PWWA 2B5JA 2F8MA 2YNGA 2HHSA 3IXQA 2IMWP 3J7ZT 1FDAA 4D3HA 4OI6A 1RAIB 4CLWA 3JSRA 2Z4PA 4ILRA 2LFVA 5G4DA 1EKRA 1NDCA 7AT1B 2P6SA 1NZAA 4C11B 4NLDA 3G4SS 1BQNB 3KLIA 2L3MA 2HGNA 3THPA 4WXWA 2KHCA 4C8OA 3TA2A 3KK2A 3NGRA 2VG5B 3SCLE 2D3O1 2GMHA 2AMCB 2L9DA 4L3KA 4U96A 2OPRA 4MIBA 3MR2A 3LP1A 1X4FA 5B0AA 3RB6A 5KFPA 2FGCA 3U1LA 3MUVP 2EK1A 3ZNUA 2EFPA 3NCPA 2CQ1A 2EI5A 2MKYA 4Z7CA 2DR9A 4ECTA 2ZDOA 1VIXA 3B82A 4OMFG 3N5FA 3CD6S 1RJJA 5F9LA 1J5EF 4DN0A 2LEPA 4Z7YA 1UWBA 4OQJA 1YJ9S 2A1BA 3JTNA 3L95X 1JXLA 4EZ9A 3AH6A 3IWXA 3PR5B 5B0FA 4C9DA 5DM6Q 2P9GA 2ZNYA 2XG8A 3PRBA 3ENQA 4DFKA 2HFUA 1Z2LA 4WE1A 3SV4A 1XNRJ 3CDAA 4X64J 3M9MB 1IBKF 2ZOGA 3W65A 3CJKB 1S6QB 4QYRA 3V4IB 2VH7A 1RTIB 4YQWA 1XC9A 4USMA 4N5SA 2FC9A 3KHGA 1X8DA 8RUCA 3OQ2A 2X51A 1QM9A 4FS2A 1U45A 2P5VA 3EPIA 1NB2A 2YNHB 3GTYX 3TUPA 4DSIA 4JUZA 4KPYA 4M5NA 2KXNB 4C3MA 2PGCA 4R0EA 2EKNA 4A8FA 1U0HA 1FKPA 2YBVA 3G71S 4W90B 1DLOB 4U6PA 4LF8J 2CPZA 5DJBA 5HVGA 5D78A 3H20A 2V8PA 1C0UA 3V6KA 2AJFE 4JI3F 2G2ZA 4ZCKA 3CW2C 5T41A 2P9EA 2NXJA 4Z37A 2W7AA 3QATA 3BH6B 3EZ5A 4I67A 2DEJA 4ECYA 2MTLA 2XMKA 1JXEA 1BHNA 3CJQA 1G2EA 4J9OA 4Q0BA 2OO4A 5IV3A 4L74A 5HANA 2XYGB 4QIWD 1WTBA 2KG1A 1RT5B 2PE8A 2GVDB 3MOZA 3W9HA 3KK3B 4I4BA 1HHQA 2UXCF 1K73T 2XLKA 1VK3A 2XY5A 2ZHOA 1NKCA 2X3DA 4YB5A 5IM0B 1YJWS 4CNYA 3KLEB 3H25A 2MPUA 2DNZA 4ZVRB 1SXLA 3BN7A 1NKBA 2BYCA 4NLQA 5EUHA 3RAMA 3TQ1A 4IO1A 2MQ8A 2ZKTA 3AFGA 3ULHA 3MM7A 4GKJJ 2E5LJ 1UA0A 3TAMA 2PEHA 1ZETA 1V3RA 3P49B 4GRSA 1Y5LB 2R9LA 1LW2B 3TOQA 2FJEB 3EGNA 2A18A 1WC1A 9RUBA 5HP1B 4ANCA 3T3FA 1EARA 4V1Ak 4UF4A 1SUQB 3JSBA 3R3TA 2W2MP 3HO1A 4KV8A 4L75A 3BKFA 1Z1ZA 1LV5A 2AU0A 3GU0A 1RT7B 1FT8A 2JL9A 4QWCA 3CD7A 4A8XA 2MQMA 4AFFA 4ECRA 5J2NB 3Q22A 1S1TA 1BMQB 1B0PA 1H7WA 3EVOA 4IOBA 4TNOA 2MMYA 4QU7A 4ZCLA 3P45B 2D1CA 2WAQD 2ZVIA 2ZITA 3LA0A 3GR1A 3J7A1 4JB8B 2QEXS 4ZS6A 1KC8T 1NLKL 4PXCA 1YK9A 1IKXB 2XMAA 1FNXH 4ED7A 3OFHA 4LFBJ 2QN6B 3LPYA 1IBLJ 1NH7A 1X7VA 4KHPJ 1FFSB 2VKZG 3AJDA 5E3CA 3H90A 1OIAA 4X4RA 3JQKA 4CH7A 1UPPA 3BJYA 1VC5A 2RKIA 4CLSA 4RUBA 3IRXA 4DR3J 3Q23A 2MZTA 3TRGA 3FK4A 2RD5C 1X4AA 1JLBB 2B7BB 2ADCA 2CQ2A 5HBMB 4QCLA 2ZBCA 4PUOA 2RILA 5HJYA 4U7UD 5KG2A 2DXEA 5A76A 3QAEA 1U47A 1RWXB 4OYMA 4JI6J 1W26A 3OR2B 2HMIB 4ZVHA 2LEBA 5KFFA 3BKTA 1S48A 4Q8EA 2BJEA 2LMIA 2XO7A 2JEJA 1SBRA 1FA0A 3ET6B 2BJ7A 2X1GA 5C2CA 2V2VA 2RF2A 1S97A 2HS3A 1YJUA 4DHVA 2V63A 2OMOA 4Q43A 3PHEA 5GMDA 5E33A 5KG3A 2MGZA 4JV2A 4NLGA 2D3ZA 5L1IA 4KPCA 2HPUA 2V4RA 1XNRF 2HFOA 2RS8A 2MJNA 3D67A 4LF1A 1TKDA 2KKHA 4TQSA 5A8KA 3BF4A 2M88A 4MKYA 4RBTA 3KLFA 2EBGA 3NOCA 1UPMB 1GQEA 3W66A 3SSQA 4ECWA 3SCKE 3TZWA 2W01A 1FE0A 2W24A 4KFBB 3I6PA 2DRAA 3I96A 1XNQJ 3NGUA 3RR7A 2FPHX 3LP2B 3GLJA 5DETA 5HROA 2RAQA 3AD8C 4YR3A 4EUVA 1RT6B 3NY0A 1SJ3P 1AFJA 4DR2J 4JI4F 5K8MA 4LF8F 3GWCA 1A9NB 1NXIA 4QR2A 1BUXA 3HVAA 3C15A 4KB7A 1S1XA 2R4FA 1U6ZA 3K2YA 2QX0A 4B9SA 3DRSB 2A2DA 2OUGA 5CABA 3MXHP 3FVYA 2RE1A 4I2QA 4WP3A 4FS1A 2VQFJ 1JLGA 4GVBA 4RBVA 5ETMA 4X4PA 2Z2MA 4Y2MA 4ZP8A 1C1BA 2JOQA 5KFTA 1CS4A 3SDEA 3TW0A 3MPVA 1LWEA 4F0KA 2QA4S 2VZ9A 5F8NA 3TR5A 1UTAA 1IQTA 4ZPTR 3MEEB 5DZ6A 5KT4A 4NWBA 3Q24A 4PXBA 4NRTA 1FXDA 1PAEX 2VA2A 5KFOA 3IO1A 1C1CB 2YQ3A 3H2VE 3CNQP 1V3SA 5F3TA 2A6OA 4K7QA 1HD0A 5IS2A 1NKEA 2W2OP 1VHIA 1NHVA 4TN2A 4PPDA 1KS2A 2GMJA 3FSIA 2K1RB 3RW7A 3HHLA 1JLEB 1S7HA 4EWTA 5D4OA 3M30B 2J9CA 4GKJF 3VQTA 4OZ5A 3LGNA 3LAKA 1G4CA 5EHHA 4KO0A 3M8PB 2ZUAA 3TA1A 2ZWPA 1OQ3A 3B78A 3M32B 2MJUA 4ZPBA 3PTWA 1N5QA 3NL0A 2C2ZB 4R8UA 4J9MA 3OT9A 5ETTA 1KRPA 1SJQA 5KFSA 4G65A 1XWLA 1VYAA 4RUCA 1DBDA 2QA1A 4EFAC 2KYZA 2E1MC 5AXKA 3OTEA 4EEYA 2VU5A 4DG1B 2F5GA 3IFEA 5J1EA 3BO2A 2VBZA 4H54A 3VAKA 5EDWA 3PO5A 3X1LB 2FHJD 4ITSA 3VQSA 3ZXWA 1K0TA 1QAJA 4IR1A 2HRYA 4FVCA 3SQGA 1DTTA 2QTWA 3HZGA 3H8YA 3QGPA 2BXJA 1O8BA 1HD1A 2K7KA 4OZ2A 1FDBA 3MM8A 1O0PA 3P96A 2V94A 5KFUA 3ZTRA 2GQCA 4K4ZA 4LFBF 3RYLA 4ID5A 4C3LA 2HQDA 1DURA 2J7UA 5K20B 1U1NA 1W7WA 1W2BR 3GV7B 2CFXA 4IH5A 4C8ZA 1JLCB 4MJKA 2ZH8A 4J9NA 2MZSA 1C4CA 1T9WA 2YWEA 3H0PA 3W61A 2H4YB 4A46A 2ZZNA 1RTJB 2NREA 4O0NA 4DR3F 2HLUA 2GW8A 1BC6A 5AE2A 1RT1B 2A0FB 1NHKL 1JLFA 3BO4A 1QTNB 4AUKA 2KXFA 5JVHQ 2QMUB 1VQ7S 5LSLA 2VV5A 4KGMA 4KT0C 2A2CA 3MURP 2WBMA 1RQ0A 5DLGA 4UUXA 4A8YA 3FZ2A 4LUBA 2F4VJ 2A6MA 2HVZA 4F4XA 3AOBA 5KT2A 3BGFA 3R6GB 1TK8A 2WVBA 1P9YA 2V4JB 5G0RB 1GXLA 4MKBA 1VBZA 2I2YA 3PCOB 3JSMB 3H40A 1VRTA 3NP5A 5F8GA 2QIFA 1U1RA 2IM2A 5F8MA 5DGBA 1S7IA 1QAYA 3RRHA 3CWJA 4ANEA 2ZWOA 3BPSP 3UNYA 4J9LA 3JS9A 5DG9A 3GSDA 1FXLA 1YJ7A 1FDNA 2ZJPQ 4NLRA 1XNQF 1RTHB 1NH8A 4NXMJ 5L1LA 3LPEA 2YKNA 4ELTA 4C8KA 3C14B 2K8GA 4DPTA 1NB7A 1RWUA 2LU1A 1S0VA 1RBLA 3JB9k 2EFQA 2XMTA 2XQCA 1CSJA 3GMGA 3CMAS 1TU0B 4DV0J 4ZIVA 3HJVA 2NYHA 3BREA 2XM3A 3QT5A 4E98A 1NU4A 3SIPB 3DOLA 1XN9A 3QPIA 2Z57B 3W2WB 3CXCR 4TU8A 4IQMA 4MKAA 4JI2F 1TMJA 2R8KA 4F4YA 1R43A 3W60A 1RWWB 3CC7S 2AZ1A 3KLGB 3DXBA 4NXNF 3J7YU 1DQ8A 5IC4B 2JJ4D 3C6UA 1U02A 5A2QU 1AUSL 5HLFB 1E6VB 4P72A 2VOOA 4KQZA 5FJ4A 5BYSA 4ECQA 4QQBA 1VRUB 2H5EA 3ZC4A 1Q53A 3HXMA 3M1VB 3VV2B 3FSYA 2EEYA 3VGVA 1EX8A 4A8MP 4MT1A 4IFYB 1T9XA 3P6YC 4BDPA 2HNDB 1DAXA 2HFSA 2J6UA 1TL3A 3CCMS 4X4VA 1YX2A 3D5MA 4HACA 4AXJA 3NGDA 2IA6A 2XHCA 2WONB 4R0JA 1AUDA 3GIKA 2KN4A 1GNKA 2RQCA 3WIUA 3VAFA 2MKSA 2E1AA 4OL8A 5ETKA 1HPZB 4HVZA 5F41A 1AA1B 3GFYA 4DSKA 2VB6A 2RHQB 4F3MA 4UZCA 3VWSA 4FYDA 5D3GA 3I5CA 2PT0A 1IVZA 2WOMA 2Y1IA 2MZQA 1OPIA 2QJ3A 5B0GA 1IBMJ 1ZM9A 2OKQA 5GADU 3KUHA 1VJWA 3MMJA 3M8WA 2V2QA 4DQQA 3QLHB 3GIMA 2OEJA 2HS0A 1NCLA 4RO0A 3BGRB 4WK1A 2VG7B 3D54A 3DNCA 3D28A 5IQ6A 3BZQA 2Y9HA 3IR7B 1DZ5A 3C6TA 5L46A 1FFWB 2CJKA 2CJAA 4B3OB 4I0WA 3WX8A 2DIUA 2GHWA 4YB1P 1AZSA 3PHTA 2CQBA 4USUA 2MKJA 2OLWA 3K7RA 4PR6A 4X4QA 3OR1B 3PJXA 4NCGA 2MQPA 1WOSA 2K3KA 4GC6A 2HIQA 3V6DA 5E2QA 1PYSB 1RHUB 1FNMA 3BYRA 2ZC4A 3V6JA 3VCDA 1PJ5A 3MAHA 1RHKB 3VHQA 1DTQB 1BQMB 1OWXA 3DLJA 1KVIA 2GNKA 4UOHA 2YX1A 2HWHA 4LSNA 2XGQA 2UUAF 4HDGA 5U47A 2OHDA 4PQUB 5DQHA 4EK2A 2ROPA 2XO6A 4ZVQB 4FYWB 3LOUA 3UDLA 5CAAA 3I4HX 2H3EB 2I5JB 1FVQA 1KFSA 2HFVA 3GJSB 2IBOA 1H7XA 2HGMA 3UDVA 3AD7C 3RBXA 2MY7A 3O3LA 3R2DJ 2BACA 4IRCA 3BKUA 4K0KJ 1RAEB 3QGIA 3DGPB 2CDQA 2NXNA 3CJ2A 2V2KA 4YR2A 2F4VF 1YBAA 2HK3A 4QWDA 1QE1B 4F0HA 3GJTB 1QAXA 2BJ3A 3BDEA 1VHFA 4CT8A 4HKQA 3MTKA 4WZQA 1F1BB 2KL8A 3E01B 3UVJA 3MWBA 1VMBA 2PMZD 1HMVB 3D66A 5EWGA 3B54A 3CCRS 1QJHA 4YEAA 4DV3F 1ZZNA 1LK5A 3K8WA 2XLIA 1WI8A 2L9WA 4J90A 4DMZA 1R31A 1RK8A 2R7UA 2WSFC 1FVSA 3L3CA 5LMNF 2DGWA 2AZ3A 3K58A 5FDLB 3SCJE 4DF4A 2QV6A 4DWIA 2AJ1A 2GIRA 2FVCA 2YKPA 2DH8A 1Q5VA 2XMJA 2PIIA 5MAOA 4XAKA 2KRRA 2GGPB 3UN3A 4B3MJ 2CRLA 3QGGA 1KQFB 2HBRB 2CPEA 1SI9A 3HDSA 5J2MB 4DFJA 2JSXA 1M1GA 4G1QB 2HHQA 5B0EA 1WKJA 3CJ0A 2R7SA 2CJBA 4PXDA 5AJ3F 4WPAA 3NNHA 5KTQA 2PA8D 4IKAA 2DHXA 3I56S 2KVQE 5JUMA 3SZ2A 2XSJB 4M94A 2FGOA 3W63A 1U24A 4AL5A 2OMLA 1MMLA 2C2EA 4LF6F 2Q6CA 2N4DA 3TAPA 2BVZA 1P1LA 3PYDA 3CCWA 2YNIB 2F63A 2PC6A 4WWSA 4CM2A 1IKYB 2VFSA 2QYCA 4ZVEA 1PJ7A 3R5AA 1S5ZA 3AA9A 1TAQA 4N77A 5EX0A 3MEKA 2NXUA 4HEA9 1OY8A 3IP0A 4DX8H 5CYQB 1CJVA 3CO9A 4DV5J 1LWCB 5D0HA 5ITHA 2W25A 1HHSA 1SPBP 4C98A 3DC2A 5IT9Y 1X4BA 4CO1A 1KNZA 3MR3A 5DDOC 1XK8A 3EGZA 3GJRB 4B02A 3RAXA 2VASA 5J2PB 2BE9B 3FRYA 3BV8A 2N7YA 3IG1A 1IBCB 1N54B 1WC3A 2KG0A 2LXUA 4ZDNA 2ROGA 4LF7J 2AX0A 1FWPA 2IRYA 1OSDA 1NPKA 4J9VA 2DRDA 4NLTA 2DB1A 3OFEA 1G1XA 3OXFA 2CPFA 2E5IA 2KT3A 4RNNA 5B7WA 2EFOA 4OX9J 4LBPA 3R5CA 1FKOB 1UETA 4C11A 1BQNA 3ENWA 2R8HA 4I69A 1VLYA 4CO5A 1RAHB 3Q8QB 4DV7J 2Q66A 4B9TA 1FK9B 2C2NA 2VG5A 1Z4UA 3PACA 3G9CA 1MN9A 4KAIA 3CCQS 3HSDA 1TAUA 3RAQA 3P8BB 1IR0A 3DXSX 3GZ7A 3WQPA 3GG0A 3UE2A 4I6WA 3DHXA 3J81U 2H54B 1BXNA 1VQPS 2KT2A 3D7SB 1KHWA 5KFWA 3HFKA 3FBBA 4QR0A 1FJGJ 2A10A 3UNGC 4P7TA 4C97A 5D0EA 4M5IA 2VC0A 5F3ZA 3E51A 2ZH1A 4DPUA 5EGYA 1TL5A 1QSYA 4ZIWA 1DY3A 1OY9A 1PIEA 2IC3B 1TK0A 3CJKA 1S6QA 2C28A 3V4IA 4RNOA 1RTIA 4I6YA 1Q7LB 4UQTA 3IM8A 2V2ZA 1LFWA 3FBCA 4NLUA 4K0KF 4ALZA 2YNHA 3BBBA 2HBZB 5CYMB 4LF4F 4Q7AA 4R25A 2AIRB 1U8SA 1QUPA 1RT2B 1MU2B 1X31C 2CZ4A 3SYZA 1HBOB 4V19J 2XCPA 3F56A 4CH1A 2ZH3A 4D3GA 1HWUA 1DLOA 4UOCA 3OFGA 2DO4A 1FX4A 1Q0NA 2GC8A 1SKRA 2YPYA 1K47A 2M70A 3QQCD 1MN7A 2RQMA 1CG2A 4AYBD 1D9DA 2YQ1A 2DH7A 1R89A 2IRXA 4USVA 5D4PA 3SMZA 2F1FA 2D9PA 4UT4A 3E2EA 3FFIB 4K5SA 1HQEB 1CLFA 1WKKA 1WG1A 1Y5IB 2BOAA 4LFCJ 1F6TA 3P5TL 1RKJA 4YB7A 3OTDA 4DFMA 4X62F 5M2RA 2OTLS 2BBEA 1BD6A 2JX2A 4A8WA 2CNLB 1VC0A 4B3MF 3A8KA 4DCPB 1RT5A 1H74A 4B3TJ 2GVDA 3KK3A 4YDDB 8ATCB 4AQYF 4F4ZA 4FNHA 4OX6A 1EQ0A 5IM0A 2IJNA 3KLEA 4ZVGA 4N8NA 3K17A 1F3VA 4RBUA 4Q45A 1S9FA 1J5OA 4OZLA 4X65F 2FLLA 4DFPA 5GADI 3KUGA 1TL1B 2DNOA 1R0AB 3OFFA 1FEHA 1FD2A 2R2RA 1HL6A 2NPFA 2KU7A 2XYPB 4I1TA 4MK8A 4W92B 3IAS9 5C42B 2C3UA 1LW2A 3TUJC 2R3VA 2LLZA 4BBYA 3RRGA 5HP1A 2BW2A 3PO4A 4I7FB 5KFYA 1H3DA 1SUQA 4LF9J 1Q81T 3K8VA 3BYPA 1N32J 2HGLA 2MLYA 3LP0B 1FE4A 2DEIA 2QLWA 3D0HE 2KJWA 1YVFA 1RT7A 4RR5A 2M9KA 4QWAA 2YNFB 1KKHA 3KLHB 1CJTB 4LIRA 1WOPA 2ACYA 5J2NA 4XTTA 3ZZRA 1QVGR 5IOLA 4M5KA 4DV5F 3N4WA 2FDNA 1U48A 5K5MA 1BE4A 2XY6A 4NMXA 2HLTA 4USIA 2DHGA 1YI2S 2PA3A 1MMNA 4RW8B 2ZM6F 4UQGA 3A12A 1T9YA 1S99A 1I3OB 1R7IA 1S12A 1KFDA 2MQNA 2BW7A 4RU9A 3N9UC 4F26A 3AOAA 3J7Z5 1IKXA 3DOKB 4M5LA 3UDCA 4ZMMA 1ZPVA 3DDKA 1KD1T 3MMAA 1VS3A 5ETPA 1T9VA 1YRTA 4WXOA 1UVLA 1SQEA 4Y65A 1NRKA 3UPFA 4BWJA 1KVKA 2YWHA 1WG4A 3DU5A 1NK7A 4EO8A 3US5A 3M8SA 1JLBA 3FSXA 2AJ2A 5HBMA 4CLTA 5L1JA 1HA1A 4DN9A 4JI8F 4Q5VA 2Z8QA 3FQKA 5HVHA 3AODA 4OI1A 4DV7F 2YWKA 3FBFA 4CLYA 3EZOA 1IWGA 2E1PA 3OR2A 3OL8A 2HMIA 2J9DA 5A8WB 1TL7A 3PXGa 3OLBA 2HW3A 4FP9A 5KT3A 3QJLA 4BS2A 4NA3A 1OO0B 4KJIA 3ET6A 2C2MB 5HQ8A 3CCSS 1JJ4A 3I0SB 1CPZA 4ZP6A 4OJGA 4WZMA 4PRFA 3L7PA 2QLFB 2JWNA 2W9CB 1FX2A 2GS8A 4N56A 1RHQB 1MROB 1LFPA 2VOPA 3H5UA 2C42A 1KSPA 4OYPA 3DGVA 3DLEA 4O44B 3TWZA 4NLYA 3QSYB 4QWBA 2BDPA 2DT9A 1SIWB 1EZZB 4O23A 3CF5Q 2WW8A 4A4JA 5C2GA 3LP2A 4RKUC 4CLFA 2PO4A 3X3UA 1N48A 3OSNA 3CCZA 5KOXA 4KSEB 2B7CB 1RT6A 5CXTA 2DH9A 2DKOB 3EDRB 2V34A 2W2QP 1TUGB 1JWWA 1UAWA 2R7OA 3VF0B 1WEXA 1E6YB 3HVTB 3DLGB 1WD6A 4J9PA 3TP2A 1ZH5A 1HW8A 2HHHF 3KFWX 2K2PA 3DRSA 3M2RB 3F0NA 2HZCA 4DX6A 4RUHA 1U49A 2GHPA 4R5PB 2COLA 1RWNB 1UKUA 4H4MB 2IM0A 2HQIA 4LFCF 4WP9A 3FJ2A 4ZLLA 2CPJA 4URQU 2XBPA 3R97A 1B70B 4K4WA 4IRDA 5DDRC 3I31A 4RW9B 4RW6B 1FNOA 2F3JA 3UW1A 3LW5C 3GG1A 3EWGA 3MEEA 1L3SA 2G2OA 2PSZA 5KFXA 3PM9A 2UVVA 4ZITA 4DUTA 3GFHA 1C1CA 3QJPA 4KGXB 3M8QB 3THTA 3PDNA 3K5OA 5IFMA 2NZ4A 4ZPVR 1CULB 1FRKA 4DJBA 4ED8A 1F9FA 5B0DA 2VBYA 2K1RA 5EX3A 1JLEA 1N5YB 2V6AA 4B3RJ 1WEYA 3OJSA 3M30A 2BX6A 3QZ8A 3L7OA 3LGHA 4L6V3 4OJHA 4OIXA 1EB0A 5D0GA 3M8PA 3MECB 4K2XA 4EBEA 1UFLA 3BS9A 1I94F 3NWRA 1RU2A 4WTYA 3D6TB 1KWMA 3D9BA 3G86A 1RCXB 3CDEA 1HBUA 1M5OC 4A47A 1Y3KA 4OX7A 1PBUA 1SJRA 2O3DA 3PJWA 2KH9A 4DQRA 4XDCA 1ULRA 2LQ5A 4CO3A 4JYAF 3R9LA 1JIHA 3M8ZA 2YX7A 4DG1A 4B9NA 3AXKA 2EFVA 2ZC3A 2B4OA 3BGUA 4LRCA 1REGX 3R5JB 4Y3CA 3BBCA 3DLBA 1U1PA 2DY9A 3AQOA 1EETB 2HHVA 3KUEA 2ASDA 2Z58B 3VTIA 1NBEB 1EAYC 1WOOA 2MKCA 4AL6A 2N82B 2IM3A 4XPEA 2DNGA 3W5ZA 3I5BA 1V5IB 2YWGA 4FF1A 3DDIA 2R2TA 5ETLA 1SC4B 2AJQA 1L3VA 1BGXT 4P9SA 3KNGA 3PRVA 2V9WA 3QAUA 1CC8A 1JLCA 4JV5J 2EWHA 3CPWR 1RTJA 1N5TA 1D09B 2U2FA 1IR1A 3NEKA 2JC1A 3LALA 3CD0A 4LREA 3OVAA 1RT1A 3NXZA 2LXIA 4I56A 4DV2F 2BR0A 5EN1A 3LQVA 1UEKA 3I87A 1X60A 3CMQA 2HQ3A 3SSSA 3MDFA 1NMEB 3CC4S 3J81j 1FJCA 5GAGU 3FC9A 1UA1A 1FDDA 3GCXP 3FKBA 2X1BA 3D6FB 3TJAA 2WK4A 4ED5A 2AYGA 1WKLA 4ZVSB 2V4JA 4F8RA 5G0RA 2BJDA 1FD8A 5E3AA 2ADBA 1PSDA 3T1HF 3JSMA 2ZEJA 3CCLS 2BE2B 4DU8A 2EG2A 1HIYA 1Y5NB 2E1RA 4F4AA 4PCQA 1WWHA 3G82B 9ATCB 1CQMA 4KHRA 1TKTB 4GC7A 5IT9U 5KG7A 1Y4ZB 5LMUF 2KM8B 1QY7A 2IYGA 4QZVB 3TAQA 3KDNA 4DV4F 2XYHB 1ROFA 3D4JA 1K1QA 2EC2A 4DR7J 4F7VA 4DL5A 4DL6A 3UR0A 1NJXA 2FC8A 1A7GE 3M2VB 1R3NA 3M6WA 3SQOP 1OSCA 1RTHA 4KKOB 4ILMA 5DDPC 2ALYB 3C14A 3M9OB 3FNNA 5I42B 4DLEA 3RB0A 5K9FA 5D4NA 3E8OA 1O5JA 2ACMA 4V19X 5KFCA 4ZPCA 2XNQA 5JVGQ 4XO0A 4B9VA 3KDOA 3BSOA 4HHHA 5MLCV 3W2WA 1RAGB 3KJFB 2OAUA 2Y1RI 6FDRA 4FYXB 3KMSA 3DRRB 2M0GB 1M5KC 1WG5A 4TVAB 1VBYA 1PILA 3HKWA 2DR5A 3KLGA 4OZ1A 1U0HB 4H4OB 2DJWA 4IH6A 1Q82T 1RISA 5HLFA 1E6VA 2GA7A 1KHVA 2MKKA 1K1SA 2CJXB 2LYVA 4DR1J 2O67A 2UZAA 3H4BA 1VRUA 3N28A 2P9CA 3R7SB 3M1VA 5J1PA 2ASYA 4IFYA 2GQQA 2UXDJ 1LQ9A 2DHSA 3OVSA 2DK2A 1P8GA 2C2DA 3HHKA 2R8IA 3N6LA 2WONA 3IM9A 4XPCA 2W9AA 3H59A 3T19A 2BM0A 3IAM9 1HPZA 3GE9A 2HVIA 2ATCB 2E44A 3HT0A 1XMOJ 3OD2A 2WB1D 2ZZMA 2YY3A
chains in the Genus database with same CATH topology
2WVCA 2HZVA 2PC6A 2HZAA 3BKUA 2WVDA 2CAJA 2BJ7A 2Y3YA 3QSIA 1Q5YA 3LGHA 2BJ9A 2F1FA 3BKTA 2BJ1A 2FGCA 3BKFA 3OD2A 2WVBA 2WVEA 2BJ3A 3PHTA 2BJ8A 2WVFA 1Q5VA 2CADA 2NZCA 2CA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVC A;  2HZV A;  2PC6 A;  2HZA A;  3BKU A;  2WVD A;  2CAJ A;  2BJ7 A;  2Y3Y A;  3QSI A;  1Q5Y A;  3LGH A;  2BJ9 A;  2F1F A;  3BKT A;  2BJ1 A;  2FGC A;  3BKF A;  3OD2 A;  2WVB A;  2WVE A;  2BJ3 A;  3PHT A;  2BJ8 A;  2WVF A;  1Q5V A;  2CAD A;  2NZC A;  2CA9 A; 
#chains in the Genus database with same CATH topology
 2O5D A;  2RUG A;  1WEZ A;  2KO1 A;  3K0J A;  5KFN A;  2HYI B;  1VQ8 S;  1YJN S;  2CQ4 A;  5IZH A;  3U7J A;  3AA8 A;  3LUY A;  3VGT A;  2VFV A;  3NKY A;  4JI5 J;  4ZVP B;  3KHH A;  4IR9 A;  2W4D A;  3QLH A;  1F5A A;  3BGR A;  2VG7 A;  3TYT A;  2WVF A;  2OPP B;  4JI0 J;  1UL3 A;  3NOG A;  2EPI A;  5ETS A;  1RHR B;  1WC0 A;  3C16 B;  4NLP A;  1X5T A;  1QTM A;  4MK9 A;  2D9O A;  4B3O A;  5LT5 A;  3TX0 A;  3ZTQ A;  2W4C A;  5ETN A;  2HQF A;  3K5P A;  3HHL D;  4GVL A;  1L3U A;  2CAJ A;  2F9J A;  4KTQ A;  3OR1 A;  4FBT A;  3HVR A;  4Y2A A;  2HQC A;  1OY6 A;  1VQN S;  2GFF A;  1HNI B;  1S1T B;  4WU3 A;  3LGM A;  1DTQ A;  1BQM A;  4HTI A;  3F44 A;  5KFM A;  4N47 A;  4NAS A;  5LOQ A;  3NMR A;  1NAQ A;  2UU9 J;  4TU9 A;  2QA4 G;  2CJ9 A;  4PQU A;  4OHW A;  3VAG A;  3KKF A;  5C24 B;  4ZN3 A;  2IBK A;  4CLL A;  4WKR A;  2Q6B A;  3QIP B;  5LM7 E;  1Q78 A;  3IR6 B;  3ZZZ A;  2I5J A;  1KQK A;  1HBN B;  5KFK A;  2YX4 A;  3AJ2 A;  2OPQ B;  4Q2L A;  5I4M A;  4HI2 A;  2CPD A;  3ELH A;  4DLG A;  1I6J A;  3MCO A;  4LSZ B;  3MFH A;  2HBQ B;  3UCU P;  4NCB A;  2W8L A;  2RRA A;  1H2V Z;  7FD1 A;  3O44 A;  3SBM A;  2D41 A;  1HFE L;  4QBU A;  4YME A;  3DGP A;  4PG5 A;  4P6Q A;  2RKI B;  1QE1 A;  4M5M A;  5KFI A;  1JKH B;  1QDU B;  2PMW A;  3MM5 B;  3OLA A;  4LR7 A;  2CQH A;  3KTQ A;  5KFH A;  2QLX A;  3E01 A;  1RGV A;  1WC6 A;  1HMV A;  1H6K X;  3FBE A;  3W2V B;  1FWK A;  4U7U K;  2AEM A;  2YKQ A;  4EZ6 A;  5ADZ A;  5HMW A;  1L5U A;  3ZTS A;  1SKW A;  4ECX A;  1N5V A;  3OSP A;  3ZO7 A;  3ILI A;  2UVR A;  1Y11 A;  3T5L A;  4DR7 F;  4H4K A;  1NM2 A;  1M1K T;  4Y00 A;  1R8H A;  4DU7 A;  1NPP A;  1NPR A;  5E5N A;  5FDL A;  1JB0 C;  5E0O A;  3NAI A;  4DQI A;  2J7W A;  2Y0S D;  2LVW A;  1PYT A;  4U9R A;  1X5S A;  2GGP A;  3N0V A;  4DS5 A;  2QRR A;  4K4V A;  4QPT A;  2V0N A;  1JNZ B;  5DO2 A;  3TO8 A;  5A8K B;  4ZN1 A;  3MMB B;  4PG6 A;  2MLX A;  2NQP A;  1GXT A;  2VUG A;  5J2M A;  1V9O A;  4G1Q A;  4M5H A;  4FDF A;  1ZA1 B;  2GJF A;  4CWB A;  2ZD1 B;  3HI9 A;  1U0S A;  5HJX A;  4BCA A;  1OS5 A;  2E29 A;  3T1A A;  3UDE A;  2AWZ A;  3D1O A;  4WU2 A;  5BJR A;  2J6T A;  2Q1L A;  2N7C A;  4MFB B;  4LVN P;  2DGS A;  4WFA Q;  2J0S D;  3I0R B;  5GME A;  1RSC A;  4O3Q A;  4NE9 C;  2BRK A;  3JXO A;  2XSJ A;  3JAM U;  2ABY A;  3HHL C;  4OI2 A;  1XMQ J;  1ELO A;  3DLH A;  3OL6 A;  2VFR A;  4HH1 A;  5KFR A;  1TKX B;  4AD6 A;  4A8K A;  3HFV A;  4YR0 A;  5HSP A;  2YNI A;  2FHM A;  1VGY A;  4BHQ A;  1IKY A;  3C2P A;  4JI7 J;  2H5I B;  2UXD F;  1XQI A;  2H5J B;  2WVE A;  1LOU A;  1VR6 A;  3R8Y A;  1SVD A;  1C2P A;  4FVM A;  2QL7 B;  4OYB A;  2NUH A;  2HVD A;  2XMW A;  1NDP A;  1S76 D;  4USW A;  1R8P A;  4HL9 A;  2W7P A;  4C0B A;  2BKP A;  2KRB A;  1RAD B;  5CYQ A;  2IIH A;  3RGI A;  3HT3 A;  4LF5 J;  1PJ6 A;  1LWC A;  3ILL A;  3ENV A;  1XMO F;  4NRU A;  4TU7 A;  4CO0 A;  2YQ0 A;  5LXR A;  3K5M A;  1MWZ A;  3BR9 A;  2O66 A;  1PC4 A;  5F0W A;  3AB4 B;  4ZA1 A;  1SQG A;  3IC1 A;  3KG4 A;  4KHM A;  1VBK A;  5J2P A;  2Z2Z A;  3RUB L;  2AV5 A;  1SCJ B;  2HNZ B;  1RAF B;  2BAN B;  1RTZ A;  3CT9 A;  2VQE F;  2NLW A;  4P74 A;  1NSA A;  1NK5 A;  1X5O A;  3IBC B;  4OV6 A;  4M5D B;  4QYZ J;  4JI0 F;  2LP4 A;  2CUY A;  2FJV A;  1TFY A;  3ZNJ 1;  3CSK A;  4O4G B;  3FCV A;  4O4R A;  1VQM S;  4F25 A;  1N34 J;  3RR8 A;  1FKO A;  2I38 A;  4ED4 A;  1RYR A;  1N88 A;  2ATL A;  3O8W A;  1YQH A;  3MCS A;  2KZZ A;  3GJQ B;  1ZOT A;  1FK9 A;  1S59 A;  2MYF A;  1FHT A;  1EHW A;  3MM9 B;  4YUD A;  3PJ9 A;  4DDF A;  3EM1 A;  2CPH A;  2AD9 A;  2E5H A;  5KG0 A;  4ECV A;  5J2Q B;  4GKK J;  5J1E B;  2OP5 A;  4WYW A;  4LRF A;  5KFQ A;  3JQJ A;  2HVE A;  4KBI A;  1MMD A;  3KJV B;  1JLA B;  1WHX A;  2RDI A;  2I6W A;  3AXM A;  1S6U A;  4FKX A;  4L72 B;  4OLO A;  4NL5 A;  1S6O A;  4Y2I A;  3MD1 A;  3S6E A;  1GK8 A;  2OFG X;  3TZZ A;  2IC3 A;  4PWD B;  2QGF B;  2E1C A;  3LF0 A;  4DZ6 A;  2YKO A;  1SH0 A;  3MED A;  2UXB J;  4F0M A;  3WZ0 A;  1HKA A;  3O6Q A;  4PZV A;  5LJ5 Y;  4KH1 B;  3VVT A;  5CYM A;  2J6S A;  1KBR A;  1RT2 A;  1MU2 A;  1XIQ A;  2HHU A;  4DX5 A;  1HBO A;  5C25 B;  3JSY A;  4B3S J;  4U8V A;  3D3C J;  3HSZ A;  4M5G A;  4Y6I A;  3VAH A;  1HNW J;  4XK8 C;  1W25 A;  1WSV A;  3FQL A;  4OZN A;  2W2P P;  3W7B A;  2FVS A;  3ISN D;  3W8P A;  4IH7 A;  3CUN A;  3ETM A;  2BJ8 A;  3FFI A;  2B43 A;  1DQA A;  2EG1 A;  3W5X A;  1UJ4 A;  1HQE A;  2BMB A;  3CCJ S;  3WIV A;  2VG6 B;  4WTO B;  1HYS B;  4NI2 B;  1T3N A;  2M7S A;  4ZJQ A;  1RTD B;  3ITH B;  2AEJ A;  2ZOF A;  3TNV A;  4I2P B;  2C2O B;  3R5G A;  2ERR A;  1MWQ A;  2BEF A;  2ZBQ A;  4YFU A;  1VQ5 S;  1T02 A;  2HZA A;  2MLZ A;  4W98 A;  4QOT A;  2JFD A;  2BRL A;  5KFA A;  4U8Y A;  1VJQ A;  4C8L A;  5SZT A;  4DPY A;  1VK8 A;  5CZV A;  2UUT A;  1WF1 A;  3MPW A;  1SV5 B;  2NPI A;  3FDS A;  4BC9 A;  4K4T A;  1URN A;  2XI3 A;  4X64 F;  4ZVF A;  1FRL A;  4Y34 A;  4DZD A;  2DNY A;  5HMY A;  1NDK A;  2DHA A;  3OXG A;  3G87 A;  1PBA A;  4DS4 A;  3CJT A;  3DMJ B;  1TL1 A;  1UFK A;  1B3T A;  1LW0 B;  1R0A A;  5BYQ A;  2W9B B;  4YY3 J;  2NYI A;  1DJ0 A;  1XEZ A;  2AT1 B;  5AE3 A;  3ISZ A;  2XSF A;  2DRB A;  1N8R T;  2OIH A;  4DPX A;  5C42 A;  3QFW A;  2RDJ A;  1XMQ F;  2RQK A;  2HHW A;  4M95 A;  1HI1 A;  3ILO A;  2CPY A;  2F4F A;  1QUV A;  4EBD A;  3M7V A;  2W7O A;  4PG4 A;  1KN6 A;  3S8S A;  4I7F A;  2LQ9 A;  1R6Y A;  1DAR A;  3CJ8 A;  5CH7 B;  2VD3 A;  1YRX A;  3LP0 A;  1RZM A;  3IA0 A;  2G0J A;  4IDK B;  3Q2T C;  1S77 D;  4J5O A;  3DRP B;  4CYU B;  4JV0 A;  3VVU A;  3DLK B;  1GX5 A;  2YNF A;  3Q8R B;  3KLH A;  2PFF B;  1CJT A;  2JNJ A;  1U2F A;  1HNV B;  3T1Y J;  3DU6 A;  2GX8 A;  4URG A;  1X9W A;  4OHZ A;  2YVS A;  2BKO A;  4FXV A;  4ZVO B;  3PX4 A;  5B0B A;  1X0F A;  3MHY A;  4ILL A;  1LKZ A;  4TLQ A;  3V2U C;  1HNZ J;  5L9X A;  3EIC A;  3P3D A;  2FZK B;  2NCK L;  4DV6 J;  2XZT B;  4RW8 A;  5F8L A;  3HHN B;  1D1U A;  2HAI A;  2EBE A;  5IWA J;  3HZE A;  3CJ4 A;  4NPO A;  2LQB A;  2F8H A;  4ZHR B;  5KAK A;  3DOK A;  4IUF A;  1J2V A;  5LSO A;  3MFI A;  3PV8 A;  4B9U A;  2WHO A;  5A6P A;  1N0V C;  5BXI A;  7FDR A;  3OTO J;  3KYL A;  3EDQ B;  3CGI A;  3TVZ A;  4FN5 A;  4ED3 A;  1S1W B;  3R5D A;  2B6A B;  3HJF A;  4F2S A;  3HF5 A;  1B0V A;  3ISN C;  1N34 F;  4HT7 A;  3ZZU A;  5H1S V;  3A3O B;  2NXE A;  2E5L F;  1K0V A;  1TL4 A;  4HHU A;  5CHC B;  1AYE A;  4K4Y A;  3A8I A;  1YKW A;  3U1N A;  3ZZ0 A;  5KG1 A;  1Q95 G;  4CTA B;  5A8W A;  4LR8 A;  4KC5 A;  4LRD A;  1XR6 A;  4GKK F;  1ZM2 A;  4A48 A;  4Q8F A;  2RU9 A;  4ZKA A;  4YS2 A;  2M52 A;  3IWL A;  1I5O B;  2C22 A;  3I0S A;  2IJF A;  1RHM B;  3KNA A;  4OJ3 A;  5T14 A;  2PI4 A;  1V6H A;  2QG9 B;  5K8P A;  2J76 E;  1RA7 A;  2W9C A;  4CQ1 A;  2G0C A;  3MF5 A;  1CJK B;  1CJU B;  2M8D B;  4B9M A;  1MRO A;  3TA0 A;  4HYK A;  1P27 B;  4UY8 T;  3HD1 A;  5IXU A;  4O44 A;  3KWM A;  3W64 A;  1PG5 B;  4UZB A;  3HLU A;  5CA5 A;  2UXB F;  1J5E J;  3PNI A;  2NS1 B;  1TV6 B;  4UW2 A;  1SJ1 A;  3IWN C;  1IBL F;  4DCO B;  4O3O A;  1S9G B;  2XMM A;  1U1L A;  4KHP F;  4EYH B;  4O3N A;  2GIF A;  4LRB A;  2B56 A;  2IVM A;  1E6Y A;  1FFG B;  3HVT A;  4L73 A;  3DLG A;  3PW4 A;  1HR0 J;  1H72 C;  4M8L A;  2GAH C;  5KG5 A;  2BQ3 A;  3M2R A;  2ZUG A;  1KOO A;  4F4K A;  4FXD A;  2MQL A;  1OMS A;  3SXL A;  1WHW A;  1D9A A;  1YBU A;  2DGQ A;  1G6B A;  5LL6 d;  4JI6 F;  4R5P A;  3RZA A;  1VRQ C;  3T9Z A;  3MPD A;  4H4M A;  4I68 A;  3R7N B;  1RB0 A;  4KRW A;  3EGV A;  3T41 A;  2VPY B;  2XS5 A;  1GX6 A;  4P2F A;  4U95 A;  4FKY A;  2OD6 A;  2KHD A;  4LJM A;  4RW9 A;  4RW6 A;  3TVY A;  1RAJ A;  1M0S A;  4UST A;  3W8G A;  3S1T A;  1HBM B;  2ALZ A;  1HQU B;  5EWE A;  4NZ6 A;  1UCN A;  2AGQ A;  1C0T B;  4P71 A;  1M90 T;  4X2B A;  2ZHA A;  1UVN A;  3M8Q A;  4MH8 A;  3U27 A;  1J27 A;  4ECZ A;  1CUL A;  1S0O A;  1TFW A;  3DKD A;  2HIY A;  2CWK A;  4USJ C;  1H73 A;  4CLZ A;  2VOD A;  4YB6 A;  1N5Y A;  2G1D A;  1R27 B;  4YY3 F;  4J9R A;  2JDJ A;  2EKY A;  1U25 A;  1HWI A;  4LR9 A;  1GMV A;  2B4P A;  2MY8 A;  3MEC A;  4ECS A;  3NG8 A;  5H9E J;  1B7Y B;  4EMD A;  2UXC J;  3QZ7 A;  4M63 A;  5I3U B;  5HN0 A;  3H5X A;  2M3D A;  4DOZ A;  1OPZ A;  2CWX A;  3KHR A;  4DR2 F;  3GCW P;  2J8S A;  1RT4 B;  4WII A;  4KY3 A;  3UD3 P;  4ID8 A;  2VL1 A;  2Z2L A;  2BA9 A;  1Q4R A;  3QMQ A;  4LBI A;  3G8T A;  3WHI A;  3T1Y F;  3RG6 A;  2R7W A;  2Q79 A;  2VQF F;  2EK6 A;  4USH A;  2KZM A;  1EET A;  4UOF A;  3PX6 A;  1DQ9 A;  2C3O A;  2HNY B;  5DM7 Q;  1QAI A;  2CQG A;  3THV A;  2Y8W A;  1S79 A;  4WK3 A;  1VI7 A;  1KVJ A;  2ROE A;  1LNQ A;  1PKU A;  3EXC X;  2F40 A;  3DDN A;  2BJ1 A;  1U09 A;  1UVI A;  1S6P B;  3G6E S;  2E66 A;  3EYZ A;  3MAA B;  1N6Q B;  3HMJ G;  3BO3 A;  4N76 A;  1WSR A;  3HP6 A;  1UVK A;  2DNM A;  3S01 A;  2GJ2 A;  3KXD A;  4DSE A;  1AXQ A;  3CDW A;  4CLP A;  4DPW A;  2QZ8 A;  3T9N A;  3Q2S C;  1LWF B;  1IWA A;  3CVK A;  3GPA A;  4ZJL A;  1VBX A;  1ZA2 B;  4ZCM A;  2LEA A;  2JVO A;  3NBP B;  3I32 A;  2YPZ A;  4ED1 A;  1NK6 A;  4DUZ J;  1WUU A;  1XJW B;  1D8Y A;  5F8J A;  2O1P A;  4ZLN A;  2RDD A;  2YKA A;  5F8H A;  3W62 A;  1VQ6 S;  4ED6 A;  4F4W A;  2MST A;  3ZZP A;  1KTV A;  2AF6 A;  4FF3 A;  1UZH A;  1WEL A;  3QID A;  2APO A;  2DNR A;  1IXK A;  3V5R A;  2OH2 A;  1YJT A;  4DBQ A;  4WFB Q;  4RW7 A;  2BE2 A;  3FUY A;  1QVF R;  3M2U B;  3QRQ A;  1TVR B;  2FHO B;  1F0X A;  3G82 A;  1XBW A;  1TKT A;  2DR6 A;  3LWL A;  1RU1 A;  2WBR A;  4IYQ A;  4C8Y A;  4LMZ A;  1S0N A;  1GMU A;  2JLF A;  2QA2 A;  4CO2 A;  5A2Q Y;  3V81 B;  1YJR A;  1RXO B;  1K8A T;  4N41 A;  1F9H A;  3PX0 A;  1SC1 B;  1X4D A;  2BM1 A;  2U1A A;  3TX8 A;  3M2V A;  3H5Y A;  6AT1 B;  1AW0 A;  4M5J A;  1UFW A;  4KKO A;  2CQP A;  1S9E B;  1G3O A;  4TY8 B;  3HX9 A;  1NK8 A;  5I42 A;  5JJB A;  3BQ0 A;  5FD1 A;  1F5C A;  2RUS A;  5DZ7 A;  4AXI A;  2WZ1 A;  4IRK A;  2NSB A;  4P10 A;  2OJ3 A;  1VQL S;  4NA1 A;  2XMV A;  1M5S A;  1R0B G;  2FTR A;  5DLF A;  3DM2 B;  1HR0 F;  1KON A;  5E3P A;  3IBW A;  1WJ9 A;  3BGO P;  4ETX A;  4DUY J;  5DQI A;  3DRR A;  2Q3P A;  3D0G E;  1TUV A;  4H4O A;  1VQS A;  4DI6 A;  4JI4 J;  1HWL A;  4OYZ A;  4EYI B;  3HSG A;  2QT7 A;  1D0E A;  4WKY A;  3I4P A;  3GFX A;  4J9S A;  4PAB A;  2ZH7 A;  4OI3 A;  1H2U X;  2OTJ S;  3J7A N;  2R7X A;  2FIU A;  2B9Y A;  1RHJ B;  1JJ2 R;  1RE1 B;  2YKM B;  4OZ0 A;  1X9S A;  4YP3 A;  3UQS A;  3OVB A;  2ZBP A;  4QPX A;  1AFI A;  1ACM B;  2FVR A;  2UV8 A;  2B9W A;  5K8O A;  3PFE A;  4RLE A;  4U67 Q;  2FY8 A;  2E9R X;  3BSN A;  2VHG A;  3OHA A;  4ICL B;  4LSL B;  4JBC A;  1RA6 A;  2V8G A;  2GO8 A;  2HHP A;  3C66 A;  4NXM F;  1N4L A;  3H7H B;  3QJJ A;  4RL1 A;  1M5P C;  2MHN A;  3ZTP A;  2RS2 A;  4DV0 F;  2X1A A;  2L08 A;  3CIM A;  3QRR A;  4ZJO A;  4EI2 A;  2LDY A;  1J5O B;  2H48 B;  4CI0 B;  1JQG A;  5KG6 A;  1S72 S;  1IJE B;  3TAN A;  4CT9 A;  3ZFV A;  3EZU A;  4F3O A;  2J0X A;  2V8H A;  3VAL A;  3PVX A;  2OPP A;  2HAF A;  2IVY A;  2VBW A;  2VF3 A;  3TVK A;  2B0G A;  3J80 Y;  1ZAX A;  3GII A;  2L41 A;  1KDN A;  4RW4 B;  1RWO B;  2IYI A;  3C16 A;  4DCJ B;  1EJ7 L;  2FQQ B;  4QYZ K;  2CVI A;  4W4M A;  2FHK A;  1PGZ A;  2EC0 A;  4ER8 A;  1U1O A;  2Y8Y A;  4FPR A;  3OV7 A;  5GMK a;  3D68 A;  5CCL A;  2IVF B;  1TKZ B;  1YZ6 A;  2QL5 B;  1GXU A;  3QT7 A;  1HNI A;  5IQQ A;  2EFG A;  1SL2 A;  1RP5 A;  5KFG A;  2XTJ P;  1TP7 A;  4B9L A;  1ICE B;  2KYX A;  3EX7 B;  3BQ2 A;  5D4L A;  3ZZY A;  4K4U A;  3VZH A;  5KFL A;  1UMJ A;  2XY7 A;  4YN3 B;  3CDU A;  5C24 A;  2F8E X;  3QIP A;  4DXL A;  2K7J A;  1HBN A;  1ARO P;  2B8P A;  5D0R A;  2OPQ A;  1MLA A;  4DUZ F;  5IV4 A;  1FES A;  3MMA B;  2V4Q A;  1IBM F;  3GV8 B;  2BQR A;  2B4U A;  3CO0 P;  4U7C A;  1KEK A;  3IGV A;  3M8Y A;  1JKH A;  3M9N B;  3MM5 A;  2VPX B;  4ES3 A;  2RU3 A;  1XER A;  3PZP A;  3TZX A;  3D1Q A;  2BKN A;  2E9Z A;  1MWY A;  3AD9 C;  1HNX J;  2B3T B;  3WX4 A;  3W2V A;  5HI7 A;  1MNE A;  2IM1 A;  3RTV A;  1SKU B;  3ZTO A;  3M6U A;  4Q2M A;  3N79 A;  4KGK A;  5AE1 A;  1TL7 B;  1RAC B;  3Q0A A;  2GHV C;  3CED A;  4HDH A;  1WC4 A;  2GZO A;  3Q89 A;  2CPX A;  5KOW A;  2D74 B;  2MDA A;  3PFO A;  1GTH A;  2GAG C;  5KT5 A;  3CCV S;  1ZTW A;  1NJW A;  3AJ1 A;  4P73 A;  1X5P A;  3BSC A;  2UVW A;  3JTO A;  4DF8 A;  2JEI A;  1RWM B;  3FZB A;  1T0T V;  2CZ9 A;  1I1G A;  3DLE B;  3MMB A;  2CQD A;  2HRT A;  2J7K A;  3UCG A;  1GMW A;  2E9T A;  2KFY A;  1VOM A;  3W1Y C;  4K5R A;  3F73 A;  2ZD1 A;  2ZDP A;  4DUY F;  3IRW P;  5M2P A;  3NWG A;  2V9K A;  3LWM A;  3MZI A;  5E3Q A;  5K14 B;  1SB6 A;  2KDO A;  2AYM A;  2QSW A;  4NZ7 A;  1RWV B;  1EKS A;  3NGK A;  2ILY A;  4MFB A;  3MTJ A;  2DHH A;  3I0R A;  3PG9 A;  2AEF A;  3CDB A;  2L9N A;  4LQ9 A;  1Y0H A;  3VAI A;  1TKX A;  3ILJ A;  2GIQ A;  3LAN A;  5E41 A;  3A4T A;  2C3Y A;  5F0U A;  3J7Y I;  4JI2 J;  3RB3 A;  4TY9 A;  2A3J A;  4Z2X A;  1IKV B;  2CNO B;  1FWL A;  2H51 B;  4IFV B;  2CQI A;  1VQY A;  5D77 A;  4NXN J;  4NML A;  1S4F A;  1WNE A;  2CQ0 A;  2JEG A;  3HHE A;  4ZOS A;  2W4P A;  2PEB A;  1NJI T;  2N3O A;  3RB4 A;  1WTF A;  2QMW A;  3C3L A;  2GQ2 A;  2WRM A;  3MM6 B;  2VPZ B;  1BWE A;  1NZ8 A;  5IT0 A;  3BSA A;  3BDP A;  1WDT A;  3J81 Y;  2DNN A;  4HTJ A;  1U7L A;  1BY9 A;  1YRU A;  2HFZ A;  2HBY B;  3PW7 A;  3FEZ A;  2E7V A;  1DHM A;  3WDO A;  3N5B A;  2HNZ A;  1JXV A;  4CIO A;  3AOC A;  2BAN A;  3EVW A;  5LJ3 Y;  2DY1 A;  3C19 A;  2G0I A;  4RJV A;  3PIP Q;  5C5J A;  3GON A;  1YIT S;  4M5D A;  1UEV A;  3HCX A;  4NLO A;  3BB5 A;  1T05 B;  2HFN A;  5E3R A;  3M4X A;  4O4G A;  3D0I E;  2RIJ A;  2CQC A;  3QWP A;  4ELV A;  1FRH A;  3HK2 A;  1YLX A;  2FYX A;  3B8H A;  3TUI C;  5EWF A;  1TK5 A;  3P4U B;  2QLB B;  1U4B A;  2EXU A;  1HBU B;  2BAB A;  1HW9 A;  4RZR A;  4LQ3 A;  3MM9 A;  4NZ0 A;  1N36 J;  1QSS A;  1JJH A;  1IKW B;  2YTC A;  2R42 A;  3BQ1 A;  3CJ3 A;  2D3O R;  3M6X A;  2V5H G;  3VGS A;  2FLO A;  1GEH A;  4NOH A;  5LXY A;  2KFZ A;  5J2Q A;  4RX6 A;  1REV B;  3UD5 A;  4CDI A;  4EBC A;  3QNW B;  1NO8 A;  3DRY A;  3W9J A;  3KJV A;  2POK A;  3Q8V A;  1JLA A;  4MIA A;  5JMN A;  3QRP A;  2G9O A;  1SKS A;  3D3B J;  2Y1L B;  4ATN A;  3KK1 B;  1TTH B;  5KG4 A;  3B6B A;  5C7P A;  2H4W B;  5KT6 A;  1F9E B;  1TUW A;  4OYX A;  2JLE A;  2DGV A;  2FJB B;  3RW6 A;  1Z2Z A;  2LCW A;  4QJV A;  1T03 B;  4PWD A;  2BZ2 A;  3MUM P;  2JHE A;  1ZPW X;  3KG0 A;  2IHR 1;  4NEZ A;  2GO9 A;  3HKZ D;  3OUY B;  1OJ4 A;  5A6W A;  4O3S A;  2HUR A;  1RBO B;  1KQS R;  4M1K A;  2UUA J;  3IMQ J;  4JV1 A;  4WIQ A;  4YHH J;  4LF7 F;  2FLP A;  1LWX A;  4RNM A;  4PWU A;  5C25 A;  3MMC B;  3UWT A;  2J0W A;  4Y0F A;  2H9Z A;  3HPO A;  1JLQ B;  2IMO A;  4HHJ A;  1HNX F;  1V3Z A;  1RT3 B;  4RPF A;  1KQG B;  2QC3 A;  4LFA J;  4DL2 A;  1YJV A;  4E0D A;  4OX9 F;  2R7R A;  2IPO B;  4L3N A;  4DR5 J;  3PY8 A;  3KJQ B;  1W2I A;  3IBF B;  5DDQ C;  2B4V A;  4OV1 A;  1UJ6 A;  1MG7 A;  4QU6 A;  1EIY B;  2VG6 A;  1KP6 A;  1HYS A;  1FTR A;  4NI2 A;  1RTD A;  3CJ5 A;  3G8Q A;  3DFE A;  3DI6 B;  1KTQ A;  3ITH A;  1M5H A;  4O3P A;  4I2P A;  3EXY A;  3I9Z A;  3H5S A;  2FZC B;  1X4H A;  1NK0 A;  3L7U A;  3NGT A;  5T7L B;  2DNL A;  4OZ3 A;  4ERD A;  2IFX A;  4DV3 J;  1GAO A;  3QT6 A;  5F8I A;  5RUB A;  3QT8 A;  1SV5 A;  5KFV A;  1HHT P;  1B7F A;  4N8O A;  1VQK S;  1VQO S;  2OEK A;  1FJG F;  2RQ4 A;  1U1Q A;  1M5V C;  4MYU A;  2C2K B;  4IOC Q;  3MD3 A;  1SC6 A;  3IGN A;  3IS9 B;  5LMN J;  2FJW A;  3L9Z A;  3DMJ A;  3AHP A;  2CXE A;  3PRD A;  3D2W A;  3GFZ A;  3A8E A;  1LW0 A;  4J9U E;  2W9B A;  2PD1 A;  3QFH A;  3DYA B;  5A0Y B;  3NCQ A;  2W2N P;  2LQJ A;  4KFB A;  1H0H B;  3EMT A;  1CVJ A;  3L09 A;  2NZC A;  2CA9 A;  4Y2K A;  1HWK A;  3GIJ A;  4OI0 A;  5KFZ A;  2DCL A;  3Q8U A;  2DR7 A;  1EP4 B;  2VJV A;  2R7T A;  1YGY A;  4ZP9 A;  5ETQ A;  5H9E K;  3QO9 B;  5AJ3 J;  2NR0 A;  2WW4 A;  4IDK A;  4UUW A;  3CB4 A;  3DRP A;  4CYU A;  2J9D E;  3DLK A;  4NYO A;  2V69 A;  2UV8 G;  4F04 B;  1HNV A;  2YWW A;  1IJF B;  4A8O A;  3CUL A;  4WFY A;  4E8U A;  4NLS A;  3RRK A;  3OBI A;  5IC6 B;  4TKT A;  4LF6 J;  2M2B A;  3K89 A;  2H65 B;  5HMZ A;  2LU2 A;  5KFE A;  3W3S A;  1P9Q C;  5HK4 A;  3SEO A;  4MAK A;  6FD1 A;  4JP8 A;  1Q8K A;  2DGX A;  3G8S A;  1YIJ S;  4ZHR A;  2CZV C;  3UO0 A;  4B3T F;  2RHS B;  2IAJ B;  4CO4 A;  2V8V A;  2ZVS A;  4IG0 B;  4N7T A;  2EW9 A;  2FB0 A;  1LXJ A;  3FEX B;  3UN5 A;  2KVI A;  5M2U A;  1ZM3 A;  3IN5 A;  5DQG A;  1S1W A;  2F9D A;  4ZVT B;  4F3Q A;  1U26 A;  2B6A A;  5HQL A;  2OPS B;  1PC5 A;  3T5K A;  5BR8 J;  2VBX A;  4ZPW R;  1PAU B;  5A8R B;  4DL7 A;  2UUC J;  4IG3 B;  3HFZ B;  4HLB A;  3U1M A;  1N36 F;  3R2C J;  3M32 A;  1WAC A;  4CTA A;  5CCM A;  3W9I A;  2ZH5 A;  1RAA B;  4FPI A;  4LF9 F;  4F2R A;  4AE5 A;  1N32 F;  1HI0 P;  2AJ4 A;  3RBD A;  1RCO B;  1KLN A;  1ITP A;  1N33 J;  3LO3 A;  2CG8 A;  2XMU A;  1U1K A;  4I6A A;  3TEG A;  1QLN A;  5FLX Y;  1R6V A;  2VJU A;  1T9T A;  1CJK A;  4CM0 A;  1CJU A;  4QWE A;  2F7V A;  2B9E A;  1U6F A;  1RKI A;  2WVD A;  5D6G A;  4FNI A;  3JYT B;  5DGA A;  1UEU A;  4WBF A;  5BYR A;  2BE7 D;  4RWX A;  2FJX A;  1NUE A;  2KXH A;  3BGL A;  3QYY A;  2FJA B;  1Q7Y T;  2R7Q A;  1TV6 A;  2AGP A;  2XS2 A;  1S1V B;  1FI4 A;  3U02 A;  4CH0 S;  1S9G A;  3QWU A;  5GAE U;  4YHH F;  3CCE S;  4DR4 J;  2FLN A;  4H4K C;  1XTZ A;  2ASJ A;  1KLM B;  2Y3Y A;  2VKR A;  5GAH U;  2UP1 A;  3DOM B;  3J80 U;  4LFA F;  4TXS A;  2UUB J;  2GVZ B;  4DR5 F;  1VQ4 S;  3MI7 X;  1Q79 A;  3ICL A;  5L8R C;  2ZE2 B;  4DEZ A;  2R2U A;  4LF4 J;  5ETO A;  3POT B;  4MMO A;  1S1U B;  3MEG B;  2B5J B;  3O1L A;  4IO9 Q;  2AHO B;  3SV3 A;  2YNG B;  3GSI A;  4FYY B;  1LK7 A;  5H9F J;  5THW A;  5LSR A;  1SQF A;  1SL1 A;  1DRZ A;  2CPI A;  2Z0G A;  2H1Y A;  1YG0 A;  1NK4 A;  3PKY A;  5KT7 A;  3I5A A;  2ZOM A;  4BC7 A;  1RAO A;  2Z2Y B;  1S49 A;  2V8D A;  2NSC A;  1HBM A;  1HQU A;  4OHX A;  2AGO A;  1C0T A;  3G6X A;  2AJ0 A;  2LA4 A;  3TZY A;  3SFU A;  3KLI B;  5F9N A;  1FEE A;  1D9F A;  3KK2 B;  1WI6 A;  3BBF A;  2HWI A;  4RNH A;  2OPR B;  2I8E A;  3I9V 9;  4S0M A;  1AT1 B;  4X62 J;  3LP1 B;  5E7O B;  2FY1 A;  4ENO A;  2DGO A;  3CC2 S;  4LF2 A;  2CAD A;  3MR5 A;  1QD1 A;  1UWB B;  3JQM A;  3D6M B;  2FVP A;  3PR4 A;  4NYZ A;  4PKD B;  3EPG A;  1JK9 B;  5CQG A;  1PO6 A;  4AQY J;  4WE1 B;  4P2S A;  5I3U A;  2XCA A;  1IR2 A;  2E5G A;  1WF2 A;  3NS7 B;  2QO3 A;  2HG4 A;  3TUZ C;  1U8W A;  3ONQ A;  2AYB A;  1RT4 A;  4ZP7 A;  3KOA A;  4X65 J;  4WCE Q;  1F3F A;  3EUN A;  2AKW B;  4C0H A;  1FJE B;  2R8G A;  1VIO A;  1B64 A;  2KB2 A;  1Q8L A;  1FRM A;  4DR6 J;  5CYJ A;  3AT1 B;  4MKV A;  2HSE B;  2PI5 A;  2JEF A;  1FKP B;  3GIL A;  1PCA A;  2J9E A;  2HNY A;  3Q8P B;  2K06 A;  4KGZ B;  3GP9 A;  4OJ1 A;  4QIG A;  2VDH A;  4OI4 A;  2QYG A;  1LXN A;  1C0U B;  4OZJ A;  1D3W A;  3PKM A;  2G4B A;  3NAH A;  4J9Q A;  4QIE A;  2DNH A;  2LDI A;  1JX4 A;  2ZZT A;  3MR7 A;  1UW4 A;  2AP6 A;  3MPU B;  1S6P A;  2XUL A;  3WBZ A;  3MAA A;  1N6Q A;  2CJQ A;  2HND A;  4P2X A;  2DXF A;  2MZJ A;  1I51 B;  3GYG A;  3T5H A;  3NLC A;  1VQ9 S;  1GH8 A;  3PEJ A;  3OHB A;  3MPY A;  4NLW A;  2AQ4 A;  1IN0 A;  2ZM6 J;  4QW8 A;  2BUN A;  3L4B C;  4B3R F;  3C8Y A;  1LWF A;  2WTF A;  4Q0B B;  2HKE A;  1S0M A;  5BR8 F;  3NBP A;  2VON A;  4OYO A;  4JI1 J;  2UUC F;  1Y00 A;  2FHJ A;  4PEO A;  1NK9 A;  5ETV A;  2V50 A;  3V4M A;  1Q16 B;  4NX9 A;  4BWM A;  4LRA A;  3A1Y G;  2AX1 A;  2LQ8 A;  3GYX B;  4MK7 A;  4P52 A;  1ZBT A;  1N33 F;  2OSQ A;  3OXL A;  2CQ3 A;  1T94 A;  2GML A;  1GT8 A;  3Q8Y A;  3MM7 B;  1RLC L;  4CLU A;  1F60 B;  3TAM B;  2ZH4 A;  1O6X A;  4UY8 5;  3UI3 A;  4JI8 J;  3R27 A;  4RUA A;  1XMB A;  3M2U A;  1TVR A;  2ZBR A;  4Y28 C;  2DR8 A;  5AXN A;  2ZKU A;  1FRX A;  4LBH A;  2FVQ A;  2C2R A;  2W8K A;  3NGS A;  3DCA A;  1X4G A;  2WCX A;  3A3N B;  3CIZ A;  3V81 A;  2LKZ A;  2J0Q D;  1RWK B;  2BV3 A;  2BQU A;  4KV8 B;  4OHY A;  4C3K A;  1WHV A;  1CQN A;  1O51 A;  1MW7 A;  1S9E A;  1N56 A;  4TY8 A;  4WFZ A;  1IUJ A;  4DR4 F;  2E7X A;  5I3Q A;  1A6L A;  5HAT A;  1UJ5 A;  4X4S A;  4JV5 F;  2UUW A;  2Q43 A;  4FF2 A;  2ZHB A;  3OPK A;  2X7I A;  2UUB F;  4HH0 A;  3DM2 A;  2MQQ A;  3S7R A;  3MED B;  3PW5 A;  3ZZT A;  2XEX A;  1YZ7 A;  4C48 A;  4PYD A;  4ZLJ A;  3KMQ A;  5CD4 H;  2HVH A;  2CNK B;  2KJV A;  1CC7 A;  2MXY A;  4A8Q A;  1OYD A;  4OYW A;  2LEC A;  1S4E A;  2FD2 A;  4F02 A;  4AND A;  2AW0 A;  1UZD A;  1SH2 A;  4ED2 A;  1Q1K A;  1JNR B;  1S10 A;  3G2X A;  3IRX B;  5HQM A;  1WF0 A;  2FUG 9;  2DIS A;  5AXL A;  2MSS A;  3QSI A;  3PEH A;  2HHH J;  1S57 A;  4PUO B;  1F2G A;  1RLD A;  3EVM A;  1H98 A;  5B09 A;  3OW2 R;  5L39 A;  4ES2 A;  3V6H A;  2YKM A;  3PYE A;  4ZCI A;  2G2Y A;  1JMT A;  2CIM A;  1OYE A;  2MZR A;  2ZH9 A;  2KT5 A;  1UP1 A;  2NUU G;  4CNZ A;  4ES1 A;  1HWJ A;  3NRB A;  1NSP A;  1BWV A;  4ETZ A;  3D6H B;  4DPO A;  4XIU A;  2DNQ A;  2RF2 B;  2CG4 A;  4ICL A;  3MOJ B;  4LSL A;  3HUL A;  3WC0 A;  4HT5 A;  2MGZ B;  2X1F A;  2B9X A;  1PYO B;  3QBC A;  3EGW B;  4EO6 A;  2R2S A;  4KGV B;  1YSJ A;  4QIF A;  3AY0 A;  3VAM A;  3GYN A;  2IRU A;  3OJU A;  4RU2 A;  1FF2 A;  1SH3 A;  5B08 A;  3TAR A;  4IQX A;  3KLF B;  3IR5 B;  3ZZO A;  4X66 J;  1X9M A;  4G6V B;  4K59 A;  3AB2 B;  4DV1 J;  3DLL Q;  1RBA A;  1TQL A;  5DRK A;  2XGP A;  4DR6 F;  2D3U A;  5HRO B;  4RW4 A;  1I94 J;  1BQX A;  1UW9 A;  5CD4 A;  2VC1 A;  3JTP A;  4GO5 X;  2CKW A;  2DPJ A;  1N0U A;  4RWW A;  3UR3 C;  1YTY A;  2PDA A;  1SIZ A;  5HMX A;  4DQP A;  1ZZF A;  2ZJQ Q;  4B08 A;  3C15 B;  4J37 A;  4DR1 F;  4DL0 C;  4JYA J;  1S1X B;  4KE5 A;  3A8J A;  3BR8 A;  1V5V A;  1P1T A;  1C4A A;  2DPI A;  4OHV A;  2IDE A;  1TKZ A;  4I2Q B;  2DVI A;  4OX8 A;  4ELU A;  5K8N A;  1JLG B;  4GVB B;  1WDD A;  1D8Z A;  3PW2 A;  1SJ4 P;  2ZH2 A;  3N6M A;  2DBB A;  1C1B B;  2XZW A;  1CS4 B;  3SDE B;  2QLJ B;  4CCH A;  2P2C B;  4NLV A;  1ZTT A;  1R0C B;  5AXM A;  1EQM A;  1LWE B;  2M8H A;  4O3R A;  1B0T A;  1A0O B;  3H42 A;  4MTP A;  5D8H B;  5GAE I;  1VFJ A;  2C3M A;  3Q8S B;  2HS4 A;  2P8I A;  2MKH A;  3F41 A;  4JI1 F;  3R5B A;  5GAH I;  1WHY A;  2BOP A;  4NEY A;  1HQ2 A;  3B4M A;  4FBU A;  2WVC A;  3KJN B;  4P2M A;  5HL7 Q;  2EVZ A;  3GQC A;  3HHL B;  4JI5 F;  4URS A;  1B99 A;  4PYA A;  5B0C A;  3CJS A;  3M8R A;  1F5B A;  3QGH A;  4UTG A;  1R8C A;  4DV2 J;  3RBE A;  5GAG I;  4KO0 B;  4EU0 A;  5SUH A;  4ECU A;  3C46 A;  4MYT A;  4LT6 A;  4PG7 A;  2SXL A;  2DO0 A;  4QW9 A;  3G96 A;  3R7B B;  2RVJ A;  4R8U B;  1VC6 A;  1FTC A;  4X4U A;  3EE3 A;  3JAM Y;  2IDL A;  4OYA A;  5D15 A;  4AL7 A;  2JLG A;  3T1H J;  4YDX A;  5IT4 A;  2ASL A;  4F67 A;  4PPZ A;  1FKA F;  3VAJ A;  3HSJ A;  4AT1 B;  2B8Q A;  3R1H A;  4C7Q A;  2GCF A;  1K44 A;  2D69 A;  4IOA Q;  1IQZ A;  3SQG B;  1DTT B;  5LMU J;  1T9U A;  2UU9 F;  3OL9 A;  2XI2 A;  4DV4 J;  3K5N A;  3UFC X;  3VGU A;  3MM8 B;  2KFN A;  4MIW A;  1M1H A;  4C8M A;  4WFX A;  3CCU S;  3DRX A;  1LEO A;  4WF9 Q;  3ETO A;  4ID5 B;  1RI7 A;  2K3I A;  2HWT A;  2W1B A;  5K14 A;  3LAM A;  1VLO A;  2MZ1 A;  1IM6 A;  4C4W A;  2JZ5 A;  2EFN A;  4LVO P;  3OL7 A;  2V68 A;  3M6V A;  1HLW A;  3O2I A;  4C6A A;  3I55 S;  3BEG B;  4A8S A;  2C3P A;  1KOH A;  1CBK A;  1JLF B;  3CTR A;  4WJB A;  5FLX U;  2DXD A;  2QE5 A;  3DHW C;  1X4C A;  2VFT A;  1IKV A;  4IFV A;  3Q86 A;  1RWP B;  3B4D A;  2RRB A;  2OSR A;  4DL4 A;  1FER A;  3VR1 A;  3KLV A;  2CDR B;  2D7S A;  1VIS A;  3PW0 A;  4FXW A;  3E3X A;  1SJF A;  4DSJ A;  2DYA A;  2JVR A;  4KR0 B;  3MM6 A;  4DQS A;  2HHX A;  1X4E A;  1VRT B;  5KFD A;  1U6B A;  2N3L A;  2ZBI A;  2DGT A;  3R6L B;  2DCU B;  2DNK A;  4ZPA A;  5HVF A;  2Y0B B;  1OQ6 A;  5KFB A;  3FCH A;  2JRS A;  1NDL A;  1YDL A;  2RB7 A;  2VPW B;  4B17 A;  4X66 F;  1FRI A;  3TJ9 A;  2OI2 A;  4TLR A;  2RH3 A;  3HD2 A;  4DV1 F;  1T05 A;  1FXR A;  3T5J A;  2DD8 S;  1TEL A;  2M5Y A;  2YKN B;  1VCT A;  1YWX A;  1WC5 A;  1APS A;  3N01 A;  4ZPD A;  3GIR A;  3CJR A;  1NSK L;  4FYV B;  1HI8 A;  3UCZ P;  4X84 A;  2RML A;  1IKW A;  3DOL B;  5JXS A;  3MCN A;  1Q8B A;  4BLG A;  3LH2 S;  4LIW A;  2MHE A;  2QFJ A;  3NCR A;  5L1K A;  3RBZ A;  4O0I A;  4USK A;  4JI7 F;  1REV A;  3BH7 B;  1R8A A;  3FEY B;  3MR6 A;  2E7W A;  2G13 A;  3M05 A;  4F36 A;  4RNF A;  3BM7 A;  2VFU A;  3C6U B;  2ZFH A;  1TR0 A;  2FZG B;  3UD4 P;  4QR1 A;  1B4S A;  4CRJ A;  4LF5 F;  3KK1 A;  4EGL A;  5AT1 B;  1T11 A;  3CCT A;  2RJZ A;  1T03 A;  1NEE A;  1X0P A;  1NJZ A;  4FF4 A;  3DN9 A;  2V67 A;  2ILZ A;  1N5S A;  1TMM A;  2CJY B;  1FCA A;  1TL3 B;  3OUY A;  4HAC B;  1Q5Y A;  2MEW A;  5DS7 A;  1TZ0 A;  2KM8 C;  1NJY A;  2G1H A;  3BPD A;  2CVE A;  2ZNZ A;  2XWY A;  2WSE C;  2Z30 B;  2XLJ A;  3PIO Q;  3MMC A;  4CLK A;  2PN6 A;  1FJ7 A;  4E2F B;  3VZI A;  1VDH A;  2J8A A;  4Q44 A;  4QIV A;  1JLQ A;  4F50 A;  4YOE A;  4KIA A;  1RT3 A;  2DNP A;  2JFK A;  1QSL A;  5D3G B;  1RYS A;  2MB0 B;  2WOM B;  1HAR A;  3WC2 A;  1AB8 A;  1XR7 A;  2VA3 A;  3FMB A;  4TQR A;  4G1P A;  4DX7 A;  2F65 A;  5CZX A;  1T95 A;  2IY5 B;  1KR4 A;  2R8J A;  4X4T A;  2FJD B;  4K4S A;  4CZC A;  3T6J A;  3DI6 A;  2YH1 A;  5FII A;  4K4X A;  3D1H A;  1H38 A;  4RW7 B;  3HM9 A;  4ZLP A;  4C8N A;  2OFH X;  2LA6 A;  2AYE A;  3C6T B;  2HRU A;  2PMH A;  2Y1J A;  3ADA C;  4WYL A;  5H9F K;  2XS7 A;  3NNA A;  4G3I A;  5T7L A;  1UVJ A;  1ZAW A;  4DSL A;  4TYA A;  3NNC A;  1JJC B;  4XDD A;  1YBT A;  3OTC A;  1RAB B;  3A3P B;  3K5L A;  1AZS B;  1U2R A;  1BLU A;  2QSF A;  3PYF A;  1ZAV A;  2GJI A;  4P75 A;  4G1I A;  4WFN Q;  3P5B P;  4J9K A;  2IA0 A;  4NCG B;  2QFI A;  2UVU A;  3IS9 A;  4PQA A;  3V6D B;  2XB2 D;  2E5J A;  4PG8 A;  1NHU A;  1Y3J A;  3DYA A;  5A0Y A;  2LXF A;  2P6T A;  1T8E A;  3HVW A;  4HR2 A;  1T7P A;  5DG8 A;  2O01 C;  5DG7 A;  2YH0 A;  3T6B A;  4LSN B;  3RU0 A;  3H4D A;  3BN4 A;  2IJR A;  4JOU A;  4ZVU B;  3H98 A;  1URR A;  1EP4 A;  1IBK J;  4KH0 B;  4B3S F;  3QO9 A;  2R7V A;  3HHD A;  3H2L A;  1SL0 A;  1HNW F;  2BJ9 A;  2HEK A;  1Y10 A;  4K50 A;  1H2T Z;  4KYZ A;  5GVQ A;  2Z56 B;  4CP5 A;  4L76 A;  8AT1 B;  1GFW B;  4K8R A;  1UWA A;  3TI0 A;  2ZJR Q;  3GV5 B;  2C1E B;  4J91 A;  3MUT P;  5L38 A;  5HAO A;  1L3K A;  4FZV A;  1RDR A;  4WP8 A;  2YXL A;  3TQE A;  1GMW D;  2OEM A;  2L48 A;  4TYB A;  2OEL A;  3Q83 A;  1Q86 T;  1GTE A;  2XHW A;  3W5Y A;  1XR5 A;  3H2U B;  3UVJ B;  3SSR A;  1K9M T;  3PYG A;  3AQP A;  2ZH6 A;  3CE8 A;  3TEH B;  3SCI E;  4J7C A;  3G6V A;  4I64 A;  4JI3 J;  2OD4 A;  4P7V A;  2IAJ A;  1U2C A;  3I82 A;  2J5A A;  4IG0 A;  4NYP A;  2XZD B;  4ZK7 M;  4K2J A;  2MKI A;  4PXE A;  2HK2 A;  3O5T B;  3MCM A;  2PFD A;  1P6T A;  2QMX A;  1R8B A;  3NS5 A;  4DL3 A;  3G6Y A;  1T3O A;  4DSF A;  3TJ8 A;  2OPS A;  1ZYQ A;  2I9S A;  2RT3 A;  3A13 A;  2B51 A;  2QL9 B;  4ED0 A;  3K57 A;  5A8R A;  5L9N A;  1ZM4 A;  1Q8I A;  3MGJ A;  1DFD A;  4IG3 A;  2HZV A;  2OGU A;  2WSC C;  5I3P A;  4OLP A;  2VQE J;  2DIT A;  1NSQ A;  2XNR A;  1ZS6 A;  3RJM B;  2N4C A;  2DGU A;  3FGV A;  1IM4 A;  1CEZ A;  1RUS A;  3K59 A;  2KTQ A;  4NA2 A;  4HI1 A;  3KG1 A;  3N6N A;  5J1N A;  2I0X A;  2VIH A;  1MSW D;  2HQG A;  2VDI A;  2GV1 A;  3SFG A;  2XC9 A;  2XWX A;  1U1M A;  1WOR A;  2DIV A;  3FMW A;  1G7C B;  4X4N A;  4PAA A;  1FO1 A;  1UVM A;  2RRN A;  1L3T A;  1Y7P A;  3GR0 A;  3JYT A;  2I1R A;  2DTJ A;  3OTB A;  1HNZ F;  1YHQ S;  4DV6 F;  5KFJ A;  5HO4 A;  3UN2 A;  2CNN B;  2M4M A;  2JC0 A;  3EJM A;  5IWA F;  3ENA A;  4OFZ A;  4OYI A;  2NXC A;  4X4O A;  4NLX A;  2KI2 A;  3AAW B;  3NS6 A;  2RSQ A;  1S1V A;  1Y9O A;  1CJV B;  3CME S;  3LTO A;  4Y2C A;  3GB0 A;  1F2H A;  2VIC A;  4NCA A;  1KLM A;  2YWF A;  3FRZ A;  2MQO A;  3OTO F;  4UOG A;  3R1L A;  2RNE A;  3MAQ A;  3DOM A;  5ETR A;  2JH3 A;  4GMK A;  3NMA A;  1SC3 B;  4GO7 X;  2X3G A;  2GVZ A;  3SI8 A;  3FCW A;  1FRJ A;  2WB4 A;  3IG1 B;  3CD5 A;  2ZE2 A;  2CYY A;  3KHL A;  4C0O C;  1N52 B;  3POT A;  1NND A;  2HHT A;  4C2M A;  1S1U A;  3MEG A;  4PWW A;  2B5J A;  2F8M A;  2YNG A;  2HHS A;  3IXQ A;  2IMW P;  3J7Z T;  1FDA A;  4D3H A;  4OI6 A;  1RAI B;  4CLW A;  3JSR A;  2Z4P A;  4ILR A;  2LFV A;  5G4D A;  1EKR A;  1NDC A;  7AT1 B;  2P6S A;  1NZA A;  4C11 B;  4NLD A;  3G4S S;  1BQN B;  3KLI A;  2L3M A;  2HGN A;  3THP A;  4WXW A;  2KHC A;  4C8O A;  3TA2 A;  3KK2 A;  3NGR A;  2VG5 B;  3SCL E;  2D3O 1;  2GMH A;  2AMC B;  2L9D A;  4L3K A;  4U96 A;  2OPR A;  4MIB A;  3MR2 A;  3LP1 A;  1X4F A;  5B0A A;  3RB6 A;  5KFP A;  2FGC A;  3U1L A;  3MUV P;  2EK1 A;  3ZNU A;  2EFP A;  3NCP A;  2CQ1 A;  2EI5 A;  2MKY A;  4Z7C A;  2DR9 A;  4ECT A;  2ZDO A;  1VIX A;  3B82 A;  4OMF G;  3N5F A;  3CD6 S;  1RJJ A;  5F9L A;  1J5E F;  4DN0 A;  2LEP A;  4Z7Y A;  1UWB A;  4OQJ A;  1YJ9 S;  2A1B A;  3JTN A;  3L95 X;  1JXL A;  4EZ9 A;  3AH6 A;  3IWX A;  3PR5 B;  5B0F A;  4C9D A;  5DM6 Q;  2P9G A;  2ZNY A;  2XG8 A;  3PRB A;  3ENQ A;  4DFK A;  2HFU A;  1Z2L A;  4WE1 A;  3SV4 A;  1XNR J;  3CDA A;  4X64 J;  3M9M B;  1IBK F;  2ZOG A;  3W65 A;  3CJK B;  1S6Q B;  4QYR A;  3V4I B;  2VH7 A;  1RTI B;  4YQW A;  1XC9 A;  4USM A;  4N5S A;  2FC9 A;  3KHG A;  1X8D A;  8RUC A;  3OQ2 A;  2X51 A;  1QM9 A;  4FS2 A;  1U45 A;  2P5V A;  3EPI A;  1NB2 A;  2YNH B;  3GTY X;  3TUP A;  4DSI A;  4JUZ A;  4KPY A;  4M5N A;  2KXN B;  4C3M A;  2PGC A;  4R0E A;  2EKN A;  4A8F A;  1U0H A;  1FKP A;  2YBV A;  3G71 S;  4W90 B;  1DLO B;  4U6P A;  4LF8 J;  2CPZ A;  5DJB A;  5HVG A;  5D78 A;  3H20 A;  2V8P A;  1C0U A;  3V6K A;  2AJF E;  4JI3 F;  2G2Z A;  4ZCK A;  3CW2 C;  5T41 A;  2P9E A;  2NXJ A;  4Z37 A;  2W7A A;  3QAT A;  3BH6 B;  3EZ5 A;  4I67 A;  2DEJ A;  4ECY A;  2MTL A;  2XMK A;  1JXE A;  1BHN A;  3CJQ A;  1G2E A;  4J9O A;  4Q0B A;  2OO4 A;  5IV3 A;  4L74 A;  5HAN A;  2XYG B;  4QIW D;  1WTB A;  2KG1 A;  1RT5 B;  2PE8 A;  2GVD B;  3MOZ A;  3W9H A;  3KK3 B;  4I4B A;  1HHQ A;  2UXC F;  1K73 T;  2XLK A;  1VK3 A;  2XY5 A;  2ZHO A;  1NKC A;  2X3D A;  4YB5 A;  5IM0 B;  1YJW S;  4CNY A;  3KLE B;  3H25 A;  2MPU A;  2DNZ A;  4ZVR B;  1SXL A;  3BN7 A;  1NKB A;  2BYC A;  4NLQ A;  5EUH A;  3RAM A;  3TQ1 A;  4IO1 A;  2MQ8 A;  2ZKT A;  3AFG A;  3ULH A;  3MM7 A;  4GKJ J;  2E5L J;  1UA0 A;  3TAM A;  2PEH A;  1ZET A;  1V3R A;  3P49 B;  4GRS A;  1Y5L B;  2R9L A;  1LW2 B;  3TOQ A;  2FJE B;  3EGN A;  2A18 A;  1WC1 A;  9RUB A;  5HP1 B;  4ANC A;  3T3F A;  1EAR A;  4V1A k;  4UF4 A;  1SUQ B;  3JSB A;  3R3T A;  2W2M P;  3HO1 A;  4KV8 A;  4L75 A;  3BKF A;  1Z1Z A;  1LV5 A;  2AU0 A;  3GU0 A;  1RT7 B;  1FT8 A;  2JL9 A;  4QWC A;  3CD7 A;  4A8X A;  2MQM A;  4AFF A;  4ECR A;  5J2N B;  3Q22 A;  1S1T A;  1BMQ B;  1B0P A;  1H7W A;  3EVO A;  4IOB A;  4TNO A;  2MMY A;  4QU7 A;  4ZCL A;  3P45 B;  2D1C A;  2WAQ D;  2ZVI A;  2ZIT A;  3LA0 A;  3GR1 A;  3J7A 1;  4JB8 B;  2QEX S;  4ZS6 A;  1KC8 T;  1NLK L;  4PXC A;  1YK9 A;  1IKX B;  2XMA A;  1FNX H;  4ED7 A;  3OFH A;  4LFB J;  2QN6 B;  3LPY A;  1IBL J;  1NH7 A;  1X7V A;  4KHP J;  1FFS B;  2VKZ G;  3AJD A;  5E3C A;  3H90 A;  1OIA A;  4X4R A;  3JQK A;  4CH7 A;  1UPP A;  3BJY A;  1VC5 A;  2RKI A;  4CLS A;  4RUB A;  3IRX A;  4DR3 J;  3Q23 A;  2MZT A;  3TRG A;  3FK4 A;  2RD5 C;  1X4A A;  1JLB B;  2B7B B;  2ADC A;  2CQ2 A;  5HBM B;  4QCL A;  2ZBC A;  4PUO A;  2RIL A;  5HJY A;  4U7U D;  5KG2 A;  2DXE A;  5A76 A;  3QAE A;  1U47 A;  1RWX B;  4OYM A;  4JI6 J;  1W26 A;  3OR2 B;  2HMI B;  4ZVH A;  2LEB A;  5KFF A;  3BKT A;  1S48 A;  4Q8E A;  2BJE A;  2LMI A;  2XO7 A;  2JEJ A;  1SBR A;  1FA0 A;  3ET6 B;  2BJ7 A;  2X1G A;  5C2C A;  2V2V A;  2RF2 A;  1S97 A;  2HS3 A;  1YJU A;  4DHV A;  2V63 A;  2OMO A;  4Q43 A;  3PHE A;  5GMD A;  5E33 A;  5KG3 A;  2MGZ A;  4JV2 A;  4NLG A;  2D3Z A;  5L1I A;  4KPC A;  2HPU A;  2V4R A;  1XNR F;  2HFO A;  2RS8 A;  2MJN A;  3D67 A;  4LF1 A;  1TKD A;  2KKH A;  4TQS A;  5A8K A;  3BF4 A;  2M88 A;  4MKY A;  4RBT A;  3KLF A;  2EBG A;  3NOC A;  1UPM B;  1GQE A;  3W66 A;  3SSQ A;  4ECW A;  3SCK E;  3TZW A;  2W01 A;  1FE0 A;  2W24 A;  4KFB B;  3I6P A;  2DRA A;  3I96 A;  1XNQ J;  3NGU A;  3RR7 A;  2FPH X;  3LP2 B;  3GLJ A;  5DET A;  5HRO A;  2RAQ A;  3AD8 C;  4YR3 A;  4EUV A;  1RT6 B;  3NY0 A;  1SJ3 P;  1AFJ A;  4DR2 J;  4JI4 F;  5K8M A;  4LF8 F;  3GWC A;  1A9N B;  1NXI A;  4QR2 A;  1BUX A;  3HVA A;  3C15 A;  4KB7 A;  1S1X A;  2R4F A;  1U6Z A;  3K2Y A;  2QX0 A;  4B9S A;  3DRS B;  2A2D A;  2OUG A;  5CAB A;  3MXH P;  3FVY A;  2RE1 A;  4I2Q A;  4WP3 A;  4FS1 A;  2VQF J;  1JLG A;  4GVB A;  4RBV A;  5ETM A;  4X4P A;  2Z2M A;  4Y2M A;  4ZP8 A;  1C1B A;  2JOQ A;  5KFT A;  1CS4 A;  3SDE A;  3TW0 A;  3MPV A;  1LWE A;  4F0K A;  2QA4 S;  2VZ9 A;  5F8N A;  3TR5 A;  1UTA A;  1IQT A;  4ZPT R;  3MEE B;  5DZ6 A;  5KT4 A;  4NWB A;  3Q24 A;  4PXB A;  4NRT A;  1FXD A;  1PAE X;  2VA2 A;  5KFO A;  3IO1 A;  1C1C B;  2YQ3 A;  3H2V E;  3CNQ P;  1V3S A;  5F3T A;  2A6O A;  4K7Q A;  1HD0 A;  5IS2 A;  1NKE A;  2W2O P;  1VHI A;  1NHV A;  4TN2 A;  4PPD A;  1KS2 A;  2GMJ A;  3FSI A;  2K1R B;  3RW7 A;  3HHL A;  1JLE B;  1S7H A;  4EWT A;  5D4O A;  3M30 B;  2J9C A;  4GKJ F;  3VQT A;  4OZ5 A;  3LGN A;  3LAK A;  1G4C A;  5EHH A;  4KO0 A;  3M8P B;  2ZUA A;  3TA1 A;  2ZWP A;  1OQ3 A;  3B78 A;  3M32 B;  2MJU A;  4ZPB A;  3PTW A;  1N5Q A;  3NL0 A;  2C2Z B;  4R8U A;  4J9M A;  3OT9 A;  5ETT A;  1KRP A;  1SJQ A;  5KFS A;  4G65 A;  1XWL A;  1VYA A;  4RUC A;  1DBD A;  2QA1 A;  4EFA C;  2KYZ A;  2E1M C;  5AXK A;  3OTE A;  4EEY A;  2VU5 A;  4DG1 B;  2F5G A;  3IFE A;  5J1E A;  3BO2 A;  2VBZ A;  4H54 A;  3VAK A;  5EDW A;  3PO5 A;  3X1L B;  2FHJ D;  4ITS A;  3VQS A;  3ZXW A;  1K0T A;  1QAJ A;  4IR1 A;  2HRY A;  4FVC A;  3SQG A;  1DTT A;  2QTW A;  3HZG A;  3H8Y A;  3QGP A;  2BXJ A;  1O8B A;  1HD1 A;  2K7K A;  4OZ2 A;  1FDB A;  3MM8 A;  1O0P A;  3P96 A;  2V94 A;  5KFU A;  3ZTR A;  2GQC A;  4K4Z A;  4LFB F;  3RYL A;  4ID5 A;  4C3L A;  2HQD A;  1DUR A;  2J7U A;  5K20 B;  1U1N A;  1W7W A;  1W2B R;  3GV7 B;  2CFX A;  4IH5 A;  4C8Z A;  1JLC B;  4MJK A;  2ZH8 A;  4J9N A;  2MZS A;  1C4C A;  1T9W A;  2YWE A;  3H0P A;  3W61 A;  2H4Y B;  4A46 A;  2ZZN A;  1RTJ B;  2NRE A;  4O0N A;  4DR3 F;  2HLU A;  2GW8 A;  1BC6 A;  5AE2 A;  1RT1 B;  2A0F B;  1NHK L;  1JLF A;  3BO4 A;  1QTN B;  4AUK A;  2KXF A;  5JVH Q;  2QMU B;  1VQ7 S;  5LSL A;  2VV5 A;  4KGM A;  4KT0 C;  2A2C A;  3MUR P;  2WBM A;  1RQ0 A;  5DLG A;  4UUX A;  4A8Y A;  3FZ2 A;  4LUB A;  2F4V J;  2A6M A;  2HVZ A;  4F4X A;  3AOB A;  5KT2 A;  3BGF A;  3R6G B;  1TK8 A;  2WVB A;  1P9Y A;  2V4J B;  5G0R B;  1GXL A;  4MKB A;  1VBZ A;  2I2Y A;  3PCO B;  3JSM B;  3H40 A;  1VRT A;  3NP5 A;  5F8G A;  2QIF A;  1U1R A;  2IM2 A;  5F8M A;  5DGB A;  1S7I A;  1QAY A;  3RRH A;  3CWJ A;  4ANE A;  2ZWO A;  3BPS P;  3UNY A;  4J9L A;  3JS9 A;  5DG9 A;  3GSD A;  1FXL A;  1YJ7 A;  1FDN A;  2ZJP Q;  4NLR A;  1XNQ F;  1RTH B;  1NH8 A;  4NXM J;  5L1L A;  3LPE A;  2YKN A;  4ELT A;  4C8K A;  3C14 B;  2K8G A;  4DPT A;  1NB7 A;  1RWU A;  2LU1 A;  1S0V A;  1RBL A;  3JB9 k;  2EFQ A;  2XMT A;  2XQC A;  1CSJ A;  3GMG A;  3CMA S;  1TU0 B;  4DV0 J;  4ZIV A;  3HJV A;  2NYH A;  3BRE A;  2XM3 A;  3QT5 A;  4E98 A;  1NU4 A;  3SIP B;  3DOL A;  1XN9 A;  3QPI A;  2Z57 B;  3W2W B;  3CXC R;  4TU8 A;  4IQM A;  4MKA A;  4JI2 F;  1TMJ A;  2R8K A;  4F4Y A;  1R43 A;  3W60 A;  1RWW B;  3CC7 S;  2AZ1 A;  3KLG B;  3DXB A;  4NXN F;  3J7Y U;  1DQ8 A;  5IC4 B;  2JJ4 D;  3C6U A;  1U02 A;  5A2Q U;  1AUS L;  5HLF B;  1E6V B;  4P72 A;  2VOO A;  4KQZ A;  5FJ4 A;  5BYS A;  4ECQ A;  4QQB A;  1VRU B;  2H5E A;  3ZC4 A;  1Q53 A;  3HXM A;  3M1V B;  3VV2 B;  3FSY A;  2EEY A;  3VGV A;  1EX8 A;  4A8M P;  4MT1 A;  4IFY B;  1T9X A;  3P6Y C;  4BDP A;  2HND B;  1DAX A;  2HFS A;  2J6U A;  1TL3 A;  3CCM S;  4X4V A;  1YX2 A;  3D5M A;  4HAC A;  4AXJ A;  3NGD A;  2IA6 A;  2XHC A;  2WON B;  4R0J A;  1AUD A;  3GIK A;  2KN4 A;  1GNK A;  2RQC A;  3WIU A;  3VAF A;  2MKS A;  2E1A A;  4OL8 A;  5ETK A;  1HPZ B;  4HVZ A;  5F41 A;  1AA1 B;  3GFY A;  4DSK A;  2VB6 A;  2RHQ B;  4F3M A;  4UZC A;  3VWS A;  4FYD A;  5D3G A;  3I5C A;  2PT0 A;  1IVZ A;  2WOM A;  2Y1I A;  2MZQ A;  1OPI A;  2QJ3 A;  5B0G A;  1IBM J;  1ZM9 A;  2OKQ A;  5GAD U;  3KUH A;  1VJW A;  3MMJ A;  3M8W A;  2V2Q A;  4DQQ A;  3QLH B;  3GIM A;  2OEJ A;  2HS0 A;  1NCL A;  4RO0 A;  3BGR B;  4WK1 A;  2VG7 B;  3D54 A;  3DNC A;  3D28 A;  5IQ6 A;  3BZQ A;  2Y9H A;  3IR7 B;  1DZ5 A;  3C6T A;  5L46 A;  1FFW B;  2CJK A;  2CJA A;  4B3O B;  4I0W A;  3WX8 A;  2DIU A;  2GHW A;  4YB1 P;  1AZS A;  3PHT A;  2CQB A;  4USU A;  2MKJ A;  2OLW A;  3K7R A;  4PR6 A;  4X4Q A;  3OR1 B;  3PJX A;  4NCG A;  2MQP A;  1WOS A;  2K3K A;  4GC6 A;  2HIQ A;  3V6D A;  5E2Q A;  1PYS B;  1RHU B;  1FNM A;  3BYR A;  2ZC4 A;  3V6J A;  3VCD A;  1PJ5 A;  3MAH A;  1RHK B;  3VHQ A;  1DTQ B;  1BQM B;  1OWX A;  3DLJ A;  1KVI A;  2GNK A;  4UOH A;  2YX1 A;  2HWH A;  4LSN A;  2XGQ A;  2UUA F;  4HDG A;  5U47 A;  2OHD A;  4PQU B;  5DQH A;  4EK2 A;  2ROP A;  2XO6 A;  4ZVQ B;  4FYW B;  3LOU A;  3UDL A;  5CAA A;  3I4H X;  2H3E B;  2I5J B;  1FVQ A;  1KFS A;  2HFV A;  3GJS B;  2IBO A;  1H7X A;  2HGM A;  3UDV A;  3AD7 C;  3RBX A;  2MY7 A;  3O3L A;  3R2D J;  2BAC A;  4IRC A;  3BKU A;  4K0K J;  1RAE B;  3QGI A;  3DGP B;  2CDQ A;  2NXN A;  3CJ2 A;  2V2K A;  4YR2 A;  2F4V F;  1YBA A;  2HK3 A;  4QWD A;  1QE1 B;  4F0H A;  3GJT B;  1QAX A;  2BJ3 A;  3BDE A;  1VHF A;  4CT8 A;  4HKQ A;  3MTK A;  4WZQ A;  1F1B B;  2KL8 A;  3E01 B;  3UVJ A;  3MWB A;  1VMB A;  2PMZ D;  1HMV B;  3D66 A;  5EWG A;  3B54 A;  3CCR S;  1QJH A;  4YEA A;  4DV3 F;  1ZZN A;  1LK5 A;  3K8W A;  2XLI A;  1WI8 A;  2L9W A;  4J90 A;  4DMZ A;  1R31 A;  1RK8 A;  2R7U A;  2WSF C;  1FVS A;  3L3C A;  5LMN F;  2DGW A;  2AZ3 A;  3K58 A;  5FDL B;  3SCJ E;  4DF4 A;  2QV6 A;  4DWI A;  2AJ1 A;  2GIR A;  2FVC A;  2YKP A;  2DH8 A;  1Q5V A;  2XMJ A;  2PII A;  5MAO A;  4XAK A;  2KRR A;  2GGP B;  3UN3 A;  4B3M J;  2CRL A;  3QGG A;  1KQF B;  2HBR B;  2CPE A;  1SI9 A;  3HDS A;  5J2M B;  4DFJ A;  2JSX A;  1M1G A;  4G1Q B;  2HHQ A;  5B0E A;  1WKJ A;  3CJ0 A;  2R7S A;  2CJB A;  4PXD A;  5AJ3 F;  4WPA A;  3NNH A;  5KTQ A;  2PA8 D;  4IKA A;  2DHX A;  3I56 S;  2KVQ E;  5JUM A;  3SZ2 A;  2XSJ B;  4M94 A;  2FGO A;  3W63 A;  1U24 A;  4AL5 A;  2OML A;  1MML A;  2C2E A;  4LF6 F;  2Q6C A;  2N4D A;  3TAP A;  2BVZ A;  1P1L A;  3PYD A;  3CCW A;  2YNI B;  2F63 A;  2PC6 A;  4WWS A;  4CM2 A;  1IKY B;  2VFS A;  2QYC A;  4ZVE A;  1PJ7 A;  3R5A A;  1S5Z A;  3AA9 A;  1TAQ A;  4N77 A;  5EX0 A;  3MEK A;  2NXU A;  4HEA 9;  1OY8 A;  3IP0 A;  4DX8 H;  5CYQ B;  1CJV A;  3CO9 A;  4DV5 J;  1LWC B;  5D0H A;  5ITH A;  2W25 A;  1HHS A;  1SPB P;  4C98 A;  3DC2 A;  5IT9 Y;  1X4B A;  4CO1 A;  1KNZ A;  3MR3 A;  5DDO C;  1XK8 A;  3EGZ A;  3GJR B;  4B02 A;  3RAX A;  2VAS A;  5J2P B;  2BE9 B;  3FRY A;  3BV8 A;  2N7Y A;  3IG1 A;  1IBC B;  1N54 B;  1WC3 A;  2KG0 A;  2LXU A;  4ZDN A;  2ROG A;  4LF7 J;  2AX0 A;  1FWP A;  2IRY A;  1OSD A;  1NPK A;  4J9V A;  2DRD A;  4NLT A;  2DB1 A;  3OFE A;  1G1X A;  3OXF A;  2CPF A;  2E5I A;  2KT3 A;  4RNN A;  5B7W A;  2EFO A;  4OX9 J;  4LBP A;  3R5C A;  1FKO B;  1UET A;  4C11 A;  1BQN A;  3ENW A;  2R8H A;  4I69 A;  1VLY A;  4CO5 A;  1RAH B;  3Q8Q B;  4DV7 J;  2Q66 A;  4B9T A;  1FK9 B;  2C2N A;  2VG5 A;  1Z4U A;  3PAC A;  3G9C A;  1MN9 A;  4KAI A;  3CCQ S;  3HSD A;  1TAU A;  3RAQ A;  3P8B B;  1IR0 A;  3DXS X;  3GZ7 A;  3WQP A;  3GG0 A;  3UE2 A;  4I6W A;  3DHX A;  3J81 U;  2H54 B;  1BXN A;  1VQP S;  2KT2 A;  3D7S B;  1KHW A;  5KFW A;  3HFK A;  3FBB A;  4QR0 A;  1FJG J;  2A10 A;  3UNG C;  4P7T A;  4C97 A;  5D0E A;  4M5I A;  2VC0 A;  5F3Z A;  3E51 A;  2ZH1 A;  4DPU A;  5EGY A;  1TL5 A;  1QSY A;  4ZIW A;  1DY3 A;  1OY9 A;  1PIE A;  2IC3 B;  1TK0 A;  3CJK A;  1S6Q A;  2C28 A;  3V4I A;  4RNO A;  1RTI A;  4I6Y A;  1Q7L B;  4UQT A;  3IM8 A;  2V2Z A;  1LFW A;  3FBC A;  4NLU A;  4K0K F;  4ALZ A;  2YNH A;  3BBB A;  2HBZ B;  5CYM B;  4LF4 F;  4Q7A A;  4R25 A;  2AIR B;  1U8S A;  1QUP A;  1RT2 B;  1MU2 B;  1X31 C;  2CZ4 A;  3SYZ A;  1HBO B;  4V19 J;  2XCP A;  3F56 A;  4CH1 A;  2ZH3 A;  4D3G A;  1HWU A;  1DLO A;  4UOC A;  3OFG A;  2DO4 A;  1FX4 A;  1Q0N A;  2GC8 A;  1SKR A;  2YPY A;  1K47 A;  2M70 A;  3QQC D;  1MN7 A;  2RQM A;  1CG2 A;  4AYB D;  1D9D A;  2YQ1 A;  2DH7 A;  1R89 A;  2IRX A;  4USV A;  5D4P A;  3SMZ A;  2F1F A;  2D9P A;  4UT4 A;  3E2E A;  3FFI B;  4K5S A;  1HQE B;  1CLF A;  1WKK A;  1WG1 A;  1Y5I B;  2BOA A;  4LFC J;  1F6T A;  3P5T L;  1RKJ A;  4YB7 A;  3OTD A;  4DFM A;  4X62 F;  5M2R A;  2OTL S;  2BBE A;  1BD6 A;  2JX2 A;  4A8W A;  2CNL B;  1VC0 A;  4B3M F;  3A8K A;  4DCP B;  1RT5 A;  1H74 A;  4B3T J;  2GVD A;  3KK3 A;  4YDD B;  8ATC B;  4AQY F;  4F4Z A;  4FNH A;  4OX6 A;  1EQ0 A;  5IM0 A;  2IJN A;  3KLE A;  4ZVG A;  4N8N A;  3K17 A;  1F3V A;  4RBU A;  4Q45 A;  1S9F A;  1J5O A;  4OZL A;  4X65 F;  2FLL A;  4DFP A;  5GAD I;  3KUG A;  1TL1 B;  2DNO A;  1R0A B;  3OFF A;  1FEH A;  1FD2 A;  2R2R A;  1HL6 A;  2NPF A;  2KU7 A;  2XYP B;  4I1T A;  4MK8 A;  4W92 B;  3IAS 9;  5C42 B;  2C3U A;  1LW2 A;  3TUJ C;  2R3V A;  2LLZ A;  4BBY A;  3RRG A;  5HP1 A;  2BW2 A;  3PO4 A;  4I7F B;  5KFY A;  1H3D A;  1SUQ A;  4LF9 J;  1Q81 T;  3K8V A;  3BYP A;  1N32 J;  2HGL A;  2MLY A;  3LP0 B;  1FE4 A;  2DEI A;  2QLW A;  3D0H E;  2KJW A;  1YVF A;  1RT7 A;  4RR5 A;  2M9K A;  4QWA A;  2YNF B;  1KKH A;  3KLH B;  1CJT B;  4LIR A;  1WOP A;  2ACY A;  5J2N A;  4XTT A;  3ZZR A;  1QVG R;  5IOL A;  4M5K A;  4DV5 F;  3N4W A;  2FDN A;  1U48 A;  5K5M A;  1BE4 A;  2XY6 A;  4NMX A;  2HLT A;  4USI A;  2DHG A;  1YI2 S;  2PA3 A;  1MMN A;  4RW8 B;  2ZM6 F;  4UQG A;  3A12 A;  1T9Y A;  1S99 A;  1I3O B;  1R7I A;  1S12 A;  1KFD A;  2MQN A;  2BW7 A;  4RU9 A;  3N9U C;  4F26 A;  3AOA A;  3J7Z 5;  1IKX A;  3DOK B;  4M5L A;  3UDC A;  4ZMM A;  1ZPV A;  3DDK A;  1KD1 T;  3MMA A;  1VS3 A;  5ETP A;  1T9V A;  1YRT A;  4WXO A;  1UVL A;  1SQE A;  4Y65 A;  1NRK A;  3UPF A;  4BWJ A;  1KVK A;  2YWH A;  1WG4 A;  3DU5 A;  1NK7 A;  4EO8 A;  3US5 A;  3M8S A;  1JLB A;  3FSX A;  2AJ2 A;  5HBM A;  4CLT A;  5L1J A;  1HA1 A;  4DN9 A;  4JI8 F;  4Q5V A;  2Z8Q A;  3FQK A;  5HVH A;  3AOD A;  4OI1 A;  4DV7 F;  2YWK A;  3FBF A;  4CLY A;  3EZO A;  1IWG A;  2E1P A;  3OR2 A;  3OL8 A;  2HMI A;  2J9D A;  5A8W B;  1TL7 A;  3PXG a;  3OLB A;  2HW3 A;  4FP9 A;  5KT3 A;  3QJL A;  4BS2 A;  4NA3 A;  1OO0 B;  4KJI A;  3ET6 A;  2C2M B;  5HQ8 A;  3CCS S;  1JJ4 A;  3I0S B;  1CPZ A;  4ZP6 A;  4OJG A;  4WZM A;  4PRF A;  3L7P A;  2QLF B;  2JWN A;  2W9C B;  1FX2 A;  2GS8 A;  4N56 A;  1RHQ B;  1MRO B;  1LFP A;  2VOP A;  3H5U A;  2C42 A;  1KSP A;  4OYP A;  3DGV A;  3DLE A;  4O44 B;  3TWZ A;  4NLY A;  3QSY B;  4QWB A;  2BDP A;  2DT9 A;  1SIW B;  1EZZ B;  4O23 A;  3CF5 Q;  2WW8 A;  4A4J A;  5C2G A;  3LP2 A;  4RKU C;  4CLF A;  2PO4 A;  3X3U A;  1N48 A;  3OSN A;  3CCZ A;  5KOX A;  4KSE B;  2B7C B;  1RT6 A;  5CXT A;  2DH9 A;  2DKO B;  3EDR B;  2V34 A;  2W2Q P;  1TUG B;  1JWW A;  1UAW A;  2R7O A;  3VF0 B;  1WEX A;  1E6Y B;  3HVT B;  3DLG B;  1WD6 A;  4J9P A;  3TP2 A;  1ZH5 A;  1HW8 A;  2HHH F;  3KFW X;  2K2P A;  3DRS A;  3M2R B;  3F0N A;  2HZC A;  4DX6 A;  4RUH A;  1U49 A;  2GHP A;  4R5P B;  2COL A;  1RWN B;  1UKU A;  4H4M B;  2IM0 A;  2HQI A;  4LFC F;  4WP9 A;  3FJ2 A;  4ZLL A;  2CPJ A;  4URQ U;  2XBP A;  3R97 A;  1B70 B;  4K4W A;  4IRD A;  5DDR C;  3I31 A;  4RW9 B;  4RW6 B;  1FNO A;  2F3J A;  3UW1 A;  3LW5 C;  3GG1 A;  3EWG A;  3MEE A;  1L3S A;  2G2O A;  2PSZ A;  5KFX A;  3PM9 A;  2UVV A;  4ZIT A;  4DUT A;  3GFH A;  1C1C A;  3QJP A;  4KGX B;  3M8Q B;  3THT A;  3PDN A;  3K5O A;  5IFM A;  2NZ4 A;  4ZPV R;  1CUL B;  1FRK A;  4DJB A;  4ED8 A;  1F9F A;  5B0D A;  2VBY A;  2K1R A;  5EX3 A;  1JLE A;  1N5Y B;  2V6A A;  4B3R J;  1WEY A;  3OJS A;  3M30 A;  2BX6 A;  3QZ8 A;  3L7O A;  3LGH A;  4L6V 3;  4OJH A;  4OIX A;  1EB0 A;  5D0G A;  3M8P A;  3MEC B;  4K2X A;  4EBE A;  1UFL A;  3BS9 A;  1I94 F;  3NWR A;  1RU2 A;  4WTY A;  3D6T B;  1KWM A;  3D9B A;  3G86 A;  1RCX B;  3CDE A;  1HBU A;  1M5O C;  4A47 A;  1Y3K A;  4OX7 A;  1PBU A;  1SJR A;  2O3D A;  3PJW A;  2KH9 A;  4DQR A;  4XDC A;  1ULR A;  2LQ5 A;  4CO3 A;  4JYA F;  3R9L A;  1JIH A;  3M8Z A;  2YX7 A;  4DG1 A;  4B9N A;  3AXK A;  2EFV A;  2ZC3 A;  2B4O A;  3BGU A;  4LRC A;  1REG X;  3R5J B;  4Y3C A;  3BBC A;  3DLB A;  1U1P A;  2DY9 A;  3AQO A;  1EET B;  2HHV A;  3KUE A;  2ASD A;  2Z58 B;  3VTI A;  1NBE B;  1EAY C;  1WOO A;  2MKC A;  4AL6 A;  2N82 B;  2IM3 A;  4XPE A;  2DNG A;  3W5Z A;  3I5B A;  1V5I B;  2YWG A;  4FF1 A;  3DDI A;  2R2T A;  5ETL A;  1SC4 B;  2AJQ A;  1L3V A;  1BGX T;  4P9S A;  3KNG A;  3PRV A;  2V9W A;  3QAU A;  1CC8 A;  1JLC A;  4JV5 J;  2EWH A;  3CPW R;  1RTJ A;  1N5T A;  1D09 B;  2U2F A;  1IR1 A;  3NEK A;  2JC1 A;  3LAL A;  3CD0 A;  4LRE A;  3OVA A;  1RT1 A;  3NXZ A;  2LXI A;  4I56 A;  4DV2 F;  2BR0 A;  5EN1 A;  3LQV A;  1UEK A;  3I87 A;  1X60 A;  3CMQ A;  2HQ3 A;  3SSS A;  3MDF A;  1NME B;  3CC4 S;  3J81 j;  1FJC A;  5GAG U;  3FC9 A;  1UA1 A;  1FDD A;  3GCX P;  3FKB A;  2X1B A;  3D6F B;  3TJA A;  2WK4 A;  4ED5 A;  2AYG A;  1WKL A;  4ZVS B;  2V4J A;  4F8R A;  5G0R A;  2BJD A;  1FD8 A;  5E3A A;  2ADB A;  1PSD A;  3T1H F;  3JSM A;  2ZEJ A;  3CCL S;  2BE2 B;  4DU8 A;  2EG2 A;  1HIY A;  1Y5N B;  2E1R A;  4F4A A;  4PCQ A;  1WWH A;  3G82 B;  9ATC B;  1CQM A;  4KHR A;  1TKT B;  4GC7 A;  5IT9 U;  5KG7 A;  1Y4Z B;  5LMU F;  2KM8 B;  1QY7 A;  2IYG A;  4QZV B;  3TAQ A;  3KDN A;  4DV4 F;  2XYH B;  1ROF A;  3D4J A;  1K1Q A;  2EC2 A;  4DR7 J;  4F7V A;  4DL5 A;  4DL6 A;  3UR0 A;  1NJX A;  2FC8 A;  1A7G E;  3M2V B;  1R3N A;  3M6W A;  3SQO P;  1OSC A;  1RTH A;  4KKO B;  4ILM A;  5DDP C;  2ALY B;  3C14 A;  3M9O B;  3FNN A;  5I42 B;  4DLE A;  3RB0 A;  5K9F A;  5D4N A;  3E8O A;  1O5J A;  2ACM A;  4V19 X;  5KFC A;  4ZPC A;  2XNQ A;  5JVG Q;  4XO0 A;  4B9V A;  3KDO A;  3BSO A;  4HHH A;  5MLC V;  3W2W A;  1RAG B;  3KJF B;  2OAU A;  2Y1R I;  6FDR A;  4FYX B;  3KMS A;  3DRR B;  2M0G B;  1M5K C;  1WG5 A;  4TVA B;  1VBY A;  1PIL A;  3HKW A;  2DR5 A;  3KLG A;  4OZ1 A;  1U0H B;  4H4O B;  2DJW A;  4IH6 A;  1Q82 T;  1RIS A;  5HLF A;  1E6V A;  2GA7 A;  1KHV A;  2MKK A;  1K1S A;  2CJX B;  2LYV A;  4DR1 J;  2O67 A;  2UZA A;  3H4B A;  1VRU A;  3N28 A;  2P9C A;  3R7S B;  3M1V A;  5J1P A;  2ASY A;  4IFY A;  2GQQ A;  2UXD J;  1LQ9 A;  2DHS A;  3OVS A;  2DK2 A;  1P8G A;  2C2D A;  3HHK A;  2R8I A;  3N6L A;  2WON A;  3IM9 A;  4XPC A;  2W9A A;  3H59 A;  3T19 A;  2BM0 A;  3IAM 9;  1HPZ A;  3GE9 A;  2HVI A;  2ATC B;  2E44 A;  3HT0 A;  1XMO J;  3OD2 A;  2WB1 D;  2ZZM A;  2YY3 A; 
#chains in the Genus database with same CATH homology
 2WVC A;  2HZV A;  2PC6 A;  2HZA A;  3BKU A;  2WVD A;  2CAJ A;  2BJ7 A;  2Y3Y A;  3QSI A;  1Q5Y A;  3LGH A;  2BJ9 A;  2F1F A;  3BKT A;  2BJ1 A;  2FGC A;  3BKF A;  3OD2 A;  2WVB A;  2WVE A;  2BJ3 A;  3PHT A;  2BJ8 A;  2WVF A;  1Q5V A;  2CAD A;  2NZC A;  2CA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...