1WC0A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
198
Chain Sequence
SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 59
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc0A00
1FX2A 1WC3A 1YBTA 4OYMA 1U0HB 4P2MA 1WC0A 3MAAB 3ET6A 4NI2A 1TL7A 1CJTA 3C14B 4USVA 4OYZA 4P2FA 3C16B 1AZSA 5IV4A 1CS4A 1CULA 2W01A 4OYIA 1WC5A 1CJVB 1CJUB 4OYOA 1AB8A 3UVJA 4CLYA 1YK9A 5D0RA 3R5GA 3MAAA 1FX4A 4OYAA 4WP9A 5IV3A 4CLKA 4CLLA 2GVDB 4CLWA 4CM0A 4CLPA 1CJKA 2QV6A 4CLUA 1CJVA 3C15B 4OYPA 3G82B 5D0GA 1WC4A 1WC1A 1U0HA 3MR7A 2WZ1A 4USTA 3ET6B 4NI2B 1TL7B 1CJTB 4P2XA 3C14A 4CLZA 4WP8A 3C16A 4OYWA 5D0HA 1CS4B 4OZ2A 4CLSA 1CJUA 3G82A 1YBUA 3UVJB 2GVZB 4USWA 5D0EA 4OYBA 4CLTA 1WC6A 4WP3A 4OYXA 4WPAA 2GVDA 4CLFA 4CM2A 5D15A 4OZ3A 1CJKB 1Y10A 1Y11A 1AZSB 4USUA 1CULB 2BW7A 2GVZA 3C15A
chains in the Genus database with same CATH superfamily
4F0KA 2CNLB 4RX6A 1EP4A 1HNVB 1BGXT 4IH7A 3AA9A 2F5GA 3EXCX 4U95A 1RAGB 4O3RA 2KRBA 5CD4A 4U67Q 3S7RA 1RTJB 3EPGA 4C48A 3QWUA 1VQYA 3KLIA 4URSA 4UOHA 3UDEA 4JYAJ 5CYJA 2ZHOA 1RT3A 4LF2A 5HAOA 3SMZA 2R2RA 5BYRA 4X62F 3ET6B 1YRUA 4ECQA 2IJNA 2N7YA 2IMOA 4USKA 3R1HA 1C1CA 4UUWA 4C97A 1S6QA 1OPIA 2QX0A 5CZXA 2KJWA 3ZC4A 1NB2A 3PYDA 5IC6B 2DNMA 3GTYX 5HSPA 5L39A 1XNRJ 3M8QA 4ZOSA 3PR5B 3AH6A 2DHAA 1TFYA 2DHXA 3G6XA 1XMQJ 3PXGa 4BCAA 3M2RB 5KFCA 5L1KA 1YJUA 3ULHA 4ER8A 5D6GA 5KFBA 3NG8A 3NAHA 1LEOA 1HNZJ 4TNOA 2R7OA 1YGYA 4LBHA 1S5ZA 3MD1A 3I5AA 2ZD1A 5CAAA 4J9MA 2JFDA 2KVQE 4Y0FA 2FZGB 5DM7Q 1CEZA 1HW9A 4CLPA 3VAIA 1LNQA 3UN3A 4WBFA 1P1TA 2W7AA 3BH6B 1SJ3P 4LF9J 4P71A 2FVRA 1HNXJ 2M3DA 3V6DA 3MD3A 2G0JA 1FKAF 3AD8C 1WI8A 1VRUB 1NKEA 1TMJA 4OYWA 2MY8A 2VJVA 3SYZA 3NL0A 1JX4A 4OI2A 2KJVA 4D3HA 4C8MA 2MGZB 1U8SA 3N0VA 5KG3A 1X60A 2B6AB 3F0NA 1EX8A 3TEGA 4C3LA 4IG3A 3G8TA 5B0AA 4H4MA 3M8PA 4RLEA 1X9WA 1ZTTA 2YVSA 2KRRA 1SCJB 5FLXU 2AP6A 4DPUA 1R0AA 2B9YA 4EMDA 4ZN1A 4GVBB 2Z4PA 4DZ6A 2JHEA 1D8ZA 2IBOA 1JLCB 3I5BA 3ELHA 2CDQA 3D6FB 2K7JA 3E8OA 3E01A 2HLUA 3PDNA 5KFOA 2UU9F 2XS7A 3SCIE 2QV6A 1RTIB 4B3OA 3C19A 4ZVSB 3ZZYA 3IG1A 3IBCB 1N36J 5KFGA 3PZPA 3I5CA 3EVMA 2ASDA 1KP6A 2BJ1A 1X4CA 4HKQA 3HSDA 3A3NB 1JNZB 1C4CA 1X5SA 3D9BA 2PFDA 1WEYA 4QPTA 1UPPA 2DISA 2X3GA 4FYYB 3HJFA 3RUBL 1L3TA 1FE0A 4F50A 3H0PA 4ZHRB 5HMZA 2VFTA 3U02A 4DV1F 4FVMA 2BYCA 1B7YB 1LOUA 5EWFA 1N0UA 1TZ0A 2UUTA 3BR9A 4LRFA 3NOCA 3L95X 1FXDA 2ZBQA 4GKJF 2OIHA 2DNYA 1JLGA 2CPJA 1T9TA 1DTTB 3I0SA 2VQEJ 4RL1A 2FY8A 3FZBA 3DI6B 3DRSB 4MIWA 2P6TA 3NCRA 1A0OB 2CPYA 1GT8A 1YJTA 2IHR1 4JI0F 2B7BB 2VICA 2AZ1A 5K14A 1UA0A 2D41A 4QU7A 4JI7J 2XQCA 2BQ3A 5J2MA 1Z2ZA 4J7CA 1JIHA 2KFZA 1OQ3A 2AD9A 4P10A 2MQLA 5HANA 1UL3A 2HURA 1WEZA 1F5CA 2YNHB 1NDKA 4ZIWA 3MEEA 1RTDB 1YVFA 1UFWA 1NPKA 5CCMA 3MGJA 4JYAF 3LWLA 4HTJA 3BGLA 3IAM9 3NGKA 2KO1A 3UQSA 3QIDA 1EARA 1JLAB 3H4BA 4E0DA 3PEJA 4UQGA 3R3TA 2JEGA 5K20B 2GJIA 3MM5B 4WYWA 1Y3KA 5KFWA 4DV3J 2V2QA 1X9MA 3UVJA 4ECYA 2OFGX 2RJZA 3BSNA 1QSLA 1XNRF 5IC4B 2R7WA 4ZPBA 4LREA 1PKUA 2GNKA 2E9ZA 3MM6A 3O2IA 4F0HA 3NBPB 1NHUA 5K5MA 4GKKJ 1T0TV 5KFEA 2XMWA 4O3OA 2QLXA 3T41A 2HHHJ 1HNZF 4DR6J 2VUGA 5DDPC 2N7CA 1PYSB 3G9CA 3LP2B 4OJGA 3JQMA 2E1MC 1SC6A 4O0NA 4N47A 1ELOA 4QW9A 3HSJA 2AF6A 2DNPA 4FKYA 2MQQA 4V19X 3K58A 4L75A 4QWCA 1F60B 1S1VA 2CAJA 2W9CA 4YFUA 3T1AA 2MYFA 1PJ5A 2YQ0A 5KFTA 1HNXF 3NP5A 2J9DA 5M2RA 2ZUGA 5D78A 2BJ8A 1KFSA 3ISND 3I4PA 3HFZB 6FD1A 2YX4A 2YX7A 4DPYA 4CT8A 3H2UB 5HLFA 1H98A 2XBPA 2Q66A 4A48A 3BBFA 3HKZD 3CT9A 2DR5A 4FXDA 3B6BA 3GU0A 4HL9A 5I42A 4DQRA 2XS5A 4RW6A 1KOHA 5GAEI 3DHWC 2JX2A 3R5DA 5F0WA 4NLRA 1SJFA 3T19A 3TR5A 5D77A 2LCWA 1T05A 1S99A 4RBVA 1F3FA 4ZVPB 1C0TB 1FRIA 4TU7A 1WD6A 3A3OB 2AYMA 2HW3A 1P27B 2WSEC 1PBUA 2UXDJ 2ABYA 3I96A 1VDHA 1I51B 1N36F 4UY85 3EGWB 2HKEA 5H9FJ 2OH2A 4P52A 2J9DE 4FYXB 4H4OB 1CLFA 1U6ZA 2UV8A 2YWGA 5BR8J 2HQIA 2AHOB 2P9GA 2BV3A 3T6BA 2YY3A 3DLJA 4M5KA 2B4PA 5EUHA 5B08A 5KFVA 2ZC4A 1NDLA 4OHVA 1X5TA 1RU1A 4KGZB 3R6LB 2NSBA 3W9JA 3ILLA 2VZ9A 2ZVIA 1QM9A 4OZ5A 1EIYB 3V4IB 3VWSA 3MR6A 5J1PA 1MMLA 2ZBPA 4B9SA 3Q8SB 3X1LB 3JAMY 2IA6A 2X1AA 3PW5A 1EETA 4J9NA 3M2UA 2XS2A 4KQZA 2VQEF 3D3CJ 2N3LA 2M70A 3UD5A 4DQIA 2ILYA 2DO0A 1WACA 1H6KX 5HBMB 3RBEA 4F25A 4JP8A 4LMZA 2QTWA 3BBCA 3BKUA 4MIBA 5C24A 4EGLA 2VG5B 2VIHA 4JI7F 5T7LA 3QNWB 1TL7A 2GGPB 2HHPA 4X4PA 2QFJA 1HWKA 2HNYB 2ADCA 3L7PA 5GADU 3FBFA 2O1PA 4K4UA 2I1RA 4OZ1A 4CTAA 4CRJA 4F67A 3EYZA 4F7VA 5C7PA 1WF0A 1VK3A 4DQSA 2KT5A 2IVYA 3BREA 2RHSB 2J0XA 1OQ6A 3UO0A 2V9KA 4LR7A 1SKRA 4DUYJ 2BXJA 5D0GA 4JI2J 4NLSA 4PG4A 5DZ7A 2NXUA 2L3MA 2XG8A 4Y00A 4DV3F 1O6XA 4X4QA 3T1YF 1WF1A 1KS2A 3ISZA 2V2ZA 1TU0B 4TKTA 1FFSB 3VF0B 1Y10A 6AT1B 2VG6B 2DRAA 3BH7B 2HRTA 1VGYA 4KO0A 3C2PA 3FQLA 5DQIA 4IR9A 3J7YI 1YLXA 2HHHF 4DR6F 4FVCA 3KLHA 3M9NB 1DURA 4ELUA 2OAUA 2J0WA 3CDAA 3MAQA 1IKWB 2GX8A 2BRLA 4BWMA 1APSA 1YWXA 2VF3A 3T5JA 3GQCA 4CT9A 3PV8A 2XI3A 3OR2A 5B0GA 3VZIA 2LXIA 3IR7B 4EFAC 4YDXA 3MMAA 3KJVA 1RTZA 4QYZK 4MKYA 3PY8A 3CJSA 3EICA 3I0RA 1HA1A 3QJJA 1B99A 2EBEA 1QY7A 1JLFA 2IRYA 4DPOA 2C3YA 2Z0GA 3FBBA 1KONA 5T14A 3BQ2A 2XYPB 1EB0A 1EHWA 1CULB 2KB2A 1BC6A 2IRXA 4DQQA 1KVKA 4XTTA 1UVMA 1RE1B 2AQ4A 2DCUB 4I2QB 1U0HB 1S9EA 1WHYA 3HD1A 4WKYA 1MW7A 2BVZA 3OLAA 1WORA 1TTHB 4PQUA 1SJ1A 2NS1B 2DITA 1RKJA 4I4BA 4YN3B 4ZPCA 2MQNA 4WIIA 1UTAA 2F65A 3QGPA 2NXJA 3Q89A 2HFVA 2UXDF 2DGVA 1ZA2B 2POKA 3ZZTA 4DF4A 3CCTA 4IG0A 1RA7A 2C2MB 3JQJA 9ATCB 3M1VB 4A8MP 4ECWA 1E6VB 3CEDA 3IS9A 3LA0A 4E2FB 2MXYA 1WC4A 4NLVA 2HAFA 2RSQA 4ECSA 2XZWA 4ID5B 2E5LF 4O3PA 4PXDA 5BR8F 3TARA 3PHTA 2VC1A 7AT1B 5D0HA 3FCWA 5E3QA 3BGRB 1RISA 2OPRA 3HX9A 2QRRA 4NXMJ 3L09A 1CPZA 3HPOA 2NUHA 2V94A 4A8FA 4ZPWR 3SIPB 1TV6A 2E29A 4FDFA 2Z58B 2J6UA 1WHWA 2AYEA 1QE1A 1FWLA 3R7SB 4MYTA 3ZTSA 1HARA 2F8MA 4DL3A 4DL0C 5KFKA 2WRMA 4EYIB 1OSCA 2XULA 1SH3A 2VV5A 2EG2A 3OLBA 3HHLB 2OUGA 3V81B 4Y2MA 1GAOA 3IRWP 1C0UB 4WK1A 2VC0A 2JVOA 2EW9A 1SH2A 1L3UA 3EJMA 2IAJB 1R0CB 3W64A 2FJWA 4R5PB 5I3UA 3QLHB 5U47A 3RYLA 1UPMB 1RP5A 3LUYA 3B4DA 5KFJA 2RNEA 4M94A 1HBNA 2KVIA 1KN6A 2VG7A 5D4NA 4LRCA 2AGPA 4DR5J 4PWUA 3MM9B 1DY3A 1FO1A 4O23A 1IWAA 3ADAC 2Z8QA 1SKWA 3DU5A 2RVJA 4KBIA 1HHTP 4IFYB 5MLCV 1RT4A 2I5JB 4DBQA 2EK1A 5ETPA 4HACA 4KHMA 4NWBA 2CVEA 2A3JA 2IDLA 2XMUA 1DBDA 3K5NA 3DMJA 2QGFB 3CD0A 4GRSA 4DUYF 3FRYA 4JI2F 2UUAF 2PC6A 5D4LA 3I31A 4ED1A 1VQ6S 3CJ0A 3HFKA 3I32A 4LRDA 1VC6A 3CJTA 5CHCB 2L48A 2CUYA 4RW4B 3E51A 1PAEX 2P9CA 3ITHB 3G71S 5CH7B 2NR0A 1IBLJ 2GC8A 1F6TA 4URGA 1IBCB 2CQ1A 3CDUA 4C0HA 4WTYA 2R2TA 1OY6A 1Q8IA 1VHIA 3H59A 4HHHA 1QAYA 2AWZA 1HR0J 2WVBA 1PBAA 1HI1A 1NZAA 3W2WB 3DGPA 1RCXB 2CYYA 3R27A 4O44B 4A8KA 1NHKL 3D1QA 3V6HA 3QATA 3HHLC 4NA3A 3MPVA 3WDOA 2CQIA 3OSNA 1TVRB 3IBFB 4DHVA 2C22A 3OVSA 2AJ2A 2UVWA 4JI1J 4H4KA 2CNKB 2BA9A 2W8KA 2KXHA 2XZTB 3DM2B 2FGOA 3AD7C 2R7XA 3MAAB 1KC8T 3J81U 3LP0A 4FNHA 1LK5A 1IBKF 3UDLA 3PW4A 2CQGA 5KG4A 3KJFB 3MOJB 3M6UA 4F36A 3SSSA 2KZZA 4X66J 5C25A 1TK0A 2DR7A 1FESA 1CJKA 3MCMA 4C11B 4F3QA 4K4XA 1IJFB 3PJXA 2EFPA 4Y2AA 2IRUA 3G82B 1N5VA 3CTRA 1IJEB 1UVKA 1PIEA 2WOMA 4ELTA 3VAJA 4PUOB 1CS4B 4PZVA 5IZHA 1FWPA 3N6MA 5A8KA 1WEXA 1R27B 2NCKL 3NS6A 2ATCB 2Y8YA 3SCLE 1XQIA 3IXQA 3Q83A 4DL4A 1X5OA 4CWBA 2H48B 4TLRA 1U49A 4E8UA 2LQBA 2ZC3A 4DCJB 5KT6A 1F9FA 3HHNB 4F3OA 5HK4A 5AE1A 5B7WA 1LXJA 1BHNA 1F1BB 5E7OB 3PX0A 4U9RA 4DG1A 3L7OA 2IC3B 2PMZD 1RT3B 3TI0A 1NK5A 4NXMF 1YZ6A 3PIOQ 1HMVB 4NLPA 1W25A 2UXCJ 3D7SB 3DLLQ 2P8IA 2YKNB 1C1CB 1S6QB 4NLDA 4O3SA 1N8RT 2YKMA 5KTQA 4X64J 1WDTA 2H51B 2GQ2A 1DARA 2FTRA 2NLWA 2V50A 3M8QB 3BQ1A 3AY0A 1T11A 3I82A 4Y2CA 2FHKA 2V2KA 2MQ8A 4KTQA 2W2MP 1FJ7A 2BBEA 3PCOB 4NZ6A 1NMEB 4F2SA 4ERDA 4RWWA 1GTHA 4W92B 3EVWA 4CCHA 5GMEA 3G6ES 5ITHA 2D9OA 2FVSA 1U48A 4JB8B 4K0KJ 1U45A 2P5VA 1RT6B 2R2UA 1IR0A 5GAHU 1T9WA 3GR1A 4DR5F 2KFNA 2M88A 4AT1B 3M8ZA 2GHVC 2GCFA 3MEDA 3V6KA 1YK9A 2OEJA 4JV1A 3V6DB 1MROA 3WZ0A 1LFWA 3HHDA 2YH1A 4ZLPA 2EFOA 3K8VA 3ILOA 1U1LA 2HSEB 5IT4A 3AOAA 5J2PA 1SB6A 1SQGA 2V8DA 2KFYA 2V4JB 1JXEA 4AE5A 1B3TA 2VODA 1Q79A 3CO9A 4IG3B 3H8YA 2YPZA 4AXIA 1IBLF 1HNWJ 3M8PB 1K44A 5EWGA 3PEHA 4CM2A 2DEIA 3NGUA 3HMJG 1R0AB 1YSJA 4DX7A 4JV2A 4ZK7M 2ZOMA 1UEUA 2AX1A 1U6FA 1TKZA 3M8SA 1NK4A 1S7HA 2HS3A 2KXFA 1HR0F 1KRPA 5KFRA 3E01B 1FRJA 4DV7J 4RW7B 2CZ4A 2NQPA 4ZLJA 3OXGA 2R7UA 2E66A 5ETKA 2AJ4A 4U7UK 4UOCA 1TKDA 1WOPA 1RT5B 3KUHA 2U1AA 1S0NA 3OXFA 1RADB 3QT5A 4KHRA 2DGSA 3VAFA 3U27A 3A1YG 1UWBB 4A4JA 3I9V9 3QPIA 1PO6A 2QA4G 3TRGA 1HWJA 1JLEA 1XTZA 2J7WA 2Q79A 4OI0A 3PACA 2R8HA 1NJXA 2HFSA 2XHWA 2G2OA 4DOZA 3DLGA 4DXLA 1S9GA 1DQ9A 4YR2A 2MLYA 2E9RX 4X66F 4LFCJ 2OJ3A 5CYMA 4NXNJ 2HHWA 2ZDOA 3UNYA 1LXNA 4WCEQ 3GFYA 4F0MA 2VB6A 3U1NA 3M6VA 1I3OB 1S48A 2WW8A 2HBQB 3D1HA 3FSXA 1TR0A 3MM8B 3KG0A 3LGMA 3SQGA 3RAQA 3KK1A 4OHZA 4RW8B 1X4DA 1XMOJ 1PG5B 3W3SA 3K7RA 4F02A 2O01C 2LQ8A 1HD0A 4WXOA 1FA0A 2RS2A 5J2MB 2L9NA 5LJ3Y 3W8PA 2FVCA 3PW2A 3QAEA 3MEEB 2KHDA 2XYHB 4O3NA 1FF2A 3MDFA 3CCVS 5LL6d 2CWXA 2WVEA 1H3DA 3QT7A 5THWA 5H9FK 1OY8A 1SUQB 1CJUA 1PYOB 1IXKA 1FRMA 2PDAA 2UXCF 2AX0A 4ZP9A 2W9BB 4MYUA 3DCAA 4KHPJ 4GMKA 3WC0A 1DJ0A 4X64F 1K9MT 1NUEA 1H2VZ 1V3ZA 3QT8A 4UF4A 4JUZA 4DDFA 4PQAA 1JJ4A 1QSYA 1FFWB 5EGYA 2RQMA 7FD1A 2VJUA 1UVIA 2OHDA 1RZMA 3R2DJ 5CYQB 4Q45A 2V4QA 3MM6B 1V5IB 4MAKA 1U1MA 4MIAA 2XC9A 1YX2A 2C2NA 2ZBCA 4TQRA 2V8HA 1X4HA 3JQKA 2VQFJ 4K0KF 3C15B 4JI3J 3TP2A 1G4CA 1D1UA 1RWOB 3D2WA 2JLGA 4I68A 2FC8A 4DV5J 1NSPA 3OUYB 3MFHA 1FEHA 4ED0A 2ZE2A 2DK2A 1KHVA 3PJWA 4HHUA 5KFHA 1ZAXA 4L74A 4DI6A 3W8GA 3QJLA 4DR3F 2H5EA 1IM6A 2PEHA 3CCRS 1KQKA 2RMLA 1LW0B 1TKXA 3FBCA 1K1SA 1RAHB 2K1RB 3R5CA 5I42B 4K4VA 4BLGA 5KAKA 1A9NB 5KFAA 5E2QA 3SDEB 2HS0A 1HNWF 2EC2A 3GFHA 1SL1A 1Q95G 5DQHA 2JDJA 2B4UA 1T05B 1NDCA 3GONA 2BM1A 1S1XA 4DCOB 2XZDB 2AJ0A 5M2UA 3X3UA 4K7QA 1VJQA 4LJMA 1LW2B 1FERA 1QAIA 3D6MB 4OIXA 3QFHA 3I87A 4DV7F 3ENAA 5AXNA 3OFHA 4FPIA 1R89A 4ZPTR 1N32J 1KOOA 3MZIA 4NEZA 1U7LA 4DPTA 4F04B 1KLNA 1YJ7A 1VBZA 3JSYA 2RT3A 2LDIA 4B02A 1S6OA 2A0FB 3HKWA 1Q7YT 4NZ7A 8RUCA 4PCQA 2HVDA 3HVTB 1RHJB 4K2JA 2XMKA 3MHYA 4WFYA 2M52A 1UZDA 3KLGA 5F41A 5J2NA 1LV5A 2C42A 4B3MJ 5L8RC 4NA2A 4KRWA 2ZFHA 3D1OA 1BWEA 3T9NA 4HT5A 1IKYA 1ZBTA 1LWEA 4CO2A 4OX8A 3EX7B 4J9LA 4LFCF 1XWLA 4FBTA 4NXNF 1F5BA 1S6PB 3GE9A 1N88A 1T3NA 4KV8A 3ICLA 4XPEA 3M2UB 1R43A 4L6V3 2LU1A 4ECVA 2PN6A 3MR7A 1VQ8S 2L9DA 2N4DA 3R7NB 1WHVA 2HVZA 4JV5J 2COLA 1HQUB 1XMOF 2N82B 5LT5A 1KFDA 1R8HA 3M30A 2LEBA 1W2IA 3I56S 5AXMA 4ENOA 1LWCA 3NS7B 3TA1A 1VRQC 1YG0A 1EAYC 2DGUA 3QGGA 1RHRB 1T02A 3GIIA 1ZZFA 3BS9A 1LWFB 4LF4J 2HHVA 4GVLA 4QQBA 1JKHB 9RUBA 1JXVA 3TQEA 2DNZA 2CJXB 3G86A 3A3PB 4KHPF 2HNDB 5DETA 3V5RA 2CPHA 4DFJA 3QRQA 2BQRA 3CCLS 3LANA 1IR1A 4TQSA 4WU2A 2HWTA 1RJJA 5E3AA 2Z2YB 3P5TL 5F3TA 5B0BA 1KTVA 5B09A 2FVPA 3HULA 4DL6A 3PYFA 2A6MA 5A8RB 1TL1B 1YDLA 2R8IA 2JL9A 1VQPS 3EGVA 2XWXA 2X3DA 2ACYA 1FKPA 3IA0A 5A0YB 1VI7A 1YJ9S 3GIMA 2EFVA 5ETNA 3K59A 2VONA 2VPXB 2IDEA 3C6TB 2VDHA 3G8QA 4JI3F 2HFZA 1M5SA 3HHLD 1BQMB 4NI2A 1HPZB 4M5DB 2BANA 2KZMA 1TELA 4B3TJ 1T03B 2MDAA 3KNGA 3D4JA 3KJVB 2VFUA 1LFPA 1VIXA 4RO0A 1X4GA 4LFAJ 3I0RB 5G0RA 4ZVFA 4DLEA 1FK9B 3VQTA 1R0BG 4KY3A 1Z4UA 3TUZC 1A6LA 2HWIA 2BE7D 4WE1A 4WJBA 1YRTA 5IM0A 3H25A 2G0CA 3KUEA 4XDDA 2MMYA 1VQ5S 3PX4A 2DRBA 2Y8WA 3H2LA 1XBWA 1NK7A 2GMHA 3HP6A 3CJ2A 4WFXA 1FDNA 4LSNB 4JOUA 1VR6A 1S9EB 1YRXA 2DD8S 1ZOTA 3GYXB 2H5IB 1JJHA 2IY5B 1DRZA 3QAUA 2E7WA 1ZETA 1IKVA 4NZ0A 4ED2A 2ZWOA 1T9YA 3BPDA 4WIQA 2HK2A 2MJUA 2ZITA 4CYUA 1N32F 1M5KC 4CH1A 4N56A 2DGOA 4USVA 3CCZA 2D3O1 2L41A 4IG0B 2X1FA 4M5LA 4ES2A 2V6AA 3MECA 1JLBB 4DSLA 2GVDB 1UFLA 4TY8A 2XCAA 3WBZA 1L5UA 2J8AA 1Q81T 1Q4RA 2FJAB 5B0FA 1XIQA 1NH7A 4KR0B 2HIQA 3EMTA 3VAHA 3K0JA 3ISNC 4B3MF 4K59A 2RH3A 1VC0A 5HP1A 2R9LA 5GAHI 1UAWA 5CD4H 2FLLA 3QT6A 2HVHA 3P8BB 3N5FA 3OR1A 2V63A 4PAAA 3W5ZA 4S0MA 2Z56B 3ILIA 2EEYA 1H2TZ 2FUG9 2ZH8A 3PVXA 1RBAA 3HT0A 2OEKA 1S1WA 1GTEA 3CMES 1ZM9A 4BC7A 2E44A 2FHJD 3NXZA 5HQMA 2R7SA 1C1BA 2CQHA 3GG1A 4JV5F 1QD1A 4ED8A 1RCOB 3CJKA 3LGNA 4KPCA 4DV4J 4QPXA 2MZJA 3C6UB 2DNRA 4UOFA 2V8VA 1MN9A 3RU0A 2FJEB 3FFIA 4EYHB 1HBNB 3PKMA 2VG7B 1D9FA 4XO0A 2DNHA 2H4WB 4IRCA 3M32B 1RAFB 2Y3YA 4RW9A 1N0VC 4LSZB 3UR3C 3THTA 1RT4B 4KAIA 2IYGA 4OHYA 2QFIA 4QJVA 4HACB 5GAEU 4LF4F 1GMWA 2VU5A 4ZCLA 5KFFA 1AUSL 2FDNA 4CO3A 4LF5F 4ZDNA 5AJ3J 4CLSA 1HWLA 3FCVA 1N5TA 4QWBA 1TKTA 3LP1A 4B9NA 1VC5A 4CLTA 3FMBA 2DXDA 5KFSA 3FUYA 4OLPA 2PO4A 3FSIA 1KKHA 4ZVTB 2EFGA 1BQXA 4LVOP 3R2CJ 4DR2J 1CQNA 5A8WA 1HI0P 4HR2A 1Y3JA 1GX6A 1W26A 2XMJA 4PWDA 3G2XA 2BW2A 3JXOA 3J80Y 1SJ4P 1FJEB 2HQDA 3O5TB 4OJHA 3HFVA 4RR5A 2JFKA 2E1PA 5ETQA 4J9PA 1P8GA 4XPCA 4Y28C 5GAGU 3MTKA 1DLOA 4ZLNA 4Q43A 1VCTA 1Q8KA 2C2DA 2XCPA 3K8WA 2CQBA 4RWXA 4LF6J 3AB2B 1HNVA 5KFDA 1NM2A 1FFGB 4BBYA 1V5VA 4FF3A 4B3TF 3TVKA 2MQOA 2YQ3A 2ACMA 3KK2A 1MMNA 1XN9A 1RTJA 5HROB 2AJFE 5CXTA 3K5OA 3LP0B 1RSCA 4GC6A 4J9VA 3RJMB 1NB7A 3FEXB 4ZLLA 3CMAS 3DDKA 1VLOA 3VGVA 3LWMA 2V8PA 2RQKA 3MFIA 1BMQB 2G9OA 4C3MA 4CZCA 2I8EA 3ET6A 1FD8A 5C25B 1L3VA 4WFZA 1V3SA 2XY5A 2WAQD 3HJVA 2D74B 2K3IA 3RW6A 2OPPB 3JAMU 1RT2B 4W98A 1F9EB 1N5SA 3GLJA 1RWXB 3KOAA 1FX4A 2BE2B 2GJFA 3DHXA 4Y6IA 1X5PA 1HD1A 1VQ9S 4DR7J 2MZQA 1B0VA 4WZQA 2PI5A 2MQPA 1SQFA 2ROPA 3M2RA 3SFGA 4WTOB 4C8LA 3IFEA 2PGCA 4NYPA 1RB0A 3US5A 1QUVA 4IH6A 2HHQA 1J27A 3KKFA 4X4UA 2EWHA 2IPOB 2UV8G 3IWLA 2ZJRQ 3MI7X 4KE5A 3GP9A 1VQOS 1Q8BA 2ZH2A 4NLQA 2QYGA 2LDYA 1ZH5A 3C8YA 4OJ1A 4OX7A 4DG1B 2C2RA 4IQMA 3NNHA 1I94J 5KG0A 2A10A 1RACB 1M90T 1Q86T 3BPSP 4FKXA 4FYWB 3O6QA 1D09B 4WFNQ 4YY3J 1VRUA 1IKXA 1WKLA 2IMWP 2D9PA 5GVQA 3GR0A 2ROEA 2KH9A 3Q8UA 4FPRA 4DZDA 3J7YU 4IR1A 1KR4A 2V67A 5A6WA 3TWZA 4QBUA 4WZMA 2B6AA 2ZUAA 4PYDA 1S0OA 2XM3A 2F9DA 3ZXWA 5KFMA 3P45B 3C46A 3IAS9 1X31C 3EZ5A 3AJ1A 3OTEA 3WC2A 4DX5A 2EKNA 2DGXA 4G1QA 2KDOA 4ELVA 4DV4F 3FKBA 3CDEA 2YXLA 3GWCA 1K73T 2HIYA 1F2HA 2EI5A 1KLMB 4WP3A 4QIWD 3FSYA 3GFZA 1RTIA 1T9UA 2C2EA 2WB4A 3V2UC 3EGNA 4UZCA 4DFMA 2EPIA 4B3RJ 1MROB 4DV2J 1NAQA 3VTIA 1FEEA 2YH0A 4J90A 4U7UD 2CDRB 5DS7A 4OYIA 1T94A 5AJ3F 1T7PA 2CPIA 4C3KA 4MT1A 4P72A 2LU2A 2CNNB 3H5XA 3JSMB 2BUNA 4CH0S 1D8YA 3W7BA 4ETXA 2C3MA 3O1LA 1FRXA 4ZHRA 2VOPA 4W90B 1FXRA 4DR2F 3B54A 3KMSA 3MCNA 1Y5LB 2DR6A 1VFJA 3CJ8A 2C2OB 5JVHQ 4DR1J 1I1GA 3IRXA 3OVAA 1H72C 2HHTA 1U24A 2XSJB 4BC9A 3QQCD 4PRFA 3A12A 4C8YA 3FNNA 3ZZOA 3DI6A 5SZTA 3DRSA 3ZTQA 5C5JA 3BJYA 4DSJA 2A2CA 4DUTA 4IFVB 3QIPB 4AXJA 5E5NA 3SV4A 1FD2A 1GMVA 4V1Ak 2RIJA 2WB1D 5B0EA 4ECXA 4ETZA 3N9UC 1VQNS 3A8EA 1AW0A 1FDAA 1UEKA 1P1LA 5J1EB 1RGVA 3ONQA 5IT0A 4CLYA 1DTQA 3KG4A 1RTDA 2NXCA 1N33F 3FZ2A 2DNGA 2LEAA 4C2MA 4P2SA 1JLAA 2NSCA 4R0JA 1BE4A 3D6HB 3NRBA 3O3LA 1S9GB 3OFEA 3W9IA 2MKHA 4LF1A 3MM5A 4JI8J 2ZNYA 1GXLA 4CO4A 1YI2S 3HCXA 4LQ3A 1S0MA 3AHPA 4X4OA 4PG7A 3PHEA 1FVQA 1IN0A 2QG9B 2I9SA 1S4FA 1MNEA 1S1UA 2BKPA 3MM7B 3SQGB 3KK1B 2V2VA 1S9FA 4DR7F 4KFBB 3JB9k 2QMXA 3KLVA 4OYMA 3POTB 5F9LA 2XY7A 4P2MA 2ZDPA 2RKIA 4PR6A 2AEFA 2QJ3A 1VQMS 3C16B 3LGHA 2Y0SD 2ERRA 5D3GA 2HQGA 2MZSA 3TAMB 2H1YA 3LQVA 1CG2A 3W5XA 5FDLB 1W2BR 1FJCA 2HRUA 3ZNJ1 3UFCX 3SCJE 1TL3A 1I94F 1FE4A 3SXLA 1SV5B 2R4FA 2H9ZA 3M4XA 2KG1A 4RKUC 1U1RA 5LJ5Y 4J91A 3H5YA 4YY3F 3OTDA 2QSFA 5E3CA 4M5IA 2W8LA 1M5VC 2BQUA 2JRSA 4KT0C 4ZCIA 1HQEB 4NCGB 3CF5Q 2PT0A 1MLAA 5L9XA 1ZPVA 1QVGR 1PJ7A 2W7OA 2JVRA 3HLUA 4RU9A 1B0PA 4I67A 1N4LA 2ASLA 3RW7A 3E2EA 5JJBA 2QIFA 2W7PA 2E7XA 4FP9A 3P3DA 3C14B 1C0TA 4MJKA 1F0XA 3FJ2A 7FDRA 3GIKA 1FJGJ 3NWGA 3AB4B 1KHWA 2P2CB 2KU7A 3VZHA 1KWMA 4DFPA 1E6YB 2HFOA 4J37A 1G6BA 3HXMA 5HMYA 2VBXA 2J9CA 2CZ9A 4UQTA 4CLKA 2F8EX 3IR5B 2E5IA 5L9NA 2DJWA 3I55S 4ZN3A 2ZE2B 3KK3A 3DYAA 2R8KA 4B3RF 2H65B 4H4OA 5KG7A 4DV2F 4C98A 3RG6A 2WBMA 1CJTB 1NJIT 4QIVA 3PIPQ 3OW2R 2FB0A 3QFWA 5F8LA 3JYTB 4ED6A 2YWWA 1M1KT 4M95A 2XY6A 1HYSB 1NU4A 3F56A 2KTQA 1CC7A 1WC6A 1X4AA 2XTJP 4X4RA 1R6VA 4NMXA 4PXCA 4F4XA 2RILA 3V4IA 4RJVA 2JLFA 3RRHA 2HAIA 2BJ3A 2FJBB 2QC3A 1T8EA 3CC2S 3K5MA 1FRKA 2ZH5A 1WWHA 1LWXA 3PO4A 4DR1F 1ROFA 4MKBA 2M4MA 3DOMB 1U8WA 5F9NA 2WONB 5CA5A 3UD4P 4CDIA 5KFQA 2E1CA 4DL5A 1XMQF 1B7FA 4TXSA 1XR6A 5C2CA 3CCJS 3DXBA 5CZVA 5HBMA 5C42B 2DNOA 3OSPA 1NSKL 5AE2A 3DLHA 4EUVA 1HBMB 3LPEA 4ZP7A 1PC4A 1RT1A 2QL7B 3DOLB 1TUVA 3ENVA 5DQGA 2HNYA 3H90A 2DH8A 4Q0BA 2RDIA 1L3KA 2W2OP 5BYQA 2N3OA 3NKYA 4LF9F 1OYEA 4FS2A 2KI2A 2IVFB 2WTFA 3ZTRA 5D0EA 3DXSX 1N5QA 3KLGB 4ECRA 3KHGA 3Q2SC 2MHEA 5KFPA 2F7VA 4A46A 2QT7A 3G8SA 3DRYA 5KFIA 5HQ8A 1YBTA 2E5GA 4IDKA 3OJUA 5HN0A 4LFBJ 4CNZA 4HHJA 1BQNB 4EZ9A 4AUKA 1BUXA 1WC5A 2AV5A 1B0TA 5IXUA 1Y7PA 2E9TA 3LO3A 4GC7A 4RU2A 2GAGC 2QMUB 3FCHA 4K5SA 3JTPA 1WG1A 5ETSA 5KOXA 3KLEB 1MU2B 1J5OB 3RBDA 4IYQA 3IR6B 4C8ZA 2RRNA 2WHOA 2H54B 2OMLA 4XAKA 2R7RA 3DLEB 2DNQA 3VGUA 5LSRA 2FGCA 1FI4A 3A8IA 1IKWA 3D3BJ 3M8YA 1SC3B 1HWIA 4HDGA 3BDPA 2W25A 3RGIA 3NMRA 3MOZA 1RAAB 4FNIA 2YNIA 5GAGI 3VGTA 3BQ0A 4K5RA 1LKZA 2NZCA 2RU9A 4F4ZA 4KGMA 1UVJA 2ZJQQ 1NRKA 3LF0A 4USMA 4M1KA 3S01A 3MF5A 2F63A 4TVAB 1M5HA 3PRBA 1T9VA 2GS8A 4DL7A 2B7CB 2BEFA 2HYIB 3SSQA 4EEYA 1S76D 2DH7A 3DLKA 2GO9A 1IWGA 3CDWA 2BKNA 5FJ4A 4M5HA 4YQWA 2LECA 3GIRA 4K8RA 2QZ8A 4F4WA 4F4YA 5L1JA 2D3UA 1WDDA 3KTQA 1RT7B 4V19J 1XK8A 1FKPB 4I2QA 3R5JB 1U0HA 4ZPVR 3LPYA 4FF2A 2CVIA 3HSGA 5KG1A 1RK8A 4CLZA 3PW7A 2KXNB 1FJGF 5E3RA 4K4WA 1U25A 1M5PC 4Y2KA 2VBWA 2F4FA 3GILA 2F8HA 3LTOA 1AFJA 1RLDA 1GK8A 5F8GA 1UKUA 4DF8A 2HWHA 4FZVA 4IOBA 4P7VA 1VRTA 2RF2B 4LIRA 1D9AA 3M1VA 1NO8A 1VK8A 2BW7A 3GJSB 1E6VA 4N8OA 3UDVA 2DIUA 1WNEA 4NCAA 3B78A 1F9HA 3TUIC 3CSKA 3HM9A 4CH7A 1JMTA 3G6YA 3OHAA 1UW9A 2K3KA 4MKVA 3R5BA 1H2UX 1REVA 4ECUA 3UD3P 4KKOB 3IO1A 2OTLS 5D0RA 2QA1A 1HFEL 3BKFA 2QL9B 1KD1T 3DRRA 4PG5A 2HEKA 5ETTA 2IYIA 3HZGA 3GCXP 2NUUG 3OFFA 3MCSA 2RDJA 1DQAA 3QGIA 4FS1A 4QW8A 2R8GA 2MB0B 3PTWA 3OL7A 1T95A 3PX6A 3MR3A 2M9KA 3V81A 3O44A 2DGTA 1YIJS 2GV1A 1UVNA 2D3ZA 2G1DA 4QIGA 2OPSA 1FNOA 1IKVB 1YBUA 4GKKF 1GXTA 3LH2S 2IAJA 3QSYB 3UCGA 2MKKA 1HNIA 2AMCB 1NDPA 1H7WA 2ZZMA 4DX8H 1QJHA 3QLHA 2YKAA 4RNHA 3BDEA 4B9UA 2HFUA 4JI6J 4I2PB 3VALA 5KT5A 4YR0A 1UWAA 3W1YC 2LYVA 4LSLA 4M5GA 1JLQB 2FHMA 4ATNA 4QYZJ 3ETMA 1UETA 2JEIA 3PM9A 2B9XA 3QYYA 2Y1LB 2GIQA 2MPUA 4X4VA 1OWXA 3MM9A 1SQEA 2BMBA 1RAOA 2PSZA 3BV8A 4IFYA 1F3VA 4DSEA 1S49A 2DO4A 2M2BA 1RTHA 4UW2A 3S1TA 3FBEA 2DHGA 5RUBA 5F0UA 1S12A 3D0HE 2B5JB 2W4DA 3OR1B 3MR2A 2NXEA 3VCDA 4LFBF 5L1IA 3Q8QB 1BWVA 3IM9A 1QTMA 1ITPA 1N5YA 2FLNA 2AKWB 3L9ZA 1NJWA 1CQMA 4RNNA 4RW4A 1WSRA 4OZ2A 3F73A 3MXHP 1S1WB 3FMWA 3OT9A 3ITHA 1RBOB 4O4GB 3AXKA 1C1BB 4ES3A 4MFBB 4K4YA 4YB7A 4QZVB 1RHQB 4X84A 5HJYA 3O8WA 4WWSA 4HTIA 4F4AA 4WKRA 3TVZA 3TAPA 3OTBA 3ZTOA 3RB3A 2GMJA 2O3DA 3CC7S 1WOSA 4N7TA 1XR5A 3NY0A 1WG4A 2D69A 4O44A 1AZSA 2ZZTA 4YR3A 2AJ1A 5F8IA 1KTQA 1IVZA 1Y5IB 3HD2A 4G6VB 3N6NA 4TYAA 3HVWA 2DPJA 2Z30B 5D4OA 3W9HA 2HQFA 3DM2A 5AXLA 2HNZB 2O66A 1TKTB 3LP1B 3QO9B 1U26A 1MMDA 4KGXB 4OI6A 5HMWA 4FYDA 4LRBA 1K8AT 1H74A 1H38A 4NA1A 3CJRA 3U7JA 4NOHA 5HMXA 2J7UA 1QDUB 3EZUA 5A8WB 4JV0A 5IOLA 1BXNA 4P9SA 4WF9Q 3Q22A 3AOBA 2X1BA 2EK6A 4Z7CA 3GCWP 1U6BA 2RD5C 1CS4A 2CFXA 2DY9A 5IS2A 4IUFA 4JI0J 2E1RA 4Y65A 1NK8A 1TMMA 4Q2MA 4L3NA 3CPWR 3MUVP 4OI4A 5F8JA 5SUHA 2XO7A 4NL5A 3KK2B 3ZTPA 2OPQB 2B9EA 1NXIA 4K4ZA 3DRXA 2EG1A 1QVFR 3TZYA 2MZ1A 2DGQA 2IC3A 2B9WA 3TUJC 1HMVA 1VQKS 1TL4A 4Q2LA 3SEOA 3TJAA 2KYZA 4ZIVA 2YKNA 3M2VA 4QWAA 3SSRA 4KGVB 2GIFA 1IUJA 1Y5NB 2XLJA 3SBMA 4ICLB 4OZ0A 3EGZA 1ZM3A 3PFEA 4TLQA 4Q7AA 3W65A 3MPYA 3DRPB 2VDIA 3QRRA 4C7QA 5DDRC 2FJDB 4Z37A 3GV8B 4QCLA 1ULRA 3FEZA 3H42A 2ILZA 4JI6F 1N54B 2IM0A 3MAHA 5HL7Q 2Q6CA 3KLFA 3TJ8A 1HHQA 3MEKA 4L72B 1UFKA 2LQ9A 1WHXA 5HJXA 1W7WA 1CBKA 1RT6A 3TZWA 4C0OC 3ZFVA 1UA1A 2FZCB 5KFXA 3D66A 1RUSA 4USJC 3Q24A 2HFNA 3D54A 3DOKA 1SXLA 4DN9A 4DU7A 1XJWB 3VHQA 1WUUA 4X65J 1HIYA 1R8PA 3OQ2A 1RAEB 4KH1B 4NLUA 4WPAA 4PXEA 1IKXB 2AEJA 2C3OA 1WSVA 2YNFB 2FYXA 4RBUA 2GVZA 2XB2D 1N6QB 1TP7A 2IVMA 1ZTWA 3Q23A 4URQU 2ADBA 2AJQA 1OY9A 3H5UA 1MG7A 2DB1A 4OMFG 5KG5A 2V4JA 2XI2A 2CQPA 1V6HA 2A6OA 5F3ZA 1B64A 3H98A 4J9RA 4RNFA 3CD5A 4LR9A 3MPDA 3SV3A 3CCSS 5F8HA 3TOQA 1S79A 5A76A 1VQSA 4G1QB 1KEKA 2HMIA 2CA9A 3GJQB 1NSAA 5HVFA 1VJWA 1XC9A 4G1PA 2GHWA 2ZKUA 4YB1P 1BY9A 1EP4B 1U4BA 3LW5C 4RW7A 2AT1B 1YKWA 4USIA 3NCPA 2Z57B 1WKKA 2DXEA 4TU9A 5DRKA 2GA7A 3U1MA 5T41A 4UZBA 2J7KA 2ZVSA 5DGAA 4ZA1A 3UN2A 2YPYA 4ZJOA 1RT5A 4USWA 2K7KA 3RAXA 3SCKE 1P9QC 1H73A 3KLIB 3OL8A 4E98A 2ZH7A 1ZYQA 3CGIA 1UWBA 3H4DA 2EC0A 2YQ1A 2R7VA 1RWVB 3UCZP 4L3KA 3OBIA 3CWJA 1WKJA 5K8OA 5EDWA 2YTCA 2O67A 4OYOA 4UY8T 2YWEA 1J2VA 2BOPA 4LQ9A 4ED5A 1JB0C 4GO5X 1VBKA 4GO7X 2KM8B 3D68A 3JTOA 4EBCA 3IRXB 4NRUA 1K0VA 2CQ0A 3D67A 5E3PA 2Y1IA 3H40A 1S4EA 1TUWA 4O0IA 4Y3CA 4LUBA 1VYAA 3B8HA 4WFAQ 2MSSA 1FRHA 3MM8A 5DJBA 1Q1KA 1BD6A 4RW8A 4HDHA 3NMAA 3UPFA 4A8QA 3K89A 5KG2A 1RWWB 5KFNA 1URRA 2XEXA 2ZD1B 5MAOA 2ZM6J 3G6VA 5LSLA 5HI7A 1RA6A 3NGTA 1NKCA 4L76A 3V6JA 1X7VA 4M5JA 3QZ7A 4LF7J 5LXRA 4X4NA 2QEXS 3OXLA 2LEPA 1DTQB 1RYSA 4M5MA 2UP1A 1WC0A 4JI5J 2IM3A 1REGX 1GX5A 1Z2LA 3WIUA 2DR9A 3EM1A 3M05A 2W24A 1SUQA 4RNOA 3KDOA 1HHSA 4RUAA 2MLZA 1OO0B 3I4HX 1DZ5A 3W66A 2PD1A 3DKDA 2W9BA 4B17A 4CLWA 2F4VJ 5K8NA 4P75A 3CD6S 4HYKA 2PIIA 2E5JA 1TUGB 2HHUA 1SI9A 3SZ2A 4DLGA 3P49B 3T1YJ 2Y1JA 2OI2A 3AA8A 2DHHA 3D5MA 4H4MB 6FDRA 1HW8A 3AD9C 2IFXA 3IM8A 2F9JA 4LBIA 2UUCJ 1S1UB 3P6YC 4NPOA 2DTJA 2VFRA 4DPXA 1EKRA 3HT3A 3MEGA 5CYQA 1TL5A 2DGWA 5CCLA 3MURP 2RKIB 2AYGA 4M8LA 3TX0A 2JSXA 4B3OB 2KKHA 1GQEA 3IG1B 5D3GB 2HG4A 4YP3A 3C15A 2KM8C 1FX2A 4QYRA 4OZNA 2CWKA 4IRDA 3BGFA 2J5AA 1FCAA 2B4VA 3CJ5A 3ZZZA 3OUYA 4ANCA 2WVCA 4JI1F 1TL3B 2FVQA 4EBEA 1PCAA 4DR4J 4USHA 4X65F 2FIUA 3EVOA 2K2PA 4ECTA 3T3FA 3E3XA 1EQMA 3K17A 4YB6A 1NBEB 5A2QY 1TQLA 3NOGA 2PMWA 2W1BA 3GMGA 4NCBA 5DO2A 1LW0A 4FYVB 1O8BA 2CQDA 2WK4A 4ZCMA 1KDNA 5JVGQ 1GEHA 3MUTP 2V8GA 1O0PA 3UCUP 2K1RA 2V0NA 5K8PA 2SXLA 1JLGB 3IP0A 3SDEA 1SL0A 2APOA 3I0SB 2BOAA 3EWGA 3J80U 2PA8D 4OX6A 5EX3A 2RU3A 4A8SA 5HATA 1FRLA 4KPYA 1IQTA 2AEMA 2XMTA 2W2PP 2A18A 1T9XA 1LW2A 5K14B 1FDBA 2OLWA 3RBZA 1EQ0A 2DPIA 3MMBA 3DFEA 3KK3B 3DYAB 2EVZA 1SJRA 1MWQA 2E5LJ 5I3PA 2BE9B 2LQJA 2GQCA 3VV2B 3HVTA 2GIRA 3VQSA 3TX8A 1Y9OA 2CQ2A 3K57A 2FY1A 3H7HB 3T1HJ 4A8XA 3OD2A 5EHHA 2MSTA 1IBMJ 4I69A 3AQPA 2LLZA 4C0BA 1Y00A 1ZAVA 5KFYA 2VOOA 5AE3A 2XGQA 4N41A 3IC1A 3QBCA 3UVJB 3KNAA 1XERA 3HI9A 3PO5A 2QLWA 3WHIA 4C8OA 1PAUB 1S6PA 3F41A 1RHKB 2V5HG 1FKOA 2I38A 3BB5A 2P6SA 3CNQP 2JC0A 4NYOA 2HHXA 1SBRA 2DNNA 4XK8C 8ATCB 5HVGA 1HQUA 4QOTA 5EWEA 3RBXA 2ZM6F 1Q0NA 1K1QA 1RT1B 3BKTA 3P96A 2KYXA 2NZ4A 4OZLA 4LF7F 1S1VB 2V9WA 3IWNC 4CNYA 2W9CB 5LMNJ 3CDBA 4Q0BB 1R3NA 2VASA 4OI3A 3HVRA 1YITS 3CD7A 1U47A 1QAXA 1TK8A 3TUPA 4JI5F 3M8RA 2C3PA 1U1QA 4OHXA 1X9SA 4WU3A 4I6AA 4J9OA 1LWFA 1A7GE 1MSWD 4NYZA 3NAIA 1JKHA 5HLFB 5BYSA 5C2GA 2RB7A 2UUAJ 2CPEA 4YEAA 4IDKB 1UP1A 2R3VA 2F4VF 4WYLA 2CJKA 2B4OA 2HNDA 3GSDA 2OTJS 3GZ7A 4I1TA 4RW6B 4QIFA 4CO1A 2OFHX 2UUCF 5DDOC 1HBUA 4HH0A 2HLTA 1ZPWX 5A8RA 1TL1A 1VBXA 2F1FA 4LBPA 3CCUS 1KNZA 8AT1B 2IBKA 5A0YA 2RHQB 3C6TA 2DNLA 1FNXH 2GW8A 4ZVHA 3W2VA 4OFZA 2QYCA 1OJ4A 4W4MA 2ZH4A 1AXQA 2YNGA 1BQMA 1HPZA 4PG6A 4M5DA 3NGRA 3FEYB 4FF1A 4EZ6A 2YNIB 3Q86A 4DR4F 1T03A 2V4RA 2EFQA 1LQ9A 3PRVA 2CPFA 1SIWB 3IGVA 3UE2A 5L1LA 2W2QP 3CUNA 1UW4A 3BR8A 4MMOA 3AOCA 3NLCA 1RWKB 3MUMP 4AL6A 1WELA 1IBKJ 3AAWB 3EDRB 3V4MA 3MMCA 1FK9A 2UVUA 1WC3A 4BHQA 1BLUA 2ZJPQ 1D3WA 4C9DA 2G4BA 1YJWS 3DLKB 1UJ6A 4IQXA 4OYZA 4UTGA 4F26A 1EETB 2OKQA 4OV1A 1UVLA 3TZXA 1U02A 3OV7A 1KBRA 4ILMA 4ZP6A 4YS2A 1YJRA 3G4SS 2QA2A 2M8DB 2XWYA 4DN0A 4LSNA 3TEHB 1UZHA 5BXIA 3ENWA 4KGKA 1DFDA 4CM0A 3NNCA 2J9EA 2X7IA 2MKCA 3UDCA 4FF4A 2XHCA 4MH8A 4R25A 2Q1LA 5C24B 4ZVUB 3OL6A 3I9ZA 3F44A 1R8BA 2KT2A 5T7LB 4LRAA 2OD4A 1TL7B 1U1PA 5D4PA 4ZVQB 3HVAA 4LR8A 4MK7A 1VRTB 1U1OA 3S6EA 2FLPA 3T6JA 4CTAB 4MK9A 2VFVA 3W61A 4NMLA 2OELA 1JLBA 1SIZA 2GVDA 2D7SA 2WBRA 3DC2A 2IA0A 1JXLA 4Q5VA 1S7IA 1RAIB 2MLXA 5FD1A 4ZVRB 4USUA 5KT4A 5ETVA 4R8UA 1REVB 3TW0A 2WSFC 3T1HF 3EE3A 4DQPA 2XNQA 1IBMF 2EBGA 4KSEB 2MKSA 1ZAWA 3DRRB 3HHKA 2KT3A 2K8GA 2H3EB 2VL1A 2KG0A 5DLFA 1K0TA 1FXLA 4XDCA 3TANA 2CJYB 3A4TA 1GMWD 3J7A1 2G2YA 3JTNA 2J6SA 2WVDA 2CJ9A 1FTRA 2HQ3A 4DS5A 3JSRA 1S77D 3A8JA 3MPUB 2OPSB 2HBZB 4KO0B 5FLXY 4N5SA 2UZAA 3DDIA 1U0SA 3BO3A 2JEJA 1DAXA 3DN9A 2DBBA 1HNIB 3SQOP 3KLHB 1U2CA 4PXBA 3QJPA 1PGZA 4ED3A 2BJ9A 2VQFF 2OP5A 2F3JA 4ZITA 3C6UA 3TNVA 1OSDA 3R1LA 1ICEB 3Q8PB 4LSLB 3JS9A 3OR2B 4DV5F 4NLTA 3CMQA 5LMNF 5ETRA 4MKAA 2ZEJA 3M32A 3MMAB 2RQCA 2IM2A 4TYBA 2XYGB 3W5YA 2CQ3A 2BR0A 1NK0A 3MPWA 4UUXA 4MK8A 1RTHB 4I7FA 1RKIA 1WOOA 2DNKA 1R8AA 4OLOA 2B8QA 2MTLA 3J81j 4B9MA 2BJ7A 1JLFB 1YQHA 3OL9A 4QR1A 3KMQA 3KHRA 1XNQJ 3A8KA 3T5LA 4J9UE 3UW1A 2BRKA 3EXYA 1NPPA 2OMOA 4ES1A 1SVDA 1N5YB 3N4WA 2BDPA 1VS3A 1CJVA 2GAHC 2QLJB 3HHEA 3R7BB 1NNDA 5JXSA 3U1LA 5CQGA 4JBCA 3ETOA 4PQUB 3FK4A 2CADA 1SPBP 1UEVA 2XLIA 2HVIA 1VQ4S 1K47A 1HWUA 4K4TA 1MWZA 1AZSB 1SKUB 3DNCA 3L7UA 3HSZA 3IS9B 2B56A 2M5YA 3MMJA 4PEOA 3EUNA 2EKYA 2MKJA 4HLBA 2AZ3A 2LMIA 1AUDA 1HQ2A 2UVRA 1X4FA 4QU6A 2YKQA 4OX9J 1Q78A 3WX8A 2OPRB 4KC5A 2LKZA 4U7CA 3ZZUA 4J9KA 1RYRA 4ZVOB 2BJDA 5HROA 1AA1B 1TV6B 3ZZRA 1VQLS 2GJ2A 1ACMB 1JWWA 1QE1B 3BGOP 2UUBJ 4CIOA 4ANDA 5KT3A 1RQ0A 2AW0A 5L46A 1HLWA 1NLKL 2ROGA 3BN7A 2FHOB 2O5DA 1NPRA 1YJNS 3IBWA 2YX1A 2ZH9A 4IH5A 2FJXA 5F8NA 2OPPA 1OPZA 1PILA 1RT2A 1XR7A 2QLBB 5J2QA 4YB5A 2LQ5A 3AT1B 4BWJA 1IR2A 3KUGA 2W4CA 4CLFA 3RAMA 2BE2A 5D15A 5I3UB 4OZ3A 3LAKA 2D1CA 1S1TA 1S72S 3UN5A 2VH7A 3DU6A 3LALA 2RUSA 2FC9A 2JH3A 2E1AA 4H54A 1NHVA 3JSBA 4ITSA 2HGMA 1QAJA 3KWMA 3CJ4A 2AGOA 3C66A 1SH0A 3OFGA 1M0SA 1PYTA 2B3TB 3EDQB 4P6QA 4RPFA 2JNJA 2XMMA 1Q8LA 2C1EB 4G65A 1ZM2A 4WXWA 2NREA 3AFGA 2B0GA 1XMBA 4FBUA 2BKOA 3DMJB 2L9WA 3VVUA 5H9EJ 4OYPA 1RHUB 3CULA 3D0IE 4WFBQ 5E0OA 1GNKA 2HGNA 2WZ1A 3TZZA 3PJ9A 4EWTA 3M2VB 1RHMB 5GMDA 2CJQA 3EPIA 2MKIA 4R0EA 3FC9A 1PSDA 4ZJQA 4Y34A 4DEZA 2Q43A 5EN1A 2DIVA 2Z2LA 4PKDB 5IWAJ 2C3UA 3CCWA 4CP5A 4Q8EA 1HBOA 3SFUA 3BSCA 2PFFB 1HKAA 4U8VA 4QWDA 2B51A 1J5EJ 2ZNZA 3R6GB 2EXUA 1S59A 3DGPB 2QE5A 3D0GE 4DUZJ 1D0EA 1S10A 3KLFB 2JEFA 2CPXA 1KLMA 3LOUA 1P6TA 3Q0AA 2Z2MA 3AXMA 1WI6A 2PA3A 1QTNB 5K8MA 2MY7A 2RAQA 3DOKB 3CC4S 1VQ7S 3TYTA 2E7VA 4A47A 3G87A 2YKPA 3Q8VA 4LFAF 2FD2A 3M6XA 4YOEA 3FDSA 4M5NA 1RU2A 2V69A 1U2FA 4I64A 2ATLA 4NLGA 4DR3J 3QSIA 4YHHJ 2R7TA 2V68A 2GVZB 2BM0A 5KG6A 3OTOJ 2DKOB 1XNQF 3JSMA 3RTVA 1XEZA 2MQMA 5IT9U 2HPUA 4EBDA 5LM7E 5D8HB 3PKYA 1CJKB 1R7IA 3G96A 2VPZB 4HEA9 4AL5A 3NEKA 2I2YA 3N6LA 4MTPA 3CO0P 1EJ7L 2WOMB 2AYBA 2JOQA 3QMQA 1CC8A 4PYAA 3GSIA 1M1GA 2XSJA 2W01A 2HMIB 2QL5B 4C8KA 4Q44A 4A8WA 4QIEA 5A8KB 1NCLA 5ETMA 4ZPAA 4OYAA 4LF8J 1S57A 4LT6A 4IFVA 2FLOA 3A13A 1Q16B 3QIPA 5KFUA 3TVYA 3DLBA 3I6PA 3M9MB 1U2RA 2HK3A 4OL8A 3BSOA 2R2SA 3THPA 3OJSA 5KFZA 2UXBJ 4OX9F 1P9YA 1WTBA 1NH8A 3BYPA 2ZHAA 2ZH6A 5J1EA 3NCQA 1TFWA 4RZRA 3VVTA 3C3LA 2ZOFA 2DR8A 4N77A 4G3IA 1V3RA 2F40A 1D9DA 1TAQA 3TO8A 2CNOB 5GADI 3Q8YA 2UUBF 3PG9A 3VAKA 4F2RA 2YKMB 1SC4B 2OO4A 5JUMA 1GFWB 2BX6A 2MGZA 4H4KC 3NGDA 2VPYB 1AB8A 2H4YB 4LVNP 4WP9A 3MM7A 2N4CA 3PYGA 2NPIA 1YJVA 4GVBA 4ZPDA 4CLUA 2VA2A 3K2YA 5E41A 1G1XA 4KFBA 1JLCA 4L73A 4C8NA 3N5BA 4IRKA 4DSFA 3POTA 1WC1A 4K4SA 1RWMB 4NASA 1VLYA 1FTCA 2IJFA 2VFSA 1ZZNA 4P2XA 4RUBA 2HZCA 2RRBA 3C16A 3IWXA 1IM4A 2A2DA 3ZZPA 2FZKB 3MEDB 3TAMA 4FXWA 1Y0HA 4A8YA 4KB7A 5ETOA 5FDLA 2QN6B 2WVFA 2OGUA 4ANEA 2GFFA 1KQFB 1Q5VA 1KQSR 2JJ4D 1SV5A 2XGPA 2YWKA 5J2PB 4DV6J 1JQGA 4NLXA 3M9OB 3IMQJ 2PI4A 2CG8A 2LXUA 1JK9B 4YMEA 1HQEA 1YBAA 3HDSA 4NCGA 4B08A 5F8MA 4CI0B 2CZVC 3AJDA 3GG0A 4K50A 4X4SA 2GMLA 3IN5A 1RXOB 3VR1A 5IWAF 2LXFA 2DT9A 1O5JA 3MEGB 5DLGA 5E33A 1TKZB 4Y2IA 1DTTA 4I6YA 4OHWA 2ZOGA 4UOGA 2VA3A 4DJBA 3CXCR 1NEEA 1J5EF 2M8HA 3GJRB 3J7Z5 1U09A 2Q6BA 4N8NA 1NSQA 3C14A 1RLCL 4KJIA 4I6WA 1NJZA 2NYIA 2VD3A 3ENQA 1N52B 3MR5A 1SKSA 1PJ6A 3FRZA 4DUZF 4IKAA 1EZZB 4J9QA 1E6YA 3CIMA 4LF6F 3GFXA 2E5HA 4K2XA 2KN4A 3T5HA 1NKBA 3AODA 1G2EA 5HO4A 4I0WA 3MCOA 5K9FA 2ZHBA 2GHPA 2ZWPA 2GZOA 2YNHA 1HL6A 2DHSA 5B0DA 2XMAA 1JLEB 2CIMA 1U1KA 1I6JA 2VHGA 1CJTA 2BJEA 3W62A 2MHNA 3UWTA 2VBZA 1B4SA 4YHHF 3JYTA 3DLGB 3OTOF 1HYSA 3R9LA 3RRKA 4WK3A 4U8YA 1T3OA 4F4KA 4PPDA 2MJNA 1H7XA 3H20A 2VBYA 3R97A 5CYMB 1ZM4A 3PYEA 4DFKA 2OSRA 2ASJA 3L4BC 2BACA 1RBLA 3B4MA 4DV0J 3BSAA 3ILJA 4NE9C 3CW2C 4USTA 3PR4A 2FQQB 3H5SA 2AU0A 3DOMA 1ZS6A 2WONA 1RI7A 4DPWA 2Y9HA 2Y1RI 3NBPA 1SC1B 2C2ZB 4ZVGA 2RRAA 4LF8F 5C42A 3GYNA 4NLYA 3MMBB 3LP2A 1HBMA 2JC1A 3AJ2A 4G1IA 3DOLA 4FXVA 2UXBF 2LP4A 5ETLA 3RR7A 3CJ3A 3P4UB 1OS5A 3N79A 2IJRA 2WW4A 3TQ1A 2XSFA 2JLEA 4O4RA 1B70B 1CJUB 2W4PA 1QLNA 4ZKAA 2I0XA 1U1NA 4F8RA 5A6PA 2DCLA 2G2ZA 3KFWX 2KL8A 3W60A 2HZVA 2HBRB 3MWBA 2B8PA 2D3OR 1N34J 1BQNA 1KVJA 3BO2A 4DSKA 3KYLA 1FKOB 3PW0A 2ASYA 1AT1B 4YDDB 4OI1A 3N28A 2M7SA 2VKRA 2RS8A 3KLEA 1MU2A 1JJCB 2QA4S 1J5OA 5DG9A 3M7VA 3BZQA 3BYRA 2YWFA 4Z2XA 1NK6A 4NRTA 4EK2A 4HVZA 1FT8A 1WG5A 2CPDA 3M6WA 5KFLA 5HVHA 3BF4A 3DLEA 3KXDA 1WJ9A 4DWIA 1UJ5A 1VHFA 2CJBA 3HO1A 4NEYA 4B9VA 3GB0A 2DY1A 2FJVA 3RB4A 3FQKA 2CPZA 4UT4A 3BO4A 4ILLA 2X51A 3T9ZA 3QWPA 4EO8A 1RABB 1VIOA 1JNRB 2RE1A 3CCQS 3IGNA 4DV6F 3J81Y 2ZZNA 3VGSA 4LF5J 1EKSA 3TJ9A 4RUHA 1TKXB 3PRDA 1R8CA 1FWKA 3TAQA 4RBTA 4TY9A 1IQZA 2LA4A 5EX0A 3GIJA 3NNAA 3ZZ0A 1HI8A 4TN2A 5DM6Q 1AFIA 3D6TB 3M8WA 1UMJA 1MN7A 1HBUB 4XIUA 1X0FA 1S1XB 3QGHA 5LMUJ 1O51A 1Y4ZB 4M63A 4AD6A 2ZH1A 5KT7A 2IIHA 4KYZA 2KHCA 3RRGA 1RT7A 4EO6A 2J6TA 1AYEA 1TK5A 3KDNA 3ZNUA 1FDDA 1M1HA 2PEBA 2FPHX 1Q82T 1X4EA 5J1NA 3TA2A 3RB6A 3W2VB 1JJ2R 2VG5A 1VISA 4DMZA 2HHSA 3ZO7A 2GGPA 3CCMS 2YNGB 3T5KA 1M5OC 2J0SD 2DYAA 2QO3A 2RF2A 4IO9Q 4ZP8A 3RB0A 2MKYA 2ZH3A 4HT7A 4QR2A 5J2NB 1R31A 5IQQA 1X4BA 3W63A 5B0CA 1YZ7A 4OV6A 3MMCB 5HQLA 1IKYB 4KKOA 1LWEB 1F5AA 2GO8A 4JI8F 4OYBA 1S6UA 2Q3PA 4OYXA 5GMKa 4AQYJ 5H1SV 4KV8B 2UUWA 3H2VE 4DV0F 4DCPB 3TA0A 5DZ6A 3RZAA 4BDPA 3KJQB 4JI4J 2YBVA 2C28A 4B3SJ 4HH1A 4P2FA 4BS2A 3FVYA 2VG6A 3HZEA 4IOAQ 3OVBA 2GQQA 3WX4A 3M30B 5LOQA 4CLLA 2RDDA 4PABA 4AFFA 2Z2ZA 3CIZA 2Y0BB 3NGSA 2X1GA 4I2PA 1UCNA 4J9SA 1LWCB 5FIIA 2J76E 5L38A 1JLQA 3DGVA 3CB4A 2MZTA 3K5LA 3HK2A 1DHMA 1SL2A 3S8SA 4R8UB 4IOCQ 4AYBD 4LIWA 1AROP 4NLOA 4OQJA 4RNMA 3R8YA 4A8OA 4DS4A 2VPWB 1CVJA 2B5JA 3N01A 1VOMA 5IT9Y 5DG8A 2XO6A 2YKOA 5KOWA 2AIRB 3BGUA 2HS4A 3FGVA 2XLKA 1I5OB 1N34F 1MWYA 2C2KB 5I4MA 4O3QA 5IV4A 1CULA 2DEJA 1WTFA 4N76A 1GXUA 2ALZA 1RDRA 4O4GA 5G4DA 2HVEA 3BM7A 1N56A 1OMSA 4MFBA 3OTCA 5AXKA 1Z1ZA 4ZCKA 4TU8A 4I56A 3LAMA 3UR0A 2OEMA 4EU0A 1FHTA 1YHQS 1NJYA 2ZBRA 2P9EA 1RWNB 4ZVEA 5DG7A 2V34A 1G7CB 2CKWA 2OSQA 4NI2B 3RR8A 5IQ6A 2BANB 4ED7A 2G13A 4B9TA 4WP8A 3NWRA 1Q53A 1G3OA 2LA6A 3WIVA 1OIAA 2VKZG 5AT1B 2PMHA 2CJAA 1URNA 4QWEA 4ID5A 1NK9A 2OD6A 5G0RB 4DX6A 4I7FB 1Y11A 3BGRA 4F3MA 3BBBA 2CG4A 4P74A 4ILRA 4KIAA 3KHLA 4B9LA 5A2QU 2HNZA 3QO9A 4WE1B 2LFVA 5IM0B 1YTYA 3KG1A 4X62J 2YWHA 3GYGA 3KJNB 2RUGA 5H9EK 1OYDA 4DL2A 4ZS6A 1QSSA 1CJVB 2J8SA 4ALZA 1CSJA 2MZRA 3CE8A 4P73A 3HHLA 5LMUF 4OZJA 3PFOA 1C0UA 2CXEA 4CO0A 3J7AN 4ED4A 1C4AA 2XMVA 1F2GA 3OPKA 3UI3A 4DSIA 3L3CA 4CYUB 4R5PA 3Q2TC 2ZBIA 5DDQC 2XNRA 3P5BP 5M2PA 3WQPA 3D28A 1N48A 4KH0B 2A1BA 3PNIA 2R42A 3VAMA 3GV7B 1KVIA 1S97A 2HRYA 3MECB 1DQ8A 2BZ2A 3THVA 4TY8B 2J0QD 2W2NP 1RWUA 1KSPA 2M0GB 4DU8A 5DGBA 2DH9A 5KT2A 4P7TA 2OPQA 4IO1A 3CCES 3HF5A 2I5JA 4Z7YA 2QSWA 4J5OA 1N33J 5HP1B 3J7ZT 4CQ1A 5IFMA 1RAJA 2ALYB 1GMUA 2JZ5A 2PE8A 1Q5YA 2HZAA 4QR0A 5CABA 1S0VA 1WF2A 3BN4A 2K06A 1V9OA 3EZOA 3UNGC 4D3GA 5IV3A 4PG8A 2W9AA 4AQYF 4U96A 2ZKTA 3OHBA 3Q8RB 2DXFA 2R8JA 3KHHA 2WSCC 5J2QB 2G1HA 4ICLA 2CQCA 1FNMA 4EI2A 4ZMMA 4JI4F 4U6PA 4RUCA 4ECZA 1X0PA 3CVKA 2CRLA 5ADZA 4B3SF 3CJKB 3NS5A 4ZJLA 1S1TB 1H0HB 1FVSA 3K5PA 3DRPA 3BEGB 2DVIA 4Q8FA 3GJTB 3W2WA 3FFIB 3SI8A 1L3SA 2WCXA 2UU9J 1KQGB 1NZ8A 1SJQA 2DRDA 4C6AA 5BJRA 4HI2A 2NPFA 2CQ4A 1GH8A 1LK7A 1QUPA 2LVWA 4RW9B 3MTJA 2G0IA 1VMBA 2HQCA 1TVRA 2BABA 1R6YA 2NXNA 4X2BA 5I3QA 2JWNA 1VBYA 3QRPA 4C4WA 4NX9A 1TAUA 3R5GA 3MAAA 2QLFB 2I6WA 2EFNA 2RQ4A 2FHJA 2NYHA 3GV5B 3GPAA 3DDNA 4X4TA 2IM1A 2YNFA 2B43A 5JMNA 1ZA1B 4DV1J 1N6QA 3R5AA 1RWPB 5LSOA 4YUDA 4OJ3A 1X8DA 2MEWA 4HI1A 1Q7LB 4PWDB 5LXYA 2HBYB 4C11A 2QMWA 4FN5A 4GKJJ 1HBOB 2U2FA 3G82A 3QZ8A 3VAGA 4AL7A 3AQOA 4PPZA 1C2PA 2HGLA 4ID8A 2H5JB 4PUOA 3B82A 1DLOB 4PWWA 4NLWA 1PC5A 3CJQA 2L08A 4CO5A 2UVVA 1UJ4A 2AGQA 2R7QA
chains in the Genus database with same CATH topology
1FX2A 1WC3A 1YBTA 4OYMA 1U0HB 4P2MA 1WC0A 3MAAB 3ET6A 4NI2A 1TL7A 1CJTA 3C14B 4USVA 4OYZA 4P2FA 3C16B 1AZSA 5IV4A 1CS4A 1CULA 2W01A 4OYIA 1WC5A 1CJVB 1CJUB 4OYOA 1AB8A 3UVJA 4CLYA 1YK9A 5D0RA 3R5GA 3MAAA 1FX4A 4OYAA 4WP9A 5IV3A 4CLKA 4CLLA 2GVDB 4CLWA 4CM0A 4CLPA 1CJKA 2QV6A 4CLUA 1CJVA 3C15B 4OYPA 3G82B 5D0GA 1WC4A 1WC1A 1U0HA 3MR7A 2WZ1A 4USTA 3ET6B 4NI2B 1TL7B 1CJTB 4P2XA 3C14A 4CLZA 4WP8A 3C16A 4OYWA 5D0HA 1CS4B 4OZ2A 4CLSA 1CJUA 3G82A 1YBUA 3UVJB 2GVZB 4USWA 5D0EA 4OYBA 4CLTA 1WC6A 4WP3A 4OYXA 4WPAA 2GVDA 4CLFA 4CM2A 5D15A 4OZ3A 1CJKB 1Y10A 1Y11A 1AZSB 4USUA 1CULB 2BW7A 2GVZA 3C15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FX2 A;  1WC3 A;  1YBT A;  4OYM A;  1U0H B;  4P2M A;  1WC0 A;  3MAA B;  3ET6 A;  4NI2 A;  1TL7 A;  1CJT A;  3C14 B;  4USV A;  4OYZ A;  4P2F A;  3C16 B;  1AZS A;  5IV4 A;  1CS4 A;  1CUL A;  2W01 A;  4OYI A;  1WC5 A;  1CJV B;  1CJU B;  4OYO A;  1AB8 A;  3UVJ A;  4CLY A;  1YK9 A;  5D0R A;  3R5G A;  3MAA A;  1FX4 A;  4OYA A;  4WP9 A;  5IV3 A;  4CLK A;  4CLL A;  2GVD B;  4CLW A;  4CM0 A;  4CLP A;  1CJK A;  2QV6 A;  4CLU A;  1CJV A;  3C15 B;  4OYP A;  3G82 B;  5D0G A;  1WC4 A;  1WC1 A;  1U0H A;  3MR7 A;  2WZ1 A;  4UST A;  3ET6 B;  4NI2 B;  1TL7 B;  1CJT B;  4P2X A;  3C14 A;  4CLZ A;  4WP8 A;  3C16 A;  4OYW A;  5D0H A;  1CS4 B;  4OZ2 A;  4CLS A;  1CJU A;  3G82 A;  1YBU A;  3UVJ B;  2GVZ B;  4USW A;  5D0E A;  4OYB A;  4CLT A;  1WC6 A;  4WP3 A;  4OYX A;  4WPA A;  2GVD A;  4CLF A;  4CM2 A;  5D15 A;  4OZ3 A;  1CJK B;  1Y10 A;  1Y11 A;  1AZS B;  4USU A;  1CUL B;  2BW7 A;  2GVZ A;  3C15 A; 
#chains in the Genus database with same CATH topology
 4F0K A;  2CNL B;  4RX6 A;  1EP4 A;  1HNV B;  1BGX T;  4IH7 A;  3AA9 A;  2F5G A;  3EXC X;  4U95 A;  1RAG B;  4O3R A;  2KRB A;  5CD4 A;  4U67 Q;  3S7R A;  1RTJ B;  3EPG A;  4C48 A;  3QWU A;  1VQY A;  3KLI A;  4URS A;  4UOH A;  3UDE A;  4JYA J;  5CYJ A;  2ZHO A;  1RT3 A;  4LF2 A;  5HAO A;  3SMZ A;  2R2R A;  5BYR A;  4X62 F;  3ET6 B;  1YRU A;  4ECQ A;  2IJN A;  2N7Y A;  2IMO A;  4USK A;  3R1H A;  1C1C A;  4UUW A;  4C97 A;  1S6Q A;  1OPI A;  2QX0 A;  5CZX A;  2KJW A;  3ZC4 A;  1NB2 A;  3PYD A;  5IC6 B;  2DNM A;  3GTY X;  5HSP A;  5L39 A;  1XNR J;  3M8Q A;  4ZOS A;  3PR5 B;  3AH6 A;  2DHA A;  1TFY A;  2DHX A;  3G6X A;  1XMQ J;  3PXG a;  4BCA A;  3M2R B;  5KFC A;  5L1K A;  1YJU A;  3ULH A;  4ER8 A;  5D6G A;  5KFB A;  3NG8 A;  3NAH A;  1LEO A;  1HNZ J;  4TNO A;  2R7O A;  1YGY A;  4LBH A;  1S5Z A;  3MD1 A;  3I5A A;  2ZD1 A;  5CAA A;  4J9M A;  2JFD A;  2KVQ E;  4Y0F A;  2FZG B;  5DM7 Q;  1CEZ A;  1HW9 A;  4CLP A;  3VAI A;  1LNQ A;  3UN3 A;  4WBF A;  1P1T A;  2W7A A;  3BH6 B;  1SJ3 P;  4LF9 J;  4P71 A;  2FVR A;  1HNX J;  2M3D A;  3V6D A;  3MD3 A;  2G0J A;  1FKA F;  3AD8 C;  1WI8 A;  1VRU B;  1NKE A;  1TMJ A;  4OYW A;  2MY8 A;  2VJV A;  3SYZ A;  3NL0 A;  1JX4 A;  4OI2 A;  2KJV A;  4D3H A;  4C8M A;  2MGZ B;  1U8S A;  3N0V A;  5KG3 A;  1X60 A;  2B6A B;  3F0N A;  1EX8 A;  3TEG A;  4C3L A;  4IG3 A;  3G8T A;  5B0A A;  4H4M A;  3M8P A;  4RLE A;  1X9W A;  1ZTT A;  2YVS A;  2KRR A;  1SCJ B;  5FLX U;  2AP6 A;  4DPU A;  1R0A A;  2B9Y A;  4EMD A;  4ZN1 A;  4GVB B;  2Z4P A;  4DZ6 A;  2JHE A;  1D8Z A;  2IBO A;  1JLC B;  3I5B A;  3ELH A;  2CDQ A;  3D6F B;  2K7J A;  3E8O A;  3E01 A;  2HLU A;  3PDN A;  5KFO A;  2UU9 F;  2XS7 A;  3SCI E;  2QV6 A;  1RTI B;  4B3O A;  3C19 A;  4ZVS B;  3ZZY A;  3IG1 A;  3IBC B;  1N36 J;  5KFG A;  3PZP A;  3I5C A;  3EVM A;  2ASD A;  1KP6 A;  2BJ1 A;  1X4C A;  4HKQ A;  3HSD A;  3A3N B;  1JNZ B;  1C4C A;  1X5S A;  3D9B A;  2PFD A;  1WEY A;  4QPT A;  1UPP A;  2DIS A;  2X3G A;  4FYY B;  3HJF A;  3RUB L;  1L3T A;  1FE0 A;  4F50 A;  3H0P A;  4ZHR B;  5HMZ A;  2VFT A;  3U02 A;  4DV1 F;  4FVM A;  2BYC A;  1B7Y B;  1LOU A;  5EWF A;  1N0U A;  1TZ0 A;  2UUT A;  3BR9 A;  4LRF A;  3NOC A;  3L95 X;  1FXD A;  2ZBQ A;  4GKJ F;  2OIH A;  2DNY A;  1JLG A;  2CPJ A;  1T9T A;  1DTT B;  3I0S A;  2VQE J;  4RL1 A;  2FY8 A;  3FZB A;  3DI6 B;  3DRS B;  4MIW A;  2P6T A;  3NCR A;  1A0O B;  2CPY A;  1GT8 A;  1YJT A;  2IHR 1;  4JI0 F;  2B7B B;  2VIC A;  2AZ1 A;  5K14 A;  1UA0 A;  2D41 A;  4QU7 A;  4JI7 J;  2XQC A;  2BQ3 A;  5J2M A;  1Z2Z A;  4J7C A;  1JIH A;  2KFZ A;  1OQ3 A;  2AD9 A;  4P10 A;  2MQL A;  5HAN A;  1UL3 A;  2HUR A;  1WEZ A;  1F5C A;  2YNH B;  1NDK A;  4ZIW A;  3MEE A;  1RTD B;  1YVF A;  1UFW A;  1NPK A;  5CCM A;  3MGJ A;  4JYA F;  3LWL A;  4HTJ A;  3BGL A;  3IAM 9;  3NGK A;  2KO1 A;  3UQS A;  3QID A;  1EAR A;  1JLA B;  3H4B A;  4E0D A;  3PEJ A;  4UQG A;  3R3T A;  2JEG A;  5K20 B;  2GJI A;  3MM5 B;  4WYW A;  1Y3K A;  5KFW A;  4DV3 J;  2V2Q A;  1X9M A;  3UVJ A;  4ECY A;  2OFG X;  2RJZ A;  3BSN A;  1QSL A;  1XNR F;  5IC4 B;  2R7W A;  4ZPB A;  4LRE A;  1PKU A;  2GNK A;  2E9Z A;  3MM6 A;  3O2I A;  4F0H A;  3NBP B;  1NHU A;  5K5M A;  4GKK J;  1T0T V;  5KFE A;  2XMW A;  4O3O A;  2QLX A;  3T41 A;  2HHH J;  1HNZ F;  4DR6 J;  2VUG A;  5DDP C;  2N7C A;  1PYS B;  3G9C A;  3LP2 B;  4OJG A;  3JQM A;  2E1M C;  1SC6 A;  4O0N A;  4N47 A;  1ELO A;  4QW9 A;  3HSJ A;  2AF6 A;  2DNP A;  4FKY A;  2MQQ A;  4V19 X;  3K58 A;  4L75 A;  4QWC A;  1F60 B;  1S1V A;  2CAJ A;  2W9C A;  4YFU A;  3T1A A;  2MYF A;  1PJ5 A;  2YQ0 A;  5KFT A;  1HNX F;  3NP5 A;  2J9D A;  5M2R A;  2ZUG A;  5D78 A;  2BJ8 A;  1KFS A;  3ISN D;  3I4P A;  3HFZ B;  6FD1 A;  2YX4 A;  2YX7 A;  4DPY A;  4CT8 A;  3H2U B;  5HLF A;  1H98 A;  2XBP A;  2Q66 A;  4A48 A;  3BBF A;  3HKZ D;  3CT9 A;  2DR5 A;  4FXD A;  3B6B A;  3GU0 A;  4HL9 A;  5I42 A;  4DQR A;  2XS5 A;  4RW6 A;  1KOH A;  5GAE I;  3DHW C;  2JX2 A;  3R5D A;  5F0W A;  4NLR A;  1SJF A;  3T19 A;  3TR5 A;  5D77 A;  2LCW A;  1T05 A;  1S99 A;  4RBV A;  1F3F A;  4ZVP B;  1C0T B;  1FRI A;  4TU7 A;  1WD6 A;  3A3O B;  2AYM A;  2HW3 A;  1P27 B;  2WSE C;  1PBU A;  2UXD J;  2ABY A;  3I96 A;  1VDH A;  1I51 B;  1N36 F;  4UY8 5;  3EGW B;  2HKE A;  5H9F J;  2OH2 A;  4P52 A;  2J9D E;  4FYX B;  4H4O B;  1CLF A;  1U6Z A;  2UV8 A;  2YWG A;  5BR8 J;  2HQI A;  2AHO B;  2P9G A;  2BV3 A;  3T6B A;  2YY3 A;  3DLJ A;  4M5K A;  2B4P A;  5EUH A;  5B08 A;  5KFV A;  2ZC4 A;  1NDL A;  4OHV A;  1X5T A;  1RU1 A;  4KGZ B;  3R6L B;  2NSB A;  3W9J A;  3ILL A;  2VZ9 A;  2ZVI A;  1QM9 A;  4OZ5 A;  1EIY B;  3V4I B;  3VWS A;  3MR6 A;  5J1P A;  1MML A;  2ZBP A;  4B9S A;  3Q8S B;  3X1L B;  3JAM Y;  2IA6 A;  2X1A A;  3PW5 A;  1EET A;  4J9N A;  3M2U A;  2XS2 A;  4KQZ A;  2VQE F;  3D3C J;  2N3L A;  2M70 A;  3UD5 A;  4DQI A;  2ILY A;  2DO0 A;  1WAC A;  1H6K X;  5HBM B;  3RBE A;  4F25 A;  4JP8 A;  4LMZ A;  2QTW A;  3BBC A;  3BKU A;  4MIB A;  5C24 A;  4EGL A;  2VG5 B;  2VIH A;  4JI7 F;  5T7L A;  3QNW B;  1TL7 A;  2GGP B;  2HHP A;  4X4P A;  2QFJ A;  1HWK A;  2HNY B;  2ADC A;  3L7P A;  5GAD U;  3FBF A;  2O1P A;  4K4U A;  2I1R A;  4OZ1 A;  4CTA A;  4CRJ A;  4F67 A;  3EYZ A;  4F7V A;  5C7P A;  1WF0 A;  1VK3 A;  4DQS A;  2KT5 A;  2IVY A;  3BRE A;  2RHS B;  2J0X A;  1OQ6 A;  3UO0 A;  2V9K A;  4LR7 A;  1SKR A;  4DUY J;  2BXJ A;  5D0G A;  4JI2 J;  4NLS A;  4PG4 A;  5DZ7 A;  2NXU A;  2L3M A;  2XG8 A;  4Y00 A;  4DV3 F;  1O6X A;  4X4Q A;  3T1Y F;  1WF1 A;  1KS2 A;  3ISZ A;  2V2Z A;  1TU0 B;  4TKT A;  1FFS B;  3VF0 B;  1Y10 A;  6AT1 B;  2VG6 B;  2DRA A;  3BH7 B;  2HRT A;  1VGY A;  4KO0 A;  3C2P A;  3FQL A;  5DQI A;  4IR9 A;  3J7Y I;  1YLX A;  2HHH F;  4DR6 F;  4FVC A;  3KLH A;  3M9N B;  1DUR A;  4ELU A;  2OAU A;  2J0W A;  3CDA A;  3MAQ A;  1IKW B;  2GX8 A;  2BRL A;  4BWM A;  1APS A;  1YWX A;  2VF3 A;  3T5J A;  3GQC A;  4CT9 A;  3PV8 A;  2XI3 A;  3OR2 A;  5B0G A;  3VZI A;  2LXI A;  3IR7 B;  4EFA C;  4YDX A;  3MMA A;  3KJV A;  1RTZ A;  4QYZ K;  4MKY A;  3PY8 A;  3CJS A;  3EIC A;  3I0R A;  1HA1 A;  3QJJ A;  1B99 A;  2EBE A;  1QY7 A;  1JLF A;  2IRY A;  4DPO A;  2C3Y A;  2Z0G A;  3FBB A;  1KON A;  5T14 A;  3BQ2 A;  2XYP B;  1EB0 A;  1EHW A;  1CUL B;  2KB2 A;  1BC6 A;  2IRX A;  4DQQ A;  1KVK A;  4XTT A;  1UVM A;  1RE1 B;  2AQ4 A;  2DCU B;  4I2Q B;  1U0H B;  1S9E A;  1WHY A;  3HD1 A;  4WKY A;  1MW7 A;  2BVZ A;  3OLA A;  1WOR A;  1TTH B;  4PQU A;  1SJ1 A;  2NS1 B;  2DIT A;  1RKJ A;  4I4B A;  4YN3 B;  4ZPC A;  2MQN A;  4WII A;  1UTA A;  2F65 A;  3QGP A;  2NXJ A;  3Q89 A;  2HFV A;  2UXD F;  2DGV A;  1ZA2 B;  2POK A;  3ZZT A;  4DF4 A;  3CCT A;  4IG0 A;  1RA7 A;  2C2M B;  3JQJ A;  9ATC B;  3M1V B;  4A8M P;  4ECW A;  1E6V B;  3CED A;  3IS9 A;  3LA0 A;  4E2F B;  2MXY A;  1WC4 A;  4NLV A;  2HAF A;  2RSQ A;  4ECS A;  2XZW A;  4ID5 B;  2E5L F;  4O3P A;  4PXD A;  5BR8 F;  3TAR A;  3PHT A;  2VC1 A;  7AT1 B;  5D0H A;  3FCW A;  5E3Q A;  3BGR B;  1RIS A;  2OPR A;  3HX9 A;  2QRR A;  4NXM J;  3L09 A;  1CPZ A;  3HPO A;  2NUH A;  2V94 A;  4A8F A;  4ZPW R;  3SIP B;  1TV6 A;  2E29 A;  4FDF A;  2Z58 B;  2J6U A;  1WHW A;  2AYE A;  1QE1 A;  1FWL A;  3R7S B;  4MYT A;  3ZTS A;  1HAR A;  2F8M A;  4DL3 A;  4DL0 C;  5KFK A;  2WRM A;  4EYI B;  1OSC A;  2XUL A;  1SH3 A;  2VV5 A;  2EG2 A;  3OLB A;  3HHL B;  2OUG A;  3V81 B;  4Y2M A;  1GAO A;  3IRW P;  1C0U B;  4WK1 A;  2VC0 A;  2JVO A;  2EW9 A;  1SH2 A;  1L3U A;  3EJM A;  2IAJ B;  1R0C B;  3W64 A;  2FJW A;  4R5P B;  5I3U A;  3QLH B;  5U47 A;  3RYL A;  1UPM B;  1RP5 A;  3LUY A;  3B4D A;  5KFJ A;  2RNE A;  4M94 A;  1HBN A;  2KVI A;  1KN6 A;  2VG7 A;  5D4N A;  4LRC A;  2AGP A;  4DR5 J;  4PWU A;  3MM9 B;  1DY3 A;  1FO1 A;  4O23 A;  1IWA A;  3ADA C;  2Z8Q A;  1SKW A;  3DU5 A;  2RVJ A;  4KBI A;  1HHT P;  4IFY B;  5MLC V;  1RT4 A;  2I5J B;  4DBQ A;  2EK1 A;  5ETP A;  4HAC A;  4KHM A;  4NWB A;  2CVE A;  2A3J A;  2IDL A;  2XMU A;  1DBD A;  3K5N A;  3DMJ A;  2QGF B;  3CD0 A;  4GRS A;  4DUY F;  3FRY A;  4JI2 F;  2UUA F;  2PC6 A;  5D4L A;  3I31 A;  4ED1 A;  1VQ6 S;  3CJ0 A;  3HFK A;  3I32 A;  4LRD A;  1VC6 A;  3CJT A;  5CHC B;  2L48 A;  2CUY A;  4RW4 B;  3E51 A;  1PAE X;  2P9C A;  3ITH B;  3G71 S;  5CH7 B;  2NR0 A;  1IBL J;  2GC8 A;  1F6T A;  4URG A;  1IBC B;  2CQ1 A;  3CDU A;  4C0H A;  4WTY A;  2R2T A;  1OY6 A;  1Q8I A;  1VHI A;  3H59 A;  4HHH A;  1QAY A;  2AWZ A;  1HR0 J;  2WVB A;  1PBA A;  1HI1 A;  1NZA A;  3W2W B;  3DGP A;  1RCX B;  2CYY A;  3R27 A;  4O44 B;  4A8K A;  1NHK L;  3D1Q A;  3V6H A;  3QAT A;  3HHL C;  4NA3 A;  3MPV A;  3WDO A;  2CQI A;  3OSN A;  1TVR B;  3IBF B;  4DHV A;  2C22 A;  3OVS A;  2AJ2 A;  2UVW A;  4JI1 J;  4H4K A;  2CNK B;  2BA9 A;  2W8K A;  2KXH A;  2XZT B;  3DM2 B;  2FGO A;  3AD7 C;  2R7X A;  3MAA B;  1KC8 T;  3J81 U;  3LP0 A;  4FNH A;  1LK5 A;  1IBK F;  3UDL A;  3PW4 A;  2CQG A;  5KG4 A;  3KJF B;  3MOJ B;  3M6U A;  4F36 A;  3SSS A;  2KZZ A;  4X66 J;  5C25 A;  1TK0 A;  2DR7 A;  1FES A;  1CJK A;  3MCM A;  4C11 B;  4F3Q A;  4K4X A;  1IJF B;  3PJX A;  2EFP A;  4Y2A A;  2IRU A;  3G82 B;  1N5V A;  3CTR A;  1IJE B;  1UVK A;  1PIE A;  2WOM A;  4ELT A;  3VAJ A;  4PUO B;  1CS4 B;  4PZV A;  5IZH A;  1FWP A;  3N6M A;  5A8K A;  1WEX A;  1R27 B;  2NCK L;  3NS6 A;  2ATC B;  2Y8Y A;  3SCL E;  1XQI A;  3IXQ A;  3Q83 A;  4DL4 A;  1X5O A;  4CWB A;  2H48 B;  4TLR A;  1U49 A;  4E8U A;  2LQB A;  2ZC3 A;  4DCJ B;  5KT6 A;  1F9F A;  3HHN B;  4F3O A;  5HK4 A;  5AE1 A;  5B7W A;  1LXJ A;  1BHN A;  1F1B B;  5E7O B;  3PX0 A;  4U9R A;  4DG1 A;  3L7O A;  2IC3 B;  2PMZ D;  1RT3 B;  3TI0 A;  1NK5 A;  4NXM F;  1YZ6 A;  3PIO Q;  1HMV B;  4NLP A;  1W25 A;  2UXC J;  3D7S B;  3DLL Q;  2P8I A;  2YKN B;  1C1C B;  1S6Q B;  4NLD A;  4O3S A;  1N8R T;  2YKM A;  5KTQ A;  4X64 J;  1WDT A;  2H51 B;  2GQ2 A;  1DAR A;  2FTR A;  2NLW A;  2V50 A;  3M8Q B;  3BQ1 A;  3AY0 A;  1T11 A;  3I82 A;  4Y2C A;  2FHK A;  2V2K A;  2MQ8 A;  4KTQ A;  2W2M P;  1FJ7 A;  2BBE A;  3PCO B;  4NZ6 A;  1NME B;  4F2S A;  4ERD A;  4RWW A;  1GTH A;  4W92 B;  3EVW A;  4CCH A;  5GME A;  3G6E S;  5ITH A;  2D9O A;  2FVS A;  1U48 A;  4JB8 B;  4K0K J;  1U45 A;  2P5V A;  1RT6 B;  2R2U A;  1IR0 A;  5GAH U;  1T9W A;  3GR1 A;  4DR5 F;  2KFN A;  2M88 A;  4AT1 B;  3M8Z A;  2GHV C;  2GCF A;  3MED A;  3V6K A;  1YK9 A;  2OEJ A;  4JV1 A;  3V6D B;  1MRO A;  3WZ0 A;  1LFW A;  3HHD A;  2YH1 A;  4ZLP A;  2EFO A;  3K8V A;  3ILO A;  1U1L A;  2HSE B;  5IT4 A;  3AOA A;  5J2P A;  1SB6 A;  1SQG A;  2V8D A;  2KFY A;  2V4J B;  1JXE A;  4AE5 A;  1B3T A;  2VOD A;  1Q79 A;  3CO9 A;  4IG3 B;  3H8Y A;  2YPZ A;  4AXI A;  1IBL F;  1HNW J;  3M8P B;  1K44 A;  5EWG A;  3PEH A;  4CM2 A;  2DEI A;  3NGU A;  3HMJ G;  1R0A B;  1YSJ A;  4DX7 A;  4JV2 A;  4ZK7 M;  2ZOM A;  1UEU A;  2AX1 A;  1U6F A;  1TKZ A;  3M8S A;  1NK4 A;  1S7H A;  2HS3 A;  2KXF A;  1HR0 F;  1KRP A;  5KFR A;  3E01 B;  1FRJ A;  4DV7 J;  4RW7 B;  2CZ4 A;  2NQP A;  4ZLJ A;  3OXG A;  2R7U A;  2E66 A;  5ETK A;  2AJ4 A;  4U7U K;  4UOC A;  1TKD A;  1WOP A;  1RT5 B;  3KUH A;  2U1A A;  1S0N A;  3OXF A;  1RAD B;  3QT5 A;  4KHR A;  2DGS A;  3VAF A;  3U27 A;  3A1Y G;  1UWB B;  4A4J A;  3I9V 9;  3QPI A;  1PO6 A;  2QA4 G;  3TRG A;  1HWJ A;  1JLE A;  1XTZ A;  2J7W A;  2Q79 A;  4OI0 A;  3PAC A;  2R8H A;  1NJX A;  2HFS A;  2XHW A;  2G2O A;  4DOZ A;  3DLG A;  4DXL A;  1S9G A;  1DQ9 A;  4YR2 A;  2MLY A;  2E9R X;  4X66 F;  4LFC J;  2OJ3 A;  5CYM A;  4NXN J;  2HHW A;  2ZDO A;  3UNY A;  1LXN A;  4WCE Q;  3GFY A;  4F0M A;  2VB6 A;  3U1N A;  3M6V A;  1I3O B;  1S48 A;  2WW8 A;  2HBQ B;  3D1H A;  3FSX A;  1TR0 A;  3MM8 B;  3KG0 A;  3LGM A;  3SQG A;  3RAQ A;  3KK1 A;  4OHZ A;  4RW8 B;  1X4D A;  1XMO J;  1PG5 B;  3W3S A;  3K7R A;  4F02 A;  2O01 C;  2LQ8 A;  1HD0 A;  4WXO A;  1FA0 A;  2RS2 A;  5J2M B;  2L9N A;  5LJ3 Y;  3W8P A;  2FVC A;  3PW2 A;  3QAE A;  3MEE B;  2KHD A;  2XYH B;  4O3N A;  1FF2 A;  3MDF A;  3CCV S;  5LL6 d;  2CWX A;  2WVE A;  1H3D A;  3QT7 A;  5THW A;  5H9F K;  1OY8 A;  1SUQ B;  1CJU A;  1PYO B;  1IXK A;  1FRM A;  2PDA A;  2UXC F;  2AX0 A;  4ZP9 A;  2W9B B;  4MYU A;  3DCA A;  4KHP J;  4GMK A;  3WC0 A;  1DJ0 A;  4X64 F;  1K9M T;  1NUE A;  1H2V Z;  1V3Z A;  3QT8 A;  4UF4 A;  4JUZ A;  4DDF A;  4PQA A;  1JJ4 A;  1QSY A;  1FFW B;  5EGY A;  2RQM A;  7FD1 A;  2VJU A;  1UVI A;  2OHD A;  1RZM A;  3R2D J;  5CYQ B;  4Q45 A;  2V4Q A;  3MM6 B;  1V5I B;  4MAK A;  1U1M A;  4MIA A;  2XC9 A;  1YX2 A;  2C2N A;  2ZBC A;  4TQR A;  2V8H A;  1X4H A;  3JQK A;  2VQF J;  4K0K F;  3C15 B;  4JI3 J;  3TP2 A;  1G4C A;  1D1U A;  1RWO B;  3D2W A;  2JLG A;  4I68 A;  2FC8 A;  4DV5 J;  1NSP A;  3OUY B;  3MFH A;  1FEH A;  4ED0 A;  2ZE2 A;  2DK2 A;  1KHV A;  3PJW A;  4HHU A;  5KFH A;  1ZAX A;  4L74 A;  4DI6 A;  3W8G A;  3QJL A;  4DR3 F;  2H5E A;  1IM6 A;  2PEH A;  3CCR S;  1KQK A;  2RML A;  1LW0 B;  1TKX A;  3FBC A;  1K1S A;  1RAH B;  2K1R B;  3R5C A;  5I42 B;  4K4V A;  4BLG A;  5KAK A;  1A9N B;  5KFA A;  5E2Q A;  3SDE B;  2HS0 A;  1HNW F;  2EC2 A;  3GFH A;  1SL1 A;  1Q95 G;  5DQH A;  2JDJ A;  2B4U A;  1T05 B;  1NDC A;  3GON A;  2BM1 A;  1S1X A;  4DCO B;  2XZD B;  2AJ0 A;  5M2U A;  3X3U A;  4K7Q A;  1VJQ A;  4LJM A;  1LW2 B;  1FER A;  1QAI A;  3D6M B;  4OIX A;  3QFH A;  3I87 A;  4DV7 F;  3ENA A;  5AXN A;  3OFH A;  4FPI A;  1R89 A;  4ZPT R;  1N32 J;  1KOO A;  3MZI A;  4NEZ A;  1U7L A;  4DPT A;  4F04 B;  1KLN A;  1YJ7 A;  1VBZ A;  3JSY A;  2RT3 A;  2LDI A;  4B02 A;  1S6O A;  2A0F B;  3HKW A;  1Q7Y T;  4NZ7 A;  8RUC A;  4PCQ A;  2HVD A;  3HVT B;  1RHJ B;  4K2J A;  2XMK A;  3MHY A;  4WFY A;  2M52 A;  1UZD A;  3KLG A;  5F41 A;  5J2N A;  1LV5 A;  2C42 A;  4B3M J;  5L8R C;  4NA2 A;  4KRW A;  2ZFH A;  3D1O A;  1BWE A;  3T9N A;  4HT5 A;  1IKY A;  1ZBT A;  1LWE A;  4CO2 A;  4OX8 A;  3EX7 B;  4J9L A;  4LFC F;  1XWL A;  4FBT A;  4NXN F;  1F5B A;  1S6P B;  3GE9 A;  1N88 A;  1T3N A;  4KV8 A;  3ICL A;  4XPE A;  3M2U B;  1R43 A;  4L6V 3;  2LU1 A;  4ECV A;  2PN6 A;  3MR7 A;  1VQ8 S;  2L9D A;  2N4D A;  3R7N B;  1WHV A;  2HVZ A;  4JV5 J;  2COL A;  1HQU B;  1XMO F;  2N82 B;  5LT5 A;  1KFD A;  1R8H A;  3M30 A;  2LEB A;  1W2I A;  3I56 S;  5AXM A;  4ENO A;  1LWC A;  3NS7 B;  3TA1 A;  1VRQ C;  1YG0 A;  1EAY C;  2DGU A;  3QGG A;  1RHR B;  1T02 A;  3GII A;  1ZZF A;  3BS9 A;  1LWF B;  4LF4 J;  2HHV A;  4GVL A;  4QQB A;  1JKH B;  9RUB A;  1JXV A;  3TQE A;  2DNZ A;  2CJX B;  3G86 A;  3A3P B;  4KHP F;  2HND B;  5DET A;  3V5R A;  2CPH A;  4DFJ A;  3QRQ A;  2BQR A;  3CCL S;  3LAN A;  1IR1 A;  4TQS A;  4WU2 A;  2HWT A;  1RJJ A;  5E3A A;  2Z2Y B;  3P5T L;  5F3T A;  5B0B A;  1KTV A;  5B09 A;  2FVP A;  3HUL A;  4DL6 A;  3PYF A;  2A6M A;  5A8R B;  1TL1 B;  1YDL A;  2R8I A;  2JL9 A;  1VQP S;  3EGV A;  2XWX A;  2X3D A;  2ACY A;  1FKP A;  3IA0 A;  5A0Y B;  1VI7 A;  1YJ9 S;  3GIM A;  2EFV A;  5ETN A;  3K59 A;  2VON A;  2VPX B;  2IDE A;  3C6T B;  2VDH A;  3G8Q A;  4JI3 F;  2HFZ A;  1M5S A;  3HHL D;  1BQM B;  4NI2 A;  1HPZ B;  4M5D B;  2BAN A;  2KZM A;  1TEL A;  4B3T J;  1T03 B;  2MDA A;  3KNG A;  3D4J A;  3KJV B;  2VFU A;  1LFP A;  1VIX A;  4RO0 A;  1X4G A;  4LFA J;  3I0R B;  5G0R A;  4ZVF A;  4DLE A;  1FK9 B;  3VQT A;  1R0B G;  4KY3 A;  1Z4U A;  3TUZ C;  1A6L A;  2HWI A;  2BE7 D;  4WE1 A;  4WJB A;  1YRT A;  5IM0 A;  3H25 A;  2G0C A;  3KUE A;  4XDD A;  2MMY A;  1VQ5 S;  3PX4 A;  2DRB A;  2Y8W A;  3H2L A;  1XBW A;  1NK7 A;  2GMH A;  3HP6 A;  3CJ2 A;  4WFX A;  1FDN A;  4LSN B;  4JOU A;  1VR6 A;  1S9E B;  1YRX A;  2DD8 S;  1ZOT A;  3GYX B;  2H5I B;  1JJH A;  2IY5 B;  1DRZ A;  3QAU A;  2E7W A;  1ZET A;  1IKV A;  4NZ0 A;  4ED2 A;  2ZWO A;  1T9Y A;  3BPD A;  4WIQ A;  2HK2 A;  2MJU A;  2ZIT A;  4CYU A;  1N32 F;  1M5K C;  4CH1 A;  4N56 A;  2DGO A;  4USV A;  3CCZ A;  2D3O 1;  2L41 A;  4IG0 B;  2X1F A;  4M5L A;  4ES2 A;  2V6A A;  3MEC A;  1JLB B;  4DSL A;  2GVD B;  1UFL A;  4TY8 A;  2XCA A;  3WBZ A;  1L5U A;  2J8A A;  1Q81 T;  1Q4R A;  2FJA B;  5B0F A;  1XIQ A;  1NH7 A;  4KR0 B;  2HIQ A;  3EMT A;  3VAH A;  3K0J A;  3ISN C;  4B3M F;  4K59 A;  2RH3 A;  1VC0 A;  5HP1 A;  2R9L A;  5GAH I;  1UAW A;  5CD4 H;  2FLL A;  3QT6 A;  2HVH A;  3P8B B;  3N5F A;  3OR1 A;  2V63 A;  4PAA A;  3W5Z A;  4S0M A;  2Z56 B;  3ILI A;  2EEY A;  1H2T Z;  2FUG 9;  2ZH8 A;  3PVX A;  1RBA A;  3HT0 A;  2OEK A;  1S1W A;  1GTE A;  3CME S;  1ZM9 A;  4BC7 A;  2E44 A;  2FHJ D;  3NXZ A;  5HQM A;  2R7S A;  1C1B A;  2CQH A;  3GG1 A;  4JV5 F;  1QD1 A;  4ED8 A;  1RCO B;  3CJK A;  3LGN A;  4KPC A;  4DV4 J;  4QPX A;  2MZJ A;  3C6U B;  2DNR A;  4UOF A;  2V8V A;  1MN9 A;  3RU0 A;  2FJE B;  3FFI A;  4EYH B;  1HBN B;  3PKM A;  2VG7 B;  1D9F A;  4XO0 A;  2DNH A;  2H4W B;  4IRC A;  3M32 B;  1RAF B;  2Y3Y A;  4RW9 A;  1N0V C;  4LSZ B;  3UR3 C;  3THT A;  1RT4 B;  4KAI A;  2IYG A;  4OHY A;  2QFI A;  4QJV A;  4HAC B;  5GAE U;  4LF4 F;  1GMW A;  2VU5 A;  4ZCL A;  5KFF A;  1AUS L;  2FDN A;  4CO3 A;  4LF5 F;  4ZDN A;  5AJ3 J;  4CLS A;  1HWL A;  3FCV A;  1N5T A;  4QWB A;  1TKT A;  3LP1 A;  4B9N A;  1VC5 A;  4CLT A;  3FMB A;  2DXD A;  5KFS A;  3FUY A;  4OLP A;  2PO4 A;  3FSI A;  1KKH A;  4ZVT B;  2EFG A;  1BQX A;  4LVO P;  3R2C J;  4DR2 J;  1CQN A;  5A8W A;  1HI0 P;  4HR2 A;  1Y3J A;  1GX6 A;  1W26 A;  2XMJ A;  4PWD A;  3G2X A;  2BW2 A;  3JXO A;  3J80 Y;  1SJ4 P;  1FJE B;  2HQD A;  3O5T B;  4OJH A;  3HFV A;  4RR5 A;  2JFK A;  2E1P A;  5ETQ A;  4J9P A;  1P8G A;  4XPC A;  4Y28 C;  5GAG U;  3MTK A;  1DLO A;  4ZLN A;  4Q43 A;  1VCT A;  1Q8K A;  2C2D A;  2XCP A;  3K8W A;  2CQB A;  4RWX A;  4LF6 J;  3AB2 B;  1HNV A;  5KFD A;  1NM2 A;  1FFG B;  4BBY A;  1V5V A;  4FF3 A;  4B3T F;  3TVK A;  2MQO A;  2YQ3 A;  2ACM A;  3KK2 A;  1MMN A;  1XN9 A;  1RTJ A;  5HRO B;  2AJF E;  5CXT A;  3K5O A;  3LP0 B;  1RSC A;  4GC6 A;  4J9V A;  3RJM B;  1NB7 A;  3FEX B;  4ZLL A;  3CMA S;  3DDK A;  1VLO A;  3VGV A;  3LWM A;  2V8P A;  2RQK A;  3MFI A;  1BMQ B;  2G9O A;  4C3M A;  4CZC A;  2I8E A;  3ET6 A;  1FD8 A;  5C25 B;  1L3V A;  4WFZ A;  1V3S A;  2XY5 A;  2WAQ D;  3HJV A;  2D74 B;  2K3I A;  3RW6 A;  2OPP B;  3JAM U;  1RT2 B;  4W98 A;  1F9E B;  1N5S A;  3GLJ A;  1RWX B;  3KOA A;  1FX4 A;  2BE2 B;  2GJF A;  3DHX A;  4Y6I A;  1X5P A;  1HD1 A;  1VQ9 S;  4DR7 J;  2MZQ A;  1B0V A;  4WZQ A;  2PI5 A;  2MQP A;  1SQF A;  2ROP A;  3M2R A;  3SFG A;  4WTO B;  4C8L A;  3IFE A;  2PGC A;  4NYP A;  1RB0 A;  3US5 A;  1QUV A;  4IH6 A;  2HHQ A;  1J27 A;  3KKF A;  4X4U A;  2EWH A;  2IPO B;  2UV8 G;  3IWL A;  2ZJR Q;  3MI7 X;  4KE5 A;  3GP9 A;  1VQO S;  1Q8B A;  2ZH2 A;  4NLQ A;  2QYG A;  2LDY A;  1ZH5 A;  3C8Y A;  4OJ1 A;  4OX7 A;  4DG1 B;  2C2R A;  4IQM A;  3NNH A;  1I94 J;  5KG0 A;  2A10 A;  1RAC B;  1M90 T;  1Q86 T;  3BPS P;  4FKX A;  4FYW B;  3O6Q A;  1D09 B;  4WFN Q;  4YY3 J;  1VRU A;  1IKX A;  1WKL A;  2IMW P;  2D9P A;  5GVQ A;  3GR0 A;  2ROE A;  2KH9 A;  3Q8U A;  4FPR A;  4DZD A;  3J7Y U;  4IR1 A;  1KR4 A;  2V67 A;  5A6W A;  3TWZ A;  4QBU A;  4WZM A;  2B6A A;  2ZUA A;  4PYD A;  1S0O A;  2XM3 A;  2F9D A;  3ZXW A;  5KFM A;  3P45 B;  3C46 A;  3IAS 9;  1X31 C;  3EZ5 A;  3AJ1 A;  3OTE A;  3WC2 A;  4DX5 A;  2EKN A;  2DGX A;  4G1Q A;  2KDO A;  4ELV A;  4DV4 F;  3FKB A;  3CDE A;  2YXL A;  3GWC A;  1K73 T;  2HIY A;  1F2H A;  2EI5 A;  1KLM B;  4WP3 A;  4QIW D;  3FSY A;  3GFZ A;  1RTI A;  1T9U A;  2C2E A;  2WB4 A;  3V2U C;  3EGN A;  4UZC A;  4DFM A;  2EPI A;  4B3R J;  1MRO B;  4DV2 J;  1NAQ A;  3VTI A;  1FEE A;  2YH0 A;  4J90 A;  4U7U D;  2CDR B;  5DS7 A;  4OYI A;  1T94 A;  5AJ3 F;  1T7P A;  2CPI A;  4C3K A;  4MT1 A;  4P72 A;  2LU2 A;  2CNN B;  3H5X A;  3JSM B;  2BUN A;  4CH0 S;  1D8Y A;  3W7B A;  4ETX A;  2C3M A;  3O1L A;  1FRX A;  4ZHR A;  2VOP A;  4W90 B;  1FXR A;  4DR2 F;  3B54 A;  3KMS A;  3MCN A;  1Y5L B;  2DR6 A;  1VFJ A;  3CJ8 A;  2C2O B;  5JVH Q;  4DR1 J;  1I1G A;  3IRX A;  3OVA A;  1H72 C;  2HHT A;  1U24 A;  2XSJ B;  4BC9 A;  3QQC D;  4PRF A;  3A12 A;  4C8Y A;  3FNN A;  3ZZO A;  3DI6 A;  5SZT A;  3DRS A;  3ZTQ A;  5C5J A;  3BJY A;  4DSJ A;  2A2C A;  4DUT A;  4IFV B;  3QIP B;  4AXJ A;  5E5N A;  3SV4 A;  1FD2 A;  1GMV A;  4V1A k;  2RIJ A;  2WB1 D;  5B0E A;  4ECX A;  4ETZ A;  3N9U C;  1VQN S;  3A8E A;  1AW0 A;  1FDA A;  1UEK A;  1P1L A;  5J1E B;  1RGV A;  3ONQ A;  5IT0 A;  4CLY A;  1DTQ A;  3KG4 A;  1RTD A;  2NXC A;  1N33 F;  3FZ2 A;  2DNG A;  2LEA A;  4C2M A;  4P2S A;  1JLA A;  2NSC A;  4R0J A;  1BE4 A;  3D6H B;  3NRB A;  3O3L A;  1S9G B;  3OFE A;  3W9I A;  2MKH A;  4LF1 A;  3MM5 A;  4JI8 J;  2ZNY A;  1GXL A;  4CO4 A;  1YI2 S;  3HCX A;  4LQ3 A;  1S0M A;  3AHP A;  4X4O A;  4PG7 A;  3PHE A;  1FVQ A;  1IN0 A;  2QG9 B;  2I9S A;  1S4F A;  1MNE A;  1S1U A;  2BKP A;  3MM7 B;  3SQG B;  3KK1 B;  2V2V A;  1S9F A;  4DR7 F;  4KFB B;  3JB9 k;  2QMX A;  3KLV A;  4OYM A;  3POT B;  5F9L A;  2XY7 A;  4P2M A;  2ZDP A;  2RKI A;  4PR6 A;  2AEF A;  2QJ3 A;  1VQM S;  3C16 B;  3LGH A;  2Y0S D;  2ERR A;  5D3G A;  2HQG A;  2MZS A;  3TAM B;  2H1Y A;  3LQV A;  1CG2 A;  3W5X A;  5FDL B;  1W2B R;  1FJC A;  2HRU A;  3ZNJ 1;  3UFC X;  3SCJ E;  1TL3 A;  1I94 F;  1FE4 A;  3SXL A;  1SV5 B;  2R4F A;  2H9Z A;  3M4X A;  2KG1 A;  4RKU C;  1U1R A;  5LJ5 Y;  4J91 A;  3H5Y A;  4YY3 F;  3OTD A;  2QSF A;  5E3C A;  4M5I A;  2W8L A;  1M5V C;  2BQU A;  2JRS A;  4KT0 C;  4ZCI A;  1HQE B;  4NCG B;  3CF5 Q;  2PT0 A;  1MLA A;  5L9X A;  1ZPV A;  1QVG R;  1PJ7 A;  2W7O A;  2JVR A;  3HLU A;  4RU9 A;  1B0P A;  4I67 A;  1N4L A;  2ASL A;  3RW7 A;  3E2E A;  5JJB A;  2QIF A;  2W7P A;  2E7X A;  4FP9 A;  3P3D A;  3C14 B;  1C0T A;  4MJK A;  1F0X A;  3FJ2 A;  7FDR A;  3GIK A;  1FJG J;  3NWG A;  3AB4 B;  1KHW A;  2P2C B;  2KU7 A;  3VZH A;  1KWM A;  4DFP A;  1E6Y B;  2HFO A;  4J37 A;  1G6B A;  3HXM A;  5HMY A;  2VBX A;  2J9C A;  2CZ9 A;  4UQT A;  4CLK A;  2F8E X;  3IR5 B;  2E5I A;  5L9N A;  2DJW A;  3I55 S;  4ZN3 A;  2ZE2 B;  3KK3 A;  3DYA A;  2R8K A;  4B3R F;  2H65 B;  4H4O A;  5KG7 A;  4DV2 F;  4C98 A;  3RG6 A;  2WBM A;  1CJT B;  1NJI T;  4QIV A;  3PIP Q;  3OW2 R;  2FB0 A;  3QFW A;  5F8L A;  3JYT B;  4ED6 A;  2YWW A;  1M1K T;  4M95 A;  2XY6 A;  1HYS B;  1NU4 A;  3F56 A;  2KTQ A;  1CC7 A;  1WC6 A;  1X4A A;  2XTJ P;  4X4R A;  1R6V A;  4NMX A;  4PXC A;  4F4X A;  2RIL A;  3V4I A;  4RJV A;  2JLF A;  3RRH A;  2HAI A;  2BJ3 A;  2FJB B;  2QC3 A;  1T8E A;  3CC2 S;  3K5M A;  1FRK A;  2ZH5 A;  1WWH A;  1LWX A;  3PO4 A;  4DR1 F;  1ROF A;  4MKB A;  2M4M A;  3DOM B;  1U8W A;  5F9N A;  2WON B;  5CA5 A;  3UD4 P;  4CDI A;  5KFQ A;  2E1C A;  4DL5 A;  1XMQ F;  1B7F A;  4TXS A;  1XR6 A;  5C2C A;  3CCJ S;  3DXB A;  5CZV A;  5HBM A;  5C42 B;  2DNO A;  3OSP A;  1NSK L;  5AE2 A;  3DLH A;  4EUV A;  1HBM B;  3LPE A;  4ZP7 A;  1PC4 A;  1RT1 A;  2QL7 B;  3DOL B;  1TUV A;  3ENV A;  5DQG A;  2HNY A;  3H90 A;  2DH8 A;  4Q0B A;  2RDI A;  1L3K A;  2W2O P;  5BYQ A;  2N3O A;  3NKY A;  4LF9 F;  1OYE A;  4FS2 A;  2KI2 A;  2IVF B;  2WTF A;  3ZTR A;  5D0E A;  3DXS X;  1N5Q A;  3KLG B;  4ECR A;  3KHG A;  3Q2S C;  2MHE A;  5KFP A;  2F7V A;  4A46 A;  2QT7 A;  3G8S A;  3DRY A;  5KFI A;  5HQ8 A;  1YBT A;  2E5G A;  4IDK A;  3OJU A;  5HN0 A;  4LFB J;  4CNZ A;  4HHJ A;  1BQN B;  4EZ9 A;  4AUK A;  1BUX A;  1WC5 A;  2AV5 A;  1B0T A;  5IXU A;  1Y7P A;  2E9T A;  3LO3 A;  4GC7 A;  4RU2 A;  2GAG C;  2QMU B;  3FCH A;  4K5S A;  3JTP A;  1WG1 A;  5ETS A;  5KOX A;  3KLE B;  1MU2 B;  1J5O B;  3RBD A;  4IYQ A;  3IR6 B;  4C8Z A;  2RRN A;  2WHO A;  2H54 B;  2OML A;  4XAK A;  2R7R A;  3DLE B;  2DNQ A;  3VGU A;  5LSR A;  2FGC A;  1FI4 A;  3A8I A;  1IKW A;  3D3B J;  3M8Y A;  1SC3 B;  1HWI A;  4HDG A;  3BDP A;  2W25 A;  3RGI A;  3NMR A;  3MOZ A;  1RAA B;  4FNI A;  2YNI A;  5GAG I;  3VGT A;  3BQ0 A;  4K5R A;  1LKZ A;  2NZC A;  2RU9 A;  4F4Z A;  4KGM A;  1UVJ A;  2ZJQ Q;  1NRK A;  3LF0 A;  4USM A;  4M1K A;  3S01 A;  3MF5 A;  2F63 A;  4TVA B;  1M5H A;  3PRB A;  1T9V A;  2GS8 A;  4DL7 A;  2B7C B;  2BEF A;  2HYI B;  3SSQ A;  4EEY A;  1S76 D;  2DH7 A;  3DLK A;  2GO9 A;  1IWG A;  3CDW A;  2BKN A;  5FJ4 A;  4M5H A;  4YQW A;  2LEC A;  3GIR A;  4K8R A;  2QZ8 A;  4F4W A;  4F4Y A;  5L1J A;  2D3U A;  1WDD A;  3KTQ A;  1RT7 B;  4V19 J;  1XK8 A;  1FKP B;  4I2Q A;  3R5J B;  1U0H A;  4ZPV R;  3LPY A;  4FF2 A;  2CVI A;  3HSG A;  5KG1 A;  1RK8 A;  4CLZ A;  3PW7 A;  2KXN B;  1FJG F;  5E3R A;  4K4W A;  1U25 A;  1M5P C;  4Y2K A;  2VBW A;  2F4F A;  3GIL A;  2F8H A;  3LTO A;  1AFJ A;  1RLD A;  1GK8 A;  5F8G A;  1UKU A;  4DF8 A;  2HWH A;  4FZV A;  4IOB A;  4P7V A;  1VRT A;  2RF2 B;  4LIR A;  1D9A A;  3M1V A;  1NO8 A;  1VK8 A;  2BW7 A;  3GJS B;  1E6V A;  4N8O A;  3UDV A;  2DIU A;  1WNE A;  4NCA A;  3B78 A;  1F9H A;  3TUI C;  3CSK A;  3HM9 A;  4CH7 A;  1JMT A;  3G6Y A;  3OHA A;  1UW9 A;  2K3K A;  4MKV A;  3R5B A;  1H2U X;  1REV A;  4ECU A;  3UD3 P;  4KKO B;  3IO1 A;  2OTL S;  5D0R A;  2QA1 A;  1HFE L;  3BKF A;  2QL9 B;  1KD1 T;  3DRR A;  4PG5 A;  2HEK A;  5ETT A;  2IYI A;  3HZG A;  3GCX P;  2NUU G;  3OFF A;  3MCS A;  2RDJ A;  1DQA A;  3QGI A;  4FS1 A;  4QW8 A;  2R8G A;  2MB0 B;  3PTW A;  3OL7 A;  1T95 A;  3PX6 A;  3MR3 A;  2M9K A;  3V81 A;  3O44 A;  2DGT A;  1YIJ S;  2GV1 A;  1UVN A;  2D3Z A;  2G1D A;  4QIG A;  2OPS A;  1FNO A;  1IKV B;  1YBU A;  4GKK F;  1GXT A;  3LH2 S;  2IAJ A;  3QSY B;  3UCG A;  2MKK A;  1HNI A;  2AMC B;  1NDP A;  1H7W A;  2ZZM A;  4DX8 H;  1QJH A;  3QLH A;  2YKA A;  4RNH A;  3BDE A;  4B9U A;  2HFU A;  4JI6 J;  4I2P B;  3VAL A;  5KT5 A;  4YR0 A;  1UWA A;  3W1Y C;  2LYV A;  4LSL A;  4M5G A;  1JLQ B;  2FHM A;  4ATN A;  4QYZ J;  3ETM A;  1UET A;  2JEI A;  3PM9 A;  2B9X A;  3QYY A;  2Y1L B;  2GIQ A;  2MPU A;  4X4V A;  1OWX A;  3MM9 A;  1SQE A;  2BMB A;  1RAO A;  2PSZ A;  3BV8 A;  4IFY A;  1F3V A;  4DSE A;  1S49 A;  2DO4 A;  2M2B A;  1RTH A;  4UW2 A;  3S1T A;  3FBE A;  2DHG A;  5RUB A;  5F0U A;  1S12 A;  3D0H E;  2B5J B;  2W4D A;  3OR1 B;  3MR2 A;  2NXE A;  3VCD A;  4LFB F;  5L1I A;  3Q8Q B;  1BWV A;  3IM9 A;  1QTM A;  1ITP A;  1N5Y A;  2FLN A;  2AKW B;  3L9Z A;  1NJW A;  1CQM A;  4RNN A;  4RW4 A;  1WSR A;  4OZ2 A;  3F73 A;  3MXH P;  1S1W B;  3FMW A;  3OT9 A;  3ITH A;  1RBO B;  4O4G B;  3AXK A;  1C1B B;  4ES3 A;  4MFB B;  4K4Y A;  4YB7 A;  4QZV B;  1RHQ B;  4X84 A;  5HJY A;  3O8W A;  4WWS A;  4HTI A;  4F4A A;  4WKR A;  3TVZ A;  3TAP A;  3OTB A;  3ZTO A;  3RB3 A;  2GMJ A;  2O3D A;  3CC7 S;  1WOS A;  4N7T A;  1XR5 A;  3NY0 A;  1WG4 A;  2D69 A;  4O44 A;  1AZS A;  2ZZT A;  4YR3 A;  2AJ1 A;  5F8I A;  1KTQ A;  1IVZ A;  1Y5I B;  3HD2 A;  4G6V B;  3N6N A;  4TYA A;  3HVW A;  2DPJ A;  2Z30 B;  5D4O A;  3W9H A;  2HQF A;  3DM2 A;  5AXL A;  2HNZ B;  2O66 A;  1TKT B;  3LP1 B;  3QO9 B;  1U26 A;  1MMD A;  4KGX B;  4OI6 A;  5HMW A;  4FYD A;  4LRB A;  1K8A T;  1H74 A;  1H38 A;  4NA1 A;  3CJR A;  3U7J A;  4NOH A;  5HMX A;  2J7U A;  1QDU B;  3EZU A;  5A8W B;  4JV0 A;  5IOL A;  1BXN A;  4P9S A;  4WF9 Q;  3Q22 A;  3AOB A;  2X1B A;  2EK6 A;  4Z7C A;  3GCW P;  1U6B A;  2RD5 C;  1CS4 A;  2CFX A;  2DY9 A;  5IS2 A;  4IUF A;  4JI0 J;  2E1R A;  4Y65 A;  1NK8 A;  1TMM A;  4Q2M A;  4L3N A;  3CPW R;  3MUV P;  4OI4 A;  5F8J A;  5SUH A;  2XO7 A;  4NL5 A;  3KK2 B;  3ZTP A;  2OPQ B;  2B9E A;  1NXI A;  4K4Z A;  3DRX A;  2EG1 A;  1QVF R;  3TZY A;  2MZ1 A;  2DGQ A;  2IC3 A;  2B9W A;  3TUJ C;  1HMV A;  1VQK S;  1TL4 A;  4Q2L A;  3SEO A;  3TJA A;  2KYZ A;  4ZIV A;  2YKN A;  3M2V A;  4QWA A;  3SSR A;  4KGV B;  2GIF A;  1IUJ A;  1Y5N B;  2XLJ A;  3SBM A;  4ICL B;  4OZ0 A;  3EGZ A;  1ZM3 A;  3PFE A;  4TLQ A;  4Q7A A;  3W65 A;  3MPY A;  3DRP B;  2VDI A;  3QRR A;  4C7Q A;  5DDR C;  2FJD B;  4Z37 A;  3GV8 B;  4QCL A;  1ULR A;  3FEZ A;  3H42 A;  2ILZ A;  4JI6 F;  1N54 B;  2IM0 A;  3MAH A;  5HL7 Q;  2Q6C A;  3KLF A;  3TJ8 A;  1HHQ A;  3MEK A;  4L72 B;  1UFK A;  2LQ9 A;  1WHX A;  5HJX A;  1W7W A;  1CBK A;  1RT6 A;  3TZW A;  4C0O C;  3ZFV A;  1UA1 A;  2FZC B;  5KFX A;  3D66 A;  1RUS A;  4USJ C;  3Q24 A;  2HFN A;  3D54 A;  3DOK A;  1SXL A;  4DN9 A;  4DU7 A;  1XJW B;  3VHQ A;  1WUU A;  4X65 J;  1HIY A;  1R8P A;  3OQ2 A;  1RAE B;  4KH1 B;  4NLU A;  4WPA A;  4PXE A;  1IKX B;  2AEJ A;  2C3O A;  1WSV A;  2YNF B;  2FYX A;  4RBU A;  2GVZ A;  2XB2 D;  1N6Q B;  1TP7 A;  2IVM A;  1ZTW A;  3Q23 A;  4URQ U;  2ADB A;  2AJQ A;  1OY9 A;  3H5U A;  1MG7 A;  2DB1 A;  4OMF G;  5KG5 A;  2V4J A;  2XI2 A;  2CQP A;  1V6H A;  2A6O A;  5F3Z A;  1B64 A;  3H98 A;  4J9R A;  4RNF A;  3CD5 A;  4LR9 A;  3MPD A;  3SV3 A;  3CCS S;  5F8H A;  3TOQ A;  1S79 A;  5A76 A;  1VQS A;  4G1Q B;  1KEK A;  2HMI A;  2CA9 A;  3GJQ B;  1NSA A;  5HVF A;  1VJW A;  1XC9 A;  4G1P A;  2GHW A;  2ZKU A;  4YB1 P;  1BY9 A;  1EP4 B;  1U4B A;  3LW5 C;  4RW7 A;  2AT1 B;  1YKW A;  4USI A;  3NCP A;  2Z57 B;  1WKK A;  2DXE A;  4TU9 A;  5DRK A;  2GA7 A;  3U1M A;  5T41 A;  4UZB A;  2J7K A;  2ZVS A;  5DGA A;  4ZA1 A;  3UN2 A;  2YPY A;  4ZJO A;  1RT5 A;  4USW A;  2K7K A;  3RAX A;  3SCK E;  1P9Q C;  1H73 A;  3KLI B;  3OL8 A;  4E98 A;  2ZH7 A;  1ZYQ A;  3CGI A;  1UWB A;  3H4D A;  2EC0 A;  2YQ1 A;  2R7V A;  1RWV B;  3UCZ P;  4L3K A;  3OBI A;  3CWJ A;  1WKJ A;  5K8O A;  5EDW A;  2YTC A;  2O67 A;  4OYO A;  4UY8 T;  2YWE A;  1J2V A;  2BOP A;  4LQ9 A;  4ED5 A;  1JB0 C;  4GO5 X;  1VBK A;  4GO7 X;  2KM8 B;  3D68 A;  3JTO A;  4EBC A;  3IRX B;  4NRU A;  1K0V A;  2CQ0 A;  3D67 A;  5E3P A;  2Y1I A;  3H40 A;  1S4E A;  1TUW A;  4O0I A;  4Y3C A;  4LUB A;  1VYA A;  3B8H A;  4WFA Q;  2MSS A;  1FRH A;  3MM8 A;  5DJB A;  1Q1K A;  1BD6 A;  4RW8 A;  4HDH A;  3NMA A;  3UPF A;  4A8Q A;  3K89 A;  5KG2 A;  1RWW B;  5KFN A;  1URR A;  2XEX A;  2ZD1 B;  5MAO A;  2ZM6 J;  3G6V A;  5LSL A;  5HI7 A;  1RA6 A;  3NGT A;  1NKC A;  4L76 A;  3V6J A;  1X7V A;  4M5J A;  3QZ7 A;  4LF7 J;  5LXR A;  4X4N A;  2QEX S;  3OXL A;  2LEP A;  1DTQ B;  1RYS A;  4M5M A;  2UP1 A;  1WC0 A;  4JI5 J;  2IM3 A;  1REG X;  1GX5 A;  1Z2L A;  3WIU A;  2DR9 A;  3EM1 A;  3M05 A;  2W24 A;  1SUQ A;  4RNO A;  3KDO A;  1HHS A;  4RUA A;  2MLZ A;  1OO0 B;  3I4H X;  1DZ5 A;  3W66 A;  2PD1 A;  3DKD A;  2W9B A;  4B17 A;  4CLW A;  2F4V J;  5K8N A;  4P75 A;  3CD6 S;  4HYK A;  2PII A;  2E5J A;  1TUG B;  2HHU A;  1SI9 A;  3SZ2 A;  4DLG A;  3P49 B;  3T1Y J;  2Y1J A;  2OI2 A;  3AA8 A;  2DHH A;  3D5M A;  4H4M B;  6FDR A;  1HW8 A;  3AD9 C;  2IFX A;  3IM8 A;  2F9J A;  4LBI A;  2UUC J;  1S1U B;  3P6Y C;  4NPO A;  2DTJ A;  2VFR A;  4DPX A;  1EKR A;  3HT3 A;  3MEG A;  5CYQ A;  1TL5 A;  2DGW A;  5CCL A;  3MUR P;  2RKI B;  2AYG A;  4M8L A;  3TX0 A;  2JSX A;  4B3O B;  2KKH A;  1GQE A;  3IG1 B;  5D3G B;  2HG4 A;  4YP3 A;  3C15 A;  2KM8 C;  1FX2 A;  4QYR A;  4OZN A;  2CWK A;  4IRD A;  3BGF A;  2J5A A;  1FCA A;  2B4V A;  3CJ5 A;  3ZZZ A;  3OUY A;  4ANC A;  2WVC A;  4JI1 F;  1TL3 B;  2FVQ A;  4EBE A;  1PCA A;  4DR4 J;  4USH A;  4X65 F;  2FIU A;  3EVO A;  2K2P A;  4ECT A;  3T3F A;  3E3X A;  1EQM A;  3K17 A;  4YB6 A;  1NBE B;  5A2Q Y;  1TQL A;  3NOG A;  2PMW A;  2W1B A;  3GMG A;  4NCB A;  5DO2 A;  1LW0 A;  4FYV B;  1O8B A;  2CQD A;  2WK4 A;  4ZCM A;  1KDN A;  5JVG Q;  1GEH A;  3MUT P;  2V8G A;  1O0P A;  3UCU P;  2K1R A;  2V0N A;  5K8P A;  2SXL A;  1JLG B;  3IP0 A;  3SDE A;  1SL0 A;  2APO A;  3I0S B;  2BOA A;  3EWG A;  3J80 U;  2PA8 D;  4OX6 A;  5EX3 A;  2RU3 A;  4A8S A;  5HAT A;  1FRL A;  4KPY A;  1IQT A;  2AEM A;  2XMT A;  2W2P P;  2A18 A;  1T9X A;  1LW2 A;  5K14 B;  1FDB A;  2OLW A;  3RBZ A;  1EQ0 A;  2DPI A;  3MMB A;  3DFE A;  3KK3 B;  3DYA B;  2EVZ A;  1SJR A;  1MWQ A;  2E5L J;  5I3P A;  2BE9 B;  2LQJ A;  2GQC A;  3VV2 B;  3HVT A;  2GIR A;  3VQS A;  3TX8 A;  1Y9O A;  2CQ2 A;  3K57 A;  2FY1 A;  3H7H B;  3T1H J;  4A8X A;  3OD2 A;  5EHH A;  2MST A;  1IBM J;  4I69 A;  3AQP A;  2LLZ A;  4C0B A;  1Y00 A;  1ZAV A;  5KFY A;  2VOO A;  5AE3 A;  2XGQ A;  4N41 A;  3IC1 A;  3QBC A;  3UVJ B;  3KNA A;  1XER A;  3HI9 A;  3PO5 A;  2QLW A;  3WHI A;  4C8O A;  1PAU B;  1S6P A;  3F41 A;  1RHK B;  2V5H G;  1FKO A;  2I38 A;  3BB5 A;  2P6S A;  3CNQ P;  2JC0 A;  4NYO A;  2HHX A;  1SBR A;  2DNN A;  4XK8 C;  8ATC B;  5HVG A;  1HQU A;  4QOT A;  5EWE A;  3RBX A;  2ZM6 F;  1Q0N A;  1K1Q A;  1RT1 B;  3BKT A;  3P96 A;  2KYX A;  2NZ4 A;  4OZL A;  4LF7 F;  1S1V B;  2V9W A;  3IWN C;  4CNY A;  2W9C B;  5LMN J;  3CDB A;  4Q0B B;  1R3N A;  2VAS A;  4OI3 A;  3HVR A;  1YIT S;  3CD7 A;  1U47 A;  1QAX A;  1TK8 A;  3TUP A;  4JI5 F;  3M8R A;  2C3P A;  1U1Q A;  4OHX A;  1X9S A;  4WU3 A;  4I6A A;  4J9O A;  1LWF A;  1A7G E;  1MSW D;  4NYZ A;  3NAI A;  1JKH A;  5HLF B;  5BYS A;  5C2G A;  2RB7 A;  2UUA J;  2CPE A;  4YEA A;  4IDK B;  1UP1 A;  2R3V A;  2F4V F;  4WYL A;  2CJK A;  2B4O A;  2HND A;  3GSD A;  2OTJ S;  3GZ7 A;  4I1T A;  4RW6 B;  4QIF A;  4CO1 A;  2OFH X;  2UUC F;  5DDO C;  1HBU A;  4HH0 A;  2HLT A;  1ZPW X;  5A8R A;  1TL1 A;  1VBX A;  2F1F A;  4LBP A;  3CCU S;  1KNZ A;  8AT1 B;  2IBK A;  5A0Y A;  2RHQ B;  3C6T A;  2DNL A;  1FNX H;  2GW8 A;  4ZVH A;  3W2V A;  4OFZ A;  2QYC A;  1OJ4 A;  4W4M A;  2ZH4 A;  1AXQ A;  2YNG A;  1BQM A;  1HPZ A;  4PG6 A;  4M5D A;  3NGR A;  3FEY B;  4FF1 A;  4EZ6 A;  2YNI B;  3Q86 A;  4DR4 F;  1T03 A;  2V4R A;  2EFQ A;  1LQ9 A;  3PRV A;  2CPF A;  1SIW B;  3IGV A;  3UE2 A;  5L1L A;  2W2Q P;  3CUN A;  1UW4 A;  3BR8 A;  4MMO A;  3AOC A;  3NLC A;  1RWK B;  3MUM P;  4AL6 A;  1WEL A;  1IBK J;  3AAW B;  3EDR B;  3V4M A;  3MMC A;  1FK9 A;  2UVU A;  1WC3 A;  4BHQ A;  1BLU A;  2ZJP Q;  1D3W A;  4C9D A;  2G4B A;  1YJW S;  3DLK B;  1UJ6 A;  4IQX A;  4OYZ A;  4UTG A;  4F26 A;  1EET B;  2OKQ A;  4OV1 A;  1UVL A;  3TZX A;  1U02 A;  3OV7 A;  1KBR A;  4ILM A;  4ZP6 A;  4YS2 A;  1YJR A;  3G4S S;  2QA2 A;  2M8D B;  2XWY A;  4DN0 A;  4LSN A;  3TEH B;  1UZH A;  5BXI A;  3ENW A;  4KGK A;  1DFD A;  4CM0 A;  3NNC A;  2J9E A;  2X7I A;  2MKC A;  3UDC A;  4FF4 A;  2XHC A;  4MH8 A;  4R25 A;  2Q1L A;  5C24 B;  4ZVU B;  3OL6 A;  3I9Z A;  3F44 A;  1R8B A;  2KT2 A;  5T7L B;  4LRA A;  2OD4 A;  1TL7 B;  1U1P A;  5D4P A;  4ZVQ B;  3HVA A;  4LR8 A;  4MK7 A;  1VRT B;  1U1O A;  3S6E A;  2FLP A;  3T6J A;  4CTA B;  4MK9 A;  2VFV A;  3W61 A;  4NML A;  2OEL A;  1JLB A;  1SIZ A;  2GVD A;  2D7S A;  2WBR A;  3DC2 A;  2IA0 A;  1JXL A;  4Q5V A;  1S7I A;  1RAI B;  2MLX A;  5FD1 A;  4ZVR B;  4USU A;  5KT4 A;  5ETV A;  4R8U A;  1REV B;  3TW0 A;  2WSF C;  3T1H F;  3EE3 A;  4DQP A;  2XNQ A;  1IBM F;  2EBG A;  4KSE B;  2MKS A;  1ZAW A;  3DRR B;  3HHK A;  2KT3 A;  2K8G A;  2H3E B;  2VL1 A;  2KG0 A;  5DLF A;  1K0T A;  1FXL A;  4XDC A;  3TAN A;  2CJY B;  3A4T A;  1GMW D;  3J7A 1;  2G2Y A;  3JTN A;  2J6S A;  2WVD A;  2CJ9 A;  1FTR A;  2HQ3 A;  4DS5 A;  3JSR A;  1S77 D;  3A8J A;  3MPU B;  2OPS B;  2HBZ B;  4KO0 B;  5FLX Y;  4N5S A;  2UZA A;  3DDI A;  1U0S A;  3BO3 A;  2JEJ A;  1DAX A;  3DN9 A;  2DBB A;  1HNI B;  3SQO P;  3KLH B;  1U2C A;  4PXB A;  3QJP A;  1PGZ A;  4ED3 A;  2BJ9 A;  2VQF F;  2OP5 A;  2F3J A;  4ZIT A;  3C6U A;  3TNV A;  1OSD A;  3R1L A;  1ICE B;  3Q8P B;  4LSL B;  3JS9 A;  3OR2 B;  4DV5 F;  4NLT A;  3CMQ A;  5LMN F;  5ETR A;  4MKA A;  2ZEJ A;  3M32 A;  3MMA B;  2RQC A;  2IM2 A;  4TYB A;  2XYG B;  3W5Y A;  2CQ3 A;  2BR0 A;  1NK0 A;  3MPW A;  4UUX A;  4MK8 A;  1RTH B;  4I7F A;  1RKI A;  1WOO A;  2DNK A;  1R8A A;  4OLO A;  2B8Q A;  2MTL A;  3J81 j;  4B9M A;  2BJ7 A;  1JLF B;  1YQH A;  3OL9 A;  4QR1 A;  3KMQ A;  3KHR A;  1XNQ J;  3A8K A;  3T5L A;  4J9U E;  3UW1 A;  2BRK A;  3EXY A;  1NPP A;  2OMO A;  4ES1 A;  1SVD A;  1N5Y B;  3N4W A;  2BDP A;  1VS3 A;  1CJV A;  2GAH C;  2QLJ B;  3HHE A;  3R7B B;  1NND A;  5JXS A;  3U1L A;  5CQG A;  4JBC A;  3ETO A;  4PQU B;  3FK4 A;  2CAD A;  1SPB P;  1UEV A;  2XLI A;  2HVI A;  1VQ4 S;  1K47 A;  1HWU A;  4K4T A;  1MWZ A;  1AZS B;  1SKU B;  3DNC A;  3L7U A;  3HSZ A;  3IS9 B;  2B56 A;  2M5Y A;  3MMJ A;  4PEO A;  3EUN A;  2EKY A;  2MKJ A;  4HLB A;  2AZ3 A;  2LMI A;  1AUD A;  1HQ2 A;  2UVR A;  1X4F A;  4QU6 A;  2YKQ A;  4OX9 J;  1Q78 A;  3WX8 A;  2OPR B;  4KC5 A;  2LKZ A;  4U7C A;  3ZZU A;  4J9K A;  1RYR A;  4ZVO B;  2BJD A;  5HRO A;  1AA1 B;  1TV6 B;  3ZZR A;  1VQL S;  2GJ2 A;  1ACM B;  1JWW A;  1QE1 B;  3BGO P;  2UUB J;  4CIO A;  4AND A;  5KT3 A;  1RQ0 A;  2AW0 A;  5L46 A;  1HLW A;  1NLK L;  2ROG A;  3BN7 A;  2FHO B;  2O5D A;  1NPR A;  1YJN S;  3IBW A;  2YX1 A;  2ZH9 A;  4IH5 A;  2FJX A;  5F8N A;  2OPP A;  1OPZ A;  1PIL A;  1RT2 A;  1XR7 A;  2QLB B;  5J2Q A;  4YB5 A;  2LQ5 A;  3AT1 B;  4BWJ A;  1IR2 A;  3KUG A;  2W4C A;  4CLF A;  3RAM A;  2BE2 A;  5D15 A;  5I3U B;  4OZ3 A;  3LAK A;  2D1C A;  1S1T A;  1S72 S;  3UN5 A;  2VH7 A;  3DU6 A;  3LAL A;  2RUS A;  2FC9 A;  2JH3 A;  2E1A A;  4H54 A;  1NHV A;  3JSB A;  4ITS A;  2HGM A;  1QAJ A;  3KWM A;  3CJ4 A;  2AGO A;  3C66 A;  1SH0 A;  3OFG A;  1M0S A;  1PYT A;  2B3T B;  3EDQ B;  4P6Q A;  4RPF A;  2JNJ A;  2XMM A;  1Q8L A;  2C1E B;  4G65 A;  1ZM2 A;  4WXW A;  2NRE A;  3AFG A;  2B0G A;  1XMB A;  4FBU A;  2BKO A;  3DMJ B;  2L9W A;  3VVU A;  5H9E J;  4OYP A;  1RHU B;  3CUL A;  3D0I E;  4WFB Q;  5E0O A;  1GNK A;  2HGN A;  2WZ1 A;  3TZZ A;  3PJ9 A;  4EWT A;  3M2V B;  1RHM B;  5GMD A;  2CJQ A;  3EPI A;  2MKI A;  4R0E A;  3FC9 A;  1PSD A;  4ZJQ A;  4Y34 A;  4DEZ A;  2Q43 A;  5EN1 A;  2DIV A;  2Z2L A;  4PKD B;  5IWA J;  2C3U A;  3CCW A;  4CP5 A;  4Q8E A;  1HBO A;  3SFU A;  3BSC A;  2PFF B;  1HKA A;  4U8V A;  4QWD A;  2B51 A;  1J5E J;  2ZNZ A;  3R6G B;  2EXU A;  1S59 A;  3DGP B;  2QE5 A;  3D0G E;  4DUZ J;  1D0E A;  1S10 A;  3KLF B;  2JEF A;  2CPX A;  1KLM A;  3LOU A;  1P6T A;  3Q0A A;  2Z2M A;  3AXM A;  1WI6 A;  2PA3 A;  1QTN B;  5K8M A;  2MY7 A;  2RAQ A;  3DOK B;  3CC4 S;  1VQ7 S;  3TYT A;  2E7V A;  4A47 A;  3G87 A;  2YKP A;  3Q8V A;  4LFA F;  2FD2 A;  3M6X A;  4YOE A;  3FDS A;  4M5N A;  1RU2 A;  2V69 A;  1U2F A;  4I64 A;  2ATL A;  4NLG A;  4DR3 J;  3QSI A;  4YHH J;  2R7T A;  2V68 A;  2GVZ B;  2BM0 A;  5KG6 A;  3OTO J;  2DKO B;  1XNQ F;  3JSM A;  3RTV A;  1XEZ A;  2MQM A;  5IT9 U;  2HPU A;  4EBD A;  5LM7 E;  5D8H B;  3PKY A;  1CJK B;  1R7I A;  3G96 A;  2VPZ B;  4HEA 9;  4AL5 A;  3NEK A;  2I2Y A;  3N6L A;  4MTP A;  3CO0 P;  1EJ7 L;  2WOM B;  2AYB A;  2JOQ A;  3QMQ A;  1CC8 A;  4PYA A;  3GSI A;  1M1G A;  2XSJ A;  2W01 A;  2HMI B;  2QL5 B;  4C8K A;  4Q44 A;  4A8W A;  4QIE A;  5A8K B;  1NCL A;  5ETM A;  4ZPA A;  4OYA A;  4LF8 J;  1S57 A;  4LT6 A;  4IFV A;  2FLO A;  3A13 A;  1Q16 B;  3QIP A;  5KFU A;  3TVY A;  3DLB A;  3I6P A;  3M9M B;  1U2R A;  2HK3 A;  4OL8 A;  3BSO A;  2R2S A;  3THP A;  3OJS A;  5KFZ A;  2UXB J;  4OX9 F;  1P9Y A;  1WTB A;  1NH8 A;  3BYP A;  2ZHA A;  2ZH6 A;  5J1E A;  3NCQ A;  1TFW A;  4RZR A;  3VVT A;  3C3L A;  2ZOF A;  2DR8 A;  4N77 A;  4G3I A;  1V3R A;  2F40 A;  1D9D A;  1TAQ A;  3TO8 A;  2CNO B;  5GAD I;  3Q8Y A;  2UUB F;  3PG9 A;  3VAK A;  4F2R A;  2YKM B;  1SC4 B;  2OO4 A;  5JUM A;  1GFW B;  2BX6 A;  2MGZ A;  4H4K C;  3NGD A;  2VPY B;  1AB8 A;  2H4Y B;  4LVN P;  4WP9 A;  3MM7 A;  2N4C A;  3PYG A;  2NPI A;  1YJV A;  4GVB A;  4ZPD A;  4CLU A;  2VA2 A;  3K2Y A;  5E41 A;  1G1X A;  4KFB A;  1JLC A;  4L73 A;  4C8N A;  3N5B A;  4IRK A;  4DSF A;  3POT A;  1WC1 A;  4K4S A;  1RWM B;  4NAS A;  1VLY A;  1FTC A;  2IJF A;  2VFS A;  1ZZN A;  4P2X A;  4RUB A;  2HZC A;  2RRB A;  3C16 A;  3IWX A;  1IM4 A;  2A2D A;  3ZZP A;  2FZK B;  3MED B;  3TAM A;  4FXW A;  1Y0H A;  4A8Y A;  4KB7 A;  5ETO A;  5FDL A;  2QN6 B;  2WVF A;  2OGU A;  4ANE A;  2GFF A;  1KQF B;  1Q5V A;  1KQS R;  2JJ4 D;  1SV5 A;  2XGP A;  2YWK A;  5J2P B;  4DV6 J;  1JQG A;  4NLX A;  3M9O B;  3IMQ J;  2PI4 A;  2CG8 A;  2LXU A;  1JK9 B;  4YME A;  1HQE A;  1YBA A;  3HDS A;  4NCG A;  4B08 A;  5F8M A;  4CI0 B;  2CZV C;  3AJD A;  3GG0 A;  4K50 A;  4X4S A;  2GML A;  3IN5 A;  1RXO B;  3VR1 A;  5IWA F;  2LXF A;  2DT9 A;  1O5J A;  3MEG B;  5DLG A;  5E33 A;  1TKZ B;  4Y2I A;  1DTT A;  4I6Y A;  4OHW A;  2ZOG A;  4UOG A;  2VA3 A;  4DJB A;  3CXC R;  1NEE A;  1J5E F;  2M8H A;  3GJR B;  3J7Z 5;  1U09 A;  2Q6B A;  4N8N A;  1NSQ A;  3C14 A;  1RLC L;  4KJI A;  4I6W A;  1NJZ A;  2NYI A;  2VD3 A;  3ENQ A;  1N52 B;  3MR5 A;  1SKS A;  1PJ6 A;  3FRZ A;  4DUZ F;  4IKA A;  1EZZ B;  4J9Q A;  1E6Y A;  3CIM A;  4LF6 F;  3GFX A;  2E5H A;  4K2X A;  2KN4 A;  3T5H A;  1NKB A;  3AOD A;  1G2E A;  5HO4 A;  4I0W A;  3MCO A;  5K9F A;  2ZHB A;  2GHP A;  2ZWP A;  2GZO A;  2YNH A;  1HL6 A;  2DHS A;  5B0D A;  2XMA A;  1JLE B;  2CIM A;  1U1K A;  1I6J A;  2VHG A;  1CJT A;  2BJE A;  3W62 A;  2MHN A;  3UWT A;  2VBZ A;  1B4S A;  4YHH F;  3JYT A;  3DLG B;  3OTO F;  1HYS A;  3R9L A;  3RRK A;  4WK3 A;  4U8Y A;  1T3O A;  4F4K A;  4PPD A;  2MJN A;  1H7X A;  3H20 A;  2VBY A;  3R97 A;  5CYM B;  1ZM4 A;  3PYE A;  4DFK A;  2OSR A;  2ASJ A;  3L4B C;  2BAC A;  1RBL A;  3B4M A;  4DV0 J;  3BSA A;  3ILJ A;  4NE9 C;  3CW2 C;  4UST A;  3PR4 A;  2FQQ B;  3H5S A;  2AU0 A;  3DOM A;  1ZS6 A;  2WON A;  1RI7 A;  4DPW A;  2Y9H A;  2Y1R I;  3NBP A;  1SC1 B;  2C2Z B;  4ZVG A;  2RRA A;  4LF8 F;  5C42 A;  3GYN A;  4NLY A;  3MMB B;  3LP2 A;  1HBM A;  2JC1 A;  3AJ2 A;  4G1I A;  3DOL A;  4FXV A;  2UXB F;  2LP4 A;  5ETL A;  3RR7 A;  3CJ3 A;  3P4U B;  1OS5 A;  3N79 A;  2IJR A;  2WW4 A;  3TQ1 A;  2XSF A;  2JLE A;  4O4R A;  1B70 B;  1CJU B;  2W4P A;  1QLN A;  4ZKA A;  2I0X A;  1U1N A;  4F8R A;  5A6P A;  2DCL A;  2G2Z A;  3KFW X;  2KL8 A;  3W60 A;  2HZV A;  2HBR B;  3MWB A;  2B8P A;  2D3O R;  1N34 J;  1BQN A;  1KVJ A;  3BO2 A;  4DSK A;  3KYL A;  1FKO B;  3PW0 A;  2ASY A;  1AT1 B;  4YDD B;  4OI1 A;  3N28 A;  2M7S A;  2VKR A;  2RS8 A;  3KLE A;  1MU2 A;  1JJC B;  2QA4 S;  1J5O A;  5DG9 A;  3M7V A;  3BZQ A;  3BYR A;  2YWF A;  4Z2X A;  1NK6 A;  4NRT A;  4EK2 A;  4HVZ A;  1FT8 A;  1WG5 A;  2CPD A;  3M6W A;  5KFL A;  5HVH A;  3BF4 A;  3DLE A;  3KXD A;  1WJ9 A;  4DWI A;  1UJ5 A;  1VHF A;  2CJB A;  3HO1 A;  4NEY A;  4B9V A;  3GB0 A;  2DY1 A;  2FJV A;  3RB4 A;  3FQK A;  2CPZ A;  4UT4 A;  3BO4 A;  4ILL A;  2X51 A;  3T9Z A;  3QWP A;  4EO8 A;  1RAB B;  1VIO A;  1JNR B;  2RE1 A;  3CCQ S;  3IGN A;  4DV6 F;  3J81 Y;  2ZZN A;  3VGS A;  4LF5 J;  1EKS A;  3TJ9 A;  4RUH A;  1TKX B;  3PRD A;  1R8C A;  1FWK A;  3TAQ A;  4RBT A;  4TY9 A;  1IQZ A;  2LA4 A;  5EX0 A;  3GIJ A;  3NNA A;  3ZZ0 A;  1HI8 A;  4TN2 A;  5DM6 Q;  1AFI A;  3D6T B;  3M8W A;  1UMJ A;  1MN7 A;  1HBU B;  4XIU A;  1X0F A;  1S1X B;  3QGH A;  5LMU J;  1O51 A;  1Y4Z B;  4M63 A;  4AD6 A;  2ZH1 A;  5KT7 A;  2IIH A;  4KYZ A;  2KHC A;  3RRG A;  1RT7 A;  4EO6 A;  2J6T A;  1AYE A;  1TK5 A;  3KDN A;  3ZNU A;  1FDD A;  1M1H A;  2PEB A;  2FPH X;  1Q82 T;  1X4E A;  5J1N A;  3TA2 A;  3RB6 A;  3W2V B;  1JJ2 R;  2VG5 A;  1VIS A;  4DMZ A;  2HHS A;  3ZO7 A;  2GGP A;  3CCM S;  2YNG B;  3T5K A;  1M5O C;  2J0S D;  2DYA A;  2QO3 A;  2RF2 A;  4IO9 Q;  4ZP8 A;  3RB0 A;  2MKY A;  2ZH3 A;  4HT7 A;  4QR2 A;  5J2N B;  1R31 A;  5IQQ A;  1X4B A;  3W63 A;  5B0C A;  1YZ7 A;  4OV6 A;  3MMC B;  5HQL A;  1IKY B;  4KKO A;  1LWE B;  1F5A A;  2GO8 A;  4JI8 F;  4OYB A;  1S6U A;  2Q3P A;  4OYX A;  5GMK a;  4AQY J;  5H1S V;  4KV8 B;  2UUW A;  3H2V E;  4DV0 F;  4DCP B;  3TA0 A;  5DZ6 A;  3RZA A;  4BDP A;  3KJQ B;  4JI4 J;  2YBV A;  2C28 A;  4B3S J;  4HH1 A;  4P2F A;  4BS2 A;  3FVY A;  2VG6 A;  3HZE A;  4IOA Q;  3OVB A;  2GQQ A;  3WX4 A;  3M30 B;  5LOQ A;  4CLL A;  2RDD A;  4PAB A;  4AFF A;  2Z2Z A;  3CIZ A;  2Y0B B;  3NGS A;  2X1G A;  4I2P A;  1UCN A;  4J9S A;  1LWC B;  5FII A;  2J76 E;  5L38 A;  1JLQ A;  3DGV A;  3CB4 A;  2MZT A;  3K5L A;  3HK2 A;  1DHM A;  1SL2 A;  3S8S A;  4R8U B;  4IOC Q;  4AYB D;  4LIW A;  1ARO P;  4NLO A;  4OQJ A;  4RNM A;  3R8Y A;  4A8O A;  4DS4 A;  2VPW B;  1CVJ A;  2B5J A;  3N01 A;  1VOM A;  5IT9 Y;  5DG8 A;  2XO6 A;  2YKO A;  5KOW A;  2AIR B;  3BGU A;  2HS4 A;  3FGV A;  2XLK A;  1I5O B;  1N34 F;  1MWY A;  2C2K B;  5I4M A;  4O3Q A;  5IV4 A;  1CUL A;  2DEJ A;  1WTF A;  4N76 A;  1GXU A;  2ALZ A;  1RDR A;  4O4G A;  5G4D A;  2HVE A;  3BM7 A;  1N56 A;  1OMS A;  4MFB A;  3OTC A;  5AXK A;  1Z1Z A;  4ZCK A;  4TU8 A;  4I56 A;  3LAM A;  3UR0 A;  2OEM A;  4EU0 A;  1FHT A;  1YHQ S;  1NJY A;  2ZBR A;  2P9E A;  1RWN B;  4ZVE A;  5DG7 A;  2V34 A;  1G7C B;  2CKW A;  2OSQ A;  4NI2 B;  3RR8 A;  5IQ6 A;  2BAN B;  4ED7 A;  2G13 A;  4B9T A;  4WP8 A;  3NWR A;  1Q53 A;  1G3O A;  2LA6 A;  3WIV A;  1OIA A;  2VKZ G;  5AT1 B;  2PMH A;  2CJA A;  1URN A;  4QWE A;  4ID5 A;  1NK9 A;  2OD6 A;  5G0R B;  4DX6 A;  4I7F B;  1Y11 A;  3BGR A;  4F3M A;  3BBB A;  2CG4 A;  4P74 A;  4ILR A;  4KIA A;  3KHL A;  4B9L A;  5A2Q U;  2HNZ A;  3QO9 A;  4WE1 B;  2LFV A;  5IM0 B;  1YTY A;  3KG1 A;  4X62 J;  2YWH A;  3GYG A;  3KJN B;  2RUG A;  5H9E K;  1OYD A;  4DL2 A;  4ZS6 A;  1QSS A;  1CJV B;  2J8S A;  4ALZ A;  1CSJ A;  2MZR A;  3CE8 A;  4P73 A;  3HHL A;  5LMU F;  4OZJ A;  3PFO A;  1C0U A;  2CXE A;  4CO0 A;  3J7A N;  4ED4 A;  1C4A A;  2XMV A;  1F2G A;  3OPK A;  3UI3 A;  4DSI A;  3L3C A;  4CYU B;  4R5P A;  3Q2T C;  2ZBI A;  5DDQ C;  2XNR A;  3P5B P;  5M2P A;  3WQP A;  3D28 A;  1N48 A;  4KH0 B;  2A1B A;  3PNI A;  2R42 A;  3VAM A;  3GV7 B;  1KVI A;  1S97 A;  2HRY A;  3MEC B;  1DQ8 A;  2BZ2 A;  3THV A;  4TY8 B;  2J0Q D;  2W2N P;  1RWU A;  1KSP A;  2M0G B;  4DU8 A;  5DGB A;  2DH9 A;  5KT2 A;  4P7T A;  2OPQ A;  4IO1 A;  3CCE S;  3HF5 A;  2I5J A;  4Z7Y A;  2QSW A;  4J5O A;  1N33 J;  5HP1 B;  3J7Z T;  4CQ1 A;  5IFM A;  1RAJ A;  2ALY B;  1GMU A;  2JZ5 A;  2PE8 A;  1Q5Y A;  2HZA A;  4QR0 A;  5CAB A;  1S0V A;  1WF2 A;  3BN4 A;  2K06 A;  1V9O A;  3EZO A;  3UNG C;  4D3G A;  5IV3 A;  4PG8 A;  2W9A A;  4AQY F;  4U96 A;  2ZKT A;  3OHB A;  3Q8R B;  2DXF A;  2R8J A;  3KHH A;  2WSC C;  5J2Q B;  2G1H A;  4ICL A;  2CQC A;  1FNM A;  4EI2 A;  4ZMM A;  4JI4 F;  4U6P A;  4RUC A;  4ECZ A;  1X0P A;  3CVK A;  2CRL A;  5ADZ A;  4B3S F;  3CJK B;  3NS5 A;  4ZJL A;  1S1T B;  1H0H B;  1FVS A;  3K5P A;  3DRP A;  3BEG B;  2DVI A;  4Q8F A;  3GJT B;  3W2W A;  3FFI B;  3SI8 A;  1L3S A;  2WCX A;  2UU9 J;  1KQG B;  1NZ8 A;  1SJQ A;  2DRD A;  4C6A A;  5BJR A;  4HI2 A;  2NPF A;  2CQ4 A;  1GH8 A;  1LK7 A;  1QUP A;  2LVW A;  4RW9 B;  3MTJ A;  2G0I A;  1VMB A;  2HQC A;  1TVR A;  2BAB A;  1R6Y A;  2NXN A;  4X2B A;  5I3Q A;  2JWN A;  1VBY A;  3QRP A;  4C4W A;  4NX9 A;  1TAU A;  3R5G A;  3MAA A;  2QLF B;  2I6W A;  2EFN A;  2RQ4 A;  2FHJ A;  2NYH A;  3GV5 B;  3GPA A;  3DDN A;  4X4T A;  2IM1 A;  2YNF A;  2B43 A;  5JMN A;  1ZA1 B;  4DV1 J;  1N6Q A;  3R5A A;  1RWP B;  5LSO A;  4YUD A;  4OJ3 A;  1X8D A;  2MEW A;  4HI1 A;  1Q7L B;  4PWD B;  5LXY A;  2HBY B;  4C11 A;  2QMW A;  4FN5 A;  4GKJ J;  1HBO B;  2U2F A;  3G82 A;  3QZ8 A;  3VAG A;  4AL7 A;  3AQO A;  4PPZ A;  1C2P A;  2HGL A;  4ID8 A;  2H5J B;  4PUO A;  3B82 A;  1DLO B;  4PWW A;  4NLW A;  1PC5 A;  3CJQ A;  2L08 A;  4CO5 A;  2UVV A;  1UJ4 A;  2AGQ A;  2R7Q A; 
#chains in the Genus database with same CATH homology
 1FX2 A;  1WC3 A;  1YBT A;  4OYM A;  1U0H B;  4P2M A;  1WC0 A;  3MAA B;  3ET6 A;  4NI2 A;  1TL7 A;  1CJT A;  3C14 B;  4USV A;  4OYZ A;  4P2F A;  3C16 B;  1AZS A;  5IV4 A;  1CS4 A;  1CUL A;  2W01 A;  4OYI A;  1WC5 A;  1CJV B;  1CJU B;  4OYO A;  1AB8 A;  3UVJ A;  4CLY A;  1YK9 A;  5D0R A;  3R5G A;  3MAA A;  1FX4 A;  4OYA A;  4WP9 A;  5IV3 A;  4CLK A;  4CLL A;  2GVD B;  4CLW A;  4CM0 A;  4CLP A;  1CJK A;  2QV6 A;  4CLU A;  1CJV A;  3C15 B;  4OYP A;  3G82 B;  5D0G A;  1WC4 A;  1WC1 A;  1U0H A;  3MR7 A;  2WZ1 A;  4UST A;  3ET6 B;  4NI2 B;  1TL7 B;  1CJT B;  4P2X A;  3C14 A;  4CLZ A;  4WP8 A;  3C16 A;  4OYW A;  5D0H A;  1CS4 B;  4OZ2 A;  4CLS A;  1CJU A;  3G82 A;  1YBU A;  3UVJ B;  2GVZ B;  4USW A;  5D0E A;  4OYB A;  4CLT A;  1WC6 A;  4WP3 A;  4OYX A;  4WPA A;  2GVD A;  4CLF A;  4CM2 A;  5D15 A;  4OZ3 A;  1CJK B;  1Y10 A;  1Y11 A;  1AZS B;  4USU A;  1CUL B;  2BW7 A;  2GVZ A;  3C15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...