1WC0A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
198
Chain Sequence
SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
total genus 59
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc0A00
3ET6A 1CJTA 1CJUA 4USTA 1WC4A 4CLYA 1CJVA 5D0RA 3MR7A 4OYBA 2GVDB 2GVZB 4WP8A 3C16A 1AB8A 2BW7A 3G82B 1CS4A 1CULA 2W01A 4WP9A 1AZSA 1U0HA 1WC0A 5D0EA 4OZ2A 3C14B 4OYMA 4CM0A 3C15A 1CJKA 4CLKA 4OYXA 4USUA 3MAAB 5IV3A 1Y11A 3UVJB 4OYIA 4NI2B 4P2XA 4WPAA 4WP3A 2GVDA 5D15A 4CLSA 2GVZA 4CM2A 4USVA 4CLFA 3G82A 5D0HA 4CLTA 4OYWA 3R5GA 4CLPA 1TL7B 3C14A 3MAAA 3ET6B 2QV6A 1CJTB 4OYAA 1WC1A 1YBUA 3UVJA 1CJUB 2WZ1A 4OYOA 1Y10A 1CJVB 1WC5A 4NI2A 1WC3A 4OYPA 4OZ3A 1YK9A 3C16B 4P2MA 1CS4B 1FX4A 1WC6A 1CULB 4OYZA 1AZSB 1FX2A 4P2FA 5D0GA 1U0HB 5IV4A 4CLLA 4CLZA 4USWA 1TL7A 3C15B 1CJKB 4CLWA 4CLUA 1YBTA
chains in the Genus database with same CATH superfamily
2MMYA 2V8HA 5A2QY 3CULA 3LP2B 5L39A 4I56A 2JVRA 2YX7A 4WK1A 4QWEA 4F4ZA 1DRZA 2ZVIA 4QZVB 4DQSA 3PY8A 2C3YA 2BJDA 1T9TA 2DXFA 2H4YB 2XY7A 4YB6A 5D4NA 3DOKB 4W90B 3CCVS 1VBYA 1FD8A 1B0TA 4O3NA 1FE0A 3NGRA 3FCVA 3BV8A 3US5A 3DOMA 1WF1A 1IJFB 1IXKA 3GJSB 1LNQA 3EVOA 3Q24A 3HD2A 1R0CB 2AX0A 4DV4J 1Z2ZA 3EX7B 4K4UA 2D9PA 3PVXA 3TWZA 1CJTB 1OO0B 1TTHB 3ULHA 2H51B 4LR9A 5GAEU 1WHVA 2V50A 5IM0A 4B3TF 3MHYA 1KDNA 5E3RA 5GAGU 1BQXA 4Y0FA 3T19A 1U0HB 4RNHA 5D8HB 1N6QA 3UD3P 1I6JA 5AXLA 4FYVB 4DLGA 4NLRA 1TL1B 3H2VE 1RB0A 2HWHA 4FF4A 2DR6A 4QYZJ 3HVRA 2FD2A 3H90A 1NSPA 2ZZTA 4TY9A 5HMXA 2WBRA 1S7HA 1Q86T 5CXTA 3EJMA 2EI5A 2BRLA 1I3OB 4FYDA 4KQZA 2B7BB 2R2UA 2VIHA 3N5FA 1NH8A 4QOTA 4JI1F 3T1YF 1XEZA 4DSEA 3KMSA 2R8HA 1UWAA 3K17A 2HG4A 2UP1A 3QT6A 3LF0A 3PYFA 3I55S 3CXCR 2W4PA 3CJ2A 2UVUA 5J2QA 3HKWA 5F3TA 3FBCA 1WJ9A 5DLGA 3Q89A 3D0GE 5LMUF 2LA4A 2M8HA 1SVDA 4ZVRB 1DHMA 1NK4A 4DX6A 5LJ3Y 3AOAA 2F65A 1X9SA 1WTBA 2L48A 3CCJS 3M2VA 5KTQA 1HMVA 3HI9A 4UW2A 5IT9U 3FKBA 2A6OA 4PWDA 3FCHA 4XPCA 2OKQA 2BE7D 2CDRB 1FTCA 2M4MA 4GKJJ 3C14B 1N0UA 2OH2A 1KR4A 3OXLA 1V5VA 4WIQA 2ACMA 2EBEA 3PW5A 2UUCF 4L76A 2QC3A 2Y3YA 4RW7A 2JH3A 1NNDA 4HHHA 4JI7J 4ANCA 4R0EA 2XLJA 2J6UA 1LWEA 2HWIA 5KFCA 4ES2A 2QRRA 3ET6B 2UVVA 5KOWA 4IYQA 5H1SV 4DWIA 4R0JA 4FVMA 1GMWA 4IRDA 1NAQA 1HI0P 3M30B 1LW2A 2Y0BB 2KRRA 5F8GA 1WOSA 1U1OA 3C15B 2HURA 4JB8B 1LQ9A 4URQU 4RW8B 4PQUB 2BE9B 1QSYA 5B0EA 2BA9A 1M5SA 4KAIA 3I9ZA 1Q4RA 2ZUGA 1VLOA 2D3O1 5ETRA 2NYIA 4ZPDA 3VZIA 1YX2A 5HLFA 2DXEA 4W92B 1J2VA 4LIWA 4HT7A 1M5OC 3MR2A 3QATA 1HD1A 4NLTA 4TQRA 4WBFA 2DHSA 4WFXA 3CJ3A 1Q5YA 4MK7A 3KOAA 4ZMMA 4ERDA 2YH1A 5IZHA 3PZPA 1HI1A 1SIZA 4ELUA 3AAWB 1CSJA 2C3OA 2G1DA 3EWGA 5F9LA 4QCLA 3E51A 2XHCA 1GFWB 1P27B 2YBVA 5E2QA 4NLGA 3OTCA 3R8YA 3IP0A 1U2RA 2PMHA 1X9WA 4J7CA 4A8XA 2QEXS 2E5LJ 1A7GE 2VA2A 3O8WA 4J9PA 3L7UA 4OZ0A 1YLXA 3NAHA 2PN6A 3AJ2A 5AXNA 5IWAF 3BH7B 3BO4A 4IUFA 1BE4A 2LFVA 4DDFA 2LQ5A 4J9VA 4TKTA 2CADA 3AA8A 1QTNB 3V2UC 4G65A 2O66A 2KFZA 1N36J 2IA0A 1RHQB 3Q8PB 1ELOA 3NGKA 3J80Y 1Y11A 5CYMB 2XS5A 5EDWA 1NSKL 4HI1A 1QSLA 3DLGB 4YS2A 3MPUB 2ZH4A 4PYAA 2FPHX 4H4MA 4KGZB 2IVMA 4HDGA 2HHHJ 5D3GA 4KFBB 3N9UC 1NHUA 2ZH5A 3UCZP 4DX8H 1BY9A 3IAS9 3LWMA 1RSCA 4BWMA 3G9CA 2O3DA 3MMJA 4ZJQA 3TARA 1TQLA 4CO2A 2HVHA 5KG3A 1JLQA 1HA1A 1Q8BA 1XN9A 2UZAA 1LWXA 1NM2A 1PAUB 5A2QU 1A0OB 4CZCA 2K3KA 4J9KA 2EVZA 4C4WA 4YB5A 2MJUA 4F4AA 4JI4J 3MEGB 4ZLJA 2F4VF 3SFGA 3SCJE 4TU9A 2AEMA 2VICA 3OLBA 3DRPB 3ILIA 2ASDA 8RUCA 1L3KA 4JI2J 2CPEA 2HLTA 3TAMA 5LSLA 3IAM9 1S6QB 5FDLA 2FVRA 5IV3A 1RHRB 3W2WA 3SXLA 4C48A 3KLGA 1T02A 1RHMB 2YNFB 5CCLA 2FHJD 3PX6A 1RKJA 3JTOA 5F41A 2FC8A 5HAOA 1TP7A 2E9RX 2F4FA 3DHXA 3ZTOA 3UN5A 5MLCV 3A3OB 2XI3A 3FFIA 2HEKA 4EFAC 2CPZA 3PJ9A 3DRYA 1OPIA 2AT1B 3R5AA 3S7RA 3WBZA 1WC5A 4JI0J 4NXNJ 4NA2A 2VBYA 1XMOJ 2B9EA 4HH0A 2G1HA 2FHMA 1RABB 2JEFA 2N7YA 4L74A 4G6VB 1YJ7A 3AQPA 1I5OB 2WBMA 2M52A 2MZRA 2NREA 1V5IB 2YKNB 4BLGA 2QL7B 3VQSA 1CLFA 1FRHA 3H5UA 1MNEA 3GYXB 4LF7F 2E1RA 2NQPA 3GYNA 5GAGI 4ILLA 2APOA 3ZTQA 2MEWA 3GSIA 4ZCLA 2QLXA 4ZP6A 2EBGA 1VRQC 2LDIA 1W25A 2P2CB 2IM1A 3KNGA 4FF1A 2AP6A 4K5SA 5LM7E 3SYZA 4MIWA 3HCXA 3KJNB 5A6WA 4WPAA 4LSNA 2X51A 2VQFJ 1CBKA 4KPYA 2L08A 1ZTWA 2DHGA 3EGWB 2Z2ZA 3SEOA 2Q43A 3MM6A 3RUBL 1VDHA 2RQMA 4PXBA 1D9FA 1VRTB 2AJ0A 2CG8A 2QX0A 1BGXT 1SH0A 5HL7Q 1MROA 1DLOA 5ETQA 2B6AB 2XTJP 1FWKA 2FGOA 3GR1A 3BS9A 2HGLA 2JC0A 3PFOA 3UDLA 4ZN3A 1FVQA 1RUSA 3CWJA 4BCAA 3K5LA 1REVA 1EJ7L 1AFIA 2J7KA 3CC4S 5CYQB 3NGUA 5JVGQ 4S0MA 2ZNZA 3R5BA 1WELA 1X5SA 4Q43A 5J1EB 1M1KT 2ZBCA 4NEYA 4ZPCA 3Q0AA 4G3IA 2DR9A 4EU0A 2N3OA 1WHYA 4V1Ak 2XULA 1HBUA 1ZS6A 3RZAA 4KKOA 3HULA 1SC1B 2BE2B 3GFHA 1F1BB 2BQ3A 2XO6A 4JI3J 2FLNA 2E5HA 3KLIA 3MPYA 2WVEA 1QTMA 1VBZA 5A8WB 4OI1A 3M8PB 1PYSB 1NSQA 4H4OB 2BV3A 5D6GA 6AT1B 2RIJA 1CJVB 3DLJA 2GO8A 4X4SA 4NYOA 4Y2CA 2NXJA 4ETZA 4AQYF 2JRSA 3I6PA 3I4HX 3MM9B 1NK5A 1RWOB 3OJUA 3TEHB 1T05B 2PI5A 2YQ0A 3IR6B 2N4DA 5FLXY 1CJUA 4YDDB 4C6AA 3QGHA 3PXGa 2V34A 3FZBA 2CJAA 1LWCA 2XNRA 3BGOP 2XSJA 4IFYA 2HBRB 3VTIA 2MTLA 3Q86A 2AMCB 5KG6A 1SQEA 4Z7CA 4I6WA 2KU7A 1QE1A 1NDKA 1U1KA 2VBXA 1P8GA 3ZZPA 3FQLA 4IG3B 3BN7A 3QT7A 2C2OB 1S48A 1N34F 5DDRC 1MMDA 2KJVA 2MGZA 2DGOA 3M05A 3F56A 1VJWA 2BJ7A 3KLFA 4MKBA 3RBEA 2WZ1A 3GWCA 1O0PA 2CFXA 2PFFB 1WC3A 4EEYA 1XR5A 1B4SA 3RU0A 1HD0A 2E9ZA 3V6KA 2HHSA 1WD6A 3QYYA 3F73A 3OR2A 1NDPA 3CJ5A 2MSTA 3W9IA 3P4UB 3CO9A 4O3QA 4V19J 3BPDA 4B3OB 1XMQF 4XIUA 3JQKA 4G1PA 4GC7A 1CC7A 4M5IA 3C16A 1AB8A 2WONB 3SZ2A 4PUOB 1TAQA 4Q2MA 2UU9J 2DNPA 4LF2A 3B4MA 4QIEA 1PBUA 2JOQA 3J80U 4MJKA 3RB4A 1O6XA 2Z2LA 3M9MB 1FNMA 3D1QA 4XDDA 4DCOB 1SC4B 4LFAJ 4DI6A 2CQHA 2AYBA 1SJRA 3VV2B 3LH2S 4C8ZA 3FUYA 3S8SA 3AOCA 5CA5A 5BJRA 5E7OB 1SJ1A 1UVKA 3ENAA 2VPXB 3VZHA 1RBLA 4YY3F 1YK9A 3ZZZA 2UUBF 3Q22A 4B9LA 4LVOP 4LF4F 1KVKA 3BBFA 4MK9A 5E0OA 4FVCA 1YJTA 4IG0B 4WWSA 1EKSA 2ZFHA 1LW0A 2HAIA 4YFUA 2MYFA 1RWUA 5KFGA 2RE1A 4CT8A 2W7AA 4DU7A 1S9GB 4CH7A 2BOPA 1UFWA 5J1PA 4J9NA 2AYMA 4P74A 3U1LA 2VDIA 4GC6A 4TY8A 3MAHA 2CJQA 3I0RA 2D41A 3LPYA 2VJUA 1K47A 3MGJA 1UL3A 4DV7F 1RT1B 5MAOA 3BGRB 2IRXA 3G82A 4KJIA 2VDHA 2L3MA 5L9XA 3GJTB 4DR1J 3R7BB 3N01A 4M5GA 3MMBA 3U7JA 4DPTA 1RWMB 4PG4A 2JLEA 3K0JA 1YVFA 2BXJA 3WZ0A 1TUWA 5J2MA 1O51A 4ZS6A 2W1BA 4O44B 4RBVA 4LF6J 4WZMA 4LRDA 3MECA 3MR6A 2OTLS 4JI1J 1UEKA 3MXHP 4KC5A 1YTYA 1UZDA 5F8LA 4OX8A 3I4PA 2RS2A 4HKQA 4OX7A 3JAMY 2PIIA 2DIUA 2ZOFA 1VI7A 5L1IA 1HNVA 1PBAA 1S9FA 1TK5A 2ZBPA 3W60A 3DGPB 2E44A 2W01A 1K0TA 1GXUA 4DV1F 2J9DA 1OY9A 2DNGA 1X4HA 2MZJA 4EK2A 1A9NB 4OZJA 3NBPA 4JI6F 4I67A 2IC3B 1K73T 2EC0A 3V6DA 1U6ZA 3EZUA 5E41A 3Q8QB 1WI6A 1AXQA 1JIHA 3NY0A 3DU5A 2HLUA 1IM6A 1QAIA 1APSA 2V4JA 3OR1B 2M7SA 1UPPA 2OD4A 1QM9A 2B51A 1FTRA 2NXUA 3GJQB 2B3TB 5KG2A 4C3MA 1KTVA 1UA0A 2NXNA 1U26A 4GRSA 4WZQA 4K0KF 2LECA 3UNGC 2LA6A 5B0FA 4FKXA 3TVKA 4DG1B 2QGFB 4EBDA 4NA1A 2HHXA 3R6GB 2Z57B 3K57A 3BKUA 5DM6Q 2J8SA 3M2UB 3MEDB 3CIMA 3FGVA 1J5OB 1IBCB 1XR7A 4XO0A 2DITA 2XMAA 2JEGA 4J9SA 1WC0A 4WKYA 5I3UA 4FXDA 1RXOB 3T9ZA 1QAXA 1SJFA 3JSYA 5J2NA 4KO0A 3MDFA 3MOZA 3R5DA 3HSGA 3F0NA 4P2XA 2K2PA 1X4GA 3ITHA 3CCWA 4X2BA 2BANA 3GYGA 3RR8A 1VISA 1TUGB 1JLFB 4NYZA 1S72S 2MKJA 1VQPS 3MAAA 5C24A 4Q45A 1HNXF 3A8EA 4A8YA 3MM8B 1TUVA 3CT9A 3M8QB 3OFHA 2AQ4A 3FEZA 4UY8T 1SL1A 1YDLA 3FBBA 4DR4F 2KFYA 4IO1A 3R27A 4M5LA 2M2BA 4CP5A 2OEMA 2Y8WA 4WJBA 3CMES 3R1HA 5FLXU 1Y00A 4C7QA 4ZIWA 4YEAA 2VKRA 3R7SB 2GGPA 3UDEA 1DTTB 1C1BA 1N5TA 1VQ9S 4DF4A 1EETA 2XLIA 2QG9B 1T0TV 2ADBA 3D6MB 3SCIE 5IXUA 1CJKA 1JX4A 2VFRA 4QU6A 5KFQA 2KL8A 3H4DA 2MQPA 5CCMA 1WI8A 1N56A 2MZTA 1S4FA 4P10A 4PCQA 4LF9J 4WF9Q 1SI9A 3IMQJ 1HNWF 3NG8A 2DR8A 2OSQA 5IWAJ 2HQGA 3LOUA 2DHHA 2QV6A 2ZZNA 3C2PA 2A18A 1SC6A 3PEJA 2I1RA 2CQCA 2WK4A 1H3DA 1VQNS 1Q1KA 4ZCIA 1FXRA 5KFXA 1RT3B 5DQHA 1N4LA 3BYRA 4DZDA 2Z56B 4IH6A 3TQEA 4LRAA 2WRMA 3NS5A 2V2KA 4B08A 4QQBA 1SC3B 2YX4A 2ZH7A 4FXWA 1KHVA 4TYBA 4WP8A 4ECSA 5ADZA 1NDCA 3OL9A 2HZCA 3U1MA 4LFCF 1PJ5A 2W2MP 5L38A 3LW5C 1WDDA 4LFBJ 2FY8A 1VIXA 4U7UK 1RWXB 1M1GA 4WTYA 3OL6A 1FRLA 4ICLA 1KNZA 4KGXB 3W66A 4A8FA 4R5PB 4LR7A 2I38A 4IRCA 3HJFA 1R0BG 5IC4B 1TL1A 2YVSA 2IAJA 4I2QA 3OT9A 4QIVA 1D9DA 1UCNA 1WOOA 3CCES 2ERRA 4P7TA 3TUIC 1IKVB 3PNIA 4Q44A 2MSSA 1P9YA 2D9OA 1S1WA 3WX4A 4K4YA 3DI6A 4RBUA 4CTAB 3POTA 3V4IA 2DGWA 3CCMS 1CVJA 3W5YA 2DCLA 1X8DA 1DQ9A 1U48A 5DGBA 1RBAA 4J9MA 2F8HA 4FP9A 4B3SF 4B9VA 3M8YA 1RT7B 3G6YA 1ROFA 1RAOA 4PZVA 3MF5A 2DEJA 2MZQA 3BM7A 1HYSA 3IBCB 3GILA 1VCTA 5JJBA 4MYUA 4ZP9A 3MCNA 1ZA1B 3PO4A 3BZQA 1HNIA 1U47A 1R6YA 4NLVA 2M70A 1OYEA 1N88A 5DS7A 2HHQA 3G4SS 2PEHA 1Q79A 3W62A 1EKRA 4OJGA 4AL5A 3ILJA 1IVZA 3PW7A 3J7AN 2VUGA 3IM8A 2ZJQQ 3CUNA 2QA2A 4CLPA 4B3MJ 3QRQA 4DPOA 2LQJA 4UOFA 2M9KA 2MHNA 2R7RA 1R0AA 3OSNA 4F50A 1M5HA 1NU4A 4LF7J 4M5MA 4ECWA 4DV0F 2B4VA 2VB6A 3V6JA 4KB7A 2ZWPA 2GZOA 4E2FB 2YNGA 1HBNB 2FLOA 1YRXA 3JAMU 4GKKJ 4DN0A 2HFVA 4R25A 1RLCL 4FZVA 1IKXB 3FNNA 1O5JA 8AT1B 1F3VA 4OIXA 4J90A 2PO4A 3D68A 3THTA 2XS2A 2QA4S 3BREA 2LLZA 5H9FJ 2E7WA 1UAWA 2W4DA 3DFEA 3Q2TC 3Q8SB 2ROEA 2FHKA 1NKEA 1W2IA 2HMIA 2YH0A 5M2RA 4F4YA 4NWBA 2DHAA 4PKDB 4GO7X 5DO2A 1H0HB 2BVZA 5HBMA 3G6XA 3CDAA 3IM9A 2V8PA 2NSBA 2JFDA 3V81A 3T41A 1HQEB 1J5EJ 2E5IA 1HNZF 4EUVA 4JBCA 3HMJG 2FVQA 5BYRA 3FQKA 2OMOA 4RUCA 2JHEA 2HGMA 3BSCA 5JMNA 2DNZA 2OGUA 2KO1A 3TVYA 2C3UA 4PXCA 2E29A 4LRBA 4CLWA 2I2YA 3NXZA 4X4VA 3SCLE 5A8RA 2NYHA 5A8KB 2WSFC 1IKWA 1N0VC 2SXLA 1BMQB 2Q79A 2J8AA 3I5CA 4KV8B 5DZ7A 5DQIA 1IQZA 1EP4B 2CVEA 4DBQA 2CJYB 5F8MA 5GMKa 3H98A 4AQYJ 5K8MA 4U96A 3T5LA 3OTDA 1L5UA 1KOOA 2CAJA 3RJMB 3GCXP 5FD1A 5LT5A 3C8YA 2RQKA 3NAIA 3CB4A 3J7YU 2QA4G 4WFNQ 2GX8A 3M8WA 1VK8A 4DCJB 3OBIA 1U8WA 3IR5B 3TUZC 4MKAA 2B56A 5B0BA 1ZZFA 2CJ9A 1FK9B 1Z2LA 2RQ4A 3BSOA 1UEVA 1RT6A 1RTDB 2ILZA 5BYSA 3I9V9 3OTBA 1N34J 2JVOA 4TYAA 5DGAA 3O1LA 4K4ZA 4X4OA 1JKHB 3GV7B 2RH3A 4OI2A 2W9CB 2XWXA 1R8AA 1BLUA 3MTJA 2R8GA 4EYIB 3CTRA 1TFYA 3QBCA 2VASA 2MQQA 4B9MA 1WF2A 4KHRA 4OV6A 1HL6A 2C2RA 3G8TA 4B9UA 2FDNA 4JV2A 2HQDA 1MSWD 2AF6A 2GVZA 2DNQA 4HH1A 4OJHA 3MCMA 3MM5A 1NJXA 3ENWA 3WDOA 4ZK7M 2QL9B 3OHAA 3CIZA 4X64F 2NS1B 1S7IA 2VG5B 1VQ6S 3M6WA 3HHLA 1JNRB 2IMOA 3EZOA 3EXCX 2WB1D 5JUMA 1XMQJ 1FKPB 2C1EB 3GPAA 3AD9C 3W3SA 3QWUA 5AXKA 4ZITA 4UUWA 2DNRA 4L3NA 2FJAB 1RTIA 2BR0A 4U8VA 4HACA 3JTNA 2ZE2A 5GADU 4BS2A 3KLVA 2WCXA 2DRDA 1ITPA 2L9DA 1AFJA 3CPWR 3SSSA 5F8NA 5IT0A 4O3OA 2XHWA 3VGSA 3L95X 5IC6B 1HPZB 3WC2A 4WE1A 4GKJF 4ZOSA 4OFZA 4YY3J 3LQVA 1KQSR 3M32A 2W8KA 1TKTB 1X4EA 1Y5NB 2GAGC 2HBYB 3DHWC 2GW8A 1S1UB 4NCAA 2EXUA 3CMQA 3KHLA 3CD5A 2XM3A 3DYAB 1H2UX 4RR5A 4JV1A 1VC6A 1WSRA 4NXMJ 1WEYA 2GQQA 3A8JA 3KXDA 2CQGA 4KHPF 1EHWA 4DL7A 4YR3A 5T7LA 2P5VA 2OHDA 1MN7A 3IG1A 4RX6A 2OPRA 2V67A 1H74A 4CLUA 1UFLA 4HR2A 2HVZA 2XZTB 2VONA 2AGPA 1WC4A 1VQ5S 5D0RA 2YNHB 4O4RA 1BQMB 2BW2A 4RW9B 1N5SA 4D3HA 2QO3A 1Q81T 4B3RF 1UVMA 3TA2A 3TRGA 3KK1B 4RKUC 4ZPTR 3T3FA 3BEGB 3MM7A 3CCSS 5BR8J 5AE3A 3SDEB 4IOCQ 4UZCA 5THWA 3HKZD 2MHEA 4CO4A 1XBWA 3ETOA 2DNNA 4K4XA 2BM1A 3ZFVA 2MJNA 4M5JA 2FY1A 5HQ8A 1NPKA 1YZ6A 2UUAF 2BACA 3GG1A 2CPYA 2GC8A 4MMOA 4ES1A 1IR2A 2HIQA 1S0OA 5HJXA 3K2YA 4QIWD 2R7WA 2RKIB 1KS2A 2M0GB 1HQ2A 4LF8J 4K8RA 3JSMA 1JXEA 4DXLA 3IGNA 4QR2A 1CULB 4FYYB 5ETSA 4ZHRB 3THVA 4OZ5A 2B9WA 1YIJS 1VQYA 3HSDA 3O5TB 1TVRB 2RB7A 3KMQA 1S1VB 4DN9A 2ZEJA 3VAFA 3ZZYA 4XTTA 2VG7B 2OIHA 3KUEA 3MUTP 3GB0A 3CCQS 2CA9A 4NE9C 2KM8C 2DGTA 4IQXA 3X3UA 1YJRA 1RTHA 3CE8A 1JNZB 3OFEA 1QD1A 3QO9B 2XG8A 2CZVC 2XBPA 1FRMA 1C0TA 1TL3A 3R2CJ 3D9BA 4FYXB 4U7UD 4N77A 3R5GA 1JLGB 3HZGA 1GEHA 4LRCA 2E7VA 5IT4A 4PYDA 1WTFA 3MWBA 5HANA 1BQNB 4IFVB 2RRAA 1RAJA 3VAIA 4CNYA 1RU1A 1U1QA 1UWBB 2BKPA 2CIMA 4I1TA 4PAAA 1B0PA 4K5RA 4F7VA 1OSCA 1HW8A 2C2MB 2HNZA 2V8GA 2KFNA 1S9EA 1MWQA 4K4WA 2WVBA 5KT2A 4IH5A 2BZ2A 3QGIA 4OYBA 4AE5A 1SKRA 3ILOA 1P1LA 3SCKE 4LT6A 4JI4F 2XMTA 3CJSA 2CNOB 5FIIA 5T41A 4EGLA 1HR0F 3TQ1A 7FDRA 3NEKA 3QJJA 2PA8D 5HP1A 4QR1A 1ZAWA 5KFLA 2AHOB 1XNQJ 2W7OA 3SBMA 2POKA 1S76D 4C3KA 2DHXA 1GX5A 4RW4A 3DM2A 3BQ0A 3MEEB 3HO1A 5CZXA 1WKJA 2M5YA 3AJ1A 5KFEA 4NLOA 3KLEB 1Y7PA 4IR9A 4B17A 5LMNJ 4DQQA 4ELVA 1FDNA 2A2CA 4Y2MA 2KHCA 4DV6J 3QT8A 2W2QP 1OY8A 3FC9A 3AB2B 4JI0F 4DPYA 2D3ZA 4NXNF 2MLXA 2BM0A 1Q95G 1XMOF 3W63A 1NK0A 4W4MA 3N6MA 3HVTA 2R7QA 2NCKL 4K59A 2AJQA 3J7YI 2ZD1B 3A3PB 4WXWA 2MXYA 4DR2F 3M1VB 1U6BA 1Q82T 4IRKA 4YR2A 1CS4A 4O23A 2JC1A 3LP0A 2BUNA 4ANEA 3C6TA 4DV5J 3OD2A 2CQIA 9ATCB 2MQMA 4R8UA 1RTJB 4CYUA 2DGUA 5L46A 1V3RA 1HKAA 2LQ9A 1GMVA 2X1AA 2VD3A 1FCAA 1TL4A 2VQFF 4RW6A 2XNQA 4HTJA 2KVQE 3VCDA 3UR3C 3P8BB 3MFIA 4NI2A 5L1KA 3NCRA 5L9NA 1HWKA 3KK2A 4X4NA 5A0YA 2QLFB 2CJXB 1GTEA 5SZTA 3MTKA 4CLLA 1R27B 5JXSA 1TL7A 1TAUA 5DJBA 5C42A 4U67Q 2OPPA 4LSZB 1VRUA 3UN3A 4YDXA 3KFWX 4F2RA 1WWHA 3AH6A 3DOMB 3OTOJ 4RPFA 4JV0A 4ECXA 3PRDA 2UUTA 2XYGB 1NK7A 3VR1A 4I7FA 2AJ1A 5L1JA 2OEKA 2NUUG 1P6TA 4JI5J 4LBPA 3VGTA 5GADI 4K7QA 4IDKA 3TP2A 4CDIA 4OI4A 3UPFA 3NNHA 5IM0B 3QLHA 1GXLA 3NCQA 4DR7F 4ZVTB 3VVTA 2BABA 1Z1ZA 1N6QB 2HQIA 4F3QA 3H7HB 3V6HA 2OFGX 3D1OA 3OPKA 1QY7A 1M5KC 4A46A 1UEUA 3DXSX 4ZCKA 5AE2A 2CNNB 2LP4A 1RT5A 1VMBA 4TNOA 2HK3A 1NDLA 4NCGA 5D0GA 1OS5A 3QGGA 3PX4A 4HT5A 3TJ9A 1IBLJ 2OSRA 3EM1A 3NRBA 4DX5A 2KDOA 2HRYA 1VQKS 1G3OA 3C46A 2DH7A 2CQ3A 2DKOB 3GR0A 1JLCA 1AA1B 2QSWA 2LXFA 1MMLA 3D6FB 1UVJA 4NZ6A 4CH1A 4ED6A 3TZZA 1HWLA 3J7A1 4AD6A 3BR8A 2IYIA 3BGLA 3QAUA 4U8YA 4H4KA 1FESA 3SI8A 5J2QB 4DUYJ 5KFHA 3HHLC 1S49A 4OHVA 2X3DA 4DQIA 2FGCA 1X5PA 3TYTA 2OO4A 1N32J 1FEEA 4M1KA 2MKCA 2N7CA 3B4DA 3KJFB 3VQTA 3PEHA 3DKDA 1FD2A 2KHDA 2G2YA 4WYLA 4QBUA 3GG0A 5AE1A 2M8DB 5HMWA 2N3LA 3M2VB 1HMVB 3NP5A 1IWAA 3OLAA 4DU8A 4PWDB 4D3GA 3BO2A 2ZOGA 3ILLA 4F2SA 2LYVA 2OLWA 2HBZB 4O3PA 2P6SA 3J81j 1YJNS 4LIRA 5ETTA 3G87A 2FJDB 1HW9A 1R31A 4RW7B 1UVNA 2VKZG 1KLNA 1MU2A 1AZSA 4MAKA 3I56S 1GX6A 2KJWA 4ES3A 1LWEB 1IM4A 4GVLA 1HNZJ 5J2PA 4DFJA 3D66A 4EZ9A 3PTWA 2ZJRQ 2CQ2A 3OFFA 1LW2B 2JFKA 2EG1A 2QN6B 1T94A 1QUPA 4DMZA 2LDYA 1X9MA 2CPJA 3LANA 4UTGA 3LGNA 2B8QA 1LXNA 4PXEA 2GS8A 4GO5X 3D3BJ 5H9FK 1T9YA 4OJ1A 3O6QA 2LU2A 2RF2A 5EHHA 4C97A 1FX2A 5HLFB 4NLUA 2IVYA 1H73A 4CLZA 1C4AA 5DZ6A 3EVMA 2MLYA 2ZUAA 3D6HB 2OJ3A 1DTQA 9RUBA 1RAIB 1KLMA 4HYKA 1AW0A 2HAFA 3Q8RB 2H4WB 3M8ZA 2FLPA 1JLEA 3M2RA 2V2VA 1RISA 4IR1A 4ZVFA 4O3SA 5KFPA 4M8LA 2HFSA 2MZSA 1T9VA 2RJZA 3ZNJ1 2RRBA 2IVFB 3IBWA 4QJVA 3IN5A 7FD1A 4USVA 4X62J 5LXRA 3DXBA 4DFKA 2UVRA 1GMWD 2LXUA 1DY3A 1PG5B 4MKVA 3GCWP 3HX9A 2V5HG 3GIKA 1B70B 4DR1F 2C42A 2HQFA 3AY0A 3GONA 4OV1A 3Q83A 3DLKA 4AYBD 3A3NB 4URGA 4F26A 4ALZA 4RUBA 4F67A 4YR0A 1Q8IA 2ZJPQ 1XK8A 1S97A 4FS2A 4P2FA 2YPYA 4WYWA 4MFBA 3T6BA 4DHVA 1SUQA 3IS9A 4LF6F 3NOGA 4P73A 2HVEA 4UUXA 5ETMA 3DN9A 2GIFA 1YI2S 1L3VA 2DH9A 4CH0S 2UXBJ 3EGZA 3GMGA 2GA7A 4X4QA 2AKWB 4H4MB 3KJVA 1HIYA 4X64J 5ETLA 4U6PA 1RKIA 5D3GB 3RBDA 2R7UA 1IKVA 3HSZA 3KK3A 2I5JA 5SUHA 2OPSA 2GHWA 3KNAA 4WU3A 3QZ7A 1I1GA 2FIUA 2E1PA 1C1CA 4ZKAA 5KFSA 4DR6F 4F02A 1RBOB 4DQRA 1Q53A 3L09A 3ZTPA 1JLQB 1FFGB 1EB0A 3RGIA 1VC0A 3G71S 4KE5A 2Z30B 3QRRA 3TX0A 4NMLA 1DURA 1KP6A 3GZ7A 3CJKA 2F8MA 4F8RA 3DGVA 4YP3A 5A76A 2U2FA 1BHNA 3TAMB 3MD3A 2B43A 1TV6A 2AJFE 4NYPA 1XNRF 2ABYA 3JSRA 5KFTA 1CPZA 3KUGA 2OFHX 3HFVA 3W2WB 4GMKA 4C8NA 3KTQA 3KLGB 2CNLB 3SSQA 1YBAA 1WG5A 2F40A 1PYOB 3E3XA 1C0UA 1IR0A 2ZNYA 3BKFA 2P6TA 3W5XA 2HKEA 1YJVA 2OPQA 1FRXA 3FFIB 1HBMA 1DAXA 4A8QA 2AD9A 2OMLA 4KHPJ 2MPUA 3RYLA 3UI3A 3P96A 4OX9J 5D0HA 4TLRA 3Q8YA 3MMCA 3QMQA 3GFXA 1URRA 1TKZA 2IJRA 4WIIA 2C2DA 1R8BA 2RU9A 1XERA 2VJVA 2KXFA 1BUXA 4B3RJ 1RT2A 2HPUA 2MDAA 1RADB 3LP1A 1JXLA 1HQUA 2WB4A 4USWA 3VAKA 3RB6A 4M5NA 2BQRA 3N0VA 1FFSB 4A4JA 4KBIA 3MPWA 1LWFA 2UUAJ 3B6BA 5D4LA 3PDNA 4LSNB 1KVIA 2W9BA 4ID5A 4OMFG 1K8AT 3TOQA 2WW4A 2B8PA 2V4QA 3K8WA 4LRFA 1TMJA 2PE8A 1RAGB 2Y8YA 2J7UA 2NZCA 3U02A 3MM6B 3X1LB 3LPEA 3NL0A 2QIFA 3W2VA 2NXCA 4C3LA 4JUZA 4DPUA 2W25A 3R6LB 2ZHOA 1MROB 1DLOB 3MURP 3FBEA 1YQHA 4CLTA 2VG6A 3RG6A 1WG1A 3D5MA 1NXIA 2DK2A 2BJ3A 2HZAA 1FEHA 2VC1A 1IBMF 5FJ4A 4LF9F 2KZMA 3CJ0A 1REVB 2GIQA 1T03A 2G0JA 4YMEA 4NRTA 1C2PA 4URSA 3PJXA 2QLJB 2HHWA 2RVJA 1F60B 2R7XA 4L73A 1TU0B 1JLAA 3RBXA 3V5RA 4UOGA 2PT0A 2OELA 4K2JA 1HBUB 1WACA 3CDUA 2U1AA 4KKOB 4YUDA 1N5YA 2XS7A 5K8PA 2VPWB 1HWJA 3HT3A 3CJQA 1M0SA 4V19X 3WC0A 4IKAA 3KLIB 2H1YA 3IA0A 3TW0A 5HROA 1RWPB 4KGKA 3VF0B 3PR5B 1Q8LA 3C6UA 4X66J 2GHPA 2HNDA 4LFBF 4Y6IA 1FRIA 2GCFA 1DQ8A 4WP3A 2B5JA 3EGNA 4XPEA 1GMUA 2H65B 1R7IA 3KWMA 1BWEA 2DNHA 3ONQA 1CJUB 4OZ1A 2W7PA 5C7PA 3T1HF 1LWCB 2MB0B 2XSJB 3GP9A 4O0NA 3TR5A 2PFDA 4IFYB 3C19A 3LAMA 4DV2J 1HR0J 1TFWA 4WK3A 3TUJC 4ZPBA 1QE1B 1I51B 1VYAA 2EKYA 4IOAQ 2RDIA 4H4KC 2P8IA 5HI7A 4E8UA 5CABA 1Z4UA 2IFXA 4M5KA 2MGZB 4RL1A 5D0EA 1TKDA 2RMLA 3CCZA 4F3OA 3KLFB 2V6AA 1CG2A 2MQLA 4DR5F 3JQMA 3QAEA 3BDEA 4G1QA 2YWEA 4L75A 3AJDA 1SL2A 4N76A 3DDKA 2ZH6A 1K0VA 4DR2J 5A6PA 2O01C 4Q2LA 4XDCA 1R8CA 3OR2B 4ZP7A 4TU8A 3Q2SC 2UV8G 3PCOB 4P6QA 4B3MF 1W26A 3TJAA 1EQ0A 2BYCA 3I0SA 3C16B 1EIYB 2KYZA 4QWCA 2XCAA 4ZLLA 5KT5A 2DY9A 3NS6A 1VR6A 2OEJA 4Y00A 4TLQA 3T1AA 5KAKA 4C8YA 1RHKB 1SBRA 2YQ1A 4GKKF 1JK9B 3CCUS 2R7TA 1NJIT 5E3CA 1E6YA 4ENOA 3GIRA 4P7VA 3N6NA 3H5XA 2XMJA 5RUBA 3TUPA 2B4UA 4FBUA 2AYEA 2BJEA 1CEZA 1S6PA 8ATCB 5E3AA 3KJQB 5F3ZA 2YXLA 1H7WA 2GQ2A 4F3MA 3MPVA 2IHR1 2O5DA 1X0FA 3SQGA 4AUKA 5M2UA 1LW0B 2HW3A 3DOLA 2Y1JA 2NXEA 2H9ZA 1GQEA 1GK8A 2DNYA 2EPIA 5DM7Q 4PXDA 1J5EF 5B0DA 4ID8A 3UQSA 3PG9A 2M88A 3DDNA 1N33J 2VU5A 4ETXA 1LXJA 4TY8B 4X84A 1IKYA 3I0RB 1ZBTA 3LGMA 2R8KA 4HEA9 2C2EA 4O4GA 4PPDA 4DV3J 2E5JA 3PHEA 1FO1A 1RHJB 3MUMP 3NKYA 3M4XA 2UXDF 4DR7J 3G82B 2G0IA 2UXCJ 3CF5Q 1B7FA 1GAOA 1V3ZA 5DDQC 1PYTA 4YQWA 5CQGA 2QZ8A 2RUSA 1S99A 3MFHA 5I42A 1AYEA 1SV5A 3N5BA 2V94A 1R8HA 2ZHAA 3MMBB 3V4MA 2J9CA 1K9MT 1UW4A 3K8VA 2CJKA 3ZO7A 3MPDA 5J2MB 2CQ0A 1S4EA 3B54A 2C22A 3MECB 2EK6A 1AUSL 3HP6A 3JB9k 4FBTA 2E1AA 5CAAA 5F0UA 1HNVB 2KRBA 3LA0A 1F5CA 3BSAA 3JQJA 2A2DA 1OQ3A 4IO9Q 2RDDA 3CW2C 4ECZA 3M6VA 5L1LA 4ED1A 4J9QA 1E6VA 3NBPB 4LJMA 4RZRA 2DO4A 4WFZA 3V6DB 3MR7A 1LKZA 1BXNA 1SCJB 2RHSB 2AZ1A 4NL5A 4DFPA 1TL5A 4ER8A 2OD6A 2V4JB 4N41A 4TQSA 2C2ZB 2P9EA 3OHBA 4Y2AA 1TKXA 1ULRA 3BR9A 3QSIA 3GIJA 2WOMA 1IBKF 4EBEA 4A8SA 4LUBA 3FBFA 4Y28C 2Z8QA 3TZYA 3UVJA 1VHIA 2ASLA 4OYOA 1R43A 4QW8A 1N5VA 1WHXA 4JYAJ 2IA6A 1ZETA 4NLPA 2MLZA 2ZBRA 3BBCA 2VQEJ 3KLHA 4ZVUB 5I3UB 3HHEA 2RSQA 3L7PA 2QLWA 5J2NB 4KO0B 4F0HA 4YB7A 3A13A 1NUEA 2JNJA 3DMJA 3ITHB 2KT3A 4LF1A 5DG7A 2BANB 1CQMA 2ROGA 1W7WA 4FPRA 3O3LA 2Q66A 1F9FA 4BDPA 5C25A 3MAAB 5C24B 4NPOA 2ATLA 1F2HA 4Y2IA 1JJHA 3C3LA 4C11A 1NKCA 3D7SB 4ZVHA 3QJPA 3KG1A 4Q0BA 3DU6A 4DEZA 4B02A 3MI7X 2WAQD 4YHHJ 3S6EA 2G13A 2HHTA 2QFJA 1RP5A 1WUUA 2VF3A 5LSOA 1Y3JA 2LKZA 4ELTA 3K5NA 2YKAA 1WNEA 4RUHA 4YN3B 3LAKA 2B9XA 4CI0B 5EN1A 1ZOTA 2EFOA 3HF5A 1G1XA 4DSLA 2IPOB 4AT1B 2WVCA 2JWNA 2GGPB 1M1HA 2K1RA 4NXMF 1C1BB 3JYTA 1EETB 1L3TA 5ETPA 2KN4A 5HVGA 4DUZJ 2MQNA 3S1TA 1V3SA 1CJKB 4RNFA 2DGSA 5HATA 3BPSP 4DR3F 3R2DJ 4OL8A 5KFNA 1D1UA 1TK8A 3IBFB 1B7YB 3D6TB 2DISA 3ISNC 1ZM9A 2MKYA 1WEXA 4OX6A 1NLKL 1XWLA 5K14A 3TVZA 3F44A 1HBOA 2KVIA 2DNOA 1SL0A 2KXNB 1B99A 2AEJA 4OHWA 2UUWA 2VV5A 1TELA 2XEXA 3I5BA 1S1XA 4KIAA 1NHVA 2MQOA 1ZPWX 3E01A 5BR8F 3QFWA 2IBOA 5KT3A 1M5PC 3OUYA 1ZM4A 2BEFA 3KHGA 2L9WA 3K58A 2PGCA 2P9GA 3PYGA 1KKHA 3MMAA 1YSJA 2J6TA 2XMWA 2OUGA 2YKQA 4B9TA 1NPRA 4J5OA 3DRSA 3E8OA 4QW9A 2CQPA 4LF8F 5G0RA 2CZ9A 2R7SA 2ASJA 2XC9A 3TANA 4NCBA 3ISZA 4MT1A 4M5DA 2XCPA 1RT4A 5CZVA 3H25A 2XWYA 1S5ZA 4NLDA 1YKWA 1Y9OA 4ICLB 3ELHA 2KM8B 3RAMA 1I94F 3DRRA 4HDHA 2W24A 1GTHA 2ZOMA 4DR6J 1QVFR 2DRBA 3IRXA 1OMSA 4F4WA 1VQOS 1X0PA 4QYZK 2IAJB 4I2QB 4DCPB 3PIPQ 3P3DA 2HSEB 3DNCA 1L3UA 2XMKA 3G6ES 2JSXA 2Z2YB 1S1WB 4KY3A 1FKOA 3DI6B 2GVDA 3POTB 3V4IB 2IDLA 1SJ4P 1FJGF 2HHVA 1XNRJ 5KT4A 2YNIA 4RU9A 1VQ8S 3HXMA 4DS5A 3W65A 4P71A 2V8DA 3SIPB 3GSDA 2X1GA 1VQLS 4RUAA 4GVBA 1Q7YT 2D69A 5KOXA 3QIPA 2QMXA 3TA0A 5KFOA 4DS4A 4WU2A 5LL6d 2GHVC 1B64A 3I96A 1HYSB 1D8ZA 4YOEA 4PG6A 2EFQA 1KVJA 1QAJA 2CKWA 1QJHA 3T9NA 2WW8A 3ENQA 3BN4A 2KG0A 1S1TA 4KH1B 1YBTA 1HNIB 4Y2KA 1KOHA 4WKRA 3GJRB 3M6XA 2DR5A 1U8SA 2MZ1A 1VJQA 5D78A 1ZPVA 2F63A 4LSLB 3TX8A 1VIOA 3VAGA 4NEZA 5K8OA 3T6JA 3EDRB 3MEKA 4PG7A 4ANDA 1R0AB 2YKMA 3H5YA 4I68A 4CLSA 1PCAA 1NB7A 2HS0A 3K5OA 5CYJA 2EK1A 1JJ2R 1XNQF 2FZGB 3DC2A 3IWLA 2EEYA 1QAYA 2I6WA 2CQBA 2YNGB 2C3MA 1B0VA 1X4AA 2HNYA 1FERA 2KZZA 4OYAA 1X5OA 1Q5VA 5CD4A 4KHMA 1FDAA 4IH7A 4UT4A 1KRPA 5LMNF 1H2TZ 2G9OA 1RI7A 4CO0A 1SIWB 4P2MA 1JLBA 1U7LA 1FWPA 4DV6F 2VFSA 3VWSA 2GIRA 3D28A 2VA3A 5HO4A 1U2CA 2GQCA 4DL4A 3DLEA 1KWMA 4I2PA 5I3QA 3HK2A 4JI8F 2VH7A 3W7BA 2HMIB 4MH8A 2HYIB 1U2FA 3LWLA 2D74B 4ED8A 3OVAA 1PIEA 2ZC4A 2PSZA 5HBMB 2YWGA 3SV4A 1RZMA 1JJ4A 1IBMJ 3V81B 3CDBA 5T14A 2EFGA 2IIHA 6FD1A 2DVIA 3R3TA 4KR0B 3LP2A 3P49B 4DV5F 4Z7YA 2JJ4D 3RAXA 4FS1A 2DGQA 2X1FA 1SXLA 3W61A 2VL1A 3UCUP 2AGQA 3DOKA 1LFWA 4QR0A 4DSIA 2XMMA 1F5AA 5A8RB 4CO1A 1IKWB 4Z37A 4WXOA 3TO8A 3QT5A 3KDNA 2ZH9A 5KFWA 1OPZA 4OZNA 4RLEA 1VBXA 1WHWA 1CJTA 1FDBA 1LK7A 3BGUA 4ZLPA 2C3PA 3THPA 5F8HA 3VALA 2F7VA 1VHFA 3ZZTA 4AXJA 2F3JA 2ZHBA 4A8WA 3OTOF 1PILA 3GFYA 2ZITA 4YB1P 1U0HA 2R9LA 5AJ3J 1KQKA 2PI4A 2Y1RI 4OZ2A 1U25A 2IRYA 2RU3A 5F8JA 4ILRA 2CYYA 4EI2A 2L9NA 4FPIA 3T1HJ 4JI5F 3H5SA 1FWLA 4ZN1A 2C2KB 4HVZA 1DARA 3G8QA 2CXEA 3KHRA 1NPPA 2W2NP 2HGNA 5GMEA 1G7CB 4CWBA 1U45A 1S57A 1RAAB 3G96A 4CQ1A 3UDCA 2ZH3A 1RT6B 4CCHA 3N4WA 2LCWA 1ZA2B 2EW9A 1Q16B 3KHHA 3G6VA 2CQ1A 2H3EB 5ITHA 2YWFA 2B4OA 4I0WA 3ZTSA 2NPFA 2XGQA 4DR5J 2F9JA 1X7VA 4USTA 1IBLF 1UJ4A 2GVZB 4X4PA 2O1PA 3MM5B 3HD1A 3QIDA 3QWPA 1PAEX 2HHUA 3HHLB 2UVWA 3OSPA 2XB2D 4BBYA 2K7JA 5KFDA 3H2UB 5LOQA 2WSEC 5BYQA 3BDPA 2DT9A 1RTIB 4DUYF 1S6UA 4CIOA 4P72A 1H2VZ 4HACB 2W9AA 2ZE2B 1CC8A 2BMBA 3C14A 3A12A 4FDFA 2ZC3A 1Q8KA 4EMDA 1N32F 2FHOB 1RTZA 2J5AA 3W8GA 3FEXB 1PSDA 2AGOA 4C8LA 2IDEA 2CVIA 2YKOA 2R7VA 3OV7A 2HZVA 5EX3A 3D0HE 1XQIA 3M6UA 3N79A 3ET6A 3JS9A 1X4CA 4WE1B 4I64A 2AJ2A 1NJWA 1MN9A 3K7RA 2FLLA 4DLEA 1KC8T 3RRKA 4ZPAA 2J7WA 3M30A 3M32B 2FJXA 1T9XA 1ZH5A 4PABA 3UE2A 5F9NA 2AU0A 4JOUA 3BQ2A 3C15A 2MKHA 4RW8A 4DL0C 4PQUA 2XMVA 3FCWA 4NZ0A 3VGVA 5GAEI 1T8EA 5DG8A 3GV8B 3HHLD 5LJ5Y 4USHA 1L3SA 2HHPA 3M8SA 4Q8EA 3EGVA 1XJWB 5T7LB 4QWAA 3IG1B 2OPRB 2QYGA 4NA3A 2DNKA 5IOLA 1DZ5A 3PFEA 1UZHA 4ZVEA 2IJFA 2ZM6J 4KSEB 2R8IA 1NJYA 1JB0C 3QRPA 5IQ6A 4ED4A 2UXDJ 4ZPWR 3RRHA 3R1LA 2Z0GA 1JQGA 2CZ4A 3A8KA 3CJ4A 3U1NA 4J9RA 1HHQA 1FJ7A 1YJUA 2JEJA 4ZVOB 2WHOA 3MM7B 2LEBA 4WCEQ 2CPIA 2WSCC 3I82A 1YJWS 2ATCB 3H20A 3HZEA 3HVAA 1FNOA 5KT6A 4DSKA 1PC4A 2AJ4A 1URNA 4OYMA 3GLJA 3K5MA 3I87A 3FJ2A 4ZPVR 1RWVB 2DEIA 1NRKA 1KSPA 3JSMB 1FXLA 2DR7A 4UF4A 4QPTA 4OYWA 2LVWA 3OVBA 2HQ3A 3DRXA 3OW2R 3HFZB 3PACA 4X62F 3DLBA 2FHJA 4J37A 2AV5A 4I69A 1OIAA 4OI6A 1KBRA 5CYMA 2V8VA 3UD4P 1QDUB 2V4RA 4F25A 4K2XA 1HWUA 3DLGA 3NMAA 4UOHA 2ROPA 1S59A 2BKNA 4OJ3A 2KI2A 1RTHB 4KFBA 2CJBA 3WQPA 2C2NA 4HHUA 1C0TB 1IBKJ 2ALYB 1TL3B 1AROP 3UCGA 2I8EA 4PRFA 5E33A 4RNNA 1Y5IB 2HRTA 2UXBF 4F4KA 1YJ9S 4G1IA 1VGYA 1Y4ZB 3W8PA 4TXSA 4DOZA 3FDSA 3NS7B 4DF8A 3MEGA 2RT3A 3DRPA 1S6OA 3VGUA 2XI2A 2MKKA 3AB4B 4WFBQ 3RW6A 3G86A 2DH8A 4FNHA 2NLWA 2ZWOA 4LF5F 2RILA 4DL5A 1S6QA 4ECYA 2QSFA 5EWEA 2Z4PA 5K20B 2HNZB 1VOMA 3EE3A 4AL6A 5KG0A 1S9EB 4DZ6A 3AD7C 1RGVA 2B0GA 2YNFA 3RTVA 5C2CA 1ZAVA 1C4CA 3KG4A 4C8MA 4ATNA 4CT9A 1S12A 5F8IA 1KHWA 2CG4A 2VPYB 3LTOA 1KEKA 1AT1B 1NB2A 1NZAA 3Q8UA 3KDOA 4M5HA 2WTFA 5HP1B 1B3TA 3DLLQ 3CD6S 1TMMA 1VQSA 2IYGA 4RW4B 2JZ5A 1F9EB 3DM2B 1Q0NA 5DETA 1S0NA 4M94A 3PX0A 2RQCA 1M90T 3ZNUA 3AODA 1SQFA 2Q6BA 4ZDNA 3RB3A 2CNKB 2G4BA 3FSIA 2YKNA 4PWWA 5GMDA 2QLBB 1OWXA 3P6YC 1U1LA 4RNMA 4JV5J 4NLXA 3L9ZA 3P5TL 1U24A 4CRJA 1D8YA 4OX9F 2RHQB 3HVTB 2HFNA 4DR3J 5HSPA 5HK4A 2H5JB 1BC6A 2D3OR 3GE9A 3D54A 2B7CB 1CS4B 4MYTA 1FX4A 2FTRA 3KUHA 3GFZA 3LP0B 1WKLA 5G4DA 3C6TB 5IQQA 4R8UB 1ZAXA 1VRTA 4CYUB 1PJ7A 1ZM3A 3AT1B 1IR1A 4PEOA 1ICEB 1RWWB 2FUG9 1OYDA 2B6AA 5EUHA 4F36A 2HVDA 4RW6B 2F8EX 3Q8VA 1IN0A 4E0DA 2HIYA 1UA1A 2AWZA 2BBEA 5CYQA 4NI2B 2BJ1A 2ZBIA 1H6KX 2CQDA 4P2SA 5EX0A 3KK2B 5A0YB 3AXMA 5CH7B 3NCPA 2XY6A 4C9DA 4EO8A 4USMA 4MTPA 1FFWB 1SPBP 5B7WA 5J1EA 4NLYA 2XYPB 2B9YA 3N28A 1TL7B 5C42B 2R7OA 2VC0A 2FVCA 3H0PA 1RLDA 1FA0A 2OPPB 3O44A 1VRUB 5KFFA 2IJNA 4B3TJ 2ALZA 1AUDA 2CUYA 1I94J 1S77D 2BE2A 2V69A 3QZ8A 3P5BP 2OTJS 3TAPA 4I7FB 2YPZA 3UDVA 5A8WA 3M8PA 4ECTA 3M9OB 5KFJA 1P9QC 4H4OA 3A1YG 4FF3A 2AW0A 3W64A 1CJVA 4IDKB 1N52B 4L6V3 3FRZA 5KFUA 3CJ8A 3I31A 1N48A 4K4TA 1FJGJ 5KFBA 3TAQA 3QLHB 1QVGR 3B78A 3PM9A 5KFYA 1SJQA 1MG7A 2CQ4A 2E1MC 3MM9A 4KRWA 3NGSA 1T05A 3T1YJ 1SB6A 2ZH2A 2IM3A 3L7OA 2V63A 2EWHA 4FKYA 2K7KA 1EZZB 1T11A 3RAQA 1HFEL 3UW1A 5D15A 1RT5B 4X66F 4ILMA 4A8OA 4ZJLA 3TZXA 4QU7A 2HRUA 1YRTA 4RNOA 4LQ9A 5CD4H 4NCGB 3BBBA 3FEYB 5HMYA 1Q78A 4PQAA 1PC5A 2VBZA 4OQJA 4ZIVA 2KKHA 2Z2MA 1LK5A 6FDRA 1JXVA 2BJ8A 2HFOA 2CRLA 1WKKA 4IG3A 3M9NB 1OJ4A 1JLCB 2KB2A 2K3IA 1G2EA 5LMUJ 4FXVA 1ZYQA 2GV1A 1G4CA 2YKPA 2HWTA 3GU0A 3PW2A 4QIFA 2BX6A 2DD8S 5KFMA 4C0HA 1MWZA 4DV2F 3DCAA 2J0WA 2A1BA 3TJ8A 3UO0A 3HLUA 1GH8A 5IFMA 2FVSA 2G0CA 2DNLA 4F0MA 2VFUA 1U49A 4QWBA 2YY3A 2OI2A 3LGHA 4OLOA 2ZH8A 3UWTA 2EFPA 3CO0P 4BWJA 2DRAA 5KFKA 4LBIA 4UY85 4OYXA 4ED0A 2UUCJ 2RD5C 1VQ4S 2GJ2A 4EBCA 3ZTRA 4B3OA 2QMUB 4X4TA 3AA9A 2IBKA 3B8HA 3JXOA 2GJIA 2ASYA 1XR6A 2WONA 2PEBA 4N7TA 4PUOA 1XIQA 1VQMS 2LEAA 1X4FA 1YBUA 3RBZA 1RWNB 2VZ9A 2KYXA 4JI8J 2GMJA 3AXKA 3JTPA 3GTYX 3GIMA 1JJCB 2J76E 2YX1A 2ZDPA 1MU2B 1AZSB 5IV4A 5C2GA 3W1YC 3H4BA 5AXMA 1CQNA 1NK8A 3P45B 2FC9A 7AT1B 3K89A 3W9HA 5J2PB 2RNEA 3FK4A 3LO3A 2QA1A 4H54A 2XMUA 4M95A 2YWKA 2V9KA 1NK9A 3L4BC 5DDOC 4I6AA 3D2WA 4IG0A 4LQ3A 1D09B 4J9OA 3E2EA 2KXHA 2Q6CA 4OYIA 4RWWA 3PR4A 3EICA 4CM2A 1S9GA 3A8IA 2RF2B 3MOJB 4HL9A 5KG7A 1FE4A 1S79A 1QUVA 4C8OA 5KG5A 1DTQB 1WF0A 1KLMB 3TA1A 2N4CA 2G2OA 1JLEB 1RT1A 3BGRA 4LMZA 3M2RB 1WOPA 4N8NA 3NNCA 1FXDA 3D0IE 2B4PA 2VPZB 1RYSA 5H9EJ 3HT0A 1N33F 3EXYA 1RA6A 4Z2XA 4LREA 1U02A 1RHUB 5HJYA 4MIAA 4DV3F 1MW7A 4O44A 1F6TA 4P9SA 4FN5A 2DIVA 2UXCF 2PD1A 1U1PA 4DL3A 1YHQS 1RA7A 1EX8A 2NPIA 2XYHB 2MQ8A 1U1NA 2QTWA 5K9FA 3M8RA 1REGX 3DLKB 3T5KA 2R42A 1NHKL 4PG5A 1NSAA 5JVHQ 4O3RA 4NMXA 4USJC 3DGPA 4NLSA 4UOCA 2CPDA 4MFBB 3CD7A 1IUJA 2F1FA 2IMWP 1SUQB 3K59A 3OTEA 3IS9B 2FZCB 5E5NA 1N8RT 2IC3A 1FDDA 1T3NA 1HHTP 1UFKA 4L72B 3BB5A 3SV3A 1OQ6A 5ETKA 4ZVGA 5D4PA 5K8NA 1RAHB 3QJLA 1LV5A 1X4BA 2X1BA 3KJVB 2KH9A 2CWKA 3VHQA 1UTAA 1Y3KA 1RQ0A 3BGFA 3CCLS 1KTQA 2MY7A 4NZ7A 5M2PA 3OR1A 2F4VJ 3KK3B 2I5JB 2JDJA 2DGXA 2OPSB 2AEFA 2Y9HA 2R4FA 1IWGA 3BQ1A 5B0CA 1F0XA 5EGYA 2BOAA 4X65F 3NMRA 4W98A 1C1CB 3PW0A 4DG1A 2QL5B 4LBHA 1R3NA 1WSVA 1OSDA 2WVFA 2W2OP 5DQGA 2Y1LB 3M2UA 3CC2S 2AX1A 3MEDA 4OI3A 1J5OA 3CJKB 4EO6A 4N5SA 3MUVP 1TV6B 1QSSA 2KTQA 4AXIA 3ZZ0A 2HFUA 4ZJOA 3SQOP 3MR3A 1WC1A 1YZ7A 2YWHA 4QYRA 2EG2A 1QLNA 2H54B 4LSLA 2LQBA 3O2IA 2VHGA 1UKUA 4JP8A 1LOUA 1FF2A 2MY8A 4JYAF 1C0UB 5B08A 4F4XA 3CD0A 1JLFA 3WX8A 5KFAA 1S0MA 2OPQB 2VQEF 3MCSA 1HBMB 3NNAA 3MM8A 3T5HA 4KPCA 3M8QA 1YRUA 4AL7A 4RBTA 4K4VA 2FB0A 1RU2A 4IQMA 3QPIA 3G2XA 3MMCB 1XTZA 4MKYA 3CCRS 3TZWA 5KFRA 3SMZA 1TKZB 1RWKB 2GJFA 1M5VC 1RK8A 1RE1B 4OLPA 1O8BA 2BJ9A 1NJZA 1RT2B 1DTTA 2JX2A 4NOHA 2PMZD 3IWNC 3LP1B 4Q8FA 3TNVA 1MLAA 1OY6A 1HQUB 4MK8A 4YHHF 1HHSA 3DDIA 3H40A 3I5AA 2FJEB 2XZWA 4ZVQB 2A6MA 1SKSA 4NX9A 2RRNA 2DJWA 3H8YA 3HPOA 1LWFB 4Y3CA 1MMNA 3BKTA 3BYPA 3OXFA 1F2GA 2W9BB 4EZ6A 4ID5B 1WC6A 1PGZA 1YGYA 5D4OA 3VAHA 1FT8A 2W4CA 4KTQA 2CPFA 2E66A 3IXQA 3FSXA 5LXYA 4A8KA 3ADAC 4BC7A 4C98A 3NWGA 4DUZF 3CNQP 4CO5A 3W2VB 3ETMA 1EAYC 2QMWA 3QQCD 3KKFA 4PG8A 2BW7A 3PHTA 2VG6B 2H5IB 3PYDA 4J9UE 1W2BR 3IO1A 2XQCA 1VS3A 1RT3A 1DQAA 1X4DA 3RB0A 2OAUA 2K8GA 5HQLA 3HHKA 4CLKA 1IQTA 3U27A 3WHIA 3WIUA 3Q23A 1FJEB 1T03B 1KFSA 5EWGA 3KG0A 1SKWA 5DDPC 1NBEB 2PMWA 4CLFA 3CSKA 3D67A 1NEEA 3UNYA 3C66A 4Y34A 5ETOA 4K4SA 3S01A 2HK2A 4EYHB 2H5EA 3PO5A 1JLAB 4BHQA 1RJJA 2GMHA 2C28A 2VOPA 2YWWA 1N5YB 1T9UA 3HVWA 5IS2A 1RYRA 3UFCX 4R5PA 2ZZMA 3RW7A 3CMAS 1DFDA 2VOOA 5HROB 4DV4F 2YQ3A 2JLFA 2IRUA 3C6UB 3IC1A 5ETVA 4J9LA 2HNDB 4CLYA 2IM2A 1UPMB 4I6YA 2ADCA 3ENVA 5KT7A 2FZKB 4CTAA 2MKIA 3ISND 2B5JB 1F5BA 4EWTA 4LF5J 2ZBQA 2MKSA 2V2QA 1RT7A 2H48B 3KYLA 4RO0A 2FJWA 1YWXA 3GIIA 2ACYA 3ZZUA 3EPIA 3R7NB 1KN6A 5DG9A 1D3WA 1WORA 3SSRA 4CNZA 1JWWA 4A8MP 4QIGA 3BO3A 3HDSA 3BH6B 3R9LA 3F41A 2W8LA 5FDLB 4NLQA 1VC5A 2GO9A 2XZDB 2XO7A 5GAHU 2QJ3A 4C2MA 2V9WA 4OYZA 2O67A 2EC2A 5U47A 2IY5B 2CPHA 2FJBB 4DPXA 1RAEB 4G1QB 1X60A 2QYCA 2CPXA 5HN0A 4C8KA 1J27A 2FYXA 1S0VA 2NR0A 4F04B 3CC7S 1DBDA 1Y5LB 3G8SA 2GFFA 2JLGA 5F0WA 2R2RA 3CJRA 2LU1A 3MCOA 3IFEA 1U09A 1HBNA 3AFGA 3CEDA 2DGVA 2PC6A 2VBWA 1DJ0A 4UQTA 1NMEB 5KFVA 3OQ2A 1R6VA 5ETNA 4MIBA 2E5GA 3I0SB 1U1MA 1TZ0A 1F3FA 5GVQA 4DSJA 3H2LA 1IKXA 1YG0A 2LMIA 2CWXA 3LALA 2WVDA 2D3UA 3OVSA 4PWUA 2DPIA 5K5MA 2VODA 3CCTA 3RRGA 3JSBA 2CDQA 5AT1B 1H72C 4KH0B 2UUBJ 4DFMA 3W9JA 4LR8A 1V6HA 4LF4J 1FRJA 4ZVSB 3CDEA 4OZ3A 2GAHC 5KG1A 4PPZA 5LSRA 2L41A 1E6YB 2J0SD 4JI7F 1HQEA 2UV8A 4FF2A 1PO6A 3ZC4A 1EQMA 1S6PB 4KGVB 2XLKA 1U0SA 4Q5VA 2ZH1A 2M3DA 2NSCA 4HHJA 1T9WA 4WP9A 1D0EA 3SQGB 4M63A 3FMBA 4OHXA 2DY1A 5B0AA 1K44A 2EFNA 3DOLB 4DV7J 1MWYA 5A8KA 2XGPA 3RR7A 1T7PA 2QT7A 1NH7A 5B09A 2JEIA 4KV8A 1IKYB 1EP4A 4B9NA 1X31C 4O4GB 2PA3A 1U6FA 2HFZA 2RS8A 1VBKA 3PRBA 4NASA 1VK3A 2RDJA 2D1CA 1XMBA 1HLWA 3CVKA 5I42B 3HM9A 1SV5B 1H7XA 4NLWA 5C5JA 3QFHA 3TI0A 2DXDA 5D77A 3NLCA 4DV1J 1SKUB 2RUGA 4USKA 3PYEA 2Y0SD 4JI6J 4BC9A 2E5LF 3UR0A 1RAFB 1K1QA 1RDRA 1FK9A 3IRWP 1D9AA 3N6LA 1RTDA 2I9SA 5AJ3F 2EFVA 3WIVA 1GXTA 3A4TA 4KT0C 4QWDA 1N5QA 3AOBA 4N47A 1VQ7S 3ICLA 1JKHA 1HI8A 5HVHA 4OHYA 4HI2A 2GNKA 2W9CA 1GNKA 4A48A 1E6VB 3PV8A 1N36F 2F9DA 4CO3A 4K0KJ 2E9TA 4KGMA 1U1RA 1KQFB 1VLYA 2BKOA 3EMTA 4HLBA 4USIA 3FMWA 3D4JA 4WFAQ 2NUHA 1FKAF 4DQPA 3J81Y 2VG5A 2HHHF 2D7SA 3BF4A 1U4BA 1SJ3P 2DBBA 3HHNB 3ZZOA 2JL9A 3B82A 1TKXB 2X7IA 2ZDOA 3ZZRA 1FKPA 2WOMB 2PDAA 2R3VA 3QSYB 1G6BA 1NO8A 2E7XA 2V68A 3CJTA 2Q1LA 4RJVA 3NWRA 4RU2A 1YITS 1Q7LB 2LXIA 3J7Z5 1UVLA 3UVJB 2Q3PA 3D1HA 3BJYA 4ZLNA 2DB1A 1ZM2A 1SQGA 2ZKUA 4DL6A 4ZVPB 1S10A 1X5TA 1UJ6A 4L3KA 1BWVA 4P52A 1RACB 3CGIA 1ZTTA 4JI2F 2P9CA 3KLHB 1HNXJ 1H98A 1NKBA 3FVYA 4N8OA 3EYZA 1VFJA 4FNIA 1HPZA 1LFPA 2FJVA 4J91A 2HQCA 2VFVA 2QFIA 1Y10A 3PW4A 4NRUA 4DR4J 3DMJB 2VFTA 3HJVA 4DJBA 1UETA 5KFZA 1TKTA 5HQMA 2OP5A 4TU7A 2FVPA 1S1UA 3SFUA 1KQGB 2IM0A 2R8JA 5C25B 1UMJA 3DYAA 5BXIA 4A47A 4C11B 1UVIA 1HWIA 4O0IA 3PKYA 4Q0BB 4ED5A 3NOCA 3TEGA 1H38A 3J7ZT 5CHCB 4DX7A 4U95A 3D3CJ 1KD1T 4PR6A 2V0NA 1FRKA 2ZVSA 4LVNP 1XC9A 3NGDA 3AHPA 4N56A 3VAJA 3QGPA 5DRKA 3IGVA 4P75A 2AZ3A 2E1CA 3MAQA 3EPGA 3OJSA 2BRKA 2YNHA 1F9HA 1BQMA 2HS3A 4RW9A 4ECRA 1HNWJ 2LEPA 2K1RB 1KONA 3JYTB 3FSYA 2DNMA 3KK1A 3OL8A 2GMLA 3R5JB 3SDEA 3FRYA 5L8RC 4ZA1A 3T5JA 4XK8C 1A6LA 1NCLA 4DPWA 4Y65A 3EVWA 2ZM6F 4U7CA 1JMTA 4UQGA 2J6SA 5K14B 1PKUA 2LQ8A 1HBOB 2G2ZA 2RAQA 4ECUA 1S1XB 4Q7AA 1WEZA 2RKIA 3OXGA 2YTCA 3E01B 4OZLA 4DSFA 3EDQB 4RWXA 4LFCJ 1NZ8A 3GV5B 3OUYB 3OFGA 2EKNA 5GAHI 1FNXH 4C0BA 3BSNA 5IT9Y 2HVIA 1CULA 4ZHRA 3DLHA 3PRVA 4UZBA 3MMAB 3R97A 1R89A 3EUNA 4DUTA 1SH2A 1IJEB 1RCXB 5B0GA 1TVRA 1S1VA 2AIRB 1FJCA 4ECQA 5H9EK 2N82B 2VG7A 5E3QA 3DRSB 2XSFA 3GQCA 5G0RB 5EWFA 5KG4A 2FQQB 2W2PP 2ZKTA 1R8PA 4DL2A 2XY5A 4IOBA 4M5DB 2I0XA 2DO0A 1RT4B 4ZCMA 2DYAA 3R5CA 3M7VA 2X3GA 2V2ZA 3QO9A 3K5PA 2KG1A 1LEOA 2BQUA 2A0FB 4X65J 2QE5A 4OYPA 3VAMA 1WG4A 2COLA 3DRRB 4ED3A 4B3SJ 3IR7B 1K1SA 3IRXB 4QPXA 1JLGA 4JI3F 3MR5A 2K06A 5HVFA 1BQNA 4IFVA 3HHDA 3H42A 2A3JA 1UJ5A 3L3CA 4I4BA 1FKOB 2GVDB 2KT5A 3AQOA 1P1TA 1UWBA 2Y1IA 3UD5A 3CDWA 3PIOQ 4OHZA 2J9EA 2YNIB 4CM0A 1V9OA 3HSJA 4USUA 3MD1A 1T3OA 4GVBB 3QIPB 5E3PA 4C0OC 3MZIA 2J9DE 3LUYA 4X4RA 4E98A 4HTIA 5J1NA 4FYWB 1UP1A 2HS4A 2R2TA 2NZ4A 1S1TB 3AD8C 4DV0J 4ED2A 4WFYA 4B9SA 1BD6A 1TR0A 3MEEA 4K50A 4WTOB 2Z58B 2ILYA 2BDPA 2F5GA 5DLFA 3NGTA 3KLEA 4TN2A 1FHTA 2DTJA 1GT8A 1SH3A 2YKMB 1T95A 4AFFA 1Y0HA 2R2SA 5I3PA 2HBQB 2AYGA 4X4UA 1RCOB 3H59A 3PKMA 3HFKA 5KFIA 3IWXA 1FI4A 3OL7A 2ZD1A 5HMZA 2HNYB 3M1VA 1UW9A 3W5ZA 1NK6A 1KFDA 3UN2A 1N54B 2KT2A 1PJ6A 3PJWA 1JLBB 4OI0A 3ZXWA 2A10A 1EARA 4ECVA 3FZ2A 4JV5F 2DPJA 3VVUA 2UU9F 4U9RA 4F0KA 3QNWB 1HARA 5I4MA 1RTJA 3DLEB 4XAKA 3I32A 4I2PB 4ITSA 1WDTA 1TK0A 1ZZNA 2DCUB 2J0QD 1ACMB 4LFAF 4TVAB 4ED7A 3EZ5A 3J81U 2J0XA 4KYZA 4ZP8A 1FVSA
chains in the Genus database with same CATH topology
3ET6A 1CJTA 1CJUA 4USTA 1WC4A 4CLYA 1CJVA 5D0RA 3MR7A 4OYBA 2GVDB 2GVZB 4WP8A 3C16A 1AB8A 2BW7A 3G82B 1CS4A 1CULA 2W01A 4WP9A 1AZSA 1U0HA 1WC0A 5D0EA 4OZ2A 3C14B 4OYMA 4CM0A 3C15A 1CJKA 4CLKA 4OYXA 4USUA 3MAAB 5IV3A 1Y11A 3UVJB 4OYIA 4NI2B 4P2XA 4WPAA 4WP3A 2GVDA 5D15A 4CLSA 2GVZA 4CM2A 4USVA 4CLFA 3G82A 5D0HA 4CLTA 4OYWA 3R5GA 4CLPA 1TL7B 3C14A 3MAAA 3ET6B 2QV6A 1CJTB 4OYAA 1WC1A 1YBUA 3UVJA 1CJUB 2WZ1A 4OYOA 1Y10A 1CJVB 1WC5A 4NI2A 1WC3A 4OYPA 4OZ3A 1YK9A 3C16B 4P2MA 1CS4B 1FX4A 1WC6A 1CULB 4OYZA 1AZSB 1FX2A 4P2FA 5D0GA 1U0HB 5IV4A 4CLLA 4CLZA 4USWA 1TL7A 3C15B 1CJKB 4CLWA 4CLUA 1YBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ET6 A;  1CJT A;  1CJU A;  4UST A;  1WC4 A;  4CLY A;  1CJV A;  5D0R A;  3MR7 A;  4OYB A;  2GVD B;  2GVZ B;  4WP8 A;  3C16 A;  1AB8 A;  2BW7 A;  3G82 B;  1CS4 A;  1CUL A;  2W01 A;  4WP9 A;  1AZS A;  1U0H A;  1WC0 A;  5D0E A;  4OZ2 A;  3C14 B;  4OYM A;  4CM0 A;  3C15 A;  1CJK A;  4CLK A;  4OYX A;  4USU A;  3MAA B;  5IV3 A;  1Y11 A;  3UVJ B;  4OYI A;  4NI2 B;  4P2X A;  4WPA A;  4WP3 A;  2GVD A;  5D15 A;  4CLS A;  2GVZ A;  4CM2 A;  4USV A;  4CLF A;  3G82 A;  5D0H A;  4CLT A;  4OYW A;  3R5G A;  4CLP A;  1TL7 B;  3C14 A;  3MAA A;  3ET6 B;  2QV6 A;  1CJT B;  4OYA A;  1WC1 A;  1YBU A;  3UVJ A;  1CJU B;  2WZ1 A;  4OYO A;  1Y10 A;  1CJV B;  1WC5 A;  4NI2 A;  1WC3 A;  4OYP A;  4OZ3 A;  1YK9 A;  3C16 B;  4P2M A;  1CS4 B;  1FX4 A;  1WC6 A;  1CUL B;  4OYZ A;  1AZS B;  1FX2 A;  4P2F A;  5D0G A;  1U0H B;  5IV4 A;  4CLL A;  4CLZ A;  4USW A;  1TL7 A;  3C15 B;  1CJK B;  4CLW A;  4CLU A;  1YBT A; 
#chains in the Genus database with same CATH topology
 2MMY A;  2V8H A;  5A2Q Y;  3CUL A;  3LP2 B;  5L39 A;  4I56 A;  2JVR A;  2YX7 A;  4WK1 A;  4QWE A;  4F4Z A;  1DRZ A;  2ZVI A;  4QZV B;  4DQS A;  3PY8 A;  2C3Y A;  2BJD A;  1T9T A;  2DXF A;  2H4Y B;  2XY7 A;  4YB6 A;  5D4N A;  3DOK B;  4W90 B;  3CCV S;  1VBY A;  1FD8 A;  1B0T A;  4O3N A;  1FE0 A;  3NGR A;  3FCV A;  3BV8 A;  3US5 A;  3DOM A;  1WF1 A;  1IJF B;  1IXK A;  3GJS B;  1LNQ A;  3EVO A;  3Q24 A;  3HD2 A;  1R0C B;  2AX0 A;  4DV4 J;  1Z2Z A;  3EX7 B;  4K4U A;  2D9P A;  3PVX A;  3TWZ A;  1CJT B;  1OO0 B;  1TTH B;  3ULH A;  2H51 B;  4LR9 A;  5GAE U;  1WHV A;  2V50 A;  5IM0 A;  4B3T F;  3MHY A;  1KDN A;  5E3R A;  5GAG U;  1BQX A;  4Y0F A;  3T19 A;  1U0H B;  4RNH A;  5D8H B;  1N6Q A;  3UD3 P;  1I6J A;  5AXL A;  4FYV B;  4DLG A;  4NLR A;  1TL1 B;  3H2V E;  1RB0 A;  2HWH A;  4FF4 A;  2DR6 A;  4QYZ J;  3HVR A;  2FD2 A;  3H90 A;  1NSP A;  2ZZT A;  4TY9 A;  5HMX A;  2WBR A;  1S7H A;  1Q86 T;  5CXT A;  3EJM A;  2EI5 A;  2BRL A;  1I3O B;  4FYD A;  4KQZ A;  2B7B B;  2R2U A;  2VIH A;  3N5F A;  1NH8 A;  4QOT A;  4JI1 F;  3T1Y F;  1XEZ A;  4DSE A;  3KMS A;  2R8H A;  1UWA A;  3K17 A;  2HG4 A;  2UP1 A;  3QT6 A;  3LF0 A;  3PYF A;  3I55 S;  3CXC R;  2W4P A;  3CJ2 A;  2UVU A;  5J2Q A;  3HKW A;  5F3T A;  3FBC A;  1WJ9 A;  5DLG A;  3Q89 A;  3D0G E;  5LMU F;  2LA4 A;  2M8H A;  1SVD A;  4ZVR B;  1DHM A;  1NK4 A;  4DX6 A;  5LJ3 Y;  3AOA A;  2F65 A;  1X9S A;  1WTB A;  2L48 A;  3CCJ S;  3M2V A;  5KTQ A;  1HMV A;  3HI9 A;  4UW2 A;  5IT9 U;  3FKB A;  2A6O A;  4PWD A;  3FCH A;  4XPC A;  2OKQ A;  2BE7 D;  2CDR B;  1FTC A;  2M4M A;  4GKJ J;  3C14 B;  1N0U A;  2OH2 A;  1KR4 A;  3OXL A;  1V5V A;  4WIQ A;  2ACM A;  2EBE A;  3PW5 A;  2UUC F;  4L76 A;  2QC3 A;  2Y3Y A;  4RW7 A;  2JH3 A;  1NND A;  4HHH A;  4JI7 J;  4ANC A;  4R0E A;  2XLJ A;  2J6U A;  1LWE A;  2HWI A;  5KFC A;  4ES2 A;  2QRR A;  3ET6 B;  2UVV A;  5KOW A;  4IYQ A;  5H1S V;  4DWI A;  4R0J A;  4FVM A;  1GMW A;  4IRD A;  1NAQ A;  1HI0 P;  3M30 B;  1LW2 A;  2Y0B B;  2KRR A;  5F8G A;  1WOS A;  1U1O A;  3C15 B;  2HUR A;  4JB8 B;  1LQ9 A;  4URQ U;  4RW8 B;  4PQU B;  2BE9 B;  1QSY A;  5B0E A;  2BA9 A;  1M5S A;  4KAI A;  3I9Z A;  1Q4R A;  2ZUG A;  1VLO A;  2D3O 1;  5ETR A;  2NYI A;  4ZPD A;  3VZI A;  1YX2 A;  5HLF A;  2DXE A;  4W92 B;  1J2V A;  4LIW A;  4HT7 A;  1M5O C;  3MR2 A;  3QAT A;  1HD1 A;  4NLT A;  4TQR A;  4WBF A;  2DHS A;  4WFX A;  3CJ3 A;  1Q5Y A;  4MK7 A;  3KOA A;  4ZMM A;  4ERD A;  2YH1 A;  5IZH A;  3PZP A;  1HI1 A;  1SIZ A;  4ELU A;  3AAW B;  1CSJ A;  2C3O A;  2G1D A;  3EWG A;  5F9L A;  4QCL A;  3E51 A;  2XHC A;  1GFW B;  1P27 B;  2YBV A;  5E2Q A;  4NLG A;  3OTC A;  3R8Y A;  3IP0 A;  1U2R A;  2PMH A;  1X9W A;  4J7C A;  4A8X A;  2QEX S;  2E5L J;  1A7G E;  2VA2 A;  3O8W A;  4J9P A;  3L7U A;  4OZ0 A;  1YLX A;  3NAH A;  2PN6 A;  3AJ2 A;  5AXN A;  5IWA F;  3BH7 B;  3BO4 A;  4IUF A;  1BE4 A;  2LFV A;  4DDF A;  2LQ5 A;  4J9V A;  4TKT A;  2CAD A;  3AA8 A;  1QTN B;  3V2U C;  4G65 A;  2O66 A;  2KFZ A;  1N36 J;  2IA0 A;  1RHQ B;  3Q8P B;  1ELO A;  3NGK A;  3J80 Y;  1Y11 A;  5CYM B;  2XS5 A;  5EDW A;  1NSK L;  4HI1 A;  1QSL A;  3DLG B;  4YS2 A;  3MPU B;  2ZH4 A;  4PYA A;  2FPH X;  4H4M A;  4KGZ B;  2IVM A;  4HDG A;  2HHH J;  5D3G A;  4KFB B;  3N9U C;  1NHU A;  2ZH5 A;  3UCZ P;  4DX8 H;  1BY9 A;  3IAS 9;  3LWM A;  1RSC A;  4BWM A;  3G9C A;  2O3D A;  3MMJ A;  4ZJQ A;  3TAR A;  1TQL A;  4CO2 A;  2HVH A;  5KG3 A;  1JLQ A;  1HA1 A;  1Q8B A;  1XN9 A;  2UZA A;  1LWX A;  1NM2 A;  1PAU B;  5A2Q U;  1A0O B;  4CZC A;  2K3K A;  4J9K A;  2EVZ A;  4C4W A;  4YB5 A;  2MJU A;  4F4A A;  4JI4 J;  3MEG B;  4ZLJ A;  2F4V F;  3SFG A;  3SCJ E;  4TU9 A;  2AEM A;  2VIC A;  3OLB A;  3DRP B;  3ILI A;  2ASD A;  8RUC A;  1L3K A;  4JI2 J;  2CPE A;  2HLT A;  3TAM A;  5LSL A;  3IAM 9;  1S6Q B;  5FDL A;  2FVR A;  5IV3 A;  1RHR B;  3W2W A;  3SXL A;  4C48 A;  3KLG A;  1T02 A;  1RHM B;  2YNF B;  5CCL A;  2FHJ D;  3PX6 A;  1RKJ A;  3JTO A;  5F41 A;  2FC8 A;  5HAO A;  1TP7 A;  2E9R X;  2F4F A;  3DHX A;  3ZTO A;  3UN5 A;  5MLC V;  3A3O B;  2XI3 A;  3FFI A;  2HEK A;  4EFA C;  2CPZ A;  3PJ9 A;  3DRY A;  1OPI A;  2AT1 B;  3R5A A;  3S7R A;  3WBZ A;  1WC5 A;  4JI0 J;  4NXN J;  4NA2 A;  2VBY A;  1XMO J;  2B9E A;  4HH0 A;  2G1H A;  2FHM A;  1RAB B;  2JEF A;  2N7Y A;  4L74 A;  4G6V B;  1YJ7 A;  3AQP A;  1I5O B;  2WBM A;  2M52 A;  2MZR A;  2NRE A;  1V5I B;  2YKN B;  4BLG A;  2QL7 B;  3VQS A;  1CLF A;  1FRH A;  3H5U A;  1MNE A;  3GYX B;  4LF7 F;  2E1R A;  2NQP A;  3GYN A;  5GAG I;  4ILL A;  2APO A;  3ZTQ A;  2MEW A;  3GSI A;  4ZCL A;  2QLX A;  4ZP6 A;  2EBG A;  1VRQ C;  2LDI A;  1W25 A;  2P2C B;  2IM1 A;  3KNG A;  4FF1 A;  2AP6 A;  4K5S A;  5LM7 E;  3SYZ A;  4MIW A;  3HCX A;  3KJN B;  5A6W A;  4WPA A;  4LSN A;  2X51 A;  2VQF J;  1CBK A;  4KPY A;  2L08 A;  1ZTW A;  2DHG A;  3EGW B;  2Z2Z A;  3SEO A;  2Q43 A;  3MM6 A;  3RUB L;  1VDH A;  2RQM A;  4PXB A;  1D9F A;  1VRT B;  2AJ0 A;  2CG8 A;  2QX0 A;  1BGX T;  1SH0 A;  5HL7 Q;  1MRO A;  1DLO A;  5ETQ A;  2B6A B;  2XTJ P;  1FWK A;  2FGO A;  3GR1 A;  3BS9 A;  2HGL A;  2JC0 A;  3PFO A;  3UDL A;  4ZN3 A;  1FVQ A;  1RUS A;  3CWJ A;  4BCA A;  3K5L A;  1REV A;  1EJ7 L;  1AFI A;  2J7K A;  3CC4 S;  5CYQ B;  3NGU A;  5JVG Q;  4S0M A;  2ZNZ A;  3R5B A;  1WEL A;  1X5S A;  4Q43 A;  5J1E B;  1M1K T;  2ZBC A;  4NEY A;  4ZPC A;  3Q0A A;  4G3I A;  2DR9 A;  4EU0 A;  2N3O A;  1WHY A;  4V1A k;  2XUL A;  1HBU A;  1ZS6 A;  3RZA A;  4KKO A;  3HUL A;  1SC1 B;  2BE2 B;  3GFH A;  1F1B B;  2BQ3 A;  2XO6 A;  4JI3 J;  2FLN A;  2E5H A;  3KLI A;  3MPY A;  2WVE A;  1QTM A;  1VBZ A;  5A8W B;  4OI1 A;  3M8P B;  1PYS B;  1NSQ A;  4H4O B;  2BV3 A;  5D6G A;  6AT1 B;  2RIJ A;  1CJV B;  3DLJ A;  2GO8 A;  4X4S A;  4NYO A;  4Y2C A;  2NXJ A;  4ETZ A;  4AQY F;  2JRS A;  3I6P A;  3I4H X;  3MM9 B;  1NK5 A;  1RWO B;  3OJU A;  3TEH B;  1T05 B;  2PI5 A;  2YQ0 A;  3IR6 B;  2N4D A;  5FLX Y;  1CJU A;  4YDD B;  4C6A A;  3QGH A;  3PXG a;  2V34 A;  3FZB A;  2CJA A;  1LWC A;  2XNR A;  3BGO P;  2XSJ A;  4IFY A;  2HBR B;  3VTI A;  2MTL A;  3Q86 A;  2AMC B;  5KG6 A;  1SQE A;  4Z7C A;  4I6W A;  2KU7 A;  1QE1 A;  1NDK A;  1U1K A;  2VBX A;  1P8G A;  3ZZP A;  3FQL A;  4IG3 B;  3BN7 A;  3QT7 A;  2C2O B;  1S48 A;  1N34 F;  5DDR C;  1MMD A;  2KJV A;  2MGZ A;  2DGO A;  3M05 A;  3F56 A;  1VJW A;  2BJ7 A;  3KLF A;  4MKB A;  3RBE A;  2WZ1 A;  3GWC A;  1O0P A;  2CFX A;  2PFF B;  1WC3 A;  4EEY A;  1XR5 A;  1B4S A;  3RU0 A;  1HD0 A;  2E9Z A;  3V6K A;  2HHS A;  1WD6 A;  3QYY A;  3F73 A;  3OR2 A;  1NDP A;  3CJ5 A;  2MST A;  3W9I A;  3P4U B;  3CO9 A;  4O3Q A;  4V19 J;  3BPD A;  4B3O B;  1XMQ F;  4XIU A;  3JQK A;  4G1P A;  4GC7 A;  1CC7 A;  4M5I A;  3C16 A;  1AB8 A;  2WON B;  3SZ2 A;  4PUO B;  1TAQ A;  4Q2M A;  2UU9 J;  2DNP A;  4LF2 A;  3B4M A;  4QIE A;  1PBU A;  2JOQ A;  3J80 U;  4MJK A;  3RB4 A;  1O6X A;  2Z2L A;  3M9M B;  1FNM A;  3D1Q A;  4XDD A;  4DCO B;  1SC4 B;  4LFA J;  4DI6 A;  2CQH A;  2AYB A;  1SJR A;  3VV2 B;  3LH2 S;  4C8Z A;  3FUY A;  3S8S A;  3AOC A;  5CA5 A;  5BJR A;  5E7O B;  1SJ1 A;  1UVK A;  3ENA A;  2VPX B;  3VZH A;  1RBL A;  4YY3 F;  1YK9 A;  3ZZZ A;  2UUB F;  3Q22 A;  4B9L A;  4LVO P;  4LF4 F;  1KVK A;  3BBF A;  4MK9 A;  5E0O A;  4FVC A;  1YJT A;  4IG0 B;  4WWS A;  1EKS A;  2ZFH A;  1LW0 A;  2HAI A;  4YFU A;  2MYF A;  1RWU A;  5KFG A;  2RE1 A;  4CT8 A;  2W7A A;  4DU7 A;  1S9G B;  4CH7 A;  2BOP A;  1UFW A;  5J1P A;  4J9N A;  2AYM A;  4P74 A;  3U1L A;  2VDI A;  4GC6 A;  4TY8 A;  3MAH A;  2CJQ A;  3I0R A;  2D41 A;  3LPY A;  2VJU A;  1K47 A;  3MGJ A;  1UL3 A;  4DV7 F;  1RT1 B;  5MAO A;  3BGR B;  2IRX A;  3G82 A;  4KJI A;  2VDH A;  2L3M A;  5L9X A;  3GJT B;  4DR1 J;  3R7B B;  3N01 A;  4M5G A;  3MMB A;  3U7J A;  4DPT A;  1RWM B;  4PG4 A;  2JLE A;  3K0J A;  1YVF A;  2BXJ A;  3WZ0 A;  1TUW A;  5J2M A;  1O51 A;  4ZS6 A;  2W1B A;  4O44 B;  4RBV A;  4LF6 J;  4WZM A;  4LRD A;  3MEC A;  3MR6 A;  2OTL S;  4JI1 J;  1UEK A;  3MXH P;  4KC5 A;  1YTY A;  1UZD A;  5F8L A;  4OX8 A;  3I4P A;  2RS2 A;  4HKQ A;  4OX7 A;  3JAM Y;  2PII A;  2DIU A;  2ZOF A;  1VI7 A;  5L1I A;  1HNV A;  1PBA A;  1S9F A;  1TK5 A;  2ZBP A;  3W60 A;  3DGP B;  2E44 A;  2W01 A;  1K0T A;  1GXU A;  4DV1 F;  2J9D A;  1OY9 A;  2DNG A;  1X4H A;  2MZJ A;  4EK2 A;  1A9N B;  4OZJ A;  3NBP A;  4JI6 F;  4I67 A;  2IC3 B;  1K73 T;  2EC0 A;  3V6D A;  1U6Z A;  3EZU A;  5E41 A;  3Q8Q B;  1WI6 A;  1AXQ A;  1JIH A;  3NY0 A;  3DU5 A;  2HLU A;  1IM6 A;  1QAI A;  1APS A;  2V4J A;  3OR1 B;  2M7S A;  1UPP A;  2OD4 A;  1QM9 A;  2B51 A;  1FTR A;  2NXU A;  3GJQ B;  2B3T B;  5KG2 A;  4C3M A;  1KTV A;  1UA0 A;  2NXN A;  1U26 A;  4GRS A;  4WZQ A;  4K0K F;  2LEC A;  3UNG C;  2LA6 A;  5B0F A;  4FKX A;  3TVK A;  4DG1 B;  2QGF B;  4EBD A;  4NA1 A;  2HHX A;  3R6G B;  2Z57 B;  3K57 A;  3BKU A;  5DM6 Q;  2J8S A;  3M2U B;  3MED B;  3CIM A;  3FGV A;  1J5O B;  1IBC B;  1XR7 A;  4XO0 A;  2DIT A;  2XMA A;  2JEG A;  4J9S A;  1WC0 A;  4WKY A;  5I3U A;  4FXD A;  1RXO B;  3T9Z A;  1QAX A;  1SJF A;  3JSY A;  5J2N A;  4KO0 A;  3MDF A;  3MOZ A;  3R5D A;  3HSG A;  3F0N A;  4P2X A;  2K2P A;  1X4G A;  3ITH A;  3CCW A;  4X2B A;  2BAN A;  3GYG A;  3RR8 A;  1VIS A;  1TUG B;  1JLF B;  4NYZ A;  1S72 S;  2MKJ A;  1VQP S;  3MAA A;  5C24 A;  4Q45 A;  1HNX F;  3A8E A;  4A8Y A;  3MM8 B;  1TUV A;  3CT9 A;  3M8Q B;  3OFH A;  2AQ4 A;  3FEZ A;  4UY8 T;  1SL1 A;  1YDL A;  3FBB A;  4DR4 F;  2KFY A;  4IO1 A;  3R27 A;  4M5L A;  2M2B A;  4CP5 A;  2OEM A;  2Y8W A;  4WJB A;  3CME S;  3R1H A;  5FLX U;  1Y00 A;  4C7Q A;  4ZIW A;  4YEA A;  2VKR A;  3R7S B;  2GGP A;  3UDE A;  1DTT B;  1C1B A;  1N5T A;  1VQ9 S;  4DF4 A;  1EET A;  2XLI A;  2QG9 B;  1T0T V;  2ADB A;  3D6M B;  3SCI E;  5IXU A;  1CJK A;  1JX4 A;  2VFR A;  4QU6 A;  5KFQ A;  2KL8 A;  3H4D A;  2MQP A;  5CCM A;  1WI8 A;  1N56 A;  2MZT A;  1S4F A;  4P10 A;  4PCQ A;  4LF9 J;  4WF9 Q;  1SI9 A;  3IMQ J;  1HNW F;  3NG8 A;  2DR8 A;  2OSQ A;  5IWA J;  2HQG A;  3LOU A;  2DHH A;  2QV6 A;  2ZZN A;  3C2P A;  2A18 A;  1SC6 A;  3PEJ A;  2I1R A;  2CQC A;  2WK4 A;  1H3D A;  1VQN S;  1Q1K A;  4ZCI A;  1FXR A;  5KFX A;  1RT3 B;  5DQH A;  1N4L A;  3BYR A;  4DZD A;  2Z56 B;  4IH6 A;  3TQE A;  4LRA A;  2WRM A;  3NS5 A;  2V2K A;  4B08 A;  4QQB A;  1SC3 B;  2YX4 A;  2ZH7 A;  4FXW A;  1KHV A;  4TYB A;  4WP8 A;  4ECS A;  5ADZ A;  1NDC A;  3OL9 A;  2HZC A;  3U1M A;  4LFC F;  1PJ5 A;  2W2M P;  5L38 A;  3LW5 C;  1WDD A;  4LFB J;  2FY8 A;  1VIX A;  4U7U K;  1RWX B;  1M1G A;  4WTY A;  3OL6 A;  1FRL A;  4ICL A;  1KNZ A;  4KGX B;  3W66 A;  4A8F A;  4R5P B;  4LR7 A;  2I38 A;  4IRC A;  3HJF A;  1R0B G;  5IC4 B;  1TL1 A;  2YVS A;  2IAJ A;  4I2Q A;  3OT9 A;  4QIV A;  1D9D A;  1UCN A;  1WOO A;  3CCE S;  2ERR A;  4P7T A;  3TUI C;  1IKV B;  3PNI A;  4Q44 A;  2MSS A;  1P9Y A;  2D9O A;  1S1W A;  3WX4 A;  4K4Y A;  3DI6 A;  4RBU A;  4CTA B;  3POT A;  3V4I A;  2DGW A;  3CCM S;  1CVJ A;  3W5Y A;  2DCL A;  1X8D A;  1DQ9 A;  1U48 A;  5DGB A;  1RBA A;  4J9M A;  2F8H A;  4FP9 A;  4B3S F;  4B9V A;  3M8Y A;  1RT7 B;  3G6Y A;  1ROF A;  1RAO A;  4PZV A;  3MF5 A;  2DEJ A;  2MZQ A;  3BM7 A;  1HYS A;  3IBC B;  3GIL A;  1VCT A;  5JJB A;  4MYU A;  4ZP9 A;  3MCN A;  1ZA1 B;  3PO4 A;  3BZQ A;  1HNI A;  1U47 A;  1R6Y A;  4NLV A;  2M70 A;  1OYE A;  1N88 A;  5DS7 A;  2HHQ A;  3G4S S;  2PEH A;  1Q79 A;  3W62 A;  1EKR A;  4OJG A;  4AL5 A;  3ILJ A;  1IVZ A;  3PW7 A;  3J7A N;  2VUG A;  3IM8 A;  2ZJQ Q;  3CUN A;  2QA2 A;  4CLP A;  4B3M J;  3QRQ A;  4DPO A;  2LQJ A;  4UOF A;  2M9K A;  2MHN A;  2R7R A;  1R0A A;  3OSN A;  4F50 A;  1M5H A;  1NU4 A;  4LF7 J;  4M5M A;  4ECW A;  4DV0 F;  2B4V A;  2VB6 A;  3V6J A;  4KB7 A;  2ZWP A;  2GZO A;  4E2F B;  2YNG A;  1HBN B;  2FLO A;  1YRX A;  3JAM U;  4GKK J;  4DN0 A;  2HFV A;  4R25 A;  1RLC L;  4FZV A;  1IKX B;  3FNN A;  1O5J A;  8AT1 B;  1F3V A;  4OIX A;  4J90 A;  2PO4 A;  3D68 A;  3THT A;  2XS2 A;  2QA4 S;  3BRE A;  2LLZ A;  5H9F J;  2E7W A;  1UAW A;  2W4D A;  3DFE A;  3Q2T C;  3Q8S B;  2ROE A;  2FHK A;  1NKE A;  1W2I A;  2HMI A;  2YH0 A;  5M2R A;  4F4Y A;  4NWB A;  2DHA A;  4PKD B;  4GO7 X;  5DO2 A;  1H0H B;  2BVZ A;  5HBM A;  3G6X A;  3CDA A;  3IM9 A;  2V8P A;  2NSB A;  2JFD A;  3V81 A;  3T41 A;  1HQE B;  1J5E J;  2E5I A;  1HNZ F;  4EUV A;  4JBC A;  3HMJ G;  2FVQ A;  5BYR A;  3FQK A;  2OMO A;  4RUC A;  2JHE A;  2HGM A;  3BSC A;  5JMN A;  2DNZ A;  2OGU A;  2KO1 A;  3TVY A;  2C3U A;  4PXC A;  2E29 A;  4LRB A;  4CLW A;  2I2Y A;  3NXZ A;  4X4V A;  3SCL E;  5A8R A;  2NYH A;  5A8K B;  2WSF C;  1IKW A;  1N0V C;  2SXL A;  1BMQ B;  2Q79 A;  2J8A A;  3I5C A;  4KV8 B;  5DZ7 A;  5DQI A;  1IQZ A;  1EP4 B;  2CVE A;  4DBQ A;  2CJY B;  5F8M A;  5GMK a;  3H98 A;  4AQY J;  5K8M A;  4U96 A;  3T5L A;  3OTD A;  1L5U A;  1KOO A;  2CAJ A;  3RJM B;  3GCX P;  5FD1 A;  5LT5 A;  3C8Y A;  2RQK A;  3NAI A;  3CB4 A;  3J7Y U;  2QA4 G;  4WFN Q;  2GX8 A;  3M8W A;  1VK8 A;  4DCJ B;  3OBI A;  1U8W A;  3IR5 B;  3TUZ C;  4MKA A;  2B56 A;  5B0B A;  1ZZF A;  2CJ9 A;  1FK9 B;  1Z2L A;  2RQ4 A;  3BSO A;  1UEV A;  1RT6 A;  1RTD B;  2ILZ A;  5BYS A;  3I9V 9;  3OTB A;  1N34 J;  2JVO A;  4TYA A;  5DGA A;  3O1L A;  4K4Z A;  4X4O A;  1JKH B;  3GV7 B;  2RH3 A;  4OI2 A;  2W9C B;  2XWX A;  1R8A A;  1BLU A;  3MTJ A;  2R8G A;  4EYI B;  3CTR A;  1TFY A;  3QBC A;  2VAS A;  2MQQ A;  4B9M A;  1WF2 A;  4KHR A;  4OV6 A;  1HL6 A;  2C2R A;  3G8T A;  4B9U A;  2FDN A;  4JV2 A;  2HQD A;  1MSW D;  2AF6 A;  2GVZ A;  2DNQ A;  4HH1 A;  4OJH A;  3MCM A;  3MM5 A;  1NJX A;  3ENW A;  3WDO A;  4ZK7 M;  2QL9 B;  3OHA A;  3CIZ A;  4X64 F;  2NS1 B;  1S7I A;  2VG5 B;  1VQ6 S;  3M6W A;  3HHL A;  1JNR B;  2IMO A;  3EZO A;  3EXC X;  2WB1 D;  5JUM A;  1XMQ J;  1FKP B;  2C1E B;  3GPA A;  3AD9 C;  3W3S A;  3QWU A;  5AXK A;  4ZIT A;  4UUW A;  2DNR A;  4L3N A;  2FJA B;  1RTI A;  2BR0 A;  4U8V A;  4HAC A;  3JTN A;  2ZE2 A;  5GAD U;  4BS2 A;  3KLV A;  2WCX A;  2DRD A;  1ITP A;  2L9D A;  1AFJ A;  3CPW R;  3SSS A;  5F8N A;  5IT0 A;  4O3O A;  2XHW A;  3VGS A;  3L95 X;  5IC6 B;  1HPZ B;  3WC2 A;  4WE1 A;  4GKJ F;  4ZOS A;  4OFZ A;  4YY3 J;  3LQV A;  1KQS R;  3M32 A;  2W8K A;  1TKT B;  1X4E A;  1Y5N B;  2GAG C;  2HBY B;  3DHW C;  2GW8 A;  1S1U B;  4NCA A;  2EXU A;  3CMQ A;  3KHL A;  3CD5 A;  2XM3 A;  3DYA B;  1H2U X;  4RR5 A;  4JV1 A;  1VC6 A;  1WSR A;  4NXM J;  1WEY A;  2GQQ A;  3A8J A;  3KXD A;  2CQG A;  4KHP F;  1EHW A;  4DL7 A;  4YR3 A;  5T7L A;  2P5V A;  2OHD A;  1MN7 A;  3IG1 A;  4RX6 A;  2OPR A;  2V67 A;  1H74 A;  4CLU A;  1UFL A;  4HR2 A;  2HVZ A;  2XZT B;  2VON A;  2AGP A;  1WC4 A;  1VQ5 S;  5D0R A;  2YNH B;  4O4R A;  1BQM B;  2BW2 A;  4RW9 B;  1N5S A;  4D3H A;  2QO3 A;  1Q81 T;  4B3R F;  1UVM A;  3TA2 A;  3TRG A;  3KK1 B;  4RKU C;  4ZPT R;  3T3F A;  3BEG B;  3MM7 A;  3CCS S;  5BR8 J;  5AE3 A;  3SDE B;  4IOC Q;  4UZC A;  5THW A;  3HKZ D;  2MHE A;  4CO4 A;  1XBW A;  3ETO A;  2DNN A;  4K4X A;  2BM1 A;  3ZFV A;  2MJN A;  4M5J A;  2FY1 A;  5HQ8 A;  1NPK A;  1YZ6 A;  2UUA F;  2BAC A;  3GG1 A;  2CPY A;  2GC8 A;  4MMO A;  4ES1 A;  1IR2 A;  2HIQ A;  1S0O A;  5HJX A;  3K2Y A;  4QIW D;  2R7W A;  2RKI B;  1KS2 A;  2M0G B;  1HQ2 A;  4LF8 J;  4K8R A;  3JSM A;  1JXE A;  4DXL A;  3IGN A;  4QR2 A;  1CUL B;  4FYY B;  5ETS A;  4ZHR B;  3THV A;  4OZ5 A;  2B9W A;  1YIJ S;  1VQY A;  3HSD A;  3O5T B;  1TVR B;  2RB7 A;  3KMQ A;  1S1V B;  4DN9 A;  2ZEJ A;  3VAF A;  3ZZY A;  4XTT A;  2VG7 B;  2OIH A;  3KUE A;  3MUT P;  3GB0 A;  3CCQ S;  2CA9 A;  4NE9 C;  2KM8 C;  2DGT A;  4IQX A;  3X3U A;  1YJR A;  1RTH A;  3CE8 A;  1JNZ B;  3OFE A;  1QD1 A;  3QO9 B;  2XG8 A;  2CZV C;  2XBP A;  1FRM A;  1C0T A;  1TL3 A;  3R2C J;  3D9B A;  4FYX B;  4U7U D;  4N77 A;  3R5G A;  1JLG B;  3HZG A;  1GEH A;  4LRC A;  2E7V A;  5IT4 A;  4PYD A;  1WTF A;  3MWB A;  5HAN A;  1BQN B;  4IFV B;  2RRA A;  1RAJ A;  3VAI A;  4CNY A;  1RU1 A;  1U1Q A;  1UWB B;  2BKP A;  2CIM A;  4I1T A;  4PAA A;  1B0P A;  4K5R A;  4F7V A;  1OSC A;  1HW8 A;  2C2M B;  2HNZ A;  2V8G A;  2KFN A;  1S9E A;  1MWQ A;  4K4W A;  2WVB A;  5KT2 A;  4IH5 A;  2BZ2 A;  3QGI A;  4OYB A;  4AE5 A;  1SKR A;  3ILO A;  1P1L A;  3SCK E;  4LT6 A;  4JI4 F;  2XMT A;  3CJS A;  2CNO B;  5FII A;  5T41 A;  4EGL A;  1HR0 F;  3TQ1 A;  7FDR A;  3NEK A;  3QJJ A;  2PA8 D;  5HP1 A;  4QR1 A;  1ZAW A;  5KFL A;  2AHO B;  1XNQ J;  2W7O A;  3SBM A;  2POK A;  1S76 D;  4C3K A;  2DHX A;  1GX5 A;  4RW4 A;  3DM2 A;  3BQ0 A;  3MEE B;  3HO1 A;  5CZX A;  1WKJ A;  2M5Y A;  3AJ1 A;  5KFE A;  4NLO A;  3KLE B;  1Y7P A;  4IR9 A;  4B17 A;  5LMN J;  4DQQ A;  4ELV A;  1FDN A;  2A2C A;  4Y2M A;  2KHC A;  4DV6 J;  3QT8 A;  2W2Q P;  1OY8 A;  3FC9 A;  3AB2 B;  4JI0 F;  4DPY A;  2D3Z A;  4NXN F;  2MLX A;  2BM0 A;  1Q95 G;  1XMO F;  3W63 A;  1NK0 A;  4W4M A;  3N6M A;  3HVT A;  2R7Q A;  2NCK L;  4K59 A;  2AJQ A;  3J7Y I;  2ZD1 B;  3A3P B;  4WXW A;  2MXY A;  4DR2 F;  3M1V B;  1U6B A;  1Q82 T;  4IRK A;  4YR2 A;  1CS4 A;  4O23 A;  2JC1 A;  3LP0 A;  2BUN A;  4ANE A;  3C6T A;  4DV5 J;  3OD2 A;  2CQI A;  9ATC B;  2MQM A;  4R8U A;  1RTJ B;  4CYU A;  2DGU A;  5L46 A;  1V3R A;  1HKA A;  2LQ9 A;  1GMV A;  2X1A A;  2VD3 A;  1FCA A;  1TL4 A;  2VQF F;  4RW6 A;  2XNQ A;  4HTJ A;  2KVQ E;  3VCD A;  3UR3 C;  3P8B B;  3MFI A;  4NI2 A;  5L1K A;  3NCR A;  5L9N A;  1HWK A;  3KK2 A;  4X4N A;  5A0Y A;  2QLF B;  2CJX B;  1GTE A;  5SZT A;  3MTK A;  4CLL A;  1R27 B;  5JXS A;  1TL7 A;  1TAU A;  5DJB A;  5C42 A;  4U67 Q;  2OPP A;  4LSZ B;  1VRU A;  3UN3 A;  4YDX A;  3KFW X;  4F2R A;  1WWH A;  3AH6 A;  3DOM B;  3OTO J;  4RPF A;  4JV0 A;  4ECX A;  3PRD A;  2UUT A;  2XYG B;  1NK7 A;  3VR1 A;  4I7F A;  2AJ1 A;  5L1J A;  2OEK A;  2NUU G;  1P6T A;  4JI5 J;  4LBP A;  3VGT A;  5GAD I;  4K7Q A;  4IDK A;  3TP2 A;  4CDI A;  4OI4 A;  3UPF A;  3NNH A;  5IM0 B;  3QLH A;  1GXL A;  3NCQ A;  4DR7 F;  4ZVT B;  3VVT A;  2BAB A;  1Z1Z A;  1N6Q B;  2HQI A;  4F3Q A;  3H7H B;  3V6H A;  2OFG X;  3D1O A;  3OPK A;  1QY7 A;  1M5K C;  4A46 A;  1UEU A;  3DXS X;  4ZCK A;  5AE2 A;  2CNN B;  2LP4 A;  1RT5 A;  1VMB A;  4TNO A;  2HK3 A;  1NDL A;  4NCG A;  5D0G A;  1OS5 A;  3QGG A;  3PX4 A;  4HT5 A;  3TJ9 A;  1IBL J;  2OSR A;  3EM1 A;  3NRB A;  4DX5 A;  2KDO A;  2HRY A;  1VQK S;  1G3O A;  3C46 A;  2DH7 A;  2CQ3 A;  2DKO B;  3GR0 A;  1JLC A;  1AA1 B;  2QSW A;  2LXF A;  1MML A;  3D6F B;  1UVJ A;  4NZ6 A;  4CH1 A;  4ED6 A;  3TZZ A;  1HWL A;  3J7A 1;  4AD6 A;  3BR8 A;  2IYI A;  3BGL A;  3QAU A;  4U8Y A;  4H4K A;  1FES A;  3SI8 A;  5J2Q B;  4DUY J;  5KFH A;  3HHL C;  1S49 A;  4OHV A;  2X3D A;  4DQI A;  2FGC A;  1X5P A;  3TYT A;  2OO4 A;  1N32 J;  1FEE A;  4M1K A;  2MKC A;  2N7C A;  3B4D A;  3KJF B;  3VQT A;  3PEH A;  3DKD A;  1FD2 A;  2KHD A;  2G2Y A;  4WYL A;  4QBU A;  3GG0 A;  5AE1 A;  2M8D B;  5HMW A;  2N3L A;  3M2V B;  1HMV B;  3NP5 A;  1IWA A;  3OLA A;  4DU8 A;  4PWD B;  4D3G A;  3BO2 A;  2ZOG A;  3ILL A;  4F2S A;  2LYV A;  2OLW A;  2HBZ B;  4O3P A;  2P6S A;  3J81 j;  1YJN S;  4LIR A;  5ETT A;  3G87 A;  2FJD B;  1HW9 A;  1R31 A;  4RW7 B;  1UVN A;  2VKZ G;  1KLN A;  1MU2 A;  1AZS A;  4MAK A;  3I56 S;  1GX6 A;  2KJW A;  4ES3 A;  1LWE B;  1IM4 A;  4GVL A;  1HNZ J;  5J2P A;  4DFJ A;  3D66 A;  4EZ9 A;  3PTW A;  2ZJR Q;  2CQ2 A;  3OFF A;  1LW2 B;  2JFK A;  2EG1 A;  2QN6 B;  1T94 A;  1QUP A;  4DMZ A;  2LDY A;  1X9M A;  2CPJ A;  3LAN A;  4UTG A;  3LGN A;  2B8Q A;  1LXN A;  4PXE A;  2GS8 A;  4GO5 X;  3D3B J;  5H9F K;  1T9Y A;  4OJ1 A;  3O6Q A;  2LU2 A;  2RF2 A;  5EHH A;  4C97 A;  1FX2 A;  5HLF B;  4NLU A;  2IVY A;  1H73 A;  4CLZ A;  1C4A A;  5DZ6 A;  3EVM A;  2MLY A;  2ZUA A;  3D6H B;  2OJ3 A;  1DTQ A;  9RUB A;  1RAI B;  1KLM A;  4HYK A;  1AW0 A;  2HAF A;  3Q8R B;  2H4W B;  3M8Z A;  2FLP A;  1JLE A;  3M2R A;  2V2V A;  1RIS A;  4IR1 A;  4ZVF A;  4O3S A;  5KFP A;  4M8L A;  2HFS A;  2MZS A;  1T9V A;  2RJZ A;  3ZNJ 1;  2RRB A;  2IVF B;  3IBW A;  4QJV A;  3IN5 A;  7FD1 A;  4USV A;  4X62 J;  5LXR A;  3DXB A;  4DFK A;  2UVR A;  1GMW D;  2LXU A;  1DY3 A;  1PG5 B;  4MKV A;  3GCW P;  3HX9 A;  2V5H G;  3GIK A;  1B70 B;  4DR1 F;  2C42 A;  2HQF A;  3AY0 A;  3GON A;  4OV1 A;  3Q83 A;  3DLK A;  4AYB D;  3A3N B;  4URG A;  4F26 A;  4ALZ A;  4RUB A;  4F67 A;  4YR0 A;  1Q8I A;  2ZJP Q;  1XK8 A;  1S97 A;  4FS2 A;  4P2F A;  2YPY A;  4WYW A;  4MFB A;  3T6B A;  4DHV A;  1SUQ A;  3IS9 A;  4LF6 F;  3NOG A;  4P73 A;  2HVE A;  4UUX A;  5ETM A;  3DN9 A;  2GIF A;  1YI2 S;  1L3V A;  2DH9 A;  4CH0 S;  2UXB J;  3EGZ A;  3GMG A;  2GA7 A;  4X4Q A;  2AKW B;  4H4M B;  3KJV A;  1HIY A;  4X64 J;  5ETL A;  4U6P A;  1RKI A;  5D3G B;  3RBD A;  2R7U A;  1IKV A;  3HSZ A;  3KK3 A;  2I5J A;  5SUH A;  2OPS A;  2GHW A;  3KNA A;  4WU3 A;  3QZ7 A;  1I1G A;  2FIU A;  2E1P A;  1C1C A;  4ZKA A;  5KFS A;  4DR6 F;  4F02 A;  1RBO B;  4DQR A;  1Q53 A;  3L09 A;  3ZTP A;  1JLQ B;  1FFG B;  1EB0 A;  3RGI A;  1VC0 A;  3G71 S;  4KE5 A;  2Z30 B;  3QRR A;  3TX0 A;  4NML A;  1DUR A;  1KP6 A;  3GZ7 A;  3CJK A;  2F8M A;  4F8R A;  3DGV A;  4YP3 A;  5A76 A;  2U2F A;  1BHN A;  3TAM B;  3MD3 A;  2B43 A;  1TV6 A;  2AJF E;  4NYP A;  1XNR F;  2ABY A;  3JSR A;  5KFT A;  1CPZ A;  3KUG A;  2OFH X;  3HFV A;  3W2W B;  4GMK A;  4C8N A;  3KTQ A;  3KLG B;  2CNL B;  3SSQ A;  1YBA A;  1WG5 A;  2F40 A;  1PYO B;  3E3X A;  1C0U A;  1IR0 A;  2ZNY A;  3BKF A;  2P6T A;  3W5X A;  2HKE A;  1YJV A;  2OPQ A;  1FRX A;  3FFI B;  1HBM A;  1DAX A;  4A8Q A;  2AD9 A;  2OML A;  4KHP J;  2MPU A;  3RYL A;  3UI3 A;  3P96 A;  4OX9 J;  5D0H A;  4TLR A;  3Q8Y A;  3MMC A;  3QMQ A;  3GFX A;  1URR A;  1TKZ A;  2IJR A;  4WII A;  2C2D A;  1R8B A;  2RU9 A;  1XER A;  2VJV A;  2KXF A;  1BUX A;  4B3R J;  1RT2 A;  2HPU A;  2MDA A;  1RAD B;  3LP1 A;  1JXL A;  1HQU A;  2WB4 A;  4USW A;  3VAK A;  3RB6 A;  4M5N A;  2BQR A;  3N0V A;  1FFS B;  4A4J A;  4KBI A;  3MPW A;  1LWF A;  2UUA J;  3B6B A;  5D4L A;  3PDN A;  4LSN B;  1KVI A;  2W9B A;  4ID5 A;  4OMF G;  1K8A T;  3TOQ A;  2WW4 A;  2B8P A;  2V4Q A;  3K8W A;  4LRF A;  1TMJ A;  2PE8 A;  1RAG B;  2Y8Y A;  2J7U A;  2NZC A;  3U02 A;  3MM6 B;  3X1L B;  3LPE A;  3NL0 A;  2QIF A;  3W2V A;  2NXC A;  4C3L A;  4JUZ A;  4DPU A;  2W25 A;  3R6L B;  2ZHO A;  1MRO B;  1DLO B;  3MUR P;  3FBE A;  1YQH A;  4CLT A;  2VG6 A;  3RG6 A;  1WG1 A;  3D5M A;  1NXI A;  2DK2 A;  2BJ3 A;  2HZA A;  1FEH A;  2VC1 A;  1IBM F;  5FJ4 A;  4LF9 F;  2KZM A;  3CJ0 A;  1REV B;  2GIQ A;  1T03 A;  2G0J A;  4YME A;  4NRT A;  1C2P A;  4URS A;  3PJX A;  2QLJ B;  2HHW A;  2RVJ A;  1F60 B;  2R7X A;  4L73 A;  1TU0 B;  1JLA A;  3RBX A;  3V5R A;  4UOG A;  2PT0 A;  2OEL A;  4K2J A;  1HBU B;  1WAC A;  3CDU A;  2U1A A;  4KKO B;  4YUD A;  1N5Y A;  2XS7 A;  5K8P A;  2VPW B;  1HWJ A;  3HT3 A;  3CJQ A;  1M0S A;  4V19 X;  3WC0 A;  4IKA A;  3KLI B;  2H1Y A;  3IA0 A;  3TW0 A;  5HRO A;  1RWP B;  4KGK A;  3VF0 B;  3PR5 B;  1Q8L A;  3C6U A;  4X66 J;  2GHP A;  2HND A;  4LFB F;  4Y6I A;  1FRI A;  2GCF A;  1DQ8 A;  4WP3 A;  2B5J A;  3EGN A;  4XPE A;  1GMU A;  2H65 B;  1R7I A;  3KWM A;  1BWE A;  2DNH A;  3ONQ A;  1CJU B;  4OZ1 A;  2W7P A;  5C7P A;  3T1H F;  1LWC B;  2MB0 B;  2XSJ B;  3GP9 A;  4O0N A;  3TR5 A;  2PFD A;  4IFY B;  3C19 A;  3LAM A;  4DV2 J;  1HR0 J;  1TFW A;  4WK3 A;  3TUJ C;  4ZPB A;  1QE1 B;  1I51 B;  1VYA A;  2EKY A;  4IOA Q;  2RDI A;  4H4K C;  2P8I A;  5HI7 A;  4E8U A;  5CAB A;  1Z4U A;  2IFX A;  4M5K A;  2MGZ B;  4RL1 A;  5D0E A;  1TKD A;  2RML A;  3CCZ A;  4F3O A;  3KLF B;  2V6A A;  1CG2 A;  2MQL A;  4DR5 F;  3JQM A;  3QAE A;  3BDE A;  4G1Q A;  2YWE A;  4L75 A;  3AJD A;  1SL2 A;  4N76 A;  3DDK A;  2ZH6 A;  1K0V A;  4DR2 J;  5A6P A;  2O01 C;  4Q2L A;  4XDC A;  1R8C A;  3OR2 B;  4ZP7 A;  4TU8 A;  3Q2S C;  2UV8 G;  3PCO B;  4P6Q A;  4B3M F;  1W26 A;  3TJA A;  1EQ0 A;  2BYC A;  3I0S A;  3C16 B;  1EIY B;  2KYZ A;  4QWC A;  2XCA A;  4ZLL A;  5KT5 A;  2DY9 A;  3NS6 A;  1VR6 A;  2OEJ A;  4Y00 A;  4TLQ A;  3T1A A;  5KAK A;  4C8Y A;  1RHK B;  1SBR A;  2YQ1 A;  4GKK F;  1JK9 B;  3CCU S;  2R7T A;  1NJI T;  5E3C A;  1E6Y A;  4ENO A;  3GIR A;  4P7V A;  3N6N A;  3H5X A;  2XMJ A;  5RUB A;  3TUP A;  2B4U A;  4FBU A;  2AYE A;  2BJE A;  1CEZ A;  1S6P A;  8ATC B;  5E3A A;  3KJQ B;  5F3Z A;  2YXL A;  1H7W A;  2GQ2 A;  4F3M A;  3MPV A;  2IHR 1;  2O5D A;  1X0F A;  3SQG A;  4AUK A;  5M2U A;  1LW0 B;  2HW3 A;  3DOL A;  2Y1J A;  2NXE A;  2H9Z A;  1GQE A;  1GK8 A;  2DNY A;  2EPI A;  5DM7 Q;  4PXD A;  1J5E F;  5B0D A;  4ID8 A;  3UQS A;  3PG9 A;  2M88 A;  3DDN A;  1N33 J;  2VU5 A;  4ETX A;  1LXJ A;  4TY8 B;  4X84 A;  1IKY A;  3I0R B;  1ZBT A;  3LGM A;  2R8K A;  4HEA 9;  2C2E A;  4O4G A;  4PPD A;  4DV3 J;  2E5J A;  3PHE A;  1FO1 A;  1RHJ B;  3MUM P;  3NKY A;  3M4X A;  2UXD F;  4DR7 J;  3G82 B;  2G0I A;  2UXC J;  3CF5 Q;  1B7F A;  1GAO A;  1V3Z A;  5DDQ C;  1PYT A;  4YQW A;  5CQG A;  2QZ8 A;  2RUS A;  1S99 A;  3MFH A;  5I42 A;  1AYE A;  1SV5 A;  3N5B A;  2V94 A;  1R8H A;  2ZHA A;  3MMB B;  3V4M A;  2J9C A;  1K9M T;  1UW4 A;  3K8V A;  2CJK A;  3ZO7 A;  3MPD A;  5J2M B;  2CQ0 A;  1S4E A;  3B54 A;  2C22 A;  3MEC B;  2EK6 A;  1AUS L;  3HP6 A;  3JB9 k;  4FBT A;  2E1A A;  5CAA A;  5F0U A;  1HNV B;  2KRB A;  3LA0 A;  1F5C A;  3BSA A;  3JQJ A;  2A2D A;  1OQ3 A;  4IO9 Q;  2RDD A;  3CW2 C;  4ECZ A;  3M6V A;  5L1L A;  4ED1 A;  4J9Q A;  1E6V A;  3NBP B;  4LJM A;  4RZR A;  2DO4 A;  4WFZ A;  3V6D B;  3MR7 A;  1LKZ A;  1BXN A;  1SCJ B;  2RHS B;  2AZ1 A;  4NL5 A;  4DFP A;  1TL5 A;  4ER8 A;  2OD6 A;  2V4J B;  4N41 A;  4TQS A;  2C2Z B;  2P9E A;  3OHB A;  4Y2A A;  1TKX A;  1ULR A;  3BR9 A;  3QSI A;  3GIJ A;  2WOM A;  1IBK F;  4EBE A;  4A8S A;  4LUB A;  3FBF A;  4Y28 C;  2Z8Q A;  3TZY A;  3UVJ A;  1VHI A;  2ASL A;  4OYO A;  1R43 A;  4QW8 A;  1N5V A;  1WHX A;  4JYA J;  2IA6 A;  1ZET A;  4NLP A;  2MLZ A;  2ZBR A;  3BBC A;  2VQE J;  3KLH A;  4ZVU B;  5I3U B;  3HHE A;  2RSQ A;  3L7P A;  2QLW A;  5J2N B;  4KO0 B;  4F0H A;  4YB7 A;  3A13 A;  1NUE A;  2JNJ A;  3DMJ A;  3ITH B;  2KT3 A;  4LF1 A;  5DG7 A;  2BAN B;  1CQM A;  2ROG A;  1W7W A;  4FPR A;  3O3L A;  2Q66 A;  1F9F A;  4BDP A;  5C25 A;  3MAA B;  5C24 B;  4NPO A;  2ATL A;  1F2H A;  4Y2I A;  1JJH A;  3C3L A;  4C11 A;  1NKC A;  3D7S B;  4ZVH A;  3QJP A;  3KG1 A;  4Q0B A;  3DU6 A;  4DEZ A;  4B02 A;  3MI7 X;  2WAQ D;  4YHH J;  3S6E A;  2G13 A;  2HHT A;  2QFJ A;  1RP5 A;  1WUU A;  2VF3 A;  5LSO A;  1Y3J A;  2LKZ A;  4ELT A;  3K5N A;  2YKA A;  1WNE A;  4RUH A;  4YN3 B;  3LAK A;  2B9X A;  4CI0 B;  5EN1 A;  1ZOT A;  2EFO A;  3HF5 A;  1G1X A;  4DSL A;  2IPO B;  4AT1 B;  2WVC A;  2JWN A;  2GGP B;  1M1H A;  2K1R A;  4NXM F;  1C1B B;  3JYT A;  1EET B;  1L3T A;  5ETP A;  2KN4 A;  5HVG A;  4DUZ J;  2MQN A;  3S1T A;  1V3S A;  1CJK B;  4RNF A;  2DGS A;  5HAT A;  3BPS P;  4DR3 F;  3R2D J;  4OL8 A;  5KFN A;  1D1U A;  1TK8 A;  3IBF B;  1B7Y B;  3D6T B;  2DIS A;  3ISN C;  1ZM9 A;  2MKY A;  1WEX A;  4OX6 A;  1NLK L;  1XWL A;  5K14 A;  3TVZ A;  3F44 A;  1HBO A;  2KVI A;  2DNO A;  1SL0 A;  2KXN B;  1B99 A;  2AEJ A;  4OHW A;  2UUW A;  2VV5 A;  1TEL A;  2XEX A;  3I5B A;  1S1X A;  4KIA A;  1NHV A;  2MQO A;  1ZPW X;  3E01 A;  5BR8 F;  3QFW A;  2IBO A;  5KT3 A;  1M5P C;  3OUY A;  1ZM4 A;  2BEF A;  3KHG A;  2L9W A;  3K58 A;  2PGC A;  2P9G A;  3PYG A;  1KKH A;  3MMA A;  1YSJ A;  2J6T A;  2XMW A;  2OUG A;  2YKQ A;  4B9T A;  1NPR A;  4J5O A;  3DRS A;  3E8O A;  4QW9 A;  2CQP A;  4LF8 F;  5G0R A;  2CZ9 A;  2R7S A;  2ASJ A;  2XC9 A;  3TAN A;  4NCB A;  3ISZ A;  4MT1 A;  4M5D A;  2XCP A;  1RT4 A;  5CZV A;  3H25 A;  2XWY A;  1S5Z A;  4NLD A;  1YKW A;  1Y9O A;  4ICL B;  3ELH A;  2KM8 B;  3RAM A;  1I94 F;  3DRR A;  4HDH A;  2W24 A;  1GTH A;  2ZOM A;  4DR6 J;  1QVF R;  2DRB A;  3IRX A;  1OMS A;  4F4W A;  1VQO S;  1X0P A;  4QYZ K;  2IAJ B;  4I2Q B;  4DCP B;  3PIP Q;  3P3D A;  2HSE B;  3DNC A;  1L3U A;  2XMK A;  3G6E S;  2JSX A;  2Z2Y B;  1S1W B;  4KY3 A;  1FKO A;  3DI6 B;  2GVD A;  3POT B;  3V4I B;  2IDL A;  1SJ4 P;  1FJG F;  2HHV A;  1XNR J;  5KT4 A;  2YNI A;  4RU9 A;  1VQ8 S;  3HXM A;  4DS5 A;  3W65 A;  4P71 A;  2V8D A;  3SIP B;  3GSD A;  2X1G A;  1VQL S;  4RUA A;  4GVB A;  1Q7Y T;  2D69 A;  5KOX A;  3QIP A;  2QMX A;  3TA0 A;  5KFO A;  4DS4 A;  4WU2 A;  5LL6 d;  2GHV C;  1B64 A;  3I96 A;  1HYS B;  1D8Z A;  4YOE A;  4PG6 A;  2EFQ A;  1KVJ A;  1QAJ A;  2CKW A;  1QJH A;  3T9N A;  2WW8 A;  3ENQ A;  3BN4 A;  2KG0 A;  1S1T A;  4KH1 B;  1YBT A;  1HNI B;  4Y2K A;  1KOH A;  4WKR A;  3GJR B;  3M6X A;  2DR5 A;  1U8S A;  2MZ1 A;  1VJQ A;  5D78 A;  1ZPV A;  2F63 A;  4LSL B;  3TX8 A;  1VIO A;  3VAG A;  4NEZ A;  5K8O A;  3T6J A;  3EDR B;  3MEK A;  4PG7 A;  4AND A;  1R0A B;  2YKM A;  3H5Y A;  4I68 A;  4CLS A;  1PCA A;  1NB7 A;  2HS0 A;  3K5O A;  5CYJ A;  2EK1 A;  1JJ2 R;  1XNQ F;  2FZG B;  3DC2 A;  3IWL A;  2EEY A;  1QAY A;  2I6W A;  2CQB A;  2YNG B;  2C3M A;  1B0V A;  1X4A A;  2HNY A;  1FER A;  2KZZ A;  4OYA A;  1X5O A;  1Q5V A;  5CD4 A;  4KHM A;  1FDA A;  4IH7 A;  4UT4 A;  1KRP A;  5LMN F;  1H2T Z;  2G9O A;  1RI7 A;  4CO0 A;  1SIW B;  4P2M A;  1JLB A;  1U7L A;  1FWP A;  4DV6 F;  2VFS A;  3VWS A;  2GIR A;  3D28 A;  2VA3 A;  5HO4 A;  1U2C A;  2GQC A;  4DL4 A;  3DLE A;  1KWM A;  4I2P A;  5I3Q A;  3HK2 A;  4JI8 F;  2VH7 A;  3W7B A;  2HMI B;  4MH8 A;  2HYI B;  1U2F A;  3LWL A;  2D74 B;  4ED8 A;  3OVA A;  1PIE A;  2ZC4 A;  2PSZ A;  5HBM B;  2YWG A;  3SV4 A;  1RZM A;  1JJ4 A;  1IBM J;  3V81 B;  3CDB A;  5T14 A;  2EFG A;  2IIH A;  6FD1 A;  2DVI A;  3R3T A;  4KR0 B;  3LP2 A;  3P49 B;  4DV5 F;  4Z7Y A;  2JJ4 D;  3RAX A;  4FS1 A;  2DGQ A;  2X1F A;  1SXL A;  3W61 A;  2VL1 A;  3UCU P;  2AGQ A;  3DOK A;  1LFW A;  4QR0 A;  4DSI A;  2XMM A;  1F5A A;  5A8R B;  4CO1 A;  1IKW B;  4Z37 A;  4WXO A;  3TO8 A;  3QT5 A;  3KDN A;  2ZH9 A;  5KFW A;  1OPZ A;  4OZN A;  4RLE A;  1VBX A;  1WHW A;  1CJT A;  1FDB A;  1LK7 A;  3BGU A;  4ZLP A;  2C3P A;  3THP A;  5F8H A;  3VAL A;  2F7V A;  1VHF A;  3ZZT A;  4AXJ A;  2F3J A;  2ZHB A;  4A8W A;  3OTO F;  1PIL A;  3GFY A;  2ZIT A;  4YB1 P;  1U0H A;  2R9L A;  5AJ3 J;  1KQK A;  2PI4 A;  2Y1R I;  4OZ2 A;  1U25 A;  2IRY A;  2RU3 A;  5F8J A;  4ILR A;  2CYY A;  4EI2 A;  2L9N A;  4FPI A;  3T1H J;  4JI5 F;  3H5S A;  1FWL A;  4ZN1 A;  2C2K B;  4HVZ A;  1DAR A;  3G8Q A;  2CXE A;  3KHR A;  1NPP A;  2W2N P;  2HGN A;  5GME A;  1G7C B;  4CWB A;  1U45 A;  1S57 A;  1RAA B;  3G96 A;  4CQ1 A;  3UDC A;  2ZH3 A;  1RT6 B;  4CCH A;  3N4W A;  2LCW A;  1ZA2 B;  2EW9 A;  1Q16 B;  3KHH A;  3G6V A;  2CQ1 A;  2H3E B;  5ITH A;  2YWF A;  2B4O A;  4I0W A;  3ZTS A;  2NPF A;  2XGQ A;  4DR5 J;  2F9J A;  1X7V A;  4UST A;  1IBL F;  1UJ4 A;  2GVZ B;  4X4P A;  2O1P A;  3MM5 B;  3HD1 A;  3QID A;  3QWP A;  1PAE X;  2HHU A;  3HHL B;  2UVW A;  3OSP A;  2XB2 D;  4BBY A;  2K7J A;  5KFD A;  3H2U B;  5LOQ A;  2WSE C;  5BYQ A;  3BDP A;  2DT9 A;  1RTI B;  4DUY F;  1S6U A;  4CIO A;  4P72 A;  1H2V Z;  4HAC B;  2W9A A;  2ZE2 B;  1CC8 A;  2BMB A;  3C14 A;  3A12 A;  4FDF A;  2ZC3 A;  1Q8K A;  4EMD A;  1N32 F;  2FHO B;  1RTZ A;  2J5A A;  3W8G A;  3FEX B;  1PSD A;  2AGO A;  4C8L A;  2IDE A;  2CVI A;  2YKO A;  2R7V A;  3OV7 A;  2HZV A;  5EX3 A;  3D0H E;  1XQI A;  3M6U A;  3N79 A;  3ET6 A;  3JS9 A;  1X4C A;  4WE1 B;  4I64 A;  2AJ2 A;  1NJW A;  1MN9 A;  3K7R A;  2FLL A;  4DLE A;  1KC8 T;  3RRK A;  4ZPA A;  2J7W A;  3M30 A;  3M32 B;  2FJX A;  1T9X A;  1ZH5 A;  4PAB A;  3UE2 A;  5F9N A;  2AU0 A;  4JOU A;  3BQ2 A;  3C15 A;  2MKH A;  4RW8 A;  4DL0 C;  4PQU A;  2XMV A;  3FCW A;  4NZ0 A;  3VGV A;  5GAE I;  1T8E A;  5DG8 A;  3GV8 B;  3HHL D;  5LJ5 Y;  4USH A;  1L3S A;  2HHP A;  3M8S A;  4Q8E A;  3EGV A;  1XJW B;  5T7L B;  4QWA A;  3IG1 B;  2OPR B;  2QYG A;  4NA3 A;  2DNK A;  5IOL A;  1DZ5 A;  3PFE A;  1UZH A;  4ZVE A;  2IJF A;  2ZM6 J;  4KSE B;  2R8I A;  1NJY A;  1JB0 C;  3QRP A;  5IQ6 A;  4ED4 A;  2UXD J;  4ZPW R;  3RRH A;  3R1L A;  2Z0G A;  1JQG A;  2CZ4 A;  3A8K A;  3CJ4 A;  3U1N A;  4J9R A;  1HHQ A;  1FJ7 A;  1YJU A;  2JEJ A;  4ZVO B;  2WHO A;  3MM7 B;  2LEB A;  4WCE Q;  2CPI A;  2WSC C;  3I82 A;  1YJW S;  2ATC B;  3H20 A;  3HZE A;  3HVA A;  1FNO A;  5KT6 A;  4DSK A;  1PC4 A;  2AJ4 A;  1URN A;  4OYM A;  3GLJ A;  3K5M A;  3I87 A;  3FJ2 A;  4ZPV R;  1RWV B;  2DEI A;  1NRK A;  1KSP A;  3JSM B;  1FXL A;  2DR7 A;  4UF4 A;  4QPT A;  4OYW A;  2LVW A;  3OVB A;  2HQ3 A;  3DRX A;  3OW2 R;  3HFZ B;  3PAC A;  4X62 F;  3DLB A;  2FHJ A;  4J37 A;  2AV5 A;  4I69 A;  1OIA A;  4OI6 A;  1KBR A;  5CYM A;  2V8V A;  3UD4 P;  1QDU B;  2V4R A;  4F25 A;  4K2X A;  1HWU A;  3DLG A;  3NMA A;  4UOH A;  2ROP A;  1S59 A;  2BKN A;  4OJ3 A;  2KI2 A;  1RTH B;  4KFB A;  2CJB A;  3WQP A;  2C2N A;  4HHU A;  1C0T B;  1IBK J;  2ALY B;  1TL3 B;  1ARO P;  3UCG A;  2I8E A;  4PRF A;  5E33 A;  4RNN A;  1Y5I B;  2HRT A;  2UXB F;  4F4K A;  1YJ9 S;  4G1I A;  1VGY A;  1Y4Z B;  3W8P A;  4TXS A;  4DOZ A;  3FDS A;  3NS7 B;  4DF8 A;  3MEG A;  2RT3 A;  3DRP A;  1S6O A;  3VGU A;  2XI2 A;  2MKK A;  3AB4 B;  4WFB Q;  3RW6 A;  3G86 A;  2DH8 A;  4FNH A;  2NLW A;  2ZWO A;  4LF5 F;  2RIL A;  4DL5 A;  1S6Q A;  4ECY A;  2QSF A;  5EWE A;  2Z4P A;  5K20 B;  2HNZ B;  1VOM A;  3EE3 A;  4AL6 A;  5KG0 A;  1S9E B;  4DZ6 A;  3AD7 C;  1RGV A;  2B0G A;  2YNF A;  3RTV A;  5C2C A;  1ZAV A;  1C4C A;  3KG4 A;  4C8M A;  4ATN A;  4CT9 A;  1S12 A;  5F8I A;  1KHW A;  2CG4 A;  2VPY B;  3LTO A;  1KEK A;  1AT1 B;  1NB2 A;  1NZA A;  3Q8U A;  3KDO A;  4M5H A;  2WTF A;  5HP1 B;  1B3T A;  3DLL Q;  3CD6 S;  1TMM A;  1VQS A;  2IYG A;  4RW4 B;  2JZ5 A;  1F9E B;  3DM2 B;  1Q0N A;  5DET A;  1S0N A;  4M94 A;  3PX0 A;  2RQC A;  1M90 T;  3ZNU A;  3AOD A;  1SQF A;  2Q6B A;  4ZDN A;  3RB3 A;  2CNK B;  2G4B A;  3FSI A;  2YKN A;  4PWW A;  5GMD A;  2QLB B;  1OWX A;  3P6Y C;  1U1L A;  4RNM A;  4JV5 J;  4NLX A;  3L9Z A;  3P5T L;  1U24 A;  4CRJ A;  1D8Y A;  4OX9 F;  2RHQ B;  3HVT B;  2HFN A;  4DR3 J;  5HSP A;  5HK4 A;  2H5J B;  1BC6 A;  2D3O R;  3GE9 A;  3D54 A;  2B7C B;  1CS4 B;  4MYT A;  1FX4 A;  2FTR A;  3KUH A;  3GFZ A;  3LP0 B;  1WKL A;  5G4D A;  3C6T B;  5IQQ A;  4R8U B;  1ZAX A;  1VRT A;  4CYU B;  1PJ7 A;  1ZM3 A;  3AT1 B;  1IR1 A;  4PEO A;  1ICE B;  1RWW B;  2FUG 9;  1OYD A;  2B6A A;  5EUH A;  4F36 A;  2HVD A;  4RW6 B;  2F8E X;  3Q8V A;  1IN0 A;  4E0D A;  2HIY A;  1UA1 A;  2AWZ A;  2BBE A;  5CYQ A;  4NI2 B;  2BJ1 A;  2ZBI A;  1H6K X;  2CQD A;  4P2S A;  5EX0 A;  3KK2 B;  5A0Y B;  3AXM A;  5CH7 B;  3NCP A;  2XY6 A;  4C9D A;  4EO8 A;  4USM A;  4MTP A;  1FFW B;  1SPB P;  5B7W A;  5J1E A;  4NLY A;  2XYP B;  2B9Y A;  3N28 A;  1TL7 B;  5C42 B;  2R7O A;  2VC0 A;  2FVC A;  3H0P A;  1RLD A;  1FA0 A;  2OPP B;  3O44 A;  1VRU B;  5KFF A;  2IJN A;  4B3T J;  2ALZ A;  1AUD A;  2CUY A;  1I94 J;  1S77 D;  2BE2 A;  2V69 A;  3QZ8 A;  3P5B P;  2OTJ S;  3TAP A;  4I7F B;  2YPZ A;  3UDV A;  5A8W A;  3M8P A;  4ECT A;  3M9O B;  5KFJ A;  1P9Q C;  4H4O A;  3A1Y G;  4FF3 A;  2AW0 A;  3W64 A;  1CJV A;  4IDK B;  1N52 B;  4L6V 3;  3FRZ A;  5KFU A;  3CJ8 A;  3I31 A;  1N48 A;  4K4T A;  1FJG J;  5KFB A;  3TAQ A;  3QLH B;  1QVG R;  3B78 A;  3PM9 A;  5KFY A;  1SJQ A;  1MG7 A;  2CQ4 A;  2E1M C;  3MM9 A;  4KRW A;  3NGS A;  1T05 A;  3T1Y J;  1SB6 A;  2ZH2 A;  2IM3 A;  3L7O A;  2V63 A;  2EWH A;  4FKY A;  2K7K A;  1EZZ B;  1T11 A;  3RAQ A;  1HFE L;  3UW1 A;  5D15 A;  1RT5 B;  4X66 F;  4ILM A;  4A8O A;  4ZJL A;  3TZX A;  4QU7 A;  2HRU A;  1YRT A;  4RNO A;  4LQ9 A;  5CD4 H;  4NCG B;  3BBB A;  3FEY B;  5HMY A;  1Q78 A;  4PQA A;  1PC5 A;  2VBZ A;  4OQJ A;  4ZIV A;  2KKH A;  2Z2M A;  1LK5 A;  6FDR A;  1JXV A;  2BJ8 A;  2HFO A;  2CRL A;  1WKK A;  4IG3 A;  3M9N B;  1OJ4 A;  1JLC B;  2KB2 A;  2K3I A;  1G2E A;  5LMU J;  4FXV A;  1ZYQ A;  2GV1 A;  1G4C A;  2YKP A;  2HWT A;  3GU0 A;  3PW2 A;  4QIF A;  2BX6 A;  2DD8 S;  5KFM A;  4C0H A;  1MWZ A;  4DV2 F;  3DCA A;  2J0W A;  2A1B A;  3TJ8 A;  3UO0 A;  3HLU A;  1GH8 A;  5IFM A;  2FVS A;  2G0C A;  2DNL A;  4F0M A;  2VFU A;  1U49 A;  4QWB A;  2YY3 A;  2OI2 A;  3LGH A;  4OLO A;  2ZH8 A;  3UWT A;  2EFP A;  3CO0 P;  4BWJ A;  2DRA A;  5KFK A;  4LBI A;  4UY8 5;  4OYX A;  4ED0 A;  2UUC J;  2RD5 C;  1VQ4 S;  2GJ2 A;  4EBC A;  3ZTR A;  4B3O A;  2QMU B;  4X4T A;  3AA9 A;  2IBK A;  3B8H A;  3JXO A;  2GJI A;  2ASY A;  1XR6 A;  2WON A;  2PEB A;  4N7T A;  4PUO A;  1XIQ A;  1VQM S;  2LEA A;  1X4F A;  1YBU A;  3RBZ A;  1RWN B;  2VZ9 A;  2KYX A;  4JI8 J;  2GMJ A;  3AXK A;  3JTP A;  3GTY X;  3GIM A;  1JJC B;  2J76 E;  2YX1 A;  2ZDP A;  1MU2 B;  1AZS B;  5IV4 A;  5C2G A;  3W1Y C;  3H4B A;  5AXM A;  1CQN A;  1NK8 A;  3P45 B;  2FC9 A;  7AT1 B;  3K89 A;  3W9H A;  5J2P B;  2RNE A;  3FK4 A;  3LO3 A;  2QA1 A;  4H54 A;  2XMU A;  4M95 A;  2YWK A;  2V9K A;  1NK9 A;  3L4B C;  5DDO C;  4I6A A;  3D2W A;  4IG0 A;  4LQ3 A;  1D09 B;  4J9O A;  3E2E A;  2KXH A;  2Q6C A;  4OYI A;  4RWW A;  3PR4 A;  3EIC A;  4CM2 A;  1S9G A;  3A8I A;  2RF2 B;  3MOJ B;  4HL9 A;  5KG7 A;  1FE4 A;  1S79 A;  1QUV A;  4C8O A;  5KG5 A;  1DTQ B;  1WF0 A;  1KLM B;  3TA1 A;  2N4C A;  2G2O A;  1JLE B;  1RT1 A;  3BGR A;  4LMZ A;  3M2R B;  1WOP A;  4N8N A;  3NNC A;  1FXD A;  3D0I E;  2B4P A;  2VPZ B;  1RYS A;  5H9E J;  3HT0 A;  1N33 F;  3EXY A;  1RA6 A;  4Z2X A;  4LRE A;  1U02 A;  1RHU B;  5HJY A;  4MIA A;  4DV3 F;  1MW7 A;  4O44 A;  1F6T A;  4P9S A;  4FN5 A;  2DIV A;  2UXC F;  2PD1 A;  1U1P A;  4DL3 A;  1YHQ S;  1RA7 A;  1EX8 A;  2NPI A;  2XYH B;  2MQ8 A;  1U1N A;  2QTW A;  5K9F A;  3M8R A;  1REG X;  3DLK B;  3T5K A;  2R42 A;  1NHK L;  4PG5 A;  1NSA A;  5JVH Q;  4O3R A;  4NMX A;  4USJ C;  3DGP A;  4NLS A;  4UOC A;  2CPD A;  4MFB B;  3CD7 A;  1IUJ A;  2F1F A;  2IMW P;  1SUQ B;  3K59 A;  3OTE A;  3IS9 B;  2FZC B;  5E5N A;  1N8R T;  2IC3 A;  1FDD A;  1T3N A;  1HHT P;  1UFK A;  4L72 B;  3BB5 A;  3SV3 A;  1OQ6 A;  5ETK A;  4ZVG A;  5D4P A;  5K8N A;  1RAH B;  3QJL A;  1LV5 A;  1X4B A;  2X1B A;  3KJV B;  2KH9 A;  2CWK A;  3VHQ A;  1UTA A;  1Y3K A;  1RQ0 A;  3BGF A;  3CCL S;  1KTQ A;  2MY7 A;  4NZ7 A;  5M2P A;  3OR1 A;  2F4V J;  3KK3 B;  2I5J B;  2JDJ A;  2DGX A;  2OPS B;  2AEF A;  2Y9H A;  2R4F A;  1IWG A;  3BQ1 A;  5B0C A;  1F0X A;  5EGY A;  2BOA A;  4X65 F;  3NMR A;  4W98 A;  1C1C B;  3PW0 A;  4DG1 A;  2QL5 B;  4LBH A;  1R3N A;  1WSV A;  1OSD A;  2WVF A;  2W2O P;  5DQG A;  2Y1L B;  3M2U A;  3CC2 S;  2AX1 A;  3MED A;  4OI3 A;  1J5O A;  3CJK B;  4EO6 A;  4N5S A;  3MUV P;  1TV6 B;  1QSS A;  2KTQ A;  4AXI A;  3ZZ0 A;  2HFU A;  4ZJO A;  3SQO P;  3MR3 A;  1WC1 A;  1YZ7 A;  2YWH A;  4QYR A;  2EG2 A;  1QLN A;  2H54 B;  4LSL A;  2LQB A;  3O2I A;  2VHG A;  1UKU A;  4JP8 A;  1LOU A;  1FF2 A;  2MY8 A;  4JYA F;  1C0U B;  5B08 A;  4F4X A;  3CD0 A;  1JLF A;  3WX8 A;  5KFA A;  1S0M A;  2OPQ B;  2VQE F;  3MCS A;  1HBM B;  3NNA A;  3MM8 A;  3T5H A;  4KPC A;  3M8Q A;  1YRU A;  4AL7 A;  4RBT A;  4K4V A;  2FB0 A;  1RU2 A;  4IQM A;  3QPI A;  3G2X A;  3MMC B;  1XTZ A;  4MKY A;  3CCR S;  3TZW A;  5KFR A;  3SMZ A;  1TKZ B;  1RWK B;  2GJF A;  1M5V C;  1RK8 A;  1RE1 B;  4OLP A;  1O8B A;  2BJ9 A;  1NJZ A;  1RT2 B;  1DTT A;  2JX2 A;  4NOH A;  2PMZ D;  3IWN C;  3LP1 B;  4Q8F A;  3TNV A;  1MLA A;  1OY6 A;  1HQU B;  4MK8 A;  4YHH F;  1HHS A;  3DDI A;  3H40 A;  3I5A A;  2FJE B;  2XZW A;  4ZVQ B;  2A6M A;  1SKS A;  4NX9 A;  2RRN A;  2DJW A;  3H8Y A;  3HPO A;  1LWF B;  4Y3C A;  1MMN A;  3BKT A;  3BYP A;  3OXF A;  1F2G A;  2W9B B;  4EZ6 A;  4ID5 B;  1WC6 A;  1PGZ A;  1YGY A;  5D4O A;  3VAH A;  1FT8 A;  2W4C A;  4KTQ A;  2CPF A;  2E66 A;  3IXQ A;  3FSX A;  5LXY A;  4A8K A;  3ADA C;  4BC7 A;  4C98 A;  3NWG A;  4DUZ F;  3CNQ P;  4CO5 A;  3W2V B;  3ETM A;  1EAY C;  2QMW A;  3QQC D;  3KKF A;  4PG8 A;  2BW7 A;  3PHT A;  2VG6 B;  2H5I B;  3PYD A;  4J9U E;  1W2B R;  3IO1 A;  2XQC A;  1VS3 A;  1RT3 A;  1DQA A;  1X4D A;  3RB0 A;  2OAU A;  2K8G A;  5HQL A;  3HHK A;  4CLK A;  1IQT A;  3U27 A;  3WHI A;  3WIU A;  3Q23 A;  1FJE B;  1T03 B;  1KFS A;  5EWG A;  3KG0 A;  1SKW A;  5DDP C;  1NBE B;  2PMW A;  4CLF A;  3CSK A;  3D67 A;  1NEE A;  3UNY A;  3C66 A;  4Y34 A;  5ETO A;  4K4S A;  3S01 A;  2HK2 A;  4EYH B;  2H5E A;  3PO5 A;  1JLA B;  4BHQ A;  1RJJ A;  2GMH A;  2C28 A;  2VOP A;  2YWW A;  1N5Y B;  1T9U A;  3HVW A;  5IS2 A;  1RYR A;  3UFC X;  4R5P A;  2ZZM A;  3RW7 A;  3CMA S;  1DFD A;  2VOO A;  5HRO B;  4DV4 F;  2YQ3 A;  2JLF A;  2IRU A;  3C6U B;  3IC1 A;  5ETV A;  4J9L A;  2HND B;  4CLY A;  2IM2 A;  1UPM B;  4I6Y A;  2ADC A;  3ENV A;  5KT7 A;  2FZK B;  4CTA A;  2MKI A;  3ISN D;  2B5J B;  1F5B A;  4EWT A;  4LF5 J;  2ZBQ A;  2MKS A;  2V2Q A;  1RT7 A;  2H48 B;  3KYL A;  4RO0 A;  2FJW A;  1YWX A;  3GII A;  2ACY A;  3ZZU A;  3EPI A;  3R7N B;  1KN6 A;  5DG9 A;  1D3W A;  1WOR A;  3SSR A;  4CNZ A;  1JWW A;  4A8M P;  4QIG A;  3BO3 A;  3HDS A;  3BH6 B;  3R9L A;  3F41 A;  2W8L A;  5FDL B;  4NLQ A;  1VC5 A;  2GO9 A;  2XZD B;  2XO7 A;  5GAH U;  2QJ3 A;  4C2M A;  2V9W A;  4OYZ A;  2O67 A;  2EC2 A;  5U47 A;  2IY5 B;  2CPH A;  2FJB B;  4DPX A;  1RAE B;  4G1Q B;  1X60 A;  2QYC A;  2CPX A;  5HN0 A;  4C8K A;  1J27 A;  2FYX A;  1S0V A;  2NR0 A;  4F04 B;  3CC7 S;  1DBD A;  1Y5L B;  3G8S A;  2GFF A;  2JLG A;  5F0W A;  2R2R A;  3CJR A;  2LU1 A;  3MCO A;  3IFE A;  1U09 A;  1HBN A;  3AFG A;  3CED A;  2DGV A;  2PC6 A;  2VBW A;  1DJ0 A;  4UQT A;  1NME B;  5KFV A;  3OQ2 A;  1R6V A;  5ETN A;  4MIB A;  2E5G A;  3I0S B;  1U1M A;  1TZ0 A;  1F3F A;  5GVQ A;  4DSJ A;  3H2L A;  1IKX A;  1YG0 A;  2LMI A;  2CWX A;  3LAL A;  2WVD A;  2D3U A;  3OVS A;  4PWU A;  2DPI A;  5K5M A;  2VOD A;  3CCT A;  3RRG A;  3JSB A;  2CDQ A;  5AT1 B;  1H72 C;  4KH0 B;  2UUB J;  4DFM A;  3W9J A;  4LR8 A;  1V6H A;  4LF4 J;  1FRJ A;  4ZVS B;  3CDE A;  4OZ3 A;  2GAH C;  5KG1 A;  4PPZ A;  5LSR A;  2L41 A;  1E6Y B;  2J0S D;  4JI7 F;  1HQE A;  2UV8 A;  4FF2 A;  1PO6 A;  3ZC4 A;  1EQM A;  1S6P B;  4KGV B;  2XLK A;  1U0S A;  4Q5V A;  2ZH1 A;  2M3D A;  2NSC A;  4HHJ A;  1T9W A;  4WP9 A;  1D0E A;  3SQG B;  4M63 A;  3FMB A;  4OHX A;  2DY1 A;  5B0A A;  1K44 A;  2EFN A;  3DOL B;  4DV7 J;  1MWY A;  5A8K A;  2XGP A;  3RR7 A;  1T7P A;  2QT7 A;  1NH7 A;  5B09 A;  2JEI A;  4KV8 A;  1IKY B;  1EP4 A;  4B9N A;  1X31 C;  4O4G B;  2PA3 A;  1U6F A;  2HFZ A;  2RS8 A;  1VBK A;  3PRB A;  4NAS A;  1VK3 A;  2RDJ A;  2D1C A;  1XMB A;  1HLW A;  3CVK A;  5I42 B;  3HM9 A;  1SV5 B;  1H7X A;  4NLW A;  5C5J A;  3QFH A;  3TI0 A;  2DXD A;  5D77 A;  3NLC A;  4DV1 J;  1SKU B;  2RUG A;  4USK A;  3PYE A;  2Y0S D;  4JI6 J;  4BC9 A;  2E5L F;  3UR0 A;  1RAF B;  1K1Q A;  1RDR A;  1FK9 A;  3IRW P;  1D9A A;  3N6L A;  1RTD A;  2I9S A;  5AJ3 F;  2EFV A;  3WIV A;  1GXT A;  3A4T A;  4KT0 C;  4QWD A;  1N5Q A;  3AOB A;  4N47 A;  1VQ7 S;  3ICL A;  1JKH A;  1HI8 A;  5HVH A;  4OHY A;  4HI2 A;  2GNK A;  2W9C A;  1GNK A;  4A48 A;  1E6V B;  3PV8 A;  1N36 F;  2F9D A;  4CO3 A;  4K0K J;  2E9T A;  4KGM A;  1U1R A;  1KQF B;  1VLY A;  2BKO A;  3EMT A;  4HLB A;  4USI A;  3FMW A;  3D4J A;  4WFA Q;  2NUH A;  1FKA F;  4DQP A;  3J81 Y;  2VG5 A;  2HHH F;  2D7S A;  3BF4 A;  1U4B A;  1SJ3 P;  2DBB A;  3HHN B;  3ZZO A;  2JL9 A;  3B82 A;  1TKX B;  2X7I A;  2ZDO A;  3ZZR A;  1FKP A;  2WOM B;  2PDA A;  2R3V A;  3QSY B;  1G6B A;  1NO8 A;  2E7X A;  2V68 A;  3CJT A;  2Q1L A;  4RJV A;  3NWR A;  4RU2 A;  1YIT S;  1Q7L B;  2LXI A;  3J7Z 5;  1UVL A;  3UVJ B;  2Q3P A;  3D1H A;  3BJY A;  4ZLN A;  2DB1 A;  1ZM2 A;  1SQG A;  2ZKU A;  4DL6 A;  4ZVP B;  1S10 A;  1X5T A;  1UJ6 A;  4L3K A;  1BWV A;  4P52 A;  1RAC B;  3CGI A;  1ZTT A;  4JI2 F;  2P9C A;  3KLH B;  1HNX J;  1H98 A;  1NKB A;  3FVY A;  4N8O A;  3EYZ A;  1VFJ A;  4FNI A;  1HPZ A;  1LFP A;  2FJV A;  4J91 A;  2HQC A;  2VFV A;  2QFI A;  1Y10 A;  3PW4 A;  4NRU A;  4DR4 J;  3DMJ B;  2VFT A;  3HJV A;  4DJB A;  1UET A;  5KFZ A;  1TKT A;  5HQM A;  2OP5 A;  4TU7 A;  2FVP A;  1S1U A;  3SFU A;  1KQG B;  2IM0 A;  2R8J A;  5C25 B;  1UMJ A;  3DYA A;  5BXI A;  4A47 A;  4C11 B;  1UVI A;  1HWI A;  4O0I A;  3PKY A;  4Q0B B;  4ED5 A;  3NOC A;  3TEG A;  1H38 A;  3J7Z T;  5CHC B;  4DX7 A;  4U95 A;  3D3C J;  1KD1 T;  4PR6 A;  2V0N A;  1FRK A;  2ZVS A;  4LVN P;  1XC9 A;  3NGD A;  3AHP A;  4N56 A;  3VAJ A;  3QGP A;  5DRK A;  3IGV A;  4P75 A;  2AZ3 A;  2E1C A;  3MAQ A;  3EPG A;  3OJS A;  2BRK A;  2YNH A;  1F9H A;  1BQM A;  2HS3 A;  4RW9 A;  4ECR A;  1HNW J;  2LEP A;  2K1R B;  1KON A;  3JYT B;  3FSY A;  2DNM A;  3KK1 A;  3OL8 A;  2GML A;  3R5J B;  3SDE A;  3FRY A;  5L8R C;  4ZA1 A;  3T5J A;  4XK8 C;  1A6L A;  1NCL A;  4DPW A;  4Y65 A;  3EVW A;  2ZM6 F;  4U7C A;  1JMT A;  4UQG A;  2J6S A;  5K14 B;  1PKU A;  2LQ8 A;  1HBO B;  2G2Z A;  2RAQ A;  4ECU A;  1S1X B;  4Q7A A;  1WEZ A;  2RKI A;  3OXG A;  2YTC A;  3E01 B;  4OZL A;  4DSF A;  3EDQ B;  4RWX A;  4LFC J;  1NZ8 A;  3GV5 B;  3OUY B;  3OFG A;  2EKN A;  5GAH I;  1FNX H;  4C0B A;  3BSN A;  5IT9 Y;  2HVI A;  1CUL A;  4ZHR A;  3DLH A;  3PRV A;  4UZB A;  3MMA B;  3R97 A;  1R89 A;  3EUN A;  4DUT A;  1SH2 A;  1IJE B;  1RCX B;  5B0G A;  1TVR A;  1S1V A;  2AIR B;  1FJC A;  4ECQ A;  5H9E K;  2N82 B;  2VG7 A;  5E3Q A;  3DRS B;  2XSF A;  3GQC A;  5G0R B;  5EWF A;  5KG4 A;  2FQQ B;  2W2P P;  2ZKT A;  1R8P A;  4DL2 A;  2XY5 A;  4IOB A;  4M5D B;  2I0X A;  2DO0 A;  1RT4 B;  4ZCM A;  2DYA A;  3R5C A;  3M7V A;  2X3G A;  2V2Z A;  3QO9 A;  3K5P A;  2KG1 A;  1LEO A;  2BQU A;  2A0F B;  4X65 J;  2QE5 A;  4OYP A;  3VAM A;  1WG4 A;  2COL A;  3DRR B;  4ED3 A;  4B3S J;  3IR7 B;  1K1S A;  3IRX B;  4QPX A;  1JLG A;  4JI3 F;  3MR5 A;  2K06 A;  5HVF A;  1BQN A;  4IFV A;  3HHD A;  3H42 A;  2A3J A;  1UJ5 A;  3L3C A;  4I4B A;  1FKO B;  2GVD B;  2KT5 A;  3AQO A;  1P1T A;  1UWB A;  2Y1I A;  3UD5 A;  3CDW A;  3PIO Q;  4OHZ A;  2J9E A;  2YNI B;  4CM0 A;  1V9O A;  3HSJ A;  4USU A;  3MD1 A;  1T3O A;  4GVB B;  3QIP B;  5E3P A;  4C0O C;  3MZI A;  2J9D E;  3LUY A;  4X4R A;  4E98 A;  4HTI A;  5J1N A;  4FYW B;  1UP1 A;  2HS4 A;  2R2T A;  2NZ4 A;  1S1T B;  3AD8 C;  4DV0 J;  4ED2 A;  4WFY A;  4B9S A;  1BD6 A;  1TR0 A;  3MEE A;  4K50 A;  4WTO B;  2Z58 B;  2ILY A;  2BDP A;  2F5G A;  5DLF A;  3NGT A;  3KLE A;  4TN2 A;  1FHT A;  2DTJ A;  1GT8 A;  1SH3 A;  2YKM B;  1T95 A;  4AFF A;  1Y0H A;  2R2S A;  5I3P A;  2HBQ B;  2AYG A;  4X4U A;  1RCO B;  3H59 A;  3PKM A;  3HFK A;  5KFI A;  3IWX A;  1FI4 A;  3OL7 A;  2ZD1 A;  5HMZ A;  2HNY B;  3M1V A;  1UW9 A;  3W5Z A;  1NK6 A;  1KFD A;  3UN2 A;  1N54 B;  2KT2 A;  1PJ6 A;  3PJW A;  1JLB B;  4OI0 A;  3ZXW A;  2A10 A;  1EAR A;  4ECV A;  3FZ2 A;  4JV5 F;  2DPJ A;  3VVU A;  2UU9 F;  4U9R A;  4F0K A;  3QNW B;  1HAR A;  5I4M A;  1RTJ A;  3DLE B;  4XAK A;  3I32 A;  4I2P B;  4ITS A;  1WDT A;  1TK0 A;  1ZZN A;  2DCU B;  2J0Q D;  1ACM B;  4LFA F;  4TVA B;  4ED7 A;  3EZ5 A;  3J81 U;  2J0X A;  4KYZ A;  4ZP8 A;  1FVS A; 
#chains in the Genus database with same CATH homology
 3ET6 A;  1CJT A;  1CJU A;  4UST A;  1WC4 A;  4CLY A;  1CJV A;  5D0R A;  3MR7 A;  4OYB A;  2GVD B;  2GVZ B;  4WP8 A;  3C16 A;  1AB8 A;  2BW7 A;  3G82 B;  1CS4 A;  1CUL A;  2W01 A;  4WP9 A;  1AZS A;  1U0H A;  1WC0 A;  5D0E A;  4OZ2 A;  3C14 B;  4OYM A;  4CM0 A;  3C15 A;  1CJK A;  4CLK A;  4OYX A;  4USU A;  3MAA B;  5IV3 A;  1Y11 A;  3UVJ B;  4OYI A;  4NI2 B;  4P2X A;  4WPA A;  4WP3 A;  2GVD A;  5D15 A;  4CLS A;  2GVZ A;  4CM2 A;  4USV A;  4CLF A;  3G82 A;  5D0H A;  4CLT A;  4OYW A;  3R5G A;  4CLP A;  1TL7 B;  3C14 A;  3MAA A;  3ET6 B;  2QV6 A;  1CJT B;  4OYA A;  1WC1 A;  1YBU A;  3UVJ A;  1CJU B;  2WZ1 A;  4OYO A;  1Y10 A;  1CJV B;  1WC5 A;  4NI2 A;  1WC3 A;  4OYP A;  4OZ3 A;  1YK9 A;  3C16 B;  4P2M A;  1CS4 B;  1FX4 A;  1WC6 A;  1CUL B;  4OYZ A;  1AZS B;  1FX2 A;  4P2F A;  5D0G A;  1U0H B;  5IV4 A;  4CLL A;  4CLZ A;  4USW A;  1TL7 A;  3C15 B;  1CJK B;  4CLW A;  4CLU A;  1YBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...