4Y28C

The structure of plant photosystem i super-complex at 2.8 angstrom resolution.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
b'SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of plant photosystem I super-complex at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 8
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y28C00
3IR6B 2GMJA 3MM8B 1PC4A 1BD6A 2WB1D 1GTEA 1Q16B 1GTHA 2Z8QA 3MM7B 1XERA 3PNIA 1FF2A 1C4AA 1JNRB 1BWEA 1ROFA 3OR2A 2XSJB 4XDCA 1FCAA 5E7OB 3LW5C 5FD1A 1CLFA 1K0TA 2C3UA 2V2KA 2FJAB 1Y5IB 2C42A 1R27B 2GMHA 3MMBB 3MMAA 1D3WA 3EGWB 4CI0B 3MM9B 1H7XA 3MM5A 1FRKA 3C8YA 3MM7A 1RGVA 4XK8C 3HKZD 2V4JB 2FGOA 1KQGB 2PA8D 1JNZB 1B0VA 1GAOA 2O01C 2WAQD 1WTFA 2Y0SD 4RKUC 1C4CA 2VPXB 3IR5B 3IR7B 2C3PA 5BYQA 1B0TA 3MM6B 5L8RC 1Y4ZB 2FJEB 1KEKA 1FDBA 3MM8A 2VPYB 5BYSA 1FRIA 3MMCB 1G3OA 1H7WA 1BC6A 4OV1A 4Y28C 4L6V3 1DAXA 1FERA 2WSFC 1FXRA 1AXQA 1H0HB 1DURA 1FDDA 2XSJA 3OR1B 1F5CA 1FRLA 1F2GA 4YDDB 1FDAA 1JB0C 3EXYA 1BQXA 1GT8A 1SIZA 1Y5LB 2C3OA 1SJ1A 3EUNA 3OR2B 5CHCB 1KQFB 3MMBA 2C3YA 2VPWB 1F5BA 1FTCA 3MM9A 3MMCA 1DFDA 1IR0A 1HFEL 2FJBB 2C3MA 3GYXB 4KT0C 2VKRA 3MMAB 2IVFB 4XDDA 1IQZA 1A6LA 1FXDA 1G6BA 1SIWB 1FRXA 2WSEC 1FRJA 3MM5B 1B0PA 2V4JA 1H98A 5BYRA 1FRMA 3OR1A 1FRHA 4OMFG 1FDNA 4ID8A 4DHVA 2WSCC 1PC5A 7FDRA 2ZVSA 4AYBD 1Y5NB 3MM6A 5CH7B 2PDAA 2FD2A 1VJWA 1FD2A 2FDNA 2FJDB 1FEHA 2PMZD 1BLUA 6FD1A 2UZAA 2VPZB 7FD1A 6FDRA
chains in the Genus database with same CATH superfamily
3Q8UA 2CVIA 2FC8A 2OFGX 4FYWB 2UUWA 2X1FA 3AA9A 2F1FA 3QIPA 1TTHB 2F9DA 1GNKA 4FPIA 4CI0B 1OY9A 3DLEB 4A8YA 2X7IA 3QPIA 4J7CA 5EWFA 3BSCA 3H5UA 3GFHA 5D0EA 5L38A 1UJ6A 3IRXA 2GZOA 4YY3J 1HWLA 4CLTA 2DCLA 3U7JA 2RE1A 2QGFB 3TUJC 1JLQA 3NGUA 1WEYA 2P8IA 1LWEB 4X4TA 5EHHA 1JLAA 2EEYA 3OHBA 4DBQA 1HW8A 2XNQA 3KLVA 1H74A 3SSSA 4J91A 4IRKA 4KGMA 1B0PA 3LPEA 2X1BA 2QYGA 2B4UA 2RNEA 4K2XA 1RTZA 2YBVA 3MM6A 1I94F 1TK8A 1B64A 3D0HE 1BD6A 4QIGA 3VAGA 2KHDA 1GTHA 1ZAXA 3JTNA 2XSJB 1X5TA 3QWUA 2FJVA 2IVMA 4FDFA 2R7UA 3NOGA 2YKNB 4B9NA 2R7SA 4Q45A 1UJ4A 1U0SA 4RR5A 4OI3A 4AL7A 2FHMA 1LFWA 1KLMB 1JKHA 4G1QB 2K8GA 2BRKA 5A8KA 1RYRA 2RKIB 1IR2A 4MH8A 3W5YA 2XO7A 3KG4A 2VHGA 2YH0A 3CD0A 2QL7B 1ZTWA 4EZ6A 2NR0A 4KIAA 3UE2A 2G0CA 1S12A 2FVQA 4OX6A 2DXEA 2VFUA 1EP4A 4ED8A 3M8QA 4FN5A 3OFFA 4M95A 2ASDA 5E33A 2CPDA 4R8UA 2XMKA 1T9VA 2PMZD 5KG2A 3BSNA 1D9AA 4FP9A 3MM8B 2H1YA 4JI7J 5F9NA 1ZS6A 4X65J 4WPAA 2BX6A 3CJ3A 2YKPA 3FEXB 4O44B 3W64A 1HQEA 4K0KF 2DNLA 2CXEA 4H54A 2QSWA 4O0IA 4C0OC 1T05B 1RB0A 3ZZPA 2HGNA 3D54A 2UXBF 2VFRA 1IKWB 2RMLA 3C3LA 2CAJA 2V6AA 4YMEA 4LQ9A 2WOMB 4I56A 2DNYA 1NK0A 2E1PA 3E01B 5ETSA 4UUXA 5CZVA 1Y11A 2Y8YA 4CP5A 4PWDA 1KOHA 4I6AA 1VRUA 3W61A 1AZSA 1IKYB 3OV7A 2V8HA 4USJC 3BEGB 2JEJA 5CYMA 3LP2A 2QV6A 1CS4A 3R6LB 4AYBD 2FDNA 2RS8A 3IBWA 2FJDB 1RBOB 3VAHA 4HLBA 1B4SA 4NMXA 4LSLB 4PKDB 2W9BA 2SXLA 2WB4A 2DJWA 3HVTA 5HO4A 2LDIA 2UXCJ 3OFGA 2R2TA 2JLFA 4GRSA 3GCXP 4NXNF 2ZH4A 4KKOA 3D2WA 3MR7A 3JSMB 3OL8A 4ZCKA 3ITHA 1OSCA 3W3SA 3VZIA 4JI4F 1YJ9S 3QAEA 2DITA 1UVNA 2XLIA 1FNOA 1N6QA 1M5PC 3KDOA 4KRWA 1FD8A 2M3DA 2LEPA 5F9LA 4M5HA 4WJBA 2R7QA 5A0YA 3UN3A 4TN2A 1S0OA 2C2MB 3VGTA 4URSA 2UUTA 1W25A 5F8HA 2KFYA 4C97A 3JAMU 3N79A 3DRRA 3DYAB 1S10A 3QIDA 4DL3A 2XLKA 4EBDA 4P71A 1F6TA 4NOHA 3I55S 3N28A 3VVTA 4WP9A 2H9ZA 1M1HA 4IG0A 3IM8A 3GILA 2WBRA 3SSRA 1QD1A 2ILYA 2JLGA 3KUGA 2IM0A 1JLBA 3H20A 2X1AA 5DLFA 3CDUA 2DPIA 3J80Y 1IM6A 2HHQA 4YDXA 3GFXA 3I9ZA 4AD6A 5LSOA 4XPCA 5IM0B 2NPIA 3OXFA 2LQ8A 3CCZA 1HR0F 1FRKA 1XR5A 4USWA 1AUDA 5L1IA 1VJQA 3F44A 2QZ8A 2PIIA 4CZCA 1YGYA 5BR8F 2W4DA 1T95A 1TL1B 4CYUB 4X66F 2AKWB 3THVA 3MMCB 4ECTA 3DN9A 1MN9A 2ILZA 3C66A 5GAGI 4DV7F 3U02A 2HWIA 3R27A 2LXFA 2ALZA 1F3VA 4QWCA 4WBFA 4ZJLA 1FVSA 1VBKA 1TKTB 3EDRB 3J7ZT 3I4HX 4WF9Q 4IH6A 2VBZA 2A1BA 1X5SA 3FK4A 3BGOP 1YHQS 4KC5A 1PAUB 5J2NA 1VQ5S 3GZ7A 2G1HA 5B0GA 2KM8B 2HAFA 4I2PA 5KT2A 1QM9A 4KGKA 5KFUA 3GLJA 4CH1A 2DH8A 3PCOB 1L3TA 4F67A 2AIRB 1JNZB 2OMOA 4CO1A 5KFHA 3FSIA 1U1RA 1RE1B 5A8WA 3NP5A 2DY9A 3CD6S 2FTRA 1FE4A 2BABA 2DNZA 2VKZG 1TKZA 1S9FA 1RTDB 4ZA1A 1PJ6A 1EX8A 1BQXA 3CGIA 3X3UA 4Y3CA 5HANA 2ZZNA 2N3LA 1N33J 1D9DA 3TAMA 4LRFA 1PBAA 2LA6A 4NYZA 1OQ3A 4MT1A 3C16B 4WXWA 3JS9A 2Q43A 1HWKA 1F1BB 5DDQC 3HT3A 4DR3F 3WDOA 3GE9A 3R5DA 1DJ0A 5HMZA 2UVRA 4Y00A 1XNRF 4LF5J 5IWAJ 2PA3A 4OL8A 2R7VA 3C15B 1R0AA 4DZ6A 2VOPA 3EGNA 1IBKJ 2CQ1A 3UPFA 2J76E 3MMAA 2PC6A 1X4AA 5AXMA 2DYAA 3MM5A 1X4HA 5A2QY 4ZLLA 5KAKA 1NSAA 2IFXA 4K5RA 2HHXA 3CC2S 2MLXA 3CMES 1V9OA 2KZMA 1U24A 3DRXA 3M2RA 3POTB 4LFBF 2Q6BA 1R6YA 1NK5A 4ZVTB 3FCWA 1SUQB 1RBAA 1VGYA 4PQUA 2KT5A 1KVIA 2EC0A 3DLEA 3KLGB 3IMQJ 3H2LA 2U2FA 2N7CA 3MPDA 3KNAA 3ETMA 5LJ5Y 3GFZA 2PEBA 3MEEA 1P9YA 4DFJA 3IAS9 2F8MA 1RWXB 2CJYB 1HI1A 3CWJA 1K0VA 2DHSA 1RI7A 4N8OA 3LA0A 2UUBJ 3DGPA 1LWEA 1VQLS 5GAEI 4K5SA 3W60A 4RW7A 3W2WB 2IMOA 5EX0A 3HKWA 1MG7A 4J37A 5KFFA 1S0MA 2M2BA 1ZM3A 1MMNA 2IJNA 5D15A 4RBVA 4DL6A 2MEWA 3N9UC 4H4KA 3M7VA 3M2VB 3CJKB 1R89A 3W63A 4LF9J 4M1KA 4H4OB 5AE2A 5L39A 3W2VB 3NCRA 1F2HA 2R7XA 4W4MA 1J5OB 4FBTA 2MY8A 4F2RA 1X9MA 3BYPA 1AXQA 2XSJA 1S1UB 3C46A 2GAHC 2DNNA 2RD5C 4MYUA 5HJYA 2EFOA 4V19J 3SYZA 3QLHB 1HNVB 1SC4B 1D0EA 2Z57B 4OYPA 2YKNA 4Z7CA 2FB0A 4CLZA 4NLOA 4ED7A 3CF5Q 3FQLA 1KLMA 1HNWF 4G1QA 3L3CA 5K8PA 2RKIA 4ER8A 3N6LA 3JQMA 3Q8RB 4LFAF 1U47A 1M5SA 2OKQA 1RHQB 2VQFF 4DR7F 1UA1A 3QSYB 1S59A 1TVRB 3TO8A 2UV8A 1S49A 2MY7A 4MKVA 1S9GA 3FSYA 2V2KA 4OHXA 2EC2A 4R5PB 3SCJE 2V0NA 1WSRA 2DR9A 2NCKL 1U49A 1T11A 1RGVA 2UUCF 1YI2S 4OZ1A 4R25A 4RL1A 3L95X 2WAQD 4LMZA 1NPPA 3LGMA 3MM8A 4GKKF 4CO2A 1Q78A 1F9EB 4I4BA 1DAXA 1GQEA 3DC2A 4ZVUB 2QA2A 4O44A 3OTDA 2W9CB 4CH7A 2JEFA 4BLGA 4LRBA 5JMNA 2VOOA 1IBCB 2NLWA 4ZN3A 1IKWA 2ZBCA 3KTQA 2ZD1B 4WFNQ 3MECB 1K1QA 2WOMA 3I32A 3RW7A 1YIJS 3O3LA 2NXUA 3E01A 1VJWA 4JI3F 2W7AA 1VQMS 2HQCA 1RJJA 1QTNB 3E3XA 4F0MA 3CJRA 5F0WA 3MM7B 1E6YA 3JTOA 3T1HF 1R8HA 1E6VB 1N34F 4C0BA 3BGRB 4X4UA 5B0CA 1IKYA 3RUBL 2AYEA 1UVLA 2I38A 4NLXA 1VMBA 4KQZA 2ZWPA 2ZDPA 3PJXA 1RCOB 2L08A 3CULA 5KG3A 3NWRA 3GMGA 1B0VA 2HEKA 1LW2A 5HBMA 5DQHA 2CPEA 1B0TA 1VLYA 5ETTA 3PIPQ 2AJFE 4DEZA 4LSLA 2FLLA 4TU7A 1HARA 1I94J 4OFZA 5G0RB 2CJQA 1QJHA 2XNRA 1NUEA 1BGXT 1XWLA 2UVWA 2EKYA 3B54A 4TVAB 2MKHA 3JSMA 4IFYB 2DNMA 1N4LA 4ZN1A 4ED4A 3PKMA 1FFSB 3AQPA 4FKYA 4FF1A 3PXGa 4Q7AA 4Y2AA 1NPRA 5D4PA 1T9YA 1RP5A 2GGPB 3I31A 4DFPA 1WACA 1Q16B 3SI8A 1K1SA 4DPUA 2R8JA 2FVRA 3GIJA 2W2MP 1Q8IA 3NMAA 4QR2A 4DL0C 3NCQA 3TP2A 4UOFA 2HHSA 3MD1A 3W62A 1YITS 5C24B 4FXVA 3UCZP 4C8ZA 2KFZA 1IWAA 1RAFB 2RQMA 3OTEA 4CLWA 1IN0A 1VYAA 5CD4A 1WC0A 2XMUA 3KHHA 4ECZA 4HYKA 3RBXA 5H9FK 2AW0A 1Y5LB 3TJ9A 1CQMA 2LECA 4OHZA 4I7FA 3VQSA 1S99A 5KT7A 2RQ4A 4K0KJ 5DGBA 4NYPA 3K8VA 3AA8A 1IVZA 3DOKA 4X62F 2QFJA 1EZZB 3QZ7A 1PC5A 1KRPA 1X5PA 3J81U 3AD8C 1SH2A 2UXBJ 1TL1A 1XC9A 4CYUA 3QSIA 1M1KT 1NKCA 4FYYB 1M1GA 1FWKA 2QLJB 1GK8A 3PR5B 3KJVB 1WWHA 1U1NA 4WZMA 1CBKA 2KU7A 4KGZB 4CLSA 3M8SA 3B82A 4X4PA 8ATCB 1CC7A 1ZH5A 3K17A 1TKTA 1Y10A 3QZ8A 5KFPA 1KLNA 4CT9A 5G4DA 4RW8B 2CPJA 3AT1B 2DHAA 2DRAA 3CJ4A 2HW3A 1U0HB 3PYGA 5T14A 1SPBP 3CUNA 2NSBA 2M52A 1ICEB 1FK9B 4ZPBA 2MHNA 4PRFA 3HJFA 5ETRA 2YWFA 4N8NA 2B9YA 4Y2KA 1TZ0A 5KFOA 3KMQA 1KQSR 3FCVA 3IGVA 4YB1P 2DY1A 1A6LA 3BPDA 3FQKA 4O3RA 3H2VE 4DN0A 1HMVB 4J9KA 4NXNJ 1WKKA 2YVSA 3LH2S 4NLPA 5C7PA 4JI4J 3T1AA 3CD5A 4QU7A 1HBNB 3I0RB 3A8KA 4PYAA 1X4DA 4ES1A 4ED6A 1FCAA 3CCLS 1NK6A 3OL6A 2YQ3A 1RXOB 4ZP9A 3RR8A 3PHTA 3TA1A 1YRUA 4HACB 4NLVA 5FDLA 2HS3A 5KFYA 5HN0A 5KT3A 3J81j 1UEKA 4X84A 1VRQC 4OX7A 4GVLA 4MYTA 2YNHB 2LU1A 3MFIA 4ED3A 4Z7YA 1NMEB 3I0SB 3C15A 1BMQB 5KFAA 2G0JA 3FCHA 1FJEB 1UETA 3WBZA 2P9EA 4DI6A 4JI0F 2WZ1A 3L9ZA 3D9BA 3LP0A 3GONA 3OPKA 1N88A 4TU8A 4B3OA 2VBWA 4OMFG 1RTJB 1XEZA 3T5JA 3J7YI 1ZAVA 2PMHA 2ZJQQ 4E2FB 4K7QA 2ZJRQ 1Y5NB 1HR0J 2OPQB 3POTA 1OJ4A 2OGUA 3JTPA 4NLWA 5LXYA 4PXBA 2Q79A 2L3MA 3TX0A 3T9ZA 1KC8T 2EI5A 5BR8J 1SUQA 3DXBA 4B9SA 1LV5A 3VV2B 4WE1B 5LOQA 1H72C 4X66J 2HHWA 4EZ9A 4ZHRA 4L3NA 3R5BA 1H3DA 3CVKA 3CCRS 4EO6A 4DCJB 1N36F 3MM9B 3V6JA 1T94A 5KFIA 4DV7J 4LREA 2A2CA 4YEAA 2E1AA 1LW0A 4ECSA 3NNCA 5HP1A 3S6EA 4F4KA 4ZCMA 4FNIA 3R9LA 2C28A 4YP3A 3W2WA 3EZUA 1S1TB 3MAHA 4PUOB 1FDAA 2Y1RI 3GIRA 1RWVB 1VI7A 3AJDA 2J9EA 2HVZA 3NBPB 3M2VA 3CJKA 5ITHA 1WC4A 5KFQA 5ETNA 4H4OA 3VGUA 1UFLA 2D74B 4F36A 3O2IA 5U47A 5I42B 1X4GA 1KR4A 2KL8A 2ZH8A 2JNJA 2RQCA 2MSSA 4ZIWA 2O66A 2DK2A 1VIXA 1S1UA 4P72A 4USKA 2RRNA 3QLHA 1HNVA 2IA6A 4CM2A 2HVEA 1U6BA 2B5JA 4M5IA 3G2XA 1UVKA 2W2PP 3V4IB 3NKYA 2ZNZA 3Q24A 3KJFB 3QQCD 4JI6F 4HR2A 5DZ6A 4DR3J 3H5YA 2AEMA 2VQEF 1TVRA 5DZ7A 2FLNA 2XO6A 3GJSB 1XNRJ 3RRKA 2XB2D 3PJ9A 2ZBRA 2AT1B 4JBCA 3W7BA 3FRZA 3KJQB 2VKRA 1NRKA 3NGSA 4QBUA 1FXDA 1KHWA 2OAUA 3ET6A 2E5IA 5GAHU 4WK3A 3M30A 3I82A 5AT1B 1HPZB 2GJFA 3H4DA 1BLUA 1LOUA 2WB1D 4HVZA 1YJ7A 3Q2TC 1UCNA 2DTJA 3LUYA 1RTIB 3FVYA 4LFBJ 1C0TB 2I2YA 4DCPB 2JC0A 1D3WA 5LT5A 1NB7A 3FRYA 3GV5B 2GQCA 2BQRA 2ZD1A 3JSRA 1HYSB 4P9SA 3KDNA 4ES2A 1J5EF 3ZZYA 2MKCA 4IO9Q 2J7WA 3BR8A 3NY0A 2M0GB 5AE1A 3BBFA 1FESA 4F3QA 4C4WA 2MJUA 3PHEA 1RT4B 4ZVSB 4ECQA 2RF2A 4Y28C 1E6VA 4QWAA 3BGRA 1G1XA 1U1QA 3KUEA 2V8GA 3KLIB 5HATA 4K4SA 3QT7A 3GJRB 5FJ4A 3HPOA 3UVJA 1NPKA 3WIUA 4CLLA 5F8IA 2ZVSA 1ACMB 1T9XA 2OTLS 2OPRB 1SC6A 3D28A 1JLFB 1CJKB 4MJKA 3V5RA 4A4JA 2QMWA 4C8KA 5G0RA 1CSJA 2OPPB 2AJQA 3HULA 2XG8A 1XMOF 3UI3A 1U1KA 2B9XA 1P27B 2ZFHA 4QR0A 4URQU 1QY7A 3R6GB 2ALYB 1V6HA 1KP6A 4NXMF 1URNA 2Y9HA 4BS2A 5LSRA 3UD5A 4F0KA 1HNWJ 1FRIA 5DG9A 4EO8A 1PJ7A 1HBMB 4LFAJ 2UU9F 2VQFJ 4DR7J 1NHKL 1DARA 1S4EA 2P9GA 1N48A 4ZLNA 2FJBB 1RT1B 4AXIA 4FVMA 2DR6A 4KB7A 3BH7B 5C24A 4I1TA 4PQAA 1FWPA 4RBTA 3G6XA 2R7OA 3RBEA 2UUCJ 2DO0A 3MZIA 4IOCQ 5GADI 2VC1A 9RUBA 2A6MA 3HSZA 2YKMA 4W92B 2E9RX 2V8DA 5FLXY 2BMBA 4HTIA 4GKKJ 3VAKA 5C2CA 1UMJA 3HX9A 2EW9A 2C42A 1R27B 4KAIA 1TK0A 2LP4A 2PFFB 4G3IA 2KXFA 1RT5B 1VQKS 2AP6A 1NDLA 2DPJA 1L3VA 4NCAA 4CH0S 2FGCA 4QU6A 3RAQA 3BKFA 2DNRA 1RT2A 4Q5VA 1VOMA 3US5A 3GFYA 3ZZRA 1WTBA 2HFOA 3PY8A 3V4MA 3KJVA 5J2MB 4JI3J 2JH3A 1UEVA 3BN4A 2KVIA 4LIRA 3NXZA 1U2CA 2IJFA 3T1HJ 4U67Q 4A48A 1N34J 3UFCX 2XHCA 1G6BA 2CPIA 4RW8A 2LVWA 2CJBA 2XGPA 1YZ6A 3CD7A 4WKYA 2GX8A 4AXJA 5D4LA 2VFVA 1U0HA 5KT5A 3LOUA 2NXNA 2C2NA 7FD1A 6FDRA 2OPSB 4IFVB 4F25A 2QJ3A 1A7GE 3A8JA 1FK9A 4C6AA 4NWBA 3ETOA 4OI6A 2Y8WA 3MDFA 4Q0BA 1A9NB 1YJRA 4P2MA 3T41A 2XY5A 2L41A 4HH1A 2EBGA 2HVIA 4G6VB 3M2UB 2PMWA 3ZTRA 5HVGA 1Y3JA 2U1AA 1CQNA 4GO7X 3GR1A 5I3PA 4KYZA 2RB7A 3HO1A 3BS9A 4D3HA 4I68A 5HSPA 1Y9OA 4GC7A 2FUG9 2C3YA 1HNZF 3S01A 4HACA 5B7WA 3N01A 1VS3A 4X4VA 2QYCA 1TKXB 2AZ3A 4J9RA 4ZKAA 2DGOA 2YNHA 6AT1B 4ICLA 1IM4A 4DQIA 5IXUA 4URGA 2B6AB 3NWGA 3IN5A 3KK1B 1PKUA 1F60B 4DDFA 4WYWA 3I0SA 4QWDA 3W5XA 4RNNA 2YWWA 2KXNB 3FGVA 1Q5YA 2ZE2B 1M5HA 7AT1B 1MWYA 3B78A 5EN1A 4XDCA 4EK2A 2Y3YA 2BKNA 2KG0A 1IKVB 4ZVEA 3HHDA 5DS7A 4N77A 1VQ9S 3TVKA 3ZTPA 2FYXA 4F7VA 3H90A 3KK3B 2OPQA 2VPXB 3D6FB 5BYQA 4JV5J 2OMLA 4CIOA 2W24A 4X62J 3RB6A 2HRTA 1YJNS 3MAQA 4WE1A 4ETZA 2VH7A 3TUZC 3AFGA 1AYEA 2AQ4A 2ZH9A 3CJ0A 5CHCB 1S6UA 3MM9A 4A46A 1EQMA 2NREA 2UVVA 2MQLA 1OY8A 1HI8A 2JFDA 2ZM6F 1XMBA 1O8BA 3H8YA 4TLQA 4IR9A 4Q8FA 3D68A 5KG7A 4WU2A 4X4RA 2DRBA 4DJBA 4F4XA 1TUWA 1S1TA 1GTEA 3T1YF 4TQSA 4A8KA 5L46A 4PUOA 3TNVA 1S1WA 3BQ0A 3HF5A 4QPXA 1KFDA 2AEFA 2WRMA 5H1SV 3NBPA 2BW2A 3S8SA 4X65F 3OUYA 5K8NA 2DKOB 3C14B 3SEOA 1S76D 2GS8A 4FYXB 2AV5A 3HZEA 4OZ5A 3R5GA 3EX7B 1TL5A 4LQ3A 5KFKA 5I42A 1GAOA 4QIFA 2KG1A 1MLAA 5DLGA 3DI6A 3BN7A 1YG0A 3QYYA 3D6TB 1LEOA 1YJTA 3TANA 3CNQP 1XN9A 1OO0B 2VJVA 2KKHA 2Y1IA 2CPXA 3VF0B 5CAAA 5I4MA 3W8GA 2JC1A 1SL1A 1NAQA 3WC2A 2R42A 2OEJA 2WK4A 4C11B 1IBLF 4IR1A 4JUZA 2HGLA 3V4IA 3K5OA 4B9TA 1I1GA 4ZDNA 2AF6A 1HWJA 4FF4A 2HVDA 3N0VA 3MEGB 2FZCB 4NPOA 3HHLB 4ZP8A 2B4VA 1FD2A 1CJVA 3QGIA 2AEJA 2XTJP 4YR2A 4QYRA 3MAAA 5K9FA 3BGLA 2ZBIA 1NNDA 2HIQA 2GJIA 2VG6A 3QJPA 1SI9A 2ZDOA 2C3UA 4ZPTR 1G2EA 4WP3A 3QRRA 4QYZJ 4IRDA 5D6GA 2COLA 1L3SA 4JI0J 4CNZA 5ETKA 3DLBA 2AU0A 5CA5A 1HPZA 4K4XA 5IZHA 3J81Y 1Y7PA 5MAOA 1RQ0A 1RTIA 2KVQE 2VA2A 4O4GB 1C0TA 2ATLA 1SJ1A 4C7QA 3HT0A 3R2DJ 2WCXA 1HYSA 3D6MB 1VIOA 2P6SA 3MFHA 2PSZA 4Y0FA 1P1TA 1SH0A 5J2QB 2QMUB 2LQ5A 1N36J 2QMXA 4H4MA 5CH7B 2H51B 1Q8KA 4P75A 1FT8A 1RT4A 3EPGA 1GX5A 3HFZB 4RW6B 5E3PA 2KRBA 5E5NA 4K50A 1EB0A 4KHMA 1U09A 2GV1A 5D4OA 4OHYA 1UJ5A 3JB9k 4U6PA 1VR6A 2F3JA 4XK8C 2FVPA 3ULHA 3QT5A 2D7SA 4M8LA 3TUPA 5K5MA 4DUZF 2YKOA 2OPRA 3FFIA 4DL2A 1WF1A 2ZH2A 2V4QA 2HNZB 4ECVA 3TUIC 1RBLA 1UW9A 4U8VA 2G2OA 3LPYA 2OPPA 1X31C 3D6HB 2YNGB 3HZGA 1TAQA 3R1HA 3IBFB 3MTKA 3LWMA 4PXDA 2FJXA 2JVRA 3RW6A 4RNHA 2W25A 3V2UC 4M5DB 2MZTA 2DT9A 5B08A 3CO9A 3KKFA 3PV8A 1TFYA 3QO9B 3N4WA 4UQTA 2ZZTA 1CULB 4DR1F 2CPFA 3VTIA 1SKUB 1RTHB 5KG5A 2VQEJ 3HK2A 1C1BB 1BHNA 2GMHA 2KN4A 3TYTA 3MI7X 4ZITA 3V6DA 3OLBA 3QRPA 1RKJA 3P96A 3PRDA 1FI4A 1TAUA 2DGTA 2QIFA 2F8HA 2C2RA 2HIYA 5BYSA 2MMYA 3F0NA 4OX9F 4A8WA 1FRLA 2VICA 2F5GA 2C3OA 2IBOA 3OBIA 1RT6B 3TVYA 1DFDA 1RT5A 2JEGA 1V5VA 5GAGU 5FIIA 1JLCB 3CPWR 4DV3J 4WU3A 4U7UK 1B7FA 2M9KA 4JI8F 2E9TA 3JQJA 5DDOC 2YPYA 2N7YA 1REVA 3MUMP 1M5VC 1J5EJ 4DR2F 4UT4A 5J2MA 2R2UA 3PW7A 3NS6A 1DQ9A 3Q8VA 1BE4A 1B7YB 2AX1A 3FKBA 1ROFA 4QW8A 1AFIA 4WYLA 2RVJA 1V3SA 3ZZ0A 1AT1B 3Q89A 2B43A 3NLCA 1KN6A 3LO3A 2F63A 2BKOA 3M8ZA 2B4PA 3HKZD 2E29A 4UW2A 2CVEA 2VFTA 1KQGB 3GP9A 4YHHF 5IQ6A 3I56S 4Y65A 3LAMA 4IFVA 2HFSA 1WHYA 1LWXA 5L9NA 4U9RA 2EPIA 1R43A 4FZVA 4C3LA 3DRSB 4NA2A 3G8TA 2VONA 1N0UA 2FC9A 1XMOJ 4C9DA 3BR9A 1YJUA 2VFSA 1YQHA 3M2UA 4PYDA 1SJFA 1QTMA 4M63A 3BZQA 2APOA 2MB0B 2CRLA 5DQIA 1N5YB 4NXMJ 3M05A 3KOAA 2KJVA 1R8BA 2G1DA 1WNEA 2ASJA 5ETMA 1EARA 5HQLA 2RH3A 2NPFA 3GIKA 3THPA 3DU5A 2HYIB 3PX0A 1TKXA 2RT3A 2UU9J 3LWLA 3BO2A 2XCAA 1C4CA 2JWNA 3GQCA 2VJUA 2CQ4A 4G1IA 3NL0A 1RK8A 5A76A 4RW4B 3ZFVA 2A0FB 2ZE2A 4RU2A 3EZ5A 2Y1LB 5IC4B 5DETA 3HI9A 1OPIA 2J5AA 1IKVA 4QCLA 2IIHA 5B0EA 2ZVIA 3GYXB 3P3DA 2HLUA 3WIVA 2FY8A 3EJMA 3HHNB 3KK3A 5GMKa 3TZWA 4NLGA 3I96A 3UO0A 3CIZA 4LF4F 4X4NA 3GG1A 1UW4A 2LQ9A 2HZAA 4P7VA 4OI1A 1G4CA 1YVFA 4U8YA 5C2GA 4NX9A 3PFOA 1S4FA 2UXDF 3PNIA 4DQRA 4OYIA 1D09B 5L1LA 3IWLA 2Y0BB 1C2PA 1TL3B 4P2SA 3A13A 5KOXA 3ZZOA 4UZBA 2YNFB 4IRCA 3T3FA 1JK9B 3H59A 3CCWA 4TYBA 3TW0A 2BR0A 2BE2B 1RHRB 3HSDA 4DXLA 3MEDA 2OI2A 3MR5A 2FJEB 4A8QA 1SV5B 5T41A 3CJSA 4O3SA 2P2CB 5KFBA 2YWHA 2HNYB 3AOBA 1RLCL 4IG3B 4M5NA 4B3RF 3EUNA 3UR0A 1WC3A 2BJ9A 2GNKA 4O23A 1FFGB 1EQ0A 3QGPA 1QAIA 3DM2B 3D0GE 4ZIVA 2CQIA 1X4CA 4ES3A 2WVCA 2DXDA 2RDJA 3HVRA 1WHWA 5J2PB 4C2MA 5F8GA 5F8MA 7FDRA 4KY3A 1WKJA 3CEDA 3OXGA 1KSPA 2HQ3A 1T8EA 4CLKA 1WEXA 2V67A 2BOPA 2J7KA 2LXUA 4YFUA 5CXTA 1TQLA 3J7Z5 1R8CA 2MKIA 2CJKA 2Z2LA 2XLJA 2GCFA 4ED5A 2LYVA 1HKAA 3O5TB 2CPYA 4NRTA 2FJAB 4UY8T 4EFAC 3FEZA 2XMAA 4CO4A 1JJCB 1HNZJ 1H73A 3ZNJ1 3MEGA 3KHLA 2BE9B 1KOOA 3HHLA 4RPFA 3MR6A 4HI2A 4OYMA 3KG1A 1TELA 4X4SA 1RISA 2DGWA 3NAHA 3MUTP 5IQQA 4DZDA 3QFHA 4DR4F 1U2RA 3V6HA 2M70A 2ADCA 3TX8A 2IDEA 3G96A 3OL7A 3KK2B 3AQOA 1DTTB 1HNXF 1SQGA 5J1EB 2XGQA 1RAAB 1KBRA 3F56A 1N5SA 3MPWA 3ENWA 4B3SF 2V8PA 3IFEA 2E7VA 3RJMB 2YTCA 1U1PA 1XBWA 4ILRA 3HP6A 4O4GA 4DF4A 2LQBA 2LCWA 3K0JA 3DDKA 4ZK7M 4RWWA 1PBUA 1JX4A 4IO1A 1RT7A 4C98A 2IBKA 4ID5B 2HNDB 3JYTA 3A3OB 2ZM6J 4JI2F 4QWBA 4RW6A 4JYAF 4DX7A 4FNHA 4MIBA 3UW1A 3R97A 4J9SA 3ONQA 4LFCF 3R7SB 1BQNA 5CZXA 1WDTA 4F50A 2WBMA 4E0DA 1KQFB 3T1YJ 4I6WA 2ZITA 4N76A 1JIHA 4MKYA 3O1LA 2QL9B 1FRJA 2EBEA 3TZXA 3UDVA 4DMZA 1RACB 4LBPA 4HHJA 1GX6A 2XMTA 4DN9A 1OPZA 3D3CJ 1TUGB 3IWNC 2XC9A 4B08A 2CNLB 2Z30B 2FZGB 2B8PA 3KLFB 4ECXA 3PG9A 2BW7A 2J0XA 1IBLJ 1RWNB 5K14B 4M5DA 2XMVA 2HFNA 2D9OA 4EUVA 1Q53A 2YX4A 4RKUC 1N8RT 4A8XA 3G8SA 3IBCB 3Q8QB 1S6QB 1OSDA 3HSJA 1RTHA 1TL7B 1C1BA 4Q2MA 3TWZA 3AXMA 2V9KA 4J90A 2Z2YB 4CO5A 2WW4A 1FRMA 3OR1A 4IKAA 3EVOA 1PGZA 2K2PA 2M4MA 4O4RA 3OFEA 4ZLJA 4DV2F 2R8HA 1FX4A 4OJHA 5HK4A 4K2JA 3DLKA 4DPOA 3ZNUA 4ECRA 2XMMA 1R0BG 1S6PB 1RT6A 1K0TA 2E5LF 3BM7A 1JLCA 1X60A 5T7LB 3LAKA 4WTOB 4LSZB 4QPTA 2LXIA 3MMJA 2BJDA 4TYAA 2NXEA 4HTJA 1B3TA 3ZXWA 1NZAA 2GQQA 5E0OA 2J8SA 1O51A 3QT6A 1M5OC 3M8WA 3BGFA 4G65A 1HBUB 3MF5A 4WFYA 2MKKA 1JLGB 3T5KA 4F8RA 4BDPA 4EI2A 2C3MA 3DDNA 3SQGB 1V3RA 3LTOA 4P73A 5H9EJ 3RU0A 4QIVA 3OW2R 3CCTA 3TA2A 3TA0A 3KLHB 2E5GA 4N56A 3UNGC 1WC6A 3IXQA 4DUZJ 1VQ7S 1NDPA 1MU2B 1YJWS 3J7AN 2R4FA 5F8JA 1VQSA 4P10A 5CQGA 2DGVA 1EHWA 2J6SA 1OY6A 1MROB 4DV0F 2ZUAA 1VRTB 3W65A 5C25B 4ECWA 2QN6B 4XO0A 2F4VF 1ZZNA 3VVUA 3OLAA 4I69A 1WD6A 1X5OA 4H4KC 1R6VA 5HMYA 3RR7A 1BC6A 3ISZA 4DG1A 5DG8A 5E41A 2RILA 1QE1A 3QRQA 1RWMB 2H54B 1K47A 2FY1A 4I2QA 2P6TA 4DR1J 4CTAA 2IVYA 4EBCA 1SKRA 5EWEA 3HD2A 4WFBQ 2O3DA 2C2EA 2VC0A 4L74A 3OVAA 4DPXA 4LF6F 2RHSB 1WF2A 1KTQA 2MLZA 2B56A 2R2RA 2JX2A 2DEJA 4NYOA 4N5SA 1VFJA 2MZQA 4OX9J 4P2XA 3CDAA 1S0NA 5LSLA 5J1PA 3EICA 1NEEA 2EG1A 3D67A 2DGXA 3Q8PB 1Q0NA 2M88A 5K8MA 3WX8A 3OXLA 4WIIA 4JI8J 1RUSA 1XNQF 1UWBB 3AY0A 1YKWA 3BGUA 1JMTA 4IQXA 3FNNA 4LRDA 4DR2J 1TL3A 4RZRA 1WHVA 5DDPC 3BH6B 2EVZA 1UVMA 3CTRA 1APSA 2UVUA 1HHQA 4WFZA 5BYRA 5IOLA 3HM9A 2VBXA 4IDKA 4DPTA 4BBYA 2OP5A 2KHCA 2W2OP 1GH8A 2CZVC 1SV5A 4YHHJ 2BJEA 5ETOA 3BKTA 1CG2A 5GAHI 2V2QA 4IG3A 3C6TB 4ILLA 4U95A 5KFEA 2HURA 2C2KB 4RNOA 4TY9A 5EGYA 3DM2A 5FLXU 3PO4A 3N5BA 2Q3PA 2Z0GA 4M94A 4MKAA 3NGDA 4JI5J 2V4JB 2PA8D 3SBMA 1JJHA 1X8DA 5KFJA 5SZTA 3NNHA 3I5AA 2G2YA 1AZSB 4QIEA 2QX0A 3BDPA 4DR6F 2IYGA 5CYMB 3IM9A 4J9PA 2ZNYA 2QE5A 2V69A 3LP2B 1CS4B 2XS5A 2H4YB 1U1LA 4OI0A 4DU8A 3LGHA 2FLOA 2DNGA 1XR7A 3G87A 4HT5A 3BREA 4CQ1A 1QAYA 3OVBA 2VG7B 3HVTB 2QC3A 3TAQA 2LKZA 3JSYA 1PAEX 5HQMA 2XI2A 3TQEA 1CPZA 4L72B 1V5IB 2E1RA 1NJWA 2PI4A 1F0XA 4USTA 4DV4F 1XTZA 5ETVA 4B9MA 4DSJA 3BQ2A 3SFUA 1SH3A 4JV0A 1T03B 3W66A 1ZA2B 3KK2A 1C0UB 1ZETA 1DY3A 1DTTA 1ELOA 3MR2A 1RAGB 3M8PB 1AUSL 5J1EA 3P5BP 1VHIA 2ADBA 5KFWA 3PR4A 3KNGA 4B17A 4DFKA 2O01C 1VC5A 1RHMB 4M5KA 5KOWA 5L8RC 1RWKB 1Y0HA 4LF4J 4DUYF 3AJ1A 1EKSA 2BM1A 4ECUA 1FDDA 3OL9A 1VK8A 3W5ZA 1WEZA 1RWUA 2J9DA 3I9V9 2UXDJ 1D8ZA 4P7TA 4XTTA 2CKWA 2GJ2A 3ZTQA 4ID5A 1JLBB 4UTGA 5CCMA 4DCOB 3H5SA 4AL5A 2ZHBA 4OZNA 2DNHA 2HBRB 2YNIB 5E3CA 3DDIA 2CWKA 2HQGA 3K57A 3L7UA 4ZOSA 3KYLA 3HD1A 2PE8A 3WZ0A 1YLXA 4OQJA 5HVHA 1CLFA 1YBAA 1N52B 5D77A 2HVHA 5AXKA 2AJ2A 2OELA 4IUFA 4B3RJ 3K58A 1QAJA 4NZ0A 3D0IE 5ETLA 2CDRB 2AMCB 3K59A 1PYOB 1VQ8S 1YWXA 3AH6A 1NU4A 5IV4A 1T05A 2W9AA 1UAWA 2D69A 4OZ2A 1KEKA 2E44A 2XY6A 5KFRA 4K59A 2BQ3A 3KG0A 5M2PA 3OJSA 2HHHF 1B99A 1O0PA 3KLFA 3L4BC 3QBCA 2EFNA 2FVCA 2ABYA 4DSEA 3HHLD 5K14A 3ZO7A 4FF3A 2XBPA 5BXIA 2GHWA 3NGRA 5DRKA 4UZCA 5J2NB 4EMDA 1ZAWA 2KM8C 3CSKA 1S6QA 5GADU 5CCLA 4I2PB 2RHQB 1TL7A 5EX3A 3CC4S 1T0TV 4PR6A 2IM3A 1YSJA 1D1UA 4DR4J 1TMJA 3BSOA 2W8KA 1T3OA 2VB6A 5KFXA 4CRJA 2ZEJA 4CLYA 4MAKA 1UWAA 4FPRA 5HI7A 3CXCR 1U8WA 1HNXJ 4ATNA 2HRUA 2QTWA 4RBUA 1GMUA 3DCAA 3F41A 3VALA 2VD3A 1WG4A 4B3SJ 1A0OB 2VBYA 4Y6IA 4G1PA 1HWIA 1S6PA 1RAOA 4LF8F 5T7LA 3OD2A 2JDJA 1U6FA 1F9HA 2CQPA 4K4VA 1IBMF 4QJVA 2KJWA 2QEXS 2CQ2A 3EM1A 1SXLA 2VUGA 4DHVA 4NLDA 1PYTA 1SVDA 2BJ1A 4J9OA 4ZJOA 3DYAA 1CEZA 3CCMS 1X9SA 1WI8A 4WP8A 4BWMA 4JI2J 4JOUA 1HBOB 1JLGA 4JYAJ 1HHTP 4LFCJ 2HQFA 5AXLA 2M8DB 3M2RB 4WZQA 2W2QP 5KFGA 2FGOA 4A8MP 4X2BA 3HJVA 3K5PA 4GKJF 2J8AA 1CJTB 4DX6A 5IM0A 3KLHA 1VBZA 2MQNA 3MURP 3GYNA 2WONB 4PQUB 1MU2A 4DV6F 3S1TA 5F41A 1MW7A 3KHRA 3K2YA 4OYWA 4JV5F 5D78A 4NLTA 3UD3P 3R5JB 2K7KA 4ZVOB 2QA4G 1S5ZA 4AL6A 3MEEB 3MMCA 3UD4P 2I0XA 1LK7A 1MROA 2ZHAA 4XIUA 2ZH5A 2AGQA 3G6VA 1VRTA 5C25A 2VU5A 3Q8YA 3DGPB 1Z2ZA 4O3QA 3BV8A 4J9UE 4RW7B 1MNEA 1NH7A 4CWBA 4UOCA 1WORA 2R7TA 1LXNA 4Q44A 3CCUS 2W7OA 2B0GA 3Q83A 5HMXA 1DQ8A 2MQPA 3D5MA 1DHMA 2HMIB 1K73T 3SMZA 2HS0A 1FJGF 5ETPA 3WC0A 2WVFA 2R8GA 4BCAA 2FQQB 1KFSA 4ENOA 4DSKA 1HQUB 1ULRA 1VHFA 2VG5B 2DVIA 4OJGA 4DPYA 2M5YA 1S9EB 2QSFA 3VZHA 3A1YG 4WFAQ 1SC3B 4QOTA 1GXTA 1FXRA 4QWEA 4DV2J 1NDKA 3OR2B 1W2IA 1OYEA 3FZ2A 3N6MA 1Q8BA 1SJRA 2BACA 1FJ7A 1RWPB 1RTDA 3T19A 5L1JA 2E5LJ 5KG4A 1FTRA 4TXSA 3K5MA 4HDHA 4NE9C 2CQ3A 3GU0A 1UWBA 2CNNB 4JV2A 1ZOTA 1S9GB 4TY8B 2DHXA 4NLQA 4F2SA 3H0PA 3G4SS 3OTBA 3C16A 4AE5A 4B9VA 3NS7B 4FS1A 2EFQA 2AX0A 3M9MB 1LNQA 3DGVA 1TMMA 2XYPB 4CT8A 3CE8A 2QRRA 1LQ9A 1Q7YT 2GIFA 1JJ4A 1NO8A 3EGVA 2H3EB 4DOZA 1H7XA 2EG2A 2JRSA 1WSVA 1NZ8A 1R31A 2CG4A 3BKUA 1YBTA 1IQTA 1PJ5A 3C6TA 4L73A 2ZWOA 1TP7A 1M90T 2AJ4A 2MQQA 1JB0C 1Q1KA 3M6XA 2DR8A 1NDCA 3GV8B 3W9JA 3T5HA 5A8RB 1YZ7A 3EVMA 2V4JA 4MKBA 1FRHA 3GSDA 1E6YB 4F3MA 4NLUA 4B3TF 3KLGA 4DV0J 2D3OR 1O5JA 4LRAA 4ITSA 3P45B 1WHXA 3ELHA 3U1NA 4OZJA 2F4VJ 2BYCA 3AJ2A 3HFKA 3QGHA 2GO8A 2ACMA 4W90B 2HAIA 2MGZB 8RUCA 4RWXA 4USMA 1LW2B 5HBMB 3MPUB 2HSEB 1AW0A 1UVIA 2W1BA 3UDLA 3TAPA 1RDRA 5JXSA 2VG7A 4L76A 1JXVA 1VQPS 5IFMA 2Y0SD 2POKA 1EJ7L 2GAGC 5L1KA 2O1PA 2D9PA 2FHJA 4LIWA 3EVWA 1MWZA 2W4PA 2ZH6A 4LF6J 2AZ1A 1T03A 3W2VA 3GV7B 3DLGB 1C0UA 4HH0A 5CABA 1F5BA 3SIPB 1J5OA 1EKRA 2OIHA 3BB5A 1JXEA 4L75A 4QZVB 3M8PA 4ZPDA 2Y1JA 4ERDA 4DFMA 5IC6B 2JFKA 3DOMB 4F4AA 2C22A 2X3GA 2CWXA 2QLFB 3TJAA 4JP8A 2XYGB 1VQ6S 1Q82T 1SBRA 2DNKA 2OEMA 3RB0A 4X64F 2VPZB 2NUHA 3FUYA 1J27A 1NM2A 3VR1A 1U4BA 5IV3A 2ACYA 1XNQJ 1WC1A 4LUBA 1H6KX 3EYZA 3PACA 4OYZA 4MIWA 4NASA 3I5CA 5LL6d 3TOQA 1QAXA 4DV1F 3M8YA 2OSQA 1Q4RA 3FDSA 4HT7A 3FZBA 2CJXB 4R5PA 1K8AT 2YNIA 1V3ZA 4PPZA 5B0BA 4FKXA 1QLNA 4LT6A 1S1XB 2R9LA 2YWGA 1U6ZA 5LMUF 4I7FB 4F02A 3QGGA 1FERA 2J9DE 1U26A 1N32F 3OVSA 3DOKB 4ZPWR 3U1LA 3M6WA 2ZOMA 1H2UX 3X1LB 4ZPCA 2YX1A 1IQZA 4MMOA 4YB6A 1C1CB 4PG5A 3Q22A 3LP1B 2OSRA 2W9CA 2ZKUA 1FDNA 1ZM9A 4DV3F 4GVBB 2RQKA 3GYGA 5HVFA 4OYOA 3MECA 4JI1F 3OTOF 1NHUA 4USVA 3K89A 4TQRA 3MCNA 2KXHA 5FD1A 4DR6J 3U27A 2CYYA 4DQPA 4Q2LA 3IO1A 3MM7A 3QJLA 1XJWB 2O67A 3QWPA 4ZP6A 4CM0A 1RKIA 4W98A 2IRUA 2ZHOA 1T7PA 2QL5B 2GIRA 3RZAA 1MMLA 4PZVA 2WVDA 2BUNA 3SXLA 3CJ2A 2W7PA 2KDOA 4ELVA 5LJ3Y 2D3ZA 5K20B 4YOEA 4YS2A 1DURA 4DV4J 3IC1A 4WTYA 5KG1A 2XCPA 2KFNA 1X7VA 4YN3B 4PG7A 2AYGA 2M7SA 3SSQA 2PO4A 2CQDA 3NRBA 4DL5A 2RDIA 3CJ8A 2WHOA 3PW0A 3FMBA 3JQKA 1WC5A 2K06A 4IFYA 3IA0A 4U96A 1JWWA 6FD1A 3U1MA 2EK6A 2IHR1 5FDLB 4M5GA 2G2ZA 1JNRB 2J0WA 4I0WA 1HD1A 3ISND 1WUUA 2ZJPQ 4DUYJ 1RU2A 3I87A 2HQDA 1L3KA 2GGPA 1UZDA 2A3JA 2A10A 1EAYC 2RIJA 1B70B 1BQMB 3LQVA 2DHHA 1RYSA 4NRUA 3B8HA 2DEIA 3VWSA 5E3RA 3O8WA 4K4YA 1G3OA 1PSDA 3LP0B 2J6UA 1HBOA 4NI2B 4B3OB 1SQEA 2XI3A 2RDDA 2CQ0A 2F40A 4LF2A 5JVGQ 3PW2A 3ILLA 4ANCA 4ELUA 1AROP 3JSBA 3VGVA 5DGAA 1DQAA 1SIWB 2WSEC 1MSWD 1CJTA 2OD6A 2WONA 3MGJA 2FJWA 4ZHRB 2MZRA 1WI6A 1VK3A 4F3OA 4WKRA 2GMLA 1RAEB 2CJAA 5THWA 2MZJA 5A6WA 4E8UA 3RTVA 3SDEB 2YQ0A 5B0AA 2BEFA 1LW0B 3M6VA 5HP1B 1SKWA 1KWMA 2LQJA 2HHHJ 1UPPA 4J9LA 2GHPA 1H38A 2XMWA 1ZZFA 3FBFA 2C2ZB 2C2DA 4YUDA 2N4DA 4OHVA 3IG1B 3VAIA 5DM7Q 5M2RA 2IRYA 1U48A 5E3QA 3MOJB 5CD4H 3AHPA 3EWGA 2HMIA 2UV8G 3H2UB 1FJCA 5D0HA 1KDNA 3D1HA 4XDDA 5C42B 3HHKA 4UUWA 4HI1A 2AGOA 3BPSP 1HQUA 1RHUB 2Z2MA 2VG5A 2J9CA 1KVKA 1S9EA 1FKOB 3RYLA 1HMVA 2RSQA 2B5JB 2ROGA 3A3PB 5I3UB 1FF2A 2XULA 1QVFR 3OR2A 3P8BB 4LBIA 2NUUG 3OSNA 5KFLA 4LF7F 1R8PA 4GC6A 1JJ2R 4F4WA 2HHVA 2MPUA 2RRBA 3C2PA 4OZLA 2G4BA 1XMQF 2AJ1A 2HBQB 1HBNA 4O3PA 4LF8J 3I0RA 3ZZZA 2YQ1A 5CYQB 3B6BA 2R2SA 2YH1A 4TY8A 1IBMJ 4RNMA 1FDBA 2LU2A 1TUVA 1QSYA 5IS2A 8AT1B 3ET6B 3M30B 3PZPA 3DOLB 3D3BJ 3OJUA 2W4CA 2CDQA 2HK2A 1MN7A 4LR8A 3TEHB 2HWHA 2I1RA 2MLYA 2HRYA 2DR5A 1LWFB 3CCVS 4GKJJ 1VQNS 1X4FA 1RTJA 3CCSS 1TR0A 2K1RB 2HFUA 3QAUA 4DV6J 1IKXB 1WG1A 1VC6A 3AOCA 1SL2A 3QFWA 5A8RA 4RUAA 4USHA 1EETB 3RBDA 2HLTA 4J9QA 1Z1ZA 4EYHB 3IRWP 3HMJG 3RBZA 2IM2A 2RF2B 3TJ8A 1N54B 3PVXA 4C8OA 3UWTA 4RU9A 1SCJB 2L48A 3QNWB 3H5XA 1SB6A 2CQCA 1S57A 5AXNA 4NCBA 3IR7B 2ZBQA 2BJ8A 4ZJQA 3V81B 4PWWA 2ZC4A 1FNMA 1RHJB 2GVZB 4NL5A 1RAJA 2G0IA 3NGTA 2MGZA 3R2CJ 1QSSA 5B09A 2HFVA 1F5CA 3UVJB 4IQMA 3LGNA 4FXWA 4CLPA 4TKTA 2ZBPA 2LMIA 1QDUB 4LSNB 2LEBA 1U8SA 2XZDB 1FJGJ 2PDAA 5KFTA 1LFPA 5KT6A 1DRZA 4ELTA 4DX5A 1PG5B 4C8MA 1UPMB 1P1LA 4PG6A 4QYZK 3DLGA 2QG9B 3ENVA 1Q8LA 4NCGB 1Y5IB 2RU3A 3MMBB 2D1CA 3GIIA 3GCWP 1IUJA 3DOMA 2XS2A 2YWEA 2WTFA 4A8SA 1X4EA 1WJ9A 3RAXA 1M5KC 3O44A 3KMSA 3JXOA 1LXJA 2J0SD 2V4RA 4R0JA 5CYJA 4KHPF 3OTCA 4ZPVR 2J6TA 1NSQA 1BWVA 3M9OB 3BF4A 4CDIA 1D8YA 3ILOA 2JL9A 4RLEA 1NKEA 1TU0B 4NEZA 4RX6A 2UUAF 3KWMA 5DM6Q 1RA7A 2EKNA 2JHEA 2W01A 4BWJA 1WOSA 3VGSA 2MKSA 3C6UB 1H2VZ 4PEOA 4Y2IA 2RRAA 2ZOGA 1S6OA 2YKMB 2B3TB 2BVZA 2XQCA 1X4BA 4IH7A 1XK8A 2CNOB 1S1XA 1NJXA 3SCKE 2F65A 3W1YC 2HBYB 2DHGA 2V94A 1RT2B 1IJFB 4ZS6A 5KFZA 3NEKA 3PW4A 4X4QA 2B9WA 2KRRA 4C8LA 2C2OB 3J7A1 5KFMA 1GMVA 1C1CA 1VBXA 3LP1A 1PILA 3RAMA 3TZZA 2IM1A 4V19X 4GVBA 3V6KA 1OYDA 2ZUGA 1DBDA 4IOBA 2KZZA 1RU1A 2YXLA 3DFEA 3T9NA 2ZKTA 2ZC3A 1R8AA 2GA7A 2WVBA 4OJ1A 5KFSA 4B9LA 1SJ4P 4B3TJ 2Q66A 2H48B 4HKQA 1S79A 2V5HG 4PPDA 2WSFC 2BBEA 3S7RA 2JVOA 4LBHA 1Z2LA 1NK9A 5B0FA 2H4WB 3G71S 4C8YA 4YR0A 1VQ4S 4X4OA 2D3O1 5H9FJ 1FTCA 1KHVA 3K7RA 5IT9U 1S0VA 3P6YC 2QA1A 2F7VA 4BHQA 4KO0B 3B4MA 2HWTA 2KI2A 2CQGA 3UN5A 3T6BA 3KLEB 4QR1A 1QUVA 2I9SA 1ZPVA 5EDWA 3ZZUA 3KLIA 2FD2A 1YJVA 2FHJD 4Q0BB 2UZAA 3R1LA 5LXRA 2OD4A 3MTJA 1REGX 2Z8QA 3IGNA 4KFBB 1BWEA 1S7HA 3H4BA 5E7OB 2D3UA 4PABA 1HW9A 1JLFA 5GVQA 1CJKA 4CCHA 3RG6A 1QVGR 3G82B 4M5LA 3MEKA 2EFVA 2XZTB 1Q81T 3PYFA 2ROPA 4UY85 1N5QA 2BXJA 4QQBA 4KH0B 3R7NB 2IMWP 2DH7A 1RT3B 3CB4A 1JXLA 1ZA1B 4OI2A 3FBBA 3NCPA 1FX2A 2H5JB 3CDEA 3OFHA 2LEAA 3MD3A 4X64J 1HNIB 4AFFA 4NLSA 1GFWB 3KFWX 4OHWA 1M0SA 2VPWB 4ICLB 5AE3A 2PT0A 2KYXA 1ITPA 5SUHA 1HBMA 4FF2A 4B3MF 1FRXA 2QLXA 2BJ7A 2PGCA 1BQMA 3G8QA 2BV3A 4DV1J 4A8FA 1RT1A 2RAQA 5HLFB 3KJNB 4P2FA 3PYEA 3UDCA 2BA9A 3WHIA 3BBBA 2V63A 1VDHA 4ETXA 4NI2A 1XIQA 1UP1A 5LMUJ 2DR7A 2MQOA 1U7LA 2PI5A 1N32J 1KKHA 4QIWD 3L7OA 3ILIA 2A2DA 1H2TZ 4DWIA 1AFJA 2VODA 2XWXA 4JV1A 2ERRA 2V68A 2E5JA 2EXUA 3H98A 4M5JA 4WIQA 4K4TA 2LDYA 4GMKA 3THTA 2AYBA 1TL4A 1D9FA 1U02A 1J2VA 5K8OA 3CO0P 3SDEA 1L5UA 1CVJA 3L09A 5KTQA 1CJUB 5HAOA 1HD0A 3CJ5A 3P5TL 4JI1J 2AHOB 3OTOJ 4KV8B 2R8KA 1TV6B 1FWLA 3EZOA 4CO3A 3SCLE 1UZHA 2NXCA 4V1Ak 4CLFA 1S1WB 3EPIA 4DR5F 2NYHA 3SZ2A 2OHDA 3IG1A 5D0RA 2XYHB 3H40A 4P74A 4ZVPB 3OUYB 1FA0A 4UQGA 1I3OB 3Q2SC 1FNXH 4MFBB 4OLPA 5LMNF 1UVJA 3KUHA 3DI6B 2OPSA 5C42A 2IPOB 5DG7A 4BC9A 2QLWA 1EIYB 1KNZA 1UL3A 3R7BB 4OJ3A 1QUPA 3N5FA 4JI5F 1Y4ZB 1FKOA 4HHHA 3K8WA 2ZH3A 1PCAA 3ILJA 4I6YA 4CO0A 5L9XA 5I3UA 3JAMY 3PX6A 1LWCB 1U45A 3HHLC 1GT8A 2L9DA 3GR0A 5D0GA 5EWGA 4FYDA 3TEGA 1T9TA 1CJVB 1YDLA 4DUTA 1HL6A 2DO4A 2HS4A 1ZYQA 1FHTA 2OTJS 5CYQA 2BDPA 2DGQA 3MAAB 3MOZA 2KTQA 2IYIA 5F3ZA 3VAFA 2VG6B 2CQBA 4J9MA 2ZOFA 1SC1B 2CZ4A 1SQFA 1WOOA 2VASA 2HHUA 3OT9A 1NCLA 1WDDA 1XERA 3TRGA 3DOLA 3GJTB 1Q86T 2B6AA 2JLEA 3KK1A 2CZ9A 2UP1A 2DD8S 3PDNA 3DMJB 4ED2A 4B02A 3DXSX 3OHAA 3BBCA 2NZCA 3DU6A 1R3NA 2MHEA 3CIMA 3G6YA 2GHVC 3WQPA 1S1VB 1LWFA 2MDAA 4OIXA 2FZKB 3AAWB 2VPYB 2VZ9A 3IP0A 5KG6A 2HHTA 4N41A 1DTQB 2K1RA 1I51B 4KTQA 2OH2A 1IKXA 2XZWA 4J9VA 4U7CA 4EEYA 4HDGA 2NYIA 4H4MB 2V2VA 4AQYF 1EETA 2E9ZA 1LKZA 1YX2A 3M4XA 3GTYX 3SFGA 5D8HB 5GAEU 1NBEB 2WSCC 3M1VB 3FJ2A 3V81A 3NOCA 2L9NA 4DF8A 2GVZA 3AODA 3GWCA 2V50A 3IR6B 1T3NA 4CLUA 3EGZA 4RUBA 4RO0A 1YBUA 3FBCA 2FPHX 3LW5C 2Q1LA 3HXMA 4K8RA 3FFIB 4LSNA 2BZ2A 5KFNA 2I5JB 1T02A 2BRLA 4NLRA 4NEYA 4Z2XA 2EFGA 1ZPWX 2OLWA 3I5BA 4EBEA 4MIAA 3C14A 1WF0A 1BXNA 2NSCA 4ZVQB 2IDLA 4HHUA 2ZZMA 4DV5F 3M6UA 4N7TA 4ANDA 3ENQA 2IRXA 4Z37A 5AJ3F 2MZSA 1MMDA 2X51A 3P4UB 3EXYA 2OJ3A 4NCGA 3R3TA 3MMBA 4FVCA 2CNKB 3VHQA 3H7HB 3HVAA 4LF7J 2JZ5A 3PTWA 1H98A 5HROB 3EXCX 2BANB 1NJYA 4KHRA 3AOAA 1XMQJ 4Y2MA 3DRPB 4ZVFA 4KGXB 5F8LA 3WX4A 4LVNP 4C11A 1FE0A 3SV3A 1PC4A 5D4NA 2AYMA 2LLZA 1Q5VA 3V6DB 1C4AA 4K4WA 2CPHA 5D3GB 4PXCA 2OO4A 3CDWA 3EGWB 4B9UA 1P8GA 3C6UA 1AB8A 3QATA 3M32B 2G13A 1LK5A 2HGMA 5DJBA 1NK8A 4RW9B 4N47A 2K3KA 2MXYA 4P6QA 4KR0B 2ASYA 3D1QA 2V8VA 4PG8A 1P6TA 2XSFA 3ZZTA 1GXUA 3AD7C 2NQPA 4ED0A 3ENAA 1F5AA 3NG8A 3M9NB 5DO2A 4DS4A 2A6OA 1RA6A 1YTYA 4ZMMA 2K3IA 3CJQA 4Q8EA 1REVB 2D41A 1BY9A 4K4ZA 1RSCA 2FVSA 5JUMA 1Q79A 3RB3A 4WCEQ 1ZM2A 3E8OA 5F8NA 4PAAA 3VCDA 3G9CA 3IS9B 2Z4PA 3PO5A 3OSPA 3CT9A 1DZ5A 2VDHA 1S7IA 3LANA 4EU0A 5KT4A 3UQSA 1JLEB 2IC3B 2C1EB 1UA0A 2GMJA 1NK7A 3CMAS 2PN6A 2ATCB 5J2QA 5E3AA 2KYZA 4EWTA 2R8IA 2KT2A 2GFFA 4FS2A 3DHXA 2F9JA 3QT8A 1R0CB 2FHOB 5I3QA 4KO0A 2PFDA 1R7IA 3UR3C 2B9EA 1U25A 4KJIA 3KLEA 1WOPA 2GVDB 1Y00A 1RLDA 4LR9A 3AD9C 4C8NA 1KVJA 1GMWA 1S48A 2V2ZA 2N82B 4P52A 3N6NA 3MPVA 4A47A 3UNYA 4PCQA 4OV1A 2W8LA 2O5DA 1YK9A 4KFBA 3PX4A 4NMLA 2BJ3A 2RS2A 1TK5A 1SIZA 3QMQA 9ATCB 2HNZA 2CIMA 1DLOB 1VLOA 3G82A 1F3FA 5B0DA 2VIHA 1N56A 2N4CA 2G9OA 3BDEA 2YNGA 4YY3F 1Q7LB 4AT1B 1UKUA 5GMDA 2VA3A 1RT3A 3W8PA 1RWOB 4S0MA 2DIUA 3RGIA 5JVHQ 4FYVB 1GEHA 4DQSA 1U1OA 2ZH7A 1HNIA 2RU9A 4MK7A 3RRHA 4KHPJ 1URRA 4U7UD 1YRTA 1AA1B 2MKJA 2VV5A 3E2EA 3ZTSA 4FXDA 3QO9A 1RAIB 4OYXA 4DSIA 3TARA 2FIUA 2HG4A 2UUAJ 2CJ9A 1FVQA 3UCGA 4YQWA 1CULA 2DGUA 1X9WA 3PKYA 1N5TA 4K4UA 2XWYA 5HLFA 3UDEA 4EYIB 2JOQA 1XQIA 4OYBA 3LF0A 5HL7Q 2HPUA 2CPZA 1HWUA 4DPWA 2FLPA 4OLOA 1HLWA 3MUVP 4ZP7A 4ALZA 1KS2A 2HHPA 2HZCA 3CJTA 3UN2A 3DLHA 5M2UA 5H9EK 1IR0A 2NS1B 1MWQA 1ZM4A 5DQGA 4ANEA 3IAM9 1RHKB 3R5CA 2I8EA 3NAIA 4KPYA 4DL4A 2DNOA 1S77D 3CMQA 1RZMA 4F26A 1P9QC 2QFIA 3D7SB 2E5HA 1VBYA 2DGSA 2J7UA 4RUHA 1CJUA 3EE3A 5F0UA 2BQUA 4MK9A 1NH8A 3NGKA 2R7RA 4KV8A 3MEDB 3DLJA 1WG5A 1TV6A 1FKPB 3C8YA 2IAJB 3PIOQ 2A18A 2MJNA 1OIAA 3DRYA 1KQKA 5E2QA 2GO9A 4JB8B 2EK1A 4JI7F 4F0HA 4F4ZA 4O3OA 3J80U 2E7XA 4YB5A 3A4TA 2XS7A 3P49B 2YKQA 3FC9A 5C5JA 2CADA 4D3GA 2P9CA 5EUHA 4WXOA 4UOGA 4MFBA 2R3VA 3MHYA 2BOAA 4YDDB 1X0PA 3QIPB 4C48A 3K5LA 4M5MA 3MPYA 5RUBA 2Z58B 4KE5A 5KG0A 3GIMA 1FO1A 3MCMA 3DKDA 5KFDA 2E66A 4Y2CA 4PG4A 2XY7A 3DRSA 3CCJS 4ZPAA 1K44A 4IH5A 1U2FA 1OWXA 2AD9A 1VISA 2DB1A 3IRXB 1X0FA 4DLGA 1S72S 3GB0A 4LVOP 4OX8A 1HI0P 4UF4A 1LWCA 3FMWA 3NNAA 1JLQB 2BKPA 4NA1A 1JQGA 4C3KA 3KXDA 1JLAB 1N5YA 3PRVA 3SCIE 2X3DA 3PRBA 3PM9A 4DLEA 2QO3A 2DXFA 2MTLA 1RCXB 4DSFA 2KT3A 3A8EA 3ICLA 4HL9A 3I4PA 2V34A 3MWBA 3E51A 3Q8SB 2AGPA 4RUCA 4B3MJ 3NMRA 2XEXA 3MM6B 4QW9A 1KD1T 3W9HA 2MQ8A 3HHEA 2UXCF 2B7BB 1NLKL 3Q0AA 2JJ4D 1H7WA 3DNCA 3W9IA 4L6V3 2RUSA 2R7WA 1H0HB 1T9UA 4J9NA 1IR1A 2IY5B 3J7YU 3O6QA 2H5EA 2K7JA 2QLBB 2DBBA 4OV6A 4RW4A 1K9MT 3DMJA 4TNOA 2IVFB 1Z4UA 2MKYA 4PXEA 1FKAF 1WKLA 1S1VA 4ID8A 4KPCA 3HFVA 2OEKA 3MXHP 2ROEA 1JKHB 5JJBA 2WW8A 3ISNC 2MSTA 3CCQS 4PWUA 3PW5A 2GQ2A 5A8KB 4ED1A 1DTQA 4C3MA 4A8OA 1RT7B 4R0EA 3MCSA 1W26A 3JYTB 2DCUB 3ZTOA 2XHWA 3IWXA 2CUYA 3R8YA 2MZ1A 3C19A 1EP4B 5IT9Y 3M1VA 3M8QB 4KSEB 3VAJA 5ETQA 1HHSA 2KO1A 1NK4A 1BQNB 3ZC4A 2V9WA 2YNFA 4C0HA 4R8UB 1N5VA 4ZVGA 4DR5J 4AUKA 1NHVA 2BE2A 1PYSB 3DHWC 1NJZA 1NB2A 4UOHA 3CW2C 2DNQA 5A2QU 3AB4B 1HQEB 2CA9A 2I5JA 4XAKA 4NLYA 3TR5A 3RB4A 2GC8A 5LMNJ 1TKDA 2HNYA 4LF1A 5GMEA 4LRCA 1NJIT 2HBZB 2KH9A 3BO3A 4Y34A 3GJQB 3BSAA 5J2PA 4USUA 1S97A 2VDIA 3GPAA 4PWDB 2FHKA 2NXJA 3T6JA 1NKBA 2B4OA 1RABB 2OUGA 1VRUB 3EDQB 3L7PA 5LM7E 1L3UA 2EFPA 1FEEA 5J1NA 2H5IB 2HKEA 5HROA 1W2BR 2BANA 2HFZA 1U1MA 3CCES 1SJQA 2BE7D 3DRPA 4EGLA 4GO5X 4JI6J 3LALA 1VC0A 2P5VA 1Q95G 4NA3A 2N3OA 4YR3A 2Q6CA 3UCUP 1F9FA 2DH9A 2NZ4A 1GXLA 4ZCIA 2RUGA 2XMJA 5IT4A 1I5OB 1W7WA 2W9BB 5D3GA 3OR1B 1IXKA 1F2GA 4NZ7A 3HCXA 1UEUA 1XR6A 3EMTA 3M32A 4I64A 2YPZA 4FBUA 1RADB 4KKOB 4I67A 1G7CB 4RW9A 3MR3A 2ASLA 2QA4S 3DLKB 3ITHB 3SV4A 2RJZA 2YWKA 1FEHA 4IYQA 1RAHB 1N6QB 4DQQA 1OMSA 4ZLPA 1IWGA 1N33F 2F8EX 2YKAA 5A0YB 5A6PA 1VQOS 2HK3A 2KB2A 3VAMA 1N0VC 2CG8A 1PO6A 3DRRB 2OFHX 4WWSA 4ZCLA 4F4YA 3IS9A 2W2NP 4AQYJ 4DS5A 2QT7A 4DL7A 1UTAA 1Y3KA 2C3PA 4LF5F 1JLEA 5IWAF 2IC3A 4TLRA 5HQ8A 4IG0B 3TVZA 1IBKF 5KFCA 2HNDA 2Z56B 2PEHA 3A8IA 1FFWB 2IJRA 3G86A 3K5NA 1O6XA 4WK1A 4WFXA 2GVDA 3GSIA 2YX7A 2B8QA 2MYFA 4LR7A 3HVWA 3R5AA 3PEHA 1NSKL 2DISA 3BJYA 2IA0A 3A12A 4F04B 5MLCV 3FBEA 2I6WA 1SKSA 3AXKA 3ADAC 5BJRA 2L9WA 4CNYA 3GG0A 1UFWA 4OZ3A 1HA1A 2CFXA 4DV5J 5HJXA 3TQ1A 1DLOA 5AJ3J 2XM3A 3D4JA 3QJJA 3I6PA 1SL0A 2AJ0A 4BC7A 1SJ3P 3TZYA 1ZTTA 1I6JA 4DG1B 1HQ2A 3F73A 2UUBF 1QE1B 2J0QD 4MTPA 3Q23A 4USIA 3Q86A 1KONA 2E1MC 3BO4A 3BYRA 4I2QB 4KH1B 4OZ0A 2DRDA 4J5OA 1OQ6A 4CTAB 1BUXA 3D1OA 2CQHA 3G6ES 3HDSA 4O3NA 2E1CA 4YB7A 4LF9F 2VL1A 4KBIA 1FXLA 1WELA 3SQOP 2Z2ZA 3A3NB 3PEJA 4XPEA 3T5LA 5F3TA 1TFWA 2WVEA 3FSXA 3BQ1A 4ECYA 1IJEB 4TU9A 2JSXA 3NS5A 3H25A 1RWWB 1VQYA 2EWHA 2DIVA 2H65B 3KHGA 2LA4A 3CC7S 2DNPA 4OI4A 5HMWA 4HEA9 5A8WB 4RJVA 1NSPA 2B51A 2X1GA 1TKZB 2PD1A 1VCTA 3TI0A 5IT0A 4E98A 2BM0A 4Q43A 3FEYB 4DU7A 2VF3A 2HQIA 3AB2B 2GIQA 2GW8A 2YY3A 3TAMB 3DLLQ 4LJMA 2AWZA 1UFKA 4ILMA 4O0NA 2B7CB 2LFVA 1WTFA 1KTVA 2ZH1A 4ZVRB 3IR5B 2M8HA 2JEIA 1HIYA 1YRXA 3CDBA 1NXIA 3B4DA 3PJWA 1QSLA 3D66A 1ZBTA 1PIEA 3HLUA 3VQTA 1OS5A 3HSGA 5DDRC 2MQMA 3MCOA 1R0AB 4IOAQ 4IDKB 4RNFA 4OYAA 4DX8H 1HFEL 4KT0C 1FKPA 3MMAB 4L3KA 2HZVA 4KGVB 4MK8A 2IAJA 3M8RA 1HBUA 3MM5B 1GMWD 1CC8A 4ZVHA 3H42A 3RRGA 4NZ6A 5ADZA 3PYDA 3OQ2A 3PFEA 2E7WA 5KFVA 3SQGA 4DSLA 1T9WA 2F4FA
chains in the Genus database with same CATH topology
4MJKA 3V5RA 4A4JA 2B56A 2R2RA 2CVIA 2JX2A 2QMWA 4C8KA 5G0RA 1CSJA 2FC8A 4NYOA 2OPPB 2AJQA 2DHGA 2OFGX 4N5SA 2UUWA 2XG8A 2X1FA 1XMOF 1VFJA 2MZQA 3AA9A 2V94A 1RT2B 2F1FA 3QIPA 3UI3A 1IJFB 4ZS6A 2F9DA 1U1KA 1GNKA 5KFZA 3CDAA 1S0NA 2B9XA 5LSLA 4CI0B 3PW4A 3DLEB 4X4QA 2B9WA 2KRRA 5J1PA 4C8LA 4A8YA 1NEEA 1P27B 2EG1A 2ZFHA 4QR0A 3QPIA 3J7A1 5KFMA 1C1CA 2DGXA 1VBXA 4URQU 3LP1A 5EWFA 3BSCA 1PILA 3RAMA 1QY7A 3Q8PB 3H5UA 2IM1A 3GFHA 1V6HA 4V19X 5L38A 1UJ6A 3V6KA 2M88A 4NXMF 2ZUGA 1DBDA 4IOBA 1URNA 5K8MA 4BS2A 3OXLA 2KZZA 4WIIA 3DFEA 3T9NA 3IRXA 5LSRA 1XNQF 2ZKTA 3D28A 2ZC3A 1R8AA 1UWBB 2GA7A 3AY0A 3BGUA 4OJ1A 1FRIA 5KFSA 4B9LA 1HWLA 1SJ4P 2Q66A 1JMTA 2DCLA 5DG9A 4EO8A 3U7JA 2RE1A 4HKQA 1HBMB 1S79A 1JLQA 2V5HG 4PPDA 3TUJC 1WEYA 2WSFC 4IQXA 1LWEB 2BBEA 3S7RA 2JVOA 3FNNA 4X4TA 1Z2LA 1NK9A 1TL3A 5B0FA 2UU9F 4RZRA 3G71S 1WHVA 5EHHA 5DDPC 1DARA 1JLAA 4C8YA 4YR0A 2P9GA 1VQ4S 1N48A 4X4OA 2EVZA 3OHBA 5H9FJ 1UVMA 1FTCA 2FJBB 4DBQA 3CTRA 1HW8A 1KHVA 1RT1B 2XNQA 3K7RA 4AXIA 3KLVA 4FVMA 1S0VA 1APSA 2UVUA 2QA1A 2F7VA 4BHQA 4KO0B 3SSSA 3P6YC 4IRKA 4KB7A 4KGMA 1B0PA 3B4MA 4WFZA 2HWTA 5BYRA 2KI2A 5C24A 2CQGA 3T6BA 3KLEB 4I1TA 4PQAA 4QR1A 1QUVA 2X1BA 4RBTA 3G6XA 3HM9A 2B4UA 2RNEA 2I9SA 4K2XA 2VBXA 2R7OA 1ZPVA 4IDKA 5EDWA 3MM6A 4BBYA 2OP5A 3ZZUA 2KHCA 3KLIA 3RBEA 2FD2A 2CZVC 1GH8A 2DO0A 1YJVA 3MZIA 4IOCQ 2FHJD 1SV5A 4Q0BB 1I94F 5GADI 1TK8A 2UZAA 2VC1A 3R1LA 5LXRA 1B64A 3D0HE 2BJEA 1BD6A 4QIGA 1CG2A 5GAHI 2OD4A 2YKMA 3VAGA 4IG3A 4W92B 2KHDA 3C6TB 2E9RX 4ILLA 3MTJA 1GTHA 2V8DA 5FLXY 1ZAXA 2Z8QA 3IGNA 4KFBB 4HTIA 1BWEA 1S7HA 3VAKA 3JTNA 2XSJB 5KFEA 3H4BA 1X5TA 5E7OB 1UMJA 2D3UA 3HX9A 4TY9A 5EGYA 3QWUA 4RNOA 2FJVA 2IVMA 1HW9A 1JLFA 2EW9A 3DM2A 2C42A 1R27B 5GVQA 4KAIA 3PO4A 1TK0A 4CCHA 2PFFB 4G3IA 3N5BA 2R7UA 2KXFA 1RT5B 1VQKS 2AP6A 2Q3PA 1QVGR 2DPJA 2Z0GA 1L3VA 2YKNB 4NCAA 4B9NA 3MEKA 2EFVA 4CH0S 4M94A 4MKAA 2R7SA 3NGDA 2FGCA 4Q45A 1Q81T 4QU6A 1UJ4A 3RAQA 2V4JB 2ROPA 2PA8D 4UY85 4OI3A 1N5QA 4AL7A 2BXJA 2DNRA 2FHMA 1JJHA 1RT2A 4QQBA 1LFWA 4Q5VA 1KLMB 1JKHA 4G1QB 2IMWP 1X8DA 2K8GA 5KFJA 2DH7A 1RT3B 5SZTA 3CB4A 1JXLA 1VOMA 3NNHA 3US5A 2BRKA 3I5AA 5A8KA 1RYRA 4OI2A 3GFYA 3NCPA 4QIEA 2RKIB 4MH8A 3ZZRA 1WTBA 2HFOA 3PY8A 3V4MA 3CDEA 3KJVA 3BDPA 5J2MB 3OFHA 4DR6F 2LEAA 3MD3A 1HNIB 2JH3A 2XO7A 4AFFA 3KG4A 1UEVA 2IYGA 4NLSA 3BN4A 5CYMB 2YH0A 4J9PA 3CD0A 2KVIA 2QE5A 2ZNYA 4LIRA 3LP2B 3KFWX 1ZTWA 4EZ6A 2NR0A 2XS5A 4OHWA 1M0SA 2IJFA 2VPWB 4ICLB 5AE3A 4KIAA 1U1LA 3UE2A 4OI0A 2FLOA 2G0CA 2PT0A 4U67Q 2KYXA 4A48A 2DNGA 2FVQA 5SUHA 4OX6A 1XR7A 3UFCX 1G6BA 1HBMA 4FF2A 4B3MF 4HT5A 1FRXA 3BREA 2CPIA 2QLXA 4RW8A 2VFUA 4CQ1A 1EP4A 1QAYA 4ED8A 2LVWA 2CJBA 3M8QA 4FN5A 2XGPA 3OVBA 3CD7A 2VG7B 2PGCA 3OFFA 1BQMA 4M95A 3HVTB 2ASDA 4WKYA 3TAQA 3G8QA 2LKZA 3JSYA 5E33A 2CPDA 2GX8A 4AXJA 2XI2A 2VFVA 5D4LA 4R8UA 2BV3A 1CPZA 2XMKA 1RT1A 5KT5A 5HLFB 4A8FA 4L72B 3LOUA 2E1RA 2PMZD 5KG2A 3UDCA 3BSNA 1D9AA 7FD1A 4FP9A 6FDRA 3MM8B 1NJWA 2PI4A 2OPSB 2BA9A 4IFVB 1F0XA 4F25A 1A7GE 1FK9A 4DV4F 1XTZA 4ETXA 5F9NA 4B9MA 4DSJA 4NWBA 3ETOA 4OI6A 3BQ2A 3SFUA 1SH3A 3CJ3A 1UP1A 4JV0A 1T03B 3MDFA 2YKPA 3FEXB 4O44B 2DR7A 4Q0BA 1HQEA 4K0KF 1A9NB 2MQOA 2DNLA 3KK2A 1YJRA 4H54A 2QSWA 1C0UB 1U7LA 2PI5A 4O0IA 1ZETA 4C0OC 1T05B 2XY5A 3ZZPA 4QIWD 2HGNA 3L7OA 1DTTA 2L41A 1ELOA 3D54A 4HH1A 2A2DA 3MR2A 3M8PB 2EBGA 2UXBF 1H2TZ 5J1EA 2ADBA 5KFWA 4DWIA 2VFRA 1IKWB 2RMLA 3PR4A 4YMEA 3C3LA 2HVIA 1AFJA 2VODA 4LQ9A 3KNGA 4G6VB 4B17A 2XWXA 4DFKA 2O01C 4JV1A 2WOMB 4I56A 2ERRA 3M2UB 1VC5A 2DNYA 2E5JA 3H98A 5KOWA 1NK0A 3E01B 5L8RC 4K4TA 2LDYA 1Y3JA 4GMKA 1Y0HA 3THTA 1TL4A 2U1AA 2AYBA 1D9FA 4UUXA 5CZVA 1CQNA 4DUYF 3AJ1A 4GO7X 3GR1A 5I3PA 1J2VA 5K8OA 4PWDA 2RB7A 2BM1A 4ECUA 3HO1A 3SDEA 3BS9A 1L5UA 1FDDA 4D3HA 1CVJA 3L09A 5KTQA 3OL9A 1HD0A 3CJ5A 1KOHA 1VK8A 3P5TL 4I68A 4I6AA 1VRUA 1Y9OA 1WEZA 4GC7A 1RWUA 2J9DA 2FUG9 2C3YA 1HNZF 3S01A 3I9V9 5B7WA 3N01A 1IKYB 1VS3A 4X4VA 1D8ZA 2QYCA 4P7TA 4KV8B 3OV7A 2R8KA 1TKXB 2V8HA 4USJC 2CKWA 3BEGB 2JEJA 2GJ2A 5CYMA 1TV6B 4J9RA 4CO3A 4ZKAA 4ID5A 3SCLE 1JLBB 3LP2A 2QV6A 2DGOA 2YNHA 4ICLA 1IM4A 5CCMA 4AYBD 1S1WB 3EPIA 3H5SA 4DQIA 5IXUA 4DR5F 4URGA 2B6AB 3NWGA 3IN5A 2FDNA 2RS8A 3IBWA 4OZNA 2ZHBA 2FJDB 3SZ2A 2DNHA 2YNIB 3IG1A 5E3CA 3KK1B 3K57A 1F60B 4DDFA 3VAHA 4HLBA 4ZOSA 3H40A 4WYWA 3OUYB 3I0SA 4LSLB 4PKDB 4QWDA 2W9BA 2SXLA 2WB4A 2DJWA 3HVTA 4RNNA 3KYLA 2KXNB 1FA0A 5HO4A 3FGVA 4UQGA 2PE8A 3WZ0A 2ZE2B 2LDIA 1M5HA 3Q2SC 1FNXH 1MWYA 3B78A 4OQJA 5EN1A 4MFBB 4OLPA 3OFGA 4XDCA 5LMNF 2R2TA 1CLFA 1UVJA 1YBAA 2KG0A 2JLFA 1N52B 1IKVB 5D77A 2HVHA 3DI6B 4ZVEA 3HHDA 2OPSA 5AXKA 5C42A 4NXNF 2ZH4A 4KKOA 3D2WA 5DS7A 4N77A 4IUFA 1VQ9S 3JSMB 3K58A 5DG7A 4BC9A 2QLWA 1QAJA 4NZ0A 3TVKA 3D0IE 3OL8A 4ZCKA 3ITHA 1OSCA 3K59A 3W3SA 3KK3B 3VZIA 4JI4F 2OPQA 1YJ9S 1KNZA 1VQ8S 1YWXA 3QAEA 2VPXB 1UL3A 2DITA 3AH6A 4OJ3A 1QUPA 1NU4A 5BYQA 1UVNA 3N5FA 4JI5F 1T05A 2OMLA 2W9AA 1UAWA 1Y4ZB 4CIOA 1FKOA 2W24A 1KEKA 3RB6A 2E44A 2XLIA 1FNOA 3K8WA 1N6QA 2ZH3A 1M5PC 2XY6A 1YJNS 5KFRA 4I6YA 3MAQA 4KRWA 4CO0A 4WE1A 1FD8A 4ETZA 5L9XA 5I3UA 2VH7A 4K59A 2M3DA 2BQ3A 3KG0A 3JAMY 2LEPA 3TUZC 5F9LA 3PX6A 4WJBA 5M2PA 1LWCB 2R7QA 3OJSA 1U45A 5A0YA 3HHLC 4TN2A 2HHHF 1S0OA 2AQ4A 1GT8A 2L9DA 3GR0A 3CJ0A 2ZH9A 5CHCB 1O0PA 5EWGA 4URSA 2UUTA 3KLFA 1W25A 4FYDA 1S6UA 3MM9A 4C97A 5F8HA 2KFYA 3N79A 4A46A 3DRRA 2EFNA 3DYAB 1S10A 2FVCA 2NREA 2UVVA 1HL6A 2MQLA 2ABYA 3QIDA 1HI8A 2JFDA 3HHLD 2ZM6F 2DO4A 2HS4A 4EBDA 5K14A 4DSEA 1XMBA 1ZYQA 2XBPA 4FF3A 1FHTA 2OTJS 5CYQA 4NOHA 1O8BA 3I55S 2BDPA 2DGQA 3H8YA 3N28A 2GHWA 4TLQA 3MOZA 5DRKA 4IR9A 4Q8FA 2IYIA 2KTQA 2H9ZA 5F3ZA 5J2NB 3VAFA 1ZAWA 4IG0A 5KG7A 4WU2A 2KM8C 2VG6B 3CSKA 2CQBA 4X4RA 3GILA 1S6QA 4J9MA 2DRBA 2WBRA 3SSRA 2ZOFA 4DJBA 5GADU 4F4XA 2CZ4A 5CCLA 2ILYA 2VASA 2JLGA 4I2PB 2IM0A 1JLBA 2HHUA 3H20A 1S1TA 1GTEA 2X1AA 5DLFA 3CDUA 3T1YF 4TQSA 4A8KA 2DPIA 1XERA 4PUOA 3TNVA 3J80Y 3TRGA 1S1WA 2HHQA 4YDXA 5EX3A 3DOLA 3BQ0A 3CC4S 1Q86T 2B6AA 3GFXA 3I9ZA 3HF5A 4PR6A 4QPXA 2IM3A 1KFDA 2JLEA 1YSJA 5LSOA 3KK1A 2WRMA 5H1SV 4XPCA 5IM0B 2NPIA 3NBPA 2BW2A 3S8SA 1D1UA 4X65F 3BSOA 3OUYA 2UP1A 2DD8S 5K8NA 3SEOA 1S76D 3OXFA 3PDNA 2W8KA 1T3OA 3CCZA 3DMJB 4ED2A 4B02A 1HR0F 1FRKA 3DXSX 3OHAA 2AV5A 1XR5A 2VB6A 3HZEA 4OZ5A 1AUDA 3EX7B 1TL5A 3DU6A 5KFXA 5L1IA 1R3NA 2MHEA 3CIMA 5KFKA 5I42A 4LQ3A 3G6YA 1GAOA 4QIFA 2KG1A 2GHVC 3F44A 2QZ8A 1S1VB 2PIIA 4CZCA 5DLGA 4MAKA 1YGYA 3DI6A 5BR8F 3BN7A 1YG0A 1LWFA 2W4DA 4FPRA 1T95A 2MDAA 3QYYA 5HI7A 3CXCR 1YJTA 4OIXA 1TL1B 3TANA 4ATNA 3AAWB 2HRUA 4RBUA 3F41A 3DCAA 4X66F 2VPYB 1XN9A 3THVA 3MMCB 2VZ9A 3VALA 5KG6A 2VD3A 1OO0B 1WG4A 4ECTA 2HHTA 4N41A 3DN9A 2VBYA 1DTQB 2K1RA 4Y6IA 2KKHA 4G1PA 2Y1IA 1HWIA 2CPXA 3VF0B 2ILZA 1S6PA 4KTQA 2OH2A 1IKXA 5I4MA 2JC1A 2XZWA 4U7CA 4EEYA 1NAQA 1SL1A 3WC2A 4HDGA 2NYIA 3C66A 4LF8F 5T7LA 4H4MB 2JDJA 1U6FA 2WK4A 4C11B 5GAGI 1EETA 4DV7F 4AQYF 1IBLF 4IR1A 4JUZA 3U02A 2HWIA 3R27A 2HGLA 2LXFA 1LKZA 2ALZA 3V4IA 3M4XA 2CQPA 4QWCA 3K5OA 4B9TA 4K4VA 1FVSA 1I1GA 1IBMF 1TKTB 2AF6A 4ZDNA 4QJVA 3SFGA 5D8HB 2KJWA 5GAEU 2QEXS 2CQ2A 1SXLA 1HWJA 3I4HX 3J7ZT 2VUGA 4DHVA 2WSCC 4FF4A 4WF9Q 3M1VB 4IH6A 3FJ2A 3N0VA 4NLDA 3MEGB 4NPOA 2VBZA 3HHLB 3V81A 4ZP8A 2B4VA 2A1BA 4J9OA 1X5SA 1FD2A 3DYAA 2L9NA 4DF8A 1CEZA 3CCMS 3QGIA 3GWCA 4YR2A 1X9SA 3IR6B 4QYRA 1T3NA 3EGZA 1WI8A 4BWMA 1YHQS 4KC5A 5K9FA 3BGLA 2ZBIA 1NNDA 2HIQA 1HBOB 4JOUA 2GJIA 1JLGA 2FPHX 5J2NA 1VQ5S 3GZ7A 2VG6A 3QJPA 3LW5C 1SI9A 2Q1LA 2ZDOA 2C3UA 3HXMA 1HHTP 4ZPTR 2E9ZA 5B0GA 3FFIB 4LSNA 2BZ2A 5KFNA 2KM8B 1G2EA 4I2PA 5KT2A 1QM9A 4QYZJ 4IRDA 2I5JB 5AXLA 2M8DB 3M2RB 4KGKA 4WZQA 5D6GA 2COLA 1L3SA 1T02A 5KFUA 4CH1A 4CNZA