4Y28C

The structure of plant photosystem i super-complex at 2.8 angstrom resolution.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title The structure of plant photosystem I super-complex at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 8
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4y28C00
2PMZD 1GTHA 2C3OA 5CHCB 1IR0A 4L6V3 1DAXA 4ID8A 1FDAA 3MM5A 1G3OA 3OR2B 2WSCC 2V4JB 1FDDA 2WSFC 2Z8QA 2FJAB 1KQGB 1H7XA 2WAQD 4YDDB 1PC5A 1VJWA 4XDCA 2FDNA 2VPZB 1F5BA 1FRJA 2C3UA 1SIWB 1FD2A 1FXRA 4XDDA 1FCAA 2GMJA 1JNRB 1F2GA 1FRHA 3EUNA 4XK8C 1H0HB 1FEHA 2XSJA 1B0TA 2WSEC 3MM9A 3PNIA 4Y28C 1KQFB 3MM6A 2C3PA 1R27B 4OV1A 2GMHA 1B0VA 1FRIA 1Y5IB 1FERA 2FJDB 2C42A 1FXDA 5L8RC 2FD2A 2FJBB 1RGVA 1FDNA 1FRLA 5BYSA 3EGWB 1Y5NB 2XSJB 1FF2A 1PC4A 3MM6B 6FDRA 2O01C 7FD1A 3MM5B 3MMBA 7FDRA 1FDBA 1D3WA 3MMAA 3OR1A 6FD1A 1FRXA 1C4AA 1ROFA 1K0TA 1GT8A 3IR7B 5BYQA 1A6LA 2PDAA 1DFDA 3IR6B 3MMCA 1Q16B 2Y0SD 1G6BA 4KT0C 2VKRA 1F5CA 4CI0B 1WTFA 2VPWB 1B0PA 2C3YA 3MMBB 1BQXA 1Y4ZB 1BC6A 3MMAB 3MM8A 5CH7B 5FD1A 3C8YA 1FTCA 2VPXB 1FRMA 1H98A 2V4JA 1GAOA 3EXYA 3MM9B 2ZVSA 1H7WA 4AYBD 3MM7A 2FJEB 1BD6A 3MM8B 1CLFA 3LW5C 2IVFB 3IR5B 2PA8D 1JNZB 2V2KA 1DURA 1SIZA 1FRKA 2VPYB 1C4CA 5BYRA 1BWEA 2C3MA 1SJ1A 3MM7B 3GYXB 3OR1B 4DHVA 4OMFG 1XERA 3OR2A 3HKZD 1IQZA 1AXQA 4RKUC 1Y5LB 1KEKA 2UZAA 2FGOA 5E7OB 2WB1D 3MMCB 1BLUA 1JB0C 1GTEA 1HFEL
chains in the Genus database with same CATH superfamily
3WIUA 2X1BA 5I3UA 4UUWA 2J9EA 2CDQA 4LBHA 2LECA 2HIQA 1NSPA 5JVGQ 3MD1A 4HVZA 5T7LB 2VFSA 2V8HA 1R0AA 3HSJA 1GXLA 3ENWA 5C2GA 3SEOA 4CYUA 4JI0F 1S5ZA 4AL6A 3R2CJ 3KHGA 4CNYA 2VQEF 2HIYA 4TU7A 4QR1A 2HMIB 4YOEA 1RWMB 1WF2A 4F4YA 3LP1B 3TAMB 4QIVA 8AT1B 1B0PA 3HSGA 2RQKA 2GMLA 2V50A 2GJIA 1DRZA 5ETRA 4QWCA 2WHOA 2YQ1A 1T94A 5T7LA 1N6QB 5DLGA 4XTTA 4USJC 4WK3A 1U0HA 2IMOA 3CCLS 4NA2A 2FC9A 2C2NA 1TK0A 2E1CA 2HS4A 2JFKA 2XLJA 1WC5A 1ZBTA 2LLZA 4WZMA 3AD9C 2BJ3A 3HSDA 4I6YA 3PJ9A 3M8SA 1D9FA 2AU0A 2BKNA 2HMIA 2D41A 3CJTA 2UUBF 1OMSA 3K7RA 4UUXA 3LP1A 1KR4A 2U2FA 1TK8A 2IJRA 1NU4A 4LF9F 4EBDA 2HHQA 2XZWA 3QJJA 5HSPA 3P49B 2ZOGA 4DR3J 2FVPA 1U1NA 1N6QA 2LQJA 2BE9B 4ITSA 5J1NA 2GO9A 4QW8A 2J7WA 3LAKA 1REVA 1SKRA 3N5FA 5DGAA 3KHRA 1M5SA 3N0VA 4K0KF 3G2XA 4FYVB 3GYGA 2NSCA 4DSLA 3AXKA 1URRA 3H40A 1KOHA 2MPUA 2FQQB 5EHHA 4TQRA 3MM7A 3SV4A 4ECYA 4A8OA 3HO1A 2K1RB 4KQZA 4DXLA 3FBBA 1CLFA 4QJVA 1ICEB 4ED3A 5A76A 4NMXA 5CZXA 3QQCD 3DXBA 4DQPA 3W64A 5HATA 2R7SA 2DEJA 1TL7B 1HR0J 2XMUA 1KQGB 5DETA 4ECUA 2YKMB 3L95X 1ZOTA 5HANA 1VHFA 1X4DA 3PX0A 3CC2S 1VJQA 1JMTA 3PR4A 2J7KA 3AY0A 1H2UX 2MLXA 4DR3F 1S0OA 4LSNB 3TUPA 5HI7A 1FFWB 4IDKA 1SC3B 4ZPVR 3TA1A 4Q43A 2F9JA 3ITHA 4DLEA 4NYOA 3QRQA 5H9EK 2I1RA 1F9EB 3MMBB 3Q89A 3MMAB 1TL7A 4DQSA 4C8LA 1K1QA 4HACA 4KC5A 3GIIA 3TRGA 1XR7A 2YKMA 4OI0A 4DV5J 1BE4A 2Y0BB 2YKQA 3E01B 3OVBA 3RB3A 1YSJA 5KFMA 3T3FA 3FEYB 1URNA 4O3RA 2FLOA 5DDOC 3FDSA 5AT1B 3RTVA 4LSNA 4J9OA 1WHVA 2MZTA 3UN5A 4PCQA 2EG1A 2Z2LA 3T5KA 4X4VA 1VMBA 9RUBA 4J5OA 3Q8PB 1S76D 4MK9A 1JNRB 4KE5A 3PRDA 4QBUA 2HHXA 2XNRA 1U47A 1SL0A 3K0JA 4KH0B 3IWXA 1XQIA 1S12A 3J80U 3TEHB 3EVOA 3VAKA 2AEMA 4DWIA 1RHMB 4PZVA 4DR5F 2D3O1 2IDLA 5G0RA 1K0VA 2R2UA 5ETTA 4YS2A 5LSOA 4NCGA 4DV6F 2OEJA 5IQ6A 5B0EA 2OH2A 4RBVA 2DCUB 2YVSA 2YQ3A 3R7BB 2M70A 1RLDA 4NYZA 4RW9B 3M6XA 2XWXA 4DV5F 5AXLA 1C4CA 2HFVA 5F8LA 3UCZP 2E9TA 1H6KX 2Z2YB 1S1WB 1VHIA 3PACA 5DG9A 3UDVA 2ZWPA 5CD4H 4KYZA 2H1YA 2ZWOA 2J6UA 1TU0B 3SV3A 1F2GA 5HQ8A 3VTIA 3G82B 4DS4A 2VDIA 4IR9A 4RW9A 3NNCA 2YNHB 1VQSA 2XI2A 3KUHA 2QL7B 1MMLA 1WSRA 2IRUA 3HJVA 4EBCA 5C42B 1R6VA 5KT4A 1RHKB 4K5SA 4NXNJ 3J7AN 4P72A 4UF4A 1RBOB 4N7TA 2W1BA 1S1WA 2VB6A 4XO0A 3HZEA 4L73A 1T9UA 3M2RA 1SKWA 3TOQA 4Y00A 4R0EA 2AD9A 2CZVC 3P96A 2ZHOA 4PQUB 2QTWA 4EGLA 4A8FA 3DGVA 2YNHA 3PW0A 3QPIA 1NHKL 4C8YA 2GIQA 1WG4A 1RBAA 2DO0A 2AGPA 2FLNA 3W9HA 1N0VC 3GJSB 3I0SA 4I0WA 3IO1A 3KJFB 1B4SA 3GSIA 4F7VA 1UPMB 4MH8A 4B9LA 1EB0A 2FVSA 2G13A 2PIIA 2MEWA 3RJMB 1JJ2R 2HBZB 4LF4J 3DI6B 4JI5J 1RAHB 1NPPA 3PEHA 3MR3A 2Z58B 1RDRA 1RKJA 2MQPA 5B09A 3I5BA 3KUGA 4ZIWA 4PQUA 3BDEA 2CPXA 2I9SA 4NLYA 3NL0A 4USHA 1C1CB 1MROB 4DSFA 1PJ7A 4NXNF 2KN4A 2DR6A 3D5MA 3QO9B 2VIHA 1N5YB 2R8KA 2DR9A 5L38A 3GB0A 2HLUA 5JXSA 4J7CA 1QY7A 3T5JA 2XSFA 4QIGA 5J2NB 2P2CB 2H5JB 5LSRA 3DI6A 4DFJA 2CRLA 2EFNA 4ECZA 3MR7A 5GMEA 5KFFA 4ZVOB 2I0XA 3US5A 3VGSA 3PTWA 3NGSA 2H9ZA 1C1CA 1MROA 4B3MF 2CQ0A 2FDNA 2GC8A 4P52A 1SIWB 4O23A 3MGJA 3W8PA 4ED2A 4XK8C 2OTJS 3GILA 1N5YA 2F8HA 1CC7A 2ZH5A 3MM6A 3GV5B 2V67A 4DL2A 1X4FA 3UNGC 1Q5VA 1ZM4A 5I3QA 5J2NA 1C2PA 2CQPA 2HHTA 3PHEA 1O51A 3E8OA 4I6AA 1DY3A 2B9XA 4QPTA 2OEKA 3TUZC 4DPXA 1M5VC 3IP0A 2LVWA 2X1GA 3HHEA 1NXIA 1SV5B 4L3KA 3DRXA 2G4BA 1IKWA 2QSFA 2PN6A 3H5XA 3GYNA 2I6WA 3D2WA 1IJFB 4CZCA 3T6BA 3HHLB 3QZ8A 1EJ7L 4PYDA 5E3RA 3M32B 4F3OA 2EFGA 5E7OB 3Q22A 2ZZMA 2OP5A 1WDDA 1I1GA 4KRWA 1WHYA 3CNQP 1AROP 4ZVFA 3M6VA 2ZBQA 1I5OB 1JXEA 4J9NA 1T05B 2MSTA 5THWA 3M30A 2CJAA 1FXLA 2UUWA 3QNWB 5FDLA 2XNQA 4ECVA 8RUCA 1N5TA 4XAKA 3NGKA 1QVGR 3M8WA 3DOLB 2ZH9A 3HHLA 2F7VA 4WK1A 1VQMS 1FO1A 4M8LA 1LXJA 1R0BG 5IWAF 4DV2F 3M32A 1YZ7A 2E5JA 2BYCA 4K50A 3FEZA 3THTA 4MKYA 4DR7F 4GKJJ 2MKKA 1N33J 4O4GB 2MKCA 1VRQC 4YHHF 3I5CA 1S9FA 4QYZK 4AYBD 1T05A 3TX0A 1KFSA 5E41A 4U95A 3SSSA 1VQYA 2JX2A 3BBFA 2ERRA 4DR6J 3AOBA 1HWUA 1SPBP 4NLUA 4I2QB 1SBRA 2DTJA 3KMSA 2AF6A 5J2QB 4X64J 3BH6B 5IT9Y 1RTIB 1WKJA 3DOLA 1H72C 3C16B 1FDAA 3TNVA 2B9YA 1RWNB 2KDOA 2RVJA 4LF8J 2UXCF 1F1BB 1X5TA 2GW8A 4B02A 4O4GA 1WKKA 1X4EA 1ZA1B 1Q7YT 2ZC3A 3Q8YA 2EFVA 4LF7J 2WSEC 4C9DA 4JV5J 1F3VA 3CT9A 3ZFVA 3RBXA 1GH8A 1XIQA 4M5DA 1VIXA 4I2QA 3HVTB 4LRFA 3RAXA 1IBKF 2ZUGA 5J2QA 4ILRA 2DPJA 1RTIA 2KFZA 3R97A 3ZTSA 2AJ2A 4QU6A 2VPWB 4P71A 5DDPC 3WHIA 4GKJF 3D7SB 1UWBB 5CH7B 2K7JA 1WG5A 3GFYA 4DFPA 3QRRA 3NCQA 3EM1A 1OIAA 4RW6A 1CEZA 4IFYA 3GIMA 2CXEA 2DITA 5ETMA 2XQCA 3QJLA 5L46A 4N5SA 3D54A 4ID5A 4C8KA 4DS5A 2FGOA 3RAMA 4YB1P 2H54B 3MR5A 2V9KA 5L9XA 4ANDA 3HVTA 4O3NA 2CQCA 2DCLA 3OL9A 4X4PA 1P27B 5A2QU 2OMLA 2YKPA 3TWZA 4RX6A 1RWXB 1OYEA 2GHVC 1UWBA 3M1VA 2G2ZA 3CCSS 4PYAA 4C0OC 1KVKA 4NLPA 3PCOB 1NM2A 4LF1A 1WOOA 2R7XA 4URGA 4HHJA 5E3CA 1L3VA 2VF3A 2BE2B 1HYSB 4HTJA 3DC2A 2XM3A 1GFWB 1W7WA 2VBYA 5CABA 2KH9A 1EKRA 3GTYX 4TYBA 1WEXA 1NDLA 1FNXH 3IRWP 1LV5A 3BF4A 3MM9B 4FKYA 2JVOA 3HK2A 4FKXA 4C8NA 2C3MA 1NSKL 4EWTA 3O1LA 4FF1A 2HW3A 3EZUA 1NK0A 3D1HA 2J5AA 4E98A 1X5OA 1JXLA 4RPFA 4OJ3A 1KOOA 3CDAA 1IKVB 2WK4A 3EYZA 1VQKS 2BE2A 3Q8RB 3RUBL 3SCLE 3G71S 5D4LA 1BUXA 1S6QB 3FSIA 3MTJA 4C2MA 1S0NA 1OY9A 2AGQA 2LDIA 3MM9A 4CNZA 1FXDA 2BOAA 4HH0A 3DMJB 1GMVA 2WTFA 3G4SS 2DNQA 4HKQA 4ALZA 4OHVA 3ZZOA 1YKWA 2HRUA 1I3OB 3ADAC 4WIQA 1KBRA 2IRXA 2G1HA 4U67Q 1YJTA 3UN2A 2XMKA 3EGNA 1IKVA 3HKWA 4RBUA 4ZVGA 5C25B 4USWA 4YY3J 1NJYA 4C7QA 2HQGA 2V2QA 2VICA 2OJ3A 1YBTA 1HARA 2WCXA 1S6QA 2L08A 3I82A 2Q6BA 4R0JA 1RT2B 1Q8BA 4DL0C 3CPWR 1VBXA 3K5PA 2DYAA 4WU2A 4ZLPA 1VBYA 1LNQA 4UT4A 2KYXA 2PMHA 1VLYA 3CCVS 2XWYA 4FNIA 1WACA 1DARA 3WIVA 2F9DA 1SJ4P 3EJMA 1I94F 1Z1ZA 3R7SB 1UETA 3DHWC 1OJ4A 2G2OA 4GMKA 3W1YC 3VQTA 4IRKA 4Y28C 2FZKB 3CJKA 1Y5IB 2W2OP 3EMTA 4KHMA 3Q24A 3CC7S 4P2XA 3CXCR 3QATA 1RTJA 2XB2D 2W9CA 3H59A 3CCTA 2J0XA 1GK8A 4DL3A 3X3UA 3C6UA 1K0TA 1GT8A 2RB7A 4Y65A 2Y0SD 2LFVA 4QWAA 2HBYB 2RF2A 2BMBA 3R9LA 4F0MA 4YY3F 3ZZPA 2VDHA 2C2OB 3CO9A 3G6XA 5I4MA 1UFWA 4Y6IA 3QIPB 4MIWA 5EX3A 1FK9B 1QAXA 3V2UC 2MZQA 2AGOA 2E29A 4LRBA 3MI7X 4Y3CA 2MQNA 1CPZA 1AZSB 3U02A 4O0IA 4DR1J 4ZVPB 4X66F 3FGVA 2V8PA 2VL1A 5ETOA 1RAGB 1PYTA 2E5IA 2P9CA 1Z4UA 2VD3A 2DH9A 2BJDA 2CNLB 3BR8A 1TUWA 4N8NA 1N4LA 2ATLA 2WAQD 1A9NB 3R6GB 2M8HA 2Q6CA 1XNQF 2VFTA 3GMGA 1NO8A 4K4TA 3C6TB 3MFHA 4UQGA 2EBGA 2F4VJ 3G8SA 3WZ0A 1L3SA 1A7GE 1HWKA 1S4EA 3QIPA 1T9VA 1U02A 4Q8EA 2AT1B 4ZJLA 2DGQA 3OFFA 3IBCB 1AZSA 1IBCB 1WUUA 2IPOB 3ISZA 4B3RJ 5EGYA 4DQIA 2ZH4A 4KKOB 2JFDA 1N88A 4OYOA 1ZM9A 3TJAA 5L39A 1GMWD 2A1BA 3CD0A 1NK7A 3C6TA 2A6OA 4AQYF 5T14A 4EEYA 4OZ1A 2DY1A 3D6MB 2R8IA 4KTQA 3DDIA 4BS2A 2CWXA 3PFOA 4UOHA 3UVJB 4MK8A 2PMZD 2OLWA 2A18A 1SUQB 5CA5A 5K8OA 4C6AA 3D3CJ 2LXUA 4GC7A 4H4KA 4KKOA 3QBCA 3CMAS 2UU9F 2F4VF 1WOPA 2AZ3A 2IA6A 1QSSA 3UCGA 4U96A 4A47A 1C4AA 4Y2CA 1HA1A 1UP1A 1VQOS 3HVWA 2L41A 4KT0C 4ZIVA 3UVJA 1T11A 1XTZA 3MR2A 1IWAA 1SUQA 3TQ1A 1UVLA 1Y3KA 2PMWA 3H2LA 4QOTA 3DFEA 4C48A 4B3RF 4XPCA 2BANB 3R3TA 2POKA 2R7RA 1KKHA 4P7TA 4IFVB 3RR8A 2EEYA 3B82A 2HAFA 5KTQA 3IA0A 2ZJRQ 4HR2A 4YEAA 4OI3A 3WDOA 9ATCB 4Y2KA 5FLXU 5KFQA 2BV3A 3CCJS 3IN5A 1HFEL 2R8HA 3CB4A 5AE3A 2FY8A 3VGVA 4A8QA 1FDDA 1D1UA 2BW2A 1PC5A 3KK1B 1E6YA 1SQFA 2CKWA 4F0KA 3HSZA 5H9FJ 2DPIA 4ANEA 3BKTA 2Y1JA 4PG6A 4ZLJA 4DV0J 2PI5A 1VR6A 4CO4A 2LKZA 2DGXA 4A8WA 3AXMA 4IFVA 2V4RA 2F8MA 2XMTA 2VHGA 4JV2A 1JLGA 3UPFA 2GFFA 3BSAA 2IBOA 4J9KA 3KNAA 3Q23A 3OJSA 1KQSR 2E1MC 3Q2SC 5F41A 2JEFA 4F25A 2YWGA 4B17A 3CEDA 4DLGA 3KK2B 2RDJA 5LXRA 1YI2S 4DQQA 3KK1A 1NZAA 2W9BB 3H25A 3KFWX 1X31C 1KSPA 1WELA 2JVRA 4ELTA 3DLKB 4F2SA 4N8OA 5RUBA 2YH0A 1XERA 1AUDA 3A3NB 1KEKA 4KO0B 3TYTA 2BACA 1S48A 4P6QA 2GIFA 2WSCC 4DFMA 2UUCF 1H7XA 5KG7A 1FX4A 2OPSA 2FYXA 2P6SA 1LWEB 1S1VB 4CM2A 4YR3A 5F8MA 2ZNYA 3SXLA 1Z2ZA 1D9DA 4C0HA 3KK2A 2W9BA 1UCNA 3ZZYA 1WORA 3VZIA 5DDQC 3OFHA 4DBQA 4P7VA 5HVGA 3BO3A 3T1HJ 3PRVA 4RR5A 2CQDA 5K9FA 1EARA 1GX6A 4KO0A 1NKBA 1X4BA 4I69A 2KI2A 3BN7A 4YMEA 2IC3B 3CMES 2DNNA 7AT1B 4OHWA 1Y10A 3JSMB 2JEGA 4ZJOA 4USUA 1S1VA 4J9RA 3BPDA 1O0PA 4B3TF 1VS3A 1NJZA 1CJKB 2J0WA 1YJVA 2V34A 2HWIA 3CJQA 4RL1A 4NLGA 3H20A 4RNOA 4RU9A 2XULA 1VOMA 4X4RA 4K4YA 3JB9k 1HBNB 3KJNB 4WXWA 2VA3A 3OVAA 4AE5A 1NK5A 3OHBA 2F4FA 3A4TA 1FKPB 2JSXA 2NSBA 3M6WA 2GO8A 2L9WA 3BN4A 2IC3A 4WFNQ 4FS1A 1VDHA 3CIMA 2ZEJA 4NRUA 4DF8A 1MU2B 4K7QA 4MYUA 5D0EA 2UVWA 4OLOA 1RUSA 3UO0A 4JI7F 1T9TA 3T1HF 2M7SA 3U1NA 2QA2A 1L5UA 1RT4B 1HBNA 3NGDA 1DTQA 3R5BA 2Z30B 3CJ0A 3M8PB 5H9EJ 2D3ZA 2KKHA 3Q8VA 1MU2A 2RUGA 3OLAA 4OX9J 1GXTA 3PW2A 1RT7A 1HLWA 2CJXB 3OUYB 1FI4A 5B0BA 5B08A 3GG1A 1VBKA 3PX4A 3TQEA 2YWWA 3KOAA 4Q0BB 5F8JA 2C1EB 3KLIB 2H5IB 3MECB 4JI6F 3ZZRA 1RCXB 1TFYA 1RT4A 4WU3A 2JZ5A 4TY8B 3JAMU 3HCXA 1S1UB 4J9PA 3FZ2A 3HT0A 1S49A 3Q8QB 1YDLA 3C3LA 5IT4A 5CD4A 3R1HA 3M8PA 2XSJB 4Z2XA 3HX9A 1WC3A 2EVZA 2AJFE 4OIXA 1WD6A 1CULB 4WZQA 3CJSA 1EIYB 4LRCA 3OUYA 3D1OA 2A2DA 1DZ5A 4ED8A 2X51A 4Q0BA 3BB5A 3MPVA 4PWUA 3HFVA 1S6PA 4NX9A 1HNXJ 3KLIA 2PFDA 2O1PA 3A3OB 4WFZA 5A8WB 3THPA 1T7PA 5IZHA 1K44A 3GWCA 2NXUA 3T1YJ 4PXCA 4TY8A 4OZ5A 4TLQA 1S1UA 2MKJA 6AT1B 2LQ8A 1TKXB 5GAHU 2WZ1A 2J76E 4F4ZA 1WWHA 2YNIA 1HBOA 5FIIA 1KP6A 3CDEA 2RT3A 2WW4A 1ZZNA 1CULA 3F41A 2KXHA 1EX8A 2W7AA 1FE4A 1OY6A 4D3HA 2FHOB 2BKOA 4B9VA 2IA0A 4S0MA 1CJUB 2WRMA 1R0CB 2KFNA 3DGPB 4IQXA 1VGYA 2APOA 3B78A 3V5RA 3NOCA 5A8WA 4JI8J 4X4QA 2J9DE 2MY7A 1Q79A 2RQCA 1CJTB 5GMKa 3MPYA 5ETNA 1JX4A 2WONB 3QZ7A 1ZM2A 4CT9A 2Y1IA 4CLPA 1TKXA 3R6LB 2KO1A 2IVYA 3V6KA 1G7CB 1HWLA 2AHOB 4DU8A 2PA3A 2VPYB 2XMVA 1PYSB 1CJUA 2NZCA 1KLNA 3DGPA 1YRTA 2UUTA 4RKUC 2OFHX 4NEYA 1BXNA 1KONA 4ZP7A 1JJHA 4FNHA 4I2PA 1CJTA 2KM8C 4DCOB 2QGFB 3MURP 4QR2A 2XYGB 1RTHB 2MYFA 5LSLA 4LR7A 2Q3PA 3MWBA 5CXTA 1APSA 1U4BA 3NG8A 1M5OC 4J9QA 3MD3A 5LT5A 4ECQA 2P5VA 4NXMJ 4K2JA 1UEUA 2F3JA 4DJBA 3FQKA 2QLWA 4H4KC 4ICLB 4FYYB 4YP3A 3F56A 5KG0A 5A8RB 4JI8F 2RNEA 2CJ9A 4U8VA 1NEEA 2IJNA 4C4WA 3AH6A 4WYLA 4BC7A 2WVFA 2JLGA 1SKUB 5HMYA 3BR9A 1FEEA 1TL3B 4DSKA 1YWXA 2V5HG 3P5BP 4ZPDA 5D0HA 4QPXA 1YTYA 1RTHA 4I7FB 1AT1B 4NEZA 1TVRB 5KFLA 2E9ZA 3G87A 3LW5C 4F4XA 1UMJA 4RUHA 2VONA 4ICLA 1SH2A 3O2IA 4P74A 5KFEA 4C97A 2M4MA 3AQPA 3K8VA 3OV7A 1H73A 2QL5B 3H0PA 5DRKA 1TZ0A 3BGOP 1WOSA 3HF5A 3JTPA 1DLOA 1TL3A 5K20B 1RBLA 3W9JA 2NYHA 3HVAA 3K59A 4NXMF 4I7FA 4JUZA 2P9EA 1EKSA 2QFIA 1O8BA 1TVRA 5EWFA 1FRLA 1VC6A 4ZK7M 2C2ZB 4QWDA 4K4XA 4FS2A 3M8YA 5KFSA 2H4WB 1RISA 3ZZZA 4LSZB 3HHNB 4J9SA 3PHTA 2AX1A 2DHAA 2R7QA 1HI1A 4PKDB 5KG1A 1U2FA 3ILLA 3R27A 3MM8B 2CPEA 4G1PA 3OXFA 2HNZB 5ETLA 1X9MA 2FY1A 4U7UD 1TL5A 4KHRA 4RWXA 4DHVA 3OFGA 2C22A 4IO1A 3V6DB 2LQ9A 2OEMA 4OYXA 2P6TA 1Y11A 4KPYA 1N56A 1YBUA 2V69A 4MKAA 4CLYA 2OMOA 5ETPA 4IH7A 1CG2A 2ROEA 5IS2A 5GAEU 3N6NA 1S1XB 4PG4A 5KG2A 3H4DA 2DY9A 1PBAA 1HNWJ 4LT6A 1S0MA 1HW8A 5KFZA 2FJDB 1TUVA 4E0DA 2NZ4A 1RGVA 4USKA 2XYPB 2E7VA 4DUZF 4DL7A 2W9AA 2HNZA 2VH7A 4RUBA 4F4KA 3SCJE 1M0SA 1K9MT 1G2EA 2ROGA 1U24A 4QYRA 5BYQA 3V6DA 2HHHF 4MTPA 2B56A 3LP0B 4LIRA 2RKIB 4H54A 2WBMA 4KGZB 4P2SA 4OYIA 3Q8UA 3CGIA 3JAMY 2VFVA 2CDRB 1FRMA 4IQMA 2FJEB 1HQEB 4ZPCA 3GYXB 2DVIA 2HVDA 4ZCKA 3NNAA 2OELA 3MAQA 3ICLA 2GQQA 4QYZJ 2YKNB 1WHWA 1X60A 3KXDA 5HVHA 3D0HE 2CQ2A 1JLAA 2AJ0A 1EHWA 3L7PA 4NCAA 2DBBA 2MXYA 4DV3F 2DEIA 2UUAJ 4UOCA 3LP0A 4M5GA 2RKIA 3IM8A 1HWIA 1XMQF 2QC3A 4ZP8A 2DRBA 3FRZA 2WBRA 3NS7B 3H98A 1N32F 1RKIA 1HI8A 3EDRB 2UXDJ 4ZN3A 3IG1B 4H4OB 4CO1A 1C0TB 1U8WA 1SCJB 2YKNA 3VVTA 4DV4F 2YNFB 1M1GA 4OZ3A 5I42B 3TZWA 2QIFA 2L3MA 3NXZA 4MFBA 1JLEB 4KAIA 2G0IA 1NZ8A 2FGCA 2CQIA 4Q5VA 3PM9A 5F3TA 5DG7A 1QVFR 1WSVA 3N6LA 1NDPA 2C28A 3K5NA 2V8VA 3IC1A 1HWJA 4IH6A 4WE1A 1IKYB 2Z2MA 3LGNA 1HD0A 1BGXT 4EZ6A 2XMAA 3GFXA 3IG1A 4H4OA 4ES1A 1ZETA 3NNHA 1C0TA 5GAGU 4QIFA 3V4IA 5J2PB 2YNFA 3IAM9 2DJWA 1M5PC 4LRDA 5I42A 2IM3A 2MQMA 1RAEB 2BJ1A 3TUIC 3OL6A 3PVXA 3RRKA 3U27A 5KT7A 2XLIA 3OTCA 2HK3A 1S72S 1JLEA 2RQ4A 4OI4A 3CJ2A 1X9SA 1FVQA 1XC9A 3ENAA 2YWKA 4M63A 3F73A 4TXSA 1IKYA 2BZ2A 5KAKA 2CQHA 3LOUA 3J7YI 1BD6A 3CD7A 2HQCA 5J2PA 2F5GA 5KT2A 2PA8D 3W2WB 3GIKA 3M8RA 4RW7B 2R2TA 3P8BB 3VAIA 3PW7A 1X4GA 3HZGA 2QEXS 4UZBA 1HIYA 1KHVA 1FFGB 1QD1A 4O3SA 1P9YA 3BSOA 1QJHA 2AJ1A 1LEOA 2KZZA 2R2RA 3NAHA 3FZBA 2FJXA 2VOOA 3MCNA 3NCRA 5F8GA 3D6FB 4O3PA 3KDNA 4R8UB 1DTTA 1U1LA 2BRLA 1HD1A 2ZH1A 4LR8A 1VQ9S 1PJ5A 2OI2A 1IWGA 3DXSX 5HMXA 5GAHI 4HTIA 3I4PA 1JJCB 3I31A 1LW2A 4K59A 4ZLNA 4XIUA 1JXVA 1UAWA 2J9CA 4Q45A 4FXDA 4ELUA 2XLKA 1GMUA 3MF5A 3NS5A 1YQHA 3CCMS 4L3NA 1JK9B 3OQ2A 1H2VZ 3MUTP 2IVMA 4CH0S 3IWNC 2RS2A 3C66A 1JIHA 1U7LA 2OKQA 3TW0A 2DR7A 3UQSA 4USTA 3BQ1A 4W4MA 1T0TV 2JEIA 1U09A 4KIAA 4M5IA 1FD8A 2ZVIA 1NDKA 2HBQB 2Q43A 3OXLA 3L7OA 3DRPA 1PG5B 3SFGA 4C8MA 2MZJA 2XG8A 3J7ZT 5C24A 2WW8A 5KFAA 4JV0A 3GLJA 1C0UB 1KLMB 4DV1F 4ELVA 1Y3JA 1XMOJ 4NLWA 1SC4B 1FKAF 3KMQA 1S0VA 5HAOA 2ROPA 4W92B 4PEOA 2HGNA 4ZPBA 2YQ0A 3G8TA 4ILMA 4MAKA 3KLEB 1T95A 2DNLA 1U1QA 4JI3J 3MEEB 5HBMB 5ETKA 2YWFA 1WEZA 4J9LA 2QX0A 3OLBA 3E2EA 4URSA 4DDFA 3K2YA 3PR5B 1HKAA 2GVDB 4ED0A 1GTHA 2YX7A 1OSCA 2BXJA 4X65J 4IG0A 2B51A 2BOPA 4LFBF 1G1XA 4RZRA 4NA1A 2HQ3A 4R5PB 3KLEA 1TKDA 3N9UC 1FRIA 2ZH6A 4X4OA 1NUEA 2XYHB 2F1FA 4WP3A 6FDRA 2LU1A 4KBIA 3FFIA 4CYUB 2GVDA 5JVHQ 2ILZA 4OYAA 2ZJQQ 2H4YB 1LXNA 1U1PA 2PGCA 3QSIA 2M8DB 4FYDA 3PKYA 4DUYF 2CPZA 1AFIA 1WG1A 2FIUA 4GKKF 4JI3F 4E2FB 3AOCA 2MJNA 2R7OA 3MTKA 4YB5A 4R5PA 2CQ3A 2KXNB 4JB8B 5MLCV 3ZZUA 2CAJA 2GIRA 1S1TB 4HI1A 4O3QA 2W8LA 1U0HB 4YB6A 2GVZA 4PXEA 3K5MA 4X65F 1U2CA 3T41A 1V5VA 4DN9A 3B4MA 4ENOA 4RNHA 2DH7A 3SBMA 1RTZA 3VAFA 4MYTA 4OV1A 2GMHA 4JI1J 2IHR1 2AQ4A 3AA9A 4TNOA 2MLYA 2FPHX 4DR2J 2EK6A 4LREA 4IR1A 2X3DA 4QWEA 3PO4A 2AWZA 1QAJA 1WF1A 4KJIA 4CM0A 2RH3A 2WB4A 1ZH5A 1FESA 4HDHA 3M2VB 1NKEA 2HVZA 1Q0NA 3VF0B 3AFGA 2W2PP 5DZ7A 1S1TA 1U45A 1REVB 2YBVA 1T9WA 3LPEA 1TP7A 4ETZA 4F36A 1T03B 4OL8A 1H98A 5T41A 4WFAQ 2RHSB 2R3VA 1N36F 1NKCA 5GAEI 3OTOF 2IY5B 3UDLA 4ZPWR 4Y0FA 3CTRA 1UW9A 3MM7B 2NYIA 2BDPA 2PEBA 3EPIA 1YG0A 5K5MA 3UI3A 1AB8A 3DLEB 3M2VA 1G3OA 3OTDA 4DOZA 1XBWA 2RRAA 1WC0A 2Z4PA 3GG0A 2KVQE 1KS2A 1T03A 4AXJA 3LALA 3DYAB 4FF4A 4PWWA 2A3JA 3C19A 1JKHB 4JI1F 3LO3A 2IBKA 4DR2F 4DEZA 2CNNB 2VBXA 5HL7Q 3IGVA 1E6VA 4B9SA 3CO0P 1NNDA 3CMQA 1Y7PA 5CYMB 1WTFA 3KTQA 1R6YA 3AJ2A 3DLEA 4IDKB 4DL5A 4JBCA 4ZVEA 4CQ1A 3ITHB 3IS9B 2BKPA 1NAQA 3PKMA 5LMNJ 3OBIA 3FSYA 4HACB 3DYAA 3PW5A 5J1EA 1JKHA 1UA1A 1FA0A 2HPUA 4CTAB 2FHJD 2JJ4D 4Q44A 1BQMB 3LQVA 3NMAA 4EBEA 4P73A 2YKAA 5CYMA 1RWVB 1NH8A 4AXIA 2HHPA 4KSEB 3UD5A 1ACMB 2HFUA 3ENVA 4AL7A 2MMYA 2C3PA 3IS9A 2PO4A 1YITS 1UVNA 1NK9A 3DN9A 1YJWS 4KR0B 1HHTP 3X1LB 4CTAA 1FHTA 2DD8S 2XMWA 4KB7A 3JTNA 3NGRA 2FVQA 1BQMA 2KRBA 2E5LJ 1CC8A 5G0RB 3SZ2A 5AJ3J 4BBYA 5DGBA 4NCGB 2LQBA 3DLLQ 5GAGI 2MQLA 1XJWB 4P10A 1HR0F 1P6TA 1SJ1A 3UDEA 4NOHA 3RW7A 4MKBA 1BY9A 3QAEA 3ISNC 4L74A 2ZM6J 2DGSA 1TKZB 4OHZA 2GHPA 3QWPA 3H90A 3CJRA 2KFYA 3DLHA 2CG8A 3FRYA 2MQQA 2VPZB 3QFHA 3I0RB 5KFVA 2CZ4A 4ES2A 3KUEA 3HULA 5L8RC 5E0OA 3GONA 2BA9A 4Y2AA 5HLFB 2HLTA 3RGIA 3PYEA 1HBMB 5B0CA 4TKTA 1S6OA 1H74A 3ZO7A 1SC6A 4V19X 1BQXA 1TKZA 1FJEB 3A8JA 4UZCA 2R8JA 2E5LF 2M9KA 2G1DA 4ZVSB 2CNOB 3I0RA 3M2RB 4K8RA 3P5TL 3HFZB 5DG8A 2HNYA 3FQLA 3J7Z5 1W2BR 1J2VA 2E7XA 3MPWA 5F8NA 2R8GA 3MCSA 4A48A 4FVMA 2EPIA 2FUG9 2WVCA 2HQFA 5F9LA 2C3OA 3VAJA 3ZTOA 2QE5A 3M9OB 1GMWA 5HLFA 3J81U 1HBMA 4LF6J 2E7WA 1IUJA 1NSAA 2EG2A 3I0SB 4DL4A 2K2PA 2C2DA 3RU0A 2A0FB 2Q66A 4X4TA 3FCWA 1VBZA 4RW8B 3PYGA 1GNKA 2B3TB 3E3XA 5D4OA 1U6ZA 3UD4P 4DL6A 4RW4B 1IR1A 2W2NP 2KT3A 2MJUA 4F3MA 1M5KC 3NKYA 2EFQA 2A2CA 3MR6A 4RBTA 3O44A 4DR4J 2V8DA 5A8KA 3BO4A 2MKSA 2VG5B 3GJRB 4F02A 1RT3B 3BZQA 2ACYA 5D4PA 3BSNA 2NUHA 3VR1A 4ZS6A 1BHNA 2BQRA 1OO0B 2VASA 2MGZB 2BBEA 4RW8A 1NDCA 1QTMA 4NZ0A 2QMWA 2OIHA 4ES3A 4AUKA 3O3LA 4RW4A 1WF0A 2PEHA 2E1RA 2DHHA 2RAQA 1ZAXA 2V4QA 3QGPA 3LWMA 2E9RX 4P2FA 5BXIA 3W61A 3ISND 3BSCA 3PY8A 2IM0A 3RR7A 2VG5A 4I6WA 2IDEA 1RT3A 4ED5A 3MM6B 2I5JA 5A0YA 2ZZTA 4OZ0A 2YPZA 2MGZA 1X7VA 3DM2B 1H3DA 1UL3A 2GGPB 1J27A 3S1TA 3C14B 1X8DA 4FXVA 4M5HA 4CCHA 1R43A 1JWWA 3UW1A 3PX6A 3CCZA 3FCVA 1IKWB 4OMFG 2DRDA 2VG7B 2IIHA 1TAUA 1L3UA 4ER8A 3OHAA 1FJCA 3MZIA 1UVKA 1SJQA 3HHKA 3DM2A 4LF4F 3T9ZA 2GGPA 4N77A 4JI5F 4U9RA 1GXUA 4XDDA 4GC6A 3BKFA 3C14A 3PIPQ 1FWLA 1F9HA 3M30B 4CO2A 3NBPB 2GQ2A 2M52A 4CP5A 2CJBA 3FBEA 5FDLB 3MM5B 4HHHA 4N56A 1QE1A 4K4UA 2OSRA 2VG7A 2CPYA 3OTEA 2GHWA 2ZOFA 4V19J 4C98A 1MWZA 4PUOB 2Q79A 3TUJC 2XGQA 3MEGB 2VOPA 3EGVA 5LL6d 3POTB 2DT9A 2HK2A 5EUHA 3FC9A 4O44B 5BYRA 1NK6A 2BUNA 4ZITA 3P45B 3M4XA 3LGMA 1RB0A 3NBPA 2PE8A 5I3PA 1SVDA 2MQOA 2HQIA 3CUNA 1X5PA 1S6UA 4I64A 3MM5A 3I56S 3KLHB 4KGXB 1NH7A 2Z56B 3VQSA 4DPOA 1FRJA 3K5LA 2BVZA 3DCAA 3BPSP 3KKFA 1LK5A 1IBLJ 4PUOA 5D78A 3KHLA 1NPRA 2NR0A 3UCUP 1MMDA 3MEGA 4DV7J 1XMBA 2Y8WA 2D9OA 4ZCMA 3POTA 1CQNA 1F60B 2W4PA 5G4DA 4O44A 4QW9A 3KG1A 4KGVB 1JLFB 7FDRA 3J80Y 2B4PA 2B5JA 3IMQJ 1U26A 1Z2LA 2HQDA 3GR0A 3P6YC 1F5CA 4M5DB 2J6TA 3D0IE 5LJ3Y 1OQ6A 1RCOB 3LUYA 2IJFA 3KLHA 5JMNA 1T9YA 4N47A 3DDNA 4LBPA 5LJ5Y 1RT6A 4YFUA 4TN2A 3NWRA 2GV1A 3CWJA 3R1LA 3M8ZA 3HD1A 3R5AA 4EZ9A 2JNJA 3NMRA 3LA0A 2ILYA 4RW6B 4DPUA 3OR2A 4IFYB 5HK4A 4NLTA 3FBFA 2E1PA 2F40A 2ZHBA 3CCWA 4ID8A 1JLFA 1U49A 4ID5B 1SQEA 2JC1A 4M5MA 2FJAB 3B8HA 3M7VA 2PFFB 1RWOB 3FCHA 3FMWA 2YTCA 2W4CA 4CDIA 1EQ0A 3ZTQA 2EKNA 3VAMA 3I87A 5KFOA 1RHUB 3H7HB 1F5AA 1IBLF 4RUCA 2BQ3A 3M1VB 4DV7F 1N33F 5M2RA 3MOZA 4X62J 2IMWP 4M1KA 1D3WA 2DISA 3PV8A 2UVRA 1X5SA 5DO2A 3TVZA 2BX6A 1M90T 3UN3A 2E66A 2NXNA 4DR6F 4KHPJ 1ELOA 1Q86T 3QLHB 3JQMA 2C2KB 4X64F 1JLBA 1S97A 1H7WA 3M6UA 4WKRA 2ZOMA 4W90B 1SH0A 2YX1A 3AODA 2OPQA 3CIZA 1JNZB 3PDNA 1NK4A 4CO3A 1VFJA 4LF8F 2WB1D 1M5HA 1JB0C 3BYRA 3NAIA 1YK9A 2FZGB 4YN3B 2BR0A 4LF7F 3ONQA 1KTVA 1RU2A 4JV5F 3LF0A 3NY0A 4YDDB 4DUTA 3JQKA 4Y2IA 3AOAA 4MIAA 2QA4S 1PAUB 2DIVA 1HQUA 2BM0A 5JJBA 3RB6A 4C11B 4EO6A 1VQ6S 3QLHA 3NCPA 2Y8YA 2XEXA 1V3RA 3ULHA 3CCQS 1LWCB 5E3PA 1JLQA 2DXDA 1OS5A 2PSZA 1RAJA 2CJYB 1U6BA 1FF2A 1KTQA 2O01C 4X62F 1RJJA 1A6LA 4GVBA 5ETQA 4QIWD 4DSJA 2EC0A 4NRTA 2HFOA 3TI0A 2DR5A 1BC6A 2HG4A 3GIJA 4DPTA 2DB1A 2ZDPA 2HFZA 5KFKA 2VQEJ 4DFKA 3H2UB 4K2XA 4PABA 1RZMA 2ZVSA 2XGPA 4HH1A 5F0WA 2IM2A 2O67A 2YXLA 2A10A 4C11A 1SL1A 4DZ6A 1YJRA 4X4NA 1LWCA 4J91A 3H4BA 1QLNA 1XEZA 4ILLA 4I67A 3JQJA 3G6YA 4DU7A 1N0UA 2B8PA 3KG4A 1QAIA 4IOCQ 3KNGA 3R2DJ 1PYOB 5SZTA 1HPZB 4FP9A 2I2YA 2AV5A 3S6EA 5J2MB 5E3AA 1VRUB 3RBZA 3MAAA 1UFLA 3PNIA 1MN7A 4BLGA 3ET6B 4F67A 2UUBJ 3EE3A 3CD6S 1VRTB 1FDNA 2W7PA 2V0NA 4IG3B 3R5DA 3M8QA 4LF9J 2CG4A 5DQHA 3DRRB 2W4DA 2G9OA 3SCKE 3CJKB 4USVA 3A1YG 1RAAB 2JWNA 2V2ZA 1UVJA 2XI3A 1RTJB 2W9CB 4IYQA 4EYHB 2O66A 2VKRA 1RADB 4G65A 3ZZ0A 1RHQB 1X0PA 3C6UB 2V68A 1TMJA 3VZHA 1Q5YA 1VQLS 4PXBA 1HPZA 3NWGA 2V6AA 5E3QA 2FLPA 5M2PA 2RF2B 5J2MA 3MAHA 4K0KJ 1KHWA 1KQKA 3D0GE 3AT1B 1NJIT 1VRUA 1RWKB 3GZ7A 3U1LA 1RAOA 4IOAQ 2COLA 4NZ6A 3ET6A 1FJGJ 5IV4A 3A8IA 1VRTA 4IG3A 4B08A 8ATCB 4OJ1A 2FB0A 3QFWA 1NBEB 2ZJPQ 4XPEA 4WYWA 3DRRA 2AIRB 1N8RT 4FZVA 2N4CA 3J7A1 1S57A 1QDUB 2NLWA 5CYJA 2LXFA 1RU1A 4NWBA 4TLRA 1FRHA 4USMA 1YGYA 3DRYA 5F9NA 5E33A 3K89A 4FN5A 2FZCB 2OAUA 2ASDA 4FYXB 2WVBA 4C8ZA 3TAMA 1KNZA 1JQGA 5HMZA 2JOQA 2P8IA 5HJXA 4U6PA 3EICA 5F0UA 4F26A 1BQNB 1S99A 3UR3C 3EXYA 5KFRA 3FMBA 3BGFA 3PRBA 2DGUA 1YZ6A 1RXOB 2NXJA 4EUVA 2DH8A 1A0OB 5HO4A 1TMMA 1FJGF 3W60A 3T19A 4EI2A 2KM8B 1ZZFA 1XN9A 5D0GA 3A8EA 2AKWB 1VISA 2RUSA 4F4AA 2HFSA 1BQNA 2GCFA 4OZLA 4OX7A 4CLKA 2MZRA 2AZ1A 4J37A 3D67A 3K57A 2DHSA 2LA4A 2J8AA 7FD1A 4NYPA 4DPWA 1MWQA 4Q2MA 1D0EA 2K1RA 3Q8SB 4F50A 3HVRA 4X4UA 4WCEQ 4F4WA 4IO9Q 3T9NA 4DR1F 4DR5J 2HZAA 4DV6J 2Z57B 3MEKA 2E5GA 3FBCA 2HZVA 4C3KA 5C5JA 5IM0B 2XO7A 1HNVB 3BV8A 2XTJP 4KFBB 4J90A 3M9MB 4DSEA 2KXFA 4KY3A 3CULA 4PG5A 3H8YA 1D9AA 1S7IA 4U8YA 4HYKA 1B3TA 2OO4A 3JSRA 5F8HA 2W25A 4UTGA 2BJ8A 5A2QY 1NHVA 2NCKL 3QJPA 1E6YB 3GE9A 3ZZTA 1S79A 4O4RA 1M1HA 3BGRB 2RJZA 3MMBA 3MMAA 3ENQA 5IM0A 1HNVA 2LMIA 2JHEA 4KFBA 5CQGA 1JLGB 1RSCA 2X1AA 3E01A 2LEBA 1T9XA 3Q2TC 4YUDA 3SQGB 3CDWA 3QGGA 4FF2A 5IT9U 1DQ9A 4C3MA 3D66A 1HMVB 5KFIA 1WJ9A 3AQOA 3I32A 1U1MA 1U1RA 3PJXA 3VAGA 2ZBRA 3I5AA 3RZAA 5U47A 2RD5C 1U1OA 4DZDA 2OPPB 1RK8A 1WI6A 4DCPB 4UOFA 3TZYA 3BGRA 4HL9A 3RYLA 4AFFA 5DM6Q 1S4FA 4Y2MA 4I4BA 4WPAA 3K17A 5IFMA 1BWVA 5D77A 2OPRB 3FJ2A 4CH1A 4LR9A 4CT8A 5GADI 4NI2B 4O3OA 3V6JA 4PG8A 2ZBCA 4EFAC 2HWHA 2OPSB 1B0VA 3SQGA 5HQLA 3N4WA 2D74B 1P8GA 3F0NA 2BABA 1HMVA 5KFWA 2OD4A 4A4JA 1VLOA 1V9OA 1TTHB 2OPPA 1LK7A 1U25A 1LWFB 3VHQA 3GJQB 2Z0GA 1V5IB 3B4DA 2FHMA 4KPCA 3EZ5A 1S59A 1K1SA 4K4SA 4ETXA 2MSSA 4D3GA 2OPRA 4NI2A 4FYWB 1ZAVA 2LCWA 2MHNA 3HKZD 2R7VA 3OL7A 1IR0A 1DAXA 2H48B 5DQIA 4DX7A 3G82A 4DV0F 1OY8A 3D68A 3TJ9A 1LWFA 2N3OA 2YX4A 3CF5Q 1NJWA 1H0HB 5F3ZA 2NPIA 1FWKA 2JDJA 2OUGA 3QIDA 1VC5A 3AAWB 5C42A 1WNEA 1TKTB 4B3MJ 5KG3A 4U7UK 4NZ7A 3D4JA 5D15A 2XS2A 3EVMA 1FDBA 1TL4A 3RRGA 1VIOA 2DGTA 5K8PA 1SJ3P 2V8GA 5SUHA 3GPAA 4B9UA 1REGX 3Q83A 5KFCA 2DNYA 5KT6A 1T02A 4DI6A 2CPIA 2YNGB 3VALA 4B9TA 2VFRA 1DTQB 1EAYC 3HI9A 5AE2A 2DR8A 3GQCA 3RBDA 2ZD1B 2VJVA 4L75A 3QGIA 2RE1A 2WVEA 1TKTA 1CSJA 3OSPA 4OI1A 3EPGA 4MMOA 4FDFA 2AJQA 2K8GA 4NLXA 4ZKAA 1UA0A 5ITHA 3ZNJ1 1L3TA 2XHWA 2Z8QA 1RT7B 5LXYA 4OYZA 2VBZA 3CD5A 3RAQA 4OZ2A 3DLGB 3TZZA 2GMJA 3O8WA 2XO6A 3KJVB 3GFZA 2FHKA 2YNGA 2Y9HA 4QQBA 2KB2A 2E44A 1RTDB 2XBPA 3U7JA 4J9MA 4ZP9A 1KVIA 2ZD1A 3QO9A 3R5CA 3TZXA 3KJQB 1IBMJ 1R8BA 1UJ6A 5DDRC 5D3GB 1RA7A 3ETOA 2KJVA 3L09A 2KL8A 2EC2A 4UY8T 5IWAJ 4JYAJ 4DV2J 1R8CA 1GX5A 3ELHA 2CA9A 2R9LA 3Q86A 2ASJA 2JH3A 4DR7J 3DLGA 1DURA 2EXUA 1SIZA 5C7PA 3KJVA 3MPDA 1S6PB 4YHHJ 3NP5A 4RNNA 3PZPA 3W65A 3VWSA 3J7YU 2BE7D 4Z7YA 1NRKA 3RW6A 2VODA 1CVJA 1IJEB 2ADBA 5B0AA 1YJNS 1RTDA 2HHWA 2B0GA 5CHCB 1K73T 1V3SA 4OYWA 2R7UA 4ED6A 3PJWA 2YNIB 1HBOB 3EXCX 5D3GA 4KV8B 2UV8G 2AW0A 1PSDA 1SQGA 4BHQA 2IYGA 4M5LA 1YBAA 2HAIA 2HHSA 3I4HX 1SH3A 3N28A 2C42A 3QT6A 4NLSA 2UXCJ 2QL9B 3UD3P 5LM7E 1RLCL 2MY8A 3TR5A 5KG5A 4NLOA 1MSWD 4KH1B 5LOQA 5KFYA 1SV5A 3NRBA 1KFDA 1Q8LA 1IBMF 1G6BA 2XZTB 2DNGA 1F0XA 4DSIA 5AXMA 3W5XA 1IBKJ 4JYAF 4OX9F 2MDAA 4KV8A 3BS9A 2CUYA 3RB4A 4LFAJ 5IXUA 3GV8B 3QYYA 4WFBQ 3CE8A 3MCMA 4N76A 1Q8IA 5CAAA 2EKYA 4ZPTR 5K8MA 2IM1A 5CCMA 3GSDA 5FLXY 4LJMA 3BO2A 3V4MA 4M5NA 3TA2A 1VQ8S 4I2PB 1KD1T 2X3GA 1NHUA 3DU5A 4PWDB 2ZFHA 1S7HA 2PD1A 4P9SA 1R89A 1U8SA 3PEJA 3MOJB 1YJ7A 3SSRA 1T3OA 1YVFA 3C46A 2GA7A 4P75A 2W7OA 1RE1B 1LFWA 2RQMA 1FFSB 6FD1A 3G8QA 3GCXP 5D0RA 1HNXF 1I6JA 4LRAA 5CCLA 2L48A 4L72B 2HHVA 4ZVQB 3T1YF 5KFDA 1FTCA 4CO0A 4ZDNA 1TFWA 4NE9C 2XS5A 1PILA 4PWDA 4HT5A 3E51A 3CCUS 5HJYA 2HSEB 3C16A 1FVSA 2O3DA 4RUAA 4LFAF 1UZDA 4ZVUB 1RT1B 2KVIA 4WIIA 2QMXA 5L1IA 4GO5X 4NA3A 3OTBA 3CVKA 2CWKA 1HNIB 4OX6A 4XDCA 2EFPA 2VV5A 4QCLA 3K5OA 1N34J 1Q1KA 1FEHA 4OYMA 3D3BJ 1XK8A 2Z2ZA 1DLOB 3LGHA 1B7YB 1Q53A 3EGWB 1ZM3A 1IVZA 5KFGA 4ZN1A 3H5YA 2B9WA 2AMCB 2EW9A 2PDAA 2B43A 3CJ4A 2F65A 1RT1A 1PCAA 2XMJA 2IFXA 3KLFB 3V81B 3C8YA 2R7WA 3A8KA 5DJBA 4WP9A 1HNIA 3TVKA 2ZZNA 5A6PA 5HROB 5LMUJ 4JV1A 2HHUA 3SFUA 5L1KA 1V3ZA 4IRCA 2WVDA 3H2VE 1VCTA 4MT1A 1U48A 3BYPA 3MMCB 3QT7A 2YY3A 2KG1A 2DNHA 2LEAA 1P1TA 2MQ8A 4EK2A 2OSQA 1TQLA 3T1AA 3ZC4A 4AL5A 3KLVA 4ANCA 3OT9A 4A46A 2GAGC 2C2RA 3KLFA 2QA1A 3V81A 2BJ7A 2GS8A 1N34F 2CJQA 4BCAA 2FHJA 2ACMA 5D8HB 1NK8A 5HROA 1HYSA 4DG1B 4HLBA 4C0BA 5J1PA 1I51B 3BGUA 1I94J 3MDFA 3J81j 3ZNUA 3MMCA 2EWHA 3DHXA 4FBUA 3HHDA 3G9CA 2ZKTA 1F3FA 5M2UA 2Y1LB 2D1CA 3M2UB 5ETVA 5B0GA 2I38A 1UKUA 3M05A 2MKIA 4A8MP 4TQSA 5LMUF 3LH2S 2OFGX 1NSQA 1X0FA 1NMEB 3I96A 4PG7A 3S8SA 3MEDB 4OQJA 4DG1A 2Y3YA 2VC1A 1ULRA 3TP2A 4G1IA 2ALZA 2KZMA 3R5GA 3SIPB 1JLAB 4ZP6A 4X66J 5AE1A 3DMJA 3EUNA 3M2UA 1XR6A 4URQU 1HQ2A 4F04B 4ECTA 4F2RA 4FBTA 3MMJA 4ERDA 2IRYA 3OFEA 1XNQJ 4J9UE 4CLZA 2QV6A 2Y1RI 2A6MA 4TU9A 4NLRA 1FT8A 2R4FA 1YRXA 5C25A 5D4NA 2VZ9A 3MEDA 1CJVB 2M5YA 4LF2A 4OHXA 2ZC4A 4WFYA 1L3KA 2CQ4A 3BGLA 1GQEA 3BBCA 2AJ4A 4BDPA 3KG0A 5L1LA 4DPYA 4NLVA 2D3OR 1F6TA 5KFPA 2W2MP 3QGHA 1HW9A 4QIEA 4NASA 4B3SJ 4ZMMA 2FJVA 2L9NA 1UEVA 1RT2A 1R3NA 2VA2A 3A3PB 4MIBA 4MFBB 2H51B 3FUYA 4OYBA 3WQPA 1B7FA 1WEYA 2C2MB 4AQYJ 1HNWF 2K3KA 2R42A 2FLLA 1RAIB 1KN6A 4ED1A 1CJVA 4WE1B 2BRKA 1AYEA 1FD2A 4JOUA 5K8NA 4WF9Q 4C3LA 4UY85 2DKOB 5F8IA 1R27B 1FTRA 4HEA9 3V4IB 4BC9A 1NJXA 2VUGA 4E8UA 2LYVA 2LQ5A 2ZBIA 1IXKA 2UU9J 5HQMA 4TY9A 2DGVA 1OWXA 3SSQA 1RACB 2NPFA 4OI2A 2ASLA 4QU7A 1PKUA 5DM7Q 2K3IA 1FK9A 5H1SV 4TU8A 4ECWA 1OPZA 2ZNZA 3VV2B 1ZPVA 2V2KA 1K8AT 3HMJG 4B3SF 1AA1B 5D6GA 2UUAF 3HJFA 4M95A 2OHDA 1W26A 1AXQA 1UPPA 3P4UB 2ZE2B 3KYLA 1FKOB 2BW7A 2AYGA 1WHXA 2ATCB 4EU0A 2B7BB 2FVRA 1U0SA 1N52B 3TO8A 3CW2C 5MAOA 4K4VA 4RJVA 5K14B 3JXOA 3D1QA 2LEPA 2UXDF 4PXDA 1GEHA 1VQPS 1RWPB 2DHXA 2NREA 3IAS9 1VI7A 2H5EA 3FEXB 5IT0A 4USIA 4WJBA 3VCDA 4MJKA 3WX4A 4HDGA 4CLFA 4UW2A 1RYSA 3IR7B 2EFOA 1SB6A 2ZE2A 2RMLA 2KHCA 1DTTB 1PBUA 1FKOA 1Y4ZB 4DMZA 3AJDA 1R8AA 1SL2A 4MK7A 2N7CA 3T6JA 3G96A 2Q1LA 3FVYA 3W3SA 2DNMA 2MB0B 4G1QB 1LW2B 1QTNB 2FTRA 3HHLC 3THVA 4CLSA 2AYBA 3ETMA 4NLQA 5K14A 4HT7A 2CPFA 2V9WA 2QYCA 2WOMB 3D6HB 3PYFA 2ALYB 3OPKA 4IOBA 1D8ZA 2B9EA 2ADCA 3OSNA 1ZTTA 4IH5A 4K4WA 2GNKA 2QLXA 2CFXA 1VJWA 3WC0A 1UVMA 3W9IA 2K06A 3FK4A 1N5VA 4X4SA 3QWUA 1HBUB 3SCIE 1SJRA 5EDWA 2UUCJ 2M2BA 2N7YA 4G1QA 3DRPB 4B3OB 2HS0A 3JSBA 1D09B 5C24B 1QM9A 1ROFA 2SXLA 2WOMA 4TVAB 4CRJA 4DX6A 2GJFA 2BANA 4OYPA 3I6PA 3AJ1A 2NS1B 2HVEA 3W5YA 2FC8A 3G6ES 1TK5A 1H2TZ 1WC4A 3SI8A 3QT8A 1T3NA 4RNFA 5KFJA 2RILA 2UP1A 3D6TB 4A8SA 1PAEX 1HBUA 2CVEA 1QSLA 3SYZA 1PGZA 2H3EB 2QZ8A 2LA6A 2GQCA 1Y5LB 2ABYA 4YR0A 1HHQA 1BLUA 4B3OA 2E5HA 3MHYA 1O6XA 1XNRJ 4I56A 4B3TJ 2BM1A 2HRYA 4EMDA 2F63A 2V94A 1EETB 4CLUA 2CIMA 4LSLB 5EN1A 3L4BC 1AFJA 4ZHRB 5DQGA 3W8GA 1FE0A 4IG0B 2B7CB 1CQMA 4DF4A 2X7IA 3BBBA 2B4OA 5KG4A 4QWBA 4CI0B 2QN6B 2ASYA 3WX8A 2C3YA 2C2EA 5KG6A 3FFIB 3NEKA 3UR0A 1RWUA 3DLKA 4ZCLA 1SC1B 1EETA 1MW7A 4JI7J 4LSLA 2OTLS 2DHGA 1SKSA 1N48A 3BREA 2YPYA 3QMQA 1VK8A 1PO6A 2XCPA 2N82B 2KTQA 4ZHRA 3EVWA 3WC2A 4HHUA 3C15B 3CJ8A 3OR1B 1UEKA 4UQTA 3PG9A 4PQAA 3MUMP 2QG9B 3DDKA 2ZUAA 3AD8C 2UVVA 2RHQB 2ZKUA 1JLCB 2HKEA 2J0QD 1LWEA 1XNRF 3HHLD 1Q8KA 1VK3A 2HRTA 3VAHA 4Y34A 1XMOF 3NS6A 2QLBB 2GVZB 3JSYA 3B6BA 1UJ5A 1DHMA 3O6QA 2FD2A 2DIUA 2QMUB 3GR1A 3AA8A 4JI6J 3C15A 3JS9A 5KT3A 1UWAA 3AB2B 3TA0A 3OR1A 1RT5B 1LQ9A 1P9QC 1Y0HA 1FJ7A 1YX2A 2RU9A 1UW4A 4LVOP 3JSMA 4I68A 1JLCA 1QAYA 2MZSA 3PIOQ 5L1JA 2NQPA 3KWMA 4NCBA 5KFHA 3CSKA 4NLDA 1CJKA 3NGUA 1QUVA 3OD2A 3AHPA 1UVIA 1RABB 2QYGA 1R8PA 3GIRA 1HNZJ 1GTEA 1TL1B 4F0HA 5C2CA 3UNYA 3HLUA 1FKPA 2V4JB 1RT5A 1K47A 2GX8A 1H38A 4LUBA 2KT5A 4I1TA 3K8WA 4PAAA 1LOUA 1EZZB 2C3UA 1IN0A 2ZITA 1X4HA 3T5LA 2CNKB 4M5JA 3MUVP 1X4CA 2K7KA 4M94A 1NPKA 3BJYA 4DQRA 2EBEA 3IM9A 3HP6A 3DLBA 4WBFA 5GMDA 5BJRA 3VGUA 3CJ3A 1MLAA 1TL1A 2LU2A 3UWTA 1E6VB 1DQ8A 1YLXA 1U1KA 3BM7A 1U2RA 3W66A 2V4JA 4K5RA 2X1FA 2VU5A 4L76A 3SDEB 2XS7A 1BWEA 2J9DA 2R7TA 3CC4S 3ILOA 4LQ3A 2CQ1A 2HNDB 1KVJA 3DRSB 1VQ4S 3ZTRA 5AXKA 5J1EB 1HNZF 2AP6A 2AX0A 3MECA 4OX8A 5IC6B 2WSFC 4RO0A 1RA6A 3A13A 4RU2A 3KDOA 2O5DA 2QLJB 2CADA 2DNRA 2W2QP 2B4UA 2XSJA 1IM4A 2HFNA 3DOKB 1KQFB 3W5ZA 2MTLA 2B4VA 3H42A 2M0GB 5BR8J 1VQ7S 3SDEA 2NUUG 1NLKL 4RLEA 1UFKA 2RDDA 1R31A 2JL9A 1EP4B 2XC9A 1J5OB 3ILIA 2QA4G 2D3UA 1DBDA 2JEJA 3KHHA 3TAPA 1NB2A 2AEJA 3IR6B 2HNDA 4PRFA 1R7IA 3DRSA 4WKYA 5ADZA 4ZVTB 3DNCA 3W62A 1FNMA 3TANA 3I9V9 3MXHP 4LBIA 4WFXA 4RWWA 3K58A 3BEGB 1N5QA 4QR0A 2DGWA 4U7CA 4MKVA 3DOKA 2KRRA 1S9EB 1MG7A 1TELA 3B54A 2ZDOA 2UZAA 4NPOA 3FNNA 3OW2R 4DCJB 2IYIA 1FX2A 1EP4A 3BQ2A 1J5OA 1XWLA 2XZDB 2V2VA 2PI4A 4KGKA 3UFCX 3G6VA 3NGTA 1ITPA 2HWTA 2RDIA 2UV8A 4WP8A 4CO5A 2MKHA 4K4ZA 5DLFA 2CPDA 3R8YA 2NXEA 4Q8FA 2W24A 2HGLA 2WONA 1Q81T 2QO3A 5BR8F 5B0DA 2LDYA 2HS3A 2GJ2A 5B0FA 2DXFA 1S9EA 3H5SA 2KJWA 4GRSA 1DFDA 1TUGB 5LMNF 4Z7CA 3Q0AA 2YWHA 2RSQA 1RHJB 2HURA 4V1Ak 4A8KA 2FVCA 3EGZA 2VG6B 3LWLA 5KFBA 4ECXA 1RI7A 3QT5A 4ZPAA 4KGMA 1MWYA 2EI5A 1FRKA 3L3CA 3W2VB 2RU3A 3BQ0A 3JYTB 2BJEA 1NB7A 3IXQA 4GO7X 2HNYB 1UZHA 4HI2A 3S7RA 5KT5A 2RRNA 5A6WA 1ZTWA 1S10A 4FF3A 4BWMA 1LW0B 1CBKA 2JLFA 1LFPA 2VC0A 3NOGA 1OSDA 3R7NB 5A8RA 2VG6A 4FPIA 5KFUA 1W25A 1RYRA 3H5UA 1QUPA 4LVNP 2H65B 2XMMA 3W2VA 3OL8A 1HHSA 1FRXA 5AJ3F 2QLFB 4Q7AA 2B8QA 3JYTA 1FWPA 4DUZJ 1OQ3A 4ZVRB 3VVUA 5EWEA 3HXMA 4PPZA 2VPXB 2M88A 3I9ZA 4IRDA 4C8OA 1LW0A 1OPIA 2HHHJ 2ZM6F 3DU6A 5HN0A 3TARA 3WBZA 2VQFJ 2BJ9A 2QT7A 2P9GA 4CIOA 5A8KB 3D9BA 4ED4A 2MZ1A 4JP8A 4F8RA 2MHEA 2AEFA 2W01A 2KT2A 4NL5A 4G3IA 2BQUA 3DKDA 4CH7A 4YB7A 3BH7B 4F3QA 3HM9A 3TVYA 2D69A 3L7UA 2QFJA 3TJ8A 2MKYA 2J7UA 1F2HA 4OJHA 2CYYA 3RG6A 2YH1A 3FSXA 4DV3J 4DX5A 2N4DA 1FERA 4LF5J 2CQGA 1YRUA 5HP1B 1ZYQA 4RNMA 2G0JA 1RP5A 4DN0A 1ZA2B 3EDQB 3AD7C 5E5NA 5KFTA 1TV6B 3EZOA 1Q78A 3JTOA 1XMQJ 1IKXB 3HDSA 3U1MA 1HL6A 4M5KA 2I5JB 5A0YB 1RQ0A 1Y00A 3MM8A 4OI6A 1N32J 3LAMA 1IR2A 3BDPA 3GU0A 1MNEA 4DV4J 4WTYA 2VQFF 2JLEA 1F9FA 1B70B 4AD6A 2PC6A 2DNKA 5IV3A 2DXEA 4NMLA 1YJUA 4ECSA 1YJ9S 4LF6F 5HP1A 1NCLA 3L9ZA 2L9DA 1S1XA 3CDUA 1TV6A 3P3DA 5B7WA 3HD2A 1IKXA 1V6HA 4OZJA 1PJ6A 1Q95G 1KC8T 3UE2A 2UXBJ 1F5BA 1X4AA 3AB4B 1T8EA 2GZOA 2AYMA 2HVHA 1B64A 2HBRB 2ZH2A 1B0TA 3TEGA 3RB0A 1RAFB 4LQ9A 4AT1B 3IBWA 2FJBB 1N5SA 4LF5F 2XY6A 1Q4RA 1Y5NB 3SQOP 4OFZA 2MLZA 2CVIA 4OZNA 2ZHAA 3VGTA 3GP9A 4DR4F 3PW4A 2IAJB 1Q16B 1FNOA 2LP4A 2OGUA 1HQEA 2DGOA 4J9VA 2JRSA 4FVCA 2HVIA 1ZAWA 2J0SD 1Q82T 1QE1B 1S9GB 3F44A 4X2BA 3T5HA 2QJ3A 2RIJA 3FKBA 4IUFA 3OXGA 3PXGa 3EWGA 3W63A 3IR5B 2AYEA 4IKAA 4OJGA 1IQZA 5CYQB 1WDTA 1VC0A 4H4MB 3QRPA 1SXLA 2J8SA 3SMZA 5HVFA 2R2SA 1AUSL 2VFUA 1DQAA 2KG0A 1Q7LB 1D8YA 3QSYB 5E2QA 2IAJA 1PIEA 1OYDA 4A8YA 2UXBF 3IGNA 4Z37A 2DNPA 1S9GA 2KHDA 1IQTA 3HFKA 1R8HA 4LMZA 1RWWB 1ZS6A 3ILJA 3IWLA 2RS8A 5DZ6A 2U1AA 1TR0A 1CS4B 3BKUA 2D7SA 3KLGB 1SI9A 1PC4A 3GV7B 4JI2J 5CYQA 4H4MA 4DX8H 3GJTB 4OV6A 3IRXB 2B5JB 1GAOA 4LIWA 3TX8A 2B6AB 5FJ4A 1MMNA 2HGMA 1N54B 3IFEA 3N01A 5KOWA 1KRPA 3OJUA 3CDBA 4JI4J 3MPUB 5GVQA 4CLTA 2LXIA 4WTOB 1G4CA 4ZVHA 1RT6B 5IC4B 2HZCA 4PR6A 5EX0A 1CS4A 5KFNA 3KLGA 5IOLA 3RBEA 3NLCA 3OR2B 1FXRA 5AXNA 3IRXA 2B6AA 2NXCA 1XR5A 4OHYA 4R25A 5ETSA 3CCES 5GADU 2BEFA 2PT0A 4CWBA 5BYSA 2KU7A 2UVUA 5EWGA 3EX7B 2DNOA 2YWEA 4LFCJ 5DS7A 1O5JA 4JI2F 4EYIB 5L9NA 2DNZA 1YHQS 4DV1J 3D28A 3MCOA 3W2WA 4RW7A 3UDCA 4ZJQA 5KFXA 1VQNS 3N6MA 4JI4F 1IM6A 1JLBB 2CQBA 2XY7A 1QSYA 3PYDA 2VJUA 4Q2LA 4O0NA 3LPYA 3A12A 4WWSA 2ZH8A 2OPQB 1WC6A 2E1AA 4ED7A 3W7BA 1DJ0A 4P2MA 2CPJA 4UOGA 4B9NA 3QAUA 4L6V3 4BWJA 4FXWA 5IQQA 3S01A 2VKZG 1LKZA 3IBFB 3G86A 3GCWP 3J81Y 1J5EJ 1RHRB 1UJ4A 3C2PA 4R8UA 4WXOA 2W8KA 4CLWA 2HEKA 2V63A 2XHCA 2ZH7A 1JJ4A 3HPOA 3LP2B 1HQUB 3R5JB 1EQMA 4LFBJ 5KOXA 5JUMA 1U6FA 1C1BB 4N41A 4ZOSA 2CJKA 2G2YA 1JLQB 2DO4A 4LFCF 5CZVA 2CZ9A 4OLPA 3CCRS 3ZXWA 3N5BA 3MFIA 2G0CA 1WKLA 3LANA 2KYZA 1WC1A 5FD1A 4X84A 2F8EX 4GVBB 2DRAA 1WI8A 3OVSA 3PFEA 1KWMA 4YDXA 2QRRA 4EO8A 4PPDA 4B9MA 1X9WA 3TAQA 4YQWA 1S77D 3V6HA 4A8XA 3LP2A 2ZH3A 2VBWA 4DUYJ 2QSWA 1HI0P 4GKKJ 1C1BA 1MN9A 1SJFA 4GVLA 4ZA1A 4FPRA 4YR2A 2DK2A 2XCAA 3GFHA 3I55S 1C0UA 2M3DA 1FCAA 1VQ5S 2HYIB 1KLMA 1Y9OA 1AW0A 1J5EF 3KK3B 1ZPWX 2GAHC 4JI0J 2FJWA 1W2IA 1UTAA 3HT3A 3DOMB 4ZCIA 2ZBPA 2J6SA 4KHPF 3MAAB 2YKOA 2CPHA 3N79A 1VYAA 5I3UB 4QZVB 4W98A 3M8QB 3RRHA 4ZLLA 3PO5A 3ZTPA 2XY5A 3M9NB 1WTBA 3DLJA 1LWXA 3MEEA 5HBMA 1B99A 3LTOA 4TYAA 2I8EA 1R0AB 2RRBA 2OD6A 2EK1A 2JC0A 2N3LA 1P1LA 4ATNA 1M1KT 2IVFB 3KK3A 1BMQB 3O5TB 4G6VB 4CLLA 3DOMA 1KDNA 1YIJS 1TAQA 2D9PA 1N36J 4ECRA 3CJ5A 5H9FK 5HMWA 3OTOJ
chains in the Genus database with same CATH topology
2VC1A 2OIHA 1ULRA 3TP2A 4ES3A 4X4RA 4AUKA 2X1BA 5I3UA 4K4YA 3O3LA 4UUWA 2J9EA 1HBNB 3JB9k 4G1IA 1WF0A 2PEHA 2E1RA 4RW4A 2ALZA 2KZMA 2CDQA 2VA3A 4WXWA 3OVAA 2LECA 2HIQA 4AE5A 1NK5A 1ZAXA 2V4QA 5JVGQ 3OHBA 3MD1A 1JLAB 3QGPA 4HVZA 4ZP6A 5T7LB 3LWMA 1FKPB 2JSXA 2E9RX 5AE1A 3DMJA 2NSBA 3M6WA 2GO8A 2L9WA 2VFSA 3EUNA 3BN4A 2IC3A 4WFNQ 3ISND 3M2UA 1XR6A 4URQU 2V8HA 1R0AA 4FS1A 3BSCA 4ECTA 3PY8A 3CIMA 4F2RA 4FBTA 1GXLA 3MMJA 4ERDA 2IRYA 3ENWA 3OFEA 4NRUA 4DF8A 2IM0A 1MU2B 3SEOA 4JI0F 3RR7A 2QV6A 2Y1RI 4AL6A 2VG5A 4MYUA 4TU9A 4I6WA 1RT3A 4NLRA 1FT8A 4OLOA 4CNYA 3KHGA 2VQEF 2UVWA 4ED5A 3MM6B 2I5JA 5A0YA 2R4FA 4TU7A 4QR1A 1YRXA 4OZ0A 5C25A 5D4NA 2HMIB 2MGZA 4JI7F 4QYZJ 2VZ9A 1X7VA 3DM2B 1WF2A 3T1HF 4YOEA 1H3DA 4F4YA 1UL3A 3MEDA 2M7SA 3LP1B 2M5YA 2GGPB 3TAMB 4QIVA 3U1NA 4OHXA 2ZC4A 4WFYA 1B0PA 1L3KA 2CQ4A 3BGLA 1GQEA 2QA2A 1L5UA 2RQKA 2GMLA 2AJ4A 1RT4B 1HBNA 3S1TA 1DTQA 3NGDA 4BDPA 3KG0A 1X8DA 3R5BA 5L1LA 2GJIA 1DRZA 2D3OR 4FXVA 4NLVA 5KFPA 3CJ0A 4QWCA 3QGHA 1HW9A 2WHOA 4QIEA 5T7LA 1T94A 1N6QB 4CCHA 5DLGA 1R43A 3M8PB 1JWWA 4ZMMA 3UW1A 2FJVA 3PX6A 2L9NA 1UEVA 1RT2A 5H9EJ 2D3ZA 1R3NA 3CCZA 4USJC 4WK3A 2KKHA 1IKWB 2IMOA 2VA2A 3CCLS 4OMFG 4NA2A 4MIBA 2FC9A 4MFBB 1MU2A 2RUGA 2VG7B 1TK0A 2E1CA 3OLAA 2HS4A 2JFKA 2XLJA 1GXTA 1B7FA 3PW2A 1RT7A 1ZBTA 1WEYA 1TAUA 2LLZA 4WZMA 3OUYB 1L3UA 3OHAA 1FJCA 5B0BA 1HNWF 3MZIA 4I6YA 2K3KA 5B08A 1UVKA 3GG1A 3PX4A 2FLLA 3M8SA 1SJQA 1D9FA 3KOAA 2AU0A 4Q0BB 2HMIA 2D41A 2UUBF 3HHKA 3DM2A 3K7RA 5F8JA 1KN6A 4UUXA 4LF4F 3T9ZA 4ED1A 3LP1A 1KR4A 2GGPA 2U2FA 4N77A 3KLIB 1TK8A 4WE1B 4JI5F 4U9RA 1NU4A 2BRKA 4LF9F 1FD2A 4JOUA 5K8NA 1GXUA 4XDDA 3MECB 4JI6F 3ZZRA 4WF9Q 4EBDA 1TFYA 4C3LA 1RT4A 4GC6A 2HHQA 2XZWA 4WU3A 2JZ5A 4UY85 4TY8B 3PIPQ 1S1UB 3QJJA 5F8IA 4J9PA 3FZ2A 1R27B 1FTRA 1S49A 3P49B 3M30B 2ZOGA 3Q8QB 4CO2A 4HEA9 3V4IB 2FVPA 3C3LA 1U1NA 1N6QA 5IT4A 3R1HA 3NBPB 3M8PA 2LQJA 2GQ2A 4BC9A 1NJXA 2M52A 2VUGA 4E8UA 2XSJB 4ITSA 5J1NA 4Z2XA 2GO9A 2LYVA 2LQ5A 4QW8A 2CJBA 2J7WA 1IXKA 2ZBIA 3LAKA 3HX9A 1REVA 5FDLB 1SKRA 2EVZA 3MM5B 2AJFE 4OIXA 3N5FA 4N56A 5DGAA 3KHRA 1QE1A 1M5SA 4K4UA 3N0VA 1WD6A 1OWXA 2DGVA 2OSRA 2VG7A 4TY9A 4WZQA 3SSQA 2CPYA 4K0KF 3OTEA 2GHWA 2NPFA 4OI2A 2NSCA 2ZOFA 2ASLA 4DSLA 3OUYA 3D1OA 4QU7A 2A2DA 1DZ5A 4ED8A 1URRA 5DM7Q 3H40A 1KOHA 2MPUA 2X51A 5EHHA 4V19J 3BB5A 4Q0BA 3MPVA 2K3IA 1FK9A 4PWUA 1MWZA 4C98A 2Q79A 3TUJC 2XGQA 4PUOB 1S6PA 4TQRA 3MM7A 4NX9A 5H1SV 4TU8A 3SV4A 3MEGB 4ECWA 4ECYA 4A8OA 1OPZA 3KLIA 3HO1A 2K1RB 4KQZA 2VOPA 5LL6d 2ZNZA 2O1PA 1ZPVA 3POTB 4WFZA 1CLFA 5A8WB 2DT9A 3THPA 4QJVA 2V2KA 5IZHA 1T7PA 5EUHA 1K8AT 3GWCA 3HMJG 4B3SF 2NXUA 4O44B 4PXCA 5D6GA 4ED3A 5BYRA 4TY8A 2UUAF 4OZ5A 3HJFA 1NK6A 4M95A 4TLQA 1S1UA 2MKJA 2BUNA 5CZXA 3DXBA 1AXQA 3M4XA 4DQPA 3LGMA 1TKXB 3NBPA 2PE8A 2ZE2B 5GAHU 2J76E 2R7SA 4F4ZA 5I3PA 1WWHA 3KYLA 2YNIA 1HBOA 2MQOA 1FKOB 2HQIA 5FIIA 3CUNA 1X5PA 1S6UA 4I64A 3MM5A 3CDEA 2RT3A 2AYGA 3I56S 3KLHB 1WHXA 1ZZNA 4EU0A 2XMUA 2B7BB 2FVRA 1KQGB 1NH7A 5DETA 3F41A 2KXHA 3VQSA 4ECUA 2W7AA 1N52B 3TO8A 2YKMB 4DPOA 1FE4A 1ZOTA 3L95X 1FRJA 3K5LA 4D3HA 2BVZA 2FHOB 1VHFA 1X4DA 3DCAA 5MAOA 4K4VA 4B9VA 5K14B 3KKFA 3D1QA 2IA0A 3PX0A 1LK5A 2LEPA 3CC2S 2UXDF 4PUOA 4PXDA 5D78A 2WRMA 3KHLA 1JMTA 2NR0A 2KFNA 3PR4A 2J7KA 3UCUP 1MMDA 1VQPS 3MEGA 3AY0A 4IQXA 1VGYA 1XMBA 2APOA 2DHXA 3B78A 2NREA 2D9OA 1H2UX 3IAS9 1VI7A 2H5EA 3POTA 1CQNA 3V5RA 4ZCMA 5A8WA 3FEXB 4DR3F 1S0OA 1F60B 2W4PA 5IT0A 4USIA 2J9DE 4X4QA 4WJBA 4LSNB 2MY7A 5G4DA 1Q79A 4O44A 3VCDA 4QW9A 2RQCA 4MJKA 3WX4A 5GMKa 3KG1A 3MPYA 1JLFB 4HDGA 7FDRA 1JX4A 2WONB 5HI7A 3J80Y 3QZ7A 4UW2A 2B4PA 4IDKA 2B5JA 1RYSA 4ZPVR 3TA1A 1ZM2A 4CT9A 3IR7B 4Q43A 1U26A 2F9JA 2EFOA 2Y1IA 3ITHA 4DLEA 1Z2LA 1SB6A 1TKXA 4NYOA 3GR0A 2ZE2A 2I1RA 2RMLA 3P6YC 2KHCA 1F5CA 4M5DB 2J6TA 1DTTB 3D0IE 1FKOA 3MMBB 1Y4ZB 5LJ3Y 3MMAB 1OQ6A 2KO1A 4DMZA 4DQSA 4C8LA 3LUYA 1R8AA 2IJFA 1SL2A 3KLHA 4MK7A 1K1QA 2IVYA 2N7CA 3T6JA 4KC5A 3V6KA 3G96A 2Q1LA 4N47A 1G7CB 3DDNA 1HWLA 3GIIA 3TRGA 1XR7A 2YKMA 3FVYA 5LJ5Y 1RT6A 3W3SA 2DNMA 2MB0B 4OI0A 4YFUA 4G1QB 1LW2B 2FTRA 3HHLC 4TN2A 2GV1A 3CWJA 3R1LA 3THVA 2AYBA 2YKQA 2PA3A 3E01B 4NLQA 3OVBA 5K14A 4HT7A 2VPYB 2XMVA 3RB3A 2CPFA 1YSJA 3R5AA 5KFMA 4EZ9A 3T3FA 3FEYB 2V9WA 1URNA 1KLNA 3NMRA 2ILYA 4RW6B 2QYCA 2FLOA 3DGPA 3OR2A 4O3RA 1YRTA 2UUTA 2WOMB 4IFYB 5DDOC 4RKUC 3FDSA 4NLTA 2OFHX 3OPKA 1KONA 4IOBA 3RTVA 1D8ZA 4LSNA 4ZP7A 2ADCA 1JJHA 4FNHA 4J9OA 3OSNA 1WHVA 2F40A 2MZTA 4I2PA 2ZHBA 1ZTTA 3CCWA 2KM8C 4ID8A 1JLFA 3MURP 1U49A 4QR2A 4ID5B 4IH5A 4PCQA 2EG1A 4K4WA 2Z2LA 3T5KA 1SQEA 2JC1A 2GNKA 1RTHB 2MYFA 2QLXA 5LSLA 2FJAB 2Q3PA 3B8HA 3MWBA 2CFXA 5CXTA 1APSA 1U4BA 3NG8A 1M5OC 2PFFB 1VJWA 3WC0A 4J9QA 1UVMA 3MD3A 4X4VA 1VMBA 3FCHA 4J5OA 5LT5A 3Q8PB 1S76D 4ECQA 3FMWA 2YTCA 2W4CA 4MK9A 2P5VA 1JNRB 1N5VA 4KE5A 3VAMA 1UEUA 3I87A 2F3JA 3PRDA 4QBUA 5KFOA 4X4SA 2XNRA 2HHXA 1F5AA 3QWUA 1HBUB 1U47A 1SL0A 4DJBA 3SCIE 1SJRA 3K0JA 3FQKA 1IBLF 5EDWA 2QLWA 4H4KC 4RUCA 4ICLB 3IWXA 2M2BA 2N7YA 2BQ3A 4G1QA 3DRPB 3M1VB 4DV7F 4B3OB 1N33F 4YP3A 5M2RA 3MOZA 3F56A 5KG0A 2HS0A 3VAKA 5A8RB 4JI8F 2RNEA 3JSBA 4DWIA 2IMWP 2CJ9A 4M1KA 5C24B 1D3WA 2DISA 1NEEA 1QM9A 2IJNA 3PV8A 4C4WA 4DR5F 1ROFA 2SXLA 2WOMA 1X5SA 2UVRA 3AH6A 4WYLA 5DO2A 5G0RA 1K0VA 2R2UA 3TVZA 4BC7A 2JLGA 2BANA 3I6PA 5HMYA 5LSOA 3AJ1A 4NCGA 2NS1B 4DV6F 1M90T 3HHNB 3BR9A 2E66A 4DR6F 1FEEA 1ELOA 1TL3B 2FC8A 3QLHB 1Q86T 4DSKA 1YWXA 2V5HG 5IQ6A 3G6ES 1TK5A 5B0EA 2OH2A 1H2TZ 4RBVA 4ZPDA 4QPXA 4X64F 1JLBA 1YTYA 1RTHA 2DCUB 2YVSA 4I7FB 2YQ3A 1S97A 1H7WA 3M6UA 2M70A 3SI8A 4NYZA 4WKRA 1TVRB 2ZOMA 5KFLA 4RW9B 2E9ZA 4W90B 1T3NA 1SH0A 2YX1A 3M6XA 3LW5C 4RNFA 2XWXA 4F4XA 2OPQA 3CIZA 4DV5F 1JNZB 5KFJA 3PDNA 5AXLA 1NK4A 2RILA 1UMJA 2UP1A 1C4CA 4RUHA 4A8SA 5F8LA 4CO3A 3UCZP 2E9TA 1HBUA 1VFJA 2VONA 2CVEA 1QSLA 4LF8F 3SYZA 1PGZA 2QZ8A 2LA6A 2GQCA 1SH2A 3O2IA 4ICLA 1Y5LB 2ABYA 4YR0A 2WB1D 1M5HA 1BLUA 1JB0C 5KFEA 3NAIA 4B3OA 4C97A 1H6KX 2E5HA 3MHYA 1S1WB 2M4MA 2BR0A 3AQPA 3PACA 5DG9A 3K8VA 4LF7F 3OV7A 4I56A 3ONQA 2BM1A 2HRYA 1KTVA 4JV5F 3LF0A 5CD4H 2V94A 1EETB 5DRKA 1TZ0A 4YDDB 3HF5A 2CIMA 4LSLB 5EN1A 3JTPA 4Y2IA 4MIAA 2J6UA 2QA4S 2DIVA 1HQUA 2BM0A 1DLOA 1AFJA 5JJBA 3RB6A 4C11B 4ZHRB 5DQGA 3SV3A 4EO6A 1FE0A 1VQ6S 1TL3A 1F2GA 3QLHA 3NCPA 5HQ8A 4IG0B 3VTIA 2B7CB 2XEXA 1V3RA 3ULHA 3HVAA 3K59A 4NXMF 3CCQS 1LWCB 4I7FA 4JUZA 1CQMA 2P9EA 5E3PA 4DS4A 1JLQA 1O8BA 4IR9A 4DF4A 1TVRA 4RW9A 1OS5A 2YNHB 1VQSA 5EWFA 3NNCA 1FRLA 2XI2A 2PSZA 1VC6A 1RAJA 4ZK7M 1MMLA 2IRUA 4QWDA 1U6BA 4K4XA 1FF2A 4EBCA 1KTQA 2O01C 4FS2A 5KFSA 5C42B 4X62F 1RJJA 5KT4A 1A6LA 2B4OA 4K5SA 4QIWD 5KG4A 4DSJA 4QWBA 4CI0B 1RISA 3ZZZA 1S1WA 4NRTA 2VB6A 2ASYA 4XO0A 4J9SA 2HFOA 2C3YA 2EC0A 3HZEA 3TI0A 5KG6A 2C2EA 2DR5A 1BC6A 2HG4A 3GIJA 2DB1A 2AX1A 2DHAA 2ZDPA 3FFIB 2HFZA 2R7QA 3UR0A 5KFKA 4DFKA 3H2UB 3M2RA 4K2XA 1RWUA 1HI1A 3DLKA 4PKDB 5KG1A 4ZCLA 1U2FA 2ZVSA 2XGPA 4HH1A 1EETA 1MW7A 5F0WA 2IM2A 3TOQA 1SKWA 3R27A 4LSLA 4Y00A 2OTLS 2O67A 2DHGA 1SKSA 3MM8B 1N48A 3BREA 3QMQA 2CPEA 4G1PA 1VK8A 1PO6A 2A10A 3OXFA 2N82B 2XCPA 4R0EA 2HNZB 4C11A 4ZHRA 2CZVC 2AD9A 2KTQA 3P96A 1SL1A 3WC2A 1X9MA 2ZHOA 2FY1A 1YJRA 1TL5A 4X4NA 4KHRA 1LWCA 4RWXA 3OR1B 4DHVA 4PQUB 3OFGA 4UQTA 4PQAA 2C22A 4IO1A 4EGLA 3MUMP 4A8FA 3V6DB 3H4BA 2YNHA 3PW0A 3QPIA 2LQ9A 3DDKA 4C8YA 2GIQA 1WG4A 1QLNA 2P6TA 1XEZA 4ILLA 2UVVA 2ZKUA 1N56A 4KPYA 4I67A 1JLCB 2DO0A 3G6YA 1N0UA 2AGPA 2J0QD 4MKAA 1LWEA 3KG4A 4IOCQ 1QAIA 2FLNA 1XNRF 3KNGA 1N0VC 3HHLD 2OMOA 3I0SA 4IH7A 1CG2A 2ROEA 3IO1A 4I0WA 1VK3A 5SZTA 1HPZB 4FP9A 5IS2A 2I2YA 3VAHA 2AV5A 4Y34A 3S6EA 5J2MB 5GAEU 3N6NA 3NS6A 1XMOF 1S1XB 4PG4A 5E3AA 5KG2A 4MH8A