2XMVA

Copper chaperone atx1 from synechocystis pcc6803 (cu1, trimeric form, his61tyr mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGYEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSR2857 PROTEIN
publication title Visualizing the Metal-Binding Versatility of Copper Trafficking Sites .
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Chaperone
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xmvA00
2GGPB 1OQ3A 1Y3KA 4HH1A 1N5QA 4NL5A 2LQBA 2AJ0A 1URRA 2HFOA 2Q3PA 2XMUA 1JWWA 2EW9A 1AFJA 2K2PA 1FESA 1CC8A 1YJUA 1Q53A 3BR8A 4FNIA 2ROPA 1CPZA 1SI9A 4HI1A 3F44A 3FRYA 1TL5A 5B0EA 5B0CA 4ZA1A 4HL9A 3TRGA 2IFXA 1OPZA 2IYGA 2QLXA 5KAKA 3IWLA 1K0VA 1Y9OA 1XBWA 2OD6A 1APSA 1RJJA 3BN7A 1X8DA 3KG0A 1CC7A 3GZ7A 3BDEA 2HFNA 5T7LB 1TZ0A 3FMBA 2N7YA 4Q2LA 2XMJA 4OJ3A 2OAUA 1JK9B 2GO8A 1Y3JA 2L3MA 2BJEA 1Q8BA 2RILA 3BGUA 4OJGA 4U9RA 3HF5A 1VQSA 2GCFA 4DN9A 4EFAC 2N4DA 1QUPA 2FHMA 2AW0A 2XMVA 1KVIA 1FE4A 2FTRA 1N5VA 2HIQA 3WDOA 3DXSX 4F67A 1YRXA 3KNGA 2RSQA 1P6TA 2OD4A 3CJKB 5B08A 2AP6A 1ULRA 1W2IA 3HDSA 2VV5A 1FVSA 2BJDA 2CRLA 2QLWA 2GGPA 3TOQA 1N5TA 2HLUA 4DPOA 1YJVA 4DL0C 2LXFA 2IYIA 1TR0A 3BM7A 4FNHA 2ROGA 2ROEA 1AFIA 1GXUA 2PGCA 2N4CA 3KKFA 2AJ1A 4OIXA 5F0WA 1SQEA 3HHLB 3MZIA 2BBEA 1GXTA 2XMTA 1FVQA 1X0PA 2KYZA 1YJRA 1U7LA 2GA7A 3LGNA 2FIUA 1P8GA 1MWYA 1Q4RA 2G9OA 2OFGX 2PD1A 3FGVA 4Y2IA 5T7LA 2K1RB 2HLTA 1KQKA 1TL4A 1Q8LA 2GFFA 1KVJA 2LDIA 2ZDPA 2FB0A 1VQYA 1X7VA 4YEAA 3K7RA 3I9ZA 1FE0A 1MWZA 1N5SA 2QIFA 2OMOA 1YJTA 2ACYA 2OFHX 2HQIA 2OKQA 2ZDOA 3BF4A 3MCSA 1LQ9A 3CJKA 3BB5A 1SB6A 5B0FA 2BYCA 4OJ1A 2XMMA 1OSDA 2W4PA 3VTIA 1FD8A 3LGMA 3E8OA 3IWXA 2W4CA 3UDCA 4Y2MA 5B09A 4A48A 2W4DA 5IXUA 1TUVA 3KG1A 2KT3A 2XMWA 4A46A 4A47A 4HH0A 2RMLA 5A6PA 2KT2A 3T9NA 2GV1A 2VH7A 3HHLA 3LO3A 5B0GA 4YDXA 2XMKA 5K9FA 1S6OA 4ZOSA 5B0DA 3QMQA 1WD6A 1OQ6A 2ASYA 4OJHA 5B0AA 5A6WA 2LQ9A 5B0BA 3HX9A 2BUNA 2KKHA 2K7JA 2OP5A 2K7KA 4NPOA 1R6YA 1Y0HA 3HHLD 4HI2A 2RU9A 2JDJA 3HHLC 4Q2MA 3TNVA 1S6UA 1FEEA 2K1RA 1IUJA 1YG0A 2QYCA 1V3ZA 3HFKA 4QOTA 4Y2KA 4A4JA 3QGPA 5F0UA 3DCAA 1AW0A
chains in the Genus database with same CATH superfamily
7FD1A 2DISA 1X4GA 1RCXB 3PEJA 5A2QU 3IG1A 3DU6A 1TL5A 2K3KA 3EWGA 2CVEA 3R6GB 3DRRA 1FXLA 3GIIA 1HW8A 1DTQA 1EETA 4M8LA 2RRBA 4Q45A 1S79A 3OTCA 2OD4A 2G1HA 2GIFA 1FO1A 2C22A 3IWNC 3W9JA 3CJ5A 3SQGB 5D0HA 3UVJA 2V34A 4C0OC 3K2YA 4RLEA 3HHEA 3K5PA 1HW9A 2Q1LA 1Q4RA 4ICLA 1MROB 4ZVSB 1H7WA 4M5LA 1X4CA 2KZMA 3HT0A 2IMWP 1OWXA 1SC4B 1FE0A 3TO8A 3S01A 4KFBB 1EZZB 1QLNA 4UOHA 4CTAA 2KT5A 2G1DA 4D3HA 4A47A 2HGNA 2RS2A 1M5HA 3M8ZA 3D2WA 5H9FJ 3KOAA 3C8YA 1Y0HA 4ZKAA 2JDJA 3HFKA 1X60A 1VK8A 4M5MA 4RW8A 1HNZF 5I3UA 5GADU 4TU9A 3LP1A 3L3CA 1TMJA 5IQQA 1RWXB 3MR7A 2HWIA 3DRXA 2R7TA 3O6QA 2OELA 2EK6A 1J5EJ 3DRPA 1NSKL 2VG7A 4Q2LA 1FKOA 2IVMA 1HNVB 1GMUA 1R8BA 1CULA 4ED4A 3DGPB 1XQIA 3PCOB 3H40A 4C3KA 5HATA 1VQMS 3OUYB 1U1NA 4MT1A 2UVVA 2B8QA 1HPZA 2VFTA 4Y2AA 4LSZB 3JSMB 2WW8A 5EHHA 1M5PC 2FHKA 4UZBA 2RQ4A 3UD4P 1KR4A 1HBNB 3BGOP 5DLGA 5C2CA 1X4HA 1MWYA 1RTIB 2KYXA 2N3OA 3AOCA 4LF2A 1D1UA 2PMZD 4LIRA 2NYHA 4WZQA 3HHDA 4A8OA 1EKSA 1X9SA 1HKAA 2R2TA 3NLCA 3TUZC 1F0XA 4GO5X 2KG1A 4TU8A 4RUBA 4QWAA 1LWEA 3GV8B 2BKOA 5AT1B 1PILA 1HQEB 2XLJA 4F04B 4DPUA 1TK8A 1U0HB 3FBFA 5KFYA 3OLBA 1UJ4A 4PPDA 2UUAF 1RHQB 1B0TA 1AFJA 2MQLA 5KAKA 4TY9A 3H0PA 1R3NA 2FHOB 5T7LB 2DGSA 3A3PB 1FXDA 4F4XA 4WF9Q 3RYLA 1RAAB 2DCUB 1YJNS 5L9XA 1JXLA 1R0CB 3D66A 1LWCA 4DF8A 1KEKA 8ATCB 3VZIA 2C3MA 1OYEA 4W98A 4ZJOA 4LFBJ 2V2VA 1VQNS 5KFAA 2ZE2B 3J81j 1PYOB 3GLJA 4F2RA 3OTOJ 4NLGA 2HBQB 1S1WB 5D4OA 3ET6A 4IYQA 2FJEB 1XR5A 5GVQA 3MM6A 1U48A 2AV5A 3L7UA 4PG5A 1S6PB 4RKUC 5JVGQ 3IXQA 2X1BA 2APOA 3CPWR 2Z58B 1GMWA 4OZNA 4RBTA 1TUWA 4NYPA 3FQKA 2UV8G 4GVBA 4NLOA 3BR9A 2BM1A 3D54A 4A8KA 3PW7A 1NKBA 2ABYA 2KXNB 2CJBA 3QIDA 1HARA 4MMOA 4EO8A 3D9BA 4CO5A 1HNXF 2IPOB 2QE5A 4DXLA 4IDKA 2UUWA 3UFCX 4PZVA 1VC6A 3W2WA 3W64A 1WEXA 3UDLA 4RWWA 4PKDB 3RRGA 2XSFA 4DU8A 3QLHA 3O3LA 4LT6A 1VQYA 2QV6A 3MOZA 2ZDOA 4YB1P 3MEEA 3MCSA 1JLQA 1PJ6A 2CQDA 4ER8A 3RZAA 3C66A 4OI1A 1X5SA 2BEFA 3BV8A 2DY1A 4OJHA 2M8DB 2HHPA 5G0RB 1M5KC 3BSCA 2WOMA 4R8UB 4MJKA 3RG6A 2PMHA 2P9EA 4OYXA 2GIQA 3CCUS 3TAMA 1RLCL 2H5IB 2OPRA 4KT0C 2DHHA 1UKUA 4QWBA 4OHZA 1D8ZA 3PO4A 3NGKA 2Y8WA 1FRMA 1TL7B 4LRCA 4IRKA 4ZN3A 2CA9A 3HF5A 4PR6A 3M2RA 2E1RA 4DR5J 2M2BA 3OL9A 4TQRA 2YKQA 2PFDA 3GYXB 5EUHA 4J9NA 3Q8SB 3FZBA 1TFYA 4W4MA 1FJEB 5EWFA 2V68A 3D0GE 1RWMB 3M6UA 2X51A 4KJIA 3SQGA 2LYVA 4B9LA 4DV0J 3C46A 1W25A 1RSCA 3N6MA 2YKAA 3NNCA 2VU5A 1SB6A 5E5NA 3T5LA 2J7KA 3I5CA 3ETMA 1ZM9A 4RNMA 5L39A 1N54B 5ETRA 1FFGB 5HAOA 4LFCF 1GAOA 4NRUA 3ZTRA 5HROA 3DN9A 3EICA 1QSLA 3NS5A 1NH7A 5B7WA 2O3DA 2DO4A 3CC2S 2V4JB 5AJ3J 2HURA 5E3QA 2E66A 1VQKS 3F41A 1X4BA 2HIYA 3ZZYA 3R97A 5K5MA 3A3OB 3GTYX 1YX2A 4CLYA 4I4BA 2JLEA 2WSEC 3D4JA 3BPSP 3HVRA 4HR2A 4MFBB 3I4HX 2BE7D 1C4AA 2OPSB 4B9VA 1KKHA 3K5LA 3BM7A 3CC7S 2CQBA 3OJUA 3MMBB 3R3TA 3JB9k 3JSYA 4IR9A 2M8HA 1HBNA 4KR0B 3BGRA 1AXQA 2AHOB 3FRZA 3QWPA 5CHCB 1N36J 3SFUA 4N8NA 2CXEA 4B3OA 3AA8A 1DQAA 4KH1B 4DQPA 5KFRA 4PWUA 1UW4A 1HBOA 1B0PA 1WD6A 1SKWA 5LJ5Y 1S6UA 1E6VA 4QOTA 1S76D 2B51A 3B4MA 1FTRA 3DLGB 3CJ3A 4WFNQ 5EWEA 1YJUA 1KWMA 5KT4A 1VBYA 1TKZA 1N5YA 2AZ3A 2HGMA 4M5GA 1UZDA 3PYFA 3PW2A 2BJ3A 4BHQA 1N0UA 2P6TA 4K0KF 1YRXA 1M1KT 5D0RA 2IBOA 1BUXA 2ZD1A 3TEHB 3MD3A 4DUTA 2VICA 2BOPA 3WBZA 1VIXA 2B43A 3O5TB 2ATLA 3HHKA 2HQIA 2FPHX 2G2ZA 3MEDA 4IR1A 2NLWA 2MZRA 3CCES 1CJTA 3KTQA 4KBIA 2ZC3A 3MF5A 1U6ZA 4V19J 3UDCA 1GTEA 1UVNA 1CJUB 1S77D 5HLFB 4ID5A 1NK4A 4AQYF 2DIVA 4J90A 2AYBA 2XG8A 3UDVA 4KB7A 1T9YA 4WTYA 1UFLA 3MR3A 5HK4A 4I0WA 4KPCA 2FLLA 3KK1B 1DTTA 4MK8A 1TAUA 4DFJA 2ZH7A 1VQ8S 3D0HE 2BE2B 3TX8A 2AQ4A 1FERA 3CE8A 5DJBA 2B6AB 3QJLA 5DG9A 1FE4A 1VRUA 1N32F 1VQOS 1NHVA 2CJKA 4A8YA 2Y3YA 4NRTA 1YTYA 3MTKA 4NXMF 3DRSB 2ROGA 3NS6A 4H4MB 2RQMA 3QT5A 2DPIA 2YQ1A 1QDUB 3SXLA 2BANA 2U1AA 2DR9A 4DQRA 4L3KA 2J0QD 1U47A 1RAOA 2VG5A 1HQUB 4C8OA 3RAMA 5F8NA 5D4LA 1FRIA 2EPIA 2W4DA 2GNKA 5CCLA 4RNFA 2YNHB 4TNOA 3LO3A 4YY3F 1P9QC 1ELOA 1HMVA 3PNIA 4NI2A 2UU9F 5CZXA 4X4QA 1N0VC 1YZ6A 2P9GA 1JLFA 4HH1A 3KLEA 4DUZF 1FD2A 1RHMB 5LSRA 1Y5NB 3DRYA 3PYGA 4ECRA 4K4ZA 2F9JA 2ZUGA 2GCFA 3C6TB 1VC5A 2DEIA 2BOAA 4HTIA 3G6VA 4UT4A 2GAHC 2VFRA 4BWMA 2IYIA 2DTJA 2R2UA 2XC9A 3GE9A 3UN3A 2CAJA 3TQEA 4RNHA 1QAIA 1FCAA 2CQPA 2DNRA 2FZGB 2D3O1 5KFFA 4BBYA 3IM8A 1S1UA 1YSJA 2GHWA 1HL6A 4L72B 2WONA 1IBLF 3TARA 2Z57B 4HHHA 2OPPB 4OV6A 5F41A 3Q8RB 5IXUA 3KLIA 5K8NA 1TUVA 1C0TB 3HHLA 4X84A 3QRQA 2ASYA 1J27A 1MMLA 2IM1A 4KPYA 2CWKA 2A3JA 3SV3A 1URRA 2JRSA 3N0VA 2R2SA 2DNLA 1XN9A 5KFMA 1KONA 3KJFB 4XPCA 1RJJA 4DX6A 3LALA 3TX0A 1QM9A 2DNZA 3W63A 1J5EF 4ED5A 4OYWA 3C6UA 4K4WA 4C11B 3ZZRA 1YBTA 2E7WA 2QL7B 3PFEA 3VGTA 3G82A 1I5OB 2IHR1 6FD1A 4FNHA 4ZLNA 2VASA 5KFJA 1NJIT 1NPPA 2GS8A 3MZIA 2HVIA 4FPRA 5FJ4A 2BQ3A 1ZPWX 2O1PA 4X4VA 3ZTSA 4U67Q 4WFBQ 1UFKA 4C8YA 1UL3A 4CO1A 9ATCB 1PCAA 4USIA 3BBFA 3P3DA 4WXOA 2JOQA 2ZH1A 1REVB 2CKWA 5KT3A 1ZOTA 5J2MA 3UN2A 1G3OA 1XC9A 1S49A 3MMAA 3I56S 3IO1A 5ITHA 1OQ6A 4O4GA 4L74A 3JYTB 3UD5A 1R6YA 3SCLE 4C8LA 1QTMA 1SQFA 4KYZA 4DV6J 5J1EB 3W65A 4Z2XA 5L1LA 3Q8VA 3GFZA 1SI9A 3FRYA 3KLFA 3THPA 1K0VA 3M1VA 1MN7A 5BYSA 1XBWA 1IM4A 4WP9A 1VYAA 5F8JA 3BGUA 4U9RA 3CXCR 4DJBA 1P27B 4NLWA 1QUPA 3ISNC 4E8UA 3AD8C 2DT9A 5D3GA 4DL4A 1K0TA 3ILIA 1LK5A 1TFWA 1QAXA 1U2CA 3R6LB 4KGXB 1HIYA 1JNZB 4BDPA 2XS5A 1T95A 2WHOA 3KJVA 4R5PB 4QPTA 2CQ2A 3CO0P 2ILYA 2LDIA 2HRTA 1R8PA 1RAIB 4NLXA 3GP9A 2YKNB 4LFBF 2Q43A 2R7QA 5HSPA 2A6OA 4PXDA 2Z4PA 3T6BA 2P2CB 2HHUA 4HT7A 3QYYA 2ZH2A 1OY6A 1UAWA 3US5A 1SH0A 3MI7X 3FBCA 1ZETA 2NS1B 4J91A 3PIOQ 2KKHA 2OP5A 2W2NP 1EX8A 1NM2A 1VIOA 5HLFA 1F2HA 3O1LA 4F0HA 2MJUA 2MQQA 2J76E 2CZ4A 4C97A 2UVUA 1C1CB 4LQ9A 3G8QA 3BKFA 1APSA 3B4DA 4PXCA 4LSLA 4EU0A 3GZ7A 2KRBA 3G86A 3JSRA 5DQHA 3EVWA 4ZCLA 4GKJJ 3OHAA 1HWLA 3VF0B 4J9PA 1QE1B 2YWGA 1W2IA 4M5IA 2O01C 1ZAVA 2RDIA 3E2EA 1LWXA 2BBEA 4N7TA 4XTTA 3UCZP 4UUXA 4B3TJ 1RU1A 2G9OA 2B5JB 2B9WA 1S72S 2HQFA 3LH2S 5LOQA 1SC3B 4NLQA 2MZJA 4YEAA 1F1BB 3FKBA 2AYGA 1S0NA 3FFIB 4OYPA 3UDEA 1V3RA 4W92B 1WG4A 3L95X 1X4FA 1EIYB 2R7SA 2HZCA 2L08A 1YIJS 2VZ9A 3KNAA 3TZYA 3RR8A 1IUJA 1KQFB 4DL7A 4BC7A 2CPZA 1ZBTA 1D0EA 2G0JA 2GVZB 3UI3A 2Z2LA 3K8WA 3EE3A 1U45A 5LSOA 3CDWA 3PJXA 5HP1B 1S97A 1HNIA 4YHHJ 4O4RA 4QIVA 5LM7E 2YKPA 1U6FA 1ZM4A 3AJDA 4ZVUB 3W5ZA 1S4EA 3VV2B 2ZC4A 1T9XA 3D7SB 4DR5F 1KC8T 4X2BA 5GAHU 2J8AA 3LGNA 2FY1A 3HFZB 3BSNA 5L8RC 2ZDPA 1X7VA 2DH9A 5LMUF 2W9BB 2DCLA 1HD1A 4DV0F 3MPVA 4YB5A 5FD1A 5IQ6A 3A4TA 1HYSA 1GT8A 3D0IE 4B3RF 2XWYA 2CNNB 2W8LA 5L1IA 1D09B 2EFOA 2GQ2A 4FDFA 4PWDA 2EG1A 3CDAA 1S1TB 4DV2J 2B4UA 5G4DA 2N82B 1JWWA 4K2JA 4ZPAA 5KFQA 4FBUA 4WYLA 4ZVTB 1Q1KA 5AJ3F 1TL1B 4M1KA 3DOMB 2CJQA 5HL7Q 3DNCA 3ENVA 1V5VA 2FTRA 4WKYA 3AFGA 1S59A 5ETMA 1TKTA 1N34F 3TUPA 2QLJB 4GKKJ 1NPKA 3OT9A 3CD7A 1BQNA 5DZ6A 4DPWA 4P71A 1HI8A 2XCAA 1Q8IA 3EMTA 4WIQA 3PO5A 1MMNA 1VMBA 4UY85 3CD5A 2KG0A 4ZVGA 3QZ8A 4OQJA 3BF4A 3RB0A 2R4FA 3NEKA 1SJ1A 2PEHA 1KQGB 4Q8FA 4AL6A 1N36F 3OQ2A 4P10A 4IRDA 1A6LA 3GILA 5FIIA 1RA6A 2H51B 2FVSA 4JV2A 3HHLC 1V9OA 3HD1A 1H73A 2HMIB 4WKRA 4U7CA 1ZA2B 4F3MA 3W5XA 2MLZA 2BRKA 3WC2A 1WI8A 5B0EA 1UMJA 4URQU 3UPFA 3PY8A 4RR5A 3TJAA 3PR5B 1JJ4A 4ED1A 1C2PA 3EGZA 2DEJA 4WK1A 3TA2A 2HQGA 3QRPA 3TP2A 3KDNA 1RTHA 4A8MP 4CWBA 1UVIA 4O0IA 5M2PA 4YQWA 4N56A 3KMQA 2HFUA 1U02A 4IH5A 4ATNA 1R31A 3W62A 5HQMA 4FXVA 1JLCB 2BQRA 2EBGA 3LANA 3ILJA 3NY0A 2R3VA 1G7CB 4WU2A 2ACYA 4DSEA 5E3CA 3QO9B 5CH7B 2BJ1A 2OI2A 1RB0A 1RP5A 4LSNB 3MCMA 5U47A 2E9RX 4EUVA 3BREA 4ES3A 2ATCB 4AXIA 3NAIA 3EGWB 1L3TA 1NDLA 2E5HA 2F65A 1HWIA 2IVFB 2GMHA 3PKYA 2PA3A 2ZJPQ 2D7SA 2B4PA 1ZTTA 3VGVA 4ANEA 5LXYA 3HHNB 4MK9A 3FSIA 3TA0A 5H1SV 4QBUA 4TKTA 2HBZB 4P73A 2E5LF 4WU3A 4WP3A 2UXBF 2GVDA 1K1SA 1ICEB 5HQ8A 1T9WA 1LXJA 3T9ZA 5DETA 1FKPA 3GQCA 4K4YA 1A9NB 2DKOB 4J5OA 5IFMA 5J2PA 1S9GB 1ZM2A 1R0BG 3WZ0A 1TL3A 4J9MA 1XNRJ 3FEZA 1SL0A 1EB0A 3H2UB 3NGTA 5K20B 3UCGA 4C98A 5A8RB 4J9LA 3IRWP 3IR5B 3EZOA 1X31C 4I2PB 1GH8A 5HJYA 1W2BR 2YQ3A 4QIGA 3POTB 2HEKA 3I5BA 3M4XA 3TVYA 5THWA 4QYZK 3QQCD 3CMQA 3SEOA 1VLOA 2L9WA 1RTJA 1X0FA 2Y1IA 3FCWA 2EKYA 2EFQA 2VPWB 1A0OB 4LREA 1RKIA 2EW9A 3EVMA 3S7RA 4LRFA 5DS7A 4OZLA 5E2QA 5IC6B 1I94J 1TZ0A 1RT3B 4WXWA 3BQ0A 3PV8A 2R7RA 4EBEA 4WE1A 2HNYA 2C2NA 2N4DA 2N7CA 1KOHA 4NA2A 3SSRA 4M5DA 2AP6A 2XO7A 4DR4J 3NBPB 2J5AA 2N4CA 5J1PA 2X1FA 1D9AA 1J5OB 3H8YA 4ELUA 4QQBA 3JXOA 1WSRA 3DOLB 2B56A 3MM8B 4F50A 3W60A 3MMCA 1TL4A 2DRAA 2KHCA 4ECZA 3OTEA 3M30A 3JTNA 2C3YA 4OMFG 1XMQJ 2W7AA 4KKOA 5B09A 3CDUA 4KO0B 3M32A 3Q23A 4UQTA 3T9NA 4B9SA 2FJAB 5L38A 1X9WA 4ED0A 2RUGA 1Y00A 4NLSA 2H4WB 4JYAJ 5A8WB 4J9KA 5DGAA 1JJCB 4BC9A 4USTA 1SUQA 4RW9A 1NSAA 3SCIE 4UW2A 3M8WA 2IFXA 2QL9B 2H54B 2YVSA 3J7AN 4JI8J 4ALZA 2GJIA 2XMVA 3CW2C 1WELA 4LF8J 4WCEQ 2QTWA 3IS9A 2F8EX 1Q8KA 4KHMA 3KKFA 2F7VA 3QT8A 2JH3A 1S9EA 2KFNA 1SC1B 3FBBA 1KQKA 4CT9A 1IJFB 4ED3A 3T1HF 3KG4A 3LTOA 2HAIA 5JJBA 4P2XA 4TY8A 4OZ5A 2DGTA 4DI6A 3W2VA 5IV4A 3I9V9 4ZCKA 2R7OA 4PABA 5HI7A 2QC3A 2WAQD 4ECUA 1RTDA 3KUHA 1TK0A 1CG2A 4G6VB 2FD2A 2Q3PA 2CJYB 2AGQA 4N77A 5KFTA 4DV6F 4QIWD 1F6TA 1QAYA 3H4DA 2ZH5A 2G13A 4WZMA 5DDOC 1RT7A 2W1BA 2ZBCA 2HHTA 1N5TA 2ASDA 2I38A 4CQ1A 3PKMA 3HULA 2QL5B 3IM9A 1RQ0A 3ZZZA 1S6QB 2K1RB 4DG1A 3IGNA 5LL6d 1WUUA 3D1QA 1HLWA 4V19X 1FWLA 2ZFHA 5IWAJ 1SJFA 1LOUA 3VTIA 4CLTA 1BGXT 2FY8A 2PE8A 4MIBA 3M8PA 2X3GA 2D3OR 5B0GA 1T05B 4X4NA 1O6XA 3O8WA 1VQLS 2XYHB 1N52B 3CCVS 2COLA 3PDNA 3BGLA 4E98A 3FNNA 2QYCA 3IA0A 4G3IA 2PMWA 3R1LA 2HHHJ 1U1PA 2PFFB 3OPKA 4R0JA 3IP0A 1AZSA 1LK7A 3KHHA 2I1RA 1OPZA 2IYGA 4F7VA 4K8RA 4ZCMA 3OJSA 1GMWD 1QSSA 4IKAA 1RAHB 4P52A 1SV5B 2L48A 1S1VA 2J9EA 2V0NA 3RB4A 3GU0A 1ULRA 3VZHA 1CVJA 1UZHA 2DD8S 2XO6A 2M70A 3P6YC 3Q0AA 1LW0B 4JI2J 2MZSA 5KFPA 3BJYA 2ZM6J 4DL2A 1GMVA 4DS5A 4B3TF 5KFSA 2NUUG 3BB5A 3DLEA 1XERA 3MUMP 1ZYQA 3TUIC 1RT6B 2WZ1A 2ASJA 4YDXA 2UP1A 4USMA 5CYMA 4YDDB 1EJ7L 1FI4A 2MZ1A 3R8YA 3GV5B 1V3SA 2HK3A 1AUSL 2RB7A 5CYQB 2YNIA 2XMUA 1BD6A 2EG2A 5IS2A 3H5YA 1ZH5A 3AXMA 3TWZA 1JLEA 1FKAF 2IRUA 4NLDA 2B4OA 1UVJA 3MAAA 4DEZA 4OYBA 2GIRA 2EFVA 1K1QA 1XJWB 3NRBA 1M1HA 3I55S 1RKJA 1KS2A 3FZ2A 3QJJA 2HGLA 2IAJA 4F2SA 4EO6A 3EXYA 3D5MA 4OL8A 2DNNA 5MLCV 3HVWA 4ZPDA 4JI4J 5KFZA 4FF4A 1URNA 1CSJA 4X4RA 1VBXA 4Z7CA 4CLWA 3Q86A 3BYPA 4B3SF 3RB6A 3O44A 4M5NA 1IKYA 3ELHA 3QAUA 2RH3A 1HR0J 2VA2A 4ZMMA 2DNKA 4PUOB 3NWGA 2XLIA 2BE9B 5IT9Y 1H6KX 5CXTA 2BDPA 2UUCF 4U7UK 5I4MA 1VR6A 3RJMB 2I0XA 1WDDA 3H25A 2R8HA 1PGZA 4DZ6A 3N5BA 1VJWA 4J9QA 4DV2F 2V2KA 4ZP8A 1OS5A 4ZA1A 1NB7A 3P5BP 1G1XA 4OJ3A 1C1BA 3W7BA 2UXCJ 8AT1B 3EGVA 4PG7A 3U1LA 4FF2A 3ISND 2W9CA 5A8KB 4M94A 2ZZMA 4YR0A 4O44B 3JQMA 2ROEA 1BWVA 2B4VA 4URSA 1EQ0A 4DR7J 5F9NA 1RI7A 3G2XA 4OYMA 2MGZA 2IC3A 1AROP 1P9YA 5F3ZA 4TYBA 5F8GA 5T14A 2OEMA 1RT4B 4KC5A 3Q8YA 1JLBA 5HQLA 1I3OB 2FJVA 4CO3A 3IR7B 2FDNA 3ZTQA 3QSYB 4E2FB 3G96A 2PEBA 3J7YI 2R7VA 1NZAA 4OI2A 3UE2A 1FEEA 3V6DA 3H42A 2LEBA 2JHEA 1A7GE 1HBUB 4YUDA 2QMWA 1FA0A 2HWTA 3FMBA 2RILA 2OEJA 2MSSA 3UR0A 1QD1A 2E5JA 2HIQA 1P1TA 3HJVA 4KSEB 4LR8A 2Y8YA 2VV5A 2YPZA 1L3VA 2PIIA 5DQIA 3QFHA 4QPXA 2R7XA 1NLKL 1FT8A 1RGVA 5HVGA 1RK8A 4DX8H 1U7LA 1QVGR 1Q8LA 4RNOA 1VK3A 2LP4A 5IOLA 2QFIA 1OJ4A 4DZDA 4M5KA 1KFSA 1YJTA 3IG1B 3LAKA 4J9RA 3THVA 1LFPA 3G4SS 3E8OA 1WJ9A 3DRRB 2DNYA 3HZEA 4EMDA 4X4PA 1DTQB 1EETB 2CPYA 3HVTA 4PAAA 2U2FA 5CZVA 1CS4A 2YX7A 3TNVA 3PACA 1TVRA 1FJGJ 1N33F 3TZWA 3DDKA 3VVUA 1WWHA 2XYGB 4QW8A 1KHWA 3MWBA 2B9XA 2R9LA 4NWBA 3UVJB 4ZVOB 4ZVRB 4CLPA 1U1QA 3LW5C 1BY9A 2VBZA 1NCLA 4ICLB 2ZBPA 2VFVA 3MPUB 2ZEJA 5GAEI 3Q89A 1R27B 1KQSR 1RBLA 4RW4A 1MU2A 3MEKA 4CLUA 2V69A 1Q86T 3J7Z5 4CTAB 4FKXA 4F0MA 1SKSA 1R8CA 2MJNA 4ANCA 3KLHA 4ZPCA 2AYEA 4RW8B 1Z4UA 5I3UB 2BW2A 1WHXA 3LP1B 1XNRF 2QA2A 2KB2A 1FRXA 3TUJC 3MURP 2NUHA 2RRNA 1S48A 3FBEA 2ILZA 3EM1A 3AJ1A 3DRPB 2VG7B 2NXJA 4YB6A 4OHVA 4AE5A 1CULB 1DLOA 1RAGB 4LBIA 3HX9A 2RDJA 1O51A 2DY9A 2CYYA 1HPZB 5BR8J 1WHVA 1RAEB 1FWPA 3KHLA 3GIJA 5IM0A 2XSJA 1U24A 1Y7PA 2WVFA 3HM9A 1X5TA 1T9TA 2KJWA 4EBCA 1R43A 2BKPA 4F02A 2DNQA 5LXRA 4P7TA 1RT1A 1WDTA 2HKEA 1H7XA 1S0VA 3TA1A 3CMES 4TVAB 4DR4F 3H2LA 1LWEB 3MR6A 4CLFA 5F8LA 1FXRA 1RHRB 3GG1A 2M9KA 2LKZA 2V6AA 4Y3CA 1XMOJ 4MKYA 3RAXA 3NS7B 1SL2A 1RWPB 5FLXY 4E0DA 1H0HB 4ELVA 3FSYA 5DZ7A 2FQQB 4IFYB 1B0VA 1GK8A 4LF5J 3PEHA 2J6UA 3QRRA 1H2VZ 3ENQA 3P8BB 4DV7J 3HHLD 2EXUA 2VDIA 2LXIA 1V6HA 2EBEA 3G9CA 1JXVA 2IRYA 4GO7X 4ES1A 4QU7A 4USHA 3ZTOA 3NGSA 2DGOA 2K3IA 2BJ8A 4JYAF 4OHYA 4HL9A 2AJ2A 3ENAA 1RAJA 2QRRA 4EZ6A 5JMNA 2VQEJ 1YBUA 1JK9B 2GO8A 4K2XA 2MKYA 1CEZA 3I0SA 1H98A 2R8JA 2JEGA 3GJRB 4JI8F 4UY8T 3ET6B 3UNGC 4JBCA 4LF8F 2RKIA 3A13A 3MM6B 2VFSA 2CQ3A 3ISZA 2FYXA 1AB8A 2D69A 1K8AT 4NLRA 2J9DA 1YITS 1S9FA 4LR9A 4Y2IA 2HHSA 2RIJA 3W66A 3ULHA 1VRTA 2DNMA 3ZNJ1 4USWA 4A8SA 2D41A 4CLSA 1T03A 4S0MA 2A2CA 4GVBB 4OZ2A 2UVWA 2MYFA 2F4FA 3BGFA 4QR0A 3DLLQ 2Y1JA 5SUHA 4X64J 2M52A 4ZOSA 2K7KA 4DUYF 4IDKB 3T5KA 2KZZA 2XS7A 3W2WB 3HKZD 3KUGA 2UZAA 1XIQA 3VVTA 4ZVEA 5ETSA 3TRGA 4WK3A 3IC1A 1RT2B 1WOPA 3QLHB 4DSFA 1HNWF 5K14B 5IT0A 4C4WA 2MTLA 4FP9A 4OI4A 4HACA 4ANDA 1UVKA 1RCOB 1JB0C 4V1Ak 2WB1D 3KNGA 3MEEB 3OTBA 4XDCA 1JLQB 3SCKE 5K8OA 1MN9A 4GMKA 5I42A 4PEOA 5H9EK 3PFOA 3T3FA 3VR1A 3HK2A 3TVZA 5HVFA 4YMEA 1KLMA 1UWBA 4DV3J 5FDLA 1DRZA 4DPXA 1WC0A 3TZXA 2WOMB 3EDRB 4ZIVA 5D0GA 3TAMB 4NA1A 4UOFA 2WB4A 1HWKA 2DVIA 1JMTA 4FS2A 2OPRB 3OW2R 3LGMA 2R2RA 5IWAF 4FVMA 2ACMA 2YWWA 3DDNA 4WBFA 1KRPA 1B4SA 2YQ0A 3RTVA 1VQ4S 3M2RB 2LQ9A 1WC1A 1TK5A 1YG0A 3R9LA 3HCXA 2IDLA 3IGVA 2E44A 1FESA 1U0SA 3BR8A 3G71S 2V8DA 3DM2B 3BN7A 1WACA 3UCUP 4IG3A 5KT2A 5DM6Q 2E5IA 1EKRA 5ADZA 2HNZA 3Q2SC 4CM2A 3OL7A 1AUDA 3NCRA 3K17A 1L3SA 5D8HB 3KJNB 1OO0B 5HROB 4ITSA 3M8RA 3GR0A 3AOAA 1JXEA 2X3DA 3EGNA 1VDHA 4ZP6A 2F63A 8RUCA 1NDKA 2MMYA 2AJ4A 4JI2F 3H7HB 1DAXA 3M2UB 2RVJA 1FD8A 3E51A 3IR6B 2Z8QA 4LQ3A 2XMWA 1F5AA 4JV1A 5KOWA 4EGLA 4DPTA 2E7VA 1RTZA 2C2DA 4M63A 3U02A 4KHPJ 2RD5C 4OV1A 1IBKF 1IJEB 4TLRA 1CQMA 5KFGA 3U27A 1MSWD 2NZ4A 2WVDA 4MYUA 5B0CA 1RBAA 2DHAA 3QGGA 2MKIA 1UEKA 4USKA 4ETZA 2HYIB 4ID8A 3EJMA 3NP5A 3BGRB 4PYAA 3R5CA 3MMJA 4IFVA 3QPIA 3TOQA 4B3OB 2DR5A 1FEHA 1MLAA 3N6NA 1UVLA 1GXUA 3NKYA 1HBOB 1VC0A 3KXDA 2LFVA 1CJVA 2GMLA 1E6VB 4DCJB 5GMDA 5J2QA 1UJ6A 2CQ0A 4PQUA 4JI4F 1TKZB 1N5YB 3ZTPA 4ILRA 1WNEA 2DJWA 4LF4J 3CJ0A 1HR0F 4O3PA 4NCGA 4IFYA 1DZ5A 1RYSA 4OZ1A 3EPGA 2AF6A 3QT6A 3T6JA 1U1LA 4LMZA 3N6LA 2ZD1B 5EDWA 2WBMA 4ECQA 3JTPA 2MQNA 1GQEA 2PDAA 4RNNA 2XHCA 2BJ9A 2ZJRQ 1SCJB 4RX6A 5D4NA 1SJ4P 4IOAQ 2RUSA 3D28A 4NLVA 2VHGA 2FHJA 3MPDA 2EC2A 2CUYA 4OJGA 1VLYA 4DX7A 4DN9A 1OPIA 4F36A 3MEDB 4IG0A 3GYNA 1JLGA 1CJTB 2UXCF 3QIPB 3HPOA 3G6ES 4UUWA 1LV5A 2YH0A 3MTJA 1NXIA 1T0TV 2HVDA 4JI0J 3JSBA 2CG4A 2GAGC 4ID5B 5IT9U 2J0WA 1IR0A 1IWAA 3ITHA 4DR7F 4USVA 1KVJA 1Q82T 1S0MA 1NKCA 1S1XA 3AH6A 1K9MT 2JLFA 2RAQA 5IT4A 1DTTB 2DGUA 2RS8A 1KTVA 1B64A 5HBMA 3I0RA 3AD7C 1ZAWA 1GFWB 2QZ8A 4DLEA 2YX1A 1VRUB 3CT9A 2CQ4A 2LQBA 3AOBA 2EEYA 3I31A 4DL3A 3RBDA 2B9EA 1NDCA 3QGIA 2GQQA 2RU3A 5C7PA 2IVYA 2BANB 3CTRA 1HNZJ 2XLKA 4ES2A 4I1TA 1X5PA 3BO3A 2H65B 2YXLA 2C2EA 2VG5B 1JLAA 3ZO7A 2HZAA 1RT2A 2DR6A 2X1GA 3CIMA 5K14A 4DV1J 5KFWA 3WHIA 3HDSA 3V4IA 2R8KA 3DLJA 3OFHA 2E1PA 1F9HA 1FRKA 1NNDA 1FDBA 1HMVB 5KFDA 4URGA 4NEZA 4NI2B 1EP4A 5E3AA 1NKEA 1YK9A 3HT3A 4KAIA 1YQHA 1JLFB 2QA1A 1SL1A 3KLEB 2E5GA 4LF9J 2K8GA 2DITA 1LKZA 1BQMA 3M2VA 4WFXA 2ADBA 2VB6A 5L9NA 3P96A 1NK5A 2VOOA 1TP7A 3HSDA 4U8YA 1HA1A 2HQ3A 3LP2A 3TJ8A 3C14A 2RU9A 1YBAA 1NJZA 2ZOGA 2B0GA 3GCWP 5LSLA 2HHVA 5KT5A 3NAHA 1FJGF 2QA4G 3H59A 4BLGA 2ZH9A 2FC9A 3HO1A 2DGQA 2N7YA 2UUAJ 1EARA 4DBQA 1LFWA 3DM2A 3U1MA 4FYXB 1S1UB 3LPYA 1WKKA 2WONB 3KFWX 2CG8A 2UXDF 1DURA 2I8EA 1NHUA 2HQDA 3KLIB 2EK1A 3DI6A 3IFEA 1HI0P 3HHLB 3Q2TC 2V94A 4TYAA 2KYZA 3D1OA 3RW6A 3CDBA 2PD1A 4OHXA 1L3UA 3G8SA 3FSXA 4CYUA 2F4VJ 3C15B 2C3PA 4JI5J 3SIPB 2JC0A 1Z2LA 3M2UA 1UTAA 2B9YA 2BJ7A 4HH0A 2PN6A 3RB3A 1Q0NA 1YDLA 1JKHA 2HAFA 1Q5VA 3C6UB 4NXNF 1T8EA 2IM3A 3G82B 2W24A 1N5QA 4L75A 3TJ9A 4I6YA 2DR8A 1CC8A 2HVEA 5BR8F 3OXGA 2NXUA 3MECA 1T11A 4XIUA 3T5HA 3IWLA 3AQPA 4CO2A 4Q44A 1WI6A 3GFXA 1NK0A 1IXKA 2L3MA 3SDEA 1FNXH 2XI3A 3VQSA 4L76A 1T3NA 2OJ3A 1GEHA 3B8HA 2YKOA 4KH0B 3ZZTA 5J2MB 5E33A 2NQPA 5KFBA 3MMAB 4MIAA 1PBAA 2XMTA 3HSJA 4C8KA 4O4GB 2VQFJ 2CZVC 3H4BA 1UEUA 2IM2A 2VOPA 4JI1J 3MDFA 3C3LA 4FKYA 3GCXP 2FB0A 1S5ZA 1E6YA 1DY3A 4RU2A 1RZMA 5C25A 5CD4A 3SQOP 2FUG9 3NCPA 3KLFB 1YKWA 2W4PA 1XMOF 3M1VB 3EYZA 3BBCA 4DCOB 1P1LA 4OI0A 1LW2A 4P2FA 5JVHQ 2F3JA 5LJ3Y 3DU5A 5E41A 1IWGA 3L09A 4B02A 5D3GB 3W5YA 2RQCA 1NEEA 3VAIA 3OXFA 2NZCA 1K47A 2OD6A 3F73A 5LMNJ 3KJVB 4DL5A 4K5SA 2MSTA 2OAUA 1FX4A 3QWUA 4FYWB 4NEYA 4L3NA 4RBUA 3M8QA 3C2PA 1FVSA 3SCJE 5D78A 3PHTA 1RBOB 1FWKA 2AJ1A 1NMEB 1N4LA 5FLXU 3QIPA 3D68A 4WTOB 3R5GA 3DXBA 4ILMA 5AXMA 4NZ0A 4ZCIA 2B8PA 2CJ9A 2ZH8A 3L4BC 1KD1T 4R0EA 3GIRA 4JI3J 1U1MA 3OR2A 1CBKA 3B78A 3AHPA 1UFWA 3M6VA 4DU7A 2BW7A 4K59A 4PXBA 2CPDA 4Q0BA 3MGJA 1DFDA 1N56A 4LSLB 3PVXA 2WTFA 4NMLA 4PG8A 2VC1A 1VHIA 3O2IA 2LEPA 3CCRS 2K7JA 5HO4A 1S7HA 4JI6J 2X7IA 4RW7A 1AW0A 4RPFA 4NCBA 4LFCJ 1Y3KA 3AY0A 4H4KA 5F8IA 5BYRA 1JIHA 2HFZA 2DGWA 2G2OA 3D6MB 3F44A 3PW0A 4LBPA 2YKMA 2D3UA 4B9NA 1KLNA 4F4WA 2VFUA 3ENWA 5HJXA 2AIRB 3IBFB 4EI2A 1RT5A 2FLNA 2DNOA 4LF7J 5KFHA 3MEGA 4LIWA 3R7BB 1H2TZ 2EVZA 3MM9A 3QZ7A 3OD2A 2OO4A 4Y2CA 4QR2A 2L9DA 4DV3F 2GHPA 3GWCA 3MD1A 2NXNA 4NMXA 4DOZA 1RWVB 2DO0A 1SH2A 3C19A 2CPIA 5J2NA 1TMMA 2BRLA 2W2OP 4WWSA 4AL5A 1HNIB 3KK3A 3FK4A 3N79A 3DCAA 1UPPA 2ZBQA 3FUYA 3MCOA 2CPXA 1RYRA 1Q53A 2DGXA 5KT6A 4GVLA 4I6AA 3NGRA 4U8VA 4TQSA 5IC4B 2IIHA 1IM6A 3A1YG 2AW0A 1D9DA 2W2MP 3GMGA 1HYSB 3SI8A 1Q7YT 2LXFA 4EYIB 1RLDA 1JJ2R 2HVHA 1FDAA 2GC8A 3LWMA 3RU0A 2QN6B 3GPAA 1YJWS 2XNQA 4KV8A 1U4BA 4PWDB 1T02A 4J7CA 2DHGA 3CWJA 3W8PA 5C42A 2MEWA 2XGPA 4J37A 4I64A 1UCNA 3QGHA 4LVOP 4CLLA 2YNFA 2XMMA 2BM0A 2YPYA 1KOOA 1WG1A 2V2QA 2I5JA 3C15A 1WKJA 2DXDA 1F9FA 5K9FA 1XR6A 4PCQA 3V6KA 2VPYB 4RW6A 1Q95G 2LMIA 3I96A 4TN2A 1TKTB 3KK2A 4HLBA 5C24A 2I9SA 4KHPF 3C16A 1CPZA 2VIHA 4ZHRA 3D6HB 3MAQA 1BQNB 4GRSA 4DV5J 5M2RA 1JNRB 2Z0GA 2VJUA 1WHWA 3AT1B 4F25A 4K50A 2EC0A 3QNWB 3M8SA 3IRXA 1SKUB 4C6AA 2DR7A 1M0SA 3DHXA 2GGPA 2ALZA 1BLUA 4Z7YA 4Z37A 4C3MA 2HK2A 3CO9A 2VBXA 4OIXA 1N32J 4DHVA 1HQ2A 2ZH4A 3KUEA 4YS2A 3SFGA 5HVHA 2YH1A 4O3OA 3FGVA 4NXMJ 5KFIA 1RWUA 4LVNP 2AKWB 2LQ8A 2GFFA 3LPEA 3CJ2A 5GMKa 1ZZFA 2OFHX 1BXNA 3TAQA 2OTLS 4IH6A 5B0FA 2H4YB 4G1QA 1FDDA 2FVRA 3T19A 4P72A 1Q78A 2UVRA 1YRUA 4LF4F 1NSPA 1CJKA 1V3ZA 3Q8PB 3NWRA 1RTHB 3DFEA 3DLKA 1ROFA 2OIHA 2HS0A 1C4CA 2UU9J 3K57A 1D3WA 1R6VA 3VGUA 3AAWB 2ZVSA 3GSIA 1VQSA 1M90T 2C3OA 2C28A 1LWFA 1TU0B 2QMXA 2B3TB 3RAQA 2NR0A 1S0OA 2OPQB 3PJWA 1YZ7A 1TELA 3M7VA 5LT5A 3OTOF 4JI0F 3CNQP 4OLOA 4FXDA 2MKCA 2KVQE 2JVOA 2JX2A 4NLUA 1KN6A 3EZ5A 4WFAQ 3FVYA 2C1EB 3V6JA 5KFOA 3KG1A 3WC0A 3ZNUA 2KT2A 3J81Y 1IBLJ 4X4TA 4EWTA 4A8FA 2FJWA 3NNAA 2GVDB 4ECVA 2Q66A 1WF0A 4IUFA 4NL5A 3GONA 4AL7A 1FKPB 1F5BA 4LBHA 5J2PB 1TL3B 2RT3A 4Y6IA 1WSVA 2IDEA 3RBXA 3CSKA 3UR3C 1ZTWA 5KG2A 2BJDA 6AT1B 4KE5A 2E29A 2AGOA 4DV1F 4AYBD 3P5TL 4C9DA 3G6XA 2MDAA 2NPIA 3CB4A 1NPRA 5CA5A 1HBMA 4H54A 1RTJB 2YWEA 2V67A 1XR7A 3I9ZA 2ZOMA 2ZBRA 2QGFB 4F3QA 2Q6BA 5KFCA 3CJKA 1Z1ZA 3THTA 1OMSA 1OSDA 5M2UA 4LF9F 3KDOA 5KFNA 2MZQA 4ZP9A 4MAKA 5KFLA 2HHXA 2KT3A 3MM7A 1W7WA 1N6QA 4ED8A 3AB2B 4WE1B 1VJQA 2HNYB 2BR0A 4AUKA 4M5DB 3JAMY 4CRJA 1O5JA 4MKAA 1WC4A 2R42A 5F0UA 3D6FB 4WJBA 2LU1A 2MQMA 4H4KC 3GSDA 3PX6A 1GX5A 3DMJA 3MMCB 3CCTA 1BMQB 7FDRA 1IBMJ 4RZRA 5DG7A 3PM9A 3M30B 4USUA 1QAJA 3V81A 3PG9A 3Q22A 4A8WA 2LCWA 3A8IA 4KKOB 4ZS6A 4W90B 2A1BA 2DIUA 2KN4A 2HHWA 3CDEA 3M32B 3LP0A 2D9PA 2XULA 2QJ3A 2VG6B 4UOCA 1TV6A 2KM8C 3F0NA 2FJXA 2L41A 4FXWA 3UNYA 1SUQB 4RW9B 3J7YU 2EFPA 2F4VF 4RUAA 1TKXA 3BH6B 4LFAJ 4JI5F 2CPFA 2VH7A 4I2QA 1WC6A 3QMQA 3DOKA 2AJFE 1FK9A 3CJTA 2JEJA 3FJ2A 3PYEA 3DYAA 3IS9B 4A4JA 4L6V3 4QWCA 1D9FA 2F5GA 3VQTA 4TLQA 1S9EB 1IKWA 3ICLA 2QLFB 1IKXA 2A18A 2VPZB 1B3TA 2KU7A 1U8WA 4TY8B 4DQQA 1C0UA 2RHQB 1UVMA 2MKHA 3W2VB 3DXSX 4NASA 3DLHA 1YVFA 2JEFA 3TEGA 4XDDA 3OR1A 4ECSA 4DPOA 1Y5IB 4NLYA 5AE1A 1QJHA 2CPHA 4H4OA 5RUBA 3BSOA 3KHRA 2MZTA 2YNGA 2A0FB 4FVCA 2VQFF 1RTDB 4DR2J 4JI1F 2CNKB 3ZC4A 2F8HA 2W7OA 1IKVA 4Y2MA 2J7WA 4K4VA 2XGQA 4D3GA 1TAQA 1MWQA 2XMKA 3TYTA 2CQCA 2IM0A 4Q2MA 1RT7B 3F56A 2OTJS 2AU0A 1Z2ZA 2H3EB 5GAEU 1J2VA 4ZLJA 4I7FA 4CO0A 9RUBA 3MAHA 3MM5A 4DG1B 2ZZTA 2NSCA 3X3UA 1R0AA 5LMNF 4QZVB 2DXEA 1YHQS 3VAMA 3QBCA 1YJVA 2FJDB 3I82A 3OLAA 3M8PB 3GIKA 2WW4A 1FVQA 4OX6A 1T9VA 1WTFA 2OPQA 3EVOA 1XEZA 1PIEA 2F1FA 2WBRA 2AJQA 2ZJQQ 2KJVA 4CP5A 4UF4A 1YGYA 4ZK7M 5HANA 1PBUA 4IO9Q 5KFUA 2MQ8A 3OV7A 1AZSB 4MYTA 4FS1A 3PR4A 4JI3F 1F3VA 2IRXA 2D9OA 1XK8A 3RBEA 5LMUJ 4I6WA 2ZZNA 2XQCA 4DR3J 1S6OA 5B0AA 1NU4A 3J7A1 1S1VB 1MROA 4EZ9A 4B3RJ 3QT7A 1TQLA 1HWJA 1T3OA 4JI6F 4YR3A 3HP6A 4KFBA 3CVKA 4ZVQB 5KTQA 4QR1A 4O3RA 1SBRA 4G65A 4CI0B 2VBWA 3P45B 1Q8BA 3MHYA 2AX1A 1KVKA 4EK2A 1S57A 5F3TA 3DLEB 3WX4A 5CABA 4OX9J 4ZN1A 3LA0A 1U26A 2V8PA 4LF7F 3EXCX 2CDQA 2GA7A 1RDRA 5CYMB 4WYWA 4RUHA 1N34J 1NJYA 4HTJA 2HQCA 1HNVA 4DMZA 5I3PA 3Q8QB 3DGPA 2YNIB 3OUYA 2XHWA 4Y28C 1JLEB 3JSMA 3MAAB 2PI5A 3PX0A 4HHUA 1FNOA 3CCWA 3HMJG 2E9TA 5GAGI 1O8BA 2HBYB 1RTIA 3VAKA 3TI0A 1SVDA 2IAJB 2ZBIA 2PSZA 4OX7A 2XWXA 4WIIA 1BQXA 4Q8EA 4CT8A 1P6TA 1IKYB 1SJQA 2MKSA 1HQEA 2V4RA 2CRLA 5KG1A 1U0HA 2HLUA 1M1GA 3PYDA 1F9EB 4DSIA 3HI9A 3G8TA 4R25A 5F0WA 4P6QA 2KTQA 3MFIA 5T7LA 4C8NA 5L1KA 2R8IA 3ZZUA 2CPEA 2VG6A 4GC7A 4P74A 4QIEA 2OMOA 3PZPA 3W1YC 3VGSA 2C2MB 1Y5LB 1VISA 2KRRA 1C1BB 1UETA 3A12A 5KG4A 2W9CB 3R5DA 4P9SA 3WDOA 4ZJQA 5KT7A 1VQPS 2ZE2A 1R89A 5AE2A 2GMJA 2AYMA 3WIUA 2WRMA 4I68A 1S1WA 2XMAA 3V4MA 4UTGA 1EQMA 4WP8A 2MGZB 1YJ7A 2IC3B 4LRAA 3M6XA 2Q6CA 4DV5F 1SKRA 1NJWA 4LJMA 3U7JA 2QEXS 1S6PA 3MR5A 2V63A 1JLBB 4NLPA 2D3ZA 1FX2A 2ZITA 1HHSA 2LLZA 2QSFA 2E5LJ 2UXBJ 3TZZA 2UV8A 1F60B 4FN5A 1VRQC 2VL1A 3V6DB 4MKVA 3CCJS 1VFJA 1NDPA 1OY9A 1B7FA 4M95A 2RNEA 2IJNA 3OL8A 1UP1A 1HHTP 1D8YA 3KLVA 1RWWB 2RHSB 1UPMB 4P75A 2WSCC 4DFMA 1B99A 2HSEB 1YI2S 2ZNYA 2J9DE 3D1HA 2CQ1A 5H9EJ 5CCMA 4TXSA 3L9ZA 5DDPC 2J6TA 2HVZA 1NK8A 5AXLA 5KG0A 2F40A 1IQTA 3VALA 1DQ9A 1GNKA 2QLXA 3Q24A 4EBDA 5MAOA 2N3LA 1ZS6A 2FHJD 5G0RA 1N5VA 4R8UA 2Y0BB 2PGCA 1KNZA 3W8GA 2HBRB 4RO0A 2WCXA 2DGVA 3TR5A 2V50A 3HVTB 3JQJA 1CS4B 4HDGA 1NAQA 1TVRB 1SC6A 1TL7A 4PWWA 1DJ0A 3X1LB 4OZJA 4DSJA 1KFDA 3MUVP 1LQ9A 4AT1B 2C2OB 1LXNA 3HZGA 1N88A 4X65J 3H20A 3BPDA 3CCMS 3SV4A 3VWSA 5B0DA 2ZVIA 1HHQA 2P5VA 3BZQA 4ZPTR 2E9ZA 5HMXA 5L1JA 4Y2KA 4RW4B 1MU2B 1FHTA 1VHFA 4GKJF 1R8AA 2POKA 2ZHOA 3MOJB 2HHQA 1VS3A 3KLHB 2LVWA 2ZOFA 2V4QA 1QY7A 1KDNA 2XMJA 2R7WA 2PO4A 3BKUA 4DDFA 2J0XA 2ZHAA 4JOUA 5H9FK 2ZHBA 2PT0A 2KFYA 2J7UA 4X62J 5ETPA 1HFEL 2V4JA 4QWEA 1RHKB 1SQGA 4CDIA 4YP3A 2AEFA 2DHSA 3LF0A 1DLOB 2OFGX 3U1NA 3WX8A 3J81U 4X4OA 1SIWB 3IAS9 2OH2A 1AA1B 3R1HA 1N5SA 3H90A 2EWHA 5IM0B 2MB0B 4MFBA 2XSJB 2DPJA 3NCQA 2OPSA 3T1HJ 2FLPA 5A6PA 3G87A 2VBYA 2MKKA 4F0KA 1NH8A 1M5VC 3MMBA 4FZVA 2W2PP 3SBMA 1IVZA 4FYYB 2X1AA 4ZPVR 3CCLS 1FFWB 1RT1B 3EUNA 3A3NB 1T9UA 1DHMA 2EFGA 3M05A 4YHHF 4ZLPA 2QA4S 3E3XA 1RA7A 4F26A 4NLTA 1WOOA 3BDPA 3AXKA 4JI7J 3CC4S 1X8DA 2AZ1A 2QT7A 5GADI 1G2EA 1RABB 2H5JB 1UWAA 1ZA1B 3J80Y 4K4TA 4B3MJ 2V5HG 2V9KA 5D77A 1IBMF 4QWDA 3IMQJ 3NMAA 1TR0A 1YLXA 3DLGA 2YWFA 5EWGA 4DR1J 4ECXA 2GO9A 5L46A 2CFXA 2JFDA 3IAM9 3WQPA 3K7RA 2GHVC 4HT5A 3UO0A 1VI7A 2CQGA 3JAMU 4RBVA 4LR7A 2E1CA 1NK6A 4IH7A 3CJ4A 3GJTB 3GJQB 2OUGA 2AEMA 5KFKA 3FDSA 3JQKA 4CH0S 1UA1A 3FEYB 3I0SB 3T1YJ 4LFAF 2DYAA 2LEAA 3RR7A 2FJBB 5DO2A 2HW3A 2L9NA 2RKIB 3VAJA 1K73T 2F9DA 2KO1A 2ZWOA 4J9OA 3BS9A 2AMCB 1CJUA 4FYDA 4YOEA 2M0GB 1WG5A 1VRTB 1Q16B 3BYRA 3ILOA 4GKKF 1T03B 2FGOA 3UD3P 2EKNA 4KGVB 3HFVA 4DL0C 5EX0A 3CJ8A 3KYLA 2P9CA 4OFZA 3KK1A 5E0OA 1QSYA 2BE2A 3ETOA 4P2SA 2G0CA 2B6AA 3CCZA 4NCAA 5E7OB 1PC5A 3GFHA 1YRTA 2CZ9A 4OJ1A 4DR2F 2XZTB 3GR1A 4YFUA 2YBVA 4KGZB 3DRSA 4UOGA 4H4MA 5A76A 4HACB 2H48B 1ZM3A 1GTHA 3BQ1A 3V6HA 3R27A 2V8HA 1KTQA 1HQUA 2JFKA 1RISA 4DX5A 1F2GA 3NNHA 5I42B 5HMYA 3S8SA 4QIFA 5KOXA 3HLUA 1KLMB 2YWHA 1UWBB 5FDLB 1M5OC 3M9NB 3OFEA 4DSLA 2YNHA 5DLFA 2VKZG 1WC3A 2JSXA 1KVIA 2VODA 3V2UC 1KHVA 4WPAA 1VQ9S 4QU6A 3R5JB 5KFXA 1QVFR 2J9CA 4EEYA 5CQGA 2Y1RI 4JV5J 2XNRA 1PJ5A 3QSIA 4OZ0A 3VCDA 2G0IA 3C6TA 4P7VA 5DDQC 3P49B 3W9HA 2XM3A 2MXYA 2DRBA 4IG3B 4B3SJ 4ECYA 1IBCB 3M9OB 2HNZB 3HKWA 4DWIA 2XEXA 3JTOA 3MCNA 4N5SA 3D67A 4DR3F 3K0JA 2AEJA 3OSNA 2AJ0A 2UUCJ 3RGIA 1OSCA 3JS9A 4IQMA 3RRKA 4MTPA 2OPPA 1T94A 3PRDA 2DBBA 1S7IA 1C0TA 2O66A 1XNQJ 3SZ2A 2BJEA 3CJQA 1KBRA 4C0HA 3AQOA 2DB1A 4B17A 4IOCQ 1OY8A 4ECWA 4CIOA 2DH8A 2IMOA 4OX9F 4BCAA 3GB0A 3AA9A 2LQ5A 2BXJA 4OLPA 4F4KA 1RUSA 4NX9A 1S10A 4C11A 1DBDA 5SZTA 3D3CJ 2W7PA 3VAHA 4DQIA 2BYCA 3LAMA 1Q81T 2W4CA 3QJPA 1PYTA 6FDRA 1WF2A 4U7UD 2E7XA 2BA9A 4PQAA 2W01A 1H38A 4NPOA 4HI2A 2LDYA 4IFVB 5I3QA 4EYHB 3K8VA 4CH1A 1I94F 3I5AA 4OYOA 3W3SA 4OYIA 2HS4A 5KFVA 1U1OA 3H5UA 4USJC 1REVA 1CJVB 1U09A 4LUBA 2FZCB 1DQ8A 3KG0A 3B82A 1TUGB 5AXKA 5E3RA 2QFJA 5J2QB 1WOSA 2O5DA 2HRUA 4PQUB 4KGMA 5BYQA 2JNJA 4U95A 3JYTA 4K7QA 1EHWA 3AD9C 3BBBA 5J1EA 4ZPBA 3I4PA 2GW8A 2MPUA 5K8PA 3OXLA 3NGDA 4ED6A 4CLKA 2W25A 4NCGB 3HD2A 4ED7A 4WFZA 1XMQF 3DLBA 4QW9A 4RJVA 2IA6A 3ZZPA 4WFYA 1S99A 2ZKTA 2FC8A 4YR2A 2QO3A 1SXLA 3I87A 4ILLA 1GXLA 1VBKA 4KQZA 4TU7A 1NK9A 1FDNA 4DR6J 2BZ2A 3R7SB 4ZVPB 3CGIA 2BACA 3CULA 4IG0B 1JLGB 2B7CB 1FTCA 4R5PA 3N28A 2HZVA 3V5RA 4DL6A 5DDRC 3DGVA 2HFOA 2YKNA 1BC6A 1N33J 2XB2D 4DSKA 4LF6J 1PAUB 1K44A 2W9AA 1Y3JA 3ITHB 1RXOB 1S1XB 3EX7B 1L5UA 4QJVA 2NREA 4IRCA 2M7SA 5HBMB 3I0RB 1ACMB 2V2ZA 5KG3A 4UZCA 1SQEA 3FEXB 2HWHA 4F8RA 3K5MA 2XY6A 1OIAA 4HVZA 3RRHA 5CAAA 2LQJA 4I67A 2ZUAA 1C1CA 5F9LA 2CADA 2CJAA 3OVBA 3CJSA 3DC2A 2J6SA 3IBCB 1PKUA 4O23A 1Q5YA 5T41A 1QE1A 3HXMA 4CCHA 2QIFA 2IJFA 2Z2MA 1SIZA 2SXLA 3CCSS 2QLBB 2JL9A 2ADCA 1DARA 3AJ2A 5KG5A 4HYKA 4ZVFA 4X4SA 1VGYA 4ZDNA 2AX0A 2CQHA 4JV0A 1JLAB 4XPEA 5B0BA 4PYDA 2B5JA 3LQVA 2IBKA 3N4WA 3V4IB 5ETLA 3K59A 5E3PA 2CVIA 3FFIA 3HVAA 4O3NA 2F8MA 5BJRA 1EP4B 3QAEA 1X4DA 1VQ7S 4CNZA 3NOGA 1WTBA 1WHYA 1U6BA 2ZH6A 1IQZA 2FHMA 4ZP7A 1BQMB 3M2VB 2WK4A 2HFSA 3R2CJ 3BH7B 1RADB 4OZ3A 2GVZA 3VHQA 2BABA 1U8SA 4RUCA 4CLZA 1PC4A 4G1IA 2CWXA 1T7PA 3LP2B 2Z30B 5AE3A 3C14B 5HP1A 5C2GA 2M88A 3CMAS 3K5OA 3T41A 3CF5Q 3TQ1A 4B9TA 1X4EA 2Z56B 2UUBJ 3TAPA 2HHHF 2VDHA 4K4XA 5KG6A 5IZHA 4X65F 3ADAC 1PO6A 2OEKA 1UJ5A 1NHKL 2W9BA 3DI6B 2HFVA 1FJCA 2LECA 2QG9B 4ZITA 2VPXB 1AT1B 3DKDA 3E01B 1V5IB 2CQIA 2W2QP 3FMWA 2MLYA 3W9IA 4JP8A 1H2UX 1XTZA 2KDOA 4JUZA 4CYUB 4F67A 2G4BA 3IBWA 4NOHA 1S1TA 2BVZA 2PC6A 2XZDB 2ZH3A 3KLGB 3CCQS 3PW4A 3NMRA 1HD0A 2WSFC 2ZM6F 4X62F 1JKHB 4OHWA 1WEYA 1RU2A 1TL1A 4DV4J 2XTJP 2MHEA 3DOMA 3DHWC 1ZAXA 1VBZA 2CJXB 2DK2A 2C3UA 1SJRA 2Y9HA 1U25A 4CNYA 3BSAA 2XCPA 1FRHA 4O0NA 3MECB 3A8KA 3MUTP 3HSZA 3KJQB 4PRFA 1I6JA 2GX8A 3SDEB 1RE1B 1WKLA 5KG7A 1NK7A 1ZPVA 4IQXA 3FQLA 4Y34A 1U2RA 4X66J 5A0YB 5AXNA 2KH9A 4DUYJ 4HHJA 3SYZA 2D1CA 2BKNA 3TVKA 2H1YA 3KMSA 4ERDA 1E6YB 3M8YA 4JI7F 1CQNA 4ZVHA 5A2QY 5C25B 2I2YA 4N41A 2LA4A 2HMIA 1HNWJ 1WEZA 4ZJLA 4C8ZA 2K06A 4CZCA 2I6WA 4L73A 4AD6A 1WORA 2P8IA 4B3MF 3UN5A 2HG4A 1ITPA 1LW2B 3H2VE 1YJRA 2QMUB 3R5AA 4X4UA 2NXCA 2BX6A 4DR1F 2IJRA 3T5JA 4A8XA 2VUGA 2HRYA 5DQGA 2OKQA 5DRKA 4HKQA 2AD9A 3LWLA 2VONA 3IWXA 3BO2A 4MH8A 2GQCA 2Z2ZA 2GV1A 1RACB 2P6SA 5DG8A 1M5SA 5ETOA 1JLCA 5ETKA 3OL6A 5HMWA 3M8QB 2A6MA 2FLOA 3T1YF 4IO1A 2R7UA 2CPJA 1UEVA 3GJSB 2XS2A 3J80U 3QO9A 4MKBA 4LSNA 1JQGA 5ETTA 1CC7A 3BDEA 3SSQA 4M5JA 3OVAA 4MK7A 1R8HA 4N8OA 4F4YA 3OR2B 4XK8C 2M4MA 4J9VA 1B7YB 3FC9A 2JZ5A 3LUYA 4Q0BB 3VAGA 1VQ6S 2DH7A 4XAKA 3BKTA 2AWZA 4ED2A 3S6EA 1PSDA 5EGYA 4RW7B 2VA3A 3PRVA 5ETVA 1MNEA 4B9UA 4K4UA 3N01A 2YKMB 3HJFA 4RU9A 4A46A 1NB2A 3ZZ0A 1R7IA 1S9GA 5DM7Q 1H3DA 1IR1A 3MPWA 3R7NB 2LXUA 1RT5B 3H98A 2VC0A 4XO0A 2FVPA 5A8RA 4F3OA 4Q7AA 3MEGB 1JX4A 4I2PA 2KM8B 3GG0A 1PYSB 3MM9B 4FNIA 3POTA 2MQOA 1RHUB 1IBKJ 3EPIA 2M5YA 4PG6A 7AT1B 4QCLA 4PG4A 5IV3A 2NSBA 4DCPB 1SPBP 5D15A 5J2NB 2NPFA 2PA8D 3PX4A 3GFYA 2Y1LB 3KK3B 2ASLA 2RQKA 1EAYC 2CIMA 3KWMA 1MMDA 4RWXA 5JUMA 3OHBA 3GYGA 1U1KA 1NUEA 3EDQB 1RHJB 1RT3A 1MG7A 4KHRA 2ERRA 4JV5F 1X5OA 3TW0A 4OYZA 1X4AA 3HSGA 2UUTA 4LRDA 2VJVA 3NBPA 2A10A 3K89A 4NYOA 2XY7A 2JVRA 4O3SA 4YN3B 3FCVA 1J5OA 2XY5A 1XMBA 3DOLA 2HNDB 1BWEA 3MM8A 1N48A 1PG5B 2OSQA 3B54A 1XWLA 5CYJA 4KV8B 3LGHA 4M5HA 1FRJA 4Y0FA 1Y9OA 4K5RA 4KO0A 1GX6A 4J9SA 1IN0A 5C42B 2ZNZA 2CNLB 3AB4B 2EI5A 3E01A 4GC6A 1XNQF 1TTHB 3M6WA 2YNFB 4A8QA 3B6BA 1U49A 2I5JB 1W26A 4NZ6A 4OI3A 1ZZNA 5A8WA 1O0PA 1H72C 3ZFVA 2YWKA 3KLGA 1NBEB 4CM0A 4RW6B 5D0EA 2HLTA 4OX8A 5KFEA 1VOMA 3VAFA 1RAFB 2KL8A 3KK2B 5C24B 3OTDA 2ALYB 3C16B 5GAHI 2MY7A 4FPIA 1FF2A 4ZHRB 2C2RA 1YJ9S 3PJ9A 4OI6A 2OLWA 2RF2B 2XZWA 1NSQA 2NXEA 1F5CA 4DN0A 2MKJA 3IRXB 3FCHA 2M3DA 2NYIA 4Y65A 4PXEA 2WVEA 4I56A 3L7OA 3NOCA 2GGPB 4NYZA 2H9ZA 3Q8UA 4F4ZA 2KI2A 3H5SA 1S4FA 1FFSB 4QYRA 2V9WA 2VKRA 1CLFA 4N76A 3OFGA 5A0YA 4LRBA 4HEA9 2GZOA 3QFWA 4DPYA 1HNXJ 1JJHA 5D4PA 1PJ7A 2HS3A 3BO4A 4C7QA 2VD3A 3AODA 3TANA 5B08A 2QLWA 4G1QB 2KXFA 1Q79A 3A8EA 2DHXA 1X0PA 2R8GA 2Q79A 4DFKA 4B9MA 1G6BA 2CDRB 2C2ZB 1CJKB 3K58A 3DLKB 2D74B 4LF5F 1MWZA 3MR2A 4K4SA 2DNPA 2E1MC 3A8JA 4FYVB 2AT1B 1X9MA 2BMBA 3H5XA 4DV7F 4FF3A 4A48A 4NA3A 3NG8A 3LOUA 4KTQA 4ETXA 2BUNA 4DR6F 1S6QA 2K1RA 1LWFB 2XI2A 2JEIA 2VQEF 1Y10A 5JXSA 1FNMA 3IN5A 4DF4A 4CH7A 1SJ3P 1QTNB 2K2PA 3WIVA 3RUBL 1LEOA 2RJZA 2QX0A 1L3KA 3CEDA 3OSPA 2MLXA 3DDIA 1T05A 4EFAC 1WF1A 4LF6F 5F8MA 1S12A 2RSQA 2G2YA 3OVSA 2OMLA 2HPUA 2Y0SD 1KP6A 2LU2A 3S1TA 4ELTA 2BQUA 1AFIA 1FJ7A 2VF3A 3UQSA 3BEGB 2UXDJ 2IY5B 2DXFA 1Y11A 1N8RT 4J9UE 1B70B 5GAGU 1YWXA 1SV5A 4X64F 1LNQA 5DGBA 4Y00A 2V8VA 2XBPA 5F8HA 4U6PA 2AGPA 5BXIA 4I69A 4ECTA 3ZZOA 3CD6S 3UWTA 2GJFA 1LW0A 3N9UC 2KFZA 1SH3A 2KXHA 1MW7A 1RWOB 3QGPA 3BQ2A 1OQ3A 2FZKB 1BE4A 3OFFA 2RE1A 3CIZA 4YB7A 3GIMA 2DRDA 4NXNJ 2YTCA 1PAEX 1FKOB 1HI1A 2FVQA 4HI1A 1Y4ZB 4QYZJ 2DNHA 1REGX 3OBIA 3CJRA 2O67A 1RT6A 4KY3A 4G1PA 1HBMB 2HFNA 4B08A 3K5NA 5J1NA 4ZIWA 4RL1A 1QUVA 4NE9C 1NJXA 3CJKB 4DQSA 3PXGa 3PHEA 5CYQA 3MM7B 1N6QB 2RDDA 5D6GA 4FF1A 1P8GA 3RW7A 4C8MA 2JLGA 5ETNA 3GV7B 4F4AA 2W8KA 2OSRA 5ETQA 4KGKA 2JJ4D 4FBTA 4DLGA 3MFHA 3G6YA 3DMJB 5CD4H 2NCKL 3T1AA 3QATA 1U1RA 2B7BB 3J7ZT 3NGUA 1KSPA 4DFPA 2UUBF 4LF1A 1VQ5S 3V81B 4UQGA 4IOBA 2OHDA 2DNGA 4C48A 2KHDA 4C2MA 3R5BA 2HNDA 4PPZA 3LP0B 1VCTA 2ZWPA 2ROPA 3NL0A 4PUOA 1TV6B 4N47A 4BS2A 4K0KJ 4AFFA 1H74A 4Q5VA 4MIWA 1NRKA 3CD0A 4DS4A 3NXZA 4C3LA 1LWCB 4Q43A 2MQPA 5HN0A 2WVCA 4JB8B 1TKXB 3RBZA 3P4UB 1GXTA 4I2QB 2H5EA 5K8MA 2FIUA 3DOKB 3ONQA 1FK9B 2Z2YB 2WVBA 2XYPB 3W61A 4ZLLA 2YY3A 3DYAB 1IR2A 1FRLA 4DV4F 2MHNA 4ZPWR 5A8KA 3ILLA 3PTWA 3ZXWA 4NZ7A 1I51B 1IKWB 4O44A 1IKXB 2RMLA 1RWNB 4OYAA 1U2FA 4AQYJ 3MXHP 1TKDA 1C0UB 5A6WA 2RF2A 2CNOB 2OGUA 2ZKUA 3D3BJ 3OR1B 4KRWA 2RRAA 1RT4A 3PW5A 3L7PA 4BWJA 1WC5A 4U96A 4X66F 4CO4A 2JWNA 4H4OB 1AYEA 2BV3A 1G4CA 2J8SA 4ENOA 2YNGB 1UA0A 1NO8A 2JC1A 3PRBA 3PIPQ 1IKVB 3D6TB 3CUNA 3M9MB 3SMZA 2A2DA 2LA6A 1Q7LB 1RWKB 1HBUA 3I32A 2IA0A 2GJ2A 2YX4A 3BN4A 2C42A 4P2MA 4HDHA 4O3QA 2J0SD 3EZUA 2KVIA 3UW1A 3R2DJ 3KHGA 3MPYA 5EN1A 1BHNA 2EFNA 2QSWA 2QYGA 4I7FB 2PI4A 2E1AA 2FVCA 1NZ8A 4YY3J 4AXJA 3Q83A 2C2KB 1F3FA 5C5JA 5HMZA 1OYDA 4C0BA 3MM5B 1UW9A 1R0AB 5GMEA 2MY8A 4KIAA 3I6PA 3N5FA 1HWUA 2V8GA 2FGCA 5EX3A 1I1GA 3SSSA 4DUZJ
chains in the Genus database with same CATH topology
2W24A 2FJBB 1N5QA 7FD1A 2EFQA 2VPWB 5DO2A 2HW3A 2DISA 1X4GA 3PEJA 2L9NA 2RKIB 3IG1A 4I6YA 3VAJA 2DR8A 4FBUA 1RKIA 2EW9A 1CC8A 1K73T 5BR8F 3OXGA 2NXUA 3DU6A 2F9DA 3MECA 3S7RA 1TL5A 5DS7A 2K3KA 2CVEA 4XIUA 2KO1A 4J9OA 3T5HA 3BS9A 4OZLA 3DRRA 3IWLA 3AQPA 4CO2A 4Q44A 4FYDA 1WI6A 5E2QA 4YOEA 2M0GB 3GFXA 1FXLA 1NK0A 1TZ0A 1IXKA 1RT3B 3GIIA 1WG5A 1HW8A 1VRTB 2L3MA 1DTQA 1EETA 4WXWA 3BQ0A 3PV8A 1Q16B 2RRBA 4M8LA 2R7RA 4Q45A 4EBEA 4WE1A 2HNYA 1S79A 2N4DA 3SDEA 2N7CA 2XI3A 1KOHA 1FNXH 4GKKF 4NA2A 3SSRA 3OTCA 3VQSA 1T03B 2FGOA 4M5DA 2OD4A 3UD3P 2AP6A 1T3NA 2OJ3A 2XO7A 3B8HA 3NBPB 4DL0C 2YKOA 3ZZTA 5EX0A 5J2MB 5E33A 1FO1A 2C22A 2NQPA 5KFBA 3IWNC 2J5AA 3KYLA 2N4CA 5J1PA 3CJ5A 3MMAB 3SQGB 4MIAA 2X1FA 1D9AA 2P9CA 2XMTA 3K2YA 4C0OC 4OFZA 1J5OB 4C8KA 3H8YA 3KK1A 4O4GB 4RLEA 5E0OA 4ELUA 4QQBA 3HHEA 2CZVC 3K5PA 1HW9A 2Q1LA 1UEUA 3H4BA 1QSYA 1Q4RA 2IM2A 2VOPA 3DOLB 4ICLA 2BE2A 3ETOA 1MROB 3MDFA 2B56A 3MM8B 4P2SA 1H7WA 3MMCA 4F50A 1TL4A 1X4CA 2G0CA 2B6AA 3CCZA 3C3LA 2KZMA 2IMWP 1OWXA 4NCAA 2DRAA 2FB0A 2KHCA 1PC5A 1E6YA 5E7OB 1FE0A 4ECZA 3GFHA 3TO8A 4RU2A 5C25A 3OTEA 3M30A 3JTNA 2C3YA 2FUG9 4OMFG 1YRTA 3S01A 4OJ1A 4KFBB 4DR2F 3NCPA 3KLFB 2W4PA 3GR1A 2W7AA 4YFUA 4KKOA 5B09A 1QLNA 3CDUA 1XMOF 3M1VB 4CTAA 2KT5A 2G1DA 4KO0B 3DRSA 4D3HA 3EYZA 4A47A 2HGNA 3M32A 3Q23A 1M5HA 2RS2A 3D2WA 4UQTA 4H4MA 3T9NA 5H9FJ 1P1LA 4OI0A 3KOAA 1LW2A 4B9SA 5JVHQ 3C8YA 1ZM3A 2F3JA 2FJAB 5L38A 5LJ3Y 1GTHA 1Y0HA 3DU5A 4ZKAA 5E41A 2JDJA 3BQ1A 4ED0A 2RUGA 3L09A 1X9WA 4B02A 3V6HA 3HFKA 3R27A 1VK8A 5D3GB 4RW8A 1HNZF 1Y00A 5I3UA 5GADU 4TU9A 4NLSA 3LP1A 2V8HA 1KTQA 1HQUA 2JFKA 3L3CA 1RISA 5A8WB 4J9KA 5DGAA 1F2GA 3NNHA 4BC9A 5I42B 5IQQA 5HMYA 3S8SA 1SUQA 4RW9A 2HWIA 3DRXA 4QIFA 5KOXA 3HLUA 4UW2A 1NEEA 3SCIE 2RQCA 3O6QA 2R7TA 1KLMB 2YWHA 3VAIA 2EK6A 3OXFA 1UWBB 2IFXA 5FDLB 1M5OC 3M9NB 2OD6A 3F73A 2YVSA 3KJVB 4DL5A 4K5SA 3DRPA 2MSTA 2VG7A 3OFEA 2YNHA 4Q2LA 1FKOA 4DSLA 2IVMA 2OAUA 1HNVB 5DLFA 2VKZG 3QWUA 4ALZA 1R8BA 2JSXA 4L3NA 4RBUA 2GJIA 2XMVA 1KVIA 2VODA 3V2UC 1WELA 3M8QA 1KHVA 4C3KA 3H40A 1VQ9S 1VQMS 4WCEQ 3OUYB 3C2PA 4QU6A 1U1NA 3IS9A 1FVSA 2UVVA 1HPZA 2VFTA 4Y2AA 3SCJE 5D78A 2F8EX 3JSMB 5KFXA 2WW8A 1QVFR 4KHMA 2J9CA 5EHHA 1M5PC 2FHKA 3KKFA 2AJ1A 2F7VA 4EEYA 1N4LA 2RQ4A 3QIPA 3UD4P 1KR4A 1HBNB 5DLGA 2JH3A 1X4HA 5CQGA 3DXBA 4ILMA 2Y1RI 1MWYA 1RTIB 2KYXA 1S9EA 5AXMA 2N3OA 2KFNA 4NZ0A 2XNRA 1KQKA 4CT9A 1IJFB 2CJ9A 4ZCIA 2ZH8A 4ED3A 3KG4A 3T1HF 1D1UA 2HAIA 4R0EA 2PMZD 1KD1T 4OZ0A 5JJBA 4LIRA 4TY8A 4OZ5A 3VCDA 1U1MA 3C6TA 3OR2A 4WZQA 2DGTA 3HHDA 4P7VA 3W2VA 3B78A 4A8OA 3AHPA 1UFWA 1X9SA 3M6VA 5DDQC 3P49B 2R2TA 4K59A 4PXBA 2CPDA 2MXYA 3MGJA 4Q0BA 3I9V9 1DFDA 1N56A 4LSLB 3NLCA 3PVXA 4ZCKA 3TUZC 2DRBA 1F0XA 4IG3B 2WTFA 4ECYA 2R7OA 4GO5X 4NMLA 4PG8A 2KG1A 2VC1A 3M9OB 5HI7A 2HNZB 4TU8A 3HKWA 4QWAA 3O2IA 1LWEA 2LEPA 4DWIA 3CCRS 3GV8B 2K7JA 2XEXA 3JTOA 5HO4A 4N5SA 1S7HA 1PILA 4RW7A 1HQEB 2XLJA 4DR3F 2WAQD 3K0JA 1AW0A 4NCBA 4ECUA 1TK8A 1Y3KA 3AY0A 4H4KA 5F8IA 1RTDA 5KFYA 5BYRA 3OSNA 2AJ0A 3OLBA 1UJ4A 1TK0A 1CG2A 1JIHA 4G6VB 4PPDA 2FD2A 2HFZA 2Q3PA 2UUAF 1OSCA 1B0TA 4IQMA 4N77A 2AGQA 1AFJA 5KFTA 2DGWA 4DV6F 3RRKA 3F44A 4MTPA 2MQLA 2OPPA 1T94A 3PRDA 3PW0A 4QIWD 5KAKA 4TY9A 2YKMA 2DBBA 2D3UA 4B9NA 1KLNA 1R3NA 4F4WA 2FHOB 5T7LB 1QAYA 2DGSA 3H4DA 1C0TA 2O66A 3SZ2A 2BJEA 2VFUA 1FXDA 3ENWA 4F4XA 4C0HA 4WF9Q 3AQOA 3RYLA 2ZH5A 2G13A 4WZMA 5DDOC 1RT5A 1RT7A 2DB1A 2HHTA 2ZBCA 2FLNA 4B17A 2DCUB 1N5TA 2DNOA 2I38A 4IOCQ 2ASDA 1YJNS 5KFHA 3MEGA 4CQ1A 4ECWA 4CIOA 5L9XA 1JXLA 2DH8A 3PKMA 4LIWA 1H2TZ 2EVZA 2IMOA 3MM9A 3QZ7A 4OX9F 4BCAA 1LWCA 4DF8A 3GB0A 1KEKA 3AA9A 3VZIA 2C3MA 2OO4A 1RQ0A 3ZZZA 2LQ5A 1S6QB 2K1RB 2BXJA 4Y2CA 4DG1A 3IGNA 5LL6d 4OLPA 4F4KA 4QR2A 2L9DA 4DV3F 3D1QA 1VQNS 5KFAA 2ZE2B 4NX9A 2GHPA 3GWCA 3MD1A 1S10A 4C11A 1DBDA 4V19X 5SZTA 2W7PA 2ZFHA 4F2RA 3VAHA 4DQIA 2BYCA 4NLGA 1S1WB 4DOZA 2DO0A 3LAMA 5D4OA 1SJFA 1Q81T 1LOUA 3VTIA 1SH2A 4IYQA 2W4CA 3QJPA 6FDRA 2FJEB 1XR5A 1BGXT 2CPIA 5GVQA 2PE8A 5J2NA 4MIBA 3M8PA 3MM6A 2BRLA 1WF2A 4AL5A 2X3GA 1HNIB 3KK3A 2D3OR 1U48A 2AV5A 5B0GA 1T05B 4X4NA 2E7XA 4PG5A 2BA9A 4PQAA 3O8WA 1VQLS 1N52B 3CCVS 2COLA 3PDNA 1H38A 4NPOA 3BGLA 4HI2A 4E98A 1S6PB 2LDYA 3FNNA 4RKUC 5JVGQ 2QYCA 4IFVB 3IA0A 4G3IA 3N79A 3DCAA 5I3QA 4EYHB 3R1LA 3IXQA 2X1BA 1U1PA 3K8VA 4CH1A 1I94F 3I5AA 2PFFB 3OPKA 2APOA 3CPWR 2CPXA 4R0JA 3W3SA 2HS4A 1RYRA 5KFVA 1Q53A 1U1OA 1LK7A 3H5UA 4OZNA 2I1RA 3KHHA 4RBTA 4USJC 1REVA 4NYPA 2DGXA 5KT6A 3FQKA 2UV8G 1OPZA 2IYGA 1U09A 4NLOA 4I6AA 3BR9A 4LUBA 4ZCMA 1DQ8A 2BM1A 3KG0A 3OJSA 3B82A 3D54A 5AXKA 4TQSA 1QSSA 4A8KA 3PW7A 5E3RA 2QFJA 5J2QB 2O5DA 1NKBA 2ABYA 2HRUA 4IKAA 4PQUB 2KXNB 4KGMA 2CJBA 5BYQA 3QIDA 3A1YG 1HARA 2AW0A 1SV5B 2L48A 3JYTA 1D9DA 1S1VA 2J9EA 2V0NA 4MMOA 4EO8A 3RB4A 4CO5A 1ULRA 3VZHA 1HNXF 1CVJA 3GMGA 2QE5A 1HYSB 3SI8A 4IDKA 2UUWA 3UFCX 1Q7YT 2LXFA 4EYIB 1VC6A 5J1EA 1JJ2R 4ZPBA 2DD8S 2HVHA 3W2WA 1FDAA 3I4PA 2GC8A 3LWMA 2GW8A 2MPUA 1WEXA 5K8PA 3RU0A 3OXLA 3NGDA 4ED6A 3UDLA 2W25A 2M70A 1YJWS 4RWWA 3P6YC 4NCGB 4PKDB 2XNQA 4KV8A 3Q0AA 4ED7A 2XSFA 3RRGA 4WFZA 1U4BA 1LW0B 4PWDB 1XMQF 1T02A 3DLBA 3QLHA 3O3LA 4LT6A 4QW9A 2DHGA 2MZSA 3CWJA 5C42A 5KFPA 3BJYA 2IA6A 3ZZPA 2XGPA 4DL2A 4DS5A 4WFYA 4B3TF 1VQYA 1S99A 2ZKTA 4J37A 4I64A 2QV6A 3MOZA 5KFSA 2ZDOA 4YB1P 3MEEA 2FC8A 3MCSA 3QGHA 4LVOP 2NUUG 3BB5A 4YR2A 2QO3A 1JLQA 2YNFA 1SXLA 2XMMA 2BM0A 3I87A 3DLEA 4ILLA 1GXLA 1KOOA 1WG1A 1XERA 2CQDA 2I5JA 4KQZA 3MUMP 1ZYQA 3TUIC 4TU7A 1RT6B 3RZAA 3C66A 1NK9A 4OI1A 1FDNA 1X5SA 2ASJA 2BZ2A 1F9FA 4YDXA 1XR6A 5K9FA 4PCQA 2UP1A 3V6KA 2VPYB 4OJHA 5CYMA 2M8DB 2HHPA 4YDDB 3CGIA 2BACA 2MZ1A 5G0RB 4RW6A 3CULA 3GV5B 1M5KC 3BSCA 4IG0B 2WOMA 4R8UB 2LMIA 3I96A 1JLGB 4MJKA 4TN2A 2B7CB 1FTCA 1V3SA 2PMHA 1TKTB 2P9EA 3N28A 4R5PA 3V5RA 4DL6A 2GIQA 5DDRC 3KK2A 4HLBA 3CCUS 5C24A 3TAMA 2RB7A 5CYQB 2I9SA 2YNIA 4KHPF 2HFOA 2XMUA 2YKNA 1BD6A 1BC6A 2EG2A 5IS2A 3H5YA 1ZH5A 2OPRA 1CPZA 4KT0C 4ZHRA 1UKUA 3MAQA 4QWBA 1JLEA 1FKAF 1BQNB 2IRUA 4OHZA 2XB2D 5M2RA 1D8ZA 1JNRB 4NLDA 2B4OA 1UVJA 3PO4A 4DSKA 3NGKA 4DEZA 1FRMA 2Z0GA 1WHWA 2GIRA 4IRKA 2EFVA 4F25A 4K50A 2EC0A 2W9AA 1Y3JA 3ITHB 3M8SA 3IRXA 3HF5A 1K1QA 4PR6A 3M2RA 2E1RA 3NRBA 2M2BA 3I55S 1RKJA 4TQRA 1S1XB 3OL9A 2YKQA 3EX7B 1KS2A 1L5UA 3GYXB 5EUHA 3FZ2A 4QJVA 4J9NA 2DR7A 1M0SA 3DHXA 2NREA 4IRCA 2GGPA 2M7SA 2ALZA 3QJJA 5HBMB 1BLUA 3Q8SB 2HGLA 3FZBA 1TFYA 3I0RB 4Z37A 1FJEB 2IAJA 4C3MA 5EWFA 3CO9A 4F2SA 2VBXA 5KG3A 4EO6A 3D0GE 3EXYA 4OIXA 3D5MA 1SQEA 3FEXB 2DNNA 2HWHA 4DHVA 4F8RA 4OL8A 3K5MA 3M6UA 2X51A 5MLCV 1OIAA 4HVZA 3RRHA 2XY6A 2LQJA 4I67A 3HVWA 2ZH4A 1C1CA 4ZPDA 4KJIA 5F9LA 2CJAA 3OVBA 3SFGA 5KFZA 4FF4A 1URNA 2YH1A 1CSJA 4O3OA 3FGVA 3DC2A 4X4RA 1VBXA 2J6SA 5KFIA 3SQGA 1RWUA 2LYVA 4B9LA 4LVNP 4O23A 2GFFA 3C46A 1W25A 5T41A 1QE1A 3HXMA 4B3SF 4CCHA 2QIFA 3N6MA 3CJ2A 2IJFA 1ZZFA 2OFHX 2YKAA 2Z2MA 5GMKa 3TAQA 2OTLS 3RB6A 3O44A 4IH6A 1IKYA 5B0FA 1SB6A 1SIZA 2SXLA 3QAUA 5E5NA 3CCSS 3T5LA 2J7KA 2RH3A 3I5CA 2JL9A 2VA2A 4ZMMA 2ADCA 1DARA 2DNKA 4G1QA 4PUOB 1ZM9A 3NWGA 2XLIA