2XMVA

Copper chaperone atx1 from synechocystis pcc6803 (cu1, trimeric form, his61tyr mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGYEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords SSR2857 PROTEIN
publication title Visualizing the Metal-Binding Versatility of Copper Trafficking Sites .
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xmvA00
2K1RB 1S6OA 3LGMA 2VH7A 2IYIA 1APSA 3FMBA 2FHMA 2K7KA 3HHLD 2GO8A 5B0DA 4Y2KA 2AP6A 1KQKA 1P6TA 2ZDOA 2N7YA 3MCSA 5F0WA 5B0BA 2PGCA 1OQ3A 4YDXA 1GXUA 4DL0C 3IWLA 5T7LA 1QUPA 1R6YA 2ZDPA 1CC7A 2N4CA 1N5VA 2PD1A 2KYZA 2FTRA 2BYCA 2AW0A 2OP5A 5KAKA 4A4JA 1FEEA 1LQ9A 2HFOA 1TUVA 1FE0A 4ZOSA 4FNHA 2XMUA 4A46A 2GGPB 4DN9A 2XMJA 4HI2A 1K0VA 4HI1A 1OSDA 4Y2MA 1JK9B 2OAUA 3HF5A 3HHLB 5B0FA 1YJUA 1RJJA 3VTIA 3CJKA 3BM7A 3WDOA 5F0UA 5B0AA 1SI9A 3LO3A 1IUJA 2K1RA 2Q3PA 2QLXA 3BB5A 1KVIA 2HFNA 4ZA1A 1VQSA 1W2IA 1YRXA 2EW9A 3GZ7A 4OJ3A 1Q4RA 1AW0A 4OJ1A 2OD4A 4QOTA 5B0CA 2ACYA 2QLWA 1ULRA 1N5QA 2GFFA 2HQIA 2LQBA 3DCAA 3I9ZA 3K7RA 4Q2MA 4U9RA 1TL5A 3E8OA 2XMMA 2HLTA 5B08A 2OKQA 2XMTA 2G9OA 4Q2LA 2AJ1A 1TR0A 1CC8A 1Q8LA 2L3MA 3BGUA 4OIXA 1FD8A 1FESA 2ROGA 2N4DA 3FRYA 1VQYA 3F44A 2AJ0A 3TRGA 2K2PA 2BUNA 1N5SA 3BN7A 2CRLA 3IWXA 4OJGA 2W4PA 1X7VA 2FB0A 1TL4A 5B0GA 2IFXA 4A48A 1Q53A 1V3ZA 1SQEA 3BDEA 3HFKA 4DPOA 1P8GA 2OMOA 5T7LB 2XMVA 3BF4A 1WD6A 4EFAC 1N5TA 3BR8A 3KG1A 3QMQA 4NL5A 2XMKA 2RU9A 4FNIA 3KG0A 5K9FA 3HX9A 1OPZA 2ASYA 3UDCA 4HL9A 1X0PA 4Y2IA 2GGPA 1GXTA 3HDSA 3LGNA 1Y0HA 1YJVA 1AFIA 3HHLA 2HIQA 1Y3KA 5B09A 2ROPA 5IXUA 4HH1A 1JWWA 2LXFA 2BJDA 5A6PA 1X8DA 5A6WA 2OD6A 3HHLC 1Y9OA 2RILA 1KVJA 1FE4A 1MWZA 1XBWA 1YJRA 1Q8BA 2BBEA 1MWYA 1Y3JA 3DXSX 2GCFA 2LQ9A 1YG0A 4HH0A 4F67A 2RMLA 3KNGA 2GA7A 1SB6A 2HLUA 5B0EA 1CPZA 2W4DA 2KKHA 2QIFA 2QYCA 3T9NA 1FVSA 1YJTA 3TNVA 1OQ6A 2KT2A 3TOQA 2VV5A 2GV1A 2W4CA 2K7JA 2OFGX 3QGPA 2RSQA 1TZ0A 2JDJA 2XMWA 2BJEA 2ROEA 2IYGA 1FVQA 2FIUA 3MZIA 4NPOA 4YEAA 3CJKB 2LDIA 1AFJA 4A47A 1URRA 2KT3A 3KKFA 1S6UA 2OFHX 1U7LA 4OJHA 3FGVA
chains in the Genus database with same CATH superfamily
4JI3J 1UWBB 1Y5NB 3FK4A 3TQEA 2HHXA 2MYFA 4V19J 1XERA 1S48A 2W2NP 3V81B 4MK7A 2F4VF 2MLXA 3MD1A 1JLEA 3DDKA 3C16B 1F60B 1GAOA 3BB5A 3SCIE 4NXMF 1FI4A 4L6V3 1NDKA 1PO6A 4DUZJ 2NSCA 2B5JB 1Q8LA 4J9OA 2D7SA 2OUGA 3BDPA 1VQ6S 5KT6A 1HNIA 2CNNB 4F0MA 1HIYA 1UEUA 1IR2A 1X31C 2B4PA 2DNNA 2W01A 2MB0B 4LSNB 4ECVA 2WSEC 3MM8A 4NYZA 2W7AA 3CCRS 5E3PA 2AQ4A 3OFGA 1F5CA 5KFGA 1H2VZ 2YNGA 1VIXA 1UVJA 2K7KA 2ZOGA 2RRNA 2P9GA 1F2HA 3M8YA 3CIMA 1YGYA 4P72A 4DN0A 4IFYA 1E6VB 1CQMA 4CTAB 1PCAA 5KFFA 3NMRA 2WVFA 2H65B 2E1AA 1ELOA 3SQGA 2QLXA 4DEZA 2PEBA 4QWEA 5A8RB 2CPJA 3M6XA 3KTQA 3GP9A 2AV5A 3PR5B 1IXKA 2OPRB 3MR5A 3CDAA 3WC0A 4ZN1A 3CSKA 4LREA 3GQCA 3NOCA 2PMWA 4P71A 2E5LF 4RZRA 4FF1A 2RVJA 2NUUG 1T03A 1VISA 2B4UA 2DR8A 3Q8RB 5HMYA 3UW1A 4RW9A 4PQAA 3UD5A 2WBRA 3GIKA 5K14A 1RAAB 1X0FA 2YNHA 3DOKA 2A6MA 2GCFA 1RT7A 5C2GA 3CVKA 1FVSA 4Z37A 3OVAA 3RG6A 3DN9A 1BHNA 4QIVA 4DL4A 3G6VA 4ICLB 1AB8A 1H38A 2FTRA 1FEEA 1CJKB 4JI2J 3I5AA 3LANA 3C66A 4AQYF 1SQGA 4L72B 4RL1A 4HT7A 3FDSA 1WKJA 3LW5C 1RAHB 1TKTB 2C22A 1VC6A 4OZ1A 3MI7X 2DNGA 4NRTA 3IG1B 2B8PA 3BPDA 4URGA 4FBUA 1JLBB 4K4SA 1VBYA 3AJ2A 3AOAA 1EQ0A 3ZTSA 1KP6A 1ZZNA 1Y4ZB 4H4KC 3NRBA 1NCLA 3C46A 3CJ3A 4KE5A 2Q1LA 4PXEA 3LGHA 3QSYB 3VAGA 4XPCA 3MR6A 4CRJA 4I1TA 4WIQA 4LBPA 4WWSA 3TX0A 4NRUA 2UVUA 3P5TL 5A8WB 1Q5VA 1BY9A 2DNOA 4YEAA 3B8HA 2DT9A 2ZWPA 3K0JA 4KPYA 2YPZA 2KM8C 3QJLA 1RTIA 1FDAA 4X64J 2QT7A 2R8GA 1RTJB 1HNWJ 2W2OP 4ED5A 2BM1A 4CYUB 1U0SA 3LO3A 3CC7S 2WVEA 4F25A 5L1IA 1N32F 1S9EB 1AW0A 5IWAF 1TFWA 4WK3A 4RUCA 3MMAA 2KXNB 3W60A 3VALA 2F8EX 3BKFA 4DV3F 1WOSA 3M32A 1MROA 3AY0A 4OHYA 3GCXP 3S01A 2UVVA 1TK5A 5LMUJ 4J9UE 2MKYA 3QJJA 3T19A 1EKRA 2JSXA 2DD8S 1OPZA 1NPRA 4PWWA 2GGPA 2YKQA 1JJ4A 3MEDA 5KT7A 1FNXH 4ZLJA 4K4VA 4ZVRB 1PJ5A 4LF4J 3D2WA 1QAXA 3MOZA 3SV3A 3THVA 2W1BA 1OIAA 2YKAA 3MM6A 2J8AA 3J7ZT 2MJNA 2GAHC 2ZVSA 1TUWA 5H9EJ 1QE1B 2AJFE 2J6TA 4DR6J 1RKJA 5ETNA 3MCSA 1XEZA 2VG7A 5H9FJ 3GR1A 1T9TA 4KGVB 2I5JA 2W7PA 2V94A 2DRBA 3NNCA 4RU2A 2NLWA 2R2UA 2WVBA 2L41A 1BQNB 3CJKA 1FRMA 5J1PA 1M5SA 2QLWA 4OV6A 4F4AA 2DITA 1S1XB 3I0SA 3HO1A 2BOPA 3H8YA 4DPUA 2KT5A 1AT1B 1JIHA 5FIIA 4OZ2A 4R0EA 1ITPA 1E6YA 4Y2IA 4LF8J 4J91A 2Z0GA 4DPXA 1WDTA 1DAXA 2PI4A 1GEHA 4QZVB 3SXLA 3ONQA 4DQRA 1K73T 3D3CJ 3T1HJ 5KFLA 1WEYA 1NK4A 3D7SB 3MM9B 3FGVA 1VMBA 1NSPA 1SXLA 4LRBA 2VUGA 3D1QA 5JJBA 3C8YA 3DM2A 4MH8A 3W2VB 1T9WA 4HACB 1B0VA 4USWA 1JK9B 3G71S 3T9ZA 5HVGA 5E5NA 1RJJA 2HHVA 4H4OB 3CCLS 4USMA 1RAOA 4QOTA 4E98A 4IG0A 3H2VE 1DTQA 2XWYA 5M2UA 4DV6J 2ABYA 1U0HA 3CCJS 4DR3J 3O44A 2DRDA 3KMSA 4KTQA 3A12A 3R5JB 3FC9A 5C25B 1NDLA 3NMAA 4IRKA 1VBXA 2AZ1A 1U8WA 5A2QU 1Q5YA 3BR8A 2JEIA 3D0HE 5DRKA 1JWWA 1Q16B 2HQ3A 3HHLC 3TZWA 4A8SA 4UZCA 2LYVA 2RT3A 2JL9A 1OPIA 3OL9A 4C98A 1OQ6A 2DR9A 4UUWA 1N33J 2FGCA 2HVZA 3GE9A 5I4MA 3EX7B 4Q44A 2FIUA 1QSYA 1F5BA 1RA6A 2GO8A 1WHYA 4L3NA 3RBXA 1RT6B 1X5TA 1M5KC 2IA0A 4YB5A 3CCQS 1BWEA 3FSXA 2ZH4A 2IM1A 4G1QB 4L75A 1N5QA 1MU2A 2YH0A 3V5RA 3KLFA 1C1CB 2HYIB 3MM5A 4QWCA 4YR3A 1C1BA 3E2EA 2AZ3A 4G1PA 5J2MA 5ADZA 4M5JA 2UV8A 1QAYA 3RZAA 2LECA 5DLGA 1FKOA 1HBOA 3GIRA 1NPPA 4OYZA 4CO0A 3NOGA 3H40A 5E3CA 3LPYA 1TKZB 2XS2A 3JYTA 2YNFA 5CCLA 4HH0A 4DV4J 1I6JA 2MZ1A 4AL5A 2XYPB 3PRDA 4PZVA 5EWEA 1S1VA 1W26A 4EGLA 4DV1F 1NK6A 1RP5A 1S6UA 3DDNA 4ZPBA 1WF1A 4HVZA 4Y2KA 4LF2A 3C6TA 3LP1B 3H98A 2W7OA 4ZJOA 2KN4A 3CD6S 3Q8PB 3ZZOA 1X9MA 1KEKA 3NCPA 5HI7A 3NBPA 5K20B 3TAMA 1FWKA 2BDPA 3MMCA 1U1KA 2HNDA 3R5DA 3TRGA 3F73A 5D77A 2CRLA 4DL6A 2VODA 3W66A 5GAHU 5BYSA 2ZM6J 5KG7A 3J7AN 4DX6A 3ENVA 2B56A 5HATA 2YWGA 3POTB 1JLAA 4UQTA 3AB2B 4P73A 1EB0A 1YJNS 4O44A 2IM0A 3OFFA 5ITHA 3M1VB 3SMZA 2V68A 3MCNA 1FE4A 4H4MA 1NJYA 2NYHA 1IJFB 2AMCB 1SH2A 4LSLB 5KFTA 5FJ4A 4KHPJ 3W1YC 1D3WA 2XO7A 1AROP 1KOOA 2DR7A 1WC1A 5J2NA 2JHEA 3CC2S 5LXRA 1QVGR 2AYBA 5ETKA 2VG5B 4BWJA 1UFKA 3GV7B 3AHPA 3M9MB 2VD3A 1ZH5A 2V2ZA 3EXCX 3DRRB 3MEGB 4ID5A 1S6QB 1SCJB 3EPIA 4Q2MA 1HNXJ 2ZJRQ 2GVDB 2KXHA 1HQ2A 4I67A 2BXJA 2H5JB 2N3LA 3DRXA 4CO1A 3KHGA 1QLNA 4DR5J 4ED2A 4ECXA 3KXDA 3BDEA 4GKJJ 1F3VA 5HK4A 2DEIA 4FNIA 3DDIA 3UI3A 3ZXWA 2CQ1A 3PX6A 2BRKA 4G65A 5E7OB 1SKRA 5E2QA 3UD3P 4DG1B 2VZ9A 5D0GA 3Q8SB 3NS5A 2MY8A 4DFPA 1L3VA 2BE2B 3CGIA 3I4PA 3PKYA 4BBYA 1LWFB 5JXSA 4J9RA 1FDBA 4H54A 2I6WA 5F41A 1H2UX 3M9OB 3BKUA 1WOOA 5CZXA 5F8IA 5SUHA 4QWBA 4KY3A 1T8EA 1S97A 4KKOB 1UWBA 1XNQJ 4X66J 3KHLA 2DNQA 2KVIA 3DGPB 3OR2B 1RABB 4YR0A 3JB9k 3V81A 2IM2A 1LFPA 4J5OA 1NK5A 1GMUA 4TQSA 4RLEA 4MIBA 1NSAA 2ERRA 5KG1A 4JV5J 1MN7A 1SQEA 1UJ5A 1HD1A 4PABA 1L5UA 2XMKA 2VB6A 3PW0A 1NJXA 4AFFA 3IAM9 4UT4A 1F9EB 3OQ2A 3HD1A 3GU0A 2NXJA 4O0IA 3PYGA 2XC9A 2JEJA 2ZH6A 2H54B 1TP7A 2OLWA 1IKVB 3TUIC 4LRFA 5CH7B 4EYIB 1S57A 1UPPA 2ZOMA 3CB4A 3GCWP 2HK2A 4LSNA 4X4OA 4GO5X 4OJ1A 1DFDA 2KXFA 4YY3J 2QEXS 4PG7A 5J2PB 3R97A 1GXUA 4DL0C 1AZSA 5AXNA 4KGMA 3OW2R 2YWWA 1O8BA 3V6KA 3M8QB 2PT0A 2DH9A 3C14A 3MR3A 5E33A 1B99A 2CPDA 2YX4A 4FKYA 4C8NA 4JI4J 5IZHA 4JI0F 1WI6A 1YTYA 2CJKA 4F36A 3GZ7A 2E1CA 2W9BA 3T5LA 1RAGB 3A8IA 2XMMA 2XMTA 3FUYA 4ANEA 5KFSA 2CDQA 1E6VA 1X9WA 3ELHA 3HHNB 3BQ1A 4JV0A 4CTAA 7FD1A 5AXKA 5LSRA 2BW2A 4O3RA 1RK8A 2IHR1 3CJRA 9ATCB 4LJMA 1RT4B 2RRAA 1UJ6A 3A8KA 1TL3A 4LFAJ 2ZD1B 3M2UA 4LF6J 1TK0A 1UFWA 3QMQA 1KWMA 2BA9A 3PDNA 4OHVA 3TZZA 4ELUA 2OPRA 2LQJA 1OYEA 4FXDA 3TP2A 3R1HA 2XI3A 1S49A 2KHDA 4RWXA 4Y28C 4A8KA 2HQFA 2MKHA 3A8EA 3TNVA 3EGZA 1RYSA 2RSQA 3TW0A 4AD6A 2FJDB 2RNEA 2YNIA 5KG4A 2ZVIA 4WCEQ 5IT9U 3V6DB 1HFEL 3ZZTA 1JJ2R 4B3SJ 4FNHA 3ZTRA 5DDRC 3B6BA 3R6LB 5G4DA 2VJUA 2HIYA 3GG0A 4FVCA 3IP0A 1YRXA 1FRHA 5L1LA 2HHPA 2OD4A 5LJ3Y 4X4TA 4ICLA 4JI3F 4F4ZA 3J7Z5 1TKXA 1S0VA 4OYPA 1CBKA 1CC8A 4MKAA 5HROA 3M2VB 2HHTA 5DDQC 1Z1ZA 3AFGA 3BGLA 2EG2A 4WZMA 3MPDA 4DUYJ 1P9QC 2H51B 3E01A 3TX8A 3RU0A 3M8WA 2CNKB 4DS4A 1CVJA 1IQZA 4W90B 1KLMB 1NKEA 1Y10A 3UDCA 5ETTA 4AL6A 2CQ2A 1Y0HA 1R8PA 4C0HA 2XCAA 1V3RA 4NA2A 2DYAA 4RW7A 4DUZF 3GB0A 2MTLA 2BW7A 2XEXA 4FZVA 1MWYA 4ZCKA 3EZOA 1DARA 4TY8B 2NSBA 2KT2A 4PQUB 1S4EA 2JLGA 1RDRA 2K1RB 5FDLB 5D6GA 1T05A 4HTIA 3OLAA 4M5LA 3R8YA 4DV0J 2XS7A 3ZZ0A 4L3KA 5A0YB 3FBBA 3GJTB 3SIPB 3VTIA 2VJVA 1IKYB 1M1GA 3K8WA 5GADI 1YDLA 4RBTA 3W5YA 3DCAA 3M8SA 1B70B 1HWJA 2DNKA 2YKMB 3CJ2A 3RBEA 1RTJA 2HNZB 4CYUA 2MZRA 3PEHA 3RAQA 1I94J 5KFMA 1NH8A 2ZH2A 1S7IA 3BN4A 1UKUA 1VQMS 2VA3A 8ATCB 3G87A 1G3OA 1O6XA 3CXCR 7AT1B 5CZVA 4DR1J 5KFQA 2XQCA 2Z2MA 5IQQA 1YJRA 4YDDB 1CPZA 2KKHA 3GG1A 1TUGB 2WTFA 3G4SS 1S6PB 2PE8A 3N9UC 2H9ZA 2NXCA 1IM6A 4M95A 3IWNC 5EX0A 1IWGA 4NLDA 4LF9J 4WTYA 1N54B 3BGRB 2PA8D 3TYTA 4OZ3A 2CNOB 1FXLA 3NCRA 5HSPA 3VR1A 1QE1A 3HJVA 3CMAS 2X7IA 1W25A 4W92B 4ZVTB 4X65J 2DIUA 1LW0A 4LF5J 1UVLA 4PG6A 3W9HA 5KFJA 4LVNP 3JAMU 4B9TA 3R6GB 3DU5A 2J8SA 4FYYB 3KHHA 1BQNA 4WYWA 2Z58B 4ZDNA 1ACMB 3AOBA 4JI2F 2ZZMA 2AYMA 2F7VA 1F1BB 2AYGA 4RU9A 3TA0A 4QPXA 2IBOA 4C11A 2ZE2A 3IM9A 1VQ9S 2HAFA 1R8AA 4RUAA 1S1XA 2L08A 3O3LA 5L46A 2X1BA 3ZNUA 7FDRA 1TL7A 1C0TB 1IBKF 3SSSA 2QN6B 3SI8A 1FX2A 2E7XA 4QW9A 1HQUB 2ZH3A 3BQ2A 4K2JA 2DNMA 5F8MA 4EWTA 3WHIA 1HWUA 3MPYA 1BQMB 4JI5J 4A8FA 1FA0A 3C6UA 3EGNA 1FERA 4P7TA 1RAEB 2AJ2A 4OJ3A 4HHJA 3ZNJ1 3QWPA 4WE1B 1PAUB 1KR4A 1SC6A 4DXLA 4IOCQ 2HQDA 2RJZA 4X64F 5CD4H 2RE1A 3I9V9 1NH7A 3EVMA 1HNWF 1N6QA 5HBMB 2BJ3A 2UP1A 2PN6A 2DGVA 2R8JA 3AD8C 4KYZA 3NAIA 4ITSA 5D4LA 1GK8A 2WB4A 2F4FA 1VJQA 1X4HA 2VBXA 5DG9A 2BACA 1XR5A 5KFVA 3LWLA 4BDPA 2OHDA 1CJVB 4FF3A 4FYWB 4FP9A 5LMUF 2FJEB 4Z2XA 2LA6A 4ZN3A 3GWCA 3RB0A 4EBCA 1FK9A 4B9VA 1QUPA 1CC7A 4LF4F 1HPZB 2MLZA 1KHWA 4F0KA 3M6VA 3KFWX 3L3CA 5AXMA 2D9OA 3ISND 3M05A 2XSFA 3ISNC 2GMJA 1U2RA 1Y7PA 1RHMB 3GILA 1HNVA 4DR6F 1Q79A 3NGTA 2R7TA 2F40A 4QWAA 4OLPA 3BREA 4FF4A 4LFBJ 3Q83A 4N76A 5K5MA 2XYGB 1TU0B 1EX8A 2HG4A 5G0RB 2XZTB 5KFBA 4TLQA 1XR6A 1UCNA 1C1CA 2DNRA 4EU0A 1WEXA 3FKBA 4DL2A 3LGNA 2B9EA 4CLKA 1Q1KA 1HD0A 3JTPA 2RHQB 3IA0A 3SFGA 2B7BB 2W24A 3WZ0A 2HBQB 4CLLA 1SH0A 1X4FA 3CDBA 3TJ8A 4C3MA 3ITHA 4QYZJ 4DCOB 2MEWA 2WSFC 2RD5C 2LQ5A 3FMBA 1TKZA 4RBVA 4LF8F 3I55S 1S1UA 3GIIA 3OV7A 3S8SA 3JSYA 3OHAA 4F3QA 4DDFA 4DU7A 3EMTA 2KZZA 2NXNA 4ZVSB 3QQCD 1S10A 1UZDA 1YSJA 2YX1A 4IRCA 1FFSB 2XYHB 3LP1A 2KG0A 2OH2A 3U27A 3PRBA 4KFBB 1RWMB 1TR0A 3H7HB 1FESA 1N5YA 1RT5B 3LF0A 1RT2B 2D41A 2W4PA 2P6SA 2IVFB 2DK2A 2MQMA 2IJFA 1FXRA 2K06A 3GMGA 5AJ3J 3NS7B 2RU9A 4EO8A 2ZZTA 4FN5A 4YR2A 4NCAA 4KHRA 2ASJA 4DS5A 1XTZA 3BQ0A 1Q8KA 4DV6F 3ICLA 1VOMA 3UCZP 3EPGA 2KZMA 2QFIA 4DR3F 3T5HA 2ZBPA 2YVSA 4Y2AA 3PIOQ 5KFUA 2OTLS 4G6VB 2CPZA 3FCHA 2C3MA 5L9NA 4K4XA 3HMJG 2X3DA 2CQCA 5T7LA 2CDRB 2ZDPA 4CNZA 2FLOA 1PJ6A 2UUBJ 4MT1A 3CD7A 3DXBA 3PY8A 4DN9A 3GYXB 4B3MJ 1RWNB 3MECA 2VPZB 1N33F 2Z2ZA 3JSBA 3THPA 1NK0A 2VG5A 3AD9C 4I7FB 4ZVPB 4NA1A 2O5DA 2DKOB 1U02A 2JX2A 4B3TJ 4CLSA 3HVRA 2DHXA 1IQTA 2ALZA 4OHWA 3W9IA 1U49A 1X4EA 2RF2A 1S6QA 2HAIA 2KTQA 4TU7A 1R7IA 3RB6A 2YX7A 2ZBIA 2GVDA 1JLEB 1YJVA 2YBVA 5IV4A 3MAAA 3BJYA 1VQ8S 1H6KX 2VPXB 1UTAA 4B17A 3DOLA 1D1UA 4L76A 3IRXA 2YWEA 2R7SA 1HNIB 3PYDA 1J5OA 2JH3A 1WOPA 3MWBA 3O1LA 2Q43A 4DR7F 4ZLNA 1FE0A 4DV5J 4JV2A 2BE2A 1LWFA 5L38A 3SV4A 3MM8B 4IR9A 2HS3A 2QTWA 3D54A 2ZHBA 1XNRJ 3KDNA 3DU6A 3FBFA 3C15A 1FEHA 1FTCA 3G8TA 3UDEA 2CPEA 4LF1A 4WFZA 2YQ3A 2VICA 1YZ7A 3L7PA 1U6ZA 3N4WA 1T94A 4ZVFA 4IUFA 3Q86A 4DX8H 2FHJD 3NKYA 2AF6A 4USVA 1OSCA 4K2XA 1NO8A 2CJAA 3LUYA 4U7UK 3EZ5A 2DR5A 1Y9OA 1DBDA 3IGVA 4JOUA 2KJWA 4URSA 4GVBB 2ZM6F 3A3OB 5J1NA 1FVQA 1HHSA 1KDNA 3MPVA 2AT1B 4DL5A 2CXEA 2Q6BA 3G96A 2C2ZB 3V4IB 5T41A 4DV2J 4CDIA 2AU0A 4A8XA 4ZITA 1XC9A 3AA8A 2PFDA 1OSDA 1IM4A 1M1HA 1U25A 4M5NA 3FBEA 4KHPF 3UQSA 1HMVB 4K4UA 3DOKB 2CAJA 1YITS 2FZCB 2JC1A 4GO7X 2NXEA 4DFMA 1KONA 2W25A 3QGGA 3B78A 2QV6A 2G2ZA 4IOBA 3TAQA 1WD6A 8AT1B 2AWZA 3A3PB 3U1NA 1MNEA 4WKYA 3RRGA 3OLBA 1HNXF 1FO1A 3L09A 2KRRA 2V4JA 3FQLA 2AD9A 3CJQA 1MMLA 5DZ6A 3SSQA 4GKJF 2VQEF 3AJDA 1RZMA 5HMXA 3N5FA 1S6OA 1HI8A 1H0HB 2R8KA 2Z4PA 4UOGA 2IRXA 1LW2A 1QJHA 2PD1A 1WTBA 3RR8A 4TLRA 2XULA 4NZ6A 1U09A 2IDEA 1D9FA 3QNWB 4B3RJ 3UO0A 1H2TZ 2GFFA 4OX7A 2MSSA 3V6DA 1AA1B 4DQQA 1S9FA 3PHTA 5D15A 2H48B 3PYEA 4NE9C 2F8MA 2AJ0A 2WOMA 4OHZA 1WJ9A 5HANA 2RHSB 4C8ZA 1Q53A 4J37A 1P8GA 5BXIA 2V9WA 2IPOB 2DCLA 2EC2A 1XNQF 4X66F 3M2VA 4P75A 2LXFA 1RBAA 3ETOA 3ISZA 1HBMB 1IKWA 4JV5F 2W8LA 4O3QA 3M32B 1MROB 4WKRA 1WSVA 1WG1A 3K5LA 2POKA 2FHMA 1PC5A 1S1TA 1FKPB 5EDWA 3FZ2A 3KLIB 1RBOB 4RNFA 5DQIA 3H5YA 1D09B 4ZVGA 2HHHJ 1FRKA 3HK2A 1UJ4A 2GGPB 3K2YA 3MEDB 2E9RX 1RI7A 3UN3A 3GJRB 2QSWA 2K1RA 5FDLA 1S0MA 5KOWA 3A13A 2OPPB 2E5GA 4ZPDA 2HVEA 3IC1A 2ZKUA 4YY3F 2DB1A 3PW2A 4EZ6A 2GC8A 5A0YA 3MM6B 1NLKL 2C1EB 4CO3A 3BBCA 1IKYA 3PKMA 3C19A 2Z57B 4ZP6A 1RYRA 1R0BG 4UTGA 4DV7F 3TWZA 4JI4F 4CP5A 1NKBA 2C2MB 4CLYA 3HFVA 2YKMA 4CLZA 1X0PA 5C2CA 4KH0B 3K57A 1J2VA 4MFBB 3AQPA 5A6PA 2D9PA 1YHQS 1Q8BA 2P6TA 3D6FB 2KHCA 3K8VA 3ENWA 3I0SB 2K7JA 4UOHA 1RHKB 1N36J 4LF6F 4LFAF 2Y9HA 1ZZFA 3VAHA 4IYQA 3KJVA 2HHSA 1NHKL 1X4BA 4AXJA 3NWGA 2UUCJ 4KSEB 1E6YB 1Y11A 3UN2A 4ILRA 3B82A 2YKNA 2IAJB 2K8GA 4K4TA 1S6PA 2VFRA 2G13A 2OO4A 1VRTB 4LIRA 2UZAA 4ZPAA 2HWHA 2ILZA 3IS9A 3KLVA 2OGUA 1VC0A 1PIEA 1RBLA 4Q7AA 3BGRA 2W2QP 3W9JA 1KKHA 2BUNA 3EE3A 1RWUA 2AHOB 4B3SF 1RWWB 4XDCA 3H2LA 1LV5A 2CQ4A 1NJZA 2Z30B 1G2EA 1JQGA 3J80Y 5K8NA 1GX5A 2VKRA 2D3OR 3KWMA 3VHQA 4ZVOB 3KNGA 1SUQB 4DUYF 4DFJA 4ZS6A 4EI2A 2V2VA 1S7HA 3GR0A 4U7UD 3QWUA 1JX4A 4Z7YA 4TY9A 3CJ0A 1Y5IB 4XTTA 2B7CB 3RB4A 2PGCA 1TV6A 3LPEA 5C5JA 1U8SA 2EFVA 3D6MB 1MW7A 1HQUA 2A0FB 2HZAA 3M30B 4FYDA 2DPJA 3KG4A 2CNLB 3TZYA 2LU2A 4ALZA 1VHIA 3CO9A 1BQMA 2OEMA 3RRHA 1FNOA 3RR7A 4IFVA 4P2XA 4Z7CA 3CE8A 4P2MA 2L3MA 4OHXA 5GAEI 4DV0F 2CJXB 4Q0BB 2C3OA 3RRKA 2DHHA 4PCQA 4FPIA 1NDPA 3TO8A 2PA3A 2RUGA 5DO2A 3OXFA 4DR2J 1BC6A 1HBUA 2ZUGA 1Y3KA 5C7PA 1KTQA 5HBMA 1YG0A 5CQGA 3PCOB 5B0EA 2CKWA 1KNZA 1I94F 3GSDA 3AA9A 3CCES 1C1BB 4U8YA 2G1DA 5KFDA 2ATLA 3GLJA 3MEEA 2Y0BB 4B02A 2XGPA 4FF2A 2UXCJ 1K0TA 1CJVA 1FKOB 1R6YA 1R6VA 1SL0A 3SCKE 4PYDA 1H7WA 2WAQD 3DHXA 3L9ZA 5EWGA 2GX8A 2J5AA 3GTYX 2QA4G 2KH9A 2OMLA 2CQBA 3K89A 2PIIA 2NR0A 1HPZA 2M7SA 3VCDA 1S1VB 1H7XA 1I1GA 1VQYA 4ELVA 3MUMP 5KG0A 4LF9F 2W2PP 3AODA 3C6TB 1AUDA 2OELA 4R25A 2XS5A 2YWFA 4JI7J 3U02A 2DNLA 3D1HA 4YB6A 4LIWA 5MLCV 2Z2YB 4QR2A 4HDGA 2J0XA 3NAHA 2BANA 3NBPB 3H20A 3DYAB 1KVJA 3I87A 1FT8A 3TAMB 4JYAJ 1OY6A 3MMCB 2R7XA 3OFEA 2HNDB 4EMDA 3A8JA 4X4NA 4BC9A 2FZGB 2GQCA 4ZIWA 5DZ7A 2LU1A 1JKHB 2ZWOA 1WELA 2DGXA 3B4DA 2U1AA 2RH3A 4C0OC 1PGZA 3OJUA 2DRAA 1TUVA 1ZPWX 2QL5B 5EGYA 3J81U 3FZBA 4K5RA 1IUJA 2MJUA 3VGSA 4FS1A 1ZYQA 4H4MB 1UFLA 2PO4A 1K47A 2Y8WA 4KGZB 3ZTOA 5IOLA 1Q78A 4JI5F 3QGIA 4M5IA 4DL3A 2AX0A 2O1PA 3LAMA 3H25A 2NPFA 3PIPQ 3MD3A 5J2NB 4HHHA 3RTVA 3LP2A 1DJ0A 3Q0AA 4F4YA 2XLJA 3HKZD 2V2QA 2J9DA 4KFBA 4QIFA 1YKWA 1XWLA 1KOHA 4OQJA 2DISA 3UNYA 4PWDA 2FYXA 2WZ1A 1M5HA 3GFXA 2NXUA 3I6PA 2W8KA 2JRSA 2W4CA 1JLFB 2CPFA 5RUBA 4NPOA 1JB0C 1NMEB 3NG8A 5CCMA 1X4AA 1KVKA 4ECZA 1VGYA 3QRQA 2QMXA 2FUG9 5KG5A 4CH1A 3V6JA 3GJQB 2HHQA 3ILJA 3PHEA 2E1RA 3FQKA 3VAKA 4C3LA 2YKOA 1VRQC 1WF2A 1ZOTA 2RQ4A 4CLFA 3O2IA 2B9WA 2NCKL 2RKIA 4NWBA 4CLPA 1N48A 3UE2A 3BV8A 1TL1B 1NPKA 5LM7E 3IR6B 1M0SA 3VZIA 1BMQB 4C0BA 2M2BA 1V3ZA 3QLHB 4TKTA 1GMVA 2JLFA 2AYEA 4I7FA 3FMWA 5GMDA 2YH1A 1D0EA 3M4XA 5ETPA 2B9YA 2HWTA 4JB8B 1SKSA 2CG8A 4NLOA 1KHVA 4RWWA 2UXDF 1B0PA 5A6WA 3F41A 4OV1A 1XBWA 3LP0A 4PPDA 3N0VA 3QZ7A 1WORA 3R2DJ 6FD1A 3MDFA 2CJ9A 5K8MA 4LFBF 4GC7A 1K1SA 2JLEA 3NS6A 2VHGA 4PRFA 4OJHA 2WONA 2RQCA 1SC4B 3CNQP 1RWKB 1NBEB 5B0BA 4EEYA 1G6BA 2EK1A 2VBYA 1LQ9A 1FDDA 4PWUA 2QE5A 5AE3A 3WDOA 4LR7A 3BEGB 1FRXA 4UY85 4MKBA 4EUVA 1A7GE 2JEFA 3M7VA 3TZXA 3US5A 4TU8A 1C4AA 4ZPWR 3PX0A 1SIZA 2R9LA 4X4RA 3T1AA 1JLGA 3PEJA 1JMTA 1RXOB 5HL7Q 2IM3A 2MQ8A 1FHTA 3DRPB 2ZH8A 4ED7A 1AZSB 3DLKB 2XMVA 1BXNA 3D68A 1B64A 4F4WA 5HMZA 3C14B 4B9UA 2FY8A 4HL9A 2J0WA 3WX8A 5M2PA 1HW9A 3CJSA 2W9BB 4OI1A 2QLBB 3IFEA 1QD1A 4MKVA 1XMQJ 5F8NA 3GYGA 5U47A 1LNQA 2B43A 1VRUB 2LKZA 2R7QA 4M8LA 5KG3A 1NZ8A 5AJ3F 4IQMA 2GJIA 1R8CA 4OYAA 4ETXA 1TL3B 3M2UB 4ANCA 4QYRA 4USJC 5KG6A 4OZ0A 5CYQA 2V8VA 4AQYJ 1YI2S 3AD7C 5I3UA 1RAFB 2FGOA 3ZC4A 2QYGA 4GVBA 2XMUA 2O67A 2QMUB 2EXUA 2CQPA 4CIOA 5HMWA 3R7NB 2AEJA 1S77D 2J0QD 2NYIA 3HULA 4PYAA 2F63A 3V4IA 2JZ5A 2HFNA 2VC1A 3D6HB 2CYYA 2CPIA 5IM0A 3NCQA 3IGNA 2VFTA 1B0TA 3UR3C 1B4SA 2CQ3A 1K1QA 1WHWA 4HR2A 2YNIB 2UUBF 2A1BA 2R7WA 3Q2TC 4DFKA 1REGX 1HMVA 2QA2A 4B3MF 4XDDA 2HMIB 5D78A 4ANDA 4ECYA 4HDHA 4B9SA 3I82A 2QFJA 1GXTA 1HKAA 2M70A 5AE2A 2RILA 4B3TF 1L3UA 4NXNJ 4F3MA 2E5HA 1DZ5A 2UU9J 1TKXB 2NPIA 3GIJA 2ZEJA 5HROB 1BE4A 2R7UA 2V67A 3E01B 3QO9A 2BV3A 2DGQA 2FLNA 4AT1B 3DKDA 2Q79A 4KGXB 1XR7A 2WVDA 4ZOSA 2MZTA 1JJCB 4OZLA 1H98A 4RW7B 1WG5A 2HPUA 3HKWA 1KVIA 4OZNA 1HYSA 1W2IA 4U67Q 2F5GA 1UEVA 3PACA 4DF4A 3PW5A 2C42A 4K0KJ 3PG9A 2I38A 1FD8A 1RISA 2YQ0A 4O4GA 1T05B 1V5IB 2RB7A 4DV5F 1ZAXA 2KJVA 1U48A 3W8GA 5GAGU 3RYLA 3QATA 2L9DA 3EGWB 1LXJA 1N88A 3WQPA 2FLPA 3OPKA 4UOFA 1XNRF 2LEAA 3R9LA 3HDSA 4OYMA 2DJWA 1PBUA 3NNAA 2MDAA 4PUOB 1C4CA 5KT4A 4KV8B 1MN9A 2PSZA 4J9VA 2BRLA 2V5HG 2H3EB 3KUEA 5FD1A 3BH6B 1NM2A 2Y1IA 2HURA 1U45A 3D66A 2J7WA 4W98A 3UVJA 4GVLA 1RUSA 3TVZA 2CVEA 4WPAA 2HRYA 3GV5B 1HBMA 3IWLA 4WU3A 3BBFA 3R2CJ 2FQQB 4ECRA 2HFOA 2IC3B 3FBCA 4DF8A 2PC6A 4OI2A 5B0FA 2DXFA 3DLGA 2F3JA 2E7VA 3CCTA 1D8ZA 3VAJA 2O66A 4CZCA 1FKPA 5BJRA 4W4MA 1T9UA 3KLIA 1WEZA 1MG7A 2OKQA 3I5CA 4WYLA 2ZUAA 5KFAA 1WDDA 2SXLA 4IG3B 1HNZJ 4N77A 5E41A 3EVWA 1HWLA 2DTJA 2R2TA 3H0PA 3HD2A 3QIPB 1I5OB 1QM9A 2KRBA 1U24A 2OPPA 4ZVHA 1ZAWA 4XAKA 2FDNA 4PXBA 4R8UA 3QGHA 2M0GB 4K8RA 2B6AB 3OR1A 4OZJA 1UW9A 5KFEA 4CLUA 3UR0A 2DGOA 1LW0B 3OBIA 1LWCB 3Q8YA 1KFSA 3QSIA 3M8PA 3NGKA 3N01A 4MFBA 4MYUA 4WFBQ 1U7LA 3E3XA 1HR0F 4C11B 2IJNA 2ZE2B 2J6SA 2BJ8A 2JC0A 1XN9A 4L74A 3CCMS 2QA1A 3MMJA 1TL7B 3HCXA 1VDHA 3AXKA 5KFKA 4M94A 2QX0A 2X1AA 3NWRA 4MK9A 2NZCA 3I9ZA 2IAJA 2DGSA 1MSWD 4I2PB 1VRTA 2JWNA 2R7OA 3C6UB 5C24B 3NXZA 2RDDA 3UNGC 4PXDA 4LQ3A 4HHUA 4B3RF 4P10A 4F3OA 4KB7A 1UVNA 4K4YA 2BJ9A 4DR4J 3HJFA 3VZHA 4LSZB 4ES3A 1PYOB 3T5KA 4R5PB 4ZPVR 2VBWA 4DJBA 2B3TB 3BSNA 2HFSA 4A8QA 5F8JA 2DXDA 1TFYA 2ALYB 2FC9A 4DX7A 2MZSA 3IBFB 4ZCLA 4YB7A 2XB2D 2IYIA 2CJYB 1YZ6A 1N6QB 4NCBA 4JI8J 2ZDOA 5THWA 3CJ5A 1SUQA 5A2QY 1LK5A 3N6MA 1AUSL 4GKKJ 4QR0A 4RKUC 4P7VA 2XNQA 3L7OA 1RHJB 3OXGA 3SBMA 2VFVA 4DZDA 3M8RA 4DPWA 3VAFA 1FD2A 2H5IB 3QZ8A 3W65A 5HO4A 2G1HA 1FRJA 2OEKA 1CEZA 1A6LA 3JTOA 3M30A 4PG8A 2VIHA 1ZA2B 2HVIA 2CUYA 3GSIA 2HHHF 2CZ4A 1FK9B 2XNRA 3PW4A 3KG0A 3HM9A 2N82B 3DGVA 4HKQA 2PEHA 2GIQA 1X9SA 2HIQA 4Q0BA 5EUHA 1O5JA 2R2RA 2RS8A 5LOQA 1VQLS 4NLYA 1X4DA 2LQ9A 4N41A 2P9EA 2A18A 1HNVB 3T9NA 3TOQA 2R8HA 4HEA9 1YLXA 3I56S 5BR8J 3T1YJ 2JVRA 4ECTA 2I0XA 1Z2LA 2BQ3A 4Q45A 2DH7A 2J7KA 1VJWA 1R0AA 2AP6A 5F0WA 4NA3A 2WW8A 4ZKAA 4P6QA 4FVMA 4K4WA 2VDHA 3CCWA 2IRUA 3NY0A 2M88A 1N4LA 4XPEA 1QVFR 3AQOA 4ZHRA 1LOUA 2B4VA 1S59A 2GZOA 1N36F 1FJCA 4PXCA 4U6PA 4DCPB 3DLBA 3TQ1A 2ASLA 2C3PA 2CZVC 1Y5LB 3ITHB 2N4DA 1JXLA 4O23A 2UUCF 2XHCA 1EKSA 3G2XA 3KK3B 1S1UB 1RTZA 2VL1A 1WC3A 3HFKA 3MHYA 3S6EA 5HQMA 2QSFA 4A8MP 4CH0S 2MGZA 1L3SA 2EFNA 4P74A 4HT5A 2IVYA 4J7CA 1CULA 4YQWA 2E66A 4WP9A 3PJXA 4ETZA 1UMJA 4TXSA 2ZNZA 2KU7A 1N5YB 3CMES 1M1KT 4O3SA 4F0HA 1AFJA 2FHOB 4FYXB 1C0UA 3K17A 2CIMA 1CJUB 5LL6d 3DYAA 4BWMA 1SIWB 1BQXA 4RBUA 1XMBA 5L8RC 3UCGA 1X5OA 3QFWA 1U4BA 4ED8A 3IR7B 1DHMA 1FRIA 1JKHA 1OJ4A 5CAAA 5MAOA 3PFOA 1BGXT 2HLTA 2GAGC 1NK8A 4NOHA 1RB0A 2CQ0A 2J9DE 1CS4A 2QGFB 1QTNB 1U6BA 3KHRA 2FB0A 2JNJA 1W7WA 4E8UA 2UXBJ 3MAQA 4NMLA 5T7LB 3IO1A 1N52B 2XMAA 4OYXA 1Q0NA 3MECB 2F9DA 1HWIA 3ZO7A 1TTHB 1UEKA 1U1PA 3L95X 1NUEA 3PFEA 3I31A 5HQLA 4Q8EA 2EC0A 2KFYA 2V2KA 3R5GA 1YRTA 3RW7A 4FS2A 1RU2A 2RF2B 4DR2F 1HARA 3W62A 4IH7A 3P96A 1KQKA 4DZ6A 2GMLA 3HLUA 2OPSA 3WIUA 2RDJA 3JXOA 1JLFA 2CZ9A 4HI2A 4P9SA 1K0VA 2B9XA 2GIFA 3D9BA 3MAAB 1SI9A 2FC8A 4D3HA 3C3LA 2E1PA 4GC6A 4DU8A 2UXCF 1KQFB 1IR0A 4I2QA 2P9CA 3DOLB 4F4XA 2D3ZA 2E9TA 2E7WA 1EAYC 3QFHA 3IRXB 3R5CA 4RW8A 2QJ3A 1J5OB 3OL7A 4KT0C 3VVUA 5IT0A 1YVFA 4BC7A 1H72C 2MY7A 1TL1A 1R43A 5HN0A 2E29A 1WACA 3QLHA 4WFNQ 3UWTA 2ZBQA 3C15B 5CA5A 4JBCA 4JI7F 3SFUA 3TJAA 2MHEA 4RX6A 2NS1B 3EDRB 2DPIA 2XY7A 1P6TA 2N7YA 4ZLLA 1FJGJ 4Y3CA 1SC1B 2ZBCA 3NGRA 4IO1A 2H4WB 4A46A 4RPFA 3G8SA 4JYAF 3P6YC 1VQOS 1RWOB 1Q7YT 5JUMA 2HBZB 4NYPA 1HQEA 1BUXA 2ZJQQ 1QTMA 4CQ1A 3FCWA 2DR6A 1AYEA 3LOUA 1N34J 1RU1A 2FVSA 4NYOA 3G6XA 3LWMA 3OL8A 2DY9A 2IFXA 2L9NA 5KFXA 4C9DA 1VHFA 3T6JA 2M52A 1RT3A 1R27B 3DRPA 2QRRA 1RHUB 3DLKA 4ED3A 4DPTA 2MKJA 3EJMA 1U1MA 4C48A 4DSJA 2BJEA 1XIQA 4C2MA 1G1XA 3T41A 5CXTA 3U7JA 5GAHI 4QYZK 2DO0A 5LT5A 2H1YA 1VRUA 3FEYB 3VQSA 2FY1A 2F65A 5H1SV 2V4JB 1SJFA 4WFYA 3HSGA 1UP1A 3ZTQA 3AAWB 2CADA 2KL8A 2V0NA 4WFAQ 4ED6A 2VC0A 1SKUB 4ZVQB 2QL7B 2CG4A 2DCUB 2HHWA 1LW2B 2EKNA 5IT9Y 5HP1B 5ETSA 3FFIB 3O5TB 3H4BA 3FEZA 2QMWA 4CLTA 2HVDA 1ZETA 2HMIA 4WIIA 5IC4B 1XJWB 3HHDA 5HJXA 2J76E 1S9GB 2WOMB 3OFHA 1FKAF 2OFHX 2XY5A 5CYMB 3KJQB 2WHOA 4QIWD 3BSOA 1FX4A 1CG2A 5K8PA 3KK2B 2N4CA 5ETQA 3M6UA 1FCAA 1Q8IA 2J7UA 3L4BC 4MYTA 4J9NA 3BGOP 1VQSA 1Q4RA 2IJRA 4NX9A 4M5HA 3EYZA 2X3GA 4WP8A 2EFPA 1IKWB 4ZVEA 1JLCA 3KNAA 3Q2SC 1IBLJ 3EVOA 3TVYA 3UFCX 5A76A 3SDEA 1S1TB 1NK9A 4H4KA 4Y2CA 3MXHP 5D3GA 4GRSA 4TYAA 2X1FA 3LA0A 3TAPA 4RUBA 2VPYB 1CLFA 2DO4A 2CQDA 1T0TV 3EWGA 4UUXA 1J5EJ 3CDEA 2QG9B 3NGSA 2HGLA 2MPUA 4MAKA 3MF5A 4ID8A 1ZM4A 2MQNA 3VVTA 5LMNJ 3G6YA 4KAIA 4QU7A 2KT3A 5LSOA 2HS0A 1VR6A 4IDKB 4PUOA 4KV8A 2EFOA 5DGAA 2MQOA 2E5JA 1DRZA 1MLAA 2I8EA 2MZJA 3CWJA 3DOMA 5I42B 4LQ9A 3OT9A 3ZZUA 3KLHA 1XMQF 5IQ6A 3KUGA 2O01C 3OUYA 1OO0B 2EEYA 5D4OA 3JQKA 2HW3A 4CCHA 3PZPA 1JLQB 1NHVA 1YBTA 5B08A 4QWDA 4RW6B 2IC3A 2FVCA 1QSLA 3K5MA 3CJTA 3KJVB 4KGKA 3VF0B 3VQTA 1HL6A 4ZJLA 2GHPA 2DY1A 3LTOA 4DPOA 1SH3A 2APOA 1VQ4S 5HVHA 5AT1B 2YKNB 1IBKJ 2EI5A 4IG3A 1U2FA 3G82B 1X8DA 2OD6A 4JI6J 3QIPA 3IS9B 3FCVA 1B7FA 1NDCA 3MOJB 2ZH1A 1WC0A 3ILIA 1IKXA 4EO6A 3Q23A 4LR8A 3JAMY 3GYNA 1KSPA 4J9LA 2R42A 2B6AA 3TA1A 5DG8A 1K9MT 1PYSB 4TQRA 3RBZA 3QT8A 4KC5A 4USHA 1LWCA 4NLGA 3PVXA 4NXNF 2HWIA 2UU9F 4ATNA 4QQBA 5I3QA 4JI1J 4KIAA 3VAMA 5HVFA 1Q81T 3QAEA 4WFXA 2OIHA 4XK8C 1R3NA 2N3OA 4LMZA 5KFHA 2OTJS 1HI1A 4TN2A 2OI2A 2CA9A 4I56A 2BM0A 1ZM9A 2LEPA 5L9XA 3MMBB 1TV6B 2GNKA 4ZK7M 4NL5A 5K9FA 3AJ1A 1X5SA 4NLVA 3R7BB 3W5XA 3THTA 3DLEA 2AGOA 4K0KF 4ECUA 1R0CB 5E0OA 2GS8A 4I2PA 1DLOA 4U95A 4ECWA 5C24A 1ZTTA 3N79A 4IFVB 1RTHB 2D74B 1NJIT 3R5AA 1WI8A 2YY3A 3ZZRA 1NAQA 2XG8A 1P9YA 2HKEA 2AEMA 2P5VA 3QAUA 3QPIA 4I69A 5CYJA 4K50A 2HZCA 4R5PA 3AH6A 5F8GA 1N0VC 1X4GA 3QRPA 1A0OB 1HBUB 3G86A 3DNCA 3A1YG 3JSMA 2Q3PA 1X4CA 3OVSA 4ZVUB 3Q8UA 4D3GA 2OPQB 2XI2A 1WG4A 3A3NB 1S99A 4GMKA 4NLPA 4LR9A 4OFZA 1V5VA 2E9ZA 1T7PA 3MEEB 4RJVA 2DVIA 4A48A 2DGWA 5EHHA 4LFCJ 4KPCA 3HZGA 1PILA 1DURA 2F9JA 3QBCA 1Q7LB 2DHSA 5L1KA 3L7UA 4WXOA 2ZH9A 4WF9Q 2Z8QA 4NI2A 4AUKA 2IDLA 3HHLA 1VK3A 4UZBA 1SJQA 1RAIB 1GX6A 1RLCL 1HNZF 4NASA 3KLEB 3SQOP 1M90T 2GV1A 5GMEA 4Y00A 3TANA 1TZ0A 5KFNA 3DFEA 2Q66A 2ZHOA 2V69A 4DSEA 1LFWA 1R31A 2MMYA 1L3TA 2J9EA 2BANB 3HI9A 1RLDA 2NQPA 1KS2A 1VK8A 2EVZA 4OI3A 4DBQA 1ZS6A 2RQMA 4HTJA 2DNPA 1FNMA 4U9RA 3IBWA 2MKCA 1SKWA 2AJ1A 4CO2A 3PX4A 4X4SA 4LRAA 3H5UA 3VV2B 4X4PA 1DTTB 4B9LA 1UA1A 2IBKA 1PBAA 3GV8B 3BF4A 2AJQA 4EFAC 2H4YB 2XWXA 5J1EB 5DDPC 4J9PA 2DIVA 1LKZA 1CJTB 3Q24A 1T9YA 3X3UA 3KK3A 2LA4A 1UVMA 2NUHA 1TMJA 2B8QA 2QZ8A 1FWLA 2HLUA 1SB6A 5AE1A 1V3SA 4PG5A 4I6YA 3CW2C 3M6WA 2OJ3A 1UAWA 3OTEA 4ILMA 1KLNA 3T1HF 1S4FA 5GVQA 3LP2B 3HHLD 1PAEX 4DR4F 3WC2A 4L73A 1L3KA 1PJ7A 2MKSA 4USIA 1VQ5S 5LXYA 3PNIA 1U1LA 3HF5A 4E2FB 4P2SA 3CUNA 2G0JA 4PWDB 4ZA1A 2GVZA 1CJUA 3TR5A 4WZQA 3BSCA 4A8YA 4JI8F 3Q8QB 3W2WB 3MFIA 4WTOB 2NREA 3IWXA 4MK8A 4GKKF 1IBCB 2QA4S 4PAAA 1LWEA 4KQZA 4CT9A 4QIEA 3KJNB 4I68A 4CO4A 1NU4A 5DS7A 4O0NA 1AFIA 1YQHA 2HGNA 2G2OA 3DXSX 2YXLA 2GO9A 3TARA 3DLHA 2RS2A 5JMNA 2RKIB 3QGPA 2F8HA 5DGBA 2LDIA 1WKKA 1RCXB 3NL0A 4QCLA 2M8DB 2W2MP 4DR7J 1FJ7A 2DH8A 3V4MA 3LAKA 4KO0A 3MCOA 1EQMA 2ZNYA 2EPIA 2C2EA 4LBIA 4HYKA 3H59A 2HFUA 4OYBA 2FLLA 1U1RA 4OLOA 3LP0B 5BR8F 4Q5VA 3T1YF 1TVRB 1UA0A 4QW8A 2W9CB 1YRUA 2M8HA 1S1WA 4C7QA 4USUA 3HFZB 2WONB 4DMZA 4OJGA 3DLLQ 4X2BA 1V6HA 5B0GA 4IH5A 4QIGA 1VI7A 2BKOA 3HVTA 5AXLA 5D4NA 1Z4UA 4M5GA 2C2OB 1IWAA 3K5OA 3HT0A 3CJ8A 2C2RA 3DRSA 1D9AA 2ZFHA 4OYWA 1GQEA 4BCAA 2VFUA 3CCUS 2WW4A 2ZKTA 1F3FA 3IRWP 2KFZA 4DV4F 4ELTA 3CCZA 3OSPA 1NB7A 1JXEA 4PG4A 1JLGB 1RT1A 1G4CA 1TQLA 5BYQA 3OTOJ 4O3OA 4DI6A 4MMOA 1N5VA 1Q95G 4KBIA 2BMBA 2Z56B 1W2BR 2XMJA 1G7CB 2M5YA 3MM7B 1CQNA 1XK8A 4EZ9A 2RUSA 1YJ9S 1PYTA 2A6OA 2C2DA 1TL5A 2R3VA 4RNNA 2XM3A 3GJSB 4M5DB 1H74A 3DMJB 2L48A 1S72S 2V8HA 4OX9J 5CYQB 3KOAA 5D0HA 3CJ4A 5I3UB 2FJVA 4YB1P 3IR5B 1NB2A 1XMOJ 3LALA 1F2GA 4NZ0A 1LXNA 3W61A 3W64A 1VQPS 5IM0B 1MMDA 2VQEJ 3CC4S 3LQVA 1YJTA 5EX3A 4C4WA 2UXBF 3FNNA 2IYGA 1LWXA 1SL1A 3I4HX 4EBEA 1JNZB 5JVHQ 3P4UB 3MPUB 4IO9Q 4J9MA 2V8DA 2BE9B 3Q89A 1WC6A 2PDAA 5HLFA 1R8HA 4ZCMA 1O51A 3CTRA 2N7CA 1B3TA 2CPHA 2C2KB 5F8HA 2XTJP 4M5KA 2UUAJ 3CO0P 5I3PA 4LRDA 1WHXA 2VG6A 3F56A 1REVA 3GFZA 2PMHA 2EBEA 4F4KA 4X84A 3QO9B 3SCLE 4UY8T 3HP6A 2FJAB 2WB1D 4DR5F 3D1OA 3HX9A 3U1MA 2BKNA 2CFXA 3A4TA 5GADU 2CJQA 3S7RA 3RJMB 2CVIA 4ZIVA 3C16A 4B3OB 3K59A 3TA2A 1HYSB 1K44A 3AXMA 2IA6A 1HI0P 3BO3A 3V6HA 4NZ7A 2KG1A 5HP1A 2B5JA 1RA7A 3FFIA 4DUTA 4O4GB 2JFDA 1KRPA 4U7CA 5KFOA 1EZZB 2W9AA 2KYZA 2BQUA 3R7SB 1JJHA 2ZH7A 2DBBA 2VF3A 1S9GA 4K59A 1P1TA 2FVRA 5DJBA 5DG7A 5CYMA 3TUZC 1D9DA 3KK2A 4KR0B 1Q86T 5IS2A 2Y3YA 3DHWC 3UVJB 1R89A 4DV7J 2RDIA 1FJGF 1DQ9A 2QL9B 4N56A 1FRLA 3HVWA 4M63A 4YHHJ 3TEGA 3DLGB 2VDIA 3AOCA 4ZCIA 3GFHA 2GHWA 1N34F 1F9FA 5A8RA 2I2YA 4Y65A 2QIFA 3UDLA 2LDYA 3QJPA 4YP3A 2KYXA 4IRDA 2DNHA 2FZKB 2ZJPQ 3D5MA 4QBUA 1SJ4P 1X60A 3CDUA 3BPSP 5C42B 1AXQA 2G4BA 4R8UB 4NLRA 1B7YB 1EARA 5F8LA 4C3KA 1QAIA 3OR1B 5B0AA 2IMOA 5M2RA 1RWPB 4IDKA 1YWXA 3SCJE 1R8BA 1ULRA 3M8PB 2P8IA 5I42A 2A2CA 3W63A 1LEOA 2HRTA 4DHVA 3MPWA 1H3DA 2XCPA 3J7YI 2JEGA 2HZVA 1JLQA 2R8IA 3HHKA 3ZZPA 3P49B 4RW6A 1CJKA 2BEFA 2RRBA 2HNYB 2K3IA 2HBRB 3D28A 2BJ1A 4CM2A 5FLXY 2BZ2A 4ES2A 5K8OA 1MWZA 2ACMA 3JQMA 3P8BB 1TKTA 2CQHA 2DEJA 5DDOC 3P5BP 3VGUA 3UDVA 5KT2A 2JFKA 5D4PA 1SBRA 2DGTA 3IG1A 3G82A 3BKTA 4NLXA 2VQFJ 1APSA 2DNZA 4TNOA 1JLBA 1QAJA 2WCXA 4DOZA 2GIRA 1M5VC 2V4RA 1U6FA 2XLKA 4ED4A 5KG2A 2VONA 4IH6A 3O8WA 4F26A 4QU6A 1S79A 3VGTA 1RGVA 2G9OA 4Q2LA 3MUTP 5A8WA 2CJBA 1IBMJ 2AGPA 1UVKA 4DX5A 3NP5A 1KFDA 3BYRA 4OL8A 2ZITA 4KHMA 4DSKA 4X62J 4NLQA 2KI2A 2KO1A 1GT8A 2VOOA 2ZOFA 3P3DA 3MMBA 1S9EA 1IBLF 1NK7A 2WK4A 1ICEB 2M9KA 4C97A 2CPYA 4Y0FA 1PG5B 5DLFA 4M5MA 2ZBRA 2VASA 1YBAA 4KRWA 2V8GA 1NHUA 2GJ2A 4DSIA 3CF5Q 6FDRA 4ECQA 1J5EF 3MEKA 1RTHA 2Y1RI 4ZPTR 1EP4B 2WSCC 1FWPA 2CPXA 5LMNF 1UETA 3H2UB 3M9NB 2ZZNA 1C2PA 3EUNA 9RUBA 4FXVA 4USTA 2LQBA 2OSRA 2KFNA 3KLGB 4NCGB 1GXLA 4U8VA 2P2CB 1IN0A 2ROGA 3IM8A 3BBBA 4N8NA 1WHVA 1RHRB 4V1Ak 1R0AB 5A8KB 3CCSS 1NNDA 1VC5A 4OYOA 4UQGA 2OPQA 1T9VA 2OEJA 3TI0A 4RNOA 2UVRA 1PSDA 4ZHRB 2ROPA 3D6TB 3O6QA 1ZM3A 2K3KA 1MWQA 4DR1F 4S0MA 3B4MA 1WKLA 4J9KA 1FXDA 4OX6A 4Y6IA 1EETB 2O3DA 4C8OA 1MMNA 3M2RB 3MAHA 4O3NA 3KK1B 2IVMA 3QIDA 4AXIA 2V8PA 4WK1A 3KLEA 4A4JA 3JSRA 4JI6F 2MGZB 4X4QA 1KQGB 4DQSA 4N47A 1UWAA 1CULB 4F02A 3DI6B 2VFSA 1FTRA 4CM0A 2XY6A 2HS4A 4E0DA 1YX2A 3GPAA 4WJBA 1P1LA 4X65F 1Y00A 1T95A 1VCTA 4LF5F 3PYFA 1C0UB 4EYHB 3BN7A 3MM9A 3SSRA 2E44A 2HBYB 3I0RB 4LVOP 4ED0A 3ENAA 3W2VA 4JI1F 4TVAB 4HACA 1YJWS 2X1GA 4LBHA 3SZ2A 2BQRA 4H4OA 3J81Y 4WU2A 5LJ5Y 4KH1B 2FD2A 2HRUA 2XSJB 2C2NA 1DTTA 4I0WA 5J1EA 2OFGX 4USKA 1U1NA 2XZWA 1CS4B 1WC5A 1CJTA 4LF7J 4ZJQA 5C25A 1WC4A 2OP5A 2BYCA 5ETVA 2VOPA 2RIJA 5KT3A 2YTCA 5KT5A 1HHQA 2MQPA 2ACYA 3B54A 5LSLA 2BR0A 1T11A 2JJ4D 3DC2A 2Y8YA 3WIVA 3ULHA 2G0CA 2LEBA 3K5NA 4MIWA 5ETOA 2XLIA 2OPSB 3VWSA 1M5OC 1RT6A 3OL6A 3W2WA 1IR1A 2UXDJ 3D67A 3RUBL 5DETA 1UVIA 4F8RA 2BOAA 3J7A1 1N0UA 4FYVB 2XGQA 4LRCA 5KFRA 3V2UC 4G1QA 3ZTPA 2F4VJ 4F7VA 1SPBP 3UN5A 2RU3A 1TAQA 3KMQA 4K5SA 1SV5B 4I2QB 5F3ZA 4LFCF 4NXMJ 3NEKA 1HLWA 3I32A 4RW8B 3H4DA 3R27A 4WP3A 2G0IA 3KYLA 3R1LA 3M8ZA 2BVZA 2E1MC 3D3BJ 5DM7Q 3SEOA 5J2QB 2MQLA 1NEEA 4AE5A 4TU9A 1VIOA 1OYDA 3HPOA 1IJEB 1U1OA 1HA1A 4X4UA 5B0CA 1ZM2A 3QT7A 1JXVA 3SYZA 2HVHA 3BSAA 3IXQA 4OIXA 2DXEA 3RB3A 1GFWB 1T3OA 1Z2ZA 2EKYA 1WSRA 5DM6Q 4NEZA 1T9XA 1UL3A 2LP4A 2KDOA 1N5SA 4B08A 2AGQA 4DQPA 4OYIA 3K5PA 5EN1A 1TVRA 2W9CA 1IVZA 1N5TA 3KG1A 3HSJA 3MR2A 3PR4A 1HW8A 2MXYA 1SL2A 4AYBD 4NLWA 1D8YA 1RTDB 3ADAC 4FXWA 5E3QA 1VLOA 1TKDA 1NSQA 4JV1A 3D0IE 1HBNB 2PFFB 1HQEB 3HVAA 3OD2A 4XIUA 2W4DA 2C3YA 1UZHA 4O3PA 4I6AA 2YKPA 4MKYA 3MGJA 3W8PA 3S1TA 5CHCB 3BS9A 5T14A 2QO3A 4RW4B 3KUHA 2A3JA 2V34A 3ET6B 1BWVA 2COLA 1RQ0A 4JUZA 2UUWA 3POTA 5JVGQ 2FJXA 2E5LJ 1RT3B 4ENOA 3M1VA 4FPRA 1T02A 2DGUA 2VU5A 4DL7A 3JS9A 2FJWA 4C8KA 1DQAA 1WNEA 4LSLA 1HHTP 3VAIA 1Q82T 2QLJB 3T6BA 2B0GA 3MM7A 4IOAQ 3MURP 2GJFA 5KFWA 1GH8A 2FHJA 3DLJA 2WRMA 1RWVB 1WUUA 2NZ4A 3PO5A 1RCOB 5KFIA 4UW2A 5D0RA 2LXIA 4M5DA 3HXMA 3DMJA 2C3UA 3DRRA 1ZA1B 2B4OA 3IMQJ 1O0PA 3MEGA 5HQ8A 2J9CA 4DLEA 2IIHA 2M4MA 2BKPA 4Q8FA 1URRA 4ZP7A 4CLWA 4YN3B 5ETRA 3CPWR 4C8YA 3F0NA 1A9NB 3FRZA 1CSJA 1GNKA 1KQSR 2ILYA 4DWIA 1RKIA 1WTFA 2WBMA 3LH2S 1OS5A 4NEYA 4DG1A 3FSYA 3D4JA 3W7BA 2FVPA 2HQGA 5L1JA 4ERDA 1TL4A 2X51A 5IV3A 1S5ZA 2GQ2A 3R3TA 5CD4A 1TMMA 3D0GE 2YNGB 4HH1A 1TK8A 4CNYA 1VQKS 4RUHA 3EM1A 2G2YA 1V9OA 4KKOA 3FJ2A 2RMLA 2GQQA 1JLCB 4YMEA 3DGPA 4IFYB 6AT1B 3OR2A 3PRVA 1RADB 1X5PA 5HJYA 1N32J 2V4QA 1WF0A 5IWAJ 5IT4A 2ROEA 3SDEB 3KKFA 3SQGB 4B3OA 3BR9A 5D3GB 1VBZA 4YDXA 4DV3J 3CMQA 3FVYA 2IMWP 4PPZA 3J7YU 4DQIA 3BO2A 2HQIA 4EBDA 1FF2A 1IKVA 3JQJA 3CCVS 1BLUA 1T03B 3OTOF 3R5BA 2AJ4A 2KM8B 2YWHA 4RW9B 1LK7A 3ZZZA 1J27A 5K14B 4R0JA 3MFHA 2YNHB 2UUTA 1RT7B 8RUCA 5J2PA 3CIZA 4Y34A 3DOMB 3KLHB 3M8QA 2LVWA 2I1RA 4DCJB 1SVDA 3BYPA 4I4BA 3K58A 3OUYB 3MTJA 3E51A 1DY3A 3G8QA 4ZP8A 3W3SA 4OZ5A 2QYCA 4N7TA 2EG1A 5DQHA 4YFUA 2ZH5A 5ETMA 1HR0J 2XMWA 1VQNS 4OX9F 2KB2A 2EBGA 1QY7A 3LGMA 1XMOF 3TEHB 1RT4A 2EFQA 4N8OA 2HEKA 3T5JA 2ZD1A 1NRKA 3OXLA 5L39A 5E3RA 5EWFA 4DV2F 4LUBA 2MZQA 3HSZA 4AL7A 2EWHA 1NSKL 3FSIA 3QRRA 3N6NA 5HAOA 3BZQA 3K7RA 4C8MA 2D69A 5C42A 1IKXB 3IN5A 2A10A 3CEDA 1SC3B 2OMOA 3HT3A 3PXGa 3OJSA 4J9QA 1WWHA 3U1LA 2JOQA 2MHNA 2MSTA 4RR5A 4HLBA 2UUAF 2ZHAA 1N56A 4QPTA 4IQXA 1RTIB 4B9NA 3H42A 5KTQA 1VS3A 2VKZG 4ED1A 3UCUP 4QJVA 1FFGB 4MIAA 5GAEU 3X1LB 3C2PA 2LLZA 4PR6A 3OHBA 3NGDA 4CH7A 2HNYA 2BJ7A 2L9WA 3KDOA 4DPYA 2HK3A 1JNRB 5KFYA 1FDNA 1RSCA 1VQ7S 3GIMA 3MMAB 4F50A 2VA2A 4FKXA 3RW6A 1KLMA 3GFYA 4PKDB 1FFWB 3DLEB 4C6AA 3J81j 1DLOB 4K4ZA 1RHQB 5ETLA 2VBZA 2R2SA 2EK6A 4OMFG 4TY8A 1SQFA 1SJRA 4PQUA 2I9SA 1OY8A 3QYYA 4CI0B 3BH7B 1SJ1A 3RBDA 4ZP9A 1DQ8A 1PKUA 3FEXB 2DHGA 3VGVA 2HFZA 3JSMB 3N5BA 4NMXA 3PTWA 4A8OA 3PJWA 2VG7B 1NKCA 5BYRA 1I3OB 2I5JB 5CABA 1NZAA 1ZBTA 3BGFA 1SJ3P 2HNZA 3CJKB 2XBPA 4A47A 4YHHF 3UD4P 3EDQB 4F67A 4YOEA 2VH7A 2H5EA 5B0DA 5F9NA 3OVBA 1U1QA 5SZTA 1I51B 2AKWB 1F6TA 4U96A 5GAGI 2IRYA 4NI2B 3EGVA 4HI1A 4NLSA 5KOXA 2OAUA 3HHLB 2BX6A 4DLGA 2V9KA 2LCWA 3HSDA 3H90A 1UPMB 3QT6A 3E8OA 2J0SD 4Q43A 1EP4A 1GMWA 4MJKA 3EICA 2D1CA 3OTBA 5FLXU 4X4VA 4F2RA 4ZMMA 2GMHA 1EIYB 2Y0SD 2E5IA 3KLGA 2QLFB 3CDWA 4DV1J 4NCGA 1RACB 2Q6CA 2XO6A 3BO4A 5D0EA 4ZLPA 3Q22A 1KN6A 5B09A 2GHVC 3I96A 5KFZA 2GW8A 5A8KA 2LQ8A 3DM2B 2ASDA 1Y3JA 1VLYA 3RAMA 1YJ7A 2VV5A 1F0XA 1RWXB 3EXYA 4DSFA 3EZUA 4WXWA 2V6AA 4RNHA 3N28A 3CT9A 1OMSA 1QDUB 3CULA 2LXUA 3TUJC 3TJ9A 3J80U 4IG0B 1DTQB 1F5AA 5KAKA 4BLGA 2CWKA 1RE1B 1YBUA 3T3FA 1EETA 1U0HB 4Y2MA 2D3UA 1YJUA 3M2RA 4OI6A 2CQGA 4YS2A 3BM7A 3KK1A 2MLYA 3H5SA 1C0TA 2EFGA 3QT5A 3HHEA 5D8HB 1XQIA 4CT8A 4OI0A 2C28A 2VQFF 4A8WA 4F2SA 1EHWA 2FPHX 4URQU 1ZTWA 3Q8VA 3DI6A 2JVOA 4XO0A 3KJFB 4EK2A 2OSQA 3ETMA 2FHKA 1ZAVA 3NNHA 4CO5A 4M1KA 2ASYA 1KC8T 2HSEB 1GMWD 2HGMA 2GVZB 1UW4A 4G3IA 1N8RT 1K8AT 2PMZD 3I0RA 3I5BA 1IBMF 3PW7A 4WE1A 2GA7A 2ATCB 4OX8A 1YIJS 2F1FA 3H5XA 4JP8A 5KFPA 1F9HA 2J6UA 4B9MA 3CD0A 2ADCA 1T3NA 3ZZYA 2PI5A 2R7RA 4X62F 1OQ3A 2XSJA 1MU2B 1LWEB 4NLTA 4TYBA 2XZDB 4J90A 1S0OA 2AW0A 3KLFB 1VFJA 3MM5B 1VBKA 2UVWA 3CD5A 4YUDA 5J2MB 2D3O1 4DSLA 3UPFA 3WBZA 1HWKA 4N5SA 2R7VA 1HBOB 2YPYA 3RAXA 2Y1LB 4V19X 3F44A 2A2DA 4RO0A 3WX4A 2M3DA 1H73A 3PM9A 3JYTB 2YNFB 4FDFA 5DQGA 3AT1B 3HZEA 2LFVA 2RQKA 3TVKA 4KO0B 3PO4A 4ZPCA 1ZPVA 4J9SA 4BHQA 2HQCA 4I6WA 4RNMA 4O4RA 2R4FA 4F04B 4C8LA 5B7WA 4UOCA 3N6LA 1KBRA 4P52A 1S1WB 4WBFA 2U2FA 3DRYA 2WVCA 3NLCA 2RAQA 4IR1A 5E3AA 5IC6B 4ER8A 2Z2LA 3MCMA 2CWXA 2ZC4A 4QR1A 1TELA 2KVQE 3HVTB 2ZC3A 1FJEB 5G0RA 1SV5A 4BS2A 1KTVA 5IFMA 5F0UA 3DRSB 1P27B 1PC4A 2EW9A 3G6ES 3NGUA 4MTPA 2CQIA 2IY5B 3OSNA 1U2CA 4UF4A 1QUVA 2FVQA 2BABA 5J2QA 2FJBB 3BGUA 1JLAB 5H9EK 1GTEA 4O44B 4NLUA 2MKKA 1RT1B 4ECSA 4K7QA 1KD1T 1X7VA 5F9LA 1RAJA 5H9FK 3TUPA 2UV8G 2VPWB 1S76D 3MTKA 4I64A 5IXUA 2V63A 3PV8A 3AB4B 2BBEA 2XHWA 4JI0J 1S12A 1ROFA 1OWXA 2DHAA 1NXIA 1RT5A 1RT2A 1URNA 1GTHA 1RTDA 4ID5B 3JTNA 5GMKa 2ADBA 1HBNA 1QSSA 2HFVA 2HHUA 2LMIA 1U26A 1YK9A 3ZFVA 2MKIA 3P45B 2YWKA 3IBCB 2AX1A 2MQQA 1S0NA 3RGIA 4P2FA 4G1IA 5KFCA 2QC3A 4CWBA 4ILLA 4KJIA 4LF7F 4RW4A 3ILOA 3ET6A 4FBTA 2AIRB 3OTDA 3FRYA 2K2PA 2B51A 1M5PC 4LT6A 1NJWA 2YQ1A 1OY9A 1BD6A 3IAS9 2DNYA 5HLFB 5F3TA 4PEOA 3MUVP 3GONA 2BJDA 3W5ZA 1U47A 3ILLA 3ENQA 4OI4A 4ES1A 1EJ7L 3MR7A 3G9CA 2AEFA 4IKAA 1TAUA 3OTCA 2VG6B 2JDJA 1REVB 2Y1JA 2V50A 3MZIA 2BE7D 1VYAA 3PJ9A
chains in the Genus database with same CATH topology
2XB2D 2IYIA 3FMBA 2ZJPQ 1TKZA 4RBVA 3D5MA 1UWBB 4QBUA 1SJ4P 3I55S 1N6QB 4LF8F 1S1UA 1Y5NB 4NCBA 3CDUA 2ZDOA 5THWA 3GIIA 2HHXA 3OV7A 2MYFA 3S8SA 4V19J 1XERA 3CJ5A 3JSYA 1S48A 3OHAA 1SUQA 5A2QY 1LK5A 5C42B 1AXQA 3V81B 3N6MA 4F3QA 2G4BA 4R8UB 4MK7A 4DDFA 4NLRA 2F4VF 2KZZA 5F8LA 3MD1A 4QR0A 4RKUC 1JLEA 4C3KA 4P7VA 3DDKA 1S10A 1QAIA 2XNQA 1F60B 3OR1B 5B0AA 2IMOA 3L7OA 1YSJA 2YX1A 1GAOA 5M2RA 4IRCA 3BB5A 4IDKA 1YWXA 3OXGA 3SCJE 1R8BA 2VFVA 3SCIE 4NXMF 1ULRA 3M8RA 3VAFA 3LP1A 4L6V3 2KG0A 2OH2A 3U27A 1FD2A 3PRBA 1PO6A 3M8PB 3QZ8A 2NSCA 4KFBB 2B5JB 1TR0A 5HO4A 1Q8LA 5I42A 2A2CA 4J9OA 1FRJA 1FESA 1CEZA 1N5YA 1A6LA 3JTOA 1RT5B 3LF0A 3M30A 2D7SA 4PG8A 1RT2B 4DHVA 2HVIA 3MPWA 1H3DA 3BDPA 1VQ6S 2HHHF 2CZ4A 2D41A 2P6SA 2W4PA 2XCPA 2IVFB 3J7YI 5KT6A 1FK9B 2DK2A 2MQMA 2IJFA 2JEGA 2XNRA 1HNIA 1FXRA 1JLQA 3GMGA 2R8IA 3HHKA 3PW4A 3ZZPA 3P49B 1UEUA 2RU9A 2B4PA 2DNNA 4EO8A 3KG0A 4FN5A 4YR2A 3HM9A 4RW6A 2N82B 4HKQA 4NCAA 2PEHA 4KHRA 2RRBA 2MB0B 2GIQA 1X9SA 2HNYB 4LSNB 2HIQA 2K3IA 4DS5A 4ECVA 1XTZA 2ASJA 4Q0BA 3D28A 5EUHA 2WSEC 5FLXY 1O5JA 2BZ2A 2R2RA 2RS8A 3BQ0A 4ES2A 4DV6F 1VQLS 3ICLA 1VOMA 5K8OA 3EPGA 3UCZP 2KZMA 1MWZA 4NLYA 1X4DA 3MM8A 4NYZA 2LQ9A 4N41A 3T5HA 2P9EA 4DR3F 2A18A 2W7AA 1TKTA 2CQHA 2YVSA 3CCRS 1HNVB 4Y2AA 3T9NA 3TOQA 5DDOC 3PIOQ 2R8HA 5E3PA 2AQ4A 4HEA9 5KFUA 5KT2A 2JFKA 3OFGA 1F5CA 3I56S 5KFGA 5D4PA 2OTLS 4G6VB 1SBRA 2JVRA 1H2VZ 4ECTA 2DGTA 2CPZA 2YNGA 1VIXA 3FCHA 2I0XA 1Z2LA 2C3MA 3IG1A 4Q45A 2BQ3A 1APSA 2DH7A 4NLXA 5L9NA 1UVJA 2K7KA 2DNZA 2J7KA 4TNOA 1VJWA 2ZOGA 1JLBA 1R0AA 2RRNA 2AP6A 2P9GA 1QAJA 2WCXA 4K4XA 5F0WA 3HMJG 4NA3A 2CQCA 3CIMA 4DOZA 5T7LA 2WW8A 2ZDPA 2GIRA 1M5VC 1YGYA 4CNZA 4ZKAA 2FLOA 4P6QA 4FVMA 4IFYA 1E6VB 4DN0A 3CCWA 3CD7A 4K4WA 3DXBA 3PY8A 4DN9A 2IRUA 3GYXB 2M88A 1CQMA 2V4RA 1N4LA 4XPEA 4CTAB 5KFFA 1QVFR 3MECA 1U6FA 3AQOA 3NMRA 4ZHRA 1LOUA 2B4VA 2E1AA 1ELOA 2VPZB 3SQGA 1N33F 2QLXA 2XLKA 5KG2A 4DEZA 1N36F 1FJCA 3JSBA 4PXCA 4QWEA 5A8RB 2VONA 3THPA 4U6PA 4IH6A 2CPJA 3O8WA 3M6XA 1NK0A 4F26A 2VG5A 3DLBA 3KTQA 4QU6A 1S79A 3TQ1A 2ASLA 2C3PA 2CZVC 1Y5LB 4I7FB 1RGVA 2AV5A 3ITHB 2G9OA 3PR5B 4Q2LA 1IXKA 2OPRB 2O5DA 4NA1A 3MUTP 3MR5A 3CDAA 2JX2A 3WC0A 2N4DA 5A8WA 2CJBA 1JXLA 3CSKA 3HVRA 2DHXA 4O23A 1IQTA 2UUCF 2ALZA 4OHWA 2AGPA 3GQCA 1UVKA 3NP5A 1U49A 1X4EA 3KK3B 2RF2A 1S1UB 2VL1A 1S6QA 3HFKA 1KFDA 2E5LF 4RZRA 2HAIA 2KTQA 3MHYA 4TU7A 1R7IA 4FF1A 2RVJA 3RB6A 2YX7A 2NUUG 4OL8A 1T03A 3S6EA 2ZBIA 2QSFA 4A8MP 4CH0S 2B4UA 2DR8A 2MGZA 3Q8RB 2ZITA 5HMYA 1JLEB 2EFNA 4KHMA 3UW1A 1L3SA 4DSKA 1YJVA 4NLQA 4HT5A 2IVYA 4RW9A 4PQAA 4YQWA 2KI2A 2KO1A 2E66A 1GT8A 2VOOA 2WBRA 2ZOFA 3GIKA 5K14A 3P3DA 1X0FA 2YNHA 3DOKA 3MMBA 1S9EA 2GCFA 3PJXA 1IBLF 1RT7A 1NK7A 4ETZA 2WK4A 3CVKA 1UMJA 1FVSA 2M9KA 4C97A 3BJYA 4Z37A 2CPYA 4TXSA 1VQ8S 1H6KX 2ZNZA 2KU7A 3OVAA 1N5YB 2VPXB 3CMES 4Y0FA 1M1KT 4B17A 4O3SA 3DN9A 1AFJA 5DLFA 2FHOB 3DOLA 1D1UA 1C0UA 2VASA 1YBAA 4KRWA 2V8GA 1NHUA 2CIMA 2GJ2A 4QIVA 4DSIA 5LL6d 3DYAA 2YWEA 3IRXA 3CF5Q 2R7SA 1HNIB 4BWMA 1SIWB 1BQXA 4RBUA 6FDRA 4ECQA 1J5EF 4DL4A 1XMBA 3MEKA 5L8RC 1J5OA 1RTHA 2JH3A 3G6VA 3MWBA 3O1LA 4ICLB 2Q43A 2Y1RI 1H38A 2FTRA 4DR7F 4ZPTR 1FEEA 1EP4B 2WSCC 1FE0A 3I5AA 3UCGA 4JV2A 2CPXA 1X5OA 5LMNF 1UETA 3H2UB 3LANA 2BE2A 3C66A 4AQYF 1U4BA 4ED8A 3M9NB 1LWFA 4L72B 3IR7B 5L38A 2ZZNA 1DHMA 1C2PA 4HT7A 3SV4A 3MM8B 1FRIA 4IR9A 1JKHA 2HS3A 3EUNA 3FDSA 3LW5C 3D54A 2ZHBA 5MAOA 4FXVA 1TKTB 2LQBA 2OSRA 2KFNA 3PFOA 3KLGB 3DU6A 2C22A 4NCGB 1BGXT 2HLTA 1VC6A 1GXLA 1NK8A 4NOHA 1FEHA 2CQ0A 1IN0A 4OZ1A 1FTCA 2J9DE 2ROGA 3G8TA 3MI7X 2CPEA 4N8NA 4WFZA 2DNGA 2YQ3A 4NRTA 1WHVA 3IG1B 4URGA 4FBUA 1U6BA 3KHRA 3L7PA 1R0AB 1JLBB 1U6ZA 3N4WA 5A8KB 2FB0A 3CCSS 4K4SA 1NNDA 1T94A 3AJ2A 1VC5A 1VBYA 4E8UA 4UQGA 4ZVFA 3MAQA 4IUFA 4NMLA 2OPQA 5T7LB 3IO1A 1ZZNA 3TI0A 1Y4ZB 4H4KC 4DX8H 1N52B 4RNOA 3NRBA 2FHJD 2UVRA 3NKYA 2AF6A 1PSDA 1OSCA 4K2XA 3MECB 2F9DA 1NO8A 3CJ3A 4KE5A 2Q1LA 3C46A 2CJAA 3LUYA 4ZHRB 4U7UK 2ROPA 4PXEA 3O6QA 3EZ5A 3VAGA 1HWIA 2DR5A 1Y9OA 1ZM3A 1DBDA 2K3KA 3IGVA 4JOUA 4DR1F 4XPCA 3MR6A 1U1PA 3B4MA 4I1TA 3L95X 2KJWA 4J9KA 4NRUA 2UVUA 1FXDA 3P5TL 4URSA 4OX6A 3PFEA 3I31A 2ZM6F 4Y6IA 5A8WB 4Q8EA 1EETB 2O3DA 1BY9A 2KFYA 5J1NA 2EC0A 4C8OA 2V2KA 1MMNA 3M2RB 2DNOA 1FVQA 3MAHA 4YEAA 3B8HA 1YRTA 1HHSA 3MPVA 2DT9A 4O3NA 3KK1B 2IVMA 4DL5A 2Q6BA 3RW7A 2RF2B 3G96A 4FS2A 3V4IB 3K0JA 4DR2F 1HARA 4KPYA 1BWEA 4IH7A 3QIDA 4AXIA 2KM8C 3P96A 3QJLA 4WK1A 1KQKA 5T41A 1RTIA 1FDAA 2GMLA 3HLUA 3KLEA 2AU0A 2OPSA 4A8XA 2QT7A 4A4JA 3JSRA 1XC9A 3AA8A 4JI6F 2RDJA 1JLFA 2MGZB 4HI2A 2R8GA 1RTJB 1K0VA 4X4QA 1OSDA 1IM4A 1KQGB 2B9XA 4DQSA 4ED5A 4N47A 4F02A 1U25A 2BM1A 1SI9A 2FC8A 3LO3A 3DI6B 2VFSA 4D3HA 3C3LA 3CC7S 4KHPF 3UQSA 1HMVB 1FTRA 4K4UA 4F25A 3DOKB 5L1IA 1N32F 1S9EB 1AW0A 1YITS 5IWAF 1TFWA 4WK3A 2XY6A 2HS4A 4RUCA 4E0DA 3MMAA 4GC6A 2JC1A 4GO7X 4WJBA 1P1LA 2KXNB 3VALA 2F8EX 4X65F 4DFMA 1KONA 2UXCF 1Y00A 2W25A 1T95A 3QGGA 1KQFB 1IR0A 3B78A 4I2QA 2P9CA 4LF5F 3DOLB 4DV3F 4F4XA 2D3ZA 2E9TA 2E7WA 1C0UB 2QV6A 4EYHB 3BN7A 3M32A 1MROA 3AY0A 3MM9A 3SSRA 3IRXB 4OHYA 2E44A 3R5CA 4RW8A 3I0RB 3S01A 2UVVA 4IOBA 1J5OB 3TAQA 4LVOP 1TK5A 3OL7A 4KT0C 4ED0A 1WD6A 5IT0A 3QJJA 3T19A 2JSXA 3W2VA 1YVFA 4JI1F 2DD8S 2AWZA 1YJWS 1OPZA 4BC7A 3U1NA 2X1GA 2GGPA 1MNEA 4WKYA 3RRGA 2YKQA 1JJ4A 3MEDA 2MY7A 3SZ2A 5KT7A 2BQRA 1TL1A 3OLBA 1FNXH 1R43A 4H4OA 3J81Y 4WU2A 5LJ5Y 1HNXF 4K4VA 5HN0A 2E29A 1WACA 1FO1A 2FD2A 3L09A 2HRUA 2KRRA 3QLHA 2XSJB 2V4JA 1DTTA 4WFNQ 4I0WA 3D2WA 3UWTA 1QAXA 3MOZA 3FQLA 3SV3A 5CA5A 2AD9A 1MMLA 3THVA 5J1EA 3SSQA 2OFGX 4GKJF 1OIAA 4JBCA 2YKAA 3MM6A 2J8AA 2VQEF 3J7ZT 4JI7F 1U1NA 2MJNA 3SFUA 2MHEA 2XZWA 2ZVSA 4RX6A 5HMXA 2NS1B 3N5FA 5H9EJ 1S6OA 1QE1B 1HI8A 2DPIA 1H0HB 2AJFE 2J6TA 2R8KA 2Z4PA 1RKJA 2IRXA 2XY7A 1P6TA 2N7YA 5C25A 3MCSA 1XEZA 2VG7A 5H9FJ 3GR1A 4Y3CA 1LW2A 1QJHA 2PD1A 2ZBCA 2OP5A 2BYCA 2I5JA 4TLRA 1WTBA 3RR8A 2XULA 2W7PA 4IO1A 2V94A 4A46A 2DRBA 3NNCA 2VOPA 2RIJA 5KT3A 3G8SA 2YTCA 4NZ6A 4RU2A 2NLWA 1U09A 2R2UA 4JYAF 2L41A 1BQNB 1D9FA 3CJKA 5KT5A 3P6YC 1FRMA 1VQOS 1Q7YT 5J1PA 5JUMA 1M5SA 4NYPA 2MQPA 1H2TZ 2ACYA 2QLWA 2GFFA 1HQEA 4OX7A 2ZJQQ 1QTMA 2MSSA 4CQ1A 3V6DA 5LSLA 2BR0A 4DQQA 1S9FA 2JJ4D 2DITA 1S1XB 3LOUA 3I0SA 3DC2A 3HO1A 2BOPA 2F8MA 3H8YA 2AJ0A 2WOMA 4OHZA 2FVSA 4NYOA 3G6XA 3LWMA 3ULHA 2G0CA 2KT5A 3OL8A 2LEBA 3K5NA 2IFXA 1JIHA 4C8ZA 1Q53A 4MIWA 5FIIA 4J37A 1P8GA 2L9NA 2XLIA 5KFXA 2V9WA 4C9DA 2OPSB 4Q8FA 2DCLA 4R0EA 3VWSA 1M5OC 1RT6A 1E6YA 3OL6A 1XNQF 3W2WA 4Y2IA 4X66F 1VHFA 2Z0GA 3T6JA 2M52A 3M2VA 1DAXA 2PI4A 5DETA 1UVIA 1RT3A 1R27B 4F8RA 2LXFA 3J7A1 1N0UA 3ETOA 3DRPA 4QZVB 3SXLA 2XGQA 2QRRA 3ISZA 5KFRA 3V2UC 4G1QA 3ONQA 1HBMB 3DLKA 4ED3A 4DQRA 2MKJA 1K73T 1IKWA 2RU3A 2W8LA 4JV5F 1TAQA 3KMQA 4K5SA 1SV5B 5KFLA 1WEYA 4O3QA 1U1MA 4I2QB 5F3ZA 4DSJA 2BJEA 4LFCF 1NK4A 3M32B 4C2MA 1G1XA 1MROB 4WKRA 1WG1A 3K5LA 3MM9B 2POKA 1VMBA 3FGVA 1SXLA 3I32A 2FHMA 4RW8B 3H4DA 1PC5A 1S1TA 2VUGA 3R27A 1FKPB 3D1QA 5JJBA 3C8YA 3KYLA 3DM2A 5CXTA 5EDWA 3FZ2A 3KLIB 3R1LA 4RNFA 3U7JA 4MH8A 5GAHI 3W2VB