2XMVA

Copper chaperone atx1 from synechocystis pcc6803 (cu1, trimeric form, his61tyr mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGYEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the Metal-Binding Versatility of Copper Trafficking Sites .
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Chaperone
molecule keywords SSR2857 PROTEIN
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xmvA00
2GV1A 2KT3A 1X7VA 2K1RB 4HH1A 2QLXA 1YRXA 4OIXA 1LQ9A 1S6OA 2QYCA 4YEAA 1WD6A 4F67A 2RMLA 5K9FA 2GCFA 2Q3PA 2KYZA 4FNIA 1OSDA 4OJGA 4EFAC 1Q4RA 2PGCA 2RU9A 1X0PA 2L3MA 2OAUA 3BDEA 5B08A 3FRYA 3LGMA 3CJKA 4ZA1A 2BJDA 5B0FA 1FESA 4HL9A 1YJUA 2IYGA 1TZ0A 1MWZA 4A46A 3FGVA 1Y3KA 3TRGA 1FD8A 2XMUA 1R6YA 3UDCA 2XMJA 3KNGA 3BM7A 2GGPB 1Y3JA 2XMKA 1U7LA 3F44A 2OFHX 1CC8A 1N5SA 2KKHA 1Y0HA 3HHLD 3TOQA 3LO3A 2LDIA 4YDXA 1YG0A 2HQIA 3FMBA 1K0VA 3WDOA 3CJKB 2HFNA 1GXTA 2K7JA 3T9NA 1AW0A 2GO8A 1YJVA 2XMMA 1Y9OA 2EW9A 1XBWA 1CPZA 1KQKA 3K7RA 1FE4A 2G9OA 2OD4A 2ZDPA 4DPOA 2GGPA 1TR0A 1JK9B 2N7YA 2VV5A 4HI2A 1URRA 4ZOSA 1S6UA 2XMWA 1W2IA 1CC7A 1VQYA 4FNHA 2HIQA 2BUNA 2AJ0A 2FHMA 2XMTA 3QMQA 3BF4A 3BN7A 3HX9A 4Q2LA 5T7LA 3HHLC 4A4JA 2GFFA 3IWXA 2ACYA 5B0GA 2N4DA 3HF5A 1TL4A 1AFIA 3HHLA 5B0EA 3BGUA 3DCAA 2AP6A 3BB5A 2HLTA 4U9RA 4NPOA 2ROEA 2OD6A 4Y2IA 1YJRA 3BR8A 2QLWA 1FEEA 4HH0A 2FIUA 2FB0A 2K1RA 2OKQA 4HI1A 4A47A 3E8OA 1AFJA 1APSA 4Q2MA 3HFKA 2BYCA 1OQ6A 2AW0A 4QOTA 4Y2KA 3HHLB 2OMOA 3KKFA 2W4CA 5A6PA 2K7KA 5B0AA 3TNVA 4OJHA 5IXUA 3KG0A 3MZIA 2ZDOA 2OFGX 4NL5A 1IUJA 2PD1A 3DXSX 5A6WA 1SB6A 4DN9A 1N5VA 5F0WA 5B0CA 2QIFA 3IWLA 1JWWA 2LQBA 2N4CA 1MWYA 2ROGA 1Q8BA 2BBEA 1N5TA 2IFXA 2IYIA 2RILA 4A48A 1GXUA 1RJJA 1TUVA 2CRLA 2ROPA 2BJEA 5KAKA 3GZ7A 3LGNA 1OQ3A 5B0BA 3VTIA 4OJ1A 1N5QA 1SI9A 2OP5A 2K2PA 2FTRA 5F0UA 1YJTA 1FVQA 2JDJA 1ULRA 4Y2MA 1Q8LA 1Q53A 2GA7A 3KG1A 2LXFA 2ASYA 5T7LB 1FVSA 5B09A 3MCSA 1QUPA 1SQEA 2W4DA 2W4PA 1TL5A 2HFOA 4OJ3A 1FE0A 1V3ZA 2VH7A 2XMVA 2AJ1A 2RSQA 1KVIA 1P8GA 3HDSA 5B0DA 2KT2A 2HLUA 2LQ9A 1KVJA 1VQSA 1X8DA 4DL0C 1OPZA 3QGPA 1P6TA 3I9ZA
chains in the Genus database with same CATH superfamily
2F5GA 1RDRA 2WVDA 3DLBA 1T94A 1TAQA 2K3KA 4OYZA 4DSFA 2FLLA 2VL1A 3SCKE 3LP1A 1S0OA 1SJ3P 4LBHA 4PWDA 3MI7X 4OV1A 1F3FA 2F40A 5L9XA 3S7RA 3W1YC 4M5KA 5KOWA 3GIRA 2AD9A 4B3TJ 4CNZA 4Q8EA 4GKJJ 2HHSA 2Q1LA 1YJUA 1HNWF 1RAEB 1LWFA 3RR8A 3TRGA 2V8PA 4L73A 1PCAA 3I0RA 4LQ3A 2PC6A 1NB2A 1OWXA 4DL7A 3AOCA 2GMJA 2OPRA 2DR6A 3DU5A 4PXCA 1WWHA 2XCPA 2LVWA 3MXHP 1N5SA 1OIAA 3BQ1A 4M8LA 3HI9A 3TEGA 3LAKA 1U09A 2FVQA 4RW9B 1HQ2A 3HVAA 1VQ9S 2E44A 4B9NA 2FJEB 2DHSA 4K7QA 4O44B 5C24A 1HQUA 4DF4A 2BANA 4DV5J 3AH6A 4PAAA 4LRCA 2H54B 2E7XA 3OXLA 4USUA 1SL1A 3CCVS 4DR6J 4C97A 4FBTA 3G82B 2LEAA 4MAKA 3EGZA 4OYBA 4JV5F 3ZZPA 2DXDA 2N3OA 1X5OA 2IY5B 2BQRA 4LBPA 3K57A 4ZOSA 3KJFB 4PG6A 5KFIA 2QMXA 1EP4A 2L08A 4I0WA 5ETOA 4QU6A 2MDAA 2VQFF 4A4JA 5F8MA 4ZS6A 3EXYA 1RA7A 2C2MB 2MQNA 2NR0A 3KK3A 1I3OB 5B0EA 1FRLA 4E0DA 4EU0A 1S9FA 2CPJA 4F0MA 2NPFA 3DLHA 1NKEA 4C11B 2FJBB 4TY8A 4TU8A 3R2CJ 1TP7A 2M52A 5BYRA 3I4HX 1IR2A 3VAKA 2J0WA 4DU7A 2GJ2A 2V94A 3KDNA 4LF4F 2A1BA 4K4ZA 5C25B 2F3JA 1FO1A 2DNZA 4OI2A 5HAOA 3O5TB 5T14A 4F4XA 2G1DA 3CJ3A 3HMJG 2E9TA 1RWWB 1BQMA 2WB1D 1JLAB 1APSA 3CDWA 1SQGA 1W25A 1FD2A 2F8MA 4X62J 3V81B 2YQ1A 2E5LJ 4R5PB 4ZPAA 4P73A 3GP9A 1M5OC 2BJ9A 3HHDA 2G2YA 2CPFA 4ZLJA 1L3VA 2NCKL 4OZLA 4N56A 1S1TB 3BS9A 3IWLA 3Q83A 2LEBA 4KKOA 3Q0AA 2EFPA 2FVSA 1MWYA 3EGNA 1HBUA 2I6WA 1OYDA 4IH7A 4DQSA 1K9MT 1HNIA 5DG9A 3BPDA 3G6XA 2GHVC 3M2RB 3PO5A 3PJXA 2W9BB 2HZVA 2M7SA 2UV8A 3GILA 2NSCA 2AJ2A 3M8QB 4DLEA 1LOUA 4M5DA 2B4UA 4YOEA 4WBFA 3M1VB 4BC9A 1E6YA 1NJZA 1FVSA 1HMVA 2JVOA 3LGHA 5KT4A 1UVMA 1HBOA 4JI0J 2H9ZA 3G82A 1WACA 2FDNA 3ETMA 2E1PA 5DETA 2AZ3A 4LF5F 4ETXA 1V3ZA 4P2SA 1C0UA 2EWHA 4LFBJ 5E2QA 1VOMA 2P2CB 1PC4A 2W7AA 2Y1LB 3LH2S 4DX7A 1NB7A 1R3NA 3EDQB 2QRRA 1WNEA 2IBKA 3H5YA 1G4CA 4YN3B 3GWCA 2X1BA 1NHVA 5AXLA 2VG7A 3PW5A 1MU2B 2CWXA 4O3NA 2K1RB 3TQ1A 1C0TA 3D1HA 4DL3A 2CVEA 2VBYA 4KHPF 1FXLA 1HQEB 1F5BA 2QGFB 4TY8B 3X3UA 1HW9A 1KOOA 3KNAA 4LVNP 4CLWA 3IN5A 1JXEA 2CFXA 4G1IA 4BBYA 4CQ1A 2FQQB 2J5AA 4ZA1A 2MKIA 2R2TA 4KPYA 5IS2A 1H74A 3HK2A 5JJBA 1U4BA 5KFNA 4DR5F 1SUQA 3QRPA 5LL6d 2RT3A 2XYPB 3UNYA 5K8MA 1S57A 3JTNA 3E2EA 2XMJA 1VQOS 5M2PA 3IRXA 4NA3A 1R6VA 1XWLA 2DRDA 3MUVP 4ZJQA 3V81A 3MECA 4ZHRB 2GVDB 4ZPWR 2R7SA 4QW8A 3JTOA 2QMUB 5CQGA 1U26A 2G2ZA 3MUTP 4ICLA 1SL0A 5E3RA 2IA6A 3IS9B 1C1BB 2DHXA 3CSKA 1UZDA 3PRDA 3RJMB 3OLAA 2YQ3A 4XPEA 3HZGA 1M90T 1KRPA 5I3PA 4FXVA 2C3UA 1OPIA 2JL9A 4D3GA 4KIAA 3AOAA 1H2TZ 1RWNB 1IN0A 1OY8A 1IKXA 1DJ0A 1S9EA 2JOQA 1S1WA 3DRSB 1VJWA 2G9OA 3EICA 4JI8J 2HVDA 4DR1J 3BKUA 5CXTA 4HI2A 2XM3A 1IVZA 1JLBA 2MHEA 1NCLA 5F3TA 5KT2A 4W90B 2HIQA 3N6LA 1NK8A 5D3GA 1SV5B 2V50A 4PABA 4CO1A 2DTJA 2YKAA 3QT6A 3LWLA 1ICEB 2JEFA 2UXBF 3KG4A 5L38A 3CCZA 4Y2CA 3F73A 1FNOA 1S6PA 5D6GA 1RWMB 2ZVIA 2V67A 1TVRB 2XHCA 1X4GA 2QJ3A 2BQ3A 4O3SA 4RLEA 3ILOA 2AF6A 4M1KA 1RE1B 2Q6CA 3QQCD 1EX8A 2A3JA 1X4DA 4RUAA 4V19J 1U8WA 5FIIA 2DRBA 3BR9A 5KT3A 3PIPQ 1YK9A 2A18A 2K1RA 2W2NP 2WHOA 3BV8A 2CDQA 5A8WB 2F9DA 5AXNA 2CQ3A 1NK7A 5KFRA 4A8WA 2R7UA 2BYCA 2I38A 3PYFA 4ZJOA 1RT3B 1UEVA 2CPXA 2DKOB 3OVBA 2VPXB 2WONB 1Q8IA 1Q16B 2EK1A 3M6VA 1N33F 3CDEA 2M70A 1KFDA 3EPGA 4B9SA 2CJYB 2ZDOA 1RBOB 4KFBA 1U1QA 3GB0A 1LW2A 1X9MA 4IRKA 2RKIB 2BA9A 4NASA 1SB6A 3D66A 1KQSR 4JP8A 5KOXA 1YRTA 4NA1A 2COLA 2N4CA 2QO3A 3IRXB 3TVZA 3U1LA 3R9LA 2J8SA 2PEHA 2RILA 5LSLA 1TUVA 1RKJA 1B99A 5HROA 1FXRA 2Z57B 3GZ7A 3HVTA 4DR3J 4GKJF 1QAYA 3L95X 3J7Z5 1F6TA 1P1TA 1RCXB 2HBZB 1MMLA 3J7YU 1Y5IB 3MM7B 2LKZA 3M8PB 4ZITA 5L1IA 4DR3F 4JYAF 1RHUB 2LP4A 4LF5J 1N8RT 5HP1A 4NLUA 5T7LB 1WUUA 4PR6A 3EVWA 4RPFA 2APOA 5B09A 4KHRA 2YKNA 3MCSA 3H8YA 2R4FA 1IKXB 2HGMA 2HFOA 4OHXA 2ZD1B 2CQCA 5KG1A 3UPFA 2VH7A 4ZVRB 4NCAA 1K8AT 3MHYA 1RGVA 5KFHA 1HNWJ 2CQPA 4ZP9A 4NXMF 4AL5A 3FFIA 4DR7F 2DNYA 4R0JA 4IH5A 1DTQA 1UZHA 3PM9A 5AE2A 1SV5A 4JOUA 1G6BA 1TUWA 2ILZA 2IM1A 2L9DA 4CO3A 4ELVA 1U25A 4IFVB 4O3PA 3QIPB 4O4GB 4YEAA 4G65A 3QLHA 4H4OA 5KFVA 1WHXA 4N8OA 4EFAC 2OI2A 4ZN3A 5LSRA 4RNMA 1U1KA 1HFEL 3GYGA 3FCHA 1DLOB 1RT7B 1X0PA 4KH1B 5LJ3Y 2DNKA 1TELA 3BDEA 4FS2A 4CM2A 2QLFB 1WORA 2HBYB 4GRSA 2DNPA 4NLSA 3TI0A 4HL9A 1N34F 2RRBA 1HKAA 1YRUA 4WFXA 4C3KA 4DR4F 2CPHA 4YY3F 3KNGA 1VFJA 5D0GA 4ECUA 2HNYA 4W92B 1U7LA 2OH2A 1FKPB 4DPWA 4ZP7A 2QA4G 5EDWA 1H98A 4K0KJ 4L3KA 3LO3A 4LJMA 3MEGA 3D28A 4IG0A 3GIJA 2IVMA 4ES3A 3FMBA 1YX2A 4KFBB 2QT7A 3BGLA 4RW4A 5IC6B 4QYZJ 3GFYA 1EJ7L 2F65A 2AIRB 4DL6A 2HW3A 2L9WA 3DRPB 3MMBA 4CTAB 1KP6A 2DGTA 4L3NA 1LK5A 4XDCA 1N5YB 4PPDA 2XB2D 4OX6A 1HYSB 1HPZB 1IKWA 3RRKA 4IQXA 3MM6B 4M5HA 2MSTA 3ADAC 3EVMA 3POTB 5E41A 1FRIA 4MJKA 4YS2A 3T5KA 4DL4A 2UVVA 3MM7A 3O8WA 4AL6A 4ECYA 5H9EK 4QYZK 3MM8A 1RT2B 2BUNA 4Q44A 1T11A 1RTIA 1VI7A 3O2IA 2IA0A 5KFYA 4WU2A 3KLVA 5HP1B 1AROP 5B0GA 2YKNB 3W7BA 4OYIA 4RUHA 2RU3A 4LR7A 2UU9J 3PW0A 5HLFA 1RK8A 2KO1A 1R8PA 4NEYA 3UQSA 2MZ1A 3RBEA 1T7PA 1HLWA 2LMIA 3NGRA 4G6VB 2B9WA 2GQQA 3C15A 5DS7A 2HMIB 4QCLA 1RI7A 2MKYA 2IM2A 1H0HB 4PUOA 1HBMA 1H72C 1NJWA 2QX0A 4HH0A 5HQ8A 5GAHI 4G1QB 1HNVA 2KRRA 5EX0A 3R5BA 4DSEA 1RXOB 1TL3A 2E7VA 5K20B 4JI6J 1S59A 2J9CA 2BE2A 1SXLA 4CI0B 3IG1B 3LANA 2JWNA 1QUVA 3KK1A 1KOHA 2OMOA 1Q78A 1WOPA 1U6ZA 1PIEA 4RW8A 4Z2XA 2C2ZB 2YX4A 5B0AA 1T03A 2MXYA 4C8MA 2AEMA 1KKHA 5GAEU 3FZ2A 4ZVPB 4ZIWA 2JEJA 3ET6B 1XIQA 1KNZA 4B3RF 1JWWA 1PBUA 1N5VA 3Q8YA 4OX8A 1XNQF 1OMSA 4K4WA 5DQIA 2RF2B 2IFXA 3MEDB 4USWA 2VFSA 1HWKA 4EO6A 1M1GA 1RWPB 2IC3A 1REVA 2CQ2A 1R8BA 3IC1A 3N01A 2VPWB 1HA1A 1HL6A 4IFYA 4ZVUB 1RAFB 2IIHA 3CPWR 4I7FA 1X31C 1L3UA 3QZ8A 2IHR1 1NK6A 2ATLA 4RW4B 4L76A 4X4UA 1RT5B 4X66J 2NSBA 1TKXA 2MHNA 4LQ9A 3MMBB 1R89A 2E7WA 4DG1A 5F3ZA 5HQMA 3OL8A 2XYGB 3SV3A 1LV5A 1HYSA 4OJ3A 4Q43A 2C28A 4CIOA 2XMVA 2FY8A 4QWEA 3HHKA 2YBVA 4EK2A 3RAMA 1D9FA 2B56A 2W1BA 3HDSA 4LIWA 1NKCA 1RT2A 4NX9A 4ZJLA 2VA3A 1VQSA 4YR2A 1BLUA 4P75A 1OPZA 2D9OA 3DMJB 4R8UB 5L9NA 4QQBA 1RHRB 4ED3A 2KXNB 3DI6A 5H1SV 4DQPA 2M3DA 3NOGA 1S49A 4F67A 1D1UA 5D77A 2KU7A 3MPVA 5HLFB 4ES1A 3AQPA 3TAPA 2F8EX 2R3VA 3VVTA 3WC2A 1D9DA 3QSYB 5KG3A 4DDFA 1NJXA 3OSPA 1UVJA 5B08A 4XAKA 1OO0B 3FRYA 2W2OP 1DTTA 2MZJA 3OL6A 2KFYA 1FESA 1FKOB 5CYMB 3GJSB 2R8KA 5G0RA 2W7PA 4ZN1A 3W9JA 1LKZA 1FJGJ 4UF4A 4N76A 4OZ5A 1UJ4A 3CTRA 1WF0A 1KHWA 4ZVGA 1DRZA 1IWAA 4DS4A 3RB0A 3LUYA 5HATA 3Q22A 2X1AA 1CEZA 1ZZNA 4RW8B 5DQGA 1DAXA 1DQAA 1JLCB 1OY6A 2LDYA 2DNOA 1XMQJ 3FRZA 2DXEA 3TZYA 2LCWA 3AB4B 6FDRA 1R8CA 1R0BG 2V9WA 3B4DA 4RBUA 3PRVA 1GAOA 2XMMA 4HEA9 1Y9OA 1YBTA 2XTJP 3I4PA 4OLPA 3GIMA 1XBWA 2VBXA 4DQQA 1CPZA 1XMBA 1NJYA 2Y9HA 2FZKB 2FD2A 1URRA 1EHWA 1S6UA 3GPAA 1IWGA 4I7FB 4RWXA 4O0IA 1R0CB 4KPCA 4KJIA 4NLXA 3DLGB 4DMZA 1QD1A 4DUYF 1SKWA 1RT5A 3NLCA 4KY3A 2CJXB 1I51B 4WTYA 3OVSA 1IQTA 3KLFA 2Y8YA 2E5IA 1HBNB 2XSJB 1FX4A 2B4OA 3HF5A 3FEYB 4DG1B 1AFIA 4GVLA 3B8HA 3IAS9 4IO9Q 1HNXF 2AEJA 2GVZB 3ENWA 2W8KA 4IOCQ 4USTA 4NPOA 1F60B 1X4CA 2D74B 1C4AA 1ZBTA 2MMYA 3H0PA 4I6WA 4DPXA 2NYIA 2IAJA 4C2MA 3W3SA 4ER8A 2NXNA 4NWBA 1JLFB 1IKVB 4NMXA 1VC0A 3AJDA 1LWCB 3DMJA 3OHAA 3GR0A 2DCUB 4AYBD 2RS8A 3MMCB 4RZRA 2L41A 3BREA 5LXYA 4KYZA 2EG1A 2XCAA 3JSRA 2XC9A 5D78A 2MLZA 1LFWA 1RTHB 3VGUA 3GONA 3G8TA 3MOJB 2DR8A 4FXDA 2DH7A 1SKRA 1F9FA 4PWWA 4EUVA 2R7VA 5E5NA 1B7FA 5A2QU 4FYXB 3UNGC 1I5OB 5F8JA 2ZBCA 2XI2A 4MKAA 2QEXS 2BM1A 4JBCA 2W8LA 3AD9C 4OI4A 5A8RA 1R43A 2CRLA 2ZKTA 5U47A 4JI3F 1RAIB 1M1HA 5A2QY 2QE5A 4X4OA 4QIVA 1S10A 4CCHA 1ZTTA 1FRJA 3A3NB 2JDJA 4DFPA 5ITHA 5C24B 3PV8A 3OPKA 3DLLQ 5GAHU 2UV8G 4LF6F 4KHMA 2LXFA 2HVZA 1KLNA 3NEKA 1JMTA 1Q79A 1IBMJ 3OLBA 4HYKA 3KK2A 2B9XA 2C2OB 3FNNA 2W4DA 4X66F 2NXCA 1LW0A 1TU0B 3GSIA 4XO0A 1CS4B 4DR5J 4MKBA 4DFMA 2PA3A 4WFZA 5ETLA 4MIWA 5KFJA 2RD5C 1NK5A 2J6TA 2HVIA 5GAGI 3H2UB 2AMCB 1KC8T 1RAOA 4DX6A 1X8DA 3V4IA 2HQGA 4ZPTR 3GE9A 5HO4A 4QWAA 1EAYC 1WDTA 2DEJA 3CC7S 1KN6A 4KV8B 1LQ9A 5KG4A 5SZTA 1T3NA 2WVFA 2BE7D 1HW8A 2KYZA 2Q3PA 3SZ2A 4X4VA 1ZAVA 5KT6A 2RJZA 1WKKA 3HO1A 3UFCX 2Y0SD 5DLGA 1U45A 1Z2ZA 1U48A 5DG8A 3PY8A 3M8RA 1JLFA 1UTAA 1VBYA 2DNNA 4FYWB 4IG3A 2O66A 3EX7B 4A8KA 1GTHA 2J7UA 2RB7A 3CJTA 4C8YA 4OYOA 3VF0B 2ZITA 4OMFG 1T9YA 3OUYA 3OR1B 4I1TA 4F4AA 2LFVA 4ZPBA 4R5PA 4ELUA 2YPZA 1PG5B 2MYFA 4X65F 1MW7A 3Q8SB 1RISA 2VPYB 1YG0A 2YNIB 3RBDA 4NXNF 3V2UC 1K44A 2H3EB 2HQIA 2EKNA 4YHHJ 4I6YA 4A8QA 5KFWA 1S1TA 5HK4A 3W63A 4ED1A 2HFNA 4DCOB 2P6TA 2VB6A 1GXTA 3R7NB 3W60A 5KFDA 4K2XA 4DCPB 5IV4A 2BACA 1TV6A 4B9MA 1LFPA 1U02A 1HNIB 1VRQC 3LOUA 3D3BJ 1GMWD 4J9UE 1FE4A 4U7UK 4C98A 4WFAQ 4GC6A 5DDOC 1U1PA 5F8NA 1S77D 1V5IB 1H6KX 2AGPA 2UXCJ 1BUXA 1SKUB 1NEEA 4M5DB 3T1AA 2Y1RI 1S1VB 4B3SF 1VBKA 4C8ZA 1Q5VA 2VZ9A 1E6YB 4YFUA 3HT3A 3AD8C 1NSQA 3A3OB 4M95A 1HMVB 3KK2B 3FJ2A 1TL4A 1LXNA 3HHLA 3PHEA 2OPQB 4USMA 4AQYF 2AP6A 3JSMB 2O3DA 1UKUA 5FDLB 3O6QA 1C0UB 2OD6A 3L7OA 3ITHA 1J5EF 3ZZTA 2I2YA 4NLDA 1NUEA 1IR1A 1GEHA 2C2RA 1WC6A 3NBPB 2R9LA 3TX8A 2GNKA 1JJHA 1FJ7A 1VQ8S 2FJXA 1WEZA 5M2UA 3G71S 3V4IB 1FFGB 1M5KC 2DO4A 1AA1B 1IM6A 2OO4A 4HI1A 2PA8D 1TKTB 3ELHA 3CO0P 3IFEA 2AW0A 4BWJA 1JLGB 1LNQA 4W4MA 3S6EA 4LFCF 1RWXB 3PJ9A 2RVJA 2XNQA 4KGKA 2I5JA 1RSCA 1Z2LA 3KG0A 4PRFA 1UW4A 3TX0A 1A6LA 1Y7PA 4ZVOB 1IM4A 3Q8VA 5IOLA 5B0CA 1N36J 1SVDA 4OQJA 4P72A 4LSLB 2EC0A 4DBQA 3I5CA 2ROGA 2QV6A 4RU9A 1CJKB 2EPIA 3NXZA 4RW6B 3BH6B 3EXCX 3ULHA 3Q23A 1OQ3A 5B0BA 5CD4A 1VBXA 5DQHA 4X4TA 2YNIA 1TQLA 4RBVA 3WZ0A 2HHUA 3FMWA 1Q8LA 4N8NA 3KG1A 5A0YA 5JVGQ 1PYTA 3THVA 4DV4F 1S1UB 5THWA 2MGZB 3X1LB 2RQ4A 5HMXA 3JQJA 3NMRA 1RT1A 4OFZA 1RLDA 2W4PA 2HS4A 3NWGA 1U6BA 3SSSA 2W25A 3DRSA 3GIKA 4IH6A 3W66A 4OI1A 2VJVA 4FYDA 2MQLA 1VRUA 1N33J 2VDIA 3BGRB 2AX1A 2L9NA 2CZ9A 4OYPA 2LA6A 3MTKA 3LW5C 1P6TA 1YVFA 2HRYA 3PX4A 5D3GB 2B5JA 3CJSA 4X64F 4DV6F 1S12A 1CG2A 1DY3A 3T1HJ 4EWTA 3JSMA 2HRTA 1DQ8A 2U2FA 3CO9A 4X64J 1RCOB 1CJVA 1P27B 1UVNA 2KFZA 1RAJA 2GIRA 1KONA 2HQCA 5L39A 4BC7A 1KQGB 5AE3A 3A4TA 3AFGA 3U1NA 4ID8A 4NLTA 2HK3A 4K8RA 1N54B 3DOMB 1MROA 1RAGB 2DGVA 2DNLA 1U24A 4NZ7A 1EETB 3AA9A 5C42A 3RRHA 2D3OR 1YITS 4LF8F 1XNRF 2FVPA 2QZ8A 1FRMA 2DIVA 2KXHA 2BOPA 1U0HB 3K5MA 5LMUJ 2B6AA 2MTLA 1C4CA 4IO1A 3LP1B 1S72S 4M5GA 1D3WA 2DHGA 2YQ0A 1UVKA 3MM5B 4DV3J 4PQUB 1WC0A 4QR1A 1JIHA 3GCWP 1RKIA 2NYHA 2YKMA 3TUJC 3WDOA 3CJKB 4ED8A 3ZTQA 3TR5A 1NBEB 2OJ3A 2FC8A 2DCLA 2R2UA 2W7OA 2V4JA 1JKHB 3HCXA 3I0RB 4F3MA 2QLBB 1KQKA 3J81Y 1HWIA 2RAQA 4J9VA 2OD4A 4I64A 2OPRB 3D5MA 3M7VA 2QLJB 3PJWA 1QTMA 2NREA 1JLEB 1F5CA 3DLKA 4NLYA 2HAFA 2DK2A 1VQYA 3W8PA 3A12A 4RW9A 4IR1A 1N32F 3HX9A 4MIBA 4Q2LA 5T7LA 4XIUA 3BSNA 4IR9A 3BPSP 4O44A 1NK9A 5F9LA 4YY3J 1RT1B 3I56S 4BS2A 4MK7A 3TARA 1LWEB 4PG4A 3BB5A 2DY1A 2HLTA 2OPSA 1KD1T 1JXVA 2RHQB 2MZQA 3EVOA 2ILYA 1VRUB 2MKJA 1L3KA 2HIYA 3AT1B 3MEEB 2IDEA 3SFUA 2ZC4A 3SSRA 3VAMA 2GMLA 2NQPA 5KFQA 3D1OA 2HHHF 4TYBA 2JLGA 2C1EB 2IRXA 3DDNA 4LF9J 1OQ6A 5HBMB 3EM1A 2J9DA 4DR7J 2YKPA 4K5RA 3FC9A 2EFVA 3OL7A 4K5SA 2JLFA 3UR3C 5LJ5Y 1LEOA 4EYIB 4H4MB 2D69A 3DRRA 3OBIA 5AXKA 4UOGA 4ECXA 3W2VA 2JNJA 4WTOB 3CJ5A 3M8YA 3P8BB 4RR5A 1D8ZA 1TKZB 2D7SA 2R7QA 3DXSX 2XLKA 4OZNA 4B9LA 2QIFA 3THTA 5K8OA 1EETA 3NY0A 1WSVA 1P9QC 3VAJA 3QAUA 4DSKA 4USJC 3I82A 2WOMB 3A8KA 2ZH8A 1WKJA 2MQOA 6FD1A 1HD0A 4LIRA 1KDNA 1N5QA 2AKWB 5IM0A 1NZ8A 4IG0B 4YB7A 3V6HA 4FPIA 4KT0C 3GMGA 1ACMB 1YQHA 3RB6A 4CO0A 1M5SA 3EZ5A 2BJ1A 2FGOA 4F04B 4Z7CA 3G9CA 2XWXA 2OELA 5RUBA 4CTAA 3OTOJ 3G6VA 5KFOA 2KI2A 3HM9A 2DRAA 3I31A 1P1LA 1JKHA 3EUNA 7FDRA 2X3GA 4L72B 3FQLA 5HVGA 4K59A 3R27A 1L3TA 3MM6A 3MMAB 3CJ8A 4KGXB 4YB6A 2V68A 1H7XA 2PE8A 2J6UA 2IM0A 3GV8B 3IBWA 3DXBA 3PX0A 5AXMA 4RNHA 2KJVA 4LF9F 1KVJA 3UN2A 5KFKA 3H5XA 2P5VA 2JSXA 3EJMA 3K17A 4LRFA 3M8QA 1VHIA 2UZAA 4NRUA 4Y6IA 3SBMA 3ZTOA 3J81U 1S6OA 2RIJA 4LF2A 2BV3A 2WSFC 1LWEA 2RMLA 1TFYA 1W26A 2A6MA 3DYAA 1YJWS 3OR2B 1ZM4A 3HP6A 2MY8A 1JJ4A 2HMIA 4U96A 2Y8WA 1SC4B 4ZVTB 4ED6A 1S1XA 2HFVA 1PO6A 1WJ9A 4ZVHA 4DQIA 1XNRJ 3FBEA 5KFFA 4N7TA 2B43A 2Z2MA 1HNZF 2V69A 1UCNA 3QSIA 3UD4P 2VG7B 1WC5A 1Y3JA 3MFIA 1S0MA 3ZZYA 2R2SA 1F2GA 3NCPA 3KK1B 4LF4J 1F2HA 2BXJA 5BYQA 5KG6A 3C2PA 3VGTA 3TOQA 2QN6B 1TL7B 2AV5A 3E51A 1U1NA 3NAHA 4WXWA 4B3MJ 4LF7J 3KJQB 5H9EJ 3WQPA 4HACB 1IQZA 4S0MA 4OYAA 3U27A 2MQ8A 3CC2S 4B3MF 1WOSA 2GO8A 2X1FA 2DXFA 4FF1A 1Y11A 2VBZA 3FK4A 2ZJQQ 3W8GA 4IFYB 5GADI 2BJ7A 5DLFA 2IRUA 3ILLA 4CLZA 3T5JA 3UCGA 4CLUA 4L6V3 2XGQA 2MKKA 2CQGA 2UUCF 1VQKS 2C3PA 4EYHB 3H98A 2YTCA 1C1BA 3C66A 2ACYA 3P5BP 3G6ES 2Y0BB 3DKDA 2XSFA 3DOKB 3SSQA 5D8HB 1CULA 5J1EB 4U9RA 3NKYA 3OTEA 2G1HA 2NUUG 1GFWB 2P9GA 3NGTA 4WYWA 1PAEX 1MN7A 3BR8A 3VV2B 4WCEQ 3PVXA 3UD5A 2G0JA 1VJQA 5I42A 3HHNB 2GZOA 3KLHA 3MOZA 2VJUA 3MCNA 4R8UA 1JLBB 1FI4A 4FKXA 4P2XA 3S1TA 4A47A 5HN0A 1FJCA 3B82A 1AFJA 1KR4A 3FBFA 2MLYA 2ZZTA 3QT5A 5D15A 5IT0A 3IR6B 1HHQA 2EFOA 3KMSA 1K47A 3R6LB 4Q7AA 5A76A 1SKSA 1TK8A 4AFFA 4X4SA 2IVFB 4JV1A 4FF3A 5HVFA 1R8AA 5IXUA 1S48A 1TVRA 5CYMA 4MKVA 1CLFA 2J8AA 1JB0C 1ZZFA 2KDOA 4XK8C 2F1FA 3EZUA 2EBEA 2FUG9 1UJ6A 4U67Q 3R5DA 3IO1A 1JXLA 3C3LA 3GG0A 4NRTA 2Y3YA 4ZLNA 3K5NA 4A48A 1X60A 1TK5A 1YSJA 1X9SA 1IBKF 5IT9U 3QWUA 3PR4A 1U49A 2VONA 2WSEC 4DPYA 2CIMA 1FDAA 2VOOA 2KB2A 4OYXA 4ZCMA 4WWSA 1TL7A 2RE1A 3AD7C 1UVLA 4B9TA 3NS7B 4WIIA 1RU2A 4LMZA 1EKRA 1UEKA 5KFMA 4WK1A 4NOHA 2CUYA 4MFBA 4LFAJ 5D4PA 5M2RA 3MR3A 3OQ2A 1QUPA 1SQEA 2RUGA 1HHTP 2V8VA 3GYXB 5IFMA 5J2PB 4RBTA 1VGYA 1SQFA 1KVIA 4RWWA 1K1SA 3J7YI 4WFYA 5B0DA 5J1PA 4DV7F 4M94A 3RRGA 3KJVA 1EB0A 2BJ8A 3B54A 3V6DB 2VFTA 2WW8A 1U2FA 3CCQS 2LYVA 5BXIA 4I4BA 3AQOA 2BM0A 1HBNA 2GAHC 3U1MA 4F7VA 3D6TB 5J2MB 2CPIA 4U8YA 1CQMA 3DOKA 2CQHA 4FYYB 4X65J 3MCMA 4K4YA 2H51B 3CCES 3PG9A 2HNDA 4OZ3A 1BQNB 2XGPA 3UWTA 3KLEA 2EFGA 4WKYA 2IAJB 3I6PA 4KO0A 3RYLA 2IDLA 5HSPA 2VICA 1H2VZ 1VQMS 3CMQA 2RRAA 1NPKA 1DHMA 2V2VA 1V3RA 1N48A 4IRCA 4HDHA 1K0TA 4JV2A 1J27A 1NH7A 1F9EB 3AXKA 1TTHB 1IKYB 5GMEA 4B02A 1R6YA 2D3UA 1RTJA 1IJFB 2YNGB 1I94F 4YR0A 1BQXA 2BRKA 4GO7X 5L1KA 1FNXH 4H54A 5ADZA 4RW7B 3V6KA 3QIDA 3QIPA 4O4GA 1S6QB 1O0PA 2CJQA 1A9NB 4KGMA 2ZNYA 1DURA 4F4WA 4F02A 4BLGA 1FT8A 2PFDA 2GQ2A 7AT1B 4WE1A 4C9DA 3QT8A 4ZPDA 1WHVA 2E1AA 1KQFB 4JYAJ 4M5NA 3CCRS 2E1MC 2ZBPA 3CCJS 1HI1A 1FDNA 2K7JA 1FEHA 3AY0A 5KFTA 2OHDA 3VAHA 3PEJA 2HKEA 1U2CA 4BHQA 5KG7A 3OV7A 2ZZMA 2KZZA 2KM8B 2XO7A 4DV1J 1HR0F 2IJNA 3PYGA 4B17A 4ES2A 3Q89A 2ZDPA 4LRBA 2HNYB 1TR0A 1JK9B 1JLQA 1MG7A 1FRXA 2N7YA 3MM9B 3KHRA 2UXCF 1FDBA 1HARA 4IDKB 1CC7A 5ETVA 1XNQJ 3QJPA 2UVUA 3N5FA 2CPDA 2KTQA 4LF6J 1FDDA 2HURA 1BC6A 3R5CA 2DH8A 3QGIA 4NLRA 4DV4J 1L3SA 4YB5A 4AE5A 1RHJB 4ZKAA 1PYOB 3DN9A 4RNOA 3KUGA 4ZIVA 5BR8J 2HEKA 1SC6A 2HZCA 1UAWA 2OGUA 2PIIA 1G3OA 4QBUA 5AJ3F 3Q86A 3HZEA 2AQ4A 1N5YA 4Q0BB 4GMKA 2IMWP 1JQGA 4JI6F 4WPAA 3NNHA 2UXDJ 2MJNA 1S4FA 1T9WA 1IKWB 3BKTA 5KFSA 2KFNA 3J7AN 5DDQC 3K8WA 3OL9A 1MN9A 2KRBA 3V6DA 4PKDB 2SXLA 3ZZUA 2FB0A 3M2UA 1RWKB 5EHHA 4LR8A 4EBEA 3E8OA 4DR4J 2C3OA 4RJVA 2XY7A 2QTWA 3W61A 4ZLLA 5D4NA 3DC2A 3E01A 3D6FB 4KH0B 3T19A 4OX9J 2A6OA 3BYPA 4NCGB 4B9UA 2B7CB 1X5PA 4DUTA 4NL5A 3Q8RB 1KVKA 2B3TB 4U6PA 3RTVA 1WF2A 2UUTA 3EE3A 4FYVB 1LWXA 3OD2A 3SCIE 1E6VB 4ILRA 3CCUS 3QAEA 2M0GB 1FXDA 2HHQA 2RUSA 2E5JA 4WP8A 4J91A 1S6QA 3LGNA 3TZWA 1U2RA 2O1PA 2HHVA 3MR7A 4N5SA 1U47A 3W5XA 1UWBB 5FLXY 2CJ9A 3D54A 3UN5A 2AJQA 3H2VE 1OYEA 3SFGA 5E33A 5F8GA 2K3IA 4F3QA 3SEOA 5CH7B 4Q45A 4PWDB 4ZVFA 2Q79A 4JI4F 4M63A 2J7KA 1C2PA 5T41A 2KVQE 1QAJA 3RR7A 4ALZA 1ZPWX 3W5YA 2V5HG 2R2RA 1NDCA 3MM9A 1Z4UA 3RU0A 2DYAA 1LWFB 2JC0A 3I96A 4M5MA 3R5AA 2MKCA 3V4MA 1KTVA 3DM2B 1N4LA 5DRKA 2OFHX 4KAIA 4PEOA 3MAQA 2Q66A 3I9ZA 2PFFB 2BX6A 3KLIA 4UOCA 1KHVA 3MD1A 1GTEA 5LOQA 1XJWB 2ZH3A 3VQTA 3BO3A 1TKXB 3C46A 4WZMA 2B9YA 1Q4RA 2PGCA 4ZVSB 1VS3A 2RU9A 3ITHB 2OAUA 4I6AA 3P49B 3MAAB 2BJDA 1A7GE 5B0FA 1N52B 1D8YA 1CJUA 2HQDA 3EWGA 1KS2A 4CM0A 1CJTA 2F7VA 2MPUA 1OY9A 2LQ5A 1FD8A 4DPUA 2ZHBA 1B0TA 2J7WA 4F4YA 1CQNA 2NXEA 4ECTA 4A8SA 2K06A 1RWOB 2CQDA 1EQ0A 2BRLA 3H42A 1Q8KA 3IP0A 4JI2J 4CLTA 1ZH5A 3OTOF 1U1LA 3BSCA 3GJTB 3TUZC 1RHQB 2FVRA 2UUCJ 3CNQP 4OL8A 3UCZP 3ILJA 2EI5A 2CVIA 3JQMA 3GJRB 2HBRB 4ED0A 3L7PA 2JFDA 4J37A 5KFCA 1UA1A 1K0VA 1NSAA 2ZH1A 3AOBA 1JJ2R 2XZTB 3UVJA 2F8HA 1FKOA 2VC0A 1VR6A 2XY6A 4AT1B 4HDGA 2DNRA 2W9CB 3CIMA 4DPOA 1VQ4S 2UXBJ 3P5TL 2WVBA 3UE2A 4X4RA 5KT5A 5GMDA 3UCUP 4WKRA 4Y00A 8RUCA 4JV0A 5HL7Q 3I87A 1HIYA 1N36F 3H40A 2E5HA 2AJ0A 3L4BC 2ZM6F 1O8BA 1FTCA 2DISA 1EKSA 3P3DA 4R25A 3SDEA 2YWFA 3QFHA 2H5IB 1B70B 3N4WA 3KFWX 2I0XA 4TLRA 4EO8A 1BGXT 1IBCB 3QRRA 5KG2A 2FGCA 5EWEA 4N47A 2Z56B 4DWIA 1WC3A 2DNQA 5HQLA 1FK9B 1MMDA 1V3SA 2AHOB 3FCVA 2LXIA 4ATNA 1SC1B 2CG8A 3CGIA 1WHWA 1R0AB 3VAFA 1Z1ZA 1Y5NB 2HVEA 1WF1A 4NYPA 5K5MA 2W2QP 3DLEA 2ABYA 1VMBA 2RHSB 4KKOB 5KG0A 3DM2A 4ANCA 4CH7A 4ED7A 4CP5A 1VIXA 4WJBA 5AE1A 3GQCA 2E1CA 1QE1A 2BOAA 1UFWA 2DNHA 1T9UA 4JI5J 1VQNS 2A2CA 4Q2MA 3BQ0A 2LQ8A 5GADU 3KLFB 2W9BA 3H2LA 5F8HA 3T6JA 2J6SA 2ZKUA 8AT1B 3N9UC 4QYRA 1RA6A 1VIOA 1H73A 4P7TA 3KOAA 2GVZA 1AUSL 2Z4PA 5EWFA 2BZ2A 4J9SA 3JTPA 4DHVA 4F4KA 2A10A 4LFAF 4PG5A 1CJTB 4F0HA 3GJQB 2VQFJ 1XMOJ 2J0SD 2MZRA 3PO4A 3EGWB 3HLUA 3NG8A 3WBZA 4RNNA 3IWNC 2WCXA 1QDUB 3CDAA 2IYIA 3R5GA 1QVFR 4GKKJ 1BQMB 5KAKA 3K58A 1QLNA 4C0OC 1RUSA 1QAXA 1I6JA 3PEHA 3CWJA 3EGVA 1PJ5A 1SJQA 3MM5A 2QA2A 1RTHA 1NXIA 3A8JA 1WEXA 4OYMA 5J1NA 4YHHF 3LPYA 1JX4A 1Q86T 4J9MA 4DV5F 4DSLA 3AXMA 2YX7A 1AB8A 3HKZD 1X0FA 2EVZA 2E9ZA 1KWMA 2ZOMA 3NGKA 4TLQA 3I9V9 4ENOA 1VQ5S 1FE0A 1M5HA 2WVCA 4LREA 3CD0A 4QIWD 5JXSA 3JYTA 5KFUA 1HBUB 2VHGA 4DPTA 1RYRA 5FJ4A 1P8GA 2VASA 1SUQB 2V8GA 3TUIC 3MD3A 2ZE2B 3LA0A 3KHGA 2H5JB 2CJBA 4C8LA 4QR2A 4TVAB 2XG8A 3SDEB 1ZA1B 2EK6A 3CF5Q 1S0VA 4LT6A 2ZBIA 3VWSA 3GSDA 3MECB 1Q7LB 3M1VA 3M2VB 4IRDA 4PZVA 4WF9Q 3PTWA 1H2UX 4C3LA 1XC9A 2VD3A 1A0OB 2LU1A 4LVOP 3IS9A 2FJWA 4DN0A 4ECRA 4TY9A 1GQEA 1MMNA 2L3MA 4NZ6A 4Y2AA 2QL7B 2GX8A 3TZXA 5F9NA 5KG5A 1VC5A 5HI7A 5GVQA 4CO4A 2R7RA 2RQMA 3G8SA 1GK8A 3FQKA 3VZIA 5JVHQ 5J2QA 2PSZA 1S1WB 2VKZG 2YKQA 3FSXA 2UU9F 4USKA 4Y65A 3ZZRA 5K14A 1MU2A 4Y0FA 2D41A 2HWTA 3TYTA 2UVRA 4P2FA 1IR0A 2DY9A 2XLJA 2GIFA 4Y34A 1DFDA 3R6GB 5CAAA 4AXJA 3HHLD 1HQEA 3WIVA 3K5LA 4J9LA 3FSIA 2QSFA 1V9OA 3LPEA 1FNMA 1VCTA 4DR2J 2V0NA 1GMUA 4KSEB 5GAEI 1S6PB 2FHOB 4IG3B 3T9NA 4F36A 1RZMA 4OI3A 3MMJA 4DV2F 1ZM9A 1AW0A 1SJRA 3MPDA 1RYSA 2WOMA 2CNOB 2V2ZA 4K4VA 2ZM6J 4HHUA 1PJ6A 2HRUA 3HSGA 3QYYA 1UPMB 2CNLB 1BE4A 4MIAA 4QPXA 4LF7F 3OR1A 5ETSA 3RUBL 4NXMJ 2UUAF 3MDFA 3QZ7A 3TJ8A 3Q2SC 4ZHRA 3NMAA 2FLNA 3K59A 5CYQA 5KFGA 1NK0A 1KEKA 1QSSA 4ICLB 4A8YA 4NLQA 5LXRA 3PYDA 4ZCLA 5IQ6A 4CH1A 4N77A 3OSNA 4DF8A 3RAXA 1W7WA 1SH2A 1Q81T 5CABA 3R1LA 1X4AA 1YTYA 3MMAA 4CLKA 3PW4A 2FHKA 5JUMA 3I0SB 2HNZA 2X1GA 3BSOA 2RKIA 1NHUA 2ZE2A 1IBKJ 2E9RX 1FF2A 4F2RA 3H5UA 2Y1IA 2R8HA 2R7XA 1NZAA 2KVIA 2HSEB 1YJ7A 2W2PP 1AT1B 1X4BA 2H4YB 2ZFHA 4NE9C 3L7UA 1S1VA 3W65A 4C3MA 4PG8A 5HROB 2AGOA 1B64A 4WFNQ 1QVGR 2FJVA 4EEYA 2BW7A 3D0IE 3DYAB 4QW9A 2ZEJA 3K0JA 3KKFA 3WC0A 1PSDA 1TL1A 1U8SA 2WBMA 4O4RA 1NAQA 1M1KT 1VK8A 3TNVA 1S1XB 2VOPA 3TZZA 1ZS6A 3ZO7A 1SL2A 2B51A 2EC2A 1IUJA 2OFGX 2PD1A 3DRXA 4L75A 1S9GB 2KL8A 2OMLA 4UUXA 3THPA 4A8MP 3CW2C 4PYDA 2CQ4A 2VC1A 2ZH4A 1TUGB 3PFOA 2ZOGA 3BH7B 2DPIA 4HTJA 1NDLA 2ROPA 2EBGA 1VLOA 3H20A 3EDRB 2BKOA 2G13A 2NXJA 4HLBA 4B08A 3M30B 5KFEA 3MURP 1B3TA 2K2PA 2DGQA 2ZWPA 2ZC3A 2M88A 4HACA 3IGNA 3OFEA 1J5OA 3ETOA 4NZ0A 1ZTWA 3PDNA 4RO0A 3PCOB 3BZQA 5F41A 3OJUA 2J9DE 3T6BA 3ENAA 3B6BA 1IBLF 1TMJA 2AJ1A 2YNFA 3TAMB 1BWEA 4GVBB 4RW6A 3AJ1A 5BYSA 3SIPB 2HLUA 3EZOA 2ALYB 3R7SB 3DHXA 4ZVEA 1VRTB 4DL0C 1UJ5A 3QGPA 4M5JA 1NRKA 5ETMA 3M8PA 4CNYA 4KTQA 3J7ZT 4NLGA 1TMMA 2CPEA 5A0YB 3C16A 1U6FA 1ZA2B 4B3RJ 2F4FA 4NA2A 3F56A 1LK7A 1S1UA 1WC1A 4O3OA 2CG4A 3CJRA 2DR7A 2KN4A 3N6NA 3I0SA 2XYHB 1X5TA 3I5BA 3OTCA 5J2NA 2PMHA 2EFNA 4LRDA 3M6XA 4NMLA 3TQEA 4CLSA 3N6MA 4CYUB 2CNKB 2QG9B 3ZTPA 2CQBA 2RQKA 2Z2ZA 3FGVA 4RX6A 4ZCKA 3RBZA 1NK4A 3UI3A 2IVYA 1DTQB 3VAGA 3RW7A 1SH3A 2GGPB 2CZVC 2XMKA 4LSNB 4NI2A 4P6QA 3W9IA 4DV6J 2C22A 1SJ4P 5MLCV 3AJ2A 1TL1B 2OUGA 1JNRB 4OLOA 3D68A 4MYTA 4UUWA 4YDXA 1RTIB 2ADCA 4K4SA 2GO9A 1N6QA 2BJ3A 2MKHA 2G0CA 1RT7A 3W64A 4A8XA 2ALZA 1YGYA 4CZCA 1UVIA 4OZJA 2DEIA 2JH3A 4YDDB 1R8HA 5KFBA 1S7HA 1K73T 2JFKA 3DOMA 1NU4A 3K7RA 1Y00A 2CPZA 4EBDA 3KDOA 3PX6A 3HVWA 2FZCB 4CDIA 2Q6BA 4BDPA 2IJRA 3D1QA 1XEZA 3OFFA 4PYAA 2BABA 3TW0A 4JV5J 2BE2B 1ROFA 1UP1A 2WSCC 2PN6A 3MEGB 2POKA 2KH9A 3T3FA 1YJ9S 1J5OB 5DDRC 2ZH2A 2HVHA 3IG1A 2V2QA 4QWCA 1NLKL 5I4MA 2N4DA 4F4ZA 2YWKA 3DLJA 2HFZA 3BGFA 4UQTA 3C8YA 1WG5A 1S0NA 4XDDA 3EYZA 1AXQA 4MK8A 1WHYA 4WP3A 2YWEA 3ET6A 4AXIA 4UQGA 3POTA 3FUYA 3EPIA 1VRTA 3LP0B 5H9FJ 3M4XA 2RF2A 3V5RA 3MM8B 3VZHA 2HPUA 5C5JA 1HWUA 2KXFA 4K4UA 2OKQA 2IC3B 1FJGF 2X51A 2Z30B 2UUBJ 3G2XA 1YDLA 4RNFA 4IKAA 1Q82T 1D09B 1NPPA 3HSJA 2LXUA 3CJ4A 3ZNJ1 2ASJA 1V5VA 3C19A 4KO0B 3FEXB 4NLPA 4TN2A 2OPSB 3IXQA 5A6PA 1X9WA 3M9MB 2E5LF 2XWYA 3LP2A 1N34J 4WIQA 1RADB 4PUOB 2XNRA 1HBMB 1ZYQA 2G0IA 2EXUA 1NNDA 4HTIA 4DN9A 3QJJA 2DNMA 2FZGB 3AB2B 4G1QA 4V1Ak 5K8PA 5DJBA 1N5TA 3Q24A 1T3OA 4RW7A 4W98A 5I3UB 2J0QD 5IQQA 2EEYA 1NMEB 3H5SA 1G2EA 3MTJA 3MUMP 2KM8C 2HZAA 2OP5A 4Y3CA 3JQKA 5F0UA 5HBMA 1C1CA 2CQ1A 3PHTA 4P7VA 3I32A 7FD1A 4ZDNA 4DL5A 2V6AA 4WP9A 2NLWA 4KRWA 3NCQA 1T03B 3DRRB 4LUBA 4B3SJ 3BSAA 3HT0A 1WDDA 2XS5A 2DGUA 4KR0B 4TQSA 3SQGB 3R1HA 4MK9A 1G7CB 2GAGC 3ZZOA 2WVEA 3G96A 5DGAA 3GV5B 2RSQA 3MEDA 2QA1A 3NGUA 4CRJA 2IJFA 2XS7A 2G2OA 1REVB 2XMAA 3J81j 2IRYA 1Y5LB 3GFHA 5IM0B 4IOBA 2YNHA 3KLGB 4OI6A 4YR3A 5EX3A 1CBKA 3ONQA 4X4QA 1RP5A 1XQIA 2X7IA 2XEXA 3M8SA 1URNA 4ILLA 2QYCA 4LR9A 4N41A 2WZ1A 2GCFA 1T9XA 1JNZB 1X5SA 4QZVB 2HHWA 3BYRA 2JHEA 1M0SA 2HBQB 3QATA 3C6TB 4J9NA 4B3OB 3DOLB 2B8QA 2WAQD 2P9EA 3LGMA 5DG7A 1NO8A 2VPZB 1QTNB 1VISA 3KUEA 3GTYX 3R3TA 4J5OA 2KHCA 4QR0A 3V6JA 3LP0A 4MH8A 2AYBA 3W5ZA 4DX5A 1FX2A 2WK4A 2BKNA 3M2UB 3W9HA 5BR8F 2MSSA 2B8PA 3L09A 3TA1A 4C0BA 4EBCA 3CDBA 1AUDA 1D0EA 4F8RA 1IJEB 1H3DA 3DI6B 1KSPA 2WBRA 2UUAJ 3CMAS 1CC8A 4ILMA 5DM6Q 4G3IA 1EP4B 4CLLA 3QO9B 2BDPA 2O67A 1BHNA 2LDIA 5ETQA 1MWQA 4NCGA 2XULA 4QIGA 2VG5A 4ZMMA 2DR5A 2W24A 1R7IA 3LP2B 3H59A 4NEZA 3VGVA 3OXGA 1DTTB 4OYWA 1EQMA 4Z7YA 4KGZB 2MZTA 3CIZA 1DARA 3N0VA 4CT8A 2B9EA 2QL9B 2PDAA 5G0RB 3P6YC 4D3HA 2ZBQA 3B4MA 3GFXA 3PKMA 5IV3A 2VF3A 4USIA 3L3CA 4GC7A 3PZPA 2BW2A 2ZWOA 3K89A 4PQAA 2FY1A 1LWCA 1DQ9A 4NYZA 4UT4A 5HMWA 1R27B 2RRNA 2A0FB 2ZBRA 2UUWA 3QMQA 1JLAA 2FHMA 4WXOA 4EI2A 2FLPA 3IA0A 4ANDA 1YZ6A 2R42A 3HSDA 3IWXA 3PNIA 4O23A 3TVKA 3NAIA 1NSPA 3WIUA 2FLOA 3ZTSA 3ZZZA 3BGUA 5SUHA 4CLYA 4P2MA 2MZSA 3VVUA 1GMWA 2ROEA 3DDIA 3H4BA 3QGHA 1PC5A 1YIJS 4IOAQ 3TVYA 2DNGA 2E66A 4DCJB 2V34A 2R8GA 5AT1B 2R8JA 2AJFE 4DS5A 2FIUA 4OHZA 5A8KB 3NGSA 3BDPA 1PGZA 3HULA 5CZVA 2FC9A 2RH3A 3KLIB 2X3DA 3A8IA 2LEPA 4RKUC 3JAMY 5KTQA 1F9HA 2F9JA 3M2RA 5HJXA 4OX9F 2XZWA 3CEDA 2VIHA 4I67A 1RBLA 4Y2KA 3ZC4A 4PCQA 1RBAA 3C6TA 4FS1A 3C14A 1RAHB 2CAJA 4B3OA 4OJHA 1WG1A 2HFUA 3MZIA 2V8DA 4OZ2A 2N3LA 3PW2A 1HBOB 1VQ7S 1NJIT 5F0WA 4Q8FA 1QM9A 4ECZA 5DZ6A 5L1LA 2Z2LA 3DGPA 4M5LA 1BXNA 1CS4A 5E7OB 5LMNF 2VFVA 5FD1A 5KFAA 4DOZA 2PMZD 4H4KA 3IR5B 3PKYA 4RU2A 5CYJA 1MSWD 4OX7A 4CO5A 2HFSA 2DB1A 2HQFA 2J0XA 4KBIA 4URQU 5EUHA 3BBCA 4ZP8A 1H7WA 1VLYA 4F0KA 2ZH5A 2ERRA 4CLPA 1RT6B 2DO0A 4Y2MA 3UDEA 1Q53A 5L46A 2ASYA 2JVRA 2MJUA 3AA8A 3GU0A 2CKWA 2AZ1A 5B7WA 2MQQA 2KT5A 2QL5B 4R0EA 1WG4A 4J90A 3WX4A 4LF8J 2W9CA 2AYEA 1LXJA 2GJFA 2YPYA 4JUZA 2ZZNA 3KJNB 1T95A 3RGIA 2GC8A 4FP9A 4X62F 2F4VJ 2QA4S 2KT2A 4I2QB 2VU5A 4P10A 3CT9A 1CVJA 2HG4A 3CD7A 3S01A 1MLAA 3A8EA 3PACA 5D0EA 5D4LA 5E3QA 1RTDB 1OS5A 1YBAA 2GVDA 2DH9A 4X4PA 2C2DA 1UEUA 1RT4A 2RNEA 3H4DA 1GT8A 2ZOFA 1DZ5A 4FNIA 4GKKF 1TAUA 4UTGA 1FK9A 4LF1A 2CADA 1XR7A 2UXDF 2ZUGA 3MWBA 2HHPA 3G8QA 2PMWA 5KFXA 4KHPJ 5HJYA 1YLXA 4ZPVR 1LW0B 4IQMA 5HANA 4DEZA 2MKSA 1RLCL 2V63A 3MPWA 2BEFA 3R97A 2ZH6A 3UN3A 4I2PA 1TZ0A 5A8KA 3QPIA 1MWZA 1TV6B 4A46A 2AU0A 1QE1B 4DV0J 3F41A 5IT4A 1VK3A 1S9EB 4UOHA 3BEGB 4DXLA 3B78A 3UR0A 4ZPCA 3BM7A 4ECVA 2LQJA 2IM3A 1PKUA 1Y0HA 2C42A 2BQUA 1N56A 3C14B 3SQOP 9RUBA 2XO6A 4WZQA 1RB0A 2HNDB 3DFEA 4ERDA 3G87A 3QBCA 4F25A 3K5PA 2I1RA 1REGX 2JRSA 2NS1B 2VG6B 2P8IA 2U1AA 1QSYA 4B3TF 2OLWA 3JXOA 3GIIA 4JI1F 3TAQA 2VA2A 3DGPB 3PR5B 2GHWA 5EWGA 3KWMA 1PBAA 1RTJB 1VYAA 1N32J 1ZOTA 2IPOB 1IXKA 1WEYA 2CJAA 5DGBA 3OUYB 1XMQF 4U7UD 4NCBA 3TWZA 2AEFA 2AX0A 4NYOA 3HVRA 1Y4ZB 4AL7A 1RT6A 1N88A 4OHVA 4JI8F 3ZNUA 3D9BA 2PO4A 1XR5A 3PW7A 1BY9A 4CH0S 3HHLC 3NS5A 4WE1B 4U7CA 2PEBA 1IBMF 1HI0P 4X4NA 1RT3A 2DGSA 4P74A 8ATCB 1ZAWA 2D3ZA 4E98A 4LFCJ 3H90A 2I5JB 3TA0A 1HWLA 1GXLA 2DITA 3IR7B 5HMZA 4PXEA 3JYTB 2HHHJ 2AWZA 3FSYA 1YJNS 4Y2IA 1LW2B 2OSQA 3HFZB 3TJ9A 4CWBA 3M6UA 2BMBA 3CCWA 4ZP6A 5HMYA 4I2QA 2RDJA 4AUKA 3TUPA 3RB3A 1JLQB 4ECWA 1F0XA 4IDKA 2FVCA 3DNCA 3MR6A 1NDKA 2RDDA 3NWRA 4KE5A 1HNZJ 3NL0A 3HVTB 1RHMB 4B9VA 4U8VA 1FRKA 3PYEA 1EZZB 4GO5X 3T1YJ 4HHJA 3L9ZA 3HHLB 1UPPA 2OPQA 2V2KA 2UUBF 4C4WA 1UWAA 2AJ4A 3Q2TC 2L48A 2QSWA 2R7OA 5FDLA 3KMQA 5G4DA 2MGZA 6AT1B 1FERA 4C0HA 3IBCB 2BANB 5E3PA 4DR1F 4DFJA 3NBPA 5E3CA 3KUHA 5A6WA 3MR2A 2MY7A 5J2QB 4RUCA 4QU7A 2ZD1A 2LQBA 1B0PA 3IAM9 2CQIA 1U1OA 1R31A 1V6HA 1XTZA 3W62A 1VQPS 2HYIB 3US5A 3M9NB 3FFIB 2Q43A 1WI8A 2GIQA 5LM7E 3FVYA 4DL2A 3BGRA 3GYNA 4P71A 1PAUB 2VDHA 3R5JB 2FTRA 3NNCA 1JLGA 2W01A 3E01B 4CT9A 2FJDB 3TEHB 2ZJPQ 2R7WA 3H7HB 2J9EA 4U95A 3CCMS 1KBRA 1CJVB 4A8OA 1DLOA 2FYXA 1GX5A 2DHHA 3MPYA 1ELOA 1TL5A 4TYAA 4LSLA 3JAMU 3SYZA 3D0HE 2B4VA 1T8EA 1NH8A 1RWVB 4C11A 4YB1P 1CJKA 4NLOA 4P9SA 3UDLA 1F3VA 2J76E 1GH8A 3FBBA 5IZHA 2JX2A 5K8NA 1QAIA 2LQ9A 3QWPA 1B7YB 1MROB 2RDIA 5CYQB 2P6SA 5C42B 4DV1F 3OW2R 2K8GA 5C25A 3RB4A 5CA5A 3BBFA 4F50A 4F26A 5LSOA 2JEGA 5LT5A 3RBXA 3TJAA 4H4KC 1WD6A 2EFQA 3SCJE 2ZH7A 4JI3J 2B6AB 3ILIA 4OJGA 2CA9A 3ISZA 4NLWA 3CB4A 4URGA 4PQUA 5CCLA 3I5AA 2BVZA 3AODA 3OFGA 3CJKA 4Q5VA 3HXMA 1Q7YT 1WSRA 3S8SA 1YBUA 5EN1A 2EKYA 1AZSB 2DGOA 3GLJA 2LECA 1Y3KA 1VC6A 2E29A 3UDCA 4JI5F 3NNAA 2GMHA 1UFKA 5E0OA 4QWBA 2KG1A 4A8FA 2B5JB 1UW9A 3F44A 3C6UB 4TXSA 1W2BR 2XLIA 1K1QA 3QT7A 5DDPC 1S79A 2YKOA 3U7JA 3MAAA 3TO8A 2N7CA 4WYLA 2XI3A 2CYYA 2Z58B 1CJUB 4UZBA 3LWMA 5CCMA 1YJVA 2V8HA 3GR1A 3C15B 3MF5A 3ZZ0A 4C8KA 3EMTA 2EW9A 1S7IA 2AT1B 3MEEA 4C8NA 3UW1A 1YKWA 3CJQA 2RQCA 3JS9A 1T9VA 3M30A 1HNVB 1JJCB 2JC1A 3OTDA 5KFZA 1FWPA 1TL3B 2C3MA 1U0HA 3ENVA 4P52A 4DJBA 2Z2YB 4QIEA 3KHLA 5LMUF 2VKRA 1GX6A 4FF4A 3CJ0A 3BN7A 2HWIA 1F5AA 4XPCA 1C0TB 2YKMB 4AD6A 3UVJB 4ED5A 4J9OA 3VCDA 2H5EA 3R7BB 4FF2A 4I69A 2GJIA 4O0NA 3VHQA 1ITPA 1HI8A 2V4JB 2YWWA 4GVBA 4ED4A 1TKZA 3MFHA 4ZLPA 5DZ7A 3OHBA 3M9OB 4HT7A 5I3QA 1S5ZA 4OHYA 3ISND 2HQ3A 1JLEA 1O5JA 2QFIA 3DLKB 3U02A 3MR5A 3GV7B 3BGOP 4K4TA 2XBPA 2DIUA 3ENQA 4JB8B 2OEKA 3I55S 4YP3A 1J5EJ 4EZ9A 3CULA 4FVMA 3SCLE 1ZM3A 3BO4A 5IT9Y 1GMVA 5DO2A 1RHKB 2M9KA 1Q0NA 3W2WA 2W4CA 2B4PA 2K7KA 1VQ6S 3R2DJ 3BO2A 1H38A 1ZPVA 2DGXA 3K5OA 4OZ0A 2WTFA 4WFBQ 4I68A 1QJHA 2ACMA 3P96A 3OTBA 1AZSA 4I56A 3HJVA 2ZHAA 2OSRA 4HVZA 1YWXA 2Z8QA 3DLEB 3G4SS 2KYXA 4G1PA 2XQCA 1U1MA 1Q8BA 2CXEA 2BBEA 4TU7A 5L1JA 3T5LA 1RTZA 1GXUA 1HWJA 4NI2B 3C6UA 3D0GE 3LF0A 2BJEA 2FPHX 3ISNC 3LQVA 4UZCA 5F8LA 1FJEB 4F2SA 1QY7A 1O51A 3RZAA 3AAWB 1WKLA 3BN4A 3CE8A 3D6MB 3O3LA 4OJ1A 3VTIA 3G6YA 1N6QB 3QRQA 3BBBA 1ULRA 4KC5A 4MMOA 4RUBA 4H4MA 4LRAA 1WTBA 1T05A 4JI4J 1XR6A 2YXLA 3W2VB 3DU6A 5E3AA 2AGQA 2DJWA 4UY85 3OVAA 1SH0A 4UW2A 4FDFA 2NPIA 3P4UB 1DBDA 3SI8A 2C2NA 3T9ZA 4PPZA 4J9QA 2ZVSA 2BE9B 4BWMA 5JMNA 3D2WA 1UETA 1U1RA 3MGJA 1UA0A 1WTFA 4ECSA 4DZDA 2O01C 3T5HA 4Y28C 3SXLA 1MNEA 4FBUA 4OIXA 4O3QA 2AYGA 1SIWB 1YRXA 5A8WA 2MQPA 5GAGU 3PIOQ 4DI6A 4ZVQB 5K9FA 3ICLA 5IWAJ 2MQMA 1OSDA 5LMNJ 3HJFA 3FDSA 3JB9k 2WW4A 3HD2A 9ATCB 5CHCB 1FFSB 2WONA 2HS0A 2I9SA 3CVKA 3HSZA 2DD8S 5L8RC 1U0SA 2PI4A 2PI5A 4C8OA 3M05A 2NZ4A 3FBCA 2IYGA 3TP2A 2CJKA 3J7A1 3M6WA 4QPTA 3NS6A 5KFPA 2OPPA 2XMUA 3NOCA 4FZVA 4XTTA 3CCSS 1FKAF 3Q8PB 1J2VA 1NHKL 3BQ2A 3DDKA 1M5PC 1SCJB 2KKHA 3M2VA 1GNKA 1T02A 1HR0J 3W2WB 3IM8A 2ASDA 2R7TA 1Q1KA 2EG2A 5BJRA 2M2BA 5CD4H 3NCRA 2JZ5A 2D1CA 3A13A 3OR2A 2HS3A 2PT0A 3FCWA 1BWVA 5MAOA 4K2JA 4ANEA 2LA4A 1G1XA 3CXCR 1QSLA 2H4WB 4DX8H 2KHDA 4ECQA 4USVA 2YWHA 1CULB 4EZ6A 4NXNJ 4YQWA 4DV3F 2ZHOA 2KZMA 1EIYB 2VBWA 3FEZA 4J7CA 3D4JA 5K14B 2FHJD 3KLHB 2V4QA 4F3OA 1C1CB 2HHXA 1W2IA 1B0VA 2Y1JA 1OJ4A 2XMTA 2FHJA 2OEJA 3MMCA 4FNHA 4KGVB 2HK2A 2VFRA 3HD1A 3OFHA 2HAIA 1VBZA 1T05B 2GFFA 2JLEA 4WU3A 1PJ7A 4IFVA 1FRHA 5F8IA 4X84A 3DCAA 3SQGA 1S97A 4DV0F 3QLHB 4H4OB 2CWKA 4UOFA 3F0NA 4RL1A 5D4OA 4PG7A 3WX8A 4DU8A 4ZK7M 3TANA 1KLMA 2BR0A 1TK0A 1BD6A 3GG1A 5D0HA 1Y10A 4DUZF 1F1BB 3BKFA 4TKTA 4HKQA 2QLWA 1FEEA 3GCXP 3CCTA 2R8IA 1SJ1A 2UP1A 3KTQA 4K4XA 5KFLA 2YNHB 1FWKA 3KLGA 2H48B 3KYLA 4DUZJ 3FZBA 5A8RB 2VUGA 4V19X 3OT9A 3SMZA 3HFKA 4KQZA 3DGVA 4TNOA 1FA0A 3CCLS 3M32B 1TFWA 1FKPA 2VODA 1XERA 1ZM2A 2VQEJ 3CD6S 2YY3A 1S4EA 2YWGA 4LFBF 3DOLA 4YUDA 1N0VC 1D9AA 3QNWB 5J1EA 4LBIA 3WHIA 2A2DA 2BKPA 2HWHA 3J80Y 2HNZB 4MYUA 4WK3A 5I42B 1YI2S 2GS8A 2OPPB 1WELA 5CZXA 3M8WA 3DRPA 4LSZB 1FHTA 1SIZA 3A1YG 1FWLA 4FKYA 1HPZA 3N5BA 4DR2F 2N82B 3QO9A 4DV7J 1SI9A 3RG6A 2AYMA 2VG5B 2NUHA 1EARA 4KB7A 4ID5B 2GA7A 3IGVA 4KV8A 1RU1A 4DLGA 5J2MA 2MB0B 3KXDA 1WC4A 2JEIA 3G86A 1IBLJ 1SJFA 1S9GA 2IMOA 3GFZA 2LLZA 3VQSA 5HVHA 3ZFVA 2XY5A 3N79A 2M8DB 4OZ1A 2DR9A 3UD3P 3SV4A 2MEWA 3D6HB 4E8UA 2O5DA 2YVSA 1Q95G 1RWUA 2E5GA 1NM2A 5ETPA 5C7PA 3T1YF 4ED2A 2ASLA 2YH0A 2ZH9A 1L5UA 4QIFA 1S99A 2YNGA 4FVCA 3LALA 3D7SB 3HFVA 2DPJA 4OHWA 5C2CA 1T0TV 4DR6F 4DQRA 4QWDA 2GV1A 2KT3A 1Q5YA 1X7VA 2B7BB 2QLXA 2H1YA 3HHEA 4HH1A 1FFWB 1VDHA 4MTPA 4C48A 1ZAXA 2OIHA 1YZ7A 2OTJS 1NPRA 3CC4S 3NRBA 4MFBB 1KLMB 3IBFB 1NSKL 3MPUB 4UY8T 5IWAF 4FXWA 4EMDA 1X4EA 5J2PA 2YNFB 3TAMA 1OSCA 2YH1A 2V4RA 2HGLA 2IBOA 1BMQB 4OV6A 2CQ0A 2CZ4A 3VALA 4ELTA 5FLXU 3UDVA 1ZETA 3KJVB 3LAMA 1HHSA 1XK8A 1XN9A 4K50A 3CDUA 3T1HF 3M32A 2DHAA 2UVWA 2M4MA 5IC4B 3C16B 3MAHA 4M5IA 1X4FA 3VGSA 4DUYJ 4JI7J 1WOOA 3D67A 3KHHA 5KT7A 1P9YA 5ETKA 2XS2A 1BQNA 3OJSA 3KLEB 3HPOA 2GHPA 2W9AA 4CO2A 2QFJA 4DV2J 2MLXA 2NZCA 3P45B 5J2NB 1HNXJ 2VFUA 2P9CA 3QFWA 1UMJA 2NXUA 2GQCA 2F63A 4QJVA 5D0RA 4CYUA 4EGLA 2CDRB 2GW8A 2DGWA 2KG0A 1PILA 1IKYA 2D9PA 2HGNA 3JSBA 1NKBA 4Q0BA 2WRMA 4IUFA 4PWUA 3O1LA 1SPBP 4FPRA 4MKYA 3IM9A 4FN5A 4PXBA 2GGPA 3R8YA 3N28A 2VV5A 4LSNA 3BJYA 2D3O1 2HHTA 1N0UA 2XMWA 4JI2F 1RAAB 3PFEA 2C2EA 4ID5A 5ETTA 4OI0A 2DVIA 3AHPA 1TKTA 4E2FB 3QGGA 3BF4A 3MCOA 2M8HA 4IYQA 1RTDA 4YMEA 4HR2A 1UL3A 2ZNZA 1B4SA 1T9TA 1I94J 4J9RA 2V9KA 3K8VA 4DSJA 3NGDA 4MT1A 5DM7Q 4HHHA 4L74A 1CSJA 2QC3A 3D3CJ 3ZXWA 2I8EA 3JSYA 4URSA 5ETRA 3VAIA 3RW6A 4J9PA 1YJRA 4DSIA 1TKDA 4JI0F 4JI7F 1VQLS 2ADBA 2CPYA 3FKBA 3HKWA 3UO0A 1UFLA 3DRYA 5EGYA 2YX1A 3H25A 3Q8QB 5H9FK 1RT4B 2WB4A 4HT5A 1XMOF 1KTQA 1RACB 2F4VF 4ITSA 4QOTA 4USHA 2ZUAA 3RAQA 5ETNA 4Z37A 1HD1A 4X2BA 3T41A 1FTRA 2CNNB 1NDPA 1JLCA 2DBBA 5GMKa 2B0GA 1YHQS 1FCAA 1HQUB 4I2PB 3PXGa 2LU2A 3CMES 4DFKA 2XZDB 3LTOA 3PRBA 3K2YA 2RS2A 2C2KB 3CJ2A 2ZJRQ 3Q8UA 4BCAA 2Z0GA 1RJJA 4TQRA 5AJ3J 2H65B 1WI6A 3A3PB 4ZCIA 1PYSB 3E3XA 1AYEA 3CD5A 3MEKA 2DT9A 4TU9A 4J9KA 4DZ6A 4NLVA 1X4HA 2XHWA 4AQYJ 5C2GA 1RABB 1YJTA 1FVQA 3OXFA 3J80U 2W2MP 1SC3B 2E1RA 2QMWA 3DLGA 3IRWP 1R0AA 2ATCB 2VG6A 3IMQJ 2FJAB 2XSJA 4CLFA 3KK3B 1KFSA 1M5VC 2C3YA 1SBRA 3DHWC 4K0KF 2M5YA 3O44A 2OTLS 1VHFA 3QJLA 4C6AA 1RQ0A 1E6VA 3NP5A 4ETZA 3M8ZA 3ZTRA 1S76D 4PXDA 5I3UA 3VR1A 1O6XA 1IKVA 1I1GA 4JI1J 2QYGA 4C7QA 2VQEF 2OEMA 3CUNA 3TA2A 2G4BA 2KJWA 4O3RA 1UWBA 2JJ4D
chains in the Genus database with same CATH topology
1RDRA 1T94A 1TAQA 2K3KA 4DSFA 2VL1A 3SCKE 3LP1A 1S0OA 1SJ3P 4PWDA 3MI7X 4OV1A 2F40A 5L9XA 3S7RA 2AD9A 5KOWA 4Q8EA 4CNZA 2HHSA 2Q1LA 1YJUA 1HNWF 1LWFA 3RR8A 3TRGA 3I0RA 4LQ3A 2PC6A 1OWXA 4DL7A 2GMJA 2OPRA 3DU5A 2XCPA 4PXCA 1WWHA 2LVWA 3MXHP 1N5SA 1OIAA 3BQ1A 4M8LA 3HI9A 3LAKA 1U09A 2FVQA 4RW9B 3HVAA 1VQ9S 2E44A 4B9NA 2FJEB 2DHSA 4O44B 5C24A 1HQUA 4DF4A 2BANA 3AH6A 2E7XA 3OXLA 1SL1A 3CCVS 4C97A 4FBTA 2LEAA 4MAKA 3EGZA 4JV5F 3ZZPA 2N3OA 1X5OA 2BQRA 3K57A 4ZOSA 5KFIA 4PG6A 2QMXA 1EP4A 2L08A 4I0WA 4QU6A 2MDAA 2VQFF 4A4JA 5F8MA 4ZS6A 3EXYA 1RA7A 2MQNA 2NR0A 3KK3A 5B0EA 1FRLA 4E0DA 4EU0A 1S9FA 2CPJA 2NPFA 3DLHA 1NKEA 4C11B 2FJBB 4TY8A 4TU8A 1TP7A 2M52A 5BYRA 3I4HX 2J0WA 2GJ2A 2V94A 4LF4F 2A1BA 4K4ZA 5C25B 2F3JA 1FO1A 2DNZA 4OI2A 4F4XA 3O5TB 5T14A 2E9TA 2G1DA 3CJ3A 3HMJG 1BQMA 2WB1D 1JLAB 1APSA 3CDWA 1W25A 1FD2A 2F8MA 3V81B 4R5PB 4ZPAA 1M5OC 3HHDA 2CPFA 1L3VA 4OZLA 4N56A 1S1TB 3BS9A 3IWLA 2LEBA 4KKOA 3Q0AA 2EFPA 2FVSA 1MWYA 3EGNA 1HBUA 4DQSA 4IH7A 1K9MT 1HNIA 5DG9A 3G6XA 2GHVC 3M2RB 3PO5A 3PJXA 2W9BB 2M7SA 2UV8A 3GILA 2NSCA 4DLEA 3M8QB 1LOUA 4M5DA 2B4UA 4YOEA 3M1VB 4BC9A 1E6YA 1NJZA 1FVSA 1HMVA 2JVOA 1UVMA 5KT4A 1HBOA 2H9ZA 1WACA 2FDNA 5DETA 4LF5F 4ETXA 1V3ZA 4P2SA 1C0UA 2EWHA 5E2QA 1VOMA 1PC4A 2W7AA 3LH2S 1NB7A 1R3NA 2QRRA 1WNEA 2IBKA 3H5YA 3GWCA 2X1BA 1NHVA 5AXLA 2VG7A 3PW5A 1MU2B 4O3NA 2K1RB 3TQ1A 1C0TA 3D1HA 4DL3A 2CVEA 2VBYA 4KHPF 1FXLA 1HQEB 1F5BA 4TY8B 3X3UA 1HW9A 1KOOA 3KNAA 4LVNP 3IN5A 1JXEA 2CFXA 4G1IA 4BBYA 4CQ1A 4ZA1A 2J5AA 2MKIA 2R2TA 4KPYA 5IS2A 3HK2A 5JJBA 1U4BA 5KFNA 4DR5F 1SUQA 5LL6d 2RT3A 5K8MA 3JTNA 3E2EA 2XMJA 1VQOS 5M2PA 3IRXA 4NA3A 1XWLA 3MUVP 3V81A 3MECA 4ZHRB 4ZPWR 2R7SA 4QW8A 3JTOA 5CQGA 1U26A 3MUTP 1SL0A 4ICLA 5E3RA 2IA6A 3IS9B 1C1BB 2DHXA 3CSKA 3PRDA 3OLAA 2YQ3A 4XPEA 3HZGA 1M90T 1KRPA 5I3PA 4FXVA 2C3UA 1OPIA 2JL9A 4D3GA 4KIAA 1H2TZ 1IN0A 1IKXA 1DJ0A 1S9EA 2JOQA 1S1WA 3DRSB 1VJWA 2G9OA 5CXTA 4HI2A 1JLBA 2MHEA 5F3TA 5KT2A 4W90B 2HIQA 3N6LA 1NK8A 5D3GA 1SV5B 4CO1A 2DTJA 2YKAA 3LWLA 2JEFA 2UXBF 3KG4A 5L38A 3CCZA 4Y2CA 3F73A 1FNOA 1S6PA 5D6GA 1TVRB 1X4GA 4O3SA 2BQ3A 4RLEA 2AF6A 4M1KA 2Q6CA 2A3JA 1X4DA 4RUAA 4V19J 5FIIA 2DRBA 3BR9A 5KT3A 3PIPQ 2K1RA 2A18A 3PW7A 2WHOA 5A8WB 1NK7A 2CDQA 5AXNA 2F9DA 2CQ3A 5KFRA 4A8WA 2R7UA 2BYCA 2I38A 1RT3B 1UEVA 2CPXA 3OVBA 2VPXB 2WONB 1Q8IA 1Q16B 2EK1A 3M6VA 1N33F 3CDEA 2M70A 1KFDA 3EPGA 4B9SA 2ZDOA 1U1QA 4KFBA 3GB0A 1LW2A 1X9MA 4IRKA 2RKIB 2BA9A 1SB6A 1KQSR 5KOXA 1YRTA 4NA1A 2COLA 2N4CA 2QO3A 3IRXB 3TVZA 3U1LA 2PEHA 2RILA 5LSLA 1TUVA 1RKJA 5HROA 1FXRA 3GZ7A 3HVTA 1QAYA 3L95X 3J7Z5 1P1TA 3J7YU 1MMLA 1Y5IB 3MM7B 2LKZA 3M8PB 5L1IA 4DR3F 4JYAF 1N8RT 5HP1A 4NLUA 5T7LB 4PR6A 5B09A 2APOA 4KHRA 2YKNA 3MCSA 3H8YA 2R4FA 1IKXB 2HGMA 2HFOA 4OHXA 2ZD1B 2CQCA 5KG1A 3UPFA 2VH7A 4NCAA 1K8AT 3MHYA 1RGVA 5KFHA 4AL5A 2CQPA 4ZP9A 4NXMF 4DR7F 3FFIA 2DNYA 4R0JA 4IH5A 1DTQA 3PM9A 5AE2A 1SV5A 4JOUA 1G6BA 2ILZA 2IM1A 2L9DA 4CO3A 4ELVA 1U25A 4IFVB 4O3PA 3QIPB 4O4GB 4YEAA 3QLHA 4H4OA 5KFVA 1WHXA 4N8OA 4EFAC 5LSRA 4RNMA 1U1KA 1HFEL 5LJ3Y 3FCHA 1DLOB 1RT7B 1X0PA 2DNKA 4FS2A 3BDEA 4NLSA 2DNPA 3TI0A 1N34F 4HL9A 2RRBA 1YRUA 4WFXA 4C3KA 4DR4F 2CPHA 4YY3F 3KNGA 1VFJA 4ECUA 2HNYA 4W92B 1U7LA 1FKPB 4ZP7A 2QA4G 5EDWA 1H98A 3LO3A 4LJMA 3MEGA 3D28A 4IG0A 3GIJA 2IVMA 4ES3A 3FMBA 4KFBB 2QT7A 3BGLA 4RW4A 4QYZJ 3GFYA 2HW3A 4DL6A 2L9WA 3DRPB 3MMBA 4CTAB 2DGTA 4L3NA 1N5YB 1LK5A 4XDCA 4PPDA 2XB2D 4OX6A 1HYSB 1HPZB 1IKWA 3RRKA 4IQXA 3MM6B 5E41A 2MSTA 3NNCA 3POTB 2UXCF 1FRIA 4MJKA 3T5KA 4DL4A 2UVVA 3MM7A 3O8WA 4AL6A 4ECYA 3MM8A 1RT2B 2BUNA 4Q44A 3O2IA 1RTIA 1VI7A 3KLVA 2IA0A 5KFYA 4WU2A 5HP1B 1K0TA 1AROP 5B0GA 2YKNB 3W7BA 4RUHA 2RU3A 3PW0A 5HLFA 1RK8A 2KO1A 1R8PA 2MZ1A 3UQSA 3RBEA 1T7PA 2LMIA 4G6VB 5DS7A 2B9WA 2GQQA 4QCLA 2HMIB 1RI7A 2IM2A 1H0HB 4PUOA 1HBMA 1NJWA 4HH0A 5HQ8A 5GAHI 4G1QB 1HNVA 2KRRA 5EX0A 3R5BA 4DSEA 1TL3A 2J9CA 2BE2A 1SXLA 4CI0B 3IG1B 3LANA 2JWNA 1QUVA 3KK1A 1KOHA 2OMOA 1Q78A 1U6ZA 4RW8A 2YX4A 1T03A 5B0AA 2MXYA 4C8MA 5GAEU 3FZ2A 2JEJA 1KNZA 4B3RF 1JWWA 4OX8A 1N5VA 1XNQF 4K4WA 5DQIA 2RF2B 2IFXA 3MEDB 2VFSA 1HWKA 4EO6A 2IC3A 3IC1A 3N01A 1REVA 2CQ2A 1R8BA 2VPWB 1HA1A 1HL6A 4IFYA 3CPWR 4I7FA 1L3UA 3QZ8A 2IHR1 1NK6A 2ATLA 4RW4B 4X4UA 1RT5B 2NSBA 1TKXA 2MHNA 4LQ9A 3MMBB 1R89A 2E7WA 4DG1A 5F3ZA 3OL8A 3SV3A 1LV5A 1HYSA 4OJ3A 4Q43A 2C28A 4CIOA 2XMVA 4QWEA 3HHKA 3RAMA 1D9FA 2B56A 3HDSA 4LIWA 1NKCA 1RT2A 4NX9A 2VA3A 1VQSA 4YR2A 1BLUA 5L9NA 1OPZA 2D9OA 3DMJB 4R8UB 4ED3A 4QQBA 1RTDB 4DQPA 2KXNB 3DI6A 5H1SV 2M3DA 1S49A 4F67A 1D1UA 5D77A 2KU7A 3MPVA 5HLFB 4ES1A 3AQPA 2F8EX 3WC2A 1D9DA 5KG3A 4DDFA 1NJXA 3OSPA 1UVJA 5B08A 4XAKA 1OO0B 3FRYA 1DTTA 2MZJA 3OL6A 2KFYA 1FESA 1FKOB 5CYMB 2R8KA 5G0RA 2W7PA 1LKZA 4N76A 4OZ5A 1UJ4A 3CTRA 1WF0A 1KHWA 4ZVGA 1DRZA 4DS4A 3RB0A 3LUYA 3Q22A 1CEZA 2X1AA 1ZZNA 4RW8B 5DQGA 1DAXA 1DQAA 1JLCB 2LDYA 2DNOA 3FRZA 2LCWA 3AB4B 6FDRA 1R8CA 2V9WA 3B4DA 4RBUA 1GAOA 2XMMA 4HEA9 1Y9OA 4OLPA 3I4PA 3GIMA 1XBWA 2VBXA 4DQQA 1CPZA 1XMBA 1NJYA 2J6TA 2FD2A 1URRA 4I7FB 1S6UA 4RWXA 4KJIA 4O0IA 4NLXA 3DLGB 4DMZA 4DUYF 1SKWA 1RT5A 3NLCA 4WTYA 3OVSA 1IQTA 3KLFA 2E5IA 1HBNB 2XSJB 3HF5A 2B4OA 4DG1B 3FEYB 1AFIA 3B8HA 3IAS9 4IO9Q 1HNXF 3ENWA 4IOCQ 2W8KA 4NPOA 1F60B 1X4CA 2D74B 1C4AA 1ZBTA 2MMYA 4I6WA 4C2MA 3TAPA 2NYIA 2IAJA 3W3SA 4NWBA 1JLFB 1IKVB 1VC0A 1LWCB 3DMJA 3OHAA 3GR0A 2DCUB 4AYBD 2RS8A 3MMCB 4RZRA 2L41A 3BREA 5LXYA 2EG1A 2XCAA 3JSRA 2XC9A 5D78A 1LFWA 1RTHB 3G8TA 3MOJB 4FXDA 2DR8A 2DH7A 1SKRA 1F9FA 4EUVA 2R7VA 5E5NA 1B7FA 3UNGC 5F8JA 2ZBCA 2XI2A 4MKAA 2QEXS 2BM1A 4JBCA 2W8LA 4OI4A 5A8RA 5U47A 1R43A 2CRLA 2ZKTA 4JI3F 5A2QY 2QE5A 4X4OA 4QIVA 1S10A 4CCHA 1ZTTA 1FRJA 4DFPA 2JDJA 5ITHA 5C24B 3PV8A 3OPKA 3DLLQ 5GAHU 2UV8G 4LF6F 4KHMA 2LXFA 2HVZA 1KLNA 1JMTA 1Q79A 3OLBA 4HYKA 3KK2A 2B9XA 3FNNA 2W4DA 4X66F 1LW0A 4XO0A 4DFMA 4MKBA 2PA3A 4WFZA 5KFJA 4MIWA 2RD5C 1NK5A 2HVIA 5GAGI 3H2UB 1KC8T 1X8DA 3V4IA 4ZPTR 3GE9A 5HO4A 4QWAA 3CC7S 1KN6A 4KV8B 1LQ9A 5KG4A 5SZTA 1T3NA 2Q3PA 1HW8A 2KYZA 3SZ2A 4X4VA 1ZAVA 5KT6A 2RJZA 3HO1A 3UFCX 2Y0SD 5DLGA 1U45A 1Z2ZA 1U48A 5DG8A 3PY8A 3M8RA 1JLFA 1VBYA 2DNNA 4IG3A 2O66A 3EX7B 4A8KA 1GTHA 2J7UA 2RB7A 4C8YA 3VF0B 2ZITA 4OMFG 3OUYA 3OR1B 4I1TA 4ZPBA 4R5PA 4ELUA 2MYFA 1MW7A 3Q8SB 1RISA 2VPYB 1YG0A 2YNIB 3RBDA 4NXNF 3V2UC 2HQIA 4I6YA 4A8QA 5KFWA 1S1TA 2HFNA 5KFDA 2P6TA 2VB6A 1GXTA 4K2XA 2BACA 1TV6A 4B9MA 1LFPA 3LOUA 1HNIB 1FE4A 4U7UK 4C98A 4WFAQ 4GC6A 5DDOC 1U1PA 5F8NA 1S77D 1H6KX 2AGPA 3T1AA 1NEEA 4M5DB 2Y1RI 1S1VB 4B3SF 4C8ZA 2VZ9A 1E6YB 4YFUA 3HT3A 4M95A 1HMVB 3KK2B 3FJ2A 1TL4A 1LXNA 3HHLA 3PHEA 2OPQB 4AQYF 2AP6A 3JSMB 2O3DA 1UKUA 5FDLB 3O6QA 1C0UB 2OD6A 3L7OA 3ITHA 1J5EF 3ZZTA 2I2YA 4NLDA 2C2RA 3NNAA 3NBPB 2R9LA 3TX8A 2GNKA 1JJHA 1FJ7A 1VQ8S 2FJXA 1WEZA 5M2UA 3G71S 3V4IB 1M5KC 2DO4A 2OO4A 4HI1A 2PA8D 1TKTB 3IFEA 2AW0A 4BWJA 1JLGB 3S6EA 4LFCF 2RVJA 2XNQA 4KGKA 2I5JA 1Z2LA 3KG0A 4PRFA 1UW4A 1A6LA 1Y7PA 1IM4A 5B0CA 4OQJA 4LSLB 2EC0A 4DBQA 3I5CA 2ROGA 2QV6A 4RU9A 2EPIA 4RW6B 3Q23A 3EXCX 3ULHA 1VBXA 1OQ3A 5B0BA 5DQHA