2XMVA

Copper chaperone atx1 from synechocystis pcc6803 (cu1, trimeric form, his61tyr mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
b'TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGYEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSR2857 PROTEIN
publication title Visualizing the Metal-Binding Versatility of Copper Trafficking Sites .
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Chaperone
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xmvA00
4F67A 3HX9A 3WDOA 5K9FA 1YRXA 1CC7A 2ACYA 2JDJA 2LDIA 1VQYA 2XMJA 5B0GA 3TOQA 1JWWA 5F0UA 1YJUA 1N5TA 1FVQA 2RMLA 1R6YA 1SB6A 1CPZA 3FMBA 1OSDA 2VH7A 3BB5A 1OQ3A 3BGUA 3DCAA 3HHLC 1Y3JA 1KVIA 4DPOA 1RJJA 1S6OA 2K1RA 2RSQA 3GZ7A 3QGPA 2IFXA 1GXTA 4A47A 1V3ZA 2ROPA 1KVJA 1MWYA 3IWXA 1S6UA 1YJRA 2K1RB 1Q8LA 2AJ0A 2KKHA 2PD1A 3BN7A 3DXSX 3IWLA 3MCSA 3T9NA 2ROGA 3TNVA 3E8OA 1URRA 1X0PA 2BUNA 5B0EA 4DN9A 4EFAC 1OQ6A 1MWZA 4DL0C 2PGCA 2ZDOA 3K7RA 2W4PA 5IXUA 3UDCA 1X8DA 2G9OA 2OD4A 1Y3KA 2VV5A 4HH1A 4U9RA 2RU9A 3FGVA 1TR0A 2LQ9A 2OMOA 3BR8A 3VTIA 2OAUA 5B08A 2N4CA 2EW9A 5B09A 5B0DA 1OPZA 3HDSA 1K0VA 2GGPA 2GO8A 4Y2MA 5B0AA 1TUVA 2GCFA 1ULRA 4YDXA 1FE4A 1U7LA 4A46A 2K7JA 2KT3A 1Y9OA 4A4JA 4HL9A 2GGPB 2ASYA 1TL5A 1Y0HA 2HLUA 2XMMA 1JK9B 1FESA 2FTRA 2XMKA 2FB0A 1P6TA 2HLTA 4Y2KA 4ZA1A 4HI1A 1VQSA 4ZOSA 2ZDPA 2HIQA 3HF5A 5F0WA 2BJDA 3HHLA 4OJ1A 2N4DA 2OFHX 2BYCA 3FRYA 3HHLD 1TL4A 1N5QA 1QUPA 4FNIA 1FEEA 1YJVA 2QYCA 2CRLA 4YEAA 2HQIA 5T7LA 2W4DA 2FIUA 3KKFA 4OJ3A 3TRGA 4A48A 3HHLB 4NPOA 3QMQA 1TZ0A 2FHMA 4OJHA 1Q8BA 1N5SA 2XMUA 4OJGA 4Q2MA 3BF4A 2AW0A 2QLWA 1P8GA 1FD8A 1N5VA 2HFOA 5T7LB 3KG1A 2GA7A 2XMTA 1LQ9A 1SQEA 2GV1A 2OFGX 3F44A 1SI9A 2K2PA 2K7KA 2KT2A 2L3MA 1FE0A 2LQBA 4HI2A 1CC8A 1GXUA 1YJTA 3BM7A 4FNHA 1KQKA 3BDEA 2IYIA 3LO3A 1Q53A 2Q3PA 4Q2LA 2BBEA 4QOTA 3KNGA 4OIXA 5KAKA 2HFNA 2N7YA 1W2IA 2OKQA 3LGMA 2IYGA 2OP5A 3KG0A 2QLXA 3CJKA 2GFFA 5A6PA 1IUJA 5B0BA 4Y2IA 1XBWA 2ROEA 3HFKA 2LXFA 2XMVA 2QIFA 1AW0A 2AJ1A 2W4CA 1Q4RA 1FVSA 5B0CA 2XMWA 3I9ZA 1YG0A 4HH0A 3CJKB 1AFJA 2AP6A 3LGNA 2KYZA 2OD6A 2RILA 5A6WA 4NL5A 1AFIA 2BJEA 3MZIA 1APSA 1WD6A 1X7VA 5B0FA
chains in the Genus database with same CATH superfamily
4B3SF 1VDHA 1TKXB 1Q8IA 3BB5A 3I31A 4FKYA 3GIIA 1CJKB 3BN7A 4OL8A 2F40A 3KK2A 2B4OA 3IRWP 5HBMB 1CQMA 1K44A 2MY7A 2VL1A 2VJVA 2BX6A 1XC9A 2OO4A 3OHAA 4O23A 3M32A 5A8KB 3I56S 3HKWA 4OMFG 4DV3F 1QAYA 1RTHA 1PBAA 3SMZA 2YH1A 2ZH9A 3IWNC 3IAM9 2J9EA 1KLMB 2DEIA 3FBBA 3NXZA 4XK8C 3LF0A 1NPKA 3PY8A 3AOCA 2VQEJ 4G3IA 5D4LA 3U1LA 2XZTB 3N9UC 2KT2A 2EPIA 2RHQB 2W2OP 2E44A 3DMJB 5A76A 1FX4A 2IYGA 2BANB 1P1TA 2HNYA 3UPFA 3HFKA 5DZ7A 4Y3CA 3Q2SC 3DOKB 2D41A 1EZZB 3GSDA 1QAXA 3D1OA 2BJ7A 4K8RA 5F8HA 1KS2A 1YHQS 4JV2A 3Q22A 3D7SB 1WTFA 1H7WA 1T3NA 3LW5C 2X51A 1KD1T 4DPWA 2YTCA 4A47A 2UVWA 4ANEA 4ICLA 5EX0A 1CLFA 3HSGA 1FWPA 1UW9A 4PXEA 1HBOA 4YB5A 3L95X 3N0VA 3D0GE 4MAKA 4LF7J 1NU4A 4Q0BB 3SCKE 2ZH8A 2BRLA 3MUTP 1GX5A 1EX8A 1PJ7A 1CJVB 1L3SA 1R8AA 2FDNA 2J8SA 4H4KA 1VQ8S 4MMOA 2B7CB 1TMJA 4H4OB 4Y00A 1T03A 2AD9A 1WNEA 2FIUA 3AJ1A 1NK0A 3O44A 4RW8A 2RT3A 5KOXA 2Z0GA 1TKDA 5DDQC 4DR5F 3MCNA 3AOAA 2BBEA 3HMJG 2BJ1A 1RHQB 5CYMB 1FEHA 3NP5A 2E1CA 2DEJA 4I6YA 4I6AA 5I42A 4MK8A 4Y2IA 4JI1F 1WTBA 4NXNJ 3FBCA 3SEOA 3CIMA 3CCWA 4ZCKA 3D0HE 1JLCB 2M4MA 4PWWA 1OY9A 3VAFA 5ADZA 4ECZA 4CLLA 3MMBB 5ETVA 2YKPA 1SJRA 2XHWA 2H3EB 3DXSX 5EUHA 2V8VA 1TV6B 2J7KA 4USHA 4ZS6A 3GFZA 3CJTA 4LFAJ 3MTKA 1HNIA 2HZVA 3H59A 1VC6A 2MHEA 4YR0A 4PQUB 2IBOA 5SZTA 2C3UA 3KXDA 3HHDA 5GADI 2Z56B 3R97A 2CG8A 3CJ4A 2H5IB 3SQOP 4IOCQ 3BN4A 4R0EA 2BXJA 4JI3F 4NPOA 5L39A 4JI7J 1M1HA 3C6UA 2MQNA 5AE2A 2BJ8A 2IM3A 3ZXWA 2VA3A 2ZH7A 1BC6A 4EYIB 3FFIA 4FXVA 3UFCX 2R7XA 5A8WB 4ZLJA 4TY8A 3W9IA 1JJ4A 4WE1B 3OSNA 3T6JA 3M6VA 3NL0A 1NSKL 5L1LA 2CIMA 1HWIA 1YJUA 2DH8A 5JVGQ 1S77D 4I2PB 1RLDA 2GHVC 4X66J 2VH7A 1YBTA 2RE1A 2CPEA 5H9EJ 4O44B 2ZZNA 2XI2A 1ZH5A 3IA0A 3QO9A 1T9XA 3PFOA 4GO5X 2NREA 2E7XA 1JJHA 2G0CA 5E2QA 5AE1A 5B08A 5B09A 3C6TB 4NXMF 3PTWA 4K0KJ 5KT7A 3KLGA 4ED0A 4ZVFA 4J7CA 2XMMA 2L9WA 2YWEA 1DQ8A 4UW2A 5DRKA 2CPJA 4ZVEA 4KHPF 3CULA 2H4WB 3BO2A 5A8RA 1GTEA 4FDFA 4X2BA 1KC8T 2M0GB 2FZKB 3BF4A 3PYFA 2JLFA 1SQEA 2GV1A 3W8GA 1TL3B 2RJZA 5F8NA 1FKAF 4C48A 3BQ0A 4OLPA 3W60A 2YKMB 3LALA 2EK6A 5CHCB 5JUMA 4K4YA 2W4CA 2Y3YA 2OD6A 2VC1A 3W5ZA 3EVWA 2KT5A 2YPZA 4U96A 3PRVA 5IC4B 5IT0A 4DPYA 1RT2A 2XZDB 3HSJA 1X9SA 4LR7A 1EETA 1JLQB 4J9QA 2KRRA 5F9NA 4DOZA 1F2GA 4M8LA 2Y1RI 2KKHA 4K5RA 3H5UA 4WIQA 2WCXA 1XK8A 3C14A 2MSTA 1RWWB 3HVTB 2M5YA 3PO4A 4IR1A 4M5DA 4DR6J 1NK4A 1HNVA 3NGSA 4CQ1A 3M2RA 2LKZA 2KJWA 2BM0A 1S49A 4HL9A 5DJBA 1OJ4A 3PVXA 4F2RA 2YQ1A 4MIAA 3QRRA 1UWAA 4X65F 2CQ2A 1YRUA 4ZJQA 1HNZJ 3G2XA 1IWGA 2FVRA 2J76E 2YQ3A 2M7SA 3MM6A 2IRUA 1FJGF 3THPA 4DV2F 2FC8A 1IM4A 3K89A 1RABB 3D6FB 4DR4J 4DPXA 5AJ3J 3GV7B 4O4GB 1BE4A 4IG3B 4AT1B 2BJEA 4JI6J 3KK3A 2BVZA 2KHCA 4WCEQ 3G87A 4C3MA 4AQYF 3T41A 1RJJA 1X0FA 1U1PA 3TJ8A 5IFMA 1LFPA 2CZ9A 1NZAA 1HFEL 4KHRA 2RF2A 4F02A 4MFBA 5K14A 4HLBA 3CO9A 4A8SA 2KT3A 1IBMJ 1RKIA 1M5SA 2Z8QA 4JI2F 3FMWA 4RNFA 1ZBTA 3HD1A 1X5SA 3GQCA 1F5AA 4FS1A 1MLAA 5GAEU 1RTDB 3IG1B 2R7SA 5D0GA 3UCGA 2DNHA 1KQFB 2WW8A 2O67A 5LSRA 1MMNA 1H0HB 5JVHQ 2R42A 5HROA 2E5GA 5HP1B 4I2QB 4NOHA 3HSZA 3V6DB 4M5JA 3MCOA 2Y8WA 3LP1A 3BGLA 1HR0F 3IXQA 2CJKA 4DSFA 5L38A 4WK3A 3ENVA 4L75A 4TXSA 1S76D 2AJ0A 3NNCA 1Q16B 2VQFJ 2ZFHA 1U1QA 2GQ2A 3QAUA 5AXMA 5BJRA 2GIFA 3QLHB 2A18A 3M7VA 4P75A 2ZDPA 1NHKL 4PG4A 3MD3A 5F9LA 1EP4A 4QCLA 1YVFA 2CZ4A 5IT4A 2HBQB 5KFLA 1RT7B 2V34A 5KG3A 2MSSA 2CNLB 4KB7A 3VQTA 2DNYA 1IKYA 2DGTA 3P8BB 2JH3A 2V68A 3QWUA 4OHZA 3DDNA 3B54A 1LW2B 2KN4A 1JLGA 2NR0A 3BREA 1W25A 2ACYA 5B0GA 1MG7A 2VBXA 4X4QA 2VPWB 3PR5B 5C24A 1G2EA 4C0BA 3BJYA 1VQNS 2ILZA 3DCAA 6FDRA 4F50A 2HFSA 2YQ0A 2V0NA 3AQPA 1S6QB 1LWCB 1IQZA 4LF9J 1T9UA 2UXBF 1X0PA 1S7IA 1P9QC 3I4PA 2MTLA 3LPYA 1CBKA 1DZ5A 4CM0A 2V2KA 1U48A 1SKSA 1FE4A 3PYGA 2FUG9 2V94A 2ILYA 3IGVA 3HP6A 3ZC4A 1N0UA 5K8OA 2BV3A 4NLWA 3S01A 5C25A 2XYPB 3Q24A 2MEWA 4J37A 3CC7S 4LIWA 3KG0A 1VBKA 1EARA 1FDBA 4ZVGA 2HBRB 2QL7B 3MGJA 1FRIA 2FHOB 4USMA 2LDIA 4A8KA 1JIHA 5ETSA 1WOOA 2RMLA 3OPKA 3RAMA 1CG2A 1FX2A 3OJUA 2VQEF 1FWLA 1ITPA 1C0UB 2PIIA 3NGRA 4WP8A 2HQDA 2VIHA 2MLYA 3KNAA 3H25A 5IQ6A 1OYDA 3O8WA 2KVQE 2IDEA 3D67A 1BY9A 3WBZA 4C8YA 4YOEA 2ASLA 3I0SA 3IS9A 4NASA 4PKDB 1VQPS 2EI5A 5EHHA 3R7NB 1YJ9S 2JVOA 1WHXA 1N52B 2J8AA 2B6AB 2GZOA 3V5RA 1S0MA 4L6V3 4OZNA 2R8IA 3VAJA 4ELUA 4ZPDA 4LR8A 1KQKA 1QTNB 1RT1B 1GMWD 1LNQA 1WEZA 3CO0P 3KHRA 2QA4G 4OX7A 5HVFA 2FJBB 4F4ZA 3CCJS 4J9VA 3VGUA 4KE5A 4CNZA 3B8HA 4LF7F 1MROA 3J7AN 5DZ6A 3GU0A 3TQ1A 3TP2A 1PO6A 3E01A 4EO8A 1MU2A 2E7VA 3NGTA 5LMUF 2BABA 3N5FA 2DHAA 3MPYA 4KV8A 3W66A 2RAQA 3GFYA 3PW0A 2BUNA 3FC9A 5KG0A 3RB6A 3NS5A 3MEGB 1OO0B 1I5OB 1FFWB 5HN0A 2HSEB 3DLGA 4ZPBA 4Z2XA 3PIOQ 1HL6A 4NXNF 2YXLA 4OYXA 1V5IB 3DC2A 4QPTA 3UDLA 3PDNA 3QT8A 2WONA 3V6HA 4KO0A 3DI6A 3ZNUA 3SCLE 5IV4A 2J0SD 4GO7X 2MLXA 2CJXB 1TK0A 3ENAA 3A12A 5KTQA 1SH2A 1RDRA 2JSXA 2LQBA 1GT8A 4DLEA 4RX6A 5E0OA 3HLUA 3CCTA 2NXJA 4LFAF 4FKXA 3ULHA 5HK4A 2J0QD 2YPYA 4H4MA 5KT5A 4IDKA 3TZYA 3O2IA 1SB6A 2QFIA 1RWUA 1GK8A 4ZVOB 2ADBA 3WZ0A 5K5MA 1VC5A 4WXWA 4JI7F 3MEDA 3KMSA 3G6VA 3D1HA 3RBDA 1NLKL 1DTQB 5DS7A 3B78A 3ETMA 1FRMA 1HI1A 2OTJS 2WOMA 3QT5A 1VQ6S 2KG1A 2LMIA 3DLJA 1BXNA 3LQVA 2XCPA 3TANA 3OL7A 1ZAXA 3A8EA 1NEEA 1S1TB 3DRSB 3EZUA 4OZ3A 2NS1B 4W98A 4X66F 4JOUA 1IR2A 1TMMA 1O8BA 4ALZA 2KB2A 4MKYA 1ZPVA 3CMES 4RPFA 2PC6A 3CMAS 2HGLA 1SL1A 4UUWA 2KL8A 4DV0F 4O0NA 1E6VA 2DNLA 1S1WA 1R6YA 3A13A 4RBVA 4DUZJ 3PM9A 4DPOA 3VVUA 4RL1A 2D3UA 5I4MA 5RUBA 1TKTB 3NGUA 1RTIB 3BPSP 2RQKA 5GMKa 1LK7A 4U9RA 1IXKA 4PWUA 1VJQA 4BHQA 2G2ZA 1CULB 1OYEA 2BW2A 3DN9A 2GHWA 5GAGU 3TAPA 4BCAA 4AFFA 1VQSA 2H1YA 2IC3A 3DLEA 4WZQA 3POTA 3OVSA 1F1BB 2AEMA 2UUTA 2KXHA 1CVJA 2VG7B 4K4SA 4TQRA 4JV1A 4B3RF 2C22A 1MSWD 1YI2S 4J9RA 2JNJA 5DO2A 2WVDA 1TUWA 4W90B 4K2XA 2F1FA 4DR6F 3PYEA 1S0OA 4A8YA 4CLYA 3P5TL 1WUUA 3UQSA 4UZCA 2YNIA 1KN6A 1X5OA 2JDJA 5LMNJ 2YNGB 3HZGA 1KBRA 1FVQA 4JI0J 2ZE2A 1IN0A 1KVIA 3BGUA 1X5PA 1J5OA 4ECVA 1RZMA 1HMVA 1HNZF 1XEZA 2HHPA 2PA8D 4UQGA 3T1HJ 3KG4A 1SUQB 3RB4A 4MK7A 4DR4F 5AJ3F 4O3PA 3PXGa 4GC7A 3A4TA 2LP4A 4ZOSA 3C6UB 2ZHBA 2DR6A 5GMEA 4DZDA 3W7BA 1Z2ZA 4QBUA 1HKAA 4M5HA 2HWHA 2LECA 1WSRA 5EX3A 2GJFA 2X3DA 3TEHB 5KFTA 5KT2A 3KLIB 1UJ4A 2WVBA 4MKAA 4USTA 1VS3A 2W24A 2YWHA 1F9HA 1JLFA 2YKNA 2VDIA 3I82A 2U2FA 1MMLA 2OUGA 2MKHA 2WBMA 4F0MA 1DTTA 2KJVA 2B56A 1ZPWX 1N88A 2OPPA 1N4LA 1PJ6A 1IBMF 3HZEA 2W1BA 1ZAVA 2CNKB 2Q1LA 2K1RA 4X4SA 2Z2MA 3CCLS 3ENWA 1XR7A 1K9MT 1Q78A 4CNYA 2VONA 4NCAA 1NDCA 1FA0A 1UEVA 1REGX 3RB0A 4RNOA 1VRQC 2I5JA 2VF3A 8AT1B 2B4VA 2XULA 4QZVB 5A8RB 3NMRA 2VHGA 2LFVA 1WACA 4B3OB 3MMJA 2J7WA 1UVLA 3HULA 3GPAA 1ZM3A 2HQIA 5IS2A 3MM8A 1YKWA 3BPDA 1GTHA 4OJGA 1HARA 5FIIA 4EEYA 1RYSA 2OSRA 1FD8A 1HNWF 4N47A 4R8UB 3MR5A 4ZCLA 5LJ3Y 2D3OR 1FT8A 3JS9A 1OPIA 3H4BA 3AJ2A 1RT5A 2VQFF 2G0IA 2JFKA 4LVOP 3CUNA 3FEZA 1N6QB 3BV8A 2XMVA 2PN6A 3AD7C 2AP6A 2DGUA 2DIUA 3HX9A 4NLRA 1R8PA 3LANA 2DYAA 3L09A 4K2JA 1IJEB 3UI3A 1ZS6A 5IOLA 1BD6A 4ETXA 3M2RB 4F0KA 4DR3F 2R7QA 4TLQA 3M8QB 1ZM9A 1FXLA 4QWEA 2W4PA 1D9AA 1TK5A 1RU1A 3NOGA 1V9OA 3RTVA 2GCFA 1AZSB 4LSLB 5BXIA 1FK9B 1UKUA 2HNZA 3DOLA 2CPHA 3MMCB 1N34F 1NDPA 1KFDA 2L9DA 5D4NA 4ZVTB 1SXLA 1M5PC 2HG4A 4UZBA 4EBDA 2ZOFA 5GADU 4OYZA 1T7PA 5DM7Q 4KGXB 4QYRA 3BSOA 3TYTA 1NXIA 4HKQA 4QWAA 2DXFA 4Y2AA 3GSIA 2WSFC 1WI8A 4LF9F 3RG6A 4FZVA 1RE1B 3TAQA 4KFBB 3C15B 2BKPA 5E3AA 2LXFA 4JBCA 3ZTRA 3GG0A 2EXUA 1JWWA 4M63A 1OSCA 4USWA 1FXRA 1GAOA 1RAAB 5D15A 2RS8A 4OYAA 3MMAA 4OV6A 4ZJLA 5M2PA 2M2BA 3E8OA 3UDVA 3HSDA 3TO8A 2VASA 1RU2A 5T14A 2XLKA 2PSZA 4YHHJ 2W2PP 4UTGA 1T05A 1RWOB 5IM0A 1EJ7L 1HIYA 1QDUB 3FEYB 5KT3A 1FTCA 4OLOA 3GFHA 2QN6B 1X4CA 2R7WA 1R0AA 1C1CA 1QE1A 3HF5A 2BJDA 2AJFE 3TEGA 4E98A 3VGTA 3B4MA 3N4WA 3TRGA 3LWLA 1T95A 4PXDA 4UOGA 2BOPA 2DGQA 1RTJB 1F5BA 1LQ9A 4HI2A 1SPBP 3SQGA 1RQ0A 1WKKA 2P2CB 4U95A 4DSEA 2OI2A 4KQZA 2MKKA 3M1VA 1XMQF 1U4BA 3MZIA 1GMUA 1NK8A 2Q66A 1N5TA 5I3PA 3N5BA 4P52A 4C2MA 3IBFB 1XR5A 1CS4B 2Z58B 1QM9A 1Y5LB 2RH3A 3MCSA 2NPFA 5EGYA 5B0EA 2HAFA 2B4PA 5KFDA 3M2VB 1YZ6A 3T1AA 2EEYA 3M9NB 4U8VA 1T94A 3QBCA 3L3CA 2UUCF 9RUBA 4WYLA 1JKHA 2J9DA 4B9TA 3S7RA 1QLNA 2HZAA 1EP4B 2NXNA 1WDTA 4DQQA 1N32J 5KFSA 2B5JB 2OPQA 3T5LA 2AYEA 4PG5A 3G9CA 1P9YA 1CJTB 3R8YA 1RBLA 3PJWA 4A8FA 2ZD1B 2V8DA 1WG1A 3ILOA 2AGQA 2KO1A 1GX6A 2C2MB 5DQGA 2IYIA 4P2FA 3LO3A 9ATCB 2ZOGA 3VVTA 2DD8S 2JLGA 2Z2YB 4ZP6A 4WTYA 1FKPB 3V2UC 5A6PA 4PXBA 4IRCA 1YX2A 2XYHB 1RHRB 1TKXA 2MJNA 5D0EA 2CQ0A 2Z30B 1VQYA 3NWRA 2LYVA 3FBEA 2HEKA 1VBXA 3R5DA 2V8GA 2M9KA 4OZ1A 1CJKA 2UUBF 1TP7A 3W1YC 3O6QA 4CO4A 5E41A 2V4JB 2PD1A 1A9NB 2OEMA 2HRUA 5KFJA 4YR3A 1FKOA 5HBMA 1O6XA 3MXHP 4KTQA 1X8DA 1DY3A 1YGYA 2HQCA 3V6JA 2AKWB 4IH6A 2FY8A 4P7VA 5KFEA 1R27B 1WEYA 5A8KA 3IM9A 1X9WA 5C25B 4ECYA 3GCWP 1FCAA 3WIUA 1KLMA 4K4XA 3LA0A 3I32A 2RDDA 4DFPA 1GMVA 4A8XA 4PG8A 4ZHRB 4EO6A 2CJYB 2VOPA 2XQCA 3BYPA 4OHVA 3DMJA 4OX9F 3UE2A 5LM7E 3QSYB 3M8WA 1NJXA 1W2IA 3EICA 4YB6A 1J5EJ 3DOKA 1YBUA 3OR1B 1GH8A 5CYQB 3J81Y 1EQ0A 3C19A 3JSBA 1B99A 2NZCA 2BEFA 4HACB 1NSPA 1YRXA 2W25A 1WHWA 1PYTA 1CJUB 5KFRA 4ZVSB 2Q79A 4DXLA 5ITHA 2ROPA 3PEHA 1NJZA 2JZ5A 1SJ4P 5AXLA 3KLVA 4ZLLA 4DL0C 1LXJA 4F3MA 3H98A 2OMOA 4Q0BA 3BYRA 5DG8A 4L74A 1HYSB 3MM9A 2FY1A 4UOCA 3J7ZT 1G7CB 1CJVA 3P49B 3PR4A 1QVFR 4H4OA 4DS4A 3WQPA 1TAUA 3HHLD 2YKQA 1M5OC 1WWHA 5J1PA 4DUZF 2F63A 2OGUA 4DUYJ 4BC9A 3JYTB 2QV6A 3PZPA 4I7FB 2ZH1A 5GVQA 5CYMA 5D77A 2UUWA 2DHGA 1RA7A 2MQ8A 5C2CA 2N7YA 4HT7A 3R5BA 1B3TA 1U45A 1HBUA 5IC6B 1FERA 2VG5B 3R9LA 1JLCA 2MPUA 3E3XA 4KV8B 1U1KA 3MMBA 5C42B 2FVSA 3OXFA 2V50A 2D3ZA 4URGA 7AT1B 1EKRA 1TV6A 2BE2B 1U6BA 3ISZA 3AH6A 4EZ6A 3T9NA 1N56A 4ZPWR 4B3SJ 2CQBA 4KKOB 3Q89A 4B3TF 4PQUA 2PFDA 2IPOB 2C3PA 1F5CA 3HM9A 4KC5A 2DNQA 1PIEA 1QTMA 4DS5A 4LFCJ 4LVNP 5HO4A 5ETQA 1H3DA 1R43A 3GR0A 5M2RA 4XDDA 1S72S 4MJKA 2NZ4A 4JI0F 2E1MC 4K4TA 2UVVA 3T1YJ 1PGZA 2HVEA 2HGMA 2P9GA 3VAMA 3T1HF 1UL3A 2PFFB 5KOWA 4QOTA 5A8WA 3OBIA 5J1EB 2V8PA 4WE1A 3ILIA 2ZUGA 4QR2A 4I64A 3R27A 1B7YB 4L3NA 1L3TA 3EM1A 3OL8A 4KHMA 4UT4A 4I2PA 2RVJA 4DX7A 4F04B 4DF4A 1UJ6A 4O44A 2I1RA 3CXCR 1D09B 3TVZA 2PMHA 4X4OA 2DT9A 5B7WA 4DSLA 2J5AA 1K1QA 3UD4P 1AROP 4MIBA 3WC2A 2DHXA 2ZEJA 3ITHB 1NAQA 3DKDA 3OFGA 3P45B 3UDCA 3C6TA 1U1LA 1U0SA 4ZPTR 3THVA 3MR7A 3R5AA 4RUCA 3BR8A 1F9EB 3W2WB 1WI6A 4B9MA 2PI5A 3DLLQ 2J0WA 1S9EB 3KLHB 2FB0A 4QIGA 4ID5B 1NSQA 4DBQA 4Q5VA 3B6BA 2QLJB 2IY5B 1IWAA 3NKYA 3OTEA 1P1LA 2YX7A 1IVZA 1VQ9S 1TL3A 2JOQA 2MMYA 4DCJB 2DR7A 2YKMA 2M52A 1TL1B 4TU7A 1E6VB 3NNHA 4CH7A 4ED4A 4P73A 4YS2A 2QE5A 3CJ5A 4DX5A 3MECB 3RR8A 4P74A 4QW9A 1FVSA 5KG5A 2MY8A 3LPEA 3CJSA 1S4FA 2AF6A 1AFIA 3CPWR 3QT7A 4DR5J 4ATNA 3MAQA 2V8HA 1JLQA 5DM6Q 4G6VB 3KUGA 1S6OA 4V19X 2KI2A 1PC5A 2XCAA 3NEKA 4AYBD 2F7VA 5D0RA 4K7QA 2CDQA 2OAUA 2IBKA 2EW9A 1JXEA 1KOOA 4USKA 1YLXA 5J2NB 3BKUA 3PIPQ 3NAIA 2OJ3A 2E9TA 3CCZA 2Z4PA 3MEEB 2CQGA 5KFUA 2DNMA 2AX1A 2C2DA 1RAJA 1NHVA 4J9UE 3HJFA 1TL7B 1B4SA 1MWQA 2DH7A 2HFUA 4Y0FA 2E5LF 4ZMMA 4WTOB 5HQMA 1K47A 3MHYA 1NJIT 4IG3A 3MAAB 1NNDA 3L7PA 2E5HA 3M8PA 4EI2A 1G3OA 2DO4A 2EG2A 2R8JA 2R7OA 2J9CA 2HHSA 2GMHA 1Q0NA 2YH0A 4Q8EA 4J91A 1FI4A 5KFKA 3EUNA 3AT1B 3F56A 4OI3A 2MJUA 3LGHA 4CLKA 2FZGB 3PX0A 4FVMA 3TARA 3OUYB 2BKNA 2ERRA 3UWTA 1XJWB 3SDEB 3LTOA 2VG6A 5JJBA 1TKZB 5AE3A 2DY1A 4O3QA 4AD6A 4DV6J 3GIMA 1GNKA 4DSKA 5F8LA 3FQLA 1H73A 2WK4A 3QFWA 4C98A 1RTDA 3IG1A 4BDPA 2ZBCA 2DPIA 3RYLA 1O51A 1PSDA 4ITSA 2GO9A 4RW4B 3TJAA 4CWBA 1MN7A 4CT8A 3KNGA 1M1KT 3W65A 4CO0A 4YHHF 4P2MA 1S59A 1FRKA 2G13A 3VAGA 4I2QA 1CEZA 1RYRA 3V6DA 1SJ3P 1YG0A 1KSPA 2C3YA 3D68A 1U2RA 1UVJA 2JC0A 3MFHA 1ZA1B 2QJ3A 2ZVIA 3K2YA 4JP8A 1YTYA 2KM8B 4CLTA 3ZZ0A 4C9DA 3IWLA 3KTQA 1HQUB 3FQKA 3MM7B 1WF1A 3FSIA 1Q79A 1X4HA 2O01C 2J7UA 2BMBA 3QLHA 2GW8A 3C16B 2UV8A 1TL5A 2DXEA 2R8KA 1RT6B 3M9MB 1NBEB 3KHHA 3DRRB 2D74B 2KM8C 1RT7A 1EIYB 3IMQJ 4J9MA 4DQPA 4UY8T 2W7PA 4M5GA 2HHTA 3H7HB 4CZCA 2HHXA 1SIWB 1LW2A 3ZZPA 4CTAB 3SFUA 3CD0A 4Z7YA 3NGKA 2J6SA 1VI7A 1N32F 4PUOB 3GMGA 1NHUA 4KGMA 5T41A 1S6QA 1LWCA 2H4YB 4AL5A 4USJC 3DU6A 4WFAQ 5G4DA 5L46A 3EVMA 3W5YA 3RUBL 5KG1A 1WC5A 3NCRA 1XNQF 2B43A 3AAWB 5LSOA 4KT0C 3F41A 5I3QA 4DR2J 4FYWB 4XO0A 5DLGA 2HVZA 2O5DA 3UR0A 3W62A 5IV3A 2I38A 3PW7A 3PRBA 2OEKA 5ETTA 4RR5A 3PHTA 4CDIA 1SJ1A 1FE0A 2M88A 1FWKA 2HHWA 3VAKA 2Y0BB 4C0HA 1HQ2A 1UJ5A 5ETMA 1XR6A 4KAIA 2KTQA 4CLWA 3A3PB 2AEFA 5HVGA 4U67Q 4G1QB 2B0GA 3DGPB 4CYUB 4WKRA 4V1Ak 2KH9A 3RRHA 1C0UA 2FJVA 2J9DE 4QJVA 3FJ2A 5E7OB 1UTAA 4N8OA 4J90A 4RNHA 4WZMA 4K50A 1WEXA 2AU0A 1WG4A 1X4AA 3AA8A 1CSJA 1D1UA 5KFYA 3VV2B 1J5EF 4TQSA 3HFZB 2LCWA 1U1OA 4ZVRB 1SBRA 2DRBA 4DPTA 4DCPB 4YP3A 2B6AA 4BS2A 1X60A 5HQ8A 4WYWA 1VBZA 1MW7A 2FJDB 4ZVPB 4N5SA 1TZ0A 2EBGA 4Q2MA 2QLWA 5H9FK 1K8AT 2V63A 1SV5B 4LBPA 4IOBA 4C8MA 3LH2S 3U1MA 5C5JA 1DAXA 2RUGA 3BQ1A 2F4FA 2OP5A 2QA1A 3OTBA 2DXDA 3N6MA 1SKUB 4LRAA 1ZM2A 3GYNA 4CI0B 5D4PA 1R8CA 5LT5A 4RW9B 1QVGR 3OLBA 2DNOA 2PE8A 4ZJOA 5AXNA 3OXGA 4IRDA 4U7CA 4P9SA 2XY5A 5GAGI 1RGVA 1TU0B 2RIJA 3Q2TC 2DGVA 1OY6A 2RU3A 1X4DA 1V3ZA 5D3GA 1JKHB 4DUYF 3KLFB 1J2VA 2VV5A 2ZUAA 2OPQB 1BQMB 4ILMA 5KFHA 2K7JA 2XG8A 1PKUA 2FC9A 5ETLA 4GKJJ 2JVRA 4IR9A 3HPOA 3JQJA 2OTLS 4LF5J 5L1IA 1RB0A 1Y4ZB 4UUXA 1FRXA 1Q8BA 3OHBA 4B3MJ 2XYGB 2MKJA 4XPEA 1L3KA 1CC8A 1WELA 1S9FA 2C2ZB 2HMIA 1S1XB 2ZH5A 3IRXB 1KRPA 2XBPA 1QAJA 2EFGA 4LQ3A 4FF2A 2KG0A 1RWKB 4LFCF 5K9FA 3TOQA 3FK4A 2LQJA 2FGOA 1V5VA 2QC3A 2XB2D 1FKOB 1OQ3A 1XNRJ 4FS2A 1VJWA 3T1YF 1DTQA 1B70B 4PR6A 2WSEC 1X4GA 4DN9A 5IXUA 2OD4A 3JAMY 2XO7A 1O0PA 2B8QA 2CNOB 4WK1A 2RUSA 3KK1B 2VICA 4YR2A 1M5VC 1LOUA 3UDEA 1S1TA 3DRSA 1QAIA 3ZTSA 4HI1A 2P9EA 2XNQA 4RW7B 2I6WA 4C7QA 1RADB 1QSYA 1YRTA 1MN9A 3MEKA 2A2DA 1KDNA 3GE9A 3MPWA 2B4UA 2NQPA 2W2QP 3NGDA 5LXRA 1NK7A 1UVMA 1GEHA 1U47A 3VZHA 3BSAA 4CLPA 3GB0A 3I5CA 5FDLB 4W4MA 4QU7A 4LF6J 4ES1A 1IUJA 2Y9HA 3ZZOA 3A3NB 2P5VA 2GAHC 4WKYA 2C2KB 1APSA 1S4EA 1EHWA 3AY0A 2JWNA 1T9YA 2LDYA 1N8RT 3GCXP 4HTJA 2JEFA 2Y8YA 4P7TA 1ZZFA 4J9LA 1TKTA 1FJEB 4NMXA 1LFWA 5HAOA 1RTIA 2R4FA 1LW0B 2B9YA 4KYZA 1I51B 1K1SA 4Z7CA 3QFHA 2BKOA 3VGSA 3O3LA 3LP0B 3MM9B 3MR2A 4NLPA 5GAHI 3N6NA 1RWPB 1AA1B 5LMUJ 2RU9A 3M4XA 1KVKA 2CYYA 2X1AA 1CULA 3OLAA 3OT9A 4ZIWA 3L9ZA 1H72C 3CD5A 3NNAA 1SL2A 4JI4J 3MOZA 1Q7LB 5KFWA 5A2QY 1DARA 4O3OA 3SSRA 2VG7A 3CJ0A 3EMTA 4NA3A 4EUVA 2X1GA 1N5VA 3IAS9 2HK3A 1HBUB 1K0TA 4YN3B 4ENOA 2DR9A 1S9GB 3BM7A 1L3UA 3BDEA 3BH7B 2PMWA 1ZM4A 1SKWA 5DDPC 1O5JA 4WU2A 3S8SA 3MI7X 2YNGA 3SIPB 1WSVA 4NL5A 2HHUA 3DOMB 2HURA 3IBWA 2EVZA 1Z2LA 2I0XA 4USIA 4DI6A 2MZQA 4EWTA 1JLAB 1SUQA 2MQMA 2XEXA 3VGVA 5J2QB 3KJVB 4ILRA 1IR0A 2MKSA 2QTWA 4PXCA 4ZK7M 4OYOA 2FJEB 3EGZA 1UCNA 1ZAWA 4OI4A 3DLBA 2MZRA 1Y9OA 1XQIA 3N79A 1SQGA 4I4BA 3LUYA 3JTNA 4QW8A 3VALA 4OHYA 2BOAA 4LBHA 3F73A 2N7CA 2R7UA 5K8MA 3MUVP 3KLIA 2NCKL 3MD1A 3OXLA 2F9JA 2F8MA 4DL5A 2JX2A 3QAEA 3J80Y 2UP1A 4Q2LA 3NRBA 4OIXA 1ROFA 2P8IA 2VJUA 2YNHB 3OR2B 2PEHA 4FXWA 2G1DA 1BGXT 5DGBA 4CP5A 5F8IA 2V2ZA 3TX8A 2ABYA 4DV6F 4PG6A 2MZJA 2JEGA 2DNKA 2E5JA 1IKXB 4MKVA 4DV0J 2VBYA 2N3LA 2COLA 3IO1A 1KWMA 2KYXA 1T9VA 1OQ6A 2PGCA 1B0VA 2R2SA 3Q8VA 3M2UB 1I94J 1UAWA 5KFMA 4B3OA 4IQXA 2WSCC 4A4JA 4QWDA 2GGPB 4RJVA 4OX6A 3TA2A 4G1PA 2IJRA 4GVBA 4DPUA 2VFUA 2DKOB 2Y1JA 3UD3P 3CB4A 1FEEA 4YEAA 4NYZA 3DGVA 4R8UA 1URNA 2DR8A 1JNRB 1WOSA 2VD3A 2C2NA 4ZP8A 3OTOJ 2D9PA 1N6QA 2AGOA 3KDOA 3F0NA 4OHXA 4W92B 1N5YB 3M8SA 3WHIA 4B3RJ 2E29A 3UN2A 2ZJRQ 1ICEB 2UXDJ 2RD5C 3QPIA 4K4UA 1QSSA 1SC4B 1RHMB 4OI0A 4NLSA 5CXTA 3TW0A 1R7IA 3M8QA 4NLOA 4USUA 4J9NA 2BQRA 4TU9A 1YBAA 4ES2A 2G1HA 3ET6B 4KGZB 2GJ2A 2RQ4A 3DYAB 2APOA 2ZJPQ 2M70A 1AZSA 4LSLA 3PKMA 3HVRA 1FK9A 1S1UB 3V81B 1BLUA 2GO8A 3MMCA 5A2QU 3U02A 2H51B 3KDNA 2DBBA 2FHJA 2DNGA 4QQBA 1F60B 2H5EA 4Q8FA 3CC2S 2XI3A 3D5MA 2C2OB 4WF9Q 4AUKA 2CPDA 4ECQA 3P3DA 1RSCA 4KFBA 2HFZA 3M8PB 3C15A 4KSEB 4KRWA 3UO0A 3W64A 2FD2A 2BJ9A 3PACA 4HHUA 5I3UB 4PQAA 1RHUB 3OVBA 5CCLA 4IH5A 4DR2F 1WC4A 3OL6A 2YY3A 3H40A 2FPHX 1YSJA 3DNCA 1KEKA 2XLJA 1RCOB 4P71A 2FVQA 3CDWA 1M5HA 2VG6B 4LT6A 2AZ3A 1NH8A 1KKHA 3OTDA 1LXNA 5SUHA 3CVKA 2V9KA 3I9V9 5B0AA 1H74A 3HD2A 1X9MA 1RT4B 5CCMA 5CZVA 4XAKA 2CPIA 1FDNA 1UZHA 1WDDA 1PCAA 1RTJA 3G82B 1HI8A 5ETNA 1T8EA 4H54A 3RRGA 3U1NA 4F3QA 2I8EA 2ZBRA 5HLFB 2E9ZA 2DNRA 5G0RB 3ZZTA 4IQMA 1JX4A 3G8QA 4I67A 1V6HA 4DG1B 1HNWJ 3TI0A 2QGFB 2KYZA 4IO1A 2QEXS 4ILLA 3MDFA 4FYDA 4IG0B 1CS4A 4U7UD 2QMUB 3A8KA 2XLIA 2W9CB 1OSDA 1SKRA 1ZOTA 1X5TA 3CJ3A 4C97A 5THWA 4AL6A 1IKVB 3M2VA 4DV5J 2BW7A 3KJQB 3HVWA 3VR1A 4EFAC 4B9SA 1U2FA 1SVDA 4NRUA 4TYBA 3OQ2A 1FF2A 5HMXA 1QSLA 1Y10A 3GYXB 3R2DJ 4NYPA 2B5JA 4DR3J 4IFYB 1XMOJ 5KFIA 2AJ4A 4ELTA 5KFGA 3SI8A 2NXEA 2XY6A 1CJTA 1LV5A 2KVIA 2DHSA 3ZZRA 1N36J 4I68A 2IHR1 2ZD1A 3E51A 3MWBA 4KPYA 1WOPA 2AW0A 5J1NA 1N34J 3SBMA 1FFSB 1SI9A 2K2PA 3SCIE 1YJTA 4YB1P 1FKPA 1NB2A 2R9LA 4PRFA 2ATCB 3NY0A 3ONQA 3CCRS 2XWYA 4CH0S 2ZZMA 1IBKJ 3QJPA 4GKJF 2FLOA 2U1AA 2WW4A 2MYFA 4O4RA 2XMJA 2JEJA 1WC0A 4RBTA 1YZ7A 2OIHA 4ECWA 2V4JA 4LF5F 1SC3B 4B3MF 1DLOB 4F36A 4JI5J 4P72A 3KYLA 5A0YB 2G2YA 4HVZA 1VYAA 2E66A 5FJ4A 5F41A 3DLHA 3CDAA 5D6GA 3D2WA 5KG4A 1F2HA 5CQGA 4ZITA 4A46A 1RXOB 2KFYA 1Y0HA 2H5JB 4GC6A 3D66A 3IR6B 2CQDA 4O3SA 2BYCA 1X4EA 4ZHRA 1UMJA 2XGQA 2ZH3A 2MKYA 1XNRF 1DJ0A 5T7LB 3HHEA 3D28A 2OPSA 3RW7A 4J5OA 3EE3A 4JV0A 2ZBQA 3RU0A 3OR1A 5CYQA 3I6PA 2DGWA 3TZZA 2IRXA 5CD4H 1WKJA 4HACA 1VQOS 4D3GA 5F8JA 2FGCA 2F4VJ 4OYWA 1CJUA 2KFZA 4JI8F 3C66A 2CADA 1RAGB 1VK8A 4ER8A 1U49A 2E9RX 2DNNA 4LF4J 3RW6A 3LAMA 5KFCA 1XMQJ 2CQ1A 3PX6A 1SJQA 4B17A 3M6UA 4F4KA 4LFBJ 1RWVB 5DG9A 2PI4A 2QO3A 1LWXA 2Y1IA 1HYSA 3W9HA 1NO8A 3SSSA 3ZTPA 1PILA 1VIOA 2ZC3A 4C4WA 4LF6F 1SH3A 4PYAA 1Y5NB 1XIQA 3IN5A 2ZKTA 3DRYA 5KFNA 4DR1F 3VWSA 2UUCJ 1QUPA 1JJ2R 1JJCB 4DLGA 3JYTA 4I7FA 1VCTA 1P8GA 1K73T 4NA1A 4HDHA 3QIPB 2HRTA 2VG5A 3M8YA 5B0BA 4YDDB 1FO1A 4IOAQ 5D8HB 4FPIA 3PJXA 1M1GA 5C42A 5D3GB 4LIRA 4N8NA 4JI4F 2ZH6A 2K06A 2XMAA 3MR6A 4WFYA 1UEUA 2BE2A 4LR9A 2W8KA 2AJQA 4OZJA 2VC0A 4KKOA 3ZO7A 4ZIVA 2QYGA 4E2FB 1C1BB 1HBNA 4M1KA 2UUBJ 2HW3A 3TX0A 2A6OA 4F4YA 4S0MA 5KFXA 4NLQA 3O5TB 2L48A 2DJWA 3DXBA 4LF8J 4Q45A 7FD1A 1HD0A 1D8ZA 2RDIA 4F7VA 1VQKS 1UVKA 1YJVA 2C28A 4DV1J 2YWKA 2HMIB 1UVIA 2PO4A 1U6FA 2OPRA 2KZMA 1P27B 4ZLPA 4AE5A 1NMEB 1N0VC 5J1EA 3CGIA 1N33J 5HMYA 4MTPA 2RKIB 3ILLA 5DGAA 2MQQA 4RZRA 2GFFA 1OIAA 1WHYA 3CJKB 2F8HA 4TN2A 3G8SA 4OX9J 5ETPA 3OJSA 2D69A 2MQLA 3GIKA 1G4CA 2WVEA 3MR3A 1FHTA 2V9WA 3R3TA 2LXIA 4F4AA 1DURA 3EGNA 8ATCB 4WFZA 2L41A 3JQKA 3GYGA 3ITHA 2C2RA 1I6JA 2YX4A 2AHOB 5HATA 4RW6B 2MHNA 3TA1A 3BKTA 3W2WA 3AXKA 3EGWB 3SZ2A 1VQ7S 3EX7B 1U02A 4Q43A 1S9EA 3KLHA 4ID5A 4P2SA 2KXNB 5KFFA 5F0WA 1TL4A 4FYVB 1KOHA 3NBPB 1KP6A 4OJ3A 2CPFA 3VZIA 2QA4S 3SCJE 2CG4A 4RNMA 2E7WA 1EAYC 3BGOP 2K3KA 2FZCB 4M5NA 1BQNB 1TL1A 3I5AA 2IAJB 5EDWA 2FLNA 1X31C 1REVB 3H0PA 3MECA 3KWMA 1Q81T 1WC1A 4CRJA 5JMNA 4RNNA 1D3WA 1I94F 1VRUB 6FD1A 1HNXJ 5CAAA 1Y7PA 4Y2CA 3MM5B 2CWKA 1V3RA 4C11B 4ANDA 1VQ5S 4FYXB 2C3MA 2VPYB 4O3RA 2QSWA 4LRCA 2UUAF 2HVHA 2GMJA 3VF0B 4ETZA 3EVOA 3PKYA 3PEJA 1X4FA 2E5IA 4K59A 4HT5A 4KY3A 2WVFA 2IA6A 3OTOF 1PJ5A 1PBUA 5J2NA 2RRAA 4G1IA 2IVMA 3EZ5A 5KFVA 1TUVA 2WAQD 2XHCA 5ETOA 3DLKB 4PABA 2LXUA 3MEEA 3S6EA 4B3TJ 2NSBA 4LF2A 3R5GA 3UVJA 3W2VB 2UXDF 2F9DA 2BRKA 5LL6d 4LQ9A 1Z4UA 2GVZB 1TL7A 2Y0SD 1RACB 5EWGA 1UPMB 1VLOA 1RBOB 3MAAA 3BKFA 4G65A 1SIZA 4DL4A 1OS5A 2I2YA 3V4IB 1BUXA 2R7RA 1E6YB 1WD6A 4BC7A 3CEDA 1RA6A 3T19A 5F3ZA 3CIZA 5CD4A 3FMBA 5C2GA 1FDDA 2Z2ZA 4TKTA 3ZZYA 3RZAA 3KHGA 2LA4A 4C8LA 2VFTA 3OUYA 1VQ4S 3DM2B 2MGZB 2P9CA 3SDEA 2W01A 5HJXA 1TKZA 4ZPAA 2HWTA 3OD2A 3HFVA 2B9XA 2MZSA 4RWXA 1NPRA 2P6SA 4JYAJ 3T5HA 4ECSA 4EZ9A 1RTZA 1NDKA 2G2OA 4KH0B 3DRPB 4RW4A 3PO5A 2NXUA 3E2EA 3GWCA 4WP3A 2XTJP 4TYAA 1RKJA 1HHSA 4NCGB 3IM8A 2QIFA 3FEXB 3I9ZA 2CVIA 4UQTA 1YJNS 2VKZG 1U8SA 1UEKA 4URQU 3H5YA 4NLDA 1KLNA 2LQ8A 4F4XA 4X4VA 1S99A 4BBYA 3QGPA 1HQUA 3MM7A 3ELHA 1MWYA 5BYRA 5KG6A 2ASDA 4Y34A 4DV7J 4WXOA 5GAHU 4GVBB 3C16A 4LF1A 1G6BA 5D0HA 1JK9B 1RT6A 2XMKA 2HS4A 3DRRA 3HHKA 2NYHA 5H9FJ 4FBTA 1BQXA 4CO1A 1DFDA 4MK9A 4IFVB 3FSXA 3J7YI 3LP2A 2EFPA 2BA9A 5IT9Y 3K5NA 2XS7A 1WF2A 4EBEA 2HHHJ 2QT7A 4DV5F 1S5ZA 2ZITA 4NLYA 3B4DA 4MKBA 3K57A 4BLGA 3U27A 4Z37A 3I55S 1LKZA 4K4VA 4CTAA 3T6BA 3M9OB 1S6PB 4HDGA 1Q1KA 1KHVA 5L1JA 4PUOA 4C8OA 1XMOF 1HLWA 2UV8G 4DFJA 2E5LJ 3T5KA 1F9FA 5HMWA 4QYZK 1N36F 4L3KA 3D3CJ 3D3BJ 1Y00A 1Q5VA 4KGKA 4DX8H 1ELOA 5MAOA 4U8YA 1ZTTA 2HAIA 4WPAA 3EZOA 3FKBA 3K59A 5DG7A 2DRDA 1HPZB 4FN5A 4R5PB 1I3OB 5HI7A 2XS2A 1U7LA 3CWJA 1IBKF 3K5OA 5J2PB 3WX4A 5F3TA 1R0CB 4KJIA 4TNOA 3HO1A 5E3CA 4HHJA 4ED8A 3SFGA 4F3OA 3K5MA 3KKFA 2YNFB 2MXYA 2B3TB 4RKUC 1KR4A 2QA2A 3MPVA 4LSNB 4JI5F 2WVCA 1S7HA 1NK5A 3H5XA 1JMTA 3G4SS 4CLSA 4G1QA 1UW4A 4N76A 3OFHA 1W26A 3PV8A 2DGXA 2UXCF 4DL6A 3DGPA 1TQLA 2Q6BA 2CQ3A 3QZ7A 3AOBA 4CYUA 2ASJA 1NM2A 1EKSA 4ECRA 1PYOB 3UCZP 4ZP9A 3Q86A 4OYIA 3TWZA 2WB4A 4QIWD 3TAMB 1N54B 5LSLA 1ZZNA 2CJQA 1U26A 3WIVA 3CCUS 2DO0A 4PPZA 1HW8A 2ZDOA 2V67A 1Y3KA 2AZ1A 1VQMS 4C3KA 2DCLA 2RDJA 2R7VA 3DHWC 1WC6A 1L3VA 2DGOA 2MDAA 2MZ1A 3H4DA 2F4VF 1RI7A 2EFVA 1FNMA 1D9FA 4WFXA 4LF4F 3QT6A 1SV5A 3D9BA 3JTPA 3GILA 4DMZA 1T9WA 4QWBA 1GXUA 2VFVA 4RWWA 4RO0A 3MURP 4LFBF 4ZCMA 1NH7A 5KFPA 3G6ES 3P4UB 5E3PA 3W8PA 5M2UA 4RW9A 3BQ2A 1S79A 3G6XA 4K5SA 2GHPA 3RJMB 1RT3B 3IR7B 3TUPA 1UFWA 1XN9A 3R6GB 2PDAA 3KLFA 1H2VZ 2AX0A 2IFXA 3C3LA 1KVJA 4GRSA 3BS9A 4KBIA 3FVYA 1WC3A 1UFLA 3EGVA 1BQMA 2MLZA 2HZCA 3N6LA 4Y65A 1RWXB 4ZP7A 1TUGB 2DK2A 2FJAB 3CW2C 5IT9U 3BGRB 1FJCA 3KUHA 1LWEB 2HHQA 1XNQJ 4NEYA 4FNIA 2O1PA 3M30B 4J9KA 1AXQA 4MT1A 3F44A 1HHTP 3P6YC 1LWFB 1S1XA 4UOHA 4F2SA 3IRXA 3D6TB 2GX8A 2KXFA 5U47A 2DGSA 3RRKA 1H2TZ 4MYUA 2G4BA 4LF8F 1HQEB 2GAGC 3CD6S 3CNQP 1S0VA 4MIWA 4DL7A 1YJWS 2XZWA 2ZZTA 4C3LA 4DV1F 1MMDA 2ZH4A 2D9OA 2GJIA 1UWBB 2CQIA 2AMCB 4DFKA 3KK1A 1M0SA 2B7BB 1W7WA 1N33F 4DR7J 1JLEB 3PYDA 4AL7A 4KGVB 3CCQS 1I1GA 4HTIA 4F25A 5DLFA 3PW4A 2K8GA 4X4TA 2Y1LB 2ZC4A 3O1LA 2OH2A 4RW7A 2OPSB 2ZBIA 1PG5B 3HKZD 2VBZA 2DTJA 4NI2A 4OZLA 4QIFA 1TVRB 3HHLB 1C0TB 4OJHA 2DIVA 3ZZZA 2W9BB 3H20A 3H42A 1H7XA 2LEBA 5FDLA 1ZETA 1RAOA 3I0RA 5CYJA 1S1VB 3JB9k 2HS3A 3KFWX 3I4HX 3LGNA 1WF0A 4LUBA 2HHVA 4QR1A 2WHOA 1VRTB 3QGGA 1B0TA 1DBDA 1LW0A 1U2CA 2OSQA 3HHLC 4P10A 3H2VE 2YKOA 3HJVA 3LP0A 1R3NA 1IKWB 2LU2A 3KOAA 4D3HA 2KU7A 3NAHA 2EC0A 2XSJB 2QL9B 3H90A 1NB7A 2A1BA 2A2CA 4IRKA 1BWEA 2IJFA 3AB4B 1HNXF 4V19J 1RAHB 2R3VA 4Q7AA 2IIHA 3FUYA 4OZ2A 2CJ9A 5E3QA 1S97A 1JXVA 2LQ5A 3RAXA 1S9GA 1IBCB 1R89A 4CO5A 3KLEB 1FFGB 2R8GA 4ZCIA 4GVLA 3AJDA 2D3O1 1U24A 1T9TA 2GIRA 4LRBA 1JB0C 1IBLJ 2ALYB 3DOMA 4OFZA 1NDLA 2DNPA 4OI6A 4ECTA 1VHIA 3Q8PB 3M8RA 3W5XA 2F5GA 4ID8A 4R0JA 1HBNB 4A8MP 1JLAA 4ZKAA 5J2QA 4WJBA 3KJVA 3MOJB 4YMEA 4QIVA 1Q7YT 4HH1A 3V6KA 4IO9Q 3HK2A 3W61A 3J7A1 1ULRA 2AYGA 2C1EB 4AXIA 2DVIA 5J2MB 4FF1A 3CJRA 2A6MA 5MLCV 1EB0A 4QIEA 4ZA1A 3G6YA 2OPRB 2CUYA 3CDEA 4TY9A 4B9VA 2JJ4D 1NCLA 3CCSS 1U0HA 4WWSA 3N01A 2CJAA 1YDLA 1TTHB 2RRNA 5L8RC 3X1LB 1VLYA 2HBZB 3J7Z5 4QWCA 1AT1B 2YNHA 3OR2A 3PW2A 2KRBA 3ZTOA 2OEJA 2KHDA 4HR2A 2ROEA 5CZXA 2DHHA 4NEZA 2GVDA 4F67A 2XSFA 1JLBB 3JSMB 4C6AA 1IKXA 2W2NP 5HMZA 1U09A 4JYAF 1FTRA 2A3JA 4XPCA 5EN1A 5H1SV 4R25A 3TVKA 4PCQA 3MCMA 2E1AA 3N28A 4HYKA 1UZDA 2VB6A 3M2UA 4JV5J 2DNZA 2KFNA 2X3GA 3KK2B 2QMWA 4IUFA 4A8QA 2GGPA 2V69A 1BWVA 2XWXA 3GJTB 3Q8QB 3J81U 4OX8A 2V4RA 1XMBA 2B9EA 1FESA 4NMLA 2PT0A 2YKAA 4I56A 2CFXA 2VOOA 3HVAA 3H5SA 3M32B 3Q83A 1RTHB 4ED1A 4OHWA 4IKAA 1A7GE 2W8LA 2L9NA 2IVFB 4ECXA 1WKLA 5CA5A 2V2QA 2KZZA 3NCQA 1ACMB 4DV7F 1N5YA 3G71S 3QZ8A 4B02A 5IWAJ 4OI2A 4NRTA 1RP5A 2HFVA 3GP9A 3VQSA 2RILA 2HNYB 2MQOA 2VU5A 4NA2A 1HWLA 2ZWPA 4UF4A 2AWZA 4OV1A 4LSZB 1L5UA 3CDBA 4M5IA 3ET6A 4K0KF 3DYAA 2A10A 4DQRA 2HHHF 3IFEA 1URRA 4ICLB 1UP1A 1MWZA 3VHQA 2VFRA 4QPXA 5HSPA 1S1UA 3V81A 3RAQA 2RS2A 3UVJB 4FF3A 2CQCA 1HBOB 4Y2MA 3H2LA 3TA0A 4LREA 2ASYA 2O66A 4N41A 1VOMA 4FYYB 3AQOA 2XNRA 2AT1B 1R8HA 1LEOA 3QNWB 1F6TA 2LVWA 3Q8UA 2GQCA 4DV4J 3M8ZA 2FJXA 4A48A 4CCHA 5E3RA 4DDFA 1T03B 4PPDA 2V4QA 3D4JA 1SQFA 3KG1A 2LEPA 4RW8B 2K7KA 1PC4A 2V6AA 5I3UA 2QLXA 2ZJQQ 4ED3A 3A8IA 5BR8J 1AW0A 2Z57B 5I42B 3ZZUA 3X3UA 3AB2B 2QG9B 4FBUA 3CMQA 2UZAA 2XM3A 4H4KC 3GR1A 5DQIA 2JRSA 3CF5Q 2ZH2A 5HJYA 1RHJB 2IVYA 3GV8B 3HHNB 2QLBB 2HPUA 2VFSA 2ATLA 2BE7D 2LQ9A 1S12A 4RLEA 1RT4A 4XDCA 2I9SA 1HNIB 2HNDA 4DCOB 1NKEA 2L08A 4DZ6A 2FTRA 2KDOA 3DFEA 4Y2KA 4C8KA 2BZ2A 3NS6A 3G82A 2IM1A 3CTRA 3DHXA 1NPPA 4NLXA 3L7UA 4B08A 1U1RA 1NSAA 5HLFA 3EXCX 2HFOA 3Q23A 1U8WA 2GA7A 2EKNA 5G0RA 4JI6F 3T5JA 4DN0A 5KAKA 4DG1A 2CPYA 3LOUA 1FRJA 2EKYA 3NS7B 3T3FA 4C8ZA 4IG0A 3FFIB 5K8NA 5A6WA 4ZN1A 1KONA 4TY8B 1X7VA 2EC2A 2W9CA 4CLFA 1TAQA 4WIIA 1G1XA 3FZBA 2X1FA 3RB3A 3IR5B 3AFGA 1VR6A 1IKVA 2IJNA 4F4WA 1PYSB 3AHPA 2HGNA 5L1KA 2HS0A 5BYSA 3RGIA 4AXJA 2H54B 5L9XA 5CH7B 5LXYA 4OZ0A 4BWJA 3QO9B 3RBXA 2UVUA 5DETA 4IFYA 1NZ8A 3LP2B 1Q95G 4ZN3A 2RB7A 1RK8A 4I0WA 3KLGB 3LAKA 5KT4A 2PA3A 3HCXA 3MUMP 1CQNA 3CE8A 2FHMA 2MKIA 2CDRB 1YK9A 4P2XA 4K4WA 3GIJA 4F8RA 3ZNJ1 1HWKA 2JEIA 1Q82T 5EWEA 4OYPA 2B9WA 7FDRA 3MFIA 3R5JB 1XWLA 2GQQA 4YY3J 2YVSA 2DITA 4ZLNA 3GG1A 2CPXA 2YX1A 3L4BC 1Y5IB 1DLOA 1VMBA 5A0YA 1RT2B 1EETB 3IWXA 1N48A 1IR1A 4EYHB 4PEOA 4X62J 3K7RA 1FRHA 8RUCA 2GNKA 1RWNB 2WBRA 4OI1A 2GIQA 3C14B 3QRQA 1ZYQA 4M5DB 4ZPCA 2AIRB 1HNVB 2CVEA 4DEZA 3C8YA 4XIUA 4DL2A 1VISA 2PEBA 2N4DA 2EFOA 2RQCA 4C8NA 5KFOA 4RUBA 4GMKA 3T9ZA 3BR9A 2CRLA 5T7LA 5KT6A 2W4DA 2AYBA 1IJFB 4ZPVR 1HA1A 2EWHA 2XMTA 1GFWB 3MM6B 1GMWA 4X4UA 3PJ9A 1BMQB 3HT0A 4DR7F 4CM2A 4FXDA 1FDAA 4OYMA 4UY85 1C4CA 5L9NA 1UPPA 2MZTA 2E1RA 1PAUB 3GLJA 3QWPA 2JC1A 4DHVA 1U1MA 3KK3B 1T11A 1CPZA 4N56A 3GJSB 1AYEA 3QQCD 1RHKB 4DFMA 1B7FA 4F0HA 2N3OA 3UW1A 4PWDA 5H9EK 2NXCA 2H9ZA 1Q5YA 3R7SB 2MB0B 2GS8A 2EK1A 4M5LA 1A0OB 2IMOA 1VHFA 4YDXA 1UFKA 2RF2B 3K5LA 4TU8A 2HQGA 4YUDA 1AB8A 4MFBB 5K14B 3BO3A 1HD1A 2FHJD 4ELVA 1VFJA 3ICLA 2GC8A 1NUEA 3QMQA 1KTQA 4L72B 2ZM6J 3QIPA 2YWFA 3KHLA 1ZTWA 3CT9A 3J7YU 3R5CA 3PCOB 3R1HA 2MQPA 3GV5B 5IZHA 1PAEX 1RAIB 3WX8A 1T0TV 3G8TA 3D0IE 1Q86T 1RUSA 4NYOA 2BDPA 4LBIA 3THTA 2Z2LA 4NX9A 2V2VA 2DR5A 1IM6A 5HROB 1HBMA 1TFWA 4O0IA 1D0EA 3TUIC 3QJLA 3LP1B 1Q8KA 2NLWA 2C2EA 2R7TA 2M8DB 1HWJA 1NK6A 1C1BA 5DDOC 2F65A 2HIYA 3ISNC 4ED7A 4ES3A 1KHWA 2XC9A 4PAAA 2CAJA 1IBLF 1B0PA 3ISND 2VODA 2QLFB 2HLUA 4RUHA 3JTOA 4OJ1A 4ERDA 3LWMA 3HXMA 2CJBA 2QZ8A 3NG8A 1TFYA 2RKIA 2EBEA 4K4ZA 2XY7A 3AA9A 3NLCA 2ZVSA 4KIAA 3OL9A 1UETA 3QRPA 4NZ6A 1F3VA 1OMSA 2A0FB 4MYTA 3CJKA 3QSIA 1RLCL 1IKYB 1SCJB 3QIDA 2R2RA 3L7OA 3EDRB 5E33A 4WU3A 1AFJA 2RRBA 2RHSB 4NLTA 1JLGB 3TUZC 3CCES 4Y28C 2IM0A 2UU9J 1H38A 4QR0A 4NLUA 2C3OA 2EFQA 4CO2A 2DPJA 5C24B 4RW6A 1NKCA 4JI8J 2CWXA 2CQHA 4YQWA 4KPCA 4UOFA 4DX6A 3CJ2A 4DUTA 4NI2B 5B0DA 2OMLA 3BBBA 5FLXY 3NBPA 2HK2A 1HW9A 4JB8B 1UA1A 3I96A 1BQNA 3I0RB 5BYQA 1VC0A 2FYXA 2C42A 2IAJA 1VQLS 3FCHA 1SC1B 2UVRA 1REVA 1Z1ZA 3EPGA 4DR1J 1J27A 2ADCA 2LEAA 4KR0B 3HI9A 3R7BB 4JV5F 1VRUA 3QATA 2IM2A 3D6HB 5D4OA 3A8JA 4E0DA 3MM5A 3TVYA 4C11A 4U7UK 5ETKA 3VCDA 4GKKJ 3GJRB 1SC6A 2BANA 2HYIB 4N77A 3B82A 1Y3JA 1TELA 3QYYA 2CQPA 5HVHA 3G96A 1WHVA 1C2PA 1NKBA 1HWUA 3MPDA 2VUGA 1DQ9A 2AQ4A 3DLKA 1GQEA 4M5MA 5IWAF 3QGHA 4DJBA 3I0SB 3W2VA 3IS9B 4M94A 2W2MP 2ZNZA 3M6XA 4Q44A 2GVZA 2WZ1A 1OWXA 4URSA 4DSIA 2ALZA 2WTFA 1N5SA 3TQEA 1HHQA 1XERA 2L3MA 2VPZB 4QU6A 1SH0A 1RWMB 3V4IA 4IYQA 2OKQA 1E6YA 3GONA 3A1YG 2HVIA 1XBWA 2CPZA 1Q4RA 4I1TA 4QYZJ 4PZVA 2ZHAA 2M3DA 2GMLA 1NJYA 4X4PA 1MROB 3WDOA 4PG7A 1SJFA 5F0UA 3J81j 2N82B 3OTCA 3CCMS 5D78A 3BBFA 3E01B 2VZ9A 4DV4F 1MU2B 3FBFA 2ZWOA 3DM2A 2MGZA 1U1NA 1S6UA 2ROGA 1M5KC 1X4BA 4CH1A 4EU0A 3FGVA 3VAHA 3VTIA 4ZVUB 3PG9A 1U0HB 3HDSA 1YWXA 1K0VA 3W3SA 3BDPA 5BR8F 1QD1A 5GMDA 4X64J 1VBYA 3DLGB 1BHNA 3W63A 3PW5A 4X84A 5HQLA 5DDRC 3P5BP 3ILJA 3EPIA 4ED5A 3DRPA 1H98A 2WONB 2AYMA 4KO0B 3KJNB 3DI6B 5AT1B 1NJWA 3NMAA 2H48B 3BSNA 4NCGA 4DSJA 2BM1A 2GVDB 1S0NA 5LMNF 1QY7A 1W2BR 2CNNB 3LGMA 3JAMU 4LRFA 4NWBA 3TUJC 2HRYA 2H65B 2JL9A 4HH0A 1R31A 5B0FA 3BSCA 4H4MB 4DV3J 4U6PA 1WG5A 1VIXA 1AUSL 4IDKB 4CIOA 2QL5B 3I87A 1GXTA 2CXEA 2EFNA 2XS5A 4A8OA 3NOCA 3MEDB 3UN3A 5FLXU 4ZVQB 3GFXA 2UUAJ 1OPZA 3DDKA 3KUEA 4L73A 2WOMB 4TVAB 3S1TA 1C4AA 1YJ7A 4IFVA 2FVCA 2RQMA 2VKRA 5GAEI 2QYCA 3EXYA 3D54A 3MPUB 1JNZB 3EJMA 3TZXA 1S6PA 1FNXH 1NRKA 4DF8A 4RBUA 2HFNA 2IDLA 4N7TA 3FCWA 3CD7A 1TK8A 3AD8C 1RBAA 1FRLA 1QUVA 3FNNA 3Q0AA 2HBYB 4EBCA 3FDSA 4EMDA 1WORA 2ZBPA 1UA0A 3OVAA 1S1WB 3EDQB 2BACA 2XGPA 1JQGA 2X1BA 3FZ2A 1Q8LA 2JHEA 5JXSA 1IQTA 4ED2A 1HPZA 4FP9A 4R5PA 1R0BG 3BGFA 4JI1J 5J2PA 2Q43A 3CJQA 2DH9A 4I69A 4DWIA 1S10A 5FD1A 4OQJA 5F8MA 5KFBA 3HVTA 2HLTA 4YY3F 2BJ3A 4L76A 2HIQA 2YNFA 4NLGA 4I6WA 2IC3B 3DLEB 4LSNA 3G86A 2VA2A 3MAHA 1A6LA 3POTB 2OFGX 3PNIA 4WFNQ 2QFJA 4ANCA 3PFEA 4X62F 2AV5A 3AD9C 1S57A 4CT9A 4B9UA 3PX4A 4LMZA 2NUHA 2V5HG 5B0CA 1R8BA 2HQ3A 4Y6IA 4MH8A 2FVPA 3RR7A 2YNIB 2J6UA 3TAMA 2VBWA 3I5BA 4JI3J 2JLEA 4O4GA 3CSKA 2MKCA 3ZTQA 2ZE2B 4ED6A 4EGLA 2DISA 2HNDB 2LA6A 2AGPA 1J5OB 2Q6CA 2QMXA 1HMVB 3IC1A 5K20B 1UVNA 3J80U 1FNOA 1KQSR 4CLZA 2RNEA 1OY8A 1V3SA 4C0OC 3HT3A 2X7IA 4DU7A 4O3NA 2CA9A 4B9NA 4LRDA 2DY9A 1YITS 3FRYA 1D9DA 3SYZA 1N5QA 1JXLA 5DQHA 2W7OA 3PHEA 3H2UB 3TZWA 5HL7Q 3KJFB 1KQGB 2B8PA 2DB1A 3CC4S 3JSRA 4TLRA 3UNYA 1GXLA 1DRZA 1HI0P 3CDUA 1DHMA 2F3JA 2FLPA 1D8YA 3EYZA 3UR3C 3OFEA 1Q53A 2NYIA 2Q3PA 1U6ZA 3ETOA 4CLUA 4NXMJ 1KNZA 1S48A 1YIJS 4J9OA 2HWIA 3K8VA 2ZOMA 4ZDNA 4X4NA 1JLFB 2YKNB 4YB7A 1RT3A 4DQSA 4KHPJ 1DTTB 1CC7A 1R6VA 2OPPB 3IGNA 3RBZA 2CKWA 2CZVC 3P96A 5E5NA 4DQIA 5KG7A 3UCUP 3GZ7A 4NZ0A 4WP9A 5HP1A 3FSYA 3R1LA 2ZM6F 2OLWA 2K1RB 4DL3A 4HEA9 2G9OA 1VGYA 2PMZD 4RU2A 5KFQA 2N4CA 1ZA2B 3BGRA 1LWEA 2I5JB 2P6TA 3OFFA 3V4MA 1RAEB 3VAIA 5HANA 3CCVS 2HKEA 3M30A 3W9JA 2BQ3A 2NUUG 1T3OA 1LWFA 3MM8B 2EG1A 2HVDA 3K0JA 2YBVA 4OZ5A 3AXMA 2AJ2A 1H2UX 1RT5B 2VPXB 1KFSA 2ZKUA 2AJ1A 1AUDA 1HQEA 2SXLA 5EWFA 1DQAA 2WRMA 4M95A 5KG2A 3EWGA 2J0XA 4XTTA 4F26A 4X65J 3NCPA 3MF5A 3KMQA 4RUAA 1UWBA 3UNGC 2UXCJ 2XO6A 4RU9A 1NK9A 3OSPA 3K5PA 3UD5A 1YJRA 3TNVA 1JLEA 2QRRA 2IRYA 5LOQA 1FJGJ 1F0XA 4DV2J 1KTVA 3SV3A 4B9LA 1YQHA 3ADAC 4E8UA 1P6TA 3BBCA 3MTJA 2HNZB 3DOLB 4LJMA 4NE9C 3Q8RB 1TVRA 3HHLA 2F8EX 1H6KX 1C0TA 4AQYJ 2W9BA 2UU9F 1F3FA 2CQ4A 1SL0A 2POKA 2BE9B 3R6LB 3AODA 2FHKA 5LJ5Y 3CJ8A 5KFAA 4M5KA 4BWMA 2YWGA 5F8GA 2HQFA 1S1VA 3U7JA 2YWWA 3D6MB 2IA0A 2XMWA 4P6QA 1VRTA 2W7AA 4PYDA 4WBFA 4JI2J 2B51A 2QX0A 2FQQB 4PWDB 3SSQA 2FJWA 4J9SA 4USVA 2R2UA 1IKWA 3A3OB 4WFBQ 2RSQA 2DCUB 6AT1B 3GTYX 2D7SA 3M6WA 2O3DA 1XTZA 2XSJA 4FF4A 1RCXB 3MMAB 1T02A 1EQMA 5AXKA 3DU5A 2QSFA 1TR0A 2VDHA 4IH7A 3K8WA 2G0JA 3FCVA 5IQQA 1T05B 4OYBA 5IM0B 3C46A 4YFUA 1HR0J 3JXOA 4GKKF 3US5A 2JFDA 4CO3A 4KH1B 1M90T 2OFHX 1R0AB 2M8HA 1C1CB 1QE1B 3OW2R 3OV7A 1WJ9A 2OHDA 2J6TA 3BEGB 3KLEA 3BH6B 1U25A 3UN5A 5KFZA 1B64A 5CABA 4NCBA 2LU1A 4FNHA 3GIRA 3GJQB 2ZHOA 3SQGB 3BZQA 4A8WA 3NWGA 1HBMB 3IBCB 1RISA 2WB1D 2DRAA 3QGIA 2ACMA 1RAFB 1RT1A 3M05A 4DU8A 1Y11A 2LLZA 3M1VB 3R2CJ 1LK5A 2BQUA 2ZNYA 4NLVA 3TR5A 4HHHA 3D1QA 4ECUA 2OELA 3ZFVA 3SXLA 1FD2A 3FRZA 3K58A 3ENQA 3WC0A 3Q8SB 3BO4A 4FVCA 2FLLA 3PRDA 3JSYA 4ZVHA 2IMWP 5J2MA 3DDIA 3JQMA 3C2PA 3TJ9A 4X4RA 3RBEA 1QJHA 1MNEA 3MEGA 5ETRA 2AEJA 2NSCA 2E1PA 1FJ7A 2BR0A 5K8PA 2K3IA 2XMUA 4EK2A 4J9PA 2NPIA 3Q8YA 2D1CA 2UXBJ 4JUZA 2W9AA 3SV4A 1FXDA 2R2TA 4FPRA 3QJJA 3IP0A 3H8YA 3K17A 1JLBA 3JSMA 3DRXA 4NZ7A 5C7PA 4X64F 1VK3A 2R8HA
chains in the Genus database with same CATH topology
4DR2F 1NK8A 2Q66A 4B3SF 3OL6A 1N5TA 5I3PA 1TKXB 3N5BA 1Q8IA 4C2MA 4NA2A 1HWLA 2AWZA 2YY3A 3BB5A 3H40A 1XR5A 3I31A 2FPHX 4OV1A 1YSJA 1L5UA 3DNCA 3CDBA 1QM9A 1Y5LB 3GIIA 1KEKA 2XLJA 2RH3A 2FVQA 4K0KF 3DYAA 3BN7A 4OL8A 2A10A 2F40A 4DQRA 3MCSA 3CDWA 1M5HA 2HHHF 2VG6B 3IFEA 3KK2A 1URRA 2NPFA 4ICLB 5B0EA 5EGYA 2B4OA 1UP1A 1MWZA 2VFRA 2B4PA 4QPXA 5KFDA 4LT6A 3M2VB 1S1UA 3V81A 3T1AA 3RAQA 1NH8A 2RS2A 3OTDA 3IRWP 5HBMB 1LXNA 3M9NB 4FF3A 5SUHA 1T94A 2UUCF 3L3CA 3CVKA 2CQCA 1HBOB 4WYLA 1JKHA 2V9KA 3I9V9 3H2LA 4Y2MA 5B0AA 2J9DA 1CQMA 3TA0A 4B9TA 3S7RA 2MY7A 2VL1A 1X9MA 1RT4B 1QLNA 1XC9A 2ASYA 1EP4B 2OO4A 5CCMA 3OHAA 5CZVA 4DQQA 2O66A 4O23A 3M32A 5KFSA 5A8KB 2B5JB 4XAKA 2OPQA 4N41A 1VOMA 3I56S 3AQOA 3T5LA 3HKWA 4OMFG 2AYEA 4DV3F 2XNRA 1QAYA 1R8HA 1RTHA 3SMZA 2YH1A 4PG5A 3G9CA 2ZH9A 2CPIA 2LVWA 1FDNA 3IAM9 2J9EA 3IWNC 1KLMB 2GQCA 2FJXA 4A48A 4CCHA 4XK8C 1RTJA 3LF0A 3PJWA 4A8FA 5E3RA 4DDFA 3PY8A 1HI8A 4G3IA 1T03B 1T8EA 4H54A 3RRGA 2ZD1B 4PPDA 5D4LA 2V8DA 3U1LA 2V4QA 3KG1A 1WG1A 3U1NA 4F3QA 2LEPA 2I8EA 3N9UC 4RW8B 2AGQA 2K7KA 2KT2A 2EPIA 2KO1A 1GX6A 5HLFB 2DNRA 2E9ZA 1PC4A 5DQGA 2IYIA 3LO3A 2ZOGA 5I3UA 2E44A 3DMJB 2DD8S 5G0RB 2JLGA 3ZZTA 2IYGA 4IQMA 1JX4A 2BANB 4ZP6A 3G8QA 2QLXA 4WTYA 2ZJQQ 1P1TA 1FKPB 4ED3A 4I67A 3V2UC 5A6PA 2HNYA 1V6HA 4PXBA 3UPFA 3HFKA 4DG1B 1AW0A 4Y3CA 4IRCA 3Q2SC 3DOKB 3TI0A 2D41A 2KYZA 4IO1A 3GSDA 2QEXS 4ILLA 5I42B 3MDFA 3ZZUA 4FYDA 3X3UA 1TKXA 2MJNA 2CQ0A 1QAXA 3D1OA 4IG0B 3AB2B 1VQYA 5F8HA 1KS2A 2LYVA 1YHQS 4FBUA 1VBXA 4JV2A 3Q22A 3R5DA 1WTFA 1H7WA 2V8GA 1T3NA 2XLIA 2UZAA 2W9CB 1OSDA 1SKRA 1ZOTA 2M9KA 4OZ1A 3LW5C 4H4KC 1X5TA 2X51A 1TP7A 3CJ3A 1KD1T 2UUBF 3GR1A 5DQIA 3O6QA 2JRSA 4C97A 2YTCA 4A47A 4CO4A 3CF5Q 2UVWA 4ICLA 2ZH2A 5THWA 5E41A 2V4JB 5EX0A 2PD1A 1IKVB 2IVYA 3M2VA 3GV8B 4AL6A 1A9NB 1CLFA 3HHNB 2HRUA 5KFJA 2HPUA 3HVWA 2VFSA 2ATLA 4YR3A 3VR1A 4EFAC 1FKOA 5HBMA 4PXEA 4B9SA 3MXHP 1U2FA 4KTQA 1X8DA 1HBOA 1YGYA 2LQ9A 4NRUA 4RLEA 4TYBA 3OQ2A 4YB5A 1FF2A 1RT4A 3L95X 3V6JA 4XDCA 3N0VA 3D0GE 4MAKA 4IH6A 4P7VA 5HMXA 1QSLA 5KFEA 2I9SA 1HNIB 2HNDA 1NU4A 3GYXB 1R27B 1WEYA 4NYPA 5A8KA 4Q0BB 2B5JA 3SCKE 2ZH8A 4IFYB 5C25B 1X9WA 2BRLA 4ECYA 3MUTP 1GX5A 5KFIA 1NKEA 2AJ4A 2L08A 4ELTA 2FTRA 2KDOA 1FCAA 5KFGA 3SI8A 3DFEA 4Y2KA 1L3SA 1R8AA 1KLMA 2BZ2A 2XY6A 4C8KA 2FDNA 4K4XA 1LV5A 2KVIA 2DHSA 3ZZRA 3NS6A 2IM1A 4I68A 3CTRA 4H4KA 1VQ8S 4MMOA 3DHXA 2B7CB 4Y00A 4H4OB 3I32A 2IHR1 2AD9A 1T03A 1WNEA 4DFPA 2ZD1A 2FIUA 3AJ1A 3E51A 4NLXA 4A8XA 3MWBA 4B08A 1NK0A 3O44A 1U1RA 4RW8A 4KPYA 4PG8A 4ZHRB 5HLFA 4EO6A 2AW0A 2RT3A 3EXCX 2HFOA 5J1NA 5KOXA 2VOPA 3Q23A 2Z0GA 1TKDA 2GA7A 4OHVA 1SI9A 2K2PA 3DMJA 4OX9F 5G0RA 3SCIE 5DDQC 1YJTA 4YB1P 3UE2A 4JI6F 4DR5F 3T5JA 1FKPA 2BBEA 3HMJG 4DN0A 5KAKA 2R9LA 1NJXA 4DG1A 1W2IA 4PRFA 2CPYA 3LOUA 5CYMB 4YB6A 3ONQA 1FRJA 3DOKA 3OR1B 1FEHA 5CYQB 2EKYA 3NP5A 2E1CA 1GH8A 4I6YA 4I6AA 3J81Y 3CCRS 3T3FA 5I42A 4MK8A 4Y2IA 4C8ZA 2XWYA 4CH0S 4JI1F 2ZZMA 1WTBA 3JSBA 4IG0A 3FFIB 3SEOA 5K8NA 3QJPA 5A6WA 4GKJF 1KONA 3CIMA 2FLOA 2U1AA 4TY8B 3CCWA 1X7VA 4ZCKA 3D0HE 2MYFA 1YRXA 4O4RA 2XMJA 1W2BR 2W9CA 1JLCB 2W25A 1TAQA 4WIIA 1G1XA 2M4MA 2JEJA 3FZBA 2X1FA 4RBTA 1WHWA 3VAFA 3RB3A 3IR5B 5ADZA 2OIHA 4ECZA 5KFRA 4ECWA 3MMBB 2Q79A 5ITHA 2V4JA 1IKVA 4LF5F 2IJNA 2YKPA 4F4WA 1SJRA 2ROPA 3PEHA 2XHWA 1NJZA 4B3MF 3AHPA 2HGNA 2JZ5A 1DLOB 2HS0A 5L1KA 5BYSA 1SJ4P 4AXJA 3DXSX 5EUHA 2V8VA 5A0YB 3KYLA 5L9XA 4HVZA 5CH7B 5LXYA 1TV6B 2J7KA 5AXLA 4OZ0A 4USHA 4ZS6A 2E66A 3GFZA 3KLVA 4BWJA 4DL0C 5FJ4A 5F41A 3QO9B 3DLHA 1LXJA 4F3MA 2UVUA 3MTKA 3H98A 1HNIA 3CDAA 5D6GA 2OMOA 3D2WA 5KG4A 4Q0BA 5DETA 4IFYA 3H59A 1VC6A 5DG8A 5CQGA 2MHEA 4YR0A 4PQUB 1HYSB 3MM9A 4A46A 4UOCA 2FY1A 2IBOA 3J7ZT 1G7CB 3LP2B 5SZTA 2KFYA 2C3UA 1Y0HA 2RB7A 3P49B 3HHDA 1RK8A 5GADI 3PR4A 4GC6A 4H4OA 1QVFR 4I0WA 4DS4A 3KLGB 3LAKA 1TAUA 3IR6B 5KT4A 2PA3A 3CJ4A 2CQDA 4O3SA 2BYCA 3HHLD 3MUMP 1X4EA 1CQNA 2YKQA 4ZHRA 1M5OC 4IOCQ 1WWHA 3BN4A 3CE8A 5J1PA 4DUZF 4R0EA 2BXJA 1UMJA 4JI3F 4NPOA 2FHMA 2MKIA 2XGQA 2ZH3A 1XNRF 1DJ0A 5T7LB 3HHEA 5L39A 3D28A 2OPSA 3RW7A 4J5OA 4K4WA 4BC9A 3JYTB 3C6UA 2QV6A 3PZPA 4I7FB 3GIJA 4F8RA 2ZH1A 5GVQA 4JV0A 2MQNA 5CYMA 1HWKA 5D77A 3RU0A 5AE2A 2UUWA 2JEIA 3OR1A 2DHGA 5CYQA 1RA7A 1Q82T 2IM3A 5EWEA 2VA3A 3I6PA 2DGWA 2N7YA 2ZH7A 1BC6A 2IRXA 4HT7A 4EYIB 3R5BA 3FFIA 5CD4H 2B9WA 4FXVA 3UFCX 7FDRA 1HBUA 3MFIA 1U45A 2R7XA 5A8WB 4TY8A 1JJ4A 1FERA 2VG5B 1XWLA 1JLCA 2MPUA 1VQOS 4WE1B 3OSNA 2GQQA 4D3GA 5F8JA 3E3XA 4KV8B 2FGCA 3T6JA 2YVSA 1U1KA 3M6VA 3NL0A 2DITA 4JI8F 2KFZA 3C66A 3MMBA 5L1LA 2CIMA 1HWIA 3GG1A 5C42B 1YJUA 2DH8A 2FVSA 5JVGQ 3OXFA 2CPXA 1VK8A 1S77D 4I2PB 1U49A 2D3ZA 2GHVC 2VH7A 2YX1A 2E9RX 4URGA 1Y5IB 2DNNA 1DLOA 2RE1A 3RW6A 3LAMA 2CPEA 1VMBA 5A0YA 5H9EJ 4O44B 5KFCA 1RT2B 2ZZNA 1TV6A 2CQ1A 2BE2B 2XI2A 1U6BA 3ISZA 1ZH5A 3IA0A 1EETB 3PX6A 1SJQA 3IWXA 3QO9A 1N48A 3AH6A 4B17A 4EZ6A 3T9NA 1N56A 4ZPWR 2CQBA 3M6UA 3PFOA 4GO5X 4EYHB 2E7XA 4KKOB 2NREA 4B3TF 4F4KA 5DG9A 3K7RA 2PI4A 2QO3A 1FRHA 2Y1IA 2GNKA 1JJHA 2WBRA 4OI1A 4PQUA 2G0CA 1HYSA 5E2QA 1NO8A 2GIQA 5AE1A 5B08A 3SSSA 5B09A 2C3PA 1ZYQA 3C6TB 4NXMF 1F5CA 1PILA 1VIOA 2ZC3A 4C4WA 4M5DB 4LF6F 5KT7A 1SH3A 4ZPCA 3HM9A 4KC5A 2DNQA 3KLGA 1HNVB 4ED0A 1QTMA 4ZVFA 4DS5A 2XMMA 1Y5NB 2L9WA 4LVNP 2YWEA 1DQ8A 2CVEA 4UW2A 5DRKA 5HO4A 2CPJA 4DEZA 3C8YA 1H3DA 4ZVEA 1R43A 4XIUA 3GR0A 3IN5A 5M2RA 4KHPF 4DL2A 2ZKTA 3DRYA 4XDDA 1S72S 4MJKA 3CULA 3BO2A 5KFNA 4DR1F 2N4DA 2EFOA 2RQCA 3VWSA 2NZ4A 5A8RA 1QUPA 4C8NA 1GTEA 5KFOA 3T9ZA 4GMKA 4JI0F 3BR9A 1JJ2R 2CRLA 5T7LA 5KT6A 2W4DA 2E1MC 4DLGA 4X2BA 1KC8T 2AYBA 3JYTA 4K4TA 4I7FA 2M0GB 2UVVA 1IJFB 3BF4A 1PGZA 1P8GA 4ZPVR 2JLFA 1HA1A 2EWHA 1K73T 2XMTA 1SQEA 2GV1A 2HGMA 4NA1A 2P9GA 3VAMA 4HDHA 3T1HF 1UL3A 1TL3B 3QIPB 2RJZA 3MM6B 5F8NA 4X4UA 1FKAF 2PFFB 5KOWA 4QOTA 5A8WA 3BQ0A 4DR7F 4OLPA 3OBIA 2YKMB 2VG5A 5J1EB 3LALA 4WE1A 2EK6A 5CHCB 5B0BA 5JUMA 2ZUGA 4FXDA 4QR2A 1FDAA 4YDDB 4I64A 1FO1A 4K4YA 2W4CA 4IOAQ 3R27A 5D8HB 4UY85 4L3NA 1L3TA 2OD6A 1C4CA 3PJXA 5L9NA 5C42A 3OL8A 4KHMA 2MZTA 2VC1A 5D3GB 4I2PA 2RVJA 4LIRA 4N8NA 2E1RA 2KT5A 3QWPA 4DHVA 2JC1A 4DF4A 4JI4F 1U1MA 1UJ6A 2ZH6A 3KK3B 5IT0A 4O44A 1RT2A 2I1RA 3MR6A 3CXCR 1CPZA 4WFYA 1UEUA 2BE2A 1X9SA 2W8KA 2AJQA 1EETA 1JLQB 3TVZA 2PMHA 4N56A 4J9QA 4X4OA 4OZJA 2KRRA 2DT9A 5F9NA 4DOZA 5B7WA 1F2GA 2VC0A 4DSLA 2J5AA 1K1QA 4M8LA 4DFMA 4KKOA 2Y1RI 3UD4P 1AROP 2KKHA 4MIBA 4K5RA 1B7FA 3H5UA 3WC2A 2DHXA 2WCXA 1XK8A 3UW1A 2N3OA 3ITHB 4PWDA 1NAQA 3OFGA 2MSTA 3UDCA 3C6TA 3HVTB 1U1LA 2H9ZA 2M5YA 1C1BB 2MB0B 3PO4A 4IR1A 4ZPTR 4M5DA 1HBNA 3THVA 3R5AA 4M1KA 4RUCA 2EK1A 3BR8A 1NK4A 2HW3A 4F4YA 1HNVA 5KFXA 3W2WB 1WI6A 2IMOA 4CQ1A 4B9MA 1VHFA 3M2RA 4NLQA 2PI5A 2LKZA 2RF2B 4YDXA 3K5LA 3DLLQ 2KJWA 3O5TB 2BM0A 4TU8A 2J0WA 1S49A 1S9EB 2L48A 4YUDA 2DJWA 3DXBA 4HL9A 4MFBB 5DJBA 5K14B 3BO3A 3KLHB 3PVXA 1HD1A 4Q45A 2FB0A 4QIGA 4ID5B 7FD1A 4F2RA 2FHJD 1HD0A 4ELVA 1D8ZA 4MIAA 2RDIA 4DBQA 1VFJA 4Q5VA 1VQKS 3NKYA 3ICLA 3OTEA 4X65F 1UVKA 1P1LA 2CQ2A 1YJVA 2YX7A 2C28A 2GC8A 1YRUA 2YWKA 3QMQA 1KTQA 4L72B