2XMVA

Copper chaperone atx1 from synechocystis pcc6803 (cu1, trimeric form, his61tyr mutant)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
63
structure length
63
Chain Sequence
TIQLTVPTIACEACAEAVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGYEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the Metal-Binding Versatility of Copper Trafficking Sites .
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Chaperone
molecule keywords SSR2857 PROTEIN
total genus 19
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xmvA00
2GFFA 2HLTA 3TRGA 1APSA 4OJHA 2VH7A 2GGPB 3GZ7A 2RU9A 1XBWA 1KVJA 2LDIA 3HHLC 1YJVA 5T7LB 2ROPA 2K7JA 3DCAA 4HH1A 2HLUA 3FGVA 3UDCA 2GA7A 1SI9A 3K7RA 5F0UA 5B0AA 2W4PA 2OP5A 1U7LA 2Q3PA 1KQKA 3BDEA 5B08A 4HI1A 1N5SA 2K1RA 3I9ZA 2W4CA 1FVQA 5A6PA 2HFNA 1IUJA 1FESA 2N4DA 2GGPA 4QOTA 2QIFA 2ROGA 4DPOA 4OJGA 1Y3KA 4Y2MA 2PGCA 1Y0HA 2OMOA 1P8GA 2ZDOA 2FHMA 3FMBA 4ZA1A 4A4JA 2XMUA 5B09A 2LQ9A 5B0EA 3MCSA 1FEEA 2BUNA 1CC8A 1K0VA 2BJEA 1TR0A 4DL0C 1TUVA 2N7YA 3BR8A 1WD6A 1MWYA 1CPZA 1VQSA 2K1RB 2OKQA 3LO3A 4Y2KA 3TNVA 1Y9OA 2ZDPA 1YJRA 4OJ1A 1S6UA 2AJ0A 2XMTA 1YJUA 4NL5A 4F67A 1FE4A 1URRA 3BB5A 3LGNA 1N5QA 4EFAC 2KKHA 1Q53A 2RMLA 3MZIA 2GV1A 4OJ3A 2IYIA 2OAUA 2QYCA 2ASYA 2FIUA 3E8OA 3VTIA 3FRYA 2W4DA 3IWLA 3WDOA 2FB0A 1X8DA 2BJDA 1W2IA 1X7VA 1ULRA 3HHLB 4YEAA 3HFKA 2OFHX 1GXUA 3HHLD 4A46A 2HFOA 2IFXA 2LXFA 3HF5A 1JWWA 3QGPA 2AW0A 2XMJA 1Q8LA 3DXSX 1SB6A 4OIXA 4DN9A 5B0BA 1KVIA 2BBEA 3HHLA 1AFJA 1CC7A 5K9FA 3KG1A 2ACYA 4HI2A 2RILA 3IWXA 2RSQA 5B0CA 5KAKA 2QLXA 5B0GA 1YJTA 2XMMA 4ZOSA 3TOQA 4A47A 1AW0A 1YRXA 2CRLA 3KKFA 4U9RA 2VV5A 4FNHA 5B0DA 5IXUA 1AFIA 1OSDA 2HIQA 3LGMA 4HH0A 3BM7A 1TL5A 3KNGA 1GXTA 1OQ6A 2AP6A 3KG0A 4YDXA 1FE0A 5A6WA 3BF4A 4Q2LA 2XMWA 2G9OA 1Q4RA 4NPOA 1VQYA 1P6TA 2K7KA 1LQ9A 2JDJA 3QMQA 2KT3A 1RJJA 3CJKA 2BYCA 2GCFA 1YG0A 1V3ZA 1OPZA 2EW9A 2HQIA 2IYGA 2OD4A 2ROEA 2K2PA 1OQ3A 1SQEA 3HDSA 2GO8A 1N5VA 1JK9B 2AJ1A 4FNIA 4Y2IA 1N5TA 2OFGX 3CJKB 1FD8A 1FVSA 3HX9A 2XMVA 4A48A 2KYZA 3T9NA 1TL4A 4HL9A 5B0FA 1R6YA 5F0WA 3F44A 2XMKA 5T7LA 2LQBA 1Q8BA 2PD1A 2L3MA 1S6OA 2KT2A 3BN7A 2QLWA 2OD6A 2N4CA 2FTRA 3BGUA 1MWZA 1Y3JA 1TZ0A 4Q2MA 1X0PA 1QUPA
chains in the Genus database with same CATH superfamily
1EETA 4ZVFA 3A3NB 3CTRA 2I5JB 2VA2A 3LWLA 2EVZA 3FK4A 3KFWX 1DTTA 3OR1B 1SUQA 3M2UA 1W7WA 3SDEA 1QE1B 2BR0A 2CQ4A 1S1UA 3TJ8A 2XLIA 3K59A 2U1AA 1ICEB 3Q8YA 4ED0A 2ZNYA 3AH6A 5F0UA 2EG1A 3BBBA 5K8PA 3T3FA 3EPGA 3POTB 3H4DA 4GVLA 1RWVB 3EGNA 5HANA 5ETOA 3KHLA 2AV5A 4ECVA 1I94F 5IM0B 2BRKA 2GO9A 4HT5A 1OY8A 2LEPA 3NCRA 4TLRA 5J1NA 3W5YA 2GGPA 2HFSA 3RGIA 5IOLA 4GO5X 3Q8RB 1FCAA 4NA3A 2AHOB 1XK8A 4Z7YA 1FJCA 5HBMA 3HHNB 1S0VA 1Y11A 2H65B 4IYQA 1RWKB 4LF8F 2V4RA 1DFDA 4NLXA 3R7SB 4DU7A 2BUNA 3H8YA 3MM7B 4OHYA 3MTJA 2DCLA 2ILZA 1Q86T 4Y3CA 1HNWJ 1WF0A 1DLOB 4OZ2A 2OKQA 2PFFB 1MROA 4ZVEA 3DM2A 4OJ1A 3J7YU 3TUIC 4OYAA 4I1TA 4TN2A 1NH8A 3NMAA 2YTCA 4DXLA 2Z2LA 3V4IA 1UW9A 2HW3A 1IM4A 1HWIA 2FUG9 2VFRA 4LQ9A 4A8XA 4P2SA 2XCPA 1RWPB 4FPRA 3QJPA 1YWXA 2O66A 2QYGA 5IT4A 1MU2B 2HNDA 2DGQA 3H90A 2MZJA 1FRLA 1TKZB 2AYEA 3QNWB 1W2BR 3IWLA 1SXLA 3DU5A 1Z4UA 1YK9A 2CNLB 1K8AT 3GLJA 3H25A 2DRAA 4O0IA 2X51A 1HMVB 1S57A 2YNHB 4IQMA 4LSLB 2RDJA 1FDDA 1SB6A 1EB0A 2DIVA 4JB8B 1TMMA 3BKFA 3P4UB 1WDTA 3CCZA 3PACA 1CC7A 4HLBA 4URGA 1NMEB 4OV1A 3Q8QB 4DF8A 2AD9A 2FJWA 1IQTA 4JI2F 2OHDA 1JLAA 4K2JA 5ETSA 1RWMB 1QAYA 1CSJA 2F8MA 2AJFE 3NGTA 4JI6F 1IBKF 4QWBA 2UU9J 1UKUA 1S97A 3MFIA 2CG8A 2E5HA 3OUYB 2M8DB 3X3UA 2Y9HA 4OZNA 1FKPA 4M8LA 2CQ2A 1S1XA 4YFUA 1SKRA 1RWXB 2QZ8A 3QT7A 1LV5A 3NS7B 3WX4A 3LPEA 2LU1A 4DR5J 2NSBA 2VA3A 2FD2A 5E7OB 2BANA 1LWCB 4F4WA 3RG6A 1KNZA 1BUXA 3BM7A 4J90A 4ALZA 5F9LA 1YITS 2EBGA 3AY0A 3QIDA 2DT9A 3TA2A 4JI4F 1P9YA 1NDPA 2XMWA 4M5DA 4PKDB 3W9JA 1JJCB 2P8IA 1RTHB 3DGVA 3P5BP 2ZEJA 1NCLA 1NNDA 1LQ9A 1IKXB 3BZQA 1SVDA 5CYQB 5DZ6A 2UVRA 3U1NA 1UPPA 2ROEA 1N6QA 3BSOA 1CJTB 1R8AA 1T02A 2QLJB 2V8VA 2NPFA 3ZC4A 3V6KA 1N5VA 2WVEA 3DYAA 5HVGA 1ZPWX 4I6WA 1WNEA 3SFGA 3R9LA 3UNYA 2BE7D 2HVEA 3W2WA 4OL8A 4NXNJ 1IKWB 4JV0A 4CLTA 4IKAA 4LRCA 3VGTA 3T5KA 2RS2A 2ASLA 2G1DA 2JEGA 5HQLA 1RTIA 3CDUA 3CJ5A 4C48A 4X62F 1FJGF 4UQTA 3BGUA 3D6TB 2Q79A 5CABA 2DY9A 1TZ0A 2DO4A 3BYRA 4L76A 4RR5A 2DXDA 1EIYB 1PG5B 3P6YC 2UXBF 2B9XA 1CULB 5ETPA 5KFHA 1VQMS 3MAQA 4U6PA 3TRGA 5A8WB 3BS9A 1VC5A 2CPIA 3Q2TC 2V0NA 3GZ7A 1KS2A 3WX8A 2BOPA 1KVJA 4ILRA 2LDIA 4HDGA 3QFWA 4LFAJ 3MMJA 1C0TB 2C2KB 2CJBA 2E9TA 5G0RA 2HZVA 2GA7A 4LQ3A 2K8GA 1IKVB 1FFGB 1FA0A 2MZTA 3NL0A 4QYZJ 4OHVA 1HKAA 5HMYA 3HT3A 1M5SA 4ELUA 2HAIA 3PJXA 3ZTRA 5IFMA 2VG7B 1CJKB 3I5BA 3TVYA 4HYKA 1RT2B 1UZDA 2OSQA 2H3EB 4DV6F 4AFFA 4ECYA 2GZOA 1DTTB 2XULA 2CFXA 3M2RB 5A8RB 2RU3A 1WG1A 2KVIA 2R4FA 4DBQA 5KG3A 4G65A 1Y0HA 5KG2A 1GMWA 3UVJB 3BQ1A 5HLFA 4DR4F 2QFJA 3AA9A 4E2FB 4DS4A 4XAKA 4GKJF 5GAHI 1JLCA 3Q86A 3GV5B 3G82B 3LP0A 3N5BA 4B3MF 5AT1B 1SV5A 2RHQB 2W8KA 1WC3A 4C9DA 2V8PA 3O6QA 4J9RA 3EYZA 1QY7A 2D3O1 3OSPA 1TL1B 2VF3A 1TK8A 1NHUA 2DR6A 2DNZA 4PXBA 1UTAA 4I2PB 3MZIA 5D15A 2ZH5A 4K4TA 4U8YA 4CYUB 4OZ3A 3C15B 4CLZA 4M5LA 4QIFA 1SC3B 5KFBA 4GRSA 3ENWA 4YEAA 1KBRA 1S99A 5K8NA 2FGOA 3NOCA 5HMZA 1RWOB 1VQPS 2BE9B 1S76D 2YKQA 2OIHA 2DNLA 2ZE2B 1TUWA 2Y0BB 4FS1A 5DO2A 1S72S 3U02A 3SXLA 4YS2A 4FYWB 1RT7B 3QZ8A 3CC2S 3CJ3A 3NWGA 4IDKA 5E41A 5EWEA 1MU2A 4R0EA 5HROB 2W2PP 3N28A 2B4PA 5B0CA 3KK3B 4O3QA 3G6ES 3MUTP 3RB0A 2NYIA 1XMQJ 2UUBF 2OLWA 3MR6A 1F9FA 2CQIA 3H5UA 5HK4A 4K4XA 3M30A 3EWGA 4X4RA 4G1IA 4M5NA 4EUVA 4NEZA 1JLBA 3LP1A 2B9WA 3M2VA 4IOBA 2VOPA 4N56A 4LSLA 5IXUA 4JI5J 1OSDA 1D3WA 2HVDA 4BC7A 4Q45A 3OL9A 1M5KC 4IFVA 4NCGB 5I3QA 1JLAB 2MHEA 3ETMA 5KT4A 4YR2A 4YP3A 1FWLA 4KTQA 1PCAA 4NPOA 2DGOA 3OW2R 1UVIA 2G0CA 3UWTA 3EX7B 1ZZFA 3PRDA 2NR0A 1T9WA 3THPA 3R1LA 4USJC 3TZWA 3EVOA 2R9LA 1IR2A 1OJ4A 2IBOA 3DU6A 2ZH7A 3TANA 3BH6B 1FDNA 4NXNF 1VQ9S 1WJ9A 2DR7A 3SYZA 2DJWA 1YRTA 4RNMA 3DLGA 3ELHA 1ITPA 5CYMB 5J1PA 3Q8PB 1N0UA 1Q8BA 1RSCA 3SCKE 5L1KA 1VQKS 2C3OA 1XC9A 2W2MP 1S6OA 1WTBA 5CYQA 2QLWA 3GV7B 4J9MA 1N5YB 3C3LA 5F3TA 3MOZA 3T1HJ 1NZ8A 2FC8A 1RHJB 1JQGA 1EP4B 3FEZA 2BMBA 3AJDA 4ICLB 4F36A 2EBEA 1H7XA 2W2OP 3ZZZA 3MPDA 3I55S 3HHKA 1NPKA 2Q6CA 5C42A 4KHRA 2RKIA 3GR0A 2IRYA 1KTVA 2I5JA 2RIJA 3KLIA 2VPYB 2DGWA 2J7WA 3JAMU 4JYAF 3P49B 4ZHRA 3CO0P 5GADI 1T03B 2FC9A 3BPDA 2VKZG 5L46A 5B08A 4M1KA 3UD3P 2F5GA 2ZWPA 2WK4A 4KR0B 1NSPA 1GFWB 2J0XA 4LRAA 1J5OB 5F8LA 2CPFA 4X4UA 4QPXA 1X5PA 3MGJA 4HTJA 3PYEA 4DR4J 4LRBA 4URQU 2AGPA 2V2KA 3W7BA 1RT6B 2IM1A 2LQ9A 3HZEA 2MGZB 2V2ZA 1S1TA 2BJEA 3QLHB 3UD5A 8AT1B 3W2VB 1TUVA 1ZAVA 4J5OA 1ZM9A 4C97A 1NM2A 5HBMB 2RUGA 3GP9A 1V3SA 1EZZB 1RYRA 3ZZTA 1Y9OA 4IFYB 2YNFB 3A8EA 3C6TA 3L09A 5KFFA 3K57A 1HNVA 2M52A 5LSOA 1YDLA 1YQHA 2R7TA 2LMIA 1IR1A 3ET6B 4QYRA 1Y5NB 2UZAA 1S10A 1GMVA 1URRA 2PDAA 1WKLA 2MJNA 5SUHA 3OTOF 1K1SA 5ITHA 4FKYA 2Z56B 4UOHA 3ISZA 4XO0A 1URNA 1CEZA 4P10A 3FRYA 1FTRA 1VISA 2EC2A 4RW8B 1R0CB 3U1LA 3HHLB 2IVFB 3KLHA 2CQHA 1WC6A 4IRDA 4C8NA 1SIWB 4HVZA 2DNNA 3I31A 4LVOP 3TEGA 3MTKA 2IJFA 5DGAA 2G1HA 3FKBA 5KFMA 3JSRA 4USIA 3WQPA 3QT8A 2YPYA 1G7CB 2HQCA 1XMOF 4P7VA 4CO1A 2D3UA 3CUNA 5KAKA 3DGPB 4DQIA 2OPQB 4USWA 1AW0A 4K0KJ 1IQZA 1FO1A 3A8JA 2LVWA 3D9BA 3KKFA 1UA1A 4K7QA 2YX4A 2CPXA 1PJ7A 2KRRA 1KWMA 3IBWA 4ENOA 5LM7E 3LGMA 3OJSA 2JVOA 3UCUP 1NK8A 4ANEA 5JUMA 3OL6A 4DG1A 4I6YA 5HROA 2F3JA 1PSDA 3R7BB 2HQFA 3P8BB 1B7FA 4X4VA 2IJNA 2MSSA 3MMBA 4RO0A 2A6MA 3B54A 3UPFA 4P7TA 3KK3A 2KHCA 3ILLA 2D3OR 4FXDA 3MPWA 4U96A 2GCFA 1KR4A 1L3UA 3L4BC 2Z2YB 5KFNA 4J7CA 1OQ3A 1HLWA 1SQEA 2NXEA 3K8VA 1JK9B 1U26A 4HACA 4BBYA 4YHHF 4JI2J 2UUWA 1MN7A 3QYYA 4G1QA 3PX4A 1S6PA 1IBMF 5IT9Y 2E7VA 3AT1B 3I56S 4DR3F 1SL0A 2GC8A 2R8KA 4ZLPA 3IP0A 5A76A 1QDUB 3VZHA 4K4UA 1SUQB 5D4NA 2C2EA 3MD1A 4O3SA 3E51A 3V6DB 1P9QC 1PJ5A 2WSFC 5J2QB 3RW6A 4DOZA 2WW8A 3W63A 2M4MA 4DQPA 2BACA 4C11A 2F4VF 3AB4B 3EMTA 1F5BA 1UW4A 2N4CA 2OD6A 3H5YA 1MN9A 2R2SA 1VK8A 4DV0J 3RRKA 3PW7A 1XNRF 3VF0B 3PDNA 2UP1A 3KK1B 3MM6A 4WWSA 4ES1A 3OBIA 1TP7A 3LWMA 2EXUA 1DTQA 5KFJA 4OHWA 4ECQA 1G2EA 5H1SV 4WFBQ 3KHHA 4PG7A 2ERRA 3GILA 2B7CB 2V4JB 3SQOP 2V69A 2Y3YA 3C46A 1NB7A 2B5JB 3GFYA 5IV3A 2FY8A 5KFKA 2QSWA 5GAGI 3V81B 4QIGA 1TKTA 2ATLA 2E5GA 5G0RB 2BE2B 5KG7A 2DR5A 2HHSA 1LFWA 1FDBA 1FERA 2MTLA 1GEHA 3ITHB 4DUYJ 4LFAF 3MAAB 2OI2A 1REGX 3MR2A 2FGCA 3O8WA 3OR1A 3QO9A 4QCLA 1ZBTA 1WC4A 1Y3KA 2HZAA 2MHNA 3W60A 4ZVOB 2XBPA 4FBUA 1H2VZ 5MAOA 2YKMA 3Q89A 1VQ7S 1VQ8S 2UXBJ 1L3TA 4A8WA 3FSYA 4I0WA 5B0EA 4KJIA 2DGUA 2W9AA 3W66A 4B08A 1WHYA 2NXNA 3DOLA 4LVNP 4P2MA 4DL0C 4ZN3A 2N7YA 4ETXA 1UVKA 1DHMA 1EX8A 3FCVA 4I4BA 8ATCB 3J81U 2GQQA 2OELA 2M3DA 2P6TA 2H4WB 4AUKA 1HBUA 2GNKA 2IAJA 4O23A 3SQGA 4U95A 4QWCA 1UEUA 2GVZB 2CZ4A 1VJWA 3GPAA 1D9AA 1VHIA 2W01A 2XI2A 4DPYA 1Q81T 3I0RA 3NP5A 5LJ3Y 2MXYA 2BW2A 1TELA 5DDQC 2MGZA 4NLQA 2KRBA 2MZQA 4I56A 4R5PB 2D1CA 3QLHA 1QSYA 3Q8VA 3T6BA 2FLPA 4ZITA 5DDRC 1CBKA 1T9YA 4Y2AA 2RQMA 5KFRA 2DNQA 2HFOA 4WP9A 4ZS6A 3K58A 3QIPA 1YZ7A 1HFEL 1Q8LA 2MY7A 5IT0A 3VGSA 2BQRA 2J6SA 1RISA 4DSIA 2BBEA 4PRFA 2XY6A 4UQGA 4M5IA 4C4WA 1E6VB 1C0UA 2VPXB 1LOUA 4YMEA 5KFIA 2BJ1A 2XZTB 3R2CJ 4IH7A 3D6FB 3PV8A 3HSJA 1ZAXA 3H40A 3UN2A 3LQVA 1NHKL 1GTHA 3IO1A 4Z37A 1S4FA 3DOKA 4RNHA 1FI4A 1OPIA 1G6BA 2DH7A 4ZVGA 5J1EA 1X9WA 1GX5A 1VIXA 4P71A 4B9NA 3M9OB 4DR1J 4DR7F 2A0FB 3BSAA 3N01A 4C8OA 3IR6B 2VONA 2GW8A 1K9MT 2DPIA 4FXWA 3AODA 4H4OA 3W61A 1N33F 2HURA 4IRCA 2LXUA 3HD1A 3BYPA 1OMSA 1VQYA 2YKPA 1C1CA 3DGPA 2Z30B 3MEGB 3HPOA 1K44A 3RB6A 3TAPA 1HQUA 2QA4G 3TWZA 4QW9A 4B9SA 2RNEA 1SJQA 2IYGA 4F2SA 3O5TB 4TU9A 1U6BA 4Y2IA 2E9RX 2FVCA 2W9BA 3R5BA 2EFGA 5A8WA 1YI2S 4BS2A 2E5LJ 2KDOA 3L7UA 2HG4A 2DH8A 2PIIA 2Z57B 3GIKA 4BDPA 1UVMA 2GMJA 4AL7A 3MMBB 3KHRA 1T9XA 1DURA 1SQFA 4KC5A 1S48A 4ZP6A 4CI0B 4JI5F 5DM7Q 1Q5YA 1Y3JA 1LXJA 2FYXA 3TARA 2VODA 4FYXB 1N56A 4S0MA 2ZFHA 2ZBIA 4KBIA 1EQMA 5K8OA 4ANDA 1WI8A 3CGIA 3GFHA 2LQ5A 3IR7B 3C6UA 5E3AA 4I68A 3A3PB 2KXNB 2C22A 2BQUA 4CLWA 3OSNA 3EZUA 3FMWA 2HHWA 1YGYA 4F2RA 1SI9A 2VKRA 4DV2J 3K7RA 5E33A 3W65A 1FJEB 1SL1A 5D4OA 1R8PA 3OTOJ 1NJZA 1BHNA 1U7LA 4MFBA 3TUJC 1DQAA 3ZZOA 3Q0AA 3X1LB 2ZBRA 4U7CA 2W4CA 1FVQA 4RPFA 4UT4A 1Q78A 5J2NA 4K50A 4RUAA 3MEEB 1U25A 5E5NA 3QFHA 5D4LA 2XYPB 2QIFA 1Y5LB 1U48A 1BMQB 3MECA 2DRBA 1M1HA 2JLFA 1F5CA 4OX8A 4CO3A 1C0TA 1RLDA 1RT5A 4L75A 4ZA1A 5LSLA 5T14A 4LR7A 2UUBJ 4I7FA 3T5HA 2VG5A 1ZA1B 3D28A 1RU1A 2J8AA 4EU0A 3QWUA 2MKKA 2FY1A 3OFEA 2F4VJ 3RAXA 2XLJA 2IA6A 2OPRB 1NDLA 5KFXA 4KH0B 4MIBA 1CPZA 1Q1KA 3SZ2A 4B3OA 1RT2A 3GJTB 4FDFA 1B64A 2H4YB 2XS2A 1JLGB 3FNNA 4IG0A 1LWFA 2AJ0A 3LP2A 5E0OA 3VCDA 1F3FA 2CVIA 3HD2A 1Q53A 2YH1A 3NGSA 2PSZA 4MK7A 2QYCA 2XHWA 3PNIA 3T19A 1JLCB 4JBCA 5ETTA 3BKTA 2MQ8A 2E44A 2PMWA 3G82A 3LP0B 3PYGA 4X66F 3VAIA 1C4AA 3JQMA 2DHGA 4KYZA 1FRXA 2IFXA 1JLEB 3KLEA 4KE5A 4WFAQ 2V50A 4WPAA 3M8QA 2M0GB 2C2OB 2GVZA 3DHWC 3SQGB 2HRUA 4NASA 3MM5B 4NZ6A 3HHLA 5IQQA 3U27A 5DQIA 2VIHA 3UD4P 2NYHA 1T7PA 2XS7A 1HYSA 2ZC3A 3WBZA 3DI6A 2R2UA 3SEOA 2VPZB 3G87A 5H9EK 1RB0A 1OY6A 2HK3A 2JC0A 4ED6A 3T1HF 2AQ4A 1RAEB 4ZOSA 1NSAA 1LWCA 2H54B 2D74B 4GKKJ 3JS9A 4ZPWR 2MJUA 1DARA 3IR5B 3U7JA 3PR5B 2P9CA 3UNGC 1Q8IA 1RAHB 5ETKA 5EWFA 2SXLA 3MMCA 3GQCA 3OJUA 2E5IA 3EGZA 4QU7A 2YQ0A 4JI0F 2VJVA 1WKKA 5F8IA 2JWNA 5KG5A 4B9LA 1TFYA 3M1VB 3AOBA 3GFXA 5DQHA 1S6QA 1PAEX 3DRYA 4Q5VA 3C19A 3UDVA 1X4AA 3S01A 3DKDA 4NWBA 4KHPF 4HR2A 4ZPTR 3NNHA 2XG8A 3HJFA 3M6VA 3P3DA 5F8JA 2JL9A 5J1EB 2C2NA 4NMLA 1PGZA 5HP1B 3M05A 2Z0GA 2VICA 4KGXB 4ZN1A 1R7IA 4ZCKA 2XNQA 2C28A 2UUCJ 3IAS9 2ZBCA 3ISND 4NA2A 1HHSA 2IRUA 2RJZA 2XMKA 3BBCA 4USUA 2LQBA 2GJ2A 5DS7A 1C1CB 1YBAA 1R89A 2JRSA 3FDSA 3UN3A 3HI9A 3G71S 4KGZB 1HQUB 4DQRA 1P1TA 2OPPA 1MWZA 5A0YA 3EDQB 1NPPA 1XTZA 3D4JA 2NS1B 4OLOA 3UR0A 5CYJA 1PILA 2BKPA 2DNKA 2HLTA 2RUSA 1FRMA 2DHXA 3GG1A 3R3TA 1O8BA 3FEXB 3DLKA 1HNIB 2VG6A 1IKVA 2CQGA 4L72B 2KVQE 3JTPA 3QT5A 3G6YA 4F4ZA 4A8QA 3MI7X 2XSJA 2B43A 3QPIA 4FVMA 4DR7J 1WSVA 3SV3A 2VC1A 1QVFR 2ASJA 3B78A 4LF1A 1RYSA 3OQ2A 1S9EA 3CMQA 2XWYA 3UQSA 3UFCX 4NLVA 2GJFA 1VRUB 3D1QA 3W2VA 3VAHA 3BDEA 1RTDB 2DYAA 3KJFB 4DN0A 2AKWB 4ZVSB 4Z2XA 1S0MA 4IH6A 4JV5F 3DMJB 4F3OA 3ENAA 5KOXA 4F8RA 5HVHA 1HNVB 2N4DA 3R6LB 2DEJA 2GAHC 3PFOA 2KYXA 1N48A 3QJLA 1FNXH 3I0SB 5BYRA 4QW8A 3RW7A 1U45A 2DPJA 1K0TA 2FHMA 1SV5B 3C16B 3OTCA 1H7WA 2E5JA 3HVTB 2AYGA 1IWGA 2KN4A 1AB8A 3HSGA 3MEDB 5GAHU 4F04B 1PKUA 3CXCR 1YIJS 5GAGU 3AB2B 4B9TA 1Q16B 2YWGA 1YZ6A 3PW2A 2J6TA 2HNYB 4PWUA 7FDRA 1H2TZ 4NLTA 1LXNA 3M8PA 3D6MB 2A1BA 2DNPA 3MPUB 4ZJQA 1HWKA 2ASDA 1J5OA 1R0BG 4MYUA 3C15A 5LMUJ 3D6HB 5GMEA 4ECRA 3IG1B 4G3IA 1H73A 3BKUA 2HS4A 1XR7A 1LKZA 4LR8A 3NY0A 4ATNA 2BV3A 4F67A 2RMLA 5H9FJ 1VK3A 3AXKA 4A8SA 2C3YA 2RS8A 3D3CJ 3NGDA 2FIUA 3AHPA 3PJWA 4DV3J 3NBPB 1TU0B 4PG6A 2FB0A 3QSIA 4WE1A 1VGYA 1V5VA 2AJ2A 2MQMA 5KG6A 2FZCB 3S7RA 4LSNA 3TVZA 3UDLA 1E6YB 3OR2B 4FF3A 1LW0B 3HLUA 6AT1B 1TFWA 4BLGA 4EK2A 2EWHA 4RLEA 3ZO7A 4JV1A 2G4BA 4UOGA 1JWWA 3CJ2A 4IG0B 3JSMA 1IKYB 3DLLQ 1TTHB 5KG1A 3Q22A 1KOHA 2WOMA 3DC2A 2H9ZA 1NJWA 3TQEA 2ZITA 2JZ5A 4RUCA 2CYYA 2EKNA 2OO4A 3NXZA 4ES3A 4DS5A 1RBAA 2QLXA 4P2FA 4IO1A 4PYAA 5B0GA 2RF2B 2VDIA 3TOQA 4O44A 3QZ7A 2DB1A 4DV1J 3ZTQA 4DPXA 4O3PA 3JTOA 2CPEA 3G96A 4QR2A 3M8QB 3UI3A 3AQOA 1Q95G 4DPTA 1K1QA 1JB0C 1R8HA 4ED5A 4DV5J 3AXMA 4C8YA 4YR0A 1U2CA 1I3OB 1YSJA 1YBUA 2BKNA 3CWJA 3MMAA 3BGOP 4TLQA 3MCMA 4OYBA 4PPDA 5C7PA 3O2IA 5DETA 1GX6A 3AD7C 1ZM3A 3KNGA 1S1WB 1WF2A 1V3RA 2V9KA 3HO1A 2GO8A 4PABA 2I9SA 3C66A 3Q24A 1R43A 3PW5A 1RT3A 3VAGA 1NDKA 1BQMB 2XI3A 1IBLJ 1IBMJ 1IR0A 1F2GA 4J9NA 1MG7A 4RNFA 5ETNA 3J7Z5 4NXMF 2LP4A 3KHGA 5BJRA 4DCPB 2C2DA 2DR8A 4QBUA 4Y0FA 1VC6A 4JI1J 3KUEA 3CD5A 2IBKA 2MLYA 2DNOA 1VYAA 2Z4PA 2ZZTA 4J9VA 3ZTOA 5JVGQ 3IAM9 2FQQB 1S1VA 4PYDA 4BWJA 4Y65A 3H42A 2F9JA 1MLAA 3CJ0A 5BR8F 2HMIA 1WORA 2Y1JA 4PUOB 5LMNF 3QO9B 2DKOB 2CA9A 3P96A 3HHLC 2B9EA 3NS6A 4ZHRB 3KLFA 4TQSA 3H4BA 1T03A 1V6HA 4HH1A 4OI2A 1N32J 2UXDJ 2OPSB 2HLUA 4NCAA 1IBCB 4IG3B 4B9VA 1G3OA 1UZHA 1VR6A 1UPMB 2L9DA 2FVSA 3CC4S 2P9EA 5D78A 4KHPJ 2EPIA 3FBFA 4DUZF 5DLFA 2X1FA 4PQAA 3VHQA 4HI1A 3OTEA 2Y8WA 4DV6J 4ZPCA 1LK5A 5HJXA 2E29A 4EBDA 2H48B 2VL1A 4EI2A 3M4XA 4DL4A 4OFZA 3J7YI 2IA0A 4KQZA 3MCNA 1XERA 2K06A 3KLGB 2VQEJ 1P8GA 2OH2A 3GIMA 1T0TV 3I6PA 5LT5A 2LA6A 2KTQA 2YNFA 3C6TB 2FJVA 3K5LA 3EGVA 1RCOB 2HHPA 4DFJA 4DCOB 1KHVA 1TKTB 2JOQA 4N76A 1FJGJ 4I67A 4C8ZA 3CCUS 3LO3A 3TNVA 4WXOA 4OMFG 3PZPA 2ZDPA 2ZZMA 4M95A 4ZVTB 1KQGB 3H5SA 2IVMA 4J9PA 4I69A 2COLA 1RE1B 1C4CA 1RGVA 1PYSB 2H1YA 3QQCD 2HYIB 2OSRA 4ID5A 1KTQA 2V2QA 4WP3A 1HQEA 2UV8G 5HL7Q 5J2MB 1KRPA 2CPYA 1X4FA 2Q43A 4QR0A 1FNMA 1W26A 1T05B 4U7UD 1YJNS 3HVWA 3CCVS 4RZRA 4YN3B 1HIYA 4A8YA 5DQGA 2QL9B 3L3CA 3CJSA 4ZK7M 4UZBA 5FLXY 3DXSX 3HHDA 1TQLA 3L95X 3QRPA 1HWLA 2RE1A 4DV0F 2GX8A 4B3RJ 1JLEA 4M5GA 4X66J 2UVVA 1KSPA 4PWDA 4ZVPB 1PYOB 3F73A 3IWXA 2AX0A 2RSQA 4Y34A 3GIIA 1FX2A 1O5JA 2RQKA 4QWAA 1T9UA 3F41A 3CNQP 3LALA 5L8RC 1NUEA 4ELTA 1XWLA 3K8WA 2YPZA 3SCIE 3M9NB 1RLCL 2VU5A 4URSA 1AXQA 4LF6F 2AEMA 5HATA 4DEZA 2R7QA 2BOAA 4HKQA 2ZH8A 1UA0A 4TY8B 4YUDA 3OD2A 1GXTA 1EAYC 1OQ6A 3GCXP 4DLEA 4NZ7A 1PYTA 1YVFA 2NXUA 2ZD1B 3BF4A 1LFPA 2R8HA 4X4OA 4DI6A 2BANB 2CJYB 4CP5A 5KFWA 1T8EA 4CO2A 2LCWA 5FLXU 1BLUA 2GQCA 3CE8A 4OV6A 3CVKA 3HSDA 2HQIA 2BXJA 4WIQA 3TZYA 1HBOA 4WBFA 2K2PA 4CIOA 2MEWA 5K14A 3ZFVA 2HHUA 2FZGB 3GCWP 2NQPA 4WIIA 3AQPA 3S1TA 3GIRA 2MDAA 4DX8H 1YJWS 1VJQA 1BQNB 2FHJA 4RX6A 3D2WA 2QMWA 4C8LA 3DLJA 3ZZYA 2J6UA 2LXIA 4XPCA 4DV2F 3R2DJ 3RRHA 4DV5F 4OZJA 2CG4A 4OX9J 4DQSA 1RP5A 1T11A 4DSFA 2KL8A 2QA1A 1NJIT 1J2VA 3JYTB 3VR1A 1JXLA 2JEJA 1SH2A 5KFUA 1D9FA 1JNZB 5J2NB 3FQKA 3K5PA 5HAOA 5F9NA 4FYVB 1NO8A 5A0YB 3BN4A 4KFBB 4NI2A 3GSDA 4MKBA 1UP1A 2VQEF 1N8RT 3KTQA 3OPKA 2KI2A 4C8MA 4XDDA 4RBVA 1QAJA 3ONQA 1VBKA 1U0HB 3UDCA 4C3KA 1HL6A 1GT8A 2XGPA 2VG5B 3FSXA 4KKOB 3W8GA 4BC9A 1F9HA 1FFWB 5C24B 2JFKA 3MAAA 5K8MA 4DFMA 4RU2A 1GMUA 3CMAS 2BX6A 4PG5A 2NXJA 2CNNB 3NGUA 1N5SA 3NLCA 1OSCA 5IZHA 2FJBB 4DL7A 5J2PA 1RADB 4NA1A 3FZ2A 3C2PA 1VLOA 2YKMB 2WB4A 4ZJOA 3RRGA 1Q0NA 1CLFA 2VG7A 3DOLB 5AE2A 1QE1A 3FMBA 2F8HA 3LW5C 1JLFA 5LMNJ 1RZMA 4L3KA 2XYHB 2HFUA 2NXCA 1R27B 1HBUB 3GYXB 1N33J 3LAMA 3M32B 3OVAA 3KXDA 3NGKA 3GE9A 4NZ0A 1RA6A 2G13A 1WD6A 1QM9A 1IJEB 2C1EB 4K4WA 3FEYB 3DNCA 3GG0A 4EO8A 4EWTA 1FKOB 5KT2A 2ZJQQ 2RRNA 4DFPA 4FPIA 3KYLA 1ZETA 3I32A 4R5PA 4NL5A 1FE4A 1RQ0A 1HYSB 3AOCA 4EFAC 3UCGA 3CJRA 1NSKL 1SKUB 2DD8S 3UW1A 4LF5J 1LNQA 2CPHA 2DGTA 4OJ3A 4ZP8A 4WP8A 3G9CA 2ASYA 4IR9A 1FRJA 2ZUGA 3L9ZA 4YB5A 2JSXA 5HJYA 3HKZD 4WTOB 1HNWF 1L3VA 3H59A 4B3OB 1GNKA 4WJBA 2XNRA 3OXFA 4DR6J 3JQKA 2Y1IA 5H9EJ 1TL3B 1N36F 2QLBB 3MM9B 4TKTA 2V4QA 1M5VC 4TYBA 1NKEA 5FD1A 4B3MJ 2VC0A 1U02A 3N5FA 3KWMA 5FDLB 2NSCA 5KT6A 4KPCA 1IKYA 1EJ7L 4M5HA 2ZE2A 1X5SA 1VCTA 1D1UA 2R8GA 4OYIA 4BHQA 3HVRA 1N4LA 3PX6A 2IC3B 1T95A 1EHWA 2YQ3A 3GR1A 1BXNA 1JKHA 1OWXA 1YRXA 3IC1A 4KV8B 5I3UB 3OHAA 4OI3A 2XC9A 3CCRS 2HHXA 4JI1F 3ZZPA 4LF4J 1FKAF 3IMQJ 4DSEA 1B0TA 1S7IA 2CDQA 4EMDA 1Z1ZA 4NE9C 5F8HA 4DX5A 1OS5A 4RKUC 1PIEA 4JOUA 4F0MA 4F7VA 9ATCB 1R31A 1JLBB 3KG0A 3RBEA 4FF2A 1FE0A 2RH3A 2ZM6J 2KFZA 1KN6A 3PHEA 1RTJA 2G0JA 2K7KA 2FPHX 3C14A 4IFVB 1HD0A 2DGXA 2G2OA 3FJ2A 3GB0A 3OXGA 3K5MA 1X4EA 1PO6A 2OD4A 1NJXA 1KC8T 1L5UA 2J9EA 1KLNA 2V94A 2CUYA 2V63A 1SC1B 1X4CA 4QIWD 2ZJPQ 2X7IA 1KKHA 2HHHJ 2ILYA 2WVBA 4RBUA 4MKYA 1G1XA 1SCJB 5F8NA 1X5TA 2YNGA 1S1WA 2RDDA 2KO1A 1SKWA 1TMJA 1R6YA 1ZA2B 2J9DA 2MQPA 2KZZA 3TYTA 2O3DA 2DR9A 2PD1A 5CCLA 1DQ9A 1EETB 1LWEA 1Q7YT 5AXLA 3G8TA 2UXDF 4DF4A 3VVUA 1F60B 2HGNA 3HMJG 1T9TA 3LOUA 2C2RA 5U47A 2R7RA 2M88A 3SDEB 4Q7AA 1PC4A 3CT9A 1APSA 1X4HA 4LFBF 5HP1A 2XZDB 3OL8A 4LMZA 3O44A 3WIUA 3N6NA 3ZZRA 1KLMB 4OI0A 3HFZB 3OLBA 2HGLA 4AL6A 1S1VB 1T94A 1KEKA 1D8YA 4DSKA 4L73A 4V19X 2MQNA 3FGVA 4V1Ak 4W4MA 2MKCA 4KO0A 1UJ4A 4QIVA 1U1NA 5B0AA 2AEJA 3G6XA 2OP5A 2RKIB 2J0WA 4JP8A 4C0OC 2OTJS 2OUGA 3CPWR 1CJVB 3AJ1A 4JUZA 3M8PB 4RWWA 4C2MA 1AZSB 5AE3A 2ZKTA 2R7WA 2PGCA 4LBIA 4HHUA 1S77D 1F9EB 2XGQA 1CS4B 2MZRA 4TNOA 3DM2B 4WFYA 1NK7A 1M5OC 2XHCA 1S5ZA 3DRXA 3W1YC 1S0NA 1UFWA 2X1BA 3QGHA 1E6YA 1WI6A 3OR2A 5AXKA 2IIHA 1BD6A 1VHFA 3DMJA 1H98A 1WG5A 3MM7A 5C2GA 3KJQB 5BYQA 3K89A 3OVSA 2I1RA 2GJIA 1I1GA 2ATCB 2DH9A 2GAGC 2WOMB 1JXEA 2RAQA 3G86A 1VFJA 3LGNA 1MROB 1H2UX 3CCWA 2HVZA 4R8UA 5KFOA 2IYIA 1T9VA 1OIAA 2LEAA 3H5XA 3PO4A 2W4DA 3MEDA 1UMJA 2VBZA 4FXVA 4RL1A 1X8DA 1X7VA 5F3ZA 3KMSA 2VJUA 1ZZNA 2WSEC 2MKYA 2G2YA 3HVAA 1VC0A 2QTWA 3HF5A 3BO3A 5M2UA 1FKOA 4N47A 4KB7A 3D54A 2IM3A 1T05A 1GXLA 2ZH1A 2NREA 5K9FA 4OZ5A 5E3CA 5EX3A 3PW0A 4NLWA 3R5AA 1DRZA 2GIQA 2GVDB 3MMAB 3NBPA 4PXEA 3WC0A 4XIUA 5DDPC 2RVJA 3G2XA 2V34A 3QT6A 2VV5A 5L39A 4FNHA 3M1VA 4IOCQ 2F8EX 1UEVA 3EZOA 2KG1A 3RB3A 4M5DB 1Q7LB 1H74A 3EDRB 2P9GA 3VQTA 1XR6A 1B0VA 1XN9A 2Z58B 2QG9B 2OGUA 2OMLA 2VPWB 4L6V3 5JVHQ 4GKKF 3E01B 5FDLA 4FYDA 5A6WA 2XQCA 2ZKUA 4CT9A 1CJUB 3JB9k 1Q4RA 3N0VA 4B3TF 2WRMA 4YB7A 4YY3F 1JLQA 4QQBA 4DDFA 3KNAA 2L08A 1J27A 3M30B 5MLCV 3EPIA 3T1YJ 1V3ZA 1OPZA 3IRWP 1QAIA 3H2LA 5BR8J 4X4TA 4F25A 3DN9A 5LJ5Y 2JEFA 4WU3A 4C0HA 1FD8A 3J80Y 5M2PA 3PXGa 3PYFA 1RTIB 3H0PA 2QN6B 2PMZD 1TL7B 4JI8F 1U0SA 2KH9A 4DQQA 1J5EJ 4PUOA 3P5TL 5FJ4A 1XQIA 4RW9A 2MZSA 4FVCA 8RUCA 3F56A 2J9DE 2VBXA 2QL5B 2CQCA 3V4MA 3D0HE 4Q0BB 2L3MA 1DY3A 1U8SA 2K3KA 3BN7A 3IRXB 2M9KA 4MJKA 4ED4A 4C3MA 4P72A 1YX2A 4UUWA 4B9UA 2R7UA 5AJ3J 4X65J 4MIWA 1U1RA 1QUPA 1JMTA 2FJAB 4NRTA 4LFBJ 2AGQA 4EYIB 1V9OA 2HQDA 3D0GE 3QJJA 1QJHA 2XB2D 1F0XA 3TX8A 2VBWA 4LF8J 4AXJA 1OYEA 1HA1A 1A7GE 2Y1RI 4FZVA 4NLRA 2HQ3A 4A8MP 4NXMJ 4ZCIA 3KK1A 4UUXA 1LWEB 5EHHA 3NWRA 4ZP7A 4DSLA 4DV7F 3FCWA 2W4PA 2WONA 1RBOB 4WYWA 3VZIA 3CIZA 4B17A 1DLOA 2MQLA 5A6PA 1ZM2A 2APOA 5HN0A 5HLFB 5D4PA 5C24A 1FESA 2Y0SD 3I87A 4ANCA 2FLOA 3LGHA 4AQYJ 4JI7J 1AA1B 4OJGA 4DLGA 2V67A 3J80U 3ZXWA 1M90T 4Q43A 2B4OA 2OPSA 5DLGA 2HNYA 4ID5B 1U09A 2V2VA 2HNDB 3T9ZA 2PFDA 4AT1B 4OYXA 3TQ1A 4LUBA 2BVZA 1X0FA 2MYFA 2BJ7A 3A8KA 1H6KX 3IG1A 3JQJA 1Q82T 3WIVA 1MWYA 3RZAA 1CJVA 1NK6A 3PEJA 2C3MA 3SSQA 2MMYA 3CDBA 4CO5A 1HNXF 2ZBPA 4DV3F 4CZCA 2R7SA 1YJUA 2WW4A 2ZBQA 2JFDA 2C3UA 1FT8A 3KLGA 5FIIA 2GQ2A 4CLYA 3T6JA 1CVJA 3T5JA 2XSFA 3MPVA 2IAJB 2CJXB 1ZTWA 3CO9A 1CS4A 2OAUA 3RU0A 5IWAF 1SJ3P 2HHVA 4RW7B 3TP2A 2W24A 2AZ1A 4RW4A 3TUPA 1HWUA 4UF4A 2VUGA 1FXRA 2CQ3A 3HFKA 4FP9A 5LXYA 2FVQA 3OL7A 3BDPA 3MM8B 3FSIA 4XK8C 4EBCA 3TI0A 3GYNA 1QAXA 3EUNA 3EVWA 5F41A 3TR5A 4WF9Q 2XY5A 1DQ8A 3BGLA 4TY8A 4IUFA 4N41A 2QV6A 4HI2A 4XTTA 1NPRA 3LP1B 3M2VB 1TL3A 3KDOA 4UW2A 3RAMA 1D09B 4F4XA 2HBRB 4CLLA 2X3GA 3V6JA 2DNGA 4DR6F 1C0UB 4X64J 1XMBA 2VZ9A 2MY8A 4WCEQ 7AT1B 2DNYA 2VQFJ 3HJVA 4NCGA 2AJ4A 2W2QP 2DXFA 2HBQB 1MMDA 4NLGA 4NYZA 4PZVA 2HRTA 1Q79A 2HVHA 2CAJA 5GADU 3M8WA 3UE2A 2Y1LB 2VOOA 4GVBA 4C7QA 4DV4F 2F1FA 4B3RF 4CNZA 3PIPQ 2YKNA 4O4GA 1FXLA 1B3TA 3M8SA 2W7PA 4OI4A 1FJ7A 3MR3A 2CVEA 3FVYA 5C25A 1ZOTA 3QMQA 1RJJA 4JI6J 2L48A 3K5NA 1Y10A 3DHXA 1YG0A 2XO7A 4YOEA 5JJBA 2E1CA 3DRPA 5L1LA 4W90B 4D3GA 4P6QA 3CB4A 1H0HB 4ZLJA 1SJFA 1A0OB 1LW2A 1ZAWA 2DGVA 2ZD1A 4DZDA 4KIAA 4DG1B 3ZNUA 3DRSA 4ID8A 4CTAB 1HBMA 4RNOA 3L7PA 3GTYX 2CNOB 2EEYA 4C3LA 3PKYA 5EN1A 4P52A 2W8LA 1Y00A 1S7HA 2AYMA 2FTRA 3BSCA 2M7SA 4YY3J 4ZIWA 3VAFA 3ENVA 1U47A 2CJKA 5K14B 5D6GA 2QRRA 2WCXA 4J9OA 2YKOA 4QPTA 3KLFB 3OT9A 3PO5A 2AF6A 3B4MA 1S6PB 1PAUB 1S1UB 2A18A 5E3QA 2MKIA 2B3TB 4R0JA 4ECZA 3TVKA 1XBWA 1YKWA 4WKYA 3KLVA 1YHQS 2HSEB 3IM9A 4RW9B 1YJ9S 2P6SA 4DU8A 5BYSA 2AX1A 2E1AA 1HBNB 2CQPA 2N7CA 4WZMA 1OYDA 4FBTA 3CIMA 4HHHA 1U1MA 1RACB 4K4ZA 5DG7A 5IQ6A 2GIRA 2J5AA 3JYTA 1KQKA 1N34J 2J0QD 1H3DA 3I9ZA 1X31C 3K5OA 1QLNA 1RABB 4MIAA 1IWAA 1RCXB 1WOSA 1S9GA 1RT6A 1WOPA 3HSZA 2M70A 5ETQA 4JI7F 2JLEA 3D3BJ 1TL1A 2ROGA 3ILOA 2P2CB 1G4CA 5E2QA 3G6VA 1NDCA 2FZKB 4OLPA 3TAMB 1AZSA 3BQ0A 2KU7A 3J81Y 1W25A 2MLZA 1VQOS 1JJHA 1FK9B 2D9PA 4KKOA 3V2UC 4F3QA 4Q8EA 1I5OB 1CC8A 1SC4B 4XDCA 1H38A 3V81A 1S9FA 1K0VA 2D69A 3ET6A 1REVA 3PG9A 3EZ5A 1U1KA 1IBKJ 2EC0A 2E66A 3NCPA 1NSQA 3ITHA 4Z7CA 3HZGA 1FFSB 2Q66A 4LRDA 3DRRB 3PM9A 4OX7A 4KGVB 2OPRA 2P5VA 5KFPA 3I4HX 5KFYA 1FRKA 4NEYA 3BB5A 2HZCA 1N5QA 2F7VA 4YDDB 5EDWA 1KD1T 3CJTA 4ELVA 2GV1A 3M6XA 3U1MA 3CF5Q 4OZLA 4RUHA 3A3OB 1HMVA 1RT4A 2YNHA 4CM2A 1R0AA 3IFEA 4R8UB 2NZ4A 2FJXA 4PG8A 2GHVC 3GJQB 2VQFF 3MR7A 5I3UA 2F9DA 1QD1A 3ADAC 2DY1A 3D1OA 2ZVIA 4M5KA 1B4SA 3CDWA 3GJSB 3I5AA 2AW0A 2XMJA 5JXSA 1UJ6A 3JTNA 4OIXA 4DN9A 5B0BA 4U67Q 1N32F 3NNAA 2B51A 3SV4A 3M8RA 3I0RB 4FF4A 3VAMA 2I0XA 2ACYA 4LIRA 4EO6A 1UETA 2HPUA 2NCKL 3TW0A 1OY9A 2RILA 1VIOA 3JAMY 4N8OA 1UWAA 3NAHA 4A8OA 4KRWA 2V6AA 5C5JA 3RAQA 2XMMA 1AROP 3EXYA 2XMAA 4ECSA 1JX4A 4NYPA 2UUCF 2CQDA 3VVTA 2RT3A 3CJ8A 4L3NA 1MSWD 2PO4A 4U9RA 4EZ9A 2CZVC 4DUTA 1GMWD 3D0IE 3QIPB 2WVFA 4NLUA 4LF2A 4B3SF 3J81j 3RTVA 1IBLF 5E3RA 2DNHA 3THTA 2DEIA 3VGUA 1LEOA 3NOGA 5CYMA 3NGRA 4CLFA 2FVRA 4I2QA 3MMCB 5KG0A 1NH7A 5ETVA 3K0JA 3KK2A 1P6TA 1RAIB 4O3RA 3CJKA 1WKJA 4G1QB 4NX9A 4LFCJ 2C42A 5AXMA 4I64A 1LWXA 3D68A 1MWQA 2EW9A 3DOKB 2CXEA 4ZVRB 3CCTA 3W2WB 4CLUA 4K4YA 4LF9F 2QT7A 4FNIA 1QVGR 1JLQB 1Y7PA 1N5TA 1X60A 3TZZA 1FVSA 1RHKB 4GVBB 3B6BA 3CJ4A 2IDLA 3PR4A 2R2RA 2B4UA 3HULA 2LDYA 1U1LA 1KLMA 4WTYA 5ETLA 3BH7B 2PN6A 5F0WA 1RK8A 1TKXB 1NK0A 1TVRB 2B8QA 2M8HA 3UDEA 1DJ0A 2WVDA 4AQYF 1QUVA 1TL7A 5HQ8A 2UVWA 3FRZA 4KO0B 2KT2A 4TU7A 3M9MB 2AYBA 2I38A 4F0KA 4IO9Q 2N3LA 1I94J 2ALZA 3M8ZA 1GAOA 2QSFA 2KG0A 3BSNA 1D0EA 1XR5A 2QEXS 5KFDA 2X3DA 2R8IA 3VAKA 2LEBA 1TK5A 4PWWA 4FYYB 2OPPB 2HRYA 2KXHA 2V4JA 2HWHA 2RU9A 3HHEA 4PAAA 3TJAA 2KJWA 3A13A 1NXIA 1Z2LA 1HBMB 4YR3A 4DV4J 3DCAA 4WFNQ 4JV2A 4NCBA 1F5AA 2BE2A 3H20A 2CQ0A 1D8ZA 2QJ3A 1TKDA 1RAJA 1HR0F 1S79A 1ZPVA 2CQBA 3NG8A 1WEYA 5L38A 1JJ4A 2UXCF 4LF6J 4YB1P 4PXDA 3CULA 2EFPA 3IXQA 2CWXA 5I42B 4A8FA 2ABYA 1TAQA 4CO4A 5D0GA 2K1RA 2BRLA 2PT0A 3DLEB 3PCOB 3SSRA 4LT6A 1VDHA 2PC6A 2HAFA 3LUYA 4IFYA 1IUJA 1RDRA 2JEIA 5ADZA 2UXCJ 3C6UB 1QSLA 3I82A 4ZVQB 1HW9A 3UO0A 1UWBA 3ILJA 3A12A 4DPOA 1RTDA 4DV7J 1HBNA 2OMOA 2ZDOA 4A4JA 2D7SA 4J91A 3TUZC 1HPZA 3M8YA 4RW6A 4X65F 4ZLLA 3HP6A 1C1BA 2ZJRQ 2B56A 2J0SD 2W1BA 2FJDB 1FEEA 1FF2A 3I0SA 3CCJS 2EFQA 1TR0A 4HHJA 3SI8A 4NLYA 3GFZA 4QR1A 2AJQA 2NUUG 4DR5F 2JLGA 1I6JA 1VLYA 1SH0A 4LF5F 2GS8A 3MEKA 2ZOMA 3DDNA 5IS2A 3MF5A 1NAQA 4DFKA 3MEEA 1ZTTA 4IQXA 2KB2A 4Q8FA 4N5SA 1NKBA 2W7OA 4USHA 4DV1F 3R1HA 4ECWA 3RR7A 2C2MB 1RT5B 2KKHA 4USKA 2IMWP 2B6AB 1RWUA 2LQ8A 4I7FB 5GAEU 2UU9F 5D3GA 2E1PA 1FK9A 1X4DA 3CEDA 1NZAA 3E8OA 2E1RA 1EKRA 4K8RA 2W9CA 3T1YF 2JNJA 2OPQA 4K5SA 2MZ1A 3DLBA 2O1PA 4I6AA 1KDNA 5KFVA 4DX7A 4KY3A 3KOAA 4V19J 4DR2F 1JLGA 2YX1A 3QGPA 1LWFB 2UV8A 3LP2B 2WHOA 1JNRB 4RW4B 2BDPA 1AFJA 2WZ1A 4P9SA 4KGMA 3KG1A 3VQSA 1LW0A 5IV4A 2ZH3A 1PBUA 3IBCB 3DOMA 4X62J 3ZZ0A 2FHOB 2HKEA 3MDFA 2DIUA 2O01C 1YLXA 1RT4B 2LU2A 6FDRA 3AFGA 1P1LA 4A47A 3JSYA 1RAAB 3Q8UA 2HFVA 4LBHA 5B7WA 1F3VA 2J7KA 2RDIA 4HACB 5B0DA 1X9MA 2D41A 4H4KC 1JJ2R 4C11B 2J8SA 4MAKA 3NKYA 2H51B 3AAWB 4O3NA 4ZCLA 1YBTA 1RAGB 3ICLA 3LA0A 3US5A 1ZYQA 5DG9A 1RHRB 1SQGA 2AP6A 3ILIA 5KT3A 1UVLA 3IS9A 4PQUB 4LF4F 4LF7F 3DDKA 3EE3A 5J2QA 1BWVA 3MD3A 1C2PA 3N4WA 3HT0A 2W9BB 4O0NA 2DO0A 5CHCB 1B0PA 3EGWB 5LXRA 4CNYA 1FNOA 3FCHA 3HDSA 1RT1B 1TV6B 2I2YA 4X2BA 4P74A 3HXMA 5CZXA 1F2HA 2B9YA 4LIWA 2IPOB 4NOHA 5GVQA 3R7NB 5C25B 3CSKA 4QJVA 5L9XA 3TA0A 4OYOA 2ADCA 1HNZJ 2FLLA 5EUHA 2RQ4A 3T5LA 2IVYA 4PXCA 1L3SA 5B0FA 2MB0B 1NK5A 4IR1A 4MT1A 3F44A 1RT3B 4PR6A 2YBVA 1BQMA 2PEHA 3NS5A 3R27A 4ICLA 1LW2B 2BA9A 1NKCA 4JV5J 1IVZA 5KTQA 4JI3J 1U2FA 2YXLA 5CQGA 4NMXA 2V68A 4Y28C 5A8KB 1WEXA 4LR9A 5DJBA 4K2XA 3OLAA 4B9MA 3KMQA 4YHHJ 2VH7A 2W25A 2BJ9A 2YKAA 3PYDA 4KGKA 4L74A 2HBZB 3F0NA 2L9NA 3OFFA 1J5EF 2PI5A 3FZBA 4M94A 2UUAF 1TVRA 2N3OA 2B4VA 3PHTA 2CQ1A 3MHYA 5KFZA 4C8KA 4LF7J 2HMIB 1UCNA 2KJVA 2GMLA 5HQMA 3KJVA 1WG4A 1RBLA 1HHQA 3IRXA 1RWWB 3QRQA 2ALYB 3H2UB 1NJYA 5EGYA 1AYEA 2YH0A 2JC1A 2B0GA 3R8YA 4FN5A 4WXWA 4F4KA 2XS5A 3TA1A 2AWZA 2QE5A 5HO4A 2XM3A 4NLSA 1O51A 4OI6A 3LPYA 5D8HB 4LSZB 4FS2A 3MAHA 3AJ2A 2WAQD 4ECTA 1FRIA 2DTJA 2M2BA 2B7BB 2E7XA 2H5IB 4Y2MA 5ETRA 4EYHB 2DNRA 2XMUA 1N34F 3CD6S 4MK8A 3V6HA 3B4DA 2U2FA 3MCSA 4CLKA 2MSTA 3MECB 4UY8T 3J7A1 2GIFA 3G8QA 2WONB 3W8PA 3FBEA 5D0RA 5I42A 5CCMA 3R5GA 5CA5A 1SL2A 1BGXT 3O3LA 3TAMA 2XCAA 1FHTA 4E0DA 3VWSA 1QTNB 3MM8A 3RUBL 4D3HA 1YJRA 2FVPA 1TUGB 1NHVA 5HI7A 2MQQA 5KFAA 2EK6A 1REVB 2J7UA 2W7AA 1XJWB 3N79A 4OYMA 1BWEA 4PEOA 2A3JA 1XMQF 4CRJA 2AGOA 4UOCA 1U1OA 3OFHA 3VTIA 2V8DA 1X4GA 1VI7A 2CWKA 1X9SA 5LL6d 4OHXA 1W2IA 4OHZA 1F1BB 1T3OA 3LF0A 2DISA 2PI4A 2R7VA 2GHWA 4A46A 3DI6B 1XMOJ 1RA7A 2R7XA 2ZVSA 2POKA 1K47A 3NAIA 3R5CA 5LMUF 1M5PC 5A2QU 1SC6A 3D5MA 3SBMA 1S4EA 4H4OB 2B6AA 2YNIB 2YWKA 3RB4A 1HI8A 3MM5A 4F50A 2KHDA 1FD2A 3MEGA 1VRTB 4WE1B 4ZPDA 1BY9A 3W5XA 4KSEB 3H98A 4LSNB 3BR9A 4CWBA 2CRLA 5BXIA 3BQ2A 4OX9F 2CADA 2AIRB 3E01A 6FD1A 2HWIA 1SJ4P 5KG4A 3MOJB 1AFIA 2VFSA 3JSMB 3RYLA 3OUYA 1EKSA 2DITA 3W62A 3FFIB 2BZ2A 5KFGA 4AE5A 4CH7A 2IM0A 2VDHA 4ZDNA 4Q2LA 5IC4B 1M0SA 3DDIA 3VV2B 1M5HA 2QC3A 4DPWA 5L1IA 4DR3J 5D77A 2DK2A 4USVA 3W5ZA 4QWDA 4DL5A 3EJMA 1WHXA 2UVUA 3AOAA 1M1GA 3G8SA 4WK1A 1KQFB 4IRKA 4EBEA 2D3ZA 3HCXA 4IH5A 4R25A 3V6DA 3CJKB 1IKXA 2YWWA 1WOOA 3JXOA 4AYBD 2VHGA 3ZNJ1 2XMVA 1S12A 2ZC4A 4AXIA 4ITSA 4K4SA 3T9NA 4Q0BA 1IM6A 4K0KF 2CZ9A 2J76E 2KZMA 5LSRA 4CT8A 2XTJP 2IRXA 3A4TA 1MW7A 4ZPVR 4ZP9A 1RHQB 2WB1D 2EFNA 4DL6A 2HHQA 5HSPA 3AD8C 2G0IA 2HNZB 3Q83A 2VG6B 2WVCA 4DPUA 5IWAJ 4MFBB 3DRPB 1HR0J 1ROFA 1KFSA 1GH8A 4C0BA 2GFFA 5IM0A 1U24A 1S9GB 4CO0A 4LREA 4YB6A 4J9SA 1S9EB 3WHIA 4F4YA 4DWIA 3NCQA 4MK9A 1SKSA 1CULA 1VRUA 2DHHA 2M5YA 5IC6B 5T7LB 4P73A 3MURP 4A8KA 1QSSA 4LF9J 3CDEA 3R5DA 3OVBA 3DLKB 2QL7B 2ZNZA 2VFVA 2YWEA 3KJNB 4KT0C 4PPZA 5HVFA 4ZJLA 4CQ1A 4FF1A 1ZS6A 3GV8B 2HBYB 2LLZA 5GMKa 4TY9A 3MCOA 1ACMB 3LTOA 4DUZJ 2BKOA 2PEBA 1IXKA 1U0HA 4CH1A 1SPBP 3K17A 1U4BA 2A2DA 2HFNA 3C16A 5THWA 5KT7A 3QAUA 4X84A 4H4KA 1KP6A 3CW2C 3THVA 3BJYA 1TK0A 1CG2A 1CQNA 2DCUB 1KHWA 1CJKA 3L7OA 5ETMA 5SZTA 2Y8YA 2RB7A 4DL2A 3IGVA 3AA8A 1N36J 2C2ZB 2Z2ZA 1L3KA 2EK1A 1UJ5A 2JJ4D 2JX2A 2LQJA 1RAOA 1UWBB 3CJQA 2D9OA 4WFZA 3CCLS 2QFIA 5GAEI 1VQSA 1XNQJ 1HQ2A 2AT1B 2CNKB 2HK2A 3HVTA 4HTIA 2YWFA 1SH3A 3BGFA 4LJMA 4RW7A 1VQ6S 2B8PA 3EXCX 2DGSA 4C98A 2N82B 4U8VA 3TJ9A 3NNCA 5JMNA 2HVIA 3PFEA 5IT9U 1UEKA 3EICA 2ZH4A 3QAEA 4WKRA 3RBDA 1RAFB 1V5IB 2ZH9A 1Y5IB 2R3VA 4M5JA 2V5HG 3CDAA 2QX0A 3H2VE 2RRBA 1WC0A 3B8HA 1I51B 1RKIA 3HHLD 3IBFB 1E6VA 2LXFA 4FKXA 2IM2A 3D7SB 4WFXA 4CYUA 4F3MA 5K20B 2W9CB 2ZZNA 5E3PA 3DRRA 4ZVUB 4DCJB 4B02A 3Q23A 2RHSB 3CCMS 2IJRA 2BJ3A 3PW4A 3PIOQ 2RF2A 1FDAA 3B82A 3BGRA 3GJRB 4MMOA 4TYAA 2FHKA 1WC5A 4E8UA 2QA4S 1S6QB 2Z2MA 2PA8D 1HQEB 4ED2A 5I4MA 5J2MA 1UFKA 4ZPBA 2ADBA 4DX6A 3SIPB 4X4NA 1R0AB 1UAWA 4G6VB 2HQGA 2XY7A 3DLHA 2F65A 5A2QY 3I5CA 4WU2A 5D0EA 4ZMMA 4O3OA 3OTDA 1PJ6A 2WBMA 5D0HA 1VOMA 2KT5A 3O1LA 3GIJA 4Y2CA 4ES2A 2NZCA 3IN5A 2AMCB 1ELOA 2IC3A 3ENQA 4H4MA 1AUSL 2DHAA 2XWXA 4J9UE 4ZIVA 1HD1A 4OYWA 5KFLA 3JSBA 2YNIA 3M6UA 2RQCA 2G9OA 2R8JA 2GMHA 3LANA 1ZH5A 2ZHOA 2KT3A 4N77A 2LKZA 4U7UK 1FWPA 3T1AA 2BYCA 4NYOA 3UN5A 1Q8KA 1FKPB 2A2CA 2QLFB 3VALA 2QMXA 5L9NA 4RWXA 2OEMA 4CTAA 2MLXA 4MKAA 3C14B 4DMZA 1UL3A 3BO2A 3GONA 5EX0A 4DSJA 1A6LA 2XLKA 3I4PA 1U2RA 3CD0A 2F63A 2QA2A 1HARA 2CIMA 1MMLA 4HL9A 3TX0A 2XSJB 4TU8A 3OHBA 2A6OA 4KPYA 2VBYA 1RTHA 4RUBA 1GQEA 3OV7A 1RXOB 2FHJD 3QGGA 5RUBA 3KK2B 1FXDA 1YRUA 1UVJA 1R3NA 3T41A 4LFCF 1O6XA 1RWNB 3PRVA 3ZTSA 4MH8A 3NRBA 3LH2S 4KHMA 4ILMA 2CPZA 1F6TA 3SCJE 2NPIA 3M2UB 3TZXA 2KM8C 2ZM6F 1SIZA 1UVNA 3NMRA 2CJAA 1JXVA 1WSRA 1Z2ZA 1O0PA 3A1YG 5DG8A 2QGFB 1NLKL 4IG3A 4KAIA 4OJHA 3MFHA 1N5YA 1M1KT 1IKWA 2GHPA 4RJVA 2FDNA 1EP4A 1YJVA 5KFSA 4HEA9 2AEFA 2QMUB 2ZOGA 2K7JA 3QWPA 1Q5VA 5T41A 3UVJA 3VGVA 3CC7S 1N88A 5DRKA 2QO3A 2OJ3A 4PG4A 3N9UC 2V9WA 4HDHA 4M5MA 2EFVA 4QU6A 3MXHP 1GTEA 4K59A 4OZ1A 3VAJA 3GYGA 2UUAJ 3MUMP 4W92B 4QYZK 4QOTA 1B7YB 4UY85 3H7HB 1U6ZA 1VMBA 1FEHA 2HGMA 1RU2A 2YX7A 4X4QA 2I6WA 1VS3A 4GC7A 3FUYA 3IGNA 1S49A 5CD4H 4DHVA 5CAAA 4J37A 5D3GB 2OTLS 2Q6BA 4J9KA 4LBPA 5CH7B 2KFNA 2BJ8A 4M63A 3MPYA 3PEHA 3TEHB 3V4IB 3BR8A 2RD5C 3PJ9A 2K1RB 3DLEA 3PKMA 5J2PB 2CPDA 5M2RA 1R6VA 2EI5A 3ETOA 3R6GB 1S1TB 1KQSR 4HT7A 1KFDA 1KONA 1S6UA 2XMTA 4ZCMA 4ECUA 4CLSA 4DZ6A 3C8YA 1TKZA 3CCQS 1RKJA 3GWCA 4AL5A 4ZKAA 3D67A 1FTCA 1NRKA 2HFZA 3E3XA 1LK7A 2JVRA 2NUHA 4IDKB 4OYZA 1DBDA 3DOMB 1C1BB 3FBCA 1WELA 3CMES 3BV8A 1UFLA 4MTPA 4Y6IA 3KLEB 4ER8A 3M32A 1MMNA 3WDOA 2ZUAA 1N52B 2C3PA 1BQXA 2YWHA 4GKJJ 3SMZA 3GU0A 2FJEB 2OFHX 2YQ1A 5KFCA 3Q8SB 4B3TJ 5KOWA 4CH0S 3QATA 3PVXA 1PC5A 4GMKA 1HHTP 2FLNA 4PWDB 1HW8A 2VB6A 5F8GA 1KVIA 1WWHA 1X4BA 1XNQF 3HKWA 5I3PA 4UTGA 4AD6A 5C2CA 4EEYA 3IA0A 4Y00A 3IS9B 4OI1A 4PQUA 1S1XB 3DXBA 3W9HA 4JI0J 5DZ7A 2PA3A 2BEFA 1YTYA 2XYGB 3ISNC 1EARA 2IHR1 2JHEA 1KVKA 4CLPA 1JIHA 2DHSA 7FD1A 1VBXA 2K3IA 1VRTA 3D66A 4I2QB 3FBBA 4ZLNA 4MKVA 3R97A 9RUBA 1DAXA 1TL5A 1IN0A 4TQRA 4DUYF 3DLGB 3DFEA 2R42A 2IDEA 5LOQA 4NRUA 1N6QB 1CJTA 1K73T 1D9DA 2PMHA 4ZPAA 2WTFA 5DM6Q 3M6WA 4ERDA 1RHMB 2F40A 2BABA 2CJ9A 2WSCC 1VBZA 1ZM4A 3ULHA 1CJUA 1BQNA 2A10A 2E7WA 2LA4A 2LFVA 3GSIA 4OZ0A 3V5RA 2ZH6A 1U6FA 2HIYA 1VBYA 1B99A 2OFGX 1TKXA 2Z8QA 4X4SA 2KM8B 4J9QA 3OXLA 2V8GA 4H4MB 4A48A 5DGBA 2KYZA 1NK9A 4RBTA 1HBOB 2X1GA 1TL4A 5C42B 4BCAA 4BWMA 4OQJA 3CCES 1FX4A 3M7VA 2DRDA 3D1HA 3N6LA 1RTJB 3KLIB 2H5JB 5DDOC 3HFVA 4GC6A 3I9V9 2VFTA 1PBAA 1VQ4S 2BM1A 1HI1A 3RBXA 3KJVB 4DJBA 1TAUA 4ED3A 1HNIA 1WTFA 2ZWOA 2ACMA 5KT5A 1SJ1A 1X5OA 2EG2A 3POTA 4P75A 4TXSA 2VD3A 5CZVA 3J7AN 5G4DA 2DNMA 2HWTA 4N7TA 3S6EA 4O4RA 1XIQA 3KG4A 4N8NA 2X1AA 3UCZP 4JI4J 5KFTA 3AD9C 2E1MC 2GGPB 2CPJA 2YNGB 2AU0A 1SJRA 3IM8A 1HNZF 3OFGA 4EZ6A 4LRFA 2MKSA 4RU9A 4K4VA 3BO4A 2PE8A 2ROPA 3QRRA 2OEKA 1XNRJ 2R2TA 2H5EA 3W9IA 3EM1A 3MM6B 2YVSA 2XEXA 3FQLA 4NLOA 2DBBA 5AJ3F 3CCSS 4MYTA 1RTZA 4C6AA 4ED7A 1S0OA 1BC6A 1XEZA 3MWBA 4JI8J 2Q3PA 2V8HA 4CCHA 3M2RA 5A8RA 2E9ZA 3FC9A 1QTMA 3HK2A 4NLDA 5F8MA 3OTBA 3QBCA 1HPZB 4RW6B 2B5JA 2O5DA 4ZVHA 1EQ0A 2HHTA 1MNEA 2L9WA 4UZCA 3S8SA 3RR8A 2Q1LA 3ZZUA 3QSYB 1FRHA 1GK8A 1YJ7A 5GMDA 4X4PA 3HM9A 1NB2A 1U8WA 2EFOA 2ZH2A 1IJFB 1AT1B 5KFQA 4CM0A 3G4SS 1SBRA 4USMA 5B09A 3PRBA 4QWEA 4PCQA 1WHWA 4YQWA 3TAQA 1RUSA 2F4FA 4USTA 1A9NB 3TO8A 3K2YA 3PY8A 2MPUA 4W98A 4F4AA 2XO6A 4ED8A 1JLFB 5KFEA 5HMXA 2WBRA 4Y2KA 2HS0A 3PTWA 4I2PA 4F26A 4TVAB 3A8IA 1R8CA 5CD4A 3E2EA 1VQLS 1B70B 2XZWA 3W3SA 3WC2A 2RRAA 4E98A 4Q44A 2CJQA 4WYLA 1H72C 4DR2J 1U1PA 2E5LF 1VRQC 1AUDA 4K5RA 3N6MA 5H9FK 4GO7X 2BQ3A 4ETZA 3UR3C 3BREA 1WC1A 2BJDA 2CDRB 1ULRA 3MM9A 1N54B 3QGIA 1DZ5A 2MQOA 4KH1B 3SSSA 1GXUA 2ZOFA 4P2XA 3IWNC 3Q2SC 1RT7A 2BW7A 3BEGB 4F02A 2I8EA 1WUUA 5L1JA 4UOFA 1WHVA 3CD7A 2YY3A 4QZVB 3MUVP 4H54A 1S59A 2HS3A 2ZHAA 3PX0A 4O44B 1U49A 1JKHB 4KV8A 2HEKA 2R7OA 2J9CA 2L41A 4DL3A 4DR1F 5AE1A 2DXEA 1YJTA 3KDNA 4RW8A 2G2ZA 3KLHB 3BGRB 3BPSP 2NLWA 3RJMB 3SFUA 1HNXJ 1VQ5S 5CXTA 4WK3A 4ILLA 5AXNA 2ZHBA 1WACA 3P45B 5K5MA 4ED1A 4IOAQ 3I96A 3DYAB 1WEZA 4B3SJ 2CKWA 2VASA 3NEKA 3KUHA 5HMWA 4XPEA 2DVIA 2HIQA 1RI7A 1NBEB 4WZQA 1WDDA 4HH0A 2BM0A 3KUGA 4YDXA 2KXFA 2UUTA 1VQNS 2LYVA 1FWKA 3ZTPA 1RT1A 1TV6A 1Y4ZB 1NK4A 4ECXA 2GVDA 2JH3A 1U1QA 2JDJA 4OYPA 3MR5A 2HNZA 3RBZA 3R5JB 2W2NP 5EWGA 4NLPA 2YKNB 1BE4A 1P27B 2O67A 4O4GB 2EKYA 2AJ1A 1NU4A 3LAKA 1HI0P 1R8BA 2LECA 4G1PA 2MKHA 1OO0B 4JYAJ 4F0HA 3GMGA 3HX9A 3FFIA 2IY5B 1KOOA 4KFBA 4NI2B 1DTQB 1NEEA 3EVMA 4X64F 4JI3F 2MKJA 4J9LA 1T3NA 5T7LA 4EGLA 3W64A 2HHHF 5A8KA 4QIEA 2AZ3A 1HWJA 3WZ0A 2VFUA 3BBFA 2OEJA 2IMOA 2KFYA 3DRSB 1WF1A 3J7ZT 1N0VC 4Q2MA 3SCLE 1X0PA 1CQMA 4CDIA 1RHUB 4OX6A 4RNNA
chains in the Genus database with same CATH topology
1EETA 4ZVFA 3CTRA 2I5JB 2VA2A 3LWLA 2EVZA 3KFWX 3OR1B 1DTTA 1SUQA 3M2UA 3SDEA 1QE1B 2BR0A 2CQ4A 1S1UA 2XLIA 3K59A 2U1AA 4ED0A 2ZNYA 3AH6A 5F0UA 2EG1A 3T3FA 5K8PA 3EPGA 3POTB 3H4DA 3EGNA 3KHLA 4ECVA 2AV5A 1I94F 5IM0B 2BRKA 2GO9A 4HT5A 4TLRA 2LEPA 3NCRA 5J1NA 2GGPA 4GO5X 3Q8RB 1FCAA 4NA3A 1XK8A 1FJCA 5HBMA 3HHNB 1S0VA 4IYQA 2V4RA 4NLXA 2BUNA 3H8YA 3MM7B 4OHYA 3MTJA 2DCLA 2ILZA 1Q86T 4Y3CA 1WF0A 1DLOB 2OKQA 1MROA 4ZVEA 3DM2A 4OJ1A 3J7YU 3TUIC 4I1TA 4TN2A 1NH8A 3NMAA 2YTCA 2Z2LA 3V4IA 2HW3A 1IM4A 1HWIA 2FUG9 2VFRA 4LQ9A 4A8XA 4P2SA 2XCPA 3QJPA 4FPRA 1YWXA 2O66A 5IT4A 1MU2B 2HNDA 2DGQA 2MZJA 1FRLA 1TKZB 2AYEA 1W2BR 3IWLA 1SXLA 3DU5A 1Z4UA 1K8AT 3H25A 2DRAA 4O0IA 2X51A 1HMVB 2YNHB 4IQMA 4LSLB 2RDJA 1FDDA 1SB6A 2DIVA 4URGA 4HLBA 3PACA 3CCZA 2AD9A 1CC7A 4DF8A 3Q8QB 4OV1A 1IQTA 2FJWA 4JI2F 5HI7A 1JLAA 4JI6F 1YI2S 2F8MA 1QAYA 1CSJA 1IBKF 2AJFE 2KZMA 4QWBA 1UKUA 1S97A 3MFIA 2E5HA 3OUYB 2M8DB 3X3UA 4OZNA 1FKPA 4M8LA 2CQ2A 1S1XA 4YFUA 1SKRA 1LV5A 2QZ8A 3WX4A 2LU1A 2NSBA 2VA3A 2FD2A 5E7OB 2BANA 1LWCB 4F4WA 1KNZA 4ALZA 3BM7A 5F9LA 1YITS 2EBGA 3AY0A 3QIDA 2DT9A 4JI4F 4PKDB 2XMWA 4M5DA 1RTHB 1NNDA 1LQ9A 1IKXB 3BZQA 5CYQB 2UVRA 3U1NA 1N6QA 2ROEA 3BSOA 2NPFA 1R8AA 1T02A 2V8VA 3ZC4A 3V6KA 1N5VA 3DYAA 1ZPWX 4I6WA 1WNEA 3SFGA 4OL8A 3W2WA 1IKWB 4JV0A 4IKAA 3T5KA 2RS2A 2ASLA 2G1DA 1RTIA 3CJ5A 3CDUA 4X62F 1FJGF 4UQTA 3BGUA 2Q79A 1TZ0A 2DO4A 2UXBF 3P6YC 2B9XA 1VQMS 5KFHA 3MAQA 4U6PA 3TRGA 5A8WB 3BS9A 1VC5A 2CPIA 3Q2TC 2V0NA 3GZ7A 1KS2A 2BOPA 1KVJA 4ILRA 2LDIA 4HDGA 3MMJA 1C0TB 2E9TA 2CJBA 5G0RA 2GA7A 4LQ3A 2K8GA 1IKVB 2MZTA 1FA0A 3NL0A 4QYZJ 4OHVA 3HT3A 5HMYA 4ELUA 1M5SA 2HAIA 3PJXA 5IFMA 2VG7B 3I5BA 3TVYA 4HYKA 1RT2B 2OSQA 4DV6F 4AFFA 4ECYA 1DTTB 2XULA 2CFXA 3M2RB 5A8RB 2RU3A 1WG1A 2KVIA 2R4FA 4DBQA 5KG3A 5KG2A 1Y0HA 4DR4F 3BQ1A 5HLFA 2QFJA 3AA9A 4DS4A 4XAKA 4GKJF 5GAHI 1JLCA 3GV5B 3LP0A 4B3MF 3N5BA 1SV5A 2W8KA 4C9DA 3O6QA 4J9RA 3EYZA 1QY7A 3OSPA 1TL1B 1TK8A 1NHUA 2DNZA 4PXBA 4I2PB 3MZIA 2ZH5A 4K4TA 4QIFA 5KFBA 3ENWA 4YEAA 1S99A 5K8NA 2FGOA 5HMZA 1VQPS 1S76D 2YKQA 2OIHA 2DNLA 2ZE2B 4FS1A 5DO2A 1S72S 3U02A 3SXLA 3QZ8A 1RT7B 3CC2S 3CJ3A 3NWGA 4IDKA 5E41A 5EWEA 1MU2A 4R0EA 5HROB 3N28A 2B4PA 5B0CA 3KK3B 4O3QA 3G6ES 3MUTP 3RB0A 2NYIA 2UUBF 2OLWA 3MR6A 1F9FA 2CQIA 3H5UA 4K4XA 3M30A 4X4RA 4G1IA 4EUVA 1JLBA 3LP1A 2B9WA 3M2VA 4IOBA 2VOPA 4N56A 4LSLA 5IXUA 1OSDA 1D3WA 4BC7A 4Q45A 3OL9A 1M5KC 4IFVA 4NCGB 5I3QA 1JLAB 2MHEA 5KT4A 4YR2A 4YP3A 4KTQA 1UVIA 4NPOA 2DGOA 3OW2R 2G0CA 3UWTA 3EX7B 1ZZFA 3PRDA 2NR0A 3R1LA 3THPA 4USJC 2R9LA 3TANA 2ZH7A 2IBOA 3DU6A 1FDNA 4NXNF 1VQ9S 2DR7A 3SYZA 2DJWA 1YRTA 4RNMA 3DLGA 5CYMB 5J1PA 3Q8PB 1N0UA 1Q8BA 1VQKS 3SCKE 5L1KA 2C3OA 1XC9A 1S6OA 1WTBA 5CYQA 2QLWA 3GV7B 4J9MA 1N5YB 3C3LA 5F3TA 3MOZA 2FC8A 1EP4B 3FEZA 4ICLB 2EBEA 1H7XA 3ZZZA 3I55S 3HHKA 2Q6CA 5C42A 4KHRA 2RKIA 3GR0A 2IRYA 1KTVA 2I5JA 2RIJA 3KLIA 2VPYB 2DGWA 2J7WA 4JYAF 4ZHRA 5GADI 1T03B 2FC9A 2VKZG 3UD3P 5B08A 4M1KA 2WK4A 4KR0B 2J0XA 1J5OB 5F8LA 2CPFA 4X4UA 4QPXA 1X5PA 3MGJA 4HTJA 4URQU 2AGPA 2V2KA 3W7BA 1RT6B 2IM1A 2LQ9A 3HZEA 2MGZB 1S1TA 2BJEA 3QLHB 3W2VB 1TUVA 1ZAVA 4J5OA 1ZM9A 4C97A 5HBMB 2RUGA 1V3SA 1RYRA 3ZZTA 1Y9OA 4IFYB 2YNFB 3A8EA 3C6TA 3L09A 5KFFA 3K57A 1HNVA 2M52A 5LSOA 1YQHA 2R7TA 2LMIA 4QYRA 1Y5NB 2UZAA 1S10A 1URRA 2PDAA 3OTOF 2MJNA 5SUHA 1K1SA 5ITHA 3ISZA 4XO0A 1URNA 1CEZA 3FRYA 1FTRA 4RW8B 3U1LA 3KLHA 3HHLB 2IVFB 2CQHA 4C8NA 1SIWB 4HVZA 2DNNA 3I31A 4LVOP 3MTKA 2IJFA 5DGAA 5KFMA 3JSRA 4USIA 1G7CB 1XMOF 4P7VA 4CO1A 2D3UA 3CUNA 5KAKA 4DQIA 2OPQB 1AW0A 1IQZA 1FO1A 2LVWA 1UA1A 3KKFA 2YX4A 2CPXA 2KRRA 3IBWA 3LGMA 3OJSA 2JVOA 3UCUP 1NK8A 5JUMA 4DG1A 4I6YA 5HROA 2F3JA 1PSDA 1B7FA 4X4VA 2IJNA 2MSSA 3MMBA 3UPFA 3KK3A 4P7TA 2KHCA 4FXDA 3MPWA 2GCFA 1KR4A 1L3UA 5KFNA 1OQ3A 1SQEA 4YHHF 3K8VA 1JK9B 1U26A 4BBYA 2UUWA 3QYYA 4G1QA 3PX4A 1S6PA 1IBMF 5IT9Y 4DR3F 2R8KA 3I56S 1SL0A 2GC8A 4ZLPA 4K4UA 3VZHA 1SUQB 5D4NA 2C2EA 3MD1A 4O3SA 3E51A 3V6DB 1P9QC 2WSFC 5J2QB 3RW6A 4DOZA 2WW8A 2M4MA 4DQPA 2BACA 4C11A 2F4VF 3AB4B 1F5BA 1UW4A 2N4CA 2OD6A 3H5YA 2R2SA 1VK8A 3RRKA 3PW7A 1XNRF 3VF0B 3PDNA 2UP1A 3KK1B 3MM6A 4ES1A 3OBIA 1TP7A 3LWMA 1DTQA 5KFJA 4OHWA 4ECQA 1G2EA 5H1SV 4WFBQ 3KHHA 4PG7A 2ERRA 3GILA 2B7CB 2V4JB 3C46A 1NB7A 2B5JB 3GFYA 5GAGI 5KFKA 3V81B 2QSWA 4QIGA 1TKTA 2ATLA 2E5GA 5G0RB 2BE2B 5KG7A 2DR5A 2HHSA 1LFWA 1FDBA 1FERA 3ITHB 4LFAF 3MR2A 2FGCA 3O8WA 3OR1A 3QO9A 4QCLA 1ZBTA 1Y3KA 2MHNA 2XBPA 4FBUA 1H2VZ 5MAOA 2YKMA 1VQ8S 1VQ7S 1L3TA 4A8WA 3FSYA 4I0WA 5B0EA 4KJIA 2DGUA 2W9AA 4B08A 1WHYA 3DOLA 4LVNP 4DL0C 2N7YA 4ETXA 1UVKA 1DHMA 4I4BA 2GQQA 2M3DA 2P6TA 4AUKA 4QWCA 1HBUA 2GNKA 2IAJA 4O23A 3SQGA 1UEUA 2CZ4A 1VJWA 1D9AA 2XI2A 1Q81T 3I0RA 3NP5A 5LJ3Y 2MXYA 2BW2A 5DDQC 2MGZA 4NLQA 2KRBA 2MZQA 4I56A 4R5PB 2D1CA 3QLHA 1QSYA 3T6BA 2FLPA 5DDRC 4Y2AA 2RQMA 5KFRA 2DNQA 2HFOA 4ZS6A 3K58A 3QIPA 1HFEL 1Q8LA 2MY7A 5IT0A 2BQRA 2J6SA 4DSIA 1RISA 4PRFA 2BBEA 2XY6A 4UQGA 4C4WA 1E6VB 1C0UA 2VPXB 1LOUA 4YMEA 5KFIA 4IH7A 3PV8A 1ZAXA 3H40A 3LQVA 1GTHA 3IO1A 4Z37A 1S4FA 3DOKA 4RNHA 1OPIA 1G6BA 2DH7A 4ZVGA 5J1EA 1X9WA 1GX5A 1VIXA 4B9NA 3M9OB 4DR7F 3BSAA 3N01A 4C8OA 3IR6B 2VONA 2GW8A 1K9MT 2DPIA 4FXWA 4H4OA 1N33F 4IRCA 2LXUA 2UU9F 1VQYA 2YKPA 1C1CA 3DGPA 3MEGB 3HPOA 3RB6A 3TAPA 1HQUA 2QA4G 4QW9A 4B9SA 2RNEA 1SJQA 2IYGA 4F2SA 3O5TB 4TU9A 1U6BA 4Y2IA 2E9RX 2FVCA 2W9BA 3R5BA 2EFGA 5A8WA 4BS2A 2KDOA 2HG4A 2DH8A 2PIIA 3GIKA 4BDPA 1UVMA 2GMJA 4AL7A 3MMBB 3KHRA 1DURA 4KC5A 1S48A 4ZP6A 4CI0B 4JI5F 5DM7Q 1Y3JA 1LXJA 3TARA 2VODA 1N56A 2ZFHA 2ZBIA 4KBIA 5K8OA 1WI8A 3CGIA 3GFHA 2LQ5A 3IR7B 3C6UA 5E3AA 4I68A 2KXNB 2C22A 2BQUA 3OSNA 3EZUA 3FMWA 2HHWA 1YGYA 4F2RA 1SI9A 2VKRA 3K7RA 5E33A 1FJEB 1SL1A 5D4OA 1R8PA 1NJZA 1U7LA 4MFBA 3TUJC 1DQAA 3ZZOA 3Q0AA 3X1LB 4U7CA 5J2NA 2W4CA 1FVQA 1Q78A 4K50A 4RUAA 3MEEB 1U25A 5E5NA 1U48A 5D4LA 2QIFA 1Y5LB 3MECA 2DRBA 2JLFA 1F5CA 4OX8A 4CO3A 1C0TA 1RT5A 4ZA1A 5LSLA 5T14A 3BQ0A 4LF8F 4I7FA 3T5HA 2VG5A 3D28A 2J8AA 4EU0A 3QWUA 2MKKA 2FY1A 3OFEA 3RAXA 2XLJA 2IA6A 2OPRB 4MIBA 1CPZA 1Q1KA 3SZ2A 4B3OA 1RT2A 1B64A 2XS2A 1JLGB 3FNNA 4IG0A 1LWFA 2AJ0A 3LP2A 5E0OA 3VCDA 2CVIA 1Q53A 2YH1A 2PSZA 4MK7A 2QYCA 2XHWA 3PNIA 3T19A 1JLCB 4JBCA 4X66F 3LP0B 2E44A 3VAIA 1C4AA 2DHGA 1FRXA 2IFXA 1JLEB 3KLEA 4KE5A 4WFAQ 3SQGB 3M8QA 2M0GB 3DHWC 2HRUA 4NZ6A 3MM5B 3U27A 3HHLA 5IQQA 5DQIA 3UD4P 2XS7A 1T7PA 1HYSA 2ZC3A 3WBZA 3DI6A 2R2UA 3SEOA 2VPZB 2JC0A 4ED6A 3T1HF 2AQ4A 4ZOSA 1LWCA 2D74B 4ZPWR 2MJUA 1DARA 3IR5B 3U7JA 3PR5B 2P9CA 3UNGC 1Q8IA 5EWFA 2SXLA 3MMCA 3GQCA 3OJUA 2E5IA 3EGZA 4QU7A 4JI0F 5F8IA 2JWNA 5KG5A 4B9LA 1TFYA 3M1VB 3GFXA 5DQHA 1S6QA 3DRYA 4Q5VA 1X4AA 3S01A 4NWBA 4KHPF 4ZPTR 3NNHA 2XG8A 3HJFA 3M6VA 3P3DA 5F8JA 2JL9A 5J1EB 4NMLA 5HP1B 3M05A 2Z0GA 1R7IA 4ZCKA 2XNQA 2C28A 3IAS9 2ZBCA 3ISND 4NA2A 1HHSA 2IRUA 2RJZA 2XMKA 5DS7A 4LF7F 2LQBA 2GJ2A 3G71S 1C1CB 1YBAA 1R89A 2JRSA 3FDSA 2D3OR 3HI9A 1HQUB 4DQRA 1P1TA 2OPPA 1MWZA 5A0YA 1XTZA 4OLOA 2NS1B 3UR0A 5CYJA 1PILA 2HLTA 2DNKA 3GG1A 3R3TA 1FRMA 2DHXA 4C11B 4L72B 1O8BA 3FEXB 3DLKA