1IJEB

Nucleotide exchange intermediates in the eef1a-eef1ba complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
total genus 23
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ijeB00
4DR7F 4LFBF 4B3MF 4DR1F 4DUZF 4LFCF 2B7BB 1HNWF 2HHHF 1XNQF 4LF8F 2UXCF 1B64A 4LF4F 4LF7F 4K0KF 4X64F 4B3SF 4DUYF 4YY3F 1G1XA 1LOUA 2B7CB 1IBLF 2UXDF 1FKAF 2UUAF 1IBKF 3OTOF 1I94F 1XNRF 4JI4F 1IBMF 3T1YF 2UU9F 4X65F 1IJFB 4JV5F 1QJHA 4OX9F 4NXNF 4DR2F 4DR4F 4LF6F 4AQYF 1CQMA 2KJWA 2YY3A 5BR8F 1XMQF 1HNZF 1HNXF 4JYAF 4B3TF 4JI1F 4JI0F 1CQNA 2VQEF 4DV0F 4LFAF 4JI8F 4JI2F 4X66F 4DV2F 2UUCF 2BXJA 1RISA 4X62F 5AJ3F 2J5AA 2VQFF 4DV1F 4DV6F 4B3RF 4NXMF 4DV7F 5LMUF 4DR5F 3R3TA 4DV4F 4GKKF 1VMBA 4KHPF 3ZZPA 2ZM6F 5IWAF 1N32F 4JI6F 2F4VF 1G7CB 1FJGF 4GKJF 1F60B 1J5EF 2KJVA 4DV3F 3T1HF 4JI3F 4DR3F 4JI7F 1IJEB 4JI5F 5LMNF 2E5LF 4DV5F 1N33F 2UUBF 1XMOF 4LF9F 1GH8A 4DR6F 1N36F 2BVZA 4LF5F 2RJZA 2UXBF 1N34F 1HR0F 4YHHF
chains in the Genus database with same CATH superfamily
4RW4B 1Q1KA 4B9SA 2CPXA 3UNYA 3SCLE 2HHSA 1KVIA 5EN1A 2XG8A 3IM9A 5M2PA 4I2PB 4OYPA 1U09A 2BJ3A 2YKNA 3Q2SC 4R8UA 3SDEA 2X1GA 1S7IA 2RQCA 1S1VB 1RWXB 4X65F 2IRUA 4FDFA 5L1KA 2XSJA 3UD4P 4NLGA 1B70B 2LEBA 4YDDB 4WFBQ 4CYUB 4AQYF 3ENAA 1JLBA 4X4TA 1SJ4P 4K4UA 1HD0A 2R8KA 3IS9A 5J2MB 2BZ2A 2P9GA 1ZPVA 5L46A 3K7RA 4NRTA 3PYEA 1IBLJ 1BD6A 1VK3A 2KKHA 3RYLA 2EEYA 2ZOMA 3OBIA 3OTOJ 2F8MA 2HNZA 3DRXA 4ED1A 2W01A 3PY8A 3OVAA 3GJSB 3HP6A 4ELVA 3BPSP 1T03B 3OD2A 4ZVFA 5DDOC 1IJEB 1U2CA 1WORA 1RWKB 3ILIA 3AHPA 5CH7B 5KFGA 2VJVA 2LEAA 2IJFA 4O44B 1X31C 5DDPC 3DHWC 2E66A 3MMCB 3CCWA 3NGTA 2W4DA 3MDFA 2RDJA 4OJHA 5I3UA 4OX6A 3RAXA 2OD6A 2CQGA 1SV5B 4L74A 4KHRA 2QT7A 4EEYA 1QLNA 1B0PA 4HACA 2UUAF 2XWYA 2DT9A 1KWMA 1S9GB 3TQEA 5IV4A 1HYSA 4TN2A 3DLKA 2D74B 2Z30B 5C2CA 4J91A 1RAAB 4LF5J 1RT3B 2PA3A 1RA6A 1U8SA 4DX7A 3D1OA 1C1BA 4IQXA 5AJ3F 3M8YA 1H98A 2A2DA 3CJ8A 1F3FA 5J1PA 3SXLA 1W25A 2FY1A 3K57A 3PTWA 1CSJA 5CAAA 1IKYA 1I94J 4ZCMA 1RHRB 1WC0A 1ZAVA 2FJDB 1Y5LB 3K2YA 3GLJA 4ED7A 4YUDA 2AGQA 2CRLA 4A47A 4HI2A 2PMHA 1RT7A 4ZPCA 4KO0A 1KD1T 1FI4A 1GH8A 1TKXA 4K4TA 2EPIA 3SSRA 2UU9J 2N3LA 3KHLA 1TAQA 4ZLJA 4P6QA 1B64A 2EK1A 1UFLA 6AT1B 4WTYA 1F9EB 2C2EA 1N6QA 3R5GA 2ZZTA 5ETNA 3M2VB 3LALA 4DL2A 3T1YF 4M94A 4BWJA 3VWSA 4DR5J 4NLSA 1WD6A 2XS2A 1SL1A 2KXNB 3KK1A 4KYZA 4K2XA 1PJ7A 3PHTA 3KLHB 1HR0J 1DTQB 1U49A 4DZDA 4N7TA 3HVWA 4EYHB 3TEGA 2P5VA 2BQUA 4DLEA 2HQ3A 1JLQB 3LP1A 2LDIA 4P2XA 2QFJA 1G7CB 1ZZNA 3CCQS 4NXNJ 1WI6A 4BS2A 4C11B 2KJVA 4FVCA 1D8ZA 3N6MA 4PR6A 4DU8A 2HFSA 2XSFA 3VAGA 5C25B 4J5OA 3MM9A 2M9KA 3QIPA 3W9IA 2OPRA 2KVIA 5LOQA 1H2UX 1IBCB 2VBWA 4LBHA 1FTCA 1SCJB 1YJRA 2DO4A 3WQPA 4DL5A 5IWAJ 3NL0A 5KFXA 3FBFA 3M6UA 5THWA 3D6MB 2C3OA 1IBLF 3T5KA 4ECYA 4KPYA 3OTOF 1SJRA 2I2YA 1AT1B 3H25A 8ATCB 3THVA 2BRKA 1G3OA 1WJ9A 4DFMA 1VJWA 2FY8A 1HNXF 3P49B 2DNGA 2J7UA 2LDYA 3LP0A 1WTBA 1TMJA 1Y5IB 5DQIA 1UEUA 4WZQA 2CJKA 2MJUA 4QWDA 5LM7E 3M8ZA 3RJMB 1KRPA 3PM9A 5AXMA 4CNZA 3QGPA 2DBBA 1LKZA 1U1QA 1X4GA 1RAGB 3G8TA 5KFTA 1BWEA 5F8HA 3I82A 3LP2A 1NK9A 3HD2A 4KHMA 3I56S 2KZMA 1HMVB 2LQJA 3JQKA 1LQ9A 2E9TA 4WFAQ 3GZ7A 3PIOQ 1QSYA 4YY3J 2Z2MA 4A8WA 2UV8A 1UTAA 4LF5F 4RW6B 3NWGA 5GAEU 5KFKA 2L9DA 1VFJA 2KT5A 1RAJA 2DNQA 1C0TB 3A8KA 5IS2A 4CNYA 6FDRA 2DR7A 2VOPA 1I94F 1H7XA 1HQ2A 2D41A 3PW4A 3I31A 1S1UB 1TMMA 4GVBA 2HRTA 4U7UD 1L3VA 4YN3B 1WHVA 1Q8BA 4KRWA 3MUMP 1X0PA 3T1HJ 1NDKA 2JHEA 4DQSA 2IM3A 1TAUA 3EMTA 3R7NB 3OR1B 5A8RB 2OEMA 2L48A 5F8LA 5ETRA 3A4TA 2DITA 3QMQA 4MKVA 4P9SA 2NXUA 4DHVA 4ECTA 4ECWA 2Y3YA 4OZ5A 3CF5Q 3NAIA 4DXLA 4EGLA 3PNIA 3QFWA 1UVJA 1XR5A 2V2ZA 3BQ2A 4M5LA 4DV1J 3O3LA 1ZTTA 1HR0F 4CH1A 4WWSA 1O5JA 4CLTA 2HFOA 3ELHA 4QIVA 4B3SF 2HFZA 2HQCA 4LFAJ 4F3MA 1T8EA 2V5HG 2Z58B 1PAUB 1N48A 3MM5A 4NXNF 2VG5B 1YSJA 1KOHA 2CFXA 1N36J 3GCWP 3DGPB 4F4AA 4UQGA 2UZAA 2F4VJ 2QSFA 4ZJQA 2LU2A 4C8MA 3D3CJ 4QOTA 2H9ZA 3W66A 3BKUA 3SI8A 4IRCA 3R5AA 5IWAF 4XPCA 1S0NA 1P9YA 3OL7A 5D6GA 2Y1RI 4RBVA 5F8NA 3GB0A 1ZAWA 2X1AA 3LAMA 4OV1A 5D4LA 2GQQA 3HSZA 2FJXA 3NGUA 4F0MA 2B9XA 2MQNA 1IR2A 2GVZB 3TUZC 2W9BB 1FWKA 2EC0A 4B9MA 2R7OA 3R8YA 3J80Y 2I38A 1AUSL 2V2VA 4KGZB 2BE2A 3DRSB 1SJFA 1YVFA 2OI2A 3MPDA 1UVNA 1N5YB 4I7FA 3E2EA 5I42A 5B0EA 3PX4A 4U9RA 3TJ8A 3PYGA 2EC2A 2BA9A 2J6UA 1P8GA 4FXDA 1WKLA 1MWQA 4G1IA 3J7YI 1JWWA 4ZOSA 4MK9A 1D09B 3MR2A 2G1HA 2EWHA 4NA1A 3R3TA 4KGXB 3SYZA 4JBCA 4U8VA 3CVKA 2Q66A 1VC6A 1N4LA 1Q16B 1KLMB 5DM6Q 1R8HA 3MAAB 2W25A 5F9NA 2ERRA 1HQEA 3CC7S 2MHEA 5IT9U 4QQBA 2C2OB 5E3AA 2HFVA 5D4OA 4IUFA 1WWHA 4RWXA 3GV8B 1GMWD 2GJIA 4ZVQB 1N56A 3KLVA 2G0IA 2DH9A 1SVDA 3E01B 1Y3JA 3MMBA 2FZKB 5A2QU 3P5BP 3D0IE 1WHYA 4PKDB 4OZ1A 2NLWA 4ILRA 4PYAA 1FE4A 4M63A 4TU8A 4IFYA 5ITHA 1EP4B 2NXEA 3IAM9 3KLEB 1W2IA 2LFVA 4Q44A 4KIAA 2A18A 5AXKA 3MD1A 2J6TA 1CQNA 1WG5A 3VGTA 1N32J 2A6MA 4GKJJ 4ZHRA 2DPJA 2HVIA 2FVQA 3NXZA 2HBRB 3VQTA 1VQSA 4DV1F 4WFXA 2QYCA 2VFRA 3U1MA 1O0PA 3EE3A 1RT5B 1RAIB 2FQQB 2JJ4D 4J9MA 1BLUA 2K7KA 2P9EA 4ERDA 4LFCJ 2BE9B 3I0SB 4ES2A 2MZ1A 3T9NA 3TRGA 5KG6A 4PEOA 2MKIA 2V0NA 4H4OA 2Z4PA 4HI1A 1T94A 1VR6A 1AFJA 2XY7A 2ROPA 4DS5A 3VQSA 1N36F 2ZUAA 3CUNA 4O3OA 1SJ3P 1JLGA 3J81Y 3ICLA 3GMGA 2PMWA 2M70A 1TUGB 4NLVA 3UNGC 2IRXA 2NS1B 4ECUA 2V2KA 3G6ES 3FGVA 1G1XA 5J2NA 2LEPA 2FHJA 2WVDA 3AD8C 2QJ3A 3P45B 3LWMA 1RTHA 1KSPA 1RBAA 1RGVA 3QO9A 3GILA 1AA1B 2KXFA 1RUSA 5KT7A 3O6QA 4QIFA 3QJLA 4WIIA 4LFBJ 4RUHA 2XMAA 1A0OB 2IY5B 4RNNA 1BQXA 5EGYA 4LF4J 1RT6A 4JI5J 3CD6S 3RG6A 2MQLA 3DMJB 2ACYA 1YRXA 2K7JA 1KBRA 4LVOP 4UTGA 2JVRA 3ISZA 2H3EB 1V5IB 5KFRA 2XLKA 2JL9A 4UUXA 1UJ4A 4OQJA 2IJNA 2EBGA 4X4NA 5MLCV 3TAQA 1V9OA 5ETSA 4EI2A 1ITPA 4DS4A 5IQ6A 1FDNA 1WF1A 2VG7B 1EQ0A 1AFIA 3HHDA 1MG7A 5M2UA 3TUPA 2ZHOA 4RUCA 2VONA 5FD1A 3BYRA 4KFBB 3H2VE 2VFSA 1Q7YT 1RHMB 2WW4A 1REVA 3HKWA 2HNYA 3TW0A 1FWLA 3W2WB 2WW8A 3GFZA 2IMWP 1QUVA 2FUG9 4H4KA 4ZP9A 4DR6J 4ZN1A 3NP5A 4USKA 3TQ1A 4F67A 2KO1A 3MR5A 2RUSA 4IFVB 3NY0A 2F63A 2XMKA 1XK8A 3C6TA 2HK3A 5B0FA 4PG6A 4NA3A 2CVIA 3DLJA 1CC7A 4XDCA 2EFVA 4ZP6A 2BABA 1B0TA 2ZKTA 2ZH6A 3AQPA 3QT5A 2AGOA 2XCPA 3D67A 2ZZMA 4N56A 3R6LB 1OO0B 3UVJA 3M2UB 1FCAA 4ENOA 2FD2A 5IOLA 3DC2A 3PKYA 3AAWB 1I51B 4URQU 1VIOA 2CQCA 1PIEA 5D8HB 4GKKJ 4WP8A 2V4QA 2MKYA 2KB2A 5KFMA 2GS8A 1IKVB 4WU3A 1F5BA 5ADZA 2R7UA 4JUZA 3IWLA 3TAMB 2VB6A 2VPYB 1RE1B 4HL9A 2R2RA 1P9QC 1XMOJ 5B08A 3VAMA 1RJJA 1R8CA 2M3DA 4WK3A 5L39A 4PWDA 1RT1A 5DQHA 1NH7A 5FLXY 2AEMA 1X5OA 1S48A 3MEGA 2COLA 4ZS6A 4LQ3A 1OPIA 5ETTA 1CG2A 5LMNJ 1S9EB 2DR9A 2PT0A 4UOFA 1XBWA 1Q4RA 5C5JA 1YRUA 3OTEA 4CH7A 3J7YU 3TWZA 3DI6A 2CG8A 2G13A 1T95A 1JLAB 4B3OB 3A13A 1X0FA 1FRIA 4AT1B 3I5BA 3ISND 4LFBF 1P27B 2MQ8A 2AHOB 2UXCF 3PX6A 4WE1B 4LF4F 3LA0A 2ZH4A 3VCDA 1E6YA 4H4MB 5H9EK 1A7GE 1D8YA 2HNDB 4FBTA 2JFDA 1XN9A 2XNRA 4ILLA 2KM8C 4A8KA 5G0RB 2HRUA 2BM0A 1FKOA 4KPCA 2CDRB 8RUCA 4A8FA 3ENWA 2CPYA 2ZDOA 3CD0A 3OR2B 1FNOA 1HWLA 3PG9A 3TYTA 2CJAA 4HYKA 1FO1A 3L7PA 1JB0C 1WDTA 4LSNB 4IDKA 2QV6A 4FS1A 4OX7A 2BM1A 4TY8A 2UXDJ 4DR6F 2YKNB 1FE0A 1CJVA 3FQKA 3BKTA 3PRDA 4R8UB 4LUBA 2QA4S 1EZZB 3FBBA 1WC6A 3FEXB 3O2IA 3KJFB 1PBUA 3H4DA 1F3VA 2E5IA 1QSLA 4Y3CA 3DRRA 3PACA 5JXSA 1K0VA 1U1RA 1R8AA 1S4FA 2YNFA 3IS9B 3LW5C 1NDPA 4NEYA 3OHAA 1OJ4A 4RW8A 2XZWA 3EPIA 4NASA 3DU5A 1LW2A 2YWEA 3SSQA 1B7FA 3E51A 2PSZA 3DOKB 3W9JA 2ZHAA 2AYBA 4DV5J 3NWRA 2CNOB 4WCEQ 1VQ5S 2R7WA 1HBOA 4GKKF 4OL8A 3GIIA 4RBTA 4BCAA 1W26A 3NMAA 3PRBA 4YEAA 4NLOA 3I87A 4CTAB 2HGNA 4ED3A 4DR4J 2I9SA 4ZPWR 4DLGA 4DQPA 2HS3A 9ATCB 3UCZP 1XMOF 3UCUP 5IZHA 4HACB 5IM0A 1RDRA 1RT2B 4IRKA 5HVFA 2E7VA 3K58A 2L41A 4MH8A 3M30B 2B6AA 1BMQB 1PYOB 1U1KA 3W62A 3DLKB 5D15A 3Q23A 3UD5A 5HMYA 2W7OA 4S0MA 3G82A 3GFXA 1VHFA 4DG1A 2BJ1A 1AXQA 3C6UA 2ZOFA 3PR5B 2AJFE 1IKYB 2GJ2A 3G8SA 3OHBA 2OPQA 3NNHA 1RISA 5KG3A 2XY5A 2XZTB 1VQMS 2JEJA 3HCXA 2FZGB 2IA0A 1C2PA 3D68A 4NX9A 3TO8A 1NH8A 1VMBA 3NOCA 1IBKJ 4KO0B 2B4PA 1TKXB 2BBEA 2CPHA 2IC3A 5DETA 3CXCR 3QJPA 4DUYJ 2GMHA 2MQMA 4UZBA 3DFEA 2XNQA 3NGRA 1N6QB 2R7SA 3UR3C 4DCJB 2K1RA 3GIMA 1FD8A 1YQHA 4ZMMA 1XEZA 2FLLA 3H98A 4AYBD 4ECQA 3CCJS 4OZLA 3RBDA 3M32A 4ETZA 1X4CA 3KK1B 5CHCB 3FCVA 5LXYA 3DLLQ 2V6AA 4JI7J 3I9ZA 1JKHB 2QYGA 1TK0A 3AH6A 2B43A 3B8HA 4R0EA 5CQGA 1L3KA 1Y5NB 1GMVA 3U02A 2KYXA 3MCNA 3MFHA 2ATLA 2DXFA 2BXJA 3C14B 3THPA 1WF0A 4TQSA 4DL4A 1CLFA 1HNVA 2YKQA 3AJ1A 2VA3A 2V8HA 1L3UA 1TKDA 3SV3A 3MM9B 2OPRB 1RCOB 4DCOB 2AZ1A 4YS2A 1S12A 1AUDA 5FIIA 1LWXA 3IRXB 5GAGI 1HL6A 1R6VA 4WPAA 3MTKA 4MFBB 4UY8T 2BQRA 4NLTA 1FK9B 2ZOGA 1ZYQA 5HROA 1DARA 2ZWPA 3KDNA 3SSSA 1X4FA 1F2GA 1DURA 4ZVSB 5LJ5Y 2AT1B 5LSRA 2OGUA 4IO1A 1U1MA 4FNHA 4DR4F 1UWBB 3NNAA 4EZ6A 2DRDA 1X7VA 4C4WA 4O4RA 4DWIA 3EWGA 2IDLA 5T7LB 3W9HA 2E9ZA 2YPYA 3A8IA 4URSA 2HVZA 2NYHA 2HVHA 1VC0A 3BSNA 1FERA 4IR9A 3MPYA 1Y3KA 1SPBP 1K9MT 2R7VA 4BHQA 2XYPB 4TLQA 1IXKA 4DCPB 2MQOA 4WKRA 2B5JB 1TKTA 2XHCA 3BS9A 2F1FA 3RRKA 1RABB 1AZSB 3CDAA 2XWXA 3HT3A 3J7AN 3C46A 1TV6B 4B3MF 2OMLA 2VPZB 4RW7A 1L5UA 2W24A 2QTWA 3C2PA 3H5YA 1UA0A 1S6OA 2LQ8A 4MK8A 4WF9Q 1IBKF 2YKAA 3DLEB 1X4AA 4PPDA 2VU5A 5LMUJ 3TNVA 5L1IA 2VC0A 2DKOB 2FHMA 3GU0A 2DO0A 2OPSB 3CDUA 3DKDA 1F6TA 3T5LA 4DL3A 3OL6A 2R2SA 4C97A 2M52A 2XYGB 2N3OA 3OUYA 1RWMB 2QLJB 3SFUA 4DDFA 2XHWA 2C3UA 1JLCA 4L76A 4QWAA 2MKSA 1JNRB 3CCVS 4F26A 3G9CA 2NZCA 4UY85 1HQUB 2GAHC 3F73A 4TLRA 3HZGA 4JI7F 2BKNA 2JEGA 3T6BA 5C42A 3QAUA 4DV2J 2YXLA 2WVBA 4WIQA 1DJ0A 1RTIB 3G8QA 3US5A 5KFZA 4OI0A 1UPMB 1K8AT 1RBOB 2B4UA 4DQQA 5C7PA 4ZVHA 2CQPA 2MGZB 2DGSA 4M5DA 4QBUA 2AYEA 3NG8A 2R8HA 2XS5A 3BB5A 3E3XA 5ETOA 1LW0B 4TU7A 2YY3A 1TL1A 4QWEA 2ILZA 3JXOA 2ZJQQ 2RT3A 4PXDA 4YB5A 4DU7A 1F0XA 1ZH5A 3D66A 5KFNA 1HPZA 2IM1A 2OIHA 4LQ9A 3NLCA 1BHNA 1BQMA 1JK9B 3P3DA 5LSOA 2J7WA 2PIIA 3BQ0A 3HJFA 4CM0A 2OTJS 2VFTA 2BJ9A 1EETB 2C3MA 3HXMA 4ID5A 4ZVGA 2VV5A 2RHSB 2HZVA 2DHAA 1RHJB 2VD3A 4I6YA 3BH6B 5KG4A 3MUTP 4ZVUB 3WDOA 1VQNS 1JMTA 2D9OA 2HHTA 1YDLA 3GE9A 3OVBA 2HGLA 2R2TA 2BX6A 2V69A 4OZJA 3GIRA 3M8QA 4ECRA 3U27A 4I7FB 5I42B 4GC6A 2WONA 4LSLA 4I64A 5KOXA 1ZBTA 5EWGA 4ECVA 1MN7A 3OXLA 1FTRA 4Z37A 2L08A 2GX8A 2HK2A 2O01C 3KNGA 3UCGA 3KLIB 3EZ5A 2EI5A 1FEEA 1QAYA 4W98A 4F3QA 3CW2C 1RAHB 2VKZG 2WTFA 5DQGA 2QA2A 4LREA 1RWOB 4W4MA 1Y0HA 2AYGA 1KDNA 2WOMA 3HLUA 4ZPVR 4QWBA 3M2RA 4C8OA 2DNNA 1CJTA 4C0BA 2B8QA 2XI2A 2ZBIA 2I5JB 4EUVA 3MMBB 2ZH9A 1ICEB 1U24A 4U6PA 2NXNA 1OIAA 1LWFB 5H9FK 4IFYB 4OYIA 5KG0A 2ZVIA 1T0TV 2KDOA 1J2VA 4K0KF 1YGYA 3F56A 2YX1A 3CB4A 1TVRA 5GAGU 4OHWA 2W9CA 1QVGR 3AJDA 4K50A 1FDDA 4FF2A 2AYMA 3BGRA 4DR3J 3I5AA 4RO0A 1Y10A 4HDGA 1TL3A 3MI7X 3PEHA 2HVDA 1WC3A 1HBUB 5D77A 3PJXA 1H38A 4DUZJ 1S6UA 4DV2F 3PKMA 5HJYA 1WNEA 2G4BA 2GVDB 3H4BA 3AXMA 1YHQS 4B9VA 4P73A 4P74A 3AJ2A 3KDOA 3IBCB 2V8PA 3RR7A 1SH2A 3OTCA 3C19A 3SZ2A 1JLGB 1OPZA 1FKPA 1T3OA 1OSDA 5HMZA 5BYSA 3KWMA 3MXHP 2AU0A 2CIMA 2H48B 2AJQA 4RUBA 3CGIA 3OTBA 2QLXA 2FC8A 4ZVRB 2B8PA 3BDEA 2M2BA 3FZBA 4G6VB 1RTHB 4DN9A 3R7BB 3QO9B 1S5ZA 4OYOA 5D0RA 4CLKA 3I0RA 3MCMA 4EWTA 2YNGA 5D0EA 2KH9A 4AL5A 5KFIA 4R5PA 2VF3A 1K44A 4HH1A 2Q1LA 1RT6B 4YDXA 3NS6A 4KKOB 4NCBA 5EUHA 3FRZA 5C24B 2WVCA 4WKYA 3K0JA 1V5VA 4X66F 3POTB 1OQ3A 4KY3A 1RTDA 3F41A 3H2LA 4BC7A 5CD4H 4I0WA 3UDCA 2FVRA 2F3JA 3D0GE 1X4EA 2VASA 3AOCA 3MM8A 3I4PA 1QVFR 1UFWA 2KXHA 3GV7B 1K1SA 3V6DB 2B9EA 3MEDA 3Q83A 1RWPB 5T14A 2DGUA 1JXLA 2DEJA 3KJVA 3J7Z5 1UCNA 2F8HA 3PYDA 2IMOA 5EX0A 3AB4B 5A6WA 5ETKA 4N47A 3D28A 3DLHA 3IGVA 4C0OC 2HNYB 2B7BB 4DUTA 4C8KA 3UW1A 4KR0B 2HQDA 1FNXH 2ADBA 5M2RA 1RTJA 4ANDA 3B78A 1FKAF 2B4VA 2IRYA 3KHHA 1YG0A 4J37A 5HBMA 2DNZA 3C6TB 3R2DJ 2ATCB 1NSKL 1HI8A 5J1NA 2VOOA 2ROEA 2HMIB 4PG7A 3S8SA 4YFUA 3K5MA 3NKYA 3BYPA 1ZZFA 1VGYA 2J7KA 4NLDA 3L7OA 2AJ4A 1J27A 3UVJB 5KFPA 4NLWA 1P1LA 2DR5A 3RAMA 3UPFA 5HJXA 4DR3F 1J5OA 4OV6A 4MYTA 2M8DB 2O5DA 2OMOA 2VBXA 2RNEA 4YR3A 2V63A 4XPEA 2ZBCA 5FDLA 1N5SA 1UAWA 4DUZF 2P6SA 3OLAA 2IYGA 1QTNB 2E7XA 4ZITA 3HHLA 3CC2S 3FBEA 1YZ7A 3IGNA 4PWDB 1LFWA 2Y0BB 5HATA 2OFHX 2VG6A 3BJYA 3MEGB 1NJZA 3IC1A 4C8LA 2WVFA 1QM9A 2C3YA 4M95A 1SXLA 3FCHA 2VH7A 3HVRA 4CO5A 1VQYA 1Q8IA 5FLXU 3BBCA 1YJUA 2CA9A 3CJSA 1OY9A 3MMAA 2O1PA 1M0SA 3TUIC 3EGZA 2RU9A 2C1EB 3DI6B 4K8RA 3OFHA 4F3OA 5AE2A 4ZP8A 3M1VA 1NJXA 3LPEA 5AT1B 1ROFA 5KFYA 1DQ9A 1VQ9S 4N8OA 4ED6A 3WZ0A 1SKRA 1FJGF 4RR5A 3HK2A 1HNZJ 1T9VA 2LA4A 5I4MA 2LU1A 1E6YB 3FJ2A 1I3OB 2BACA 3N01A 2FB0A 3S1TA 3G96A 5KFQA 2B3TB 2AJ0A 3PW7A 7FDRA 1KONA 5A0YA 1DZ5A 1FKOB 1B7YB 2R4FA 4JI2J 4YB6A 2MY7A 4KBIA 3MECA 3OTDA 1FFSB 1W7WA 4LJMA 2AP6A 4USVA 3KNAA 1U0HA 4JV5F 2XMUA 1VQ4S 2POKA 1OSCA 2DGWA 4RNHA 2KFZA 4V19X 3NAHA 3OLBA 2LMIA 4LR7A 4WFZA 3NGKA 4IG0B 5KFOA 3TA1A 1C1CA 4ANEA 5K5MA 2B51A 5CYQA 3ET6A 3BGLA 1FD2A 2VPWB 4UOCA 1RK8A 2XI3A 4YB7A 3CJ2A 1JLFB 3GJQB 4IOBA 5DGBA 3BH7B 3OJUA 4C98A 3SV4A 1KP6A 8AT1B 5E33A 4DR2J 2NUHA 4TKTA 3RW7A 3ZFVA 3UDVA 4DPYA 2EKNA 2RDDA 5A8KA 2A3JA 5IXUA 1KC8T 2PFDA 5EWFA 2CDQA 3N6LA 1SC3B 1KS2A 2UVUA 4RU9A 1SH0A 3PFOA 4RW8B 2AGPA 4FS2A 5LJ3Y 1LW2B 3FCWA 2DHXA 4TVAB 2YNHB 2H51B 2M0GB 1XR7A 4ALZA 2VBZA 2KVQE 3RBZA 4WTOB 2DCUB 1HBOB 4OJ1A 1HWUA 4ECSA 2FLNA 1M5VC 3DXBA 3CMES 3CJ0A 1QDUB 3PW2A 2MJNA 1RYRA 5KFLA 1VQ6S 1NO8A 2BOAA 3I6PA 3CDBA 4B9UA 2VDIA 3ETOA 5I3QA 2FLOA 1L3TA 2CYYA 5MAOA 1JXVA 4YHHJ 2R7QA 4OX9J 5IM0B 5ETPA 1Q95G 1IR0A 3N5BA 4F8RA 3QPIA 4N77A 1NM2A 2B56A 4F2RA 1GNKA 1IBMJ 2RJZA 4I2QA 4B9LA 2MHNA 1W2BR 1Q0NA 4B02A 3VAKA 3RAQA 3C6UB 3IWNC 2Y8WA 1XTZA 3LWLA 3Q8RB 2W2NP 2OPQB 1WI8A 1MROB 3JYTA 4IH7A 1S72S 1HNZF 5KT6A 1L3SA 1TELA 3IO1A 4C8ZA 1HKAA 2XLJA 2Z57B 1HHSA 1UJ6A 2BKOA 5DZ7A 5T41A 2O66A 2VFVA 2AX1A 1MMDA 4I2PA 1FJCA 4ZCKA 3W2VA 3CNQP 5EHHA 2OP5A 2Y8YA 1S1VA 2CPZA 4LF6J 2JH3A 4ELUA 3QWPA 4CYUA 3KXDA 3ZZRA 3M32B 2RRNA 5HVHA 3K5PA 5J2MA 3OXGA 2GO8A 1FFGB 4DPTA 4PZVA 1VLOA 3PR4A 1UPPA 4XK8C 2W1BA 4HTIA 4ETXA 2AV5A 1WOOA 3VVUA 1HWIA 4JI3J 4DV7J 2BUNA 4PUOA 1Z2LA 1PYTA 2WHOA 1SQGA 4DR2F 1HNVB 1I1GA 1NK5A 2XGQA 2ILYA 2DRBA 3G71S 3KK2B 1NDCA 3QT6A 2FLPA 4CLZA 5JUMA 2CQ3A 2XYHB 2RSQA 2DNPA 2H65B 4RPFA 3MMCA 5HQ8A 1FRHA 4Y2MA 4WU2A 1S1TA 1X9MA 2CWKA 2HLTA 2X51A 3GYXB 2J0QD 3M8RA 3GQCA 1VDHA 3M4XA 2EK6A 2U1AA 2BRLA 2A0FB 4F0KA 5J2QA 3D5MA 4B3TJ 2HYIB 2M88A 5HROB 4ZPAA 4U95A 1RHQB 3VV2B 2YKOA 5ETLA 2EKYA 5B0BA 3M8WA 3UDEA 3KG0A 1IKWB 2YWWA 1KVJA 3CULA 2F7VA 2QE5A 2W2MP 4U7CA 2CQ4A 1U1OA 4QW9A 1S6QB 1NSPA 5LL6d 2JFKA 3DN9A 1AYEA 4OX9F 3AOBA 3KG4A 1CQMA 4FKXA 1TL7A 2PD1A 4X4PA 2C2NA 2LXIA 2EG1A 1TKZB 3MM6A 1H73A 1WOPA 1QE1A 4RW9A 4C8YA 2PN6A 4X84A 3VAIA 3DRPB 4C7QA 3K5LA 4NWBA 1ZA2B 4ZPBA 2V4JA 4G1QA 1RWUA 1NK8A 2AWZA 1RHKB 2AX0A 5GVQA 1Y11A 3BBFA 2DGQA 2QFIA 2BR0A 4RW7B 3CD7A 3RBEA 2YQ0A 3KHRA 1DQ8A 2MLXA 4I67A 2ZKUA 4A8QA 2DNLA 4C9DA 3FBCA 1RTZA 4FYXB 1U6BA 1JLQA 3BGUA 1ZM2A 3TVYA 1UJ5A 2EFOA 4LF1A 2NSBA 2DGXA 1Q79A 1CEZA 2H5JB 3OUYB 4LF6F 3Q24A 5HMXA 4KT0C 3GFHA 4GO5X 4EK2A 3M9MB 1SQEA 5KG1A 5E7OB 4NZ0A 4CRJA 1XNQJ 1XERA 5IFMA 2W8KA 4OLOA 3PFEA 1WSVA 3OFEA 2OHDA 4DSKA 4I56A 2W7AA 2NCKL 3BM7A 2GJFA 2QRRA 3BKFA 1JLEA 1SIZA 3N4WA 5F9LA 1RHUB 2F9JA 1S77D 2JRSA 5KFSA 5KFFA 5D3GB 4ED8A 4DJBA 2E1RA 4JI3F 3JQMA 4O3NA 5AXLA 3GG0A 5KOWA 5HI7A 4J9SA 2MKCA 1WEZA 2LYVA 5B0DA 4FZVA 1SC4B 2YNIA 2N7YA 4F7VA 1KR4A 3QRQA 4M5DB 3GONA 3HDSA 2GA7A 1M5SA 2Z2LA 2ZD1A 5D4NA 2ZVSA 4E98A 2O3DA 5KG7A 3IG1A 3HT0A 1V6HA 1SI9A 3TZYA 1X5SA 5C2GA 2FJBB 5KFDA 4ES1A 1HPZB 2NQPA 2G0CA 4N5SA 1BQMB 4CLFA 1H2VZ 1U1PA 4B3TF 4XDDA 2N4DA 4J9VA 5J1EA 3PJ9A 4EYIB 4XAKA 4YR2A 4KH1B 4RW6A 4OZNA 4ID5B 3P8BB 4PYDA 1GTHA 4NMXA 1S1XB 4X64J 1C0TA 2JNJA 1UEKA 5E3PA 4PQUB 3KMSA 2KHDA 2GMJA 4ECZA 2ZUGA 1S1WA 4ICLA 4LF7J 1T9YA 1A6LA 4DX8H 2RS8A 3M8QB 2GHVC 3EZUA 3M7VA 2ABYA 2MKJA 3QRPA 2WONB 2DK2A 4LSLB 1B3TA 1GQEA 3G6YA 3ZZYA 2FVSA 3WC2A 2RILA 2CVEA 1U1NA 4TYAA 4ZVTB 4ZLNA 2FVCA 1EX8A 4ITSA 3FSYA 2EG2A 2M5YA 2GIRA 3HD1A 4DN0A 4IO9Q 4XTTA 4USJC 4HT7A 5DDQC 3R7SB 4ED4A 2VA2A 3H8YA 2DY9A 2JEIA 1S79A 1NLKL 1JX4A 4FF1A 2WOMB 2MEWA 3M2RB 4DSEA 1JQGA 1F5AA 2J8SA 4TYBA 3FK4A 5BXIA 3LF0A 3ZTPA 1NK7A 3VTIA 3KLFB 1NNDA 2A2CA 3CCRS 1LK7A 1T7PA 2DGTA 1PC4A 2CPFA 4MIWA 2M7SA 2HHHJ 2P2CB 5E3RA 3W63A 2KFNA 1X9SA 2J0WA 2VG5A 5AE1A 2VHGA 2C28A 2BJ8A 3NBPA 4TXSA 2DY1A 3ENQA 4MKAA 4OYMA 4M5IA 1EKRA 2WSFC 4G3IA 2XMMA 1XNQF 2NREA 3D4JA 1RWNB 4V1Ak 1CBKA 1IWGA 3R9LA 4YR0A 4OZ2A 4L3KA 3BBBA 4F50A 4UT4A 2CZ9A 2PI4A 4J7CA 4Q7AA 2RB7A 2UU9F 1VBYA 3JTOA 2HBZB 3I4HX 1K1QA 2BKPA 3RZAA 2G1DA 3MTJA 3AY0A 3CEDA 3QSIA 2NYIA 2XTJP 4LBPA 2J5AA 3MFIA 4YMEA 1R8BA 2E5LJ 3SCKE 4DR5F 5E3CA 2ZBQA 3AXKA 1DLOA 4QU6A 2X7IA 3ILLA 3I55S 4NRUA 3LANA 1HNWJ 3CJQA 2CPDA 4ZCIA 1N5YA 2X1BA 3FMBA 2YX4A 1N5VA 3F0NA 3I0RB 3I96A 5K8PA 2BYCA 2ASYA 2XO6A 1P1TA 1U0SA 1LEOA 2YVSA 4LSZB 2OJ3A 5HP1A 4KV8A 1WKKA 3L95X 4R5PB 2X1FA 2HS4A 3NGDA 2X3GA 3MR6A 4X64F 2Z56B 2N4CA 5B09A 1H2TZ 2ZNZA 4EMDA 1LOUA 1QAJA 5IT9Y 2OUGA 2DISA 1CC8A 4X62J 2AJ1A 4OYBA 1XIQA 1MU2A 4PRFA 4QCLA 3EGWB 3SMZA 4EO6A 1QAXA 1FVQA 1D0EA 4Q0BB 2KJWA 5IC4B 2ZJRQ 2XY6A 5A2QY 2NR0A 1Q82T 1PJ6A 3V81B 4MYUA 2XS7A 2R7XA 2GQCA 4P71A 3GR1A 3HHLD 3MEDB 3CJ4A 1NAQA 3KJVB 1RACB 2KG0A 5K8MA 4FYYB 4DQRA 3HVTA 4Q5VA 4AL6A 1EP4A 5LXRA 2BJ7A 3TZZA 3UE2A 2APOA 2XC9A 3GPAA 2L9WA 4CT9A 3D3BJ 1RTJB 4C0HA 3T6JA 4FYVB 4CQ1A 4EBDA 1TFWA 1YBUA 5HBMB 2HQFA 3KUEA 4YY3F 1YJ9S 1J5EJ 1KOOA 3EGNA 2ALYB 2HHXA 5L38A 5DLFA 3VZIA 1SIWB 4UW2A 5AE3A 3W64A 1U25A 4L3NA 2J9DA 4GO7X 2C2ZB 2DHGA 1T9XA 3Q0AA 3MCOA 3QBCA 5ETQA 3Q8VA 4QR1A 2SXLA 2Z2YB 2HLUA 2QL5B 1IVZA 4HVZA 1CJUA 1J5OB 4NPOA 3K5OA 4UQTA 4JP8A 3HX9A 3WX4A 2UP1A 5KTQA 5FDLB 2QX0A 4CO3A 1D9AA 2H54B 1TFYA 3PYFA 3V4IA 1IKXA 3B82A 1S76D 4QZVB 3T1HF 2WSCC 4ZP7A 3KYLA 2MLZA 3WC0A 3FFIA 3HHLB 4Y0FA 1S4EA 2MPUA 2D3ZA 4GMKA 9RUBA 3TVZA 4J9NA 5IT0A 2VG6B 4DX6A 1BQNB 1HBMB 1U7LA 2ASJA 1BGXT 5KG5A 1U26A 2H5IB 1YTYA 1RSCA 5E2QA 2G2OA 1FVSA 1HIYA 1UEVA 4LRBA 1PSDA 3A12A 1QJHA 1V3ZA 4LRFA 3V6HA 3R5JB 5KFJA 3ZO7A 3L3CA 1CPZA 1RBLA 1ZS6A 3AA8A 3C16A 2RIJA 1YJVA 1TL5A 1LNQA 3M1VB 2IIHA 4LFAF 2YWKA 4QYZK 3PO4A 4DBQA 2VG7A 1S0MA 2KI2A 3D1QA 4QJVA 4DSFA 3HJVA 2BOPA 4KFBA 2R42A 2C3PA 1XNRJ 1UVMA 2F4VF 3W2WA 1VQKS 2JLFA 4IKAA 1XMQJ 2PE8A 1APSA 3WBZA 1VK8A 2FJWA 3IR6B 2HVEA 5A0YB 2FPHX 3VVTA 2QN6B 4X65J 4PXCA 3H59A 1UVIA 4AQYJ 1U0HB 2L9NA 4D3GA 3HSDA 4USUA 3PX0A 2MB0B 2HRYA 1RAOA 1H7WA 4QR2A 1UZHA 4AFFA 2MDAA 1HI1A 3JS9A 4WBFA 4PABA 4BBYA 1C1CB 2UV8G 3JAMU 1NUEA 5H9EJ 5CYQB 3ADAC 1IJFB 3ET6B 4ED2A 2RS2A 4A8XA 1HNIB 1IM4A 4CLWA 4X2BA 3H5XA 3TARA 3M2UA 1YJ7A 5F3ZA 4K4WA 3D6TB 4X4VA 1NKEA 1UKUA 1HHTP 3K59A 1HHQA 3EX7B 4YQWA 3EGVA 2DPIA 5DLGA 3KOAA 2CPJA 4RU2A 2Q6BA 4OI6A 5HN0A 4J9QA 3MR7A 2PEHA 1Q5VA 2CG4A 1J5EF 2KZZA 1O6XA 2VC1A 5F8GA 1U45A 1DBDA 1F9HA 1WKJA 1S10A 5IC6B 2UUAJ 4LIRA 2K2PA 4FN5A 5CYJA 4K2JA 1B4SA 4DV6J 3ILOA 1S9EA 1WOSA 4DPOA 2HIYA 3OL8A 3TI0A 1RKJA 2IJRA 1JJ2R 2AEFA 1NK4A 3R5DA 2R8JA 5CYMB 2WK4A 4TQRA 2Y9HA 4F02A 3UI3A 1REGX 3TEHB 3T1AA 4ZVPB 1ELOA 2QMWA 1JLAA 1NKCA 3DLBA 1GXLA 3RRHA 4QPXA 5KG2A 5A8WA 3GWCA 2XBPA 4CH0S 1RU1A 1S49A 3BQ1A 4FKYA 2VUGA 2QL9B 3J81j 1NB7A 2V8VA 1N5QA 4HHJA 3R5CA 4KTQA 1WC5A 2PEBA 2A10A 2GQ2A 2HSEB 3BDPA 3VGUA 1N32F 3C15A 3JSMB 1GEHA 4I2QB 4GKJF 3MR3A 1FDAA 4ZA1A 5G0RA 4V19J 4X4SA 2P8IA 1DTTB 3U1LA 2QA4G 4MKBA 1IQZA 4MK7A 2E7WA 2QMXA 4Q2MA 3PV8A 2CQDA 3ZZ0A 4Q8EA 3QLHB 4LFCF 3DLGB 2ROGA 1QAIA 3AODA 1NMEB 3IWXA 3RRGA 3IN5A 2JC1A 2PGCA 3V2UC 3IRWP 4NOHA 1SJ1A 1VHIA 1XNRF 3OSNA 3SEOA 4O4GA 4EFAC 2JOQA 1XMQF 4WP3A 2JZ5A 3TX0A 4NYOA 5L8RC 2FIUA 1DQAA 2ZBRA 3W2VB 4NLRA 5KT2A 4L75A 1A9NB 2OO4A 3R2CJ 1CJKB 3DM2B 2DXEA 2ACMA 2R3VA 1LV5A 4P2SA 1T9WA 2LA6A 2FJEB 1Q8LA 1WF2A 3EVOA 1S99A 4CLYA 3PJWA 1RADB 3PHEA 1M5KC 3NS5A 4NLUA 4JI5F 1DHMA 4DF4A 2KYZA 3UWTA 4QR0A 3WX8A 1OY6A 3W5YA 2BE7D 2UUCJ 4O23A 1G6BA 2ASLA 3DOKA 4USWA 3EVWA 2ZE2A 3DNCA 4Z7CA 4PUOB 1HNXJ 4F4KA 1N52B 2HQGA 2NPIA 5GMDA 3IR5B 1C4AA 1NSQA 3UR0A 4QIEA 4QPTA 5HO4A 3HHEA 1WEXA 2AQ4A 4CTAA 1F1BB 1S1TB 1YBTA 1EHWA 4OX8A 2NUUG 2BV3A 2KT3A 4E2FB 3M8PA 4OI3A 4A8YA 1RT2A 2CPEA 4I69A 4J9OA 2OD4A 5DJBA 2DIUA 4DV6F 1VYAA 4F2SA 4BDPA 3M30A 5J2QB 2HGMA 4P75A 3QGGA 1ZOTA 4OJGA 3M6XA 2JWNA 3SDEB 3BO3A 5SUHA 4AXJA 2E1AA 4CO4A 2P9CA 3BSOA 2XSJB 4KE5A 1JLBB 2XGPA 1M5HA 3CTRA 4ID8A 3PVXA 2IM2A 2VL1A 1VCTA 2YTCA 3ZTRA 2E5GA 2J9CA 5DDRC 3CJRA 2ZH8A 3RW6A 4W90B 4NLPA 3FSXA 4HEA9 4NLYA 1TL7B 3LO3A 2C22A 1Y00A 3MOJB 1GK8A 4Y2KA 4KB7A 2HNZB 3MM6B 3NCQA 4K4VA 1FA0A 1YBAA 2VODA 1QE1B 1SUQA 4CLSA 1RP5A 4EBCA 1QD1A 4RW9B 2E5HA 1QTMA 2UUBJ 4UUWA 2ZHBA 2DEIA 5DM7Q 3LTOA 2MKKA 3QGIA 2VPXB 4DR7J 2V4JB 4G1QB 3CCMS 2HBQB 2DD8S 2ADCA 2JX2A 2WBMA 4LRDA 5I3UB 1HW8A 2BDPA 3W61A 3QJJA 1FESA 1KNZA 1JKHA 4Y6IA 2FDNA 4CO2A 1HYSB 4B3SJ 2OH2A 2DJWA 3PCOB 3K8WA 5LMNF 2DHSA 1Z1ZA 2KTQA 1FX4A 1S9FA 1T05A 2IVYA 3MAHA 2Y1LB 1C1BB 5KFCA 4FXWA 3G4SS 3C14A 2W9AA 3FKBA 3UFCX 2XMWA 2H5EA 4RJVA 3KLGA 2W4PA 1B0VA 3TUJC 1IQTA 3PXGa 1TUWA 1NPKA 1UP1A 4DL0C 1YK9A 3VGSA 1D3WA 4LF9J 4ZDNA 5F8MA 1RT7B 2DR6A 3IRXA 1N88A 5F41A 4PQAA 4BC9A 1ZPWX 3GJRB 1T9TA 1JLEB 3QGHA 4DR1J 3OV7A 1FJ7A 4MFBA 2UUCF 1FK9A 1YX2A 5HANA 4F4WA 3GYGA 2C2DA 2K8GA 4H54A 1NK6A 2YNIB 3D0HE 4WXOA 3OW2R 3CO0P 2F5GA 1VJQA 5DS7A 1UWBA 3CMQA 1X4HA 3BO2A 4JI0J 4PWWA 2YKPA 2ZD1B 3D1HA 1HWKA 3CJKA 1S6PA 4WJBA 4GC7A 4LT6A 3IG1B 5T7LA 2H4WB 5CCLA 1M1GA 4OYWA 2O67A 2WRMA 5CABA 2FC9A 2B9YA 4UOHA 1PAEX 2IDEA 2ZFHA 1G4CA 4K4XA 1N54B 3LP1B 5J1EB 3DDKA 2UXDF 2J9EA 1FNMA 4CIOA 3C66A 2RQ4A 2HZAA 4M8LA 2B5JA 3GP9A 1DAXA 4KAIA 3E8OA 3BGOP 1AZSA 4N41A 4BWMA 1RCXB 2RQMA 4KGKA 2MZTA 3QIPB 1TV6A 2YQ1A 3IBWA 1AROP 1C0UA 1S1WB 4ICLB 4MT1A 3OJSA 3KKFA 4E0DA 4NZ6A 2CNLB 3ZTQA 3RB3A 1R6YA 3DLEA 4JV2A 1VIXA 5B7WA 1XC9A 2H4YB 3HFKA 2OPSA 4DV5F 2ZZNA 2UUBF 3LP0B 2CNKB 2IVFB 4NL5A 2QLFB 3JB9k 3M8SA 2JC0A 4DR7F 2HURA 4I6WA 2MTLA 3G6XA 4CLUA 1KQGB 2PI5A 2JLGA 2FJAB 1CULA 4NI2A 2I6WA 3LP2B 1HQUA 3DOMA 5F0UA 1F5CA 1PILA 2RE1A 3RR8A 1NPPA 2HG4A 4USMA 4C48A 2NXJA 3RUBL 1UZDA 2R9LA 4ELTA 4DX5A 1RTIA 3VALA 2V8GA 1NRKA 2VZ9A 4FYWB 3MURP 4DOZA 3NBPB 2MGZA 4ED5A 1TR0A 3R6GB 1UMJA 1N8RT 1LW0A 2HZCA 4GVBB 2OAUA 4LF9F 2VFUA 4CDIA 4NZ7A 2EXUA 3MPUB 4MJKA 5D78A 4DR1F 2E29A 1OWXA 3U1NA 5H9FJ 3LGHA 4ZKAA 2Q3PA 4LR8A 2LECA 3JSRA 1EETA 4DUYF 1SKWA 3Q8QB 2HHPA 3LOUA 1R7IA 1YJTA 4Y2CA 1H0HB 2HWTA 4WYLA 4RNFA 3W65A 2HIQA 2RKIA 3FC9A 1X8DA 1FXLA 4JI0F 2QLWA 2V67A 1DLOB 5ETMA 2QZ8A 3S6EA 3CIZA 1UWAA 4FYDA 2RHQB 2R7RA 3W60A 1R0AA 3NMRA 3HKZD 2DR8A 3VF0B 1FT8A 1DFDA 4NMLA 3H40A 3MCSA 1XJWB 1PCAA 3G2XA 2IBKA 2QLBB 1SC6A 4OI1A 4JI4J 1NHVA 3CDEA 1U4BA 3HMJG 5HP1B 4KV8B 3MM5B 2DNHA 1P6TA 4JI1J 1LFPA 1Q86T 4J9PA 2K06A 2VQEJ 3IP0A 4DV0J 4JI8J 1NZ8A 3NS7B 3HULA 3Q2TC 3ITHA 3KLIA 5KFVA 4WYWA 1WACA 3DXSX 1WUUA 3RBXA 1S0VA 2BW7A 1MU2B 2RRBA 4Y65A 2GHWA 3T5HA 4DV4J 3BZQA 1NJIT 2HAIA 4MMOA 3S7RA 4PXEA 1HWJA 1VQLS 4B9TA 2B7CB 2HWIA 3MEEA 4DFKA 1JJCB 2F8EX 3TVKA 2I5JA 2HFNA 4RNOA 1LXNA 2B9WA 4AXIA 4CM2A 4KQZA 3HVTB 3UN2A 1LWFA 4HDHA 2X3DA 2F9DA 2QA1A 3MMJA 3LQVA 4DZ6A 1E6VA 2AIRB 2EFGA 3SIPB 3CCZA 2HAFA 4UZCA 3MHYA 1VRTA 3FQLA 2MXYA 1GTEA 2BE2B 2CWXA 3R97A 3QSYB 1RAEB 5J2PA 3O1LA 1HI0P 2RU3A 2ZBPA 3J80U 1JJ4A 4E8UA 5HQLA 1HBUA 1URRA 2V68A 3R5BA 3T9ZA 1T02A 4X4OA 1B99A 1U2RA 1UW4A 4B3RJ 5CCMA 4NXMJ 2GVDA 3HI9A 1WG4A 1NKBA 1YLXA 3CT9A 2ASDA 5E3QA 4PAAA 4P2FA 3TP2A 1H6KX 1PG5B 3IAS9 3BN4A 3O44A 3DDIA 4OFZA 1CJUB 3JSBA 3CIMA 3R1LA 1HQEB 2FHJD 3OQ2A 4PXBA 3H5UA 2G9OA 5F8JA 2BW2A 3K17A 1EKSA 2FJVA 1RA7A 5K14A 4J9KA 1GX6A 3BO4A 3HHLC 2E1MC 3V4IB 4R0JA 1IKXB 5LMUF 1KTVA 3GR0A 4O3PA 2CQ2A 4KGMA 4USTA 1I6JA 2D7SA 1FXDA 3FFIB 2CZ4A 2F65A 3ZZPA 4ANCA 4RX6A 1X9WA 3B6BA 2UXCJ 3QT8A 1AB8A 4KKOA 2W8LA 3TZWA 3J7ZT 4CZCA 4LF2A 3GTYX 5C24A 1YZ6A 3T5JA 2RD5C 3POTA 3H2UB 2KN4A 4ZHRB 2CJBA 4P10A 2E44A 1N5TA 1HBNA 1HLWA 1N0VC 1KEKA 3C16B 1UVLA 3SQGA 3EPGA 3CCES 3N0VA 4JI4F 3EJMA 5HLFA 2E9RX 5DGAA 1NCLA 4HLBA 3V6DA 1GX5A 2D3OR 4RWWA 5HAOA 3ZTSA 4H4OB 2FTRA 2V4RA 3GCXP 2Y0SD 2MKHA 4JI1F 3D6HB 3NCPA 2VQEF 1FHTA 2HW3A 4DV0F 4JI8F 1U02A 1WG1A 1U48A 1Q81T 1RAFB 4URGA 2OFGX 3OFFA 4DV4F 1C4CA 1JIHA 1NHUA 3TZXA 4M5KA 3HM9A 1NDLA 2ZITA 5J2NB 3J81U 4OHZA 3GIKA 4P52A 3ONQA 3H7HB 2FGCA 4GVLA 2AD9A 1NZAA 4XIUA 2HMIA 1FRMA 4CT8A 3UN3A 4Q45A 2CNNB 2MY8A 4CLPA 5GMKa 2MQQA 2HHWA 2EFNA 1DRZA 2LVWA 1IUJA 1TTHB 3ETMA 4P7TA 3CCLS 2DNOA 3R1HA 1NSAA 4AD6A 1M5PC 3VGVA 4OYZA 4DV3J 4HTJA 1WSRA 2HKEA 1RQ0A 4I68A 3A1YG 2MSSA 2QIFA 1S0OA 4J9LA 3ZZOA 2C2MB 1N34J 1MN9A 5DO2A 5IQQA 1R0CB 3HO1A 3KFWX 3EM1A 4B3RF 1WHXA 4NXMF 2DGVA 1BWVA 4KC5A 2ZWOA 2YKMA 2QO3A 2ZH3A 2Q6CA 1BXNA 3OXFA 4GRSA 4IG3A 2GCFA 5CD4A 1IN0A 4MIBA 1NPRA 5ETVA 3D7SB 4P7VA 5EDWA 2UUTA 1TP7A 4J90A 1REVB 4K4YA 2I0XA 2UVVA 5BR8J 3O8WA 2CZVC 1VRQC 2W2PP 5F3TA 3QQCD 5JJBA 3L9ZA 3AFGA 1M5OC 4YP3A 3IA0A 1TL4A 3L7UA 1QSSA 4KHPJ 2BJEA 4WP9A 1FRJA 3M6WA 3QRRA 1UVKA 4ILMA 1Q5YA 4ED0A 2B0GA 2WZ1A 5KFEA 1QY7A 5A8WB 3FZ2A 1RWWB 4Y28C 4C3KA 5EWEA 3OPKA 2IAJA 2RVJA 3M9NB 4Y2AA 3P96A 2W2OP 1KKHA 1LK5A 1S57A 1RYSA 4CLLA 1XMBA 4HT5A 3C15B 5IV3A 1FF2A 2YH0A 5L1JA 5HSPA 2CQ1A 5KFBA 3BEGB 2IPOB 1VQOS 2GW8A 1TU0B 1R31A 2XLIA 3KUHA 1Q7LB 3TOQA 1IM6A 1TZ0A 3SQOP 1NU4A 4P72A 1JXEA 2EVZA 3QIDA 4IG0A 4NLQA 4BLGA 1RT1B 1KQSR 2CADA 2MZSA 3OT9A 1IWAA 4ER8A 4RL1A 3EVMA 3BR9A 4O4GB 4HHUA 5FJ4A 3B4MA 1JLFA 5A76A 1KFSA 2GGPA 4JOUA 1LWEA 3X1LB 2HWHA 3IXQA 1RT4A 3DYAA 5HK4A 1TK8A 1FEHA 2W2QP 3VHQA 3DRYA 1UW9A 3MM7A 2CAJA 3ENVA 2XQCA 1R43A 4D3HA 3C3LA 3JSYA 1M90T 1ZM3A 2VKRA 2YNHA 2MZJA 3GSDA 4Y34A 4Q2LA 1YKWA 4F0HA 1VRUA 4RZRA 4NCGA 3N28A 3GV5B 2J9DE 4DV3F 1H72C 2ZE2B 4DSJA 2OLWA 4FVMA 3KK3A 3RTVA 1YITS 3BSCA 2DIVA 1N34F 4FP9A 1FXRA 4UF4A 1HD1A 3DOLA 4KSEB 2HQIA 3M8PB 3PDNA 3BN7A 3DHXA 4JV1A 4DQIA 4N76A 3UN5A 2W4CA 3TA0A 4IDKB 2E5JA 3Q22A 5KFHA 2MQPA 4NCAA 2DNRA 2XEXA 5BR8F 1RZMA 3W5XA 4DSLA 1V3RA 4TY8B 1CJVB 4X4QA 2PO4A 5L9XA 4FNIA 3EYZA 2UVRA 1PBAA 3Q8PB 1SB6A 4FF4A 3BREA 3RB0A 6FD1A 4NLXA 4TNOA 4X4RA 2D69A 3NOGA 3DRRB 4KHPF 2QG9B 1YI2S 3F44A 3ISNC 4B3MJ 4DL7A 4ZPTR 4K4ZA 1XQIA 2YNFB 1MROA 2OPPA 4K5RA 1VBKA 3DGVA 1GXTA 5BYRA 3GG1A 1YIJS 2CJYB 4A46A 1Q78A 5BJRA 3T3FA 4DL6A 3EDQB 3RGIA 2V50A 4USHA 2XCAA 4PWUA 1SUQB 4IRDA 2VICA 1VLYA 2RMLA 1FFWB 2CXEA 5GADI 4M5GA 2IBOA 4O3QA 3ZZUA 1G2EA 2KRRA 1X4BA 2DVIA 2LXFA 3QAEA 2DRAA 1MMNA 3HSJA 5K9FA 2DXDA 1U6ZA 1D1UA 3CCSS 1Y7PA 1UETA 1K0TA 4C2MA 2UXBJ 2MYFA 3W8GA 3HVAA 4O0IA 4U67Q 5DG7A 2D1CA 2J0XA 3BSAA 3UDLA 1U8WA 2BANA 2VBYA 4IH5A 4F36A 2B6AB 3CD5A 1OQ6A 1VOMA 1T05B 3G82B 3QWUA 2NZ4A 1LWCA 4TU9A 3CWJA 3ZNUA 4JYAJ 4MTPA 5LT5A 4ZK7M 4DG1B 5F0WA 3MPWA 4LVNP 5BYQA 3KLGB 3KK2A 4AL7A 1BUXA 1MW7A 2LCWA 3FEZA 1CS4A 2QSWA 3W5ZA 2EW9A 4OIXA 5EX3A 3K89A 5SZTA 3HHNB 1RKIA 2YWHA 3NEKA 4L73A 3MAQA 4C3MA 4WXWA 2RF2A 3MEKA 2F40A 1WC1A 2KRBA 4RW4A 3I9V9 1Q8KA 3TAPA 2IC3B 1N33J 3OL9A 1RLCL 2HBYB 3H20A 5DRKA 2A6OA 3LGMA 3GFYA 1KTQA 4JI2F 2K1RB 1H3DA 2PA8D 2HHQA 1RWVB 1IKWA 3CPWR 4WK1A 3G86A 2GHPA 3CJKB 1S6PB 2G2YA 1MMLA 2KHCA 3EUNA 2XZDB 2XMTA 5KFWA 4M1KA 1S6QA 2BJDA 2WB1D 1FWPA 2R8IA 2AZ3A 3M05A 3KHGA 2AMCB 2G2ZA 3B4DA 2XULA 2CKWA 1CVJA 1TKZA 3A3PB 3H5SA 1SL0A 2V9KA 2I8EA 2V2QA 1KHVA 3B54A 2YWGA 1T03A 1SJQA 1T3NA 4ZCLA 3JQJA 2DNKA 3IFEA 4FF3A 5G4DA 5B0AA 3DRPA 2LQBA 2KT2A 2MLYA 1MWYA 4O44A 2D3O1 1SQFA 5HMWA 4EZ9A 3WHIA 2V94A 3CE8A 4Z2XA 1O51A 1C0UB 2HFUA 4LR9A 4KJIA 4I4BA 1SV5A 3JTPA 3FNNA 2XO7A 5KFAA 2AF6A 2R7TA 1S9GA 5E0OA 4M5NA 2UVWA 4A4JA 2V9WA 1RT3A 5D0GA 1PO6A 2Q79A 5KAKA 4F4YA 2C42A 3P6YC 2J76E 3EICA 4QU7A 2HHVA 1F60B 3HSGA 2NSCA 4K0KJ 3AQOA 3EZOA 1R0BG 4I1TA 2ZNYA 1ULRA 1VQ8S 4RNMA 2DCLA 1CULB 1NEEA 1Y4ZB 3Q86A 4NI2B 4ZVOB 5KT5A 2G0JA 2FHOB 2UXBF 2D9PA 4YHHF 3DOMB 2IM0A 3NGSA 3CCUS 3FSIA 3GYNA 2ZM6J 2M4MA 1AW0A 5H1SV 5DG9A 2EFPA 1KFDA 1URNA 1GXUA 1IBMF 5D3GA 1PC5A 2VIHA 1WHWA 4LIWA 1FDBA 3CMAS 3WIVA 2GO9A 3PIPQ 4JYAF 4IOAQ 1TKTB 3RB4A 4WFNQ 4O3RA 3M2VA 4B9NA 5E5NA 3EDRB 3V4MA 1X4DA 2ZH5A 4Y2IA 2RH3A 2M8HA 1HA1A 5U47A 4JB8B 4IYQA 3TANA 4MKYA 4ZLLA 4OMFG 1NHKL 3MOZA 2WCXA 1PJ5A 3AOAA 3KLHA 1DTQA 5D0HA 3NCRA 2D3UA 2GZOA 4AE5A 1S97A 4EBEA 4A8SA 4OYAA 5JMNA 4RKUC 3TJAA 2FYXA 4A8OA 1N33F 2GIFA 2DH8A 4CCHA 4YOEA 3M6VA 1BY9A 2LKZA 3K8VA 4PG5A 4C11A 1EQMA 4NEZA 2OSRA 1S1XA 1X60A 2I1RA 4DPUA 4ZN3A 3FMWA 5AXNA 1JLCB 5CZXA 2RKIB 4PQUA 4YB1P 5C25A 1WEYA 4X66J 4NYZA 4ATNA 4ZIVA 3ZTOA 1GAOA 3PW5A 5F8IA 1ZETA 1R0AB 1NJYA 5GADU 4QIGA 5GAHI 4IQMA 3RU0A 1LXJA 2AW0A 1MLAA 5I3PA 5C42B 1K47A 2JLEA 4K5SA 1VISA 2HPUA 2NPFA 3BGFA 3LH2S 1XR6A 4Z7YA 3QZ8A 4DV7F 3T41A 1BE4A 3LPYA 2CJ9A 4NA2A 3MPVA 1VQ7S 2R2UA 3ITHB 2DNYA 2ZEJA 1D9FA 1HFEL 3V6KA 2WVEA 1RXOB 4Y00A 4QW8A 2CQBA 1Y9OA 1TQLA 2F4FA 1TL1B 2CQHA 2EFQA 1HMVA 2VQFJ 2GMLA 3MEEB 3GJTB 4Q8FA 4OHVA 4K7QA 2IVMA 3O5TB 4ES3A 3KLFA 3OVSA 3ZC4A 1YJWS 1M1KT 3ZZTA 3A3OB 4U96A 3QZ7A 4FPRA 1VBXA 2MZQA 5CA5A 1ZA1B 4K4SA 3CO9A 2CPIA 1XWLA 4ECXA 1E6VB 4QYRA 3PW0A 5A6PA 4P2MA 1VRTB 2N7CA 4LF8J 2BQ3A 4M5MA 4NE9C 3FEYB 2K3KA 1U6FA 1SH3A 5J2PB 3W1YC 1S1UA 2OKQA 2H1YA 2MSTA 4IH6A 2JVOA 5KT4A 2FVPA 2IFXA 2ZM6F 1SKSA 2HS0A 4A48A 5KT3A 3AB2B 2ZDPA 2BMBA 3OR1A 3QNWB 5A8RA 4DF8A 1WTFA 3D2WA 2U2FA 3IMQJ 3PZPA 4N8NA 2KL8A 1I5OB 2OSQA 4O0NA 3KJNB 1SL2A 4USIA 1F2HA 1S59A 1UL3A 5K14B 4DMZA 2LP4A 1TUVA 1CJTB 3CJ3A 4ZVEA 1EB0A 2BEFA 4AUKA 1FRKA 3AD7C 3S01A 3R27A 2UUWA 1FJGJ 4CO0A 1QUPA 4CWBA 1NJWA 5HVGA 3QT7A 4F4XA 4OHYA 1BC6A 4FXVA 3CSKA 3UQSA 2OEKA 2QC3A 1TVRB 2HHUA 3DGPA 4U7UK 1WDDA 2W9CB 4FBUA 2DNMA 4RLEA 2AJ2A 1YJNS 3BGRB 3MD3A 3L09A 2XMJA 3N79A 4Q0BA 2QMUB 2WSEC 3MZIA 1TL3B 1HBNB 3Q8YA 4RBUA 3MGJA 3MWBA 2GIQA 2XMVA 3V81A 2AEJA 1R27B 1JNZB 3SQGB 4OJ3A 5CZVA 4JV5J 4WFYA 5HLFB 3A8JA 5KFUA 2QL7B 3P5TL 2A1BA 3QATA 3D6FB 3TX8A 3HZEA 2DHHA 1D9DA 1IR1A 3MUVP 2IYIA 3X3UA 4PCQA 1SKUB 4EO8A 3NNCA 3AD9C 1Q53A 1EIYB 3IR7B 3IM8A 2GVZA 3V5RA 1EJ7L 2W9BA 2R8GA 1X5PA 1FKPB 4M5HA 2DYAA 7AT1B 5IT4A 1ZM4A 4OHXA 3DRSA 3FDSA 3EXYA 4CO1A 2VDHA 1U1LA 3QFHA 2VQFF 1OY8A 4PG4A 3C8YA 4C3LA 5D4PA 3D9BA 2CQIA 4QYZJ 4QWCA 3ULHA 4MAKA 1U47A 4L6V3 4M5JA 4IR1A 2YNGB 2ZH2A 3HFZB 4U8YA 3SCJE 1KN6A 4HHHA 3ZZZA 5L9NA 1NK0A 1GFWB 3T19A 1VI7A 3TJ9A 2LQ5A 1JJHA 3UD3P 2IHR1 1DY3A 3ILJA 1VC5A 5RUBA 3FVYA 1O8BA 2HEKA 1KLMA 3BV8A 4C8NA 4B17A 2WB4A 3MAAA 1RTDB 2QGFB 2RRAA 4LF8F 4O3SA 3W3SA 4LF7F 4B08A 4HKQA 4EU0A 1ACMB 3TR5A 4JI6J 2Z2ZA 1ZAXA 3MM8B 1OYEA 4WZMA 4LRCA 3P4UB 3E01A 3NRBA 4ZJLA 2Q43A 1KHWA 4UOGA 2YKMB 1V3SA 3HHKA 1RB0A 3G87A 3GIJA 4IG3B 3KTQA 4I6AA 4A8MP 3IBFB 3M9OB 4H4KC 1R89A 1RI7A 5GAHU 2MMYA 1BQNA 3CJ5A 2FHKA 1HBMA 4J9UE 4ZJOA 3KLEA 5K20B 2KFYA 2ALZA 2Z0GA 3OSPA 4OLPA 3A8EA 3W7BA 1GMUA 3VR1A 2YH1A 2GV1A 2J0SD 3CDWA 4R25A 2OELA 3AT1B 1YRTA 1RT5A 3MF5A 1PGZA 5B0CA 1FRLA 1UFKA 3I32A 3GSIA 3KG1A 2FGOA 3I0SA 1R3NA 3VAFA 1MWZA 1R8PA 4OYXA 2C2KB 2HHHF 3AA9A 3I5CA 3A3NB 2JEFA 2ZH1A 2IAJB 1SC1B 4PPZA 2EBEA 2AKWB 1GT8A 4TY9A 1KLNA 2Y1IA 3N6NA 2ZC4A 1EAYC 4KH0B 2OEJA 1OS5A 4L72B 3V6JA 4W92B 1Z4UA 3JAMY 1GMWA 3H42A 2N82B 1S7HA 2PC6A 2XM3A 3HF5A 3Q8SB 2JDJA 2CJXB 4DI6A 3N9UC 3TA2A 4X4UA 1T11A 5JVGQ 4CI0B 1H74A 1HNIA 4F4ZA 1WELA 1FX2A 2YX7A 3DMJA 2E5LF 5B0GA 1EARA 2J8AA 3Q89A 2YBVA 3KMQA 3K5NA 3SBMA 3MMAB 4OI4A 1HNWF 2GGPB 2DTJA 1LWEB 1TK5A 1U2FA 1RT4B 3ZXWA 3Q8UA 5HL7Q 2GNKA 4G65A 2VJUA 3DYAB 2OTLS 4DPWA 4ZLPA 3RB6A 5DZ6A 2ZH7A 4OZ3A 3MM7B 4LRAA 2IA6A 3DCAA 4ZPDA 2Z8QA 5K8NA 2V8DA 3SFGA 2K3IA 4X62F 1VRUB 3PEJA 2J6SA 4NCGB 3QYYA 1ZM9A 2RQKA 1PYSB 2P6TA 2CJQA 4OI2A 4C6AA 5CYMA 4IFVA 3KK3B 4LBIA 3MECB 5HQMA 4JI6F 3PO5A 4F25A 2ZC3A 1KQFB 3H90A 2Y1JA 2WBRA 1SBRA 3FUYA 4ZIWA 5GMEA 3U7JA 1FRXA 3UO0A 4K59A 4DEZA 2RAQA 4J9RA 4F04B 3DOLB 2BVZA 2W7PA 1VBZA 2GC8A 3VAJA 2YPZA 1MSWD 2YWFA 4LMZA 4G1PA 3CCTA 4KGVB 2XB2D 3HFVA 3JSMA 5K8OA 3THTA 3LAKA 2PMZD 4OZ0A 3CC4S 1DTTA 3H0PA 4FPIA 1IKVA 2E1CA 1VS3A 2C2RA 1PKUA 2DH7A 4CP5A 3QLHA 5A8KB 3TAMA 3DLGA 1Z2ZA 3J7A1 2OPPB 2GFFA 4QIWD 2RUGA 1HARA 2NXCA 1NB2A 4IOCQ 3CJTA 3PRVA 3W8PA 1T9UA 3BPDA 3SCIE 1MNEA 3L4BC 3JTNA 3VAHA 5CXTA 3G6VA 3OFGA 1VQPS 3ZNJ1 4Q43A 2GAGC 3KJQB 4HH0A 4XO0A 3FRYA 5AJ3J 2DGOA 4HR2A 1KVKA 4PG8A 1NBEB 1N0UA 2CUYA 1CJKA 3DM2A 1OYDA 1KQKA 1ZTWA 3WIUA 3D54A 4B3OA 5LSLA 2LQ9A 3EXCX 2E1PA 3BR8A 1WC4A 2PDAA 1F9FA 1NXIA 5DG8A 5L1LA 2ZJPQ 4WE1A 3HPOA 5JVHQ 2PFFB 2MZRA 2BANB 3LUYA 4H4MA 2YQ3A 2HNDA 7FD1A 4NYPA 3LGNA 3DU6A 2V34A 2LLZA 3DDNA 4DPXA 1LWCB 1X5TA 1RU2A 1K73T 1UA1A 1HW9A 2KU7A 3KUGA 2QEXS 5E41A 4JV0A 2L3MA 2KG1A 1CS4B 3T1YJ 2KM8B 1YWXA 3BF4A 1M1HA 2RDIA 2FZCB 1RLDA 3OR2A 3N5FA 4RUAA 5GAEI 2B4OA 3JYTB 2LXUA 1FJEB 2CQ0A 2WAQD 3VZHA 2JSXA 4DFJA 4DSIA 1OMSA 4LSNA 4DFPA 2RF2B 4MIAA 2DB1A
chains in the Genus database with same CATH topology
3C46A 1TV6B 4B3MF 4RW4B 2YVSA 1M5OC 1Q1KA 2OJ3A 5HP1A 2OMLA 4KV8A 4YP3A 4B9SA 3L95X 4R5PB 2CPXA 2X1FA 2HS4A 2VPZB 4RW7A 3NGDA 3IA0A 1TL4A 2X3GA 1L5UA 2W24A 3MR6A 3SCLE 4X64F 2HHSA 1KVIA 5EN1A 2XG8A 1QSSA 5M2PA 2N4CA 4I2PB 2BJEA 5B09A 1H2TZ 1FRJA 1S6OA 1U09A 3M6WA 3H5YA 1UA0A 3C2PA 2ZNZA 4MK8A 2YKNA 4WF9Q 1UVKA 1LOUA 3Q2SC 1QAJA 5IT9Y 2DISA 1CC8A 4R8UA 4ILMA 2AJ1A 3SDEA 2X1GA 4ED0A 1IBKF 2YKAA 2RQCA 3DLEB 1MU2A 1X4AA 4PRFA 1S1VB 2B0GA 4X65F 4QCLA 4PPDA 3EGWB 3SMZA 3TNVA 1QY7A 2IRUA 1QAXA 4EO6A 5A8WB 1FVQA 2XSJA 5KFEA 5L1KA 5L1IA 3UD4P 1D0EA 4NLGA 3FZ2A 4Y28C 2LEBA 4C3KA 4YDDB 2VC0A 3OPKA 5EWEA 4WFBQ 4AQYF 2FHMA 1JLBA 4Q0BB 2IAJA 2KJWA 2RVJA 2DO0A 4X4TA 3M9NB 2ZJRQ 2OPSB 3CDUA 2XY6A 1SJ4P 5A2QY 2NR0A 4Y2AA 1Q82T 3P96A 4K4UA 3V81B 1HD0A 4MYUA 3T5LA 4DL3A 1LK5A 3OL6A 2XS7A 2R7XA 2R2SA 2GQCA 2R8KA 3IS9A 4C97A 5J2MB 1RYSA 1XMBA 3GR1A 4HT5A 2BZ2A 2M52A 1FF2A 2YH0A 5L1JA 2CQ1A 2N3OA 3OUYA 3HHLD 2P9GA 1ZPVA 5KFBA 3SFUA 4DDFA 3BEGB 2XHWA 3MEDB 2C3UA 1JLCA 3CJ4A 1VQOS 2GW8A 3K7RA 4NRTA 1R31A 1NAQA 4QWAA 3KJVB 2XLIA 2MKSA 2KG0A 1BD6A 1JNRB 1VK3A 2KKHA 5K8MA 3RYLA 2ZOMA 4DQRA 3CCVS 3HVTA 3OBIA 2F8MA 2HNZA 3DRXA 4F26A 4Q5VA 4ED1A 1Q7LB 3PY8A 3G9CA 4AL6A 3OVAA 1EP4A 5LXRA 4UY85 3HP6A 3TOQA 4ELVA 1HQUB 3F73A 4TLRA 3UE2A 1T03B 1TZ0A 3HZGA 4JI7F 2APOA 4ZVFA 5DDOC 1IJEB 2XC9A 1NU4A 3AHPA 5CH7B 5KFGA 2JEGA 1JXEA 2EVZA 2LEAA 2L9WA 3T6BA 3QAUA 3QIDA 5C42A 4IG0A 4CT9A 2IJFA 4NLQA 4O44B 5DDPC 3DHWC 1RTJB 2E66A 4C0HA 1RT1B 1KQSR 1DJ0A 1RTIB 3MMCB 3T6JA 3CCWA 2W4DA 2MZSA 3MDFA 3G8QA 3US5A 4CQ1A 2RDJA 4OJHA 5KFZA 4EBDA 1K8AT 4OI0A 1TFWA 5HBMB 5I3UA 2B4UA 4OX6A 3RAXA 2OD6A 3BR9A 4O4GB 4DQQA 2CQGA 5FJ4A 3B4MA 1JLFA 1SV5B 4YY3F 4KHRA 2CQPA 2QT7A 4ZVHA 2DGSA 2MGZB 4EEYA 1QLNA 1B0PA 1YJ9S 4M5DA 4QBUA 2UUAF 2XWYA 2AYEA 2DT9A 1KOOA 3EGNA 1KFSA 3NG8A 1S9GB 2GGPA 2R8HA 2HHXA 2XS5A 5L38A 5DLFA 1HYSA 3BB5A 3VZIA 3E3XA 4JOUA 1SIWB 4TN2A 4UW2A 5AE3A 1LWEA 3X1LB 2HWHA 1LW0B 4TU7A 3IXQA 2YY3A 1RT4A 1TL1A 3DLKA 2D74B 2ILZA 4QWEA 2ZJQQ 2RT3A 1U25A 4L3NA 2J9DA 4GO7X 3DYAA 4PXDA 1RT3B 2DHGA 2PA3A 4YB5A 1TK8A 1RA6A 1U8SA 1F0XA 1FEHA 3Q0AA 1ZH5A 3D1OA 1C1BA 4IQXA 4QR1A 5KFNA 2SXLA 3DRYA 5AJ3F 1HPZA 1H98A 2IM1A 2OIHA 4LQ9A 2HLUA 2A2DA 3MM7A 3NLCA 5J1PA 3ENVA 4HVZA 3SXLA 1BQMA 1W25A 1JK9B 2FY1A 3P3DA 5LSOA 1R43A 2J7WA 2PIIA 4D3HA 3BQ0A 1J5OB 3K57A 3C3LA 3JSYA 4NPOA 1CSJA 3K5OA 1M90T 3HJFA 4UQTA 2OTJS 1ZM3A 2VFTA 1IKYA 2VKRA 2YNHA 1EETB 2MZJA 3GSDA 2C3MA 3HX9A 3WX4A 4Y34A 4Q2LA 2UP1A 4ZCMA 5FDLB 5KTQA 3HXMA 4ID5A 4ZVGA 1ZAVA 1D9AA 2VV5A 2FJDB 4CO3A 1TFYA 2DHAA 1VRUA 1Y5LB 4RZRA 2VD3A 3K2YA 4NCGA 4YUDA 4ED7A 3V4IA 1IKXA 3N28A 3GV5B 2AGQA 2J9DE 3B82A 4DV3F 4QZVB 3T1HF 1S76D 2WSCC 4I6YA 4ZP7A 2ZE2B 3KYLA 3WC0A 2CRLA 4DSJA 4A47A 4HI2A 5KG4A 2PMHA 1RT7A 2OLWA 3MUTP 4ZPCA 3FFIA 4FVMA 3WDOA 4KO0A 3KK3A 1VQNS 3HHLB 1KD1T 1JMTA 2D9OA 1GH8A 1TKXA 3RTVA 4Y0FA 2HHTA 1YITS 4K4TA 2MPUA 2EPIA 2D3ZA 3SSRA 3GE9A 3BSCA 2DIVA 2N3LA 3KHLA 4GMKA 1N34F 3TVZA 1TAQA 4J9NA 3OVBA 4FP9A 1FXRA 5IT0A 2HGLA 2R2TA 2VG6B 4P6QA 1B64A 1BQNB 4OZJA 1HBMB 1U7LA 2ASJA 3M8QA 2EK1A 4ECRA 1BGXT 5KG5A 1UFLA 3U27A 4I7FB 1U26A 4WTYA 1YTYA 5I42B 1HD1A 4GC6A 2C2EA 5E2QA 2WONA 3DOLA 4KSEB 4LSLA 1N6QA 2HQIA 1FVSA 3M8PB 1UEVA 3PDNA 4I64A 5KOXA 1ZBTA 3BN7A 3DHXA 3LALA 3M2VB 5EWGA 4JV1A 4DQIA 4N76A 4DL2A 3T1YF 4M94A 1PSDA 2W4CA 4BWJA 3VWSA 3TA0A 1QJHA 1V3ZA 2E5JA 4IDKB 5KFHA 2MQPA 3Q22A 4NLSA 4NCAA 1WD6A 2DNRA 1SL1A 3V6HA 2XS2A 5KFJA 2XEXA 2KXNB 3L3CA 4ECVA 5BR8F 1CPZA 3AA8A 2RIJA 1YJVA 3OXLA 1TL5A 1FTRA 3KK1A 4DSLA 1V3RA 4TY8B 4Z37A 2L08A 3M1VB 4K2XA 2GX8A 2O01C 3KNGA 3KLHB 4LFAF 3UCGA 1DTQB 3KLIB 2YWKA 4X4QA 2PO4A 3EZ5A 1U49A 2EI5A 5L9XA 4FNIA 1FEEA 1QAYA 3EYZA 3HVWA 2UVRA 4F3QA 4EYHB 3Q8PB 1SB6A 3PO4A 4FF4A 4DBQA 2VG7A 1S0MA 3BREA 2P5VA 6FD1A 2KI2A 3RB0A 2BQUA 3D1QA 4DLEA 2HQ3A 4QJVA 2VKZG 2WTFA 5DQGA 2QA2A 1JLQB 4NLXA 4TNOA 4X4RA 4DSFA 2BOPA 3LP1A 2LDIA 3DRRB 4KFBA 4KHPF 2QFJA 1YI2S 1Y0HA 2C3PA 2AYGA 3F44A 3ISNC 1UVMA 4DL7A 2WOMA 1G7CB 3HLUA 4ZPTR 3M2RA 4ZPVR 4QWBA 3CCQS 1ZZNA 4C8OA 4K4ZA 3W2WA 2YNFB 1VQKS 1WI6A 4BS2A 4C11B 1MROA 2DNNA 2OPPA 2JLFA 2FJVA 4IKAA 2KJVA 4K5RA 2F4VF 4C0BA 2XI2A 2ZBIA 2I5JB 4FVCA 1D8ZA 3N6MA 4PR6A 2PE8A 1GXTA 5BYRA 3GG1A 4EUVA 1APSA 1YIJS 3WBZA 1VK8A 3MMBB 2FJWA 4A46A 3IR6B 1Q78A 5A0YB 5BJRA 3T3FA 2XSFA 2ZH9A 4DL6A 3VAGA 5C25B 4J5OA 1U24A 2FPHX 3MM9A 4U6PA 2M9KA 4PXCA 1OIAA 3QIPA 1LWFB 2OPRA 2KVIA 4IFYB 4USHA 2XCAA 4PWUA 5KG0A 1SUQB 1H2UX 3H59A 2VBWA 1UVIA 4IRDA 2L9NA 4D3GA 2KDOA 1VLYA 1J2VA 2RMLA 1FTCA 4K0KF 5GADI 3PX0A 1YJRA 1YGYA 2MB0B 3F56A 2YX1A 2HRYA 2DO4A 3CB4A 2IBOA 1TVRA 5GAGU 4DL5A 4OHWA 1H7WA 2W9CA 4QR2A 3NL0A 5KFXA 4AFFA 4O3QA 3M6UA 1QVGR 3ZZUA 5THWA 2MDAA 1HI1A 1G2EA 2C3OA 2KRRA 1IBLF 4K50A 4BBYA 1FDDA 1C1CB 2UV8G 3T5KA 4ECYA 1X4BA 4KPYA 2DVIA 2AYMA 3OTOF 4FF2A 3BGRA 1SJRA 5H9EJ 2I2YA 5CYQB 3H25A 1IJFB 2LXFA 3QAEA 3THVA 2BRKA 4ED2A 2DRAA 1MMNA 2RS2A 4A8XA 1HNIB 1G3OA 1IM4A 3I5AA 5K9FA 4X2BA 4HDGA 3H5XA 1TL3A 1U6ZA 4DFMA 1VJWA 3MI7X 1D1UA 3CCSS 1Y7PA 3PEHA 1HNXF 3P49B 1UETA 2DNGA 2J7UA 2LDYA 1K0TA 3TARA 3LP0A 4C2MA 1WTBA 1Y5IB 3M2UA 1UEUA 5DQIA 2MYFA 1HBUB 3HVAA 4O0IA 4WZQA 5F3ZA 5D77A 4U67Q 4K4WA 3PJXA 2CJKA 1H38A 5DG7A 2D1CA 1S6UA 4DV2F 3PKMA 4X4VA 2MJUA 2G4BA 1WNEA 4QWDA 2J0XA 3H4BA 1KRPA 3PM9A 1NKEA 3BSAA 5AXMA 1UKUA 4CNZA 1HHTP 1YHQS 3QGPA 3K59A 3UDLA 2DBBA 4B9VA 2BANA 2VBYA 1LKZA 3EX7B 4IH5A 1U1QA 2B6AB 3CD5A 4YQWA 1OQ6A 1X4GA 3G8TA 3AJ2A 5KFTA 2DPIA 1BWEA 5F8HA 3RR7A 1SH2A 3I82A 1VOMA 3OTCA 3LP2A 1T05B 5DLGA 1NK9A 3KOAA 2CPJA 4RU2A 2Q6BA 4KHMA 4OI6A 3I56S 2KZMA 1HMVB 5HN0A 2LQJA 4J9QA 1LQ9A 3QWUA 2E9TA 2PEHA 1LWCA 2CG4A 4WFAQ 2NZ4A 4TU9A 1J5EF 3SZ2A 1JLGB 1OPZA 1FKPA 1T3OA 3CWJA 3GZ7A 1OSDA 2VC1A 4MTPA 4ZK7M 4DG1B 5BYSA 3KWMA 5F0WA 5HMZA 5F8GA 3PIOQ 3MXHP 3MPWA 1QSYA 1U45A 1DBDA 4LVNP 5BYQA 3KLGB 2AU0A 2CIMA 3KK2A 4AL7A 1S10A 2Z2MA 2AJQA 1MW7A 2LCWA 2K2PA 4LIRA 3FEZA 2QSWA 4A8WA 2EW9A 2UV8A 4FN5A 3CGIA 3OTBA 5CYJA 2QLXA 4LF5F 2FC8A 4OIXA 4RW6B 3NWGA 5GAEU 5KFKA 2L9DA 5EX3A 1VFJA 3BDEA 2M2BA 2KT5A 3FZBA 1RAJA 2DNQA 1RTHB 1S9EA 4G6VB 1C0TB 4DPOA 5SZTA 4DN9A 3OL8A 3HHNB 1RKIA 3QO9B 3TI0A 2YWHA 1RKJA 5IS2A 1JJ2R 4CNYA 1NK4A 6FDRA 3R5DA 3I0RA 2R8JA 3MAQA 4C3MA 4EWTA 2YNGA 4WXWA 2WK4A 5CYMB 2DR7A 2VOPA 4TQRA 2RF2A 3MEKA 2F40A 2KH9A 2KRBA 4RW4A 4F02A 1I94F 4AL5A 3I9V9 3UI3A 5KFIA 1H7XA 4R5PA 2D41A 4HH1A 3TAPA 2IC3B 2Q1LA 1RT6B 3T1AA 4YDXA 1ELOA 3NS6A 2QMWA 4KKOB 3PW4A 3OL9A 1JLAA 1NKCA 3I31A 4NCBA 5EUHA 1S1UB 3H20A 5DRKA 3FRZA 3DLBA 3LGMA 5C24B 1GXLA 3GFYA 3RRHA 1L3VA 4WKYA 4QPXA 1KTQA 3K0JA 1WHVA 4JI2F 5KG2A 4X66F 3POTB 1Q8BA 2K1RB 1H3DA 1OQ3A 2PA8D 4KRWA 3MUMP 2HHQA 1X0PA 2JHEA 4DQSA 5A8WA 1RTDA 3F41A 3GWCA 1IKWA 3CPWR 2XBPA 2IM3A 4CH0S 4WK1A 3H2LA 4BC7A 1TAUA 1S49A 3G86A 3BQ1A 2VUGA 5CD4H 2GHPA 3OR1B 5A8RB 1NB7A 4I0WA 2V8VA 1N5QA 4HHJA 3CJKB 2L48A 3R5CA 1S6PB 3UDCA 5F8LA 2FVRA 4KTQA 2A10A 2F3JA 2GQ2A 1MMLA 2DITA 2KHCA 1X4EA 3D0GE 3EUNA 3QMQA 2XMTA 5KFWA 2VASA 4M1KA 1S6QA 3BDPA 1N32F 2BJDA 3MM8A 2WB1D 3JSMB 3I4PA 1QVFR 1UFWA 4I2QB 2R8IA 2KXHA 3GV7B 2NXUA 4GKJF 4DHVA 1K1SA 3M05A 3MR3A 3KHGA 4ECTA 4ECWA 3V6DB 3MEDA 1FDAA 4OZ5A 4ZA1A 5T14A 3CF5Q 5G0RA 2DGUA 1JXLA 4V19J 3NAIA 4X4SA 3B4DA 4EGLA 2XULA 3PNIA 3KJVA 1DTTB 3U1LA 2QA4G 4MKBA 3J7Z5 1IQZA 1UVJA 2CKWA 4MK7A 2E7WA 2F8HA 1CVJA 1XR5A 2IMOA 1TKZA 5EX0A 3H5SA 2QMXA 3AB4B 4Q2MA 5A6WA 3BQ2A 3PV8A 1SL0A 4N47A 2CQDA 3D28A 3O3LA 3ZZ0A 4Q8EA 2V9KA 2I8EA 1ZTTA 1HR0F 1KHVA 3QLHB 2YWGA 3DLHA 3IGVA 1T03A 4C0OC 2HNYB 1SJQA 4CH1A 4LFCF 2B7BB 1T3NA 3DLGB 2ROGA 4ZCLA 1O5JA 2DNKA 2HFOA 1QAIA 3IFEA 4C8KA 3UW1A 4KR0B 4QIVA 1FNXH 4B3SF 3IWXA 5G4DA 5B0AA 3DRPA 4FF3A 2LQBA 2KT2A 2ADBA 2HFZA 5M2RA 3RRGA 1MWYA 4O44A 3IN5A 2JC1A 2PGCA 4F3MA 1RTJA 3B78A 3V2UC 5HMWA 3IRWP 4NOHA 1T8EA 2V5HG 1FKAF 1SJ1A 2B4VA 2IRYA 3KHHA 4EZ9A 1N48A 1XNRF 3OSNA 3SEOA 1YG0A 2V94A 3CE8A 4J37A 5HBMA 4Z2XA 2DNZA 3MM5A 1O51A 4NXNF 1C0UB 2VG5B 3C6TB 4O4GA 4EFAC 4KJIA 1YSJA 1HI8A 2JOQA 4I4BA 5J1NA 1XMQF 2VOOA 2JZ5A 2ROEA 1SV5A 4NYOA 3JTPA