1IJEB

Nucleotide exchange intermediates in the eef1a-eef1ba complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords elongation factor 1-alpha
publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ijeB00
2UUBF 4LF5F 4DR7F 4JI6F 4DV3F 4JI7F 1FJGF 1LOUA 3T1YF 4YHHF 4AQYF 2J5AA 1N32F 4YY3F 4X65F 1N34F 4LF7F 3OTOF 2UXDF 3ZZPA 4JV5F 1HNXF 2UXCF 2VQEF 1CQMA 3R3TA 1HNZF 1G1XA 4JI3F 2KJWA 4DR5F 4B3TF 2B7CB 1F60B 4GKJF 1B64A 4JI8F 1VMBA 1HNWF 4NXMF 4JYAF 4JI2F 4DV4F 2KJVA 3T1HF 1N36F 4LF8F 2YY3A 4KHPF 4JI5F 1QJHA 4DV7F 2UUCF 1FKAF 1IJFB 5LMNF 2RJZA 4DV0F 4DV1F 4LFCF 2ZM6F 4DUZF 4DR3F 4DV2F 1J5EF 4LF4F 1RISA 1CQNA 1GH8A 4JI0F 2E5LF 2B7BB 2UU9F 1HR0F 4JI1F 1XNQF 4OX9F 1IBKF 5IWAF 4DV6F 4K0KF 1G7CB 1IJEB 2HHHF 4B3SF 4B3MF 4LFAF 4DR2F 4LFBF 4X66F 1XNRF 4JI4F 4DR4F 2VQFF 4DR1F 1IBLF 2F4VF 4B3RF 1N33F 4X62F 2BVZA 4DV5F 1I94F 4DR6F 4DUYF 1XMQF 4LF9F 4NXNF 1XMOF 1IBMF 2UXBF 4X64F 5LMUF 2UUAF 4LF6F 2BXJA 4GKKF 5BR8F 5AJ3F
chains in the Genus database with same CATH superfamily
2V63A 2ZUAA 1UVLA 5J2MB 4IRCA 1WC5A 1KLNA 3NMRA 1SV5A 1U1NA 3I9V9 2OKQA 2ABYA 4ZLLA 4DS5A 3CJTA 5D0EA 3BO4A 2F63A 1SC4B 2ZE2A 2V9KA 2XZDB 2YNFA 3VQTA 1B0TA 1HBUA 1FDNA 4YUDA 2HQIA 1LXJA 2YY3A 3J7A1 2EI5A 2YWGA 2YKNB 4FPIA 4LJMA 4W98A 2DNRA 2Y0SD 2BDPA 4N5SA 5IQ6A 4Y28C 4FVCA 2BJ8A 1N34J 1U48A 2R7VA 3SBMA 3MD1A 3PXGa 1T3NA 2FYXA 3OFHA 3OTEA 2PMZD 3SZ2A 4ZS6A 4M95A 3CDBA 4WWSA 1XK8A 1JLBB 2CJKA 1FJ7A 1RT4B 4JYAJ 3KLGB 3LUYA 1N36J 2AYBA 3KWMA 1GFWB 5C42A 3DGPA 1ELOA 3LP0B 3KHHA 5JMNA 3IFEA 2GGPA 3HHNB 2ZITA 4HDHA 5HP1A 2MZRA 2KH9A 4CO1A 1RUSA 2E44A 3EVOA 3R6LB 3C19A 5L1LA 4AL7A 2PGCA 1LK5A 2IFXA 4NCAA 2CJ9A 1IQTA 5B0FA 1IXKA 1LKZA 2OD4A 4AL6A 4U8VA 3RRKA 5LMNF 2AJ1A 3VZHA 2LKZA 2XYHB 5DG8A 3HVAA 4F0KA 5HJXA 1U09A 3IWNC 1F5CA 1JLCA 2EXUA 4FF2A 4YY3J 1YRTA 5K8NA 2J6TA 4P75A 3DHXA 2RQMA 1HNVB 2OIHA 3TEHB 4NLPA 2F8MA 2UXBF 1MG7A 1IBMF 5D0RA 1AXQA 1N54B 1KQSR 4JV2A 4WTOB 1ACMB 3CXCR 3A1YG 4XAKA 4YP3A 1JIHA 4DR5J 3NOGA 4WCEQ 2CNKB 5IQQA 5HATA 4OYMA 2D9OA 3Q23A 1T9TA 3BM7A 3MMBA 3MR2A 3DI6A 4JI4J 5L9XA 4IR1A 1QD1A 1MMNA 3BBBA 4KQZA 4HT5A 3R1LA 2AD9A 2PO4A 4MIBA 4A8XA 1HNIA 2N3OA 2RMLA 3CCZA 1P1LA 1UEUA 1L5UA 1B3TA 2VBYA 4CM0A 2OMLA 5KFOA 1QAXA 1S9EA 3LGHA 3SV3A 2GX8A 5L39A 2GMLA 2VG5B 4DV5F 2U2FA 1KNZA 1S7IA 4RUBA 4NXNF 1URNA 4M94A 1PJ6A 1CJVB 1HNWJ 3LP1A 2RILA 2DGSA 4YS2A 3DRSB 2BW2A 1YWXA 2KZMA 4QJVA 3FBCA 2MLYA 5KG0A 1PC5A 5DG7A 2MY7A 1D8ZA 4JV5F 4AD6A 3MDFA 3HZGA 4OI0A 1RE1B 1G1XA 3MCSA 2KJWA 2ZHAA 1CLFA 2AJ0A 1U0SA 2AW0A 1ZYQA 1ZTWA 4A46A 3CIZA 3LA0A 3KUHA 4DLEA 2KVIA 2DNZA 3U1MA 4DF8A 1NDCA 2F65A 3L9ZA 1YZ6A 2MHNA 1A9NB 5AJ3J 3HD1A 3TAMA 4U7CA 4ANCA 1FHTA 1PGZA 3FQKA 3MR3A 3GE9A 4DPXA 4ETXA 2IM2A 5SZTA 1WTBA 3B6BA 1H7XA 1Q82T 1RK8A 1VLYA 4V1Ak 2HZCA 5DO2A 4KBIA 4MK7A 4C3MA 4FP9A 3TYTA 5FIIA 2MQOA 4ZPVR 2ZH8A 2Z0GA 4OHZA 2HAIA 3NNAA 4IOAQ 1ZM3A 1E6VB 4ZPDA 3PTWA 2Q66A 3KTQA 1IR0A 3M32B 2NXCA 4KHRA 2HWIA 4NXMF 1TUVA 3P6YC 1TVRB 2ZVIA 3HXMA 1GMWD 3I0SB 3I96A 3HM9A 2YWEA 3FMBA 4FS2A 3ZNJ1 1S4FA 1K0VA 2UUAJ 1OY8A 1X4CA 1RXOB 3CD6S 4ZJQA 1FWLA 2DNLA 1TQLA 2VIHA 2QMXA 3K5MA 4C9DA 3CJSA 1RI7A 2HVEA 5LXYA 3MUMP 4NEYA 1SQFA 4ED5A 2BA9A 3NCRA 4HACA 1O6XA 5EX3A 1KC8T 5K14B 4O44A 2KDOA 3EZUA 2VC0A 1X4DA 2JFDA 4O3QA 2X3DA 3US5A 4KE5A 4ZPWR 4HI2A 2J8SA 2YQ3A 3NS7B 2IRUA 4X4UA 2PT0A 3H25A 3EZOA 3PZPA 2G2YA 5HK4A 1BY9A 3A4TA 1SKWA 1HI1A 2VONA 1FKPB 3RBEA 3JSYA 2B6AB 2BRLA 1NHVA 3QRQA 5J2PB 4J9OA 2YNHA 2ZD1B 2IVFB 2XHCA 2X1AA 2ZKTA 4NI2A 3MEDA 4LF6J 2HFOA 1HL6A 4GKKJ 3IR7B 1C1BB 2LEAA 4JI6J 1N48A 1RT2B 1VR6A 3IM9A 5KFXA 1RTDB 4CLWA 3UNGC 3DLHA 1XNRF 2HHUA 2V2QA 3KG1A 1WI6A 2NR0A 3GP9A 1RT7B 3EZ5A 4C8NA 3TJ9A 1KRPA 4C3KA 5AXLA 1T9WA 5K8PA 4JI2J 1RWWB 2R8IA 5K8OA 2VFSA 1WSVA 3HX9A 3RZAA 2H9ZA 1NSAA 4DV0J 3FJ2A 2FVSA 3FRZA 1KEKA 5BJRA 1FRHA 4Y65A 3R7BB 3JSMA 1HNZF 2XNQA 3M05A 4OX9J 1NU4A 4KYZA 1TK5A 1RGVA 5GAEI 2EC0A 4YR3A 2HGMA 3UN3A 4YEAA 4KHPF 3W7BA 1DLOB 2K1RB 4USKA 1VC0A 3S6EA 2VG6B 2K06A 2B43A 1REVB 4OHXA 2YH1A 3KLIA 2K3KA 3Q8RB 4JI1F 5SUHA 1ITPA 3B4DA 1WF1A 3CMQA 3GR1A 3CCJS 5F0WA 1S0NA 1U26A 2YKMA 3VF0B 3D1OA 2ZDPA 3MM5A 5ETVA 2IYGA 4DQIA 2BE7D 4JOUA 4Y2IA 1TUGB 2DRBA 2CDQA 4B9SA 3LQVA 4Y2KA 3T19A 1NKEA 4P52A 1FK9B 4X64F 4UY85 4R25A 5IT0A 4EK2A 2ZWOA 1OMSA 4LF8J 4FXVA 2OFHX 1B0PA 1UJ4A 4YHHF 2W2QP 2AJ4A 1WKJA 1VRTB 2YTCA 4KKOB 3BGRA 3OHBA 2XSJB 1FRJA 5CYQA 1Q8KA 1F60B 4DX5A 1U6BA 5D3GB 3ETMA 1VQYA 3H42A 3O44A 3JS9A 4OZJA 2BV3A 4YDXA 4Q45A 2NZ4A 1KLMB 5EHHA 3A3PB 1RABB 2OD6A 3THTA 3BR9A 2DVIA 1X5PA 2R7UA 2D69A 1HW8A 2FHOB 3E8OA 4UOFA 2R7WA 4DL3A 3OJSA 4J5OA 2M3DA 3W2VA 2DGVA 3N9UC 5DRKA 4UW2A 5J2NB 2LFVA 1WEYA 3EGNA 5IM0A 2JC0A 4PG4A 1SJ1A 4OX6A 4DR7F 2VD3A 4X4RA 3BSOA 2FGOA 3RBDA 5F9LA 4AFFA 2R7SA 3M8QA 2KRBA 4YR2A 3TJ8A 1CULA 2ADBA 4BC7A 3TA0A 3IP0A 3MM9A 3V6DA 2QA2A 2MZQA 1A6LA 1EQ0A 5F8GA 5CYMB 4LMZA 4Q2MA 1BC6A 1NJZA 1C0TB 3W66A 4NYOA 2IDEA 2FHJD 5B0GA 1D0EA 1IJFB 1QDUB 1UFLA 1N0VC 3OW2R 2QV6A 1G4CA 3RG6A 2IVMA 3HFZB 1GH8A 5L1JA 4KIAA 5CCLA 1XNQF 3BPSP 3K5PA 4QIFA 4DPWA 1H3DA 2FLPA 4B9UA 2WSCC 1CEZA 4V19X 2NS1B 1YITS 1TK8A 4UOCA 2BACA 2FJVA 4ES1A 3KLHB 3C15A 3MMAA 2E9RX 4OZ5A 3UDCA 2VODA 3CDWA 1VQNS 2KVQE 5ADZA 1X5SA 4PYDA 2KXNB 3UD5A 1QM9A 4DQPA 1LWFB 3RAQA 3VZIA 2X1FA 4ICLB 4C8LA 5CHCB 3V5RA 1H2TZ 2F9JA 1WHVA 4G1PA 1D9FA 2EK1A 4FDFA 2Y8WA 2HMIB 4JI8F 2XI2A 4USUA 2OSQA 3MPDA 4EUVA 1BQNA 2FC8A 1R89A 2MKCA 4DLGA 4MK8A 2YWWA 1EAYC 4DV7F 1QSYA 4WYLA 3KLFB 4R0JA 4NEZA 4DPTA 3LPYA 2HNYB 3TZXA 3LOUA 4L74A 4M5GA 4J9SA 4L72B 2AX1A 1FD2A 4XDDA 3N5BA 2K2PA 2PIIA 2W24A 3X1LB 6AT1B 2J76E 4ID5A 2BE9B 4P71A 5C24A 4JUZA 1N5YB 2JEIA 2G4BA 1OS5A 4O4RA 1T02A 1SKRA 3OVSA 3CUNA 1WC4A 2Q6CA 1S49A 1TKTB 5T7LB 2WAQD 2PI4A 3NEKA 5EX0A 4S0MA 2WVEA 4QYRA 2D74B 3DRRA 4CH1A 4CYUA 3G4SS 2UXCF 4DPOA 4RNMA 1SKSA 3KJVB 4DR5F 3R7NB 2QRRA 4F0MA 1K1QA 4O3OA 3PW2A 4DV6J 1L3VA 3CC4S 3HHLD 1Q16B 4ELVA 5E3CA 2VQFJ 2R3VA 2ALZA 2YX1A 2RRNA 2J7KA 1TU0B 3MAAA 2OMOA 4P2SA 1MW7A 2XNRA 2HIYA 3SQOP 3BPDA 1P8GA 3ZZOA 4ECWA 2JNJA 2POKA 2VPXB 4KB7A 1BXNA 2AX0A 3VGTA 4PCQA 3M1VB 3VWSA 3SMZA 1HWUA 3AD8C 3RBZA 4ETZA 3VVUA 4DR1F 3N6LA 2IAJB 5CYJA 3LAMA 4X62F 2EFQA 2MPUA 2HHQA 4K8RA 1XMQF 3LH2S 2I9SA 1UA0A 2V9WA 1RAIB 1SQGA 1FDDA 3DNCA 1X9MA 4DCPB 1BQMB 3TA2A 1FFGB 3IA0A 2BM1A 3ZC4A 1RTHA 2YQ1A 3Q89A 3MTKA 1NK8A 3B4MA 2OUGA 4WXWA 4I2QB 4B02A 4CLKA 2XMKA 1RJJA 2CNNB 3EDRB 1RT5A 3EVMA 2XHWA 2H5JB 4IG0B 4JI7J 2HFVA 2GV1A 2KT2A 1VIXA 4MFBA 2J9DE 3IAS9 3Q8YA 2HHHF 5ETNA 2YKOA 2HEKA 4X4OA 2BKOA 9ATCB 2R2UA 1RTIA 4M63A 4CLLA 2WB1D 3IWXA 4LF9F 4FYWB 3EVWA 2Z2ZA 3FCWA 4DL5A 5KFDA 3PIOQ 1SUQA 4QOTA 4H4MA 1KP6A 3K5OA 4DCJB 3AB4B 2B5JA 2MEWA 2OPPB 3GJTB 1HNXF 2WRMA 2ZH2A 3QSIA 5DGAA 2JWNA 3GMGA 3UQSA 2CG4A 2ZVSA 3DM2B 3DFEA 4W4MA 1RLCL 2IDLA 2NSBA 1OYEA 4ZIVA 1FXLA 3G6ES 2KM8B 4CT8A 3Q8QB 1QJHA 3UE2A 4HLBA 2EK6A 1BQXA 5ITHA 4U8YA 2W8KA 1OWXA 2P2CB 1H98A 3MOJB 1NAQA 1GMWA 4WU3A 3UNYA 2E7WA 4KH1B 2F8EX 2VHGA 1ZAWA 2DNOA 3M2VB 2BJDA 5AXNA 2KB2A 1NUEA 5L38A 4IYQA 3PRVA 4CO5A 2LEBA 3BEGB 4K4TA 4DL4A 3BKTA 3CDUA 4UOGA 1OSCA 5LM7E 4HI1A 2LXFA 1FTCA 4PXEA 5D6GA 5E2QA 4NASA 1GX5A 2R7QA 3WC2A 2FLOA 3FC9A 3G71S 4IFYA 2RHQB 3ENVA 2KZZA 4G3IA 2ZM6J 2QGFB 3PX4A 3HT3A 4EO6A 2FLLA 1L3UA 4L75A 4WXOA 2AV5A 3ET6A 1VQ5S 2XMUA 3GYGA 3EMTA 3L7UA 4Q0BB 3JAMY 3QIPA 1VBZA 3KMSA 1LWCB 5M2UA 3E2EA 2HIQA 5EWGA 5LMUJ 4LFCF 3G82B 3JSMB 4B3MJ 2QJ3A 4DV3J 3DLEA 3TOQA 4F3QA 1KN6A 4Q8FA 3C6UA 5J1EA 3M4XA 4J9QA 3EX7B 4FZVA 2AJFE 4G1QB 2ZJQQ 1MWYA 5LJ5Y 5MAOA 2RT3A 5GADU 4Y2AA 2NXNA 3A8JA 1Q5VA 3ENQA 5KFAA 4JP8A 1TKXA 4Q43A 3TZYA 2CJAA 3UD3P 4FXWA 2AGPA 4X4PA 2AEMA 5IT9U 1R6VA 4QPTA 3C16B 2HNZA 3TEGA 3PO4A 2MGZB 4IOBA 3R3TA 1RYRA 4DSEA 3EPIA 4RW7A 3EGZA 1JLQA 3Q8PB 1VBYA 2FJAB 2ZC4A 1X9SA 2QA4S 4FYDA 1KVKA 2DB1A 3HZEA 3M2UB 5HROA 3QGHA 1R0AB 2CA9A 3HSDA 5GAHI 3E3XA 1IKVB 2XWXA 1T03B 5IT4A 3ILLA 1FX4A 5J2QA 1WELA 5LSOA 3TVKA 2M52A 4WYWA 3VALA 3LGMA 3NGUA 1XERA 3ITHA 1NPPA 5D4NA 4OMFG 2HK2A 2XLIA 1QSLA 2YBVA 4ES3A 4ECXA 1LWEB 3GWCA 4RO0A 1QAJA 4ZK7M 2BE2A 2G9OA 1TL3B 1IVZA 1Q0NA 2CYYA 3AXMA 3P4UB 2WOMA 1IKWB 2R2SA 3SXLA 1NJWA 4YN3B 5A76A 1G2EA 1SL2A 2Y1LB 2YNGB 3ELHA 1MSWD 3MM6A 4RZRA 3ENWA 1MLAA 5DQGA 8AT1B 1RT6A 2IY5B 2CQDA 1RTJB 2QLFB 5CH7B 4N8NA 2FVRA 2WVDA 3W9JA 2A1BA 1NPRA 2GVDB 4J9UE 5AE2A 1U1QA 3DLKA 5KFGA 5H9FK 1RT1A 3I9ZA 5HQLA 1AA1B 2KG1A 1SH2A 4WJBA 3L09A 2BRKA 1S1TB 2DISA 3RB0A 1WI8A 4DHVA 4HTJA 1CULB 3CW2C 4OYWA 2Q79A 3MM9B 1VGYA 2OP5A 4P74A 2IJRA 3CJQA 1SJRA 4DR2F 1LWXA 3DOMA 1X5OA 3ZNUA 1X7VA 5B08A 2RAQA 4OJ1A 3CCVS 2LU1A 2ZH9A 4LSNA 2KYXA 4Y3CA 2O3DA 5GMDA 1TL5A 5DM6Q 3NGTA 2EFVA 4ZCMA 1NO8A 2GIQA 1BD6A 3BGUA 1QUPA 3NGKA 2VJVA 1WG4A 4DV2J 4KC5A 1YLXA 3ILJA 3G6XA 3CNQP 4FN5A 1PJ7A 5KOXA 1IM6A 3MF5A 3KK1A 3C15B 3RBXA 2R2RA 1M0SA 3BDEA 4YMEA 2M8HA 2IA6A 3QPIA 4ATNA 4NCGB 5DDPC 4HEA9 1DRZA 2OPQB 4I6AA 2DCUB 2MSSA 4JI5F 3DC2A 3ZTRA 1UPMB 3IWLA 3QT7A 3R2CJ 4O23A 1RWKB 1ZS6A 5BYRA 5EN1A 5A8WB 2GHWA 1NRKA 2YPYA 4EI2A 4OQJA 4K0KF 4GMKA 5KG1A 4IG3A 1R43A 1UEKA 3MEGA 2FQQB 2HS4A 4CLFA 2KYZA 3T9ZA 2A0FB 5D15A 1I94F 4WFNQ 2CIMA 3CJRA 2FLNA 1KDNA 1HBOA 1LW0B 2GC8A 2NYIA 2I2YA 1EP4B 2IIHA 3H5SA 1R8PA 2ASLA 3LGNA 4LSLB 1FJGF 5E3QA 3ICLA 3T1YF 2RDDA 4I64A 2D41A 4X65F 3OTOF 4WPAA 1XWLA 3DOLB 2VFRA 3CJ4A 5E7OB 2UVVA 1FRXA 2DO0A 5F3TA 3LANA 1AYEA 1WUUA 5FDLB 3MXHP 3R7SB 1NBEB 3FFIA 3NCPA 1S1WA 2A10A 4DR4J 3KLEB 1F3VA 1V3SA 4Z37A 2XMJA 5FD1A 1RHKB 4DV1F 1C0UB 3KFWX 2DRDA 4CYUB 2MQMA 1L3SA 3OR1B 2XGPA 1VQ6S 4AQYJ 3A12A 3AA9A 3WC0A 1P27B 3M2RA 4F4WA 1IKXA 4IR9A 4A4JA 1S6QA 2J0SD 5KT6A 5KFEA 1H6KX 3NXZA 4IH6A 3KHLA 4GC7A 3QLHA 3PFEA 2XTJP 4K4XA 1FRKA 3FEYB 2H4WB 1JLGB 1NB7A 1YJVA 1TV6B 4DG1B 3R97A 4KFBB 1RAOA 2UUCJ 1HIYA 3R5JB 5KT7A 1CJUB 2MLZA 4N76A 1KHVA 5DQIA 2C3YA 4HH1A 2W25A 3GV7B 2VUGA 2WB4A 2LA6A 3MM8A 5LJ3Y 1VQ8S 4PEOA 4QPXA 1N8RT 1YRUA 4LF1A 3KJNB 3AT1B 4KGMA 4X66J 4I2PA 1FVQA 1BE4A 3C2PA 4A47A 3CB4A 1JLAB 1I51B 1T9UA 3MAHA 4GVBA 2XO7A 5HVFA 2E1RA 3HHLA 5A0YB 2XLJA 2ACYA 3UN5A 2ATLA 3GFHA 4LF4F 2RF2B 4JI0F 1LK7A 1MN9A 2WTFA 5L9NA 2B8QA 1UP1A 5KFQA 1UFWA 2R2TA 2HZVA 1IR1A 1HWIA 4MKYA 3HFKA 1L3KA 1S10A 2KFZA 1UVMA 3OTDA 3D5MA 4ZPTR 2RS2A 3T41A 2BOAA 3BKUA 5BXIA 2LMIA 3GPAA 2XM3A 1Y10A 1IM4A 2B4UA 4I68A 1RP5A 4XPCA 4O4GB 2HQDA 2BOPA 2HAFA 1WNEA 2L3MA 1O0PA 3HT0A 2E5HA 4ZVOB 2OJ3A 5JVHQ 1N5VA 2VQEF 5F8MA 1BWEA 1GAOA 1RTIB 5KG5A 2I6WA 4RW6B 4IUFA 2HK3A 1S99A 4L3KA 4NMLA 2DR5A 1Y3JA 1VQ7S 4OI3A 2X1GA 4ILLA 3Q8SB 4NOHA 4PQAA 2RNEA 2FUG9 1TTHB 2MQNA 5CXTA 2V4JB 3FNNA 1FXDA 1VLOA 2QE5A 2V2KA 4MJKA 1Y0HA 2XYGB 9RUBA 1OPIA 1VRUA 2VPYB 2NXUA 1J5EF 4IKAA 3HFVA 2DXFA 4LVOP 1SVDA 4O3RA 3GSIA 1MWZA 3M8PA 5B0AA 2JOQA 1F2GA 4F04B 3VAKA 4C11B 1LW2A 2MKIA 1GMUA 2VFUA 2XWYA 3OSNA 3W3SA 2VPWB 1XMOF 1ZH5A 2P8IA 4NLSA 4MT1A 4C0BA 4ED0A 5KFCA 3R8YA 2EEYA 2J5AA 1KD1T 2Y0BB 1EX8A 4QWEA 3MEEB 3QWUA 2BQUA 3PR5B 3NWRA 1H2VZ 2DNKA 1F9HA 2CPEA 1X4GA 2ZZTA 1NMEB 4NYPA 2OPRB 1FF2A 4MIAA 3K2YA 2F8HA 4OV6A 5IV4A 5LSRA 4RNOA 2RUSA 3AQOA 1WDTA 5LSLA 1B0VA 2CPYA 1YBTA 4P73A 2UXBJ 1IBMJ 1OQ3A 1Y00A 2RJZA 2MDAA 1FDAA 5B0CA 2HVDA 3KK3B 5HI7A 2E29A 4J9MA 1QY7A 4HHUA 4PG6A 5DLGA 4TQSA 2QC3A 4DDFA 2R8JA 2B4VA 2I1RA 3BS9A 3C6TB 3BGLA 3M9MB 4DU7A 2NPIA 1ZTTA 4C8MA 1WF0A 3JB9k 3NS6A 1WC6A 4RUHA 1XR6A 2F40A 3KLVA 1P1TA 5EDWA 1U6ZA 2ATCB 4YB1P 2J6SA 4DOZA 3GJQB 2E1PA 5D77A 2JX2A 4PUOB 5KFTA 1TP7A 2VU5A 4X4QA 2ZC3A 4OYIA 1AT1B 4DV5J 4IH5A 2E66A 3MPWA 3Q8VA 3SIPB 4NXNJ 4NL5A 4DR3F 1RISA 1S59A 1MU2B 3POTA 2BZ2A 1NPKA 3D2WA 4DFMA 4Q5VA 4H4OA 4KGKA 1MROA 4IDKB 2FC9A 5C25A 4CO2A 1KHWA 2RQCA 4KT0C 4B3MF 3DLGB 2B8PA 2W7OA 2KN4A 2WBMA 4JV5J 2FY8A 2GVZB 3HKWA 2DCLA 3TAPA 3QMQA 3JYTB 3FQLA 4F02A 3IS9B 2JLEA 2EKNA 3J80Y 5GADI 1NK7A 1DTTB 4BHQA 5KFNA 2VOOA 1FE4A 3SEOA 2XI3A 2QN6B 4TXSA 3CCSS 2B51A 2WW4A 4ZP8A 3H8YA 4V19J 2AYEA 1N56A 4G1IA 4RBVA 3JTNA 3LP2A 4OJ3A 1SI9A 1CQMA 2G1DA 3IBFB 2YNIA 3V6HA 1T05A 4KO0A 4LRAA 1YVFA 3NNCA 3NKYA 1YDLA 4M5NA 2HWHA 3HDSA 3NLCA 1RHMB 2BJ3A 2WOMB 2LQBA 2AJQA 1EB0A 5KFPA 2G0IA 1J5OB 3PFOA 3SQGB 3PYDA 5A8RA 2HLUA 1U0HA 4RPFA 2XBPA 1Q4RA 2FIUA 1IBCB 3M8SA 4ZVSB 3T3FA 3A3NB 3EXYA 1SCJB 3DLBA 5KFIA 4TLRA 1FKOA 1UEVA 4LVNP 2IC3A 1M5VC 3PG9A 4NLRA 2HYIB 2P6SA 3TWZA 2JRSA 4NXMJ 4R5PA 1KOOA 4KGXB 3BR8A 2ILYA 5FLXY 2K7KA 1M5OC 2C2DA 4UQTA 2BQRA 3K59A 2IJFA 1D9AA 3DRPA 1NJYA 1CJKB 2BANB 5DDRC 4DMZA 4QZVB 4L6V3 3DOMB 1QE1A 3GFYA 2N7YA 3MMCB 4ZVRB 2LDIA 3ILIA 1NSPA 1VDHA 5A6WA 4O3SA 2CQCA 4MTPA 4BS2A 4DUZJ 2KJVA 1HQUA 4OHYA 4UF4A 3TARA 2AZ1A 1K73T 1RKIA 3LW5C 4TYBA 4QBUA 3TRGA 5I3UA 1CQNA 4I56A 5KG7A 1VQLS 1IBKF 5HVGA 3SCJE 3W5XA 2FZKB 2MKKA 1B7YB 3GONA 3PM9A 3M8RA 3THVA 4KRWA 2GCFA 4N56A 2IM0A 3VCDA 2HG4A 3OFFA 3OL6A 2VKRA 1R8HA 3QFWA 2CZVC 1LNQA 4CO0A 2JFKA 4ANDA 4LR7A 2BM0A 2M0GB 1NK4A 2C2RA 1IKYB 4NZ0A 3BSNA 1LOUA 4LIWA 4QW9A 4E0DA 1N32F 2C42A 2GQQA 2GJIA 2MTLA 2XMWA 2QYGA 3DKDA 1DTQA 2MHEA 1VYAA 1UVIA 2R7RA 3EWGA 3PYGA 1MNEA 1UWBB 4M5DB 4Y6IA 4GVLA 2ZDOA 1O51A 1HBOB 2C2OB 3R2DJ 2A6OA 1XNRJ 1AZSB 4PWDB 2YVSA 2Y1JA 4PPZA 1V9OA 3MUTP 3W5ZA 4YB5A 2VG7A 1J27A 2D3O1 1HD1A 4LSZB 1N4LA 1YBUA 2AZ3A 2PMHA 1LV5A 3PX0A 2IJNA 1HNZJ 4RNHA 2DNPA 4XPEA 5A2QY 4P2MA 4FXDA 1UPPA 4B17A 2JEJA 2MQLA 4IFVB 1Q8LA 1K44A 3GV5B 3CGIA 2KFYA 4U7UD 4KHPJ 4KH0B 2WK4A 1FWPA 3M30A 1F5BA 1FO1A 2I0XA 4DBQA 1HI8A 2YKPA 3RR8A 4JI1J 3UN2A 4UOHA 1PJ5A 4GKJF 4QR2A 3WQPA 2LECA 4GO5X 2MKJA 4YB7A 4ZHRB 2VPZB 3TW0A 1WOSA 1NJXA 2OEMA 1SC3B 3V81A 2YH0A 3CT9A 2EFGA 3JSRA 2HHXA 4N47A 2W9CA 4X64J 1Z2ZA 3UCUP 2Y3YA 3BO3A 4U67Q 3CJ0A 1AW0A 4DWIA 1TFWA 4RW9B 1KFSA 3BB5A 4F4KA 1FWKA 4YHHJ 2ROGA 1QUVA 3HP6A 2PMWA 1RWOB 4MKVA 4CNZA 2V67A 2Z2LA 1SL1A 1IBLF 1TL4A 3AB2B 3FSYA 4B9TA 2RRBA 3QT6A 4I0WA 4EO8A 2KHCA 4FS1A 1Q7YT 1S1XB 3KJQB 2YWKA 1U2RA 4LUBA 2D3OR 2R8GA 3OSPA 1KTVA 3L4BC 2DHSA 2DY9A 3L3CA 2ALYB 4LIRA 1HBNB 3OQ2A 1TL1B 4F3MA 1DURA 5F9NA 4F2RA 3BJYA 2KL8A 5E3RA 1JJCB 4R8UB 2DEJA 1WKLA 1PSDA 2W7PA 4DL6A 4OYAA 4KV8B 1T11A 2DRAA 2MY8A 2ZFHA 4DPUA 1HQEB 2CADA 3OT9A 4DFPA 1T9XA 2O5DA 2PEBA 4NLYA 4J9RA 4KPCA 4RW4A 1FFWB 5HBMA 2LXIA 2MQPA 1TUWA 3SDEA 4N7TA 4F4AA 4N41A 1QVGR 4QWBA 4RJVA 3FK4A 2ADCA 2OEKA 2FDNA 4DR7J 4X4NA 2QZ8A 3NBPB 5DDQC 2IHR1 1EKRA 3K0JA 2H65B 4OLPA 2RHSB 1PKUA 4B3OB 1YJ9S 3D6FB 2XEXA 5B7WA 2D9PA 5G4DA 5HLFB 4X4TA 1S6PB 4F7VA 2CZ9A 4OI2A 1VQMS 2HHVA 2G13A 2RE1A 3PVXA 4Z7CA 3AH6A 5G0RA 5HN0A 1I1GA 3FBFA 3ZZ0A 1U02A 2CPJA 3LPEA 1WOOA 5HMWA 3I55S 1KBRA 1JLFB 3W60A 3J81U 3MPYA 3DRYA 1XR5A 4J91A 2Z57B 3VHQA 3NGSA 1S1UA 1XNQJ 1AROP 4NZ6A 2DHXA 3CIMA 1RWUA 3RW7A 1U6FA 1GK8A 4KGZB 2H1YA 1CBKA 2AQ4A 4MYTA 1LEOA 5KFWA 3CCRS 4DV4F 4ZPAA 3QWPA 2CQ0A 4CNYA 3H7HB 3UCGA 3H90A 3BQ2A 5IZHA 4WZMA 1KWMA 4IRKA 3CJKB 3KNAA 3D3CJ 4ZPCA 1S72S 4UUXA 4CTAA 3BSAA 1HQ2A 3V4IB 2FB0A 2UVUA 2GMJA 3H59A 3MECB 3H4DA 2ZJPQ 4FBUA 1O5JA 4WK1A 4DX6A 1JJ2R 3CF5Q 1AB8A 2CNLB 5HAOA 3BBCA 4JI8J 4MIWA 3G86A 4ZVEA 1UZHA 1Q86T 4HTIA 2AIRB 4ITSA 4DV7J 3CCES 1GQEA 2C22A 1YJUA 4KSEB 1NSKL 3OVBA 2DITA 1D3WA 2QLJB 1HBMB 5B09A 2HGNA 3C14B 2GS8A 2B7CB 3W9IA 2LQJA 4LQ9A 3R5GA 3NG8A 1S6UA 2XY5A 3T5HA 1CJTB 3MFIA 2G2ZA 3CEDA 2RKIA 3QO9A 5B0DA 4K5SA 2VC1A 4ERDA 3HVTB 2VBXA 3FEXB 1S77D 3UI3A 4AE5A 2YWHA 5KFBA 2N3LA 1NXIA 1NHUA 4DCOB 4WE1B 3ZZUA 3FZBA 5I42A 2RS8A 3TAQA 1G7CB 4B3SF 2UXCJ 2V2VA 3OUYB 4FF4A 1JJ4A 2C1EB 2ZH7A 3TQ1A 4TN2A 3Q24A 3Q86A 1JKHA 2CG8A 3I87A 4QU7A 2N7CA 5KFYA 3CC2S 3OXFA 2DIVA 3QQCD 1T7PA 1YJ7A 1W2IA 3KHRA 2HW3A 3BQ0A 2W9BB 1E6YA 3U1NA 3I0RA 2HFSA 2Y1RI 1ZBTA 3AOCA 3SFGA 1VS3A 3DU5A 3M8ZA 2MQQA 1JLEA 4DR1J 1HLWA 1Q8BA 3P96A 4OJHA 4X62J 1NH8A 1X9WA 2CQBA 1XMQJ 1NJIT 1HYSA 2XG8A 1EKSA 4ED4A 3DCAA 2FJBB 2V8VA 3OLAA 4PQUB 1N88A 3H5YA 3K57A 2RU3A 2I5JB 2LYVA 3ZTQA 1GTHA 3DDKA 2DEIA 3O3LA 3E01B 2JEFA 5DDOC 1H72C 5JXSA 5MLCV 2BQ3A 2YX4A 5J2MA 4WF9Q 2QEXS 4C7QA 5F8NA 4PXBA 5F8HA 3Q8UA 4OZ1A 4CCHA 1EETB 3N6MA 2P9EA 2KM8C 3NNHA 1RSCA 2AF6A 2HQGA 3AODA 2XO6A 3K8WA 1HMVB 3BKFA 3VAHA 4F3OA 3C8YA 2VFVA 3AAWB 5E5NA 1SL0A 1ZA1B 4PR6A 1FA0A 2YKNA 3HI9A 1UW9A 1YJNS 2HHHJ 3DLLQ 4F4ZA 4A8FA 5ETRA 2W2PP 2OLWA 4QIWD 4W90B 1EHWA 1Y11A 3F56A 4LF9J 2HVHA 2F9DA 4ZN1A 3DOKB 2M7SA 5A8KB 2GHVC 1YG0A 4PAAA 1RYSA 3ZTOA 3R27A 1S1VB 1TFYA 4K4ZA 3S8SA 2NXJA 3D68A 1JLBA 1UTAA 1FERA 3PJWA 1PIEA 2LCWA 1HNXJ 3M6WA 2WONB 1B70B 1RT4A 2QSFA 3W2WB 3KLGA 3GJRB 4ZCKA 4DSLA 3MPVA 2P9CA 1S9GB 2PA3A 4ZA1A 4FKXA 2VZ9A 4ZDNA 1GXTA 3LP0A 4MK9A 2QFIA 3W65A 1VC5A 1N6QB 3OR2B 2FJXA 3PYFA 1HWJA 2HNDB 3D6HB 1ROFA 3KNGA 2XQCA 2ZUGA 4URSA 4OI1A 3KMQA 4E8UA 3GQCA 2CJQA 1RBAA 1HPZB 1SBRA 3OXLA 4H54A 3K5NA 5KFVA 2LVWA 1WOPA 5KFSA 4RUAA 1C1CB 3B54A 3DXBA 2GAGC 3AQPA 2W9AA 3N4WA 3OD2A 3OFEA 1R3NA 2XMVA 2UU9J 1DFDA 3LWMA 4K2XA 2KKHA 2NQPA 1QSSA 1K47A 1YZ7A 4DUZF 2YX7A 5DETA 4F67A 3IGNA 3HD2A 3HF5A 1HR0F 1HNVA 4QW8A 5F8LA 2VKZG 3IRXB 4QR0A 3IBCB 2DNHA 3D66A 4F26A 2BMBA 1EIYB 3C66A 3RU0A 3WDOA 1NCLA 2WVCA 1HWKA 4OJGA 3LTOA 2HPUA 1ZAVA 1TKDA 3QT8A 3RJMB 1MMLA 1CS4B 3KOAA 1JXEA 2OPSB 3OBIA 4LFCJ 2BX6A 1X0FA 2XY7A 3NY0A 5KFZA 2KO1A 4C0OC 3N6NA 4PXCA 3GIRA 2G0CA 2FZGB 2RB7A 1YBAA 4KGVB 1X0PA 1KR4A 3QFHA 4CLSA 3VR1A 2L08A 1TL7B 2JHEA 4NPOA 3CE8A 1M1HA 4ELTA 3U02A 3KK2B 2VBZA 2VG5A 1W26A 1M1GA 2XC9A 2QL7B 3RYLA 3PEJA 2QL9B 3UVJB 3OPKA 5C7PA 1CJVA 3EXCX 4CLTA 2V5HG 3DRSA 4DUYF 4K4UA 2B4OA 2DHHA 2V8PA 3HHLC 1V5VA 1SPBP 3NP5A 2F1FA 2PC6A 4QWAA 2AYGA 4C48A 4NLUA 4NLXA 3BH7B 4TQRA 2DR8A 1KVJA 1S97A 2B3TB 4A8SA 3NS5A 1EZZB 2C3PA 5CD4A 4OL8A 2IMOA 2QL5B 1Y7PA 4BWMA 1YKWA 4B3TF 2NYHA 4ZJOA 2C2MB 1KS2A 3IG1B 1RLDA 3MUVP 5KFUA 4WK3A 4ZVGA 2E5LJ 2CVEA 2JLGA 3IC1A 1FE0A 2EVZA 4I7FB 2OO4A 2GIFA 1WACA 2HQCA 3AD9C 4HHHA 3GIKA 1X31C 3K89A 5KFFA 1UMJA 1K9MT 2VOPA 4J9VA 3KUGA 2Z56B 2CPHA 2VBWA 3J7YU 1DQ9A 1UWAA 2F4VF 2Q43A 1IR2A 5JVGQ 2ERRA 1JK9B 2DNNA 2BJ7A 3TNVA 4DU8A 3ZZZA 1E6VA 1Q95G 4LF5F 2UVRA 4YFUA 3M32A 4OLOA 4TYAA 2DY1A 4EYHB 2NSCA 1TVRA 4L3NA 1SV5B 4LT6A 2LEPA 1ZA2B 4NA1A 3I0SA 2G0JA 4DQRA 2P9GA 4DR2J 1WD6A 2ZE2B 2YNFB 3IXQA 3CCLS 2ZEJA 1HBUB 2G2OA 2FZCB 2OI2A 2R4FA 3F41A 3OL8A 2D1CA 4DN0A 3KYLA 4IRDA 2CKWA 5K14A 5F0UA 3QAUA 2DXDA 1RAFB 2C3MA 5B0EA 2D3UA 7AT1B 3QGGA 1JNZB 4IO9Q 1VQSA 2IM1A 1UZDA 4WKYA 2VH7A 4CLPA 5EWFA 2ZNZA 4JI5J 3QZ7A 5HSPA 1M5PC 1XJWB 5C42B 3HLUA 1FKPA 1XBWA 2B6AA 3DGPB 1KTQA 3BH6B 1FRIA 5J2PA 4WP3A 2UVWA 4K0KJ 2GGPB 2ZD1A 2BEFA 2MZSA 2R9LA 5HP1B 3NWGA 3SSQA 2IBOA 2MJNA 1RHJB 1I94J 2R7XA 1C1BA 3C3LA 1RT2A 3PHTA 2DD8S 2N82B 1RTDA 4ED2A 4DFJA 3D0IE 3T5JA 4URQU 1FJGJ 3T1YJ 3A13A 4X65J 1RT7A 3OTOJ 3I5CA 2V4QA 3M6XA 3UWTA 3QYYA 2ZOMA 1JLCB 3KG4A 1SJ4P 3TO8A 4NA2A 5ETMA 3MR7A 4USIA 5KTQA 3GILA 3H40A 2BKNA 4DXLA 3HSZA 2UV8G 1B99A 4KY3A 4HT7A 4MMOA 4DV1J 2KT5A 2QMWA 4CP5A 4DPYA 5I42B 5CD4H 4C98A 4UY8T 3PW7A 2QIFA 2HHSA 2FY1A 1TAUA 3AY0A 3TR5A 3V4MA 3BSCA 3BYRA 5KFLA 3DMJA 1DLOA 2K1RA 2GHPA 2VG6A 1RBOB 3F44A 2R42A 2FHMA 1REVA 4LBHA 1FVSA 3MMBB 1OIAA 3DI6B 3OLBA 2NUUG 2DPIA 1E6YB 5IWAJ 3CTRA 3UPFA 1PO6A 2DGTA 3Q2SC 4D3GA 3TUZC 2XLKA 2H5IB 1CPZA 4X84A 3ISNC 3RR7A 2O1PA 1SC6A 1VCTA 2KI2A 2DH7A 2CQ2A 3LF0A 3QAEA 1HNIB 1T0TV 1FK9A 3MI7X 3A8KA 2MLXA 4FBTA 5HMZA 4DR6F 2X7IA 4ZMMA 2GA7A 5E3AA 1S9EB 4X4SA 3CCTA 5HANA 2MXYA 3CDEA 3LWLA 2AEFA 5BYQA 1VRTA 4HH0A 1SIZA 4KKOA 5GAGU 1GMVA 1U1LA 2XSJA 2WVBA 5KFJA 3LP1B 2IYIA 2GNKA 4LF4J 2DT9A 1Y5NB 4JI0J 2QFJA 3JQMA 1DZ5A 1VHFA 4OHVA 3PNIA 1PC4A 1M5HA 5D3GA 3I4HX 1H74A 1KLMA 2NLWA 4LRFA 1RZMA 4M8LA 5HO4A 3UDEA 4BBYA 2MJUA 2MMYA 5T14A 3DRXA 3PW0A 3CJ3A 1RWXB 2LA4A 2AU0A 1XQIA 8ATCB 1WC1A 2KXHA 4FNHA 3P45B 1YJWS 3PKMA 3RB3A 5IV3A 4FYYB 5J2NA 3MPUB 2G1HA 4OI4A 5H1SV 4M5MA 5BYSA 3TAMB 2W7AA 3MWBA 2VQEJ 1KQGB 2AEJA 2J0XA 3IAM9 4M5JA 3VQSA 2CPXA 4HL9A 2HBQB 5E3PA 4Y34A 2DYAA 2V94A 1VBKA 2CJYB 3G87A 1U2CA 1S9FA 2RU9A 3Q2TC 2HRUA 5FJ4A 3VGSA 1QTNB 5DJBA 2C28A 4LF7F 3T6BA 4JV0A 1J5EJ 3ZZPA 3Q83A 1RT3A 4OYBA 3GJSB 1H7WA 2BKPA 5CYMA 4CI0B 4HYKA 1C0TA 3CJ2A 3PEHA 1H2UX 2LLZA 4ZN3A 1N52B 1RHUB 2I38A 1Q8IA 2FVCA 4A8KA 2RH3A 1DY3A 4RX6A 1XMOJ 5IC4B 5EUHA 4R0EA 1RACB 3GR0A 3P5BP 4CWBA 4EBDA 2ACMA 2KHDA 3KLHA 5E33A 4LFBF 2RVJA 1HKAA 1GXLA 1TELA 3VAIA 2HQ3A 2IPOB 2IRXA 3DGVA 1WG5A 2V8HA 1LWFA 3JTPA 4HACB 3UFCX 4ER8A 4ZVFA 4ICLA 1SJFA 4O44B 4TY9A 3OTCA 4USWA 5LL6d 4QCLA 1WG1A 3O5TB 2HMIA 5DGBA 1H38A 4UZCA 2IRYA 3L7OA 4C0HA 4RKUC 3HSJA 3KLFA 2HNYA 2MKYA 5GMEA 4ZVHA 2HHPA 2BJ1A 3BN4A 2FVPA 2DIUA 2N4CA 3R5DA 2P6TA 3FBEA 3CD0A 3VAJA 3AJDA 4IO1A 4K7QA 2WBRA 3NAIA 3MHYA 2YNHB 2WZ1A 4NRTA 2UU9F 2XS7A 1S5ZA 5KOWA 3QT5A 4NI2B 3MEDB 5H9EJ 2VL1A 1N5YA 3SCLE 5DZ7A 2DXEA 2JSXA 2QO3A 1A0OB 1PCAA 1YK9A 3N0VA 3QRPA 3HJFA 1TKTA 4BLGA 5ETOA 1Q79A 3L7PA 5T7LA 1NDLA 2BBEA 2RRAA 2CJXB 2A3JA 2UUBF 4EZ6A 3QZ8A 4P7TA 3KJVA 2B9XA 4DR3J 2Z2YB 1TMJA 2XZWA 4NLGA 1JWWA 4NYZA 4K2JA 3TVZA 3A8IA 2NCKL 3HULA 4KPYA 3I4PA 2DK2A 4LREA 4TU7A 1CC7A 2EBGA 4ZP7A 4YQWA 1R8CA 5KG3A 3KG0A 4GRSA 2DR9A 1ZZFA 1RKJA 4E2FB 2MZJA 1HWLA 1VC6A 2ZJRQ 2B9YA 1T95A 4RWWA 3HVWA 4RBTA 4NX9A 1RDRA 3M1VA 4RWXA 4C8YA 1IN0A 5CCMA 2IAJA 3H2LA 4PRFA 3KLIB 4LFAF 4O3NA 1URRA 5KT5A 3ISND 4ECSA 5CABA 2YKMB 1QLNA 3MM5B 4FKYA 2H48B 5F8IA 3M7VA 1NDKA 3Q0AA 1F9FA 2Q3PA 1Z1ZA 2KT3A 1BQMA 5HL7Q 4ZLNA 4PZVA 2LQ9A 4QYZJ 3BN7A 3BGOP 2HGLA 1YSJA 3UR0A 1V3ZA 1SIWB 1DHMA 3FUYA 2H51B 3P5TL 4I2QA 2AJ2A 3BGRB 2O67A 4EBCA 3MR5A 1T9VA 3BGFA 4C8OA 4C4WA 2DO4A 2X51A 5CYQB 4M5HA 2BABA 2ROEA 2ZZMA 4IG0A 2B56A 4O0NA 4QWDA 3ZTSA 4CLYA 2E9ZA 2E5LF 1UFKA 3GFZA 3VAFA 2M88A 1SXLA 4C8KA 4OZLA 4ZCIA 3J7YI 1IQZA 4U7UK 1I5OB 4P2FA 2EC2A 2VDIA 5LXRA 3MCNA 2O66A 2X3GA 3OTBA 3PV8A 4B3RF 4QIGA 2C2ZB 4OZNA 3ETOA 1YJTA 3VAGA 3D1QA 3I56S 3VAMA 3W2VB 2QLXA 3KUEA 3NMAA 3EYZA 5L1KA 1WHXA 3D28A 3U7JA 2OPPA 3IR5B 4ELUA 2AHOB 2W2MP 5IM0B 4PG5A 2F4FA 5DZ6A 5HQ8A 4NLTA 3GYNA 2ZNYA 2WSFC 2QX0A 3PYEA 1AUDA 5HJYA 3RW6A 1JB0C 3DM2A 3RGIA 4KJIA 1QTMA 1IBKJ 3M8QB 4Z7YA 2LP4A 3G6YA 2IVYA 4TY8A 1OY6A 4BWJA 3V6DB 2NZCA 2KG0A 1J2VA 2U1AA 1SKUB 2LDYA 3J81j 2XMMA 3VVTA 3M2VA 1XC9A 2OGUA 2WCXA 3CMES 3MOZA 1N32J 3EJMA 4M5KA 1CC8A 3PKYA 4ECVA 3R5CA 3OVAA 3M9NB 1YQHA 1QVFR 4BC9A 5BR8F 3DDIA 3MMAB 4KHMA 2ILZA 1HARA 4X4VA 1R6YA 3W61A 1WJ9A 5J1NA 1FNXH 2C2KB 4HKQA 2NUHA 2DGQA 1TK0A 3J7ZT 5LT5A 2Y1IA 3D54A 4Q0BA 1CSJA 1PYSB 3O8WA 5JUMA 5DS7A 2FHJA 1F2HA 4A8WA 1LWCA 3G82A 2UP1A 1Q7LB 1K1SA 4OZ0A 1UVKA 1VJQA 4A8QA 2V68A 1BQNB 3TQEA 3QGIA 3AJ1A 3ISZA 2XS2A 3T5KA 3HVRA 1V6HA 4CH0S 4G1QA 3DMJB 3GYXB 3R6GB 1U8SA 2Z4PA 4WFZA 3KDOA 5KG6A 1XN9A 1NDPA 3P3DA 3RUBL 5GAHU 1GTEA 4OX8A 4GKJJ 4ED8A 1Y5IB 4BDPA 4ID5B 3NGRA 4DN9A 3C16A 4G6VB 5C24B 3TX8A 3UO0A 1EJ7L 1GXUA 1X8DA 2MGZA 1D9DA 3I31A 4IQMA 1VQ4S 3GSDA 2ZZNA 2J6UA 3U27A 3SCKE 2UXDF 1JX4A 1D09B 2UV8A 4XIUA 5ETLA 2R7TA 5AXKA 2WVFA 3TUJC 3VGUA 1K8AT 2A2CA 3TX0A 4U6PA 2ZHOA 4TVAB 2DH8A 2WHOA 3MEKA 3DRRB 4XTTA 2HHTA 3GCWP 1RWNB 3M2UA 1R0AA 4Q44A 1IBLJ 2EFPA 4QWCA 2CWKA 2FPHX 2EG2A 4WFBQ 2EPIA 3V6KA 3CSKA 1IKVA 3O2IA 2DKOB 1T03A 3HHEA 7FD1A 2W1BA 6FDRA 4FYXB 2M8DB 1T3OA 3RB6A 5C2GA 3MAAB 1LWEA 4KR0B 4NA3A 5IWAF 4KTQA 2CQ4A 4FNIA 3K58A 1PILA 3W1YC 1C2PA 1R8BA 2MKSA 3GB0A 3PW5A 2E7VA 3UCZP 1TL3A 3OHAA 1WORA 1F0XA 1YTYA 2V0NA 3AD7C 5IOLA 4ECQA 1IKWA 2HBRB 3W62A 2YNGA 2H3EB 2Z8QA 5GAGI 2F5GA 4X2BA 4I6YA 1U1KA 1RTJA 2CXEA 1RAHB 3OJUA 1NK6A 1FX2A 4I1TA 2CPZA 1S48A 5J1PA 3AJ2A 4XK8C 3JAMU 2GVDA 4I4BA 4ZVQB 3K7RA 4CLZA 2HURA 2HWTA 1FJCA 2KRRA 1UVJA 1S1TA 1WTFA 3FSXA 3TA1A 2IMWP 5ETQA 1RTHB 1XMBA 3O1LA 1S4EA 1DBDA 2YPZA 5D78A 3H0PA 2JZ5A 3UR3C 4LR8A 1VQOS 1GT8A 1RT3B 2CPIA 4B08A 4RW8A 3SV4A 5KT3A 1RT5B 3QJJA 2K8GA 1NSQA 1N0UA 1DAXA 1X60A 2HRTA 1Z4UA 1YGYA 1M1KT 4MKBA 2YQ0A 3GCXP 5K8MA 3TANA 4MFBB 4EFAC 3CMAS 4GC6A 2DPJA 2LU2A 4DV4J 4ILRA 5GMKa 4ED3A 2C2NA 4K4WA 1H0HB 3S1TA 3B82A 1SUQB 1N34F 1U25A 2GO9A 1TKZA 2MYFA 2DNQA 4H4MB 4LRDA 3EUNA 4NCGA 3SSSA 2B5JB 2R8KA 1ZPWX 4GO7X 2OPQA 2KTQA 2Z2MA 4C3LA 1RCOB 5IT9Y 4Y00A 4JYAF 5U47A 3D6TB 2FVQA 3GIMA 4AUKA 3TZZA 1N36F 1VI7A 4NLWA 5A8WA 1NZAA 1N5TA 4ECTA 3UW1A 3HKZD 1JMTA 4U9RA 2AP6A 4WP8A 2W8LA 5KFRA 4ZJLA 4Z2XA 4DSKA 2V50A 1LW0A 4I69A 5L1IA 1S7HA 4NE9C 4N77A 2D7SA 1EP4A 4LRBA 3VTIA 1VQPS 3CO9A 1OSDA 4LSLA 3TUPA 2W2OP 3WBZA 2ZBIA 2QLBB 4LBPA 2JEGA 3DOLA 4TNOA 1PBUA 2E5GA 3M8YA 1KQFB 3K17A 1FT8A 3AHPA 3D0HE 3HO1A 4YY3F 1VIOA 5FDLA 4M5LA 4OIXA 3I32A 5F41A 4P6QA 1M5KC 4IFYB 1ULRA 2VA3A 3KLEA 4J9KA 1FTRA 1KKHA 3RB4A 3IRWP 2W4CA 2UZAA 4ZKAA 2B9WA 4B3SJ 3SCIE 3FDSA 2GFFA 1C0UA 4YOEA 3ET6B 2A6MA 1HI0P 4NMXA 2ASJA 4F0HA 3OR1A 3PHEA 4HDGA 3QIPB 1LXNA 1OYDA 1A7GE 5K9FA 2FJWA 4OFZA 3CWJA 3ZZYA 1RTZA 2XB2D 2J0WA 4JI4F 5I3QA 2DNYA 1JLGA 4ES2A 6FD1A 3CC7S 1TV6A 4DG1A 4DQSA 3DLEB 5THWA 3BDPA 3C6UB 4KFBA 5J1EB 2CAJA 4CM2A 3I5BA 1RWMB 1CJUA 2LQ8A 5KFKA 2JVOA 2RQ4A 4PKDB 2XY6A 1G6BA 2XSFA 2ROPA 3PRBA 1YIJS 1TKXB 1RAGB 5KAKA 1U1OA 2C3UA 4ECZA 1N5SA 1KQKA 4QIVA 1NLKL 5I4MA 1U45A 5C5JA 1JLAA 2Z30B 2HNZB 2HBZB 1HNWF 5A0YA 3SFUA 3O6QA 4M5IA 1F5AA 1X4FA 3N5FA 1RA6A 2DGXA 2RF2A 4RW7B 1JLQB 4ZP9A 2CQIA 1FKAF 3OL7A 4A8MP 3GLJA 3NRBA 1OPZA 1VISA 1TMMA 4YB6A 3ULHA 5HROB 2EBEA 4A8YA 4J7CA 2GZOA 1RU1A 3KKFA 3R9LA 4JB8B 2PFFB 2FD2A 5L46A 3QGPA 4ZITA 3N28A 2GJ2A 2VV5A 3GU0A 5J2QB 2XMAA 2OHDA 4O4GA 1UA1A 1RBLA 4K50A 3ITHB 1BLUA 3ILOA 3UD4P 5AJ3F 3FBBA 2RDJA 4FYVB 4OHWA 1ZOTA 2CDRB 4RW6A 2BE2B 4DL2A 1S0MA 3A3OB 2V4JA 2Z58B 2BJ9A 2VF3A 4H4KC 1GNKA 4NRUA 3MM6B 4PXDA 1U4BA 4NWBA 1H73A 3DYAA 1RT6B 1TZ0A 1AFJA 1FD8A 2NPFA 5L8RC 4KAIA 2GAHC 4WFXA 3CCWA 1U1PA 3GTYX 3UDLA 2JL9A 1X4BA 3DLKB 3IM8A 3D0GE 5AXMA 1RT1B 1R31A 3WX4A 1K0TA 1U1MA 1Y9OA 4C11A 4DZDA 4RNNA 4CLUA 3NAHA 1N33J 3FVYA 3PJXA 2DNGA 2OFGX 4WU2A 4TY8B 1EQMA 3M9OB 2EG1A 1P6TA 3F0NA 1S6OA 3QSYB 2E1AA 2UUAF 4RR5A 1OO0B 2M9KA 4MAKA 1V5IB 3MEEA 1S12A 2L41A 2AT1B 4LSNB 3K8VA 3D6MB 2RIJA 4E98A 1VOMA 2D3ZA 2OPRA 4NZ7A 3G96A 2LXUA 2MZTA 4USTA 4ECRA 1HR0J 1I3OB 4B9VA 1HHTP 1MWQA 1JNRB 3V2UC 1VK3A 5RUBA 3KK1B 3BF4A 2H4YB 3KK3A 3DLJA 2AKWB 1XTZA 3A8EA 1NK0A 5KT2A 3H2UB 3RTVA 1RA7A 4CDIA 2XCPA 2CQ1A 1GEHA 3CJ5A 4OX7A 3WX8A 2OTJS 4QQBA 3C6TA 1NKBA 3R1HA 4RU2A 1V3RA 1WHYA 4F4YA 3CCMS 1PYOB 4J9NA 3SYZA 1HFEL 4ECUA 4LF6F 4IG3B 2BXJA 3Q22A 3MEGB 5HMYA 4GKKF 2E7XA 3K5LA 3ONQA 5CQGA 3MM7A 4JI6F 2DGUA 2EWHA 4USJC 4PUOA 2PE8A 5CZXA 2HLTA 3J7Z5 4CQ1A 3RRGA 2BJEA 4DSIA 7FDRA 1NH7A 5AT1B 2KXFA 5K5MA 2OTLS 3MCMA 2ASYA 2FTRA 5KFMA 3MD3A 4JI2F 2DGWA 3P8BB 1MU2A 2L48A 4MYUA 4DUYJ 1WWHA 3FFIB 5IXUA 4DV0F 1S1WB 4HR2A 3ZO7A 2AYMA 2PA8D 2ZH6A 4IDKA 3H5UA 2CJBA 2B7BB 3DLGA 4IQXA 3G8SA 4FF1A 4ZIWA 4OX9F 2GVZA 1NM2A 4OI6A 3TUIC 3JYTA 1RB0A 2ZOGA 3GG1A 3HHKA 3IS9A 3PX6A 3TVYA 3WIVA 2DHGA 3W64A 4DI6A 1DTTA 2BUNA 2GW8A 2UUWA 3GV8B 2DGOA 4B3TJ 3M2RB 1IKXB 4DEZA 1S6QB 1RWPB 2RD5C 2LQ5A 4PWUA 2GQCA 1T94A 2HRYA 2A2DA 2BYCA 4DS4A 4EEYA 2YKQA 4UQGA 3QLHB 2EKYA 2F3JA 4CRJA 2WSEC 2E1MC 4JI3J 1SQEA 4PG8A 1R0BG 3HJVA 2NXEA 3BV8A 3T1HJ 3OXGA 4YR0A 2ZH5A 1VJWA 4DJBA 5E41A 4EMDA 1VHIA 3DDNA 3MM8B 2CQHA 4MKAA 2F4VJ 1HW9A 4LF8F 4ED6A 3RAMA 4ZLPA 5D4LA 1J5OA 2AGOA 4K4VA 3AOBA 4I2PB 2XCAA 5D4PA 3SQGA 1S0OA 5KG2A 1L3TA 3KHGA 3C46A 2L9WA 2QG9B 1VRQC 4ED1A 2ASDA 2E9TA 4GVBB 4LF5J 2CRLA 3HHLB 2VA2A 5E0OA 1SJ3P 1R8AA 4B9NA 4USVA 2CNOB 1PAUB 3EDQB 3T5LA 2VASA 3BO2A 2X1BA 2V69A 1TR0A 5F8JA 1VK8A 1REGX 1RAJA 3ENAA 2IA0A 3MTJA 1CJKA 2BANA 1YJRA 3I82A 4JBCA 4RW8B 4WFYA 2XGQA 1IUJA 3MMCA 2H54B 2ZHBA 3G2XA 2ZBRA 2HFUA 1F6TA 4PWWA 3ZZTA 1KONA 2Q6BA 4OV1A 4C97A 2JDJA 2EFNA 5CZVA 2AWZA 3AFGA 1FNMA 2E5IA 3PO5A 1RQ0A 1D8YA 3CD7A 1WC3A 5DG9A 3V6JA 4WTYA 1F9EB 1TKZB 1B7FA 4FF3A 1OJ4A 3EPGA 4L76A 3LALA 1VRUB 3DN9A 2QSWA 3J80U 1LFPA 1CG2A 2DJWA 1DJ0A 3D3BJ 3LAKA 3ZXWA 2FGCA 4P10A 1WKKA 4ZCLA 2BW7A 3M8PB 1IKYA 4DFKA 1LW2B 3HK2A 2J8AA 4LQ3A 1UKUA 4P9SA 1OQ6A 3QRRA 2N4DA 3M6VA 3JXOA 4DSFA 3N01A 2W4PA 1WSRA 2VDHA 4ID8A 8RUCA 1UWBA 2E5JA 1S76D 4M5DA 3MAQA 1BHNA 4RUCA 2QMUB 1I6JA 5ETPA 1AZSA 2JC1A 2A18A 5AE3A 4C6AA 4MH8A 1N5QA 1D1UA 3HPOA 3S01A 1VMBA 4RLEA 4PWDA 3MFHA 1B4SA 2PDAA 1ZM4A 1FRLA 3IR6B 2CPFA 5EGYA 4EU0A 5CAAA 3NOCA 4Y0FA 2CQ3A 3FZ2A 4F50A 1Q5YA 1X5TA 3CD5A 2YKAA 1MN7A 4P7VA 4DX7A 5AE1A 4OYOA 3BREA 1NEEA 2L9DA 4PG7A 2ZH1A 5FLXU 4IFVA 4DSJA 4NLOA 3X3UA 3CPWR 3H20A 5DQHA 1FJEB 4N8OA 4Q2LA 3CJ8A 2K3IA 4ECYA 1M90T 2JJ4D 3HSGA 3W8PA 2HHWA 5IFMA 1Q81T 4W92B 3IMQJ 3WHIA 3I5AA 4QR1A 4EBEA 1JXLA 1FEHA 4ZHRA 1QAIA 4TLQA 1TAQA 1SC1B 2E1CA 2XS5A 1T9YA 5ETTA 4D3HA 3CO0P 2CVIA 2XZTB 2W2NP 4OZ3A 2DBBA 4DR6J 4RW9A 4HVZA 3PY8A 4AXIA 4CO4A 3FEZA 4UTGA 4OYXA 2PI5A 4DF4A 4F25A 4J9LA 1Z2LA 2HBYB 2SXLA 4USMA 3GZ7A 3QJPA 3MR6A 4HHJA 3POTB 1W7WA 4DV6F 5I3PA 4NCBA 1S1XA 2VQFF 1WF2A 2RQKA 4H4OB 4USHA 1MROB 3D9BA 5C25B 3JTOA 5B0BA 2CQGA 3EGWB 1LFWA 1HBNA 4G65A 4K59A 4F36A 1CVJA 1TL1A 2RSQA 3TJAA 3ZZRA 3CVKA 2OEJA 4K4YA 4R8UA 3U1LA 1MMDA 4J90A 4RNFA 2J9CA 4KV8A 1YHQS 3D7SB 4LR9A 4DL7A 5IC6B 1HQEA 1R7IA 2CFXA 4RU9A 4EYIB 2Y8YA 4WKRA 5D4OA 3OL9A 1NHKL 2MZ1A 4WBFA 3LP2B 1U7LA 4DQQA 2DNMA 1DARA 4I67A 2YNIB 1XIQA 1Q78A 3CCQS 1T05B 4KO0B 3FRYA 1RAEB 2ZBQA 3NBPA 2MQ8A 3IO1A 3TP2A 2IBKA 3WZ0A 2ZOFA 4PYAA 3PJ9A 2I8EA 2DTJA 5A2QU 2AGQA 2HQFA 4XO0A 4B3OA 4LF7J 4C2MA 3E51A 3QBCA 1X4HA 1IJEB 3SI8A 2JVRA 3DYAB 5HLFA 2EFOA 1S6PA 4F4XA 2B0GA 1NK5A 5A8RB 1U0HB 3M6UA 5DM7Q 2M70A 3FKBA 1YX2A 1VBXA 1Y3KA 1FKOB 1W2BR 1JLFA 2IC3B 1P9QC 1RHRB 4JI7F 4PABA 2OH2A 4R5PB 1ZM9A 1S0VA 1WHWA 3BBFA 1FDBA 1GX6A 3MMJA 3R5BA 4XDCA 3JQJA 4IH7A 4QU6A 4NLDA 1U47A 4DL0C 4EZ9A 3MURP 3DRPB 1Q53A 3PACA 1WEZA 2J0QD 1QE1B 4LFBJ 5LMNJ 3IGVA 4LBIA 3CJKA 4DUTA 1SJQA 3DHWC 2OELA 2IM3A 1JQGA 2DHAA 5M2PA 1S57A 3V4IA 4AT1B 1RAAB 2Y9HA 2CQPA 1HQUB 3MECA 3ZTPA 3KXDA 1RU2A 3B8HA 1FFSB 4NLVA 1U2FA 5H9FJ 1JJHA 2FJEB 2HVZA 5I3UB 1BGXT 2QA4G 2FHKA 1DQAA 2V2ZA 2V8DA 1N33F 2B4PA 2BVZA 1KOHA 3D1HA 3P49B 2ZBPA 4ZOSA 5HVHA 4I6WA 1WC0A 5HQMA 1RCXB 4O3PA 3PW4A 1R0CB 3L95X 4P72A 4TKTA 5ETKA 1HBMA 3KDNA 3C14A 2NREA 4YDDB 3G8TA 1EARA 2L9NA 2PFDA 2CZ4A 3NCQA 1QAYA 2PD1A 1CJTA 1FI4A 3J7AN 4NLQA 3AXKA 1APSA 5A6PA 1DTQB 2EW9A 1VQ9S 3W5YA 2XMTA 3W9HA 2MB0B 3HVTA 2RUGA 3MM7B 1IWGA 2HVIA 3ADAC 3JQKA 1PG5B 2ZM6F 4WE1A 3FSIA 1UL3A 1T8EA 2QLWA 2UUBJ 3HHDA 4UUWA 3OUYA 2DR6A 3T1AA 3BQ1A 4ILMA 3MGJA 2VG7B 1HHSA 3WIUA 4WFAQ 2VFTA 3W8GA 4CIOA 4Q7AA 3TZWA 1ZPVA 5LMUF 3IN5A 3NL0A 2HFZA 2W9BA 3NGDA 3FCVA 1UJ5A 2PN6A 1BMQB 4DV3F 4K5RA 5KFHA 3HMJG 2ZKUA 4WIQA 3FCHA 3FMWA 3M30B 5JJBA 2GJFA 3OV7A 1FRMA 5CA5A 2P5VA 3EE3A 4LFAJ 3J81Y 1FXRA 4JV1A 3EGVA 2CWXA 2PEHA 1YI2S 2O01C 1G3OA 1C4CA 2QT7A 4ED7A 1XEZA 4URGA 4PQUA 2I5JA 3H98A 3DU6A 1SH0A 1KSPA 4LF2A 3H2VE 3E01A 2CPDA 3V81B 2XULA 2HFNA 2OSRA 4U96A 2W9CB 1HD0A 2B9EA 3MCOA 3PDNA 1X4AA 3OFGA 2C2EA 3F73A 4CT9A 4WP9A 1EETA 3GG0A 1UVNA 5T41A 1HMVA 2JH3A 3VGVA 2V4RA 1LQ9A 1VFJA 1PAEX 1UCNA 1X4EA 2VB6A 4O0IA 1Q1KA 2WW8A 2BR0A 3ZFVA 4ZVPB 2PSZA 2HS3A 1RADB 5LOQA 2V6AA 1UETA 4WZQA 4JI3F 4ZLJA 4RBUA 5M2RA 4TU8A 3UDVA 3RAXA 1NNDA 2ZBCA 2CUYA 4TU9A 3T1HF 4B3RJ 3DOKA 3BYPA 5A8KA 1U8WA 4AXJA 2J9EA 3T6JA 1S1VA 1KVIA 1HA1A 4ENOA 4P2XA 4RW4B 2ZH4A 5HBMB 2WONA 1RWVB 3TI0A 3IBWA 2OAUA 3SDEB 3W2WA 3R5AA 1SB6A 1C4AA 1S9GA 4A8OA 2HSEB 5KG4A 1N6QA 3OR2A 3QIDA 2YXLA 4QIEA 3T9NA 2GIRA 2HNDA 5HMXA 4OYZA 1Y5LB 2Q1LA 4DX8H 2C3OA 2J7WA 2MSTA 1SH3A 2UUTA 2ZWPA 1RHQB 4RL1A 2R8HA 1HPZA 3LO3A 1C1CA 5GVQA 5G0RB 4CH7A 4BCAA 3BZQA 2RDIA 3QNWB 5F3ZA 3MZIA 1XR7A 1PBAA 2QA1A 2KU7A 2R7OA 1BUXA 1S1UB 3PCOB 1R27B 3DXSX 1AUSL 3RRHA 1ZETA 5H9EK 2HKEA 4WIIA 4AL5A 2DH9A 1NZ8A 3AA8A 1M5SA 2DR7A 3IRXA 4ZPBA 4DV2F 1ICEB 4H4KA 1S79A 5BR8J 3H5XA 3I6PA 4U95A 2HZAA 4C8ZA 3QATA 1OY9A 5K20B 3GIIA 1FEEA 4CTAB 1IWAA 1ZAXA 2GQ2A 4ZP6A 1DQ8A 4CZCA 4UZBA 1F1BB 1NK9A 1CS4A 3SSRA 3PR4A 1NB2A 2OPSA 2V8GA 4ALZA 1YRXA 4EWTA 2F7VA 4FVMA 5D8HB 5D0HA 2KFNA 3PRDA 1AFIA 2M5YA 1W25A 3CCUS 2H5EA 2V34A 4OYPA 3B78A 4EGLA 4FPRA 1BWVA 3CULA 1WEXA 1TL7A 4B9MA 5GAEU 2QYCA 2ZH3A 2XYPB 4K4SA 3KJFB 3KK2A 1ZZNA 3D4JA 1FCAA 4L73A 3G9CA 1PYTA 3UVJA 1JXVA 1UW4A 4PPDA 2RKIB 3QO9B 4B9LA 1WDDA 3CDAA 2UXDJ 2APOA 4J37A 1U24A 2K7JA 3EICA 5D0GA 3W63A 1VQKS 4DR4F 1FESA 2M2BA 3GIJA 2VJUA 3G6VA 4QYZK 1F3FA 2YWFA 3S7RA 4ZVUB 3PIPQ 4A48A 5IS2A 4OZ2A 4Y2MA 1JKHB 3G8QA 4AQYF 5EWEA 5KT4A 4ANEA 4J9PA 4DZ6A 3IG1A 2GO8A 5DLFA 1O8BA 1B64A 4IOCQ 3I0RB 3M8WA 3EM1A 4I7FA 3THPA 1ZM2A 2UUCF 3VV2B 3AOAA 2AMCB 1JLEB 3D67A 2MKHA 3H4BA 2COLA 4Y2CA 4F8RA 3FGVA 1HYSB 1P9YA 1KFDA 1U49A 4LRCA 3GFXA 3N79A 4AYBD 2HS0A 4ZVTB 1U1RA 3QJLA 5C2CA 2VICA 4X66F 4F2SA 3JSBA 1UJ6A 3HCXA 4UT4A 1NKCA 2JLFA 2M4MA 1Y4ZB 4Q8EA 1UAWA 2J9DA 2FJDB 2QTWA 2W4DA 5ETSA 4CO3A 4M1KA 2GMHA 1FNOA 2J7UA 2W01A 1HHQA
chains in the Genus database with same CATH topology
1UVLA 5J2MB 4IRCA 2JVOA 1QUPA 2RQ4A 4PKDB 1KLNA 1JXEA 2XY6A 2OPSB 3NMRA 1SV5A 1U1NA 1G6BA 3NGKA 3I9V9 2OKQA 2XSFA 3OBIA 2ROPA 3PRBA 2ABYA 1WG4A 1X0FA 4KC5A 1YIJS 4DS5A 3G6XA 2XY7A 1TKXB 3BO4A 5KAKA 5KFZA 4FN5A 1U1OA 2C3UA 4ECZA 2KO1A 1N5SA 1KQKA 4QIVA 5KOXA 4C0OC 5I4MA 1U45A 3N6NA 2ZE2A 4PXCA 3MF5A 2G0CA 3KK1A 2V9KA 2R2RA 5C5JA 1JLAA 2RB7A 2YNFA 1YBAA 3VQTA 1X0PA 1M0SA 3BDEA 2HNZB 4YMEA 2M8HA 1B0TA 1HBUA 1KR4A 2IA6A 3QPIA 1HNWF 4ATNA 1FDNA 4NCGB 5DDPC 5A0YA 4HEA9 4YUDA 3VR1A 3SFUA 3O6QA 2HQIA 1F5AA 1LXJA 1X4FA 3N5FA 1DRZA 1RA6A 2OPQB 2DGXA 2YY3A 2L08A 2RF2A 4I6AA 2DCUB 2MSSA 4RW7B 4JI5F 3J7A1 2EI5A 2YWGA 1JLQB 2JHEA 2YKNB 4ZP9A 2CQIA 3DC2A 1FKAF 4NPOA 3CE8A 3IWLA 4ELTA 3U02A 3OL7A 4A8MP 4LJMA 4O23A 3NRBA 2DNRA 2Y0SD 5BYRA 1OPZA 5EN1A 2BDPA 4YB6A 4N5SA 3KK2B 5A8WB 3ULHA 5IQ6A 5HROB 2EBEA 4Y28C 4FVCA 4A8YA 2GHWA 3KKFA 2VBZA 1NRKA 2VG5A 2PFFB 4OQJA 2FD2A 2XC9A 1U48A 2R7VA 3QGPA 3MD1A 3PXGa 4K0KF 3RYLA 3PEJA 1T3NA 4GMKA 3N28A 2GJ2A 2VV5A 3OPKA 3OFHA 3OTEA 5KG1A 2PMZD 4IG3A 3SZ2A 1R43A 5J2QB 4ZS6A 3EXCX 3MEGA 4M95A 2HS4A 2KYZA 4O4GA 2V5HG 3CDBA 3T9ZA 1UA1A 1XK8A 3DRSA 1I94F 1JLBB 4WFNQ 4DUYF 2CJKA 2CIMA 4K4UA 4K50A 2B4OA 3ITHB 1BLUA 2FLNA 1HBOA 1LW0B 1FJ7A 2GC8A 3HHLC 1RT4B 2NYIA 2I2YA 3NP5A 2F1FA 3UD4P 2PC6A 5AJ3F 4QWAA 1EP4B 3LUYA 3KLGB 2AYGA 2RDJA 2AYBA 3H5SA 1R8PA 3KWMA 2ASLA 5C42A 3LGNA 4LSLB 4NLUA 4NLXA 4OHWA 1ZOTA 4TQRA 2DR8A 1FJGF 5E3QA 3ICLA 3DGPA 3T1YF 4I64A 1S97A 1KVJA 2B3TB 4A8SA 1ELOA 2D41A 4X65F 4RW6A 3OTOF 2BE2B 1XWLA 3DOLB 4DL2A 2VFRA 3NS5A 3CJ4A 5E7OB 2UVVA 3LP0B 1FRXA 2C3PA 3KHHA 2DO0A 5F3TA 1S0MA 3IFEA 2GGPA 3HHNB 4OL8A 2ZITA 2IMOA 3LANA 4HDHA 5HP1A 2MZRA 2V4JA 2KH9A 4CO1A 1Y7PA 5FDLB 4BWMA 4B3TF 2E44A 3MXHP 4H4KC 1GNKA 5L1LA 4AL7A 2PGCA 4NRUA 1KS2A 3IG1B 3MM6B 4PXDA 1LK5A 1U4BA 2IFXA 4NWBA 3FFIA 4NCAA 2CJ9A 3DYAA 1RT6B 1S1WA 3NCPA 1IQTA 1TZ0A 3MUVP 1FD8A 2A10A 1AFJA 2NPFA 5KFUA 4WK3A 5B0FA 1IXKA 5L8RC 4KAIA 3KLEB 1LKZA 4ZVGA 1V3SA 2OD4A 4WFXA 2CVEA 2JLGA 3CCWA 4Z37A 2XMJA 4AL6A 1U1PA 3IC1A 1FE0A 2EVZA 5FD1A 4I7FB 2OO4A 3UDLA 3RRKA 2JL9A 1X4BA 5LMNF 3DLKB 2AJ1A 4DV1F 1C0UB 3KFWX 3D0GE 5AXMA 3VZHA 2LKZA 1WACA 1RT1B 5DG8A 1R31A 3HVAA 3WX4A 1K0TA 1U1MA 2MQMA 3GIKA 1Y9OA 4C11A 5KFFA 1U09A 1L3SA 3IWNC 4RNNA 1UMJA 1K9MT 1F5CA 1JLCA 2VOPA 3OR1B 2XGPA 1VQ6S 4FF2A 3NAHA 3AA9A 3WC0A 1P27B 3FVYA 2CPHA 3PJXA 2VBWA 3M2RA 2DNGA 2OFGX 4WU2A 1YRTA 4TY8B 1IKXA 1DQ9A 5K8NA 3J7YU 4F4WA 2J6TA 4IR9A 3DHXA 2RQMA 4A4JA 3M9OB 1S6QA 1HNVB 2OIHA 2J0SD 2EG1A 1P6TA 5KT6A 2F4VF 2Q43A 5KFEA 1H6KX 4IH6A 3KHLA 1S6OA 5JVGQ 4GC7A 3QLHA 4NLPA 3PFEA 2F8MA 4K4XA 2UXBF 1IBMF 1FRKA 2ERRA 3FEYB 1AXQA 2E1AA 2UUAF 1JLGB 1NB7A 1YJVA 1TV6B 1JK9B 2DNNA 1OO0B 1N54B 2M9KA 4DG1B 1KQSR 4JV2A 4MAKA 3TNVA 3MEEA 3ZZZA 2L41A 1E6VA 4LSNB 4KFBB 4LF5F 3K8VA 2UVRA 3CXCR 2RIJA 4E98A 3A1YG 4XAKA 4YP3A 1JIHA 1VOMA 2D3ZA 4YFUA 2OPRA 5KT7A 3M32A 4NZ7A 4OLOA 4TYAA 3G96A 4WCEQ 2LXUA 2MZTA 4N76A 1KHVA 5IQQA 5DQIA 4EYHB 4ECRA 2C3YA 4HH1A 2D9OA 2W25A 2VUGA 2WB4A 3GV7B 2LA6A 2NSCA 3MM8A 5LJ3Y 1HHTP 4B9VA 1VQ8S 1TVRA 4L3NA 1SV5B 4QPXA 4LT6A 3Q23A 2LEPA 1N8RT 4NA1A 1YRUA 1JNRB 3I0SA 3BM7A 3V2UC 4DQRA 1VK3A 2P9GA 3MMBA 4KGMA 3MR2A 4I2PA 3DI6A 1WD6A 1FVQA 5L9XA 4IR1A 2ZE2B 3KK1B 3BF4A 3C2PA 4A47A 3CB4A 1JLAB 2YNFB 1MMNA 4KQZA 3KK3A 3IXQA 3CCLS 3MAHA 4HT5A 1HBUB 3DLJA 2XO7A 3R1LA 2E1RA 3HHLA 5A0YB 1XTZA 2XLJA 2AD9A 3A8EA 1NK0A 2ACYA 2PO4A 5KT2A 2R4FA 2ATLA 4MIBA 3GFHA 4LF4F 3H2UB 3F41A 3RTVA 2RF2B 4JI0F 4A8XA 1RA7A 3OL8A 2D1CA 4DN0A 3KYLA 1LK7A 1HNIA 2N3OA 2RMLA 3CCZA 2WTFA 4IRDA 2XCPA 2CQ1A 5L9NA 1P1LA 1UEUA 3CJ5A 1L5UA 4OX7A 1UP1A 5KFQA 2CKWA 5K14A 5F0UA 2OTJS 3QAUA 4QQBA 1UFWA 2R2TA 3C6TA 1HWIA 2VBYA 1NKBA 4MKYA 2OMLA 3HFKA 2C3MA 1L3KA 1S10A 2KFZA 3R1HA 1UVMA 3OTDA 4RU2A 5KFOA 1QAXA 5B0EA 1S9EA 3D5MA 1V3RA 3SV3A 4ZPTR 2GX8A 2RS2A 2D3UA 1WHYA 5L39A 4F4YA 2GMLA 3QGGA 2VG5B 1JNZB 4DV5F 2U2FA 4IO9Q 1VQSA 1KNZA 2LMIA 3CCMS 2IM1A 1URNA 4NXNF 4M94A 4J9NA 3SYZA 1HFEL 4KTQA 4ECUA 4LF6F 1IM4A 2B4UA 4IG3B 3LP1A 4I68A 2BXJA 2RILA 3Q22A 3MEGB 1RP5A 2DGSA 4WKYA 5HMYA 4XPCA 4GKKF 2VH7A 4O4GB 2E7XA 3DRSB 5EWFA 2BOPA 1WNEA 2ZNZA 2BW2A 2L3MA 3K5LA 1YWXA 3QZ7A 2KZMA 3ONQA 4QJVA 5CQGA 3MM7A 4JI6F 1O0PA 2DGUA 2EWHA 5KG0A 1PC5A 4USJC 2E5HA 5DG7A 2OJ3A 4PUOA 2PE8A 2MY7A 1M5PC 1D8ZA 5CZXA 5C42B 4JV5F 3HLUA 1N5VA 1FKPA 2HLTA 3MDFA 5JVHQ 1XBWA 3J7Z5 4CQ1A 2VQEF 3RRGA 2BJEA 4DSIA 3HZGA 2B6AA 5F8MA 4OI0A 1BWEA 1KTQA 7FDRA 1G1XA 3MCSA 1GAOA 1RTIB 5KG5A 2KJWA 4RW6B 2ZHAA 1CLFA 4IUFA 1FRIA 5J2PA 1S99A 4NMLA 2UVWA 2DR5A 2AJ0A 1Y3JA 1NH7A 1VQ7S 4OI3A 2X1GA 4ILLA 3Q8SB 2AW0A 2GGPB 2KXFA 2ZD1A 5K5MA 4NOHA 4PQAA 1ZYQA 2OTLS 2RNEA 2FUG9 2ASYA 2FTRA 2MQNA 2MZSA 5KFMA 2R9LA 1ZTWA 3MD3A 4A46A 5HP1B 5CXTA 4JI2F 2DGWA 2V4JB 3NWGA 3FNNA 3SSQA 1FXDA 2QE5A 2IBOA 1MU2A 3CIZA 2V2KA 2L48A 2MJNA 4DLEA 4MYUA 4MJKA 2R7XA 2KVIA 1C1BA 1Y0HA 3C3LA 2DNZA 3U1MA 1WWHA 3FFIB 5IXUA 4DF8A 4DV0F 1S1WB 1RT2A 1OPIA 2DD8S 1VRUA 2VPYB 2AYMA 2NXUA 2PA8D 1J5EF 2N82B 4IKAA 2MHNA 4IDKA 2ZH6A 1A9NB 3H5UA 2CJBA 2B7BB 1RTDA 3DLGA 4ED2A 4IQXA 4DFJA 3G8SA 3TAMA 4LVOP 3D0IE 3T5JA 4URQU 4O3RA 4FF1A 4U7CA 4OX9F 1MWZA 3M8PA 4OI6A 5B0AA 3TUIC 1RT7A 3JYTA 1FHTA 2ZOGA 3GG1A 3HHKA 3IS9A 3PX6A 2JOQA 1PGZA 3I5CA 2V4QA 3FQKA 1F2GA 3MR3A 3GE9A 3VAKA 4C11B 1LW2A 2MKIA 3M6XA 3UWTA 3TVYA 2VFUA 3QYYA 4DR4F 2ZOMA 1JLCB 2DHGA 2XWYA 3KG4A 1SJ4P 3TO8A 4ETXA 2IM2A 1DTTA 2BUNA 2GW8A 2UUWA 4NA2A 3GV8B 5SZTA 1WTBA 2DGOA 3M2RB 1IKXB 3OSNA 3W3SA 2VPWB 4DEZA 1H7XA 1XMOF 1Q82T 1RK8A 1VLYA 4USIA 1ZH5A 1S6QB 2RD5C 2HZCA 2LQ5A 4KBIA 5DO2A 5KTQA 4PWUA 4NLSA 3GILA 2GQCA 4MK7A 1T94A 3H40A 2HRYA 4C3MA 4C0BA 4FP9A 3TYTA 4ED0A 5FIIA 2A2DA 5KFCA 2BYCA 4DS4A 4EEYA 2MQOA 2YKQA 4ZPVR 2UV8G 4UQGA 3QLHB 2EKYA 2ZH8A 2Z0GA 2F3JA 4OHZA 2HAIA 2WSEC 2J5AA 4HT7A 4MMOA 2E1MC 1KD1T 3NNAA 1SQEA 2KT5A 2QMWA 4IOAQ 5I42B 1ZM3A 4QWEA 3MEEB 3QWUA 4PG8A 2BQUA 3PR5B 1E6VB 5CD4H 4C98A 4UY8T 1H2VZ 3PW7A 2DNKA 4ZPDA 2QIFA 2CPEA 2HHSA 1X4GA 2FY1A 1TAUA 2Q66A 4NYPA 3KTQA 3AY0A 3OXGA 2OPRB 3TR5A 3V4MA 1IR0A 4YR0A 3BSCA 1FF2A 3M32B 3K2YA 4MIAA 2ZH5A 1VJWA 4KHRA 5KFLA 4DJBA 2HWIA 2F8HA 3DMJA 1DLOA 5E41A 2K1RA 4NXMF 3DDNA 3MM8B 1TUVA 3P6YC 2GHPA 2VG6A 1TVRB 2CQHA 4MKAA 3F44A 5LSRA 4RNOA 1HW9A 2FHMA 3HXMA 1REVA 4ED6A 3AQOA 3RAMA 4ZLPA 4LF8F 3I0SB 5LSLA 3I96A 3HM9A 5D4LA 1FVSA 2YWEA 3FMBA 3MMBB 4FS2A 1J5OA 2AGOA 1B0VA 2CPYA 1OIAA 4K4VA 4I2PB 1OQ3A 1Y00A 2RJZA 1S4FA 3DI6B 2MDAA 5D4PA 3SQGA 2XCAA 1S0OA 1K0VA 3OLBA 5KG2A 1L3TA 1X4CA 2NUUG 3KHGA 2DPIA 1E6YB 3C46A 1FDAA 3CD6S 5B0CA 2L9WA 3CTRA 3UPFA 2DNLA 1TQLA 4ED1A 2ASDA 2DGTA 3KK3B 5HI7A 2E29A 4J9MA 3Q2SC 2E9TA 2QMXA 3K5MA 4D3GA 1QY7A 2CRLA 3TUZC 2XLKA 4C9DA 3HHLB 1RI7A 2VA2A 1CPZA 4X84A 3ISNC 5E0OA 1SJ3P 3RR7A 2O1PA 4PG6A 1SC6A 1R8AA 5DLGA 4B9NA 2KI2A 5LXYA 2DH7A 4TQSA 4DDFA 2CQ2A 3LF0A 3QAEA 1HNIB 3MUMP 3T5LA 2R8JA 2VASA 1FK9A 4ED5A 3BO2A 2BA9A 3NCRA 3MI7X 2X1BA 2B4VA 5EX3A 1KC8T 2I1RA 1TR0A 5K14B 5F8JA 3BS9A 3C6TB 3BGLA 2KDOA 4O44A 1VK8A 5HMZA 3M9MB 4FBTA 1RAJA 4DR6F 2NPIA 3EZUA 2VC0A 1X4DA 2GA7A 4ZMMA 1ZTTA 2JFDA 4O3QA 5E3AA 1S9EB 2IA0A 4X4SA 3CCTA 4KE5A 3MTJA 3US5A 4ZPWR 2MXYA 3CDEA 3LWLA 2BANA 4C8MA 4HI2A 1WF0A 1YJRA 3JB9k 5BYQA 3I82A 3NS6A 1VRTA 4HH0A 1SIZA 4KKOA 5GAGU 4RUHA 2YQ3A 1XR6A 2F40A 4JBCA 1U1LA 2IRUA 4RW8B 4X4UA 4WFYA 2XGQA 2XSJA 2PT0A 1IUJA 3KLVA 3MMCA 5KFJA 3H25A 1P1TA 3LP1B 5EDWA 3PZPA 2IYIA 2ZHBA 1U6ZA 2GNKA 4YB1P 2DT9A 1Y5NB 2J6SA 4DOZA 3ZZTA 2QFJA 1KONA 5D77A 1BY9A 2JX2A 1DZ5A 2Q6BA 1SKWA 1VHFA 4OV1A 4OHVA 3PNIA 1HI1A 1PC4A 4C97A 1M5HA 5D3GA 2JDJA 2EFNA 3I4HX 5CZVA 2AWZA 4PUOB 2VONA 1KLMA 2NLWA 5KFTA 1FKPB 3RBEA 1TP7A 3JSYA 1FNMA 2B6AB 2BRLA 2E5IA 1NHVA 4X4QA 2ZC3A 3PO5A 4M8LA 5J2PB 4J9OA 5HO4A 1RQ0A 1D8YA 4BBYA 2YNHA 4IH5A 2MJUA 2E66A 2MMYA 3CD7A 3MPWA 5T14A 5DG9A 2ZD1B 3DRXA 2IVFB 3PW0A 2X1AA 2ZKTA 3V6JA 4NL5A 3MEDA 4WTYA 3CJ3A 4DR3F 1TKZB 2HFOA 2LA4A 2AU0A 1HL6A 1RISA 1B7FA 4FF3A 1MU2B 3POTA 2BZ2A 3IR7B 3EPGA 2KXHA 4FNHA 3LALA 1C1BB 2LEAA 3D2WA 1YJWS 3PKMA 1N48A 4DFMA 1RT2B 3RB3A 1VRUB 3DN9A 2QSWA 4Q5VA