1IJEB

Nucleotide exchange intermediates in the eef1a-eef1ba complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
90
structure length
90
Chain Sequence
PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQSIEEDEDHVQSTDIAAMQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of nucleotide exchange intermediates in the eEF1A-eEF1Balpha complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Translation
molecule keywords elongation factor 1-alpha
total genus 23
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2001-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ijeB00
1N33F 4DR7F 1IJEB 4X64F 4OX9F 5AJ3F 1RISA 4B3RF 4DV4F 4LF5F 2BXJA 2E5LF 2BVZA 4JI5F 4DV1F 4LFAF 4B3MF 4JV5F 4JI8F 4B3TF 4DV3F 4DV6F 2B7CB 1N36F 1QJHA 1IBKF 2RJZA 1FJGF 4DV0F 4B3SF 1J5EF 1B64A 4DV2F 1XMQF 2UUBF 1IBMF 2F4VF 3T1YF 1CQMA 2UXCF 4LF6F 4X66F 1GH8A 2UXDF 4AQYF 4LF8F 4GKJF 1N32F 5IWAF 2UU9F 1CQNA 4LFCF 4X62F 4YHHF 5BR8F 4DUYF 4JI1F 4DR3F 2UUCF 4GKKF 4JI6F 4DR2F 1XNQF 1HNWF 4DR5F 2B7BB 1I94F 3T1HF 4DUZF 4LF4F 4DR4F 1LOUA 1VMBA 3R3TA 4JI4F 4DR6F 4KHPF 4JI7F 4K0KF 4DV7F 4LFBF 3OTOF 1G7CB 2UXBF 5LMUF 2VQFF 2KJWA 1G1XA 2KJVA 5LMNF 4DV5F 3ZZPA 4DR1F 1HNXF 2HHHF 2YY3A 1IJFB 1FKAF 4YY3F 1XNRF 1N34F 4NXMF 4JI3F 1F60B 2J5AA 2UUAF 2VQEF 1XMOF 1HNZF 1HR0F 1IBLF 4LF9F 4JI0F 4JI2F 4NXNF 4LF7F 4JYAF 2ZM6F 4X65F
chains in the Genus database with same CATH superfamily
5KOXA 1SPBP 2W2QP 1SIZA 3NBPA 3Q24A 1U1PA 2HMIA 3LUYA 1BHNA 3Q86A 4DX8H 1I94J 1FD8A 3KDNA 4EEYA 3H5UA 4LF4J 5BJRA 1TMMA 4WIIA 2XNRA 1R31A 2IAJA 3TANA 1REVA 1RAOA 4KGKA 1VIOA 1RISA 2CPYA 4KV8A 3C14B 1IR1A 3I31A 1RT6B 1UJ5A 3ILJA 4NI2B 4PYDA 3CCWA 5BYSA 3MAQA 1N0UA 2G1HA 2HGNA 2N7CA 4Z7YA 1UA1A 2YWEA 3U1MA 4OZ2A 1HNZJ 2YVSA 4JI1J 1RT2A 5L1LA 3Q0AA 4NXNJ 4Y00A 4QCLA 4WBFA 2E5LF 1XN9A 3CJ2A 4TVAB 1JNRB 4OLPA 3MUVP 1VOMA 4J9QA 1H73A 2K8GA 3WZ0A 4AL7A 2QA4G 2NSBA 2JVRA 1J27A 4JUZA 4U7UK 3MEKA 3GCWP 2IHR1 2EWHA 3N28A 3LP2B 1NJXA 2OEKA 1WSVA 4LIRA 3RBXA 2DD8S 5A6PA 2HGMA 2V8HA 1VHIA 2VONA 5M2UA 1WTBA 4Y2AA 4B3SF 3QMQA 1B64A 1FF2A 1XMQF 3U02A 3QFHA 4DPUA 1VBKA 4EZ9A 3HX9A 2K7JA 3I5AA 4B17A 4OZ0A 1RHQB 2PT0A 1YJNS 1JQGA 3G4SS 2ZHOA 4UUWA 1KDNA 5KFVA 1FRJA 4ILLA 2BRLA 3D0GE 2EFQA 1YZ7A 5EUHA 1UW9A 2M8HA 2P2CB 4KV8B 1NH8A 4MKAA 4ZN1A 4B9VA 3CC2S 5IWAF 2LFVA 3O2IA 3RU0A 5CD4A 3B54A 1M1HA 2H48B 1FRXA 4LF1A 3EX7B 1URRA 1Y7PA 2ZITA 3EMTA 4F3QA 2I8EA 4YR2A 1RYSA 1EKSA 2W25A 1QM9A 1N56A 1YLXA 4J9UE 3KJFB 3FSYA 4DPTA 3RRKA 4OQJA 2PA8D 4CLSA 3WQPA 4OZ1A 1Z1ZA 1XNQF 2YNIB 1BWVA 5U47A 4ZCIA 2CPHA 3KK3B 3OL8A 4QR2A 2LEBA 4DL6A 4EBEA 2VPWB 1U1LA 3MM9A 4NLXA 2VODA 3UD4P 1S1UA 1TQLA 2KVIA 1S77D 1Q95G 2OPSB 4DV5J 2WTFA 2CNLB 4QIGA 1N6QB 2G1DA 1TKXB 3PACA 3KK1A 4DR4J 1JLBB 4RNHA 4X4RA 5KG2A 3PR5B 2HFNA 1Q8LA 2MJNA 4M5GA 3QJPA 2FPHX 4OZJA 2GIRA 3CDBA 5CYQA 2HQCA 5I3PA 5H9EK 1DJ0A 1CS4A 1VQ9S 2AEFA 3D9BA 4X2BA 3BJYA 1S48A 4EYHB 3V81B 4RUCA 2XEXA 2B8QA 3H2LA 2ASLA 3S7RA 3IR5B 1KOHA 1FX2A 1D8ZA 1KKHA 3VR1A 2VA3A 1PBUA 1S1WA 1WC0A 1FEHA 3DRPA 4CT9A 3T5KA 2DPJA 1B3TA 2XBPA 3HVTB 3MD1A 4TU9A 2W9BA 2DJWA 2VHGA 2AU0A 2H4YB 2FIUA 4N47A 3UQSA 5B0AA 1SC6A 4DN9A 3CT9A 2EC0A 1SC4B 2K3KA 2IVMA 3A3PB 4MAKA 1JLQA 4LF7J 3U27A 3IG1B 2KFNA 2J7UA 3CJRA 4K4XA 2V4QA 2Z57B 4LRFA 1GX6A 2RQMA 4URSA 3QIDA 3S1TA 2Z30B 4DUYJ 3PX4A 1U1OA 2ZUGA 1YSJA 5HBMA 2KFYA 1N5QA 4DN0A 4CLYA 4ZVGA 3CCUS 3SV3A 1NZAA 5KFBA 2DNOA 3O8WA 3QWPA 2ZM6F 3G6VA 4ZVSB 2AW0A 3A3OB 2QEXS 4M5HA 3C3LA 5EN1A 3FFIB 1FFGB 3AD7C 4NLRA 4CDIA 2F63A 4J90A 3W9IA 4FBUA 4IFYA 2VASA 3M30B 3HXMA 1NB2A 4QR1A 2XI2A 2AMCB 5KFYA 2XMTA 3H7HB 9ATCB 5D8HB 2AV5A 3G8QA 3N4WA 5KG6A 4X65J 2LU2A 2OEMA 3UR0A 3H2UB 3HSGA 2ZBIA 2MLXA 3FUYA 1VQLS 2CDRB 1H6KX 1NU4A 1UVNA 2VDHA 1VRTA 4PQUA 4YUDA 2BVZA 1F1BB 1KD1T 1IXKA 2UXCJ 1RT4A 3VZIA 4V19X 2UUTA 2L9WA 1PILA 2QV6A 1ZOTA 3SSQA 4DF4A 1HNIB 2R3VA 1Y11A 2GW8A 4J9SA 2QTWA 5KFLA 3VGTA 4QOTA 3OUYA 4J9OA 1IBKF 3RR8A 3DLLQ 5HJYA 1BD6A 2Y0SD 4PQAA 1TKTB 2KI2A 4KKOB 4QIEA 2HHTA 2KFZA 5KG7A 2IVFB 1M1KT 1AB8A 1KEKA 2I0XA 2E9TA 2LECA 2D3OR 2VOOA 1LXJA 2O01C 5HJXA 4LR8A 3OTOJ 3MMJA 2V2QA 2E1PA 4R0JA 3DU6A 3MM6A 1HLWA 3R5AA 3EM1A 2F8MA 3U1NA 4U8YA 4X4QA 1GH8A 2DT9A 3RZAA 3Q89A 3W9HA 4AUKA 2YNHB 4EU0A 4A8YA 1H72C 2BUNA 3HZEA 1JLFA 3F73A 4ELVA 4X64J 3R5JB 1KHWA 4LVOP 5DZ7A 1N32F 1HW9A 2X1BA 3BH6B 3HKWA 2DNMA 2LA6A 2WB1D 4OYPA 5HQMA 4A8WA 4PXDA 2MB0B 2VOPA 3OFGA 1SQFA 3HHNB 2WW4A 2F4FA 4CP5A 5KG5A 4C8KA 2Z2MA 2FVPA 2AGPA 2EFGA 1RT1A 4ZIWA 2L41A 3BSOA 1S0VA 1K9MT 1XEZA 3O3LA 4DS4A 1WOSA 2QRRA 4GKKF 2DGWA 5E2QA 1JX4A 3AJ1A 1HNIA 1HWLA 4C8OA 2FHKA 5HAOA 2B9WA 2GIFA 3GCXP 4ZVEA 3KLHB 2FVRA 1F5AA 3RW7A 1C1CB 3PYGA 1IBKJ 3E3XA 1UFWA 3J80Y 2UVWA 2LXUA 2XMJA 1FJCA 1K0VA 1QE1B 5FJ4A 2NPFA 5JXSA 4DUZF 4F25A 3M9OB 3G96A 3T41A 1P1TA 1CC7A 1V6HA 5I42B 5BXIA 1WSRA 2V0NA 3QLHA 7FDRA 3PJ9A 4Q0BA 4OJGA 2W2NP 4TLQA 2D9OA 3LH2S 2CAJA 1NSAA 4QIVA 1NJZA 1YRXA 1HQ2A 4Q8FA 4LSNA 3RR7A 3HI9A 5LMUF 5E7OB 2VQFF 3O1LA 2NZ4A 4LFBJ 2B3TB 3VGVA 2ZWOA 4ZLPA 4JI7J 3THVA 2RD5C 5HN0A 1RCOB 1X5SA 1FRHA 2MQPA 4DCOB 3DDKA 4ENOA 2HLUA 1IKXB 4UT4A 4MTPA 3ELHA 3MFIA 1OY6A 2BJ3A 2LXFA 2VG5B 4RKUC 4YY3F 1K44A 1HBUA 4UF4A 1H3DA 3KLVA 2OH2A 2ZH7A 3PM9A 1X60A 2I5JB 1QY7A 3DXSX 4HYKA 4ECZA 4ED5A 1RE1B 3W60A 2HWHA 3GQCA 2WVFA 4IH5A 4DBQA 5G4DA 4CIOA 4K4TA 2C3PA 3FVYA 3QAUA 5KT3A 4B3SJ 3FQLA 2ZH8A 4X65F 5DM6Q 1AUSL 1N33F 3B4MA 3OXFA 4NCGB 4FN5A 1XWLA 2M7SA 4KB7A 3TW0A 1LWEA 2HIYA 3CCMS 1SKSA 3J7YI 1JXLA 2XCPA 1S1TB 2ACMA 1EARA 5IWAJ 1RU2A 4ILRA 3H4BA 2IA6A 2KZZA 3BGRB 3AQPA 5J2MB 2HS0A 1T7PA 4E8UA 3GB0A 5IOLA 2YWFA 4HI1A 4CQ1A 3OL7A 2V63A 1RTDB 3EZOA 1FKOA 1YJ7A 3A8EA 3BQ0A 4PG8A 3KK2A 3G82B 2FC8A 3BGUA 4QW9A 1EAYC 1RHUB 2FHJA 4YB1P 2F8EX 4USKA 1MW7A 2GHPA 2VL1A 2W9CB 4CCHA 2EEYA 2X3GA 3G6XA 2A6MA 1RTHA 4C2MA 5KTQA 3KYLA 1NK9A 3FZ2A 2B4OA 3QSYB 1PO6A 1CJUB 2G0CA 2UP1A 3BKFA 5L46A 4S0MA 4YY3J 1NK0A 4FF4A 3K0JA 1CSJA 1TUWA 3K5PA 4EGLA 5DQIA 2RVJA 3T5LA 1PIEA 3SMZA 1S1VB 4C4WA 4I2QB 1YJ9S 4CM2A 3ZXWA 1RTJA 2QLFB 5HI7A 2DHHA 2C2DA 5ETSA 3FJ2A 4XAKA 3CJQA 2IPOB 1S9FA 1N6QA 4K50A 5IV4A 3GV8B 1L3TA 2IY5B 1V3ZA 2EKYA 1TTHB 2OPQB 2YQ1A 3V4MA 2FVQA 4MFBA 1RAFB 1TR0A 4PZVA 2XZTB 2RDJA 2B9EA 2MY8A 1CLFA 3DLGA 2IA0A 1HQUA 4HTIA 3PTWA 4M8LA 4P75A 2BOPA 1JXVA 4HI2A 3M6UA 5E3RA 4WP3A 1FDDA 5J2PB 5J2MA 4LQ3A 1A9NB 2A2CA 1H74A 2FGOA 4MT1A 1PJ6A 4KT0C 3THPA 4USIA 4IOBA 5HL7Q 1VQ8S 3C6TB 2KRRA 3ETOA 3GPAA 3KK2B 3OT9A 2DNKA 3CJTA 2W2PP 4FDFA 1RAEB 3S6EA 4ECVA 1SI9A 3EE3A 1UTAA 3FKBA 2JWNA 4KPCA 2F3JA 2V6AA 3P96A 4NZ7A 2GAGC 3CJSA 3PRDA 3C19A 1CJUA 3MHYA 4K59A 5LXYA 2B4UA 4B9MA 3DC2A 1WC5A 1YHQS 4WYLA 1KR4A 1L3SA 1KNZA 1AXQA 1HBOA 4M5LA 4DLGA 4HKQA 3GMGA 2DO4A 2NPIA 1WF0A 3EVOA 4FZVA 1FNMA 3PW5A 2CUYA 4J5OA 1LOUA 2Q3PA 2DXEA 4RR5A 5A8WA 3QPIA 4DPYA 3GFYA 2D69A 2DR7A 3UDVA 3W66A 2FVCA 2V9WA 5CZXA 4DI6A 3HSZA 3LWMA 1C1BA 2B56A 1S6UA 1TL1B 4FVCA 4X4SA 4RW9B 3PFOA 3W8GA 3J7ZT 3J7Z5 1X9WA 1UVJA 1TELA 2CIMA 1N52B 2WVCA 2UXBF 3MI7X 3DRSB 1PAUB 1Q79A 2AEMA 1TL7B 2F8HA 5LMNF 4CLFA 3VAFA 1RT4B 3FBCA 3TVYA 2HHHF 3CULA 2CQ1A 1MMNA 2YY3A 4WFXA 2C42A 1HBMB 2Q43A 2HBRB 2YKAA 4RBUA 4DMZA 4BDPA 3EXYA 1M5SA 4ED7A 1L3UA 4HVZA 1DQ9A 1RZMA 3M4XA 3R97A 2F9JA 3MCMA 2IM2A 1QTMA 1JB0C 1PBAA 1GK8A 4N7TA 2H54B 4O3PA 1U1KA 3SDEB 2GA7A 2WK4A 3WIVA 1FE0A 3VVUA 3M2RA 4RUAA 2ZD1B 2BM0A 5KFEA 1S49A 5ITHA 4ZDNA 3DM2B 4EI2A 4O3RA 1VQYA 2JC0A 2GS8A 2NXCA 3Q2TC 2X7IA 2DHGA 3DDNA 3GSDA 3IWLA 4PCQA 3Q8QB 2NSCA 2WRMA 1OY8A 3QGIA 4UTGA 1FO1A 2D41A 4PG4A 3V6HA 4OX9F 3NL0A 2WCXA 4CWBA 3T1HJ 3KLIA 2GVDA 3NS6A 1RT3B 4A8QA 2DVIA 3RUBL 5K8PA 3EUNA 2XGQA 3R7SB 1U49A 2FJWA 1T8EA 2XS2A 2D74B 2E5HA 5HVGA 1YBUA 4NZ6A 4RUHA 1M5OC 4B3MF 1B99A 1VRQC 2VBYA 4Y28C 3HP6A 3TWZA 2NLWA 4ZPBA 4O4GA 4IDKB 1NKEA 4EBDA 4I0WA 4TQSA 4Q8EA 2CG8A 2DNNA 1WUUA 3R5GA 4UOCA 1NSQA 3KLGB 1X4DA 1NSPA 5C42B 2IBKA 2AGOA 3MMBA 1YQHA 3K5MA 3MWBA 1T3OA 2DCUB 3DMJA 3I4PA 4DV0F 4PKDB 1AZSB 1JLAB 4AL6A 5D3GB 1R89A 4H4MA 2XWXA 1AW0A 2XTJP 3K58A 3G8SA 3M2VA 4ANEA 1REVB 3H59A 3GLJA 3KHRA 3C14A 2CPEA 4QWAA 4OYAA 3T6BA 4YR0A 1T9UA 1KBRA 2D9PA 3MR6A 2CQGA 3BO2A 4AQYF 4DR7J 5G0RB 1FWKA 5GAEU 3NG8A 1HWUA 1U0HA 1YBTA 2HK3A 3OL6A 3KLEA 1URNA 3QGGA 4ZP9A 4NLYA 4DF8A 1X4GA 1F9HA 2EW9A 3IO1A 4I56A 3KG0A 3HHLA 3QBCA 4USVA 4L6V3 2ZEJA 2VG5A 3TO8A 1WG1A 4XTTA 1NSKL 5A76A 3PNIA 4FYXB 2JEJA 1HFEL 3I56S 2E7XA 1RDRA 2OFHX 4LSLB 3QZ8A 4ZIVA 5CH7B 3QYYA 2HQDA 1NUEA 1YRUA 3HCXA 2QL9B 3LQVA 2A2DA 5IM0B 1PGZA 3PX0A 1JLEA 2YKQA 4KGZB 1WHYA 3CJ3A 3G9CA 2HNYB 4DR5F 4DFPA 2AYEA 3W5YA 5GADU 4DR4F 4L72B 3MUMP 2ZHBA 3W5XA 3TUPA 1RABB 3DN9A 2W9AA 2RIJA 2EBGA 1OPIA 2W24A 3ENQA 4KHPF 2LMIA 4WP8A 1WHXA 2CADA 1TK8A 4K0KF 1D9DA 2CWXA 3CVKA 3PIPQ 4TLRA 2ZBRA 3TX8A 3G71S 4C7QA 5J1EA 2XMWA 1S0NA 2MEWA 2W9CA 2HNZA 1KOOA 1NO8A 4XDDA 1LQ9A 1VLOA 2KYXA 4ZJOA 4YDDB 2HKEA 5KFCA 5C25A 3OVSA 5JVGQ 3DNCA 3MTJA 4IG3A 1FKAF 4KTQA 1U8WA 5FIIA 3OW2R 2ZKTA 3R7BB 3G6YA 3GV5B 1GT8A 3MPUB 1PG5B 1PKUA 3SFUA 1SL1A 1RTDA 2CJQA 1NPKA 1VC5A 3AXMA 3PJWA 1NPPA 1TVRB 3HFZB 2U2FA 2VQEF 4PXCA 4MH8A 4DCJB 3AJDA 1UWAA 3DYAB 1RTZA 3AD8C 2FJVA 2OPSA 5JJBA 5HO4A 1X9MA 4A4JA 1S9EB 1HHSA 2Z8QA 2EFVA 5AXLA 5IXUA 1MN9A 3NBPB 5A2QU 3OHBA 2YKMB 3KKFA 2L08A 3IFEA 3G6ES 1QSLA 1VQPS 2DGOA 3EDRB 4K0KJ 4C48A 4C3KA 3OLBA 5ADZA 2ROGA 4EYIB 2HG4A 3D67A 1T9XA 1MU2A 4DR7F 5T14A 4NPOA 4G1QA 2HFVA 2HSEB 4LIWA 4ZVHA 2NCKL 4ANDA 4QYZK 2W7OA 2BOAA 2GCFA 2V4JA 2NUHA 1GTHA 4CLUA 4DSLA 3HKZD 2DNYA 4DWIA 5IC4B 4Z37A 4P10A 2ZVIA 3OLAA 3BQ1A 1QVGR 3B78A 3I32A 3D0HE 2R4FA 2W4PA 1JMTA 6FD1A 1DTTB 2R7OA 4F0MA 4DV0J 1AFJA 3T6JA 4HDGA 3QATA 4DV3F 1Z2ZA 1NJYA 2YXLA 2V5HG 3RBZA 2XULA 3IBFB 4P7TA 5ETKA 3DRRB 2ATLA 1WG5A 1JKHA 2VKRA 1N8RT 4CZCA 3TZXA 1S0MA 3IM9A 3DOMB 5GAGI 3JAMU 4ILMA 2JSXA 4UQGA 3PDNA 3MURP 2AJ0A 2C3UA 4EFAC 4LRBA 3MECB 5T41A 5HP1B 2R8HA 1TL1A 4C98A 3PV8A 4XPEA 4P7VA 4TY9A 3EVMA 5GADI 2CVEA 2RRBA 3PIOQ 2E5IA 5C7PA 2CZ4A 2QA1A 2YNFA 3GV7B 3RB4A 2YPYA 2ZUAA 3CIZA 4NWBA 4DEZA 5HMXA 4RBVA 3MUTP 3JQMA 3NOGA 1N5YA 3F44A 5KFDA 1I6JA 2V8GA 1S72S 4DOZA 1FCAA 3ENWA 5A0YA 1S6QB 5K8MA 2E9ZA 2O5DA 1VISA 3AFGA 4ZA1A 1PJ5A 3BV8A 1HI0P 2HWIA 4NASA 2EFOA 1NJWA 2IDLA 4IFYB 3WC2A 2HHSA 2Z0GA 3CD6S 4RL1A 2Y3YA 1RAJA 1H98A 2OO4A 3I55S 3KMQA 2BE2B 3CB4A 2ZOGA 3DDIA 1BQMA 3I87A 4MJKA 4PEOA 4ES2A 1WKLA 2GMLA 3PEHA 4USWA 3T1HF 4IR1A 3K8VA 2AQ4A 4AD6A 2R7SA 1HNXJ 1HD0A 4WIQA 4ZVTB 3OL9A 2GMJA 3IWXA 1IUJA 3N0VA 4OMFG 4QU6A 1FNXH 3KDOA 1AROP 4DV7F 5LMUJ 2P5VA 1RT3A 5EWFA 2R7VA 3R2CJ 3TJAA 3EGVA 4NCAA 3PXGa 3VTIA 1XBWA 4PUOA 2A6OA 4P71A 3SQGA 1RLCL 2KJWA 4XDCA 1FRKA 3CJ4A 1CPZA 3ZZPA 4LRAA 7AT1B 5AXMA 1NZ8A 2PA3A 2V34A 3VZHA 3MEEA 1LW2A 2FB0A 3K5OA 4CTAA 5B09A 2LQBA 3OFEA 4KC5A 4ED8A 2BM1A 4DR6J 4MKBA 4DSKA 4M5KA 1BC6A 2WOMB 2Y0BB 3C6UA 4LF8J 4DU7A 1JLQB 4C97A 4B3TJ 1T9YA 4LMZA 1D09B 4I7FA 3IA0A 1HNWJ 5CQGA 3ZTQA 3C16A 2WONB 1C4CA 4KAIA 3FZBA 4QU7A 4H4MB 2DH9A 2HAFA 4WU2A 2I6WA 2OMOA 1I5OB 5KFHA 1WF2A 4R5PB 1U25A 1YK9A 1NHVA 3TA0A 3Q2SC 1I51B 2ZH1A 4UOHA 2V8PA 2V8VA 4J9MA 3HLUA 3M32B 4RX6A 2UUAJ 1X4AA 3MM7B 3EWGA 4DJBA 5D6GA 2DXDA 1K8AT 3L95X 4BC7A 4PYAA 1RUSA 1N36J 5MAOA 1T9WA 3VAGA 3DFEA 1V9OA 5JUMA 4X64F 3VAKA 1E6YB 3L7PA 2V2ZA 5AJ3F 2ZJRQ 4ECUA 3OQ2A 1Y9OA 5J2NB 1R27B 1VJQA 3A8JA 5DZ6A 4UZBA 2QN6B 3ET6B 3AXKA 1HW8A 2RF2B 2RS2A 3CO9A 1VBZA 4K2JA 4BWMA 1HBUB 2Z2YB 4NMLA 5HQ8A 1O6XA 3O5TB 3K59A 3OFHA 1R8AA 2IVYA 3CSKA 2WBRA 3DGPB 4QZVB 4R25A 5HATA 3V2UC 4UOGA 3TZZA 1JLEB 3VGSA 1RWPB 1SIWB 1TUVA 1D3WA 2Q1LA 2BE9B 4H4KC 4Q2LA 4GVBA 1VLYA 5FLXU 1N36F 1IKWB 2V68A 4DR1J 3SI8A 3HF5A 2CJKA 2GZOA 1Q7YT 2CJ9A 3RGIA 1V5VA 1HWIA 2CQBA 2EG2A 4U96A 2LXIA 2YNGA 3N6LA 1S1TA 2JX2A 5CCLA 1VYAA 2VZ9A 2CJAA 4KFBB 3W64A 5DDQC 4A8FA 4JI2J 1RSCA 4K5RA 2LQ5A 1S12A 2MZJA 3ILIA 1U1QA 3QIPA 2XY6A 4LFCJ 1Q5VA 5D0EA 2DGXA 1GFWB 3MAAB 2NQPA 2EPIA 1CJTB 4I6WA 2HNDA 1RTIA 3LAMA 3TI0A 4Q5VA 3R1LA 3DXBA 3SCKE 3W63A 3CCES 1EETB 2DGVA 4TY8B 3KLFA 2XLIA 1SJQA 1U1RA 2W8LA 2OGUA 4YHHF 1PSDA 1UKUA 1SH0A 5MLCV 4HH0A 4YEAA 4F3MA 2XO7A 1NDLA 1SH3A 1W26A 4OYIA 1JJ2R 2P6TA 1FWPA 2KM8B 4DX7A 3EJMA 1P9QC 2BJ9A 3O44A 1G2EA 3CUNA 4GRSA 2DNQA 3SCIE 5CA5A 4QYZJ 2JHEA 2MKJA 2XY7A 4IUFA 3JTPA 1U4BA 4N41A 2VPYB 1N88A 2KU7A 3ITHB 4ES3A 2HHWA 1V3SA 3W61A 3BKUA 5CYMA 4PABA 5FLXY 2UXDJ 2YKMA 4FNIA 4RWXA 4URQU 4IH6A 3CDWA 3EPIA 1VMBA 2QYGA 2A1BA 3L9ZA 3IN5A 3S01A 2WB4A 1TK5A 1IR0A 3L7UA 2HZCA 3QRRA 3DOKA 3AAWB 1RT5B 1PYSB 5D4PA 2FY8A 1RAAB 2DNGA 4EBCA 3P4UB 1TZ0A 3TZWA 1YJTA 1YRTA 4LSNB 3VAIA 2KXFA 4Y6IA 3I0SA 2NXNA 1JLCB 2QE5A 1FI4A 2F4VJ 4FYWB 4O0IA 3GP9A 2I9SA 3SIPB 4OLOA 3T9NA 1S10A 2VH7A 3DHXA 2W7PA 1JJ4A 4WK1A 1X4BA 5KFOA 3W2WB 4TY8A 3KLFB 1DTTA 2DNLA 3RYLA 4DV5F 1SKRA 1U6ZA 3FGVA 3M8SA 2HVIA 2KXNB 3Q8UA 4NA3A 2EK6A 1AA1B 1N5SA 2UU9J 2YX4A 4YB5A 4C11A 1SQEA 1WHWA 5B0EA 3Q23A 1TMJA 1UETA 1RWUA 3DLGB 3MMCB 4ED0A 3OJSA 1RCXB 4U7CA 2VG7A 3FMWA 4LT6A 1RJJA 1XMOF 3GTYX 3I4HX 4WXWA 1RAIB 1WKKA 3I0RB 3CCVS 5HMWA 3FCVA 2B6AB 3GU0A 3MM5B 5CYMB 4ZMMA 3MPYA 5F8LA 2DNPA 5EX0A 4NCGA 3MOZA 1T03A 3LW5C 4OHZA 1MMDA 3SCJE 5DETA 1QSYA 4CLLA 3MZIA 3CJKB 4CO2A 5HMYA 4DL0C 2HK2A 1UPMB 2XMVA 3D1QA 5E3AA 4ZHRB 1ROFA 4WYWA 1ZS6A 4ECRA 3TEGA 1HMVA 3CC4S 4FNHA 3CMES 4F02A 3VGUA 3DRPB 5KG4A 4F7VA 1NK8A 2W9BB 2BJ1A 5E41A 1N4LA 1HBMA 2UUCJ 1B7FA 3J81Y 3MM8A 2LA4A 3VCDA 3I9V9 2DXFA 1UL3A 3I9ZA 2VV5A 3W2WA 2MGZB 4F2RA 4U7UD 2F5GA 3IS9A 3FQKA 3MPVA 3IG1A 2IYGA 1WHVA 4KY3A 4OIXA 2UVRA 3HHDA 3MMCA 4ZCMA 2NUUG 3ZZRA 4KYZA 3H25A 1CJKA 5A8RB 1ZTTA 3QT5A 1UMJA 4OYXA 5KG1A 3KWMA 3UVJB 2DB1A 2OHDA 1OMSA 4P2MA 1KQKA 1AFIA 4PXEA 2CQCA 2HAIA 1SB6A 2KHDA 2NXEA 3FBBA 3OR2B 2RMLA 2DO0A 2UZAA 2BDPA 5F8NA 2GVDB 3NS5A 2J7WA 3CJKA 2RUGA 3CXCR 4NLWA 3J7AN 4N5SA 1C0UB 4H4KA 4DQQA 1B0TA 4CO5A 5DDOC 2E1CA 1TL3B 2KG0A 1HMVB 1WWHA 2XSFA 4IFVA 4J9VA 2ILYA 4B9NA 2XO6A 1EQMA 1M5KC 2Q79A 4U8VA 4GKJF 2ZD1A 3H98A 2UU9F 2AYGA 1R0AA 4CTAB 4YR3A 2HHHJ 1HBNB 2HQFA 1GTEA 4O3OA 3ZO7A 1U24A 2J6UA 3Q83A 3OHAA 3NGTA 1X5PA 3MEGB 3ZZTA 4DUYF 4ZK7M 4CNYA 1XR5A 4F4XA 3MMBB 3SCLE 4ECXA 4JOUA 4NOHA 3AOCA 1LW0A 4PPZA 2CQDA 2WONA 3RBDA 5E33A 1VK8A 1B0VA 1W25A 2XZWA 4KE5A 2BBEA 4B3OA 2P8IA 4MIAA 1DY3A 1IM4A 2V67A 1R8PA 1I3OB 4B02A 1GX5A 3DGVA 1NLKL 5A8WB 2JLGA 1VQ6S 2X1AA 1SKUB 4HHUA 2C3YA 5IFMA 4DR5J 3BBCA 2YWGA 3LALA 1OYEA 1Q86T 3OSNA 4A8KA 1ULRA 1FXDA 3PR4A 3W3SA 2C22A 3N5FA 2QLWA 2KT2A 3UDEA 4NLSA 1E6VB 2CVIA 4NLTA 5AT1B 1JJCB 1TL4A 2HZAA 4D3HA 1AYEA 1MROB 4KQZA 2AZ3A 1MNEA 5KT2A 2B5JB 3RJMB 1G1XA 2WSCC 4M5DB 3F41A 3QGHA 1T0TV 2QFJA 3FC9A 4DR1F 1VQ4S 2BQUA 3KLHA 1M5HA 2LVWA 1YTYA 4RWWA 2IM1A 2XMKA 3QZ7A 4NXMF 1X7VA 1R7IA 2HNYA 3GSIA 3IP0A 4NMXA 5CZVA 4JV0A 1QSSA 1FKPA 1NHKL 1ZA1B 1FTCA 4MYUA 2PE8A 2YNGB 2CXEA 4RO0A 2KT5A 3PHEA 3A1YG 2J0QD 4I67A 3HFKA 3JYTA 4DSEA 2AX0A 1RHMB 3QIPB 4JP8A 2FJEB 3BBBA 1H2TZ 3DLEA 3K57A 1LK7A 5H9EJ 1VC6A 4FS1A 2DH8A 2HNDB 1CBKA 4R8UA 2JRSA 2DHXA 2EK1A 2HVDA 3C2PA 1CJVB 1TUGB 5F0UA 2PI4A 3RTVA 1S6PB 2AJ1A 2ZZTA 1TU0B 3K17A 3A12A 2C2OB 3TRGA 1EIYB 2BXJA 3JS9A 3M8YA 5DS7A 1QDUB 4KO0B 4ETZA 2CPIA 2RQKA 3LOUA 3KJQB 1KLMB 2FHJD 2LP4A 3BDPA 2ZZNA 4F4WA 4YHHJ 3OTCA 2F40A 3WBZA 4Q43A 1VQ5S 1S4FA 4P6QA 5C42A 1C0TA 2BABA 2ZBPA 1RBLA 2KRBA 2MY7A 1JJHA 1T9VA 2X1GA 1FK9B 4DL5A 2R7QA 4ID5B 2QL5B 4USJC 5D3GA 2VIHA 2C3MA 2E9RX 3OV7A 1J5EF 5D0HA 2UUBF 4U9RA 4DV6J 1EJ7L 3DOKB 5D4NA 2MKIA 4RW8A 4YN3B 2GFFA 1WDDA 3M2UB 5B0FA 1HD1A 2OEJA 5DO2A 4X66F 2FLLA 1SC3B 3DLEB 3E51A 2DGQA 4DSFA 2YWWA 4DL3A 1FTRA 1NK4A 1SJ4P 3V6DA 1S1XB 2V2VA 4O4RA 4R8UB 5G0RA 4FYYB 4LRCA 1S0OA 4ZJLA 5HVFA 2YPZA 3CDUA 3DI6B 4USMA 2QSWA 4WTOB 1UWBB 1XR6A 1RU1A 2VDIA 3BGLA 2XLKA 4WZQA 5FDLB 4FF3A 2HGLA 3Q8YA 1K73T 5D77A 1X4CA 2GO9A 3LANA 3FMBA 5IV3A 5KFNA 3UCZP 2AYBA 2UVUA 3KMSA 4OI4A 3KJVA 3SV4A 3C15A 2VICA 3RB0A 4M94A 4ZPAA 1BXNA 1NCLA 4L73A 5KFPA 1JLGB 2Z2LA 5DLFA 3SSRA 3AB2B 2DNRA 4HTJA 2OJ3A 3JXOA 3H8YA 4X66J 3BREA 5ETMA 3NP5A 4H54A 5IM0A 1MU2B 3MCSA 4RLEA 1D8YA 2ROEA 2HFOA 3ISZA 1GAOA 5EX3A 4AYBD 2J8SA 1RQ0A 2W4CA 4LF9J 1S6OA 4QBUA 1GMVA 4I69A 3FEXB 1J5EJ 1FJEB 3H2VE 1F9FA 4USTA 1HNVA 4JB8B 3Q8RB 2HMIB 3MECA 3NRBA 4CH1A 4G6VB 4USUA 1GMUA 2LDYA 3GJTB 2E1AA 4TU8A 1MG7A 2JEIA 4HHJA 1APSA 4K5SA 1ITPA 4MKVA 5KFQA 4HLBA 3GR1A 2VJUA 3MOJB 4RW8B 2PIIA 1TKZB 2CQIA 4OZNA 2APOA 4J91A 4PR6A 4P9SA 3UWTA 1HKAA 3AODA 3TYTA 2H5EA 3R5CA 3EZ5A 3H42A 3T1YJ 3V6DB 5L1JA 2MZ1A 2C2EA 3H90A 3HDSA 1BQNB 1U26A 1YVFA 2HEKA 1G7CB 2QL7B 3MM8B 1TKDA 4H4OB 1HHTP 1KLNA 1S1UB 3DOMA 3SXLA 5ETQA 5C25B 2IIHA 1SBRA 2D3UA 5KFFA 2JFDA 3R5DA 2FLOA 2MKCA 3JSBA 3QWUA 4K8RA 5C2GA 3F0NA 1RBAA 1NHUA 2ERRA 1NBEB 1Y0HA 2JL9A 4I4BA 1U09A 1BQMB 3HHKA 1BY9A 2MYFA 3M1VA 3QGPA 4CO0A 4CO3A 3T9ZA 3HMJG 2OKQA 1HR0F 1IBLF 3ISND 4DR3J 2QO3A 3ILLA 3VALA 5KFGA 3CW2C 3D0IE 1M0SA 1RWMB 3LPEA 3B4DA 4TN2A 2M3DA 1T11A 1VCTA 2KHCA 2MKKA 2DRAA 3W7BA 3AJ2A 2D1CA 1TK0A 2MSSA 5E3PA 3A8KA 4OJ1A 2HHUA 3JSRA 2AD9A 3AQOA 3QQCD 5D15A 5IT9U 1OO0B 4G1QB 1FESA 2DEJA 4Q7AA 2XI3A 1NDPA 2QJ3A 4C6AA 2ZM6J 1IJEB 4IO9Q 1KQFB 4DL4A 5JVHQ 4O3QA 3H20A 1UVMA 2E66A 5CCMA 5KFJA 1R0AB 2KTQA 5GAHU 1LW2B 5KT7A 3CJ5A 2ZE2B 4ZVFA 5B0GA 5FD1A 1T02A 2ABYA 3ILOA 4KHRA 1XIQA 2WW8A 3HVWA 2HRYA 4ER8A 4AXJA 4BC9A 5HLFB 2H9ZA 2DIUA 3T5JA 2N82B 2XQCA 4JI8F 3D6FB 5CD4H 1XC9A 1HWJA 2L3MA 3KK3A 5KFZA 1RYRA 2E7VA 1B4SA 3AHPA 2HVZA 4I64A 1XTZA 5DGBA 3TARA 3QJLA 3UW1A 1EHWA 3ZTSA 4WP9A 2CZVC 4IKAA 3ZZYA 2U1AA 1VQNS 3DOLB 1RWVB 3I96A 3NS7B 2OELA 3QO9B 1JLBA 4WJBA 3TEHB 1B70B 3BN4A 2GC8A 3AT1B 1KTVA 1U2RA 1Y5LB 4RW4A 1SQGA 1U6BA 4YOEA 2AX1A 3KLIB 1OWXA 2MQMA 1J5OB 1E6YA 3CC7S 1WACA 2OD6A 1E6VA 1U2FA 5IS2A 4IQXA 2XYGB 2HHQA 4X4TA 3BSAA 4CM0A 3KXDA 3IR7B 3BSNA 1XMQJ 2Y1RI 1EP4B 2YH0A 3TUJC 5J1PA 3EPGA 4FXDA 1N5VA 1S99A 1VQSA 1OIAA 1MLAA 2DR6A 3EGNA 2ZBCA 4LRDA 2DBBA 2Y1IA 3PG9A 3OVAA 1DFDA 1NEEA 5ETLA 4F0HA 2GVZB 4Z2XA 1EX8A 2XYHB 5B0DA 4R5PA 2BR0A 1XQIA 1Q78A 2IFXA 3X3UA 1L5UA 2VU5A 2H3EB 4NRUA 1FXLA 2OAUA 1D1UA 4XO0A 2RKIB 4ZVPB 4CLPA 2XGPA 2GMHA 5K9FA 3OBIA 1A7GE 5T7LA 1JK9B 1NKCA 2YNHA 1X0PA 2PMWA 4PWWA 2W2OP 5D78A 4A8OA 4O23A 4F4KA 3D6TB 3D28A 3WIUA 7FD1A 1VRUB 2OUGA 1XMOJ 2CJBA 2IDEA 5JMNA 2DKOB 4LBIA 4B9SA 2HBYB 3R7NB 3AH6A 3A3NB 3QT8A 2EI5A 3QSIA 1YJVA 3R3TA 4NEZA 1GNKA 5B08A 2UVVA 4X4PA 3MAAA 3DLHA 3NMRA 3AOBA 1IKYB 5BYRA 3VVTA 3NKYA 3RBEA 2FYXA 4JYAJ 3E01A 2AEJA 1S6PA 1P27B 2R7XA 2H1YA 4GO5X 4LFBF 5I3UB 2OPPB 1U48A 4FYVB 4NRTA 5L9XA 4PWDA 2H4WB 3I82A 4TYBA 4W92B 2ZH5A 2QMUB 4IO1A 2QLBB 4KBIA 4MIBA 1SJ3P 4D3GA 4URGA 2D7SA 3RRHA 1FXRA 2GVZA 4HACB 4ZN3A 4KJIA 4AE5A 4XIUA 2N3LA 4ED4A 4U95A 4CO1A 1P1LA 1F0XA 4V19J 4YMEA 2C2ZB 5K8NA 5GAHI 4P2XA 1UCNA 5T7LB 2CKWA 3P3DA 4NE9C 3SEOA 2JJ4D 3M8WA 2AZ1A 2QLXA 3UI3A 4DDFA 1N34F 4KR0B 4JI3F 2ZZMA 2J5AA 1GXTA 2IMWP 2JH3A 2UUAF 2XS5A 2CPDA 4ZVQB 1QAJA 1HI1A 1FDBA 1Y00A 3J80U 3GIIA 3UDCA 4ZLJA 1GXUA 1X5OA 4OV1A 4GC7A 1HNZF 2VPZB 1VIXA 3MM6B 4PG5A 1RWKB 2EFNA 3N01A 4NI2A 3PJXA 3IRXA 3MEDA 3IGNA 4CYUA 2YH1A 1MWYA 1NAQA 1VFJA 1M5VC 2J7KA 1F2HA 1QUPA 1C2PA 1R6VA 1JLFB 1TAUA 2M70A 2JEGA 1O51A 4L74A 4OX9J 3PKMA 5J1EB 2KN4A 3G2XA 2MPUA 1WI8A 2DK2A 3JTOA 2KKHA 1K1QA 3UPFA 3CD0A 1ZH5A 2N7YA 4FKXA 2BJDA 1S9GB 4WPAA 4A47A 4C9DA 4JI8J 3W65A 2ZOMA 2HHVA 3CEDA 1TV6A 4J9PA 4GMKA 2V50A 3C15B 3MCNA 1HR0J 3LP2A 2W8KA 1VBXA 3UFCX 3MR3A 3C66A 2XS7A 2PD1A 2ZDOA 1S59A 2XMMA 3V81A 2J9CA 1DQ8A 1MN7A 2EVZA 3BGRA 4KPYA 5KFTA 4UUXA 4F4AA 3HK2A 1NRKA 2F65A 1S1WB 4NLPA 1YBAA 3I0SB 5GVQA 3TAQA 4HEA9 5I42A 4EZ6A 5DQHA 4F0KA 3NNCA 3QLHB 2IM3A 3F56A 4TQRA 1R43A 4JV5J 1H2VZ 3TAPA 1O0PA 3N6MA 3UCUP 1NPRA 5HVHA 3T1YF 2VQFJ 4JV2A 2UXCF 2H51B 1I1GA 2LQ8A 4Y34A 3PO5A 1WELA 3GJQB 4Y3CA 1UZDA 3NY0A 3WDOA 4ECYA 5DM7Q 2HW3A 3QT7A 4TNOA 3D1OA 3MR5A 2UUBJ 3GIRA 3DKDA 1EETA 4I6AA 1KWMA 1LXNA 3PYFA 2CPZA 3J81j 2I2YA 2VB6A 3IS9B 4QWBA 3BO4A 1TV6B 2ASYA 2CRLA 2MZQA 2VFUA 2ZH2A 3CCSS 1R0CB 4NYZA 3P6YC 4DV1J 4UY85 4OHXA 1ZYQA 1XJWB 2CPJA 2G0IA 1JKHB 1RACB 4F3OA 4ETXA 2YX7A 2LDIA 5ETOA 2MLZA 2PDAA 4NLUA 3PRVA 3JSMA 4OJHA 2F9DA 4W90B 4ZP7A 1TKXA 3JQJA 3MPDA 2FZGB 2FZCB 4JI6F 4DR2F 3KG1A 3DCAA 3LGNA 4AFFA 1T9TA 3NWRA 2DY1A 1HIYA 4NEYA 5IQ6A 3L09A 3HVRA 3TX0A 1QLNA 2P6SA 3CPWR 3HVAA 3Q8VA 2WAQD 4DZDA 1FD2A 4CT8A 3OTEA 3V4IB 1TL3A 4NA2A 4P52A 3J81U 1VQOS 3MXHP 1U02A 4X84A 5EGYA 3M8RA 3K2YA 2GIQA 2KO1A 2GHVC 3OR1B 1U7LA 5HANA 1KVIA 1MSWD 3ZNJ1 2CPFA 1RWOB 4NLQA 1UW4A 5A0YB 2BQRA 1KSPA 2E44A 1R3NA 4GVLA 2BW2A 4ZVRB 3TZYA 1Q81T 1BE4A 4ELUA 2RDIA 2HURA 4WFZA 2O66A 3ZZ0A 3M9NB 1HNXF 3MFHA 1CEZA 2IYIA 1Q82T 4NLGA 4X62J 3IC1A 2R7WA 2KM8C 4LBPA 2BE2A 1S1VA 5L8RC 4WZMA 2QYCA 3FBEA 2ADCA 4DG1A 2CQ4A 1LK5A 3W9JA 4BWJA 3THTA 3FFIA 1BQXA 3FCWA 2VKZG 3VWSA 2L9DA 3HM9A 1GMWA 2V2KA 2VFTA 3OXGA 5EWEA 4HHHA 2E1RA 3M30A 1ZPVA 1NK6A 2XMUA 2GJ2A 3CWJA 1NM2A 1RAGB 2HWTA 4KGVB 2RRAA 2ZC4A 1T03B 1UJ6A 2DNZA 3NXZA 4LF6J 5KFXA 2K1RA 2DNHA 2CYYA 1LFWA 2IJNA 3HHLD 1C1CA 4B9TA 4PUOB 2R8IA 2BKPA 3L4BC 3BKTA 1GMWD 1Y5IB 2LLZA 3JAMY 3RB6A 2DR5A 4HR2A 2K06A 2CQ0A 1DZ5A 3FRZA 2ZJPQ 1VK3A 4FKYA 4ICLA 2V94A 1UEUA 2NXJA 2MDAA 1O5JA 3MCOA 1KVKA 3MEEB 3BYPA 2M2BA 2RILA 4ANCA 5GAGU 4N56A 1VBYA 2E5LJ 2E1MC 1AT1B 2MGZA 2J6TA 2WOMA 2VA2A 1Q8BA 1LWFA 3EVWA 3IGVA 3DRYA 3UN3A 4ZKAA 2NXUA 2AF6A 2R2RA 3N6NA 4LFAF 3C16B 2QZ8A 2NREA 3H40A 2CA9A 2MMYA 2ZH6A 3M8QA 4E98A 4ZPWR 2W4DA 1YJUA 3WX4A 2B7CB 2E7WA 1HL6A 2HVEA 2G13A 2OLWA 2Z4PA 5A8RA 4ES1A 3DRXA 1IKVB 9RUBA 4JI4J 3HHLC 1CC8A 1IKXA 3KUHA 4JBCA 4RW6A 4Q45A 2ASDA 1Y4ZB 3VQTA 3CCJS 2FTRA 5KG3A 1LWXA 5IT9Y 3MMAB 4J9KA 4B3MJ 4DU8A 2XYPB 2B9YA 4O4GB 1IKYA 5CXTA 3M7VA 1U1MA 2H5IB 2I5JA 4NLVA 4LF6F 4OI1A 2BJ8A 2RDDA 2WSEC 5A6WA 2CG4A 2Z56B 5KFMA 1OQ6A 1W7WA 2VFVA 1KQSR 4B9LA 3BPDA 4J7CA 1KC8T 4BLGA 3E2EA 1FKPB 4DXLA 4ZP6A 2UXDF 3TOQA 1EZZB 1VI7A 2E5JA 5AXNA 2FQQB 3W2VA 2JLEA 1WI6A 2ZH4A 3LPYA 2HRTA 4M5NA 1HBNA 2VUGA 1ZAXA 2PSZA 3MR7A 5LT5A 2PMZD 3CCTA 2VFRA 1A0OB 4RPFA 1LWFB 2GX8A 4X62F 2L9NA 3FRYA 4DR2J 1WKJA 2KL8A 3BSCA 3PZPA 3QFWA 1IKWA 2MSTA 2HS4A 1RK8A 2MQOA 3GYXB 4Y2KA 3R1HA 4ID5A 3NGSA 1HPZA 4O44B 2GNKA 3DLKB 2DITA 2VQEJ 2YQ3A 2HVHA 3TAMB 5LSRA 4RW7B 4KFBA 5E3QA 4EK2A 1RKIA 4CYUB 1ZM4A 2QFIA 3HSDA 4Q2MA 3H4DA 4C3LA 2Y9HA 4XPCA 1DURA 4CLKA 1FJ7A 3V6KA 4KGMA 4N8OA 3MMAA 4UQTA 4HDHA 4PAAA 4WXOA 6FDRA 1NKBA 5L9NA 3POTB 1CJTA 5H1SV 5L1KA 3LGHA 1SL0A 2R8KA 3J7A1 5J1NA 2CJYB 2YWKA 3FDSA 4DUZJ 1OY9A 2W2MP 3NCPA 4A8MP 3CTRA 4ZPCA 1BMQB 3R9LA 2V69A 4OYOA 5E5NA 5DGAA 2AHOB 4MK8A 2OSQA 1C4AA 3GFXA 3OTOF 2MHEA 4K4YA 2OPQA 4LQ9A 4X4OA 4NYPA 4MMOA 2B5JA 4DV7J 3PW2A 3CF5Q 2Q66A 2CWKA 3KTQA 3UNYA 3TNVA 2M52A 5BYQA 3D6HB 2IAJB 2J0XA 3ISNC 4N77A 2FJDB 2BANB 2PC6A 2ZC3A 3TUIC 3W8PA 6AT1B 2MZSA 3ITHA 4M1KA 5D4OA 1IR2A 5F0WA 4ZITA 3LWLA 2ZJQQ 4F4ZA 2HFSA 2D3O1 1Q7LB 2HFZA 2FJXA 3UN5A 1S1XA 2UV8G 4WE1B 3RB3A 4I68A 1RKJA 4IG0A 4O44A 2XCAA 1VQKS 4JV1A 1T94A 2MJUA 2P9GA 1DQAA 4F50A 5F8JA 1D9AA 4N76A 3IWNC 4OZ3A 4K4VA 1S97A 4LF9F 5FDLA 1F6TA 4TKTA 1FDNA 1P6TA 3UO0A 1ZM2A 3B8HA 2UUWA 4UW2A 1IWAA 2E5GA 2HQIA 4WTYA 4NLOA 4C3MA 2VG6B 3R2DJ 2GHWA 2GAHC 4JYAF 2C28A 1J2VA 4YB6A 3PFEA 1WG4A 1QD1A 3H5YA 2MQLA 4H4OA 4YP3A 1PCAA 3AB4B 2JNJA 2R2SA 2AGQA 2YX1A 3LTOA 1CVJA 4OHYA 3P8BB 1F3FA 2A3JA 3KNAA 4IOCQ 2Q6CA 1C1BB 2C3OA 2L48A 4IYQA 2YKNA 1ZAVA 3TA2A 5KOWA 5DDRC 3CCQS 1KLMA 1YGYA 2MQ8A 1X4EA 4NA1A 2HLTA 3FEYB 3HFVA 1P9YA 2VG7B 2RU3A 2ZH9A 1HQEA 2BANA 2NYHA 1R8HA 3ZZUA 3P45B 3PYDA 1C0TB 3IR6B 2OD4A 4DV6F 4DUTA 5KFSA 2Z2ZA 3ICLA 4WE1A 3TVKA 2PMHA 4FXWA 5LJ3Y 3OSPA 2EFPA 1BQNA 2VFSA 4MFBB 5SZTA 4DSIA 1FERA 2X51A 1F3VA 3IBWA 2X1FA 2AKWB 2RJZA 3A4TA 4OZLA 1KFSA 3EICA 4OV6A 1UJ4A 2EXUA 2IMOA 1WORA 2RHQB 3RRGA 1G3OA 4PG7A 3MR2A 4ZHRA 4ZOSA 5L39A 4RUBA 3GIKA 2ALYB 2DY9A 1WTFA 3SDEA 1MMLA 4RU2A 3C6TA 2C2KB 4V1Ak 2J8AA 4JI0J 1UFLA 3QRPA 5KAKA 5IC6B 1Y10A 4O3SA 2GGPB 2RSQA 3MDFA 2J0WA 4CRJA 4RZRA 2V4RA 2JEFA 1UP1A 3RW6A 2YKPA 2O1PA 4IG3B 2HQ3A 2RQ4A 5ETVA 1WF1A 4DX6A 3EYZA 2M8DB 3CCRS 2W7AA 1UVIA 4ED6A 4P74A 1CQNA 4LFAJ 1KFDA 1XNQJ 2DHSA 4FS2A 4LVNP 1CS4B 2FD2A 5KG0A 1TVRA 3AOAA 4DG1B 1WC3A 1OYDA 4M5IA 2IRYA 4DV3J 2R7UA 3UN2A 4FPIA 1SJRA 5A8KB 2MKYA 3BYRA 2JDJA 3KUEA 2QT7A 2AJFE 1VR6A 1KTQA 1WC6A 5DRKA 3TQEA 3JSYA 3FSXA 5GMKa 2G2ZA 2J9DE 4CI0B 3OD2A 1WOPA 4XK8C 4DHVA 1OS5A 4MIWA 4Y2CA 5A2QY 1FX4A 1RAHB 1VGYA 1K1SA 1TAQA 2ATCB 2PGCA 2QG9B 2ZE2A 4ITSA 4LR9A 4LSZB 4ZJQA 3VAMA 4I2PA 1DLOB 2PO4A 4P2SA 3DRSA 1YIJS 1N33J 2HIQA 4WFAQ 3PX6A 5IZHA 1KN6A 3P5TL 2YTCA 2RQCA 2CNNB 3CCZA 4FPRA 2FLPA 4W4MA 4N8NA 2VJVA 4F36A 2IC3B 3B6BA 2HHPA 2C2RA 2RB7A 2SXLA 3HSJA 4MK7A 4QWCA 3LO3A 5I4MA 1LV5A 3DOLA 3M6XA 1HARA 1LFPA 1TP7A 2C2NA 2G9OA 2VD3A 3HHEA 3EDQB 5K8OA 3NAHA 5KFWA 3BDEA 3VAJA 1NDCA 1U8SA 1VDHA 3LGMA 1N48A 3I5CA 4Y65A 4RNOA 2DGUA 4A8SA 1FRIA 2POKA 2VC0A 2MXYA 4JI5J 1UVKA 2JZ5A 3M05A 2DCLA 1F60B 2J76E 3CE8A 1SUQA 3LP1B 4R0EA 3TVZA 5A8KA 4DQIA 1VRTB 4PQUB 2HHXA 2JOQA 3MTKA 3M6VA 2VBWA 2FHMA 1BGXT 2IBOA 4FVMA 2GQQA 4NXNF 8RUCA 4DV4J 1T05B 3CMAS 3ZFVA 4OHWA 5LSOA 2FC9A 4FF1A 4RNNA 2DRBA 4DV2J 4OJ3A 5C5JA 2RKIA 1F2GA 1ICEB 5HROA 1H7WA 4WU3A 5I3UA 3PYEA 4C0HA 5K14B 4OI0A 1DAXA 2WVDA 3BZQA 2XZDB 1FFSB 2C2MB 5F3TA 3W2VB 3VF0B 4IDKA 2DYAA 3ZZZA 1H2UX 2IJFA 5HSPA 2OPRA 4B3RF 4G1PA 3KLGA 2BEFA 3Q22A 1VC0A 3N9UC 1S6QA 3QJJA 1UEVA 3BS9A 2DISA 3D3BJ 3M32A 3KUGA 3HJFA 2N3OA 4OYMA 8ATCB 3NGRA 1CULA 3MAHA 2IJRA 1RT2B 4O3NA 4MYTA 4DV1F 2QA2A 3TJ9A 3NGKA 2HNZB 2GV1A 2RRNA 2WHOA 1RWNB 3E01B 3NEKA 5KFIA 1W2BR 4C0BA 2ACYA 2AJ4A 4BCAA 5F8MA 2M9KA 1H38A 3NCQA 2K2PA 3KHLA 2CNOB 4USHA 1QJHA 3D54A 3D2WA 1SV5A 2BACA 3QO9A 1SL2A 2RH3A 3Q8SB 3GYNA 2B43A 2FLNA 3HD2A 2V9KA 4HACA 2BA9A 4EO8A 2BJEA 3VHQA 2R7RA 1YITS 2HS3A 3KLEB 1U47A 3C46A 2QGFB 2KB2A 3HULA 1T95A 4C8YA 4GVBB 1X31C 2J9DA 3NLCA 5E0OA 4C8MA 4ECSA 2CJXB 5K14A 3UE2A 2AP6A 5DLGA 3P49B 1AUDA 1S76D 2DH7A 3LF0A 2WZ1A 4YQWA 2YWHA 2HRUA 3CD7A 4KSEB 5KFRA 1LKZA 4C8NA 1IVZA 5THWA 3AA8A 1P8GA 2MKSA 2PN6A 1UEKA 3FBFA 2OTJS 4P2FA 4I1TA 4ZVOB 2B4VA 3KHHA 4BHQA 2KT3A 2A0FB 4KRWA 1WDTA 1N0VC 5BR8F 3BH7B 4QYRA 4BBYA 2J9EA 2MQQA 4HL9A 4QPXA 4LBHA 2RT3A 3A8IA 2CQ2A 4IG0B 3GONA 4DQSA 2ZVSA 4JI1F 1LWCA 3M8PB 1FVQA 2MZTA 4RBTA 4B9UA 4M63A 1FVSA 2W1BA 4OX7A 4EO6A 5BR8J 2B0GA 1KP6A 2MQNA 2Y8WA 1IM6A 1M5PC 3BF4A 5D0RA 3OTDA 4GC6A 4DL7A 4PRFA 2PFDA 3UD3P 1HYSB 3HO1A 1K0TA 1RHRB 2HZVA 4TU7A 1ZM3A 2OIHA 3HPOA 4OI2A 4WFNQ 3TUZC 4A8XA 4JI4F 3BQ2A 1YX2A 1RWXB 1RXOB 3IXQA 5C2CA 2PEHA 3E8OA 3MM9B 5IQQA 3R8YA 3T19A 5KFUA 3WHIA 4K4SA 4DLEA 1VS3A 4JI7F 1SCJB 1WD6A 3L7OA 4IQMA 3BO3A 1BWEA 1BLUA 2VBZA 2D3ZA 5KT4A 1SH2A 1NK7A 2LQJA 1V3RA 4PWDB 2M4MA 3CO0P 3BBFA 2OP5A 5IT0A 1OSCA 4CLZA 1IQTA 2YKNB 5I3QA 2ZWPA 3IMQJ 4WWSA 4W98A 1ZTWA 3BGFA 5ETRA 4QPTA 4JI3J 4P73A 4OYBA 3PW7A 2DR8A 3DLBA 4YB7A 1KONA 2KJVA 2DRDA 1YI2S 3ADAC 4QIFA 4F04B 3LA0A 3CD5A 4J9LA 5KFKA 4ZCLA 4Y0FA 5GMEA 4PG6A 1N5TA 1U1NA 2XWYA 4L75A 4J9RA 5LL6d 1UPPA 3D6MB 4IH7A 1LWCB 3M8PA 4M5MA 1FT8A 1RT7B 4CNZA 2K3IA 3KHGA 1FWLA 1PC5A 1T3NA 4NCBA 1RTHB 2RAQA 1TKZA 3RG6A 3RAXA 4JI2F 1WNEA 4KH1B 3IRXB 3KJNB 3MEDB 2UXBJ 5J2QB 4OI3A 1NK5A 2B9XA 4NL5A 2WVEA 2CDQA 4LREA 2IRXA 1NJIT 1PYOB 2BMBA 3D4JA 1M1GA 1KS2A 1RTIB 1ZM9A 1Q53A 2FZKB 1SJFA 1WEZA 3UNGC 5F41A 1N34J 1WEXA 3IM8A 2ZHAA 1X8DA 3C8YA 5ETPA 1RA6A 3IBCB 3JSMB 4TYAA 5KFAA 2H5JB 2MZRA 4KH0B 2LU1A 3U1LA 3NGDA 4DV4F 2F7VA 4LF5F 4RNFA 3GJSB 3OTBA 3NNHA 3DRRA 1X0FA 3TR5A 3NAIA 2RNEA 1VJWA 2ZOFA 2HBQB 3K5LA 2QSFA 3SQGB 3D68A 4JI5F 1TL5A 3V4IA 3CJ0A 3QNWB 1Y3JA 2WBMA 2XM3A 4JV5F 2J0SD 5D4LA 1XK8A 2DTJA 4KGXB 3HD1A 4KHMA 4AT1B 3OR1A 5AE2A 2R2TA 1Q5YA 4DFKA 1R6YA 2KDOA 3BR9A 1QUVA 5DQGA 2MTLA 2RE1A 1NDKA 5CYQB 5IT4A 5B0BA 2LCWA 3LP0A 4FYDA 2K1RB 1FJGF 3TP2A 3ZTOA 1ZZNA 3H5SA 5CHCB 1RA7A 2K7KA 1OJ4A 4NX9A 4DV2F 4ECTA 1WOOA 2CPXA 3MF5A 3VQSA 5J2QA 1QVFR 2QMWA 3GILA 1N5YB 1SVDA 2XHWA 4U67Q 5F9LA 2BZ2A 2GQCA 3OXLA 1SC1B 2IC3A 4ED3A 1JLCA 2ZNYA 2ADBA 2A18A 1S7HA 1NMEB 2HQGA 4QQBA 5ETTA 3M9MB 3QAEA 2FDNA 3CNQP 3PEJA 4K4WA 5B0CA 4LF5J 5KT6A 1R8CA 1PC4A 3N79A 4QR0A 4ZS6A 4AXIA 3R6GB 5EDWA 5KT5A 4O0NA 3PHTA 3OVBA 5AXKA 4OI6A 1EKRA 1KHVA 2DEIA 2I38A 5HBMB 2Y1JA 4IRDA 5M2PA 3J7YU 4LFCF 1UVLA 3PY8A 1ZA2B 2CQ3A 1IKVA 1C0UA 3CGIA 2LQ9A 3HZGA 3OFFA 4E2FB 1D0EA 2AT1B 2B6AA 1RB0A 2FUG9 4ID8A 2QX0A 4RW4B 5F9NA 1S79A 1PYTA 2VPXB 2X3DA 3HVTA 4ERDA 2M88A 3GG0A 4Y2IA 3VV2B 4OYZA 3V6JA 5GAEI 3BPSP 3GWCA 4CLWA 1HNWF 4M5JA 3LP0B 3DLJA 1RP5A 2CQHA 3M6WA 1VQMS 3R27A 3D66A 2XLJA 3KFWX 2BKNA 1I94F 1D9FA 4LF4F 4GKJJ 3GG1A 1UAWA 3BM7A 5D0GA 4DS5A 3D7SB 1EP4A 3KG4A 4DR6F 3UR3C 2XMAA 1YJRA 2H65B 4WKRA 1R8BA 1Q8IA 3T1AA 3IAM9 1HHQA 1JWWA 1FE4A 4FXVA 2BKOA 3SZ2A 2HBZB 1DARA 3GFZA 2CFXA 4MK9A 4B3OB 2KZMA 4ZPDA 2QLJB 3MPWA 4DQRA 1YJWS 2PI5A 3ENAA 3EGWB 2B51A 5CAAA 3AA9A 4DX5A 2ROPA 4NLDA 1L3VA 4DCPB 4YS2A 2P9CA 4WKYA 1VRUA 3ZZOA 4DFJA 1HPZB 1WC1A 2ZH3A 5AE1A 2Y8YA 3FNNA 3TAMA 4WCEQ 1FHTA 1DTQB 5HK4A 1F9EB 4J9NA 2PFFB 3G8TA 1ZAWA 2LKZA 4A48A 2JLFA 3FK4A 2MHNA 1OSDA 4RNMA 1F5BA 3GIJA 4AL5A 1XERA 1RHKB 2BV3A 1Z4UA 4K2XA 4L3KA 4Z7CA 4QWEA 4P72A 1B0PA 4DPOA 2PEBA 4C0OC 4LF7F 4IOAQ 1KVJA 1B7YB 3UCGA 4UZCA 3ET6A 3W1YC 1FDAA 1F5CA 1REGX 3ENVA 1LNQA 5SUHA 1XNRJ 5AJ3J 3I5BA 2NZCA 1X4HA 3FEZA 3BR8A 4IFVB 1RHJB 4ICLB 2GQ2A 2V8DA 4F67A 5EWGA 2BYCA 3DLKA 5H9FK 4OHVA 2DR9A 3DGPA 1PJ7A 4G65A 4RU9A 3X1LB 1GQEA 1FEEA 1HWKA 1SXLA 3M2VB 4J37A 4ECQA 1XNRF 3AD9C 3MEGA 2XB2D 3UDLA 1H7XA 2UV8A 1CG2A 3CIMA 1QAXA 3PCOB 1QE1A 4CO4A 5AE3A 2XC9A 3GR0A 3NCRA 4E0DA 3POTA 1TFWA 2AJ2A 1U6FA 3PRBA 1W2IA 2JFKA 4F26A 1GEHA 3M8QB 4QIWD 2KVQE 4OX8A 4B3RJ 4Q0BB 1CJVA 3CMQA 3N5BA 3WC0A 1DTQA 2XSJB 4Q44A 4OL8A 3JB9k 1HYSA 2HPUA 4DQPA 4RW6B 3ZNUA 3HJVA 4K4ZA 5L1IA 3KOAA 1NB7A 3W62A 1SKWA 2QC3A 4LSLA 4ZVUB 2KH9A 2BJ7A 1IN0A 2ALZA 2HYIB 1GXLA 4I2QA 4FBTA 2OFGX 2P9EA 3T3FA 2R8JA 1IBMF 2F4VF 1X4FA 1RBOB 4X4UA 3I0RA 1Q1KA 2ZDPA 1QTNB 1S9GA 3HT3A 1S7IA 1JNZB 1K47A 4F2SA 5LJ5Y 1R0BG 3M8ZA 3MM5A 1JXEA 1IBMJ 1PAEX 3IRWP 5CABA 4OZ5A 1IBCB 4IRKA 1DHMA 1LEOA 1OPZA 1Y5NB 2NS1B 1FFWB 1YDLA 1UZHA 1S5ZA 5K20B 3K5NA 3QT6A 4YFUA 3JTNA 2XG8A 1S4EA 1HQEB 3VAHA 2OMLA 3I6PA 1RT6A 2CZ9A 4K7QA 1ZPWX 3D5MA 2BE7D 4L3NA 1Q16B 3V5RA 2J6SA 4ZLLA 2VF3A 3K89A 1RGVA 1RT7A 2GJFA 1LWEB 1NXIA 1Q8KA 2GO8A 3ETMA 5F8HA 1HI8A 3B82A 4CH0S 2XSJA 2UUCF 3EZUA 1RT5A 1YG0A 4CH7A 1Q4RA 2N4DA 3JYTB 2O67A 2BX6A 4CLTA 4KHPJ 1JIHA 4UY8T 2YKOA 3U7JA 1O8BA 3IAS9 3ULHA 2B7BB 3GJRB 2RS8A 4LR7A 4OFZA 4ZP8A 3H5XA 3G86A 2COLA 5LSLA 3FSIA 2M5YA 1CJKB 1NH7A 4QW8A 4KIAA 3TQ1A 2R8GA 3DYAA 3JQKA 5DG7A 4LJMA 1QAYA 2IRUA 2KXHA 4L76A 4B08A 1U45A 1M90T 8AT1B 1SJ1A 2G0JA 4DPWA 1RWWB 4MKYA 1IQZA 4KO0A 1RI7A 4C11B 3TJ8A 4DPXA 2DGTA 2MLYA 1MWQA 2FGCA 1RTJB 2RHSB 2FVSA 1XR7A 3MD3A 4HT5A 4C8ZA 4ALZA 3GE9A 1YKWA 3EXCX 1FJGJ 1L3KA 4ZCKA 1DBDA 2VBXA 2EBEA 3NNAA 1FKOB 2R7TA 2ZKUA 2V4JB 2LYVA 3D1HA 4PXBA 3G82A 3ZTPA 5M2RA 5F8IA 3NGUA 2EG1A 4ZPTR 2F1FA 2CNKB 2GGPA 2Q6BA 4QJVA 1ACMB 4QWDA 3KNGA 2A10A 2XY5A 4ECWA 3R5BA 4EUVA 4I2PB 1BUXA 3M2UA 1WEYA 2YBVA 3RAQA 4JI0F 2ILZA 3HT0A 2OSRA 2VG6A 4PPDA 2YNIA 3BGOP 2R2UA 1ELOA 3S8SA 4M95A 3NMAA 2EKNA 2OI2A 1ZZFA 2R42A 3BEGB 2DIVA 2ZNZA 3GYGA 3DI6A 2KG1A 1UWBA 3OPKA 2G2YA 4NXMJ 2GJIA 2I1RA 3KK1B 1WJ9A 3SSSA 1U2CA 3KJVB 4TXSA 5HP1A 3MGJA 4A46A 1G4CA 4AQYJ 1HQUB 3WX8A 5LOQA 4ELTA 1DRZA 2VC1A 3D3CJ 3BN7A 2N4CA 5J2PA 4G1IA 5CYJA 3UVJA 2YNFB 1U0SA 4ZPVR 4G3IA 2EC2A 1SUQB 4YDXA 3A13A 1MWZA 3BB5A 3OJUA 1IWGA 2Z58B 4PWUA 4B3TF 3LAKA 1HNVB 2NR0A 2MKHA 3EGZA 4DFMA 2ASJA 5DG8A 3AY0A 3OR2A 4RW9A 4WFBQ 4F8RA 1OQ3A 3T5HA 4IRCA 5DJBA 2BQ3A 3FCHA 5B7WA 2FJBB 1RADB 1FNOA 2B4PA 2FJAB 1NNDA 5F8GA 5L38A 1X9SA 4Y2MA 3Q8PB 4X4VA 5E3CA 1TL7A 3TA1A 3PO4A 1X5TA 2CQPA 4WFYA 1AZSA 1JLAA 1HBOB 3NWGA 1CQMA 4HT7A 3PKYA 1ZBTA 2E29A 1RLDA 4NZ0A 5LXRA 3QRQA 3W5ZA 4ED1A 2OPRB 3NOCA 2W01A 1Z2LA 4LF2A 2JVOA 3K7RA 2DPIA 4C8LA 2G4BA 1UFKA 1YZ6A 1CULB 1ZETA 2HFUA 3PVXA 3CDEA 2OTLS 4ED2A 1H0HB 1LW0B 4EWTA 4IR9A 4LF8F 4FP9A 1Q0NA 3M2RB 1J5OA 4FF2A 2Y1LB 3CJ8A 5K5MA 2O3DA 1EB0A 4BS2A 2AIRB 3DM2A 3P5BP 4DL2A 1TFYA 3M1VB 3HHLB 2ZFHA 2YQ0A 3GIMA 5H9FJ 5C24A 4DR3F 1SV5B 5ETNA 3DHWC 2LEAA 1FRMA 3US5A 5DDPC 1UA0A 2QMXA 4EMDA 4F4YA 2DHAA 4ZLNA 2JC1A 1N32J 5LM7E 1EQ0A 1KRPA 1DLOA 2M0GB 3C6UB 3OUYB 3H0PA 4OX6A 2FY1A 1VHFA 1TKTA 1V5IB 1MROA 4KKOA 4I7FB 2AYMA 1FK9A 1YWXA 2QIFA 5F3ZA 2QA4S 2RUSA 3CCLS 3SBMA 2ZBQA 4M5DA 3PW4A 1QAIA 4JI6J 2RU9A 3DU5A 4OYWA 5LMNJ 4I6YA 1N54B 4LUBA 4GKKJ 3O6QA 2LEPA 5DG9A 1HA1A 5EHHA 4UOFA 4NYOA 2FHOB 4RJVA 3MM7A 4DZ6A 2AJQA 5GMDA 3GFHA 2KYZA 5HLFA 1A6LA 1IBLJ 3DMJB 5RUBA 1Y3KA 2R9LA 3ZTRA 4WK3A 3ONQA 3SQOP 1IJFB 3UD5A 5J2NA 4RW7A 2DGSA 1XMBA 2WSFC 1KQGB 2C1EB 1WC4A 3RAMA 2OPPA 3LP1A 1FA0A 2RF2A 3K8WA 2BRKA 4ATNA 5C24B 2XHCA 5HQLA 2XNQA 3L3CA 3G87A 3GZ7A 1G6BA 2NYIA 1RT1B 1JLGA 3R6LB 4GO7X 4K4UA 3ZC4A 1T05A 4WF9Q 2G2OA 1S57A 4U6PA 1U0HB 3SYZA 2AWZA 3SFGA 5HMZA 4HH1A 3CDAA 4DSJA 1FRLA 3PW0A 2WVBA 4X4NA 5HROB 1S9EA 2IM0A 2BW7A 1VQ7S 2B8PA
chains in the Genus database with same CATH topology
5KOXA 3Q24A 2HMIA 1SIZA 3NBPA 3LUYA 5D8HB 4DX8H 1FD8A 4EEYA 3H5UA 5BJRA 4WIIA 2XNRA 1R31A 2IAJA 3TANA 1REVA 4KGKA 4KV8A 1VIOA 1RISA 2CPYA 3I31A 3MAQA 1RT6B 1UJ5A 5BYSA 4UY85 3CCWA 1N0UA 1UA1A 2HGNA 2N7CA 2YWEA 3U1MA 2YVSA 1RT2A 5L1LA 3Q0AA 4Y00A 4QCLA 2E5LF 1XN9A 3CJ2A 1JNRB 4OLPA 3MUVP 1VOMA 4J9QA 2K8GA 3WZ0A 4AL7A 2QA4G 2NSBA 2JVRA 4JUZA 4U7UK 3MEKA 3N28A 2IHR1 2EWHA 3LP2B 1NJXA 4LIRA 2DD8S 5A6PA 2HGMA 2V8HA 2VONA 5M2UA 1WTBA 4Y2AA 4B3SF 3QMQA 1B64A 1FF2A 1XMQF 3U02A 4EZ9A 3HX9A 2K7JA 3I5AA 4B17A 4OZ0A 2PT0A 1YJNS 3G4SS 2ZHOA 4UUWA 5KFVA 1FRJA 4ILLA 2BRLA 3D0GE 2EFQA 5EUHA 4KV8B 2M8HA 4MKAA 4B9VA 1NH8A 3CC2S 5IWAF 3O2IA 3RU0A 3EX7B 1FRXA 1URRA 1Y7PA 2ZITA 4F3QA 4YR2A 2I8EA 1RYSA 2W25A 1N56A 1QM9A 3FSYA 3RRKA 4OQJA 2PA8D 4OZ1A 1Z1ZA 1XNQF 2YNIB 5U47A 4ZCIA 2CPHA 3KK3B 3OL8A 4QR2A 2LEBA 4DL6A 4EBEA 2VPWB 1U1LA 3MM9A 4NLXA 2VODA 3UD4P 1S1UA 1TQLA 2KVIA 1S77D 2OPSB 2WTFA 4QIGA 1N6QB 2G1DA 1TKXB 3PACA 3KK1A 1JLBB 4RNHA 4X4RA 5KG2A 3PR5B 2HFNA 1Q8LA 2MJNA 2FPHX 4OZJA 2GIRA 3CDBA 5CYQA 5I3PA 1DJ0A 1VQ9S 4X2BA 3BJYA 1S48A 4EYHB 3V81B 4RUCA 2XEXA 3H2LA 2ASLA 3S7RA 3IR5B 1KOHA 1D8ZA 3VR1A 2VA3A 1S1WA 3T5KA 1FEHA 3DRPA 4CT9A 2DPJA 2XBPA 3HVTB 3MD1A 4TU9A 2W9BA 2DJWA 2AU0A 3UQSA 2FIUA 4N47A 5B0AA 1SC6A 4DN9A 3CT9A 2EC0A 2K3KA 2IVMA 4MAKA 1JLQA 3U27A 3IG1B 2KFNA 2J7UA 4K4XA 2V4QA 1GX6A 2RQMA 4URSA 3QIDA 3S1TA 3PX4A 1U1OA 2ZUGA 1YSJA 5HBMA 2KFYA 1N5QA 4DN0A 4ZVGA 3CCUS 3SV3A 1NZAA 5KFBA 2DNOA 3O8WA 3QWPA 2ZM6F 3G6VA 2QEXS 2AW0A 3C3LA 5EN1A 3FFIB 4NLRA 4FBUA 4IFYA 2VASA 3M30B 3HXMA 4QR1A 2XI2A 5KFYA 2XMTA 2AV5A 3G8QA 3N4WA 5KG6A 2LU2A 3UR0A 3H2UB 2ZBIA 1VQLS 1H6KX 1NU4A 1UVNA 1VRTA 4PQUA 4YUDA 2BVZA 1KD1T 1IXKA 1RT4A 3VZIA 4V19X 2UUTA 2L9WA 1PILA 2QV6A 1ZOTA 3SSQA 4DF4A 1HNIB 2GW8A 4J9SA 4J9OA 5KFLA 3OUYA 4QOTA 1IBKF 3RR8A 3DLLQ 1BD6A 2Y0SD 4PQAA 1TKTB 2KI2A 4KKOB 4QIEA 2HHTA 2KFZA 5KG7A 2IVFB 1M1KT 1KEKA 2I0XA 2E9TA 2LECA 2D3OR 2VOOA 1LXJA 2O01C 3VAIA 3MMJA 4R0JA 4DL5A 1ZTWA 3DU6A 3MM6A 3R5AA 4X4QA 2F8MA 3U1NA 1GH8A 2DT9A 3RZAA 4AUKA 2YNHB 4EU0A 4A8YA 4ELVA 2BUNA 3HZEA 1JLFA 3F73A 1KHWA 4LVOP 1N32F 1HW9A 2X1BA 3HKWA 2DNMA 2LA6A 2WB1D 4A8WA 2MB0B 4PXDA 2VOPA 3OFGA 3HHNB 5KG5A 4C8KA 2Z2MA 2FVPA 2AGPA 2EFGA 1RT1A 2L41A 3BSOA 1S0VA 1K9MT 1XEZA 3O3LA 4DS4A 2QRRA 4GKKF 2DGWA 5E2QA 1JX4A 3AJ1A 1HNIA 1HWLA 4C8OA 2FHKA 3KLHB 2B9WA 2FVRA 4ZVEA 4WZQA 1F5AA 3RW7A 1C1CB 3E3XA 1UFWA 3J80Y 2UVWA 2LXUA 2XMJA 1FJCA 1K0VA 1QE1B 5FJ4A 2NPFA 5JXSA 4DUZF 4F25A 3M9OB 3G96A 1P1TA 1CC7A 1V6HA 5I42B 2V0NA 3QLHA 7FDRA 4Q0BA 4OJGA 4TLQA 2D9OA 3LH2S 4QIVA 1NJZA 1YRXA 4Q8FA 4LSNA 3RR7A 3HI9A 5LMUF 5E7OB 2VQFF 3O1LA 2NZ4A 2B3TB 4ZLPA 3THVA 2RD5C 5HN0A 1X5SA 1FRHA 2MQPA 3DDKA 1IKXB 2HLUA 4MTPA 3MFIA 4YY3F 2LXFA 2VG5B 4RKUC 1HBUA 1H3DA 3KLVA 2OH2A 2ZH7A 3PM9A 2I5JB 1QY7A 3DXSX 4HYKA 4ECZA 4ED5A 2HWHA 3GQCA 4IH5A 4DBQA 4CIOA 5G4DA 4K4TA 2C3PA 3FVYA 3QAUA 5KT3A 3FQLA 2ZH8A 4X65F 5DM6Q 1N33F 3B4MA 3OXFA 4NCGB 4FN5A 1XWLA 2M7SA 4KB7A 3TW0A 1LWEA 3CCMS 1SKSA 1JXLA 3J7YI 2XCPA 1S1TB 3H4BA 2IA6A 4ILRA 2KZZA 3BGRB 3AQPA 5J2MB 2HS0A 1T7PA 4E8UA 3GB0A 2YWFA 4HI1A 4CQ1A 3OL7A 1FKOA 3A8EA 3BQ0A 4PG8A 3KK2A 2FC8A 3BGUA 4QW9A 4YB1P 2FHJA 2F8EX 2W9CB 1MW7A 2GHPA 2VL1A 4CCHA 3G6XA 2X3GA 1RTHA 4C2MA 5KTQA 3KYLA 1NK9A 3FZ2A 2B4OA 2UP1A 1PO6A 2G0CA 4FF4A 3K0JA 1NK0A 1CSJA 3K5PA 4EGLA 5DQIA 2RVJA 3T5LA 3SMZA 1S1VB 4C4WA 4I2QB 1YJ9S 1RTJA 5HI7A 2C2DA 3FJ2A 4XAKA 1S9FA 4K50A 1N6QA 3GV8B 1L3TA 1V3ZA 2EKYA 2OPQB 3V4MA 2FVQA 4MFBA 1TR0A 2RDJA 1CLFA 2MY8A 3DLGA 2IA0A 1HQUA 4HTIA 2BOPA 4M8LA 4HI2A 3M6UA 5E3RA 1FDDA 5J2PB 5J2MA 4LQ3A 1A9NB 2A2CA 2FGOA 4KT0C 3THPA 4USIA 4IOBA 5HL7Q 1VQ8S 3C6TB 2KRRA 3ETOA 3KK2B 2DNKA 3S6EA 4ECVA 1SI9A 2JWNA 2F3JA 3P96A 4NZ7A 3PRDA 3MHYA 5LXYA 4K59A 2B4UA 4B9MA 3DC2A 1YHQS 1KNZA 4WYLA 1KR4A 1L3SA 1AXQA 1HBOA 4DLGA 4HKQA 3GMGA 2DO4A 2NPIA 1WF0A 4FZVA 1FNMA 3PW5A 4J5OA 1LOUA 2Q3PA 5A8WA 3QPIA 3GFYA 2DR7A 2FVCA 2V9WA 5CZXA 3LWMA 1C1BA 2B56A 1S6UA 1TL1B 4FVCA 4X4SA 4RW9B 3PFOA 3J7Z5 3J7ZT 1X9WA 1UVJA 2CIMA 1N52B 2UXBF 3MI7X 3DRSB 1Q79A 2F8HA 5LMNF 3VAFA 3CULA 1RT4B 3TVYA 2HHHF 2CQ1A 1MMNA 2YY3A 4WFXA 2C42A 1HBMB 2Q43A 4DMZA 2YKAA 4RBUA 4BDPA 3EXYA 1M5SA 4ED7A 1L3UA 4HVZA 1DQ9A 3M4XA 2F9JA 2IM2A 1QTMA 1JB0C 4O3PA 1U1KA 3SDEB 2GA7A 2WK4A 1FE0A 3M2RA 4RUAA 2ZD1B 2BM0A 5KFEA 1S49A 5ITHA 4ZDNA 3DM2B 4O3RA 3Q2TC 1VQYA 2JC0A 3DDNA 2DHGA 3GSDA 3IWLA 4PCQA 3Q8QB 2NSCA 2WRMA 3QGIA 1FO1A 2D41A 4PG4A 3V6HA 4OX9F 3NL0A 2WCXA 3KLIA 3NS6A 1RT3B 4A8QA 2DVIA 5K8PA 3EUNA 2XGQA 1U49A 2FJWA 1T8EA 2XS2A 2D74B 2E5HA 4NZ6A 4RUHA 1M5OC 4Y28C 2VBYA 3HP6A 2NLWA 4ZPBA 4O4GA 4IDKB 1NKEA 4EBDA 4I0WA 4TQSA 4Q8EA 2DNNA 4UOCA 3KLGB 1X4DA 5C42B 2IBKA 2AGOA 3MMBA 1YQHA 3K5MA 3MWBA 1T3OA 2DCUB 3DMJA 3I4PA 4DV0F 4PKDB 1JLAB 4AL6A 5D3GB 1R89A 4H4MA 2XWXA 3K58A 3G8SA 3M2VA 1REVB 3H59A 3KHRA 2CPEA 4QWAA 3T6BA 4YR0A 2D9PA 3BO2A 3MR6A 2CQGA 4AQYF 5G0RB 5GAEU 3NG8A 1HWUA 3OL6A 3KLEA 1URNA 3QGGA 4ZP9A 4NLYA 4DF8A 1X4GA 2EW9A 3IO1A 4I56A 3KG0A 3HHLA 4L6V3 2VG5A 3TO8A 1WG1A 3PNIA 2JEJA 1HFEL 3I56S 2E7XA 1RDRA 2OFHX 4LSLB 3QZ8A 5CH7B 3QYYA 1YRUA 5IM0B 1PGZA 3LQVA 2A2DA 3PX0A 1JLEA 2YKQA 1WHYA 3CJ3A 3G9CA 2HNYB 4DR5F 4DFPA 2AYEA 5GADU 4DR4F 4L72B 3MUMP 2ZHBA 3DN9A 2W9AA 2RIJA 2EBGA 1OPIA 2W24A 3ENQA 4KHPF 2LMIA 1WHXA 1TK8A 4K0KF 1D9DA 3CVKA 3PIPQ 4TLRA 3TX8A 3G71S 4C7QA 5J1EA 2XMWA 1S0NA 2W9CA 1KOOA 1NO8A 2HNZA 4XDDA 1LQ9A 2KYXA 4YDDB 5KFCA 3OVSA 5C25A 5JVGQ 3DNCA 3MTJA 4IG3A 1FKAF 4KTQA 5FIIA 3OW2R 2ZKTA 3G6YA 3GV5B 1GT8A 3SFUA 1SL1A 1RTDA 2CJQA 1VC5A 3PJWA 1TVRB 2U2FA 2VQEF 4PXCA 4MH8A 2FJVA 3DYAB 2OPSA 5JJBA 5HO4A 1X9MA 4A4JA 1S9EB 1HHSA 2Z8QA 2EFVA 5AXLA 5IXUA 3G6ES 3NBPB 3OHBA 2YKMB 3KKFA 2L08A 3IFEA 1QSLA 1VQPS 2DGOA 3OLBA 4C3KA 5ADZA 2ROGA 4EYIB 2HG4A 1MU2A 4DR7F 5T14A 4NPOA 4G1QA 4LIWA 4ZVHA 2W7OA 2GCFA 2V4JA 2NUHA 1GTHA 4DSLA 3HKZD 2DNYA 4DWIA 4Z37A 3OLAA 3BQ1A 1QVGR 3B78A 3I32A 3D0HE 2R4FA 2W4PA 1JMTA 6FD1A 1DTTB 2R7OA 1AFJA 3T6JA 4HDGA 4DV3F 1Z2ZA 1NJYA 2V5HG 2XULA 4P7TA 3DRRB 2ATLA 1WG5A 1JKHA 2VKRA 1N8RT 4CZCA 1S0MA 5GAGI 4ILMA 2JSXA 4UQGA 3PDNA 3MURP 2AJ0A 2C3UA 4EFAC 3MECB 5T41A 5HP1B 2R8HA 1TL1A 4C98A 3PV8A 4XPEA 4P7VA 4TY9A 5GADI 2CVEA 2RRBA 3PIOQ 2E5IA 2CZ4A 2QA1A 2YNFA 3GV7B 3RB4A 4NWBA 4DEZA 3CIZA 3MUTP 5HMXA 4RBVA 1N5YA 3F44A 5KFDA 1I6JA 2V8GA 1S72S 4DOZA 1FCAA 3ENWA 5A0YA 1S6QB 5K8MA 2E9ZA 2O5DA 1HI0P 4ZA1A 2HWIA 2EFOA 1NJWA 4IFYB 3WC2A 2HHSA 2Z0GA 1RAJA 1H98A 2OO4A 3I55S 3KMQA 2BE2B 3CB4A 2ZOGA 1BQMA 3I87A 4MJKA 4ES2A 2GMLA 3PEHA 3T1HF 4IR1A 3K8VA 2AQ4A 2R7SA 3OL9A 1HD0A 2GMJA 3IWXA 1IUJA 3N0VA 4OMFG 4QU6A 1FNXH 1AROP 4DV7F 2P5VA 1RT3A 5EWFA 2R7VA 4NCAA 3PXGa 3VTIA 1XBWA 4PUOA 3SQGA 2KJWA 4XDCA 1FRKA 3CJ4A 1CPZA 3ZZPA 3QJPA 2KZMA 5AXMA 3VZHA 2PA3A 5B09A 2BQRA 3MEEA 1LW2A 2FB0A 3K5OA 4CTAA 2LQBA 3OFEA 4KC5A 4ED8A 2BM1A 1BC6A 4MKBA 4DSKA 2WOMB 3C6UA 1JLQB 4C97A 4LMZA 4I7FA 3IA0A 5CQGA 2WONB 1C4CA 4KAIA 3FZBA 4QU7A 4H4MB 2DH9A 4WU2A 5KFHA 4RZRA 2OMOA 3M9MB 1WF2A 4R5PB 1U25A 3TA0A 1NHVA 3Q2SC 2ZH1A 2V8VA 4J9MA 3HLUA 3M32B 4RX6A 1X4AA 3MM7B 4DJBA 5D6GA 1K8AT 3L95X 4BC7A 5MAOA 3VAGA 3DFEA 1V9OA 5JUMA 4X64F 3VAKA 1E6YB 3L7PA 5AJ3F 2ZJRQ 4ECUA 3OQ2A 1Y9OA 5J2NB 1R27B 1HW8A 2RF2B 2RS2A 3CO9A 1VBZA 4BWMA 1HBUB 4NMLA 5HQ8A 3K59A 3O5TB 3OFHA 1R8AA 3CSKA 2IVYA 2WBRA 4QZVB 4R25A 3V2UC 4B3MF 3CD6S 1JLEB 1SIWB 2Q1LA 1TUVA 1D3WA 4Q2LA 4H4KC 1N36F 1VLYA 1IKWB 3SI8A 3HF5A 2CJKA 1Q7YT 2CJ9A 1HWIA 2CQBA 2EG2A 2LXIA 2YNGA 3N6LA 1S1TA 2JX2A 5CCLA 4KFBB 2VZ9A 2CJAA 5DDQC 4A8FA 4K5RA 2LQ5A 2MZJA 1U1QA 3QIPA 2XY6A 2DGXA 2NQPA 2EPIA 4I6WA 2HNDA 1RTIA 3LAMA 3TI0A 4Q5VA 3R1LA 3DXBA 3SCKE 3CCES 1EETB 2DGVA 4TY8B 3KLFA 2XLIA 1SJQA 1U1RA 2W8LA 4YHHF 1PSDA 1UKUA 1SH0A 5MLCV 4HH0A 4YEAA 4F3MA 2XO7A 1SH3A 1JJ2R 2P6TA 2KM8B 1P9QC 3O44A 1G2EA 3CUNA 5CA5A 2DNQA 3SCIE 4QYZJ 2JHEA 2MKJA 2XY7A 4IUFA 3JTPA 1U4BA 4N41A 2VPYB 1N88A 2KU7A 3ITHB 4ES3A 2HHWA 1V3SA 5CYMA 5FLXY 2YKMA 4FNIA 4RWXA 4URQU 4IH6A 3CDWA 3EPIA 1VMBA 2A1BA 3IN5A 3S01A 2WB4A 1TK5A 1IR0A 2HZCA 3DOKA 3AAWB 1RT5B 5D4PA 2DNGA