3SBMA

Trans-acting transferase from disorazole synthase in complex with acetate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
MKAYMFPGQGSQAKGMGRALFDAFPALTARADGVLGYSIRALCQDDPDQRLSQTQFTQPALYVVNALSYLKRREEEAPPDFLAGHSLGEFSALFAAGVFDFETGLALVKKRGELMGDARGGGMAAVIGLDEERVRELLDQNGATAVDIANLNSPSQVVISGAKDEIARLQVPFEAAGAKKYTVLRVSAAFHSRFMRPAMVEFGRFLEGYDFAPPKIPVISNVTARPCKADGIRAALSEQIASPVRWCESIRYLMGRGVEEFVECGHGIVLTGLYAQIRRDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DisD protein
publication title Structure and Mechanism of the trans-Acting Acyltransferase from the Disorazole Synthase.
pubmed doi rcsb
source organism Sorangium cellulosum
total genus 106
structure length 281
sequence length 281
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2011-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3sbmA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3sbmA01
2CUYA 2QJ3A 3HHDA 3TQEA 2G2YA 2QO3A 2G2ZA 3TZYA 3H0PA 2VZ8A 2G2OA 1MLAA 4QBUA 3RGIA 3SBMA 3BV8A 5DZ7A 3TZWA 5CZCA 3K89A 2JFKA 3EZOA 2VZ9A 2QC3A 3G87A 2VKZG 2C2NA 3IM8A 3TZXA 2HG4A 5CZDA 3IM9A 3PTWA 3TZZA 3HJVA 3CJ8A 2G1HA 3QATA 4RL1A 4RR5A 2JFDA 3HMJG 3R97A 2H1YA 1NM2A 2PFFB 3R8YA 5DZ6A 2UV8G
chains in the Genus database with same CATH superfamily
2F63A 2E66A 1DTQA 3I9ZA 1Q86T 2RUSA 4RW4B 2YWHA 1RT5B 1VGYA 2FLOA 2YNIB 4E2FB 5HJXA 4NYPA 5HVHA 3GJSB 4GO7X 4OZ0A 4A8FA 2MZJA 2CPZA 2UUBJ 2J7UA 3VHQA 4O3PA 2NLWA 1HI0P 4NRUA 3W60A 1KQSR 2AW0A 3CMES 2R3VA 3ZNJ1 3DYAA 1SKSA 5KT5A 4WWSA 1GQEA 2JZ5A 1N54B 1CEZA 2KXFA 3PYGA 5EN1A 2UU9F 1OQ3A 4DV0F 1LWEA 4QWAA 1FNMA 3OL6A 4C11B 2ZH4A 4NMXA 1QSSA 2KM8C 2H65B 3CB4A 1U1RA 2C22A 4NYOA 2C2EA 5EUHA 1S9FA 4M5JA 2RHSB 2FHJD 5CZCA 1T3OA 4EYHB 2FYXA 4O3QA 4BC7A 4KO0B 3QZ7A 1TTHB 4WFNQ 3FBFA 1CBKA 2DR6A 4ETXA 1VC5A 1NK4A 4PRFA 3ET6A 4QR2A 3K57A 4QU6A 4DV3J 4PPZA 5BYQA 2ZOGA 2K7JA 1ZAVA 4DSFA 2P9GA 2VIHA 1Q82T 3UPFA 3T1HJ 3BGUA 3DMJA 2GIQA 1N88A 1RAIB 3GTYX 1S9GB 1CSJA 4KPCA 3ZC4A 1XNRF 2V5HG 1JJ4A 1G2EA 4X4NA 3FRYA 3M2RB 1MU2B 3UNYA 2X3GA 1E6VB 4J9MA 4FS2A 4UQGA 2MQMA 2OPSB 3U1NA 1LWCB 1TKXB 3SBMA 3M1VA 2WOMB 3NS7B 3EGZA 1KR4A 3M32A 4QYZK 1QM9A 3BN4A 2XSJA 4YB5A 5AE1A 5JXSA 2D1CA 3M9MB 1YKWA 2DKOB 5KFPA 2WVDA 2IRUA 4KGXB 3SI8A 3LANA 4OYAA 5IS2A 3RB0A 1WHVA 1U8WA 3MFIA 4L76A 5L8RC 1RXOB 3W61A 2ZDOA 3MI7X 1R8PA 4X66J 4AXIA 3D68A 1B64A 1FWPA 4OX6A 4N7TA 2OIHA 4LFAJ 1U1PA 2L9WA 3FFIA 3D3BJ 3W7BA 3FCHA 1RTJA 4F3OA 2RAQA 5T7LA 2MKCA 1V9OA 1DQ9A 5KT4A 3DLKA 5ETLA 3W5XA 3LO3A 2VC0A 3KJNB 4MAKA 2HFVA 2VJUA 1TKTA 1SJ3P 3QFWA 3BQ0A 2VZ8A 3MD1A 3J7YI 5DQIA 1RBOB 2DNGA 1SH3A 2B4OA 2Z2ZA 4NLTA 2H4YB 2J0QD 4DZ6A 4JUZA 1RT7B 4GKKJ 4ECWA 1XR7A 2RHQB 1S0VA 3TAQA 3CO9A 2E5JA 1LOUA 4JBCA 2HW3A 1CG2A 2UVRA 4Q2LA 3S6EA 2PD1A 2HMIA 3MPWA 5BR8F 1RCOB 1VQOS 1JLFB 1QUPA 4QR0A 2QLWA 1O0PA 1Q95G 1UWAA 4E98A 3BSCA 3MMCB 3GYNA 1PG5B 5HATA 5K8PA 3OUYB 1NK7A 4OHXA 3CSKA 3MM8B 3KLHA 3A8IA 4J9VA 3NL0A 1FRKA 4FS1A 1TV6A 4OJ3A 2QA1A 2CQIA 3W2WB 1B0PA 1R8BA 4NOHA 2F9JA 1MNEA 3HX9A 3TA1A 3RG6A 1JXLA 4QIFA 3MMBB 2BOPA 1F60B 3VVUA 4TVAB 2K8GA 1IJEB 2F4VF 3WC0A 2IJFA 4L3KA 4CRJA 2MMYA 4EZ6A 4OQJA 2B8QA 2HFUA 3MR3A 4Y2CA 3TJ8A 2JLFA 1DHMA 3CJ3A 3MTJA 1Q79A 2PEHA 2MXYA 1RTHA 4OZLA 3W8GA 1AW0A 3OL7A 4IFVB 4I56A 3CD5A 1HNVB 1WKJA 2XMAA 2BANA 1Y3JA 1U2FA 2NXUA 2YPYA 1RCXB 4XTTA 4XAKA 3C8YA 4B3TF 5IT9Y 1HW9A 1KONA 3K59A 1FK9A 1RBAA 5L1KA 1X4GA 4B9VA 4EMDA 4C98A 3H42A 1FD8A 2H5EA 1PJ5A 1S4FA 1ULRA 3US5A 1RWKB 4YOEA 2ZDPA 1RT1B 3GMGA 3EGVA 3BYPA 3WBZA 3MCSA 1KTQA 5KOXA 1WEZA 2CAJA 2ZE2B 4C8ZA 2KTQA 1FXDA 1HPZB 4UZCA 1XC9A 4HVZA 4GRSA 2XC9A 4JP8A 4C9DA 2OSQA 3H5UA 3CDWA 3H0PA 2UUWA 3NNCA 1QDUB 4QIWD 3DDKA 2CZ4A 3UCGA 1L3UA 2PE8A 2XG8A 3DRPB 5DDPC 3CJ5A 4ZS6A 3D9BA 3VALA 3AXKA 3DI6B 3QGHA 1TMJA 3J81j 4X4SA 3ZZZA 5D6GA 3U1LA 2JX2A 4XO0A 4IYQA 5GAEU 4K2JA 1RTIB 1CULB 4ZN1A 1Y4ZB 1KHWA 2HHVA 3NMAA 1NSKL 3GV8B 2IAJB 2AJ1A 4PXEA 5HL7Q 3H5SA 5KG3A 1ZM4A 2BW7A 3CIMA 4H4KC 1ACMB 2WONB 5H9FK 2ZBRA 2HLTA 3AJDA 2JSXA 5EWEA 1FDDA 3QSIA 4X62F 2WCXA 3AOAA 3UNGC 1AFJA 4ZMMA 5A8KB 2KJWA 4WU2A 1QTMA 3N6MA 4LF7F 2EK1A 4J7CA 4K2XA 1UVJA 2ZFHA 2NS1B 5C25B 2FJEB 3G6YA 3FGVA 3J81Y 2DGTA 4ID5A 3Q2SC 3WIUA 1M1KT 3BBCA 4L74A 1IBMF 3PRBA 1NB2A 5I3UA 1DZ5A 2WVBA 1SJQA 1D9DA 4OI0A 3RBZA 1QD1A 1RT2A 3R5AA 1TL4A 3KJQB 2WZ1A 3RB6A 3NGRA 4GO5X 1JLQA 5BXIA 2OPPB 1KQFB 4ECXA 2GO8A 2UXBF 2CQCA 1Y9OA 2O01C 3P96A 5F8NA 2HZVA 4B9SA 3L7PA 3NLCA 1AB8A 2LEPA 1JKHA 5ETVA 1YJ9S 3KMQA 3GLJA 1JX4A 1RAAB 4ECZA 2Q66A 1YBAA 3A13A 2YH1A 4W4MA 1PJ6A 2MZSA 1VIOA 3UDEA 5HROA 4WE1A 2RT3A 3BZQA 1S77D 1YWXA 4Q2MA 2DEJA 1S99A 3PY8A 3N6LA 4LF1A 1B0VA 3W5ZA 3KYLA 2I2YA 3OFGA 3WX4A 2DHXA 2I5JA 3TR5A 2AIRB 2IVYA 3X3UA 2YY3A 5B0BA 3MDFA 2Z2YB 4ENOA 4NCGA 5I3QA 4ZK7M 2YKAA 1K1QA 2N3LA 3BQ2A 1A6LA 4EO6A 3LW5C 1S6PA 3G4SS 3ULHA 4RW6B 4IOCQ 1TK8A 1VHIA 1WDTA 2AGQA 1RKJA 1F2HA 3PJWA 2G13A 4AFFA 1RAJA 5D0EA 4A46A 3I0SA 1S97A 5KFIA 3SQGB 5DM6Q 2DITA 1SV5B 1FVSA 5LXYA 2Q6BA 3UO0A 3AA8A 1WG4A 4NYZA 1HD0A 3CC7S 4HHJA 4OMFG 3BREA 1R8CA 1HBNA 1D8ZA 1TKZB 4I7FB 3NBPB 2QL5B 3M4XA 4WBFA 3AD9C 4ZP8A 4FVMA 3I0RA 2ZD1A 3DOKA 1D0EA 4DV4J 5F0UA 2FY8A 9RUBA 2NPFA 2R2RA 2CQHA 2O1PA 3AD8C 2V8HA 2IJNA 3MR7A 1VRUB 1HMVA 4F4KA 3ZFVA 1TQLA 2DYAA 4IKAA 5KT2A 4B9UA 4FDFA 4KGKA 2DJWA 4PQUA 3GE9A 3ONQA 4HHUA 1NEEA 3BGRB 5EX3A 4ATNA 1UFKA 2JFKA 3M6XA 2GC8A 5HMYA 3DU5A 3HFKA 4TQSA 3S8SA 1U6FA 2BABA 3DM2A 2AZ1A 1FX2A 2R7XA 5A76A 2RD5C 4DV2F 3W5YA 3KLEB 2HNZB 1CJKB 4NXMF 3HFVA 3G6XA 2DNLA 2GMLA 1ZOTA 1VI7A 1S1WB 1D8YA 2QA4S 4UUXA 4BC9A 1I1GA 2JRSA 2WSCC 2RRNA 1WC5A 1UZHA 5D8HB 4L6V3 2AJQA 1T9VA 2OTLS 1SUQB 1DQAA 1JXEA 2B9EA 2B5JB 2VFRA 2SXLA 2ZM6F 2EVZA 4AD6A 1ZS6A 2IJRA 1YZ7A 2BYCA 4JI8F 4RW8A 4R5PB 2KYXA 3U02A 3BF4A 2K3IA 4N47A 3JTOA 2EPIA 2R2UA 1UTAA 4PPDA 5F41A 4KHPF 4LREA 4QPTA 1T7PA 2AHOB 1C0TA 4KV8A 3RUBL 4J9SA 3FZBA 2QMUB 4R0EA 1Y5IB 2A3JA 3OTDA 4YY3J 3VZHA 2FJBB 5J2QB 3QJJA 4MK9A 2YKOA 4P2SA 1S9EB 5L9NA 4E8UA 2IVFB 1LK7A 4UZBA 1F5CA 6FDRA 3GFYA 1XK8A 1OWXA 5IM0A 3BO4A 1HHTP 1BD6A 4LFCF 2MDAA 2GMHA 4ZCIA 2B7CB 4A8QA 1KSPA 2DGUA 4X4VA 3P5TL 1T9YA 1WELA 1VLOA 4FYVB 2VQFF 2FQQB 3K89A 3BN7A 1WI8A 4QYZJ 5G0RA 4TY9A 3CJ4A 4NLVA 5HN0A 1J27A 4MJKA 2L9DA 2BZ2A 4JV5F 1FTRA 3P8BB 5KTQA 2Y8YA 5D77A 3M6WA 3TAMA 4G1QB 1Q5VA 3T41A 3CCWA 1S1VB 2J0WA 4DR7J 4NLPA 1TL7B 2M5YA 1RWOB 2PN6A 4ZCMA 3QYYA 3UDCA 2OPQA 3D1QA 2H4WB 2CQBA 5KG5A 3HVWA 1UW4A 2G0CA 4PG5A 2CRLA 1O5JA 1PYOB 4OYXA 1F9HA 3R8YA 2FLLA 1WACA 2FLNA 1N8RT 4LSLA 3M8QB 4ZP7A 4HDGA 5CYQA 5J1NA 3LP0A 3TZXA 4C3MA 1WDDA 5ADZA 2MLYA 2FC8A 2P5VA 1VBKA 5GADI 3C2PA 1MWYA 3SZ2A 1U7LA 3D67A 2BA9A 2JEFA 2HYIB 1L5UA 4JYAJ 2WVCA 5IZHA 4LF4J 3PYFA 3UDVA 1H2TZ 5K8MA 1AZSA 2DEIA 1IUJA 3WIVA 1FNOA 1GTEA 2HVZA 3N9UC 1UFWA 2R2TA 2APOA 1JLAA 3L09A 2CXEA 5FLXU 3RGIA 1P27B 1CJVA 3HT3A 1HBUB 3V6DB 4OHYA 1ZAXA 1BMQB 1WSVA 1U1MA 2V2ZA 4USUA 1HNZF 2ILYA 4LSNA 2CJKA 2IDLA 2OEKA 1SJRA 2V0NA 5MAOA 1CQNA 4Y65A 1OYDA 5GMKa 1TZ0A 5J1EA 1R27B 1XBWA 2CA9A 3TVZA 2BQUA 4OYWA 2HSEB 1KHVA 1NHKL 1L3KA 2WK4A 4M5NA 4DXLA 2DCLA 5IWAF 2N7YA 5U47A 1KWMA 4EGLA 3BGFA 1U2RA 1KC8T 2M52A 2ZZMA 3TUPA 2MZ1A 3LWLA 4NI2B 2J6UA 3I4HX 2FJVA 5C5JA 4KAIA 3F56A 1X7VA 1IR2A 1YGYA 4LIRA 2JWNA 2XULA 4FYYB 1IVZA 4UOFA 4HL9A 3JSYA 3D4JA 3M05A 1NXIA 2XMWA 2YKNB 1YHQS 1OO0B 2HQDA 2IPOB 4NA1A 1EKSA 2ZKUA 4IG3A 1WOPA 1SC3B 3PM9A 3CJ0A 2HAIA 1QE1B 3CC2S 5AXMA 1G3OA 4IR9A 4O3RA 2YWGA 5ITHA 3CCLS 1LXJA 2K2PA 1YX2A 4DR2F 1PAUB 2ATLA 1KNZA 2DRBA 4NCAA 3UWTA 3LGHA 4RW7B 5L1IA 5I3PA 2DH8A 3KHHA 1VK3A 4JI3F 3AOCA 1UPPA 2KVIA 3RBDA 3KG1A 1G7CB 3N79A 2R7QA 1OIAA 5J2PB 2YWKA 3EM1A 1EHWA 5A8WB 1U0HA 4I4BA 1KQKA 3K8VA 1FJEB 2CJQA 4J9UE 2XS7A 3V5RA 2CPEA 2C3OA 4QQBA 4WFYA 3TVYA 4PAAA 1VS3A 5D4PA 4FYXB 4RL1A 2LYVA 3CDUA 5LMUJ 4WK3A 2B0GA 2VDHA 5KFZA 2NSBA 3GR1A 5E2QA 3WQPA 1SPBP 4CM0A 2D41A 3MM7B 1E6YB 1DFDA 3NKYA 1S6OA 5KG2A 1A0OB 3QIPB 5KFOA 4CH0S 2MQOA 3H90A 3FBEA 3QO9A 1WG5A 3ISND 3VWSA 5H9FJ 3IM9A 1BHNA 3LOUA 1N32F 2DR8A 3GILA 5J2MA 4RNMA 4LF8J 4OX9J 3K5NA 4PKDB 3DDNA 2ZJQQ 5FDLB 5DQHA 1DQ8A 2XWXA 3E01B 3OFHA 4IDKB 3LALA 5L1LA 1OY9A 2XO6A 1FWKA 2HG4A 2EW9A 1MMDA 2AYGA 3PKYA 2B56A 2E5LF 3A1YG 1JQGA 1NM2A 3Q8UA 4M5IA 1TUVA 4J9PA 2VC1A 2FUG9 5HAOA 1NJIT 2QE5A 4X64F 3IRWP 4ILLA 4K4XA 2PDAA 4ZVFA 3GIIA 3DGPB 3QQCD 5AXKA 1U1OA 2OI2A 2FJXA 3G82B 2KJVA 1NDPA 1NKCA 2EFOA 1FERA 2J8SA 2HHQA 5T14A 2D3O1 1TMMA 5AJ3J 2Y9HA 1RLDA 1SH0A 3BSOA 2YKQA 2VV5A 1DAXA 3V81B 1IKVB 4Y34A 1RAFB 2V9WA 4IQXA 2HHXA 4JI5F 4NZ6A 1FI4A 4JI7F 3FKBA 3GJTB 1L3SA 2JC0A 2YNGA 3NCQA 4FNIA 4PCQA 4H4OA 2HNYB 3ISNC 3T5JA 2HWHA 3GV7B 1BGXT 2VODA 2AV5A 2VBXA 3MM9A 3BQ1A 4XIUA 2V2KA 1DURA 3CMQA 3OTCA 3LTOA 4NCBA 1LW0B 1WC0A 3I4PA 3GSDA 1H74A 1DLOA 3DOLB 2Z8QA 1YK9A 4EBEA 2BKPA 1DJ0A 5KFCA 5HLFB 4WFZA 2AEFA 5KFTA 4NLQA 3QRQA 5KFMA 3HVTA 1YJUA 3MEGA 2CZ9A 5HSPA 1ZA1B 4DV7F 3FBBA 3D28A 1WHXA 1IKYA 4QW9A 3EVOA 3IC1A 1W2IA 3A8EA 4RUCA 3HD1A 4YHHF 1AROP 2GQCA 2BACA 2DK2A 4DDFA 1AT1B 2F9DA 4K5RA 3HKZD 3EZOA 4LRDA 4DSKA 4I68A 1N48A 2J5AA 3KFWX 4HACB 2DTJA 1WUUA 4MTPA 3C6UB 2ERRA 2M9KA 1MROB 2WBRA 2ATCB 4ANDA 4HDHA 4EYIB 2DGOA 2XYHB 3MEDA 1T03B 1U26A 1B3TA 1HIYA 4DUZJ 3D1OA 2A6OA 3WC2A 4B17A 5F8HA 4JV1A 3A8KA 2XHCA 3CVKA 4OZ2A 2LCWA 2ZC3A 3SCLE 1F3VA 2BKOA 3R3TA 4YR2A 1B4SA 1LQ9A 2A0FB 1VIXA 2A2DA 3AT1B 3HHNB 3EYZA 4IFYA 2GS8A 3DRRB 1SCJB 4OX8A 4LVNP 1RWWB 3MPDA 2DR5A 4OHWA 2DGVA 4ANCA 2VB6A 3OTEA 2M8HA 1S1TB 3FBCA 3RB3A 1IKXA 4OJGA 2J9DE 5IC4B 2OPRA 2EWHA 2P8IA 4ZVEA 2L48A 4CT8A 4CLZA 4DFJA 5HMWA 4K4VA 1Y10A 3QGIA 1N33J 1RADB 2U1AA 4RNOA 4CIOA 1V3SA 1RTDB 4BHQA 2EXUA 2EK6A 4ZPTR 2ZBCA 4PUOA 4P2MA 3THPA 3KHLA 2PMHA 4EWTA 2KRBA 2B4UA 4PYDA 1U24A 1G6BA 2UV8A 1P1TA 1GK8A 4IO9Q 1IKWB 1GMWD 1R0AB 3MM6B 5EGYA 1U45A 2DPIA 2R7OA 3LPEA 2VFUA 1WEYA 2XS5A 4CWBA 3NXZA 1RWPB 2RILA 4WJBA 3DOMA 4F67A 1U02A 4NLRA 4K8RA 4YEAA 1H2UX 5L38A 5D3GB 3CPWR 2OLWA 3G2XA 3F41A 3LWMA 1KLMA 1RE1B 4J9LA 1BWEA 4UY85 2KXHA 4DUTA 4Q0BB 2ASYA 2I9SA 2BX6A 4GVBB 3M30B 3BGOP 2J6SA 2HURA 4CO4A 2EC2A 2HHPA 3RRKA 2ACMA 3V4IB 1U1KA 4DQQA 5KFAA 4CZCA 4PABA 5A0YA 1XJWB 3LUYA 3RAXA 5HMXA 3JSBA 3H59A 2VOPA 4NZ7A 1FKPA 1X5OA 1Y5LB 4QWDA 3KDOA 4C2MA 4NPOA 3EVWA 1UMJA 3MEEB 1MMNA 2D3OR 2QG9B 1D3WA 1YJVA 2AX0A 3W9HA 1DTTB 1H72C 4DPUA 1ZTWA 3Q0AA 5EWGA 4DV5F 4F02A 4WPAA 1H0HB 4U8VA 1KD1T 1JJ2R 3H5XA 1QTNB 4AQYJ 3OLAA 3CJQA 4F8RA 1FXRA 3VAHA 4RW9A 1RWVB 1WI6A 4ZDNA 3M8RA 1CJTA 4DUYJ 1D9FA 1SC4B 1EETA 4HLBA 2RSQA 2UUBF 1RK8A 1FCAA 2QO3A 7FD1A 4B3OA 2M7SA 3L3CA 2J0SD 2KYZA 2HQ3A 1KVKA 4WP3A 1EP4A 2BRLA 2XI2A 5B0GA 3PDNA 3Q89A 3C15B 5E3QA 4PWDB 1WTFA 4ED5A 1WHYA 4U7UK 2IBKA 2R7VA 5CAAA 3IWNC 1KFDA 8RUCA 5LSLA 1EX8A 3CD6S 2Y1IA 2W9BB 4LQ9A 2V6AA 3GWCA 3Q86A 3C3LA 2RQKA 2FY1A 1CJUA 2G1DA 3O2IA 2C2DA 3M2VA 3UN5A 2HHWA 1HQEA 2KFNA 2YQ3A 4PZVA 2OMLA 1T02A 2OFHX 3SIPB 2YBVA 3G8TA 1C1CB 1CVJA 4ZPDA 1FKOA 2HFSA 2UU9J 4DF4A 4KFBA 2O66A 5LMNJ 4QJVA 4DV0J 1F1BB 2KU7A 2F4FA 2LXIA 2FVQA 2RKIA 3EPGA 1JXVA 4DV3F 1LFPA 3MECB 5FLXY 4B9MA 2JEIA 4K4ZA 3QT8A 2VZ9A 3T1HF 3IS9B 1NJXA 2VFTA 4Q8FA 1FXLA 4ID8A 3QT5A 3MCMA 3L95X 3RR7A 1N0VC 3MHYA 1PO6A 4Q7AA 1U6BA 1X9SA 3T5HA 2HLUA 3ZZRA 3MM8A 4GC6A 1UPMB 2IY5B 4DL6A 1JLGA 1HI8A 5F8IA 2V69A 3M8WA 1VBXA 1XNRJ 7FDRA 2CQPA 1KS2A 3S01A 4DCOB 3PEJA 3I5AA 5KT3A 1JLEA 5KFLA 4K0KF 3DLGB 4ED2A 3KLFA 3SMZA 5EWFA 2Y1JA 1DTQB 1CPZA 3S7RA 1SQFA 4X66F 4CCHA 3M6UA 2BJ3A 4LFAF 1HL6A 2X51A 4P10A 4XDDA 1U25A 3ICLA 3AHPA 5KFNA 2NXNA 2YX1A 3IBFB 4GMKA 2ZZNA 4ALZA 2HIYA 3AQPA 4DOZA 2ASDA 3G71S 3J7Z5 1W2BR 2LQ5A 3HSJA 4OHVA 3FDSA 3KKFA 2W8KA 3K5MA 3DYAB 2I38A 2XZWA 5AXLA 3NY0A 3MMJA 5F3TA 4O4GA 2CVIA 2UXCF 1S5ZA 5ETPA 3FSXA 4HI2A 5DGBA 3JXOA 4RUBA 4I0WA 1N5YA 1VRQC 3ILLA 1HNXJ 2VBYA 1LWEB 5C7PA 2HFOA 2F40A 4J9NA 3OD2A 2LP4A 2DT9A 1T9XA 4GKKF 3NCPA 3QSYB 2GQ2A 3MWBA 3V4MA 1VC6A 1G1XA 2YWWA 3G86A 1VQYA 3K5OA 3DXSX 2OD4A 1RU2A 1S57A 3IM8A 5JJBA 1VBZA 4QWCA 4ZP9A 2C2KB 3JQKA 1T94A 5HK4A 4RR5A 2JL9A 3IR6B 5IT4A 2RDIA 5FD1A 4WU3A 2XGQA 4XDCA 2XNQA 2M88A 3TUZC 3I82A 2W9AA 2DISA 1RGVA 2CPXA 2M3DA 3OW2R 3ET6B 2KT2A 3ETOA 2Y3YA 3FCWA 4Z37A 5ETSA 3KG4A 3DMJB 2VG7A 5BR8J 2ROPA 2ZNYA 2H51B 2W2PP 1I51B 1UKUA 2BE2A 1H7XA 4CH7A 5GAHI 2FD2A 3RBXA 4F0KA 4R8UA 4ZIVA 2IBOA 4M63A 3J80Y 4DR4F 4ZVOB 2ZBIA 4MIAA 3M1VB 2MKJA 3R1HA 3I6PA 3M32B 3AB4B 2XSJB 1B0TA 3QGPA 4NLOA 1RISA 2W2OP 3CCRS 2MJUA 3BO3A 4BCAA 1W26A 3EXYA 3PACA 1N6QA 2VG6A 4X4PA 3KDNA 1QAXA 2BKNA 4DQSA 4HEA9 4QYRA 3D6FB 1O8BA 3ZZYA 5HBMA 2QA4G 2K7KA 2KT3A 3FFIB 1FD2A 1S4EA 2HHHJ 1WSRA 1RTJB 2IC3A 1Q1KA 5HMZA 2HRUA 2CNNB 3FMBA 1F6TA 3E51A 3DLKB 2XBPA 3GG0A 4OZJA 5B09A 3LQVA 3EDQB 1X4HA 2HK3A 3R7BB 1TKTB 1NO8A 2LA6A 2MKHA 3AH6A 1RHKB 2CQ3A 4MKYA 4LVOP 4DCPB 4ES2A 1BLUA 1FEEA 2QV6A 3B6BA 3OJSA 4OLOA 3CCES 4KGZB 4LR9A 4V19X 2EFPA 3M8SA 1NBEB 1FDAA 1TVRB 4F50A 3QNWB 1KN6A 1FRXA 1I5OB 3VAIA 3HHLA 3MGJA 4OYPA 3BH6B 4XPEA 4OZNA 4MKBA 3JQMA 2NZ4A 2G2OA 2XI3A 3G6VA 2C3YA 3M9OB 3KLHB 2AJ0A 1EB0A 4A8YA 2ASLA 4UF4A 3D54A 3PKMA 3CNQP 1TV6B 5L39A 4I2PA 3R2CJ 3HO1A 3R5DA 3ITHA 1JJCB 3CF5Q 3BDPA 1SQGA 1EQ0A 5E3PA 1BQNA 1DARA 1M5VC 3HD2A 3MOJB 2DGWA 5DLFA 4NASA 2MGZA 2DD8S 3BKUA 2VHGA 1Z1ZA 1RAGB 2YPZA 4FZVA 1TK5A 5DDQC 1PCAA 1M1HA 2XEXA 2Z30B 2LQ9A 2VPXB 1SXLA 1RTHB 1HI1A 3EDRB 2KFYA 4Z7YA 3MEKA 2VD3A 1TUGB 3K7RA 9ATCB 2W2QP 4J37A 1JWWA 2I0XA 1VCTA 3EJMA 2BANB 4KHMA 2RH3A 1R8AA 5LJ3Y 1FFWB 4M5DA 4LF9F 1FK9B 1O6XA 1SH2A 1UZDA 1TAUA 2JLGA 3CJRA 2V67A 1UVMA 2VBZA 3MPYA 1NPKA 4Q43A 1WC4A 1VJWA 2WSEC 2HNDA 4DX6A 2W7OA 1YVFA 2M8DB 1LW2A 4RBVA 3F44A 2XCPA 3TO8A 2QZ8A 2QSWA 3HCXA 2ZVIA 3D5MA 2FDNA 2ZBPA 2JEGA 4YFUA 4E0DA 2WB4A 4CO0A 4DL0C 5H1SV 2QYGA 1NPPA 4A8WA 3OV7A 4K7QA 3G87A 4LBPA 4WXWA 4HHHA 3I5BA 5C24A 3V2UC 1SUQA 4KH1B 2DY9A 2KM8B 1Y5NB 3T5KA 3CGIA 1Q53A 1HHSA 4ELTA 3UR3C 2AJFE 5DG7A 1M5OC 4KT0C 4ZCLA 3LP1A 3PIPQ 1SJ4P 3OR2A 4OYOA 4HTIA 2R7UA 4DQIA 1UVKA 3IXQA 5DGAA 1HWLA 1KRPA 5LSRA 2BE7D 2CQ4A 3PZPA 2R8JA 1TL5A 4WYLA 2QLXA 4LRCA 2C2MB 1TELA 2P9EA 2R8IA 1XMQJ 5DQGA 3E8OA 1TL3B 5KG4A 3LA0A 3CTRA 2ZH3A 4KSEB 2R7WA 3CUNA 3PRVA 3HULA 1IWGA 1R31A 5JVHQ 2PEBA 4ZHRA 2CDQA 3K2YA 1X4AA 3R97A 3GB0A 2FZKB 2BMBA 2AF6A 4ID5B 5ETNA 1CS4A 1FX4A 3TWZA 4DV4F 4O3OA 5I3UB 2JH3A 1NK8A 2CQGA 1HR0J 1K73T 4ERDA 3HSDA 2PFFB 3I96A 4RNFA 1RT2B 3D0IE 4PYAA 3NRBA 1RBLA 1U4BA 2V9KA 3BB5A 1GNKA 3H40A 4IR1A 1U8SA 2XY5A 1JLQB 3HM9A 2FHOB 5BYRA 3CD0A 1Q4RA 4PG7A 1LWXA 1T11A 1FDNA 1UA0A 3A3OB 3VV2B 3UN2A 1X60A 3SDEA 4KC5A 2BJ9A 1JKHB 4OI6A 1REVA 1CC8A 3GCXP 1J5EJ 4AL6A 5KFWA 2VG5A 2RDDA 3NGUA 4X4OA 4DPTA 5GAGI 2I1RA 3KK3A 3WHIA 1ELOA 2IM3A 3NGKA 1VMBA 4ZPBA 5E5NA 4Q45A 2VUGA 2W7AA 3VAGA 5HROB 4WE1B 2Y0BB 5HQLA 4KTQA 1HKAA 3U1MA 2POKA 1BUXA 4TLQA 2DHSA 3MZIA 2I5JB 2CQDA 3LPYA 2F5GA 4N77A 3IGVA 2VONA 2NREA 3TA0A 5DG8A 1U6ZA 4L3NA 2G2YA 4RU9A 3CCZA 3R27A 5GAHU 1WHWA 4NCGB 1N34J 3MAQA 1IJFB 2D9OA 3MAAA 2BV3A 4Y2IA 2AJ2A 2HRYA 3AB2B 1S6PB 4PEOA 3CJSA 2LKZA 2HHSA 1S48A 4YY3F 1T05A 2COLA 2PI5A 4JI8J 4EEYA 5ETQA 4JI4F 5K8NA 2ACYA 4KE5A 2CNLB 4Y28C 5LM7E 1SB6A 5HP1B 2BW2A 4KHPJ 2Y0SD 2E9TA 3ZNUA 4CO3A 2KN4A 2MQPA 1B7YB 3GIRA 3P3DA 2F65A 5JUMA 1TR0A 3BEGB 3VGTA 2DNZA 2ZJRQ 1EARA 4MFBA 3IO1A 1OYEA 1HBNB 5F8MA 5KFHA 5KFSA 2WVFA 1NDLA 3JAMU 2HBYB 3J7AN 4CTAA 3VTIA 4J9KA 4LFCJ 3I0RB 2ZD1B 3DOKB 5CZDA 4DWIA 2EEYA 5DO2A 1FO1A 4ZJLA 3CJ2A 3VAJA 1IQTA 2AYEA 1QJHA 1DY3A 1XEZA 2AD9A 1HMVB 2DIUA 4DR7F 1RKIA 3KOAA 4X2BA 4O3NA 3IWLA 1X9MA 2HFZA 2OJ3A 2X1FA 2MKIA 2OSRA 2AKWB 3C16A 3OPKA 2YTCA 3FCVA 4I67A 1ZYQA 4PQUB 3QAUA 4ZLPA 3KLIA 3NOGA 3BR9A 3PFOA 4JV5J 2RS8A 3PYDA 4S0MA 4D3GA 1PAEX 3DM2B 3KK1A 4NLWA 1WC1A 5LXRA 2UXDJ 4RX6A 4B3SJ 1PYSB 3IAM9 4IG0A 2V8PA 1NK0A 1HNIA 2DVIA 4ZJQA 4JYAF 3OXLA 4LF4F 4AMPA 4AUKA 3NS6A 3SCIE 3H25A 5CD4H 3R1LA 4RBTA 1R3NA 3T9NA 4Q8EA 2N3OA 5KFEA 3CMAS 2C2RA 1OSDA 4J90A 3PR4A 3QATA 5CCMA 5I42A 1UCNA 2IA0A 1Q5YA 2C42A 1NPRA 1BY9A 4Y2AA 4CM2A 5A6PA 1WC6A 4RW8B 4QBUA 4CLKA 4DFKA 4U95A 1QAJA 2MJNA 1Q78A 2IM0A 2JLEA 1Z2LA 3N5BA 2KG0A 4CI0B 3PTWA 4OIXA 4WIIA 3Q8VA 3M2UA 4ZCKA 2L08A 3TNVA 1C0TB 4DV6J 3GPAA 2CDRB 3I55S 3OHBA 3CCMS 2UUCJ 4C4WA 2YWEA 3THVA 3BO2A 4NE9C 1YG0A 3VCDA 3HKWA 2CJYB 3J7A1 2R7SA 2BJ1A 1HNZJ 2KL8A 5KOWA 1T95A 5IM0B 2HPUA 4OV1A 4JI0F 6AT1B 1RHUB 1NJZA 1DRZA 1YJWS 2IM2A 4CLPA 4CP5A 4P52A 3A3NB 2OELA 3T19A 4ED8A 4JV0A 4C0HA 4NWBA 3HJVA 5FDLA 4WFXA 5G0RB 4B3RF 2H5IB 4TU9A 3GV5B 1S1UA 4G65A 2RVJA 1SC6A 3C6TA 1UEKA 3M8YA 1F9EB 4ILRA 4DPWA 1R6VA 2GGPA 5KT7A 3TAMB 2FJAB 2PGCA 2CYYA 5SUHA 1B99A 4DV1J 3RR8A 1U1NA 4L73A 1HLWA 4IRCA 3M8PA 3G82A 2BJEA 4M1KA 4A48A 4EBDA 1NLKL 2OPQB 2G0IA 1ZM9A 2FZCB 2PFDA 2PA3A 3LP2A 3H4DA 3NWRA 4EZ9A 2OKQA 3D3CJ 3M8ZA 3V81A 1HHQA 3K5LA 4JB8B 2NCKL 1IN0A 4LSLB 3EPIA 3CCTA 2ZOFA 2DNRA 2H1YA 3LP0B 2YNFA 4DR3J 1FNXH 2NUHA 5KFKA 1GXUA 4OV6A 1RHQB 2MKKA 4ES1A 1AZSB 4UOGA 4UW2A 1KVJA 4JI3J 5KG0A 1Q7LB 2C2ZB 1RT3A 3SV4A 2MZRA 1JLAB 2AP6A 2GJFA 1GT8A 1WKLA 1CJVB 4NLSA 1C1BA 3DOLA 4U9RA 2GVDA 1P9QC 4LRBA 1N52B 2KRRA 2HIQA 1XNQJ 5H9EK 3AOBA 3VF0B 2V2VA 3GIMA 4LSNB 2M70A 3CWJA 4B9NA 4TU7A 3MMAA 1MW7A 2E1CA 3M9NB 2ABYA 5J1EB 1TU0B 1S1XA 2JDJA 4ZVUB 2HHUA 3HF5A 3V6KA 4CO2A 4OX9F 4LF8F 4DR1J 1C0UA 1FEHA 2HVEA 4I6YA 1U49A 1WKKA 4DU8A 4HACA 1TL1A 2D74B 3MM5A 3DKDA 2CQ2A 4YB6A 2EFVA 4LMZA 2J9CA 3L7OA 3UN3A 2A2CA 4DS4A 5LT5A 5L1JA 2XMKA 3MR5A 2A18A 2V4QA 3BR8A 3OL9A 2HQIA 4F0MA 1ZZFA 1VRTA 1S10A 4NA2A 1N4LA 1Z2ZA 1UJ5A 3I9V9 3HVRA 1F2GA 1OQ6A 3TAPA 2HZCA 2MY8A 3JS9A 3CDBA 4IG3B 3JYTA 1PYTA 5AJ3F 2J76E 2E5LJ 3K17A 3IG1A 4FYWB 4RU2A 5LL6d 2V4RA 1GXTA 2DNMA 4CYUA 2ZITA 5HQMA 5IT9U 2UVWA 5E33A 1GMWA 4KQZA 3Q22A 4U6PA 5KG1A 4O0IA 3LGMA 1KKHA 3AD7C 1HA1A 3MUMP 2XMMA 1J5OA 3KXDA 1HYSB 2KHDA 2PO4A 4OFZA 3EZ5A 5DRKA 3IRXA 3DGVA 5A8RA 3FRZA 5K5MA 3MCOA 3CDEA 3K0JA 4Y3CA 2XMVA 5HVGA 1D09B 3EUNA 1KOHA 4OZ3A 2FHKA 4FPIA 1M0SA 4URGA 1U0HB 1MSWD 5CXTA 1UP1A 3AA9A 3OSNA 1S0NA 1WOSA 3BSNA 2BEFA 1JLCA 3TARA 4FBUA 4WTOB 4O44A 5CYJA 1RT4A 1C4CA 3BBBA 4JI1J 2AMCB 4NRTA 3H5YA 4NXNF 3PXGa 3BJYA 3LF0A 4DFPA 4WK1A 7AT1B 1VQ6S 4K4UA 2D3UA 1S76D 2ASJA 4DL4A 4IOBA 2M4MA 3PO4A 1EKRA 3A8JA 1SL0A 3QO9B 4P6QA 1DBDA 4USJC 2BDPA 4WIQA 4DUZF 2ALZA 2Q79A 4URSA 5IXUA 2QFIA 5J2MB 3QGGA 4W92B 4IH6A 4WKRA 3D1HA 2B9XA 4F3MA 1SL2A 1RWNB 1SC1B 4PR6A 2BJDA 1X0FA 1V5IB 2HBQB 2YNHA 1FF2A 4C8YA 2CG8A 5K14B 3GJQB 3J81U 3SCJE 4TQRA 1PBAA 4ANEA 1X4CA 3BBFA 3MCNA 3CJTA 1HQ2A 3T1YJ 3N0VA 2EC0A 3C14A 1ZPVA 2A10A 1YQHA 1S0OA 3LH2S 4WYWA 1RAEB 1K8AT 1N5QA 2QTWA 2E7VA 3J7YU 1F5BA 1RT6A 2XSFA 1N33F 2GQQA 2Y8WA 4HTJA 3FEZA 3KTQA 1PBUA 4DG1A 4DPOA 3EVMA 3F0NA 2YNGB 3W2VA 1GTHA 3H2VE 4FF3A 4KYZA 4H4OB 4PWDA 2HQCA 3MOZA 2IDEA 3POTA 4IUFA 2ZH1A 5CA5A 2JFDA 2X7IA 4IRKA 3MM9B 1I94F 2KG1A 2DY1A 1DLOB 5K9FA 3N01A 3CEDA 1T3NA 2DPJA 1GMVA 4DF8A 1RABB 3B8HA 3MTKA 4PXCA 3T6BA 3FUYA 2R7RA 4DHVA 3HVTB 4CNZA 3O44A 3MEGB 2M0GB 1KBRA 5K8OA 2YKMA 3UVJA 1GH8A 2HGMA 2P2CB 3IBWA 3TEGA 1YBTA 3R7SB 2LECA 2VBWA 5DZ7A 4X4RA 4C7QA 2CPDA 3PYEA 1FRMA 4F4XA 2N7CA 2KZMA 4USKA 2OTJS 2A1BA 1OMSA 4OYMA 1RWMB 3FMWA 3C66A 4IQMA 2MZTA 3CIZA 3PIOQ 2AJ4A 4FXDA 2ROGA 3HPOA 3ZTRA 3ILOA 2VQEF 4MKVA 4KH0B 3MEDB 4UUWA 2E1MC 3B78A 4N8OA 4ZP6A 3HSZA 4AQYF 4LF6J 3G8QA 3IAS9 1NSQA 3W63A 1UL3A 4OI4A 2FVRA 2RMLA 1GAOA 2V4JA 3W3SA 2EFNA 4MIWA 5B0DA 4ZIWA 5KFGA 1UVLA 3JSMA 2RF2A 2VICA 4Y6IA 2CWKA 1NK6A 1V6HA 4IFYB 4DUYF 2AWZA 2KHCA 5GAEI 1N36J 4O23A 4JI6F 3JAMY 4YDXA 3M6VA 1JLBB 1M5SA 3N28A 1RACB 1RB0A 1H38A 1X5TA 1IKXB 4NLGA 5THWA 3AFGA 2GHVC 1NJYA 2OPRB 4M5HA 4BWJA 2ZZTA 2IM1A 3OL8A 4ZJOA 4FXVA 2D3ZA 2WW8A 3Q8YA 1VQPS 2F3JA 2LDYA 3P45B 4EBCA 2GVZA 1V5VA 3CXCR 4WFBQ 2ZH5A 1M5HA 4KKOA 1FT8A 2HVHA 2Z0GA 5KG7A 3D6TB 4X84A 2ZHOA 4PUOB 2BBEA 2OAUA 3Q8QB 3H4BA 4DEZA 3IR7B 2MQNA 2J7KA 4IH5A 4DX8H 3IP0A 2C28A 1X4EA 4PG4A 3UDLA 4ED0A 2K1RA 2GAGC 2DNPA 3IN5A 5EX0A 5J2NA 4J9OA 1WTBA 4C8OA 4DPXA 5CQGA 1NKEA 1QAIA 1RTZA 3DOMB 1HD1A 5KFFA 5LMNF 3EX7B 2B4PA 3QMQA 2RB7A 1RQ0A 2Q6CA 2W8LA 2YQ0A 4DN0A 1H98A 4H4MA 1KLMB 2V8DA 5JMNA 5AE2A 1YJTA 2LA4A 1CC7A 2RU3A 2XHWA 2AGPA 2ADCA 3OXGA 3EZUA 1LFWA 4DR6J 3FVYA 1RU1A 3MF5A 2RJZA 3QLHA 2RIJA 2W9CA 2BUNA 4I6WA 3GYGA 2UVVA 4ED6A 1S59A 5A0YB 2QYCA 3CCSS 1FKPB 5L9XA 4BDPA 2BQRA 1S6QB 3OLBA 3SFUA 4CNYA 3QAEA 1MMLA 4XK8C 5KFDA 3CT9A 3TZYA 1OPZA 5SZTA 4EU0A 1FRIA 4O0NA 3PR5B 4M8LA 3OR1A 1SJ1A 4PWUA 2DGXA 2ZVSA 2L41A 3Q2TC 3UQSA 3JTNA 4RW9B 1NMEB 1HQUA 1NDKA 2ZH7A 1QAYA 2NYIA 3FNNA 1CJTB 2O67A 1Y7PA 1HWKA 3L4BC 1EETB 2UUAJ 3B4MA 3W62A 3EGNA 2OEMA 4LF5J 4K0KJ 3DRSA 4B3OB 4Q44A 3PG9A 1QLNA 1EP4B 1LWFA 1B70B 1VC0A 2DRAA 4CQ1A 5C42A 2HK2A 3OVSA 1Z4UA 1GX6A 3L9ZA 2RE1A 3SSSA 4OI2A 5EHHA 3KK2A 4A8KA 1X5PA 2FJDB 3GR0A 1HNXF 1X5SA 5CYMA 3KMSA 4DR5F 1AYEA 4QIEA 5KT6A 1CJUB 3O8WA 4PG6A 4N5SA 3M2VB 3GFHA 2IRYA 3KJVA 1HQEB 2UXCJ 1OY6A 1NUEA 3HK2A 2FHMA 1C4AA 4KIAA 3CJKA 3RW7A 2MB0B 1RA6A 3Q23A 1FKOB 3NAIA 1YI2S 2LEAA 2XQCA 4KFBB 4F7VA 5J1PA 2GHPA 1SKUB 1P9YA 3DLEA 3BSAA 4M5MA 1AA1B 2YQ1A 2RKIB 2C3MA 3F73A 3HDSA 2JC1A 2YVSA 2B43A 5H9EJ 2Z4PA 1N5VA 4X4TA 2DR9A 1GXLA 5K20B 2QEXS 1K0VA 2J9EA 1D1UA 1XQIA 3FK4A 2AQ4A 4DSJA 4TYBA 3IFEA 1PJ7A 2QJ3A 3EGWB 3IMQJ 1TVRA 1UWBA 1VYAA 3ETMA 1XIQA 2X3DA 4USHA 1QUVA 4CLFA 4DBQA 2NXJA 5DDOC 2GMJA 2VPYB 2V34A 1NSPA 2B6AA 4KGVB 1P6TA 5KFVA 1VQSA 3OTOJ 4Y2MA 2IMWP 4BBYA 1JLGB 2VFVA 4PG8A 4M5GA 3S1TA 1MWZA 4ICLA 2YXLA 4WP9A 4X65J 4TKTA 1SKWA 1ITPA 4ZOSA 4I1TA 4DX7A 1JLEB 1XMOF 4QU7A 4FF4A 1FFSB 3SQOP 3PHEA 3KLFB 5KFYA 3KG0A 4DR4J 3OJUA 1RHMB 4TU8A 5B0FA 2KVQE 3BS9A 4F3QA 1UJ6A 1PIEA 3NMRA 4BLGA 3W1YC 2ZOMA 4P7TA 1X31C 2X1GA 4ZVSB 2QLBB 2XLKA 4CLTA 2HHHF 2RS2A 1IM6A 5IV3A 2PIIA 3TVKA 3H2LA 4B3MJ 1WWHA 2DGQA 2E44A 5DZ6A 4K5SA 2W2MP 4KY3A 4USWA 2LFVA 1HFEL 3OXFA 4F4WA 5KAKA 2HFNA 4O4GB 4BS2A 2K3KA 2G1HA 1ROFA 1YRUA 2EG1A 3T6JA 4WF9Q 1Q8BA 2WTFA 4NEZA 3TP2A 4BWMA 1N5YB 2LQBA 4WCEQ 4RUAA 3G96A 3RRHA 2MQ8A 1IBLF 3VAMA 4USIA 3OSPA 4LFBJ 2LLZA 2C3PA 1UEVA 2XWYA 3DU6A 2B8PA 2MYFA 1NZ8A 4HKQA 2VOOA 2WW4A 3I87A 1VFJA 4YP3A 3D66A 2DBBA 3WDOA 3PNIA 3PJXA 3HHDA 2YX4A 4M5LA 3R5JB 1BQMA 4LR7A 1MG7A 4O3SA 4AMNA 1M5PC 2V50A 1VJQA 2ADBA 2DNHA 1SIWB 2DR7A 3U7JA 1VQNS 5M2UA 2VF3A 4U8YA 1U1LA 3MFHA 2CKWA 1YJRA 1KQGB 4NEYA 3UD4P 2VG7B 2MHEA 4TN2A 4ECVA 2PT0A 1FJGJ 2BE2B 2N82B 3RRGA 3PCOB 5IT0A 2GJ2A 2QL7B 4X4QA 4J9QA 4RPFA 4R8UB 3C46A 4CLLA 1TL3A 3QFHA 4ZLJA 3OVAA 5IQ6A 4MMOA 2XZDB 4LQ3A 4P2XA 2KH9A 4LBHA 2W4PA 4F4ZA 2FVCA 1Q16B 1MWQA 2IHR1 1N6QB 3KLGA 2VG6B 2CVEA 3A3PB 2NZCA 3VQSA 5GADU 1HBOA 2E5IA 4ITSA 1TFYA 2OFGX 4RW4A 5HBMB 4OX7A 1RT5A 4GKJF 1Q7YT 2YNIA 3D7SB 2E5GA 1JIHA 3R9LA 3P49B 1KLNA 2C2NA 3WX8A 1JNRB 1YSJA 3SV3A 2IC3B 2LMIA 2AEJA 2B9WA 4HH0A 4USMA 3NCRA 2RUGA 3RAQA 1WG1A 3IR5B 3IA0A 1YDLA 2DNNA 2BR0A 2CUYA 2AGOA 2FHJA 4HI1A 1IXKA 4LT6A 4LF9J 4J5OA 4N41A 3CCJS 2LVWA 3NAHA 3IWXA 4TYAA 3VGUA 2W25A 2QN6B 1KEKA 2MSSA 1HBMB 2CPHA 4TXSA 4ZVPB 1FE0A 4C11A 1HNWF 1YJNS 3UCZP 4JI2J 1URNA 1H6KX 2FVSA 1V3RA 2B4VA 1A9NB 4RNHA 1IQZA 4USVA 3CDAA 4G1PA 1MN7A 5D0GA 3TRGA 2FVPA 2I6WA 3N5FA 3QPIA 2AYBA 1PILA 5D78A 2IFXA 4FVCA 3SYZA 2J6TA 2IMOA 3HHLB 4DI6A 2Y1LB 4KO0A 2N4DA 5JVGQ 1XMQF 2OH2A 2HVDA 2WBMA 2ILZA 1ZPWX 2VA3A 2LQ8A 2A6MA 2DNQA 4I2PB 5HP1A 3TX0A 3OFFA 1S9GA 4RO0A 3ITHB 2MLXA 2XMTA 2YX7A 2Q1LA 3AAWB 2Z2MA 1BQNB 3M2RA 2NSCA 1MU2A 2W2NP 1HR0F 3BPSP 1M90T 1E6VA 2XMJA 3NOCA 2MGZB 2OPSA 4B9LA 3H7HB 3HHLD 1LWCA 1TKXA 2HHTA 1HWUA 4G3IA 2WOMA 1LKZA 2K06A 1IBKJ 2GZOA 4ER8A 2IVMA 1JK9B 1YITS 5KG6A 2E9RX 2QA2A 1X4DA 1U48A 3W9IA 2G0JA 2GHWA 4Y0FA 3PW0A 2DHHA 2HS4A 5LSOA 1GEHA 1VBYA 4DX5A 1NAQA 1J5EF 4M5DB 3KHGA 1EQMA 1RYRA 4TY8B 2HAFA 3GZ7A 3K5PA 3DRXA 3QWPA 4B02A 1YBUA 2DB1A 2XLIA 2HNDB 1LW2B 1TK0A 3GYXB 4WZQA 3QRPA 2BE9B 1J2VA 4PWWA 5KFRA 1FESA 5G4DA 3TEHB 1S79A 4WFAQ 3UCUP 2MKSA 3EE3A 1IM4A 4G6VB 1Q8IA 4FNHA 1RA7A 4UOHA 2KXNB 1N34F 2ZUAA 1SIZA 4OZ5A 1X4FA 5C24B 4DLEA 3HHLC 1VQ8S 5FIIA 2CJAA 8AT1B 1RT7A 1SVDA 4V1Ak 1TFWA 3LP1B 3OR2B 4I69A 2ZH6A 1H7WA 2OGUA 3THTA 5C2GA 1Y11A 1OY8A 2Z58B 1JLFA 1WC3A 4ZVTB 2F1FA 4FYDA 4F4YA 2LU1A 3MMCA 2F8MA 1N5TA 3Q8RB 1S0MA 3OUYA 4FP9A 1R89A 4ZPVR 5ETKA 2RRBA 4JI4J 1T9WA 4ZPCA 2EFGA 2R9LA 1L3VA 5HO4A 2WHOA 3TQEA 4MKAA 4ILMA 1R6YA 4I2QB 1S49A 2J0XA 4ZHRB 3W2WA 2KI2A 2CPFA 4R25A 2ZH2A 1XN9A 4HR2A 1CS4B 1IWAA 3MMBA 4H4KA 5GMDA 2UV8G 5BYSA 1N5SA 2YKPA 4ETZA 1EIYB 1MN9A 1C2PA 2NQPA 2LEBA 1YZ6A 3M7VA 2OUGA 1RYSA 5DS7A 2DGSA 3JSRA 1XMBA 2XY7A 2BJ8A 5M2PA 2ZH9A 4IFVA 1Q0NA 2LXFA 3PV8A 1HNVA 3SDEB 2AZ3A 1REVB 2RQMA 4AMOA 2UXDF 2E5HA 2VG5B 1VQLS 4B3SF 1S7HA 3ZZUA 1FVQA 3DLHA 3GONA 2N4CA 3DCAA 4PQAA 1XWLA 3KK3B 1VQ4S 2PC6A 3IGNA 2CQ1A 4KHRA 1IR0A 3O5TB 2J7WA 1VOMA 3UI3A 1RT1A 3DHXA 1TAQA 1BXNA 2MHNA 2VH7A 2BQ3A 2ZE2A 1K1SA 1HPZA 5E3AA 4CLUA 1NCLA 2CQ0A 2XCAA 1BE4A 3GFXA 1ZH5A 4QR1A 1PKUA 4DV6F 2HWTA 3MAAB 4F4AA 3P5BP 4CDIA 5KFBA 3MR2A 2W7PA 3R5CA 4ZLLA 4P73A 2UUCF 5RUBA 1T05B 4DL7A 3DRPA 5HI7A 4FXWA 3CULA 2OHDA 3PW4A 2G4BA 1ZETA 4EO8A 1KTVA 1K44A 3DI6A 5GVQA 1SJFA 4ZPAA 2BRKA 4W98A 2E29A 2W1BA 2MLZA 1T9UA 4RUHA 3RB4A 1RTIA 1CULA 3BPDA 4RLEA 5KFXA 2IAJA 4A8SA 4C8KA 2MQLA 2C3UA 1WOOA 3HVAA 1RDRA 2F7VA 3VGVA 2WONA 1LK5A 4Z7CA 3Q83A 4W90B 3HFZB 3W65A 4MFBB 4O4RA 1RSCA 1P8GA 5L46A 4A47A 5A8KA 2MY7A 2OEJA 1PC5A 2HGLA 2FJWA 2Z2LA 2E9ZA 2JVRA 4CTAB 4K4TA 2CPIA 5C25A 4JI0J 5IFMA 2KFZA 2BJ7A 4UY8T 4LBIA 1QVFR 3T9ZA 2F4VJ 1K9MT 4P9SA 3H2UB 2GX8A 2AYMA 1X9WA 4D3HA 4DV1F 4PXBA 1UEUA 2O3DA 4B3RJ 1YJ7A 2V94A 4URQU 4KRWA 1R0CB 3C16B 3D6HB 2KKHA 2OPPA 1VHFA 1VISA 4Q5VA 3ZTOA 3KLIB 2XNRA 3DDIA 4ZVGA 2X1BA 3TW0A 1I6JA 5F8LA 5T7LB 4F0HA 3CW2C 5ETRA 2C1EB 3KK1B 4Y00A 2WVEA 3H8YA 4B3TJ 4DR3F 2E1AA 2KO1A 4IG0B 4P74A 1NK5A 3FJ2A 1HNIB 1HYSA 2QC3A 4P71A 4Z2XA 3RTVA 1RWUA 3EICA 4K59A 2HQGA 5DJBA 2H9ZA 3DLBA 4ZKAA 2HS0A 5I42B 2R42A 4GC7A 4JOUA 1LNQA 1HWIA 4ECSA 2FLPA 2QX0A 2HMIB 1XNQF 3E3XA 3BM7A 1VQMS 3X1LB 2DXDA 3M2UB 1KFSA 4C6AA 3GSIA 2H48B 2X1AA 4EUVA 1EJ7L 2DIVA 4DZDA 5AT1B 1FTCA 5F8GA 1UETA 1UW9A 4RW6A 4I64A 5CD4A 3E2EA 4DR1F 2DNOA 1SI9A 3VAKA 2AU0A 5F9LA 4YN3B 4U67Q 2VPWB 3TX8A 3SQGA 2QL9B 2YWFA 3UD5A 1SV5A 4NLXA 1VQ7S 3J80U 3QWUA 3ADAC 2W4DA 1YLXA 4X62J 3UD3P 1SKRA 4N8NA 3NGSA 1TKZA 4I7FA 1S1UB 3NBPA 4C97A 5K14A 2GJIA 4LF7J 4XPCA 2JNJA 4H54A 3C6TB 5CZXA 4NLDA 4A8XA 5T41A 3AODA 4P75A 2CPYA 2RDJA 4C8LA 4LIWA 4FF2A 2GGPB 1QSYA 1IBMJ 2MTLA 5HANA 3R5GA 1SL1A 1GFWB 2DH7A 1PSDA 1UVIA 1VRUA 3M8PB 2J8AA 1ZAWA 4DS5A 3BKTA 1OPIA 4X4UA 2GO9A 3LP2B 2W24A 2CNKB 4AL5A 4LF2A 2FZGB 2GAHC 2UXBJ 3VZIA 3P6YC 3BGRA 2JHEA 1W7WA 1X8DA 2XYGB 4M95A 2YNFB 2ZJPQ 1RWXB 1BQXA 1YRXA 2V63A 2EFQA 4K4SA 3TOQA 3KLEA 2HNZA 2XLJA 3OFEA 4AL7A 1CJKA 2VPZB 3NS5A 2ZHAA 1S1WA 2I8EA 3FQKA 3TI0A 1UAWA 3C19A 3DHWC 3HSGA 4YB7A 3TANA 4DJBA 2G9OA 3EXCX 1RT3B 3FSYA 4J91A 3FSIA 1NZAA 2IYGA 3G9CA 2CIMA 2B5JA 3D0GE 1OJ4A 1VQ5S 1C1BB 2R8KA 2XO7A 4JI1F 1N0UA 2GVDB 2H54B 3N6NA 4R5PA 1HARA 2NR0A 2DHGA 1Q81T 5A2QU 3J7ZT 4KJIA 4RWXA 5ETMA 2EG2A 1I3OB 3D2WA 5LJ5Y 4DMZA 3QBCA 1B7FA 5EDWA 3MR6A 3PW5A 3GIKA 3NGDA 3TUIC 1ZA2B 3MMAB 1PC4A 3ZZPA 2VJVA 3ENWA 3QJLA 2HZAA 1WF2A 1FWLA 1S1XB 3I5CA 3MUTP 1T9TA 3VAFA 1LV5A 2DHAA 3CO0P 2AEMA 3RW6A 2FC9A 2P9CA 1EZZB 3AXMA 3RZAA 3JB9k 5J2QA 1C0UB 2OD6A 4NXNJ 1JB0C 4RZRA 3R2DJ 4N56A 1TL1B 1S9EA 3RAMA 3MM5B 2R8HA 2OMOA 1R0BG 1VLYA 4C8NA 2HBRB 5F3ZA 2VKZG 5GMEA 3UFCX 3W8PA 3T1YF 2ZKTA 3QRRA 1VRTB 2V8VA 4F26A 2RNEA 4V19J 3MPVA 1RAOA 1SQEA 4ZLNA 2VA2A 2WAQD 2MKYA 2LDIA 1F9FA 3JYTB 4U96A 4AXJA 4USTA 3IG1B 2ROEA 3OBIA 4CYUB 4WXOA 2DXFA 1YIJS 4RNNA 2PMZD 4P7VA 1JLBA 3KJFB 4QWBA 1S7IA 4YQWA 4G1QA 5F8JA 3HXMA 1S1VA 3AJ1A 4QIVA 1TL7A 1J5OB 3ZZTA 3IRXB 4QIGA 5A8RB 4J9RA 1R7IA 3L7UA 4ZVHA 4F36A 5F9NA 3O3LA 1ZM2A 1CQMA 2MPUA 1XR6A 3HMJG 3ZXWA 2EI5A 1FE4A 4IH7A 3M8QA 2QLFB 4B9TA 5E41A 1F0XA 1QVGR 2QRRA 2IIHA 4RWWA 4DV2J 2UVUA 3QIDA 1GMUA 2CJXB 2BVZA 5DM7Q 4NXMJ 1EAYC 3B54A 2RU9A 4LR8A 2DH9A 3QZ8A 1JLCB 3P4UB 4ELUA 1I94J 3GG1A 2B51A 2RQCA 4HH1A 5DETA 4ECQA 1NDCA 4O44B 1ZBTA 3PHTA 1RT4B 2ZM6J 1RLCL 4LRFA 4DSLA 1YTYA 1HBUA 3HZGA 3V6DA 2FTRA 3DRYA 1WJ9A 3V6HA 2GA7A 5CCLA 1R8HA 3GQCA 2XM3A 4OYBA 1FRLA 4DCJB 2L3MA 3I0SB 3R6LB 3BYRA 1GX5A 3TA2A 5FJ4A 2JOQA 2QMXA 3VGSA 4LF6F 3BH7B 4C0BA 1TP7A 2NUUG 3PEHA 2C2OB 1U1QA 2WRMA 3MAHA 1JJHA 2DNYA 2R4FA 1RZMA 1W25A 2YNHB 2HGNA 1S6QA 1Y00A 4AE5A 1NH8A 4NI2A 2F8EX 1SBRA 1NK9A 2E1PA 2MEWA 2VQEJ 4LSZB 4K4YA 1N36F 4KBIA 3G8SA 4K50A 4ECTA 1Q8KA 3C14B 3T5LA 1UFLA 2GNKA 3VR1A 3V6JA 2VQFJ 3TJAA 4OJ1A 3JTPA 2FPHX 3KHRA 3RBEA 1LEOA 2YKNA 3HI9A 3H20A 3I31A 4M5KA 1YRTA 2UZAA 1RT6B 3NNAA 3I56S 3ISZA 3QT6A 4DL2A 3PW7A 1TKDA 2CWXA 4NLYA 3VVTA 1T0TV 1QE1A 4JI6J 4EK2A 4DG1B 4ZITA 1RJJA 3T3FA 4I6AA 2QT7A 1QSLA 4L72B 2IA6A 4HT7A 1FDBA 5AXNA 1O51A 4A8MP 2AX1A 3W2VB 5DDRC 2CJBA 2KB2A 1WNEA 4TLRA 2NYHA 5D0RA 4A4JA 3D0HE 3POTB 2ZNZA 5IV4A 2ZHBA 1FJ7A 1UJ4A 4U7UD 4RW7A 3HZEA 4HYKA 4YR3A 3NGTA 4WTYA 4ECUA 1NU4A 3PJ9A 1BWVA 2ZBQA 2NPIA 4ES3A 4DQRA 3FC9A 2BOAA 4AMMA 1V3ZA 1AXQA 3B82A 2VASA 1MLAA 5J2PA 5A8WA 4ZVRB 4F2RA 4NMLA 4RKUC 4WP8A 2KT5A 3QT7A 3A12A 2Q43A 5DG9A 1F5AA 1NHUA 4MT1A 1REGX 4MK7A 4DR6F 4KV8B 4CLWA 1NHVA 2YKMB 3UVJB 3B4DA 4OHZA 1QY7A 3EWGA 1IBCB 2E7XA 2XYPB 5B08A 2KZZA 3K58A 1RHRB 2EBEA 5CZVA 4NLUA 3ENAA 2QIFA 3GJRB 3OTBA 4DFMA 3TUJC 1K47A 3TZWA 3GIJA 4QCLA 3MM7A 1E6YA 1HWJA 5E7OB 3GP9A 2W01A 1G4CA 3ENQA 1L3TA 3QIPA 2PI4A 3LGNA 3N4WA 1X0PA 3UE2A 3LAMA 1FJCA 3U27A 4NZ0A 1XR5A 2QFJA 1WF1A 2V4JB 5IWAJ 4ZVQB 2JJ4D 4C3KA 4IDKA 3E01A 4CLSA 1ZZNA 3JSMB 2RF2B 3CD7A 2WB1D 2OP5A 1UA1A 2IRXA 1U09A 5DLGA 3FEYB 2R7TA 1NRKA 3FZ2A 2UUAF 1NB7A 2D7SA 4MK8A 4LF5F 4P2FA 4KPYA 3DGPA 5KFQA 2HBZB 3TQ1A 3ENVA 3HLUA 1Q8LA 3SFGA 3ILIA 1FHTA 2GVZB 3BV8A 2UP1A 3SCKE 4KKOB 1FRHA 1VK8A 3BGLA 1IKVA 2LXUA 3TYTA 2P6TA 4OYIA 2KDOA 5CYQB 3AJ2A 3RYLA 5BJRA 3PFEA 4DR2J 8ATCB 1NSAA 5A6WA 2K1RB 2HNYA 2UUTA 3EMTA 1FFGB 1LXNA 5J2NB 3DFEA 2WSFC 4OLPA 3Q24A 3OVBA 1ZTTA 2CJ9A 5LMUF 3NP5A 4DR5J 1RAHB 1LW0A 3BKFA 2O5DA 1H2VZ 3PVXA 4H4MB 4ED4A 3ZTSA 3KUHA 3KUEA 3CE8A 1JNZB 5B0CA 5HLFA 1APSA 2CZVC 3GCWP 1F3FA 2HWIA 3OT9A 3SSRA 1P1LA 4MYTA 1FA0A 3QLHB 1XTZA 4FKYA 2W9CB 1BC6A 4ED1A 2XB2D 1PGZA 3MUVP 3BDEA 4NX9A 2B7BB 3RJMB 3AQOA 2GCFA 2B3TB 4IO1A 3SEOA 3OTOF 3HJFA 5IQQA 1AFIA 4UOCA 3ILJA 2VDIA 2E1RA 5C2CA 3OQ2A 2FGCA 3OHAA 1AUDA 3C6UA 1H3DA 4HT5A 5B0AA 3CCQS 4FPRA 1D9AA 4X65F 1MROA 2J9DA 3MPUB 3FEXB 3IBCB 2DO4A 3DNCA 4FBTA 3HT0A 1T03A 1OS5A 2R8GA 1WD6A 3HHEA 3LAKA 4JV2A 1M5KC 4CLYA 3OR1B 1N32J 1HW8A 4LRAA 3SXLA 5D4NA 1S12A 5HJYA 3QJPA 4QPXA 3DLJA 2FIUA 5D4LA 3Q8PB 4FN5A 1OSCA 5GAGU 1U47A 5KFJA 2NXEA 1HQUB 4YB1P 3O1LA 3NNHA 3GU0A 4DLGA 1X4BA 4KR0B 4OI1A 1WORA 2XTJP 2VFSA 4IRDA 2ZEJA 3DLLQ 3DRRA 1NH7A 3HP6A 1RP5A 4OYZA 2XY6A 2ZC4A 4X64J 4B3MF 4DSEA 3CJ8A 4ELVA 1XMOJ 3DRSB 1S1TA 3DN9A 4QOTA 2CNOB 4UTGA 2DNKA 1LWFB 5M2RA 1KOOA 5CH7B 2LQJA 5C42B 2QMWA 4YR0A 5B0EA 1FKAF 3TZZA 2BXJA 4L75A 4RBUA 4EI2A 5E0OA 2BM0A 4G1IA 3KK2B 4FKXA 1TUWA 3SSQA 2ZWPA 3NEKA 2RRAA 5CYMB 2H3EB 1RTDA 4IOAQ 4JI5J 3ELHA 4ZN3A 1U0SA 4QW8A 4JI7J 3NG8A 4LFBF 3R6GB 4ED7A 5CHCB 3KJVB 2E7WA 4MIBA 4C3LA 4CO5A 2W4CA 3D6MB 5LOQA 1IKWA 4DN9A 2BM1A 1R0AA 3MM6A 3PX0A 3CJKB 1UVNA 3ZZOA 3ZO7A 5D0HA 2VU5A 3DXBA 1VDHA 2OO4A 1IBLJ 1HBMA 5D4OA 3DLEB 1R43A 3WZ0A 3PW2A 3KWMA 5D3GA 4DL5A 2U2FA 1WEXA 4ZA1A 5MLCV 5ETOA 2EBGA 1N56A 4DSIA 2XMUA 4Q0BA 1FJGF 3A4TA 4GVBA 2RQ4A 3M30A 1Y3KA 1UWBB 5A2QY 4DV7J 2VKRA 2CPJA 3I32A 2HRTA 1RI7A 3V4IA 2HEKA 3DC2A 4YHHJ 2B6AB 4MYUA 5CABA 1NNDA 2DO0A 1KVIA 4DU7A 3FQLA 4RJVA 4CO1A 4M94A 1KP6A 2XGPA 3VQTA 3MEEA 2ZWOA 1FRJA 2R2SA 4ICLB 1K0TA 2D9PA 2P6SA 2HQFA 1DTTA 3RU0A 4N76A 2GW8A 4WZMA 4GVLA 4NL5A 1XERA 2MQQA 4FF1A 3JQJA 2F8HA 1VQ9S 1H73A 4OI3A 2FB0A 3O6QA 4KB7A 3R7NB 3MURP 2PSZA 2FGOA 1AUSL 3MD3A 2XS2A 3W66A 4MH8A 1IR1A 2EKNA 4YUDA 1NKBA 4F2SA 5B7WA 4QZVB 2YH0A 6FD1A 2Z57B 3UW1A 2JVOA 5IOLA 1NJWA 4ECRA 1S6UA 2V68A 2M2BA 1VR6A 1RHJB 3KUGA 3MXHP 4KGMA 3HHKA 4TY8A 5E3RA 3PX4A 2L9NA 3ZZ0A 5F0WA 2MZQA 1U2CA 3C15A 3T1AA 3Q8SB 5IC6B 4GKJJ 2Y1RI 2GV1A 4P72A 2V2QA 2QGFB 3CC4S 2GIFA 1ICEB 3TJ9A 4AYBD 4YS2A 2W9BA 4ECYA 1M1GA 4NA3A 3K8WA 2AT1B 4U7CA 4C48A 1CLFA 1RUSA 4WKYA 3CCVS 4Y2KA 4JI2F 4CT9A 2LU2A 4LJMA 2IYIA 2CG4A 2G2ZA 4AT1B 2HKEA 1T8EA 4UQTA 4OL8A 3W9JA 1C1CA 5HVFA 1BQMB 1VQKS 2DXEA 2ALYB 3KNAA 1IKYB 1KDNA 2PMWA 4UT4A 4DQPA 2GFFA 1HNWJ 2PA8D 2ZH8A 4DL3A 1S72S 4ZPWR 3MECA 3G6ES 2QSFA 4OJHA 4DPYA 4F04B 2GIRA 5I4MA 3ZTPA 4YDDB 1Y0HA 3IS9A 2Z56B 3PX6A 4R0JA 4EFAC 2NXCA 3CCUS 2XZTB 1WF0A 1A7GE 3NWGA 2JEJA 3W64A 4ED3A 2DRDA 5KFUA 5ETTA 2VL1A 5E3CA 1URRA 2ZUGA 5D15A 3KLVA 3PRDA 4C8MA 2Q3PA 2HVIA 2DCUB 4F25A 4LUBA 1JMTA 2MSTA 3GFZA 3KNGA 2B9YA 2H5JB 5HQ8A 3R5BA 1IBKF 2D69A 3ZTQA 2CADA 2HS3A 4I2QA 2V8GA 3H98A 4TNOA 5AE3A 4K4WA 3PO5A 4PXDA 3AY0A 4DV5J 4QWEA 4CH1A 3KLGB 4B08A 4A8OA 4YMEA 2EKYA 2CFXA 2QLJB 3DLGA 4OZ1A 4C0OC 1HBOB 3UR0A 1ZM3A
chains in the Genus database with same CATH topology
2CUYA 2QJ3A 3HHDA 3TQEA 2G2YA 2QO3A 2G2ZA 3TZYA 3H0PA 2VZ8A 2G2OA 1MLAA 4QBUA 3RGIA 3SBMA 3BV8A 5DZ7A 3TZWA 5CZCA 3K89A 2JFKA 3EZOA 2VZ9A 2QC3A 3G87A 2VKZG 2C2NA 3IM8A 3TZXA 2HG4A 5CZDA 3IM9A 3PTWA 3TZZA 3HJVA 3CJ8A 2G1HA 3QATA 4RL1A 4RR5A 2JFDA 3HMJG 3R97A 2H1YA 1NM2A 2PFFB 3R8YA 5DZ6A 2UV8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUY A;  2QJ3 A;  3HHD A;  3TQE A;  2G2Y A;  2QO3 A;  2G2Z A;  3TZY A;  3H0P A;  2VZ8 A;  2G2O A;  1MLA A;  4QBU A;  3RGI A;  3SBM A;  3BV8 A;  5DZ7 A;  3TZW A;  5CZC A;  3K89 A;  2JFK A;  3EZO A;  2VZ9 A;  2QC3 A;  3G87 A;  2VKZ G;  2C2N A;  3IM8 A;  3TZX A;  2HG4 A;  5CZD A;  3IM9 A;  3PTW A;  3TZZ A;  3HJV A;  3CJ8 A;  2G1H A;  3QAT A;  4RL1 A;  4RR5 A;  2JFD A;  3HMJ G;  3R97 A;  2H1Y A;  1NM2 A;  2PFF B;  3R8Y A;  5DZ6 A;  2UV8 G; 
#chains in the Genus database with same CATH topology
 2F63 A;  2E66 A;  1DTQ A;  3I9Z A;  1Q86 T;  2RUS A;  4RW4 B;  2YWH A;  1RT5 B;  1VGY A;  2FLO A;  2YNI B;  4E2F B;  5HJX A;  4NYP A;  5HVH A;  3GJS B;  4GO7 X;  4OZ0 A;  4A8F A;  2MZJ A;  2CPZ A;  2UUB J;  2J7U A;  3VHQ A;  4O3P A;  2NLW A;  1HI0 P;  4NRU A;  3W60 A;  1KQS R;  2AW0 A;  3CME S;  2R3V A;  3ZNJ 1;  3DYA A;  1SKS A;  5KT5 A;  4WWS A;  1GQE A;  2JZ5 A;  1N54 B;  1CEZ A;  2KXF A;  3PYG A;  5EN1 A;  2UU9 F;  1OQ3 A;  4DV0 F;  1LWE A;  4QWA A;  1FNM A;  3OL6 A;  4C11 B;  2ZH4 A;  4NMX A;  1QSS A;  2KM8 C;  2H65 B;  3CB4 A;  1U1R A;  2C22 A;  4NYO A;  2C2E A;  5EUH A;  1S9F A;  4M5J A;  2RHS B;  2FHJ D;  5CZC A;  1T3O A;  4EYH B;  2FYX A;  4O3Q A;  4BC7 A;  4KO0 B;  3QZ7 A;  1TTH B;  4WFN Q;  3FBF A;  1CBK A;  2DR6 A;  4ETX A;  1VC5 A;  1NK4 A;  4PRF A;  3ET6 A;  4QR2 A;  3K57 A;  4QU6 A;  4DV3 J;  4PPZ A;  5BYQ A;  2ZOG A;  2K7J A;  1ZAV A;  4DSF A;  2P9G A;  2VIH A;  1Q82 T;  3UPF A;  3T1H J;  3BGU A;  3DMJ A;  2GIQ A;  1N88 A;  1RAI B;  3GTY X;  1S9G B;  1CSJ A;  4KPC A;  3ZC4 A;  1XNR F;  2V5H G;  1JJ4 A;  1G2E A;  4X4N A;  3FRY A;  3M2R B;  1MU2 B;  3UNY A;  2X3G A;  1E6V B;  4J9M A;  4FS2 A;  4UQG A;  2MQM A;  2OPS B;  3U1N A;  1LWC B;  1TKX B;  3SBM A;  3M1V A;  2WOM B;  3NS7 B;  3EGZ A;  1KR4 A;  3M32 A;  4QYZ K;  1QM9 A;  3BN4 A;  2XSJ A;  4YB5 A;  5AE1 A;  5JXS A;  2D1C A;  3M9M B;  1YKW A;  2DKO B;  5KFP A;  2WVD A;  2IRU A;  4KGX B;  3SI8 A;  3LAN A;  4OYA A;  5IS2 A;  3RB0 A;  1WHV A;  1U8W A;  3MFI A;  4L76 A;  5L8R C;  1RXO B;  3W61 A;  2ZDO A;  3MI7 X;  1R8P A;  4X66 J;  4AXI A;  3D68 A;  1B64 A;  1FWP A;  4OX6 A;  4N7T A;  2OIH A;  4LFA J;  1U1P A;  2L9W A;  3FFI A;  3D3B J;  3W7B A;  3FCH A;  1RTJ A;  4F3O A;  2RAQ A;  5T7L A;  2MKC A;  1V9O A;  1DQ9 A;  5KT4 A;  3DLK A;  5ETL A;  3W5X A;  3LO3 A;  2VC0 A;  3KJN B;  4MAK A;  2HFV A;  2VJU A;  1TKT A;  1SJ3 P;  3QFW A;  3BQ0 A;  2VZ8 A;  3MD1 A;  3J7Y I;  5DQI A;  1RBO B;  2DNG A;  1SH3 A;  2B4O A;  2Z2Z A;  4NLT A;  2H4Y B;  2J0Q D;  4DZ6 A;  4JUZ A;  1RT7 B;  4GKK J;  4ECW A;  1XR7 A;  2RHQ B;  1S0V A;  3TAQ A;  3CO9 A;  2E5J A;  1LOU A;  4JBC A;  2HW3 A;  1CG2 A;  2UVR A;  4Q2L A;  3S6E A;  2PD1 A;  2HMI A;  3MPW A;  5BR8 F;  1RCO B;  1VQO S;  1JLF B;  1QUP A;  4QR0 A;  2QLW A;  1O0P A;  1Q95 G;  1UWA A;  4E98 A;  3BSC A;  3MMC B;  3GYN A;  1PG5 B;  5HAT A;  5K8P A;  3OUY B;  1NK7 A;  4OHX A;  3CSK A;  3MM8 B;  3KLH A;  3A8I A;  4J9V A;  3NL0 A;  1FRK A;  4FS1 A;  1TV6 A;  4OJ3 A;  2QA1 A;  2CQI A;  3W2W B;  1B0P A;  1R8B A;  4NOH A;  2F9J A;  1MNE A;  3HX9 A;  3TA1 A;  3RG6 A;  1JXL A;  4QIF A;  3MMB B;  2BOP A;  1F60 B;  3VVU A;  4TVA B;  2K8G A;  1IJE B;  2F4V F;  3WC0 A;  2IJF A;  4L3K A;  4CRJ A;  2MMY A;  4EZ6 A;  4OQJ A;  2B8Q A;  2HFU A;  3MR3 A;  4Y2C A;  3TJ8 A;  2JLF A;  1DHM A;  3CJ3 A;  3MTJ A;  1Q79 A;  2PEH A;  2MXY A;  1RTH A;  4OZL A;  3W8G A;  1AW0 A;  3OL7 A;  4IFV B;  4I56 A;  3CD5 A;  1HNV B;  1WKJ A;  2XMA A;  2BAN A;  1Y3J A;  1U2F A;  2NXU A;  2YPY A;  1RCX B;  4XTT A;  4XAK A;  3C8Y A;  4B3T F;  5IT9 Y;  1HW9 A;  1KON A;  3K59 A;  1FK9 A;  1RBA A;  5L1K A;  1X4G A;  4B9V A;  4EMD A;  4C98 A;  3H42 A;  1FD8 A;  2H5E A;  1PJ5 A;  1S4F A;  1ULR A;  3US5 A;  1RWK B;  4YOE A;  2ZDP A;  1RT1 B;  3GMG A;  3EGV A;  3BYP A;  3WBZ A;  3MCS A;  1KTQ A;  5KOX A;  1WEZ A;  2CAJ A;  2ZE2 B;  4C8Z A;  2KTQ A;  1FXD A;  1HPZ B;  4UZC A;  1XC9 A;  4HVZ A;  4GRS A;  2XC9 A;  4JP8 A;  4C9D A;  2OSQ A;  3H5U A;  3CDW A;  3H0P A;  2UUW A;  3NNC A;  1QDU B;  4QIW D;  3DDK A;  2CZ4 A;  3UCG A;  1L3U A;  2PE8 A;  2XG8 A;  3DRP B;  5DDP C;  3CJ5 A;  4ZS6 A;  3D9B A;  3VAL A;  3AXK A;  3DI6 B;  3QGH A;  1TMJ A;  3J81 j;  4X4S A;  3ZZZ A;  5D6G A;  3U1L A;  2JX2 A;  4XO0 A;  4IYQ A;  5GAE U;  4K2J A;  1RTI B;  1CUL B;  4ZN1 A;  1Y4Z B;  1KHW A;  2HHV A;  3NMA A;  1NSK L;  3GV8 B;  2IAJ B;  2AJ1 A;  4PXE A;  5HL7 Q;  3H5S A;  5KG3 A;  1ZM4 A;  2BW7 A;  3CIM A;  4H4K C;  1ACM B;  2WON B;  5H9F K;  2ZBR A;  2HLT A;  3AJD A;  2JSX A;  5EWE A;  1FDD A;  3QSI A;  4X62 F;  2WCX A;  3AOA A;  3UNG C;  1AFJ A;  4ZMM A;  5A8K B;  2KJW A;  4WU2 A;  1QTM A;  3N6M A;  4LF7 F;  2EK1 A;  4J7C A;  4K2X A;  1UVJ A;  2ZFH A;  2NS1 B;  5C25 B;  2FJE B;  3G6Y A;  3FGV A;  3J81 Y;  2DGT A;  4ID5 A;  3Q2S C;  3WIU A;  1M1K T;  3BBC A;  4L74 A;  1IBM F;  3PRB A;  1NB2 A;  5I3U A;  1DZ5 A;  2WVB A;  1SJQ A;  1D9D A;  4OI0 A;  3RBZ A;  1QD1 A;  1RT2 A;  3R5A A;  1TL4 A;  3KJQ B;  2WZ1 A;  3RB6 A;  3NGR A;  4GO5 X;  1JLQ A;  5BXI A;  2OPP B;  1KQF B;  4ECX A;  2GO8 A;  2UXB F;  2CQC A;  1Y9O A;  2O01 C;  3P96 A;  5F8N A;  2HZV A;  4B9S A;  3L7P A;  3NLC A;  1AB8 A;  2LEP A;  1JKH A;  5ETV A;  1YJ9 S;  3KMQ A;  3GLJ A;  1JX4 A;  1RAA B;  4ECZ A;  2Q66 A;  1YBA A;  3A13 A;  2YH1 A;  4W4M A;  1PJ6 A;  2MZS A;  1VIO A;  3UDE A;  5HRO A;  4WE1 A;  2RT3 A;  3BZQ A;  1S77 D;  1YWX A;  4Q2M A;  2DEJ A;  1S99 A;  3PY8 A;  3N6L A;  4LF1 A;  1B0V A;  3W5Z A;  3KYL A;  2I2Y A;  3OFG A;  3WX4 A;  2DHX A;  2I5J A;  3TR5 A;  2AIR B;  2IVY A;  3X3U A;  2YY3 A;  5B0B A;  3MDF A;  2Z2Y B;  4ENO A;  4NCG A;  5I3Q A;  4ZK7 M;  2YKA A;  1K1Q A;  2N3L A;  3BQ2 A;  1A6L A;  4EO6 A;  3LW5 C;  1S6P A;  3G4S S;  3ULH A;  4RW6 B;  4IOC Q;  1TK8 A;  1VHI A;  1WDT A;  2AGQ A;  1RKJ A;  1F2H A;  3PJW A;  2G13 A;  4AFF A;  1RAJ A;  5D0E A;  4A46 A;  3I0S A;  1S97 A;  5KFI A;  3SQG B;  5DM6 Q;  2DIT A;  1SV5 B;  1FVS A;  5LXY A;  2Q6B A;  3UO0 A;  3AA8 A;  1WG4 A;  4NYZ A;  1HD0 A;  3CC7 S;  4HHJ A;  4OMF G;  3BRE A;  1R8C A;  1HBN A;  1D8Z A;  1TKZ B;  4I7F B;  3NBP B;  2QL5 B;  3M4X A;  4WBF A;  3AD9 C;  4ZP8 A;  4FVM A;  3I0R A;  2ZD1 A;  3DOK A;  1D0E A;  4DV4 J;  5F0U A;  2FY8 A;  9RUB A;  2NPF A;  2R2R A;  2CQH A;  2O1P A;  3AD8 C;  2V8H A;  2IJN A;  3MR7 A;  1VRU B;  1HMV A;  4F4K A;  3ZFV A;  1TQL A;  2DYA A;  4IKA A;  5KT2 A;  4B9U A;  4FDF A;  4KGK A;  2DJW A;  4PQU A;  3GE9 A;  3ONQ A;  4HHU A;  1NEE A;  3BGR B;  5EX3 A;  4ATN A;  1UFK A;  2JFK A;  3M6X A;  2GC8 A;  5HMY A;  3DU5 A;  3HFK A;  4TQS A;  3S8S A;  1U6F A;  2BAB A;  3DM2 A;  2AZ1 A;  1FX2 A;  2R7X A;  5A76 A;  2RD5 C;  4DV2 F;  3W5Y A;  3KLE B;  2HNZ B;  1CJK B;  4NXM F;  3HFV A;  3G6X A;  2DNL A;  2GML A;  1ZOT A;  1VI7 A;  1S1W B;  1D8Y A;  2QA4 S;  4UUX A;  4BC9 A;  1I1G A;  2JRS A;  2WSC C;  2RRN A;  1WC5 A;  1UZH A;  5D8H B;  4L6V 3;  2AJQ A;  1T9V A;  2OTL S;  1SUQ B;  1DQA A;  1JXE A;  2B9E A;  2B5J B;  2VFR A;  2SXL A;  2ZM6 F;  2EVZ A;  4AD6 A;  1ZS6 A;  2IJR A;  1YZ7 A;  2BYC A;  4JI8 F;  4RW8 A;  4R5P B;  2KYX A;  3U02 A;  3BF4 A;  2K3I A;  4N47 A;  3JTO A;  2EPI A;  2R2U A;  1UTA A;  4PPD A;  5F41 A;  4KHP F;  4LRE A;  4QPT A;  1T7P A;  2AHO B;  1C0T A;  4KV8 A;  3RUB L;  4J9S A;  3FZB A;  2QMU B;  4R0E A;  1Y5I B;  2A3J A;  3OTD A;  4YY3 J;  3VZH A;  2FJB B;  5J2Q B;  3QJJ A;  4MK9 A;  2YKO A;  4P2S A;  1S9E B;  5L9N A;  4E8U A;  2IVF B;  1LK7 A;  4UZB A;  1F5C A;  6FDR A;  3GFY A;  1XK8 A;  1OWX A;  5IM0 A;  3BO4 A;  1HHT P;  1BD6 A;  4LFC F;  2MDA A;  2GMH A;  4ZCI A;  2B7C B;  4A8Q A;  1KSP A;  2DGU A;  4X4V A;  3P5T L;  1T9Y A;  1WEL A;  1VLO A;  4FYV B;  2VQF F;  2FQQ B;  3K89 A;  3BN7 A;  1WI8 A;  4QYZ J;  5G0R A;  4TY9 A;  3CJ4 A;  4NLV A;  5HN0 A;  1J27 A;  4MJK A;  2L9D A;  2BZ2 A;  4JV5 F;  1FTR A;  3P8B B;  5KTQ A;  2Y8Y A;  5D77 A;  3M6W A;  3TAM A;  4G1Q B;  1Q5V A;  3T41 A;  3CCW A;  1S1V B;  2J0W A;  4DR7 J;  4NLP A;  1TL7 B;  2M5Y A;  1RWO B;  2PN6 A;  4ZCM A;  3QYY A;  3UDC A;  2OPQ A;  3D1Q A;  2H4W B;  2CQB A;  5KG5 A;  3HVW A;  1UW4 A;  2G0C A;  4PG5 A;  2CRL A;  1O5J A;  1PYO B;  4OYX A;  1F9H A;  3R8Y A;  2FLL A;  1WAC A;  2FLN A;  1N8R T;  4LSL A;  3M8Q B;  4ZP7 A;  4HDG A;  5CYQ A;  5J1N A;  3LP0 A;  3TZX A;  4C3M A;  1WDD A;  5ADZ A;  2MLY A;  2FC8 A;  2P5V A;  1VBK A;  5GAD I;  3C2P A;  1MWY A;  3SZ2 A;  1U7L A;  3D67 A;  2BA9 A;  2JEF A;  2HYI B;  1L5U A;  4JYA J;  2WVC A;  5IZH A;  4LF4 J;  3PYF A;  3UDV A;  1H2T Z;  5K8M A;  1AZS A;  2DEI A;  1IUJ A;  3WIV A;  1FNO A;  1GTE A;  2HVZ A;  3N9U C;  1UFW A;  2R2T A;  2APO A;  1JLA A;  3L09 A;  2CXE A;  5FLX U;  3RGI A;  1P27 B;  1CJV A;  3HT3 A;  1HBU B;  3V6D B;  4OHY A;  1ZAX A;  1BMQ B;  1WSV A;  1U1M A;  2V2Z A;  4USU A;  1HNZ F;  2ILY A;  4LSN A;  2CJK A;  2IDL A;  2OEK A;  1SJR A;  2V0N A;  5MAO A;  1CQN A;  4Y65 A;  1OYD A;  5GMK a;  1TZ0 A;  5J1E A;  1R27 B;  1XBW A;  2CA9 A;  3TVZ A;  2BQU A;  4OYW A;  2HSE B;  1KHV A;  1NHK L;  1L3K A;  2WK4 A;  4M5N A;  4DXL A;  2DCL A;  5IWA F;  2N7Y A;  5U47 A;  1KWM A;  4EGL A;  3BGF A;  1U2R A;  1KC8 T;  2M52 A;  2ZZM A;  3TUP A;  2MZ1 A;  3LWL A;  4NI2 B;  2J6U A;  3I4H X;  2FJV A;  5C5J A;  4KAI A;  3F56 A;  1X7V A;  1IR2 A;  1YGY A;  4LIR A;  2JWN A;  2XUL A;  4FYY B;  1IVZ A;  4UOF A;  4HL9 A;  3JSY A;  3D4J A;  3M05 A;  1NXI A;  2XMW A;  2YKN B;  1YHQ S;  1OO0 B;  2HQD A;  2IPO B;  4NA1 A;  1EKS A;  2ZKU A;  4IG3 A;  1WOP A;  1SC3 B;  3PM9 A;  3CJ0 A;  2HAI A;  1QE1 B;  3CC2 S;  5AXM A;  1G3O A;  4IR9 A;  4O3R A;  2YWG A;  5ITH A;  3CCL S;  1LXJ A;  2K2P A;  1YX2 A;  4DR2 F;  1PAU B;  2ATL A;  1KNZ A;  2DRB A;  4NCA A;  3UWT A;  3LGH A;  4RW7 B;  5L1I A;  5I3P A;  2DH8 A;  3KHH A;  1VK3 A;  4JI3 F;  3AOC A;  1UPP A;  2KVI A;  3RBD A;  3KG1 A;  1G7C B;  3N79 A;  2R7Q A;  1OIA A;  5J2P B;  2YWK A;  3EM1 A;  1EHW A;  5A8W B;  1U0H A;  4I4B A;  1KQK A;  3K8V A;  1FJE B;  2CJQ A;  4J9U E;  2XS7 A;  3V5R A;  2CPE A;  2C3O A;  4QQB A;  4WFY A;  3TVY A;  4PAA A;  1VS3 A;  5D4P A;  4FYX B;  4RL1 A;  2LYV A;  3CDU A;  5LMU J;  4WK3 A;  2B0G A;  2VDH A;  5KFZ A;  2NSB A;  3GR1 A;  5E2Q A;  3WQP A;  1SPB P;  4CM0 A;  2D41 A;  3MM7 B;  1E6Y B;  1DFD A;  3NKY A;  1S6O A;  5KG2 A;  1A0O B;  3QIP B;  5KFO A;  4CH0 S;  2MQO A;  3H90 A;  3FBE A;  3QO9 A;  1WG5 A;  3ISN D;  3VWS A;  5H9F J;  3IM9 A;  1BHN A;  3LOU A;  1N32 F;  2DR8 A;  3GIL A;  5J2M A;  4RNM A;  4LF8 J;  4OX9 J;  3K5N A;  4PKD B;  3DDN A;  2ZJQ Q;  5FDL B;  5DQH A;  1DQ8 A;  2XWX A;  3E01 B;  3OFH A;  4IDK B;  3LAL A;  5L1L A;  1OY9 A;  2XO6 A;  1FWK A;  2HG4 A;  2EW9 A;  1MMD A;  2AYG A;  3PKY A;  2B56 A;  2E5L F;  3A1Y G;  1JQG A;  1NM2 A;  3Q8U A;  4M5I A;  1TUV A;  4J9P A;  2VC1 A;  2FUG 9;  5HAO A;  1NJI T;  2QE5 A;  4X64 F;  3IRW P;  4ILL A;  4K4X A;  2PDA A;  4ZVF A;  3GII A;  3DGP B;  3QQC D;  5AXK A;  1U1O A;  2OI2 A;  2FJX A;  3G82 B;  2KJV A;  1NDP A;  1NKC A;  2EFO A;  1FER A;  2J8S A;  2HHQ A;  5T14 A;  2D3O 1;  1TMM A;  5AJ3 J;  2Y9H A;  1RLD A;  1SH0 A;  3BSO A;  2YKQ A;  2VV5 A;  1DAX A;  3V81 B;  1IKV B;  4Y34 A;  1RAF B;  2V9W A;  4IQX A;  2HHX A;  4JI5 F;  4NZ6 A;  1FI4 A;  4JI7 F;  3FKB A;  3GJT B;  1L3S A;  2JC0 A;  2YNG A;  3NCQ A;  4FNI A;  4PCQ A;  4H4O A;  2HNY B;  3ISN C;  3T5J A;  2HWH A;  3GV7 B;  1BGX T;  2VOD A;  2AV5 A;  2VBX A;  3MM9 A;  3BQ1 A;  4XIU A;  2V2K A;  1DUR A;  3CMQ A;  3OTC A;  3LTO A;  4NCB A;  1LW0 B;  1WC0 A;  3I4P A;  3GSD A;  1H74 A;  1DLO A;  3DOL B;  2Z8Q A;  1YK9 A;  4EBE A;  2BKP A;  1DJ0 A;  5KFC A;  5HLF B;  4WFZ A;  2AEF A;  5KFT A;  4NLQ A;  3QRQ A;  5KFM A;  3HVT A;  1YJU A;  3MEG A;  2CZ9 A;  5HSP A;  1ZA1 B;  4DV7 F;  3FBB A;  3D28 A;  1WHX A;  1IKY A;  4QW9 A;  3EVO A;  3IC1 A;  1W2I A;  3A8E A;  4RUC A;  3HD1 A;  4YHH F;  1ARO P;  2GQC A;  2BAC A;  2DK2 A;  4DDF A;  1AT1 B;  2F9D A;  4K5R A;  3HKZ D;  3EZO A;  4LRD A;  4DSK A;  4I68 A;  1N48 A;  2J5A A;  3KFW X;  4HAC B;  2DTJ A;  1WUU A;  4MTP A;  3C6U B;  2ERR A;  2M9K A;  1MRO B;  2WBR A;  2ATC B;  4AND A;  4HDH A;  4EYI B;  2DGO A;  2XYH B;  3MED A;  1T03 B;  1U26 A;  1B3T A;  1HIY A;  4DUZ J;  3D1O A;  2A6O A;  3WC2 A;  4B17 A;  5F8H A;  4JV1 A;  3A8K A;  2XHC A;  3CVK A;  4OZ2 A;  2LCW A;  2ZC3 A;  3SCL E;  1F3V A;  2BKO A;  3R3T A;  4YR2 A;  1B4S A;  1LQ9 A;  2A0F B;  1VIX A;  2A2D A;  3AT1 B;  3HHN B;  3EYZ A;  4IFY A;  2GS8 A;  3DRR B;  1SCJ B;  4OX8 A;  4LVN P;  1RWW B;  3MPD A;  2DR5 A;  4OHW A;  2DGV A;  4ANC A;  2VB6 A;  3OTE A;  2M8H A;  1S1T B;  3FBC A;  3RB3 A;  1IKX A;  4OJG A;  2J9D E;  5IC4 B;  2OPR A;  2EWH A;  2P8I A;  4ZVE A;  2L48 A;  4CT8 A;  4CLZ A;  4DFJ A;  5HMW A;  4K4V A;  1Y10 A;  3QGI A;  1N33 J;  1RAD B;  2U1A A;  4RNO A;  4CIO A;  1V3S A;  1RTD B;  4BHQ A;  2EXU A;  2EK6 A;  4ZPT R;  2ZBC A;  4PUO A;  4P2M A;  3THP A;  3KHL A;  2PMH A;  4EWT A;  2KRB A;  2B4U A;  4PYD A;  1U24 A;  1G6B A;  2UV8 A;  1P1T A;  1GK8 A;  4IO9 Q;  1IKW B;  1GMW D;  1R0A B;  3MM6 B;  5EGY A;  1U45 A;  2DPI A;  2R7O A;  3LPE A;  2VFU A;  1WEY A;  2XS5 A;  4CWB A;  3NXZ A;  1RWP B;  2RIL A;  4WJB A;  3DOM A;  4F67 A;  1U02 A;  4NLR A;  4K8R A;  4YEA A;  1H2U X;  5L38 A;  5D3G B;  3CPW R;  2OLW A;  3G2X A;  3F41 A;  3LWM A;  1KLM A;  1RE1 B;  4J9L A;  1BWE A;  4UY8 5;  2KXH A;  4DUT A;  4Q0B B;  2ASY A;  2I9S A;  2BX6 A;  4GVB B;  3M30 B;  3BGO P;  2J6S A;  2HUR A;  4CO4 A;  2EC2 A;  2HHP A;  3RRK A;  2ACM A;  3V4I B;  1U1K A;  4DQQ A;  5KFA A;  4CZC A;  4PAB A;  5A0Y A;  1XJW B;  3LUY A;  3RAX A;  5HMX A;  3JSB A;  3H59 A;  2VOP A;  4NZ7 A;  1FKP A;  1X5O A;  1Y5L B;  4QWD A;  3KDO A;  4C2M A;  4NPO A;  3EVW A;  1UMJ A;  3MEE B;  1MMN A;  2D3O R;  2QG9 B;  1D3W A;  1YJV A;  2AX0 A;  3W9H A;  1DTT B;  1H72 C;  4DPU A;  1ZTW A;  3Q0A A;  5EWG A;  4DV5 F;  4F02 A;  4WPA A;  1H0H B;  4U8V A;  1KD1 T;  1JJ2 R;  3H5X A;  1QTN B;  4AQY J;  3OLA A;  3CJQ A;  4F8R A;  1FXR A;  3VAH A;  4RW9 A;  1RWV B;  1WI6 A;  4ZDN A;  3M8R A;  1CJT A;  4DUY J;  1D9F A;  1SC4 B;  1EET A;  4HLB A;  2RSQ A;  2UUB F;  1RK8 A;  1FCA A;  2QO3 A;  7FD1 A;  4B3O A;  2M7S A;  3L3C A;  2J0S D;  2KYZ A;  2HQ3 A;  1KVK A;  4WP3 A;  1EP4 A;  2BRL A;  2XI2 A;  5B0G A;  3PDN A;  3Q89 A;  3C15 B;  5E3Q A;  4PWD B;  1WTF A;  4ED5 A;  1WHY A;  4U7U K;  2IBK A;  2R7V A;  5CAA A;  3IWN C;  1KFD A;  8RUC A;  5LSL A;  1EX8 A;  3CD6 S;  2Y1I A;  2W9B B;  4LQ9 A;  2V6A A;  3GWC A;  3Q86 A;  3C3L A;  2RQK A;  2FY1 A;  1CJU A;  2G1D A;  3O2I A;  2C2D A;  3M2V A;  3UN5 A;  2HHW A;  1HQE A;  2KFN A;  2YQ3 A;  4PZV A;  2OML A;  1T02 A;  2OFH X;  3SIP B;  2YBV A;  3G8T A;  1C1C B;  1CVJ A;  4ZPD A;  1FKO A;  2HFS A;  2UU9 J;  4DF4 A;  4KFB A;  2O66 A;  5LMN J;  4QJV A;  4DV0 J;  1F1B B;  2KU7 A;  2F4F A;  2LXI A;  2FVQ A;  2RKI A;  3EPG A;  1JXV A;  4DV3 F;  1LFP A;  3MEC B;  5FLX Y;  4B9M A;  2JEI A;  4K4Z A;  3QT8 A;  2VZ9 A;  3T1H F;  3IS9 B;  1NJX A;  2VFT A;  4Q8F A;  1FXL A;  4ID8 A;  3QT5 A;  3MCM A;  3L95 X;  3RR7 A;  1N0V C;  3MHY A;  1PO6 A;  4Q7A A;  1U6B A;  1X9S A;  3T5H A;  2HLU A;  3ZZR A;  3MM8 A;  4GC6 A;  1UPM B;  2IY5 B;  4DL6 A;  1JLG A;  1HI8 A;  5F8I A;  2V69 A;  3M8W A;  1VBX A;  1XNR J;  7FDR A;  2CQP A;  1KS2 A;  3S01 A;  4DCO B;  3PEJ A;  3I5A A;  5KT3 A;  1JLE A;  5KFL A;  4K0K F;  3DLG B;  4ED2 A;  3KLF A;  3SMZ A;  5EWF A;  2Y1J A;  1DTQ B;  1CPZ A;  3S7R A;  1SQF A;  4X66 F;  4CCH A;  3M6U A;  2BJ3 A;  4LFA F;  1HL6 A;  2X51 A;  4P10 A;  4XDD A;  1U25 A;  3ICL A;  3AHP A;  5KFN A;  2NXN A;  2YX1 A;  3IBF B;  4GMK A;  2ZZN A;  4ALZ A;  2HIY A;  3AQP A;  4DOZ A;  2ASD A;  3G71 S;  3J7Z 5;  1W2B R;  2LQ5 A;  3HSJ A;  4OHV A;  3FDS A;  3KKF A;  2W8K A;  3K5M A;  3DYA B;  2I38 A;  2XZW A;  5AXL A;  3NY0 A;  3MMJ A;  5F3T A;  4O4G A;  2CVI A;  2UXC F;  1S5Z A;  5ETP A;  3FSX A;  4HI2 A;  5DGB A;  3JXO A;  4RUB A;  4I0W A;  1N5Y A;  1VRQ C;  3ILL A;  1HNX J;  2VBY A;  1LWE B;  5C7P A;  2HFO A;  2F40 A;  4J9N A;  3OD2 A;  2LP4 A;  2DT9 A;  1T9X A;  4GKK F;  3NCP A;  3QSY B;  2GQ2 A;  3MWB A;  3V4M A;  1VC6 A;  1G1X A;  2YWW A;  3G86 A;  1VQY A;  3K5O A;  3DXS X;  2OD4 A;  1RU2 A;  1S57 A;  3IM8 A;  5JJB A;  1VBZ A;  4QWC A;  4ZP9 A;  2C2K B;  3JQK A;  1T94 A;  5HK4 A;  4RR5 A;  2JL9 A;  3IR6 B;  5IT4 A;  2RDI A;  5FD1 A;  4WU3 A;  2XGQ A;  4XDC A;  2XNQ A;  2M88 A;  3TUZ C;  3I82 A;  2W9A A;  2DIS A;  1RGV A;  2CPX A;  2M3D A;  3OW2 R;  3ET6 B;  2KT2 A;  3ETO A;  2Y3Y A;  3FCW A;  4Z37 A;  5ETS A;  3KG4 A;  3DMJ B;  2VG7 A;  5BR8 J;  2ROP A;  2ZNY A;  2H51 B;  2W2P P;  1I51 B;  1UKU A;  2BE2 A;  1H7X A;  4CH7 A;  5GAH I;  2FD2 A;  3RBX A;  4F0K A;  4R8U A;  4ZIV A;  2IBO A;  4M63 A;  3J80 Y;  4DR4 F;  4ZVO B;  2ZBI A;  4MIA A;  3M1V B;  2MKJ A;  3R1H A;  3I6P A;  3M32 B;  3AB4 B;  2XSJ B;  1B0T A;  3QGP A;  4NLO A;  1RIS A;  2W2O P;  3CCR S;  2MJU A;  3BO3 A;  4BCA A;  1W26 A;  3EXY A;  3PAC A;  1N6Q A;  2VG6 A;  4X4P A;  3KDN A;  1QAX A;  2BKN A;  4DQS A;  4HEA 9;  4QYR A;  3D6F B;  1O8B A;  3ZZY A;  5HBM A;  2QA4 G;  2K7K A;  2KT3 A;  3FFI B;  1FD2 A;  1S4E A;  2HHH J;  1WSR A;  1RTJ B;  2IC3 A;  1Q1K A;  5HMZ A;  2HRU A;  2CNN B;  3FMB A;  1F6T A;  3E51 A;  3DLK B;  2XBP A;  3GG0 A;  4OZJ A;  5B09 A;  3LQV A;  3EDQ B;  1X4H A;  2HK3 A;  3R7B B;  1TKT B;  1NO8 A;  2LA6 A;  2MKH A;  3AH6 A;  1RHK B;  2CQ3 A;  4MKY A;  4LVO P;  4DCP B;  4ES2 A;  1BLU A;  1FEE A;  2QV6 A;  3B6B A;  3OJS A;  4OLO A;  3CCE S;  4KGZ B;  4LR9 A;  4V19 X;  2EFP A;  3M8S A;  1NBE B;  1FDA A;  1TVR B;  4F50 A;  3QNW B;  1KN6 A;  1FRX A;  1I5O B;  3VAI A;  3HHL A;  3MGJ A;  4OYP A;  3BH6 B;  4XPE A;  4OZN A;  4MKB A;  3JQM A;  2NZ4 A;  2G2O A;  2XI3 A;  3G6V A;  2C3Y A;  3M9O B;  3KLH B;  2AJ0 A;  1EB0 A;  4A8Y A;  2ASL A;  4UF4 A;  3D54 A;  3PKM A;  3CNQ P;  1TV6 B;  5L39 A;  4I2P A;  3R2C J;  3HO1 A;  3R5D A;  3ITH A;  1JJC B;  3CF5 Q;  3BDP A;  1SQG A;  1EQ0 A;  5E3P A;  1BQN A;  1DAR A;  1M5V C;  3HD2 A;  3MOJ B;  2DGW A;  5DLF A;  4NAS A;  2MGZ A;  2DD8 S;  3BKU A;  2VHG A;  1Z1Z A;  1RAG B;  2YPZ A;  4FZV A;  1TK5 A;  5DDQ C;  1PCA A;  1M1H A;  2XEX A;  2Z30 B;  2LQ9 A;  2VPX B;  1SXL A;  1RTH B;  1HI1 A;  3EDR B;  2KFY A;  4Z7Y A;  3MEK A;  2VD3 A;  1TUG B;  3K7R A;  9ATC B;  2W2Q P;  4J37 A;  1JWW A;  2I0X A;  1VCT A;  3EJM A;  2BAN B;  4KHM A;  2RH3 A;  1R8A A;  5LJ3 Y;  1FFW B;  4M5D A;  4LF9 F;  1FK9 B;  1O6X A;  1SH2 A;  1UZD A;  1TAU A;  2JLG A;  3CJR A;  2V67 A;  1UVM A;  2VBZ A;  3MPY A;  1NPK A;  4Q43 A;  1WC4 A;  1VJW A;  2WSE C;  2HND A;  4DX6 A;  2W7O A;  1YVF A;  2M8D B;  1LW2 A;  4RBV A;  3F44 A;  2XCP A;  3TO8 A;  2QZ8 A;  2QSW A;  3HCX A;  2ZVI A;  3D5M A;  2FDN A;  2ZBP A;  2JEG A;  4YFU A;  4E0D A;  2WB4 A;  4CO0 A;  4DL0 C;  5H1S V;  2QYG A;  1NPP A;  4A8W A;  3OV7 A;  4K7Q A;  3G87 A;  4LBP A;  4WXW A;  4HHH A;  3I5B A;  5C24 A;  3V2U C;  1SUQ A;  4KH1 B;  2DY9 A;  2KM8 B;  1Y5N B;  3T5K A;  3CGI A;  1Q53 A;  1HHS A;  4ELT A;  3UR3 C;  2AJF E;  5DG7 A;  1M5O C;  4KT0 C;  4ZCL A;  3LP1 A;  3PIP Q;  1SJ4 P;  3OR2 A;  4OYO A;  4HTI A;  2R7U A;  4DQI A;  1UVK A;  3IXQ A;  5DGA A;  1HWL A;  1KRP A;  5LSR A;  2BE7 D;  2CQ4 A;  3PZP A;  2R8J A;  1TL5 A;  4WYL A;  2QLX A;  4LRC A;  2C2M B;  1TEL A;  2P9E A;  2R8I A;  1XMQ J;  5DQG A;  3E8O A;  1TL3 B;  5KG4 A;  3LA0 A;  3CTR A;  2ZH3 A;  4KSE B;  2R7W A;  3CUN A;  3PRV A;  3HUL A;  1IWG A;  1R31 A;  5JVH Q;  2PEB A;  4ZHR A;  2CDQ A;  3K2Y A;  1X4A A;  3R97 A;  3GB0 A;  2FZK B;  2BMB A;  2AF6 A;  4ID5 B;  5ETN A;  1CS4 A;  1FX4 A;  3TWZ A;  4DV4 F;  4O3O A;  5I3U B;  2JH3 A;  1NK8 A;  2CQG A;  1HR0 J;  1K73 T;  4ERD A;  3HSD A;  2PFF B;  3I96 A;  4RNF A;  1RT2 B;  3D0I E;  4PYA A;  3NRB A;  1RBL A;  1U4B A;  2V9K A;  3BB5 A;  1GNK A;  3H40 A;  4IR1 A;  1U8S A;  2XY5 A;  1JLQ B;  3HM9 A;  2FHO B;  5BYR A;  3CD0 A;  1Q4R A;  4PG7 A;  1LWX A;  1T11 A;  1FDN A;  1UA0 A;  3A3O B;  3VV2 B;  3UN2 A;  1X60 A;  3SDE A;  4KC5 A;  2BJ9 A;  1JKH B;  4OI6 A;  1REV A;  1CC8 A;  3GCX P;  1J5E J;  4AL6 A;  5KFW A;  2VG5 A;  2RDD A;  3NGU A;  4X4O A;  4DPT A;  5GAG I;  2I1R A;  3KK3 A;  3WHI A;  1ELO A;  2IM3 A;  3NGK A;  1VMB A;  4ZPB A;  5E5N A;  4Q45 A;  2VUG A;  2W7A A;  3VAG A;  5HRO B;  4WE1 B;  2Y0B B;  5HQL A;  4KTQ A;  1HKA A;  3U1M A;  2POK A;  1BUX A;  4TLQ A;  2DHS A;  3MZI A;  2I5J B;  2CQD A;  3LPY A;  2F5G A;  4N77 A;  3IGV A;  2VON A;  2NRE A;  3TA0 A;  5DG8 A;  1U6Z A;  4L3N A;  2G2Y A;  4RU9 A;  3CCZ A;  3R27 A;  5GAH U;  1WHW A;  4NCG B;  1N34 J;  3MAQ A;  1IJF B;  2D9O A;  3MAA A;  2BV3 A;  4Y2I A;  2AJ2 A;  2HRY A;  3AB2 B;  1S6P B;  4PEO A;  3CJS A;  2LKZ A;  2HHS A;  1S48 A;  4YY3 F;  1T05 A;  2COL A;  2PI5 A;  4JI8 J;  4EEY A;  5ETQ A;  4JI4 F;  5K8N A;  2ACY A;  4KE5 A;  2CNL B;  4Y28 C;  5LM7 E;  1SB6 A;  5HP1 B;  2BW2 A;  4KHP J;  2Y0S D;  2E9T A;  3ZNU A;  4CO3 A;  2KN4 A;  2MQP A;  1B7Y B;  3GIR A;  3P3D A;  2F65 A;  5JUM A;  1TR0 A;  3BEG B;  3VGT A;  2DNZ A;  2ZJR Q;  1EAR A;  4MFB A;  3IO1 A;  1OYE A;  1HBN B;  5F8M A;  5KFH A;  5KFS A;  2WVF A;  1NDL A;  3JAM U;  2HBY B;  3J7A N;  4CTA A;  3VTI A;  4J9K A;  4LFC J;  3I0R B;  2ZD1 B;  3DOK B;  5CZD A;  4DWI A;  2EEY A;  5DO2 A;  1FO1 A;  4ZJL A;  3CJ2 A;  3VAJ A;  1IQT A;  2AYE A;  1QJH A;  1DY3 A;  1XEZ A;  2AD9 A;  1HMV B;  2DIU A;  4DR7 F;  1RKI A;  3KOA A;  4X2B A;  4O3N A;  3IWL A;  1X9M A;  2HFZ A;  2OJ3 A;  2X1F A;  2MKI A;  2OSR A;  2AKW B;  3C16 A;  3OPK A;  2YTC A;  3FCV A;  4I67 A;  1ZYQ A;  4PQU B;  3QAU A;  4ZLP A;  3KLI A;  3NOG A;  3BR9 A;  3PFO A;  4JV5 J;  2RS8 A;  3PYD A;  4S0M A;  4D3G A;  1PAE X;  3DM2 B;  3KK1 A;  4NLW A;  1WC1 A;  5LXR A;  2UXD J;  4RX6 A;  4B3S J;  1PYS B;  3IAM 9;  4IG0 A;  2V8P A;  1NK0 A;  1HNI A;  2DVI A;  4ZJQ A;  4JYA F;  3OXL A;  4LF4 F;  4AMP A;  4AUK A;  3NS6 A;  3SCI E;  3H25 A;  5CD4 H;  3R1L A;  4RBT A;  1R3N A;  3T9N A;  4Q8E A;  2N3O A;  5KFE A;  3CMA S;  2C2R A;  1OSD A;  4J90 A;  3PR4 A;  3QAT A;  5CCM A;  5I42 A;  1UCN A;  2IA0 A;  1Q5Y A;  2C42 A;  1NPR A;  1BY9 A;  4Y2A A;  4CM2 A;  5A6P A;  1WC6 A;  4RW8 B;  4QBU A;  4CLK A;  4DFK A;  4U95 A;  1QAJ A;  2MJN A;  1Q78 A;  2IM0 A;  2JLE A;  1Z2L A;  3N5B A;  2KG0 A;  4CI0 B;  3PTW A;  4OIX A;  4WII A;  3Q8V A;  3M2U A;  4ZCK A;  2L08 A;  3TNV A;  1C0T B;  4DV6 J;  3GPA A;  2CDR B;  3I55 S;  3OHB A;  3CCM S;  2UUC J;  4C4W A;  2YWE A;  3THV A;  3BO2 A;  4NE9 C;  1YG0 A;  3VCD A;  3HKW A;  2CJY B;  3J7A 1;  2R7S A;  2BJ1 A;  1HNZ J;  2KL8 A;  5KOW A;  1T95 A;  5IM0 B;  2HPU A;  4OV1 A;  4JI0 F;  6AT1 B;  1RHU B;  1NJZ A;  1DRZ A;  1YJW S;  2IM2 A;  4CLP A;  4CP5 A;  4P52 A;  3A3N B;  2OEL A;  3T19 A;  4ED8 A;  4JV0 A;  4C0H A;  4NWB A;  3HJV A;  5FDL A;  4WFX A;  5G0R B;  4B3R F;  2H5I B;  4TU9 A;  3GV5 B;  1S1U A;  4G65 A;  2RVJ A;  1SC6 A;  3C6T A;  1UEK A;  3M8Y A;  1F9E B;  4ILR A;  4DPW A;  1R6V A;  2GGP A;  5KT7 A;  3TAM B;  2FJA B;  2PGC A;  2CYY A;  5SUH A;  1B99 A;  4DV1 J;  3RR8 A;  1U1N A;  4L73 A;  1HLW A;  4IRC A;  3M8P A;  3G82 A;  2BJE A;  4M1K A;  4A48 A;  4EBD A;  1NLK L;  2OPQ B;  2G0I A;  1ZM9 A;  2FZC B;  2PFD A;  2PA3 A;  3LP2 A;  3H4D A;  3NWR A;  4EZ9 A;  2OKQ A;  3D3C J;  3M8Z A;  3V81 A;  1HHQ A;  3K5L A;  4JB8 B;  2NCK L;  1IN0 A;  4LSL B;  3EPI A;  3CCT A;  2ZOF A;  2DNR A;  2H1Y A;  3LP0 B;  2YNF A;  4DR3 J;  1FNX H;  2NUH A;  5KFK A;  1GXU A;  4OV6 A;  1RHQ B;  2MKK A;  4ES1 A;  1AZS B;  4UOG A;  4UW2 A;  1KVJ A;  4JI3 J;  5KG0 A;  1Q7L B;  2C2Z B;  1RT3 A;  3SV4 A;  2MZR A;  1JLA B;  2AP6 A;  2GJF A;  1GT8 A;  1WKL A;  1CJV B;  4NLS A;  1C1B A;  3DOL A;  4U9R A;  2GVD A;  1P9Q C;  4LRB A;  1N52 B;  2KRR A;  2HIQ A;  1XNQ J;  5H9E K;  3AOB A;  3VF0 B;  2V2V A;  3GIM A;  4LSN B;  2M70 A;  3CWJ A;  4B9N A;  4TU7 A;  3MMA A;  1MW7 A;  2E1C A;  3M9N B;  2ABY A;  5J1E B;  1TU0 B;  1S1X A;  2JDJ A;  4ZVU B;  2HHU A;  3HF5 A;  3V6K A;  4CO2 A;  4OX9 F;  4LF8 F;  4DR1 J;  1C0U A;  1FEH A;  2HVE A;  4I6Y A;  1U49 A;  1WKK A;  4DU8 A;  4HAC A;  1TL1 A;  2D74 B;  3MM5 A;  3DKD A;  2CQ2 A;  4YB6 A;  2EFV A;  4LMZ A;  2J9C A;  3L7O A;  3UN3 A;  2A2C A;  4DS4 A;  5LT5 A;  5L1J A;  2XMK A;  3MR5 A;  2A18 A;  2V4Q A;  3BR8 A;  3OL9 A;  2HQI A;  4F0M A;  1ZZF A;  1VRT A;  1S10 A;  4NA2 A;  1N4L A;  1Z2Z A;  1UJ5 A;  3I9V 9;  3HVR A;  1F2G A;  1OQ6 A;  3TAP A;  2HZC A;  2MY8 A;  3JS9 A;  3CDB A;  4IG3 B;  3JYT A;  1PYT A;  5AJ3 F;  2J76 E;  2E5L J;  3K17 A;  3IG1 A;  4FYW B;  4RU2 A;  5LL6 d;  2V4R A;  1GXT A;  2DNM A;  4CYU A;  2ZIT A;  5HQM A;  5IT9 U;  2UVW A;  5E33 A;  1GMW A;  4KQZ A;  3Q22 A;  4U6P A;  5KG1 A;  4O0I A;  3LGM A;  1KKH A;  3AD7 C;  1HA1 A;  3MUM P;  2XMM A;  1J5O A;  3KXD A;  1HYS B;  2KHD A;  2PO4 A;  4OFZ A;  3EZ5 A;  5DRK A;  3IRX A;  3DGV A;  5A8R A;  3FRZ A;  5K5M A;  3MCO A;  3CDE A;  3K0J A;  4Y3C A;  2XMV A;  5HVG A;  1D09 B;  3EUN A;  1KOH A;  4OZ3 A;  2FHK A;  4FPI A;  1M0S A;  4URG A;  1U0H B;  1MSW D;  5CXT A;  1UP1 A;  3AA9 A;  3OSN A;  1S0N A;  1WOS A;  3BSN A;  2BEF A;  1JLC A;  3TAR A;  4FBU A;  4WTO B;  4O44 A;  5CYJ A;  1RT4 A;  1C4C A;  3BBB A;  4JI1 J;  2AMC B;  4NRT A;  3H5Y A;  4NXN F;  3PXG a;  3BJY A;  3LF0 A;  4DFP A;  4WK1 A;  7AT1 B;  1VQ6 S;  4K4U A;  2D3U A;  1S76 D;  2ASJ A;  4DL4 A;  4IOB A;  2M4M A;  3PO4 A;  1EKR A;  3A8J A;  1SL0 A;  3QO9 B;  4P6Q A;  1DBD A;  4USJ C;  2BDP A;  4WIQ A;  4DUZ F;  2ALZ A;  2Q79 A;  4URS A;  5IXU A;  2QFI A;  5J2M B;  3QGG A;  4W92 B;  4IH6 A;  4WKR A;  3D1H A;  2B9X A;  4F3M A;  1SL2 A;  1RWN B;  1SC1 B;  4PR6 A;  2BJD A;  1X0F A;  1V5I B;  2HBQ B;  2YNH A;  1FF2 A;  4C8Y A;  2CG8 A;  5K14 B;  3GJQ B;  3J81 U;  3SCJ E;  4TQR A;  1PBA A;  4ANE A;  1X4C A;  3BBF A;  3MCN A;  3CJT A;  1HQ2 A;  3T1Y J;  3N0V A;  2EC0 A;  3C14 A;  1ZPV A;  2A10 A;  1YQH A;  1S0O A;  3LH2 S;  4WYW A;  1RAE B;  1K8A T;  1N5Q A;  2QTW A;  2E7V A;  3J7Y U;  1F5B A;  1RT6 A;  2XSF A;  1N33 F;  2GQQ A;  2Y8W A;  4HTJ A;  3FEZ A;  3KTQ A;  1PBU A;  4DG1 A;  4DPO A;  3EVM A;  3F0N A;  2YNG B;  3W2V A;  1GTH A;  3H2V E;  4FF3 A;  4KYZ A;  4H4O B;  4PWD A;  2HQC A;  3MOZ A;  2IDE A;  3POT A;  4IUF A;  2ZH1 A;  5CA5 A;  2JFD A;  2X7I A;  4IRK A;  3MM9 B;  1I94 F;  2KG1 A;  2DY1 A;  1DLO B;  5K9F A;  3N01 A;  3CED A;  1T3N A;  2DPJ A;  1GMV A;  4DF8 A;  1RAB B;  3B8H A;  3MTK A;  4PXC A;  3T6B A;  3FUY A;  2R7R A;  4DHV A;  3HVT B;  4CNZ A;  3O44 A;  3MEG B;  2M0G B;  1KBR A;  5K8O A;  2YKM A;  3UVJ A;  1GH8 A;  2HGM A;  2P2C B;  3IBW A;  3TEG A;  1YBT A;  3R7S B;  2LEC A;  2VBW A;  5DZ7 A;  4X4R A;  4C7Q A;  2CPD A;  3PYE A;  1FRM A;  4F4X A;  2N7C A;  2KZM A;  4USK A;  2OTJ S;  2A1B A;  1OMS A;  4OYM A;  1RWM B;  3FMW A;  3C66 A;  4IQM A;  2MZT A;  3CIZ A;  3PIO Q;  2AJ4 A;  4FXD A;  2ROG A;  3HPO A;  3ZTR A;  3ILO A;  2VQE F;  4MKV A;  4KH0 B;  3MED B;  4UUW A;  2E1M C;  3B78 A;  4N8O A;  4ZP6 A;  3HSZ A;  4AQY F;  4LF6 J;  3G8Q A;  3IAS 9;  1NSQ A;  3W63 A;  1UL3 A;  4OI4 A;  2FVR A;  2RML A;  1GAO A;  2V4J A;  3W3S A;  2EFN A;  4MIW A;  5B0D A;  4ZIW A;  5KFG A;  1UVL A;  3JSM A;  2RF2 A;  2VIC A;  4Y6I A;  2CWK A;  1NK6 A;  1V6H A;  4IFY B;  4DUY F;  2AWZ A;  2KHC A;  5GAE I;  1N36 J;  4O23 A;  4JI6 F;  3JAM Y;  4YDX A;  3M6V A;  1JLB B;  1M5S A;  3N28 A;  1RAC B;  1RB0 A;  1H38 A;  1X5T A;  1IKX B;  4NLG A;  5THW A;  3AFG A;  2GHV C;  1NJY A;  2OPR B;  4M5H A;  4BWJ A;  2ZZT A;  2IM1 A;  3OL8 A;  4ZJO A;  4FXV A;  2D3Z A;  2WW8 A;  3Q8Y A;  1VQP S;  2F3J A;  2LDY A;  3P45 B;  4EBC A;  2GVZ A;  1V5V A;  3CXC R;  4WFB Q;  2ZH5 A;  1M5H A;  4KKO A;  1FT8 A;  2HVH A;  2Z0G A;  5KG7 A;  3D6T B;  4X84 A;  2ZHO A;  4PUO B;  2BBE A;  2OAU A;  3Q8Q B;  3H4B A;  4DEZ A;  3IR7 B;  2MQN A;  2J7K A;  4IH5 A;  4DX8 H;  3IP0 A;  2C28 A;  1X4E A;  4PG4 A;  3UDL A;  4ED0 A;  2K1R A;  2GAG C;  2DNP A;  3IN5 A;  5EX0 A;  5J2N A;  4J9O A;  1WTB A;  4C8O A;  4DPX A;  5CQG A;  1NKE A;  1QAI A;  1RTZ A;  3DOM B;  1HD1 A;  5KFF A;  5LMN F;  3EX7 B;  2B4P A;  3QMQ A;  2RB7 A;  1RQ0 A;  2Q6C A;  2W8L A;  2YQ0 A;  4DN0 A;  1H98 A;  4H4M A;  1KLM B;  2V8D A;  5JMN A;  5AE2 A;  1YJT A;  2LA4 A;  1CC7 A;  2RU3 A;  2XHW A;  2AGP A;  2ADC A;  3OXG A;  3EZU A;  1LFW A;  4DR6 J;  3FVY A;  1RU1 A;  3MF5 A;  2RJZ A;  3QLH A;  2RIJ A;  2W9C A;  2BUN A;  4I6W A;  3GYG A;  2UVV A;  4ED6 A;  1S59 A;  5A0Y B;  2QYC A;  3CCS S;  1FKP B;  5L9X A;  4BDP A;  2BQR A;  1S6Q B;  3OLB A;  3SFU A;  4CNY A;  3QAE A;  1MML A;  4XK8 C;  5KFD A;  3CT9 A;  3TZY A;  1OPZ A;  5SZT A;  4EU0 A;  1FRI A;  4O0N A;  3PR5 B;  4M8L A;  3OR1 A;  1SJ1 A;  4PWU A;  2DGX A;  2ZVS A;  2L41 A;  3Q2T C;  3UQS A;  3JTN A;  4RW9 B;  1NME B;  1HQU A;  1NDK A;  2ZH7 A;  1QAY A;  2NYI A;  3FNN A;  1CJT B;  2O67 A;  1Y7P A;  1HWK A;  3L4B C;  1EET B;  2UUA J;  3B4M A;  3W62 A;  3EGN A;  2OEM A;  4LF5 J;  4K0K J;  3DRS A;  4B3O B;  4Q44 A;  3PG9 A;  1QLN A;  1EP4 B;  1LWF A;  1B70 B;  1VC0 A;  2DRA A;  4CQ1 A;  5C42 A;  2HK2 A;  3OVS A;  1Z4U A;  1GX6 A;  3L9Z A;  2RE1 A;  3SSS A;  4OI2 A;  5EHH A;  3KK2 A;  4A8K A;  1X5P A;  2FJD B;  3GR0 A;  1HNX F;  1X5S A;  5CYM A;  3KMS A;  4DR5 F;  1AYE A;  4QIE A;  5KT6 A;  1CJU B;  3O8W A;  4PG6 A;  4N5S A;  3M2V B;  3GFH A;  2IRY A;  3KJV A;  1HQE B;  2UXC J;  1OY6 A;  1NUE A;  3HK2 A;  2FHM A;  1C4A A;  4KIA A;  3CJK A;  3RW7 A;  2MB0 B;  1RA6 A;  3Q23 A;  1FKO B;  3NAI A;  1YI2 S;  2LEA A;  2XQC A;  4KFB B;  4F7V A;  5J1P A;  2GHP A;  1SKU B;  1P9Y A;  3DLE A;  3BSA A;  4M5M A;  1AA1 B;  2YQ1 A;  2RKI B;  2C3M A;  3F73 A;  3HDS A;  2JC1 A;  2YVS A;  2B43 A;  5H9E J;  2Z4P A;  1N5V A;  4X4T A;  2DR9 A;  1GXL A;  5K20 B;  2QEX S;  1K0V A;  2J9E A;  1D1U A;  1XQI A;  3FK4 A;  2AQ4 A;  4DSJ A;  4TYB A;  3IFE A;  1PJ7 A;  2QJ3 A;  3EGW B;  3IMQ J;  1TVR A;  1UWB A;  1VYA A;  3ETM A;  1XIQ A;  2X3D A;  4USH A;  1QUV A;  4CLF A;  4DBQ A;  2NXJ A;  5DDO C;  2GMJ A;  2VPY B;  2V34 A;  1NSP A;  2B6A A;  4KGV B;  1P6T A;  5KFV A;  1VQS A;  3OTO J;  4Y2M A;  2IMW P;  4BBY A;  1JLG B;  2VFV A;  4PG8 A;  4M5G A;  3S1T A;  1MWZ A;  4ICL A;  2YXL A;  4WP9 A;  4X65 J;  4TKT A;  1SKW A;  1ITP A;  4ZOS A;  4I1T A;  4DX7 A;  1JLE B;  1XMO F;  4QU7 A;  4FF4 A;  1FFS B;  3SQO P;  3PHE A;  3KLF B;  5KFY A;  3KG0 A;  4DR4 J;  3OJU A;  1RHM B;  4TU8 A;  5B0F A;  2KVQ E;  3BS9 A;  4F3Q A;  1UJ6 A;  1PIE A;  3NMR A;  4BLG A;  3W1Y C;  2ZOM A;  4P7T A;  1X31 C;  2X1G A;  4ZVS B;  2QLB B;  2XLK A;  4CLT A;  2HHH F;  2RS2 A;  1IM6 A;  5IV3 A;  2PII A;  3TVK A;  3H2L A;  4B3M J;  1WWH A;  2DGQ A;  2E44 A;  5DZ6 A;  4K5S A;  2W2M P;  4KY3 A;  4USW A;  2LFV A;  1HFE L;  3OXF A;  4F4W A;  5KAK A;  2HFN A;  4O4G B;  4BS2 A;  2K3K A;  2G1H A;  1ROF A;  1YRU A;  2EG1 A;  3T6J A;  4WF9 Q;  1Q8B A;  2WTF A;  4NEZ A;  3TP2 A;  4BWM A;  1N5Y B;  2LQB A;  4WCE Q;  4RUA A;  3G96 A;  3RRH A;  2MQ8 A;  1IBL F;  3VAM A;  4USI A;  3OSP A;  4LFB J;  2LLZ A;  2C3P A;  1UEV A;  2XWY A;  3DU6 A;  2B8P A;  2MYF A;  1NZ8 A;  4HKQ A;  2VOO A;  2WW4 A;  3I87 A;  1VFJ A;  4YP3 A;  3D66 A;  2DBB A;  3WDO A;  3PNI A;  3PJX A;  3HHD A;  2YX4 A;  4M5L A;  3R5J B;  1BQM A;  4LR7 A;  1MG7 A;  4O3S A;  4AMN A;  1M5P C;  2V50 A;  1VJQ A;  2ADB A;  2DNH A;  1SIW B;  2DR7 A;  3U7J A;  1VQN S;  5M2U A;  2VF3 A;  4U8Y A;  1U1L A;  3MFH A;  2CKW A;  1YJR A;  1KQG B;  4NEY A;  3UD4 P;  2VG7 B;  2MHE A;  4TN2 A;  4ECV A;  2PT0 A;  1FJG J;  2BE2 B;  2N82 B;  3RRG A;  3PCO B;  5IT0 A;  2GJ2 A;  2QL7 B;  4X4Q A;  4J9Q A;  4RPF A;  4R8U B;  3C46 A;  4CLL A;  1TL3 A;  3QFH A;  4ZLJ A;  3OVA A;  5IQ6 A;  4MMO A;  2XZD B;  4LQ3 A;  4P2X A;  2KH9 A;  4LBH A;  2W4P A;  4F4Z A;  2FVC A;  1Q16 B;  1MWQ A;  2IHR 1;  1N6Q B;  3KLG A;  2VG6 B;  2CVE A;  3A3P B;  2NZC A;  3VQS A;  5GAD U;  1HBO A;  2E5I A;  4ITS A;  1TFY A;  2OFG X;  4RW4 A;  5HBM B;  4OX7 A;  1RT5 A;  4GKJ F;  1Q7Y T;  2YNI A;  3D7S B;  2E5G A;  1JIH A;  3R9L A;  3P49 B;  1KLN A;  2C2N A;  3WX8 A;  1JNR B;  1YSJ A;  3SV3 A;  2IC3 B;  2LMI A;  2AEJ A;  2B9W A;  4HH0 A;  4USM A;  3NCR A;  2RUG A;  3RAQ A;  1WG1 A;  3IR5 B;  3IA0 A;  1YDL A;  2DNN A;  2BR0 A;  2CUY A;  2AGO A;  2FHJ A;  4HI1 A;  1IXK A;  4LT6 A;  4LF9 J;  4J5O A;  4N41 A;  3CCJ S;  2LVW A;  3NAH A;  3IWX A;  4TYA A;  3VGU A;  2W25 A;  2QN6 B;  1KEK A;  2MSS A;  1HBM B;  2CPH A;  4TXS A;  4ZVP B;  1FE0 A;  4C11 A;  1HNW F;  1YJN S;  3UCZ P;  4JI2 J;  1URN A;  1H6K X;  2FVS A;  1V3R A;  2B4V A;  1A9N B;  4RNH A;  1IQZ A;  4USV A;  3CDA A;  4G1P A;  1MN7 A;  5D0G A;  3TRG A;  2FVP A;  2I6W A;  3N5F A;  3QPI A;  2AYB A;  1PIL A;  5D78 A;  2IFX A;  4FVC A;  3SYZ A;  2J6T A;  2IMO A;  3HHL B;  4DI6 A;  2Y1L B;  4KO0 A;  2N4D A;  5JVG Q;  1XMQ F;  2OH2 A;  2HVD A;  2WBM A;  2ILZ A;  1ZPW X;  2VA3 A;  2LQ8 A;  2A6M A;  2DNQ A;  4I2P B;  5HP1 A;  3TX0 A;  3OFF A;  1S9G A;  4RO0 A;  3ITH B;  2MLX A;  2XMT A;  2YX7 A;  2Q1L A;  3AAW B;  2Z2M A;  1BQN B;  3M2R A;  2NSC A;  1MU2 A;  2W2N P;  1HR0 F;  3BPS P;  1M90 T;  1E6V A;  2XMJ A;  3NOC A;  2MGZ B;  2OPS A;  4B9L A;  3H7H B;  3HHL D;  1LWC A;  1TKX A;  2HHT A;  1HWU A;  4G3I A;  2WOM A;  1LKZ A;  2K06 A;  1IBK J;  2GZO A;  4ER8 A;  2IVM A;  1JK9 B;  1YIT S;  5KG6 A;  2E9R X;  2QA2 A;  1X4D A;  1U48 A;  3W9I A;  2G0J A;  2GHW A;  4Y0F A;  3PW0 A;  2DHH A;  2HS4 A;  5LSO A;  1GEH A;  1VBY A;  4DX5 A;  1NAQ A;  1J5E F;  4M5D B;  3KHG A;  1EQM A;  1RYR A;  4TY8 B;  2HAF A;  3GZ7 A;  3K5P A;  3DRX A;  3QWP A;  4B02 A;  1YBU A;  2DB1 A;  2XLI A;  2HND B;  1LW2 B;  1TK0 A;  3GYX B;  4WZQ A;  3QRP A;  2BE9 B;  1J2V A;  4PWW A;  5KFR A;  1FES A;  5G4D A;  3TEH B;  1S79 A;  4WFA Q;  3UCU P;  2MKS A;  3EE3 A;  1IM4 A;  4G6V B;  1Q8I A;  4FNH A;  1RA7 A;  4UOH A;  2KXN B;  1N34 F;  2ZUA A;  1SIZ A;  4OZ5 A;  1X4F A;  5C24 B;  4DLE A;  3HHL C;  1VQ8 S;  5FII A;  2CJA A;  8AT1 B;  1RT7 A;  1SVD A;  4V1A k;  1TFW A;  3LP1 B;  3OR2 B;  4I69 A;  2ZH6 A;  1H7W A;  2OGU A;  3THT A;  5C2G A;  1Y11 A;  1OY8 A;  2Z58 B;  1JLF A;  1WC3 A;  4ZVT B;  2F1F A;  4FYD A;  4F4Y A;  2LU1 A;  3MMC A;  2F8M A;  1N5T A;  3Q8R B;  1S0M A;  3OUY A;  4FP9 A;  1R89 A;  4ZPV R;  5ETK A;  2RRB A;  4JI4 J;  1T9W A;  4ZPC A;  2EFG A;  2R9L A;  1L3V A;  5HO4 A;  2WHO A;  3TQE A;  4MKA A;  4ILM A;  1R6Y A;  4I2Q B;  1S49 A;  2J0X A;  4ZHR B;  3W2W A;  2KI2 A;  2CPF A;  4R25 A;  2ZH2 A;  1XN9 A;  4HR2 A;  1CS4 B;  1IWA A;  3MMB A;  4H4K A;  5GMD A;  2UV8 G;  5BYS A;  1N5S A;  2YKP A;  4ETZ A;  1EIY B;  1MN9 A;  1C2P A;  2NQP A;  2LEB A;  1YZ6 A;  3M7V A;  2OUG A;  1RYS A;  5DS7 A;  2DGS A;  3JSR A;  1XMB A;  2XY7 A;  2BJ8 A;  5M2P A;  2ZH9 A;  4IFV A;  1Q0N A;  2LXF A;  3PV8 A;  1HNV A;  3SDE B;  2AZ3 A;  1REV B;  2RQM A;  4AMO A;  2UXD F;  2E5H A;  2VG5 B;  1VQL S;  4B3S F;  1S7H A;  3ZZU A;  1FVQ A;  3DLH A;  3GON A;  2N4C A;  3DCA A;  4PQA A;  1XWL A;  3KK3 B;  1VQ4 S;  2PC6 A;  3IGN A;  2CQ1 A;  4KHR A;  1IR0 A;  3O5T B;  2J7W A;  1VOM A;  3UI3 A;  1RT1 A;  3DHX A;  1TAQ A;  1BXN A;  2MHN A;  2VH7 A;  2BQ3 A;  2ZE2 A;  1K1S A;  1HPZ A;  5E3A A;  4CLU A;  1NCL A;  2CQ0 A;  2XCA A;  1BE4 A;  3GFX A;  1ZH5 A;  4QR1 A;  1PKU A;  4DV6 F;  2HWT A;  3MAA B;  4F4A A;  3P5B P;  4CDI A;  5KFB A;  3MR2 A;  2W7P A;  3R5C A;  4ZLL A;  4P73 A;  2UUC F;  5RUB A;  1T05 B;  4DL7 A;  3DRP A;  5HI7 A;  4FXW A;  3CUL A;  2OHD A;  3PW4 A;  2G4B A;  1ZET A;  4EO8 A;  1KTV A;  1K44 A;  3DI6 A;  5GVQ A;  1SJF A;  4ZPA A;  2BRK A;  4W98 A;  2E29 A;  2W1B A;  2MLZ A;  1T9U A;  4RUH A;  3RB4 A;  1RTI A;  1CUL A;  3BPD A;  4RLE A;  5KFX A;  2IAJ A;  4A8S A;  4C8K A;  2MQL A;  2C3U A;  1WOO A;  3HVA A;  1RDR A;  2F7V A;  3VGV A;  2WON A;  1LK5 A;  4Z7C A;  3Q83 A;  4W90 B;  3HFZ B;  3W65 A;  4MFB B;  4O4R A;  1RSC A;  1P8G A;  5L46 A;  4A47 A;  5A8K A;  2MY7 A;  2OEJ A;  1PC5 A;  2HGL A;  2FJW A;  2Z2L A;  2E9Z A;  2JVR A;  4CTA B;  4K4T A;  2CPI A;  5C25 A;  4JI0 J;  5IFM A;  2KFZ A;  2BJ7 A;  4UY8 T;  4LBI A;  1QVF R;  3T9Z A;  2F4V J;  1K9M T;  4P9S A;  3H2U B;  2GX8 A;  2AYM A;  1X9W A;  4D3H A;  4DV1 F;  4PXB A;  1UEU A;  2O3D A;  4B3R J;  1YJ7 A;  2V94 A;  4URQ U;  4KRW A;  1R0C B;  3C16 B;  3D6H B;  2KKH A;  2OPP A;  1VHF A;  1VIS A;  4Q5V A;  3ZTO A;  3KLI B;  2XNR A;  3DDI A;  4ZVG A;  2X1B A;  3TW0 A;  1I6J A;  5F8L A;  5T7L B;  4F0H A;  3CW2 C;  5ETR A;  2C1E B;  3KK1 B;  4Y00 A;  2WVE A;  3H8Y A;  4B3T J;  4DR3 F;  2E1A A;  2KO1 A;  4IG0 B;  4P74 A;  1NK5 A;  3FJ2 A;  1HNI B;  1HYS A;  2QC3 A;  4P71 A;  4Z2X A;  3RTV A;  1RWU A;  3EIC A;  4K59 A;  2HQG A;  5DJB A;  2H9Z A;  3DLB A;  4ZKA A;  2HS0 A;  5I42 B;  2R42 A;  4GC7 A;  4JOU A;  1LNQ A;  1HWI A;  4ECS A;  2FLP A;  2QX0 A;  2HMI B;  1XNQ F;  3E3X A;  3BM7 A;  1VQM S;  3X1L B;  2DXD A;  3M2U B;  1KFS A;  4C6A A;  3GSI A;  2H48 B;  2X1A A;  4EUV A;  1EJ7 L;  2DIV A;  4DZD A;  5AT1 B;  1FTC A;  5F8G A;  1UET A;  1UW9 A;  4RW6 A;  4I64 A;  5CD4 A;  3E2E A;  4DR1 F;  2DNO A;  1SI9 A;  3VAK A;  2AU0 A;  5F9L A;  4YN3 B;  4U67 Q;  2VPW B;  3TX8 A;  3SQG A;  2QL9 B;  2YWF A;  3UD5 A;  1SV5 A;  4NLX A;  1VQ7 S;  3J80 U;  3QWU A;  3ADA C;  2W4D A;  1YLX A;  4X62 J;  3UD3 P;  1SKR A;  4N8N A;  3NGS A;  1TKZ A;  4I7F A;  1S1U B;  3NBP A;  4C97 A;  5K14 A;  2GJI A;  4LF7 J;  4XPC A;  2JNJ A;  4H54 A;  3C6T B;  5CZX A;  4NLD A;  4A8X A;  5T41 A;  3AOD A;  4P75 A;  2CPY A;  2RDJ A;  4C8L A;  4LIW A;  4FF2 A;  2GGP B;  1QSY A;  1IBM J;  2MTL A;  5HAN A;  3R5G A;  1SL1 A;  1GFW B;  2DH7 A;  1PSD A;  1UVI A;  1VRU A;  3M8P B;  2J8A A;  1ZAW A;  4DS5 A;  3BKT A;  1OPI A;  4X4U A;  2GO9 A;  3LP2 B;  2W24 A;  2CNK B;  4AL5 A;  4LF2 A;  2FZG B;  2GAH C;  2UXB J;  3VZI A;  3P6Y C;  3BGR A;  2JHE A;  1W7W A;  1X8D A;  2XYG B;  4M95 A;  2YNF B;  2ZJP Q;  1RWX B;  1BQX A;  1YRX A;  2V63 A;  2EFQ A;  4K4S A;  3TOQ A;  3KLE A;  2HNZ A;  2XLJ A;  3OFE A;  4AL7 A;  1CJK A;  2VPZ B;  3NS5 A;  2ZHA A;  1S1W A;  2I8E A;  3FQK A;  3TI0 A;  1UAW A;  3C19 A;  3DHW C;  3HSG A;  4YB7 A;  3TAN A;  4DJB A;  2G9O A;  3EXC X;  1RT3 B;  3FSY A;  4J91 A;  3FSI A;  1NZA A;  2IYG A;  3G9C A;  2CIM A;  2B5J A;  3D0G E;  1OJ4 A;  1VQ5 S;  1C1B B;  2R8K A;  2XO7 A;  4JI1 F;  1N0U A;  2GVD B;  2H54 B;  3N6N A;  4R5P A;  1HAR A;  2NR0 A;  2DHG A;  1Q81 T;  5A2Q U;  3J7Z T;  4KJI A;  4RWX A;  5ETM A;  2EG2 A;  1I3O B;  3D2W A;  5LJ5 Y;  4DMZ A;  3QBC A;  1B7F A;  5EDW A;  3MR6 A;  3PW5 A;  3GIK A;  3NGD A;  3TUI C;  1ZA2 B;  3MMA B;  1PC4 A;  3ZZP A;  2VJV A;  3ENW A;  3QJL A;  2HZA A;  1WF2 A;  1FWL A;  1S1X B;  3I5C A;  3MUT P;  1T9T A;  3VAF A;  1LV5 A;  2DHA A;  3CO0 P;  2AEM A;  3RW6 A;  2FC9 A;  2P9C A;  1EZZ B;  3AXM A;  3RZA A;  3JB9 k;  5J2Q A;  1C0U B;  2OD6 A;  4NXN J;  1JB0 C;  4RZR A;  3R2D J;  4N56 A;  1TL1 B;  1S9E A;  3RAM A;  3MM5 B;  2R8H A;  2OMO A;  1R0B G;  1VLY A;  4C8N A;  2HBR B;  5F3Z A;  2VKZ G;  5GME A;  3UFC X;  3W8P A;  3T1Y F;  2ZKT A;  3QRR A;  1VRT B;  2V8V A;  4F26 A;  2RNE A;  4V19 J;  3MPV A;  1RAO A;  1SQE A;  4ZLN A;  2VA2 A;  2WAQ D;  2MKY A;  2LDI A;  1F9F A;  3JYT B;  4U96 A;  4AXJ A;  4UST A;  3IG1 B;  2ROE A;  3OBI A;  4CYU B;  4WXO A;  2DXF A;  1YIJ S;  4RNN A;  2PMZ D;  4P7V A;  1JLB A;  3KJF B;  4QWB A;  1S7I A;  4YQW A;  4G1Q A;  5F8J A;  3HXM A;  1S1V A;  3AJ1 A;  4QIV A;  1TL7 A;  1J5O B;  3ZZT A;  3IRX B;  4QIG A;  5A8R B;  4J9R A;  1R7I A;  3L7U A;  4ZVH A;  4F36 A;  5F9N A;  3O3L A;  1ZM2 A;  1CQM A;  2MPU A;  1XR6 A;  3HMJ G;  3ZXW A;  2EI5 A;  1FE4 A;  4IH7 A;  3M8Q A;  2QLF B;  4B9T A;  5E41 A;  1F0X A;  1QVG R;  2QRR A;  2IIH A;  4RWW A;  4DV2 J;  2UVU A;  3QID A;  1GMU A;  2CJX B;  2BVZ A;  5DM7 Q;  4NXM J;  1EAY C;  3B54 A;  2RU9 A;  4LR8 A;  2DH9 A;  3QZ8 A;  1JLC B;  3P4U B;  4ELU A;  1I94 J;  3GG1 A;  2B51 A;  2RQC A;  4HH1 A;  5DET A;  4ECQ A;  1NDC A;  4O44 B;  1ZBT A;  3PHT A;  1RT4 B;  2ZM6 J;  1RLC L;  4LRF A;  4DSL A;  1YTY A;  1HBU A;  3HZG A;  3V6D A;  2FTR A;  3DRY A;  1WJ9 A;  3V6H A;  2GA7 A;  5CCL A;  1R8H A;  3GQC A;  2XM3 A;  4OYB A;  1FRL A;  4DCJ B;  2L3M A;  3I0S B;  3R6L B;  3BYR A;  1GX5 A;  3TA2 A;  5FJ4 A;  2JOQ A;  2QMX A;  3VGS A;  4LF6 F;  3BH7 B;  4C0B A;  1TP7 A;  2NUU G;  3PEH A;  2C2O B;  1U1Q A;  2WRM A;  3MAH A;  1JJH A;  2DNY A;  2R4F A;  1RZM A;  1W25 A;  2YNH B;  2HGN A;  1S6Q A;  1Y00 A;  4AE5 A;  1NH8 A;  4NI2 A;  2F8E X;  1SBR A;  1NK9 A;  2E1P A;  2MEW A;  2VQE J;  4LSZ B;  4K4Y A;  1N36 F;  4KBI A;  3G8S A;  4K50 A;  4ECT A;  1Q8K A;  3C14 B;  3T5L A;  1UFL A;  2GNK A;  3VR1 A;  3V6J A;  2VQF J;  3TJA A;  4OJ1 A;  3JTP A;  2FPH X;  3KHR A;  3RBE A;  1LEO A;  2YKN A;  3HI9 A;  3H20 A;  3I31 A;  4M5K A;  1YRT A;  2UZA A;  1RT6 B;  3NNA A;  3I56 S;  3ISZ A;  3QT6 A;  4DL2 A;  3PW7 A;  1TKD A;  2CWX A;  4NLY A;  3VVT A;  1T0T V;  1QE1 A;  4JI6 J;  4EK2 A;  4DG1 B;  4ZIT A;  1RJJ A;  3T3F A;  4I6A A;  2QT7 A;  1QSL A;  4L72 B;  2IA6 A;  4HT7 A;  1FDB A;  5AXN A;  1O51 A;  4A8M P;  2AX1 A;  3W2V B;  5DDR C;  2CJB A;  2KB2 A;  1WNE A;  4TLR A;  2NYH A;  5D0R A;  4A4J A;  3D0H E;  3POT B;  2ZNZ A;  5IV4 A;  2ZHB A;  1FJ7 A;  1UJ4 A;  4U7U D;  4RW7 A;  3HZE A;  4HYK A;  4YR3 A;  3NGT A;  4WTY A;  4ECU A;  1NU4 A;  3PJ9 A;  1BWV A;  2ZBQ A;  2NPI A;  4ES3 A;  4DQR A;  3FC9 A;  2BOA A;  4AMM A;  1V3Z A;  1AXQ A;  3B82 A;  2VAS A;  1MLA A;  5J2P A;  5A8W A;  4ZVR B;  4F2R A;  4NML A;  4RKU C;  4WP8 A;  2KT5 A;  3QT7 A;  3A12 A;  2Q43 A;  5DG9 A;  1F5A A;  1NHU A;  4MT1 A;  1REG X;  4MK7 A;  4DR6 F;  4KV8 B;  4CLW A;  1NHV A;  2YKM B;  3UVJ B;  3B4D A;  4OHZ A;  1QY7 A;  3EWG A;  1IBC B;  2E7X A;  2XYP B;  5B08 A;  2KZZ A;  3K58 A;  1RHR B;  2EBE A;  5CZV A;  4NLU A;  3ENA A;  2QIF A;  3GJR B;  3OTB A;  4DFM A;  3TUJ C;  1K47 A;  3TZW A;  3GIJ A;  4QCL A;  3MM7 A;  1E6Y A;  1HWJ A;  5E7O B;  3GP9 A;  2W01 A;  1G4C A;  3ENQ A;  1L3T A;  3QIP A;  2PI4 A;  3LGN A;  3N4W A;  1X0P A;  3UE2 A;  3LAM A;  1FJC A;  3U27 A;  4NZ0 A;  1XR5 A;  2QFJ A;  1WF1 A;  2V4J B;  5IWA J;  4ZVQ B;  2JJ4 D;  4C3K A;  4IDK A;  3E01 A;  4CLS A;  1ZZN A;  3JSM B;  2RF2 B;  3CD7 A;  2WB1 D;  2OP5 A;  1UA1 A;  2IRX A;  1U09 A;  5DLG A;  3FEY B;  2R7T A;  1NRK A;  3FZ2 A;  2UUA F;  1NB7 A;  2D7S A;  4MK8 A;  4LF5 F;  4P2F A;  4KPY A;  3DGP A;  5KFQ A;  2HBZ B;  3TQ1 A;  3ENV A;  3HLU A;  1Q8L A;  3SFG A;  3ILI A;  1FHT A;  2GVZ B;  3BV8 A;  2UP1 A;  3SCK E;  4KKO B;  1FRH A;  1VK8 A;  3BGL A;  1IKV A;  2LXU A;  3TYT A;  2P6T A;  4OYI A;  2KDO A;  5CYQ B;  3AJ2 A;  3RYL A;  5BJR A;  3PFE A;  4DR2 J;  8ATC B;  1NSA A;  5A6W A;  2K1R B;  2HNY A;  2UUT A;  3EMT A;  1FFG B;  1LXN A;  5J2N B;  3DFE A;  2WSF C;  4OLP A;  3Q24 A;  3OVB A;  1ZTT A;  2CJ9 A;  5LMU F;  3NP5 A;  4DR5 J;  1RAH B;  1LW0 A;  3BKF A;  2O5D A;  1H2V Z;  3PVX A;  4H4M B;  4ED4 A;  3ZTS A;  3KUH A;  3KUE A;  3CE8 A;  1JNZ B;  5B0C A;  5HLF A;  1APS A;  2CZV C;  3GCW P;  1F3F A;  2HWI A;  3OT9 A;  3SSR A;  1P1L A;  4MYT A;  1FA0 A;  3QLH B;  1XTZ A;  4FKY A;  2W9C B;  1BC6 A;  4ED1 A;  2XB2 D;  1PGZ A;  3MUV P;  3BDE A;  4NX9 A;  2B7B B;  3RJM B;  3AQO A;  2GCF A;  2B3T B;  4IO1 A;  3SEO A;  3OTO F;  3HJF A;  5IQQ A;  1AFI A;  4UOC A;  3ILJ A;  2VDI A;  2E1R A;  5C2C A;  3OQ2 A;  2FGC A;  3OHA A;  1AUD A;  3C6U A;  1H3D A;  4HT5 A;  5B0A A;  3CCQ S;  4FPR A;  1D9A A;  4X65 F;  1MRO A;  2J9D A;  3MPU B;  3FEX B;  3IBC B;  2DO4 A;  3DNC A;  4FBT A;  3HT0 A;  1T03 A;  1OS5 A;  2R8G A;  1WD6 A;  3HHE A;  3LAK A;  4JV2 A;  1M5K C;  4CLY A;  3OR1 B;  1N32 J;  1HW8 A;  4LRA A;  3SXL A;  5D4N A;  1S12 A;  5HJY A;  3QJP A;  4QPX A;  3DLJ A;  2FIU A;  5D4L A;  3Q8P B;  4FN5 A;  1OSC A;  5GAG U;  1U47 A;  5KFJ A;  2NXE A;  1HQU B;  4YB1 P;  3O1L A;  3NNH A;  3GU0 A;  4DLG A;  1X4B A;  4KR0 B;  4OI1 A;  1WOR A;  2XTJ P;  2VFS A;  4IRD A;  2ZEJ A;  3DLL Q;  3DRR A;  1NH7 A;  3HP6 A;  1RP5 A;  4OYZ A;  2XY6 A;  2ZC4 A;  4X64 J;  4B3M F;  4DSE A;  3CJ8 A;  4ELV A;  1XMO J;  3DRS B;  1S1T A;  3DN9 A;  4QOT A;  2CNO B;  4UTG A;  2DNK A;  1LWF B;  5M2R A;  1KOO A;  5CH7 B;  2LQJ A;  5C42 B;  2QMW A;  4YR0 A;  5B0E A;  1FKA F;  3TZZ A;  2BXJ A;  4L75 A;  4RBU A;  4EI2 A;  5E0O A;  2BM0 A;  4G1I A;  3KK2 B;  4FKX A;  1TUW A;  3SSQ A;  2ZWP A;  3NEK A;  2RRA A;  5CYM B;  2H3E B;  1RTD A;  4IOA Q;  4JI5 J;  3ELH A;  4ZN3 A;  1U0S A;  4QW8 A;  4JI7 J;  3NG8 A;  4LFB F;  3R6G B;  4ED7 A;  5CHC B;  3KJV B;  2E7W A;  4MIB A;  4C3L A;  4CO5 A;  2W4C A;  3D6M B;  5LOQ A;  1IKW A;  4DN9 A;  2BM1 A;  1R0A A;  3MM6 A;  3PX0 A;  3CJK B;  1UVN A;  3ZZO A;  3ZO7 A;  5D0H A;  2VU5 A;  3DXB A;  1VDH A;  2OO4 A;  1IBL J;  1HBM A;  5D4O A;  3DLE B;  1R43 A;  3WZ0 A;  3PW2 A;  3KWM A;  5D3G A;  4DL5 A;  2U2F A;  1WEX A;  4ZA1 A;  5MLC V;  5ETO A;  2EBG A;  1N56 A;  4DSI A;  2XMU A;  4Q0B A;  1FJG F;  3A4T A;  4GVB A;  2RQ4 A;  3M30 A;  1Y3K A;  1UWB B;  5A2Q Y;  4DV7 J;  2VKR A;  2CPJ A;  3I32 A;  2HRT A;  1RI7 A;  3V4I A;  2HEK A;  3DC2 A;  4YHH J;  2B6A B;  4MYU A;  5CAB A;  1NND A;  2DO0 A;  1KVI A;  4DU7 A;  3FQL A;  4RJV A;  4CO1 A;  4M94 A;  1KP6 A;  2XGP A;  3VQT A;  3MEE A;  2ZWO A;  1FRJ A;  2R2S A;  4ICL B;  1K0T A;  2D9P A;  2P6S A;  2HQF A;  1DTT A;  3RU0 A;  4N76 A;  2GW8 A;  4WZM A;  4GVL A;  4NL5 A;  1XER A;  2MQQ A;  4FF1 A;  3JQJ A;  2F8H A;  1VQ9 S;  1H73 A;  4OI3 A;  2FB0 A;  3O6Q A;  4KB7 A;  3R7N B;  3MUR P;  2PSZ A;  2FGO A;  1AUS L;  3MD3 A;  2XS2 A;  3W66 A;  4MH8 A;  1IR1 A;  2EKN A;  4YUD A;  1NKB A;  4F2S A;  5B7W A;  4QZV B;  2YH0 A;  6FD1 A;  2Z57 B;  3UW1 A;  2JVO A;  5IOL A;  1NJW A;  4ECR A;  1S6U A;  2V68 A;  2M2B A;  1VR6 A;  1RHJ B;  3KUG A;  3MXH P;  4KGM A;  3HHK A;  4TY8 A;  5E3R A;  3PX4 A;  2L9N A;  3ZZ0 A;  5F0W A;  2MZQ A;  1U2C A;  3C15 A;  3T1A A;  3Q8S B;  5IC6 B;  4GKJ J;  2Y1R I;  2GV1 A;  4P72 A;  2V2Q A;  2QGF B;  3CC4 S;  2GIF A;  1ICE B;  3TJ9 A;  4AYB D;  4YS2 A;  2W9B A;  4ECY A;  1M1G A;  4NA3 A;  3K8W A;  2AT1 B;  4U7C A;  4C48 A;  1CLF A;  1RUS A;  4WKY A;  3CCV S;  4Y2K A;  4JI2 F;  4CT9 A;  2LU2 A;  4LJM A;  2IYI A;  2CG4 A;  2G2Z A;  4AT1 B;  2HKE A;  1T8E A;  4UQT A;  4OL8 A;  3W9J A;  1C1C A;  5HVF A;  1BQM B;  1VQK S;  2DXE A;  2ALY B;  3KNA A;  1IKY B;  1KDN A;  2PMW A;  4UT4 A;  4DQP A;  2GFF A;  1HNW J;  2PA8 D;  2ZH8 A;  4DL3 A;  1S72 S;  4ZPW R;  3MEC A;  3G6E S;  2QSF A;  4OJH A;  4DPY A;  4F04 B;  2GIR A;  5I4M A;  3ZTP A;  4YDD B;  1Y0H A;  3IS9 A;  2Z56 B;  3PX6 A;  4R0J A;  4EFA C;  2NXC A;  3CCU S;  2XZT B;  1WF0 A;  1A7G E;  3NWG A;  2JEJ A;  3W64 A;  4ED3 A;  2DRD A;  5KFU A;  5ETT A;  2VL1 A;  5E3C A;  1URR A;  2ZUG A;  5D15 A;  3KLV A;  3PRD A;  4C8M A;  2Q3P A;  2HVI A;  2DCU B;  4F25 A;  4LUB A;  1JMT A;  2MST A;  3GFZ A;  3KNG A;  2B9Y A;  2H5J B;  5HQ8 A;  3R5B A;  1IBK F;  2D69 A;  3ZTQ A;  2CAD A;  2HS3 A;  4I2Q A;  2V8G A;  3H98 A;  4TNO A;  5AE3 A;  4K4W A;  3PO5 A;  4PXD A;  3AY0 A;  4DV5 J;  4QWE A;  4CH1 A;  3KLG B;  4B08 A;  4A8O A;  4YME A;  2EKY A;  2CFX A;  2QLJ B;  3DLG A;  4OZ1 A;  4C0O C;  1HBO B;  3UR0 A;  1ZM3 A; 
#chains in the Genus database with same CATH homology
 2CUY A;  2QJ3 A;  3HHD A;  3TQE A;  2G2Y A;  2QO3 A;  2G2Z A;  3TZY A;  3H0P A;  2VZ8 A;  2G2O A;  1MLA A;  4QBU A;  3RGI A;  3SBM A;  3BV8 A;  5DZ7 A;  3TZW A;  5CZC A;  3K89 A;  2JFK A;  3EZO A;  2VZ9 A;  2QC3 A;  3G87 A;  2VKZ G;  2C2N A;  3IM8 A;  3TZX A;  2HG4 A;  5CZD A;  3IM9 A;  3PTW A;  3TZZ A;  3HJV A;  3CJ8 A;  2G1H A;  3QAT A;  4RL1 A;  4RR5 A;  2JFD A;  3HMJ G;  3R97 A;  2H1Y A;  1NM2 A;  2PFF B;  3R8Y A;  5DZ6 A;  2UV8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...