3SBMA

Trans-acting transferase from disorazole synthase in complex with acetate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
MKAYMFPGQGSQAKGMGRALFDAFPALTARADGVLGYSIRALCQDDPDQRLSQTQFTQPALYVVNALSYLKRREEEAPPDFLAGHSLGEFSALFAAGVFDFETGLALVKKRGELMGDARGGGMAAVIGLDEERVRELLDQNGATAVDIANLNSPSQVVISGAKDEIARLQVPFEAAGAKKYTVLRVSAAFHSRFMRPAMVEFGRFLEGYDFAPPKIPVISNVTARPCKADGIRAALSEQIASPVRWCESIRYLMGRGVEEFVECGHGIVLTGLYAQIRRDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of the trans-Acting Acyltransferase from the Disorazole Synthase.
pubmed doi rcsb
source organism Sorangium cellulosum
molecule tags Transferase
molecule keywords DisD protein
total genus 106
structure length 281
sequence length 281
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2011-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3sbmA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3sbmA01
3HJVA 3IM9A 2PFFB 2C2NA 3HHDA 3TQEA 2JFKA 2G2OA 4RL1A 2QO3A 3BV8A 2VZ9A 2G2YA 3G87A 2QC3A 3PTWA 2VKZG 3H0PA 3SBMA 3K89A 5DZ7A 3EZOA 5DZ6A 2VZ8A 5CZCA 3TZWA 2G1HA 3CJ8A 2G2ZA 3RGIA 3QATA 3TZZA 3R8YA 2CUYA 5CZDA 2QJ3A 3TZYA 3IM8A 3TZXA 1NM2A 2H1YA 2JFDA 4QBUA 2HG4A 1MLAA 3HMJG 3R97A 4RR5A 2UV8G
chains in the Genus database with same CATH superfamily
4RO0A 1EX8A 1Q4RA 2N82B 4X4PA 2DCUB 2OPQA 3WIVA 1ZOTA 2I38A 3MD1A 4K59A 1PSDA 4K8RA 4NASA 4Y6IA 4ES2A 4KC5A 4EZ9A 4I6AA 2QC3A 3NWGA 4ED4A 2PA3A 3CULA 4KGXB 1ZZNA 4ED3A 2HQCA 8AT1B 2R7TA 3M8PB 4P2MA 5CHCB 4ZHRA 1GNKA 4C6AA 3MUMP 3M2UB 4J9OA 4B3TJ 3UCZP 3DLBA 2LMIA 1SB6A 4F50A 3BBFA 3FEXB 1M0SA 3D54A 1RI7A 2H65B 2WK4A 2IM1A 5B0GA 1FXLA 4IRCA 2E1AA 4P2FA 3CD6S 3POTA 3Q8VA 1R43A 1RTHB 1IKYB 1S49A 2EKNA 3MR7A 4KGKA 4C48A 1T8EA 1FJGJ 3VQTA 1D3WA 4L3KA 3PVXA 1IKVA 3VGVA 5E3QA 4K5RA 5IFMA 2PFDA 2HHTA 4X2BA 3HO1A 1NDCA 1NK9A 3M6WA 4E98A 5GMEA 3SZ2A 1FWKA 2NYIA 2ZUAA 2PSZA 4FDFA 2HMIA 3K89A 4N8NA 4ECWA 4UW2A 4H4KC 1SKSA 2QEXS 2OPSB 4JB8B 3AT1B 3NCRA 2MMYA 5C7PA 2LKZA 3NGSA 4HTJA 4DV1F 3G8SA 3FSXA 1N5YB 3BSOA 3V6DB 1C1BA 3CJ5A 3O44A 4IG0B 5ITHA 4LRBA 4C8LA 1WC1A 1BWVA 5M2PA 3HSGA 4G1PA 2R8KA 1YGYA 4DR7J 4KKOB 2P9EA 1B70B 3DLKA 1JLQB 2ZH4A 1WC5A 2VC1A 5KT7A 2IHR1 2QA4S 3DM2B 1LKZA 4TN2A 3T1HJ 1T05B 2H5IB 4DUTA 2PMWA 3BZQA 4ZLNA 1HHQA 1HBUA 2J9EA 2VPWB 4WFZA 3FZ2A 4CZCA 1B0PA 1HMVA 2QGFB 3HHDA 2GMJA 3K5MA 4KH0B 4F4XA 3NL0A 4ALZA 2WVDA 5L39A 5ETLA 4DS4A 4OX9F 3JQJA 2DB1A 3Q8SB 3Q2TC 1FNMA 1HNIA 1EKRA 2K3IA 1QTMA 1WWHA 2CRLA 4N5SA 2DITA 5AE1A 4IH6A 3MAAA 4BWMA 1CG2A 1UETA 2CVEA 2QE5A 4KSEB 5J2MB 4JP8A 5HROA 4NCGA 3TANA 3U1MA 3H59A 5CZDA 5CAAA 2VFVA 1FESA 3JQKA 2R7OA 3OVSA 2XYPB 4JBCA 5LSLA 5KT6A 2ROPA 2PA8D 3HVTA 3KFWX 3J80Y 3JB9k 2UVRA 1VQNS 2B4PA 2FZKB 4J9QA 2MLXA 1UMJA 3CJRA 1P6TA 1IXKA 2D7SA 2V8VA 1URRA 1DTTA 1LWXA 2MGZB 3M32A 3W2VA 1XNQJ 2UXCJ 1TL3B 4IDKB 4XDDA 4ZA1A 5DQHA 4RWXA 4N77A 3Q8UA 3SDEA 4QYRA 3QSYB 3PCOB 3CCUS 3QFHA 1FE4A 4ED2A 5KFSA 4ZN1A 1R89A 2OAUA 2V4JA 1F6TA 3CO9A 1R0BG 1CULA 2H4WB 4ITSA 5DJBA 3RYLA 4J5OA 4URSA 4ZS6A 2ZWPA 1N33J 2UUBF 3NGTA 1UEKA 5H1SV 4A8YA 4EYHB 2EXUA 4RBTA 4K4YA 2JJ4D 4PWUA 2HHWA 4C8NA 5L1JA 3GTYX 2IMOA 2VDIA 2FGOA 3IG1B 3MM9A 5F8HA 3IR6B 3P49B 1NUEA 1WSRA 1C0TA 5F8JA 2F9DA 3CCZA 3M05A 3M8PA 3M2RA 3AAWB 4QWCA 3KLGB 4JOUA 3H40A 1FNOA 2QSWA 1LK5A 4LT6A 3VGTA 1XR6A 2X7IA 3IRWP 1IWGA 5KOXA 1RTDB 2GVZA 4LFBJ 2HS3A 3L95X 3RB0A 4ER8A 2E5HA 3D6HB 3VAHA 4PWDB 1XC9A 3P45B 2AYMA 4EU0A 4I0WA 1NHUA 7FD1A 4M95A 3RB3A 2OUGA 3HSJA 3C3LA 2FUG9 4AXIA 2ZJRQ 1G4CA 3CC4S 5F8NA 1ZPWX 1F9FA 2AZ1A 2BE2B 2JWNA 2JRSA 3ZTRA 2UVUA 1GEHA 1AFIA 3G4SS 3SCIE 5KFDA 2GO9A 1VK3A 3QO9A 4DQIA 4AUKA 4UOHA 2HRTA 3ONQA 4CLWA 3BO2A 4QIWD 1TAUA 5GMDA 3OD2A 3LAMA 4QR0A 4RUAA 5L1LA 2MKHA 1X0PA 3NNAA 4OFZA 2CZVC 1URNA 5DQIA 3TAMB 1IKWA 4LUBA 1V5IB 2BQ3A 1YVFA 4FNHA 1H2TZ 1WTBA 3IRXB 4WTYA 1RSCA 3AOAA 4IG0A 5GAEU 1JLEB 2DIVA 3KK2A 1KBRA 1OQ3A 1IR0A 1OY6A 2YKNA 1LWEB 3GLJA 4FYYB 4I7FA 1J5OB 3AODA 4KKOA 1FO1A 1MN9A 2YQ1A 2JL9A 5EGYA 5ETPA 3K5LA 1JLQA 3K58A 2BRKA 1R8CA 3D68A 4UQTA 3V4IB 3HVAA 2AZ3A 3OFHA 1YRXA 1VQ9S 3P96A 1RB0A 1UPMB 4U9RA 1RA7A 2VJVA 1NZ8A 3V6HA 2QN6B 3IBWA 2C2OB 3M30B 3PW2A 4N56A 1N4LA 1S1TB 3SEOA 3MCNA 3DLEB 3NBPA 3DRRA 1RBOB 4MAKA 3MM5B 1K44A 1C0UA 2V0NA 3DHXA 4A8OA 2KVQE 1F0XA 3TAPA 2BZ2A 2LQ5A 3KJVB 2A1BA 3T6BA 1Y5LB 1SQFA 2ZBCA 3A3NB 1AW0A 4B3SJ 1SV5A 3GFYA 3OVBA 2MKIA 2KZZA 5BR8F 2EFGA 1CBKA 2ZWOA 1FDDA 2F1FA 2I1RA 3QWUA 1X4CA 2ZFHA 4PPZA 3W62A 4TU8A 3F56A 2AYEA 3C15B 3KJQB 3V4MA 1QAYA 3B78A 3OUYA 3BGLA 5B0BA 4XPCA 4J91A 3MM7B 4G6VB 4DU8A 1BHNA 4B3SF 4NCBA 2IFXA 2QMXA 2CPEA 3JTNA 4O44B 1YJWS 2F4VF 2K3KA 3IR7B 1TL3A 4IDKA 4RW9A 1HW8A 2WTFA 4M5DB 3OW2R 3SV4A 1FVQA 1YIJS 1WUUA 4G65A 2EG1A 4HI2A 4PG7A 4HEA9 2DGUA 4Q44A 2DEJA 2WOMB 1NHKL 4HH1A 2R8IA 3TQ1A 2E5LJ 1TUVA 2OPRB 4K4XA 3T5JA 1N52B 5I42A 4QR2A 2YWWA 3BEGB 1MMNA 2WVBA 2NREA 1AXQA 2GFFA 4LVNP 4X4UA 1MNEA 3MCOA 3D2WA 4C3KA 3UO0A 2E1MC 2RU3A 4N7TA 4WIIA 5LMUF 3WQPA 3ILJA 5D6GA 1Q81T 4B9MA 1H7XA 4WP3A 3M9OB 2GGPA 3HKZD 2Y3YA 2RKIB 2NXUA 2WRMA 2FD2A 2B56A 3HT0A 3W9HA 4DV2F 3AQPA 5DRKA 5IT0A 1AUSL 3KLGA 1I94J 1TMJA 3IA0A 2AEJA 2XY6A 4B9TA 3T1YF 1Q5YA 4DCJB 3BQ2A 2CPDA 3QRRA 2M8DB 3ZTSA 2ZH7A 4IFYA 3N6MA 1NCLA 3KLIB 4PABA 2G0JA 1FRIA 2ZBRA 2B5JA 4CH0S 1NK0A 3SSRA 3F41A 1RKIA 1X7VA 4B17A 1KNZA 2V5HG 3A12A 3K7RA 3KMQA 3IM9A 4WP9A 4WXWA 1YLXA 2XMTA 3K57A 3RR8A 3ITHB 3T6JA 1RISA 1Y11A 1CEZA 3M1VA 4LBHA 3BJYA 1JLCB 2AJ1A 3HK2A 2F63A 1X8DA 2FLOA 2E9ZA 4ZPTR 4QU6A 3GWCA 1VRTA 4IR1A 2AP6A 2IM2A 2GMLA 1FF2A 4Z7CA 2JVRA 3HHLB 2V8GA 1G7CB 2QL7B 3SMZA 3DDNA 1XBWA 3VZHA 4YQWA 3HVRA 1EKSA 3MWBA 3M2VB 1MU2A 4OZ3A 4DV0F 1TK8A 5KFRA 1FRMA 1NJYA 1DTQB 1WNEA 3GONA 3I9V9 1PYTA 2ROEA 1UAWA 2CJKA 4C4WA 1NDLA 2GCFA 1Q53A 5CXTA 3THTA 3G82B 1RBAA 2ZHOA 3R5GA 3D6MB 2QRRA 5DDPC 4J37A 1SJ1A 1N8RT 3UN5A 4RNMA 4LFAF 1JKHB 4FS1A 2KH9A 3N6LA 4RPFA 1VRUA 4QIVA 3KK3A 4Q8FA 1GMWA 1Q8IA 2EVZA 5K5MA 1ZYQA 3LGMA 2IYIA 1RTHA 4P72A 4DR2J 3G8QA 4XDCA 2D3O1 4LBPA 4ZN3A 4ZIVA 3LGNA 1KLNA 3MM8A 3J81Y 4JI4F 4GKKF 2Y1JA 1WF0A 2MDAA 2DKOB 2ZBIA 3AY0A 4KGZB 1GX5A 1LEOA 3KK1B 1N36F 1IBMJ 1P9QC 3R5DA 4R5PB 2E1CA 2BV3A 2J5AA 4ECRA 2HKEA 2KKHA 1VDHA 5CYQA 2A2CA 2Z30B 3NS7B 2CJBA 3PJXA 4I1TA 1U45A 3H4BA 5KFBA 2HQFA 3C15A 3HT3A 5GVQA 2DTJA 2OPSA 4AMMA 3BQ0A 4O3SA 2OELA 2WVEA 2XBPA 3JSYA 4X84A 3TEHB 2YWHA 5BJRA 4Z7YA 1ACMB 5CYMB 2V9WA 2D1CA 1XIQA 3HZEA 3HHNB 3HD1A 3PX4A 2UXBF 4ZLLA 1E6VB 2IJNA 4CYUB 1BQMA 3DLHA 5GAGI 3EPIA 1EARA 2GHPA 2GC8A 2VKZG 2VASA 2QLJB 4WXOA 5B09A 3W5XA 4NX9A 4BC7A 1NJIT 2HURA 2APOA 3BB5A 3OLAA 2UVWA 4DR5F 2GV1A 2NXEA 3L7UA 4ZPDA 3BN7A 2ASYA 2E1RA 3NOCA 3KLFB 1KDNA 1VQ7S 4PWWA 6FD1A 1FKOA 1EZZB 1LOUA 1R7IA 2OPRA 2XNQA 4LRAA 3A8IA 4ZLPA 4RNNA 2ASLA 4P52A 3D3CJ 4X62J 4LREA 3IC1A 3OV7A 1I51B 5U47A 2UUTA 4MYUA 2NCKL 1JLFA 3W63A 4DFPA 2QX0A 1ZA1B 4Z2XA 3ET6A 2MQQA 4ZVOB 2HZAA 3MPVA 5DM7Q 2O66A 2LQBA 2EC0A 3QLHA 1IM6A 1WOOA 4A8KA 5H9FJ 3BQ1A 3K0JA 1RTIB 3DI6A 4YEAA 3N4WA 4Y65A 2GQ2A 3QNWB 3M6UA 1FWLA 3N6NA 4Q45A 2UP1A 1N0VC 1U09A 1YBTA 3UCGA 3G87A 3O2IA 4F2SA 3G2XA 3B82A 1PAUB 1Y9OA 4N41A 3H90A 2FHMA 1YRUA 4OV6A 1HWKA 2Y0BB 1KQFB 2UUAJ 2R2UA 2BW2A 1ZETA 3IP0A 4R8UA 4OJGA 2L9NA 4AD6A 1KD1T 1WHYA 1YRTA 4KH1B 5IV3A 2VOPA 3P8BB 2IA0A 1HQEB 2AJ0A 4QJVA 2GIQA 2XQCA 1QUPA 2HFVA 2J7UA 3BR8A 1JLCA 1KP6A 2R7WA 1X4FA 2QFIA 1X5SA 3H42A 3Q83A 4TYBA 5F0WA 5KFTA 3WC0A 5D4PA 1WC3A 1AA1B 4ANDA 3VAMA 4JI7J 1RBLA 1U1OA 1HYSB 3HCXA 1B4SA 1NRKA 3TX8A 2W9CB 3R3TA 4LFAJ 5HMWA 5L1IA 2HVIA 2COLA 2FQQB 3M2VA 3O8WA 3I87A 3CXCR 1OPIA 3AJ1A 2CQIA 2X1GA 1NSQA 3G82A 4DCOB 3E01B 1Y3JA 1R27B 1VIOA 2X1BA 3SQGA 3UDLA 1NJXA 1H2UX 2IC3B 3NG8A 3NP5A 2VA2A 1YK9A 5DG9A 9RUBA 1S1UB 4HT5A 5AJ3F 3TUZC 1K8AT 4W92B 2VBZA 2C42A 2I0XA 4PWDA 3A8JA 1N56A 3HJFA 1VRUB 4ZPVR 1AYEA 1CJUA 2CPJA 2DXEA 4YDXA 1Z2LA 2XS5A 2UXDJ 3AOCA 2CIMA 2VL1A 4DCPB 2HPUA 4DL6A 1VC0A 1S0NA 1RHUB 4NXNF 4GKKJ 1RT4A 1HARA 5HL7Q 1U8WA 2BE2A 4L6V3 5C5JA 2AYBA 1UW4A 4IKAA 4DR2F 4ZKAA 1WG4A 3QT6A 4LIWA 3KLEB 3VHQA 1S4FA 3MTJA 4R5PA 2FJDB 3RR7A 4Q2LA 3OT9A 3Q0AA 1RJJA 2DY9A 3UQSA 2U2FA 3GFZA 3PW7A 1SJFA 1CQNA 1UPPA 4XAKA 2CJXB 2PT0A 1VQ4S 4NLDA 1QSSA 4NXMF 1CVJA 4Y3CA 2KXHA 2UXBJ 2CNNB 5BYRA 1JLEA 1CC7A 4DV7J 1TELA 1VQSA 2HNDA 2YKNB 4CWBA 2ZOGA 2ROGA 3C19A 4R0JA 2QJ3A 1XR5A 3S6EA 3BREA 4ZJQA 4AMPA 3BPSP 2HGMA 4ILRA 3RUBL 4P75A 1YITS 2YWEA 2QLBB 4ED7A 3MR2A 2R7QA 3KLFA 1O8BA 3I9ZA 2ZH9A 2NR0A 3NMAA 3P5TL 5HP1B 1QJHA 1SI9A 4KHPJ 2AX1A 3CWJA 3TQEA 2VUGA 3K5OA 4C8ZA 4QPTA 2EBGA 2M88A 2QMUB 4FBUA 1JQGA 4FPRA 4AFFA 2QFJA 4CIOA 1WG5A 1TR0A 2KDOA 2X51A 2WB1D 4KY3A 4QR1A 4ZVEA 4RKUC 5L8RC 5DZ7A 2VA3A 1RAHB 1GAOA 4ZDNA 1A9NB 1RTJB 3LA0A 3GFXA 3PIPQ 5I3UA 1Q5VA 3G96A 2G1DA 1FKAF 1S9EB 1R6YA 2GQQA 1K9MT 3UVJB 1LWCB 3QBCA 2HBRB 4YB7A 5A8WA 5HQ8A 4ELUA 4F0MA 1LWFA 1WEZA 4NLUA 3JYTA 2Z58B 4DV3F 4OX6A 3WZ0A 3TUJC 1GH8A 4OYBA 4LF4F 2EFQA 1L5UA 5KFCA 4HDHA 4F67A 1R8BA 4BC9A 3I4HX 1YI2S 3BR9A 2HG4A 4LQ9A 4KGMA 3SI8A 1S6PA 2LQ8A 2M3DA 4LRFA 4DPYA 4F0HA 2DPIA 5HLFB 1RE1B 5M2UA 4ED6A 1VBYA 2PFFB 3IBFB 4ZP8A 2FJBB 2FJVA 3CPWR 1HI1A 3BV8A 3NXZA 4DSEA 5AE2A 3QGIA 5CABA 4X4VA 4NYOA 4ZP7A 4DL4A 1UW9A 2ZEJA 2FZCB 3SCJE 3CCTA 4MMOA 2XC9A 1NO8A 4Q0BA 1U1MA 4ZK7M 1V3ZA 4FF4A 1HI8A 2CDQA 2ZKUA 2AQ4A 1PILA 3DRPB 4N47A 3HM9A 3ILLA 1DFDA 3QGHA 1Q1KA 2B9YA 2HBZB 3MI7X 2MZQA 2XI3A 3ZZOA 3BO4A 3NNHA 2MKKA 3MOJB 1W7WA 5FJ4A 3FBCA 2KRBA 2DNYA 2DT9A 4DDFA 4L3NA 5BYSA 2N4DA 3OPKA 4PEOA 4KAIA 4DXLA 1K1SA 2UV8G 4YY3F 4LF4J 4ILLA 3T1YJ 2KXNB 1XMOJ 3IWNC 3NOGA 3QZ7A 1S1UA 1YJNS 2DIUA 1X5OA 2VC0A 4IFYB 3I0SB 4X66J 1VC6A 2V69A 3W60A 1CJUB 1CJTA 4TY9A 2N3LA 1NB7A 2QSFA 3MEDB 2HNZB 2R2RA 3OHBA 2J0SD 1FRXA 2DNPA 2E1PA 1N6QB 4WU2A 4CCHA 1FCAA 3C6TA 1FEHA 1AZSA 2ZBPA 2I2YA 2V67A 4USVA 2XLKA 2MJUA 3MPWA 1UWAA 4AE5A 1SL0A 4JV2A 4UZBA 3OJSA 3MR6A 2MQPA 3GR1A 2BE9B 4FXDA 4H4MA 4NZ0A 5EWFA 1N33F 2XGPA 3HVWA 3ISZA 1GTHA 4QIEA 1VQMS 2GIFA 4TY8B 2RRAA 2W4PA 3QYYA 5KFEA 5BYQA 2W1BA 4YR2A 4MKBA 2HIYA 4WIQA 2QTWA 4ZVPB 2L3MA 4LRCA 2MQNA 2LQ9A 5F3TA 3EMTA 3DU5A 3BGOP 3G71S 2MKCA 4WZMA 4MTPA 2MTLA 1M5KC 2VKRA 4I64A 1T3OA 2F8EX 4WP8A 4QW9A 3BDEA 1RCXB 1KSPA 4F3MA 1RWVB 1DLOA 2F9JA 1BUXA 1FT8A 3MMBB 3TR5A 1JKHA 1LW2B 1FX4A 5AXMA 3TO8A 3QATA 3KK3B 3WDOA 3JSMB 2VV5A 4FKYA 3OR1B 2M7SA 2DNGA 3G9CA 2JLFA 4YB6A 1U2CA 3TEGA 4HDGA 2KT5A 2C2ZB 2DR9A 2FY1A 2MQLA 3OR2A 3IGNA 4DR3F 3AD7C 4DPXA 2AJFE 4MKYA 3HHEA 3J81j 2Z2LA 3SFUA 1NU4A 3DLGB 2C2NA 2LCWA 3BN4A 4OZ1A 4NYPA 4RZRA 5A8WB 3BKUA 3GIJA 1TKDA 5B7WA 4JV0A 3J80U 2UUAF 1LWFB 3JYTB 2BX6A 1BWEA 3VAGA 1S7HA 1JIHA 3LWMA 4NMLA 1Y3KA 5CYMA 1M5SA 3D1QA 2FHJD 3L09A 4OHXA 3QJJA 3BPDA 2OMLA 5HLFA 3DMJA 1BQMB 2DJWA 3FEYB 1G3OA 4IFVB 1CLFA 3ZC4A 1T9TA 2I5JA 3SIPB 1ZH5A 3R5BA 2IRYA 1FKPB 1V6HA 4DR6J 3D7SB 2CZ9A 1V5VA 4DV4F 2XMVA 1T03B 4XIUA 5LT5A 1H0HB 1TV6A 4OQJA 4V19X 4PG5A 4X62F 3F73A 3WX8A 3QJPA 4M1KA 2G2OA 5T41A 3QWPA 2QA1A 1FJCA 1WG1A 3PYFA 2DO4A 2DR7A 3UN2A 1OSDA 1SJ4P 4ES3A 3D6TB 2B43A 2M8HA 4PR6A 2KO1A 3OL7A 3BGRB 1ZS6A 3OLBA 1KN6A 2OLWA 2B8QA 2J0WA 2PD1A 3TP2A 5DG8A 1YHQS 4NLXA 2Y1LB 4WWSA 1TKXB 1MROB 2NUUG 2V34A 5IM0B 3BO3A 2FVSA 1TAQA 2BBEA 4ZJOA 2PDAA 1HBMA 3CEDA 2ADCA 3D1OA 3RZAA 3N28A 1HHTP 3CJTA 4DR4F 2MEWA 1EJ7L 2QA2A 3B54A 1P1LA 4PAAA 2AU0A 5FDLA 4ZJLA 4EMDA 2R8GA 4F0KA 3W8GA 3H25A 2HGNA 4I2PB 1HQEA 1B99A 3VQSA 2LQJA 4ETXA 4TYAA 4DFMA 4NXMJ 2IBOA 1O6XA 2JC1A 4DPOA 4QU7A 4LF5F 4OHWA 1VBXA 2DNZA 2OSRA 3HKWA 4CDIA 2EK6A 3TA1A 5LMUJ 1RT7A 5DDQC 2BMBA 3DOKB 1HYSA 2OHDA 5KG5A 1IBKJ 2C3UA 4USUA 3SCKE 2KYZA 4OHZA 4FVCA 3CCMS 3C2PA 2BJ8A 1IBLF 1FTRA 3RW7A 2HFOA 2YKQA 1F60B 3QJLA 2L9WA 3PYGA 1UFLA 3HSDA 4L74A 3SV3A 2LXFA 4GVBA 4YB1P 5GMKa 1PG5B 1X60A 5LXRA 2HYIB 4RJVA 2EFPA 1DLOB 1OYDA 2D9PA 3MMBA 4F3OA 1UVNA 3H5XA 1V3RA 3O1LA 3U02A 5HVHA 4WFAQ 3JSMA 1S9GB 3E8OA 5F41A 3PHEA 4EWTA 2V8DA 1VHFA 1DAXA 5K14A 1DARA 3I55S 1HD1A 1YZ6A 2DRAA 2FZGB 4DBQA 3EXCX 3M8QA 4YR3A 1LFPA 1SH2A 1T9VA 4DFKA 1TZ0A 3PFEA 4JI6F 2NUHA 1ZTWA 5D3GA 2R7SA 5H9EJ 3QGGA 2DH9A 3W66A 1R3NA 4WK3A 1X9WA 4C7QA 4U8YA 4UOGA 3MEKA 1XNQF 1RGVA 4H4KA 4ID5B 4PYAA 3W1YC 5G0RB 3FJ2A 4NZ6A 4GC6A 2MXYA 1S12A 2D69A 2RF2A 1U7LA 4ANCA 4DV4J 4NE9C 2UU9J 1OMSA 2GHVC 4EO6A 3CJ4A 3OSNA 1NK5A 2CAJA 3OTDA 1RT6A 4O0NA 1TK5A 3TUPA 1GX6A 2BOPA 1MMLA 2BJ3A 4DV6F 3NGKA 2ACYA 5D4NA 4GKJJ 1Q0NA 2ZC3A 1FA0A 4P74A 1FRKA 3BSCA 3CD7A 4M5MA 2IVFB 4ED5A 1T9WA 1NZAA 4J9VA 4U8VA 3QRPA 4F4AA 1OY8A 1JXEA 2DGSA 4WU3A 4MH8A 5E3PA 5B0EA 2QLFB 2G13A 1BGXT 3GV5B 1S0MA 3R7BB 4ZITA 4RBVA 1T03A 1LV5A 1T94A 1K0VA 2AGPA 3DDKA 1RAEB 2RQ4A 3VCDA 2HRUA 5C2CA 1Y00A 1S6QA 1X31C 2BOAA 4YUDA 2K7KA 3OSPA 4DZ6A 2OP5A 4USTA 3OVAA 1FJEB 2HBYB 2DVIA 1LW0A 4NEYA 5K9FA 3LO3A 4ZMMA 3JQMA 3T1HF 1RTJA 2LEPA 3FGVA 3BH7B 3BGRA 2XLIA 4CM0A 2O67A 3EJMA 3TOQA 4C11A 4NRUA 3UVJA 2CQCA 5C42A 3I32A 3AB4B 3GYXB 2MZTA 2V94A 1HBMB 2AD9A 4K50A 1KVIA 1F9HA 4EBCA 4W4MA 1XMQF 1H3DA 5IT9Y 1N54B 4GKJF 2R2TA 4OZNA 2KB2A 3BH6B 4ZVHA 4NA2A 3ZFVA 3KYLA 1ZM3A 4WFXA 3ZTQA 2E5IA 4FZVA 2YNGB 2CA9A 4KBIA 2FIUA 2MY8A 2FHKA 3L4BC 1K73T 2K2PA 2POKA 4P2XA 1I6JA 1EP4B 3R5AA 2AIRB 2LU2A 1EHWA 2DNNA 5J2PA 4JI5F 1RYSA 4DPTA 1VJQA 1WHVA 2RHSB 3P6YC 1TL1A 5IQQA 4R0EA 4DJBA 1MLAA 4ZVRB 2XCPA 4OYOA 4L75A 3IWXA 1Y4ZB 1KVKA 3DRPA 3F0NA 1FFWB 3CMES 1SUQA 2XULA 3KLHA 2AYGA 4K2JA 2RJZA 3CCWA 1FX2A 4RW8B 2Z2YB 5B0AA 4X4RA 3GIMA 1M5PC 2AJ2A 5KFAA 1T7PA 3UFCX 3EGNA 2BJ1A 1HW9A 1DJ0A 1Q8BA 5IWAJ 4FYDA 5C24A 7FDRA 1GXTA 2HIQA 3IFEA 4QIFA 3IAM9 1KLMA 3THVA 1NKCA 5IZHA 4HACB 3SFGA 2CDRB 1Q86T 2OTLS 2XS7A 1K0TA 5A8KB 5J1PA 1UJ6A 4G1IA 3TNVA 1OIAA 5E3RA 1IKXB 1RAOA 2WSFC 1HNWJ 1EETB 4IUFA 4NEZA 3H2VE 3PFOA 3HFKA 1YX2A 1KOOA 1SJRA 3FEZA 3MEDA 3UDCA 1BQNB 3I5BA 3PIOQ 2KFYA 2EKYA 2ZC4A 1KHVA 1IJFB 1HWIA 1QUVA 3TI0A 5L9NA 1KS2A 2B6AA 3LP0A 4X4QA 3H8YA 4WYWA 4A47A 3MMJA 2AGOA 4DV7F 1SJ3P 4DUZF 3ETMA 5D3GB 2K8GA 4EZ6A 1KEKA 4H4MB 3ADAC 1FXRA 1HWJA 1S4EA 1NDPA 3PRVA 2HZVA 1HA1A 2GHWA 2NSCA 3DRYA 4P71A 4DL2A 1KHWA 1NLKL 5HMZA 4NLTA 4UF4A 4ZCLA 4TU9A 1SL1A 3EZ5A 4BHQA 4YDDB 3RGIA 4ZLJA 4DUZJ 1HMVB 1BMQB 3GIRA 2NPFA 4OI6A 2XHCA 3CJQA 5IOLA 4URGA 3R1HA 5HJYA 1HHSA 5IS2A 1PCAA 1E6YB 4DR6F 2G0IA 3R6GB 3THPA 5F8IA 1F9EB 1HNIB 2YWKA 2M0GB 3N79A 4DSJA 1WC0A 1MN7A 3N0VA 2WONB 1K1QA 4N76A 2LDYA 1PYOB 2BM1A 3D6FB 3OR1A 4MFBB 3CVKA 1WI6A 4I56A 3TVKA 4NCGB 1S6QB 5L46A 2YQ0A 3CDEA 2WVCA 4YY3J 5CH7B 1YG0A 2EEYA 2WBMA 3MM6A 3O3LA 4IOCQ 5J1NA 2PE8A 3VR1A 2GAHC 1Y5IB 2DHHA 1JNZB 3N9UC 2OD6A 1H2VZ 1HQUB 1ZPVA 2GVDA 4JI1J 3AJ2A 2YTCA 2ASJA 4B3OA 1RU1A 2L48A 4RWWA 2LFVA 2NQPA 4FXWA 2XGQA 4OL8A 4ECYA 4K7QA 2CWKA 2UXDF 5D0GA 1OSCA 2B7CB 4U67Q 1XWLA 1TUWA 4O3QA 3UE2A 1SQGA 2ATCB 2BR0A 3MMCB 1HBNA 2VQFJ 1J27A 1JXVA 2VD3A 1DQ8A 1RT3A 1XNRJ 2YKMA 1HNXJ 2Z0GA 3EDRB 3LP2A 4V1Ak 5GAHU 2F65A 2HS0A 5HK4A 3ENVA 2W7AA 1QTNB 2WHOA 3M8WA 5A0YB 5J2PB 1T3NA 4WYLA 1YJ9S 2AX0A 2R7XA 2RDIA 2YNHA 3GYGA 1PBUA 2BEFA 4FP9A 3CDUA 3AB2B 1CJKA 1HWUA 3DRSA 3GB0A 4N8OA 3J7ZT 2RAQA 4KGVB 1U2FA 3BBBA 4KIAA 3IR5B 5D0EA 4RW8A 4OYPA 3RB4A 2R3VA 1QSYA 1FDBA 1N36J 3Q2SC 2RILA 4PQAA 4F4YA 4KPYA 1G6BA 1X5TA 2W2MP 5D4LA 2W4CA 2CG4A 5JVGQ 4CH1A 1MROA 2W7OA 3D5MA 2ZD1A 1H38A 3FBFA 5A8KA 4CLYA 3D1HA 1B7YB 4FKXA 2CNOB 4LBIA 2VG5A 3FQLA 3AOBA 4P7VA 4USIA 3Q24A 3QO9B 2UXCF 3HF5A 1BQXA 3LOUA 4UY8T 2VF3A 4P9SA 5HAOA 2RQCA 4ZVQB 3K59A 1UTAA 3QRQA 3Q89A 1ELOA 3ZZRA 2YH1A 3NGRA 2V2ZA 2KL8A 5J2NA 1CPZA 3MTKA 3TAMA 4I2PA 4KR0B 4DQPA 2VQEJ 3DGPB 3IRXA 2NXJA 2B4UA 4J9MA 1NK8A 4KRWA 1RAGB 5DO2A 5GAHI 4ELTA 4ZCKA 1RCOB 1S7IA 5IC4B 4UOFA 2H5EA 2YXLA 4LRDA 1W26A 2P9GA 3VWSA 3DDIA 9ATCB 4LSNA 3RBDA 2ABYA 3PNIA 4ED8A 4O23A 1GMVA 3LUYA 3ZZTA 1TTHB 3DKDA 3OL9A 1Q78A 2O3DA 3N5FA 1L3TA 1WF2A 1KC8T 3R1LA 4ECSA 5F9NA 2B9XA 2L08A 1UWBA 2QMWA 2C2MB 2HQGA 2VBWA 4FN5A 3FCHA 4RNFA 3MGJA 4J9PA 3V6KA 1WEYA 2AHOB 4IH5A 4UT4A 1JLGB 3ENQA 4AL5A 1S57A 1JX4A 1F5CA 4DR3J 1MW7A 3GJSB 2IJRA 2Y1IA 4B9VA 3MXHP 3KKFA 2XG8A 1SH3A 5D0HA 4LR7A 5KT2A 4UY85 3MFHA 1SQEA 2ZOFA 4FYXB 4TU7A 1ZAVA 2WSEC 1S6OA 2OPPA 3H2LA 2LA6A 4CT8A 3C14A 5T7LB 5H9EK 2FB0A 3OXFA 2ZZMA 5DM6Q 4NLVA 3D67A 1IVZA 3FRZA 1ZM9A 4OMFG 5D0RA 1RADB 4CO1A 2BDPA 2JZ5A 2J0QD 2W2PP 3M8QB 1SC3B 2FY8A 4CI0B 1MWQA 3LALA 4NI2A 3CC2S 3PO4A 4ZPCA 5ETNA 4DLGA 2MB0B 4UOCA 1ULRA 4OX9J 1IBMF 2GVDB 2O5DA 1HNXF 2C2RA 3UD5A 1Z2ZA 1WD6A 1X0FA 4DSLA 3L7PA 1YJ7A 1KWMA 2VG6B 3OFFA 1IR1A 2N3OA 3ZZ0A 2RF2B 4QPXA 3I6PA 1T05A 4QYZJ 2E44A 2WOMA 1LXNA 1HBUB 3ELHA 1I3OB 4H4OA 4KQZA 4NA3A 4B3MJ 4PG4A 2UVVA 1YDLA 1SJQA 1CJVA 1JWWA 4LSZB 3ISNC 4X4SA 4JI5J 3MPYA 2Q1LA 3LP2B 4DFJA 2E5GA 1NSPA 4CH7A 5HO4A 2WSCC 1SKRA 1FFGB 3Q8YA 2BQUA 4ECUA 1L3KA 2XI2A 4WE1A 2UV8A 3HSZA 2HWTA 3HMJG 2C3YA 3TX0A 2KT3A 1YJTA 2W25A 2YNHB 4M5JA 1JJCB 5AT1B 4JI3F 3MAQA 1RACB 1RK8A 3FRYA 5J2MA 1RU2A 1U1QA 1TU0B 4IG3B 4C8KA 4P10A 1S97A 3W64A 2D74B 3MD3A 3VVTA 2F4FA 3HVTB 4TXSA 5E5NA 3SBMA 2UUBJ 2MYFA 3GFHA 3J7YI 3AXKA 5L9XA 3ZZZA 4F36A 2MZJA 1WTFA 2SXLA 5HBMA 1FD8A 1S1VB 2ZH8A 3TARA 2OMOA 3UCUP 1EQ0A 4IOBA 4RUBA 3B6BA 3K17A 2YWGA 3VAKA 3FDSA 3MFIA 4F25A 3BGFA 4USWA 4C3LA 2H51B 1IR2A 3M1VB 1DHMA 4YS2A 5CA5A 1GQEA 2DXFA 3J7YU 2XM3A 3AHPA 1VISA 5LSOA 5B08A 2RQMA 3QQCD 1TVRB 2KG1A 1U47A 2FLPA 2WZ1A 1S59A 2YNGA 4ED0A 3MECB 2DHSA 2JFKA 1X4BA 3DGPA 3LPYA 3U1NA 2MSTA 4HT7A 3CJKA 1C0TB 1WC6A 5A8RB 3UNYA 1X9MA 1YZ7A 4O4GA 2HVHA 1X5PA 3EICA 4Y2IA 2KRRA 5E2QA 3T5HA 4LSNB 1UJ5A 3SSSA 3EPGA 2KM8B 1RT2A 1RTDA 2BW7A 5F8MA 1VK8A 1RWPB 3GP9A 3H4DA 4ZVGA 2B4OA 2ZZTA 3QAUA 4WK1A 1TKTB 2GS8A 1S6UA 4A8SA 4KHPF 2A6MA 1BLUA 3ZTOA 4JI4J 3PJWA 4HACA 3MM8B 3I56S 4B9UA 1KQSR 2HHVA 2RUSA 4DF8A 1U1LA 5FLXY 4B3RJ 1REGX 4DX6A 1EETA 1Q7LB 3A8KA 1JXLA 2HVZA 3RG6A 1HNZF 3MR5A 3D0HE 5CYQB 1NDKA 3EVOA 4EFAC 2XLJA 2RD5C 3HPOA 2IDLA 2JDJA 4A8WA 2XB2D 5DZ6A 2FGCA 1M90T 3OFGA 2JNJA 3JXOA 3T3FA 4WTOB 3WHIA 1RWWB 2ERRA 2MQOA 3CC7S 1VJWA 2CQPA 2M9KA 5F8GA 2RHQB 3MOZA 3HDSA 4BBYA 3KK2B 5L1KA 2YKPA 1AB8A 2IDEA 4CLFA 2VB6A 4MYTA 5C25B 2VQFF 1SL2A 2DGOA 1XEZA 6FDRA 4ETZA 2C2EA 1N34J 4DL5A 2DYAA 3KHRA 1V3SA 1OYEA 2CQ0A 2V68A 4RNOA 2R7UA 4ICLA 5LL6d 3FFIB 3FSYA 3TJ8A 2MKSA 1VQYA 1JK9B 2OEMA 1VLYA 2BANA 1QSLA 3CW2C 1C0UB 2C1EB 3W9IA 1PC4A 4P6QA 2A18A 3ET6B 4AXJA 2QIFA 2UUCJ 3LF0A 2EBEA 3MPUB 4K4SA 2MPUA 3AQOA 2KFZA 4W90B 1ROFA 2XZTB 3KHGA 2BYCA 1QE1A 1YJVA 3W9JA 4OJHA 3FBEA 2JEGA 4WBFA 4MFBA 3J81U 4AL7A 2DRDA 4OI4A 4RW7A 5KFQA 4NA1A 2HEKA 4LQ3A 3TZYA 3IM8A 1M1GA 3DOMA 3PDNA 4HHHA 1CC8A 1NHVA 4USKA 3CCQS 4DV5J 2UUCF 3UD4P 4B9LA 4OX7A 2JLEA 5DS7A 5I3QA 3OL6A 2GW8A 3RAXA 4K4WA 4PUOA 2DEIA 2OFHX 2I6WA 5IWAF 4O44A 2E7VA 2HVDA 2YX7A 2BJ9A 1RABB 3QIDA 2H5JB 2QLXA 4WF9Q 2VBYA 5C2GA 3MUTP 8RUCA 7AT1B 3P3DA 1NKEA 2UU9F 4F2RA 2Y8YA 2A3JA 2RU9A 3FK4A 4GMKA 5E0OA 1RHJB 2FJXA 4OX8A 2RVJA 4LF8F 3HX9A 5EX0A 2YPYA 1RT3B 4KV8A 3IN5A 5JJBA 2GA7A 1N5SA 2J9DA 3BKTA 3NWRA 2OEJA 2OPQB 3IGVA 4UQGA 3HHLD 1SIZA 5BXIA 3DNCA 3CJKB 2GGPB 5EDWA 2J7WA 3R7SB 4NLGA 1U0HA 2RKIA 4YMEA 1XK8A 2MY7A 2YY3A 2E29A 2RB7A 3E01A 5LMNF 3W3SA 1SC6A 8ATCB 4DSKA 3KOAA 1KRPA 3PRBA 1RT2B 1NJWA 1WF1A 3OTCA 4DI6A 1YJRA 4L73A 1A7GE 4JI2F 1FNXH 1D0EA 2XMMA 1C2PA 1N5VA 2AT1B 2Q3PA 2CPIA 3FCWA 1S1XA 3KDOA 3TRGA 1UVIA 1U25A 2PC6A 2HK3A 4X65F 4H54A 3ZXWA 3NCQA 1RT4B 2MHNA 2KHDA 4OV1A 3DOLA 2PI4A 4FVMA 4Y2MA 1YSJA 1HKAA 1JLBB 1RWNB 2BACA 4LF9F 3GV8B 4OLPA 1RAAB 3GU0A 2MZRA 2VDHA 2F8MA 3L7OA 1D8ZA 1RAJA 3R5JB 4NLRA 4LF6F 2HGLA 1W2BR 1HD0A 4IOAQ 3BM7A 5KFUA 2ZVIA 4AQYF 2V8PA 1WC4A 3HFVA 5A6WA 3S8SA 4LIRA 5CZVA 5J2NB 4DQQA 1LFWA 4K0KJ 3HHKA 2D41A 3BKFA 4HL9A 2RMLA 5IC6B 3CDAA 3C16B 1C1BB 1UZHA 4CLLA 2M5YA 4ECVA 3H7HB 4JI7F 4DV1J 1ZZFA 3KJNB 5C25A 3PY8A 4FPIA 2HLTA 1XNRF 3DLKB 4ENOA 4A8MP 5J1EB 4Y2KA 1HIYA 5D77A 5KFVA 1D1UA 1NMEB 3CO0P 1SC4B 3CD0A 3UPFA 4KJIA 1DQAA 4KO0B 4MIWA 1PBAA 2ZNZA 3AH6A 4LF7J 3BYPA 2DD8S 1UWBB 2EC2A 3FFIA 2DGXA 3HHLC 4K5SA 1ZBTA 2K06A 4QZVB 4PKDB 2MZSA 5KFLA 2VU5A 2FPHX 1RHKB 4OYWA 1NH7A 5K8MA 1KFDA 3OTOF 3VTIA 2HAFA 3RAMA 3RW6A 3UI3A 5SZTA 4WPAA 1SKWA 2CQHA 4DZDA 4FNIA 2CFXA 4Q7AA 3KK1A 2N7CA 1N48A 4JI3J 4WKYA 3HD2A 2FJWA 4LF7F 5I3UB 3CMAS 4Q43A 1AFJA 2F4VJ 3ISND 3GCWP 2R8JA 2XS2A 1Z1ZA 5HROB 4K0KF 4DV2J 1PYSB 4DG1A 4DHVA 2V2KA 1ITPA 1OS5A 3DOMB 4CO0A 4J9LA 2ACMA 2EW9A 2B4VA 2O01C 5CD4A 2FVPA 3CE8A 3CDWA 4Q8EA 1FERA 2HHQA 1OWXA 1Y0HA 2Q79A 1S6PB 3W5ZA 2IJFA 1E6VA 4CYUA 1DTTB 2MGZA 1UVLA 1Q79A 4CO2A 1S5ZA 1KONA 1IBLJ 1RQ0A 5CD4H 2XO7A 1A0OB 4DR1J 1IBCB 3R2CJ 5E7OB 1HWLA 3NCPA 3SDEB 1O51A 4CLSA 2VIHA 1QM9A 2E7WA 2PGCA 3LP1A 5KG6A 1RT1A 3I5CA 4EBEA 4DR5J 1PJ7A 2XWXA 4PPDA 5E3AA 2XYHB 4KFBA 5ADZA 2IIHA 5KFHA 3M8SA 3K8VA 2ILZA 2VG7B 4DX8H 2NLWA 4M5GA 2UZAA 1RDRA 4Y28C 3G6YA 5KG4A 4YR0A 2ALZA 4B3TF 4I2QB 3BBCA 4QW8A 2ZH2A 4TQRA 1BY9A 2XY5A 4Y00A 2GIRA 2MKYA 3QLHB 4WE1B 2FHJA 2BVZA 1RHQB 1RWOB 4I4BA 3GIIA 2OTJS 3M2RB 4GC7A 1CS4A 5IXUA 2CPHA 4IG3A 2CJ9A 3QT7A 3I82A 3AA9A 5G4DA 2HVEA 2VPXB 4LR8A 3VALA 1VCTA 1WOPA 2LXUA 2P6TA 4F4ZA 1NK4A 1QVGR 1OO0B 4RW6A 4URQU 4QWEA 5HATA 4OI2A 4PG6A 2DNMA 3VV2B 1D8YA 3EUNA 4AQYJ 5DDOC 1U02A 5H9FK 2QYCA 3W2WA 3C6TB 1KVJA 2YNIA 3VAFA 1N5QA 4A8QA 1T9YA 2GMHA 4RU9A 4EYIB 5DLGA 1PGZA 3GYNA 3GV7B 1UL3A 1FI4A 2CQ4A 1JLAA 5ETTA 4BLGA 1DY3A 2XY7A 1U49A 1IBKF 3DXBA 3NKYA 4PYDA 4ILMA 4KE5A 4C0BA 1TVRA 1YQHA 2W2NP 1GXLA 5B0DA 4OYMA 2W9CA 1IKWB 2W4DA 1TP7A 5B0FA 3QZ8A 1BD6A 1QD1A 4RBUA 3G6VA 4AT1B 2FVQA 3C16A 1OQ6A 2ZH6A 5A8RA 4ZVTB 2XCAA 3M4XA 4I7FB 3HXMA 1J5OA 3VZIA 4J9SA 1NM2A 1H74A 1J2VA 1TL5A 4C0HA 3SQGB 5B0CA 3V4IA 2IC3A 5FLXU 4DX5A 2Y0SD 3CTRA 2MJNA 4P73A 2GJ2A 3ZNUA 3FBBA 2ZH5A 2ZKTA 1HLWA 3POTB 3H0PA 1DZ5A 3DRRB 5LSRA 3KG0A 1A6LA 1RUSA 4AYBD 4NMXA 2D3OR 2NPIA 2XZWA 3OR2B 4AMNA 2GQCA 4YOEA 1SV5B 4MIBA 5A2QU 4J9NA 2IAJB 3PXGa 1FRJA 2H3EB 2ZITA 1FHTA 2EFNA 2BM0A 5KG0A 2Z57B 3TZZA 2ZE2A 4ZPAA 2QL9B 4HVZA 4NYZA 3OQ2A 3P4UB 2XHWA 2HMIB 2AMCB 3N5BA 3I96A 1VQLS 2QA4G 3MM7A 2JC0A 4ZCMA 4HKQA 2V4RA 1T02A 2NZCA 2VFSA 3HHLA 4QWBA 3FSIA 3KHHA 1N5YA 3BF4A 5KFZA 4NLPA 2BJDA 1M1HA 4I67A 3UN3A 4RW9B 4X66F 4LFBF 4DLEA 2Y1RI 4Y2CA 3PV8A 2VJUA 1B7FA 5AXLA 5EUHA 1VQKS 1QVFR 3DM2A 4Q5VA 3GG1A 4QOTA 3T41A 1RT1B 5CZXA 1VQPS 2V8HA 5KG3A 1S10A 4G3IA 1NH8A 3C66A 4DV3J 2J8AA 4GRSA 2W2OP 4KFBB 4LR9A 5I42B 2HW3A 1ZAXA 5A6PA 2LLZA 4DU7A 1WDTA 2VG7A 4IH7A 4PQUB 5SUHA 4Z37A 4JI8J 3PX0A 3B8HA 2HBQB 2DGQA 4I2QA 4F4KA 2OSQA 2Z2ZA 4RUCA 1EIYB 1F2GA 3Q8PB 1MMDA 3MAAB 3ZZYA 3FQKA 1S9EA 2F5GA 3K5NA 3NAHA 3E2EA 1R6VA 5IM0A 4C97A 3OJUA 2HWIA 3WX4A 2KM8C 2ZOMA 2VONA 2D3ZA 1NK7A 2CZ4A 2CWXA 3CD5A 4P7TA 2OGUA 5KFGA 4RW6B 3KLIA 1U48A 1S79A 4GO7X 2HHUA 1GK8A 4ZPWR 5F3ZA 2RS2A 2B5JB 2WBRA 2M4MA 5FDLB 1MWYA 3EVWA 1UA1A 2YNIB 1AT1B 1C1CB 2VOOA 2R4FA 5IT9U 4CNZA 2CUYA 3ITHA 4DEZA 2F3JA 2ATLA 2V6AA 2L41A 1U6BA 4B3RF 4WZQA 2XMUA 4R25A 2DNLA 1JLAB 1TL7B 3BGUA 5IV4A 3ZNJ1 1T9XA 1HQ2A 5EWGA 4Q0BB 3CCRS 4M5LA 3MEEA 2V63A 2VICA 3S1TA 4RR5A 4USMA 5ETQA 2C3PA 1O5JA 4FF2A 1HPZA 4S0MA 3LPEA 4GO5X 5AJ3J 3ZTPA 2FJEB 3MM9B 1VQOS 4IQMA 3I31A 1ZAWA 3B4MA 3EWGA 2O1PA 4FXVA 1U0HB 2JHEA 4JI0J 1IQZA 2HNYB 2XEXA 3VGUA 2X3GA 3AXMA 4QIGA 1TMMA 4ECZA 3ILOA 4ECXA 1Q8KA 2KN4A 4QWDA 2G4BA 1FRLA 3NNCA 2AJ4A 2GVZB 2QLWA 1T95A 4U96A 4O3OA 3H5UA 4LFCF 1WI8A 5KOWA 1U1NA 3ENAA 3PYEA 2V4QA 4OYXA 3G86A 2DNQA 3NS5A 1B3TA 4IQXA 4NRTA 1I1GA 2JFDA 1NBEB 2ZJPQ 5EN1A 3KJFB 4OZ5A 1JNRB 3RBEA 1X4EA 1FE0A 2A0FB 3DOLB 2OIHA 1VR6A 5KG7A 1UFKA 2V9KA 1JLBA 4OI1A 3EZUA 4HH0A 4NZ7A 5KT3A 2ZE2B 2OD4A 3RB6A 1KFSA 1VIXA 4HLBA 1XJWB 1RAFB 4ZP6A 3GILA 1BE4A 4ID5A 2HFZA 3DLJA 4J9KA 4O3RA 3KNAA 1S99A 3PR5B 4FYWB 4TY8A 4DS5A 2ZVSA 3SQOP 5EWEA 1WHXA 4WJBA 3R5CA 1NK6A 5AXNA 2IVYA 4F04B 3CB4A 3AA8A 4PXCA 1PJ6A 3J7Z5 1SXLA 1WJ9A 5KFOA 2Q43A 4DV6J 1HR0F 3PZPA 1FTCA 2ILYA 2HS4A 1AROP 4C2MA 5J1EA 3PM9A 1J5EF 1R8PA 2J8SA 4QBUA 4D3GA 1RWMB 3NS6A 1TUGB 3B4DA 5F8LA 3OBIA 1LW2A 1JJHA 1FKOB 3MZIA 4ZVFA 2HQDA 2OI2A 4KYZA 1S1TA 3OL8A 1XTZA 3GSIA 3R27A 2FJAB 4CM2A 2Q66A 2QT7A 1DBDA 4HTIA 2JEJA 1U26A 1ZM4A 5HJXA 4K4ZA 3KJVA 1YBUA 5KFFA 2QL5B 3DN9A 3X3UA 2YNFB 1RTIA 2VQEF 1JJ2R 2OEKA 2YKAA 1KTQA 1C4AA 5K8PA 1IQTA 2BE7D 3OUYB 3C6UA 4C8MA 1M5VC 3I0RB 1UVJA 1N5TA 4RLEA 3VAJA 2Z2MA 3U7JA 5J2QA 2C28A 3J7A1 1NSKL 3DMJB 4IFVA 4OIXA 5HANA 2EWHA 4R8UB 1BC6A 2RRBA 4M5KA 3GPAA 4OLOA 4M5DA 1C1CA 1HNVB 1S1WB 3D0GE 1ZTTA 5KFKA 1GMUA 4KT0C 3KTQA 3A13A 2E5LF 2UUWA 2W24A 3RTVA 1IWAA 4CTAA 1TV6B 1FXDA 3MEEB 4KPCA 2AW0A 3TJAA 2DR6A 4ZPBA 4CO4A 1YTYA 3CIZA 5KAKA 3AFGA 2RNEA 3DGVA 1NPKA 1RA6A 1YWXA 2K7JA 4NL5A 3UDEA 4LF9J 2KVIA 1PC5A 3NGUA 2N4CA 2FC9A 3CJ0A 3PG9A 5THWA 4ZVUB 2Q6CA 3TA0A 3NEKA 2W2QP 3W8PA 2W9AA 1W25A 3JTOA 2DRBA 2HNYA 5C24B 1FK9A 4PQUA 2XMJA 2DO0A 4NCAA 2Z8QA 1TKXA 3UR0A 5EX3A 4CLTA 6AT1B 3LANA 4DV5F 3JAMU 4X4OA 4KB7A 1SVDA 3OTBA 4DWIA 2VZ9A 5CQGA 3MCMA 2KI2A 4MKVA 1U0SA 3WBZA 2RDDA 3JSRA 1XN9A 1U2RA 3QPIA 2ASDA 1NAQA 3W2WB 2VZ8A 1TL4A 3QGPA 2HHXA 1XERA 4PZVA 4WKRA 1H7WA 3JS9A 2H4YB 3M8YA 4DN0A 3EXYA 2R2SA 4CLPA 3X1LB 2CJYB 1U8SA 1WKKA 1Y5NB 3FC9A 3KLEA 3V81A 2JLGA 4NLOA 3ETOA 3S01A 1PKUA 2CQGA 4DL7A 2FDNA 2ZNYA 4CLUA 3UD3P 3A3PB 4U6PA 4LF5J 5MAOA 1NB2A 3LH2S 2YBVA 4L72B 1QDUB 3DOKA 4DR1F 1VMBA 3A8EA 5D78A 4C8YA 4NXNJ 1MU2B 1QLNA 2VH7A 1DTQA 2RH3A 5L38A 3R7NB 2HNDB 3TW0A 5KFYA 5LMNJ 3NMRA 2EFOA 3N01A 4ANEA 5EHHA 2FLNA 4O0IA 3G6ES 2E66A 1FWPA 2NXNA 2B7BB 4I68A 4MK9A 2W7PA 2FVRA 2PEBA 1HR0J 5DETA 5HP1A 1RLDA 5E41A 2WONA 2PO4A 1PIEA 2DHGA 4USHA 1RHRB 2DGWA 3GIKA 3LQVA 1AUDA 1SKUB 2HK2A 4HR2A 1F3VA 4KHMA 2P6SA 3Q8QB 2GAGC 3R6LB 5CCLA 2C22A 3KDNA 3V2UC 2NZ4A 1FVSA 4ATNA 3FMWA 1RWUA 1H72C 2IAJA 3AD8C 3D4JA 4I6YA 3U27A 2DR5A 2XNRA 2YWFA 4KHRA 2YNFA 3EGVA 4M63A 2JOQA 1LWCA 2CPFA 2HAIA 3VVUA 4MT1A 4J90A 4BCAA 4O4RA 2F40A 3D28A 1GFWB 2DNHA 3PTWA 3PEHA 4USJC 2Z56B 2L9DA 2W8LA 4FYVB 3C6UB 1N32J 3H98A 1N0UA 2OO4A 3PW5A 3G8TA 2MZ1A 4WFBQ 3EZOA 4B9NA 3MEGA 1HI0P 1HBNB 2QG9B 1N88A 5J2QB 1VS3A 2GJIA 4PXEA 4B02A 1HNWF 2LEAA 2YKMB 1U6FA 1UKUA 4EUVA 2ZDPA 1HFEL 2ZDOA 4U95A 2IM0A 4I69A 4DX7A 4Y0FA 2CVIA 1DURA 2CPZA 2M52A 3SXLA 3ZZPA 4HHJA 1PO6A 1GTEA 1P9YA 2AF6A 3H20A 1T0TV 2BKOA 1X4GA 2CJQA 2RUGA 3KG4A 4CTAB 3WC2A 3OTOJ 1QY7A 1SH0A 1XMQJ 4B3MF 2G9OA 4FF3A 4O3NA 2BKPA 3RAQA 2Z4PA 1U1PA 1Z4UA 1EB0A 2ALYB 2G2YA 1JLFB 3AD9C 5KFNA 4I6WA 4OJ1A 1BXNA 4CRJA 4YFUA 2CYYA 4OHVA 2FVCA 3HZGA 2BABA 1O0PA 1NPRA 4YHHJ 1FK9B 2RQKA 5I3PA 2MHEA 1RZMA 3DC2A 3DI6B 3KUEA 4Y2AA 4DL0C 5HN0A 4F8RA 2KZMA 4OI0A 2C2KB 1YJUA 3KUGA 3QIPA 3RJMB 2ZD1B 1TKZA 4PCQA 2ZM6F 4F4WA 2IM3A 1LQ9A 3EVMA 4QCLA 3O6QA 5ETMA 3I0SA 2MLYA 1VQ8S 2HZCA 4O3PA 4XK8C 1CJTB 5ETVA 3T9ZA 2HNZA 1U4BA 3AJDA 1D9FA 2NXCA 4X4TA 2NS1B 3GZ7A 4X64J 3PEJA 1RHMB 4OJ3A 1AZSB 4HYKA 1F5BA 2CNLB 5K8OA 4DV0J 2YVSA 1TFWA 1EP4A 1FD2A 2IRXA 4OZLA 1IM4A 4DUYJ 4OHYA 3V6JA 3I4PA 1TL7A 2CPYA 5IT4A 1TL1B 4OZ0A 5K8NA 1P8GA 1UA0A 3NLCA 2KG0A 4NPOA 5F0UA 3CCJS 1B64A 5KFJA 5JUMA 2J6TA 3KUHA 2P8IA 2KT2A 1SUQB 3EM1A 3KLHB 1HPZB 5HSPA 4UUWA 1RAIB 1PAEX 4DUYF 1NNDA 3RBZA 2IBKA 2BKNA 5D8HB 3FKBA 3C46A 3MUVP 2F7VA 4OYAA 1UVMA 2LEBA 3W7BA 3VF0B 4CP5A 1KLMB 3ENWA 4EEYA 5JVHQ 5E33A 4XO0A 3R97A 3K2YA 4C98A 3EGZA 2DGTA 1IKXA 2CJAA 3HJVA 4F3QA 1DQ9A 5KFWA 1KOHA 1H98A 1VFJA 2R42A 3K5PA 4YB5A 2QO3A 2U1AA 3Q22A 1I5OB 5D15A 4WCEQ 2OPPB 4IO9Q 1G1XA 4L76A 3F44A 3CNQP 5LJ3Y 3RU0A 1F2HA 1LNQA 4U7UK 1D9AA 1N32F 4LF8J 4LSLB 1SBRA 4AL6A 2HQ3A 2B6AB 3LP0B 3VAIA 2B51A 4LF2A 3MMAA 1VHIA 4NI2B 2OKQA 3DLGA 3RRHA 4TLRA 1VBZA 1VGYA 3CJ2A 2PMHA 2H48B 4EO8A 1VC5A 1FDAA 2DK2A 5DG7A 5HQMA 1R31A 2CQ3A 3OFEA 5E3CA 1FJGF 2H54B 2DBBA 1R0CB 2FHOB 3RRGA 1UVKA 1Y10A 2GZOA 4ECTA 2M70A 4M5NA 3GE9A 2OFGX 2CKWA 5CZCA 1Y7PA 1RT5A 3MEGB 3PW0A 4JI6J 4G1QB 2QV6A 1NPPA 4OZJA 1CJVB 1NXIA 2P9CA 3CDBA 1JMTA 1RP5A 2HLUA 4AMOA 1WKJA 2MSSA 2DISA 2I8EA 2W9BB 3PO5A 1FKPA 4C0OC 2B9WA 3DYAB 4J9RA 2KFNA 4HI1A 2XO6A 3GG0A 1REVB 4DPUA 2VPZB 3CJ3A 3D66A 1SPBP 4ZP9A 3GJRB 3TZWA 1S77D 1WSVA 2A2DA 4CT9A 4CLZA 4C8OA 2K1RB 3QFWA 3UWTA 3M7VA 2DHAA 1RWXB 3R8YA 3M9NB 4NLWA 2VODA 2B0GA 3M8RA 3GJQB 3HLUA 5AXKA 5FIIA 4RW4B 1Q7YT 1D09B 1PJ5A 4YHHF 5LXYA 4FF1A 4IRDA 2VFRA 1HQUA 3A4TA 2ZHBA 2NYHA 4IRKA 4DR7F 4MK7A 4X4NA 1CQMA 4B3OB 3FNNA 5M2RA 4JI1F 3ZO7A 2ZBQA 4RU2A 1TKZB 4K4TA 4V19J 3V5RA 4NLYA 4ZCIA 3BS9A 3D0IE 1EAYC 1UEVA 1T9UA 3RRKA 3I0RA 4DQSA 1P27B 1R8HA 4DR4J 2FYXA 1RKJA 3IO1A 2F8HA 3MMCA 4QYZK 3TA2A 1S76D 1SIWB 1K47A 1LXJA 3M6VA 5IQ6A 2LVWA 2RDJA 1B0TA 2DNKA 3QT5A 3GCXP 3I5AA 2IMWP 2CQ2A 3MECA 2PMZD 1HNVA 1S1WA 3NY0A 4LF1A 5JXSA 1QAIA 4M94A 5FD1A 2CPXA 3Q86A 4M8LA 1APSA 1NSAA 5A0YA 2H1YA 5A76A 1M5OC 5GADU 2KXFA 1VRQC 2LDIA 5KFPA 2JEFA 3QSIA 4JV5F 1FJ7A 3GMGA 4E2FB 3M2UA 2BJEA 3DRSB 4NOHA 4LJMA 5DDRC 4NLSA 1G2EA 1LK7A 1R8AA 2WW4A 1KR4A 2IA6A 4EI2A 1P1TA 2YH0A 2YQ3A 4LVOP 1X4DA 5DQGA 1ZM2A 2CG8A 3CIMA 4W98A 2PIIA 3LWLA 3EE3A 2M2BA 4QQBA 1U24A 3H5YA 2HFSA 3OTEA 2XZDB 1VI7A 2XSJB 4CO5A 2B9EA 3KG1A 1IKYA 3MDFA 3PR4A 3MR3A 2AEFA 1OJ4A 3ZZUA 4LMZA 1IKVB 4RX6A 3L3CA 5HMXA 1JB0C 1ICEB 4ECQA 1YBAA 4JI2J 2AEMA 5LOQA 2PN6A 3KHLA 3FVYA 2RIJA 3BYRA 5A2QY 2C2DA 3T9NA 5K14B 3T19A 4EGLA 3QMQA 1WDDA 2E7XA 4DN9A 1N6QA 1J5EJ 2V50A 3NAIA 4C3MA 1MWZA 2G0CA 3V81B 1TFYA 2FTRA 3PW4A 4K4UA 3H5SA 2DH8A 3KNGA 5KFIA 3Q8RB 2PI5A 1H6KX 2AV5A 2DR8A 1VQ5S 1Q8LA 3OXGA 2MQ8A 1IUJA 2XMAA 2HFUA 3PACA 2C3OA 4E8UA 1S0OA 3E3XA 4F02A 2MKJA 4A48A 3LTOA 5DGBA 4DL3A 2AKWB 1TQLA 2XYGB 2CQBA 3M9MB 4Q2MA 3T5KA 1UJ4A 2KJWA 4IYQA 1U1KA 5DGAA 2W8KA 1RT6B 3R2DJ 2CNKB 4G1QA 3DXSX 1L3UA 4F26A 2BRLA 4UTGA 3CT9A 3RBXA 1KQKA 1JLGA 1S9FA 5GAGU 1Q82T 3GR0A 1I94F 3HP6A 3C8YA 2XMKA 4P2SA 3CCLS 2A6OA 3PRDA 4TQSA 4ERDA 1UP1A 5K20B 2IPOB 3IBCB 4J7CA 2QYGA 2B3TB 3EX7B 3SYZA 1U1RA 5GAEI 1W2IA 1WOSA 4UZCA 4LF6J 2DXDA 4ED1A 4IR9A 4MKAA 3C14B 4OYZA 5T7LA 3TUIC 4A46A 2QZ8A 3EGWB 2LP4A 4TNOA 2X1AA 3MURP 2ZHAA 2CQDA 4ZIWA 2DH7A 1WORA 3MPDA 4A4JA 1U6ZA 2ZM6J 2RT3A 1EQMA 4WFNQ 2R7RA 2VHGA 1S72S 3EYZA 3IS9A 2IY5B 1GT8A 1IJEB 1XQIA 2IRUA 4PUOB 5I4MA 2R7VA 3CJ8A 4RUHA 3CCES 3M32B 3OXLA 3W2VB 5LJ5Y 5T14A 5C42B 2P5VA 2HHHJ 2RE1A 4DMZA 4DSFA 2GNKA 1VLOA 3TZXA 2VG6A 3IAS9 2JX2A 4GVLA 2KHCA 1X4HA 2WCXA 4X64F 3NGDA 2J9DE 2YX4A 3MF5A 4K2XA 2WVFA 5HVFA 2X1FA 3KXDA 3EDQB 4U7UD 1CULB 2V2QA 4TLQA 3S7RA 1RYRA 1M5HA 3MAHA 4H4OB 2J6SA 3ILIA 2NSBA 2LA4A 4DSIA 3PKMA 2J9CA 2BQRA 4KV8B 1Q95G 1XMOF 4PG8A 1YKWA 2KYXA 4RL1A 2J7KA 4CO3A 2RSQA 2I5JB 3P5BP 4MK8A 4XPEA 1HNZJ 2DPJA 4XTTA 3T5LA 1SC1B 2DHXA 3IG1A 1FDNA 2IYGA 3QT8A 1HBOB 4RNHA 5BR8J 5HI7A 4EBDA 3TVYA 2B8PA 1D9DA 2OJ3A 2PEHA 1C4CA 3GQCA 3JTPA 1FFSB 2KJVA 3VGSA 3HI9A 5CYJA 4DQRA 1R0AA 2W01A 3FZBA 4ZOSA 3CCVS 3BDPA 3L9ZA 5JMNA 2VFTA 2VFUA 1WEXA 4PXDA 4PRFA 2GJFA 2IVMA 1F3FA 2ZJQQ 2VBXA 2FC8A 3DU6A 3CMQA 4E0DA 1N34F 1S1XB 1RTZA 4D3HA 4MIAA 5KTQA 4FS2A 3TAQA 3D9BA 2XSJA 4X65J 5DLFA 2HQIA 5CCMA 5HBMB 1S1VA 3J7AN 4TVAB 3QIPB 4QWAA 2BA9A 2DCLA 2AJQA 5AE3A 1XR7A 2OH2A 3R9LA 2EG2A 3D3BJ 3H2UB 3IWLA 2JSXA 4UUXA 5KG1A 5KT5A 3OHAA 2AGQA 1F5AA 1QAXA 4ES1A 1SCJB 4HHUA 5KFMA 3DCAA 5HQLA 1BQNA 1S0VA 2C3MA 3E51A 3US5A 5RUBA 1S48A 2BJ7A 2I9SA 2J6UA 2CQ1A 1WELA 1VOMA 2G1HA 5ETSA 5LM7E 2R9LA 1UEUA 1KKHA 1L3SA 2FLLA 4B9SA 4IO1A 3CSKA 4J9UE 3NRBA 1WACA 1LWEA 4O4GB 3W5YA 5F9LA 4K4VA 1VYAA 3HULA 3LGHA 4ZHRB 1MG7A 4U7CA 1UZDA 2DNRA 1Q16B 1XMBA 2CADA 1RT7B 2N7YA 3U1LA 4JI8F 2JVOA 3UW1A 3IMQJ 3DHWC 3DRXA 2Y8WA 4JYAJ 1L3VA 4KO0A 2YX1A 4KTQA 1ZA2B 2BXJA 2HHPA 3IXQA 3M30A 1TKTA 2D9OA 1WHWA 3CCSS 4ZVSB 3KWMA 3UR3C 2HRYA 3DLEA 3NBPB 3MM5A 2GX8A 1M1KT 1E6YA 1V9OA 3TVZA 4GVBB 2GO8A 3TWZA 2LECA 1F1BB 2ZUGA 4OZ2A 5D4OA 4NLQA 4CLKA 2RRNA 3BSNA 2JH3A 4A8FA 2DY1A 2X3DA 4C9DA 1DRZA 5ETKA 2ADBA 4Y34A 4MJKA 2VPYB 2CXEA 1S9GA 3LW5C 4TKTA 3M8ZA 2RS8A 4M5HA 5HVGA 3CUNA 1VBKA 1WKLA 3FMBA 4OYIA 2Y9HA 4CNYA 3A1YG 4DG1B 4PXBA 3FCVA 3KLVA 1NEEA 4JV5J 4ID8A 3MM6B 2H9ZA 3BSAA 4LSLA 4BS2A 4JUZA 2KTQA 2LXIA 3IS9B 3MMAB 2E9TA 2J76E 3V6DA 4BDPA 3MCSA 3CGIA 2ZH3A 3PJ9A 2HHHF 2LU1A 4WFYA 5MLCV 3GSDA 3PKYA 3DLLQ 2WAQD 2HHSA 1X4AA 2MLZA 4JYAF 3UNGC 5G0RA 3DFEA 4M5IA 1RXOB 3HFZB 3PHTA 2HFNA 2E9RX 3LP1B 2WB4A 3PYDA 2Q6BA 1RT5B 2HSEB 4ICLB 5GADI 1IN0A 1RWKB 1B0VA 2YPZA 1T11A 5KT4A 4F7VA 5ETOA 2EFVA 1KQGB 3TYTA 3ULHA 3JSBA 2BANB 3WIUA 4EK2A 5HMYA 2MQMA 4YP3A 4LFCJ 2LYVA 1TK0A 3W61A 2W9BA 2V2VA 2JEIA 2EPIA 3O5TB 1X9SA 3A3OB 3DYAA 3M6XA 1JJ4A 2A10A 2D3UA 1HBOA 4NWBA 1QAJA 1REVA 1MSWD 1FEEA 3KMSA 2XMWA 1UFWA 4CQ1A 1QE1B 2DGVA 1RLCL 3FUYA 4JI0F 4BWJA 3W65A 1CS4B 1UCNA 2K1RA 1FRHA 2XWYA 3K8WA 3SCLE 1CJKB 4DOZA 3CJSA 3TJ9A 4DF4A 1R0AB 4RW7B 1VQ6S 2YKOA 1HL6A 1GMWD 4JV1A 1H73A 1NKBA 4RW4A 1LW0B 3MHYA 2XSFA 1KTVA 2EK1A 3CF5Q 1OY9A 3T1AA 3Q23A 3QAEA 3JAMY 4C11B 4DPWA 2ZH1A 2AWZA 3GJTB 1NJZA 2HWHA 2XTJP 2G2ZA 3PX6A 2WW8A 2R8HA 1GXUA 2J0XA 4YN3B 3LAKA 5KG2A 2P2CB 1CSJA 2BUNA 2VG5B 5KFXA 4B08A 2V4JB 3G6XA 2EI5A 3ICLA 4OI3A 4A8XA 4ELVA 2E5JA 3SSQA 5ETRA 2ZZNA 1VRTB 4FBTA 1OPZA 2DNOA 3UDVA 2KU7A
chains in the Genus database with same CATH topology
3HJVA 3IM9A 2PFFB 2C2NA 3HHDA 3TQEA 2JFKA 2G2OA 4RL1A 2QO3A 3BV8A 2VZ9A 2G2YA 3G87A 2QC3A 3PTWA 2VKZG 3H0PA 3SBMA 3K89A 5DZ7A 3EZOA 5DZ6A 2VZ8A 5CZCA 3TZWA 2G1HA 3CJ8A 2G2ZA 3RGIA 3QATA 3TZZA 3R8YA 2CUYA 5CZDA 2QJ3A 3TZYA 3IM8A 3TZXA 1NM2A 2H1YA 2JFDA 4QBUA 2HG4A 1MLAA 3HMJG 3R97A 4RR5A 2UV8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJV A;  3IM9 A;  2PFF B;  2C2N A;  3HHD A;  3TQE A;  2JFK A;  2G2O A;  4RL1 A;  2QO3 A;  3BV8 A;  2VZ9 A;  2G2Y A;  3G87 A;  2QC3 A;  3PTW A;  2VKZ G;  3H0P A;  3SBM A;  3K89 A;  5DZ7 A;  3EZO A;  5DZ6 A;  2VZ8 A;  5CZC A;  3TZW A;  2G1H A;  3CJ8 A;  2G2Z A;  3RGI A;  3QAT A;  3TZZ A;  3R8Y A;  2CUY A;  5CZD A;  2QJ3 A;  3TZY A;  3IM8 A;  3TZX A;  1NM2 A;  2H1Y A;  2JFD A;  4QBU A;  2HG4 A;  1MLA A;  3HMJ G;  3R97 A;  4RR5 A;  2UV8 G; 
#chains in the Genus database with same CATH topology
 4RO0 A;  1EX8 A;  1Q4R A;  2N82 B;  4X4P A;  2DCU B;  2OPQ A;  3WIV A;  1ZOT A;  2I38 A;  3MD1 A;  4K59 A;  1PSD A;  4K8R A;  4NAS A;  4Y6I A;  4ES2 A;  4KC5 A;  4EZ9 A;  4I6A A;  2QC3 A;  3NWG A;  4ED4 A;  2PA3 A;  3CUL A;  4KGX B;  1ZZN A;  4ED3 A;  2HQC A;  8AT1 B;  2R7T A;  3M8P B;  4P2M A;  5CHC B;  4ZHR A;  1GNK A;  4C6A A;  3MUM P;  3M2U B;  4J9O A;  4B3T J;  3UCZ P;  3DLB A;  2LMI A;  1SB6 A;  4F50 A;  3BBF A;  3FEX B;  1M0S A;  3D54 A;  1RI7 A;  2H65 B;  2WK4 A;  2IM1 A;  5B0G A;  1FXL A;  4IRC A;  2E1A A;  4P2F A;  3CD6 S;  3POT A;  3Q8V A;  1R43 A;  1RTH B;  1IKY B;  1S49 A;  2EKN A;  3MR7 A;  4KGK A;  4C48 A;  1T8E A;  1FJG J;  3VQT A;  1D3W A;  4L3K A;  3PVX A;  1IKV A;  3VGV A;  5E3Q A;  4K5R A;  5IFM A;  2PFD A;  2HHT A;  4X2B A;  3HO1 A;  1NDC A;  1NK9 A;  3M6W A;  4E98 A;  5GME A;  3SZ2 A;  1FWK A;  2NYI A;  2ZUA A;  2PSZ A;  4FDF A;  2HMI A;  3K89 A;  4N8N A;  4ECW A;  4UW2 A;  4H4K C;  1SKS A;  2QEX S;  2OPS B;  4JB8 B;  3AT1 B;  3NCR A;  2MMY A;  5C7P A;  2LKZ A;  3NGS A;  4HTJ A;  4DV1 F;  3G8S A;  3FSX A;  1N5Y B;  3BSO A;  3V6D B;  1C1B A;  3CJ5 A;  3O44 A;  4IG0 B;  5ITH A;  4LRB A;  4C8L A;  1WC1 A;  1BWV A;  5M2P A;  3HSG A;  4G1P A;  2R8K A;  1YGY A;  4DR7 J;  4KKO B;  2P9E A;  1B70 B;  3DLK A;  1JLQ B;  2ZH4 A;  1WC5 A;  2VC1 A;  5KT7 A;  2IHR 1;  2QA4 S;  3DM2 B;  1LKZ A;  4TN2 A;  3T1H J;  1T05 B;  2H5I B;  4DUT A;  2PMW A;  3BZQ A;  4ZLN A;  1HHQ A;  1HBU A;  2J9E A;  2VPW B;  4WFZ A;  3FZ2 A;  4CZC A;  1B0P A;  1HMV A;  2QGF B;  3HHD A;  2GMJ A;  3K5M A;  4KH0 B;  4F4X A;  3NL0 A;  4ALZ A;  2WVD A;  5L39 A;  5ETL A;  4DS4 A;  4OX9 F;  3JQJ A;  2DB1 A;  3Q8S B;  3Q2T C;  1FNM A;  1HNI A;  1EKR A;  2K3I A;  1QTM A;  1WWH A;  2CRL A;  4N5S A;  2DIT A;  5AE1 A;  4IH6 A;  3MAA A;  4BWM A;  1CG2 A;  1UET A;  2CVE A;  2QE5 A;  4KSE B;  5J2M B;  4JP8 A;  5HRO A;  4NCG A;  3TAN A;  3U1M A;  3H59 A;  5CZD A;  5CAA A;  2VFV A;  1FES A;  3JQK A;  2R7O A;  3OVS A;  2XYP B;  4JBC A;  5LSL A;  5KT6 A;  2ROP A;  2PA8 D;  3HVT A;  3KFW X;  3J80 Y;  3JB9 k;  2UVR A;  1VQN S;  2B4P A;  2FZK B;  4J9Q A;  2MLX A;  1UMJ A;  3CJR A;  1P6T A;  1IXK A;  2D7S A;  2V8V A;  1URR A;  1DTT A;  1LWX A;  2MGZ B;  3M32 A;  3W2V A;  1XNQ J;  2UXC J;  1TL3 B;  4IDK B;  4XDD A;  4ZA1 A;  5DQH A;  4RWX A;  4N77 A;  3Q8U A;  3SDE A;  4QYR A;  3QSY B;  3PCO B;  3CCU S;  3QFH A;  1FE4 A;  4ED2 A;  5KFS A;  4ZN1 A;  1R89 A;  2OAU A;  2V4J A;  1F6T A;  3CO9 A;  1R0B G;  1CUL A;  2H4W B;  4ITS A;  5DJB A;  3RYL A;  4J5O A;  4URS A;  4ZS6 A;  2ZWP A;  1N33 J;  2UUB F;  3NGT A;  1UEK A;  5H1S V;  4A8Y A;  4EYH B;  2EXU A;  4RBT A;  4K4Y A;  2JJ4 D;  4PWU A;  2HHW A;  4C8N A;  5L1J A;  3GTY X;  2IMO A;  2VDI A;  2FGO A;  3IG1 B;  3MM9 A;  5F8H A;  3IR6 B;  3P49 B;  1NUE A;  1WSR A;  1C0T A;  5F8J A;  2F9D A;  3CCZ A;  3M05 A;  3M8P A;  3M2R A;  3AAW B;  4QWC A;  3KLG B;  4JOU A;  3H40 A;  1FNO A;  2QSW A;  1LK5 A;  4LT6 A;  3VGT A;  1XR6 A;  2X7I A;  3IRW P;  1IWG A;  5KOX A;  1RTD B;  2GVZ A;  4LFB J;  2HS3 A;  3L95 X;  3RB0 A;  4ER8 A;  2E5H A;  3D6H B;  3VAH A;  4PWD B;  1XC9 A;  3P45 B;  2AYM A;  4EU0 A;  4I0W A;  1NHU A;  7FD1 A;  4M95 A;  3RB3 A;  2OUG A;  3HSJ A;  3C3L A;  2FUG 9;  4AXI A;  2ZJR Q;  1G4C A;  3CC4 S;  5F8N A;  1ZPW X;  1F9F A;  2AZ1 A;  2BE2 B;  2JWN A;  2JRS A;  3ZTR A;  2UVU A;  1GEH A;  1AFI A;  3G4S S;  3SCI E;  5KFD A;  2GO9 A;  1VK3 A;  3QO9 A;  4DQI A;  4AUK A;  4UOH A;  2HRT A;  3ONQ A;  4CLW A;  3BO2 A;  4QIW D;  1TAU A;  5GMD A;  3OD2 A;  3LAM A;  4QR0 A;  4RUA A;  5L1L A;  2MKH A;  1X0P A;  3NNA A;  4OFZ A;  2CZV C;  1URN A;  5DQI A;  3TAM B;  1IKW A;  4LUB A;  1V5I B;  2BQ3 A;  1YVF A;  4FNH A;  1H2T Z;  1WTB A;  3IRX B;  4WTY A;  1RSC A;  3AOA A;  4IG0 A;  5GAE U;  1JLE B;  2DIV A;  3KK2 A;  1KBR A;  1OQ3 A;  1IR0 A;  1OY6 A;  2YKN A;  1LWE B;  3GLJ A;  4FYY B;  4I7F A;  1J5O B;  3AOD A;  4KKO A;  1FO1 A;  1MN9 A;  2YQ1 A;  2JL9 A;  5EGY A;  5ETP A;  3K5L A;  1JLQ A;  3K58 A;  2BRK A;  1R8C A;  3D68 A;  4UQT A;  3V4I B;  3HVA A;  2AZ3 A;  3OFH A;  1YRX A;  1VQ9 S;  3P96 A;  1RB0 A;  1UPM B;  4U9R A;  1RA7 A;  2VJV A;  1NZ8 A;  3V6H A;  2QN6 B;  3IBW A;  2C2O B;  3M30 B;  3PW2 A;  4N56 A;  1N4L A;  1S1T B;  3SEO A;  3MCN A;  3DLE B;  3NBP A;  3DRR A;  1RBO B;  4MAK A;  3MM5 B;  1K44 A;  1C0U A;  2V0N A;  3DHX A;  4A8O A;  2KVQ E;  1F0X A;  3TAP A;  2BZ2 A;  2LQ5 A;  3KJV B;  2A1B A;  3T6B A;  1Y5L B;  1SQF A;  2ZBC A;  3A3N B;  1AW0 A;  4B3S J;  1SV5 A;  3GFY A;  3OVB A;  2MKI A;  2KZZ A;  5BR8 F;  2EFG A;  1CBK A;  2ZWO A;  1FDD A;  2F1F A;  2I1R A;  3QWU A;  1X4C A;  2ZFH A;  4PPZ A;  3W62 A;  4TU8 A;  3F56 A;  2AYE A;  3C15 B;  3KJQ B;  3V4M A;  1QAY A;  3B78 A;  3OUY A;  3BGL A;  5B0B A;  4XPC A;  4J91 A;  3MM7 B;  4G6V B;  4DU8 A;  1BHN A;  4B3S F;  4NCB A;  2IFX A;  2QMX A;  2CPE A;  3JTN A;  4O44 B;  1YJW S;  2F4V F;  2K3K A;  3IR7 B;  1TL3 A;  4IDK A;  4RW9 A;  1HW8 A;  2WTF A;  4M5D B;  3OW2 R;  3SV4 A;  1FVQ A;  1YIJ S;  1WUU A;  4G65 A;  2EG1 A;  4HI2 A;  4PG7 A;  4HEA 9;  2DGU A;  4Q44 A;  2DEJ A;  2WOM B;  1NHK L;  4HH1 A;  2R8I A;  3TQ1 A;  2E5L J;  1TUV A;  2OPR B;  4K4X A;  3T5J A;  1N52 B;  5I42 A;  4QR2 A;  2YWW A;  3BEG B;  1MMN A;  2WVB A;  2NRE A;  1AXQ A;  2GFF A;  4LVN P;  4X4U A;  1MNE A;  3MCO A;  3D2W A;  4C3K A;  3UO0 A;  2E1M C;  2RU3 A;  4N7T A;  4WII A;  5LMU F;  3WQP A;  3ILJ A;  5D6G A;  1Q81 T;  4B9M A;  1H7X A;  4WP3 A;  3M9O B;  2GGP A;  3HKZ D;  2Y3Y A;  2RKI B;  2NXU A;  2WRM A;  2FD2 A;  2B56 A;  3HT0 A;  3W9H A;  4DV2 F;  3AQP A;  5DRK A;  5IT0 A;  1AUS L;  3KLG A;  1I94 J;  1TMJ A;  3IA0 A;  2AEJ A;  2XY6 A;  4B9T A;  3T1Y F;  1Q5Y A;  4DCJ B;  3BQ2 A;  2CPD A;  3QRR A;  2M8D B;  3ZTS A;  2ZH7 A;  4IFY A;  3N6M A;  1NCL A;  3KLI B;  4PAB A;  2G0J A;  1FRI A;  2ZBR A;  2B5J A;  4CH0 S;  1NK0 A;  3SSR A;  3F41 A;  1RKI A;  1X7V A;  4B17 A;  1KNZ A;  2V5H G;  3A12 A;  3K7R A;  3KMQ A;  3IM9 A;  4WP9 A;  4WXW A;  1YLX A;  2XMT A;  3K57 A;  3RR8 A;  3ITH B;  3T6J A;  1RIS A;  1Y11 A;  1CEZ A;  3M1V A;  4LBH A;  3BJY A;  1JLC B;  2AJ1 A;  3HK2 A;  2F63 A;  1X8D A;  2FLO A;  2E9Z A;  4ZPT R;  4QU6 A;  3GWC A;  1VRT A;  4IR1 A;  2AP6 A;  2IM2 A;  2GML A;  1FF2 A;  4Z7C A;  2JVR A;  3HHL B;  2V8G A;  1G7C B;  2QL7 B;  3SMZ A;  3DDN A;  1XBW A;  3VZH A;  4YQW A;  3HVR A;  1EKS A;  3MWB A;  3M2V B;  1MU2 A;  4OZ3 A;  4DV0 F;  1TK8 A;  5KFR A;  1FRM A;  1NJY A;  1DTQ B;  1WNE A;  3GON A;  3I9V 9;  1PYT A;  2ROE A;  1UAW A;  2CJK A;  4C4W A;  1NDL A;  2GCF A;  1Q53 A;  5CXT A;  3THT A;  3G82 B;  1RBA A;  2ZHO A;  3R5G A;  3D6M B;  2QRR A;  5DDP C;  4J37 A;  1SJ1 A;  1N8R T;  3UN5 A;  4RNM A;  4LFA F;  1JKH B;  4FS1 A;  2KH9 A;  3N6L A;  4RPF A;  1VRU A;  4QIV A;  3KK3 A;  4Q8F A;  1GMW A;  1Q8I A;  2EVZ A;  5K5M A;  1ZYQ A;  3LGM A;  2IYI A;  1RTH A;  4P72 A;  4DR2 J;  3G8Q A;  4XDC A;  2D3O 1;  4LBP A;  4ZN3 A;  4ZIV A;  3LGN A;  1KLN A;  3MM8 A;  3J81 Y;  4JI4 F;  4GKK F;  2Y1J A;  1WF0 A;  2MDA A;  2DKO B;  2ZBI A;  3AY0 A;  4KGZ B;  1GX5 A;  1LEO A;  3KK1 B;  1N36 F;  1IBM J;  1P9Q C;  3R5D A;  4R5P B;  2E1C A;  2BV3 A;  2J5A A;  4ECR A;  2HKE A;  2KKH A;  1VDH A;  5CYQ A;  2A2C A;  2Z30 B;  3NS7 B;  2CJB A;  3PJX A;  4I1T A;  1U45 A;  3H4B A;  5KFB A;  2HQF A;  3C15 A;  3HT3 A;  5GVQ A;  2DTJ A;  2OPS A;  4AMM A;  3BQ0 A;  4O3S A;  2OEL A;  2WVE A;  2XBP A;  3JSY A;  4X84 A;  3TEH B;  2YWH A;  5BJR A;  4Z7Y A;  1ACM B;  5CYM B;  2V9W A;  2D1C A;  1XIQ A;  3HZE A;  3HHN B;  3HD1 A;  3PX4 A;  2UXB F;  4ZLL A;  1E6V B;  2IJN A;  4CYU B;  1BQM A;  3DLH A;  5GAG I;  3EPI A;  1EAR A;  2GHP A;  2GC8 A;  2VKZ G;  2VAS A;  2QLJ B;  4WXO A;  5B09 A;  3W5X A;  4NX9 A;  4BC7 A;  1NJI T;  2HUR A;  2APO A;  3BB5 A;  3OLA A;  2UVW A;  4DR5 F;  2GV1 A;  2NXE A;  3L7U A;  4ZPD A;  3BN7 A;  2ASY A;  2E1R A;  3NOC A;  3KLF B;  1KDN A;  1VQ7 S;  4PWW A;  6FD1 A;  1FKO A;  1EZZ B;  1LOU A;  1R7I A;  2OPR A;  2XNQ A;  4LRA A;  3A8I A;  4ZLP A;  4RNN A;  2ASL A;  4P52 A;  3D3C J;  4X62 J;  4LRE A;  3IC1 A;  3OV7 A;  1I51 B;  5U47 A;  2UUT A;  4MYU A;  2NCK L;  1JLF A;  3W63 A;  4DFP A;  2QX0 A;  1ZA1 B;  4Z2X A;  3ET6 A;  2MQQ A;  4ZVO B;  2HZA A;  3MPV A;  5DM7 Q;  2O66 A;  2LQB A;  2EC0 A;  3QLH A;  1IM6 A;  1WOO A;  4A8K A;  5H9F J;  3BQ1 A;  3K0J A;  1RTI B;  3DI6 A;  4YEA A;  3N4W A;  4Y65 A;  2GQ2 A;  3QNW B;  3M6U A;  1FWL A;  3N6N A;  4Q45 A;  2UP1 A;  1N0V C;  1U09 A;  1YBT A;  3UCG A;  3G87 A;  3O2I A;  4F2S A;  3G2X A;  3B82 A;  1PAU B;  1Y9O A;  4N41 A;  3H90 A;  2FHM A;  1YRU A;  4OV6 A;  1HWK A;  2Y0B B;  1KQF B;  2UUA J;  2R2U A;  2BW2 A;  1ZET A;  3IP0 A;  4R8U A;  4OJG A;  2L9N A;  4AD6 A;  1KD1 T;  1WHY A;  1YRT A;  4KH1 B;  5IV3 A;  2VOP A;  3P8B B;  2IA0 A;  1HQE B;  2AJ0 A;  4QJV A;  2GIQ A;  2XQC A;  1QUP A;  2HFV A;  2J7U A;  3BR8 A;  1JLC A;  1KP6 A;  2R7W A;  1X4F A;  2QFI A;  1X5S A;  3H42 A;  3Q83 A;  4TYB A;  5F0W A;  5KFT A;  3WC0 A;  5D4P A;  1WC3 A;  1AA1 B;  4AND A;  3VAM A;  4JI7 J;  1RBL A;  1U1O A;  1HYS B;  3HCX A;  1B4S A;  1NRK A;  3TX8 A;  2W9C B;  3R3T A;  4LFA J;  5HMW A;  5L1I A;  2HVI A;  2COL A;  2FQQ B;  3M2V A;  3O8W A;  3I87 A;  3CXC R;  1OPI A;  3AJ1 A;  2CQI A;  2X1G A;  1NSQ A;  3G82 A;  4DCO B;  3E01 B;  1Y3J A;  1R27 B;  1VIO A;  2X1B A;  3SQG A;  3UDL A;  1NJX A;  1H2U X;  2IC3 B;  3NG8 A;  3NP5 A;  2VA2 A;  1YK9 A;  5DG9 A;  9RUB A;  1S1U B;  4HT5 A;  5AJ3 F;  3TUZ C;  1K8A T;  4W92 B;  2VBZ A;  2C42 A;  2I0X A;  4PWD A;  3A8J A;  1N56 A;  3HJF A;  1VRU B;  4ZPV R;  1AYE A;  1CJU A;  2CPJ A;  2DXE A;  4YDX A;  1Z2L A;  2XS5 A;  2UXD J;  3AOC A;  2CIM A;  2VL1 A;  4DCP B;  2HPU A;  4DL6 A;  1VC0 A;  1S0N A;  1RHU B;  4NXN F;  4GKK J;  1RT4 A;  1HAR A;  5HL7 Q;  1U8W A;  2BE2 A;  4L6V 3;  5C5J A;  2AYB A;  1UW4 A;  4IKA A;  4DR2 F;  4ZKA A;  1WG4 A;  3QT6 A;  4LIW A;  3KLE B;  3VHQ A;  1S4F A;  3MTJ A;  4R5P A;  2FJD B;  3RR7 A;  4Q2L A;  3OT9 A;  3Q0A A;  1RJJ A;  2DY9 A;  3UQS A;  2U2F A;  3GFZ A;  3PW7 A;  1SJF A;  1CQN A;  1UPP A;  4XAK A;  2CJX B;  2PT0 A;  1VQ4 S;  4NLD A;  1QSS A;  4NXM F;  1CVJ A;  4Y3C A;  2KXH A;  2UXB J;  2CNN B;  5BYR A;  1JLE A;  1CC7 A;  4DV7 J;  1TEL A;  1VQS A;  2HND A;  2YKN B;  4CWB A;  2ZOG A;  2ROG A;  3C19 A;  4R0J A;  2QJ3 A;  1XR5 A;  3S6E A;  3BRE A;  4ZJQ A;  4AMP A;  3BPS P;  2HGM A;  4ILR A;  3RUB L;  4P75 A;  1YIT S;  2YWE A;  2QLB B;  4ED7 A;  3MR2 A;  2R7Q A;  3KLF A;  1O8B A;  3I9Z A;  2ZH9 A;  2NR0 A;  3NMA A;  3P5T L;  5HP1 B;  1QJH A;  1SI9 A;  4KHP J;  2AX1 A;  3CWJ A;  3TQE A;  2VUG A;  3K5O A;  4C8Z A;  4QPT A;  2EBG A;  2M88 A;  2QMU B;  4FBU A;  1JQG A;  4FPR A;  4AFF A;  2QFJ A;  4CIO A;  1WG5 A;  1TR0 A;  2KDO A;  2X51 A;  2WB1 D;  4KY3 A;  4QR1 A;  4ZVE A;  4RKU C;  5L8R C;  5DZ7 A;  2VA3 A;  1RAH B;  1GAO A;  4ZDN A;  1A9N B;  1RTJ B;  3LA0 A;  3GFX A;  3PIP Q;  5I3U A;  1Q5V A;  3G96 A;  2G1D A;  1FKA F;  1S9E B;  1R6Y A;  2GQQ A;  1K9M T;  3UVJ B;  1LWC B;  3QBC A;  2HBR B;  4YB7 A;  5A8W A;  5HQ8 A;  4ELU A;  4F0M A;  1LWF A;  1WEZ A;  4NLU A;  3JYT A;  2Z58 B;  4DV3 F;  4OX6 A;  3WZ0 A;  3TUJ C;  1GH8 A;  4OYB A;  4LF4 F;  2EFQ A;  1L5U A;  5KFC A;  4HDH A;  4F67 A;  1R8B A;  4BC9 A;  3I4H X;  1YI2 S;  3BR9 A;  2HG4 A;  4LQ9 A;  4KGM A;  3SI8 A;  1S6P A;  2LQ8 A;  2M3D A;  4LRF A;  4DPY A;  4F0H A;  2DPI A;  5HLF B;  1RE1 B;  5M2U A;  4ED6 A;  1VBY A;  2PFF B;  3IBF B;  4ZP8 A;  2FJB B;  2FJV A;  3CPW R;  1HI1 A;  3BV8 A;  3NXZ A;  4DSE A;  5AE2 A;  3QGI A;  5CAB A;  4X4V A;  4NYO A;  4ZP7 A;  4DL4 A;  1UW9 A;  2ZEJ A;  2FZC B;  3SCJ E;  3CCT A;  4MMO A;  2XC9 A;  1NO8 A;  4Q0B A;  1U1M A;  4ZK7 M;  1V3Z A;  4FF4 A;  1HI8 A;  2CDQ A;  2ZKU A;  2AQ4 A;  1PIL A;  3DRP B;  4N47 A;  3HM9 A;  3ILL A;  1DFD A;  3QGH A;  1Q1K A;  2B9Y A;  2HBZ B;  3MI7 X;  2MZQ A;  2XI3 A;  3ZZO A;  3BO4 A;  3NNH A;  2MKK A;  3MOJ B;  1W7W A;  5FJ4 A;  3FBC A;  2KRB A;  2DNY A;  2DT9 A;  4DDF A;  4L3N A;  5BYS A;  2N4D A;  3OPK A;  4PEO A;  4KAI A;  4DXL A;  1K1S A;  2UV8 G;  4YY3 F;  4LF4 J;  4ILL A;  3T1Y J;  2KXN B;  1XMO J;  3IWN C;  3NOG A;  3QZ7 A;  1S1U A;  1YJN S;  2DIU A;  1X5O A;  2VC0 A;  4IFY B;  3I0S B;  4X66 J;  1VC6 A;  2V69 A;  3W60 A;  1CJU B;  1CJT A;  4TY9 A;  2N3L A;  1NB7 A;  2QSF A;  3MED B;  2HNZ B;  2R2R A;  3OHB A;  2J0S D;  1FRX A;  2DNP A;  2E1P A;  1N6Q B;  4WU2 A;  4CCH A;  1FCA A;  3C6T A;  1FEH A;  1AZS A;  2ZBP A;  2I2Y A;  2V67 A;  4USV A;  2XLK A;  2MJU A;  3MPW A;  1UWA A;  4AE5 A;  1SL0 A;  4JV2 A;  4UZB A;  3OJS A;  3MR6 A;  2MQP A;  3GR1 A;  2BE9 B;  4FXD A;  4H4M A;  4NZ0 A;  5EWF A;  1N33 F;  2XGP A;  3HVW A;  3ISZ A;  1GTH A;  4QIE A;  1VQM S;  2GIF A;  4TY8 B;  2RRA A;  2W4P A;  3QYY A;  5KFE A;  5BYQ A;  2W1B A;  4YR2 A;  4MKB A;  2HIY A;  4WIQ A;  2QTW A;  4ZVP B;  2L3M A;  4LRC A;  2MQN A;  2LQ9 A;  5F3T A;  3EMT A;  3DU5 A;  3BGO P;  3G71 S;  2MKC A;  4WZM A;  4MTP A;  2MTL A;  1M5K C;  2VKR A;  4I64 A;  1T3O A;  2F8E X;  4WP8 A;  4QW9 A;  3BDE A;  1RCX B;  1KSP A;  4F3M A;  1RWV B;  1DLO A;  2F9J A;  1BUX A;  1FT8 A;  3MMB B;  3TR5 A;  1JKH A;  1LW2 B;  1FX4 A;  5AXM A;  3TO8 A;  3QAT A;  3KK3 B;  3WDO A;  3JSM B;  2VV5 A;  4FKY A;  3OR1 B;  2M7S A;  2DNG A;  3G9C A;  2JLF A;  4YB6 A;  1U2C A;  3TEG A;  4HDG A;  2KT5 A;  2C2Z B;  2DR9 A;  2FY1 A;  2MQL A;  3OR2 A;  3IGN A;  4DR3 F;  3AD7 C;  4DPX A;  2AJF E;  4MKY A;  3HHE A;  3J81 j;  2Z2L A;  3SFU A;  1NU4 A;  3DLG B;  2C2N A;  2LCW A;  3BN4 A;  4OZ1 A;  4NYP A;  4RZR A;  5A8W B;  3BKU A;  3GIJ A;  1TKD A;  5B7W A;  4JV0 A;  3J80 U;  2UUA F;  1LWF B;  3JYT B;  2BX6 A;  1BWE A;  3VAG A;  1S7H A;  1JIH A;  3LWM A;  4NML A;  1Y3K A;  5CYM A;  1M5S A;  3D1Q A;  2FHJ D;  3L09 A;  4OHX A;  3QJJ A;  3BPD A;  2OML A;  5HLF A;  3DMJ A;  1BQM B;  2DJW A;  3FEY B;  1G3O A;  4IFV B;  1CLF A;  3ZC4 A;  1T9T A;  2I5J A;  3SIP B;  1ZH5 A;  3R5B A;  2IRY A;  1FKP B;  1V6H A;  4DR6 J;  3D7S B;  2CZ9 A;  1V5V A;  4DV4 F;  2XMV A;  1T03 B;  4XIU A;  5LT5 A;  1H0H B;  1TV6 A;  4OQJ A;  4V19 X;  4PG5 A;  4X62 F;  3F73 A;  3WX8 A;  3QJP A;  4M1K A;  2G2O A;  5T41 A;  3QWP A;  2QA1 A;  1FJC A;  1WG1 A;  3PYF A;  2DO4 A;  2DR7 A;  3UN2 A;  1OSD A;  1SJ4 P;  4ES3 A;  3D6T B;  2B43 A;  2M8H A;  4PR6 A;  2KO1 A;  3OL7 A;  3BGR B;  1ZS6 A;  3OLB A;  1KN6 A;  2OLW A;  2B8Q A;  2J0W A;  2PD1 A;  3TP2 A;  5DG8 A;  1YHQ S;  4NLX A;  2Y1L B;  4WWS A;  1TKX B;  1MRO B;  2NUU G;  2V34 A;  5IM0 B;  3BO3 A;  2FVS A;  1TAQ A;  2BBE A;  4ZJO A;  2PDA A;  1HBM A;  3CED A;  2ADC A;  3D1O A;  3RZA A;  3N28 A;  1HHT P;  3CJT A;  4DR4 F;  2MEW A;  1EJ7 L;  2QA2 A;  3B54 A;  1P1L A;  4PAA A;  2AU0 A;  5FDL A;  4ZJL A;  4EMD A;  2R8G A;  4F0K A;  3W8G A;  3H25 A;  2HGN A;  4I2P B;  1HQE A;  1B99 A;  3VQS A;  2LQJ A;  4ETX A;  4TYA A;  4DFM A;  4NXM J;  2IBO A;  1O6X A;  2JC1 A;  4DPO A;  4QU7 A;  4LF5 F;  4OHW A;  1VBX A;  2DNZ A;  2OSR A;  3HKW A;  4CDI A;  2EK6 A;  3TA1 A;  5LMU J;  1RT7 A;  5DDQ C;  2BMB A;  3DOK B;  1HYS A;  2OHD A;  5KG5 A;  1IBK J;  2C3U A;  4USU A;  3SCK E;  2KYZ A;  4OHZ A;  4FVC A;  3CCM S;  3C2P A;  2BJ8 A;  1IBL F;  1FTR A;  3RW7 A;  2HFO A;  2YKQ A;  1F60 B;  3QJL A;  2L9W A;  3PYG A;  1UFL A;  3HSD A;  4L74 A;  3SV3 A;  2LXF A;  4GVB A;  4YB1 P;  5GMK a;  1PG5 B;  1X60 A;  5LXR A;  2HYI B;  4RJV A;  2EFP A;  1DLO B;  1OYD A;  2D9P A;  3MMB A;  4F3O A;  1UVN A;  3H5X A;  1V3R A;  3O1L A;  3U02 A;  5HVH A;  4WFA Q;  3JSM A;  1S9G B;  3E8O A;  5F41 A;  3PHE A;  4EWT A;  2V8D A;  1VHF A;  1DAX A;  5K14 A;  1DAR A;  3I55 S;  1HD1 A;  1YZ6 A;  2DRA A;  2FZG B;  4DBQ A;  3EXC X;  3M8Q A;  4YR3 A;  1LFP A;  1SH2 A;  1T9V A;  4DFK A;  1TZ0 A;  3PFE A;  4JI6 F;  2NUH A;  1ZTW A;  5D3G A;  2R7S A;  5H9E J;  3QGG A;  2DH9 A;  3W66 A;  1R3N A;  4WK3 A;  1X9W A;  4C7Q A;  4U8Y A;  4UOG A;  3MEK A;  1XNQ F;  1RGV A;  4H4K A;  4ID5 B;  4PYA A;  3W1Y C;  5G0R B;  3FJ2 A;  4NZ6 A;  4GC6 A;  2MXY A;  1S12 A;  2D69 A;  2RF2 A;  1U7L A;  4ANC A;  4DV4 J;  4NE9 C;  2UU9 J;  1OMS A;  2GHV C;  4EO6 A;  3CJ4 A;  3OSN A;  1NK5 A;  2CAJ A;  3OTD A;  1RT6 A;  4O0N A;  1TK5 A;  3TUP A;  1GX6 A;  2BOP A;  1MML A;  2BJ3 A;  4DV6 F;  3NGK A;  2ACY A;  5D4N A;  4GKJ J;  1Q0N A;  2ZC3 A;  1FA0 A;  4P74 A;  1FRK A;  3BSC A;  3CD7 A;  4M5M A;  2IVF B;  4ED5 A;  1T9W A;  1NZA A;  4J9V A;  4U8V A;  3QRP A;  4F4A A;  1OY8 A;  1JXE A;  2DGS A;  4WU3 A;  4MH8 A;  5E3P A;  5B0E A;  2QLF B;  2G13 A;  1BGX T;  3GV5 B;  1S0M A;  3R7B B;  4ZIT A;  4RBV A;  1T03 A;  1LV5 A;  1T94 A;  1K0V A;  2AGP A;  3DDK A;  1RAE B;  2RQ4 A;  3VCD A;  2HRU A;  5C2C A;  1Y00 A;  1S6Q A;  1X31 C;  2BOA A;  4YUD A;  2K7K A;  3OSP A;  4DZ6 A;  2OP5 A;  4UST A;  3OVA A;  1FJE B;  2HBY B;  2DVI A;  1LW0 A;  4NEY A;  5K9F A;  3LO3 A;  4ZMM A;  3JQM A;  3T1H F;  1RTJ A;  2LEP A;  3FGV A;  3BH7 B;  3BGR A;  2XLI A;  4CM0 A;  2O67 A;  3EJM A;  3TOQ A;  4C11 A;  4NRU A;  3UVJ A;  2CQC A;  5C42 A;  3I32 A;  3AB4 B;  3GYX B;  2MZT A;  2V94 A;  1HBM B;  2AD9 A;  4K50 A;  1KVI A;  1F9H A;  4EBC A;  4W4M A;  1XMQ F;  1H3D A;  5IT9 Y;  1N54 B;  4GKJ F;  2R2T A;  4OZN A;  2KB2 A;  3BH6 B;  4ZVH A;  4NA2 A;  3ZFV A;  3KYL A;  1ZM3 A;  4WFX A;  3ZTQ A;  2E5I A;  4FZV A;  2YNG B;  2CA9 A;  4KBI A;  2FIU A;  2MY8 A;  2FHK A;  3L4B C;  1K73 T;  2K2P A;  2POK A;  4P2X A;  1I6J A;  1EP4 B;  3R5A A;  2AIR B;  2LU2 A;  1EHW A;  2DNN A;  5J2P A;  4JI5 F;  1RYS A;  4DPT A;  1VJQ A;  1WHV A;  2RHS B;  3P6Y C;  1TL1 A;  5IQQ A;  4R0E A;  4DJB A;  1MLA A;  4ZVR B;  2XCP A;  4OYO A;  4L75 A;  3IWX A;  1Y4Z B;  1KVK A;  3DRP A;  3F0N A;  1FFW B;  3CME S;  1SUQ A;  2XUL A;  3KLH A;  2AYG A;  4K2J A;  2RJZ A;  3CCW A;  1FX2 A;  4RW8 B;  2Z2Y B;  5B0A A;  4X4R A;  3GIM A;  1M5P C;  2AJ2 A;  5KFA A;  1T7P A;  3UFC X;  3EGN A;  2BJ1 A;  1HW9 A;  1DJ0 A;  1Q8B A;  5IWA J;  4FYD A;  5C24 A;  7FDR A;  1GXT A;  2HIQ A;  3IFE A;  4QIF A;  3IAM 9;  1KLM A;  3THV A;  1NKC A;  5IZH A;  4HAC B;  3SFG A;  2CDR B;  1Q86 T;  2OTL S;  2XS7 A;  1K0T A;  5A8K B;  5J1P A;  1UJ6 A;  4G1I A;  3TNV A;  1OIA A;  5E3R A;  1IKX B;  1RAO A;  2WSF C;  1HNW J;  1EET B;  4IUF A;  4NEZ A;  3H2V E;  3PFO A;  3HFK A;  1YX2 A;  1KOO A;  1SJR A;  3FEZ A;  3MED A;  3UDC A;  1BQN B;  3I5B A;  3PIO Q;  2KFY A;  2EKY A;  2ZC4 A;  1KHV A;  1IJF B;  1HWI A;  1QUV A;  3TI0 A;  5L9N A;  1KS2 A;  2B6A A;  3LP0 A;  4X4Q A;  3H8Y A;  4WYW A;  4A47 A;  3MMJ A;  2AGO A;  4DV7 F;  1SJ3 P;  4DUZ F;  3ETM A;  5D3G B;  2K8G A;  4EZ6 A;  1KEK A;  4H4M B;  3ADA C;  1FXR A;  1HWJ A;  1S4E A;  1NDP A;  3PRV A;  2HZV A;  1HA1 A;  2GHW A;  2NSC A;  3DRY A;  4P71 A;  4DL2 A;  1KHW A;  1NLK L;  5HMZ A;  4NLT A;  4UF4 A;  4ZCL A;  4TU9 A;  1SL1 A;  3EZ5 A;  4BHQ A;  4YDD B;  3RGI A;  4ZLJ A;  4DUZ J;  1HMV B;  1BMQ B;  3GIR A;  2NPF A;  4OI6 A;  2XHC A;  3CJQ A;  5IOL A;  4URG A;  3R1H A;  5HJY A;  1HHS A;  5IS2 A;  1PCA A;  1E6Y B;  4DR6 F;  2G0I A;  3R6G B;  3THP A;  5F8I A;  1F9E B;  1HNI B;  2YWK A;  2M0G B;  3N79 A;  4DSJ A;  1WC0 A;  1MN7 A;  3N0V A;  2WON B;  1K1Q A;  4N76 A;  2LDY A;  1PYO B;  2BM1 A;  3D6F B;  3OR1 A;  4MFB B;  3CVK A;  1WI6 A;  4I56 A;  3TVK A;  4NCG B;  1S6Q B;  5L46 A;  2YQ0 A;  3CDE A;  2WVC A;  4YY3 J;  5CH7 B;  1YG0 A;  2EEY A;  2WBM A;  3MM6 A;  3O3L A;  4IOC Q;  5J1N A;  2PE8 A;  3VR1 A;  2GAH C;  1Y5I B;  2DHH A;  1JNZ B;  3N9U C;  2OD6 A;  1H2V Z;  1HQU B;  1ZPV A;  2GVD A;  4JI1 J;  3AJ2 A;  2YTC A;  2ASJ A;  4B3O A;  1RU1 A;  2L48 A;  4RWW A;  2LFV A;  2NQP A;  4FXW A;  2XGQ A;  4OL8 A;  4ECY A;  4K7Q A;  2CWK A;  2UXD F;  5D0G A;  1OSC A;  2B7C B;  4U67 Q;  1XWL A;  1TUW A;  4O3Q A;  3UE2 A;  1SQG A;  2ATC B;  2BR0 A;  3MMC B;  1HBN A;  2VQF J;  1J27 A;  1JXV A;  2VD3 A;  1DQ8 A;  1RT3 A;  1XNR J;  2YKM A;  1HNX J;  2Z0G A;  3EDR B;  3LP2 A;  4V1A k;  5GAH U;  2F65 A;  2HS0 A;  5HK4 A;  3ENV A;  2W7A A;  1QTN B;  2WHO A;  3M8W A;  5A0Y B;  5J2P B;  1T3N A;  4WYL A;  1YJ9 S;  2AX0 A;  2R7X A;  2RDI A;  2YNH A;  3GYG A;  1PBU A;  2BEF A;  4FP9 A;  3CDU A;  3AB2 B;  1CJK A;  1HWU A;  3DRS A;  3GB0 A;  4N8O A;  3J7Z T;  2RAQ A;  4KGV B;  1U2F A;  3BBB A;  4KIA A;  3IR5 B;  5D0E A;  4RW8 A;  4OYP A;  3RB4 A;  2R3V A;  1QSY A;  1FDB A;  1N36 J;  3Q2S C;  2RIL A;  4PQA A;  4F4Y A;  4KPY A;  1G6B A;  1X5T A;  2W2M P;  5D4L A;  2W4C A;  2CG4 A;  5JVG Q;  4CH1 A;  1MRO A;  2W7O A;  3D5M A;  2ZD1 A;  1H38 A;  3FBF A;  5A8K A;  4CLY A;  3D1H A;  1B7Y B;  4FKX A;  2CNO B;  4LBI A;  2VG5 A;  3FQL A;  3AOB A;  4P7V A;  4USI A;  3Q24 A;  3QO9 B;  2UXC F;  3HF5 A;  1BQX A;  3LOU A;  4UY8 T;  2VF3 A;  4P9S A;  5HAO A;  2RQC A;  4ZVQ B;  3K59 A;  1UTA A;  3QRQ A;  3Q89 A;  1ELO A;  3ZZR A;  2YH1 A;  3NGR A;  2V2Z A;  2KL8 A;  5J2N A;  1CPZ A;  3MTK A;  3TAM A;  4I2P A;  4KR0 B;  4DQP A;  2VQE J;  3DGP B;  3IRX A;  2NXJ A;  2B4U A;  4J9M A;  1NK8 A;  4KRW A;  1RAG B;  5DO2 A;  5GAH I;  4ELT A;  4ZCK A;  1RCO B;  1S7I A;  5IC4 B;  4UOF A;  2H5E A;  2YXL A;  4LRD A;  1W26 A;  2P9G A;  3VWS A;  3DDI A;  9ATC B;  4LSN A;  3RBD A;  2ABY A;  3PNI A;  4ED8 A;  4O23 A;  1GMV A;  3LUY A;  3ZZT A;  1TTH B;  3DKD A;  3OL9 A;  1Q78 A;  2O3D A;  3N5F A;  1L3T A;  1WF2 A;  1KC8 T;  3R1L A;  4ECS A;  5F9N A;  2B9X A;  2L08 A;  1UWB A;  2QMW A;  2C2M B;  2HQG A;  2VBW A;  4FN5 A;  3FCH A;  4RNF A;  3MGJ A;  4J9P A;  3V6K A;  1WEY A;  2AHO B;  4IH5 A;  4UT4 A;  1JLG B;  3ENQ A;  4AL5 A;  1S57 A;  1JX4 A;  1F5C A;  4DR3 J;  1MW7 A;  3GJS B;  2IJR A;  2Y1I A;  4B9V A;  3MXH P;  3KKF A;  2XG8 A;  1SH3 A;  5D0H A;  4LR7 A;  5KT2 A;  4UY8 5;  3MFH A;  1SQE A;  2ZOF A;  4FYX B;  4TU7 A;  1ZAV A;  2WSE C;  1S6O A;  2OPP A;  3H2L A;  2LA6 A;  4CT8 A;  3C14 A;  5T7L B;  5H9E K;  2FB0 A;  3OXF A;  2ZZM A;  5DM6 Q;  4NLV A;  3D67 A;  1IVZ A;  3FRZ A;  1ZM9 A;  4OMF G;  5D0R A;  1RAD B;  4CO1 A;  2BDP A;  2JZ5 A;  2J0Q D;  2W2P P;  3M8Q B;  1SC3 B;  2FY8 A;  4CI0 B;  1MWQ A;  3LAL A;  4NI2 A;  3CC2 S;  3PO4 A;  4ZPC A;  5ETN A;  4DLG A;  2MB0 B;  4UOC A;  1ULR A;  4OX9 J;  1IBM F;  2GVD B;  2O5D A;  1HNX F;  2C2R A;  3UD5 A;  1Z2Z A;  1WD6 A;  1X0F A;  4DSL A;  3L7P A;  1YJ7 A;  1KWM A;  2VG6 B;  3OFF A;  1IR1 A;  2N3O A;  3ZZ0 A;  2RF2 B;  4QPX A;  3I6P A;  1T05 A;  4QYZ J;  2E44 A;  2WOM A;  1LXN A;  1HBU B;  3ELH A;  1I3O B;  4H4O A;  4KQZ A;  4NA3 A;  4B3M J;  4PG4 A;  2UVV A;  1YDL A;  1SJQ A;  1CJV A;  1JWW A;  4LSZ B;  3ISN C;  4X4S A;  4JI5 J;  3MPY A;  2Q1L A;  3LP2 B;  4DFJ A;  2E5G A;  1NSP A;  4CH7 A;  5HO4 A;  2WSC C;  1SKR A;  1FFG B;  3Q8Y A;  2BQU A;  4ECU A;  1L3K A;  2XI2 A;  4WE1 A;  2UV8 A;  3HSZ A;  2HWT A;  3HMJ G;  2C3Y A;  3TX0 A;  2KT3 A;  1YJT A;  2W25 A;  2YNH B;  4M5J A;  1JJC B;  5AT1 B;  4JI3 F;  3MAQ A;  1RAC B;  1RK8 A;  3FRY A;  5J2M A;  1RU2 A;  1U1Q A;  1TU0 B;  4IG3 B;  4C8K A;  4P10 A;  1S97 A;  3W64 A;  2D74 B;  3MD3 A;  3VVT A;  2F4F A;  3HVT B;  4TXS A;  5E5N A;  3SBM A;  2UUB J;  2MYF A;  3GFH A;  3J7Y I;  3AXK A;  5L9X A;  3ZZZ A;  4F36 A;  2MZJ A;  1WTF A;  2SXL A;  5HBM A;  1FD8 A;  1S1V B;  2ZH8 A;  3TAR A;  2OMO A;  3UCU P;  1EQ0 A;  4IOB A;  4RUB A;  3B6B A;  3K17 A;  2YWG A;  3VAK A;  3FDS A;  3MFI A;  4F25 A;  3BGF A;  4USW A;  4C3L A;  2H51 B;  1IR2 A;  3M1V B;  1DHM A;  4YS2 A;  5CA5 A;  1GQE A;  2DXF A;  3J7Y U;  2XM3 A;  3AHP A;  1VIS A;  5LSO A;  5B08 A;  2RQM A;  3QQC D;  1TVR B;  2KG1 A;  1U47 A;  2FLP A;  2WZ1 A;  1S59 A;  2YNG A;  4ED0 A;  3MEC B;  2DHS A;  2JFK A;  1X4B A;  3DGP A;  3LPY A;  3U1N A;  2MST A;  4HT7 A;  3CJK A;  1C0T B;  1WC6 A;  5A8R B;  3UNY A;  1X9M A;  1YZ7 A;  4O4G A;  2HVH A;  1X5P A;  3EIC A;  4Y2I A;  2KRR A;  5E2Q A;  3T5H A;  4LSN B;  1UJ5 A;  3SSS A;  3EPG A;  2KM8 B;  1RT2 A;  1RTD A;  2BW7 A;  5F8M A;  1VK8 A;  1RWP B;  3GP9 A;  3H4D A;  4ZVG A;  2B4O A;  2ZZT A;  3QAU A;  4WK1 A;  1TKT B;  2GS8 A;  1S6U A;  4A8S A;  4KHP F;  2A6M A;  1BLU A;  3ZTO A;  4JI4 J;  3PJW A;  4HAC A;  3MM8 B;  3I56 S;  4B9U A;  1KQS R;  2HHV A;  2RUS A;  4DF8 A;  1U1L A;  5FLX Y;  4B3R J;  1REG X;  4DX6 A;  1EET A;  1Q7L B;  3A8K A;  1JXL A;  2HVZ A;  3RG6 A;  1HNZ F;  3MR5 A;  3D0H E;  5CYQ B;  1NDK A;  3EVO A;  4EFA C;  2XLJ A;  2RD5 C;  3HPO A;  2IDL A;  2JDJ A;  4A8W A;  2XB2 D;  5DZ6 A;  2FGC A;  1M90 T;  3OFG A;  2JNJ A;  3JXO A;  3T3F A;  4WTO B;  3WHI A;  1RWW B;  2ERR A;  2MQO A;  3CC7 S;  1VJW A;  2CQP A;  2M9K A;  5F8G A;  2RHQ B;  3MOZ A;  3HDS A;  4BBY A;  3KK2 B;  5L1K A;  2YKP A;  1AB8 A;  2IDE A;  4CLF A;  2VB6 A;  4MYT A;  5C25 B;  2VQF F;  1SL2 A;  2DGO A;  1XEZ A;  6FDR A;  4ETZ A;  2C2E A;  1N34 J;  4DL5 A;  2DYA A;  3KHR A;  1V3S A;  1OYE A;  2CQ0 A;  2V68 A;  4RNO A;  2R7U A;  4ICL A;  5LL6 d;  3FFI B;  3FSY A;  3TJ8 A;  2MKS A;  1VQY A;  1JK9 B;  2OEM A;  1VLY A;  2BAN A;  1QSL A;  3CW2 C;  1C0U B;  2C1E B;  3W9I A;  1PC4 A;  4P6Q A;  2A18 A;  3ET6 B;  4AXJ A;  2QIF A;  2UUC J;  3LF0 A;  2EBE A;  3MPU B;  4K4S A;  2MPU A;  3AQO A;  2KFZ A;  4W90 B;  1ROF A;  2XZT B;  3KHG A;  2BYC A;  1QE1 A;  1YJV A;  3W9J A;  4OJH A;  3FBE A;  2JEG A;  4WBF A;  4MFB A;  3J81 U;  4AL7 A;  2DRD A;  4OI4 A;  4RW7 A;  5KFQ A;  4NA1 A;  2HEK A;  4LQ3 A;  3TZY A;  3IM8 A;  1M1G A;  3DOM A;  3PDN A;  4HHH A;  1CC8 A;  1NHV A;  4USK A;  3CCQ S;  4DV5 J;  2UUC F;  3UD4 P;  4B9L A;  4OX7 A;  2JLE A;  5DS7 A;  5I3Q A;  3OL6 A;  2GW8 A;  3RAX A;  4K4W A;  4PUO A;  2DEI A;  2OFH X;  2I6W A;  5IWA F;  4O44 A;  2E7V A;  2HVD A;  2YX7 A;  2BJ9 A;  1RAB B;  3QID A;  2H5J B;  2QLX A;  4WF9 Q;  2VBY A;  5C2G A;  3MUT P;  8RUC A;  7AT1 B;  3P3D A;  1NKE A;  2UU9 F;  4F2R A;  2Y8Y A;  2A3J A;  2RU9 A;  3FK4 A;  4GMK A;  5E0O A;  1RHJ B;  2FJX A;  4OX8 A;  2RVJ A;  4LF8 F;  3HX9 A;  5EX0 A;  2YPY A;  1RT3 B;  4KV8 A;  3IN5 A;  5JJB A;  2GA7 A;  1N5S A;  2J9D A;  3BKT A;  3NWR A;  2OEJ A;  2OPQ B;  3IGV A;  4UQG A;  3HHL D;  1SIZ A;  5BXI A;  3DNC A;  3CJK B;  2GGP B;  5EDW A;  2J7W A;  3R7S B;  4NLG A;  1U0H A;  2RKI A;  4YME A;  1XK8 A;  2MY7 A;  2YY3 A;  2E29 A;  2RB7 A;  3E01 A;  5LMN F;  3W3S A;  1SC6 A;  8ATC B;  4DSK A;  3KOA A;  1KRP A;  3PRB A;  1RT2 B;  1NJW A;  1WF1 A;  3OTC A;  4DI6 A;  1YJR A;  4L73 A;  1A7G E;  4JI2 F;  1FNX H;  1D0E A;  2XMM A;  1C2P A;  1N5V A;  2AT1 B;  2Q3P A;  2CPI A;  3FCW A;  1S1X A;  3KDO A;  3TRG A;  1UVI A;  1U25 A;  2PC6 A;  2HK3 A;  4X65 F;  4H54 A;  3ZXW A;  3NCQ A;  1RT4 B;  2MHN A;  2KHD A;  4OV1 A;  3DOL A;  2PI4 A;  4FVM A;  4Y2M A;  1YSJ A;  1HKA A;  1JLB B;  1RWN B;  2BAC A;  4LF9 F;  3GV8 B;  4OLP A;  1RAA B;  3GU0 A;  2MZR A;  2VDH A;  2F8M A;  3L7O A;  1D8Z A;  1RAJ A;  3R5J B;  4NLR A;  4LF6 F;  2HGL A;  1W2B R;  1HD0 A;  4IOA Q;  3BM7 A;  5KFU A;  2ZVI A;  4AQY F;  2V8P A;  1WC4 A;  3HFV A;  5A6W A;  3S8S A;  4LIR A;  5CZV A;  5J2N B;  4DQQ A;  1LFW A;  4K0K J;  3HHK A;  2D41 A;  3BKF A;  4HL9 A;  2RML A;  5IC6 B;  3CDA A;  3C16 B;  1C1B B;  1UZH A;  4CLL A;  2M5Y A;  4ECV A;  3H7H B;  4JI7 F;  4DV1 J;  1ZZF A;  3KJN B;  5C25 A;  3PY8 A;  4FPI A;  2HLT A;  1XNR F;  3DLK B;  4ENO A;  4A8M P;  5J1E B;  4Y2K A;  1HIY A;  5D77 A;  5KFV A;  1D1U A;  1NME B;  3CO0 P;  1SC4 B;  3CD0 A;  3UPF A;  4KJI A;  1DQA A;  4KO0 B;  4MIW A;  1PBA A;  2ZNZ A;  3AH6 A;  4LF7 J;  3BYP A;  2DD8 S;  1UWB B;  2EC2 A;  3FFI A;  2DGX A;  3HHL C;  4K5S A;  1ZBT A;  2K06 A;  4QZV B;  4PKD B;  2MZS A;  5KFL A;  2VU5 A;  2FPH X;  1RHK B;  4OYW A;  1NH7 A;  5K8M A;  1KFD A;  3OTO F;  3VTI A;  2HAF A;  3RAM A;  3RW6 A;  3UI3 A;  5SZT A;  4WPA A;  1SKW A;  2CQH A;  4DZD A;  4FNI A;  2CFX A;  4Q7A A;  3KK1 A;  2N7C A;  1N48 A;  4JI3 J;  4WKY A;  3HD2 A;  2FJW A;  4LF7 F;  5I3U B;  3CMA S;  4Q43 A;  1AFJ A;  2F4V J;  3ISN D;  3GCW P;  2R8J A;  2XS2 A;  1Z1Z A;  5HRO B;  4K0K F;  4DV2 J;  1PYS B;  4DG1 A;  4DHV A;  2V2K A;  1ITP A;  1OS5 A;  3DOM B;  4CO0 A;  4J9L A;  2ACM A;  2EW9 A;  2B4V A;  2O01 C;  5CD4 A;  2FVP A;  3CE8 A;  3CDW A;  4Q8E A;  1FER A;  2HHQ A;  1OWX A;  1Y0H A;  2Q79 A;  1S6P B;  3W5Z A;  2IJF A;  1E6V A;  4CYU A;  1DTT B;  2MGZ A;  1UVL A;  1Q79 A;  4CO2 A;  1S5Z A;  1KON A;  1IBL J;  1RQ0 A;  5CD4 H;  2XO7 A;  1A0O B;  4DR1 J;  1IBC B;  3R2C J;  5E7O B;  1HWL A;  3NCP A;  3SDE B;  1O51 A;  4CLS A;  2VIH A;  1QM9 A;  2E7W A;  2PGC A;  3LP1 A;  5KG6 A;  1RT1 A;  3I5C A;  4EBE A;  4DR5 J;  1PJ7 A;  2XWX A;  4PPD A;  5E3A A;  2XYH B;  4KFB A;  5ADZ A;  2IIH A;  5KFH A;  3M8S A;  3K8V A;  2ILZ A;  2VG7 B;  4DX8 H;  2NLW A;  4M5G A;  2UZA A;  1RDR A;  4Y28 C;  3G6Y A;  5KG4 A;  4YR0 A;  2ALZ A;  4B3T F;  4I2Q B;  3BBC A;  4QW8 A;  2ZH2 A;  4TQR A;  1BY9 A;  2XY5 A;  4Y00 A;  2GIR A;  2MKY A;  3QLH B;  4WE1 B;  2FHJ A;  2BVZ A;  1RHQ B;  1RWO B;  4I4B A;  3GII A;  2OTJ S;  3M2R B;  4GC7 A;  1CS4 A;  5IXU A;  2CPH A;  4IG3 A;  2CJ9 A;  3QT7 A;  3I82 A;  3AA9 A;  5G4D A;  2HVE A;  2VPX B;  4LR8 A;  3VAL A;  1VCT A;  1WOP A;  2LXU A;  2P6T A;  4F4Z A;  1NK4 A;  1QVG R;  1OO0 B;  4RW6 A;  4URQ U;  4QWE A;  5HAT A;  4OI2 A;  4PG6 A;  2DNM A;  3VV2 B;  1D8Y A;  3EUN A;  4AQY J;  5DDO C;  1U02 A;  5H9F K;  2QYC A;  3W2W A;  3C6T B;  1KVJ A;  2YNI A;  3VAF A;  1N5Q A;  4A8Q A;  1T9Y A;  2GMH A;  4RU9 A;  4EYI B;  5DLG A;  1PGZ A;  3GYN A;  3GV7 B;  1UL3 A;  1FI4 A;  2CQ4 A;  1JLA A;  5ETT A;  4BLG A;  1DY3 A;  2XY7 A;  1U49 A;  1IBK F;  3DXB A;  3NKY A;  4PYD A;  4ILM A;  4KE5 A;  4C0B A;  1TVR A;  1YQH A;  2W2N P;  1GXL A;  5B0D A;  4OYM A;  2W9C A;  1IKW B;  2W4D A;  1TP7 A;  5B0F A;  3QZ8 A;  1BD6 A;  1QD1 A;  4RBU A;  3G6V A;  4AT1 B;  2FVQ A;  3C16 A;  1OQ6 A;  2ZH6 A;  5A8R A;  4ZVT B;  2XCA A;  3M4X A;  4I7F B;  3HXM A;  1J5O A;  3VZI A;  4J9S A;  1NM2 A;  1H74 A;  1J2V A;  1TL5 A;  4C0H A;  3SQG B;  5B0C A;  3V4I A;  2IC3 A;  5FLX U;  4DX5 A;  2Y0S D;  3CTR A;  2MJN A;  4P73 A;  2GJ2 A;  3ZNU A;  3FBB A;  2ZH5 A;  2ZKT A;  1HLW A;  3POT B;  3H0P A;  1DZ5 A;  3DRR B;  5LSR A;  3KG0 A;  1A6L A;  1RUS A;  4AYB D;  4NMX A;  2D3O R;  2NPI A;  2XZW A;  3OR2 B;  4AMN A;  2GQC A;  4YOE A;  1SV5 B;  4MIB A;  5A2Q U;  4J9N A;  2IAJ B;  3PXG a;  1FRJ A;  2H3E B;  2ZIT A;  1FHT A;  2EFN A;  2BM0 A;  5KG0 A;  2Z57 B;  3TZZ A;  2ZE2 A;  4ZPA A;  2QL9 B;  4HVZ A;  4NYZ A;  3OQ2 A;  3P4U B;  2XHW A;  2HMI B;  2AMC B;  3N5B A;  3I96 A;  1VQL S;  2QA4 G;  3MM7 A;  2JC0 A;  4ZCM A;  4HKQ A;  2V4R A;  1T02 A;  2NZC A;  2VFS A;  3HHL A;  4QWB A;  3FSI A;  3KHH A;  1N5Y A;  3BF4 A;  5KFZ A;  4NLP A;  2BJD A;  1M1H A;  4I67 A;  3UN3 A;  4RW9 B;  4X66 F;  4LFB F;  4DLE A;  2Y1R I;  4Y2C A;  3PV8 A;  2VJU A;  1B7F A;  5AXL A;  5EUH A;  1VQK S;  1QVF R;  3DM2 A;  4Q5V A;  3GG1 A;  4QOT A;  3T41 A;  1RT1 B;  5CZX A;  1VQP S;  2V8H A;  5KG3 A;  1S10 A;  4G3I A;  1NH8 A;  3C66 A;  4DV3 J;  2J8A A;  4GRS A;  2W2O P;  4KFB B;  4LR9 A;  5I42 B;  2HW3 A;  1ZAX A;  5A6P A;  2LLZ A;  4DU7 A;  1WDT A;  2VG7 A;  4IH7 A;  4PQU B;  5SUH A;  4Z37 A;  4JI8 J;  3PX0 A;  3B8H A;  2HBQ B;  2DGQ A;  4I2Q A;  4F4K A;  2OSQ A;  2Z2Z A;  4RUC A;  1EIY B;  1F2G A;  3Q8P B;  1MMD A;  3MAA B;  3ZZY A;  3FQK A;  1S9E A;  2F5G A;  3K5N A;  3NAH A;  3E2E A;  1R6V A;  5IM0 A;  4C97 A;  3OJU A;  2HWI A;  3WX4 A;  2KM8 C;  2ZOM A;  2VON A;  2D3Z A;  1NK7 A;  2CZ4 A;  2CWX A;  3CD5 A;  4P7T A;  2OGU A;  5KFG A;  4RW6 B;  3KLI A;  1U48 A;  1S79 A;  4GO7 X;  2HHU A;  1GK8 A;  4ZPW R;  5F3Z A;  2RS2 A;  2B5J B;  2WBR A;  2M4M A;  5FDL B;  1MWY A;  3EVW A;  1UA1 A;  2YNI B;  1AT1 B;  1C1C B;  2VOO A;  2R4F A;  5IT9 U;  4CNZ A;  2CUY A;  3ITH A;  4DEZ A;  2F3J A;  2ATL A;  2V6A A;  2L41 A;  1U6B A;  4B3R F;  4WZQ A;  2XMU A;  4R25 A;  2DNL A;  1JLA B;  1TL7 B;  3BGU A;  5IV4 A;  3ZNJ 1;  1T9X A;  1HQ2 A;  5EWG A;  4Q0B B;  3CCR S;  4M5L A;  3MEE A;  2V63 A;  2VIC A;  3S1T A;  4RR5 A;  4USM A;  5ETQ A;  2C3P A;  1O5J A;  4FF2 A;  1HPZ A;  4S0M A;  3LPE A;  4GO5 X;  5AJ3 J;  3ZTP A;  2FJE B;  3MM9 B;  1VQO S;  4IQM A;  3I31 A;  1ZAW A;  3B4M A;  3EWG A;  2O1P A;  4FXV A;  1U0H B;  2JHE A;  4JI0 J;  1IQZ A;  2HNY B;  2XEX A;  3VGU A;  2X3G A;  3AXM A;  4QIG A;  1TMM A;  4ECZ A;  3ILO A;  4ECX A;  1Q8K A;  2KN4 A;  4QWD A;  2G4B A;  1FRL A;  3NNC A;  2AJ4 A;  2GVZ B;  2QLW A;  1T95 A;  4U96 A;  4O3O A;  3H5U A;  4LFC F;  1WI8 A;  5KOW A;  1U1N A;  3ENA A;  3PYE A;  2V4Q A;  4OYX A;  3G86 A;  2DNQ A;  3NS5 A;  1B3T A;  4IQX A;  4NRT A;  1I1G A;  2JFD A;  1NBE B;  2ZJP Q;  5EN1 A;  3KJF B;  4OZ5 A;  1JNR B;  3RBE A;  1X4E A;  1FE0 A;  2A0F B;  3DOL B;  2OIH A;  1VR6 A;  5KG7 A;  1UFK A;  2V9K A;  1JLB A;  4OI1 A;  3EZU A;  4HH0 A;  4NZ7 A;  5KT3 A;  2ZE2 B;  2OD4 A;  3RB6 A;  1KFS A;  1VIX A;  4HLB A;  1XJW B;  1RAF B;  4ZP6 A;  3GIL A;  1BE4 A;  4ID5 A;  2HFZ A;  3DLJ A;  4J9K A;  4O3R A;  3KNA A;  1S99 A;  3PR5 B;  4FYW B;  4TY8 A;  4DS5 A;  2ZVS A;  3SQO P;  5EWE A;  1WHX A;  4WJB A;  3R5C A;  1NK6 A;  5AXN A;  2IVY A;  4F04 B;  3CB4 A;  3AA8 A;  4PXC A;  1PJ6 A;  3J7Z 5;  1SXL A;  1WJ9 A;  5KFO A;  2Q43 A;  4DV6 J;  1HR0 F;  3PZP A;  1FTC A;  2ILY A;  2HS4 A;  1ARO P;  4C2M A;  5J1E A;  3PM9 A;  1J5E F;  1R8P A;  2J8S A;  4QBU A;  4D3G A;  1RWM B;  3NS6 A;  1TUG B;  3B4D A;  5F8L A;  3OBI A;  1LW2 A;  1JJH A;  1FKO B;  3MZI A;  4ZVF A;  2HQD A;  2OI2 A;  4KYZ A;  1S1T A;  3OL8 A;  1XTZ A;  3GSI A;  3R27 A;  2FJA B;  4CM2 A;  2Q66 A;  2QT7 A;  1DBD A;  4HTI A;  2JEJ A;  1U26 A;  1ZM4 A;  5HJX A;  4K4Z A;  3KJV A;  1YBU A;  5KFF A;  2QL5 B;  3DN9 A;  3X3U A;  2YNF B;  1RTI A;  2VQE F;  1JJ2 R;  2OEK A;  2YKA A;  1KTQ A;  1C4A A;  5K8P A;  1IQT A;  2BE7 D;  3OUY B;  3C6U A;  4C8M A;  1M5V C;  3I0R B;  1UVJ A;  1N5T A;  4RLE A;  3VAJ A;  2Z2M A;  3U7J A;  5J2Q A;  2C28 A;  3J7A 1;  1NSK L;  3DMJ B;  4IFV A;  4OIX A;  5HAN A;  2EWH A;  4R8U B;  1BC6 A;  2RRB A;  4M5K A;  3GPA A;  4OLO A;  4M5D A;  1C1C A;  1HNV B;  1S1W B;  3D0G E;  1ZTT A;  5KFK A;  1GMU A;  4KT0 C;  3KTQ A;  3A13 A;  2E5L F;  2UUW A;  2W24 A;  3RTV A;  1IWA A;  4CTA A;  1TV6 B;  1FXD A;  3MEE B;  4KPC A;  2AW0 A;  3TJA A;  2DR6 A;  4ZPB A;  4CO4 A;  1YTY A;  3CIZ A;  5KAK A;  3AFG A;  2RNE A;  3DGV A;  1NPK A;  1RA6 A;  1YWX A;  2K7J A;  4NL5 A;  3UDE A;  4LF9 J;  2KVI A;  1PC5 A;  3NGU A;  2N4C A;  2FC9 A;  3CJ0 A;  3PG9 A;  5THW A;  4ZVU B;  2Q6C A;  3TA0 A;  3NEK A;  2W2Q P;  3W8P A;  2W9A A;  1W25 A;  3JTO A;  2DRB A;  2HNY A;  5C24 B;  1FK9 A;  4PQU A;  2XMJ A;  2DO0 A;  4NCA A;  2Z8Q A;  1TKX A;  3UR0 A;  5EX3 A;  4CLT A;  6AT1 B;  3LAN A;  4DV5 F;  3JAM U;  4X4O A;  4KB7 A;  1SVD A;  3OTB A;  4DWI A;  2VZ9 A;  5CQG A;  3MCM A;  2KI2 A;  4MKV A;  1U0S A;  3WBZ A;  2RDD A;  3JSR A;  1XN9 A;  1U2R A;  3QPI A;  2ASD A;  1NAQ A;  3W2W B;  2VZ8 A;  1TL4 A;  3QGP A;  2HHX A;  1XER A;  4PZV A;  4WKR A;  1H7W A;  3JS9 A;  2H4Y B;  3M8Y A;  4DN0 A;  3EXY A;  2R2S A;  4CLP A;  3X1L B;  2CJY B;  1U8S A;  1WKK A;  1Y5N B;  3FC9 A;  3KLE A;  3V81 A;  2JLG A;  4NLO A;  3ETO A;  3S01 A;  1PKU A;  2CQG A;  4DL7 A;  2FDN A;  2ZNY A;  4CLU A;  3UD3 P;  3A3P B;  4U6P A;  4LF5 J;  5MAO A;  1NB2 A;  3LH2 S;  2YBV A;  4L72 B;  1QDU B;  3DOK A;  4DR1 F;  1VMB A;  3A8E A;  5D78 A;  4C8Y A;  4NXN J;  1MU2 B;  1QLN A;  2VH7 A;  1DTQ A;  2RH3 A;  5L38 A;  3R7N B;  2HND B;  3TW0 A;  5KFY A;  5LMN J;  3NMR A;  2EFO A;  3N01 A;  4ANE A;  5EHH A;  2FLN A;  4O0I A;  3G6E S;  2E66 A;  1FWP A;  2NXN A;  2B7B B;  4I68 A;  4MK9 A;  2W7P A;  2FVR A;  2PEB A;  1HR0 J;  5DET A;  5HP1 A;  1RLD A;  5E41 A;  2WON A;  2PO4 A;  1PIE A;  2DHG A;  4USH A;  1RHR B;  2DGW A;  3GIK A;  3LQV A;  1AUD A;  1SKU B;  2HK2 A;  4HR2 A;  1F3V A;  4KHM A;  2P6S A;  3Q8Q B;  2GAG C;  3R6L B;  5CCL A;  2C22 A;  3KDN A;  3V2U C;  2NZ4 A;  1FVS A;  4ATN A;  3FMW A;  1RWU A;  1H72 C;  2IAJ A;  3AD8 C;  3D4J A;  4I6Y A;  3U27 A;  2DR5 A;  2XNR A;  2YWF A;  4KHR A;  2YNF A;  3EGV A;  4M63 A;  2JOQ A;  1LWC A;  2CPF A;  2HAI A;  3VVU A;  4MT1 A;  4J90 A;  4BCA A;  4O4R A;  2F40 A;  3D28 A;  1GFW B;  2DNH A;  3PTW A;  3PEH A;  4USJ C;  2Z56 B;  2L9D A;  2W8L A;  4FYV B;  3C6U B;  1N32 J;  3H98 A;  1N0U A;  2OO4 A;  3PW5 A;  3G8T A;  2MZ1 A;  4WFB Q;  3EZO A;  4B9N A;  3MEG A;  1HI0 P;  1HBN B;  2QG9 B;  1N88 A;  5J2Q B;  1VS3 A;  2GJI A;  4PXE A;  4B02 A;  1HNW F;  2LEA A;  2YKM B;  1U6F A;  1UKU A;  4EUV A;  2ZDP A;  1HFE L;  2ZDO A;  4U95 A;  2IM0 A;  4I69 A;  4DX7 A;  4Y0F A;  2CVI A;  1DUR A;  2CPZ A;  2M52 A;  3SXL A;  3ZZP A;  4HHJ A;  1PO6 A;  1GTE A;  1P9Y A;  2AF6 A;  3H20 A;  1T0T V;  2BKO A;  1X4G A;  2CJQ A;  2RUG A;  3KG4 A;  4CTA B;  3WC2 A;  3OTO J;  1QY7 A;  1SH0 A;  1XMQ J;  4B3M F;  2G9O A;  4FF3 A;  4O3N A;  2BKP A;  3RAQ A;  2Z4P A;  1U1P A;  1Z4U A;  1EB0 A;  2ALY B;  2G2Y A;  1JLF B;  3AD9 C;  5KFN A;  4I6W A;  4OJ1 A;  1BXN A;  4CRJ A;  4YFU A;  2CYY A;  4OHV A;  2FVC A;  3HZG A;  2BAB A;  1O0P A;  1NPR A;  4YHH J;  1FK9 B;  2RQK A;  5I3P A;  2MHE A;  1RZM A;  3DC2 A;  3DI6 B;  3KUE A;  4Y2A A;  4DL0 C;  5HN0 A;  4F8R A;  2KZM A;  4OI0 A;  2C2K B;  1YJU A;  3KUG A;  3QIP A;  3RJM B;  2ZD1 B;  1TKZ A;  4PCQ A;  2ZM6 F;  4F4W A;  2IM3 A;  1LQ9 A;  3EVM A;  4QCL A;  3O6Q A;  5ETM A;  3I0S A;  2MLY A;  1VQ8 S;  2HZC A;  4O3P A;  4XK8 C;  1CJT B;  5ETV A;  3T9Z A;  2HNZ A;  1U4B A;  3AJD A;  1D9F A;  2NXC A;  4X4T A;  2NS1 B;  3GZ7 A;  4X64 J;  3PEJ A;  1RHM B;  4OJ3 A;  1AZS B;  4HYK A;  1F5B A;  2CNL B;  5K8O A;  4DV0 J;  2YVS A;  1TFW A;  1EP4 A;  1FD2 A;  2IRX A;  4OZL A;  1IM4 A;  4DUY J;  4OHY A;  3V6J A;  3I4P A;  1TL7 A;  2CPY A;  5IT4 A;  1TL1 B;  4OZ0 A;  5K8N A;  1P8G A;  1UA0 A;  3NLC A;  2KG0 A;  4NPO A;  5F0U A;  3CCJ S;  1B64 A;  5KFJ A;  5JUM A;  2J6T A;  3KUH A;  2P8I A;  2KT2 A;  1SUQ B;  3EM1 A;  3KLH B;  1HPZ B;  5HSP A;  4UUW A;  1RAI B;  1PAE X;  4DUY F;  1NND A;  3RBZ A;  2IBK A;  2BKN A;  5D8H B;  3FKB A;  3C46 A;  3MUV P;  2F7V A;  4OYA A;  1UVM A;  2LEB A;  3W7B A;  3VF0 B;  4CP5 A;  1KLM B;  3ENW A;  4EEY A;  5JVH Q;  5E33 A;  4XO0 A;  3R97 A;  3K2Y A;  4C98 A;  3EGZ A;  2DGT A;  1IKX A;  2CJA A;  3HJV A;  4F3Q A;  1DQ9 A;  5KFW A;  1KOH A;  1H98 A;  1VFJ A;  2R42 A;  3K5P A;  4YB5 A;  2QO3 A;  2U1A A;  3Q22 A;  1I5O B;  5D15 A;  4WCE Q;  2OPP B;  4IO9 Q;  1G1X A;  4L76 A;  3F44 A;  3CNQ P;  5LJ3 Y;  3RU0 A;  1F2H A;  1LNQ A;  4U7U K;  1D9A A;  1N32 F;  4LF8 J;  4LSL B;  1SBR A;  4AL6 A;  2HQ3 A;  2B6A B;  3LP0 B;  3VAI A;  2B51 A;  4LF2 A;  3MMA A;  1VHI A;  4NI2 B;  2OKQ A;  3DLG A;  3RRH A;  4TLR A;  1VBZ A;  1VGY A;  3CJ2 A;  2PMH A;  2H48 B;  4EO8 A;  1VC5 A;  1FDA A;  2DK2 A;  5DG7 A;  5HQM A;  1R31 A;  2CQ3 A;  3OFE A;  5E3C A;  1FJG F;  2H54 B;  2DBB A;  1R0C B;  2FHO B;  3RRG A;  1UVK A;  1Y10 A;  2GZO A;  4ECT A;  2M70 A;  4M5N A;  3GE9 A;  2OFG X;  2CKW A;  5CZC A;  1Y7P A;  1RT5 A;  3MEG B;  3PW0 A;  4JI6 J;  4G1Q B;  2QV6 A;  1NPP A;  4OZJ A;  1CJV B;  1NXI A;  2P9C A;  3CDB A;  1JMT A;  1RP5 A;  2HLU A;  4AMO A;  1WKJ A;  2MSS A;  2DIS A;  2I8E A;  2W9B B;  3PO5 A;  1FKP A;  4C0O C;  2B9W A;  3DYA B;  4J9R A;  2KFN A;  4HI1 A;  2XO6 A;  3GG0 A;  1REV B;  4DPU A;  2VPZ B;  3CJ3 A;  3D66 A;  1SPB P;  4ZP9 A;  3GJR B;  3TZW A;  1S77 D;  1WSV A;  2A2D A;  4CT9 A;  4CLZ A;  4C8O A;  2K1R B;  3QFW A;  3UWT A;  3M7V A;  2DHA A;  1RWX B;  3R8Y A;  3M9N B;  4NLW A;  2VOD A;  2B0G A;  3M8R A;  3GJQ B;  3HLU A;  5AXK A;  5FII A;  4RW4 B;  1Q7Y T;  1D09 B;  1PJ5 A;  4YHH F;  5LXY A;  4FF1 A;  4IRD A;  2VFR A;  1HQU A;  3A4T A;  2ZHB A;  2NYH A;  4IRK A;  4DR7 F;  4MK7 A;  4X4N A;  1CQM A;  4B3O B;  3FNN A;  5M2R A;  4JI1 F;  3ZO7 A;  2ZBQ A;  4RU2 A;  1TKZ B;  4K4T A;  4V19 J;  3V5R A;  4NLY A;  4ZCI A;  3BS9 A;  3D0I E;  1EAY C;  1UEV A;  1T9U A;  3RRK A;  3I0R A;  4DQS A;  1P27 B;  1R8H A;  4DR4 J;  2FYX A;  1RKJ A;  3IO1 A;  2F8H A;  3MMC A;  4QYZ K;  3TA2 A;  1S76 D;  1SIW B;  1K47 A;  1LXJ A;  3M6V A;  5IQ6 A;  2LVW A;  2RDJ A;  1B0T A;  2DNK A;  3QT5 A;  3GCX P;  3I5A A;  2IMW P;  2CQ2 A;  3MEC A;  2PMZ D;  1HNV A;  1S1W A;  3NY0 A;  4LF1 A;  5JXS A;  1QAI A;  4M94 A;  5FD1 A;  2CPX A;  3Q86 A;  4M8L A;  1APS A;  1NSA A;  5A0Y A;  2H1Y A;  5A76 A;  1M5O C;  5GAD U;  2KXF A;  1VRQ C;  2LDI A;  5KFP A;  2JEF A;  3QSI A;  4JV5 F;  1FJ7 A;  3GMG A;  4E2F B;  3M2U A;  2BJE A;  3DRS B;  4NOH A;  4LJM A;  5DDR C;  4NLS A;  1G2E A;  1LK7 A;  1R8A A;  2WW4 A;  1KR4 A;  2IA6 A;  4EI2 A;  1P1T A;  2YH0 A;  2YQ3 A;  4LVO P;  1X4D A;  5DQG A;  1ZM2 A;  2CG8 A;  3CIM A;  4W98 A;  2PII A;  3LWL A;  3EE3 A;  2M2B A;  4QQB A;  1U24 A;  3H5Y A;  2HFS A;  3OTE A;  2XZD B;  1VI7 A;  2XSJ B;  4CO5 A;  2B9E A;  3KG1 A;  1IKY A;  3MDF A;  3PR4 A;  3MR3 A;  2AEF A;  1OJ4 A;  3ZZU A;  4LMZ A;  1IKV B;  4RX6 A;  3L3C A;  5HMX A;  1JB0 C;  1ICE B;  4ECQ A;  1YBA A;  4JI2 J;  2AEM A;  5LOQ A;  2PN6 A;  3KHL A;  3FVY A;  2RIJ A;  3BYR A;  5A2Q Y;  2C2D A;  3T9N A;  5K14 B;  3T19 A;  4EGL A;  3QMQ A;  1WDD A;  2E7X A;  4DN9 A;  1N6Q A;  1J5E J;  2V50 A;  3NAI A;  4C3M A;  1MWZ A;  2G0C A;  3V81 B;  1TFY A;  2FTR A;  3PW4 A;  4K4U A;  3H5S A;  2DH8 A;  3KNG A;  5KFI A;  3Q8R B;  2PI5 A;  1H6K X;  2AV5 A;  2DR8 A;  1VQ5 S;  1Q8L A;  3OXG A;  2MQ8 A;  1IUJ A;  2XMA A;  2HFU A;  3PAC A;  2C3O A;  4E8U A;  1S0O A;  3E3X A;  4F02 A;  2MKJ A;  4A48 A;  3LTO A;  5DGB A;  4DL3 A;  2AKW B;  1TQL A;  2XYG B;  2CQB A;  3M9M B;  4Q2M A;  3T5K A;  1UJ4 A;  2KJW A;  4IYQ A;  1U1K A;  5DGA A;  2W8K A;  1RT6 B;  3R2D J;  2CNK B;  4G1Q A;  3DXS X;  1L3U A;  4F26 A;  2BRL A;  4UTG A;  3CT9 A;  3RBX A;  1KQK A;  1JLG A;  1S9F A;  5GAG U;  1Q82 T;  3GR0 A;  1I94 F;  3HP6 A;  3C8Y A;  2XMK A;  4P2S A;  3CCL S;  2A6O A;  3PRD A;  4TQS A;  4ERD A;  1UP1 A;  5K20 B;  2IPO B;  3IBC B;  4J7C A;  2QYG A;  2B3T B;  3EX7 B;  3SYZ A;  1U1R A;  5GAE I;  1W2I A;  1WOS A;  4UZC A;  4LF6 J;  2DXD A;  4ED1 A;  4IR9 A;  4MKA A;  3C14 B;  4OYZ A;  5T7L A;  3TUI C;  4A46 A;  2QZ8 A;  3EGW B;  2LP4 A;  4TNO A;  2X1A A;  3MUR P;  2ZHA A;  2CQD A;  4ZIW A;  2DH7 A;  1WOR A;  3MPD A;  4A4J A;  1U6Z A;  2ZM6 J;  2RT3 A;  1EQM A;  4WFN Q;  2R7R A;  2VHG A;  1S72 S;  3EYZ A;  3IS9 A;  2IY5 B;  1GT8 A;  1IJE B;  1XQI A;  2IRU A;  4PUO B;  5I4M A;  2R7V A;  3CJ8 A;  4RUH A;  3CCE S;  3M32 B;  3OXL A;  3W2V B;  5LJ5 Y;  5T14 A;  5C42 B;  2P5V A;  2HHH J;  2RE1 A;  4DMZ A;  4DSF A;  2GNK A;  1VLO A;  3TZX A;  2VG6 A;  3IAS 9;  2JX2 A;  4GVL A;  2KHC A;  1X4H A;  2WCX A;  4X64 F;  3NGD A;  2J9D E;  2YX4 A;  3MF5 A;  4K2X A;  2WVF A;  5HVF A;  2X1F A;  3KXD A;  3EDQ B;  4U7U D;  1CUL B;  2V2Q A;  4TLQ A;  3S7R A;  1RYR A;  1M5H A;  3MAH A;  4H4O B;  2J6S A;  3ILI A;  2NSB A;  2LA4 A;  4DSI A;  3PKM A;  2J9C A;  2BQR A;  4KV8 B;  1Q95 G;  1XMO F;  4PG8 A;  1YKW A;  2KYX A;  4RL1 A;  2J7K A;  4CO3 A;  2RSQ A;  2I5J B;  3P5B P;  4MK8 A;  4XPE A;  1HNZ J;  2DPJ A;  4XTT A;  3T5L A;  1SC1 B;  2DHX A;  3IG1 A;  1FDN A;  2IYG A;  3QT8 A;  1HBO B;  4RNH A;  5BR8 J;  5HI7 A;  4EBD A;  3TVY A;  2B8P A;  1D9D A;  2OJ3 A;  2PEH A;  1C4C A;  3GQC A;  3JTP A;  1FFS B;  2KJV A;  3VGS A;  3HI9 A;  5CYJ A;  4DQR A;  1R0A A;  2W01 A;  3FZB A;  4ZOS A;  3CCV S;  3BDP A;  3L9Z A;  5JMN A;  2VFT A;  2VFU A;  1WEX A;  4PXD A;  4PRF A;  2GJF A;  2IVM A;  1F3F A;  2ZJQ Q;  2VBX A;  2FC8 A;  3DU6 A;  3CMQ A;  4E0D A;  1N34 F;  1S1X B;  1RTZ A;  4D3H A;  4MIA A;  5KTQ A;  4FS2 A;  3TAQ A;  3D9B A;  2XSJ A;  4X65 J;  5DLF A;  2HQI A;  5CCM A;  5HBM B;  1S1V A;  3J7A N;  4TVA B;  3QIP B;  4QWA A;  2BA9 A;  2DCL A;  2AJQ A;  5AE3 A;  1XR7 A;  2OH2 A;  3R9L A;  2EG2 A;  3D3B J;  3H2U B;  3IWL A;  2JSX A;  4UUX A;  5KG1 A;  5KT5 A;  3OHA A;  2AGQ A;  1F5A A;  1QAX A;  4ES1 A;  1SCJ B;  4HHU A;  5KFM A;  3DCA A;  5HQL A;  1BQN A;  1S0V A;  2C3M A;  3E51 A;  3US5 A;  5RUB A;  1S48 A;  2BJ7 A;  2I9S A;  2J6U A;  2CQ1 A;  1WEL A;  1VOM A;  2G1H A;  5ETS A;  5LM7 E;  2R9L A;  1UEU A;  1KKH A;  1L3S A;  2FLL A;  4B9S A;  4IO1 A;  3CSK A;  4J9U E;  3NRB A;  1WAC A;  1LWE A;  4O4G B;  3W5Y A;  5F9L A;  4K4V A;  1VYA A;  3HUL A;  3LGH A;  4ZHR B;  1MG7 A;  4U7C A;  1UZD A;  2DNR A;  1Q16 B;  1XMB A;  2CAD A;  1RT7 B;  2N7Y A;  3U1L A;  4JI8 F;  2JVO A;  3UW1 A;  3IMQ J;  3DHW C;  3DRX A;  2Y8W A;  4JYA J;  1L3V A;  4KO0 A;  2YX1 A;  4KTQ A;  1ZA2 B;  2BXJ A;  2HHP A;  3IXQ A;  3M30 A;  1TKT A;  2D9O A;  1WHW A;  3CCS S;  4ZVS B;  3KWM A;  3UR3 C;  2HRY A;  3DLE A;  3NBP B;  3MM5 A;  2GX8 A;  1M1K T;  1E6Y A;  1V9O A;  3TVZ A;  4GVB B;  2GO8 A;  3TWZ A;  2LEC A;  1F1B B;  2ZUG A;  4OZ2 A;  5D4O A;  4NLQ A;  4CLK A;  2RRN A;  3BSN A;  2JH3 A;  4A8F A;  2DY1 A;  2X3D A;  4C9D A;  1DRZ A;  5ETK A;  2ADB A;  4Y34 A;  4MJK A;  2VPY B;  2CXE A;  1S9G A;  3LW5 C;  4TKT A;  3M8Z A;  2RS8 A;  4M5H A;  5HVG A;  3CUN A;  1VBK A;  1WKL A;  3FMB A;  4OYI A;  2Y9H A;  4CNY A;  3A1Y G;  4DG1 B;  4PXB A;  3FCV A;  3KLV A;  1NEE A;  4JV5 J;  4ID8 A;  3MM6 B;  2H9Z A;  3BSA A;  4LSL A;  4BS2 A;  4JUZ A;  2KTQ A;  2LXI A;  3IS9 B;  3MMA B;  2E9T A;  2J76 E;  3V6D A;  4BDP A;  3MCS A;  3CGI A;  2ZH3 A;  3PJ9 A;  2HHH F;  2LU1 A;  4WFY A;  5MLC V;  3GSD A;  3PKY A;  3DLL Q;  2WAQ D;  2HHS A;  1X4A A;  2MLZ A;  4JYA F;  3UNG C;  5G0R A;  3DFE A;  4M5I A;  1RXO B;  3HFZ B;  3PHT A;  2HFN A;  2E9R X;  3LP1 B;  2WB4 A;  3PYD A;  2Q6B A;  1RT5 B;  2HSE B;  4ICL B;  5GAD I;  1IN0 A;  1RWK B;  1B0V A;  2YPZ A;  1T11 A;  5KT4 A;  4F7V A;  5ETO A;  2EFV A;  1KQG B;  3TYT A;  3ULH A;  3JSB A;  2BAN B;  3WIU A;  4EK2 A;  5HMY A;  2MQM A;  4YP3 A;  4LFC J;  2LYV A;  1TK0 A;  3W61 A;  2W9B A;  2V2V A;  2JEI A;  2EPI A;  3O5T B;  1X9S A;  3A3O B;  3DYA A;  3M6X A;  1JJ4 A;  2A10 A;  2D3U A;  1HBO A;  4NWB A;  1QAJ A;  1REV A;  1MSW D;  1FEE A;  3KMS A;  2XMW A;  1UFW A;  4CQ1 A;  1QE1 B;  2DGV A;  1RLC L;  3FUY A;  4JI0 F;  4BWJ A;  3W65 A;  1CS4 B;  1UCN A;  2K1R A;  1FRH A;  2XWY A;  3K8W A;  3SCL E;  1CJK B;  4DOZ A;  3CJS A;  3TJ9 A;  4DF4 A;  1R0A B;  4RW7 B;  1VQ6 S;  2YKO A;  1HL6 A;  1GMW D;  4JV1 A;  1H73 A;  1NKB A;  4RW4 A;  1LW0 B;  3MHY A;  2XSF A;  1KTV A;  2EK1 A;  3CF5 Q;  1OY9 A;  3T1A A;  3Q23 A;  3QAE A;  3JAM Y;  4C11 B;  4DPW A;  2ZH1 A;  2AWZ A;  3GJT B;  1NJZ A;  2HWH A;  2XTJ P;  2G2Z A;  3PX6 A;  2WW8 A;  2R8H A;  1GXU A;  2J0X A;  4YN3 B;  3LAK A;  5KG2 A;  2P2C B;  1CSJ A;  2BUN A;  2VG5 B;  5KFX A;  4B08 A;  2V4J B;  3G6X A;  2EI5 A;  3ICL A;  4OI3 A;  4A8X A;  4ELV A;  2E5J A;  3SSQ A;  5ETR A;  2ZZN A;  1VRT B;  4FBT A;  1OPZ A;  2DNO A;  3UDV A;  2KU7 A; 
#chains in the Genus database with same CATH homology
 3HJV A;  3IM9 A;  2PFF B;  2C2N A;  3HHD A;  3TQE A;  2JFK A;  2G2O A;  4RL1 A;  2QO3 A;  3BV8 A;  2VZ9 A;  2G2Y A;  3G87 A;  2QC3 A;  3PTW A;  2VKZ G;  3H0P A;  3SBM A;  3K89 A;  5DZ7 A;  3EZO A;  5DZ6 A;  2VZ8 A;  5CZC A;  3TZW A;  2G1H A;  3CJ8 A;  2G2Z A;  3RGI A;  3QAT A;  3TZZ A;  3R8Y A;  2CUY A;  5CZD A;  2QJ3 A;  3TZY A;  3IM8 A;  3TZX A;  1NM2 A;  2H1Y A;  2JFD A;  4QBU A;  2HG4 A;  1MLA A;  3HMJ G;  3R97 A;  4RR5 A;  2UV8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...