3SBMA

Trans-acting transferase from disorazole synthase in complex with acetate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
MKAYMFPGQGSQAKGMGRALFDAFPALTARADGVLGYSIRALCQDDPDQRLSQTQFTQPALYVVNALSYLKRREEEAPPDFLAGHSLGEFSALFAAGVFDFETGLALVKKRGELMGDARGGGMAAVIGLDEERVRELLDQNGATAVDIANLNSPSQVVISGAKDEIARLQVPFEAAGAKKYTVLRVSAAFHSRFMRPAMVEFGRFLEGYDFAPPKIPVISNVTARPCKADGIRAALSEQIASPVRWCESIRYLMGRGVEEFVECGHGIVLTGLYAQIRRDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DisD protein
publication title Structure and Mechanism of the trans-Acting Acyltransferase from the Disorazole Synthase.
pubmed doi rcsb
source organism Sorangium cellulosum
molecule tags Transferase
total genus 106
structure length 281
sequence length 281
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2011-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3sbmA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3sbmA01
3IM8A 2UV8G 2JFDA 1NM2A 3HHDA 5DZ7A 2VZ9A 3TQEA 2QO3A 2PFFB 3TZYA 3PTWA 2HG4A 3R8YA 3QATA 3TZWA 5CZDA 4RR5A 3HMJG 2QC3A 2QJ3A 2C2NA 2VKZG 2H1YA 3TZXA 3SBMA 5CZCA 3H0PA 3CJ8A 3G87A 1MLAA 4RL1A 2VZ8A 2G1HA 2G2ZA 2G2YA 3EZOA 3TZZA 3HJVA 3K89A 2G2OA 3IM9A 3R97A 2CUYA 5DZ6A 3BV8A 4QBUA 2JFKA 3RGIA
chains in the Genus database with same CATH superfamily
3DLGB 1HNXF 2ZEJA 3PRVA 2C3PA 4LFCJ 4FS2A 1VHFA 2N7CA 2AYMA 3EUNA 5CZDA 1VQPS 4BDPA 2W01A 1M5PC 4DV2J 3TYTA 1KS2A 2FPHX 4ZCLA 4DL4A 1T8EA 2FLLA 4RW7A 2I5JB 5HMXA 1MWQA 2LU2A 4PQUA 1QD1A 1UCNA 3M4XA 4Z7YA 1APSA 2NZCA 1WF0A 1MU2B 4ZVQB 1H0HB 3KDOA 1NDKA 1T7PA 2DK2A 3SIPB 3QZ8A 4V19J 5C24B 2APOA 3GJQB 5JXSA 2LFVA 2CQCA 3R1LA 2RAQA 4JBCA 2XNQA 3D6HB 4XAKA 1X60A 3BGOP 1U1QA 4Y3CA 1X4AA 3I4PA 1TTHB 3VAIA 2OPSA 2IBOA 4KHPF 2DXFA 5KFDA 1W2IA 3HSGA 2R8HA 2MKYA 1RWMB 2W2QP 3OVSA 1TL4A 4B3TF 1RT4B 3T6BA 2HVIA 2DIUA 3TUIC 4C8OA 4FNIA 1GX6A 4RNHA 5ETTA 2ZH4A 1HBOA 2CQ0A 4X66F 9RUBA 1U1PA 4HTJA 5KG5A 2YVSA 1LWFA 4USHA 1VC5A 2MSTA 1HNZF 3MFIA 3DOLA 3IS9A 5K8MA 1E6YA 1J5EJ 2Q6CA 5HI7A 2E5HA 2QLBB 3A1YG 4RW7B 1XMQF 4G65A 4PQUB 1UZHA 4PXBA 2DHXA 1N6QA 3N0VA 5IXUA 3GR1A 1M90T 3DU6A 1HNIA 1K73T 5KT2A 3AY0A 3ZZRA 2DH7A 1OYEA 4HI1A 3GIIA 1D9AA 3IWLA 1MWYA 1NCLA 2ZH6A 2YBVA 1H98A 5CQGA 3UNGC 2OPSB 1FKOA 3HSDA 2XLIA 4F4YA 2V6AA 3CJ8A 1Y9OA 4EZ9A 1YDLA 3I31A 1L3KA 1MN7A 2V34A 4A8XA 3ZZ0A 1NNDA 1T0TV 2QO3A 5HP1B 2KB2A 3SFUA 5J2NA 1HBOB 2X3GA 1SI9A 5AJ3F 2G1DA 1K1SA 4PQAA 4Q45A 1KR4A 1V5IB 4M5MA 4O0NA 3DOLB 3IS9B 1UEVA 4ZOSA 3LTOA 2JEJA 1SUQA 3OTEA 1SL0A 2JLEA 2OUGA 2KFNA 4EO6A 2GFFA 4BCAA 3EXCX 1VC0A 2CQHA 4CLWA 4ZMMA 1N6QB 1FKAF 3QWPA 2LQBA 5L9NA 1SKWA 1I51B 2R9LA 1HNIB 1WSVA 4KH0B 4NLOA 3OFEA 2FHJD 3D0IE 2HHQA 3QLHA 4DU8A 2MZTA 4OX8A 2ZH5A 3P8BB 3T1AA 3NGRA 1FKOB 1RHQB 1DZ5A 1NUEA 4CLLA 3GZ7A 2NREA 1BXNA 2J9EA 3PM9A 2JFKA 1QSYA 3GFXA 1YRTA 3IBWA 4LSLB 3PJXA 2N4CA 4O4GA 1F9FA 5J2NB 4FZVA 1CC8A 3PDNA 4J9RA 3B4DA 2BRLA 1BWVA 1UEKA 1SUQB 1V5VA 4FNHA 1RI7A 3OXFA 4AQYF 3C6TA 2V9WA 2E5JA 2BYCA 3GYNA 3D1QA 1HBMA 2O1PA 5LSOA 3FFIA 2F1FA 4USJC 2RUSA 5F8MA 3KLHA 2KFYA 2LA6A 5G0RB 2HVHA 3P6YC 3RBEA 2H9ZA 2BM1A 2ZH8A 1VQ6S 1VIOA 2ZZMA 2LLZA 3MDFA 2LU1A 3RBXA 2J0WA 3D1HA 2Y9HA 4OJHA 1YJWS 4N5SA 4RU9A 5KFJA 2CPXA 1SBRA 3RRKA 2NZ4A 1XK8A 2KI2A 2XY5A 3QGIA 1GXUA 4IH6A 4O4GB 1CJUA 4PG4A 1JXLA 1PYSB 4C8LA 3Q23A 3ZXWA 3WX8A 2UVRA 4Y2CA 5KFHA 4N41A 2OTJS 3THVA 4W4MA 3HULA 2MQPA 3BF4A 2HWHA 1UVLA 5ETLA 1RYSA 2G4BA 2AX0A 3CJ4A 2OP5A 3HI9A 1LFPA 2RDDA 2C22A 2HVDA 3NS6A 2IJRA 1Y5NB 3GJSB 1ZA2B 2V68A 2UUBJ 1HBMB 2YXLA 1RADB 3W5ZA 2DPIA 1LW2B 4H54A 4ZVOB 2V2KA 3KLHB 2QX0A 2OELA 1S72S 2YNHA 2HURA 3CMAS 3LAMA 1WEYA 1RT5A 4O0IA 2IVMA 5B0CA 2HG4A 3MMCA 4FYXB 4ED3A 4ZVGA 1TVRA 5KG2A 3MF5A 4CO4A 1OY9A 3NBPA 1SQEA 5LJ3Y 1CJUB 1XR5A 2MKJA 1GK8A 3T1HF 4HEA9 1KWMA 3RW7A 1RWOB 4CP5A 2BM0A 3H5XA 2VBZA 1B0VA 2WZ1A 1TV6A 4CLFA 2ZITA 1BUXA 2VDHA 2VH7A 5HJYA 1HARA 1J2VA 4TYAA 3W2WA 4LSNA 3UR0A 2HQ3A 3ISZA 2GGPA 4WKRA 3J81U 4LVOP 4FVMA 1NPRA 2JZ5A 2RKIA 1NRKA 3RBDA 3KDNA 5LT5A 1VMBA 1JLBA 2AF6A 3TZWA 1EKSA 4OHZA 2VD3A 2XMAA 1L5UA 1LK7A 3G86A 4F3OA 5KTQA 2AJ0A 4JV5J 3T5JA 2AIRB 1K9MT 1RT5B 3JSMA 1AUDA 4ZDNA 2Y8WA 3MMCB 3MD1A 4AMNA 1TVRB 1ZAVA 2HZCA 1OSDA 2GNKA 2X51A 2Z56B 4LIWA 2M3DA 3G96A 3NBPB 3V5RA 3LWLA 1NB2A 2W25A 3DN9A 4C3LA 2MZQA 3W62A 2XNRA 1DQ9A 1Q86T 3B4MA 1D9FA 1RAOA 2UXDF 4NYZA 4DPTA 4A8WA 4J9OA 2HVEA 4WF9Q 3TWZA 5DGBA 2UVVA 3W2WB 2UVUA 4LSNB 2F4VJ 2GGPB 1RWKB 3NY0A 4L75A 4KPCA 3DDNA 4ZLLA 4I0WA 2EI5A 3BV8A 1SQFA 4JI0J 4DV0J 2WCXA 1JLBB 2B0GA 2J8AA 1N52B 5LMUF 1FI4A 1I5OB 1ZH5A 1KNZA 1H7WA 4QU7A 2C2NA 4CLSA 3V6DA 1GTHA 3OTBA 2VJUA 2MQOA 2H5IB 3UDVA 1CULA 3VV2B 4EUVA 2RD5C 5B0BA 2ZJPQ 2NSCA 1D9DA 2YNIA 1SJQA 5KFFA 1T9YA 5K8OA 2RQKA 1WD6A 2CXEA 3SCKE 1OO0B 4L6V3 2MKIA 2VQFF 1BWEA 4C11B 4NXMF 5D0RA 4LR7A 1S0OA 4LUBA 3HFVA 1IWAA 1KVKA 4URQU 2HPUA 4TLRA 1NDCA 3CC4S 2V69A 5DQGA 4EYHB 1C1CA 3DMJB 4EWTA 3NNCA 2MGZA 4J9PA 2WW4A 3HVRA 1JLGB 4AL6A 1TUVA 3KHHA 3R5CA 3HVWA 4LSZB 2MJUA 3V6DB 1IBMF 2JEGA 1CQNA 2HNYA 3S6EA 2A6MA 1OMSA 4DQQA 1CULB 3NEKA 2JSXA 2XLKA 4RO0A 4V19X 5DDQC 2LQ5A 2Y0BB 3JTNA 2YNIB 1S77D 2GO8A 2MQLA 3QRPA 2JEIA 2PMWA 1B7YB 1UP1A 2I8EA 2DGUA 4YP3A 1VYAA 4MKAA 1PKUA 1FWLA 3QGHA 1Y11A 1XBWA 1JJHA 5D4LA 4RUCA 1WOOA 2OMOA 2F8MA 2JWNA 1RAEB 2K2PA 2MZJA 2IM2A 2B9XA 5CZVA 3H8YA 1UFKA 2FHMA 2D3UA 4P75A 1TMJA 4F2RA 2XZDB 2NYHA 5DQIA 1IBLJ 4LFCF 4ZPWR 2V50A 3L7OA 3QT8A 1NO8A 2EC0A 1S97A 4ITSA 4CM2A 3OVBA 1HBNA 4MIWA 5KFMA 2UXBJ 2HNYB 2AQ4A 1TKZA 5FD1A 1F2GA 1RCXB 4DX7A 3I82A 2V4JB 4PG6A 2MQQA 1HWKA 2MY8A 4C4WA 3UD3P 3TARA 1Y5IB 2ZJQQ 3BSNA 3BEGB 2HW3A 1IKWA 2VPZB 2Z58B 3MECA 2JLFA 3DC2A 1IXKA 2N3LA 1U1KA 4RUHA 3BSOA 2X1AA 1U49A 4HH0A 4FPIA 5LXRA 2GAHC 3NP5A 4DV7F 4MMOA 4P7VA 3IRWP 4IFYA 4EYIB 2Y1RI 3UN3A 1GAOA 2V8PA 4NLSA 2MXYA 4U96A 4RNFA 2HHXA 2ZBCA 3H7HB 4OHYA 4P74A 1D8ZA 3HT0A 4DFKA 1NJIT 3THPA 3MCNA 3FBFA 3A3OB 3BH6B 3MFHA 1AT1B 4FKXA 5MLCV 4DSKA 2HBRB 2DRDA 4JI4F 3C15A 4QZVB 1U25A 1T3NA 1FRMA 5DG8A 1NK0A 1HBNB 4LRCA 2NS1B 3QAUA 5F8LA 1TKZB 3FVYA 3NGSA 4H4KA 1HYSA 3C14A 4KE5A 1IN0A 4CM0A 1Q5YA 2MZ1A 3TAPA 5CCLA 2JDJA 1Q7LB 4B9VA 1IKWB 4ZLNA 2ROEA 1HIYA 1RBAA 3I9V9 2IY5B 5D4PA 4I67A 3MECB 1D3WA 2AD9A 3JS9A 4KR0B 2EK6A 2LEBA 1FK9A 3KK3B 2CKWA 2KYXA 5KOWA 2XBPA 4PCQA 2HZAA 3QYYA 1AYEA 1HW9A 5F8JA 2CJ9A 1YGYA 4ED7A 3PW2A 2H4YB 2DISA 4A4JA 2WVBA 4IFYB 4KGMA 2LEAA 1ITPA 3BO4A 2NPFA 4USTA 2OHDA 2XB2D 2VBYA 2MQ8A 5C2GA 3M32A 2F3JA 1BC6A 2JHEA 2CPZA 3CCUS 2EXUA 4P7TA 3I5BA 2B7CB 3TEGA 3CJKA 4DPUA 1S9EA 3H98A 2GCFA 2LECA 4AD6A 4YB7A 1IWGA 2ACMA 3C15B 2OFHX 3NOGA 1JLQB 4XK8C 2XMKA 2ATCB 5HBMA 2YPYA 1B64A 3D1OA 5E5NA 4YEAA 1HYSB 3C14B 4BHQA 2RE1A 4ZS6A 2QA4G 4ILRA 3W64A 3GILA 3LP2A 4U67Q 2NCKL 1FK9B 1XTZA 3TVZA 3OJSA 3UCUP 4ZHRA 4DR2J 4DV4J 3CVKA 4LRFA 4K4XA 1VI7A 2DGWA 3H20A 4RBVA 3ZFVA 4QWDA 1SL1A 3M6WA 1FRHA 2FVSA 3W9JA 3K8VA 5E41A 3C46A 2CJKA 3MM8A 2ZHOA 3M32B 5D0EA 2CRLA 4IH7A 1X5SA 4Q0BA 3K58A 1PIEA 3CJKB 1FTCA 1S9EB 1LQ9A 5HO4A 1G1XA 3SQGB 2O5DA 2P2CB 1YJRA 4OHXA 4DPOA 5F0WA 5CAAA 3HKWA 3R8YA 1TQLA 5HBMB 1C4AA 2YKQA 2W7PA 3PIOQ 1TK0A 2KTQA 3B78A 2WOMA 5J1PA 2BJ1A 2AZ1A 2ASDA 4USVA 1U47A 5CYJA 2JC0A 3LP2B 3JB9k 1DHMA 5ITHA 4L76A 3LPEA 3EXYA 2OEJA 4ZHRB 2GIRA 5K9FA 5E33A 2MZRA 2HK2A 3A8IA 3KOAA 2RHSB 4PABA 5KFXA 4OYWA 3L7UA 2QG9B 2E7VA 3NWGA 1FXDA 1IKVA 4F0MA 1N32F 5I4MA 3G8TA 3PW5A 2B9YA 3A3NB 3J7A1 5GAGI 4EU0A 4A8FA 3MM8B 2FZGB 4DR1F 3FBBA 2BW2A 2JRSA 4NLVA 4TU9A 2CNNB 5D78A 2HFZA 3UCGA 1UL3A 4BLGA 5F9NA 4RZRA 3VAGA 5CXTA 2BJ3A 4Q0BB 1AROP 4I7FA 4HHHA 3M8WA 3D66A 2VU5A 2D3O1 1UVJA 4ECVA 4F02A 4MKYA 2PFDA 1X5PA 2N82B 2DITA 3HHKA 4ZPBA 3KG1A 2XMUA 3UDEA 1C1BA 4BC7A 2FHKA 3MMJA 2MKCA 3CCMS 4K4VA 3NCRA 4Z37A 1SC3B 4O4RA 1WF2A 3NWRA 5DZ7A 1IR1A 4CH7A 1YJTA 2F9DA 4DSIA 1PBUA 5GAGU 3EDQB 3RZAA 5T41A 2ATLA 1N5TA 3MURP 4RBTA 3QIDA 1NJXA 2PA3A 3RU0A 5J2QA 2GW8A 4WJBA 1IKVB 3E3XA 1VQOS 2R4FA 2V4RA 1XMBA 3PRBA 5CA5A 4JI1F 2C2RA 3BKUA 2CQ1A 3R5JB 3NS5A 4YDDB 5D4NA 3D67A 2DGTA 3RJMB 3CJ5A 1ZM2A 2P9EA 4TY8A 1GNKA 1FFSB 5KFPA 2XYHB 2L08A 2BOAA 4L3NA 2AX1A 4I7FB 5KFCA 3U7JA 3HMJG 3ZTOA 3Q2TC 1RLDA 4LF9J 4RKUC 3TX0A 2AJQA 4Y65A 1C1BB 2J76E 2A2DA 3O44A 4ER8A 3TA1A 3DLJA 5M2PA 2VB6A 2DNMA 1R0AA 4B08A 4KIAA 3GSIA 1GTEA 5DETA 4K0KJ 4OL8A 3PFEA 3R9LA 3AD8C 3R3TA 2EFVA 4MFBA 3WX4A 2VJVA 1ICEB 3N79A 5J2QB 3AA9A 4OX7A 5F8GA 2Z57B 5FDLA 3I87A 1WOSA 4AXIA 1RHJB 4JB8B 4I4BA 2XZWA 2K7JA 2OH2A 2GX8A 3PHEA 5AXKA 3HO1A 3IBFB 4TY8B 3D5MA 4TN2A 1YSJA 2M4MA 5AXMA 2AV5A 2K3KA 2FJAB 3ELHA 1TK8A 2FYXA 1WHVA 2MEWA 2J9CA 3PXGa 1FX4A 3OFHA 4X4VA 2HIQA 1OJ4A 2I6WA 2EPIA 2E5LJ 1N8RT 3TAMA 5CH7B 4DUZJ 2ZDPA 4H4KC 1R0AB 4DV6J 5HJXA 3GIMA 1KHWA 1R0BG 4K5SA 2VFSA 1WDDA 1YBUA 4KPYA 3KTQA 2DIVA 2QEXS 2KXFA 3M9NB 2CNLB 3O8WA 1REVA 1WG4A 3B6BA 4F4ZA 3GQCA 2HBQB 3R2DJ 1JKHB 5FDLB 3D0HE 1X9WA 4PKDB 2ZC3A 2W2OP 3GIKA 2XMVA 2RS2A 3EGVA 1GFWB 4DR4J 1DFDA 2EC2A 3OBIA 2GHPA 1JJCB 3AJDA 2YWFA 5HVGA 2AJFE 3L4BC 3QGGA 1HD0A 4CLYA 3UE2A 2E7XA 2KHDA 1VCTA 4WTOB 3QFHA 2E7WA 2IRYA 2R7OA 4F67A 4L73A 4WFNQ 2IRUA 4MYUA 3I4HX 3HX9A 5KT3A 4PXDA 5HAOA 2B4OA 4RX6A 4JI5J 2IAJA 2YY3A 1REVB 1YVFA 2WVFA 1KTVA 3TJ8A 3W65A 1YLXA 5M2RA 4RUAA 4XDCA 1WG5A 1QSLA 3ILOA 2RH3A 4C8NA 2AGPA 2UUCJ 1RA6A 2BJ8A 3GCWP 1LV5A 3PTWA 1VRTA 3HZGA 4GMKA 3DCAA 3G6VA 1JB0C 4TXSA 2G0CA 1B0PA 5EDWA 1UETA 5H9EJ 5EHHA 4C0BA 1FNOA 1HR0F 4ECRA 4ANEA 5IM0B 1SKUB 3LGMA 2FVPA 4DXLA 2D3ZA 3N6MA 2BOPA 5IS2A 4Y34A 1VQKS 3H5SA 1IKYA 3T1YF 5HLFA 2D41A 3KWMA 2E29A 5LSRA 3KHLA 3AJ1A 2UUAJ 4K4WA 2BR0A 4J37A 4ZP8A 4LF2A 4LR8A 4M8LA 2V5HG 1VGYA 4GKKF 5F0UA 4RUBA 2FLNA 1HBUB 1UJ5A 5ETNA 4KB7A 3RR7A 1QVFR 3WDOA 2J9DE 4X65J 5DO2A 3NOCA 2GQQA 1LEOA 3H2LA 3DOKB 5K20B 3NMAA 1KSPA 3TQ1A 2P6SA 1VRTB 4IOCQ 1N0UA 1WC0A 3IN5A 4ZK7M 2YNGA 4OZ3A 1XNQJ 4KBIA 3VGUA 1GXLA 3HLUA 3FRZA 3J7AN 2VFUA 2V8HA 2WVCA 2B43A 2FTRA 5J2PA 4DX8H 4QQBA 2JVRA 3TUJC 5FJ4A 4PAAA 4WP9A 1IKYB 5KFVA 3OR2A 4N56A 1RT1A 3MMAA 1M5OC 4C3MA 5C2CA 2N7YA 4LFBF 1JLEA 2YWHA 1V6HA 3K89A 2EG1A 1FJEB 4YDXA 2AJ2A 4X62F 1AFIA 4QIGA 4DQRA 5DJBA 4OMFG 5L9XA 3H4BA 4RW4A 3IR6B 4A48A 2ZOFA 1BQXA 1FDBA 3ICLA 2DCUB 1Q0NA 1Q78A 1D0EA 4HYKA 2XGPA 3CW2C 4LRAA 2C2EA 5HK4A 2J7UA 4CIOA 3PX0A 3W66A 2WW8A 2NQPA 1KEKA 1OWXA 4PXCA 4X64J 5L1KA 2RIJA 2YNGB 2HGLA 3W61A 3PW4A 1N34J 3IAS9 3NXZA 2DT9A 3LH2S 2KVQE 2C2OB 4X4QA 1X31C 4ZVUB 3ENAA 3U02A 4G1IA 4ZPAA 2LEPA 2FVRA 1HNVA 3JQMA 4ID8A 2UXCJ 2CNOB 2W8LA 3HCXA 3CC7S 5KFSA 3FQLA 1UVKA 3OR2B 3R6GB 1RT1B 4CH0S 3MMAB 3TANA 2VPWB 4JI2J 2DGXA 3VR1A 1JLEB 2RDJA 2IJFA 2V67A 2ZM6F 5IT4A 2ZHAA 3FNNA 2MYFA 1C2PA 4F7VA 2EBEA 1RT6A 2JH3A 3UQSA 2M0GB 7AT1B 3FEXB 4FKYA 2OGUA 3CJQA 3WIVA 3UDLA 1U4BA 4RW4B 5BJRA 5F8IA 4K8RA 2BW7A 4E8UA 2HNZA 1RQ0A 5LMNJ 2WB4A 4ED4A 4FPRA 1HNXJ 1LWCA 1M1GA 3P5TL 1N48A 2NSBA 3FZBA 4UUWA 3FCWA 1U7LA 1RK8A 2VG6A 2CADA 2WK4A 5KFWA 1WOPA 1B4SA 2AEFA 3AOCA 1T11A 1H6KX 3J7ZT 3CXCR 2Z2YB 2HQGA 1RHUB 4G1PA 3ZZYA 2YWEA 4U9RA 4DV3F 4DV4F 1HNVB 3RB0A 4OYXA 2EK1A 2E9ZA 2AGOA 4F04B 4USKA 3WC2A 5D77A 4BS2A 1HPZA 4J9VA 1VOMA 1M0SA 4KHPJ 2BACA 4OX9F 2CNKB 4HACA 1RJJA 3MR3A 1URNA 4OI4A 3LALA 4L3KA 1RT6B 3QSIA 4QWCA 4QWAA 1KQFB 2BBEA 4B3TJ 3RTVA 4UZCA 4ZLPA 2HNZB 4ZN1A 4O23A 3KJFB 2NXJA 1TKXA 4P72A 2Z30B 4P52A 4X66J 1LWCB 2PE8A 4RWWA 4ELTA 5F3TA 4KYZA 4OLPA 3HZEA 2CJXB 3PCOB 3MAQA 2VG6B 5L39A 1HNZJ 3H2VE 3RW6A 4WYLA 4NRUA 3S8SA 1XMQJ 3DLHA 1UAWA 1S4FA 3VF0B 2PT0A 1VQ8S 3OD2A 2COLA 1TFYA 2C3OA 3DRSA 3JSYA 2BX6A 3OV7A 2FGCA 4O3QA 3M1VB 3DLLQ 4ZLJA 1HPZB 2Q3PA 1YZ7A 3DGVA 2XHCA 2BJEA 2ERRA 4EBCA 1UMJA 2OFGX 2EBGA 1JIHA 1JXEA 1U09A 1ZM4A 2KVIA 4HACB 1NK9A 1X0PA 3VGSA 1RXOB 1T05A 3LUYA 3RYLA 1X4BA 3OXLA 1JJ4A 3PO4A 3RAMA 4NXNF 2QGFB 3DLEA 1NHUA 1YBTA 2V94A 3DRXA 4O3SA 3ZO7A 2H5JB 2K1RB 5KFAA 1TKXB 4NASA 3TI0A 4DEZA 3SFGA 5K14A 5AJ3J 1ACMB 4ECQA 2ZVSA 1TAUA 1PAUB 2XEXA 2QT7A 3CWJA 3GV5B 3W8PA 1UEUA 4OQJA 3NCPA 1A9NB 3QJPA 2QJ3A 5HMZA 3M9OB 2HLUA 5J1NA 5LL6d 1TFWA 2QIFA 3KHRA 1EIYB 2G0JA 4DFMA 3Q86A 1S0NA 5A0YB 4CI0B 2ALZA 2UP1A 1FJGF 3SV3A 1QM9A 3HJFA 3JTOA 4DBQA 4ZVRB 2ZC4A 3PFOA 2DNRA 3DRSB 1AFJA 4EI2A 1R0CB 2IVYA 1PSDA 1S6QB 1B3TA 4FF1A 2ZUAA 1RBLA 3AHPA 4LBPA 5CYQA 2VIHA 2VQEF 2J0SD 1Q5VA 1T05B 3DM2A 3EM1A 2G2ZA 3TZZA 3V4IA 5A6PA 2ZH2A 2C3MA 1RT3A 4UOGA 1FEHA 3DDKA 3UD4P 3DLEB 4ZVFA 4Y2KA 1V9OA 4AMMA 3A8JA 5KAKA 2BE7D 2RDIA 3D2WA 3KK1B 1I3OB 2YX7A 4UOCA 1CQMA 3TA0A 4AQYJ 1FJ7A 3Q8UA 1L3TA 2QLFB 1RT7B 5KG7A 1A0OB 4NLDA 4DR7F 2XS2A 3ETOA 1WTBA 2HLTA 4DCJB 1YJVA 2KL8A 1M1HA 4DI6A 1RKIA 3QJLA 2PC6A 2HSEB 2ZOMA 5CYQB 3PX6A 4NA1A 4LF5F 3DM2B 3T3FA 1WEZA 4MK7A 1NZAA 4ZKAA 2BDPA 3K5MA 1UWBB 2W9CA 2VFRA 2MHEA 1VHIA 3KMQA 3HFZB 4QR2A 1SH2A 1NB7A 3HM9A 4NCGA 4B02A 1K47A 2RQCA 1BY9A 4K2XA 1S48A 3ZZUA 4Q8FA 4NRTA 2MY7A 3DRPA 2VOOA 1R27B 2KJWA 5L1JA 2FVCA 1VRUA 4C8KA 3P3DA 1O51A 2FJBB 5A8KB 4CWBA 2EWHA 3H5YA 1DAXA 3KUGA 4FXVA 3AJ2A 3QT6A 4IG3A 2GZOA 1N33F 3B82A 3KUEA 3M6XA 5AT1B 2RRNA 4ZCKA 2DNOA 5HSPA 5I42A 1JLAA 5A76A 2NYIA 4WXOA 2F9JA 5ETOA 4U7UK 4F4AA 3M8SA 3AQOA 2R7UA 2H3EB 1S79A 1SXLA 2HAFA 4USUA 1KRPA 2RJZA 2BJ9A 2V0NA 3PYGA 1DLOA 2E9TA 2DNKA 3DU5A 3VQTA 2W9CB 4USIA 1F5BA 2UUTA 4DSEA 3EWGA 1P9QC 4NCGB 1NEEA 3T1HJ 1FRJA 4V1Ak 4DCPB 2GA7A 1HHTP 1GT8A 4DV5F 2JJ4D 3H4DA 2ZE2A 1WWHA 1VRUB 3AOAA 5DM7Q 4YR0A 3HHLD 1I94F 3P4UB 4U6PA 1PJ5A 2ADCA 4UF4A 1EAYC 3LPYA 2PI4A 1HHQA 4Y00A 2ZWOA 2DB1A 4IG3B 3PHTA 4K5RA 3IWXA 3PJWA 1RA7A 2FC9A 5I42B 1JLAB 1QTNB 3LP0A 1DJ0A 4DUYF 5L38A 3VWSA 3CDUA 1FTRA 3PYDA 3GSDA 2KXHA 4C8ZA 2LKZA 1TR0A 2POKA 4CT9A 1SJ4P 2DBBA 4JUZA 3Q8SB 3UDCA 3SDEB 1TKTA 3M6VA 1Y4ZB 4TVAB 3N9UC 4R5PA 2AYGA 2HVZA 2IBKA 2QL7B 2YX4A 4Y2IA 2BV3A 3U27A 2MDAA 2GMJA 3AA8A 3C6UA 2ZDOA 5B0AA 4J91A 4NPOA 3TR5A 4DPWA 3ISNC 4OJ1A 4QJVA 1RISA 3CCQS 2UXDJ 3J7Z5 2IA0A 1S6UA 4ES1A 5GADI 3I0SB 3AXKA 4FYDA 4MYTA 1FNXH 3MTJA 2CFXA 3KLEA 3ILIA 3QT5A 4ALZA 3J81j 5ETPA 3GIJA 2YQ3A 3H0PA 2DXEA 5KFBA 1CBKA 1YTYA 1FO1A 2OEKA 3OHAA 3QO9A 3LP0B 4A8SA 3IO1A 3OL7A 1S1VA 5LMUJ 4J9NA 4NMLA 1DQ8A 3NMRA 5HN0A 4FXWA 1T03A 3DLBA 2EFNA 3L9ZA 4QIFA 1TKTB 3V81B 4LRBA 2BMBA 1NKCA 4TYBA 4R5PB 6AT1B 2GAGC 2NUHA 3BSCA 5BYRA 2EKNA 5GADU 4C2MA 2DNHA 4EGLA 5G4DA 1Z2ZA 4HR2A 3CDBA 3KG4A 1Q95G 3W7BA 1HNWF 1UVMA 1YRXA 4YN3B 2CQPA 5BR8J 1FFWB 3A4TA 1ULRA 2CG8A 3HXMA 2BRKA 2QMWA 2VQFJ 1ZTWA 1X9MA 4NXMJ 1WC1A 4WZQA 3KLEB 1QE1A 1IUJA 2PD1A 4RR5A 3PR5B 1VS3A 2CA9A 1YJUA 1GQEA 2KFZA 2E9RX 3FBCA 2ZBPA 4JOUA 4UZBA 3QO9B 1FRKA 4LJMA 4XPCA 3MEEA 1O6XA 1T95A 1S1VB 1NK5A 3BH7B 3PEHA 3JQKA 4ENOA 2DNYA 2KT2A 1T03B 2MKKA 1VQ9S 2R3VA 5E3PA 2V8DA 1IBMJ 1WNEA 4R0EA 4UT4A 4RJVA 2I5JA 2XCPA 2J6UA 3OFGA 1DURA 1HL6A 1MU2A 3TJ9A 4DR6F 1JXVA 1F9HA 2FJXA 2O01C 4HLBA 2DO4A 3BN7A 2XWYA 4MH8A 4DLEA 2VPYB 3CCZA 1FRIA 1R6VA 2HHUA 4WK1A 4X4PA 4DG1A 4ZJOA 3OTCA 1SB6A 1PJ7A 4TQSA 4FVCA 5H9FK 4TQRA 1Y5LB 4OFZA 1KFDA 4DV1F 5IZHA 4C7QA 4C48A 3M8YA 5HL7Q 5ETKA 2EG2A 3MEEB 5HROA 3MM5A 4D3HA 3MMBA 5JUMA 1A7GE 2BJDA 3C8YA 3N6LA 3CF5Q 4UY85 2VODA 3MI7X 3EDRB 1VQYA 3Q24A 2QV6A 1LXJA 2QA1A 4ECTA 1WHWA 2I2YA 3M8QA 1G6BA 2DRBA 3BO3A 4RNOA 2BKOA 4OZLA 1FRLA 2O66A 3FBEA 2ABYA 3N6NA 1ELOA 4XTTA 4YUDA 1VBKA 4QWEA 1HA1A 4LF4F 2B6AA 3VQSA 1DRZA 3BREA 2W2MP 5L46A 3PKYA 5DG9A 1NLKL 2CPYA 4FN5A 4DV7J 2KH9A 3HT3A 4ID5A 3D6MB 4DG1B 5LSLA 3PYFA 2AWZA 2K8GA 3CCLS 4C0HA 3KG0A 4JI3F 5HP1A 3G6XA 2EVZA 4U95A 3HP6A 5HROB 4ZPCA 3MM5B 3NGTA 4DSFA 3MMBB 1RCOB 5CD4A 6FDRA 3G2XA 4JI4J 2FVQA 3GU0A 4C8YA 3NL0A 2E1PA 5D3GA 5C25A 3MUTP 3M8QB 2VZ9A 4OJGA 1NJZA 1VBXA 1RP5A 5ETQA 3GIRA 4NI2A 2OPRB 2H5EA 1TMMA 4NA2A 5E3AA 4RL1A 3PRDA 4RBUA 1JLFB 1S9GA 1PJ6A 4ANCA 3NS7B 3OPKA 1OPZA 2IM1A 3TVYA 1NMEB 2B6AB 2PN6A 5J1EA 3MTKA 2F7VA 1NPKA 4ID5B 1H74A 4CQ1A 2IDLA 5ETSA 5D0GA 1HWUA 4CO0A 1OS5A 1MG7A 2M70A 3FCHA 1XWLA 4ETXA 3NRBA 4LSLA 1SL2A 1VLYA 3IRXA 5RUBA 4KGXB 2E66A 2XY7A 3RB3A 1R31A 3SSSA 1UJ6A 1U48A 3WZ0A 4NEZA 2V4QA 2R7XA 2PSZA 4PWUA 1TK5A 1XIQA 1B70B 3BKFA 1TL1A 4K7QA 4HT7A 5D3GB 2WAQD 5C25B 5KFRA 5KOXA 1FWKA 1GMWA 1WEXA 1EHWA 3MCOA 1CJTA 4ZA1A 4NI2B 1FE4A 4LF6F 2MHNA 2MSSA 5G0RA 1S9GB 1KLNA 4KC5A 1FDDA 4AL5A 1RKJA 3GE9A 4EZ6A 3OVAA 5DS7A 5J1EB 3UI3A 4QR0A 3F56A 4DL2A 1ZA1B 5FLXY 2J7WA 2CPHA 1X9SA 1CVJA 4E0DA 3IRXB 2HGMA 1AXQA 8RUCA 3OTOF 2CQ3A 1FJCA 3QRRA 2B7BB 2HHVA 2UV8G 1ZAXA 4WFXA 1FFGB 1WKLA 4LR9A 4LF1A 1TL1B 3QRQA 5KFZA 3VVUA 4GVBA 2PEHA 4I56A 5EUHA 3EGZA 4KHMA 2EFOA 3RAQA 2ZH1A 1ZAWA 1CJTB 2A1BA 1RWVB 2K7KA 5L1IA 1KOHA 1LW2A 1K0TA 1Q82T 1NJWA 1XR6A 3OFFA 1NDPA 1H73A 1WKJA 4JYAF 2HWTA 1EQ0A 1AUSL 2N3OA 3T9NA 1N32J 4YY3F 2XSJA 3FQKA 3Q22A 3H40A 4ZN3A 3D3BJ 4DR1J 5A6WA 4WU3A 4F2SA 1NSKL 1RAIB 1M1KT 1Q81T 4CTAB 1H72C 5KFKA 4NA3A 2HWIA 1YX2A 2XYGB 5HQ8A 2QA2A 2HBYB 4NLGA 4GKJF 3MR6A 2YX1A 4U7CA 1HD1A 4ETZA 2FJWA 2AJ1A 2RF2A 3GV7B 3MM7A 4GVBB 1WG1A 5H1SV 4X4RA 2NPIA 3RGIA 2CJYB 2IA6A 2B5JA 4AMPA 4F8RA 1S6OA 3GG0A 3W3SA 3IGNA 4QYZJ 1YWXA 2DNLA 4F50A 1SPBP 1B0TA 1OSCA 1TZ0A 2IJNA 3PW0A 2R2SA 1F5AA 1TU0B 3FMBA 2IIHA 1TL3A 1Q7YT 1P6TA 5HANA 1HFEL 3KNGA 4JI1J 1S1XA 2XSJB 1XJWB 2GIFA 1LFWA 2V2ZA 3LQVA 3RUBL 2WSCC 1J27A 1NZ8A 4J9MA 2F65A 3PACA 1VBYA 4ZPVR 4PZVA 2A10A 4M5LA 2WBMA 1I1GA 1VDHA 5BYSA 2ZH9A 2HMIA 3ILLA 1S49A 2LXFA 4FDFA 3OR1A 3GJTB 1WJ9A 2RF2B 4ICLB 4FYVB 4Q7AA 3MM7B 4PG7A 1YJ7A 3MWBA 4OZNA 2LCWA 3OXGA 2GJIA 2B5JB 4OZ2A 1ZPVA 2KG1A 2GHVC 2YQ1A 1UA1A 1WC5A 4XO0A 3DXBA 2YH1A 3OL6A 2L3MA 3S1TA 1TL3B 2H48B 4M5JA 4NLPA 5KFYA 1S1XB 4TKTA 2CPFA 2RRBA 2W2NP 3LGNA 3QAEA 1FDAA 2Q43A 3MUMP 4PYAA 4FYWB 1F6TA 3I32A 4URGA 3CMQA 2XS5A 5IWAF 3HK2A 3IMQJ 4PYDA 4KGZB 4YS2A 2ZHBA 2HMIB 2VZ8A 3VAMA 1TL7A 1VBZA 4ILMA 3M8PA 4AT1B 3OR1B 1WC6A 2KKHA 3ZTPA 4C11A 2ZBQA 2R8KA 5HQMA 3OW2R 1RB0A 1Z2LA 4CO1A 3WHIA 4N8NA 2IM3A 2QC3A 1CS4B 2AW0A 3FSIA 1UPPA 3ZTSA 2XTJP 3PO5A 4J7CA 2E1AA 2DR8A 1BQNA 2BEFA 4F4WA 3DMJA 1KLMB 4ZP9A 3PNIA 3EZUA 3MPDA 2ACYA 1T3OA 1Y7PA 4JI6F 1X5OA 3SV4A 5B0EA 3EICA 4NZ0A 1JLGA 3J80Y 2DYAA 4W98A 2B8PA 2QN6B 4WYWA 2L9DA 1N54B 1S1WA 4R8UA 1REGX 4AXJA 2DHAA 2DGVA 1L3VA 5T7LA 3OQ2A 3MXHP 1O5JA 5BR8F 4DZDA 1TL7B 3KLVA 3M8PB 3H2UB 4CZCA 1A6LA 2HNDB 2Z0GA 3CCJS 1NH7A 3KLGA 1QY7A 4CO3A 5KG0A 1VR6A 3CD0A 3LP1A 2HHHF 3EJMA 2BQRA 1BQNB 2Q1LA 2ZBIA 2MQMA 4A8YA 3FSYA 3W9HA 3DGPB 3NKYA 4P9SA 4C98A 2DNGA 5GAHI 1SQGA 4LF7F 5ETVA 2VOPA 1XN9A 1F3FA 2W24A 2Z2LA 4AFFA 3GLJA 2ZFHA 5HQLA 3BBBA 1OY8A 1P27B 1S1WB 4R8UB 2V4JA 2D1CA 4I6YA 3BDPA 2J7KA 5D4OA 3TVKA 1Q4RA 5T7LB 1HR0J 5EX0A 4ZIVA 1LW0A 4CLKA 2YKPA 4B9UA 4JI7F 1QTMA 4H4OA 4PUOA 3CO0P 3T5LA 1UA0A 3PIPQ 5U47A 3T1YJ 2CJAA 1NSAA 3M2VA 5GAHU 3KLGB 3ZTRA 4MT1A 3ZC4A 3LP1B 4EO8A 1YRUA 1WC4A 1BMQB 4KGVB 4GC6A 4GKKJ 4KHRA 1RUSA 1JJ2R 2LVWA 1SJRA 4KO0A 3CGIA 3JYTA 2CZ9A 3DHWC 3Q8QB 2QLXA 5KFQA 2R7QA 2BKNA 2VKRA 3TZYA 1AZSB 4NLYA 2J6SA 2J9DA 2QE5A 2HGNA 2GMLA 3FRYA 4N47A 3X3UA 4O3NA 2LDYA 1AW0A 2UUWA 4EBEA 4DR5F 2QYCA 2ASYA 4DL5A 3IBCB 3G71S 5KFOA 2HHTA 1S7HA 2RS8A 2AYBA 2OMLA 1WHYA 4YB1P 3W2VA 4X4TA 2ILYA 3SXLA 1LW0B 4DQSA 5IT0A 2YWKA 3KK3A 4B9MA 4WZMA 3MAAB 3QBCA 2J6TA 1IVZA 1WF1A 4H4OB 4PUOB 3BQ0A 4C0OC 2KM8B 3C16B 2C2MB 3TUPA 5GVQA 2WB1D 3M2VB 3R5DA 3ULHA 4LFBJ 5GMDA 3AB2B 4ED8A 4X62J 3JTPA 3BGRA 1SKRA 1NKBA 4KO0B 1X4DA 3VVTA 4X2BA 3JYTB 1YK9A 2XI2A 2HHWA 4LF8F 3H59A 1FA0A 1NHKL 1WTFA 3Q89A 2ZNZA 1GXTA 1WI8A 5IV3A 1JLQA 5M2UA 2WTFA 3MPVA 2WRMA 2WBRA 4I2QA 3DI6A 2EFGA 2HHPA 1URRA 5DRKA 1X0FA 3CCSS 1HQUB 1KTQA 3KXDA 4P6QA 1S59A 3TJAA 4DFPA 2GMHA 2JX2A 1IBCB 3W2VB 2O67A 3ENQA 1WHXA 3RB6A 1EB0A 1H2TZ 1NU4A 3F0NA 2FLPA 1LWEA 4P71A 4A46A 3I6PA 1QAJA 1UKUA 3CO9A 1P1LA 3RAXA 2YQ0A 3I56S 3MPUB 3LGHA 2E1MC 2ZM6J 1MMDA 4NCAA 3MPWA 1RAGB 3BGRB 3M9MB 4PWWA 4LQ3A 2VA2A 2IYIA 4DS5A 5C42B 1GMUA 1RAAB 1S10A 3OL9A 2OD4A 2V2VA 2YWGA 1M5SA 2VG5A 4A8OA 1RLCL 1SKSA 3HHDA 4UQGA 3SQGA 4IR9A 2DH8A 4N8OA 4DOZA 2D3OR 1SC1B 4ECWA 1NK6A 2J0XA 1FF2A 2VHGA 2B4UA 3V2UC 1KBRA 2HAIA 4DWIA 3PV8A 1M5KC 4IFVA 1IKXB 4I2QB 2HKEA 1CSJA 4IO1A 4G6VB 2CUYA 3DI6B 4M95A 3CSKA 4M1KA 1J5OB 4IO9Q 4OV6A 1P8GA 1YJNS 4R0JA 3ZZTA 4F3QA 2DR9A 4AE5A 5CZXA 2FUG9 4DV3J 3ZZOA 1KKHA 1LWEB 4OHWA 4NLXA 1TUGB 3PR4A 2B51A 3DFEA 4ANDA 3BPDA 4NLUA 5HATA 2MB0B 1WSRA 5C5JA 3JQJA 4L74A 4IRDA 2O3DA 2DY1A 2MQNA 3K5NA 1OYDA 4ELUA 2NXEA 3FUYA 1U2RA 1RHMB 2IDEA 1KHVA 4ZIWA 4NMXA 4OX9J 4OJ3A 1C0UA 1ZYQA 1KFSA 2B4PA 1DTQA 3EPGA 5JVHQ 4O3PA 1HHSA 4K59A 2VG5B 4WWSA 3N5FA 4J9LA 2OSQA 2PMHA 3O2IA 1DQAA 3EMTA 4CYUB 4WK3A 2WVEA 3OT9A 1X5TA 1MMLA 4YOEA 3L95X 2DVIA 4IFVB 4OI2A 3BM7A 4DUTA 4CRJA 2JOQA 4OYOA 2WSEC 3A12A 1S1UA 3CJTA 1PG5B 2P6TA 5GAEI 1F1BB 1IBKF 4MIBA 4C3KA 1RGVA 2CZ4A 1H2UX 1RE1B 3C2PA 2R2UA 3VHQA 3IC1A 2J0QD 2YKOA 2Z2ZA 5DLFA 1UTAA 1UW9A 4CLPA 2XYPB 3VAJA 2ZWPA 2FD2A 2K3IA 2Y8YA 1F9EB 3HD2A 1U1LA 2JC1A 3HVAA 3SCLE 3KK2A 4C6AA 3W8GA 4M5GA 2M52A 1C0UB 5B0GA 2R2TA 4K4TA 5KT5A 1DTQB 2ZKUA 1M5VC 4NXNJ 1I6JA 4TY9A 4CLUA 4IR1A 1MLAA 2C28A 5DG7A 4P10A 3JAMY 4WBFA 3QJJA 3US5A 2DPJA 4OYBA 5GAEU 2QLWA 2MJNA 1S9FA 2KZZA 4ZP6A 3VZIA 4TNOA 1PC4A 3QMQA 4CH1A 2MLXA 1U8SA 3SBMA 2CAJA 3SYZA 2GIQA 3QFWA 2OJ3A 4P2XA 2DR6A 1S1UB 1LWFB 4LFAJ 2YWWA 4M5NA 1TELA 5DGAA 1FJGJ 1F0XA 3DOMA 3R5GA 1ZM9A 4KT0C 3E51A 5IOLA 2JNJA 1E6YB 2W7AA 3OL8A 1NSPA 3CCRS 3FEYB 4MAKA 1QVGR 5E3RA 2ZOGA 3IM8A 4J9SA 2IFXA 2QSWA 2QFIA 2KM8C 2B56A 4RW6A 2OPQA 4OI6A 2VONA 4IG0A 2VQEJ 3KK2B 3CD6S 1RWUA 4ECZA 4USMA 3GWCA 4B3RF 2GQCA 4WIQA 2A6OA 5K8NA 3G82A 1W25A 3DKDA 3P96A 1FT8A 1XQIA 4LIRA 1FVSA 2R7WA 5C7PA 1KVJA 3LOUA 3BR8A 3H90A 5AE1A 2L48A 4QIVA 4WP3A 1TUWA 4QYZK 5FIIA 4ERDA 2HHSA 1FNMA 4B9TA 4W90B 4DPXA 3BJYA 1YKWA 3N4WA 4UUXA 2PDAA 2GO9A 3DOMB 1L3UA 1MSWD 4NYPA 4J90A 1O8BA 4DR7J 5BYQA 2XMMA 2H1YA 2HIYA 3QQCD 2GV1A 4UW2A 4RW6B 1JKHA 2D69A 4DQIA 2OPQB 4B17A 1FCAA 4IG0B 3POTA 4LF5J 1M5HA 3QLHB 1VRQC 4ZVHA 3G82B 4E2FB 4CNYA 2J5AA 1FVQA 2YNFA 3G8SA 1N36F 1HI8A 5AXLA 3FMWA 4ED5A 3KLIA 4HT5A 2QRRA 4ES2A 1PCAA 1SV5A 5A2QY 2RMLA 2ZBRA 4J9KA 2FIUA 1B99A 3ET6A 2AYEA 1EKRA 4GO5X 2CG4A 5IT9Y 3IWNC 1QAYA 2J8SA 4A8KA 1N33J 5SUHA 2GJFA 3KHGA 1SIZA 3LA0A 2C42A 2E5GA 2M2BA 2ASJA 3C6TB 3BN4A 1RABB 4CT8A 1U8WA 2M88A 3T5KA 1NK4A 5DZ6A 4IQMA 2QMUB 3FFIB 3IGVA 3POTB 2ADBA 4DSJA 2ZUGA 2ZKTA 3NNHA 3DYAA 1PC5A 3FEZA 3IAM9 4DDFA 1RACB 4B3MF 4OZJA 3IA0A 1HWJA 2YNFB 2GQ2A 4CLTA 2PO4A 2ROGA 5IM0A 2CDRB 3CNQP 2RU9A 2VA3A 4K50A 4F25A 3KLIB 4G3IA 4IDKA 4ZJLA 2FQQB 2LA4A 3O3LA 1V3RA 4D3GA 1U6ZA 4EEYA 4DV5J 1SV5B 1R8CA 3ET6B 3MAHA 2M9KA 3MHYA 1FWPA 5KFTA 1XR7A 3C19A 1I94J 1VQMS 3UWTA 3TA2A 4DN0A 4OV1A 2M8HA 3MEKA 3AB4B 4KRWA 1X4HA 5KT6A 1HBUA 2D7SA 2OIHA 4AYBD 5LOQA 2MTLA 1BLUA 4DUYJ 2XMTA 3MOJB 3KKFA 1JQGA 3DOKA 3P49B 3CPWR 1XC9A 5D8HB 4IQXA 4IUFA 4OZ5A 2ASLA 1G3OA 3NLCA 2G2YA 4PEOA 4Q2LA 3IM9A 5CABA 4WP8A 1WDTA 3UCZP 3EGWB 1V3ZA 3HSZA 2W1BA 1U6BA 4K4ZA 3C66A 4W92B 4O44A 1R8HA 2YNHB 1PYOB 3DYAB 4KFBA 2B9WA 1UFWA 2NXNA 2R8JA 1TAQA 3E8OA 5EWEA 4IDKB 1X8DA 2H65B 4B9SA 1Y3KA 1UWAA 4YHHF 2JLGA 1MN9A 3AT1B 3ZZZA 3GR0A 2WSFC 2N4DA 2FJDB 3AD9C 3VGVA 1SH3A 3EE3A 3CCTA 3L09A 3G8QA 1NH8A 2F63A 1TV6B 2MZSA 3BQ2A 1N56A 3CDAA 2MKSA 1T9TA 5T14A 2VV5A 1XNRJ 2GS8A 2W9BA 2R8IA 1ZETA 1IM4A 1RAHB 4NOHA 2NUUG 3L3CA 2RKIB 3D68A 3DRRA 2E1RA 3C3LA 2I9SA 1LXNA 2GC8A 1HWIA 4MK9A 1R8BA 2ZJRQ 3OLBA 4O44B 4QPXA 4KFBB 1BD6A 4RW8A 3FDSA 4CCHA 3GCXP 1U6FA 3JSMB 1XMOF 2FJVA 3W5XA 3SSRA 1WKKA 2CQ4A 4LQ9A 2HRUA 3HPOA 3LWMA 1FESA 1HNWJ 3R2CJ 3F41A 2OAUA 4DR3F 3PJ9A 1VISA 4Q8EA 4DL7A 2IVFB 2DJWA 2JEFA 1GX5A 2OSRA 2UU9F 2YKMA 3IFEA 4EFAC 3F73A 5IQQA 2QTWA 2HFSA 3OHBA 4K4UA 2BA9A 2W9BB 4IKAA 1K1QA 3OJUA 1YITS 4KSEB 3CJ0A 2XC9A 3DRRB 1RZMA 2VBWA 3MEDA 3ONQA 2BJ7A 4I6WA 1NKEA 3CIMA 4TLQA 2R7TA 3QWUA 1L3SA 1JWWA 2KJVA 4Z2XA 4K4SA 1GMWD 3R6LB 3CMES 2LYVA 4RW8B 1H2VZ 4OYMA 4EMDA 1Y10A 1UVNA 2VDIA 4DR6J 5K8PA 4NLQA 3O6QA 4LRDA 3ETMA 3CE8A 4B3SF 1U26A 5KFEA 3PKMA 5I3UA 4C9DA 1NK7A 4DPYA 2A18A 3E01A 5AE2A 2DGSA 3FKBA 2KRRA 2GVZA 3DHXA 2QYGA 4OYIA 1S12A 4Q2MA 2YKMB 1T9UA 4FBTA 3GB0A 1S0MA 1SVDA 1MROA 4HHJA 4DV1J 3HHLA 1R43A 2U2FA 2CZVC 4EBDA 3QSYB 3KLFA 3MEDB 3EVWA 3SCJE 1C1CB 2MGZB 3A8KA 1H7XA 3UPFA 1QDUB 1B7FA 3MR2A 3G6YA 2P9CA 5B0DA 5KT4A 2G13A 4DV2F 2C3UA 2HRYA 3CDWA 4IRKA 2FJEB 4KKOA 3ZNUA 2JFDA 3MM6A 4DL0C 4DHVA 2LP4A 4DCOB 2AU0A 4LF4J 3M1VA 1SC6A 1RAJA 1X4EA 5F41A 5I3UB 2NLWA 2R7SA 2RRAA 3E01B 2AMCB 2GVZB 2A2CA 1JLCA 2V9KA 3DLKA 3BR9A 1QUPA 4JI3J 1MROB 1WUUA 2C2DA 5HMWA 4WIIA 2K1RA 3OTDA 4WKYA 4ZVEA 3HHLB 1D8YA 1U2CA 2H51B 1MWZA 3ITHA 2OTLS 1JK9B 3Q0AA 3KLFB 3J81Y 4RNMA 3TZXA 2RUGA 1RWPB 3CJRA 1N5YA 1DBDA 4Y2AA 3CC2S 1N5QA 5A0YA 4DQPA 2EKYA 1U1OA 3HHNB 3NGDA 1J5EF 1VQ7S 4NLTA 2BZ2A 3UR3C 4KKOB 2AEMA 1S6QA 3MM6B 3ZTQA 2ILZA 2H4WB 2OEMA 1PBAA 2Q79A 5F8HA 2QFJA 1R6YA 3BDEA 2DEIA 3BYPA 1LKZA 2Y1LB 1JLCB 4GRSA 1WELA 3DLKB 1IJFB 3T5HA 3MR7A 4N7TA 4U8VA 2XHWA 5CHCB 3V4MA 4NCBA 1W2BR 2R42A 1RHRB 1TKDA 5KG4A 3ZZPA 3ITHB 2MMYA 2MPUA 2DXDA 2Z8QA 2KHCA 3BYRA 4CLZA 2HQFA 1WORA 1N88A 3KK1A 2V63A 3OLAA 1ZBTA 4ECUA 1N5YB 1YI2S 4Q44A 4LFAF 4OYPA 1RT7A 2CPIA 3M30A 2ZVIA 5D15A 2XO6A 2KT5A 1Z1ZA 2OPPA 5LM7E 4LF6J 2M7SA 3GV8B 1G2EA 3M6UA 2YKNA 4Y0FA 5B0FA 3OSNA 1QUVA 2DEJA 2RB7A 4JV1A 1XEZA 1E6VA 3N01A 3WIUA 3Q2SC 3CJSA 4RW9A 4DZ6A 3GYGA 1HQ2A 4QPTA 2W2PP 2LXIA 5CZCA 4G1QA 2L9NA 3B54A 4J9QA 3HDSA 1UWBA 4FF4A 3Q8VA 1EJ7L 1Y0HA 2QL5B 3ILJA 5D0HA 3R5AA 2C3YA 3BBFA 5F9LA 3OTOJ 1T02A 1U0HA 2M5YA 3M2RA 2DGQA 3AAWB 4IH5A 3UVJA 3K17A 1QLNA 4NEYA 2H54B 2F8EX 2LMIA 5A8KA 1RYRA 5E0OA 4O3OA 3JXOA 1H3DA 3R7NB 3I96A 3TAQA 2RILA 3M30B 1GH8A 2Y3YA 1OPIA 2OPPB 1JNZB 4YR3A 5E3CA 2YKNB 3WBZA 5MAOA 2UV8A 4I2PA 4DFJA 3MCMA 1NK8A 1E6VB 1KC8T 4RW9B 2HZVA 4JYAJ 2DD8S 4A8QA 3I9ZA 3D4JA 4JV0A 5AE3A 3VCDA 4DJBA 4G1QB 4F4XA 4FBUA 1CC7A 4YY3J 4OI1A 2AP6A 1Z4UA 3HJVA 3K8WA 1BQMA 5E3QA 1S7IA 3GONA 4LT6A 2KO1A 3D6FB 1VC6A 2L9WA 1Q8KA 2IC3A 5ETRA 1U0HB 2B4VA 1CG2A 3M2RB 1LK5A 3UVJB 4JI8J 4DX5A 1FKPA 1O0PA 4GKJJ 4OZ1A 1S99A 3SMZA 3JSBA 3R5BA 8AT1B 3BSAA 1VLOA 3P45B 4N76A 2RU3A 2PGCA 2W7OA 3CB4A 3T41A 3NAIA 3K59A 3RRGA 1Q1KA 3G4SS 3CIZA 2CPJA 3SI8A 2GHWA 4PXEA 3GG1A 1HW8A 1C0TA 2CWXA 1ZTTA 4ATNA 3K5OA 5E2QA 4I2PB 3HF5A 7FDRA 2WOMB 1YIJS 3RRHA 2UUBF 5DQHA 3SCIE 3RG6A 1HI1A 3DXSX 3VAKA 2MKHA 3FCVA 2PMZD 4DSLA 2D74B 3SDEA 1OQ3A 1ZOTA 2VKZG 2KU7A 1S6PA 3KYLA 2RQMA 1BQMB 1VQLS 3CD7A 4LREA 3VALA 3QNWB 3KFWX 2L41A 3TX8A 2IC3B 4UQTA 1FXRA 1Q79A 2HS3A 2XSFA 3HHLC 1FKPB 3CD5A 5KFUA 3I0SA 4QIEA 3SZ2A 2ZZTA 4QW9A 2VL1A 4DF8A 4OYZA 1Y00A 2CVIA 3FC9A 3CEDA 3EZ5A 3G87A 4B9LA 1W26A 4URSA 1PYTA 1C0TB 2OLWA 1C4CA 2EW9A 1P9YA 2XZTB 5A8WA 2VFTA 5KT7A 2HK3A 3EZOA 3DDIA 3VZHA 4AL7A 4F4KA 1FD2A 3QT7A 3BO2A 3W5YA 4DU7A 4IOAQ 3TP2A 3V81A 2FHJA 2DNNA 5CYMA 1S6PB 4RNNA 4JV5F 3AOBA 3VGTA 1YJ9S 2GVDA 3BQ1A 4Y28C 2Q6BA 2IRXA 2BQUA 5DM6Q 5IWAJ 4HI2A 1F3VA 3U1LA 4F3MA 5F8NA 3GYXB 2DHSA 2XG8A 4C97A 1OY6A 5HVFA 2B9EA 1KDNA 1VK8A 4IYQA 1FRXA 5ETMA 2M8DB 2A3JA 5IV4A 1DARA 4L72B 4HDGA 3EPIA 2RVJA 4YB6A 4OX6A 5EN1A 3V6HA 4M5KA 1XNRF 2Y1IA 1T94A 4OLOA 3GTYX 3BBCA 3M7VA 4JI6J 2F4VF 5A8WB 2NR0A 5H9EK 2K06A 3K5PA 3FGVA 4JI0F 4DV0F 4NYOA 2C2KB 1X4FA 1S1TA 1W7WA 5CYMB 2BE9B 2CYYA 2LXUA 4MFBB 2I0XA 2GVDB 4ED0A 1YBAA 1R89A 2HRTA 2XO7A 1YZ6A 5CCMA 3NCQA 4WFZA 4Q5VA 3K57A 1NSQA 1ZZFA 3I0RA 2KYZA 2HQCA 2AKWB 4FS1A 2WHOA 1RWXB 2V8GA 4XDDA 2HQIA 3MD3A 2QZ8A 2CDQA 4B9NA 3NNAA 6FD1A 2AJ4A 4X4SA 5FLXU 4X84A 2LDIA 2E44A 4DX6A 5LXYA 1D1UA 1T9VA 3A3PB 4JP8A 1MW7A 3AD7C 2HHHJ 4DS4A 3K7RA 3AFGA 4ECYA 3V6JA 2PIIA 4ZVTB 4P2SA 3TAMB 4RU2A 2IHR1 4LF7J 1NJYA 4DL3A 1EQMA 2DHGA 1KP6A 2OO4A 4NL5A 7FD1A 2DNZA 4F36A 1QAIA 2OD6A 1S1TB 2YPZA 1S0VA 4K2JA 4WFYA 4OI0A 1G4CA 2AT1B 2P5VA 4HHUA 1EP4A 5BXIA 3IR5B 3V6KA 4WU2A 2Z4PA 1FD8A 3F44A 1UPMB 4RPFA 4GVLA 3N5BA 3I0RB 1VIXA 4QW8A 4ED1A 4C8MA 3UD5A 1R8PA 4YB5A 4JI7J 3T9ZA 3LW5C 5KFNA 3BKTA 4Y6IA 3O1LA 3IR7B 2YKAA 1FEEA 2Z2MA 4BBYA 1YG0A 3D0GE 2DY9A 2R7RA 4HDHA 2VC0A 3MEGA 1U0SA 2IM0A 3W63A 1U1NA 4YMEA 3DNCA 3SEOA 2LQ9A 1U1RA 3P5BP 3NG8A 1P1TA 3M8RA 1RDRA 2DGOA 2CJBA 1N4LA 4PG5A 1HWLA 4XIUA 4PWDA 1VJWA 2W9AA 3D3CJ 1NXIA 4LBHA 3QPIA 3AQPA 1XERA 3RBZA 1RT2A 1IBLF 4GC7A 3R97A 4IOBA 5DDRC 4DR5J 4WCEQ 1ZZNA 4OIXA 3K0JA 2IAJB 4N77A 5JMNA 1EP4B 1IQZA 3D9BA 3MM9A 2OPRA 4OZ0A 2UXBF 4NE9C 1N5VA 3SQOP 1JLFA 1CPZA 2EEYA 1RSCA 2YH0A 5HMYA 1TP7A 3I5CA 1MMNA 2DCLA 2XULA 4MK8A 4QIWD 3MZIA 5KFIA 2F5GA 2IYGA 1BGXT 2R2RA 1GEHA 5CD4H 3MEGB 2FY8A 1UW4A 1UZDA 2BANA 4ZVSB 4NWBA 2IMWP 1RWWB 3FZ2A 3NAHA 3VAFA 3U1NA 2A0FB 5HLFB 3AODA 2IPOB 4AMOA 1DTTA 1IR2A 1VQSA 4LF8J 4U8YA 2FLOA 2ZNYA 3R7BB 4PWDB 2SXLA 2YTCA 1RT2B 2DRAA 3D6TB 4ZPDA 3KJVA 5HVHA 4F0HA 1HKAA 2F40A 3ENWA 5B09A 3EYZA 4M5HA 1X4CA 1RTDA 3MM9B 2FY1A 5AXNA 3D54A 1KQKA 1AB8A 3UO0A 2P8IA 5H9FJ 4YQWA 3QZ7A 3MR5A 1NPPA 2ALYB 4I69A 2VC1A 5K5MA 2R8GA 2CIMA 3X1LB 3R1HA 3MPYA 2QL9B 3TQEA 1Y3JA 5GMEA 3PY8A 4J5OA 5EGYA 3RR8A 3UN2A 4ZPTR 1IQTA 2JL9A 5J2PB 4X4OA 4FF2A 2FC8A 2BANB 2W4CA 2RSQA 3GPAA 5L1LA 2X7IA 4QWBA 3U1MA 1S76D 1V3SA 1DTTB 2E5IA 2CQDA 4R25A 4DF4A 4WXWA 3NGUA 1GMVA 3UNYA 1WC3A 3BZQA 3W60A 4CNZA 5F3ZA 2DTJA 1X7VA 5E7OB 2FB0A 4NLRA 1BE4A 1IJEB 3KJVB 3PVXA 4HTIA 1F2HA 3KJQB 1U02A 4P2FA 4Y2MA 2LQJA 1HMVA 4HKQA 4I1TA 2B3TB 5IC6B 5EWFA 4MKVA 4ZVPB 2NXUA 1RTDB 2X3DA 4M63A 3BPSP 3CUNA 9ATCB 1K0VA 3J80U 1NHVA 1FDNA 1ZS6A 4OYAA 3W1YC 2WVDA 4PG8A 1HLWA 4WTYA 5EWGA 3EGNA 2PI5A 1R7IA 5THWA 4DR2F 2Y1JA 1RTHA 1EETA 3HSJA 4HVZA 2HS0A 1UVIA 3UN5A 4KJIA 1Q8LA 1SIWB 2X1FA 1T9XA 1F5CA 4CTAA 1SJ1A 2PEBA 3T19A 2I1RA 2OI2A 4DMZA 3VAHA 1PILA 2X1GA 5JVGQ 3KMSA 1R3NA 1CJKA 3FJ2A 1VFJA 3Q8RB 3SSQA 2VASA 4H4MA 1Q8BA 1HMVB 5ADZA 4ZCIA 4ECXA 3GMGA 3TNVA 5DDOC 2P9GA 1QAXA 2VF3A 1LOUA 2CWKA 5DLGA 3S7RA 3TO8A 3LANA 1PAEX 3UFCX 1IBKJ 4X4UA 3KJNB 2KXNB 5KFLA 3M8ZA 2BXJA 3FK4A 1N0VC 1WI6A 1H38A 2V2QA 4CO2A 1RTHB 4ILLA 1EETB 2XMWA 3A13A 3MGJA 2ZH3A 1S4EA 3GFZA 1X4GA 1LWXA 4PPDA 1RU1A 2C2ZB 3ADAC 3HHEA 4ED6A 2VPXB 4HL9A 4JI8F 1KD1T 4TU7A 2IMOA 2HS4A 4KH1B 1RTZA 1SCJB 1CJKB 2AZ3A 1K8AT 3EVMA 2AEJA 2XQCA 3KNAA 2ZH7A 4H4MB 3H25A 4ICLA 4KY3A 5DDPC 1FERA 3S01A 2QMXA 1FE0A 2GJ2A 3M05A 4P2MA 1HQEA 4S0MA 3IP0A 2XI3A 1LNQA 3W9IA 1JMTA 4M5DA 4OHVA 3IXQA 5B7WA 3OSPA 2F8HA 4AUKA 3AXMA 1RTJA 5JJBA 1Q53A 2KG0A 4QCLA 4LBIA 1JNRB 4CO5A 3K2YA 4NLWA 1RHKB 1NBEB 5A8RA 1K44A 2MLZA 1FX2A 3I5AA 3UW1A 2W4DA 4B3RJ 3GFHA 4B3OA 2KT3A 4LMZA 1CJVA 1WACA 3J7YI 1R8AA 2FDNA 3H5UA 4I64A 2VG7A 4F26A 4TU8A 2G2OA 1VK3A 1RAFB 3BGFA 1SH0A 4UY8T 1S5ZA 3PG9A 1YQHA 2XS7A 2DO0A 2Q66A 4LF9F 2C1EB 4FYYB 4UOFA 2BABA 3ZNJ1 1CS4A 1HQEB 3HD1A 1OIAA 5K14B 3MUVP 2BQ3A 1ZPWX 4QU6A 4EK2A 1RTIA 3DRYA 3AH6A 3GJRB 2HFNA 4USWA 3BB5A 3PEJA 1KLMA 2PA8D 4M5DB 1TL5A 3WC0A 4I68A 3PZPA 5B08A 3CTRA 2UZAA 1D09B 1KONA 2DNQA 1RWNB 3I55S 1U45A 2W4PA 1RTJB 4K0KF 3J7YU 1VJQA 1PGZA 2DNPA 5A8RB 3CULA 4M94A 1AA1B 2CQBA 4UOHA 1YHQS 4B3OB 4BWJA 8ATCB 1CJVB 3Q8PB 3GP9A 1MNEA 4KAIA 2PFFB 3CJ2A 2ROPA 3TUZC 1EZZB 2HYIB 1N36J 3THTA 1CLFA 2VG7B 1F60B 2FGOA 3EVOA 4GO7X 3LF0A 3V4IB 4O3RA 2HBZB 3GFYA 1RT3B 3G9CA 1ZM3A 1SJ3P 2HNDA 5GMKa 2HEKA 4DN9A 2XCAA 2XY6A 2KN4A 3QIPA 4PPZA 3LO3A 2B8QA 3FSXA 4RLEA 1RTIB 4RWXA 2E5LF 5J2MA 2DHHA 3DGPA 4DUZF 3PX4A 3BGLA 2HFVA 3PW7A 2ZD1A 3B8HA 4DV6F 5IQ6A 2F4FA 5I3PA 2KRBA 3ENVA 5KG3A 4XPEA 5IC4B 1NDLA 5KG1A 4FXDA 2HFUA 3BGUA 3IG1A 4DLGA 4F0KA 1N5SA 2R7VA 1Q8IA 3HVTA 4YR2A 4B3MJ 1VQ5S 3RB4A 2VICA 1OQ6A 1U1MA 2XLJA 2DR5A 2G9OA 4MTPA 2OKQA 4ZITA 4NX9A 4WFBQ 4DR4F 2Y0SD 4QR1A 2D9OA 2DH9A 5KFGA 3QIPB 3NGKA 1SJFA 1VQ4S 2XM3A 3EX7B 3TW0A 3CCES 1U2FA 2AGQA 3HKZD 1BHNA 4FF3A 3DRPB 5J2MB 2CQ2A 2CQGA 2CQIA 4KV8A 2V8VA 2EFQA 2FHOB 1AZSA 2ZD1B 4DL6A 4KTQA 1KN6A 4J9UE 1QSSA 3CCVS 2D9PA 5EX3A 4JI5F 4MJKA 3MOZA 3OUYA 3IG1B 3H42A 2RQ4A 1HI0P 3R27A 4WE1A 3T6JA 3HVTB 1ROFA 3HFKA 2QA4S 2UUCF 3MAAA 1FXLA 3CT9A 1DLOB 1G7CB 4E98A 3C16A 4ES3A 2FZKB 3QGPA 1PO6A 4QYRA 2MLYA 4YHHJ 3JSRA 4I6AA 2QLJB 3WQPA 2XMJA 3E2EA 4BC9A 4Z7CA 3CCWA 1VQNS 3Q8YA 2ZE2B 3D28A 3ISND 4YFUA 2UUAF 1EX8A 4ZCMA 4KV8B 1NAQA 2WONA 3JAMU 3TOQA 4QOTA 1QJHA 2CPEA 5IFMA 2RT3A 4KQZA 3G6ES 2HFOA 4WPAA 2AHOB 4ED2A 4QBUA 1RBOB 2DR7A 4X65F 2XGQA 3QATA 3OUYB 1KVIA 1HQUA 4WE1B 4MKBA 4WFAQ 1XMOJ 3K5LA 1XNQF 4FP9A 1IR0A 5LJ5Y 4X4NA 1S57A 3C6UB 1DY3A 3Q83A 4U7UD 1U24A 1FHTA 4DR3J 2KDOA 2LQ8A 1NM2A 1SC4B 4NZ6A 3M2UA 3VTIA 1Q16B 4PRFA 2W8KA 2VUGA 4MIAA 2UU9J 4CDIA 5SZTA 5C42A 2CJQA 4ZJQA 4A8MP 2JVOA 1KOOA 3CJ3A 4HH1A 3O5TB 1EARA 2WONB 3R7SB 2CVEA 2KZMA 2RHQB 2BE2A 2G0IA 3CDEA 5I3QA 2EFPA 1CEZA 1IM6A 3L7PA 3KUHA 1IKXA 1RU2A 1J5OA 4ECSA 4PR6A 3DLGA 2VBXA 2X1BA 5KG6A 4LVNP 2QSFA 3TRGA 2HQDA 2RNEA 1KQGB 1KQSR 3N28A 3A8EA 4A47A 2XWXA 4X64F 4OI3A 5D6GA 2BVZA 1N34F 2FZCB 4B3SJ 2UVWA 2ZZNA 2VFVA 2I38A 2CPDA 4M5IA 5C24A 4KGKA 2UXCF 3M2UB 5L8RC 4Q43A 3PYEA 1T9WA 4NZ7A 1UJ4A 4JI2F 4ELVA 3LAKA 4IRCA 2BKPA 2BUNA 3D7SB 4UTGA 1QE1B 4JV2A 4P73A 2BE2B 1JX4A 4K4YA 1RT4A 1UFLA 2NXCA 4CYUA 5A2QU 3TEHB 2DKOB 4ZP7A 3BS9A 2E1CA 4BWMA 2U1AA 2G1HA 5LMNF 3MCSA 5IT9U
chains in the Genus database with same CATH topology
3IM8A 2UV8G 2JFDA 1NM2A 3HHDA 5DZ7A 2VZ9A 3TQEA 2QO3A 2PFFB 3TZYA 3PTWA 2HG4A 3R8YA 3QATA 3TZWA 5CZDA 4RR5A 3HMJG 2QC3A 2QJ3A 2C2NA 2VKZG 2H1YA 3TZXA 3SBMA 5CZCA 3H0PA 3CJ8A 3G87A 1MLAA 4RL1A 2VZ8A 2G1HA 2G2ZA 2G2YA 3EZOA 3TZZA 3HJVA 3K89A 2G2OA 3IM9A 3R97A 2CUYA 5DZ6A 3BV8A 4QBUA 2JFKA 3RGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IM8 A;  2UV8 G;  2JFD A;  1NM2 A;  3HHD A;  5DZ7 A;  2VZ9 A;  3TQE A;  2QO3 A;  2PFF B;  3TZY A;  3PTW A;  2HG4 A;  3R8Y A;  3QAT A;  3TZW A;  5CZD A;  4RR5 A;  3HMJ G;  2QC3 A;  2QJ3 A;  2C2N A;  2VKZ G;  2H1Y A;  3TZX A;  3SBM A;  5CZC A;  3H0P A;  3CJ8 A;  3G87 A;  1MLA A;  4RL1 A;  2VZ8 A;  2G1H A;  2G2Z A;  2G2Y A;  3EZO A;  3TZZ A;  3HJV A;  3K89 A;  2G2O A;  3IM9 A;  3R97 A;  2CUY A;  5DZ6 A;  3BV8 A;  4QBU A;  2JFK A;  3RGI A; 
#chains in the Genus database with same CATH topology
 3DLG B;  1HNX F;  2ZEJ A;  3PRV A;  2C3P A;  4LFC J;  4FS2 A;  1VHF A;  2N7C A;  2AYM A;  3EUN A;  5CZD A;  1VQP S;  4BDP A;  2W01 A;  1M5P C;  4DV2 J;  3TYT A;  1KS2 A;  2FPH X;  4ZCL A;  4DL4 A;  1T8E A;  2FLL A;  4RW7 A;  2I5J B;  5HMX A;  1MWQ A;  2LU2 A;  4PQU A;  1QD1 A;  1UCN A;  3M4X A;  4Z7Y A;  1APS A;  2NZC A;  1WF0 A;  1MU2 B;  4ZVQ B;  1H0H B;  3KDO A;  1NDK A;  1T7P A;  2DK2 A;  3SIP B;  3QZ8 A;  4V19 J;  5C24 B;  2APO A;  3GJQ B;  5JXS A;  2LFV A;  2CQC A;  3R1L A;  2RAQ A;  4JBC A;  2XNQ A;  3D6H B;  4XAK A;  1X60 A;  3BGO P;  1U1Q A;  4Y3C A;  1X4A A;  3I4P A;  1TTH B;  3VAI A;  2OPS A;  2IBO A;  4KHP F;  2DXF A;  5KFD A;  1W2I A;  3HSG A;  2R8H A;  2MKY A;  1RWM B;  2W2Q P;  3OVS A;  1TL4 A;  4B3T F;  1RT4 B;  3T6B A;  2HVI A;  2DIU A;  3TUI C;  4C8O A;  4FNI A;  1GX6 A;  4RNH A;  5ETT A;  2ZH4 A;  1HBO A;  2CQ0 A;  4X66 F;  9RUB A;  1U1P A;  4HTJ A;  5KG5 A;  2YVS A;  1LWF A;  4USH A;  1VC5 A;  2MST A;  1HNZ F;  3MFI A;  3DOL A;  3IS9 A;  5K8M A;  1E6Y A;  1J5E J;  2Q6C A;  5HI7 A;  2E5H A;  2QLB B;  3A1Y G;  4RW7 B;  1XMQ F;  4G65 A;  4PQU B;  1UZH A;  4PXB A;  2DHX A;  1N6Q A;  3N0V A;  5IXU A;  3GR1 A;  1M90 T;  3DU6 A;  1HNI A;  1K73 T;  5KT2 A;  3AY0 A;  3ZZR A;  2DH7 A;  1OYE A;  4HI1 A;  3GII A;  1D9A A;  3IWL A;  1MWY A;  1NCL A;  2ZH6 A;  2YBV A;  1H98 A;  5CQG A;  3UNG C;  2OPS B;  1FKO A;  3HSD A;  2XLI A;  4F4Y A;  2V6A A;  3CJ8 A;  1Y9O A;  4EZ9 A;  1YDL A;  3I31 A;  1L3K A;  1MN7 A;  2V34 A;  4A8X A;  3ZZ0 A;  1NND A;  1T0T V;  2QO3 A;  5HP1 B;  2KB2 A;  3SFU A;  5J2N A;  1HBO B;  2X3G A;  1SI9 A;  5AJ3 F;  2G1D A;  1K1S A;  4PQA A;  4Q45 A;  1KR4 A;  1V5I B;  4M5M A;  4O0N A;  3DOL B;  3IS9 B;  1UEV A;  4ZOS A;  3LTO A;  2JEJ A;  1SUQ A;  3OTE A;  1SL0 A;  2JLE A;  2OUG A;  2KFN A;  4EO6 A;  2GFF A;  4BCA A;  3EXC X;  1VC0 A;  2CQH A;  4CLW A;  4ZMM A;  1N6Q B;  1FKA F;  3QWP A;  2LQB A;  5L9N A;  1SKW A;  1I51 B;  2R9L A;  1HNI B;  1WSV A;  4KH0 B;  4NLO A;  3OFE A;  2FHJ D;  3D0I E;  2HHQ A;  3QLH A;  4DU8 A;  2MZT A;  4OX8 A;  2ZH5 A;  3P8B B;  3T1A A;  3NGR A;  1FKO B;  1RHQ B;  1DZ5 A;  1NUE A;  4CLL A;  3GZ7 A;  2NRE A;  1BXN A;  2J9E A;  3PM9 A;  2JFK A;  1QSY A;  3GFX A;  1YRT A;  3IBW A;  4LSL B;  3PJX A;  2N4C A;  4O4G A;  1F9F A;  5J2N B;  4FZV A;  1CC8 A;  3PDN A;  4J9R A;  3B4D A;  2BRL A;  1BWV A;  1UEK A;  1SUQ B;  1V5V A;  4FNH A;  1RI7 A;  3OXF A;  4AQY F;  3C6T A;  2V9W A;  2E5J A;  2BYC A;  3GYN A;  3D1Q A;  1HBM A;  2O1P A;  5LSO A;  3FFI A;  2F1F A;  4USJ C;  2RUS A;  5F8M A;  3KLH A;  2KFY A;  2LA6 A;  5G0R B;  2HVH A;  3P6Y C;  3RBE A;  2H9Z A;  2BM1 A;  2ZH8 A;  1VQ6 S;  1VIO A;  2ZZM A;  2LLZ A;  3MDF A;  2LU1 A;  3RBX A;  2J0W A;  3D1H A;  2Y9H A;  4OJH A;  1YJW S;  4N5S A;  4RU9 A;  5KFJ A;  2CPX A;  1SBR A;  3RRK A;  2NZ4 A;  1XK8 A;  2KI2 A;  2XY5 A;  3QGI A;  1GXU A;  4IH6 A;  4O4G B;  1CJU A;  4PG4 A;  1JXL A;  1PYS B;  4C8L A;  3Q23 A;  3ZXW A;  3WX8 A;  2UVR A;  4Y2C A;  5KFH A;  4N41 A;  2OTJ S;  3THV A;  4W4M A;  3HUL A;  2MQP A;  3BF4 A;  2HWH A;  1UVL A;  5ETL A;  1RYS A;  2G4B A;  2AX0 A;  3CJ4 A;  2OP5 A;  3HI9 A;  1LFP A;  2RDD A;  2C22 A;  2HVD A;  3NS6 A;  2IJR A;  1Y5N B;  3GJS B;  1ZA2 B;  2V68 A;  2UUB J;  1HBM B;  2YXL A;  1RAD B;  3W5Z A;  2DPI A;  1LW2 B;  4H54 A;  4ZVO B;  2V2K A;  3KLH B;  2QX0 A;  2OEL A;  1S72 S;  2YNH A;  2HUR A;  3CMA S;  3LAM A;  1WEY A;  1RT5 A;  4O0I A;  2IVM A;  5B0C A;  2HG4 A;  3MMC A;  4FYX B;  4ED3 A;  4ZVG A;  1TVR A;  5KG2 A;  3MF5 A;  4CO4 A;  1OY9 A;  3NBP A;  1SQE A;  5LJ3 Y;  1CJU B;  1XR5 A;  2MKJ A;  1GK8 A;  3T1H F;  4HEA 9;  1KWM A;  3RW7 A;  1RWO B;  4CP5 A;  2BM0 A;  3H5X A;  2VBZ A;  1B0V A;  2WZ1 A;  1TV6 A;  4CLF A;  2ZIT A;  1BUX A;  2VDH A;  2VH7 A;  5HJY A;  1HAR A;  1J2V A;  4TYA A;  3W2W A;  4LSN A;  3UR0 A;  2HQ3 A;  3ISZ A;  2GGP A;  4WKR A;  3J81 U;  4LVO P;  4FVM A;  1NPR A;  2JZ5 A;  2RKI A;  1NRK A;  3RBD A;  3KDN A;  5LT5 A;  1VMB A;  1JLB A;  2AF6 A;  3TZW A;  1EKS A;  4OHZ A;  2VD3 A;  2XMA A;  1L5U A;  1LK7 A;  3G86 A;  4F3O A;  5KTQ A;  2AJ0 A;  4JV5 J;  3T5J A;  2AIR B;  1K9M T;  1RT5 B;  3JSM A;  1AUD A;  4ZDN A;  2Y8W A;  3MMC B;  3MD1 A;  4AMN A;  1TVR B;  1ZAV A;  2HZC A;  1OSD A;  2GNK A;  2X51 A;  2Z56 B;  4LIW A;  2M3D A;  3G96 A;  3NBP B;  3V5R A;  3LWL A;  1NB2 A;  2W25 A;  3DN9 A;  4C3L A;  2MZQ A;  3W62 A;  2XNR A;  1DQ9 A;  1Q86 T;  3B4M A;  1D9F A;  1RAO A;  2UXD F;  4NYZ A;  4DPT A;  4A8W A;  4J9O A;  2HVE A;  4WF9 Q;  3TWZ A;  5DGB A;  2UVV A;  3W2W B;  2UVU A;  4LSN B;  2F4V J;  2GGP B;  1RWK B;  3NY0 A;  4L75 A;  4KPC A;  3DDN A;  4ZLL A;  4I0W A;  2EI5 A;  3BV8 A;  1SQF A;  4JI0 J;  4DV0 J;  2WCX A;  1JLB B;  2B0G A;  2J8A A;  1N52 B;  5LMU F;  1FI4 A;  1I5O B;  1ZH5 A;  1KNZ A;  1H7W A;  4QU7 A;  2C2N A;  4CLS A;  3V6D A;  1GTH A;  3OTB A;  2VJU A;  2MQO A;  2H5I B;  3UDV A;  1CUL A;  3VV2 B;  4EUV A;  2RD5 C;  5B0B A;  2ZJP Q;  2NSC A;  1D9D A;  2YNI A;  1SJQ A;  5KFF A;  1T9Y A;  5K8O A;  2RQK A;  1WD6 A;  2CXE A;  3SCK E;  1OO0 B;  4L6V 3;  2MKI A;  2VQF F;  1BWE A;  4C11 B;  4NXM F;  5D0R A;  4LR7 A;  1S0O A;  4LUB A;  3HFV A;  1IWA A;  1KVK A;  4URQ U;  2HPU A;  4TLR A;  1NDC A;  3CC4 S;  2V69 A;  5DQG A;  4EYH B;  1C1C A;  3DMJ B;  4EWT A;  3NNC A;  2MGZ A;  4J9P A;  2WW4 A;  3HVR A;  1JLG B;  4AL6 A;  1TUV A;  3KHH A;  3R5C A;  3HVW A;  4LSZ B;  2MJU A;  3V6D B;  1IBM F;  2JEG A;  1CQN A;  2HNY A;  3S6E A;  2A6M A;  1OMS A;  4DQQ A;  1CUL B;  3NEK A;  2JSX A;  2XLK A;  4RO0 A;  4V19 X;  5DDQ C;  2LQ5 A;  2Y0B B;  3JTN A;  2YNI B;  1S77 D;  2GO8 A;  2MQL A;  3QRP A;  2JEI A;  2PMW A;  1B7Y B;  1UP1 A;  2I8E A;  2DGU A;  4YP3 A;  1VYA A;  4MKA A;  1PKU A;  1FWL A;  3QGH A;  1Y11 A;  1XBW A;  1JJH A;  5D4L A;  4RUC A;  1WOO A;  2OMO A;  2F8M A;  2JWN A;  1RAE B;  2K2P A;  2MZJ A;  2IM2 A;  2B9X A;  5CZV A;  3H8Y A;  1UFK A;  2FHM A;  2D3U A;  4P75 A;  1TMJ A;  4F2R A;  2XZD B;  2NYH A;  5DQI A;  1IBL J;  4LFC F;  4ZPW R;  2V50 A;  3L7O A;  3QT8 A;  1NO8 A;  2EC0 A;  1S97 A;  4ITS A;  4CM2 A;  3OVB A;  1HBN A;  4MIW A;  5KFM A;  2UXB J;  2HNY B;  2AQ4 A;  1TKZ A;  5FD1 A;  1F2G A;  1RCX B;  4DX7 A;  3I82 A;  2V4J B;  4PG6 A;  2MQQ A;  1HWK A;  2MY8 A;  4C4W A;  3UD3 P;  3TAR A;  1Y5I B;  2ZJQ Q;  3BSN A;  3BEG B;  2HW3 A;  1IKW A;  2VPZ B;  2Z58 B;  3MEC A;  2JLF A;  3DC2 A;  1IXK A;  2N3L A;  1U1K A;  4RUH A;  3BSO A;  2X1A A;  1U49 A;  4HH0 A;  4FPI A;  5LXR A;  2GAH C;  3NP5 A;  4DV7 F;  4MMO A;  4P7V A;  3IRW P;  4IFY A;  4EYI B;  2Y1R I;  3UN3 A;  1GAO A;  2V8P A;  4NLS A;  2MXY A;  4U96 A;  4RNF A;  2HHX A;  2ZBC A;  3H7H B;  4OHY A;  4P74 A;  1D8Z A;  3HT0 A;  4DFK A;  1NJI T;  3THP A;  3MCN A;  3FBF A;  3A3O B;  3BH6 B;  3MFH A;  1AT1 B;  4FKX A;  5MLC V;  4DSK A;  2HBR B;  2DRD A;  4JI4 F;  3C15 A;  4QZV B;  1U25 A;  1T3N A;  1FRM A;  5DG8 A;  1NK0 A;  1HBN B;  4LRC A;  2NS1 B;  3QAU A;  5F8L A;  1TKZ B;  3FVY A;  3NGS A;  4H4K A;  1HYS A;  3C14 A;  4KE5 A;  1IN0 A;  4CM0 A;  1Q5Y A;  2MZ1 A;  3TAP A;  5CCL A;  2JDJ A;  1Q7L B;  4B9V A;  1IKW B;  4ZLN A;  2ROE A;  1HIY A;  1RBA A;  3I9V 9;  2IY5 B;  5D4P A;  4I67 A;  3MEC B;  1D3W A;  2AD9 A;  3JS9 A;  4KR0 B;  2EK6 A;  2LEB A;  1FK9 A;  3KK3 B;  2CKW A;  2KYX A;  5KOW A;  2XBP A;  4PCQ A;  2HZA A;  3QYY A;  1AYE A;  1HW9 A;  5F8J A;  2CJ9 A;  1YGY A;  4ED7 A;  3PW2 A;  2H4Y B;  2DIS A;  4A4J A;  2WVB A;  4IFY B;  4KGM A;  2LEA A;  1ITP A;  3BO4 A;  2NPF A;  4UST A;  2OHD A;  2XB2 D;  2VBY A;  2MQ8 A;  5C2G A;  3M32 A;  2F3J A;  1BC6 A;  2JHE A;  2CPZ A;  3CCU S;  2EXU A;  4P7T A;  3I5B A;  2B7C B;  3TEG A;  3CJK A;  4DPU A;  1S9E A;  3H98 A;  2GCF A;  2LEC A;  4AD6 A;  4YB7 A;  1IWG A;  2ACM A;  3C15 B;  2OFH X;  3NOG A;  1JLQ B;  4XK8 C;  2XMK A;  2ATC B;  5HBM A;  2YPY A;  1B64 A;  3D1O A;  5E5N A;  4YEA A;  1HYS B;  3C14 B;  4BHQ A;  2RE1 A;  4ZS6 A;  2QA4 G;  4ILR A;  3W64 A;  3GIL A;  3LP2 A;  4U67 Q;  2NCK L;  1FK9 B;  1XTZ A;  3TVZ A;  3OJS A;  3UCU P;  4ZHR A;  4DR2 J;  4DV4 J;  3CVK A;  4LRF A;  4K4X A;  1VI7 A;  2DGW A;  3H20 A;  4RBV A;  3ZFV A;  4QWD A;  1SL1 A;  3M6W A;  1FRH A;  2FVS A;  3W9J A;  3K8V A;  5E41 A;  3C46 A;  2CJK A;  3MM8 A;  2ZHO A;  3M32 B;  5D0E A;  2CRL A;  4IH7 A;  1X5S A;  4Q0B A;  3K58 A;  1PIE A;  3CJK B;  1FTC A;  1S9E B;  1LQ9 A;  5HO4 A;  1G1X A;  3SQG B;  2O5D A;  2P2C B;  1YJR A;  4OHX A;  4DPO A;  5F0W A;  5CAA A;  3HKW A;  3R8Y A;  1TQL A;  5HBM B;  1C4A A;  2YKQ A;  2W7P A;  3PIO Q;  1TK0 A;  2KTQ A;  3B78 A;  2WOM A;  5J1P A;  2BJ1 A;  2AZ1 A;  2ASD A;  4USV A;  1U47 A;  5CYJ A;  2JC0 A;  3LP2 B;  3JB9 k;  1DHM A;  5ITH A;  4L76 A;  3LPE A;  3EXY A;  2OEJ A;  4ZHR B;  2GIR A;  5K9F A;  5E33 A;  2MZR A;  2HK2 A;  3A8I A;  3KOA A;  2RHS B;  4PAB A;  5KFX A;  4OYW A;  3L7U A;  2QG9 B;  2E7V A;  3NWG A;  1FXD A;  1IKV A;  4F0M A;  1N32 F;  5I4M A;  3G8T A;  3PW5 A;  2B9Y A;  3A3N B;  3J7A 1;  5GAG I;  4EU0 A;  4A8F A;  3MM8 B;  2FZG B;  4DR1 F;  3FBB A;  2BW2 A;  2JRS A;  4NLV A;  4TU9 A;  2CNN B;  5D78 A;  2HFZ A;  3UCG A;  1UL3 A;  4BLG A;  5F9N A;  4RZR A;  3VAG A;  5CXT A;  2BJ3 A;  4Q0B B;  1ARO P;  4I7F A;  4HHH A;  3M8W A;  3D66 A;  2VU5 A;  2D3O 1;  1UVJ A;  4ECV A;  4F02 A;  4MKY A;  2PFD A;  1X5P A;  2N82 B;  2DIT A;  3HHK A;  4ZPB A;  3KG1 A;  2XMU A;  3UDE A;  1C1B A;  4BC7 A;  2FHK A;  3MMJ A;  2MKC A;  3CCM S;  4K4V A;  3NCR A;  4Z37 A;  1SC3 B;  4O4R A;  1WF2 A;  3NWR A;  5DZ7 A;  1IR1 A;  4CH7 A;  1YJT A;  2F9D A;  4DSI A;  1PBU A;  5GAG U;  3EDQ B;  3RZA A;  5T41 A;  2ATL A;  1N5T A;  3MUR P;  4RBT A;  3QID A;  1NJX A;  2PA3 A;  3RU0 A;  5J2Q A;  2GW8 A;  4WJB A;  1IKV B;  3E3X A;  1VQO S;  2R4F A;  2V4R A;  1XMB A;  3PRB A;  5CA5 A;  4JI1 F;  2C2R A;  3BKU A;  2CQ1 A;  3R5J B;  3NS5 A;  4YDD B;  5D4N A;  3D67 A;  2DGT A;  3RJM B;  3CJ5 A;  1ZM2 A;  2P9E A;  4TY8 A;  1GNK A;  1FFS B;  5KFP A;  2XYH B;  2L08 A;  2BOA A;  4L3N A;  2AX1 A;  4I7F B;  5KFC A;  3U7J A;  3HMJ G;  3ZTO A;  3Q2T C;  1RLD A;  4LF9 J;  4RKU C;  3TX0 A;  2AJQ A;  4Y65 A;  1C1B B;  2J76 E;  2A2D A;  3O44 A;  4ER8 A;  3TA1 A;  3DLJ A;  5M2P A;  2VB6 A;  2DNM A;  1R0A A;  4B08 A;  4KIA A;  3GSI A;  1GTE A;  5DET A;  4K0K J;  4OL8 A;  3PFE A;  3R9L A;  3AD8 C;  3R3T A;  2EFV A;  4MFB A;  3WX4 A;  2VJV A;  1ICE B;  3N79 A;  5J2Q B;  3AA9 A;  4OX7 A;  5F8G A;  2Z57 B;  5FDL A;  3I87 A;  1WOS A;  4AXI A;  1RHJ B;  4JB8 B;  4I4B A;  2XZW A;  2K7J A;  2OH2 A;  2GX8 A;  3PHE A;  5AXK A;  3HO1 A;  3IBF B;  4TY8 B;  3D5M A;  4TN2 A;  1YSJ A;  2M4M A;  5AXM A;  2AV5 A;  2K3K A;  2FJA B;  3ELH A;  1TK8 A;  2FYX A;  1WHV A;  2MEW A;  2J9C A;  3PXG a;  1FX4 A;  3OFH A;  4X4V A;  2HIQ A;  1OJ4 A;  2I6W A;  2EPI A;  2E5L J;  1N8R T;  3TAM A;  5CH7 B;  4DUZ J;  2ZDP A;  4H4K C;  1R0A B;  4DV6 J;  5HJX A;  3GIM A;  1KHW A;  1R0B G;  4K5S A;  2VFS A;  1WDD A;  1YBU A;  4KPY A;  3KTQ A;  2DIV A;  2QEX S;  2KXF A;  3M9N B;  2CNL B;  3O8W A;  1REV A;  1WG4 A;  3B6B A;  4F4Z A;  3GQC A;  2HBQ B;  3R2D J;  1JKH B;  5FDL B;  3D0H E;  1X9W A;  4PKD B;  2ZC3 A;  2W2O P;  3GIK A;  2XMV A;  2RS2 A;  3EGV A;  1GFW B;  4DR4 J;  1DFD A;  2EC2 A;  3OBI A;  2GHP A;  1JJC B;  3AJD A;  2YWF A;  5HVG A;  2AJF E;  3L4B C;  3QGG A;  1HD0 A;  4CLY A;  3UE2 A;  2E7X A;  2KHD A;  1VCT A;  4WTO B;  3QFH A;  2E7W A;  2IRY A;  2R7O A;  4F67 A;  4L73 A;  4WFN Q;  2IRU A;  4MYU A;  3I4H X;  3HX9 A;  5KT3 A;  4PXD A;  5HAO A;  2B4O A;  4RX6 A;  4JI5 J;  2IAJ A;  2YY3 A;  1REV B;  1YVF A;  2WVF A;  1KTV A;  3TJ8 A;  3W65 A;  1YLX A;  5M2R A;  4RUA A;  4XDC A;  1WG5 A;  1QSL A;  3ILO A;  2RH3 A;  4C8N A;  2AGP A;  2UUC J;  1RA6 A;  2BJ8 A;  3GCW P;  1LV5 A;  3PTW A;  1VRT A;  3HZG A;  4GMK A;  3DCA A;  3G6V A;  1JB0 C;  4TXS A;  2G0C A;  1B0P A;  5EDW A;  1UET A;  5H9E J;  5EHH A;  4C0B A;  1FNO A;  1HR0 F;  4ECR A;  4ANE A;  5IM0 B;  1SKU B;  3LGM A;  2FVP A;  4DXL A;  2D3Z A;  3N6M A;  2BOP A;  5IS2 A;  4Y34 A;  1VQK S;  3H5S A;  1IKY A;  3T1Y F;  5HLF A;  2D41 A;  3KWM A;  2E29 A;  5LSR A;  3KHL A;  3AJ1 A;  2UUA J;  4K4W A;  2BR0 A;  4J37 A;  4ZP8 A;  4LF2 A;  4LR8 A;  4M8L A;  2V5H G;  1VGY A;  4GKK F;  5F0U A;  4RUB A;  2FLN A;  1HBU B;  1UJ5 A;  5ETN A;  4KB7 A;  3RR7 A;  1QVF R;  3WDO A;  2J9D E;  4X65 J;  5DO2 A;  3NOC A;  2GQQ A;  1LEO A;  3H2L A;  3DOK B;  5K20 B;  3NMA A;  1KSP A;  3TQ1 A;  2P6S A;  1VRT B;  4IOC Q;  1N0U A;  1WC0 A;  3IN5 A;  4ZK7 M;  2YNG A;  4OZ3 A;  1XNQ J;  4KBI A;  3VGU A;  1GXL A;  3HLU A;  3FRZ A;  3J7A N;  2VFU A;  2V8H A;  2WVC A;  2B43 A;  2FTR A;  5J2P A;  4DX8 H;  4QQB A;  2JVR A;  3TUJ C;  5FJ4 A;  4PAA A;  4WP9 A;  1IKY B;  5KFV A;  3OR2 A;  4N56 A;  1RT1 A;  3MMA A;  1M5O C;  4C3M A;  5C2C A;  2N7Y A;  4LFB F;  1JLE A;  2YWH A;  1V6H A;  3K89 A;  2EG1 A;  1FJE B;  4YDX A;  2AJ2 A;  4X62 F;  1AFI A;  4QIG A;  4DQR A;  5DJB A;  4OMF G;  5L9X A;  3H4B A;  4RW4 A;  3IR6 B;  4A48 A;  2ZOF A;  1BQX A;  1FDB A;  3ICL A;  2DCU B;  1Q0N A;  1Q78 A;  1D0E A;  4HYK A;  2XGP A;  3CW2 C;  4LRA A;  2C2E A;  5HK4 A;  2J7U A;  4CIO A;  3PX0 A;  3W66 A;  2WW8 A;  2NQP A;  1KEK A;  1OWX A;  4PXC A;  4X64 J;  5L1K A;  2RIJ A;  2YNG B;  2HGL A;  3W61 A;  3PW4 A;  1N34 J;  3IAS 9;  3NXZ A;  2DT9 A;  3LH2 S;  2KVQ E;  2C2O B;  4X4Q A;  1X31 C;  4ZVU B;  3ENA A;  3U02 A;  4G1I A;  4ZPA A;  2LEP A;  2FVR A;  1HNV A;  3JQM A;  4ID8 A;  2UXC J;  2CNO B;  2W8L A;  3HCX A;  3CC7 S;  5KFS A;  3FQL A;  1UVK A;  3OR2 B;  3R6G B;  1RT1 B;  4CH0 S;  3MMA B;  3TAN A;  2VPW B;  4JI2 J;  2DGX A;  3VR1 A;  1JLE B;  2RDJ A;  2IJF A;  2V67 A;  2ZM6 F;  5IT4 A;  2ZHA A;  3FNN A;  2MYF A;  1C2P A;  4F7V A;  2EBE A;  1RT6 A;  2JH3 A;  3UQS A;  2M0G B;  7AT1 B;  3FEX B;  4FKY A;  2OGU A;  3CJQ A;  3WIV A;  3UDL A;  1U4B A;  4RW4 B;  5BJR A;  5F8I A;  4K8R A;  2BW7 A;  4E8U A;  2HNZ A;  1RQ0 A;  5LMN J;  2WB4 A;  4ED4 A;  4FPR A;  1HNX J;  1LWC A;  1M1G A;  3P5T L;  1N48 A;  2NSB A;  3FZB A;  4UUW A;  3FCW A;  1U7L A;  1RK8 A;  2VG6 A;  2CAD A;  2WK4 A;  5KFW A;  1WOP A;  1B4S A;  2AEF A;  3AOC A;  1T11 A;  1H6K X;  3J7Z T;  3CXC R;  2Z2Y B;  2HQG A;  1RHU B;  4G1P A;  3ZZY A;  2YWE A;  4U9R A;  4DV3 F;  4DV4 F;  1HNV B;  3RB0 A;  4OYX A;  2EK1 A;  2E9Z A;  2AGO A;  4F04 B;  4USK A;  3WC2 A;  5D77 A;  4BS2 A;  1HPZ A;  4J9V A;  1VOM A;  1M0S A;  4KHP J;  2BAC A;  4OX9 F;  2CNK B;  4HAC A;  1RJJ A;  3MR3 A;  1URN A;  4OI4 A;  3LAL A;  4L3K A;  1RT6 B;  3QSI A;  4QWC A;  4QWA A;  1KQF B;  2BBE A;  4B3T J;  3RTV A;  4UZC A;  4ZLP A;  2HNZ B;  4ZN1 A;  4O23 A;  3KJF B;  2NXJ A;  1TKX A;  4P72 A;  2Z30 B;  4P52 A;  4X66 J;  1LWC B;  2PE8 A;  4RWW A;  4ELT A;  5F3T A;  4KYZ A;  4OLP A;  3HZE A;  2CJX B;  3PCO B;  3MAQ A;  2VG6 B;  5L39 A;  1HNZ J;  3H2V E;  3RW6 A;  4WYL A;  4NRU A;  3S8S A;  1XMQ J;  3DLH A;  1UAW A;  1S4F A;  3VF0 B;  2PT0 A;  1VQ8 S;  3OD2 A;  2COL A;  1TFY A;  2C3O A;  3DRS A;  3JSY A;  2BX6 A;  3OV7 A;  2FGC A;  4O3Q A;  3M1V B;  3DLL Q;  4ZLJ A;  1HPZ B;  2Q3P A;  1YZ7 A;  3DGV A;  2XHC A;  2BJE A;  2ERR A;  4EBC A;  1UMJ A;  2OFG X;  2EBG A;  1JIH A;  1JXE A;  1U09 A;  1ZM4 A;  2KVI A;  4HAC B;  1NK9 A;  1X0P A;  3VGS A;  1RXO B;  1T05 A;  3LUY A;  3RYL A;  1X4B A;  3OXL A;  1JJ4 A;  3PO4 A;  3RAM A;  4NXN F;  2QGF B;  3DLE A;  1NHU A;  1YBT A;  2V94 A;  3DRX A;  4O3S A;  3ZO7 A;  2H5J B;  2K1R B;  5KFA A;  1TKX B;  4NAS A;  3TI0 A;  4DEZ A;  3SFG A;  5K14 A;  5AJ3 J;  1ACM B;  4ECQ A;  2ZVS A;  1TAU A;  1PAU B;  2XEX A;  2QT7 A;  3CWJ A;  3GV5 B;  3W8P A;  1UEU A;  4OQJ A;  3NCP A;  1A9N B;  3QJP A;  2QJ3 A;  5HMZ A;  3M9O B;  2HLU A;  5J1N A;  5LL6 d;  1TFW A;  2QIF A;  3KHR A;  1EIY B;  2G0J A;  4DFM A;  3Q86 A;  1S0N A;  5A0Y B;  4CI0 B;  2ALZ A;  2UP1 A;  1FJG F;  3SV3 A;  1QM9 A;  3HJF A;  3JTO A;  4DBQ A;  4ZVR B;  2ZC4 A;  3PFO A;  2DNR A;  3DRS B;  1AFJ A;  4EI2 A;  1R0C B;  2IVY A;  1PSD A;  1S6Q B;  1B3T A;  4FF1 A;  2ZUA A;  1RBL A;  3AHP A;  4LBP A;  5CYQ A;  2VIH A;  2VQE F;  2J0S D;  1Q5V A;  1T05 B;  3DM2 A;  3EM1 A;  2G2Z A;  3TZZ A;  3V4I A;  5A6P A;  2ZH2 A;  2C3M A;  1RT3 A;  4UOG A;  1FEH A;  3DDK A;  3UD4 P;  3DLE B;  4ZVF A;  4Y2K A;  1V9O A;  4AMM A;  3A8J A;  5KAK A;  2BE7 D;  2RDI A;  3D2W A;  3KK1 B;  1I3O B;  2YX7 A;  4UOC A;  1CQM A;  3TA0 A;  4AQY J;  1FJ7 A;  3Q8U A;  1L3T A;  2QLF B;  1RT7 B;  5KG7 A;  1A0O B;  4NLD A;  4DR7 F;  2XS2 A;  3ETO A;  1WTB A;  2HLT A;  4DCJ B;  1YJV A;  2KL8 A;  1M1H A;  4DI6 A;  1RKI A;  3QJL A;  2PC6 A;  2HSE B;  2ZOM A;  5CYQ B;  3PX6 A;  4NA1 A;  4LF5 F;  3DM2 B;  3T3F A;  1WEZ A;  4MK7 A;  1NZA A;  4ZKA A;  2BDP A;  3K5M A;  1UWB B;  2W9C A;  2VFR A;  2MHE A;  1VHI A;  3KMQ A;  3HFZ B;  4QR2 A;  1SH2 A;  1NB7 A;  3HM9 A;  4NCG A;  4B02 A;  1K47 A;  2RQC A;  1BY9 A;  4K2X A;  1S48 A;  3ZZU A;  4Q8F A;  4NRT A;  2MY7 A;  3DRP A;  2VOO A;  1R27 B;  2KJW A;  5L1J A;  2FVC A;  1VRU A;  4C8K A;  3P3D A;  1O51 A;  2FJB B;  5A8K B;  4CWB A;  2EWH A;  3H5Y A;  1DAX A;  3KUG A;  4FXV A;  3AJ2 A;  3QT6 A;  4IG3 A;  2GZO A;  1N33 F;  3B82 A;  3KUE A;  3M6X A;  5AT1 B;  2RRN A;  4ZCK A;  2DNO A;  5HSP A;  5I42 A;  1JLA A;  5A76 A;  2NYI A;  4WXO A;  2F9J A;  5ETO A;  4U7U K;  4F4A A;  3M8S A;  3AQO A;  2R7U A;  2H3E B;  1S79 A;  1SXL A;  2HAF A;  4USU A;  1KRP A;  2RJZ A;  2BJ9 A;  2V0N A;  3PYG A;  1DLO A;  2E9T A;  2DNK A;  3DU5 A;  3VQT A;  2W9C B;  4USI A;  1F5B A;  2UUT A;  4DSE A;  3EWG A;  1P9Q C;  4NCG B;  1NEE A;  3T1H J;  1FRJ A;  4V1A k;  4DCP B;  2GA7 A;  1HHT P;  1GT8 A;  4DV5 F;  2JJ4 D;  3H4D A;  2ZE2 A;  1WWH A;  1VRU B;  3AOA A;  5DM7 Q;  4YR0 A;  3HHL D;  1I94 F;  3P4U B;  4U6P A;  1PJ5 A;  2ADC A;  4UF4 A;  1EAY C;  3LPY A;  2PI4 A;  1HHQ A;  4Y00 A;  2ZWO A;  2DB1 A;  4IG3 B;  3PHT A;  4K5R A;  3IWX A;  3PJW A;  1RA7 A;  2FC9 A;  5I42 B;  1JLA B;  1QTN B;  3LP0 A;  1DJ0 A;  4DUY F;  5L38 A;  3VWS A;  3CDU A;  1FTR A;  3PYD A;  3GSD A;  2KXH A;  4C8Z A;  2LKZ A;  1TR0 A;  2POK A;  4CT9 A;  1SJ4 P;  2DBB A;  4JUZ A;  3Q8S B;  3UDC A;  3SDE B;  1TKT A;  3M6V A;  1Y4Z B;  4TVA B;  3N9U C;  4R5P A;  2AYG A;  2HVZ A;  2IBK A;  2QL7 B;  2YX4 A;  4Y2I A;  2BV3 A;  3U27 A;  2MDA A;  2GMJ A;  3AA8 A;  3C6U A;  2ZDO A;  5B0A A;  4J91 A;  4NPO A;  3TR5 A;  4DPW A;  3ISN C;  4OJ1 A;  4QJV A;  1RIS A;  3CCQ S;  2UXD J;  3J7Z 5;  2IA0 A;  1S6U A;  4ES1 A;  5GAD I;  3I0S B;  3AXK A;  4FYD A;  4MYT A;  1FNX H;  3MTJ A;  2CFX A;  3KLE A;  3ILI A;  3QT5 A;  4ALZ A;  3J81 j;  5ETP A;  3GIJ A;  2YQ3 A;  3H0P A;  2DXE A;  5KFB A;  1CBK A;  1YTY A;  1FO1 A;  2OEK A;  3OHA A;  3QO9 A;  3LP0 B;  4A8S A;  3IO1 A;  3OL7 A;  1S1V A;  5LMU J;  4J9N A;  4NML A;  1DQ8 A;  3NMR A;  5HN0 A;  4FXW A;  1T03 A;  3DLB A;  2EFN A;  3L9Z A;  4QIF A;  1TKT B;  3V81 B;  4LRB A;  2BMB A;  1NKC A;  4TYB A;  4R5P B;  6AT1 B;  2GAG C;  2NUH A;  3BSC A;  5BYR A;  2EKN A;  5GAD U;  4C2M A;  2DNH A;  4EGL A;  5G4D A;  1Z2Z A;  4HR2 A;  3CDB A;  3KG4 A;  1Q95 G;  3W7B A;  1HNW F;  1UVM A;  1YRX A;  4YN3 B;  2CQP A;  5BR8 J;  1FFW B;  3A4T A;  1ULR A;  2CG8 A;  3HXM A;  2BRK A;  2QMW A;  2VQF J;  1ZTW A;  1X9M A;  4NXM J;  1WC1 A;  4WZQ A;  3KLE B;  1QE1 A;  1IUJ A;  2PD1 A;  4RR5 A;  3PR5 B;  1VS3 A;  2CA9 A;  1YJU A;  1GQE A;  2KFZ A;  2E9R X;  3FBC A;  2ZBP A;  4JOU A;  4UZB A;  3QO9 B;  1FRK A;  4LJM A;  4XPC A;  3MEE A;  1O6X A;  1T95 A;  1S1V B;  1NK5 A;  3BH7 B;  3PEH A;  3JQK A;  4ENO A;  2DNY A;  2KT2 A;  1T03 B;  2MKK A;  1VQ9 S;  2R3V A;  5E3P A;  2V8D A;  1IBM J;  1WNE A;  4R0E A;  4UT4 A;  4RJV A;  2I5J A;  2XCP A;  2J6U A;  3OFG A;  1DUR A;  1HL6 A;  1MU2 A;  3TJ9 A;  4DR6 F;  1JXV A;  1F9H A;  2FJX A;  2O01 C;  4HLB A;  2DO4 A;  3BN7 A;  2XWY A;  4MH8 A;  4DLE A;  2VPY B;  3CCZ A;  1FRI A;  1R6V A;  2HHU A;  4WK1 A;  4X4P A;  4DG1 A;  4ZJO A;  3OTC A;  1SB6 A;  1PJ7 A;  4TQS A;  4FVC A;  5H9F K;  4TQR A;  1Y5L B;  4OFZ A;  1KFD A;  4DV1 F;  5IZH A;  4C7Q A;  4C48 A;  3M8Y A;  5HL7 Q;  5ETK A;  2EG2 A;  3MEE B;  5HRO A;  3MM5 A;  4D3H A;  3MMB A;  5JUM A;  1A7G E;  2BJD A;  3C8Y A;  3N6L A;  3CF5 Q;  4UY8 5;  2VOD A;  3MI7 X;  3EDR B;  1VQY A;  3Q24 A;  2QV6 A;  1LXJ A;  2QA1 A;  4ECT A;  1WHW A;  2I2Y A;  3M8Q A;  1G6B A;  2DRB A;  3BO3 A;  4RNO A;  2BKO A;  4OZL A;  1FRL A;  2O66 A;  3FBE A;  2ABY A;  3N6N A;  1ELO A;  4XTT A;  4YUD A;  1VBK A;  4QWE A;  1HA1 A;  4LF4 F;  2B6A A;  3VQS A;  1DRZ A;  3BRE A;  2W2M P;  5L46 A;  3PKY A;  5DG9 A;  1NLK L;  2CPY A;  4FN5 A;  4DV7 J;  2KH9 A;  3HT3 A;  4ID5 A;  3D6M B;  4DG1 B;  5LSL A;  3PYF A;  2AWZ A;  2K8G A;  3CCL S;  4C0H A;  3KG0 A;  4JI3 F;  5HP1 A;  3G6X A;  2EVZ A;  4U95 A;  3HP6 A;  5HRO B;  4ZPC A;  3MM5 B;  3NGT A;  4DSF A;  3MMB B;  1RCO B;  5CD4 A;  6FDR A;  3G2X A;  4JI4 J;  2FVQ A;  3GU0 A;  4C8Y A;  3NL0 A;  2E1P A;  5D3G A;  5C25 A;  3MUT P;  3M8Q B;  2VZ9 A;  4OJG A;  1NJZ A;  1VBX A;  1RP5 A;  5ETQ A;  3GIR A;  4NI2 A;  2OPR B;  2H5E A;  1TMM A;  4NA2 A;  5E3A A;  4RL1 A;  3PRD A;  4RBU A;  1JLF B;  1S9G A;  1PJ6 A;  4ANC A;  3NS7 B;  3OPK A;  1OPZ A;  2IM1 A;  3TVY A;  1NME B;  2B6A B;  2PN6 A;  5J1E A;  3MTK A;  2F7V A;  1NPK A;  4ID5 B;  1H74 A;  4CQ1 A;  2IDL A;  5ETS A;  5D0G A;  1HWU A;  4CO0 A;  1OS5 A;  1MG7 A;  2M70 A;  3FCH A;  1XWL A;  4ETX A;  3NRB A;  4LSL A;  1SL2 A;  1VLY A;  3IRX A;  5RUB A;  4KGX B;  2E66 A;  2XY7 A;  3RB3 A;  1R31 A;  3SSS A;  1UJ6 A;  1U48 A;  3WZ0 A;  4NEZ A;  2V4Q A;  2R7X A;  2PSZ A;  4PWU A;  1TK5 A;  1XIQ A;  1B70 B;  3BKF A;  1TL1 A;  4K7Q A;  4HT7 A;  5D3G B;  2WAQ D;  5C25 B;  5KFR A;  5KOX A;  1FWK A;  1GMW A;  1WEX A;  1EHW A;  3MCO A;  1CJT A;  4ZA1 A;  4NI2 B;  1FE4 A;  4LF6 F;  2MHN A;  2MSS A;  5G0R A;  1S9G B;  1KLN A;  4KC5 A;  1FDD A;  4AL5 A;  1RKJ A;  3GE9 A;  4EZ6 A;  3OVA A;  5DS7 A;  5J1E B;  3UI3 A;  4QR0 A;  3F56 A;  4DL2 A;  1ZA1 B;  5FLX Y;  2J7W A;  2CPH A;  1X9S A;  1CVJ A;  4E0D A;  3IRX B;  2HGM A;  1AXQ A;  8RUC A;  3OTO F;  2CQ3 A;  1FJC A;  3QRR A;  2B7B B;  2HHV A;  2UV8 G;  1ZAX A;  4WFX A;  1FFG B;  1WKL A;  4LR9 A;  4LF1 A;  1TL1 B;  3QRQ A;  5KFZ A;  3VVU A;  4GVB A;  2PEH A;  4I56 A;  5EUH A;  3EGZ A;  4KHM A;  2EFO A;  3RAQ A;  2ZH1 A;  1ZAW A;  1CJT B;  2A1B A;  1RWV B;  2K7K A;  5L1I A;  1KOH A;  1LW2 A;  1K0T A;  1Q82 T;  1NJW A;  1XR6 A;  3OFF A;  1NDP A;  1H73 A;  1WKJ A;  4JYA F;  2HWT A;  1EQ0 A;  1AUS L;  2N3O A;  3T9N A;  1N32 J;  4YY3 F;  2XSJ A;  3FQK A;  3Q22 A;  3H40 A;  4ZN3 A;  3D3B J;  4DR1 J;  5A6W A;  4WU3 A;  4F2S A;  1NSK L;  1RAI B;  1M1K T;  1Q81 T;  4CTA B;  1H72 C;  5KFK A;  4NA3 A;  2HWI A;  1YX2 A;  2XYG B;  5HQ8 A;  2QA2 A;  2HBY B;  4NLG A;  4GKJ F;  3MR6 A;  2YX1 A;  4U7C A;  1HD1 A;  4ETZ A;  2FJW A;  2AJ1 A;  2RF2 A;  3GV7 B;  3MM7 A;  4GVB B;  1WG1 A;  5H1S V;  4X4R A;  2NPI A;  3RGI A;  2CJY B;  2IA6 A;  2B5J A;  4AMP A;  4F8R A;  1S6O A;  3GG0 A;  3W3S A;  3IGN A;  4QYZ J;  1YWX A;  2DNL A;  4F50 A;  1SPB P;  1B0T A;  1OSC A;  1TZ0 A;  2IJN A;  3PW0 A;  2R2S A;  1F5A A;  1TU0 B;  3FMB A;  2IIH A;  1TL3 A;  1Q7Y T;  1P6T A;  5HAN A;  1HFE L;  3KNG A;  4JI1 J;  1S1X A;  2XSJ B;  1XJW B;  2GIF A;  1LFW A;  2V2Z A;  3LQV A;  3RUB L;  2WSC C;  1J27 A;  1NZ8 A;  4J9M A;  2F65 A;  3PAC A;  1VBY A;  4ZPV R;  4PZV A;  2A10 A;  4M5L A;  2WBM A;  1I1G A;  1VDH A;  5BYS A;  2ZH9 A;  2HMI A;  3ILL A;  1S49 A;  2LXF A;  4FDF A;  3OR1 A;  3GJT B;  1WJ9 A;  2RF2 B;  4ICL B;  4FYV B;  4Q7A A;  3MM7 B;  4PG7 A;  1YJ7 A;  3MWB A;  4OZN A;  2LCW A;  3OXG A;  2GJI A;  2B5J B;  4OZ2 A;  1ZPV A;  2KG1 A;  2GHV C;  2YQ1 A;  1UA1 A;  1WC5 A;  4XO0 A;  3DXB A;  2YH1 A;  3OL6 A;  2L3M A;  3S1T A;  1TL3 B;  2H48 B;  4M5J A;  4NLP A;  5KFY A;  1S1X B;  4TKT A;  2CPF A;  2RRB A;  2W2N P;  3LGN A;  3QAE A;  1FDA A;  2Q43 A;  3MUM P;  4PYA A;  4FYW B;  1F6T A;  3I32 A;  4URG A;  3CMQ A;  2XS5 A;  5IWA F;  3HK2 A;  3IMQ J;  4PYD A;  4KGZ B;  4YS2 A;  2ZHB A;  2HMI B;  2VZ8 A;  3VAM A;  1TL7 A;  1VBZ A;  4ILM A;  3M8P A;  4AT1 B;  3OR1 B;  1WC6 A;  2KKH A;  3ZTP A;  4C11 A;  2ZBQ A;  2R8K A;  5HQM A;  3OW2 R;  1RB0 A;  1Z2L A;  4CO1 A;  3WHI A;  4N8N A;  2IM3 A;  2QC3 A;  1CS4 B;  2AW0 A;  3FSI A;  1UPP A;  3ZTS A;  2XTJ P;  3PO5 A;  4J7C A;  2E1A A;  2DR8 A;  1BQN A;  2BEF A;  4F4W A;  3DMJ A;  1KLM B;  4ZP9 A;  3PNI A;  3EZU A;  3MPD A;  2ACY A;  1T3O A;  1Y7P A;  4JI6 F;  1X5O A;  3SV4 A;  5B0E A;  3EIC A;  4NZ0 A;  1JLG A;  3J80 Y;  2DYA A;  4W98 A;  2B8P A;  2QN6 B;  4WYW A;  2L9D A;  1N54 B;  1S1W A;  4R8U A;  1REG X;  4AXJ A;  2DHA A;  2DGV A;  1L3V A;  5T7L A;  3OQ2 A;  3MXH P;  1O5J A;  5BR8 F;  4DZD A;  1TL7 B;  3KLV A;  3M8P B;  3H2U B;  4CZC A;  1A6L A;  2HND B;  2Z0G A;  3CCJ S;  1NH7 A;  3KLG A;  1QY7 A;  4CO3 A;  5KG0 A;  1VR6 A;  3CD0 A;  3LP1 A;  2HHH F;  3EJM A;  2BQR A;  1BQN B;  2Q1L A;  2ZBI A;  2MQM A;  4A8Y A;  3FSY A;  3W9H A;  3DGP B;  3NKY A;  4P9S A;  4C98 A;  2DNG A;  5GAH I;  1SQG A;  4LF7 F;  5ETV A;  2VOP A;  1XN9 A;  1F3F A;  2W24 A;  2Z2L A;  4AFF A;  3GLJ A;  2ZFH A;  5HQL A;  3BBB A;  1OY8 A;  1P27 B;  1S1W B;  4R8U B;  2V4J A;  2D1C A;  4I6Y A;  3BDP A;  2J7K A;  5D4O A;  3TVK A;  1Q4R A;  5T7L B;  1HR0 J;  5EX0 A;  4ZIV A;  1LW0 A;  4CLK A;  2YKP A;  4B9U A;  4JI7 F;  1QTM A;  4H4O A;  4PUO A;  3CO0 P;  3T5L A;  1UA0 A;  3PIP Q;  5U47 A;  3T1Y J;  2CJA A;  1NSA A;  3M2V A;  5GAH U;  3KLG B;  3ZTR A;  4MT1 A;  3ZC4 A;  3LP1 B;  4EO8 A;  1YRU A;  1WC4 A;  1BMQ B;  4KGV B;  4GC6 A;  4GKK J;  4KHR A;  1RUS A;  1JJ2 R;  2LVW A;  1SJR A;  4KO0 A;  3CGI A;  3JYT A;  2CZ9 A;  3DHW C;  3Q8Q B;  2QLX A;  5KFQ A;  2R7Q A;  2BKN A;  2VKR A;  3TZY A;  1AZS B;  4NLY A;  2J6S A;  2J9D A;  2QE5 A;  2HGN A;  2GML A;  3FRY A;  4N47 A;  3X3U A;  4O3N A;  2LDY A;  1AW0 A;  2UUW A;  4EBE A;  4DR5 F;  2QYC A;  2ASY A;  4DL5 A;  3IBC B;  3G71 S;  5KFO A;  2HHT A;  1S7H A;  2RS8 A;  2AYB A;  2OML A;  1WHY A;  4YB1 P;  3W2V A;  4X4T A;  2ILY A;  3SXL A;  1LW0 B;  4DQS A;  5IT0 A;  2YWK A;  3KK3 A;  4B9M A;  4WZM A;  3MAA B;  3QBC A;  2J6T A;  1IVZ A;  1WF1 A;  4H4O B;  4PUO B;  3BQ0 A;  4C0O C;  2KM8 B;  3C16 B;  2C2M B;  3TUP A;  5GVQ A;  2WB1 D;  3M2V B;  3R5D A;  3ULH A;  4LFB J;  5GMD A;  3AB2 B;  4ED8 A;  4X62 J;  3JTP A;  3BGR A;  1SKR A;  1NKB A;  4KO0 B;  1X4D A;  3VVT A;  4X2B A;  3JYT B;  1YK9 A;  2XI2 A;  2HHW A;  4LF8 F;  3H59 A;  1FA0 A;  1NHK L;  1WTF A;  3Q89 A;  2ZNZ A;  1GXT A;  1WI8 A;  5IV3 A;  1JLQ A;  5M2U A;  2WTF A;  3MPV A;  2WRM A;  2WBR A;  4I2Q A;  3DI6 A;  2EFG A;  2HHP A;  1URR A;  5DRK A;  1X0F A;  3CCS S;  1HQU B;  1KTQ A;  3KXD A;  4P6Q A;  1S59 A;  3TJA A;  4DFP A;  2GMH A;  2JX2 A;  1IBC B;  3W2V B;  2O67 A;  3ENQ A;  1WHX A;  3RB6 A;  1EB0 A;  1H2T Z;  1NU4 A;  3F0N A;  2FLP A;  1LWE A;  4P71 A;  4A46 A;  3I6P A;  1QAJ A;  1UKU A;  3CO9 A;  1P1L A;  3RAX A;  2YQ0 A;  3I56 S;  3MPU B;  3LGH A;  2E1M C;  2ZM6 J;  1MMD A;  4NCA A;  3MPW A;  1RAG B;  3BGR B;  3M9M B;  4PWW A;  4LQ3 A;  2VA2 A;  2IYI A;  4DS5 A;  5C42 B;  1GMU A;  1RAA B;  1S10 A;  3OL9 A;  2OD4 A;  2V2V A;  2YWG A;  1M5S A;  2VG5 A;  4A8O A;  1RLC L;  1SKS A;  3HHD A;  4UQG A;  3SQG A;  4IR9 A;  2DH8 A;  4N8O A;  4DOZ A;  2D3O R;  1SC1 B;  4ECW A;  1NK6 A;  2J0X A;  1FF2 A;  2VHG A;  2B4U A;  3V2U C;  1KBR A;  2HAI A;  4DWI A;  3PV8 A;  1M5K C;  4IFV A;  1IKX B;  4I2Q B;  2HKE A;  1CSJ A;  4IO1 A;  4G6V B;  2CUY A;  3DI6 B;  4M95 A;  3CSK A;  4M1K A;  1J5O B;  4IO9 Q;  4OV6 A;  1P8G A;  1YJN S;  4R0J A;  3ZZT A;  4F3Q A;  2DR9 A;  4AE5 A;  5CZX A;  2FUG 9;  4DV3 J;  3ZZO A;  1KKH A;  1LWE B;  4OHW A;  4NLX A;  1TUG B;  3PR4 A;  2B51 A;  3DFE A;  4AND A;  3BPD A;  4NLU A;  5HAT A;  2MB0 B;  1WSR A;  5C5J A;  3JQJ A;  4L74 A;  4IRD A;  2O3D A;  2DY1 A;  2MQN A;  3K5N A;  1OYD A;  4ELU A;  2NXE A;  3FUY A;  1U2R A;  1RHM B;  2IDE A;  1KHV A;  4ZIW A;  4NMX A;  4OX9 J;  4OJ3 A;  1C0U A;  1ZYQ A;  1KFS A;  2B4P A;  1DTQ A;  3EPG A;  5JVH Q;  4O3P A;  1HHS A;  4K59 A;  2VG5 B;  4WWS A;  3N5F A;  4J9L A;  2OSQ A;  2PMH A;  3O2I A;  1DQA A;  3EMT A;  4CYU B;  4WK3 A;  2WVE A;  3OT9 A;  1X5T A;  1MML A;  4YOE A;  3L95 X;  2DVI A;  4IFV B;  4OI2 A;  3BM7 A;  4DUT A;  4CRJ A;  2JOQ A;  4OYO A;  2WSE C;  3A12 A;  1S1U A;  3CJT A;  1PG5 B;  2P6T A;  5GAE I;  1F1B B;  1IBK F;  4MIB A;  4C3K A;  1RGV A;  2CZ4 A;  1H2U X;  1RE1 B;  3C2P A;  2R2U A;  3VHQ A;  3IC1 A;  2J0Q D;  2YKO A;  2Z2Z A;  5DLF A;  1UTA A;  1UW9 A;  4CLP A;  2XYP B;  3VAJ A;  2ZWP A;  2FD2 A;  2K3I A;  2Y8Y A;  1F9E B;  3HD2 A;  1U1L A;  2JC1 A;  3HVA A;  3SCL E;  3KK2 A;  4C6A A;  3W8G A;  4M5G A;  2M52 A;  1C0U B;  5B0G A;  2R2T A;  4K4T A;  5KT5 A;  1DTQ B;  2ZKU A;  1M5V C;  4NXN J;  1I6J A;  4TY9 A;  4CLU A;  4IR1 A;  1MLA A;  2C28 A;  5DG7 A;  4P10 A;  3JAM Y;  4WBF A;  3QJJ A;  3US5 A;  2DPJ A;  4OYB A;  5GAE U;  2QLW A;  2MJN A;  1S9F A;  2KZZ A;  4ZP6 A;  3VZI A;  4TNO A;  1PC4 A;  3QMQ A;  4CH1 A;  2MLX A;  1U8S A;  3SBM A;  2CAJ A;  3SYZ A;  2GIQ A;  3QFW A;  2OJ3 A;  4P2X A;  2DR6 A;  1S1U B;  1LWF B;  4LFA J;  2YWW A;  4M5N A;  1TEL A;  5DGA A;  1FJG J;  1F0X A;  3DOM A;  3R5G A;  1ZM9 A;  4KT0 C;  3E51 A;  5IOL A;  2JNJ A;  1E6Y B;  2W7A A;  3OL8 A;  1NSP A;  3CCR S;  3FEY B;  4MAK A;  1QVG R;  5E3R A;  2ZOG A;  3IM8 A;  4J9S A;  2IFX A;  2QSW A;  2QFI A;  2KM8 C;  2B56 A;  4RW6 A;  2OPQ A;  4OI6 A;  2VON A;  4IG0 A;  2VQE J;  3KK2 B;  3CD6 S;  1RWU A;  4ECZ A;  4USM A;  3GWC A;  4B3R F;  2GQC A;  4WIQ A;  2A6O A;  5K8N A;  3G82 A;  1W25 A;  3DKD A;  3P96 A;  1FT8 A;  1XQI A;  4LIR A;  1FVS A;  2R7W A;  5C7P A;  1KVJ A;  3LOU A;  3BR8 A;  3H90 A;  5AE1 A;  2L48 A;  4QIV A;  4WP3 A;  1TUW A;  4QYZ K;  5FII A;  4ERD A;  2HHS A;  1FNM A;  4B9T A;  4W90 B;  4DPX A;  3BJY A;  1YKW A;  3N4W A;  4UUX A;  2PDA A;  2GO9 A;  3DOM B;  1L3U A;  1MSW D;  4NYP A;  4J90 A;  1O8B A;  4DR7 J;  5BYQ A;  2XMM A;  2H1Y A;  2HIY A;  3QQC D;  2GV1 A;  4UW2 A;  4RW6 B;  1JKH A;  2D69 A;  4DQI A;  2OPQ B;  4B17 A;  1FCA A;  4IG0 B;  3POT A;  4LF5 J;  1M5H A;  3QLH B;  1VRQ C;  4ZVH A;  3G82 B;  4E2F B;  4CNY A;  2J5A A;  1FVQ A;  2YNF A;  3G8S A;  1N36 F;  1HI8 A;  5AXL A;  3FMW A;  4ED5 A;  3KLI A;  4HT5 A;  2QRR A;  4ES2 A;  1PCA A;  1SV5 A;  5A2Q Y;  2RML A;  2ZBR A;  4J9K A;  2FIU A;  1B99 A;  3ET6 A;  2AYE A;  1EKR A;  4GO5 X;  2CG4 A;  5IT9 Y;  3IWN C;  1QAY A;  2J8S A;  4A8K A;  1N33 J;  5SUH A;  2GJF A;  3KHG A;  1SIZ A;  3LA0 A;  2C42 A;  2E5G A;  2M2B A;  2ASJ A;  3C6T B;  3BN4 A;  1RAB B;  4CT8 A;  1U8W A;  2M88 A;  3T5K A;  1NK4 A;  5DZ6 A;  4IQM A;  2QMU B;  3FFI B;  3IGV A;  3POT B;  2ADB A;  4DSJ A;  2ZUG A;  2ZKT A;  3NNH A;  3DYA A;  1PC5 A;  3FEZ A;  3IAM 9;  4DDF A;  1RAC B;  4B3M F;  4OZJ A;  3IA0 A;  1HWJ A;  2YNF B;  2GQ2 A;  4CLT A;  2PO4 A;  2ROG A;  5IM0 A;  2CDR B;  3CNQ P;  2RU9 A;  2VA3 A;  4K50 A;  4F25 A;  3KLI B;  4G3I A;  4IDK A;  4ZJL A;  2FQQ B;  2LA4 A;  3O3L A;  1V3R A;  4D3G A;  1U6Z A;  4EEY A;  4DV5 J;  1SV5 B;  1R8C A;  3ET6 B;  3MAH A;  2M9K A;  3MHY A;  1FWP A;  5KFT A;  1XR7 A;  3C19 A;  1I94 J;  1VQM S;  3UWT A;  3TA2 A;  4DN0 A;  4OV1 A;  2M8H A;  3MEK A;  3AB4 B;  4KRW A;  1X4H A;  5KT6 A;  1HBU A;  2D7S A;  2OIH A;  4AYB D;  5LOQ A;  2MTL A;  1BLU A;  4DUY J;  2XMT A;  3MOJ B;  3KKF A;  1JQG A;  3DOK A;  3P49 B;  3CPW R;  1XC9 A;  5D8H B;  4IQX A;  4IUF A;  4OZ5 A;  2ASL A;  1G3O A;  3NLC A;  2G2Y A;  4PEO A;  4Q2L A;  3IM9 A;  5CAB A;  4WP8 A;  1WDT A;  3UCZ P;  3EGW B;  1V3Z A;  3HSZ A;  2W1B A;  1U6B A;  4K4Z A;  3C66 A;  4W92 B;  4O44 A;  1R8H A;  2YNH B;  1PYO B;  3DYA B;  4KFB A;  2B9W A;  1UFW A;  2NXN A;  2R8J A;  1TAQ A;  3E8O A;  5EWE A;  4IDK B;  1X8D A;  2H65 B;  4B9S A;  1Y3K A;  1UWA A;  4YHH F;  2JLG A;  1MN9 A;  3AT1 B;  3ZZZ A;  3GR0 A;  2WSF C;  2N4D A;  2FJD B;  3AD9 C;  3VGV A;  1SH3 A;  3EE3 A;  3CCT A;  3L09 A;  3G8Q A;  1NH8 A;  2F63 A;  1TV6 B;  2MZS A;  3BQ2 A;  1N56 A;  3CDA A;  2MKS A;  1T9T A;  5T14 A;  2VV5 A;  1XNR J;  2GS8 A;  2W9B A;  2R8I A;  1ZET A;  1IM4 A;  1RAH B;  4NOH A;  2NUU G;  3L3C A;  2RKI B;  3D68 A;  3DRR A;  2E1R A;  3C3L A;  2I9S A;  1LXN A;  2GC8 A;  1HWI A;  4MK9 A;  1R8B A;  2ZJR Q;  3OLB A;  4O44 B;  4QPX A;  4KFB B;  1BD6 A;  4RW8 A;  3FDS A;  4CCH A;  3GCX P;  1U6F A;  3JSM B;  1XMO F;  2FJV A;  3W5X A;  3SSR A;  1WKK A;  2CQ4 A;  4LQ9 A;  2HRU A;  3HPO A;  3LWM A;  1FES A;  1HNW J;  3R2C J;  3F41 A;  2OAU A;  4DR3 F;  3PJ9 A;  1VIS A;  4Q8E A;  4DL7 A;  2IVF B;  2DJW A;  2JEF A;  1GX5 A;  2OSR A;  2UU9 F;  2YKM A;  3IFE A;  4EFA C;  3F73 A;  5IQQ A;  2QTW A;  2HFS A;  3OHB A;  4K4U A;  2BA9 A;  2W9B B;  4IKA A;  1K1Q A;  3OJU A;  1YIT S;  4KSE B;  3CJ0 A;  2XC9 A;  3DRR B;  1RZM A;  2VBW A;  3MED A;  3ONQ A;  2BJ7 A;  4I6W A;  1NKE A;  3CIM A;  4TLQ A;  2R7T A;  3QWU A;  1L3S A;  1JWW A;  2KJV A;  4Z2X A;  4K4S A;  1GMW D;  3R6L B;  3CME S;  2LYV A;  4RW8 B;  1H2V Z;  4OYM A;  4EMD A;  1Y10 A;  1UVN A;  2VDI A;  4DR6 J;  5K8P A;  4NLQ A;  3O6Q A;  4LRD A;  3ETM A;  3CE8 A;  4B3S F;  1U26 A;  5KFE A;  3PKM A;  5I3U A;  4C9D A;  1NK7 A;  4DPY A;  2A18 A;  3E01 A;  5AE2 A;  2DGS A;  3FKB A;  2KRR A;  2GVZ A;  3DHX A;  2QYG A;  4OYI A;  1S12 A;  4Q2M A;  2YKM B;  1T9U A;  4FBT A;  3GB0 A;  1S0M A;  1SVD A;  1MRO A;  4HHJ A;  4DV1 J;  3HHL A;  1R43 A;  2U2F A;  2CZV C;  4EBD A;  3QSY B;  3KLF A;  3MED B;  3EVW A;  3SCJ E;  1C1C B;  2MGZ B;  3A8K A;  1H7X A;  3UPF A;  1QDU B;  1B7F A;  3MR2 A;  3G6Y A;  2P9C A;  5B0D A;  5KT4 A;  2G13 A;  4DV2 F;  2C3U A;  2HRY A;  3CDW A;  4IRK A;  2FJE B;  4KKO A;  3ZNU A;  2JFD A;  3MM6 A;  4DL0 C;  4DHV A;  2LP4 A;  4DCO B;  2AU0 A;  4LF4 J;  3M1V A;  1SC6 A;  1RAJ A;  1X4E A;  5F41 A;  5I3U B;  2NLW A;  2R7S A;  2RRA A;  3E01 B;  2AMC B;  2GVZ B;  2A2C A;  1JLC A;  2V9K A;  3DLK A;  3BR9 A;  1QUP A;  4JI3 J;  1MRO B;  1WUU A;  2C2D A;  5HMW A;  4WII A;  2K1R A;  3OTD A;  4WKY A;  4ZVE A;  3HHL B;  1D8Y A;  1U2C A;  2H51 B;  1MWZ A;  3ITH A;  2OTL S;  1JK9 B;  3Q0A A;  3KLF B;  3J81 Y;  4RNM A;  3TZX A;  2RUG A;  1RWP B;  3CJR A;  1N5Y A;  1DBD A;  4Y2A A;  3CC2 S;  1N5Q A;  5A0Y A;  4DQP A;  2EKY A;  1U1O A;  3HHN B;  3NGD A;  1J5E F;  1VQ7 S;  4NLT A;  2BZ2 A;  3UR3 C;  4KKO B;  2AEM A;  1S6Q A;  3MM6 B;  3ZTQ A;  2ILZ A;  2H4W B;  2OEM A;  1PBA A;  2Q79 A;  5F8H A;  2QFJ A;  1R6Y A;  3BDE A;  2DEI A;  3BYP A;  1LKZ A;  2Y1L B;  1JLC B;  4GRS A;  1WEL A;  3DLK B;  1IJF B;  3T5H A;  3MR7 A;  4N7T A;  4U8V A;  2XHW A;  5CHC B;  3V4M A;  4NCB A;  1W2B R;  2R42 A;  1RHR B;  1TKD A;  5KG4 A;  3ZZP A;  3ITH B;  2MMY A;  2MPU A;  2DXD A;  2Z8Q A;  2KHC A;  3BYR A;  4CLZ A;  2HQF A;  1WOR A;  1N88 A;  3KK1 A;  2V63 A;  3OLA A;  1ZBT A;  4ECU A;  1N5Y B;  1YI2 S;  4Q44 A;  4LFA F;  4OYP A;  1RT7 A;  2CPI A;  3M30 A;  2ZVI A;  5D15 A;  2XO6 A;  2KT5 A;  1Z1Z A;  2OPP A;  5LM7 E;  4LF6 J;  2M7S A;  3GV8 B;  1G2E A;  3M6U A;  2YKN A;  4Y0F A;  5B0F A;  3OSN A;  1QUV A;  2DEJ A;  2RB7 A;  4JV1 A;  1XEZ A;  1E6V A;  3N01 A;  3WIU A;  3Q2S C;  3CJS A;  4RW9 A;  4DZ6 A;  3GYG A;  1HQ2 A;  4QPT A;  2W2P P;  2LXI A;  5CZC A;  4G1Q A;  2L9N A;  3B54 A;  4J9Q A;  3HDS A;  1UWB A;  4FF4 A;  3Q8V A;  1EJ7 L;  1Y0H A;  2QL5 B;  3ILJ A;  5D0H A;  3R5A A;  2C3Y A;  3BBF A;  5F9L A;  3OTO J;  1T02 A;  1U0H A;  2M5Y A;  3M2R A;  2DGQ A;  3AAW B;  4IH5 A;  3UVJ A;  3K17 A;  1QLN A;  4NEY A;  2H54 B;  2F8E X;  2LMI A;  5A8K A;  1RYR A;  5E0O A;  4O3O A;  3JXO A;  1H3D A;  3R7N B;  3I96 A;  3TAQ A;  2RIL A;  3M30 B;  1GH8 A;  2Y3Y A;  1OPI A;  2OPP B;  1JNZ B;  4YR3 A;  5E3C A;  2YKN B;  3WBZ A;  5MAO A;  2UV8 A;  4I2P A;  4DFJ A;  3MCM A;  1NK8 A;  1E6V B;  1KC8 T;  4RW9 B;  2HZV A;  4JYA J;  2DD8 S;  4A8Q A;  3I9Z A;  3D4J A;  4JV0 A;  5AE3 A;  3VCD A;  4DJB A;  4G1Q B;  4F4X A;  4FBU A;  1CC7 A;  4YY3 J;  4OI1 A;  2AP6 A;  1Z4U A;  3HJV A;  3K8W A;  1BQM A;  5E3Q A;  1S7I A;  3GON A;  4LT6 A;  2KO1 A;  3D6F B;  1VC6 A;  2L9W A;  1Q8K A;  2IC3 A;  5ETR A;  1U0H B;  2B4V A;  1CG2 A;  3M2R B;  1LK5 A;  3UVJ B;  4JI8 J;  4DX5 A;  1FKP A;  1O0P A;  4GKJ J;  4OZ1 A;  1S99 A;  3SMZ A;  3JSB A;  3R5B A;  8AT1 B;  3BSA A;  1VLO A;  3P45 B;  4N76 A;  2RU3 A;  2PGC A;  2W7O A;  3CB4 A;  3T41 A;  3NAI A;  3K59 A;  3RRG A;  1Q1K A;  3G4S S;  3CIZ A;  2CPJ A;  3SI8 A;  2GHW A;  4PXE A;  3GG1 A;  1HW8 A;  1C0T A;  2CWX A;  1ZTT A;  4ATN A;  3K5O A;  5E2Q A;  4I2P B;  3HF5 A;  7FDR A;  2WOM B;  1YIJ S;  3RRH A;  2UUB F;  5DQH A;  3SCI E;  3RG6 A;  1HI1 A;  3DXS X;  3VAK A;  2MKH A;  3FCV A;  2PMZ D;  4DSL A;  2D74 B;  3SDE A;  1OQ3 A;  1ZOT A;  2VKZ G;  2KU7 A;  1S6P A;  3KYL A;  2RQM A;  1BQM B;  1VQL S;  3CD7 A;  4LRE A;  3VAL A;  3QNW B;  3KFW X;  2L41 A;  3TX8 A;  2IC3 B;  4UQT A;  1FXR A;  1Q79 A;  2HS3 A;  2XSF A;  3HHL C;  1FKP B;  3CD5 A;  5KFU A;  3I0S A;  4QIE A;  3SZ2 A;  2ZZT A;  4QW9 A;  2VL1 A;  4DF8 A;  4OYZ A;  1Y00 A;  2CVI A;  3FC9 A;  3CED A;  3EZ5 A;  3G87 A;  4B9L A;  1W26 A;  4URS A;  1PYT A;  1C0T B;  2OLW A;  1C4C A;  2EW9 A;  1P9Y A;  2XZT B;  5A8W A;  2VFT A;  5KT7 A;  2HK3 A;  3EZO A;  3DDI A;  3VZH A;  4AL7 A;  4F4K A;  1FD2 A;  3QT7 A;  3BO2 A;  3W5Y A;  4DU7 A;  4IOA Q;  3TP2 A;  3V81 A;  2FHJ A;  2DNN A;  5CYM A;  1S6P B;  4RNN A;  4JV5 F;  3AOB A;  3VGT A;  1YJ9 S;  2GVD A;  3BQ1 A;  4Y28 C;  2Q6B A;  2IRX A;  2BQU A;  5DM6 Q;  5IWA J;  4HI2 A;  1F3V A;  3U1L A;  4F3M A;  5F8N A;  3GYX B;  2DHS A;  2XG8 A;  4C97 A;  1OY6 A;  5HVF A;  2B9E A;  1KDN A;  1VK8 A;  4IYQ A;  1FRX A;  5ETM A;  2M8D B;  2A3J A;  5IV4 A;  1DAR A;  4L72 B;  4HDG A;  3EPI A;  2RVJ A;  4YB6 A;  4OX6 A;  5EN1 A;  3V6H A;  4M5K A;  1XNR F;  2Y1I A;  1T94 A;  4OLO A;  3GTY X;  3BBC A;  3M7V A;  4JI6 J;  2F4V F;  5A8W B;  2NR0 A;  5H9E K;  2K06 A;  3K5P A;  3FGV A;  4JI0 F;  4DV0 F;  4NYO A;  2C2K B;  1X4F A;  1S1T A;  1W7W A;  5CYM B;  2BE9 B;  2CYY A;  2LXU A;  4MFB B;  2I0X A;  2GVD B;  4ED0 A;  1YBA A;  1R89 A;  2HRT A;  2XO7 A;  1YZ6 A;  5CCM A;  3NCQ A;  4WFZ A;  4Q5V A;  3K57 A;  1NSQ A;  1ZZF A;  3I0R A;  2KYZ A;  2HQC A;  2AKW B;  4FS1 A;  2WHO A;  1RWX B;  2V8G A;  4XDD A;  2HQI A;  3MD3 A;  2QZ8 A;  2CDQ A;  4B9N A;  3NNA A;  6FD1 A;  2AJ4 A;  4X4S A;  5FLX U;  4X84 A;  2LDI A;  2E44 A;  4DX6 A;  5LXY A;  1D1U A;  1T9V A;  3A3P B;  4JP8 A;  1MW7 A;  3AD7 C;  2HHH J;  4DS4 A;  3K7R A;  3AFG A;  4ECY A;  3V6J A;  2PII A;  4ZVT B;  4P2S A;  3TAM B;  4RU2 A;  2IHR 1;  4LF7 J;  1NJY A;  4DL3 A;  1EQM A;  2DHG A;  1KP6 A;  2OO4 A;  4NL5 A;  7FD1 A;  2DNZ A;  4F36 A;  1QAI A;  2OD6 A;  1S1T B;  2YPZ A;  1S0V A;  4K2J A;  4WFY A;  4OI0 A;  1G4C A;  2AT1 B;  2P5V A;  4HHU A;  1EP4 A;  5BXI A;  3IR5 B;  3V6K A;  4WU2 A;  2Z4P A;  1FD8 A;  3F44 A;  1UPM B;  4RPF A;  4GVL A;  3N5B A;  3I0R B;  1VIX A;  4QW8 A;  4ED1 A;  4C8M A;  3UD5 A;  1R8P A;  4YB5 A;  4JI7 J;  3T9Z A;  3LW5 C;  5KFN A;  3BKT A;  4Y6I A;  3O1L A;  3IR7 B;  2YKA A;  1FEE A;  2Z2M A;  4BBY A;  1YG0 A;  3D0G E;  2DY9 A;  2R7R A;  4HDH A;  2VC0 A;  3MEG A;  1U0S A;  2IM0 A;  3W63 A;  1U1N A;  4YME A;  3DNC A;  3SEO A;  2LQ9 A;  1U1R A;  3P5B P;  3NG8 A;  1P1T A;  3M8R A;  1RDR A;  2DGO A;  2CJB A;  1N4L A;  4PG5 A;  1HWL A;  4XIU A;  4PWD A;  1VJW A;  2W9A A;  3D3C J;  1NXI A;  4LBH A;  3QPI A;  3AQP A;  1XER A;  3RBZ A;  1RT2 A;  1IBL F;  4GC7 A;  3R97 A;  4IOB A;  5DDR C;  4DR5 J;  4WCE Q;  1ZZN A;  4OIX A;  3K0J A;  2IAJ B;  4N77 A;  5JMN A;  1EP4 B;  1IQZ A;  3D9B A;  3MM9 A;  2OPR A;  4OZ0 A;  2UXB F;  4NE9 C;  1N5V A;  3SQO P;  1JLF A;  1CPZ A;  2EEY A;  1RSC A;  2YH0 A;  5HMY A;  1TP7 A;  3I5C A;  1MMN A;  2DCL A;  2XUL A;  4MK8 A;  4QIW D;  3MZI A;  5KFI A;  2F5G A;  2IYG A;  1BGX T;  2R2R A;  1GEH A;  5CD4 H;  3MEG B;  2FY8 A;  1UW4 A;  1UZD A;  2BAN A;  4ZVS B;  4NWB A;  2IMW P;  1RWW B;  3FZ2 A;  3NAH A;  3VAF A;  3U1N A;  2A0F B;  5HLF B;  3AOD A;  2IPO B;  4AMO A;  1DTT A;  1IR2 A;  1VQS A;  4LF8 J;  4U8Y A;  2FLO A;  2ZNY A;  3R7B B;  4PWD B;  2SXL A;  2YTC A;  1RT2 B;  2DRA A;  3D6T B;  4ZPD A;  3KJV A;  5HVH A;  4F0H A;  1HKA A;  2F40 A;  3ENW A;  5B09 A;  3EYZ A;  4M5H A;  1X4C A;  1RTD A;  3MM9 B;  2FY1 A;  5AXN A;  3D54 A;  1KQK A;  1AB8 A;  3UO0 A;  2P8I A;  5H9F J;  4YQW A;  3QZ7 A;  3MR5 A;  1NPP A;  2ALY B;  4I69 A;  2VC1 A;  5K5M A;  2R8G A;  2CIM A;  3X1L B;  3R1H A;  3MPY A;  2QL9 B;  3TQE A;  1Y3J A;  5GME A;  3PY8 A;  4J5O A;  5EGY A;  3RR8 A;  3UN2 A;  4ZPT R;  1IQT A;  2JL9 A;  5J2P B;  4X4O A;  4FF2 A;  2FC8 A;  2BAN B;  2W4C A;  2RSQ A;  3GPA A;  5L1L A;  2X7I A;  4QWB A;  3U1M A;  1S76 D;  1V3S A;  1DTT B;  2E5I A;  2CQD A;  4R25 A;  4DF4 A;  4WXW A;  3NGU A;  1GMV A;  3UNY A;  1WC3 A;  3BZQ A;  3W60 A;  4CNZ A;  5F3Z A;  2DTJ A;  1X7V A;  5E7O B;  2FB0 A;  4NLR A;  1BE4 A;  1IJE B;  3KJV B;  3PVX A;  4HTI A;  1F2H A;  3KJQ B;  1U02 A;  4P2F A;  4Y2M A;  2LQJ A;  1HMV A;  4HKQ A;  4I1T A;  2B3T B;  5IC6 B;  5EWF A;  4MKV A;  4ZVP B;  2NXU A;  1RTD B;  2X3D A;  4M63 A;  3BPS P;  3CUN A;  9ATC B;  1K0V A;  3J80 U;  1NHV A;  1FDN A;  1ZS6 A;  4OYA A;  3W1Y C;  2WVD A;  4PG8 A;  1HLW A;  4WTY A;  5EWG A;  3EGN A;  2PI5 A;  1R7I A;  5THW A;  4DR2 F;  2Y1J A;  1RTH A;  1EET A;  3HSJ A;  4HVZ A;  2HS0 A;  1UVI A;  3UN5 A;  4KJI A;  1Q8L A;  1SIW B;  2X1F A;  1T9X A;  1F5C A;  4CTA A;  1SJ1 A;  2PEB A;  3T19 A;  2I1R A;  2OI2 A;  4DMZ A;  3VAH A;  1PIL A;  2X1G A;  5JVG Q;  3KMS A;  1R3N A;  1CJK A;  3FJ2 A;  1VFJ A;  3Q8R B;  3SSQ A;  2VAS A;  4H4M A;  1Q8B A;  1HMV B;  5ADZ A;  4ZCI A;  4ECX A;  3GMG A;  3TNV A;  5DDO C;  2P9G A;  1QAX A;  2VF3 A;  1LOU A;  2CWK A;  5DLG A;  3S7R A;  3TO8 A;  3LAN A;  1PAE X;  3UFC X;  1IBK J;  4X4U A;  3KJN B;  2KXN B;  5KFL A;  3M8Z A;  2BXJ A;  3FK4 A;  1N0V C;  1WI6 A;  1H38 A;  2V2Q A;  4CO2 A;  1RTH B;  4ILL A;  1EET B;  2XMW A;  3A13 A;  3MGJ A;  2ZH3 A;  1S4E A;  3GFZ A;  1X4G A;  1LWX A;  4PPD A;  1RU1 A;  2C2Z B;  3ADA C;  3HHE A;  4ED6 A;  2VPX B;  4HL9 A;  4JI8 F;  1KD1 T;  4TU7 A;  2IMO A;  2HS4 A;  4KH1 B;  1RTZ A;  1SCJ B;  1CJK B;  2AZ3 A;  1K8A T;  3EVM A;  2AEJ A;  2XQC A;  3KNA A;  2ZH7 A;  4H4M B;  3H25 A;  4ICL A;  4KY3 A;  5DDP C;  1FER A;  3S01 A;  2QMX A;  1FE0 A;  2GJ2 A;  3M05 A;  4P2M A;  1HQE A;  4S0M A;  3IP0 A;  2XI3 A;  1LNQ A;  3W9I A;  1JMT A;  4M5D A;  4OHV A;  3IXQ A;  5B7W A;  3OSP A;  2F8H A;  4AUK A;  3AXM A;  1RTJ A;  5JJB A;  1Q53 A;  2KG0 A;  4QCL A;  4LBI A;  1JNR B;  4CO5 A;  3K2Y A;  4NLW A;  1RHK B;  1NBE B;  5A8R A;  1K44 A;  2MLZ A;  1FX2 A;  3I5A A;  3UW1 A;  2W4D A;  4B3R J;  3GFH A;  4B3O A;  2KT3 A;  4LMZ A;  1CJV A;  1WAC A;  3J7Y I;  1R8A A;  2FDN A;  3H5U A;  4I64 A;  2VG7 A;  4F26 A;  4TU8 A;  2G2O A;  1VK3 A;  1RAF B;  3BGF A;  1SH0 A;  4UY8 T;  1S5Z A;  3PG9 A;  1YQH A;  2XS7 A;  2DO0 A;  2Q66 A;  4LF9 F;  2C1E B;  4FYY B;  4UOF A;  2BAB A;  3ZNJ 1;  1CS4 A;  1HQE B;  3HD1 A;  1OIA A;  5K14 B;  3MUV P;  2BQ3 A;  1ZPW X;  4QU6 A;  4EK2 A;  1RTI A;  3DRY A;  3AH6 A;  3GJR B;  2HFN A;  4USW A;  3BB5 A;  3PEJ A;  1KLM A;  2PA8 D;  4M5D B;  1TL5 A;  3WC0 A;  4I68 A;  3PZP A;  5B08 A;  3CTR A;  2UZA A;  1D09 B;  1KON A;  2DNQ A;  1RWN B;  3I55 S;  1U45 A;  2W4P A;  1RTJ B;  4K0K F;  3J7Y U;  1VJQ A;  1PGZ A;  2DNP A;  5A8R B;  3CUL A;  4M94 A;  1AA1 B;  2CQB A;  4UOH A;  1YHQ S;  4B3O B;  4BWJ A;  8ATC B;  1CJV B;  3Q8P B;  3GP9 A;  1MNE A;  4KAI A;  2PFF B;  3CJ2 A;  2ROP A;  3TUZ C;  1EZZ B;  2HYI B;  1N36 J;  3THT A;  1CLF A;  2VG7 B;  1F60 B;  2FGO A;  3EVO A;  4GO7 X;  3LF0 A;  3V4I B;  4O3R A;  2HBZ B;  3GFY A;  1RT3 B;  3G9C A;  1ZM3 A;  1SJ3 P;  2HND A;  5GMK a;  2HEK A;  4DN9 A;  2XCA A;  2XY6 A;  2KN4 A;  3QIP A;  4PPZ A;  3LO3 A;  2B8Q A;  3FSX A;  4RLE A;  1RTI B;  4RWX A;  2E5L F;  5J2M A;  2DHH A;  3DGP A;  4DUZ F;  3PX4 A;  3BGL A;  2HFV A;  3PW7 A;  2ZD1 A;  3B8H A;  4DV6 F;  5IQ6 A;  2F4F A;  5I3P A;  2KRB A;  3ENV A;  5KG3 A;  4XPE A;  5IC4 B;  1NDL A;  5KG1 A;  4FXD A;  2HFU A;  3BGU A;  3IG1 A;  4DLG A;  4F0K A;  1N5S A;  2R7V A;  1Q8I A;  3HVT A;  4YR2 A;  4B3M J;  1VQ5 S;  3RB4 A;  2VIC A;  1OQ6 A;  1U1M A;  2XLJ A;  2DR5 A;  2G9O A;  4MTP A;  2OKQ A;  4ZIT A;  4NX9 A;  4WFB Q;  4DR4 F;  2Y0S D;  4QR1 A;  2D9O A;  2DH9 A;  5KFG A;  3QIP B;  3NGK A;  1SJF A;  1VQ4 S;  2XM3 A;  3EX7 B;  3TW0 A;  3CCE S;  1U2F A;  2AGQ A;  3HKZ D;  1BHN A;  4FF3 A;  3DRP B;  5J2M B;  2CQ2 A;  2CQG A;  2CQI A;  4KV8 A;  2V8V A;  2EFQ A;  2FHO B;  1AZS A;  2ZD1 B;  4DL6 A;  4KTQ A;  1KN6 A;  4J9U E;  1QSS A;  3CCV S;  2D9P A;  5EX3 A;  4JI5 F;  4MJK A;  3MOZ A;  3OUY A;  3IG1 B;  3H42 A;  2RQ4 A;  1HI0 P;  3R27 A;  4WE1 A;  3T6J A;  3HVT B;  1ROF A;  3HFK A;  2QA4 S;  2UUC F;  3MAA A;  1FXL A;  3CT9 A;  1DLO B;  1G7C B;  4E98 A;  3C16 A;  4ES3 A;  2FZK B;  3QGP A;  1PO6 A;  4QYR A;  2MLY A;  4YHH J;  3JSR A;  4I6A A;  2QLJ B;  3WQP A;  2XMJ A;  3E2E A;  4BC9 A;  4Z7C A;  3CCW A;  1VQN S;  3Q8Y A;  2ZE2 B;  3D28 A;  3ISN D;  4YFU A;  2UUA F;  1EX8 A;  4ZCM A;  4KV8 B;  1NAQ A;  2WON A;  3JAM U;  3TOQ A;  4QOT A;  1QJH A;  2CPE A;  5IFM A;  2RT3 A;  4KQZ A;  3G6E S;  2HFO A;  4WPA A;  2AHO B;  4ED2 A;  4QBU A;  1RBO B;  2DR7 A;  4X65 F;  2XGQ A;  3QAT A;  3OUY B;  1KVI A;  1HQU A;  4WE1 B;  4MKB A;  4WFA Q;  1XMO J;  3K5L A;  1XNQ F;  4FP9 A;  1IR0 A;  5LJ5 Y;  4X4N A;  1S57 A;  3C6U B;  1DY3 A;  3Q83 A;  4U7U D;  1U24 A;  1FHT A;  4DR3 J;  2KDO A;  2LQ8 A;  1NM2 A;  1SC4 B;  4NZ6 A;  3M2U A;  3VTI A;  1Q16 B;  4PRF A;  2W8K A;  2VUG A;  4MIA A;  2UU9 J;  4CDI A;  5SZT A;  5C42 A;  2CJQ A;  4ZJQ A;  4A8M P;  2JVO A;  1KOO A;  3CJ3 A;  4HH1 A;  3O5T B;  1EAR A;  2WON B;  3R7S B;  2CVE A;  2KZM A;  2RHQ B;  2BE2 A;  2G0I A;  3CDE A;  5I3Q A;  2EFP A;  1CEZ A;  1IM6 A;  3L7P A;  3KUH A;  1IKX A;  1RU2 A;  1J5O A;  4ECS A;  4PR6 A;  3DLG A;  2VBX A;  2X1B A;  5KG6 A;  4LVN P;  2QSF A;  3TRG A;  2HQD A;  2RNE A;  1KQG B;  1KQS R;  3N28 A;  3A8E A;  4A47 A;  2XWX A;  4X64 F;  4OI3 A;  5D6G A;  2BVZ A;  1N34 F;  2FZC B;  4B3S J;  2UVW A;  2ZZN A;  2VFV A;  2I38 A;  2CPD A;  4M5I A;  5C24 A;  4KGK A;  2UXC F;  3M2U B;  5L8R C;  4Q43 A;  3PYE A;  1T9W A;  4NZ7 A;  1UJ4 A;  4JI2 F;  4ELV A;  3LAK A;  4IRC A;  2BKP A;  2BUN A;  3D7S B;  4UTG A;  1QE1 B;  4JV2 A;  4P73 A;  2BE2 B;  1JX4 A;  4K4Y A;  1RT4 A;  1UFL A;  2NXC A;  4CYU A;  5A2Q U;  3TEH B;  2DKO B;  4ZP7 A;  3BS9 A;  2E1C A;  4BWM A;  2U1A A;  2G1H A;  5LMN F;  3MCS A;  5IT9 U; 
#chains in the Genus database with same CATH homology
 3IM8 A;  2UV8 G;  2JFD A;  1NM2 A;  3HHD A;  5DZ7 A;  2VZ9 A;  3TQE A;  2QO3 A;  2PFF B;  3TZY A;  3PTW A;  2HG4 A;  3R8Y A;  3QAT A;  3TZW A;  5CZD A;  4RR5 A;  3HMJ G;  2QC3 A;  2QJ3 A;  2C2N A;  2VKZ G;  2H1Y A;  3TZX A;  3SBM A;  5CZC A;  3H0P A;  3CJ8 A;  3G87 A;  1MLA A;  4RL1 A;  2VZ8 A;  2G1H A;  2G2Z A;  2G2Y A;  3EZO A;  3TZZ A;  3HJV A;  3K89 A;  2G2O A;  3IM9 A;  3R97 A;  2CUY A;  5DZ6 A;  3BV8 A;  4QBU A;  2JFK A;  3RGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...