3BDEA

Crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
QGMIRHTVVFTLKHASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFSMEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mll5499 protein
publication title Crystal structure of domain of unknown function with a ferredoxin-like fold (NP_106155.1) from Mesorhizobium loti at 1.79 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Unknown function
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdeA00
2RMLA 1URRA 3KKFA 3TOQA 1RJJA 4ZOSA 1FESA 4YEAA 1Y9OA 3IWXA 1AW0A 1FVSA 5B0CA 1YJUA 2ROGA 1P6TA 1VQSA 3DXSX 1TL5A 1P8GA 3HHLA 3HHLC 4HH1A 4U9RA 4A48A 2IYGA 2GO8A 2LQ9A 1FD8A 2XMVA 3E8OA 2AJ1A 4HH0A 1X8DA 2OFHX 2HLTA 1OSDA 1TL4A 1Y0HA 4A46A 2PD1A 3CJKA 1TR0A 3T9NA 2W4PA 2QYCA 2IYIA 3LO3A 2HFNA 4OJ3A 2BYCA 3HFKA 2OD6A 2RILA 2QLXA 1TZ0A 3CJKB 2OMOA 3WDOA 1Q53A 2LQBA 3BN7A 3DCAA 1OPZA 3FGVA 3TNVA 1AFJA 1K0VA 1Q8BA 1YRXA 1XBWA 1R6YA 2W4CA 3F44A 4HI1A 1TUVA 2N4DA 2ASYA 1CPZA 2VV5A 3I9ZA 1IUJA 2GFFA 1JK9B 2HLUA 2K7KA 1ULRA 2GGPA 2HFOA 2BBEA 2QLWA 2ZDPA 4YDXA 2GA7A 2Q3PA 2G9OA 1X7VA 2BJDA 2RSQA 4HL9A 2FTRA 5A6WA 4DL0C 2ROEA 3GZ7A 5K9FA 1Y3JA 2GGPB 5B0BA 2OKQA 3KG1A 2QIFA 3QMQA 5F0UA 3K7RA 1KVIA 4ZA1A 5KAKA 2OD4A 2ZDOA 3BGUA 2AJ0A 2IFXA 3HHLB 1YG0A 2LDIA 1KVJA 3LGNA 1WD6A 1QUPA 2JDJA 2K7JA 3HX9A 3HF5A 3FRYA 3BM7A 3KG0A 4Y2IA 4DPOA 1OQ6A 4A4JA 1N5QA 2AW0A 1GXUA 5B0AA 1CC8A 1N5SA 4NPOA 2FB0A 2XMUA 4FNIA 1LQ9A 3BB5A 1FE4A 1W2IA 2RU9A 2EW9A 1FEEA 2HIQA 3KNGA 2PGCA 2FIUA 4NL5A 1Q4RA 2BUNA 4QOTA 2HQIA 1SB6A 2N4CA 1U7LA 2OFGX 5B0FA 5T7LA 1SQEA 3HHLD 3LGMA 1APSA 3TRGA 1Y3KA 3BDEA 2ACYA 2KYZA 1Q8LA 3FMBA 3MZIA 2AP6A 2VH7A 4OJ1A 4Y2KA 5B09A 1FVQA 2K1RA 2OP5A 2XMJA 3QGPA 2GCFA 1FE0A 3VTIA 1KQKA 2XMWA 1JWWA 1MWZA 1V3ZA 1N5VA 1MWYA 1YJRA 2K1RB 2W4DA 3HDSA 2BJEA 5B0GA 1OQ3A 4Q2LA 1AFIA 2KT3A 4Y2MA 1SI9A 4OJHA 2XMMA 3UDCA 2LXFA 2KT2A 3BR8A 4OIXA 4F67A 3MCSA 2XMKA 2OAUA 5A6PA 1GXTA 1X0PA 3BF4A 1S6OA 3IWLA 2K2PA 4OJGA 5F0WA 2FHMA 1S6UA 1YJTA 4A47A 4DN9A 2CRLA 2L3MA 4EFAC 1CC7A 5IXUA 4Q2MA 2GV1A 5B0EA 4HI2A 5B0DA 1YJVA 1VQYA 2ROPA 2XMTA 4FNHA 2KKHA 5B08A 5T7LB 1N5TA 2N7YA
chains in the Genus database with same CATH superfamily
3ITHA 3HKZD 1YRUA 2V2VA 2VFUA 2Z30B 2XQCA 3VVUA 5LL6d 5J1PA 2Y1IA 3PW2A 1MG7A 3BBFA 2FC8A 4DV4J 5HO4A 3J80Y 5D0EA 1M5OC 5AJ3J 3PFOA 1SV5B 4EBDA 1GFWB 3AAWB 2MZQA 3M2VA 2ZHBA 1F2HA 5DRKA 3OVAA 4HHJA 3W8GA 3R6GB 3G87A 1Q7YT 1Q4RA 1R0AA 1UWAA 1TKDA 2IC3B 3BH6B 1FXRA 1WELA 4RUCA 3NNAA 2XS7A 4TLRA 1RWOB 5C5JA 4QIVA 4Q2LA 1AFIA 1XNQJ 1E6VB 4H4KA 3L7PA 4F0MA 2AYEA 3W5XA 5GAGU 2UU9F 1RAJA 1FCAA 5E3PA 1S1WB 4J9VA 1U6BA 3TEHB 2OPPB 1EIYB 4HVZA 3LP0B 3M8ZA 5GAEU 3H5XA 4L6V3 2NPFA 1G6BA 1YI2S 5E3QA 2I5JA 1F6TA 3KLEB 4DG1A 3KTQA 1B0TA 4XTTA 1P1LA 1VISA 5DG9A 1NXIA 3H25A 3JQJA 4JI2F 2H54B 2KB2A 5C42B 2VBXA 4PQAA 3MM6A 3KK3B 1TKXA 4LSLB 4ZVHA 3AD9C 3MUTP 1VRQC 4ZVSB 3GILA 2MY7A 4X65F 4IR1A 2EPIA 2VC0A 4DSKA 3Q24A 4GC6A 4QOTA 3A3PB 1HBUA 3H8YA 2VKZG 3GMGA 2HRUA 2CUYA 3EVMA 2XI3A 2OIHA 5J1NA 4ES1A 2NQPA 2XGPA 3QRQA 4HKQA 5HBMA 4DN9A 3M6UA 2W01A 2ZITA 2K06A 4LF4F 3GYGA 3MWBA 1WTBA 3TR5A 3Q2SC 3JSMB 1YK9A 1S1VB 1CBKA 4RW8A 2RKIB 4I69A 3OUYB 1AA1B 3CNQP 4HH0A 4ZLNA 2OFHX 3QGHA 3OL8A 1K47A 2UU9J 4FYYB 1CVJA 5BR8F 2OSQA 2JH3A 4KKOB 3SQGB 4K2JA 1QSSA 1VHFA 4Q0BB 2IA6A 1JLQA 1BD6A 3J7YI 3M30B 2ZE2B 2ILZA 4GKKF 2V2QA 3N5FA 1FDAA 4J90A 1YZ6A 5CHCB 1N5SA 5KFNA 4KPYA 1T9TA 1JLBA 4DX8H 2MQQA 3I0RA 4CM0A 2V8GA 4JI2J 2W9CB 1NJXA 4RNOA 1W2BR 4OJHA 1S9EB 3FCWA 4OIXA 4WE1B 3MFIA 2B9YA 4ELVA 4PXEA 4X65J 4G6VB 1JXLA 4UZBA 4KFBA 1H72C 1FHTA 1FK9A 4M94A 2VFSA 1URRA 4LFAF 1F3VA 2EI5A 2VUGA 1HNIA 4LF2A 4RU9A 4PR6A 2MZJA 2MQLA 4PRFA 2XWXA 1NKBA 5T14A 3LO3A 3Q8SB 2YKNB 2OI2A 5KFCA 3TVYA 1KN6A 2C2MB 3DM2B 4LF4J 4P72A 1LWEB 1YZ7A 3BGOP 2ZDOA 4DV0F 2ZZMA 5KG2A 5AE1A 3VCDA 3CCUS 3OL9A 4C8NA 2K3IA 5KG0A 5MAOA 4CYUA 3M2RB 1T7PA 2F4FA 2FB0A 3EDQB 4FNIA 3QO9A 2RQKA 1HLWA 3Q83A 1RAAB 3I4HX 1X4CA 5A8WB 5BR8J 2EWHA 5HN0A 2BE7D 3GIIA 3QGPA 1RISA 3O8WA 5IXUA 3I5AA 3AHPA 3ZTQA 4L3KA 3H5YA 4J37A 1S1TB 5IT4A 4GKKJ 2FLLA 3L7OA 4MJKA 2AMCB 3SYZA 1ZYQA 2HMIB 2HNDB 1S6PB 2HQCA 3NMRA 3MCMA 4I6YA 3NOGA 3BJYA 2DXEA 4DCJB 3LH2S 3TO8A 5D3GB 2MKIA 1IKWA 3FEYB 3PX4A 4OV6A 4P52A 5C25A 1CLFA 4F2SA 5HROB 2C28A 2OMLA 1WF2A 1TR0A 4EWTA 2VA3A 1X4HA 1LW0A 4X66F 2I2YA 5KFOA 2GAHC 2ASYA 2C1EB 1HARA 2V67A 4OYWA 3SSRA 2CKWA 1S9GB 2OPRA 2FTRA 4LFAJ 1FX2A 2CIMA 2FZCB 5KFVA 5D0GA 2ZD1B 5FLXU 2H65B 5H9EK 1KONA 1N34J 4RNHA 3F41A 1RWPB 2HPUA 2M5YA 5J2PB 2RF2A 4OHVA 2AZ3A 2CZVC 1RCOB 5HJXA 2CPEA 4OI6A 1EP4B 1Q1KA 4KPCA 4W90B 2WCXA 8AT1B 4DV0J 4WTOB 2W7OA 1X4AA 3G4SS 2DHGA 4DHVA 1VQYA 1GX5A 2C22A 1YIJS 2Y9HA 1A9NB 2AJQA 2HVIA 4CH1A 3EZ5A 1C0UA 3FFIA 3UFCX 1AYEA 2XMVA 3R5CA 3MM5A 2OEJA 2DR7A 1WWHA 1RYRA 4FYDA 3T3FA 4HTIA 2NPIA 3M9NB 1LKZA 1E6YB 1X0FA 4IG3B 1MWQA 1TL3B 5B0BA 3CO0P 1UTAA 2KRRA 4TY8A 4P7VA 3RGIA 5DZ7A 3SBMA 1RT5A 2LP4A 2R8GA 4X66J 3QATA 4ZVFA 4M5HA 4F4XA 3VQSA 2E29A 3SFGA 4Y6IA 4R8UA 1N5VA 2HQGA 2D7SA 2CDRB 2KT3A 3V4IA 1CSJA 1DTTB 5A6PA 3P5BP 3R5AA 1TL7B 3NGKA 1UVMA 4DPYA 3VVTA 4PWDB 4YB6A 1PYOB 4NOHA 1UJ4A 5L9XA 5J2MB 2R8IA 1KLMA 1ZM9A 1TL5A 4WK1A 3A3NB 2AWZA 2H9ZA 4I0WA 4YMEA 3IM8A 2YNGA 3TAMB 3HMJG 2HBRB 3TZXA 4NZ0A 3PW7A 3HHEA 3TNVA 3BGFA 3I4PA 3J7Z5 1ZA2B 2G9OA 2O66A 3IG1A 4ZP9A 3G8SA 3KOAA 1R8HA 1HYSB 2AD9A 3MM9B 1NZ8A 4NASA 3HM9A 4G1QB 3RAXA 3QT6A 4DPXA 2APOA 4DX6A 3DHXA 3DOMA 3QSYB 3AXMA 2GVZA 2D3UA 4WKRA 3QJPA 2PFFB 4DI6A 1M5VC 1I3OB 2Y8YA 2OJ3A 1NDKA 3MMJA 2AYMA 3GJSB 5LOQA 2IRXA 4OHXA 1TV6B 2OAUA 4ZPDA 2BW7A 4MK7A 2LXUA 4A47A 3BBCA 1QJHA 2XSFA 3DGPB 2CWKA 1HHTP 3M8PB 2DY1A 2AX1A 2DGQA 3TZWA 2MKSA 2ALZA 2J9CA 3DRYA 1XTZA 3Q89A 5A8RA 4YR0A 4WIQA 2DHHA 3AB4B 2HG4A 5GAHU 4ECWA 2KZMA 3RW6A 2XCPA 2O01C 3K59A 5HANA 4JI6F 2AIRB 4C7QA 3JAMY 1X4GA 1Z1ZA 1JLEA 2XNQA 4W92B 1J27A 3ILJA 4NE9C 5AXLA 4C8KA 2BMBA 2H51B 2HVZA 1GT8A 1DARA 1TL1B 1IKXB 2HBQB 1S1WA 2CVIA 2NSBA 1RHKB 4Z7CA 3VTIA 5LMNF 5GADI 3OXGA 4PG6A 4K5SA 2B51A 1KOOA 1KFSA 1J5EF 5KFDA 2J6UA 4FKXA 2FHMA 5E3RA 1D9AA 4F25A 4FNHA 3L3CA 5EWEA 3G8TA 4U7UD 2VJUA 1HWKA 1ZBTA 3V5RA 4P71A 1X9WA 4UUWA 3IWXA 3U1MA 1ELOA 4IKAA 5F8JA 4WFBQ 4IRKA 2XB2D 3KG4A 1FO1A 3K8WA 4C98A 4EI2A 3PYEA 3UNGC 1VQOS 5HP1B 1CPZA 1M5PC 3PFEA 4FS2A 3US5A 1ACMB 4U95A 2JDJA 2VODA 3HF5A 3FRYA 4Y2IA 5B0AA 4DDFA 3JQKA 2JWNA 3M8QB 4OYOA 2A1BA 2D69A 1PYTA 2CQ1A 1OIAA 4JI6J 3SEOA 5C24B 1SJQA 3MMAB 2XMWA 3SCJE 1RXOB 3FZBA 3I6PA 1K8AT 2CXEA 2CWXA 4DR2F 2HWIA 2RHSB 2PEHA 4M1KA 4KGVB 1ZETA 3LAKA 3DLLQ 3IWLA 4F2RA 2CRLA 1C4AA 3WQPA 2V68A 2NZCA 3SQGA 3ZZRA 2DXFA 4IH5A 1P6TA 5LMNJ 3M30A 3MR7A 2HKEA 4OX9J 3MEGA 4QWEA 1J5EJ 4NMLA 3RR7A 2VBWA 1NU4A 1QY7A 1AXQA 1FI4A 1NK0A 2C2ZB 4LSZB 2RAQA 4UUXA 3RAMA 2XSJB 1CULB 1FWLA 4DCPB 1NK5A 3LUYA 2ZH9A 4FDFA 5KAKA 2AYGA 2G13A 1WHYA 1S0MA 1WD6A 3OXFA 2MSTA 2HQFA 1UJ5A 1SCJB 1DTQB 4P7TA 2J0QD 3H40A 1UFLA 2VL1A 2DGSA 1UA0A 2W7PA 5JMNA 3VGVA 5MLCV 2RS2A 3UQSA 2YVSA 3DOLB 4ED6A 4D3HA 3U1LA 1YJWS 4C0HA 3HXMA 2EVZA 3MPWA 3I0SB 1NCLA 3HHDA 1QUVA 2ZH7A 2R7QA 2ASLA 4YN3B 4IQXA 1LWEA 3C8YA 4KH0B 2ZHAA 4ED2A 4OZ2A 5KFTA 1JLAB 4QIFA 1Y0HA 1CG2A 4K4WA 2FLNA 4LRDA 4DR2J 3QQCD 5D0HA 2DGOA 4V19J 1XIQA 3IN5A 1F3FA 3GTYX 3WHIA 1LXJA 2U2FA 1PG5B 2L9WA 2DD8S 4EMDA 1S1TA 4MMOA 5KFZA 3RAQA 3TARA 2FGCA 1XMBA 3IGNA 2NUUG 4P2MA 3LP2A 3J7YU 4FXDA 3ILOA 4CM2A 1M5KC 4N47A 5D3GA 3DRRA 1R31A 4ITSA 2XMAA 5HROA 5J1EB 3K5NA 4A8QA 4F8RA 4TN2A 3MM8B 1U49A 3TAQA 5AXNA 3PTWA 4CIOA 1WJ9A 2Y1LB 3EGZA 1BQMA 3HLUA 1F1BB 2DCUB 2Q6CA 2PIIA 2QGFB 2OSRA 1QE1B 2A0FB 2YX1A 1FD2A 1OY8A 2F7VA 3A8IA 4MFBB 4RO0A 4IOBA 4KHRA 5J2PA 2JEIA 3ILIA 3QJJA 2QL5B 1M0SA 4WIIA 4FF1A 1HBOA 3V6JA 3W8PA 1MU2B 4OQJA 5DG8A 2CNOB 2VG5B 1T8EA 1JXEA 2DR9A 2KN4A 2HYIB 2ZH2A 3UE2A 4U7CA 3KUGA 1FJ7A 1C0TB 4ECYA 2VDIA 4QWBA 3VWSA 3KHLA 2AGPA 4ZVTB 4QBUA 1K9MT 3MEDB 5E5NA 2B56A 3MECB 3MURP 1Q8KA 4I7FA 1H6KX 4RKUC 2KTQA 4K50A 1VI7A 1U2CA 1CEZA 5A2QY 4PYDA 4MH8A 2ZBRA 5B08A 2QE5A 1DJ0A 5HJYA 1M90T 1NJYA 5G0RA 2IM0A 4FVMA 3AODA 3D66A 1P8GA 1V3SA 4DV2F 1U1KA 4LIRA 4X4RA 4P75A 5KFBA 3HJVA 2MJUA 4FXWA 4DFMA 1PKUA 3G86A 4FN5A 1FFSB 4UTGA 1K0TA 2BBEA 2V69A 1HA1A 1GMVA 1CJTB 1GNKA 1UVKA 3RYLA 2XHCA 1LXNA 3CDUA 2CPYA 3DKDA 1HBMB 2DYAA 3BPDA 3M9MB 3C15B 1P1TA 2RRAA 4F3MA 4NMXA 3DGVA 4H4MB 2DR6A 2DH7A 3UVJB 2E9TA 3BKFA 2ASJA 3O1LA 1SQFA 3MAAA 3TRGA 4QPXA 1MMDA 4NCAA 4USKA 3ONQA 3CULA 1XC9A 3KMSA 1HR0F 3E01B 3VAHA 3W2WA 1NDPA 2R2TA 2EC2A 4KSEB 1SJ3P 2JLFA 2HS4A 2LECA 4CO3A 2PMZD 1UMJA 4J7CA 3SV3A 1SL0A 1N5TA 2OELA 3UDLA 2WSCC 4EZ9A 1WG4A 1T3NA 4NLVA 2J7UA 2R4FA 2LQJA 5A2QU 1ZTWA 4IFVB 2YNIA 4LIWA 4GC7A 3NCQA 4P9SA 4YB7A 5DQIA 5DDPC 4IOAQ 4IRCA 1F5AA 2WB4A 2GW8A 2NS1B 5KOXA 1RUSA 4LF8F 4TYAA 3J7AN 1VMBA 3M4XA 2MQNA 1XR5A 1U8WA 2IVYA 3S7RA 1ROFA 3LTOA 4KJIA 4ZLLA 1D0EA 2WZ1A 1Q5VA 1S0NA 2JL9A 1RBAA 1FJGF 1IQZA 5F8LA 4OHZA 4Y65A 5LSLA 2RRNA 2G1DA 5CYMA 1CJVA 2ZUGA 3GP9A 3T19A 5F9LA 1RTZA 2ZZNA 3LWMA 5DG7A 4X4QA 3SQOP 2CJXB 2RE1A 2WSFC 1RWUA 2B8QA 2FJBB 3RUBL 2DB1A 2LCWA 4ZIVA 2UV8A 2YPYA 4DR1F 4NLTA 2FLOA 4ZPBA 1XR7A 4PG8A 5DLFA 1HR0J 2CZ9A 1TZ0A 2NYHA 3WDOA 3N28A 4L75A 4MKBA 1L3SA 4P73A 1KLNA 1IKXA 1EQMA 2J9EA 5E41A 2H5JB 4IH6A 3BPSP 3POTA 4F4AA 1FJEB 1GK8A 2VHGA 2MHNA 5HLFB 4MK9A 1PJ6A 2B6AA 2X1GA 1ZPVA 4YY3F 2CNKB 2LLZA 1HNWF 1GH8A 2BE2A 2EW9A 4RW7A 1UAWA 4B17A 1W26A 3RBEA 1RHQB 2J7KA 2F65A 5LM7E 3BBBA 3KMQA 3CCES 4LF8J 4Y2CA 1NHVA 4O3NA 5KT3A 4ENOA 4H54A 3TQEA 4ANDA 2MSSA 3A1YG 5CD4H 3CDWA 1FJGJ 3G6VA 5HP1A 4OYPA 4RWXA 2MKJA 4K4ZA 3QZ8A 1RJJA 2X1AA 2VG7A 5KFMA 5B0CA 1CS4A 5L39A 2IVMA 4ZITA 4WFNQ 1O0PA 2YNFB 3GFXA 3GJTB 4PXBA 1YJ9S 4M5JA 3DRSB 4J9QA 3HKWA 5ETOA 4F50A 3SSQA 1KBRA 3N4WA 2BKNA 3DOKA 2ATCB 4C8MA 2ACMA 3LP1B 4AYBD 4DR1J 3IS9B 5D4PA 1HPZA 3RRGA 1VRUB 3W64A 1RAIB 1QAYA 1L5UA 2L08A 2QZ8A 2DBBA 2HHPA 4ZLJA 3HHKA 3IBWA 2AF6A 4OLOA 2VICA 5KFQA 1Z2LA 2UUTA 4RW4B 4E0DA 3P3DA 1KTQA 2FDNA 2MQOA 2XMMA 4Y34A 1DRZA 1T9XA 2UXDF 4YY3J 1H73A 1HNWJ 2ZKTA 1EJ7L 1VQMS 3VAMA 2VFTA 3BSCA 3QPIA 1AT1B 5GADU 2KG0A 5L1LA 3RBZA 3QWUA 2V4JA 4UF4A 2G0IA 3VR1A 1RK8A 3CD6S 6AT1B 4USVA 3KLGB 3IAS9 2YBVA 5H9FK 3R5DA 1UJ6A 1DTQA 5IQQA 2HFZA 3L09A 4QJVA 2HNZA 2BRLA 4Q7AA 4KH1B 4CCHA 1H2UX 3KJQB 1CQNA 2BXJA 1S1UA 2CJQA 3OD2A 5F8MA 1LV5A 4UQTA 2P9CA 4EK2A 5M2RA 2CJ9A 2PGCA 1T95A 1H98A 1IXKA 3W65A 2KYZA 2D1CA 2WVFA 5KG1A 2U1AA 4TU8A 2DVIA 2FJEB 3V6DA 2MHEA 2CPDA 4O4GA 3ZZUA 2QA4S 2IPOB 4ZPVR 4EGLA 5EUHA 1RE1B 2D41A 3GCXP 3W63A 5RUBA 2B9WA 4CQ1A 2HHSA 1A6LA 4ZVOB 1WF0A 3EZOA 2V0NA 4NXNF 2UXDJ 4Z7YA 4DS4A 4MIAA 1QVFR 1HL6A 2B4VA 1DURA 4TU7A 1S77D 2PE8A 4XDCA 3JTOA 3G82A 3GIKA 4B02A 2F4VF 3MM8A 4ZP6A 4J9SA 3G9CA 1MMLA 1U1PA 1R3NA 5L1KA 2HQDA 5I42A 2KVIA 2MB0B 1SQEA 1V5IB 1FRKA 2ILYA 1FVQA 2BOPA 2NXUA 3TEGA 1N33F 2Q1LA 5EWFA 1S6QA 4R0JA 4QYZK 2XCAA 1HMVA 2F1FA 3H7HB 3FCHA 4TKTA 2UVRA 4HDHA 3B8HA 2ADCA 1MU2A 2HRTA 4RBUA 2DEJA 1IR1A 2XS5A 3D54A 2V8VA 2VG5A 4USMA 5DM6Q 3OJUA 1IM6A 4UOFA 5A8KA 1M1HA 2H3EB 3CCLS 1C4CA 1C0TA 3IO1A 1T9WA 2HAFA 3MEDA 3VF0B 1GAOA 3CCRS 1RTHB 3MECA 4IOCQ 2GIRA 4IFYB 1XMOF 1NDCA 5KG5A 2YTCA 2JJ4D 4DSIA 3FEXB 2M8HA 3KNGA 4NXNJ 3NGUA 2FVPA 1XERA 3MR2A 3U7JA 2VH7A 4B3OA 3KXDA 2YWHA 1NKCA 1B3TA 1SKUB 2XC9A 1C1BB 1RBLA 4NX9A 3CO9A 3DLKA 4NYZA 3FMWA 2F4VJ 4ECUA 3PYFA 4IH7A 4M95A 5B0EA 1DLOA 4MT1A 4KGXB 4WXOA 2PSZA 1IBCB 1CJTA 2HIYA 1OYDA 4YP3A 2C2DA 2GO8A 1HQEB 2RU3A 1ZAWA 2MY8A 1N33J 1S59A 2Y1JA 4DSFA 5LJ3Y 2DR8A 2GJ2A 2KZZA 3QLHA 4H4MA 2LQ8A 1UKUA 3TI0A 1Y5NB 3I9ZA 2B43A 1JJCB 2RSQA 3GR0A 1SJ4P 4DZDA 3BGLA 1X4EA 1P27B 2WTFA 3TZYA 4ZPTR 2HNYA 4C48A 1S99A 1FKPA 1DY3A 4RL1A 2ZVSA 4G65A 4ERDA 3C16B 1TU0B 2IM3A 4OV1A 3MCNA 1JLGB 5L1JA 1LWFB 2V9KA 4OI2A 2A3JA 1R6VA 2HZAA 1WEXA 4Y2MA 2W8LA 1FKAF 1N88A 3HVAA 4F67A 2VPYB 2K3KA 1H2VZ 5J2NA 1TUWA 1XMOJ 4X4NA 2XG8A 4LBIA 2YKMA 2G2OA 3A13A 2DH8A 3KWMA 3TUJC 2MQ8A 3ITHB 3KLHA 2V5HG 1S76D 2DNGA 1S48A 2IYGA 2DY9A 1SKSA 2OEMA 2OPQA 1NLKL 3O3LA 2JZ5A 3KK1A 3TAPA 4NYOA 3QYYA 1U0SA 3MPYA 1ZS6A 1UPPA 1UEUA 4CNZA 3NLCA 4K5RA 3TX0A 1SKWA 4OHYA 3QBCA 3M2VB 3NS6A 4EZ6A 3SMZA 4HDGA 1FJCA 1Q82T 3D1QA 2Z8QA 5CCMA 1N52B 4DEZA 3SXLA 2HQIA 3B4MA 2FHKA 1R0AB 5DLGA 4XIUA 2XMKA 4EO6A 3BF4A 4ZJQA 1WSRA 4YQWA 1QAXA 3PKMA 2MZRA 1WOPA 3TZZA 3SZ2A 5EX3A 3WZ0A 3GJQB 4ZOSA 1SVDA 3CSKA 2VFVA 2CNNB 3I31A 2JLEA 1WC0A 1Y5LB 2A18A 2P9GA 3I56S 3R5BA 3T9NA 2J0WA 4DG1B 5IT0A 2RNEA 3H59A 5KG7A 2R7SA 3IA0A 2N4DA 3BQ0A 5J2QB 2P8IA 1H7XA 5JVHQ 4JV5F 2CQIA 1X7VA 4N5SA 1HQ2A 3JSBA 3MHYA 4ZCKA 2KH9A 3FQLA 3T6JA 3FSXA 3CCSS 3MM6B 2AEJA 1TKXB 1RT4A 2X1BA 2G1HA 1SIWB 1V5VA 3C66A 1FWPA 1KP6A 3ZZ0A 3KUEA 3UI3A 5IQ6A 4A8KA 1FA0A 1HBUB 1T03A 4RU2A 3D0HE 1RP5A 3HULA 5EN1A 4I2PB 2JVRA 1U1MA 2XYHB 3R2CJ 2LXIA 2B4OA 1QTNB 4FPRA 1UL3A 2GNKA 5GMKa 2M7SA 2GIQA 5KFEA 1NAQA 3OHAA 5BJRA 4EUVA 2M9KA 1M1KT 4A48A 3IS9A 4PWWA 3W5YA 3ZZPA 4ZVRB 4DN0A 2QYCA 2C3PA 3OV7A 1CJUB 3HT3A 1HWJA 2AGOA 2MEWA 2GFFA 1SJ1A 2FVCA 2YNHA 2F40A 2HHWA 1K1SA 2HK3A 2PT0A 2OD4A 1FF2A 3P45B 1RHMB 3MUVP 1O5JA 2EG2A 3KUHA 3AT1B 4OYZA 3RU0A 2DGVA 2DXDA 2IAJA 2QT7A 1FE4A 2LU1A 1F60B 2W2OP 1RT3A 1JLBB 2R7OA 3NGRA 2EK1A 4OHWA 4JV5J 4NA1A 2W2NP 3I0RB 3D9BA 5LSOA 1EKSA 1J2VA 1JJ4A 4O3RA 3HVTA 5KOWA 1XK8A 5HQMA 2FY8A 4CH7A 5CYJA 3KYLA 3SDEB 2DO4A 2D9PA 2RQ4A 5DDOC 4O3QA 1BC6A 4AUKA 3MTJA 1FK9B 3OVSA 2CAJA 5KFSA 2E5IA 2VDHA 1A7GE 1TK8A 3K5OA 2R3VA 3S1TA 5IM0B 4IYQA 2ATLA 3EXYA 1HI8A 2BJ3A 1IUJA 3CCWA 1N0VC 1YGYA 1FXLA 2GQCA 5ETMA 2AJ0A 1RDRA 2CQBA 2RQCA 2BKPA 4ZVUB 5ETKA 3BB5A 4CYUB 2NLWA 4AD6A 1PC5A 2XZTB 1JB0C 3QO9B 2A2CA 3PEJA 4I68A 3FMBA 4I2QB 1S0VA 2QFJA 1VQ7S 3NWRA 4N56A 5IWAF 4A8OA 2BJ8A 1WDTA 2E7VA 1Q78A 2X1FA 2DGUA 1X0PA 2CQ3A 4DFPA 1U2RA 2H5EA 2POKA 5DO2A 3RJMB 5B0DA 1HHSA 1BWEA 4NLDA 2XY5A 3GE9A 1NO8A 3K5LA 1DQ9A 3S6EA 2O3DA 4NLWA 4KR0B 1H0HB 4ZVEA 4EO8A 2WRMA 1EZZB 2IY5B 1IKWB 5E0OA 1KKHA 2VOOA 2QJ3A 4UOHA 5C25B 3A8KA 1UFKA 4M8LA 1ZM3A 3CGIA 2YWFA 5CYQB 1LW0B 2PMWA 3T5JA 4IUFA 4EYHB 3K89A 2HVHA 3GFYA 2RRBA 1XR6A 1UEVA 2BJ9A 2OPRB 4ZA1A 1HQUA 3HFVA 4K4VA 2F8EX 3UCUP 3AD7C 3DLGA 1CJKB 3FNNA 3VZIA 2ZH4A 3GFZA 2XY7A 1NUEA 1RGVA 1N36F 1QSYA 2DNRA 2OFGX 1W7WA 4FYVB 4TLQA 4LREA 4WFZA 4OI0A 4ZPAA 1KSPA 2ACYA 2RF2B 2Z2YB 3J81U 1VBYA 4DR6F 2FJWA 1KD1T 5LSRA 3MMBA 4CTAB 4LT6A 2R9LA 1GMUA 3CJ3A 4DZ6A 3IRWP 4LQ9A 3MUMP 3PCOB 2XMJA 4BBYA 3R3TA 5G4DA 1GTEA 5IV3A 5IWAJ 2CPIA 5KT6A 3FFIB 1DBDA 3R27A 4X4TA 1WACA 3CJKA 3O44A 5IT9Y 3I96A 3C3LA 3MM5B 3GG0A 3TJ9A 2OTLS 3R2DJ 4O23A 1N4LA 1VCTA 1S97A 1N48A 2XLIA 3ENVA 1RSCA 1RT1A 3R9LA 4E8UA 5CD4A 2E9ZA 3VAIA 4LFCJ 1NEEA 4IRDA 2VONA 1JNZB 1TUGB 4P2SA 2B4UA 5ETPA 3CW2C 1N5QA 1U1QA 1SC4B 2XMUA 4DUTA 2JC0A 2BOAA 2KFNA 4TY8B 4OZ3A 3TX8A 3PO4A 2AEMA 3D0GE 1RHJB 2HWTA 2VBZA 4YB1P 2E5HA 2QL7B 4BDPA 2XBPA 3GG1A 5AE3A 2FVRA 1D09B 3QIPA 4WBFA 3AQPA 2R8KA 2EFGA 1YKWA 4PCQA 5B0GA 4WP3A 2AGQA 4R8UB 3GFHA 1XNRF 2R7XA 4KYZA 4LVNP 2Q43A 3H20A 4OI3A 2KRBA 1N36J 1G7CB 3U02A 3I5BA 2FLPA 1QAIA 3FEZA 2LA6A 3P4UB 5F3ZA 2UV8G 2ZBCA 1KEKA 4DR6J 2ZH3A 5ETSA 4RWWA 2W9BA 4DQIA 4DXLA 3RB6A 4DL7A 1S7IA 3MEEA 5E33A 3PNIA 1MLAA 3C16A 3CCVS 2VV5A 4CI0B 2HVDA 1VBKA 5KFPA 4ZDNA 3M7VA 4USJC 2FJXA 3ADAC 2W25A 5KFGA 1A0OB 2BV3A 2HURA 4A8YA 4DMZA 2D9OA 3DOMB 3MPUB 3MPVA 4DSJA 2K1RA 2PEBA 4DBQA 4OX6A 5HQLA 3NGTA 1R89A 3JSYA 2JNJA 3S8SA 2C42A 2FPHX 1SC3B 4V19X 4I1TA 4H4OA 2GHWA 3N6MA 2PA3A 2VD3A 4FBTA 4YHHF 4QIGA 3T5HA 1FRJA 5K8MA 3IR7B 3R97A 2AJ1A 3W2VA 2HLTA 4I6WA 1NH7A 5BYQA 1YDLA 4Q45A 1UETA 1XNRJ 2MZSA 5A8RB 1F5BA 2AJ2A 2P6TA 2BJ1A 2GGPA 3P49B 1SL1A 3RRHA 2O67A 1KVIA 2CADA 3EVWA 4R0EA 1JLEB 1JXVA 1OMSA 4RNNA 4BS2A 3D67A 4WFYA 1FRHA 1RCXB 4KGZB 4NLRA 2KU7A 3GONA 2Y1RI 5FIIA 3LGMA 5D77A 1U26A 5KFJA 3GYXB 4Q43A 2M70A 4QW9A 3ZNUA 1F9FA 3QJLA 1HWUA 1JLCA 4USHA 3R8YA 3OTDA 4O3PA 1D8YA 2MGZA 3CIZA 3WX8A 1GXTA 3K57A 4W4MA 3FQKA 5CCLA 2QG9B 1KFDA 1LW2A 2Z57B 1EETA 1TMJA 4CO4A 5KFFA 3QGIA 5J2QA 4WK3A 1P9YA 2DRDA 3M1VA 2IHR1 3K8VA 1L3VA 3CF5Q 2HVEA 4LF7F 4CLWA 3F0NA 1U0HB 2JVOA 3DDKA 2QMXA 3J80U 1R43A 5IV4A 4K4TA 2BM1A 5L8RC 2R7WA 3DLHA 2QYGA 3PYGA 1NDLA 4PG5A 4U6PA 3L95X 3AJ2A 2ASDA 2LDIA 4YHHJ 4RW9A 2CQPA 4I2PA 3LOUA 1NKEA 2DITA 3VGTA 2HIQA 4IR9A 4ES3A 2BA9A 2FHOB 4NEZA 4RNFA 2NSCA 1EKRA 3ZC4A 3CWJA 5C2CA 4AE5A 2GQQA 1T9YA 1S0OA 4DS5A 4OYMA 2L9DA 3KNAA 1UW4A 1S6UA 4BWJA 1CJUA 4F7VA 1VIXA 1FFWB 2UVUA 1IKVB 4PZVA 4QIWD 4KB7A 4DV5F 1U48A 5D15A 3CD7A 4K7QA 3MEGB 5HL7Q 1TUVA 3HI9A 1VC0A 2QN6B 3M9OB 1MROA 2ROEA 3IBFB 4J9OA 4F4WA 1RB0A 1XWLA 2YWGA 3UPFA 3OQ2A 2CZ4A 4ED3A 4LF9F 1NMEB 3SDEA 4LF7J 4XK8C 3TA2A 1W2IA 2D74B 4MYUA 5CABA 4X2BA 3HD2A 3V6HA 3BZQA 2I1RA 3NGSA 1HBNB 1G4CA 1L3KA 4RW6A 2BW2A 1BXNA 4NA2A 1T9VA 2CQHA 5IM0A 2HHHF 1N34F 3HSGA 2GV1A 3BN4A 1NSQA 1YVFA 5D6GA 2HFSA 1F9EB 3RB0A 1FKOB 2BABA 1BY9A 1U09A 4J9NA 3JSRA 3PR5B 2HZVA 4LSNA 2VG6A 4KC5A 2SXLA 2UXCF 1BUXA 4I2QA 2MQMA 2KJWA 1F5CA 1I1GA 4DV5J 3VV2B 4MIWA 1Q79A 1QAJA 2CQGA 1WSVA 2RIJA 4W98A 3KJVB 3QWPA 3BSAA 4JBCA 3OW2R 4PG7A 1HNVA 4X4UA 1Q8LA 3LP2B 4O3SA 2IM1A 5BYSA 1V6HA 2GS8A 2PA8D 4FYWB 3DRRB 2Q66A 2R2UA 2NXEA 2DNHA 1GX6A 3DXBA 2BJ7A 4LF9J 3KJNB 1FTRA 1FT8A 5CYQA 3DRXA 4KBIA 4QIEA 1YJVA 3PM9A 5EGYA 2DEIA 2E1PA 2HZCA 3P5TL 1BQMB 3HZGA 3CB4A 3IXQA 2J6SA 4RZRA 4MAKA 3N79A 1TMMA 4CLTA 1T02A 1WC5A 4O0NA 1UW9A 3RG6A 1CJKA 2Y0BB 2HHHJ 3IGVA 1O8BA 4ZKAA 1Y00A 2VASA 4DL0C 3CMQA 3FSYA 5F0UA 4RUBA 3EGVA 2IMOA 3IR6B 2WVDA 1HBOB 4J9PA 1LWXA 1NB2A 1S57A 3WC2A 4CTAA 1OQ6A 4LJMA 5K5MA 5A76A 2VBYA 4JV1A 3AD8C 2Z4PA 2J7WA 4HT7A 4NZ7A 3DI6A 3PVXA 2HQ3A 2XI2A 1NJZA 1SXLA 4KTQA 4DCOB 5KFWA 2C2KB 4X4OA 2UXCJ 2YWWA 1SH3A 2V9WA 2W8KA 4ZK7M 4PEOA 3F73A 3ZZOA 3QAUA 2JRSA 4I7FB 1LNQA 3HZEA 3M2UA 3VZHA 3ZTPA 1U1OA 2IIHA 3C6UB 1LWCB 1X9SA 5I4MA 1OSCA 1WEZA 3PRDA 1TQLA 3B4DA 5THWA 3OVBA 1QTMA 2ADBA 4C8OA 3HP6A 3W9IA 3CDAA 5G0RB 5DM7Q 1HI0P 2JLGA 4WPAA 1HHQA 1YQHA 3D6HB 4WKYA 4OYBA 4ZCIA 2RILA 2B7BB 3R5GA 3CJ4A 4L72B 1SIZA 1U47A 3R7NB 3SCKE 4KGMA 4IO9Q 3ZZYA 4WXWA 3R7BB 4ZVGA 5DETA 3GPAA 1HKAA 4ZMMA 4PPZA 2WK4A 2M52A 2K7JA 3I87A 2DH9A 3D3CJ 4QZVB 4UQGA 2D3O1 1FERA 2UXBF 3OLBA 4UOGA 3D3BJ 8ATCB 2DO0A 2V34A 3MAAB 1UA1A 2FGOA 3JB9k 1IJEB 4URQU 4HACA 2EBEA 3ZZTA 3W2WB 3JTPA 4LBHA 3PHEA 3M32A 4IG0B 1KR4A 2GVDB 5CH7B 2B3TB 4LBPA 3SFUA 2DJWA 1KQGB 5E7OB 4LRAA 4OLPA 3A4TA 3BKUA 1NK4A 2BZ2A 2QSFA 2YNIB 3ISZA 3FRZA 4L74A 5F8NA 3MM7A 4B3TF 3K0JA 2K8GA 5F8HA 1U45A 3WX4A 1N8RT 2WHOA 2J9DE 1KNZA 1RTIB 1R8AA 1X5TA 4ED7A 1T94A 4EYIB 3FCVA 2DHXA 2QRRA 1LQ9A 1RKIA 3EPGA 1H3DA 1VOMA 2R7UA 4IO1A 1CQMA 4LF1A 4C11A 1RADB 2PDAA 1T05B 5CYMB 1CJVB 2HHVA 3EZUA 3M8SA 3DU5A 3FC9A 4AT1B 3EXCX 4RNMA 3UDCA 2F8HA 4YFUA 3E2EA 1VC6A 1WC1A 4A8FA 4RUHA 2VOPA 1DFDA 3IBCB 1AB8A 2JEJA 2BR0A 2UXBJ 3WIVA 3CIMA 4DL2A 2V8DA 2CPFA 1JKHA 3V4MA 2UUBF 2ZH8A 1PAEX 1EB0A 3IM9A 2UVVA 1VQ5S 3KHRA 2KXHA 4ZVPB 5IC6B 1S4EA 2X3GA 1REVA 3D2WA 1PJ5A 4MKAA 3A3OB 2NXNA 3POTB 4B3RF 4YR3A 4A8MP 3GLJA 3R5JB 4NLYA 3M8YA 4OX9F 2B6AB 3HFZB 1BGXT 4Y00A 1TFWA 4B9NA 2BE2B 4RW7B 4CZCA 1WTFA 1TKZB 4B3TJ 4LR7A 4TQRA 2C2EA 2ZHOA 1NNDA 1RU1A 4JI7F 1WKKA 1U0HA 1ZA1B 1N5YA 3ENAA 3LPEA 3RW7A 1UWBA 4QU6A 4ILMA 4YEAA 3CJ0A 1RA6A 4NA3A 3PX0A 2VG7B 2XULA 4HH1A 3W9HA 2CVEA 1CS4B 1RKJA 1T3OA 2XHWA 4RR5A 3FGVA 3LPYA 3B82A 1Y10A 2G2YA 2Z58B 3GIRA 3JAMU 2R7VA 3DOKB 2XO6A 3KK2A 1YJNS 1FRXA 3NNCA 3GV7B 1HD0A 4FZVA 3HX9A 3THVA 2UUBJ 1HPZB 4P2XA 2GJIA 3FUYA 2V8PA 4GVBA 1FEEA 2UZAA 2KXNB 4TYBA 1IWGA 3W62A 2Q79A 3HSDA 1IKVA 1TP7A 3OL7A 3ET6B 4WYLA 1MWZA 3FVYA 5KTQA 4B3RJ 1WDDA 4F26A 2WONB 4DF8A 3PHTA 5EX0A 1PJ7A 2ZH5A 1I51B 2R2SA 2P9EA 2B4PA 3H2UB 1SJRA 4NRUA 4J9KA 2ZH1A 5KT4A 1TKTA 3FKBA 1H38A 2LA4A 2BRKA 2ZOFA 2CJYB 2FHJA 2V4JB 4B9LA 4ECZA 1WEYA 4OZ0A 4OJ3A 1YTYA 4C3LA 2QMUB 1ZTTA 2QLXA 4JI7J 5GAHI 1S1XA 3NS5A 3F44A 5BYRA 3WC0A 4B3SF 2OGUA 4F36A 2FZKB 2WVEA 3IRXA 2B5JA 3AOCA 1U02A 3UD5A 4NLPA 2HNZB 1KVJA 1HBNA 4R5PA 3OR2A 4JI4J 1D3WA 1S1UB 3ISND 3R1HA 1Q95G 3V6KA 2W24A 2BE9B 3N9UC 5GVQA 1EX8A 1NSPA 4WF9Q 3PKYA 2ZNZA 3G2XA 1TFYA 5D4NA 4MK8A 1VQ8S 4CO0A 3T1HF 4NCBA 3V6DB 1FKOA 4O4GB 3OJSA 3X3UA 3TVKA 2NXJA 5KFUA 3NOCA 4NCGA 4DWIA 1C1CA 2MYFA 2BANA 2M0GB 4LUBA 5KFHA 1NM2A 4NI2A 2IDLA 2PI5A 1VJWA 4DU8A 2DNLA 3KJVA 3ZO7A 2KHDA 3K5PA 4DQPA 1VFJA 1BLUA 3KLFA 4C8ZA 1NH8A 5HI7A 3P96A 4NLXA 4AL7A 4C97A 4IQMA 3BM7A 3G82B 4QPTA 3Q2TC 2HW3A 5ETLA 1YSJA 3Q8YA 1NK7A 5B0FA 4YOEA 2RT3A 4ETZA 4WU2A 2ZUAA 1N6QA 4B3SJ 2DIUA 5I42B 3ZFVA 2WVCA 4QWDA 3KLIA 3GCWP 2EFQA 1LFPA 1HWIA 1NSKL 1S6QB 1ZZFA 3NBPA 2IA0A 1VK3A 4WFXA 4I4BA 6FDRA 3FBFA 1HMVB 3BGRA 1FDNA 2ZWOA 2P2CB 2QV6A 2ABYA 3QSIA 1SPBP 4RUAA 1Q81T 3EGWB 2DRBA 1T0TV 3H4DA 1YBAA 3EVOA 1LOUA 2HFNA 3T1HJ 4JUZA 3DCAA 1Q7LB 4USUA 1UP1A 5A8KB 1JMTA 2B8PA 2QLWA 1HI1A 2AU0A 2Q3PA 1WG1A 1AZSA 3K2YA 3LAMA 3PIPQ 1RA7A 1WF1A 3G96A 4B9MA 2AW0A 2HFUA 1FNXH 1NSAA 3C6UA 2YKPA 4TNOA 3PRVA 4HLBA 1LWCA 4CT9A 1OY6A 4WTYA 1MN7A 1K1QA 3RZAA 4B3OB 3JTNA 2NUHA 4F0KA 1QVGR 2YXLA 3MD1A 4ECQA 2AJFE 4C0BA 3DLKB 2AQ4A 4Q2MA 2AX0A 1FRLA 1DLOB 3HVRA 3I82A 3H2VE 4DSEA 2Z0GA 3HT0A 3GWCA 2I6WA 4BLGA 3RB4A 3E8OA 4FVCA 2EKNA 1X8DA 3VALA 5ETRA 1XEZA 3T1YF 3C14B 1Y4ZB 3BR9A 4ID5A 3JYTB 2HGMA 1TVRA 2BYCA 3ETOA 3PDNA 3H90A 1OY9A 1UVLA 1OWXA 4ANEA 4PKDB 1XBWA 2H1YA 3V81B 4DV3F 5CXTA 4XPCA 3QLHB 3PXGa 3BSOA 1VS3A 4Z2XA 4X4PA 1IM4A 2DNPA 2ZC4A 3FBBA 2UUWA 1YJ7A 1BQXA 4GVLA 2OTJS 4NPOA 2HNYB 1RT2B 2DIVA 3O5TB 1WOSA 1N56A 1FKPB 2QLBB 4IG0A 4J9MA 2GVDA 3BSNA 2YQ3A 4Q5VA 2FHJD 1APSA 1X4BA 1H74A 2C2NA 3KDOA 3HHNB 3NG8A 4DPUA 1P9QC 3HSZA 3DC2A 4WYWA 3PX6A 2QA2A 4YS2A 1FX4A 2DNZA 5F0WA 2K2PA 2DHSA 1RAHB 5J2NB 4ZPCA 2M8DB 4HI2A 1U24A 3BV8A 4F4KA 4N76A 4LQ3A 1RWXB 2YKMB 2BX6A 3D7SB 3DRPA 1ZAXA 2IVFB 1QD1A 1B99A 2R8HA 1RTIA 3KLHB 2N82B 5AT1B 1BQNB 3QT5A 3DYAB 2FQQB 3NKYA 2H4WB 2A10A 2M3DA 4KO0A 2OPQB 3FJ2A 1VDHA 2VKRA 4JI1F 5KT7A 3MEKA 4RBTA 5C2GA 3KK1B 2JOQA 1VRTA 1WKLA 1T05A 1M1GA 1R0CB 2AHOB 3RR8A 1KQFB 5FLXY 1Y5IB 3T5KA 1G2EA 4X64F 3I32A 3T1YJ 1WNEA 4C9DA 4BHQA 2QEXS 4PQUA 4UW2A 1RYSA 2JEGA 1IKYA 3ZXWA 1LK5A 3AY0A 4N7TA 3BYPA 4DV3J 2FJAB 2GAGC 1Y3KA 2IJFA 2HS0A 2J76E 2W4DA 3RBDA 4ZJOA 1ZOTA 1SUQB 3VQTA 5E3AA 1KTVA 1I5OB 2XEXA 1WORA 4ID8A 5HK4A 3OFHA 4DFKA 2G0CA 3RRKA 3MCOA 4BWMA 1RLCL 3HHLC 2DTJA 2QO3A 3DLJA 3NY0A 4ZVQB 3EM1A 4NEYA 4JI0F 3GSDA 3M05A 1X60A 4KIAA 1PBUA 4GKJF 1Q53A 3Q8QB 3HK2A 1U2FA 3MMCA 1NPKA 3AB2B 3PYDA 2V4QA 4KGKA 2CYYA 1TKZA 3MF5A 2W2MP 4MKYA 3FBCA 4NXMF 1RT4B 1UVJA 5F8IA 3CCZA 4QYRA 4M5MA 4JI1J 1PSDA 3PG9A 3BDEA 3BO4A 1WC4A 4JI3F 5IC4B 1T03B 4CLLA 4CH0S 2E7WA 3MTKA 3TUZC 4EEYA 1XQIA 4X64J 4DQSA 2V50A 4F0HA 1B4SA 1ICEB 3GR1A 3OFEA 4C6AA 1B64A 4KV8A 1NRKA 1Y11A 4ILRA 2VPWB 4FKYA 2E5GA 3I5CA 4KT0C 1UPMB 1FRMA 3MI7X 2EXUA 5SZTA 3J7A1 2E5LF 2HFOA 2ZKUA 2YNHB 3ET6A 3B6BA 1LEOA 2V2KA 4UY85 4A4JA 2FY1A 3Q8PB 1GXUA 2HGLA 4JI0J 3AFGA 7FDRA 3MOZA 4DL3A 2WSEC 4ZPWR 3ZZZA 1ZH5A 3G6ES 3CUNA 2KXFA 2WONA 4GKJJ 2EFNA 2BUNA 2IAJB 1T9UA 1ZZNA 1RT3B 3KLVA 2A6OA 3TUPA 5I3UA 4KE5A 1YJRA 2VC1A 2XLJA 1PYSB 3OFGA 1RWVB 2KVQE 2X3DA 2HAIA 2WOMA 5K20B 3HVTB 4NXMJ 2XYPB 5JXSA 5F41A 3T9ZA 2XMTA 5T7LB 3Q0AA 3HD1A 5D4LA 2IBOA 2MKYA 1AW0A 3RTVA 3PW4A 1YJUA 4PWUA 5E3CA 5ITHA 2LQ9A 4J91A 4JI3J 1Q0NA 2CPJA 3PR4A 4JOUA 5L38A 2WAQD 3RBXA 3TA1A 1RWMB 2ZDPA 5H9EJ 2BJDA 2KDOA 3BQ1A 1VYAA 4ANCA 2KHCA 1RLDA 2DNKA 3AXKA 2IFXA 1YG0A 1YHQS 2MDAA 1KHWA 1FRIA 3PW5A 2MZ1A 3TYTA 2DPJA 4PPDA 1GTHA 4ICLB 2W9AA 2E5LJ 2AP6A 1N54B 2MJNA 1FE0A 4UT4A 3D6TB 4ZLPA 3UDVA 2XO7A 4C4WA 1RT7A 3H4BA 1RTJA 1G3OA 1U1NA 4I64A 3ENQA 4Q8EA 4M63A 2BEFA 1NPRA 3HVWA 2YX7A 2VF3A 3W7BA 1GMWA 5HVFA 1TAQA 4PABA 3GJRB 1OYEA 2DCLA 1X4FA 2E1RA 1SV5A 3QRPA 3N6LA 1X5PA 2DISA 1URNA 3CJQA 3D6FB 4MYTA 3BGUA 5FD1A 2DT9A 2J6TA 1HQUB 1N0UA 1K73T 2I38A 4MIBA 1IN0A 4USTA 3DLGB 1ITPA 4KAIA 3M8WA 2IC3A 2MZTA 3ENWA 3SCLE 4ZN3A 2GQ2A 4G1IA 2RUSA 2F3JA 2I0XA 5B09A 4JV0A 1HD1A 2DNQA 1E6VA 4KRWA 1V3ZA 1J5OB 3Q22A 2I9SA 3NL0A 2EBGA 3LANA 1ZM2A 5FDLB 3AA9A 1X5OA 3MMBB 1RHUB 2OPPA 3M6VA 2QMWA 3LP0A 5SUHA 3D28A 2KG1A 3FZ2A 5CA5A 4K4UA 2ROGA 5D8HB 3KLEA 3SI8A 2DGTA 3RB3A 2R2RA 1JLFB 1BWVA 4OX7A 1TL4A 2YWKA 1SQGA 1TK0A 2PMHA 4DOZA 3CJKB 4P10A 2LQBA 3QFHA 5ETQA 5C42A 2QL9B 3R1LA 3KK3A 5LMUF 4LSLA 1H2TZ 2VA2A 4M5DB 1RT1B 2KJVA 5EHHA 3IAM9 3E3XA 1CC8A 4TQSA 2HGNA 4ZIWA 3CJTA 1R27B 1HFEL 3GQCA 2XTJP 3TJ8A 2RS8A 3QIPB 4OL8A 4JI8F 4DX5A 2FZGB 4BC9A 3C14A 2UVWA 1D9FA 3JYTA 2GX8A 4M5GA 1RABB 3EMTA 4EFAC 5DQHA 3IWNC 3NCPA 3V81A 1LFWA 3JSMA 2KI2A 1S1VA 3OL6A 4ILLA 2RKIA 2YX4A 3BQ2A 3OUYA 4ECTA 4DU7A 2EFPA 3PV8A 4LRFA 1L3TA 3X1LB 2MLZA 2Z2ZA 1R8BA 5DS7A 2OPSB 3OTOF 1B0VA 1RT2A 2YQ1A 1GQEA 1OJ4A 2W9BB 4KKOA 3DMJB 3MEEB 3BREA 4Q0BA 2YY3A 2ZBQA 2XNRA 2ZE2A 2HEKA 3K7RA 1Q5YA 3T1AA 5KG3A 1PILA 4TXSA 2QC3A 4DR4F 3IC1A 4JI5F 3DN9A 3EX7B 5KFIA 4LVOP 5KT2A 1FDDA 3IR5B 3FK4A 3NNHA 2W9CA 4WU3A 4NL5A 7AT1B 3TP2A 2VB6A 5JUMA 5ADZA 4Y2KA 5LMUJ 2XWYA 3MAHA 2BDPA 3WIUA 1S9EA 4WE1A 2K1RB 1SI9A 2MXYA 2LXFA 1RI7A 2JX2A 3BR8A 3PIOQ 3H0PA 4GMKA 1RT6B 4P6QA 4KY3A 1BQNA 5L1IA 3O6QA 3DYAA 2HK2A 2L3MA 3DDNA 3GSIA 2R42A 4A8XA 3Q8VA 2CQCA 3NMAA 4H4OB 4CLYA 4JYAF 5IS2A 3NCRA 5I3QA 3BS9A 2YKNA 2IMWP 3DHWC 4JI8J 3W2VB 3UR3C 3BN7A 3DM2A 3A8EA 2HLUA 3SSSA 1IJFB 2XYGB 4OYAA 4CO1A 2GGPB 2RHQB 2YQ0A 3HHLB 3M2RA 3LGNA 4P74A 2VQFF 1YX2A 4JB8B 3Q23A 5HMXA 4N8NA 2CQ2A 1SUQA 2MLYA 1TTHB 2FJVA 4ECSA 3OTOJ 5A8WA 3EE3A 4HT5A 5I3PA 3U1NA 3WBZA 2B0GA 4HTJA 1JJHA 1GMWD 5KG6A 3AA8A 2KO1A 2HMIA 2HNDA 4DR4J 2CDQA 1S6PA 3ILLA 4JI5J 1JLCB 1R8CA 4PAAA 3N6NA 5HVHA 2MGZB 1SJFA 3A8JA 1O6XA 1VC5A 1LW2B 3G8QA 4U67Q 3QAEA 3IMQJ 1EETB 1KVKA 2M4MA 4DFJA 1TK5A 3ZTSA 3NWGA 1RAFB 3M1VB 2ZBPA 4Y28C 3DLEB 3TANA 2OLWA 2RUGA 2DGXA 4DR7F 2QLJB 5K8OA 4F4ZA 1S9GA 2YWEA 4K4SA 2C2RA 2ZJQQ 3MDFA 2ZD1A 2RH3A 4OFZA 5F8GA 3NEKA 2PN6A 4LR9A 5HMWA 3KG1A 2QIFA 4JYAJ 3NXZA 4X4VA 4CP5A 4RW9B 3MR5A 4ED1A 2MPUA 3PJXA 1IBKF 4V1Ak 2X7IA 1IWAA 4OX8A 2CNLB 2EKYA 2W2QP 4DV6F 1MSWD 1U7LA 4WCEQ 1EARA 1EP4A 1DZ5A 3OR1B 3V2UC 3W1YC 2VPZB 1MMNA 2P5VA 2VQFJ 4GRSA 3JXOA 1Z4UA 2GC8A 2VFRA 3FBEA 4JV2A 3L7UA 1FDBA 1Z2ZA 2GMJA 2HHXA 5JJBA 3EYZA 5CZXA 1VHIA 3TOQA 2HS3A 4ZP8A 2HSEB 1IQTA 5HMYA 8RUCA 3T5LA 4ED0A 4ZJLA 3W61A 3D1OA 1M5HA 3HPOA 2RD5C 1UZHA 1Y7PA 1E6YA 3W60A 1SKRA 4IG3A 4WJBA 2ZH6A 1D9DA 2VZ9A 2VJVA 1TL3A 2V94A 1NK6A 5CQGA 1Q8IA 3BO3A 1D1UA 1MROB 1VQPS 3BKTA 2LYVA 3AH6A 5F3TA 2FVSA 2CG4A 2F63A 1C2PA 4DR7J 2WW8A 5T7LA 1REGX 4TY9A 2OEKA 3M6WA 2JC1A 4OZNA 1KQKA 5DGBA 4J9RA 1DTTA 3EUNA 1FFGB 1WOOA 1TL7A 2DKOB 5HSPA 2DHAA 4K4XA 4B3MF 1IBKJ 3JQMA 4RW6B 4NZ6A 1EQ0A 4PWDA 2AZ1A 3KHHA 4DV6J 5J2MA 2NXCA 4HEA9 4NYPA 1KDNA 4ETXA 1VQSA 1F0XA 3DXSX 4CLZA 1FEHA 1ZPWX 2MKHA 3TAMA 1FD8A 5KG4A 2WBMA 3UNYA 3BYRA 4CO5A 1B0PA 3H2LA 2W4PA 2IYIA 3D1HA 3UCZP 4FF4A 4CLKA 5K8PA 3VAJA 4AL5A 4X4SA 2J9DA 1HYSA 4ICLA 3MM9A 4LSNB 2VG6B 1UFWA 4G1QA 2J8AA 2VPXB 4ES2A 1S72S 3L4BC 3MFHA 2GJFA 3CMAS 4YUDA 2FJDB 2NCKL 4DJBA 2N4CA 3LA0A 1Q16B 3BEGB 4EBCA 4DF4A 2ERRA 1HNVB 2GHVC 4DV2J 4LFCF 4O44B 3T41A 1TV6A 3BH7B 5KT5A 2NYIA 3CJSA 1S10A 3LQVA 5IZHA 1I94F 3GYNA 2HBZB 3W9JA 3VAKA 3DGPA 1CC7A 3Q8UA 1NJWA 4DPTA 3OFFA 2DK2A 2MLXA 4DQQA 1VBXA 3M8PA 1M5SA 3MAQA 3CXCR 4LF6F 4USIA 1G1XA 3CC4S 3AOBA 3ETMA 3TWZA 1VQ6S 2XZDB 3W66A 1YITS 2RB7A 1S7HA 2IJNA 2Y3YA 2CJKA 2J8SA 2AV5A 4OI1A 4B3MJ 3W3SA 4HI1A 2KL8A 1ULRA 3TJAA 3CEDA 2E44A 3GZ7A 3QRRA 3M8RA 1HW8A 1DQAA 2G2ZA 3QMQA 3ZTRA 2BKOA 2Z2LA 3EWGA 5U47A 1J5OA 3TW0A 1TL1A 4DV1F 2YKAA 1YWXA 4QWCA 2GMLA 5FDLA 3UWTA 1EAYC 1HNZF 2HWHA 1RZMA 3EDRB 2ZBIA 4K8RA 1XN9A 5EDWA 5FJ4A 1R7IA 5T41A 3DI6B 1W25A 2FC9A 1JLFA 4H4KC 4PUOB 4B08A 2FUG9 2QFIA 3M2UB 4ATNA 1WKJA 2WB1D 2RMLA 4QR0A 2YH1A 3TVZA 3CCMS 2OO4A 1Y9OA 3H98A 4YB5A 1FVSA 4M5DA 2EG1A 2Z2MA 4NLOA 4A8SA 4Q44A 1RAGB 3ELHA 1PGZA 5GMEA 3CDBA 4M5LA 2YH0A 5LXYA 1B7FA 5DDRC 2OMOA 1I94J 4LFBF 3CMES 4U96A 2EFVA 1ZAVA 3QFWA 4RJVA 4K59A 1NK8A 4LF6J 5KFRA 2ZM6F 5C7PA 2ZVIA 3M8QA 4ER8A 4DQRA 3UN5A 2RU9A 1U4BA 2A2DA 2V2ZA 1FWKA 1O51A 5C24A 4A8WA 9RUBA 1OS5A 4QQBA 4DLEA 3GB0A 3MMAA 4TVAB 1AUDA 1SH0A 4MKVA 1MWYA 2MQPA 3UCGA 2KT2A 2YPZA 2AJ4A 4DV1J 2OPSA 4M5IA 4HACB 1HNZJ 3DMJA 4C8LA 3UR0A 3M32B 3QIDA 2BQRA 1NB7A 5KFLA 2IM2A 2I8EA 2RJZA 2KFYA 2MMYA 2HRYA 1RWNB 4X84A 2ALYB 2GZOA 2EK6A 4U9RA 2R8JA 1HWLA 5IT9U 2YKQA 2DR5A 1OPZA 2XSJA 4MTPA 4KHMA 1CULA 4S0MA 4NLUA 1T11A 2DNNA 2IBKA 9ATCB 3MM7B 3CTRA 4M5KA 3THTA 1S79A 1VGYA 2OH2A 2E1CA 3PJ9A 4DPOA 1SC6A 4E2FB 1RT6A 4ZHRB 1QLNA 1AUSL 1WC3A 2V4RA 2BQ3A 4LFBJ 3PEHA 4AQYF 3DOLA 4QU7A 4C11B 4BC7A 3I9V9 4I67A 4F3OA 4OZ5A 4CO2A 4DUYF 3OBIA 3I0SA 3D0IE 2ZM6J 4GO7X 3GU0A 4OJGA 4KHPF 1K44A 4Y0FA 2AEFA 1PBAA 3N0VA 2O1PA 1D8ZA 4WZMA 3CC2S 1JLAA 3FDSA 3HHLA 1NPPA 1JKHB 2RDIA 2HHQA 1KWMA 3ZTOA 3HFKA 4Y2AA 3AQOA 3NP5A 1SC1B 2M88A 4ZCMA 2K7KA 4F3QA 3K17A 1RWWB 3OSNA 1REVB 4DR5F 1KC8T 4B9TA 2Y0SD 2L9NA 4ED8A 4C8YA 2N3OA 4LR8A 1UCNA 2R7TA 4K4YA 2C2OB 3CCTA 4C3KA 1SB6A 4X62F 3KDNA 5A0YB 4OJ1A 2LEPA 5J1EA 2VQEF 4ECXA 2JFDA 2MTLA 2DNOA 3H5UA 2COLA 3DLEA 2Y8WA 1UVIA 4RLEA 3OTBA 3W5ZA 3LWLA 2X51A 3CT9A 5HATA 1N5YB 2KKHA 3TQ1A 1UWBB 3GV8B 1QE1A 2H5IB 2QA1A 4C3MA 1FESA 5H9FJ 3MGJA 1X31C 2LKZA 3C6TB 4AQYJ 3U27A 1DQ8A 4MFBA 4URGA 4DUYJ 2J0SD 1F9HA 1OSDA 4A46A 2C3YA 3AJ1A 5L9NA 4NWBA 4KHPJ 3EJMA 2KFZA 3BO2A 2MKKA 2IJRA 1U1LA 4F02A 2DPIA 2IDEA 2QLFB 4F04B 3EICA 4HL9A 4CLPA 5K9FA 2HHUA 3N5BA 3OR1A 3G71S 1EHWA 1QUPA 3KK2B 4J9UE 3VHQA 3AOAA 3QT7A 2XS2A 1FNOA 1SH2A 4GVBB 4IDKB 2UUCF 3MZIA 3I55S 1NHUA 1WC6A 1KOHA 4DR5J 4G3IA 1VIOA 2BJEA 4L76A 4OZLA 2LQ5A 2Z56B 2QA4G 2CPZA 4DX7A 1S49A 4ED5A 5AXKA 4OMFG 4FBUA 3HCXA 3KHGA 3KKFA 4X62J 1S4FA 5HMZA 1QM9A 4J9LA 2VQEJ 3BDPA 4C2MA 1VJQA 1TKTB 1X5SA 3QGGA 1JNRB 4DPWA 2W1BA 1VQ4S 4FYXB 2KT5A 3KFWX 3OHBA 2CPHA 3CJ2A 1K0VA 2W4CA 4PYAA 3NAHA 2V63A 4NRTA 1S1XB 4YDXA 2E7XA 2FYXA 3PACA 5A6WA 4YR2A 2BQUA 1U1RA 4OYXA 2ZWPA 1HBMA 5LT5A 4HHHA 3IRXB 2B5JB 3C15A 1YBTA 3NRBA 1RBOB 4L3NA 4OZ1A 4DUZF 3PRBA 4HHUA 2LVWA 1BE4A 1H7WA 3UVJA 2QTWA 4R5PB 1SBRA 3R7SB 1S12A 1GXLA 5K14B 3OR2B 2E9RX 4L73A 1PCAA 3CPWR 2GO9A 4PXCA 5GAGI 2ZEJA 3L9ZA 4QYZJ 1RTDB 1I6JA 5F9NA 1MN9A 3E51A 1NZAA 3M6XA 3E01A 2ZJPQ 4DSLA 2F9JA 2B9EA 4NLSA 3LW5C 4RX6A 3R6LB 3B78A 4FF3A 5GAEI 4C0OC 1S9FA 5IOLA 4LMZA 3PW0A 5DZ6A 3OT9A 2LEBA 3CC7S 2OP5A 2N7YA 3OSPA 2JFKA 2R7RA 2UUCJ 2KM8C 3LGHA 2PO4A 4AL6A 4IFVA 4NCGB 5HAOA 1C1CB 2BANB 1V3RA 3F56A 4K2XA 2OD6A 4HR2A 2XZWA 3ISNC 1AFJA 2QSWA 4NI2B 1IBMF 5LXRA 4UY8T 2RVJA 1XMQF 4WP9A 3D68A 3KLFB 3PY8A 3B54A 4M5NA 4O44A 2CG8A 4NLQA 3MOJB 2V8HA 4GO5X 2KYXA 4QWAA 4AFFA 2CFXA 1OPIA 2EC0A 3HHLD 5D78A 3TA0A 4HYKA 1U6FA 4UOCA 3Q86A 4B9SA 1U8SA 2NR0A 1N6QB 4DV7F 2V6AA 1FNMA 2NREA 5M2UA 4OYIA 2C3MA 3KLIB 4U8YA 3MCSA 3SV4A 3ZNJ1 2JEFA 4AXJA 4DUZJ 2ZFHA 1S6OA 3VAGA 3CD5A 2C3UA 5IFMA 3NBPB 4ED4A 1OO0B 1LK7A 1XJWB 4QCLA 3BGRB 4XPEA 2RQMA 3CVKA 4FPIA 1KQSR 2WVBA 2G4BA 4CRJA 1IVZA 4LRBA 1YBUA 1Q8BA 4R25A 5D4OA 3K58A 2D3ZA 1ZM4A 2H48B 2E5JA 3J7ZT 5HLFA 3HSJA 1R0BG 1AZSB 1RACB 4WZQA 2I5JB 4LRCA 3LALA 4EU0A 4DLGA 4PUOA 2J5AA 2XM3A 4FS1A 2CQDA 5DGAA 2FIUA 1WHVA 1IBMJ 1YLXA 2HBYB 4QR1A 2DNYA 1XMQJ 3AJDA 2AYBA 2ZZTA 2HFVA 2Q6BA 3SIPB 5JVGQ 3NS7B 1AROP 3HO1A 4WFAQ 1WI6A 2ZC3A 2UP1A 1WI8A 2XY6A 4AXIA 2BACA 4DR3F 1F2GA 2YNFA 1TELA 4F4YA 1JIHA 1VBZA 1KHVA 2BM0A 2E66A 2QX0A 3DRSA 4DV7J 2F8MA 4RPFA 1PAUB 2W2PP 4BCAA 5HBMB 2G0JA 1FXDA 4CLFA 4ID5B 1BHNA 3UD4P 1TVRB 4N8OA 2P6SA 3LP1A 1JK9B 2GA7A 2JSXA 4Y3CA 3N01A 5CZVA 4RBVA 1IR2A 3UD3P 4B9VA 4EBEA 1RAEB 3J81j 4RW8B 1VRUA 3THPA 3MD3A 1NJIT 3KG0A 3G6XA 2DNMA 4CDIA 3VGSA 4CWBA 1KRPA 4ECVA 2IRYA 3CCJS 3QT8A 1RAOA 3DNCA 2J0XA 4RW4A 1VQKS 2F9DA 2PI4A 5KFKA 3GIMA 3H42A 1JLQB 1IBLF 4KQZA 5DJBA 4B9UA 1OQ3A 1V9OA 5L46A 1B70B 1TAUA 3OTCA 2XLKA 1SL2A 5AE2A 1KS2A 1VQLS 3FSIA 4XO0A 1YJTA 4FP9A 4QW8A 2JHEA 4OZJA 3G6YA 5HVGA 5HQ8A 2CA9A 1VR6A 3DRPB 2VU5A 4DL4A 1RQ0A 3PO5A 2EEYA 3KLGA 4U7UK 2PD1A 4ZN1A 4ZHRA 4O4RA 2YKOA 4KFBB 2EFOA 3DFEA 4KO0B 6FD1A 2F5GA 3D6MB 2FD2A 1HNIB 3UW1A 1YRTA 4P2FA 4DR3J 1VRTB 3EPIA 2N3LA 5DDQC 3KJFB 3PJWA 1NBEB 2B7CB 1L3UA 5AXMA 4O0IA 3QNWB 1WUUA 3EGNA 3ULHA 3DLBA 1B7YB 4PQUB 5BXIA 2HHTA 3MPDA 4CNYA 1IKYB 3PZPA 5KFXA 3J81Y 3HDSA 5LJ5Y 3O2IA 3MR3A 1NHKL 4J5OA 5ETTA 3CJ5A 2E1MC 2BVZA 2W7AA 3HJFA 5D0RA 5EWGA 2CQ0A 4YDDB 4DL6A 2A6MA 1MNEA 1IR0A 4N41A 5K8NA 3VAFA 1MW7A 3JS9A 1DAXA 3GV5B 4I6AA 3OLAA 4QR2A 1IBLJ 4WWSA 5KFYA 4CT8A 2OUGA 1JX4A 5E2QA 2B9XA 3D5MA 5A0YA 3Q8RB 4WP8A 3MMCB 2OHDA 3D4JA 4USWA 4NLGA 2PFDA 2GIFA 3QZ7A 4TU9A 3C2PA 1QSLA 2LEAA 1FTCA 2MKCA 1N32F 5M2PA 3GIJA 3ICLA 2L41A 4OI4A 5KFAA 3DU6A 3CJRA 3C6TA 2GHPA 1VK8A 1R8PA 2GMHA 2VIHA 1UZDA 2CPXA 1QDUB 4JI4F 4G1PA 1RU2A 1S5ZA 5H1SV 4D3GA 2M2BA 4DL5A 1WHXA 4E98A 4ZP7A 4LF5F 1U6ZA 3CE8A 4Z37A 1HNXF 1RWKB 1PO6A 2CJAA 4KV8B 2UUAF 1BMQB 1NK9A 3K5MA 2LU2A 4ZS6A 2IRUA 4O3OA 1UVNA 1YRXA 1DHMA 4U8VA 4ZCLA 5B7WA 2AT1B 2E1AA 4XDDA 2O5DA 4IDKA 1RTHA 2WBRA 5ETNA 1C0UB 1Y3JA 5ETVA 1X4DA 4FF2A 2FVQA 4IFYA 4N77A 1JQGA 1U25A 1VQNS 2PC6A 3C46A 3UDEA 3P6YC 4K0KF 4PXDA 3IP0A 3UN3A 4CLUA 5DQGA 4URSA 7FD1A 2RDJA 1JJ2R 3LF0A 1WHWA 2GCFA 1C1BA 2CQ4A 5I3UB 3CDEA 3CD0A 5CAAA 4I56A 1RT5B 4DV4F 3VGUA 2WOMB 5AJ3F 3OTEA 1N32J 3CJ8A 3IFEA 2NZ4A 4ALZA 1X9MA 2N7CA 1PIEA 2ZJRQ 1HQEA 4ELTA 3T6BA 3MR6A 2DRAA 3H5SA 3V4IB 1UEKA 1GEHA 2WW4A 2XGQA 1HW9A 5K14A 1R6YA 2CJBA 2L48A 2LDYA 1WG5A 1RTDA 4LF5J 1RHRB 2KM8B 3MXHP 3UN2A 2OKQA 4PG4A 3SCIE 1XNQF 1KLMB 1VLYA 3DDIA 1HNXJ 2DGWA 2C3OA 4CLSA 2D3OR 4UZCA 1HIYA 2YNGB 2UUAJ 3UO0A 2LMIA 4ELUA 1JLGA 3NAIA 1LWFA 3A12A 3TUIC 4Q8FA 3IG1B 3OPKA 3CCQS 1Q86T 2LFVA 3OXLA 3C19A 1PC4A 3NGDA 1VQ9S 1JWWA 4FXVA 2RDDA 3S01A 2ZNYA 2AKWB 3P8BB 2GVZB 1RT7B 4ECRA 1RTJB 2H4YB 4K0KJ 2ZOMA 2ZOGA 4XAKA 5GMDA 2ROPA 4JP8A 1VLOA
chains in the Genus database with same CATH topology
4U67Q 3QAEA 2KG0A 3B4DA 5L1LA 1EETB 3ITHA 3QWUA 3HKZD 5THWA 3OVBA 2M4MA 1YRUA 1QTMA 4DFJA 2ADBA 2V4JA 4C8OA 3HP6A 2VFUA 1TK5A 3CDAA 5G0RB 3VR1A 5DM7Q 1RK8A 3NWGA 1HI0P 2JLGA 3M1VB 3CD6S 1YQHA 4Y28C 5LL6d 5J1PA 2Y1IA 3DLEB 3PW2A 4WKYA 3TANA 2OLWA 2RUGA 2DGXA 3KLGB 4ZCIA 2RILA 2B7BB 3IAS9 2FC8A 3R5DA 3CJ4A 1UJ6A 4L72B 4DR7F 1HR0F 1DTQA 5K8OA 5IQQA 4F4ZA 5HO4A 1S9GA 1SIZA 3J80Y 1U47A 1M5OC 2HFZA 2YWEA 3SCKE 4KGMA 4IO9Q 3PFOA 4K4SA 3ZZYA 3L09A 2ZJQQ 4WXWA 2C2RA 3MDFA 1SV5B 4ZVGA 4QJVA 5DETA 2HNZA 2ZD1A 2RH3A 4OFZA 2BRLA 4Q7AA 2PN6A 5HMWA 5F8GA 4EBDA 3KG1A 2QIFA 4CCHA 4ZMMA 3AAWB 4PPZA 1H2UX 1CQNA 2WK4A 2MZQA 2BXJA 4X4VA 2M52A 2K7JA 3M2VA 2ZHBA 1S1UA 5DRKA 2CJQA 4RW9B 5F8MA 3MR5A 4ED1A 2MPUA 3I87A 2DH9A 3PJXA 3OVAA 1IBKF 1LV5A 4HHJA 4UQTA 2P9CA 4QZVB 4UQGA 5M2RA 2CJ9A 2PGCA 4OX8A 2EKYA 1Q7YT 1Q4RA 1FERA 1T95A 2UXBF 1H98A 4DV6F 1MSWD 1U7LA 4WCEQ 1R0AA 3OLBA 1EP4A 1IXKA 2KYZA 1TKDA 2IC3B 1FXRA 2DO0A 2D1CA 1DZ5A 1WELA 5KG1A 3OR1B 4RUCA 3NNAA 2XS7A 2U1AA 3V2UC 1UA1A 4TU8A 2FGOA 4TLRA 3JB9k 2VPZB 5C5JA 1MMNA 4QIVA 4Q2LA 1AFIA 2DVIA 1IJEB 4URQU 2P5VA 1E6VB 2FJEB 3V6DA 2MHEA 2CPDA 1Z4UA 2EBEA 2GC8A 3L7PA 4H4KA 2AYEA 4O4GA 3ZZUA 2QA4S 5GAGU 2VFRA 3ZZTA 3W2WB 4JV2A 3JTPA 1FDBA 1Z2ZA 3PHEA 4ZPVR 2UU9F 4EGLA 3M32A 1RAJA 4IG0B 1KR4A 1FCAA 2GMJA 5E3PA 5EUHA 1S1WB 2HHXA 1U6BA 5JJBA 2OPPB 3EYZA 4HVZA 5CZXA 3TOQA 5CH7B 2B3TB 2HS3A 4ZP8A 3SFUA 3LP0B 5GAEU 2D41A 3H5XA 1IQTA 4L6V3 2NPFA 1G6BA 5HMYA 2DJWA 1KQGB 1YI2S 5E3QA 2I5JA 5E7OB 2B9WA 4CQ1A 3T5LA 4ED0A 3KLEB 2HHSA 1A6LA 4DG1A 3KTQA 4OLPA 3D1OA 1B0TA 1M5HA 1WF0A 1P1LA 3HPOA 2RD5C 5DG9A 1Y7PA 2V0NA 1E6YA 3H25A 1NK4A 4NXNF 2BZ2A 2QSFA 2YNIB 3ISZA 1SKRA 4DS4A 4IG3A 4MIAA 1HL6A 1QVFR 2B4VA 4WJBA 1DURA 2ZH6A 1D9DA 2VZ9A 4JI2F 1TL3A 2V94A 3FRZA 4TU7A 1S77D 1NK6A 2KB2A 2PE8A 5CQGA 5C42B 5F8NA 3MM7A 4XDCA 2VBXA 4PQAA 1Q8IA 3MM6A 4B3TF 3KK3B 3K0JA 2K8GA 5F8HA 3BO3A 1TKXA 1D1UA 1U45A 3JTOA 4LSLB 1MROB 4ZVHA 3WX4A 2WHOA 3MUTP 1VQPS 1N8RT 2J9DE 1KNZA 1RTIB 1R8AA 1X5TA 3GIKA 4ED7A 1T94A 4B02A 4EYIB 2LYVA 3GILA 2MY7A 2F4VF 4X65F 3MM8A 3AH6A 4IR1A 2DHXA 4ZP6A 2EPIA 2VC0A 2QRRA 5F3TA 4J9SA 4DSKA 3G9CA 1LQ9A 1MMLA 1RKIA 3Q24A 1U1PA 2FVSA 3EPGA 1H3DA 1VOMA 2CG4A 1C2PA 2R7UA 1R3NA 5L1KA 4GC6A 4QOTA 4IO1A 2WW8A 5I42A 2KVIA 2MB0B 1CQMA 1SQEA 5T7LA 4TY9A 4C11A 1HBUA 3H8YA 1FRKA 2ILYA 1FVQA 2PDAA 2VKZG 1T05B 3M6WA 2JC1A 2HRUA 3GMGA 5CYMB 2BOPA 2HHVA 3EZUA 2NXUA 4OZNA 1KQKA 5DGBA 2XI3A 3M8SA 4J9RA 2OIHA 1DTTA 3DU5A 3EUNA 3EXCX 5J1NA 4RNMA 1N33F 4ES1A 3UDCA 2NQPA 2Q1LA 2F8HA 5EWFA 1S6QA 4R0JA 2XGPA 4YFUA 3E2EA 2XCAA 4K4XA 2DHAA 1VC6A 4HKQA 4A8FA 2VOPA 4RUHA 5HBMA 4DN9A 4B3MF 1DFDA 4RW6B 4NZ6A 1HMVA 2F1FA 3M6UA 2JEJA 3FCHA 2ZITA 4PWDA 4TKTA 2BR0A 4HDHA 2UVRA 4LF4F 3KHHA 3B8HA 3MWBA 1WTBA 3CIMA 3TR5A 3Q2SC 5J2MA 4DL2A 2V8DA 3JSMB 2ADCA 4HEA9 4NYPA 1S1VB 1AFJA 2CPFA 1JKHA 4RW8A 1VQSA 1MU2A 4ETXA 3V4MA 2RKIB 1F0XA 4I69A 4RBUA 3DXSX 3OUYB 1FEHA 1ZPWX 2MKHA 3TAMA 1FD8A 5KG4A 2UUBF 2WBMA 4HH0A 2XS5A 2OFHX 3D54A 3QGHA 4CO5A 2ZH8A 1B0PA 3OL8A 3H2LA 2V8VA 2VG5A 2W4PA 2IYIA 5DM6Q 3OJUA 3D1HA 3UCZP 4FF4A 2UVVA 1VQ5S 5A8KA 5K8PA 3VAJA 3KHRA 4AL5A 2KXHA 4X4SA 3CCLS 1C4CA 1CVJA 2J9DA 2X3GA 1C0TA 5BR8F 3IO1A 1REVA 3D2WA 2OSQA 2JH3A 4ICLA 4KKOB 1HYSA 3SQGB 4MKAA 3MM9A 3MEDA 3VF0B 1VHFA 4LSNB 1QSSA 2VG6B 1UFWA 1GAOA 4G1QA 4Q0BB 2IA6A 1JLQA 3CCRS 2J8AA 3POTB 1BD6A 1RTHB 2VPXB 3J7YI 4B3RF 4ES2A 3M30B 3MECA 4YR3A 2ZE2B 4A8MP 2ILZA 1S72S 4GKKF 4IOCQ 3N5FA 3MFHA 2GIRA 1FDAA 4NLYA 5CHCB 1N5SA 4IFYB 5KFNA 4OX9F 1XMOF 3CMAS 4YUDA 4KPYA 5KG5A 2B6AB 1JLBA 2YTCA 2FJDB 2JJ4D 1BGXT 4DSIA 3FEXB 4DX8H 2M8HA 2MQQA 3KNGA 4Y00A 1TFWA 4DJBA 4B9NA 2N4CA 1Q16B 3BEGB 3I0RA 4EBCA 2BE2B 4RW7B 2FVPA 4CZCA 1WTFA 2V8GA 1XERA 2W9CB 3MR2A 3U7JA 2VH7A 4B3OA 4DF4A 1TKZB 2ERRA 1HNVB 2GHVC 4RNOA 1NJXA 1W2BR 2YWHA 1NKCA 4LFCF 4O44B 4OJHA 1TV6A 4TQRA 1S9EB 2XC9A 1C1BB 4OIXA 2C2EA 2ZHOA 4WE1B 1NNDA 5KT5A 2NYIA 1S10A 3LQVA 4NX9A 3CO9A 3DLKA 3MFIA 2B9YA 4NYZA 4JI7F 5IZHA 4ELVA 3FMWA 1I94F 3GYNA 4PXEA 3VAKA 4G6VB 1N5YA 3DGPA 1JXLA 1CC7A 3RW7A 1NJWA 4ECUA 1UWBA 3OFFA 4IH7A 4M95A 5B0EA 1DLOA 4QU6A 2DK2A 4KFBA 1FHTA 4DQQA 1VBXA 3M8PA 1FK9A 4M94A 4ILMA 4YEAA 2VFSA 1URRA 1M5SA 4LFAF 3CJ0A 3MAQA 2EI5A 3CXCR 1RA6A 2VUGA 4WXOA 2PSZA 4LF6F 4NA3A 4USIA 1HNIA 4RU9A 4PR6A 4YP3A 3PX0A 2VG7B 2C2DA 2XULA 4HH1A 3CC4S 1G1XA 1VQ6S 2GO8A 2MZJA 1HQEB 2RU3A 2MQLA 1ZAWA 4PRFA 2MY8A 2XWXA 2CVEA 1RKJA 1NKBA 1T3OA 5T14A 2Y1JA 3LO3A 1YITS 2RB7A 3Q8SB 5LJ3Y 4DSFA 2YKNB 1S7HA 2IJNA 2XHWA 5KFCA 2CJKA 2DR8A 3TVYA 2GJ2A 2KZZA 2AV5A 3FGVA 3LPYA 3QLHA 3B82A 4H4MA 4OI1A 1UKUA 3W3SA 4HI1A 3TI0A 1KN6A 1Y5NB 3I9ZA 1ULRA 2B43A 3DM2B 3CEDA 2RSQA 2R7VA 3GR0A 2E44A 3GZ7A 3M8RA 1HW8A 1LWEB 1DQAA 1SJ4P 3DOKB 3QMQA 3KK2A 1YJNS 1FRXA 3NNCA 2ZDOA 3GV7B 3BGLA 4DV0F 1X4EA 2Z2LA 1P27B 5U47A 2WTFA 1J5OA 2ZZMA 1HD0A 4FZVA 4ZPTR 3HX9A 3TW0A 2HNYA 5AE1A 5KG2A 3VCDA 3CCUS 3THVA 3OL9A 4C8NA 1TL1A 4DV1F 2K3IA 5KG0A 1HPZB 5MAOA 3M2RB 1T7PA 2YKAA 1YWXA 1S99A 2GMLA 5FDLA 3UWTA 4QWCA 1FKPA 2FB0A 2ZVSA 4FNIA 2GJIA 2RQKA 3QO9A 1HNZF 4ERDA 2HWHA 1FEEA 2UZAA 2ZBIA 1XN9A 5EDWA 2KXNB 2IM3A 4TYBA 3I4HX 4OV1A 1X4CA 2Q79A 1JLGB 5L1JA 1LWFB 5FJ4A 1R7IA 1IKVA 2V9KA 5A8WB 2EWHA 5HN0A 4OI2A 5T41A 3DI6B 1TP7A 2A3JA 3GIIA 3OL7A 3QGPA 1RISA 4WYLA 1W25A 3O8WA 2FC9A 1MWZA 3I5AA 3FVYA 5IXUA 3AHPA 5KTQA 3H5YA 1WEXA 1JLFA 4Y2MA 4J37A 2W8LA 1FKAF 1N88A 4F26A 1S1TB 3HVAA 4F67A 5IT4A 2FLLA 2VPYB 3L7OA 4MJKA 4H4KC 2K3KA 1H2VZ 5J2NA 3SYZA 1ZYQA 2HMIB 2HNDB 4PUOB 1S6PB 4X4NA 2XG8A 4B08A 2FUG9 2WONB 4DF8A 3NMRA 5EX0A 2ZH5A 2YKMA 3M2UB 4ATNA 4I6YA 2R2SA 2WB1D 3BJYA 2P9EA 2B4PA 3H2UB 2RMLA 4QR0A 2YH1A 3TVZA 1SJRA 3CCMS 3LH2S 3TO8A 2OO4A 5D3GB 1Y9OA 2MKIA 4NRUA 1IKWA 3FEYB 3PX4A 4J9KA 3H98A 2DH8A 3KWMA 4YB5A 3TUJC 2ZH1A 1FVSA 5KT4A 1TKTA 3ITHB 4M5DA 2EG1A 5C25A 3KLHA 2V5HG 1H38A 2LA4A 1CLFA 2BRKA 2ZOFA 4F2SA 5HROB 2FHJA 2DNGA 1S76D 1S48A 2V4JB 2IYGA 2C28A 1SKSA 2OMLA 2Z2MA 4NLOA 4ECZA 4Q44A 1WF2A 4A8SA 4B9LA 1TR0A 1WEYA 4EWTA 2OPQA 4OZ0A 1PGZA 2VA3A 1X4HA 3O3LA 4OJ3A 3CDBA 2JZ5A 1LW0A 2YH0A 4C3LA 1YTYA 1ZTTA 5LXYA 2QLXA 4X66F 1B7FA 5DDRC 2I2YA 2OMOA 3KK1A 5GAHI 5KFOA 4LFBF 1S1XA 3NS5A 3TAPA 3F44A 4NYOA 3QYYA 2ASYA 3CMES 1HARA 3MPYA 5BYRA 3SSRA 3WC0A 2EFVA 4B3SF 1UEUA 1ZAVA 4CNZA 2CKWA 1S9GB 2OPRA 3NLCA 2FTRA 3IRXA 2B5JA 2CIMA 4K59A 4K5RA 1NK8A 5KFVA 4NLPA 2HNZB 2ZD1B 5KFRA 1KVJA 1HBNA 2ZM6F 4R5PA 1SKWA 4OHYA 3OR2A 1D3WA 3M8QA 3M2VB 3NS6A 1S1UB 3ISND 3R1HA 4EZ6A 1KONA 3SMZA 4HDGA 1FJCA 1Q82T 4DQRA 3D1QA 4RNHA 2Z8QA 3F41A 5CCMA 2HPUA 2RU9A 3V6KA 1N52B 1U4BA 2W24A 2A2DA 3N9UC 1O51A 5GVQA 5C24A 3SXLA 4DEZA 4A8WA 2M5YA 5J2PB 2HQIA 2RF2A 4OHVA 1OS5A 3B4MA 2FHKA 2CZVC 4QQBA 4DLEA 3GB0A 2CPEA 3MMAA 4WF9Q 4OI6A 1R0AB 3PKYA 1AUDA 2ZNZA 1TFYA 1EP4B 5DLGA 5D4NA 1SH0A 1Q1KA 4MK8A 1MWYA 4XIUA 2MQPA 4W90B 2WCXA 3UCGA 1VQ8S 2KT2A 4CO0A 2AJ4A 2XMKA 3T1HF 2W7OA 4EO6A 1X4AA 3G4SS 4NCBA 3BF4A 2OPSA 3V6DB 2DHGA 1FKOA 4O4GB 3OJSA 4YQWA 1QAXA 4DHVA 3PKMA 2MZRA 3X3UA 3DMJA 1VQYA 1GX5A 3UR0A 2C22A 3SZ2A 4C8LA 1YIJS 3M32B