3BDEA

Crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
b'QGMIRHTVVFTLKHASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFSMEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mll5499 protein
publication title Crystal structure of domain of unknown function with a ferredoxin-like fold (NP_106155.1) from Mesorhizobium loti at 1.79 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Unknown function
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdeA00
1OSDA 2QLWA 2AJ0A 5A6PA 3TRGA 2OD4A 2KT2A 4YEAA 1N5SA 2OMOA 2XMVA 5B0AA 1V3ZA 3HHLA 1LQ9A 3FGVA 2FIUA 5A6WA 5T7LB 3BM7A 3E8OA 1ULRA 2XMJA 1FVSA 4ZOSA 1P6TA 4A46A 2N4DA 2W4DA 4Q2MA 2AP6A 2BJEA 2ASYA 2XMWA 4U9RA 2IYIA 5B0GA 3HHLC 2HFNA 1Q8LA 5IXUA 1KVJA 2AW0A 3BB5A 1CC8A 3KKFA 3FMBA 4EFAC 3HX9A 3HHLB 3MZIA 2GCFA 4HI1A 4OJ1A 3TNVA 2K2PA 1TL4A 5KAKA 2K1RA 2G9OA 2OFHX 1Y9OA 2HQIA 2ZDPA 2ROPA 2AJ1A 2ROEA 1FVQA 2ROGA 1AW0A 1CPZA 1TZ0A 3IWXA 3FRYA 4HH1A 1S6UA 4QOTA 2QLXA 5B0DA 4Y2MA 1KVIA 1KQKA 2OKQA 2N4CA 2FHMA 1S6OA 5F0WA 1YJVA 2K1RB 1CC7A 1W2IA 2RMLA 2XMTA 3K7RA 5B0EA 3BGUA 2GO8A 3MCSA 1OQ6A 1TUVA 2KKHA 2OD6A 2RILA 4NL5A 2K7JA 4OIXA 5K9FA 3TOQA 3DCAA 4DN9A 2PGCA 2KYZA 2LDIA 1IUJA 3LGNA 1SB6A 3I9ZA 1N5VA 2W4CA 3IWLA 5B09A 1U7LA 1FD8A 2EW9A 1TR0A 3KG0A 1YJTA 3T9NA 1AFIA 1X0PA 4A48A 1SQEA 1K0VA 4Y2IA 2HFOA 4OJGA 1JWWA 4FNIA 5B0FA 5B08A 5B0BA 4HI2A 1YJUA 2RSQA 3VTIA 2IYGA 2L3MA 2LXFA 1FE0A 2FTRA 3HDSA 1Q4RA 3KG1A 2N7YA 1JK9B 3HFKA 2BYCA 1P8GA 1VQSA 3BDEA 1YRXA 4FNHA 2ACYA 1YJRA 3BF4A 2OAUA 1APSA 1N5QA 2GV1A 1RJJA 2BJDA 1Q53A 1X7VA 1XBWA 3WDOA 3F44A 1GXUA 2OFGX 1VQYA 1GXTA 2GGPA 2XMMA 4F67A 4YDXA 3LGMA 3BN7A 3QMQA 4OJ3A 1OPZA 2RU9A 3LO3A 1R6YA 4HH0A 4A4JA 2GA7A 1Y0HA 2BBEA 3HF5A 1Y3JA 2CRLA 2HLTA 4ZA1A 2HLUA 2FB0A 1URRA 2XMKA 3CJKA 4A47A 2HIQA 4HL9A 2GGPB 1TL5A 2QIFA 2XMUA 1Y3KA 3BR8A 2VV5A 3HHLD 2OP5A 1FE4A 1X8DA 2QYCA 2IFXA 3UDCA 1QUPA 2VH7A 1FEEA 1Q8BA 2ZDOA 4Y2KA 1YG0A 1AFJA 1MWYA 2KT3A 1FESA 2JDJA 1SI9A 5B0CA 2PD1A 5T7LA 2LQ9A 2LQBA 2BUNA 4NPOA 3GZ7A 4Q2LA 3CJKB 3KNGA 2GFFA 1OQ3A 2Q3PA 3QGPA 3DXSX 5F0UA 2K7KA 1N5TA 1WD6A 4OJHA 4DL0C 4DPOA 1MWZA 2W4PA
chains in the Genus database with same CATH superfamily
2XMVA 2DPIA 1HI1A 1ZAVA 1JJHA 2XGPA 3FEXB 1U4BA 3DOKB 1S57A 3D4JA 4K4SA 1RT5A 1PAEX 2M0GB 1WC3A 2BXJA 2OSRA 1Z2ZA 1IBKJ 1KFDA 2UUAJ 2MZRA 2C2EA 5KTQA 4TNOA 5EN1A 1HMVA 2HW3A 2VG5B 3VAKA 2G2ZA 2BKOA 5HL7Q 3M2VB 2CQ0A 1APSA 2E5JA 1H98A 1R43A 3C14B 2JEFA 4FZVA 4LF7J 2L9DA 5KFFA 4DSEA 4FP9A 3V5RA 1QAXA 1TKDA 4TKTA 1SV5A 3KDOA 4TXSA 2AX0A 4UUWA 2JVRA 5IT9U 4YR2A 1WNEA 3MOZA 1MSWD 3IBCB 1RE1B 3V81A 3SMZA 4FYWB 5ETRA 1ZA2B 2CJAA 4CI0B 2DVIA 4ZVOB 1M90T 4OHWA 4NEZA 1M0SA 4LR7A 2HVDA 1L3UA 3POTA 2ZBQA 2BE9B 3NCRA 2GCFA 4IOCQ 3QSYB 4K0KJ 3IG1B 3I4HX 1UCNA 1MMLA 3VAJA 1QLNA 1K73T 3PRVA 4B08A 1NCLA 1JJ2R 4ENOA 1KN6A 1Q1KA 4P2SA 4WTYA 4ED1A 1KNZA 3OVAA 1AFIA 3PX6A 2DK2A 4KKOA 2HFOA 3DU5A 4ZHRA 3T3FA 3VQTA 2KTQA 3RB0A 3I96A 3VGVA 1JK9B 3M6XA 3SDEB 2CQPA 2GQQA 1S1UB 1EZZB 2F9DA 3FSYA 1BQXA 1FRXA 2EFPA 3GG0A 2ZWOA 1A6LA 1S0NA 2MDAA 4KSEB 4QWCA 3NAHA 3Q8YA 2LU2A 2W9BA 2WK4A 3MCOA 4B17A 2X51A 4MIBA 2HHHF 3GP9A 5RUBA 1R0CB 4EBDA 3L4BC 4KIAA 3QRRA 1YRTA 2G9OA 1H38A 1KTVA 1BY9A 2Z2MA 5IOLA 4P2XA 4LFCF 1JLBB 2DHSA 3R3TA 4KFBB 4YHHJ 5DDPC 4NRUA 1KHVA 5I3UB 1X0PA 4LRFA 3VAGA 1QTNB 3T5KA 4YB5A 4DX5A 3SQGB 1FI4A 1RTJB 3KLGB 3N6LA 2ZD1A 5HLFA 4ZMMA 2VQFF 3TVYA 3SSSA 3CXCR 3KFWX 1UL3A 3D0HE 2XWXA 2VKZG 4UW2A 3CJKA 3B8HA 4FPRA 1FWLA 4NXNF 3KG4A 1TKZA 2NREA 1M1KT 2WW8A 1S77D 4YOEA 4YFUA 2ZC4A 4NCAA 1ITPA 4PG6A 1VQ5S 2HHVA 3ZTOA 4LR8A 3A3OB 2E1CA 1S7HA 1TMMA 1LWCA 5J2MB 2B9YA 1CJTA 4X4RA 2YWWA 3OJSA 1QAIA 2CQDA 4BWJA 4DOZA 2KJWA 3I56S 1JLAA 4TYBA 3NGRA 2LFVA 3QQCD 3K5PA 5GAEU 5JUMA 3G6YA 2QGFB 1OO0B 4NCGA 2P9EA 5JVGQ 2BZ2A 5KFOA 1NK7A 1C1BB 2VQEF 1WHXA 5HO4A 2QSWA 4O4GB 4CT8A 3DRSB 3MAHA 2JFDA 5D0EA 1NK9A 4DL3A 1YVFA 3DFEA 2DISA 1RT7A 4U6PA 3M2UA 2WONA 4I2QA 3ZZRA 4IG3B 2VICA 4M5NA 3RBZA 4K4TA 1LW0B 1RT1B 4WP9A 2W7PA 2ZM6J 3GR0A 4Q8FA 2PIIA 3OFFA 4ID5B 2R7WA 2FGOA 4EBEA 1SQGA 4FVMA 2CG4A 4U7UK 4ECUA 5B0AA 2RT3A 4L72B 1TUGB 3DOKA 2FLNA 4EYHB 3I0SB 5K8MA 1FX2A 2YX4A 1Q95G 2ZKUA 1IN0A 2AW0A 3CJ2A 4OJ1A 3MMBB 3R6LB 1UZHA 3TA1A 2ROGA 4UOGA 1RWVB 3Q8PB 1CC7A 3Q8SB 3PNIA 4OLPA 3N9UC 1OYDA 3JSBA 3SBMA 2VG5A 4L73A 3L95X 2QMXA 1QTMA 2DNQA 5KFQA 4USTA 1BHNA 3ZNJ1 4KPYA 3GCWP 3I5BA 3F73A 2IA0A 2I9SA 1C1CB 4NZ6A 3ILIA 4HTJA 1N6QB 3HJFA 3M2VA 4NE9C 4DV0F 2Y3YA 2G4BA 2I2YA 2C3OA 3U27A 1JJCB 4Q0BB 2H48B 3BF4A 2BJDA 3HD1A 3HSDA 5KT5A 1T9YA 3Q86A 5ETLA 4RZRA 4M63A 4PABA 5I3PA 2HNZB 1AA1B 2B51A 1VDHA 2C2OB 1YJ9S 2DEIA 4NX9A 2QLWA 2D3ZA 2HGLA 2HSEB 3DXBA 3T1YF 3IG1A 4F0MA 2IJNA 1U1KA 2DT9A 1X5PA 4C6AA 2QTWA 5I4MA 2HVHA 2W2PP 3ICLA 2VFUA 3QO9B 1PCAA 3R2DJ 3PKMA 1P1LA 2RUSA 4K8RA 5HJYA 4LMZA 3CCRS 4J9VA 2JJ4D 1S1UA 2J5AA 4PG4A 2UUCF 4FF1A 1HNXF 1KVKA 4CNZA 1HBNB 3KJVB 5JXSA 4DSLA 4Y2CA 1FHTA 1OJ4A 2FY1A 1X7VA 2FVCA 3VZHA 3K5LA 1OPZA 3ZZTA 4HH0A 3OPKA 3TEGA 1NDPA 1U1NA 1RT2B 1RAAB 4BDPA 3D1HA 4ER8A 4CZCA 1S0VA 1UFLA 3H7HB 3UPFA 4C8NA 4DV5F 3PX4A 1FJGJ 1WC5A 1H2TZ 4ED5A 4W4MA 5A8RB 3BGRB 3JAMY 2X3GA 1RLDA 3K8VA 2UVWA 2AP6A 2HZCA 5E3RA 2KFYA 1SKWA 1JLBA 4KFBA 3AD8C 4DF4A 2IMOA 1I1GA 1V6HA 1XK8A 1U02A 5I3UA 1S1TB 3KHRA 1F3FA 5F8JA 2ZH7A 5C42B 2V63A 1NAQA 1H6KX 1RTJA 1XNRJ 3TW0A 3KLGA 2KZZA 2JEJA 1NUEA 1T9UA 5J2PA 3WIVA 5ETQA 2UUAF 1N5QA 5D78A 3HK2A 2Y1JA 4AT1B 4OI6A 2V4JB 3PYGA 2HHXA 1Y3JA 4M8LA 2QA1A 2EFVA 4NCBA 4JI4J 5LSLA 2MHNA 3ILOA 5SZTA 5J2MA 2QA4G 2C3MA 1UEUA 1NDKA 4LFAF 1X4AA 1L3VA 3OFGA 3MPUB 4PXCA 3PTWA 2VBXA 3DGPB 1G4CA 4OX6A 4UF4A 2R9LA 4IH7A 3W63A 1RHJB 1GX6A 1XWLA 4DS4A 1RKIA 4XIUA 1U2FA 1SJ4P 4OZ2A 4F3OA 1C1BA 1N52B 3MAAB 4O4GA 1T3OA 4F3QA 4K0KF 3RB3A 3R5CA 3DRSA 2YBVA 4ZVQB 5A0YB 3H5SA 3KJNB 1VQNS 1PG5B 5F8GA 3UDVA 4I1TA 1TKTB 2B5JB 3HDSA 3SSRA 3NCQA 4U8VA 2YPYA 1EJ7L 1YRXA 3ZZYA 2ACYA 2KT5A 1LW0A 1NHVA 3IO1A 1JNZB 1RT1A 3ET6A 3OFHA 4FPIA 3DHXA 4MMOA 4A4JA 4OV1A 4NA3A 4ID5A 4O44B 4PG7A 3CWJA 2DCLA 1PC4A 2QIFA 1VC5A 1NJZA 1WSVA 4PCQA 1NNDA 2PI4A 2KXHA 1YI2S 1U47A 5T41A 1RP5A 3I0SA 2MPUA 1SC6A 4FXVA 4J9SA 3BSNA 3M8YA 4AXIA 1SC4B 3RBDA 4ZVSB 2YNFB 2BANB 2ASYA 2ZBRA 1HD1A 3T41A 2DD8S 1T02A 3PRBA 2ZHAA 2FQQB 1X4CA 1RABB 1FKOB 2IJRA 2CQBA 1C1CA 2CJBA 1REGX 3JTOA 1N6QA 2QA2A 2GO8A 3W7BA 2HURA 2R2SA 3J81Y 5ETNA 3UCGA 4Q0BA 2IRUA 3VVTA 4ZCLA 2CQCA 2CG8A 2RQKA 5FDLB 4ZVEA 5LJ5Y 3RW7A 1SL1A 2IAJB 1RWPB 3MMCB 1YBAA 5ETPA 4X62J 1DQAA 3BREA 4A8SA 4I6YA 3OFEA 2HNZA 4DR4J 1UKUA 1N48A 3H2LA 4Y2AA 1RBAA 1KLMB 2EFNA 1FE4A 3FBFA 2B3TB 3GYNA 1BMQB 1N34J 1JJ4A 3CCQS 2KB2A 1HLWA 2J6SA 2F40A 3D1QA 2UP1A 3NNAA 3DRRB 4C8KA 1NSAA 1U1OA 3CULA 1CULB 4TVAB 1BWEA 2JC0A 1FVSA 2X1AA 3CF5Q 3TVKA 3X3UA 4DFJA 1FXDA 2LLZA 2AYEA 2R7UA 2DCUB 2D9OA 3QO9A 2IHR1 4K4YA 2ASLA 2GW8A 3M8WA 4C8OA 2AZ1A 5F0WA 4HTIA 3UD5A 3EGVA 1BWVA 1HD0A 1HBNA 2NXCA 2SXLA 3KJVA 3DHWC 5GAEI 2B9WA 4PG8A 1HWJA 3N0VA 1TKXB 1ZAWA 2RHQB 2BJ8A 1NDCA 1RT2A 4DSFA 2AU0A 3L09A 1M5HA 2WB4A 3JB9k 5A8RA 2ZBIA 3BGRA 2H51B 2N7CA 1B64A 3NMAA 3TAQA 1VYAA 4EU0A 4OI1A 4FF4A 3EGNA 3NL0A 5D4PA 4A46A 2A18A 5HQ8A 1LW2B 5BYSA 1CC8A 1KR4A 4QBUA 3CD5A 2FZKB 1PJ7A 4KGKA 1WTFA 1S1TA 2V5HG 4CLZA 4B3OB 2VPZB 4WFXA 3T6JA 5C42A 1TL1B 3M6WA 2BV3A 2J0SD 2Z57B 2J9EA 2W01A 4DS5A 5U47A 1I51B 3GCXP 1S10A 2Y8YA 4LF2A 1PBAA 4UZCA 1BE4A 3IRWP 2ZEJA 1TVRB 2BYCA 2V4JA 2ZOMA 3I0RB 2W8LA 3Q8VA 2XYGB 5BR8J 5E3QA 2J8SA 2DGXA 4ZN1A 2HQFA 2O01C 2POKA 1H73A 3N5BA 3MUVP 2YWHA 4DN0A 5CQGA 1L5UA 2NUUG 1MROB 5GADU 4B02A 4DL6A 4M94A 5M2RA 2RE1A 4CTAB 2M5YA 2CQGA 5KT7A 5L8RC 2AV5A 5KG7A 2JLEA 1REVB 1Y4ZB 1K8AT 1S59A 1X4EA 1O6XA 3DGPA 2KHDA 1TTHB 3R7SB 4WFNQ 1VQMS 2DO4A 3TX8A 4J9MA 1FXLA 3FKBA 2RDJA 3MAAA 4DV2F 3UN2A 4DPWA 4GMKA 4CLYA 5A0YA 4RPFA 4FKYA 5IQQA 1U7LA 1TKTA 2B5JA 3C6UB 2OLWA 1VBYA 2IDEA 5BYQA 3EWGA 3QLHB 1HQ2A 2PDAA 3CB4A 1ZTTA 1JLGB 4ILLA 3MM6B 3OTDA 4HHHA 4F3MA 2UUBF 4O44A 2DXDA 1LXJA 4LF6J 3HPOA 1VLOA 2VBWA 2VJVA 8RUCA 1WELA 3R5AA 2M8HA 3LGHA 2V50A 2R4FA 1VK8A 1XR5A 3GIIA 3GV8B 1FESA 1H0HB 2G13A 3IMQJ 2YNFA 3CCZA 4PWWA 2BANA 4BC9A 3PY8A 4KE5A 3CJ4A 2FVRA 4B9NA 1I3OB 1S97A 2C2NA 1JKHB 2RS8A 1QUVA 4F2RA 3VGUA 4IG0B 5ETTA 2GX8A 2O5DA 1HPZB 2V4RA 2MHEA 2HFSA 2WVCA 5I3QA 4KHMA 3AJ1A 3BEGB 4GKKF 2XS7A 3LAMA 2JL9A 2CDQA 3I55S 5FDLA 3DLEB 4DI6A 4WK3A 2A2CA 1EQMA 1B99A 4Z7YA 2IAJA 3MMCA 5B0BA 5EWEA 4KBIA 1W2BR 1FE0A 3C6TB 2OIHA 1VQSA 5LMNF 3UNGC 2OGUA 4DF8A 2MLXA 5JMNA 4LBIA 1KLMA 4DV7F 2GMLA 1F5AA 2D3UA 4DR1F 1RDRA 4WIIA 2UVUA 1RQ0A 3R7NB 4FBUA 4J9NA 3BQ0A 2GGPB 1RT6B 3NP5A 2VV5A 2DNOA 2MB0B 4FYYB 3QT5A 2HBQB 4ZP9A 2CUYA 3DRRA 5DGBA 4JV5J 1CULA 2V2ZA 1GH8A 4F4XA 2LQ9A 4ECRA 3V4MA 2KM8B 2VFTA 4UY85 4X4VA 5CA5A 2E5LJ 4MIWA 4CLSA 3HZGA 2P8IA 4RNFA 2CXEA 4XDDA 3GLJA 2AGQA 5HQMA 2IM0A 1W7WA 4RL1A 2K3IA 2DB1A 2VODA 2KRBA 2N4CA 4ZCIA 2B4OA 2MJNA 3HZEA 4YN3B 1TKXA 4B3SF 5IQ6A 4Y2IA 4DZ6A 1X4FA 4LR9A 1XN9A 3ONQA 4ECVA 1Y11A 3KLVA 1RJJA 4PXBA 1RYRA 2Q1LA 3OUYB 1G7CB 2YH0A 3BQ1A 1MLAA 3I87A 1TP7A 2FB0A 1URRA 4I6AA 1FJEB 4QR1A 5CABA 4J7CA 1UWAA 4UTGA 4A8XA 4G6VB 1QSYA 3CMAS 3QZ7A 3FMWA 4CRJA 2R8GA 4KYZA 4CLLA 2X3DA 4IR9A 1KQSR 1LW2A 4BLGA 1FRKA 3CC7S 1S79A 2B7BB 3U1MA 1WJ9A 2CZ9A 2CNNB 3H2UB 4B3OA 3KLFB 2BM0A 2VPWB 1B0VA 1TL1A 2WVEA 1QSSA 4C98A 3CEDA 4UOCA 2QZ8A 3VVUA 4PWDB 2KHCA 3JQJA 4LFBJ 1RA7A 5KFRA 3AJ2A 3DLGB 1HARA 3IWLA 1EP4B 2Q66A 3HT0A 3SV4A 2EW9A 4BWMA 2HQDA 1TVRA 4AFFA 2LXUA 3I0RA 3W5YA 1VC6A 4FS1A 2VG7B 5D4NA 4MFBB 2AJ4A 2OFGX 3MWBA 1MROA 2HVIA 1C0TB 3CPWR 1FWPA 1UETA 4LQ3A 4HYKA 4CTAA 4L74A 1HI0P 4I68A 6FDRA 1REVA 4ANDA 2BE2B 3HSJA 4USUA 4FKXA 1WC6A 2GFFA 3QGPA 4NLQA 4M5KA 4YY3J 4YEAA 2HRYA 2GNKA 2JEIA 3CC2S 4ZVPB 2HIYA 2HBYB 4RO0A 4QWDA 1KC8T 2HNYB 3Q0AA 2MQMA 1V5IB 5L1LA 2YY3A 2V34A 1AB8A 3UN5A 4G1IA 4DR2J 3OTCA 1D9FA 4ED2A 4DUYJ 2MKIA 3C6UA 2FHKA 3EICA 2IMWP 3QLHA 2EK1A 1IR2A 4YB1P 3N28A 2ZJQQ 4ZP6A 1JLGA 3GSDA 3NOCA 1FWKA 2C42A 2MQ8A 3CMES 4DLGA 3AY0A 4OJGA 2DITA 1BD6A 3FCHA 5D4OA 2XY5A 4RNHA 4OZ0A 1V3RA 3NNHA 3QRQA 3CT9A 3N5FA 4WU3A 2LQ5A 3HHKA 2L08A 1X4DA 3VZIA 1W26A 3O3LA 1JLFB 4LBHA 2MZQA 3ZZZA 2R8HA 1HR0J 3KLEB 3TQEA 3BH6B 4Q2LA 3QYYA 1JKHA 3H8YA 1XMOF 3TI0A 3AFGA 5EDWA 2MQPA 1SL2A 2H54B 4KGVB 4X4SA 3IA0A 4IG0A 2YNIB 3UNYA 2VBZA 1HPZA 1K44A 4BS2A 3US5A 2BQ3A 2UXDF 3BO2A 2WSCC 3P8BB 3HM9A 1U6FA 2M9KA 2KFNA 5E2QA 4ED3A 4Z37A 5EX3A 4QOTA 3AA9A 2OKQA 1TFYA 1QD1A 3QSIA 1B3TA 2JX2A 2RMLA 4KO0B 2FJBB 4UOHA 2Z58B 2EKYA 1M1GA 3G96A 4ZLNA 3C6TA 3K2YA 1ZBTA 3P45B 1J5EF 1T05B 4FF2A 4U7UD 4FNIA 2R7VA 3EGZA 4DV1F 1RACB 5KFMA 3LANA 1H2VZ 2GC8A 3LALA 4YQWA 4NLPA 1FEHA 2DH7A 2GGPA 1LWEB 4RNOA 1RT6A 4JI0F 4RX6A 2AGPA 3J80Y 1YBUA 2ZITA 1TUWA 5BR8F 3QT7A 3OV7A 4WYLA 4ECTA 1SCJB 1WKJA 2BABA 3DRXA 4URGA 4ZN3A 1SKSA 1M5VC 2ZKTA 4NXMF 2UXBF 3CD0A 4PKDB 4A8KA 3BO4A 5KG2A 4P7TA 4LIRA 2NCKL 3EZUA 4JI8J 2RF2B 2NXNA 1CJKB 2CDRB 1CPZA 1NEEA 2A0FB 3IN5A 1HL6A 1S6OA 3OTOJ 1GTHA 4PAAA 4ALZA 2DRDA 3K5OA 3D54A 1R89A 2I38A 4AQYJ 1B7YB 2W24A 2LEBA 4DR7F 5J2NB 3K5MA 2A6OA 2DJWA 2JEGA 3MD3A 3VTIA 3RRHA 2FDNA 3OUYA 1VBKA 3TA0A 2V94A 3GU0A 3W1YC 4MTPA 4KHPJ 1FNMA 3RAQA 3AD9C 3MM9B 4IOBA 2CJ9A 4F02A 2WSFC 4X4QA 2BEFA 1VIOA 2RU3A 4WFYA 4I4BA 4AYBD 4PR6A 5K8OA 2VDHA 3K59A 5EWGA 4YUDA 3T5JA 2EEYA 5KG0A 5L46A 3KLFA 2VA2A 4OMFG 4ES2A 4A8MP 2WVBA 1PKUA 3V6HA 2XMWA 2G1HA 1Q8LA 4CO4A 2DNMA 1L3SA 4PWDA 1PYTA 2XGQA 3JSRA 1TZ0A 3DLGA 3EXYA 5D3GB 1EP4A 4JI1J 1X4HA 1RTIB 4X4OA 2CAJA 1Y5IB 3OVSA 3O1LA 1U26A 1KQFB 4USVA 3ENAA 5FLXU 4ED6A 1HNZF 7FDRA 3M8PB 4ECQA 4MFBA 2HRUA 3IP0A 5CCLA 3I31A 3GJQB 5DJBA 3PIOQ 2XCAA 3PYEA 1RHUB 2LCWA 1FJ7A 1SBRA 3SCJE 3JTPA 4B9MA 1I5OB 2FJAB 4N41A 2PEBA 2VFRA 3MXHP 4HEA9 4WF9Q 4DPYA 1V3SA 4O3PA 4NYZA 2HS0A 4FS2A 1WKLA 1NXIA 3M4XA 2E9RX 4NA1A 4YR3A 3F0NA 1UEKA 2C3PA 4ZJQA 2N3OA 1UA0A 1CJVA 3ZNUA 3DNCA 4QWAA 2HNYA 3MEKA 4B3MJ 2AMCB 2OMOA 2R7TA 2KVQE 1AROP 2EXUA 2CADA 4NYPA 4JV5F 4WBFA 4Y6IA 3VAMA 4ZS6A 3CDWA 1G1XA 3OTEA 2E5LF 2AKWB 3NNCA 1FFSB 3MMJA 1KVIA 1RBOB 3TVZA 3BPSP 1VQOS 1NPPA 2OO4A 3ETOA 3FQKA 2C2ZB 5L9NA 4K7QA 3E3XA 3I32A 1HYSB 1B70B 3SXLA 5IV3A 3EZ5A 2RDIA 1N32F 2PA8D 1WI6A 5F8HA 4TU7A 2RRNA 3BZQA 2YPZA 2ACMA 4FYXB 4N77A 1JLFA 4H4MB 2A2DA 4LF1A 1XR7A 1YJNS 3KLEA 4HL9A 2XHCA 4CH7A 4CLFA 4XDCA 2JRSA 2R7OA 1ROFA 5C7PA 4P74A 2KM8C 4JI6J 1SKUB 2YNIA 3AHPA 4DL0C 3LF0A 1GFWB 2E1PA 4EO8A 5GAHU 4E2FB 3L7PA 3VR1A 1F2GA 3CVKA 3NBPB 3Q83A 3ULHA 1RK8A 1F0XA 5H9EK 2HHPA 4KO0A 1FVQA 3SZ2A 1WUUA 1AYEA 4ZCKA 4X4PA 2CPJA 4IDKB 4GKJJ 3AAWB 2VKRA 1T05A 1B7FA 4F04B 1NZAA 4WYWA 3CNQP 1NB7A 3LGNA 2AHOB 5DDOC 2XI2A 3VHQA 3F41A 4LRCA 3JAMU 1VLYA 5C24B 4JYAF 2LYVA 1CJUB 2FJDB 1LWEA 4WXWA 1YJRA 2ZHBA 3H25A 1K1QA 4DXLA 4E0DA 4GO7X 2NPIA 3W65A 2MSSA 1OSCA 3MI7X 3PEHA 2CNKB 2HZVA 4Z2XA 5KFKA 3HKZD 1E6YB 2Z2ZA 1UAWA 2VH7A 1WG4A 2D3O1 5K20B 1K1SA 1S1XB 5A2QY 1KD1T 3CD7A 2FZGB 2F8HA 3HCXA 4IFVB 3OW2R 2YX7A 2RF2A 1CJKA 3DLKB 1MN9A 2JH3A 4ES1A 1JXEA 4DDFA 1S6PB 4DV6F 4CLKA 4YB6A 1IBLF 2BR0A 2MMYA 3A3PB 2NXJA 1NKEA 5J2NA 2B4VA 4TY8B 2AX1A 5BXIA 4BC7A 1Q78A 5IZHA 1T0TV 3AODA 5B0FA 1N33J 2NQPA 3MM9A 4IFYB 2FPHX 2BOPA 1YGYA 6FD1A 3UW1A 3SCKE 1GXUA 2DGVA 4IO9Q 3BGFA 4TU8A 4J9QA 2ZH3A 2B4UA 1VIXA 4NLUA 3UE2A 1P1TA 2OP5A 3JSMB 4K4WA 3H4DA 2W2OP 3B82A 2DR7A 4F7VA 3AD7C 2HGNA 2GZOA 3OJUA 4GVBB 5IT0A 2F1FA 5K8NA 1RAGB 1HR0F 1SQFA 4RU9A 3BPDA 2BDPA 5D3GA 4F25A 4DUZJ 2E5GA 2K2PA 1RTIA 3RU0A 1EETB 1IR1A 2G2YA 2I1RA 1RAEB 4OQJA 1DTTB 1FO1A 3TUPA 1RAOA 1SB6A 2J6TA 5CAAA 2BACA 1VK3A 1BC6A 1M5OC 3TJ8A 1O51A 4IR1A 1NSQA 3SIPB 5KT6A 2R7SA 2MYFA 3KG1A 3BN4A 4NLDA 1O5JA 1DLOB 4X66F 2G1DA 4P7VA 4N56A 3PKYA 4WP3A 1VBZA 4L6V3 3HF5A 2FD2A 3T1AA 1WOSA 3B54A 3RR8A 3P5BP 3RRKA 3J81U 1HHQA 1NSPA 3CIMA 1TK8A 2FJWA 2OD4A 2E9ZA 2CQ4A 1VGYA 3V6DB 3S6EA 3R5BA 3Q24A 4B9LA 4PUOB 1CBKA 4ZVGA 2C2KB 4L75A 4B9TA 3T5HA 1XTZA 3KMSA 4ED8A 3D67A 2QV6A 2GQCA 3ADAC 2Z30B 4PXDA 2B43A 3MF5A 4J9UE 1HYSA 2FJVA 3WC2A 1HMVB 1ZA1B 4DL2A 4DN9A 2P6SA 5DQHA 3ELHA 3TJ9A 4LRBA 2JSXA 2KVIA 5MLCV 1F1BB 1GAOA 1K0VA 4K2XA 4H4MA 5K5MA 1VCTA 1I94J 1N88A 2J7WA 2MZSA 3P5TL 2VZ9A 2HQCA 1F6TA 1SH3A 2HK3A 3ZC4A 4AQYF 2ZH6A 4ZJOA 4URSA 3GB0A 3KYLA 3CW2C 3GV5B 2HRTA 3FCVA 2HMIB 3W62A 1TK0A 2H3EB 5HVFA 2ERRA 3ZXWA 3PEJA 2RIJA 3U02A 3H59A 4GRSA 1OQ3A 1MG7A 2YKPA 3NBPA 2QJ3A 5ETMA 3W9HA 1URNA 4RUHA 3D3BJ 3JXOA 1P6TA 4ZDNA 4DCOB 2BJ1A 5HMXA 3MPYA 4IDKA 3H5UA 1NB2A 3RTVA 2WTFA 3MECB 2ZZMA 2UVVA 5C24A 3LW5C 1CJUA 2W4CA 5D6GA 1H7WA 1X0FA 3J7YI 1ZZNA 1P9YA 4JI1F 1U45A 4JI5J 3CO0P 1HNWF 1IKVB 5CHCB 4LF8J 1NRKA 3OL8A 2YKQA 4EUVA 1E6YA 2HBRB 1F5BA 2HEKA 3LGMA 4QIWD 3UQSA 1Q81T 3LO3A 3NMRA 2KDOA 4WCEQ 5DETA 1S1XA 2MSTA 2HHSA 2QLBB 4Q7AA 7AT1B 3EPGA 3MUMP 4IFVA 2KYXA 2XNRA 4K4UA 4N76A 3DLKA 2F7VA 3GONA 4FVCA 2DGWA 1FNOA 1IM4A 1S6PA 1VI7A 5ETOA 4X84A 3R97A 4LRAA 2ZH1A 5AJ3F 1HA1A 3UO0A 4B3MF 2XLKA 2QLXA 4TY8A 1U48A 3OTBA 1U8WA 1S6QB 1QY7A 1G2EA 1DAXA 4ZIVA 4QPXA 1ZM4A 1N56A 4IFYA 1FFGB 5B08A 1O0PA 4EEYA 2KXFA 3NEKA 3H40A 2GV1A 2EC0A 1XMBA 1XEZA 2J9DA 2E1MC 4JBCA 2E7VA 1TELA 1N36J 1S5ZA 1D9AA 2RNEA 3JSMA 1RWNB 3ISND 5KFJA 1TKZB 4Y34A 3N6NA 2MLZA 3KTQA 2ZVSA 3AB2B 3EVOA 4GVBA 3W2VB 2JDJA 8AT1B 2MQLA 1F9EB 4ZLJA 2YWEA 2UUTA 2QRRA 1NM2A 3VV2B 1EETA 3IR7B 1FKAF 3HX9A 1RT4B 5GAHI 2FY8A 3LP0B 1YDLA 1HFEL 3PW7A 1SJ1A 2DNNA 2DRAA 4RWXA 2OD6A 1IWGA 4ZP8A 4EZ9A 2BW2A 3CUNA 1FF2A 2IM3A 2W25A 3V4IB 4NMLA 1DLOA 4RJVA 4GKJF 2C28A 1Y00A 4IQMA 3HSZA 5KFEA 2WBMA 1QVGR 2QL9B 3D6FB 4I67A 5LXRA 5DQGA 2W2NP 2OTLS 4Q44A 4I7FB 1GXTA 1VC0A 2WOMB 2W9CB 3CTRA 2ZH9A 4JI2F 5KFCA 3PDNA 2EWHA 4WP8A 1Y3KA 4YS2A 1U8SA 3WX4A 5H9EJ 4OX9F 3V6DA 5CD4H 3FEZA 1R31A 2MXYA 4PUOA 1M5SA 3KK3B 2AGOA 3UD3P 3Q22A 4KGZB 3T1HF 1AXQA 2B8PA 3ILJA 1KWMA 3BV8A 5CXTA 3RAMA 2RB7A 4U67Q 4WJBA 4CYUB 1MW7A 1VR6A 1YTYA 4RUAA 2M88A 4DZDA 4C0OC 3UCUP 2O67A 4JV2A 5DG7A 4OHYA 4LF5J 1IKYB 3W9JA 4P2MA 4CQ1A 5FIIA 2PT0A 2RVJA 3OLBA 3IXQA 3THPA 2OPSB 1MWQA 3QAEA 2XO7A 1FNXH 2OMLA 2ZZNA 2NSBA 1TL3B 2BX6A 2ZHOA 3S7RA 4NLSA 1XMQJ 2HMIA 5IS2A 3DKDA 4YP3A 1EQ0A 4L76A 3RGIA 3FDSA 2DGUA 1UVNA 4F4ZA 1FTRA 2MKSA 4HDHA 3ENQA 2KT3A 3H5XA 2D3OR 2J0XA 1OSDA 1R7IA 4KRWA 1DQ8A 4LRDA 1WDDA 2PE8A 1VQPS 2DH9A 2CPFA 3HHNB 2H65B 3MECA 5KFZA 4U7CA 2VHGA 5HQLA 1WACA 2C2RA 5KAKA 3G8SA 1PJ5A 2UXCF 1T8EA 3FRYA 1R8AA 5C2GA 2NS1B 2FHMA 2O1PA 4RNMA 4NLTA 3DM2B 1UEVA 3K57A 1IKVA 1ZM2A 3P96A 1I6JA 4L3KA 1AT1B 1JWWA 4F2SA 3NY0A 1RI7A 2HVEA 3OL7A 2DNRA 2YTCA 2VOOA 2CVIA 3K89A 2J0WA 4DU7A 3MGJA 3M8QB 5IC6B 3AH6A 4BHQA 2C3YA 4FYVB 3HVRA 2Y0BB 4NZ0A 1VQ9S 4L3NA 2U1AA 2XSJB 3KUGA 4YB7A 1Q8BA 1KDNA 1YG0A 4O3OA 4EO6A 4FXWA 1FCAA 4TQSA 3OQ2A 3UFCX 3MPDA 1LQ9A 1HW8A 4AUKA 2HFVA 2A6MA 2QO3A 3QT6A 2N4DA 4DR5J 2VB6A 4YR0A 3VGTA 3GMGA 1P27B 1S6QA 1GQEA 5IC4B 3PFEA 4Q5VA 2IC3B 2H9ZA 5B0EA 2G2OA 2RILA 1JQGA 5J2PB 2QL5B 2LEPA 2RRBA 5L1JA 4ZPAA 4OL8A 1EB0A 2ABYA 5KFTA 3M8ZA 4M5JA 1HWKA 2H5EA 2OHDA 3PZPA 1UW9A 2DR6A 4I69A 2I8EA 3OSNA 4XO0A 1RAHB 2C2MB 1LXNA 4ZVRB 3SSQA 2UU9J 3W2VA 4HACB 2K8GA 5D77A 3TANA 3RB4A 2EC2A 1AFJA 1K0TA 4DX6A 2BRLA 3DI6B 4ANCA 2IVYA 2XYPB 5E33A 5F0UA 1ZTWA 2HVZA 2EKNA 1YIJS 2VF3A 1RT4A 3VALA 4J90A 3NGKA 4A8WA 1T03B 1RBLA 3J7AN 4F4AA 3QZ8A 3LP0A 3JYTB 4U9RA 1F60B 2CPIA 2ADCA 2CQ1A 4MH8A 2ZOFA 5F3TA 2PC6A 2Z4PA 3O2IA 1YX2A 3UWTA 3D6MB 4OYMA 3MTJA 4PYDA 4F0HA 1ELOA 2D74B 2XMAA 1KFSA 2XMTA 3V4IA 2QSFA 5LMUF 4CLTA 3C15B 2MLYA 1P9QC 2C2DA 4LF4F 5L38A 3N79A 3ET6B 2R8JA 4I7FA 2WOMA 3IGNA 2N7YA 2W9CA 2RAQA 3PACA 4M5IA 3T9ZA 1NJYA 6AT1B 4X2BA 2KG1A 5FLXY 4HKQA 1JX4A 4ZA1A 1UPPA 3PM9A 4LF8F 1DJ0A 3KK3A 2VU5A 1RKJA 4ERDA 4HT7A 1AZSB 1FEEA 2BQUA 4AXJA 3BS9A 1XC9A 2ZH4A 1J5OB 2DR9A 4DQPA 3ISNC 3U1NA 5HANA 3PX0A 4CYUA 3G8TA 2PFDA 2W4DA 4ZVHA 4KB7A 3CJSA 3BB5A 1PIEA 2XY7A 3U7JA 2NYIA 2IBOA 1U1LA 5DGAA 2XS5A 2G0JA 3A8EA 4RKUC 2HQIA 2ZDPA 3TP2A 3R2CJ 3J80U 1IKYA 2HHTA 2L9WA 5LL6d 4IKAA 3G4SS 3RR7A 2OPSA 1R8CA 4PYAA 4EBCA 2DHHA 3DDIA 1UWBB 2FC8A 4KV8B 3NS7B 2KZMA 1Q7LB 3BH7B 5E7OB 1Y10A 1TL3A 2ATCB 3MUTP 4ITSA 2RD5C 2LXFA 4ZIWA 2Z0GA 3PCOB 4R8UB 2OH2A 2LMIA 1S72S 4CP5A 2DRBA 5H1SV 2AYGA 4DG1B 3MMAB 1UFWA 4OLOA 5THWA 1WC1A 3HMJG 1C4AA 1GMWD 3K8WA 4ZKAA 5FD1A 1FX4A 2Z8QA 4CM0A 4I0WA 2JLGA 1RLCL 2B56A 1FT8A 3UVJA 3CJ3A 5DRKA 2XCPA 4A8FA 4XK8C 4QIEA 1ZM9A 4ICLB 2QMWA 5KFHA 1UP1A 5AT1B 1YJ7A 3FBEA 3DMJB 1KOHA 2XHWA 3GSIA 4O3NA 3DM2A 3W3SA 1KQKA 4DV4F 3PR5B 4IH5A 4V19X 3PJXA 3IFEA 4USHA 3PR4A 4LF9F 2R2TA 4N47A 2BE7D 4DL5A 4ZPWR 2XM3A 5AE2A 1HNVB 4JOUA 4MYTA 1KEKA 3A4TA 1RSCA 1X9WA 2DKOB 3M8QA 3GFXA 3A12A 3M9MB 1A7GE 1U1PA 2IPOB 5CCMA 1IBMF 2H1YA 1NO8A 4F50A 2XSJA 3FFIB 3IS9B 2V69A 3D2WA 2CQIA 4AE5A 1U25A 1HW9A 4DQIA 1VQ6S 2V68A 4WKRA 2LQBA 2B7CB 2K7KA 1N5TA 2BJ3A 1WOPA 2C1EB 4NLWA 5BJRA 2AYMA 2HQ3A 2FIUA 1RWKB 3W2WB 3VWSA 1WI8A 3E01B 3ILLA 1Y5LB 5ITHA 2IC3A 2NLWA 1RHMB 3ZZOA 1JMTA 1D9DA 2VFVA 3H4BA 1M1HA 5E3PA 5KFBA 1FRJA 1CS4B 1IBKF 4ZPDA 2HG4A 2C22A 2W2QP 5D0GA 2FHOB 5KFYA 5HJXA 5KOWA 4B9VA 4IOAQ 1FDNA 1WORA 1RHRB 1O8BA 1E6VB 1SVDA 1RU2A 3IM9A 1SJRA 5J1EB 3WX8A 1LV5A 1RU1A 4LF7F 4K50A 1S4EA 2W1BA 1RWOB 4HACA 2AEJA 2DHGA 3OXFA 2VQFJ 1KSPA 3TZZA 3BBFA 4MJKA 1VJQA 3CJ0A 5HP1B 3KLHB 3DI6A 1NKBA 4RUBA 1HBUB 1RAIB 1S48A 2IRXA 4J9RA 1D3WA 4M5HA 3EX7B 4J9PA 2YX1A 4NXNJ 3QFHA 5M2UA 3GYGA 1T03A 2FGCA 3M6VA 3JYTA 2DNPA 3NWRA 1TL7B 5DO2A 1GMWA 1PYOB 3K58A 1DHMA 1JNRB 2KG0A 3F56A 2GMJA 4OZJA 2CNOB 2MZJA 4CWBA 1RISA 3MURP 1TAUA 1ZM3A 1J27A 2A1BA 1DQ9A 5JJBA 1WTBA 2CWKA 3C15A 2HHQA 2PMZD 2HAIA 4NEYA 3MCSA 3J81j 2F63A 4C7QA 5AE1A 4CH0S 4B3TJ 2YQ3A 4C8ZA 4LBPA 3MEGB 1HQEB 2VQEJ 2F4FA 4MKBA 1D8ZA 2FVQA 2OPQB 4FDFA 4U95A 2OAUA 3W61A 1Q53A 2CPDA 3AXMA 1Q8KA 1YLXA 2KH9A 1S7IA 1C0UB 2GA7A 1AZSA 4M1KA 3D9BA 4RU2A 3IWNC 4F26A 5KFXA 1J5OA 2E29A 2WSEC 2XWYA 2UVRA 1HI8A 1QDUB 1PO6A 1WEXA 4QJVA 2EPIA 1T9TA 1FDAA 3D66A 1WSRA 4Y00A 3CJ8A 3EVWA 2YNHB 2EFOA 2PN6A 1RZMA 1N4LA 4KH0B 2GS8A 3IC1A 3QRPA 1Y5NB 1JXLA 3EE3A 3G82B 3IWXA 1UWBA 2PI5A 4KV8A 3GIKA 3TWZA 2WHOA 4YHHF 2QX0A 2M8DB 1SJQA 3KOAA 3BGUA 3FRZA 3CCTA 5A2QU 4R8UA 1KQGB 5CD4A 5IFMA 4ZPCA 4IUFA 5CH7B 4O3SA 3QGHA 4DG1A 3MMAA 1PBUA 4ZCMA 3W8GA 2MKHA 2A10A 1PAUB 4XPEA 3I4PA 1X31C 2X1GA 3GFZA 4JUZA 2J9DE 4ICLA 3FVYA 4WXOA 5KFDA 3LTOA 4DFPA 2X7IA 3DMJA 2ZUGA 5CYQB 4KTQA 4DCJB 2WW4A 4ES3A 1WHVA 2LDYA 5E0OA 3J7Z5 1HNVA 2DGSA 5GMDA 2KYZA 2RRAA 4OYXA 4TLQA 2FUG9 2HQGA 3TR5A 4WKYA 3GJTB 4ECYA 1SJFA 1KS2A 3PHEA 3FC9A 4DBQA 2UUCJ 1HNXJ 2Q6BA 3FFIA 3IS9A 2XMMA 4CO5A 5IM0B 2RU9A 1VFJA 1T7PA 1BUXA 4C48A 2ZM6F 3X1LB 1X9MA 2XG8A 2ZH2A 2LXIA 4LSZB 2PD1A 3CDBA 3PVXA 4ATNA 1FRMA 3DLHA 3W2WA 3E01A 4R25A 3TARA 2AJ0A 3AOCA 4XPCA 1KOOA 3M30B 1TV6B 1SKRA 4J91A 3THTA 2W7AA 3KKFA 1OIAA 4AL5A 1UVIA 1CS4A 2LU1A 3TAPA 4IO1A 1Q16B 3A8IA 3OR1B 3OD2A 4KH1B 3R1HA 5DS7A 3DOMB 2XZDB 1E6VA 1SJ3P 1HBMB 5J1EA 4AD6A 5GMKa 1FERA 2AEMA 4Y3CA 1HWUA 1PC5A 2Y1LB 2EVZA 1LK5A 2Q6CA 2RDDA 1U24A 2OSQA 5H9FK 1ZH5A 4IH6A 3THVA 5HP1A 3KLHA 3CCVS 3EGWB 2NXEA 2JNJA 1HBUA 2O3DA 4LVOP 3KXDA 4FBTA 5F9NA 4DV3J 5CYJA 3IRXA 2DH8A 1Y7PA 3DYAB 3BR8A 2OI2A 2RS2A 2D69A 1TL7A 1KHWA 4P52A 3BBBA 4ED7A 1MWZA 3I9V9 3TUIC 5A6PA 2D1CA 1SIZA 5E5NA 3NWGA 5AE3A 4LFAJ 1RHQB 2DTJA 2YNGB 5HK4A 1RUSA 3FMBA 2GHPA 4K2JA 1YZ7A 4C8MA 3UD4P 3MHYA 2MGZB 3QGGA 2QG9B 3GYXB 2I0XA 3MEGA 4ELUA 4OZ1A 2KN4A 1HQEA 1C4CA 2XZTB 2OPQA 3SEOA 2X1FA 1RA6A 3GQCA 3VGSA 1C0UA 1AUSL 2PFFB 3I5AA 3CSKA 1VQYA 4F67A 5KG4A 3UCZP 1EARA 1FJGF 2V8GA 3A8KA 2QYCA 2F5GA 2I6WA 1Q86T 3LAKA 3PYFA 4CO1A 2DNLA 2MY8A 1MWYA 4R0JA 2XQCA 5B0CA 3DLJA 2YNHA 1VBXA 4AL6A 2BVZA 2RKIA 3VAHA 4K4XA 1SUQB 5F8IA 3KDNA 5T7LB 5D8HB 2XMJA 2DPJA 4F8RA 1VRQC 4ZITA 3G82A 1F9HA 4N8NA 4USJC 1R8BA 1WF0A 4O4RA 3WHIA 2ZOGA 2IIHA 1NJIT 5G0RB 3H20A 3VQSA 1T9VA 2R2RA 2RHSB 1JXVA 2UV8A 2Y1IA 3CGIA 3IBWA 2PO4A 3OT9A 3EZOA 5J1NA 1HHSA 3Q23A 2F9JA 1ZOTA 1IJEB 2IRYA 2V2VA 2EI5A 1XNRF 5B09A 4CO3A 3E2EA 3TQ1A 1MN7A 5G4DA 4KGMA 3BSCA 1KTQA 1LWFB 2XTJP 1LK7A 2ILYA 4PEOA 2CJYB 2ZUAA 5IWAJ 4JB8B 2HK2A 3WC0A 2Y1RI 5F41A 2GIFA 4JP8A 4JI4F 4V19J 3FK4A 1VOMA 3NOGA 4C8YA 2NPFA 4CLWA 3BGLA 4WZQA 4DQRA 2CZ4A 4EYIB 2EBEA 4USWA 1R3NA 4MK7A 2VC0A 4KC5A 3FBCA 1HNIB 3MOJB 5CYQA 4DSKA 3H42A 3GILA 2OJ3A 4Q2MA 5K14B 4OYAA 5F8MA 2AQ4A 3OVBA 3ZTQA 2U2FA 2QMUB 1VQLS 4H4OB 4EI2A 3V6KA 1N8RT 3MM7B 4RLEA 4PG5A 2CFXA 2YWGA 3B4MA 5HATA 2HAFA 2BQRA 3I9ZA 1U09A 4O3RA 1SH0A 4M5DB 1WHWA 2HWHA 3KUEA 1GNKA 2QLJB 3CMQA 1RAFB 2RSQA 3UDLA 3V2UC 5IM0A 1IQTA 3LA0A 2ZFHA 2EFGA 4B3TF 3SQOP 2CJXB 1JB0C 2QA4S 4MIAA 4DU8A 1CSJA 2MQNA 3EXCX 3QNWB 2QYGA 2E44A 1QVFR 1YRUA 4TYAA 2DGQA 2QL7B 4WE1B 3C46A 4CLPA 4OZLA 3M30A 3FZ2A 1TV6A 1OY9A 3SFGA 2WVDA 1GMUA 1RB0A 3OR1A 2GQ2A 1UZDA 1NMEB 5L1IA 3PJ9A 3D0IE 2RQCA 3DOMA 2ROEA 2AJFE 1ACMB 4QIGA 4CIOA 1HBMA 3JTNA 2DR5A 2H4YB 2XC9A 2NR0A 2JZ5A 3S8SA 4QWEA 2VUGA 1TK5A 2F65A 4DL7A 2Q43A 2BJ7A 4DWIA 3J7A1 4X62F 3L9ZA 4UT4A 4MKAA 1EKSA 4PZVA 2ATLA 2XBPA 3R7BB 4OYOA 3RG6A 3FEYB 4DR4F 3DYAA 4DPTA 4G3IA 2GO9A 3C14A 4C3KA 1CJVB 1TL5A 2ALZA 4M95A 1N34F 2IFXA 3KK2B 3N01A 2FHJD 2DXEA 3JSYA 3GZ7A 2P5VA 2MKKA 4TLRA 2YNGA 9RUBA 4NLGA 3KHHA 2MJUA 4TU9A 5HN0A 2MGZA 4C2MA 1B0PA 2Z2YB 2M2BA 4MAKA 1YSJA 4AL7A 1S0MA 3RZAA 3MAQA 4N7TA 4DV2J 4ECXA 3Q2SC 2K1RB 3BKUA 4GVLA 4G65A 5D4LA 2DHAA 1PGZA 1M5KC 4NLRA 2CZVC 3NGUA 2YVSA 4C97A 2J8AA 2YKNB 1LFPA 3KJFB 1ZETA 1D1UA 3ZTPA 3M1VB 3ZTRA 2CA9A 3ZZPA 1FKPB 2UUBJ 5HI7A 5DLFA 3BYPA 3DU6A 3CCJS 2ZNZA 3SDEA 3HD2A 4UQTA 2XY6A 2WB1D 2XMUA 2H4WB 5DG9A 2K3KA 5ADZA 3JQKA 1SUQA 3MR2A 3MPVA 4HVZA 5T7LA 5CZVA 2Z56B 1DY3A 3PFOA 1JLEB 5EHHA 3K17A 1RAJA 2R2UA 3PO4A 1HIYA 1KONA 5G0RA 2BJEA 4LJMA 4OYWA 1EX8A 2E5IA 3W66A 4UZBA 3EJMA 3NXZA 1LWXA 2A3JA 4P6QA 2VBYA 4OZ5A 1LWFA 4OHZA 4DUTA 1U1MA 1GX5A 2QN6B 4GKKJ 1IXKA 2ZBPA 4FN5A 4IRDA 1B0TA 3VAFA 2DYAA 3S01A 3BYRA 2AYBA 1EHWA 2P9CA 3EM1A 2DNGA 3PXGa 1HWLA 4CDIA 2QT7A 5LMNJ 4X65J 5GADI 3SQGA 4ILRA 4DV7J 2BJ9A 2DNYA 4C9DA 1HNIA 2UZAA 4DR1J 4QIFA 1X8DA 2GVDB 1G6BA 4DV3F 3OBIA 2NZ4A 5K14A 4DPOA 2AJQA 5HMWA 2KT2A 5LOQA 3RYLA 2P9GA 2MY7A 2HWIA 5KFPA 2FHJA 3OR2B 5MAOA 4H4OA 2VASA 3MM7A 2ASJA 4J5OA 1L3TA 3S1TA 2AEFA 1RWMB 3HP6A 1YWXA 5KT4A 3O6QA 2CJKA 1GEHA 4OZNA 2F4VJ 4UOFA 5H9FJ 3PG9A 1A0OB 1GK8A 1S99A 4M5DA 2XZWA 4OIXA 1N5YB 2NXUA 1VQ7S 4QPTA 1NHKL 2MZ1A 5KG1A 4B3SJ 3ZZ0A 4P71A 4BCAA 4F4YA 1V9OA 3CCES 4WFBQ 4HDGA 4I64A 3TZXA 5LSOA 3T9NA 4FNHA 2WAQD 1FTCA 4LF6F 5EX0A 1M5PC 2J7KA 3RUBL 5J1PA 3HVWA 1V5VA 3LP1B 4OJ3A 1Q5VA 3CJRA 2F8EX 3QT8A 2CPEA 3C2PA 4WE1A 4PQAA 3CCLS 3P3DA 3CCMS 3TA2A 4IG3A 3GJSB 5LSRA 3CJTA 4W98A 4CO2A 2E7WA 4B9UA 3G6ES 4MYUA 2ZWPA 1RXOB 5LT5A 2RUGA 2YH1A 2JOQA 1BXNA 4QQBA 4JI7J 3PW2A 3L7OA 4C0BA 2CQHA 1RTHB 3I5CA 4GC7A 1PYSB 1AUDA 5LXYA 1NK4A 3OHAA 5A8KB 3KJQB 4ELTA 5K8PA 2V0NA 3MMBA 3BKTA 2GHWA 4B3RJ 9ATCB 3KG0A 4NWBA 4CLUA 1UJ5A 3AOAA 1GXLA 1NH7A 2CPYA 1WHYA 4P10A 4DR6J 2E5HA 4IQXA 4QU6A 1KLNA 1UVMA 2ZZTA 3ETMA 2MZTA 1QE1B 1SH2A 3KK2A 3B6BA 5IWAF 3W64A 1JLQB 3BKFA 2V8HA 2VIHA 2HHUA 3PO5A 2YWFA 3CD6S 3DXSX 3IAM9 4NLYA 1WD6A 1DBDA 3G2XA 3RRGA 7FD1A 1Z4UA 2J0QD 3QPIA 2IVFB 3HO1A 3MFIA 4A8QA 3DGVA 3KWMA 1GTEA 4O23A 1J2VA 2K1RA 2VJUA 1CLFA 4LSLB 2RJZA 1X5TA 4EK2A 1RWXB 2VOPA 5L1KA 1Z2LA 1VS3A 2YKNA 4Z7CA 2VPYB 3UI3A 4LQ9A 2P6TA 1VRUB 4DSJA 3M1VA 3WBZA 1IKXB 2DNZA 1FKPA 1YITS 1VHFA 2GIRA 3FQLA 2OELA 4W92B 3CCSS 1R6YA 1XNQJ 4RWWA 3TUZC 1CG2A 1D09B 4UQGA 2DNHA 2XSFA 4P2FA 4WPAA 3MCMA 2QFIA 4M5GA 4XAKA 4ED4A 2RH3A 1JLEA 3LP2B 4M5LA 2B9EA 4NLXA 3M9NB 2ZH5A 1DTQB 1UMJA 2HFUA 4KJIA 3UR0A 5KG6A 3RAXA 2XEXA 1XMOJ 4CM2A 3D7SB 3TEHB 3TJAA 1F3VA 5IXUA 2E66A 2IBKA 1SPBP 2UUWA 2UXDJ 1A9NB 1AW0A 1EAYC 1Q8IA 4LFBF 1F9FA 3SCIE 2FJXA 3D5MA 1NKCA 4Q45A 3GJRB 4J9OA 2HZAA 3BR9A 2W8KA 2YQ0A 2GIQA 1FD8A 2DNKA 2LKZA 1OWXA 4K59A 1JLCB 1T9WA 2FTRA 1J5EJ 4DHVA 3Q8RB 2P2CB 4QW9A 4DV1J 1U1RA 2DY1A 1UTAA 3WQPA 2YKMB 1IM6A 2LECA 4CT9A 3D68A 2BOAA 1S9GB 2VPXB 1Y0HA 4NMXA 5KFAA 2GVDA 1X60A 3Q2TC 5ETVA 5F9LA 4JI0J 4ZLLA 3EYZA 4LVNP 3PJWA 2QE5A 2EK6A 3UDCA 2DHXA 4KY3A 4Y2KA 1YJWS 4YY3F 2B6AB 3OR2A 1T3NA 4N5SA 2W4PA 2HNDB 2VD3A 3QJLA 4OX8A 3E8OA 5ETKA 4NXMJ 2UXBJ 3KMQA 3GFYA 5L9XA 5KG3A 1SIWB 2ILZA 4DQQA 2HYIB 2KL8A 5AXKA 2XNQA 1MU2B 3HHLB 1NDLA 4DR2F 3PIPQ 1K47A 3B78A 1S9FA 4BBYA 1TL4A 3O44A 4K5RA 2N82B 4DUYF 1VQ4S 1LKZA 1W25A 1N5YA 2M7SA 3CDUA 1FD2A 2ZJPQ 3K7RA 1R8HA 4ID8A 4NL5A 3QBCA 3HFVA 4X64J 1UVKA 3QAUA 5GMEA 4DR7J 4OYPA 3D6HB 3ZZUA 3LP1A 1H3DA 5EWFA 3G86A 5GAGU 4NYOA 3E51A 1MNEA 3QWUA 4OYZA 3DOLB 2DIUA 5J2QB 4A47A 1OMSA 4NRTA 5HROB 2UV8G 2PEHA 3KNAA 3DC2A 3MM8B 2YQ1A 5HMYA 4ELVA 2LEAA 1RTHA 3AB4B 2BW7A 3D6TB 1Q82T 5A8KA 4EFAC 2DXFA 5HAOA 3OSPA 2NUHA 2OEMA 2AT1B 4EMDA 4IRKA 1FFWB 2HS3A 1ZYQA 3BBCA 2R7XA 3VAIA 2CNLB 1Q0NA 5K9FA 2KKHA 2G0CA 2ZH8A 1ZZFA 2G0IA 3DCAA 3H98A 2M3DA 4ECZA 5HBMB 1FKOA 2FJEB 4NASA 2BMBA 2Z2LA 1NZ8A 3GWCA 1NHUA 1H7XA 3OLAA 3TZYA 1HNZJ 3H2VE 1QE1A 1P8GA 3IR5B 2XI3A 3AQOA 3D1OA 2VONA 1SC3B 4IYQA 3C16B 3RBEA 5AXMA 1JLQA 1UVLA 2R8KA 2HLUA 3EDRB 3AOBA 4KGXB 2AIRB 3DLBA 3HHLD 3KUHA 4DCPB 1TU0B 3EUNA 1OYEA 4X65F 3TO8A 2FVSA 2CIMA 3OL6A 4DL4A 3HT3A 3FCWA 1NPRA 2GMHA 4ZOSA 3V6JA 2OEKA 2AZ3A 4JI8F 1X5SA 4LSLA 2PMWA 2IM1A 2DO0A 3MZIA 3GTYX 3R27A 3T19A 1Q79A 4C4WA 3G6VA 5KFWA 3OTOF 1VRUA 2V8VA 2IDLA 4NI2B 3MM5B 5IT9Y 1IKXA 1N5VA 3NS6A 2AD9A 2X1BA 3CO9A 3M8SA 2F4VF 2H5IB 4QYRA 5AXLA 1SQEA 4ZK7M 3HI9A 1PSDA 4J37A 2R42A 3A1YG 2MTLA 1CVJA 1YZ6A 4KHPF 4OZ3A 1N32J 2ZC3A 2I5JB 3CDAA 3HJVA 3DLLQ 1OY8A 2BRKA 2YWKA 2XLIA 1UW4A 1QM9A 3QMQA 3LP2A 2BBEA 3GE9A 1WG5A 4PRFA 4ETXA 1DTQA 4QYZK 2VFSA 3G8QA 1QUPA 2ZDOA 3CIZA 3Q89A 2N3LA 4RBUA 4ZP7A 4KPCA 3DDNA 2OUGA 2DY9A 1UJ6A 3RJMB 5E41A 2VDIA 2D7SA 3BM7A 3UN3A 4B9SA 2IYIA 2HFNA 4RR5A 3TNVA 3Q8UA 4JI7F 1S1VB 1JLCA 4Q43A 1TUVA 1D0EA 2LP4A 3GG1A 1KP6A 4NLVA 3QIPB 4PWUA 1FXRA 2YKMA 2IYGA 1NK5A 4ILMA 4DPUA 5A76A 1Q4RA 4JYAJ 3CE8A 1S76D 4B3RF 1S9GA 3HFKA 2JVOA 2YKOA 4MT1A 1U6ZA 3NG8A 4OHXA 2LA4A 3R5DA 2VG6B 2DGOA 4WK1A 3WIUA 4DR6F 2HLTA 5EGYA 1IVZA 3LUYA 4RW9B 2MKCA 2B6AA 4DR3J 2L41A 2HNDA 1NK0A 3M32B 2EG2A 4DFMA 1NPKA 3HKWA 3DDKA 4QU7A 3TRGA 5AXNA 1MU2A 3HHLA 1IR0A 3GFHA 3D3CJ 5A8WB 2RQ4A 2M4MA 2KO1A 3OHBA 2CQ3A 4DV6J 1PJ6A 5ETSA 4USKA 1NLKL 1EKRA 4Y2MA 5LJ3Y 1N54B 3MEEB 1IBLJ 5KT2A 4OI3A 2CPXA 4V1Ak 1TR0A 4P75A 4MK8A 5HMZA 4JV1A 2IVMA 4DFKA 1X5OA 2J7UA 4M5MA 3R9LA 1VQKS 4CCHA 3EMTA 3DOLA 3BDEA 3BQ2A 5J2QA 3CC4S 4WU2A 3MM6A 4J9KA 1U0HB 2GJ2A 5HROA 3BN7A 3LH2S 4JI3J 2WCXA 3T6BA 3MM8A 2XMKA 3GPAA 4JI6F 5DM7Q 3L3CA 2ZE2B 2ALYB 2CQ2A 1IJFB 1XNQF 4HLBA 1FDDA 1U1QA 3LPEA 2HFZA 1R6VA 1RYSA 1RT3B 4U96A 5B0GA 1HWIA 2JLFA 2QLFB 3CCWA 4HI1A 4KQZA 1WC4A 3IM8A 4D3GA 4QZVB 2R7RA 3NAIA 5HBMA 3ZO7A 2OPRB 2FLLA 1IUJA 3W5XA 4OHVA 4RBVA 5KFIA 1JIHA 2XULA 1WG1A 2BKNA 3D28A 1NU4A 1XJWB 3G6XA 3C16A 3G71S 2VC1A 3DLEA 1TAQA 1PILA 3HFZB 3HULA 1HQUB 2F8MA 4HT5A 2HKEA 5CYMB 4X66J 2B9XA 3W5ZA 4KAIA 4LSNB 3PHTA 4Y65A 4DSIA 1DURA 1CEZA 2OTJS 1OS5A 2D41A 2IM2A 5D0HA 1LOUA 5F8LA 2EFQA 4LIWA 3R8YA 1DARA 5D0RA 1FDBA 4DQSA 4K5SA 2MEWA 3ENVA 3NGDA 4ZLPA 3ITHB 3I6PA 2FLOA 4OYIA 2OFHX 3LQVA 4NI2A 1S6UA 3MM5A 3NGTA 3FBBA 3DRYA 5I42B 4PXEA 3FNNA 3MPWA 4TY9A 3ISZA 1DZ5A 3FSIA 3H90A 1YJTA 1ZPVA 3KHGA 3UDEA 2I5JA 1N33F 4ZVFA 1D8YA 4F0KA 4RNNA 3DRPB 4X4TA 4X64F 3PW0A 4O0IA 4ZPTR 4S0MA 2EBGA 3NGSA 1UVJA 4EZ6A 3C3LA 5DLGA 2V67A 2CRLA 2KXNB 5EUHA 5GAGI 1VQ8S 2CVEA 4K4ZA 5DZ6A 3UVJB 1RHKB 4G1QB 2IJFA 1U49A 1XERA 4OJHA 3PW5A 2CPZA 1V3ZA 4DLEA 2J9CA 1N0VC 2ZNYA 4DUZF 2Y8WA 2B8QA 1WC0A 2YKAA 3HHLC 1TMJA 1S1VA 1WF2A 3P4UB 1HBOB 2V8PA 2ADBA 1KKHA 4GO5X 2AWZA 1FK9B 5DZ7A 3KLIB 3QGIA 3NKYA 3QIPA 2O66A 2K7JA 1NK6A 3TAMB 2LDIA 4ZPBA 4RW6B 2HGMA 4OV6A 2RQMA 3HVTB 2DBBA 3RW6A 4P72A 4A48A 2OPPB 3UR3C 5C25B 3J7YU 4J9LA 1WOOA 3K0JA 3KK1B 3R6GB 3M05A 2V8DA 2VG6A 4R0EA 1HNWJ 4OI2A 4RW9A 2E1AA 3B4DA 1UA1A 2VG7A 2J6UA 3M32A 4RBTA 3QIDA 4DMZA 2OEJA 1C0TA 3C8YA 3MEDB 1S1WB 3CJQA 3BSAA 4Q8EA 2BUNA 5A8WA 2BE2A 3A8JA 4HR2A 2GJIA 1XIQA 1ULRA 1Q5YA 3PYDA 1KVJA 3L7UA 4KHRA 3MEEA 5DDQC 1G3OA 2Y9HA 5KFNA 5HVGA 5AJ3J 2W7OA 1R27B 2AJ1A 2KI2A 1NK8A 5JVHQ 4PPZA 2XS2A 1YBTA 4YDDB 1R0AB 1UPMB 1UJ4A 3AXKA 2DR8A 4HHUA 4JV0A 5C5JA 3IGVA 3M9OB 2DGTA 5T14A 1I94F 3GV7B 4FXDA 3QJPA 3I82A 2L3MA 3MDFA 1U0HA 2JHEA 4A8YA 5KFLA 2PMHA 2IA6A 3VCDA 1RCOB 3RBXA 5KG5A 2XO6A 2AJ2A 2V9KA 1QSLA 1WDTA 4O3QA 4E98A 4ED0A 3OXLA 2ZE2A 1K9MT 3TUJC 5E3CA 1S4FA 3P49B 4RUCA 3G87A 3J7ZT 1IKWB 4HHJA 3MCNA 1RT3A 4OYBA 1NSKL 2NZCA 4ETZA 2XLJA 2MQQA 3N6MA 2CJQA 4DPXA 2L9NA 2Y0SD 4X4NA 2CPHA 3MTKA 3MD1A 2OPRA 3BSOA 4LREA 2E1RA 4NLOA 5B0DA 2EG1A 3NS5A 2MKYA 5GVQA 4RW4B 1XQIA 4JI5F 4QYZJ 1FRHA 1S49A 4HI2A 3R5JB 1HQUA 2COLA 2V2QA 4YMEA 3W60A 5CYMA 3BJYA 2JC1A 5KFUA 5B7WA 2PA3A 4LSNA 3TYTA 4DX7A 4I56A 2KRRA 5IV4A 4H4KA 3BGOP 4USMA 4JI2J 1IWAA 3LOUA 1ZPWX 4WTOB 1U2CA 4C3LA 3PRDA 4OX9J 1NJXA 4F4KA 2NYHA 4TN2A 3FGVA 4DR3F 3ITHA 3Q8QB 3T1HJ 3TZWA 3OL9A 4QIVA 2GJFA 4CO0A 3IAS9 1RTDB 2KU7A 5I42A 1VRTB 4NZ7A 2MKJA 3PW4A 3QWPA 4FYDA 3U1LA 2ZBCA 3WZ0A 2APOA 4QR2A 3DRPA 1LFWA 3EVMA 5DQIA 1BQNB 4NA2A 4N8OA 4RW8B 1S9EB 2WRMA 1N36F 4C0HA 2M52A 2V6AA 4CNYA 1VMBA 3F44A 4MK9A 4R5PB 4KT0C 2CYYA 4GC6A 4DEZA 4LUBA 2B4PA 3LWLA 4P9SA 2AF6A 2FZCB 4G1QA 4DJBA 1ZAXA 2W2MP 2VL1A 5SUHA 4USIA 3HLUA 1H72C 5HSPA 3OXGA 3BO3A 1BLUA 2ZVIA 1YHQS 3GR1A 1F5CA 4JI3F 1UFKA 3HVAA 4FF3A 3A13A 2LQ8A 3M2RB 5A6WA 2LA6A 1ZS6A 1X4GA 1HBOA 2C3UA 1WEYA 2LQJA 2KJVA 4Y0FA 4PQUB 1FK9A 3KLIA 2GVZB 4Y28C 2ROPA 2LVWA 2M70A 3TAMA 4MKVA 4RW6A 2VA3A 3HVTA 2UXCJ 1S12A 4A8OA 1T9XA 1BQMB 1RTZA 2OPPA 3ENWA 4URQU 5C25A 2CWXA 3KK1A 2J76E 2WBRA 4QWBA 2BM1A 5BYRA 1FRLA 5DG8A 2FLPA 4F36A 3M8PA 3MR6A 4QW8A 2ASDA 1F2HA 5HVHA 3MEDA 2V9WA 5E3AA 4IRCA 1S1WA 2HWTA 3DN9A 3QFWA 4QCLA 1QAYA 2HIQA 3K5NA 2HHHJ 4I2PB 2HPUA 2QFJA 3VF0B 4C11B 4RW7B 2HHWA 3KNGA 2FYXA 1OY6A 4ECWA 3GIRA 1U6BA 1U2RA 3A3NB 1HHTP 1X4BA 1T95A 3KHLA 2QC3A 4LFCJ 1YKWA 1FA0A 4D3HA 4TQRA 4ZJLA 1U0SA 2R7QA 1R0AA 3SI8A 3D0GE 2DIVA 1RWUA 4LF5F 2W9AA 1X9SA 4WFZA 1WF1A 1W2IA 1XR6A 5M2PA 1OQ6A 2V4QA 4UY8T 3W9IA 4ZVTB 2GHVC 3CDEA 3MR5A 1DRZA 4P73A 2BA9A 5F3ZA 1RT5B 1DFDA 2H5JB 3M6UA 2FVPA 3QJJA 8ATCB 4OI0A 2V2KA 5C2CA 2XYHB 1XMQF 1RGVA 3EPIA 3IRXB 4OI4A 1XBWA 3M7VA 3BDPA 4ECSA 3FJ2A 1EIYB 3MFHA 3SCLE 1IKWA 4G1PA 2KFZA 3W8PA 4H4KC 3HHEA 1L3KA 3LWMA 4NOHA 1SI9A 1SV5B 4NPOA 4C8LA 3M8RA 5DM6Q 4EWTA 1HKAA 1N5SA 2B0GA 3IBFB 3V81B 1T94A 2F3JA 2WVFA 1GT8A 3CJ5A 5DDRC 3POTB 3PV8A 5CZXA 2CKWA 2GAGC 4RW4A 4OX7A 4PPDA 1KRPA 1IBCB 2BKPA 1R0BG 3P6YC 2E9TA 3O8WA 1SL0A 5KFSA 2IY5B 1LEOA 5LMUJ 1MMNA 1TFWA 3HHDA 3FSXA 3R5GA 3FZBA 4LF4J 4KKOB 2K06A 1BGXT 2PSZA 5D15A 4ZHRB 3ZTSA 3WDOA 4H54A 3N4WA 4EGLA 3H0PA 4KR0B 2DEJA 1RADB 5LM7E 4O0NA 2ZJRQ 2WZ1A 2RKIB 3AJDA 1YQHA 4MKYA 4E8UA 3R1LA 1MMDA 2FC9A 5KOXA 4K4VA 3AA8A 3O5TB 4LT6A 4F4WA 4DR5F 2NSCA 3RB6A 1RTDA 3H5YA 5KFGA 4X4UA 1VRTA 1H2UX 3FUYA 2W9BB 4WWSA 4ANEA 3AQPA 2JFKA 1Y9OA 2D9PA 4HH1A 1NJWA 4QR0A 1WKKA 3T5LA 3JS9A 4DV0J 1RWWB 1NBEB 1Z1ZA 2YXLA 1BQNA 5FJ4A 4CH1A 5IT4A 3ZFVA 4RW8A 1QJHA 1IQZA 1S9EA 2R8IA 3HSGA 4R5PA 3C66A 1S0OA 3IR6B 1C2PA 2L48A 1RCXB 4YDXA 4C3MA 2UU9F 3G9CA 1VHIA 1VJWA 2ZD1B 4I6WA 5HLFB 3TX0A 1WEZA 3NRBA 1OPIA 3MR3A 2XB2D 1SC1B 2JWNA 4ZVUB 3T1YJ 1FJCA 1QAJA 2HS4A 3M2RA 4WIQA 2GAHC 3CJKB 2QEXS 4W90B 4WFAQ 2Q3PA 3AT1B 4PQUA 3CCUS 3HXMA 3MR7A 2GVZA 5KFVA 1H74A 1N0UA 3JQMA 4U8YA 1LWCB 1BQMA 1CJTB 4ZPVR 1NH8A 4WZMA 4OFZA 1CQMA 3NCPA 1YJVA 4DV4J 1VISA 3TOQA 2PGCA 5L39A 3SYZA 1JLAB 1DTTA 5F8NA 3LPYA 1YK9A 4DX8H 4LF9J 3EDQB 4NCGB 1FRIA 2R3VA 1YJUA 1CQNA 2Q79A 1ICEB 2HBZB 1B4SA 5KT3A 1T11A 4DV5J 1LNQA 1Q7YT 3GIMA 3NLCA 1KBRA 3SFUA 3C19A 2E7XA 4I2PA 1IBMJ 3SV3A 3GIJA 4C11A 1RT7B 3M2UB 1R8PA 4RW7A 1WWHA 2WONB 4I2QB 1GMVA 1SXLA 2MQOA 3QATA 4UUXA 1TQLA 4XTTA
chains in the Genus database with same CATH topology
1FT8A 3TI0A 3CJ3A 2HNDB 5DRKA 5EDWA 2XCPA 2MQPA 2XMVA 2VD3A 1SL2A 4A8FA 3QJLA 4OX8A 4X4SA 3IA0A 4XK8C 4IG0A 3E8OA 4QIEA 1ZM9A 2DPIA 3KMQA 2YNIB 3GFYA 2VBZA 5L9XA 1HPZA 1HI1A 4ICLB 5KG3A 2QMWA 4BS2A 1ZAVA 1SIWB 1JJHA 2ILZA 3US5A 4DQQA 2BQ3A 2UXDF 2HYIB 3BO2A 2XGPA 5KFHA 5AXKA 2XNQA 1MU2B 2WSCC 3HHLB 4DR2F 3PIPQ 1UP1A 3B78A 1U6FA 3FEXB 3HM9A 4BBYA 1S9FA 1U4BA 3DOKB 1TL4A 2M9KA 3DMJB 3O44A 4K5RA 2N82B 4DUYF 2KFNA 1KOHA 2XHWA 5E2QA 4ED3A 4O3NA 1LKZA 1W25A 4Z37A 1VQ4S 3DM2A 5EX3A 4QOTA 1N5YA 3W3SA 2M7SA 3AA9A 2OKQA 3CDUA 1KQKA 4IH5A 3PR5B 4DV4F 4K4SA 1RT5A 1FD2A 1TFYA 2ZJPQ 2JX2A 2RMLA 3K7RA 4V19X 1R8HA 2M0GB 3PJXA 2FJBB 4ID8A 4KO0B 4NL5A 2BXJA 3IFEA 2OSRA 4USHA 1Z2ZA 3PR4A 2EKYA 1KFDA 4LF9F 2R2TA 4N47A 3G96A 4DL5A 1UVKA 2MZRA 4ZPWR 3C6TA 2C2EA 3QAUA 3K2YA 1ZBTA 5AE2A 5KTQA 4TNOA 1HNVB 4JOUA 1J5EF 1T05B 5EN1A 4MYTA 1HMVA 4FF2A 2HW3A 2VG5B 4FNIA 3VAKA 1KEKA 2R7VA 3EGZA 4DV1F 5HL7Q 1X9WA 5KFMA 3LANA 3ZZUA 3LP1A 1H3DA 3M8QA 1H2VZ 3M2VB 5EWFA 2GC8A 3GFXA 3G86A 2CQ0A 3LALA 1APSA 4YQWA 4NLPA 5GAGU 4NYOA 3E51A 1A7GE 2E5JA 3M9MB 1H98A 1R43A 1U1PA 2JEFA 4FZVA 1MNEA 1FEHA 2L9DA 3QWUA 2DH7A 5KFFA 2GGPA 5CCMA 1LWEB 4RNOA 1IBMF 4DSEA 1RT6A 1NO8A 4F50A 4JI0F 3DOLB 4RX6A 2XSJA 4FP9A 3V5RA 2DIUA 3FFIB 2AGPA 5J2QB 3J80Y 3IS9B 1QAXA 1TKDA 4TKTA 1SV5A 3D2WA 4A47A 2ZITA 2CQIA 4TXSA 4AE5A 2AX0A 4NRTA 5HROB 2UV8G 5BR8F 4UUWA 2JVRA 1U25A 3OV7A 4WYLA 4YR2A 2PEHA 1HW9A 1WNEA 4DQIA 3KNAA 3DC2A 4ECTA 3MOZA 1MSWD 1VQ6S 2BABA 3MM8B 3DRXA 4WKRA 2LQBA 4URGA 3V81A 1SKSA 3SMZA 2B7CB 2CJAA 2K7KA 1N5TA 1M5VC 2ZKTA 4NLWA 4CI0B 5HMYA 4ELVA 2LEAA 2DVIA 5BJRA 4NXMF 2UXBF 2AYMA 2HQ3A 1RTHA 2FIUA 3CD0A 4PKDB 1M90T 3AB4B 4OHWA 1M0SA 4A8KA 3BO4A 3W2WB 3VWSA 1WI8A 5KG2A 1L3UA 3E01B 3POTA 4P7TA 4LIRA 1Q82T 1Y5LB 3EZUA 5ITHA 5A8KA 3NCRA 2IC3A 4EFAC 2NLWA 2GCFA 3ZZOA 1JMTA 4IOCQ 3IG1B 2RF2B 1D9DA 3I4HX 3OSPA 2NUHA 2VFVA 3H4BA 1CPZA 1MMLA 1NEEA 3IN5A 5E3PA 1HL6A 3VAJA 1QLNA 4IRKA 5KFBA 2HS3A 1ZYQA 1FRJA 1K73T 1S6OA 1IBKF 4ZPDA 2R7XA 3VAIA 2HG4A 4B08A 2C22A 1JJ2R 1GTHA 4ALZA 5K9FA 2KKHA 2G0CA 2ZH8A 1ZZFA 3DCAA 3H98A 1KN6A 2FHOB 1Q1KA 5KFYA 3K5OA 3D54A 4P2SA 5KOWA 2M3DA 4WTYA 4ECZA 5HBMB 4ED1A 4B9VA 1FKOA 2FJEB 1KNZA 4IOAQ 3OVAA 1R89A 1AFIA 2I38A 1FDNA 2W24A 3PX6A 2LEBA 2DK2A 4KKOA 4DR7F 2Z2LA 5J2NB 3GWCA 2HFOA 3DU5A 3K5MA 1O8BA 1E6VB 4ZHRA 3T3FA 1NHUA 2DJWA 2JEGA 3MD3A 3VQTA 4PUOA 1H7XA 3VTIA 3OLAA 2KTQA 1SJRA 3RB0A 3I96A 5J1EB 3H2VE 3RRHA 2FDNA 1LV5A 1JK9B 3OUYA 4LF7F 3TA0A 4K50A 1QE1A 3M6XA 1P8GA 3IR5B 2XI3A 2CQPA 3SDEB 2GQQA 2V94A 1S1UB 3AQOA 3D1OA 4MTPA 2VONA 2F9DA 1FNMA 2DHGA 3FSYA 1BQXA 4IYQA 3RAQA 3RBEA 1FRXA 3OXFA 1KSPA 5AXMA 4MJKA 2EFPA 1JLQA 3MM9B 1UVLA 4IOBA 2R8KA 2HLUA 3CJ0A 5HP1B 2CJ9A 4F02A 3GG0A 3KLHB 2WSFC 4X4QA 3DI6A 1NKBA 1VIOA 1A6LA 1HBUB 2RU3A 3DLBA 4WFYA 1S48A 2IRXA 3HHLD 4I4BA 4AYBD 4J9RA 1D3WA 4PR6A 1S0NA 3EX7B 5K8OA 2MDAA 4J9PA 2YX1A 3EUNA 4X65F 4KSEB 4QWCA 3TO8A 2FVSA 2CIMA 5EWGA 4YUDA 3K59A 3T5JA 3NAHA 5M2UA 1T03A 5KG0A 2FGCA 2LU2A 3M6VA 3OL6A 4DL4A 2W9BA 2WK4A 3HT3A 3JYTA 2DNPA 4B17A 2X51A 3KLFA 4MIBA 5DO2A 2VA2A 4OMFG 4ES2A 3K58A 2HHHF 4A8MP 1DHMA 1JNRB 2GMHA 2KG0A 3F56A 4ZOSA 2GMJA 3V6JA 4OZJA 4JI8F 3V6HA 1X5SA 4LSLA 2XMWA 4EBDA 2IM1A 1Q8LA 2MZJA 2DO0A 1RISA 4CO4A 3MURP 4KIAA 2DNMA 3MZIA 1TAUA 1YRTA 3R27A 1L3SA 4PWDA 2G9OA 2XGQA 1H38A 1KTVA 3T19A 1Q79A 1BY9A 1ZM3A 2Z2MA 3JSRA 4C4WA 3G6VA 5KFWA 1TZ0A 3OTOF 3DLGA 2A1BA 3EXYA 5D3GB 1DQ9A 5JJBA 1WTBA 4LFCF 1EP4A 1X4HA 1JLBB 2HHQA 2DHSA 3R3TA 2PMZD 1RTIB 2HAIA 1VRUA 2V8VA 3MCSA 4KFBB 4X4OA 5DDPC 5AE1A 4C7QA 3MM5B 5IT9Y 1IKXA 1N5VA 4CH0S 1Y5IB 3NS6A 3OVSA 2AD9A 2X1BA 3O1LA 3CO9A 4NRUA 3M8SA 1U26A 2YQ3A 1KHVA 1KQFB 2F4VF 4C8ZA 5I3UB 3MEGB 1X0PA 4ED6A 4QYRA 5AXLA 1SQEA 7FDRA 1HNZF 3M8PB 4ZK7M 3HI9A 1PSDA 1HQEB 3VAGA 4J37A 4ECQA 4MFBA 2HRUA 3A1YG 3T5KA 1CVJA 4YB5A 4MKBA 3I31A 5CCLA 1D8ZA 4KHPF 2FVQA 3SQGB 1RTJB 5DJBA 2ZC3A 3KLGB 2OPQB 3N6LA 2ZD1A 2I5JB 3PIOQ 5HLFA 2OAUA 4ZMMA 3CDAA 2XCAA 3DLLQ 2VQFF 2LCWA 3TVYA 1Q53A 1FJ7A 1SBRA 3SCJE 3SSSA 2CPDA 3JTPA 2BRKA 2YWKA 4B9MA 3CXCR 2XLIA 1UW4A 2FJAB 3KFWX 1UL3A 1QM9A 3QMQA 2KH9A 4N41A 3LP2A 1C0UB 2GA7A 2BBEA 3GE9A 4M1KA 3MXHP 2VFRA 4RU2A 4HEA9 3IWNC 3D0HE 1WG5A 4F26A 4WF9Q 2XWXA 2VKZG 4UW2A 1V3SA 4ETXA 4O3PA 4PRFA 4NYZA 1DTQA 3CJKA 5KFXA 3B8HA 2VFSA 2HS0A 4FS2A 1J5OA 3G8QA 2E29A 4FPRA 4NXNF 2WSEC 2XWYA 1QUPA 3M4XA 3KG4A 2UVRA 1HI8A 2ZDOA 2E9RX 4NA1A 4YR3A 1PO6A 3CIZA 1TKZA 2NREA 2C3PA 2N3OA 1UA0A 1M1KT 2WW8A 2N3LA 1WEXA 1S77D 4YOEA 4YFUA 2ZC4A 4RBUA 4NCAA 4QJVA 4PG6A 4ZP7A 1VQ5S 2EPIA 3DNCA 2HHVA 4QWAA 2HNYA 3MEKA 1FDAA 3DDNA 4Y00A 1UJ6A 2OMOA 2R7TA 2E1CA 1S7HA 1AROP 5E41A 1LWCA 2D7SA 3BM7A 5J2MB 2B9YA 2YNHB 2EFOA 2PN6A 4B9SA 4NYPA 1N4LA 4JV5F 2IYIA 2HFNA 4Y6IA 4X4RA 3VAMA 4ZS6A 3CDWA 1G1XA 3OTEA 3TNVA 3OJSA 3IC1A 2E5LF 3NNCA 1Y5NB 1JXLA 2CQDA 1QAIA 3IWXA 1UWBA 2PI5A 4KV8A 4JI7F 3MMJA 3GIKA 4BWJA 4DOZA 2KJWA 3I56S 1KVIA 1JLAA 1S1VB 4TYBA 2WHOA 3TVZA 4YHHF 3K5PA 5GAEU 2M8DB 1VQOS 5JUMA 3G6YA 1SJQA 1JLCA 4Q43A 3KOAA 2OO4A 3BGUA 1OO0B 1TUVA 4NCGA 3ETOA 3FQKA 5L9NA 2P9EA 5JVGQ 2BZ2A 3FRZA 1D0EA 3CCTA 5KFOA 3E3XA 3GG1A 3I32A 4NLVA 1HYSB 1NK7A 4R8UA 1C1BB 3QIPB 2VQEF 1KQGB 3SXLA 1WHXA 5HO4A 2QSWA 4PWUA 4O4GB 3EZ5A 5IFMA 4CT8A 1FXRA 2YKMA 2RDIA 3DRSB 2PA8D 1WI6A 4ZPCA 3MAHA 2JFDA 2IYGA 5F8HA 4TU7A 2RRNA 1NK5A 4IUFA 4ILMA 5CH7B 1Q4RA 4O3SA 3CE8A 1NK9A 1S76D 3BZQA 4B3RF 4DL3A 1YVFA 1S9GA 3HFKA 3QGHA 4DG1A 3MMAA 3DFEA 4N77A 1JLFA 2JVOA 2DISA 4H4MB 2YKOA 2A2DA 1RT7A 4U6PA 1U6ZA 3M2UA 3NG8A 4OHXA 2WONA 4I2QA 3ZZRA 2LA4A 3R5DA 4IG3B 2VG6B 2DGOA 1XR7A 4WK1A 4ZCMA 2MKHA 4DR6F 2HLTA 4K4TA 1LW0B 1YJNS 2A10A 5EGYA 1RT1B 3KLEA 2W7PA 3LUYA 4HL9A 4RW9B 4CH7A 4XDCA 2MKCA 2B6AA 2JRSA 3GR0A 2R7OA 4XPEA 3I4PA 4Q8FA 1ROFA 2PIIA 2X1GA 3GFZA 4JUZA 2L41A 2HNDA 3OFFA 1NK0A 4ID5B 2R7WA 2J9DE 2EG2A 3M32B 2FGOA 2KM8C 4EBEA 4DFMA 2YNIA 3AHPA 3HKWA 4ICLA 4DL0C 3LF0A 4FVMA 3FVYA 2CG4A 3DDKA 4EO8A 4U7UK 4QU7A 3TRGA 4ECUA 4WXOA 5AXNA 5B0AA 5KFDA 5GAHU 1MU2A 2RT3A 3HHLA 4DFPA 1IR0A 3GFHA 4L72B 5A8WB 3DOKA 3L7PA 3DMJA 3VR1A 2FLNA 4EYHB 3I0SB 1F2GA 3CVKA 2ZUGA 5CYQB 3NBPB 5K8MA 2RQ4A 2YX4A 4KTQA 3ULHA 2ZKUA 1IN0A 2AW0A 3CJ2A 2M4MA 1RK8A 2KO1A 4OJ1A 1F0XA 3MMBB 4ES3A 3OHBA 3TA1A 2CQ3A 2HHPA 4KO0A 1FVQA 1WHVA 2ROGA 3SZ2A 2LDYA 5E0OA 4Y2MA 3J7Z5 5LJ3Y 1N54B 4ZCKA 3MEEB 4X4PA 2CPJA 4IDKB 3Q8PB 5KT2A 1CC7A 2VKRA 3AAWB 1HNVA 3Q8SB 4OI3A 1T05A 3PNIA 2CPXA 1B7FA 4OLPA 1NZAA 3JSBA 2DGSA 3N9UC 4WYWA 2VG5A 2KYZA 1NB7A 3L95X 3LGNA 2QMXA 5DDOC 1QTMA 2DNQA 5KFQA 2RRAA 4KPYA 3I5BA 3F73A 2IA0A 2XI2A 2I9SA 1TR0A 1C1CB 4NZ6A 3F41A 4TLQA 1VLYA 2FUG9 3TR5A 4HTJA 4MK8A 4WKYA 1N6QB 3HJFA 3M2VA 5C24B 5HMZA 4JYAF 2LYVA 4JV1A 2IVMA 4DFKA 1X5OA 2J7UA 4ECYA 1SJFA 1KS2A 3PHEA 4DV0F 2FJDB 1LWEA 1VQKS 4CCHA 2G4BA 2I2YA 2C3OA 4DBQA 3U27A 3DOLA 4WXWA 4Q0BB 3BDEA 3BQ2A 3BF4A 1YJRA 2Q6BA 2ZHBA 3FFIA 5J2QA 2BJDA 3H25A 3IS9A 1K1QA 3CC4S 5KT5A 4WU2A 3MM6A 4J9KA 2XMMA 4E0DA 4GO7X 2GJ2A 2NPIA 4CO5A 5HROA 3BN7A 3LH2S 5IM0B 2MSSA 1VFJA 2RU9A 1T7PA 1OSCA 3MI7X 3PEHA 4RZRA 4Z2X