3BDEA

Crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
QGMIRHTVVFTLKHASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFSMEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of domain of unknown function with a ferredoxin-like fold (NP_106155.1) from Mesorhizobium loti at 1.79 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Unknown function
molecule keywords Mll5499 protein
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdeA00
2XMTA 4A48A 2L3MA 5B09A 2KT2A 3DCAA 5T7LA 3IWXA 1OPZA 1YRXA 2FB0A 1KVJA 2BUNA 2GA7A 3HX9A 1JWWA 1X0PA 1TUVA 1X8DA 2KKHA 4HI2A 2GGPB 3BB5A 5B0FA 2LXFA 1KVIA 4Y2KA 3BF4A 1LQ9A 2XMMA 2LDIA 2FIUA 4HI1A 5A6PA 2W4CA 4Y2MA 4OJ1A 2OMOA 3TOQA 2IYIA 1Q8LA 3QGPA 3BR8A 4Q2MA 3UDCA 4ZA1A 3WDOA 2RSQA 2VH7A 2KT3A 2LQ9A 4HL9A 2RU9A 2K7KA 1V3ZA 1S6UA 1K0VA 2HQIA 2QYCA 1RJJA 2GGPA 2GCFA 2ROEA 2ROGA 3HDSA 5B08A 3FMBA 1IUJA 1Y3KA 2VV5A 1X7VA 2ASYA 1KQKA 3MCSA 1MWYA 1ULRA 1W2IA 1Y3JA 4FNIA 3KNGA 5B0BA 1YJRA 1VQSA 1OQ3A 3KG0A 3MZIA 1N5QA 4YEAA 5F0UA 3CJKA 1OSDA 4NL5A 1FEEA 1WD6A 4DPOA 2OD4A 4YDXA 1N5VA 1YJVA 2OFHX 1SQEA 3F44A 2Q3PA 3LO3A 3VTIA 5B0DA 3QMQA 1OQ6A 2BYCA 2K7JA 2XMVA 2OFGX 2OAUA 5K9FA 4F67A 2QIFA 1URRA 3BGUA 1Q4RA 3K7RA 2K2PA 2JDJA 1JK9B 2LQBA 2KYZA 1Y9OA 2OKQA 2OD6A 2XMKA 2IYGA 2N4CA 5B0GA 1APSA 4Q2LA 5T7LB 4U9RA 4A47A 1GXUA 2ACYA 1FESA 3LGNA 3I9ZA 2HFNA 2OP5A 4HH0A 3DXSX 4NPOA 1AFIA 4EFAC 1CC7A 2BJDA 3TRGA 1TR0A 5A6WA 4DN9A 2IFXA 2QLXA 2AJ1A 1VQYA 1XBWA 1Q8BA 2K1RA 2XMUA 2CRLA 5IXUA 4HH1A 1P8GA 2N4DA 3BDEA 3FRYA 3TNVA 1GXTA 2RMLA 4A46A 1CC8A 2AJ0A 2HFOA 2ROPA 2ZDOA 1FD8A 4DL0C 1FVQA 2XMWA 3HF5A 5B0EA 2PGCA 2W4DA 3HHLB 1YJUA 1TL4A 4QOTA 1FVSA 2GV1A 2HLUA 3HFKA 5KAKA 3GZ7A 1N5SA 5F0WA 5B0CA 2GO8A 4ZOSA 3E8OA 1MWZA 1R6YA 1YG0A 1CPZA 1TZ0A 4OJHA 2QLWA 2N7YA 4Y2IA 2AW0A 1FE0A 3HHLD 2AP6A 1Y0HA 2BJEA 3KKFA 2PD1A 1TL5A 3HHLC 1Q53A 1YJTA 1FE4A 2FHMA 2RILA 1N5TA 2W4PA 1U7LA 2XMJA 1S6OA 3KG1A 3BM7A 2HIQA 3LGMA 3T9NA 1AFJA 1AW0A 4A4JA 1QUPA 4FNHA 2EW9A 5B0AA 2HLTA 1SI9A 3FGVA 3HHLA 3IWLA 4OIXA 2BBEA 4OJ3A 3CJKB 2ZDPA 1P6TA 2G9OA 2GFFA 1SB6A 3BN7A 2FTRA 2K1RB 4OJGA
chains in the Genus database with same CATH superfamily
1TL3B 4FF4A 4X4OA 2KM8B 3RR8A 1S76D 2X7IA 3H8YA 4KGVB 4LMZA 3H5SA 3ZZOA 4KO0A 5KFIA 4B3RF 2NZCA 2V6AA 1UL3A 3MM8A 3OTEA 3TP2A 3TVZA 4ZLPA 3KJVB 1SKUB 1S1VB 3PFOA 1QE1B 1HD1A 2WBMA 2WTFA 4DV1F 2UXDF 4JUZA 1S0NA 2FIUA 2EK6A 2ZOFA 2ZOGA 3IR5B 1Q79A 2IC3A 4B9NA 3JSMB 4LQ9A 3MEEA 1S59A 1GAOA 4C11A 4RW4B 1VQ8S 3EDRB 2HEKA 1VCTA 1IJFB 3WDOA 2VH7A 2RIJA 5IOLA 1NKCA 2LQ9A 2YVSA 2I2YA 5I42B 4RR5A 3G8SA 2HAFA 2DCLA 4NLWA 2HMIB 4NLUA 4PXBA 4CLFA 3HKWA 2VU5A 4KV8B 4ID5B 5HVHA 1C4AA 2ROEA 2ROGA 1FX4A 4Q8EA 4K50A 2UU9F 2RHSB 1JMTA 1RT7B 4DUZF 2D3UA 3IR7B 4DG1B 4RW8B 3K58A 4WFZA 1FK9A 4DV4J 5J2MA 2RRAA 2ASYA 4OYMA 4FNIA 9RUBA 3V6HA 5AJ3J 2RD5C 1QTMA 4MMOA 2KZZA 5F0UA 2J0QD 5SUHA 5LJ3Y 3TJAA 3OFEA 4CNZA 3W1YC 3BR9A 3P49B 1WC1A 2J6UA 1R43A 1R3NA 2IDEA 2OFHX 2IVMA 3GFHA 1SQEA 5LM7E 1KEKA 3QZ7A 1IJEB 3NMRA 1Z2ZA 3MEGB 4NLRA 1S1TA 1S10A 2G0CA 1GFWB 2XMVA 4NI2B 3GB0A 3LANA 2WSEC 4X4NA 3GTYX 3UE2A 2W2PP 2BXJA 1TKTB 1NBEB 2G13A 3AY0A 7FD1A 4Q7AA 3UD5A 2DIVA 4U7CA 4Y3CA 4QWAA 3ISNC 2K2PA 3BBFA 5THWA 1U26A 2UVVA 3O1LA 2E5IA 3CNQP 2YNIA 4M63A 4ECYA 5HATA 3D6HB 3CCMS 4C8OA 2MKIA 2BRLA 3GLJA 4S0MA 1O6XA 4KY3A 1RWNB 4KKOB 5DRKA 3HULA 3EGZA 2CNKB 2XEXA 2ALYB 5HVFA 4LSZB 4QJVA 4WFNQ 5GAHI 4EEYA 5H9EK 2ZH7A 1HNXF 2ZZMA 2NCKL 2D9PA 4I68A 4LF4F 4YY3F 4JI3J 4NZ0A 2J9DA 3OSNA 2JSXA 2XHWA 3THPA 3OHAA 1B64A 1HWJA 1DZ5A 2HFOA 3VQTA 1PGZA 1JB0C 2HURA 5AE1A 1C1BB 2O5DA 3UD3P 1P1TA 2DNPA 3IS9A 3TQEA 1O8BA 4ECWA 5D3GB 3HFKA 1XMQF 3HK2A 4L6V3 3M8QA 1FKPA 2DHXA 2DNYA 2O01C 3M32B 3FCVA 4J5OA 3TZWA 4ED2A 4QZVB 5J2QB 3HVTB 4IDKA 1G6BA 3EM1A 5A8RA 1S0OA 3CMAS 2DH8A 2AP6A 4WPAA 1RLDA 2Q66A 3KJQB 2LCWA 4F7VA 4RNHA 1Z2LA 4B9MA 1YJTA 2B6AB 3MURP 3OFHA 2XQCA 2W4PA 3LGMA 1U7LA 3QIPA 2JL9A 1RTJB 3KLFB 3EXCX 3EX7B 5KFSA 3AH6A 4QW8A 3SV4A 4KFBA 3UD4P 1CLFA 2AHOB 2HLTA 2HRUA 2P2CB 3MMBA 5U47A 1XNRF 4GKJF 3JQJA 3Q2TC 4JP8A 4OFZA 4DMZA 3CSKA 1GEHA 2ZBIA 4CP5A 4ECZA 1H2VZ 3V5RA 2Q6BA 3DXBA 2ZUGA 2NYHA 1Q0NA 1KDNA 1S7IA 3QZ8A 1E6VA 3CJSA 2J6SA 3DLLQ 4PPDA 3L95X 5CYJA 1WHXA 3MTJA 4ZCLA 4I6YA 3P96A 2GA7A 5KT4A 2IPOB 2H5JB 3Q24A 3WHIA 2KKHA 4W92B 5DS7A 2NSBA 1S49A 2I9SA 5BR8J 4KAIA 2YKMB 3SCLE 1UP1A 1RT2A 3BSOA 3SYZA 2HHHF 3VZHA 1TUGB 3UN2A 1LQ9A 3H40A 4WZMA 1IQTA 2DPJA 5F3TA 2ZH9A 4YS2A 2EBEA 1FNOA 3HXMA 1TL3A 3I5CA 1Q8LA 1CJVA 2V8PA 5IFMA 4HT7A 3BH6B 5HSPA 2VONA 1JLFA 2G1DA 2HGMA 4WYLA 1S6UA 2OI2A 4C97A 2G4BA 1K0VA 2HQIA 1QTNB 3UCZP 2ADBA 3DMJA 4C8LA 3IBFB 2DRAA 1C4CA 1VRTB 5DDQC 1HQEA 4A8KA 3FBEA 2VICA 3SIPB 2BJ8A 2V8GA 1NLKL 2E1PA 3I0SA 4BWMA 3PEJA 1CJTA 3QNWB 5KFDA 1R0AA 5EN1A 1YI2S 1JLBA 2QSWA 4RNOA 4USMA 2RH3A 2AX1A 3CJKA 3RBDA 2QX0A 3VGSA 1FEEA 3HPOA 2IJRA 5GVQA 4N76A 4IQMA 4KH1B 2OPQA 1SPBP 2O3DA 4MKBA 3LO3A 4WIIA 4ZPBA 4WFBQ 1D9AA 3RU0A 2VG5B 3PR5B 3J81j 4JI4J 4A8YA 4HHJA 2OPRA 3HHDA 4OLPA 1J5EJ 2LQ8A 2FQQB 3CDEA 2QL5B 1WKKA 4J91A 3OXFA 2IM0A 3NKYA 2D41A 3GIKA 4J9RA 2D3O1 3M2UA 3QRPA 4DDFA 3FCWA 2ZHAA 2BE2B 1BD6A 4K0KJ 2JC1A 4K7QA 4JYAJ 4LFBJ 2I8EA 1VBXA 2CDQA 1NXIA 1HNWJ 1JJHA 4NA2A 4GKKF 2H51B 2M4MA 3SMZA 4E98A 2HZAA 2XCPA 2B4VA 4PWWA 1NJXA 1JLCA 4EFAC 2HQFA 3MEGA 4ZJOA 4R5PB 4BC9A 1S1TB 1U48A 3H98A 4WWSA 3QJPA 1FT8A 4RNNA 2IFXA 3MPDA 2FJAB 3HD1A 4DV0F 3BYRA 1P8GA 2N4DA 3FRYA 3F41A 4ED5A 2HAIA 4WXWA 4A46A 2H5EA 2CJAA 3VR1A 3KHRA 2HHSA 1HARA 1V6HA 4JI5J 3Q86A 2J5AA 3L7PA 4LREA 1NB7A 2DNQA 1FNMA 1I5OB 5GAHU 3HZGA 3T5LA 4Z37A 4AQYJ 2VG5A 2L08A 3DDIA 1PO6A 2OPRB 2V4JB 2EC0A 1T0TV 5J1EA 3GP9A 2W9BB 3MM5A 4YN3B 1I3OB 4NYZA 2G2ZA 3RBEA 4TLRA 2ASDA 4DSKA 1UVIA 1M1KT 2P9GA 1D8YA 3PZPA 3C66A 1S12A 1VLOA 4G1IA 2XLJA 2N7YA 3AQOA 3CJ4A 2MQQA 2V4QA 1ZH5A 2QMXA 3IR6B 3G2XA 3W5XA 4A8SA 4DF8A 2YTCA 2IMOA 4AYBD 1FI4A 2FGOA 4CTAB 3DOMA 3IC1A 4PG5A 1FE4A 4TQRA 3NNCA 3GCWP 4QIGA 1S6OA 1HQUB 3AT1B 3RW7A 3B78A 1UFLA 4QIWD 4AT1B 5K8PA 4YR0A 1GMWD 2B3TB 1VQ6S 4BLGA 4PUOA 2C1EB 2CQCA 1S97A 1U45A 4TU7A 4M5IA 3TUJC 1UEVA 1HPZA 5BYRA 2R7SA 1R8BA 3A3PB 2BW2A 4FDFA 1S77D 2XY7A 4Q8FA 3RRGA 2Z2LA 3DLEA 1RT5B 4NRTA 1EKSA 3MDFA 4ZPAA 5LOQA 2VPYB 3AXMA 4NLDA 2YKQA 4C4WA 4UUWA 1N52B 3IM8A 2XZTB 3GJSB 1T11A 2XZDB 1UAWA 2C2NA 3GFZA 3OR2B 2COLA 3PNIA 2QYGA 3QIPB 4URQU 5LSRA 3LWMA 3PO4A 1Y10A 1OYDA 4N7TA 5L38A 3DM2B 2V5HG 5HBMA 2DR6A 3DU6A 4RUCA 1OIAA 4ZJQA 2MEWA 4HEA9 4H4MA 4I7FA 4RBUA 2XGPA 2OMOA 1VQNS 4G3IA 1XN9A 3G82A 3P5BP 1X4CA 5F9NA 1HHTP 1F1BB 2B56A 3FDSA 4RBTA 3MF5A 1MG7A 1U1MA 3ZZTA 4JI4F 1HNIB 3R5JB 1NEEA 2E9TA 4Q44A 2XSJB 2ZM6F 3CCVS 2CYYA 5IV4A 1D9FA 3IAS9 2EFQA 2ZE2A 3W61A 5LT5A 3LW5C 2XCAA 4IYQA 4QW9A 2Y1JA 2MZ1A 4KQZA 5AXMA 4F4AA 3RYLA 2UVWA 5E41A 4RL1A 3DHXA 2APOA 2NYIA 3KFWX 3VAGA 3BGRA 1HR0J 3FMBA 3KK3B 2UU9J 4C6AA 1YVFA 2GHWA 2VV5A 2DR8A 5AJ3F 2C3MA 3DGVA 3ZC4A 2YKNA 2XO6A 3SI8A 5GMEA 3US5A 3FNNA 1CJKA 2GIQA 2RE1A 3GJRB 4NCBA 5IT9U 4O4RA 4JI7F 2VFTA 1SXLA 2GQCA 3N9UC 3OTDA 3JTOA 4JI0F 4D3GA 5EDWA 1VQ7S 4FYYB 3C3LA 4I67A 3X1LB 5IM0B 5L39A 3NGDA 2PDAA 5A0YA 3CCUS 1H3DA 4O3OA 5B0DA 3O6QA 1H0HB 4HHUA 1U4BA 2DNLA 3I5AA 4ZMMA 1PYOB 1WG1A 1ZAWA 2CNLB 2PMHA 3LPYA 3J7ZT 1NKBA 1R0AB 4F3QA 4U8VA 3ZZ0A 1FKAF 1T03A 1N36F 4O3SA 1F0XA 2KFYA 1DFDA 1Q4RA 4ECRA 1QE1A 2DHHA 2Y0BB 2JDJA 2G2OA 2KYZA 1Y9OA 3U02A 2VFSA 3W64A 2C2EA 1KWMA 2QL9B 4ZN3A 1BUXA 1XNRJ 2IM2A 3A13A 3KWMA 1N6QA 3CD6S 2CZ4A 3IN5A 3M4XA 3R1HA 3NWGA 2FDNA 2C3OA 2R7QA 3M9OB 4EU0A 1RBOB 1ZM4A 2BQRA 2RS8A 3UWTA 2HK3A 3R8YA 1KBRA 2FVRA 4F3MA 3ET6A 3KUHA 2AGQA 2K1RA 3TUPA 2CRLA 4QYZJ 2EWHA 2GAGC 2GHPA 2HMIA 4F4KA 1FJ7A 2RMLA 3BQ0A 2QA4S 4ID5A 3WZ0A 2ZUAA 1FVQA 4C8ZA 4DPWA 4ZHRB 5B0EA 2PGCA 4PZVA 4JI7J 2N82B 3OL7A 2XSFA 4CT8A 1VC0A 4JI1J 1SUQB 1U09A 3OJSA 1S4EA 4GO5X 3BQ1A 2YWEA 3JQKA 3VF0B 2YH1A 3KMQA 2W7PA 1U2CA 2VUGA 1R6YA 3E8OA 1JLCB 5I4MA 3JYTB 2H54B 4OX8A 1CULA 3DU5A 4DSJA 4MYUA 1T03B 4AL5A 4ZDNA 4O3QA 5AE2A 3BSCA 3K0JA 3WQPA 4EO6A 5JUMA 2RILA 3PFEA 5HQMA 3IWNC 3EGNA 5D8HB 2OEKA 4WFYA 2C2DA 4ZVUB 1HNZF 4MKYA 4ATNA 1JXLA 2QA1A 5CAAA 2QRRA 3C16B 3V6DB 2V8DA 2D1CA 5M2RA 4C2MA 1VI7A 3MM5B 2K1RB 3CJRA 2VA3A 5J2NB 2HHTA 5IWAJ 4U67Q 1HNXJ 4RKUC 3MMJA 1IN0A 1C1CB 2JNJA 1GXLA 1KFDA 1WC3A 2DXFA 2WB4A 4LF8F 2L9WA 2HNDB 3UR0A 4C9DA 3ZFVA 2P8IA 3QFWA 4EK2A 1N5YA 3O3LA 1N4LA 5F8HA 2VQEJ 1L3VA 3C15B 2HWTA 1R89A 3V6JA 1AB8A 3GIRA 4LBIA 4B02A 5D6GA 4PABA 1SQFA 3D9BA 1UJ6A 4WTOB 1B70B 3CIZA 3I55S 4KRWA 1QSLA 2CIMA 1KLNA 2V9WA 4PUOB 1RT1A 1HWUA 3AFGA 4OYOA 2LQJA 1RCOB 1OPIA 2WB1D 3PYDA 1SJ3P 1FWPA 4K5SA 4ECXA 3IS9B 2OEJA 1KS2A 3OD2A 1AZSA 5DG7A 3UI3A 2ADCA 1VQ9S 3V4MA 3I82A 1UVMA 2UXDJ 1ZBTA 5KG4A 3S1TA 2IVFB 3W9IA 4ILLA 1VQ4S 5KFGA 1VDHA 2W9CA 1OJ4A 3IXQA 2RU3A 3OVAA 3D0HE 4LF7J 4TN2A 4KHPJ 3OR2A 1KTQA 2RDJA 1I94J 4YFUA 1Q7YT 1DAXA 3HDSA 3L09A 2QEXS 2HG4A 2YBVA 1DY3A 2GC8A 4PYDA 3PY8A 2H48B 1C1CA 2B6AA 5D78A 4PG8A 1H6KX 1VRUB 3MD3A 2JVRA 4DPTA 1YHQS 2HK2A 3UDEA 5EWFA 4NXNF 4IH6A 5IWAF 3A8JA 3FBCA 4X66J 1T05B 1OWXA 2VDIA 3LF0A 2CPDA 2XY6A 2HPUA 4G65A 1NDPA 3QO9B 4AQYF 1S72S 4DI6A 4HVZA 2ACMA 4ZVPB 3Q0AA 3DC2A 2HNZA 1U0HA 1WG4A 3ONQA 1XJWB 3VTIA 3ILOA 4X62F 3VQSA 4AL6A 4DL7A 3HO1A 2R7XA 2IY5B 2DVIA 3AD9C 3SFUA 3BZQA 4UY8T 5GMDA 3EZOA 3R2DJ 2HVZA 2A2DA 4DQPA 5DQGA 1BXNA 1TV6B 2CPEA 4F67A 5ETKA 4JI6F 1KRPA 2YWKA 1C0TB 3DLKA 2PA8D 4WE1B 3SSSA 4DUYJ 3CD7A 1WC4A 4X4SA 3KLGA 1KHVA 1Q82T 1KSPA 3LOUA 2LQBA 4F36A 2M52A 3EPIA 2OD6A 2XMKA 4H54A 3TW0A 4Q2LA 5K14B 5KFBA 2YWFA 2GIRA 1CBKA 2WHOA 3ETMA 4P9SA 3I9ZA 2WVCA 2CNOB 5EX3A 2M88A 2GQ2A 2OP5A 4XPEA 4ZCMA 2BOPA 1BQMA 5LL6d 3KDOA 5A0YB 1QAYA 4MKAA 1VRUA 1BQXA 1HLWA 4CYUB 2DD8S 2UUWA 1UTAA 4ILMA 3T5JA 1UW9A 3DRYA 4KGXB 2UVUA 2EKNA 3OFGA 3VGTA 4U6PA 1TFYA 3PV8A 1U2FA 5RUBA 2MKKA 1BC6A 1UEUA 2W4DA 4K8RA 1E6YA 2DNMA 3CPWR 2QFJA 3DN9A 3I0SB 5I3UB 2IM3A 4TXSA 3SQGA 1PBAA 2QLJB 5KAKA 1RT3A 1UETA 1O5JA 2DIUA 2MYFA 4ZLLA 5IQ6A 5L1JA 4B3TJ 2DHSA 3BJYA 4IR1A 2CPIA 5D4NA 3ZZZA 2VG6B 2F4FA 4FKXA 1XR5A 2KJVA 2WVBA 4ED1A 4DS5A 2V34A 2GO9A 4GKJJ 1IKXB 2I1RA 1GMUA 5F8JA 3DLBA 3GONA 1WORA 1WI6A 2BJ7A 2DRDA 3VAIA 4J37A 1S4FA 2PD1A 4OYWA 1RTHA 1TL5A 1M5VC 3PR4A 3GYXB 4IG0B 3ZO7A 1N5TA 4LQ3A 4ZHRA 1RP5A 1RT4A 1PYTA 1SI9A 1J2VA 1JJ2R 5ETNA 5DM7Q 3MCNA 4WF9Q 1P6TA 5B7WA 1N88A 1X5PA 2L48A 2RQ4A 3M8PA 4OYAA 2PFFB 3LWLA 3PYEA 3AOBA 2NPFA 4DLGA 1QVGR 4ZPVR 4RUAA 4JI8J 2ZWPA 1XMQJ 2AZ3A 2MKCA 1YRXA 4WJBA 1SH0A 2WOMA 3DLGB 3A3NB 5KFJA 3VAJA 3K5MA 3W65A 2YQ3A 3HX9A 2Y1LB 5I3UA 4B3SF 1HBOA 3BBBA 3DRSB 4WP8A 1YRTA 1EP4A 3W2VB 1H2UX 1NJZA 3KHLA 1KVIA 4YUDA 1NK8A 3PX0A 1MWQA 1PCAA 2VG6A 3P45B 4IG3B 1UVJA 4WYWA 3R7NB 2CJ9A 3HSZA 2HKEA 3KG4A 3N4WA 3O2IA 2U1AA 1H98A 2V68A 3EXYA 3T6BA 5HMZA 4ETXA 2IM1A 1VYAA 4I2QA 5F8IA 1QD1A 3EMTA 1DHMA 2Z57B 1Q5YA 5J1EB 2AX0A 4X64F 4RNMA 5D0RA 4ZCIA 4Q0BB 1Y7PA 3A3OB 1BLUA 1RT7A 2C2KB 5FDLB 3Q89A 5EGYA 5LMNJ 5CCLA 1R0CB 5CD4H 3V81A 3TA2A 1D9DA 4C8KA 3QJJA 4JV2A 1ZAVA 2MQLA 1HBNB 3M8PB 3CC2S 3SFGA 2WW4A 3BS9A 1VBZA 4F2SA 3SZ2A 2K3IA 2LFVA 3AD8C 3SEOA 4LVOP 4DFPA 1KN6A 2VIHA 3IG1B 1TKZB 3H4BA 2KRRA 2NUUG 1NH8A 3W62A 2BQ3A 1J5EF 2W25A 2XTJP 2MSSA 4L73A 5B0BA 1NO8A 4F02A 1TU0B 3ULHA 1D8ZA 2ZOMA 2HHPA 4USHA 2CQ0A 3PRDA 3ZTPA 4TQSA 4J9SA 4N41A 4FPIA 1AZSB 1EP4B 2AGPA 3AB4B 2J7WA 4KYZA 3OVSA 2UP1A 3ISND 4XTTA 3Q8QB 3TZYA 3F44A 4O4GB 4DR5J 1IWGA 3MEKA 3OR1A 1M1GA 3BGLA 4RW6B 4EO8A 4ED6A 2M8DB 3QMQA 1OQ6A 1WF0A 3C19A 2XLKA 2OAUA 1SJRA 4Z7CA 1VJWA 4ZN1A 1UKUA 1ZA1B 2KG1A 3TARA 4F4ZA 3KNAA 2HFZA 4F50A 3RB6A 4LFCF 3DNCA 4PR6A 2IJFA 4OI2A 1HHSA 1T05A 2W01A 2F9JA 1U1PA 3A12A 1RDRA 2N4CA 3W3SA 4DCOB 1RHKB 2OPSB 3BEGB 4A47A 2ACYA 5ETMA 1C2PA 1HBNA 3WIUA 2AJQA 3TAPA 1AFIA 2XHCA 2VKZG 4JI6J 3JB9k 3TO8A 3MMCA 3HD2A 4IQXA 4ANEA 4RPFA 1HIYA 1Q7LB 1TP7A 1FRKA 1JJCB 1TUWA 1Q8BA 1VQYA 2ZE2B 2X1BA 4QWDA 1TMJA 3BDEA 2ZJRQ 2NS1B 4GC6A 1ZZNA 1CS4A 1SC3B 1CC8A 2AYBA 3VAMA 3DLKB 1GTEA 4QYRA 5AXKA 4DL0C 3JXOA 4EMDA 1I1GA 2X51A 1LWEA 4DV5J 2H4YB 2XWXA 4PYAA 1UVLA 3JAMU 1PC5A 2GVZB 5C24B 1FVSA 1WUUA 4ZLNA 4IO9Q 2DITA 4P6QA 3LP1A 4JV1A 2ZNZA 5J1PA 4K4SA 2XWYA 3POTA 3CJTA 4B9UA 1BQNA 1FEHA 2MPUA 3MWBA 4UZCA 1U6FA 3TAMA 1PYSB 4Y00A 3IRWP 4DV7J 1YDLA 4LFBF 4CYUA 4L72B 1DTQA 5A8WB 3NGUA 2J76E 4DZDA 1FXRA 2VG7A 2FGCA 1V5VA 3ICLA 2OMLA 1Y4ZB 2LVWA 4EI2A 3BKUA 5GAGU 1YRUA 4KGMA 3K59A 5LSOA 3KK2A 4IRCA 2N3OA 3A8IA 2BA9A 1B0TA 2IVYA 2B4PA 3AAWB 4K4WA 3ILJA 1F5AA 2KJWA 3M2VB 3O5TB 1HD0A 5LMUF 4ZVSB 3T1HF 3NGSA 1HBMA 3D5MA 1YZ6A 3FUYA 3LTOA 3BN7A 2FLOA 2E5JA 3B6BA 3Q8UA 3UDVA 3JSMA 5F8MA 4ECVA 1NK5A 3LUYA 4FVCA 1CS4B 4LF4J 1XMOF 1N6QB 3C8YA 1A7GE 1Q1KA 5GAEI 1UW4A 2GVDA 4OHVA 4AFFA 3PJWA 4WTYA 3ZZUA 4DXLA 1Q8KA 3QT7A 1X8DA 3MCOA 6FDRA 1YBAA 2B9EA 4LR8A 2XG8A 1HL6A 2ZHOA 1HW9A 4Y2AA 2UUAF 1SV5A 1S48A 1CJVB 4HI1A 1DARA 1XNQF 2DISA 2LEPA 1URNA 1PSDA 4ELUA 3EWGA 1F2GA 3QGPA 4Y0FA 3E01B 1HWLA 3UDCA 4OI6A 1VR6A 3I4HX 2VPWB 2WSCC 5CA5A 4R25A 4I56A 2FC9A 4ELVA 1YWXA 3I0RA 1RTIB 2D69A 3LP0A 3EUNA 1CJTB 1H7XA 2HGLA 4ZCKA 3UR3C 3V2UC 2PC6A 1JLBB 1R31A 1WKJA 4MH8A 2E1RA 2MGZA 4QU6A 2O67A 5BYQA 1OMSA 2AWZA 4FYVB 3D1HA 5L46A 4B3SJ 1OY9A 1GQEA 3P3DA 5HJXA 3CDAA 1W2IA 4L76A 4F25A 5KT3A 3FSXA 2ZH6A 1HWIA 1RWMB 2LU1A 2V8HA 2YNGA 3FEXB 3KG0A 3KUEA 4GVBB 4YEAA 3J7YU 2ZHBA 1VQKS 1FRMA 1S1UA 2YQ1A 4F4WA 2OJ3A 1CQMA 2RRBA 5CQGA 5FDLA 4OX6A 2G2YA 3M2UB 3AA8A 2F65A 2P6SA 2BE2A 3H20A 1B4SA 1JLQB 1WOPA 3EGWB 1NSKL 1SVDA 3MPVA 3HT0A 1RAHB 2I38A 4ANCA 3OLAA 1W2BR 2CQ4A 4ITSA 4UOHA 1X4GA 4CT9A 4R5PA 3T5HA 3CULA 5KFAA 4KPYA 5KG3A 4QWCA 4ZPCA 2NQPA 1FKPB 2FPHX 3M32A 2W2OP 1FDDA 4DV5F 5KFVA 4P7TA 4ED3A 2HVEA 4RW6A 2POKA 2H4WB 3CDUA 1XMBA 3BBCA 1RCXB 2W2NP 3MI7X 4P2FA 4USVA 1FX2A 6FD1A 4RNFA 1H7WA 4G1QA 4Y34A 1U1NA 1RT6B 2CWXA 1FD8A 1RTJA 2GS8A 2ZDOA 3FCHA 5E33A 2RB7A 3CEDA 2IBOA 2RT3A 2W1BA 4RBVA 1ZA2B 2W9BA 2HQDA 4B17A 1TKDA 2EBGA 3J7A1 1RAJA 2GW8A 2E7WA 4FS1A 5ITHA 1F2HA 1S9FA 4ZVRB 3OTCA 2Z2ZA 4NLXA 3TVYA 4BCAA 1GK8A 3HSGA 3CDWA 3M6UA 3THVA 2R8IA 3MHYA 2HZVA 2UUBF 1TZ0A 1KKHA 2LP4A 5KFRA 3UVJA 4R8UB 4RJVA 2WONA 5KFKA 3HHLD 3U1LA 3OV7A 1AUDA 1Y0HA 5ETLA 2R8JA 4F3OA 1TTHB 2DEJA 3A4TA 3U7JA 5L1KA 3E51A 1UWBA 2QTWA 3TA0A 5BXIA 1LFWA 4P73A 5I3QA 3CO9A 2LA4A 5T14A 3PCOB 3IWLA 3M8YA 3C46A 2FLLA 1MNEA 3PJXA 2RDDA 4CM2A 1VFJA 2V67A 2JEFA 1C0TA 2G9OA 2WCXA 2V2KA 4DBQA 2QJ3A 2DH9A 3EJMA 2MJNA 3B4MA 4DX7A 3NS6A 5B09A 1H38A 4O44B 4FVMA 4DX5A 4TKTA 1MN9A 2ZWOA 3H25A 2VG7B 4TYAA 3P6YC 3T1HJ 2JH3A 2Z0GA 4LF2A 2F3JA 4V19X 1OY8A 1VC6A 1JWWA 1Z1ZA 2R2SA 3BB5A 2NREA 2BOAA 2E66A 1B7YB 3L3CA 3PACA 4DS4A 1IBCB 2YNHA 1WF1A 3CCES 2VFRA 2RUGA 1XQIA 4QQBA 4BHQA 1OY6A 1NHUA 3G6VA 5HLFB 2W4CA 1L3UA 1JKHA 2CQBA 2FUG9 3I96A 4OJ1A 4CWBA 4XIUA 1UWAA 1SKSA 4IUFA 5H9FJ 4N56A 2MQPA 1VBKA 3ZTRA 1R6VA 2DB1A 2EFOA 2WVFA 3ILLA 2VQFJ 3KLVA 3V4IB 3MXHP 2PI5A 2KRBA 3MM7B 2GGPA 1R8AA 2J7UA 3GFXA 1S6PB 4UTGA 5CYMB 4WKYA 5M2UA 3TZXA 3BO3A 4DQQA 3AJ2A 2KT5A 2CAJA 2VPXB 3OL6A 2E29A 3A8KA 5HK4A 3D68A 4C98A 4KV8A 2R2TA 4DUZJ 1IBLJ 1KQKA 4WBFA 2XYHB 1GX5A 2AJ2A 4OI4A 4I64A 1PC4A 3TJ9A 1N32F 2MKSA 2HVHA 3F0NA 2AT1B 3JQMA 1MMDA 1N48A 1KQFB 2QGFB 3MAHA 2HVDA 4ECTA 2A6OA 1K8AT 1SJ1A 2LXUA 4YB7A 4OI0A 5G4DA 3QRRA 1X4HA 2OH2A 3KJFB 1REVA 4LF5J 1SIWB 4TNOA 2ZKUA 1FFWB 4CH1A 4EBEA 2KFZA 4WKRA 2F63A 2C22A 3M2RA 2AU0A 2M9KA 5IC6B 3W2VA 5CZVA 1CVJA 1XEZA 3NY0A 5E7OB 5DLGA 1LFPA 2XNQA 2ZVSA 4IG3A 4CRJA 4F4XA 1SKRA 3DYAB 4U7UD 4EBDA 5T7LB 3VV2B 1EX8A 5CYQB 3NBPB 4YHHF 4DSIA 2JJ4D 5J2PB 4UUXA 2ATCB 1W26A 2R2UA 4UY85 1HHQA 4O3NA 3TEHB 1BE4A 2GJFA 4NLVA 3S7RA 4ZIWA 3EVWA 5FIIA 1QDUB 1TR0A 3TRGA 1KVKA 2NXNA 2X3DA 2FVQA 2JHEA 4LFAJ 1SJQA 2CVEA 4O3PA 1WELA 4HH1A 3D6MB 5EUHA 3V81B 2BE7D 2WAQD 3THTA 3AODA 3K2YA 4JOUA 4PXEA 4ZPDA 3VAFA 2UUTA 2QN6B 1RU1A 3R97A 1TAQA 4IOCQ 2XYPB 3HF5A 3ZZYA 1G1XA 4X4UA 2D9OA 2EVZA 3VALA 1IR0A 3L4BC 4DQRA 3PW7A 2J0WA 3JSRA 2R9LA 4DUTA 3GZ7A 4YMEA 2OGUA 4P75A 5E5NA 2WW8A 3C6UB 3D3BJ 2LEBA 1VQOS 4MK8A 1SL1A 3IM9A 3PEHA 4DN0A 2CJQA 4V19J 2QLWA 1NJYA 3SSQA 3ELHA 2AZ1A 2VD3A 3GG1A 5C25A 4DR4F 4O4GA 4CZCA 2IA0A 3HHLC 1VQPS 3LGHA 1PBUA 3VWSA 1RYRA 1Q86T 3NBPA 1C0UB 2CWKA 4X4TA 4MIAA 2IBKA 4KKOA 2QMWA 1QUPA 2CNNB 3B54A 3DM2A 3OT9A 4WP9A 5ETPA 3DRPB 4CLTA 1FJEB 1VBYA 2DHAA 1X5OA 1X5TA 1N0UA 2J8AA 3H2VE 4QR2A 3KLFA 4PQUB 2HNDA 1SB6A 3CCWA 1T3NA 2VDHA 2RS2A 4KFBB 3NS7B 3PRVA 5D4LA 3PIPQ 5KFEA 1G2EA 1GNKA 5IT9Y 2OPSA 1DURA 2NUHA 4UT4A 1XERA 5D4PA 5DETA 2L41A 3SV3A 2HS3A 3QPIA 5F41A 4YQWA 1CG2A 1VK3A 1TFWA 5G0RB 4CO1A 2WVDA 1RABB 3D7SB 3CO0P 2DNRA 4WP3A 2HBQB 1WTFA 3HKZD 5B0FA 3AJDA 2KDOA 3BF4A 1D09B 4IH7A 4NZ7A 3UNYA 3CB4A 4HR2A 2LDIA 4FBTA 3Q2SC 3HZEA 3QQCD 1SJFA 2F5GA 1BY9A 2NPIA 3QGIA 5A6PA 3CJQA 2P5VA 3K17A 2HHXA 2RKIA 1VHFA 2JEJA 2ZZNA 4RW7B 4K0KF 3QT5A 5C24A 2GAHC 2C42A 1CSJA 3LAMA 4MKVA 1HNWF 2U2FA 3TUZC 4NX9A 1HWKA 1S6QB 3QGGA 1V3ZA 5CHCB 1RK8A 2EC2A 2I5JA 4URSA 1JNZB 4CQ1A 2KG0A 4DL4A 2NZ4A 1F5BA 1VS3A 4OYPA 2YKAA 4USUA 1EHWA 3KLEB 1QAJA 2MTLA 4IRDA 5HANA 4YP3A 5F8GA 2AEJA 4DL5A 5HLFA 4ECUA 4Z2XA 2G0JA 4JI2F 1EARA 2M5YA 5GAEU 1U8SA 4W90B 3KNGA 1TKXB 3D0IE 5CD4A 1R8PA 4DQIA 2B51A 3G4SS 4LVNP 3MR3A 3RTVA 1UMJA 1TMMA 1MMNA 4QBUA 5EWEA 2FYXA 4O3RA 1RACB 2ZEJA 1VGYA 2DXDA 5K8NA 3PW5A 2Q3PA 3BKTA 1FXDA 1TV6A 5DGAA 4KHRA 2DR9A 1EQMA 5CYMA 3W9JA 2DGXA 2MXYA 2HVIA 2RKIB 2GVDB 2OFGX 1D1UA 1KNZA 2Y8WA 5GAGI 2ERRA 2KXFA 1MU2B 2LEAA 1FJGJ 1BHNA 4ID8A 1T94A 3J80U 1ZTTA 1UZDA 3LALA 1JLFB 1M5HA 3MMAB 1FXLA 1F3VA 2AEMA 4JV5J 1FRLA 1UVKA 3NCPA 2DNKA 5D0GA 4Z7YA 1APSA 4TLQA 1GXUA 1FESA 1T9TA 3J7Z5 4KO0B 2MLZA 2L9NA 3VCDA 1G4CA 3DXSX 4X4VA 3M05A 4C0HA 2MQOA 2VL1A 3D54A 4DR6J 1LWFA 5D4OA 1RKJA 1GTHA 3QATA 2B0GA 2BR0A 4DN9A 5KFMA 3J7AN 1EETB 3W2WA 1S1WA 3FC9A 3FFIA 5IXUA 4N5SA 2UXCF 1YJWS 4ZS6A 3MGJA 1ZYQA 2R3VA 3G86A 2CG4A 1IKVA 1H74A 4H4KA 3N79A 2DBBA 2HSEB 4P72A 3W5YA 2ILYA 3MEEB 2F4VJ 3ETOA 2YKPA 2V8VA 4RW4A 3CMES 1TL4A 3DYAA 2A0FB 1RHRB 4LR7A 4C3MA 2IA6A 4J9NA 1U1OA 2QV6A 1WHYA 4O0NA 4EZ9A 1CPZA 1SC6A 1YG0A 2VQEF 3RAMA 2KM8C 1M5PC 2F4VF 5DDPC 4X2BA 2M2BA 2ZH3A 3R9LA 4ZITA 2DPIA 2ASLA 3K5PA 4KB7A 2SXLA 3JSYA 1FDBA 1CJUB 3R5DA 4RW8A 5FLXY 1KOOA 4PCQA 2FZCB 4P52A 4EGLA 1RADB 4DEZA 5HMXA 4OZ3A 4A4JA 4FNHA 2JZ5A 4DU7A 1JLQA 2CDRB 1FF2A 1ROFA 1S57A 2IAJA 2UV8A 4OIXA 3SDEA 2XY5A 4B9LA 3NMAA 4K4ZA 1UVNA 5DDOC 2GFFA 4F8RA 3W2WB 1N34F 4NXMJ 2DEIA 2BKOA 1N0VC 1EJ7L 3GR0A 5F8LA 1OS5A 3KK1A 2VBWA 3F73A 2EG2A 5HL7Q 3FQLA 4LJMA 4QIEA 4LIRA 2IHR1 1HNZJ 4K2JA 2J8SA 3SCKE 1HW8A 2CQ3A 3GWCA 2Y9HA 4DR5F 3KDNA 5HI7A 4BBYA 1L3KA 1CQNA 1N32J 4Y2KA 3M30B 1HMVB 2NXCA 2JFDA 4Y65A 5FD1A 1XMOJ 4QWBA 4IOBA 4OHXA 3TOQA 1R8CA 1JXEA 4P7VA 1NNDA 1NZAA 3T1AA 4CTAA 3MUVP 4AXIA 5C2GA 1RAGB 1RWPB 4RWXA 4OLOA 4AE5A 3Q23A 4ED8A 1VC5A 3CCTA 3GFYA 4NYOA 4ER8A 5LMNF 1X9SA 2VKRA 1YX2A 4BC7A 3LH2S 5AT1B 3TQ1A 2BV3A 1FCAA 1C1BA 4NLYA 2MQ8A 3ZTSA 3RB4A 1HBUB 3OSPA 3QIDA 2Z2YB 2UUCF 3MCSA 4WE1A 1PAUB 1Y3JA 2E7VA 2B43A 2FVPA 4FXDA 1S1XB 2C2OB 4M5GA 4RW7A 1WHVA 3W9HA 3OR1B 2XNRA 2HWIA 2YX7A 2J0SD 3FBBA 4NL5A 3MFIA 2MY8A 3AD7C 5KT7A 2OUGA 1WC0A 1T3OA 2NSCA 3R7BB 4K5RA 3CD0A 4G6VB 2YNFA 1YJVA 2Y3YA 4L3NA 3QGHA 2CZVC 5IC4B 4U96A 3N5FA 4LF9F 4ED7A 4LF5F 5LXYA 3D6FB 3G87A 4H4MB 1KP6A 2BYCA 3BGOP 3DRRA 3QAUA 4I7FB 4CLYA 3RAQA 5IM0A 5DG8A 4QPTA 3MMBB 2MY7A 5K9FA 3T9ZA 2AJFE 3I4PA 2RQMA 3DRXA 2H1YA 2E7XA 1VQLS 1X5SA 4PG6A 2RHQB 4BS2A 1PJ6A 2LDYA 3CC7S 1WKLA 1UEKA 4B9VA 4IOAQ 5EX0A 1KLMA 1Q8IA 2LU2A 3D1QA 3OHBA 2W9AA 4M5LA 1Y11A 2IC3B 4CCHA 3NG8A 4GO7X 5HP1A 3DOKB 3QYYA 4M5DA 4X65J 1KHWA 3WX8A 2AKWB 2MLYA 3IA0A 5K20B 3HP6A 4RO0A 3CCJS 1WEYA 4NRUA 4DFMA 2YKMA 2YKNB 4DR1F 1LWEB 3NGRA 1XBWA 3B82A 4B3TF 1S1XA 3SQOP 1BMQB 3V4IA 3ADAC 2KL8A 2RRNA 2C3PA 4MTPA 3EZ5A 5IT4A 4USJC 4DL2A 1S6PA 1ACMB 2HFSA 2PMWA 3CXCR 2F8MA 3LAKA 3MM6A 4NLSA 4OV6A 1QY7A 2GV1A 1HQ2A 3NEKA 1SBRA 2M8HA 3BV8A 3ZZRA 4B3RJ 1WJ9A 2XZWA 4OZ0A 2MHEA 3L9ZA 4ZOSA 4JB8B 2JX2A 1Y00A 2OSQA 1RAOA 4C0BA 5KFZA 1UJ5A 4OJHA 3T19A 3DLGA 2DR7A 2GIFA 1RTZA 4ECQA 2HBZB 1KLMB 4C48A 1N33J 1FRIA 2PN6A 2JFKA 3D2WA 4LIWA 2UUAJ 1X9WA 1FNXH 4USTA 3SCIE 3KHHA 4NI2A 2ZC3A 1NK6A 3W60A 1J27A 2VASA 2BABA 2CPHA 2MJUA 3K89A 4PXCA 2BBEA 3CJKB 5JXSA 3T1YJ 3DFEA 4PAAA 5HN0A 3W7BA 2FZKB 2X1GA 5HVGA 1QAIA 3ZTQA 2C2ZB 4A48A 4NASA 5ETQA 5T7LA 4N8NA 1M1HA 2IRUA 2QLFB 1WTBA 2CQHA 1KVJA 3MPWA 4QWEA 2HIYA 4K59A 2CKWA 2CPJA 3GSIA 3IP0A 3GIJA 3D0GE 2EEYA 3G8QA 3MR7A 2MZRA 4LF1A 4NXMF 2G1HA 4UF4A 4QR0A 4C8MA 2A1BA 2FHOB 3SDEB 3X3UA 5ADZA 3JYTA 3BO2A 2HFUA 3C15A 3HMJG 1P1LA 4Y2MA 4XO0A 2QZ8A 2YPZA 3O8WA 4LSNB 3I5BA 4RLEA 4HHHA 1DTTA 2M7SA 4DV7F 1G3OA 1LWCB 1NZ8A 3BR8A 3CJ0A 3ITHB 4QIFA 4ZA1A 1SQGA 5C2CA 4ZK7M 2H65B 3H0PA 3P4UB 6AT1B 4YB5A 4F4YA 3QSYB 4PWDA 4NMXA 4J9LA 1HKAA 4IDKB 2VOOA 2QYCA 2A18A 3C16A 4DL6A 3CCSS 3R5BA 1YIJS 2G0IA 3HFVA 3IMQJ 2OO4A 2YNGB 2XB2D 4B3OB 4ED0A 4WXOA 3MM9B 1MWYA 3SSRA 2E5GA 1V9OA 4KPCA 2BANB 1S9EB 2EI5A 3JAMY 3C6TB 4DV2F 2KXHA 3HHNB 4YB6A 5K8MA 1OSDA 3BREA 3CTRA 3FEYB 4FXWA 4PG4A 3UQSA 2Q6CA 2VPZB 1B7FA 1PILA 4CH7A 1F9HA 2XYGB 2DYAA 4CM0A 4C3KA 5DDRC 2AYMA 3OFFA 3CUNA 3DOMB 2XS5A 4IR9A 1U8WA 3GIMA 4L75A 3M6VA 1RWXB 2KO1A 2XI2A 3L7OA 4WU3A 3ENWA 4LSNA 1QSYA 1DTTB 3MEDA 1VQ5S 2V2QA 3ITHA 4LRAA 4JI0J 8ATCB 3IGVA 1WHWA 1URRA 1FRJA 4LF9J 4ZVHA 3TJ8A 3TAQA 1X4FA 5A2QY 5KFNA 3GIIA 2W9CB 4U9RA 1DQ8A 1RWUA 2GX8A 4G1PA 3LP1B 2EFGA 4PXDA 5D15A 1ZPVA 4ZP6A 5KG5A 3OUYA 3DLEB 4X4QA 2ILZA 1LK7A 4JV0A 3KLGB 4OX7A 5IQQA 4YB1P 1U47A 4DZ6A 1FTCA 1SJ4P 4XAKA 3Q8RB 4J9MA 4B3OA 1NPPA 1FFGB 4JBCA 3G8TA 2V63A 4N8OA 5A6WA 2QLXA 3RJMB 1RYSA 1HYSB 2BE9B 4IFVA 4FS2A 2AGOA 2KFNA 1AROP 2CQ1A 5D3GA 2UZAA 4R0EA 4NLTA 5HBMB 1U49A 2JEGA 2F9DA 1WDDA 3NP5A 2IRXA 1XR7A 3PYGA 3QO9A 4HYKA 4A8WA 3PX4A 4OX9J 3GJQB 3HHKA 3G82B 1X9MA 4ERDA 2H5IB 3GYGA 3CDBA 4MIWA 3OL9A 3ISZA 1X31C 4J9VA 2VFUA 2WONB 4IO1A 1TL7A 4RWWA 3M8SA 5HP1B 1PJ5A 1TKXA 4KR0B 5C7PA 2KI2A 2X1FA 5DO2A 5T41A 2I6WA 2BDPA 3CVKA 3NAIA 2B4UA 2AW0A 3CWJA 4FXVA 4X64J 1F5CA 3CJ5A 2KU7A 3TZZA 2IMWP 4NEYA 4DUYF 2FHMA 4J90A 4F04B 2YWGA 2BEFA 3BM7A 3HJVA 2YWWA 3K8WA 3NGKA 5AXNA 3TANA 4F0HA 5B0AA 3DHWC 2ZFHA 1UFKA 1ZZFA 1DLOA 1TK8A 1TQLA 1VIXA 2OLWA 3PHEA 4NLQA 1IQZA 3ENVA 3OTBA 4WZQA 3MR5A 1OYEA 3HSDA 1B99A 2CQPA 3IRXA 4OJGA 3RGIA 1RWWB 4CI0B 3EYZA 3PW4A 2UXBJ 3KJVA 5J2MB 1NUEA 2J9EA 3IWXA 4UZBA 1HI1A 3MPUB 3BYPA 1B0PA 3PYFA 3OW2R 4YOEA 2CVIA 1WSRA 1X0PA 3HLUA 1VHIA 4XDCA 2XM3A 4QR1A 3M9NB 4M5MA 4MJKA 1CEZA 2JLEA 1XC9A 2R7OA 3I31A 1RISA 4IH5A 2DNZA 4ICLA 3UO0A 4ZVOB 3RRHA 2OIHA 3I56S 3UDLA 3HVAA 3GV5B 4NA3A 3J81Y 1P9QC 1SL0A 2NXUA 4WK3A 1JX4A 2M0GB 3C2PA 3NNAA 2W7AA 4NYPA 2RU9A 2JEIA 4ZVFA 4I2PA 1GMVA 5KFFA 3G96A 4AUKA 1FK9B 3PKMA 3CJ2A 4ENOA 3GMGA 1YITS 1HI8A 5HAOA 2K8GA 1NMEB 4KTQA 4FF1A 5MLCV 3R1LA 3PW2A 4GKKJ 2C28A 4NLPA 3AB2B 2QE5A 1T7PA 2DR5A 4V1Ak 1NH7A 1YJRA 3MPYA 1OQ3A 1RZMA 1B0VA 3NOCA 2JLGA 2WRMA 1PIEA 2F8HA 1SL2A 1ICEB 2GMLA 1REVB 2ZBPA 5F9LA 4M8LA 2AD9A 2LQ5A 1ITPA 2A6MA 2ALZA 4QCLA 1U6ZA 2MLXA 4M1KA 3ENQA 1TKTA 2Z8QA 4OX9F 3EVMA 3M8QB 1K73T 3M8ZA 2V9KA 2VJUA 4I2QB 2HRYA 4ZVTB 3U27A 2CZ9A 2QIFA 3FSYA 2HS0A 5D77A 4KJIA 2F7VA 3H5YA 2AYGA 3CIMA 2RQCA 3K5NA 1PJ7A 1JK9B 1ZAXA 4RW9B 4CLUA 2CPYA 4DPXA 1RAEB 2CQIA 2ZC4A 2PA3A 4LRDA 1WG5A 3UNGC 3DLJA 2CJBA 3LGNA 3ENAA 2LA6A 2LKZA 3JTNA 3RBZA 4JI2J 4HDHA 3BN4A 4ZKAA 3NS5A 3DLHA 3BSAA 1N5YB 4KHMA 1T9VA 2BRKA 2C2MB 2W24A 3I87A 4YDDB 1TKZA 2W2MP 4R8UA 4QPXA 3UFCX 2XSJA 4FBUA 2AJ1A 4MK7A 2M70A 3UN5A 3WIVA 4DV4F 2OTLS 4CIOA 1X4DA 2KHDA 3MMCB 2E9RX 3HFZB 2BJ1A 2ROPA 1J5OA 2E1CA 5HQLA 4XPCA 1YQHA 2Z58B 3S01A 4TU9A 1XK8A 2OPPA 2C3UA 4DV6F 3HHLB 2Z56B 7FDRA 5DG9A 2FVSA 3MAAA 2KH9A 2HLUA 1NRKA 3DOLB 1RUSA 1S7HA 5CH7B 2BACA 4URGA 4F0KA 3QRQA 4OI3A 5C25B 1CJKB 4C3LA 2AF6A 2FHJA 5FLXU 1V5IB 3QSIA 4KE5A 1FE0A 3SBMA 5FJ4A 4HLBA 3W63A 1RWVB 2CFXA 2HGNA 1K0TA 1Q53A 1N36J 2FLPA 1KR4A 1IBMF 1AFJA 4Y28C 1IBMJ 4DPUA 3FZ2A 2HQGA 5GMKa 3DI6B 4NCGB 3HM9A 2YNHB 1YBTA 3FGVA 5HMYA 3KHGA 1E6VB 2VF3A 4UQTA 1QSSA 3DMJB 4GVLA 3CT9A 1TL7B 1K47A 3KK2B 2NLWA 4RU9A 1JLAA 1KONA 2XMTA 4P2XA 5C42B 1RBLA 1NHVA 2DTJA 1OPZA 4LRFA 1F9FA 1RLCL 1T9YA 4DV3F 1L3TA 1RT2B 4ZPTR 1D3WA 1FKOA 1HR0F 4LF6J 2GVZA 3A8EA 1TUVA 2JC0A 2BM0A 7AT1B 2MQNA 4LBHA 2GGPB 5KG0A 4USWA 2ASJA 4X84A 2OPQB 4M5HA 1LNQA 1AXQA 2HFVA 4ES2A 2XMMA 1GT8A 4MIBA 1DLOB 3FQKA 5K14A 1NDKA 2ZBQA 4UOCA 1UFWA 3Q22A 2KN4A 1FA0A 3H2UB 2YKOA 1SUQA 2VBYA 3OPKA 5KFYA 5KFOA 1IKWB 2J9CA 3KXDA 2XGQA 1IR1A 4DU8A 1VRTA 1JNRB 2VC0A 4FYDA 1NDCA 2XO7A 4M5KA 3E01A 4WK1A 4K4YA 1CULB 1RJJA 1SC1B 3TX0A 3VZIA 2GCFA 2Z30B 4Y2CA 2VODA 3N5BA 3MUTP 5MAOA 3DKDA 3JTPA 1JLAB 2YX4A 5C42A 1IUJA 2R4FA 2MHNA 2ZJPQ 1YK9A 3NRBA 4ZP7A 5KFPA 1VQSA 4C11B 3WBZA 4F0MA 5DLFA 4J9OA 4FF2A 5CYQA 1IKXA 3GV8B 2ZH1A 4K4TA 2AQ4A 5GADU 3FMWA 3UPFA 2R2RA 5J2PA 5I42A 1RGVA 1RAAB 1K44A 1SV5B 2DKOB 3UCGA 1MU2A 4LR9A 8AT1B 4C0OC 4A8QA 1X0FA 2QFIA 3PG9A 1IBLF 1XR6A 1WC6A 4B9TA 2DO4A 2HHUA 1FHTA 2C3YA 2ZKTA 2VBZA 2ZBRA 4DG1A 2QA4G 1EIYB 1NJWA 2QA2A 3PHTA 3MCMA 2Y1IA 3H7HB 3J7YI 4PPZA 4WFAQ 3JSBA 4DR3F 1JJ4A 3OL8A 2VOPA 3I0RB 1MW7A 3OBIA 1LWFB 1WEZA 3W66A 4X4PA 4YR2A 2DXEA 1DBDA 5JMNA 3K57A 4OZJA 1EETA 2EFVA 4RX6A 4A8XA 5KOWA 3NAHA 2E5LJ 2QG9B 3IBWA 1NK0A 1TL1A 2Z4PA 4O0IA 4LFCJ 2R7UA 2DNNA 4DR6F 1HNVA 1T9UA 2BKNA 2QL7B 3FKBA 4TY9A 3BH7B 5H1SV 2R8GA 4OHYA 4CO0A 4FZVA 1HPZB 4GVBA 4J9KA 1GXTA 3GR1A 2V2VA 5D0EA 4NLGA 2DNHA 2E44A 2V4JA 1C0UA 3D28A 3WC0A 2JOQA 1NDLA 2AV5A 3IBCB 3PRBA 5A2QU 1RT5A 1IWAA 2VJVA 4JI5F 2ZH2A 4RW9A 1FD2A 3DRPA 4DR4J 1YJUA 2CA9A 3GJTB 4CLSA 1N8RT 5A8KB 3U1NA 1RT6A 1RTDA 3D66A 5F8NA 1TVRB 2V50A 3HI9A 1MWZA 3NCQA 4GRSA 5CCMA 2EFPA 4DR7J 2UV8G 3SXLA 1R27B 4L74A 4Y2IA 5CZXA 3KKFA 3L7UA 3NGTA 2BJEA 3RB3A 2UUBJ 3QJLA 3B4DA 2ZM6J 2E1AA 2PO4A 5KFLA 4ED4A 2GMHA 2IAJB 1ZM9A 2FD2A 3BKFA 3KYLA 2EKYA 5KG1A 1HNIA 3RRKA 5SZTA 1J5OB 2NXJA 2AIRB 5KFUA 3OTOJ 3MD1A 3P5TL 4PQAA 4Q5VA 4HACB 1H72C 2V0NA 1Q78A 3HHLA 4MK9A 1M5SA 3TVKA 4CLZA 2QSFA 3SCJE 1L5UA 4ANDA 5HROA 1LW2B 4U95A 2FTRA 3BGRB 3TUIC 3ZNUA 2L3MA 3HVTA 4DX8H 4G1QB 3PVXA 4DFKA 2UUCJ 3NWRA 2BM1A 1IBKJ 2A3JA 3HCXA 3PDNA 4USIA 2RUSA 3M30A 3ZZPA 2BUNA 4DF4A 2HW3A 1AUSL 4M5JA 2JLFA 3K5LA 3M8WA 1GH8A 1VQMS 1RXOB 3H5XA 1JLGA 1TVRA 1X60A 4TU8A 1VLYA 4MFBA 5A76A 3J80Y 5KFXA 2VC1A 3UVJB 1LXNA 2HWHA 4Y6IA 2DHGA 1RA6A 5L1IA 4LF6F 2ZVIA 4OV1A 4W98A 3NXZA 1IVZA 4NOHA 3TA1A 4DJBA 5DJBA 1UWBB 4Q2MA 1WF2A 2CPFA 5KFHA 3PX6A 4LT6A 1G7CB 1KD1T 5JVGQ 4MYTA 4OQJA 4X66F 2LECA 2KVQE 1PG5B 2F8EX 4WIQA 3H4DA 2NXEA 1NK7A 3KJNB 2D74B 2ZNYA 2FY1A 1NK9A 1KC8T 4OZ5A 3DDNA 2DY1A 2DGTA 5ETRA 3NLCA 2H3EB 3MM7A 3A1YG 4L3KA 1O51A 3J81U 3PXGa 2HYIB 2B9YA 1ULRA 1VISA 5LXRA 2YNFB 3HSJA 2UXBF 3CD5A 3POTB 1HFEL 4CLWA 4B3MF 2K06A 3GCXP 3PIOQ 4C7QA 3K8VA 1WD6A 4NMLA 4CLLA 3BQ2A 1ZOTA 4LSLA 4NA1A 1LK5A 1RQ0A 1JIHA 1O0PA 4I6WA 2XLIA 3M1VA 1FRHA 3T41A 4YR3A 1JQGA 3PO5A 2PIIA 5L9NA 1JKHB 2V69A 3BSNA 4DSLA 1REGX 5J1NA 1XIQA 4F2RA 2MZQA 2GNKA 1MSWD 3TWZA 1FERA 1U24A 2AJ4A 3K7RA 2VZ9A 4M5DB 1N56A 4I6AA 2IYGA 5KT2A 2DT9A 4J9QA 1YTYA 4B9SA 2B5JB 1NPKA 2BQUA 3V6KA 3ET6B 3DGPA 2HFNA 3N6MA 2FJDB 4WFXA 3PJ9A 5DZ6A 4ZVQB 4HTJA 1ZETA 2BZ2A 1WEXA 1ZPWX 2IDLA 1DRZA 1GMWA 3M6XA 4N47A 2PEBA 1IM6A 4PG7A 1MLAA 3UN3A 1T02A 4ES1A 2QO3A 2X1AA 2ZH4A 2LMIA 2KYXA 2BJ9A 4I2PB 2KXNB 1X4EA 4FYXB 1ZTWA 3QLHA 4ES3A 1VJQA 1S0VA 3H2LA 2KZMA 2EK1A 3IAM9 3QWUA 5DM6Q 2PI4A 3RAXA 4JI1F 3TYTA 2DO0A 1A6LA 2BVZA 4QOTA 1LV5A 1LW0B 4MAKA 3HJFA 3IG1A 4DSEA 3MUMP 4NCAA 4OZ1A 3BPDA 4ZPWR 2W8KA 3I32A 4DX6A 3U1MA 3TI0A 1LOUA 1RTIA 4F26A 3BO4A 1U1RA 2JRSA 1K1QA 1S0MA 3E3XA 2RVJA 3QBCA 2VHGA 1N33F 3Q83A 2A2CA 1T9WA 3OJUA 1N34J 3KLIB 3QT6A 3C14A 2IIHA 2B5JA 3FEZA 3V6DA 2HIQA 2HHQA 1Q16B 2Q1LA 2MZJA 2EW9A 3DDKA 1NSQA 2ZDPA 4ILRA 4P2MA 1XTZA 2HS4A 1RTDB 2PT0A 2RDIA 4ZLJA 1HA1A 4A8OA 3T5KA 3N0VA 1U1QA 4LUBA 2RJZA 4CO3A 1RI7A 3QLHB 3AXKA 2MB0B 2FJEB 1F9EB 3CGIA 1IM4A 4CO5A 2QT7A 4P10A 2D3OR 1FWLA 1V3SA 3R3TA 3S8SA 1SC4B 4HI2A 4TVAB 1PKUA 1RSCA 3NCRA 1HQUA 3PM9A 1RBAA 5KG6A 4DV6J 4QIVA 4DLEA 1SIZA 2EG1A 4GC7A 2K3KA 4ALZA 4KIAA 3QT8A 1LWCA 2OSRA 4KBIA 4EZ6A 1V3RA 3PTWA 4DCJB 1UCNA 2CQGA 5HROB 4PWDB 2IYIA 4RZRA 2OPPB 2CJKA 5JVHQ 4ZP9A 2CJYB 3KLIA 3N6NA 1Q5VA 3PW0A 1A9NB 1SKWA 2Q79A 2RSQA 2CPXA 4DR2F 1D0EA 1RB0A 3I6PA 3GQCA 4KC5A 4UOGA 3WC2A 2CJXB 2YX1A 4KHPF 5KFTA 4EYIB 1U1KA 1TK5A 3UW1A 2XMAA 2MSTA 1F3FA 1IR2A 1S9EA 1MROB 2AYEA 4OYZA 5DZ7A 2IRYA 4MFBB 3R27A 2J9DE 5KT5A 3RB0A 1HI0P 4OYIA 5LJ5Y 2D3ZA 4TY8B 4AD6A 3UCUP 1I51B 2HNYA 3GE9A 5GADI 1HQEB 4NWBA 3OXLA 2XC9A 2RAQA 4PWUA 3MOJB 4DPOA 2ABYA 2PE8A 2KHCA 2P6TA 2B7BB 3D3CJ 4O23A 3ZTOA 4B08A 1VRQC 2J7KA 4YY3J 4GMKA 2UVRA 1RAFB 1N5VA 1UJ4A 2VB6A 2VBXA 1FO1A 2R42A 2FY8A 2X3GA 5L9XA 1S5ZA 4LBPA 1LWXA 2J0XA 4PKDB 2CUYA 2KB2A 3FRZA 1NU4A 4DCPB 1NK4A 4OYXA 4J9UE 1FTRA 4U8YA 3Q8PB 1FKOB 1YJ7A 2DGWA 4EBCA 1NSPA 3KK3A 1RHJB 3KLHB 1QVFR 2Y0SD 2BKPA 2OTJS 1MMLA 1KOHA 2QC3A 1K1SA 3VAKA 4FKYA 5KFCA 2DNGA 3OTOF 1F60B 3D4JA 3QWPA 4OMFG 4LFAF 3OXGA 4IG0A 4O44A 3D67A 4PRFA 4JV5F 5IV3A 3KLEA 4LSLB 3KTQA 1U02A 3MECA 1RA7A 1MROA 4HH0A 4NPOA 1WDTA 1IKYB 5EHHA 1M5KC 1QLNA 2IJNA 1R8HA 1VMBA 2RF2B 4IFYA 1QUVA 1Y5IB 5H9FK 3KOAA 2EFNA 3FZBA 3R6LB 2BMBA 1IKWA 1S1VA 2FHJD 1VOMA 4OZ2A 4P74A 1A0OB 2GMJA 2DY9A 3MR6A 3CCRS 4DPYA 3EPGA 1RT3B 1YKWA 2ZH5A 2WOMB 2MGZB 3GG0A 3AJ1A 3T3FA 2HHWA 3N28A 2DH7A 3RG6A 2PFDA 2V4RA 2P9CA 3G6ES 3ILIA 1VK8A 2MQMA 3HT3A 1IKVB 5M2PA 5ETTA 1WC5A 3GU0A 1EB0A 2HZCA 3DGPB 4OZNA 4EWTA 2MMYA 2GO8A 1LEOA 2O1PA 3EVOA 5H9EJ 1B3TA 1RTHB 2DGSA 2DK2A 5K5MA 3RBXA 3TX8A 5BR8F 4K2XA 2HHHJ 2GZOA 4FF3A 4H4OA 2R7TA 4KT0C 3MMAA 3BDPA 2MKYA 1UA0A 3HHEA 5AE3A 1RWOB 5ETSA 2AMCB 2LXIA 5E3PA 5HMWA 3OQ2A 4DR3J 2R8HA 3N01A 3MECB 4OZLA 4K4XA 1NJIT 3M8RA 4ZIVA 1IKYA 3I9V9 1LW0A 2CPZA 4N77A 3OLBA 2B8PA 1RHQB 3FJ2A 1TK0A 3T6JA 2OHDA 3R6GB 5IT0A 4K4UA 2KT2A 2B4OA 3DCAA 1KFSA 2AEFA 1BWVA 3WX4A 1Q95G 2QLBB 5E3RA 4Q45A 1T8EA 3AOAA 1ZM3A 3RR7A 2E9ZA 2FB0A 3MFHA 4DQSA 2UXCJ 3CJ3A 3NOGA 4J7CA 3KK1B 3CCLS 2HBRB 4ICLB 2V2ZA 3AQPA 4I1TA 4DHVA 3C14B 1N54B 3H90A 3PKYA 3RW6A 1SCJB 4AXJA 2CXEA 3D1OA 1KTVA 2LXFA 2PMZD 4DSFA 4BDPA 3FSIA 2CQ2A 1U6BA 2N3LA 4RUBA 2ZZTA 4C8YA 2EPIA 2MDAA 1W7WA 5E3QA 2CQDA 4NZ6A 2FLNA 4LRBA 3JS9A 1RHUB 1HMVA 2JWNA 3C6TA 3CW2C 4P71A 3OVBA 1BWEA 1FRXA 1FDNA 2EXUA 1SH3A 4ZVEA 5JJBA 5A8KA 4NLOA 2L9DA 5IZHA 1PAEX 3CMQA 2WBRA 3IGNA 3R7SB 1UPPA 1S9GB 2K7KA 2WZ1A 2GJ2A 2YWHA 1R7IA 3EZUA 4OYBA 4X4RA 4HTIA 2LYVA 3TR5A 5HQ8A 1U0SA 2HBYB 2ATLA 4FP9A 3ZXWA 1EAYC 4AL7A 2PSZA 3AHPA 3G6XA 2KTQA 1WNEA 2R7RA 3VAHA 3BGFA 2KVIA 1U1LA 3EICA 4X62J 1M5OC 1RT1B 4FPRA 3VGUA 3Q8SB 4IRKA 4HACA 4OHZA 5BYSA 3EGVA 1N5QA 1M0SA 9ATCB 1I94F 2WSFC 2E5HA 5KG7A 1XNQJ 2HQCA 1OO0B 2CG8A 5E2QA 1M90T 1LW2A 2DRBA 2R7VA 3O44A 2JVOA 1DQAA 4P2SA 4DFJA 3CE8A 3RZAA 1FJCA 3R5GA 2ZITA 2H9ZA 2BW7A 3EE3A 1AYEA 4UQGA 2B9WA 4HDGA 3TAMB 5K8OA 3HVWA 1DJ0A 4TY8A 4LF7F 4FYWB 4NE9C 3ZNJ1 4EUVA 3G6YA 3BGUA 5KOXA 1NKEA 1JLEB 2ZJQQ 1JLGB 3GSDA 1WACA 3AA9A 2B9XA 4EYHB 3Q8VA 1XWLA 1AT1B 5B0GA 3MR2A 4ZP8A 4TYBA 3KUGA 4CDIA 3BPSP 1ELOA 2V94A 4RUHA 3R5AA 2VQFF 4E0DA 3QAEA 1U0HB 3NNHA 1VIOA 1RE1B 4A8FA 4OHWA 4D3HA 2BJDA 5G0RA 4DR1J 2XS2A 5C5JA 1K9MT 1NHKL 2FZGB 4M94A 2OEMA 3GYNA 4OL8A 5BJRA 4HKQA 4I0WA 3TNVA 3W8GA 1JXVA 2DCUB 1WSVA 3MAAB 2AJ0A 4KH0B 3KLHA 4BWJA 3DOLA 1RWKB 4NEZA 3LP2A 4MT1A 1NCLA 2I0XA 1OSCA 1FWKA 2F1FA 2XMWA 4XDDA 3CJ8A 2E5LF 1BQNB 4A8MP 4XK8C 3CF5Q 4PEOA 3CC4S 5E3AA 1FFSB 1DTQB 5A8WA 4DV0J 3DRRB 5F0WA 1YJNS 1T95A 2QMUB 1LXJA 3B8HA 1ZM2A 3IRXB 4DL3A 3MM6B 1MN7A 1TELA 3CCQS 2RF2A 4IFYB 4LRCA 1RHMB 3VVUA 2GHVC 2O66A 2MKJA 2FHKA 3FVYA 1JLEA 3DI6A 4NCGA 4WU2A 4CO4A 1YLXA 5L1LA 3M2VA 2B8QA 3M1VB 3KG1A 3S6EA 5IS2A 3H42A 1NSAA 3T9NA 1HBMB 3FBFA 3R5CA 1QM9A 3VGVA 3DOKA 1KQSR 4ZVGA 1IBKF 4W4MA 5KFWA 2FJVA 4K4VA 3SQGB 2NR0A 2W8LA 1X4BA 2DGQA 3EDQB 1GX6A 3M2RB 5ETVA 2N7CA 3GV7B 2HHVA 4QYZK 1FDAA 1UPMB 2YXLA 4LF8J 2FJBB 3Q8YA 4H4OB 3LP2B 2FC8A 1F6TA 1YSJA 3F56A 3W8PA 2ZH8A 5J2NA 1WOSA 2MKHA 2Z2MA 4DR7F 1S1UB 5DQHA 1AA1B 2YH0A 4OI1A 1LKZA 2Y1RI 2DGOA 2W2QP 2DNOA 5E0OA 1RAIB 2RQKA 3RUBL 5EWGA 1EQ0A 1YZ7A 2WVEA 1FJGF 2MZTA 1YJ9S 3W5ZA 5CXTA 3G9CA 2VFVA 2MZSA 1QAXA 2ZD1A 2FJXA 2YPYA 1T9XA 1R0BG 3HVRA 1UZHA 3M7VA 8RUCA 3LP0B 1Z4UA 5DQIA 2KT3A 4HL9A 2ZBCA 3VVTA 1NB2A 1H73A 2DGUA 1P9YA 1S1WB 3C6UA 3FFIB 2CADA 5ETOA 1HBOB 3DRSA 2E1MC 1P27B 4KGKA 3M6WA 4CO2A 3NL0A 1H2TZ 2HQ3A 4ETZA 1NAQA 1RU2A 1EKRA 5B08A 4I69A 3N6LA 4FN5A 3QFHA 1EZZB 1QJHA 1Y3KA 4J9PA 4ELTA 1TAUA 2XS7A 1X7VA 3VHQA 1L3SA 4X65F 1Y5LB 4NXNJ 4DV2J 2C2RA 3MZIA 2YNIB 4DV1J 4DV3J 2OELA 2DGVA 4PQUA 2OD4A 4Q0BA 2HRTA 2FVCA 3MM9A 4YDXA 4CLPA 2BANA 1S9GA 4E8UA 5KFQA 3IFEA 5KTQA 2R8KA 1CJUA 3LQVA 1Q81T 4M95A 2K7JA 4B3MJ 2YQ0A 1UA1A 2ZD1B 1WI8A 2HNZB 2XI3A 2M3DA 3CCZA 5D0HA 5E3CA 1U2RA 4WCEQ 1ZS6A 2P9EA 2Q43A 3FK4A 4QU7A 3TEGA 1WOOA 4UW2A 5DGBA 4CLKA 3GPAA 3MTKA 4U7UK 2OKQA 2YY3A 3IO1A 5HJYA 4ECSA 3MEDB 1TL1B 4KSEB 1HNVB 1U25A 3M9MB 1I6JA 2XBPA 2GQQA 5KT6A 2DJWA 5J2QA 3H5UA 1CC7A 3P8BB 4JYAF 4JI8F 4Q43A 4RU2A 4IKAA 5A8RB 3E2EA 3R2CJ 2XMUA 1S6QA 1BQMB 2I5JB 4C8NA 5F3ZA 5KG2A 4YHHJ 4E2FB 3K5OA 1HYSA 2W7OA 1YBUA 4HT5A 1KQGB 4CNYA 4USKA 3MM8B 4UOFA 2A10A 2WK4A 2BX6A 2B7CB 1X4AA 4JI3F 1N5SA 2HNYB 2BJ3A 5B0CA 1SH2A 1DQ9A 3AOCA 1E6YB 4DWIA 2D7SA 1NPRA 2Y8YA 2FJWA 4M5NA 1RKIA 3LA0A 5AXLA 5LMUJ 1W25A 4I4BA 4R0JA 3T1YF 1YGYA 4ZJLA 5CABA 3GILA 2R7WA 1S79A 1BGXT 1IXKA 3KMSA 2J6TA 1HBUA 3MAQA 2XMJA 3LPEA 3MOZA 1NM2A 2LLZA 2PEHA 5I3PA 4DOZA 3OUYB 1AW0A 5L8RC 2GJIA 2RNEA 3G71S 2F40A 4CH0S 1Y5NB 4OJ3A 4DR2J 3H59A 1WWHA 3D6TB 4KGZB 5LSLA 2XULA 4H4KC 2VA2A 1S99A 5HO4A 4IFVB 1RT4B
chains in the Genus database with same CATH topology
1TL3B 4FF4A 4X4OA 2KM8B 3RR8A 1S76D 3H8YA 4LMZA 3H5SA 3ZZOA 4KO0A 5KFIA 4B3RF 3MM8A 1UL3A 3TP2A 3OTEA 3TVZA 4ZLPA 3KJVB 1S1VB 3PFOA 1QE1B 1HD1A 2WBMA 2WTFA 4DV1F 2UXDF 4JUZA 1S0NA 2FIUA 2EK6A 2ZOFA 2ZOGA 3IR5B 1Q79A 2IC3A 4B9NA 3JSMB 4LQ9A 3MEEA 1GAOA 4C11A 4RW4B 1VQ8S 3WDOA 1IJFB 2VH7A 2RIJA 1NKCA 2LQ9A 2YVSA 2I2YA 5I42B 3G8SA 2DCLA 4NLWA 2HMIB 4NLUA 4PXBA 3HKWA 4KV8B 4ID5B 1C4AA 2ROEA 2ROGA 4K50A 4Q8EA 2UU9F 1JMTA 1RT7B 4DUZF 2D3UA 3IR7B 4DG1B 4RW8B 3K58A 4WFZA 1FK9A 5J2MA 2RRAA 2ASYA 4FNIA 3V6HA 2RD5C 4MMOA 2KZZA 5F0UA 2J0QD 5SUHA 5LJ3Y 3OFEA 4CNZA 3BR9A 3P49B 2J6UA 1R43A 1R3NA 3QZ7A 2OFHX 2IVMA 3GFHA 1SQEA 1KEKA 3NMRA 1IJEB 1Z2ZA 3MEGB 4NLRA 1S1TA 1S10A 2G0CA 2XMVA 3GB0A 3LANA 2WSEC 4X4NA 3UE2A 2BXJA 1TKTB 2G13A 3AY0A 7FD1A 4U7CA 4Q7AA 4QWAA 2DIVA 4Y3CA 3ISNC 2K2PA 5THWA 1U26A 2UVVA 3O1LA 2E5IA 4ECYA 2YNIA 4M63A 3CCMS 4C8OA 2MKIA 2BRLA 4KKOB 5DRKA 3EGZA 2XEXA 4WFNQ 4QJVA 5GAHI 4EEYA 1HNXF 2ZZMA 2ZH7A 2D9PA 4I68A 4LF4F 4YY3F 4NZ0A 2J9DA 3OSNA 2JSXA 2XHWA 3THPA 3OHAA 1B64A 1HWJA 1DZ5A 2HFOA 3VQTA 1PGZA 1JB0C 5AE1A 1C1BB 2O5DA 3UD3P 1P1TA 2DNPA 3IS9A 4ECWA 1O8BA 5D3GB 1XMQF 3HFKA 3HK2A 4L6V3 3M8QA 1FKPA 2DHXA 2DNYA 2O01C 3M32B 4J5OA 4ED2A 4QZVB 5J2QB 3HVTB 4IDKA 1G6BA 5A8RA 1S0OA 3CMAS 2DH8A 2AP6A 2Q66A 2LCWA 4RNHA 1Z2LA 4B9MA 1YJTA 2B6AB 3MURP 3OFHA 3KLFB 2W4PA 3LGMA 1U7LA 3QIPA 2JL9A 1RTJB 3EX7B 3EXCX 5KFSA 3AH6A 4QW8A 3SV4A 4KFBA 3UD4P 1CLFA 2HLTA 2HRUA 3MMBA 5U47A 1XNRF 4GKJF 3Q2TC 4OFZA 4DMZA 3CSKA 2ZBIA 4ECZA 1H2VZ 3V5RA 2Q6BA 3DXBA 2ZUGA 3QZ8A 1E6VA 2J6SA 3DLLQ 4PPDA 3L95X 5CYJA 1WHXA 3MTJA 4ZCLA 4I6YA 3P96A 2GA7A 5KT4A 3Q24A 2KKHA 4W92B 5DS7A 2NSBA 1S49A 2I9SA 2HHHF 4KAIA 2YKMB 3SCLE 1UP1A 1RT2A 3BSOA 3SYZA 3VZHA 1IQTA 3H40A 1LQ9A 4WZMA 2DPJA 5F3TA 2ZH9A 2EBEA 1FNOA 3HXMA 1TL3A 3I5CA 1Q8LA 5IFMA 4HT7A 2VONA 1JLFA 2G1DA 2HGMA 4WYLA 1S6UA 1K0VA 4C97A 2G4BA 2HQIA 2ADBA 3DMJA 4C8LA 2DRAA 1C4CA 1VRTB 5DDQC 1HQEA 4A8KA 2V8GA 3I0SA 4BWMA 3PEJA 5KFDA 1R0AA 5EN1A 1YI2S 1JLBA 2QSWA 4RNOA 2RH3A 2AX1A 3CJKA 3RBDA 3HPOA 1FEEA 5GVQA 4N76A 4IQMA 2OPQA 4WIIA 2O3DA 4MKBA 3LO3A 4ZPBA 4WFBQ 1D9AA 3RU0A 2VG5B 3PR5B 4A8YA 4HHJA 2OPRA 3HHDA 4OLPA 3CDEA 3OXFA 2IM0A 3NKYA 2D41A 3GIKA 4J9RA 3M2UA 4DDFA 2ZHAA 2BE2B 1BD6A 2JC1A 2I8EA 1VBXA 2CDQA 1JJHA 4NA2A 4GKKF 2M4MA 3SMZA 4E98A 2XCPA 2B4VA 1NJXA 1JLCA 4EFAC 3MEGA 4R5PB 4BC9A 1S1TB 1U48A 3H98A 1FT8A 4RNNA 2IFXA 2FJAB 4DV0F 1P8GA 2N4DA 3FRYA 3F41A 4ED5A 2HAIA 4WXWA 4A46A 2H5EA 2CJAA 3VR1A 3KHRA 2HHSA 1HARA 1V6HA 2J5AA 3L7PA 1NB7A 2DNQA 1FNMA 5GAHU 3HZGA 3T5LA 4Z37A 2VG5A 2L08A 1PO6A 2OPRB 2V4JB 2EC0A 5J1EA 2W9BB 3MM5A 3RBEA 4NYZA 4TLRA 2ASDA 4DSKA 1UVIA 1M1KT 2P9GA 1D8YA 3PZPA 3C66A 4G1IA 2XLJA 2N7YA 3AQOA 3CJ4A 2MQQA 2V4QA 1ZH5A 2QMXA 3IR6B 4A8SA 4DF8A 2YTCA 2IMOA 4AYBD 2FGOA 4CTAB 3DOMA 3IC1A 4PG5A 1FE4A 4TQRA 3NNCA 4QIGA 1S6OA 1HQUB 3RW7A 3B78A 1UFLA 4QIWD 5K8PA 4YR0A 2B3TB 4PUOA 2CQCA 1S97A 1U45A 4TU7A 3TUJC 1UEVA 1HPZA 5BYRA 1R8BA 2BW2A 1S77D 2XY7A 4Q8FA 3RRGA 2Z2LA 3DLEA 1RT5B 4NRTA 4ZPAA 3MDFA 2UUCF 2VPYB 4NLDA 4C4WA 2YKQA 4UUWA 1N52B 2NREA 3PNIA 2RS2A 3GFZA 1UAWA 3QIPB 4URQU 3OR2B 2COLA 5LSRA 3LWMA 2NR0A 3PO4A 5L38A 3DM2B 2V5HG 5HBMA 4RUCA 3DU6A 1OIAA 4HEA9 4H4MA 4I7FA 4RBUA 2XGPA 2OMOA 1VQNS 4G3IA 1XN9A 1X4CA 5F9NA 1HHTP 2B56A 3FDSA 4RBTA 1U1MA 3MF5A 4JI4F 3ZZTA 1HNIB 1NEEA 2E9TA 4Q44A 2XSJB 2ZM6F 3CCVS 2CYYA 1D9FA 3IAS9 2EFQA 2ZE2A 5LT5A 3LW5C 2XCAA 4IYQA 4QW9A 2Y1JA 2MZ1A 4KQZA 5AXMA 3RYLA 2UVWA 5E41A 3VAGA 3DHXA 2APOA 2NYIA 3KFWX 3BGRA 3FMBA 3KK3B 1YVFA 2GHWA 2VV5A 2DR8A 5AJ3F 2C3MA 3ZC4A 2YKNA 3SI8A 3US5A 3FNNA 2GIQA 2RE1A 4NCBA 4O4RA 4JI7F 2VFTA 1SXLA 2GQCA 3N9UC 3OTDA 3JTOA 4JI0F 4D3GA 5EDWA 1VQ7S 4I67A 3X1LB 5IM0B 5L39A 3NGDA 2PDAA 5A0YA 3CCUS 1H3DA 4O3OA 5B0DA 3O6QA 1H0HB 1U4BA 2DNLA 3I5AA 4ZMMA 1WG1A 1ZAWA 2PMHA 3LPYA 3J7ZT 1NKBA 1R0AB 4F3QA 3ZZ0A 1FKAF 4O3SA 1T03A 1N36F 2E9RX 1F0XA 2KFYA 1DFDA 1Q4RA 4ECRA 1QE1A 2JDJA 2KYZA 1Y9OA 3U02A 2VFSA 2C2EA 2IM2A 3KWMA 1N6QA 3CD6S 2CZ4A 3IN5A 3M4XA 3R1HA 3NWGA 2FDNA 2C3OA 2R7QA 3M9OB 4EU0A 1ZM4A 2BQRA 2RS8A 3UWTA 2FVRA 4F3MA 2AGQA 2K1RA 2CRLA 4QYZJ 2EWHA 2GHPA 2HMIA 4F4KA 1FJ7A 2RMLA 3BQ0A 2QA4S 4ID5A 3WZ0A 1FVQA 4C8ZA 4ZHRB 5B0EA 2PGCA 2N82B 3OL7A 2XSFA 4CT8A 1VC0A 1SUQB 1U09A 3OJSA 4GO5X 3BQ1A 2YWEA 3VF0B 2YH1A 3KMQA 2W7PA 2VUGA 3E8OA 1R6YA 5I4MA 1JLCB 3JYTB 4OX8A 4DSJA 3DU5A 4MYUA 1T03B 4AL5A 4ZDNA 4O3QA 5AE2A 3BSCA 3K0JA 4EO6A 5JUMA 2RILA 3PFEA 3IWNC 3EGNA 5D8HB 2C2DA 4WFYA 1HNZF 4MKYA 4ATNA 1JXLA 2QA1A 2QRRA 3V6DB 2V8DA 2D1CA 5M2RA 4C2MA 1VI7A 3MM5B 2K1RB 2VA3A 2HHTA 5J2NB 4U67Q 4RKUC 3MMJA 1IN0A 1C1CB 1GXLA 1KFDA 2WB4A 4LF8F 2L9WA 2HNDB 3UR0A 4C9DA 3ZFVA 1N5YA 3O3LA 1N4LA 5F8HA 1L3VA 3V6JA 2HWTA 1R89A 4B02A 5D6GA 1UJ6A 3CIZA 3I55S 4KRWA 1QSLA 2CIMA 1KLNA 2V9WA 4PUOB 1RT1A 1HWUA 1SJ3P 2LQJA 2WB1D 1OPIA 4K5SA 4ECXA 3IS9B 1KS2A 5DG7A 1VQ9S 3UI3A 2ADCA 3V4MA 3I82A 1UVMA 1ZBTA 5KG4A 3S1TA 2IVFB 4ILLA 1VQ4S 5KFGA 2W9CA 3OVAA 3IXQA 2RU3A 3D0HE 4TN2A 3OR2A 1KTQA 2RDJA 4YFUA 1Q7YT 1DAXA 3HDSA 3L09A 2QEXS 2HG4A 2GC8A 3PY8A 5D78A 1C1CA 2B6AA 4PG8A 1H6KX 1VRUB 3MD3A 2JVRA 1YHQS 4NXNF 5EWFA 4IH6A 5IWAF 1T05B 1OWXA 3LF0A 2CPDA 2XY6A 2HPUA 4AQYF 3QO9B 1S72S 4HVZA 3Q0AA 3DC2A 2HNZA 1WG4A 3ONQA 3VTIA 4X62F 4DL7A 3VQSA 4AL6A 3HO1A 2R7XA 2DVIA 3SFUA 3BZQA 4UY8T 2HVZA 2A2DA 4DQPA 5DQGA 1TV6B 2CPEA 4F67A 4JI6F 1KRPA 2YWKA 1C0TB 3DLKA 2PA8D 4WE1B 3SSSA 3UCZP 3CD7A 3KLGA 4X4SA 1KSPA 1KHVA 1Q82T 3LOUA 2LQBA 2M52A 3EPIA 2OD6A 2XMKA 4H54A 3TW0A 4Q2LA 5K14B 5KFBA 2YWFA 2GIRA 2WHOA 5EX3A 3I9ZA 4XPEA 2BOPA 2M88A 2GQ2A 2OP5A 4ZCMA 1BQMA 5LL6d 5A0YB 1QAYA 4MKAA 1VRUA 1BQXA 2DD8S 2UUWA 4ILMA 3T5JA 3DRYA 2UVUA 3OFGA 4U6PA 1TFYA 3PV8A 1U2FA 2MKKA 1BC6A 1UEUA 2W4DA 1N32F 1E6YA 2DNMA 3CPWR 2QFJA 3DN9A 3I0SB 5I3UB 2IM3A 4TXSA 3SQGA 5KAKA 1RT3A 1UETA 1O5JA 2DIUA 2MYFA 5IQ6A 5L1JA 2DHSA 3BJYA 4IR1A 2CPIA 5D4NA 3ZZZA 2VG6B 4DS5A 1XR5A 2KJVA 4ED1A 2GO9A 1IKXB 2I1RA 5F8JA 3DLBA 1WI6A 3VAIA 4J37A 1S4FA 2PD1A 1M5VC 1RTHA 1TL5A 3PR4A 3GYXB 4IG0B 1N5TA 4LQ3A 4ZHRA 1RP5A 1RT4A 1SI9A 1J2VA 1JJ2R 5DM7Q 4WF9Q 1P6TA 5B7WA 1N88A 1X5PA 2L48A 2RQ4A 3M8PA 2PFFB 3LWLA 2NPFA 4DLGA 1QVGR 4ZPVR 4RUAA 2MKCA 4WJBA 1YRXA 5KFJA 1SH0A 2WOMA 3DLGB 3VAJA 3K5MA 2YQ3A 3HX9A 4B3SF 5I3UA 1HBOA 3DRSB 1YRTA 1EP4A 3W2VB 1H2UX 1NJZA 3KHLA 1KVIA 4YUDA 1NK8A 3PX0A 4IG3B 2VG6A 1UVJA 4WYWA 2CJ9A 3KG4A 3N4WA 3O2IA 3T6BA 5HMZA 2U1AA 1H98A 3EXYA 5KTQA 4ETXA 2IM1A 5F8IA 4I2QA 1DHMA 4X64F 4Q0BB 5J1EB 2AX0A 4RNMA 4ZCIA 1Y7PA 1BLUA 1RT7A 5FDLB 3V81A 5EGYA 1D9DA 5CCLA 5CD4H 4C8KA 3TA2A 3QJJA 4JV2A 1ZAVA 2MQLA 1HBNB 3M8PB 3CC2S 3SFGA 3BS9A 1VBZA 4F2SA 3SZ2A 2K3IA 3SEOA 4DFPA 1KN6A 4LVOP 3IG1B 1TKZB 3H4BA 2KRRA 2NUUG 1NH8A 2BQ3A 1J5EF 2W25A 5B0BA 2MSSA 4F02A 1NO8A 3ULHA 1D8ZA 2ZOMA 2HHPA 4USHA 2CQ0A 3PRDA 4J9SA 4TQSA 4N41A 1EP4B 2AGPA 3AB4B 2J7WA 2UP1A 3OVSA 3ISND 3Q8QB 3F44A 4O4GB 3MEKA 3OR1A 3BGLA 4RW6B 4EO8A 4ED6A 2M8DB 3QMQA 1OQ6A 1WF0A 2XLKA 2OAUA 1SJRA 2KG1A 1VJWA 3KNAA 1UKUA 3TARA 4F4ZA 2HFZA 4F50A 3RB6A 4LFCF 3DNCA 4PR6A 2IJFA 4OI2A 1HHSA