3BDEA

Crystal structure of a dabb family protein with a ferredoxin-like fold (mll5499) from mesorhizobium loti maff303099 at 1.79 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
100
structure length
100
Chain Sequence
QGMIRHTVVFTLKHASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFSMEFADQAAYTRYNDHPDHVAFVRDRWVPEVEKFLEIDYVPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of domain of unknown function with a ferredoxin-like fold (NP_106155.1) from Mesorhizobium loti at 1.79 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Unknown function
molecule keywords Mll5499 protein
total genus 29
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdeA00
1VQSA 1AW0A 1SQEA 1OQ3A 2OKQA 2OP5A 2FTRA 1FE0A 1SI9A 2VV5A 1Y3JA 4HI2A 2OD6A 4F67A 2W4DA 2XMMA 4NL5A 3T9NA 3TOQA 1U7LA 2XMUA 5B0FA 3QGPA 5A6PA 1MWZA 1FEEA 1XBWA 3CJKB 2KT3A 2GO8A 1FESA 3TNVA 2PD1A 1N5VA 3HDSA 5B09A 2BUNA 2BJDA 1OPZA 1V3ZA 2HLTA 4A48A 3WDOA 4EFAC 4ZOSA 2OD4A 1APSA 1WD6A 2OFGX 4OJHA 4A4JA 2N4DA 2LDIA 2OAUA 4QOTA 4Q2MA 3TRGA 1YJTA 1FVQA 2CRLA 2RILA 3BDEA 4NPOA 4YEAA 3IWXA 5T7LB 1KQKA 3UDCA 4A46A 3KG0A 2HFOA 2GGPA 5B0BA 2QLXA 3KKFA 4HI1A 2ACYA 3LO3A 1URRA 1YJVA 2K1RB 3MCSA 2W4CA 1YRXA 2KYZA 1LQ9A 2VH7A 1TUVA 3FRYA 2XMVA 5F0UA 1AFJA 4HH0A 2LQBA 4OJGA 1K0VA 1X0PA 2ZDPA 2BJEA 2FIUA 3BN7A 4Y2MA 1IUJA 1SB6A 2RU9A 1CPZA 2ROEA 5B0EA 5B0CA 1YJRA 3E8OA 2FHMA 2N4CA 1CC7A 2K2PA 2BYCA 4DPOA 1VQYA 2L3MA 2XMKA 3I9ZA 1JK9B 1TR0A 2QIFA 1X8DA 3HFKA 1GXTA 3HHLB 2QLWA 1GXUA 1FE4A 2LXFA 2GV1A 1N5TA 5B08A 4U9RA 2K1RA 1S6OA 2BBEA 2OMOA 1QUPA 3LGNA 3DCAA 5B0AA 3FMBA 1W2IA 1N5SA 2GA7A 2AJ0A 2HFNA 4FNHA 1ULRA 3HHLA 5A6WA 1Y3KA 2ROPA 1OSDA 1R6YA 2W4PA 1X7VA 3BGUA 4A47A 3F44A 4HH1A 3BM7A 2Q3PA 5IXUA 1P8GA 2AJ1A 1TL4A 2HQIA 2ROGA 5KAKA 2LQ9A 2RSQA 3K7RA 2ZDOA 1JWWA 2IYGA 3BB5A 1Y9OA 2N7YA 3HX9A 5B0DA 2JDJA 2IFXA 1FVSA 1S6UA 3LGMA 5B0GA 2K7JA 1Y0HA 5F0WA 3FGVA 2QYCA 2HIQA 4DN9A 2AP6A 3DXSX 4OJ1A 3CJKA 1OQ6A 4Y2IA 4OJ3A 2XMJA 1MWYA 1FD8A 4Q2LA 2XMTA 1TZ0A 2RMLA 3BF4A 4HL9A 2KT2A 4Y2KA 2GGPB 3QMQA 1Q8LA 3KNGA 2KKHA 5T7LA 4ZA1A 4YDXA 1YJUA 2GCFA 2XMWA 3MZIA 3KG1A 1AFIA 1N5QA 2HLUA 1KVJA 2AW0A 1CC8A 3HF5A 2IYIA 3VTIA 2EW9A 1RJJA 1TL5A 3GZ7A 1KVIA 3BR8A 3HHLC 2OFHX 1P6TA 1YG0A 1Q8BA 2G9OA 3IWLA 5K9FA 4FNIA 2K7KA 3HHLD 2GFFA 4OIXA 2ASYA 2PGCA 4DL0C 1Q4RA 2FB0A 1Q53A
chains in the Genus database with same CATH superfamily
1TK8A 5HN0A 3TX0A 5HI7A 2W24A 1YGYA 3MM7A 3N9UC 2OD6A 3FCHA 3FNNA 1NXIA 3TI0A 2CPIA 1HLWA 1H98A 1B64A 2VFSA 2MQPA 1XWLA 2CQPA 4MYUA 2B8QA 4JB8B 1SBRA 1FESA 3TNVA 2PD1A 4I68A 3IP0A 4R5PB 2XY6A 4HEA9 3QGGA 3MPWA 4X65F 1SL0A 2H5JB 4ZVUB 5IQQA 4K4UA 1WELA 1KVKA 4LF5J 1IKWB 3GQCA 1R0BG 1S1WA 4CP5A 4DR2F 4LF6J 5D77A 9RUBA 5GAEU 2FVQA 4LFCF 3ZTOA 4ES2A 4EZ9A 4X64J 2YPYA 3BYPA 1X5SA 3CNQP 1EKRA 3IS9B 3MAQA 3VHQA 4P2SA 5HL7Q 3AXKA 4LVOP 2V4QA 3OW2R 1X9WA 3QIPA 3GWCA 1RHQB 1M5KC 1VJWA 2K1RB 4XO0A 3HM9A 3BJYA 2KYZA 1R0AB 4W92B 2EC0A 3A8IA 1JLCB 3IBFB 3PV8A 3FZ2A 3D3BJ 1RT4B 5F0UA 5LMNF 5CD4H 1FXRA 2MPUA 2HNDA 5ETPA 5HLFB 2HSEB 4ITSA 4PR6A 2ZE2B 5KG5A 4B3MF 3I0SB 4O23A 5DG7A 1IBCB 3PJ9A 3SDEB 2HGNA 4AYBD 1JJ4A 2PI4A 1BWEA 4MIWA 2V4JB 2E9TA 1MW7A 1YJRA 5CYMA 3CGIA 1OPIA 2PDAA 2FHMA 1KLMB 4G1PA 5B7WA 3S6EA 2BA9A 2XBPA 1ZM2A 2VUGA 2R2SA 4NXNF 4ZVPB 3M8YA 3BGRA 4Y2CA 1D0EA 1KFSA 1LFPA 2BE2A 4P7TA 4P74A 2Q43A 3RBDA 1TFYA 1X4HA 1TL3B 2H51B 3D7SB 3M7VA 5HQ8A 2JLGA 4O3SA 2CWKA 4U9RA 4RUAA 4ECVA 1MU2B 1MMNA 3JTPA 1T3NA 1U1NA 4YQWA 2CYYA 5A6WA 3G8QA 4IUFA 3I82A 4Q8EA 2YH1A 1CJKB 2OHDA 1FDAA 1FWLA 3R5BA 1EIYB 4GKJJ 3VWSA 2DR9A 5HROB 4WYLA 4IFVA 4ECQA 3TANA 3GR0A 3H2VE 2QC3A 3BB5A 1DTTA 4JV5F 4C8KA 3OQ2A 5HVGA 3CO0P 3MI7X 4PG7A 5F8MA 1FVSA 2CKWA 3LGMA 3KHGA 5F8JA 3AB4B 3KNAA 3ENWA 1OIAA 1RISA 2NUUG 4CDIA 1OQ6A 2XZDB 1HQUB 1U2CA 4NLTA 4EBDA 2MKCA 2Z4PA 3H5XA 4K0KF 1UWBA 5J2PB 2AYGA 1M90T 4LMZA 2JH3A 1T95A 4LR7A 3VZHA 4TU8A 1QSLA 4X4UA 3LPEA 1IR2A 3R5AA 4JI5J 2PC6A 1M5VC 2IY5B 1Q82T 2XO6A 3NEKA 2V8DA 1YJUA 2W2OP 3DOLB 2NSCA 2CQ3A 2QSFA 3DYAB 3MF5A 4UOCA 5K14B 5BYSA 3K5PA 1W25A 3LQVA 4WU2A 1J27A 4O3OA 3OUYA 2QA4S 3C6UA 3TX8A 3VCDA 3SBMA 3US5A 4PWDA 1HD1A 2F4VF 2PA8D 4CYUA 4DCOB 1SC1B 2P6SA 2QLBB 4RUCA 3AQPA 1TELA 3BBCA 2UUCJ 2NYIA 4LUBA 4DSLA 1NDKA 4PXCA 1W26A 5KFIA 1HQEB 1RT3A 5C2CA 4CT9A 3OT9A 1RI7A 2FJVA 3BDPA 5IT9Y 3KJFB 3WC2A 2OEJA 2OEKA 2FQQB 2ZVIA 4N8OA 2UU9F 2L41A 3TVYA 2HBQB 4F0HA 1N52B 2D9PA 4IOBA 4R8UB 2JVOA 5CQGA 1TV6A 1M5HA 1AW0A 2XNQA 2UXBJ 4LF2A 3HHNB 2OP5A 2W9BA 2R8IA 5IM0B 2GJFA 2GS8A 2ZOFA 3ZZUA 3G6XA 2H54B 3TOQA 3HVWA 5J2PA 2GZOA 2E7WA 3GJSB 3UCGA 2QYGA 4EEYA 4QWBA 5D3GA 2HNZA 1XBWA 5M2PA 3JXOA 1YBAA 3WX8A 2UU9J 3JYTA 1B0TA 2EXUA 2GO8A 4F3MA 2B6AA 3GFHA 3PEHA 2W25A 2ZITA 1JXLA 2JEFA 4X4PA 4FXWA 2IM0A 2OTJS 3MECA 5D0EA 1H72C 1MNEA 5LM7E 1LWEA 2ZH4A 5AJ3J 3M32B 1IKYA 3MEDB 4HDGA 1TKDA 3UVJB 4UT4A 1PYSB 1RTJA 2LMIA 3ZZTA 4A8SA 1PIEA 2HFOA 1Q5VA 1XMOJ 1EQMA 3O5TB 1FK9B 2ZZTA 4NE9C 1SJ1A 1DFDA 3NCQA 3GB0A 4CCHA 2DT9A 4YHHJ 3O6QA 1HHQA 2AEFA 4WTOB 3MCSA 3JAMU 3M2RB 2DGWA 4P71A 5KFLA 3J80U 4IH7A 4F4WA 2H3EB 1QAXA 2ATCB 3HFZB 4LBPA 1TL3A 1VQ9S 4HT5A 4ZPDA 1S99A 1WC1A 2XEXA 1PJ6A 3UQSA 4WKYA 5D4OA 2YKMA 2BEFA 1KLMA 2O5DA 2QA1A 3DN9A 2JFKA 2M0GB 4KPCA 4NRTA 1IUJA 2IDLA 2RU9A 3LGHA 2VONA 1K73T 2OELA 4QPTA 3DLKB 3F56A 4IG0A 2ZM6F 1VQMS 4OL8A 2MQMA 2ZE2A 2XG8A 1IBKF 3AJ2A 1H6KX 3T6BA 2XMKA 5DM6Q 1X4FA 3UDVA 1NLKL 5JUMA 3A8EA 3R9LA 3K5NA 2ZH9A 1VC5A 4OHYA 2QLFB 3MM5A 2DNNA 5L39A 1VQ4S 1XR7A 3OR2B 4ZK7M 3B6BA 1EKSA 4KV8B 3LGNA 1XNRF 3O44A 3UPFA 3FMBA 3BQ1A 2KL8A 3C15A 4RNMA 1JJHA 1K1QA 3DMJA 5D4PA 5LJ5Y 3R1LA 2AGPA 2AJ4A 2C3MA 1PG5B 4ZJQA 2B9EA 5D4LA 1U24A 3MEEB 3KJVB 1HWUA 3RBXA 3H59A 1WEZA 3V81A 2YNIB 1KOHA 4RBVA 4TY8A 5IXUA 1P8GA 1HIYA 2B5JB 1TL7B 5ITHA 2Y9HA 1HNIA 2XSFA 1VQOS 1YZ7A 1OS5A 2ZDOA 3EVOA 1FXDA 8RUCA 2E44A 2X1AA 4YUDA 2E1MC 4NWBA 1TKXB 4ZCIA 1X5TA 4ANCA 3D28A 4MIAA 1IQTA 4ZVOB 3TA1A 4C11A 5F0WA 5HBMB 1BXNA 1WKKA 3Q8YA 5HBMA 4C11B 3QAEA 1DY3A 3I4HX 4CLFA 4RUHA 2Y1LB 4NLGA 2IBKA 2PMHA 1FRKA 1LWCA 1MWYA 4JI8F 4Q2LA 5A0YB 2NQPA 1TZ0A 3A12A 2V94A 3D1HA 3SCJE 1RAGB 5HO4A 1N56A 1KD1T 3VR1A 2G2YA 2EBEA 5GMEA 1N0UA 2H4YB 4PCQA 1P1LA 3V81B 2C3OA 3GJQB 4YDXA 4KB7A 1K47A 3THPA 1KVJA 3PO4A 4IFYA 1WHXA 2CPHA 2I5JB 1NKEA 2R8JA 3C3LA 3VTIA 1VGYA 2J9CA 3AA9A 5HQMA 1IBMF 1VC6A 4DR6F 4KGZB 4KV8A 4ZVGA 1Q8BA 5KFVA 3A8JA 3SCKE 3PO5A 1S1TA 3HHLD 4P2MA 3RB3A 2WAQD 3P5BP 2NS1B 1GT8A 4L75A 4K7QA 4NA2A 1YJ9S 1NJIT 2VPZB 5E3PA 1Q4RA 2NXNA 2MXYA 2XCAA 4WFAQ 1FDNA 4RW7A 1SQFA 2GJ2A 2E9ZA 2VG5B 3P8BB 4DDFA 4LSNA 4ED2A 1HNZF 2BJ9A 2QV6A 2VV5A 1S6PB 3HKZD 3M6UA 5THWA 4AXJA 1NRKA 4KGVB 3QO9A 2B8PA 4LF5F 4ID5B 2FLOA 3G4SS 1JJCB 4ZHRA 2CQ2A 3KUHA 5L8RC 5F8HA 2GHVC 2M8HA 1H3DA 3HSZA 1IM6A 1RYRA 1HNXF 3O1LA 8ATCB 4DZ6A 4B3TJ 1T9UA 4KE5A 1RKJA 1PBUA 3BN4A 4QWAA 3QJJA 5J2QA 2OD4A 3NCPA 2XCPA 2CJBA 1PCAA 2GAGC 3P3DA 2V9WA 4DR7F 3RW6A 3G8TA 3N4WA 1HA1A 5J2NB 1TP7A 3TRGA 2E5LJ 1MSWD 2GMHA 4YP3A 4EU0A 1RU1A 2Y1RI 2VFRA 3FQKA 3VGTA 3N79A 2JEJA 1T7PA 1EX8A 1PBAA 1RHKB 3OR1A 4B9MA 5MLCV 4LREA 4OI0A 4IRCA 4F02A 1C1BA 3O8WA 3IC1A 5BXIA 3W9IA 3MECB 5AE2A 2G1DA 2DXEA 3DLEA 4KR0B 4F4XA 1NK4A 2FJWA 1RTIA 2H5EA 2E5LF 3CJ4A 4DV5J 2HHHF 3A3OB 2DNKA 1U0SA 3LUYA 3M05A 2RDJA 3HVAA 3OTBA 1WSRA 3TEHB 1O8BA 2HNZB 3M30B 3MAAB 4OYIA 5FLXY 1HBMB 3N6NA 4O4GB 1YIJS 5EN1A 4OHXA 2VU5A 3K5OA 4PYDA 4QIWD 1WOSA 5I42B 3S7RA 4Z7CA 2M3DA 5B0EA 1YKWA 1WEXA 2LEAA 5B0CA 4DV7F 4DR5F 4MFBB 4PQUB 2IVYA 3GR1A 4KAIA 4ECRA 2RAQA 2AGOA 4RBUA 2UXCF 3P5TL 2Q1LA 4J9PA 5KFYA 1U47A 2KFNA 3PM9A 5DM7Q 2HIYA 3KK3B 4U8VA 1FE4A 2F8MA 4YB5A 4X4QA 2WOMA 3Q2TC 1UW4A 3E3XA 2QMXA 1Q81T 1ITPA 2CQIA 1U45A 1HMVB 5MAOA 3QIDA 5KFQA 3GP9A 2PN6A 3W66A 5LSLA 2Y0SD 3BEGB 1RT7B 3FBFA 3ENQA 3K2YA 3MM8B 2LEPA 3P49B 3KTQA 2WB1D 4HHHA 3UFCX 2MKJA 3V4MA 1WKLA 2P2CB 2KRBA 2IYGA 3AD7C 3SQGA 4BCAA 1RT2B 4DN0A 4ES1A 4AXIA 2MQOA 4LJMA 2R7QA 3R3TA 2MZ1A 3K8VA 4CQ1A 1L3TA 4K4SA 3M8WA 3KLIB 4ZPBA 3HD1A 1R3NA 4RLEA 3VGUA 2HRTA 3SSQA 3RR8A 3TYTA 3DOMB 1K1SA 2QYCA 3FC9A 3G82B 5SZTA 2CG4A 4YFUA 2PT0A 1SIZA 5CCLA 2H65B 1DHMA 4U96A 2XMJA 2X3DA 2UVVA 2DITA 3T1HF 3KUGA 5HROA 1E6VA 4QYZK 2CJXB 1Y5LB 3JSBA 1U8SA 4B3MJ 3CJ2A 4ECZA 4QU7A 2WRMA 5T7LA 4OI1A 5H9FJ 1TAQA 2A10A 4C8MA 1RWMB 4ZMMA 1QAIA 3EZ5A 1AFIA 3H2LA 1U1KA 4LSZB 4FF2A 3TVZA 2YKNA 2IYIA 4NI2B 2EW9A 3EXCX 2RKIB 5T41A 3QJPA 2OFHX 1YG0A 1MU2A 3PCOB 5CHCB 5KG4A 4WXOA 4Z7YA 3I31A 1F3VA 4O3PA 2OPRA 3RAXA 3PIOQ 1WTBA 2BM1A 2PGCA 3CC7S 4YY3J 1T03A 1QM9A 3MFIA 4L6V3 1WORA 3TZWA 2XY7A 3POTB 3M9OB 2C2KB 1VJQA 1VBKA 2FTRA 1F6TA 1FE0A 1WC4A 3MOZA 4YB7A 2Q66A 2Z0GA 1RACB 1RK8A 2HWIA 4P6QA 1B0VA 1CSJA 1SXLA 4LF7F 4DV3J 2IM3A 5DG8A 5DG9A 7FDRA 1MWZA 3R7BB 3GIRA 3LP1A 2NXCA 3PRDA 2JEGA 2Z8QA 5C24B 1UVIA 2XLKA 5KG2A 3GYGA 1FCAA 1HW9A 2BUNA 2DNYA 4ZOSA 5KFPA 1CULB 2CDQA 2ZH2A 3NLCA 5DLGA 3NNAA 4H4OB 1S7HA 3B78A 3OJSA 3KLFB 1UZHA 4DV3F 1M5OC 4B9TA 2MMYA 3CD5A 2LDIA 1H7WA 3EZOA 2F1FA 4ZVRB 3RZAA 2KG1A 2ALZA 2IAJB 5C25B 1JKHB 4ZIWA 1N32J 1JKHA 1DURA 1BE4A 4EYHB 4O0IA 3BR9A 3AQOA 3PIPQ 3P96A 3F73A 1BC6A 2YPZA 3EMTA 2KXNB 1VC0A 1IKWA 3FSYA 2HAIA 1D8YA 2C2NA 4QYZJ 3V4IB 1DLOA 3B8HA 4OLOA 3CUNA 1JLEB 3L4BC 3G2XA 1TL1A 2V2QA 1TUVA 4W90B 2GC8A 1DQ8A 3PFEA 1YX2A 4Y00A 2E1PA 2VOPA 2BACA 2F8HA 4O3QA 1NH8A 4DV4F 4K4ZA 4LF4J 3I87A 3BN7A 2V69A 2DR6A 4RNFA 4U67Q 5IT9U 2DNMA 4JI4J 3MCOA 1Y00A 1CBKA 2A2CA 2G2ZA 4WP3A 3G6VA 1NJWA 2YWHA 2DGQA 1NK0A 1N4LA 4ALZA 4FPIA 4CTAB 3GIMA 5DJBA 3KG4A 1X4AA 4DFMA 4RW8A 1HBNB 1VQ6S 2B4UA 1S9EA 2P8IA 3T41A 3K58A 4B3SF 1C4AA 4KC5A 4IRKA 4RNNA 2KN4A 1QJHA 4Y28C 1U8WA 2DRDA 4USKA 5B0AA 1N36F 1GAOA 3IMQJ 1VRUB 2QT7A 3UD5A 2YKNB 5BJRA 2ASLA 2FLNA 2ROPA 1B4SA 2JHEA 3HKWA 1C0UA 3AHPA 4J7CA 4NA3A 4X66F 2DGSA 5ETLA 1UFLA 2AIRB 2KHDA 3I6PA 3M1VA 4J9RA 3L95X 4O3RA 5IFMA 4DEZA 3DLBA 3EVMA 1SJRA 4KIAA 4DFKA 3GTYX 1ZAXA 3W2WA 3CPWR 1YJNS 4JYAJ 2YX7A 1G6BA 2BKOA 3LTOA 4I2PA 4OYPA 5H9FK 2LDYA 3N28A 3H5YA 5KT5A 1F5CA 2MJNA 4OYZA 3KK1A 1LEOA 3CW2C 5CABA 4X65J 2HZVA 3NBPB 2AYMA 2YBVA 1FNOA 1RXOB 3PX4A 1NNDA 2Z58B 4OYXA 4FYYB 1HHTP 1RT2A 1DZ5A 5HMYA 4DV6F 5DETA 4IOCQ 3CC4S 3NOGA 4V1Ak 4WK1A 2I1RA 1RA6A 2WVDA 2GGPB 2HBZB 3NMRA 2AU0A 2RHQB 4C8NA 2KKHA 4ECSA 5CH7B 5D0HA 4YN3B 3OSPA 2BW7A 3HI9A 2E66A 3NP5A 5ETSA 3Q24A 2YWEA 3OVBA 4Y3CA 4DSFA 3KLGA 4NCBA 5CA5A 2ZH6A 4DR4F 2FD2A 1ZS6A 1T94A 5EWEA 4K0KJ 5DS7A 1GQEA 4ZJOA 3GJRB 2ASYA 3QWUA 4BLGA 1VQLS 1KP6A 1FI4A 5D0RA 9ATCB 1XNQF 2DTJA 4TU7A 4G65A 1RADB 1KQGB 4PABA 1NH7A 2FHOB 2I9SA 1SPBP 2EFPA 4G6VB 1YRTA 4F67A 4NL5A 1BMQB 1QY7A 4ED4A 1U7LA 3CCRS 1WEYA 4FPRA 2OPPA 4C6AA 1UTAA 2OPQB 2BE7D 1A7GE 2ZWOA 3BKTA 3TAMA 3VQSA 4QBUA 1QE1B 4QR0A 2OMLA 3WBZA 2DISA 5B09A 5KFHA 4IOAQ 3TUIC 3RBZA 5JMNA 3TO8A 5DDRC 3KLGB 1WACA 4UUXA 4HACB 1L5UA 1EETA 3R5CA 1W7WA 2BMBA 3SQOP 2XM3A 3DLHA 4NPOA 4BC9A 4E8UA 1BY9A 1FRJA 3IWXA 1NZ8A 2QL5B 5IQ6A 1TAUA 2VB6A 4AUKA 3OL9A 2A2DA 2GGPA 1WF2A 1MMLA 4GO7X 4OX6A 4P75A 2VG6A 5DQGA 3VALA 4H4KA 3QFWA 4GKKJ 4FF1A 3DHWC 2YQ3A 1F9EB 3VQTA 3ZC4A 2RIJA 1NSKL 4C0BA 3NBPA 2VIHA 5KFUA 3EICA 3V6KA 5HP1A 1XQIA 4PXBA 1PKUA 3NGRA 2AV5A 2HFZA 1X0PA 4A8QA 1MMDA 1T9WA 4PWUA 2FHJD 4DOZA 4GKKF 2UUWA 1WNEA 2FJBB 4PUOA 1FTRA 1KTQA 3KWMA 3KXDA 4ECYA 5JXSA 5L46A 4DQPA 4KO0A 4IR1A 3AD9C 3GYXB 5KFZA 3NNCA 1WG1A 4DSEA 5K20B 1U09A 3EE3A 1RSCA 1JLQB 1HW8A 1YITS 1TFWA 1VRUA 2CUYA 1XNRJ 4DFPA 1PAUB 2ZJRQ 1VRTA 1ZM9A 3M8ZA 1Q7YT 1PJ7A 1W2IA 2OGUA 5BR8F 1S0VA 2H1YA 2LKZA 1BD6A 2O67A 1NMEB 3NAIA 4DPWA 2CQDA 3BGUA 4WTYA 4M5KA 5G0RB 4CTAA 3ULHA 4B3RJ 1WG5A 2CVIA 3QBCA 2XWYA 1FKPB 2IPOB 2YNFB 1XTZA 1UFKA 2AF6A 2BXJA 4IH6A 1Q16B 2V63A 3FSXA 3K5MA 2E9RX 3W3SA 1RWKB 2B0GA 2M52A 2MYFA 4ECXA 2CNOB 3HPOA 3DRSB 2VFVA 1WJ9A 2VFUA 1ROFA 3VGSA 1ZZNA 3AT1B 3D6TB 3UNGC 1URNA 5F8IA 2HK3A 3R97A 2EPIA 1FJGF 3TJAA 1S77D 5AT1B 1NDCA 4EUVA 1S97A 3I0RA 1RAJA 2MHEA 1JLEA 1CJUB 3RGIA 2MLZA 3KLHB 4V19X 3PX0A 2RHSB 3LP2A 1IR0A 4OZ2A 4WXWA 4OZLA 4N41A 2O3DA 4Q45A 1KDNA 2GVDB 5ETTA 1VHIA 3KLEB 4Q8FA 3GFXA 2MGZB 2FPHX 2XMWA 3I5CA 1ZH5A 1N5QA 3TUPA 3BSCA 4PPZA 1TUWA 3GZ7A 2GHPA 2BM0A 2KZMA 5HSPA 3OR2A 1KHVA 3AA8A 1J5EJ 2HS0A 4LF8F 1TKZA 2H4WB 3R5DA 3HJFA 3RRHA 1FRLA 1BQXA 1RBLA 3H2UB 4FS1A 4C7QA 1GMVA 2O66A 2WVFA 2MY8A 3IN5A 1BHNA 2NCKL 3T5LA 3T1AA 1VISA 4NLUA 5SUHA 1RAIB 2FJXA 3HXMA 2F40A 3IFEA 3SSSA 4PG5A 5AXMA 3G71S 2YNGA 4LRDA 4OZ1A 4NLRA 1FDBA 1R31A 2HZCA 2B51A 2FHJA 4P2XA 2EK1A 1VLYA 4A48A 3CIZA 4HVZA 4F50A 1TMJA 2DHAA 2RKIA 2V8HA 2J6TA 2KZZA 2XLJA 2BR0A 1LW0B 2OFGX 4ZPVR 2B4VA 2PIIA 4WYWA 2HHXA 5K5MA 3U1NA 2CRLA 4YEAA 4ZCKA 1UEKA 3AY0A 2MKHA 5T7LB 2DGVA 1N34J 4JI7J 1O5JA 4CLKA 3ITHB 3MTJA 4QIGA 4RWWA 1IKYB 2AKWB 4ZP8A 5G4DA 4DX5A 3HT3A 1EARA 5J1EB 1XK8A 4DF8A 4ZITA 2BE9B 3DI6B 4HLBA 1G3OA 1URRA 5IC4B 1U1PA 3CCUS 2JRSA 2R7SA 1X4EA 5IC6B 3G82A 1LQ9A 3W1YC 5HMZA 2E5JA 2QX0A 1S76D 1G4CA 1WHVA 2J8AA 3MWBA 3JYTB 2PFDA 2WW8A 4HH0A 3ETOA 4LFBF 2MGZA 3I5AA 2OSQA 2FJAB 1PYTA 3RU0A 3SZ2A 3SQGB 1S1VB 2BJEA 3CSKA 4X4OA 1S10A 1ZPWX 1HWJA 2Y3YA 1FJ7A 4ZPWR 3D3CJ 3OLBA 4XPCA 3RYLA 3BO2A 3QFHA 1RT1A 4YB1P 4B3SJ 4UY8T 3PX6A 4HT7A 2RS2A 1DBDA 5E3QA 3TA2A 1S9FA 2HBRB 3N0VA 3MOJB 4OQJA 4XK8C 1VCTA 1LWFB 4GVLA 3EX7B 2VPWB 4DV5F 4NYPA 3IG1B 2UUCF 1TU0B 1SC4B 3DRRB 2DH8A 2V0NA 4C8YA 3CE8A 5HAOA 2WOMB 3K89A 2FVCA 2F3JA 5C5JA 1KRPA 3KK3A 1OSDA 1UA1A 4P72A 2MLYA 1XMQF 3I9V9 4HTIA 2WVBA 5HMWA 3TZZA 4M5HA 4PQUA 2AJ1A 1NK7A 2HQIA 3A8KA 2VQEF 1DTQB 2LQ9A 2QEXS 2ILZA 2C3UA 2RS8A 4DV0J 1BWVA 2CQ1A 3MTKA 4MK8A 1JJ2R 1VRTB 3R6LB 4DHVA 4ZLPA 3HHDA 3ZZPA 3SV4A 2J9DE 4JI0F 1QDUB 3MM6A 5HMXA 3QWPA 5E2QA 3ZZYA 3K8WA 1R27B 2KJWA 4DN9A 2AYBA 4OX7A 4OJ3A 5K8MA 1C1BB 2UV8G 1WG4A 3RG6A 4IFVB 4DPXA 4JI6F 4DMZA 3A1YG 3CDEA 1KQSR 1YTYA 1RWVB 2K8GA 4OZ3A 1RAAB 1CJKA 1X5PA 3D66A 2HFSA 1LW2A 2D3ZA 3V6DA 3RAQA 2WCXA 4K2JA 2ADCA 2HLUA 2VF3A 3GV7B 3P6YC 1PAEX 1N34F 3DLGA 2HURA 4CLZA 1AB8A 1LW0A 3CCQS 3U7JA 1K8AT 5LMNJ 1PYOB 1TL5A 1Y5IB 2QTWA 2Z57B 4TVAB 4I0WA 3BS9A 2W2MP 2DNRA 3TQ1A 3GIKA 1NB7A 3EDQB 2U1AA 1ICEB 2V4RA 4DR3J 2BQ3A 1JX4A 1MLAA 2GFFA 4RNOA 2F5GA 5H9EK 1RLCL 5HJYA 4L74A 1HQ2A 2NXUA 5I3QA 1RB0A 1UAWA 2GW8A 1SUQA 4OYBA 3N6MA 4M5GA 1TK0A 1R8PA 4WP9A 1Q1KA 2KT5A 2V68A 3TA0A 2MSSA 4I4BA 1KR4A 4DQQA 2AEMA 4UTGA 1OY9A 4HACA 5LMUF 4WBFA 2ATLA 2KI2A 4DR3F 4ED5A 1UKUA 3FBCA 3PDNA 2RB7A 3AJDA 4BDPA 5KFBA 4C0OC 4EO6A 2I2YA 1RT4A 2L9WA 5H9EJ 2GHWA 1SCJB 3Q8QB 2J9EA 2W7PA 2OPQA 1UCNA 3ISZA 4EFAC 4MJKA 2AJ2A 3GV5B 1JXEA 2RRBA 3AFGA 4I6WA 4TYAA 4F25A 4ED7A 1U1LA 2AX1A 4A8YA 4R0JA 4I64A 2HMIA 1RHRB 3OL7A 1S0OA 2ZVSA 4CT8A 3HVRA 2OAUA 4M95A 5DQIA 1FVQA 1SL2A 2RILA 1LNQA 3PYDA 1HI1A 3ET6B 2DXDA 3OVSA 2HK2A 3TWZA 3R5JB 3JQJA 1JMTA 3D0GE 1C0TB 2CXEA 4DL4A 3TW0A 1CJUA 3KLHA 1HBOB 1IKVA 3HD2A 3LO3A 3M9NB 4C8LA 1FHTA 1NKCA 1FJCA 1S5ZA 4Q5VA 4DV0F 2CZVC 1NUEA 3MD1A 4JV2A 1FD2A 2Q6BA 3GG0A 4AL6A 2H5IB 2EWHA 3CJ3A 1HARA 1QVFR 2BVZA 3CCSS 1AUSL 4YR0A 1H7XA 4EGLA 4X4VA 3T19A 1JLGB 4EBEA 1VS3A 2UUTA 3ADAC 2BJ3A 2D3O1 1CLFA 2FY8A 2B5JA 2HWTA 3B4MA 3HVTB 5BR8J 1V5IB 1NK5A 3M2VB 2YNFA 2D9OA 2UZAA 3LW5C 5KFOA 3KYLA 3VAJA 3UD3P 3PYFA 3GPAA 1H73A 1WDDA 2WTFA 2PE8A 5ADZA 1O0PA 2HS3A 5ETOA 3HFKA 2DR5A 3V5RA 5HVHA 3GYNA 2GV1A 3PFOA 1NB2A 1V6HA 2BQRA 3DCAA 3M4XA 2PSZA 2E1RA 3QLHA 1KKHA 1B70B 4JI7F 1NKBA 4QPXA 4AE5A 3N5BA 1H38A 2QJ3A 4KO0B 4P9SA 2DRAA 4C48A 1Z1ZA 1Q0NA 3MCMA 1HNVA 1IBLF 1IR1A 3GE9A 1U2RA 2ROGA 1FFSB 2CPJA 2IHR1 4DV2F 4K50A 5E5NA 4CRJA 3CCVS 4DZDA 4EI2A 2DIUA 2B9WA 2XSJB 2LCWA 4C9DA 5KOWA 2AJFE 1T8EA 1BQNB 3D1OA 4L73A 2VKRA 2AMCB 4NCGA 4RW8B 4CO4A 1JNZB 1R0CB 3RB0A 2ASJA 1XMQJ 2KFYA 1N36J 3H0PA 1BQMA 2W1BA 5DO2A 4U8YA 1X0FA 2DGUA 2XULA 4JI4F 2DXFA 3PJXA 2HYIB 3L3CA 2RNEA 3OXLA 3PKMA 2M4MA 2X1GA 2HVZA 2W2QP 3IR6B 1U1OA 1JLFB 2HAFA 2ZOGA 2XMAA 3G6ES 1JLGA 4OYAA 2MJUA 3WC0A 3HSJA 3GIJA 1VQ5S 2EFQA 4HTJA 5IWAF 3KG1A 4H4MA 1J5EF 1EETB 4DV7J 1TQLA 2DBBA 3C6TA 4JI0J 5KFSA 1G7CB 2OEMA 4J9SA 2UXCJ 2L48A 3FK4A 1P6TA 1FKAF 4MAKA 2IMWP 1I1GA 2B4PA 2IM1A 4FNIA 3UE2A 3ZTPA 4DR4J 3V4IA 1RHUB 3DC2A 1C0TA 1VMBA 2M70A 4M5NA 3JSMA 1N32F 2HPUA 3D54A 2B3TB 3CCJS 2JWNA 2FY1A 2OKQA 1XEZA 1WOPA 4WWSA 4RBTA 2ACMA 1SI9A 2C28A 1SJFA 2YNHA 5IM0A 4NXMF 2ZD1B 3BZQA 4N76A 3L09A 3EGWB 2CQBA 2HVEA 2EG1A 2W4DA 3KHHA 4LVNP 4FXVA 2HQ3A 4URGA 3CD6S 5GAHU 3S01A 4JUZA 4QR2A 2IJRA 3R6GB 5E3CA 3UN2A 4JOUA 4RPFA 3C16A 1HQEA 3ZZ0A 2LU2A 3B54A 2PEHA 2Y0BB 2ZUAA 4JI6J 3KDNA 2RQMA 4J37A 4L3KA 2WK4A 1VBZA 5LSRA 4GMKA 3LWLA 1R8HA 3NMAA 4F4YA 1VBXA 3V6JA 4F0MA 4I6AA 3FCWA 4HHJA 1V3RA 2RJZA 4Q2MA 5HVFA 1GTHA 3BDEA 4F26A 3FBBA 4Y34A 1EAYC 4MK7A 2R2RA 2CJQA 2Y8YA 3H4DA 3DDKA 3H8YA 2AGQA 4RW4A 1DARA 1HL6A 3ILJA 3OTOJ 2DGOA 2NLWA 1M1GA 5HK4A 4LBHA 2CQ0A 2ABYA 4NI2A 2XMVA 3D67A 2OPSB 1FO1A 4TKTA 3ZZOA 4DV1J 2WBRA 4DBQA 2R8KA 4K4WA 3JAMY 1LW2B 3RAMA 3V6DB 1ZPVA 3R8YA 1NJYA 4O44A 4I2PB 2MQ8A 4GVBA 1R8AA 2MHNA 1IJEB 3I55S 2ZJPQ 1N88A 5KFAA 3DFEA 2ERRA 2J76E 2BJ7A 4GC6A 3E51A 3NGTA 3NY0A 3THVA 1JNRB 4FYVB 2DR7A 1IWAA 4ZPAA 4OZ5A 2FJEB 5LSOA 3MM6B 4JP8A 2ZBRA 3C14B 3KLIA 4UUWA 2ZM6J 4MKBA 2MKSA 4NLXA 4CNYA 4C3MA 1HFEL 2VZ9A 4UQGA 1QUPA 2DCLA 1N54B 1IWGA 5KFRA 2C22A 4LR9A 1Y3KA 4LF9F 1R6YA 4TNOA 4RW4B 1X7VA 1F9HA 1AYEA 2H48B 3ELHA 2DJWA 1JIHA 5E3RA 3ISND 4C2MA 2G1HA 3KK2B 4J9UE 3X3UA 3Q8VA 1TMMA 5CYMB 2FUG9 2MZTA 2HBYB 2CJYB 2VPYB 4ZPTR 2HHUA 2ZNZA 1SH0A 1KONA 4FKXA 3OFFA 4OHWA 5C42B 5LT5A 5JVHQ 2UVUA 2LXUA 2NPIA 3IG1A 3TR5A 4I2QA 4ED0A 4CH0S 4K2XA 1U1QA 3CIMA 4XDCA 5JVGQ 3S1TA 1R0AA 3W5YA 5KFXA 7AT1B 2QMUB 2IRXA 1Y11A 4QJVA 3QPIA 1DLOB 1RT1B 3QYYA 3QIPB 2R8HA 3Q83A 4JBCA 4Y2KA 3OD2A 4ES3A 1U1MA 5I42A 2DYAA 1S1VA 4M63A 3TUZC 1L3VA 2QGFB 2IAJA 3M30A 1PC5A 5BYQA 1I94F 3RB6A 3E01B 3AOCA 3IBWA 4YOEA 2GIFA 2PEBA 4AD6A 2ZBIA 2R2TA 5KTQA 4LRBA 1VK3A 3UCUP 2DCUB 4F3QA 4DPYA 1B99A 5K9FA 2VC0A 4R5PA 1R8BA 2PMWA 3Q23A 5A76A 4IQXA 3I32A 5ETMA 5GAEI 4DL0C 3GJTB 4ILRA 3QRPA 4CH1A 2WONB 1Y0HA 1WC5A 4J9NA 3G8SA 1OQ3A 2DGTA 1RWNB 2M2BA 5DDQC 3QZ8A 1VQNS 2L9DA 5L1JA 4M5IA 3MAHA 2Z2MA 4CLLA 1WF0A 3D6HB 3IM8A 4LRCA 3W2VB 2YKAA 4FVCA 4C3KA 1GMWA 1T11A 5K8PA 4CIOA 3T9NA 4QR1A 3J81Y 2WSEC 4KGXB 2VDHA 5L38A 2W7AA 4J90A 3CJKB 3GV8B 2WSCC 5HANA 3ZTRA 2J6UA 3IA0A 2CPXA 1UJ4A 2XGQA 4ZVFA 3HCXA 4KQZA 4DQIA 1X5OA 2CZ4A 2XSJA 2HLTA 4WP8A 3BSOA 1Q86T 1LV5A 2GJIA 2N3OA 1FWPA 5D0GA 2LFVA 1BGXT 1APSA 1QD1A 1F2HA 3QT8A 3KOAA 5E7OB 2A3JA 4RW6B 3UO0A 4B3TF 1NU4A 2ILYA 1QSSA 2G4BA 5IWAJ 1S6PA 4RNHA 5DZ6A 1HNVB 4KKOB 2A18A 2VG5A 3WZ0A 4P52A 3W5XA 1VQKS 4USHA 4KHPF 3AJ1A 2DGXA 4DPTA 2CPYA 1RT5B 2Y1JA 3PW5A 4Y65A 4ZVQB 1HD0A 3VAIA 4OZ0A 4ZVTB 2R7VA 4J91A 2VFTA 1FRMA 1VOMA 2ZNYA 1ZBTA 3I5BA 4OZNA 3W63A 4DL6A 3IRWP 5KG7A 2HKEA 2AD9A 1YRXA 2IA6A 4MK9A 3DOMA 4C97A 4USJC 2CQCA 2MTLA 2I5JA 3SYZA 5FD1A 1JLBB 4M5DA 3DOKA 1B7FA 2B4OA 2VBZA 4F0KA 2WW4A 4X4NA 1NSPA 2HVIA 3JQMA 3M8PB 1RTDA 3NXZA 1SV5B 4Y2MA 3UR0A 1RZMA 3Q8RB 1XIQA 3LP2B 4WFYA 2JJ4D 4IH5A 1XN9A 1LWCB 1K9MT 2QE5A 4E98A 1OMSA 4URQU 3SSRA 3CO9A 3MMJA 2IM2A 3M8SA 3FJ2A 1XC9A 2VBWA 4J9QA 3HK2A 4M5MA 5B08A 1S1UA 4ZDNA 1QSYA 4RO0A 1TKXA 1GTEA 3HZGA 4F2SA 1HBOA 4CH7A 1P9YA 1N5SA 2YWFA 2AJ0A 5HQLA 3J81j 4DV6J 2I38A 4ZP7A 1NPPA 1FXLA 5CYQB 1TL7A 4QW8A 3PR4A 4MYTA 3MPUB 4ZN1A 3ET6A 2HWHA 1CG2A 1V3SA 4KGMA 4MFBA 4CNZA 1T05B 4JV1A 2E7VA 2IA0A 4BWJA 3G86A 4NEYA 2KG0A 1GK8A 3C15B 1A9NB 1RWUA 1VR6A 4DR5J 2KVIA 3PRBA 2ZHAA 2LU1A 3PVXA 4DX6A 5C7PA 1L3SA 3A3NB 4PQAA 2EFVA 2FZCB 2JDJA 3ZNUA 2W9CB 4U7UD 4W98A 3J7AN 1C2PA 2J9DA 1OY6A 4YMEA 1WC3A 1DAXA 2D41A 4OYOA 1HBUB 2V2ZA 3PW4A 1HNWF 4CO3A 4IG0B 1TK5A 3DLKA 3P45B 3CDWA 2E1CA 4JV5J 1NHKL 1S4FA 4K5SA 3AODA 2D74B 2V6AA 1GX5A 3NAHA 2QFIA 1HNZJ 2JLEA 1SUQB 3QSIA 3DKDA 2YKQA 4A8OA 2UVWA 1AROP 4AL5A 1TTHB 4WCEQ 5HP1B 1I6JA 4B9LA 2YWWA 4JI1J 2VDIA 3CCTA 4C8ZA 3OTCA 1C1CA 4NOHA 2KH9A 1JLAA 3EPGA 5ETRA 1KN6A 1UVMA 4N77A 2JVRA 4WZQA 2J7UA 2DIVA 1WI6A 3U27A 1FRHA 4M1KA 4YR3A 3PACA 2FB0A 2RU3A 3SV3A 1M1KT 3D4JA 1VRQC 1ZA1B 3K59A 1NAQA 3HSDA 1KSPA 1X4DA 3UI3A 2KJVA 4FBUA 1B0PA 2XMMA 4LBIA 4LSNB 2PMZD 2VASA 3FRZA 5KT7A 1BUXA 1U6FA 3AOBA 3C8YA 1R6VA 2NXJA 2CADA 4LSLA 5A6PA 3T9ZA 4C0HA 3PHTA 5DZ7A 1FT8A 3C46A 1N33J 5AJ3F 2QN6B 3TP2A 1RQ0A 5L1IA 3LF0A 2OPPB 3MM9B 4Y0FA 4H4KC 2QL7B 1WD6A 4C3LA 4QWDA 1GFWB 6FDRA 1S1XA 4OJHA 1XMOF 4RW9B 4NLSA 2W9BB 4USTA 1YRUA 3BGFA 1TV6B 3MGJA 3ZTQA 3KG0A 4LT6A 2R3VA 4DV1F 3BH6B 4FVMA 4TY9A 1KEKA 4ILMA 4PPDA 4DS5A 5CYQA 1TVRA 2YTCA 1D9AA 3QZ7A 1NPRA 4NMLA 4PXDA 4Q44A 1RT3B 3Q8PB 2KDOA 1R89A 1RWWB 3RW7A 2R7RA 5F8NA 3VAKA 5FDLB 3W61A 4NZ0A 3V2UC 4DL3A 2XB2D 1QUVA 1U48A 1F2GA 1YJ7A 3CULA 2J0QD 2IDEA 3MURP 3H20A 1UWAA 2YY3A 3MPVA 4DX8H 2ZDPA 2ZH7A 1HR0J 2NZ4A 1REGX 1ELOA 4LIRA 3IRXB 3C2PA 1FTCA 2ZBCA 1RT6B 1CQNA 3M8QB 3NS7B 3I4PA 1WTFA 3ILLA 2YNIA 1S59A 4TY8B 3U02A 2XC9A 3BQ0A 4KHPJ 1K44A 2GQQA 1LFWA 1FFWB 2K2PA 2VBYA 3CB4A 2A1BA 3OHBA 3KJVA 4WFXA 3I9ZA 4ANDA 2QA4G 1Z2ZA 1RTHA 4ED8A 2R42A 1GXTA 3FMWA 3MUVP 2DO0A 4ZVHA 2BANB 5GAGU 5KOXA 3KHRA 2ZJQQ 3PG9A 2OMOA 2CJAA 3DM2A 1DTTB 3DI6A 2DNOA 2ZBPA 3MM5B 4NASA 5AXKA 1EB0A 1MN7A 3PW0A 2C3PA 3OBIA 1M1HA 3T1HJ 2UVRA 3W2WB 5FIIA 4E0DA 1FRIA 2X1BA 2HQFA 2V9KA 4M5JA 4A47A 4CWBA 4IDKB 4ED3A 2J7KA 1YSJA 3TZXA 4YY3F 3E2EA 3LWMA 3MD3A 2FZGB 3K0JA 1XR6A 1XMBA 2YKPA 4R25A 4OI2A 5T14A 1CJTB 1A0OB 2GMLA 4PAAA 3VVTA 4OX9F 4TN2A 1I3OB 1KHWA 1CJVB 2DKOB 2RRAA 1AXQA 4OV1A 5CYJA 1E6YA 1S9GA 1E6YB 1S9GB 2OJ3A 4CLWA 1H2UX 1RCOB 2HIQA 1LK5A 3GSIA 4OJ1A 3CJKA 3KHLA 2OH2A 3BREA 4B9SA 1RWXB 4K4XA 1S6QA 1O51A 2V34A 2YKOA 3VGVA 3MR3A 3MFHA 2HHSA 1QAYA 1T9YA 1U25A 2L08A 1F5AA 2QA2A 2V4JA 3JSRA 3ONQA 4K8RA 4NZ7A 5GVQA 2VL1A 4ZKAA 3M9MB 1Q8IA 1NSAA 2F7VA 3J7ZT 3GONA 3MR2A 4X66J 2DH7A 3UVJA 3IWNC 3MEDA 3Q86A 2WONA 4DUZF 2CPEA 3M2UB 1RHJB 3IXQA 2M5YA 5I3UA 3BSAA 4LF7J 1TKZB 2BOAA 4CLSA 3LH2S 1IN0A 4NRUA 4FYDA 2G9OA 2YWGA 3IWLA 2BANA 3SI8A 2ZZMA 3UDEA 2QO3A 3WIVA 2B6AB 4M8LA 2DHSA 4NLOA 2F8EX 1VBYA 4HKQA 3NWGA 4USWA 3F0NA 1KQKA 2XZWA 5CD4A 4A8KA 2HQCA 4JI5F 2CNNB 2R7OA 1J2VA 3IS9A 3ZTSA 2F63A 3PEJA 4Y2AA 4OLPA 1S1WB 3M8QA 2AWZA 1QTNB 2R9LA 4B9VA 2J5AA 1JXVA 2QMWA 4QQBA 1RHMB 4OMFG 2DPJA 3NGDA 4A8FA 4K59A 4A8XA 4R8UA 3R7NB 2DY9A 3HFVA 4IRDA 4DXLA 4NX9A 3RJMB 1ZM3A 1WSVA 2HHPA 5CZVA 3G9CA 1SC6A 3ICLA 3DXBA 2DHXA 1CS4A 2K06A 3LP1B 2XS5A 4ELTA 4OFZA 4O0NA 4NA1A 1SIWB 3GCWP 4CO5A 5CXTA 4RJVA 3DGPB 3KJNB 2WSFC 4WJBA 4O3NA 4C98A 4KFBA 4WU3A 4ECUA 2DR8A 4LF4F 3C6UB 3U1LA 4PKDB 2MQQA 4PWDB 2BDPA 3OUYB 4X62F 4CO0A 4QOTA 3DYAA 3LALA 1NBEB 1Y5NB 3DOLA 3POTA 3CCES 2X3GA 4A8MP 5F9LA 5GAGI 1HNXJ 4XAKA 3JTNA 2D3UA 1YZ6A 5B0BA 2CZ9A 3T6JA 2QLXA 5CZXA 1NK9A 1OO0B 2EG2A 2V67A 3FEZA 4UZCA 2G0CA 1HQUA 2JSXA 3MM9A 2FYXA 4ID8A 4FYXB 3W9JA 4FS2A 5J2MA 4JI1F 5M2UA 3L9ZA 5DDPC 2CPDA 3LAKA 3RR7A 2KB2A 2MZSA 5FJ4A 4LSLB 1Q5YA 4J9KA 3MCNA 5A8KA 1NK6A 1K0VA 2R7WA 1AA1B 3LA0A 3DDNA 2K3KA 1RGVA 2VPXB 1UVNA 2ROEA 1E6VB 3CC2S 2RQKA 2HHTA 3PZPA 2CG8A 1JB0C 3KDOA 4JYAF 2FVSA 3ETMA 1RP5A 4NLQA 5E3AA 2CDRB 3VAGA 4U6PA 5EHHA 2IRUA 2OPSA 1GXLA 1U0HA 4P2FA 1CQMA 3JSYA 3R1HA 2POKA 2XHCA 4OI6A 2E5IA 2BBEA 4ECWA 1KFDA 1TUGB 1FA0A 1UVKA 2M9KA 2DRBA 1HWKA 1F0XA 4KBIA 3J80Y 4JV0A 3FSIA 2M7SA 2RVJA 3BGRB 1VFJA 2WBMA 3L7OA 3EGNA 3GFZA 3QNWB 3J7Z5 3JB9k 1UA0A 2GAHC 2LA4A 4IYQA 4USIA 3EYZA 4KT0C 4I56A 4YHHF 4DR2J 4LFCJ 1VLOA 2L9NA 2LA6A 4I7FB 4KYZA 2RSQA 4ZVEA 1PO6A 4XPEA 2XZTB 3CWJA 3GLJA 3TQEA 1SH2A 4PG4A 3CT9A 4LR8A 2HNYB 2HNDB 4JI2J 3UW1A 8AT1B 5CAAA 5B0GA 3D6MB 1QE1A 1N6QA 2K7JA 1YK9A 5FLXU 3K17A 4AL7A 3H98A 2W9CA 4B9NA 1RAOA 2NUHA 5K8NA 1MROB 3DRYA 2XMTA 4G1QB 1YBUA 2RMLA 2JC0A 3BF4A 4GC7A 4DSKA 4JI3F 5KFTA 3J7YU 3TAPA 2G0IA 2ZD1A 4EZ6A 2Z2YB 3PJWA 3KNGA 1T05A 2COLA 3GCXP 1RWPB 2ADBA 1HBMA 3K57A 3PTWA 4TLQA 2DPIA 3MZIA 1FERA 1FJGJ 3R2DJ 4PRFA 4IR9A 2CWXA 2GO9A 4Y6IA 5IOLA 2CQ4A 3QSYB 4XDDA 4USVA 2B7BB 1PJ5A 4YDDB 3DLEB 1N8RT 4L72B 5E0OA 3EM1A 4ZLNA 2W01A 1U1RA 3RBEA 1IVZA 1U4BA 1RUSA 4B02A 5DQHA 3C19A 4ETXA 1SQEA 2KVQE 3FUYA 4CZCA 5RUBA 5IT0A 1FWKA 2MDAA 3O3LA 5AE1A 5LOQA 2EKYA 3MMBB 4EWTA 4LF1A 3DRPA 5IS2A 2P6TA 3BGLA 3NNHA 4BS2A 1SV5A 3D5MA 4AFFA 2ASDA 3GSDA 1IBMJ 2X7IA 3NRBA 1BQMB 5BYRA 1ZTWA 2EVZA 3B82A 1SKUB 3MEKA 5F41A 1QAJA 4L76A 1ZTTA 1EP4A 2F4FA 2KM8C 3NGSA 1F3FA 2YWKA 1HPZB 2BJDA 2GMJA 3FFIA 3H42A 1KOOA 4X84A 1PILA 2J0XA 4I1TA 3WDOA 4ZCMA 4ID5A 2W8KA 4IO9Q 4PYAA 2VQFJ 2WVCA 5LMUJ 1SJ3P 4WE1B 4DSIA 1UP1A 1ZAWA 2N3LA 2MLXA 3QO9B 4A4JA 3J7YI 3AXMA 3OL6A 3T5KA 3EGZA 4C4WA 4U7CA 3OV7A 2KM8B 4O4RA 5HATA 4Q0BB 4OX8A 2JLFA 2RT3A 4IQMA 4KKOA 4L3NA 4Q0BA 1R7IA 5ETQA 3FEXB 4X2BA 4RW6A 5ETNA 3NS5A 3QLHB 2C2DA 1KBRA 3EZUA 1S1TB 5DDOC 2A6OA 2KTQA 3DNCA 2CQHA 2DNPA 2HQGA 4FYWB 1JQGA 1OYEA 3FRYA 2LLZA 5KFMA 4N7TA 2Y8WA 1PGZA 4H54A 3W7BA 2ZZNA 1KNZA 1HBNA 5KFNA 2G13A 5LXRA 3QQCD 1Q95G 2XI3A 1V9OA 3W65A 3PKYA 1UVLA 5C2GA 5KFCA 2J6SA 4F04B 5D8HB 2RF2B 6AT1B 2FLLA 5J1PA 3HVTA 1SB6A 1CPZA 5F9NA 2GNKA 4RX6A 3DHXA 2QZ8A 3CXCR 3W9HA 2VKZG 3SEOA 5A8RB 5A0YA 4DV2J 2JX2A 1AZSA 1NCLA 1CC7A 4KRWA 3FZBA 4ANEA 2HHQA 1VQYA 2IC3A 4NMXA 3HT0A 2Z2LA 3TJ9A 2ZH1A 2B7CB 3CF5Q 5KG6A 1IBLJ 2C3YA 3HHLB 3P4UB 4IO1A 1FRXA 4NLDA 2HFVA 4I6YA 1N5TA 3QGHA 5DGBA 1NPKA 1TL1B 1LKZA 2KXFA 2ZBQA 5JJBA 3Q2SC 5AXNA 1M5SA 2QRRA 3IAM9 4X62J 3T1YJ 1HNIB 3D6FB 3CJSA 3PW7A 3E01A 2W4PA 3AAWB 3F44A 4HH1A 4DJBA 3MEEA 1A6LA 1NJXA 2C2EA 2HG4A 1F9FA 2MB0B 2LYVA 1XJWB 3T3FA 2VBXA 2CAJA 2W2PP 1P9QC 4H4OA 4ZP9A 1MROA 4G1QA 4K4YA 1CULA 2KFZA 4J9VA 2HVHA 2IVFB 5I4MA 5GMKa 1FFGB 4JI8J 3O2IA 1S72S 2NREA 1QTMA 3NGKA 4I2QB 2FDNA 2AYEA 1N6QB 2AP6A 5KT3A 2HNYA 4A8WA 2EK6A 5C42A 2B9XA 2JOQA 1IM4A 3CJ0A 1KC8T 2BOPA 4KH1B 3J81U 1RWOB 4CO1A 4UOHA 4UW2A 1Q8LA 4S0MA 3NL0A 3X1LB 3WQPA 3KK2A 2O1PA 1K0TA 1UETA 3BBBA 3SFGA 5EUHA 1EQ0A 3HF5A 4MTPA 5EX3A 2OPRB 3RRKA 1RJJA 2VQEJ 3BR8A 4ECTA 3M2RA 1GMWD 4ICLB 3MHYA 3TEGA 3RTVA 3KMSA 2XI2A 4K4TA 3C14A 3R7SB 1VDHA 3UNYA 1T9VA 4B3RF 2DNQA 4DR1J 4CM2A 2XYPB 2HGLA 4MKAA 4D3HA 1VQSA 3EVWA 3ZZZA 4DQSA 3IR5B 5H1SV 3VV2B 4PG6A 4TU9A 3H25A 4DQRA 1HI8A 3DLLQ 2C1EB 1SJQA 4LF9J 4OYMA 4DR1F 4U7UK 3M32A 2XLIA 2P9GA 4OV6A 4ETZA 4DUYF 2OSRA 4GVBB 1LWEB 3R5GA 4X4SA 2DB1A 4UY85 4OI4A 3AD8C 3WIUA 3H5UA 4YS2A 5B0FA 3QRQA 3G87A 3GG1A 3QGPA 3LOUA 5A8KB 3HLUA 4YR2A 2EBGA 3RRGA 2XYHB 3CDAA 3OSNA 2MY7A 2RQCA 3HDSA 2IVMA 1V3ZA 2BJ1A 3QAUA 3QT6A 5J2MB 4ICLA 2VG7A 5D3GB 2YQ0A 3EGVA 4B17A 3I56S 1S79A 1DTQA 1UPPA 2HQDA 2N4DA 3JQKA 2R7XA 3W8GA 1SKRA 4ZP6A 4DPOA 4OZJA 4ER8A 3V6HA 3MM8A 3T1YF 2Q6CA 1FJEB 2R7UA 1Z4UA 4ZLJA 1N48A 2MZJA 4DF4A 2BZ2A 1VI7A 3M6VA 4Q7AA 4NCAA 1T02A 3EXYA 5KG0A 1ZM4A 1NM2A 1OYDA 1VIOA 2D7SA 2YX1A 4FDFA 1Z2LA 1YJVA 3DGPA 4IG3A 4J5OA 4DUTA 1WF1A 3UCZP 3DRRA 3TVKA 2VH7A 1UEUA 2BKPA 2DO4A 4K5RA 2OLWA 3CDUA 1WWHA 1NZAA 3MPYA 2CA9A 3U1MA 1H0HB 2X51A 3H7HB 4NLPA 2DNGA 4CLTA 3GIIA 2V2VA 2BABA 2EFNA 3NOCA 4I69A 3W8PA 4D3GA 4BC7A 1LXNA 2XS7A 1OWXA 3MXHP 2YNHB 4N47A 2JC1A 4CLYA 4Q43A 1UWBB 4O4GA 2F9JA 3OFEA 2RDDA 4WZMA 5KFKA 4WIIA 3JSMB 1ZYQA 1ZA2B 4MKVA 1MG7A 2VICA 4F36A 1TKTB 2CFXA 2CNLB 4WK3A 2ZC3A 2HFNA 1O6XA 1S4EA 5D78A 4F4AA 5A8WB 3TZYA 3HP6A 3C6TB 5KG1A 2RUSA 2Z56B 2GX8A 4FKYA 1VQ8S 2FVPA 4H4MB 1XR5A 2IC3B 4ILLA 2GIRA 1AZSB 1SC3B 4RZRA 2IMOA 1JLFA 4USUA 2GIQA 2B56A 1IBKJ 1XNQJ 2D1CA 1TL4A 4CLUA 5J2NA 2F4VJ 3QJLA 5KAKA 3HHKA 1SKWA 2C2MB 4NXMJ 2Z30B 3BYRA 2RF2A 3BSNA 1Y9OA 3HX9A 3Q89A 2QSWA 5GAHI 4RUBA 5EX0A 5I3PA 5J2QB 1I94J 1NO8A 5ETVA 4ZPCA 2E7XA 1RAEB 1V5VA 3ZFVA 1S6UA 2W9AA 1NSQA 2FVRA 1BQNA 1GH8A 3FGVA 1GMUA 4NEZA 4QIEA 2BE2B 2MQLA 2XTJP 1B7YB 1JWWA 2P5VA 4ZJLA 2DEJA 3EUNA 2DD8S 4ZHRB 1N5YA 4QW9A 4J9MA 2DK2A 4ENOA 2FHKA 1SVDA 2KT2A 4URSA 3G6YA 4QU6A 2CJKA 4LQ9A 2I0XA 4MIBA 1C4CA 3A3PB 4WFNQ 2HRUA 2RE1A 2EC2A 4WFBQ 3UWTA 4DL2A 3I0SA 4IDKA 4RW7B 2KO1A 5HLFA 2LQJA 3CTRA 3HZEA 3L7PA 4RR5A 4X4TA 1NDLA 4DR6J 1VYAA 4KSEB 1MN9A 1JLCA 1Q79A 1S57A 3HSGA 3WHIA 3HHLC 2AQ4A 2DEIA 4F4ZA 1Q78A 4KY3A 2MKYA 5EDWA 2ZKTA 2OIHA 2F9DA 2K7KA 4ERDA 3QRRA 4K4VA 2IIHA 4MH8A 5DLFA 2CVEA 4IFYB 4N56A 2ALYB 1FEHA 1T0TV 1WC0A 2OUGA 2GVDA 3M2VA 3OFHA 3FKBA 4HI2A 3UN5A 3IRXA 3DRPB 4TXSA 1FX2A 1IKXA 2HW3A 2I8EA 2XMUA 2F65A 4UOGA 3ISNC 1FEEA 1FDDA 4HHUA 4ZVSB 2KXHA 3IM9A 3FEYB 2AEJA 3H5SA 4HR2A 4X4RA 1X4BA 3BGOP 3G96A 4AT1B 1OPZA 1REVA 5FDLA 2IJFA 2UV8A 2M8DB 1IKVB 4MMOA 1NDPA 3CEDA 3DRSA 1IKXB 1BLUA 3BKFA 4CI0B 3MR6A 1TVRB 2HS4A 1RAHB 1DJ0A 3CCWA 2YH0A 3MEGB 3WX4A 5IV4A 3KMQA 3OXFA 2NPFA 2Q79A 1FKPA 1HWIA 3OFGA 1RBAA 2V2KA 5LL6d 4USMA 5KFWA 4QWEA 2VJVA 2UUAF 1L3UA 2N7CA 4LF6F 4G1IA 1F5BA 3DGVA 1PSDA 2VA3A 2XYGB 1OSCA 4X64F 1YLXA 3DMJB 4KHMA 2XY5A 2R7TA 2HMIB 1U49A 1UL3A 4HI1A 5D15A 4ZLLA 2ACYA 2QFJA 3CMES 2P9EA 1F60B 2ZKUA 3W5ZA 3EJMA 3PR5B 2Z2ZA 2BX6A 2H9ZA 2EKNA 3D1QA 2DNZA 3CD0A 3I96A 4EBCA 1D9DA 1SH3A 2UP1A 2AHOB 2LXIA 1R43A 4QZVB 1DQ9A 1OY8A 1RTZA 4KFBB 4BWMA 1N33F 4OJGA 3NWRA 1FNMA 4RKUC 3ZO7A 2YX4A 1J5OA 4R0EA 1ZETA 3L7UA 1EHWA 1UJ6A 2BW2A 3OLAA 2FLPA 2UUBF 4F3OA 1UJ5A 4Z2XA 4GRSA 2XO7A 3UD4P 1LWXA 2MQNA 2YKMB 2BYCA 3MMCB 1ZAVA 3OTDA 1FNXH 2L3MA 1FKOA 4NYOA 1TR0A 2QIFA 3MPDA 3DDIA 1QLNA 3CJRA 1Y7PA 1I51B 2QLWA 2V50A 2DY1A 2LXFA 1U6ZA 2IBOA 1HI0P 1OJ4A 3PW2A 2PI5A 1S6OA 2FZKB 2VC1A 1JLAB 3UR3C 2WZ1A 2GA7A 4FNHA 3Q0AA 2HZAA 2R2UA 1ULRA 4DL5A 2X1FA 1FK9A 1RU2A 1U0HB 3DLGB 2VODA 2DVIA 3PY8A 3CJTA 3BO3A 2BQUA 4W4MA 3NCRA 1RTJB 2EI5A 4UQTA 4FZVA 1X31C 2CJ9A 1VHFA 1Y4ZB 3KUEA 4UOFA 4B9UA 4FF4A 4PG8A 2AX0A 2HFUA 5GADI 4DCPB 5A8WA 1J5OB 2O01C 4XTTA 1HBUA 5EWGA 3OJUA 1S49A 1MWQA 2N7YA 4HYKA 5IT4A 3M6WA 2RRNA 2RQ4A 5KG3A 1HYSA 5KFDA 2IFXA 4TLRA 2ZUGA 4F4KA 3CCMS 3PYGA 5KT2A 4QIFA 3OXGA 3R2CJ 2P9CA 5KFEA 4XIUA 1YJWS 3PRVA 2BJ8A 3QT7A 4Y2IA 3M8RA 4EK2A 2ZFHA 5F3ZA 4FF3A 2DH9A 2RD5C 3J7A1 1GX6A 2VJUA 2DHHA 4WFZA 4DI6A 4DG1A 4F2RA 3N01A 4ZA1A 3PXGa 1U02A 3SCIE 1U2FA 2V8VA 3MEGA 4PEOA 5J1NA 3CCZA 3D68A 3CMAS 2E29A 4OI3A 5M2RA 5U47A 1Y10A 1CVJA 3PNIA 4CO2A 3T5HA 2MEWA 2OI2A 3OPKA 1REVB 3ILOA 3LP0B 3OTEA 4CYUB 5E33A 3K5LA 1H2VZ 1CS4B 4UF4A 2Y1IA 1LWFA 2V8GA 2RUGA 4FN5A 3PHEA 3OL8A 4PWWA 3EWGA 4AQYF 2UXBF 1Q53A 5K14A 3BPDA 1LOUA 4DL7A 3AOAA 2LEBA 3VZIA 1Y3JA 1VQPS 2HRYA 2APOA 5K8OA 1X60A 2AT1B 5IZHA 3ZZRA 1RTDB 1UFWA 2BKNA 2QLJB 4KHRA 2ZH3A 3H40A 2VG7B 3VAHA 1W2BR 1R8CA 1KTVA 4E2FB 2KT3A 3DOKB 2NXEA 1D9FA 3PYEA 4B3OA 1SL1A 3MR7A 3N6LA 3MUMP 4C8OA 1YHQS 5LXYA 3KK1B 4LFAF 2ZH8A 2UXDJ 3CCLS 4KH0B 3CVKA 3DLJA 5KT4A 3FCVA 3W62A 1WHWA 2KHCA 5J1EA 5I3UB 1RT5A 2QL9B 3JS9A 4NZ6A 3M2UA 4NLYA 4P10A 2XGPA 2J7WA 4LFAJ 2UXDF 3ITHA 4A46A 4BHQA 5IV3A 3HULA 1X9SA 4QCLA 1C0UB 1WI8A 3W60A 2C2OB 2EEYA 1UMJA 4ELUA 1IQZA 2G2OA 2SXLA 4U95A 1D09B 5KFJA 1S6QB 4LF8J 1N5YB 3ENVA 1RYSA 2MZQA 2W4CA 1T3OA 3SXLA 2VQFF 1GEHA 2B43A 3N5FA 1UZDA 3QGIA 3KLVA 2W2NP 1YQHA 1CJVA 1YVFA 1LXJA 2A0FB 2YNGB 2LQBA 4OHVA 2ZOMA 1CJTA 3NGUA 1YWXA 3BKUA 4DSJA 4P7VA 1RLDA 2CPZA 2CIMA 3F41A 1HR0F 3W2VA 3BBFA 2NR0A 4DR7J 2ZEJA 3SDEA 3E8OA 2I6WA 1Q8KA 2N4CA 4DPUA 4RL1A 3NS6A 1FX4A 3ZXWA 3IBCB 2W8LA 3D9BA 2MKKA 1KS2A 1X8DA 2FC8A 2GQ2A 7FD1A 2E5GA 2DHGA 1UEVA 3MMAB 3A13A 4F8RA 3DM2B 4ZN3A 4JI3J 4NXNJ 2K1RA 1TKTA 1WOOA 3RB4A 1KQFB 2PA3A 3HJVA 1AUDA 4G3IA 2BRKA 1XERA 2G0JA 1RTHB 2KYXA 2UUAJ 2J0SD 2JL9A 2RH3A 2C42A 1L3KA 2N82B 3SFUA 3KLEA 5KFGA 3BM7A 2D69A 5C25A 3SMZA 4NLVA 3TUJC 4EYIB 1RT6A 3KLFA 3K7RA 2J0WA 1DQAA 1EJ7L 2NYHA 3I0RB 3ZNJ1 1IJFB 5AE3A 2GQCA 3MMAA 1S0MA 4ZS6A 1YDLA 5EGYA 5AXLA 2E1AA 5C24A 1SKSA 4DFJA 1M5PC 1CEZA 2V5HG 3VAFA 2HVDA 2U2FA 2KRRA 3DXSX 4DLGA 3TJ8A 1NJZA 1FD8A 4IG3B 2FGCA 4BBYA 4MKYA 4HL9A 4DU8A 3THTA 3CMQA 5D6GA 1H2TZ 2XHWA 3MUTP 3B4DA 2A6MA 3MM7B 3QMQA 4CLPA 2XNRA 3UDLA 4DUZJ 3Q22A 4KTQA 2D3OR 2RDIA 3A4TA 2GCFA 2YVSA 5G0RA 4RW9A 2AZ1A 1T03B 2JNJA 4DWIA 2AW0A 1S1XB 2LVWA 1WKJA 2CQGA 3CD7A 2GVZA 1X4CA 3GU0A 1VQ7S 1D1UA 3DU5A 1WHYA 2HHWA 2J8SA 4ZCLA 2MKIA 3ENAA 4WIQA 4TQRA 1QVGR 1RABB 1JLQA 3FVYA 4PXEA 4NYZA 4LRAA 5L1LA 3D2WA 2YQ1A 5DRKA 3IGVA 4OYWA 4LIWA 2ZHOA 5L1KA 1IXKA 2JFDA 4PUOB 3LAMA 1S7IA 1U26A 1U6BA 3D0HE 5DGAA 1EZZB 2WHOA 4WE1A 1X9MA 4O44B 2PFFB 3VF0B 2HHVA 1HKAA 2C2ZB 2WVEA 4UZBA 4EO8A 3BO4A 1HPZA 1ZOTA 3KFWX 1EP4B 3Q8UA 2R4FA 2NSBA 1N5VA 2NZCA 3FBEA 3JTOA 1T9TA 3NKYA 1RA7A 2PO4A 4B3OB 4WF9Q 3OVAA 1C1CB 4TYBA 1VK8A 5KFFA 5F3TA 1HHSA 1P27B 1X4GA 2VG6B 5EWFA 3QATA 1NHUA 5KT6A 1YJTA 3MMBA 4YB6A 3GMGA 3DU6A 3KJQB 3UDCA 1WUUA 4LQ3A 4GO5X 1RT7A 4LFBJ 2EFOA 1B3TA 3AB2B 4OX9J 1H74A 4DCJB 3HHEA 2M88A 4WKRA 1HMVA 4KGKA 4FBTA 3KKFA 3FDSA 3H90A 4ATNA 3HMJG 3LP0A 2R8GA 5GMDA 3MDFA 1S48A 2DNHA 2DNLA 3IO1A 5GADU 4AQYJ 1UVJA 3C16B 5L9XA 5L9NA 3LANA 3TAMB 1WDTA 3S8SA 4DS4A 3SCLE 1YI2S 1AFJA 1SJ4P 2LQ8A 4M94A 4FXDA 2FC9A 3DRXA 4V19J 2VD3A 4DG1B 3C66A 2FIUA 3MR5A 4I67A 1LK7A 2BRLA 2YXLA 4PZVA 3UN3A 3H4BA 2WB4A 1N0VC 1NHVA 3OHAA 2VA2A 1UPMB 2EFGA 3SIPB 3GILA 1M0SA 4DU7A 5F8GA 3MAAA 1NEEA 3CJ5A 3RUBL 3VVUA 3GFYA 1JK9B 4ED6A 4JI2F 1KWMA 1S12A 1RTIB 2MZRA 4B08A 1GXUA 1RAFB 2ZWPA 2MSTA 4Z37A 6FD1A 2XS2A 1HYSB 1FF2A 1RE1B 4TQSA 4M5LA 1S1UB 4OHZA 2LECA 3BH7B 3HO1A 3OR1B 3HHLA 4I7FA 1RCXB 1HNWJ 5A2QU 2QG9B 4F7VA 2JEIA 2FJDB 4WPAA 5CCMA 1WC6A 2LQ5A 5LJ3Y 5A8RA 2Q3PA 3AH6A 1RKIA 4DX7A 2C2RA 1ZZFA 1P1TA 2HEKA 2IRYA 5ETKA 1UW9A 2OO4A 1T9XA 4IKAA 1AT1B 2CPFA 3LPYA 3M6XA 4P73A 2OTLS 1HWLA 1G2EA 3M8PA 4HDHA 1ACMB 4CM0A 5B0DA 4QWCA 1DRZA 4ZIVA 2JZ5A 3VAMA 2VOOA 3ILIA 1G1XA 3R27A 4M5DB 3BQ2A 3BPSP 4NCGB 1JLBA 4QYRA 4N5SA 4J9OA 2B9YA 4ED1A 2K3IA 5F8LA 1FKOB 2ZHBA 4QIVA 1SQGA 4EMDA 3MMCA 2V8PA 2HGMA 2IJNA 4LRFA 2BV3A 5D4NA 2W7OA 3EDRB 4DUYJ 4DLEA 2KU7A 3D0IE 2ZH5A 1S0NA 1D8ZA 3T5JA 3CJQA 4RU2A 4MT1A 3IR7B 4DV4J 2FGOA 3Q8SB 4RWXA 2AJQA 1VIXA 3M1VB 1D3WA 3CJ8A 3BV8A 5A2QY 2XWXA 1F1BB 1I5OB 4KJIA 1PC4A 2UUBJ 4NLWA 4N8NA 2E5HA 1CC8A 1RDRA 4ELVA 1GNKA 2ZC4A 3CDBA 3FQLA 2XQCA 2HHHJ 3EPIA 1KVIA 2LP4A 3IGNA 1RBOB 3OTOF 3QT5A 2AZ3A 3FFIB 5E41A 2GVZB 2VHGA 4GKJF 1KLNA 4J9LA 4RU9A 1S9EB 3NG8A 4OIXA 3TAQA 3TARA 3W64A 4KPYA 3IAS9 5HJXA 1Q7LB 4FP9A 1YBTA 1NK8A 2CNKB
chains in the Genus database with same CATH topology
1TK8A 5HN0A 5HI7A 2W24A 1YGYA 3MM7A 3N9UC 2OD6A 3FCHA 3FNNA 3TI0A 2CPIA 1H98A 1B64A 2VFSA 2MQPA 1XWLA 2CQPA 4MYUA 1SBRA 1FESA 3TNVA 2PD1A 4I68A 2XY6A 4R5PB 4HEA9 3QGGA 3MPWA 4X65F 1SL0A 5IQQA 4K4UA 1WELA 1IKWB 3GQCA 1S1WA 4DR2F 4LFCF 5D77A 5GAEU 2FVQA 4ES2A 4EZ9A 1X5SA 3IS9B 3MAQA 4P2SA 5HL7Q 1X9WA 4LVOP 2V4QA 3OW2R 3QIPA 3GWCA 1M5KC 1VJWA 2K1RB 4XO0A 3HM9A 3BJYA 2KYZA 1R0AB 4W92B 2EC0A 2JEIA 1JLCB 3PV8A 3FZ2A 5F0UA 1RT4B 5LMNF 5CD4H 1FXRA 2MPUA 2HNDA 5HLFB 1I6JA 4ITSA 4PR6A 5KG5A 2ZE2B 4B3MF 3I0SB 4O23A 5DG7A 4AYBD 3SDEB 2HGNA 1JJ4A 2PI4A 1BWEA 4MIWA 2V4JB 2E9TA 1MW7A 1YJRA 5CYMA 3CGIA 1OPIA 2PDAA 2FHMA 1KLMB 4G1PA 5B7WA 3S6EA 2BA9A 2XBPA 1ZM2A 2VUGA 2R2SA 4NXNF 4Y2CA 3BGRA 1D0EA 1KFSA 1LFPA 2BE2A 4P7TA 3RBDA 2Q43A 1TFYA 1X4HA 1TL3B 5HQ8A 4O3SA 2JLGA 4U9RA 4RUAA 4ECVA 1MU2B 1MMNA 3JTPA 1T3NA 1U1NA 4YQWA 2CYYA 5A6WA 3G8QA 4IUFA 3I82A 4Q8EA 2YH1A 3R5BA 1FDAA 3VWSA 2DR9A 5HROB 4WYLA 4IFVA 4ECQA 3TANA 3GR0A 3H2VE 3BB5A 1DTTA 4JV5F 4C8KA 3OQ2A 3MI7X 4PG7A 5F8MA 1FVSA 2CKWA 3LGMA 3KHGA 5F8JA 3AB4B 3KNAA 3ENWA 1OIAA 1RISA 2NUUG 4EBDA 1OQ6A 1HQUB 4NLTA 4K0KF 2MKCA 2Z4PA 1UWBA 5J2PB 2AYGA 1M90T 4LMZA 2JH3A 1T95A 3VZHA 4TU8A 1QSLA 4X4UA 3R5AA 2PC6A 1M5VC 1Q82T 2V8DA 1YJUA 3DOLB 3MF5A 2NSCA 2CQ3A 2QSFA 3DYAB 4UOCA 5K14B 5BYSA 2QA4S 3K5PA 1W25A 3LQVA 4WU2A 4O3OA 3OUYA 2HHTA 3C6UA 3TX8A 3VCDA 4PWDA 3US5A 1HD1A 2F4VF 2PA8D 4RUCA 2P6SA 3AQPA 2NYIA 4LUBA 4PXCA 5KFIA 1HQEB 1RT3A 2FJVA 4CT9A 3BDPA 1RI7A 5IT9Y 3WC2A 4N8OA 2UU9F 2L41A 3TVYA 1N52B 2D9PA 4IOBA 4R8UB 2JVOA 5CQGA 1TV6A 1M5HA 1AW0A 2XNQA 3HHNB 2OP5A 2W9BA 2R8IA 5IM0B 3ZZUA 2ZOFA 3G6XA 3TOQA 3HVWA 5J2PA 2E7WA 3UCGA 4EEYA 5D3GA 4QWBA 2HNZA 1XBWA 5M2PA 1YBAA 3JYTA 1B0TA 2GO8A 4F3MA 2B6AA 3GFHA 3PEHA 2W25A 2ZITA 1JXLA 2OTJS 4X4PA 4FXWA 2IM0A 3MECA 1MNEA 1LWEA 2ZH4A 3M32B 1IKYA 3MEDB 4HDGA 1TKDA 1RTJA 3ZZTA 2LMIA 4A8SA 2HFOA 3O5TB 1FK9B 1DFDA 1SJ1A 3NCQA 3GB0A 4CCHA 2DT9A 3O6QA 3KTQA 3MCSA 3M2RB 2DGWA 5KFLA 4IH7A 4F4WA 1QAXA 1VQ9S 1TL3A 4HT5A 4ZPDA 1S99A 2XEXA 3UQSA 4WKYA 5D4OA 2YKMA 1KLMA 2O5DA 2QA1A 3DN9A 2JFKA 2M0GB 4NRTA 2VONA 1IUJA 2RU9A 1K73T 4QPTA 3DLKB 3F56A 4IG0A 2ZM6F 1VQMS 4OL8A 2MQMA 2ZE2A 2XG8A 1IBKF 3AJ2A 1H6KX 3T6BA 2XMKA 5DM6Q 1X4FA 5JUMA 3A8EA 3K5NA 2ZH9A 1VC5A 4OHYA 3MM5A 2DNNA 5L39A 1VQ4S 1XR7A 3OR2B 4ZK7M 4KV8B 3LGNA 1XNRF 3O44A 3UPFA 3FMBA 3BQ1A 4RNMA 1JJHA 1K1QA 3DMJA 5D4PA 5LJ5Y 2AGPA 2AJ4A 2C3MA 5D4LA 1U24A 3MEEB 3KJVB 1HWUA 3V81A 3H59A 1WEZA 2YNIB 1KOHA 4RBVA 4TY8A 5IXUA 1P8GA 2B5JB 5ITHA 1HNIA 2XSFA 1VQOS 1OS5A 2ZDOA 1FXDA 2E44A 2X1AA 4YUDA 2E1MC 4NWBA 1TKXB 4ZCIA 1X5TA 3D28A 4MIAA 1IQTA 3TA1A 4C11A 5HBMB 5F0WA 5HBMA 4C11B 3QAEA 3I4HX 4RUHA 4NLGA 2IBKA 2PMHA 1FRKA 1LWCA 1MWYA 4JI8F 4Q2LA 5A0YB 2NQPA 1TZ0A 2V94A 3D1HA 3SCJE 5HO4A 1N56A 1KD1T 3VR1A 2EBEA 1N0UA 4PCQA 3V81B 1P1LA 2C3OA 4YDXA 4KB7A 3THPA 1KVJA 3PO4A 4IFYA 1WHXA 2CPHA 2I5JB 1NKEA 2R8JA 3VTIA 1VGYA 2J9CA 3AA9A 1IBMF 1VC6A 4DR6F 4KV8A 4ZVGA 1Q8BA 5KFVA 3SCKE 1S1TA 3HHLD 3RB3A 2WAQD 1NJIT 2NS1B 1GT8A 4NA2A 1YJ9S 2VPZB 5E3PA 1Q4RA 2MXYA 2XCAA 4WFAQ 1FDNA 4RW7A 2E9ZA 2GJ2A 2VG5B 4DDFA 4ED2A 4LSNA 1HNZF 2QV6A 2VV5A 1S6PB 3HKZD 3M6UA 5THWA 4AXJA 1NRKA 3QO9A 4LF5F 4ID5B 2FLOA 3G4SS 4ZHRA 2CQ2A 5L8RC 5F8HA 2GHVC 2M8HA 1H3DA 1RYRA 1HNXF 3O1LA 4KE5A 1RKJA 3BN4A 4QWAA 3QJJA 5J2QA 2OD4A 3NCPA 2XCPA 2CJBA 2V9WA 3P3DA 4DR7F 3RW6A 3G8TA 3N4WA 1HA1A 5J2NB 1TP7A 3TRGA 1MSWD 2GMHA 4YP3A 4EU0A 2Y1RI 2VFRA 3FQKA 3N79A 2JEJA 1T7PA 4B9MA 3OR1A 5MLCV 4F02A 4OI0A 4IRCA 1C1BA 3O8WA 3IC1A 3MECB 5AE2A 2G1DA 3DLEA 4KR0B 4F4XA 1NK4A 2FJWA 1RTIA 2H5EA 2E5LF 3CJ4A 2HHHF 2RDJA 2DNKA 3LUYA 3M05A 3HVAA 3OTBA 1O8BA 2HNZB 3M30B 1YIJS 5FLXY 1HBMB 3N6NA 4O4GB 5EN1A 4OHXA 3K5OA 4QIWD 5I42B 3S7RA 2M3DA 5B0EA 5B0CA 1WEXA 2LEAA 4DR5F 4DV7F 4PQUB 4MFBB 2IVYA 3GR1A 4KAIA 4ECRA 2AGOA 4RBUA 2UXCF 3P5TL 2Q1LA 4J9PA 5KFYA 1U47A 2KFNA 3PM9A 5DM7Q 3KK3B 1FE4A 2F8MA 4YB5A 4X4QA 2WOMA 3Q2TC 1UW4A 3E3XA 2QMXA 1Q81T 2CQIA 1U45A 1HMVB 5MAOA 3QIDA 5KFQA 2PN6A 5LSLA 3BEGB 2Y0SD 1RT7B 3ENQA 3K2YA 3MM8B 2LEPA 3P49B 2WB1D 3UFCX 2MKJA 3V4MA 2KRBA 2IYGA 3SQGA 4BCAA 4DN0A 1RT2B 4ES1A 2UUCF 4AXIA 2MQOA 4LJMA 2R7QA 3R3TA 2MZ1A 3K8VA 4CQ1A 1L3TA 3KLIB 4ZPBA 4RLEA 1R3NA 3SSQA 3RR8A 3TYTA 1K1SA 2QYCA 2UVWA 5SZTA 2CG4A 4YFUA 2PT0A 1SIZA 5CCLA 1DHMA 2XMJA 2UVVA 2DITA 3T1HF 5HROA 1E6VA 3JSBA 1Y5LB 1U8SA 3CJ2A 4ECZA 4QU7A 2WRMA 5T7LA 4OI1A 5H9FJ 1TAQA 2A10A 4C8MA 4ZMMA 1QAIA 1AFIA 3EZ5A 3H2LA 1U1KA 4FF2A 3TVZA 2YKNA 2IYIA 2EW9A 3EXCX 2RKIB 5T41A 3QJPA 2OFHX 1YG0A 1MU2A 5CHCB 5KG4A 4WXOA 3I31A 4O3PA 2OPRA 3RAXA 3PIOQ 1WTBA 2BM1A 2PGCA 3CC7S 1T03A 1QM9A 3MFIA 4L6V3 2XY7A 3POTB 3M9OB 2FTRA 3MOZA 1FE0A 4YB7A 2Q66A 2Z0GA 1RK8A 2HWIA 4P6QA 1B0VA 1CSJA 1SXLA 4LF7F 2IM3A 5DG8A 5DG9A 7FDRA 1MWZA 3LP1A 2JEGA 3PRDA 2Z8QA 5C24B 1UVIA 2XLKA 5KG2A 1FCAA 1HW9A 2BUNA 2DNYA 4ZOSA 5KFPA 2CDQA 2ZH2A 3NLCA 5DLGA 3NNAA 4H4OB 1S7HA 3B78A 3OJSA 3KLFB 4DV3F 4B9TA 1M5OC 2MMYA 3CD5A 2LDIA 1H7WA 2F1FA 3RZAA 2KG1A 2ALZA 2IAJB 5C25B 1JKHB 1JKHA 1DURA 4EYHB 1BC6A 4O0IA 3BR9A 3AQOA 3PIPQ 3P96A 3F73A 2KXNB 1VC0A 1IKWA 3FSYA 2HAIA 1D8YA 4QYZJ 3V4IB 1DLOA 3B8HA 4OLOA 3CUNA 1JLEB 1TL1A 1TUVA 4W90B 2GC8A 1DQ8A 3PFEA 4Y00A 2VOPA 2BACA 2F8HA 4O3QA 1NH8A 4DV4F 4K4ZA 3I87A 3BN7A 4RNFA 4U67Q 2DNMA 1Y00A 2A2CA 3G6VA 1NJWA 1NK0A 2YWHA 2DGQA 1N4LA 4ALZA 4CTAB 3GIMA 5DJBA 3KG4A 1X4AA 4DFMA 4RW8A 1HBNB 1VQ6S 2B4UA 1S9EA 3K58A 4B3SF 4IRKA 1C4AA 4KC5A 4RNNA 2KN4A 1QJHA 4Y28C 5B0AA 1N36F 1GAOA 1VRUB 2QT7A 5BJRA 2YKNB 2ASLA 2FLNA 2ROPA 2JHEA 3HKWA 1C0UA 3AHPA 4NA3A 4X66F 4J9RA 2DGSA 4DSIA 1UFLA 2KHDA 3I6PA 3M1VA 4O3RA 3L95X 5IFMA 4DEZA 3DLBA 1SJRA 4KIAA 4DFKA 1ZAXA 3W2WA 3CPWR 1YJNS 2YX7A 1G6BA 4I2PA 2LDYA 3N28A 3H5YA 5KT5A 1F5CA 2MJNA 3KK1A 3NBPB 2AYMA 1FNOA 3PX4A 1NNDA 1HHTP 1RT2A 1DZ5A 5HMYA 4DV6F 5DETA 4IOCQ 3CC4S 4WK1A 2I1RA 1RA6A 2GGPB 3NMRA 2AU0A 4C8NA 2KKHA 4ECSA 5CH7B 3OSPA 3HI9A 2E66A 3NP5A 3Q24A 2YWEA 3OVBA 4Y3CA 4DSFA 3KLGA 4NCBA 5CA5A 2ZH6A 4DR4F 2FD2A 5EWEA 1T94A 5DS7A 1GQEA 2ASYA 3QWUA 1VQLS 1XNQF 2DTJA 4TU7A 1KQGB 1NH7A 2FHOB 2I9SA 2EFPA 4G6VB 1YRTA 4F67A 4NL5A 1QY7A 1U7LA 3CCRS 1WEYA 4FPRA 2OPPA 2OPQB 1A7GE 3VQSA 3TAMA 4QBUA 1QE1B 4QR0A 2OMLA 3WBZA 2DISA 5B09A 5KFHA 4IOAQ 3TUIC 3TO8A 5DDRC 3KLGB 1WACA 4UUXA 1L5UA 1EETA 3R5CA 3DLHA 4NPOA 4BC9A 4E8UA 1BY9A 1FRJA 3IWXA 1TAUA 5IQ6A 2VB6A 4AUKA 3OL9A 2A2DA 2GGPA 1WF2A 1MMLA 4GO7X 4OX6A 2VG6A 5DQGA 3VALA 4H4KA 4FF1A 3DHWC 2YQ3A 3VQTA 3ZC4A 2RIJA 4C0BA 3NBPA 5HP1A 5KFUA 3V6KA 4PXBA 2AV5A 2HFZA 1X0PA 4A8QA 1MMDA 4PWUA 2FHJD 4DOZA 4GKKF 2UUWA 1WNEA 2FJBB 4PUOA 1FTRA 1KTQA 3KWMA 4ECYA 5JXSA 4DQPA 4KO0A 4IR1A 3GYXB 5KFZA 3NNCA 1WG1A 4DSEA 1YITS 1U09A 1JLQB 1HW8A 1TFWA 1VRUA 4DFPA 2ZJRQ 1VRTA 1ZM9A 1Q7YT 1W2IA 5BR8F 1S0VA 2LKZA 1BD6A 2O67A 3NAIA 2CQDA 3BGUA 4WTYA 5G0RB 4CTAA 3ULHA 1WG5A 2CVIA 2XWYA 1FKPB 2YNFB 1XTZA 2AF6A 2BXJA 4IH6A 1Q16B 3FSXA 3K5MA 2E9RX 3W3SA 2B0GA 2MYFA 2M52A 4ECXA 3HPOA 3DRSB 2VFVA 2VFUA 1ROFA 1ZZNA 3UNGC 1URNA 5F8IA 2EPIA 1FJGF 1S77D 4EUVA 1S97A 3I0RA 1RAJA 2MHEA 1JLEA 3KLHB