4RW9B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B03
3PHEA 1N56A 1S1WB 3IS9B 1S1UB 1REVB 2YNGB 5KFYA 5EWFA 2AU0A 2IC3A 5KFAA 4KKOA 1JLEA 1RDRA 3D5MA 3M9MB 2XWYA 5DQHA 3PZPA 2JLEA 2WONA 4ID5B 3MF5A 1SV5A 1TL1A 4NRUA 2FVRA 1IKXB 4ECQA 2YNHA 1RTDA 3C6UA 3GV8B 3CDWA 1R0AA 5KFVA 2OPSA 2HMIB 5KT5A 2HMIA 5KFEA 4B3OA 1FK9A 2V0NA 1C1CA 1FK9B 2ALZA 2D41A 2YKMB 1TKZB 4H4OA 2YKMA 1RT2B 4J9SA 1HQUB 4IDKB 2BANA 3CO9A 5D3GA 3V81B 2R2RA 3IRXB 1D0EA 5KG4A 4QWBA 1LWEA 2UVVA 4Q8FA 4Q0BA 5KFDA 4JV0A 3M8QA 4Q43A 2EC0A 4NRTA 3H4BA 4URQU 2FVSA 4NLTA 4IG0A 5F8IA 3DM2A 2B5JB 3V6KA 4IQXA 1EETA 4J9OA 4M95A 2RDIA 3H5XA 2JEFA 1S0MA 4LSLA 1IKYB 1RTHA 2WCXA 3GIKA 2W9CA 4GC6A 4LQ9A 3DMJB 3KK2A 3T1AA 4TY8B 3LALA 4EEYA 3DI6A 1FKPA 3G86A 3I5AA 4K4VA 3I5BA 1RT3A 5F8HA 5KFJA 3TAMA 1RT3B 3PJWA 4WZQA 2QV6A 4H4MA 4PQUA 2C2DA 2C2RA 2YKNB 3HVAA 5DLGA 3NAIA 4ED3A 2WOMB 3UDLA 5F9NA 4ED1A 3RB6A 4TN2A 2ILZA 4R0EA 3OSPA 1JLGA 1U09A 3KK1A 1TL3B 1T03A 4ZHRA 3IG1A 5CYMB 1HQEA 5HLFB 2HNYA 5F8NA 3FQKA 3PW5A 3ITHA 1RYSA 2R2TA 4R8UB 4IFVB 5K14A 4TQRA 3MEGB 2HAIA 2WRMA 4IFVA 5K14B 2FJWA 4XPEA 5F9LA 4RUAA 1RYRA 5DG8A 3KMQA 3DM2B 3DLGB 4NLXA 4WFZA 5KFGA 2B6AB 2GIQA 3BQ2A 3BGRB 4RW7A 3DRSA 3NAHA 2JC1A 1JLQB 4DG1B 2XGPA 3QLHA 2ATLA 2ZE2B 3V6DA 2J6TA 4DL2A 3LP2B 5KFUA 1TP7A 4KAIA 2ILYA 1HNIA 2WB4A 3SI8A 3N6LA 5JXSA 2J6SA 1HYSB 5KFHA 1RT5A 4KV8B 1R0AB 1KHWA 4I2PB 2W7PA 1JKHB 3I0SB 3LP1A 3QIPB 1JLFB 3QYYA 3NMAA 5F8JA 4ZVHA 3G6XA 2IC3B 3FQLA 1JLBA 5KG5A 1IKWB 2VG6B 3JSMB 4IRKA 3DOLA 3BQ1A 1IKWA 4ICLA 4LQ3A 1XR6A 1JXLA 3IN5A 1RT1A 3KLFA 3M9NB 2C28A 3NBPB 2HNDB 5KFQA 3IRXA 2HNDA 3MECA 4M94A 4Q0BB 2GIRA 1N4LA 2DPIA 5L1LA 1MU2B 1WNEA 4J9LA 4O3OA 1FKOB 1LWFA 2OPQA 2HWIA 4MK9A 4WYLA 5KG3A 3RB0A 2VA2A 1VRUB 4YR0A 4YQWA 5I42A 1RT2A 4O3RA 4MKBA 1HMVA 4O3QA 4ED8A 4Y2CA 3H98A 3UPFA 4J9KA 2FLNA 1NHVA 1C0UB 5J2QB 1KHVA 2W9BA 4K4XA 4RZRA 3LP2A 4IR9A 3G6YA 1TL1B 2IM1A 1BQNB 2YNHB 1RTDB 4NLOA 4O3PA 1TKTB 2OPPA 5KFSA 4O4GA 2CKWA 3E51A 5C5JA 2IM3A 4YR2A 3DRRA 2E9ZA 4O4GB 4RNHA 5DGAA 2R8GA 3KLGB 3KLHB 4J9RA 4KB7A 4Y2AA 4ECWA 2VG6A 3BR9A 2IMWP 1C1BA 2VG5A 4EBCA 1JIHA 3KLIA 2GC8A 3BSNA 4K4UA 1S9GB 3RBEA 4ED2A 4RUCA 2UVUA 1QUVA 2UVWA 3NL0A 1HQEB 1DTTB 5KFXA 4H4MB 2R2SA 2OPSB 4XPCA 4ZP6A 1JX4A 4IR1A 4HYKA 3HHKA 4MK7A 2VA3A 2V4QA 1TKXB 2RKIA 5J2PB 4ECRA 5KFTA 1TKXA 1VRUA 2RKIB 3Q8RB 3GYNA 5I42B 1ZTWA 2W7OA 3KMSA 1TKZA 5J2NB 1HMVB 3HVTA 4NLYA 3KLEB 3BGRA 4RW7B 5C42A 3OLBA 1LWCB 5KG7A 2JEGA 1N6QB 5CYMA 2WTFA 3GV5B 1SH0A 1RTIB 1VRTA 3KHLA 3DYAA 4YR3A 4KFBA 3MR5A 4HKQA 2XCPA 3IGVA 3KHRA 2J6UA 3MR3A 1RT6A 5L1JA 5T14A 4DL5A 4DL3A 5KT2A 3QO9A 4K4TA 2AGQA 2W8LA 3OL6A 3C6TA 3FRZA 5DGBA 3TVKA 1JKHA 3I0SA 3ISND 3LP1B 3QIPA 3KLGA 2BRLA 1EETB 4Q8EA 4RW8A 5CYQB 4RU9A 1DTQB 4K4ZA 1S1UA 2YNGA 2HNZB 3JSMA 5KT6A 1S9FA 3TQ1A 4MIBA 1GX5A 4QWEA 3KJVA 2IA6A 2OH2A 1FKPB 2D3UA 4EO8A 4MFBB 3V6HA 3M8PB 4F4ZA 4MFBA 4NZ0A 4EO6A 3C6UB 2XCAA 4QWAA 2R8HA 5J2PA 2F8EX 3PW2A 4ECZA 1FKOA 2BR0A 1K1QA 3QGHA 4B3OB 3Q8SB 3FSIA 4PUOB 1DLOA 3VQSA 4FBUA 5EDWA 1S9EB 5HBMB 4PUOA 5EWGA 1LWCA 4NLVA 4RNFA 3KK3A 1RA7A 2FJVA 1VRTB 4IH5A 5D3GB 4IRCA 2HNYB 1S4FA 1XR7A 3EPGA 4X2BA 3ITHB 3SFGA 1N48A 1OS5A 2RDJA 5C24A 1BQNA 1TKTA 3E01B 3LP0B 4NCGA 1K1SA 3KOAA 1TV6B 1TV6A 3QZ7A 4I7FB 2XI3A 5KFLA 4ED7A 3MR6A 4FBTA 3LANA 4O3SA 4RNNA 1S10A 3DRSB 1S1TB 3I0RB 4RW4B 2YNIB 5J2QA 3MEEA 1S1TA 3DMJA 3I0RA 4EYHB 4WFYA 1S6QB 2IJFA 4KHRA 1QE1B 2WONB 4NLRA 2C2EA 1BQMA 3DRPB 2AGOA 4TLRA 4TY9A 1S6PA 4J9MA 1S0NA 2DPJA 1MU2A 4RW6A 2CJQA 3DLEB 1HNVA 2OPRB 2BE2B 2YNFB 3JYTB 1S1XA 5J1EB 1CSJA 1C1BB 2VG5B 4WFXA 3JYTA 1C2PA 1S1XB 5J1EA 2W8KA 4EYIB 3DOLB 3GIJA 1S9EA 5HBMA 2AX1A 4Y34A 3NGDA 4F4XA 3KNAA 3KLEA 3KK3B 2IBKA 3FDSA 1RT1B 3T19A 3KLFB 3CJ0A 4IDKA 4FS1A 2FLPA 4ZHRB 4NLGA 3H5SA 2O5DA 2W9BB 5KFMA 1QAJA 2VG7A 3PJXA 3KLVA 1GX6A 3RB3A 2RF2A 3Q8QB 4IRDA 1ZTTA 3LP0A 4NCGB 4R5PB 4ZVFA 3N6MA 2IM2A 3G6VA 3MFIA 2WHOA 4I7FA 2B6AA 5C25B 3PW0A 1DTQA 4ZVEA 3CJ2A 3DDKA 5L1KA 4MH8A 4DL6A 3KK2B 4LSLB 3QIDA 4F4YA 2C22A 3QLHB 2R8IA 1S9GA 4ECTA 3IGNA 4TY8A 4OL8A 5HROA 3GV7B 4K4WA 4MKAA 2FVQA 1JLCA 1C0TB 3V4IA 5KG6A 5HP1B 3DRRB 5KG2A 4RW6B 2BQRA 1LW0B 5HP1A 1HNVB 2UUWA 4H54A 1J5OB 2V9WA 1LW0A 3NKYA 3N6NA 1RT7A 4RNOA 3PW4A 4EBDA 1JLGB 4GC7A 4WZMA 1TL3A 4YP3A 3T5HA 2FLLA 1RT4B 1T03B 4G3IA 4U7CA 2HWHA 4ZP9A 5C42B 3MR2A 5KFRA 3V81A 3H59A 4YMEA 5KFKA 1T3NA 1LW2A 1UWBA 3FFIB 4ZPCA 1JLAB 2AX0A 5EWEA 4Q44A 3MFHA 3KHHA 3LAMA 4KO0A 2RF2B 4URGA 4IKAA 1IKVB 4PWDB 1IKVA 5DG7A 3C6TB 4J9QA 2D3ZA 5KFZA 2XC9A 3DLGA 2R2UA 4RW8B 1S1WA 3IS9A 4MIAA 4QW8A 5KFOA 1N5YB 3ISNC 2ASDA 5F8LA 4U6PA 4ZPBA 3DYAB 4O44A 4J9PA 5JUMA 5DQIA 2IAJB 1RT6B 3MEDA 1T94A 4IH7A 1QE1A 1KLMA 3CJ5A 4IFYB 2JC0A 1RT5B 3QO9B 1KLMB 1C0TA 1JLCB 1TQLA 2BQ3A 4PQUB 4Q45A 1JLFA 3DOKB 3CIZA 4ECSA 4Y3CA 3GIIA 3DLEA 2I1RA 2WOMA 4WXOA 1JLBB 1C1CB 4NLSA 4LSNA 3QGGA 1T05B 1SH2A 3BSCA 4RW4A 4H4OB 2YNIA 4LSNB 1RT4A 1T05A 5J2MA 3BSAA 3D28A 3KJVB 1D1UA 3H40A 3PR5B 2W9AA 1S97A 2JEJA 4K4SA 1SUQB 1S6QA 2BANB 2R8KA 1TVRA 3M8PA 4TQSA 1IKXA 1TVRB 1DTTA 3DLKB 3CWJA 4ZPAA 4IH6A 2VG7B 3OL9A 3MECB 3MEGA 1HARA 2UUTA 4DL4A 4RW9A 3UR0A 3LAKA 3CVKA 4F4WA 3OSNA 5I3UB 3V6JA 1RA6A 1RAJA 2B5JA 2AWZA 1DLOB 2IM0A 3HVWA 1I6JA 4NYZA 1N5YA 4ZMMA 4RNMA 2ZD1B 3CJ4A 1REVA 4KBIA 4TYAA 5EUHA 2XGQA 3RAXA 2R8JA 4KKOB 3OHAA 2FJXA 1N6QA 3ICLA 2XI2A 4O4RA 4JUZA 1RTIA 4ED0A 2UVRA 4NLDA 2IJNA 2IAJA 3OLAA 4ED6A 2ZKUA 3H2LA 3H5YA 2JEIA 1HNIB 4KSEB 4TYBA 1HYSA 5KFWA 2OPPB 2FVCA 2BQUA 4R5PA 5KFPA 4NLPA 2AGPA 4I2PA 1NNDA 1EP4A 4ZVGA 1S6PB 1EP4B 2I5JB 3PVXA 4K50A 5C25A 3EPIA 3QGIA 3KHGA 4EBEA 4ECVA 4NLQA 2WK4A 5J2MB 5KG1A 3MEEB 2ASLA 2E9RX 3NBPA 4J9NA 1SH3A 3QZ8A 3IG1B 1LW2B 1UWBB 3FFIA 1W25A 4URSA 4QPXA 1XR5A 3V4IB 3BREA 4KHMA 3M8QB 1IM4A 5FDLB 2V4RA 5FDLA 3CDEA 4IG3B 2OPRA 5KG0A 1RT7B 4IG3A 5KT4A 3EZUA 3H4DA 2E9TA 4ZP8A 3KK1B 3Q8PB 2ZD1A 4DEZA 3HVTB 4WYWA 3PW7A 4WXWA 4DG1A 4KFBB 5KFBA 4QW9A 4G1QB 1JLAA 2ZE2A 1LWEB 3V6DB 3CJ3A 3BQ0A 4DL7A 4I2QB 3DI6B 3RAQA 5L9XA 4I2QA 1HPZA 1HPZB 3T5JA 3TAMB 5C24B 3OL8A 4KV8A 5DLFA 3RB4A 3DOKA 2D7SA 1MMLA 2I5JA 2ASJA 5CYQA 3BJYA 1J5OA 2HNZA 5F8GA 1IKYA 1RTHB 2W9CB 1JLQA 3KLIB 1JLEB 3SFUA 4ICLB 4O44B 3PR4A 4ECXA 3MEDB 1RTJA 1ZETA 1QAIA 1Z4UA 4ID5A 4IFYA 5KFCA 5HROB 1RTJB 3OL7A 3GIMA 1SV5B 4WE1B 5HLFA 3GQCA 4ZPDA 3DLKA 4K4YA 5KFFA 4ECYA 4WE1A 1BQMB 3DRPA 1S48A 4R8UA 4ECUA 5F8MA 5DG9A 5L1IA 4XO0A 2B43A 4RW9B 2YKNA 5KFNA 3OHBA 4TXSA 3UQSA 5DQGA 4PWDA 3M9OB 5KT3A 5I3UA 2AQ4A 4NLWA 2BE2A 2YNFA 4MK8A 3T5KA 1S49A 5J2NA 3T5LA 4NLUA 3H5UA 4QWCA 3GILA 3HKWA 1SUQA 3I5CA 2BRKA 4ZP7A 2QE5A 3BSOA 1HQUA 4F50A 4G1QA 1S1VB 1C0UA 4JV2A 5KFIA 1S1VA 2FVPA 3MTKA 4KO0B 1YVFA 3RBDA 1NHUA 1S0OA 3E01A 4O3NA 4FS2A 4QWDA 4JV1A 1LWFB 2OPQB 4IG0B 3CDUA 4IOBA 3KLHA 4KE5A 5KT7A
chains in the Genus database with same CATH superfamily
2VKRA 1N56A 1WI6A 1S1WB 1LK5A 1S1UB 5KFYA 5IOLA 1WHXA 1FWLA 3ZZOA 4N77A 9RUBA 4LFAJ 2QTWA 1UFLA 2JLEA 2WONA 3PYEA 4OYIA 5FIIA 1IKXB 1RTDA 4JI8F 3C6UA 1UJ6A 2PMWA 1GTHA 1RADB 5JVHQ 4K59A 2J7UA 2PO4A 4OX8A 4OZLA 2R7SA 4LF4F 4KTQA 3QSIA 1VJQA 3FCHA 1AA1B 1WC5A 4UQGA 1YBAA 4DQPA 4HI1A 4Q5VA 4OZJA 3EGWB 3J80U 1VQKS 2RD5C 2YKMA 3CEDA 3W60A 4LUBA 2V2ZA 4FVCA 1LXNA 2D69A 3TOQA 3SCIE 3MWBA 1U49A 2I6WA 4EZ9A 1ITPA 2RU9A 5GAHI 1D0EA 5KG4A 1SQGA 3EVMA 4IOAQ 3IBWA 4Q0BA 4P6QA 4JV0A 4EEYA 4Q43A 2VDIA 2J0WA 2EC0A 1PYSB 5IWAF 2AZ3A 3QQCD 1ACMB 2GA7A 2JH3A 4NLTA 4DSFA 1QLNA 1V3ZA 1HNZJ 7FDRA 1XQIA 3LO3A 2B5JB 3V6KA 4J9OA 1EB0A 4DFJA 2RDIA 1BD6A 3W7BA 1S0MA 4LSLA 1IKYB 1T9YA 3FJ2A 5B0AA 2W9CA 2DNRA 5G0RA 2H1YA 5IV3A 1G3OA 1RAIB 1LOUA 2CG4A 3MM6B 3UO0A 1C4AA 4K4VA 3SEOA 3L7UA 4USUA 1NK8A 1RT3A 5KFJA 2ZJPQ 2YXLA 4LF8F 4X62F 3QFHA 4WP9A 3M2UB 5A2QU 1SL1A 3D1HA 2J7KA 3WIVA 1UA0A 4HDHA 2DYAA 1HWKA 2BKPA 1RABB 4ED3A 3R1HA 2RT3A 3T41A 2MQPA 3CCZA 4YY3F 4WP3A 4NA1A 2BX6A 4ED1A 2ZHOA 4CM0A 1ZAVA 1VC5A 4FF1A 1J27A 4OZ5A 2VB6A 3F44A 4DPOA 1U47A 3H90A 2VFTA 4ZHRA 3G96A 3IG1A 4QZVB 1HQEA 1G1XA 2HHUA 1Q53A 3VF0B 1CJUA 2Z58B 4W4MA 4FXDA 1KVJA 3N0VA 1QAYA 2HAIA 3MPYA 3MI7X 4XPEA 4RUAA 3KMQA 2QL9B 5DG8A 1N8RT 5T7LB 1K9MT 2W4PA 2BW7A 3PHTA 3UFCX 2YWHA 1CJKB 1U1NA 4KHPJ 5L46A 3AA8A 2QSFA 3BQ2A 2R42A 1FJGJ 1JJCB 4W92B 4F0HA 3FSYA 1JLQB 2M9KA 1N34F 1OO0B 3QLHA 3MZIA 5FLXU 4C8NA 3PIOQ 2XGPA 2LECA 3CB4A 3GU0A 1AUSL 4FYWB 5M2RA 2XYGB 4UOFA 3BO2A 1RUSA 3BSOA 4KAIA 2R3VA 5IC6B 1LFPA 1N5VA 1HYSB 5F0UA 4NA3A 4WFAQ 4CLUA 3M6UA 4DCOB 1DJ0A 1HWIA 5IM0B 2SXLA 3A1YG 2ZOFA 2DIVA 4ZVHA 4E2FB 2IC3B 1H38A 2KHCA 3UN3A 2VG6B 2OEMA 3JSMB 4FPRA 1IKWA 4J91A 4WTYA 3RW6A 3M1VA 1X9MA 2M0GB 4LF5J 4LQ3A 1HR0J 1UW9A 4CQ1A 3M9NB 2V4JB 3NBPB 5KFQA 2GHPA 2KVIA 1RBLA 3CW2C 1MG7A 4ZCMA 1ZH5A 4K5SA 3MMCB 4M94A 4Q0BB 2A10A 2DRBA 1N4LA 2R7TA 3ENQA 1UFKA 3J80Y 2XY5A 5L1LA 2DPIA 1AFJA 2R7QA 1FJCA 3BZQA 5H9EJ 3NOGA 1D9FA 1FRIA 1HI8A 1WEYA 2P2CB 3W61A 3MAQA 1NU4A 2B4UA 5KG3A 1VRUB 5DDPC 4YR0A 3NS6A 3RB0A 4YQWA 4DSIA 4ZITA 1SIWB 2NSBA 5ADZA 5E5NA 1Q8LA 2QMWA 3SBMA 4ZLLA 1YIJS 4Y2CA 3H98A 2L3MA 3UPFA 1AT1B 2HLUA 1G6BA 4DPWA 2W9BA 4JI1J 2ZNYA 3TUPA 5D8HB 2QLFB 3BPSP 1R8BA 2ZITA 2MGZA 1VQ8S 4YN3B 3HDSA 3HKZD 1TL1B 2L08A 2IM1A 1JJ2R 4BHQA 4NLOA 4TQRA 5C5JA 2IBOA 4K8RA 5KFSA 3E51A 4YR2A 3BB5A 1ZAXA 2H54B 2IM3A 3GFHA 4O4GB 4HTIA 4LVOP 4RNHA 3D6HB 3KLGB 3KLHB 3B54A 2HS3A 1H7WA 4KB7A 4LRBA 2LEPA 4U8YA 2EBEA 3OVBA 1CC7A 2GZOA 3SCJE 1B4SA 1C1BA 3FCWA 1CJVB 4PAAA 2D1CA 3IR6B 3KLIA 2GC8A 2JHEA 2AF6A 1R8AA 1RWPB 4QR2A 2Y0BB 2N4DA 3M32B 3OR2B 3AODA 3N4WA 3ZZZA 1EHWA 2B9YA 2HFNA 3D9BA 1HQEB 5MAOA 4CO0A 4LBIA 3VAKA 1WSRA 4FDFA 1KS2A 2LMIA 4XPCA 1QD1A 3GZ7A 4ZP6A 4CLFA 3W8GA 3A8EA 4X62J 4F2SA 3D3CJ 2JWNA 1KOOA 1TKXA 2RKIB 2V8DA 1VBXA 1HBUB 2QFIA 1AYEA 2KXNB 2W7OA 2FIUA 3CCJS 1HBMA 1VFJA 4OV6A 1HI1A 2VFUA 3PO4A 1LWCB 3HSDA 3MMAA 1SH0A 3HO1A 1FRKA 3H20A 3KHRA 3HHNB 4KFBA 4HKQA 3CGIA 3IGVA 2ACMA 2J6UA 1RKIA 1X9SA 2E5LJ 4B9VA 4YB5A 3TX0A 1QSYA 4QIFA 1U02A 5KT2A 4J5OA 2QYGA 1UKUA 1NO8A 3CCES 4USWA 2VJVA 4KPYA 3OTOF 3H2VE 4I6YA 2FB0A 3W9IA 2UUCJ 1U24A 3M2RB 3VHQA 2IJRA 5DDOC 3UN5A 4LFAF 3KDNA 4E98A 3GJSB 4MIWA 2HQCA 4ZLNA 2OJ3A 3JSMA 4RR5A 4I69A 4MIBA 1GX5A 3Q83A 4QWEA 3KJVA 1RBAA 2IA0A 1VC6A 3LWMA 4JI2J 3AJ1A 3PKMA 4EO8A 2CPFA 1R7IA 3MPDA 2AKWB 4F4ZA 1S0OA 4ERDA 2XMMA 1LQ9A 3QNWB 3MMCA 4EO6A 1IWGA 2XCAA 3D54A 2GQ2A 3FZBA 1OY8A 4HH0A 2EFNA 2B9EA 3A8IA 1H2TZ 3PW2A 2F8EX 1TZ0A 3NGRA 4ECZA 1XMOJ 1YKWA 2DNNA 2BR0A 1SJ1A 1UA1A 2L41A 4B3OB 2V8HA 2VBYA 5I4MA 3UDCA 4PUOB 4FBUA 3R2DJ 1R27B 5HBMB 2CPEA 4HHJA 5THWA 1F0XA 1BQXA 1KQGB 3QT6A 3ADAC 4J9UE 4E8UA 4IRCA 1VRTB 1PJ5A 3MM9A 4PWWA 2PMZD 2IVMA 4X4NA 1S4FA 4X2BA 1ZS6A 2CJ9A 1KQSR 3LF0A 2DHHA 3SFGA 1TL4A 1SB6A 1Q5YA 1OS5A 3A12A 5C24A 3J7ZT 2GW8A 4QPTA 1EAYC 3Q86A 2XBPA 2DGQA 4JI2F 3LP0B 4NCGA 3AQOA 2HHXA 3DU6A 5RUBA 4PKDB 4ZVOB 4I7FB 2HQ3A 2KT3A 1V5IB 4B3RF 3PG9A 3ZZRA 1U6FA 3CD6S 3GWCA 4RW4B 1KTVA 3HHEA 4WFYA 1HQ2A 1S6QB 1F5BA 1SC4B 2IJFA 1QE1B 2WONB 2RQMA 3WDOA 5LSOA 1FX2A 1FDDA 4DR6F 1NRKA 1U0SA 3ZNUA 4YY3J 1H72C 1R8PA 3PJ9A 4IOCQ 1UVJA 2DNPA 1RXOB 4Y6IA 3K59A 4J9MA 1L3TA 3OTBA 1MU2A 3DLEB 1HNVA 2LXIA 3DXBA 3MCMA 3KXDA 4LIRA 4WFXA 2W9AA 2ZH1A 2HW3A 1FTCA 1S4EA 2EI5A 4OMFG 3TZWA 4DMZA 5HJYA 3DOLB 2W8KA 1S9EA 2AX1A 3NGDA 3W2WB 1N0VC 2G9OA 2WBMA 2BKOA 2KVQE 3GYXB 3MPWA 1U7LA 2MEWA 3JS9A 5GADU 1RT1B 3KLFB 2QRRA 2W2OP 4FS2A 1RZMA 1SQFA 4FS1A 4NLGA 3RBZA 4DSEA 2KO1A 2O5DA 4K7QA 4X4OA 2OIHA 2PI5A 1QAJA 2GNKA 2RB7A 4DBQA 3KLVA 3MUMP 1YJTA 3IP0A 3MOZA 3PEJA 1N0UA 2OD6A 1NK0A 2F7VA 2HZAA 3JAMY 4YHHF 2XMKA 1ZTTA 1NB2A 3GFYA 3N5BA 1NSQA 1L3UA 2IM2A 4TU7A 3QAEA 2WHOA 2HBRB 4C11A 2XZWA 4ZIWA 4N47A 3BDPA 2Y8WA 2B6AA 5K8PA 3UNGC 3AB2B 2K8GA 2E1MC 2GVZA 5HAOA 2XMTA 5L1KA 4Y2KA 1ZYQA 2ZC4A 1RLDA 3MURP 1SC6A 5CXTA 3QIDA 4LSLB 3POTA 1FT8A 4AXJA 2MXYA 1R6YA 5D78A 3QRPA 2VQEJ 4ZIVA 1U1QA 3BGFA 3PY8A 2BZ2A 2AMCB 4MKVA 4CH0S 2GHWA 3HMJG 3DFEA 4MKAA 3UD5A 4IUFA 4B9NA 5E3QA 5KG6A 3EICA 3DRRB 3C15A 1VK3A 4NI2B 3B4MA 3P45B 1P1LA 2GVDA 2J0QD 4J90A 1BY9A 4FNHA 1LW0A 3W9HA 5B09A 2HHHF 1KFDA 3ZZ0A 1AXQA 4RNOA 2XY6A 4EBDA 3PW4A 4FYDA 1L3SA 3T5HA 1Y4ZB 1T03B 1FX4A 4A8SA 2CG8A 2XSJA 2MLYA 1UFWA 2VFVA 1T02A 5KFRA 3MR2A 2PGCA 1A9NB 5IT0A 3FFIB 2QLXA 3GJRB 3GMGA 2AD9A 1F6TA 5EWEA 2V94A 4DL6A 4YDDB 1YZ6A 4V19X 1SBRA 2LQ8A 3PRVA 4XDDA 2Q6BA 4URGA 4NXNF 2CQ3A 3I4PA 4GVBA 1TAUA 4PWDB 2V9KA 2W4DA 3M30A 4LT6A 5H9FJ 3OJSA 3EGZA 1HWLA 3IS9A 2F9DA 1CJKA 4DS5A 2CQPA 1N5YB 3N28A 2DR5A 3HD1A 4LSZB 2YQ3A 1TFWA 3QT7A 2IYGA 3CJKA 3S1TA 3BBCA 3DLBA 3KYLA 1QE1A 1KLMA 2JFDA 4WJBA 4IFYB 2JZ5A 5AE2A 2XMAA 3QO9B 3BN4A 4DV7F 2PD1A 2PT0A 1BMQB 4P7VA 4MAKA 4RLEA 1JQGA 1QUPA 5CD4H 2BQ3A 1JLFA 2HHTA 3DOKB 2NXCA 4B3TF 1HBOB 3DLEA 4TLQA 2I1RA 2WOMA 1URRA 4IQMA 2XLIA 2CADA 1KR4A 2XSFA 4LSNA 3QGGA 1T05B 1H6KX 1GXLA 3BSAA 2YNIA 2CQCA 2HVEA 2QA1A 2NXUA 5H9EK 4K4SA 5E0OA 1D1UA 3MCSA 1S97A 2JEJA 1Q78A 2HFSA 1Y00A 2DY9A 3B78A 2MQ8A 4RBUA 4AUKA 2E1CA 2R8KA 1LFWA 3M8PA 1KWMA 4Y2MA 1IKXA 4TQSA 1M5VC 3C2PA 5KAKA 3I4HX 2ZBPA 4IH6A 2WZ1A 3TRGA 4OYWA 4CLPA 1DBDA 2G0JA 1HARA 2UUTA 3ONQA 4RW9A 5HL7Q 4DZ6A 2XYPB 4EFAC 4DL4A 5JVGQ 1R8CA 2ADCA 1U2FA 5BYRA 1RAJA 5A8WB 3OTOJ 4BBYA 2AWZA 1DLOB 1XN9A 2QO3A 1I6JA 1DARA 3I31A 5LJ3Y 2J8SA 4N7TA 2ZFHA 4BCAA 4C6AA 3RAXA 2O01C 1NDCA 4OHXA 3M8ZA 4M5LA 1N6QA 3ICLA 4KYZA 2UVRA 4F3MA 4NLDA 2IAJA 3JSBA 4ED6A 1JJHA 3WX4A 1IBMJ 3I6PA 1GMWA 4G1IA 4TYBA 2M8DB 2DVIA 4USJC 3GONA 5C2GA 4DV6J 3EGVA 1EP4A 2R7XA 3B82A 5A8RB 3PVXA 5LL6d 5C25A 1H3DA 5ETVA 3GP9A 4EBEA 4LFBF 1IQTA 3ZO7A 5KG1A 4CTAA 3MEEB 2ASLA 1HHTP 4CRJA 1VBYA 4LF6J 4WTOB 4U7UK 2R7VA 4DHVA 2DXDA 3M32A 1SH3A 4PEOA 3QZ8A 2NQPA 3FFIA 2OUGA 3AD8C 1IBLF 3MPVA 2CIMA 3NGUA 3V4IB 2ASYA 1YZ7A 4YB1P 2VHGA 2CPYA 2G2YA 3TI0A 3VZIA 3PTWA 4P10A 3VGSA 4BC7A 3ETOA 3E2EA 4QYZJ 4IG3B 2LCWA 2OPRA 3H42A 5KG0A 5KT4A 4DR4F 2DRAA 3E3XA 3PM9A 1TELA 3T9ZA 4JI4J 3BKUA 2V67A 4JP8A 3BKTA 2ZD1A 1HNXF 2BOPA 5LT5A 3R6GB 1HBMB 1UJ4A 1F2HA 2A3JA 2DEJA 4DUZF 5DM6Q 4USHA 1JLAA 2MY7A 3MEKA 4NXNJ 4MYUA 1NK7A 3ZTSA 4HR2A 2WSCC 3LA0A 1HPZA 3GSDA 2XLJA 4WPAA 1HNWF 2CQDA 4L74A 3UN2A 1PILA 3LPEA 5DZ6A 3C14B 3T6BA 4KV8A 2QT7A 4CDIA 3OL8A 1CVJA 1RCOB 3K7RA 3TA1A 3DOKA 1N88A 2DCUB 3EE3A 5CYQA 3GSIA 1KDNA 1J5OA 4DUZJ 1Q82T 3M6XA 1TK0A 1JLQA 3CSKA 1JLEB 4C8MA 1VJWA 4DV2J 4GO5X 2LFVA 3BDEA 3MEDB 1ZPVA 1RTJA 3AHPA 4DF4A 1N36J 2IBKA 4HACB 4LBPA 3PNIA 1SV5B 4WE1B 5LM7E 3ZXWA 2KT2A 3OFGA 4DZDA 5KFFA 3R1LA 1S48A 2DHAA 4HTJA 1PO6A 4ECUA 1F5AA 1KC8T 5DG9A 5L1IA 5KFNA 4RW9B 2YKNA 2RQKA 1S0VA 5BYQA 5IM0A 4F3OA 5IQQA 3M9OB 1Q4RA 4NLWA 1JXVA 2UU9J 4MK8A 1E6YB 1REGX 2OMLA 2YWGA 2EK1A 3D7SB 5E33A 4X4UA 2DCLA 2BJ9A 2GGPA 3TZYA 3SSSA 2DIUA 1SKUB 3AOAA 1AUDA 4NCAA 4OHWA 4PG6A 2Z57B 2P9GA 2IVYA 4ANCA 4G1QA 3OXFA 3TP2A 1S1VB 5DDRC 3LPYA 1PC4A 3SIPB 5KFIA 4A47A 3HI9A 4JV5F 2LU2A 1F9HA 1YLXA 3H25A 2Q66A 2UXCF 3RBDA 2VOOA 2R4FA 2OLWA 1RBOB 2G0IA 5AXLA 2HQGA 6FDRA 2DHGA 3PHEA 1FXDA 1TK5A 2HHSA 1S9FA 4ETXA 1REVB 2AU0A 4Q2LA 2IC3A 5KFAA 2E5HA 5G4DA 3FBEA 4DPXA 7FD1A 1UPPA 4ZKAA 1NDKA 3M9MB 4EMDA 2BA9A 5BYSA 2MGZB 2EKYA 3BO4A 4ID5B 3GIRA 3PZPA 1MNEA 4NRUA 1TL1A 4OHVA 2Q1LA 5CZVA 2HKEA 3FRYA 5J1PA 3E8OA 4RU2A 1VQNS 2VPWB 5J1NA 1R0AA 5KFVA 1YDLA 4CYUA 1FHTA 2PA8D 2NSCA 1YTYA 1X5TA 5KT5A 1VQMS 3CCWA 4ELUA 2HMIA 3PX0A 3SQGB 3DOMA 3MD1A 1FK9A 1SPBP 2B4OA 1C1CA 3MM5B 2VODA 1N33J 2VC0A 2D41A 1TKZB 1UJ5A 3CD5A 4I0WA 3GE9A 1O51A 5HI7A 3GFZA 1CEZA 2HIYA 2FY8A 1HQUB 4IDKB 5LMNJ 4TU8A 2BANA 1OPZA 4RJVA 3TANA 3CO9A 2GO8A 3V81B 3FNNA 3HHDA 2CA9A 5SZTA 2VJUA 4Q8FA 4FXVA 2UVVA 4QU6A 1KN6A 4QIVA 3TJ9A 5A0YA 2LQ5A 2NPIA 3Q89A 3TA2A 4URQU 1JNRB 2FVSA 3M05A 4CLYA 4N5SA 2ZJQQ 2VPXB 1VLYA 4Y28C 2KM8B 1UP1A 2H51B 4IQXA 3EDQB 3FMWA 9ATCB 3DHXA 2QL7B 5HMYA 1RHMB 2HHVA 3B8HA 4CO3A 2UU9F 2HBZB 4FYVB 4Y2IA 4GC6A 4ZLPA 4DR7F 3RRGA 3H8YA 3QAUA 4LQ9A 3W9JA 4USMA 1ZM4A 5K8OA 4M5IA 3L4BC 3DI6A 2XEXA 3G86A 3HCXA 2FHJA 3I5AA 2VZ9A 4OYXA 4QR1A 3IWLA 1U48A 1VR6A 1QTMA 5F8HA 2OTLS 2FC9A 3PJWA 4WZQA 2C2KB 3EGNA 1YGYA 1ZA2B 4RBTA 4OYMA 2IRUA 4CLZA 3A3PB 5B08A 2YKNB 2O66A 3AJ2A 3QMQA 4UF4A 3SQOP 5DLGA 1NDLA 4CLWA 4FPIA 4F26A 5F9NA 3L7OA 4ZPVR 4ZK7M 2V5HG 1WACA 2YWKA 4R0EA 2N7CA 4GVLA 2XLKA 3KK1A 3N01A 2Q3PA 2FJBB 5K20B 1T03A 4CWBA 4FF2A 2NXJA 3TUZC 5HLFB 2O67A 3FQKA 2MZSA 1V9OA 4GMKA 3T9NA 4AFFA 4CLSA 4U67Q 4IFVB 3M8YA 3T1YF 2V34A 3MEGB 4I1TA 4LBHA 5K14B 2E29A 3NOCA 2QJ3A 1WOSA 2FJWA 2IDLA 2RRNA 2VPYB 3BBFA 2EFVA 1A0OB 1P9YA 4CH1A 4NLXA 1Z2LA 2X3DA 4R0JA 3IBCB 4RUBA 4WFZA 3M30B 4DPUA 2VUGA 3K58A 3CC2S 3JXOA 4J7CA 6AT1B 3I55S 2BOAA 2DNLA 4RW7A 3DHWC 3VQTA 3HM9A 3Q8UA 3LTOA 4QCLA 4DG1B 4B9LA 4DV0J 2CDRB 2ZE2B 3V6DA 2ROEA 3FBFA 3GCWP 5HVFA 4DL0C 5IT4A 5LOQA 3LP2B 3CMAS 1FE4A 2DO0A 4KPCA 4OI1A 2Y1IA 3GYGA 3QJPA 1HNIA 1VHIA 2WB4A 3BEGB 3NWGA 2NS1B 5E7OB 3SI8A 5K8NA 3L95X 1R0AB 2DNHA 5CH7B 4I2PB 3I0SB 3QIPB 2EPIA 1JLFB 1RISA 3C19A 3K5OA 5F8JA 1HBOA 3R5GA 2BKNA 5BR8J 2QIFA 2AJ0A 2LQBA 5DDQC 2XY7A 2F9JA 1WHVA 4ICLA 1EJ7L 4HHUA 5F3TA 5L8RC 1XR6A 3IN5A 1VQ7S 2JX2A 1Y9OA 2HNDB 2B3TB 2EK6A 4HEA9 2W1BA 1M5SA 4K5RA 1YHQS 1Q81T 3MECA 4OIXA 3CCVS 2A6OA 2GIRA 1NPPA 2VV5A 2HLTA 5ETKA 3TWZA 3VCDA 4XTTA 5A0YB 3JSYA 1MU2B 3MAAA 1NK4A 4J9LA 1X4HA 2ZDPA 1WNEA 2EFPA 4ES1A 1SKSA 2WSEC 2A2CA 1FKOB 2OPQA 3JQKA 4ED4A 4WYLA 5D6GA 1RE1B 2VU5A 5JJBA 2JFKA 2V68A 1X8DA 5I42A 1WD6A 2FC8A 1F5CA 1JXLA 3HSGA 3CMQA 1QVGR 3ZZYA 2GQCA 3ILLA 2NR0A 1HL6A 4NE9C 1OSCA 2FLNA 1NHVA 1C0UB 4OJGA 2E5GA 3GJQB 1VQ4S 2N7YA 4IR9A 4HVZA 3G6YA 1UL3A 3OR1B 1M5HA 2YNHB 2EG2A 1O0PA 2FTRA 3K2YA 4B9SA 1PC5A 2XHCA 1AW0A 5DGAA 4J9RA 1B0VA 4Z7YA 3CCMS 2OTJS 5IT9Y 3SDEB 2WVFA 4ECWA 2VG6A 4CLKA 2ZH6A 1SJFA 1Q8KA 2IMWP 2CZ4A 3AD7C 4M8LA 3VGUA 4K4UA 1X4FA 2ZOMA 4CTAB 1R43A 2W2NP 4ED2A 2UVUA 1QUVA 4M5MA 5ETLA 3NY0A 2RILA 4OLOA 2YH1A 1DTTB 4DV0F 1DRZA 4IO1A 5CYJA 2UVWA 2NUHA 3AJDA 3HHLC 2OPSB 1BLUA 1PAUB 4HYKA 3HHKA 4MK7A 4RKUC 5C7PA 5J2PB 1FNOA 1S99A 4ECRA 2ZH4A 1VRUA 2CVEA 4NYPA 4F0MA 3KMSA 5J2NB 1FRLA 1RHKB 1URNA 3HVTA 2B8QA 3KLEB 1KVKA 4RW7B 3CJQA 1NJZA 5IV4A 4BS2A 3MM7A 5CYMA 4FXWA 2IDEA 4U8VA 2UUCF 3DYAA 1GMVA 1RWKB 1RAFB 2P9CA 1RAGB 5GAGI 2H48B 2ZZMA 3MR3A 1Y5LB 4DV1J 5GAEI 1HA1A 5T14A 2PIIA 3MMBA 1T9VA 1VQ9S 3R97A 2AGQA 4M5KA 3OL6A 2LA6A 3C46A 3TVKA 1XIQA 3I0SA 3QIPA 3KLGA 3BF4A 2UUAJ 1EETB 1EQMA 2YX4A 2FHMA 5CYQB 4EGLA 4RU9A 4Q8EA 4DV4F 1HNWJ 1DTQB 2N4CA 1S1UA 2C3UA 3M8SA 1FXLA 3W5ZA 5CABA 3TQ1A 3KJFB 4XAKA 3QSYB 1DAXA 2YVSA 2YPZA 4TVAB 2OH2A 1FKPB 2N3LA 5SUHA 4MFBB 1FCAA 1WTFA 3M2VB 1NK6A 1PYTA 4AL5A 2MJNA 4DFKA 5EX3A 4JI4F 4N8NA 2CQ4A 3C6UB 4ZVSB 5KOWA 4Y65A 4YEAA 1D8ZA 3AQPA 2CRLA 2EC2A 3IWNC 2XZDB 1R3NA 2KHDA 2RS2A 1FKOA 1MWYA 1SIZA 5HN0A 4O0NA 1WG4A 2YQ1A 1PAEX 3FSIA 5CCLA 4DJBA 2C2OB 1IBLJ 2K7KA 3VQSA 5EDWA 2WAQD 3RJMB 2NZ4A 1KP6A 1LWCA 1IJEB 4NLVA 1VS3A 3KK3A 3U1LA 4RNFA 4JI6F 2MPUA 1WELA 4MMOA 2BUNA 2HNYB 1XR7A 2RAQA 3EPGA 2OP5A 3ITHB 3HP6A 4ES2A 3HHLA 1NDPA 1S77D 4UY8T 1KTQA 3C66A 2AT1B 4CT8A 1ZM2A 2UXDJ 3KG1A 1TV6B 5D4OA 2M88A 5B0FA 4DFPA 4OYOA 3QZ7A 4L6V3 1W7WA 3R9LA 4X66F 3ELHA 4FBTA 4OV1A 4M1KA 4A8QA 3QGPA 4LF9J 4ITSA 4O3SA 3DRSB 1S1TB 3I0RB 4ZPWR 2YNIB 3Q2TC 5J2QA 4JOUA 3EVOA 5G0RB 2FY1A 3R2CJ 2DEIA 2X1AA 4KT0C 3G6ES 4WCEQ 2C2EA 3PRDA 2VBXA 2YX1A 1BQMA 2AGOA 1YJNS 2LXUA 2I9SA 4TLRA 2FHKA 1VK8A 2MQQA 2L9WA 4F02A 2GFFA 4OZ0A 2J5AA 2DPJA 1X4CA 2IY5B 4RW6A 2CJQA 3WHIA 2XM3A 2BE2B 3JYTB 3QWPA 1S1XA 2W2PP 2N3OA 5GMDA 3UVJB 5F8NA 1C2PA 5J1EA 2EWHA 5HBMA 1U8WA 4KR0B 1UVNA 1FD2A 3KNAA 3KLEA 3CNQP 3QJLA 2LVWA 2K7JA 4ZVRB 3T19A 3CJ0A 4IDKA 4ZHRB 1FEHA 3CD7A 4QR0A 2ZOGA 1LWXA 3NWRA 1DQ9A 4NL5A 1IVZA 3R5BA 2I0XA 5GAGU 3VAHA 3RB3A 1S57A 1T7PA 1MROA 3K5LA 3HULA 2RNEA 3Q8QB 5F0WA 3LP0A 4NCGB 1KQKA 3T3FA 1IBKF 3MFIA 3UE2A 3MMJA 2B4VA 4I7FA 2QMUB 3VV2B 5C25B 4B9UA 1DTQA 1BHNA 2FYXA 3CJ2A 3DDKA 1HKAA 4MH8A 1OWXA 3P3DA 4OX9F 2VFRA 2DKOB 5IFMA 2KFYA 4F4YA 1WHYA 3GLJA 3FUYA 3QLHB 1S9GA 1VHFA 1X5SA 5ETQA 2AW0A 1Z1ZA 3CTRA 2XG8A 4QYRA 3PDNA 1YRUA 2A1BA 3I87A 4K4WA 4A8YA 1JLCA 1C0TB 3V4IA 4PG4A 5ETSA 4BLGA 1SKWA 3P6YC 4ED5A 3W63A 2IPOB 5HP1A 1HNVB 2DH7A 2EEYA 1J5OB 2UUWA 4FVMA 2NPFA 5B0CA 3NKYA 3N6NA 1LKZA 5H1SV 2F4VF 1TUWA 4DQIA 4PWUA 5D4NA 4EZ6A 1JLGB 1P6TA 2X3GA 3AT1B 4GC7A 2OGUA 2RDDA 3S8SA 3HPOA 1RT4B 2V8VA 1I94F 2D9OA 1ICEB 1U2CA 5C42B 1KKHA 2Z56B 3BH6B 2Q6CA 4ZP9A 4YMEA 5KFKA 2FGCA 1T3NA 2VOPA 1LW2A 4WU3A 1JLAB 2R7RA 2HGMA 1T0TV 3TVYA 1MN9A 2J76E 4KO0A 4IKAA 1IKVB 1X4EA 6FD1A 5HK4A 4F0KA 3C6TB 1F3VA 3JAMU 4J9QA 2D3ZA 5KFZA 1N54B 3ZC4A 2XC9A 2KFNA 4RW8B 1S1WA 2ZUAA 2MMYA 3L7PA 4C9DA 1NPKA 4PPDA 4CT9A 4DCPB 5C2CA 2ASDA 4KGKA 5F8LA 4KJIA 2R7UA 4U6PA 2XO6A 3CC4S 1CULB 2L9NA 2VKZG 3RU0A 2KM8C 5JUMA 1RT6B 3MEDA 4I6AA 2FQQB 2KXFA 4IH7A 3CJ5A 1UWAA 4HACA 2JC0A 1RT5B 1B99A 2HAFA 3FEYB 3MDFA 4PQAA 2BDPA 1TQLA 1KVIA 1SC3B 2QLWA 4PQUB 1XMQF 4C7QA 4NEYA 4ECSA 3DN9A 4LFCF 1UETA 1JLBB 4WXOA 4OX6A 1YITS 1NUEA 2AYMA 4NLSA 3CCSS 1RK8A 1E6YA 1SJ3P 4QU7A 2QMXA 5J2MA 3D28A 3H40A 4A8KA 1ULRA 1RWOB 2XSJB 3PR5B 2MSTA 2ZVSA 4M5DA 2A6MA 3OTEA 2HFZA 4OFZA 2O3DA 3GG1A 4LRDA 3N9UC 1TVRB 1FF2A 1GTEA 1U1KA 4ZPAA 2DNQA 3OL9A 3MECB 1NH8A 2MKJA 2OFHX 2P6TA 2H4WB 4ZS6A 3V4MA 2RJZA 3UR0A 2IRXA 3NS5A 5I3UB 3ETMA 1TL5A 1GT8A 3V6JA 1TL7B 2LYVA 2B5JA 1PIEA 3D0GE 1QVFR 4NXMJ 3X1LB 2IM0A 4NYZA 1YRXA 1N5YA 5HATA 3QT5A 4DR6J 2R8JA 1VYAA 1REVA 4C4WA 1YJRA 4W98A 2WVEA 3R7BB 2FJXA 2DR8A 2FLOA 4O4RA 4C48A 2G1DA 4PABA 1Q16B 4ED0A 2Y1JA 3M8WA 2JEIA 2E7VA 2FGOA 3MM8B 3M6WA 4I56A 2JRSA 3BM7A 5D4LA 2CAJA 2FVCA 2Y8YA 4R5PA 5KFPA 4NLPA 1BGXT 1WC1A 2P6SA 1YX2A 3VAFA 2AGPA 3GR1A 1S6PB 2C42A 3DGVA 4ZA1A 4LF5F 1OQ3A 2I5JB 2CFXA 3GG0A 3THTA 4K50A 1FRXA 4ZCKA 4X65J 1NJYA 3EPIA 3QGIA 2K3IA 2HZVA 1P27B 5L9NA 2JVRA 2KJVA 2WK4A 4LFCJ 3NNCA 1U26A 1NBEB 4DN9A 2KFZA 4B3SJ 1P9QC 3IR7B 5KTQA 2E9RX 2UXDF 4ZLJA 2DD8S 3EM1A 1B0TA 2KTQA 3IG1B 1RP5A 1LW2B 3CUNA 5HQLA 1NH7A 4GO7X 2B8PA 2QSWA 4FKYA 1CJUB 1RB0A 3BREA 1FJEB 1FKAF 1IM4A 1OY9A 3ILOA 3NXZA 4HL9A 2V4RA 4OHYA 5FDLA 4DV6F 3DC2A 1BC6A 4ILMA 5A8WA 1VLOA 3UD3P 3BV8A 1TFYA 1HBNA 3AOCA 4ILRA 1FFGB 3KK1B 2E9TA 3Q8PB 3JB9k 5B7WA 3HVTB 3AH6A 4DQRA 2UV8G 4WYWA 3A8KA 3J81U 3BQ0A 2D74B 3RAQA 3JTPA 4DL7A 3DI6B 2C3PA 2X1FA 4I2QA 4JI7F 4UUWA 5C24B 3D6TB 5DLFA 3Q24A 1H74A 2D7SA 2HS0A 1MMLA 5A8RA 4X64J 4JYAF 4UY85 2PDAA 2KKHA 1VMBA 5L39A 1F9EB 2GX8A 2KZMA 2E5LF 1DFDA 3TEHB 1SCJB 2HVZA 4CO4A 1RTHB 4I64A 2YY3A 1UW4A 4C0OC 3PR4A 4ECXA 2UXBJ 1M1KT 3OL7A 1F1BB 5HROB 1NMEB 5DETA 2CWKA 2PSZA 4FNIA 5HLFA 1JK9B 5FD1A 2JVOA 4ZVPB 5B0BA 3GIMA 3GQCA 2BW2A 2CPJA 3FMBA 1RJJA 4X84A 1KEKA 4DPTA 2R9LA 3HF5A 2DH9A 3D1OA 2BACA 4OZ2A 2MHEA 3PXGa 3J7A1 2AQ4A 5I3UA 4M5GA 2FZGB 2V6AA 4DR5J 4ANDA 4YB7A 2WB1D 2EG1A 4DV7J 2ZM6J 4DQQA 2HEKA 4ZP7A 2KG1A 2LEBA 2HBYB 4F3QA 3CCUS 2ZZNA 1CS4A 4P73A 1FRJA 4OI3A 4UOCA 4Q7AA 5E3PA 4LFBJ 3IA0A 4KHPF 3SV3A 2Z0GA 4JBCA 4V19J 1WF2A 3HHLB 2QA4G 3E01A 2HG4A 4HDGA 4QWDA 3SXLA 2OPQB 3I9V9 3T1HJ 4FF4A 1T9WA 4IG0B 2YTCA 3CDUA 3OXLA 3RUBL 3D66A 4IOBA 5ETNA 1X4BA 4OHZA 3KLHA 4KE5A 1CC8A 5I3QA 2YNGB 1AROP 3TEGA 2P5VA 5EWFA 2ZBQA 1YI2S 1I1GA 1JLEA 1DY3A 1RDRA 1Q86T 4C2MA 1S76D 5B0DA 5IS2A 4DU7A 2QYCA 3D5MA 1I51B 4UW2A 5DQHA 5ITHA 4AT1B 1J2VA 3MF5A 1SV5A 1HLWA 2ZUGA 3Q0AA 1U1OA 2FVRA 2FUG9 2YNHA 2POKA 3WBZA 3GV8B 3CDWA 4YB6A 4YFUA 3RW7A 5A8KA 2ROGA 3GB0A 4KGVB 2NREA 2HHHJ 5KFEA 4FF3A 2B9WA 1NKCA 2QA4S 2V0NA 1OPIA 2PN6A 3H2UB 3Q8YA 1N52B 2ALZA 5KOXA 2YKMB 4H4OA 1R0BG 3M7VA 2Z2YB 2QG9B 2QZ8A 4NA2A 3I32A 5D3GA 1PG5B 2KN4A 4OYAA 5AXMA 3J7Z5 3UD4P 2ADBA 1VBZA 1K0VA 3PYFA 3K57A 4P52A 3QFWA 2VL1A 5ETPA 4WK3A 1XWLA 2W25A 5KFDA 4I67A 2HHQA 2K06A 3SV4A 1SC1B 1VQYA 4LRCA 4ZOSA 4LF6F 3J7AN 4LR7A 2ABYA 2MQMA 2D3OR 4O23A 4A8OA 3DM2A 3U27A 4WFBQ 1VQOS 2HBQB 2NZCA 2ZKTA 4WBFA 4CH7A 4M95A 1X31C 4NYOA 1B7YB 3ZFVA 4PZVA 2ZH5A 4F4KA 2B0GA 3DU5A 2PA3A 1RTHA 2PFDA 3PFOA 2OSRA 4DWIA 2GAGC 3NG8A 3DMJB 3MCOA 3QATA 4TY8B 3LALA 2XS7A 3G87A 3SCKE 4U96A 2ERRA 4PRFA 1T9UA 2MQLA 2HZCA 2DR9A 3HLUA 3TAMA 4LJMA 4X4QA 1RT3B 2QV6A 4OZNA 3KUEA 3M2UA 2C2DA 4C8LA 2DGOA 2W2MP 2QL5B 3N79A 2C2RA 2CPHA 2IVFB 4LF2A 2P8IA 3SQGA 3NAIA 4IO9Q 1N33F 2LXFA 2WOMB 1TUGB 3UDLA 3H7HB 4YS2A 2DGWA 2ILZA 4ZVQB 1NPRA 1JLGA 4F04B 4Z7CA 3FEZA 4ALZA 4JI5J 4USTA 4DX5A 5CYMB 1RACB 1YSJA 4N56A 3ILJA 1YBUA 3DDIA 3PW5A 1RYSA 2G13A 2CYYA 3EXYA 4LVNP 4R8UB 1RU1A 2RE1A 3BKFA 5K9FA 3TUIC 3FEXB 3NMRA 1QJHA 1FFSB 1UEVA 3VZHA 3K0JA 3VVTA 4M5HA 2ZBIA 3CJRA 5D15A 1Y7PA 2GIQA 3THPA 4NPOA 2HFUA 2M7SA 2UP1A 1P8GA 3BGRB 2E7XA 2HQDA 1E6VB 2J7WA 1U1PA 2JLFA 2JC1A 3NAHA 5IQ6A 3PX4A 1NKEA 3RR8A 1KD1T 4ELVA 3D6MB 2CJXB 3WZ0A 4A48A 2J6TA 4S0MA 4H4KC 5KFUA 4ZVUB 2ILYA 2GHVC 3R7NB 1GMUA 2RRAA 1VQLS 3IXQA 2ZH2A 1RT5A 3CF5Q 1BE4A 4OLPA 1KHWA 3H0PA 3WC0A 5LXYA 1SXLA 3OT9A 1LV5A 1JKHB 3LP1A 2CQIA 2HRTA 5B0GA 4B3SF 2U1AA 3NMAA 2BMBA 2CJAA 2DB1A 2DXFA 4ID8A 4JI0F 3FQLA 3RBXA 1JLBA 2D3O1 1IKWB 2H5JB 3TJ8A 3CC7S 1R8HA 4F7VA 3DOLA 3BQ1A 3AAWB 2DNGA 3PACA 2WBRA 3TO8A 1RU2A 2E7WA 2V4JA 1MLAA 2DNKA 3MPUB 1RT1A 3KLFA 4RPFA 3V2UC 5M2UA 2C28A 4ZN3A 2FJDB 1FVQA 1RWXB 1K47A 2W4CA 2C1EB 3MTJA 2RHQB 4LF1A 2B56A 3NS7B 2M5YA 5HMWA 2VICA 2X1GA 4KQZA 1Y3JA 5FJ4A 1CJTB 1IR0A 4O3OA 5HJXA 4Y0FA 1TKDA 3DLJA 3QRRA 4A4JA 2HWIA 4G1PA 2GV1A 2VA2A 2MKCA 4JI5F 1MN7A 1J5EJ 3NNAA 1RT2A 4O3RA 1HMVA 2B9XA 4O3QA 5HANA 4ED8A 2AYGA 2HK2A 3K5PA 2OEJA 3F41A 4J9KA 4ZPTR 2F4FA 3CIMA 5J2QB 2B7BB 3VR1A 2DXEA 3LP2A 2EFQA 5CZXA 1U8SA 2ATCB 3MM8A 2ZH7A 4DCJB 1TKTB 2CQ1A 4O4GA 2CKWA 4TU9A 3DRRA 1Y11A 2MKSA 2VQFF 2GJIA 2V8PA 1H0HB 5CCMA 2WW4A 4FP9A 4KY3A 5HO4A 4Y2AA 4DV3J 1WTBA 3BR9A 2KDOA 1UVMA 4EBCA 1JIHA 4OYPA 1S9GB 1XTZA 1JMTA 4F25A 1XMQJ 4Z2XA 3I9ZA 3U1NA 1G7CB 3AA9A 4WWSA 3RRHA 2OELA 1ZBTA 2WVCA 2QGFB 3MR7A 2MKIA 2VIHA 3NL0A 5KFXA 5LSRA 1D3WA 3ET6A 2DK2A 4H4MB 1U1MA 3EZ5A 2LEAA 1FJGF 1JX4A 4F67A 5E3AA 3CDAA 2VA3A 2V4QA 1TKXB 2RKIA 4EK2A 2QEXS 1VOMA 3DKDA 3Q8RB 3GYNA 4PCQA 5I42B 3AOBA 2RH3A 4KGZB 2M3DA 4DXLA 4LF4J 1HBNB 2YKOA 2ZC3A 2KT5A 2XHWA 2DNZA 3G82A 3BGRA 5C42A 4NLYA 3TX8A 3OLBA 2CWXA 4JI1F 1ZPWX 2CJBA 2JEGA 2WTFA 1RTIB 3WC2A 1U45A 4YR3A 4DSLA 2OSQA 3DDNA 2XCPA 2F8HA 5EHHA 2BJDA 4DL5A 4DL3A 2OO4A 3CCQS 3QO9A 3CT9A 4NASA 3TVZA 2DR7A 1XNQF 3SZ2A 2I8EA 4F8RA 3C6TA 2MZJA 4DV1F 3VGVA 3IM8A 1JKHA 3LP1B 2N82B 4X4RA 1I3OB 1SL0A 1D9AA 4J9VA 3QJJA 4RW8A 4DX7A 1M5PC 4CNZA 5AE1A 4CI0B 4FZVA 4QBUA 2Y9HA 3PFEA 3FBCA 3HJFA 3BS9A 2CJYB 4DSKA 1GEHA 4A8FA 4NZ6A 2IA6A 3GR0A 3MM6A 2V2VA 3CCLS 1FO1A 3AXKA 1G4CA 3V6HA 3M8PB 5H9FK 2LQJA 3R5CA 4NZ0A 3HX9A 4B08A 2ZJRQ 3CCRS 1GXUA 5HMXA 3BBBA 2YKPA 2YBVA 4DOZA 1CJTA 1W26A 4QWAA 5J2PA 1KFSA 5DM7Q 1RHQB 1GH8A 5IXUA 2W24A 3IM9A 2DGSA 2EW9A 4K0KJ 1WC4A 1DLOA 1WJ9A 2LU1A 5IZHA 3WIUA 4PUOA 2K2PA 4RWWA 1PYOB 2ZH9A 4E0DA 2CZVC 5EN1A 3HFZB 2DNOA 5E3RA 2ZNZA 2FJVA 4IH5A 5KFWA 1CLFA 4DV5J 2QC3A 1PGZA 3VWSA 4BWMA 4DS4A 4UT4A 2C2NA 4PG8A 3UCZP 2DGTA 1N48A 1XNRF 1RAEB 1U1RA 3HJVA 3UDEA 5A6PA 1X60A 2JOQA 2Y1LB 2VQFJ 1TKTA 1PJ7A 3E01B 2MLZA 1K1SA 2HHWA 2W2QP 2EBGA 3A13A 4GRSA 3TZZA 4B9TA 3CPWR 5KFLA 2X51A 4ED7A 1S72S 4RNNA 1ZOTA 3VALA 4NEZA 4WIIA 4JI8J 5BJRA 2AHOB 5AJ3F 3MEEA 5BXIA 4DV4J 2AIRB 4EYHB 4QYZK 1MWZA 4KHRA 4JYAJ 2XS2A 4NLRA 5K5MA 4P74A 1J5EF 3ET6B 3DRPB 1S5ZA 1FFWB 2BYCA 2CNKB 4ES3A 2BJ7A 2FD2A 4RX6A 1S6PA 3EVWA 4TY9A 3LGMA 4ATNA 4L72B 1H98A 2OPRB 2YNFB 1CSJA 2E66A 2WW8A 4Y34A 5DJBA 2VG5B 3IWXA 3W62A 3ZTRA 5LJ5Y 4LF8J 2XNRA 2XB2D 2MY8A 3GIJA 1FDNA 4USKA 4DR4J 4F4XA 2H4YB 3G82B 3W2WA 3KK3B 1WHWA 3FDSA 3G71S 5BR8F 1GXTA 2DHXA 1TTHB 3C16A 4ZCIA 4B3TJ 1UEKA 5KFMA 2G2OA 4QIEA 2RF2A 4IRDA 2G1HA 4R5PB 3G6VA 1L5UA 2KL8A 1HI0P 2F8MA 4WIQA 1YWXA 4TKTA 1NK5A 5EX0A 4WKYA 1Q1KA 1X5PA 3BH7B 3PW0A 1WKKA 5L38A 3CJTA 4FKXA 3KUHA 2J9CA 1WC0A 4MT1A 4OYBA 4CLTA 3NNHA 3KK2B 1H2UX 1HHQA 3VVUA 4KH1B 2R8IA 1W2BR 4P2FA 4ECTA 1IUJA 1FWPA 3D0HE 3IGNA 4TY8A 4GKJJ 4OL8A 3UI3A 2UXBF 1QAXA 1YJ9S 3OFEA 1UZHA 2VASA 3J81j 3GV7B 5IT9U 2FVQA 4Q2MA 1BWEA 2Q43A 2GS8A 3LQVA 3MXHP 3R8YA 3TJAA 2D9PA 3HVRA 4RW6B 1LW0B 2M70A 2XWXA 4KC5A 2CQBA 3IRWP 2CPIA 2KYZA 2RMLA 2EXUA 1EX8A 5ETTA 4B9MA 1T3OA 1KQFB 2GMHA 4WZMA 1TL3A 4U7UD 2FLLA 5GAHU 1UAWA 1VI7A 3D0IE 3P4UB 1CBKA 2HWHA 1Y0HA 4V1Ak 4U7CA 1SJQA 2MKYA 4NMLA 4ZPCA 2OKQA 2AX0A 4Q44A 3MFHA 1JWWA 3TA0A 3OD2A 3KHHA 2QN6B 3R7SB 3LAMA 2HGLA 2J9DE 2MKKA 3D68A 1XNRJ 4USIA 1YJ7A 4ZJLA 4BWJA 3PX6A 1HR0F 1FD8A 3G9CA 4RBVA 2A0FB 3THVA 4QWBA 1OJ4A 3EWGA 1VQ5S 2CNLB 5D0EA 1A6LA 5KFOA 5AE3A 4QW8A 1VIOA 2UUBJ 2XULA 3SSRA 3ENVA 3W66A 2BE9B 3CJSA 2MZTA 3EYZA 3MMAB 2GO9A 3Q23A 2K3KA 2CVIA 3TYTA 4A8MP 1YRTA 1YQHA 5DQIA 1U4BA 1M5KC 1UMJA 4CCHA 4D3HA 3CJKB 2KRRA 2A2DA 1KLMB 1C0TA 1JLCB 1Y10A 2HGNA 3NGKA 2HVIA 4Q45A 1TR0A 3UCGA 2MHNA 2CNNB 1FXRA 3VAIA 3W5XA 1XMOF 3VAJA 1M1HA 1C1CB 3MM5A 1UPMB 2GCFA 4RWXA 1SH2A 1JNZB 2HWTA 3DRYA 2F63A 4LSNB 1RT4A 1T05A 3HFKA 2Q79A 4KIAA 3KJVB 5U47A 4RUHA 2DJWA 4L73A 1VRQC 2BANB 3U1MA 3U02A 1IWAA 5KT7A 1R0CB 5K8MA 2VBWA 4OJHA 1DTTA 1FRMA 3L09A 3CWJA 2KH9A 2J0SD 4F4AA 2YKQA 2CQGA 1T95A 1WF1A 1Q8IA 5D0RA 3G8TA 3ISZA 3LAKA 2AJ4A 3LGNA 3KG4A 5IC4B 1ELOA 2GAHC 1RA6A 3C3LA 3W1YC 2DNYA 1FRHA 3CJ4A 4TYAA 1XNQJ 2A18A 2YH0A 2RUGA 2HK3A 3WQPA 3OHAA 4JUZA 1IQZA 2F4VJ 1HFEL 3H2LA 3SSQA 2DBBA 4DSJA 1HYSA 2H9ZA 1WWHA 2OPPB 2FDNA 2VH7A 3A3NB 2V8GA 4KGXB 1NAQA 2CPXA 3UWTA 4NMXA 3W3SA 5A8KB 4HT7A 1EP4B 1WI8A 4B3MF 3O6QA 4NCBA 4USVA 2F3JA 4ECVA 4NLQA 1C4CA 1XERA 2FHOB 5J2MB 5HQMA 3IFEA 5LSLA 3D2WA 1RSCA 1HNZF 3VAGA 2AEMA 1WKLA 2DGUA 2PC6A 4CLLA 3NBPA 4C8OA 1WKJA 3O8WA 1IBKJ 1W25A 2FJAB 4QPXA 1ROFA 1XR5A 3W5YA 5LMUJ 5HSPA 4GKKJ 4ANEA 4ZCLA 2FZKB 3CDEA 4OI4A 4DV3F 1RT7B 4IG3A 1OYDA 1TL7A 2RIJA 3CO0P 4EWTA 3NCQA 5ETRA 2DR6A 3H4DA 4ZP8A 4L3NA 1CG2A 2G0CA 1NJIT 3PYDA 2CXEA 3IR5B 1Q95G 2UZAA 1OIAA 2MQNA 3PW7A 4DG1A 4B17A 5KFBA 1ZAWA 3CJ3A 2ZE2A 1LWEB 3V6DB 2KRBA 3DGPB 3Q2SC 1NZAA 2JDJA 3HD2A 1QSLA 1HPZB 4LF7J 3TAMB 2J9EA 3RB4A 4I6WA 1L3VA 1M5OC 1UTAA 4UTGA 2Y3YA 2Z4PA 3W64A 2I5JA 2M4MA 1OQ6A 4DR3J 2ASJA 3U7JA 1CQMA 3BJYA 4B3RJ 3W8PA 3OUYB 2HNZA 5F8GA 3F0NA 5D77A 3PIPQ 2Z8QA 3RTVA 3KLIB 2DT9A 2PEBA 3SFUA 1V5VA 3S6EA 4ICLB 4O44B 3AFGA 4KRWA 2HFVA 5AT1B 5CQGA 1GK8A 4QQBA 2YKAA 3VTIA 2XQCA 3EX7B 1ZETA 1Z4UA 5KFCA 1NM2A 2QFJA 1RTJB 1TUVA 4ECYA 2Z2LA 4WU2A 4ZPDA 2E1RA 3RYLA 3TR5A 4WE1A 1BQMB 2PMHA 3D1QA 4ZJQA 4R8UA 3KUGA 3IO1A 4G6VB 5F8MA 2R7WA 2VQEF 4XO0A 4FN5A 2B43A 1X9WA 1PCAA 3O3LA 3JQJA 4TXSA 3UQSA 5LXRA 3OHBA 1RHJB 2BE2A 2VBZA 2NYIA 1RCXB 3R5DA 1JXEA 2GGPB 2HSEB 5A2QY 4P9SA 2VONA 2I2YA 1WC6A 3GILA 1SUQA 2BRKA 3RG6A 1WDDA 1E6VA 3O44A 2M52A 3OQ2A 2C3OA 4P71A 3QPIA 1WG5A 3GCXP 4CO2A 1C0UA 1S79A 4L75A 3J7YU 4JV2A 3UNYA 1S1VA 3MTKA 1VGYA 4ZDNA 4AD6A 1S12A 1YVFA 3O2IA 2LDYA 4JV1A 5EGYA 1OMSA 2H3EB 2DGXA 2P9EA 3LOUA 1KBRA 3HSZA 4DUYF 1FI4A 3TUJC 3IS9B 3OW2R 4EI2A 2ZDOA 4KKOA 1PKUA 1KOHA 1IN0A 2HIQA 2HVDA 4P2XA 3NEKA 1GMWD 2G2ZA 3HZGA 4EU0A 1RI7A 3MOJB 2XWYA 4EYIB 3S7RA 4OQJA 3TARA 4HLBA 4NXMF 4ECQA 1ZA1B 2CDQA 2ZEJA 4DR1F 2J6SA 4WF9Q 2OPSA 2MJUA 1BUXA 4C97A 4M5JA 2HMIB 2KYXA 3TNVA 1EQ0A 1IXKA 2V50A 2L9DA 3HK2A 2JNJA 2RUSA 3NGTA 4B3OA 2MKHA 4ETZA 4Z37A 4NWBA 2DH8A 1FK9B 1NEEA 4PXDA 2MQOA 2YX7A 4DUYJ 1YJWS 1RT2B 2YWFA 4AXIA 4J9SA 4CP5A 2R2RA 3IRXB 2HRUA 1FWKA 3BYRA 1LWEA 3K8WA 1OYEA 3C16B 1FDAA 1DURA 2MLXA 3DGPA 3DXSX 3PKYA 3M8QA 1K44A 2VF3A 5D0GA 4BC9A 4NRTA 2F5GA 3MMBB 3KNGA 4G65A 3H4BA 4OX9J 1NCLA 4IG0A 2H5EA 4OI6A 4C0BA 5F8IA 1RGVA 5T7LA 5GAEU 3CE8A 1EETA 1LK7A 3H5XA 4RL1A 4TNOA 4X65F 4DF8A 2BM1A 2JEFA 4EUVA 2WCXA 5IWAJ 3GIKA 4DQSA 2J0XA 1N5TA 3FK4A 3KK2A 1O8BA 4M63A 3T1AA 3UR3C 5HVHA 4P7TA 1LNQA 1FKPA 3EDRB 3FKBA 3MGJA 3I5BA 2AYBA 2W01A 3GTYX 3M2VA 1Q5VA 3P96A 3G8SA 4JI3J 4NX9A 4ILLA 4H4MA 1VQPS 4PQUA 1Y5IB 3V5RA 4XIUA 2B51A 1IBMF 3WX8A 3HVAA 1KNZA 2HQFA 1O6XA 2HRYA 5B0EA 4TN2A 1W2IA 2C3YA 4DR2F 2IHR1 3OSPA 1U09A 4MKYA 1TL3B 1O5JA 3HT3A 2EFOA 3O1LA 2GJ2A 4OZ3A 5AXNA 1SJ4P 4YOEA 2HNYA 1IR1A 2BEFA 1BWVA 3ITHA 3UCUP 2KZZA 2R2TA 3MHYA 5K14A 1X4AA 3NGSA 3FC9A 1UCNA 4LMZA 2WRMA 4IFVA 5GADI 4PYAA 3OVAA 3X3UA 4DU8A 5F9LA 1HD1A 1SVDA 1RYRA 3DM2B 2DY1A 3GPAA 3DLGB 3ILIA 5KFGA 2B6AB 1EARA 4JV5J 3OPKA 2CQ2A 3TQEA 2KB2A 2ACYA 4I4BA 1I5OB 3DRSA 2E5JA 2M2BA 3POTB 4MTPA 2ATLA 2J9DA 2V2KA 3AXMA 5GMEA 4DL2A 1UVLA 4CM2A 4C98A 1CPZA 2RU3A 1OSDA 1TP7A 2VDHA 4LREA 4M5NA 1RAAB 4YHHJ 1WEXA 2IYIA 3N6LA 5I3PA 3JQMA 4P2MA 5JXSA 4KV8B 3A8JA 3KDOA 4C3KA 5KFHA 3M8RA 4DI6A 2ZM6F 3ZTQA 1S6OA 1WSVA 3QYYA 4ENOA 2W7PA 2EKNA 2W7AA 4UOGA 2CZ9A 1FTRA 3BN7A 5DO2A 2AYEA 3G6XA 3F73A 5A6WA 5KG5A 1XEZA 4UZBA 4IRKA 5DZ7A 3P49B 1X0FA 4LIWA 1ZZFA 3BO3A 1B64A 3IBFB 4OX7A 3DLHA 2AJFE 2YPYA 4J37A 4O0IA 4F2RA 4ZJOA 2NCKL 3I56S 2XMVA 1L3KA 3IRXA 2HNDA 3AY0A 1T9TA 3DCAA 2AP6A 1SKRA 3LWLA 2C2MB 3UW1A 4UQTA 1MROB 3M6VA 3ENWA 1YBTA 1I94J 2Z2MA 1LWFA 3K17A 1M1GA 2AEFA 4MK9A 4RO0A 4UUXA 1DHMA 4X64F 1H7XA 3I82A 2LKZA 1KLNA 1N5SA 3PO5A 2ZBCA 2HURA 4MKBA 1VDHA 4D3GA 4PG5A 2E44A 4WP8A 1FE0A 2BABA 2XYHB 4HT5A 1KHVA 3JTNA 3ULHA 4K4XA 1IBCB 2B4PA 3T6JA 5AXKA 2Z30B 4RZRA 1RKJA 4ELTA 4MJKA 4X66J 4X4VA 4KH0B 2CUYA 3Q22A 1UZDA 5E41A 1BQNB 1RTDB 4O3PA 3K5NA 4C3MA 2OPPA 2E9ZA 3JSRA 2RQ4A 1SL2A 3CDBA 2WSFC 1CQNA 2R8GA 2UXCJ 3S01A 1VQ6S 2AEJA 2AV5A 2BV3A 3KG0A 4U9RA 2MB0B 3Q8VA 2VG5A 1BXNA 2BXJA 3R5JB 1T8EA 5ETMA 2JL9A 3BSNA 3RBEA 4K2XA 1X5OA 4NZ7A 4RUCA 2LDIA 2CPDA 1V3RA 3I96A 2R2SA 3D4JA 2CQ0A 4K2JA 4CYUB 4QIWD 4P75A 4WFNQ 4B3MJ 4IR1A 4X4SA 1RQ0A 3M4XA 4LRAA 4HHHA 1VISA 2BVZA 1Q8BA 3FZ2A 1LEOA 3PCOB 4XK8C 5KFTA 5T41A 4CZCA 2RHSB 1F3FA 1ZTWA 2JSXA 4PYDA 3TAPA 1TKZA 3VAMA 4J9PA 3R6LB 1JJ4A 4CNYA 1HMVB 3OVSA 4DUTA 2K1RA 1NZ8A 4N8OA 3MCNA 5KG7A 1N6QB 1WOOA 2OMOA 3GV5B 1VRTA 3MM9B 2RQCA 1U0HA 3KHLA 3MR5A 1V3SA 1YJVA 3RB6A 2AZ1A 4OJ1A 1K73T 1RT6A 1FVSA 4N76A 3K5MA 5L1JA 3CJ8A 1T9XA 4C8YA 2LLZA 4K4TA 2C3MA 4DR1J 2W8LA 3FRZA 1MWQA 2NXNA 3VGTA 5DGBA 1RTZA 3ISND 5D4PA 4DX6A 2GMJA 1HW8A 2BRLA 3N5FA 2DITA 2J8AA 3OTCA 1NJXA 2F1FA 2XTJP 4K4ZA 1EIYB 2YNGA 1APSA 2HNZB 4P2SA 2H5IB 5KT6A 2QLBB 2XMWA 5ETOA 2HPUA 3EJMA 2M8HA 1FDBA 3B6BA 2D3UA 2Z2ZA 2UV8A 1EKSA 4M5DB 1HNXJ 2PEHA 1YJUA 4MFBA 2ZHBA 1FJ7A 3NP5A 8ATCB 1RHRB 5MLCV 2OHDA 4DDFA 3PEHA 1MMNA 2QA2A 1RHUB 2R8HA 4LR9A 4QOTA 3ENAA 3P5TL 4JB8B 1K1QA 3QGHA 4X4TA 2QX0A 3Q8SB 1R31A 3P5BP 1MMDA 3HZEA 4AQYF 4C0HA 1NK9A 3M1VB 1S9EB 1QM9A 5EWGA 4L76A 2IMOA 2ZHAA 1U1LA 3DNCA 4K0KF 1U6ZA 4A8WA 1P1TA 1RA7A 2BJEA 1HWUA 5D3GB 1RAHB 2LQ9A 3MUVP 4P72A 1HHSA 3OV7A 3A4TA 4CIOA 1X0PA 2RDJA 1SI9A 2ZWOA 3C14A 1BQNA 1X4GA 4DN0A 1TMJA 3OFFA 3ZTOA 3KOAA 3LUYA 4KGMA 5FLXY 2ZH8A 3D67A 1TV6A 3US5A 1RWUA 2HHPA 1A7GE 1AB8A 1RWNB 2XI3A 5D0HA 3MR6A 3LANA 1B7FA 5GVQA 1S10A 4DLEA 1Q0NA 2R7OA 5F3ZA 2L48A 1S1TA 3DMJA 3I0RA 1VC0A 4WKRA 1V6HA 1XJWB 1FEEA 1WDTA 3RAMA 4DR3F 1SJRA 3DLLQ 1GFWB 1B0PA 4LRFA 2PFFB 2F40A 3O5TB 3MD3A 3NCRA 5E2QA 1S0NA 3GJTB 4OI2A 3CXCR 1XBWA 4FYXB 2GVDB 3KKFA 3L9ZA 1FNXH 5J1EB 4ZVFA 3FGVA 1C1BB 4AE5A 1CJVA 3JYTA 2XMJA 1S1XB 4U95A 4GKJF 5GMKa 1Q79A 3A3OB 4ZVTB 1IM6A 3LGHA 2K1RB 3TW0A 1QSSA 2COLA 4A46A 5HMZA 3T1HF 2FLPA 4JI0J 2KI2A 1U25A 2RS8A 3MUTP 2BM0A 2KXHA 3H5SA 1U0HB 2XS5A 1MSWD 2VD3A 2W9BB 1JB0C 2VG7A 1X4DA 3LW5C 3BPDA 3PJXA 1GX6A 2CNOB 1YG0A 4OZ1A 4DR7J 3FVYA 2YWEA 2BE7D 2OAUA 3PYGA 4NOHA 3HFVA 2HFOA 3J7YI 3N6MA 3D3BJ 1HBUA 4PG7A 1NJWA 3PV8A 4H4KA 3QT8A 1Y3KA 1UEUA 1ZM3A 2DRDA 2JLGA 3RZAA 4ZVEA 3SYZA 4AYBD 2IRYA 4YDXA 2C22A 3BR8A 4N41A 1M0SA 3BGLA 2XO7A 2HQIA 1S6UA 1S59A 1VCTA 3G2XA 5HROA 3SCLE 1XMBA 5LMNF 3KTQA 2G4BA 3FSXA 3OR1A 4HI2A 1PBAA 1K0TA 1H2VZ 2F65A 4C8ZA 2KJWA 5HP1B 2NUUG 2ZZTA 5KG2A 2FJEB 3J81Y 2BQRA 4H54A 4BDPA 4L3KA 2V9WA 3OUYA 1T11A 1VIXA 3SDEA 1RT7A 3G8QA 4DLGA 3T1YJ 3HT0A 1YK9A 2YQ0A 1AZSA 2BJ1A 4YP3A 4G3IA 2VC1A 3W65A 3UDVA 4OJ3A 3V81A 3H59A 4ZN1A 2BJ3A 2IIHA 4A8XA 1UWBA 2ZBRA 3ZTPA 4DR2J 4JI7J 2GJFA 1FESA 4LR8A 3IMQJ 1NSAA 5CHCB 1H73A 4PPZA 1WOPA 1FERA 2RF2B 4LF9F 1FA0A 3HHLD 4R25A 1IKVA 3OTDA 3KJNB 4B02A 5DG7A 4UZCA 2NYHA 5F41A 2X7IA 3DLGA 2AJ2A 2HYIB 2R2UA 3M2RA 4MIAA 3EZOA 4JI3F 1SQEA 1TK8A 3ISNC 2PE8A 1HW9A 1QY7A 1HWJA 2JJ4D 1KONA 2LP4A 2MYFA 2BBEA 2FPHX 3DYAB 4O44A 2B7CB 1EZZB 2V2QA 4IYQA 1CULA 4ZPBA 3EXCX 2IAJB 1T94A 3KFWX 2GIFA 1S7IA 4JI6J 4UOHA 4F36A 2YWWA 3OJUA 2C2ZB 3FCVA 2X1BA 3NCPA 1RLCL 3CIZA 5DS7A 2RSQA 1U6BA 4Y3CA 3GIIA 1IJFB 4C3LA 3GFXA 1D8YA 1N34J 3BSCA 4RW4A 4H4OB 2FZCB 3BYPA 1Q7YT 3TZXA 4YUDA 1M90T 2UUBF 1S7HA 1KRPA 1SUQB 1QTNB 1S6QA 2V63A 1MW7A 4W90B 1TVRA 2ALYB 2RRBA 2LA4A 5CAAA 1WUUA 3CCTA 3DLKB 1HIYA 2DO4A 2V69A 2VG7B 3MEGA 2OI2A 1RWWB 3P8BB 3QWUA 3W2VA 4CO5A 2GQQA 3CVKA 4HH1A 5JMNA 4F4WA 3OSNA 2I38A 1U2RA 3IC1A 3R5AA 4QIGA 3HVWA 1G2EA 4ZMMA 2AJ1A 2ZD1B 2ROPA 3FBBA 4KBIA 4RNMA 5EUHA 5DRKA 2XGQA 4KKOB 3K8VA 2XNQA 2DNMA 5AJ3J 2VFSA 2XI2A 1TAQA 1VBKA 1RTIA 2MDAA 1Z2ZA 3AD9C 2IJNA 3F56A 3HSJA 3OLAA 4DFMA 1F2GA 1WEZA 2ZKUA 3BGUA 4PR6A 3H5YA 1HNIB 3CMES 4KSEB 2EVZA 1R89A 2FHJD 2MSSA 1QDUB 2CPZA 4MYTA 3DRXA 2BQUA 1ZZNA 4I2PA 3PRBA 1NNDA 1UVKA 4PXEA 2U2FA 4ZVGA 4C11B 1Q7LB 4WK1A 2HVHA 1NLKL 1TU0B 3C8YA 3K89A 2MTLA 5LMUF 3KHGA 3RRKA 4DR5F 1KSPA 3KJQB 1UVIA 4GKKF 1AZSB 4CO1A 2AJQA 1WG1A 4AQYJ 3R3TA 3OR2A 4Y00A 2DGVA 3NRBA 4J9NA 2XZTB 1UWBB 4URSA 3ZNJ1 1NKBA 1F60B 1EKRA 2HS4A 3B4DA 2DISA 4KHMA 3M8QB 3MAAB 3C15B 2MZ1A 5FDLB 1K8AT 2Y0SD 3LH2S 5M2PA 4OI0A 3IAM9 2EFGA 3KWMA 4X4PA 1WORA 2NLWA 3EZUA 3UVJA 2E1AA 1XK8A 1ZM9A 1LXJA 2CQHA 1RAOA 2GVZB 4DEZA 2ZH3A 1DQAA 7AT1B 2ZWPA 3OFHA 4WXWA 2RVJA 4KFBB 4QW9A 4G1QB 2IFXA 1PBUA 3QBCA 5A76A 1DZ5A 1D9DA 2UUAF 4I2QB 2QLJB 5L9XA 1PSDA 3ZZPA 1NB7A 3G4SS 2DTJA 2ZVIA 2CJKA 1RWVB 1FNMA 3T5JA 1D09B 4FYYB 2E1PA 1AFIA 3CULA 1GAOA 4I68A 3ZZTA 1Y5NB 4LF7F 3ZZUA 4NI2A 3QRQA 2H65B 2DHSA 1OY6A 3HXMA 3BGOP 1TMMA 1WC3A 1IKYA 3EMTA 2W9CB 1F9FA 4ER8A 1N32F 8AT1B 5CA5A 3RR7A 1NHKL 1XC9A 2O1PA 1QAIA 4ID5A 1NSPA 4IFYA 4XDCA 4K4YA 1B3TA 2VPZB 3DLKA 2MZQA 3TAQA 3DRPA 2OEKA 2Y1RI 4AL7A 3W2VB 1GQEA 3D6FB 3OXGA 1PJ6A 1IR2A 5DQGA 4GVBB 2KG0A 4PWDA 2NXEA 3AB4B 5KT3A 1NSKL 2OFGX 1DQ8A 2YNFA 3DOMB 4DV5F 3T5KA 1S49A 5J2NA 3T5LA 4NLUA 2E5IA 1WF0A 4OYZA 3H5UA 4PXCA 4QWCA 3EUNA 3HKWA 3I5CA 3R27A 3CD0A 2QE5A 3MAHA 1HQUA 1VQSA 1N5QA 3MM7B 5E3CA 5HVGA 1RWMB 4F50A 4DPYA 3L3CA 2OD4A 4PXBA 5HQ8A 1CS4B 1R6VA 2MZRA 2FVPA 3NLCA 8RUCA 3SMZA 5CD4A 2KU7A 3RGIA 4KO0B 1B70B 2APOA 3IAS9 3OBIA 2WVBA 1NHUA 4AL6A 4O3NA 1NXIA 1GNKA 1HD0A 2XMUA 1LWFB 1X7VA 2WVDA 4QJVA 2GMLA 4DV2F 1N36F 2PI4A 4DX8H 2BJ8A 4C8KA 1N32J 3JTOA
chains in the Genus database with same CATH topology
2VKRA 1N56A 1WI6A 1S1WB 1LK5A 1S1UB 5KFYA 1WHXA 3ZZOA 4N77A 1UFLA 2JLEA 2WONA 5FIIA 1IKXB 1RTDA 4JI8F 3C6UA 1UJ6A 1GTHA 5JVHQ 4K59A 2J7UA 2PO4A 4OX8A 4OZLA 4KTQA 3FCHA 4UQGA 4DQPA 1YBAA 4Q5VA 4OZJA 3EGWB 1VQKS 2RD5C 2YKMA 3CEDA 4LUBA 4FVCA 1LXNA 3TOQA 3SCIE 3MWBA 1U49A 4EZ9A 2RU9A 5GAHI 1D0EA 5KG4A 4IOAQ 3IBWA 4Q0BA 4P6QA 4JV0A 4Q43A 2EC0A 2J0WA 5IWAF 1QLNA 2GA7A 2JH3A 4DSFA 4NLTA 1V3ZA 7FDRA 3LO3A 2B5JB 3V6KA 4J9OA 4DFJA 2RDIA 1BD6A 3W7BA 1S0MA 4LSLA 1IKYB 3FJ2A 5B0AA 2W9CA 2DNRA 5G0RA 1G3OA 1LOUA 2CG4A 3MM6B 1C4AA 4K4VA 3SEOA 1NK8A 1RT3A 5KFJA 2ZJPQ 4LF8F 4X62F 1SL1A 3M2UB 3D1HA 2J7KA 1UA0A 4HDHA 1HWKA 4ED3A 3R1HA 2RT3A 2MQPA 3CCZA 4YY3F 4NA1A 4ED1A 2ZHOA 1ZAVA 1VC5A 4FF1A 4OZ5A 2VB6A 3F44A 4DPOA 1U47A 2VFTA 4ZHRA 3G96A 3IG1A 4QZVB 1HQEA 1G1XA 2HHUA 1Q53A 3VF0B 1KVJA 4FXDA 3N0VA 1QAYA 2HAIA 3MPYA 3MI7X 4XPEA 4RUAA 3KMQA 5DG8A 1N8RT 5T7LB 1K9MT 2W4PA 3UFCX 2YWHA 1U1NA 3AA8A 2QSFA 3BQ2A 4W92B 3FSYA 1JLQB 2M9KA 1N34F 1OO0B 3QLHA 3MZIA 3PIOQ 4C8NA 2XGPA 2LECA 3CB4A 3BO2A 5M2RA 4KAIA 1LFPA 1N5VA 1HYSB 4WFAQ 4NA3A 3M6UA 1DJ0A 1HWIA 5IM0B 2SXLA 3A1YG 2ZOFA 2DIVA 4ZVHA 2IC3B 1H38A 2KHCA 2VG6B 3JSMB 4FPRA 1IKWA 4WTYA 3RW6A 3M1VA 1X9MA 2M0GB 4LQ3A 4CQ1A 3M9NB 2V4JB 3NBPB 5KFQA 2GHPA 2KVIA 4ZCMA 1ZH5A 4K5SA 3MMCB 4M94A 4Q0BB 2A10A 2DRBA 1N4LA 2R7TA 3ENQA 3J80Y 2XY5A 2DPIA 5L1LA 1AFJA 2R7QA 1FJCA 3BZQA 5H9EJ 1D9FA 1FRIA 1HI8A 1WEYA 3MAQA 3RB0A 1NU4A 2B4UA 5KG3A 1VRUB 5DDPC 4YR0A 3NS6A 4YQWA 4DSIA 1SIWB 2NSBA 5ADZA 5E5NA 1Q8LA 2QMWA 1YIJS 4Y2CA 3H98A 2L3MA 3UPFA 2HLUA 5D8HB 1G6BA 2W9BA 2ZNYA 1R8BA 2ZITA 2MGZA 1VQ8S 3HDSA 3HKZD 1TL1B 2L08A 2IM1A 1JJ2R 4BHQA 4NLOA 4TQRA 5C5JA 2IBOA 5KFSA 4YR2A 3E51A 4LF4F 3BB5A 1ZAXA 2IM3A 3GFHA 4O4GB 4HTIA 4LVOP 4RNHA 3KLGB 3KLHB 2HS3A 1H7WA 4KB7A 2LEPA 3OVBA 2EBEA 1CC7A 3SCJE 1C1BA 2D1CA 3IR6B 3KLIA 2GC8A 2JHEA 2AF6A