4RW9B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B03
5KG2A 4WE1A 2VG5A 3IN5A 2RDIA 3LP1B 1N5YB 3Q8RB 1GX5A 3OHBA 1N5YA 4IQXA 2B5JB 3QGHA 5EWFA 2B5JA 4MK7A 2BR0A 3BR9A 1HNIA 5K14A 1IKVB 1S9GA 5D3GB 3SFUA 1IKVA 5T14A 4RNMA 2E9ZA 2D41A 4NLQA 5HP1A 2VG7B 3PW5A 4QW9A 4J9OA 3KLIA 3BQ0A 3V6KA 5EWEA 4MIAA 3KK3A 4MK8A 4WZQA 1HQEA 4WFZA 2ASJA 5KFGA 4Y34A 2HWHA 4O4RA 2UVWA 2IJNA 3M8QB 3PW7A 3M8QA 4I7FA 1TV6B 3DI6B 4IR9A 3N6LA 1N4LA 1TV6A 3KJVA 4ZVGA 4JV2A 4NLPA 2UVRA 4F4XA 2AWZA 1RT2B 1KLMB 1RT2A 1HNVA 4YR2A 4ZVFA 4U7CA 2HNDB 4EYIB 4RU9A 4DL2A 3M8PB 2FVRA 1W25A 3RBEA 2JEIA 3DRPB 4YP3A 4JUZA 1S0OA 4QWBA 5DQGA 3H5YA 2J6TA 3NBPB 3GV7B 3BQ1A 4ECTA 2C22A 3ICLA 4MK9A 2ZKUA 1S1VB 1JLGB 4RW4B 5KFHA 3QLHB 2ZE2B 1JLGA 1RT1B 4RW4A 3V6JA 2ZE2A 1TKTB 1T03B 4Q8FA 1LW0B 1HMVB 1S9EA 1HMVA 1FKPB 2ATLA 2O5DA 5F8MA 4R5PA 5KFXA 3TAMA 5KFPA 3CDEA 2ILYA 5EUHA 3FDSA 4J9NA 4LSLB 4QWEA 3GV8B 1D0EA 4KO0B 3IS9B 4ED8A 4ECZA 2R8GA 3IS9A 4B3OB 5KFMA 5DGAA 4B3OA 4HKQA 4KE5A 1TP7A 4KHRA 1DTQA 5F8LA 4Q43A 2UVUA 3BSCA 1C0TB 5L1IA 3RB3A 1C0TA 2WRMA 3UDLA 4NZ0A 2WCXA 5KFNA 3GIKA 4H4OB 3G86A 2RDJA 4H4OA 3EPGA 1S1XA 2FJVA 2W9AA 2R8IA 4WXWA 3OSNA 1S1UB 4TY8A 3H5XA 2JEGA 3KLHB 1RTJA 3KLHA 3CDWA 1KHWA 3CDUA 4O3QA 1SUQA 4TXSA 5KFQA 1K1QA 2I5JB 4TQRA 4EEYA 2I5JA 1S0MA 3KK2B 5J2MA 5DQIA 5DGBA 3OL8A 3CJ3A 2B43A 4LQ3A 1RTHA 1JLEB 4PUOA 3QGGA 4DEZA 3Q8SB 1JLEA 4ECQA 1EP4B 3KOAA 5JXSA 3C6TB 4Y2AA 3CIZA 1RT7B 3C6TA 2CKWA 3IGNA 1N6QB 3OL6A 4ECSA 4ED3A 1ZETA 2W9CB 3LP0B 4RW7A 1OS5A 2W9CA 4M95A 1VRUB 1IKYB 4I2QB 1S10A 1VRUA 4I2QA 5HBMB 1EETB 3H4DA 3RB6A 1EETA 4Q8EA 1BQMA 2OPSB 1NHVA 1REVA 2OPSA 4WYLA 2BANA 1T05A 3BSOA 3G6XA 1S0NA 4KKOA 2IM1A 3QIPB 1JLQB 3V6DB 4DL3A 3V6DA 1JLQA 3FFIA 3HVTA 3M9NB 1RT4B 2VA2A 2UVVA 4NYZA 4Q0BB 1RT4A 1S97A 4RW9A 4RNOA 3E01B 1RT5B 1S1TB 4ID5B 3E01A 1RT5A 1S1TA 4ID5A 3HKWA 3I5BA 4R0EA 3TVKA 3MECB 5KG7A 2BQRA 3MECA 2HMIB 2IM2A 3H5SA 1S6QA 2YNIA 4ED7A 4QWCA 2IM0A 1XR7A 5I3UA 4IH6A 3DDKA 3MEEB 3DLGB 4H54A 5KFTA 1FK9A 3DLGA 1S1WB 3OSPA 2JC1A 2GC8A 3HVAA 4MIBA 4KSEB 3DLKB 1SH2A 4KBIA 2OPRB 3DLKA 4ZVHA 3I0RB 3I5AA 4IRKA 4JV1A 3I0RA 3MFIA 3RBDA 1SV5B 4Q45A 4IDKB 1SH3A 1SV5A 5CYQB 2RKIB 3FQLA 2BE2B 3BJYA 5CYQA 4YMEA 1N48A 3DM2A 5KT4A 3H59A 1TVRA 1HQUB 5KFSA 4ECRA 2WONA 2OPQA 4O4GA 4KB7A 4WXOA 5KG0A 4R8UB 2VG5B 2WHOA 4R8UA 4EBCA 3MR5A 2IC3B 3KLFA 2IC3A 4WFYA 4ZPBA 2IBKA 1D1UA 2IMWP 1HNIB 3Q8PB 5K14B 2YNGB 1TKZA 2YNGA 3D28A 1S9GB 4DL6A 3IGVA 4K4WA 5KFRA 3PR5B 2JEFA 2J6UA 5HP1B 4NLUA 4G3IA 4NLWA 4URGA 3KLIB 5DG9A 5JUMA 1BQNA 5C25B 4K4TA 2HAIA 5C25A 3KK3B 4XPEA 4K4VA 1HQEB 1RA7A 1RTDB 1RTDA 3DOLA 5F8HA 1JLBB 3PR4A 3GILA 2W8LA 3OL9A 1JLBA 4ICLA 3OHAA 4I7FB 3NL0A 3KJVB 1QAIA 2FVSA 3HHKA 1YVFA 3PJWA 4ECXA 3V81B 3QIDA 1HNVB 3V81A 5HROB 3H98A 4ECUA 2W8KA 2HWIA 5HROA 4IFVA 3HVWA 4ZPDA 3H4BA 4J9KA 4IRDA 4K4YA 2FJXA 1C0UB 4DL5A 1C0UA 4RW8B 1Z4UA 1LWFB 1RTIA 1ZTWA 4RW8A 1LWFA 3PW0A 2I1RA 3M9OB 4ZP8A 1C1CB 2D7SA 1C1CA 4NRTA 5KFDA 2ILZA 3RAQA 3NAIA 4TQSA 3FRZA 1S9EB 2RF2B 4EO6A 2RF2A 1DLOB 1IKXA 1FKOB 1DLOA 4R5PB 1FKOA 3NAHA 2OPPB 3TAMB 5KG6A 3V4IA 2OPPA 2J6SA 3ITHA 4EBEA 3NGDA 3ISNC 2BRKA 3BSAA 4M94A 2JEJA 3OLBA 4MFBB 2HNZA 4MFBA 3MEDB 1MU2A 3JYTB 4NLXA 4NLVA 3MEDA 3BSNA 3JYTA 1TKXA 5KFAA 3PW2A 1QE1A 4URQU 3KLEB 3CVKA 3KLEA 4NLYA 2WB4A 1DTQB 2ZD1B 2ZD1A 2FVPA 1JLCA 4X2BA 1VRTA 3KK1B 4NLGA 3KK1A 3T5HA 1S1XB 2W7OA 5KFCA 3NMAA 2JC0A 3DLEA 2V0NA 4TY8B 5KG3A 2F8EX 2R8HA 4FBUA 3V6HA 3MTKA 1RTJB 1C1BA 2YKNA 5HLFA 2WOMA 4G1QA 4IOBA 3MR6A 1SUQB 1UWBA 3DMJA 1JLAA 4IG3A 4IG0A 2B6AA 3I5CA 3Q8QB 3UR0A 5J2MB 3OLAA 5J2QB 3UPFA 4J9MA 5J2QA 1RTHB 4O3NA 5KFBA 3MFHA 3CJ0A 1TQLA 4PUOB 4FS2A 1MMLA 5I42A 5KFKA 3EPIA 3CJ4A 4ZP6A 3LP2A 2D3UA 4MKAA 3T19A 4ECYA 3EZUA 1I6JA 1JKHB 2GIRA 4RNHA 1JKHA 4RW7B 2QV6A 1IKWA 3I0SB 2UUTA 4TLRA 4U6PA 4ZHRA 3I0SA 5DLFA 5KFJA 4RZRA 2ASLA 1RYSA 4OL8A 1BQMB 3N6NA 1REVB 2BANB 5FDLA 4NLSA 3GIIA 1T05B 5KG4A 2FJWA 3IG1A 5DG8A 4KKOB 3G6VA 3KHHA 2FLNA 2VA3A 3BGRB 3HVTB 3BGRA 3FFIB 2XGQA 4YR0A 4QWAA 3QZ7A 4RW9B 3FSIA 4J9SA 4NRUA 5J2NA 1CSJA 2YKMB 4GC7A 2BQ3A 2YKMA 1JX4A 2V4RA 2C2RA 4KV8B 1HPZA 4KV8A 1S6QB 2YNIB 4LSNB 4LSNA 4IFYA 3JSMA 4O44A 5I3UB 4ZPAA 3PJXA 3IRXA 2AGQA 5KT5A 1FK9B 2IJFA 2DPIA 1S49A 3DYAA 1K1SA 1XR5A 4Q44A 1RYRA 4WYWA 2BQUA 4EO8A 2FVQA 4MKBA 3G6YA 4PWDB 1U09A 4H4MB 1QAJA 3M9MB 4PWDA 3MF5A 4H4MA 5J2PB 3H40A 2EC0A 4NCGA 5J2PA 2YNHB 3H2LA 1TL3A 4O3OA 2XC9A 2YNHA 3DM2B 4LQ9A 1TVRB 1S9FA 3DRSA 5F8NA 2WONB 2OPQB 4O4GB 5KFFA 4F50A 1J5OB 2C2DA 5F8JA 1J5OA 3ISND 3KLFB 1DTTA 4K4SA 4QPXA 5KT6A 2FLLA 2D3ZA 1TKZB 5C42A 5KFEA 3T1AA 4F4WA 3SI8A 2QE5A 5CYMA 2VG6A 5DQHA 5KFUA 2W7PA 3BQ2A 2R2SA 2FVCA 3LAMA 3FQKA 3SFGA 5DLGA 4RNNA 1RT6B 1C2PA 3RB4A 1BQNB 1RT6A 5C24A 1XR6A 2BRLA 3KNAA 2XGPA 3DOLB 2AGOA 5L1LA 4ICLB 3MR2A 3CJ2A 4O3RA 3LP1A 1RDRA 4K4XA 5DG7A 2R8KA 5C5JA 1T3NA 4TY9A 4GC6A 4IFVB 4F4YA 4FBTA 3LALA 1NHUA 1GX6A 4ZP7A 5D3GA 3UQSA 4IR1A 1RTIB 1WNEA 2VG7A 2JLEA 3GIMA 1N56A 3PW4A 2YNFB 3DOKB 2YNFA 3DOKA 2GIQA 5KFLA 1LWEB 4WFXA 3BREA 1LWEA 4QW8A 1IKXB 3DI6A 1ZTTA 5KFOA 3V4IB 3ITHB 2XWYA 1KLMA 2W9BB 4PQUB 5L9XA 3T5KA 2E9RX 2W9BA 4PQUA 4K4ZA 4TYAA 2HNDA 2HNZB 3PHEA 4Y2CA 2XI2A 5KFIA 4JV0A 1MU2B 1IM4A 1TKXB 3M8PA 5KFZA 1QE1B 4KHMA 3KHRA 3DRPA 5L1JA 3MR3A 2IAJB 4K50A 3NBPA 4IKAA 2IAJA 3D5MA 5KG1A 3TQ1A 1S1VA 3QLHA 5F8IA 1RT1A 1JLCB 1TKTA 4NLDA 1T03A 1LW0A 1VRTB 3LAKA 3KHLA 4EYHB 3CJ5A 1FKPA 3DLEB 4I2PB 2OH2A 3KHGA 4TYBA 4I2PA 1NNDA 1JIHA 4ZPCA 3GV5B 4NLOA 1C1BB 2YKNB 5HLFB 2WOMB 3C6UB 4G1QB 4IRCA 1UWBB 3C6UA 1JLAB 3DMJB 4IG0B 2B6AB 4IG3B 3N6MA 4NLTA 5F9LA 2WTFA 4ECVA 4ED2A 4ED0A 1QUVA 2AX0A 4URSA 3PZPA 4ECWA 2R8JA 4LSLA 5I42B 1RT3B 3T5JA 4ED1A 1RT3A 1S48A 3LP2B 4XPCA 4RUAA 2V4QA 4KO0A 4J9PA 2DPJA 4F4ZA 3GYNA 2CJQA 3CO9A 1HYSB 1LW2B 1IKWB 1HYSA 3QYYA 1LW2A 4IH5A 4ZHRB 4YR3A 2ASDA 4KAIA 4ZVEA 2C2EA 2HNYB 5FDLB 2HNYA 1JXLA 3KMSA 3IG1B 2R2UA 2AGPA 1KHVA 1S1UA 5KG5A 3KLVA 4O3PA 5F8GA 1HARA 5J2NB 4RW6B 2R2TA 1LWCB 4RW6A 3KK2A 2C28A 1LWCA 1RA6A 3KMQA 1HPZB 5KFYA 4HYKA 3VQSA 4J9LA 3QO9B 1EP4A 4IFYB 4XO0A 3JSMB 3QO9A 4O44B 3E51A 2AQ4A 4QWDA 2ALZA 1RT7A 4WZMA 1N6QA 3IRXB 1S4FA 3LP0A 5F9NA 3T5LA 4DG1B 3DYAB 1IKYA 4DG1A 5EDWA 5HBMA 3PVXA 3RAXA 4FS1A 4DL4A 2AU0A 3H5UA 4IH7A 5EWGA 3LANA 4YQWA 3QIPA 4NCGB 4RUCA 5J1EB 5KT2A 4EBDA 3GQCA 5J1EA 1TL3B 4Q0BA 1RAJA 4J9RA 3DRSB 3MEGB 1R0AB 3MEGA 1R0AA 2HMIA 3QZ8A 2E9TA 5KT3A 4ZP9A 2UUWA 1DTTB 1T94A 3DRRB 3DRRA 3NKYA 2V9WA 4ZMMA 4ED6A 3QGIA 4NLRA 4J9QA 3MEEA 2IM3A 5KFWA 3KLGB 3OL7A 3GIJA 1S1WA 5C42B 3KLGA 5L1KA 2IA6A 1SH0A 4TN2A 2XI3A 4MH8A 5KFVA 5CYMB 2VG6B 2WK4A 4RNFA 2FLPA 2OPRA 1JLFB 1TL1B 5C24B 3RB0A 1JLFA 1TL1A 4IDKA 2AX1A 4DL7A 2RKIA 4KFBB 2BE2A 4O3SA 4KFBA 2XCPA 5KT7A 1S6PB 4K4UA 4Y3CA 3CWJA 1S6PA 2XCAA 1HQUA 2R2RA 4WE1B
chains in the Genus database with same CATH superfamily
4C11B 5KG2A 4ELTA 2IPOB 1V5IB 4MK7A 2FC8A 3BR9A 2XMWA 3ZTPA 2C3MA 3L4BC 3V6KA 1LK5A 2LEPA 1XJWB 3P5BP 1HQEA 4DR7J 1OY8A 4C8YA 5HMWA 1TV6B 4LF7J 3N6LA 3HP6A 3J7AN 3OVSA 5HO4A 4NWBA 2DR8A 1VQSA 2JOQA 2MZRA 4PXEA 1HR0J 2DNHA 3DNCA 5KOXA 4LBIA 2GGPB 3VQTA 4B3SF 3GU0A 2MLYA 1L3UA 2YKQA 3CC4S 2L08A 4K5RA 4JI2J 2G2ZA 1FX2A 4B3TJ 5DGAA 4DR5J 3CD6S 1P6TA 2HFZA 3WIVA 3G86A 1AXQA 3OSNA 1Q7LB 3O6QA 1IBLJ 1VQ7S 4EEYA 4Y00A 2MKHA 5B7WA 3HJVA 1N6QB 2C2KB 2B4VA 3D1HA 3LP0B 4LF9F 1F0XA 2XLJA 1EETB 2JWNA 1KSPA 2OFHX 4DL3A 1OQ3A 3FEYB 1JLQA 2VA2A 4OX9J 4LBHA 2J0SD 4X4QA 2KHDA 1S6QA 2EI5A 4FVMA 3OXGA 5E2QA 3OJUA 4Y6IA 4LR8A 2OPRB 4JV1A 2A3JA 1FE4A 2B56A 2G0CA 2GS8A 4DN9A 4X84A 4K2JA 2OPQA 2E1CA 1EJ7L 4R8UA 3MHYA 4M5IA 4FF1A 2ZH6A 5ETSA 4WFYA 3J7ZT 3KJQB 2KN4A 2QL7B 4H4KC 1QAXA 2HAIA 1RA7A 1RTDB 4FVCA 4WKYA 2EFOA 3TAQA 1MMNA 4NZ7A 1NH8A 4ED4A 5BR8F 2OP5A 4AL6A 2XLKA 3A4TA 2KJWA 3FRZA 3NNCA 1BY9A 1U2CA 4RL1A 2ZBRA 3F41A 1H38A 3BSAA 2QT7A 4JI3F 1TKXA 4RLEA 2MPUA 3V5RA 2ZD1B 2WVDA 4IG3A 4IG0A 1ZM3A 4ZVSB 3UR0A 5J2MB 3MFHA 3BGLA 2UU9F 2BOAA 3HHNB 1I6JA 3ELHA 4JI5F 3MM6B 2ZH9A 5FDLA 3PO4A 2RT3A 3W9HA 1QTNB 4F0MA 1WC0A 3CCVS 2IDLA 4GVBB 4NI2B 4ES1A 5I3UB 5AE3A 1UETA 5IV3A 2EFNA 2DGTA 1VR6A 4JYAJ 1ICEB 3OR2B 4C8NA 2KFYA 3CCQS 4F36A 2L48A 4RUBA 2N4CA 3HHLC 3L95X 2G1DA 3MI7X 1KRPA 4QPXA 2LU1A 3T1AA 1V6HA 1K0VA 3T9NA 1RHQB 3OPKA 4C11A 2MQ8A 4B08A 3D66A 4YS2A 3F0NA 4N56A 4DFMA 1D9AA 2A6OA 3HJFA 1CJVA 1NK7A 4ED5A 2NPFA 1Q78A 2W9BB 1RABB 2RDDA 4YUDA 5B0CA 2N7YA 3MR3A 3PFEA 3QNWB 2GGPA 5A0YB 3S1TA 1YGYA 5F8IA 1JLCB 4NLDA 2KL8A 4FNIA 7FD1A 4I2PB 1OJ4A 3U1NA 3KHGA 4ZPCA 1JIHA 1TUVA 1DJ0A 3C6UA 3IXQA 3W8GA 3DKDA 1RE1B 3ZTRA 5LMNF 3PTWA 1FDNA 3NS5A 4ZVUB 2KT2A 5M2UA 2CJQA 1HYSA 1NDPA 4U96A 3VGSA 2KXFA 2V2ZA 1KFSA 3K0JA 1KHVA 5J2NB 4LSZB 5DM6Q 4G1IA 3JSMB 1N6QA 3LP0A 2BOPA 1VQLS 2MZJA 4DSIA 4J9RA 2I6WA 3QZ8A 3HHLB 1GFWB 4DJBA 1DTTB 4ZLLA 2RU3A 4J9QA 1QD1A 1CJKB 1FJGF 9ATCB 5DO2A 2OPRA 1PBUA 1H2VZ 3A12A 4OHVA 4WIIA 3BPSP 1U0HA 4OZLA 2E5LJ 2CXEA 4M5DB 4EZ9A 2D74B 2F40A 2DD8S 2JLFA 3GFHA 1WHYA 2IJNA 3FZBA 3PW7A 1F2GA 4ZLPA 2ROGA 4ZVRB 1Z1ZA 1KQSR 2VOOA 4DUYJ 5ETTA 2LLZA 2FB0A 4PRFA 3N9UC 4Q8FA 3A8IA 4CM0A 2EW9A 3CCLS 1XNQF 2CG8A 4NZ0A 4UF4A 1FTCA 2RDJA 1OY6A 2M7SA 5L39A 3CDWA 4LVNP 2I5JA 5J2MA 3C66A 2CQDA 3LUYA 1YJ9S 4BCAA 1ZETA 2XMJA 4LFCJ 1IKYB 1S7HA 3MM6A 2OEMA 1RWPB 1EIYB 1WHVA 1V9OA 3EVWA 1REGX 4USTA 3W3SA 1RT5B 4ID5A 2W4DA 5DDOC 2IM2A 3H5SA 4W98A 4NI2A 1AFJA 5I3UA 1S72S 1U1PA 3OSPA 2JC1A 3OT9A 2NCKL 2OD6A 4IDKB 3OR2A 4WFAQ 2QSFA 4XIUA 1YQHA 3JTPA 3T3FA 1N8RT 1HQUB 2HS3A 2AKWB 5HK4A 4EUVA 3MR5A 1QSLA 2JZ5A 3R5GA 4KPYA 2AJ2A 4NA3A 3K5LA 4H4KA 3A3PB 1RLCL 1WEXA 1UVLA 3D6MB 2W01A 3R3TA 5C25A 3M6VA 4UQGA 5E41A 3QIDA 2RH3A 3B6BA 4QZVB 1CC7A 2QMUB 3GMGA 2VQFF 3UO0A 5C2GA 4RW8A 3EICA 4O0NA 2D7SA 2XMUA 5KFDA 3Q89A 2R9LA 1M5PC 1BC6A 3ETMA 2CQCA 3JQMA 4PXDA 4J37A 1MG7A 1RK8A 4ZPVR 2GJFA 4F02A 2RQMA 2PEHA 1N54B 5A0YA 5DZ6A 4BBYA 1JLCA 2OFGX 5CD4H 1S1XB 2B0GA 1RHKB 4P72A 1VDHA 3SQGB 4MKAA 2GIRA 1LNQA 1WWHA 2AHOB 2F1FA 1T05B 3KHHA 2VIHA 1RSCA 3FSIA 3CCUS 5J2NA 2YKMB 2D3OR 2C2RA 2DRAA 2CPYA 3JSMA 4LREA 4HHJA 4Q44A 1P1TA 2RUSA 1T11A 3PNIA 1TVRB 4DSKA 2C2DA 1DTTA 3CJ8A 4V19X 1CJKA 3I82A 3AJ2A 2F9JA 4QR1A 3MUTP 4UZCA 5K8NA 2WSCC 3W5YA 4ANCA 4M5DA 3LALA 2QA1A 2PSZA 2OO4A 1U1NA 3QJJA 2R42A 2V68A 2B4OA 1F5CA 1UW4A 4L73A 3KG4A 4QCLA 3HFKA 2PFDA 1UJ6A 4RPFA 2DNKA 5KFIA 4CM2A 2O01C 1U1QA 5KFZA 1UFLA 4K50A 2RVJA 1IM6A 4IOAQ 2O66A 3NNHA 2W4PA 1UPMB 3U7JA 4J9UE 2OH2A 5GMKa 1NNDA 3KUGA 1LK7A 4RO0A 2HS4A 5MAOA 5D4OA 2XYPB 2ZBIA 1KDNA 2DO0A 4F4ZA 1UMJA 1SCJB 1PCAA 3HVRA 1VLOA 4OJHA 2HNYB 1NPKA 4RW6B 4N8NA 3NP5A 2ALZA 3IWLA 5F9NA 2D1CA 1IKYA 1ZM9A 2HHUA 3TAPA 3HF5A 5EWGA 3ENVA 2VH7A 4DLGA 2MB0B 1L3SA 3T1HJ 3DRRB 2XO7A 1YBTA 3KLGB 2EWHA 1PGZA 4A8SA 2QL9B 2GQCA 4F4KA 3DN9A 3OR1A 4IDKA 1U6FA 3C3LA 4YDXA 1HQUA 5CXTA 2LFVA 1HI8A 1EQ0A 1X8DA 5IV4A 3FBCA 1YJ7A 2HQDA 5KOWA 2QLBB 1IKVA 1GT8A 4CO5A 2K3KA 4ZK7M 2Y1RI 4CLLA 3DI6B 4FZVA 4N8OA 4JBCA 4KGXB 3FNNA 4Q2LA 2POKA 1V3RA 1WC6A 2GO8A 2KI2A 2FVRA 2QFJA 3LGMA 4C8OA 2DHSA 4LBPA 1TKTB 3NRBA 2ILYA 3DU6A 2CQGA 2IVMA 5EUHA 4WK1A 3R5BA 4LSLB 3VHQA 1URNA 3BH7B 3IS9A 1P1LA 4X64J 4B3OA 5B08A 3POTB 4Q43A 3GIKA 1W2IA 2NR0A 1S1XA 4LIRA 2R8IA 4WP9A 3H5XA 1RHJB 4TXSA 1I51B 1CVJA 3MCMA 3CT9A 1JLEA 4Y2AA 3SQGA 3IGNA 2W9CA 1DFDA 4FYDA 3LA0A 4Q8EA 4OMFG 1T05A 1S0NA 1Q8LA 3RR8A 3M32B 1RT4A 4RNOA 2L41A 1S1TA 1QVFR 4RX6A 3BGUA 4DR4J 4ED7A 5ETPA 4BC7A 1CC8A 2HVDA 2EFQA 5A6PA 4YFUA 3I0RB 4M1KA 2SXLA 1N48A 2V4JB 1TVRA 4X62J 1R0CB 3PX6A 2H4YB 4E0DA 3CJKB 3PXGa 1F3VA 2IBKA 3D28A 1RU1A 3AB4B 2W25A 4Q2MA 3KUHA 4YN3B 5GMEA 3TJ8A 3PR4A 1T9XA 3I87A 4DV2F 3BKFA 3R1HA 4UOCA 3CCJS 1T9TA 5H9EJ 2DITA 4OZ5A 3K5NA 4A8KA 4NRTA 2RF2B 1DLOB 2WVEA 2OPPB 3GJQB 5MLCV 4FDFA 3JB9k 2DHXA 1HNZF 2AF6A 2CQ1A 2CJAA 2W7OA 4NMXA 4PR6A 3MR6A 2V4RA 3Q8QB 2W24A 1XIQA 5J2QA 2FHJD 4A48A 1JJ4A 1VYAA 4HT5A 3LWMA 1Y7PA 2UUTA 1EARA 3WC2A 3VAIA 5DG8A 1TTHB 4OV1A 1SC1B 3D1OA 2EFPA 4DSJA 4NA1A 2AGQA 4USWA 1S49A 1B70B 4GKJF 1XMOJ 1W7WA 1KONA 2RILA 4ZS6A 2WONB 5F8JA 1VIOA 3CMAS 1HFEL 3QT7A 4DZ6A 1HBUB 2YKOA 3SI8A 5DQHA 5KFUA 1RCXB 3ZZRA 4C2MA 2FD2A 4DU8A 4DX5A 3IO1A 4IR1A 2HRTA 2MHNA 4YY3J 2IRXA 2P9GA 4WFXA 1WG5A 3BREA 4O23A 3DI6A 2Z30B 3P6YC 3EXYA 2XWYA 3AH6A 4QYRA 3A8JA 2XI2A 2VQEJ 2ZH8A 4DV4J 3PRDA 3KNGA 4OI2A 2LA6A 1TKTA 1U48A 2NPIA 3PZPA 2HZVA 1FWLA 4LSLA 3LOUA 3VAKA 3GYNA 1LW2A 4PQAA 2AZ3A 1NZAA 3W2VB 3VAMA 2OUGA 1HARA 4RBUA 2H5IB 4ZVTB 2ZZNA 3Q8YA 3IRXB 5D6GA 1F5AA 3GJTB 2BW7A 2AU0A 4YQWA 5FLXY 2M0GB 3AFGA 2M3DA 2E1PA 4X4RA 2XSFA 5HN0A 1WC5A 4WP3A 5C42B 3GONA 1PKUA 4FF3A 1PYOB 4ALZA 4CH1A 1FFWB 3E8OA 1JNZB 1NRKA 1UZDA 3RB0A 2AX1A 2KVQE 3EGNA 2V4JA 3W5XA 1T9VA 3N79A 2HWTA 5EWFA 2ZDPA 2NUHA 5D3GB 4M5JA 1VK8A 5T14A 3CE8A 3CD0A 3PW5A 3ENAA 4WZQA 3L7UA 2FPHX 2VC0A 2PMWA 2RS8A 1RT2A 4OYBA 3FSYA 4R25A 1N36J 3D6HB 2LQ5A 3TUIC 2RSQA 4ECTA 2C22A 3ICLA 2ZE2B 1EKRA 2XSJB 2QLFB 4PWWA 3CDEA 3NXZA 3MMAB 4LF4J 3S01A 4QWEA 4DUTA 2VBWA 1VMBA 1GMWA 1BGXT 1C0TA 1Y3KA 1IBMF 1KP6A 2JEGA 3KLHB 1KHWA 2DHHA 3BBBA 2NQPA 1S0MA 4LQ3A 3I32A 5GAGI 4J7CA 4ECSA 2XHCA 2E5GA 2J0WA 1YJUA 3BO3A 4I2QA 3H90A 2KYZA 2CNOB 2OPSA 1Q0NA 3D4JA 2UXBF 4Y65A 1S97A 4Q0BB 3TZWA 2ALYB 2QLJB 4UUWA 5KG7A 2JVRA 3K5OA 3OTOF 3MECA 1IQTA 2JSXA 4L3KA 2DR5A 2BJEA 2EKNA 1ZAVA 2DR7A 4A8XA 3UNGC 2KDOA 4QPTA 2AJ1A 3UDEA 4Q45A 2DYAA 4OV6A 3D68A 4LRAA 2WONA 2IC3B 2YNGA 3A13A 4DL6A 1HBUA 3HPOA 2JEFA 2ZH3A 1AW0A 1FRXA 2HEKA 5HATA 3OHAA 3KJVB 3IRWP 2JH3A 4ECXA 5HQLA 1ELOA 3HI9A 4LF7F 4B9LA 2VFUA 1LWFB 4ZOSA 2CQ3A 1H6KX 2HFNA 2BRKA 4M94A 2QC3A 4B3MF 4B3SJ 1S79A 1HBMB 2MMYA 5KFAA 4HACB 2MJUA 2WB4A 2A6MA 1G1XA 1UPPA 2A2CA 2DEJA 1G3OA 4E2FB 1TR0A 1OMSA 1NDKA 1SI9A 2PDAA 2VICA 3N4WA 3OFEA 2D3UA 3EZUA 1IBLF 3U27A 4U6PA 3I0SB 1GEHA 2CQBA 3BO4A 4RKUC 3W9JA 4KKOB 3Q2SC 4C0HA 3IAM9 4LF9J 3TZZA 4KV8A 2RHQB 2YNIB 1WHXA 4ZPAA 3IRXA 5KT5A 1XR5A 2BQUA 4EO8A 2NXJA 3KYLA 3AJ1A 2YNHA 4LT6A 5F8NA 2HFSA 1J5OB 1FNOA 3NGKA 3KLFB 4DUZF 4P7TA 4N7TA 3CGIA 1TKZB 5C42A 2W7PA 3BF4A 4CQ1A 2ZM6J 2KO1A 3KFWX 1NJXA 4DQPA 1TFYA 2X3DA 5CQGA 4JI1J 5C5JA 2GVDB 4WWSA 2Z2ZA 2YBVA 5D3GA 1X4GA 1V3SA 2F4VJ 2QRRA 4DCOB 3LF0A 1SJ1A 5BR8J 5KFOA 3EYZA 2XEXA 2Y9HA 4TYAA 2CZ9A 3GYXB 3RGIA 4KY3A 3D3BJ 2DNQA 2OELA 2K06A 3D5MA 2HHQA 2GFFA 3TQ1A 1OWXA 2XSJA 1U1OA 3ENWA 2XWXA 4JI3J 1CJTB 4NLOA 3DOMA 1UWBB 4ECVA 4ILRA 3A3OB 1F9EB 3HSDA 2VB6A 2V4QA 2DPJA 3FEZA 2W2MP 4DV7F 2UU9J 4B9TA 5LT5A 4PXCA 2ZH1A 4JI5J 3KMQA 4TKTA 1Y00A 4C97A 2AQ4A 4F2RA 4DG1A 4DR6F 2AIRB 2KVIA 3H5UA 2Z2YB 1R3NA 3GQCA 1NB7A 5J1EA 4Q0BA 1X5TA 3OFHA 3AAWB 4M8LA 2EK6A 5KT3A 2YY3A 1UP1A 4JYAF 2ZBCA 3NKYA 2I0XA 3CCZA 4NEYA 2OAUA 5KFVA 2VG6B 3P45B 5C24B 4DR1F 2XCAA 1QAJA 4P52A 1RACB 4HTIA 1YIJS 1FNXH 3HK2A 1N33J 2HHHJ 1FI4A 2EVZA 4HR2A 4UZBA 2QJ3A 4QIFA 1TZ0A 1LV5A 3SXLA 2P6TA 3KJVA 4DPUA 4ZPWR 4ZVOB 2HRYA 3M8PB 1NHKL 1HWKA 4NMLA 1X7VA 3W2WA 5IC4B 3H5YA 2VPXB 2NS1B 4CO4A 3QSYB 4B9MA 4N47A 4HEA9 5IOLA 1T03B 1HMVB 3ET6B 5K8PA 2LKZA 3DU5A 5F8MA 2X51A 3FDSA 4RUHA 1HBMA 2NXCA 1D0EA 5LMUF 2BX6A 4ECZA 1WOPA 4KE5A 5HI7A 4MKYA 4FXVA 5LMNJ 4H4OA 2W9AA 4WXWA 3ZZ0A 1RWXB 2CFXA 3CDBA 2B43A 2NYHA 4ECQA 4BWMA 3CIZA 3JAMY 4PZVA 3J81Y 2Z0GA 3T41A 3RBZA 4KKOA 2IM1A 3D7SB 1MROA 2UVVA 1ZAWA 3RW7A 3HKWA 3I5BA 3TVKA 2DBBA 2YNIA 3PYEA 2WVBA 2P9EA 1HBNA 1HL6A 1NO8A 1ZS6A 2EC2A 4P9SA 5LSRA 4N5SA 3UVJB 2HBQB 1IN0A 1QVGR 2COLA 1SH3A 1UFWA 5CYQA 4G65A 1L5UA 4CO1A 1T3NA 1FJGJ 3KLFA 4DPXA 1TKZA 3PR5B 2AYBA 4DMZA 3OVAA 4NXMJ 2YTCA 5IT9Y 2MKIA 3G87A 4XPEA 2VHGA 3JSBA 2V2KA 4B9VA 1PIEA 4FF4A 1R0BG 3N5BA 3HHKA 1RJJA 5E3AA 1HNVB 2GVDA 5HL7Q 2CDQA 4J9KA 5HSPA 4IRDA 2FJXA 1BD6A 3PW0A 3M9OB 2B9XA 2ZNYA 1C1CA 5EN1A 1O51A 1M5KC 1RAAB 3MEDB 4WTYA 2XM3A 4EI2A 1DZ5A 1UWBA 1XNQJ 1RUSA 4PUOB 4OJ1A 3EPIA 1U47A 3I9ZA 2XYHB 2QV6A 4F0HA 4J91A 3KG0A 4LFCF 4QWAA 3ENQA 4B02A 2MY8A 4M5MA 4CO3A 4KGZB 1UW9A 2GMHA 2ZITA 1YHQS 4PEOA 2VBZA 3TJAA 4DX6A 3LGNA 4F3MA 2ZKTA 1U09A 3MF5A 3FUYA 1VIXA 1JWWA 4O3OA 1SBRA 3JTNA 1SQFA 3W8PA 1YRTA 2CDRB 3GFZA 4F50A 5B0GA 3RR7A 5CA5A 5H1SV 2HHSA 2KM8C 1VRQC 1CLFA 4Y2KA 2H4WB 5KFEA 3G8QA 2VG6A 3QWPA 3EE3A 5C24A 4HH0A 3TEGA 2DKOB 3TRGA 2MKYA 3EMTA 2OEKA 3H25A 4DCJB 4R0JA 1RCOB 3G96A 4ZP7A 2AYGA 3G2XA 3QJPA 2J7KA 4I0WA 1LWEB 1IKXB 1ZTTA 2HLTA 3NY0A 2V8DA 2XY5A 3FBFA 3M8PA 1DAXA 2IAJA 1T03A 1WC1A 2MYFA 3ET6A 1EQMA 2R8JA 2AX0A 1FJ7A 1WKLA 2QA2A 3MAQA 4CH7A 1MN9A 3CO9A 1IBKF 3HULA 1IKWB 3CCRS 2DB1A 2C2EA 3PFOA 4NXNJ 4C8KA 1JJ2R 2DR6A 1RBAA 3GR1A 2HRUA 2EXUA 2R2TA 1F60B 1P9YA 3BPDA 4U9RA 3HD1A 3VQSA 4QWDA 1HLWA 3HHDA 3ZZUA 2XB2D 5A8WB 1ULRA 1TL5A 2BEFA 1L3KA 4USKA 4DQRA 2HFVA 3NWRA 2V94A 1EX8A 2ZH2A 3KTQA 3ZC4A 4TN2A 2ZFHA 3UVJA 4KHPF 2VPWB 4OZNA 4PCQA 1QTMA 1NB2A 4UW2A 1AZSB 2B5JA 1PO6A 4BWJA 1HI0P 4J9VA 1FT8A 3BEGB 2MZSA 2UVRA 2AWZA 7FDRA 1HNVA 3CD5A 2PMZD 1DHMA 3OVBA 3BQ1A 1DQ8A 2RUGA 1JLGA 1MLAA 2BXJA 2RQ4A 3B82A 2F8MA 1L3VA 2EPIA 2KZZA 2DNZA 1WI6A 1VQKS 1NXIA 4ES3A 3CC2S 3EPGA 5RUBA 2EG1A 2D69A 4FYWB 4B9UA 2F3JA 1RHRB 5DQIA 3OL8A 1IJFB 4A8FA 3VCDA 4PUOA 3QGGA 1EP4B 2HVIA 1OS5A 1IXKA 1Y5NB 1O5JA 2HPUA 1HWIA 2PI5A 1AROP 4N77A 4R0EA 4NYPA 1YKWA 2KJVA 3PG9A 2OMOA 2D3O1 3PX4A 3R27A 3C46A 5D4LA 3T1HF 5D77A 1VQ6S 2W2OP 1R31A 2YPZA 5A2QU 3IBFB 4WXOA 2GV1A 4X4UA 4NOHA 2IMWP 5K14B 4PABA 2CG4A 3ZNJ1 3DLLQ 1SPBP 4DL0C 2IYGA 2W8LA 3M2UB 5F8HA 2YWEA 1JLBA 4TU8A 4I68A 1PBAA 4TLQA 3ZO7A 4AUKA 5LJ3Y 2MGZB 3D6TB 2OTJS 4D3GA 3FC9A 1H72C 2U2FA 1IQZA 1IKXA 1VQPS 3RG6A 5KG6A 4EBEA 3CJRA 3ISNC 3OLBA 3VWSA 3JYTA 1VQNS 4YB6A 2IHR1 3HSJA 3US5A 4NLYA 2K7KA 1OPZA 3LWLA 4X2BA 4DF4A 4FPIA 4A47A 2JC0A 2MQNA 2R8HA 2IA0A 3SV3A 3C15B 3SMZA 4OX7A 2GIFA 4MYTA 2XS7A 4ZLJA 4ECYA 1IKWA 2LXUA 5B09A 1IVZA 1BQMB 1WF2A 1KFDA 3P49B 3GCWP 3JTOA 3QZ7A 4LSNB 2HK2A 3MEKA 2ZVIA 3KJFB 1NU4A 2R7OA 3TVYA 1C4AA 4H4MB 5A8WA 4F3QA 2X1FA 1OYDA 2FHMA 4DDFA 5A8RB 3M2VA 5ETKA 4K4SA 3I96A 2FGOA 2FJBB 2D3ZA 2LXFA 4X62F 2B51A 1E6YB 4QQBA 2I9SA 1RT6A 2C42A 4DV1J 3C8YA 3MOZA 2AGOA 2GHPA 5A8KB 1R8CA 3IMQJ 4B9SA 2BACA 1WNEA 4DV2J 2PFFB 3MTJA 3DGPB 1GH8A 2IVFB 3QJLA 5F3TA 5KFLA 4QW8A 1RU2A 5L9XA 2E9RX 4PQUA 2OTLS 4K4ZA 1Z2LA 5ETQA 1I1GA 5L1JA 2Q66A 3WZ0A 2N4DA 1S99A 5FLXU 2ASYA 4TYBA 2YKNB 3R8YA 2YWHA 1YI2S 1HNZJ 4GKKJ 3HHLD 5J1PA 4ECWA 3GFYA 5IM0A 1S48A 4RUAA 4IH5A 2ASDA 5LXRA 2CPIA 3RBXA 3GG0A 4TNOA 1LWCB 3FMBA 5ETMA 3BGFA 4DBQA 5AJ3J 3L9ZA 3R1LA 1EP4A 3QO9A 4O44B 4WZMA 3DYAB 4FS1A 3G71S 4NCGB 2F4FA 4WFNQ 1QLNA 4F3OA 4X66F 2CZ4A 3VR1A 4ZP9A 2UUWA 4GKJJ 2E7XA 2HS0A 2F5GA 4CLKA 2GQQA 3W62A 1GTHA 2HQ3A 1SH0A 2YPYA 2QZ8A 2K7JA 1QM9A 2NYIA 4UOHA 1TL1A 2OHDA 3Q2TC 4O3SA 3FEXB 5KT7A 2YQ1A 3R6GB 4OFZA 4PPDA 3Q8RB 1GX5A 3QGHA 3MM8A 5K14A 3L3CA 1UWAA 2E9ZA 1VQ9S 4IUFA 5CZVA 2BDPA 2G0JA 3M2UA 3TQEA 1U2RA 2B4PA 3M8QA 3THTA 2QFIA 4P74A 5M2PA 4F4XA 4YY3F 3C14A 2MGZA 4DPWA 4DL2A 2RD5C 1UTAA 2C1EB 4DZDA 1N5SA 5JJBA 4ATNA 1B0PA 1M0SA 4M5NA 5KFPA 2H1YA 1WSRA 3GG1A 1NK5A 3IR6B 4KO0B 2RE1A 4KHRA 2Y1IA 3BB5A 2ZNZA 2AJ0A 5DDRC 3C15A 3LW5C 2RRBA 4DFJA 3EGVA 2CNLB 4HH1A 1VC6A 4CLUA 3HT0A 3C6TA 4ED3A 3GR0A 3O1LA 1VRUA 2ACYA 1BQMA 4P75A 2BZ2A 5LSOA 1JLQB 4YB5A 2J7WA 3V6DA 1P8GA 3R2CJ 2YX1A 1VQ8S 2FGCA 3DRXA 2UZAA 2KXNB 4IH6A 1WEYA 3DLGA 1T9WA 1SH2A 3DLKA 1HBOA 3MFIA 1SV5A 3AQPA 4YMEA 1S77D 5A8RA 5IT4A 4KB7A 4R8UB 2HHXA 2XMMA 1WDTA 2QSWA 4F2SA 1NK4A 2DVIA 3R5DA 1S9GB 3EX7B 3IGVA 5DS7A 1Y5IB 4NLUA 3HXMA 4W90B 1E6YA 4P2XA 5B0DA 4K4VA 2I8EA 5IQ6A 5L9NA 2EG2A 2AD9A 3K8WA 5A8KA 1WF0A 2HGNA 3V81A 3UD4P 2W8KA 2X7IA 4K4YA 5ETLA 1BQXA 2XBPA 4UUXA 4NASA 3DGPA 3NAIA 1VS3A 4WP8A 1WI8A 4MFBA 3QRQA 2E44A 3I4PA 1TL7B 1NEEA 3KLEA 3OXLA 4LF4F 1ZM2A 3SSQA 1TL4A 2V0NA 3Q86A 1FD8A 4PKDB 2YKNA 1YZ7A 3X3UA 2CPJA 2AYEA 1AA1B 2O67A 1LOUA 1IBMJ 2JJ4D 1HD1A 3GLJA 1SL2A 2M8DB 2X1AA 3HX9A 3GIIA 4F67A 1GXLA 1WG4A 2GAHC 1RI7A 4CLZA 2JVOA 1Q4RA 2FYXA 5GAHU 4O44A 3MM5B 1R7IA 3W65A 3DYAA 1RYRA 2J9CA 3OTOJ 3G6YA 3H40A 1M5HA 4NCGA 1H7XA 1NKEA 3ADAC 4QOTA 2WB1D 3L7OA 1TMMA 1R27B 4ZN1A 3JQKA 3HHEA 2KHCA 1HNXF 1CG2A 3CC7S 2WSEC 1ZA2B 3WIUA 1T9YA 2KXHA 5M2RA 3AXMA 1UKUA 4K4XA 2OJ3A 2NREA 4FYYB 1U1LA 5E7OB 2JFKA 4Z7YA 3HMJG 3L7PA 3OUYB 1CJVB 1W2BR 1KBRA 1KN6A 3TUZC 2HVEA 3ITHB 4RR5A 3T5KA 3K17A 2YXLA 4DSFA 1PAEX 3TW0A 3G4SS 3ONQA 4KHMA 4W4MA 4J5OA 3DFEA 3H2VE 2DY9A 1VHFA 1FRKA 4B3MJ 3KHLA 1RWVB 3BN7A 4F25A 2WOMB 3C6UB 1LFPA 5F9LA 1ZZFA 4URSA 1QJHA 3Q8VA 4ZITA 1B4SA 1RT3A 4XPCA 2A10A 4KO0A 1HYSB 2PC6A 3AD7C 4YR3A 4P2MA 2J0QD 2E5IA 4ZA1A 4EWTA 2R2UA 3KMSA 3SZ2A 1JXVA 3KJNB 4HHHA 4IFYB 1HNWF 3A3NB 3PVXA 4KQZA 3M8ZA 4DL4A 3TA0A 2NSCA 4EMDA 2B8PA 5C7PA 5KT2A 1R8HA 1YG0A 1X4HA 3DRSB 4HHUA 2CA9A 2IJRA 1HW8A 1FERA 3WBZA 4AFFA 3J7YU 1SJRA 2X1GA 2C2ZB 2V2VA 3NGTA 3VVTA 1VISA 4M5HA 4ETXA 1T02A 4DUZJ 2O3DA 4C7QA 3H42A 2ZM6F 3PYDA 1U0HB 4OYXA 1T8EA 4C3KA 1S9GA 1VC0A 4JI1F 4J9OA 3NGRA 4HT7A 1M1GA 4MIAA 1SJ3P 2AEMA 4WFZA 4LF5F 1R89A 4Y34A 3NNAA 4ZVGA 4P71A 4K5SA 2F4VF 3BN4A 2HNDB 3CJTA 4X4SA 2V6AA 1IR2A 2E5HA 3JAMU 2MKCA 3J81U 4DFKA 1FHTA 4D3HA 5BYRA 2G0IA 1BXNA 2CJBA 2DIUA 2Z4PA 5JVGQ 4ETZA 2YWGA 1TL7A 2HVZA 5KFMA 4JI8J 4KH0B 5AE2A 1EKSA 4K8RA 3SBMA 4KR0B 1TKDA 2I5JB 4Q5VA 4BC9A 1KKHA 4DV7J 5CCLA 3KOAA 3CCTA 4GVLA 2RB7A 3DXBA 1Y9OA 2ROEA 3OV7A 4BDPA 4Q7AA 1IBCB 5IT9U 2Y3YA 3M9NB 3M2RA 4ID5B 4CLPA 4USUA 4DR6J 3D54A 1A6LA 5H9EK 3MM5A 3QFWA 2M5YA 1SKRA 3K5MA 3TJ9A 1MN7A 3EGWB 2FTRA 3GWCA 4DN0A 5KG0A 1HKAA 2ZUGA 4DR1J 2GCFA 4RBTA 3G82B 5H9FK 2J6UA 4HDHA 1H3DA 4NLWA 3NG8A 1RP5A 4QR2A 1SJ4P 2HHTA 4K4TA 5C25B 3QWUA 4JV5F 1N33F 3KK3B 3GIRA 2HHHF 3NS6A 1LFWA 4DS5A 2LA4A 2FVSA 1YVFA 2BJ8A 3PJWA 2UP1A 4ZPDA 4USIA 1ZOTA 1OO0B 4DL5A 4RW8B 1APSA 1B7YB 3J81j 1YITS 2ILZA 1PC5A 3OUYA 1T9UA 3FSXA 4AT1B 1TAUA 1U0SA 1Y3JA 2MZQA 3JXOA 3ITHA 1RB0A 3IWNC 2PT0A 3BSNA 1SKSA 3LH2S 4XDCA 5T7LA 4K0KF 4DWIA 2CQ2A 1S0VA 3IBWA 2OIHA 1VQ5S 2LCWA 5LMUJ 3FCHA 2W2NP 2WOMA 2GVZB 3I5CA 5F0UA 4OHWA 1WJ9A 2WZ1A 3IAS9 3CJ4A 1PSDA 1TK0A 5DLFA 4OL8A 3W64A 2BE9B 3PKMA 3HVTB 3BGRA 4CTAA 2XS2A 3ILIA 2QIFA 4I67A 1ZPVA 1D9FA 3B54A 1N5QA 4IFYA 3MCSA 1NSQA 2MKJA 4F26A 3HD2A 5EX3A 2Y8WA 3H2LA 3TNVA 3DRSA 4HVZA 2FHJA 2XZTB 3FMWA 1U2FA 2QE5A 2R2SA 1IWAA 1HW9A 5CHCB 3KNAA 2XGPA 3O3LA 4DV3F 1NJYA 4NXMF 3MR2A 1BLUA 1V3ZA 1LEOA 2ZOMA 4GC6A 1URRA 1GX6A 2AV5A 4C0BA 4Y2IA 3GIMA 2CPFA 1U6ZA 2Z2MA 1UA1A 5D15A 2CVEA 3DOKA 3GYGA 1XMQJ 3V4IB 2FLOA 5LL6d 2V67A 2HNDA 3NCPA 4RJVA 3GZ7A 4DR2J 2M52A 2PEBA 4X65F 2DNYA 4LUBA 2VBYA 3M6XA 2E1MC 1SKUB 3C19A 2RJZA 4EZ6A 3HSGA 3DCAA 2XHWA 2FJDB 3NCQA 4PG6A 3G9CA 4NCBA 1MWQA 4O3PA 1WOSA 3PM9A 2XMKA 2FHOB 3QFHA 5ADZA 5ETNA 2F7VA 2HQCA 3T5LA 2YVSA 4ZIVA 3W63A 3Q83A 3T9ZA 4DR3F 4NLRA 3H2UB 2KZMA 2BJ7A 5CYMB 2WK4A 4DV5F 3OTBA 3OR1B 3SIPB 1JLFA 4IYQA 2F63A 7AT1B 1S6PA 1PJ6A 2R2RA 2UXCF 4WE1A 3QT5A 2FJAB 3OHBA 4UY85 1IKVB 3M05A 3G82A 4NLQA 5BXIA 1RHUB 1B3TA 3BQ0A 4LFAJ 4IO9Q 3CJSA 3KK3A 1LKZA 3B4DA 4DFPA 3UCGA 3UDCA 5DZ7A 4JV2A 1KLMB 4YR2A 4USJC 2KFZA 1YZ6A 5LSLA 3MPVA 3S6EA 1VBXA 1VOMA 4YP3A 3R6LB 2QA4S 4QWBA 3GV7B 4FF2A 2ZKUA 1S1VB 4LFBF 3V6JA 2EK1A 4LRBA 2MHEA 1BMQB 1PC4A 5KFXA 3SCKE 1M5SA 2UV8A 1X5OA 1SC6A 3IS9B 4B3OB 1YJVA 1RHMB 3PRBA 1VBYA 3K59A 1Y4ZB 3QRRA 1UVNA 1J5EF 1S1UB 1FF2A 4O3QA 1IBKJ 5KFQA 1KQKA 2GVZA 4TQRA 2Z58B 3EZ5A 4CCHA 1JLEB 3IR7B 1RTZA 4NXNF 3UWTA 3BBFA 2AT1B 2W9CB 2A18A 3BSOA 1FKAF 3QIPB 3HVTA 2EBGA 1RT4B 2E5JA 4NYZA 4LIWA 1S1TB 3E01A 2DNPA 4DV0J 4U8YA 1RWUA 2HQGA 3OJSA 2GC8A 1SL0A 2DJWA 2HHWA 4KBIA 5U47A 1CQNA 1R6VA 3TUJC 4ECRA 2H48B 4LF8F 3DXSX 4KHPJ 2B9EA 4DX7A 2FY1A 2QA4G 4FKYA 2HIQA 1G2EA 1E6VA 1SVDA 3CTRA 1FO1A 1R8PA 1S4EA 5DG9A 5DDPC 4ZCMA 2P9CA 5ITHA 1FWKA 2PD1A 2VODA 3K8VA 3JQJA 3O5TB 1S57A 3EM1A 4MYUA 5HROA 1NUEA 4HDGA 4OIXA 1ZTWA 1VGYA 1H98A 2DIVA 3ISZA 2ATCB 3TAMB 3V4IA 2J6SA 4BS2A 3ULHA 2VDIA 2RAQA 1UZHA 2ZEJA 3IBCB 3NOGA 1DTQB 2XZDB 3CCES 2V2QA 3OTCA 2KT3A 3KK1A 5HAOA 3CD7A 1RTJB 4IOBA 4DQIA 1SUQB 3AD8C 4MIWA 3OLAA 5J2QB 4O3NA 1RZMA 3AOAA 2MLZA 4GMKA 1JKHA 4RNHA 4M5KA 4PG7A 3RAQA 1JNRB 3N6NA 5KG4A 3DLHA 3G6VA 2VA3A 1S7IA 3CSKA 2HIYA 2RQCA 4PXBA 2LQ9A 3FCVA 3CW2C 1TU0B 5J2PA 1R43A 3J7Z5 4JI7F 2EEYA 4PWUA 2GJ2A 1TFWA 1RAOA 3M8WA 5KFFA 3NGUA 2QLWA 2IIHA 2BJ3A 1FRLA 2VC1A 3CDAA 4AD6A 1X4EA 1X4FA 3P96A 4F0KA 1TUGB 4F4WA 5CYMA 1G6BA 3SFGA 1KLNA 5DJBA 2RRNA 2B7BB 3CJ2A 2J8AA 4FKXA 2LU2A 5HQMA 1LQ9A 3ZZOA 1FFGB 3CJQA 2DGSA 2GIQA 4DXLA 3D2WA 2HYIB 1KVIA 4DQSA 1KLMA 3BYPA 1MU2B 1B0TA 3R7NB 2Y0SD 5KG1A 1S1VA 2UUAF 1A0OB 4O0IA 4JB8B 1VRTB 2IY5B 4EYHB 1EB0A 4X4OA 1C1BB 5HLFB 8RUCA 4WKRA 4ED0A 1KNZA 4C4WA 1U26A 4KGMA 4USHA 4J9PA 3S7RA 3MUVP 1LW2B 3VALA 4ZVEA 5IXUA 2H9ZA 2YKAA 3S8SA 4KGVB 1S1UA 5KG5A 4UOGA 3OFGA 4LR9A 2W2QP 3PJ9A 3QMQA 1N34F 1ZH5A 4A8WA 5HANA 3QIPA 2MQQA 2MSSA 3ZTQA 3CB4A 1RAJA 1U24A 1TMJA 4CH0S 2IA6A 2FLPA 3AODA 3R9LA 2CPXA 2RDIA 1N5YA 2GAGC 2UUBJ 4DV1F 2V5HG 2DH7A 3BKTA 3SFUA 5BYQA 2AEFA 1GTEA 5LOQA 2A0FB 4LRFA 1JXEA 1YJWS 3E2EA 1UCNA 4UY8T 2DGWA 1KVKA 4OLPA 1RT2B 3BH6B 1F2HA 4U7CA 2RRAA 3SSSA 2J9DA 2YX4A 3TANA 1TK5A 4CI0B 2P5VA 4RW4A 5A2QY 1Y10A 2MKKA 2DR9A 1NPRA 3W61A 3TAMA 1YWXA 5HMYA 3H20A 4ZN3A 4U7UD 4J9NA 4QYZK 4NZ6A 1YJTA 2LDYA 4GKKF 5AXMA 1DTQA 1C0TB 3RB3A 2WCXA 3QBCA 4LJMA 2RNEA 1RTJA 2J9DE 3QRPA 1SUQA 1K1QA 3VZIA 1U6BA 3KK2B 3MDFA 1TUWA 1X31C 3Q22A 1RT7B 4I2QB 5HBMB 5AJ3F 2OPSB 4WYLA 2A1BA 4ZVPB 3IP0A 2P6SA 3BBCA 4CLWA 5AXNA 3MECB 3MMBB 5D0EA 2GO9A 3HVAA 5AXKA 4X66J 4DHVA 1N5TA 4IRKA 1VQ4S 2QO3A 1L3TA 2RS2A 1N5VA 3Q8UA 3OFFA 5D8HB 2WHOA 2ZWOA 4RU2A 2YNGB 4F4AA 5BJRA 2JRSA 1B7FA 3KDOA 2FZCB 2LQBA 3EDRB 3GILA 2G2OA 9RUBA 1QAIA 3FCWA 4B3RF 1C0UA 1Z4UA 1RBOB 2DY1A 2ZH5A 2K1RB 1X5SA 3HDSA 3VV2B 1JJCB 4CLSA 2Z2LA 2CRLA 1S9EB 3R7BB 4ZCIA 1UL3A 2QG9B 1S5ZA 2YWKA 1FKOA 1C4CA 3L09A 3MCOA 3D67A 4YHHJ 3PRVA 1MU2A 4NLVA 1X4AA 3X1LB 4AL5A 1CJUB 4KH1B 1R8AA 1KOHA 1VRTA 1SJFA 3SDEA 2DNLA 1RWMB 4AE5A 3UNYA 1C1BA 5HLFA 2B7CB 4AL7A 1NM2A 1CBKA 4P2FA 1TK8A 4A8QA 4OJ3A 4OYWA 1H2UX 3IM9A 1RYSA 1N88A 3TARA 1XBWA 4QU6A 4FXDA 3IA0A 4I6AA 1YX2A 4KV8B 1I3OB 2YX7A 2CNKB 2DCLA 1AB8A 4CO2A 3CCWA 3MGJA 2FVQA 4PWDA 5CH7B 2YNHB 3DM2B 2J76E 5DM7Q 1FEEA 2CAJA 4Y0FA 1YSJA 4O4GB 3A8EA 2MQMA 1BE4A 3BQ2A 2FVCA 1MWZA 1IR0A 2UUCJ 1N0VC 3DOLB 4TVAB 2QGFB 3LGHA 4DLEA 2XO6A 3UQSA 2HBRB 1RAIB 2MQOA 3FVYA 1N56A 2YNFA 2Q3PA 1Q86T 2V34A 3N0VA 3UW1A 5E33A 4ITSA 2MLXA 3KHRA 4OZ0A 5IS2A 4IKAA 2J0XA 5J1NA 2HZAA 4NPOA 2X3GA 4ELVA 3DOMB 2HSEB 3MAAB 1QUVA 4FYXB 4ED1A 2GW8A 1WC4A 4ZHRB 4I6YA 1BWEA 1WSVA 3UCZP 3KK2A 2L9WA 5KFYA 1U8WA 2L9NA 3H0PA 1RT7A 2WBMA 4DG1B 5HBMA 2JLGA 3RAXA 4C3MA 2VBXA 1WDDA 2WVCA 4OYMA 5J1EB 1Y5LB 1RGVA 1WKJA 3MEGA 1R0AA 3MMBA 4AXJA 3MR7A 2CWXA 3QGIA 4OLOA 2PO4A 1WORA 5E3QA 4MH8A 1BWVA 1Q5YA 5CYJA 4KFBA 2R7XA 4FYVB 1HNXJ 1RWWB 1GMVA 3IN5A 2ZHBA 1XC9A 3LP1B 2BR0A 1PYSB 4C9DA 3AT1B 4DSEA 4X4PA 4KYZA 1N4LA 1TV6A 1YK9A 4I4BA 1P9QC 1NJWA 1RAHB 1DBDA 4XTTA 4EYIB 1WHWA 3W2WB 3DRPB 4JUZA 4MTPA 3TZXA 2Q6BA 2J6TA 4C98A 2K1RA 1H2TZ 1LW0B 1S9EA 3CMES 3D9BA 1Q1KA 4YOEA 2BBEA 2IBOA 3UDVA 3DRYA 4WCEQ 2MZ1A 4ED8A 1IJEB 1CJUA 5F8LA 2BKPA 1K47A 4H4OB 2HKEA 3CNQP 2VJVA 1FD2A 5F41A 4MMOA 4ZLNA 3PYFA 3UFCX 2ADCA 2CKWA 3SCIE 4ZKAA 1UFKA 5GAEU 3MXHP 1EETA 2KT5A 3HZEA 1NHVA 5GADU 2K3IA 1MROB 1HNWJ 1PYTA 2EFGA 1PILA 4YR0A 1MSWD 2DGVA 1O8BA 1HD0A 1HBNB 1XR7A 2IM0A 3ZZPA 3WDOA 1F3FA 4H54A 2C2MB 1S1WB 1ZM4A 4FNHA 5G4DA 1W26A 4F8RA 4CZCA 5CYQB 3DM2A 3H59A 1UVJA 2C3PA 1SB6A 4O4GA 2KG1A 1D1UA 1Q95G 4Y28C 3BR8A 1KD1T 4I69A 3TA2A 3T6JA 4A8MP 3W1YC 1WUUA 3KDNA 3UN2A 2CIMA 3KLIB 1QAYA 4ANEA 3K5PA 1VFJA 1RTDA 3DOLA 2R7WA 4I7FB 3HVWA 3A1YG 4L6V3 4ZPTR 4LF5J 3T1YF 4ILMA 3GSIA 2GJIA 1LWXA 3P3DA 1C1CB 4TU7A 1OQ6A 2OMLA 1NDCA 2DHAA 4U7UK 1MNEA 1DY3A 4R5PB 3UD5A 2H51B 1FVSA 1S0OA 2E1RA 3PW2A 2DGOA 1XQIA 2HFUA 2BKOA 2M2BA 3G8TA 2ZD1A 2FVPA 1D8ZA 2B3TB 3NMAA 4B9NA 4JI8F 1S6OA 4CWBA 3A8KA 3MAAA 3UPFA 3PY8A 4FS2A 5KFKA 2LEBA 1VCTA 4CLYA 3GFXA 1NK8A 4C8LA 4RW7B 4TLRA 4CT8A 4ZHRA 1VBKA 3ZZYA 1REVB 2BANB 3H8YA 1F5BA 5I3QA 2Y0BB 2D9OA 3GSDA 2BQ3A 4PG5A 4QIEA 2DXEA 2XY7A 4Z7CA 3AXKA 4GVBA 1BUXA 1ZBTA 5D78A 2H65B 3SQOP 1QSYA 3M9MB 4UQTA 2KKHA 2XC9A 3HFZB 4XDDA 3ISND 4LF1A 2NZCA 2CUYA 2C2OB 4FPRA 3PHTA 5L8RC 2Y1LB 2FUG9 4GRSA 4YB1P 1U7LA 3RB4A 3MM7B 4NA2A 3TUPA 3LP1A 1RDRA 2XLIA 3PACA 4JV5J 4F4YA 1RTIB 4HI2A 3QQCD 5F3ZA 1MMDA 6FD1A 5GAHI 3D3CJ 1QUPA 2CQ4A 3N5FA 1Y11A 3LPYA 3BGOP 2IRYA 4OZ2A 2NZ4A 1XN9A 2W9BA 4Y2CA 2HNZB 2E1AA 1UVMA 3DRPA 2IAJB 4N76A 1VJWA 3UD3P 1LW0A 4C0OC 3DLEB 4I2PA 3GV5B 3CEDA 1FESA 4IRCA 4NLTA 4K0KJ 1B99A 2MJNA 2DXFA 4ID8A 3I4HX 4DQQA 3LP2B 1XK8A 1RWOB 2WW4A 4WK3A 3KLVA 3E3XA 4JI4F 4MT1A 1M1KT 1RA6A 1VI7A 3CCSS 2HK3A 4XO0A 3Q0AA 5THWA 5C2CA 2C3YA 2JDJA 4BLGA 2KRRA 4RUCA 2VV5A 2UXDJ 1WEZA 3IWXA 1EAYC 1Y0HA 1ROFA 4F7VA 3VVUA 3HFVA 3HHLA 3TVZA 4ED6A 5KFWA 2DGUA 2P8IA 2JL9A 1S1WA 4RBVA 1Q16B 2F65A 1O0PA 4Z37A 1PAUB 3CWJA 1FEHA 3AA8A 2B5JB 2YH0A 3FJ2A 3B4MA 2V8VA 4DV3J 2FDNA 2D41A 3J7A1 4Z2XA 3KLIA 4KJIA 2Q79A 4USVA 2M8HA 4I7FA 2R7SA 5SZTA 5L38A 3BS9A 1XMQF 1W25A 3NBPB 2XNQA 1JLGB 5B0FA 3J7YI 2YQ0A 2MQLA 4DR2F 3F73A 4DS4A 4R5PA 2AP6A 1RAFB 4X65J 3GV8B 3DGVA 4HKQA 1TP7A 4CNZA 1RAEB 2FJVA 4KRWA 4C48A 2H54B 1SIZA 2PA3A 2ZOFA 3KXDA 4HL9A 2MKSA 4YB7A 3MUMP 5DGBA 3CJ3A 3FKBA 4WFBQ 2VD3A 2CWKA 2B8QA 4RW7A 2V9KA 1REVA 2BANA 3D0HE 3IC1A 1V5VA 1QSSA 1RT5A 3D0GE 3Q23A 2HMIB 1M1HA 4QWCA 1GK8A 2BJ9A 1NBEB 4OJGA 5KFTA 2ZC4A 2XULA 4KT0C 3LPEA 5D0RA 4DR3J 3FQLA 3BJYA 1FJCA 1RQ0A 3TX8A 4DPOA 4DV5J 4EGLA 3DDIA 4A46A 4ZPBA 3GPAA 5AT1B 2CQIA 3PO5A 2UXCJ 4MJKA 2Q6CA 3MM7A 4ZDNA 1JLBB 4XK8C 4PYAA 1NCLA 3I31A 4LFAF 1ZAXA 2V69A 1VLYA 1HQ2A 2DK2A 1RTIA 4OI3A 2BM1A 3I9V9 5CD4A 2AJFE 2R4FA 2B4UA 3D6FB 3M6UA 4LFBJ 2HNZA 1KS2A 3JYTB 2HQIA 2YH1A 3CF5Q 2VF3A 5IFMA 2VKRA 2DGQA 4QIVA 2PN6A 3R2DJ 2Z57B 4JI6F 5FD1A 3DLEA 4OX6A 4FBUA 3V6HA 4G3IA 1X0PA 3OXFA 1NK9A 5LXYA 4J9MA 2V8PA 3CJ0A 2LP4A 3MD1A 4ZP6A 3LP2A 1J5EJ 4USMA 5E0OA 4HTJA 3MCNA 5KFJA 3DLJA 4JI0F 4NLSA 2FLNA 2FJWA 2Q1LA 2DGXA 3FFIB 5HJXA 4J9SA 1UAWA 2YKMA 1SXLA 3RJMB 5FJ4A 3PJXA 1KWMA 1VC5A 5IT0A 4WU2A 2LYVA 4DV0F 2DXDA 4NL5A 3RAMA 2GHVC 3AB2B 3P8BB 4OHYA 2MDAA 5L46A 3GCXP 3M2VB 1S9FA 1YJNS 2LMIA 3RRKA 2LVWA 1HHTP 2KM8B 4MAKA 2VU5A 1U1RA 4DPTA 2X1BA 4ERDA 1H74A 1RT6B 4LF8J 1YDLA 5GMDA 4ICLB 4WIQA 2MZTA 2IYIA 2IVYA 4O3RA 4QR0A 2BJDA 2R8KA 2W4CA 3W5ZA 1NHUA 2K8GA 4ES2A 2ZH7A 3HLUA 1VJQA 1KTQA 1VQOS 4PQUB 2MSTA 4JV0A 1QE1B 3PIPQ 2E7WA 1H7WA 1S59A 3VAGA 3NBPA 4CP5A 1WTFA 5H9FJ 3LAKA 2LQ8A 2CNNB 3R5CA 3RRHA 2VFSA 1OPIA 1WD6A 4G1QB 3DMJB 3N6MA 4ED2A 3UCUP 5IM0B 5I42B 1Q8BA 3T5JA 3KKFA 1U8SA 1NKBA 2HNYA 1JXLA 2R7VA 4OI1A 1Q8KA 4ZJOA 1IR1A 4RW6A 1HPZB 1UJ5A 1EZZB 6AT1B 3CCMS 3QO9B 2RIJA 1S4FA 2ZJPQ 1YRXA 4DV6J 3AA9A 2FQQB 3RUBL 3FK4A 4NE9C 3HZGA 1YBUA 4OZJA 5E3RA 2HMIA 4KC5A 5HVFA 3DRRA 3GIJA 1YRUA 2HZCA 3KLGA 4JI7J 2P2CB 1TL1B 2XCPA 4K4UA 5EX0A 3J80Y 2HAFA 1D9DA 4X4VA 3MM8B 1ACMB 4QU7A 2HLUA 3O2IA 1I94F 2AJ4A 1WF1A 4DPYA 4ZIWA 3M8QB 1Q5VA 3QAEA 3C14B 4KPCA 4RU9A 2GX8A 3EWGA 3WX4A 2YQ3A 1TAQA 3UI3A 1H0HB 4P2SA 3EDQB 4DSLA 3RU0A 4DX8H 1M90T 4C3LA 1FKPB 2L3MA 1G7CB 1K8AT 1FXLA 2VL1A 2UUAJ 3RTVA 5I3PA 4OX8A 5K20B 3W7BA 3POTA 3BSCA 2G2YA 1RKIA 4L3NA 5F0WA 1X4DA 1NZ8A 1KEKA 3KG1A 2Y1JA 5JXSA 3C6TB 1VRUB 3MPUB 3RB6A 2FHKA 1NPPA 5HJYA 1NMEB 3C16B 1FX4A 3V6DB 3FFIA 1G4CA 3M32A 2DNNA 5CAAA 1N34J 3M8SA 2CYYA 1X5PA 3DDNA 1H73A 3DDKA 3DLGB 1CEZA 2J9EA 3C2PA 1SQEA 4MIBA 3DLKB 1HBOB 5IWAF 3I5AA 3I0RA 2CPZA 1SV5B 2QX0A 4RWWA 1F6TA 3GTYX 1DRZA 2IDEA 2AZ1A 1XNRF 4C8ZA 1WACA 3CJKA 3OTDA 2IMOA 4K59A 1HNIB 1RKJA 5KFRA 4P7VA 2V63A 2UUBF 3GJRB 1F1BB 3PEHA 4AQYF 4ICLA 4CLTA 4EU0A 2R7QA 3BV8A 3V81B 3H98A 3GP9A 2OSRA 1HHSA 5E5NA 2AYMA 1NJZA 2EKYA 4TQSA 5SUHA 2RF2A 1DLOA 3NAHA 3ZZTA 3D1QA 2OPPA 1VBZA 3B78A 4MFBB 1SIWB 4U8VA 1QE1A 1WG1A 4URQU 4LVOP 3KLEB 2G13A 4KIAA 2LQJA 1N32F 1IWGA 4IQMA 2W7AA 5KFCA 1OIAA 3NLCA 4TY8B 4G1QA 3DMJA 1KVJA 2FZGB 4OZ1A 1K44A 1RTHB 1FTRA 5I42A 2WAQD 1NLKL 1U25A 4LF6F 5KAKA 1FJEB 3V2UC 1Z2ZA 2GZOA 1JJHA 4YEAA 3HM9A 5AE1A 1HPZA 3SSRA 1WC3A 4DCPB 2DISA 3UR3C 2DPIA 4JOUA 1RBLA 4NX9A 4MKBA 2OD4A 2C3OA 3RRGA 3AHPA 4LQ9A 3NS7B 4F04B 1SKWA 2C2NA 1FXRA 4Y2MA 3FBBA 1RISA 1A9NB 1CPZA 4WPAA 4RNNA 3DC2A 1XR6A 2BRLA 4RWXA 3EUNA 5L1LA 2JFDA 4DR7F 2ZC3A 2DH8A 3SCLE 1K9MT 1S12A 2N3LA 2LECA 4B3RJ 1HR0F 3MWBA 3VGUA 3TX0A 3PHEA 3OD2A 2QTWA 2CPDA 4JI2F 4YHHF 4B3TF 8ATCB 1FKPA 3V4MA 4DR5F 1UVIA 2C3UA 2WVFA 2AEJA 1XTZA 1RT3B 3VF0B 3RW6A 3VAFA 2DCUB 2KG0A 4ENOA 3W2VA 3AY0A 3Q24A 1VK3A 1JMTA 2FIUA 1X4CA 1KC8T 2C28A 4HYKA 1WELA 1D8YA 1JK9B 3CXCR 4OX9F 2APOA 3BDPA 3M8YA 2G4BA 5EDWA 3RZAA 5ETRA 3C16A 3LANA 4L72B 4EBDA 2E9TA 5A6WA 2OLWA 3TYTA 4ZMMA 5G0RB 2ZBQA 2UV8G 2IRUA 2XI3A 1DURA 4RNFA 1K73T 1DQ9A 4PPZA 3R97A 4FN5A 3SEOA 4Y3CA 2QN6B 4K2XA 2UUCF 1HNIA 2HW3A 5B0EA 3THVA 2VG7B 4QW9A 4QBUA 3I6PA 4KTQA 1PG5B 1O6XA 4MK8A 4NEZA 2UVWA 2DNGA 1NSKL 2QYGA 4U95A 2DT9A 5K5MA 2PI4A 2ZZTA 1K0TA 2JEIA 1PJ7A 1P27B 5KFHA 3QLHB 2ZE2A 2ROPA 2DEIA 4CT9A 2PGCA 2BUNA 1NH7A 3MMAA 1NDLA 3AQOA 2R8GA 3K58A 2UVUA 1RWKB 4OYPA 4UOFA 2AW0A 2WRMA 5KFNA 4P73A 1F9HA 3WQPA 4PAAA 4TY8A 3CULA 3KLHA 1BHNA 3D0IE 1RTHA 3K57A 3OL6A 2XTJP 4M95A 4WBFA 3NEKA 3M2RB 1D09B 2L9DA 4I6WA 2ZOGA 3MEEB 2CZVC 3PV8A 3RBDA 2BE2B 1RWNB 4MKVA 1FRIA 4QJVA 4EBCA 2VG5B 2IC3A 1PJ5A 5ETVA 3Q8PB 3GB0A 2VPZB 3U02A 5DRKA 4URGA 5D0HA 2XMVA 2BYCA 5E3PA 5HQ8A 4LRDA 4N41A 1LXJA 4X4NA 2HGLA 4V1Ak 2DRDA 2AMCB 2KYXA 2R7RA 1ITPA 2RQKA 2KU7A 4ZJQA 1LWFA 1OYEA 4ZVQB 1VQYA 4CLFA 2JNJA 2M70A 1SC3B 4EO6A 3M30B 3M1VB 1Q81T 3EZOA 3NGDA 2LDIA 2YKPA 4HACA 2N7CA 3CVKA 1LXNA 3M4XA 5T7LB 1HWJA 1SJQA 2DNOA 4NLGA 1HHQA 3T5HA 2M4MA 4DF8A 5I4MA 3HCXA 3ZTSA 2U1AA 2D9PA 2WW8A 1TQLA 1AUSL 4ANDA 2E29A 3I0SA 4RZRA 2ASLA 2MQPA 2ADBA 3BGRB 4CTAB 4QIWD 2XGQA 4RW9B 3U1MA 3M6WA 4BHQA 3CO0P 3KUEA 2M88A 4WF9Q 1K1SA 1N52B 4QYZJ 1WTBA 2WSFC 2GA7A 1FCAA 4YDDB 2OGUA 4TU9A 1J5OA 1AT1B 5G0RA 3ETOA 1OSCA 4DOZA 1MWYA 2GMJA 5DLGA 3LAMA 1YJRA 2E5LF 1BQNB 1FXDA 1JB0C 1U02A 5FIIA 4FBTA 1T3OA 2FY8A 1GAOA 5EGYA 2VG7A 2JLEA 4DUYF 3PW4A 3DOKB 3PEJA 3T1YJ 2MXYA 1XMBA 3MPDA 4OYZA 5LM7E 4ILLA 4DU7A 1IM4A 1UA0A 1XWLA 2E7VA 5D0GA 1HIYA 3W66A 2QL5B 3QLHA 5LJ5Y 3PX0A 1CJTA 1UEKA 4I56A 4EFAC 2DNRA 2GHWA 2HVHA 2W1BA 4JP8A 1U49A 3QYYA 1VQMS 4KAIA 1A7GE 3G6ES 4A8OA 1D3WA 2AGPA 2QYCA 1HI1A 1CS4B 2DO4A 3EXCX 2VZ9A 1Q53A 1HWLA 2XYGB 4G6VB 4OHZA 3OW2R 3VGTA 2VKZG 2F9DA 1FWPA 3U1LA 4W92B 1TL3B 1FVQA 4WJBA 1VHIA 1T7PA 1AYEA 2VDHA 2MY7A 3OL7A 3MEEA 2ZHOA 4GO5X 2NXEA 3R7SB 3QT6A 5T41A 1JLFB 3ILJA 2BE2A 1S6PB 2CQPA 2W2PP 2V8GA 3F56A 4WE1B 2QEXS 2VG5A 1I5OB 4OYIA 2J7UA 3MZIA 1FDBA 2GQ2A 2HFOA 1AUDA 1UVKA 2YWFA 4RNMA 1GMWD 2KH9A 3TO8A 3HO1A 3HT3A 1UEVA 4IR9A 2VQFJ 1OSDA 2BV3A 1F9FA 3EVOA 2PA8D 5A76A 2A2DA 1DARA 1FE0A 4PYDA 3DHWC 3K2YA 5DQGA 4AYBD 1QY7A 1NJIT 3IR5B 2H5EA 1KTVA 1HMVA 2ATLA 3M30A 2O5DA 3M1VA 4L75A 2ZJRQ 3UDLA 3SYZA 1FRJA 1U1MA 3ZXWA 3BDEA 1DQAA 3CDUA 5HVHA 4DEZA 1HWUA 2ACMA 1FRMA 3WX8A 4U67Q 2VJUA 1NSPA 4JI4J 3TP2A 3OBIA 4E98A 3BKUA 2R3VA 1AFIA 3G6XA 2PIIA 4RW9A 3E01B 5D4PA 5CCMA 2UXDF 4OZ3A 1RLDA 2ZVSA 4KSEB 4IOCQ 1M5VC 1KQGB 5KT4A 4I1TA 5KFSA 4KGKA 2IFXA 1FNMA 3MOJB 5JMNA 1E6VB 4K4WA 5HP1B 4UTGA 3VGVA 4WTOB 5JUMA 1BQNA 2EBEA 2OEJA 4FXWA 3OL9A 4S0MA 4LF2A 3NL0A 5GAEI 2NLWA 2Z8QA 5GADI 5HROB 4ZCLA 4ECUA 3P5TL 1GNKA 1HA1A 3UN3A 2I1RA 4ZP8A 2CQHA 2OKQA 1RAGB 3WC0A 3ZNUA 2BKNA 2XNRA 2JEJA 4NLXA 3MEDA 1WOOA 5AXLA 8AT1B 3VAJA 3KK1B 1YTYA 5KG3A 1UJ4A 4DI6A 2V9WA 4L74A 4WU3A 1KR4A 4ELUA 1JKHB 3ILLA 1X9MA 2WBRA 2NSBA 4K7QA 1XERA 2XY6A 5EHHA 2PMHA 5CABA 1CS4A 4ZCKA 3R5AA 4A8YA 4FP9A 3W9IA 2DRBA 2RU9A 1FK9B 3WHIA 3MPYA 3UE2A 5HMZA 2BABA 1B0VA 2ZUAA 2H3EB 2EC0A 5J2PB 1X9SA 4PG4A 1TL3A 1U4BA 1Q82T 2M9KA 2KTQA 2DHGA 2HHVA 1CQMA 1NSAA 1CULB 4C6AA 1C2PA 2VFRA 1SL1A 4OHXA 3NOCA 4IFVB 3SV4A 4ER8A 4OI6A 1KOOA 2BM0A 5B0BA 1X4BA 2Z56B 2DTJA 1LWEA 2DNMA 1FA0A 3H7HB 2R7UA 1QDUB 2BE7D 1T95A 5DETA 1FDDA 2OSQA 4IO1A 5IQQA 5DDQC 2HG4A 1EHWA 4X64F 1JLAB 3W60A 2B6AB 1FFSB 2V8HA 4OI0A 4JI6J 3QT8A 3PIOQ 4GO7X 1GXUA 1UEUA 1FRHA 2BVZA 4QIGA 3IG1B 3J80U 1N0UA 3BYRA 4CRJA 4PG8A 2LXIA 4J9LA 3E51A 4JI0J 3O44A 2B9WA 4HI1A 2ZH4A 4DR4F 5K8MA 3QAUA 1Q8IA 2CJ9A 4IH7A 4CDIA 3DLBA 2O1PA 2HHPA 1YLXA 1Q7YT 3JS9A 1U1KA 2NXNA 2XQCA 1OY9A 4HLBA 2IM3A 3FBEA 5L1KA 2GNKA 3QSIA 3LO3A 1XEZA 2XZWA 2XS5A 2NUUG 4DL7A 5HVGA 1S76D 2VFVA 4OI4A 1JQGA 2VOPA 1AZSA 1N5YB 4IQXA 5HMXA 4UT4A 3NCRA 2HQFA 3MMCB 3PCOB 5HP1A 1FDAA 1X9WA 5EWEA 1J27A 2ASJA 5KFGA 2HWHA 4O4RA 5GAGU 2KRBA 4NLPA 2GMLA 3G8SA 1R6YA 2ZWPA 4ZVFA 3HKZD 3RBEA 2BJ1A 1SC4B 2CVIA 2JHEA 3ZTOA 3MPWA 4MK9A 4RW4B 1RT1B 3M7VA 2MTLA 3MAHA 3PKYA 4CYUB 2VONA 2MEWA 2BA9A 4LMZA 2G1HA 2Y8YA 5L1IA 1ZPWX 2XMAA 3EGZA 2ZBPA 1GMUA 2NXUA 2ZZMA 3NMRA 2I38A 3NWGA 4L76A 2ABYA 4B17A 3SCJE 3P4UB 3Q8SB 3AJDA 3MURP 2PE8A 1ZA1B 3ZZZA 3MMJA 1S10A 3H4DA 2VUGA 2HGMA 1S6UA 4OYAA 4G1PA 3PDNA 2HBZB 1R8BA 3JSYA 4DV6F 3M8RA 3K89A 2FZKB 3GJSB 2BQRA 4ZJLA 2QMXA 1XMOF 1NKCA 1FK9A 2RMLA 4AXIA 3N28A 5K8OA 4CNYA 4ZVHA 3MM9B 1ZYQA 2RKIB 3THPA 2CJKA 3AD9C 3BZQA 2XMTA 1SQGA 3TWZA 3T6BA 4LR7A 6FDRA 3I56S 3NGSA 1CULA 1M5OC 1HQEB 3ILOA 3VAHA 3TEHB 4EK2A 3TA1A 3EVMA 4V19J 1I94J 2HWIA 5GVQA 4IFVA 3H4BA 3ZFVA 2K2PA 1C0UB 2N82B 5ETOA 2CPEA 4E8UA 3VZHA 2YWWA 2VQEF 2DH9A 1FKOB 4DV4F 4M5LA 4I64A 2AJQA 4X4TA 3FRYA 4OQJA 1NAQA 3K7RA 3SDEB 2E66A 2FJEB 2F8EX 3IFEA 3KWMA 3MTKA 1JLAA 2B6AA 2V50A 2FC9A 2KFNA 3TOQA 5KFBA 1MMLA 4OYOA 3FZ2A 5BYSA 3T19A 2F8HA 5JVHQ 3VTIA 3QPIA 1YBAA 3QGPA 3IG1A 4CIOA 3OQ2A 3CMQA 4NRUA 2I2YA 1CSJA 4GC7A 3N01A 1JX4A 1S6QB 4LSNA 3IM8A 3EJMA 2CJYB 2IJFA 4WYWA 3FGVA 1MW7A 5B0AA 4PWDB 3AOBA 4H4MA 5KTQA 2ERRA 4C8MA 1X60A 2BW2A 2Q43A 1B64A 2OPQB 1IUJA 4M5GA 5IWAJ 5KT6A 2VFTA 2XG8A 2FLLA 1WKKA 3I55S 3GE9A 2QLXA 1XNRJ 5K9FA 3FQKA 2J8SA 3DHXA 3PYGA 2EFVA 3RYLA 4NYOA 2R7TA 2CQ0A 3TZYA 1NK0A 5DG7A 1GXTA 4TY9A 3TI0A 2QMWA 2H5JB 3MMCA 4AQYJ 2ZJQQ 5D4NA 4J90A 2ZHAA 2CPHA 2VASA 2YNFB 1GQEA 1J2VA 3BO2A 1N36F 2HBYB 1NK6A 2G9OA 3O8WA 1TKXB 5CZXA 2HURA 4M63A 3OTEA 2RHSB 1TELA 1RT1A 3CJ5A 4NCAA 2J5AA 4IG0B 4IG3B 4XAKA 2WTFA 4CYUA 1N32J 1X0FA 3UN5A 2BMBA 3CIMA 5E3CA 3CPWR 2OI2A 3QATA 5FDLB 3MD3A 2N3OA 2ZDOA 5F8GA 4LRCA 4LF6J 3BM7A 3R5JB 3JSRA 4P10A 1T0TV 1U45A 1LWCA 3HSZA 2JX2A 3AOCA 2CADA 2LEAA 4A4JA 2UXBJ 1RADB 3F44A 3B8HA 2CJXB 3LQVA 1KQFB 5IZHA 3MEGB 1R0AB 4P6QA 1T94A 2VPYB 3TR5A 2B9YA 3CUNA 1Q79A 2KB2A 1RXOB 3MM9A 1ZZNA 2RKIA 4KFBB 3LTOA 5IC6B 4CO0A
chains in the Genus database with same CATH topology
4C11B 4WE1A 5KG2A 2FJAB 4ELTA 4HTIA 3OHBA 1YIJS 4X4VA 1FNXH 3MM8B 4MK7A 2FC8A 3BR9A 3HK2A 4UY85 2XMWA 1IKVB 3M05A 4QU7A 2EVZA 4NLQA 2HLUA 3O2IA 2C3MA 1I94F 2AJ4A 3BQ0A 3V6KA 4IO9Q 1LK5A 1WF1A 2LEPA 3KK3A 1LKZA 3B4DA 1HQEA 4DFPA 4QIFA 1TZ0A 1LV5A 3UCGA 3UDCA 3M8QB 3SXLA 4C8YA 2P6TA 5HMWA 1TV6B 4JV2A 3N6LA 3KJVA 3QAEA 4ZPWR 3HP6A 3OVSA 1KLMB 5HO4A 4YR2A 4USJC 4NWBA 2DR8A 4RU9A 1VQSA 2HRYA 2KFZA 2JOQA 3MPVA 5LSLA 3S6EA 1VBXA 3M8PB 1VOMA 2MZRA 4PXEA 1HWKA 2GX8A 4NMLA 1X7VA 2YQ3A 2DNHA 1TAQA 3DNCA 4QWBA 2VPXB 2NS1B 3UI3A 3W2WA 4CO4A 5KOXA 1H0HB 4P2SA 3GV7B 4B9MA 2GGPB 4N47A 4FF2A 2ZKUA 1S1VB 4HEA9 4DSLA 3RU0A 3VQTA 4LFBF 4B3SF 3V6JA 1T03B 1L3UA 2YKQA 1HMVB 4DX8H 1M90T 4C3LA 1FKPB 2EK1A 5K8PA 2MHEA 2L3MA 2LKZA 3CC4S 2L08A 3DU5A 4K5RA 1PC4A 5F8MA 2X51A 1G7CB 5KFXA 1K8AT 3SCKE 1FXLA 2VL1A 3FDSA 1M5SA 4RUHA 3RTVA 2UV8A 5I3PA 1HBMA 4OX8A 3W7BA 1X5OA 1SC6A 1D0EA 5LMUF 3IS9B 4ECZA 4B3OB 5DGAA 4KE5A 1YJVA 3CD6S 5HI7A 3POTA 4MKYA 1P6TA 2HFZA 3BSCA 4FXVA 3PRBA 1VBYA 3G86A 3K59A 4H4OA 1AXQA 1Y4ZB 2W9AA 1UVNA 1RKIA 1J5EF 4WXWA 4L3NA 1S1UB 3OSNA 5F0WA 3ZZ0A 1Q7LB 1FF2A 3O6QA 1X4DA 4O3QA 1VQ7S 5KFQA 1KQKA 4TQRA 2CFXA 4EEYA 3CDBA 2B43A 4Y00A 3EZ5A 1KEKA 4CCHA 3KG1A 1JLEB 3IR7B 4ECQA 4BWMA 2Y1JA 4NXNF 5JXSA 3C6TB 2MKHA 3CIZA 3UWTA 5B7WA 1N6QB 2B4VA 3D1HA 3LP0B 3JAMY 2W9CB 3J81Y 1VRUB 4LF9F 1F0XA 2A18A 2FHKA 1EETB 2XLJA 3RB6A 2Z0GA 2JWNA 3BSOA 1FKAF 4KKOA 2IM1A 2OFHX 3QIPB 3V6DB 4DL3A 1OQ3A 3FEYB 1MROA 1JLQA 3FFIA 3HVTA 2EBGA 1RT4B 1ZAWA 3M32A 2E5JA 2DNNA 4LIWA 4NYZA 1S1TB 3RW7A 3E01A 3HKWA 3I5BA 3TVKA 2J0SD 2DNPA 2DBBA 4X4QA 2KHDA 3M8SA 1S6QA 2YNIA 2CYYA 1X5PA 2P9EA 2EI5A 3DDNA 1HBNA 1HL6A 1NO8A 3DDKA 4FVMA 3OXGA 3DLGB 5E2QA 1CEZA 2J9EA 3OJUA 1RWUA 3C2PA 1SQEA 4Y6IA 3OJSA 2GC8A 1SL0A 2DJWA 4MIBA 2HHWA 5LSRA 4N5SA 3DLKB 1HBOB 4KBIA 2OPRB 5IWAF 4JV1A 3I5AA 1IN0A