4RW9B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B03
4ZHRB 1TL3A 2RF2B 5T14A 2B5JB 3BQ0A 4WZQA 4KFBA 4KB7A 2HNZB 4I2PB 2W9CB 4TQSA 5J2MA 3HHKA 3NBPB 3V4IB 1EP4B 4RZRA 3MFIA 5C42A 1TP7A 3KLEA 4ZVFA 5KG1A 1JLAA 4IG3B 5HROA 1S1VA 2CKWA 2O5DA 1T03B 3KLFA 2FJWA 3DOLB 5J1EB 1MMLA 3M8PB 5I3UA 3PW5A 3T1AA 3I0SB 4WFXA 3FQKA 2B43A 4Y34A 5KFOA 1JLBA 1QE1A 3DM2B 1S0NA 4FS1A 4DG1B 1JLGB 1LW2A 5KFCA 4EO6A 3RAQA 4B3OA 1REVA 1HQEA 2EC0A 2IC3A 5DQIA 4ZMMA 3IGVA 5KG7A 4IKAA 4RUCA 4J9QA 4NLUA 3T5KA 3QZ7A 4IH6A 5DGBA 3QGGA 3JSMB 2W7PA 1RTDB 2D3UA 2R2RA 4Y2CA 3GV5B 3Q8RB 4ECXA 1DTTB 5HLFB 3DMJB 3UQSA 4RW9B 3IRXA 2HNYA 2W8LA 3DRRA 4ZHRA 5KFLA 3MEDB 4K4WA 2OPSB 4LSLB 5D3GB 4O3SA 2WHOA 1R0AA 2ZE2B 4TYAA 1DTTA 5HLFA 1T94A 5KFSA 1SV5B 4IRKA 3M9OB 3DLKA 3DOLA 5J1EA 1LWEA 1S4FA 2YNFB 2ASJA 1RTJA 1S1VB 3EZUA 4IDKA 3NAIA 3LP1B 1RA6A 5C42B 2IM1A 3BR9A 2AQ4A 3KLGB 3NGDA 1REVB 2WTFA 4DL7A 1S1WA 4G3IA 5KT5A 2R8KA 4KFBB 3D28A 4NLWA 4KHRA 4RUAA 3QLHA 2RKIA 3TAMB 3GIMA 2W8KA 1TKXA 1S1XB 2WK4A 5EWEA 4KE5A 4K4ZA 4PWDB 2AX1A 4R5PA 4KO0B 1S0OA 4IRDA 4ZPBA 4J9PA 1T05B 2W7OA 3FFIA 4NLQA 3QO9B 4TY9A 2E9ZA 3JYTA 1ZETA 4G1QA 1J5OB 3EPGA 1NHVA 3BJYA 1N56A 4FBUA 4KV8A 4WXOA 2IC3B 2IA6A 2FVSA 3NBPA 1JLEA 3V4IA 3OL6A 3KHGA 4H4MA 3RB0A 4ICLB 3C6TA 4NLDA 3FFIB 3RB3A 3H5YA 5J2PA 2OPRA 2RF2A 2VG6A 3BGRA 3KK3A 1ZTTA 4URSA 2AGQA 2C2RA 3FDSA 3KHLA 3C6UA 5C24A 1LW0B 4O4GB 1LW0A 1HNIB 4K4SA 5F8LA 2E9RX 2VG6B 3BGRB 4TXSA 3NL0A 4O44B 4KBIA 2UVVA 1LWCA 2WONA 2R2SA 3D5MA 4O3RA 2BQ3A 1C0TB 1S6PA 3OHAA 3KLFB 5KFXA 1DTQB 3PW2A 4IFVA 2JEJA 4DL3A 3KLEB 4XPEA 3MECA 2B6AA 1HQUB 4GC6A 2OPPA 1KHVA 5J2MB 1TQLA 3JYTB 3GIJA 2HNZA 1LWEB 4I2PA 3H5UA 2WONB 5KFKA 5K14A 4QPXA 5KG5A 3MF5A 3T5LA 2V4RA 1D1UA 4J9SA 3ISND 1TL1A 2I5JB 2IM2A 3DRPA 2IJFA 3GIKA 1TKXB 3GV7B 5KFFA 4X2BA 3H98A 5L1JA 1QAJA 3LP0B 4IG0B 1HNVA 4DEZA 5JXSA 4ID5B 4YR2A 1UWBA 3I0RB 3MR3A 3CDUA 3FSIA 4EYHB 3KHHA 4KKOB 5DQGA 3H4DA 1JXLA 4URGA 4IQXA 1RTJB 4OL8A 1C1BA 4O4RA 4ZPCA 5KFTA 2BQRA 1JLCA 4PQUA 3CDWA 5KFQA 1JKHA 3CJ3A 1RDRA 3N6LA 1S1TB 1IKYB 4EBEA 1HARA 2YNIB 1CSJA 1HPZA 3KLHB 2ZKUA 1XR5A 5J2QA 4IH5A 4DL4A 3MEDA 4EBCA 3QLHB 4ECVA 4Q8FA 5CYQA 2YNIA 4ICLA 4Q0BB 4DL6A 1SH2A 3RB4A 2VG7B 4WXWA 4I7FB 4NRTA 2WCXA 1HMVA 4URQU 3IG1A 1N5YA 4QW8A 2BRLA 4R0EA 5KFJA 1T03A 1IKXB 2ZD1A 3LAKA 4IDKB 3LAMA 3CVKA 3BSOA 4K4VA 3I5AA 3CJ2A 3IG1B 1N5YB 2CJQA 4ED8A 3M8QA 3G6YA 2VG7A 3CDEA 5HP1B 3QYYA 4NLVA 1WNEA 3DLEA 1EETB 1TKZA 1QUVA 2JLEA 1NHUA 5KT7A 4DL2A 5I3UB 1C0UB 3DLEB 1RTHA 2I1RA 3KLIA 1IKYA 4PQUB 2ILZA 3ICLA 4NYZA 1IKVB 3V81B 3MEEA 3QIDA 4ED7A 1IM4A 5L1LA 1S97A 4Q8EA 2UUWA 4FS2A 1BQMB 3ISNC 3MTKA 2V4QA 4IFVB 2XCPA 5KFMA 1RT6A 4B3OB 4RW4B 1SV5A 1C0TA 5HBMA 3UR0A 4RU9A 2JEGA 1JLFA 1KLMA 2HMIA 2GIRA 3PW7A 2OPSA 4LSLA 4KSEB 2FLNA 1JLQB 1S1UA 2RDIA 4MFBB 3E51A 5KT3A 3IRXB 4RW9A 3DMJA 4IFYB 3KLHA 5FDLB 2XI3A 4NLXA 4Q43A 3OLAA 4F4XA 2AGOA 2HAIA 2V0NA 1RTDA 3TQ1A 3UPFA 2D3ZA 2VG5A 4ED0A 2UVRA 1YVFA 4GC7A 3C6TB 1ZTWA 1JLCB 5L9XA 3TVKA 3N6MA 4K4YA 1VRTA 4TYBA 4O3QA 3MR2A 3MECB 3QGIA 3NMAA 1TV6A 4MK8A 1RT4B 3H4BA 5EWFA 1K1SA 2XWYA 5KG3A 4RNFA 5CYQB 2R2TA 3DOKA 4XO0A 1JX4A 4WYLA 3H2LA 4J9MA 5KFWA 4FBTA 4NLSA 2I5JA 1RT2A 3IGNA 4EYIB 2AGPA 2ILYA 4H54A 4IR1A 5DQHA 3T5HA 2WOMA 3PVXA 3BSAA 2IM0A 4J9KA 3HKWA 4MIBA 2HWIA 5KFUA 2RDJA 3LP2B 3QZ8A 4MK7A 3NAHA 4ECZA 1MU2B 2YNHA 3QGHA 4KHMA 1W25A 2C28A 3RBEA 5JUMA 1S49A 4ZP6A 2HNDA 3MEGA 3I5CA 3LP0A 4IG0A 2B5JA 1S0MA 3FQLA 4ECWA 4TLRA 1RT1A 3CJ5A 5FDLA 4IFYA 2YKMA 3SFGA 2YKMB 4TY8B 4Q45A 5D3GA 3CJ0A 2BQUA 3ITHB 2DPIA 3KLVA 3DOKB 3GIIA 5HP1A 1NNDA 3CJ4A 4Y3CA 1RT6B 5DLFA 5KFZA 3DI6A 1HQUA 3V6KA 3NKYA 2YNGA 1DTQA 3KK1B 3KHRA 4RNMA 2XGPA 4QWAA 1KHWA 4I7FA 1RTHB 3DDKA 2C22A 4JV2A 1RT2B 3HVTB 1FK9B 4ED1A 2AU0A 4U6PA 1EETA 4XPCA 1OS5A 2XI2A 4RW6A 2BE2A 3N6NA 2AWZA 3M8QB 2IAJB 3PR4A 4MKAA 4PUOB 3DYAA 2J6SA 3DYAB 4TN2A 2FJXA 3OSPA 3GILA 3MEEB 5KG2A 1IKVA 3V81A 3G6XA 4Q44A 4ID5A 1TKTB 2QE5A 4LQ9A 4IH7A 4ED3A 4Q0BA 2C2DA 5KT4A 4WE1B 5CYMB 3V6DB 1JIHA 5KT2A 4YQWA 1S1UB 3I5BA 4QWCA 3DRSB 3H40A 4LSNB 4NCGA 2HNYB 1HPZB 1KLMB 2HMIB 2GC8A 3BQ1A 1S1TA 2FVPA 5DG9A 4RW4A 2R8GA 2R2UA 4RW8B 1TKTA 4IRCA 5F8GA 2WB4A 3BSNA 5DG7A 4MH8A 3GV8B 3KK1A 2OPQB 2B6AB 2W9BB 5KFPA 4J9NA 3M9MB 1S6QB 2UUTA 3G6VA 5L1KA 1D0EA 4M95A 3KJVB 1XR6A 1HNVB 1TVRB 5EUHA 2W9CA 4YR0A 1GX6A 4RW6B 3T5JA 4K4UA 1QE1B 3SFUA 2GIQA 2R8IA 4WZMA 3I0SA 1TL1B 1SH0A 1TKZB 3QIPB 3HVTA 1RTIA 4MK9A 1RT1B 4ZPDA 3Q8QB 4NLRA 2XGQA 2ATLA 1Z4UA 2OPRB 1FKOA 3KK3B 4ECYA 2BR0A 3KMQA 1SUQA 1K1QA 4ED2A 2HNDB 3OSNA 2YKNA 2XC9A 2UVWA 2FVQA 1C1CA 3EPIA 3PZPA 1UWBB 3I0RA 4ZVGA 2YKNB 2IAJA 3HVWA 2HWHA 4WFYA 3VQSA 4O44A 1S9EA 5J2NA 1RA7A 1I6JA 1HNIA 1HYSB 3MFHA 2R8JA 2C2EA 5F8MA 2BANA 1JLQA 1SH3A 3PR5B 4TQRA 1JLFB 2E9TA 4MKBA 4NLOA 4M94A 4H4MB 4ZVEA 3KJVA 5F8NA 5HROB 5KFDA 1JLAB 1N6QB 2OPPB 1TV6B 3G86A 3M9NB 2W9BA 3BQ2A 1LWFA 2ASLA 3BREA 1EP4A 4NLPA 4WFZA 1VRTB 4JV1A 2OPQA 4G1QB 1J5OA 5F9NA 4IR9A 2WRMA 1S6PB 4ZPAA 4I2QA 4K4XA 4EEYA 1RT3B 4IOBA 3DLKB 4ZP8A 4PWDA 3GQCA 4ECRA 3KLIB 4RW7B 1RTIB 4F4WA 3QIPA 2DPJA 1S1XA 5KG4A 5EWGA 1U09A 3UDLA 3OL7A 3PW0A 3KNAA 3IS9A 1GX5A 3OL8A 3HVAA 2W9AA 4WYWA 4I2QB 2R8HA 4F4YA 3MEGB 3PJWA 1BQNA 5F9LA 4ECSA 4J9RA 4DL5A 1C1CB 4KAIA 2D7SA 4JV0A 4F50A 3RB6A 4KV8B 1BQMA 2YNHB 5KFVA 3V6JA 4H4OA 2ASDA 5DGAA 2J6UA 3LANA 4EBDA 3V6HA 1SUQB 1HMVB 3E01B 1HQEB 4RW8A 3T19A 4LQ3A 5EDWA 1N48A 1XR7A 3DLGA 4ECTA 3Q8PB 3OL9A 2JC0A 2J6TA 3DRSA 4MFBA 4K50A 5J2NB 4O3NA 4NLYA 5KG0A 5J2PB 5J2QB 4MIAA 1C2PA 3DLGB 3H59A 5I42A 1TVRA 1S10A 1S6QA 3KOAA 5KFBA 3MR5A 4NZ0A 4IG3A 1N4LA 4HYKA 5F8IA 5L1IA 3BSCA 1FKOB 1JLGA 1LW2B 5I42B 4KO0A 5F8HA 1S9GB 2BE2B 4JUZA 1T3NA 4QWDA 1RT5A 3DM2A 1JLBB 2FVRA 4RNHA 4EO8A 1C0UA 4K4TA 3PW4A 3RAXA 3IS9B 3TAMA 4QWBA 1FK9A 5KFGA 3OHBA 1RT5B 4U7CA 5HBMB 1S1WB 2JEFA 2IBKA 2AX0A 5C25B 5KFRA 1RYSA 2FLLA 2FLPA 1C1BB 4F4ZA 2BRKA 3LP1A 4H4OB 5C5JA 3MR6A 3IN5A 3SI8A 2JC1A 2IM3A 4PUOA 3PHEA 3H5XA 3CIZA 1N6QA 4Y2AA 1MU2A 1DLOA 1FKPA 1RT7A 4DG1A 2IMWP 4O3OA 5KG6A 2ZE2A 1LWCB 3OLBA 3KMSA 4LSNA 3DRRB 3Q8SB 1S9FA 4TY8A 4WE1A 5CYMA 3V6DA 2FVCA 4YMEA 2XCAA 4NLGA 3C6UB 5C24B 4ZVHA 1S9GA 1S9EB 4RNOA 1RAJA 4J9LA 3JSMA 1RT3A 1JKHB 1QAIA 5DLGA 4QWEA 4ECQA 2F8EX 1IKXA 1RT4A 2ZD1B 1LWFB 2YNGB 1VRUB 1S48A 1VRUA 5KFAA 5KFNA 4RNNA 4O3PA 4YR3A 2V9WA 4NRUA 3DI6B 3LP2A 3KK2B 3QO9A 4ZP9A 3CWJA 2VG5B 3CO9A 4ED6A 3ITHA 3LALA 5KFIA 4R5PB 5KFEA 2ALZA 5F8JA 3GYNA 4QW9A 1IKWB 5KFHA 1IKWA 2IJNA 3M8PA 2UVUA 2RKIB 5K14B 4ECUA 3E01A 3FRZA 3KK2A 5KT6A 1DLOB 1FKPB 1RT7B 3H5SA 1JLEB 4YP3A 4KKOA 3KLGA 5KFYA 2JEIA 2VA2A 4ZP7A 2FJVA 1RYRA 1BQNB 3RBDA 3PJXA 2D41A 4J9OA 2YNFA 2QV6A 5DG8A 1T05A 4NLTA 2WOMB 2VA3A 1TL3B 5C25A 2OH2A 3DRPB 2BANB 4R8UA 1R0AB 4R8UB 4HKQA 4O4GA 4RW7A 4NCGB 1HYSA
chains in the Genus database with same CATH superfamily
4ZVUB 1OPIA 2RF2B 3JAMU 2B5JB 3ISZA 4E0DA 1PC5A 1N5SA 1U45A 4TQSA 4KHPF 3HHKA 3HFKA 1EP4B 4Z7YA 2X1BA 1FJGJ 5IM0B 4ZVFA 3CJKB 5KG1A 4IG3B 3J7YU 4NMXA 2E5GA 2PA3A 2P2CB 3DOLB 5J1EB 2BYCA 4RJVA 3OV7A 3LOUA 1U1QA 1MSWD 3HSZA 2C3UA 2VDIA 3L7UA 2KJWA 3BBBA 1Y5NB 3DGPA 3ENVA 3J7Z5 5I3UA 2O1PA 1FD2A 3CT9A 1N5VA 2FJEB 2ROPA 2KL8A 3MAAB 5KFCA 4AXIA 3RAQA 4QU6A 2Q6CA 2ZITA 2DBBA 3U1MA 3W3SA 2AEFA 3HHEA 2DGOA 4N77A 5DQIA 4C97A 5KG7A 2ZH7A 4NE9C 4Y2KA 2X3GA 3HMJG 2DR7A 1NSPA 1NPRA 4A8FA 3QZ7A 4IH6A 5THWA 1X4CA 4B9UA 4M5IA 5A8RA 1YRXA 2W7PA 4Y2CA 1NDPA 3R1HA 2G4BA 3BPDA 1ZA1B 1KQKA 1R89A 4TU8A 3IRXA 4RW9B 1UVNA 2RUSA 1UW4A 4ZHRA 4K4WA 2OPSB 5D3GB 2OSRA 3UN5A 2E7VA 1DTTA 5HLFA 1T94A 3HULA 4ETZA 2GO8A 2CG8A 4RBVA 5E5NA 3DLKA 3RAMA 4O23A 4OX7A 3LUYA 3NAIA 3OTEA 2YY3A 5LSRA 3PKMA 4M63A 1LXNA 2GS8A 3BR9A 4NI2A 4B9SA 5J1PA 1K8AT 1UWAA 2V4JB 3PACA 3AA8A 3ENQA 4Q2MA 2E1PA 1H2VZ 2HZAA 3ZZPA 1TKDA 4DMZA 2RKIA 1YK9A 3GIMA 3GSDA 2FDNA 1XNRF 2H5EA 2KVIA 1S1XB 2LLZA 2XS7A 4K4ZA 4DUZJ 4KO0B 1RTZA 1V9OA 3V2UC 3BYRA 3FFIA 5A0YA 3OTCA 2GHPA 3M1VA 1MW7A 2F8MA 1NB2A 1ZETA 2RRBA 3BJYA 3NNHA 3BYPA 3D7SB 3QJLA 3D6HB 4WXOA 3S8SA 1NZ8A 4DSJA 4I67A 5CA5A 3KHGA 3CCUS 1Z2LA 2DT9A 1Y3KA 2NXCA 3I9V9 3RB0A 2HFUA 3MMBB 2VKRA 1U0HB 2DGUA 4WP9A 4WIQA 4B3MJ 3C6UA 2HQGA 1LW0A 1LNQA 5A6WA 3K0JA 2GAGC 3CE8A 2E9RX 3BGRB 3BGUA 4TXSA 3T9ZA 3NL0A 3WC0A 4B3RJ 2R2SA 3PRVA 1REGX 4ZITA 5A8WA 1CULB 2A10A 4LR7A 3PW2A 4B9VA 2XO6A 1Q5YA 3KLEB 4XPEA 2E7WA 3PEHA 3U1NA 5B09A 1VQ5S 1TAQA 3IBWA 2OPPA 1YG0A 5F41A 3R97A 1HNWJ 3NCQA 3GIJA 5KFKA 1F5AA 1Q7YT 3T5LA 2JRSA 4FYYB 3Q22A 2VBZA 1V5IB 4OI6A 1Y10A 2OEKA 3OVSA 4OHVA 1GMWD 2E5LF 1F9EB 1UA0A 5ETOA 2MKIA 1RU2A 2YWWA 3HX9A 5KFFA 3UW1A 2KYZA 2VQEJ 2EBGA 2W2NP 3Q8YA 4A4JA 4GVLA 4PAAA 4ID5B 2WVFA 5JXSA 4DFKA 2DY1A 1RWUA 2DH9A 4D3HA 2DO0A 1RAFB 1S59A 3IO1A 5CXTA 2LYVA 2ZC3A 4KKOB 4OZ5A 3VVUA 2EFPA 4CLPA 1YTYA 4G6VB 3G71S 5KFTA 2C2MB 1JLCA 1DHMA 3RYLA 3IFEA 4JI7J 5CYJA 3BGFA 3SSRA 3CJ3A 1RDRA 2V68A 3OR2A 1K47A 3IXQA 2DY9A 4QIEA 1KEKA 1VQ6S 1HARA 2G13A 1CSJA 1HPZA 3KLHB 4N47A 4CH0S 1PYTA 2ZKTA 3LGHA 3MEDA 2XWXA 2FY8A 4UW2A 2MGZA 4EBCA 3VGUA 5HMXA 2DRBA 3SQGA 3QLHB 1FRJA 3FMWA 4DPUA 4Q8FA 2H51B 4K2JA 4ZN3A 4DL6A 5HVGA 4MAKA 1YJNS 5GVQA 2D1CA 1UL3A 2ADCA 4QW8A 1HMVA 2G1HA 4URQU 1GEHA 1M5KC 2BRLA 4R0EA 3BH6B 1D9AA 1WD6A 4C6AA 4GO7X 1S76D 2EFNA 1NH8A 3HHNB 3PXGa 1WC6A 3M8QA 3HSDA 4NLVA 4B9LA 1WNEA 3P8BB 3DLEA 2OFGX 3M2UB 2ZH2A 1FJ7A 4WTOB 2JLEA 1VOMA 5E3QA 5G0RB 3TJ8A 5KT7A 3M6WA 3E2EA 2V2ZA 3HHLA 4P2XA 3ZO7A 3DLEB 1RTHA 2EI5A 3M2UA 1J5EJ 2ZM6F 4M5LA 5K9FA 1YJ9S 1G4CA 4M5JA 5GMEA 4PQUB 3ICLA 4HI2A 4NYZA 1AUDA 3V81B 5L8RC 3MEEA 5CZVA 1IM4A 4FNIA 5ETSA 2ZWPA 4QIFA 2DNMA 3MTKA 1KKHA 3DU5A 4QIVA 1HNZF 1N5TA 2XCPA 3KWMA 2R42A 4RW4B 1C0TA 2VOOA 2WSFC 2PMWA 4C9DA 2GIRA 4I4BA 3PW7A 1OJ4A 1W2BR 2A18A 4LF9F 1TK0A 3TX0A 1OY9A 3DMJA 3I31A 3KLHA 1LWXA 1SB6A 1ULRA 1VIXA 3N28A 4KQZA 4LRCA 2HAIA 3ZTRA 1RTDA 3TQ1A 4ED0A 3KG0A 9RUBA 3FEYB 1HFEL 2UVRA 1YI2S 1ZTWA 1TL4A 1Q82T 1JLCB 5L9XA 2YKOA 3MD3A 1N34J 3UD5A 1VRTA 2GCFA 1S5ZA 3GG0A 3HI9A 1VBKA 3MECB 3KXDA 3C15B 3QGIA 3Q2TC 1TV6A 3NMAA 4CLLA 2YKQA 5EWFA 2EFOA 4LR8A 1K1SA 2AZ1A 4OV1A 5LXRA 5KG3A 2CXEA 4CO4A 4U67Q 2JVOA 2RT3A 4QCLA 3RGIA 3I87A 2XZTB 2KRBA 4FF4A 3VAGA 3T1YF 2B0GA 3TEGA 3EJMA 1ZA2B 4NA1A 2EFQA 3R6LB 2RU3A 2FHMA 4N7TA 2WOMA 2I9SA 2GVDA 2HWIA 1ICEB 2RDJA 4DR2J 1NK7A 5L9NA 1VBZA 1GXUA 3QZ8A 1S7IA 1NK8A 1QTMA 3QGHA 2MJNA 3OT9A 4KHMA 1DJ0A 1URRA 4F0KA 2FLOA 5HQMA 5JUMA 4FNHA 3QRPA 4ZP6A 4DFJA 2UU9J 4M5DA 1UEUA 2CQDA 3VF0B 3VGTA 4DCOB 5HMYA 1SVDA 2HHHJ 4QYZJ 3FZ2A 4DR1J 1X5SA 1D09B 2DH8A 1S0MA 4TLRA 5DM7Q 2HK2A 2OTLS 3DLHA 2G2OA 1GMUA 4IFYA 2L08A 1WSRA 4TY8B 1MROB 5D3GA 1WACA 1X9SA 3HZGA 2AMCB 3GJRB 1CS4A 3ITHB 4C48A 4FN5A 5FLXU 2GA7A 2Z2YB 3NCRA 3VTIA 4DU7A 3GIIA 5I3PA 5HP1A 3CJ4A 2UV8A 1AFIA 1RT6B 1YSJA 3IM9A 3POTA 2UP1A 1NAQA 2VIHA 3V6KA 3QAUA 1VQ8S 3UE2A 2HVEA 4OHXA 1QLNA 2IVYA 1NB7A 2EG2A 2BABA 2CA9A 4P52A 3W2VB 2XGPA 2NSBA 5LSLA 1ZPVA 4I7FA 2HRUA 3KJFB 2C22A 4JV2A 2HRTA 1P8GA 4LBHA 4MTPA 2VONA 3QATA 1WC5A 2N82B 1EETA 1UVKA 3EVWA 3N6NA 1X7VA 3M8RA 2M7SA 3W2WB 5HVHA 4MKAA 1AT1B 4WWSA 2HSEB 4DV5J 2MDAA 3D2WA 1FTCA 4PUOB 3OFGA 4AL7A 2Y9HA 4X4TA 3DYAA 4B3RF 2QRRA 4LF2A 2CWKA 3IBFB 4MJKA 1HBNA 3DN9A 4X62J 1N52B 4WBFA 4ED3A 4DBQA 1YBTA 3IWNC 4DJBA 2C2DA 2HLTA 2CNNB 5LT5A 1F5BA 3QAEA 5KT2A 4JBCA 1RLCL 4YQWA 3CCZA 3VAFA 3D3CJ 2ZJPQ 3B82A 1U7LA 2FD2A 3I56S 2ACYA 1KLMB 3MWBA 2DHSA 2RE1A 3DGPB 4WU2A 4IO9Q 1S1TA 1EHWA 3RW6A 4RW4A 2R2UA 1RZMA 3DHXA 2BZ2A 3LW5C 3BM7A 4IRCA 2GAHC 3A13A 2JSXA 2AYBA 4ZCMA 2MQPA 1H38A 3AD7C 5ETPA 2OPQB 3OXFA 3SZ2A 4CDIA 2B6AB 2KN4A 1GQEA 1I5OB 4BBYA 4KH0B 5KFPA 4J9NA 2XY6A 2UUTA 3FNNA 4WPAA 2RNEA 3DLJA 4M95A 1V3SA 4WTYA 4C0BA 4NOHA 2DNPA 4F3MA 2HHXA 1JWWA 3T5JA 3L4BC 2DNZA 3M05A 4ZPVR 1QE1B 1H7WA 2OD4A 4KIAA 3CCLS 2GIQA 4X4OA 4DV4J 3GIRA 3ZTQA 2XYPB 1N36F 2FY1A 2FZGB 4L3KA 1TL1B 2RVJA 4PXBA 1R6YA 3A3OB 4MK9A 1RT1B 5SZTA 3BKTA 2H5IB 2KT2A 3ENAA 4QZVB 3Q8QB 2C3PA 1Z4UA 3KK3B 1FKOA 3CJTA 5CH7B 4DQPA 1YLXA 3QFHA 3WX4A 1CJVB 4ED2A 2ZBIA 3W5YA 3N01A 2XC9A 4C0HA 2CZVC 4XK8C 1G1XA 2FVQA 3QSYB 1YBAA 3EPIA 3R1LA 4FYVB 4KGMA 3I0RA 3M8YA 2MYFA 2B9EA 2IAJA 3QQCD 2WB1D 3MAAA 5T7LA 4PKDB 4O44A 4RX6A 2J0WA 1SIZA 1OSCA 1AROP 1H3DA 1HNIA 2QL9B 2W2MP 5G4DA 1WEZA 3TZXA 1KVJA 4CP5A 2YQ3A 3CC2S 2IJRA 2YWHA 5D78A 1FA0A 2APOA 1Q7LB 4F25A 1JLFB 1HR0F 1DY3A 4U8YA 4H4MB 1TMJA 5F8NA 3MMCB 4ATNA 2YWGA 1AZSB 2OEJA 3QT8A 4OYZA 3BQ2A 5AXMA 3BREA 2QGFB 4A8WA 1XBWA 4YB7A 1J5OA 2QJ3A 5B0EA 4IR9A 5HAOA 2MJUA 2WRMA 3NCPA 5A6PA 2DCUB 4DV1F 1RT3B 4KGVB 2DGTA 4ZLLA 1CQNA 4ZCLA 2LMIA 5AXLA 5AE1A 2ZOFA 5BJRA 1TK8A 4ECRA 2KFYA 5KG4A 3TQEA 5EWGA 1U09A 2B3TB 2AYEA 3QSIA 3PW0A 1R8PA 4ES2A 2GHWA 1GX5A 3CGIA 3OL8A 2BXJA 3MM9A 2PE8A 2Y3YA 2R7XA 2J6TA 5IT9Y 4I2QB 2J9DE 2CPEA 2XG8A 5IV4A 3FVYA 2ZH4A 1RHQB 3T9NA 1HNZJ 1FTRA 4J9RA 3RB6A 2FPHX 2QZ8A 1UPPA 4TLQA 3TYTA 4DN9A 5KG0A 4DXLA 4RPFA 4F50A 3V6JA 4OX9F 2KVQE 3LANA 4I64A 1ZS6A 3D0HE 2E1MC 5HN0A 1P9QC 1HQEB 4M1KA 2NXJA 4OYWA 1TFYA 4LQ3A 3GWCA 1LFWA 3ZNJ1 5B0BA 5L46A 1DZ5A 2UXBF 3DLGA 1H98A 2H3EB 1TU0B 2XYGB 1VI7A 4RL1A 5HQ8A 3TX8A 3RRKA 3DRSA 4MFBA 2BJ7A 5K8NA 3OJSA 2LVWA 1HWIA 1U8WA 2HQFA 5E3CA 4H4KC 1KVKA 5LM7E 4HI1A 4LT6A 3RBXA 2XLJA 4EZ6A 1HBMA 3GZ7A 3VWSA 5I42A 1JJ4A 3UN3A 2MKCA 3A3NB 3AB4B 2RQMA 5D0HA 2F3JA 3DDNA 3KOAA 1OQ6A 2QA1A 1N4LA 1UEKA 3UN2A 1RAOA 1WKKA 3JSRA 3W1YC 5F8IA 3TI0A 2Z4PA 1LW2B 3QWUA 1VQPS 4KO0A 1T3NA 1WORA 2GHVC 1XIQA 3HK2A 1JLBB 3MI7X 4RNHA 3SMZA 3PX0A 3IS9B 1FX2A 3TAMA 3AXMA 2ZNZA 1W26A 5IT9U 1WWHA 5HBMB 4U7CA 2EW9A 2C2KB 4LREA 5I3QA 1H73A 5KFRA 2ZJQQ 3AFGA 2XY7A 1HBNB 5C2CA 1C1BB 1KOOA 2ROEA 1OY8A 4ID8A 1GTEA 3X1LB 5C5JA 2OELA 2QX0A 3UDEA 3SI8A 1XJWB 2JC1A 4PUOA 2LU1A 2SXLA 3ZZTA 2VC1A 3PHEA 3ZTOA 4ETXA 2RDDA 2WBMA 4OZJA 4C11B 4C8ZA 1FKPA 1RT7A 3MM8A 4DR7F 1F6TA 4NWBA 1ZM3A 1FD8A 5KG6A 1KQGB 4C8NA 3R2DJ 4FYDA 4LSNA 4JB8B 2R9LA 4NLGA 2FVCA 2V9KA 3EZOA 5C24B 5D0RA 5IS2A 3JSMA 4GRSA 2HFNA 3EXYA 1RHKB 4DUZF 1VQSA 4ECQA 3CCMS 1IKXA 4DCJB 1LWFB 1KBRA 1VRUB 1NDKA 1U6FA 3GG1A 3LQVA 1MMNA 5B0DA 5KOXA 5ITHA 5KFNA 4DV2F 1AB8A 1VQOS 2JWNA 4JV0A 3KG1A 5ETVA 3KK2B 2HGNA 1AXQA 4N41A 2QTWA 3CO9A 3DRXA 2ALZA 2ZC4A 4R5PB 1OPZA 4QW9A 3M32B 1IKWA 5KFHA 4P72A 4A8SA 4F0MA 4OHZA 2LCWA 1FRIA 2DNRA 1P9YA 3C16A 3MAHA 4PXDA 1GK8A 5B0CA 3PYEA 3AD9C 2Y1LB 1DLOB 1NK0A 1JLEB 3ZZ0A 2JEIA 3MPDA 4EWTA 2Y1JA 1WKJA 4ZP7A 3OTOF 2KTQA 1VDHA 2UUCF 2Q43A 1H2UX 1RYRA 1BQNB 1IXKA 2V8HA 3PJXA 2DNQA 4U8VA 5HMZA 5IZHA 2YX1A 5DG8A 2AEMA 2BVZA 1TL3B 4WK1A 2XSJA 3Q8PB 2OH2A 3R6GB 2MLXA 1YJUA 3HD1A 4O0IA 4R8UB 1VBXA 4P2SA 4RW7A 4NCGB 2HZVA 3EYZA 1HYSA 3FSYA 1KLNA 3BQ0A 1RUSA 2JLFA 1SIWB 4KFBA 2CPJA 4KB7A 2A2CA 3NGSA 2DK2A 2XBPA 4Y6IA 1AFJA 4DF4A 2DEIA 1VQ9S 4LBIA 1T0TV 5J2MA 4DQQA 3D0GE 4JI3J 4LF5F 5C42A 1TP7A 2FJAB 2K06A 4PWWA 1T03B 3KLFA 2FJWA 2GV1A 3HT0A 3G87A 3PHTA 2EXUA 3QPIA 4PXEA 1PILA 3QT5A 4DV4F 1MMLA 3PG9A 4FZVA 2J0QD 2E5JA 2M8HA 2XHCA 2LEPA 2VF3A 3T1AA 1Q1KA 2VD3A 1PJ5A 2XEXA 3M4XA 4WFXA 2R7RA 4DSLA 2B43A 2KFZA 4TNOA 4CO2A 5T41A 1S0NA 1Q8BA 3CULA 4UOGA 4WFNQ 4DS4A 1LW2A 4USVA 4BWMA 4EO6A 4CLYA 3EVOA 1NJZA 1HQEA 4ZDNA 2EC0A 2DXFA 4JP8A 2KFNA 2MMYA 1UZHA 1VYAA 3ZNUA 3IGVA 2CDRB 2CDQA 4NLUA 5LL6d 1RACB 1X0FA 1XWLA 3PRBA 3THTA 4PPZA 1RTDB 2HBYB 1HBMB 4LFCF 4A48A 4ECXA 4ZIVA 1H0HB 3DMJB 1ZM9A 5CD4H 2W8LA 2HNYA 1DFDA 3MEDB 5BR8J 2YQ1A 3RUBL 3UCGA 1N5QA 3RU0A 2LA4A 4TYAA 4F3QA 2MZQA 2VHGA 5KFSA 3SV3A 3CMQA 3P5TL 2BUNA 3A4TA 1GTHA 2H4YB 5H9FK 2CG4A 1B3TA 3GPAA 2ZBCA 3M30A 1LWEA 3LO3A 2YNFB 3M2VA 2X1FA 2ZVIA 3FSXA 2FGCA 4ES3A 2HHVA 5C42B 4RUHA 2F9JA 1Z2ZA 4WK3A 2PGCA 3NGDA 4QR0A 7FDRA 3Q0AA 4DL7A 4FVMA 4UQGA 3FEZA 1FX4A 4B9TA 3LPYA 4KFBB 3R5DA 3D28A 4NLWA 3UR3C 5LSOA 4RUAA 3QLHA 4I6WA 4DS5A 2A6OA 3W5XA 4USKA 1D9DA 4KH1B 4K7QA 2M3DA 1KFDA 1M5SA 5D4PA 2ZEJA 2DNKA 2IIHA 3P3DA 4TY9A 5GADU 1JXVA 1B0TA 1Q8IA 2CQ0A 1NHVA 1IR2A 2BJ3A 3R7NB 4CT9A 4DU8A 4DUYF 2DGXA 2E66A 2F9DA 1N56A 1M5VC 3AT1B 4JI6F 4ILLA 2FVSA 1CJKA 1FI4A 3NBPA 2R3VA 2RS8A 3O6QA 4PPDA 4CO1A 5AE3A 2IRUA 2YKPA 5HJXA 3TNVA 4YB1P 1FE0A 4F04B 3W62A 4ICLB 3C6TA 2LA6A 2DHAA 3VAKA 3H5YA 2DJWA 3RB3A 5J2PA 4K5RA 2RF2A 2VG6A 5FD1A 4V19J 2AGQA 2K8GA 3FDSA 2X1AA 1RXOB 2HBRB 1HNIB 4ZN1A 4I1TA 2CJ9A 1WKLA 1P27B 2EFGA 4RWXA 1I94F 2HHWA 1TMMA 4O44B 2K3KA 4KBIA 2UVVA 1LWCA 1LK7A 1RWPB 3D5MA 2ATCB 1Y7PA 1SPBP 2RSQA 3SSSA 1VRQC 3KLFB 2Z8QA 4TVAB 5KFXA 4XIUA 1QDUB 1DTQB 1XNQF 4DR2F 2EC2A 1RSCA 2VQFF 2B6AA 3TA0A 2BE7D 3H42A 3HP6A 2CVEA 3CTRA 1FE4A 2D69A 2DNNA 1Y11A 2IYGA 2VQFJ 3VAMA 2WONB 1T9WA 5J1NA 4QPXA 4V19X 2A0FB 3EE3A 1HHQA 3I9ZA 1D1UA 4YS2A 4J9SA 3ISND 1TL1A 3DRPA 1AUSL 1SC4B 2IJFA 5KOWA 1TKXB 2MZJA 4X2BA 1M1GA 2WBRA 4UY85 3S7RA 2ZZTA 2OUGA 2JH3A 3ULHA 4J37A 2VODA 4YR2A 1UWBA 2JDJA 4ELUA 3CDUA 4DR6F 2HHHF 3CUNA 3C14A 1JXLA 4URGA 1PC4A 1FJEB 4O4RA 1YJVA 3MPVA 2BQRA 3CDWA 3J7A1 3VAIA 5K8PA 2DR9A 5IC4B 3N6LA 2MEWA 1S1TB 3K8WA 3AAWB 4DL4A 4IH5A 2ZKUA 2DNLA 3D0IE 1XR5A 1EAYC 1HWUA 3TO8A 3OW2R 2F5GA 1E6YA 2VASA 2QLXA 4JV5J 2R7WA 5CYQA 1UA1A 1NJWA 4W98A 4I7FB 1S0VA 2HGLA 3KUHA 4NRTA 2WCXA 3IG1A 3I82A 2ZBPA 4CIOA 2ROGA 1NKCA 2KRRA 4ITSA 4K4VA 1RBOB 2OEMA 3MUTP 2ZH9A 4GMKA 1X5OA 3CJ2A 3IG1B 2CJQA 3IMQJ 4H4KA 1JB0C 2VPZB 4ANEA 5E3AA 2VG7A 3A12A 2YVSA 4YUDA 3DU6A 4LF8J 2OFHX 2JZ5A 1QUVA 3PCOB 2AJ2A 4M8LA 1ZM2A 2QA4S 5EN1A 1TUWA 2P6SA 5I3UB 3W9JA 3RR7A 2QLJB 2DIUA 3KLIA 1S12A 2D9PA 4ANCA 5LMNJ 1NK6A 2ZOMA 1PJ6A 3MUMP 1IKVB 3GCWP 4Q8EA 1UETA 5L1LA 1S97A 2UUWA 1TL7A 3C14B 3DXSX 1WG4A 5JJBA 1TTHB 4OZLA 4NYOA 2HHQA 2V4QA 2DRAA 3VGSA 3UR0A 4E98A 4BC9A 2OPSA 2U2FA 2E5LJ 4KSEB 3ZXWA 1JLQB 1S1UA 2RDIA 3IRXB 4RW9A 3W61A 2XI3A 4MYTA 2O3DA 1KQSR 2V0NA 2HIYA 1NJXA 4TKTA 1IBLJ 2W2PP 2DEJA 3ILIA 4GC7A 3C6TB 4J90A 4DPTA 4PCQA 2RUGA 1FO1A 2WSCC 2XO7A 5GAGU 1X4HA 3NOCA 3C15A 4M5HA 1NK5A 2Q3PA 2M70A 5U47A 2EK1A 3EUNA 1FWKA 2RRNA 2IA0A 3THPA 2F40A 4RNFA 5CYQB 1NSAA 2R2TA 4CWBA 3DOKA 1SJ4P 2LEAA 2V5HG 3NG8A 2HRYA 3GSIA 2I5JA 4NLSA 3J7AN 1BQXA 3T1HJ 1H74A 4IR1A 2PFFB 5DQHA 1YHQS 3WZ0A 3T5HA 2KG0A 4JI8J 1UJ4A 2IM0A 3BSAA 3KJNB 1PAEX 3MCNA 1ZOTA 4JI0J 4RBUA 3AB2B 2H5JB 3NAHA 1MU2B 2YNHA 3CCSS 1IN0A 1O6XA 3HZEA 3JAMY 1XN9A 1R43A 2LQ9A 1LV5A 4K59A 3AODA 2MXYA 1UPMB 3I5CA 3O1LA 4P9SA 1NKBA 3PYGA 2HHPA 5EHHA 4DR3F 1UVIA 3RZAA 4DX5A 1KWMA 1RT1A 2E1CA 1K0TA 1WI6A 2OMOA 3TUPA 2Z0GA 3G96A 2YKMB 4CYUB 1KOHA 4HACA 4ERDA 1DAXA 2VPXB 3ZTSA 2DPIA 2RAQA 4F26A 3NLCA 4UTGA 4BCAA 2MQLA 2VDHA 2NR0A 2DR5A 3GR0A 1U48A 2E5HA 3DI6A 4B17A 1CEZA 1HQUA 2D9OA 1VGYA 5LMUJ 1VQLS 2GVZB 2MHNA 1DTQA 3DLLQ 3KHRA 1DRZA 4LF7J 2VU5A 5LMUF 2MB0B 3JTNA 3N5FA 1PG5B 4YDDB 4W92B 2J8AA 3PY8A 2XNQA 3JTPA 3W60A 1KONA 4QPTA 1RTHB 1HWKA 3DDKA 4OLOA 1QUPA 2DB1A 3KUGA 1KTQA 2QC3A 2NXUA 2QLWA 3H2VE 4U6PA 2NUUG 2XI2A 1SJ3P 4LF9J 1MWYA 2CYYA 4CO3A 4Y2MA 3T3FA 1U26A 4CZCA 4GO5X 5ETLA 4LF5J 3H25A 3GYGA 1KVIA 1SKSA 4DR4F 4LF4J 2GIFA 2J7KA 3DYAB 1HW8A 4HEA9 4MMOA 3BBFA 4TN2A 1VFJA 2FJXA 2BW2A 3OFFA 5KAKA 3MEEB 5KG2A 3V81A 3G6XA 3OSPA 2H65B 3LPEA 1YJWS 4LQ9A 2QE5A 4NASA 3FCWA 4USHA 2IMOA 4Q0BA 1GMWA 4MT1A 1WC3A 2JOQA 2QL7B 2CWXA 1L3KA 4WE1B 5CYMB 4UOCA 3H40A 4XTTA 3Q24A 4NCGA 3HJVA 2HNYB 2GC8A 2HMIB 2L3MA 3G8QA 4ZS6A 3W8GA 1CLFA 5HSPA 2V2QA 2FVPA 4N56A 5DG9A 3BQ1A 1TKTA 4DQRA 2K1RA 1U47A 3BSNA 4I56A 2OP5A 4PG4A 4A46A 3ZZZA 2AIRB 5DETA 4QYZK 1RCXB 1QM9A 4CQ1A 4DL0C 1NK9A 4Q7AA 1U1NA 2CADA 1O8BA 4USJC 4OI1A 1D0EA 4HR2A 4R0JA 2P9GA 1HNVB 2ZH3A 1L3SA 2KHDA 4RW6B 2PEHA 3WHIA 1EKRA 3CCWA 2Q6BA 3DRYA 3D6TB 3MMJA 1XMQJ 2DGWA 2XMJA 1C4AA 1GH8A 1SH0A 2DR6A 2DCLA 4L76A 3QIPB 1M90T 1XMQF 1QVGR 4OHWA 2YBVA 1EB0A 3BR8A 4PWUA 1B99A 4ECYA 4ZCKA 2HQCA 1SUQA 2ATLA 3CCJS 5IFMA 3OSNA 4USUA 3EMTA 4FF3A 1B0VA 2UVWA 4ZJOA 1YITS 1N32J 1C1CA 1WDTA 1S77D 4LRBA 4ZVGA 3DHWC 3U7JA 3S01A 4DOZA 1HQ2A 4NXNF 3HJFA 3VQSA 3FMBA 4IOAQ 5H9EJ 4OZ1A 2N3LA 3R5JB 3D3BJ 3UVJA 2IVMA 1Q16B 3HHLD 5D4OA 1S9EA 1PYOB 1RA7A 2E1AA 3KNGA 5HI7A 2JHEA 4DHVA 2KU7A 4B3TF 2GJFA 5A8KB 3HT3A 2C2EA 1RABB 1JLQA 3AJ1A 3MM5A 1SH3A 1PGZA 3CNQP 5HVFA 4ZK7M 3FC9A 3M7VA 1IVZA 2DO4A 4NLOA 5BYSA 2OKQA 2QFIA 3KG4A 3KJVA 4DV3J 1JLAB 3G86A 3H2UB 1TV6B 1SJRA 3R9LA 4C11A 4CLKA 4WKYA 1LWFA 4DWIA 3BDPA 1VRTB 5E7OB 3VAJA 4JV1A 1VMBA 4FKYA 1WHXA 4LUBA 1S6PB 4O0NA 4X66F 3MM6A 2P9EA 4XDCA 1X5TA 3E3XA 3TZWA 3DLKB 1RWVB 4EI2A 1Q79A 2HURA 4ZP8A 2FQQB 2BM0A 3KLIB 4RW7B 1RTIB 2XHWA 3QIPA 3K89A 4F4WA 3THVA 1S1XA 3M32A 2DPJA 4NCBA 3OL7A 2DYAA 3KNAA 4OYBA 2VBXA 3K17A 3HVAA 3UVJB 2OI2A 4G1PA 2ASYA 2DHHA 3NY0A 1H2TZ 2PEBA 3MEGB 3PJWA 4C3KA 4CI0B 2R8HA 3Q23A 2HS0A 5F9LA 3MM7A 2KDOA 2H48B 2POKA 4ECSA 4KAIA 2MKKA 2PN6A 2QO3A 2QG9B 4PG5A 2DNGA 2ASDA 3OUYB 2C3OA 2JL9A 4F8RA 4K0KJ 3G9CA 2NLWA 4JI1F 2JFKA 3MMAB 3NS5A 3MOZA 1FRMA 5HO4A 4RW8A 1X60A 2DNYA 3SBMA 3IBCB 1F3FA 5BYQA 4DSEA 1I51B 4PEOA 2HBQB 5A8KA 2JC0A 3R2CJ 4CO5A 4OIXA 4O3NA 3ETOA 4NLYA 2BJDA 2YH1A 3UI3A 3P6YC 1C2PA 4OYIA 1YQHA 1H72C 3DLGB 5AJ3J 4X4RA 5LJ3Y 1UKUA 3M8ZA 2D3O1 1VBYA 3OPKA 1TVRA 4UOHA 1N36J 2VV5A 3CIMA 4C3MA 4KPYA 3MGJA 3MR5A 4NZ0A 4IG3A 2V94A 4HYKA 2H4WB 1CC8A 1UAWA 4QR2A 3Q8UA 5L1IA 2PMHA 3BSCA 2JNJA 3D9BA 2QMWA 1VHIA 1JQGA 1RT5A 3GU0A 2FVRA 3R8YA 1SKUB 1C0UA 3PNIA 3PW4A 1I3OB 2VICA 4GKKJ 2HVIA 2J76E 1U24A 4QWBA 2KM8C 2MKHA 3D66A 5HQLA 3UFCX 4IUFA 2E29A 1RI7A 4DR5F 3TJ9A 2AX0A 5C25B 3F56A 3MM8B 1TFWA 5K8OA 4G65A 1RYSA 3H0PA 1WEXA 1RAEB 3AA9A 4NXNJ 2BRKA 3L3CA 5D4NA 3P4UB 3MR6A 2MSSA 4GVBB 4RKUC 1U1OA 1Q4RA 3PV8A 4IO1A 4DZ6A 4LF6J 3FBCA 1VLYA 3CEDA 2ZE2A 1LWCB 3AJ2A 1D8YA 2E7XA 4DDFA 2GFFA 3ETMA 3HVRA 3K5LA 2UXDJ 2RQKA 1BE4A 1DBDA 2B9WA 2AJ4A 2GX8A 4WE1A 5CYMA 3O5TB 4EMDA 4M5MA 2IY5B 4ZVHA 5FIIA 2IHR1 2Z58B 4RNOA 4YN3B 4NEZA 3UCZP 1RT3A 2A6MA 5DLGA 4C8OA 1FEEA 1HNWF 1HA1A 2ZBRA 2R7VA 4Y28C 4FF2A 1EX8A 2F8EX 1HLWA 3DXBA 2XY5A 1RT4A 2EG1A 1CJKB 2GVZA 2MZTA 2YNGB 4NZ7A 5KFAA 2VJVA 1R8HA 1WDDA 4O3PA 4X65F 2HYIB 2B8QA 2W25A 1H6KX 4CLTA 4M5GA 4YHHJ 3LP2A 3LF0A 1KS2A 3R5AA 2BKPA 4OYOA 2NYHA 4U96A 2CZ4A 3QBCA 4AT1B 4ED6A 1N33F 3LALA 2M4MA 4JYAF 1NU4A 3CD0A 3M8PA 5IOLA 1EZZB 3ZZOA 3DDIA 2X3DA 4Q5VA 2AJQA 2CPFA 2P5VA 1NRKA 2HFOA 4P6QA 2MTLA 4USWA 2KH9A 2LQBA 1V5VA 3IM8A 4PXCA 1XMOF 1KNZA 2UXCF 3H5SA 3RBZA 3NOGA 3BKFA 2ACMA 3PRDA 4W90B 3HXMA 1MLAA 2RJZA 1U25A 4NL5A 3SDEB 1OMSA 4YY3J 2B4UA 2ZH5A 3ZTPA 4CM2A 1SC3B 4J9OA 2QV6A 2KHCA 1QTNB 5C25A 2ZWOA 2CJKA 3W7BA 4QU7A 4HKQA 4L75A 4Z2XA 2FB0A 1TL3A 1FRXA 2BACA 2GGPA 1TAUA 5T14A 4OYXA 4WZQA 4I2PB 2AD9A 2W9CB 1TK5A 3NBPB 5DJBA 2QA2A 3KLEA 1F5CA 3CD6S 3MMCA 1Q81T 1S1VA 2O5DA 3WIVA 3W63A 4USMA 2AZ3A 1JJHA 4WP3A 2GW8A 5AE2A 3HHLC 1U1KA 1SXLA 1ACMB 4J9UE 1J2VA 1YBUA 2CNOB 1RLDA 2RHQB 4J91A 1NPKA 3MOJB 5GAHU 3PW5A 2ADBA 3I0SB 5D0EA 1NK4A 3FQKA 3FKBA 3B6BA 4LRDA 4C3LA 1BC6A 3Q8VA 3O3LA 3DM2B 1QE1A 4BLGA 2HK3A 3SCIE 3KDNA 3PYFA 1U1RA 4LFAF 1RE1B 4DG1B 2LXIA 3PYDA 1REVA 3OFEA 1KN6A 1YZ6A 1CQMA 2IC3A 2G2YA 2RQ4A 4ZPWR 5LXYA 3G6ES 4RUCA 5H1SV 3H8YA 3IR5B 4KR0B 4UT4A 4J9QA 4WJBA 4USTA 1U1LA 3T5KA 3QGGA 3JSMB 4XAKA 2B4VA 2R2RA 3GV5B 4JV5F 2NZ4A 5CAAA 3Q8RB 2FZKB 1H7XA 3UQSA 1X31C 1QSLA 1BMQB 2FHJD 2YWFA 5KFLA 5F0UA 1HWLA 4LSLB 2G2ZA 4FVCA 4O3SA 2AYMA 1MN9A 1R0AA 2NS1B 1V3RA 2OSQA 1NJIT 3UD4P 4IRKA 3D4JA 2HQIA 2XNRA 4AL5A 4ZVOB 3PX4A 2CQHA 3DOLA 5J1EA 4QQBA 2MLYA 2XULA 5DZ7A 2GQ2A 3T6BA 4X65J 4IRDA 1S1VB 3LP1B 1FFWB 1RA6A 4LSZB 3CCES 1K9MT 3B4MA 3CSKA 2AQ4A 2G0CA 4NLXA 4NZ6A 3TZYA 2NSCA 4DLGA 1RADB 1NLKL 5KT5A 2CRLA 4KHRA 4DX6A 3PO5A 3ZC4A 2J9EA 3TAMB 2VFUA 3PJ9A 1TKXA 5A76A 2W8KA 3PX6A 3NNCA 1T9VA 2LEBA 4JI5J 2WK4A 5EWEA 2V8VA 3TJAA 4N8OA 1FWLA 2CIMA 4PWDB 4R5PA 2C2NA 2YX7A 4L74A 3PFOA 8AT1B 1G7CB 4OLPA 4J9PA 1T05B 2HQDA 3EXCX 4DV7F 3QO9B 5GAGI 1HNXF 3CMES 3JYTA 4JI3F 4AYBD 1XERA 2BMBA 2E9ZA 4G1QA 3NGRA 3EPGA 3FBEA 5KTQA 2XMUA 4KV8A 2IC3B 3V4IA 5GMDA 4AE5A 2BE9B 5HL7Q 3OL6A 3K5MA 3F73A 2I8EA 4UUWA 3P5BP 4LF4F 1FVQA 2XMKA 2JFDA 3OXGA 3FFIB 1UFWA 3HD2A 3OFHA 5A0YB 2OPRA 3B4DA 2KXNB 1ZTTA 1WUUA 1IJFB 1WHWA 3KHLA 5C24A 4U9RA 5CZXA 1WOOA 5F8LA 5CD4A 5IQQA 2VG6B 1R3NA 2XSJB 2Y0SD 2R7SA 2V8GA 2WONA 2V50A 4O3RA 2Q79A 1C0TB 1X4DA 1S6PA 3D6MB 2FJDB 2KXFA 4I69A 1NHKL 3GCXP 2JEJA 2WZ1A 5IM0A 3SIPB 3VV2B 3MECA 1T9YA 1Y3JA 3IA0A 5ETRA 1KHVA 3D68A 1TQLA 1MMDA 4I2PA 3H5UA 3ILOA 4Y00A 2DR8A 1K0VA 5K14A 3CJQA 5KG5A 1IBKF 3R7BB 2FHKA 1F60B 4Z7CA 3U1LA 2B7CB 5G0RA 3GV7B 1NBEB 1RISA 5L1JA 1SL1A 3LP0B 2WW8A 2ABYA 4E2FB 1HNVA 2RQCA 3NNAA 3FCHA 1S79A 3SCLE 4DEZA 3MR3A 1W7WA 3FSIA 1CJUB 4EYHB 9ATCB 3D1HA 4GVBA 4C0OC 3AOAA 3KHHA 3SEOA 4FXDA 1HI8A 4IQXA 1RTJB 4ZPCA 3MPWA 3TEHB 1R27B 4PQUA 5D4LA 4WFAQ 5DDPC 5KFQA 1JKHA 1T95A 1X9WA 2MZSA 2IYIA 1IKYB 4EBEA 1IUJA 1IR0A 3PDNA 4ZKAA 1FNMA 1N8RT 2CJAA 2MGZB 1FHTA 2DVIA 4ICLA 2DISA 4Q0BB 4HHHA 7AT1B 8ATCB 2U1AA 4WXWA 4QIWD 3OR2B 4KRWA 3RJMB 4AUKA 3HHDA 5K5MA 4DUYJ 1N5YA 5KFJA 1O0PA 3TW0A 2ZD1A 1A0OB 3LAKA 4IDKB 3LAMA 2J9CA 1PCAA 2GQQA 2HIQA 2ZFHA 3CVKA 1FEHA 3ENWA 3K8VA 3NWRA 1N5YB 3M2VB 4WIIA 2FJBB 4ED8A 3EICA 2UXCJ 1F9FA 2K1RB 3FRYA 3G6YA 4WCEQ 3KJQB 3QYYA 3GFHA 3PIOQ 1RHUB 5A2QY 1TKZA 3MM9B 3GLJA 1UP1A 3EGVA 3W9IA 4LFBF 4YOEA 2XMVA 4X4UA 2HHUA 3R3TA 3K59A 5L38A 3H20A 3QJJA 4LFBJ 4QBUA 1IKYA 3ZZUA 3QRRA 2XLKA 4ZLPA 4CLUA 1NXIA 2YPZA 3AY0A 3HSGA 3JXOA 3DLBA 2KT3A 3LTOA 3CC4S 3OTBA 1XEZA 4FS2A 2G0JA 3ISNC 1ITPA 2B56A 1LEOA 3MR7A 3LWLA 1FDBA 3ONQA 3VGVA 1LXJA 4X64J 2HBZB 3WX8A 4B3OB 3UO0A 1SV5A 2WVCA 1UTAA 4RU9A 2JEGA 1JLFA 1KLMA 5FJ4A 1UJ5A 2W4CA 4X4QA 2FLNA 2LFVA 3E51A 4MFBB 4A8XA 2ZH6A 4C8YA 1Y4ZB 2J9DA 5FDLB 2AGOA 2W01A 3A8KA 4RBTA 2N7YA 2D3ZA 2VG5A 3MZIA 3MPUB 1RWNB 5M2RA 2OD6A 1S6UA 3TVKA 3N6MA 1HBOA 4AD6A 4K4YA 2ZHBA 4DCPB 3JS9A 5GADI 3CMAS 3MXHP 4MK8A 1WF0A 1RT4B 4LVNP 3H4BA 4CM0A 3ADAC 1Q53A 3KDOA 4DR6J 1RKIA 2VFRA 2VFTA 4JOUA 4JI4F 4XO0A 1VIOA 1Y00A 5CABA 2P8IA 3IAM9 2IPOB 2PD1A 3H2LA 2L9WA 4OX6A 4WYLA 3AHPA 1FXDA 1GT8A 5KFWA 4J9MA 4DV2J 4RU2A 4HT5A 4D3GA 4CLFA 2QSFA 3OD2A 2EKYA 5FLXY 1K73T 1SKWA 3CD5A 2G0IA 1FWPA 3PVXA 1PJ7A 4J9KA 3HKWA 4OYMA 4MIBA 5KFUA 4C4WA 1VK3A 3DOMA 3IR6B 2CQ1A 3D67A 3ET6B 4ECZA 1X4EA 1NUEA 1W25A 3DGVA 3QT7A 3VAHA 1R8CA 2I2YA 3RBEA 3MCSA 4OHYA 1HD1A 1S49A 4P7VA 2GMJA 3WQPA 2HNDA 3MEGA 3M1VB 4F67A 5I4MA 3LP0A 2F4VJ 2UZAA 1NSKL 1EARA 3CCTA 4ECWA 3IP0A 3N5BA 3J80Y 1RWXB 1KC8T 4C8KA 3SFGA 2HHSA 2EPIA 3MAQA 4NXMF 2BQUA 1ZZFA 1K44A 1T9TA 1UW9A 2CJBA 3DOKB 3VCDA 3MMBA 5E3RA 3UNGC 4V1Ak 2XZWA 1Y9OA 1JJCB 1NNDA 4HH0A 4Y3CA 2PI4A 2NQPA 5DLFA 3EDQB 5KFZA 2N4CA 2CQBA 4FPIA 2VPWB 1VC6A 2CZ9A 1PYSB 2CQCA 1FNXH 3KK1B 2XQCA 5K8MA 4JI5F 3HKZD 2J7WA 3T1YJ 2A1BA 1KHWA 3W2WA 3F0NA 4DX7A 3EGNA 4OZ2A 4OZ3A 2XSFA 5RUBA 1FK9B 1BY9A 3PO4A 5MAOA 4ED1A 2LDIA 3DC2A 4UZCA 2EFVA 4DQIA 3QMQA 1OS5A 4CLZA 5D77A 1RHJB 4B3SJ 1XK8A 1SQGA 2RB7A 2L9DA 4Y0FA 3PR4A 1G2EA 3MPYA 2V8DA 1IBLF 2VOPA 1OQ3A 1YIJS 2J6SA 3RG6A 1RBAA 2CUYA 3WBZA 3OUYA 2KG1A 3BH7B 3GILA 1IKVA 5GMKa 4KPCA 2VUGA 4LRFA 2FUG9 3SCKE 2RS2A 1D8ZA 1MN7A 2CNKB 4IH7A 3M6VA 5KT4A 5DM6Q 4KJIA 4FP9A 4MYUA 3V6DB 1JIHA 5C2GA 5L39A 4WKRA 1CS4B 3I5BA 1GMVA 4ALZA 3DRSB 3T1HF 2N3OA 4LSNB 1F2HA 1HWJA 3NP5A 2O66A 4KC5A 3AD8C 2FC9A 2F65A 4P2FA 1XNRJ 3DFEA 2R8GA 3QJPA 5F8GA 3TA1A 2AF6A 3MEKA 2EEYA 2LECA 1WTFA 5DG7A 1O51A 4K8RA 4OI4A 1RP5A 1IBKJ 4KT0C 2JX2A 2GJ2A 4DR5J 2W9BB 1OWXA 3M9MB 4HL9A 4NMLA 3HM9A 2B4OA 2RRAA 5EUHA 1XR6A 3KJVB 5EGYA 1WOSA 2O67A 4Q2LA 3GONA 4YR0A 2W9CA 1CBKA 2BX6A 3US5A 2WVBA 1XQIA 1VQYA 2DGVA 4CRJA 2R8IA 1WOPA 3I0SA 1FRKA 1TKZB 1N0UA 3GR1A 1P6TA 2QN6B 2W7AA 1I1GA 4U7UK 4YEAA 2MKJA 2A2DA 1TELA 1E6VB 2RMLA 1FRHA 4HDGA 4F36A 3J81j 3TUIC 4LF6F 2YKNA 1AA1B 3SDEA 1WG5A 1YJTA 4LF7F 3MDFA 5F3ZA 4HH1A 3KKFA 3G4SS 1QAXA 1UWBB 2M9KA 2FTRA 1A7GE 3PZPA 1RHRB 1QSSA 3GJSB 2HWHA 3HF5A 3O8WA 4WFYA 3B54A 3NS7B 5DDOC 1PBUA 1SBRA 3M6UA 1NMEB 3NGKA 4OJHA 3C66A 5J2NA 4KYZA 1I6JA 5HATA 2AW0A 1RBLA 4M5KA 3MFHA 2VJUA 2R8JA 1MROA 4N8NA 4GKJF 5F8MA 1VQMS 3J81U 2BANA 2F1FA 1NKEA 4I6YA 2R7QA 2QIFA 3CJ8A 4PYDA 4QR1A 4OV6A 2K2PA 4DPWA 1Q8KA 2GQCA 4ES1A 3O2IA 2B51A 4M94A 1T9UA 3PFEA 4ZVEA 4CLSA 4DUTA 1YX2A 5KFDA 2G9OA 1UZDA 5BYRA 5GAEU 4AXJA 1XMOJ 6FDRA 1L3TA 4ELTA 4WFZA 1EP4A 4PG6A 5F9NA 1E6VA 2M88A 3B78A 4I2QA 4X4PA 1XTZA 2OO4A 4WFBQ 1MNEA 4K4XA 4EEYA 1WHYA 5BXIA 3CDBA 5DZ6A 3GQCA 1HL6A 5MLCV 2PFDA 4ELVA 4WF9Q 1NH7A 3UDLA 1IQZA 2ERRA 4BHQA 3AOCA 2AYGA 4ZCIA 3NRBA 4G1IA 2I6WA 2W9AA 2J8SA 1HBUA 1Q95G 1R8AA 4DSIA 5CCMA 2VBYA 3N79A 4I0WA 4DL5A 2QEXS 1U6BA 2O01C 2D7SA 3A1YG 1JXEA 2B9XA 3FBFA 1BQMA 1KR4A 3JSYA 2YNHB 2XMMA 4S0MA 4H4OA 8RUCA 3EWGA 3BO4A 2KZMA 4C98A 2CJXB 3MCOA 1P1LA 4EBDA 3V6HA 1HMVB 3E01B 2XMAA 1VLOA 3M8WA 3MTJA 5EDWA 3K5OA 3UDCA 1U1MA 1RWKB 4P74A 4PABA 2ZZNA 1L3UA 3C19A 3OL9A 4ECTA 3SQGB 3H7HB 4EUVA 2E1RA 4DR7J 5J2NB 3L95X 1U0HA 2OJ3A 2DKOB 5T7LB 1Y0HA 3BEGB 5AXKA 4B02A 4ER8A 2DHGA 1S57A 1WHVA 2Z56B 2QLBB 1S10A 1ZZNA 1WC1A 4LFCJ 4HTIA 2DIVA 1UJ6A 2VBWA 2QSWA 4OZNA 1UFLA 3BBCA 2E44A 4LBPA 1F0XA 3C46A 2Y8YA 1CJUA 1RAGB 3B8HA 3K5NA 1YRUA 1FKOB 1UFKA 1JLGA 5F8HA 3GJQB 1S9GB 1X0PA 3NWGA 4QWDA 4K4TA 4EO8A 5CCLA 3M6XA 2HQ3A 3HHLB 3S1TA 2OHDA 3RAXA 5D6GA 3RW7A 1FK9A 3MCMA 2MZ1A 1B7YB 1RT5B 2DGSA 3TZZA 4F2RA 5D15A 2BJ9A 2XMTA 1FFSB 1X4BA 3QT6A 5ETMA 2JEFA 4LF8F 4KY3A 4YHHF 2FLPA 4OX9J 3A8EA 3MM6B 3KUEA 2BJ1A 3LP1A 5ETQA 4EU0A 1U49A 2LQ5A 2IM3A 4DI6A 4LVOP 3ILJA 4OYPA 2F4VF 3H5XA 1N6QA 4Y2AA 1MU2A 5B08A 2CVIA 2DD8S 1DLOA 1SL0A 2NREA 1I94J 2IMWP 4PR6A 1VISA 2F63A 5A2QU 3D1OA 4J9VA 4DV6F 2ZZMA 2AKWB 1OIAA 3WC2A 1X4AA 2D74B 1RWOB 2GO9A 2V63A 2VFSA 4TY8A 3V6DA 4YMEA 1WEYA 1DARA 2KO1A 3P45B 2XCAA 3C6UB 4CLWA 6FD1A 3I32A 5D8HB 1S9EB 4J9LA 1RAJA 4ILMA 4C8MA 3TOQA 3UDVA 1JKHB 1QAIA 4LMZA 1BHNA 2CPZA 3CB4A 3GYXB 3MMAA 4LJMA 1YRTA 1G6BA 4ZOSA 4M5DB 2QMXA 5HK4A 3D1QA 5IQ6A 1SI9A 2LU2A 5JVHQ 4OZ0A 4JI6J 2DGQA 1YJRA 1S48A 1VRUA 4RNNA 4B3SF 4NA2A 3U02A 1HNXJ 2M5YA 2GNKA 4NRUA 3U27A 2LP4A 4EK2A 2V9WA 2YH0A 2PI5A 1M1HA 3QO9A 1LQ9A 4QOTA 2KB2A 3W9HA 2ZH1A 3CWJA 1RHMB 4OMFG 2FHOB 4U95A 3ITHA 4YB5A 5KFEA 1FERA 3R5GA 4HHJA 1IKWB 2CQ4A 1UVJA 4DN0A 2IJNA 1X4FA 3T41A 2UVUA 1U6ZA 2CQ3A 2W24A 4ED5A 2RKIB 4E8UA 5K14B 3D6FB 3KK2A 2ZJRQ 2V4JA 1SCJB 1FKPB 1RT7B 2CPHA 3HSJA 4YP3A 4DR1F 2PA8D 2CPXA 2NCKL 4RR5A 1B70B 3VQTA 5IWAJ 5DDQC 2VA2A 1FFGB 3ELHA 4JI7F 2H9ZA 3MM7B 1BGXT 1HBOB 3RBDA 5IWAF 2D41A 2Y1RI 1CC7A 3A8JA 4UUXA 1N32F 4JI2F 4L72B 4NLTA 1SQEA 2WOMB 1NCLA 4QYRA 1OYDA 1Q0NA 4RUBA 4LFAJ 5DDRC 2VA3A 3DRPB 4PYAA 4JI0F 1R0AB 4JI2J 2B7BB 3Q2SC 4H54A 4A8OA 4ZHRB 4ILRA 4NPOA 2J0SD 4C7QA 1RK8A 4OJGA 2HNZB 1LFPA 3R7SB 1FXLA 2RIJA 3KYLA 4HHUA 1Q8LA 3EVMA 3V4IB 4RZRA 3MFIA 3TAQA 2DXEA 3MD1A 1J27A 2QYGA 4OI3A 3NMRA 3JQKA 1JLAA 2CKWA 5HROA 2YTCA 1JNRB 3DOMB 5H9FJ 4J5OA 1X9MA 2ZDOA 4LRAA 5GAEI 2CPYA 3SYZA 3CD7A 4EZ9A 4KTQA 4X66J 1D3WA 3M8PB 3W5ZA 4BC7A 1FF2A 1MG7A 2PDAA 3DCAA 1NDCA 2IFXA 1ROFA 3JSBA 2NYIA 4Y34A 5KFOA 1WC0A 1JLBA 3CJSA 3GP9A 1VJQA 5M2UA 2UXDF 4FS1A 1VC0A 1JLGB 4GKJJ 2BBEA 2AJ1A 2HWTA 4B3OA 2KT5A 3N4WA 5E33A 2X1GA 3VZHA 1FJCA 2RILA 4WU3A 4DPOA 4ZMMA 1SL2A 4IKAA 1CPZA 4CH7A 1U2FA 4MKVA 2HW3A 1L3VA 4RWWA 2UV8G 2B4PA 2ZBQA 2VKZG 2BV3A 5DGBA 4U7UD 2D3UA 1Y5IB 1AYEA 3IRWP 2MQOA 4DR4J 1DTTB 5HLFB 1MWZA 2IDLA 5ADZA 2QFJA 4DV0J 1JJ2R 4X4VA 2GGPB 3DRRA 2HEKA 2MPUA 2NPIA 5GAHI 2KKHA 3CW2C 2WHOA 3F41A 2ZE2B 1RAHB 4IQMA 1Q5VA 4OQJA 2F4FA 1SV5B 5IT0A 4JYAJ 3S6EA 3G8TA 2HG4A 3M9OB 4ZLJA 2R7OA 2K7KA 1B7FA 2LDYA 1S4FA 2ZUGA 3BO3A 3L7OA 3NGTA 1RTJA 1RB0A 1DQ8A 2YXLA 2ASJA 2HZCA 2MHEA 2FYXA 4N5SA 3OVAA 3EZUA 4IDKA 1M0SA 1O5JA 1SJ1A 3AOBA 4ZPTR 2IM1A 1R8BA 3G82A 1B4SA 3KLGB 1RJJA 1ZAXA 1REVB 2OLWA 3PEJA 3QNWB 4I68A 3Q83A 3I55S 2WTFA 1S1WA 2HKEA 2HPUA 1WF1A 4CO0A 1IBMF 1SC6A 2A3JA 1APSA 2QA4G 1C4CA 4YFUA 1R7IA 2CQGA 2PC6A 1IJEB 1SJFA 4KE5A 2KJVA 2J5AA 2AX1A 2I0XA 5ETKA 2WVDA 3Q86A 1S0OA 2B9YA 2MQMA 4ZPBA 1T7PA 3K57A 2E5IA 2W7OA 3N0VA 4NLQA 4ZVTB 1QVFR 4HVZA 2Y1IA 4TU7A 1J5OB 2R4FA 3A8IA 2BDPA 1VQ4S 4QIGA 4FBUA 3BKUA 3TANA 4B9MA 2MY8A 1SKRA 2IA6A 2QYCA 4F7VA 1JLEA 4WP8A 2NUHA 1NPPA 2MY7A 4H4MA 2QT7A 3OXLA 4TU9A 3VZIA 1IR1A 1OYEA 6AT1B 1UMJA 4NLDA 1FDAA 3KK3A 3BGRA 1YWXA 4URSA 1VS3A 2PIIA 2C2RA 2LKZA 4AQYJ 1L5UA 1LW0B 4O4GB 5CQGA 5F3TA 4DPYA 4Z37A 3PKYA 4JI1J 4K4SA 3CF5Q 3TA2A 3X3UA 2ALYB 3WDOA 4P10A 3M2RB 2F8HA 2HAFA 3OR1B 2BQ3A 3VVTA 1R31A 1U8SA 5E0OA 3OHAA 2GJIA 2FIUA 4IFVA 4LF1A 4DL3A 1ZAWA 2W9BA 1N88A 2R8KA 4GC6A 1HQUB 1ZM4A 2W4PA 3PM9A 4JI4J 5J2MB 1EQMA 2BKOA 2ZUAA 2ZVSA 2GZOA 3JYTB 2HNZA 1LWEB 1TL5A 2ZH8A 3KTQA 4DV3F 2VH7A 2AT1B 1U4BA 3LH2S 3MF5A 1SC1B 4HACB 2V4RA 4ZJQA 1FKAF 2IM2A 2I5JB 1HKAA 1T02A 3GIKA 3GFZA 2AJ0A 2XYHB 3BV8A 3JQJA 1VC5A 3H98A 4UY8T 1QAJA 4IG0B 3W8PA 2UXBJ 4B3MF 4F4XA 3TR5A 1HI0P 3I0RB 1IWGA 2Q1LA 1HW9A 1LOUA 5LOQA 2L9NA 4B9NA 2KI2A 5DS7A 3HFVA 4MIWA 5DQGA 4X62F 3H4DA 1VK8A 2XS2A 1X4GA 5F0WA 4DQSA 4OL8A 1C1BA 1WSVA 2VB6A 1KQFB 2PT0A 3AH6A 3R5CA 4ANDA 3NS6A 2VC0A 3EX7B 3D54A 2DITA 2YX4A 4RO0A 2PMZD 2C1EB 3FK4A 2FGOA 4ENOA 2YNIB 5HJYA 2EKNA 5J2QA 1BUXA 3VHQA 3HFZB 1E6YB 1FESA 1WG1A 5B7WA 5LMNF 5E2QA 2XB2D 3OVBA 5C7PA 4ECVA 2YNIA 5M2PA 5B0GA 3TUZC 4G3IA 1GFWB 1SH2A 2VG7B 1WC4A 3RB4A 4K0KF 1CJTA 2NXEA 2UU9F 1WI8A 4LIWA 4C2MA 3TVYA 1T03A 1IKXB 1VR6A 2Z30B 2VL1A 3BSOA 3TAPA 3I5AA 3QRQA 3HPOA 1B64A 2HVHA 3C8YA 1NZAA 3JB9k 4N76A 3CDEA 3K2YA 5HP1B 1YKWA 4DLEA 4DFMA 2UUBF 2YPYA 4CNYA 1UVMA 1EETB 1NHUA 2L41A 4P7TA 1YDLA 1Y5LB 4I6AA 4DL2A 1C0UB 1RAAB 1IM6A 2V2VA 4OX8A 2I1RA 2XS5A 1YGYA 3V4MA 4NI2B 4EGLA 4DFPA 2KXHA 2ILZA 3QIDA 5DRKA 4ED7A 3UNYA 1KTVA 2H54B 1TL7B 1BQMB 1DURA 4IFVB 1GNKA 2NXNA 1CJTB 1RT6A 2FZCB 4PG7A 3TRGA 5KFMA 2K3IA 1PBAA 3FCVA 1HBUB 3UWTA 3TARA 5HBMA 2R7TA 2QLFB 4FYWB 2HMIA 2OAUA 1EJ7L 4LSLA 5KT3A 2UUAJ 3OLAA 4IFYB 1NDLA 4Q43A 4DR3J 1KP6A 1ZBTA 3UPFA 3OTOJ 1CVJA 2MKYA 3G2XA 1YVFA 3RR8A 5ETNA 3NGUA 4HLBA 2C3YA 3LA0A 4A8QA 2CPIA 4F2SA 5B0FA 3MURP 1J5EF 4TYBA 4O3QA 3J7YI 3CJKA 3MR2A 3HO1A 4HT7A 3ZFVA 4DV1J 3R27A 1RU1A 2FC8A 2XWYA 1BLUA 2MQNA 4XDDA 2J0XA 1HHTP 1R6VA 4NYPA 1RCOB 2CJYB 2QMUB 2VFVA 4FBTA 1RT2A 5E41A 3IGNA 4EYIB 2AGPA 4BWJA 2ILYA 1PAUB 2W2QP 4EFAC 3AQPA 3CDAA 1VCTA 4P73A 2IVFB 3MHYA 1IWAA 3IC1A 4P71A 4NCAA 3GTYX 3LP2B 2F7VA 4MK7A 3SV4A 2YWEA 2C28A 2CQPA 2Z2LA 3EDRB 2IRXA 2MQ8A 3N9UC 2M52A 2EBEA 3FGVA 2CQIA 2RH3A 3TWZA 3BO2A 1VQKS 4IG0A 1FRLA 2GVDB 3BS9A 2B5JA 1FJGF 3M2RA 3FQLA 3OR1A 5AJ3F 3MM5B 1BWVA 3CJ5A 5FDLA 2W4DA 3PTWA 2YKMA 1FDNA 4CYUA 1HD0A 4Q45A 2VQEF 2HHTA 3CJ0A 1T8EA 1AW0A 1U2RA 3CJRA 4PG8A 3P49B 1IBCB 3KLVA 3BDEA 3Q89A 2P6TA 2V67A 1S72S 2AV5A 2XM3A 4JI8F 3G82B 4USIA 5HMWA 2XLIA 3NKYA 4YB6A 2AJFE 2YNGA 1JX4A 3FUYA 2OGUA 4BDPA 1TUGB 3I96A 1QD1A 4RNMA 3HDSA 2BKNA 3CCQS 4ZIWA 2LQ8A 3K7RA 4QWAA 1OSDA 2KM8B 3M8SA 1XNQJ 5AXNA 2C2OB 1RT2B 1U1PA 3HVTB 5H9EK 1S99A 3HLUA 1WELA 1TUVA 2DH7A 3CCVS 3JQMA 1RWWB 4KGXB 2AU0A 1F1BB 4Y65A 1ZPWX 2HVDA 3NEKA 4XPCA 4FXVA 5DO2A 5E3PA 4RW6A 2BE2A 1GAOA 4ZVRB 2AWZA 4F4KA 3M8QB 2IAJB 3R5BA 1B0PA 3UCUP 1VQNS 1ZYQA 2IDEA 3C2PA 1DQAA 1S6OA 3FJ2A 4F02A 2AP6A 3SXLA 4NX9A 4X84A 2CPDA 3T6JA 5EX0A 3L09A 3M30B 4Q44A 4ID5A 1TKTB 4FXWA 3OTDA 5JMNA 1IQTA 3QFWA 1RAIB 3AQOA 2DXDA 5IT4A 4QWCA 2LXFA 4ZA1A 1S1UB 2RD5C 2ZM6J 4L73A 2ASLA 2Y0BB 4PQAA 1KD1T 1HPZB 1S7HA 2DHXA 2BJEA 2JLGA 1SJQA 1NM2A 4ZVSB 2ZNYA 4RW8B 1NO8A 3W2VA 3BN4A 2WB4A 2M0GB 1KFSA 2MKSA 2I38A 4MH8A 1WJ9A 2EWHA 2HVZA 3KK1A 3LGNA 2IBOA 4CTAB 3GV8B 2Z2MA 2GMHA 5K20B 4HTJA 2L48A 1N33J 1NJYA 3GFXA 1AZSA 4UOFA 1S6QB 2XTJP 4B08A 1N34F 3G6VA 3OBIA 5L1KA 3EZ5A 1TVRB 3O44A 3P96A 3L9ZA 3TVZA 1GX6A 3OJUA 4ZVQB 1JMTA 3BGOP 4K5SA 5IC6B 3SFUA 1D9FA 4K4UA 2KYXA 2MSTA 5IXUA 2VZ9A 4WZMA 4KHPJ 2RU9A 3HVTA 1RTIA 1QSYA 2XGQA 4ZPDA 1YJ7A 4NLRA 1GXLA 1CG2A 4UZBA 2OPRB 3MUVP 5JVGQ 4DV6J 2BR0A 4OJ1A 3L7PA 4NXMJ 3KMQA 4YY3F 4QJVA 1K1QA 3IWLA 2N7CA 3PIPQ 2HNDB 4LR9A 1R0CB 3CCRS 2UUCJ 1UVLA 2BEFA 4PRFA 1P1TA 4F0HA 2V69A 2HFVA 3DNCA 3OQ2A 2JVRA 4DSKA 2YKNB 1M5OC 3HVWA 1HR0J 1RKJA 2Q66A 3BN7A 5EX3A 2IRYA 2DNOA 2OMLA 1HYSB 4IYQA 2K7JA 4P75A 4W4MA 1QY7A 4DV7J 1UCNA 4MKYA 1OY6A 3ZZYA 3J81Y 2M2BA 1PO6A 2P9CA 3PR5B 4TQRA 1WTBA 2E9TA 3AXKA 4MKBA 2ZDPA 1KSPA 4A8YA 1N0VC 2X51A 1FDDA 1JK9B 3JTOA 3NXZA 5HROB 2WVEA 2CAJA 1N6QB 2OPPB 3BB5A 3DKDA 3QGPA 1N54B 4FKXA 3TUJC 1F9HA 2QL5B 4CH1A 4NLPA 4M5NA 3GE9A 3M9NB 2W1BA 4YDXA 3RRHA 2OPQA 4G1QB 2BOPA 1M1KT 2M8DB 2UUBJ 2C2ZB 1CULA 2WSEC 2YQ0A 3GFYA 3HCXA 4ZPAA 3W66A 1RQ0A 5IV3A 3J80U 4IOBA 2J7UA 4OFZA 3KFWX 3UD3P 3BPSP 2ZHAA 3C16B 4PWDA 2HFZA 4X4NA 3BZQA 4A8KA 1VHFA 2Z57B 3SCJE 3IS9A 2FHJA 2AEJA 2KZZA 5AT1B 4B3TJ 1WF2A 4WYWA 3G8SA 4CNZA 4F3OA 1FXRA 4F4YA 1T3OA 3CO0P 1BQNA 4Y2IA 2V34A 1LKZA 4DX8H 2UUAF 5D0GA 2PO4A 3GMGA 1C1CB 2BA9A 4KV8B 1V3ZA 1BXNA 3A3PB 3ET6A 5KFVA 3W65A 3VR1A 4ED4A 3RTVA 1LK5A 4AFFA 4CTAA 5DGAA 1ELOA 4R25A 2J6UA 1FCAA 4J7CA 1SUQB 1EIYB 2HS4A 3T19A 1T9XA 3I4PA 2HFSA 5BR8F 1N48A 1PKUA 1TR0A 3E8OA 1XR7A 2BJ8A 1RGVA 1FT8A 3BF4A 4DZDA 4K50A 4A8MP 5J2PB 5J2QB 2LXUA 4MIAA 4DV5F 1X8DA 1XMBA 5SUHA 1S4EA 3C3LA 1EKSA 1JNZB 2Z2ZA 3H59A 3FZBA 2V8PA 5B0AA 4ZLNA 3TP2A 2YWKA 2NZCA 1S6QA 1BD6A 4OI2A 4OYAA 5KFBA 2AHOB 2N4DA 1U2CA 3F44A 1XC9A 4L3NA 3POTB 1X5PA 4LIRA 2NPFA 5I42B 4L6V3 2BE2B 1KDNA 2DRDA 1HI1A 2ZHOA 5HANA 4JUZA 3ZZRA 3DM2A 4BS2A 2R7UA 1URNA 4FDFA 4OJ3A 4UQTA 2CQ2A 2JJ4D 2EK6A 5KFGA 4PZVA 3LGMA 4X4SA 2H1YA 3OHBA 1UEVA 1QJHA 3GJTB 1S1WB 3CXCR 1BWEA 2IBKA 5A8RB 4CT8A 4DV0F 2MZRA 2FLLA 1VJWA 1T11A 2VPYB 1ZAVA 2CNLB 1DQ9A 4F4ZA 2DTJA 1M5PC 3K5PA 4H4OB 3LWMA 4A47A 4UF4A 1Q86T 3IN5A 3I4HX 2X7IA 3K58A 1Q78A 4ZVPB 3CIZA 4DF8A 3SSQA 1HIYA 2HLUA 2COLA 4DG1A 4FPRA 2LQJA 2MQQA 1QAYA 3ILLA 1G3OA 1M5HA 1TZ0A 1R0BG 4O3OA 3OLBA 3KMSA 5LJ5Y 2XMWA 2HS3A 3H90A 3DRRB 4X64F 2C3MA 3Q8SB 4DPXA 1S9FA 1RWMB 3CPWR 2BW7A 2RHSB 1S9GA 2WAQD 1NSQA 4GKKF 4RLEA 1PIEA 4P2MA 1IBMJ 4QWEA 3RRGA 3FEXB 1F3VA 2HGMA 2V6AA 4DSFA 2Y8WA 1YZ7A 3EGWB 3FBBA 1EQ0A 2OIHA 2ZD1B 2B8PA 1PSDA 2EVZA 2DNHA 4NEYA 4YR3A 4FF1A 1U02A 3DI6B 4F4AA 1KRPA 4IOCQ 3CC7S 2CFXA 3GB0A 3V5RA 2XZDB 2MLZA 3W64A 4KGZB 5A8WB 7FD1A 4ZP9A 1VQ7S 2VG5B 3QWPA 5F8JA 5KFIA 3I6PA 1U0SA 1W2IA 3GYNA 2C42A 3WIUA 3EGZA 2PSZA 4C8LA 2BM1A 1FNOA 4CCHA 1FVSA 3AJDA 3E01A 2BOAA 3FRZA 4NA3A 4AL6A 4ECUA 2WW4A 3IWXA 2W2OP 5CHCB 5KT6A 1SQFA 4HDHA 4KKOA 3KLGA 1MWQA 3BGLA 5KFYA 1Z1ZA 4OI0A 2G1DA 2ZOGA 2FJVA 3SQOP 2OTJS 3IR7B 1NEEA 1GXTA 5ETTA 3EM1A 3IAS9 3VALA 1F2GA 1A6LA 1CJVA 2YNFA 2V2KA 4AQYF 4FYXB 1T05A 4ZJLA 2D3OR 1V6HA 2GMLA 1ZH5A 1A9NB 4K2XA 2YKAA 2BANB 4KGKA 4R8UA 3J7ZT 1HHSA 4O4GA 1OO0B
chains in the Genus database with same CATH topology
1OPIA 2RF2B 2B5JB 3ISZA 4E0DA 1PC5A 1N5SA 1U45A 4TQSA 4KHPF 3HHKA 3HFKA 1EP4B 2X1BA 5IM0B 4ZVFA 3CJKB 5KG1A 4IG3B 3J7YU 2E5GA 2PA3A 3DOLB 5J1EB 2BYCA 3OV7A 1U1QA 3LOUA 1MSWD 2C3UA 2KJWA 1Y5NB 3DGPA 3ENVA 3J7Z5 5I3UA 2O1PA 1FD2A 3CT9A 1N5VA 2FJEB 2ROPA 5KFCA 4AXIA 3RAQA 4QU6A 2Q6CA 2ZITA 2DBBA 3U1MA 3W3SA 3HHEA 2DGOA 4N77A 5DQIA 4C97A 5KG7A 2ZH7A 4Y2KA 2X3GA 3HMJG 2DR7A 4A8FA 3QZ7A 4IH6A 5THWA 1X4CA 4B9UA 5A8RA 2W7PA 1YRXA 4Y2CA 3R1HA 1KQKA 1R89A 4TU8A 4RW9B 3IRXA 1UVNA 1UW4A 4ZHRA 4K4WA 2OPSB 5D3GB 2OSRA 1DTTA 5HLFA 1T94A 4ETZA 2GO8A 4RBVA 5E5NA 3DLKA 3RAMA 4O23A 4OX7A 3LUYA 3NAIA 3OTEA 2YY3A 5LSRA 3PKMA 4M63A 1LXNA 3BR9A 4B9SA 5J1PA 1K8AT 4G3IA 2V4JB 3PACA 3AA8A 3ENQA 4Q2MA 3ZZPA 1H2VZ 1TKDA 4DMZA 2RKIA 3GIMA 3GSDA 2FDNA 1XNRF 2H5EA 2KVIA 1S1XB 2LLZA 2XS7A 4K4ZA 4KO0B 1V9OA 3V2UC 3FFIA 5A0YA 3OTCA 2GHPA 3M1VA 1MW7A 2F8MA 1ZETA 2RRBA 3BJYA 3NNHA 4WXOA 3S8SA 4DSJA 4I67A 5CA5A 3KHGA 3CCUS 1Z2LA 2DT9A 1Y3KA 3I9V9 3RB0A 3MMBB 2VKRA 2DGUA 3C6UA 1LW0A 5A6WA 3K0JA 2E9RX 3CE8A 3BGRB 3BGUA 4TXSA 3T9ZA 3NL0A 3WC0A 2R2SA 5A8WA 2A10A 3PW2A 4B9VA 3KLEB 4XPEA 2E7WA 3PEHA 3U1NA 5B09A 1VQ5S 1TAQA 3IBWA 2OPPA 1YG0A 5F41A 3NCQA 3GIJA 5KFKA 1F5AA 1Q7YT 3T5LA 2JRSA 3Q22A 2VBZA 4OI6A 3OVSA 2E5LF 4OHVA 1UA0A 2MKIA 5KFFA 3HX9A 3UW1A 2KYZA 2EBGA 4A4JA 5JXSA 4ID5B 4DFKA 1RWUA 2DH9A 4D3HA 2DO0A 3IO1A 5CXTA 2LYVA 2ZC3A 4KKOB 4OZ5A 2EFPA 1YTYA 4G6VB 3G71S 5KFTA 1JLCA 1DHMA 3RYLA 3IFEA 5CYJA 3BGFA 3SSRA 3CJ3A 1RDRA 3OR2A 1KEKA 1M5OC 3IXQA 4QIEA 1VQ6S 1HARA 2G13A 1CSJA 1HPZA 3KLHB 4N47A 4CH0S 2ZKTA 3MEDA 2XWXA 2MGZA 4UW2A 4EBCA 2DRBA 5HMXA 3SQGA 3QLHB 1FRJA 3FMWA 4Q8FA 4DL6A 4MAKA 1YJNS 5GVQA 2D1CA 1UL3A 2ADCA 4QW8A 1HMVA 4URQU 1M5KC 2BRLA 4R0EA 1D9AA 1WD6A 4GO7X 2EFNA 1NH8A 3HHNB 3PXGa 3M8QA 4NLVA 4B9LA 1WNEA 3DLEA 2OFGX 3M2UB 2ZH2A 1FJ7A 2JLEA 1VOMA 5E3QA 5G0RB 5KT7A