4RW9B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B03
5I3UA 4I7FA 5HLFB 2W9BA 3MFHA 2XWYA 2RDIA 3ITHA 1JLBB 2WRMA 1C1BB 1C0TA 3RB4A 3KK1B 1IKWA 3T5KA 4TLRA 1N6QA 1S49A 4IRCA 1LW0A 4RZRA 2WHOA 4ED8A 4DEZA 5KG3A 1SH2A 1S0OA 2BQRA 2CJQA 3IG1A 2BE2B 4QWAA 2J6TA 1JLFA 4MKBA 4ID5B 4TXSA 1S1WA 3TAMA 5L1IA 2B5JA 3G86A 3PHEA 1KHVA 4NLGA 3DI6A 4IFVB 4DG1A 2UUWA 4Q44A 3QO9A 4J9PA 4R8UB 3T19A 4ED1A 3V6DB 3D5MA 1U09A 4KO0A 3GYNA 3KJVB 4RW9A 2VG5A 3FQKA 2AU0A 1S0NA 3V6HA 1HQUB 2HWHA 1LWCA 3JSMA 3CIZA 3KLFA 4WFXA 4ECTA 1NHUA 1QE1B 4O3NA 2BANA 2R2TA 3HVTB 2AGOA 4R0EA 4YQWA 1KLMA 2WOMB 4O4GA 5C42A 1NNDA 3IN5A 2E9RX 4O44B 4J9KA 1JLCA 5HP1B 1D0EA 3ISNC 3DOLB 5CYMB 3M8QA 4Q45A 1FK9B 3LAKA 3QIDA 3DI6B 4IFVA 3QGGA 3MR2A 2ATLA 4ZVGA 5DGBA 3QO9B 2ASJA 4YP3A 1WNEA 2ZE2A 2HNZB 1N5YA 3KLIB 3E51A 4J9QA 4ECRA 3SFUA 4F4ZA 4HYKA 3KHGA 2OPSB 2UVUA 1LW2A 5KFVA 3MECA 3BGRA 1EP4B 3GV5B 1JX4A 1TL3B 4IG0B 1OS5A 1T03B 3QZ7A 4H4MA 4Q0BA 5L9XA 1LWCB 2W7PA 4WFYA 3OL6A 4PWDB 4FS1A 3DRRA 5J2MB 5KFYA 1NHVA 2B43A 4ECXA 2WONA 1DTQA 2FVPA 1JLGA 2DPJA 2FLNA 3M8PB 3MEDB 3RAXA 2HNYA 4J9SA 2ZD1B 4DL3A 1JLCB 2JLEA 5F9LA 3KLEA 4MIBA 4RNHA 2FLPA 2YNFA 2RKIA 1BQNB 1JKHB 3LALA 2XCPA 3NBPB 4YR2A 4ECUA 3BJYA 4YR0A 1LWFA 3OSPA 4YMEA 2V4RA 3ICLA 4NLYA 2E9ZA 4X2BA 4K50A 3V6JA 2B6AA 5J1EA 1C1CB 5KT7A 1D1UA 1FKOA 1N6QB 5J2QA 4PQUB 3OL7A 5EWEA 5KFQA 3DOKA 5KFTA 3BQ0A 4U7CA 1EETB 5F8LA 4NCGB 2AGQA 4RUAA 4Q0BB 3G6YA 4I2QA 4ID5A 3V6KA 4G1QB 1S1UB 1S97A 1S1VA 2WCXA 3SI8A 1QAJA 3KNAA 3NAIA 2WONB 5KFJA 5C25A 5L1JA 4WYWA 1T94A 3HKWA 4F50A 1DTTB 2ZD1A 3NMAA 3KLEB 1IKXB 4KSEB 4URGA 2UVRA 2BQUA 3DRPA 1RT1B 1HNIA 1C0UB 2I1RA 2AGPA 3V6DA 2JEFA 2IA6A 1TL1B 3H40A 1TVRA 3BREA 5KFGA 4TY8A 4K4VA 4YR3A 3LP1B 3FQLA 4J9RA 1S9EA 2OPPB 3DLGB 4MFBA 3FRZA 4MKAA 2B6AB 5J1EB 4M94A 5KFPA 2XI3A 4EO6A 4URSA 1S9GB 2C2RA 2YKMB 1RT7A 5C5JA 4RU9A 3DOKB 2D3UA 2HNDA 1HNVB 1VRUA 4XPCA 3KLHB 3LANA 1HQEA 1RT5B 5FDLA 5KFNA 3QGHA 4FS2A 3I0SB 5KT2A 2R8HA 3KK3A 4KKOB 4JUZA 4LQ3A 1FK9A 3BSCA 3IGNA 4EO8A 5KFAA 3DM2B 4NLWA 2YNIA 5KFKA 4RNOA 4ED6A 4IH5A 1HARA 4O3RA 4ZMMA 2J6SA 4U6PA 5D3GB 4EYIB 1DLOA 4EBEA 1HPZB 5J2PB 1C0UA 3HVWA 3SFGA 3GIJA 4I7FB 5HLFA 5F9NA 4NLTA 5KFMA 1S10A 2RF2A 2XCAA 1T3NA 3ITHB 2BQ3A 2HAIA 1S6PB 1JLBA 3PJXA 4O3OA 2AWZA 1SV5A 2C2DA 5KFOA 3UDLA 4ECVA 1IKWB 2R8KA 5KFRA 1RT7B 2ILYA 4ZP8A 5L1KA 1SH0A 4O3QA 4J9NA 5CYQB 3T1AA 1YVFA 1RT5A 1MU2A 1TP7A 1BQNA 1JKHA 3H59A 5EWGA 4NLXA 2OPQB 1TV6A 4OL8A 2XC9A 1W25A 3N6LA 3KHRA 3GQCA 3JYTA 4ED0A 1HPZA 1FKOB 3PW2A 2JEJA 3BQ2A 4R5PB 3QGIA 5HBMA 3C6UA 4NRTA 4ZPDA 2W9CA 4RW9B 1QUVA 3LP2A 4NRUA 3RBDA 3GV8B 3EPGA 4WFZA 5KFZA 2GC8A 1S0MA 3RB0A 1RT4B 2IC3A 4Y3CA 4TY9A 3H98A 5KFLA 4RUCA 2C22A 1N56A 4J9LA 1TKTB 4K4ZA 4B3OA 1KLMB 5C42B 3FDSA 2BR0A 2D7SA 1DTTA 3PJWA 1IKYB 5KT6A 2JEGA 3KMSA 1HYSB 3UPFA 4IDKA 1FKPB 1RTHB 5EWFA 3QLHB 4IFYA 4RNMA 2F8EX 5I3UB 5KG7A 3GIKA 3IRXA 3DYAA 1TKXA 2UVWA 4JV1A 5KFCA 1RYRA 4KBIA 2ZE2B 4ZVFA 4QWCA 3KK1A 3PW7A 1JLAB 3DRSB 5HROA 5HBMB 4IRDA 1GX5A 1S6QB 4WE1A 4TYAA 2VG7A 1RT3A 4XO0A 2XGPA 1HQEB 3OLAA 3PR5B 4H4MB 4ICLB 1IM4A 3FFIA 5I42B 3V4IA 4F4XA 4M95A 2AX0A 3N6MA 5J2MA 1RA6A 4HKQA 1JLEA 1GX6A 4KFBA 5KG4A 2QV6A 1JLGB 3LAMA 3Q8SB 3M9OB 3EZUA 1IKYA 1XR7A 4TN2A 5KG2A 4H4OA 5C24B 4IDKB 4O4RA 3M9MB 4K4YA 4IFYB 3QLHA 1UWBB 2UVVA 3G6XA 3UQSA 1RTIB 1S1TB 3CDEA 3IRXB 4RW7B 4NLDA 2VG5B 1SH3A 3KHLA 1LWFB 4WYLA 3MEGA 4WXOA 1SV5B 2R2SA 3PW5A 3DMJB 3JSMB 1C1CA 3KLFB 4Y34A 4DL6A 2AQ4A 2HMIB 4RNNA 3C6TB 4MIAA 1JLAA 3PW4A 2BANB 5J2QB 1S4FA 1HMVA 4NLRA 4QPXA 3KK2A 4KB7A 1J5OA 2CKWA 4ECSA 4IRKA 1RT3B 5CYQA 2ALZA 4Q8FA 3CVKA 2FJXA 5HP1A 3BQ1A 4ECZA 3VQSA 2YKNB 3QZ8A 3DOLA 5CYMA 1MU2B 2IMWP 1S1UA 4WZMA 3CJ2A 1SUQB 4I2PA 3H2LA 5F8IA 3H4BA 3KLVA 1JLEB 1RT2A 5K14A 5C25B 3DDKA 2BRLA 4ZP9A 3OSNA 4QWDA 3DLKB 2ZKUA 3KLIA 1HNIB 1RT1A 3DRPB 3IS9B 2W8LA 4ECWA 1K1QA 4FBTA 2W8KA 1RTIA 3C6UB 1TVRB 4RW7A 5DG8A 3KOAA 4XPEA 1EP4A 4TY8B 1ZETA 4RNFA 3MEGB 1K1SA 2OPPA 4MFBB 3MR6A 4JV2A 4WXWA 1C0TB 2I5JA 3BSOA 1TKZA 2QE5A 1S9GA 3DRRB 2YKMA 2YNHA 4FBUA 5KFWA 2JEIA 3T5LA 3M9NB 1J5OB 3MEDA 3H5SA 2HNYB 2BE2A 4PUOB 3V81B 2J6UA 1KHWA 1S1WB 3TAMB 4KKOA 2RKIB 1Z4UA 4Y2CA 3H5XA 4URQU 1XR6A 1LWEB 4DL2A 3DM2A 1RT2B 5K14B 4NLVA 2IM3A 3G6VA 1R0AA 5F8HA 3GILA 3DLKA 5J2PA 1RTDA 1RAJA 4R8UA 2VG6A 3I5BA 3DRSA 2UUTA 5DLFA 3EPIA 3RB3A 4IR9A 3BSAA 5DG9A 4NLPA 4Q43A 2VG7B 2DPIA 4ZVEA 1RA7A 5KFDA 2IAJB 3PR4A 2I5JB 4NLUA 1TKZB 3TVKA 1S1VB 1IKVA 1TQLA 3MR3A 3PVXA 3BSNA 4EBDA 5F8GA 4KFBB 1S9FA 4QW8A 4RW6B 2WB4A 1BQMB 4O3PA 3V81A 4EYHB 3T5HA 1IKXA 3HHKA 5J2NB 3Q8QB 5KFEA 1RTJA 5KFUA 2W9BB 1S1TA 3MFIA 1LWEA 3Q8RB 3H4DA 2R8IA 4Y2AA 3ISND 2R2UA 2D41A 4JV0A 2W9AA 1REVB 4ZPBA 4RW8A 1S9EB 3OHAA 3DLGA 1R0AB 3JYTB 4DL5A 3LP0A 2HNZA 1N5YB 1RTDB 4LSNB 3BR9A 3CWJA 5KG1A 3C6TA 2R8GA 2W9CB 4LSLA 2EC0A 3BGRB 2E9TA 4QWBA 1VRUB 3KLHA 3PZPA 3KMQA 3FSIA 1T03A 2FJWA 2FVCA 3DLEA 1T05B 5EUHA 5KT5A 5DLGA 2FVSA 2YKNA 1JXLA 3KK3B 2OH2A 2B5JB 4PWDA 3E01A 2IM0A 1TKTA 4ZP7A 4ZVHA 2BRKA 4ED3A 5F8MA 4ED2A 4EEYA 3I0RB 3QIPB 3H5UA 1BQMA 3IGVA 2ASDA 1DLOB 1HYSA 4WZQA 3H5YA 4IH7A 2YNFB 3OHBA 5J2NA 1RT6B 1JLQA 1XR5A 5JUMA 3NBPA 2RF2B 1TKXB 4IG3A 4KHRA 5KG6A 3CDUA 1RYSA 4RW8B 2JC0A 4K4TA 4DL4A 1HQUA 3LP0B 3NGDA 3OLBA 3PW0A 5HROB 4KV8A 3HVTA 3HVAA 4ECQA 2V9WA 5F8JA 4O44A 4ZHRB 4NCGA 1C2PA 2FVRA 4QWEA 2XGQA 4I2QB 3CJ3A 5T14A 1S1XB 2C2EA 3M8QB 4G1QA 1JIHA 1VRTA 5DQGA 4RW4A 2HWIA 4F4YA 3TQ1A 4IOBA 3I5AA 3MR5A 2C28A 4H4OB 3OL8A 2O5DA 4MK9A 2YNGB 3MECB 2VG6B 4IH6A 1JLQB 4R5PA 1I6JA 1LW2B 3GIIA 4TYBA 2GIQA 5KFHA 2IJNA 3N6NA 4NLQA 3LP1A 5DQIA 5KFSA 4K4UA 2IAJA 1RT4A 2IC3B 5DQHA 3Q8PB 4O3SA 1CSJA 2W7OA 3KHHA 4QW9A 3CO9A 3CDWA 1HMVB 3MF5A 3KK2B 3QYYA 3M8PA 4IKAA 3IG1B 4ED7A 4ZHRA 1QAIA 5KFBA 1N48A 5FDLB 1FKPA 1RTHA 3I0SA 4ZP6A 2RDJA 1S1XA 2IJFA 3CJ4A 5JXSA 5KFFA 1VRTB 1RTJB 4NLSA 1SUQA 3DYAB 2YNIB 3RBEA 4DG1B 3KLGB 1REVA 3CJ0A 3OL9A 2IBKA 3UR0A 3MEEB 3I5CA 4LSNA 3IS9A 2IM2A 4ZPAA 4KO0B 4PQUA 4LSLB 3KJVA 2JC1A 4J9OA 1S6QA 4WE1B 1S6PA 1EETA 4TQSA 5L1LA 4H54A 3DLEB 1T05A 4EBCA 4ICLA 3RAQA 3FFIB 2VA3A 3V4IB 5I42A 2R2RA 2D3ZA 4ECYA 3E01B 1QE1A 2YNHB 5KT3A 1ZTTA 2WOMA 4O4GB 3GV7B 4F4WA 4TQRA 4NYZA 3I0RA 3QIPA 2OPRA 5KG0A 4PUOA 5DG7A 3MTKA 4Q8EA 5C24A 5F8NA 4KHMA 2WTFA 1UWBA 4LQ9A 1RT6A 5EDWA 4J9MA 2ASLA 2OPQA 1TL1A 3NAHA 4MK7A 4K4XA 1TV6B 1ZTWA 4IG3B 4K4WA 3T5JA 3KLGA 4GC6A 2FLLA 3NL0A 4GC7A 1C1BA 3DMJA 4NLOA 3MEEA 2HMIA 1RDRA 3NKYA 3CJ5A 1LW0B 2OPSA 4KV8B 2XI2A 2HNDB 3LP2B 1HNVA 1N4LA 1TL3A 4IG0A 4MH8A 2IM1A 4G3IA 3GIMA 5KFIA 1MMLA 4NZ0A 1JLFB 2V0NA 2FVQA 5KG5A 2VA2A 1IKVB 4I2PB 4RW4B 5KFXA 5KT4A 2WK4A 2GIRA 4B3OB 4KAIA 4MK8A 1DTQB 3D28A 4DL7A 4ZPCA 2AX1A 5DGAA 4IQXA 4K4SA 4RW6A 2OPRB 1S48A 5D3GA 2R8JA 3RB6A 4IR1A 2YNGA 2ILZA 2FJVA 4KE5A 2V4QA
chains in the Genus database with same CATH superfamily
5HLFB 2OSRA 4K5RA 3ZTOA 4ZLNA 3MFHA 2RDIA 1X0PA 1NLKL 3PYGA 2V8HA 5JMNA 2MKKA 2AEJA 2MZSA 2OMLA 5CCLA 2NS1B 2NXJA 4M5JA 1IKWA 3QBCA 3DOMA 5I3QA 1LW0A 4NOHA 2IDLA 2POKA 4DEZA 1Q1KA 1SH2A 2YQ0A 1S0OA 3SCIE 1X4FA 1BE4A 1EKSA 2MKJA 1R43A 3EICA 3QRQA 2BE2B 1QD1A 1H0HB 3HX9A 4AE5A 1IBLJ 3OQ2A 1WI8A 2XMVA 2CQ2A 5B0EA 2F40A 5IT9Y 5FJ4A 3PHEA 1VYAA 5B0GA 3SSQA 4NLGA 5H1SV 5M2RA 2Y1LB 2DRBA 2DVIA 3KXDA 4OYPA 2P6SA 1JXVA 3L9ZA 3C8YA 4C8KA 3T9ZA 2ROGA 3HT0A 5D4PA 4R8UB 1ZYQA 3T19A 1PAUB 4KGZB 4YFUA 4ED1A 3P96A 1Q8KA 2KFNA 4OYWA 1CJUA 1DZ5A 1S0VA 1U1KA 5LSLA 3W5YA 2VQEF 2CQ1A 3V6HA 5EX0A 2HWHA 4DV7J 4HLBA 3KLFA 1NJXA 5HMXA 3PEJA 1NHUA 3TEGA 2R2TA 1U47A 2WOMB 4O4GA 2AIRB 3D7SB 3IN5A 4DSKA 2E9RX 4NA3A 3UE2A 3A8IA 1X8DA 3DLJA 4HTIA 3UW1A 4X4PA 1BHNA 3LWLA 4ZCIA 2RUGA 2X1FA 5IWAJ 4TLQA 2JWNA 3ISNC 1IJEB 3DOLB 5CYMB 4YN3B 3EZOA 2F8HA 4KPCA 2ZJRQ 4NXMF 2M0GB 4HACB 2F3JA 3LAKA 2HBYB 3DI6B 3MR2A 1NSQA 4DOZA 5BXIA 3R5CA 4K7QA 4OYMA 2ASJA 1FVQA 4EZ9A 3BDEA 4YP3A 2HSEB 3D6FB 1UZHA 2ZE2A 1SKSA 1N5YA 3E51A 2BM0A 1HKAA 1UPMB 2V94A 3PJ9A 4F4ZA 4KGKA 3KHGA 2OPSB 2GA7A 4JI3F 2AMCB 4H4KC 3GV5B 2H1YA 3HKZD 1TL3B 4IG0B 1TAQA 1OS5A 3D6TB 5ETRA 5A0YA 3OFHA 1RISA 1HI0P 1B64A 4Q0BA 2VC0A 3M30B 3GCXP 5AE1A 4WFYA 1TL7B 3WX8A 1RABB 4BCAA 4X65J 2YBVA 5KFYA 3GYGA 2Q79A 4B9NA 2FVPA 1TK0A 2FLNA 4YB5A 3MEDB 2ZD1B 4CQ1A 2K06A 2JLEA 2L9WA 3HSJA 2MTLA 1TKDA 3PTWA 9RUBA 2AJ4A 4RUBA 1BQNB 1D3WA 5K8NA 1OSCA 3CD6S 4CLTA 3BPSP 3NY0A 3RR8A 3A4TA 1RE1B 2NCKL 3CDAA 2V4RA 2XB2D 3AOBA 3VV2B 3V6JA 2B6AA 1VQ8S 1D1UA 1H2UX 2CQPA 3TJ8A 5D4NA 1W2IA 2GW8A 4CZCA 2HHVA 3J7ZT 2NREA 1FRMA 2G0CA 3J7YI 4J7CA 3QJLA 1PYSB 2BE7D 4CLYA 3AQPA 3D3CJ 4NCGB 1FEHA 2LQ8A 2OEKA 4RUAA 2JZ5A 2ACMA 4ZVSB 4G1QB 4DV5F 4OX6A 5LXYA 2XLJA 2MQNA 2W24A 2WONB 3NG8A 5C25A 4ELUA 4C8YA 1LOUA 1WC0A 2Y0BB 3HKWA 1IQTA 4LFBJ 3KLEB 1IKXB 2DR7A 4NCBA 4NPOA 3V6DA 4WF9Q 2IA6A 1RHQB 3H40A 4PXDA 5D0HA 1ZH5A 1UJ4A 1U6BA 1UETA 1WTFA 3KUHA 4DV3J 5ETTA 3R27A 5H9EJ 3OXGA 3AJ1A 5J1EB 3EMTA 3MMJA 5E2QA 2WBMA 5J1NA 4DF4A 3HHLA 1M1HA 1ZZNA 1TMJA 4N8NA 4PQAA 5BJRA 2YKMB 1IBMF 1X31C 1J27A 3BN4A 4OLPA 3V4MA 2CJAA 1WD6A 2DHGA 1HNVB 1NB2A 4EUVA 4AD6A 1UVLA 1HNWF 4FYDA 3FSYA 1SBRA 1SC3B 3I0SB 1VK3A 2AW0A 4KKOB 1RXOB 3KDOA 4JUZA 4W98A 4HACA 3LH2S 3BSCA 5KFKA 5KFAA 4NLWA 1BY9A 4ANEA 2BZ2A 1ZZFA 2XY5A 1KQGB 1HARA 5T7LB 2DNNA 2H51B 4P7VA 4QYRA 1BLUA 4ZK7M 2RDDA 4QIVA 2EFNA 4DFKA 3N28A 1U4BA 4C9DA 4X62J 5JVHQ 3MM6B 2A10A 5HLFA 5F9NA 3VR1A 4NLTA 4C3KA 5KFMA 1TUWA 1T3NA 3ITHB 4O3OA 2E5HA 1XMOJ 1RAGB 2P2CB 4UOHA 4X64F 4LBHA 2ZH3A 4F4KA 3M30A 2E1PA 4I6AA 1IKWB 2G2YA 2R8KA 1JB0C 4MT1A 4QZVB 3SXLA 3A3PB 3IM9A 3AODA 3T3FA 4BHQA 3QATA 1NPKA 1TUVA 4WFNQ 2UU9J 2IPOB 1VQ9S 3PM9A 3WIUA 1BMQB 3O44A 4OLOA 1FRHA 1MU2A 2ZBQA 3H59A 3UDCA 5EWGA 2ZH1A 4UQGA 2AEMA 4OL8A 1R3NA 2FGOA 1U1QA 4H4KA 4MMOA 1MN7A 3IXQA 3MAAB 1W25A 2EG1A 2MHEA 4DZ6A 1T02A 4DPWA 1VMBA 2HQGA 4RWWA 2V68A 2Z8QA 2JEJA 4FF2A 3MCNA 4DPYA 2HBZB 3QMQA 3VHQA 3Q23A 4ZPDA 4F3QA 4YUDA 3MM5B 3QNWB 1WC1A 1QUVA 2LDIA 3JSYA 3PEHA 3BH7B 1S12A 3LP2A 1HW9A 1UFLA 3UFCX 3N9UC 3U1NA 4BC7A 5B0BA 3ENVA 1YJ7A 5KFZA 1VHIA 1K73T 5HQLA 2IIHA 4HEA9 4HI1A 4Y3CA 1S6UA 5KFLA 2NXCA 1KQFB 2C22A 3UN5A 2XNRA 2ZFHA 3FBCA 1TKTB 1PIEA 1RSCA 3WIVA 4K4ZA 3GJTB 5LM7E 3LO3A 5AXMA 1KSPA 2VF3A 3TJ9A 2VIHA 2RB7A 3UPFA 2DEJA 3NS5A 1FKPB 5K9FA 3OD2A 4BWJA 5H9EK 3PHTA 4LR7A 3IRXA 3DYAA 1TKXA 2EG2A 2GGPA 4UOFA 2Q43A 4OHVA 5KFCA 4J37A 1RBOB 4DCJB 1MROA 2KYZA 4YHHF 1SXLA 2KM8C 2RIJA 4FXWA 1U24A 2NXUA 4P72A 2H3EB 4MYUA 4NMLA 1CJVA 3G6ES 3K89A 3OXLA 4USHA 1VBXA 4ZCLA 1OY8A 1P6TA 4Y65A 4TYAA 4IRDA 1QM9A 2VG7A 1HHTP 4IQXA 1FRKA 1P8GA 3L7OA 3PR5B 4KH1B 3QAEA 2F1FA 3I9V9 5DDOC 3IWNC 3FFIA 4FKXA 1NHKL 4F4XA 1F6TA 2B56A 2AX0A 4F0MA 2MYFA 3KG1A 2MQOA 4R25A 4GKKJ 4KFBA 2GNKA 2F7VA 1JLGB 3LAMA 2XBPA 1NDPA 3JSBA 1NU4A 4U96A 1IKYA 1UMJA 1X5PA 1NMEB 4OFZA 5KG2A 2R42A 4DDFA 2B4VA 4K4YA 3RRHA 4WP9A 2K1RB 5K20B 4P9SA 2G1HA 1HR0F 4ZLLA 4RW7B 1Y0HA 5E41A 1HNZJ 2LCWA 4X4NA 2VQFF 2QJ3A 2AEFA 2XMTA 2ZOFA 4K2JA 4RJVA 4AXIA 3I55S 3D2WA 1C1CA 3KLFB 1SJQA 4DL6A 5ETQA 2HMIB 2AQ4A 2HWTA 1IWGA 1FD8A 1C4AA 1ZM4A 2F65A 4MIAA 4DHVA 2BANB 1S4FA 4PG6A 3QRRA 2OEJA 3KK2A 4C2MA 2CKWA 2B7CB 3VQTA 1UZDA 2XTJP 5HJYA 4LFCF 4WU2A 3BQ1A 5HP1A 2D3O1 4V19J 1YI2S 2YKNB 1MU2B 2VUGA 4WZMA 1R6YA 1APSA 4I2PA 3PO5A 5C2GA 1JLEB 2AF6A 2YXLA 5C25B 3DDKA 1NH8A 3ZNUA 1BD6A 5L38A 2X1BA 4QWDA 3HJFA 4B3MF 2OFHX 1AYEA 2JRSA 3ADAC 1LV5A 4N76A 2VB6A 3CC2S 1RAEB 4PCQA 4A8FA 1XNRF 2V8PA 4QBUA 1XC9A 3KOAA 3G2XA 1ZM9A 4RNFA 1I3OB 2EK6A 2RVJA 5F3ZA 2DITA 2IVYA 3MEGB 3CCVS 4DV6J 4DFPA 1N0UA 1C0TB 1YG0A 2GJIA 3J80U 3CCLS 1WF1A 1S9GA 2AZ1A 2RJZA 3GIRA 4D3GA 4FBUA 3I96A 2NXEA 3MCOA 4MJKA 2CPDA 3F0NA 3MEDA 3H5SA 1HBNB 3WX4A 5HO4A 2BOAA 2C2NA 5D4OA 3V81B 4EI2A 3GG0A 2ZNZA 3W5XA 4KRWA 4X4TA 3VAGA 3LGNA 3R9LA 3TAMB 1R89A 4KKOA 1X4EA 1D9FA 2MSSA 4URQU 2GAGC 3P4UB 3V5RA 5CD4A 2JNJA 4WK1A 2J5AA 3R5JB 2RQCA 4KHPF 2ACYA 4WPAA 5DS7A 2YH1A 4F02A 4DU7A 5J1PA 1PYOB 4KHPJ 3X3UA 3CIMA 2HHPA 3GILA 3VAIA 2I2YA 2UUTA 2MJUA 3BBBA 3RB3A 2PE8A 1EQ0A 4IR9A 4IQMA 2CPXA 5E3AA 2DO0A 2KT2A 1KQKA 3UVJB 1LXJA 2M9KA 3ENAA 4ZVEA 1RA7A 3V2UC 5BYSA 2H5EA 2GMJA 4DV2J 1B3TA 2I5JB 4NLUA 1TKZB 4DMZA 2OP5A 4KGVB 1F2HA 2DNOA 5IV3A 3BSNA 1QSYA 4USVA 5F8GA 2OJ3A 1SL0A 1HWJA 3GJSB 2UUBF 2CJ9A 2LKZA 2CPYA 4O3PA 3UN2A 2O66A 3T5HA 1FNXH 4RR5A 4JI1F 1O51A 3W9HA 2V6AA 5FIIA 3W65A 5KFEA 4V1Ak 2W9BB 3AQOA 3H4DA 3DLHA 4LRBA 4NYPA 2R2UA 1CULA 2PDAA 4OZ1A 4RW8A 2MZJA 3JYTB 3LP0A 3AJ2A 2LXIA 3BR9A 1ZA2B 4GVBA 3NNCA 5HMZA 1QSLA 1TK8A 3C46A 2XQCA 4JV5J 1CEZA 1FJEB 5ETOA 1XBWA 2Y0SD 3MPDA 3WHIA 4X4RA 3FSIA 1Q8IA 5EUHA 1T05B 6FDRA 2UUAF 4F8RA 3TUPA 5DLGA 4ES3A 1WEXA 1DQ8A 2YKNA 2HS4A 2XWXA 3SYZA 4I56A 2UUAJ 2B5JB 4ERDA 4RBVA 4PWDA 2MQ8A 2VPWB 5HJXA 2RRNA 1SL2A 1TKTA 5AXKA 2YWKA 3M4XA 4ED3A 4NXMJ 4DR7J 2ZH8A 3K58A 2UUCJ 5IWAF 5E0OA 1PKUA 3HCXA 2YWGA 2KZZA 2YH0A 4JI7J 2YNFB 3OHBA 2XYGB 2HFNA 3NMRA 5BYRA 4BLGA 2QC3A 4DWIA 2RF2B 1TKXB 1GAOA 1QVGR 2H54B 3UD3P 1VCTA 2W2QP 5EN1A 4DL4A 1NDLA 3B8HA 3M2RB 4OV1A 3OUYA 3OLBA 4DR3F 4ENOA 2CPHA 1WC4A 3KG4A 3OFEA 3PW0A 1VQLS 4V19X 5HROB 1N36J 4DSEA 1NKBA 3BPDA 3HO1A 3AT1B 1VI7A 4ZOSA 1TFWA 2FB0A 2R7OA 2V9WA 3WBZA 1E6VB 3D0IE 1TAUA 2MQMA 1BXNA 2V34A 2QLFB 4JYAF 3M8QB 1WI6A 3MCSA 2HQCA 3TVYA 2ZZMA 1YRTA 3IBCB 2HWIA 4DR6J 3VGSA 4MKYA 1YDLA 4HH0A 1WOOA 3T6JA 3ZTRA 2M3DA 2L3MA 3MR5A 4H4OB 2XMWA 3CB4A 5D0GA 4CO4A 3Q24A 2YNGB 3MECB 2AKWB 2E1AA 3M2VB 1JLQB 3PYFA 4R5PA 3UD4P 4OHYA 1LW2B 4QR1A 4PKDB 4TYBA 1WKKA 5B7WA 1YK9A 5HSPA 1T3OA 2UV8G 1RWVB 3UNYA 3WC2A 1DY3A 3QGPA 4K4UA 2XM3A 3Q8PB 2P5VA 1YKWA 4WKYA 1CSJA 4O3SA 4WP3A 2ABYA 1ZAWA 3SV3A 1SVDA 1KQSR 2XLKA 4C4WA 2HW3A 2XY6A 2ZM6F 2Z56B 1VC0A 3QYYA 4IKAA 2XS2A 1N48A 1XK8A 4LREA 1DAXA 2H48B 1R8CA 8RUCA 2QEXS 4ZP6A 4CCHA 2AT1B 1CBKA 4DQIA 3CJ4A 2Z57B 5JXSA 2ZHAA 2HG4A 1JK9B 1HR0J 4DG1B 3KLGB 2WZ1A 3EM1A 1CULB 4M63A 4A8XA 2LU2A 1HNZF 3TX0A 3UR0A 1RTZA 2RHSB 4FXVA 3IS9A 2N7CA 2KKHA 1FDNA 4PQUA 2MLZA 3AD9C 3MMBA 1HBMB 3D0HE 3OVAA 3TW0A 1OQ6A 1S6QA 4WE1B 1S6PA 1UEUA 1EKRA 2P8IA 5M2PA 4DQSA 2I0XA 4YDDB 1T05A 1NPRA 4RX6A 3HHNB 2DR6A 1YLXA 2PSZA 3V4IB 1GTHA 2VA3A 2D3ZA 4LBIA 4LFCJ 3M2UB 3EVOA 3SZ2A 1M5SA 1ZTTA 3PCOB 2R3VA 1GEHA 2IVMA 1HFEL 3GSIA 4L72B 3S6EA 4CH1A 3NGUA 4NYZA 5KG0A 4PUOA 2DNQA 1KR4A 3CD7A 1R0CB 2PFDA 2BW2A 3VTIA 3W66A 2FJEB 4LF2A 1N8RT 4I0WA 3C16A 4LQ9A 4X4SA 3MEKA 1QLNA 2VV5A 4USWA 1TL1A 3GONA 1Y5NB 2BM1A 1GK8A 3RUBL 1PAEX 4PPDA 2V9KA 4F0HA 3RW6A 1TL5A 3M7VA 5A8RA 5GAEI 2FJBB 1C1BA 2BDPA 2HHSA 2HMIA 2GO9A 3NKYA 1KFSA 1LW0B 1B0VA 2M88A 3O6QA 5CD4H 1YJTA 3IR5B 4B9VA 2DXEA 1KOHA 2XI2A 4WJBA 3RR7A 4UUXA 2BKNA 1G6BA 2GFFA 5HAOA 2MXYA 1MMLA 2GCFA 1JLFB 1O5JA 2CPJA 2VA2A 1V6HA 1WG5A 2HHXA 3M6WA 4B3OB 4I6YA 4MK8A 4UOGA 5LSOA 3HP6A 4WK3A 2XZDB 3AOAA 3HZGA 3RYLA 3TVZA 2OPRB 1JJCB 5D3GA 1PC5A 2DBBA 2KDOA 2HHHJ 4IR1A 3MECA 2YNGA 3J80Y 2FJVA 3AJDA 2B3TB 5I3UA 4I7FA 1CC8A 2MLYA 2W9BA 3G4SS 4R0JA 2LQ9A 1BC6A 1H74A 3ZFVA 3W7BA 1OSDA 3QFWA 2VKRA 2WRMA 1UAWA 1XWLA 3MMCB 3MWBA 4DL0C 3RB4A 4DUYF 1S49A 1VS3A 3FBFA 2ZOMA 2WHOA 1XQIA 3CT9A 4K5SA 3CCQS 2ROPA 2BQRA 3FC9A 4DLEA 2CJQA 2K7KA 1UJ5A 1FRJA 3C14B 4QWAA 2L08A 3D3BJ 4N5SA 1KKHA 1OPIA 2J6TA 1IBLF 1S1WA 2A2DA 5HMYA 3RG6A 4FYXB 4C7QA 2VL1A 3CCTA 4FNIA 1KWMA 2NZCA 3WQPA 3OW2R 1K9MT 3DI6A 4DG1A 1RWNB 1HL6A 2HVZA 2UUWA 4E2FB 2R7WA 2MB0B 1XNQF 3QO9A 3OTEA 2GQ2A 1WDTA 1YBTA 2ALYB 4ZJQA 4YDXA 3R7BB 2ATLA 2VBXA 4NL5A 3MXHP 3MMBB 3ONQA 1X4HA 3GYNA 3KJVB 1FFGB 2F63A 4Z37A 5A8KB 1VJWA 3BDPA 2CDQA 3LA0A 1LWCA 1RWMB 4ZN1A 2KXFA 2VQEJ 4ECTA 1AB8A 4CO1A 2DD8S 2XMAA 3HVTB 4R0EA 1KFDA 1KLMA 2X3GA 4YQWA 1NNDA 2UXCF 1E6VA 4RL1A 2W4PA 3LPEA 2LQJA 3TEHB 5LMUF 4IUFA 1UVMA 2IDEA 3M8QA 3CJKA 1FK9B 2JX2A 4PG4A 1DQ9A 3IWXA 4OI2A 3QWUA 3RJMB 3K5NA 1MSWD 1U48A 1WSVA 2JFDA 2KHCA 1RCOB 2YY3A 1Q53A 4Y0FA 1WNEA 3QT8A 4ECRA 4JI5F 3K17A 4IYQA 4OMFG 1LW2A 3GR1A 5KFVA 2VFTA 2OLWA 1JX4A 2FTRA 3FBEA 4NA1A 4ZIVA 5GADI 3QZ7A 1KNZA 3OTOJ 3DXSX 3IP0A 4ZVUB 2W7PA 1RCXB 3BKFA 3OL6A 2ROEA 5DZ6A 2R7RA 4PWDB 1RHKB 3DRRA 2FHJD 5HQ8A 2QFJA 4NZ6A 4AQYF 4O23A 1ZBTA 2HHQA 1ZA1B 1HD1A 3M8PB 2BBEA 3RAXA 2HNYA 1JLCB 4QU6A 2DIVA 3KLEA 5F9LA 2FLPA 3C66A 2XS7A 1FVSA 2YNFA 1T9YA 2PC6A 1MNEA 4AL5A 2VFRA 1QSSA 4QR0A 1GT8A 3EVWA 2VBWA 2VFSA 3OT9A 3VZIA 2EFQA 4JI0F 1J5EF 4M5LA 3BJYA 1LWFA 3FSXA 1XNRJ 4YMEA 2RE1A 3I32A 2E9ZA 4ZKAA 1UCNA 1KN6A 3CUNA 4L3NA 1ICEB 5J1EA 2MHNA 4OYZA 5IS2A 4P2MA 3HHLB 3TZZA 4AL6A 3PG9A 5J2QA 4PQUB 5BR8F 3OL7A 1NK8A 2MEWA 3G82B 1IBKF 4DR4J 2VBYA 2MZ1A 3NCPA 2QA2A 2B0GA 5B0AA 4QIWD 1NDCA 1RAFB 1U2RA 4Q0BB 3JTOA 4USIA 3G6YA 1M90T 4ID5A 1JNRB 3C15A 3NWGA 4PG5A 4P73A 5LL6d 3VF0B 4E8UA 1S1VA 1REGX 2WCXA 5G0RA 5T41A 3HMJG 2KVQE 4WFBQ 2J0WA 3NAIA 3SI8A 4DSLA 4WYWA 2BJEA 5A8WA 4F50A 1YZ6A 3FJ2A 3DC2A 2EC2A 2Y3YA 2ZD1A 2KHDA 3IBWA 4AYBD 4CO2A 1M1KT 1HIYA 2DGTA 3BO4A 1N5QA 5ETPA 5IM0A 1HNIA 2AGPA 3MM6A 2I1RA 1CQNA 2B4OA 3IBFB 1WF0A 1TL1B 1YJRA 2F5GA 1RGVA 4PABA 4DV3F 3H2UB 3Q8YA 4TY8A 1FE0A 1FF2A 4ZDNA 2AJ0A 3ZZZA 1DARA 4YR3A 3J7AN 3LP1B 2N3LA 3BO3A 2OPPB 3FRZA 4NE9C 4MKAA 5HATA 2B6AB 4M94A 2J9DE 2KFZA 2XI3A 1WEYA 1CJKA 4WBFA 2C2RA 4RU9A 3CULA 1U0HA 3PIOQ 2A0FB 2D3UA 2E7XA 2MKYA 5CXTA 1XEZA 3BF4A 1HQ2A 5KFPA 2VHGA 1SI9A 3AH6A 3MZIA 4B17A 5FDLA 4CLZA 3QGHA 4FS2A 2I38A 3AA8A 3UDEA 2R7QA 2R7UA 2EBGA 3KNGA 2R7TA 4PZVA 3PRBA 1BQXA 4JI8F 3IGNA 1NK5A 2M8DB 2CNOB 3DM2B 4K59A 2IHR1 4K4SA 4CH0S 4IH5A 4B3TF 4ZMMA 3OPKA 1NPPA 4WP8A 5B0FA 5D3GB 4OJ1A 2PMHA 4LF6F 2ZUGA 5J2PB 1SKUB 3OTBA 4I67A 4WU3A 2BEFA 3HVWA 3T1YF 4B9TA 3GIJA 2GVZB 4X62F 1OQ3A 1S10A 1WC3A 3MM5A 1WHYA 1TMMA 1M0SA 2EEYA 1J2VA 2IBOA 2HAIA 1S6PB 1JLBA 2YWHA 1FFWB 4ILRA 4P10A 4DPXA 2D74B 3R6LB 5KFOA 4U7UK 3VAMA 5A76A 3M8SA 1KC8T 3RGIA 3W2WA 4P71A 4CLLA 2ILYA 1WOSA 3DRYA 2HVIA 5L1KA 3NNHA 4J9NA 5CYQB 2Y8YA 3W9IA 1YVFA 1RT5A 4CRJA 3DKDA 3EVMA 1B4SA 2CQGA 1TP7A 1F3FA 1S79A 1WELA 3GR0A 2RMLA 4U8YA 3HPOA 1PO6A 2D69A 2B51A 3F41A 2C1EB 1SC4B 2W25A 1OY6A 4LMZA 3GQCA 1H2VZ 3BYRA 1Y5LB 4ED0A 1H7XA 3PKMA 5I4MA 1FKOB 2C2MB 3TO8A 2R7SA 1E6YA 3QGIA 3SDEB 1LK5A 4AT1B 1PSDA 3AY0A 3RW7A 2IY5B 2GX8A 3MM7B 4GRSA 1LXNA 2LEBA 2GMLA 3EPGA 2AJFE 3BKUA 2J8SA 3CCRS 4C11B 3OFGA 1FXLA 2B7BB 1S0MA 3RB0A 2IC3A 1N56A 4J9LA 2UXBF 1NK6A 4B3OA 5C42B 2BR0A 2ZOGA 3SQGB 1S76D 5A8WB 2D7SA 1RU1A 5KT6A 2X1AA 2ZHOA 3NOCA 1HYSB 4JI4F 2CUYA 4IDKA 2J76E 2KYXA 3LF0A 7FD1A 2JDJA 2K1RA 4IFYA 3U27A 5EWFA 2F8EX 5KG7A 2DNHA 2G1DA 5ETMA 1U25A 1B99A 1U6FA 2E29A 8ATCB 2PA8D 4LF4F 4OHWA 1RYRA 2H65B 4KBIA 1EJ7L 1ELOA 4ZVFA 4C98A 3J81U 2MSTA 5HBMB 1T9XA 2FUG9 3EGVA 5CH7B 2BUNA 3PFOA 2QLWA 2C3YA 1YRXA 2XGPA 1RT3A 2XMKA 3NXZA 4XAKA 2GVDA 3IM8A 5I42B 1RACB 3FCVA 4KT0C 3TNVA 4K0KJ 3N6MA 5J2MA 1RA6A 1Y7PA 4WWSA 1JLEA 1GX6A 1H7WA 1Y11A 2BJ8A 3CD5A 2QV6A 3D67A 1RP5A 3FK4A 3H20A 3QAUA 3CD0A 2H5JB 2E5GA 4TN2A 5A2QY 2G9OA 1G2EA 2A3JA 2H4YB 5C24B 3M9MB 1EAYC 2MLXA 4M5DB 3WC0A 3QLHA 1FX4A 2DHSA 2HIYA 3POTA 2ADBA 1IBMJ 2BX6A 3UQSA 4LF5J 1RTIB 4LF9F 1NZ8A 3IRXB 4NLDA 3ZZTA 3QWPA 4OI3A 3MM8B 1LWFB 1U1NA 3I82A 2R2SA 1FWKA 5C7PA 3JSMB 1KRPA 4Y34A 2QTWA 2E5LJ 2Z30B 1CJVB 4DV0F 2OTLS 1HMVA 2LU1A 2G2ZA 2LDYA 4M5HA 4KB7A 5DETA 5B0DA 1JQGA 5EGYA 1RBAA 3G8SA 4F04B 2Z2LA 2FJXA 2Z2MA 3EWGA 4ANCA 5ITHA 4ECZA 2CQ3A 2GJ2A 3QZ8A 3SQOP 3G8QA 3CJ2A 3KJFB 5F8IA 2GHPA 3W2VA 2N7YA 5E3RA 1FT8A 1EIYB 5B08A 3OSNA 2IRUA 1X5SA 2QMXA 3R1LA 1N32J 2DGUA 2W7AA 1LFPA 3QSIA 3DDIA 4Q7AA 4ECWA 1HNIB 4FBTA 1R8AA 2W8LA 3KKFA 4ZJOA 4D3HA 4DQRA 1HBUA 3C6UB 3CCWA 3H2VE 3K7RA 4RW7A 3AB2B 2HKEA 5DG8A 1DFDA 1IJFB 3S8SA 4X64J 1ZETA 2AJQA 2OPPA 2APOA 3BO2A 1B70B 2V8VA 2I5JA 3BSOA 1IBKJ 3RU0A 3M8YA 1GMWA 2WB1D 2Q66A 5KFWA 2JEIA 3T5LA 2KJVA 2YQ1A 4OYBA 3TAQA 2D3OR 2XHWA 2HNYB 3TJAA 2BE2A 5IZHA 2MGZB 4W4MA 3WDOA 4HDGA 4DV5J 2HHHF 2QN6B 4DCPB 5IXUA 4RWXA 4U7UD 2NZ4A 1H38A 4MTPA 3DM2A 1W7WA 4PXEA 1T11A 2RHQB 1TUGB 4XTTA 1BUXA 5THWA 2OSQA 4PXBA 5F8HA 3DLKA 1QAYA 3M6XA 3QQCD 5K8PA 3KUEA 4YOEA 3I5BA 2BACA 2CQBA 2YQ3A 2F8MA 3EPIA 2BKPA 1IR0A 4Q43A 4U67Q 2LA4A 1UA1A 3BB5A 4CO3A 1YX2A 2DNLA 4DUYJ 3CMES 2BVZA 3BEGB 1HWIA 3B4DA 4JBCA 3TANA 3TQEA 1FTCA 4P6QA 4CDIA 4NXNF 2CQCA 3UD5A 3N01A 1K44A 3MUTP 4RW6B 2WB4A 3JXOA 1BQMB 2OTJS 3V81A 4EYHB 4ER8A 1T95A 3DGPB 2LECA 3EDRB 4P2XA 2CQDA 2KT3A 4OZ5A 4LFAJ 4DU8A 2UXCJ 1RTJA 5E3PA 4A47A 3MFIA 1LWEA 2H4WB 1K0VA 3ISND 2D41A 2RRBA 2W9AA 1REVB 2OKQA 2Y8WA 1X4GA 4ZPBA 4Q2MA 3S1TA 2M52A 4LF1A 4B08A 7FDRA 2HLTA 3D54A 1N5YB 3CWJA 2HBRB 4X84A 1UP1A 4W90B 2JOQA 3C6TA 3MI7X 3VAJA 2R8GA 1CVJA 1BWVA 3LGMA 2W9CB 2E9TA 4DR5J 4DV1J 3KLHA 1OPZA 3PZPA 3KMQA 2FJWA 2ZH7A 3DLEA 2FDNA 5GAGU 2FC8A 2PEHA 1DRZA 3B4MA 1Q4RA 3OR2B 3VCDA 1A9NB 1HNXJ 3N5BA 1A7GE 2ZEJA 4AUKA 5K8MA 4ED2A 3H5UA 2DK2A 1DLOB 1HYSA 2VPXB 4QOTA 2NYIA 2OD6A 3LOUA 1N88A 1FFSB 2EFPA 4WZQA 3M2VA 1XR5A 5JUMA 3A8JA 1MMNA 4G65A 5L46A 2HAFA 3MD1A 2B4UA 2B9YA 4JI5J 4ID8A 1DURA 1CJUB 1SQEA 2HGMA 2ZITA 4KHRA 3OR1B 4OJ3A 4Y28C 2K7JA 3A3NB 4A48A 4J5OA 3KDNA 6AT1B 3R1HA 2ZJPQ 3C3LA 1S99A 2J9DA 1GXTA 2VU5A 3RBXA 5FLXY 3ZXWA 3U1LA 4GVBB 4QYZK 1VLYA 1VRQC 1YSJA 3S7RA 2DGQA 4L76A 1EHWA 3RRGA 2LQBA 4ECQA 2QA4G 4C6AA 2BA9A 4P2FA 4NCGA 3GJQB 4B9MA 4P52A 3W61A 2KB2A 1SPBP 3CJ3A 3NS7B 2QSWA 5IFMA 4A8OA 1VRTA 2BJ7A 5DQGA 2X3DA 4RW4A 2MPUA 4JI2J 3HDSA 1IQZA 4OV6A 4F4YA 3HULA 1SC1B 3H8YA 3TQ1A 3PDNA 1XNQJ 3I5AA 2C28A 3G96A 2O5DA 2QMUB 2MMYA 2RQMA 4IH6A 4MK9A 4NX9A 4ZVPB 1JJHA 2OIHA 2R9LA 3GIIA 3IRWP 1NBEB 1YQHA 4LFBF 3T6BA 2GIQA 2DY9A 1FERA 2YX1A 2DKOB 3N0VA 2V69A 2IJNA 4ZLJA 5BR8J 5HVGA 4ES2A 1C4CA 2GQCA 2A1BA 1TL4A 3D68A 3M2RA 5KFSA 3OUYB 2IAJA 3CF5Q 3TARA 3LUYA 2H5IB 1RT4A 1OIAA 3QT6A 3EZ5A 2W01A 3KHHA 4ZITA 3FKBA 2PT0A 3CDWA 4UW2A 5GAEU 3GFXA 3MF5A 2EVZA 1P9QC 1M5KC 2B8QA 5DJBA 2XO6A 3ETOA 5KFBA 2LP4A 3I0SA 3C16B 2WW8A 1QVFR 3BV8A 4U9RA 3TI0A 4GKKF 1SUQA 3P5TL 4YB7A 3TUIC 2E66A 2MY8A 2WSEC 3HT3A 2RAQA 3RBEA 3WZ0A 1K8AT 4OX7A 4OI0A 1OWXA 4LF9J 3MEEB 3PYDA 4LSNA 1CJTB 3AHPA 2YTCA 5D0RA 4HHHA 2ASDA 2UXDF 1Y00A 2NPIA 4ANDA 1VHFA 3SCKE 2OAUA 4USMA 4TVAB 2VQFJ 1NJZA 1VC5A 1V3RA 2LYVA 1EETA 1WKLA 2GHVC 4TQSA 5L1LA 1N0VC 1VISA 4LR8A 4CYUB 2O67A 4ICLA 4EBCA 3RAQA 2JSXA 5HVFA 5I42A 2HPUA 5HI7A 4DN9A 4ZS6A 3CCES 4DV0J 3BN7A 4LRAA 4KTQA 1S72S 1HWUA 4CH7A 3T1HJ 4JOUA 5C2CA 2WOMA 4O4GB 2WW4A 1NK0A 1NRKA 3I0RA 3QIPA 2OPRA 5D4LA 4DX6A 4LF8F 2V2QA 3ZZRA 2ZBIA 2HQIA 1UWBA 1AW0A 5KTQA 5EDWA 2BE9B 1NKCA 2V4JB 1URNA 2RNEA 2V2KA 3ZTPA 2JVRA 1TV6B 1ZTWA 4IG3B 1NCLA 3KYLA 2MJNA 5GADU 3MPYA 3KLGA 4GC6A 3K5MA 3FCWA 1CS4A 1PC4A 1RWXB 4GC7A 1MWZA 1RWUA 4B9SA 3IAS9 3MMCA 3PX4A 3FMWA 2PI5A 1RDRA 1CQMA 1RUSA 4KV8B 2GJFA 1F9HA 2HK2A 2OGUA 4PWUA 4NZ7A 1Q5VA 2JLGA 4P2SA 4LF7F 2IM1A 3JSRA 4C0OC 3S01A 5IC4B 2DCLA 3OXFA 2A6OA 1QY7A 5F0UA 1D8YA 4M5NA 2XMMA 4LT6A 4KAIA 1SJRA 2GIRA 3CC4S 1O8BA 3GE9A 4DL7A 2D1CA 2PD1A 5DGAA 4EFAC 3IAM9 1F2GA 1VQSA 2PA3A 2LXUA 2ZNYA 2KRBA 2R8JA 4FYVB 1HW8A 4DJBA 3RB6A 1N34F 3DN9A 1B0TA 4CLWA 2ILZA 5KFUA 5ETKA 3ET6A 4RO0A 3W64A 3UI3A 4ES1A 2XWYA 3ITHA 2J7KA 4ALZA 2LEAA 5A8RB 2HRYA 4MIWA 4OJHA 2DNMA 1C1BB 1YWXA 9ATCB 2A6MA 3KUGA 4TLRA 3T5KA 2ZHBA 4IRCA 1VGYA 4RZRA 4ED8A 2B9XA 3P6YC 3JQMA 2HVHA 2DRDA 3THTA 1YITS 4KIAA 4NXNJ 3IG1A 1T9UA 2N3OA 1JLFA 3B82A 3EGNA 3O5TB 4MKBA 2LXFA 5CABA 3G86A 1ITPA 1KHVA 4G1PA 1JJ2R 4IFVB 3SMZA 2SXLA 3MAAA 3FBBA 2AYGA 4J9PA 3TUJC 2VBZA 3TZYA 3SV4A 5DM7Q 3V6DB 2CZ9A 1SIZA 1U09A 2RH3A 4A8MP 2AU0A 4RW9A 2ZC3A 4O0NA 3L4BC 3PX6A 1NKEA 1VOMA 1T7PA 4DQPA 1TFYA 1VBZA 2HFVA 1KTQA 3M1VB 2YPZA 2W1BA 2HHUA 3DHWC 4DBQA 2J9CA 4QIEA 1X9MA 3QT5A 1GFWB 1YRUA 1QE1B 4O3NA 2BANA 2AGOA 4F3OA 5KG4A 2DNRA 4W92B 1A0OB 3AD7C 5IQQA 4J9KA 1JLCA 2CVIA 3OVBA 5HP1B 1UFKA 3PRVA 5CZXA 1D0EA 2CQ0A 3FZ2A 3M05A 3GFZA 4WTYA 4Q45A 2UU9F 1HBOA 2P9GA 3ULHA 3H90A 3D0GE 4M8LA 4LF5F 2G0IA 1F1BB 4DR1F 4M5KA 4ZVGA 2YWWA 4JI7F 4HT7A 4USJC 3QO9B 5DGBA 2YKOA 1FXRA 2UXDJ 2ZUAA 4J90A 5LOQA 3KLIB 3AXKA 2NSCA 2N82B 4J9QA 2CJKA 5HN0A 2FIUA 2ZH5A 4XIUA 2KXHA 1KTVA 1YJNS 1MW7A 2C3UA 2HFOA 2KT5A 3LWMA 1OJ4A 1LNQA 4UTGA 4C0BA 1LWCB 3UCZP 3OTOF 2GZOA 2MZQA 3EX7B 2DGWA 4I4BA 1R6VA 1Q95G 2B8PA 2B43A 4ECXA 4KGXB 2E5IA 1JLGA 2MKSA 4NASA 4Q5VA 2CYYA 1HBNA 3GP9A 3JQKA 4AL7A 4RNHA 3KWMA 1PJ5A 3C2PA 2VC1A 1FE4A 1WC5A 3D1QA 3NBPB 4YR2A 4QPTA 4ECUA 4PYDA 5E7OB 4YR0A 2CAJA 3ICLA 1FWPA 4Q2LA 2XG8A 4LVNP 4JI0J 4X2BA 2FZGB 4B3RF 4K50A 1NO8A 3D9BA 4B9LA 1C1CB 1RWKB 5ETLA 3CSKA 2BJ3A 4NEYA 3DHXA 3TA2A 2EKYA 1X9SA 2MKCA 4A4JA 1U0HB 4BBYA 2QL9B 3DOKA 5KFTA 5KFQA 1WHVA 5KOXA 2EFGA 4U7CA 1EETB 5F8LA 4UOCA 4TU9A 1SKRA 1PCAA 1BWEA 2MZRA 4PR6A 4OZ0A 4I2QA 2CNLB 1Y5IB 4I1TA 1FDDA 1X4AA 1XIQA 1Y4ZB 1S1UB 2P9CA 2ZBPA 4KC5A 1S97A 1QAJA 1WORA 2B4PA 2EKNA 5E33A 4YS2A 3ZZPA 2LLZA 3SCLE 2VOOA 3GFHA 2FC9A 1T94A 2YVSA 3EJMA 3LTOA 1DTTB 4DPOA 4UF4A 1I1GA 1YJVA 4XDCA 4LIRA 4X4QA 4KSEB 4URGA 2W4CA 2XY7A 2RUSA 3DGVA 2BQUA 2UVRA 2RQKA 4DZDA 2CVEA 2JEFA 2J7WA 1TVRA 1RJJA 2BJDA 4A8QA 4K4VA 5D15A 2GGPB 1Q8BA 2CWKA 4J9RA 1SCJB 1PYTA 4OX9F 3DLGB 3J81j 3UNGC 5A2QU 5IT4A 3GU0A 4I69A 3GYXB 4ZLPA 1RAAB 2HS3A 4TKTA 5EX3A 1H3DA 3TWZA 5DDQC 4URSA 2QFIA 1S9GB 2CQHA 1IVZA 5AE2A 2PMZD 3MMAB 2HNDA 3MHYA 1VRUA 4XPCA 5LMNF 1HQEA 2HIQA 1RT5B 1FJ7A 1U8WA 3MM9B 3MAHA 3EYZA 5KT2A 2R8HA 3KK3A 3DLBA 2CQIA 3PY8A 4CTAA 3ZNJ1 4N56A 1NEEA 4RNOA 2HLUA 3UWTA 2QA4S 2YNIA 4ED6A 4O3RA 2J6SA 2WBRA 1ZS6A 4JI6F 2BOPA 4A8SA 3QJJA 1SB6A 1TTHB 2UV8A 4C8ZA 2XULA 4M5MA 1QTNB 3TRGA 5IM0B 4CNZA 2VOPA 1C0UA 1HA1A 3SFGA 4LR9A 1EQMA 2RF2A 3G71S 3VZHA 2V67A 3CJTA 4DFMA 3PJXA 4FDFA 4DR7F 2AWZA 2XEXA 3GCWP 3F56A 4Y2IA 2C2DA 3CO0P 2OELA 2Y1JA 4EZ6A 3UDLA 2YPYA 4DUZF 2PN6A 3HXMA 1RT7B 4F3MA 1IN0A 3TZXA 1L5UA 3RAMA 1Q82T 1AUDA 4GO7X 2K3IA 2LQ5A 1SH0A 1IR2A 2HQ3A 1Y9OA 3T1AA 2W2MP 2DO4A 3CCUS 1N36F 3RZAA 4F2SA 2J0SD 1KS2A 1WG1A 1BQNA 1S6OA 2IRYA 2L9NA 4NLXA 4RBUA 3PXGa 4AXJA 1N34J 1SQGA 1TV6A 3LPYA 4I6WA 1ZAVA 5D78A 3SIPB 2XC9A 2UUCF 2FLOA 2DHXA 1WEZA 3KHRA 3W62A 4K8RA 1CS4B 4K2XA 4PAAA 3RRKA 1L3KA 3JYTA 1HPZA 1WJ9A 1L3UA 1FJCA 3ELHA 3BQ2A 5F41A 5DDRC 4R5PB 3B78A 3GG1A 5HBMA 4IOCQ 2M8HA 4RW9B 4YEAA 2CIMA 2QZ8A 5IOLA 2AHOB 2X1GA 4NRUA 5DZ7A 3IO1A 1XTZA 3TR5A 2VJUA 3MR7A 3CE8A 1N33F 3FUYA 2VONA 3HD2A 3HVRA 2GC8A 1QTMA 3AXMA 2MY7A 4RUCA 2EW9A 3CC7S 4QR2A 2B9EA 1UEVA 4OHZA 3ZZUA 3P5BP 1U02A 3GFYA 4B02A 1TELA 4ELVA 1DTTA 2YWEA 1T9VA 3E3XA 3PJWA 2JEGA 3T9NA 4FF4A 4QJVA 4MAKA 2DNYA 2KVIA 2MQLA 1EARA 2RT3A 3QLHB 3POTB 1MG7A 2ZH4A 4RNMA 1YGYA 1WSRA 2XZTB 3PNIA 4KR0B 3BYPA 4UZCA 2O1PA 1SJ1A 2KG1A 4HR2A 2BYCA 3QFHA 4TU8A 2ZE2B 1EX8A 4QWCA 3PW7A 1L3VA 5HROA 3AAWB 3SDEA 3M8RA 2MDAA 3TUZC 4BDPA 2KU7A 2HQFA 3L7PA 3OV7A 1NXIA 4OYOA 1S6QB 4WE1A 5CCMA 3R3TA 2ASYA 3UVJA 1HHQA 1HQEB 4DV7F 4MYTA 3OLAA 1NK7A 1IM4A 4HDHA 1VQPS 2HFUA 3V4IA 3CJQA 1S7HA 2RRAA 5SUHA 1UVJA 2PEBA 4FP9A 3ZO7A 2W2OP 5U47A 2XLIA 2NLWA 3R5DA 3MUMP 3M9OB 3W8PA 2QLBB 1PG5B 2DGXA 1B7YB 1G4CA 3W3SA 2G13A 2J0XA 1Z2ZA 4H4OA 4IDKB 4O4RA 3CJSA 4IFYB 4GVLA 2IFXA 3H0PA 3G6XA 1N54B 1UKUA 1HBUB 1V9OA 1Q79A 3F73A 2P9EA 2K2PA 2CFXA 3O3LA 2QMWA 5HANA 1VLOA 2DNGA 3A12A 1WF2A 3DMJB 2PGCA 3EGZA 4P7TA 3K0JA 1WTBA 1JLAA 3PW4A 3X1LB 4CI0B 1S4EA 2VKZG 3ENWA 4NLRA 2JL9A 2HGNA 1LEOA 4QIFA 4FPRA 1M5PC 2X51A 4ECSA 1RT3B 2LVWA 2ALZA 4Q8FA 3J81Y 3MPWA 3VQSA 4AQYJ 3DOLA 5CYMA 2OFGX 1WACA 1S1UA 1HBOB 3H2LA 3SSSA 3H4BA 1UA0A 4PXCA 3P49B 4JI6J 2UP1A 1RT2A 5K14A 4Y00A 4ZP9A 1M5HA 2QT7A 3HZEA 2ZZTA 3JTPA 2ZZNA 1YJWS 3DLKB 2ZKUA 2C42A 3U02A 1X0FA 3KLIA 2V8GA 3IS9B 4CIOA 2AP6A 4CT9A 4RUHA 1RTIA 2HHTA 1TVRB 1R31A 4ETXA 1YTYA 2DCUB 3A1YG 1KBRA 1XERA 3Q2TC 4I64A 2VFUA 5IC6B 4FZVA 4ATNA 1K1SA 1MMDA 5GMKa 4OHXA 4JV2A 1HD0A 3EXYA 5LT5A 3W63A 5GAHU 2YKMA 4X4UA 4U8VA 3DXBA 3ZZOA 1J5OB 1AT1B 1DHMA 1V5IB 3I31A 4PUOB 2J6UA 2M2BA 4ZPTR 1KHWA 4JB8B 3BBCA 1S1WB 1Z4UA 2Q3PA 1KONA 3H5XA 1LWEB 2DB1A 4DL2A 1SKWA 1SL1A 3PFEA 3CMQA 4NLVA 1FHTA 2XMUA 3HSZA 3J7A1 1EB0A 1TZ0A 4GKJF 2HQDA 2ZVIA 2OUGA 5DLFA 1JMTA 1FXDA 1DJ0A 3NP5A 3JAMY 1KVJA 3BSAA 2WVBA 3BGUA 3AFGA 4BC9A 2VG7B 3CMAS 2DPIA 5D8HB 3PR4A 1HNWJ 2QLJB 1VFJA 2AJ1A 2ZDPA 4J9VA 3TVKA 4ILLA 1IKVA 1X4CA 3Q2SC 4PEOA 2BABA 2JLFA 3TX8A 3PVXA 4FF1A 2WVFA 4KFBB 3L09A 2OEMA 1RQ0A 1Q7YT 1S9FA 1GTEA 2NR0A 2CQ4A 4YY3F 1HWKA 1CLFA 2CJBA 1IKXA 1B7FA 5E3QA 4Z7YA 2RS2A 3BS9A 3CEDA 5J2NB 4PG8A 3JS9A 5E5NA 3BGLA 4LFAF 1GMVA 2PFFB 3Q8RB 1IXKA 4YHHJ 3OR1A 4P74A 2ZDOA 1RK8A 3DLGA 1R0AB 3T1YJ 5F0WA 2HNZA 1RTDB 1FJGJ 3R97A 1WDDA 4WFAQ 3BGRB 2B9WA 5HL7Q 2FZKB 4QWBA 3MUVP 2CPIA 1VRUB 3NGKA 4WTOB 3ISZA 4KYZA 2FVCA 1T03A 1F0XA 1NZAA 3C14A 1NJYA 1M1GA 1JXLA 3MOJB 3KK3B 2DGVA 2PI4A 3E01A 2IM0A 3CCZA 4QU7A 4UT4A 4QIGA 4ZP7A 4ZVHA 4RU2A 5SZTA 5HQMA 1OMSA 3G8TA 4EEYA 1HI8A 4ED5A 1BQMA 3GLJA 2KN4A 3UO0A 2CADA 4P75A 2DIUA 4IH7A 3H5YA 4ILMA 4C3LA 1VQ5S 2AD9A 3MCMA 3G87A 1L3SA 4DX8H 3H7HB 3P3DA 1LK7A 2DXDA 1R8PA 2BJ1A 4CLUA 2E7VA 5KG6A 3CDUA 2C2ZB 4K4TA 5A8KA 1HQUA 3R5BA 1YIJS 2E5LF 2CZVC 2XHCA 3W60A 1U1RA 4QCLA 3HVTA 2QRRA 3OJSA 5B09A 3HVAA 2KH9A 1FNOA 1FRLA 3N79A 5F8JA 5HK4A 4C48A 4N8OA 4O44A 2A18A 1VC6A 1PJ7A 3FEYB 1PILA 1OY9A 4NEZA 2FVRA 2EPIA 2FY8A 4QWEA 3N4WA 2KO1A 3P45B 2C2EA 1RKJA 4JI4J 3CJKB 1VQMS 1P1TA 4XK8C 5H9FK 4LJMA 1Q0NA 4N47A 4C8OA 2E7WA 1S57A 2HK3A 1U2FA 1UL3A 2VPYB 2Y1RI 2V5HG 4JI2F 3GPAA 3HJVA 4IOBA 1RHUB 4LF4J 2ZVSA 1I6JA 1MWQA 4FF3A 3LQVA 2QIFA 1X9WA 3HSDA 4ZJLA 5LXRA 4C8NA 5IT0A 1UVIA 4N41A 3N6NA 2U2FA 3LP1A 1P27B 3HHLD 1AXQA 3TAPA 5DQIA 3M32B 3CTRA 4CO5A 1HLWA 4OZNA 5DQHA 3VAKA 3AB4B 4FYYB 4DXLA 2XSJB 4QW9A 3CO9A 2W2PP 3Q0AA 3CCJS 3CGIA 4OYXA 3KK2B 2MQQA 1U1OA 3M8PA 1LFWA 2VICA 4AFFA 4ZHRA 2LEPA 2ZM6J 4OIXA 5FDLB 4JI3J 2WSFC 1FKPA 2RDJA 4K0KF 3MURP 1S1XA 2IJFA 1N5TA 5KFFA 2HVEA 1VRTB 1D9AA 1DQAA 1OO0B 1IUJA 4NLSA 5ETNA 3DYAB 2M4MA 3NCRA 1FESA 4L6V3 1F5CA 2FY1A 3OL9A 1MROB 3NGTA 1PJ6A 2GV1A 5A6WA 2E1CA 2QL7B 2IBKA 4GKJJ 1UTAA 4O0IA 1RB0A 5CYJA 2IM2A 5CA5A 4KO0B 1U8SA 3KJVA 2JC1A 3B6BA 3MAQA 5GAHI 2D9OA 3HHLC 3R5GA 3DLLQ 4Y6IA 3NGRA 1QJHA 3FFIB 4S0MA 1R7IA 2R2RA 1LWXA 3BR8A 3BGFA 3VVUA 3DCAA 3E01B 2UUBJ 2JFKA 2QLXA 3D4JA 3TZWA 5KT3A 1T9WA 3Q83A 4KGMA 3W9JA 2V8DA 2VASA 3GV7B 4F4WA 4B3SJ 4JI8J 4A8YA 5DG7A 3MTKA 2EFOA 3MPUB 4Q8EA 5F8NA 4KHMA 1UVKA 2XS5A 2WTFA 4OI1A 4J9MA 3T41A 3TOQA 2ASLA 2J7UA 2OPQA 3NAHA 4K4XA 2GQQA 4A46A 2WAQD 4A8KA 2FHKA 3T5JA 1QDUB 1RWOB 2FLLA 2M5YA 3NL0A 3A8EA 3PV8A 2DHHA 4HTJA 3DMJA 4ZVTB 4CLSA 3MEEA 4HI2A 3O2IA 2FZCB 4BS2A 1NK9A 3K5PA 1RU2A 2HHWA 5AT1B 2Z2YB 4QQBA 4CM2A 4MH8A 2VFVA 1N5SA 4OQJA 1GNKA 1AUSL 3GTYX 5KFIA 4LF7J 4G3IA 4NZ0A 3JB9k 3SSRA 4DUZJ 5G4DA 1ZPWX 3A13A 2KXNB 1Q81T 1AFIA 5KG5A 1IKVB 4I2PB 2AYEA 4QYZJ 5KFXA 5KT4A 4F36A 1DTQB 1VR6A 2YKQA 4PWWA 1S48A 3JTNA 4IO1A 4ZVQB 2E44A 2C3MA 3HHEA 2KJWA 3QT7A 4KE5A 4ZVOB 2GVZA 2RQ4A 4N77A 2C3PA 1VIOA 2LMIA 4EGLA 3OBIA 2DH7A 3Q86A 2NPFA 4G1IA 1KDNA 1JLBB 4X66F 4C8LA 3M1VA 3U1MA 4OZJA 5JJBA 1C0TA 3KK1B 1O0PA 3IA0A 1N6QA 2HGLA 4DV2F 4RLEA 2XSJA 3I56S 3AD8C 5KG3A 1G3OA 2N4CA 2K3KA 3G82A 5FD1A 4C3MA 1GMWD 3KTQA 4G6VB 3ILOA 2GAHC 4IO9Q 5LMNJ 4ELTA 5IT9U 2HBQB 4ID5B 2Z0GA 3TAMA 3C15B 3D1OA 4TXSA 2B5JA 4E98A 5L1IA 2JVOA 3DU6A 1VQKS 4DR6F 2F4VF 1ZPVA 1QUPA 4KPYA 5A6PA 1I5OB 4Q44A 4LRCA 1SJ4P 2DHAA 3Q22A 1MWYA 2M70A 4M5DA 1WG4A 3CCMS 1D9DA 1Q7LB 3P8BB 3HF5A 3D5MA 3ET6B 4KO0A 1FA0A 1YBUA 1HBMA 3FQKA 2VG5A 1RHRB 2ZWOA 3HFZB 4CWBA 3MM8A 3CDBA 1O6XA 5A0YB 1JNZB 3OFFA 3UCGA 1S0NA 2VPZB 1HQUB 1U2CA 1WOPA 3JSMA 2EI5A 3CIZA 3K5OA 4FYWB 4LUBA 2JH3A 4WFXA 3DOMB 3M2UA 4DCOB 4DV1F 2AYBA 2Y9HA 2HEKA 2XMJA 3JQJA 5C42A 3IMQJ 2HRUA 2Z58B 3K8WA 4O44B 3DNCA 3HLUA 3DU5A 1GXLA 4IOAQ 2EFVA 1WC6A 2HZVA 1Z2LA 2ZJQQ 1YHQS 4M5IA 2CZ4A 3QSYB 1I94F 3NRBA 1AZSA 3IWLA 3QIDA 4IFVA 1EZZB 3QGGA 3FVYA 3VVTA 1DBDA 1QAXA 2KL8A 4WIQA 2DNZA 3K5LA 5CQGA 1S77D 4DR1J 4CLFA 1NAQA 5AJ3J 2NUHA 2NXNA 2HNZB 3GB0A 3SFUA 4HYKA 3Q8VA 1VBYA 1VQ4S 2UVUA 2KFYA 3BGRA 1EP4B 1FRXA 4UUWA 5E3CA 5KOWA 1T03B 2DJWA 4H4MA 4C0HA 4ED4A 1RAHB 4L3KA 5L9XA 4X4VA 1U26A 5LJ5Y 2CPEA 1NSPA 3H42A 5J2MB 4FS1A 1NHVA 2DRAA 1X5TA 2WONA 1CC7A 1DTQA 5GMDA 2GIFA 1FNMA 3KJNB 4ZA1A 2DPJA 2K8GA 4J9SA 1HI1A 4DL3A 2MGZA 2YKPA 5B0CA 1G1XA 4MIBA 4DR2J 2RKIA 1JKHB 3LALA 1SJ3P 3BM7A 4BWMA 3D6HB 2XCPA 3M6UA 4B3MJ 1HHSA 3OSPA 4B3RJ 3R6GB 4M5GA 4NLYA 3RBZA 1WHWA 4DV6F 1XMQJ 2O01C 5KT7A 1NJIT 1FKOA 4DUTA 2XO7A 1N6QB 1XMQF 5FLXU 4LIWA 2I8EA 3BZQA 1R27B 2C3OA 3FCHA 3R5AA 3D6MB 4L74A 1AROP 5EWEA 3US5A 3MMAA 3THPA 4DSFA 3BQ0A 2CPZA 3M6VA 2PMWA 3MPVA 1Y3JA 2AGQA 4UZBA 4C11A 3MM9A 1Y3KA 4RBTA 2IVFB 4PYAA 2IA0A 3V6KA 3GWCA 3W8GA 4EU0A 4I68A 3KNAA 2EBEA 4USTA 5KFJA 5L1JA 2F9JA 4GO5X 2DR9A 1X4BA 3NOGA 1RHJB 2VD3A 2ZH2A 2FHOB 3ILJA 1NSAA 3NMAA 1S59A 3DRPA 1RT1B 5D6GA 1C0UB 5RUBA 2MKIA 2FJAB 1NDKA 1VBKA 2AYMA 3BREA 5KFGA 4CNYA 1Q5YA 4UY85 1P1LA 3FQLA 1NK4A 2DH8A 2J0QD 1S9EA 4MFBA 1GQEA 3NS6A 2KI2A 1BGXT 3FZBA 3J7YU 3C19A 4EO6A 4F2RA 2G2OA 4YB6A 5LMUJ 1RT7A 2LA6A 4OYIA 4CP5A 2C2OB 2M7SA 1PBAA 5C5JA 4CT8A 3DOKB 5GVQA 2NYHA 1P9YA 3T1HF 1U49A 3KLHB 5M2UA 3LANA 2ZBCA 3I9ZA 4L75A 4EK2A 4B3SF 1RADB 1VIXA 4EWTA 2DGOA 1XMBA 2VDIA 5KFNA 4LSZB 1R8BA 3Q8UA 4F25A 4LQ3A 2ZBRA 2YWFA 4DPUA 1FK9A 8AT1B 4EO8A 1AZSB 3SEOA 1WHXA 2KZMA 1WUUA 3HFVA 4U6PA 4EYIB 1DLOA 4EBEA 1HPZB 1VQ6S 4ZCKA 4NWBA 1XN9A 3CW2C 4I7FB 1H2TZ 1NH7A 4CLKA 3HFKA 2XCAA 2DR5A 5DM6Q 2BQ3A 3LGHA 1FO1A 2VDHA 1SV5A 1W2BR 1H73A 2A2CA 2QX0A 3L3CA 3I4PA 4ZN3A 5HMWA 4ECVA 2GMHA 5KFRA 3EDQB 4ZP8A 5CHCB 2ZH9A 1UFWA 2HFSA 5LSRA 4O3QA 5EHHA 4DF8A 2KTQA 2FQQB 1FEEA 2CNNB 3I6PA 3DGPA 4HH1A 4WCEQ 4FPIA 1R0BG 2BJ9A 1JKHA 2RD5C 4CTAB 4F7VA 5CZVA 2OPQB 4X4OA 1Y10A 1RLCL 1YBAA 3VGUA 5T7LA 3N6LA 1S5ZA 4F0KA 1UWAA 1UW4A 3PACA 1F5BA 2G0JA 1JXEA 5D0EA 2CJXB 2CWXA 2DNKA 4X66J 3H25A 3PW2A 2RS8A 3C6UA 4NRTA 2DT9A 4Z2XA 1FI4A 2W9CA 2C2KB 2MZTA 1KLNA 1GMUA 4DI6A 4J9UE 3RBDA 3GV8B 4OZ3A 5ETVA 4WFZA 4DR3J 1X60A 1RZMA 4FVMA 3R2CJ 2WVCA 1RT4B 2VH7A 1N33J 4TY9A 1FDAA 3H98A 3HSGA 1ULRA 3K59A 1KLMB 1TR0A 1WWHA 2CJYB 3FDSA 1X4DA 1L3TA 1IKYB 4C8MA 1OYDA 2CPFA 1UPPA 3KMSA 2ADCA 4JYAJ 3NNAA 3BKTA 1K0TA 2MQPA 1RTHB 2NQPA 1Q78A 1RHMB 2F9DA 5I3UB 1Z1ZA 5IQ6A 3GIKA 5JVGQ 6FD1A 2UVWA 2DEIA 3J7Z5 2KRRA 5MAOA 4JV1A 3LW5C 2ZH6A 4NMXA 3ZC4A 4F4AA 4HT5A 3KK1A 2ERRA 3GZ7A 1JLAB 3DRSB 1TU0B 1U0SA 4LRFA 2GO8A 2BMBA 2MKHA 4NYOA 3OVSA 3HK2A 1NSKL 1GX5A 4XO0A 4DR5F 7AT1B 3M8ZA 2R4FA 4H4MB 4ICLB 1KVKA 3EUNA 1F60B 3M8WA 4M95A 2R7XA 4FNHA 3VGTA 4HKQA 1JJ4A 3MGJA 1U1PA 3Q8SB 3BBFA 3HD1A 4DX7A 4DSIA 3EZUA 1XR7A 1IR1A 2E1RA 1F3VA 1ZOTA 1D8ZA 1UWBB 2FYXA 2ZKTA 4PG7A 2UVVA 1RLDA 3F44A 2XYHB 1S1TB 1Q86T 3CDEA 2R7VA 1B0PA 1VQOS 1YJ9S 2VG5B 1SH3A 1MN9A 3KHLA 4WYLA 2YKAA 3IC1A 2F4FA 2IJRA 2QYCA 3MEGA 4MKVA 4WXOA 1SV5B 2BW7A 5K5MA 3O1LA 3PW5A 1VQNS 5L9NA 3CPWR 2Z4PA 3G9CA 4RNNA 3PIPQ 3C6TB 1PGZA 2OD4A 2Y1IA 5J2QB 2OHDA 4QPXA 1UW9A 2VJVA 4DS5A 1VQYA 4FKYA 4FVCA 1J5OA 4IRKA 1IM6A 2VZ9A 5CYQA 1S7IA 4OX8A 4RPFA 2DY1A 3CVKA 3O8WA 4X65F 3OJUA 3VAFA 1H6KX 3ILIA 3PRDA 1SQFA 3FEZA 2IMWP 1F5AA 1SUQB 2RILA 4F26A 4OZ2A 2DYAA 3B54A 3KLVA 1NB7A 3FEXB 2BRLA 3GMGA 2QYGA 2NSBA 4FN5A 1LKZA 1T8EA 4DR2F 3OTCA 1N32F 1RT1A 3DRPB 2ATCB 1K1QA 1J5EJ 1IBCB 2W8KA 1T0TV 1GXUA 2HVDA 1VJQA 4ITSA 3THVA 2DH9A 4XPEA 1EP4A 2IMOA 4TY8B 4LBPA 4ZVRB 1KEKA 2WVDA 4MFBB 3MR6A 3RTVA 3QJPA 5ADZA 4WXWA 1D09B 4HHUA 1TKZA 1N52B 2QE5A 3U7JA 1LQ9A 3DRRB 4KQZA 4DFJA 2YNHA 2GHWA 1RAIB 3MOZA 4N7TA 3M9NB 3ENQA 5H9FJ 4DV4F 4NA2A 2CRLA 2NUUG 1MLAA 2V2ZA 3K57A 2RKIB 2J9EA 4Y2CA 2V4JA 3VAHA 1SJFA 1Q8LA 1XR6A 3D1HA 3CJ8A 4WKRA 3UDVA 1RT2B 5K14B 5CAAA 3TP2A 2HS0A 3UR3C 3HHDA 4KJIA 1ZM2A 4DN0A 2KG0A 2IM3A 3G6VA 1R0AA 3NLCA 2HRTA 4USUA 1KP6A 5J2PA 2QL5B 1RTDA 1RAJA 2X7IA 3I87A 2VG6A 2D9PA 4WIIA 4ZPWR 5I3PA 4R8UA 3DRSA 1F9EB 3UN3A 3R7NB 2EWHA 1A6LA 3SBMA 5DG9A 1V3SA 4NLPA 4OX9J 4YB1P 1T9TA 2Z2ZA 5KFDA 1UVNA 4C97A 2IAJB 4TNOA 3UCUP 3W2WB 1S1VB 1NUEA 1TQLA 4HL9A 5G0RB 3MR3A 2VODA 2DR8A 4EBDA 2CDRB 3GJRB 2DNPA 2F4VJ 2AJ2A 3Q89A 4F67A 4QW8A 3HI9A 4XDDA 2WVEA 3DDNA 3CXCR 4B3TJ 1VQ7S 2L41A 3HHKA 4DSJA 2AV5A 5AXLA 4YY3J 5D77A 3Q8QB 2OO4A 3ZZ0A 4A8WA 1GH8A 4JI1J 1S1TA 4NI2B 1V5VA 2R8IA 1CG2A 1PBUA 2FHMA 4Y2AA 2HYIB 1XJWB 4JV0A 4LF6J 3OHAA 1S9EB 3TA0A 3HM9A 2Q6BA 1FJGF 2KM8B 1RWWB 4DL5A 2PIIA 4NCAA 3IFEA 4Y2MA 3R8YA 4LSNB 1CJTA 5KG1A 2G4BA 1E6YB 1CJKB 1U1MA 4LSLA 2EC0A 1XMOF 2E5JA 2DGSA 3CJRA 2L9DA 2L48A 1M5VC 2RSQA 1IWAA 3FRYA 2FHJA 4CYUA 4ZCMA 4U95A 5KT5A 2FVSA 1TL7A 4OI6A 1TK5A 2OH2A 2XNQA 2N4DA 3PO4A 1U6ZA 2CXEA 2BRKA 2CG8A 1H98A 5F8MA 3I0RB 3QIPB 3IGVA 2IRXA 3I4HX 2RU3A 1F9FA 4KH0B 1SIWB 3IR6B 3N5FA 5J2NA 1I94J 1RT6B 1JLQA 3FGVA 3NGSA 1U45A 4E0DA 3MD3A 3NBPA 1NM2A 3KJQB 4IG3A 3DFEA 3BH6B 3PYEA 3QPIA 2QGFB 4DS4A 1URRA 5AJ3F 1RYSA 1RI7A 4RW8B 1FCAA 2JC0A 4ETZA 3LP0B 3NGDA 2YX7A 3NWRA 3ZZYA 3PX0A 2OMOA 4DQQA 4KV8A 5K8OA 2QO3A 3OTDA 2I9SA 2CA9A 3CNQP 3KG0A 2Q1LA 3KFWX 1ZAXA 4OJGA 5HVHA 2XSFA 4ZHRB 4LRDA 3QRPA 2UXBJ 2ZWPA 3IR7B 1C2PA 4TU7A 1FKAF 2XGQA 4I2QB 2UZAA 5T14A 1S1XB 2V50A 4OI4A 4G1QA 1JIHA 2EXUA 3VGVA 4GMKA 2EK1A 2IYIA 5BYQA 3MTJA 1YJUA 5DRKA 1SC6A 2HZAA 3ILLA 3OL8A 4PRFA 2QA1A 3K2YA 4LVOP 2VG6B 4CLPA 1WKJA 3L7UA 4CO0A 4Y2KA 1W26A 5KFHA 2IYGA 1X7VA 2FJDB 1RKIA 3E2EA 3R2DJ 3W1YC 3MM7A 4NLQA 3VWSA 5AE3A 1U7LA 4DPTA 3TA1A 4FXDA 2IC3B 4UY8T 4DR4F 1M5OC 1FWLA 4ZPVR 3ZTSA 4CM0A 2XYPB 1OYEA 5L8RC 2W7OA 1HMVB 2E1MC 1JWWA 3SQGA 5ETSA 1ACMB 2HZCA 3JAMU 3IG1B 4ED7A 1RWPB 1QAIA 2QG9B 5GMEA 4PPZA 1RTHA 3EGWB 2AZ3A 1RTJB 2O3DA 4NI2A 2JHEA 2YNIB 3FNNA 4UQTA 5KAKA 2HFZA 1REVA 2QSFA 3NCQA 3BGOP 3CJ0A 1RBLA 1FDBA 2H9ZA 1AFJA 3MDFA 2BXJA 1ZM3A 1V3ZA 1FTRA 3E8OA 1VK8A 1ROFA 2J8AA 3I5CA 4RKUC 1HWLA 2YX4A 4ZPAA 4LSLB 2P6TA 2RU9A 2ZC4A 3EXCX 3K8VA 1YZ7A 4J9OA 1CPZA 3VALA 1UJ6A 1I51B 2U1AA 2LFVA 3DLEB 1KOOA 3NEKA 2GVDB 4H54A 4B9UA 3M32A 2GS8A 2DTJA 1G7CB 4ECYA 3SCJE 3ZTQA 3OR2A 1QE1A 2YNHB 1K47A 2DISA 2OI2A 3R7SB 4LF8J 1N5VA 3ETMA 4USKA 3TYTA 5GAGI 4TQRA 3D66A 2DXFA 3AOCA 5C24A 1UEKA 2PO4A 1RT6A 2HURA 3FMBA 4MK7A 3EE3A 3A3OB 5F3TA 4DX5A 5MLCV 2CG4A 5DDPC 4K4WA 2BKOA 2FD2A 4M1KA 4OYAA 1FRIA 1KVIA 2I6WA 5AXNA 1KD1T 5IV4A 3AA9A 4HHJA 4NLOA 4JV5F 1AA1B 2JJ4D 3L95X 3CJ5A 5LJ3Y 2OPSA 2BV3A 2XZWA 2FPHX 4J91A 3PKYA 2V2VA 3GSDA 4JP8A 4EMDA 4L73A 2HNDB 3LP2B 1HNVA 1N4LA 1TL3A 4IG0A 2V63A 2COLA 3GIMA 2W4DA 2WSCC 3DRXA 1X5OA 4DV4J 1R8HA 2V0NA 5L39A 4OZLA 1HNXF 2FVQA 4HVZA 3CCSS 4Z7CA 3W5ZA 1RAOA 4RW4B 2FGCA 4ZIWA 3W2VB 4DLGA 2WK4A 1NJWA 1H72C 3D28A 5DO2A 4ZPCA 1Q16B 2AX1A 1U1LA 4RW6A 2CNKB 4KY3A 3A8KA 1FD2A 2W2NP 1VDHA 2Q6CA 1FX2A 2V4QA
chains in the Genus database with same CATH topology
5HLFB 2OSRA 4K5RA 3MFHA 2RDIA 1X0PA 2V8HA 2MKKA 2MZSA 5CCLA 2OMLA 2NS1B 1IKWA 3DOMA 5I3QA 1LW0A 4NOHA 2POKA 4DEZA 1Q1KA 1SH2A 1S0OA 3SCIE 1X4FA 2MKJA 1R43A 2BE2B 3HX9A 1H0HB 4AE5A 3OQ2A 1WI8A 2XMVA 2CQ2A 5B0EA 2F40A 5IT9Y 5FJ4A 3PHEA 5B0GA 3SSQA 4NLGA 5H1SV 5M2RA 2DRBA 2P6SA 3C8YA 4C8KA 3T9ZA 2ROGA 5D4PA 4R8UB 1ZYQA 3T19A 4YFUA 4ED1A 3P96A 2KFNA 1DZ5A 1S0VA 1U1KA 5LSLA 2VQEF 2CQ1A 3V6HA 5EX0A 2HWHA 4HLBA 3KLFA 1NJXA 5HMXA 3PEJA 1NHUA 2R2TA 1U47A 2WOMB 4O4GA 3IN5A 4DSKA 2E9RX 4NA3A 3UE2A 1X8DA 3DLJA 4HTIA 3UW1A 4X4PA 3LWLA 4ZCIA 2RUGA 2X1FA 1HD1A 4TLQA 2JWNA 3ISNC 1IJEB 3DOLB 5CYMB 2F8HA 2ZJRQ 4NXMF 2M0GB 2F3JA 3LAKA 3DI6B 3MR2A 4DOZA 3R5CA 2ASJA 1FVQA 4EZ9A 3BDEA 4YP3A 1SKSA 2ZE2A 1N5YA 3E51A 2BM0A 2V94A 4F4ZA 4KGKA 3KHGA 2OPSB 2GA7A 4JI3F 4H4KC 3GV5B 3HKZD 1TL3B 4IG0B 1TAQA 1OS5A 5A0YA 1HI0P 3OFHA 1RISA 1B64A 4Q0BA 2VC0A 3M30B 5AE1A 4WFYA 4BCAA 5KFYA 2Q79A 4B9NA 2FVPA 1TK0A 2FLNA 4YB5A 3MEDB 2ZD1B 4CQ1A 2JLEA 2L9WA 1TKDA 2AJ4A 1BQNB 1D3WA 5K8NA 1OSCA 3CD6S 3RR8A 2V4RA 3CDAA 2XB2D 3V6JA 2B6AA 1VQ8S 1D1UA 1H2UX 2CQPA 5D4NA 1W2IA 2GW8A 2HHVA 3J7ZT 2NREA 1FRMA 2G0CA 3J7YI 3QJLA 3AQPA 4NCGB 1FEHA 4RUAA 2JZ5A 4G1QB 4DV5F 4OX6A 5LXYA 2XLJA 2MQNA 2W24A 2WONB 3NG8A 5C25A 4ELUA 4C8YA 1LOUA 3HKWA 1IQTA 3KLEB 1IKXB 2DR7A 4NCBA 4NPOA 3V6DA 4WF9Q 2IA6A 3H40A 4PXDA 1ZH5A 1UJ4A 1U6BA 1UETA 1WTFA 3R27A 5H9EJ 3OXGA 3AJ1A 5J1EB 3MMJA 5E2QA 4DF4A 2WBMA 5J1NA 4DSLA 3HHLA 1ZZNA 4N8NA 5BJRA 4PQAA 2YKMB 1IBMF 3BN4A 4OLPA 3V4MA 1WD6A 2CJAA 2DHGA 1HNVB 4EUVA 1UVLA 4FYDA 1HNWF 3FSYA 1SBRA 3I0SB 1VK3A 2AW0A 4KKOB 4JUZA 3LH2S 3BSCA 5KFKA 5KFAA 4NLWA 1BY9A 2XY5A 2BZ2A 1ZZFA 1KQGB 1HARA 5T7LB 2DNNA 4P7VA 4QYRA 1BLUA 4ZK7M 4DFKA 4QIVA 2EFNA 1U4BA 3N28A 4C9DA 5JVHQ 3MM6B 2A10A 5HLFA 5F9NA 3VR1A 4NLTA 4C3KA 5KFMA 1T3NA 3ITHB 4O3OA 2E5HA 4X64F 2ZH3A 4F4KA 3M30A 4I6AA 1IKWB