4RW9B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B03
4TY8B 4KBIA 1RT6A 1DTTB 5KFDA 2IC3A 2WOMA 3RB0A 4NLUA 4ECZA 4LQ9A 1TQLA 2OPPA 3IG1B 1JLFB 3V6DB 3MR3A 2WCXA 2C2RA 1JLGB 4O3PA 5EDWA 1TKTB 3CIZA 3IS9B 2B6AA 2JC0A 2W9BA 1HYSA 3KLFB 1VRUB 1SH2A 1U09A 3I0RA 1LW2A 1S0NA 1S1VB 2AQ4A 2JC1A 4DL4A 3KLHA 3KK2B 5CYMA 4U7CA 3OL6A 2AU0A 4O44B 2YNFA 5J2MB 2FJWA 4RNFA 4RW6B 2O5DA 2FLLA 2JEJA 1EP4B 5J2NA 4ZVHA 3KLGA 3PHEA 4NLYA 2BE2B 3H5SA 5HBMA 4EYIB 5F8NA 2FLPA 1HNIA 2BR0A 1S6PA 4LSLB 3DLKA 1NHVA 3NAHA 1I6JA 1DTQB 4Q0BA 4I7FA 5C42A 2QE5A 4K4WA 3M8QA 4KV8B 3M8PA 2BQUA 4Q8EA 2VG5B 5KG6A 1RTHA 4PUOA 1C1CB 4KHMA 4QWEA 2QV6A 1SUQA 1JLQA 5KFUA 2UVRA 3D28A 3Q8QB 5I3UB 1RT7A 1REVA 1S1UB 5HROA 1RYSA 5L1JA 4WE1B 5KT6A 4ECSA 1MU2A 1TKZB 1N4LA 1RT2B 4KO0A 4RW4B 1T94A 2UUTA 3FQKA 4R8UA 3Q8PB 3KHGA 1WNEA 1UWBB 5KFIA 3C6UA 1RT1A 3DRPA 2FVSA 3I5BA 3GYNA 3V6HA 2R2TA 4KB7A 3H5XA 4NLPA 1S1WB 2XI2A 3TVKA 3IGVA 4NLSA 1R0AB 4K50A 1RT5A 3PW4A 3RAXA 4HKQA 3EPGA 2HNDA 2ZE2B 4NLTA 1JLEB 4ECWA 1BQNB 2R8JA 4TYBA 3PW2A 2IA6A 2IM1A 1J5OA 5D3GA 1JIHA 4RUAA 1RA6A 4ECTA 4ZPAA 2WONB 1GX5A 3SI8A 1S10A 4K4ZA 3CO9A 4F4XA 4DL6A 3QYYA 3DRSA 2V9WA 4O4GB 5KG5A 5DQIA 3MEGB 4G1QA 4NLXA 3IGNA 1RAJA 1LWEA 2RF2B 1T03B 1RTDB 3M9OB 1LWFA 4ECUA 3E01B 1IKXB 4RW7A 4KKOA 4IKAA 3FDSA 4I2QA 4J9MA 1TL3A 4TY9A 4RNOA 5KFTA 2E9ZA 5J2PA 4TXSA 5DGAA 4I2PB 3PZPA 3QLHA 3JSMA 2OPQB 3TAMA 2FJXA 3MTKA 4YR2A 4B3OA 4RUCA 3CWJA 1CSJA 1IKYA 2BQRA 2VG6A 1LWCA 3KLIA 2IJNA 1HPZA 3DLGB 4NLRA 2W9AA 5C24A 2XWYA 3DI6A 1RTJB 3MR2A 1C0TB 2OPRA 4NYZA 5KT5A 1TV6A 3BSCA 4GC6A 1TVRA 3NMAA 2XGPA 2ASDA 5HLFA 2W7PA 1S1TA 1HARA 3DYAA 2YKNA 1RTIA 4Y34A 2J6UA 1FK9B 2AX0A 2V4QA 4Y3CA 1S0MA 2XC9A 3EPIA 3NBPB 4K4SA 4WZQA 4IG3A 3DLEB 2J6SA 1KHVA 3DOLA 3KLEB 1JLBB 1JLCB 3OHAA 5J1EA 5F9LA 5T14A 1IKVA 2E9TA 1VRTB 5KG0A 3DM2B 2ILYA 1BQMB 1FKPB 3CDEA 4YMEA 3LP0A 5DG9A 4J9OA 4URQU 4H4OA 2I5JB 2JEIA 4K4XA 3KK3B 4PQUA 2V0NA 5JUMA 3LALA 3QO9A 1SV5A 3QIPB 3KMSA 3PW7A 4IH5A 4RZRA 2GIRA 3MEEA 2D3ZA 1HMVB 2UVVA 2OH2A 4ZMMA 4DL5A 4ECYA 2WHOA 1LW0B 4KFBB 3T19A 3FSIA 1D0EA 3KHLA 4F4WA 1S49A 2VG7B 3T5JA 4ZP6A 1ZETA 2YNIB 2UVWA 4RW9B 5KFMA 3GIIA 3PJXA 5KG7A 4IDKA 1C0UB 4IG0A 3SFGA 4RW8B 4RNNA 1JLAA 3G86A 3DRRB 4O3SA 1D1UA 4ZHRB 1HQUA 3V6JA 1QE1A 2BRLA 3UPFA 4DG1A 1KLMA 4LSNA 1K1QA 2J6TA 4MK8A 4RNMA 2YKMA 1RT3B 3HKWA 3RB4A 2DPJA 2DPIA 3KJVA 2HNYA 2ILZA 2ZD1A 3V81B 5KFNA 4H4MA 3BJYA 2R8GA 2B5JA 5KT4A 5DQHA 4QWAA 3CJ4A 1QAJA 2GIQA 3HVTB 5C5JA 5J2QA 5DG8A 3N6MA 4NCGA 4IFVB 3CJ3A 3CVKA 4ZPDA 2XCAA 1S1XA 3BGRB 1FKOB 2CKWA 1RT2A 4IFYA 3RB6A 2HMIB 3E51A 2OPSB 1XR7A 5KFAA 1EETB 5L1IA 3M9MB 3KMQA 4HYKA 5KFQA 1S9GB 5CYQB 3OLBA 4ICLA 3LP2B 1S48A 3D5MA 4PWDA 3KHHA 1T05B 3IRXB 1BQNA 3I5CA 5C25B 5L9XA 2IAJA 4TN2A 3CJ0A 5HP1A 1RT4B 2AGPA 4WXWA 4EBCA 2BQ3A 3JYTB 4NLDA 3MEDA 3MR6A 1IKWA 4JV0A 4WFYA 2AGQA 5KFWA 2R8KA 3MECA 4KHRA 2IM2A 3NGDA 1TKXA 5F8IA 4DL3A 4ZVEA 1TL1B 2ASLA 4RNHA 1S9EA 2YNGA 1S6QA 2C2DA 1RT6B 2HWHA 3QGHA 1S97A 2IC3B 2WOMB 4J9NA 4URGA 1HQEA 5KFLA 2OPPB 4EYHB 4F4ZA 3VQSA 1KHWA 4TYAA 2XI3A 2B6AB 3KOAA 2W9BB 4ID5A 4YR3A 1XR5A 1HYSB 4MKAA 3T5KA 4TQSA 2FVQA 4OL8A 3T5LA 3I0RB 1LW2B 3G6YA 3C6TA 4JV2A 4ED2A 4ED8A 2WTFA 3QGGA 1NNDA 2YNHA 2FVCA 3KLHB 2IM3A 3RB3A 5CYMB 3MFIA 3H5YA 2YNFB 3T5HA 4YP3A 2W8KA 3KNAA 5J2NB 4R5PA 3KLGB 4FS1A 1C1BA 5HBMB 5JXSA 2BANA 1HNIB 3SFUA 4J9PA 1S6PB 2UUWA 3DLKB 4FS2A 3LP1A 4Q0BB 4I7FB 5C42B 3FFIA 3M8QB 3BQ0A 3DOKA 3M8PB 3KK1A 3MR5A 3FQLA 4YQWA 1DLOA 1RTHB 4PUOB 1N56A 4YR0A 3NKYA 1SUQB 1JLQB 3BSNA 4GC7A 2C2EA 3OLAA 1HNVA 1RT7B 1N6QA 4MIBA 4ZVFA 2WRMA 2W9CA 5FDLA 1REVB 4Q43A 5HROB 3G6VA 3OSPA 5KG3A 2WB4A 1MU2B 3V4IA 4KO0B 2RKIA 4R8UB 4J9LA 4NLWA 1N5YA 3V6KA 2R2SA 3C6UB 1RT1B 3DRPB 3I5AA 3ITHA 5KFKA 5K14A 4QW9A 4R0EA 3Q8SB 5KG1A 1RT5B 5KFZA 3GIMA 4Q8FA 5EWFA 2HNDB 3DMJA 2R2RA 4IH6A 2R2UA 4NLGA 3PW0A 2W7OA 3H40A 4ECXA 4MFBA 3BREA 3NAIA 5I42A 2V4RA 2HNZA 4K4VA 1NHUA 3I0SA 5KFEA 5D3GB 1J5OB 4TY8A 4ZP8A 3M9NB 5EUHA 4QW8A 3OL7A 4M95A 1DTTA 2W8LA 2IMWP 3UDLA 1S9FA 3DRSB 3IG1A 3V6DA 1JLFA 4G1QB 2D3UA 1JLGA 1LWEB 1TKTA 2VA3A 3IS9A 4JUZA 4ED1A 3GQCA 3N6NA 4Q44A 1LWFB 1OS5A 4RW7B 2C28A 4KKOB 3KLFA 5KFFA 4I2QB 1VRUA 4O4RA 1TL3B 3QIDA 4KE5A 1S1VA 5J2PB 1GX6A 5KFGA 4DL2A 3OHBA 3KK2A 3QLHB 3JSMB 3TAMB 4O3OA 4O44A 4EEYA 5J2MA 4B3OB 4RW6A 3GILA 4JV1A 1EP4A 1IKYB 2VG6B 2BE2A 3NL0A 1LWCB 3KLIB 1HPZB 4EO8A 4MK9A 3LP2A 4LSLA 5KFHA 5C24B 1QAIA 5KFVA 2ALZA 1DTQA 3DI6B 2OPRB 1TV6B 1TVRB 4KV8A 2R8IA 2HWIA 2VG5A 5HLFB 1S1TB 3DYAB 3H5UA 2YKNB 1RTIB 4NLOA 4ECVA 1C1CA 3CJ5A 3MF5A 3KLVA 2I1RA 5I3UA 4IG3B 2C22A 4IR9A 3DOLB 4XPCA 1S1UA 3GV5B 4WE1A 5J1EB 4XO0A 1C2PA 1TKZA 3LAKA 2AX1A 3BSAA 4ED6A 1S0OA 1JX4A 4RW4A 4FBTA 4IRDA 1IKVB 5EWGA 4TLRA 1UWBA 4NLQA 4J9QA 1Z4UA 4K4TA 4DL7A 4XPEA 1IM4A 1S1WA 3ICLA 5F8GA 3LP0B 2XCPA 1R0AA 2ASJA 4H4OB 2ZE2A 4PQUB 1JLEA 3QO9B 1SV5B 4QWCA 2F8EX 3CDUA 2GC8A 2D7SA 3MEEB 3DDKA 4IR1A 3FRZA 1XR6A 3ISNC 2FJVA 2WONA 3UQSA 4LQ3A 1N48A 2ATLA 3H2LA 1JKHB 2CJQA 3RBDA 4O4GA 3MEGA 1K1SA 2IJFA 3PJWA 4RU9A 4IDKB 4IG0B 2JLEA 1JLAB 2RF2A 1T03A 1RTDA 4MKBA 3CDWA 3HHKA 2BRKA 4O3QA 1HQUB 3E01A 1QE1B 1IKXA 4MK7A 4DG1B 1KLMB 4LSNB 5L1KA 4J9SA 4IOBA 3OSNA 2YKMB 1TP7A 5KFSA 5DGBA 3KJVB 2HNYB 4I2PA 1ZTTA 1MMLA 4ZVGA 2EC0A 2ZD1B 2OPQA 4WYLA 5F9NA 4H4MB 2AWZA 2B5JB 3HVWA 4WXOA 4WFZA 4WFXA 4ZP9A 5KT3A 2FLNA 4QWDA 3DLGA 5J2QB 3H98A 2XGQA 2R8HA 4NCGB 4ZPCA 3QZ8A 4WZMA 3KHRA 3OL8A 1S1XB 5L1LA 1RTJA 4IFYB 1C0TA 4NZ0A 5F8MA 5KFPA 4IRCA 2IM0A 3H4DA 3N6LA 4FBUA 2FVRA 1FK9A 2VA2A 4ICLB 5KG4A 5KFXA 4PWDB 3NBPA 5KG2A 3DLEA 3QGIA 5KFOA 3KLEA 4K4YA 1JLBA 1JLCA 1SH0A 3PR5B 2IBKA 1SH3A 3IN5A 2RDJA 1RYRA 2IAJB 3UR0A 3T1AA 5KFBA 5HP1B 1VRTA 3DM2A 3MEDB 1BQMA 1FKPA 4Q45A 1JXLA 1IKWB 2JEFA 4IRKA 3RBEA 2I5JA 4ECRA 3MECB 3KK3A 4O3NA 3ISND 1TKXB 4O3RA 3Q8RB 3QIPA 3CJ2A 3BSOA 3PW5A 1S9EB 2YNGB 4J9KA 1S6QB 3H4BA 1HMVA 4IQXA 5DLGA 5DG7A 4KSEB 4WYWA 4QWBA 5EWEA 1LW0A 4KFBA 5DQGA 2E9RX 1HQEB 4MH8A 4NLVA 5F8HA 2VG7A 4NRUA 1T3NA 2YNIA 4RW9A 4K4UA 4ID5B 1C0UA 4NRTA 2FVPA 4RW8A 5KFCA 4J9RA 4H54A 4MIAA 3DRRA 4EBEA 2ZKUA 4Y2CA 1RA7A 4ZHRA 4F4YA 3C6TB 3EZUA 3BQ2A 4EBDA 3TQ1A 1YVFA 4KAIA 3GIJA 2YNHB 1ZTWA 1RT3A 3BQ1A 2B43A 4ZP7A 5KFYA 1S4FA 3G6XA 4F50A 4R5PB 5KT7A 3V81A 4ED7A 1RDRA 1C1BB 2RDIA 3GIKA 2BANB 4ED0A 2JEGA 3LP1B 5KFJA 3HVTA 4EO6A 3RAQA 3FFIB 4IFVA 4U6PA 3DOKB 1W25A 3QZ7A 3GV8B 3KK1B 3BGRA 3LANA 1FKOA 4DEZA 3LAMA 1DLOB 2HMIA 4URSA 2OPSA 2D41A 5KFRA 1EETA 4M94A 1HNVB 1S9GA 5CYQA 1N6QB 2AGOA 3OL9A 2W9CB 5FDLB 3PVXA 5DLFA 3HVAA 3MFHA 4TQRA 5F8LA 1T05A 3V4IB 2HAIA 2RKIB 4IH7A 1N5YB 3IRXA 5F8JA 3ITHB 5C25A 1QUVA 4X2BA 1RT4A 5K14B 3JYTA 3H59A 5KT2A 3DMJB 3GV7B 4ED3A 1JKHA 4MFBB 4QPXA 3BR9A 2UVUA 4G3IA 5I42B 2WK4A 2HNZB 4Y2AA 4ECQA 4ZPBA 3PR4A 3I0SB 1TL1A
chains in the Genus database with same CATH superfamily
1RHRB 3SV3A 1BWEA 1EQ0A 1AW0A 4MIWA 2AEJA 5GAEI 3QAEA 5IM0A 1UJ5A 2MJUA 5D6GA 5CYMA 3R7SB 1RZMA 2MQ8A 4DV4J 2FLLA 3H8YA 1YIJS 3N5BA 2YY3A 4J5OA 4LSLB 4PWUA 1I6JA 4U96A 5KAKA 4Q0BA 1VQ9S 2L3MA 2G2OA 2YQ3A 1SIWB 1ZM9A 1RYSA 2E7XA 3QT7A 3CD0A 2OSRA 4USKA 1TK5A 3RAXA 2QG9B 2ZE2B 4DFKA 4UUXA 3ZZYA 2FD2A 4KGXB 4RPFA 2CQDA 1U1KA 3K8WA 3TUZC 1LWEA 4IKAA 4I2QA 1TL3A 3R1LA 5LSLA 4B3OA 3CJQA 5E3QA 1IKYA 2DY9A 2BQRA 1YWXA 2V63A 3N9UC 1NZ8A 4DUYJ 1C0TB 1L3SA 4BS2A 4I6YA 1S1TA 4A4JA 3TAPA 4U7UD 2RSQA 1S0MA 3DLEB 1S59A 2JFDA 4DOZA 3WIUA 3VWSA 3VAKA 4YMEA 3HPOA 4PAAA 3KNGA 2V0NA 2C2OB 5E41A 3GWCA 4FYWB 4GKJF 4F4WA 2VG7B 4RW9B 2E1MC 4EUVA 2DRDA 3QPIA 2NXNA 3HKWA 1NDKA 4N41A 2X1AA 5FIIA 4QWAA 2VQEJ 2XCAA 3N4WA 1NB7A 3TA1A 3T1YJ 1VQSA 5CYQB 2ZVSA 2GVDB 4W98A 3IR6B 2PFFB 5BYQA 3SCIE 3M8RA 4N76A 4WFYA 2ZH6A 1SJQA 1TKXA 3FJ2A 2BABA 1SKSA 4Q5VA 1RT6B 4DR7J 5L8RC 2IBOA 3CEDA 1CJVB 3TJAA 2D3OR 4TYAA 3I6PA 1NUEA 1RWXB 4MTPA 2CZVC 1Y5IB 1C1BA 3W64A 1TL7B 1C4AA 3KK1A 5IS2A 4P2XA 3AD8C 1Y10A 2IHR1 1RAIB 2DY1A 4Q43A 5IV4A 2XM3A 2HHQA 2DT9A 2J0QD 1T9UA 3GIMA 2AKWB 3MMBB 5IT9Y 3OFGA 2UV8G 1FXRA 4N77A 2XMVA 4WU2A 1KEKA 3I56S 4NXNF 4JUZA 1NU4A 2VL1A 2AV5A 5EX3A 1TUVA 3HK2A 2AP6A 3WZ0A 2ZH7A 4MK9A 2VFRA 2CG8A 2DNRA 5A6WA 3AY0A 3Q2TC 2VDHA 2B9YA 4YY3J 4U8YA 5HATA 2XMTA 1Q8IA 4WTOB 3TEGA 4FBTA 4DFPA 4MYTA 1UWBA 1VQNS 2IMOA 1YX2A 4C0OC 1VJQA 3DLHA 1R8PA 4AYBD 3H2LA 4LFCJ 1G4CA 5HVGA 3MEGA 2BMBA 2C3UA 1YJNS 1SQFA 4DG1B 2BKPA 3NGSA 2YKMB 2EC0A 1S76D 2BBEA 4ZP9A 2EXUA 5KT3A 4NCGB 2KHCA 3OL8A 4DV6F 3TYTA 5A76A 1SH0A 3PR5B 3MPWA 4DCPB 5HP1B 5ETVA 4QIGA 1R0BG 4B02A 4E98A 1Q4RA 2DNKA 1JK9B 3LGMA 2WVBA 2XTJP 1PBUA 1WHYA 4ILMA 1CJTA 1RLCL 1OPZA 3M8ZA 4ID5B 4K4UA 2FVPA 2NXJA 4UZCA 3VGTA 2R42A 3GIJA 2B43A 1NLKL 3HM9A 4ZCIA 2F4VJ 3V81A 2OMLA 1Q0NA 5BJRA 3DGPA 2ZH2A 4OYPA 3QZ7A 3BGRA 2K7KA 4B3SJ 1XMBA 1PSDA 3MD1A 3L7UA 1T05A 3V4IB 4B9UA 5K20B 2BJ3A 3T1HJ 3TA2A 3R5BA 3GYXB 3ILJA 4ZKAA 4X66J 1B7YB 4HDGA 4RWWA 1HI8A 3U1MA 4DLGA 2WOMA 1GXUA 4RO0A 2LQJA 4CH0S 3THVA 4DSIA 2W9BA 4UF4A 3QRPA 4DV7J 4NMLA 2WVDA 4I64A 2H3EB 3VGUA 1DQ9A 2WB1D 3OL6A 3G6ES 2ZH4A 3CCMS 2O66A 1YK9A 1X9MA 2HFSA 1AT1B 1DTQB 3VAHA 2AD9A 2R7VA 2QV6A 2UVRA 4DHVA 1VR6A 2HHTA 3JTNA 1R8HA 3FQKA 4OIXA 5BYSA 5A0YB 4F3MA 3EPGA 2HNDA 2CJAA 1JLEB 4DR2J 4USIA 3D0IE 1R27B 5HMXA 2IA6A 5D3GA 4DXLA 1I94J 3HHNB 2IFXA 4JYAF 4CRJA 4TY9A 2UXCJ 5KFTA 5J2PA 4KT0C 2ZJRQ 4M5KA 5AXKA 1UVMA 1LWCA 1HPZA 4PQAA 4DSKA 2W7PA 3DYAA 4Y3CA 4LF4F 3DOLA 2E9TA 1O51A 3CCVS 2GIFA 4PEOA 4OYBA 3K5PA 3AJDA 2HZAA 1WHWA 1M90T 2D3ZA 2CPHA 1EB0A 2WHOA 4A8WA 1D0EA 1Q7YT 1FRHA 2HVDA 2RD5C 3G86A 3DRRB 2BUNA 1FJCA 1JJCB 1WKKA 4A8KA 1T0TV 1OQ3A 2HHHF 2W25A 5KT4A 4DCOB 1HWUA 3CJ3A 3BBBA 3E51A 3SYZA 5D0RA 4ZK7M 4DPUA 5KFQA 4OJ3A 4DQPA 2GVZB 5JVGQ 2QSFA 2CPFA 2PSZA 3RUBL 3BBFA 4RNHA 2DNYA 2L9DA 2AJQA 1CVJA 2KJWA 2MGZA 4CP5A 3MM7A 1G6BA 4TQSA 4K0KJ 3TANA 4JI2F 3QGGA 1ZM4A 2IM3A 4C7QA 2B4VA 2PMWA 5HVFA 2NZCA 1U4BA 3FQLA 4O23A 1N56A 1SUQB 1RT7B 2WRMA 1REVB 1RHMB 4DV3J 1LKZA 4R8UB 4OI4A 3V6KA 3HJFA 3B82A 3MM5B 1R0CB 2LMIA 4IOCQ 1FKAF 2UXBJ 2XMJA 2HQIA 3DRSB 2B3TB 2MHNA 2DR6A 2ZUGA 2HVEA 1NSAA 3CCSS 4FYDA 5KFGA 5JJBA 2V6AA 2J7UA 4JV1A 4M5JA 1REGX 3GZ7A 2CZ4A 4PXBA 3JQKA 3CUNA 4LSLA 2ALZA 4LRAA 4UOHA 3TZWA 1RWWB 1PAUB 5CYJA 1ZAXA 3SSSA 4GVLA 3NGRA 3OFFA 2QL9B 2AX1A 3BSAA 1FI4A 2JVRA 2KT3A 3WX4A 2ZE2A 1NKCA 3U02A 1HL6A 2KO1A 2FZCB 4JBCA 1U45A 3QSIA 2JLEA 1N5VA 2BRKA 4CLKA 1HQUB 4J9SA 2E5LF 2XS2A 1S6UA 2ZD1B 4WYLA 3EXCX 5D4PA 3RTVA 2ZC4A 1WTFA 4DSJA 4C8YA 1U26A 1C0TA 1O5JA 3MI7X 2DGXA 1FEEA 3DLEA 2HHUA 1ULRA 2HIYA 2VPYB 4P74A 2F3JA 4F4KA 2E44A 4CM2A 1IKWB 4J90A 3ISND 1ITPA 3PW5A 1S9EB 2CWKA 3EMTA 2DNPA 2VG7A 4OHWA 4RW9A 5F3ZA 5B7WA 3BB5A 3I96A 2K8GA 1XMQF 3TQ1A 4LBIA 1X0FA 3PRBA 1XTZA 3FZ2A 2HFZA 4LMZA 4X4QA 1WJ9A 4DR5F 2CQ0A 4UT4A 1UEKA 1RK8A 2R7WA 2BDPA 3NLCA 1NXIA 5CYQA 1LOUA 2NZ4A 2GVDA 3BM7A 1KQKA 1UFLA 1WSVA 1U1NA 2VKZG 4CM0A 2MKKA 2GFFA 4QPXA 1Y5LB 4YEAA 1RT6A 1VQMS 1QLNA 2B7BB 1CJVA 4N5SA 1J5EJ 3K7RA 4IOAQ 2AJ2A 2BA9A 7AT1B 3JXOA 2AZ1A 1M5OC 1DBDA 4U7CA 4FP9A 4RW6B 4ANEA 1BMQB 3D6FB 3GB0A 2HHXA 5EX0A 1TL7A 2HFNA 3SBMA 4OZ5A 5C2GA 1IJFB 1VQ4S 3PYDA 3BKTA 2E7WA 1H2VZ 2HFOA 1I5OB 4LF6J 1X8DA 5KT6A 1TKZB 4DX7A 4DV2J 3MMBA 3VZIA 2GV1A 3MCMA 3PO5A 1B3TA 1KC8T 2R8JA 1VBXA 2IVMA 1JIHA 3HX9A 3WIVA 1SVDA 3BH6B 4OX8A 5KG5A 4DZDA 2JX2A 2RJZA 5B08A 3UCUP 5EHHA 2QA2A 5DDRC 1CULB 1NPRA 1KBRA 2MZTA 4YR2A 1NO8A 2XS7A 4ATNA 2QL5B 3SDEB 4Y34A 2HBQB 2GMHA 1S5ZA 1FHTA 1B0TA 5DG9A 1UA1A 3TA0A 4XK8C 3KMSA 3G96A 5H9EJ 3TJ8A 3KHLA 3KDOA 4G6VB 2DNHA 2CNKB 2UVWA 2A6MA 5KFMA 5KG7A 2VODA 2XS5A 4CNYA 2KVQE 4DQQA 3UPFA 2BRLA 1T11A 4DG1A 1K1QA 5HQMA 4DQRA 2YKMA 3RB4A 3T6BA 3PYEA 1TUGB 2ROEA 2DD8S 5DG8A 4NCGA 2ZZMA 5DDPC 4P72A 1Q81T 3W61A 4ENOA 2CVIA 3M7VA 2ZM6J 2VDIA 3GSDA 2M7SA 2MY8A 1BC6A 5U47A 3HCXA 5HP1A 4EBCA 2CQHA 4DQIA 3L3CA 4BC7A 3H20A 3UE2A 3VF0B 4ZVEA 1TL1B 5F8IA 5K8NA 1UA0A 4URGA 2OSQA 3CB4A 1TFWA 4ID5A 4L73A 3ILIA 3OT9A 1HHSA 3MFIA 4TKTA 3KLGB 4DFJA 5FD1A 4JI0J 3BS9A 2B4UA 2P9EA 2AJ0A 1X31C 2PIIA 4ZVFA 3OSPA 5HROB 1MU2B 3V4IA 2R2SA 4A47A 4R0EA 2DEJA 4Q8FA 2W7OA 1BE4A 3EVWA 1PILA 5HO4A 1HWJA 5D4LA 2I8EA 1X4CA 3FZBA 3F73A 2HRTA 4EEYA 3G82B 4F3OA 3AJ2A 2NPIA 2XG8A 1X4DA 3IAM9 1DTQA 4BWMA 3UDEA 4NLOA 4ZPWR 2SXLA 3G8QA 1S0OA 3LAKA 3EX7B 3PFEA 1IKVB 3HHLB 5A0YA 2OAUA 4XPEA 2XCPA 2Z4PA 5L38A 1Q95G 1JLEA 2ZH3A 3QO9B 4LR7A 2BX6A 3OD2A 3R2DJ 3PJWA 5B0DA 2G1DA 4PXCA 3OSNA 1N5TA 2FZGB 3QWPA 1SC4B 5IWAF 2LQ5A 4H4MB 5J2QB 1S1XB 3HF5A 1AZSB 5KFPA 2W2MP 1VYAA 1WSRA 4N8NA 1HD0A 4WBFA 3QJJA 2CQPA 2V2VA 5ETMA 8AT1B 3R27A 4O3RA 3HZGA 4OX6A 4LVOP 4QWBA 4PG5A 1V5VA 2IDEA 2G4BA 3DRRA 2C1EB 2ZKUA 1YVFA 4BDPA 2QTWA 3FK4A 1QY7A 1NH7A 5ADZA 3OVSA 5KFJA 1X4EA 1W25A 1K44A 1GT8A 4G1PA 2KH9A 1N6QB 5FDLB 4TQRA 2GVZA 4P75A 1FT8A 5K14B 4FF3A 3DHWC 4FYYB 1TMMA 4ED3A 4ED4A 2PI4A 2GJFA 3Q83A 1TR0A 4YN3B 2ZNYA 1SC3B 3H90A 1WD6A 5AXNA 2C2RA 3V6DB 1JLFB 5EDWA 2MKYA 3UD5A 2FLOA 2VBYA 2UUBF 1MMDA 5J2MB 2Q79A 3SIPB 2QIFA 2FLPA 5K9FA 3FRYA 5LMUF 2DGVA 1F3FA 1SUQA 1WF0A 1RT7A 3O6QA 1M5PC 1REVA 4WE1B 3CD6S 3NG8A 3T1YF 1YI2S 2J5AA 4R8UA 1IJEB 4KY3A 3MM5A 4ZCLA 1SCJB 1XBWA 3BKUA 4K4ZA 4ZPAA 3D0HE 3UN2A 5ETOA 3DRSA 4O4GB 4NYOA 1JJHA 3EYZA 1Z2ZA 3FDSA 4I2PB 2NXUA 3MTKA 4FDFA 3ZTOA 4DJBA 3R5DA 1N54B 1X0PA 1S57A 1FA0A 4NYZA 3VGVA 2ADBA 4YDDB 2XYGB 1HARA 1OPIA 1VC5A 3FMWA 1U1LA 1KHVA 1FE0A 2ZWOA 5A8RB 2M8HA 1ZPVA 4F36A 4D3GA 3KDNA 3GJTB 5E3CA 1EX8A 3VZHA 2I5JB 2BW2A 3J7AN 2KU7A 2ZC3A 1E6YB 1CC8A 4KFBB 4KYZA 4LREA 4RNNA 2ZFHA 4WIIA 4ZHRB 1HQUA 1FDDA 3MD3A 1U1PA 2YPZA 1N8RT 2DH8A 2AYGA 1WEYA 3MOJB 1RBAA 3CJKB 3LPYA 5GAHI 4TU9A 2ZD1A 3GLJA 2EG1A 3EXYA 2R8GA 1VLYA 4P2FA 3PG9A 1RKIA 2FJEB 3PFOA 2UXDF 3J80U 3M9MB 3FSXA 3OLBA 3JQJA 5ETSA 1BHNA 4YY3F 1RACB 5C25B 2KZMA 4LR9A 4IQMA 2O01C 4FZVA 4XIUA 1IKWA 2AGQA 2XZDB 1U47A 1OO0B 1S9EA 5LL6d 2IC3B 1WC1A 3W9JA 2WW8A 2P2CB 1S79A 1XR5A 4OL8A 1YITS 5A2QY 2WTFA 3RB3A 1S0VA 4E8UA 3THTA 2VBZA 3MPVA 4FS2A 1L5UA 2F8HA 3M8PB 4WPAA 1KFSA 2RQ4A 3PIPQ 2DGSA 2MKSA 3W5YA 2JL9A 2G9OA 3QQCD 3G6VA 1LV5A 4J9LA 5ITHA 4KRWA 4CT9A 5K5MA 3QRRA 5D4OA 3IR7B 3Q8SB 2XLIA 3NAIA 1V3ZA 4FF1A 3MEKA 3P45B 4V19J 4ZP8A 4QW8A 4DBQA 3CTRA 4CO3A 1U2RA 2BKNA 3RRKA 2DVIA 3N6NA 1OS5A 5CAAA 4KKOB 3KXDA 4CNZA 1T8EA 3BDPA 4M5HA 2PE8A 1Y0HA 4RW6A 4OHYA 1YHQS 2VG6B 3CC2S 2KXHA 5KFHA 5C24B 2CPDA 2QLJB 4XDDA 2R8IA 3CJ5A 1FRLA 3LGNA 4LUBA 4CTAB 3I55S 1SJFA 1TKZA 3N0VA 1P6TA 1QSYA 2DHAA 3ICLA 5F8GA 2CPEA 3ZNUA 4B9NA 2EKNA 2FJDB 2P9GA 3DDKA 1JJ2R 2OD4A 2KFZA 3RBDA 3UNYA 3HHLD 2CYYA 4JI4J 1HW9A 5E0OA 1CULA 1X4FA 2B5JB 1FDNA 3GFYA 3FUYA 2XGQA 5BXIA 4NZ0A 3E2EA 1KTQA 2MTLA 1FRIA 3SDEA 2NCKL 5F3TA 3ZTPA 3W2WB 1IXKA 1HNXJ 5EN1A 4YFUA 3P4UB 2EKYA 1XNRJ 3H4BA 5GVQA 3UN3A 3C15B 4CO4A 2BOAA 4DR2F 1FNMA 2B9XA 1BXNA 3I32A 4NRUA 4IO9Q 1Q7LB 1UVIA 4LF8J 2Y1LB 4M5NA 2LVWA 1KP6A 2MQNA 1P27B 2FZKB 2FY1A 2HBZB 1PYTA 4UZBA 2HRUA 2ZHBA 3F41A 2ZDOA 4ILLA 1YJ9S 2GGPB 2R7RA 2MQMA 1KKHA 1DURA 4Y2AA 4JI5F 3PR4A 3I0SB 1TL1A 3V2UC 3FCHA 2V2ZA 1LQ9A 4LQ9A 2AJ4A 1TELA 2B8PA 4ETZA 2MSSA 1UW4A 5RUBA 2AU0A 4O44B 3HFVA 3KLGA 4ZJQA 3H5SA 1IBLF 2QLFB 1Q82T 5MLCV 1OY9A 2M70A 3A3PB 4ILRA 3UR3C 5KFUA 3O44A 3NRBA 1R43A 5HROA 1MU2A 5CZXA 4X62F 2UUTA 1U2CA 1BQXA 2AYMA 5ETTA 3V6HA 4ZJOA 2G2ZA 2XMKA 4HKQA 3MWBA 2XSJB 1T95A 1M1HA 2CJXB 1U1MA 3MPUB 3IWLA 5F0WA 2KM8B 3IP0A 3AFGA 3NNAA 4KPYA 4K0KF 2OPQB 3G82A 2EFQA 2IJNA 4QIVA 9ATCB 1RTJB 3OUYB 2FHJA 3JSYA 4X4NA 3IBFB 3NBPB 4WZQA 4GKJJ 1UFWA 1ELOA 2L41A 1IKVA 1VRTB 3HHLA 3P96A 2CQ3A 4CO5A 1B7FA 1S12A 3LTOA 2PI5A 3KK3B 1WC3A 3QO9A 2B4OA 1RAFB 3TVYA 4MAKA 3V4MA 2AIRB 4PZVA 1RHQB 3PYGA 5H9EK 4UTGA 2NYIA 4WIQA 2HGLA 2LYVA 4H4MA 1RWKB 5DQHA 1QAJA 5J2QA 2ATCB 1S1XA 1AZSA 2ZHAA 3ZTQA 2V68A 3CD5A 1T3OA 3OBIA 3B8HA 1BQNA 5L9XA 4LRBA 2ZH9A 3D54A 3W9HA 2WAQD 1ZZFA 4DWIA 2CRLA 4XAKA 2C3MA 1KQFB 4LVNP 2OPPB 1PG5B 2VFUA 3HHDA 4J37A 2YQ1A 4WP9A 1GMWD 2MZRA 4X84A 5HBMB 4J9PA 4C48A 4J91A 3E3XA 2HQ3A 3VQTA 2F8MA 3NEKA 3OLAA 4CQ1A 1N6QA 5FDLA 5HVHA 1VHFA 2LXFA 3C6UB 2HW3A 2MSTA 4NXNJ 5K14A 5LMNF 2RIJA 2IYIA 3BREA 4ZVPB 4K4VA 3KG4A 4M5DB 1D3WA 2HVZA 3GR1A 3V6DA 1JLFA 4C4WA 1LEOA 2KI2A 2IY5B 4X4SA 5J2MA 3OR1B 2QMWA 2DXDA 3KLIB 5IOLA 2KJVA 4DS5A 5KFVA 5M2PA 2D1CA 1TVRB 2HWIA 4KGKA 4QR2A 2CPYA 1DAXA 1NEEA 2C22A 2C42A 4NCBA 1UW9A 3GV5B 4WE1A 2H65B 1VIXA 7FD1A 1N36J 2ZH8A 2F8EX 2D7SA 3Q8UA 1XR6A 1VBYA 3HI9A 4LQ3A 1T9VA 2QN6B 3D0GE 4O4GA 2RB7A 4MKBA 2XO6A 4DV6J 2UUAJ 1J5EF 2CAJA 5DGBA 1HI1A 3PKMA 4I2PA 4ZVGA 2XB2D 3A4TA 2FLNA 2J8AA 4NYPA 3H2VE 3DFEA 3F0NA 1F60B 5A8RA 5KFBA 3CXCR 1HW8A 3R6GB 4NZ7A 4LF6F 4DV2F 2I5JA 5IT0A 3CD7A 2E5JA 1E6YA 4KSEB 4KFBA 1HQEB 4UUWA 4X64F 1T3NA 4CH7A 3K5MA 4ES2A 1J2VA 3PO4A 4H54A 2MZJA 4ZHRA 2WVCA 3CC7S 4QR1A 3CJKA 1NJWA 1Y5NB 3MMCA 2OLWA 3PY8A 3LAMA 5K8MA 3AD7C 1NJZA 3ETMA 4EMDA 1EJ7L 4Z7YA 2HLTA 3HVAA 3JS9A 4ZLNA 2F5GA 5C25A 2P6TA 1VISA 3D6HB 4HEA9 2EFOA 1RWOB 3H59A 3F44A 2HBRB 2HG4A 2G0IA 1RTZA 3CNQP 2JSXA 1GMWA 2BJ9A 2ZUAA 2K7JA 2VHGA 1AUDA 2PA8D 2IC3A 2ZOFA 4O3PA 3QJPA 1VRUB 1S1VB 1YJRA 3HD2A 2M8DB 4DL4A 3I4HX 1KONA 1EP4B 2C3YA 4Y0FA 2Q6BA 4EYIB 3UNGC 3HZEA 5THWA 2FQQB 3G71S 2DHGA 1HR0F 2JNJA 3M8PA 2DCUB 5B0GA 5DM7Q 3SQGB 2VG5B 5HANA 2YKQA 1C1CB 3Q8QB 2IRXA 1RT2B 1YTYA 2HGNA 3CSKA 2CNNB 3I5BA 1NK8A 2QEXS 2BW7A 4NLPA 4ANDA 4CLZA 4JYAJ 5LM7E 4OV6A 2ZNZA 2HURA 1BY9A 1GEHA 3I9V9 3MR7A 3CO9A 1SJRA 2HLUA 4DF4A 3TZZA 1YJ7A 2GAHC 5CD4A 4KKOA 4RNOA 1LFPA 2LLZA 4OJ1A 1RCXB 2FJXA 2QYCA 2RILA 2A10A 2VG6A 5C24A 5HL7Q 1BD6A 3NWRA 2J6UA 3EPIA 4GO5X 3KLEB 4CTAA 4L74A 1YQHA 3OTEA 4DUZJ 1QAYA 3DM2B 1BQMB 2MJNA 1DHMA 3PEJA 3T19A 4QOTA 3M8WA 3OTBA 3GIIA 1N32J 1G1XA 4IO1A 4O3SA 1IM6A 3W63A 3OTDA 4PRFA 1PO6A 2ILZA 4OQJA 1TL4A 3BJYA 5ETRA 2B5JA 1DZ5A 2ROGA 4DPOA 3DLBA 1FKOB 5LJ3Y 2J9DA 2H4WB 3WBZA 4DMZA 1NK9A 4HYKA 3PX6A 3W2WA 3D5MA 1FDAA 3KHHA 4C8NA 2AGPA 4OHXA 2U1AA 2BQ3A 4V1Ak 1HLWA 1U6FA 5KFWA 2R8KA 4F3QA 1P1TA 3DXBA 5FLXU 3C15A 5M2RA 1MWYA 3GFHA 3EZ5A 4F4ZA 2QO3A 3ILLA 2A6OA 2GW8A 3ULHA 5D0EA 4YOEA 3AAWB 3CDBA 2A18A 2W24A 3T5HA 4JI6J 3HHEA 4EU0A 4P10A 3CGIA 5HSPA 3HSGA 1FWPA 3BSNA 1WHXA 2QFIA 4M5MA 1EZZB 4WFNQ 2GGPA 4AFFA 3DRPB 2RS2A 4QW9A 4K5SA 4ZIVA 1IBCB 1NHUA 3I0SA 3JSRA 3DLLQ 4NASA 1J5OB 3M9NB 4M1KA 4JB8B 3OL7A 3UDLA 5IQ6A 5E3PA 2WSEC 1W26A 2C28A 2F63A 2LFVA 1HBOB 4O44A 7FDRA 1KOOA 1ZPWX 3FBBA 3FEZA 3GP9A 1UJ6A 4IG3B 2CNLB 1DQAA 3ZNJ1 1SPBP 2IPOB 2DNOA 5EWGA 3K89A 1RI7A 5DRKA 2R4FA 3VAMA 2C3PA 4PQUB 2E5LJ 2XSJA 4GVBB 5KTQA 5T41A 2YX4A 1GMVA 2HVIA 2X3DA 3R5CA 4IDKB 2HQFA 3NWGA 2ALYB 1IVZA 5KFSA 2EG2A 2OPQA 3BN7A 5F9NA 1VK3A 3IO1A 1FFGB 4LF9J 1Q53A 4YB1P 1F5BA 1JB0C 3D66A 1RTJA 4IFYB 3OUYA 4OI2A 3GFXA 1EIYB 3U27A 3NBPA 4ZLJA 4JV5F 1AFIA 3MDFA 2IAJB 1VRTA 1PJ7A 2GQQA 2P8IA 3MECB 1XMQJ 3KK3A 2LCWA 2O3DA 3CJ2A 4J9KA 1N88A 2B51A 2W7AA 4DR5J 1UPMB 1PYOB 3AH6A 3UI3A 3BQ1A 1N0UA 2QSWA 1RHKB 1YSJA 5DZ6A 1U48A 4DPWA 2OEMA 5F8LA 2HAIA 2V8VA 4PXEA 3ITHB 3CJTA 2ZEJA 2CJYB 2XYHB 3U1NA 2HNZB 1QTNB 4ZPVR 2CQ1A 4FF2A 1Q8KA 5E3AA 2EBEA 1PBAA 3S8SA 4X4VA 4HTJA 2OPPA 4O0NA 5J1PA 2GMJA 1NAQA 4NPOA 4ELTA 2AEFA 3C19A 1S7HA 3NS6A 2IVFB 1KVIA 2BKOA 4CDIA 2BJ7A 5HBMA 1Q5VA 1GTEA 3B4DA 1AROP 3E8OA 2Z0GA 3D28A 2RS8A 4F0HA 4NEZA 2DHXA 4QZVB 3C6UA 3QMQA 2R2TA 4NLTA 1FD2A 4KR0B 5AJ3J 2DNZA 2CPIA 2IM1A 3UCGA 4M5DA 1RA6A 4ANCA 2V9WA 1DJ0A 1LNQA 1SQEA 1RAJA 3MAQA 4ZN1A 3HFKA 3FBFA 1RAHB 4PR6A 2JHEA 4ZS6A 1YLXA 2QLWA 3OR1A 5H9FK 1L3VA 4NMXA 2HHSA 1V6HA 3KLIA 1Z2LA 3EDQB 2XWYA 3NCPA 3BDEA 1TVRA 3G87A 1SKUB 3EGVA 1JLBB 1JLCB 1I3OB 5F9LA 5M2UA 3PNIA 3UD4P 1FO1A 2JLGA 2VFSA 3TR5A 4PKDB 3JTOA 4W4MA 1FE4A 5SZTA 2UVVA 4ZVSB 1LW0B 2LU2A 2MXYA 1UAWA 2R7XA 2XY7A 4ZN3A 1JJ4A 1JQGA 4KGMA 2M0GB 2JRSA 1YBTA 1JNZB 3N79A 1VS3A 1Y7PA 4ZPDA 2OPSB 3EJMA 5KFAA 4C8KA 1S9GB 3VHQA 2Q3PA 2HQCA 2IA0A 5DDOC 3CC4S 3D68A 1QAXA 2RRBA 2XHWA 2IM2A 2JDJA 1YRTA 2OFGX 1HQEA 2PGCA 5CCMA 4I6AA 3CDAA 4BWJA 2X1FA 1HYSB 4MKAA 2FVQA 3T5LA 3KLHB 4EWTA 8ATCB 4YP3A 2W8KA 3KNAA 1EAYC 1Y4ZB 3BGFA 4JI4F 5JXSA 1HNIB 1KR4A 3GG1A 4AXJA 5E3RA 4LIWA 3MCSA 2RHSB 3TX0A 1N0VC 3MR5A 2RUGA 5I4MA 2ZBRA 1NH8A 3CCLS 2LDIA 3GJQB 4C6AA 1MN7A 2HS3A 3R2CJ 1RT1B 3I5AA 3D1OA 1D09B 4DV0J 1B99A 5KG1A 1F9HA 4G3IA 1HNXF 2R2RA 3CCWA 4RX6A 4ZDNA 4KGZB 5EUHA 1XNRF 4WF9Q 4PCQA 4AL6A 4OI3A 2VBWA 3PV8A 5G4DA 2KB2A 3GQCA 2CPZA 3H7HB 4RW7B 1VRUA 4QIWD 1S1VA 2MB0B 4CZCA 3H2UB 3Q24A 4O3OA 1F6TA 2DBBA 1EP4A 3EVOA 1X9SA 1ZAVA 3SQGA 2VG5A 2V5HG 1FF2A 2YKNB 1RTIB 5HJYA 1C1CA 2KT5A 4G65A 3AB2B 1O6XA 1JX4A 4IRDA 5GMKa 4L3NA 4NLQA 1Z4UA 3LP0B 2ASJA 4FF4A 4IYQA 4X4RA 2J0XA 3HULA 3A8EA 2FJAB 3NXZA 3MEEB 2OMOA 5IWAJ 3KKFA 3ISZA 2RE1A 2E1AA 4QPTA 2DIUA 4IG0B 1JLAB 4OYIA 1UVLA 4MK7A 1KWMA 2DH7A 4LRCA 2KM8C 3L4BC 1QSSA 3IAS9 1YDLA 3CMAS 2Z56B 1FNOA 3TUIC 1RAAB 3ZTSA 3ZXWA 1MSWD 5SUHA 4EI2A 2YTCA 2DO4A 1SKWA 2OELA 1M1KT 2FVRA 1G7CB 1S77D 2KVIA 3KLEA 3QGPA 2Z2ZA 2IBKA 2DEIA 2MYFA 3DM2A 1BQMA 3F56A 4O3NA 3Q0AA 2YNGB 3VVUA 1KLNA 4DX8H 5DQGA 3C8YA 4JI7F 1VFJA 3AA8A 3CCES 2JH3A 3D4JA 2GQCA 5KFCA 2MQPA 4J9RA 2X1BA 4F4YA 3P8BB 3Q23A 3RYLA 1M0SA 3M8YA 2JJ4D 1SL1A 2KDOA 1FKOA 2PD1A 3LUYA 4QYZJ 1U6BA 1HI0P 4KHPJ 1LWXA 3LWLA 4QU6A 1JKHA 3UDCA 1U0HB 1U1QA 2UUBJ 2CA9A 4PYDA 1TUWA 4C3KA 1FTRA 3MOZA 2DRBA 3CIZA 2KT2A 2JC0A 2AYEA 1RKJA 3KLFB 1FX4A 5CA5A 2PT0A 5LMUJ 4BBYA 2OTJS 3W2VB 1F3VA 2JC1A 4I0WA 1R7IA 3VTIA 3SZ2A 3M2UB 1NKBA 3G4SS 4TLQA 4C8ZA 3TO8A 3BO4A 2G13A 5H1SV 4OYOA 1XWLA 1WACA 5L1JA 3US5A 2LQBA 3SEOA 3DRPA 2FVSA 3GYNA 3IC1A 4KB7A 1R0AB 4LFAF 3DRYA 2HS4A 1C4CA 1D8YA 5BR8F 1JMTA 4ECWA 2BZ2A 1J5OA 2R7UA 4UOFA 4UW2A 3DU5A 4ECUA 2N7YA 1AXQA 3GFZA 1HBOA 4DN9A 1KOHA 5DGAA 1Q5YA 5K8OA 2DTJA 4J7CA 3RR8A 4NLRA 3T3FA 3S1TA 1M5VC 2AX0A 3M8SA 2IVYA 4RUHA 4IG3A 4CLFA 3ZO7A 5KG0A 3D67A 4MKVA 2J9DE 1WEXA 4PQUA 5JUMA 3QIPB 4GVBA 2OH2A 3VR1A 5IFMA 1VGYA 3OV7A 3PJXA 4IDKA 5LSOA 2VQFF 3SFGA 2DO0A 2UXDJ 4D3HA 2J0SD 3DN9A 3GYGA 5LXYA 4MYUA 2O1PA 5KFNA 3MM9B 1E6VB 4MMOA 1OYDA 3HVTB 3D1QA 5C5JA 2DNQA 1CC7A 1RABB 1UL3A 4IFYA 1KN6A 3DDIA 3OJUA 3FBCA 3W66A 3LP2B 5CCLA 3IRXB 2IAJA 4ELVA 3CJ0A 2FGOA 2QMUB 4L72B 2YWWA 3MECA 1SC1B 1W2IA 2C2ZB 1N36F 3KJNB 1VQ8S 4EYHB 1NJXA 4EFAC 4DSLA 2ZZNA 1SIZA 2LU1A 3I0RB 1NK4A 4XTTA 1U1OA 1IQTA 3KG1A 4HH0A 2UUAF 2UU9F 2DB1A 4B9MA 1ZAWA 1RAOA 2UUWA 1X9WA 5E5NA 4I7FB 3M8QB 3CF5Q 3VAGA 4YR0A 2FC8A 2NYHA 5KG3A 2LEAA 4KO0B 4ED5A 3ITHA 1RT5B 2N4CA 2HNZA 2DR8A 3L09A 2YVSA 3R8YA 2XO7A 1URNA 1B0PA 4KQZA 3KUHA 3FCVA 4Q44A 4Y65A 3G9CA 3QIDA 3W65A 4CCHA 3ZFVA 1GH8A 3TAMB 1RGVA 4YB5A 3M4XA 4DSEA 4FPIA 3W5XA 4UY8T 1IN0A 4HT7A 2OPRB 1R3NA 1CJUB 3LWMA 1U0SA 4PG6A 4ED6A 4K50A 1B64A 3L9ZA 4DFMA 1IR0A 1CEZA 3RG6A 2V69A 2GJ2A 1B70B 2EEYA 3FEYB 1VBZA 4LSNB 5DJBA 1NDPA 3KJVB 4WFBQ 2HIQA 4J9UE 4WXOA 4WFAQ 1KQGB 4Y6IA 1F2GA 4HVZA 2Y0SD 4FYVB 8RUCA 1NK7A 2QLXA 4ICLB 3NCRA 5KG4A 3W8PA 1JLBA 1JLCA 3AXKA 1VRQC 4Q45A 3Q2SC 4P2MA 3KTQA 3FCWA 3BKFA 4C8LA 1LW0A 1VI7A 3GONA 5CZVA 1RWUA 4HI2A 2F1FA 5I3QA 3NNCA 5I3PA 1PAEX 5KT7A 4A8QA 4J9VA 3GIKA 1RQ0A 3FFIB 4U6PA 5KOWA 2OPSA 2HPUA 1O8BA 3DGVA 3M6WA 4JI5J 1S9GA 5DLFA 3MFHA 2G2YA 3TAQA 4DPYA 2O67A 4GRSA 4ID8A 4DUZF 5HQ8A 1WELA 3N5FA 1RAEB 4LF1A 2N3LA 4CIOA 4DSFA 4LR8A 3G2XA 1IBLJ 2RUSA 3J7A1 4C97A 1U02A 2DGUA 1HYSA 6FDRA 5DDQC 1N32F 2UUCJ 3KLHA 1FRMA 2EK6A 2JEJA 4X62J 2V8GA 2OP5A 3PHEA 3LA0A 4MJKA 1HNIA 4QYRA 2BR0A 3T9ZA 1SJ1A 1CBKA 6AT1B 3C2PA 2MY7A 5DZ7A 2AJ1A 2BXJA 4K2XA 2XMWA 1RT1A 3RAMA 5G0RB 2XI2A 4ELUA 2CVEA 2Y1IA 2GHVC 4RU2A 4LF7F 4TYBA 4ECTA 1GX5A 3SI8A 2Q66A 4DL6A 4DPTA 3A12A 4RW7A 3R5JB 4HDHA 4J9MA 2QFJA 4OZLA 3QATA 1NCLA 2L08A 3AD9C 4PABA 3CWJA 3DNCA 2YKOA 2KZZA 4JI6F 1D9FA 2FC9A 4H4KA 4OZ1A 3MPYA 2YKNA 1RTIA 3M05A 1XMOJ 2V4QA 2OHDA 2IIHA 2J6SA 3D9BA 4C9DA 3ZZUA 3PCOB 4ZITA 3K58A 1WOSA 3CDEA 3LP0A 4K4XA 3D3CJ 1EQMA 4IH5A 3MEEA 2E7VA 1HMVB 3AB4B 2NSBA 3FSIA 1S49A 2U2FA 3UVJB 4ZP6A 2WZ1A 4IG0A 1MWQA 1JLAA 4AQYF 2DK2A 4Q2MA 4RNMA 4OZ2A 2R7QA 1RWPB 1YZ6A 2MQQA 2HMIB 4FNIA 4FPRA 1WI6A 2CQGA 3TZYA 3MMJA 2AW0A 2ZOMA 2PMZD 4KTQA 3CCZA 2YWGA 1H7WA 1U8SA 3K2YA 1ZYQA 2LECA 5EGYA 1HD1A 3IFEA 5A8WB 1A9NB 4DL3A 2YNGA 1FERA 2FUG9 3UWTA 2NS1B 4TVAB 5HMYA 2FJBB 1LW2B 4L6V3 3CW2C 4DCJB 5B0AA 1AFJA 2GS8A 3A8KA 2JLFA 5LMNJ 1FFWB 5C42B 4DV1F 4B3TJ 1T9XA 4LF9F 5ETLA 4OHZA 2DYAA 1R6YA 2C2EA 4OFZA 4Q7AA 1KTVA 2PFDA 4BLGA 2OD6A 4F04B 3PW0A 3H40A 1YRUA 4OLPA 1U0HA 2BACA 2V4RA 3TARA 1MN9A 2VFTA 2IMWP 2W4CA 1K0VA 2K3KA 3KLFA 4KE5A 3W2VA 2V8PA 2F9JA 1FVQA 3GILA 2OTLS 3M2UA 4DV5F 4DR6F 3OTOF 1Q79A 5LOQA 4ZVQB 1NK6A 1BUXA 1UWAA 5JMNA 4J9QA 1DQ8A 1U24A 5D15A 4RBUA 1R0AA 2OEKA 2LP4A 1P8GA 2HWTA 1Y3JA 3BGLA 3ETOA 3EGWB 2CUYA 4UQGA 3P3DA 4RU9A 4LRFA 3PX0A 1UCNA 3CDWA 4USUA 4L3KA 1FD8A 3JB9k 2HNYB 1ZTTA 4WKRA 1LXJA 3M2RB 4FN5A 2I2YA 4ZPCA 1X4GA 5L1LA 1RE1B 1ZBTA 2VIHA 4FYXB 2A1BA 2Z8QA 2BE9B 4X64J 3T1AA 2I38A 2RHQB 4HI1A 5LSRA 4AXIA 1VK8A 1EKRA 4KGVB 1YJTA 3QIPA 4X4OA 1S6QB 3VCDA 1U7LA 3J81U 2DCLA 3A13A 2FPHX 5AJ3F 1OJ4A 1XIQA 4CLYA 1WC0A 2VV5A 2D69A 3C6TB 5GAGU 4F2RA 1YG0A 1RHJB 1W2BR 1RCOB 2HQGA 3MM9A 1E6VA 4DR3F 1RADB 4OZNA 3HVTA 4CO1A 1TK0A 2CJ9A 5GAGI 4PPZA 2P5VA 2RKIB 3IRXA 4QYZK 1QUVA 1WDTA 2HYIB 3GJSB 2RRAA 5ETKA 5D0HA 1NSQA 1KSPA 4ZPTR 4UQTA 1HQ2A 2MLZA 4GKKJ 3IMQJ 3IG1B 5D77A 2E5IA 1HR0J 2ZZTA 3OFEA 1SH2A 3I0RA 2A0FB 1VDHA 1GXTA 4OZJA 3KK2B 1UETA 2G1HA 3NAHA 4K4WA 4I7FA 2QE5A 3VAJA 3M8QA 2B8QA 3GG0A 3AOBA 3PRVA 2AHOB 4USMA 4KO0A 4C0HA 3Q8PB 5KFIA 6FD1A 3TVKA 4NLSA 1RT5A 4B9VA 4R0JA 3JQMA 2AYBA 4RUAA 5D78A 2VD3A 1RBLA 1RTDB 1L3KA 4YHHJ 2B9EA 4FKYA 3TX8A 2VF3A 2OGUA 1K0TA 3NOCA 4C0BA 3TAMA 2N4DA 3K59A 1K47A 1NK0A 2OPRA 3NMAA 1CJUA 1N34F 2E5HA 2VKRA 2DXEA 1NSKL 2Q43A 4H4KC 4USJC 2XBPA 4DV0F 4F02A 1TAUA 4USTA 4ZMMA 3T5JA 1WC5A 5HI7A 1ZZNA 2ZBPA 2N82B 4LSNA 1NB2A 3PACA 2DPJA 3KJVA 2PC6A 2PN6A 4DR1F 1XNQF 4U67Q 4X4UA 1EARA 2GIQA 4IFVB 4NI2B 3K57A 1XR7A 2Y8WA 4X4TA 4ICLA 2CPXA 2Z57B 3N28A 4AL5A 5A6PA 3W5ZA 3I5CA 3OPKA 4WXWA 4C98A 4WK3A 3MR6A 1EHWA 4KC5A 3LOUA 2M2BA 4OX9F 5DETA 3FGVA 2ACYA 4C8OA 2HWHA 2FB0A 2ZBQA 4FVCA 2B6AB 1WKJA 4ED2A 2BEFA 2FVCA 4I6WA 1V3RA 3HXMA 2OJ3A 2LQ9A 2Z30B 3SV4A 3FFIA 1VC6A 4YQWA 3POTB 4PUOB 1UKUA 4GC7A 1RAGB 3QT8A 3J7YU 4P6QA 2D9OA 2DR5A 5IV3A 1FWKA 2KHDA 4HL9A 1MMNA 1HWKA 2ACMA 3KYLA 4NA1A 3ZZOA 1HWLA 4HACB 3J7YI 1MLAA 3M6VA 1FXLA 3SSRA 3MUTP 3M6XA 4G1IA 3JSMB 3CJSA 2HFVA 4W90B 5HLFB 2C2KB 3DOMB 3X3UA 1NMEB 3ENQA 5L46A 4JI3J 4XPCA 3BR8A 5J1EB 2QRRA 5F0UA 1FJEB 2YWEA 3UN5A 4K4TA 5G0RA 2ZH5A 4KHPF 3GSIA 2MKHA 4OHVA 1X4BA 5L39A 1UEUA 1UMJA 1VQ7S 3CMQA 2XULA 1AA1B 1UTAA 4C11B 4AT1B 2RRNA 4O3QA 3C66A 5HK4A 2LA4A 1TP7A 2KFNA 3BH7B 4JV5J 5CH7B 3SCKE 3EGNA 2KKHA 3H98A 2CDRB 2MZ1A 3PM9A 2FGCA 1U25A 1NKEA 2V8HA 3BZQA 1NJYA 3ET6B 5IT9U 2DHHA 4P52A 2EFGA 3IN5A 1FJGF 1TKDA 4N8OA 1JXLA 3RW7A 2F9DA 1TAQA 3ILOA 1HMVA 3R3TA 1SXLA 3HDSA 3JTPA 4USWA 3TW0A 3UVJA 2DNNA 4MIAA 2ZJQQ 2ZWPA 4A8YA 4JI8F 4RKUC 3G6XA 1F5CA 4ED7A 4OX7A 2J8SA 3LP1B 2VUGA 1DLOB 2HMIA 1F5AA 5B09A 5E2QA 5AT1B 3Q8YA 1A6LA 1N5YB 2QC3A 3FKBA 3V5RA 3B78A 5I42B 2WK4A 2KXNB 4ECQA 5A8WA 4ZPBA 4TY8B 1DTTB 5KFDA 4NLUA 2J9CA 1KFDA 2A2CA 4JI1F 1UJ4A 1LW2A 3PKYA 4X4PA 2N3OA 3IWXA 2GO8A 2EVZA 5F8NA 2MPUA 5C42A 3QBCA 4QWEA 4WP8A 3MAHA 4LFBF 2C2MB 2MLYA 3AXMA 4LBHA 3P49B 3J80Y 3BPSP 1T94A 4K5RA 1S1WB 4L76A 3GU0A 1MROB 3TJ9A 1WEZA 2PO4A 2K06A 3IGNA 2HK2A 2RF2B 1APSA 1KNZA 4PG8A 2NXCA 2DGTA 2XMAA 3MTJA 3L7OA 4GC6A 2Y8YA 4I1TA 1U6ZA 3QWUA 4K4SA 2J76E 2XZTB 1LK7A 4EK2A 1NRKA 1R89A 3TVZA 4IUFA 4NOHA 3FVYA 2GIRA 3M1VB 3R7NB 4ECYA 2EFPA 3PRDA 2F4FA 4Z7CA 2J6TA 2DPIA 4OYAA 2HNYA 1P9YA 4U8VA 3PHTA 4I56A 3M2RA 1ACMB 3CVKA 1MW7A 2V2QA 5L1IA 1Y00A 2V9KA 3A3OB 4K2JA 4LSZB 2CFXA 2ZBIA 1RB0A 2FHJD 2JZ5A 2K2PA 3PDNA 3C16B 4HTIA 3DXSX 2Z2MA 4C3MA 1S6QA 1WI8A 3KOAA 4N56A 2ZITA 3CMES 1XEZA 3CT9A 3C6TA 1QVGR 3VVTA 2CWXA 1J27A 1U49A 3OTCA 4FS1A 3SFUA 4B17A 3NGUA 3GJRB 4ZVUB 2RKIA 2QA4S 5KFKA 2LDYA 3B4MA 1M1GA 3I9ZA 2R2UA 2YX1A 3SQOP 5HMWA 5KFEA 3RJMB 3Q8VA 3FSYA 3BF4A 3IG1A 4G1QB 3W8GA 1UP1A 5KFFA 2DRAA 1WHVA 4DL2A 3OHBA 3KK2A 3QLHB 1PYSB 2CDQA 2F65A 3D6TB 1H38A 1TV6B 3H5UA 2POKA 3KLVA 3CE8A 5E33A 1H98A 4AE5A 3ZZRA 4XO0A 2GHPA 4E0DA 3M32B 3A8IA 1IM4A 2OUGA 2W2QP 5C2CA 2MHEA 2VPZB 1SV5B 2P6SA 4QWCA 4ITSA 4IR1A 1RUSA 1VQ6S 5GMEA 1D9AA 1N48A 1NPPA 2L48A 4P9SA 3LGHA 2VJVA 1RTDA 2XY5A 1F2HA 3RW6A 4IOBA 4KH1B 4DR4F 2RT3A 2MEWA 1RLDA 2DGQA 3M30B 3CCRS 4FNHA 2UUCF 3TUJC 2BE7D 2ABYA 1FNXH 5KFXA 4GMKA 3A1YG 1KQSR 2H54B 3RRHA 4JI7J 3I82A 2LQ8A 1RP5A 1R6VA 3EZOA 4DPXA 3ZC4A 1IBMF 5H9FJ 2HBYB 1AUSL 4UY85 1MWZA 2B7CB 1NM2A 2H1YA 2QGFB 3HJVA 4CLWA 3AA9A 1RA7A 1FXDA 4EBDA 4KAIA 1HBUB 4ZP7A 5B0CA 1F1BB 5T7LB 3MHYA 2RAQA 5GADU 4QIFA 4IFVA 3DOKB 4NI2A 2HS0A 3LANA 5KFRA 1K8AT 3J81j 1XMOF 2D74B 2BVZA 4F2SA 4E2FB 4LT6A 4Z2XA 2MZQA 4I68A 3QSYB 5GADI 2V2KA 3IXQA 2PEHA 4Y2KA 2XLJA 3RB0A 1TQLA 1U1RA 2B6AA 2BV3A 2YXLA 1WWHA 1S0NA 5HJXA 4LIRA 4KIAA 4WKYA 4RNFA 2GJIA 4ZVHA 3LH2S 2YWHA 3OVAA 4FXWA 2QT7A 4LFAJ 1PGZA 1RSCA 4ZCKA 3DKDA 3POTA 4PUOA 5BR8J 2X51A 4KHMA 1TK8A 5I3UB 2EC2A 4M5IA 2BM1A 3TOQA 2GMLA 4ECSA 4Q2LA 1M5KC 1FFSB 2Z2YB 2RU3A 2FIUA 4F8RA 3ADAC 1VQ5S 3PW2A 1RXOB 4HACA 1UPPA 5FJ4A 3QYYA 2DHSA 1OMSA 1FJ7A 2IDLA 3ZTRA 2E9ZA 4TXSA 3JSMA 5IZHA 2NUUG 1CSJA 2W4DA 1CG2A 3I4PA 4B3RF 4DDFA 3MM6B 3MPDA 3SCLE 5HLFA 1VMBA 3DOMA 4B3TF 2MMYA 4F7VA 5L9NA 3TWZA 5J1EA 2H9ZA 2VPXB 4F4AA 1SB6A 1IBKF 2VQFJ 4X65F 3BN4A 4URQU 4FXDA 3B54A 3OJSA 2WSFC 3MCNA 3PYFA 4ZLLA 3PIOQ 3OXLA 2XNQA 4C11A 3MZIA 4DLEA 2KFYA 1UVJA 1WG5A 5AE2A 2WW4A 2HHVA 2EFNA 1SJ4P 3PX4A 1RU2A 4WK1A 3KMQA 1PJ6A 2FY8A 3ET6A 4ERDA 1RT4B 4RL1A 3P5BP 1TZ0A 3HLUA 1FESA 1KD1T 1H6KX 1FWLA 2QLBB 3QGHA 4KH0B 2UU9J 2DR7A 1HHQA 3M6UA 2F7VA 1O0PA 4PG7A 4JV2A 4QBUA 2YNFB 1ZM2A 2DNGA 5ETPA 5CD4H 5B0BA 4ZOSA 3LP1A 3O1LA 3KWMA 4N47A 1X5SA 1DLOA 1JLQB 1VQOS 4MKYA 4NLWA 1N5YA 3IRWP 3AQPA 4NX9A 4U9RA 2DNLA 4TNOA 5I42A 1X7VA 2KYXA 3RRGA 2VONA 1WF2A 4TY8A 2R7TA 1DTTA 3TP2A 1I1GA 2D3UA 4HLBA 1LWFB 5B0FA 2HGMA 1HNZF 1Q16B 1HBMB 5HAOA 1SI9A 2A3JA 5LJ5Y 1S72S 1QAIA 3DI6B 2EPIA 1L3TA 2BJDA 5E7OB 1RWMB 3KUEA 3IBCB 4ZCMA 3ZZTA 1FX2A 3KUGA 2LA6A 1ZOTA 4TLRA 3TQEA 4DS4A 3AODA 3A8JA 1S1WA 4OZ0A 4H4OB 3NGKA 1CLFA 1MROA 2GC8A 2XEXA 2VICA 2H48B 1K1SA 1XK8A 4GKKF 2GCFA 2RF2A 3HHKA 3VV2B 1KLMB 2YX7A 3FBEA 1Y9OA 4LF5F 4NXMJ 2AWZA 3HVWA 3GE9A 4WFZA 4WFXA 1QD1A 4QWDA 4WZMA 3ELHA 5IC6B 1VQLS 4A8FA 4NWBA 2XNRA 4LRDA 3HT3A 4K4YA 2VC1A 1XN9A 2OO4A 3Q8RB 3BSOA 1SL0A 3M1VA 5DG7A 2B9WA 1PC5A 4NRTA 5D8HB 2YNHB 4WWSA 5KFYA 4YHHF 4R5PB 4C3LA 4P7VA 2JEGA 3J7ZT 4DEZA 3R7BB 3DDNA 2D41A 1HNVB 3IM9A 1H74A 3S7RA 2HZVA 1B0VA 3K8VA 2NLWA 1NBEB 1GMUA 3U1LA 3C16A 3H0PA 1H7XA 1DFDA 3DMJB 3RB6A 1FRJA 4A8OA 3MR3A 4OV1A 4I4BA 1N33J 3IS9B 4ES3A 1LXNA 1IWGA 4XDCA 1NJIT 1R31A 2YKAA 2XMMA 5HMZA 2Z2LA 3T9NA 4NLYA 1RBOB 3DRXA 2HK3A 1VHIA 2IYGA 4LF7J 2MKCA 3EDRB 1BLUA 4DV4F 1N4LA 2H5EA 3KHGA 4OZ3A 3GMGA 1WNEA 1FRKA 2DH9A 1Y11A 2KRRA 3IGVA 2FTRA 2XHCA 3BV8A 4NZ6A 5BYRA 3QNWB 1BQNB 1HFEL 3AQOA 2QJ3A 4F4XA 3G8SA 5DQIA 5FLXY 4G1QA 4NLXA 3QFHA 2DGWA 1T03B 2VOPA 3NOGA 4KPCA 4V19X 1CS4B 4AD6A 3PZPA 3QLHA 3SXLA 5JVHQ 4RUCA 1HKAA 2VFVA 5KT5A 1TV6A 4OI1A 2KRBA 2MQLA 2VC0A 2EK1A 3EWGA 2FHMA 3Q22A 3BBCA 1ZS6A 2UV8A 2I0XA 3M32A 2ILYA 3BO3A 4DUYF 3S01A 1RWVB 4CYUB 4AQYJ 4Y28C 3S6EA 1SV5A 2DXFA 3PW7A 3L7PA 1JXVA 3CCTA 2BYCA 1IQZA 1KVJA 1C0UB 4P2SA 3UD3P 4OLOA 3OW2R 4WP3A 3M30A 1LK5A 2IRYA 1RU1A 1VQPS 3H25A 2GQ2A 1TU0B 3PTWA 1H72C 2YH0A 2MDAA 1D8ZA 3HD1A 2B56A 4QIEA 4A8MP 1U2FA 3AT1B 4JI3F 2VQEF 4NLDA 3B6BA 4JV0A 2EI5A 1H2UX 1Q1KA 1HHTP 1R8AA 2AT1B 2R9LA 3EVMA 1KHWA 2EWHA 4DV1J 1YJWS 3NGTA 3T5KA 3K5LA 2ZJPQ 1NNDA 1HBUA 3H5YA 3FEXB 5T7LA 4DR7F 1VLOA 2J7WA 3BQ0A 3DOKA 1YBUA 3OR2B 4MIBA 5AXLA 2ZHOA 2HAFA 2WB4A 3R5GA 4Y2MA 4NLGA 1KS2A 3IA0A 3ENAA 2ZDPA 3FC9A 1CPZA 4JOUA 5K8PA 4EZ6A 1OYEA 4M95A 3TUPA 1MNEA 1S9FA 4LF2A 5GAHU 1TFYA 4DV5J 4DR6J 2RQCA 3OTOJ 5CXTA 4O4RA 2RDDA 1NDCA 2Q6CA 2V4JB 3NL0A 3DC2A 3MF5A 3MMCB 5I3UA 4IR9A 2KL8A 1Z1ZA 2DJWA 4ETXA 4N7TA 2KN4A 5AE3A 2RMLA 4DL7A 1Y3KA 2CQ2A 4PPDA 3ISNC 2LEPA 2ATLA 5A8KB 5A2QU 3CCJS 2YQ0A 1QE1B 5L1KA 3IM8A 1VQYA 2B4PA 1MMLA 3MMAB 3D7SB 3THPA 1S99A 1WDDA 4LFCF 2ROPA 3QRQA 2L9NA 3DHXA 3K0JA 3MM6A 1JWWA 3KHRA 1OY6A 1H3DA 1RWNB 4OI0A 4PWDB 3QGIA 4F26A 2WSCC 3ENWA 2RDJA 1RYRA 1CJKB 2QL7B 4MT1A 3HT0A 3MEDB 2CNOB 1WC4A 2JOQA 2OKQA 3OFHA 2AEMA 2RQKA 1MG7A 5F8HA 3HFZB 1JNRB 4DR3J 1G2EA 2ZKTA 4Y2CA 4DUTA 3AJ1A 3EZUA 1S4FA 3RZAA 1SBRA 2BANB 1HBNB 3K17A 4B3MJ 3KJFB 3DU6A 4I69A 2Y9HA 3CJRA 1X5OA 2M52A 1X5PA 3OL9A 2W9CB 2F4VF 2YBVA 4IH7A 1HIYA 1RT4A 1YKWA 3K5NA 3RR7A 1RHUB 3HMJG 3GV7B 4B3SF 5IQQA 2WBRA 2P9CA 1FCAA 2WCXA 2A2DA 3T1HF 3W1YC 2F40A 1ZH5A 1U09A 2PMHA 4X66F 2XSFA 5AE1A 2OIHA 2YNFA 2O5DA 2H5IB 2W4PA 4Z37A 2RU9A 1HNWJ 2CJBA 4KV8B 2K3IA 2BQUA 3O8WA 4DV7F 3ZZPA 3OXGA 3R97A 1JLQA 5MAOA 4A8XA 1N5QA 2V50A 4PWWA 3VALA 3Q89A 5B0EA 1KVKA 1NHKL 2CQ4A 2WONB 1WUUA 5ETNA 1HWIA 1VBKA 2EW9A 2W2OP 5D4NA 3M2VB 3NP5A 3UO0A 1LWFA 3E01B 2PA3A 2VB6A 1P1LA 1N34J 1WG4A 3WX8A 1OSDA 1QM9A 1HBMA 1I94F 1SQGA 1OIAA 2XY6A 3DI6A 4ZVOB 1YZ7A 3MGJA 2UXCF 4U7UK 1FK9B 4HHUA 2XC9A 2XLKA 1Q86T 1FKPB 1EKSA 4RR5A 4H4OA 1VQKS 4M63A 1X4AA 2BM0A 1W7WA 2AJFE 2FHKA 2UZAA 4DR1J 1XNQJ 3CJ8A 5C7PA 2YNIB 1YBAA 3HO1A 1AYEA 1KLMA 2H4YB 3AOAA 4K7QA 3MUMP 3CJ4A 2E29A 3TNVA 1RT2A 1EETB 3T6JA 1S6OA 3TEHB 4CLTA 4OX9J 4ZVRB 3TRGA 2ADCA 1DY3A 3JYTB 1CQNA 2MKJA 1X5TA 3C3LA 1VC0A 4KHRA 3NGDA 2ASLA 3IR5B 2GZOA 2GAGC 4DF8A 3W3SA 4M8LA 4BCAA 1S97A 1AB8A 2CG4A 4O0IA 2QA1A 4NCAA 4CWBA 1XQIA 2Y3YA 2EBGA 3AOCA 4Y2IA 2YNHA 1S4EA 1IWAA 4FXVA 2MLXA 5J2NB 4R5PA 2YKPA 1S6PB 4W92B 3DLKB 3RGIA 1NK5A 4C8MA 2HSEB 2M9KA 1RTHB 3NKYA 1FDBA 1HNVA 1XERA 4DL0C 1GNKA 5KFZA 5EWFA 3DMJA 4NL5A 1TMJA 4ECXA 1P9QC 4USVA 3ZZZA 2JVOA 4DV3F 4ZJLA 2DNMA 2VA3A 3IS9A 4L75A 4ED1A 4B9SA 2K1RB 3LW5C 5LXRA 4U95A 2UXBF 1GX6A 2J9EA 1K9MT 2XZWA 1DRZA 4A8SA 2I6WA 1R8CA 3TI0A 3MM8B 3MXHP 4NEYA 3BPDA 1I51B 1K73T 2M88A 1N5SA 4B08A 4RLEA 3VAIA 4F0MA 2CJQA 1T03A 3O2IA 2LKZA 5IXUA 1CS4A 3P6YC 1FJGJ 1UVKA 3O3LA 2R8HA 3QZ8A 4NA2A 1UEVA 2CXEA 2QA4G 2IM0A 3P5TL 4FBUA 2GNKA 5CQGA 2VA2A 4KJIA 2XWXA 3FMBA 4ZIWA 4P7TA 2BJEA 3RBXA 2JEFA 1ZM3A 4IRKA 2KG1A 4CYUA 2R3VA 4JI8J 3HVRA 3PEHA 1NPKA 3C46A 3D6MB 3LO3A 3MCOA 4NLVA 2IJRA 1C0UA 1KRPA 3C14B 2GA7A 2RDIA 4ES1A 3GV8B 3ENVA 3D2WA 4URSA 1F9FA 2AGOA 3GTYX 3A3NB 2E1PA 4DQSA 4DU8A 4JI1J 3QAUA 4WJBA 2QMXA 4DX5A 4MFBB 2UVUA 2X1GA 2IRUA 4KBIA 3CCQS 4USHA 2AZ3A 3VAFA 4EGLA 1JLGB 1TKTB 3QT6A 1H0HB 3HP6A 2AQ4A 4LFBJ 1TTHB 4K59A 4F67A 1T9YA 4WTYA 5KOXA 2BE2B 3BYRA 2G0JA 2H51B 1NHVA 4Q8EA 4JP8A 3OR2A 2CQBA 4HHJA 4UOCA 1S1UB 5AXMA 3OXFA 1VCTA 4RW4B 2M3DA 4UOGA 3EGZA 3PW4A 2NREA 1Q8LA 1M5SA 2UP1A 1SJ3P 2L9WA 2W01A 2J7KA 1U8WA 2MQOA 3BEGB 4GO7X 2GO9A 3M9OB 4P71A 4RBTA 1IKXB 2GHWA 2J0WA 3GPAA 4B9LA 3JAMU 2V4JA 1WOPA 3DLGB 2W9AA 1FVSA 3MR2A 4YS2A 1F9EB 4CH1A 2XGPA 3JAMY 5T14A 3K5OA 3WC0A 3BGOP 3GIRA 1PIEA 2VJUA 2JEIA 1F0XA 2BJ8A 2D9PA 3GCXP 2R7SA 4RZRA 2MKIA 2D3O1 4WCEQ 2AMCB 1URRA 5A8KA 4RW8B 2HHPA 1V5IB 3V6JA 1QE1A 1X4HA 1RT3B 1IUJA 2HVHA 3MMAA 2V34A 2FYXA 1UFKA 3IBWA 1GXLA 1D9DA 2DITA 3MAAB 1S7IA 4PWDA 1PC4A 1NSPA 2XQCA 4TN2A 2CPJA 1CJKA 3MEDA 2VH7A 5DM6Q 2HQDA 2C2DA 2ZM6F 1FRXA 1BGXT 1B4SA 5KFLA 3VQSA 2LXIA 2XI3A 2HKEA 4CI0B 1XJWB 3QT5A 1T9TA 5IM0B 4A48A 5ETQA 3MUVP 4ED8A 1GK8A 4YDXA 5CYMB 4K8RA 2BANA 1ICEB 1HBNA 1CQMA 4NXMF 3W60A 4Q0BB 3X1LB 1GAOA 4LF4J 2APOA 4M5GA 1QDUB 3AHPA 2W9CA 4CO2A 5D0GA 1SC6A 3VGSA 4RWXA 4JI0F 4YB7A 2FDNA 2XMUA 1N52B 2RQMA 2COLA 4ZVTB 4LJMA 3TZXA 3ZZ0A 2HZCA 2OI2A 1Q8BA 2EFVA 1LWEB 1RJJA 1FEHA 2HHHJ 4I2QB 3HHLC 3WDOA 1TL3B 4R25A 2Y1RI 4OMFG 2XYPB 1TL5A 4B3OB 1Q78A 2V67A 1IKYB 3W9IA 4EO8A 2W2NP 2E5GA 4BHQA 4KV8A 3UFCX 3KFWX 1S1TB 4ECVA 2CADA 5F41A 2JFKA 2DR9A 2NPFA 3BO2A 3WHIA 4P73A 1QVFR 2QYGA 4LBPA 4QQBA 1WTBA 4DR4J 3R1HA 3FRZA 3EE3A 1YGYA 2WONA 3LF0A 3UQSA 1UVNA 1PCAA 1JKHB 3CCUS 3CULA 4JI2J 3M2VA 3E01A 2E1CA 4OYWA 1N33F 2G0CA 1WOOA 1GQEA 2X7IA 4S0MA 3NS7B 3R5AA 3R9LA 9RUBA 1IR1A 4IRCA 1GTHA 3H4DA 1FK9A 3N01A 1IBMJ 4CLLA 5KFOA 1SH3A 3NCQA 3RBZA 4HH1A 3QFWA 3GCWP 3NS5A 1FKPA 4ECRA 5IT4A 1TKXB 3D1HA 4OJGA 1OSCA 4IQXA 2HEKA 5DLGA 4MH8A 1V3SA 1JXEA 2YNIA 2RNEA 4EBEA 3L95X 1ZTWA 4A46A 2M5YA 4F50A 4QR0A 4PG4A 1C1BB 2PEBA 1VJWA 3KK1B 1GFWB 4QU7A 2CQIA 1EETA 2HRYA 3ONQA 1WKLA 1X60A 3GR0A 3U7JA 1SKRA 4QCLA 5F8JA 4X2BA 3JYTA 4I67A 4YUDA 4EZ9A 2NQPA 1IR2A 4OYXA 2DIVA 3G6YA 2ZBCA 2ZH1A 5GMDA 4FVMA 4ECZA 3SMZA 3O5TB 3OVBA 2R7OA 2VZ9A 4OYMA 2VOOA 1YJUA 2CIMA 1QTMA 2FJWA 3BGUA 1T02A 5J2NA 1UZDA 4HT5A 1S6PA 3DLKA 1LFWA 2FHOB 2DISA 2YPYA 1DARA 1WORA 2GX8A 5KG6A 4CLUA 1RTHA 2YH1A 4M5LA 4DZ6A 3FNNA 1UWBB 3IWNC 1NDLA 2VU5A 3H5XA 3D3BJ 1WF1A 3OQ2A 4ALZA 5J1NA 2CQCA 4AL7A 3W7BA 1S10A 2CZ9A 1WG1A 1ZA2B 2NUHA 2N7CA 4B3RJ 3MEGB 2WVFA 3KG0A 2K1RA 3J7Z5 4C2MA 2OFHX 2RH3A 4ZLPA 3QJLA 2HFUA 1YJVA 2NXEA 4ZA1A 3MURP 1IBKJ 4X65J 1OY8A 1FTCA 3EM1A 3BSCA 3MM8A 3HSJA 2CJKA 2NR0A 2ASDA 2V94A 1KDNA 1QUPA 3G8TA 3OHAA 3UDVA 1ZA1B 4CO0A 3CPWR 3LPEA 5DO2A 4J9OA 5LT5A 1VIOA 3EICA 3I31A 2WVEA 3LALA 3PJ9A 4DL5A 2HHWA 4HR2A 1CJTB 1ZETA 2QX0A 1PJ5A 1D1UA 2VASA 4MK8A 4QJVA 3V81B 2Y1JA 2JWNA 3DGPB 3PXGa 2DGOA 3N6MA 3BGRB 2ERRA 2CKWA 2M4MA 2NSCA 3CIMA 5IC4B 4OJHA 4DX6A 3DLJA 3CO0P 1S48A 2VPWB 1T05B 1OQ6A 4OI6A 4B9TA 2MZSA 4AUKA 4YB6A 4TU7A 5CABA 4DI6A 3EUNA 4CT8A 2E66A 2WOMB 4J9NA 3DCAA 2W9BB 2V8DA 4YR3A 4PXDA 1R8BA 4RUBA 4DN0A 3BYPA 4NA3A 1T9WA 4F0KA 3JSBA 3C14A 2ASYA 4HHHA 4RBVA 3WQPA 2C2NA 4RJVA 2AF6A 2YWKA 2HNDB 4IH6A 1L3UA 4MFBA 3Q86A 2LEBA 5D3GB 1HNZJ 2W8LA 2ZVIA 1JLGA 1TKTA 3J81Y 4DU7A 3NNHA 3LQVA 2W2PP 1OWXA 2RVJA 1H73A 5J2PB 1H2TZ 2DKOB 2KYZA 2BE2A 4NE9C 1LWCB 3T41A 1HPZB 3LP2A 1SL2A 3HKZD 4B3MF 3DYAB 2I1RA 3UW1A 4BC9A 3DOLB 1S1UA 2Z58B 5DS7A 1C2PA 4CLPA 4RW4A 3SSQA 3SCJE 2BOPA 1XC9A 3RU0A 2VBXA 2ZOGA 5CHCB 1G3OA 4TU8A 3CDUA 5HQLA 1A0OB 1RISA 4LF5J 2FJVA 1PKUA 2I9SA 1QJHA 2IJFA 3HSDA 4PYAA 3KJQB 1IKXA 1T7PA 1ROFA 2QZ8A 3DLGA 3WC2A 5F8MA 3NY0A 1HNWF 3N6LA 2KXFA 5KG2A 3I87A 1WC6A 3UCZP 3UR0A 4ER8A 2KG0A 2OEJA 3RBEA 4F25A 3HSZA 3NMRA 1UZHA 2X3GA 4OYZA 4WYWA 5EWEA 2Y0BB 2E9RX 2YWFA 3W62A 1YRXA 2MGZB 3MM7B 4RW8A 2PDAA 2W1BA 3BQ2A 1A7GE 2BJ1A 1RT3A 4WU3A 1HA1A 2H5JB 3R6LB 1RDRA 2LXUA 2WBMA 4Y00A 1M5HA 4ED0A 1BWVA 4EO6A 3RAQA 4LF8F 4M94A 3MAAA 2B0GA 2KTQA 3PVXA 5HN0A 4CLSA 1NZAA 5GAEU 2E1RA 1QSLA 3H42A 2Q1LA 5KT2A 1V9OA 4FKXA 2C3OA 3BR9A 1VOMA
chains in the Genus database with same CATH topology
1FRJA 3FCHA 3V2UC 3SV3A 4CIOA 1LQ9A 4DSFA 4A8OA 4LQ9A 3MR3A 2AJ4A 4OV1A 1BWEA 4I4BA 1AW0A 4MIWA 3IS9B 4ES3A 1LXNA 3J7A1 4C97A 5GAEI 4ETZA 2DGUA 1HYSA 3QAEA 2MSSA 5IM0A 4XDCA 6FDRA 5DDQC 1UJ5A 1NJIT 1R31A 2MJUA 1N32F 1UW4A 2YKAA 5D6GA 2XMMA 5HMZA 3KLHA 1FRMA 5CYMA 2AU0A 4O44B 2EK6A 2Z2LA 2FLLA 2JEJA 3T9NA 3KLGA 2OP5A 2V8GA 3PHEA 3H8YA 3H5SA 4NLYA 3N5BA 1YIJS 2YY3A 4QYRA 4MJKA 1HNIA 3DRXA 4J5OA 2BR0A 4LSLB 1Q82T 4PWUA 1IBLF 3T9ZA 1I6JA 5MLCV 5KAKA 4Q0BA 1SJ1A 2M70A 1VQ9S 4ILRA 2L3MA 3UR3C 2YQ3A 3C2PA 2IYGA 5KFUA 2MY7A 2MKCA 3O44A 1SIWB 2AJ1A 3NRBA 1R43A 1ZM9A 5HROA 1RYSA 1BLUA 4DV4F 1MU2A 5CZXA 4X62F 1N4LA 2BXJA 2H5EA 2E7XA 2UUTA 4K2XA 3KHGA 1BQXA 2XMWA 2AYMA 3GMGA 1WNEA 1FRKA 1RT1A 2DH9A 3RAMA 3V6HA 5G0RB 2XI2A 2OSRA 2KRRA 2XMKA 3CD0A 3IGVA 1TK5A 4ELUA 3RAXA 4HKQA 3MWBA 2ZE2B 2FTRA 4NZ6A 5BYRA 2CVEA 2XSJB 1T95A 2Y1IA 2GHVC 4RU2A 4DFKA 4LF7F 1BQNB 4UUXA 3ZZYA 4TYBA 1U1MA 2FD2A 1HFEL 4ECTA 1GX5A 3AQOA 3IWLA 3SI8A 2Q66A 5F0WA 2KM8B 4F4XA 4DL6A 2CQDA 1U1KA 3K8WA 3G8SA 5DQIA 5FLXY 4G1QA 4NLXA 3TUZC 2DGWA 1LWEA 1T03B 2VOPA 3NNAA 4V19X 4RW7A 4IKAA 4HDHA 4I2QA 4J9MA 1TL3A 2QFJA 4OZLA 3R1LA 4KPYA 3PZPA 3QLHA 4K0KF 2OPQB 2L08A 3SXLA 5LSLA 5JVHQ 4B3OA 2EFQA 4RUCA 5E3QA 3CWJA 1IKYA 2BQRA 3DNCA 1YWXA 2IJNA 2YKOA 4QIVA 2KZZA 4JI6F 3N9UC 2VFVA 1RTJB 3OUYB 1C0TB 2FHJA 5KT5A 1TV6A 3JSYA 4OI1A 1D9FA 2KRBA 2FC9A 2MQLA 2VC0A 4H4KA 1L3SA 4I6YA 4OZ1A 4BS2A 1S1TA 3MPYA 2EK1A 4A4JA 2YKNA 1RTIA 3M05A 3TAPA 4X4NA 2V4QA 2RSQA 1S0MA 3NBPB 4WZQA 2FHMA 3Q22A 3DLEB 4DOZA 2JFDA 2J6SA 1UFWA 1ELOA 4C9DA 3ZZUA 2UV8A 3VWSA 2L41A 1IKVA 2I0XA 3K58A 1VRTB 3HHLA 3M32A 3P96A 2CQ3A 4CO5A 1B7FA 2ILYA 3BO3A 4YMEA 3CDEA 3VAKA 3LP0A 3S01A 4DUYF 3HPOA 4K4XA 2PI5A 4Y28C 3KNGA 3KK3B 2V0NA 3S6EA 3GWCA 5E41A 3QO9A 1SV5A 2B4OA 3PW7A 4IH5A 3MEEA 3L7PA 1HMVB 4GKJF 3AB4B 3TVYA 2NSBA 3FSIA 4MAKA