4RW9B

Crystal structure of hiv-1 reverse transcriptase (y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 109
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw9B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw9B03
2WCXA 4LQ3A 3OL9A 4RNOA 4IOBA 5EWEA 3GIMA 4ZP6A 3JSMB 4NLDA 4KO0B 4RW4A 5KFQA 3LP2B 3KNAA 1HYSA 2DPIA 3G6XA 5CYMA 3KHGA 3ITHB 5HBMB 2BQRA 1HQEB 3GV8B 1C0UA 4KV8B 3CJ0A 4EO6A 4ECYA 1JXLA 3MEEA 4KAIA 1JX4A 5F8GA 3KLGA 3I0SA 5J2NB 4I7FB 1R0AA 3V6DA 5KFLA 1HPZA 2VG7B 4MFBA 1FKOA 4MH8A 4TQSA 2JEGA 1S0NA 3MF5A 1RT7A 5DG7A 4XPCA 1KHVA 4TYAA 4ECQA 4FS1A 4WYLA 3T5LA 3SI8A 4LQ9A 2IC3B 2UUWA 3H98A 1TV6B 4KB7A 1DLOA 3BQ0A 1LW2A 3LAMA 1T05A 5KFFA 4Y3CA 2ALZA 2C2DA 3DOKB 4ECTA 2W9AA 4NLPA 4NLWA 4TY9A 4DL7A 4ZP7A 1HNVB 1TKXB 4TY8A 3DI6B 5KFWA 4J9LA 5KT3A 1K1QA 1RA6A 3H4BA 4RW9B 2WK4A 4RUCA 3Q8RB 1S9GB 1JLFA 2HNZB 3V6KA 2RKIA 1T05B 5KFYA 2ILYA 2FVCA 1NNDA 2HNYB 3VQSA 4ECSA 1DLOB 5J1EA 1FK9A 4YP3A 1HMVB 2XWYA 4WYWA 1D0EA 5C5JA 3TAMA 1C1BA 3MECA 1GX5A 4I2PB 5EUHA 2AGPA 2BE2A 4KKOB 5KFAA 2JLEA 2BANB 3T1AA 4RW7B 3DLGA 1U09A 3PZPA 3ICLA 5K14A 1S49A 1JLBB 3BSAA 3MR6A 3DLKA 4ECZA 4MIBA 1JLCA 4TYBA 1BQNB 2B5JA 1LWCB 1C0TA 3OLBA 2BANA 1EETB 4M94A 4X2BA 3NMAA 3CJ3A 1S1UB 3FQLA 2BE2B 2UUTA 2IAJB 3BGRA 3DLKB 4R5PA 2AQ4A 2WOMA 1OS5A 3SFUA 5DGBA 3MEGA 2D41A 1TL3B 3KLIB 3IRXA 4J9KA 3H4DA 4Y2CA 2D7SA 3MR3A 1S1UA 3H5SA 1MMLA 5L9XA 3N6LA 3DYAA 5HROA 1D1UA 4NLTA 3QZ8A 5KFRA 4ED1A 1TL1A 3T5HA 1RYSA 5JUMA 1MU2A 3LANA 5FDLB 4F4ZA 3FFIA 1IKYA 2BQ3A 3QIDA 4JV2A 2JEJA 3LAKA 5DQIA 2YNHA 3N6MA 1VRTA 2ZD1A 3CWJA 3KLHB 1RT3A 4RW6B 2GC8A 4NLUA 3QO9A 1BQMA 4IFVA 5F8JA 3CVKA 1C2PA 1REVB 3N6NA 3KMSA 3H40A 2VG6A 1SH3A 4NLVA 5L1LA 4DL4A 4I2PA 5DG8A 1LWFB 3C6UA 3DRRB 3IG1B 3NAHA 4ZP9A 1HMVA 2IC3A 2WHOA 4NLXA 5F9NA 3C6TA 3BR9A 4NLSA 5K14B 4EYHB 1N6QB 4YQWA 3JYTB 5L1IA 3M8PA 4NRUA 4URGA 3GV5B 1RYRA 3DOKA 1ZTWA 3FSIA 2ASLA 3OSNA 2W8LA 2E9ZA 4IR1A 4F4YA 3JSMA 2C28A 3QLHA 2OPRB 1S1TB 4RW6A 5KFMA 1JLEB 2V0NA 4WE1B 1RT5B 2GIQA 5F8NA 2J6UA 3UDLA 3DRRA 1IKWA 4O3PA 5KFZA 2E9TA 4ID5B 3DOLA 1HQEA 1HNIA 1CSJA 4O3QA 5I3UB 1SV5B 3NAIA 2HWIA 4QWEA 4IRKA 2JC1A 4ZVFA 4ECVA 2V9WA 5KFOA 2OPQA 2EC0A 4NLRA 2IM2A 4MKAA 4DL5A 1N5YB 4RUAA 2I5JB 4ZVGA 2BRKA 3IN5A 3BSNA 3RB6A 4MK9A 4ED0A 3E51A 4LSNB 3T19A 2E9RX 2HMIA 4IH7A 4NCGA 3CJ2A 1RTHA 3V81A 1S1XB 3DM2B 1TVRA 3LALA 3NBPA 3V4IA 4PUOB 1C1BB 1EP4B 3MECB 4URQU 4J9PA 2FLLA 2XCPA 4DL6A 3KLHA 3OL7A 4RW8A 2IM3A 1TKXA 4TY8B 2CKWA 3CIZA 5KG5A 5F9LA 4TN2A 3TVKA 2FVPA 3M8QA 4DG1B 3GYNA 3MTKA 3OL6A 2F8EX 1RT2A 1SUQA 3DMJA 5KFTA 4J9SA 4K4VA 4HKQA 1TVRB 3KLVA 4JV0A 1JKHB 3LP2A 1N4LA 3I5BA 5KG1A 2UVWA 3FRZA 2WB4A 5KFNA 4IG0A 3CDEA 1S6PA 5KG0A 4FS2A 3KK3A 3BGRB 3ITHA 3QGIA 5DQGA 2C2EA 4ECXA 4ZVEA 2VA2A 4QWDA 3GIKA 4XO0A 5DLFA 4NLGA 4KKOA 3KHLA 5D3GB 2XGPA 2ZE2A 4YR3A 3KLIA 1HNIB 4NZ0A 4ED7A 2ASJA 4GC6A 4O3RA 4PWDB 1RT7B 1N48A 4FBTA 3G6VA 5KFGA 2FJWA 3KJVA 2JC0A 3HVWA 2YNFB 2YNGB 4URSA 4R8UB 4F50A 4KO0A 4RW4B 1I6JA 4MIAA 3MEDA 2QV6A 3PW2A 3BSCA 4NYZA 1RT1A 2AGOA 4EBEA 1IKVA 2FVQA 3QGGA 3KHRA 2R2RA 5F8LA 1VRUB 5D3GA 3V81B 4PQUA 1DTTA 4OL8A 4K4YA 5KFUA 1LW0A 1TKZB 4WXOA 4RU9A 4KBIA 3DMJB 2R2SA 3KMQA 5J2NA 4DEZA 4PWDA 3IGVA 2B43A 1FK9B 4QWCA 4EEYA 1QE1A 4NLOA 4F4XA 2WRMA 4Q8EA 3QLHB 3UR0A 2AX1A 1N56A 1RT6A 3DLGB 1FKPA 4QW9A 3PR5B 2OH2A 4O44B 5C42A 1REVA 5KT7A 4TXSA 5J2QB 3CO9A 1ZTTA 3DOLB 3EPGA 3LP0B 3GV7B 3RAXA 3HVTA 3CDUA 2B6AA 1RTDB 1VRTB 4ICLA 1RTIA 4ZP8A 4KFBA 3PR4A 1UWBA 4I2QA 4IDKB 3PHEA 2XGQA 2XCAA 2FLNA 1LW0B 1RDRA 1HYSB 2UVVA 3KLEB 2YKMB 2FLPA 4YR0A 4ZPBA 3EPIA 4RNFA 1HARA 5KT6A 4K50A 4LSNA 4Q0BB 4G1QA 4H4OB 5EWGA 3MFIA 1RTJB 4G3IA 3H5UA 2J6SA 3I0SB 1S9EA 1YVFA 4QWAA 3T5KA 4RNNA 2W9BB 1RT5A 4U7CA 3HVTB 1JLAA 1T03A 1KHWA 4MK7A 3PJWA 5KFXA 5L1JA 3OSPA 2YNGA 5L1KA 4WFYA 5KG7A 1SV5A 2HNDA 2AX0A 3HKWA 4WFXA 4IQXA 1VRUA 5HLFA 2C22A 1TL3A 1RT3B 4MK8A 5KFSA 1S0MA 1DTQB 1UWBB 1WNEA 3QYYA 5F8HA 1S6PB 2YNHB 3LP1A 2WONB 1N5YA 1JLBA 2OPPA 2RDIA 3KOAA 3PW5A 2YKNA 4IFYA 4KHMA 1MU2B 5FDLA 5KT2A 4RW7A 4F4WA 1T94A 3Q8QB 5J2PB 5KG6A 4NCGB 3QIPA 2ATLA 4K4UA 1LW2B 2XC9A 1RT6B 3I5CA 4EBDA 1BQMB 4H54A 4O4RA 2R8HA 3BQ1A 2WONA 3HHKA 4Q45A 1QE1B 4NRTA 4B3OA 2JEIA 4FBUA 3PW4A 1W25A 4ED6A 3RBDA 4RNHA 5KG4A 1SH0A 3OLAA 1RTHB 5J2MB 4QW8A 4RNMA 3GIJA 1S1WB 2RF2B 3M8QB 4DG1A 2OPSA 1N6QA 2R8IA 3MEGB 2UVUA 2YKNB 4IFYB 4B3OB 4ZHRA 1RTIB 4IH6A 1S1VB 4MKBA 1IKVB 4Q44A 2VG5B 1S6QA 4IG0B 3KK1B 4ZVHA 5J1EB 3DRSB 1RTJA 3M9NB 1ZETA 3NGDA 1DTTB 1TKTA 3MFHA 1JKHA 1LWEB 4IKAA 2O5DA 5C24B 3E01A 5I42B 4ECRA 3GQCA 1JLGA 4ID5A 1XR6A 4WFZA 2AU0A 1TV6A 2W7PA 1S6QB 3KK1A 3DLEA 3IS9B 3OHAA 3V6JA 4QPXA 1HNVA 3GIIA 5KG3A 2OPQB 2I1RA 1S1WA 1EP4A 3PJXA 4YR2A 4DL3A 5C24A 4O44A 5C42B 5I42A 4IR9A 1C0TB 3H59A 3D28A 1R0AB 4K4ZA 4K4XA 2XI3A 1S97A 3DRSA 4Y34A 2OPPB 3H5XA 2FJXA 1S1TA 5HP1B 2HAIA 4R5PB 1C0UB 4KV8A 5C25A 2D3ZA 5KFBA 2IBKA 3MEDB 3E01B 1GX6A 3PVXA 2RKIB 1RT4A 4WZMA 4K4WA 1FKOB 4O4GA 2YNFA 2R8JA 3HVAA 4ECWA 4O3NA 1QAIA 4RZRA 1IKWB 4KE5A 2W9BA 1TQLA 4ED3A 2OPSB 2BQUA 1KLMB 2YNIA 2W9CB 3MR2A 1S10A 4JV1A 1NHUA 1BQNA 2B5JB 3G6YA 4NLYA 3KLFA 3ISNC 4WXWA 5KG2A 3T5JA 5KFEA 3V6HA 5C25B 3TQ1A 3C6TB 2WTFA 1XR5A 3MEEB 3LP1B 1IM4A 4ICLB 1JLGB 2FVRA 2HNYA 1J5OB 3LP0A 3V4IB 4PUOA 1QAJA 5KFDA 5KFKA 2V4RA 1LWEA 4GC7A 4J9QA 1JLFB 2HNZA 2YKMA 3KK2B 3KJVB 3IGNA 2W9CA 2AGQA 4RW9A 3RAQA 2D3UA 3RB3A 3BQ2A 3H2LA 4ED8A 5EDWA 4IRDA 1JLEA 1IKXA 1RA7A 2R2TA 3GILA 5F8MA 1C1CA 2C2RA 1S9FA 3M9MB 1TL1B 1HPZB 2VG7A 4MFBB 4EBCA 4IG3A 1TP7A 2DPJA 5I3UA 2R2UA 2BRLA 5JXSA 4IFVB 2HWHA 4O3OA 2J6TA 1JLCB 1T03B 3MR5A 4M95A 3UQSA 4J9MA 3RB0A 4KSEB 2VA3A 4Y2AA 5HP1A 2VG5A 3ISND 2IM1A 2R8GA 4WZQA 3IG1A 3FDSA 5CYMB 5HLFB 2ZE2B 1Z4UA 4IRCA 4LSLA 5KT5A 3CJ4A 2HNDB 5J2PA 3BSOA 4ZPCA 5KT4A 3JYTA 1LWCA 4ZPDA 1KLMA 2YNIB 3NL0A 4I7FA 3M9OB 3QZ7A 2IMWP 1IKXB 3OL8A 2JEFA 2WOMB 1S0OA 3I5AA 1JIHA 3IS9A 3OHBA 4ECUA 4ZMMA 2W7OA 4H4MB 5KFIA 2IAJA 3KLFB 2OPRA 3FFIB 1QUVA 2QE5A 1JLQA 1K1SA 4Q0BA 3Q8PB 2IJFA 1S9GA 3DDKA 4JUZA 3QGHA 3RBEA 3QIPB 2AWZA 3RB4A 4PQUB 4LSLB 5EWFA 3QO9B 1JLAB 4DL2A 3KK3B 2ZD1B 4Q43A 4J9RA 1S9EB 2GIRA 1S1VA 4R0EA 1IKYB 4K4SA 4G1QB 1LWFA 4H4OA 1TKZA 5CYQA 3KK2A 5KFVA 4KHRA 4O4GB 2VG6B 2W8KA 5J2MA 2IA6A 5KFJA 1HQUA 3EZUA 3PW0A 4K4TA 4ED2A 3DRPA 5F8IA 2RDJA 1XR7A 3DI6A 3DLEB 2B6AB 1RTDA 1S48A 4IH5A 3C6UB 3I0RB 3H5YA 4J9NA 5DGAA 4J9OA 5HBMA 4QWBA 4R8UA 3NBPB 1HQUB 3BREA 3V6DB 2CJQA 3KLEA 1RT2B 1SUQB 2FJVA 3M8PB 2XI2A 5T14A 3IRXB 3TAMB 4I2QB 4IDKA 3NKYA 3D5MA 5KFHA 4HYKA 2IJNA 2UVRA 5KFPA 1RAJA 3CDWA 4U6PA 3DRPB 1RT1B 3BJYA 1NHVA 4XPEA 3Q8SB 2IM0A 1S4FA 3KHHA 3DYAB 5HROB 4TLRA 1RT4B 2ILZA 2BR0A 1J5OA 2FVSA 3G86A 1JLQB 4ZPAA 3SFGA 1T3NA 4Q8FA 5KFCA 3I0RA 5DLGA 2I5JA 4H4MA 4ZHRB 1DTQA 5DG9A 2RF2A 3FQKA 5J2QA 1SH2A 2ZKUA 5DQHA 4IG3B 1S1XA 1EETA 3DM2A 3CJ5A 4NLQA 4EO8A 1TKTB 1FKPB 4YMEA 2R8KA 3PW7A 2ASDA 1C1CB 2HMIB 3UPFA 5CYQB 4EYIB 3KLGB 4O3SA 4KFBB 4RW8B 4TQRA 4WE1A 2V4QA
chains in the Genus database with same CATH superfamily
4LF7F 3HMJG 2PC6A 3MUVP 4RNOA 1YG0A 1AFJA 2UUCF 2HSEB 3C3LA 2K06A 4WF9Q 2UXCF 1O8BA 1ZPVA 3Q8YA 5K5MA 1VQNS 1A6LA 2L48A 2ROPA 3JQKA 2P6SA 5IT9U 5IV3A 4USMA 2M8DB 4MAKA 3QRPA 4KV8B 2QMWA 2BACA 4I1TA 3GJQB 4CLWA 4LF7J 3VZHA 3CPWR 1JX4A 1MWZA 3KXDA 1XK8A 3VGTA 3RGIA 4I7FB 1R0AA 4TU8A 5LMNJ 5A8RB 2HHUA 3M8RA 4MYTA 1HPZA 1T9TA 1FKOA 3OTCA 3TEGA 4IUFA 3PM9A 3MF5A 1P9YA 1LFWA 1S59A 1Y5NB 4Q7AA 4XPCA 1KHVA 2DH8A 4AL6A 3BV8A 3MGJA 3MI7X 3W8GA 1KNZA 2HVZA 3W66A 3SI8A 4NZ6A 1CJKB 2YXLA 2EW9A 3A8EA 3KDNA 4KB7A 2ZJPQ 5HAOA 2DGUA 4LIWA 2HVEA 2DR7A 2HFVA 1LW2A 3P5TL 5KFFA 4Y3CA 1RAFB 1ELOA 4ECTA 1FRKA 1PJ7A 4LMZA 2YWFA 4LF6J 1HLWA 1RHUB 2QEXS 1AZSA 4NLWA 4TY9A 4ZP7A 2MZ1A 2XEXA 2MZRA 3B78A 3MM9B 2QA4S 1K1QA 2HEKA 4J9LA 1RA6A 2Q43A 4YOEA 3H4BA 3ZZZA 4ZOSA 2QL7B 2WK4A 5EHHA 3TQEA 5D4PA 1NK6A 2BDPA 2OD6A 4CH1A 1YBUA 2E1AA 2D69A 1NNDA 3ILOA 3WC2A 2B51A 3VQSA 1RJJA 5J1EA 2NR0A 4YP3A 2JFKA 4GVBB 2XWYA 2E29A 4I4BA 4WYWA 1Y5LB 3B8HA 1GX5A 4I2PB 2W25A 2X1BA 2BE2A 3B6BA 1RE1B 4KKOB 2ZOFA 4WKRA 1UEUA 2CPFA 3ZTOA 4F3QA 4DV7J 1ZH5A 4DFPA 3T1AA 2DR5A 2MYFA 4DMZA 1WHVA 2LEPA 2W4DA 2M52A 1FXDA 5K14A 3ICLA 3UWTA 5KOWA 4ILLA 1Y10A 2FZGB 1UP1A 3AQOA 4CDIA 2LVWA 5B0GA 1GTHA 2CPHA 1ICEB 2ZJRQ 1S72S 3TARA 4GKKF 2VQEF 2EFVA 2Y1LB 3MM7B 5IFMA 3GR1A 2OEJA 5CCMA 3CJ3A 3NGTA 3TZZA 1GT8A 4USHA 2B3TB 4KHPF 3BGRA 4LF8F 2PA3A 2VIHA 4A8WA 2AQ4A 4FKXA 3KJQB 3IR6B 1RWVB 1UJ4A 4OHWA 3SFUA 4UZCA 1FRHA 3MPYA 4DCJB 4ELUA 4NE9C 3IRXA 5DETA 3PCOB 4Y2CA 2D7SA 3MR3A 2XYGB 4DS4A 2IA0A 3UNGC 5DDRC 1D1UA 3T5HA 2AD9A 3QJLA 2CJ9A 2HG4A 1RYSA 4M5GA 4W4MA 4X4SA 1H3DA 2XLKA 3MUTP 4C8NA 4KC5A 3LAKA 2IYGA 2CNOB 2JL9A 4ES3A 1U6FA 2VFRA 1KWMA 2Z2YB 1ZM9A 3N6MA 4EK2A 3M8SA 2KB2A 1NB7A 1NB2A 2GC8A 3AOCA 1P1TA 4IFVA 2V8DA 3G87A 3CVKA 2O67A 5D0GA 4CYUB 4PG8A 3N6NA 4FXVA 4LRBA 2XBPA 3KMSA 3CCLS 1CQNA 1FTRA 4H4KA 3J7A1 4P2MA 1HNZJ 3G96A 4QU6A 2HHWA 1AXQA 2RQ4A 5DG8A 1RBOB 3NAHA 1FCAA 1RWKB 1ZOTA 2DGSA 3IFEA 4ZP9A 2XULA 2IC3A 2WHOA 1F5AA 3Q86A 4JV5J 5BYRA 2UXBF 3PNIA 1N6QB 2BJ9A 3JYTB 1X4BA 1W7WA 4URGA 1FTCA 2DTJA 5IQ6A 1NO8A 5AT1B 3I56S 2V6AA 4RL1A 2LDIA 2BJ7A 3AB4B 3QLHA 3VHQA 2O1PA 2E1CA 4RW6A 4P6QA 5KFMA 2N3LA 2V0NA 1U1OA 5F8NA 2GIQA 4Y28C 1KLNA 1CC7A 4OHVA 1I1GA 3UDLA 3DRRA 1U2CA 1NU4A 4UZBA 3RAMA 1HNIA 2PSZA 4DZ6A 3T1YJ 4QWEA 4IRKA 2ALYB 2V94A 5AJ3J 4QYZJ 3TZYA 5KFOA 4AQYJ 3FBFA 4WWSA 3THPA 4PYAA 3ZTPA 5CXTA 2C2MB 4HHUA 5AXMA 4JP8A 1WI8A 2BRKA 2ZVIA 4MK9A 3OTOF 4DHVA 2JVOA 2ZC4A 2CPIA 4QIVA 3SDEB 1NK4A 4IH7A 3M8YA 3ZTQA 4NCGA 3CJ2A 4OJHA 5BR8F 4OJ3A 2KXFA 3SXLA 3WBZA 2R7RA 2VONA 4C11B 4PUOB 3OUYA 1EP4B 1FEHA 5CYJA 3UR3C 4EGLA 4UOHA 2W2MP 2CQ4A 3RYLA 4J9PA 2XCPA 4DL6A 1U1KA 1RP5A 1G1XA 2IVYA 3BS9A 1RAAB 1TKXA 2IM3A 4TY8B 5KG5A 2XLIA 5LJ5Y 1SCJB 2PEBA 1AT1B 3GIRA 4BBYA 4Y65A 3TUIC 1QVFR 1GTEA 1OSDA 4K4VA 2WSEC 4J9SA 2Z0GA 3D0IE 2DH9A 3FMWA 2A1BA 4YN3B 3W60A 4JV0A 1JKHB 1Y9OA 3ZTSA 5KG1A 1WC4A 1VIOA 2R3VA 4LRCA 1VK8A 1PYSB 3HM9A 1KOHA 1MNEA 2FDNA 4FF1A 2EC2A 3JAMY 3VCDA 1KTQA 5KFNA 4PYDA 5E5NA 3KK3A 3OXLA 2DHAA 3BGRB 3ITHA 2DNHA 1FRLA 4ECXA 3QT5A 5I4MA 3G8TA 1R0BG 4FVMA 5LMUF 2MEWA 1ULRA 4NLGA 5GAGU 2BV3A 4ZJLA 2G2OA 2KRBA 1EJ7L 4NZ0A 3MMAA 5HMWA 4GMKA 1O6XA 1QM9A 3BKFA 3FSXA 4RPFA 4GC6A 1VK3A 4PWDB 3DFEA 2DR9A 2MLXA 3NCPA 5B08A 4OX7A 2HKEA 3R1HA 1R6VA 2CNNB 1TR0A 2V5HG 2PA8D 2QV6A 1RACB 4DCPB 3PW2A 2RRAA 2UUBF 3MM6B 2GX8A 4X66J 2GJ2A 3TP2A 2AGOA 2ZHBA 2NZCA 1IKVA 1FX4A 2ACYA 2FUG9 2XZTB 4USVA 5D0EA 5HJYA 4J91A 4DSLA 2XB2D 4C97A 3KHRA 2Y1IA 1PC4A 3FUYA 1XMOJ 3ULHA 4CQ1A 4U95A 2CZVC 4FPIA 1FT8A 4OL8A 1N36F 3AA8A 5IZHA 1QD1A 4UW2A 4QCLA 2QT7A 4WXOA 4C0OC 1YJNS 3BN4A 3DMJB 4J5OA 4L3KA 4ALZA 2Q66A 4PWDA 3EDRB 5FD1A 4CTAA 4HH0A 1KFSA 1TL7A 1PJ5A 1HBMA 4LRAA 2XMAA 1VLYA 3QLHB 1N5VA 2FY8A 2VV5A 2AX1A 3OR1B 1RT6A 1MROB 3DLGB 2M5YA 3ADAC 4FZVA 4IQMA 3T9ZA 2OH2A 5D77A 4QIWD 4TXSA 5CZVA 5A0YB 5C2CA 4AL5A 2JRSA 3EPGA 1GQEA 2FIUA 2YX7A 4MTPA 3S01A 1T8EA 2DNKA 3RAXA 1RTDB 4DR6J 3ETMA 5GMDA 4ICLA 4A48A 3KUEA 3NGUA 3P5BP 3FBBA 4ZP8A 4KFBA 1UWBA 4X4PA 4IDKB 2ZZTA 3H20A 2XGQA 3MPVA 1PG5B 2KJWA 1HYSB 3M30A 4I68A 2MGZB 5HVHA 2VBXA 3EXYA 4PWWA 4YR0A 2ZITA 3RBZA 3MM7A 1X5PA 4NI2B 1RQ0A 3BDEA 2MMYA 2COLA 3ZTRA 1ZM4A 2MQLA 5LSLA 3PRVA 4OZ5A 2LXFA 4RNNA 3VWSA 1PIEA 4JI1J 4RKUC 4X62F 3CSKA 2K7KA 1KHWA 4MK7A 3PJWA 5KFXA 3OSPA 1DQ9A 4WFYA 1TFYA 2EEYA 5ADZA 4CO4A 5F0UA 3DGPB 3SCLE 3MCSA 4ZLNA 3CCQS 3DU5A 1XMQJ 3Q23A 1TL3A 1RT3B 4MK8A 4XTTA 5KFSA 1DTQB 1UWBB 1ACMB 2SXLA 3R9LA 2ZZNA 2QA2A 3HF5A 5F8HA 3LP1A 4WU2A 2MQPA 2G1HA 2OPPA 2DGVA 5FIIA 3TUJC 2YKNA 3KHLA 2VHGA 3ENAA 2H4YB 2V4JB 1T94A 3Q8QB 5J2PB 5JMNA 1HQ2A 3HKZD 3O1LA 1B0TA 2BJDA 2HQCA 2QTWA 1IJEB 3ONQA 1N52B 1R0CB 3I5CA 2RVJA 4M63A 1BQMB 3LUYA 4H54A 3T6BA 2LDYA 1HNWJ 3W5ZA 1FNMA 1WEZA 2ZFHA 4Q45A 2L41A 3M2VA 2IPOB 4Y6IA 4B3OA 3VZIA 4FBUA 4N5SA 4JYAJ 4U9RA 3GCXP 3RRGA 1SH0A 2CDRB 4RNMA 3TX0A 2CPYA 2DXDA 1N33F 4ZN3A 1V9OA 1FDDA 1Q95G 3VAGA 2R8IA 2NXJA 3VAHA 4IFYB 4MIWA 1X5SA 1N34F 1TU0B 4JYAF 4D3GA 3CJSA 1MMNA 1OY8A 5FJ4A 2A6MA 2YWHA 1U6ZA 1XJWB 3S6EA 3OXGA 1GXUA 2HFSA 4LR8A 2B4UA 4DFJA 1DTTB 2HGMA 3MFHA 1SL0A 2XSFA 1IBLJ 1LWEB 1UPPA 2O5DA 4IKAA 5B0CA 4ED5A 2XMJA 2DEJA 3GQCA 3FRYA 1XR6A 2GGPB 2K1RB 2VFSA 1TV6A 2Y3YA 1S6QB 4DR2J 3IWXA 5H9FJ 3IS9B 1R31A 1E6VB 1QSSA 3CULA 2OPQB 3AAWB 3D68A 4UQTA 1HNZF 1S1WA 5GVQA 3R3TA 3KG4A 4BLGA 4O44A 5C42B 3N5FA 1SJFA 3EGWB 3RR8A 2HFNA 3R7BB 1G6BA 4E2FB 3OR1A 1FESA 1SJRA 1UW9A 3HHEA 2UXBJ 2JWNA 2XI3A 4Y34A 2FYXA 4LFAJ 3HLUA 2OPPB 1D9FA 4C7QA 2FJXA 1RKIA 3MUMP 4OFZA 1T95A 2D3ZA 3TW0A 4CH0S 3HJFA 1T9UA 2VC0A 4DI6A 1SPBP 3C16A 2LQ9A 2QX0A 4WZMA 4K4WA 5K8OA 1CJTA 2DB1A 2MLZA 3KUGA 4YDXA 2VPZB 5A8RA 5HQLA 2VBZA 2ABYA 4ZCLA 4F0HA 1QAIA 4RZRA 1W2BR 1HIYA 1IKWB 1Q7YT 5GAGI 2KO1A 2KT5A 1VHFA 4PR6A 2G1DA 4EFAC 2FJEB 2W9BA 1WKLA 2X7IA 4ED3A 1BY9A 2OPSB 3MMBB 4DPUA 2U1AA 4CM2A 2YNIA 4KGMA 2BQUA 1FJEB 2XZWA 4L73A 1CJTB 3OJUA 1S10A 4JV1A 1T9YA 2BJ3A 4OHXA 4RBVA 5E2QA 4Y2IA 5B7WA 2K3KA 1I3OB 1TK5A 4NLYA 1HBUA 3T5JA 3V6HA 3HSDA 4TVAB 5KG2A 2WTFA 1FXLA 3BM7A 3MEEB 4ZVTB 3ISZA 3AJ2A 1UA0A 1SIWB 2OFHX 1PBAA 3VR1A 4OMFG 4JI5F 3V4IB 2LYVA 1QAJA 5KFDA 1JWWA 4DR5J 2GJFA 2A3JA 2HNZA 4JBCA 2YKMA 4ETZA 2ZH4A 4GVLA 2W9CA 4PG5A 4USTA 3AY0A 1RLDA 2IJRA 4KH0B 1EX8A 3H2LA 4AXJA 3T9NA 2QZ8A 1IKXA 1RA7A 1VQSA 2CVIA 2RJZA 3AHPA 3D67A 2J8SA 1X4AA 4WP3A 2AJ2A 5E3QA 1TL1B 2VG7A 3M32A 1M90T 3BPDA 2E5IA 5I3UA 2R2UA 4QJVA 2C3PA 5JXSA 3NOGA 1U47A 2J6TA 2VOOA 3UD4P 2AP6A 4NXNF 3K5PA 3RB0A 1BGXT 4Y2AA 3CCUS 1UZDA 2VG5A 3ISND 1S4EA 3EE3A 1UVKA 4DWIA 5GAEU 4M5LA 5HLFB 2ZE2B 4ELVA 1LEOA 4C11A 3KFWX 1N54B 3BSOA 3HO1A 3M1VA 2Y9HA 1KLMA 3HD1A 2IMWP 1IKXB 2KG0A 3GSIA 3K89A 2W7OA 2VPYB 4I6YA 5KFIA 2CAJA 3W5XA 1K9MT 4KGVB 3G82B 2IFXA 3VQTA 3C14A 3VGVA 3CJTA 2IJFA 4V1Ak 4UY8T 3N28A 3QIPB 2R7OA 3RB4A 2M4MA 5LMNF 5EWFA 1WOSA 2G0IA 3HFVA 2BA9A 1FRJA 3KK3B 2ZD1B 4Q43A 1S9EB 1FDAA 1YLXA 1S1VA 2HLTA 1XMOF 3NGRA 3HZGA 2W2PP 2J0WA 2CQGA 1M1GA 4M5NA 3BO2A 2C3UA 1N36J 1Y11A 1HR0J 3M1VB 2KH9A 2MKYA 4O4GB 2VQEJ 2ZH5A 1REGX 2LU2A 1HQUA 2QMUB 3W1YC 4V19X 1LNQA 2VPWB 4PXEA 3TANA 3DRPA 1NK9A 1FHTA 2P2CB 3SCJE 5F8IA 2OTJS 1ITPA 3JSYA 6FDRA 3DLEB 4IH5A 1S48A 2P9EA 4C2MA 1PJ6A 1S7HA 2IBOA 1F0XA 4QWBA 3K57A 2HHSA 4D3HA 3O44A 1HQUB 2FLOA 3DLJA 1ZA1B 2OO4A 3OT9A 4M8LA 2CJQA 2EKNA 4CLYA 1U48A 4OJ1A 2G13A 3IRXB 1WD6A 4ES1A 3BYRA 2NZ4A 4I2QB 3B82A 3EZOA 3NKYA 2UVRA 2CPEA 2W24A 1WHYA 2FHJD 4C98A 1S76D 1RAJA 1IUJA 2CQ1A 4AXIA 2WBRA 2CG8A 2UV8G 1WG5A 1Z2LA 1KTVA 2FJBB 2M2BA 2ZBRA 4AUKA 4ITSA 2BR0A 2EK6A 4L3NA 1HBOB 1X9MA 1UTAA 4K59A 3PYEA 3LF0A 1HBMB 1DTQA 4B9TA 2V8HA 5ETNA 1A9NB 1FXRA 2OD4A 1Q0NA 2PMHA 2YKAA 2PEHA 3D6MB 3CC7S 3QWUA 4DCOB 5DQHA 1S1XA 1RXOB 3CJ5A 4OYWA 5HL7Q 3I6PA 1T7PA 2R8KA 2HHTA 3GG0A 1RISA 5D6GA 5EX3A 1C1CB 4ER8A 3Q8VA 3HHDA 3RBXA 3MOJB 4R25A 1L3KA 2RDDA 4QBUA 4Y00A 4KFBB 1RZMA 2Y0SD 5DLFA 2LA6A 3LPEA 2QA4G 4IOBA 4OZ3A 3JAMU 1MWYA 1HNXJ 2GS8A 2DXEA 2BMBA 4FYXB 1VISA 4NLDA 1ZAWA 2CQ3A 3GCWP 5KFQA 3CCMS 2LA4A 2R7WA 3A4TA 1GH8A 1EHWA 3G6XA 2XHWA 3KHGA 4J37A 3EICA 2FHMA 1YBAA 3CJ0A 3GV8B 3H0PA 2H65B 3G71S 4WFBQ 3EX7B 4ECYA 1JXLA 2R7SA 5A8WB 2A10A 3JTPA 3CMES 1AYEA 4EI2A 3OFHA 1C4CA 3GFYA 2PE8A 2RRNA 3FCVA 3G9CA 1RWUA 3CCZA 3CDAA 4MFBA 2D74B 3M8ZA 1S0NA 3G82A 3J81j 1RT7A 4TYAA 4C3KA 4LF9J 4KY3A 4FS1A 3E3XA 3T5LA 4ZVQB 2F63A 2IC3B 2GVZA 1TV6B 2DNQA 2I8EA 2YWKA 4QIEA 3ET6A 2DNRA 3C8YA 2CXEA 2F1FA 4CLZA 2E5LJ 3CGIA 3LAMA 3P96A 3IWLA 3R2CJ 1SC3B 2WSCC 4JI6F 2KM8C 3QGPA 4CO0A 4NZ7A 1EQ0A 1Y0HA 3H8YA 1HNVB 4DSJA 4LBHA 4CO5A 3DI6B 4B3RJ 3OTEA 1YIJS 2HFUA 1O51A 2IRXA 3NMRA 3AOBA 5FLXY 3F73A 3QSIA 3U02A 1PC5A 1F5BA 2VD3A 4NI2A 3Q8RB 3UCUP 4DV2J 1S9GB 2GV1A 2HQDA 1JLFA 2VPXB 3QFWA 5HI7A 1T05B 8AT1B 1AA1B 2B0GA 2DIUA 2ILYA 2ZDOA 4A8QA 4B3RF 5HMZA 1VGYA 1E6YB 4DN9A 1H2VZ 3SZ2A 2NSCA 4YFUA 1DFDA 2CNLB 3W3SA 1WSVA 4Q2LA 1R3NA 3MECA 1BQXA 1KQGB 5IC4B 3EUNA 5EUHA 4X4OA 2AGPA 4RO0A 1SKSA 3BDPA 1S0VA 4WK3A 2BVZA 2XS2A 3BPSP 4RW7B 4DV1F 3DLGA 2AEFA 2XMUA 4CLTA 1FWLA 1B3TA 2HZVA 2UU9F 2PI5A 4ZJQA 1DY3A 3BSAA 3MR6A 5IWAF 1DHMA 1UVMA 4PEOA 4EMDA 3MMCA 3I31A 2HS0A 4TYBA 1BQNB 1LWCB 1WHXA 3D3BJ 1U7LA 2ZDPA 3NMAA 1QSLA 2J7WA 2K2PA 1X5TA 2Y0BB 2IAJB 3SQGB 5A2QU 2CJAA 2MSTA 4R5PA 4MT1A 2QLBB 3M2UB 2PDAA 1PCAA 1T11A 2D41A 2EKYA 2QJ3A 3NCQA 4KGXB 4J9KA 2WBMA 5A2QY 3H5SA 3R5GA 3BH6B 5L9XA 1H6KX 3DYAA 3ZNUA 4C0BA 5KTQA 5JVGQ 4ED1A 4C4WA 1TL1A 3M32B 4ZK7M 4R0JA 1YGYA 1MU2A 3LANA 3PEJA 3RU0A 2DJWA 5HO4A 5JUMA 4F4ZA 2BQ3A 4JV2A 2JEJA 4RX6A 1S7IA 3QBCA 1VRTA 1GMWD 2ZD1A 3CXCR 1YITS 1UAWA 2MQMA 3A3OB 1BQMA 1RHMB 2GAHC 5F8JA 1C2PA 1REVB 2ZWOA 2EWHA 3H40A 1Q86T 1NZ8A 2VG6A 1ROFA 1SH3A 2D9OA 3HHLA 2GMHA 3IM9A 1WORA 3C6UA 2I0XA 1TMJA 3DRRB 2KDOA 3QT6A 1BUXA 3GPAA 4L72B 1NKBA 3CCVS 4NLXA 2DD8S 3HSJA 5AE1A 4HI1A 1SB6A 2VZ9A 3GYGA 3BR9A 5GAHI 4DFKA 2HIQA 3GV5B 3HK2A 3IA0A 3DOKA 1OPIA 5A8KB 3OSNA 4F4YA 2C28A 4ES2A 1CJVB 4PABA 2OPRB 3X3UA 1JLEB 4B3MJ 4I6AA 1WG4A 2IIHA 4OZNA 1T3OA 3CO0P 5LT5A 1Q82T 5KFZA 4LF4F 4DLGA 1YK9A 1RCXB 3L7PA 2HGNA 1CSJA 3GJSB 4O3QA 5I3UB 3M8WA 1KSPA 1SV5B 5ETRA 3NAIA 3MM5B 4ZVUB 2HWIA 1CVJA 3G6ES 1G4CA 4YHHF 2V50A 2QGFB 2KRRA 3GYXB 2NPIA 4PG7A 4B9SA 1UEVA 1LXJA 4GO5X 4MKAA 4DBQA 3UE2A 1N5YB 4TU9A 4ILRA 3SMZA 3POTA 1PAEX 5CA5A 1KVJA 3BSNA 3RB6A 3MPUB 1B4SA 2Z2LA 3DDNA 3BKTA 3E51A 4LSNB 2E5GA 3FSYA 1H98A 3M6WA 2HMIA 3NS5A 4OYXA 3I9V9 5HK4A 3S1TA 1LK7A 3VF0B 4NL5A 3CCES 1VOMA 3DM2B 1R8CA 3MECB 4BWJA 2XNRA 1NUEA 2LU1A 3JSBA 4I0WA 3C46A 4IYQA 3D0HE 3POTB 1VQ5S 2W7AA 3OL7A 5IV4A 1FVSA 4CIOA 1KOOA 1HHTP 5E0OA 3E8OA 4RBTA 5F9LA 4TN2A 3TVKA 4DG1B 1RT2A 1SUQA 2ZEJA 4HKQA 2GCFA 4U8VA 5GMEA 2OGUA 1FWKA 1N4LA 2HAFA 2XY7A 2KJVA 1FNOA 3MMBA 3FRZA 4M1KA 1S12A 1VC6A 1U1NA 4FPRA 2C2RA 2GHVC 3CDEA 1S6PA 2PGCA 4C8YA 1XIQA 3DLHA 3QGIA 3NNHA 2BZ2A 2V9KA 4F7VA 2N3OA 3WC0A 5A8KA 2RNEA 3GIKA 2XMTA 2ZM6F 2E7XA 4KKOA 4NEYA 5D3GB 1L3SA 4USUA 2FTRA 1RSCA 4ED7A 2HBQB 1VQMS 5ETQA 3VTIA 4JI4J 1F9EB 3M2VB 5IOLA 3DXSX 3IAS9 3QT7A 1CULB 2ZH8A 4O3RA 3AA9A 3R5BA 3D54A 4FBTA 2DO0A 2AJ0A 2MZJA 5KFGA 2R7XA 3HVWA 4F50A 2YNFB 4P9SA 1OYEA 2D9PA 3NG8A 2WB1D 4KO0A 4RW4B 4X64J 5HN0A 3U1MA 4AT1B 3BSCA 4NYZA 3CTRA 3IWNC 1RWOB 3ZZTA 2GQCA 2LFVA 4GKKJ 3BF4A 1JXEA 4WKYA 3TA2A 3TJ9A 4L76A 1U02A 5D8HB 1U8WA 4N41A 4B3SF 4CM0A 1DTTA 2JLGA 4K4YA 3IAM9 1FE0A 3R7NB 1TKZB 1FA0A 2VFUA 3W2WB 4RU9A 4CNZA 3THTA 4KTQA 1SJ4P 1VQ9S 3TYTA 1CULA 1Z1ZA 2HW3A 3IGVA 1DURA 2NSBA 1E6YA 3J80Y 2RUGA 2VH7A 2WRMA 1CJVA 1YJUA 2L08A 3I9ZA 2C2KB 2O3DA 4OJGA 3UDCA 1W26A 3W9IA 2RQKA 4ZPTR 5SZTA 1SC1B 3EVWA 1S77D 4IOAQ 1Q8KA 3GONA 3MCMA 3R6LB 1YKWA 3UDVA 4P7VA 3BO4A 1VC0A 4F3OA 7FDRA 3LP0B 1AW0A 1WC3A 2W2OP 2AJFE 3H2VE 4DJBA 1C4AA 2MDAA 3FBEA 5ETOA 1GK8A 3MMAB 3DHWC 2XCAA 1PO6A 2CFXA 1VQ4S 1KVIA 2VQFJ 2UVVA 2ERRA 1UKUA 2MQOA 1KQFB 1I5OB 4ZLPA 5K20B 3QWPA 1HARA 4K50A 3SDEA 3C14B 3MFIA 1RB0A 4PAAA 3GP9A 4YS2A 3PO4A 3H5UA 4LBPA 1RBAA 3GJTB 2RB7A 3D1OA 3T5KA 2HIYA 1RWXB 4DR3J 3HVTB 1NMEB 2VQFF 4OYBA 2H9ZA 2Z2MA 5L1JA 4NMXA 1YRXA 4P71A 3UD5A 5L1KA 3EYZA 3JQMA 2AX0A 4KRWA 3OJSA 4WFXA 1XEZA 4LBIA 4IQXA 5HLFA 3IXQA 2C22A 1HI8A 2KKHA 1S0MA 3VGSA 3TWZA 1M5OC 1U45A 2RDIA 4DR1F 2AYGA 1JLBA 1U4BA 2HS3A 2ZBPA 3MPWA 4KHMA 2UXDJ 5FDLA 5KT2A 2ADBA 1WTBA 5M2RA 4DSEA 2CQPA 5B0FA 5KG6A 3W7BA 4NCGB 2UUCJ 3C16B 2E5HA 2XC9A 2AEJA 2CJKA 1Q81T 2ZH3A 4EBDA 2HQGA 3W2VB 3HHKA 4WTOB 2CG4A 3IRWP 5CQGA 1M5PC 4Q5VA 1D09B 2GMJA 3FEXB 3KJNB 1HBNB 1W25A 2AIRB 1UW4A 5LL6d 4P52A 5BR8J 2ZHAA 3RBDA 4RNHA 4DUTA 1MWQA 4FKYA 2F8MA 2PT0A 2V68A 1RTHB 1L3TA 3GIJA 4JI8F 1H7WA 4HDGA 1RU2A 4DG1A 1JNRB 1NH8A 2CJXB 4OX6A 1OMSA 2UVUA 2YKNB 4B3OB 2AF6A 4ZHRA 2F9DA 4IH6A 4MKBA 4LR9A 4Q44A 4DV0J 4KH1B 4ZVHA 2ROGA 2HK3A 2J9EA 3DRSB 1RTJA 2BABA 2VBWA 3IR5B 3FGVA 2CQCA 2X3DA 3HD2A 5IT4A 1P6TA 3HI9A 1K8AT 5K9FA 2PI4A 2G0CA 4M5JA 2C3MA 1JKHA 1Y00A 2Q6CA 2XZDB 3MM5A 1KONA 3LWLA 3K58A 3Q2SC 2FQQB 3FEZA 4K7QA 1JLGA 4ID5A 4WFZA 1ZM2A 4FN5A 3DLLQ 3R27A 1Q8LA 3FC9A 2DR6A 3OHAA 1WUUA 3FKBA 2VFVA 2ZVSA 2WVDA 3GTYX 3KKFA 1F60B 5E3RA 4NA3A 2XO6A 3PJXA 1NCLA 2R4FA 3SV4A 1NDKA 2BE7D 2VUGA 3H59A 4F04B 1R0AB 1UMJA 1EKSA 4K4XA 1S97A 3DRSA 1CQMA 2DBBA 3CW2C 1S99A 1KP6A 1DJ0A 1MLAA 5IT0A 2I9SA 4KV8A 2ROEA 1TTHB 5KFBA 3L3CA 4A8KA 1YJTA 3MCOA 4E0DA 2GFFA 2VOPA 5IT9Y 2RKIB 4LF2A 4O4GA 4NYOA 4J90A 2R8JA 3LPYA 3HVAA 4OX9F 2DGTA 3UN2A 4YB1P 2XWXA 2CWKA 3BEGB 1PYTA 1SKRA 1PKUA 5DDQC 2GO9A 3N5BA 3TO8A 4F8RA 4M5HA 3ZFVA 1XNQJ 1JB0C 3BR8A 2ZOMA 1X9WA 4K5RA 1NHUA 4ZKAA 2MKIA 1FEEA 3NNCA 1IBCB 2I2YA 2V2KA 2L9NA 3J80U 5KFEA 2HHXA 3TQ1A 3PG9A 4YB5A 3C2PA 4OI2A 2FB0A 1QSYA 1J27A 1RAGB 3SEOA 1GMVA 1T9VA 1IN0A 3QT8A 5F41A 2IHR1 4DX7A 1J5OB 3LP0A 4PUOA 3OUYB 1X60A 3I55S 4USJC 1YJRA 5HANA 3HVRA 5T7LA 2GA7A 4ZLJA 1Q8BA 2QYCA 3RAQA 1Y5IB 2A0FB 4ZVPB 2FGOA 2LKZA 2OFGX 3BQ2A 1QDUB 2LQ5A 3CCJS 4ANCA 2Z56B 4P72A 2FJDB 2LQ8A 3CE8A 1SQEA 4PG4A 4WPAA 4N56A 5LXRA 3M9MB 1AUSL 2DK2A 1HPZB 3Q83A 4OV1A 3JSRA 5LOQA 4JI0F 4IFVB 4KGKA 4JI7J 4M95A 3UQSA 2IRUA 4LSZB 1OSCA 4KSEB 1R89A 3CNQP 3D0GE 1U26A 2CPZA 1RADB 3D1QA 2N82B 2LECA 2VA3A 4PCQA 2BEFA 2R8GA 4WZQA 1J2VA 2L9DA 3IG1A 4ZIWA 3FDSA 1MMDA 2KG1A 3UCGA 1M1HA 3HHLB 3UW1A 3WZ0A 1B0VA 3CJ4A 4DDFA 5J2PA 5KT5A 4ZPCA 4B9NA 4DV4F 1RWWB 1Y3KA 2CA9A 3JYTA 2M3DA 4ZPDA 2YNIB 4JI4F 4Z2XA 3NL0A 1IJFB 1MW7A 2WOMB 2FZCB 1S0OA 1BHNA 3FZBA 4TKTA 1HBUB 1WOPA 2CADA 2CIMA 2NXUA 3HULA 3PYGA 4HACA 4YB6A 1JLQA 1K1SA 2OELA 2V8VA 1X0FA 3DDKA 2NUUG 4HLBA 2AWZA 2NQPA 4PZVA 1KC8T 2CZ4A 2DH7A 1FJCA 4LSLB 1HNWF 3SSQA 2YKQA 1JLAB 3QJPA 1NSPA 4DL2A 2UU9J 2MQNA 3VGUA 4AQYF 4DPTA 2GIRA 5I3PA 1VBZA 3JQJA 3NY0A 4B3SJ 3DNCA 1VQKS 4M5MA 4G1QB 1P8GA 1V3SA 3W9JA 4KHRA 1BE4A 1X4FA 2QSWA 5J2MA 4NOHA 4Z7YA 5KFJA 3PW0A 1T02A 2MKSA 2YWWA 1F2HA 3EM1A 1U2RA 4QQBA 1R7IA 4DOZA 2DISA 5B0DA 4QYZK 3EVMA 1S5ZA 2B7BB 3I82A 3PACA 4ZVOB 3BZQA 2OI2A 3ZZYA 3FEYB 4C48A 2H5JB 1OO0B 4DLEA 3K0JA 4J9NA 2B6AB 3C6UB 3P8BB 1VMBA 2NXEA 1QJHA 2W2NP 1FRIA 2CPJA 3BBBA 5HBMA 3ILJA 4OYAA 5LM7E 1IBLF 2DRBA 4X4QA 2FJAB 3D9BA 2KM8B 2DT9A 5BJRA 5DZ6A 2FJVA 2XI2A 4WP9A 3TAMB 2J7UA 3PV8A 3BGLA 3HFKA 3BH7B 2YWGA 2I6WA 2DNOA 3CDWA 4U6PA 3R2DJ 4PXDA 1RT1B 1HHQA 3R7SB 2MJNA 3BJYA 1RLCL 5LSOA 3CF5Q 2M8HA 3RJMB 3GWCA 3D6TB 5L9NA 5HROB 3UVJB 1S6UA 4H4KC 4ZPWR 3UN3A 3HT3A 2MKKA 4I69A 1J5OA 3DCAA 2W4CA 3AD8C 3SFGA 4A8OA 1IXKA 4X4TA 2KT2A 3VAFA 1U1RA 2HRUA 4ENOA 2I5JA 4FYVB 3PRBA 1QY7A 4DV5J 3X1LB 1X7VA 3OFEA 2RF2A 1Q7LB 3EGNA 2CQ0A 2RS2A 1R6YA 4F2RA 1SVDA 4YMEA 4F4KA 2E1MC 4B9LA 1KFDA 2E5JA 1FKPB 1SBRA 2N7YA 3HJVA 2JVRA 4KT0C 4AYBD 2HMIB 3UPFA 2ASDA 1EIYB 4ZA1A 2DRDA 4HDHA 2KU7A 4O3SA 3RZAA 3WQPA 4RW8B 4TQRA 4FF2A 1XNRF 4X2BA 2V4QA 3CB4A 2WCXA 1I94J 4J7CA 4LQ3A 3OL9A 2C1EB 5EWEA 4ZP6A 3JSMB 1DARA 2FGCA 3CCSS 2DGXA 4KO0B 4RW4A 2LLZA 3GB0A 3LP2B 4GO7X 4HT5A 2WW8A 4O23A 4BWMA 5CABA 4MKYA 1XNQF 1KQSR 3KNAA 3MAAA 2H4WB 3ITHB 1C0UA 2G2YA 3UO0A 1YJ9S 1FKAF 2WSFC 1FDNA 4ZDNA 3MEEA 2HHHJ 3AD9C 1Q5YA 2WVCA 3G8QA 5F8GA 2KI2A 3KNGA 3KLGA 3I0SA 2UXCJ 1N0VC 3DGVA 5J2NB 4HHJA 1NKCA 1SIZA 3MM8A 1HWJA 2NREA 4XK8C 3V6DA 1F9FA 3OR2A 2H5IB 4NYPA 4MH8A 4JB8B 1IBKF 4DPWA 3K5NA 2HHHF 2OMOA 5DG7A 4ECQA 2HWTA 4WIQA 3SYZA 4FP9A 2UUWA 3H98A 2U2FA 1DLOA 2H54B 2HZCA 1RI7A 2GNKA 4CLKA 4DV6F 2B4PA 1X9SA 1YBTA 2ALZA 2C2DA 3DOKB 4OLPA 1X4CA 2B8PA 2GQ2A 2W9AA 1EAYC 2OSRA 1B99A 2ZHOA 2OIHA 2A18A 2YH0A 2F4VF 4GVBA 2BJ8A 2GVZB 1APSA 5T41A 5KFWA 3D6FB 4PXCA 4CP5A 2C3YA 3L7OA 4NCBA 3H90A 3J7AN 1R8BA 2MQ8A 4RW9B 2MZSA 4PKDB 5CD4A 1WEXA 1GAOA 5FLXU 2HNZB 2DVIA 2BOAA 2RKIA 2YX1A 4I56A 4NX9A 5KFYA 2FVCA 2HNYB 1IQZA 2EVZA 3NP5A 3OW2R 4ECSA 1DLOB 3NGKA 4GKJF 2B56A 3Q22A 3CUNA 1SL2A 1UJ6A 1MSWD 1JJHA 1HMVB 1UZHA 2EK1A 2H48B 2RU3A 5C5JA 2VODA 3P6YC 2IY5B 4F26A 4NASA 1C1BA 3TEHB 4A8FA 4U67Q 5KFAA 2JLEA 1ZYQA 1TUGB 2BANB 3FCWA 4Z37A 3PY8A 1U09A 2DNYA 1U8SA 3I4HX 1JLBB 2IRYA 1CPZA 3DLKA 1JNZB 1JLCA 1F9HA 1IR0A 1H74A 2B5JA 3QPIA 1VJWA 1WOOA 1X5OA 1VJQA 3BN7A 3R5JB 1DZ5A 4OI3A 4M94A 2HK2A 1SJ1A 4LVNP 2F8HA 1S1UB 2QMXA 2OTLS 3CC2S 4ZCMA 2KFNA 2DIVA 4EU0A 4QIFA 5GADU 1RWPB 2V69A 4N76A 2WOMA 3RG6A 1M5KC 1HR0F 3MEGA 1UFWA 1TL3B 1X4EA 3WDOA 4DXLA 1MN7A 1TL5A 3H4DA 1S1UA 1XERA 1MMLA 5IC6B 3QZ8A 2VF3A 4UOCA 5KFRA 3PIPQ 4LF8J 3FFIA 1IKYA 4WIIA 3P45B 5CZXA 1A7GE 1VQYA 2LQJA 4EUVA 1HW9A 3RR7A 2B9XA 3CWJA 2JHEA 1URNA 4O0NA 1RT3A 4DPXA 4NLUA 1FJ7A 3HXMA 3QO9A 1ZZFA 2KZZA 5ETLA 1SJ3P 5KAKA 4LREA 4JI7F 4J9VA 4M5DB 1JQGA 1UWAA 4DL4A 3MM8B 1HBNA 4I2PA 2C2OB 2QSFA 2WW4A 4HVZA 3K8VA 4X84A 4UY85 1G3OA 2OEMA 3QMQA 1HMVA 1KVKA 1SXLA 1WC6A 2DY1A 2RE1A 4F0MA 3RRKA 4QPTA 3C6TA 1WJ9A 4NLSA 5K14B 4EYHB 2JNJA 4LJMA 2MKCA 2AJ4A 5L1IA 3M8PA 1LK5A 4NRUA 5T7LB 3ILLA 1ZTWA 3FSIA 3QAUA 5E3PA 2C3OA 3NS6A 2E9ZA 4IR1A 3W61A 1NKEA 1H38A 3ELHA 3JSMA 2XMWA 5MLCV 1Q79A 1TK0A 2DITA 1RWNB 1YJ7A 2R7QA 4WE1B 1RT5B 3MM9A 3ZZOA 3QSYB 4ZJOA 1U1QA 5G0RB 1VHIA 4BHQA 2ZZMA 2ACMA 3LTOA 3PKMA 3DOLA 1HQEA 2CRLA 2XHCA 3ZXWA 1QAXA 2OHDA 1BD6A 3TJ8A 3N0VA 4ECWA 3NXZA 4DF8A 1SI9A 2BJ1A 2OPQA 2Y1RI 1U1MA 2EC0A 5U47A 3CJ8A 5IQQA 3ZZRA 3VALA 4DL5A 1T9XA 4RUAA 2D3O1 2I5JB 2KFZA 2YQ1A 2CUYA 1PYOB 1TK8A 2GGPA 3ENVA 1G2EA 3T19A 3T1HF 1QVGR 4YEAA 2YPYA 1DQ8A 1S1XB 1IWGA 4URQU 3NBPA 3OBIA 5D15A 1C1BB 2R42A 3VVTA 4JI8J 2FLLA 1WEYA 2DGWA 2PIIA 2W1BA 1RU1A 1IWAA 4ZS6A 2CKWA 4QYRA 1F1BB 2FVPA 3M8QA 1S57A 3GYNA 4B08A 4V19J 2F8EX 3PX0A 4DR3F 3NGSA 3MDFA 1YJVA 3KLVA 1VQ6S 3LP2A 2X1FA 3TUPA 5HVFA 2UVWA 2WZ1A 4FXWA 1JXVA 2JJ4D 2K3IA 2WB4A 4CO3A 2XMMA 4DZDA 4IG0A 2YH1A 2B7CB 5E41A 1RK8A 5KG0A 3VAKA 5CH7B 2XS7A 4UUXA 2O01C 1NSKL 1FJGJ 3F56A 2C2EA 4OHYA 1ZA2B 4ZVEA 3T41A 1FDBA 4K2XA 4XO0A 4PQAA 1FE4A 2L3MA 2P5VA 4WFAQ 2XGPA 4DL0C 4A8MP 1HNIB 2RHSB 2CQ2A 4CT9A 1UFLA 4RLEA 4JI3F 1WC0A 2HBRB 3A1YG 1E6VA 3TNVA 2OUGA 4A8SA 3OVBA 1OPZA 1NDPA 1BWVA 1RAEB 2X3GA 3PTWA 3RTVA 1N48A 3G6VA 4CLUA 3KJVA 1NSAA 1I6JA 3V2UC 4QR1A 4OYPA 1H73A 1HFEL 2RQCA 2ZKTA 5ETVA 4IO9Q 4HL9A 3VAIA 3I87A 4OX9J 1RT1A 1NH7A 1WF0A 4N8OA 4W98A 3S8SA 1D8ZA 2FVQA 3QGGA 4DQQA 1RAHB 1UL3A 3CDBA 5F8LA 3CMAS 1VRUB 5D3GA 4NA2A 3TVZA 1KRPA 2UUAJ 3P49B 3BBFA 2KHDA 3LGMA 1H2TZ 4K8RA 1LW0A 1ZAVA 5KFUA 3PKYA 4Z7CA 2EFNA 2UUBJ 5LJ3Y 3KMQA 3N79A 3PHTA 4OZ2A 6FD1A 2VDIA 4QWCA 1OQ6A 4OV6A 1QE1A 1N5TA 1Q8IA 3PYDA 4NLOA 2HRYA 4F4XA 2FPHX 1NLKL 3HZEA 3MAHA 1IBKJ 1CJUA 1FKPA 2IVMA 3BGUA 2ZH6A 4XDCA 2ZH2A 2AMCB 4O44B 5C42A 1REVA 2JX2A 3AOAA 4C8ZA 5J2QB 1FFWB 2QLFB 3CO9A 1ZTTA 3I32A 3DOLB 1AROP 1NBEB 2LP4A 1UVJA 2E1RA 2X51A 2ZH7A 2DHSA 1NJXA 3HVTA 2RMLA 2B6AA 3CDUA 2J5AA 1JJCB 1VRTB 1NK0A 4WP8A 3L09A 1RTIA 3R97A 3M7VA 1WACA 4BC7A 1SQFA 4I2QA 1N0UA 3BYPA 4UUWA 2NPFA 3PR4A 3D2WA 2FLNA 1N88A 1LW0B 2EI5A 2J7KA 2JSXA 3A3NB 3KLEB 3DGPA 3FCHA 3R5DA 3DDIA 4HH1A 1JK9B 4ZPBA 3VVUA 5H9EJ 1NK7A 4B9UA 4I64A 9RUBA 4LSNA 3OFFA 4G1QA 5EWGA 2XS5A 1TUWA 3I0SB 1YVFA 5EGYA 1XMQF 1WI6A 2NYIA 5SUHA 4DX5A 2W9BB 2EFGA 3MD1A 1JLAA 4TLQA 1T03A 1FWPA 1IM6A 2R7UA 5HVGA 1URRA 2QRRA 5KG7A 1SV5A 2HNDA 1T9WA 2L9WA 3LO3A 2BUNA 3M30B 4P2XA 2MGZA 3G8SA 3O6QA 2BE9B 3T3FA 3J81Y 2DEIA 1NDCA 1UEKA 2YPZA 5LXYA 2DGQA 2ZBQA 1PAUB 4MJKA 2WONB 4C8MA 1WDTA 3CD0A 4P2SA 3PXGa 3PW5A 4JI6J 3KOAA 2FHJA 3GFZA 2KXHA 1V3ZA 4RW7A 1FFGB 4DSIA 3MAQA 4F4WA 2CJBA 4DX8H 4E8UA 2HPUA 3QIPA 2DGOA 4DU7A 1LW2B 4K4UA 3CD6S 1RT6B 1ZAXA 2F4FA 2RSQA 3QNWB 4O4RA 2UP1A 3BQ1A 1UVIA 1N33J 2WONA 3GFHA 1QE1B 2J9CA 2XYHB 1Q1KA 3Q89A 1N34J 1RHQB 4C8OA 4DR4J 5D78A 5EX0A 1CC8A 1DBDA 4ED6A 5KG4A 3OLAA 4KHPJ 2M70A 1V5IB 3GJRB 4QZVB 5HMYA 4C8LA 2NUHA 1X4HA 2RF2B 1Q16B 3M8QB 2OPSA 1N6QA 2MTLA 2IDLA 2POKA 4J9UE 3DRYA 1KQKA 5CAAA 2VDHA 2BW7A 1RTIB 5DS7A 1S1VB 4X4RA 1IKVB 2EFQA 2VG5B 3KK1B 5J1EB 1WDDA 4YUDA 3M9NB 3TI0A 4G1PA 2AJ1A 3E2EA 3NGDA 2BKPA 3SV3A 3D66A 3OVSA 2VASA 1TKTA 3MTJA 1LOUA 2EG1A 1D8YA 5C24B 2AYEA 4K2JA 3TZXA 3DLBA 4P2FA 2HHQA 5B0EA 3P3DA 3VAMA 4KPYA 3B54A 2OAUA 3US5A 2W7PA 7FD1A 4DV4J 3PO5A 4CO1A 5H9FK 2XLJA 1TL7B 5I3QA 3V6JA 3L9ZA 1VBKA 4QR2A 1WKKA 4KR0B 2XY5A 5AXKA 5KG3A 3M6XA 4M5IA 1YX2A 4OHZA 4YR2A 4DL3A 5C24A 2FHOB 2XG8A 4EZ6A 1C0TB 1NDLA 2KYZA 3J7YI 2B8QA 3CCRS 1W2IA 1B64A 1F2GA 2MKJA 4K4ZA 1NZAA 2J0XA 5JVHQ 2JLFA 5DDPC 4CZCA 3HT0A 5HP1B 2K1RA 1R8PA 1NJWA 5C25A 3FVYA 2H5EA 5F3TA 2VB6A 1UCNA 1WSRA 3PVXA 4HTJA 3EJMA 1RT4A 1OY9A 4DUZF 1FKOB 3MXHP 2P9CA 3UN5A 4MKVA 1VIXA 2H3EB 4CRJA 2IDEA 1A0OB 1UJ5A 4A46A 5JJBA 3K5OA 1KBRA 1DRZA 3A12A 4KE5A 1P1LA 1TQLA 1FX2A 3EMTA 3PX6A 1WC5A 1YI2S 1VC5A 3HHLC 1XNRJ 3T1YF 4LF5J 3ENWA 3QAEA 5BYSA 1I94F 4CWBA 2W9CB 2XYPB 1ZS6A 2CQHA 3MR2A 2VU5A 4OYMA 3ZZUA 1NAQA 3CD5A 2HHVA 2P9GA 1BC6A 1F6TA 1BQNA 2HBZB 3FJ2A 1XN9A 3KLFA 3ISNC 2RS8A 1RHKB 3GG1A 3J7YU 1KKHA 5C25B 1TL4A 2BKOA 2DY9A 2E44A 2LCWA 1XR5A 3LP1B 1P27B 4UTGA 1V5VA 4ICLB 3C15B 4CT8A 5CCLA 1JLGB 2M7SA 2FVRA 2HNYA 3N4WA 3P4UB 4UT4A 4OI0A 5KFKA 2V4RA 2Y1JA 2ZH9A 4CLLA 4J9QA 1N32J 4RWXA 3IGNA 3CC4S 1Q4RA 1RWMB 1YSJA 4RW9A 5H1SV 1U1LA 3CJKB 2D3UA 3RB3A 2ADCA 5G0RA 1TAUA 4PPZA 4ED8A 3NNAA 3MCNA 5EDWA 4JI5J 2DHGA 3OFGA 3NOCA 2R2TA 3OTBA 4B02A 4PXBA 5F8MA 3GILA 1JJ4A 2N4CA 2Z30B 5J1PA 1GXTA 3UFCX 4MFBB 3BBCA 1TP7A 4BC9A 2DPJA 3MPDA 2WAQD 3AQPA 3WIUA 2HWHA 1JLCB 1T03B 3MR5A 1VQOS 4G6VB 2A2DA 3IO1A 2P8IA 3RUBL 3W62A 5HP1A 1EKRA 1BLUA 4OQJA 2IM1A 1KD1T 4B9VA 3TOQA 2YKPA 1U24A 3EXCX 5H9EK 4ED4A 2XMKA 4MMOA 5CYMB 4JOUA 4ZVRB 3K2YA 3SQGA 4CNYA 3MURP 4LSLA 3EDQB 5E3CA 4IRCA 4F02A 3NEKA 1EARA 4BCAA 2J8AA 4JI3J 1LWCA 1CS4B 2XO7A 2QN6B 1H2UX 4I7FA 3M9OB 4QOTA 3QZ7A 3OL8A 4USWA 1FD2A 4NMLA 2HQIA 1L5UA 1JIHA 3IS9A 2CVEA 3OHBA 4ECUA 3D6HB 1XMBA 4LVOP 2XQCA 2IAJA 2HS4A 5HQMA 5L39A 3FFIB 1QUVA 3WHIA 1HBOA 4Q0BA 1VYAA 4JUZA 3RBEA 4UQGA 4LF4J 2GQQA 3AB2B 3W64A 2EBEA 4X66F 4ERDA 4DV3J 2Z58B 4ZLLA 4DV7F 1OY6A 1EB0A 2D3OR 1YJWS 1Q53A 1WKJA 4XDDA 4J9RA 1VCTA 4K4SA 3BGOP 3DOMB 2FC9A 4H4OA 3AD7C 1LXNA 2E1PA 3HPOA 5CYQA 1PGZA 2MHEA 4DR7J 3KK2A 5KFVA 2MXYA 2W8KA 4IO1A 2MQQA 3IP0A 1LQ9A 2IA6A 4NPOA 5E7OB 1J5EF 3EZUA 4USIA 1IBMF 5B0BA 1D9AA 4DV0F 4ED2A 1QLNA 3AFGA 3AODA 3CJRA 2VKZG 1XR7A 2H51B 3M2UA 3DI6A 4N8NA 5L8RC 4MYUA 5A6WA 3I0RB 4C0HA 3MHYA 5DGAA 4J9OA 2KYXA 2B9EA 1M5HA 3NBPB 1X8DA 3BREA 3M2RB 3UI3A 1D3WA 1GEHA 3V6DB 4DR6F 5A76A 3KLEA 1RT2B 1SUQB 1OQ3A 2V2ZA 2W4PA 1L3VA 2ASYA 4F0KA 1U25A 3NLCA 2E7VA 3PFOA 4IDKA 5KFHA 3D5MA 5KFPA 1FERA 3PFEA 6AT1B 4N47A 2D1CA 3DRPB 3W8PA 4DR7F 1NHVA 5C7PA 4XPEA 2IM0A 3LGNA 1S4FA 1VDHA 2V2QA 3KHHA 3U1NA 2NS1B 1B0PA 1XBWA 4FYDA 2PD1A 1AFIA 2G2ZA 3CEDA 1FFSB 2FVSA 2F65A 4ZPAA 1T3NA 3ET6B 4X4UA 4AL7A 4Q8FA 1IVZA 2QYGA 4ZHRB 4OYZA 1KDNA 4CTAB 3FQKA 3W65A 1VBYA 2FZKB 3OTDA 1K47A 2HQFA 4IG3B 2EFPA 2HVDA 3A8IA 3FK4A 4FNHA 4NLQA 1TKTB 1AB8A 1FI4A 2CPXA 3ENQA 3KG1A 3MD3A 2J9DA 2HYIB 3HCXA 4CI0B 3MWBA 3U27A 1V6HA 2I38A 2VKRA 1TUVA 3R6GB 5HJXA 1PILA 2CPDA 3BB5A 4X64F 2JEFA 2NXNA 3NS7B 3GIMA 2PFFB 8ATCB 2H1YA 4ANEA 1UVLA 1VBXA 4DFMA 2J0SD 2DCLA 2FC8A 1NPRA 2Y8YA 3PDNA 1HYSA 2QFIA 2WVFA 2DPIA 3R5CA 5CYMA 4LRDA 2BQRA 5HBMB 3SBMA 1HQEB 2F40A 5AJ3F 3PIOQ 4EO6A 1WG1A 2N7CA 1N8RT 1Q78A 1DQAA 1PSDA 3GLJA 4KAIA 3MOZA 1U0HA 3ZNJ1 3OD2A 4ELTA 3MEKA 4LF1A 5IXUA 1U49A 1QTNB 1LWXA 4G1IA 4P10A 4P75A 4RR5A 5GAEI 3OTOJ 2V34A 2YQ0A 5KFLA 3EVOA 2VG7B 4A47A 5BXIA 4TQSA 2E5LF 3WX4A 2R9LA 2G0JA 2JEGA 1D9DA 4LFBJ 2NCKL 4OZLA 2HHPA 2Q6BA 4WYLA 3CCTA 2A2CA 2QFJA 3AJ1A 1EQMA 2KN4A 4LQ9A 5MAOA 3Q24A 3DKDA 2X1GA 3DN9A 2NYHA 3BQ0A 2DRAA 1T05A 2JZ5A 4LIRA 4LFBF 4LF9F 4F3MA 2JOQA 3UNYA 4NLPA 2V67A 1H7XA 2DXFA 5ETSA 2ZBIA 4DL7A 2E7WA 4F2SA 1X0PA 3A3PB 4PPDA 5ETKA 5CD4H 1TKXB 4TY8A 1X4DA 5KT3A 3HP6A 3KG0A 4KQZA 4K5SA 3JTNA 2QLWA 3K59A 2BYCA 2ZH1A 4RUCA 1ZZNA 3F41A 1FJGF 5THWA 5L46A 3OVAA 3V6KA 5LMUJ 4CH7A 3AXKA 3A8JA 3M6VA 4DU8A 1S6OA 1M0SA 4KYZA 3HX9A 1FK9A 1YQHA 2AHOB 2F3JA 4XIUA 2BBEA 3OV7A 2HGLA 4DUZJ 1TKDA 1D0EA 3TAMA 5IWAJ 2XM3A 1FF2A 5HQ8A 4TNOA 1TFWA 2HZAA 1VQ8S 5A0YA 2BKNA 4LRFA 5ETMA 4U7UD 2ZC3A 4OLOA 3IM8A 5HATA 2V4JA 4DQIA 1CJUB 3PZPA 3DOMA 4HI2A 2WVEA 4B3TJ 1S49A 2MLYA 2F5GA 1U0HB 2NLWA 3L7UA 1SKUB 1YRTA 1G7CB 2AW0A 4LUBA 4WJBA 1LKZA 4ECZA 3W2VA 4MIBA 1OYDA 3IC1A 1C0TA 2AYMA 3OLBA 3PYFA 2BANA 1EETB 5DRKA 3D1HA 5DJBA 5B0AA 2C2NA 2DNZA 2MHNA 2BE2B 2UUTA 3EGVA 3FQLA 3V5RA 5GADI 3AJDA 1N5SA 5K8PA 1FNXH 4FVCA 3DLKB 3L95X 4L6V3 4X4VA 4C8KA 3ILIA 4WK1A 1OS5A 3U7JA 3TR5A 3C19A 1GMWA 5DGBA 1VQLS 2QLXA 3KLIB 3TA0A 4P7TA 1H72C 3U1LA 3RW6A 2MY8A 4DN0A 3ZO7A 3N6LA 5HROA 3R1LA 4NLTA 2JFDA 5FDLB 2EG2A 3ZC4A 3QRQA 3GSDA 4NXMF 2B4VA 3K17A 3QIDA 4X4NA 5DQIA 2YNHA 4W90B 1QAYA 4RBUA 2HBYB 4ID8A 1X4GA 3KLHB 2GO8A 4OYOA 4RW6B 2ZNYA 3DU6A 4C6AA 4CO2A 2VICA 4CLFA 1YDLA 2CJYB 2ZWPA 2BM1A 4NEZA 5L1LA 4NLVA 3VV2B 2V8GA 2HFOA 1UA1A 1MN9A 1LWFB 1B7FA 3IG1B 4DV5F 1NHKL 1X31C 3OQ2A 1Y7PA 3NRBA 1R8AA 2HLUA 2Q3PA 1CJKA 2Q1LA 5F9NA 4RU2A 2QL5B 2RD5C 4X65J 4YQWA 4DUYF 4X62J 1RYRA 2MB0B 4K0KF 2ASLA 2F4VJ 3N01A 3M2RA 2W8LA 2ZBCA 2IYIA 2GZOA 2YBVA 3NCRA 1F3FA 1HD0A 1V3RA 1WF1A 3WX8A 2FY1A 4FF4A 2QL9B 4HACB 1S1TB 4S0MA 4Y0FA 3QFHA 4QIGA 2J6UA 1R27B 4CCHA 1P9QC 3G4SS 5D0RA 4A4JA 1IKWA 4O3PA 2E9TA 2KTQA 4ID5B 2XNQA 1SL1A 3KTQA 1YHQS 1HW8A 3GMGA 4NWBA 1HWKA 2M9KA 2YX4A 2R7VA 3O8WA 2GMLA 3UVJA 2JC1A 4Y2KA 4ZVFA 2KT3A 4ECVA 2V9WA 3QJJA 1XQIA 2RIJA 4QR0A 2RAQA 2IM2A 4NLRA 2DCUB 3IBFB 2V63A 4OZJA 2PFDA 5K8NA 4ZVGA 5IM0A 1IR1A 1DAXA 1NPKA 3PEHA 3IN5A 1AUDA 4ED0A 3EGZA 2DNLA 3EZ5A 4HR2A 4RUHA 1J5EJ 3GZ7A 4YHHJ 2E9RX 2DO4A 2Z2ZA 1RTHA 1VRQC 3V81A 1TVRA 3LALA 3V4IA 4A8XA 3RRHA 5F0WA 4I6WA 5AE2A 1QTMA 3TZWA 3TUZC 3C15A 5IM0B 3KLHA 4AFFA 3J7ZT 4RW8A 4OI4A 1NK5A 1UVNA 2JDJA 3CIZA 1TZ0A 3OL6A 3JB9k 3MTKA 5J1NA 3DMJA 1RAOA 3CD7A 5KFTA 3O5TB 4WTYA 1TVRB 3UDEA 4A8YA 1VQ7S 3LH2S 1NM2A 3I5BA 3TJAA 4DS5A 1K0TA 1IQTA 3FZ2A 2PMZD 4LR7A 3O3LA 2ZNZA 2BJEA 2J0QD 4P73A 1SJQA 1RCOB 4DR2F 4FS2A 1M1KT 5DQGA 3B4MA 1SQGA 2MZTA 4F25A 2CNKB 4TU7A 2FLPA 2MKHA 1HL6A 4XAKA 4QWDA 2VA2A 3MR7A 1GXLA 3OR2B 1HWIA 2EPIA 1GMUA 2GIFA 2ZE2A 2YWEA 3KLIA 2QO3A 3I4PA 3R8YA 5E33A 3RW7A 4YR3A 4PG6A 4GKJJ 2ZUGA 2ASJA 2OLWA 1O0PA 3D3CJ 1NSQA 1FRXA 2OKQA 3UCZP 1RT7B 4O0IA 1O5JA 5C2GA 3AT1B 1K0VA 1AZSB 2LMIA 2FJWA 3LA0A 2CYYA 1U0SA 2JC0A 4NCAA 2YNGB 4URSA 4R8UB 4DR4F 1MROA 2VFTA 2FHKA 4JV5F 3DC2A 4MIAA 3MEDA 4ATNA 2HVHA 3R5AA 2MJUA 1HNXF 3JS9A 2LXIA 3BKUA 4EBEA 2J76E 3D4JA 1K44A 1UETA 1EZZB 2NXCA 4C3LA 4WFNQ 2R2RA 4N77A 1HHSA 3SSRA 3V81B 4PQUA 1MG7A 1WC1A 2RHQB 2MSSA 1TMMA 3AXMA 3IBCB 4KBIA 3CJQA 2R2SA 3TA1A 5J2NA 3SCIE 4DEZA 3JTOA 2B43A 3HSGA 1FK9B 4EEYA 2R7TA 3GU0A 3K8WA 4WU3A 3H42A 3UR0A 5GAHU 4Q8EA 1WF2A 8RUCA 1N56A 2M88A 2OMLA 3F44A 1TELA 4QW9A 3L4BC 3PR5B 5KT7A 1ZPWX 3VAJA 4DF4A 1OIAA 4U96A 3GV7B 2QC3A 2XTJP 1HKAA 3PJ9A 4L74A 1Q5VA 2CZ9A 3T1HJ 2HFZA 4F67A 1VS3A 1QUPA 1CG2A 1WTFA 2AT1B 2J9DE 3PHEA 1PBUA 4GRSA 4YY3F 1RDRA 2VJUA 3J7Z5 4EWTA 2YKMB 4RJVA 2OJ3A 4IOCQ 2YY3A 1VQPS 3EPIA 4RNFA 3NWGA 5KT6A 4EZ9A 4G3IA 4Q0BB 4H4OB 1RTJB 3QATA 2B9WA 1HWUA 2CQDA 2FD2A 2J6SA 1S9EA 1UFKA 4QWAA 4HTIA 3AH6A 3WIVA 4UF4A 4DQSA 2AYBA 1RT5A 1HWLA 5ITHA 4U7CA 1M5SA 1FVQA 3MZIA 1XC9A 1LV5A 4DV2F 2RRBA 2APOA 3HDSA 5CHCB 2ZOGA 4JI2J 2YNGA 4CLSA 2BXJA 2UXDF 2HRTA 3HFZB 2KVIA 3W9HA 3HKWA 2GVDB 2XY6A 4FF3A 1VRUA 3PRDA 5BYQA 3KJFB 1WNEA 1Y4ZB 2JH3A 3QYYA 2W01A 1S6PB 2YNHB 1KR4A 1N5YA 2Z57B 3BO3A 4AD6A 4IFYA 4DQRA 2AKWB 1CS4A 1MU2B 1H0HB 1HD1A 2VL1A 2M0GB 4B3TF 1YZ7A 2AZ1A 2RILA 2ATLA 3HHNB 5DM6Q 1F5CA 5AE3A 4QU7A 3TAPA 4HT7A 2BM0A 2R8HA 5IS2A 2BW2A 4HHHA 3D7SB 4DV3F 4DSFA 2XSJA 2MY7A 4DPYA 1RTZA 4NRTA 4B17A 1CLFA 2JEIA 2CDQA 4OX8A 4KGZB 3PW4A 1OWXA 1SKWA 2GVDA 2KXNB 3QRRA 2PO4A 4F4AA 5M2UA 5J2MB 4QW8A 1S1WB 2IVFB 1ZBTA 2VJVA 4PRFA 2K8GA 3MEGB 1FO1A 1FRMA 1RABB 2YTCA 1IBMJ 2HVIA 1S6QA 4IG0B 4BS2A 4KPCA 3IBWA 2ATCB 5LSRA 1ZETA 4P74A 3DHXA 2B9YA 4DV6J 5B09A 2GW8A 4NXMJ 3LOUA 1VI7A 5I42B 3E01A 1R43A 2RUSA 4N7TA 4ECRA 1HI0P 2F7VA 4Y2MA 1SC6A 3H2UB 2AU0A 2ZJQQ 3KK1A 4LF6F 3Q2TC 3DLEA 2EXUA 5D0HA 4QPXA 1ZM3A 3JXOA 1HNVA 3GIIA 3A13A 2HQ3A 5ETTA 3CMQA 2I1RA 4ZN1A 1EP4A 5L38A 5I42A 4IR9A 2RT3A 4ZPVR 2GHWA 3C66A 3D28A 3ZZPA 4E98A 3LQVA 1Y3JA 5D4NA 4NA1A 3H5XA 4DUYJ 5AXNA 1S1TA 2HAIA 2B4OA 4R5PB 1C0UB 2F9JA 3M4XA 2IBKA 3K5MA 1R8HA 5DDOC 3MEDB 2HURA 1L3UA 3E01B 1GX6A 2GHPA 1CEZA 4YDDB 1K73T 2YNFA 3KUHA 3TX8A 1RAIB 2CQIA 2WVBA 5E3AA 4O3NA 4B3MF 1VLOA 3CT9A 3DRXA 4JI1F 5M2PA 2IMOA 5HMXA 1NEEA 4Q2MA 3T6JA 1N5QA 2UUAF 2KFYA 2PMWA 4ZCIA 5DZ7A 2DKOB 1KLMB 2G9OA 2OP5A 4YB7A 1BWEA 2AEMA 2B5JB 4DPOA 4RWWA 1M5VC 4WBFA 3G6YA 1RHRB 1T0TV 4WXWA 2X1AA 4LT6A 2V8PA 5DM7Q 1NJZA 2G4BA 3C6TB 5ETPA 5A8WA 1IM4A 3KYLA 3FBCA 3LW5C 4DX6A 3Q8UA 1JJ2R 2K7JA 2Z8QA 3CIMA 2DNPA 5D4OA 5D4LA 4GC7A 1KN6A 1LWEA 4NXNJ 1JLFB 2OEKA 1SC4B 4OZ0A 3KK2B 3KJVB 2P6TA 3SQOP 1NJIT 1YRUA 2DYAA 2AGQA 4AE5A 4PWUA 3ZZ0A 1JMTA 3TRGA 5HSPA 2MPUA 2C2ZB 4KJIA 3THVA 3KWMA 3H7HB 1JLEA 1KEKA 4IRDA 2AJQA 1B7YB 1C1CA 5GMKa 1B70B 1S9FA 3W2WA 1VFJA 4EBCA 4FYYB 2VBYA 4IG3A 4OI6A 3FMBA 2BRLA 4C9DA 4O3OA 2RQMA 3Q0AA 4J9MA 2W2QP 3G2XA 2LQBA 2DHHA 4ETXA 2MZQA 4CLPA 3HSZA 1YWXA 2RH3A 1WHWA 3FNNA 2EBGA 2ZM6J 3F0NA 5RUBA 1Z4UA 2A6OA 3UD3P 3O2IA 2Q79A 2V2VA 4C3MA 7AT1B 2N4DA 2HNDB 1YTYA 2DR8A 5KT4A 2YKOA 2DNNA 2KVQE 3CCWA 3OXFA 1NRKA 1GFWB 1TAQA 1WWHA 3K7RA 4FNIA 3I5AA 3SSSA 3V4MA 4ZMMA 4G65A 3MM6A 4H4MB 1RBLA 3KLFB 2OPRA 2EFOA 2LEBA 4ZCKA 2QE5A 3IR7B 4KIAA 3Q8PB 3H25A 3KDOA 4DSKA 1I51B 1S9GA 1F3VA 2DNGA 3M05A 3QGHA 2DNMA 4ILMA 4OIXA 4LFAF 4PQUB 3W5YA 4OI1A 3QO9B 3W63A 3K5LA 2KL8A 1GNKA 4DV1J 5DO2A 4W92B 3PX4A 2QIFA 3GFXA 2C42A 2GAGC 3EWGA 4R0EA 1IKYB 1WELA 3CJKA 4ZIVA 1RUSA 2AZ3A 1LWFA 1TKZA 1NK8A 2UV8A 1HA1A 1RGVA 1U6BA 2Y8WA 2VG6B 4B9MA 1CBKA 2GJIA 2XMVA 4K4TA 2LEAA 3GR0A 5AXLA 4I67A 1U2FA 2OSQA 4LF5F 4OZ1A 3TAQA 2RDJA 3M6UA 2AV5A 3LGHA 3H5YA 1RTDA 3IMQJ 2BOPA 2CQBA 2RU9A 4FDFA 4HEA9 4LFCF 2QG9B 4ZITA 4R8UA 3DXBA 4BDPA 1VR6A 4U7UK 3BGFA 1U1PA 2CWXA 3NWRA 5K8MA 5T14A 1NXIA 3LWMA 3M8PB 2LXUA 2YQ3A 2ZUAA 4M5KA 5EN1A 2DHXA 4UOFA 1RKJA 4JI0J 4FXDA 1XTZA 4F36A 4HYKA 2IJNA 4ANDA 2KHCA 2XSJB 4YY3J 1FD8A 4DR5F 1YZ6A 4DQPA 3QQCD 2Z4PA 4LFCJ 1N32F 1RHJB 4U8YA 3SIPB 3Q8SB 1XWLA 3DYAB 4TLRA 1BXNA 1LFPA 3ETOA 1HI1A 1RT4B 1BMQB 1NPPA 2ILZA 3MMJA 4M5DA 4FYWB 3G86A 1JLQB 1OJ4A 2YVSA 5G4DA 4CYUA 1UPMB 2BX6A 3MMCB 3OPKA 4OYIA 3I0RA 4ZVSB 4UOGA 5DLGA 4H4MA 5KFCA 1KS2A 1Z2ZA 4RUBA 3B4DA 3GE9A 4JI2F 3SCKE 2KZMA 2QLJB 1S79A 2QA1A 3I96A 1IR2A 4USKA 5DG9A 3J81U 3S7RA 2O66A 2PN6A 3A8KA 4L75A 5J2QA 3MAAB 1SH2A 2ZKUA 9ATCB 4X65F 3DM2A 1EETA 4EO8A 3HHLD 5A6PA 5F3ZA 4K0KJ 2VC1A 3PW7A 2UZAA 4DR1J 5CYQB 4EYIB 3KLGB 3TVYA 4WCEQ 5KOXA 1NJYA 2E66A 3N9UC 4WE1A
chains in the Genus database with same CATH topology
4LF7F 3HMJG 2PC6A 3MUVP 4RNOA 1YG0A 1AFJA 2UUCF 3C3LA 4WF9Q 2UXCF 1O8BA 1ZPVA 5K5MA 1A6LA 2L48A 2ROPA 2P6SA 2M8DB 4MAKA 4KV8B 2QMWA 2BACA 4I1TA 3VZHA 3CPWR 1JX4A 1MWZA 1XK8A 4I7FB 1R0AA 4TU8A 5A8RB 2HHUA 3M8RA 4MYTA 1HPZA 1FKOA 3OTCA 4IUFA 3PM9A 3MF5A 1LFWA 4Q7AA 1Y5NB 4XPCA 1KHVA 2DH8A 4AL6A 3MGJA 3MI7X 1KNZA 2HVZA 3SI8A 4NZ6A 2ZJPQ 2EW9A 3A8EA 4KB7A 2DGUA 4LIWA 2DR7A 1LW2A 3P5TL 5KFFA 4Y3CA 1ELOA 4ECTA 1FRKA 4LMZA 2YWFA 2QEXS 4NLWA 4TY9A 4ZP7A 2MZ1A 2XEXA 2MZRA 3B78A 3MM9B 2QA4S 1K1QA 4J9LA 1RA6A 2Q43A 4YOEA 3H4BA 3ZZZA 4ZOSA 2WK4A 5EHHA 1NK6A 5D4PA 2BDPA 2OD6A 4CH1A 2E1AA 1NNDA 3WC2A 2B51A 3VQSA 1RJJA 5J1EA 2NR0A 4YP3A 2JFKA 2XWYA 2E29A 4I4BA 4WYWA 1Y5LB 3B8HA 1GX5A 4I2PB 2W25A 2X1BA 2BE2A 4WKRA 4KKOB 2ZOFA 1UEUA 2CPFA 4F3QA 1ZH5A 4DFPA 3T1AA 2DR5A 2MYFA 4DMZA 1WHVA 2LEPA 2W4DA 2M52A 1FXDA 5K14A 3ICLA 3UWTA 5KOWA 4ILLA 1UP1A 3AQOA 2LVWA 5B0GA 1GTHA 2CPHA 2ZJRQ 1S72S 3TARA 4GKKF 2VQEF 2EFVA 3MM7B 5IFMA 3GR1A 5CCMA 3CJ3A 1GT8A 4USHA 2B3TB 4KHPF 3BGRA 4LF8F 2PA3A 4A8WA 2AQ4A 3IR6B 1UJ4A 4OHWA 3SFUA 1FRHA 3MPYA 4ELUA 3IRXA 5DETA 4Y2CA 2D7SA 3MR3A 4DS4A 2IA0A 3UNGC 5DDRC 1D1UA 3T5HA 2AD9A 3QJLA 2CJ9A 2HG4A 1RYSA 4X4SA 1H3DA 2XLKA 3MUTP 4C8NA 4KC5A 3LAKA 2IYGA 2JL9A 4ES3A 2XNRA 1U6FA 2VFRA 3N6MA 3M8SA 1ZM9A 1NB7A 2KB2A 2GC8A 1P1TA 4IFVA 2V8DA 4PG8A 3CVKA 2O67A 4KJIA 3N6NA 4FXVA 3KMSA 2XBPA 3CCLS 1CQNA 1FTRA 4H4KA 3J7A1 4QU6A 2HHWA 3G96A 1AXQA 2RQ4A 5DG8A 3NAHA 1FCAA 3IFEA 1ZOTA 2DGSA 4ZP9A 2XULA 2IC3A 2WHOA 1F5AA 5BYRA 2UXBF 3PNIA 1N6QB 3JYTB 1X4BA 4URGA 1FTCA 2DTJA 5IQ6A 1NO8A 3I56S 2LDIA 3AB4B 3QLHA 2E1CA 2O1PA 4RW6A 4P6QA 5KFMA 2N3LA 2V0NA 1U1OA 5F8NA 2GIQA 4Y28C 1KLNA 1CC7A 4OHVA 1I1GA 3UDLA 3DRRA 1NU4A 3RAMA 1HNIA 2PSZA 4QWEA 4IRKA 2V94A 4QYZJ 5KFOA 3THPA 5CXTA 5AXMA 1WI8A 2BRKA 4MK9A 3OTOF 4DHVA 2JVOA 2ZC4A 2CPIA 4QIVA 3SDEB 1NK4A 4IH7A