2PMWA

The crystal structure of proprotein convertase subtilisin kexin type 9 (pcsk9)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title The Crystal Structure of PCSK9: A Regulator of Plasma LDL-Cholesterol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 21
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2pmwA01
2W2OP 2Z58B 4NE9C 2PMWA 2W2QP 2W2NP 3BGOP 2ZWOA 3P5BP 3CNQP 2Z30B 1SPBP 2Z2YB 2ZWPA 4K8RA 3VV2B 3AFGA 3CO0P 2QTWA 3A3OB 2XTJP 3GCXP 3BPSP 3A3PB 4NMXA 3WIVA 4JP8A 2Z2ZA 1ITPA 2W2MP 3T41A 2E1PA 1SCJB 2W2PP 1R6VA 3QFHA 3VHQA 2Z56B 3WHIA 3GCWP 3A3NB 4YN3B 3H42A 4OV6A 3SQOP 2Z57B 1V5IB 3WIUA
chains in the Genus database with same CATH superfamily
2R7UA 3FVYA 4ED5A 1E6VA 4WZQA 3K5PA 1RT1B 2KH9A 1KLNA 3HDSA 3SBMA 4QR0A 2YXLA 3M30B 3ONQA 1P1TA 4JI7J 4LFAJ 4QPXA 2CQIA 2YNFA 2VFVA 4LR8A 2HVHA 3SDEA 2GO9A 4MJKA 5D4LA 1X5TA 3M2RB 1JLEA 9RUBA 3Q8YA 3M8SA 3EGVA 2WK4A 1T9WA 1HBUB 2U1AA 3MZIA 1TFYA 3CJQA 1U4BA 5D0HA 3OT9A 2Y0BB 1TL5A 4P7TA 2DIUA 5KOXA 3KJNB 4TXSA 2W8KA 1RTZA 2GS8A 4ECZA 1S57A 3Q8UA 2JL9A 1F2GA 3DRSA 3FMWA 2B4OA 2GVDA 3M32A 3KLIB 2ZBPA 4NLYA 2M0GB 1K44A 3OUYA 3HK2A 2XHWA 3K7RA 3NS7B 1KTVA 2VU5A 3RB4A 5FLXY 3PW5A 1RUSA 4QJVA 3UVJB 4H4OA 4ZVPB 1WACA 1YRUA 3RTVA 1EJ7L 2HHPA 1KS2A 3DLLQ 4NLOA 2A2DA 2V68A 4UTGA 3CCQS 2F9DA 3NL0A 2ASDA 3BQ0A 2YQ0A 2W9BB 4UW2A 1OPIA 1KHWA 1S7HA 1LW0A 1FDBA 4DL0C 2C3UA 2W4PA 1RT6A 3QRRA 2IA6A 4RW4A 4UUXA 4LF7J 3IO1A 4TU9A 1M1HA 1RTHA 4DX8H 2ZNYA 2WRMA 3RR8A 2PEBA 3CCMS 5A8RB 4MK9A 4KH0B 4K4TA 3CXCR 3W8GA 2AGOA 3W9HA 2A1BA 3GYXB 3U7JA 3DYAB 2L48A 1LWCA 1NNDA 3ZZYA 3OPKA 4RW9B 1RT5A 2UZAA 3HFVA 1S6OA 4ZJOA 3E01B 2OFGX 4F36A 1QVGR 1YJNS 4WYLA 5KFYA 4WXOA 1FRMA 4QWEA 2ZEJA 1RBLA 5L1KA 7FDRA 3NGUA 3I0SB 3GV7B 4LUBA 3LP2A 1CS4B 3EYZA 3LGNA 2HK2A 3C16B 4ZPAA 4WTOB 5CYMA 5DS7A 4WU3A 3GIJA 3TX8A 1ZBTA 3H5YA 4WP9A 2FVRA 2XZDB 1SJFA 2XC9A 4EGLA 2IBKA 1RCOB 4B9MA 2XS5A 4M94A 1AW0A 4N8OA 3EUNA 2FTRA 4FF4A 1UEVA 1SPBP 1FNMA 4RWXA 4NCAA 3C6UA 4OX9J 2MLYA 2AU0A 3KNAA 2AYEA 4A8KA 1ZZNA 5HJXA 1VR6A 4HHUA 3D7SB 4NEZA 4QWCA 3GFXA 3MFHA 3VAMA 4JV1A 2QYCA 1LK5A 4TYBA 4F0MA 2LQ9A 3TAMA 2C22A 2LQ8A 4B3TF 1WOOA 1Y5LB 1TKTA 2XCPA 1M5SA 3MUMP 1RB0A 4IYQA 4H4MB 4LRCA 4KPYA 4I2QB 3SCKE 3U1LA 5JMNA 3VTIA 4NOHA 4GKKF 1Q86T 2F40A 3AFGA 4PPDA 1F5CA 3S6EA 1M5VC 4CM2A 1U45A 2LXUA 1FRHA 3HI9A 5IOLA 4P52A 4JV0A 1JLGB 3FBCA 2MKJA 3WHIA 4NWBA 3EPGA 1BMQB 3PACA 3PEJA 4X64F 4Q2LA 4TY8B 1FRKA 1R7IA 1HNWF 5IT9Y 2AF6A 4C0BA 1JJ2R 1VRUB 1RSCA 1VQNS 2IY5B 4LMZA 4CO5A 3GIRA 4NX9A 2MKIA 2BW2A 2U2FA 1D3WA 1U6ZA 2UUCJ 2IIHA 3ILJA 5CXTA 2OHDA 1VQSA 2HMIA 5KFXA 1WG1A 4DL5A 1S72S 2O1PA 3V4IA 4DPXA 1SJQA 3CUNA 3AJ1A 3D3BJ 2C42A 5C24B 4DG1B 3PR4A 5AJ3J 4ZPWR 4JI0J 1IBCB 4OZLA 4QOTA 5U47A 1UWBA 5I4MA 3GYNA 1OSDA 4WIQA 3H25A 3MM9B 3BO3A 2VFSA 4RLEA 2WHOA 2KKHA 4K0KJ 4DV1F 2QEXS 2ZKUA 1C2PA 3TVYA 2XYHB 2FVPA 5IWAJ 3BGLA 3H4DA 2C2DA 3D5MA 2CJAA 4DS4A 1RT3B 2ZH4A 5ETLA 3G2XA 2ASYA 3P3DA 1PYOB 4WE1A 5HQ8A 1IKYA 1R8AA 4OZNA 4JV2A 2UVWA 4BHQA 3R7BB 2EWHA 3KK1A 2FHJD 2BJ3A 3O2IA 5K5MA 3JTPA 2F63A 1S6UA 1FJCA 2CRLA 4C3KA 1M5HA 1IJFB 1YWXA 1CBKA 3SXLA 3PKYA 1Q95G 4NA3A 3BV8A 3HD2A 3K8WA 1WHYA 1CC7A 2QIFA 3G4SS 3PY8A 1DBDA 3TQEA 3K57A 1X8DA 1Q4RA 3RJMB 4O3NA 5KG3A 1LXNA 4P74A 2AIRB 1W7WA 4WXWA 1DQAA 1FI4A 1W26A 2MB0B 4Y2AA 1DTQA 2G2OA 3P5TL 3ETMA 1S1UA 2DHGA 3DGVA 1R3NA 3NNCA 2DGSA 3J7YU 2RJZA 1WHXA 1XN9A 3HHNB 3PX6A 2MY7A 2HHWA 3JTNA 2FVCA 5T14A 5ETRA 1NPPA 4QIGA 3J7YI 4OZ3A 3M2VA 2M5YA 2LXIA 3CB4A 1JX4A 2V2KA 1VIXA 3K5MA 4CCHA 3UNYA 4FYVB 3OR1A 4QW8A 4AL7A 3AHPA 2LU2A 1PAUB 3KTQA 3W1YC 1KONA 3TRGA 4P71A 5ADZA 2DR5A 4Y0FA 4CH7A 3TO8A 3TA2A 1QVFR 2BE9B 5JUMA 3MMAA 2DH8A 4OZ0A 1VK8A 5B0GA 1FWPA 3BM7A 1C1BB 3VGSA 1HHTP 5LL6d 4B9VA 1VQ5S 4R0EA 4E8UA 1EARA 2B4VA 4YDDB 5KT4A 4P72A 1FNXH 1OJ4A 1IXKA 2D3UA 4DSLA 1UMJA 1IM6A 2CQ1A 5J1EA 1TKDA 1UKUA 2B7CB 3R9LA 3TJ8A 2GIFA 3H20A 5AXMA 1OY6A 3KDNA 2HAIA 2FJBB 2XO7A 1J5OB 1SQFA 2WVEA 2ZH3A 3SV3A 4FF1A 4OI4A 2AJ1A 3D68A 4K4ZA 1X9MA 4HVZA 2HGNA 1N32J 2A0FB 1UL3A 4DXLA 4NZ0A 2HFNA 3N5FA 1TK8A 2DR6A 5ETSA 5FLXU 1K1SA 2F8HA 3MAQA 3CCVS 2VC0A 2KZZA 1N6QA 3KJVB 2ZH2A 4UY85 4HH1A 1X5SA 2R7XA 3WC2A 4M5DA 1ZM2A 4QW9A 5A8WA 3GIIA 5I3UA 1HI1A 3D4JA 1RTDB 3ADAC 1TP7A 4O3PA 1IBKJ 4X62J 2YKMA 2O5DA 5DG7A 2EFQA 3R3TA 1T05A 2BX6A 1UEKA 5LMNJ 1EP4A 1FWLA 2DEJA 2NS1B 1UA0A 5KFRA 3PYDA 3HPOA 3HO1A 1YJVA 3D1QA 5KFSA 1URNA 4ZOSA 3LO3A 4QQBA 3DOMB 4DV2F 4JI4J 4EK2A 4J9KA 3OTOF 4A47A 4GC7A 2OH2A 4GO7X 1K1QA 2DRBA 4X65J 1ZAXA 3G6VA 2F4VJ 1H74A 1H0HB 5F8NA 2HAFA 1XWLA 1Z1ZA 3HHLD 2WBMA 2YKNB 3GYGA 5DJBA 2A6MA 4MK7A 3L9ZA 1S12A 4TLQA 4DHVA 5D4NA 3FCWA 1BHNA 5A8KA 3CCTA 4MIAA 2HS3A 1UVIA 2QSWA 4DR4J 1H2VZ 1U2FA 2WSEC 1PKUA 4Y34A 5D3GB 2GV1A 2YNGB 2CUYA 4NYOA 1SC3B 3DM2B 1FXDA 3ZTSA 2LXFA 4FBUA 1LW2B 2CPZA 5EGYA 1ROFA 4YDXA 5ETKA 1BWEA 3EMTA 3R7SB 3A13A 3CD7A 5J1PA 2CPHA 1S9FA 4U7UD 3EGWB 2MHNA 1CVJA 3ZTPA 5IQQA 4CLKA 5EWEA 3A4TA 4WBFA 1CJVB 3CMQA 4LR9A 4DR3F 2BJEA 5FDLA 4CH0S 2UUAF 3J7A1 3T6JA 2QL9B 4X4RA 5EDWA 1X4EA 2EC0A 2IRUA 4X4UA 3KG4A 4FXVA 2FJDB 1TUVA 2AEJA 1S1XA 3HF5A 2DR9A 3QWPA 5J2MA 1D9FA 2XS2A 4FN5A 4B3RJ 1B99A 4ZVGA 4K4VA 2HHTA 2YNIA 4B9TA 2CA9A 1S97A 2ZZTA 2ERRA 1P8GA 4YS2A 4U67Q 1FO1A 4FP9A 3H2VE 3D67A 2O01C 3TEHB 4RU9A 3M9OB 1MMDA 5DZ6A 4NLDA 3GCXP 1LNQA 2CWXA 1RWNB 3HVTA 1XTZA 3W3SA 3CDAA 1NB2A 2R8IA 1OWXA 2DCLA 3K2YA 4C8LA 4YB1P 2C2RA 3SEOA 1ZPVA 2ZZNA 3DI6A 2KRRA 3LP0A 2RB7A 1A6LA 1KKHA 3DU5A 5IT9U 1DQ8A 4ZA1A 2QG9B 2E5LJ 2PIIA 3DRXA 4WFYA 5KTQA 3A8JA 2DT9A 4M1KA 5F41A 2VJVA 3LH2S 3ZZ0A 1RKJA 1R0AA 3VVTA 4CTAA 2YH0A 1OQ6A 2PMHA 2GAGC 1KD1T 3ZNUA 2HNDA 1YTYA 3BKFA 3R8YA 4M5MA 1JLFA 4LRAA 3HJVA 4RW6B 1S7IA 2LQJA 3TA0A 1IVZA 1RWXB 6FDRA 1X4DA 3N01A 3MMBA 3PJ9A 3D66A 2IM3A 3MCMA 3T41A 4IH5A 2BKNA 3LGMA 1KHVA 4USWA 1VLYA 4DV7J 1N5YA 4L72B 2HHSA 3FRYA 2BE7D 4WP3A 2M70A 2R4FA 2HLUA 1GFWB 2X1FA 2FB0A 3MUTP 3AA9A 4RNHA 2E5HA 3C46A 2F1FA 4LIRA 1YZ7A 2XS7A 3AA8A 5K14B 4LVOP 3PW4A 2YWGA 1JNZB 2IC3B 1FNOA 3IR6B 2V8GA 3MPUB 5KFCA 1J5EJ 1RAEB 1F60B 2B51A 2MHEA 3OFGA 3CJ2A 3I0RB 1CC8A 4DR6J 2J9EA 4S0MA 3NBPA 4MIBA 4PUOA 4KGMA 1P6TA 2BA9A 2VG7A 3UD5A 3MM7A 5GAGI 3EXYA 2B8PA 2GJFA 2P6SA 3MF5A 3WIUA 4KSEB 2MMYA 2DPIA 4AXJA 4OYAA 5HAOA 1QE1B 3OHBA 2CAJA 1UVKA 1KR4A 5IQ6A 1QSSA 4USVA 2N4CA 1B7FA 3M8WA 1WOPA 4I7FB 4DCPB 1SC6A 4USJC 4CO4A 4NA1A 1ZAWA 1U6BA 3I31A 4Y65A 1FJGF 4UQTA 1UAWA 4KPCA 1WELA 2L9WA 1Q0NA 2B5JA 1JKHA 5G0RA 2IJFA 2JFKA 4DV5J 1TL4A 3CJTA 4HH0A 1HQEB 4AL6A 3CMAS 5ETTA 2B9WA 1WEXA 5B7WA 2ILYA 5HBMB 4B9NA 4IR1A 1ZYQA 2VKZG 5JVHQ 1GK8A 3TZWA 5E3PA 4D3HA 2YKOA 1U0HA 4KJIA 3BKTA 1CJUA 3ELHA 4C48A 3CULA 5A2QU 2ZWPA 2OPSB 3A8EA 1VJWA 2A10A 2QSFA 3I82A 3KK2A 1OIAA 4K5RA 2RS8A 3DOLB 1FKPA 2GGPB 4CLWA 1T3OA 2GW8A 2HQIA 5IM0A 1FRJA 4ZLJA 1I94J 1IKWA 4ZJLA 1XMOJ 2HK3A 3SFUA 5IC6B 4NASA 1AA1B 3RRKA 2OPQB 4ZHRA 2OEMA 1DHMA 4I2PA 2DITA 1SVDA 3IWLA 3RAXA 3W5YA 2J6TA 4LSLA 4OZ1A 4R5PA 1CJTB 4C11B 1K47A 2M7SA 5JVGQ 3L95X 4IQMA 1KP6A 2I2YA 5I42B 1X4CA 5D78A 3AD7C 2E5IA 4J9QA 2V4JA 3LWMA 1QTNB 1ZTWA 3ZXWA 5K8OA 1E6YB 4IFVA 3FEXB 3S01A 2HHHF 2PDAA 4KHMA 1HI0P 5HJYA 2DJWA 2YX7A 3CJ4A 2HNZA 2BM1A 1H2UX 3HXMA 4I68A 2L3MA 2Y9HA 1HBOA 3PV8A 3ZZOA 3PIOQ 2DY9A 2V2VA 1NMEB 2DRDA 4JI3J 3IC1A 4B3OB 2RUGA 3ILLA 1X4HA 3GJSB 5DM7Q 5CCMA 4DX7A 1TAQA 3DRYA 4DL7A 4WWSA 4OZJA 1F5BA 1D8YA 3MGJA 4EZ6A 2VV5A 1UJ4A 4FF2A 2BJ7A 2VUGA 3D54A 4TYAA 3K5NA 1WC5A 4HR2A 2E9RX 2FZCB 3MEKA 1X9WA 2AX1A 1WHWA 4A8MP 4U8VA 2V67A 2CQ4A 4J9LA 4RUHA 2DEIA 1S6PB 3KMSA 1SUQB 2O67A 2MLZA 2WSCC 3JQKA 2PSZA 5KT3A 2BACA 5GVQA 4CLFA 1FA0A 2D74B 4ZIVA 4EBDA 2CXEA 4ZPDA 2Q6CA 5C42B 4ES1A 4DLEA 2HVZA 2RF2A 5DG9A 4IFYB 2EG1A 1V3RA 1OQ3A 3H4BA 3UD3P 1Q8IA 5HVHA 3F41A 3CNQP 4DEZA 4OZ2A 2NZ4A 1IKXB 4ECQA 2XMWA 2DGWA 1Y9OA 1JK9B 3CGIA 3PW0A 4UZCA 2WOMA 1G3OA 4ED3A 5D0EA 2OFHX 2J0SD 2NZCA 3PG9A 3QMQA 3DC2A 4YN3B 2YPYA 3PYGA 5KG4A 1RWMB 3D3CJ 3X3UA 2GVZB 2DPJA 2YX4A 2QLJB 2KT2A 3G8TA 2AGPA 4DFMA 2R2RA 4KQZA 1YJTA 1NM2A 1VFJA 1FWKA 2LQBA 1XNRJ 5KG7A 2GHPA 3KUGA 2JLEA 2ZJPQ 3LGHA 3BGRB 2CPDA 1R31A 3LP1B 1C0UA 4A46A 2HIYA 2ZBQA 4GO5X 3EPIA 1KVJA 3PX4A 2OAUA 4K4YA 3W60A 1X0FA 3M4XA 3TJ9A 5B0DA 2J6SA 2LP4A 1TKXB 2WCXA 3CCSS 5B0BA 3MAAA 4MKBA 2OPRB 1T3NA 1XIQA 3BSAA 3DHXA 4J9PA 4EEYA 2ZM6F 5L38A 4KGXB 5GAEU 2GIQA 2ROGA 4C3MA 1VRTA 2V2ZA 2ZD1B 5MAOA 4QIVA 1FRLA 4RWWA 5DLGA 1RT7A 3OR2A 5KT6A 2DNHA 5KG6A 3KUEA 4XPEA 4ZDNA 4DV6J 3F44A 1X7VA 3NOCA 1HNXF 1HR0F 1YSJA 4ZP6A 4CRJA 2CZ9A 2XLKA 3DFEA 2PC6A 3TAPA 2HQFA 2IYGA 3GPAA 5KFBA 4U95A 3UCUP 1V3SA 3T5KA 3J81U 2DGTA 3DXBA 5BR8J 2HFOA 1GAOA 1RE1B 4J5OA 3R27A 4QR2A 4L73A 4G1QB 2J9DE 2UV8A 2EVZA 3ILOA 2UUBJ 1S1VB 4AQYF 2FIUA 1HMVB 4ZN1A 2XTJP 4YP3A 3R5AA 3QNWB 2HGMA 3W9JA 2W9CA 3BO2A 2VPYB 3I4PA 2RKIB 1M1GA 2MSTA 2H4WB 3D9BA 1RADB 3A12A 2W4CA 2HURA 5CYJA 1GNKA 3M8PA 3TUPA 3G82A 1FK9B 4KBIA 3MUVP 2F9JA 4RR5A 4QWAA 2KRBA 1S10A 1RWVB 2KYXA 1TKZB 1HFEL 3POTB 3C19A 1SJ4P 3Q83A 3KLGB 4DV4J 2AX0A 3BSOA 2ACMA 5IZHA 4O44B 2QT7A 2QX0A 3PR5B 1SL0A 5M2RA 2BKOA 2L08A 4ZPCA 4LF8J 4CLUA 4O3QA 1AROP 2HBYB 2MLXA 2ZFHA 4QYZK 1NH7A 1RT4A 2W7AA 3LPEA 2N3OA 2EFNA 3VVUA 2RQMA 3HP6A 4I64A 1EETB 3BR8A 3C6TA 4LT6A 5BXIA 2XZTB 3IP0A 5SUHA 3SCJE 5A76A 5F8HA 2UXBF 2XMVA 2E1RA 1RACB 5DG8A 4GVLA 3UD4P 2FLNA 3HCXA 3OJSA 2PE8A 3K5OA 3NKYA 4XDDA 1GH8A 2Y3YA 4NL5A 4N8NA 3OL7A 4EU0A 2VA3A 5HI7A 3O44A 4WKYA 3L3CA 2NLWA 4LFBF 1WDTA 4LFCJ 4NXNF 1JLQB 2GC8A 2X7IA 2DTJA 4EUVA 1FT8A 3SI8A 1EIYB 2G0CA 1FD8A 2KVIA 3SSSA 3EXCX 4JV5F 3NAHA 1UVJA 2ACYA 1JJ4A 3KFWX 4IG0B 1VQ8S 1OPZA 1F3VA 3QT7A 3DOKA 5K8PA 4KKOA 3MM5A 5GADU 4YOEA 1NAQA 4OYBA 1N33F 2AJ2A 4Y6IA 4V19X 2EBEA 1C0TB 4JI2F 2RILA 1Q1KA 4M5NA 3GCWP 3JSMB 1MLAA 4F4XA 1RI7A 4PWUA 1Q78A 1TV6B 5EUHA 5LSOA 1VQPS 1NCLA 1NPRA 2FHOB 1FRXA 2EC2A 1URRA 2K3IA 3TZZA 1CSJA 4Z2XA 4RW8B 2FY1A 3GJQB 3RW6A 4USHA 2B9XA 4KE5A 1G4CA 4ZP7A 2WONB 2BDPA 3DU6A 1N52B 3DRRB 3IAS9 4KYZA 2ALZA 2Z2LA 2QLXA 2RMLA 4MH8A 2C3OA 1E6VB 4EMDA 3BREA 1SJ3P 5KFZA 3GV8B 2DH7A 2R7RA 3UDCA 4PRFA 3H90A 1UP1A 1HBMA 1JLCA 1FF2A 3OTDA 4TLRA 2VBXA 2XM3A 4PZVA 4E2FB 5HLFA 2YNFB 3PYEA 3SDEB 1NEEA 2M4MA 3N5BA 1NPKA 4NXMJ 1JLBA 2CVEA 4NLVA 1LK7A 2GQ2A 4PAAA 1IQTA 1JLEB 1S99A 1RQ0A 2VB6A 1NRKA 2XWXA 4DPTA 2ZE2A 3VAHA 2IVMA 2IRYA 1MN9A 4A48A 4KHPF 3QGIA 2PMWA 3ZZZA 3OVBA 2LLZA 2Q3PA 1U2CA 2OTJS 2BZ2A 3DRSB 2P8IA 4CDIA 1QUVA 1U1LA 4ANEA 3S7RA 2GVDB 2CQDA 3M32B 4L3KA 3KLHA 4I4BA 3GQCA 3J81j 1KWMA 2UVRA 4F2RA 3OUYB 2F8MA 4NPOA 3G96A 1Q8LA 3VGTA 3ZTQA 5B0FA 1WC4A 4EO8A 4CO2A 3HHKA 3HFZB 4H4OB 4LVNP 2E5GA 2BRLA 2QMXA 3M8QA 1L3VA 3T19A 1ZM3A 4ZCLA 1KEKA 3AJ2A 1X60A 4DR2F 3PW2A 4DDFA 4PEOA 1YRXA 2YPZA 4P73A 1LW0B 5EX0A 2ZUAA 3DLGA 4DSJA 1DFDA 3HHEA 4RW4B 4RW9A 4J9MA 1IBLF 2QLFB 3RAMA 1PC5A 3ZNJ1 1RTHB 3W63A 2PT0A 1YBAA 5GMEA 1YI2S 4KRWA 3CJ3A 2RE1A 3W5XA 5KG1A 3CIZA 3D0GE 1LWCB 4B3TJ 4C9DA 2AQ4A 1RT5B 4UF4A 3RRGA 4J7CA 2VIHA 3MPDA 2BEFA 1FEEA 2EEYA 2G2YA 4GKKJ 2JFDA 3LP2B 4X66F 3MOZA 5CYMB 1WTFA 4K2JA 2BKPA 3NNAA 4Q8EA 3HULA 2FD2A 1Q8BA 1Y5NB 5B0EA 2BJ9A 4OHYA 2DO0A 2MKCA 2V9KA 4X64J 3CSKA 1HNWJ 5KG5A 3CCRS 2G0JA 3LW5C 4GKJF 3CE8A 3EVWA 1RKIA 1G6BA 2XCAA 4N76A 1ZOTA 4NI2A 3C6UB 2C2MB 3PM9A 3SSRA 1KQKA 2KXHA 1TK0A 2LEAA 1AFJA 1O8BA 2FYXA 4NCGA 2IJNA 1GMUA 1Y3JA 3U02A 5A6WA 5CHCB 3TAMB 3X1LB 5T41A 3DLEA 3IR7B 3O3LA 3JAMY 1TKTB 2RQ4A 3UCGA 4UZBA 2M88A 3FSIA 4DQSA 4KV8A 5HL7Q 4X4NA 1H3DA 1PGZA 2MDAA 3NS6A 2VG5A 2IVYA 1S77D 3V2UC 1LWEA 1JLGA 1YIJS 4QIEA 3FSXA 4RNFA 2FJAB 4D3GA 4DV1J 5E3RA 2KDOA 4LQ9A 4P9SA 1VRQC 3CD6S 4OI3A 1IBMF 1NSAA 1FRIA 3RBEA 1UTAA 2UVUA 1RAJA 1FJ7A 5D15A 4K2XA 3EGNA 4ZPBA 2ZH9A 1RLDA 4P10A 4Z7YA 3I9ZA 1HQUA 2WW4A 2QA4S 1QUPA 3W9IA 2DHXA 4OYWA 1VQ6S 2HMIB 5F0UA 1R8BA 2FJVA 2WVCA 2OGUA 3V4IB 1T8EA 1PJ6A 1NK6A 2H3EB 3FQLA 4G1PA 1SQEA 1IM4A 3IRXA 3NGDA 1N48A 2XY6A 4J37A 1SH3A 2VQFF 1VQMS 4WFZA 3IWNC 1UWBB 5DDRC 2V6AA 2BABA 2FC9A 1N5VA 3MXHP 3MHYA 1LWXA 2BJ1A 3KKFA 4N7TA 1OO0B 2VH7A 2UXDF 2VPZB 5MLCV 1I5OB 3OXFA 2G4BA 3CF5Q 3L4BC 4RBVA 2XO6A 2I6WA 2MQPA 2HGLA 4J9NA 3KWMA 1H6KX 3OSPA 1B70B 3BQ1A 2QV6A 4K50A 4ZPVR 4WE1B 1CQNA 3RGIA 3NMRA 2V63A 1IKYB 3AD8C 4JBCA 1CULA 3KK1B 5CA5A 5EWFA 5HATA 3IM9A 2JEIA 2EPIA 5BJRA 3FMBA 2E7VA 4B08A 1Y0HA 4LSNA 5AJ3F 4DX5A 3H59A 2CIMA 1RWWB 1PSDA 2CNLB 1S0NA 1S48A 2OKQA 4PXCA 5IT4A 3W66A 2VJUA 4ZVHA 2CQ3A 3B4MA 5GMKa 1SKRA 3K89A 4O4GA 4YR2A 3RG6A 4DV0F 1RWKB 4Q8FA 2GMJA 4KB7A 3LQVA 2P2CB 1SH2A 3OJUA 1YJ7A 1DTQB 4OYIA 1JXVA 3A3OB 5J2NA 5C5JA 4QZVB 4QIFA 1S1UB 2DO4A 2WTFA 1LFWA 4OJ3A 3TYTA 4WP8A 3UWTA 3HSDA 4DPYA 2AJFE 4MTPA 1F5AA 1JNRB 1TK5A 2XULA 1SBRA 5C2CA 3M2VB 2XI3A 1ZPWX 3TAQA 2COLA 4M5JA 1U1KA 4ZP8A 5C7PA 3OR1B 3I56S 1ZA2B 4I6AA 3TJAA 4DZ6A 3M1VA 1FX2A 1B64A 1HNIA 3VZHA 2MQLA 3MR3A 3MMAB 1Z2LA 4F50A 2QMUB 3TZYA 1HPZA 2HIQA 3NOGA 4N41A 2OIHA 1V6HA 2IM2A 3H98A 4OV6A 2JLFA 3NGTA 2QGFB 2JEFA 5J1EB 1I1GA 1JQGA 4DWIA 4DV2J 3DKDA 3OTOJ 1KTQA 3GIKA 2GNKA 4DUTA 2CPFA 4Y2CA 1U47A 2VASA 3Q8VA 2EKNA 1YQHA 4M63A 1N88A 2XYGB 3K58A 4Z37A 1NSQA 3FUYA 4Q7AA 2IYIA 5LOQA 1OMSA 3GSIA 1APSA 1OSCA 4BC7A 2NUUG 4WKRA 2QFJA 2JX2A 4OQJA 1N6QB 2V4QA 1YBUA 4OYXA 4M5DB 5A8WB 1U8WA 5I3UB 2PI5A 3DLKA 2YKMB 1Y3KA 1DZ5A 1T05B 2GQCA 2QZ8A 2BVZA 1EP4B 1F3FA 3TP2A 5LXYA 3J80Y 3W8PA 2JEJA 2HZVA 4DR3J 2UUAJ 2C3YA 3FK4A 2FZKB 1HD1A 1V5VA 3H7HB 4ED0A 3DDNA 5F8LA 2HFSA 4CZCA 3PTWA 5E3QA 2ZDOA 4DCJB 4RL1A 2ZNZA 5LMUF 4C6AA 1U7LA 3CEDA 4WK3A 2B9YA 1N4LA 3WQPA 2FVQA 1WKKA 2R7VA 2MZTA 4LRDA 2ZBIA 2IRXA 3NGRA 1GXTA 5A6PA 2KB2A 2CNNB 3PHEA 2JVRA 5A8KB 1KSPA 4DJBA 3IBFB 1EKSA 2CZ4A 4DN9A 2EG2A 2QTWA 1UVMA 4DFJA 2I9SA 2XMUA 3AXMA 4ZLLA 4XO0A 1RCXB 4YY3F 1GEHA 1VOMA 3PRBA 2X1AA 3IAM9 4BDPA 1ZTTA 3HSJA 3BQ2A 3L7PA 3FBFA 2PI4A 1IN0A 1Y00A 3W5ZA 4JP8A 3E51A 5L1LA 1FE4A 5FDLB 1MWQA 4ECRA 1MMNA 3FEZA 2J0XA 2K1RA 2MQOA 3NAIA 5CQGA 2VG6A 4M8LA 1S1XB 3HSGA 2QFIA 2PA8D 1C1CA 1RA6A 2BE2B 5J2MB 2ZC3A 3M9MB 2E7XA 4EWTA 4RNOA 3VAJA 3UN2A 1HNVA 4X4VA 3ISNC 2Z2MA 2NXEA 4DR4F 4ED8A 2NSBA 4CQ1A 5HMWA 4IRCA 4P75A 1RISA 3SMZA 1SV5A 4QBUA 3HVTB 1DLOA 2QE5A 4Q0BA 3SFGA 2EXUA 1X5OA 5C2GA 3N9UC 3T6BA 3DI6B 3LP0B 1UW4A 4ANDA 2J0QD 2C2OB 2FHMA 4IO1A 2K3KA 4RW6A 1EX8A 5CABA 2D69A 4FNIA 2ZJQQ 1GXLA 1YX2A 3GJRB 4P2MA 1U49A 1DTTA 3DLHA 1X31C 1R0AB 4CTAB 1X4BA 1NJWA 2C3MA 2HNDB 1OYEA 2QLBB 1JLFB 1JLAA 2W2QP 3NG8A 3M9NB 4G1IA 3QATA 4L76A 3MMBB 4ZVQB 4XDCA 2L9DA 4LBPA 2Y8WA 3GFYA 3R97A 2D3OR 4ZN3A 4NZ6A 5FIIA 2EBGA 3GILA 1A9NB 2YNHA 4ED6A 1KNZA 5F3ZA 1FJGJ 1N5YB 4ELTA 4I67A 1RLCL 3G6YA 2KG0A 1F9HA 2VBWA 3TEGA 3KHHA 2GA7A 3DDKA 4MFBA 1VS3A 1UFLA 2GHVC 3OD2A 4DR5F 1XNQF 1T11A 4OJGA 4ILMA 5E3CA 5CAAA 4QU6A 2ZKTA 1N0VC 4WZMA 3CC2S 2Z8QA 3P5BP 4WFAQ 2M3DA 2M2BA 4DPWA 1X4FA 1BQNA 3NBPB 4PUOB 3L09A 2VG7B 3MM7B 3Q2SC 3MAHA 2ZDPA 3TWZA 1FFGB 3MCOA 3FDSA 1RZMA 2H5JB 3QSIA 5AXNA 2R7TA 3V81A 4NLTA 2EFOA 4CLYA 1H2TZ 3FNNA 4DF4A 1WWHA 2RVJA 2CJQA 2POKA 3T1YF 2Z4PA 2G0IA 2D3ZA 3AXKA 3ZC4A 4ALZA 3BYRA 4CLLA 2XB2D 2KT5A 3GV5B 3I5AA 1IKVA 1JJHA 1HQ2A 5KFTA 1NDCA 3HZEA 4DCOB 4IH6A 4DSIA 5GAHU 5B0AA 2KM8B 2B5JB 1JKHB 2LYVA 5GAHI 4A8FA 1D1UA 1HWIA 3RBDA 2RDDA 4F26A 1SB6A 1N36F 2ZOGA 1S6QA 3DNCA 3GP9A 3AH6A 3KUHA 3C15A 2AT1B 2VBYA 3EWGA 1MMLA 2CJKA 3G9CA 2HHHJ 4C8NA 3RB0A 2KFZA 2W2OP 1U0HB 1CJUB 2HHUA 2VFUA 1HD0A 2ROPA 3KJFB 1UEUA 3QLHA 3KK2B 3SZ2A 4FF3A 1FKPB 4Y2MA 4PG8A 5IM0B 2ZH7A 4ED7A 1UFWA 3VAIA 4LBIA 2YH1A 3FCVA 3L7UA 4PQUA 1IKWB 5F8JA 4JI8F 5HP1A 5KFHA 1Q79A 5IV4A 1PYSB 5KFUA 4M5KA 1DARA 3MD1A 2B7BB 1TL3A 4ZHRB 4I2PB 1VLOA 2GCFA 4LSLB 4R5PB 4CIOA 2E1CA 2QJ3A 2BQUA 3RB6A 3IG1A 1E6YA 1G7CB 2CPIA 2VC1A 1RK8A 4F04B 4EZ9A 2E5JA 4KTQA 5E5NA 2P9GA 2OEJA 4CYUA 4I6YA 4KFBA 2V4JB 5DQHA 2ILZA 1FVSA 3E3XA 4AL5A 4IFVB 3RW7A 3E2EA 3EDRB 4KGVB 1S4FA 3R7NB 4Q2MA 4ECVA 1P9QC 3H40A 3PO4A 2HNZB 2HRYA 1RYRA 4B9SA 1D09B 3CCLS 3PRDA 3JB9k 1Z2ZA 2D9OA 1NHKL 3BN7A 1HBOB 4OYMA 5ETMA 2IDLA 2WW8A 4KO0A 4NRTA 5DQGA 1P9YA 1FFSB 2XQCA 3R5DA 1DJ0A 3J80U 1N8RT 1ICEB 5LT5A 3N79A 3LTOA 5L1IA 3CJKA 2MSSA 5LXRA 2NPFA 3ZZPA 1QAYA 4LF6F 2I1RA 3RUBL 3PYFA 5B09A 4J9RA 3VHQA 1REGX 3V6JA 2HHQA 3OXGA 2J7WA 2HRTA 4IRKA 2E29A 2DGXA 5KFEA 3IN5A 3FZBA 1GMWA 2MZ1A 1Q81T 3CT9A 1ZZFA 1WC6A 3M6VA 3FBEA 3BSCA 4B9UA 1RT2A 4CI0B 4Y2KA 4AFFA 2RF2B 1KN6A 3MEEA 6FD1A 5CZVA 3JXOA 1LEOA 4ED1A 1H7WA 1HHSA 3S1TA 1SIZA 4IO9Q 4CNYA 3ZTOA 1XMQJ 4M5GA 2UU9F 3EM1A 1NDPA 3QGPA 5F8MA 4C7QA 4G3IA 4UOGA 4M95A 2FJXA 5D0RA 4FPRA 3OQ2A 5LSLA 2PO4A 3VGUA 3WBZA 1IR0A 2ZM6J 1U26A 2WOMB 2YKQA 3CC4S 2C3PA 2ZHBA 4WFXA 2R8JA 4USIA 2BQRA 2RU3A 1JXEA 2A2CA 1KQGB 3CWJA 4WYWA 3AJDA 3FFIA 4C8ZA 1QAXA 1Q5YA 1TTHB 3I55S 1WF0A 3UN3A 4C98A 3GMGA 1HNXJ 1MWZA 2CPXA 1HR0J 4C8KA 4MK8A 5SZTA 3NP5A 3TQ1A 5HANA 3W7BA 2YQ1A 5IS2A 1YRTA 2IJRA 2C2EA 2UV8G 2LCWA 2YWWA 4A8OA 6AT1B 5L1JA 5CYQA 4IRDA 1NJYA 3KK3A 3GTYX 1C0UB 4MIWA 4RBTA 1YGYA 1RAAB 3TUZC 1UJ6A 3NXZA 3Q0AA 3SYZA 1QLNA 2DGOA 2XMAA 4ATNA 2QA2A 3KLVA 4YB7A 5LM7E 3G6ES 2CWKA 4AQYJ 2MQ8A 2BOPA 4OZ5A 2Q79A 3P8BB 4OX8A 3PJWA 2H9ZA 5HMYA 3MAAB 2M8HA 4ZITA 2B3TB 2MQMA 2W2PP 3DHWC 1RTJA 2F4FA 1VRTB 2V0NA 1F2HA 2J0WA 3VF0B 3JS9A 1WOSA 4O4RA 5D4OA 1RT7B 3OR2B 3MM8A 1YHQS 1R8PA 2IMWP 1FKOA 4F3MA 2W7OA 3KDOA 4JB8B 4YEAA 1NZ8A 2RT3A 2J9DA 4OV1A 1DRZA 2GHWA 2C28A 1MG7A 3H5SA 1Q16B 2IAJA 2BQ3A 4MKVA 2XSJA 4Q44A 1TVRA 2OD6A 4RPFA 5RUBA 2CDRB 4ICLA 1T0TV 4O3SA 2B56A 4GMKA 2DNYA 2ASLA 4KIAA 3R5GA 3OL6A 4C2MA 1QAIA 3EZ5A 2ATCB 3TARA 2DRAA 4ZCIA 3MM6A 4ZP9A 3D6HB 2KM8C 5L8RC 3EGZA 3OFEA 5EN1A 5KT5A 1SJ1A 2J7UA 1N5TA 3BH6B 1FEHA 2YWHA 3BJYA 1U1QA 3UE2A 2UXBJ 2EFPA 1REVA 2BR0A 2W9CB 2Z58B 2JC0A 3IS9A 2GQQA 2HNYA 2UUWA 4B3SF 5CD4H 1N5QA 3OFFA 3M8PB 3G82B 4TQRA 2RAQA 1D9DA 2ZH1A 1QJHA 3D6FB 5E33A 3PFOA 4LFBJ 3THTA 2XI2A 3H5XA 1FHTA 5IT0A 4JUZA 3DGPA 1YK9A 1RAOA 4DL2A 4F3QA 4JI5F 2ZOMA 4OFZA 2L9NA 5AT1B 8AT1B 2ZH8A 2BANA 2ZJRQ 2CYYA 2BM0A 1HNZF 4BCAA 4UOCA 3QIPA 4ZLNA 4AE5A 4FS2A 4DX6A 1PIEA 4JV5J 1LWFA 3IWXA 3QBCA 2KFNA 4UUWA 2IBOA 2RHQB 2DHHA 3WX8A 1M90T 4ZKAA 1RT4B 4R8UA 2KFYA 5A0YA 1N33J 4J9SA 3U27A 3VV2B 3ET6A 5FJ4A 1HWLA 3CPWR 3MECA 4JI2J 3QO9A 4HI2A 1PAEX 3C6TB 3CJRA 3ENWA 1EQ0A 1JJCB 4TKTA 1MNEA 3RYLA 1VHFA 2L41A 3ITHA 2DY1A 3ISND 4PQAA 3DRPA 2B9EA 3PCOB 1Q82T 1BQXA 4UT4A 3FZ2A 3SQOP 2V94A 4DQIA 3TNVA 4XK8C 1X0PA 3IBWA 3A1YG 2FHJA 3SSQA 1NJIT 4ZCKA 4OJHA 4URQU 4AD6A 5KT2A 3OV7A 4USTA 1JWWA 3I5BA 2YX1A 1NK7A 4LF9F 3R5BA 3MFIA 3A8KA 4TY9A 4USUA 5T7LA 1LKZA 1HIYA 3DLBA 1RXOB 1WHVA 2GX8A 3DOKB 1U25A 4KKOB 2XLJA 3VR1A 3MM5B 3MURP 2AV5A 3J7Z5 3G6XA 4EI2A 3S8SA 1RU1A 3MPVA 4ZVFA 4P2FA 1Q7LB 4PWDA 3P4UB 1WNEA 3MMCA 3QQCD 4I1TA 4X4QA 4IKAA 1WSVA 5M2UA 2I5JA 5J2QA 2ZITA 5H9FJ 3AOAA 2Y0SD 4KHPJ 2IHR1 2YKAA 1JIHA 4PWWA 2OP5A 2P9EA 2VQEF 2A6OA 4JYAF 5BYQA 2NREA 1HL6A 2AZ3A 3GJTB 3ZO7A 4R0JA 2RU9A 3QRQA 1TL7A 2MTLA 3Q86A 2KJWA 3FJ2A 1BQMB 2MZQA 4PPZA 5KFJA 2G2ZA 3FEYB 4LRBA 4BWMA 3MOJB 1AB8A 3Q24A 1FESA 2HFUA 3R2DJ 3GONA 2IMOA 4LIWA 1TUGB 4USMA 5F9NA 4IDKA 4IG3A 2XSFA 2HKEA 5KFVA 1HBMB 2ADCA 2ASJA 3CW2C 1JLCB 2MZSA 3DMJA 2DH9A 4K59A 4GC6A 5HLFB 3MI7X 3W2VA 1MROA 2NXJA 1GMWD 1YVFA 4A8WA 3GE9A 1JLBB 5B0CA 4C97A 1RHKB 4DR2J 3M8YA 4F4ZA 4X2BA 4YB5A 3TA1A 4DUZF 3Q8RB 4NMLA 2MPUA 2A3JA 4DPUA 1VI7A 2ZE2B 3H2LA 3OLAA 4Y00A 1IBLJ 2VONA 5KT7A 1YITS 3Q2TC 3LAMA 2K7KA 4PG4A 1Y11A 1S9GA 1SL2A 3KMQA 3Q89A 1WTBA 2YWKA 3TR5A 3OVSA 1T03A 3B54A 3JQJA 1IQZA 3WDOA 5CCLA 2HFVA 4MKAA 3KLHB 1NK0A 3RAQA 3KHLA 4M5LA 1RABB 1NK4A 5KFOA 1U1MA 4W90B 3GLJA 4DI6A 3NWRA 4X66J 1VDHA 4HDHA 4NXMF 2CJBA 1S1TA 2H48B 4WF9Q 3G87A 1U09A 2RIJA 4TNOA 2BJDA 2XNQA 2XBPA 1HBNA 2MQQA 5D4PA 2DXFA 4X4TA 3UNGC 1CG2A 3M8QB 3IXQA 3NRBA 4EFAC 2WB4A 3GG1A 1ZM4A 5KG0A 3D0HE 4GKJJ 5ETVA 3VQTA 3CD5A 5KFMA 3DLGB 3PRVA 1GTHA 1UZDA 2XY7A 4L74A 5ETQA 2K06A 3QGHA 4ID5A 1T9VA 5DGBA 5DZ7A 2K8GA 3CJSA 3ISZA 2FJWA 2DD8S 3HHLA 3CC7S 4Z7CA 1NK8A 1VIOA 3ETOA 4F4AA 3IM8A 2EK6A 1UWAA 2HRUA 4YHHF 2RNEA 2BMBA 4B3MF 2HLTA 2GO8A 3MEDA 4YR3A 4HHJA 2HSEB 2AJ4A 4DF8A 1IR1A 4DL4A 3CCUS 1ZH5A 3KLEA 2X3GA 1EQMA 1FDDA 2BXJA 3W2WA 1IBMJ 4W98A 2VZ9A 1SC1B 4HKQA 3V6DA 5ETPA 3AB4B 4ES2A 2DCUB 3KLFA 2R2SA 2CQHA 2BJ8A 2EW9A 1NB7A 2B6AA 4M5IA 3AT1B 4NI2B 1N54B 5KFAA 3SCIE 2NYHA 4OIXA 3PFEA 2R2UA 2KI2A 1VC0A 1MU2A 4FYXB 1ULRA 2FDNA 4NCGB 2EK1A 3UN5A 1KLMA 2H5IB 3OFHA 2KJVA 4RW7A 2VQFJ 3DLEB 3RU0A 4HT7A 5AE3A 4KV8B 5AE2A 4L75A 3UR3C 2VG5B 1LWEB 3VZIA 1T9UA 3BGFA 3BH7B 3UCZP 2UXDJ 3W61A 4IR9A 1RWUA 5L9XA 2W8LA 4U7CA 5CH7B 1FERA 3AOBA 1UVLA 2RQCA 3QT6A 2CADA 3H5UA 1PJ5A 2AJ0A 3LALA 4TN2A 2VDIA 3M2UA 4K4UA 2APOA 3T5HA 4DSFA 1WORA 4CH1A 3T9ZA 1CPZA 3LPYA 3BS9A 3EZUA 2H51B 3OBIA 3UO0A 2X1BA 2J76E 4QU7A 4ETZA 1HQUB 1L5UA 2XLIA 3P6YC 2G1HA 2CNOB 1D9AA 3QAUA 2YWFA 4OX6A 4ZLPA 1S0OA 2AW0A 3AY0A 4BLGA 4ILLA 2J8SA 2BUNA 1S9EA 4F0KA 1R43A 3H42A 3I96A 2X1GA 3IRXB 1PBUA 1TL1A 4DV0J 2UP1A 2ZVIA 4FS1A 2RRAA 3MTKA 4DV3F 2CPJA 4EYHB 4FBTA 4ZS6A 2XGPA 4PYDA 2QL7B 2UUTA 3OSNA 4TVAB 4USKA 3GIMA 4JI1F 2XZWA 4GVBA 4DUYF 3PX0A 2W25A 4KHRA 4MYUA 1SJRA 3B78A 5L9NA 3MEGA 2DNRA 3NCRA 2G1DA 4DFKA 3HSZA 2VODA 1AFIA 3T5JA 3JSBA 5GAEI 4OL8A 4J9VA 5DLFA 4KR0B 2E44A 4CO1A 5K8NA 2QA1A 2RRNA 3V4MA 1CULB 5HSPA 5HROA 4Q45A 2XYPB 1RAHB 4LSNB 2PFDA 4ED4A 4PXBA 4IH7A 5L46A 1YBTA 4U8YA 1JB0C 1CQMA 2V8VA 1H72C 4Y28C 4QWDA 3GU0A 1ZAVA 3BF4A 5I3PA 1U02A 1BD6A 1GXUA 1KDNA 3H2UB 4IOAQ 5H9EK 4O4GB 3BBBA 4RZRA 1I51B 3EZOA 3VAKA 2RHSB 4NLWA 3VGVA 2KT3A 2HBRB 1GMVA 2OEKA 3SQGA 5M2PA 1WJ9A 1WEZA 3BN4A 5J2NB 1BY9A 3CJ0A 3BBFA 5K20B 4F67A 4LF4F 4PG7A 3C66A 1CJKA 4ZCMA 1HWUA 3D1OA 1FKAF 3KOAA 1AZSA 4HACA 5KG2A 4HHHA 3PZPA 1RTIA 4RNNA 1S1WA 1UJ5A 2JNJA 1WC1A 3FSYA 4KGKA 2EKYA 2DK2A 4F25A 5A2QY 2RD5C 2GJIA 2HQCA 1B0PA 3P45B 4HLBA 4OI6A 3G71S 5DDPC 4IOCQ 3BPSP 3D1HA 5C25A 3M1VB 4HDGA 1PC4A 1N34J 1Z4UA 4F2SA 1HNIB 3UPFA 1NDLA 4JOUA 5KOWA 4CO3A 1O6XA 3U1MA 3OL8A 4ZK7M 2CQPA 2FZGB 3N0VA 3QJLA 3UDVA 1HPZB 1R27B 3DDIA 2MKYA 3B6BA 2B0GA 2VPXB 2BYCA 4DR7F 1EKRA 2OPPA 1Y4ZB 4ETXA 4P2XA 4RU2A 1VJQA 2HBQB 4PXEA 2CPEA 4DL6A 1F6TA 5CZXA 4PG6A 4ZVOB 1RWPB 3D2WA 3TANA 1T7PA 1UVNA 4OYPA 1UW9A 1VMBA 1X4GA 3MDFA 1W25A 3T1HF 2AD9A 2Q1LA 4N47A 1RHMB 5LMUJ 1S76D 5F8GA 2H4YB 1ZS6A 5J1NA 1PO6A 1JMTA 1CLFA 2HS0A 2WVBA 2QL5B 2Y1RI 1GTEA 5BYRA 1VBKA 1Y10A 2UXCF 2SXLA 3FCHA 1XQIA 2QO3A 1HYSA 4BBYA 3FKBA 4V1Ak 1L3TA 2R7SA 4JI6F 4CT9A 4J90A 3QAEA 3UI3A 3I5CA 4YY3J 3DLKB 3KG1A 2J5AA 5JXSA 1DY3A 4B9LA 1MW7A 4OHXA 3ZZTA 4F7VA 2KYZA 1TELA 4LF5F 3JYTA 5J2PA 1VQLS 2I0XA 2RSQA 1VQYA 5GADI 3BKUA 2HZCA 2D41A 3M7VA 2V9WA 1AUDA 3LWLA 3OXLA 1SI9A 3QWUA 3C14A 3I6PA 2BV3A 5HQMA 4O3OA 1WKLA 1T9YA 2DNGA 2DHSA 1UETA 2JEGA 3THPA 2MGZA 1M5KC 2X51A 4FKXA 1XJWB 1U1RA 3H8YA 3CCES 2OMLA 2VKRA 2LMIA 3KYLA 1RT1A 4DLGA 3C3LA 3UQSA 5KFGA 2JLGA 1V3ZA 3GFHA 2MXYA 4ECWA 2ABYA 3M30A 2CNKB 4H4KC 5ETOA 4DR1F 4RUAA 5KFQA 3RB3A 4DL3A 4DZDA 4K8RA 3O8WA 2DXEA 2FLPA 1HARA 3Q23A 1YLXA 1CEZA 2MQNA 1GQEA 1RBAA 3M2RA 2R9LA 4E98A 2W1BA 4CWBA 4WIIA 2DGUA 5EX3A 3PO5A 1HBUA 2M9KA 4ZVTB 7AT1B 2BE2A 2KHCA 1ITPA 3IRWP 5H9EJ 4ED2A 3MPYA 1F9FA 1XBWA 4A8YA 2IM1A 3QFWA 2Q43A 1VQOS 2ALYB 1FDAA 2K1RB 3AB2B 2VG6B 4N77A 2X3DA 3O5TB 1C1CB 4L3NA 1B0VA 3KLIA 3MD3A 3FRZA 3MR5A 1HNVB 2PD1A 4EO6A 1KVKA 2I38A 3WC0A 4WTYA 1OY9A 2OJ3A 4GRSA 2ZZMA 4DU8A 1WG5A 3NWGA 4NMXA 4HTJA 4OLOA 3IMQJ 1WEYA 1VHIA 1SV5B 1DLOB 4OMFG 3UVJA 3TI0A 2AKWB 4Q0BB 4ILRA 3LAKA 4PXDA 1WC3A 1L3KA 4DR5J 4JI7F 1XNQJ 4LFAF 9ATCB 3R6GB 2QC3A 2H1YA 1XERA 1H73A 3QYYA 3QT8A 1F9EB 1QTMA 2ZH6A 4O0IA 3Q8SB 2FY8A 2W9BA 4ZJQA 3W62A 2BW7A 2HWIA 2R8HA 1HI8A 4G6VB 1DTTB 3RRHA 4M5HA 1D8ZA 1RAIB 1RAFB 2R8KA 3IR5B 3Q8QB 4TQSA 3AOCA 4NYZA 1JLAB 2CFXA 4K5SA 5AXLA 5A8RA 3Q22A 1ZM9A 3PJXA 1RT6B 1KQSR 3DYAA 2KL8A 1EZZB 3T1YJ 2YVSA 4BWJA 4HT5A 1L3UA 3CJ8A 4UOFA 1T95A 3E01A 4EBEA 4DQQA 1R0BG 2YNHB 3AODA 1VBZA 2B43A 3NEKA 3C2PA 3I0SA 1R0CB 1VYAA 1CS4A 5HN0A 3C16A 3J81Y 1C4CA 4I69A 3JTOA 2IA0A 3NLCA 1S79A 4MFBB 1R8HA 2FPHX 4FXWA 5GAGU 1P1LA 1HWJA 4U7UK 4ANCA 3P49B 3B4DA 4DQRA 3R1LA 1N36J 2NSCA 3NCQA 5D77A 2HQGA 3KJQB 2P5VA 1OS5A 1K8AT 1OY8A 3HX9A 2RDIA 4WPAA 1NH8A 5AXKA 1BQNB 1WI8A 4RKUC 4X4OA 1VQ7S 4MAKA 4LF7F 3QJPA 3MTJA 1EAYC 1SQGA 4C8OA 3V81B 2H65B 3EJMA 2RUSA 2OO4A 2DNKA 4C0OC 2OI2A 1TR0A 5H1SV 3F0NA 4JI8J 2ZBRA 3K59A 1VC5A 5HK4A 3MPWA 4H4MA 1B7YB 4OHWA 3PKMA 1IKVB 4I2QA 1U1OA 3VAGA 4H4KA 2WZ1A 1AUSL 3TZXA 2E9ZA 1TQLA 2QRRA 3T9NA 1YJWS 2W9AA 2HWHA 1FTRA 2LKZA 3V5RA 2YKPA 3PIPQ 3EE3A 4YQWA 1LOUA 4ZVEA 4KAIA 4F8RA 4QCLA 4Q5VA 4ELVA 2HPUA 1S6QB 4TY8A 1VISA 5DDQC 2IFXA 1VRUA 3C15B 2DNMA 3NNHA 1M1KT 4UOHA 3M6XA 4ZPTR 2HQ3A 1IR2A 4P7VA 4OX9F 4FNHA 2XG8A 4MYTA 2FVSA 1K0VA 1MWYA 3HT3A 3ZTRA 5K8MA 1NBEB 4NLGA 2CQBA 1BE4A 2ZOFA 2Y1JA 4NLQA 3QLHB 2MY8A 3MCSA 4XTTA 5C24A 4DG1A 2PA3A 1BGXT 1O51A 2CQ2A 1YJRA 3EX7B 4PQUB 3QPIA 4YFUA 1T02A 2LEPA 1KVIA 5HP1B 2R3VA 3MM9A 2D7SA 4J91A 3LOUA 2HS4A 1IWAA 4CLTA 1FD2A 1TL3B 3NGKA 7FD1A 4LF6J 2AYMA 3MR7A 3R2CJ 2VDHA 4R25A 4NEYA 2PN6A 4OX7A 2E9TA 2RRBA 2E1AA 3L7OA 2E1PA 1SKSA 5D6GA 4FVCA 3IG1B 3HKZD 1RT3A 1IJEB 3ZZRA 1YG0A 4DS5A 4ECUA 3PVXA 2I8EA 2HZAA 3PHTA 3HM9A 2HVIA 4DMZA 4KGZB 1Q8KA 4CYUB 1VBXA 2JC1A 4KFBB 2YTCA 2BBEA 4LRFA 4WFNQ 2HQDA 1LQ9A 1QAJA 1NLKL 3BB5A 2WB1D 2M52A 2UUCF 1T9TA 2Z2YB 5KFKA 2JH3A 1W2IA 3CD0A 4CLPA 4IOBA 2MJNA 3OTEA 5F0WA 1QD1A 4KH1B 1TMJA 4KO0B 4JI0F 1TZ0A 5D8HB 2UU9J 2AYGA 2W24A 2ZUGA 2Z2ZA 4OI1A 2LA6A 2MKKA 3T1AA 5HMXA 3CJKB 4ES3A 1NHUA 1AXQA 4K0KF 3IA0A 1RU2A 2XNRA 2WSFC 3PEHA 2KN4A 4I56A 5F9LA 5IWAF 4PKDB 2R7OA 1SCJB 4WFBQ 2LVWA 2W01A 2Z57B 1ZA1B 3CDEA 1KOHA 2VD3A 3CDBA 1DAXA 1DURA 2XEXA 4QR1A 4OI0A 1NK5A 1W2BR 2KXFA 2AGQA 3M8ZA 1QY7A 2V8DA 3EVOA 2OSQA 3NCPA 1RT2B 1XR5A 1QDUB 1VK3A 3BSNA 1IUJA 4LJMA 4A8QA 3MEEB 4ZIWA 2R2TA 1R89A 1C1BA 3GG0A 4NLRA 3KG0A 4CLSA 5DQIA 5HMZA 2DISA 3IFEA 2J9CA 2AYBA 2GJ2A 1NXIA 2MKHA 1FE0A 4HEA9 1XEZA 3ENAA 4DSKA 2QLWA 4F3OA 1J5OA 1U24A 4ERDA 4TU7A 1WD6A 2LQ5A 2MZJA 4Y3CA 2D3O1 3QZ8A 1N56A 2VOPA 4AUKA 4FVMA 5HVGA 3FFIB 2V5HG 1R6VA 2ZH5A 5KAKA 3G86A 2AHOB 5AE1A 1WC0A 3I9V9 2GMLA 3WX4A 5IXUA 2P9CA 2KG1A 2ATLA 3KJVA 1XMQF 4IQXA 2OSRA 1S49A 3R5CA 4L6V3 1PCAA 5CYQB 1SIWB 2AEFA 3KK3B 2W2NP 1RTDA 1EHWA 2DR7A 1KFDA 1M0SA 3TX0A 3VQSA 1TMMA 2ADBA 1XR7A 3HHDA 1FXLA 3RBXA 3GB0A 4PABA 5HQLA 4QYRA 1XC9A 3M6WA 1PILA 4CNZA 3DOMA 3HZGA 1RTJB 3H0PA 4B3SJ 3G8QA 3FC9A 4K4XA 4DU7A 2LFVA 1TU0B 4MKYA 3MM8B 4J9UE 1N32F 4X84A 2IVFB 2HFZA 1FKOB 4CLZA 4JI5J 2FHKA 2YKNA 3VWSA 3LA0A 1HNZJ 4A8SA 3G8SA 3N4WA 2DBBA 2IAJB 2XSJB 1QM9A 1TVRB 3NY0A 3QZ7A 3M8RA 5D3GA 4AXIA 2AZ1A 2YNGA 4ICLB 4U9RA 1S59A 3DM2A 2N7CA 2VPWB 1J27A 1FXRA 2VL1A 1IBKF 4X62F 1LW2A 3RBZA 1BC6A 2LA4A 2B4UA 3MM6B 5LMNF 3F56A 3HVAA 3OHAA 3GR0A 2O66A 1Q5VA 4NA2A 1FFWB 1U1NA 4IUFA 1CJVA 1A0OB 1GX6A 1NSKL 3TUIC 4WCEQ 1HW9A 4MMOA 1REVB 4ITSA 2OLWA 1WI6A 4JI4F 3IS9B 2Y1IA 2HNYB 4XIUA 2LEBA 5ETNA 3I32A 2HW3A 2Q66A 4XPCA 1NO8A 2XHCA 3CCWA 4X65F 4I6WA 2YBVA 3BDPA 4NRUA 2HWTA 5F8IA 4U6PA 2F4VF 3DGPB 1NUEA 3US5A 2LECA 3AD9C 1LV5A 1RHUB 3JAMU 2W2MP 2BANB 4WJBA 2YNIB 2IDEA 1R8CA 1QSLA 4LF9J 3QSYB 3QIPB 4CM0A 4ECSA 1LWFB 3W64A 1UCNA 3C8YA 5BYSA 1AT1B 4FKYA 4DBQA 4DQPA 1U8SA 4X4SA 4B02A 4R8UB 2P6TA 2CG4A 4LF2A 4HYKA 1TAUA 4K4SA 5A0YB 1YJUA 3QRPA 3ET6B 2VFTA 3MECB 2KO1A 1B0TA 1VBYA 5KFFA 1HHQA 3QO9B 5L39A 3HVRA 1WKJA 1PYTA 4URSA 3MR2A 3ITHB 2XGQA 3DRPB 4F4WA 4J9OA 4ZMMA 4FYWB 4B3RF 5DM6Q 1Q7YT 2WVDA 1H7XA 8ATCB 2VQEJ 4JYAJ 2QN6B 4BC9A 3ZFVA 4A4JA 3D28A 1GT8A 2GMHA 3KNGA 4NCBA 3OVAA 4F0HA 2B8QA 1RHRB 2FC8A 3R6LB 4RBUA 3BDEA 1RA7A 4NLSA 5K14A 4FPIA 2IC3A 3CO0P 5T7LB 1ZETA 1BUXA 3Q8PB 3TUJC 3PXGa 1VQKS 1GX5A 1Q53A 2MZRA 2DNPA 1U48A 1P27B 2E5LF 1R6YA 5KFDA 3I0RA 3KHGA 2BOAA 1RAGB 5LSRA 5E2QA 3V6HA 2C2KB 1NK9A 1HLWA 2JOQA 4ZVSB 4PWDB 2AP6A 1K0TA 3MMCB 2NCKL 3VAFA 3BBCA 4NLPA 4DUZJ 3OLBA 3D6TB 2RQKA 4C8MA 1QE1A 2I5JB 3BO4A 5J2QB 4KT0C 1MSWD 4OHZA 4LSZB 1BQMA 2WBRA 4NZ7A 3GZ7A 3I87A 2NUHA 4ID8A 4FYYB 1K9MT 3A3NB 4I7FA 3THVA 2KU7A 2CG8A 5E3AA 5KFLA 2JRSA 3BGOP 5KFIA 2FJEB 3HLUA 4DV7F 1T9XA 1KBRA 1D0EA 1TL7B 2CJXB 4UQGA 3CDWA 1RHQB 2ZBCA 2OMOA 3QJJA 2N3LA 3LUYA 1HQEA 3TW0A 2R7QA 3N28A 4IDKB 2RS2A 4IG3B 1RBOB 4F4YA 2E66A 5HBMA 1OYDA 3K5LA 3CJ5A 3I4HX 1J5EF 3JQMA 2NYIA 5KFNA 3DMJB 5G0RB 2RDJA 2HG4A 4FXDA 5JJBA 3W2VB 4DR6F 1MROB 3PDNA 2HHVA 3W65A 2MYFA 2M8DB 1NKCA 3J7AN 3ICLA 1M5PC 1M5OC 1KC8T 3O1LA 2OPSA 1YJ9S 1J2VA 1N5SA 2VHGA 3DOLA 2GGPA 4OI2A 4DN0A 4V19J 3FQKA 3GR1A 3IGVA 1I6JA 2C1EB 2DNLA 2XMMA 1LXJA 5DRKA 3BPDA 4DOZA 2FLLA 1S9GB 2XWYA 3E8OA 2ZWOA 3BYPA 3MR6A 3ULHA 1F0XA 4F4KA 5HO4A 3RZAA 3PNIA 3HKWA 2HYIB 1T03B 2OPQA 3VALA 2CQCA 1MN7A 2NQPA 3HJFA 1YZ6A 2V4RA 4ZVUB 4YHHJ 5KFWA 3UW1A 1ACMB 2G9OA 5THWA 4B3MJ 4DV5F 1CJTA 4C11A 1EB0A 4WK1A 4W92B 3K8VA 3HVWA 2Z56B 1U0SA 5I42A 1S1TB 4HI1A 4QYZJ 3JSYA 5DDOC 4BS2A 3ENVA 5K9FA 1HBNB 1VQ9S 5HVFA 3UDLA 4K7QA 2V69A 3SIPB 2JJ4D 1H98A 1NKBA 1S5ZA 2XMKA 2F8EX 3AQOA 2V34A 4CO0A 2DR8A 1WG4A 3O6QA 2DGQA 2CJYB 4U96A 5GMDA 3DLJA 2F65A 2ZC4A 4YB6A 1KQFB 3UFCX 2HVDA 1O0PA 1V5IB 5KFPA 5EWGA 4YUDA 4B3OA 2PMZD 1FTCA 3M05A 3IGNA 4DFPA 5I3QA 2EFGA 1HKAA 1C4AA 1V9OA 3DXSX 1I94F 1KOOA 4ID5B 3A3PB 2DYAA 3FGVA 4X4PA 5LJ5Y 5G4DA 1B4SA 2H54B 1T94A 1I3OB 1XMOF 3HHLB 3OTCA 1WSRA 3UDEA 1SKUB 2R42A 3DN9A 3D0IE 2EFVA 1BLUA 2KZMA 2PFFB 3QT5A 4OHVA 5LJ3Y 1FCAA 3MEDB 3M6UA 4ZVRB 4AT1B 3MCNA 3SCLE 2LDYA 3CCJS 3KLEB 4NYPA 2DGVA 4HL9A 1S6PA 1PJ7A 5IC4B 1SUQA 3W2WB 4P2SA 2VF3A 5DETA 2F5GA 1WDDA 3V6DB 3V6KA 2QYGA 3R1HA 1TFWA 4EYIB 3N6LA 4G65A 3MWBA 2LDIA 3GFZA 2D9PA 1VGYA 3KLFB 4Y2IA 2H5EA 5E41A 5FD1A 4TU8A 4URGA 2CQGA 2CVIA 5C42A 2K7JA 2K2PA 2B6AB 3NGSA 1AYEA 2CQ0A 4IFYA 4DPOA 1B3TA 2Y8YA 1FVQA 1SC4B 1NSPA 3BGUA 2GZOA 4RUCA 2FGOA 4O3RA 4JI3F 1RP5A 1NZAA 5D0GA 2VBZA 1U2RA 2B4PA 3AAWB 4UY8T 1IKXA 3KHRA 4W4MA 4LREA 4YR0A 2Q6BA 1MU2B 2Y1LB 4RO0A 4O0NA 1KLMB 4O23A 4OLPA 2XMTA 4H54A 4RW7B 1A7GE 3PW7A 2GFFA 4DV3J 1UPPA 2V8HA 4A8XA 2IM0A 2HHXA 4HTIA 1TUWA 2OUGA 2JSXA 4Q43A 3BR9A 4JI1J 4DUYJ 2Z30B 2GVZA 2NXUA 5EHHA 2DIVA 3GSDA 3HD1A 2J6UA 3HT0A 4RJVA 2CDQA 1NDKA 3CDUA 4C0HA 3M2UB 4F02A 3NS5A 1RYSA 5CD4A 3UR0A 1VC6A 4WU2A 4AYBD 1LFPA 1PBAA 2JZ5A 3HMJG 2G13A 3LANA 3BGRA 3LP1A 2AMCB 3CCZA 3WZ0A 1WUUA 4XAKA 5DO2A 1RGVA 2DXDA 2XY5A 2AWZA 4QPTA 2CJ9A 2GAHC 1S9EB 2MKSA 1RWOB 2F3JA 1TKXA 3D6MB 1G2EA 1TL1B 3N6MA 2OPRA 2A18A 2LU1A 2J8AA 4LR7A 1BXNA 2YQ3A 4P6QA 5IV3A 2DNQA 4PG5A 4FYDA 3FBBA 4C3LA 1RHJB 2ZD1A 4OJ1A 5H9FK 2BRKA 4C8YA 3A8IA 1X9SA 5E0OA 1QSYA 2OELA 1FJEB 1VCTA 4GVBB 3R5JB 1N0UA 4LF4J 4ECYA 1VQ4S 5F3TA 2JVOA 1WF1A 1XMBA 2N4DA 4ENOA 3QFHA 3MEGB 2AEMA 1SXLA 3GWCA 2DB1A 2ZVSA 1G1XA 2IPOB 1XNRF 3CMES 2KVQE 1WF2A 3OW2R 4YMEA 4OYZA 2FLOA 5HROB 2C2ZB 4FZVA 2V8PA 4N56A 3CO9A 1BWVA 2NXCA 4NLUA 5B08A 2DVIA 4DSEA 2RH3A 5DGAA 1NU4A 1FX4A 4G1QA 1PG5B 2Z0GA 3KXDA 2MJUA 4CT8A 4I0WA 3N6NA 2PEHA 1H38A 1S1VA 2E7WA 4E0DA 2DNOA 2HVEA 1HMVA 2GIRA 2D1CA 1K73T 3EICA 1Y7PA 4DR7J 3QGGA 3F73A 1XR6A 1S0VA 1S4EA 2FUG9 2RKIA 1UPMB 1L3SA 4N5SA 1NJZA 3AQPA 2O3DA 3TOQA 3SQGB 1FK9A 1RDRA 2VICA 3MMJA 2DNNA 3K17A 3TVKA 3ILIA 4EBCA 4ECXA 2E1MC 3BZQA 1HW8A 1TKZA 3CTRA 1CJKB 4C4WA 2YY3A 3POTA 2ROEA 4DV6F 3CVKA 3LF0A 2UVVA 1YDLA 1AZSB 4HACB 3KLGA 3ZZUA 3T1HJ 3VCDA 1ELOA 1RTIB 3WIVA 4O44A 5IFMA 3P96A 2MEWA 1S1WB 3EVMA 3TVZA 4ECTA 4NXNJ 2W7PA 5E7OB 2DKOB 2PGCA 1S0MA 2VOOA 5BR8F 2R8GA 5C25B 2UXCJ 1U1PA 3K0JA 1X5PA 1XK8A 3EDQB 3QIDA 2R7WA 3J7ZT 3BEGB 2V50A 2NPIA 2FQQB 4K4WA 1O5JA 2UUBF 4JI6J 1U6FA 2OTLS 1UZHA 1NKEA 1EETA 2JDJA 3OTBA 4MT1A 2WVFA 4LF1A 1SKWA 4PYAA 2V2QA 4LQ3A 2CKWA 1IWGA 2XMJA 4LF5J 2OPPB 3OL9A 2WAQD 2AJQA 1X4AA 2OD4A 4LBHA 1NJXA 2QA4G 3B82A 3DCAA 1JLQA 4FDFA 2FGCA 4NLXA 4ELUA 1RJJA 3ENQA 2QMWA 4DV4F 5ITHA 4KC5A 4PCQA 2KHDA 1N34F 2CZVC 2NR0A 4RX6A 2W4DA 4NE9C 2JHEA 2HBZB 1FDNA 3SV4A 1F1BB 4OYOA 1KRPA 1UFKA 8RUCA 4LF8F 4IG0A 2ZHAA 2ZHOA 2F7VA 3NMAA 2HEKA 3HHLC 4DR1J 1HA1A 1SL1A 3HFKA 2JWNA 4RNMA 3B8HA 1SH0A 1HYSB 3RR7A 1JXLA 3IBCB 1Y5IB 3CIMA 4CP5A 1C0TA 2CPYA 3JSMA 2KTQA 2EI5A 2VA2A 4QIWD 2N7YA 1TV6A 1DQ9A 3U1NA 3JYTB 2N82B 1UA1A 5J2PB 2KXNB 4PR6A 4KY3A 4RUBA 4RW8A 1NHVA 2YWEA 3T5LA 3T3FA 2DNZA 4ER8A 2VFRA 3JSRA 2DHAA 4LFCF 2J7KA 2C2NA 3C14B 2NXNA 2WONA 1KFSA 4QWBA 1HWKA 3DRRA 1YKWA 2MGZB 4B17A
chains in the Genus database with same CATH topology
2W2OP 2Z58B 4NE9C 2PMWA 2W2QP 2W2NP 3BGOP 2ZWOA 3P5BP 3CNQP 2Z30B 1SPBP 2Z2YB 2ZWPA 4K8RA 3VV2B 3AFGA 3CO0P 2QTWA 3A3OB 2XTJP 3GCXP 3BPSP 3A3PB 4NMXA 3WIVA 4JP8A 2Z2ZA 1ITPA 2W2MP 3T41A 2E1PA 1SCJB 2W2PP 1R6VA 3QFHA 3VHQA 2Z56B 3WHIA 3GCWP 3A3NB 4YN3B 3H42A 4OV6A 3SQOP 2Z57B 1V5IB 3WIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2O P;  2Z58 B;  4NE9 C;  2PMW A;  2W2Q P;  2W2N P;  3BGO P;  2ZWO A;  3P5B P;  3CNQ P;  2Z30 B;  1SPB P;  2Z2Y B;  2ZWP A;  4K8R A;  3VV2 B;  3AFG A;  3CO0 P;  2QTW A;  3A3O B;  2XTJ P;  3GCX P;  3BPS P;  3A3P B;  4NMX A;  3WIV A;  4JP8 A;  2Z2Z A;  1ITP A;  2W2M P;  3T41 A;  2E1P A;  1SCJ B;  2W2P P;  1R6V A;  3QFH A;  3VHQ A;  2Z56 B;  3WHI A;  3GCW P;  3A3N B;  4YN3 B;  3H42 A;  4OV6 A;  3SQO P;  2Z57 B;  1V5I B;  3WIU A; 
#chains in the Genus database with same CATH topology
 2R7U A;  3FVY A;  4ED5 A;  1E6V A;  4WZQ A;  3K5P A;  1RT1 B;  2KH9 A;  1KLN A;  3HDS A;  3SBM A;  4QR0 A;  2YXL A;  3M30 B;  3ONQ A;  1P1T A;  4JI7 J;  4LFA J;  4QPX A;  2CQI A;  2YNF A;  2VFV A;  4LR8 A;  2HVH A;  3SDE A;  2GO9 A;  4MJK A;  5D4L A;  1X5T A;  3M2R B;  1JLE A;  9RUB A;  3Q8Y A;  3M8S A;  3EGV A;  2WK4 A;  1T9W A;  1HBU B;  2U1A A;  3MZI A;  1TFY A;  3CJQ A;  1U4B A;  5D0H A;  3OT9 A;  2Y0B B;  1TL5 A;  4P7T A;  2DIU A;  5KOX A;  3KJN B;  4TXS A;  2W8K A;  1RTZ A;  2GS8 A;  4ECZ A;  1S57 A;  3Q8U A;  2JL9 A;  1F2G A;  3DRS A;  3FMW A;  2B4O A;  2GVD A;  3M32 A;  3KLI B;  2ZBP A;  4NLY A;  2M0G B;  1K44 A;  3OUY A;  3HK2 A;  2XHW A;  3K7R A;  3NS7 B;  1KTV A;  2VU5 A;  3RB4 A;  5FLX Y;  3PW5 A;  1RUS A;  4QJV A;  3UVJ B;  4H4O A;  4ZVP B;  1WAC A;  1YRU A;  3RTV A;  1EJ7 L;  2HHP A;  1KS2 A;  3DLL Q;  4NLO A;  2A2D A;  2V68 A;  4UTG A;  3CCQ S;  2F9D A;  3NL0 A;  2ASD A;  3BQ0 A;  2YQ0 A;  2W9B B;  4UW2 A;  1OPI A;  1KHW A;  1S7H A;  1LW0 A;  1FDB A;  4DL0 C;  2C3U A;  2W4P A;  1RT6 A;  3QRR A;  2IA6 A;  4RW4 A;  4UUX A;  4LF7 J;  3IO1 A;  4TU9 A;  1M1H A;  1RTH A;  4DX8 H;  2ZNY A;  2WRM A;  3RR8 A;  2PEB A;  3CCM S;  5A8R B;  4MK9 A;  4KH0 B;  4K4T A;  3CXC R;  3W8G A;  2AGO A;  3W9H A;  2A1B A;  3GYX B;  3U7J A;  3DYA B;  2L48 A;  1LWC A;  1NND A;  3ZZY A;  3OPK A;  4RW9 B;  1RT5 A;  2UZA A;  3HFV A;  1S6O A;  4ZJO A;  3E01 B;  2OFG X;  4F36 A;  1QVG R;  1YJN S;  4WYL A;  5KFY A;  4WXO A;  1FRM A;  4QWE A;  2ZEJ A;  1RBL A;  5L1K A;  7FDR A;  3NGU A;  3I0S B;  3GV7 B;  4LUB A;  3LP2 A;  1CS4 B;  3EYZ A;  3LGN A;  2HK2 A;  3C16 B;  4ZPA A;  4WTO B;  5CYM A;  5DS7 A;  4WU3 A;  3GIJ A;  3TX8 A;  1ZBT A;  3H5Y A;  4WP9 A;  2FVR A;  2XZD B;  1SJF A;  2XC9 A;  4EGL A;  2IBK A;  1RCO B;  4B9M A;  2XS5 A;  4M94 A;  1AW0 A;  4N8O A;  3EUN A;  2FTR A;  4FF4 A;  1UEV A;  1SPB P;  1FNM A;  4RWX A;  4NCA A;  3C6U A;  4OX9 J;  2MLY A;  2AU0 A;  3KNA A;  2AYE A;  4A8K A;  1ZZN A;  5HJX A;  1VR6 A;  4HHU A;  3D7S B;  4NEZ A;  4QWC A;  3GFX A;  3MFH A;  3VAM A;  4JV1 A;  2QYC A;  1LK5 A;  4TYB A;  4F0M A;  2LQ9 A;  3TAM A;  2C22 A;  2LQ8 A;  4B3T F;  1WOO A;  1Y5L B;  1TKT A;  2XCP A;  1M5S A;  3MUM P;  1RB0 A;  4IYQ A;  4H4M B;  4LRC A;  4KPY A;  4I2Q B;  3SCK E;  3U1L A;  5JMN A;  3VTI A;  4NOH A;  4GKK F;  1Q86 T;  2F40 A;  3AFG A;  4PPD A;  1F5C A;  3S6E A;  1M5V C;  4CM2 A;  1U45 A;  2LXU A;  1FRH A;  3HI9 A;  5IOL A;  4P52 A;  4JV0 A;  1JLG B;  3FBC A;  2MKJ A;  3WHI A;  4NWB A;  3EPG A;  1BMQ B;  3PAC A;  3PEJ A;  4X64 F;  4Q2L A;  4TY8 B;  1FRK A;  1R7I A;  1HNW F;  5IT9 Y;  2AF6 A;  4C0B A;  1JJ2 R;  1VRU B;  1RSC A;  1VQN S;  2IY5 B;  4LMZ A;  4CO5 A;  3GIR A;  4NX9 A;  2MKI A;  2BW2 A;  2U2F A;  1D3W A;  1U6Z A;  2UUC J;  2IIH A;  3ILJ A;  5CXT A;  2OHD A;  1VQS A;  2HMI A;  5KFX A;  1WG1 A;  4DL5 A;  1S72 S;  2O1P A;  3V4I A;  4DPX A;  1SJQ A;  3CUN A;  3AJ1 A;  3D3B J;  2C42 A;  5C24 B;  4DG1 B;  3PR4 A;  5AJ3 J;  4ZPW R;  4JI0 J;  1IBC B;  4OZL A;  4QOT A;  5U47 A;  1UWB A;  5I4M A;  3GYN A;  1OSD A;  4WIQ A;  3H25 A;  3MM9 B;  3BO3 A;  2VFS A;  4RLE A;  2WHO A;  2KKH A;  4K0K J;  4DV1 F;  2QEX S;  2ZKU A;  1C2P A;  3TVY A;  2XYH B;  2FVP A;  5IWA J;  3BGL A;  3H4D A;  2C2D A;  3D5M A;  2CJA A;  4DS4 A;  1RT3 B;  2ZH4 A;  5ETL A;  3G2X A;  2ASY A;  3P3D A;  1PYO B;  4WE1 A;  5HQ8 A;  1IKY A;  1R8A A;  4OZN A;  4JV2 A;  2UVW A;  4BHQ A;  3R7B B;  2EWH A;  3KK1 A;  2FHJ D;  2BJ3 A;  3O2I A;  5K5M A;  3JTP A;  2F63 A;  1S6U A;  1FJC A;  2CRL A;  4C3K A;  1M5H A;  1IJF B;  1YWX A;  1CBK A;  3SXL A;  3PKY A;  1Q95 G;  4NA3 A;  3BV8 A;  3HD2 A;  3K8W A;  1WHY A;  1CC7 A;  2QIF A;  3G4S S;  3PY8 A;  1DBD A;  3TQE A;  3K57 A;  1X8D A;  1Q4R A;  3RJM B;  4O3N A;  5KG3 A;  1LXN A;  4P74 A;  2AIR B;  1W7W A;  4WXW A;  1DQA A;  1FI4 A;  1W26 A;  2MB0 B;  4Y2A A;  1DTQ A;  2G2O A;  3P5T L;  3ETM A;  1S1U A;  2DHG A;  3DGV A;  1R3N A;  3NNC A;  2DGS A;  3J7Y U;  2RJZ A;  1WHX A;  1XN9 A;  3HHN B;  3PX6 A;  2MY7 A;  2HHW A;  3JTN A;  2FVC A;  5T14 A;  5ETR A;  1NPP A;  4QIG A;  3J7Y I;  4OZ3 A;  3M2V A;  2M5Y A;  2LXI A;  3CB4 A;  1JX4 A;  2V2K A;  1VIX A;  3K5M A;  4CCH A;  3UNY A;  4FYV B;  3OR1 A;  4QW8 A;  4AL7 A;  3AHP A;  2LU2 A;  1PAU B;  3KTQ A;  3W1Y C;  1KON A;  3TRG A;  4P71 A;  5ADZ A;  2DR5 A;  4Y0F A;  4CH7 A;  3TO8 A;  3TA2 A;  1QVF R;  2BE9 B;  5JUM A;  3MMA A;  2DH8 A;  4OZ0 A;  1VK8 A;  5B0G A;  1FWP A;  3BM7 A;  1C1B B;  3VGS A;  1HHT P;  5LL6 d;  4B9V A;  1VQ5 S;  4R0E A;  4E8U A;  1EAR A;  2B4V A;  4YDD B;  5KT4 A;  4P72 A;  1FNX H;  1OJ4 A;  1IXK A;  2D3U A;  4DSL A;  1UMJ A;  1IM6 A;  2CQ1 A;  5J1E A;  1TKD A;  1UKU A;  2B7C B;  3R9L A;  3TJ8 A;  2GIF A;  3H20 A;  5AXM A;  1OY6 A;  3KDN A;  2HAI A;  2FJB B;  2XO7 A;  1J5O B;  1SQF A;  2WVE A;  2ZH3 A;  3SV3 A;  4FF1 A;  4OI4 A;  2AJ1 A;  3D68 A;  4K4Z A;  1X9M A;  4HVZ A;  2HGN A;  1N32 J;  2A0F B;  1UL3 A;  4DXL A;  4NZ0 A;  2HFN A;  3N5F A;  1TK8 A;  2DR6 A;  5ETS A;  5FLX U;  1K1S A;  2F8H A;  3MAQ A;  3CCV S;  2VC0 A;  2KZZ A;  1N6Q A;  3KJV B;  2ZH2 A;  4UY8 5;  4HH1 A;  1X5S A;  2R7X A;  3WC2 A;  4M5D A;  1ZM2 A;  4QW9 A;  5A8W A;  3GII A;  5I3U A;  1HI1 A;  3D4J A;  1RTD B;  3ADA C;  1TP7 A;  4O3P A;  1IBK J;  4X62 J;  2YKM A;  2O5D A;  5DG7 A;  2EFQ A;  3R3T A;  1T05 A;  2BX6 A;  1UEK A;  5LMN J;  1EP4 A;  1FWL A;  2DEJ A;  2NS1 B;  1UA0 A;  5KFR A;  3PYD A;  3HPO A;  3HO1 A;  1YJV A;  3D1Q A;  5KFS A;  1URN A;  4ZOS A;  3LO3 A;  4QQB A;  3DOM B;  4DV2 F;  4JI4 J;  4EK2 A;  4J9K A;  3OTO F;  4A47 A;  4GC7 A;  2OH2 A;  4GO7 X;  1K1Q A;  2DRB A;  4X65 J;  1ZAX A;  3G6V A;  2F4V J;  1H74 A;  1H0H B;  5F8N A;  2HAF A;  1XWL A;  1Z1Z A;  3HHL D;  2WBM A;  2YKN B;  3GYG A;  5DJB A;  2A6M A;  4MK7 A;  3L9Z A;  1S12 A;  4TLQ A;  4DHV A;  5D4N A;  3FCW A;  1BHN A;  5A8K A;  3CCT A;  4MIA A;  2HS3 A;  1UVI A;  2QSW A;  4DR4 J;  1H2V Z;  1U2F A;  2WSE C;  1PKU A;  4Y34 A;  5D3G B;  2GV1 A;  2YNG B;  2CUY A;  4NYO A;  1SC3 B;  3DM2 B;  1FXD A;  3ZTS A;  2LXF A;  4FBU A;  1LW2 B;  2CPZ A;  5EGY A;  1ROF A;  4YDX A;  5ETK A;  1BWE A;  3EMT A;  3R7S B;  3A13 A;  3CD7 A;  5J1P A;  2CPH A;  1S9F A;  4U7U D;  3EGW B;  2MHN A;  1CVJ A;  3ZTP A;  5IQQ A;  4CLK A;  5EWE A;  3A4T A;  4WBF A;  1CJV B;  3CMQ A;  4LR9 A;  4DR3 F;  2BJE A;  5FDL A;  4CH0 S;  2UUA F;  3J7A 1;  3T6J A;  2QL9 B;  4X4R A;  5EDW A;  1X4E A;  2EC0 A;  2IRU A;  4X4U A;  3KG4 A;  4FXV A;  2FJD B;  1TUV A;  2AEJ A;  1S1X A;  3HF5 A;  2DR9 A;  3QWP A;  5J2M A;  1D9F A;  2XS2 A;  4FN5 A;  4B3R J;  1B99 A;  4ZVG A;  4K4V A;  2HHT A;  2YNI A;  4B9T A;  2CA9 A;  1S97 A;  2ZZT A;  2ERR A;  1P8G A;  4YS2 A;  4U67 Q;  1FO1 A;  4FP9 A;  3H2V E;  3D67 A;  2O01 C;  3TEH B;  4RU9 A;  3M9O B;  1MMD A;  5DZ6 A;  4NLD A;  3GCX P;  1LNQ A;  2CWX A;  1RWN B;  3HVT A;  1XTZ A;  3W3S A;  3CDA A;  1NB2 A;  2R8I A;  1OWX A;  2DCL A;  3K2Y A;  4C8L A;  4YB1 P;  2C2R A;  3SEO A;  1ZPV A;  2ZZN A;  3DI6 A;  2KRR A;  3LP0 A;  2RB7 A;  1A6L A;  1KKH A;  3DU5 A;  5IT9 U;  1DQ8 A;  4ZA1 A;  2QG9 B;  2E5L J;  2PII A;  3DRX A;  4WFY A;  5KTQ A;  3A8J A;  2DT9 A;  4M1K A;  5F41 A;  2VJV A;  3LH2 S;  3ZZ0 A;  1RKJ A;  1R0A A;  3VVT A;  4CTA A;  2YH0 A;  1OQ6 A;  2PMH A;  2GAG C;  1KD1 T;  3ZNU A;  2HND A;  1YTY A;  3BKF A;  3R8Y A;  4M5M A;  1JLF A;  4LRA A;  3HJV A;  4RW6 B;  1S7I A;  2LQJ A;  3TA0 A;  1IVZ A;  1RWX B;  6FDR A;  1X4D A;  3N01 A;  3MMB A;  3PJ9 A;  3D66 A;  2IM3 A;  3MCM A;  3T41 A;  4IH5 A;  2BKN A;  3LGM A;  1KHV A;  4USW A;  1VLY A;  4DV7 J;  1N5Y A;  4L72 B;  2HHS A;  3FRY A;  2BE7 D;  4WP3 A;  2M70 A;  2R4F A;  2HLU A;  1GFW B;  2X1F A;  2FB0 A;  3MUT P;  3AA9 A;  4RNH A;  2E5H A;  3C46 A;  2F1F A;  4LIR A;  1YZ7 A;  2XS7 A;  3AA8 A;  5K14 B;  4LVO P;  3PW4 A;  2YWG A;  1JNZ B;  2IC3 B;  1FNO A;  3IR6 B;  2V8G A;  3MPU B;  5KFC A;  1J5E J;  1RAE B;  1F60 B;  2B51 A;  2MHE A;  3OFG A;  3CJ2 A;  3I0R B;  1CC8 A;  4DR6 J;  2J9E A;  4S0M A;  3NBP A;  4MIB A;  4PUO A;  4KGM A;  1P6T A;  2BA9 A;  2VG7 A;  3UD5 A;  3MM7 A;  5GAG I;  3EXY A;  2B8P A;  2GJF A;  2P6S A;  3MF5 A;  3WIU A;  4KSE B;  2MMY A;  2DPI A;  4AXJ A;  4OYA A;  5HAO A;  1QE1 B;  3OHB A;  2CAJ A;  1UVK A;  1KR4 A;  5IQ6 A;  1QSS A;  4USV A;  2N4C A;  1B7F A;  3M8W A;  1WOP A;  4I7F B;  4DCP B;  1SC6 A;  4USJ C;  4CO4 A;  4NA1 A;  1ZAW A;  1U6B A;  3I31 A;  4Y65 A;  1FJG F;  4UQT A;  1UAW A;  4KPC A;  1WEL A;  2L9W A;  1Q0N A;  2B5J A;  1JKH A;  5G0R A;  2IJF A;  2JFK A;  4DV5 J;  1TL4 A;  3CJT A;  4HH0 A;  1HQE B;  4AL6 A;  3CMA S;  5ETT A;  2B9W A;  1WEX A;  5B7W A;  2ILY A;  5HBM B;  4B9N A;  4IR1 A;  1ZYQ A;  2VKZ G;  5JVH Q;  1GK8 A;  3TZW A;  5E3P A;  4D3H A;  2YKO A;  1U0H A;  4KJI A;  3BKT A;  1CJU A;  3ELH A;  4C48 A;  3CUL A;  5A2Q U;  2ZWP A;  2OPS B;  3A8E A;  1VJW A;  2A10 A;  2QSF A;  3I82 A;  3KK2 A;  1OIA A;  4K5R A;  2RS8 A;  3DOL B;  1FKP A;  2GGP B;  4CLW A;  1T3O A;  2GW8 A;  2HQI A;  5IM0 A;  1FRJ A;  4ZLJ A;  1I94 J;  1IKW A;  4ZJL A;  1XMO J;  2HK3 A;  3SFU A;  5IC6 B;  4NAS A;  1AA1 B;  3RRK A;  2OPQ B;  4ZHR A;  2OEM A;  1DHM A;  4I2P A;  2DIT A;  1SVD A;  3IWL A;  3RAX A;  3W5Y A;  2J6T A;  4LSL A;  4OZ1 A;  4R5P A;  1CJT B;  4C11 B;  1K47 A;  2M7S A;  5JVG Q;  3L95 X;  4IQM A;  1KP6 A;  2I2Y A;  5I42 B;  1X4C A;  5D78 A;  3AD7 C;  2E5I A;  4J9Q A;  2V4J A;  3LWM A;  1QTN B;  1ZTW A;  3ZXW A;  5K8O A;  1E6Y B;  4IFV A;  3FEX B;  3S01 A;  2HHH F;  2PDA A;  4KHM A;  1HI0 P;  5HJY A;  2DJW A;  2YX7 A;  3CJ4 A;  2HNZ A;  2BM1 A;  1H2U X;  3HXM A;  4I68 A;  2L3M A;  2Y9H A;  1HBO A;  3PV8 A;  3ZZO A;  3PIO Q;  2DY9 A;  2V2V A;  1NME B;  2DRD A;  4JI3 J;  3IC1 A;  4B3O B;  2RUG A;  3ILL A;  1X4H A;  3GJS B;  5DM7 Q;  5CCM A;  4DX7 A;  1TAQ A;  3DRY A;  4DL7 A;  4WWS A;  4OZJ A;  1F5B A;  1D8Y A;  3MGJ A;  4EZ6 A;  2VV5 A;  1UJ4 A;  4FF2 A;  2BJ7 A;  2VUG A;  3D54 A;  4TYA A;  3K5N A;  1WC5 A;  4HR2 A;  2E9R X;  2FZC B;  3MEK A;  1X9W A;  2AX1 A;  1WHW A;  4A8M P;  4U8V A;  2V67 A;  2CQ4 A;  4J9L A;  4RUH A;  2DEI A;  1S6P B;  3KMS A;  1SUQ B;  2O67 A;  2MLZ A;  2WSC C;  3JQK A;  2PSZ A;  5KT3 A;  2BAC A;  5GVQ A;  4CLF A;  1FA0 A;  2D74 B;  4ZIV A;  4EBD A;  2CXE A;  4ZPD A;  2Q6C A;  5C42 B;  4ES1 A;  4DLE A;  2HVZ A;  2RF2 A;  5DG9 A;  4IFY B;  2EG1 A;  1V3R A;  1OQ3 A;  3H4B A;  3UD3 P;  1Q8I A;  5HVH A;  3F41 A;  3CNQ P;  4DEZ A;  4OZ2 A;  2NZ4 A;  1IKX B;  4ECQ A;  2XMW A;  2DGW A;  1Y9O A;  1JK9 B;  3CGI A;  3PW0 A;  4UZC A;  2WOM A;  1G3O A;  4ED3 A;  5D0E A;  2OFH X;  2J0S D;  2NZC A;  3PG9 A;  3QMQ A;  3DC2 A;  4YN3 B;  2YPY A;  3PYG A;  5KG4 A;  1RWM B;  3D3C J;  3X3U A;  2GVZ B;  2DPJ A;  2YX4 A;  2QLJ B;  2KT2 A;  3G8T A;  2AGP A;  4DFM A;  2R2R A;  4KQZ A;  1YJT A;  1NM2 A;  1VFJ A;  1FWK A;  2LQB A;  1XNR J;  5KG7 A;  2GHP A;  3KUG A;  2JLE A;  2ZJP Q;  3LGH A;  3BGR B;  2CPD A;  1R31 A;  3LP1 B;  1C0U A;  4A46 A;  2HIY A;  2ZBQ A;  4GO5 X;  3EPI A;  1KVJ A;  3PX4 A;  2OAU A;  4K4Y A;  3W60 A;  1X0F A;  3M4X A;  3TJ9 A;  5B0D A;  2J6S A;  2LP4 A;  1TKX B;  2WCX A;  3CCS S;  5B0B A;  3MAA A;  4MKB A;  2OPR B;  1T3N A;  1XIQ A;  3BSA A;  3DHX A;  4J9P A;  4EEY A;  2ZM6 F;  5L38 A;  4KGX B;  5GAE U;  2GIQ A;  2ROG A;  4C3M A;  1VRT A;  2V2Z A;  2ZD1 B;  5MAO A;  4QIV A;  1FRL A;  4RWW A;  5DLG A;  1RT7 A;  3OR2 A;  5KT6 A;  2DNH A;  5KG6 A;  3KUE A;  4XPE A;  4ZDN A;  4DV6 J;  3F44 A;  1X7V A;  3NOC A;  1HNX F;  1HR0 F;  1YSJ A;  4ZP6 A;  4CRJ A;  2CZ9 A;  2XLK A;  3DFE A;  2PC6 A;  3TAP A;  2HQF A;  2IYG A;  3GPA A;  5KFB A;  4U95 A;  3UCU P;  1V3S A;  3T5K A;  3J81 U;  2DGT A;  3DXB A;  5BR8 J;  2HFO A;  1GAO A;  1RE1 B;  4J5O A;  3R27 A;  4QR2 A;  4L73 A;  4G1Q B;  2J9D E;  2UV8 A;  2EVZ A;  3ILO A;  2UUB J;  1S1V B;  4AQY F;  2FIU A;  1HMV B;  4ZN1 A;  2XTJ P;  4YP3 A;  3R5A A;  3QNW B;  2HGM A;  3W9J A;  2W9C A;  3BO2 A;  2VPY B;  3I4P A;  2RKI B;  1M1G A;  2MST A;  2H4W B;  3D9B A;  1RAD B;  3A12 A;  2W4C A;  2HUR A;  5CYJ A;  1GNK A;  3M8P A;  3TUP A;  3G82 A;  1FK9 B;  4KBI A;  3MUV P;  2F9J A;  4RR5 A;  4QWA A;  2KRB A;  1S10 A;  1RWV B;  2KYX A;  1TKZ B;  1HFE L;  3POT B;  3C19 A;  1SJ4 P;  3Q83 A;  3KLG B;  4DV4 J;  2AX0 A;  3BSO A;  2ACM A;  5IZH A;  4O44 B;  2QT7 A;  2QX0 A;  3PR5 B;  1SL0 A;  5M2R A;  2BKO A;  2L08 A;  4ZPC A;  4LF8 J;  4CLU A;  4O3Q A;  1ARO P;  2HBY B;  2MLX A;  2ZFH A;  4QYZ K;  1NH7 A;  1RT4 A;  2W7A A;  3LPE A;  2N3O A;  2EFN A;  3VVU A;  2RQM A;  3HP6 A;  4I64 A;  1EET B;  3BR8 A;  3C6T A;  4LT6 A;  5BXI A;  2XZT B;  3IP0 A;  5SUH A;  3SCJ E;  5A76 A;  5F8H A;  2UXB F;  2XMV A;  2E1R A;  1RAC B;  5DG8 A;  4GVL A;  3UD4 P;  2FLN A;  3HCX A;  3OJS A;  2PE8 A;  3K5O A;  3NKY A;  4XDD A;  1GH8 A;  2Y3Y A;  4NL5 A;  4N8N A;  3OL7 A;  4EU0 A;  2VA3 A;  5HI7 A;  3O44 A;  4WKY A;  3L3C A;  2NLW A;  4LFB F;  1WDT A;  4LFC J;  4NXN F;  1JLQ B;  2GC8 A;  2X7I A;  2DTJ A;  4EUV A;  1FT8 A;  3SI8 A;  1EIY B;  2G0C A;  1FD8 A;  2KVI A;  3SSS A;  3EXC X;  4JV5 F;  3NAH A;  1UVJ A;  2ACY A;  1JJ4 A;  3KFW X;  4IG0 B;  1VQ8 S;  1OPZ A;  1F3V A;  3QT7 A;  3DOK A;  5K8P A;  4KKO A;  3MM5 A;  5GAD U;  4YOE A;  1NAQ A;  4OYB A;  1N33 F;  2AJ2 A;  4Y6I A;  4V19 X;  2EBE A;  1C0T B;  4JI2 F;  2RIL A;  1Q1K A;  4M5N A;  3GCW P;  3JSM B;  1MLA A;  4F4X A;  1RI7 A;  4PWU A;  1Q78 A;  1TV6 B;  5EUH A;  5LSO A;  1VQP S;  1NCL A;  1NPR A;  2FHO B;  1FRX A;  2EC2 A;  1URR A;  2K3I A;  3TZZ A;  1CSJ A;  4Z2X A;  4RW8 B;  2FY1 A;  3GJQ B;  3RW6 A;  4USH A;  2B9X A;  4KE5 A;  1G4C A;  4ZP7 A;  2WON B;  2BDP A;  3DU6 A;  1N52 B;  3DRR B;  3IAS 9;  4KYZ A;  2ALZ A;  2Z2L A;  2QLX A;  2RML A;  4MH8 A;  2C3O A;  1E6V B;  4EMD A;  3BRE A;  1SJ3 P;  5KFZ A;  3GV8 B;  2DH7 A;  2R7R A;  3UDC A;  4PRF A;  3H90 A;  1UP1 A;  1HBM A;  1JLC A;  1FF2 A;  3OTD A;  4TLR A;  2VBX A;  2XM3 A;  4PZV A;  4E2F B;  5HLF A;  2YNF B;  3PYE A;  3SDE B;  1NEE A;  2M4M A;  3N5B A;  1NPK A;  4NXM J;  1JLB A;  2CVE A;  4NLV A;  1LK7 A;  2GQ2 A;  4PAA A;  1IQT A;  1JLE B;  1S99 A;  1RQ0 A;  2VB6 A;  1NRK A;  2XWX A;  4DPT A;  2ZE2 A;  3VAH A;  2IVM A;  2IRY A;  1MN9 A;  4A48 A;  4KHP F;  3QGI A;  2PMW A;  3ZZZ A;  3OVB A;  2LLZ A;  2Q3P A;  1U2C A;  2OTJ S;  2BZ2 A;  3DRS B;  2P8I A;  4CDI A;  1QUV A;  1U1L A;  4ANE A;  3S7R A;  2GVD B;  2CQD A;  3M32 B;  4L3K A;  3KLH A;  4I4B A;  3GQC A;  3J81 j;  1KWM A;  2UVR A;  4F2R A;  3OUY B;  2F8M A;  4NPO A;  3G96 A;  1Q8L A;  3VGT A;  3ZTQ A;  5B0F A;  1WC4 A;  4EO8 A;  4CO2 A;  3HHK A;  3HFZ B;  4H4O B;  4LVN P;  2E5G A;  2BRL A;  2QMX A;  3M8Q A;  1L3V A;  3T19 A;  1ZM3 A;  4ZCL A;  1KEK A;  3AJ2 A;  1X60 A;  4DR2 F;  3PW2 A;  4DDF A;  4PEO A;  1YRX A;  2YPZ A;  4P73 A;  1LW0 B;  5EX0 A;  2ZUA A;  3DLG A;  4DSJ A;  1DFD A;  3HHE A;  4RW4 B;  4RW9 A;  4J9M A;  1IBL F;  2QLF B;  3RAM A;  1PC5 A;  3ZNJ 1;  1RTH B;  3W63 A;  2PT0 A;  1YBA A;  5GME A;  1YI2 S;  4KRW A;  3CJ3 A;  2RE1 A;  3W5X A;  5KG1 A;  3CIZ A;  3D0G E;  1LWC B;  4B3T J;  4C9D A;  2AQ4 A;  1RT5 B;  4UF4 A;  3RRG A;  4J7C A;  2VIH A;  3MPD A;  2BEF A;  1FEE A;  2EEY A;  2G2Y A;  4GKK J;  2JFD A;  3LP2 B;  4X66 F;  3MOZ A;  5CYM B;  1WTF A;  4K2J A;  2BKP A;  3NNA A;  4Q8E A;  3HUL A;  2FD2 A;  1Q8B A;  1Y5N B;  5B0E A;  2BJ9 A;  4OHY A;  2DO0 A;  2MKC A;  2V9K A;  4X64 J;  3CSK A;  1HNW J;  5KG5 A;  3CCR S;  2G0J A;  3LW5 C;  4GKJ F;  3CE8 A;  3EVW A;  1RKI A;  1G6B A;  2XCA A;  4N76 A;  1ZOT A;  4NI2 A;  3C6U B;  2C2M B;  3PM9 A;  3SSR A;  1KQK A;  2KXH A;  1TK0 A;  2LEA A;  1AFJ A;  1O8B A;  2FYX A;  4NCG A;  2IJN A;  1GMU A;  1Y3J A;  3U02 A;  5A6W A;  5CHC B;  3TAM B;  3X1L B;  5T41 A;  3DLE A;  3IR7 B;  3O3L A;  3JAM Y;  1TKT B;  2RQ4 A;  3UCG A;  4UZB A;  2M88 A;  3FSI A;  4DQS A;  4KV8 A;  5HL7 Q;  4X4N A;  1H3D A;  1PGZ A;  2MDA A;  3NS6 A;  2VG5 A;  2IVY A;  1S77 D;  3V2U C;  1LWE A;  1JLG A;  1YIJ S;  4QIE A;  3FSX A;  4RNF A;  2FJA B;  4D3G A;  4DV1 J;  5E3R A;  2KDO A;  4LQ9 A;  4P9S A;  1VRQ C;  3CD6 S;  4OI3 A;  1IBM F;  1NSA A;  1FRI A;  3RBE A;  1UTA A;  2UVU A;  1RAJ A;  1FJ7 A;  5D15 A;  4K2X A;  3EGN A;  4ZPB A;  2ZH9 A;  1RLD A;  4P10 A;  4Z7Y A;  3I9Z A;  1HQU A;  2WW4 A;  2QA4 S;  1QUP A;  3W9I A;  2DHX A;  4OYW A;  1VQ6 S;  2HMI B;  5F0U A;  1R8B A;  2FJV A;  2WVC A;  2OGU A;  3V4I B;  1T8E A;  1PJ6 A;  1NK6 A;  2H3E B;  3FQL A;  4G1P A;  1SQE A;  1IM4 A;  3IRX A;  3NGD A;  1N48 A;  2XY6 A;  4J37 A;  1SH3 A;  2VQF F;  1VQM S;  4WFZ A;  3IWN C;  1UWB B;  5DDR C;  2V6A A;  2BAB A;  2FC9 A;  1N5V A;  3MXH P;  3MHY A;  1LWX A;  2BJ1 A;  3KKF A;  4N7T A;  1OO0 B;  2VH7 A;  2UXD F;  2VPZ B;  5MLC V;  1I5O B;  3OXF A;  2G4B A;  3CF5 Q;  3L4B C;  4RBV A;  2XO6 A;  2I6W A;  2MQP A;  2HGL A;  4J9N A;  3KWM A;  1H6K X;  3OSP A;  1B70 B;  3BQ1 A;  2QV6 A;  4K50 A;  4ZPV R;  4WE1 B;  1CQN A;  3RGI A;  3NMR A;  2V63 A;  1IKY B;  3AD8 C;  4JBC A;  1CUL A;  3KK1 B;  5CA5 A;  5EWF A;  5HAT A;  3IM9 A;  2JEI A;  2EPI A;  5BJR A;  3FMB A;  2E7V A;  4B08 A;  1Y0H A;  4LSN A;  5AJ3 F;  4DX5 A;  3H59 A;  2CIM A;  1RWW B;  1PSD A;  2CNL B;  1S0N A;  1S48 A;  2OKQ A;  4PXC A;  5IT4 A;  3W66 A;  2VJU A;  4ZVH A;  2CQ3 A;  3B4M A;  5GMK a;  1SKR A;  3K89 A;  4O4G A;  4YR2 A;  3RG6 A;  4DV0 F;  1RWK B;  4Q8F A;  2GMJ A;  4KB7 A;  3LQV A;  2P2C B;  1SH2 A;  3OJU A;  1YJ7 A;  1DTQ B;  4OYI A;  1JXV A;  3A3O B;  5J2N A;  5C5J A;  4QZV B;  4QIF A;  1S1U B;  2DO4 A;  2WTF A;  1LFW A;  4OJ3 A;  3TYT A;  4WP8 A;  3UWT A;  3HSD A;  4DPY A;  2AJF E;  4MTP A;  1F5A A;  1JNR B;  1TK5 A;  2XUL A;  1SBR A;  5C2C A;  3M2V B;  2XI3 A;  1ZPW X;  3TAQ A;  2COL A;  4M5J A;  1U1K A;  4ZP8 A;  5C7P A;  3OR1 B;  3I56 S;  1ZA2 B;  4I6A A;  3TJA A;  4DZ6 A;  3M1V A;  1FX2 A;  1B64 A;  1HNI A;  3VZH A;  2MQL A;  3MR3 A;  3MMA B;  1Z2L A;  4F50 A;  2QMU B;  3TZY A;  1HPZ A;  2HIQ A;  3NOG A;  4N41 A;  2OIH A;  1V6H A;  2IM2 A;  3H98 A;  4OV6 A;  2JLF A;  3NGT A;  2QGF B;  2JEF A;  5J1E B;  1I1G A;  1JQG A;  4DWI A;  4DV2 J;  3DKD A;  3OTO J;  1KTQ A;  3GIK A;  2GNK A;  4DUT A;  2CPF A;  4Y2C A;  1U47 A;  2VAS A;  3Q8V A;  2EKN A;  1YQH A;  4M63 A;  1N88 A;  2XYG B;  3K58 A;  4Z37 A;  1NSQ A;  3FUY A;  4Q7A A;  2IYI A;  5LOQ A;  1OMS A;  3GSI A;  1APS A;  1OSC A;  4BC7 A;  2NUU G;  4WKR A;  2QFJ A;  2JX2 A;  4OQJ A;  1N6Q B;  2V4Q A;  1YBU A;  4OYX A;  4M5D B;  5A8W B;  1U8W A;  5I3U B;  2PI5 A;  3DLK A;  2YKM B;  1Y3K A;  1DZ5 A;  1T05 B;  2GQC A;  2QZ8 A;  2BVZ A;  1EP4 B;  1F3F A;  3TP2 A;  5LXY A;  3J80 Y;  3W8P A;  2JEJ A;  2HZV A;  4DR3 J;  2UUA J;  2C3Y A;  3FK4 A;  2FZK B;  1HD1 A;  1V5V A;  3H7H B;  4ED0 A;  3DDN A;  5F8L A;  2HFS A;  4CZC A;  3PTW A;  5E3Q A;  2ZDO A;  4DCJ B;  4RL1 A;  2ZNZ A;  5LMU F;  4C6A A;  1U7L A;  3CED A;  4WK3 A;  2B9Y A;  1N4L A;  3WQP A;  2FVQ A;  1WKK A;  2R7V A;  2MZT A;  4LRD A;  2ZBI A;  2IRX A;  3NGR A;  1GXT A;  5A6P A;  2KB2 A;  2CNN B;  3PHE A;  2JVR A;  5A8K B;  1KSP A;  4DJB A;  3IBF B;  1EKS A;  2CZ4 A;  4DN9 A;  2EG2 A;  2QTW A;  1UVM A;  4DFJ A;  2I9S A;  2XMU A;  3AXM A;  4ZLL A;  4XO0 A;  1RCX B;  4YY3 F;  1GEH A;  1VOM A;  3PRB A;  2X1A A;  3IAM 9;  4BDP A;  1ZTT A;  3HSJ A;  3BQ2 A;  3L7P A;  3FBF A;  2PI4 A;  1IN0 A;  1Y00 A;  3W5Z A;  4JP8 A;  3E51 A;  5L1L A;  1FE4 A;  5FDL B;  1MWQ A;  4ECR A;  1MMN A;  3FEZ A;  2J0X A;  2K1R A;  2MQO A;  3NAI A;  5CQG A;  2VG6 A;  4M8L A;  1S1X B;  3HSG A;  2QFI A;  2PA8 D;  1C1C A;  1RA6 A;  2BE2 B;  5J2M B;  2ZC3 A;  3M9M B;  2E7X A;  4EWT A;  4RNO A;  3VAJ A;  3UN2 A;  1HNV A;  4X4V A;  3ISN C;  2Z2M A;  2NXE A;  4DR4 F;  4ED8 A;  2NSB A;  4CQ1 A;  5HMW A;  4IRC A;  4P75 A;  1RIS A;  3SMZ A;  1SV5 A;  4QBU A;  3HVT B;  1DLO A;  2QE5 A;  4Q0B A;  3SFG A;  2EXU A;  1X5O A;  5C2G A;  3N9U C;  3T6B A;  3DI6 B;  3LP0 B;  1UW4 A;  4AND A;  2J0Q D;  2C2O B;  2FHM A;  4IO1 A;  2K3K A;  4RW6 A;  1EX8 A;  5CAB A;  2D69 A;  4FNI A;  2ZJQ Q;  1GXL A;  1YX2 A;  3GJR B;  4P2M A;  1U49 A;  1DTT A;  3DLH A;  1X31 C;  1R0A B;  4CTA B;  1X4B A;  1NJW A;  2C3M A;  2HND B;  1OYE A;  2QLB B;  1JLF B;  1JLA A;  2W2Q P;  3NG8 A;  3M9N B;  4G1I A;  3QAT A;  4L76 A;  3MMB B;  4ZVQ B;  4XDC A;  2L9D A;  4LBP A;  2Y8W A;  3GFY A;  3R97 A;  2D3O R;  4ZN3 A;  4NZ6 A;  5FII A;  2EBG A;  3GIL A;  1A9N B;  2YNH A;  4ED6 A;  1KNZ A;  5F3Z A;  1FJG J;  1N5Y B;  4ELT A;  4I67 A;  1RLC L;  3G6Y A;  2KG0 A;  1F9H A;  2VBW A;  3TEG A;  3KHH A;  2GA7 A;  3DDK A;  4MFB A;  1VS3 A;  1UFL A;  2GHV C;  3OD2 A;  4DR5 F;  1XNQ F;  1T11 A;  4OJG A;  4ILM A;  5E3C A;  5CAA A;  4QU6 A;  2ZKT A;  1N0V C;  4WZM A;  3CC2 S;  2Z8Q A;  3P5B P;  4WFA Q;  2M3D A;  2M2B A;  4DPW A;  1X4F A;  1BQN A;  3NBP B;  4PUO B;  3L09 A;  2VG7 B;  3MM7 B;  3Q2S C;  3MAH A;  2ZDP A;  3TWZ A;  1FFG B;  3MCO A;  3FDS A;  1RZM A;  2H5J B;  3QSI A;  5AXN A;  2R7T A;  3V81 A;  4NLT A;  2EFO A;  4CLY A;  1H2T Z;  3FNN A;  4DF4 A;  1WWH A;  2RVJ A;  2CJQ A;  2POK A;  3T1Y F;  2Z4P A;  2G0I A;  2D3Z A;  3AXK A;  3ZC4 A;  4ALZ A;  3BYR A;  4CLL A;  2XB2 D;  2KT5 A;  3GV5 B;  3I5A A;  1IKV A;  1JJH A;  1HQ2 A;  5KFT A;  1NDC A;  3HZE A;  4DCO B;  4IH6 A;  4DSI A;  5GAH U;  5B0A A;  2KM8 B;  2B5J B;  1JKH B;  2LYV A;  5GAH I;  4A8F A;  1D1U A;  1HWI A;  3RBD A;  2RDD A;  4F26 A;  1SB6 A;  1N36 F;  2ZOG A;  1S6Q A;  3DNC A;  3GP9 A;  3AH6 A;  3KUH A;  3C15 A;  2AT1 B;  2VBY A;  3EWG A;  1MML A;  2CJK A;  3G9C A;  2HHH J;  4C8N A;  3RB0 A;  2KFZ A;  2W2O P;  1U0H B;  1CJU B;  2HHU A;  2VFU A;  1HD0 A;  2ROP A;  3KJF B;  1UEU A;  3QLH A;  3KK2 B;  3SZ2 A;  4FF3 A;  1FKP B;  4Y2M A;  4PG8 A;  5IM0 B;  2ZH7 A;  4ED7 A;  1UFW A;  3VAI A;  4LBI A;  2YH1 A;  3FCV A;  3L7U A;  4PQU A;  1IKW B;  5F8J A;  4JI8 F;  5HP1 A;  5KFH A;  1Q79 A;  5IV4 A;  1PYS B;  5KFU A;  4M5K A;  1DAR A;  3MD1 A;  2B7B B;  1TL3 A;  4ZHR B;  4I2P B;  1VLO A;  2GCF A;  4LSL B;  4R5P B;  4CIO A;  2E1C A;  2QJ3 A;  2BQU A;  3RB6 A;  3IG1 A;  1E6Y A;  1G7C B;  2CPI A;  2VC1 A;  1RK8 A;  4F04 B;  4EZ9 A;  2E5J A;  4KTQ A;  5E5N A;  2P9G A;  2OEJ A;  4CYU A;  4I6Y A;  4KFB A;  2V4J B;  5DQH A;  2ILZ A;  1FVS A;  3E3X A;  4AL5 A;  4IFV B;  3RW7 A;  3E2E A;  3EDR B;  4KGV B;  1S4F A;  3R7N B;  4Q2M A;  4ECV A;  1P9Q C;  3H40 A;  3PO4 A;  2HNZ B;  2HRY A;  1RYR A;  4B9S A;  1D09 B;  3CCL S;  3PRD A;  3JB9 k;  1Z2Z A;  2D9O A;  1NHK L;  3BN7 A;  1HBO B;  4OYM A;  5ETM A;  2IDL A;  2WW8 A;  4KO0 A;  4NRT A;  5DQG A;  1P9Y A;  1FFS B;  2XQC A;  3R5D A;  1DJ0 A;  3J80 U;  1N8R T;  1ICE B;  5LT5 A;  3N79 A;  3LTO A;  5L1I A;  3CJK A;  2MSS A;  5LXR A;  2NPF A;  3ZZP A;  1QAY A;  4LF6 F;  2I1R A;  3RUB L;  3PYF A;  5B09 A;  4J9R A;  3VHQ A;  1REG X;  3V6J A;  2HHQ A;  3OXG A;  2J7W A;  2HRT A;  4IRK A;  2E29 A;  2DGX A;  5KFE A;  3IN5 A;  3FZB A;  1GMW A;  2MZ1 A;  1Q81 T;  3CT9 A;  1ZZF A;  1WC6 A;  3M6V A;  3FBE A;  3BSC A;  4B9U A;  1RT2 A;  4CI0 B;  4Y2K A;  4AFF A;  2RF2 B;  1KN6 A;  3MEE A;  6FD1 A;  5CZV A;  3JXO A;  1LEO A;  4ED1 A;  1H7W A;  1HHS A;  3S1T A;  1SIZ A;  4IO9 Q;  4CNY A;  3ZTO A;  1XMQ J;  4M5G A;  2UU9 F;  3EM1 A;  1NDP A;  3QGP A;  5F8M A;  4C7Q A;  4G3I A;  4UOG A;  4M95 A;  2FJX A;  5D0R A;  4FPR A;  3OQ2 A;  5LSL A;  2PO4 A;  3VGU A;  3WBZ A;  1IR0 A;  2ZM6 J;  1U26 A;  2WOM B;  2YKQ A;  3CC4 S;  2C3P A;  2ZHB A;  4WFX A;  2R8J A;  4USI A;  2BQR A;  2RU3 A;  1JXE A;  2A2C A;  1KQG B;  3CWJ A;  4WYW A;  3AJD A;  3FFI A;  4C8Z A;  1QAX A;  1Q5Y A;  1TTH B;  3I55 S;  1WF0 A;  3UN3 A;  4C98 A;  3GMG A;  1HNX J;  1MWZ A;  2CPX A;  1HR0 J;  4C8K A;  4MK8 A;  5SZT A;  3NP5 A;  3TQ1 A;  5HAN A;  3W7B A;  2YQ1 A;  5IS2 A;  1YRT A;  2IJR A;  2C2E A;  2UV8 G;  2LCW A;  2YWW A;  4A8O A;  6AT1 B;  5L1J A;  5CYQ A;  4IRD A;  1NJY A;  3KK3 A;  3GTY X;  1C0U B;  4MIW A;  4RBT A;  1YGY A;  1RAA B;  3TUZ C;  1UJ6 A;  3NXZ A;  3Q0A A;  3SYZ A;  1QLN A;  2DGO A;  2XMA A;  4ATN A;  2QA2 A;  3KLV A;  4YB7 A;  5LM7 E;  3G6E S;  2CWK A;  4AQY J;  2MQ8 A;  2BOP A;  4OZ5 A;  2Q79 A;  3P8B B;  4OX8 A;  3PJW A;  2H9Z A;  5HMY A;  3MAA B;  2M8H A;  4ZIT A;  2B3T B;  2MQM A;  2W2P P;  3DHW C;  1RTJ A;  2F4F A;  1VRT B;  2V0N A;  1F2H A;  2J0W A;  3VF0 B;  3JS9 A;  1WOS A;  4O4R A;  5D4O A;  1RT7 B;  3OR2 B;  3MM8 A;  1YHQ S;  1R8P A;  2IMW P;  1FKO A;  4F3M A;  2W7O A;  3KDO A;  4JB8 B;  4YEA A;  1NZ8 A;  2RT3 A;  2J9D A;  4OV1 A;  1DRZ A;  2GHW A;  2C28 A;  1MG7 A;  3H5S A;  1Q16 B;  2IAJ A;  2BQ3 A;  4MKV A;  2XSJ A;  4Q44 A;  1TVR A;  2OD6 A;  4RPF A;  5RUB A;  2CDR B;  4ICL A;  1T0T V;  4O3S A;  2B56 A;  4GMK A;  2DNY A;  2ASL A;  4KIA A;  3R5G A;  3OL6 A;  4C2M A;  1QAI A;  3EZ5 A;  2ATC B;  3TAR A;  2DRA A;  4ZCI A;  3MM6 A;  4ZP9 A;  3D6H B;  2KM8 C;  5L8R C;  3EGZ A;  3OFE A;  5EN1 A;  5KT5 A;  1SJ1 A;  2J7U A;  1N5T A;  3BH6 B;  1FEH A;  2YWH A;  3BJY A;  1U1Q A;  3UE2 A;  2UXB J;  2EFP A;  1REV A;  2BR0 A;  2W9C B;  2Z58 B;  2JC0 A;  3IS9 A;  2GQQ A;  2HNY A;  2UUW A;  4B3S F;  5CD4 H;  1N5Q A;  3OFF A;  3M8P B;  3G82 B;  4TQR A;  2RAQ A;  1D9D A;  2ZH1 A;  1QJH A;  3D6F B;  5E33 A;  3PFO A;  4LFB J;  3THT A;  2XI2 A;  3H5X A;  1FHT A;  5IT0 A;  4JUZ A;  3DGP A;  1YK9 A;  1RAO A;  4DL2 A;  4F3Q A;  4JI5 F;  2ZOM A;  4OFZ A;  2L9N A;  5AT1 B;  8AT1 B;  2ZH8 A;  2BAN A;  2ZJR Q;  2CYY A;  2BM0 A;  1HNZ F;  4BCA A;  4UOC A;  3QIP A;  4ZLN A;  4AE5 A;  4FS2 A;  4DX6 A;  1PIE A;  4JV5 J;  1LWF A;  3IWX A;  3QBC A;  2KFN A;  4UUW A;  2IBO A;  2RHQ B;  2DHH A;  3WX8 A;  1M90 T;  4ZKA A;  1RT4 B;  4R8U A;  2KFY A;  5A0Y A;  1N33 J;  4J9S A;  3U27 A;  3VV2 B;  3ET6 A;  5FJ4 A;  1HWL A;  3CPW R;  3MEC A;  4JI2 J;  3QO9 A;  4HI2 A;  1PAE X;  3C6T B;  3CJR A;  3ENW A;  1EQ0 A;  1JJC B;  4TKT A;  1MNE A;  3RYL A;  1VHF A;  2L41 A;  3ITH A;  2DY1 A;  3ISN D;  4PQA A;  3DRP A;  2B9E A;  3PCO B;  1Q82 T;  1BQX A;  4UT4 A;  3FZ2 A;  3SQO P;  2V94 A;  4DQI A;  3TNV A;  4XK8 C;  1X0P A;  3IBW A;  3A1Y G;  2FHJ A;  3SSQ A;  1NJI T;  4ZCK A;  4OJH A;  4URQ U;  4AD6 A;  5KT2 A;  3OV7 A;  4UST A;  1JWW A;  3I5B A;  2YX1 A;  1NK7 A;  4LF9 F;  3R5B A;  3MFI A;  3A8K A;  4TY9 A;  4USU A;  5T7L A;  1LKZ A;  1HIY A;  3DLB A;  1RXO B;  1WHV A;  2GX8 A;  3DOK B;  1U25 A;  4KKO B;  2XLJ A;  3VR1 A;  3MM5 B;  3MUR P;  2AV5 A;  3J7Z 5;  3G6X A;  4EI2 A;  3S8S A;  1RU1 A;  3MPV A;  4ZVF A;  4P2F A;  1Q7L B;  4PWD A;  3P4U B;  1WNE A;  3MMC A;  3QQC D;  4I1T A;  4X4Q A;  4IKA A;  1WSV A;  5M2U A;  2I5J A;  5J2Q A;  2ZIT A;  5H9F J;  3AOA A;  2Y0S D;  4KHP J;  2IHR 1;  2YKA A;  1JIH A;  4PWW A;  2OP5 A;  2P9E A;  2VQE F;  2A6O A;  4JYA F;  5BYQ A;  2NRE A;  1HL6 A;  2AZ3 A;  3GJT B;  3ZO7 A;  4R0J A;  2RU9 A;  3QRQ A;  1TL7 A;  2MTL A;  3Q86 A;  2KJW A;  3FJ2 A;  1BQM B;  2MZQ A;  4PPZ A;  5KFJ A;  2G2Z A;  3FEY B;  4LRB A;  4BWM A;  3MOJ B;  1AB8 A;  3Q24 A;  1FES A;  2HFU A;  3R2D J;  3GON A;  2IMO A;  4LIW A;  1TUG B;  4USM A;  5F9N A;  4IDK A;  4IG3 A;  2XSF A;  2HKE A;  5KFV A;  1HBM B;  2ADC A;  2ASJ A;  3CW2 C;  1JLC B;  2MZS A;  3DMJ A;  2DH9 A;  4K59 A;  4GC6 A;  5HLF B;  3MI7 X;  3W2V A;  1MRO A;  2NXJ A;  1GMW D;  1YVF A;  4A8W A;  3GE9 A;  1JLB B;  5B0C A;  4C97 A;  1RHK B;  4DR2 J;  3M8Y A;  4F4Z A;  4X2B A;  4YB5 A;  3TA1 A;  4DUZ F;  3Q8R B;  4NML A;  2MPU A;  2A3J A;  4DPU A;  1VI7 A;  2ZE2 B;  3H2L A;  3OLA A;  4Y00 A;  1IBL J;  2VON A;  5KT7 A;  1YIT S;  3Q2T C;  3LAM A;  2K7K A;  4PG4 A;  1Y11 A;  1S9G A;  1SL2 A;  3KMQ A;  3Q89 A;  1WTB A;  2YWK A;  3TR5 A;  3OVS A;  1T03 A;  3B54 A;  3JQJ A;  1IQZ A;  3WDO A;  5CCL A;  2HFV A;  4MKA A;  3KLH B;  1NK0 A;  3RAQ A;  3KHL A;  4M5L A;  1RAB B;  1NK4 A;  5KFO A;  1U1M A;  4W90 B;  3GLJ A;  4DI6 A;  3NWR A;  4X66 J;  1VDH A;  4HDH A;  4NXM F;  2CJB A;  1S1T A;  2H48 B;  4WF9 Q;  3G87 A;  1U09 A;  2RIJ A;  4TNO A;  2BJD A;  2XNQ A;  2XBP A;  1HBN A;  2MQQ A;  5D4P A;  2DXF A;  4X4T A;  3UNG C;  1CG2 A;  3M8Q B;  3IXQ A;  3NRB A;  4EFA C;  2WB4 A;  3GG1 A;  1ZM4 A;  5KG0 A;  3D0H E;  4GKJ J;  5ETV A;  3VQT A;  3CD5 A;  5KFM A;  3DLG B;  3PRV A;  1GTH A;  1UZD A;  2XY7 A;  4L74 A;  5ETQ A;  2K06 A;  3QGH A;  4ID5 A;  1T9V A;  5DGB A;  5DZ7 A;  2K8G A;  3CJS A;  3ISZ A;  2FJW A;  2DD8 S;  3HHL A;  3CC7 S;  4Z7C A;  1NK8 A;  1VIO A;  3ETO A;  4F4A A;  3IM8 A;  2EK6 A;  1UWA A;  2HRU A;  4YHH F;  2RNE A;  2BMB A;  4B3M F;  2HLT A;  2GO8 A;  3MED A;  4YR3 A;  4HHJ A;  2HSE B;  2AJ4 A;  4DF8 A;  1IR1 A;  4DL4 A;  3CCU S;  1ZH5 A;  3KLE A;  2X3G A;  1EQM A;  1FDD A;  2BXJ A;  3W2W A;  1IBM J;  4W98 A;  2VZ9 A;  1SC1 B;  4HKQ A;  3V6D A;  5ETP A;  3AB4 B;  4ES2 A;  2DCU B;  3KLF A;  2R2S A;  2CQH A;  2BJ8 A;  2EW9 A;  1NB7 A;  2B6A A;  4M5I A;  3AT1 B;  4NI2 B;  1N54 B;  5KFA A;  3SCI E;  2NYH A;  4OIX A;  3PFE A;  2R2U A;  2KI2 A;  1VC0 A;  1MU2 A;  4FYX B;  1ULR A;  2FDN A;  4NCG B;  2EK1 A;  3UN5 A;  1KLM A;  2H5I B;  3OFH A;  2KJV A;  4RW7 A;  2VQF J;  3DLE B;  3RU0 A;  4HT7 A;  5AE3 A;  4KV8 B;  5AE2 A;  4L75 A;  3UR3 C;  2VG5 B;  1LWE B;  3VZI A;  1T9U A;  3BGF A;  3BH7 B;  3UCZ P;  2UXD J;  3W61 A;  4IR9 A;  1RWU A;  5L9X A;  2W8L A;  4U7C A;  5CH7 B;  1FER A;  3AOB A;  1UVL A;  2RQC A;  3QT6 A;  2CAD A;  3H5U A;  1PJ5 A;  2AJ0 A;  3LAL A;  4TN2 A;  2VDI A;  3M2U A;  4K4U A;  2APO A;  3T5H A;  4DSF A;  1WOR A;  4CH1 A;  3T9Z A;  1CPZ A;  3LPY A;  3BS9 A;  3EZU A;  2H51 B;  3OBI A;  3UO0 A;  2X1B A;  2J76 E;  4QU7 A;  4ETZ A;  1HQU B;  1L5U A;  2XLI A;  3P6Y C;  2G1H A;  2CNO B;  1D9A A;  3QAU A;  2YWF A;  4OX6 A;  4ZLP A;  1S0O A;  2AW0 A;  3AY0 A;  4BLG A;  4ILL A;  2J8S A;  2BUN A;  1S9E A;  4F0K A;  1R43 A;  3H42 A;  3I96 A;  2X1G A;  3IRX B;  1PBU A;  1TL1 A;  4DV0 J;  2UP1 A;  2ZVI A;  4FS1 A;  2RRA A;  3MTK A;  4DV3 F;  2CPJ A;  4EYH B;  4FBT A;  4ZS6 A;  2XGP A;  4PYD A;  2QL7 B;  2UUT A;  3OSN A;  4TVA B;  4USK A;  3GIM A;  4JI1 F;  2XZW A;  4GVB A;  4DUY F;  3PX0 A;  2W25 A;  4KHR A;  4MYU A;  1SJR A;  3B78 A;  5L9N A;  3MEG A;  2DNR A;  3NCR A;  2G1D A;  4DFK A;  3HSZ A;  2VOD A;  1AFI A;  3T5J A;  3JSB A;  5GAE I;  4OL8 A;  4J9V A;  5DLF A;  4KR0 B;  2E44 A;  4CO1 A;  5K8N A;  2QA1 A;  2RRN A;  3V4M A;  1CUL B;  5HSP A;  5HRO A;  4Q45 A;  2XYP B;  1RAH B;  4LSN B;  2PFD A;  4ED4 A;  4PXB A;  4IH7 A;  5L46 A;  1YBT A;  4U8Y A;  1JB0 C;  1CQM A;  2V8V A;  1H72 C;  4Y28 C;  4QWD A;  3GU0 A;  1ZAV A;  3BF4 A;  5I3P A;  1U02 A;  1BD6 A;  1GXU A;  1KDN A;  3H2U B;  4IOA Q;  5H9E K;  4O4G B;  3BBB A;  4RZR A;  1I51 B;  3EZO A;  3VAK A;  2RHS B;  4NLW A;  3VGV A;  2KT3 A;  2HBR B;  1GMV A;  2OEK A;  3SQG A;  5M2P A;  1WJ9 A;  1WEZ A;  3BN4 A;  5J2N B;  1BY9 A;  3CJ0 A;  3BBF A;  5K20 B;  4F67 A;  4LF4 F;  4PG7 A;  3C66 A;  1CJK A;  4ZCM A;  1HWU A;  3D1O A;  1FKA F;  3KOA A;  1AZS A;  4HAC A;  5KG2 A;  4HHH A;  3PZP A;  1RTI A;  4RNN A;  1S1W A;  1UJ5 A;  2JNJ A;  1WC1 A;  3FSY A;  4KGK A;  2EKY A;  2DK2 A;  4F25 A;  5A2Q Y;  2RD5 C;  2GJI A;  2HQC A;  1B0P A;  3P45 B;  4HLB A;  4OI6 A;  3G71 S;  5DDP C;  4IOC Q;  3BPS P;  3D1H A;  5C25 A;  3M1V B;  4HDG A;  1PC4 A;  1N34 J;  1Z4U A;  4F2S A;  1HNI B;  3UPF A;  1NDL A;  4JOU A;  5KOW A;  4CO3 A;  1O6X A;  3U1M A;  3OL8 A;  4ZK7 M;  2CQP A;  2FZG B;  3N0V A;  3QJL A;  3UDV A;  1HPZ B;  1R27 B;  3DDI A;  2MKY A;  3B6B A;  2B0G A;  2VPX B;  2BYC A;  4DR7 F;  1EKR A;  2OPP A;  1Y4Z B;  4ETX A;  4P2X A;  4RU2 A;  1VJQ A;  2HBQ B;  4PXE A;  2CPE A;  4DL6 A;  1F6T A;  5CZX A;  4PG6 A;  4ZVO B;  1RWP B;  3D2W A;  3TAN A;  1T7P A;  1UVN A;  4OYP A;  1UW9 A;  1VMB A;  1X4G A;  3MDF A;  1W25 A;  3T1H F;  2AD9 A;  2Q1L A;  4N47 A;  1RHM B;  5LMU J;  1S76 D;  5F8G A;  2H4Y B;  1ZS6 A;  5J1N A;  1PO6 A;  1JMT A;  1CLF A;  2HS0 A;  2WVB A;  2QL5 B;  2Y1R I;  1GTE A;  5BYR A;  1VBK A;  1Y10 A;  2UXC F;  2SXL A;  3FCH A;  1XQI A;  2QO3 A;  1HYS A;  4BBY A;  3FKB A;  4V1A k;  1L3T A;  2R7S A;  4JI6 F;  4CT9 A;  4J90 A;  3QAE A;  3UI3 A;  3I5C A;  4YY3 J;  3DLK B;  3KG1 A;  2J5A A;  5JXS A;  1DY3 A;  4B9L A;  1MW7 A;  4OHX A;  3ZZT A;  4F7V A;  2KYZ A;  1TEL A;  4LF5 F;  3JYT A;  5J2P A;  1VQL S;  2I0X A;  2RSQ A;  1VQY A;  5GAD I;  3BKU A;  2HZC A;  2D41 A;  3M7V A;  2V9W A;  1AUD A;  3LWL A;  3OXL A;  1SI9 A;  3QWU A;  3C14 A;  3I6P A;  2BV3 A;  5HQM A;  4O3O A;  1WKL A;  1T9Y A;  2DNG A;  2DHS A;  1UET A;  2JEG A;  3THP A;  2MGZ A;  1M5K C;  2X51 A;  4FKX A;  1XJW B;  1U1R A;  3H8Y A;  3CCE S;  2OML A;  2VKR A;  2LMI A;  3KYL A;  1RT1 A;  4DLG A;  3C3L A;  3UQS A;  5KFG A;  2JLG A;  1V3Z A;  3GFH A;  2MXY A;  4ECW A;  2ABY A;  3M30 A;  2CNK B;  4H4K C;  5ETO A;  4DR1 F;  4RUA A;  5KFQ A;  3RB3 A;  4DL3 A;  4DZD A;  4K8R A;  3O8W A;  2DXE A;  2FLP A;  1HAR A;  3Q23 A;  1YLX A;  1CEZ A;  2MQN A;  1GQE A;  1RBA A;  3M2R A;  2R9L A;  4E98 A;  2W1B A;  4CWB A;  4WII A;  2DGU A;  5EX3 A;  3PO5 A;  1HBU A;  2M9K A;  4ZVT B;  7AT1 B;  2BE2 A;  2KHC A;  1ITP A;  3IRW P;  5H9E J;  4ED2 A;  3MPY A;  1F9F A;  1XBW A;  4A8Y A;  2IM1 A;  3QFW A;  2Q43 A;  1VQO S;  2ALY B;  1FDA A;  2K1R B;  3AB2 B;  2VG6 B;  4N77 A;  2X3D A;  3O5T B;  1C1C B;  4L3N A;  1B0V A;  3KLI A;  3MD3 A;  3FRZ A;  3MR5 A;  1HNV B;  2PD1 A;  4EO6 A;  1KVK A;  2I38 A;  3WC0 A;  4WTY A;  1OY9 A;  2OJ3 A;  4GRS A;  2ZZM A;  4DU8 A;  1WG5 A;  3NWG A;  4NMX A;  4HTJ A;  4OLO A;  3IMQ J;  1WEY A;  1VHI A;  1SV5 B;  1DLO B;  4OMF G;  3UVJ A;  3TI0 A;  2AKW B;  4Q0B B;  4ILR A;  3LAK A;  4PXD A;  1WC3 A;  1L3K A;  4DR5 J;  4JI7 F;  1XNQ J;  4LFA F;  9ATC B;  3R6G B;  2QC3 A;  2H1Y A;  1XER A;  1H73 A;  3QYY A;  3QT8 A;  1F9E B;  1QTM A;  2ZH6 A;  4O0I A;  3Q8S B;  2FY8 A;  2W9B A;  4ZJQ A;  3W62 A;  2BW7 A;  2HWI A;  2R8H A;  1HI8 A;  4G6V B;  1DTT B;  3RRH A;  4M5H A;  1D8Z A;  1RAI B;  1RAF B;  2R8K A;  3IR5 B;  3Q8Q B;  4TQS A;  3AOC A;  4NYZ A;  1JLA B;  2CFX A;  4K5S A;  5AXL A;  5A8R A;  3Q22 A;  1ZM9 A;  3PJX A;  1RT6 B;  1KQS R;  3DYA A;  2KL8 A;  1EZZ B;  3T1Y J;  2YVS A;  4BWJ A;  4HT5 A;  1L3U A;  3CJ8 A;  4UOF A;  1T95 A;  3E01 A;  4EBE A;  4DQQ A;  1R0B G;  2YNH B;  3AOD A;  1VBZ A;  2B43 A;  3NEK A;  3C2P A;  3I0S A;  1R0C B;  1VYA A;  1CS4 A;  5HN0 A;  3C16 A;  3J81 Y;  1C4C A;  4I69 A;  3JTO A;  2IA0 A;  3NLC A;  1S79 A;  4MFB B;  1R8H A;  2FPH X;  4FXW A;  5GAG U;  1P1L A;  1HWJ A;  4U7U K;  4ANC A;  3P49 B;  3B4D A;  4DQR A;  3R1L A;  1N36 J;  2NSC A;  3NCQ A;  5D77 A;  2HQG A;  3KJQ B;  2P5V A;  1OS5 A;  1K8A T;  1OY8 A;  3HX9 A;  2RDI A;  4WPA A;  1NH8 A;  5AXK A;  1BQN B;  1WI8 A;  4RKU C;  4X4O A;  1VQ7 S;  4MAK A;  4LF7 F;  3QJP A;  3MTJ A;  1EAY C;  1SQG A;  4C8O A;  3V81 B;  2H65 B;  3EJM A;  2RUS A;  2OO4 A;  2DNK A;  4C0O C;  2OI2 A;  1TR0 A;  5H1S V;  3F0N A;  4JI8 J;  2ZBR A;  3K59 A;  1VC5 A;  5HK4 A;  3MPW A;  4H4M A;  1B7Y B;  4OHW A;  3PKM A;  1IKV B;  4I2Q A;  1U1O A;  3VAG A;  4H4K A;  2WZ1 A;  1AUS L;  3TZX A;  2E9Z A;  1TQL A;  2QRR A;  3T9N A;  1YJW S;  2W9A A;  2HWH A;  1FTR A;  2LKZ A;  3V5R A;  2YKP A;  3PIP Q;  3EE3 A;  4YQW A;  1LOU A;  4ZVE A;  4KAI A;  4F8R A;  4QCL A;  4Q5V A;  4ELV A;  2HPU A;  1S6Q B;  4TY8 A;  1VIS A;  5DDQ C;  2IFX A;  1VRU A;  3C15 B;  2DNM A;  3NNH A;  1M1K T;  4UOH A;  3M6X A;  4ZPT R;  2HQ3 A;  1IR2 A;  4P7V A;  4OX9 F;  4FNH A;  2XG8 A;  4MYT A;  2FVS A;  1K0V A;  1MWY A;  3HT3 A;  3ZTR A;  5K8M A;  1NBE B;  4NLG A;  2CQB A;  1BE4 A;  2ZOF A;  2Y1J A;  4NLQ A;  3QLH B;  2MY8 A;  3MCS A;  4XTT A;  5C24 A;  4DG1 A;  2PA3 A;  1BGX T;  1O51 A;  2CQ2 A;  1YJR A;  3EX7 B;  4PQU B;  3QPI A;  4YFU A;  1T02 A;  2LEP A;  1KVI A;  5HP1 B;  2R3V A;  3MM9 A;  2D7S A;  4J91 A;  3LOU A;  2HS4 A;  1IWA A;  4CLT A;  1FD2 A;  1TL3 B;  3NGK A;  7FD1 A;  4LF6 J;  2AYM A;  3MR7 A;  3R2C J;  2VDH A;  4R25 A;  4NEY A;  2PN6 A;  4OX7 A;  2E9T A;  2RRB A;  2E1A A;  3L7O A;  2E1P A;  1SKS A;  5D6G A;  4FVC A;  3IG1 B;  3HKZ D;  1RT3 A;  1IJE B;  3ZZR A;  1YG0 A;  4DS5 A;  4ECU A;  3PVX A;  2I8E A;  2HZA A;  3PHT A;  3HM9 A;  2HVI A;  4DMZ A;  4KGZ B;  1Q8K A;  4CYU B;  1VBX A;  2JC1 A;  4KFB B;  2YTC A;  2BBE A;  4LRF A;  4WFN Q;  2HQD A;  1LQ9 A;  1QAJ A;  1NLK L;  3BB5 A;  2WB1 D;  2M52 A;  2UUC F;  1T9T A;  2Z2Y B;  5KFK A;  2JH3 A;  1W2I A;  3CD0 A;  4CLP A;  4IOB A;  2MJN A;  3OTE A;  5F0W A;  1QD1 A;  4KH1 B;  1TMJ A;  4KO0 B;  4JI0 F;  1TZ0 A;  5D8H B;  2UU9 J;  2AYG A;  2W24 A;  2ZUG A;  2Z2Z A;  4OI1 A;  2LA6 A;  2MKK A;  3T1A A;  5HMX A;  3CJK B;  4ES3 A;  1NHU A;  1AXQ A;  4K0K F;  3IA0 A;  1RU2 A;  2XNR A;  2WSF C;  3PEH A;  2KN4 A;  4I56 A;  5F9L A;  5IWA F;  4PKD B;  2R7O A;  1SCJ B;  4WFB Q;  2LVW A;  2W01 A;  2Z57 B;  1ZA1 B;  3CDE A;  1KOH A;  2VD3 A;  3CDB A;  1DAX A;  1DUR A;  2XEX A;  4QR1 A;  4OI0 A;  1NK5 A;  1W2B R;  2KXF A;  2AGQ A;  3M8Z A;  1QY7 A;  2V8D A;  3EVO A;  2OSQ A;  3NCP A;  1RT2 B;  1XR5 A;  1QDU B;  1VK3 A;  3BSN A;  1IUJ A;  4LJM A;  4A8Q A;  3MEE B;  4ZIW A;  2R2T A;  1R89 A;  1C1B A;  3GG0 A;  4NLR A;  3KG0 A;  4CLS A;  5DQI A;  5HMZ A;  2DIS A;  3IFE A;  2J9C A;  2AYB A;  2GJ2 A;  1NXI A;  2MKH A;  1FE0 A;  4HEA 9;  1XEZ A;  3ENA A;  4DSK A;  2QLW A;  4F3O A;  1J5O A;  1U24 A;  4ERD A;  4TU7 A;  1WD6 A;  2LQ5 A;  2MZJ A;  4Y3C A;  2D3O 1;  3QZ8 A;  1N56 A;  2VOP A;  4AUK A;  4FVM A;  5HVG A;  3FFI B;  2V5H G;  1R6V A;  2ZH5 A;  5KAK A;  3G86 A;  2AHO B;  5AE1 A;  1WC0 A;  3I9V 9;  2GML A;  3WX4 A;  5IXU A;  2P9C A;  2KG1 A;  2ATL A;  3KJV A;  1XMQ F;  4IQX A;  2OSR A;  1S49 A;  3R5C A;  4L6V 3;  1PCA A;  5CYQ B;  1SIW B;  2AEF A;  3KK3 B;  2W2N P;  1RTD A;  1EHW A;  2DR7 A;  1KFD A;  1M0S A;  3TX0 A;  3VQS A;  1TMM A;  2ADB A;  1XR7 A;  3HHD A;  1FXL A;  3RBX A;  3GB0 A;  4PAB A;  5HQL A;  4QYR A;  1XC9 A;  3M6W A;  1PIL A;  4CNZ A;  3DOM A;  3HZG A;  1RTJ B;  3H0P A;  4B3S J;  3G8Q A;  3FC9 A;  4K4X A;  4DU7 A;  2LFV A;  1TU0 B;  4MKY A;  3MM8 B;  4J9U E;  1N32 F;  4X84 A;  2IVF B;  2HFZ A;  1FKO B;  4CLZ A;  4JI5 J;  2FHK A;  2YKN A;  3VWS A;  3LA0 A;  1HNZ J;  4A8S A;  3G8S A;  3N4W A;  2DBB A;  2IAJ B;  2XSJ B;  1QM9 A;  1TVR B;  3NY0 A;  3QZ7 A;  3M8R A;  5D3G A;  4AXI A;  2AZ1 A;  2YNG A;  4ICL B;  4U9R A;  1S59 A;  3DM2 A;  2N7C A;  2VPW B;  1J27 A;  1FXR A;  2VL1 A;  1IBK F;  4X62 F;  1LW2 A;  3RBZ A;  1BC6 A;  2LA4 A;  2B4U A;  3MM6 B;  5LMN F;  3F56 A;  3HVA A;  3OHA A;  3GR0 A;  2O66 A;  1Q5V A;  4NA2 A;  1FFW B;  1U1N A;  4IUF A;  1CJV A;  1A0O B;  1GX6 A;  1NSK L;  3TUI C;  4WCE Q;  1HW9 A;  4MMO A;  1REV B;  4ITS A;  2OLW A;  1WI6 A;  4JI4 F;  3IS9 B;  2Y1I A;  2HNY B;  4XIU A;  2LEB A;  5ETN A;  3I32 A;  2HW3 A;  2Q66 A;  4XPC A;  1NO8 A;  2XHC A;  3CCW A;  4X65 F;  4I6W A;  2YBV A;  3BDP A;  4NRU A;  2HWT A;  5F8I A;  4U6P A;  2F4V F;  3DGP B;  1NUE A;  3US5 A;  2LEC A;  3AD9 C;  1LV5 A;  1RHU B;  3JAM U;  2W2M P;  2BAN B;  4WJB A;  2YNI B;  2IDE A;  1R8C A;  1QSL A;  4LF9 J;  3QSY B;  3QIP B;  4CM0 A;  4ECS A;  1LWF B;  3W64 A;  1UCN A;  3C8Y A;  5BYS A;  1AT1 B;  4FKY A;  4DBQ A;  4DQP A;  1U8S A;  4X4S A;  4B02 A;  4R8U B;  2P6T A;  2CG4 A;  4LF2 A;  4HYK A;  1TAU A;  4K4S A;  5A0Y B;  1YJU A;  3QRP A;  3ET6 B;  2VFT A;  3MEC B;  2KO1 A;  1B0T A;  1VBY A;  5KFF A;  1HHQ A;  3QO9 B;  5L39 A;  3HVR A;  1WKJ A;  1PYT A;  4URS A;  3MR2 A;  3ITH B;  2XGQ A;  3DRP B;  4F4W A;  4J9O A;  4ZMM A;  4FYW B;  4B3R F;  5DM6 Q;  1Q7Y T;  2WVD A;  1H7X A;  8ATC B;  2VQE J;  4JYA J;  2QN6 B;  4BC9 A;  3ZFV A;  4A4J A;  3D28 A;  1GT8 A;  2GMH A;  3KNG A;  4NCB A;  3OVA A;  4F0H A;  2B8Q A;  1RHR B;  2FC8 A;  3R6L B;  4RBU A;  3BDE A;  1RA7 A;  4NLS A;  5K14 A;  4FPI A;  2IC3 A;  3CO0 P;  5T7L B;  1ZET A;  1BUX A;  3Q8P B;  3TUJ C;  3PXG a;  1VQK S;  1GX5 A;  1Q53 A;  2MZR A;  2DNP A;  1U48 A;  1P27 B;  2E5L F;  1R6Y A;  5KFD A;  3I0R A;  3KHG A;  2BOA A;  1RAG B;  5LSR A;  5E2Q A;  3V6H A;  2C2K B;  1NK9 A;  1HLW A;  2JOQ A;  4ZVS B;  4PWD B;  2AP6 A;  1K0T A;  3MMC B;  2NCK L;  3VAF A;  3BBC A;  4NLP A;  4DUZ J;  3OLB A;  3D6T B;  2RQK A;  4C8M A;  1QE1 A;  2I5J B;  3BO4 A;  5J2Q B;  4KT0 C;  1MSW D;  4OHZ A;  4LSZ B;  1BQM A;  2WBR A;  4NZ7 A;  3GZ7 A;  3I87 A;  2NUH A;  4ID8 A;  4FYY B;  1K9M T;  3A3N B;  4I7F A;  3THV A;  2KU7 A;  2CG8 A;  5E3A A;  5KFL A;  2JRS A;  3BGO P;  5KFI A;  2FJE B;  3HLU A;  4DV7 F;  1T9X A;  1KBR A;  1D0E A;  1TL7 B;  2CJX B;  4UQG A;  3CDW A;  1RHQ B;  2ZBC A;  2OMO A;  3QJJ A;  2N3L A;  3LUY A;  1HQE A;  3TW0 A;  2R7Q A;  3N28 A;  4IDK B;  2RS2 A;  4IG3 B;  1RBO B;  4F4Y A;  2E66 A;  5HBM A;  1OYD A;  3K5L A;  3CJ5 A;  3I4H X;  1J5E F;  3JQM A;  2NYI A;  5KFN A;  3DMJ B;  5G0R B;  2RDJ A;  2HG4 A;  4FXD A;  5JJB A;  3W2V B;  4DR6 F;  1MRO B;  3PDN A;  2HHV A;  3W65 A;  2MYF A;  2M8D B;  1NKC A;  3J7A N;  3ICL A;  1M5P C;  1M5O C;  1KC8 T;  3O1L A;  2OPS A;  1YJ9 S;  1J2V A;  1N5S A;  2VHG A;  3DOL A;  2GGP A;  4OI2 A;  4DN0 A;  4V19 J;  3FQK A;  3GR1 A;  3IGV A;  1I6J A;  2C1E B;  2DNL A;  2XMM A;  1LXJ A;  5DRK A;  3BPD A;  4DOZ A;  2FLL A;  1S9G B;  2XWY A;  3E8O A;  2ZWO A;  3BYP A;  3MR6 A;  3ULH A;  1F0X A;  4F4K A;  5HO4 A;  3RZA A;  3PNI A;  3HKW A;  2HYI B;  1T03 B;  2OPQ A;  3VAL A;  2CQC A;  1MN7 A;  2NQP A;  3HJF A;  1YZ6 A;  2V4R A;  4ZVU B;  4YHH J;  5KFW A;  3UW1 A;  1ACM B;  2G9O A;  5THW A;  4B3M J;  4DV5 F;  1CJT A;  4C11 A;  1EB0 A;  4WK1 A;  4W92 B;  3K8V A;  3HVW A;  2Z56 B;  1U0S A;  5I42 A;  1S1T B;  4HI1 A;  4QYZ J;  3JSY A;  5DDO C;  4BS2 A;  3ENV A;  5K9F A;  1HBN B;  1VQ9 S;  5HVF A;  3UDL A;  4K7Q A;  2V69 A;  3SIP B;  2JJ4 D;  1H98 A;  1NKB A;  1S5Z A;  2XMK A;  2F8E X;  3AQO A;  2V34 A;  4CO0 A;  2DR8 A;  1WG4 A;  3O6Q A;  2DGQ A;  2CJY B;  4U96 A;  5GMD A;  3DLJ A;  2F65 A;  2ZC4 A;  4YB6 A;  1KQF B;  3UFC X;  2HVD A;  1O0P A;  1V5I B;  5KFP A;  5EWG A;  4YUD A;  4B3O A;  2PMZ D;  1FTC A;  3M05 A;  3IGN A;  4DFP A;  5I3Q A;  2EFG A;  1HKA A;  1C4A A;  1V9O A;  3DXS X;  1I94 F;  1KOO A;  4ID5 B;  3A3P B;  2DYA A;  3FGV A;  4X4P A;  5LJ5 Y;  5G4D A;  1B4S A;  2H54 B;  1T94 A;  1I3O B;  1XMO F;  3HHL B;  3OTC A;  1WSR A;  3UDE A;  1SKU B;  2R42 A;  3DN9 A;  3D0I E;  2EFV A;  1BLU A;  2KZM A;  2PFF B;  3QT5 A;  4OHV A;  5LJ3 Y;  1FCA A;  3MED B;  3M6U A;  4ZVR B;  4AT1 B;  3MCN A;  3SCL E;  2LDY A;  3CCJ S;  3KLE B;  4NYP A;  2DGV A;  4HL9 A;  1S6P A;  1PJ7 A;  5IC4 B;  1SUQ A;  3W2W B;  4P2S A;  2VF3 A;  5DET A;  2F5G A;  1WDD A;  3V6D B;  3V6K A;  2QYG A;  3R1H A;  1TFW A;  4EYI B;  3N6L A;  4G65 A;  3MWB A;  2LDI A;  3GFZ A;  2D9P A;  1VGY A;  3KLF B;  4Y2I A;  2H5E A;  5E41 A;  5FD1 A;  4TU8 A;  4URG A;  2CQG A;  2CVI A;  5C42 A;  2K7J A;  2K2P A;  2B6A B;  3NGS A;  1AYE A;  2CQ0 A;  4IFY A;  4DPO A;  1B3T A;  2Y8Y A;  1FVQ A;  1SC4 B;  1NSP A;  3BGU A;  2GZO A;  4RUC A;  2FGO A;  4O3R A;  4JI3 F;  1RP5 A;  1NZA A;  5D0G A;  2VBZ A;  1U2R A;  2B4P A;  3AAW B;  4UY8 T;  1IKX A;  3KHR A;  4W4M A;  4LRE A;  4YR0 A;  2Q6B A;  1MU2 B;  2Y1L B;  4RO0 A;  4O0N A;  1KLM B;  4O23 A;  4OLP A;  2XMT A;  4H54 A;  4RW7 B;  1A7G E;  3PW7 A;  2GFF A;  4DV3 J;  1UPP A;  2V8H A;  4A8X A;  2IM0 A;  2HHX A;  4HTI A;  1TUW A;  2OUG A;  2JSX A;  4Q43 A;  3BR9 A;  4JI1 J;  4DUY J;  2Z30 B;  2GVZ A;  2NXU A;  5EHH A;  2DIV A;  3GSD A;  3HD1 A;  2J6U A;  3HT0 A;  4RJV A;  2CDQ A;  1NDK A;  3CDU A;  4C0H A;  3M2U B;  4F02 A;  3NS5 A;  1RYS A;  5CD4 A;  3UR0 A;  1VC6 A;  4WU2 A;  4AYB D;  1LFP A;  1PBA A;  2JZ5 A;  3HMJ G;  2G13 A;  3LAN A;  3BGR A;  3LP1 A;  2AMC B;  3CCZ A;  3WZ0 A;  1WUU A;  4XAK A;  5DO2 A;  1RGV A;  2DXD A;  2XY5 A;  2AWZ A;  4QPT A;  2CJ9 A;  2GAH C;  1S9E B;  2MKS A;  1RWO B;  2F3J A;  1TKX A;  3D6M B;  1G2E A;  1TL1 B;  3N6M A;  2OPR A;  2A18 A;  2LU1 A;  2J8A A;  4LR7 A;  1BXN A;  2YQ3 A;  4P6Q A;  5IV3 A;  2DNQ A;  4PG5 A;  4FYD A;  3FBB A;  4C3L A;  1RHJ B;  2ZD1 A;  4OJ1 A;  5H9F K;  2BRK A;  4C8Y A;  3A8I A;  1X9S A;  5E0O A;  1QSY A;  2OEL A;  1FJE B;  1VCT A;  4GVB B;  3R5J B;  1N0U A;  4LF4 J;  4ECY A;  1VQ4 S;  5F3T A;  2JVO A;  1WF1 A;  1XMB A;  2N4D A;  4ENO A;  3QFH A;  3MEG B;  2AEM A;  1SXL A;  3GWC A;  2DB1 A;  2ZVS A;  1G1X A;  2IPO B;  1XNR F;  3CME S;  2KVQ E;  1WF2 A;  3OW2 R;  4YME A;  4OYZ A;  2FLO A;  5HRO B;  2C2Z B;  4FZV A;  2V8P A;  4N56 A;  3CO9 A;  1BWV A;  2NXC A;  4NLU A;  5B08 A;  2DVI A;  4DSE A;  2RH3 A;  5DGA A;  1NU4 A;  1FX4 A;  4G1Q A;  1PG5 B;  2Z0G A;  3KXD A;  2MJU A;  4CT8 A;  4I0W A;  3N6N A;  2PEH A;  1H38 A;  1S1V A;  2E7W A;  4E0D A;  2DNO A;  2HVE A;  1HMV A;  2GIR A;  2D1C A;  1K73 T;  3EIC A;  1Y7P A;  4DR7 J;  3QGG A;  3F73 A;  1XR6 A;  1S0V A;  1S4E A;  2FUG 9;  2RKI A;  1UPM B;  1L3S A;  4N5S A;  1NJZ A;  3AQP A;  2O3D A;  3TOQ A;  3SQG B;  1FK9 A;  1RDR A;  2VIC A;  3MMJ A;  2DNN A;  3K17 A;  3TVK A;  3ILI A;  4EBC A;  4ECX A;  2E1M C;  3BZQ A;  1HW8 A;  1TKZ A;  3CTR A;  1CJK B;  4C4W A;  2YY3 A;  3POT A;  2ROE A;  4DV6 F;  3CVK A;  3LF0 A;  2UVV A;  1YDL A;  1AZS B;  4HAC B;  3KLG A;  3ZZU A;  3T1H J;  3VCD A;  1ELO A;  1RTI B;  3WIV A;  4O44 A;  5IFM A;  3P96 A;  2MEW A;  1S1W B;  3EVM A;  3TVZ A;  4ECT A;  4NXN J;  2W7P A;  5E7O B;  2DKO B;  2PGC A;  1S0M A;  2VOO A;  5BR8 F;  2R8G A;  5C25 B;  2UXC J;  1U1P A;  3K0J A;  1X5P A;  1XK8 A;  3EDQ B;  3QID A;  2R7W A;  3J7Z T;  3BEG B;  2V50 A;  2NPI A;  2FQQ B;  4K4W A;  1O5J A;  2UUB F;  4JI6 J;  1U6F A;  2OTL S;  1UZH A;  1NKE A;  1EET A;  2JDJ A;  3OTB A;  4MT1 A;  2WVF A;  4LF1 A;  1SKW A;  4PYA A;  2V2Q A;  4LQ3 A;  2CKW A;  1IWG A;  2XMJ A;  4LF5 J;  2OPP B;  3OL9 A;  2WAQ D;  2AJQ A;  1X4A A;  2OD4 A;  4LBH A;  1NJX A;  2QA4 G;  3B82 A;  3DCA A;  1JLQ A;  4FDF A;  2FGC A;  4NLX A;  4ELU A;  1RJJ A;  3ENQ A;  2QMW A;  4DV4 F;  5ITH A;  4KC5 A;  4PCQ A;  2KHD A;  1N34 F;  2CZV C;  2NR0 A;  4RX6 A;  2W4D A;  4NE9 C;  2JHE A;  2HBZ B;  1FDN A;  3SV4 A;  1F1B B;  4OYO A;  1KRP A;  1UFK A;  8RUC A;  4LF8 F;  4IG0 A;  2ZHA A;  2ZHO A;  2F7V A;  3NMA A;  2HEK A;  3HHL C;  4DR1 J;  1HA1 A;  1SL1 A;  3HFK A;  2JWN A;  4RNM A;  3B8H A;  1SH0 A;  1HYS B;  3RR7 A;  1JXL A;  3IBC B;  1Y5I B;  3CIM A;  4CP5 A;  1C0T A;  2CPY A;  3JSM A;  2KTQ A;  2EI5 A;  2VA2 A;  4QIW D;  2N7Y A;  1TV6 A;  1DQ9 A;  3U1N A;  3JYT B;  2N82 B;  1UA1 A;  5J2P B;  2KXN B;  4PR6 A;  4KY3 A;  4RUB A;  4RW8 A;  1NHV A;  2YWE A;  3T5L A;  3T3F A;  2DNZ A;  4ER8 A;  2VFR A;  3JSR A;  2DHA A;  4LFC F;  2J7K A;  2C2N A;  3C14 B;  2NXN A;  2WON A;  1KFS A;  4QWB A;  1HWK A;  3DRR A;  1YKW A;  2MGZ B;  4B17 A; 
#chains in the Genus database with same CATH homology
 2W2O P;  2Z58 B;  4NE9 C;  2PMW A;  2W2Q P;  2W2N P;  3BGO P;  2ZWO A;  3P5B P;  3CNQ P;  2Z30 B;  1SPB P;  2Z2Y B;  2ZWP A;  4K8R A;  3VV2 B;  3AFG A;  3CO0 P;  2QTW A;  3A3O B;  2XTJ P;  3GCX P;  3BPS P;  3A3P B;  4NMX A;  3WIV A;  4JP8 A;  2Z2Z A;  1ITP A;  2W2M P;  3T41 A;  2E1P A;  1SCJ B;  2W2P P;  1R6V A;  3QFH A;  3VHQ A;  2Z56 B;  3WHI A;  3GCW P;  3A3N B;  4YN3 B;  3H42 A;  4OV6 A;  3SQO P;  2Z57 B;  1V5I B;  3WIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...