2DJWA

Crystal structure of ttha0845 from thermus thermophilus hb8
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
MITAFVLIRPRGNRVQALGEAIAELPQVAEVYSVTGPYDLVALVRLKDVEELDDVVTQGILSLEGVERTETLLAFRAYPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords probable transcriptional regulator, AsnC family
publication title Structure of the stand-alone RAM-domain protein from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 13
structure length 80
sequence length 80
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2djwA01
2EFPA 2EFNA 2CG4A 1RI7A 2P5VA 2PN6A 2QZ8A 2W24A 2EFOA 2ZNZA 2IVMA 3I4PA 1I1GA 2E7XA 2PMHA 2Z4PA 2P6TA 2E1AA 2EFQA 4PCQA 2E1CA 2DJWA 2JSXA 2VBYA 2VBZA 2VBWA 2W25A 2CYYA 2YX7A 2CVIA 2ZNYA 2YX4A 2E7WA 2VC0A 2ZBCA 2P6SA 2DBBA 2GQQA 2VC1A 2IA0A 2CFXA 2VBXA
chains in the Genus database with same CATH superfamily
3L7UA 3S01A 4ZVGA 1MROA 2LXIA 1SKRA 4Y2MA 3ZTSA 3L09A 2CNOB 1X9WA 4QWDA 2ZWPA 5HO4A 2WW8A 1QSYA 2ZZNA 4BS2A 1F9EB 2HMIA 3R2DJ 2WVFA 1T9WA 1NKCA 4TU7A 4EK2A 3T1YJ 1RK8A 1YX2A 3ILJA 3QFHA 1NHUA 3ILOA 2J6SA 1KD1T 1HNXF 4OI6A 5D4PA 3P6YC 3EPIA 1YGYA 4QCLA 2DCUB 2EWHA 3SSQA 1XMBA 3DRRB 3H59A 2J9EA 3OLAA 3NGSA 4HHJA 3OXFA 3MWBA 2XBPA 3OSPA 1TL1A 3FGVA 1RLCL 2CADA 2VU5A 2MKSA 1FEHA 1CJTB 2GAHC 2C2EA 3QAEA 3ZZTA 4RZRA 3QO9B 2W4CA 4L6V3 4DPXA 1V9OA 1P9QC 2JSXA 1EHWA 1JJ4A 1AYEA 1R27B 1B7FA 4P2SA 1HNWJ 3RTVA 4IQXA 2XWXA 2E5JA 5D3GA 1ZS6A 4WTOB 4YY3J 7FD1A 2LQ9A 3WC0A 3UVJA 3IBWA 3VCDA 4DFPA 2Q79A 2VODA 3AOAA 3QRPA 4PXBA 1B0VA 1Y00A 5KFMA 3MM9B 2XYPB 2OPPB 4JP8A 5DO2A 3HVTA 2B4UA 5IM0A 4Y65A 3VZHA 4CH1A 2CJKA 4DQQA 4JI3J 4G6VB 4LF7F 2CJBA 3IO1A 2UXDJ 3QGHA 1Q16B 3AAWB 5F8GA 3RBEA 3MECA 4J9SA 3FZBA 3O8WA 1VLOA 1XTZA 4B9SA 2BM1A 3H4DA 4GKKF 3SIPB 2HNZA 2Z4PA 4KSEB 2BW7A 3NG8A 5DG8A 1RSCA 2DXDA 2A1BA 1DBDA 3K8VA 2MPUA 3EZUA 5ETSA 3ITHB 3A8KA 2GMHA 3IFEA 3G2XA 3O44A 2GJ2A 4DR6J 4ZN1A 2YNGB 1JX4A 1MWZA 2AYGA 3Q23A 3GP9A 3EGVA 3H7HB 4CT9A 3CCUS 2B9YA 4DX6A 3BO3A 2GHWA 4LQ3A 2ZDPA 1RBOB 2X7IA 4WWSA 2KHDA 3E51A 4WP9A 2IPOB 1VQ6S 3GV7B 5J1EB 4WFXA 3H0PA 3O1LA 5B0CA 1BE4A 4ANEA 1TMMA 4ATNA 5C25A 3ILIA 4B3MJ 3V4IA 3DGVA 5DM6Q 2XB2D 4IFVB 4TLQA 4M5LA 1DTTA 3Q2SC 1LEOA 3A12A 4K4UA 4DR2J 2DT9A 1V5IB 4FYYB 4OMFG 2CQPA 1QSSA 1JKHA 4ES3A 4ZHRA 3FFIB 3EM1A 1N33F 4K4ZA 5EX0A 2OHDA 1IBLF 2QV6A 3CDWA 4OZ3A 1WSVA 1JLGA 4DBQA 2A2DA 3NWGA 2UVUA 1Q95G 2W7OA 1NPPA 4OZ2A 1VQ5S 5CH7B 2LU1A 1IR0A 1WEZA 3T1HF 2XO7A 3I4HX 2UUAF 2B4VA 3H5SA 3BO4A 1FKAF 1S76D 1S1TB 2E7XA 1U8WA 3DDNA 5AXNA 4Z7CA 1PCAA 3BQ1A 1FD2A 5IWAF 1OQ6A 3CXCR 1FKPB 4K0KJ 2VC1A 5C2GA 4DX8H 4KGVB 3S7RA 2GZOA 2BV3A 4NCAA 5D4LA 2VQEF 1C0TA 1TV6B 4H4OA 4OZNA 2R8HA 2UVWA 4AE5A 2R8IA 2OPQB 1HBMA 3DC2A 3DRSA 1DLOA 3TEHB 3KXDA 1T03B 1G2EA 4LF1A 3BDEA 5E3RA 3CSKA 2XGQA 3HHKA 1FRJA 2WK4A 4Q8FA 3LUYA 1RB0A 1KC8T 4UY8T 2Y1LB 3H42A 4QR2A 3ZTQA 3DLKB 3O6QA 5KFCA 2DNPA 5KFTA 4KY3A 4IDKB 1HWLA 2DNQA 1FNMA 1L3UA 1P1TA 1CJUB 3DLBA 2BKPA 2QLXA 1VRTA 3RAXA 1I5OB 4DV4F 2D1CA 2P9EA 2VFSA 3AD8C 3M2VB 4R8UB 3S6EA 2QFIA 2BMBA 3X1LB 4C3MA 2BM0A 4ENOA 4NWBA 4USIA 4KRWA 2Y1JA 1VQYA 3OVAA 2R2TA 2L48A 3KUEA 1VJQA 4OI2A 3Q2TC 1R89A 3VZIA 3ENAA 4JI6F 3SCIE 2CQ1A 3IGNA 1ZM4A 2OH2A 1X4FA 3CD0A 1J5OB 2U2FA 5FD1A 2QA2A 4H54A 2J6TA 1RJJA 4LF8F 3R1LA 2CWXA 4K4SA 3JAMU 1E6YB 2UUBJ 1WHXA 1VISA 2I5JB 2I2YA 4OHWA 3POTB 1PIEA 3BGOP 4C0BA 5JVGQ 1N5YA 2RT3A 2GCFA 1VYAA 4OI1A 1DTQA 4PG8A 1WOPA 2VKZG 2C2RA 2X51A 2YKNA 2DISA 4AQYF 3SCKE 3TZZA 1ELOA 4CIOA 2K1RA 2MXYA 2AIRB 4OV1A 4ED2A 2ZH2A 1IKXA 3PHTA 3UR0A 3PM9A 3BEGB 3DI6A 4KIAA 1F0XA 4ALZA 1U48A 3Q8YA 4TY8A 4USUA 2ROGA 3PTWA 2GIFA 4CYUA 2EBGA 2QL7B 5J2NB 4IG3A 4ZVFA 3SDEB 4WK3A 1FRXA 3NMRA 2W2OP 2DIVA 3MR7A 1SH3A 2E29A 4GC7A 1S6OA 2DB1A 4B17A 4OYOA 4DV3F 3LF0A 1WTFA 3BREA 3M30A 2DRDA 1N5VA 1BXNA 2ZD1B 3N0VA 1RT6A 1W25A 2HKEA 2R7UA 3DLEB 4LF6J 4B3SF 3NXZA 2D9OA 3CJ4A 4DCOB 2W01A 2AYMA 4TU8A 1BY9A 1IWGA 4K2XA 5IC4B 4IFYB 4MYTA 4N8OA 4KBIA 4MKBA 4OZJA 2CPFA 4LVOP 3NBPB 3QFWA 4UZBA 1RTDB 2CJAA 3I55S 3VVUA 4ZKAA 3VGVA 3EZOA 2JEFA 2RUGA 3ZZOA 4HI1A 3VWSA 4YS2A 3C15B 3NOCA 2ZC4A 4FZVA 1IN0A 2H3EB 2VDHA 4CO5A 1U2FA 1D09B 4B9MA 1G6BA 1C1CA 2R7XA 3Q8VA 5F0WA 3LAMA 4URSA 1JWWA 2B9EA 2AGPA 3A3PB 3BQ0A 2V8GA 2JX2A 4MMOA 3UE2A 3HD2A 5ETRA 5KG3A 3VAKA 1S99A 2HHWA 1NJIT 2XC9A 3C66A 5LMUF 3LALA 3B82A 1S6QB 4NMXA 3J81U 2DRAA 2WONA 3BSCA 3GTYX 1HWIA 2IVFB 2XG8A 1NPRA 3QAUA 3K5OA 1FEEA 4RW6B 3BO2A 6FD1A 2WOMB 3MMBB 2XMKA 2ADBA 3IGVA 2ZM6J 2J7KA 4Q2LA 3I5CA 1HMVA 5LMNJ 4DN0A 3PCOB 4J37A 5KFXA 2DNNA 4B3OB 1HR0F 3LOUA 4F0MA 3M6WA 1KQFB 1U09A 4OYZA 2M88A 2EI5A 2C2MB 3RRHA 3M32B 4NRTA 2CPIA 2E7WA 1FCAA 2CQBA 4ZS6A 4WBFA 5DZ6A 1UEKA 2BE2A 2Y9HA 2KZZA 4JI7F 3CD5A 2EPIA 5D15A 5I42A 1HBOB 4E8UA 4TLRA 4RW4A 3ISND 1S9EB 1QVFR 3C6UA 3TZXA 3T5HA 3MM8B 3R97A 2RAQA 3N5FA 2AJ2A 4JI8F 2ZOGA 3NGUA 2OKQA 1DY3A 3ZXWA 5I3UA 2W9CA 1S7HA 2EEYA 2E5LJ 4DL7A 4F2RA 1CEZA 3FCWA 4ZIVA 2HWTA 1KWMA 2GGPA 5AT1B 3OJSA 2XWYA 3VVTA 1HHQA 2RDDA 3L3CA 1N8RT 3ELHA 1OY8A 4FF3A 1WSRA 2HK3A 4TNOA 2FHJD 5JMNA 3MMCA 4O0NA 1VQNS 1UWBB 4L75A 4O3PA 3H5YA 7AT1B 5HP1A 2B51A 4NLDA 2NUHA 2GC8A 4YR3A 1VRUA 2BRLA 3TA1A 4JV2A 4NYPA 4KPYA 1S49A 4RU9A 2HLTA 4E98A 3ENWA 4OX6A 4S0MA 1PC4A 3UW1A 4DR5F 1P8GA 3MPWA 4LUBA 2ATCB 3E8OA 1DRZA 2IY5B 4KGXB 1GNKA 3C14A 5THWA 2WZ1A 2IJRA 5HSPA 3ET6B 4N77A 3FBCA 3E3XA 2VH7A 3V5RA 4LRFA 3I0RA 3M8PA 2A6OA 3T6JA 2HNDA 4RU2A 3BGRA 3A3NB 4RW7B 4C7QA 2ROEA 4NI2A 1JLCA 4FKXA 1Q81T 4NA3A 3RB4A 2MQNA 4C3LA 4HT5A 1HW9A 2WTFA 1O8BA 1MG7A 2GIQA 3BH7B 4DV5J 2JL9A 4X64J 2UUCF 5HBMA 4ELVA 2QFJA 4IOCQ 4R5PA 2B7BB 4C8LA 1ZTTA 1RTHB 2LQBA 2ASLA 2L08A 1PJ7A 1R0CB 2F63A 4NCGB 3IWLA 1YHQS 5C42A 3GG1A 4NEYA 3NNAA 3F0NA 3NWRA 2C3OA 1NJWA 4QIWD 2HS4A 2DGOA 3MPYA 2V8HA 4JBCA 4RUCA 1SBRA 3MOZA 4ZPCA 1FKOA 2QN6B 2VDIA 1S1XB 1WUUA 4RW8A 3HK2A 3ULHA 2YTCA 1SIWB 2DEIA 1R0BG 5KOWA 3HPOA 4OZ5A 1VK8A 4O3RA 2H1YA 2VFVA 2YWHA 5HLFB 5A6PA 1D9FA 3CT9A 4P75A 2H5EA 3HDSA 3PACA 3TAMB 1UW4A 1HQ2A 4RJVA 1TVRA 2WW4A 3PVXA 1HNIB 3MD3A 1RT4B 3HFVA 1S72S 3KLHA 5E3QA 2RHQB 5H9EJ 3D7SB 3F56A 1YQHA 2AW0A 1S9GA 1UL3A 3EWGA 4PWWA 2MJUA 1KNZA 5B0EA 5E41A 3SSRA 1AFJA 2VG5B 5LSOA 1RTJA 4PYDA 4P74A 1H3DA 1RWPB 4JV5J 5HJXA 2MZRA 1YJWS 4JYAF 2HZVA 3THPA 3CDEA 1YG0A 2D3O1 1RWKB 3LP2B 1TL5A 4A8QA 4OHYA 1SJRA 2PMWA 3VR1A 4ZPVR 5IT9U 3MEEB 4LJMA 4C8YA 1TAUA 1UVNA 2VBZA 1H73A 2MSTA 4K4XA 4ECSA 4WF9Q 2HFOA 4P10A 2Z8QA 2Z0GA 4NXNJ 3MCOA 2E5IA 3QIDA 1PAEX 4DSIA 3KHHA 5KG5A 1FX4A 1R6YA 3H2UB 5CZXA 2KT5A 4NEZA 3CJ2A 4ZK7M 4W90B 3RBDA 3ZNUA 2H9ZA 4NLOA 1FO1A 1PO6A 4ZDNA 3FSIA 3V6DB 2QL5B 2NQPA 3CPWR 5DG9A 2W4DA 4K5SA 1LV5A 4M95A 3MCNA 3AODA 3DRRA 3TUPA 4X4QA 3I6PA 4A8WA 2KXFA 4DG1A 5F8HA 3D0IE 1UVMA 4ECUA 2Q6BA 4WE1B 3CDBA 4M63A 2NSCA 1JLAB 1RWMB 2OD4A 5KFEA 1GMUA 5GMKa 1HD1A 3AD9C 1CJTA 2RKIA 1GFWB 1UZDA 2A18A 2XMWA 2LQ8A 2MTLA 3OD2A 4PYAA 4OX9F 5BYQA 3B78A 2AU0A 3TA0A 3W8GA 2K7JA 3W63A 2GFFA 2DKOB 1U1MA 4P73A 2EK6A 2FJEB 1NHKL 3SCJE 3LW5C 4ID5A 2EVZA 2POKA 4CDIA 4A8SA 4FXDA 2DGXA 2DHAA 2VG6B 3KNAA 3GIJA 1XIQA 2OPPA 4KPCA 4AL5A 4OYWA 3Q8PB 3KLEB 3MAQA 1SUQB 3M8YA 1OO0B 3KNGA 3UN2A 2RE1A 1ZAXA 2DEJA 3CNQP 4B3TJ 3CC4S 5L46A 4I2QA 3M1VB 1M1HA 4TVAB 4BC9A 3RBXA 3FRZA 4PXEA 2PD1A 2GVDB 1ROFA 3OTCA 1N5SA 1HPZB 3R5BA 2DY9A 3J7Z5 2ZH3A 4I6AA 1N6QB 4OX8A 2J0SD 2DO0A 3U1NA 3IAM9 1CPZA 2YNGA 5EX3A 1S77D 2HAIA 5KG7A 3RZAA 4NA1A 5LSLA 4KGKA 1FVSA 3CVKA 2EKYA 3W2VA 2RVJA 4KB7A 3CCES 3LANA 2MGZB 4GKJJ 3D0HE 1TL7B 5D4NA 2GJFA 1C4CA 2ZBIA 2BOPA 4LFCJ 4NLVA 1YI2S 3GYNA 4O0IA 2AX1A 3MPDA 5J1EA 4XDCA 4CLFA 4CCHA 4ZJLA 1KVIA 4C0HA 2VB6A 1N32F 4CLKA 1GEHA 2BR0A 2OD6A 2LP4A 1RAAB 3D67A 3MURP 2WAQD 3C2PA 1UKUA 3C16A 4FDFA 2NREA 5D6GA 4EFAC 1U4BA 5LT5A 3OTOF 4AFFA 1IBKJ 3M8WA 4DL6A 4NE9C 2H4WB 1B70B 3DM2B 3N28A 3UNYA 1QAYA 1RWUA 3DU6A 3L9ZA 3N9UC 2B56A 2H5IB 5AXMA 4GO5X 4ED3A 1Y4ZB 4ECVA 2R8GA 4WFNQ 3P5TL 3PG9A 4H4KC 2CZ9A 1Q5VA 3GLJA 5D0EA 1S10A 2HWIA 2E1CA 5GADU 3IC1A 1K9MT 2IJNA 3GWCA 2HQDA 1NHVA 4LF4F 1S1VB 2E9ZA 2QEXS 3RR8A 9ATCB 2F7VA 4WP8A 3KHGA 2CDQA 2VA3A 5GVQA 1WF2A 2UU9F 3K8WA 1RAFB 2KRBA 3RRGA 2DCLA 1S1TA 4CQ1A 1Q7YT 2UP1A 2LYVA 3EICA 1O6XA 5A8RA 5F8IA 2DTJA 3OT9A 5E3AA 1MMLA 4MT1A 4X84A 2E1AA 4TXSA 1TV6A 2XZWA 2YWFA 4DU7A 1GK8A 1LXNA 4YFUA 3MEKA 2VONA 3HMJG 1R6VA 4FYVB 4LF5F 2RUSA 2KXHA 3DXBA 3WBZA 3GCXP 1AB8A 1X8DA 1SJ4P 4FPRA 2ZE2B 3I9ZA 1T03A 3W64A 4CM0A 2FD2A 1N33J 3OL7A 2IA0A 5C2CA 2AGQA 2CJYB 1RWOB 2OPRB 3G86A 2J7UA 3NS6A 2L41A 4DLEA 1D3WA 7FDRA 4HTJA 4DLGA 1KVKA 3MMAB 4X4UA 1FWPA 1NMEB 2VV5A 3BZQA 4NXMF 3KK3A 2ZH6A 2CQIA 4IDKA 3T1HJ 1IKWB 2YBVA 5C5JA 4MK7A 2KXNB 5DQGA 5B7WA 1CJUA 1NB2A 2DNRA 3CCTA 2N7YA 1VOMA 1WDTA 1FFSB 3KK1B 1CJKB 1VIXA 1JLQB 3NGTA 1REVB 1IR1A 2ATLA 3M2VA 1QDUB 1RT5A 4HKQA 1DURA 2VQEJ 1UFLA 4I4BA 1TUVA 4JI2J 1CG2A 4DUTA 3DMJB 3CD7A 1YBUA 3KHLA 1HL6A 3M6XA 2RRBA 1RT1B 3FMBA 2DHXA 1LW0A 2GS8A 1RGVA 1J5OA 3QT5A 5KT3A 1DQAA 2G2OA 4DS4A 2JEJA 4CNYA 1VGYA 2KM8B 3MFHA 1SXLA 2I5JA 1RYSA 4X65F 4A8YA 4ED5A 3QT8A 3W65A 2LA6A 2YPYA 4OZ0A 5EDWA 4P9SA 2QSWA 2H4YB 2HIYA 3R5GA 4L72B 1KTVA 1U25A 1C0UB 1HA1A 4LFBJ 3R5DA 1S4FA 4I69A 2A0FB 1IWAA 4ECXA 3BKUA 4MK9A 5F8LA 2XM3A 2CPJA 4Y34A 2B5JB 2MKCA 2ROPA 4DOZA 3TJAA 4DQIA 2V4RA 2QE5A 2MQQA 3TAQA 4XPCA 1OPZA 5IC6B 2RILA 2AEJA 3PR4A 5J2NA 3QSIA 2V8PA 3M4XA 3SDEA 2J5AA 4HHUA 1WEXA 3ZZ0A 5K14A 2V9KA 1K8AT 5DRKA 1FE0A 4AXIA 3PW7A 4KGZB 2L9NA 3TA2A 4PQUB 4N8NA 5D78A 5KT7A 5HK4A 3CJKB 4YUDA 3GFZA 2FYXA 2ZD1A 3TRGA 2WCXA 1DHMA 4RNHA 1RHRB 3D54A 4J9RA 5ETQA 5DETA 3PW4A 2A3JA 1RAJA 1BHNA 2Y0SD 2HSEB 1FRLA 4J9QA 2N3OA 1XNRF 1PJ6A 1L3SA 1ZPVA 1R31A 1HI8A 5AE3A 1RTDA 3Q8QB 4ZVEA 2J7WA 3MEDB 3ILLA 4ETXA 2YX4A 2KI2A 5CCMA 1UFWA 1U6ZA 2GQQA 4ZP8A 4Z7YA 3C15A 1ZH5A 2OEMA 2IVMA 2C28A 5D0HA 2B8QA 4WPAA 3JSMB 1R8AA 4EI2A 1WI8A 1P6TA 3EDRB 2YKMB 5T41A 2VZ9A 2RF2A 2DXFA 3NKYA 2RQKA 1S0NA 2GVZB 3LWMA 1F2GA 4KFBB 2VQFF 4USVA 3OR1A 5I3QA 1X31C 4YB6A 1HYSB 4HTIA 5KT6A 3M6UA 3CO0P 3G6YA 5EUHA 3HKWA 3TUJC 3JQMA 1S6QA 3QZ7A 3EGZA 3FCHA 1YIJS 3JYTA 4N7TA 5LXRA 2ZUAA 1GMWD 5K8NA 2NXJA 2YXLA 3RW7A 1GTEA 4RX6A 2XMVA 3D3CJ 1S59A 2F9JA 5AE2A 2HFSA 2WOMA 2X3GA 2NPFA 2DRBA 3MMBA 4Y6IA 2V68A 3DKDA 3OFGA 1U1PA 3RB3A 2KVIA 5KFOA 1WWHA 3M9MB 4QYRA 2F4VJ 3R6GB 1WEYA 1LKZA 4XTTA 2W2MP 2ADCA 3LGMA 4CLWA 4DR7F 1VQPS 3HHLC 4B3OA 3PFOA 5HQ8A 3H40A 3CCLS 2Y3YA 1F5AA 2QIFA 4X4RA 2P9GA 2V2VA 1AROP 4LSNB 3D1HA 2FDNA 4CLYA 1QJHA 1D0EA 4ZMMA 5HMYA 3US5A 2F9DA 4MIWA 1B4SA 4KR0B 2N4DA 2K06A 2G2ZA 5HVFA 1TMJA 1YKWA 2G1HA 2OTJS 3QJPA 2NR0A 1TZ0A 1HBOA 1HQUB 4RBTA 3CCMS 2UZAA 2UXCF 2F5GA 4OJ1A 1S9EA 1GH8A 3SFUA 4DV0J 2HFZA 2Q1LA 3KUHA 1C1BB 4UQGA 1SJ1A 2GNKA 1V5VA 2PDAA 3RU0A 3ZNJ1 2R7WA 2XSJB 4WFYA 2H51B 2UV8A 4UZCA 1NH7A 2NLWA 2GV1A 1Z4UA 4USTA 4DR4F 1MN7A 4KV8B 2JLEA 1ZBTA 2E5HA 2RH3A 3R9LA 2CNLB 4QBUA 3RJMB 3NL0A 1XWLA 1KOOA 1Q79A 1GX5A 2AT1B 2KDOA 1IM4A 1UMJA 1HNZF 2VBYA 4FNIA 1MLAA 2VBWA 4QWAA 4UOGA 3FEXB 3VAMA 4PR6A 2MLXA 4FVMA 1UWBA 2JH3A 1S5ZA 1TK5A 1U1KA 2MZQA 4ZLJA 4JB8B 4P71A 4N76A 3WIUA 2J8SA 2HQFA 2ASJA 1NU4A 2JLFA 4O4RA 1N88A 2FHJA 3DNCA 3J7YU 1MU2B 1XEZA 4K50A 3UCZP 1BQNB 4YHHJ 2MKIA 2A10A 1RAIB 3CDAA 1RT2A 1JB0C 2AX0A 1EP4B 2N82B 2K7KA 2A2CA 2CKWA 4HYKA 5KFHA 1C4AA 3RGIA 2RQ4A 2QMWA 1M5HA 1PYTA 5CYQB 4DPYA 3ET6A 2MQOA 3UDCA 1N0VC 4CH7A 3M8RA 2DR5A 2D3UA 1QE1B 2VG7B 3TARA 1N56A 3R7NB 3KUGA 4NASA 1QUVA 3CJTA 2FPHX 3MHYA 4RW7A 1WC5A 3I56S 3K17A 1RABB 1NH8A 1TL3B 5J1NA 2FGCA 5J1PA 1SJFA 2HFVA 3TUZC 1M5PC 3OUYB 1M0SA 3AOCA 2I9SA 4F4KA 2R7TA 3BV8A 1TAQA 1VQ7S 2QGFB 2E9TA 4JI1F 3M7VA 4HH0A 3VAFA 3JAMY 5KFWA 4RBVA 4WTYA 3DOLB 2C1EB 5FIIA 2MZSA 2IC3B 3GJSB 4ZVOB 4CP5A 1VHFA 1PJ5A 2NUUG 1NDKA 2IHR1 1PC5A 5HQLA 4ED6A 2OEKA 4USKA 2ZBPA 2HVZA 4WXWA 4ZPTR 2L9WA 4DV1F 1S1XA 4ZP7A 3SQGB 1RLDA 1EX8A 1YLXA 1R8BA 3EVMA 2J9CA 3F73A 3KG1A 1ZYQA 3TX0A 1U47A 1JNZB 3FUYA 3PRDA 1N48A 5HLFA 3GPAA 4ZVQB 2MQPA 1MN9A 2H65B 4EBEA 1U6FA 5L1KA 4FYXB 3W60A 2X1FA 1XMOJ 2DPIA 5CZVA 4DL0C 2DR6A 1X4CA 4A8MP 1EJ7L 4OYAA 1RT4A 1HWKA 3HHLD 2XLIA 2G2YA 4F26A 3FKBA 4DV7J 4KAIA 1NZAA 1BQMB 4V19J 1QTMA 2L9DA 1WHWA 1F9HA 4PWDB 3HHLB 3VF0B 4NZ6A 1RCXB 1FT8A 2WB4A 3EJMA 3A4TA 1NSKL 2OMLA 2UXBF 2VG5A 2OGUA 4P2XA 1MMNA 3D6FB 2Z2LA 3NNHA 3LP2A 4PPDA 2CFXA 2KU7A 3T1YF 5DS7A 2AV5A 3O2IA 3VGTA 5LJ5Y 3MEEA 2ACYA 3KJQB 3GIRA 3PYGA 4I7FB 2FJWA 4BC7A 1LK5A 3EVOA 3DOMB 5B0BA 1TK0A 5HVGA 1FJGJ 2PFDA 1KS2A 1SC1B 2C2NA 2I1RA 4CM2A 4DQRA 1BMQB 1N5TA 4B08A 1YJNS 3QSYB 5A2QU 1O0PA 1TKZA 4ECTA 2CPYA 5KFQA 5A8KB 4UF4A 4UOFA 2HZCA 5KTQA 3A3OB 2NXUA 4OYIA 1ZA2B 1IKVB 1KFSA 3RYLA 2XMAA 2JEIA 5C7PA 2HGNA 3V6DA 2QRRA 1RHQB 1U6BA 1Y0HA 4OV6A 4YEAA 4LSZB 4JI5F 1HNWF 3J81Y 2FJDB 1SC4B 3DRPB 1NBEB 1VBXA 2MLYA 2RMLA 5CABA 3AJ2A 4I6WA 2CPXA 4YY3F 4AD6A 2AF6A 2HMIB 5L9NA 3CWJA 1XERA 4RNOA 4C97A 2XYGB 4LSLB 2ZVIA 1JLAA 3PYFA 4X4SA 1F5CA 1M5KC 4I64A 2CNNB 5HVHA 1OY9A 2DK2A 2CJQA 2O01C 4FYDA 1YTYA 4I0WA 4WK1A 2UXDF 1JJCB 3U02A 1VC6A 9RUBA 3KLVA 1LWXA 4WKRA 1TKTA 4HI2A 3K0JA 5H9FJ 4N41A 1Z1ZA 2FGOA 1TP7A 2HBRB 3UFCX 3C8YA 2KL8A 4GRSA 1Q82T 5DDPC 3H25A 2P6SA 3D5MA 3VAIA 2ASDA 2MSSA 1AXQA 2KO1A 4DR6F 2XI3A 4IO9Q 1OIAA 3MM6A 2P5VA 1UEUA 3KLEA 2EFOA 4ZPWR 1SUQA 1X5SA 3LGNA 4C2MA 3KMQA 4FNHA 5HI7A 4TYAA 3ZZRA 2XMTA 3M1VA 1QY7A 5HANA 5KT4A 4O44A 4DSLA 1KONA 1J5EF 4NLTA 3UVJB 2G0JA 2GVDA 2BKOA 3CIMA 4KKOB 4F4AA 4OZ1A 2NXNA 2V50A 3HVTB 5IM0B 2PE8A 4QWCA 2PMZD 2C3MA 3WX4A 4DHVA 1N6QA 1KQKA 4ICLA 3IAS9 5AJ3F 2LDIA 4P6QA 2Y0BB 5KOXA 1WKLA 1LWFB 3NCPA 2N7CA 5RUBA 4ZIWA 1YBTA 5EGYA 4OX9J 2Q66A 2LQ5A 5HL7Q 2FY8A 4LRCA 1KKHA 1GQEA 1CSJA 1SCJB 4GMKA 1RAEB 2MGZA 4K4TA 4MK8A 1TL7A 5CHCB 2YVSA 1HI1A 2L3MA 1YZ7A 2DR7A 2GIRA 5E33A 3CF5Q 1YDLA 1TR0A 3GONA 3W62A 2RU9A 5BJRA 1GXUA 1DQ8A 4C8KA 5T7LB 4AT1B 2V6AA 5LM7E 4OLOA 1S79A 4DR3F 3QRQA 1JJHA 1KR4A 4M94A 2B0GA 3T5JA 2BUNA 2E9RX 2DGUA 5GAGI 1SKUB 4ZN3A 3DM2A 2LMIA 4HDHA 3FC9A 4K0KF 1NCLA 3GJTB 5C25B 3IG1B 3P8BB 4DFMA 1IBMF 2H54B 2DH8A 2HRTA 3Q8RB 1W26A 2X1GA 3J7A1 1FTCA 2YPZA 3GYXB 2X1BA 2CYYA 5KG2A 4Q45A 2YH1A 4NMLA 1S1VA 2FLOA 1T7PA 5LJ3Y 1E6VB 1FWKA 3WC2A 2KB2A 4NYZA 2KHCA 4DN9A 2CQDA 1JNRB 3WDOA 1AZSA 4ZVPB 3ISZA 5FLXY 4B9VA 2VFRA 5G0RB 2XCAA 3DCAA 1Y3JA 2GMJA 3B8HA 2DD8S 1N32J 1HHSA 3UN5A 4J9NA 5CD4H 2XS7A 1VQLS 3PZPA 4ZVUB 1CJVA 5D8HB 2KT3A 2IDLA 4LBIA 3MOJB 3QMQA 2HQGA 2YKOA 1NSAA 3R8YA 1RWNB 1GXTA 2F8MA 1F3FA 2ZE2A 5IT4A 3R7BB 3IR7B 1T05B 1VQKS 1S1UB 3THTA 1ULRA 3W8PA 3LQVA 2OPRA 4Z2XA 1RT3A 3P5BP 1AT1B 4H4OB 4PUOB 3EXYA 3PRBA 2IM2A 4PEOA 2J0QD 3QATA 4ZJOA 1TK8A 4C8NA 3MMAA 4PZVA 3T1AA 3OFEA 1L3KA 2DHGA 3PXGa 1IKWA 1M5SA 2BRKA 1ZM9A 1F3VA 1RE1B 2RRAA 4XK8C 3H5XA 3M6VA 1K47A 3IP0A 5F8MA 4U7UK 1CJKA 4A8OA 4F4WA 2UUBF 1JLQA 2R7OA 4Z37A 3KK2B 4O3NA 2GX8A 5HQMA 4ZVTB 4OIXA 3TVKA 3Q8SB 1X9MA 5IFMA 4ZLLA 4WU3A 2AGOA 1D8YA 4IRKA 5IT9Y 2AJFE 4K7QA 4CLTA 2BOAA 3DYAB 2BQUA 3W7BA 3UD3P 3OQ2A 3BDPA 5A6WA 3DLJA 1UPMB 3B4MA 1SH0A 1YRUA 3W5ZA 1ZM2A 3PW5A 3FSYA 3F44A 1XMQJ 3B54A 1LFPA 2EG2A 4K2JA 1Q86T 4TY9A 4U7UD 1RU2A 2CPHA 2I38A 5LOQA 5KG4A 3KLFB 3E01A 4ILLA 1BC6A 1U2CA 3TVZA 2RS8A 1J27A 1WKKA 4CO1A 4RPFA 3MTKA 3TR5A 2AJQA 2KRRA 3TQEA 1KLMB 1SC6A 5MAOA 1TFWA 3RW6A 4UUXA 4J9PA 2RRNA 3HSJA 3T9NA 1L5UA 2SXLA 1S48A 4FF2A 4MJKA 5HN0A 5M2UA 2DNGA 3HSZA 1U0HA 3B4DA 1WC6A 3VAJA 4WYLA 3QT7A 3A8EA 1VQMS 3AOBA 1GXLA 1DQ9A 1K1SA 4PQUA 3R6LB 5JVHQ 4UOHA 4H4MA 5F9NA 2HQIA 2DO4A 4P52A 3QJJA 2ZC3A 3CJKA 1P1LA 1S0VA 2HQ3A 4URGA 4NZ0A 3KLGB 4NLXA 4TY8B 2JVOA 4KO0B 5J2QB 3IXQA 2FZKB 2QZ8A 8RUCA 2V63A 4LQ9A 4X4PA 1QAXA 4MKAA 2HHHJ 4ED7A 4IG3B 3ENQA 3HHEA 3FK4A 2ZZTA 2F3JA 2D3OR 4ELTA 1LFWA 3KOAA 1G4CA 4P7TA 4K4VA 3AQPA 1XN9A 4NLYA 1RA6A 1NUEA 2QA4G 3M30B 3MEDA 3MM7B 1WORA 2P8IA 3PW2A 2V69A 2RSQA 1RT6B 4QPXA 2MQLA 1I51B 2DGTA 3R27A 3KG0A 2BE7D 3WZ0A 4QZVB 2ZH4A 4L73A 2LCWA 4ZPAA 4P72A 1DAXA 2YKMA 2ZM6F 3EZ5A 2GVZA 3T41A 5F8NA 2WSFC 2QA1A 4G65A 2OP5A 2OAUA 5LMNF 4KFBA 2OTLS 1X0PA 4CI0B 2BABA 2MLZA 1HD0A 1PILA 1ACMB 2VBXA 2K3KA 4KHPJ 5LSRA 2EFVA 1FE4A 5KFFA 2B4OA 1FX2A 5F8JA 1B0TA 3AXMA 3W3SA 1S57A 1R0AB 1NK9A 4DR1J 4IUFA 5IS2A 5KG1A 1OMSA 4ILRA 3GYGA 2W4PA 3MD1A 2IM1A 4DI6A 1D9AA 3P45B 1QSLA 1MSWD 3G96A 4X62F 2DNLA 1GMWA 2B4PA 4AYBD 1NLKL 4JI4J 4U96A 2M5YA 1BUXA 2AZ3A 5KAKA 5L8RC 5HMZA 2XMJA 4LSNA 1KOHA 5I3PA 4ZVSB 3IRXB 4YOEA 1X9SA 4C11B 1T9VA 4YB5A 2YY3A 2UV8G 2CPZA 3EE3A 2UVRA 1MNEA 2XTJP 3FRYA 2E5LF 3EXCX 6AT1B 3PJ9A 3OVSA 3PX4A 4UOCA 2KYZA 3CGIA 1SL1A 4PWUA 4W4MA 2VQFJ 2CIMA 3ETOA 3FQLA 5KFUA 3DHXA 1VR6A 2YNHB 1UJ4A 1U7LA 2ZVSA 3UCGA 3EPGA 2CNKB 3EUNA 2JRSA 3SV4A 2VOPA 4CLZA 3MPVA 3SV3A 2R7VA 2FHMA 2WB1D 5KFBA 2OFGX 1H38A 1Q5YA 2XSJA 4ED0A 3UDVA 5KFGA 4X4TA 4FBUA 4QWBA 4ZA1A 4NOHA 2QMUB 1N36J 1AUSL 3DOKA 4KV8A 2FLNA 3G6XA 5F9LA 5T14A 3C6UB 1Q0NA 2LDYA 4QW8A 1C2PA 2J8AA 5CYMA 3HVAA 1FI4A 3W61A 4F7VA 1QVGR 3I5BA 3MUMP 2RB7A 1HQEB 2BEFA 4DDFA 4Y28C 1IBCB 3PYDA 4MIAA 3AJ1A 3CJ8A 3TX8A 3HZEA 2JZ5A 4LRBA 2UUWA 3A8JA 2PFFB 3I31A 3U27A 5L39A 3MUTP 4A8XA 1BQNA 3MCSA 4DUYJ 2YKAA 2AYBA 3M2RB 4RLEA 1RADB 1EP4A 4I2PB 3D9BA 4LIRA 1WJ9A 1KVJA 2BANB 3MMCB 3OTEA 3JQJA 3NAHA 2XCPA 5HATA 5ETVA 1WELA 2XGPA 5K9FA 5HP1B 4FPIA 2XY7A 3ZO7A 4DV5F 3GJQB 4FP9A 3DFEA 2HHUA 1URRA 2IAJA 4IOAQ 5BYRA 3CCQS 1VC5A 2C42A 5EWFA 2E7VA 2K3IA 2F8EX 2VG7A 3OXGA 3CCJS 5ETPA 2AEMA 2R4FA 1CC8A 1HBNB 2D7SA 1S1WB 4M5MA 4EYHB 3HKZD 1JLFB 1FRMA 1UVKA 3C6TA 3W2WB 1TL3A 1SVDA 3MFIA 1FHTA 5KT2A 2HBYB 3NGKA 2PMHA 3OUYA 4J7CA 3SBMA 4DPUA 2ZHOA 1R7IA 1UETA 2EC0A 2E5GA 3JXOA 4OHVA 4U67Q 2GJIA 2R2RA 4F4XA 4ZPDA 4NI2B 4TKTA 3G82B 3D68A 1VQOS 3QIPA 2ZNYA 2V2ZA 1VQSA 5AXLA 1SV5A 2M2BA 4C6AA 5F41A 4A8FA 3DOLA 4BCAA 1OQ3A 2XULA 2R8JA 4UY85 1N4LA 3D0GE 2YWWA 2V94A 4N47A 3TEGA 3KFWX 2E1PA 3D3BJ 1T11A 3GIKA 2Q43A 4LF9F 1WOOA 3JSBA 4Y2AA 5B0FA 2C2KB 2OUGA 3KJVB 5IT0A 3LH2S 1QAIA 4YN3B 2VJVA 4NX9A 3GIIA 1NJYA 3GG0A 4RW9B 4QYZJ 4CTAA 2QMXA 2JWNA 3W5XA 3CW2C 1M1KT 1NEEA 3QGIA 3OFFA 4JV5F 3H2VE 5DM7Q 4B9TA 1FXLA 1B64A 4FXVA 2U1AA 2XZDB 2V9WA 2QTWA 5EHHA 1IJEB 2DNMA 4RW8B 4B3RJ 2ZKTA 3KJNB 1T95A 3GSDA 4ID8A 1BQMA 2HHQA 3GU0A 4HDGA 4NXNF 1T3OA 4FVCA 4OL8A 5GMDA 2IBKA 1UVJA 1Q1KA 1RA7A 2VPWB 3HHLA 3V81A 4ZCMA 1Q8IA 5KFLA 1QAJA 3IMQJ 2F8HA 4MYUA 3PYEA 1TVRB 2DH9A 3KWMA 1VDHA 2LECA 4N5SA 3TANA 4CO3A 3VAGA 4YDDB 5FDLA 2BDPA 1PYSB 1RTIB 3HP6A 4DV1J 3TNVA 3CC7S 1X4EA 3HSDA 2GAGC 2KFNA 2LXUA 3JTOA 4MFBA 4I7FA 1HI0P 4CO2A 3GV8B 2HQCA 4WJBA 3F41A 1TKXA 2V0NA 4CT8A 3DOMA 1ZAWA 1RTJB 2EFNA 1EQMA 4JI0J 1FA0A 3ZC4A 2HGLA 1ZZFA 2KH9A 4Q43A 4ED4A 3PX0A 4YP3A 2Y1RI 4U8YA 3LA0A 1YZ6A 1FJCA 3J81j 1AW0A 1APSA 3MM5A 1ZZNA 3FEZA 2WSEC 3X3UA 4IG0B 1PYOB 1K73T 1EAYC 3CC2S 1IKVA 1FDBA 2YNIB 3BN7A 3O5TB 4DV6F 2CQ0A 4BWJA 3ZFVA 1SB6A 3MDFA 3P3DA 1FD8A 4ZLPA 3TI0A 3QT6A 1S6PB 3V6KA 1N34J 5FLXU 4DL3A 3N01A 3BYPA 1ZTWA 3KLIB 3DRPA 4FS1A 2UXBJ 2D41A 2XHWA 4ZLNA 4G1IA 5A0YB 4BDPA 1X4HA 1QTNB 1FDAA 3VTIA 3BPDA 2WRMA 4DCPB 2IBOA 2B7CB 1D9DA 1YRTA 4IR1A 3LGHA 1PBUA 1KSPA 1MMDA 4LSLA 4IOBA 1NK0A 2LEAA 4M5GA 3TAPA 2JC0A 2RU3A 3UDLA 2O67A 4DL4A 2HIQA 5E3CA 2XZTB 1KLNA 4B3TF 2R2UA 2BJ7A 3CJ5A 1S12A 4LIWA 2G13A 2XNQA 2YH0A 4DU8A 4PG6A 2OJ3A 4O4GA 2W2QP 2Y8YA 4LBHA 3QZ8A 4DG1B 3IS9B 3ZTPA 2YQ0A 3J7AN 1B3TA 2DITA 3VALA 1JK9B 3G9CA 3LPYA 5H9EK 4FS2A 2ZOFA 1UEVA 3MEGB 2C3UA 3MAAB 5GMEA 1Q53A 2RKIB 1BGXT 2XO6A 3BQ2A 2E1MC 3HSGA 1WNEA 2QJ3A 5DJBA 5B0GA 3CCRS 1R8CA 4LFAF 4JI5J 1GT8A 2XNRA 1NK5A 3RBZA 4XPEA 1Q4RA 2DHSA 4GKJF 2BKNA 3VQSA 1FTRA 4KQZA 3G6ES 4WFZA 3KTQA 5M2PA 1RHUB 1P27B 4ID5B 4LBPA 3ZZZA 3AY0A 1VK3A 4LFCF 4RNFA 1YJRA 2OSQA 4KKOA 3D6HB 2B9WA 2E66A 3H4BA 1EIYB 5IZHA 5C24B 3LP1A 2APOA 1FNOA 3D2WA 3UI3A 4DUZJ 1LWFA 4I2QB 2HK2A 2C2OB 2D9PA 3TQ1A 2G9OA 3FJ2A 2JOQA 1IBKF 1AA1B 1RYRA 3I0SB 4A46A 5JUMA 4ECRA 4F3QA 3GV5B 2YX7A 3QYYA 3W66A 1NPKA 2F40A 2EKNA 4HVZA 5U47A 2JFDA 2VHGA 5D77A 3EGWB 1WACA 3SZ2A 3NRBA 1T02A 3CJQA 4E2FB 3RG6A 4YDXA 2KKHA 2JFKA 3GIMA 4Y2CA 3UN3A 4ZCIA 5AXKA 1B99A 3W2VB 4RNNA 5T7LA 4KH0B 4PPZA 2B8PA 3K89A 3RAMA 3HHDA 3DGPB 3ZZUA 4C9DA 1J5EJ 4DSFA 1SL0A 1RCOB 2ZBQA 4WFAQ 5EWGA 2WVCA 4TQRA 5JXSA 5ITHA 1VBYA 2EC2A 2QLWA 3FCVA 2IFXA 3IG1A 5B09A 2B3TB 5AJ3J 1CS4B 1U45A 2BQ3A 1NDLA 4OI4A 2QA4S 4QIEA 4Q44A 2D74B 2GO8A 4QIFA 3C16B 5H1SV 3QO9A 1PSDA 2DNHA 2ZH8A 3TJ8A 1WOSA 2WSCC 4DSKA 2MEWA 2DNKA 3D6MB 1E6VA 2B6AB 1VC0A 4OJGA 2UVVA 4X4VA 2AWZA 5GAHU 3KYLA 2M0GB 4WZQA 1U49A 4B9UA 2HURA 3OL9A 1ZA1B 1KBRA 3LAKA 4DMZA 1XNQF 5G0RA 4EZ9A 3MM9A 2ERRA 3TP2A 2CWKA 1RAHB 4NLRA 1SKWA 2DGSA 5KFRA 1HNXJ 2DH7A 2V4QA 3CJ3A 1VBZA 2GQ2A 2YQ1A 2XY5A 2M7SA 5SZTA 1NRKA 1RHJB 2JC1A 1JJ2R 4F02A 4BHQA 5L1JA 2CJ9A 4OYBA 5ETTA 3NY0A 1V3SA 4DR3J 4P2MA 4CWBA 2Z2MA 2HFUA 3D1OA 3N6LA 4I56A 5IV4A 4CLSA 2VPZB 3R7SB 1Z2ZA 2VD3A 1VI7A 1BQXA 2HVHA 2YX1A 5A8RB 4DZDA 3NGRA 1H74A 1SJ3P 3RB0A 3T19A 3ITHA 1T05A 4EBCA 3ZTOA 1S1UA 4K5RA 3DRXA 2HHPA 1IBMJ 4K4YA 4JI2F 3SCLE 2R7RA 1JQGA 1WHVA 4PUOA 3TOQA 3SYZA 1CULB 1FK9B 3PO5A 3T5LA 3H98A 3DLHA 1G7CB 4Q8EA 2YQ3A 3TZWA 2MY7A 2OPSB 3PIPQ 1ITPA 4M5IA 2CPDA 5KFIA 5E0OA 3LP0B 5KFNA 3TVYA 1UVIA 1ZM3A 3HXMA 1F6TA 2FVPA 3UD4P 3T3FA 4DFJA 3AB4B 4LT6A 2G0CA 2I6WA 1U1RA 3QNWB 2ALZA 4UQTA 1NKBA 3KK2A 5HROB 1S6UA 3I96A 4LF7J 4X66F 3PW0A 1RUSA 3K5NA 2C22A 5AE1A 1W2IA 3D4JA 3KK3B 4IO1A 1X7VA 4LFBF 3V6HA 4IFVA 5F3TA 4ED1A 4PXCA 2HHTA 5B08A 4DSEA 4GKKJ 1JXEA 5KFSA 2MZJA 2BJ1A 1L3VA 3BKFA 5CQGA 3DYAA 5GAHI 3BN4A 3M2UB 2CG4A 3FEYB 2FVCA 3FFIA 3OJUA 3OVBA 2QYCA 1RT5B 3I9V9 2J0WA 2BJ9A 1Q8KA 3R3TA 4RWWA 3IR6B 2DHHA 2VFTA 3PFEA 1NZ8A 2CAJA 4OX7A 5A2QY 2EK1A 2HGMA 3ISNC 3KLFA 2M52A 1VS3A 1X0FA 5IQQA 3P49B 3CMAS 4KE5A 1LW0B 2JVRA 2O1PA 4WYWA 2CQ4A 4L76A 2HNYB 2FC8A 3NP5A 1MW7A 4DS5A 1KLMA 5CA5A 4OZLA 5KFVA 1LWCB 2V2QA 1FKPA 1U2RA 3VAHA 4OI3A 2W8KA 2K2PA 4M5KA 3HT3A 5A8WB 3CJ0A 3U1MA 2HAFA 1UJ6A 3W5YA 3EX7B 2O3DA 3JTNA 3J80U 2PGCA 3FSXA 2OPQA 3DXSX 1D1UA 2CZ4A 2VIHA 4ELUA 4F25A 1WG1A 3IN5A 1FDDA 2FVSA 4CLLA 4XO0A 2X3DA 2HBQB 2ZEJA 3SXLA 1I94F 2C2DA 3KLGA 4QIGA 1GMVA 4DFKA 2X1AA 1IBLJ 4KO0A 4QW9A 5J2QA 2XMUA 2ZHBA 2DPJA 4LR9A 2OEJA 4USWA 3DLKA 3W9JA 2J9DA 3SMZA 4QWEA 3GQCA 5K14B 4NLUA 3MR2A 2XHCA 5KT5A 3KMSA 1TUGB 5IXUA 3DLLQ 1WHYA 3JB9k 4ERDA 2BZ2A 2UUAJ 4A8KA 3OW2R 4NCBA 4M5DB 3MM7A 1UA1A 3BYRA 1IUJA 2Q6CA 3FBEA 3FVYA 1KHWA 4DF8A 5IWAJ 3QGPA 1U24A 1XBWA 3ZZPA 2EW9A 1Y5IB 4R8UA 1D8ZA 4YR2A 4F0KA 3ICLA 5E3PA 3LO3A 4QR1A 5DLGA 2F4VF 1DJ0A 3G4SS 3RR7A 3UDEA 4EWTA 5ETKA 1OPIA 1X4AA 1UA0A 3CMES 2AP6A 3R5AA 3C19A 3OSNA 4Q5VA 1LNQA 1TU0B 4DSJA 1RU1A 4C48A 2IYIA 2ZDOA 3QQCD 1HHTP 3DRYA 3I82A 5HMXA 1IKYB 2QT7A 1FXRA 1R0AA 1E6YA 1NB7A 4X2BA 1X5OA 5LL6d 2RF2B 2DIUA 3POTA 1Y9OA 2Q3PA 4ER8A 4EUVA 2K8GA 5D0RA 2FVRA 3KG4A 3OR1B 3VHQA 3N79A 2BA9A 4OJHA 3JQKA 3M05A 3AD7C 2NSBA 3NLCA 4DV0F 4A4JA 2RNEA 1A7GE 1JLEB 3N5BA 4DV4J 2JLGA 3JYTB 3CO9A 3OL8A 4C0OC 2LEBA 3IRXA 2KG1A 2V2KA 5KG0A 1YJ7A 4C11A 3CCSS 4Q0BB 3G8QA 2EFQA 5E7OB 4MH8A 3RB6A 5ADZA 3CDUA 1B0PA 2GHVC 3PKYA 1NSPA 5DDQC 2PA8D 1UAWA 3OBIA 3BSAA 4DL5A 2YNHA 4C3KA 4JI6J 5BR8F 4CRJA 2AJ4A 4ZP9A 1WI6A 1EQ0A 4GVLA 3TO8A 1S7IA 4LF8J 2LKZA 3CIZA 1X5PA 3DLEA 4F3MA 2FHKA 2OMOA 1NK8A 2ZBRA 2LVWA 3CTRA 4WKYA 2C3YA 2FJBB 2R3VA 2EFGA 1AFIA 1SKSA 1VQ4S 4YHHF 4PG5A 2IRYA 4MTPA 4RWXA 1XR6A 4IFYA 4I1TA 2XI2A 3NBPA 3HF5A 4X62J 4RKUC 4AQYJ 4ECZA 2KJVA 3MGJA 4J9OA 4DWIA 2DBBA 1HFEL 1NAQA 3UNGC 2YKQA 1Z2LA 1TELA 2WVEA 3OHAA 1HQEA 3RRKA 4BWMA 2FZGB 1T9TA 4XDDA 1NXIA 4G1PA 3QJLA 3MZIA 5EWEA 3QBCA 2RD5C 1QM9A 2Z56B 2EG1A 4NRUA 1TQLA 5ETOA 3CCZA 4YMEA 2AZ1A 4DQPA 4IH7A 1Y5NB 1JXVA 3VGSA 2PN6A 4O23A 1U26A 2ZFHA 5MLCV 1LK7A 3M2RA 5E2QA 4I2PA 3BGFA 2J6UA 2M3DA 1S4EA 2BANA 5K5MA 4DV3J 2M70A 1YJVA 1N52B 2DGQA 4Y3CA 1WC4A 4DF4A 1NO8A 2WHOA 3H2LA 3HJVA 4B3SJ 2FZCB 4X4OA 2OO4A 5CD4A 1IR2A 4RW6A 2VPXB 3O3LA 3IWNC 8ATCB 4UTGA 1RT2B 1HBNA 4O3OA 1S1WA 1JLFA 3W2WA 3B6BA 5K8MA 3L4BC 3H5UA 4GVBB 3MCMA 2VJUA 1V3RA 3WHIA 4RL1A 1IJFB 4BBYA 2YNFB 3AFGA 3K59A 1TKDA 4DV2F 1M5OC 4KHMA 1SQFA 4F0HA 4MAKA 3WX8A 3M32A 3HFKA 5M2RA 3FBFA 4ES2A 3J7ZT 1LXJA 4FXWA 2QLJB 1FDNA 2WBRA 4F8RA 3THVA 3R5CA 3G82A 3G8TA 4J9VA 1FRIA 2AJ1A 3QRRA 3PJXA 1KFDA 4TYBA 1XMOF 1NDPA 1NNDA 4J5OA 1YWXA 2JJ4D 5LMUJ 2FTRA 2BACA 3MM8A 4LR8A 1U1QA 4DV7F 4V19X 2HWHA 5DG7A 2VA2A 3KJVA 4G1QB 4QIVA 4KC5A 4CH0S 2NS1B 5KFDA 4GC6A 4EU0A 2NZ4A 2CQ2A 4RW9A 1IQZA 1GAOA 3FDSA 4KH1B 2ALYB 1M90T 3HULA 4WIQA 3AH6A 3W9IA 2MY8A 1IQTA 4HACB 4J9UE 1HR0J 1FWLA 3I87A 4P7VA 4U6PA 1WG5A 1RISA 2F1FA 4ZPBA 5J2PB 4ZVHA 1HBUB 3TW0A 2LQJA 1RT7B 2IRXA 4LMZA 3G8SA 3MI7X 3CJSA 3HHNB 2FJXA 3IBCB 4AL6A 4IKAA 3UR3C 1LWEB 4JI7J 4KJIA 4EO6A 2MZ1A 1FJGF 3PNIA 5LXYA 3NCRA 3DU5A 2VL1A 3BPSP 3OR2B 1Y11A 4ED8A 3TWZA 3I5AA 1KP6A 2NYHA 2ZJQQ 5J2MB 4LRDA 5ETMA 1QD1A 4Y2KA 4KHRA 2J76E 2CPEA 3UO0A 4LF9J 4UW2A 1X4GA 1JLBB 4JI8J 1RTIA 2KZMA 1O51A 1VLYA 2W2NP 2HHVA 3NEKA 4DL2A 4GO7X 3V2UC 3A1YG 2VKRA 3S1TA 1J2VA 4HLBA 4DQSA 1RAOA 1NJXA 2M4MA 5HMWA 3G87A 3HD1A 4TN2A 2PEBA 1UVLA 1LW2B 2MKYA 2V4JB 5DLFA 3M8SA 2MHEA 2VUGA 1NJZA 3PX6A 2CQHA 2W7AA 2FLPA 1NK4A 4YQWA 2CQCA 4AL7A 1OJ4A 4B9LA 2N3LA 4IG0A 1X60A 3MAHA 2B43A 4I68A 2ZBCA 2YNIA 1HARA 3H90A 3P96A 2NXCA 3UQSA 1N54B 2FHOB 1URNA 2CXEA 2P2CB 4ZOSA 3K5MA 3CEDA 4Y00A 1G3OA 1S6PA 2P6TA 4D3HA 4XAKA 2RS2A 1RTHA 2DJWA 2NYIA 3KLIA 4UUWA 2N4CA 4J9MA 2PT0A 4DR5J 4NCGA 4USHA 5A0YA 3IR5B 1XR7A 1TKZB 4NL5A 3AA9A 4LREA 5ETLA 1SPBP 1SQGA 4ECWA 2BQRA 2VC0A 2OSRA 4C8MA 1T9XA 3DLGB 3DDIA 2HRYA 1RWWB 2HHXA 3GFHA 2MQMA 2V8DA 4D3GA 1M1GA 2VICA 3M8QB 3GCWP 3BJYA 4PKDB 3NOGA 5GAEU 2HVEA 1HNVB 3IS9A 1UFKA 3GILA 4OHXA 1IXKA 3TAMA 4ZITA 2LLZA 4M8LA 4O3SA 4RR5A 4Y2IA 3OTDA 1HNIA 2W25A 3MEGA 3MAAA 2P9CA 5BXIA 4DV6J 4MKYA 3E2EA 2MJNA 3GJRB 4CZCA 2BJEA 5FJ4A 2UUCJ 3OXLA 2ZHAA 2V34A 3IBFB 1TKTB 3QLHB 2G0IA 2CZVC 1R8HA 2FVQA 1CBKA 2GW8A 3OTBA 2R8KA 1DZ5A 3IRWP 2OLWA 2AD9A 1K44A 2W8LA 4DJBA 1HLWA 5HJYA 3AT1B 3TUIC 3MM6B 2HZAA 1VBKA 5C24A 2O66A 1H7XA 3DDKA 1UW9A 3BBFA 3PV8A 2C2ZB 2HVDA 4WXOA 4WFBQ 4RO0A 3PDNA 1NKEA 3PO4A 1L3TA 4KGMA 1VMBA 4I6YA 3AXKA 2AMCB 3K7RA 3G6VA 2KM8C 4IH5A 4O44B 1DARA 1YK9A 3BF4A 2IVYA 3PKMA 2Y1IA 3I0SA 1JXLA 1KDNA 1QUPA 2FJVA 2W9BB 4BLGA 2MHNA 2V8VA 1F1BB 1FRKA 1EETB 4USMA 4ICLB 2AJ0A 2D3ZA 3SQOP 1Y10A 4QQBA 1R43A 3QPIA 2MZTA 4IQMA 3ZZYA 1TL4A 1VFJA 2DVIA 1MROB 4LFAJ 4ILMA 2KVQE 3NMAA 4L3NA 3HO1A 1SJQA 5GAEI 3MR3A 2NPIA 4KYZA 3K5LA 2F65A 3DGPA 2PI4A 4JYAJ 2J0XA 1SH2A 1CLFA 4WE1A 1JMTA 2R9LA 1YSJA 3LPEA 3OFHA 4CLUA 2HPUA 3M8ZA 4C98A 2ZH9A 3M9OB 4JI3F 4F4YA 3ADAC 3GE9A 1CS4A 4K8RA 2YWKA 3MTJA 4RUHA 5H9FK 1IM6A 3PRVA 2LFVA 5D4OA 2WVBA 4YB1P 1Y3KA 2IMWP 2YWGA 1RBAA 1VIOA 1XC9A 4A48A 4NLSA 1RP5A 3H20A 4UT4A 2B6AA 2ZH1A 5GAGU 3QWPA 2QSFA 2CQGA 1WF0A 1TL1B 2XSFA 2A6MA 4Q7AA 2FC9A 1A6LA 2ZJPQ 1FERA 2VG6A 4EYIB 2RDJA 2RIJA 1VHIA 1BWVA 2RHSB 3N6NA 3D66A 3GFXA 2AQ4A 2Z30B 1RWXB 5ETNA 1V6HA 3H8YA 4C4WA 2B9XA 1DFDA 5D3GB 3CMQA 4XIUA 1S0MA 5CAAA 1SQEA 2KT2A 1AZSB 2ZZMA 1AUDA 1ZETA 4C8ZA 2DXEA 4NLGA 1HPZA 3BKTA 3L95X 1FNXH 5DGBA 1X4BA 2HS0A 4LR7A 2DR8A 1T3NA 4Q2MA 3Q0AA 4B3MF 3SFGA 4M5NA 1YITS 3VV2B 1H98A 2RJZA 5CCLA 1LQ9A 1CJVB 1MWYA 3JS9A 4OQJA 5A76A 2JNJA 4WZMA 3MECB 1CULA 1FK9A 4EZ6A 1WKJA 5F3ZA 3I32A 1NDCA 2HNZB 4DR2F 5DQHA 2OPSA 2BJ3A 3CD6S 3Q24A 3LP0A 1SC3B 5E5NA 5JJBA 2IIHA 4LVNP 4EBDA 3FMWA 2XLKA 1WC3A 3V6JA 1H6KX 1XNQJ 1UP1A 1U8SA 2EXUA 1RT3B 1Q78A 1RBLA 1YVFA 2ZWOA 3KJFB 4WCEQ 4ZCLA 2KN4A 3PIOQ 1XMQF 3GZ7A 2XQCA 5HROA 4F36A 4KT0C 3EMTA 1PG5B 1H2TZ 4HHHA 2PI5A 2DY1A 1X4DA 4OI0A 1RKJA 3ZTRA 2V5HG 4F67A 3GB0A 2BVZA 1WDDA 3OV7A 2HS3A 4NLQA 3M2UA 4OLPA 1OWXA 1REGX 4ZCKA 2MQ8A 3TJ9A 1ZOTA 4KTQA 3L7OA 4EGLA 3WIVA 3V4IB 4ZJQA 2M9KA 4E0DA 3K57A 2HW3A 2MB0B 2C3PA 4CNZA 4J90A 1UCNA 4EEYA 1DTTB 2M8HA 2IMOA 5GADI 4PCQA 4QU7A 1UWAA 2LEPA 2BX6A 1Q8BA 1OYEA 2G1DA 1BWEA 2ACMA 3A8IA 4YR0A 4NLPA 1TUWA 1T0TV 1JKHB 4ZHRB 2ZH7A 2DNOA 2RQCA 2DNZA 3AHPA 6FDRA 3MPUB 4RUBA 2HNYA 1FESA 1U1OA 2FIUA 2LXFA 3V4MA 3NNCA 1JLGB 2BXJA 1LWCA 3FNNA 1IVZA 1EB0A 4W98A 2COLA 2HBZB 4MKVA 2HHHF 3CUNA 5F0UA 4X66J 2AHOB 5A8WA 3EVWA 3MXHP 1HIYA 2W2PP 3E01B 2MKJA 1Y5LB 2CRLA 4PG4A 3MF5A 3OTOJ 2Y8WA 3GR0A 4FF1A 3ETMA 3RUBL 1RAGB 4G3IA 1PKUA 2Z58B 2V67A 1VRQC 1UPPA 2WVDA 1WD6A 2BJ8A 4LRAA 3L7PA 2VOOA 1U1LA 3GFYA 2FJAB 3BH6B 1YBAA 1XJWB 3PJWA 4M5JA 5KFKA 1HWJA 2HFNA 1C0TB 1FJEB 5DDOC 3G71S 1U0HB 2R42A 2W7PA 3EGNA 5CXTA 1RHMB 1CQMA 4USJC 1HBMB 2AEFA 4LF4J 1FFGB 3DRSB 1DLOB 2RQMA 2YKPA 1VCTA 4H4MB 5I4MA 2UU9J 4KHPF 4AXJA 4DXLA 3U7JA 1U1NA 4M5DA 4OHZA 3RAQA 3KK1A 1HWUA 2I8EA 4DR1F 2BBEA 2HHSA 2M8DB 1REVA 2WBMA 4NPOA 2OFHX 1T9UA 1W2BR 1ICEB 2OELA 2ZH5A 1NK6A 4NZ7A 3C3LA 4MIBA 3A13A 3Q89A 3NCQA 1PAUB 3DMJA 1EARA 3LWLA 1RZMA 5G4DA 4LF5J 2HRUA 4JI4F 1A9NB 4PAAA 3NS5A 1RT1A 2ILYA 3TYTA 5IQ6A 2GHPA 1N0UA 1VRTB 3GMGA 1K0TA 4FF4A 1I94J 1IKYA 3UWTA 4DPWA 2I0XA 2IM0A 2PO4A 4ANCA 2E1RA 3D6TB 3SEOA 4RUAA 1ZAVA 1SI9A 4QOTA 3JSRA 4RBUA 3NS7B 3CJRA 4NXMJ 3MR5A 1C0UA 1OSCA 3AQOA 4W92B 4CO4A 2IA6A 2ZOMA 2QLBB 3ENVA 2ZNZA 1JLEA 4J91A 4LF6F 3HVRA 2B5JA 4J9LA 2DR9A 3FQKA 2GO9A 3OHBA 3EDQB 1N36F 1N5YB 2HG4A 4Q0BA 5HAOA 1DTQB 1VQ8S 4OYMA 4P2FA 4PG7A 2MKKA 3KKFA 2O5DA 4JV0A 2YKNB 5KFAA 2XEXA 3D1QA 2RDIA 2K1RB 1YRXA 3Q83A 2MDAA 3OL6A 1S0OA 1SIZA 2HYIB 2BYCA 1IKXB 3CB4A 5L9XA 1BD6A 1OYDA 4DZ6A 3DI6B 2H5JB 4A47A 2QX0A 2BE9B 4JV1A 1RKIA 3I4PA 4CYUB 1WG4A 2AYEA 4L74A 4ZP6A 3T6BA 4X65J 3KDOA 1TFYA 1RQ0A 1OY6A 2NZCA 4DUYF 1RXOB 3SI8A 1HW8A 2FY1A 4JUZA 1XQIA 2W9AA 1OS5A 3BSOA 1CQNA 1MWQA 4PABA 2Z2ZA 4L3KA 4H4KA 4IH6A 3IM9A 3MUVP 4C8OA 3HFZB 2JDJA 2NXEA 2R7QA 4DPOA 4DPTA 4TU9A 1UJ5A 1F5BA 3JSMA 5K20B 1RTZA 3R1HA 1RACB 3DOKB 4O3QA 1I6JA 5BYSA 3GR1A 4OJ3A 5DZ7A 2VASA 5KFYA 1HYSA 2IYGA 3MMJA 3T9ZA 5CYMB 3VGUA 3IA0A 2E44A 5BR8J 1S97A 5K8PA 4R0JA 2VPYB 5SUHA 5IV3A 2CVEA 5IOLA 5L38A 1H2UX 2QL9B 2DYAA 4WIIA 1X5TA 1C1CB 3Q8UA 2J9DE 3QWUA 3PHEA 1U0SA 3S8SA 3HVWA 3OPKA 1XNRJ 3CE8A 2MYFA 4R25A 2CDRB 3HJFA 3N4WA 4IYQA 4F50A 3W9HA 4GVBA 1KQGB 4QU6A 1SL2A 2F4FA 1O5JA 2WONB 2YNFA 3CCWA 2IAJB 2KTQA 1F60B 2IM3A 4U95A 3PEHA 2UUTA 3IWXA 4K59A 1KQSR 4ZVRB 3W1YC 1BLUA 2OI2A 4TQSA 2NCKL 4FN5A 1HMVB 1N5QA 3C6TB 2MMYA 2PA3A 4URQU 4QR0A 1M5VC 1HQUA 1YJUA 3BM7A 2FB0A 2ABYA 3T5KA 2CG8A 3FBBA 4NA2A 1C1BA 3CULA 3BBCA 2Z57B 4J9KA 4DCJB 4B3RF 3Q86A 4EMDA 3HCXA 1FVQA 5K8OA 2KG0A 3HX9A 4G1QA 3GSIA 3DHWC 2BE2B 5KFPA 2HVIA 2G4BA 4OFZA 5I42B 3QIPB 1RWVB 3K58A 2VFUA 1JIHA 2KFZA 3KDNA 4RW4B 4ECQA 1SV5B 3AB2B 1I3OB 4X4NA 1UTAA 2PIIA 1T94A 2ZKUA 4HACA 2QC3A 4DR7J 2BW2A 1WF1A 3J80Y 1EKSA 3BS9A 4IRDA 2ZJRQ 1Q7LB 4DV2J 5J2PA 2KYXA 1HBUA 1NSQA 2GQCA 2EFPA 1RT7A 1GX6A 1I1GA 5I3UB 1TTHB 5L1LA 2W9CB 2GMLA 4CTAB 2DNYA 4IR9A 2FLLA 3J7YI 1KTQA 1LWEA 4JI0F 1MU2A 2GGPB 4NLWA 2CJXB 2ILZA 5L1IA 3OR2A 2ASYA 3NGDA 3PY8A 1K1QA 4HT7A 5J2MA 2UXCJ 2H48B 2XLJA 2GA7A 4AUKA 2XYHB 2XMMA 1H7WA 4ETZA 8AT1B 3DN9A 4RNMA 4HEA9 4DX7A 1EKRA 2XS2A 5CYQA 1WC0A 4ES1A 3CCVS 2OIHA 1JLBA 1VRUB 4X64F 1FRHA 4EO8A 1LOUA 1QE1A 4U8VA 1N34F 4DR4J 3V81B 5KFZA 2Z2YB 5D0GA 3HZGA 4FBTA 2QG9B 3NAIA 1YJTA 3WQPA 3BR8A 4F04B 3PEJA 1CVJA 3EYZA 1LW2A 3C14B 2V4JA 2W1BA 3JTPA 5FDLB 1HNZJ 4R0EA 1UZHA 1T8EA 3SSSA 1OSDA 2IDEA 2W24A 3Q22A 3TZYA 4U7CA 4B9NA 3ONQA 1XR5A 3I0RB 1Q8LA 1A0OB 2JEGA 3M8PB 4MFBB 5KFJA 4F3OA 2FUG9 3MR6A 4FYWB 3AA8A 2HNDB 1PGZA 1TKXB 2PEHA 1V3ZA 4WP3A 2EBEA 3BGRB 2VF3A 2KFYA 4ANDA 1JLCB 1H2VZ 4NYOA 1YJ9S 2HEKA 1U02A 1FXDA 1VQ9S 4QJVA 3BBBA 3OLBA 3UCUP 2IC3A 3BGLA 3MM5B 2AKWB 4M1KA 1HKAA 4U9RA 3M9NB 2PC6A 1XK8A 2QLFB 2CQ3A 1ZPWX 1G1XA 4FKYA 1FFWB 2MKHA 4F2SA 4QYZK 1T9YA 1R3NA 4N56A 3HT0A 2R7SA 4WU2A 5HBMB 2PSZA 3DLGA 4PRFA 3SQGA 2JHEA 4R5PB 1B7YB 1RHKB 3IM8A 4K4WA 2BJDA 3FZ2A 5CYJA 3M8QA 5C42B 1GTHA 3D28A 2ZITA 1FF2A 1HNVA 1S9FA 2LA4A 4ECYA 4M5HA 1RI7A 4YB7A 2XS5A 2R2SA 1QLNA 5DQIA 4OYPA 5EN1A 1PBAA 2QYGA 1FJ7A 1FKOB 4JOUA 1RDRA 1CC7A 4PXDA 3BGUA 1W7WA 4DUZF 3KHRA 4DEZA 2IJFA 4JI1J 3JSYA 4O4GB 4OYXA 3PR5B 3BB5A 3UD5A 4IRCA 4PWDA 1H0HB 4F4ZA 1F9FA 3QLHA 5DGAA 2DGVA 2CA9A 4HL9A 4CO0A 4I67A 3K2YA 4V1Ak 4LF2A 2CVIA 1WTBA 2FQQB 2XY6A 2DGWA 2KJWA 3KLHB 1NK7A 3UPFA 4HH1A 3R5JB 3C46A 1KRPA 3VQTA 1S9GB 1R8PA 1NM2A 5KG6A 3U1LA 1KEKA 1F2HA 3N6MA 3HI9A 2LU2A 2D69A 2HLUA 3HLUA 4Y0FA 1Y7PA 2QO3A 1H72C 1VJWA 3AJDA 4DX5A 5B0DA 3HM9A 2IRUA 3K5PA 2W9BA 4ITSA 1P9YA 4B02A 1EETA 3BSNA 3LP1B 5DDRC 3P4UB 3R2CJ 1KN6A 5A8KA 2CUYA 4QPTA 2ZUGA 1KHVA 2YWEA 3BR9A 4HR2A 4CLPA 1EZZB 4PQAA 1WC1A 3LTOA 1K0VA 5B0AA 3QGGA
chains in the Genus database with same CATH topology
2DTJA 3S01A 4ZVGA 5E3AA 1MMLA 1MROA 4X84A 2LXIA 1FE4A 3AH6A 5KFFA 2B4OA 2MY8A 5F8JA 1IQTA 2E1AA 1SKRA 4Y2MA 1B0TA 3W3SA 4TXSA 1R0AB 1TV6A 3L09A 1NK9A 1X9WA 4QWDA 2XZWA 3I87A 4P7VA 2YWFA 4IUFA 4U6PA 5HO4A 1WG5A 2WW8A 1LXNA 1RISA 2F1FA 5IS2A 4ZPBA 1QSYA 5J2PB 5KG1A 4ZVHA 4YFUA 2ZZNA 1HBUB 4ILRA 3MEKA 3TW0A 2VONA 2LQJA 4BS2A 2HMIA 3HMJG 2W4PA 3MD1A 1RT7B 4LF5F 2IM1A 2IRXA 4LMZA 2KXHA 3DXBA 3WBZA 3G8SA 1NKCA 4TU7A 1X8DA 1SJ4P 1D9AA 3MI7X 4FPRA 1QSLA 1RK8A 2ZE2B 1MSWD 3HHNB 3G96A 1NHUA 2FJXA 3I9ZA 2J6SA 1KD1T 1T03A 4AL6A 1HNXF 4IKAA 3UR3C 1LWEB 4X62F 4KJIA 2DNLA 4EO6A 4OI6A 2MZ1A 2FD2A 5D4PA 1FJGF 3OL7A 2IA0A 2B4PA 3P6YC 4AYBD 3PNIA 5LXYA 3NCRA 3DU5A 2VL1A 3OR2B 2AGQA 3EPIA 4ED8A 2OPRB 3I5AA 1YGYA 2ZJQQ 5J2MB 4QCLA 3G86A 2DCUB 2J7UA 3NS6A 2L41A 2EWHA 2M5YA 1XMBA 3SSQA 4DLEA 3DRRB 1D3WA 4Y2KA 5KAKA 5L8RC 4HTJA 7FDRA 4KHRA 4DLGA 3H59A 5HMZA 2XMJA 4LSNA 2J76E 1KOHA 2J9EA 5I3PA 3OLAA 3IRXB 4YOEA 2CPEA 3MMAB 1X9SA 4X4UA 4HHJA 4C11B 2VV5A 3BZQA 3OXFA 4NXMF 3KK3A 4UW2A 4YB5A 2ZH6A 1X4GA 1JLBB 2CQIA 3MWBA 1RTIA 4IDKA 1O51A 1VLYA 2XBPA 2CPZA 2YY3A 2UV8G 2HHVA 3OSPA 2UVRA 1MNEA 1TL1A 3FGVA 3FRYA 4DL2A 2E5LF 3EXCX 1IKWB 2MKSA 3OVSA 5C5JA 4MK7A 4GO7X 2KXNB 5DQGA 5B7WA 3V2UC 3A1YG 1FEHA 4UOCA 3PX4A 2KYZA 2VKRA 3CGIA 1SL1A 4PWUA 3S1TA 1J2VA 2DNRA 2CIMA 3ETOA 3CCTA 3FQLA 2N7YA 3DHXA 1VOMA 5KFUA 3KK1B 2YNHB 2C2EA 3QAEA 4HLBA 1UJ4A 1U7LA 2ZVSA 3UCGA 4DQSA 1NJXA 3EPGA 1VIXA 3EUNA 3ZZTA 4RZRA 3QO9B 2M4MA 5HMWA 1JLQB 2W4CA 4L6V3 1V9OA 1P9QC 2JRSA 3SV4A 2VOPA 1REVB 4TN2A 2ATLA 2JSXA 3MPVA 1UVLA 1LW2B 1JJ4A 3M2VA 3SV3A 2R7VA 1R27B 2V4JB 5DLFA 2FHMA 1B7FA 1RT5A 2WB1D 5KFBA 4P2SA 3M8SA 4HKQA 2MHEA 3RTVA 1DURA 2VUGA 1UFLA 2OFGX 4IQXA 4I4BA 1TUVA 1NJZA 1H38A 3PX6A 2XWXA 2CQHA 2XSJA 1CG2A 2E5JA 4ED0A 2W7AA 5D3GA 2FLPA 3DMJB 1NK4A 5KFGA 4YQWA 4X4TA 2CQCA 4FBUA 4QWBA 3CD7A 4ZA1A 7FD1A 3KHLA 2LQ9A 4NOHA 3WC0A 1HL6A 4AL7A 2N3LA 4B9LA 4IG0A 3IBWA 3VCDA 4DFPA 3M6XA 2Q79A 2VODA 4PXBA 1B0VA 1Y00A 5KFMA 3DOKA 3MM9B 4KV8A 2RRBA 3MAHA 1RT1B 3FMBA 2B43A 4I68A 2OPPB 2FLNA 2ZBCA 2YNIA 1HARA 2DHXA 5DO2A 3HVTA 3P96A 2B4UA 5IM0A 1LW0A 3UQSA 4Y65A 3VZHA 1N54B 3G6XA 4CH1A 2FHOB 2CJKA 1URNA 5F9LA 4DQQA 1RGVA 5T14A 4ZOSA 4G6VB 3K5MA 3C6UB 2KZMA 1J5OA 4LF7F 2CJBA 3CEDA 4Y00A 1G3OA 2LDYA 1S6PA 2P6TA 3IO1A 4XAKA 1DQAA 4D3HA 5KT3A 2RS2A 1RTHA 2DJWA 4DS4A 4QW8A 2NYIA 1C2PA 3KLIA 4UUWA 2JEJA 2N4CA 2J8AA 4J9MA 2PT0A 3QGHA 1Q16B 3HVAA 5CYMA 3AAWB 4NCGA 1VGYA 4CNYA 5F8GA 2KM8B 3MFHA 1SXLA 3RBEA 4USHA 5A0YA 3MECA 4J9SA 3FZBA 2I5JA 1RYSA 3O8WA 1QVGR 4X65F 1XTZA 4B9SA 3IR5B 3I5BA 2BM1A 3MUMP 1XR7A 4A8YA 4ED5A 3H4DA 1TKZB 4NL5A 4GKKF 2RB7A 1HQEB 2HNZA 2LA6A 3AA9A 4OZ0A 2Z4PA 4DDFA 5EDWA 4KSEB 4Y28C 2QSWA 4MIAA 3AJ1A 4L72B 1KTVA 1U25A 1C0UB 1HA1A 3TX8A 3R5DA 3NG8A 5DG8A 4ECWA 1S4FA 4I69A 3HZEA 2A1BA 2JZ5A 2UUWA 2VC0A 2OSRA 1DBDA 2BQRA 2PFFB 3K8VA 3I31A 3U27A 5L39A 3MUTP 4A8XA 2MPUA 4C8MA 3DLGB 3EZUA 3ITHB 1BQNA 2GMHA 2HRYA 3MCSA 4ECXA 4MK9A 2HHXA 3IFEA 2YKAA 5F8LA 3GFHA 2MQMA 2AYBA 3M2RB 4RLEA 2V8DA 4D3GA 3O44A 2GJ2A 1EP4A 4I2PB 4LIRA 2YNGB 3M8QB 1KVJA 2CPJA 2BANB 4Y34A 3BJYA 1JX4A 4PKDB 1MWZA 2AYGA 2B5JB 3MMCB 5GAEU 3OTEA 3NAHA 2MKCA 3Q23A 1HNVB 3IS9A 2XCPA 2ROPA 4DOZA 3GILA 4DQIA 1WELA 2V4RA 4OHXA 1IXKA 3TAMA 2QE5A 2MQQA 2XGPA 3TAQA 5K9FA 4XPCA 2LLZA 1OPZA 4CT9A 3CCUS 5HP1B 2B9YA 4M8LA 3BO3A 2XY7A 4O3SA 4DV5F 4Y2IA 2GHWA 4FP9A 3DFEA 4LQ3A 2ZDPA 2HHUA 1URRA 2IAJA 4IOAQ 2RILA 3PR4A 5BYRA 3OTDA 3CCQS 5J2NA 1VC5A 1HNIA 2W25A 2C42A 3M4XA 5EWFA 3SDEA 3MEGA 2J5AA 2KHDA 3E51A 2K3IA 2P9CA 2F8EX 2VG7A 1WEXA 5F8IA 1VQ6S 3ZZ0A 5K14A 2V9KA 3OXGA 3CCJS 1K8AT 3GV7B 5J1EB 4WFXA 5DRKA 1FE0A 2R4FA 4AXIA 1CC8A 3PW7A 4MKYA 3E2EA 2L9NA 2MJNA 3O1LA 5B0CA 3TA2A 1HBNB 4PQUB 2D7SA 4CZCA 1S1WB 2BJEA 5FJ4A 4N8NA 4EYHB 5D78A 3HKZD 3OXLA 2ZHAA 1JLFB 1FRMA 1UVKA 5KT7A 3C6TA 3W2WB 4ATNA 3CJKB 5C25A 4YUDA 1TKTB 3V4IA 3GFZA 2ZD1A 1TL3A 3TRGA 3MFIA 2WCXA 1FHTA 3QLHB 5KT2A 1DHMA 5DM6Q 4RNHA 2CZVC 1R8HA 2FVQA 2XB2D 3NGKA 2GW8A 3D54A 3OTBA 4IFVB 4TLQA 1DTTA 4J9RA 5DETA 2R8KA 2PMHA 3PW4A 3OUYA 3Q2SC 2A3JA 1DZ5A 3IRWP 1RAJA 2OLWA 2Y0SD 2AD9A 2W8LA 4DJBA 4K4UA 2ZHOA 2DT9A 1FRLA 4J9QA 2N3OA 1R7IA 1XNRF 1UETA 2EC0A 1L3SA 2E5GA 3TUIC 1ZPVA 1R31A 4OMFG 2CQPA 4OHVA 4U67Q 1HI8A 3MM6B 1QSSA 5C24A 2O66A 2GJIA 1JKHA 4ES3A 5AE3A 2R2RA 1H7XA 3DDKA 3FFIB 4ZHRA 3Q8QB 1RTDA 4F4XA 3PV8A 1N33F 4ZPDA 4K4ZA 4TKTA 1VQOS 5EX0A 4WXOA 4WFBQ 3QIPA 4ZVEA 2J7WA 3MEDB 1IBLF 2QV6A 3CDWA 4ETXA 3PDNA 2ZNYA 1NKEA 2YX4A 3PO4A 1L3TA 4KGMA 2KI2A 5CCMA 1UFWA 1JLGA 1VMBA 4DBQA 4I6YA 1U6ZA 2GQQA 1VQSA 4ZP8A 5AXLA 2A2DA 1SV5A 2M2BA 3K7RA 3NWGA 5F41A 3G6VA 2UVUA 4A8FA 3DOLA 4BCAA 4IH5A 2KM8C 4O44B 1OQ3A 1DARA 2XULA 1ZH5A 2R8JA 2W7OA 4UY85 2IVMA 2C28A 1N4LA 3BF4A 3D0GE 2V94A 4N47A 2IVYA 3JSMB 3KFWX 1R8AA 3PKMA 1WI8A 2Y1IA 3I0SA 3GIKA 1JXLA 1VQ5S 1QUPA 5CH7B 1P6TA 2FJVA 2Q43A 4LF9F 2W9BB 3JSBA 4Y2AA 5B0FA 2LU1A 2YKMB 2MHNA 1IR0A 1WEZA 2V8VA 2VZ9A 5T41A 3T1HF 2RF2A 3KJVB 3NKYA 2XO7A 3I4HX 2RQKA 1S0NA 1FRKA 5IT0A 3LH2S 1QAIA 1EETB 3LWMA 2UUAF 2B4VA 3H5SA 4NX9A 3BO4A 1FKAF 1S76D 3GIIA 1F2GA 4ICLB 1S1TB 2E7XA 4KFBB 2VQFF 1NJYA 3GG0A 3OR1A 3DDNA 5I3QA 4RW9B 4YB6A 2AJ0A 5AXNA 1HYSB 4QYZJ 4CTAA 2D3ZA 2QMXA 4QQBA 4HTIA 2JWNA 1R43A 3BQ1A 1FD2A 5KT6A 3M6UA 3QPIA 5IWAF 3G6YA 1M1KT 1OQ6A 2MZTA 3HKWA 4IQMA 5EUHA 3CXCR 1FKPB 2VC1A 3TUJC 1NEEA 3QGIA 4DX8H 3OFFA 4JV5F 3ZZYA 1S6QA 1TL4A 1VFJA 3QZ7A 2DVIA 3EGZA 1MROB 3H2VE 3S7RA 4ILMA 2BV3A 4NCAA 5D4LA 2VQEF 3NMAA 3FCHA 1YIJS 1C0TA 1TV6B 3JYTA 5DM7Q 4L3NA 4B9TA 3HO1A 1FXLA 1B64A 1SJQA 4H4OA 5GAEI 4OZNA 3MR3A 4FXVA 5LXRA 2NPIA 2U1AA 2R8HA 3K5LA 2UVWA 5K8NA 2V9WA 4AE5A 3DGPA 2R8IA 2PI4A 5EHHA 1IJEB 2OPQB 1GTEA 3RW7A 2J0XA 4RX6A 2XMVA 1SH2A 2DNMA 2F9JA 5AE2A 1CLFA 2WOMA 4RW8B 2X3GA 1HBMA 4WE1A 1JMTA 2ZKTA 3DC2A 2NPFA 2DRBA 1T95A 3DRSA 1YSJA 2R9LA 3GSDA 3MMBA 4ID8A 3OFHA 4Y6IA 1BQMA 1DLOA 2HPUA 3OFGA 1U1PA 4C98A 2HHQA 4HDGA 3RB3A 4NXNF 1T03B 1T3OA 2ZH9A 1G2EA 4FVCA 2KVIA 5KFOA 1WWHA 3M9OB 4JI3F 3M9MB 4QYRA 4OL8A 1WEYA 1LKZA 3BDEA 5E3RA 4F4YA 2IBKA 1UVJA 1Q1KA 1RA7A 3CSKA 2XGQA 3HHKA 3GE9A 1FRJA 2VPWB 3HHLA 3V81A 2WK4A 2ADCA 3LGMA 4Q8FA 3LUYA 4ZCMA 2YWKA 3MTJA 1Q8IA 4RUHA 5KFLA 4DR7F 1VQPS 1QAJA 3HHLC 2F8HA 4MYUA 4B3OA 3PFOA 5HQ8A 1KC8T 4UY8T 1TVRB 2DH9A 3H40A 5D4OA 3CCLS 4QR2A 1F5AA 2QIFA 3KWMA 2LECA 4X4RA 4YB1P 4N5SA 3TANA 1Y3KA 2P9GA 4CO3A 1AROP 2IMWP 2YWGA 3DLKB 3O6QA 4LSNB 3VAGA 1VIOA 1XC9A 4A48A 3D1HA 4YDDB 5FDLA 5KFCA 4NLSA 1RP5A 3H20A 2BDPA 2FDNA 2DNPA 2B6AA 1QJHA 2ZH1A 1D0EA 5KFTA 4ZMMA 5GAGU 3QWPA 5HMYA 3US5A 1RTIB 2QSFA 4IDKB 2F9DA 2CQGA 4MIWA 3HP6A 1WF0A 1TL1B 2XSFA 1HWLA 2DNQA 4Q7AA 1FNMA 2FC9A 2N4DA 4KR0B 3TNVA 3CC7S 1A6LA 1X4EA 2ZJPQ 1L3UA 1P1TA 1FERA 3QJPA 2VG6A 2OTJS 2KFNA 2LXUA 3DLBA 2NR0A 4EYIB 1TZ0A 2RDJA 3JTOA 4MFBA 2RIJA 1HBOA 4I7FA 1HI0P 1HQUB 4CO2A 3GV8B 2QLXA 4RBTA 1VRTA 3CCMS 3RAXA 4WJBA 4DV4F 2UZAA 2UXCF 2D1CA 3F41A 1TKXA 2V0NA 4OJ1A 4CT8A 3DOMA 1ZAWA 1S9EA 1RTJB 2P9EA 2EFNA 3N6NA 1GH8A 3SFUA 2VFSA 2HFZA 1FA0A 2Q1LA 3GFXA 1C1BB 2AQ4A 3M2VB 4R8UB 3ZC4A 3S6EA 2HGLA 1ZZFA 4UQGA 2KH9A 3X1LB 4C3MA 4Q43A 1SJ1A 2GNKA 3PX0A 2BM0A 4YP3A 2PDAA 2Y1RI 3RU0A 1V6HA 3H8YA 4NWBA 4USIA 4KRWA 2R7WA 2XSJB 4WFYA 4C4WA 2B9XA 1DFDA 2Y1JA 5D3GB 1VQYA 3OVAA 2R2TA 4XIUA 2UV8A 1S0MA 1FJCA 2L48A 1AW0A 1APSA 3MM5A 1ZZNA 3FEZA 2WSEC 1SQEA 2KT2A 1NH7A 3X3UA 2NLWA 4OI2A 3Q2TC 4IG0B 1R89A 3VZIA 2GV1A 1Z4UA 4DR4F 2ZZMA 1K73T 1AUDA 4KV8B 1ZETA 4C8ZA 3CC2S 1IKVA 2JLEA 4JI6F 1FDBA 4NLGA 1ZBTA 2YNIB 3BN7A 3O5TB 2E5HA 1HPZA 2RH3A 4DV6F 3L95X 4QBUA 2CQ0A 4BWJA 1FNXH 5DGBA 3ZFVA 1X4BA 3SCIE 3NL0A 1SB6A 2HS0A 3MDFA 1XWLA 2CQ1A 3P3DA 1FD8A 3IGNA 1ZM4A 4ZLPA 2DR8A 2OH2A 1T3NA 1KOOA 1X4FA 3CD0A 3TI0A 1J5OB 1Q79A 2U2FA 4Q2MA 3Q0AA 5FD1A 1S6PB 4B3MF 1GX5A 3V6KA 4DL3A 2QA2A 4H54A 2J6TA 1RJJA 3N01A 3SFGA 2KDOA 1IM4A 4LF8F 1UMJA 1YITS 1ZTWA 1HNZF 3KLIB 2VBYA 1H98A 3DRPA 2RJZA 4FNIA 4FS1A 3R1LA 2VBWA 4K4SA 5CCLA 1E6YB 1LQ9A 1MWYA 4OQJA 3FEXB 4QWAA 3VAMA 1WHXA 4WZMA 2D41A 2XHWA 4G1IA 5A0YB 4BDPA 3MECB 4PR6A 1X4HA 1FK9A 2I5JB 2I2YA 4EZ6A 1FDAA 4FVMA 1UWBA 4OHWA 3VTIA 1M90T 2WRMA 5F3ZA 3POTB 2IBOA 2B7CB 3I32A 2JH3A 1TK5A 4C0BA 5JVGQ 1N5YA 1D9DA 1YRTA 2RT3A 4IR1A 1U1KA 2GCFA 2HNZB 4DR2F 5DQHA 4OI1A 1KSPA 1MMDA 2MZQA 2OPSA 1DTQA 4LSLA 4IOBA 1NK0A 4PG8A 2LEAA 4N76A 3TAPA 3CD6S 3Q24A 3LP0A 2VKZG 2ASJA 2C2RA 1NU4A 2JLFA 4O4RA 5E5NA 1N88A 2FHJA 2JC0A 5JJBA 2X51A 4LVNP 4EBDA 2YKNA