1VFJA

Crystal structure of tt1020 from thermus thermophilus hb8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVTPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords nitrogen regulatory protein p-II
publication title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
total genus 24
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vfjA00
1PILA 1V6HA 3O8WA 4YB5A 1Q1KA 2ZOMA 4ZK7M 4USJC 1O5JA 4CNYA 3T9ZA 4CO4A 3AA9A 3TA2A 2RD5C 2EG2A 2E66A 4CNZA 3AH6A 3OPKA 4NYPA 5L9NA 3M05A 1V3RA 2NS1B 2XULA 2J9EA 4C3MA 2XBPA 1HWUA 4CO3A 2XG8A 2NUUG 5D4NA 4CO1A 4YB7A 4D3GA 1QY7A 2NUHA 1NAQA 4Y6IA 4WK1A 3NCRA 2J9DE 2XZWA 5DS7A 4CO5A 4CO2A 3X3UA 1OSCA 4OZNA 1GNKA 3AA8A 5D4PA 5D4OA 4RX6A 4C3KA 4D3HA 3TA1A 1UKUA 4RWXA 2JJ4D 4WK3A 4USIA 3LF0A 3NCPA 3DFEA 3HLUA 4AFFA 1O51A 2O67A 3MHYA 3CE8A 1KR4A 2PIIA 1UMJA 2O66A 1NH8A 2V5HG 1VHFA 2GNKA 5DRKA 4NYOA 4E98A 5D4LA 2GX8A 1J2VA 3N5BA 3AHPA 4R25A 1VFJA 4USHA 1V3SA 1P1LA 2CZ4A 2EG1A 1UL3A 1NZAA 2ZFHA 2VD3A 4OZJA 3TA0A 4Y65A 1XK8A 1UFLA 4RWWA 4IYQA 4RLEA 4YB6A 4C3LA 1NH7A 3NCQA 2J9CA 1H3DA 3GSDA 3O5TB 2GW8A 2J9DA 4OZLA 3L7PA 1V9OA 3BZQA 4CO0A 2DCLA 2Z0GA
chains in the Genus database with same CATH superfamily
4WP9A 4FS2A 3PO4A 3TA2A 5F8JA 3TZZA 4LF7F 4L73A 4B9UA 2QYGA 2J7WA 3M30B 3TZWA 2M2BA 3M2RB 3P4UB 1F5AA 2ZZMA 3D9BA 3IS9A 2HHSA 2GJIA 4I1TA 3SQOP 4K4YA 1VJWA 2GIQA 1S6QB 1NUEA 3H2UB 2CQGA 1XQIA 1AW0A 2RQ4A 4Y2CA 3C14A 2J6TA 1L3VA 5KG2A 5CYQB 3TUPA 2MGZA 2CVEA 3EX7B 2VBWA 3MUTP 3W8GA 1UCNA 1U24A 4LFCJ 1T9YA 2FJEB 4NYZA 4OHVA 4FYVB 4KHRA 1S0MA 4YY3J 2W2NP 1SV5B 4WP3A 3DI6B 2QFIA 4X4NA 4GO7X 2QRRA 2MQOA 3MZIA 3KUGA 2BW7A 4EK2A 2GFFA 4LF5J 4O3PA 2DNPA 1YZ7A 1LV5A 2A2CA 4DV4J 4TYAA 3DLLQ 3NMRA 3HD1A 4DL0C 4JUZA 2EG2A 3G6VA 3R5GA 5E5NA 3L3CA 4F4WA 1SQEA 1IVZA 3EMTA 2DXDA 1ZZNA 1KC8T 4X4TA 3HZGA 2YNHA 3LP0A 4S0MA 3FRYA 1QAYA 5HQ8A 4DV5J 2QV6A 4JB8B 4NEZA 1VYAA 3IM8A 5J1EA 2OTJS 1C4CA 5KOWA 3R97A 1YBUA 3HDSA 1NBEB 1OQ6A 2K1RA 3RB3A 3RAMA 3HULA 1KR4A 1HQEB 2RS2A 2R2TA 3KJNB 1IM4A 3SBMA 4JI8F 5E41A 2EG1A 4I7FA 2V8HA 3QRQA 3S1TA 4DX5A 3TA0A 2JDJA 2LA4A 3N01A 1MU2B 3TAMA 4CRJA 5GMKa 3HD2A 1RACB 2HMIB 3H40A 4V19J 1Y9OA 2XO7A 5J2MA 1VQ4S 3P3DA 3LTOA 2WONA 1YJWS 3TQ1A 1IKXA 4JI0F 4MFBA 4RW4A 1RHMB 1U0SA 1P8GA 4KKOA 4U8YA 2FJVA 4UT4A 1ZPVA 3OFHA 2OPQA 4QJVA 5EWGA 4ETZA 1LFPA 1WUUA 3RW6A 3CD6S 3E51A 3US5A 2D3OR 3M6WA 1N33F 2ZBPA 2NXEA 3PNIA 3MD1A 2DT9A 3TAPA 3FUYA 3GONA 3U1LA 3PCOB 2UV8G 1EETB 2V0NA 4NL5A 4USHA 3M8SA 3PW0A 3IP0A 1LEOA 5HL7Q 1FNMA 2CZVC 2H51B 5E3CA 2MLZA 4LQ3A 4RUCA 1KLMB 2HZAA 1S0OA 2JHEA 2AF6A 2GVZA 2V94A 2IM1A 2JC1A 2MYFA 2PSZA 2E7WA 3M7VA 1U2RA 3HHLD 1DTTB 2UXCJ 2BR0A 1OPIA 4O4RA 1HWUA 1IR1A 2GIRA 4L72B 2MY7A 4Y6IA 3T1YF 4CIOA 1LXJA 2CQCA 3WX4A 2BA9A 2P5VA 1RZMA 3QGPA 3PIPQ 4KGVB 2B51A 3HCXA 1F3FA 3MR2A 4RU9A 2C3MA 1IWAA 1X4GA 1HR0J 4B9TA 3OTCA 4IH6A 3DOMB 1HPZB 4FPIA 4DR4J 4AXIA 1RT1B 2WSCC 3MEDB 1C0UB 3TUZC 2PD1A 1SUQA 4DQPA 3W60A 5AJ3F 1SBRA 2DNGA 4HVZA 3J7YU 1RWKB 3A3PB 3N5BA 4RNFA 1HNXJ 1X4HA 2ALZA 3OXFA 5JMNA 2VH7A 2IRYA 2D9OA 2RDJA 2BV3A 4WYWA 5ETOA 2VJUA 4JI1F 1T9TA 2XZTB 4NZ0A 3KG4A 4F4KA 4GMKA 2WVBA 3NWRA 4B9SA 4XTTA 4C6AA 3KWMA 3KG0A 3W7BA 4R5PA 1R0AB 4ED5A 2R8HA 5KT5A 5HVHA 1N0UA 2YWEA 4IG0B 2KI2A 3DOLA 2D3ZA 1SC1B 3ZC4A 2ZNYA 4X4PA 4FBTA 4AQYJ 3F56A 5HJXA 3C15A 3JSMA 1KHVA 2D3O1 2W24A 4RJVA 4F3OA 2W9BB 1S79A 2GMLA 1RK8A 3H98A 2R7VA 2ATLA 1RB0A 2CFXA 4RBUA 3IMQJ 2W1BA 3CJKB 4P72A 1R8AA 2LQ9A 1GMWD 2Z30B 5E0OA 1CJUB 4MKYA 4DF4A 1S72S 1HQ2A 2XMTA 3GTYX 2R9LA 4KGXB 5CYMB 2Z2LA 4C11B 2Y1IA 3WX8A 2XSJA 1KLNA 2ZH4A 5HP1A 3PX6A 5IV4A 2HGLA 2J7KA 3C6TB 5LXRA 1S1WB 2R8IA 3I56S 1ZYQA 3TQEA 3SCLE 4FKYA 1IM6A 1YJTA 4PWDA 4OIXA 1D1UA 3MM5A 1NDCA 3SZ2A 1Y7PA 2X1GA 4Z7YA 4IOCQ 2C3UA 1RTDA 1LK7A 4FBUA 2BJ9A 4YS2A 3OLBA 2IRXA 2A3JA 3ZNUA 1DAXA 1DBDA 2K7KA 3W66A 1JLEA 1CG2A 3AY0A 4ITSA 4KV8B 4WKRA 1HQUB 1JLFA 2BM0A 3KTQA 1NPKA 2MTLA 3P96A 3NGDA 1JLAB 3KK2B 2DGOA 3I4PA 1RKIA 4DFJA 5KFEA 4J9MA 2KT2A 3SSQA 2IDEA 1FFGB 2WAQD 3UCUP 1IBLJ 1Q5VA 5KFTA 2C1EB 1A0OB 2MXYA 5AE2A 2I5JB 4O3RA 1NHVA 2HPUA 2AX0A 2BUNA 1T05A 2V63A 1WC5A 4EFAC 4B9LA 3HK2A 2DY1A 4YEAA 1JJCB 1HMVB 1HIYA 5LL6d 3QLHB 3IBCB 1IJEB 3MM8B 2ZHBA 5K8NA 5L1KA 1XMBA 1KSPA 2YH1A 1T9XA 3N79A 4HH0A 4M63A 2RU9A 3CIMA 5KFUA 4B3MF 3BKTA 1CJKB 1NB7A 2MKHA 4LRFA 7FD1A 1FKOB 1JLCB 2XMWA 1UKUA 2DD8S 3GB0A 3GLJA 1AT1B 1YDLA 2A6OA 2J6UA 4B3OA 2I0XA 1WC1A 2B3TB 2RHSB 2HVEA 1QSYA 3UQSA 5D6GA 1CS4A 3M1VA 1ICEB 3MEGA 5J2QB 2C2KB 4LT6A 5EWFA 1MMDA 1WC0A 1ZAVA 3FEXB 1LFWA 4HACA 5K8PA 5C2CA 2B4OA 3HVAA 2AZ3A 2UUBJ 3M2VB 1NDPA 4OL8A 2EWHA 1VQSA 3HHKA 2J8SA 2OO4A 5A0YA 2EBGA 5KFGA 4I6YA 3W9JA 1WSRA 2ABYA 2VQEJ 4RR5A 1X9SA 2M88A 4BC9A 4J9LA 4ZIVA 1CSJA 5EUHA 3HSZA 2LEBA 2OLWA 2RQCA 4DL5A 3UD3P 2FLLA 1REGX 4DEZA 3AOAA 2RVJA 3KHHA 4C8ZA 3PHEA 4FS1A 4HKQA 1ZAXA 3GJQB 1WHYA 4YB7A 1N36J 3M2RA 5D78A 3ZTPA 5ETSA 3RR8A 1HD0A 2AGPA 5CXTA 2HBQB 1FRKA 4RX6A 2MKSA 1S6QA 3A8KA 5KFJA 1NNDA 1OJ4A 1NKCA 2WVEA 4KT0C 1KFSA 2C42A 3AD7C 1HKAA 4OJHA 4FDFA 2ASDA 1W7WA 1HBNB 4YR0A 1KOOA 4UOHA 2OPRB 2LA6A 4CZCA 3HSGA 2GC8A 2YH0A 2OD6A 2QL7B 1PC4A 3GG1A 4P2FA 3WC0A 1RADB 1SV5A 5E3AA 2ZVIA 1WHXA 3J80Y 3KMSA 4CT9A 1UPPA 4KFBA 1VBXA 4PPZA 3OTOJ 3H0PA 3RW7A 1B70B 2LLZA 1CPZA 4I69A 4YFUA 1D8ZA 1PCAA 2FZGB 2VFVA 5HI7A 2HWHA 2XEXA 1ZETA 5IWAJ 4GC6A 1RDRA 1RJJA 2GA7A 1NM2A 1K9MT 4C2MA 4FF3A 4IUFA 4USIA 2AQ4A 1FE0A 3BJYA 1Q16B 2DPIA 4CTAA 5DGAA 4HDGA 2PMHA 4USVA 1RAJA 2H3EB 4CLYA 1NJWA 2IBKA 2G1HA 1FO1A 2V4QA 1HQEA 3NS6A 4E98A 2IM0A 3N6MA 4ZN3A 1VQ9S 1MW7A 4IRDA 2LKZA 1P6TA 1UFWA 4NOHA 5AT1B 1GAOA 2CJKA 3F44A 3EYZA 4QR0A 3I82A 2DEJA 2HBZB 1NDLA 3H90A 4NCAA 1MU2A 4JBCA 1TKDA 1XTZA 1PYTA 4NE9C 4TY8B 3CCRS 1J5OB 2ROGA 5HMXA 3F41A 3SXLA 2W4PA 4PQUB 2WBMA 3SIPB 4QW8A 1NSPA 1TL3B 1K44A 3NAIA 4KY3A 4G6VB 3M05A 4OYAA 1N54B 3VAJA 1X4EA 4RNHA 1KBRA 2GJFA 2OPSB 2CQIA 4MIBA 1FX2A 3W5YA 2O1PA 1FKAF 4NLWA 1UTAA 1HFEL 4ZVGA 3BQ1A 1TMMA 3PFEA 4O4GB 4FYDA 1B0PA 2FHJA 4NLVA 3VALA 4DR6J 4DV3F 4NA3A 2HHHF 3C16B 3CEDA 5C7PA 2FZCB 3BGRA 3GILA 3KK3B 2E1RA 2D41A 1U8WA 2QZ8A 2H9ZA 3NMAA 3OL6A 3KG1A 2AIRB 3GE9A 3QIPB 1S9EB 3D6HB 2IYIA 2DCLA 3LA0A 1B64A 2CQDA 1PBAA 2HQDA 4LRCA 3Q22A 4JI5J 3C46A 4C98A 3VHQA 1V5VA 2HRYA 4O44A 1DTTA 1YSJA 3ADAC 2KM8C 2ZD1B 3GU0A 4I4BA 1FJCA 1TKXA 1K0VA 4CO2A 4QWAA 2FLOA 3HM9A 1QUPA 2HAIA 3OD2A 2CG8A 5F8LA 1GXLA 1JKHB 2FGOA 2XM3A 2UUCF 1UVKA 4NWBA 3DOMA 1SH0A 3OW2R 1RP5A 3NBPB 2CWXA 1HWIA 2CJXB 4C4WA 1BQMA 2BJ1A 3R7NB 1CJVA 1SJ4P 2QIFA 4F0KA 3R9LA 4U9RA 3J7AN 2AEFA 1MLAA 2C2DA 1HBOB 3DLKB 3DLBA 2VA3A 4ANCA 2ZOMA 1U6ZA 2GQCA 3HKWA 2UXDF 4KHPJ 1JJ2R 2CAJA 4Y3CA 3QATA 1F2HA 1R0AA 4J9KA 4ECVA 2MKKA 1CQNA 1S97A 1SJQA 2NUUG 2VDHA 2FYXA 3RBXA 1BGXT 3OL7A 3NNHA 3BPSP 1N0VC 4HH1A 3NNAA 4B9NA 1RT7A 3BSOA 2DNLA 2W9BA 2M5YA 4NA1A 1KQSR 1DLOB 1N6QA 2LU2A 3OVSA 4BS2A 1T0TV 2AJ1A 3I5CA 4MIAA 3H8YA 1S48A 3MR7A 3I0SB 4EWTA 2DVIA 4Y2MA 5E33A 2VD3A 1T7PA 4RBTA 1LW2A 2CNNB 3TP2A 1DRZA 2GO8A 1LWFA 1HNVA 1S6OA 4OZLA 4C11A 5D3GA 1DHMA 2IBOA 3C6TA 3Q86A 2AGQA 2W01A 4HI2A 3Q8RB 1ZTWA 1YJNS 2KDOA 4MK7A 3OVAA 2CQ3A 3W8PA 2DISA 3M8QB 4ZJOA 2KVQE 5ETNA 2OSRA 4LFCF 4LF9J 4J90A 1IQZA 3W62A 4LF1A 5M2UA 1EX8A 4L3KA 4U67Q 4FYWB 4NZ6A 2YWGA 2EI5A 3OR1B 2KKHA 4LF5F 4K4VA 5DQGA 3M8YA 5T14A 4C8LA 4ELTA 5J1NA 7FDRA 3MMCA 4KV8A 4DV4F 1HQUA 4HLBA 4Q2MA 2PO4A 1Y10A 2JEFA 3PKMA 1OY9A 3GFZA 1Q8LA 5L46A 3KK2A 4XIUA 4NYOA 5HAOA 5IC6B 2HNZA 4R0EA 3BO4A 1XNQJ 4KH0B 3CD5A 2C2ZB 3O1LA 1T9VA 4TN2A 4DV5F 5GAGU 2AJ2A 1RI7A 1RTIB 3M32B 5DM6Q 2B9EA 2I5JA 3MAAB 1QAXA 4ED2A 5HQMA 3KLEA 4V19X 1YWXA 3QSIA 1DZ5A 3KYLA 2HKEA 1QDUB 1HMVA 1O5JA 5HN0A 5F8GA 3QBCA 3AA9A 3BBBA 5KFOA 3QLHA 4LRDA 3MM8A 2EC0A 1Y3JA 3V5RA 4E2FB 4UF4A 1ZA2B 3Q8YA 4DS4A 2DKOB 2JLFA 5D4NA 4UTGA 4N76A 1RWNB 1CJKA 4OI6A 4H4KA 1FKOA 2HIYA 4I2PB 3FBFA 3HFZB 3DLGB 2YKMB 2BOPA 1K1SA 1YZ6A 1ELOA 1U1MA 1LWCA 4OYMA 2BACA 2ZDOA 3BSCA 4LR9A 5A8WB 3ZZZA 2ZH1A 4CDIA 4M8LA 3PX0A 4A8WA 3CCWA 4OJ3A 1S0VA 4TLRA 2XI3A 3HFVA 3PEHA 3NCQA 2LEPA 2Y1LB 3OJUA 1RXOB 1AZSB 2ZH9A 1A9NB 2DGQA 3MXHP 4WFNQ 3W5ZA 1YRXA 2VKZG 3RBEA 5LMUJ 2VPXB 1GTHA 4HL9A 3RUBL 4PXEA 1FX4A 2HVZA 4CNZA 3FNNA 3AQOA 1V3RA 2J9EA 3L7UA 3QQCD 4A46A 2CPXA 1BQNB 1P27B 4CLFA 4LBPA 1U02A 4ZKAA 3QO9B 4DSJA 4B17A 2EW9A 5EX3A 4U8VA 3NL0A 1JMTA 2Q66A 2JEIA 1EKRA 1HBUB 1RT5B 1G4CA 2QMXA 4CLKA 3D0GE 3RZAA 2HFVA 1ZTTA 4RL1A 2B0GA 1HBNA 3NS5A 4PXCA 2OPRA 1UVIA 3OBIA 2W2QP 1XMQJ 1T8EA 1UWBA 2GMJA 5IT0A 4M5KA 4QCLA 1VRTB 1U1QA 1B4SA 2F4VJ 3WBZA 4DV7J 4OQJA 3THTA 1HR0F 3T1HJ 3FBCA 4PWWA 4DR4F 1X4DA 1M5SA 2A1BA 1TVRB 1M1HA 5J2PA 2DTJA 4EZ9A 3OJSA 5K14B 1Y4ZB 4O3NA 1NJYA 1Q86T 4CCHA 1R8HA 2E7VA 3MCMA 1K1QA 3CJ5A 2V69A 1WKKA 4RUAA 4W92B 3LWLA 1FFWB 3VAKA 3JXOA 3WHIA 2OGUA 5LMNJ 4NXNJ 3A3NB 1SQFA 3P6YC 4F4XA 2VPZB 2NR0A 1K73T 2W9CA 1E6VB 4G3IA 1ZS6A 2PMWA 3CE8A 3CSKA 1N5TA 1R8PA 4WYLA 4MYUA 3AXMA 4WJBA 3UR3C 4P74A 2KN4A 1Q0NA 2AT1B 3C3LA 4ZCIA 2BW2A 2IA0A 1U26A 2HHPA 1FESA 1F0XA 3VGVA 3A13A 2ZUAA 4AQYF 2C3YA 1SH2A 2LCWA 3LPYA 3GYGA 3D6MB 5HBMB 2VFSA 2MDAA 4WKYA 4F25A 4KIAA 2XLIA 4DF8A 5BYQA 3V4MA 2NSCA 1JIHA 4PQUA 3BF4A 4G1QB 2QA4G 1KTVA 3QT5A 4JV1A 3SDEB 1HHTP 2KT5A 1TL3A 1S4FA 2VDIA 1IBMJ 4P2XA 5J2NB 3OTDA 3KK1B 3POTA 3QFWA 4MIWA 1Z4UA 2MZSA 2VG5B 1O0PA 4O4GA 3T5KA 3NCPA 1YBAA 2LP4A 3CCTA 4ES1A 2CIMA 3C16A 3R5AA 2WVFA 1X60A 4P10A 5AE3A 2KYZA 3VAFA 3KK3A 1BD6A 1Q79A 2ZFHA 5FLXY 2AWZA 1K0TA 1VISA 4DQQA 1S4EA 3PZPA 4DV0J 2F8EX 1U6BA 3NRBA 1OIAA 3QIPA 3PRVA 1S9EA 2BZ2A 2K3KA 3SQGA 2CNKB 3EICA 3CPWR 1OPZA 1ZH5A 4UUXA 4OZ0A 1OYEA 2R3VA 2DIVA 2FUG9 1GTEA 3GP9A 1SPBP 3K5MA 1LK5A 1WEZA 2WCXA 1F60B 2HQGA 2KVIA 4TQSA 3B8HA 3Q89A 5HK4A 4F4AA 1S99A 5GADI 1J5EJ 1SKUB 2ZD1A 5JVHQ 1IBLF 1MNEA 3IO1A 3K8VA 2DH8A 2O01C 3GJSB 2I9SA 4R0JA 4F3MA 3FK4A 4UW2A 2I8EA 5EX0A 1M1GA 2VL1A 1C4AA 1JKHA 3A8EA 1RSCA 1HARA 1HD1A 5KFIA 2E5JA 1M0SA 2CXEA 2O66A 2RH3A 4DL7A 4K4WA 4PUOB 3I0RA 3VR1A 3NBPA 5CH7B 1NSAA 3WQPA 4LSLB 3DGPB 4OZJA 2IPOB 2GS8A 3QSYB 1IBKJ 1IBCB 2MKJA 4DUTA 2CQ4A 4DR7J 4X84A 1JQGA 2H1YA 4JV0A 4ZLNA 1OS5A 1HBOA 4WU3A 5FJ4A 2NXJA 3DLKA 2KU7A 4PG5A 3E2EA 3D7SB 5IV3A 4M5IA 2FVPA 2RD5C 1DTQB 4LBHA 4NYPA 5L39A 4FYYB 1JLGB 4HTJA 1TKZB 1JXLA 3I5BA 4A8KA 1RAHB 2M8DB 4B3SJ 4TU8A 4FF2A 3KXDA 1U1OA 1RCXB 2UUBF 5IT4A 3G6YA 4F3QA 3N6NA 2YKPA 4NLSA 1D8YA 1D0EA 2YNGB 4X66F 3DLEB 1N4LA 1Y5NB 2JVOA 5DO2A 1RCOB 1SJ1A 1DLOA 1WF0A 4A8OA 3CVKA 4IFYB 1VLOA 3CCSS 3HI9A 3KLIB 1X9MA 2AEMA 3GFXA 2P6SA 2J0WA 3GSDA 1IKYB 2GHWA 2J9DA 3MM7B 1WDTA 2LEAA 4ED8A 4QPXA 3RAXA 5KG7A 1VR6A 2Z8QA 4DUZJ 1WI8A 4YHHJ 3H4DA 2IRUA 1VK3A 2KT3A 4KGKA 4KGMA 2GQ2A 5H9EK 2ZH3A 3Q0AA 2FIUA 1U1RA 1FXDA 2G13A 1C1CB 2VC1A 4Z2XA 1ZM9A 2DGXA 3J7A1 3ILJA 4F4ZA 1FJGJ 4ZPAA 3IC1A 3MURP 5KFDA 1FDBA 3DRPB 3MECB 3OR1A 1DURA 2JVRA 3ZO7A 1U48A 1FA0A 3VQSA 4KHMA 3K58A 4NCBA 3BN7A 2QA2A 1FWKA 3OVBA 1RU1A 1TL4A 1RQ0A 1U6FA 3LP2B 4RW6B 1TAUA 1L5UA 3S8SA 3KHGA 2KRBA 1Y00A 3ISZA 1S0NA 2VHGA 1ZZFA 3PYFA 2LMIA 3BH6B 1B7YB 2YWKA 3EDQB 1HW8A 3BQ2A 1RTIA 3M32A 1V9OA 3H25A 3NGUA 4EO8A 2MQPA 2EFOA 4IH5A 3O44A 3BN4A 2W8LA 3HP6A 5HVGA 2B7CB 2Q79A 3ILOA 5LJ3Y 5DZ6A 2UP1A 3IA0A 4KB7A 2NS1B 3UVJB 2PEBA 2MY8A 3RB0A 1S76D 2KO1A 4XPCA 1VRQC 4QPTA 2CPZA 2J7UA 3GSIA 3NKYA 1R8BA 5CZXA 2MZRA 5ETPA 4M5MA 3CIZA 1BWEA 4LR7A 4R8UB 4KC5A 1PC5A 2CPFA 4WTYA 2XCAA 2DGUA 4DR1J 1VQPS 1SI9A 3CXCR 4ZP6A 3K8WA 1U0HB 2R8GA 1FD2A 3FBEA 3AB2B 1I51B 3FFIA 4B3RJ 4KGZB 5L1JA 3CDBA 4C9DA 1CC7A 2CJ9A 3I32A 4FXVA 2DK2A 1RKJA 1C1BB 3DDKA 2BE7D 1AZSA 4H4OB 5CQGA 3O8WA 3GQCA 2QSWA 3KHLA 4DR6F 3ZZYA 2JLEA 5KOXA 3C6UB 4WTOB 3CC2S 2Q6BA 5U47A 3AAWB 2V8PA 1S6PB 1XN9A 2A6MA 5THWA 1YHQS 1BQNA 1XERA 1X5OA 3QO9A 3VGSA 3U1MA 2VU5A 1S1TB 2N3OA 2H5IB 2F3JA 4DR2J 2V4JB 2J76E 1NO8A 3TA1A 5JXSA 5D77A 4DPUA 2B5JB 2M7SA 2XWYA 3TEHB 4JI5F 5D0RA 1UEVA 2BKPA 1SVDA 1U1LA 5FIIA 3G96A 4EYHB 4YQWA 1S7IA 1U09A 5D4LA 2Y8WA 3GCXP 4N8OA 3PHTA 4Y28C 1GQEA 2F9DA 5ITHA 3DRSA 2FQQB 5B7WA 3P8BB 1U4BA 3KLHB 2DGSA 4HHHA 4YB1P 2VV5A 5HMYA 1FEHA 2XMKA 4DL3A 3BGLA 2DHAA 4J5OA 4CWBA 5MAOA 3D4JA 4ZVHA 4ZJLA 1U47A 2ZVSA 3AQPA 5K14A 5DDOC 2KJWA 1CBKA 2ACMA 1BHNA 1VIXA 3J7YI 3RG6A 4USMA 3D6TB 3OUYB 3UNYA 3HVRA 1R0BG 3VAHA 1R0CB 3M9OB 1C0TB 3FMWA 5D4OA 4NASA 3MMAA 4DCPB 1Q53A 3QGIA 3PM9A 3L9ZA 3OV7A 2BJDA 4PG7A 4BLGA 1WG5A 2D7SA 1RISA 2F9JA 4PEOA 4QZVB 1RT2B 1CULB 3MM6B 1E6VA 3K7RA 1QD1A 2AGOA 2DNRA 3RB6A 4CYUB 1VRUB 4GO5X 2QE5A 2VPYB 3PKYA 3MPDA 1VBZA 3CJRA 5G4DA 2W9AA 5ETTA 1UA0A 3R7SB 3D66A 4OX9J 2DR9A 1MROB 9RUBA 1GX5A 2YPYA 4M5JA 1Q81T 4ECYA 3BEGB 1Q7LB 3JTPA 2P6TA 4C8MA 4DCOB 5B0CA 3H2VE 4LSZB 2BX6A 4LF4F 3RR7A 2Q3PA 4XO0A 2NREA 2GAGC 3GCWP 2PA3A 2IVFB 2GHVC 3KK1A 2F40A 4ZCMA 3UDVA 4HHUA 2YNFA 5FDLB 2VG5A 3CCMS 4K4TA 1RAEB 2HQCA 5EWEA 2E1MC 3PJ9A 1WC3A 3BR8A 5HLFB 1F6TA 2FC8A 4F2SA 5AXLA 4QYZK 4CH1A 2IHR1 4RO0A 3IR5B 2OFHX 2XHWA 3ITHB 4LFBF 4X4SA 2HBYB 3CNQP 1YJRA 1NK8A 3TOQA 4I0WA 4H4KC 1HL6A 3WIVA 3NWGA 3LPEA 4ZPTR 3M6UA 5A6PA 3MPWA 3RYLA 4OJGA 3MEKA 4GKJF 5DG9A 1MWQA 2DR8A 1WHWA 2CNOB 5HROA 3HVTB 2EFVA 2YNIB 1A6LA 1TK0A 1XNQF 2XC9A 3CJSA 4CM2A 4CLTA 1PKUA 2V2VA 3G8SA 3M8ZA 2G0IA 1IUJA 2KXNB 4P75A 1H7WA 1TMJA 1I94F 4ED3A 2VF3A 1OO0B 3OL8A 2LVWA 1VHIA 2POKA 1QTMA 3AOCA 2VC0A 4RNNA 4JV2A 1G6BA 3IWLA 3MUVP 2DGTA 4GC7A 2BM1A 2HURA 3AT1B 2FY1A 2R7SA 3MOZA 1YKWA 3W2VA 2V2ZA 4LSLA 2APOA 4WXWA 5KFYA 4EEYA 5LXYA 5BYSA 3O5TB 3D3BJ 2XS7A 3FSIA 4DDFA 4U7UK 4ZVSB 1RLCL 3BREA 3EGZA 4UOFA 1NPPA 1JLBB 4LF6J 4OHWA 2WSFC 3LO3A 4PRFA 2CPHA 4PABA 1VC6A 4OZ2A 4Q0BB 1QUVA 2OJ3A 1NK6A 3THVA 3V4IB 3ENAA 3KLGB 2RQKA 5H1SV 2E9ZA 1TKZA 2R8JA 2EBEA 4CO3A 4GVBA 4LR8A 3EVOA 4KO0B 5DS7A 2FJBB 1IR0A 2DHXA 2PE8A 1HHQA 4USTA 3C8YA 2V6AA 2X1AA 3GV7B 3MPUB 2KHCA 3KHRA 3LALA 2IAJB 2DR7A 2XO6A 5LMUF 2YNGA 3T5JA 3CMAS 3DLEA 4U95A 3O6QA 4X4QA 4ZLJA 5EDWA 3JQJA 1O8BA 2AHOB 4UZBA 4CLWA 3G71S 1QE1A 3LGNA 2IC3B 2MSSA 3DYAB 2OEJA 3HT0A 3KLIA 2GGPA 3CMES 1PJ7A 2YXLA 3TZYA 1RYSA 5DDRC 4ECSA 3ZTRA 4MKAA 1REVB 3MM7A 4C7QA 2Z2MA 4I64A 4OX7A 3WC2A 1RTJA 4X65J 2GQQA 3D3CJ 5KG0A 4CNYA 1OSDA 1L3SA 3G82B 4AE5A 3NOGA 4OYWA 5CD4H 1PSDA 1WG4A 3R27A 1A7GE 4ZPWR 1D09B 3CJ8A 5A6WA 2DYAA 4ILMA 2DITA 1NK5A 2V2QA 1RABB 1HNZJ 2WW8A 1X5SA 1C1CA 3OR2A 3IRXB 1NK7A 4DS5A 2ERRA 4DX6A 3LH2S 4JV5F 1PAUB 2ZITA 2F4VF 4A8QA 5D4PA 3UCGA 1VQ6S 1B7FA 3I6PA 4DV7F 3ZZOA 5G0RA 3MFHA 1XJWB 1S7HA 3HT3A 2VFUA 3K59A 1GFWB 2JEJA 3V6HA 4V1Ak 3GIKA 3H2LA 1NXIA 4B3TJ 2JNJA 3IAM9 4DG1A 3MTJA 4P71A 4LREA 2HK3A 5C2GA 2B43A 4L3NA 3TUJC 2ZOGA 3LP2A 1VDHA 2K3IA 9ATCB 1BLUA 3KJVA 2QA4S 1TKTB 4I67A 4I68A 5KFRA 2GW8A 5LMNF 4NXNF 1RGVA 2QJ3A 2F5GA 2OELA 4EUVA 1TTHB 4PQAA 2CRLA 3PV8A 1Y0HA 2CQ1A 1SCJB 2OPPA 4QU6A 4P52A 3MMBB 3AJDA 4FXDA 3VCDA 2FDNA 1RHQB 4RW7B 4BHQA 2DR5A 3PRDA 4URQU 1YK9A 3MAHA 4MJKA 1W2IA 1EAYC 4LFAF 2PC6A 3QJLA 4O0IA 4QWEA 2ZUGA 2AJ0A 1GXUA 4ZDNA 3HHDA 4WK3A 1FD8A 2O67A 6AT1B 3IWXA 4R8UA 4ED6A 2CPDA 3F0NA 4G65A 4CLSA 2JRSA 2XS5A 2P9EA 1RTHB 4DZ6A 2MEWA 5HO4A 4J9RA 5HSPA 1IBMF 1FVSA 4YMEA 3GV8B 5F8HA 4ZPBA 2HQIA 1RU2A 3BSAA 1IN0A 1ZAWA 1FWPA 1K8AT 3V6DB 3NG8A 4Z37A 2UUTA 1G1XA 1S1XB 5KG3A 1SXLA 1T9UA 4CH7A 2F8MA 2E9RX 3B82A 1ZM4A 5KFWA 5LJ5Y 4OI0A 1M1KT 4BBYA 2XY5A 5DJBA 3IR7B 3Q8VA 1BMQB 5H9FK 1FDNA 2MQNA 4G1PA 3DMJA 3C6UA 1FWLA 2CADA 5IM0B 5BXIA 4DSIA 1T9WA 4DFMA 1SL0A 2AYBA 3FZ2A 5B08A 3ZZRA 4EZ6A 2UZAA 4DV0F 1TELA 3BQ0A 2ZH6A 3GR1A 1RWMB 3M2UB 2I2YA 4AL6A 1ZBTA 2FJDB 3EE3A 3H5YA 1KNZA 2KRRA 2RF2B 3M8PA 2CZ4A 2J0XA 5F8MA 1N34J 4OI1A 4ZPDA 3GFHA 3I87A 2JL9A 2K2PA 2JEGA 4MTPA 4XDCA 5LSOA 3KLHA 5GVQA 1TU0B 4OHZA 1AYEA 3CCZA 4Z7CA 4TXSA 1HNIB 5I3UA 1JLQA 2RUSA 3G6XA 1TL5A 3T1YJ 2G0JA 2DEIA 3QAEA 5F3ZA 2MJUA 4I56A 3GMGA 2IIHA 5F8NA 2CJBA 3IN5A 1UEUA 4F67A 2JSXA 1AFJA 5B0BA 2QLBB 3OUYA 1RHUB 3GIRA 4WCEQ 3K0JA 3MR6A 3EXYA 3P5BP 1IBKF 1HHSA 4P9SA 1VQ8S 3MGJA 3ILIA 3PACA 1FKPA 3LAKA 2KH9A 4QR2A 2QMUB 2MZ1A 3ILLA 4QYRA 5LSLA 1TL1A 1RT2A 4Q2LA 5C42B 2DHSA 2D69A 2M0GB 3AB4B 4DPWA 2YVSA 4AL5A 4C97A 4FF1A 4UQGA 1IKVB 4Q8FA 3DOKA 1BXNA 2A10A 2QC3A 2MZTA 4CYUA 2DNMA 4B3SF 3I9V9 1YJVA 1Q8BA 1PYSB 2HVDA 2RIJA 3CCES 1NH7A 3NS7B 4BDPA 3CUNA 2HQFA 1LW0B 1T02A 3BZQA 3UNGC 4QBUA 3JS9A 2KM8B 3DLJA 2FLPA 2GHPA 3CC4S 3MEEB 1ZA1B 1KVJA 2DR6A 2VFRA 3G8TA 5HMZA 2HFUA 1N52B 2YKAA 2GIFA 2QLFB 5K20B 2C22A 3D1HA 2Y9HA 4RZRA 4WFYA 5HANA 1FF2A 4BCAA 1S10A 3H4BA 1TP7A 1H0HB 3Q8SB 1F5BA 3MD3A 2W2PP 5KFFA 1SKRA 4X2BA 3IS9B 4DUZF 4YHHF 1I3OB 1NHUA 2XSFA 4LSNB 1FDDA 3VAIA 4IG3B 2RNEA 3I9ZA 1VIOA 2OSQA 4R25A 1SQGA 3C14B 3OQ2A 4ZLPA 2XMMA 1U49A 2MGZB 3ITHA 3UE2A 5BJRA 4HR2A 4LVNP 2Y8YA 3S6EA 2ZH5A 3FJ2A 2HHWA 4ILRA 3CB4A 1S1VA 1TQLA 4FVMA 1X4CA 3IXQA 3DHWC 4O3SA 4CO4A 3LGMA 4J9QA 2UUAF 2V8VA 4NMLA 2J5AA 1N5YA 2MZJA 5CZVA 1LQ9A 2ZDPA 2IVYA 3HVTA 5KFXA 1N8RT 1GK8A 2YNIA 2XBPA 3S01A 3OTBA 3FQLA 3T3FA 1IWGA 1KP6A 4I2QA 3EUNA 2XS2A 2AKWB 3VVTA 2FPHX 5KFQA 5GAGI 1Q95G 4DMZA 4DL2A 2DCUB 2J8AA 1BC6A 2P8IA 1VC0A 1T3NA 2IMOA 4AFFA 2RKIB 4JI6J 2X1FA 5J1EB 3D1OA 1MN7A 5C5JA 2AYGA 4DV2J 4HDHA 1GMUA 1IXKA 2HEKA 1YIJS 2HFZA 1RBLA 2K1RB 3UPFA 2MKIA 4C8YA 4XK8C 2E1PA 4OJ1A 2R7TA 2VODA 1H2UX 1WSVA 3CJ3A 3TUIC 3FCVA 1NMEB 3HKZD 4KR0B 2NXUA 2B9WA 2OD4A 1JLBA 3TVZA 2HFOA 3TAMB 1ULRA 2VASA 5LSRA 4RW9B 4Q0BA 1TUVA 3HHLA 3V4IA 5DQHA 2XY7A 3NY0A 4JI4J 4DWIA 5J2MB 3TARA 4YR2A 4KTQA 4WK1A 4NMXA 4KO0A 4E0DA 4B3RF 1FRIA 4MFBB 3MFIA 2YX4A 4RW4B 2EVZA 2HAFA 2ZWOA 3EWGA 2RMLA 2EKYA 4KKOB 1ZPWX 5D15A 1QJHA 4NLGA 2KZZA 4DLGA 3V6JA 2ZKTA 3JYTB 4A48A 3TX0A 3CDWA 3U1NA 3A4TA 3KLFB 1U2FA 3TVYA 4Y2AA 2DNYA 1F9HA 2RU3A 5DDPC 3J81Y 2CPJA 4OYPA 2ZJRQ 2V50A 3OTEA 5DQIA 2DGVA 4M5HA 2GMHA 2Z4PA 4ZN1A 1QSSA 2OTLS 4DR2F 3DU5A 3JSYA 3ET6B 2HVHA 4CH0S 5CA5A 2C2NA 3G82A 1I1GA 2NYIA 1XNRF 3FCWA 2XNQA 2GVZB 4ZA1A 2H4WB 2ROEA 2XWXA 3BDPA 1H7XA 4NLQA 4OI3A 5K8MA 1KTQA 2H5EA 3BPDA 3TW0A 1NPRA 2UVUA 4MKBA 1S9GA 3NLCA 2V5HG 3VF0B 1UVLA 1ZM3A 3LQVA 1I6JA 1KRPA 1RAIB 5DM7Q 2AP6A 2B9XA 2PN6A 1T03A 4ZCKA 4DHVA 1U1NA 1KVIA 1NSQA 2LQ8A 2MPUA 2E1CA 1SUQB 2W8KA 3JB9k 1T11A 2HGMA 1GMWA 2F4FA 4IOAQ 4K2XA 3CTRA 2CQ2A 4DOZA 2QA1A 3M30A 3K5NA 4USUA 2VOOA 3MR5A 1X4FA 1P1TA 1NHKL 2N82B 2PI4A 4IO1A 1F5CA 2FVRA 3Q23A 2M3DA 4OMFG 4FVCA 2DRAA 2WTFA 2MMYA 5CD4A 3ENQA 4PPDA 2CNLB 5CYQA 3W2WB 4FNHA 2P9GA 3EPGA 4OX9F 3DOLB 2ZHOA 4UOGA 4NCGB 3AJ2A 2G1DA 2MHEA 3LOUA 4MMOA 3E3XA 3Q83A 3BYRA 2OEKA 4TKTA 3DI6A 1WHVA 2BOAA 3VAGA 1RTHA 5C24B 2YTCA 3A1YG 3AODA 2C3OA 1VQ7S 1UP1A 4ICLB 2DB1A 2HNDB 2N7YA 1SJ3P 3D0HE 2QL9B 3UW1A 1RWPB 3EGVA 3V6DA 2J9CA 1ZM2A 2FLNA 3FEYB 5JVGQ 3HHNB 4CO0A 4ZP7A 1RT3B 4P2MA 4MH8A 3NGRA 4BWMA 1N48A 1VLYA 3D2WA 2QX0A 2QYCA 4KRWA 1SKWA 4OHYA 4PWDB 3I31A 1JX4A 2R2RA 3MM5B 2VICA 4Q45A 2ZHAA 1HW9A 2BDPA 2W7OA 2WOMB 4NLUA 3K2YA 4RWXA 3GR0A 2VPWB 3DFEA 1YVFA 5F9NA 3EXCX 2VKRA 2ILZA 2K8GA 4OV6A 4ZVOB 4HEA9 4N5SA 1ACMB 4ED7A 1UVMA 4B9MA 1NH8A 2C3PA 2UU9J 4WFZA 1JLEB 2DJWA 1X5PA 1JLFB 2HMIA 3E8OA 2D9PA 4M5DB 1G7CB 3MCNA 2F65A 3W5XA 4UUWA 2CA9A 2RF2A 1F2GA 2MLXA 5JUMA 1AROP 3KDNA 3D0IE 1XR5A 6FDRA 1WC6A 5GADU 2R4FA 1GEHA 1V6HA 1KQGB 3TEGA 2VJVA 2ZH8A 3D54A 3FGVA 2N4CA 2R8KA 2OHDA 4NI2B 2ZC3A 4WWSA 4YDDB 3AH6A 2V67A 3RJMB 3Q2SC 4F0HA 2QEXS 2RQMA 1RLDA 4K4SA 3QNWB 2NUHA 4J37A 4WFBQ 1VOMA 4QWBA 4P73A 2HHTA 5H9FJ 4YUDA 3QRPA 2W2MP 3JTNA 1HBMB 3HLUA 2LECA 1EETA 3MHYA 3QJJA 5KT4A 1RAFB 4LF6F 1HA1A 3ISNC 2BQRA 3QMQA 5C42A 3D5MA 4URSA 5A8RB 2U1AA 2BE2B 2KG1A 3L09A 3JQKA 1UW9A 1KLMA 4ECUA 4B3OB 1IKVA 1WELA 2NQPA 2BKNA 4WF9Q 1CS4B 2DNQA 3X1LB 1N88A 1QVGR 3MCOA 4O3QA 1NSKL 2BRLA 1LW0A 4M94A 2Y0SD 2CQ0A 3EVWA 1Q4RA 2WSEC 4NLYA 4H4MB 2GZOA 2DNOA 3C19A 3DRRB 5A0YB 3FBBA 2M9KA 3R7BB 5ETVA 5ETLA 5KFPA 3SCJE 2LXUA 4MKVA 3ZTOA 2KHDA 1HPZA 4AD6A 1PAEX 1RT1A 2VBYA 2XI2A 2KJVA 1UPMB 3MEDA 3CJ2A 1C0UA 4OV1A 2WRMA 1H72C 2M8HA 1FJEB 2HWIA 5AXKA 1NEEA 4KYZA 5KFHA 3R2CJ 4X65F 1BWVA 3BDEA 2FJWA 1TZ0A 1U1PA 4LSNA 3FKBA 4IG3A 1NB2A 5B0DA 1UL3A 4F2RA 1RE1B 1HNZF 1VS3A 3M6XA 3EJMA 2VA2A 1M90T 1VMBA 3M6VA 4U96A 2DHHA 3ZZPA 4IG0A 4OYBA 4TNOA 4QU7A 3FRZA 1KONA 3NXZA 3UD4P 4EGLA 2PEHA 4B3TF 2JWNA 4JI3J 4KFBB 2GCFA 1SIWB 1DQ9A 4Q43A 2HLTA 2DNKA 2X3GA 5A76A 3EGWB 4J9NA 3OXLA 3Q8UA 3MI7X 3CJKA 1X9WA 4K8RA 2DXFA 2VG6B 2HHUA 3FMBA 4DLEA 2RKIA 5RUBA 2FHMA 1CJUA 1RBAA 5CCLA 2CQHA 3T41A 5CYMA 1TK8A 1X7VA 4CTAB 1R8CA 1R3NA 3KLVA 1S1WA 3QT8A 4PG4A 2E9TA 2IMWP 1XMOJ 4O3OA 3I96A 1HNWJ 3PYDA 4RW8B 2KG0A 3GYNA 3W61A 2V9WA 2HFNA 1RT4B 1SL2A 1TUGB 3BSNA 2H54B 2RB7A 4YY3F 4K59A 5L9XA 5KFBA 1T94A 2YKNB 1Y11A 3BGUA 4EO6A 3CDUA 3FVYA 4RW9A 2B9YA 3IR6B 3PIOQ 1GX6A 4IKAA 4JYAJ 3CC7S 1WD6A 2RRAA 1JLAA 3X3UA 3HX9A 4K5RA 4ZVFA 4CI0B 2AYMA 3W3SA 2VQFJ 4DV1J 1NRKA 2HQ3A 4FKXA 3AXKA 2QLWA 4CLZA 3W64A 2MHNA 3QFHA 1FT8A 2R2UA 4Y34A 1N5VA 5L1LA 2BKOA 3W9IA 1SC3B 3JYTA 2I6WA 2N4DA 4OYOA 1KWMA 3KLFA 3LP1B 3L7OA 5E3QA 2E29A 8ATCB 3BGRB 4A8XA 4AUKA 3RGIA 2LQBA 4AYBD 3ET6A 5IXUA 3H5SA 2Z2ZA 1RUSA 2HRUA 1Q1KA 2B8PA 8RUCA 3R8YA 1K47A 2ALYB 1JLCA 5HJYA 3PW5A 2BMBA 3OXGA 4YR3A 2BJ7A 1H6KX 4LRBA 3K5OA 1N34F 1IKWB 2V8GA 4DU8A 2KL8A 4O44B 4LUBA 1CJTB 4IDKB 5J2QA 2HRTA 2OMOA 1FVQA 1Q5YA 2V8DA 1TKXB 3PXGa 3OFGA 3M2VA 4MYTA 3CO0P 5KFNA 2EFNA 3ZZTA 2ADBA 4ZVPB 2FB0A 2E7XA 2QSFA 1S6UA 3PDNA 2BYCA 3MOJB 2WVCA 1UZHA 5AE1A 2X3DA 2NPIA 1BQMB 4L75A 3MDFA 4HI1A 4I6AA 4EBCA 1X5TA 1CJVB 5ETRA 3OLAA 2AZ1A 1FTCA 4OYIA 1PO6A 3HVWA 1EB0A 3BO3A 3OT9A 3BV8A 2ATCB 5LM7E 2B4UA 3THPA 2WVDA 2HZVA 1QY7A 4G1IA 2EC2A 1MMNA 4JP8A 3KFWX 3W2WA 1TUWA 3UFCX 1YRUA 2G2ZA 2UXCF 3DXSX 1S1UB 2V9KA 3LW5C 4DFKA 4ZP8A 2CJAA 4NCGA 2Y3YA 2HHQA 2D3UA 5F0WA 2L9NA 4LF2A 2NYHA 1BUXA 4LF8J 4AT1B 1R7IA 2QG9B 1RT7B 5C24A 3AHPA 4CLUA 3H59A 5D0HA 2F63A 4ICLA 2HNDA 3QZ8A 1N6QB 4WFXA 1FDAA 2QN6B 1AUSL 2EPIA 4QIGA 1HNXF 2C2OB 2HGNA 1WTBA 3PR5B 1LW2B 6FD1A 1RT3A 4PKDB 1LWFB 1HNVB 1MG7A 4IR1A 1FEEA 4ZIWA 5ETQA 2CWKA 4QIFA 2YKQA 3B6BA 2PMZD 5D3GB 2KXFA 3DXBA 4YN3B 5C25B 3Q8QB 1GT8A 2YQ1A 3GFYA 4WP8A 2ZKUA 2CDRB 3R3TA 2JJ4D 2EKNA 2WOMA 3TYTA 5F9LA 3C66A 3UI3A 1OY6A 3ZXWA 2KZMA 2ZM6J 2FHKA 3VZHA 3ZZ0A 3HHLC 1NCLA 3EPIA 3KJQB 2JX2A 4ES2A 2JH3A 1HYSB 3MMCB 2R7WA 4TY8A 1J5OA 4OI4A 4M5DA 4DQSA 3Q24A 4DSFA 2HK2A 4Y00A 2VG7B 2HNZB 1WNEA 3T19A 2R2SA 4Y2IA 2OPSA 4YB5A 2LXIA 1TAQA 1X0FA 4JI6F 4DUYJ 4A8FA 2JZ5A 4C0HA 2RJZA 2HIQA 4NI2A 4DV2F 3KLEB 4WIIA 2NSBA 2IM3A 4K4UA 5KT3A 3CJ0A 2LU1A 3DGVA 4RUBA 1NAQA 5J1PA 3MUMP 4F8RA 3QGHA 1H2TZ 3UO0A 1R6VA 2HLUA 2NZ4A 1YI2S 3P45B 2FGCA 2YX1A 2XYPB 3CO9A 2FZKB 3DRYA 1HBMA 4MT1A 1N5SA 1SC4B 4NXMJ 5KFLA 5CYJA 4IQXA 1F3VA 3BH7B 4FZVA 3Q2TC 3A3OB 3HJVA 3FEZA 4N56A 4CP5A 2DHGA 2QFJA 5A8RA 3IGNA 2BE2A 3UR0A 4USWA 3R5DA 4JI4F 5K5MA 1LWCB 3N5FA 4KQZA 2DPJA 3H20A 1XK8A 2EFGA 3TJ8A 4N8NA 4ECXA 1U7LA 2ZJPQ 3IG1B 2B6AB 1TFYA 1UVJA 1L3KA 3SMZA 3K57A 2PT0A 4IOBA 1VQOS 2BRKA 4KH1B 2CUYA 2AJFE 2O5DA 3GJRB 1E6YB 2BJ3A 4H4MA 3HFKA 3T9NA 3UN5A 4ELUA 1VQYA 3DRRA 5KFAA 4C3MA 3BO2A 5GAHU 4QIEA 2OMLA 3UDCA 4X66J 2HNYB 2DRBA 2FHJD 4DN9A 4ED4A 1IJFB 4OFZA 1YJUA 1O51A 2HHXA 3EDRB 4IR9A 4OLOA 2O3DA 1L3UA 3FDSA 2YWFA 2BANB 5F3TA 1NK4A 3VZIA 2G0CA 5BYRA 4TYBA 2EK1A 1OYDA 5GMEA 2D74B 1UFLA 5F0UA 1RAOA 1H74A 3QWUA 2XCPA 4OYXA 1UAWA 5GAEU 2JFDA 1UWBB 2WW4A 3QYYA 1S57A 3CCQS 4FPRA 1EKSA 2RSQA 4NPOA 2VQEF 2XULA 2J0SD 1LKZA 5HMWA 1FXLA 2XMAA 5J2PB 1X8DA 3VWSA 4DBQA 4DR5J 3ZTQA 2HS3A 1F9EB 1OY8A 3G8QA 1R27B 3RRGA 3JAMU 2LFVA 2UVVA 2HYIB 1D3WA 5FLXU 3BBCA 1N36F 3I0SA 2AU0A 1AFIA 3KNAA 2VG6A 4ZS6A 5A8KB 3A12A 1FNOA 3V2UC 4QOTA 1UJ4A 2ZH2A 3MR3A 3ZTSA 1V3SA 2ZH7A 4P6QA 2W9CB 3SV4A 2NXCA 2ZBIA 4PG6A 2COLA 3V6KA 3G9CA 4XPEA 3PG9A 4RW8A 1MWYA 2E5LJ 3M8QA 4TY9A 1RT4A 1WDDA 5KT2A 2ZNZA 2H65B 4CLLA 2KFZA 2CG4A 1NKEA 4ZHRB 1FRXA 4NLDA 2YKNA 4DJBA 1RT6B 4DL4A 4DSLA 3OTOF 5KT6A 3CJTA 1M5VC 3BGOP 3VGUA 2CPYA 2XGPA 3D68A 1WKJA 2AX1A 3CCLS 3JSBA 1KVKA 3ENVA 3PFOA 1EP4B 2B7BB 5IWAF 2VUGA 3POTB 4ANEA 2C2RA 3N6LA 2YBVA 1EJ7L 2GAHC 3FCHA 3D1QA 4ZVTB 3MAAA 1J2VA 1EHWA 1DJ0A 3FQKA 3CD7A 3RAQA 1D9FA 2Q6CA 4FP9A 4C8NA 3D6FB 3LP1A 2XMVA 3PW2A 1TR0A 2RILA 1SJFA 3PJXA 1DFDA 5EGYA 2FD2A 1WI6A 4FF4A 2A0FB 3T9ZA 1URRA 1UZDA 2UU9F 1HWJA 2L48A 1RHJB 1VK8A 1LWXA 3RBDA 2Y1JA 2L9DA 3SQGB 3T6BA 1UFKA 4I2PA 3DLGA 2YKMA 4RUHA 1XWLA 2LQ5A 4NLOA 4ATNA 2UXBJ 1IKWA 1U25A 5A8WA 4EMDA 2ILYA 1QLNA 4K4XA 2IA6A 1EQMA 1CJTA 4IDKA 1LWEB 3CMQA 4C0OC 2AD9A 4NX9A 4C48A 4J9UE 1VC5A 2XY6A 2PFDA 2UVWA 2DH7A 1WTFA 4X64J 3LUYA 1BE4A 5ETMA 5LOQA 3OFFA 3KUHA 2FJXA 5SUHA 3OHBA 3QT7A 1I5OB 4W98A 4CQ1A 3UN3A 3I0RB 2XMJA 2CYYA 1GMVA 4L74A 4A8SA 2DH9A 4ECZA 1HI0P 2L3MA 1UEKA 1S5ZA 1WC4A 2J0QD 1O6XA 2KYXA 5E3RA 4ZLLA 2DBBA 2ZOFA 4A4JA 3D67A 1UJ6A 2K7JA 3NNCA 4F0MA 4WFAQ 4NLTA 4WE1B 2N7CA 1EZZB 1HBUA 1RT5A 1UJ5A 5B0GA 2RUGA 3SCKE 3DLHA 2OIHA 2PFFB 5KTQA 2GO9A 3R5CA 5B09A 3KMQA 4C3KA 1W25A 4OYZA 1S1UA 3U02A 2EEYA 1MWZA 4K0KJ 2AJQA 4E8UA 4KPCA 3EM1A 1VRTA 1JK9B 1V3ZA 2CPIA 4C0BA 5IZHA 1F1BB 4N47A 4NRUA 5T7LB 3RRHA 4A8MP 3BGFA 1G3OA 2YWHA 4DL6A 4B08A 1TVRA 4Y65A 5DG7A 2EFPA 2R42A 4DV6J 1QVFR 1HI8A 4LF4J 2B4PA 3QRRA 5B0AA 2Q43A 3S7RA 1QTNB 4WU2A 4JI7J 3GZ7A 2ZZTA 5E2QA 4TLQA 1N56A 1SKSA 4X62J 1CLFA 5C25A 1PGZA 2ZWPA 3ZNJ1 3AD8C 1YX2A 3ENWA 4JI2J 1YITS 5KFCA 4KHPF 3TVKA 1Q82T 2HW3A 3BR9A 1RTZA 2DO4A 2DGWA 4LFBJ 1S77D 3OFEA 1XEZA 2E5HA 2OUGA 1VBYA 2E1AA 5HBMA 4DR3J 4JI3F 5M2PA 5HATA 2WZ1A 3JSRA 3TNVA 1HYSA 4Q8EA 4GKJJ 4TU7A 3WIUA 4DX8H 4YB6A 1RA7A 1QM9A 3IBWA 3SSSA 4G1QA 1CVJA 2YX7A 2VG7A 3SDEA 3IBFB 1KEKA 3SSRA 5J2NA 1Y5LB 3E01B 2VIHA 4ZCLA 5L1IA 4DI6A 5EHHA 4ZK7M 4AL7A 4DX7A 2LQJA 2WBRA 3CJQA 3MCSA 3R6LB 2DNNA 3G4SS 2AYEA 4WBFA 1I94J 4O23A 3R6GB 2CQPA 1WOSA 2XZWA 5CCMA 5B0EA 4J9OA 1XMOF 4FN5A 5DLGA 1DY3A 1HNWF 2V2KA 4NLXA 2WB4A 4EU0A 4ERDA 3H42A 3UDEA 3LF0A 4DQIA 4LF9F 8AT1B 4NA2A 2JLGA 2MLYA 1JNRB 4UQTA 4EYIB 3OSNA 4KPYA 1Q78A 4NLPA 2SXLA 2JOQA 1Z1ZA 5IQ6A 4Y2KA 4QW9A 4HHJA 3HXMA 2X51A 2R7UA 4JYAF 1RYRA 4ZITA 3T5LA 2PGCA 1R6YA 2LDIA 2DXEA 4UOCA 3IFEA 2FVCA 2AV5A 4C3LA 4M1KA 3KDOA 5IC4B 4Y0FA 1JXVA 4PR6A 3IG1A 4H54A 2B6AA 3IRWP 2VQFF 3IWNC 4IFVB 4DV1F 1YGYA 1N32J 1DARA 2Z57B 3FFIB 4UZCA 2XTJP 2BJ8A 1E6YA 3MM9B 4KSEB 4IRCA 2XYHB 1U45A 1M5KC 2CJQA 3VQTA 2ZBRA 5DG8A 1L3TA 1RWXB 4DPTA 3QGGA 1Z2ZA 4K2JA 4ELVA 2KFNA 1FE4A 4D3GA 4LMZA 1X31C 1FRJA 1R89A 1UWAA 5BR8J 2HNYA 1X4BA 5KAKA 2YPZA 4PUOA 1BQXA 3AOBA 1S9FA 2M70A 2E44A 3TRGA 3LAMA 3RB4A 1VI7A 3N9UC 3DGPA 1WACA 2G2OA 3G2XA 2BANA 4IH7A 3JQMA 5I4MA 2HFSA 1RWVB 4GKKJ 2RRNA 2YKOA 4KE5A 3DC2A 2FVQA 2VBXA 1DQAA 2R7RA 1LXNA 3CD0A 3G87A 4ID5B 3N4WA 2HZCA 1DTQA 4RNMA 1JLGA 2E5GA 3DRSB 1VQMS 1MSWD 5HVFA 2NXNA 4JV5J 1IQTA 1M5PC 3K89A 2UV8A 3HF5A 3VGTA 2FTRA 5KG1A 3DCAA 1D9AA 3CCJS 3DKDA 3M8RA 1S49A 5K9FA 2GV1A 4LJMA 3LANA 4OZ5A 4RPFA 1B0TA 5KT7A 4D3HA 3BKFA 2AW0A 2DO0A 3TR5A 1U8SA 2W7PA 3PR4A 1QAJA 1NJIT 4K5SA 1YG0A 4YP3A 2HSEB 4U6PA 4IFYA 3R5JB 1WWHA 2VB6A 1UMJA 3MMAB 3PY8A 1FI4A 2B56A 4LF7J 2IYGA 3WZ0A 5A8KA 1JB0C 4EI2A 4DU7A 1IKYA 1FXRA 3P5TL 4LQ9A 4OZ3A 2CKWA 5KG4A 1APSA 5KFSA 4C8OA 1VFJA 3GV5B 3R5BA 4F36A 5I3QA 1KN6A 2RDIA 2CPEA 2XMUA 1JJHA 2AEJA 3FZBA 4N7TA 4X4OA 4I6WA 1YTYA 1FERA 2GJ2A 4PWUA 3GIMA 4NZ7A 1HWLA 4U7CA 2K06A 3H5UA 3TX8A 1XMQF 5CAAA 4F7VA 1VQ5S 4LFAJ 2W4DA 3QAUA 2CDQA 4QQBA 3I5AA 1PJ6A 4LF8F 4IQMA 1VQLS 2J6SA 5CABA 2BXJA 3KKFA 2KTQA 4ZHRA 4ED0A 4N41A 3T1HF 1RT6A 3HZEA 2BABA 5KFMA 3J7Z5 3DRPA 3MECA 3DM2B 3GIIA 5DETA 1Q8IA 2F1FA 3UWTA 4QIWD 4KJIA 3ZFVA 4M95A 5SZTA 2FY8A 1RBOB 2MJNA 3ZZUA 4EBDA 2W7AA 1D9DA 2MQLA 2H5JB 4RW6A 1SJRA 5AXMA 4P7VA 1GH8A 1DQ8A 1EP4A 2ADCA 2XQCA 2PIIA 3D28A 2YNFB 1Z2LA 3OSPA 2QO3A 2BE9B 4J9VA 2IJNA 1EIYB 1Q7YT 1KKHA 4TQRA 3OL9A 5A2QU 1NKBA 1T3OA 4P2SA 3PTWA 2XZDB 3DN9A 4QIVA 1WORA 2C2MB 3GIJA 1G2EA 4M5GA 4CM0A 2C28A 1HWKA 4ZP9A 2IJRA 3UVJA 5DLFA 3CT9A 4K50A 3JAMY 3A8IA 2DRDA 2H48B 2V68A 1AA1B 3QJPA 2ZM6F 3DNCA 2BQ3A 1UVNA 4OX8A 3M9MB 3FSYA 1MMLA 1XIQA 2QLXA 4RBVA 5H9EJ 4ZMMA 1WJ9A 5IT9U 1WOOA 2HVIA 1WEYA 3TAQA 4JI8J 4ILLA 3BYPA 3J7ZT 1TK5A 1JWWA 2NCKL 3NCRA 2J9DE 5HROB 3EZOA 1UA1A 1FK9B 3W9HA 5AXNA 1U0HA 3VV2B 4DCJB 3HO1A 1B99A 1F9FA 1XR6A 1LWEA 3RU0A 4DUYF 1R43A 3KOAA 4JI0J 4M5NA 5B0FA 1C1BA 4LIRA 1TV6B 4H4OA 3TO8A 2DNHA 3T1AA 3C2PA 1NZAA 2NLWA 3L95X 4N77A 4F26A 3GWCA 2Z56B 4CLPA 3TWZA 4QWDA 3DHXA 3W2VB 1S6PA 1PILA 5D0GA 5E7OB 3R2DJ 1N33J 4NXMF 1S1TA 1FCAA 3QWPA 5M2RA 2V4JA 4QR1A 1UETA 1X0PA 2R7QA 4J9PA 5CHCB 5ADZA 3MF5A 3NAHA 3CJ4A 4IRKA 4WE1A 2B5JA 3V81B 1FRLA 3T6JA 2BBEA 1OSCA 1KD1T 1FFSB 5KFZA 2GVDB 3UCZP 2EFQA 3P49B 4DPXA 3RRKA 1AUDA 5JJBA 1TL7B 4GVBB 1J5EF 1VGYA 2VBZA 4F04B 3AFGA 1ZOTA 2ZE2B 4ZOSA 4ZVRB 4YDXA 1LOUA 3R1LA 5IS2A 1M5OC 4L6V3 3NGSA 4ER8A 3QIDA 5T7LA 1YRTA 4FXWA 2U2FA 2MSTA 1RWOB 1KDNA 4XAKA 1QE1B 1W26A 4P7TA 3UDLA 3B4DA 3BS9A 1PJ5A 2GGPB 5IFMA 5I42B 1AXQA 1R31A 1C0TA 5AJ3J 1C2PA 3OPKA 2IY5B 3AD9C 2I1RA 4DR7F 4A47A 3HHEA 3BBFA 1RTJB 2XYGB 1XC9A 2WHOA 3PO5A 2P2CB 4LBIA 1EQ0A 2V4RA 3ONQA 1CULA 1FRMA 3MM6A 1KQKA 3K5PA 4JI1J 4OZNA 3AA8A 2XB2D 4BC7A 3MPYA 3VAMA 2DY9A 2VZ9A 4MK8A 3VTIA 4DSEA 1JJ4A 5EN1A 1VRUA 1KFDA 3CDAA 3OR2B 1URNA 2ZBCA 2ASLA 4ANDA 3O3LA 2HHVA 4QWCA 4UY85 3SEOA 1N5QA 5G0RB 4USKA 1H38A 1KHWA 1MROA 3ULHA 3IAS9 2BEFA 5L8RC 3BKUA 3MTKA 1KS2A 4DR5F 2UUAJ 4DG1B 3NEKA 1IR2A 2QL5B 2IVMA 1QSLA 5DZ7A 3ETOA 1YLXA 2QLJB 4X4UA 3HMJG 4ECQA 4HYKA 3KJVB 2CZ9A 3E01A 4NRTA 1V5IB 4PAAA 1Q8KA 4Q5VA 4F4YA 3IM9A 5FDLA 1NJZA 1XR7A 2MB0B 1MN9A 1U2CA 3G86A 1SB6A 5I3PA 3ICLA 1B0VA 2F8HA 5HLFA 3LWMA 4FNIA 2OPPB 4ENOA 3H7HB 4RNOA 4DN0A 3K17A 1RAGB 2VOPA 4TU9A 2E5LF 2BJEA 5T41A 4XDDA 2QT7A 3SFGA 3ETMA 4UY8T 2F7VA 2GNKA 1FJGF 3CW2C 2Q1LA 3NP5A 1OMSA 3EZ5A 1RWUA 3QT6A 3GJTB 1S12A 3PX4A 4B9VA 2NPFA 5D0EA 4PXBA 4W4MA 4Q44A 3W1YC 4RU2A 4OX6A 2OAUA 4J9SA 2ZEJA 3EZUA 5D8HB 5IOLA 4ZJQA 1ITPA 2IDLA 4IFVA 5KFKA 4PYDA 4YOEA 1VQKS 1PG5B 2EK6A 4ID8A 1NZ8A 2W25A 3MM9A 3LP0B 2YNHB 5L9NA 5L38A 4F50A 4J91A 3HJFA 3FSXA 3CULA 2L08A 1VJQA 2JC0A 3DMJB 4F02A 4BWJA 3NGKA 1P9QC 2N3LA 1S59A 1HI1A 3MMJA 2MZQA 2Z58B 2VFTA 3JTOA 2IJFA 4ECWA 2RT3A 4DSKA 5DRKA 1WOPA 3A8JA 3GG0A 4FYXB 4QYZJ 4ZPVR 4ZVUB 2D1CA 4I7FB 1SC6A 2R7OA 2BQUA 4B3MJ 4DR1F 2QGFB 1U1KA 1YQHA 1SL1A 2RS8A 1H3DA 1YJ9S 2UXBF 1EARA 1XNRJ 4ID5A 3KLGA 1RHRB 5LT5A 3M8PB 3M8WA 2KXHA 4LVOP 4J7CA 1WG1A 2XLJA 2WONB 1RWWB 3PW4A 2ZJQQ 1IKXB 1H98A 1OQ3A 1FNXH 4PG8A 4O0NA 5I3UB 5KG5A 1JLQB 3DDNA 5F8IA 4X64F 2PI5A 3NOCA 2IAJA 2OPQB 3DU6A 4CO5A 4L76A 2OH2A 4URGA 2MKCA 1JNZB 1JXEA 1FJ7A 7AT1B 2XHCA 4PXDA 2QMWA 4OLPA 2ZBQA 3EVMA 4DPYA 4DXLA 4X4RA 4ETXA 3SI8A 2IC3A 2MQQA 4EBEA 4PZVA 3DYAA 2PDAA 2G2YA 3TANA 1NDKA 1FKPB 3TI0A 1BY9A 2KFYA 1TFWA 1REVA 2OI2A 4LRAA 3B4MA 1TL1B 1OWXA 4WIQA 1M5HA 3PEJA 4RWWA 3PYGA 4RLEA 2X1BA 3KJFB 4GVLA 3DOKB 3SYZA 4GRSA 3U7JA 2Z0GA 1KQFB 4U7UD 2Y1RI 2G4BA 1VCTA 2RHQB 4K0KF 2HBRB 2H4YB 4JOUA 3K5LA 2W4CA 2XGQA 2VONA 3LGHA 3IRXA 5DDQC 3SCIE 4ZVEA 2L41A 2KB2A 2YWWA 3PW7A 2OP5A 4CO1A 3R1HA 4HTIA 3DM2A 4DV6F 3ELHA 3QPIA 4PCQA 4OI2A 1XBWA 4HT7A 4DQRA 3FC9A 1PBUA 3PVXA 4DPOA 4JI7F 3T5HA 3U27A 4RKUC 1CEZA 1TKTA 1RHKB 4ECTA 4B02A 1VHFA 2LDYA 5K8OA 2RE1A 1B3TA 4X62F 2OFGX 3N0VA 3RTVA 3L4BC 1SIZA 1WF1A 1LNQA 2G9OA 2WB1D 4JI2F 1H73A 3MMBA 2HS4A 5GMDA 3H5XA 2I38A 3NGTA 1HLWA 4RW7A 4DFPA 4USJC 4R5PB 4WZMA 3CWJA 5ETKA 3ISND 4WZQA 1Y5IB 4DR3F 3M4XA 5IQQA 1S1VB 1PYOB 4WXOA 4IO9Q 2BVZA 4X4VA 2MQMA 2ASYA 2A18A 2V34A 2OEMA 3C15B 2Z2YB 3JSMB 3GPAA 3OHAA 1N5YB 1WF2A 4TVAB 2L9WA 2P9CA 1SH3A 3UD5A 4NLRA 1FK9A 1H2VZ 1CQMA 4I2QB 2M4MA 3J81U 3RBZA 2CVIA 3B78A 2RRBA 2HWTA 1NU4A 2HS0A 4NEYA 1S1XA 3GYXB 1J27A 2ZC4A 3CDEA 4KAIA 2ZZNA 4ZVQB 4ES3A 3IGVA 1P1LA 1TV6A 2R7XA 2CJYB 2XNRA 3F73A 2XSJB 5HP1B 3MWBA 4MK9A 3PRBA 1NK0A 5IM0A 2QTWA 3PYEA 1NK9A 2B4VA 1GXTA 1RAAB 4DV3J 1FRHA 2XLKA 3W63A 2LYVA 1UW4A 5MLCV 2HHHJ 1T95A 3MAQA 2E66A 3HSDA 3UN2A 2FHOB 3WDOA 1RTDB 3BM7A 1X4AA 3SFUA 2PA8D 4Q7AA 3CF5Q 4W90B 3CCVS 3M2UA 5KG6A 2ASJA 3V81A 3BB5A 5A2QY 3EGNA 1GNKA 2AJ4A 3CGIA 5HQLA 3HHLB 3SV3A 3HPOA 3MPVA 2GVDA 1FHTA 2JFKA 4ECRA 4M5LA 5FD1A 1TL7A 1N32F 3I55S 4K4ZA 4CT8A 2AMCB 4AXJA 1WKLA 2CQBA 3DDIA 2ZE2A 1FTRA 3CCUS 2W2OP 1HNIA 5IT9Y 2EXUA 2OKQA 2YQ3A 5GAHI 3G6ES 2Y0BB 2ROPA 2DIUA 1T05B 1RA6A 4IYQA 5BR8F 5F41A 3J81j 3TJAA 2M52A 1ROFA 3TZXA 1WEXA 3KNGA 1QAIA 2UUCJ 5DGBA 5KFVA 1VBKA 3DRXA 2UVRA 4C8KA 1NJXA 2YY3A 2B8QA 3O2IA 1Y3KA 2E5IA 3N28A 2NZCA 3M9NB 5I42A 2DNZA 4K7QA 1KOHA 4GKKF 4A8YA 2HG4A 2IFXA 2XG8A 1VQNS 4OZ1A 4HT5A 2FC9A 4WPAA 1PIEA 3J80U 3I4HX 2LXFA 2ACYA 2FVSA 5GAEI 3QZ7A 3AJ1A 3M1VB 3TJ9A 4ED1A 2UXDJ 3MEGB 2RDDA 3W65A 4ALZA 1YJ7A 4LIWA 4HACB 2C2EA 3B54A 2GX8A 1CC8A 4MAKA 2WK4A 2X7IA 3HSJA 2RAQA 2MKYA 1S9GB 3PJWA 4DZDA 5E3PA 3VVUA 2YQ0A 3MEEA 1NLKL 3KUEA 2UUWA 4ZPCA 4PYAA 1W2BR 1P9YA 1YBTA 1AB8A 3L7PA 3Q8PB 4OHXA 2MQ8A 2A2DA 2IM2A 2FJAB 1T03B 4KBIA
chains in the Genus database with same CATH topology
3HKZD 2L3MA 4KIAA 2XLIA 4DF8A 5BYQA 3V4MA 2NSCA 4KR0B 2NXUA 2B9WA 2OD4A 2J0QD 4FS2A 5E3RA 2KYXA 3PO4A 1JLBA 1JIHA 2HFOA 3TVZA 4PQUA 2DBBA 3TA2A 3TAMB 1ULRA 2VASA 3BF4A 4G1QB 5LSRA 1KTVA 2QA4G 2ZOFA 4A4JA 4RW9B 4JV1A 1UJ6A 2K7JA 4LF7F 5F8JA 4B9UA 3NNCA 4Q0BA 4WFAQ 3SDEB 1TUVA 1HHTP 2KT5A 1TL3A 1S4FA 3HHLA 2J7WA 3M30B 4NLTA 3V4IA 5J2NB 5DQHA 4WE1B 3OTDA 2XY7A 2N7CA 2M2BA 3M2RB 4DWIA 3KK1B 5J2MB 3TARA 4YR2A 1HBUA 1RT5A 1UJ5A 4KTQA 1F5AA 5B0GA 2RUGA 2ZZMA 4WK1A 3SCKE 3POTA 3DLHA 3IS9A 2OIHA 4KO0A 4E0DA 2HHSA 2PFFB 5KTQA 2GO9A 3R5CA 4MIWA 2GJIA 4I1TA 1Z4UA 2MZSA 4K4YA 1VJWA 2GIQA 2VG5B 4B3RF 1S6QB 1FRIA 4MFBB 1O0PA 5B09A 3MFIA 3KMQA 2YX4A 4C3KA 4RW4B 2EVZA 3H2UB 2CQGA 4O4GA 1AW0A 3T5KA 3NCPA 1YBAA 2RQ4A 1W25A 2RMLA 1S1UA 2EKYA 3U02A 4KKOB 1ZPWX 4Y2CA 2J6TA 1MWZA 2AJQA 1L3VA 5KG2A 3CCTA 5CYQB 4E8UA 1QJHA 4ES1A 2MGZA 2CVEA 4NLGA 2KZZA 4DLGA 3V6JA 3EX7B 2CIMA 2VBWA 2ZKTA 3MUTP 3JYTB 1VRTA 1JK9B 4A48A 1V3ZA 2CPIA 4C0BA 3R5AA 5IZHA 3CDWA 4N47A 3U1NA 1U24A 4NRUA 3KLFB 5AE3A 2FJEB 4NYZA 4OHVA 1U2FA 5T7LB 3TVYA 4A8MP 4Y2AA 2KYZA 3BGFA 3KK3A 2DNYA 3VAFA 1G3OA 4KHRA 1BD6A 1Q79A 1S0MA 2YWHA 2RU3A 4DL6A 2ZFHA 4B08A 1SV5B 5DDPC 2AWZA 5FLXY 3J81Y 3DI6B 1TVRA 2CPJA 2ZJRQ 1K0TA 4X4NA 4Y65A 3OTEA 5DG7A 4GO7X 2EFPA 1QVFR 5DQIA 2QRRA 2DGVA 4DQQA 3PZPA 2MQOA 3MZIA 2GMHA 2Z4PA 2F8EX 1QSSA 2OTLS 4DR2F 1U6BA 3NRBA 3DU5A 1OIAA 1HI8A 2GFFA 3JSYA 3QIPA 2B4PA 2HVHA 4O3PA 4CH0S 1S9EA 2DNPA 5B0AA 2BZ2A 2K3KA 3SQGA 1LV5A 2A2CA 2Q43A 4TYAA 5CA5A 3CPWR 1OPZA 3DLLQ 3S7RA 3NMRA 4DL0C 4WU2A 4JUZA 1ZH5A 3GZ7A 4UUXA 4OZ0A 2EG2A 3G6VA 5E5NA 5E2QA 2DIVA 3L3CA 4F4WA 4TLQA 2FUG9 1N56A 1SQEA 1GTEA 1SKSA 1I1GA 3K5MA 1LK5A 2NYIA 1WEZA 2WCXA 1F60B 1XNRF 1CLFA 2KVIA 4TQSA 1ZZNA 1KC8T 4X4TA 2XNQA 2YNHA 3HZGA 3LP0A 3B8HA 3FRYA 4ZA1A 1QAYA 5HQ8A 2QV6A 1S99A 5C25A 5GADI 1PGZA 2ZD1A 5JVHQ 1IBLF 2ROEA 2XWXA 1MNEA 3IO1A 3K8VA 2DH8A 3ENWA 3BDPA 1H7XA 2O01C 4NLQA 5J1EA 2I9SA 1YITS 5KFCA 4KHPF 4OI3A 3TVKA 4R0JA 2OTJS 5K8MA 1Q82T 2HW3A 4F3MA 1C4CA 4UW2A 5KOWA 1KTQA 2I8EA 3HDSA 3BR9A 5EX0A 2H5EA 2VL1A 2DO4A 1C4AA 1OQ6A 2K1RA 3TW0A 1JKHA 2DGWA 3RB3A 2UVUA 3A8EA 3RAMA 4MKBA 1S9GA 1HARA 1HD1A 1S77D 3OFEA 1KR4A 1HQEB 3NLCA 1XEZA 2E5HA 1M0SA 2E5JA 2O66A 5KFIA 2RS2A 2RH3A 2V5HG 1VBYA 3VF0B 1UVLA 2R2TA 4DL7A 4K4WA 2E1AA 5HBMA 1IM4A 4PUOB 4JI3F 1ZM3A 3I0RA 3VR1A 3NBPA 5M2PA 3LQVA 1I6JA 5CH7B 1KRPA 5DM7Q 2AP6A 2B9XA 2PN6A 3JSRA 4LSLB 4JI8F 4ZCKA 5E41A 4DHVA 1T03A 2EG1A 4I7FA 3TNVA 1U1NA 1HYSA 2V8HA 1KVIA 4Q8EA 4TU7A 3S1TA 2MPUA 2E1CA 4OZJA 4DX8H 3TA0A 2JDJA 1SUQB 2LA4A 2W8KA 3JB9k 4YB6A 1RA7A 1QM9A 2HGMA 3N01A 1MU2B 3TAMA 3IBWA 3SSSA 4G1QA 2MKJA 1CVJA 4IOAQ 2YX7A 5GMKa 2VG7A 4K2XA 2CQ4A 3CTRA 3SDEA 2HMIB 2CQ2A 4DOZA 4X84A 3H40A 2QA1A 3M30A 3SSRA 1KEKA 3K5NA 4JV0A 5J2NA 1Y5LB 4V19J 1Y9OA 3E01B 2VOOA 2XO7A 4ZCLA 5L1IA 3MR5A 1OS5A 1X4FA 1P1TA 5EHHA 1HBOA 4ZK7M 5J2MA 4AL7A 4WU3A 1VQ4S 5FJ4A 2N82B 3DLKA 2KU7A 4PG5A 3P3DA 2PI4A 3E2EA 4IO1A 2LQJA 1F5CA 2FVPA 2WBRA 2RD5C 3MCSA 2DNNA 2FVRA 3G4SS 2WONA 1YJWS 2AYEA 1DTQB 3TQ1A 4NYPA 5L39A 1IKXA 3Q23A 1JLGB 4JI0F 4HTJA 4MFBA 4O23A 1TKZB 2M3DA 4OMFG 4FVCA 4RW4A 3I5BA 2WTFA 1JXLA 2MMYA 2DRAA 2CQPA 4A8KA 3ENQA 1P8GA 4KKOA 4PPDA 2M8DB 4TU8A 4FF2A 1U1OA 2FJVA 2UUBF 2XZWA 5CCMA 5IT4A 5B0EA 3G6YA 5CYQA 3W2WB 4J9OA 1ZPVA 3OFHA 2OPQA 1XMOF 4FN5A 4FNHA 5DLGA 4QJVA 4F3QA 2P9GA 5EWGA 3EPGA 1HNWF 3N6NA 4ETZA 1LFPA 2V2KA 4NLXA 4OX9F 3DOLB 2WB4A 4EU0A 2YKPA 2ZHOA 4NLSA 3RW6A 4ERDA 3LF0A 4DQIA 4NCGB 3AJ2A 2G1DA 3CD6S 2MHEA 1D8YA 3LOUA 4MMOA 1D0EA 3E51A 4LF9F 4NA2A 3E3XA 3US5A 2JLGA 2YNGB 1JNRB 4UQTA 4EYIB 2D3OR 4X66F 3M6WA 3DLEB 4TKTA 1N4LA 3DI6A 1N33F 3OSNA 1Y5NB 3PNIA 3MD1A 4KPYA 2DT9A 1Q78A 2JVOA 5DO2A 1WHVA 3TAPA 1SJ1A 4NLPA 1DLOA 3VAGA 1RTHA 5C24B 2YTCA 2SXLA 2JOQA 3U1LA 3A1YG 1WF0A 4A8OA 2UV8G 1EETB 1Z1ZA 5IQ6A 4Y2KA 2V0NA 4QW9A 2C3OA 4NL5A 4HHJA 1VQ7S 4USHA 3HXMA 2X51A 1UP1A 3M8SA 4ICLB 2DB1A 2R7UA 3PW0A 4JYAF 1RYRA 5HL7Q 2HNDB 1FNMA 3CVKA 4IFYB 2N7YA 3T5LA 3CCSS 1SJ3P 2PGCA 3HI9A 3KLIB 2CZVC 3D0HE 1R6YA 2LDIA 3UW1A 1X9MA 3GFXA 4UOCA 3IFEA 2FVCA 2AV5A 4C3LA 3V6DA 5E3CA 4M1KA 2P6SA 2J9CA 2J0WA 3GSDA 1IKYB 1ZM2A 4Y0FA 2GHWA 2J9DA 2FLNA 3MM7B 4PR6A 4LQ3A 3FEYB 2LEAA 3IG1A 5JVGQ 3HHNB 4RUCA 1KLMB 2B6AA 4H54A 4CO0A 4QPXA 3IRWP 4ZP7A 4ED8A 3RAXA 5KG7A 2VQFF 3IWNC 1S0OA 4IFVB 2Z8QA 4DV1F 2JHEA 1YGYA 1RT3B 1DARA 1WI8A 2AF6A 2V94A 2IM1A 4MH8A 2JC1A 2MYFA 3H4DA 2PSZA 3FFIB 4BWMA 2IRUA 2E7WA 1VLYA 1N48A 1VK3A 1E6YA 2KT3A 4KGKA 3MM9B 4KGMA 1U2RA 4KSEB 3D2WA 4IRCA 3HHLD 1U45A 1M5KC 2GQ2A 1DTTB 2QYCA 2CJQA 3VQTA 5DG8A 2ZH3A 4KRWA 1L3TA 2BR0A 3Q0AA 1SKWA 2FIUA 1OPIA 3QGGA 4O4RA 1U1RA 1FXDA 1HWUA 1Z2ZA 2G13A 4OHYA 4PWDB 4ELVA 3I31A 1FE4A 1C1CB 2GIRA 2VC1A 4D3GA 4Z2XA 4L72B 2KFNA 1JX4A 1ZM9A 2MY7A 2R2RA 4Y6IA 2DGXA 3T1YF 3MM5B 4CIOA 4LMZA 3J7A1 1LXJA 4F4ZA 2CQCA 3WX4A 2BA9A 4Q45A 2P5VA 2ZHAA 3QGPA 1HW9A 1FRJA 1R89A 3PIPQ 2BDPA 2W7OA 2HNYA 2B51A 1X4BA 2WOMB 5KAKA 4NLUA 4ZPAA 3K2YA 3MR2A 4RWXA 3GR0A 2VPWB 4RU9A 4PUOA 1BQXA 2C3MA 3DFEA 1YVFA 1X4GA 3IC1A 5KFDA 5F9NA 3MURP 3EXCX 2VKRA 4B9TA 2ILZA 3OTCA 2K8GA 4IH6A 1FDBA 1S9FA 3DRPB 4HEA9 2M70A 2E44A 3MECB 3OR1A 1HPZB 1DURA 2JVRA 3TRGA 3LAMA 3RB4A 1U48A 4AXIA 1RT1B 4N5SA 1VI7A 4ED7A 1FA0A 3N9UC 3VQSA 2WSCC 3DGPA 4KHMA 3K58A 1UVMA 3MEDB 4NCBA 1C0UB 3BN7A 2QA2A 3TUZC 4B9MA 1NH8A 1WACA 2C3PA 2PD1A 1SUQA 4DQPA 3OVBA 4WFZA 1JLEB 2BANA 1SBRA 4IH7A 5I4MA 5AJ3F 2DNGA 4HVZA 3J7YU 1TL4A 1RQ0A 1U6FA 2DJWA 3LP2B 4RW6B 2RRNA 2YKOA 1X5PA 1JLFB 3N5BA 4RNFA 1TAUA 1L5UA 2HMIA 3E8OA 2D9PA 1X4HA 3S8SA 3KHGA 2ALZA 4KE5A 4M5DB 1G7CB 2KRBA 1Y00A 3DC2A 3ISZA 3OXFA 4UUWA 2FVQA 1S0NA 2VBXA 1DQAA 1ZZFA 2RF2A 2VH7A 2R7RA 1F2GA 5JUMA 2IRYA 2D9OA 2LMIA 1AROP 1LXNA 3CD0A 2RDJA 2BV3A 4WYWA 2YWKA 3D0IE 1XR5A 4JI1F 6FDRA 1HW8A 4ID5B 3BQ2A 3N4WA 1RTIA 3M32A 2HZCA 1DTQA 4RNMA 1V9OA 3H25A 1JLGA 4EO8A 2MQPA 5GADU 2R4FA 2EFOA 2E5GA 4IH5A 3O44A 3DRSB 3BN4A 1V6HA 1VQMS 4NZ0A 1KQGB 1MSWD 3KG4A 2W8LA 4F4KA 4GMKA 3HP6A 2B7CB 2ZH8A 4B9SA 2Q79A 3D54A 3FGVA 3KWMA 2N4CA 3KG0A 5LJ3Y 3W7BA 2R8KA 4R5PA 2ZC3A 1R0AB 1IQTA 2UP1A 4ED5A 3IA0A 4YDDB 5KT5A 2R8HA 1M5PC 2UV8A 3AH6A 1N0UA 4KB7A 3HF5A 2YWEA 2FTRA 2NS1B 4IG0B 2KI2A 3DOLA 5KG1A 2D3ZA 3DCAA 3Q2SC 3ZC4A 1D9AA 2MY8A 2ZNYA 3CCJS 3RB0A 2QEXS 1S76D 2RQMA 4X4PA 4FBTA 4K4SA 2NUHA 2KO1A 4J37A 3M8RA 1S49A 5K9FA 4WFBQ 3F56A 2GV1A 4XPCA 1VOMA 3LANA 4LJMA 4QPTA 4QWBA 4OZ5A 2CPZA 3JSMA 1B0TA 2J7UA 1KHVA 2HHTA 5H9FJ 3NKYA 1R8BA 5KT7A 2W24A 4YUDA 4D3HA 2AW0A 3JTNA 5CZXA 2DO0A 1HBMB 4F3OA 2W9BB 3HLUA 2MZRA 3TR5A 1U8SA 1S79A 3CIZA 2W7PA 2GMLA 1RK8A 1BWEA 3PR4A 2LECA 1QAJA 4R8UB 1EETA 3MHYA 4KC5A 1NJIT 1PC5A 3QJJA 3H98A 5KT4A 2CPFA 4K5SA 4WTYA 1YG0A 4YP3A 4U6PA 2XCAA 2DGUA 4IFYA 4LF6F 1VQPS 1WWHA 2R7VA 2VB6A 2ATLA 1HA1A 1SI9A 1UMJA 3ISNC 3CXCR 4ZP6A 3MMAB 3PY8A 2B56A 2BQRA 2IYGA 3QMQA 3WZ0A 5C42A 3D5MA 4URSA 3K8WA 5A8RB 5A8KA 1JB0C 2CFXA 2U1AA 2BE2B 2KG1A 3L09A 1IKYA 1FXRA 3P5TL 4RBUA 4LQ9A 3CJKB 2CKWA 5KG4A 1APSA 5KFSA 4C8OA 1KLMA 1VFJA 4ECUA 2R8GA 3GV5B 1FD2A 4B3OB 1IKVA 1WELA 3R5BA 5I3QA 3AB2B 1R8AA 2NQPA 2LQ9A 4WF9Q 1KN6A 2RDIA 5E0OA 2CPEA 2XMUA 4MKYA 1JJHA 4DF4A 1S72S 3FFIA 3FZBA 2XMTA 4X4OA 2R9LA 2DNQA 5L1JA 3CDBA 4I6WA 3X1LB 5CYMB 4C9DA 1YTYA 2Z2LA 4C11B 1CC7A 1FERA 1N88A 2CJ9A 3I32A 2DK2A 4FXVA 2Y1IA 2XSJA 1RKJA 4O3QA 1QVGR 1KLNA 2BRLA 2ZH4A 2GJ2A 1C1BB 5HP1A 3DDKA 3PX6A 2HGLA 2J7KA 4H4OB 1LW0A 4PWUA 3C6TB 3GIMA 4M94A 2Y0SD 5LXRA 4NZ7A 2CQ0A 1HWLA 1S1WB 2R8IA 3I56S 5CQGA 1ZYQA 1Q4RA 4U7CA 3O8WA 2WSEC 3GQCA 3H5UA 4NLYA 3SCLE 4H4MB 2QSWA 3TX8A 1YJTA 1XMQF 4PWDA 4OIXA 3KHLA 2DNOA 1D1UA 3ZZYA 4DR6F 2JLEA 1VQ5S 5KOXA 2W4DA 3DRRB 3MM5A 5A0YB 3C6UB 2M9KA 3CC2S 3QAUA 3SZ2A 2Q6BA 1Y7PA 2CDQA 3I5AA 4QQBA 4LF8F 4IQMA 1VQLS 2J6SA 2X1GA 5KFPA 5U47A 3AAWB 4IOCQ 2BXJA 3KKFA 3SCJE 2KTQA 2C3UA 2LXUA 4ZHRA 4ED0A 1S6PB 4N41A 1XN9A 3T1HF 1RT6A 3HZEA 5THWA 1YHQS 2KHDA 2BABA 1RTDA 1LK7A 5