1VFJA

Crystal structure of tt1020 from thermus thermophilus hb8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVTPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
molecule keywords nitrogen regulatory protein p-II
total genus 24
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vfjA00
5D4LA 3O8WA 3AA9A 3NCQA 4RWXA 1KR4A 4WK3A 2J9CA 2ZFHA 3NCRA 2EG2A 1XK8A 3O5TB 1UFLA 2GW8A 4WK1A 3M05A 2J9EA 2PIIA 1Q1KA 4IYQA 5D4PA 3AHPA 3T9ZA 2EG1A 4YB7A 3GSDA 2Z0GA 3NCPA 2GNKA 4CO3A 4YB5A 4CO2A 2XG8A 4Y65A 1NAQA 1NZAA 1VFJA 2NS1B 4CO5A 4CNYA 1P1LA 1UMJA 1O5JA 2XULA 2VD3A 2JJ4D 3TA1A 2O67A 1V3RA 4D3GA 1OSCA 4E98A 5DRKA 2V5HG 4R25A 4C3MA 1O51A 2XZWA 3X3UA 4D3HA 1H3DA 3TA2A 3BZQA 3MHYA 4USHA 3AH6A 1UL3A 1V6HA 4ZK7M 4RWWA 4OZJA 1HWUA 2RD5C 1VHFA 1QY7A 3DFEA 4USIA 4RX6A 1V9OA 4NYOA 4CNZA 2O66A 4RLEA 4C3KA 5D4NA 5L9NA 2DCLA 2E66A 3L7PA 2J9DE 1V3SA 4CO1A 1J2VA 4USJC 4CO0A 1UKUA 1NH7A 2XBPA 2NUUG 3HLUA 4CO4A 1PILA 4AFFA 1NH8A 4YB6A 3CE8A 2J9DA 4OZLA 2ZOMA 4NYPA 2NUHA 3TA0A 2GX8A 3AA8A 4Y6IA 3OPKA 3N5BA 1GNKA 3LF0A 5D4OA 4C3LA 5DS7A 2CZ4A 4OZNA
chains in the Genus database with same CATH superfamily
1IBKF 3LUYA 4F3QA 3CWJA 1RA7A 5K8PA 2JEJA 4A8QA 2JVOA 3ETMA 4RWXA 1KR4A 1YX2A 1K9MT 1DJ0A 3CJ3A 3I9ZA 1W7WA 2CADA 2JH3A 3PRBA 1SJ3P 3IBFB 4DV3F 4DLGA 2F3JA 4KV8B 5EX3A 1KRPA 4AL6A 1ZM4A 1JQGA 1TL3A 1WG1A 2CAJA 2DGWA 3GG1A 2R8GA 3P8BB 3DLBA 4X2BA 1SJRA 1YK9A 3MECB 1U45A 3EM1A 1VQ8S 1HKAA 3MEGB 2ASLA 2E5GA 2ZD1A 3B4DA 4ZP9A 2DJWA 4NLPA 1GMVA 2O3DA 3GFYA 1X5OA 2ALYB 4HHJA 3UNYA 4YB7A 4IKAA 2GS8A 4OI1A 4YB1P 1K1SA 4C8ZA 2VKRA 1N5YA 3M8YA 3QATA 1N36J 1REVA 3HX9A 4IO1A 4HL9A 3W8GA 5KFYA 1JXVA 4LREA 1KQKA 5ITHA 4RW6B 3NS7B 2CRLA 1EJ7L 1B4SA 2HVEA 5ETQA 4EK2A 1D8ZA 1JLFB 1FTRA 1YJRA 2CNKB 2DGOA 2V69A 3LP0B 2CQGA 1C4CA 3M6VA 2ZJPQ 5BJRA 1T03B 2IA6A 2E5IA 6FDRA 3GR1A 2NPFA 5AE2A 4X64J 4LF6J 4ED0A 3H98A 3I87A 1U6ZA 4JI5F 3OTCA 5I42B 5CD4H 1QSYA 1ZTWA 2ZBRA 3R5CA 3HVAA 2ZH8A 4C0BA 1HHTP 1T9XA 1VQMS 2O67A 4DCPB 4ILLA 2OMOA 2C3OA 4X4SA 3GJQB 3Q23A 3FFIB 2LYVA 3GMGA 4H4KC 3DU6A 3G4SS 3G6XA 4DR5F 4EFAC 3T5LA 3UCZP 2KTQA 1PKUA 5DQHA 2ABYA 2AT1B 3BM7A 4U95A 3NMAA 4QU6A 4PR6A 3K5OA 2BJ1A 2HBRB 5DM7Q 1N34J 2KYXA 2HPUA 1JLEB 3HULA 3A8EA 1Q81T 1EQMA 2JDJA 2XCAA 2VA2A 3N6LA 4B3RF 5HMYA 2JEIA 1JJHA 2EFGA 1JXLA 3NMRA 8ATCB 1XWLA 5AE1A 4DR3J 1CG2A 3BSAA 4CH7A 1Q79A 5HBMB 3CCZA 1JLCB 4O4GB 3PM9A 1KS2A 1NDKA 2APOA 1LWFA 4F0KA 4N41A 1CULB 3LGNA 1FERA 2G2ZA 1ZZNA 3FEXB 1UP1A 1Y3KA 3POTB 2ZH3A 4DFMA 2RHQB 1FJGJ 3CCTA 3V2UC 1V9OA 3CCVS 2RAQA 3DRXA 4F4ZA 1G3OA 1N88A 1Y5LB 3W5XA 1DFDA 3UDVA 1S6QB 2MZSA 1Q8IA 3GSIA 1ICEB 1NBEB 1NJZA 4MIWA 3RRHA 1NK0A 2E29A 1X5TA 1NKEA 3GB0A 1RUSA 2YX4A 2UUAJ 2ZUAA 4I68A 2Y1IA 1M1HA 2HBZB 2WB4A 4CRJA 1S6UA 5ETPA 5IC6B 1RT3A 2AYBA 4ED4A 5E3QA 4DV5F 3FSIA 3KJVB 1UFKA 1CPZA 2NQPA 1M5VC 3R5GA 4B9VA 5F9LA 3G8TA 3ILJA 4IOAQ 4C9DA 5A0YA 2CQ1A 2VFVA 2ZBPA 4PUOB 4LR8A 1I3OB 4WP3A 4DV6F 2OJ3A 2RE1A 2D9OA 3GIKA 3OR2B 4OQJA 5DS7A 3D9BA 1VJWA 4Z7YA 4Y2KA 2B56A 2G1HA 1FWKA 2CPXA 2I0XA 2DNNA 4ED2A 4KGXB 3IR7B 4DV2J 4ID8A 4YDXA 2KYZA 1ZM9A 2IMOA 4UZCA 2CJXB 2X3GA 2DPIA 1FNOA 4F4YA 2DHGA 2A6MA 1IKVA 2WRMA 4KRWA 1OO0B 1VRQC 4DZDA 2K1RA 3DYAB 5BYQA 3OJUA 2DRBA 4DR4J 4M5JA 3LH2S 1C1BA 1I94J 3GU0A 5EDWA 3VAIA 4QYRA 2HG4A 2I6WA 5F0UA 1S1XA 4JI7F 2LA4A 3JSYA 1KDNA 1KHWA 2ZVSA 3JSBA 4ZCLA 4QW9A 2BW7A 3KLHA 4OYPA 4JI6F 2G4BA 4NRTA 4CIOA 4P9SA 3ZC4A 1SUQB 4PABA 3MM8B 4FDFA 3ONQA 4RW9B 2FHOB 2HS0A 3PYGA 1TL7B 1FRMA 1FCAA 1REGX 2N3OA 1FNXH 4USTA 3LANA 1VBYA 1GH8A 3FUYA 4GKKF 1WJ9A 5D8HB 5IT9U 3GR0A 5CAAA 2RF2B 2V8DA 1GT8A 1S1VB 2DGTA 2ZWPA 2PMZD 3PY8A 2QLBB 5KFEA 1JLQA 4DI6A 2JX2A 3HM9A 2F4VJ 3HK2A 3D5MA 5KG0A 1C1CA 1U8WA 1VK8A 2E5HA 2FJVA 1BWEA 2OPPA 3K7RA 3VHQA 5EWGA 2IDLA 2H5JB 1GXTA 2QYCA 3MUMP 1U1MA 3PEHA 1NK8A 4DV5J 2V2VA 5CXTA 1X4DA 2V2QA 2FLOA 2IM3A 3IGNA 2FPHX 3NKYA 5GAGU 3HMJG 3UW1A 3MM9A 5HL7Q 2M3DA 1WKLA 4DUTA 2ILYA 4LR7A 4QIVA 5DRKA 3DOKA 2I8EA 4P2SA 2V5HG 1F9HA 2RMLA 2WSCC 4CYUB 3MM6B 3SBMA 1WDTA 4J9SA 3PZPA 4B9LA 1XNQJ 4FZVA 1LWCB 5HJXA 3DI6B 4C6AA 1RI7A 3HD2A 3NGSA 1RYSA 4PG7A 4LF5J 3F44A 4C4WA 1SJ1A 3G8QA 3A8KA 4Q43A 2NXEA 3Q24A 5K14A 2O1PA 2W2MP 3IG1A 2EFVA 2XGPA 2DGXA 3VZHA 1YJTA 1S1VA 2M9KA 2HVHA 1FKPA 3MEKA 2B6AB 2OPQA 2DXDA 2GO8A 1S6OA 4H4MB 4OYIA 2R2UA 2GGPB 3PO5A 4ZIWA 2J0SD 3W2WA 1N5TA 3HSDA 4GKJJ 1WF1A 4RU9A 2RNEA 2YNHA 4ZPVR 3SDEA 3VALA 2E5LJ 4F0MA 2FLPA 1S1WB 1XMOF 4I1TA 1LXJA 3JQJA 1QE1A 3FCWA 4PQUB 1U48A 4F4AA 3ISND 3R27A 4DPOA 1N5QA 1OQ6A 3FFIA 3UI3A 3I56S 1FEHA 4NL5A 5KFIA 2DCLA 4JI8F 2B4OA 1S9EA 2YWFA 3QJPA 2OPRB 2A0FB 4CDIA 4NASA 4JI4J 3PKYA 5F41A 4OI4A 2X51A 4K2XA 1IKWA 1JKHB 4EEYA 1XR6A 3B54A 3R5JB 3KKFA 3QGIA 1KQGB 2DB1A 2DEIA 4N7TA 5LXRA 3EYZA 4OZ2A 1LW2B 3D6MB 4CO0A 3GYGA 4ZJLA 1JNRB 2OUGA 2NUUG 3ZZRA 2V8GA 4GVBA 1T05A 4JOUA 4M95A 3DHXA 1LWFB 5DLGA 2ZBCA 4OV6A 2JHEA 1ZH5A 4RKUC 1P8GA 1RCXB 3MD3A 3ZTRA 4KKOA 2CZ9A 3DMJB 4H4OA 1S1WA 4OYAA 2HBYB 1NCLA 1LKZA 2V9KA 4FPRA 4B3MJ 2B51A 2FJDB 1WG5A 2E7VA 3V6DB 2VFSA 3DRRB 4C3LA 3PX4A 2KHDA 4PPDA 1PAUB 4OZNA 2L08A 1XERA 5J2NB 4ETZA 3GCXP 3TVZA 2CQHA 3J81j 1CQNA 1YJ9S 2C2EA 2PT0A 3D6FB 3RR8A 3R2CJ 2N4CA 2HS4A 2VBWA 4U96A 3CO0P 3DHWC 2XEXA 1VIOA 3NNHA 1FWLA 2BE7D 3DGVA 2NPIA 4ZPWR 2J0QD 3EWGA 2AGPA 1FO1A 2XMVA 2F9JA 3P96A 2DGQA 4LSNA 1REVB 2KZMA 1DRZA 4LF9J 2K2PA 3QWPA 2XNRA 3IN5A 3KWMA 4FN5A 2YH0A 1T7PA 2C2DA 1K0VA 3CJKB 1UEKA 2DO0A 1WKJA 2L9WA 2MJNA 2MJUA 2R7OA 2QFJA 1T03A 2CPZA 2G9OA 3SCLE 2QYGA 3RRGA 4H4OB 2HHSA 3VGVA 1ZM3A 3B4MA 4HT5A 4DEZA 5I42A 4DV4F 2UUWA 3NCPA 3MPVA 3R5BA 2BR0A 1NB7A 4PG8A 3C6TA 4MKAA 4NA3A 3MCOA 2M8HA 1OY6A 2HRYA 3M2VB 2LQ9A 3LP1B 4CO2A 2ZH7A 1Y0HA 4CLLA 5LMUJ 3QT7A 2IPOB 4Y65A 1N6QA 1F6TA 4HR2A 3PFOA 4WFNQ 3R6GB 4YEAA 1QD1A 3HSJA 1NJIT 1SV5A 2CVEA 2G0JA 4U7CA 1VQNS 4CQ1A 1H98A 3HDSA 3PX6A 3NRBA 2HKEA 5I4MA 2I5JB 3HSZA 1T02A 4L3KA 2DR9A 1JJCB 2Z2YB 4USMA 4IQXA 3BPSP 4O3OA 1GX6A 1HI1A 2RRNA 4OJHA 5G0RA 4C8KA 1SH2A 4LF6F 1XTZA 2L9NA 1JLCA 1TKTA 4O4GA 1PGZA 2YQ3A 2R7SA 4FS1A 1S4EA 2CWKA 3MAQA 3CDAA 3POTA 4RW7A 2KM8B 2WB1D 2Y3YA 2KVQE 1IXKA 3X3UA 1SCJB 3AAWB 1M5PC 1RBOB 2AEFA 5AT1B 1NK5A 1JX4A 3I5AA 1HLWA 4DS4A 4IR9A 2UXDF 1M0SA 3AH6A 2AZ1A 3O1LA 1OYDA 4LF1A 4CLFA 1N6QB 1K8AT 3BR9A 3ZZYA 2VH7A 2IJRA 4C97A 4TU8A 1UA0A 4I2QB 1T3OA 1SKSA 3KG4A 1BQXA 3C16B 4ECQA 2H65B 4TQRA 3RYLA 2MSSA 1HWUA 1UCNA 3R1LA 2DVIA 3GFXA 2NXNA 4G1QB 2QLJB 4QIFA 4DJBA 2VFTA 5H1SV 1KVIA 3FNNA 1BMQB 2BANB 3UO0A 3PKMA 2P6TA 3MM9B 2W4PA 5G0RB 4X65F 4ILRA 1RAFB 4FXWA 1M90T 5GMKa 3SSQA 2BRLA 3THPA 4QWDA 1CVJA 1NLKL 2HW3A 2B7BB 2BE9B 4U7UK 4NLRA 4RNFA 3NOGA 3AOCA 3Q8UA 4HDGA 5C25B 2MKIA 1P1TA 1TL1A 1R8AA 4B3OB 1R8BA 1IR2A 2XWYA 1UEVA 2BKOA 1VC0A 3KMSA 2IBOA 2MXYA 2WVFA 3IAM9 1UKUA 4EYIB 2JEFA 2AHOB 3PIPQ 4NEYA 2BJDA 5K20B 1WC4A 3G6ES 4DR4F 1QTMA 4ZVHA 1RTHA 2KG0A 3ENQA 5I3QA 2R8KA 1KQFB 3CCQS 2DXFA 1TTHB 3AB2B 3RAMA 4EU0A 1I94F 2HNZB 3MEEB 2YY3A 3C14B 1IR0A 2EKYA 2XZDB 4WFYA 2LXUA 5H9FJ 4NXMJ 2AX1A 2GVZA 2VONA 2K1RB 3MEGA 4M5DA 3I55S 4BHQA 2YNGB 1QM9A 3KLIA 2HK2A 4I7FA 1U0SA 2HZVA 2YNIB 4KE5A 4OJGA 2W9BA 1DY3A 1TAQA 4RW9A 1SJ4P 5E3AA 5GMDA 1MNEA 1YKWA 4QR0A 3MM7A 3BN4A 3NCQA 4QPTA 2A10A 2IY5B 3QIDA 2AW0A 4U8YA 3C15A 2KM8C 2CVIA 5J1EA 2XS2A 2D1CA 2HNDA 1TL7A 4WKYA 3P49B 2QL9B 3BR8A 1SPBP 2ZFHA 2G2OA 5GAEU 2CQPA 2V8PA 4FKYA 1RU2A 4ED3A 4J9UE 3THTA 2COLA 3HZGA 4LBHA 5DZ7A 1BC6A 2VQFF 3SSRA 1SH3A 5CYJA 2FGCA 1G6BA 4I6YA 1JLQB 1URRA 3TWZA 1U1QA 3CJ2A 1RAHB 4ZP6A 1HQUA 2W4DA 3OTBA 1OS5A 2FDNA 3U7JA 3CJSA 4CLPA 3WC2A 2CJKA 3BO3A 1VRTA 2LXFA 3GSDA 2K8GA 5HMXA 2DNOA 4J9PA 2W01A 3TQEA 1LQ9A 3TX0A 3VCDA 4NLGA 3L09A 3D3CJ 5LT5A 1XR7A 4RUAA 3ITHB 4CTAB 1WTFA 4YB5A 2MQPA 3RR7A 3CVKA 4NCAA 2X3DA 4WU2A 5FJ4A 4PEOA 1N33F 1WACA 4X62F 3CNQP 1UVLA 1U0HA 4P10A 4CYUA 4M5NA 3PIOQ 1FD2A 1FKOA 1LFWA 1P27B 3L7OA 4TQSA 1TUVA 5IV4A 4Y2IA 4K4UA 2RJZA 4DR2F 4DR7F 4CLUA 3HHKA 2QSWA 4FYVB 1OIAA 4IG0B 5KG2A 3G71S 1U1PA 3AB4B 2QE5A 1V3RA 3M8ZA 2DR8A 1TK5A 2CPYA 3T1YJ 2VU5A 4LR9A 4TU9A 3NEKA 1PSDA 4KJIA 1TU0B 1UVMA 3H5XA 4ECZA 3ISZA 2XZWA 3SDEB 4CH1A 3V4IB 4JP8A 3JAMU 2C22A 4YHHF 2V4JB 1PJ5A 2JL9A 3R5DA 1FEEA 2V8HA 3CIZA 3W9HA 3QQCD 4CLZA 4Q44A 3Q8QB 1VBZA 1FKAF 4UQGA 3SI8A 3VAGA 2RS8A 2HIYA 1AFJA 4C2MA 1X4FA 1HNVA 3BB5A 1QAYA 1U1LA 1RWPB 4OHXA 3AFGA 1RBLA 4J90A 4JI4F 5E41A 4DUZF 3ZTSA 2WSFC 3JTPA 3DOLB 2EEYA 4AUKA 3T1AA 3EGWB 4N77A 4AT1B 1MWYA 3KJVA 3H42A 3R7SB 1YZ6A 1X7VA 4Z7CA 4DR6J 3MEDB 3O2IA 3HHLB 5HJYA 5HQLA 1I51B 2DNMA 1PC5A 3G87A 4TVAB 3NL0A 2RHSB 4ILMA 2WVCA 4K4SA 2RUGA 3A8JA 1Y11A 1FTCA 2E5JA 2MKSA 3JYTB 4USKA 2K7KA 5DG8A 3Q8PB 1OQ3A 1D1UA 3BPDA 1JJ2R 2DNHA 4FP9A 3ENVA 4Y2AA 2DNRA 3CJ5A 1BHNA 1XMBA 1RAIB 2QL7B 4NRUA 1S48A 4U9RA 2ASYA 1YTYA 2UU9F 4M5MA 4XDCA 3KK2A 4EUVA 3HFZB 4C0OC 3QLHA 1NMEB 3R97A 1J27A 3GJTB 2KG1A 1RTJB 1VHIA 2F7VA 3D67A 3CEDA 4OIXA 4J37A 1T95A 4DR1F 1UW4A 2ZKUA 3T1HJ 1VBXA 1FJGF 1E6VA 2E7XA 3GCWP 3RBXA 2XMMA 1HBNB 3BREA 4GRSA 2Z8QA 2B9EA 1HBOB 4CLWA 2YQ0A 2XI3A 2IFXA 2BV3A 5I3UB 1HNZJ 1LEOA 3GIIA 4QWBA 1M5KC 1X8DA 3UPFA 5DDOC 3QGPA 4IFYB 1HNXJ 4B3TF 1B64A 5KFPA 3UN5A 2V68A 1S7HA 3FQKA 2LU1A 1VRUA 3MPWA 5EUHA 5CYQA 3Q8RB 2EFNA 3H40A 3W61A 2RQ4A 2PEHA 2FY1A 2CNOB 5KG5A 2XO7A 5EN1A 5L1IA 3VQSA 5B0AA 4M5IA 2XTJP 3GYXB 1W2BR 3SCIE 3D6HB 2ZWOA 4PKDB 2E9TA 3O5TB 2DNLA 1J5EJ 1X4GA 3D1OA 3KK3B 2GW8A 5GMEA 4X4UA 2VOOA 1FK9B 1C4AA 1JIHA 3OXLA 2BZ2A 4KH0B 4KGZB 4UOGA 1VQ4S 2I1RA 1SKWA 3EE3A 3RU0A 4UTGA 2QEXS 3GV8B 3NGKA 2CQBA 1RT7A 3T9NA 1LW0B 1K44A 4NX9A 3AOBA 3CCSS 3WBZA 1SH0A 2OIHA 3IBWA 3DRYA 4P2XA 2XQCA 1K1QA 1S9GB 2A2CA 2HQCA 2YNIA 4PZVA 3UWTA 4I64A 3M30B 2W9BB 2CDRB 2PSZA 2ZVIA 4ZLLA 2GZOA 3OTOJ 2ZZMA 1FRLA 3P4UB 4LRBA 4WFBQ 2HWTA 2FQQB 3NNCA 3AY0A 3JTNA 1OPZA 3NAIA 1N4LA 3VAFA 5ADZA 4UY8T 2OI2A 1DBDA 1FWPA 1IWGA 3BGUA 2V2ZA 4DF8A 3L9ZA 4NZ6A 3T41A 1K47A 3KUEA 3W64A 3ZO7A 4B17A 5IWAJ 3PHEA 4K4WA 3QAUA 4ZVFA 3LQVA 3GIMA 2KHCA 5D78A 4ED1A 4QCLA 1TKXB 2YNHB 2QJ3A 3FRZA 3JAMY 2KI2A 3CC2S 2MHNA 1OSCA 2EVZA 1PCAA 2G0CA 2B6AA 2MY8A 2OPQB 5DO2A 4P7VA 5GAHI 4RBVA 2HLUA 4ICLA 1S1UB 1DHMA 3V6JA 1F3FA 3FSYA 2I38A 2YPYA 1RISA 3QYYA 2EXUA 4NI2B 1JLAB 4QZVB 2DGVA 4RW8A 1FJ7A 1B99A 1GFWB 2G2YA 1HFEL 2NSCA 3ITHA 1U1KA 4FF3A 4LRCA 3EDRB 3H8YA 4TNOA 3FCVA 3TUIC 1RHQB 4DPXA 3PR4A 3BF4A 3M1VA 1QJHA 2AJ0A 1OJ4A 1UL3A 2V67A 3P5TL 4F3OA 1YRUA 4R5PA 1R8CA 3KNAA 2GJIA 2L48A 1SC6A 2AEMA 3M8SA 3KHLA 2WVDA 1Q4RA 2YX7A 1GMWD 1T9TA 5K5MA 1P6TA 2QTWA 3M8PA 3ZTOA 2PI5A 2R7WA 4C8YA 1SXLA 5T41A 2PDAA 4NYOA 4OYWA 2AQ4A 1S0OA 3QZ7A 1FRHA 3H7HB 3PW7A 3PYDA 1RAJA 2VG6A 5L9NA 2N4DA 1K0TA 2WVEA 2D3O1 5C24A 2GAHC 2ZE2B 4URGA 2XSJB 1FX4A 2K3IA 4N8NA 3OTEA 1C1CB 4F04B 5KFHA 3GILA 2YWKA 3D7SB 3D54A 3GYNA 3I0RA 5KFWA 3M9MB 1HR0F 4EZ9A 2NZ4A 1C2PA 3M6UA 1NNDA 1IBLF 3JQMA 4AL7A 1TVRB 1NH7A 2H4YB 3I32A 2G13A 2KRBA 2R8IA 1N32J 1BQMA 1SQEA 3LP2B 1YJNS 3EZ5A 2V9WA 2BJ8A 4AFFA 1WHYA 3SIPB 3Q8VA 3KG1A 4XTTA 5ETVA 1IUJA 3HHLD 3UD4P 5BR8J 4ELVA 2MKYA 5AXMA 2OO4A 2M52A 4FVCA 4UOCA 5HANA 3K5LA 4LIWA 2QMUB 3IBCB 2B3TB 2IYIA 4HDHA 2RDDA 3TVYA 4J9RA 3H4DA 2R7RA 3JQKA 2Q79A 4G1PA 4R8UB 3D2WA 4BBYA 1WKKA 3CDUA 1RA6A 3CGIA 1AB8A 1F60B 3AA9A 3F41A 4C48A 2JC1A 3BGFA 2PMWA 4LSLA 4O0IA 4X62J 4RBUA 4Q2LA 4OZ0A 3WIUA 4J9NA 3C6TB 3TRGA 4RZRA 5CYMB 4IRDA 2VV5A 3E51A 3LO3A 3PACA 1UZDA 1VS3A 1XNRF 4ALZA 3W65A 4NCBA 2M0GB 1EETB 1R3NA 1RKIA 3S8SA 4P75A 2Y0BB 3BN7A 3J7YI 1FRIA 3CDBA 3HPOA 3HFVA 8AT1B 4DL3A 3QRPA 3T9ZA 2EC0A 5A76A 2PI4A 1RP5A 3MMCB 2BQ3A 3DXBA 2VPWB 3AT1B 1WEZA 4RUHA 4NMLA 2HYIB 1MROB 2B4PA 3CCLS 1KNZA 3KUGA 2CQ0A 3MD1A 5HQ8A 3RG6A 2X1AA 4YHHJ 4O3RA 2XLJA 3KLEA 1F9FA 3SCJE 3TZXA 5K8OA 2DT9A 4LFAJ 5KT7A 1NSKL 1RWUA 4IR1A 3PW5A 4TU7A 1YWXA 2GA7A 2HVZA 5DQIA 4FVMA 1ZTTA 2QLXA 3CD7A 2V4JA 4I69A 3R9LA 4X66F 1KC8T 2OEJA 3QO9A 3EICA 4LRDA 2I9SA 3DRSB 2MKKA 3T3FA 2PMHA 1HW9A 4M5HA 1XC9A 4G65A 2FHKA 3OL7A 2DISA 2HVDA 4I2QA 2HQGA 3VGUA 2AD9A 4MH8A 3MPUB 4MJKA 3CCRS 2BW2A 4HT7A 3WHIA 2RVJA 4WXOA 5A8WA 3EVMA 4WZQA 2WW8A 3E2EA 3UN2A 2KB2A 4DV3J 1H7WA 2HWIA 1RYRA 3MR2A 3GZ7A 5D0GA 5T7LB 2M70A 3H20A 3EDQB 1R89A 1B0VA 2D69A 3JYTA 3FEYB 1JLGB 2BE2B 4DV2F 4KTQA 2UXBF 4JI1F 1FI4A 1YJUA 1VQ9S 3CD5A 1V6HA 3CJ4A 2B5JA 2OKQA 1S6QA 3V81B 2WVBA 1MSWD 1WOPA 1BQNA 3M2UB 4OZJA 3SQGA 1Y5NB 1SBRA 3QLHB 3ZZUA 3PVXA 2RD5C 3GE9A 1X0FA 1RCOB 1VQYA 2V8VA 3TW0A 4DPWA 4QYZJ 1WI6A 3T1HF 1WTBA 2KN4A 1TKZA 2ZUGA 2ZM6F 2XMJA 2LU2A 4NZ0A 1XNQF 1WC5A 2AV5A 4LUBA 2FHJA 2ZH9A 4ZN3A 1S1TB 1CBKA 2ATCB 3HP6A 4OZ3A 3OV7A 3M9OB 3QJJA 3V6HA 3D28A 4PXEA 2F5GA 2GO9A 2HMIB 1APSA 1EB0A 2BXJA 1YJ7A 4URSA 4CLTA 2ATLA 2CJYB 3WIVA 2FLLA 3G9CA 2HZAA 1S72S 1VC6A 1V3ZA 4USJC 1FXLA 2W24A 3PFEA 1TKTB 2LLZA 3FVYA 2E1AA 2UXDJ 3D3BJ 3SFGA 4DZ6A 4IH6A 3R8YA 3G96A 3C2PA 5L39A 2EI5A 3L4BC 4YQWA 1X0PA 4RW7B 1EQ0A 2KXFA 4TY8A 4KGVB 2F4VF 1TUWA 2OEKA 3G86A 1YBTA 1S76D 4PYDA 3C66A 4O3SA 1J5EF 4PXCA 3OLBA 3CCWA 2UVUA 2KXNB 1YVFA 1Q82T 1O8BA 4LBIA 4DUYF 5D3GB 4C8LA 1X5SA 2FJBB 2NYHA 3EGVA 3PJXA 4UQTA 2HHHF 3NOCA 3W2WB 3VAKA 1CEZA 3FSXA 4LF8J 1X4CA 2CQCA 3EJMA 2GAGC 3GJSB 1IJEB 1S6PA 3NBPA 3ZZOA 4EGLA 1FE0A 4DL6A 4LBPA 4DSIA 1JLBA 1CJTB 3CJQA 3GP9A 3H0PA 4HTIA 2CKWA 1RT7B 1G1XA 4MK8A 2Z2MA 4R0JA 3VVTA 4RNNA 5KOXA 1NPKA 3UN3A 2ZH6A 2DH7A 3SCKE 1S1XB 1MG7A 4X4QA 3PHTA 2JRSA 4YY3J 2VG5A 5DGBA 1U24A 2BANA 3HKZD 2KKHA 1VR6A 4DSLA 2YH1A 1KOHA 1RT2A 7FDRA 2LXIA 4QIWD 2NXCA 5FDLA 3GLJA 1IBCB 1TZ0A 3HHLC 2G0IA 2W9CB 1FFWB 3N5FA 1E6YB 2PIIA 3HJVA 2F9DA 4XDDA 2RQMA 3QRQA 2DNYA 4GMKA 4RNOA 2YQ1A 3OR1B 3UVJA 2RS2A 2IVFB 5K8MA 3UQSA 3KLFA 4R8UA 2UUAF 3N6NA 4DU8A 1XEZA 3M32B 4EI2A 2XYHB 1WEXA 5A8KB 3G8SA 2RU3A 2VIHA 3V6DA 4X4VA 4GO5X 3VWSA 1CJTA 1RKJA 2XWXA 2QMWA 3MM5B 2RIJA 4NPOA 4LVOP 4F26A 1YITS 2CPHA 4AE5A 4DCOB 5B7WA 2LCWA 2HFOA 1WNEA 2VD3A 4FYWB 2R7XA 4L73A 1RHRB 4CLSA 2GIFA 2XYPB 3VGSA 1FDBA 1PYOB 3A13A 3WZ0A 3DNCA 3PYFA 3QT8A 3X1LB 5CQGA 2ZH2A 3A1YG 2IJNA 1TUGB 4DF4A 2KFNA 2H3EB 1Y7PA 1HWKA 3MWBA 1O51A 2AWZA 2L41A 4KBIA 4QPXA 3M8PB 5KTQA 1RTDA 2C3UA 4HH1A 5J1EB 2LFVA 2OFHX 3ET6A 1OSDA 4H4MA 5AJ3J 1RT5A 2CPFA 1L5UA 1PIEA 1PO6A 1VRTB 5A8RA 1B0PA 2BRKA 3S01A 4LF4J 2GMJA 2BYCA 1BE4A 4LQ9A 1D0EA 4WYLA 1CSJA 4WIIA 3M8RA 1KD1T 4NA1A 2ZC4A 4KSEB 1UVNA 1SKRA 4PG5A 2P2CB 1R6VA 3TVKA 4XK8C 1BQMB 5C5JA 4ECTA 2G1DA 4TY9A 2AYGA 1C0UB 1QY7A 2FC9A 5AXNA 3J81U 3EGZA 4F8RA 4RNHA 3ZNUA 5BR8F 4KFBB 4JI3F 2VF3A 4PWUA 4RPFA 2VPZB 4NLOA 2PC6A 1FX2A 1RTJA 1QVFR 5F8NA 1I6JA 3QWUA 2HIQA 2IM1A 4GVBB 4IG0A 3J7ZT 2MY7A 2VJVA 4ZJQA 1PBUA 5B0GA 3OUYB 3UFCX 2ZBIA 3BGLA 5IZHA 3HO1A 2GVDB 4P73A 3W5YA 1IVZA 4LRFA 4N5SA 1NSAA 1GK8A 3H2VE 1TFYA 4O0NA 4Y2CA 3GV5B 3ZZTA 2QC3A 2IJFA 4I0WA 1YRXA 4TLRA 4ED8A 3V81A 3D0GE 1WDDA 2AP6A 2OEMA 9ATCB 5KFKA 4DSEA 2N82B 1S77D 1F1BB 1N52B 2DYAA 2HFZA 3AODA 2ZOMA 4F25A 4WZMA 2QL5B 2MKJA 2CNNB 3AA8A 3IWLA 4LJMA 4TKTA 4ZCMA 1FXRA 2BKPA 3Q8SB 4HHUA 2OH2A 5BYSA 2D3UA 3K8WA 4QOTA 2XSFA 1X9MA 4FF4A 2QG9B 2H5EA 2V4QA 1S7IA 2WBRA 3JB9k 2BDPA 2W2PP 2Z2ZA 2VODA 4UUXA 1DQAA 2Z57B 2AZ3A 1KFSA 1U1NA 3L95X 4KGKA 2O01C 2HFUA 1RT1A 4NLUA 4FYYB 2W9AA 4I67A 3KHHA 1RHUB 1RT6A 2AYEA 4ZVUB 3OSNA 4JV5F 3OFEA 3VAMA 1QVGR 2CG4A 2FJXA 1N36F 3W63A 1YHQS 1UFLA 3K2YA 4KH1B 2A1BA 3CJTA 5KFRA 2A6OA 2E44A 1Q16B 4M5KA 1CJVB 2VFUA 5GAHU 4EYHB 1Q1KA 4L72B 2DRAA 3DRSA 3H5YA 1DARA 1KEKA 5D3GA 3C3LA 3DLGA 3LP1A 1MLAA 2RB7A 5KT2A 3T5KA 1DTTA 5KFZA 1J5OA 3NG8A 1MMDA 3CUNA 1EZZB 5L9XA 1RT3B 3LOUA 3W8PA 3GONA 4RW8B 3JSMB 2LMIA 4M5DB 4A8FA 2DH8A 2H4WB 1ZETA 1NAQA 1GX5A 4LMZA 1N5VA 4RW6A 2E1RA 3US5A 4F02A 4W90B 4CNYA 2R2RA 1VQ6S 2YKQA 2PN6A 5J2PB 1G7CB 3ICLA 4K8RA 2DITA 1EP4B 3TX8A 3UCGA 3J7YU 5GAGI 2BOAA 1NJXA 4G6VB 2JEGA 1L3UA 2OP5A 3W5ZA 1X5PA 1KN6A 3WX4A 4WPAA 1NK6A 4ETXA 3N01A 4J9VA 2B8PA 1QUVA 4XIUA 4P6QA 2UXBJ 2RH3A 1TKZB 4R25A 2Q43A 2YPZA 3LWLA 3VVUA 2Y8YA 2Q66A 3DOMA 2J8SA 1N34F 2CWXA 2C42A 3C19A 2ZZNA 4NLVA 4FNIA 2K06A 3OTOF 3OBIA 4Z37A 2ROGA 3OVSA 1NM2A 1ZPVA 3SSSA 4ZP7A 1T0TV 2IC3A 3L7UA 1NSPA 3J81Y 2XLIA 2R2SA 3DKDA 3PW2A 4V19X 4FBTA 1TP7A 3Q0AA 2MZRA 4G1QA 3GTYX 2ILZA 3E8OA 1SJQA 2CUYA 4MTPA 4WWSA 5G4DA 3TZWA 2L9DA 2ZITA 2OGUA 3BQ2A 2LDIA 4K4YA 1S10A 4F50A 2K7JA 3CB4A 3IXQA 3A12A 3KDOA 1Q8LA 2R4FA 2ZHOA 4ECYA 1F5CA 3CJRA 5AE3A 4KO0A 5RUBA 1RWXB 3KUHA 5LMUF 4MK9A 3MPYA 2AJ2A 4RLEA 4B3OA 2QO3A 1L3VA 1RQ0A 4A4JA 4ZN1A 4ZLPA 2UVWA 4ECVA 3IP0A 3IGVA 3UNGC 1KTQA 2ZC3A 2QZ8A 1UJ5A 3G6VA 1T3NA 3CMQA 1CJKA 1Q53A 2GJFA 1S79A 3OTDA 4U67Q 2QN6B 3DC2A 3FKBA 4PG4A 1FFGB 3M8QA 1FA0A 4OX9F 2UP1A 2OAUA 2HQ3A 3LPYA 4ZS6A 1W2IA 4ZVSB 1I5OB 4K7QA 1H7XA 1UVKA 2GQCA 1BUXA 1JLAA 4QWAA 1G2EA 1UPMB 1R0BG 4J9KA 3MM6A 3KMQA 3D4JA 3TI0A 1PILA 4ZLJA 4A47A 1S1UA 3N9UC 3O44A 4DV7F 3VTIA 2AIRB 2C2OB 3KJQB 2QA4G 3FZBA 5FDLB 1Q5YA 5J1NA 4Y2MA 4ES2A 3ZFVA 4XPEA 3IA0A 2GX8A 5K14B 2W2QP 2C1EB 3JXOA 2F65A 4KY3A 5HK4A 2ASDA 1QDUB 3DN9A 5D4OA 2GHWA 5KFNA 2YWWA 5FLXU 1RAAB 5A2QY 2E1PA 4OHVA 4Y00A 3WX8A 1CQMA 2RRAA 2AGQA 1Y9OA 5KFGA 1FXDA 1TK0A 4EMDA 1S0NA 3K5NA 1NRKA 3K57A 3PNIA 1R0AA 3N79A 1A6LA 3M8QB 4C11A 3N4WA 2H5IB 1QSSA 2FJEB 1H2UX 3M9NB 4LIRA 3HHDA 4TYAA 1T9YA 4DR1J 2EG2A 2XSJA 4WBFA 4JI3J 3OD2A 3CXCR 4QWEA 1VQPS 3QJLA 1HARA 4RBTA 3DYAA 4Y3CA 5E2QA 4G1IA 4ECXA 2GQ2A 4A48A 5CA5A 2YKNB 2FZCB 2JFDA 3MM5A 4IYQA 2VDIA 3IRXB 3VV2B 3OHBA 4O3PA 1NJWA 5U47A 2C3MA 3KK2B 1HNZF 4W4MA 2E9ZA 4NLTA 2OD4A 3BO2A 1C0TA 2HAIA 3R3TA 4RW4A 4ZP8A 3R1HA 4DMZA 2LEBA 2YKMA 1M1GA 4K4VA 1FJEB 1FKOB 1F0XA 4TLQA 4K2JA 4LVNP 4OI0A 3BDEA 1KONA 3MM8A 3OHAA 4LFBF 2VOPA 3H59A 1R27B 3BKUA 2MZJA 3HSGA 4S0MA 3NGDA 1JLGA 2Y0SD 2QLWA 1X9SA 3KYLA 4F67A 1HI0P 3CCJS 4X4OA 3MUTP 3GQCA 4M8LA 4YS2A 5J2NA 2JJ4D 3DXSX 3ET6B 1A9NB 4B3SF 3BSOA 3DRPA 2XI2A 2DNGA 3V4IA 2DBBA 2HSEB 3BKFA 2HAFA 3TA1A 1QSLA 5ETKA 3U1NA 4LF7F 1GTHA 4O23A 4ANCA 3KXDA 1F3VA 3AQPA 4UOFA 3PJ9A 3W62A 4JUZA 3RGIA 3OFHA 3KOAA 2BVZA 1V5VA 1DQ8A 2IDEA 3M8WA 2UV8A 2R3VA 3W9JA 4C0HA 4DV7J 3THVA 1Y00A 5KT5A 1T8EA 3OJSA 3MCMA 4LF2A 1FRJA 2ADBA 1M5OC 1SIZA 3HD1A 1XMOJ 3KDNA 5HBMA 4ECRA 4DV1J 2HS3A 2IYGA 4USHA 5ETMA 3CC7S 1SQFA 1XIQA 4DX8H 3OVAA 2BQRA 2C3YA 5L8RC 3TJ8A 1QTNB 3SQOP 2EW9A 3R2DJ 1VK3A 4J9QA 4ZK7M 3H5UA 2QLFB 1FKPB 1VHFA 4OYZA 4FF1A 3DRPB 5FD1A 1SUQA 4RX6A 4B3RJ 2ASJA 2MZ1A 4WKRA 4YR0A 4AYBD 2OMLA 4WU3A 1DQ9A 4DL0C 1EHWA 2ZM6J 1S0MA 4DL4A 2R7UA 1K73T 2MZQA 3BYRA 3L7PA 2PGCA 2RF2A 2PO4A 3HF5A 3OFGA 1XQIA 3NP5A 4IQMA 4CO1A 4OX6A 2DHAA 2BM0A 1RWMB 2IVMA 3RW6A 3U1LA 1Y5IB 1D09B 5JUMA 1R0CB 2OFGX 2MLYA 3CW2C 3M4XA 2CPDA 2CIMA 3P45B 4ICLB 5D0RA 2J8AA 2OPSB 2RT3A 1FVSA 1VBKA 2B8QA 1IKWB 5GAEI 3MFIA 4DL2A 1QUPA 5CABA 1JLFA 3ZZ0A 1GMUA 2NZCA 2RKIA 2JC0A 4LSZB 4CO4A 2MGZB 1JLBB 1MWZA 2Y1LB 3HVRA 5I3UA 1S5ZA 3F0NA 3MOJB 3PJWA 1Q95G 2DO4A 1X4EA 2MLXA 2VG5B 4Q5VA 2V50A 3H4BA 2UUCF 4OFZA 1NK7A 3WC0A 2CDQA 4DU7A 2FC8A 1H74A 1NU4A 4C98A 5CYQB 1HNIB 4DX6A 2W9CA 2PA3A 1SJFA 1HR0J 3DGPA 2MPUA 5D4LA 2B9XA 4FYXB 8RUCA 4H4KA 2LEAA 4JV2A 4K5RA 4DPUA 1WC6A 1ZS6A 3T5HA 1O6XA 4AQYF 3HZEA 4WE1A 3LPEA 4I6WA 4DV6J 3PEJA 1EKSA 1Q8BA 4DR6F 3LALA 3NCRA 4OYOA 4DS5A 2W2NP 1QE1B 2DHHA 3TOQA 1M5HA 1LW0A 5J2PA 1Y3JA 2GJ2A 2QSFA 4WK1A 5LXYA 1KQSR 2J9EA 1NHUA 1X31C 1XR5A 2DY9A 1TV6A 3BQ0A 2CXEA 2PD1A 2VL1A 3OT9A 3AHPA 2AEJA 1KBRA 2ZHAA 1ZYQA 4C8OA 4OI2A 1XMQF 1NDLA 3LAKA 2RU9A 4NE9C 5F3TA 2JNJA 1HNIA 4DX5A 3HVWA 2SXLA 2XG8A 2BM1A 3E3XA 4ZDNA 2AYMA 5JMNA 1VFJA 4UUWA 1LWEB 1RTZA 2IC3B 4GC7A 5C42A 2XS7A 1HHQA 3NBPB 1ITPA 1JMTA 1UZHA 4MT1A 1PYSB 3A3NB 3KLIB 4I7FB 1IBLJ 2NSBA 4NOHA 2DD8S 4DSJA 3G82B 1Y4ZB 4I4BA 3VQTA 1HNXF 3TZYA 2GVZB 4B3TJ 5BYRA 4K4ZA 2MYFA 4Q45A 3OL9A 2U1AA 3IWNC 1CS4B 4TN2A 1HNWJ 3ENAA 1DURA 2OLWA 1R31A 2MSTA 2P9CA 4HI2A 4I6AA 4KFBA 4E98A 5KAKA 4JYAF 3M1VB 5KG1A 4C3MA 1YBAA 4J5OA 1U2FA 4HACB 3TUZC 2IBKA 2DGUA 1C0UA 2FY8A 3BBFA 3SV4A 4OMFG 3KG0A 1F2HA 4NLSA 4BWJA 3TR5A 2KJVA 3MMBB 4UF4A 5L38A 4JV1A 5LMNF 5HLFA 1WELA 3MXHP 1AT1B 2IA0A 3JSRA 3DI6A 5DLFA 4OYMA 2HGMA 2R7TA 4N47A 4P2FA 2C2KB 1SB6A 1TR0A 4H54A 5KG4A 2XS5A 4OJ1A 1QAXA 1T9WA 2EKNA 3BBBA 1GMWA 3P5BP 4ZVRB 1UWBB 2BJ7A 3E01B 1RTIA 3KK1A 1ZA2B 2VG6B 4CT9A 1SQGA 5HQMA 2ZDPA 2J7UA 3ILOA 1YRTA 3W60A 4KPYA 1RT4B 3HJFA 2QFIA 3DFEA 5E3PA 3HI9A 3R7BB 3Q2SC 1U2RA 1D9DA 5DDRC 5KT3A 1UA1A 1CS4A 2OHDA 3MUVP 2XM3A 1Q5VA 3CIMA 2CJAA 2PFDA 4ANEA 3I5BA 5ETTA 5LSLA 5C7PA 1KLNA 3W7BA 1TVRA 3KHGA 3FZ2A 2ZOFA 4HI1A 1S9EB 4L6V3 4X4TA 5LMNJ 4PWWA 4BS2A 3QZ8A 1V5IB 3CCUS 1FD8A 3QT6A 4JI1J 2GIQA 4U7UD 3MF5A 2VFRA 2RSQA 2EBEA 4F36A 1JKHA 2VA3A 2AJFE 3OXFA 5HATA 5KFOA 1RWWB 4LF4F 1BGXT 2VPYB 5B0EA 1YQHA 2D41A 2QMXA 2ROEA 3NWGA 2MQLA 4CM2A 2BJ9A 3H25A 4KHRA 2ZH4A 2V63A 2P9EA 4A8YA 2YNFB 2DR5A 3ULHA 1RXOB 1MW7A 4WYWA 3SV3A 1AZSB 1RAEB 4NEZA 2BMBA 3K89A 4ERDA 5KFTA 1EIYB 5A8RB 4Y34A 3TA0A 1RT4A 3ENWA 2OTJS 2P9GA 3BBCA 1GNKA 1W26A 3DMJA 1BQNB 3IRXA 3LF0A 2J7KA 3P3DA 2YVSA 3SQGB 1HBUB 1M1KT 1EAYC 5DG7A 1HNVB 3F73A 4DPYA 4EZ6A 2HHPA 3B78A 2DNPA 3O8WA 2P6SA 3OXGA 5CYMA 4IDKA 5B0CA 4DR2J 4M94A 1D8YA 2OELA 3VGTA 1DAXA 2J0XA 3GFHA 2IIHA 4ZVTB 3CJ0A 4ER8A 2HMIA 1N5SA 2ROPA 1EETA 5CCMA 2BJ3A 1ZAXA 2YKMB 1X4BA 3Q83A 1UPPA 2ZKTA 4KPCA 5HROB 4YOEA 3MMCA 1T9VA 4MKBA 5F8HA 2IRYA 3F56A 2NLWA 2EBGA 2HHVA 2DR7A 4NMXA 3QMQA 3EVOA 4IFVA 1CULA 3HKWA 2GHVC 3MEDA 1MMNA 5F3ZA 2DNKA 2XY5A 1VQSA 5IQQA 4ZPBA 3FJ2A 5LJ3Y 3HXMA 4OYBA 3KLEB 2F1FA 3LAMA 4BCAA 4OX7A 2UUBJ 3B8HA 4OL8A 2DPJA 5H9FK 2DTJA 5J2QB 1F9EB 4MK7A 3I4HX 1RAGB 1YI2S 2Q6CA 4IDKB 3RBZA 2CQ3A 3M2VA 1E6VB 4K50A 2NS1B 2FJAB 2BBEA 4RJVA 4AD6A 1VQLS 1S6PB 2LEPA 2BOPA 1N32F 3UDEA 1O5JA 2FHMA 2WONB 4J9OA 2F4FA 2XZTB 3ELHA 4KHPJ 2VG7A 3U27A 1SC3B 4DN9A 5B0DA 2GC8A 3UR3C 1NO8A 4QU7A 2DHSA 3D1QA 1PC4A 2JWNA 2KH9A 4DV1F 2OTLS 4HEA9 4JI2F 5KFSA 1VRUB 4KR0B 2J6SA 1RLCL 4MYUA 2CQDA 1WHXA 4LFCJ 2F8EX 2YWGA 2AJ4A 4KIAA 4OYXA 4EWTA 4IFYA 4DQRA 5HVHA 3CCES 4RU2A 3DLEA 1BY9A 1LNQA 4DPTA 3MMAA 4DFPA 2FUG9 5FIIA 2WSEC 1H3DA 2D7SA 4ECWA 2J0WA 2B5JB 3BZQA 1JWWA 4DSFA 5L1KA 3PTWA 3I9V9 4USWA 2DHXA 3MTJA 5EWFA 3W1YC 4JI0F 4OV1A 5HN0A 1FDDA 2F40A 4ECUA 2B43A 3CJ8A 1WD6A 3M2RA 3DLKA 3M32A 3MZIA 1RSCA 2BKNA 1U8SA 2IRXA 4RWWA 1IBMF 2QX0A 1S1TA 3W66A 3A3OB 1S9GA 4X64F 1HYSA 2W1BA 4QIEA 3ZXWA 4C7QA 3FBCA 2FVCA 3G82A 2VG7B 3KFWX 3RTVA 1KSPA 4USIA 5F8LA 1X60A 2D74B 4ZJOA 4ANDA 2YTCA 4WFAQ 3DOLA 2O66A 3NGTA 2XCPA 1ZA1B 4IG3B 2IMWP 1FRXA 2E66A 2BEFA 4USUA 2MQ8A 2Z58B 4CCHA 2HHQA 3CDEA 3I96A 5D0EA 2RQKA 4TY8B 1IKXB 1U25A 2VHGA 1QAIA 1WOSA 2BX6A 2E5LF 1J2VA 2LVWA 4OI3A 2Y9HA 3TUPA 2EK1A 2QGFB 3DGPB 4M63A 5CZXA 3BKTA 4OHZA 5B08A 1TFWA 4CLKA 4HTJA 1U26A 5H9EJ 1B7FA 3K8VA 2DH9A 2HFSA 2DGSA 2BJEA 2UV8G 4LRAA 4P72A 1N56A 3OW2R 2VBZA 2XBPA 2XMUA 5M2PA 1RTDB 1XNRJ 2MEWA 3QT5A 1R8PA 4QW8A 5ETSA 1D3WA 2MZTA 1RHMB 2PEBA 3Q8YA 5ETOA 1KLMB 5DDQC 1UWBA 1IQZA 1ZM2A 3DLKB 1HHSA 2XMKA 2J9DA 1Q8KA 4FNHA 3V4MA 4O3QA 2VDHA 3RB4A 5IT4A 1RTHB 2NUHA 2Z30B 2MQMA 2ACMA 2M7SA 1IR1A 5KFDA 3IC1A 1Q78A 2JLFA 1UETA 3J80Y 3CSKA 2XB2D 5IM0A 1H73A 1NK4A 4IH5A 1SC1B 1JJ4A 2AU0A 2NXJA 1R43A 5IWAF 2P8IA 1EKRA 2X1BA 3KHRA 4DFKA 2UUCJ 1DTQB 2MTLA 3AD7C 4RUCA 2V4RA 2W7OA 4KB7A 2C2MB 5LM7E 2DEJA 2F63A 3NS6A 4B3MF 3FCHA 1RE1B 2EFOA 4WFXA 2J9CA 2MMYA 3CJKA 1FJCA 4KT0C 2RILA 1RJJA 1OMSA 3NY0A 3OR1A 1GXUA 3UVJB 2ZH1A 1XK8A 1VYAA 5KFLA 4M1KA 2UVVA 2WW4A 5THWA 4KQZA 4FF2A 3IMQJ 4A8KA 3M05A 1Z2ZA 3GPAA 2Y1RI 1KVKA 2N7YA 1VC5A 2RDJA 1IM6A 4DQPA 1FE4A 5DQGA 1U4BA 1D9FA 4DR7J 3CULA 4OHYA 3PW4A 4O44A 4OI6A 4KV8A 3V6KA 4CTAA 2NYIA 2HHXA 3SEOA 3ILIA 4PUOA 3K59A 4DQIA 4PAAA 4J9MA 3MMBA 4RR5A 4X4NA 4MKVA 3TAPA 2KFZA 2ZD1B 1GTEA 2DR6A 2ZNYA 3K5MA 4JV5J 3ZZZA 4CO5A 5HMZA 1WUUA 4A8XA 2YKPA 1YIJS 2BQUA 2HURA 1XJWB 3HCXA 2DCUB 4W98A 4WP9A 5HLFB 1UVJA 5B0FA 3MTKA 9RUBA 5EHHA 1HBNA 3UD3P 4X4RA 2HQFA 2QA4S 5MLCV 2J6TA 4B3SJ 2B7CB 3H2LA 1JB0C 4IFVB 1LW2A 3OL8A 4DV0J 5HVGA 4LSLB 1ZAWA 3PRDA 3RW7A 2XY6A 1VJQA 4J7CA 5E5NA 2RDIA 4NLQA 1RWVB 4P74A 2KJWA 1RABB 3MDFA 4ZPCA 3ZZPA 5IT9Y 1LXNA 2E9RX 3DCAA 5J2QA 1P9QC 2CPEA 2GQQA 2WCXA 1HWLA 4Q8EA 2F8MA 1MWQA 2CJ9A 3UE2A 2HGNA 4RW4B 5HO4A 3SMZA 5DG9A 4DV4J 2UUTA 1BXNA 1WC0A 2HQIA 3U1MA 1FVQA 5F8GA 4DQSA 4YDDB 1Q7LB 2IAJB 2CFXA 4CI0B 2MLZA 4WXWA 3KLGA 1MN9A 1TELA 5CD4A 5CZVA 1MROA 4NZ7A 2FYXA 1UAWA 4R5PB 4PWDA 3W3SA 3QBCA 2JVRA 1P9YA 4Q2MA 5IT0A 2HHUA 3LGMA 4UOHA 5C2CA 4PRFA 1AFIA 4LQ3A 1QLNA 1PYTA 4ID5B 4LSNB 2VC1A 1H0HB 5C25A 3CMAS 3PYEA 4HYKA 2C2ZB 2W8KA 5BXIA 3DLEB 1V3SA 3TJAA 1WSVA 2KO1A 2QT7A 1H2TZ 3TP2A 5HSPA 5L46A 2F8HA 3ADAC 4FKXA 2N7CA 4UY85 1F2GA 2CYYA 1KVJA 4JI6J 3I82A 1UJ6A 4WFZA 3EZOA 1U1RA 3I6PA 4JI5J 4OZ1A 3IFEA 3CO9A 1TKXA 3Q22A 2IVYA 3I4PA 1NJYA 2CG8A 1RDRA 3FMBA 3FQLA 1R7IA 2IAJA 5CHCB 4HHHA 4YB6A 1N54B 1N5YB 4GKKJ 3IWXA 2FD2A 4OZLA 3TAMA 4NYPA 4ZPAA 4CH0S 5KFJA 1HBOA 3M6XA 2V2KA 1CJUA 2VUGA 1HI8A 4BC7A 3NGRA 5HROA 1TV6B 2DIUA 2YBVA 3IO1A 2ERRA 3P6YC 2KZZA 1WOOA 4FXVA 4LT6A 1U09A 3C6UA 3LTOA 3UD5A 4X4PA 2OD6A 2UUBF 1RT1B 2CA9A 2W25A 1IJFB 1HWJA 2WBMA 2ZZTA 1HD0A 4ZOSA 3ZTQA 5C2GA 4JBCA 2XMTA 2DIVA 2W2OP 4ZKAA 1ZPWX 5JXSA 5A2QU 3PXGa 1Q7YT 2BE2A 4X66J 3IS9B 4XO0A 1W25A 2HNDB 2HZCA 5ETNA 3N6MA 2DY1A 2VBXA 3I0SA 1SC4B 2JOQA 3QIPA 3S6EA 1TQLA 1UEUA 3GV7B 1X9WA 4N56A 4AQYJ 3RB0A 2ACYA 1J5OB 4KGMA 1NB2A 3DLGB 2OSQA 2WONA 3KTQA 4ZPTR 2MQQA 4V1Ak 3QPIA 2B9YA 1Q0NA 2WOMA 1IKVB 3A8IA 1RHKB 1UTAA 1H6KX 4WJBA 5CH7B 4ZCKA 3DU5A 5SUHA 4F0HA 5DM6Q 4BDPA 3M7VA 1FK9A 4F4WA 4GC6A 3IAS9 4WIQA 2MGZA 1DZ5A 5DJBA 3OQ2A 3NLCA 3JSMA 4NLXA 4E2FB 2OPSA 1HBMA 5HP1B 3I0RB 3KJNB 5CCLA 5AJ3F 1SVDA 2GNKA 3K17A 5KFAA 4WF9Q 3W9IA 1IKYA 1U0HB 1Z2LA 2NCKL 4AXIA 5KT6A 4Q0BA 1OWXA 4LFAF 3QRRA 3CD6S 2LQ5A 4HACA 1PJ7A 3MR3A 1H72C 4USVA 2GCFA 1I1GA 1HMVA 2I2YA 3OVBA 4B08A 1GAOA 2M5YA 3J7Z5 3HT3A 3RB6A 5JVGQ 1URNA 3RJMB 1FT8A 3I31A 1VMBA 3DOMB 3TJ9A 1ULRA 3UDCA 1RK8A 4C11B 3CF5Q 2X1FA 2WAQD 4D3GA 2CZVC 2WOMB 4IRCA 3AD9C 4GVLA 1Q86T 2YKAA 1ZAVA 3PW0A 2POKA 4ZVPB 5L1LA 1ELOA 1RU1A 2HLTA 3MMJA 2ZHBA 3DLHA 1HYSB 4FBUA 2UXCF 4YFUA 2FHJD 4UZBA 2JZ5A 4ZCIA 1U6FA 2FLNA 2H51B 1AROP 1VGYA 4X84A 4IUFA 2AJ1A 3A4TA 5AXKA 3R7NB 3T1YF 4FYDA 5KFVA 4K0KJ 4IO9Q 2LP4A 3RAQA 2Y1JA 1VQOS 1IKXA 3BSNA 5KFQA 5F8JA 3VAHA 4NCGB 3D6TB 1TL5A 3OR2A 1AUSL 4N8OA 1NKCA 4JI7J 3AJDA 2R8JA 5KOWA 1UWAA 1NXIA 1T11A 2MHEA 2MKHA 3EMTA 3Q2TC 1FHTA 4I2PA 1X4AA 2JFKA 1FNMA 2W4CA 1RGVA 3N28A 2R9LA 1YSJA 3DDNA 4CLYA 3R6LB 4NA2A 5B09A 3C46A 1HQEA 2Q3PA 3RBEA 2YNFA 4J9LA 1KLMA 4DDFA 4QYZK 3MOZA 2XHWA 1SL0A 4YMEA 4K4TA 1O0PA 2EFQA 2VKZG 4OHWA 5DGAA 4ED5A 3JTOA 4NLYA 5IQ6A 2YWHA 1YJWS 3EUNA 4JB8B 1NHVA 1WC3A 2XHCA 5ETRA 3PV8A 2LECA 1HBUA 3TAQA 3HT0A 2BUNA 1IQTA 3Q89A 4DN0A 4DL5A 3DDKA 3FK4A 3QO9B 2A2DA 3KNGA 4E0DA 4TYBA 3FBEA 1TL4A 1S97A 3AXKA 2YKOA 3NAHA 3D1HA 4F4KA 3GWCA 4O4RA 3BH6B 2XO6A 2CPJA 2B4VA 4BC9A 3FBFA 4ED6A 1CC7A 4Y6IA 3IM8A 4IOCQ 3HHNB 3LP0A 4CZCA 5I3PA 2UU9J 1U1OA 4MKYA 1BD6A 1FF2A 3JS9A 4DUZJ 3E01A 1IBKJ 3B6BA 1RLDA 4PQAA 2CQ2A 1EARA 3BEGB 1NUEA 1KFDA 2M8DB 1RWNB 3MGJA 1S4FA 1OY8A 2E7WA 4B9MA 1IN0A 3TNVA 1LV5A 3VAJA 2V0NA 4A8SA 3HVTA 3EXYA 5F8MA 4RL1A 4DSKA 1JLEA 4WK3A 1N0VC 2WTFA 4KC5A 4ZLNA 4B9NA 4YN3B 2LQBA 5J2MB 3MAHA 3PO4A 2AX0A 2DRDA 2GMLA 4NWBA 4DWIA 1HA1A 2GFFA 2FVQA 3LW5C 3BS9A 4NYZA 5KFBA 2H9ZA 2WZ1A 1U47A 1KHVA 2IRUA 3MAAA 4ZVQB 3J7A1 2HVIA 3IM9A 1CJUB 4M5GA 3MCSA 4BWMA 5LSRA 2C28A 6AT1B 1VQ7S 1WG4A 3ISNC 3PG9A 1D9AA 2GVDA 4PXBA 4C8NA 2VZ9A 3WQPA 4ES1A 2Q6BA 1G4CA 6FD1A 4ES3A 3UR0A 2KL8A 2MKCA 5C24B 5IFMA 5E33A 3QFWA 1PAEX 1RWOB 3AJ2A 3RZAA 2CQ4A 5GADI 3MR7A 3HHLA 4A8OA 4GO7X 2RUSA 1UJ4A 2XMAA 3LA0A 3BJYA 1UMJA 1IM4A 2XULA 2QV6A 1TL3B 3FEZA 4MFBA 1Z4UA 5KG6A 4K4XA 3GFZA 1SI9A 1WEYA 1YDLA 3BV8A 4ZIVA 2OPRA 2XC9A 2W8LA 1BLUA 4WE1B 2RRBA 3DLJA 2E1MC 2HBQB 1TMJA 2L3MA 4XAKA 1R6YA 4IRKA 2VQFJ 3D66A 4NXMF 1EX8A 5EGYA 3QSYB 3NNAA 2GV1A 3TYTA 3MCNA 3LWMA 1LFPA 2VQEF 4MYTA 5FLXY 5F9NA 4PWDB 2FVRA 4AXJA 2I5JA 5F8IA 4Y0FA 1WC1A 5HVFA 3VZIA 1KOOA 1MU2A 4CWBA 4EBEA 4URQU 5T7LA 4BLGA 2HRTA 4M5LA 1A7GE 1HD1A 1HWIA 4HH0A 3TZZA 2O5DA 2QIFA 1LK7A 4L75A 3EZUA 1HL6A 1L3SA 4ZA1A 1RT5B 1N8RT 2IM2A 1NDPA 4DG1B 3K5PA 4DXLA 4DX7A 1RWKB 4FS2A 4MMOA 3DRRA 4PCQA 4JI0J 2AMCB 3K0JA 1CLFA 4KHPF 2KT2A 2UZAA 1ZOTA 1HW8A 3GJRB 3I5CA 3DLLQ 2B0GA 3S7RA 1X4HA 1NSQA 3BYPA 2CPIA 4O3NA 4F2RA 3FBBA 3PDNA 4U8VA 3BDPA 2C3PA 3O6QA 1H38A 2GIRA 2HNYB 2RKIB 2VC0A 1S57A 3KK3A 4ZVOB 5KT4A 1EP4A 2PE8A 3EGNA 4JV0A 4QR1A 2MQOA 1B3TA 5E7OB 2H1YA 3UDLA 3O3LA 4EO6A 5D6GA 4LF7J 3VF0B 2XGQA 5IM0B 2J6UA 3C6UB 1YGYA 2IHR1 3I0SB 3KLHB 4TXSA 4WTOB 3RB3A 1HPZB 2CJBA 3M30A 5T14A 4QBUA 4NCGA 4DLEA 2XMWA 1WSRA 1SKUB 1YG0A 4KHMA 4DG1A 1GXLA 5MAOA 2C2RA 1N33J 2M2BA 2QRRA 1GEHA 2HFNA 4I2PB 4E8UA 5LOQA 1TMMA 4KYZA 4MIBA 5K9FA 3OPKA 3MR5A 1RHJB 2GHPA 3N5BA 1RTIB 4OJ3A 3KK1B 1HNWF 2U2FA 2HNZA 3MEEA 2R7VA 3QFHA 2HQDA 4YR2A 3TANA 3RAXA 4Q7AA 3B82A 5ETLA 1HIYA 4YP3A 4DQQA 1T9UA 4NI2A 2MB0B 1LOUA 1WHWA 4PG6A 2X7IA 1VDHA 1ACMB 3DOKB 2W7PA 4EBCA 1SL2A 4Q0BB 4QQBA 3GIJA 2NR0A 3TEGA 1ZZFA 4K5SA 3VR1A 1YJVA 4HVZA 1UW9A 2ZDOA 5HP1A 3RBDA 3MM7B 1FDAA 1B7YB 3BGRA 2V6AA 2JLEA 3EVWA 4UT4A 2KFYA 5A0YB 4QWCA 2HHWA 4NLDA 4ELTA 3OLAA 2EWHA 3C15B 3U02A 3H5SA 2J76E 4J91A 1JK9B 5LL6d 4ZITA 2ALZA 1SIWB 1U49A 3NGUA 5M2RA 5E0OA 2Z0GA 5EWEA 4DOZA 1AZSA 2FVSA 3BH7B 3OFFA 1WF2A 4RUBA 4CO3A 4MIAA 4EO8A 5JVHQ 1DLOA 4YY3F 2GGPA 4DHVA 1DTTB 3TQ1A 2UXCJ 3OL6A 3N0VA 5KFCA 2D3ZA 2DXEA 4ZPDA 1AUDA 1L3TA 1VOMA 2R7QA 3HHEA 2N3LA 5A8KA 4RNMA 3QGHA 5KFMA 3CCMS 4YR3A 2JSXA 5KFFA 5M2UA 4IH7A 2M4MA 5AXLA 1P1LA 1AXQA 2KT3A 5E3CA 3KJFB 1C1BB 3AOAA 3QGGA 5LJ5Y 2ZE2A 2XNQA 1MMLA 1RBAA 4OX8A 4R0EA 5J2MA 1JNZB 1NEEA 3AXMA 4OZ5A 3EPIA 2HRUA 3SYZA 1WI8A 1N48A 5SZTA 1U2CA 1RB0A 2V34A 4OLPA 4PXDA 4NLWA 5A8WB 3MR6A 4CP5A 5B0BA 2R8HA 2VPXB 2MDAA 3FC9A 1ZBTA 4CM0A 3FGVA 3K58A 3SZ2A 1WF0A 1S0VA 1DTQA 4JI8J 2E1CA 1WWHA 4DR3F 4LF5F 3LP2A 4P52A 3HFKA 3CC4S 1F5BA 3MPDA 1S12A 2H48B 2B4UA 5KG7A 2IM0A 4X65J 3T6BA 4D3HA 2C2NA 1N0UA 1T05B 3FMWA 2WHOA 3TA2A 7FD1A 5HI7A 2QA1A 5IOLA 4ZHRB 4ID5A 1MN7A 5D15A 3CDWA 2LQJA 3CD0A 3ZTPA 1L3KA 3MHYA 4O44B 4KKOB 5GVQA 5IS2A 2BACA 4DR5J 4K59A 2Q1LA 2KRRA 4DBQA 3MFHA 2VICA 4F4XA 1FESA 5K8NA 1NK9A 2HEKA 2HHTA 2NREA 2K3KA 2YKNA 5IV3A 3PCOB 3FRYA 2VB6A 4YUDA 7AT1B 5JJBA 4QIGA 3TUJC 4KAIA 1C0TB 5D0HA 4L74A 3TAMB 3PX0A 2Y8WA 3BSCA 4UW2A 2RQCA 1VIXA 4CNZA 2ZJQQ 5D4NA 3OSPA 3QNWB 1E6YA 4F2SA 1B70B 4QJVA 1NDCA 2LA6A 5DZ6A 1YZ7A 1TK8A 1FDNA 4WP8A 5H9EK 3DDIA 2J9DE 2QA2A 1AA1B 1S9FA 3H90A 2BA9A 5IXUA 4Z2XA 3KLFB 1UVIA 3MURP 2AJQA 4ZHRA 2FVPA 3OUYA 1CJKB 1AYEA 3J7AN 3MI7X 3MMAB 4N76A 1HQUB 3HLUA 2JLGA 2ZJRQ 4B9TA 2WK4A 2ZH5A 2HK3A 2R2TA 1NH8A 1YLXA 3CE8A 2Z2LA 1SV5B 1ROFA 1S59A 5HAOA 4ENOA 2DNZA 1RACB 1XMQJ 2VASA 4B02A 4JYAJ 1RADB 2CQIA 2HFVA 3NS5A 2Z4PA 1LK5A 3KLGB 4JI2J 3M6WA 2CZ4A 4I56A 1SL1A 1WORA 3D0IE 4LF8F 3PRVA 5KG3A 1HBMB 1KTVA 2FJWA 2LQ8A 3LGHA 1PJ6A 2J5AA 3C8YA 1QAJA 3BGOP 3TARA 1AW0A 1RT6B 1NPPA 2EK6A 2LKZA 3UCUP 2XY7A 2HHHJ 4LF9F 5LSOA 4B9SA 2DKOB 2D3OR 4QR2A 3G2XA 1VCTA 2FTRA 4KO0B 2AGOA 3EX7B 5F0WA 1FFSB 1Y10A 4PPZA 4LFBJ 1KWMA 2KVIA 3M2UA 1IBMJ 1IWAA 2YXLA 2PFFB 2AKWB 1F5AA 3SXLA 3G6YA 5D4PA 2H54B 4EBDA 4NXNJ 2EG1A 2KT5A 2A18A 4MFBB 3ZNJ1 1NKBA 4W92B 2V94A 3QAEA 3RRKA 3CTRA 4C8MA 3IRWP 4ECSA 2Z56B 4HLBA 5GADU 3EPGA 4ITSA 1S99A 4AL5A 3C16A 4DUYJ 3J80U 5L1JA 1NZ8A 3NWRA 4XPCA 3W2VA 1NZAA 4FPIA 5A6PA 4ZMMA 3BQ1A 4B9UA 2OSRA 2CJQA 1TKDA 1A0OB 1TL1B 1PG5B 3TO8A 1MU2B 5HMWA 4DCJB 5IC4B 2UVRA 3BGRB 2EC2A 5DDPC 4ZVGA 4Q8FA 2ZNZA 2ZOGA 3AD8C 2VBYA 4L76A 1NHKL 3WDOA 1CC8A 4K0KF 3QIPB 1VQ5S 4DL7A 3DM2A 2DK2A 2YX1A 3PR5B 3D0HE 3IS9A 3NXZA 3Q86A 1GQEA 1KP6A 2FIUA 2ZEJA 2A3JA 2FZKB 1Z1ZA 3FDSA 3KLVA 3CPWR 1M5SA 4ZVEA 4F7VA 2HNYA 3T6JA 2OPPB 3AQOA 3H2UB 2CNLB 4RO0A 1DLOB 3M2RB 1YBUA 1R0AB 5KFUA 1TAUA 1LWXA 1HQEB 1JXEA 1B0TA 2VQEJ 3L3CA 4DFJA 2D9PA 2YWEA 3QSIA 5E3RA 3V5RA 2GMHA 4MAKA 1XBWA 3C14A 4F3MA 3W2VB 4ELUA 3ILLA 4U6PA 4NXNF 2J7WA 1R8HA 1UFWA 1OPIA 1VLOA 2FGOA 1IKYB 2YNGA 2XLKA 4P7TA 4IG3A 2X1GA 3T19A 2EFPA 3T5JA 4PYAA 1LWCA 1HQ2A 4ATNA 2EPIA 4ED7A 4Y28C 1RT2B 2MQNA 3IR6B 1VISA 2FB0A 2BABA 2KDOA 3R5AA 3CT9A 4C3KA 3DM2B 1LWEA 1CJVA 1HPZA 3TEHB 2PA8D 4A8WA 4HKQA 1BWVA 1XN9A 1U6BA 4V19J 4GKJF 3BO4A 1OYEA 3A3PB 2B9WA 4A46A 1VQKS 5KFXA 4OLOA 2W7AA 1OY9A 5J1PA 2KU7A 1HMVB 3IG1B 5D77A 2KXHA 3S1TA 5C42B 1U02A 3GIRA 4G3IA 3IR5B 2VJUA 3HVTB 3RUBL 2HWHA 2ADCA 5EX0A 1KKHA 3EXCX 1VI7A 2LDYA 1S49A 2XYGB 5DETA 4WTYA 2NXUA 4FXDA 3ETOA 2DNQA 3AJ1A 1VLYA 3MECA 4P71A 2ZBQA 1H2VZ 4WCEQ 2HGLA 4PQUA 1NPRA 3CMES 2P5VA 3GG0A 2M88A 4P2MA 3MAAB 4LFCF 4L3NA 2FZGB 1FRKA 4IOBA 1RAOA 1RZMA 1PBAA 2AF6A 1T94A 4CT8A 4DV0F 4A8MP 1WHVA 4OX9J 2R42A 3SFUA 1U7LA 3D68A 5A6WA
chains in the Genus database with same CATH topology
1IBKF 3LUYA 4F3QA 3CWJA 1RA7A 5K8PA 2JEJA 4A8QA 2JVOA 4RWXA 1KR4A 1K9MT 1DJ0A 3CJ3A 3I9ZA 3PRBA 2JH3A 1SJ3P 4DV3F 4DLGA 2F3JA 4KV8B 5EX3A 1KRPA 4AL6A 1ZM4A 1TL3A 1WG1A 2DGWA 3GG1A 2R8GA 3DLBA 4X2BA 1SJRA 3MECB 1U45A 1VQ8S 3MEGB 2ASLA 2E5GA 2ZD1A 3B4DA 4ZP9A 2DJWA 4NLPA 2O3DA 3GFYA 4HHJA 1X5OA 4YB1P 4C8ZA 4YB7A 4IKAA 4OI1A 1K1SA 2VKRA 1N5YA 1REVA 3HX9A 4IO1A 4HL9A 5KFYA 5ITHA 1KQKA 4RW6B 2CRLA 1D8ZA 1JLFB 1FTRA 1YJRA 2DGOA 3LP0B 3M6VA 2OH2A 2CQGA 1C4CA 2ZJPQ 5BJRA 1T03B 2IA6A 2E5IA 6FDRA 3GR1A 2NPFA 3H98A 3I87A 1U6ZA 4JI5F 3OTCA 5I42B 5CD4H 1QSYA 1ZTWA 3R5CA 3HVAA 2ZH8A 4C0BA 1HHTP 1VQMS 2O67A 4ILLA 2OMOA 2C3OA 4X4SA 3Q23A 3FFIB 2LYVA 3GMGA 4H4KC 3DU6A 3G4SS 3G6XA 4DR5F 4EFAC 3T5LA 3UCZP 2KTQA 5DQHA 2ABYA 3NMAA 3BM7A 4QU6A 4PR6A 3K5OA 5DM7Q 2KYXA 2HPUA 1JLEB 2VA2A 3A8EA 1Q81T 2JDJA 2XCAA 4B3RF 3N6LA 5HMYA 2JEIA 1JJHA 2EFGA 1JXLA 3NMRA 1XWLA 5AE1A 1CG2A 3BSAA 4CH7A 1Q79A 5HBMB 3CCZA 1JLCB 4O4GB 3PM9A 1KS2A 2APOA 1LWFA 4N41A 3LGNA 1FERA 1ZZNA 3FEXB 1UP1A 1Y3KA 3POTB 2ZH3A 4DFMA 3CCTA 3V2UC 1V9OA 3CCVS 3DRXA 4F4ZA 1G3OA 1N88A 1Y5LB 1DFDA 1S6QB 2MZSA 1Q8IA 1NJZA 1NK0A 4MIWA 3RRHA 2E29A 1X5TA 1NKEA 3GB0A 2YX4A 4I68A 2Y1IA 2WB4A 1S6UA 1RT3A 2AYBA 5E3QA 4DV5F 3FSIA 3KJVB 1CPZA 2NQPA 1M5VC 4B9VA 5F9LA 3G8TA 4IOAQ 4C9DA 5A0YA 2CQ1A 2VFVA 4PUOB 4DV6F 2OJ3A 2RE1A 2D9OA 3GIKA 3OR2B 4OQJA 5DS7A 1VJWA 4Y2KA 2B56A 2I0XA 2CPXA 2DNNA 4ED2A 3IR7B 4ID8A 4YDXA 2KYZA 1ZM9A 2IMOA 2X3GA 2DPIA 1FNOA 4F4YA 2DHGA 1Q82T 1IKVA 2WRMA 4KRWA 1OO0B 3OJUA 2K1RA 3DYAB 5BYQA 2DRBA 3LH2S 1C1BA 5EDWA 3VAIA 4QYRA 2HG4A 5F0UA 1S1XA 4JI7F 2LA4A 3JSYA 4ZCLA 1KHWA 2ZVSA 3JSBA 4QW9A 3KLHA 4JI6F 2G4BA 4NRTA 4CIOA 3ZC4A 1SUQB 3MM8B 3ONQA 4RW9B 2FHOB 2HS0A 1FRMA 1FCAA 2N3OA 1FNXH 1VBYA 3LANA 1GH8A 4GKKF 5D8HB 3GR0A 2RF2B 2V8DA 1GT8A 1S1VB 2DGTA 2PMZD 3PY8A 5KFEA 3HM9A 1JLQA 2JX2A 3HK2A 3D5MA 5KG0A 1C1CA 1VK8A 2E5HA 2FJVA 1BWEA 2OPPA 3K7RA 5EWGA 1GXTA 2QYCA 3MUMP 1U1MA 3PEHA 1NK8A 5CXTA 1X4DA 2FLOA 2IM3A 3IGNA 2FPHX 3NKYA 5GAGU 3HMJG 3UW1A 3MM9A 5HL7Q 2M3DA 2ILYA 5DRKA 4QIVA 1TFWA 3DOKA 2I8EA 4P2SA 2V5HG 4B9LA 2RMLA 2WSCC 4J9SA 3MM6B 3PZPA 4FZVA 1LWCB 3DI6B 1RI7A 1RYSA 4PG7A 3F44A 4C4WA 1SJ1A 3G8QA 4Q43A 3Q24A 5K14A 2O1PA 3IG1A 2EFVA 2XGPA 2DGXA 3VZHA 1YJTA 1S1VA 2M9KA 2HVHA 1FKPA 3MEKA 2B6AB 2OPQA 4H4MB 2GO8A 1S6OA 5LMNF 2R2UA 3PO5A 2GGPB 2J0SD 3W2WA 1N5TA 1WF1A 4RU9A 2RNEA 2YNHA 4ZPVR 3SDEA 3VALA 2FLPA 1S1WB 1XMOF 4I1TA 1LXJA 1QE1A 4PQUB 1U48A 3ISND 3R27A 4DPOA 1N5QA 1OQ6A 3FFIA 3UI3A 3I56S 1FEHA 4NL5A 5KFIA 2DCLA 4JI8F 2B4OA 1S9EA 2YWFA 3QJPA 2OPRB 3PKYA 5F41A 4OI4A 2X51A 4K2XA 1IKWA 1JKHB 4EEYA 1XR6A 3KKFA 3QGIA 1KQGB 2DB1A 3EYZA 5LXRA 1LW2B 4CO0A 1JNRB 2NUUG 3ZZRA 2V8GA 1T05A 4JOUA 4M95A 3DHXA 1LWFB 5DLGA 2ZBCA 2JHEA 1ZH5A 4RKUC 1P8GA 3MD3A 4KKOA 3DMJB 4H4OA 1S1WA 4FPRA 1LKZA 2V9KA 4AL5A 2B51A 2FJDB 1WG5A 3V6DB 3PX4A 2VFSA 3DRRB 4C3LA 2KHDA 4PPDA 4OZNA 5J2NB 2L08A 1XERA 4ETZA 3TVZA 2CQHA 2C2EA 1CQNA 1YJ9S 2PT0A 3RR8A 2N4CA 2HS4A 2VBWA 3DHWC 2XEXA 1VIOA 3NNHA 2NPIA 4ZPWR 2J0QD 2AGPA 1FO1A 2XMVA 2F9JA 3P96A 2DGQA 4LSNA 1REVB 2KZMA 1DRZA 2XNRA 2K2PA 3QWPA 3IN5A 3KWMA 4FN5A 2YH0A 1T7PA 2C2DA 1K0VA 3CJKB 2DO0A 2L9WA 2MJNA 2MJUA 2R7OA 2QFJA 1T03A 2CPZA 2G9OA 3SCLE 3RRGA 4H4OB 2HHSA 1ZM3A 3B4MA 4HT5A 4DEZA 5I42A 4DV4F 2UUWA 3NCPA 3MPVA 3R5BA 2BR0A 1NB7A 4PG8A 3C6TA 4MKAA 4NA3A 2M8HA 2HRYA 3M2VB 2LQ9A 3LP1B 4CO2A 2ZH7A 1Y0HA 4JV1A 4Y65A 1N6QA 3PFOA 4WFNQ 4YEAA 1NJIT 1SV5A 2CVEA 4U7CA 4CQ1A 1H98A 3HDSA 3PX6A 3NRBA 5I4MA 2I5JB 1T02A 2DR9A 4IQXA 4O3OA 1GX6A 1HI1A 2RRNA 4OJHA 5G0RA 4C8KA 1SH2A 4LF6F 1XTZA 2L9NA 1JLCA 1TKTA 4O4GA 1PGZA 2YQ3A 2R7SA 4FS1A 3MAQA 3CDAA 3POTA 4RW7A 2KM8B 2WB1D 3X3UA 1IXKA 3AAWB 1M5PC 1NK5A 1JX4A 3I5AA 4DS4A 4IR9A 2UXDF 1M0SA 3AH6A 3O1LA 1N6QB 1K8AT 3BR9A 3ZZYA 2VH7A 4C97A 4TU8A 1UA0A 4I2QB 1T3OA 1SKSA 3KG4A 1BQXA 4ECQA 4TQRA 3RYLA 2MSSA 1HWUA 3R1LA 2DVIA 3GFXA 4DJBA 4G1QB 4QIFA 2VFTA 5H1SV 1KVIA 3FNNA 2BANB 3PKMA 2P6TA 3MM9B 2W4PA 5G0RB 4X65F 4ILRA 4FXWA 1M90T 5GMKa 3SSQA 2BRLA 3THPA 4QWDA 1CVJA 2HW3A 2B7BB 4U7UK 4NLRA 4RNFA 5C25B 4HDGA 2MKIA 1P1TA 1TL1A 1R8AA 4B3OB 1R8BA 2XWYA 1UEVA 1VC0A 3KMSA 2IBOA 2MXYA 3IAM9 1UKUA 4EYIB 2JEFA 3PIPQ 2BJDA 3G6ES 4DR4F 1QTMA 4ZVHA 1RTHA 2KG0A 3ENQA 5I3QA 2R8KA 1KQFB 3CCQS 3AB2B 3RAMA 4EU0A 1I94F 2HNZB 3MEEB 2YY3A 1IR0A 2EKYA 4WFYA 5H9FJ 2LXUA 2AX1A 2VONA 2K1RB 3MEGA 4M5DA 3I55S 4BHQA 2YNGB 1QM9A 3KLIA 4I7FA 2YNIB 4KE5A 4OJGA 2W9BA 1TAQA 4RW9A 1SJ4P 5E3AA 1MNEA 4QR0A 3MM7A 3BN4A 3NCQA 4QPTA 2A10A 3QIDA 2AW0A 2KM8C 2CVIA 5J1EA 2XS2A 2D1CA 2HNDA 4WKYA 3P49B 3BR8A 2ZFHA 5GAEU 4ED3A 2CQPA 3THTA 2COLA 3HZGA 1BC6A 2VQFF 3SSRA 1SH3A 5CYJA 2FGCA 1G6BA 4I6YA 1JLQB 1URRA 1U1QA 3CJ2A 4ZP6A 1HQUA 2W4DA 3OTBA 1OS5A 2FDNA 3U7JA 3WC2A 2CJKA 3BO3A 1VRTA 2LXFA 3GSDA 2K8GA 5HMXA 2DNOA 4J9PA 3VCDA 1LQ9A 4NLGA 3L09A 5LT5A 1XR7A 4RUAA 3ITHB 4CTAB 1WTFA 4YB5A 2MQPA 3RR7A 3CVKA 4NCAA 4WU2A 5FJ4A 1N33F 1WACA 4X62F 1UVLA 3PIOQ 1FD2A 1FKOA 1LFWA 1P27B 3L7OA 4TQSA 1TUVA 4Y2IA 4K4UA 2RJZA 4DR2F 4DR7F 3HHKA 2QSWA 4IG0B 1OIAA 5KG2A 3G71S 1U1PA 3AB4B 2QE5A 1V3RA 2DR8A 1TK5A 2CPYA 4TU9A 4KJIA 1PSDA 1UVMA 3H5XA 4ECZA 3ISZA 2XZWA 3SDEB 4CH1A 3V4IB 2C22A 4YHHF 2V4JB 2JL9A 3R5DA 1FEEA 3CIZA 2V8HA 4Q44A 3Q8QB 1VBZA 1FKAF 4UQGA 3SI8A 3VAGA 2RS8A 1AFJA 4C2MA 1X4FA 1HNVA 3BB5A 1QAYA 1U1LA 4OHXA 4JI4F 5E41A 4DUZF 2WSFC 3JTPA 3DOLB 4AUKA 3T1AA 3EGWB 4N77A 1MWYA 3KJVA 1X7VA 3MEDB 3O2IA 3HHLB 2DNMA 1PC5A 4ILMA 3NL0A 4K4SA 2RUGA 1FTCA 2E5JA 2MKSA 3JYTB 5DG8A 2K7KA 3Q8PB 1OQ3A 1D1UA 1JJ2R 2DNHA 4FP9A 3ENVA 4Y2AA 2DNRA 3CJ5A 1XMBA 4NRUA 4U9RA 1S48A 2ASYA 1YTYA 2UU9F 4XDCA 3KK2A 4EUVA 4C0OC 3QLHA 2KG1A 1RTJB 2F7VA 4OIXA 3CEDA 4J37A 1T95A 4DR1F 1UW4A 2ZKUA 1VBXA 1FJGF 1E6VA 2E7XA 2XMMA 1HBNB 3BREA 2Z8QA 1HBOB 2XI3A 2BV3A 2IFXA 5I3UB 3GIIA 4QWBA 1M5KC 1X8DA 3UPFA 5DDOC 3QGPA 4IFYB 4B3TF 1B64A 5KFPA 1S7HA 3FQKA 2LU1A 1VRUA 3MPWA 5EUHA 5CYQA 3Q8RB 2EFNA 3H40A 2RQ4A 2PEHA 2FY1A 5KG5A 5EN1A 2XO7A 5L1IA 3VQSA 5B0AA 3GYXB 1W2BR 3SCIE 4PKDB 2E9TA 3O5TB 2DNLA 4X4UA 1X4GA 3D1OA 3KK3B 2GW8A 2VOOA 1FK9B 1C4AA 1JIHA 3OXLA 2BZ2A 1VQ4S 2I1RA 1SKWA 3RU0A 2QEXS 3GV8B 3NGKA 2CQBA 1RT7A 3T9NA 1LW0B 4NX9A 3CCSS 3WBZA 1SH0A 2OIHA 3IBWA 3DRYA 1K1QA 1S9GB 2A2CA 2YNIA 3UWTA 2W9BB 4I64A 3M30B 2ZZMA 2PSZA 1FRLA 4WFBQ 2HWTA 3NNCA 3AY0A 3JTNA 1OPZA 3NAIA 1N4LA 3VAFA 5ADZA 1DBDA 3BGUA 4DF8A 3BJYA 4NZ6A 4B17A 1ZTTA 4K4WA 3PHEA 3QAUA 4ZVFA 3LQVA 3GIMA 2KHCA 5D78A 4ED1A 4QCLA 1TKXB 2YNHB 3FRZA 3JAMY 2KI2A 3CC2S 2MHNA 1OSCA 2EVZA 2G0CA 2B6AA 2MY8A 2OPQB 5DO2A 4P7VA 5GAHI 4RBVA 2HLUA 4ICLA 1S1UB 1DHMA 3V6JA 3FSYA 2I38A 3QYYA 1RISA 1JLAB 4QZVB 2DGVA 4RW8A 1FJ7A 1U1KA 1HFEL 2NSCA 3ITHA 4FF3A 4TNOA 3H8YA 3TUIC 3PR4A 3BF4A 3M1VA 1QJHA 2AJ0A 4F3OA 1UL3A 3P5TL 1YRUA 4R5PA 1R8CA 3KNAA 2GJIA 2L48A 1SC6A 3M8SA 3KHLA 1Q4RA 2YX7A 5K5MA 1P6TA 3M8PA 2PI5A 2R7WA 4C8YA 1SXLA 5T41A 2PDAA 4NYOA 2AQ4A 1S0OA 3QZ7A 1FRHA 3PW7A 1RAJA 2VG6A 5L9NA 2N4DA 1K0TA 5C24A 2ZE2B 4URGA 2XSJB 2K3IA 4N8NA 3OTEA 1C1CB 5KFHA 3GILA 2YWKA 5KFWA 3D54A 3GYNA 3I0RA 3M9MB 1HR0F 4EZ9A 2NZ4A 1C2PA 3M6UA 1NNDA 1IBLF 4AL7A 1TVRB 1NH7A 3I32A 2G13A 2KRBA 2R8IA 1BQMA 1SQEA 3LP2B 1YJNS 3EZ5A 2V9WA 4AFFA 1WHYA 3KG1A 4ELVA 1IUJA 3HHLD 3UD4P 5AXMA 2OO4A 2M52A 4FVCA 4UOCA 3K5LA 4LIWA 2B3TB 2IYIA 4HDHA 3TVYA 4J9RA 3H4DA 2R7RA 2Q79A 4G1PA 4R8UB 3D2WA 4BBYA 3CDUA 1RA6A 3CGIA 1F60B 3AA9A 3F41A 2JC1A 3BGFA 4LSLA 4O0IA 4RBUA 4Q2LA 4OZ0A 4J9NA 3C6TB 3TRGA 4RZRA 5CYMB 4IRDA 2VV5A 3E51A 3LO3A 3PACA 1VS3A 1XNRF 4ALZA 4NCBA 2M0GB 1EETB 1R3NA 1RKIA 3S8SA 3BN7A 3J7YI 1FRIA 3CDBA 3HPOA 4DL3A 3T9ZA 2PI4A 1RP5A 3MMCB 2BQ3A 3DXBA 2VPWB 1WEZA 4RUHA 4NMLA 2HYIB 1MROB 2B4PA 3CCLS 1KNZA 2CQ0A 3MD1A 5HQ8A 2X1AA 4O3RA 2XLJA 3KLEA 1F9FA 3SCJE 5K8OA 2DT9A 5KT7A 1RWUA 4IR1A 3PW5A 4TU7A 1YWXA 2GA7A 2HVZA 5DQIA 4FVMA 2QLXA 3CD7A 2V4JA 4I69A 4X66F 1KC8T 3QO9A 2MKKA 2I9SA 3DRSB 1XC9A 3T3FA 2PMHA 1HW9A 2FHKA