1VFJA

Crystal structure of tt1020 from thermus thermophilus hb8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVTPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Signaling protein
molecule keywords nitrogen regulatory protein p-II
total genus 24
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vfjA00
4CNZA 1KR4A 3N5BA 3DFEA 1GNKA 1P1LA 2NUHA 4RX6A 4RLEA 2PIIA 3AA8A 4OZLA 1H3DA 3AA9A 2VD3A 4Y65A 2Z0GA 4R25A 4Y6IA 2O66A 3NCPA 2V5HG 1O51A 3GSDA 4YB5A 3O8WA 3BZQA 2EG1A 1NH7A 4AFFA 2ZOMA 4CO5A 4YB7A 4D3GA 1V6HA 1Q1KA 1PILA 4USHA 2ZFHA 1UMJA 1UFLA 4OZNA 2GNKA 4CO0A 1V3SA 2GW8A 1V3RA 3AH6A 3CE8A 4E98A 4NYPA 2NUUG 1QY7A 2J9DE 4WK1A 3X3UA 2J9DA 1UL3A 4ZK7M 1J2VA 3M05A 4YB6A 3T9ZA 4CNYA 1VHFA 2J9CA 4WK3A 5L9NA 3TA0A 3MHYA 4USIA 1NH8A 4C3LA 4C3MA 3NCRA 3LF0A 3AHPA 4OZJA 5DRKA 4CO4A 1UKUA 4D3HA 4C3KA 3L7PA 5D4NA 2O67A 2DCLA 2GX8A 5D4OA 1OSCA 3OPKA 1HWUA 4RWXA 2XULA 1O5JA 5D4PA 5DS7A 2XBPA 2XG8A 2JJ4D 3O5TB 1VFJA 1NAQA 4CO1A 2XZWA 4IYQA 3NCQA 2CZ4A 2RD5C 3HLUA 2EG2A 5D4LA 3TA2A 4RWWA 1NZAA 4CO3A 2J9EA 4NYOA 4CO2A 1XK8A 2NS1B 1V9OA 3TA1A 2E66A 4USJC
chains in the Genus database with same CATH superfamily
1S0MA 3VAJA 4A8WA 3M9MB 4E0DA 3SCKE 4DF4A 2WK4A 2XMAA 2IA6A 4DSJA 1Y0HA 4Y2AA 2NZ4A 4PR6A 3QJPA 3N5BA 3DFEA 4DUYJ 2VFSA 4OJGA 1P1LA 3BBBA 3FQLA 1MLAA 3DGPB 2HRUA 4OZLA 3I56S 4Y2IA 5ITHA 5ETMA 4OI1A 2QYGA 2UU9J 1SI9A 1YK9A 4MAKA 2FGCA 4F8RA 2GIRA 1EHWA 1XERA 2RS8A 1CC8A 5IQQA 2WTFA 2HQIA 3MTKA 2BJDA 2DGTA 2FY8A 2GQCA 4PG8A 2E5LF 1FFWB 2ZWPA 2LLZA 5ETOA 4ZVPB 2C42A 1SH3A 2FDNA 1F5CA 2BANA 3VVUA 4DN9A 5BJRA 1NKBA 4RUBA 2CVIA 4DL6A 2L48A 2P9EA 4ZHRB 3CT9A 4K4VA 2KXHA 3UDLA 3DDKA 1ZPVA 2UUBJ 2DH7A 4YN3B 2G13A 3MEGA 4ES3A 4JI6F 4HDHA 4X64J 2YNFB 2GO8A 3DHWC 3JTNA 4LJMA 3TO8A 4B3OB 2M88A 3VGTA 3FVYA 2X7IA 3ZZYA 3MM8B 3J7A1 4W98A 2IA0A 1Q82T 1BQMA 1IKWB 4H4KC 1QJHA 3IG1A 1CQNA 4TU8A 4QWCA 1YIJS 3KLFA 1XNRF 3JAMU 4RU9A 1HHTP 2DJWA 2YKOA 2CUYA 4JI8F 2YX1A 2RU9A 3EVWA 4CH1A 1J5EJ 2R8KA 4GKKJ 2PSZA 1KC8T 4JV2A 2M7SA 5ETVA 4OL8A 2H3EB 3IR6B 2BKNA 3PV8A 1FJCA 1C1BB 1VK8A 5A8KA 4FBTA 3PHTA 5KG7A 3AY0A 3TVYA 3KJVA 1P8GA 2R7QA 3PJWA 3Q8YA 4ZJLA 2OEKA 4ZJQA 1JK9B 4DV1F 3BV8A 2IM2A 3RG6A 5J2MA 4DFJA 1F3FA 4IG0B 4LSLB 4U9RA 1S6QA 5H9FK 4IFYB 4P72A 1E6VB 1R0AA 1ZAWA 1FF2A 1TV6B 4BCAA 3F56A 1SKUB 3O2IA 1N34J 1WG4A 3PXGa 1HNIA 5E3QA 1GXUA 4I6YA 4EMDA 3JSRA 4X66F 1S0NA 1JB0C 4I56A 5HANA 4NRTA 2GVZB 4JYAJ 4TVAB 2QE5A 5B7WA 3NWGA 4OX8A 4PPDA 4DV5J 2VJUA 1S1WB 2NXCA 3DGPA 5K14A 2CZVC 3AAWB 2I38A 3ETOA 3KKFA 3MEGB 2HVIA 2WB1D 1S1TA 1T9TA 2PFDA 1X5SA 4QR0A 4B9TA 2QMWA 2H5JB 1RACB 3V6KA 1I94F 5G0RB 4ES2A 5IZHA 4LF5F 1HHSA 4L74A 3Q86A 4DR7J 4UT4A 3QLHB 3TZXA 2VQFJ 2AJFE 4ED5A 2ZDOA 3RBXA 4CLSA 2RF2B 1VLYA 2MJUA 3N6NA 8AT1B 2M8DB 2DGWA 3EPGA 3WIUA 3RYLA 5IV3A 2O1PA 3ISNC 2FLPA 2ACYA 1TAUA 2OLWA 4CO1A 4IH5A 4F4YA 4B3TF 2V34A 2VG6A 4FXVA 2HHTA 1RU1A 2QLFB 4FBUA 1W25A 5FIIA 2OP5A 4JB8B 3ZXWA 4ANDA 3ZZOA 3UR0A 1NK7A 4M5IA 2ABYA 1JXEA 3HHKA 4O3NA 1JLBA 4CYUA 2XGQA 3IGNA 3HPOA 2IDLA 4YDDB 1FNOA 4R5PB 4EZ6A 1LWCA 3G82A 3NOGA 1RWUA 4DX7A 3OSPA 3FK4A 1IJEB 1SJFA 3W5XA 1EAYC 2XLIA 3FQKA 1R7IA 1H73A 2E66A 1CEZA 3OTBA 2AMCB 3DU5A 5GMDA 3LOUA 1G6BA 4CH7A 2ZZNA 3QIPA 3HP6A 5T7LA 2ZM6J 4GC6A 2D3O1 2V8HA 3MAQA 5AJ3F 3F44A 5KFWA 3ISZA 4F4KA 1WC3A 3DRSB 5CA5A 2DKOB 3QIDA 4WU2A 3AOCA 4DL7A 5K9FA 1HYSA 4ZDNA 1REGX 3CCQS 4CLUA 3Q8VA 3GIRA 3D1QA 4IQXA 1RT4A 1H7WA 2DNMA 4LMZA 3NNHA 4ZOSA 3MUMP 4CH0S 3ET6A 2QLWA 1RT5B 3E01A 5KG3A 5L1LA 3H8YA 3BQ1A 4HTIA 3JYTA 3CJRA 2ZE2B 1IQZA 1FFSB 4AQYF 4NLDA 3BO2A 1PC5A 1RTIB 1RWVB 2C1EB 3FFIA 1C0UB 3GSDA 3C66A 1A7GE 4IH7A 4NA1A 4C8MA 4QWDA 1N5TA 4EYIB 3BZQA 2YPZA 2HVZA 1KWMA 2E5IA 1RAJA 3IGVA 3KJQB 4MK8A 4ZP7A 3DLEA 3N5FA 4XTTA 3DYAB 1NNDA 2B43A 2N7CA 3RAQA 1KVKA 2E5LJ 2L9NA 2E1AA 4B9UA 1RHMB 3L09A 3ZZZA 1ZTWA 3HVRA 2EFPA 2DNNA 4K7QA 2IVFB 4DV7J 1BQNA 1S12A 1TZ0A 2LDIA 1JLQB 1QDUB 2CQBA 3TAMB 5IFMA 2F8HA 5AXMA 4X2BA 2N7YA 1SB6A 4J9SA 2Q6CA 3MFIA 4DL5A 3GE9A 3T1YF 3BYRA 3JB9k 1HW8A 2OH2A 3DLGB 5FDLA 1XMBA 1F0XA 3SDEA 1JJ4A 1JKHB 3TYTA 2HQ3A 2R7SA 2M0GB 3X3UA 4EWTA 3H7HB 4QIFA 2P9CA 3J7YI 4JI3F 3G6XA 3DLEB 5KG5A 1WEYA 2H4YB 1XNRJ 2PFFB 2GO9A 1RTDB 5A8RB 4NXNF 2RUGA 3U7JA 4NLWA 6AT1B 3KK1A 4URGA 3BR9A 3G86A 2KXNB 1C1BA 5A8KB 1OWXA 1TMMA 2JOQA 4E8UA 1RHRB 1T95A 3EPIA 3BGFA 4DR6F 2RUSA 4IR9A 2ILYA 4LIRA 4KGMA 3NCRA 1K1SA 2NZCA 2V2ZA 1WC5A 3BBFA 3E01B 1MMNA 1YSJA 2FJBB 1WC0A 2NXEA 2PEBA 3FBEA 1RK8A 4PKDB 2WBRA 3KLEA 3LP2B 1VOMA 2HEKA 3CJ2A 1E6VA 3G71S 3IO1A 2WOMB 1IKWA 2B56A 5A6WA 1MMLA 5M2UA 3MM8A 1E6YA 2IMWP 3G82B 1BE4A 5HK4A 1SL1A 2YXLA 2EW9A 4DZDA 1IBCB 5DO2A 4BWMA 3D6HB 1CULB 1VQMS 2D3UA 1YDLA 2PE8A 3PO5A 2F5GA 3FSXA 2VL1A 4MFBA 5L8RC 5LMNJ 2JWNA 3L95X 1RT2B 2ZUAA 3M1VB 4F4XA 2GS8A 2AJ0A 3AQOA 4RR5A 4DOZA 1GX6A 4QWBA 2GIQA 5KFTA 1SC3B 2CPFA 1VQYA 2EPIA 3FJ2A 3MM7B 3L7UA 3HT3A 4DV1J 4OYXA 5J2NB 4DR4F 4HEA9 2RF2A 3IA0A 3L7OA 4N5SA 2QLXA 3A8EA 2XS2A 2D3OR 1PAUB 3BR8A 2DISA 1RCXB 3LGNA 1D9DA 4B3OA 5KT5A 3PW4A 2CZ4A 2OKQA 1URNA 4X4VA 1N32J 3DN9A 3MMAA 4ETXA 1RGVA 2HVHA 3PR5B 1HNZJ 4C7QA 3MEEA 2I1RA 3GFZA 1GT8A 1U2RA 4DF8A 1SPBP 4XO0A 4NOHA 4UOGA 1TVRA 2W01A 1YQHA 5KFRA 5JJBA 2X1AA 2UUCJ 5A2QU 4B3TJ 2FHMA 4NLTA 1X5TA 2VV5A 2WSEC 2WVDA 2ZDPA 4EO8A 4ID8A 3QAEA 1KLNA 2FPHX 3RR7A 1ROFA 1Q8LA 1DHMA 3AJ1A 2ILZA 1AXQA 1YKWA 2I9SA 3GMGA 2UV8G 4ECQA 1U1OA 2F8EX 1Q5VA 7FD1A 5HMWA 4DS4A 1R6YA 2BBEA 2XTJP 4USVA 3ZZPA 4DXLA 5HJXA 3MMBA 1CVJA 2EWHA 1S6QB 1IWGA 2PIIA 4BDPA 3LAMA 1MN7A 1H3DA 5CQGA 5F41A 4UW2A 2HFOA 5K8NA 1R8AA 2RRBA 2OFHX 2WBMA 3HHLA 3J7YU 3M8QB 4YOEA 4DSKA 1KQKA 1BHNA 2A2DA 2DXDA 3OL9A 1IBLF 2ZM6F 1A0OB 1H7XA 5E7OB 4L72B 5KFVA 1H2TZ 4DBQA 3SMZA 3JQKA 4GC7A 1G4CA 2V8DA 3H2VE 3HI9A 4R25A 3KJNB 2QEXS 1ICEB 3RR8A 2BYCA 4LF7J 4GKJJ 3M8YA 2J0QD 4IG0A 4LSLA 3HHLD 3WDOA 3DRRA 2KJVA 4YMEA 2N82B 3TARA 3BDEA 1CJVA 5L46A 3KK2B 2I2YA 2Y8WA 3CO9A 1X0PA 2KM8C 4LF8F 3UCUP 5DLFA 1UP1A 2YBVA 1Q1KA 1ZPWX 2KO1A 3NRBA 3W60A 1RKJA 2FJEB 1R8PA 2XO6A 4USHA 3PY8A 4FNIA 4AQYJ 4K2JA 2J6UA 1UEUA 1VS3A 4KR0B 3PRVA 5K20B 1V3RA 3DOKA 4Y0FA 2DD8S 3WZ0A 4LR9A 4ZPCA 2X51A 4E98A 3V81A 1JLEB 5A2QY 1S9FA 1FESA 1HBMA 2YQ3A 3R5JB 1RAAB 1FDBA 4UTGA 1G2EA 2LQ9A 3DCAA 1SH2A 1N36F 4DEZA 1J2VA 2MY8A 1JLBB 4J9UE 1KN6A 2MQPA 2IRUA 2HZVA 3CVKA 2ZH7A 2ATLA 3BKFA 2C3YA 3PYEA 4HHUA 1BGXT 1HHQA 4JV0A 5MLCV 4DQPA 4KV8A 1X4EA 3I5AA 5MAOA 4OHYA 2PN6A 4KJIA 4QYRA 3C16B 4U95A 1LFWA 1HNVB 2JFDA 4OZ2A 4P71A 3ADAC 4RKUC 5J2QA 5KFZA 2Q43A 3T1HJ 1RAGB 1OPZA 4G65A 4YR2A 3B8HA 1QVGR 1DTQB 1PBUA 2ZKUA 4O3RA 5HQMA 4CLKA 4OI6A 2QMXA 3ENQA 4J9KA 3M9OB 1RHJB 3UDCA 4X62J 2FC8A 4QBUA 3D2WA 1BQNB 2UUBF 2KRRA 1NHKL 3L7PA 2BQRA 2ZJQQ 1JLAA 4YY3F 4ENOA 1WG1A 4FN5A 1H38A 2V9KA 4EYHB 5D0RA 3W2WA 3QRRA 1F6TA 1HQEB 3UNYA 4DV4F 3KTQA 2DNLA 2VFRA 5K14B 3VF0B 4K0KF 1RWMB 3GR0A 2OIHA 1A6LA 5GAGU 3UD3P 4DFPA 1V3ZA 4RW9A 2AQ4A 2HURA 2W2OP 3I87A 5CABA 1NAQA 1LK5A 3OR2B 1ZM4A 3CMES 3C6UA 3CD0A 4NXNJ 2K8GA 1XQIA 1TV6A 2NLWA 3QWUA 2DR6A 2WRMA 3ZZ0A 3M2VB 2RD5C 1NKCA 5EN1A 1TL4A 1S1XB 3N6LA 5JXSA 3CXCR 1X9WA 4QYZK 3G8SA 4CO3A 1I1GA 2MZTA 1VJWA 3MD1A 3MCOA 4JI0F 1TTHB 1VK3A 2CPXA 2LXFA 5T7LB 2CPDA 2JZ5A 1E6YB 3OHBA 4KGZB 5HO4A 3GIIA 2ZH1A 1Z1ZA 2F4FA 2QT7A 1N34F 3I82A 2J76E 1Y10A 3K58A 3H5UA 3NGRA 4JV5J 5B08A 5KFYA 1YG0A 3AOBA 1TKZA 3H25A 2FJXA 4PRFA 3I96A 4OYBA 3L3CA 1RLDA 5DM6Q 1TKXB 2QRRA 1PC4A 1S9EB 3Q8UA 1U0HA 2Z2YB 3DLHA 1NDPA 2KFYA 4ICLB 2ZBIA 2J7UA 5GAEU 1M5PC 2LKZA 1VR6A 1XMQJ 1RWXB 3KDNA 2Y0BB 4KGVB 4OYIA 1IQTA 4J9VA 3OVBA 3H20A 3EZOA 3BGUA 2L3MA 2XI3A 2Y1LB 2Y0SD 4ZVHA 3TJAA 4A8OA 2VIHA 3OD2A 4TN2A 4IOBA 1HI0P 3MZIA 4DX6A 2VC0A 2NREA 2DRAA 3QJJA 2AYMA 2GZOA 2XSJA 1N5QA 2DNHA 2IPOB 4KB7A 4X4QA 2D7SA 2ZZTA 3K17A 3W2VB 1HNZF 1UVJA 3VR1A 2KTQA 1NH7A 5KFHA 2W8KA 1MNEA 4U7CA 2OAUA 2HSEB 4RUHA 1VCTA 1H2UX 2HBZB 4UY8T 3NY0A 2MGZA 1MROB 2GW8A 4E2FB 4PEOA 2YWEA 3CE8A 1GXLA 2WSCC 4Y2KA 2OPRB 3CJKB 1MWZA 5KFDA 5JVGQ 2CAJA 4YHHF 2NUUG 1EIYB 4JI7F 4LF8J 2DY1A 2L9WA 3QAUA 1Q8IA 5I4MA 2V4JB 3V6DA 2PGCA 4UY85 2GQQA 4ATNA 3MM9A 2HQDA 2V2QA 2P9GA 3O1LA 1F60B 4KFBA 1MU2A 4F4WA 2KVIA 2AWZA 2F8MA 2WHOA 1S6UA 4KRWA 2AV5A 4MIWA 1NUEA 4A8XA 1VC6A 4MKAA 1OYEA 2ZNZA 5HJYA 4DG1B 4RZRA 1RHQB 4P6QA 2VBZA 4NZ6A 5HMXA 2YKNB 2MEWA 1VJQA 3NNCA 2R2UA 3RB0A 2IAJB 5IXUA 4C3MA 4P52A 3LF0A 1Q78A 2CPZA 3GG1A 1IKYB 1NSAA 2MZSA 2EFOA 2OPSB 3CJSA 1S0OA 4G1QB 2DYAA 4ZCKA 5IT9U 2FHOB 1QE1B 4WIQA 2J7KA 1UKUA 2RIJA 4J7CA 4P9SA 2QX0A 2W7OA 2FHJD 1ZA2B 2IBOA 3AOAA 1B3TA 3PO4A 2QMUB 1V5IB 2UZAA 2MSSA 4U67Q 4JI4F 1R8HA 4NE9C 5CYQA 5A6PA 2UU9F 4J9LA 1RTDA 2R9LA 3WC0A 4HR2A 2ADBA 1GH8A 3A1YG 3IS9A 1R27B 4F2RA 4DV7F 1OO0B 2QV6A 1K0VA 3VAFA 4XDDA 1S1TB 3EDQB 2E5GA 2AJ1A 4I6WA 1XBWA 1WSVA 3Q2SC 2VG6B 5K5MA 2K2PA 3M6UA 1S57A 3DXSX 2KT2A 2LU2A 4ALZA 1ZAVA 2MPUA 4LFAJ 3GQCA 3JQJA 1VFJA 2V0NA 2B7BB 1HNXF 1R6VA 1XIQA 3OL7A 5HROA 1N48A 1YJTA 2UXDJ 1HBUA 3TZWA 5BR8J 2MZRA 4YEAA 2MKIA 2QN6B 2KYZA 1QTMA 3MPYA 1M5KC 2XYGB 4Q44A 1ZA1B 4NLRA 3QSYB 2QJ3A 2CQ1A 1WC1A 1EB0A 2AP6A 2DNZA 2WZ1A 2QA2A 3RU0A 5B0EA 1VQ5S 4N76A 2JHEA 5E33A 1R31A 1TMJA 1GXTA 1LKZA 5CH7B 2V9WA 2BJ8A 2AGOA 1S59A 5SUHA 2OEMA 3CDAA 3MGJA 1U1MA 2DHXA 2B5JB 4F0MA 4YY3J 4YQWA 2DR7A 3R7BB 1RA6A 4F4AA 1RT3A 4JI2F 4DUZF 3FRZA 1YLXA 3HHLC 1FWKA 1L3VA 3UQSA 4P7VA 1PO6A 3OTCA 1HPZB 1WF0A 1MN9A 1SV5A 2EKYA 1Q5YA 2JFKA 2FJDB 2RMLA 3ILJA 1S9GA 1NHUA 4HACA 4QIWD 5EX0A 1AW0A 2RQMA 2KT3A 3SSSA 5AXLA 2DRBA 3QT8A 2D9PA 3D67A 3D3CJ 2VG7A 3MCNA 3D1OA 4LBPA 3MECA 1J5OA 4W90B 2RDIA 1GTHA 3I55S 2B0GA 2Z0GA 2BJ7A 3QGPA 2UXBJ 1TUGB 3H42A 3CJQA 3SFUA 4PWWA 4DX8H 4JYAF 4C97A 3EX7B 2C3MA 5C2GA 5HLFA 4LT6A 4Q5VA 4R8UA 4M5JA 1M5VC 4B3RJ 4OJ1A 5SZTA 4JI0J 2W9CB 5GAGI 3D5MA 1HA1A 2M2BA 3K5MA 1RAHB 3EMTA 4QYZJ 2XS5A 1PAEX 4OMFG 1P6TA 4QWEA 1JNRB 4G1PA 1JLFA 4YB7A 5GMKa 1ZETA 2OHDA 2OTLS 2MDAA 2UVWA 3VVTA 5KFSA 1RUSA 1U6ZA 5HN0A 1GEHA 4QJVA 4RJVA 3CW2C 4F50A 1S6PB 3VQSA 4NYPA 1WDTA 3LP1B 5HP1A 2B9WA 4AXIA 2D3ZA 3BGRA 3SYZA 4OIXA 3EZ5A 3I4HX 4DV5F 3QQCD 2E9TA 2B4OA 4DWIA 4OYWA 3MUVP 1KTVA 3DRPA 3M8ZA 2ASLA 1U8SA 2OELA 2F4VJ 3WBZA 3AD7C 2ZHBA 1KHWA 4CTAB 3OV7A 1TK8A 3KHLA 3R5BA 1VQ8S 3GJSB 5HBMB 2V2KA 4LF4F 4I1TA 2D41A 4JI7J 1NH8A 4C3LA 4M8LA 1KVJA 1AB8A 2Z2MA 4BHQA 2FVQA 1VBZA 4DHVA 1UJ5A 2K3IA 1S72S 4WP9A 4ZMMA 1AYEA 3AHPA 6FDRA 2B9EA 2B9YA 3FGVA 2L08A 4I6AA 4M5GA 1SKWA 4LF7F 1TFWA 4GKJF 4QU7A 2CJXB 5DQHA 2G0CA 4ITSA 3MM7A 2OO4A 2VHGA 4J9QA 3EUNA 3NAHA 3QSIA 2AEJA 4LSNB 4QR2A 3NBPA 4OHZA 4ZLJA 4CIOA 4HACB 3V4IA 2B4UA 5H9FJ 4ZA1A 2HWTA 2O67A 3QATA 4FKXA 1APSA 5THWA 3V6HA 4GO5X 2JEJA 1HWKA 3KLIB 2DHGA 4OHVA 5D4OA 3TANA 2WONA 2FJWA 3SCIE 4O3OA 3QWPA 2ZHAA 4RL1A 1T3OA 1XNQF 2AD9A 1QAJA 5LSRA 4ZPAA 5EWFA 2WVEA 4OQJA 4EK2A 3O5TB 2FIUA 2HHPA 4NEYA 5I42B 3TOQA 4LRBA 3LP0A 3HHNB 3OR1B 1DURA 1JLGA 3L9ZA 3UVJA 1D09B 1LW0A 1UAWA 3P3DA 4X84A 1IR1A 3F0NA 5KFXA 2CDRB 2OUGA 1S5ZA 1ZM3A 3BKTA 3MURP 4RNOA 4Y3CA 4U7UK 5KFKA 3HLUA 3BSOA 2BJ1A 2KT5A 1HBUB 1MMDA 3QGIA 1NZAA 1SIZA 4PG4A 3G9CA 1S10A 2OJ3A 2MKSA 4FXWA 5IWAF 2CADA 2KG1A 2WB4A 2XSJB 2FTRA 3W64A 1N54B 2GFFA 2VOPA 4GMKA 5DJBA 3CMQA 3EVMA 1XR6A 1YRTA 2AX0A 2HBYB 2AT1B 3PZPA 3C3LA 2VOOA 3FEZA 2HBRB 1FK9A 4FYXB 4JI4J 4LFBF 1UWBA 5EHHA 1QVFR 3R97A 3CJ4A 4J90A 1I5OB 2QL9B 4DFKA 2DIUA 3ZZRA 4DCOB 1ZYQA 1RBAA 2J0XA 1N33J 1JJHA 2CJBA 2XSFA 3FCWA 3NG8A 4FKYA 4J9RA 4J9NA 3PCOB 4IFVB 5CZXA 1WOSA 2XLJA 3Q23A 3BO3A 2VD3A 5DDOC 4DR6J 1X9SA 2K3KA 2YWKA 1JX4A 2DH8A 3AD8C 2BOAA 1AROP 1UTAA 2CQGA 1MW7A 2AU0A 5ETLA 4Y6IA 1XC9A 1CPZA 2KHDA 2E9ZA 1RTJA 5AE1A 3C6TA 2V63A 1X0FA 2DGSA 3OT9A 5EX3A 2W7PA 2MTLA 1NZ8A 2RHQB 2R2SA 3KMQA 4QCLA 4WYWA 7AT1B 3OXGA 4QOTA 3FBCA 2DNQA 3TEGA 3JSMA 3R2CJ 4C4WA 5HSPA 3K5LA 3ICLA 3A8KA 1R89A 1SUQA 1N4LA 3CCJS 1U1PA 4NLXA 4ZLPA 3TZZA 3SI8A 3OFFA 1OS5A 4Y34A 3GJTB 3CUNA 1UFLA 1Q86T 4DQSA 4TYAA 1U8WA 2IDEA 2GGPA 3UO0A 3ZTPA 4DFMA 1TK0A 4NLUA 4M5DA 2DNOA 3D7SB 4X65J 2RQCA 3PTWA 1WUUA 1WTBA 2HLTA 3DDIA 2FD2A 1K9MT 2CDQA 2IYGA 4G3IA 4QIGA 3P8BB 2DNGA 2CFXA 2PMWA 1KFSA 2XNQA 4DG1A 3MM6B 1Z2LA 2W4CA 2DO4A 4NEZA 3QYYA 2O01C 3HD1A 3PJ9A 3IFEA 4L76A 1D3WA 1FD2A 2WW8A 3FUYA 1RISA 2FHKA 3M8RA 3IM9A 4H4OB 4R0JA 1REVB 1PJ7A 1EP4A 1X4GA 3NGUA 2RB7A 4PQAA 3C15A 2ZJPQ 3RB3A 2RE1A 2V4JA 1KNZA 3DRPB 2UXBF 2XMMA 5L1JA 1NJXA 4V19X 5I3PA 1NJWA 5L1KA 2JNJA 3IXQA 3L4BC 3V6JA 2YWGA 5RUBA 1NJZA 4DPXA 2VBWA 4M5LA 2R7WA 1U1RA 3MPDA 3SV3A 1XMQF 1F5AA 5L38A 1UWBB 2Z58B 3MPVA 4TU7A 2F4VF 3QO9B 3B6BA 3CIZA 1EZZB 3TAQA 2MLZA 2VJVA 1TL3A 1NCLA 4ECUA 2HPUA 4F26A 2JRSA 4ZN1A 1N5YA 4IFVA 3BDPA 3DXBA 3BPDA 3HX9A 4CM0A 3UD4P 2Z2LA 1K47A 4YDXA 3US5A 4WKRA 1SXLA 2GA7A 2XWXA 3ZNJ1 4GVLA 5EGYA 3HVTB 2CG8A 2YWHA 1OY9A 1WF2A 4ZVTB 3VAKA 2C3UA 4RBVA 1O5JA 5F9LA 1ZOTA 1UW4A 2OSRA 3V2UC 1UJ4A 2M3DA 5DGAA 4HYKA 2XG8A 3IBWA 4ECTA 1VQ9S 2E9RX 1IKYA 1UCNA 2OI2A 4KE5A 1FKPB 4DCJB 4A48A 5C42A 3CDBA 4F2SA 3K5PA 3VCDA 9ATCB 2DHHA 4URSA 2H48B 1ZZFA 3VZHA 3IBCB 2VFTA 3P5BP 2H5EA 3J81j 4ZIVA 3OBIA 2ASYA 3R1LA 4NXMJ 4YFUA 2DEIA 1F2GA 2MLYA 4HH1A 4U8YA 4IG3B 1EP4B 2PI5A 2CQDA 4B9MA 4OV6A 4ZVQB 1WC6A 3M30A 4MH8A 4R8UB 1TU0B 1PJ6A 1GX5A 2AF6A 1X7VA 1XK8A 2G2YA 3MTJA 2MQOA 3N6MA 2A2CA 5IV4A 4UQGA 1V9OA 1MWQA 1FXRA 1S1UB 2DNKA 2V2VA 3MAHA 5ETSA 5FLXY 3PG9A 1LWCB 1TQLA 2UVRA 1KFDA 3C6TB 3CJ0A 4PG7A 8RUCA 4K4YA 1CJUB 3D3BJ 4C8OA 1XNQJ 2WONB 3K5OA 4Z7CA 1YJVA 4KH1B 3UN2A 2C3PA 2EFGA 4Q45A 2GAHC 2KJWA 5F3TA 4S0MA 1NBEB 3CD6S 2G2OA 4RX6A 2CJAA 3JS9A 2D69A 1RTZA 3CCTA 4USUA 4FVCA 3DI6B 4QZVB 2EC0A 3ZZTA 2QFJA 4DQIA 1NSKL 4LFBJ 1GTEA 3OFGA 4M63A 4ECXA 4JI5F 3C46A 3IWNC 2FZGB 3AODA 2IC3A 2W9BA 3VHQA 2JLGA 1PG5B 1S99A 2VFUA 4ELTA 3ELHA 2XZDB 2VFVA 3T5LA 1ELOA 3BKUA 1S49A 4YB5A 2JLEA 4EBDA 2AJ2A 1KONA 3CCMS 1JLAB 5D8HB 1PYOB 3B4DA 2GCFA 4O3QA 1CSJA 4EEYA 2HIYA 4CZCA 3D28A 4M1KA 3VGUA 2VQEF 4I7FB 4P7TA 3D6FB 4ZVRB 4OI3A 3W8PA 3DI6A 4D3GA 3T5KA 3M4XA 1NJIT 1M1GA 2ZFHA 2BE9B 3BGRB 4OYPA 4BBYA 4LRFA 2LVWA 3HF5A 5LMUJ 2XLKA 4TY9A 4Z2XA 3BO4A 1Q7LB 3THTA 1HBNB 3SZ2A 4Z37A 2A18A 2P8IA 1P9QC 3ISND 5EWEA 3HJVA 2LU1A 3OR1A 1YHQS 1B0TA 4U96A 2F7VA 5F9NA 1N33F 3MFHA 2CQPA 2JDJA 3ENVA 2LP4A 1DBDA 2RU3A 3OJUA 5E5NA 3KK3A 2FLLA 3KG1A 2F65A 3UCZP 2JEFA 4W4MA 1VQ6S 4AXJA 2AX1A 4PQUB 2IJNA 5LT5A 2BUNA 2M5YA 5KFUA 3HZGA 1DTTB 2JX2A 2Z57B 1VHFA 1Y7PA 1O6XA 2EXUA 3M30B 3ONQA 4WK3A 3THPA 4C0BA 5I3QA 3LANA 1X4CA 4X64F 2YQ0A 1UZDA 4K59A 5DDRC 4A8YA 1UFKA 2IBKA 3E51A 5BXIA 3D9BA 2YH1A 5KFFA 2V8VA 2Z56B 2JC1A 3Q8QB 1LOUA 2I5JB 5L9XA 2C2ZB 3VZIA 2MQLA 3B82A 2HFUA 4J37A 5D77A 1NK9A 2IAJA 3PVXA 4USKA 3CCRS 2LXUA 3AXKA 3KXDA 1T05A 2VPWB 1KQFB 3H59A 2VDHA 3ZTSA 4B9LA 2MJNA 5U47A 3Q8SB 1T7PA 1TKTB 5E3PA 3GFHA 1Y5LB 2WW4A 5AXNA 1NPKA 3QFWA 4ECWA 3NP5A 1AUSL 3I9V9 2FLNA 3BSAA 4PWDB 2G1DA 5DETA 4WFYA 2OSQA 3IAM9 4CTAA 3DM2A 4IDKA 4K5RA 2GV1A 1DFDA 2HBQB 2ROEA 2GQ2A 2MYFA 3EM1A 4FVMA 4RWXA 4C11A 3PW5A 2C22A 4USTA 3OTOF 4TU9A 3H4DA 3OUYB 2FVRA 5T41A 1CBKA 1FKAF 3CWJA 4JV5F 3D4JA 1YJ7A 2JJ4D 3GYGA 1DTQA 1S79A 3FCVA 2X3GA 4MTPA 1L3UA 2RDDA 4FZVA 4DX5A 2NR0A 2W9AA 1HI1A 3KLHB 1LW2A 1VQLS 3PKMA 2GHVC 3MUTP 1YI2S 2AEFA 2LFVA 3CCSS 1U2CA 4RW6A 5D0EA 1G1XA 3Q89A 4DQQA 3NWRA 2KKHA 4NRUA 4OLOA 4J5OA 2GMHA 3DRYA 4DPOA 2DEJA 2P5VA 2WVCA 3W5YA 2V67A 3UDEA 5GADU 4O3PA 4O0NA 1RABB 3CTRA 2HNDA 2J6TA 1U0SA 2P6SA 4IO1A 3CC4S 3K0JA 3O3LA 2Q6BA 2W7AA 3D66A 1KDNA 1YGYA 3R6LB 1HBMB 3BREA 1F9FA 3LP1A 5KT4A 2VDIA 1R8CA 5T14A 3ET6B 1Q79A 3MMJA 3MOZA 2BKPA 2E7VA 2OPSA 3AQPA 3HSGA 3M6VA 3DDNA 1CULA 2ALYB 4NLOA 2AIRB 2HNYA 1B0VA 1Y3JA 1J5OB 4M5DB 2IMOA 4WFZA 5CYMB 4QPTA 1CG2A 3M2RB 4RLEA 2ZH6A 4KPYA 3MR5A 4KIAA 1P9YA 2G9OA 1VRTB 3S8SA 2AKWB 1O8BA 5F8IA 2MSTA 3Q0AA 5HQ8A 3ILLA 3KLGB 2CNKB 2HVEA 4Q0BB 3ITHA 1JLGB 3EWGA 3OR2A 3BPSP 3DRRB 2N3OA 1OY8A 4C98A 3KUEA 5KG0A 2ZKTA 2HWHA 4DPUA 2O66A 4NA3A 1OYDA 2QYCA 3FSIA 3BSNA 4ED2A 5E3CA 4GRSA 3OVAA 1WD6A 2V50A 3RRGA 2UXDF 4PYDA 3FBFA 3QZ8A 3QRQA 2BE7D 2QA4G 2MKHA 1JXVA 3LGHA 5ETKA 2UVVA 4O4GA 3OL6A 1O0PA 2A6MA 2BRKA 5AJ3J 5KFLA 2W4DA 4PUOA 1S4FA 4B9SA 1Q8BA 1S9GB 2DXEA 4XIUA 4GVBA 2WVFA 3SSRA 1NPPA 1EETB 2VF3A 4C2MA 3K59A 3CC2S 1CQMA 1UMJA 1Y00A 4P2FA 1N36J 4NCBA 2HK2A 3H2LA 3DLGA 2ZOFA 5FDLB 1V3SA 5BYQA 1W2BR 1H6KX 1FCAA 3DLKB 4LFAF 3AB4B 1TK5A 2HS0A 4MT1A 3UN5A 4PAAA 2HKEA 1BUXA 2UVUA 1TUWA 2DHSA 3K89A 3P4UB 4P75A 1FJEB 4I4BA 2C28A 2AGPA 4ERDA 3G2XA 3G96A 4ZPBA 2IYIA 2GJIA 2VBYA 3M2UB 2CXEA 3QT6A 3A8IA 3NXZA 2H65B 5DZ7A 2UXCF 2J9CA 2MZQA 1WWHA 1RBOB 1PBAA 4LSZB 2XGPA 1YVFA 2FJAB 4I2PB 1VYAA 2CA9A 3CO0P 1R3NA 1TL3B 3PHEA 1NB2A 3R8YA 3DLKA 4HDGA 4UZBA 4ED8A 3CCVS 3PW0A 2Q66A 2CQ4A 4K0KJ 5DM7Q 2BJ9A 2IIHA 1HNVA 3HSDA 4DN0A 1RKIA 2H9ZA 4OZ1A 3HDSA 2LEAA 1IR0A 2RRAA 4NL5A 2OGUA 1VMBA 2MHNA 3CJ3A 5KOXA 2ROGA 5LSOA 3RTVA 1DZ5A 1T9UA 4O4GB 2VPZB 5K8MA 3PW7A 1CS4B 4LQ3A 3C15B 1F3VA 4C9DA 3PFOA 4IKAA 2R7RA 2XS7A 2E1PA 1VLOA 5CAAA 2OMOA 1H72C 5KTQA 3J80U 4DSFA 1DQ9A 3IWXA 1I6JA 3FMBA 4ANEA 2KXFA 3TWZA 3I0RA 3ILIA 3KLEB 3ENWA 4LF6J 4X65F 3T19A 1JJ2R 4AL5A 1F1BB 3SEOA 2IVYA 4KTQA 3D0GE 2HFSA 1VRTA 1YBAA 3LW5C 1EJ7L 2GMLA 2X1GA 4CLLA 4PXCA 1FWPA 1VQSA 2E5HA 4EUVA 3EGWB 2DGQA 1RWOB 3A3OB 2R7VA 1WHYA 4Z7YA 1NM2A 2YTCA 5D4LA 3GV5B 4ED1A 4RBTA 3HVWA 4YR0A 1IM4A 1HPZA 5LXRA 3MMBB 3KLIA 4KT0C 3M8PA 4OX7A 4PYAA 1HMVA 1YRXA 2EI5A 2YVSA 4B3SJ 1ACMB 2O3DA 3KG0A 2FY1A 1URRA 2EK1A 4I69A 5M2RA 1KOOA 3DOMA 2KVQE 1JKHA 1WHXA 2PEHA 3D54A 3N28A 5D0GA 4Q8FA 1B64A 4B9VA 3TQEA 4R5PA 2XMUA 4KGKA 4Q43A 5KT7A 1KBRA 1RAOA 2K7KA 2RT3A 3AXMA 3FEXB 4KY3A 3GB0A 3UWTA 4FS2A 1XMOF 1HR0F 3VTIA 4RW8A 3HHLB 5A76A 1RLCL 1Q81T 4NLSA 2MQNA 2ATCB 2DT9A 2XMTA 4NCAA 1HBNA 3MMAB 2CJKA 3ZZUA 5IM0A 2DGOA 2J0SD 3TI0A 2HRTA 3EGVA 5HBMA 2WVBA 4WKYA 1YJWS 3PDNA 2PT0A 1S6OA 1AZSB 2F40A 3AA9A 4EZ9A 2COLA 3MR7A 2V8PA 1RBLA 2HHXA 5LOQA 4WJBA 3ULHA 2N3LA 2OD4A 1DLOA 2NYHA 1CLFA 1FERA 2W2PP 3HULA 2CQIA 2VC1A 1WEXA 3CD5A 3D0HE 3TQ1A 1FK9B 3H0PA 3EJMA 1QAIA 1QLNA 5A8WB 2BOPA 4M5KA 1RT5A 1N5SA 1IUJA 1JWWA 2IC3B 1YBTA 3GWCA 5IT0A 3MR3A 2QC3A 1OSDA 4DL0C 2HW3A 4CO5A 4H4MA 2HNZB 3S1TA 4ICLA 9RUBA 2AW0A 1FFGB 5J1NA 3LTOA 1BXNA 1K73T 2BR0A 1HNWF 2DCUB 3C14A 5ETNA 1M0SA 2BXJA 1RYRA 1IBLJ 4RW4B 2L41A 1VGYA 1FJGJ 1BY9A 3QZ7A 4V1Ak 3IBFB 3HKWA 3M1VA 3PJXA 2PD1A 2VKZG 1JQGA 2RKIA 3A8JA 4Y00A 4JP8A 1S97A 2X1BA 4TLQA 5AT1B 3H90A 1KEKA 3GFYA 3N9UC 3P96A 3W2VA 3TJ9A 2FC9A 1WJ9A 1NK6A 2E7WA 4PXEA 2HHWA 2FZCB 4DU8A 4Y28C 3FZ2A 1PKUA 4RNNA 3CEDA 3F73A 1BD6A 1JJCB 2V4QA 1NXIA 3TW0A 2ZVSA 4LREA 3QFHA 4HHJA 1ZM2A 4NWBA 1VQPS 1GMWA 2EKNA 2GVDA 1HQEA 3QNWB 4KV8B 4AD6A 3NGDA 3LWLA 1CC7A 2YX7A 1Q8KA 2GC8A 3GSIA 2CPHA 2E44A 2FVCA 4B3MJ 2XULA 1C0TB 1Q95G 4LRDA 3RBZA 4DUYF 2VONA 2E29A 1NSPA 5D4PA 4L75A 1FEEA 2W9BB 3UR3C 4N8NA 1R0CB 2CQ2A 4WPAA 4QQBA 4DPWA 2MXYA 2N4DA 5KFNA 1S6PA 1T11A 3ZTOA 2KZZA 2ZH4A 2SXLA 2LECA 1AZSA 1NMEB 5C24A 3W8GA 2OFGX 4NLYA 1AFIA 3M9NB 3M8PB 2XZWA 5L39A 1YTYA 2YQ1A 1IBMJ 2B4VA 2HS3A 4WP8A 3U1MA 4Q2LA 2EG2A 3SCLE 3KHRA 2UUAJ 4N41A 1WF1A 3IS9B 1WOOA 1TKXA 3VAGA 2YKQA 2V4RA 2I0XA 4DUZJ 1MWYA 2AEMA 2V68A 4DS5A 4LF6F 2JEGA 3I31A 4OX9F 3SFGA 4DR1J 2W24A 1YX2A 3UCGA 4DV4J 1HWJA 2ZITA 4DV0J 1S48A 2XI2A 2YX4A 3TR5A 5C7PA 2B51A 1T9VA 3AT1B 1S1VB 3MM6A 2KG0A 3OL8A 1FRJA 2DNYA 4AE5A 4A47A 4PABA 4A8MP 1S0VA 1KR4A 2BE2A 2CQ0A 4FPIA 1FDAA 1HWLA 2RQKA 4I0WA 1KKHA 2VG7B 4ZKAA 2XCAA 3HM9A 3HZEA 1RDRA 3N0VA 3MR2A 2YKNA 1X8DA 1FNMA 4Y2CA 5D3GA 1CJTA 2JH3A 1XWLA 3NMAA 2CQ3A 4KBIA 1SV5B 5B0GA 3PIPQ 2MZJA 1WORA 1TL1B 4HTJA 2NXNA 3C6UB 4LF2A 3GILA 4I64A 2L9DA 3S7RA 5EDWA 4WP3A 3PNIA 4HI2A 4DMZA 4AL6A 4K8RA 2R7OA 3W7BA 2VZ9A 4EGLA 1RA7A 4DV6F 4G6VB 3KJFB 2W2MP 2OPRA 2HNDB 1SC4B 3AFGA 3HFVA 3T9NA 4K4UA 3HD2A 4RU2A 3W9JA 5F8NA 3C8YA 2A10A 2RVJA 3SV4A 1MROA 4WYLA 2HQCA 1RSCA 1JLQA 3BF4A 3BYPA 3PFEA 4DDFA 5J2PA 1V6HA 5CYJA 1HL6A 1OPIA 1NK0A 1RB0A 3I5CA 3HT0A 1B7FA 4F3MA 1VQNS 4CI0B 3Q8RB 3WX8A 2ASJA 3ZTRA 1NU4A 2HRYA 4ED0A 2OTJS 1XR5A 1D8ZA 3HSJA 5B0CA 1YJNS 3CDUA 2JVRA 2JLFA 4OLPA 4NZ7A 1B70B 3IWLA 3FFIB 1W7WA 4MKVA 4CLYA 1L5UA 1IM6A 1WI6A 2F3JA 1KP6A 1M1HA 2APOA 1TVRB 2PA8D 1HFEL 2D9OA 4P2XA 4WK1A 4ZCLA 4C11B 3G6ES 2FVSA 4I67A 3KHHA 3HXMA 3Q24A 1KQSR 3MCMA 3H5SA 4OX6A 2W8LA 1VRUA 5BYRA 3THVA 3VQTA 1I3OB 2HGLA 3I4PA 4P2MA 1WKJA 3M05A 4YB6A 2AYEA 1WSRA 3T9ZA 2F63A 1CJTB 4USIA 3N01A 1L3SA 3P45B 4A8SA 2H51B 3TUJC 4DSEA 3M2VA 4RNMA 3OVSA 3MEKA 3JQMA 5KT3A 3GG0A 4TXSA 4CLFA 1VHIA 2YWWA 3IC1A 3M7VA 4WFBQ 2DR5A 1X60A 2RHSB 4C8KA 2KB2A 5D15A 2QO3A 1B0PA 2FB0A 4CO4A 4GVBB 4RW9B 3RRKA 5AE2A 5KOWA 3PM9A 3PYGA 1JNZB 1PCAA 4HH0A 1HYSB 3CNQP 4WTYA 2RH3A 2CVEA 4C3KA 4DU7A 5D3GB 1K8AT 3PKYA 2B7CB 4IRDA 1K0TA 3OTEA 5D4NA 3T3FA 4O44B 1PGZA 2HNZA 2YNIB 3BB5A 4MYUA 3BQ0A 1VQKS 2KN4A 3PYDA 3R1HA 4FNHA 3CCLS 2HHHJ 1RU2A 2ZH2A 4WFNQ 3TX8A 1VI7A 2VG5B 4QWAA 1SVDA 4P2SA 3LH2S 3V6DB 1ZS6A 4F0KA 3FZBA 3MMCA 4USWA 2NXJA 2LQ8A 2CG4A 4ZP6A 5F3ZA 5GAHU 4J91A 4YP3A 4LVNP 5K8OA 2RS2A 5E41A 3KLFB 2NCKL 4DL2A 1TFYA 2BX6A 3QJLA 1KLMB 3HMJG 3G4SS 4OJ3A 4F67A 3FRYA 2ERRA 2POKA 3TVKA 3W63A 3A3PB 5KFBA 2HMIB 3CDWA 4ZVOB 2R7TA 3EGNA 2HNYB 2MKJA 5G0RA 5C2CA 4RW6B 1WHWA 3HFZB 3W2WB 2B6AB 2E1RA 5A0YA 2R7XA 2KFZA 4UUXA 1S7HA 3K8WA 4B02A 2Y1IA 1SL0A 3R2DJ 4LF1A 1T02A 3WIVA 4FF4A 1UA1A 2YNHB 1T9XA 1K1QA 3B78A 2GJ2A 5CD4A 3J81Y 4USJC 2K06A 2QIFA 4G1IA 1FKOB 4HT7A 3SSQA 1RT6A 2CPIA 3KNGA 1KHVA 2B8QA 3MXHP 1N0UA 1TR0A 2RAQA 4U6PA 3DLBA 4OHWA 3HCXA 4YS2A 2NUHA 4ZIWA 3OLAA 1UJ6A 1R0AB 1Y4ZB 2VB6A 3QT7A 5BR8F 5J2PB 1YZ6A 1DARA 2CQCA 2C2RA 4N56A 1PJ5A 1SJQA 3A4TA 3O6QA 1U6FA 3UPFA 2H5IB 4NLQA 1S9EA 3A13A 2V8GA 2XHCA 3Q83A 4Q2MA 5ETPA 5F0UA 1Y5IB 1TKDA 3TVZA 3J81U 4GKKF 2HVDA 3TX0A 4RBUA 2W9CA 3MOJB 2QLJB 2DNPA 3NCPA 2LXIA 2YKMA 4O23A 1EARA 4IFYA 3AB2B 3H2UB 1F5BA 2HFVA 1HQUB 2PDAA 3HFKA 2E1CA 2V94A 2C2MB 4N47A 2MQMA 4CT8A 4ECRA 2Y1RI 4NCGA 4DR1F 3B54A 4PWDA 4PG5A 5M2PA 3M32B 1CS4A 1BQMB 2W25A 4ECYA 4LQ9A 3KJVB 1Y3KA 2CNNB 3M2RA 3O44A 2R2TA 4ZVUB 1DY3A 2HFNA 4ECVA 3GTYX 5IOLA 5CD4H 3BGOP 1LV5A 5F8JA 5F8MA 3X1LB 3MEDB 2RQ4A 5D6GA 1T3NA 5C24B 3W5ZA 1SJ3P 2LEPA 3AJDA 5KAKA 1LFPA 2KRBA 3NS7B 4PG6A 4Q7AA 4O3SA 4WCEQ 2X1FA 1N8RT 3MM5B 4ZITA 3ZNUA 2XWYA 4DLGA 1WG5A 2ZWOA 5ADZA 3QLHA 2GAGC 4C8ZA 1NHVA 2J9DA 2BVZA 3DMJB 1DLOB 3LWMA 1UL3A 1EX8A 4ZVFA 1LNQA 4CYUB 3R5CA 3FNNA 4KO0A 1ITPA 1JLCA 2XM3A 3MEEB 1R0BG 3TZYA 2Y9HA 2ACMA 3PX4A 5HVFA 3TA0A 3W66A 4JI1F 2X3DA 4ZHRA 4ILMA 4DR7F 2XMJA 5B0FA 1BLUA 3ZO7A 3UI3A 4PCQA 3JSBA 1X31C 1L3TA 2BMBA 4RW8B 5B09A 3Q8PB 1FT8A 3I6PA 1DRZA 4QPXA 3SQOP 2CNOB 5E3RA 3W65A 4M94A 1FTCA 3QMQA 1WC4A 4JOUA 3BSCA 4I7FA 2HWIA 1X4HA 3DOMB 4URQU 4IRCA 3QRPA 4M5HA 5IM0B 3PRBA 4BWJA 4ILRA 1SIWB 3CULA 3M2UA 1FEHA 4KAIA 4PPZA 2NSBA 4USMA 4ECSA 1V5VA 2P2CB 3BBCA 4I68A 4CM2A 2AZ1A 2EFNA 1IBKF 4M95A 2GVDB 2MQQA 5I3UA 2DR8A 2E1MC 4RO0A 3V4MA 1RP5A 4X4TA 3DRXA 1CJKA 4DL3A 1RTIA 2QSWA 4DR2J 2GVZA 1VISA 3NMRA 1VBKA 4K4XA 2F9DA 4UOCA 1JXLA 4IH6A 1HMVB 1F2HA 1TL1A 4KHPJ 4LBIA 2ZH8A 1UWAA 3PR4A 5GADI 4RW7A 5F8HA 3NCQA 3C2PA 4QR1A 4OZ5A 1VC0A 3QGHA 4MFBB 3TA2A 4F04B 2IJRA 3T5HA 4ILLA 3DRSA 1N5VA 3GYXB 4C0HA 4K4ZA 1U09A 3GV7B 2J9EA 3UDVA 4NYOA 2Z2ZA 4QU6A 1NDKA 1FHTA 5B0BA 2VU5A 2XY5A 3I0RB 3CCUS 4NLGA 3IM8A 1RXOB 2CWKA 1H2VZ 1RAFB 2ZBQA 5KT2A 2XO7A 4P10A 3NOCA 1KD1T 2PO4A 5LJ3Y 2BANB 4ZPDA 4ZVEA 2BW2A 3VV2B 1T9WA 1D9AA 1C4CA 2M4MA 3QPIA 5GAEI 5LSLA 3CMAS 4F4ZA 3GIKA 1D1UA 1PYTA 3EICA 3R9LA 1GNKA 2CPYA 2W2QP 4ZVSB 3JTPA 5IC6B 2B4PA 2G2ZA 4I2PA 4FPRA 4OJHA 1UFWA 4A8QA 1RYSA 2YNFA 3GJQB 3QGGA 4H4MB 4F3OA 3FMWA 4CLWA 3G6YA 1UVIA 1FKPA 1C2PA 1NRKA 1QD1A 4ZP8A 4ZLLA 3R27A 4DV2J 2R8JA 1WHVA 1VRUB 5EUHA 3UD5A 3G6VA 3RB4A 5LM7E 1PIEA 4UZCA 3CB4A 3KMSA 1VC5A 2ADCA 2A1BA 3SDEB 1BMQB 2CQHA 1O51A 5LMUF 2C2DA 3GZ7A 3UFCX 1RHUB 4IR1A 2ZOGA 3EVOA 1X4DA 2KYXA 4L6V3 4JI3J 3BS9A 4ZLNA 4CDIA 4UF4A 3W1YC 3OQ2A 3T1HF 2DPIA 3P6YC 1FD8A 5DG8A 3RW6A 3D6MB 4RUAA 1RZMA 1RT4B 3KG4A 2UUAF 2ZBCA 2MKKA 5CZVA 4EU0A 1S1WA 3NGSA 4NA2A 2DPJA 3DYAA 3MF5A 2NYIA 1UVLA 5I42A 4H54A 4OX9J 3FSYA 4N7TA 1HIYA 2DGUA 3LA0A 2H4WB 1KLMA 1ZH5A 4DJBA 1C0UA 2DTJA 2DIVA 1WI8A 3UNGC 5GAHI 2ZBRA 2HZCA 3OHAA 3OW2R 2BEFA 4EFAC 4MYTA 3TUZC 1SUQB 2QG9B 5J2MB 2HZAA 1AUDA 1UPPA 3SIPB 3PX6A 2MKCA 4WF9Q 4PQUA 3FCHA 1HBOA 1QAXA 4ZP9A 1J5EF 3PEHA 4X4SA 3GCWP 5F8LA 2EFQA 1KVIA 2B8PA 1LWFB 4WE1B 1RWKB 3I9ZA 5J1EB 4MMOA 4B3RF 1T8EA 5J1PA 4JBCA 4FS1A 1MG7A 2CZ9A 4RW4A 1KOHA 3TRGA 3GP9A 2KU7A 2DVIA 1N52B 4LR7A 1TAQA 3IN5A 3DOLB 1MSWD 5DRKA 1KTQA 1Z4UA 2ZEJA 3FC9A 3IG1B 2MQ8A 2KL8A 4J9PA 3EZUA 2EC2A 5JVHQ 1YJ9S 2VA3A 4JI1J 5IT4A 4IO9Q 2D1CA 3KK1B 2DCLA 1RCOB 2QA4S 5KG2A 1N6QA 4X66J 4DZ6A 2ZC3A 1FVQA 2JSXA 2OPQA 5DQGA 5E0OA 1HWUA 4ZVGA 5C25B 5DGBA 1N56A 5FD1A 2HHVA 1DAXA 2ZNYA 3OXFA 4RNHA 5DS7A 3MDFA 3U02A 2XBPA 2GHPA 3QO9A 1S4EA 1XMOJ 1HR0J 2OPPA 4LVOP 1X5PA 2K1RA 3M8SA 4HT5A 4MK9A 3BQ2A 4LFCF 2F1FA 2QZ8A 2IVMA 4H4KA 2FLOA 1NK8A 4DQRA 1VBYA 1R43A 3PEJA 3C16A 3FDSA 2XYPB 2NPFA 3IRXA 3UN3A 4DPTA 4WTOB 5KFIA 1D0EA 1OIAA 2VQFF 2HQFA 4RUCA 4TQRA 4DR2F 2EK6A 4U7UD 2XB2D 4X4OA 2P6TA 2W2NP 2XHWA 3POTA 4N77A 1U24A 4ZN3A 2EBGA 3RZAA 1RWPB 1IVZA 3DC2A 3MCSA 2QGFB 3T6JA 5IS2A 4KHPF 1I51B 1M5SA 3TA1A 5KFPA 4TKTA 1HW9A 2QL5B 2PA3A 3H40A 4K4WA 2MKYA 2ZE2A 1RI7A 2R3VA 3RAXA 3DM2B 4P73A 1U4BA 3ZTQA 2J8AA 3GPAA 3MEDA 2ZHOA 2M70A 2VBXA 4ANCA 2AYGA 3GV8B 2FUG9 1TL5A 4I2QA 5CCMA 1LWXA 3RRHA 4EBCA 2UP1A 2AJ4A 2BV3A 3C19A 4OI2A 1NSQA 1IKXB 2DRDA 1M90T 4RPFA 3D6TB 3FEYB 1IN0A 1HWIA 1SBRA 1RT7B 4CP5A 1K44A 1Q0NA 1OMSA 5AE3A 1FJGF 4FYDA 4KSEB 3A12A 4ID5A 4QIEA 2CKWA 3FBBA 4GO7X 1S1VA 2QLBB 1FE0A 4NYZA 1M1KT 5IQ6A 3BH7B 2RDJA 2J5AA 4DR3J 2EVZA 1YJRA 1LXNA 2RJZA 2DH9A 5IWAJ 3I5BA 1T03B 3PIOQ 3M6XA 4WZQA 3WX4A 4BLGA 1B4SA 2DITA 2YY3A 2FQQB 1G7CB 4X4RA 3GLJA 3NAIA 3DU6A 2KFNA 4B3MF 1Q16B 1TL7A 1DQ8A 2LMIA 2RILA 5KG6A 3R5AA 2R8HA 1N5YB 1KRPA 4HVZA 5C42B 3LQVA 1YWXA 5J2QB 2A3JA 2OPPB 4MKYA 2DO0A 3KLHA 4V19J 1X9MA 4JI5J 4TY8B 3RUBL 2G0JA 1XEZA 1U26A 5A8WA 2YNGA 3K2YA 4X62F 3KOAA 2OD6A 5DZ6A 3W61A 4CLTA 4X4PA 3F41A 3VGSA 2HG4A 3E2EA 1IBMF 1L3KA 2FYXA 3CIMA 5AXKA 3R5GA 1AA1B 3KUGA 2C2NA 3BGLA 3MPUB 1ZTTA 4IOCQ 1HNXJ 4BS2A 2GIFA 3RB6A 4A4JA 5L9NA 2E5JA 2HIQA 1KQGB 2EBEA 1VIOA 2VQEJ 2B3TB 3OXLA 2HGNA 3SXLA 3DOLA 5KFGA 1RT1B 1XN9A 5HATA 4DR5J 1VBXA 1NB7A 2HMIA 2BQUA 1FX4A 2FZKB 2NPIA 3ENAA 2QTWA 5HVGA 5KFMA 1SJ4P 4FDFA 4DUTA 2VA2A 5ETQA 3EE3A 3WC2A 3TAPA 1SJ1A 2LYVA 1UETA 1H0HB 2I5JA 2ZD1A 4LRCA 1Q53A 2VODA 2VUGA 1EETA 3QBCA 4O4RA 4I2QB 3SQGB 3J80Y 1FA0A 2VG5A 3P5TL 2M52A 3WHIA 1REVA 1T03A 3OJSA 4JI6J 2IY5B 2KDOA 2BW7A 3KK2A 2AJQA 1FRLA 1H74A 3I32A 2WAQD 2XMKA 4IG3A 1EQMA 4C8LA 4A8FA 3A3NB 4DV0F 2DXFA 1RQ0A 2YKMB 4KH0B 2XNRA 4AT1B 4WFXA 1RTHB 4LF4J 3CGIA 3R5DA 3FKBA 2MLXA 1NK4A 2HGMA 2R2RA 4NI2A 1SH0A 3PRDA 4K2XA 2K7JA 1BC6A 4ZCMA 2G0IA 1IJFB 2W4PA 4F7VA 2IJFA 1Z2ZA 5C5JA 4OYZA 4PZVA 4DCPB 3KLGA 4FF2A 4Q0BA 1TP7A 2IM3A 3JSYA 3ETMA 2VASA 4EI2A 4HLBA 3NGTA 1OQ3A 1T9YA 1P27B 3EXCX 1FKOA 5DQIA 4ZPWR 2XY6A 4JV1A 3PX0A 4K4SA 1DJ0A 2RRNA 1PYSB 4U8VA 5KG1A 3KK3B 4W92B 5LJ5Y 2YNGB 5JMNA 2BM0A 2XEXA 1FRKA 1ZZNA 3VALA 4HKQA 3IRWP 1ZBTA 2HQGA 5ETRA 2U2FA 1WEZA 1NPRA 3MD3A 2OPQB 2ZC4A 3S01A 1N32F 3T5JA 1N6QB 2D74B 1YZ7A 2YH0A 3CJTA 4MKBA 5E2QA 1FRMA 4C0OC 1S77D 4PWUA 4CT9A 4DV3F 2ZVIA 1Q4RA 1F9HA 2HS4A 3IR5B 2BJEA 1T0TV 1JLFB 2BZ2A 4ZJOA 3JXOA 4YR3A 2B9XA 3UE2A 3Q2TC 4ER8A 2IFXA 3V5RA 3E8OA 1BWVA 5KFCA 4FF3A 1LW2B 3LP0B 4OFZA 3BEGB 5LXYA 4XPEA 3K57A 2J8SA 2C3OA 4ES1A 2KH9A 3NL0A 4NXMF 4NI2B 4ZPVR 3RGIA 4F25A 5H1SV 3I0SB 4OYMA 4WIIA 4IRKA 1UVMA 3OUYA 4L73A 2AHOB 2XCPA 1U02A 2Y1JA 3ILOA 1RE1B 1U2FA 3KWMA 4C8NA 2EG1A 2ROPA 4DI6A 1C1CA 1EKRA 1X4AA 1SKSA 3OLBA 5F8GA 1LWEB 1RAEB 1VQ7S 2WOMA 3R7NB 2HK3A 1TKTA 4QW9A 2VICA 4TNOA 4PUOB 4OZNA 1A9NB 5FJ4A 2ZD1B 2GNKA 3VGVA 2GJFA 1RT3B 3DKDA 1NO8A 3GU0A 2ASDA 3AH6A 1N88A 2BE2B 2CYYA 3IP0A 2BABA 2CRLA 1ULRA 2GGPB 3LUYA 3NLCA 2MGZB 2HHUA 2EFVA 2OMLA 2J9DE 3G8QA 1S1UA 4K4TA 3RW7A 2EEYA 2O5DA 2VKRA 4KHMA 5I3UB 4CLPA 5L1IA 3SCJE 2JEIA 3B4MA 1XJWB 1SQGA 2AYBA 4ZK7M 4FXDA 2Q3PA 3ITHB 5CHCB 4CLZA 1HARA 1RAIB 4HI1A 1M5HA 4UUWA 1U6BA 2HHSA 3HKZD 4CWBA 1LEOA 3IMQJ 3EDRB 3CJKA 3GIMA 4FYWB 2HLUA 5D78A 2CNLB 1FXLA 3OFEA 3MI7X 3GFXA 4L3KA 2ZH9A 4OZJA 3S6EA 2BJ3A 2LQJA 1NDLA 1LQ9A 1T94A 4D3HA 3WQPA 3VWSA 1TL7B 1WKLA 3ZC4A 5C25A 3MR6A 1PSDA 4M5NA 3HVTA 3W62A 4A8KA 1JLCB 2DY9A 3TUPA 4KO0B 4OZ3A 1B7YB 1J27A 1TKZB 4DLEA 1OSCA 4WXWA 4Q8EA 3OPKA 3DLLQ 3JYTB 1SQEA 5HLFB 4EBEA 1EKSA 4G1QA 3UVJB 4ELVA 3T1YJ 5JUMA 2F9JA 3RJMB 4LF9J 1ZAXA 2CJQA 1T05B 4M5MA 4YB1P 3DGVA 4KQZA 2ZUGA 1LWFA 1IKXA 1Y9OA 2DHAA 3CDEA 4K5SA 4OV1A 4WE1A 2VPXB 4IQMA 2XC9A 3KDOA 1OJ4A 3GIJA 5BYSA 3VAHA 5DLGA 4DR5F 5B0AA 4RWWA 3TP2A 1U45A 5LL6d 4IDKB 2QFIA 1JIHA 1MU2B 2Z4PA 2IHR1 4DSLA 2HAFA 3EGZA 3CSKA 1DTTA 3HO1A 4UOHA 4OZ0A 5LMNF 4ETZA 2R8IA 1CJUA 1UEKA 5DG9A 2PC6A 3KNAA 1NEEA 1QTNB 5CXTA 2BKOA 1QM9A 3I0SA 1RTJB 3ZFVA 3OSNA 4MIAA 5D0HA 1P1TA 1U7LA 1ZM9A 3MPWA 3EYZA 1W2IA 1Q7YT 1QUPA 2C2EA 2E7XA 1WTFA 4CNZA 1TELA 4OHXA 1U47A 1EQ0A 3C14B 3NS6A 5E3AA 3UW1A 2OEJA 2IRXA 3KUHA 4NASA 4ZPTR 4DV6J 3IRXB 4KKOA 1LXJA 2HAIA 2N4CA 3M6WA 4LSNA 2ZZMA 3H98A 3CPWR 4F02A 5CYMA 1KSPA 4XPCA 2GHWA 4B3SF 3GYNA 1BWEA 3LALA 2PMZD 2B5JA 2YNHA 1CJKB 2BRLA 3AJ2A 2KI2A 2NSCA 2V5HG 1GAOA 3HHDA 4Y2MA 2UUCF 2QL7B 1OY6A 4OYAA 4DV3J 4IUFA 1Y5NB 3POTB 1UVKA 4DR4J 3O8WA 4LFCJ 2UUTA 4AFFA 2ZOMA 4CCHA 1U1LA 2CIMA 4R0EA 5HAOA 5B0DA 3N4WA 3T41A 2A0FB 2LDYA 5DDPC 1IKVA 4ZS6A 1RADB 2ZH5A 5G4DA 1SCJB 3RBDA 2GMJA 1D8YA 4LF5J 3K5NA 4TQSA 4CO0A 5HP1B 2MMYA 4AYBD 3V81B 1C4AA 5KFQA 1HNIB 4NLPA 3R3TA 2JL9A 1IR2A 2ZJRQ 1QY7A 4FF1A 2LCWA 1RWWB 3G87A 3TEHB 3HVAA 3VAMA 1WELA 3LGMA 4LUBA 1RT7A 2MHEA 4C6AA 2XY7A 3LPEA 3CD7A 4OI0A 2HHQA 4LBHA 3M32A 1QUVA 2CJYB 5CCLA 3PW2A 3IAS9 1FDNA 4WBFA 3DMJA 2J0WA 2DBBA 2RKIB 3K8VA 2IM0A 2LQBA 4CNYA 3VAIA 2MZ1A 4ED7A 3IR7B 1UVNA 2R4FA 3MHYA 4KKOB 3MM9B 4KFBB 3D68A 2UV8A 4J9OA 5KFOA 2M8HA 3BN4A 3PACA 2FHJA 1IWAA 3JTOA 4YHHJ 3BJYA 1SL2A 4FYYB 4K50A 3DOKB 2PI4A 3U1LA 3MAAB 3BN7A 4UQTA 1HQ2A 1NLKL 3NGKA 1NKEA 2JC0A 4X4NA 4PXDA 1XR7A 1GFWB 1YITS 3MECB 5J1EA 1KS2A 4NZ0A 2AZ3A 1S7IA 3J7Z5 2VH7A 2PMHA 2CPEA 2NXUA 2R8GA 3KYLA 1HKAA 4DL4A 2FVPA 4B9NA 1GMWD 2MY7A 1WDDA 5A8RA 1U1NA 1GK8A 1G3OA 2XQCA 4NCGB 4HHHA 2G4BA 1U25A 2NQPA 2RSQA 1AT1B 2LA4A 1LWEA 1QAYA 1U1QA 3GJRB 1NDCA 4MK7A 3JSMB 4BC7A 1RT6B 5GVQA 2W1BA 3SQGA 3NBPB 4LRAA 4NLVA 2Q1LA 1U49A 5ETTA 1QSSA 1X4FA 5HMZA 1B99A 3DHXA 2YKPA 1WKKA 5KG4A 4C48A 5F0WA 4F36A 5HROB 2V69A 3JAMY 2R42A 3GONA 2BQ3A 2UXCJ 4MIBA 1SC6A 2Z8QA 2ZH3A 3J7AN 1YRUA 3CJ8A 2B6AA 1RT1A 2BACA 2QA1A 3TNVA 5DDQC 4BC9A 5A0YB 2I6WA 5KT6A 4B17A 4RNFA 1UEVA 4XDCA 3J7ZT 2HYIB 1IKVB 1U0HB 1NK5A 3N79A 3K7RA 3QT5A 3LO3A 3PYFA 1HD0A 2CWXA 3DLJA 4DV2F 5H9EJ 1VQOS 4DSIA 4ECZA 4ELUA 2Q79A 2XZTB 3U27A 4FP9A 3LAKA 4WFAQ 2J6SA 5K8PA 3H5YA 2RNEA 3MMCB 1FE4A 2YKAA 3MM5A 1YBUA 5HI7A 5GMEA 4WU3A 3W9HA 2KM8B 2C2KB 2LEBA 4ID5B 5HVHA 5EWGA 5KFAA 2JVOA 3HJFA 5H9EK 5IC4B 2XMVA 5HMYA 1JMTA 4LR8A 4JI8J 2KHCA 3G8TA 3KHGA 2CPJA 3D1HA 1S1XA 3AA8A 1HBOB 1SC1B 4UOFA 3T6BA 3TUIC 2H1YA 3EXYA 1YJUA 3NEKA 3BM7A 5J2NA 1UW9A 1W26A 4LF9F 4Y65A 1LW0B 3NS5A 2DK2A 1WOPA 3GCXP 4H4OA 4LIWA 1SKRA 2DNRA 1HQUA 4TLRA 4CQ1A 4JI2J 1S76D 2BA9A 1C1CB 5IT9Y 1UZHA 1SJRA 2XYHB 3DNCA 5DG7A 1GQEA 1RT2A 2IM1A 4IOAQ 4OYOA 1Y11A 3CCES 1GMVA 2DB1A 2FGOA 2LQ5A 2YPYA 2YNIA 3KLVA 4O44A 4NMXA 1WNEA 3E3XA 4XK8C 1FI4A 4EO6A 2QSFA 1AFJA 3P49B 3AD9C 1FTRA 4ED3A 4ZCIA 4RW7B 4J9MA 3HSZA 1PILA 2FJVA 1F9EB 4F0HA 3BH6B 4WXOA 3LP2A 2UUWA 4O0IA 8ATCB 3HK2A 3CJ5A 4CRJA 4B08A 4DPYA 1FDDA 1FRIA 3U1NA 5KFEA 1FJ7A 2Y8YA 2K1RB 1D9FA 2DGXA 4KYZA 4NX9A 1BQXA 2G1HA 1QSLA 2YWFA 1GMUA 1FO1A 3TAMA 1RJJA 1C0TA 4OI4A 2MB0B 3OTOJ 3CF5Q 2IRYA 1LK7A 2XMWA 3CCWA 3W9IA 1QSYA 2C2OB 1RHKB 3CCZA 2DR9A 2DGVA 3RBEA 1HI8A 4FYVB 5CYQB 1X5OA 1UPMB 4F3QA 1UA0A 1TUVA 1IXKA 1RWNB 5KFJA 1M5OC 1JLEA 1OQ6A 2BM1A 3H5XA 1DQAA 1QE1A 3LPYA 4KPCA 4TY8A 4ED6A 1I94J 3MWBA 1IBKJ 4C8YA 4NMLA 1U1KA 1FX2A 4WWSA 2M9KA 3R6GB 4NPOA 1HLWA 2H54B 1FVSA 3NKYA 1RTHA 3OFHA 1NJYA 4X4UA 2A6OA 1HNWJ 1HD1A 2R7UA 2GX8A 2V6AA 4XAKA 4AL7A 3OTDA 2AGQA 3H4BA 3HHEA 1WACA 3QIPB 2U1AA 4L3NA 1FWLA 2ZBPA 1R8BA 3CC7S 3RAMA 3D0IE 3T1AA 4TYBA 4HL9A 1VDHA 4ED4A 1FRHA 2ALZA 2WCXA 1FRXA 4JUZA 3TJ8A 2VPYB 7FDRA 1N0VC 2J7WA 1VIXA 4QW8A 4WZMA 1XTZA 2BDPA 4DR3F 3M8WA 4KHRA 2Y3YA 2LA6A 2Z30B 3M8QA 1H98A 4YUDA 1FXDA 4IYQA 4P74A 2WSFC 4PXBA 3MAAA 4KC5A 3Q22A 2HFZA 5HL7Q 3SBMA 3KFWX 4A46A 1VQ4S 1FNXH 1VRQC 6FD1A 3NNAA 1CJVB 5HQLA 4MJKA 3R7SB 4CO2A 3V4IB 4QIVA 2CJ9A 2HHHF 2NS1B 4N8OA 3W3SA 1U48A 1SQFA 4AUKA 2KZMA 3GR1A 5FLXU 1X4BA 4KGXB 2I8EA
chains in the Genus database with same CATH topology
1S0MA 3VAJA 4A8WA 3M9MB 4E0DA 3SCKE 4DF4A 2WK4A 4DSJA 1Y0HA 4Y2AA 2NZ4A 4PR6A 3QJPA 3N5BA 3DFEA 2VFSA 4OJGA 1P1LA 3FQLA 2HRUA 4OZLA 3I56S 4Y2IA 5ITHA 4OI1A 4F8RA 1SI9A 4MAKA 2FGCA 2GIRA 5IQQA 1XERA 2RS8A 1CC8A 2WTFA 2HQIA 3MTKA 2BJDA 2DGTA 2GQCA 4PG8A 2E5LF 2LLZA 2C42A 1SH3A 2FDNA 1F5CA 2BANA 4DN9A 5BJRA 1NKBA 2CVIA 4DL6A 2L48A 2P9EA 4ZHRB 3CT9A 4K4VA 2KXHA 3UDLA 3DDKA 1ZPVA 2DH7A 2G13A 3MEGA 4ES3A 4JI6F 4HDHA 2YNFB 2GO8A 3DHWC 3JTNA 4LJMA 3TO8A 4B3OB 2M88A 3FVYA 3ZZYA 3MM8B 3J7A1 2IA0A 1Q82T 1BQMA 1IKWB 4H4KC 1QJHA 3IG1A 1CQNA 4TU8A 4QWCA 1YIJS 3KLFA 1XNRF 4RU9A 1HHTP 2DJWA 2YKOA 4JI8F 2YX1A 2RU9A 4CH1A 2R8KA 2PSZA 1KC8T 4JV2A 2M7SA 4OL8A 3IR6B 3PV8A 1FJCA 1C1BB 1VK8A 5A8KA 4FBTA 5KG7A 3AY0A 3TVYA 3KJVA 1P8GA 2R7QA 3PJWA 1JK9B 4DV1F 2IM2A 5J2MA 4DFJA 4IG0B 4LSLB 4U9RA 1S6QA 4IFYB 1R0AA 1E6VB 1ZAWA 1FF2A 1TV6B 4BCAA 3F56A 3O2IA 1WG4A 3PXGa 1HNIA 5E3QA 1GXUA 4I6YA 4X66F 3JSRA 1S0NA 1JB0C 4I56A 4NRTA 2QE5A 5B7WA 3NWGA 4OX8A 4PPDA 1S1WB 5K14A 3DGPA 2CZVC 3AAWB 2I38A 3ETOA 3KKFA 3MEGB 2HVIA 2WB1D 1S1TA 1X5SA 4QR0A 4B9TA 2QMWA 1I94F 3V6KA 5G0RB 4ES2A 5IZHA 4LF5F 1HHSA 3QLHB 4ED5A 2AJFE 2ZDOA 2RF2B 1VLYA 2MJUA 3N6NA 2M8DB 2DGWA 3EPGA 3RYLA 2O1PA 3ISNC 2FLPA 2ACYA 1TAUA 2OLWA 4CO1A 4IH5A 4F4YA 4B3TF 2VG6A 4FXVA 2HHTA 4FBUA 1W25A 5FIIA 2OP5A 1NK7A 3ZZOA 3UR0A 2ABYA 1JXEA 3HHKA 4O3NA 1JLBA 2XGQA 3IGNA 4YDDB 1FNOA 4R5PB 4EZ6A 1LWCA 3OSPA 1RWUA 1IJEB 1SJFA 2XLIA 3FQKA 1R7IA 2E66A 1CEZA 3OTBA 3DU5A 3LOUA 1G6BA 4CH7A 2ZZNA 3QIPA 3HP6A 5T7LA 4GC6A 2V8HA 3MAQA 5AJ3F 3F44A 5KFWA 3ISZA 4F4KA 3DRSB 5CA5A 3QIDA 4WU2A 4DL7A 5K9FA 1HYSA 4ZDNA 3CCQS 4IQXA 3D1QA 4LMZA 1RT4A 1H7WA 2DNMA 3NNHA 4ZOSA 3MUMP 4CH0S 5L1LA 2QLWA 1RT5B 3E01A 5KG3A 3H8YA 3BQ1A 4HTIA 3JYTA 2ZE2B 1IQZA 4AQYF 4NLDA 3BO2A 1PC5A 1RTIB 3FFIA 3GSDA 4IH7A 1C0UB 4EYIB 3C66A 1A7GE 4NA1A 4QWDA 4C8MA 1N5TA 3BZQA 2HVZA 2E5IA 1RAJA 3IGVA 4MK8A 4ZP7A 2N7CA 3DLEA 3N5FA 3RAQA 3DYAB 1NNDA 2B43A 4B9UA 2L9NA 2E1AA 3L09A 3ZZZA 1ZTWA 3HVRA 2EFPA 2DNNA 2IVFB 1BQNA 1TZ0A 2LDIA 1JLQB 2CQBA 3TAMB 5IFMA 4X2BA 2F8HA 5AXMA 2N7YA 1SB6A 4J9SA 2Q6CA 3MFIA 4DL5A 3GE9A 3T1YF 3JB9k 1HW8A 2OH2A 3DLGB 5FDLA 1XMBA 1F0XA 3SDEA 1JJ4A 1JKHB 3TYTA 2HQ3A 2R7SA 2M0GB 3X3UA 4EWTA 4QIFA 3J7YI 2P9CA 4JI3F 3G6XA 3DLEB 5KG5A 1WEYA 2PFFB 2GO9A 1RTDB 5A8RB 4NXNF 2RUGA 3U7JA 4NLWA 3KK1A 4URGA 3BR9A 3G86A 2KXNB 1C1BA 5A8KB 1OWXA 2JOQA 4E8UA 3EPIA 1T95A 3BGFA 4DR6F 4IR9A 2ILYA 4LIRA 4KGMA 3NCRA 1K1SA 4DSIA 3E01B 4UY85 1MMNA 1YSJA 2FJBB 4PKDB 1RK8A 2WBRA 3KLEA 3LP2B 1VOMA 3CJ2A 1E6VA 3G71S 3IO1A 2WOMB 1IKWA 2B56A 5A6WA 1MMLA 5M2UA 3MM8A 1E6YA 2IMWP 1SL1A 2EW9A 5DO2A 4BWMA 1VQMS 2D3UA 2PE8A 3PO5A 5L8RC 3FSXA 2VL1A 4MFBA 2VA3A 2JWNA 3L95X 1RT2B 4F4XA 3M1VB 2AJ0A 3AQOA 4DOZA 1GX6A 4QWBA 2GIQA 5KFTA 2CPFA 1VQYA 2EPIA 3FJ2A 3MM7B 3HT3A 5J2NB 4DR4F 4HEA9 2RF2A 3IA0A 3L7OA 4N5SA 2QLXA 3A8EA 2XS2A 2D3OR 3BR8A 2DISA 3LGNA 4B3OA 1D9DA 5KT5A 3PW4A 2CZ4A 2OKQA 1URNA 3DN9A 3MMAA 4ETXA 1RGVA 3PR5B 4C7QA 3MEEA 2I1RA 3GFZA 1GT8A 1U2RA 4DF8A 4XO0A 4NOHA 1TVRA 1YQHA 5KFRA 5JJBA 2X1AA 2FHMA 4NLTA 1X5TA 2ZDPA 2VV5A 2WSEC 4EO8A 2KG0A 4ID8A 3QAEA 1KLNA 2FPHX 3RR7A 1ROFA 1Q8LA 1DHMA 3AJ1A 2ILZA 1AXQA 2I9SA 3GMGA 2UV8G 4ECQA 1U1OA 2F8EX 7FD1A 5HMWA 4DS4A 1R6YA 2BBEA 3ZZPA 1CVJA 3MMBA 2EWHA 1S6QB 2PIIA 4BDPA 3LAMA 1H3DA 5CQGA 5F41A 4UW2A 2HFOA 5K8NA 1R8AA 2RRBA 2OFHX 2WBMA 3HHLA 3J7YU 3M8QB 4YOEA 4DSKA 1KQKA 2A2DA 3OL9A 1IBLF 2ZM6F 5E7OB 1H7XA 5KFVA 4L72B 4DBQA 1H2TZ 4GC7A 3SMZA 3RR8A 4R25A 2V8DA 3H2VE 3HI9A 2QEXS 2BYCA 2J0QD 4IG0A 4LSLA 3HHLD 3WDOA 3DRRA 2KJVA 4YMEA 2N82B 3TARA 3BDEA 3KK2B 2I2YA 3CO9A 1X0PA 2KM8C 4LF8F 3UCUP 5DLFA 1UP1A 1Q1KA 1ZPWX 2KO1A 3NRBA 1RKJA 2FJEB 1R8PA 3PY8A 4USHA 4FNIA 2J6UA 1UEUA 1VS3A 4KR0B 1V3RA 3DOKA 4Y0FA 2DD8S 3WZ0A 4E98A 4ZPCA 2X51A 3V81A 1S9FA 1JLEB 5A2QY 1FESA 1HBMA 2YQ3A 1G2EA 1FDBA 2LQ9A 3DCAA 1SH2A 1N36F 4DEZA 1J2VA 2MY8A 1JLBB 1KN6A 2MQPA 2IRUA 3CVKA 2ZH7A 2ATLA 5MLCV 2C3YA 4DQPA 1BGXT 4JV0A 4KV8A 1X4EA 3I5AA 5MAOA 4OHYA 2PN6A 4KJIA 4QYRA 1LFWA 1HNVB 2JFDA 5J2QA 4RKUC 5KFZA 2Q43A 4YR2A 1OPZA 1QVGR 3B8HA 1DTQB 2ZKUA 4O3RA 4OI6A 2QMXA 3ENQA 4J9KA 3M9OB 3UDCA 2FC8A 4QBUA 3D2WA 1BQNB 2UUBF 2KRRA 2BQRA 3L7PA 1H38A 2ZJQQ 1JLAA 4YY3F 1WG1A 4FN5A 2V9KA 4EYHB 3W2WA 1HQEB 3KTQA 4DV4F 4K0KF 2DNLA 2VFRA 5K14B 3VF0B 3GR0A 1A6LA 5GAGU 3UD3P 4DFPA 1V3ZA 4RW9A 3I87A 1NAQA 1LK5A 3OR2B 1ZM4A 3CMES 3C6UA 3CD0A 2K8GA 1TV6A 2NLWA 3QWUA 2WRMA 3ZZ0A 3M2VB 2RD5C 1NKCA 5EN1A 1TL4A 1S1XB 3N6LA 5JXSA 3CXCR 1X9WA 3G8SA 4CO3A 1I1GA 2MZTA 1VJWA 3MD1A 4JI0F 1VK3A 2CPXA 5T7LB 2LXFA 3OHBA 2CPDA 2JZ5A 1E6YB 3GIIA 5HO4A 2ZH1A 2DPJA 1Z1ZA 2QT7A 1N34F 3I82A 2J76E 3K58A 3H5UA 5B08A 5KFYA 1YG0A 3H25A 1TKZA 2FJXA 4PRFA 3I96A 3L3CA 5DM6Q 1TKXB 2QRRA 1PC4A 1S9EB 3DLHA 2KFYA 4ICLB 2ZBIA 2J7UA 5GAEU 1M5PC 2LKZA 1IQTA 3OVBA 3H20A 3BGUA 2L3MA 2XI3A 4ZVHA 2Y0SD 4A8OA 1HI0P 4TN2A 4IOBA 3MZIA 2NREA 2VC0A 2DRAA 3QJJA 2AYMA 2XSJA 1N5QA 2DNHA 4KB7A 4X4QA 2D7SA 1UVJA 3W2VB 1HNZF 2KTQA 3VR1A 1NH7A 5KFHA 2W8KA 1MNEA 4U7CA 2OAUA 4RUHA 1H2UX 4UY8T 2MGZA 1MROB 2GW8A 3CE8A 2YWEA 1GXLA 2WSCC 4Y2KA 2OPRB 3CJKB 1MWZA 5KFDA 5JVGQ 4YHHF 2NUUG 4JI7F 2L9WA 3QAUA 1Q8IA 5I4MA 2V4JB 3V6DA 2PGCA 2GQQA 4ATNA 3MM9A 3O1LA 4KFBA 2P9GA 4F4WA 1F60B 1S10A 1MU2A 1RYRA 2KVIA 2AWZA 2F8MA 2WHOA 1S6UA 4KRWA 2AV5A 4MIWA 4A8XA 5ADZA 1VC6A 4MKAA 2ZNZA 4RZRA 4DG1B 4P6QA 2VBZA 4NZ6A 5HMXA 2YKNB 3NNCA 2R2UA 3RB0A 2IAJB 5IXUA 4C3MA 3LF0A 1Q78A 2CPZA 3GG1A 1IKYB 2MZSA 2EFOA 2OPSB 1S0OA 4G1QB 4ZCKA 2FHOB 1QE1B 2J7KA 1UKUA 2RIJA 2W7OA 2FHJD 2IBOA 3PO4A 2UZAA 2MSSA 4U67Q 4JI4F 1R8HA 5CYQA 5A6PA 2UU9F 4J9LA 1RTDA 2R9LA 3WC0A 2ADBA 1GH8A 3A1YG 3IS9A 1R27B 4F2RA 4DV7F 1OO0B 2QV6A 1K0VA 3VAFA 4XDDA 1S1TB 4I6WA 2E5GA 2AJ1A 1XBWA 3Q2SC 2VG6B 5K5MA 2K2PA 3M6UA 4ALZA 3DXSX 2KT2A 2LU2A 3GQCA 1ZAVA 2MPUA 1VFJA 2V0NA 2B7BB 1HNXF 3OL7A 5HROA 1N48A 1YJTA 1HBUA 2MZRA 4YEAA 2MKIA 1QTMA 2KYZA 3MPYA 1M5KC 4Q44A 4NLRA 2CQ1A 2AP6A 2DNZA 3RU0A 2QA2A 5B0EA 1VQ5S 4N76A 2JHEA 5E33A 1R31A 1GXTA 1LKZA 5CH7B 2V9WA 2AGOA 5SUHA 3CDAA 3MGJA 1U1MA 2DHXA 2B5JB 4YQWA 2DR7A 1RA6A 1RT3A 4JI2F 4DUZF 3FRZA 3HHLC 1L3VA 3UQSA 4P7VA 1PO6A 3OTCA 1HPZB 1WF0A 1SV5A 2JFKA 2EKYA 2RMLA 3KNAA 2FJDB 1S9GA 1NHUA 4QIWD 5EX0A 1AW0A 2RQMA 2KT3A 3SSSA 5AXLA 2DRBA 2D9PA 2VG7A 4W90B 3D1OA 1J5OA 3MECA 2RDIA 1GTHA 3I55S 2B0GA 2Z0GA 3QGPA 3SFUA 4DX8H 4JYAF 4C97A 3EX7B 2C3MA 5HLFA 4LT6A 4Q5VA 4R8UA 1M5VC 4OJ1A 5SZTA 2W9CB 5GAGI 3D5MA 1HA1A 2M2BA 3K5MA 4QYZJ 2XS5A 4OMFG 2IA6A 1P6TA 4QWEA 1JNRB 4G1PA 1JLFA 4YB7A 5GMKa 1ZETA 2OTLS 2MDAA 2UVWA 5KFSA 1U6ZA 5HN0A 4QJVA 4F50A 1S6PB 3VQSA 4NYPA 5HP1A 3LP1B 2B9WA 4AXIA 2D3ZA 3BGRA 3SYZA 4OIXA 3EZ5A 3I4HX 4DV5F 2E9TA 2B4OA 4DWIA 3MUVP 1KTVA 3DRPA 2ASLA 1U8SA 3WBZA 2ZHBA 1KHWA 4CTAB 3OV7A 1TK8A 3KHLA 3R5BA 1VQ8S 5HBMB 2V2KA 4LF4F 4I1TA 2D41A 1NH8A 4C3LA 4M8LA 1KVJA 2Z2MA 4BHQA 2FVQA 1VBZA 4DHVA 1UJ5A 2K3IA 1S72S 4ZMMA 3AHPA 6FDRA 3FGVA 2B9YA 4I6AA 2L08A 4LF7F 4GKJF 1SKWA 4QU7A 5DQHA 2G0CA 4ITSA 3MM7A 2OO4A 4J9QA 3EUNA 3NAHA 4LSNB 4QR2A 4OHZA 4CIOA 3NBPA 3V4IA 2B4UA 5H9FJ 4ZA1A 2HWTA 2O67A 1APSA 5THWA 3V6HA 4GO5X 2JEJA 1HWKA 3KLIB 2DHGA 4OHVA 5D4OA 3TANA 2WONA 2FJWA 3SCIE 4O3OA 3QWPA 2ZHAA 1T3OA 2AD9A 1QAJA 5LSRA 4ZPAA 5EWFA 4OQJA 3O5TB 2FIUA 2HHPA 5I42B 3TOQA 3HHNB 3LP0A 3OR1B 1DURA 1JLGA 1LW0A 1UAWA 3P3DA 4X84A 5KFXA 1ZM3A 3MURP 4RNOA 4Y3CA 4U7UK 5KFKA 3HLUA 3BSOA 2KT5A 3QGIA 1HBUB 1MMDA 4PG4A 1NZAA 1SIZA 3G9CA 2OJ3A 2MKSA 4FXWA 5IWAF 2KG1A 2WB4A 2XSJB 2FTRA 1N54B 2GFFA 2VOPA 4GMKA 5DJBA 1XR6A 1YRTA 2AX0A 3PZPA 3C3LA 2VOOA 3FEZA 1FK9A 4LFBF 1UWBA 5EHHA 1QVFR 3CJ4A 4DFKA 2DIUA 3ZZRA 1ZYQA 2J0XA 1JJHA 2CJBA 2XSFA 3NG8A 4J9RA 4J9NA 4IFVB 5CZXA 2XLJA 3BO3A 2VD3A 5DDOC 1X9SA 2K3KA 2YWKA 1JX4A 2DH8A 1AROP 2CQGA 1MW7A 2AU0A 4Y6IA 1XC9A 1CPZA 2KHDA 2E9ZA 1RTJA 5AE1A 3C6TA 1X0FA 2DGSA 2R2SA 5EX3A 2W7PA 3KMQA 4QCLA 4WYWA 3OXGA 4QOTA 2DNQA 3JSMA 4C4WA 3K5LA