1VFJA

Crystal structure of tt1020 from thermus thermophilus hb8
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
MKLIVAIVRPEKLNEVLKALFQAEVRGLTLSRVQGHGGETERVETYRGTTVKMELHEKVRLEIGVSEPFVKPTVEAILKAARTGEVGDGKIFVLPVEKVYRIRTGEEDEAAVTPVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords nitrogen regulatory protein p-II
publication title Crystal structures of the signal transducing protein GlnK from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 24
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vfjA00
4USIA 4CO2A 2XULA 5D4LA 3M05A 2EG2A 4CNZA 1NH7A 4WK1A 4CO3A 2J9DE 4NYOA 5L9NA 4CNYA 3O5TB 1H3DA 1V6HA 3DFEA 4USJC 1NZAA 4YB5A 1UL3A 3HLUA 4RWWA 2EG1A 1OSCA 2O66A 1VFJA 3TA2A 3AHPA 4ZK7M 4RLEA 2NUUG 3AA9A 4USHA 1V9OA 5D4OA 2ZFHA 3NCRA 4R25A 3GSDA 2XG8A 3X3UA 4C3MA 4D3GA 1XK8A 4IYQA 2E66A 4C3KA 2GX8A 1VHFA 1UKUA 1QY7A 1O5JA 2O67A 3AA8A 1KR4A 3TA0A 2ZOMA 2NUHA 3MHYA 1P1LA 4C3LA 4D3HA 1NAQA 2DCLA 3AH6A 2GNKA 4CO0A 3NCPA 3T9ZA 1UFLA 3N5BA 2J9DA 1O51A 4AFFA 1HWUA 2PIIA 5DS7A 2J9CA 2RD5C 3BZQA 2JJ4D 2V5HG 1GNKA 4CO5A 1V3SA 4OZLA 1J2VA 1Q1KA 4CO1A 3NCQA 2VD3A 4CO4A 4E98A 2XZWA 4OZJA 4Y65A 1PILA 1UMJA 1NH8A 3O8WA 3LF0A 4YB7A 4WK3A 4Y6IA 2GW8A 2Z0GA 2J9EA 4YB6A 5D4PA 1V3RA 4RX6A 2NS1B 3OPKA 2XBPA 4OZNA 3TA1A 5DRKA 5D4NA 4RWXA 3CE8A 2CZ4A 3L7PA 4NYPA
chains in the Genus database with same CATH superfamily
4M63A 5AXMA 1WSRA 1S4FA 2FZKB 1T9UA 4QYZJ 4Q43A 3CCJS 2ZM6J 3T5JA 3R3TA 2OP5A 5CZVA 4FYVB 1DY3A 3SQGA 4YN3B 4FBTA 2MQNA 4F0HA 5KFMA 4C3MA 3R1LA 4AQYJ 4DEZA 1SKWA 4LT6A 4DFMA 3HX9A 1YQHA 4B9SA 2MGZB 4IOBA 4OJGA 1JLQA 1X8DA 5AXNA 2AJ1A 1RDRA 1HPZA 2DY9A 1YBTA 1JLEB 4N5SA 2FVCA 4X66F 4RW4A 4NX9A 4BHQA 3PM9A 3TWZA 2OEMA 4Q5VA 4OZJA 5ETSA 2OI2A 2AGQA 3D0GE 2YXLA 5T41A 4N77A 2XY6A 2VHGA 1T7PA 1WD6A 3UN2A 2XLJA 5CCMA 3HD2A 1FXRA 3N01A 5ETPA 4OZNA 4E0DA 1KVJA 2PI4A 5CABA 4CNZA 2RUGA 2Q6BA 3ENQA 1UVNA 1KFSA 4YDXA 2GAHC 3MM9A 2JL9A 1JLFA 4LSLB 1U0HB 2GGPA 4DQSA 3OVBA 5C42B 3EGVA 4BC7A 1TL5A 3PTWA 3D68A 3U1NA 1RTZA 3TOQA 5GMEA 2EWHA 4I67A 3US5A 3VF0B 2HFVA 3ZXWA 3I5CA 4DQQA 2BR0A 4RU2A 5AE1A 1LWCA 4H4KC 2ZNYA 4DPTA 1B64A 5DS7A 3D6HB 3NEKA 1YX2A 1L3KA 4OZ1A 3OUYA 1F6TA 1FNMA 3MF5A 2CPIA 3CJ8A 1HI0P 4NRUA 1UETA 4DR3J 1WUUA 1WKKA 1UPPA 4ANDA 1IVZA 4ZP8A 2G2YA 3ZTSA 3VQTA 3G87A 3GR1A 3ZTOA 2AT1B 3F44A 4DV4F 2AGOA 4H4MA 1C1BB 3UR3C 1Q8BA 4DSJA 1GMVA 3CCTA 2E9RX 3IMQJ 3IG1A 1OMSA 3JAMU 3FBCA 4DCJB 3P96A 3Q2SC 5KG2A 3AD8C 1K9MT 3A13A 2IMOA 5DDPC 1VOMA 2WAQD 5KFTA 4TYBA 1PO6A 4IOAQ 2J6UA 2YNGB 4BWJA 4KB7A 2MQLA 2DHAA 3KJVA 2G1HA 3IM9A 1UFKA 2IJRA 3MDFA 4RW6A 3S6EA 1WG4A 2R8KA 4CM0A 2LCWA 4NLXA 2CDQA 4PYDA 5KFJA 3C8YA 3T1YF 2IPOB 1HBUA 3PW7A 1FRMA 4P71A 4IG3A 2NZCA 2FTRA 2HZCA 1Q1KA 3ILJA 3OLBA 2V68A 1KVIA 4OI6A 4RUAA 4DFJA 5AXKA 2DEIA 2IA0A 2WVEA 1REVA 2YKMA 1LWFB 2M4MA 3FK4A 2W4CA 4FPRA 1JLAA 2J9DE 2HHPA 4F4YA 5KT2A 1EKSA 3O6QA 5LJ5Y 1E6VB 1Y10A 2YY3A 2OGUA 3R2DJ 2BW2A 2IJFA 3C46A 2MLYA 1UP1A 4CYUA 5IC4B 1K73T 2QT7A 3TA2A 2FJDB 3TP2A 4JI7F 3VGTA 4MKBA 3QGGA 1FXLA 3LO3A 2VFVA 1VQKS 4QU7A 1MMLA 5A8RB 1NO8A 1GT8A 1PYTA 4NI2B 2IC3A 1FERA 5HMXA 3RTVA 4KSEB 3FJ2A 5T7LA 1N5YA 4LR9A 3SCIE 4NCAA 2CZVC 4B3MJ 4PG7A 5E7OB 3VAHA 2GVDA 4NLGA 2Y3YA 1ULRA 4C0BA 3JSYA 1WORA 1RKJA 2BJ8A 2OUGA 3NBPA 3SSQA 1U49A 3IR7B 4NXMJ 2B0GA 2XI2A 2CQ0A 1EB0A 4FBUA 3KLFA 4J9SA 3QGIA 5CD4A 2WOMB 3N4WA 2YH1A 5IV3A 1R8HA 5CYMB 3TUJC 4CLFA 4Z37A 2Y8WA 2D9OA 5D78A 4DPUA 3GFXA 3AAWB 2AF6A 3MM7A 1NZAA 3KUGA 2WK4A 1CJTA 4QU6A 3H2VE 1H74A 4C9DA 3BGLA 4DFPA 5HK4A 2D69A 3BBFA 2QA2A 2J8AA 2OD4A 2BW7A 1FJGJ 2VH7A 4P6QA 1VGYA 3P3DA 4L6V3 3DLEA 3LOUA 5U47A 1JLGA 4QOTA 4USWA 4QYZK 4I7FB 3QJPA 3BGFA 3DRSB 4F4WA 3NCPA 3EGZA 2KHCA 3EYZA 4P2XA 3M8QA 1EHWA 3K5MA 2V2VA 3DMJB 1RAEB 2FD2A 5LSLA 1S9GA 2R7RA 1Q8IA 4M5KA 1RLDA 2FLLA 4F3MA 3D66A 3FSXA 2NPFA 1RHKB 4GC7A 1QAIA 3RRHA 2JFDA 1HBOA 2G9OA 2NS1B 4F02A 1NDLA 2LDIA 3HD1A 2B9EA 2RHSB 4KYZA 3TNVA 4OHZA 2VFUA 2DB1A 3L4BC 1Y00A 3ENWA 1F3VA 1QTNB 4YUDA 1XC9A 3W5ZA 5C2GA 3H5SA 4ELTA 2FVRA 3C14A 1U1PA 3EICA 3GIRA 1LWEA 4ZVEA 2FUG9 2CPJA 4WP9A 2H48B 2V8HA 1NKBA 4IYQA 1N34F 1WC5A 1WG1A 3FFIB 1TL3B 2QJ3A 2DH7A 4OYMA 1KQKA 3BO2A 4B08A 1HQUA 3R5AA 3I56S 2HRTA 3DYAB 1NPKA 2J9CA 2LU1A 1N52B 1UFWA 1CJUB 2ZZNA 3PX6A 4A8SA 4AUKA 3D54A 2H5IB 3HHEA 3QO9A 3OW2R 3G6VA 2IMWP 3W66A 3EPGA 3I0SA 4UQGA 1DTTB 2XCAA 3RRKA 3NNHA 2V50A 3OL8A 4A4JA 2A18A 1S57A 1KS2A 4WK1A 2IVMA 3VAFA 1S72S 1U7LA 2XMMA 3U02A 3ADAC 2PMWA 1VBYA 2HHQA 2BANB 3MECA 3FSYA 4JI6F 2ZKTA 4O0IA 1FDNA 5BYSA 1XWLA 1F5BA 5CCLA 4AXIA 3CCES 1MU2B 2IBOA 1LV5A 3BPDA 3CDBA 1HW9A 3K59A 3PV8A 3NWGA 5HI7A 1J5EJ 3PFEA 3AB2B 3UO0A 3AH6A 4ICLB 2XGPA 4DSKA 3W9JA 2RDJA 4QW9A 4KHMA 4ZPTR 1NJIT 2L3MA 2HFZA 3GSIA 4OHWA 2YKPA 3MM5A 1W25A 2VDHA 3EDQB 4ECSA 3FBEA 2F1FA 1I3OB 4EI2A 4PWDA 4ECRA 4W92B 1TU0B 5FDLB 5EWFA 4O3OA 1BXNA 3GYGA 2CPFA 4EUVA 4M5GA 1NK9A 4QR1A 3TJ8A 4EBCA 3CXCR 1MMNA 3QRQA 2GMJA 4CLUA 3G6YA 2PMZD 4USJC 2VUGA 1CJVA 1CQNA 4OYOA 4E2FB 2GFFA 3EE3A 4GO7X 1X9WA 2HVHA 3WBZA 4FXVA 4BC9A 3AHPA 2G0IA 3MAAB 5I3UA 1M1KT 5E3RA 4B3OA 3U7JA 4G1QB 4ZPDA 2DNZA 2XZDB 1KSPA 2QG9B 2VZ9A 2DRBA 4JV5F 1EJ7L 1PAEX 3RG6A 2GS8A 4MK8A 1WF0A 3MCMA 4C6AA 4ERDA 3G8TA 1VRUA 5LMUF 3MFHA 3BO3A 4OL8A 3C6UA 3R7BB 4ZJQA 4XO0A 3HZEA 5M2PA 4ZCKA 2RIJA 3CJSA 3LWLA 2VG7A 4G1PA 4DR7J 5RUBA 2J8SA 1ZETA 4O3SA 3JSMA 2IDLA 4ZP9A 1U48A 1VC5A 3QT8A 2DKOB 2V2KA 4JI0F 3KDNA 1N6QA 2B4OA 3D1HA 3TUZC 3D0HE 3RAMA 3J7ZT 4F4KA 1NB2A 1FT8A 3PVXA 1IM4A 3CD5A 1PIEA 1LK5A 5DZ6A 3BKTA 4UOCA 3OFFA 2I5JA 2JOQA 2DCUB 4HDGA 2ADCA 3MPYA 1HMVA 4ECWA 2ILZA 4PQUA 5HQMA 2MQ8A 1MW7A 4PUOB 2Z8QA 3ZZYA 4ZVOB 3IAM9 4HI1A 3R8YA 4DF4A 4DWIA 1IBKJ 4X65J 3DGPB 4LRCA 2CFXA 3ILIA 2A6MA 3KDOA 3S1TA 1IKVB 3W9HA 3BDPA 1HW8A 2HVEA 4IDKB 4HL9A 2CWXA 4B3TJ 4WZMA 4TU8A 1JLEA 1YKWA 2AIRB 1WF2A 2M88A 2NYIA 4UY85 2DT9A 4KGKA 1WKJA 4DFKA 1VMBA 3ISNC 1CJKA 1VBKA 3PEJA 2DNGA 4O3PA 3BGUA 4YB1P 3NMRA 3VAMA 4O3QA 3MURP 3DOMB 3IWNC 2F8EX 1SJQA 1HD0A 4WIQA 1RUSA 2ZFHA 4WFZA 4MTPA 4K59A 1GX5A 2BUNA 4LSLA 1U0HA 2VONA 4DV7J 1VRTB 4ED3A 3RGIA 1FRHA 3G2XA 4LF4J 2NUHA 1Y3KA 1KDNA 4UZBA 2HQDA 1SJFA 2VQFJ 2Z2MA 6FDRA 4GC6A 3GR0A 3GIMA 1N5TA 4P75A 3H7HB 3D6TB 2F9JA 1QVFR 2HMIA 4DV3J 2NLWA 4S0MA 4X4RA 4DV0F 3J81j 2J7UA 3VAJA 2HRYA 1F5AA 4ZVHA 4OZ3A 3HCXA 4YR2A 4KGVB 2W9AA 4TU7A 3VQSA 4A8XA 4MKYA 1IM6A 3DXBA 3OSPA 1NH7A 3H8YA 3QRPA 1H3DA 1C1BA 3DLKB 1U24A 2B9YA 2OELA 2XHWA 3WHIA 1RACB 3FRZA 1HNXJ 4DF8A 4ZK7M 1RI7A 1TMMA 1VCTA 5A8KA 4RUHA 3GB0A 1SJ1A 1S0NA 4CM2A 5LXRA 4DPOA 1WDDA 3M8ZA 2AJ2A 2HNYB 5IT9Y 1S1TA 2DNPA 2JSXA 2YNGA 3TEGA 2XYPB 3QRRA 2RMLA 3IRWP 2E1MC 2W2OP 3AFGA 1WHWA 2MJNA 4ZP7A 4NOHA 5KT3A 4RBUA 3TQ1A 5EUHA 5GAEI 3CJ4A 3VALA 3GYNA 3N6LA 3CIMA 4DR4J 2DD8S 2YWWA 3TR5A 3HVRA 1NH8A 3CWJA 3AB4B 1CC8A 4RBVA 5B0AA 1VK8A 2ROGA 5C25B 4J9KA 4Y2AA 4O0NA 2CJ9A 4I6AA 2N7YA 1Q5VA 1KLMB 3VZHA 3GWCA 1LWFA 1UEUA 2BV3A 4DL5A 1VQMS 2HAFA 2YBVA 2M3DA 1OSCA 3HP6A 3SDEA 1S48A 3R1HA 2HFOA 2ZH9A 3KUHA 1RLCL 1L3SA 4DSIA 3MGJA 5F9NA 4JP8A 4UUWA 3M8WA 1S4EA 3LP0B 4EBEA 2DRAA 3T9ZA 5ITHA 1UJ6A 3KNGA 4NI2A 3OVAA 4DCPB 2CA9A 3K5NA 5L1IA 4TN2A 5B0CA 4I1TA 2UUWA 2F4FA 3AJ2A 4FXDA 4DL3A 1PKUA 1WC0A 5LMNF 1UEVA 3BQ1A 3BGRB 5DRKA 4OZ5A 1M5PC 4F2RA 2DNQA 5ETNA 2WVFA 4HHHA 1CG2A 2PO4A 4FKYA 1BWEA 1N32J 4F67A 1D9DA 2WOMA 4JI3F 2YPZA 3M2UB 2P9GA 5CYMA 3BM7A 4AD6A 4UUXA 4TLRA 3NY0A 3RW6A 1K44A 2A6OA 1R0BG 5D4OA 4C8NA 4DJBA 2EBGA 3S8SA 2J0WA 3CGIA 1U25A 3DLJA 2FJVA 3LPYA 2EFGA 2J6TA 4EZ9A 2ERRA 3OSNA 3R9LA 4B9MA 1EIYB 1SB6A 4WTOB 1S9FA 5DG7A 4CLSA 4DR2J 2HKEA 2QL9B 4ED0A 3FRYA 3MEKA 1MWYA 4I7FA 3UQSA 4ECVA 3DRSA 3R97A 2QL5B 1KQGB 1HYSB 1DQ8A 1FJCA 4NEZA 1T95A 3PW2A 1MNEA 3DMJA 1IR0A 1V3ZA 4DV6J 2A10A 2M0GB 1MLAA 2HHWA 2I0XA 5E41A 2VOPA 3Q83A 2DEJA 4Y00A 1U1NA 4JI4F 5F3TA 4NLSA 1I6JA 1R8AA 1JXLA 4HVZA 2CJYB 3L9ZA 4WU3A 3OTOF 1KRPA 1HQEA 2OPRA 4PPZA 3FSIA 5KFLA 3TAPA 3C3LA 2K1RB 3UPFA 3H98A 2LFVA 1FVSA 5AT1B 4Q7AA 2GQCA 3NGUA 1U1MA 4F0KA 2AJ4A 4U8VA 2FJWA 1ZZNA 5KFBA 2LLZA 5GMKa 3U1LA 1IWAA 1RAGB 4C8KA 2CQ3A 2VG5B 3ULHA 1VJWA 5KFXA 5KFRA 1TL3A 2UU9F 3DDIA 3DLGB 3I31A 4CTAB 2J6SA 3OT9A 1OY6A 5EHHA 4M94A 3I4PA 5D3GB 4JI8F 4WFXA 2ROPA 3JSBA 1CJUA 1R6YA 2LVWA 4I6YA 1RT4A 2HW3A 3MWBA 4IH6A 2MHEA 1FA0A 4OI0A 5EWEA 1Q7LB 2WSEC 1Q81T 3BDEA 4ED6A 2GJIA 3DI6B 3DOLB 1N56A 4B9VA 1NMEB 1U0SA 3HVWA 2GA7A 4RWWA 4ED5A 2QLWA 3RJMB 2PFFB 2BANA 5D77A 4QWDA 1K47A 2KI2A 1VISA 1ZAXA 3C66A 1UWBB 2ASYA 2D41A 5A2QY 1IKYB 5GVQA 3M6WA 1YJWS 5LSOA 1BC6A 1MU2A 4GKKF 1EX8A 2DIUA 1KWMA 2W24A 1WJ9A 4I64A 4NLTA 3DU6A 1QDUB 1JXVA 2RE1A 2E9TA 1YJNS 5GAEU 4KGZB 4ZLPA 1H0HB 4ICLA 2ZHAA 2RRAA 1YHQS 3W63A 1SUQB 4RR5A 1RAFB 4ED8A 1SIZA 3MUMP 1YLXA 3V4MA 2IM2A 4HH0A 2GW8A 1U1RA 1YJ7A 4ZITA 1FKAF 3H59A 2W2PP 5K20B 3PNIA 5ETRA 2LDYA 4M5DB 2W4DA 2JC0A 1RWUA 4CO2A 3CD7A 1FDBA 4XPCA 2YKNB 2ZDOA 5KG7A 2RHQB 1CPZA 2X3GA 3IP0A 4LSNB 4BS2A 4YB5A 1A6LA 2KXFA 1KEKA 1FEEA 2IY5B 1GH8A 1BQNB 3T5LA 3KHLA 2R8GA 3MAAA 2X51A 2IVFB 4GKJJ 1KR4A 2KH9A 1DHMA 4KFBB 4USVA 4HYKA 4YY3J 4Z7YA 3IBFB 1TV6B 3FMWA 1X5OA 2IBKA 3HHLC 5FIIA 2PFDA 2ZH8A 2R2RA 2H5JB 4ZS6A 2DR8A 4KO0B 2GQ2A 4B9NA 3O2IA 2K2PA 4ZA1A 2Y1IA 2RQ4A 4M5NA 4PYAA 4UTGA 1D8YA 5IM0B 3MEDA 1X9SA 2YH0A 3IM8A 4PG5A 1CVJA 1UA0A 1QUPA 1T3OA 2CQBA 5AE2A 5E2QA 4J90A 3MCNA 5HMZA 5HQ8A 3T9NA 4KHPF 1T9VA 2MKIA 1TUVA 3TUPA 1MG7A 3AD9C 5D0HA 2NSCA 3OLAA 4FZVA 3QIPB 4MK9A 4PUOA 4RKUC 3PACA 5M2UA 2W2MP 2V69A 4FYXB 2D3ZA 3ELHA 3R7SB 5IXUA 4UW2A 3OTBA 1J27A 3AXKA 2I2YA 3FNNA 2BKPA 1IKVA 3SYZA 4OZ2A 2HHSA 4IDKA 1ZYQA 4B3RF 3HI9A 2N3OA 2DGTA 2DO0A 2HBZB 2MZTA 5G4DA 1N48A 4QWBA 3EUNA 5B0GA 3V81A 2G13A 4FYWB 1VIOA 3M32A 5DLGA 1T9XA 3BQ0A 1KLNA 1NHVA 1VQYA 2MPUA 2ZITA 1S1VB 3IS9B 3VAKA 1RT1A 4ZDNA 1LKZA 2QX0A 2IFXA 3CCQS 4EGLA 4DI6A 3K7RA 1ZA2B 4LF6J 2QA4G 5IT9U 3MTJA 5KT6A 1XJWB 3DOMA 2UVUA 4R8UB 5F8HA 2VKRA 1U1LA 1MSWD 2Y0BB 3OR2B 3OXFA 1OQ3A 4J9RA 2VC0A 1L5UA 2FQQB 1VRTA 5KOWA 1S1UB 2NZ4A 3IO1A 2FY8A 3BH7B 1HA1A 4NA3A 3JXOA 2HQIA 3LP1B 4UF4A 3W7BA 3IXQA 4ZKAA 4TU9A 1LW0B 4QYRA 4EO6A 2D3O1 3QATA 2JLGA 1FX4A 5HBMB 4IQXA 2E5LF 4YB7A 5DLFA 2HBQB 1RBAA 3MZIA 1I94J 3BS9A 2J0SD 5F41A 1N5SA 5LJ3Y 1FD2A 1DJ0A 3F0NA 4ZN3A 1PAUB 2SXLA 7FDRA 2D74B 2HYIB 1L3TA 1XR6A 4HHJA 1DLOB 1RWXB 3J80Y 2F4VJ 4B3SF 4F50A 1HNWF 1GAOA 2F40A 1N4LA 2A2DA 2EK1A 5KFKA 3WIUA 2CPEA 3QGHA 1VYAA 3QWPA 3DLKA 1APSA 3J7AN 1V9OA 2MB0B 1TFYA 3R27A 3TW0A 1XQIA 2X7IA 4I56A 1QSSA 1F60B 1SQGA 1R6VA 3N28A 3UCGA 5IWAF 2CJKA 2E7VA 2GNKA 4F4AA 2RJZA 4AFFA 3LW5C 1S5ZA 1TL1B 4Y28C 3KHGA 5KG5A 2HNYA 3BYPA 1AZSB 4Q0BB 5MAOA 1BQXA 2QGFB 2QYGA 1NUEA 5LSRA 2GAGC 1RWKB 3CDUA 3EJMA 3WQPA 1TP7A 2OIHA 3NS7B 2FC8A 3SQGB 3S7RA 1DURA 1F2HA 2AU0A 2ZWPA 2HURA 2CAJA 1RJJA 5A76A 4WPAA 5C25A 4X64J 4C4WA 4Q8FA 1NHUA 2HSEB 3NOGA 1JLQB 3EPIA 4C0HA 2ZHBA 1YJUA 1KLMA 3CSKA 2HAIA 4CDIA 3CUNA 3BREA 5D0RA 2LYVA 3D9BA 1XK8A 3MAQA 2CNKB 2ZM6F 3UN5A 3CEDA 2U2FA 4DUZJ 3AOAA 1S97A 3SQOP 5H9FJ 4I2QB 4J9OA 2ZOMA 1X4AA 2JEGA 1JNZB 4J91A 3KG4A 1RWMB 3BZQA 4K2XA 1PCAA 1T9WA 2FJEB 2GQQA 5HROA 4LQ3A 3QJLA 4A8QA 2E1RA 1JLFB 1UVJA 5A0YB 4NZ7A 5LOQA 1U47A 3VR1A 3NS6A 5DQIA 1RB0A 4K4ZA 1RAJA 3SBMA 2M2BA 3M8PA 4WFBQ 2HS4A 1S7IA 2A0FB 2E7XA 3HKZD 3CD6S 4O3RA 3CMES 1S0VA 3CCWA 2V8DA 1Q0NA 1JJHA 2Z2YB 3WDOA 1NK6A 4Q8EA 2BQ3A 2R2UA 3WC2A 3PW4A 4ETZA 3NOCA 5C24B 1RWNB 3M2UA 2W9CB 1N5VA 1SXLA 4A8MP 1NK7A 3Q2TC 1O5JA 2UXBJ 3UW1A 4FNIA 4FYYB 2G1DA 3W62A 4CH0S 2J9DA 1JQGA 1VRQC 3HF5A 4NZ6A 3RBXA 1HHQA 2RT3A 1Y3JA 2F65A 4ZJOA 4JOUA 3E3XA 1NK5A 4DZDA 3NRBA 2OPPB 4DQIA 5B0EA 3GMGA 1TL7B 2HGNA 4ALZA 2W8KA 1N8RT 3PG9A 1HYSA 3DGVA 4RNNA 1I51B 1D0EA 1Z2LA 4F26A 3J81Y 1TELA 4DR3F 4XIUA 2RF2B 2G0CA 2XULA 3SSRA 1P9YA 4ZVSB 1N0UA 4B9LA 2WVBA 4DX6A 2VPWB 4EMDA 2JFKA 2OPQB 2YWFA 2OFHX 3JSRA 3BKUA 1A0OB 4N41A 4I68A 3OTEA 4IG3B 2AW0A 5A2QU 5I42A 4HLBA 3QJJA 3MI7X 4WF9Q 3VGSA 4G6VB 1EETB 2QMUB 1HR0J 3ETOA 4HACA 1REVB 2YKMB 5EX0A 3KLIB 3BV8A 5HL7Q 2R8JA 3ZZPA 1V3SA 4DUTA 2VG5A 2RQCA 2DXDA 1UVIA 2L08A 4L73A 3DLGA 4BWMA 4CTAA 4NXNJ 3GFHA 2DITA 5D3GA 2XCPA 4NWBA 2BM0A 2HEKA 3C2PA 1QE1A 1GFWB 4OYWA 4O4GB 1SH0A 5D8HB 1UCNA 3I4HX 4WXWA 1N5YB 3UD3P 4CLYA 4ZLLA 3QT7A 3JQKA 3OHAA 2GVDB 2B4UA 4TYAA 4ES3A 3T5KA 2AD9A 1RHMB 2NUUG 1ZTWA 4ILLA 3RRGA 5ADZA 4B9UA 3ETMA 3DRRA 3J7YI 2CQDA 4V1Ak 3W65A 4RL1A 2J76E 3PEHA 4IO1A 2UUAJ 3AOCA 2DCLA 4DPYA 2R8HA 1UWBA 1EKRA 2RQKA 1IKYA 1LQ9A 4DL7A 4P2FA 2KVIA 4WJBA 4YOEA 2B6AB 1CJTB 1HBMB 4B3MF 1U02A 1WC6A 1Y5IB 3B8HA 4LREA 2UXDJ 4KR0B 4PXBA 3UN3A 4F0MA 3PR5B 1HI8A 1FVQA 1S99A 4ECQA 4PRFA 1GQEA 4PG4A 3EGWB 3HFKA 3MPVA 1CS4B 1T9TA 1VQ6S 1B7FA 1FDAA 2OKQA 3PW5A 5L39A 2OJ3A 3KLEA 2QFJA 4NXMF 3H5XA 1PBUA 3P6YC 2NPIA 3HK2A 4RJVA 4M5DA 3N5FA 3TQEA 1PBAA 2LEPA 3BSOA 3KNAA 1WHVA 5IV4A 3NAIA 2OEJA 4ATNA 3P4UB 4X62J 5CZXA 2YKNA 5BYQA 3NGTA 2W7AA 4ZVRB 2YX4A 3ZTPA 2KT3A 4IRKA 1NJYA 1VQPS 1RTDB 4KV8B 2H1YA 1HBOB 1BQNA 3L7UA 1FJGF 4A8KA 2XS5A 3DHWC 2W2NP 2OEKA 2Y0SD 4KY3A 2KB2A 1RT2B 2ZZTA 1P6TA 2V6AA 5JMNA 4KFBA 4K7QA 3UDLA 2PC6A 1IBCB 5H9FK 3AY0A 5KT5A 4P74A 2CPYA 3C14B 4OX9J 3JTNA 1LWEB 1FRLA 4YB6A 3OTDA 3KHHA 4LFCJ 4CRJA 4DV5J 4KO0A 4PG6A 1TK0A 2A3JA 2POKA 4ECTA 3CCRS 3DCAA 1NK4A 1S1XB 4ILMA 1RU2A 2G2ZA 1VQ9S 1EAYC 3I9V9 5IM0A 4E8UA 2PD1A 1L3VA 3R2CJ 1X4DA 1HNVB 5KFOA 5J2MB 1FTCA 4YHHF 2E5HA 4QIFA 3QO9B 3GSDA 2BXJA 2F8MA 1AA1B 3I0SB 3JS9A 2BACA 3FEXB 1R43A 2L9NA 5E5NA 1Q8LA 2P8IA 1RWWB 1T11A 1AROP 1YJRA 1JB0C 3QIPA 2LXFA 3EWGA 5KFHA 4WFYA 3DN9A 3I82A 3IWLA 2P5VA 4CT9A 3MECB 4J9QA 3FBFA 4FVCA 2XO7A 4Y65A 2JX2A 3QAEA 4NLVA 2R9LA 2LQ5A 3CPWR 1FRIA 4NRTA 4TNOA 3J80U 3C15A 4LF5F 4IH5A 4FF2A 3KK3B 4DPWA 1RT7A 3P5TL 2QA4S 4RW9B 3DLBA 1R31A 2GCFA 4ZN1A 3D1QA 2KTQA 3TARA 3W61A 3P45B 3D67A 2MSTA 5B09A 3T1HJ 1NSAA 4RW8A 1D1UA 5KAKA 2DTJA 1SKRA 1ZAVA 4W98A 4RLEA 3DNCA 1MWZA 1MN9A 2LEAA 1QVGR 1S1VA 2RDIA 3IS9A 2L48A 4KH1B 1S76D 1AW0A 2XWXA 2Y9HA 4GO5X 3MHYA 7AT1B 3BB5A 2VBYA 3IR6B 1IJEB 4UT4A 1J5EF 5HVGA 3KOAA 3BH6B 5IFMA 5IC6B 2ASLA 1S1UA 2KN4A 3GJTB 3HT0A 3EZUA 1CJVB 2NYHA 3OJSA 3EMTA 1N36J 3LP1A 1ZOTA 4EK2A 3ISND 2DGUA 1U8SA 2KDOA 5I3UB 4B3OB 3ZNJ1 1LW0A 3KK1B 1M5HA 3TZWA 1RHQB 2KXNB 3I96A 5HBMA 1TVRB 2Z4PA 1V5IB 3H90A 2JVRA 1VRUB 4WWSA 2IM1A 1MWQA 3W1YC 2FVQA 4PWUA 4V19X 2MYFA 3HM9A 1IBMJ 1LXNA 3W60A 2OO4A 1GMWD 1S49A 4PR6A 5EGYA 1H6KX 3JSMB 2XWYA 3FMBA 2V8PA 4ECXA 2DK2A 4DR6J 8ATCB 2CJQA 5IQ6A 3MMCB 2GV1A 1JK9B 4D3HA 1RXOB 3GJRB 1O51A 2YNHA 4C8ZA 4OLOA 1ZPWX 1FRKA 4RBTA 1CQMA 2IIHA 2JWNA 1G6BA 2YQ3A 4HI2A 2I5JB 3D0IE 1TL1A 3CO9A 4CO4A 3P5BP 1U6FA 1HMVB 2RB7A 1NDCA 4PQUB 2K3IA 1MMDA 1XIQA 1AZSA 4Q0BA 1R89A 2IVYA 1Q95G 4DR7F 1Y9OA 2EFQA 2VL1A 4M5HA 4KAIA 3D6FB 4XDCA 2FY1A 2XGQA 4CO3A 2UUBJ 4YEAA 5HLFB 2VC1A 3UCUP 1NBEB 2R7SA 3PIOQ 1R0AA 3MUTP 5KFGA 4L3KA 4DQPA 2QA1A 2ZUAA 3CDAA 2CJXB 1IQZA 1FEHA 1NK0A 3LA0A 4USHA 1F2GA 2CXEA 2FHJD 2D1CA 2UVVA 3Q8VA 1S12A 4WYWA 3UD4P 2LA4A 2VQEJ 4AL7A 3QSYB 3BJYA 1KNZA 1QY7A 2KM8C 3MOJB 4A8FA 2LXUA 5ETMA 2GHVC 4UZCA 3BF4A 1P27B 3AXMA 1CJKB 4Y0FA 3GIJA 1W7WA 4I2QA 2OSQA 1IBKF 2MEWA 4X65F 3V5RA 5K8PA 2KVQE 3CF5Q 1X0FA 1IWGA 1EP4B 2JRSA 3J81U 5DDOC 2JNJA 4NMLA 3MEGB 2MQPA 2RAQA 5K8MA 3U1MA 1NCLA 2YWHA 8AT1B 4QPTA 4B3TF 1O0PA 5A0YA 4MT1A 3M9OB 2M8DB 3OR1B 2YVSA 1T94A 2DY1A 2FLPA 1IR2A 4A8OA 2RNEA 4J9UE 2AJFE 3NXZA 4KPCA 1Q7YT 5B08A 1S6PA 2HMIB 3MTKA 5F8JA 3W3SA 4DX5A 5GAHI 2HGMA 2BOAA 5C24A 3M8RA 3H40A 4DG1B 2OD6A 2W9CA 3ZZTA 2M5YA 1E6YB 4JB8B 4J9MA 3BBCA 1K0TA 1HHTP 2Y8YA 2W4PA 1ZPVA 4DV7F 2VFTA 4FS1A 4LF4F 1F9HA 2DNRA 3HHDA 4P73A 4GVBA 3VAGA 2VQFF 1M90T 2KG0A 2OPPA 4FF3A 3TJ9A 4LFBJ 5A8KB 1TL7A 3BBBA 1BHNA 3NLCA 4DV3F 4C48A 3GE9A 3E2EA 4M8LA 2KZMA 1Q53A 5KFQA 2GJFA 4TVAB 1S1TB 3K89A 2CPDA 2RF2A 1YG0A 1FJEB 3ENAA 1X4BA 1VC6A 3AOBA 1B70B 3KK2B 1B99A 1X7VA 3LALA 2NXJA 2OPQA 3PHTA 1G2EA 2LQBA 3FCVA 4K5SA 4LF8J 2H9ZA 4ZIVA 2V4QA 1HNXF 2ZJQQ 2AMCB 1F5CA 4EEYA 1EETA 2KO1A 4ZP6A 3SIPB 1M1GA 2IM0A 3TX8A 2NXEA 5IS2A 4NLUA 5SUHA 4OI1A 3KLIA 1UW4A 3OD2A 1AFIA 2ZNZA 1F1BB 2DIVA 1XR5A 5SZTA 2RSQA 5DG9A 4TY8B 1WACA 3CVKA 4I0WA 3SDEB 3D3CJ 2LECA 4KGMA 2DGVA 1H7WA 2R7VA 1NKEA 1V3RA 1UWAA 3D4JA 4M95A 4Z7CA 1YITS 1JJ2R 1SL2A 2HFUA 1P1TA 1FCAA 3EZ5A 2HGLA 2NXNA 2M8HA 5B7WA 3Q8RB 1LFWA 3GQCA 2E5IA 4URGA 4QIWD 2N4CA 2G2OA 4O4GA 1C4CA 1PYSB 3VV2B 3HMJG 4NCGB 4OFZA 1BY9A 1NSKL 3THPA 3CB4A 5B0FA 2Q1LA 3QIDA 1HNIA 2GVZA 2ZBCA 2BOPA 2DNLA 2MXYA 2VBWA 4U7CA 3KWMA 2MQOA 5C7PA 4KRWA 1RISA 2YKOA 2P2CB 3DRPB 1SPBP 4NLDA 2Y1RI 2IAJB 1WSVA 4QWCA 3W2VB 4MFBA 1NRKA 1EZZB 2O5DA 1RHRB 3HXMA 4NLOA 4ECUA 4P52A 1BWVA 2QC3A 1UJ5A 4HT7A 3F56A 2HFNA 3O8WA 2C22A 2R7TA 4CLTA 2B6AA 1R8BA 2VB6A 1HBMA 1FKPB 4J9NA 3RR8A 1UA1A 2CJAA 2EFNA 3SV4A 3ENVA 5I4MA 2XHCA 2CPHA 3HVAA 3RB4A 4YMEA 3I55S 3KXDA 1CS4A 2AGPA 1KHVA 4TLQA 5M2RA 2CQGA 1WC1A 2NCKL 1XNQJ 4P9SA 2RUSA 4PKDB 4K4XA 3DOKA 1HWJA 1OY8A 4N8OA 2HNZA 4N7TA 3GFYA 4DN9A 1VK3A 5KFUA 3ZC4A 3MR5A 1N32F 3DRXA 1VBXA 1IJFB 1TKDA 4OV1A 3RB6A 4F04B 4HTJA 3QLHA 4IUFA 1RTDA 5F8LA 1K0VA 4KV8A 4K4WA 2BQUA 3AD7C 3GU0A 1ZH5A 3KLHB 1HWKA 3DRYA 1HQEB 2OPRB 2JVOA 2C2NA 4EWTA 3THTA 4DZ6A 4C11B 4DR2F 3K5LA 4YP3A 2LEBA 1DRZA 3RYLA 5ETLA 2MQQA 1RT2A 1XBWA 4DU7A 2CKWA 4URSA 2UXCF 2XMUA 3LAKA 5DQGA 2CQPA 2BM1A 4DV6F 1FTRA 2R7WA 2HK3A 4I4BA 4OYBA 1PYOB 3RBDA 3VZIA 1KVKA 1NKCA 1TUWA 1IUJA 3TJAA 5CYQB 3F73A 1S1XA 2HWIA 1RWOB 1AFJA 4USTA 5GAHU 1UAWA 2QO3A 3HJFA 3AJDA 3A8JA 1HNVA 1NM2A 3HDSA 5J2MA 1RT4B 5JJBA 1B0VA 3G8QA 1TQLA 2F9DA 4LMZA 1DAXA 2DH9A 5F3ZA 1HI1A 3HHLD 1P8GA 2NSBA 2Z30B 4DR5J 4ZCMA 1FXDA 1GNKA 1QJHA 1B4SA 5F8NA 3ZZOA 5DQHA 3PX4A 5FLXY 3PRBA 2RU9A 3UDEA 1X4GA 3LUYA 4QZVB 2MZ1A 2HQ3A 2RH3A 2QV6A 2F8HA 3H20A 2DR6A 2HNDB 3TANA 2RS2A 2P6SA 3KK3A 2XS2A 4I6WA 4AT1B 2C42A 4RW9A 2X1AA 3BKFA 3K17A 1HIYA 1WTFA 3TAQA 3NMAA 5K14B 2EG1A 3KLVA 1PJ7A 2JZ5A 2KRRA 4JYAJ 4PXCA 3HHLA 1C0TA 1FRXA 2VJUA 2FPHX 1QTMA 3EVOA 3EXCX 2BYCA 1NHKL 2CUYA 2EI5A 2IYGA 3HKWA 2L9DA 1VQSA 4HR2A 1RYRA 4IRDA 2WZ1A 5L8RC 4Y34A 1TMJA 3E01A 4NLWA 1SKUB 4DUYJ 1C2PA 4KIAA 1J5OB 1Z4UA 1WOSA 2DPIA 3PO5A 3N9UC 4OYXA 3OFHA 2YKAA 2WONB 4NYPA 1KONA 2CDRB 3DDNA 1SJ3P 4J9PA 1WOPA 3KK1A 2AQ4A 4WE1B 1XMQJ 1TVRA 2F7VA 4C8YA 3UVJA 1NSQA 4Y2CA 1B0TA 2MLZA 2V4JA 2AX0A 1IQTA 2NREA 2J7KA 1SV5A 4YDDB 3EGNA 1VHFA 4ER8A 1FJ7A 1VIXA 1S6OA 1NAQA 4EO8A 3MEDB 4MJKA 3RB0A 3MMCA 2W8LA 2ALYB 2B8PA 2MKJA 3OFGA 1NPPA 1KP6A 1YJVA 2W1BA 2ZH2A 4DDFA 4QR2A 4KHRA 4ZLJA 3X1LB 3SV3A 4YY3F 4ZPCA 1H2UX 3VCDA 3NP5A 3N79A 1GEHA 4B3RJ 5CHCB 3EX7B 4ZPBA 1I1GA 1FE0A 4DSLA 3MD3A 2PI5A 5CAAA 3PXGa 4CIOA 1WI6A 4LSZB 4YFUA 3FVYA 3PCOB 2XTJP 3Q86A 3ICLA 4FKXA 5KFDA 3G96A 5HLFA 2HIQA 4G1IA 1VR6A 1FNXH 5KFWA 2JEFA 4K50A 5ETOA 1FRJA 1XR7A 1Q8KA 4O44B 1YWXA 4PAAA 2HQFA 2QLBB 4I69A 3QYYA 3M30B 4JBCA 3V81B 2V9WA 3NGKA 3M32B 4NASA 1S1WB 2AJQA 5HMYA 1HLWA 3JTPA 3CT9A 3OFEA 1TR0A 2YNIA 2M52A 1RT1B 3MR7A 1JLBB 5AJ3J 4PCQA 4LF7J 1NB7A 1XMBA 3H2UB 1EP4A 2XLKA 3LH2S 4V19J 2HHUA 3MEGA 4PPDA 4ED2A 4DN0A 2XMWA 1LXJA 4ZVGA 4RUBA 2E29A 2VU5A 1NDPA 4IQMA 4FF4A 3SFGA 1FWKA 5DO2A 2RKIB 3IRXB 2EK6A 2KFNA 2MKKA 5G0RB 3OR1A 5F8GA 1N5QA 3A3NB 4LIWA 2PE8A 4J9LA 2V94A 2QFIA 4J5OA 3PKMA 2D3UA 2H5EA 2GX8A 2DHGA 1YBUA 4LF6F 2F5GA 4OI4A 1DBDA 1HWUA 4QWAA 4DG1A 2BJEA 4OYAA 1GX6A 2HHXA 1Q86T 1E6YA 2ZOFA 1IN0A 3FDSA 2CYYA 2P6TA 4PWWA 2D9PA 3POTB 2VV5A 3Q8QB 5KG6A 5C5JA 1Q78A 1HKAA 5D0EA 1H73A 1LFPA 3CC7S 2CNOB 2ZUGA 1KOHA 4RW7B 2FZCB 2E5JA 1XNRJ 1I94F 4JI5J 3MM6A 4C98A 4PG8A 4ILRA 1OYDA 2EW9A 1ITPA 5HJXA 5B0DA 2JLFA 4DV1J 2AKWB 4PXDA 3OV7A 5B0BA 1HNZJ 3PX0A 2F4VF 3UI3A 4J37A 2F63A 3CJ5A 3C6TA 1WF1A 5AE3A 2NR0A 2FJAB 3KK2A 4NPOA 1HL6A 3ITHB 1SC6A 2PMHA 2C2OB 4LR7A 2FJXA 2C3OA 3BSAA 2CNLB 1V5VA 4NLRA 2C2DA 2JJ4D 3OL9A 4BBYA 2HBYB 2ZWOA 4IFVA 1SKSA 1QAXA 3HPOA 1TAQA 3L95X 3LWMA 2DXEA 2QN6B 1X4EA 2V2ZA 4DL4A 3MMJA 1ZS6A 2Q6CA 3QZ8A 2Z2ZA 3GYXB 3EVWA 1RGVA 2EC2A 1VBZA 4Y2KA 4TY8A 1CLFA 4CH1A 5D4LA 3P49B 3T6BA 1OS5A 1U6BA 2FIUA 1VDHA 3N6MA 4NCBA 3NL0A 1TAUA 2KJWA 2ASDA 4MK7A 4KJIA 2DR5A 2OFGX 4Q2MA 5A6WA 3D5MA 2GHWA 4X64F 5HROB 2HVDA 3OBIA 3KTQA 4LF9J 2YQ1A 3PJ9A 3WIVA 3PO4A 4NCGA 3K57A 3PKYA 1RTHA 2J5AA 1FX2A 1KKHA 4OYIA 4U8YA 3QFHA 4DL2A 2CQ2A 3TVZA 3M8PB 3ZNUA 2IDEA 1F3FA 2AEMA 1FHTA 4DR1J 3GP9A 3SFUA 3CCUS 1T0TV 2NXUA 4FXWA 4KPYA 4DUZF 3DRPA 2QSFA 2B9WA 2IAJA 3W2VA 3TZZA 2Z56B 4I2PB 2W7PA 2AEJA 1O6XA 2GIQA 2CIMA 3SSSA 4WK3A 2LQ9A 1FWPA 3ET6A 2DHHA 2RRBA 4A47A 3P8BB 4WP3A 4XAKA 4KBIA 2E9ZA 5HVFA 1FKPA 3QT6A 1VC0A 3DFEA 4ECYA 2MKHA 1RT6B 3QBCA 2FVSA 2MMYA 4ELUA 4ID8A 5JXSA 4CI0B 1WG5A 3FEYB 2HWTA 4OX8A 4LR8A 2C2RA 2BRLA 4OMFG 2HWHA 1BGXT 1VQNS 3HULA 1SC4B 1TKXB 2J0XA 1U2RA 3AODA 1ELOA 2QZ8A 4CO0A 4EBDA 3R5BA 1FD8A 4FP9A 4WTYA 3PYEA 2DO4A 2VPZB 5FLXU 5CXTA 3G6ES 2KJVA 2Q66A 4ED4A 1FE4A 2UXBF 1G7CB 3VGVA 2I8EA 2LMIA 4GRSA 3KLHA 2FLNA 4F7VA 1KOOA 2RILA 3B4MA 5I42B 1FFGB 4C11A 2UUCJ 5D4PA 2B4VA 4F4XA 4KGXB 3RBEA 1ZZFA 2N7CA 2VA2A 2DISA 3NWRA 3BYRA 4HDHA 3L3CA 5HATA 3CDEA 5KOXA 2B56A 3JYTB 2OPSA 4HT5A 2CNNB 2GMHA 3VHQA 2WTFA 4ED1A 3A3PB 3D28A 2VJVA 4HACB 2UV8G 1WEXA 3FUYA 2R4FA 3QSIA 1U1KA 3JTOA 1RP5A 3HLUA 1WKLA 2W9BB 1R7IA 4QIVA 3DU5A 3QGPA 2ASJA 2XEXA 2B51A 5CYQA 2KT2A 3VWSA 3O3LA 2ACMA 3DC2A 4OHXA 1RADB 1QE1B 2DR7A 4WYLA 4H4OB 3WZ0A 3CCLS 1SL0A 2XO6A 2AYMA 1C1CB 3H0PA 1F0XA 2YTCA 1HR0F 3FQLA 2EKNA 5J2PB 3I5BA 3FGVA 4A8WA 3NKYA 4ECZA 1Q5YA 3T3FA 2WB1D 1M0SA 3M6UA 1X4HA 5IZHA 2R3VA 1CULB 2K7KA 3DRRB 1R8PA 2X1FA 2KYXA 1VQOS 3HSJA 4NXNF 2DNHA 4C8MA 4LRBA 4IFYA 4K0KJ 3MR6A 3CNQP 4LRAA 2HNDA 2EVZA 2ZZMA 1JKHB 2YNFB 2AEFA 4C7QA 4QWEA 2H4YB 2H65B 9ATCB 1FI4A 3NS5A 3PHEA 1R3NA 4AE5A 2EXUA 4ZCIA 4CQ1A 4FYDA 4WFNQ 1TUGB 3DXSX 1IBLJ 5K14A 1X5SA 1RKIA 2YPYA 3LP2A 3HVTB 2MZSA 4AL6A 4DBQA 3M9NB 3KLEB 3A4TA 3MMAA 4CO5A 2UUAF 3N6NA 3SCKE 5EX3A 1T8EA 2YWGA 3KJQB 5HANA 3HHKA 1S6UA 2W7OA 1HBNB 4Q44A 1RT3B 3KYLA 3W5XA 1J5OA 2HVZA 5ETQA 4FPIA 2Y1JA 3RAQA 1KBRA 2ZKUA 5J1EA 2QMXA 2UXDF 1NEEA 3PY8A 4P7TA 2C3UA 4CNYA 3KMSA 1D3WA 3GILA 2WONA 3MM8B 1TKZA 3V6KA 2HHHJ 4LFAJ 4F3OA 4R0JA 3RUBL 5J2QB 1TK5A 4WE1A 2DJWA 2E1AA 2H3EB 3QAUA 4JV0A 1IKWA 4YHHJ 5BJRA 3IFEA 1RTIA 3KLGB 1X4FA 4KKOA 4X62F 3O44A 4Y3CA 2B7BB 4U9RA 2MZQA 4ZVTB 1RA6A 2KFYA 4XK8C 5KFSA 4LF2A 1TK8A 4ZVFA 5DG8A 4DS5A 5BR8J 4LRFA 5L1KA 2XMVA 4CWBA 1BQMB 2V34A 1TKTB 4DLEA 4X4UA 2V4RA 1WHYA 5E33A 3TYTA 3C16A 3M2VA 2K8GA 3A8KA 2X1BA 4X4NA 3I5AA 4LF5J 2VG6B 1CSJA 2KG1A 2V67A 4OX9F 1D9AA 4NYOA 4N76A 4WBFA 1Z1ZA 2MY8A 4IH7A 3MAHA 3M9MB 4LFCF 1JLCB 3FCWA 4DV5F 2VBZA 4JI2J 2ACYA 1BUXA 4LQ9A 3FQKA 2BX6A 4ID5B 3MPUB 2FC9A 4X4OA 4QCLA 2VODA 5D0GA 2BJ3A 2FHOB 2CWKA 1XMOJ 3R5CA 3DHXA 1QAYA 2W25A 1X31C 3ISZA 2MQMA 4WFAQ 4ELVA 2R7UA 3C15B 2ZH7A 1N33J 3MR2A 1RT7B 1TZ0A 5KFNA 1A9NB 3CCVS 2R7OA 2VIHA 4NZ0A 4O44A 1NK8A 1VQ4S 1G3OA 3PYDA 4CZCA 3A8EA 2ROEA 4TXSA 4L74A 5KT7A 2D3OR 1GXTA 2DGXA 2KT5A 1OJ4A 2AJ0A 3N0VA 3LTOA 3M30A 4RW8B 2CVIA 3HZGA 1S1WA 3AQPA 2WCXA 4DLGA 3RZAA 2R8IA 2DHXA 2H4WB 4LF1A 3IGVA 1UVMA 2ZEJA 2ZD1B 1WC4A 3LGMA 2EG2A 4RU9A 1JLBA 2MKYA 1S10A 1R0CB 4FS2A 5DETA 3IGNA 5JVGQ 4JI1J 2AP6A 1YK9A 1PSDA 2VPXB 2BE2B 1T03B 1RQ0A 2I38A 4YS2A 5BYRA 3T1HF 1FWLA 2RKIA 3DKDA 3IRXA 2DGSA 5LM7E 4PZVA 5G0RA 3V6HA 3L09A 1NJWA 2JLEA 3HO1A 1WDTA 1MROA 5IT4A 5ETVA 2EKYA 4DV2F 5K5MA 1SBRA 2GHPA 1RWVB 1Q4RA 5KFZA 4NA2A 2ALZA 3DM2B 3QWUA 2WRMA 3EXYA 3B78A 3DLHA 5A8WB 4M1KA 4WZQA 3V6DB 1RT5B 1HARA 3Q24A 2I9SA 2GIRA 5E0OA 2QTWA 1H98A 1RTJB 4DSFA 3POTA 3MEEB 1N36F 4DPXA 1ACMB 5IOLA 1UVKA 2GO9A 4FVMA 1Q79A 2DNMA 4LIRA 2YNHB 1G4CA 1QAJA 2P9CA 4RW7A 5DM7Q 3S01A 1S6QA 3HSDA 1SJRA 3R6GB 2DHSA 2KYZA 3J7A1 4A46A 4D3GA 1IBMF 4MYTA 1NSPA 5DGBA 4F8RA 2QMWA 4MH8A 5KFPA 2AYGA 4X66J 5E3AA 2XMJA 2XSFA 3GLJA 3BN4A 3ITHA 1Q82T 1QSLA 4DR6F 1RCXB 4F2SA 1R0AB 4RNMA 2O3DA 3ZTRA 1GMUA 2CG8A 4G65A 2GIFA 3OJUA 2WBRA 4H4KA 3M6VA 4M5LA 2MGZA 3L7PA 3GJQB 2IA6A 1MN7A 3SZ2A 2ZHOA 4ANEA 3LGHA 2HIYA 3OXLA 4CLPA 3CJRA 4OI3A 2ZH4A 3ILOA 1Y4ZB 3W5YA 2UUBF 2Q3PA 1SC3B 5ETKA 4AQYF 2XS7A 5LXYA 2DRDA 2JEJA 4IR1A 3HT3A 4Q2LA 2AHOB 1VQ7S 1YJTA 2X1GA 3QQCD 4CLZA 3K8WA 2DXFA 4NLPA 1NJXA 4P2MA 2IRYA 4LBIA 2VQEF 3C19A 1D8ZA 1VQLS 4FDFA 5C42A 3NGRA 5CH7B 4CO1A 2PDAA 4USUA 4DV4J 3PRVA 2G4BA 2UUTA 4X2BA 2BJDA 1S6PB 4FNHA 2M7SA 4QBUA 1WEZA 2VKZG 4UQTA 2DBBA 4I2PA 3TA1A 4C0OC 4ETXA 3THVA 4ZPWR 5BXIA 1SI9A 3Q8PB 3MFIA 3SI8A 1UZHA 3RBZA 2IRXA 1UVLA 2E5GA 1V6HA 2L9WA 1URRA 5HP1B 3CC4S 1FNOA 1FESA 1RT6A 1Y7PA 4GVBB 3LGNA 4OV6A 1ICEB 1VLOA 2QLXA 5L1JA 2HFSA 3B4DA 3T1YJ 3PDNA 3KUEA 3GONA 5A6PA 1UEKA 5JUMA 3LANA 3H42A 2M9KA 2UZAA 1TKXA 1ROFA 1OPZA 5H9EJ 4UOGA 3ZFVA 1LK7A 4USMA 3GCWP 3R6LB 4ZVUB 1KQSR 3F41A 4ZVQB 3G8SA 1K8AT 1CC7A 2K3KA 1SH2A 1U1QA 4QPXA 3AJ1A 4FN5A 3T1AA 1OQ6A 2J9EA 4OX7A 3T19A 1S0MA 2CQHA 3TVYA 2M70A 4C8OA 3OTCA 4ZMMA 5F8MA 4JI7J 4LFBF 3M6XA 5EN1A 2WSFC 2X3DA 2CZ9A 4OYZA 2B5JB 1OIAA 3JYTA 3HSGA 1VFJA 1SJ4P 3LAMA 3Q23A 4AL5A 5DJBA 4LRDA 2I6WA 1OYEA 4JUZA 3PYGA 2W9BA 3I0RB 1EQ0A 1OWXA 3D2WA 1GXLA 3IN5A 4LUBA 3GG1A 3FBBA 2R42A 4LF8F 1E6VA 2PA8D 3E51A 4ZPAA 2LA6A 2V5HG 2D7SA 4H4OA 2ADBA 2ZVSA 2KHDA 1J2VA 1AXQA 2XMAA 2OMLA 4OYPA 3CJ2A 1Q16B 3IC1A 1C1CA 1I5OB 4J7CA 2CRLA 4A8YA 5A8RA 1HNIB 1SCJB 1YRTA 3OL6A 1SQFA 4CT8A 4ZJLA 2GVZB 5J2PA 1WNEA 3IBWA 3VGUA 3H5UA 5D15A 2R7XA 2GO8A 4EYIB 4MKVA 1KN6A 4LBPA 1WELA 2WVDA 3CW2C 5IQQA 3K5PA 4MAKA 1N88A 4AYBD 4U96A 1CULA 4K4TA 1VQ5S 2VFRA 4O4RA 4MFBB 1B3TA 3NAHA 4B02A 1YRXA 3VAIA 5HO4A 1JJ4A 1AT1B 3T5HA 1OSDA 3CCZA 3AQOA 1QM9A 1JKHA 2YNFA 3B6BA 2RRNA 1T9YA 3MCSA 2QE5A 2HLTA 3GJSB 2ATLA 3TA0A 5AXLA 1NXIA 1U45A 3KJFB 1VS3A 3FEZA 3N5BA 5KFIA 3OL7A 3QFWA 3MPWA 4HHUA 3HVTA 1ZBTA 2JDJA 1A7GE 9RUBA 5KTQA 1JMTA 2H54B 2YX1A 2C2KB 2R2SA 1RABB 3WX4A 2CJBA 3DOKB 2B4PA 4NA1A 2CQ4A 2HNZB 3GTYX 2LQJA 2AZ1A 4ITSA 4OHVA 2C3YA 3FZ2A 2APOA 3TRGA 1HBNA 4P72A 1RT3A 2CVEA 1RWPB 3R7NB 3M05A 2UXCJ 2IHR1 2C3MA 4F4ZA 3QLHB 4UOHA 3MMBB 1BMQB 1UPMB 3QNWB 3TVKA 1U26A 3I6PA 1N34J 4OJHA 3NNAA 3TX0A 3CDWA 1U09A 3MM8A 1HHSA 3NG8A 1ZM4A 1KC8T 4URQU 1Y0HA 1XNQF 4X84A 5J2QA 1X5TA 2PGCA 4A48A 3JB9k 3KLGA 3AT1B 2HVIA 2MKCA 3GIIA 3T41A 2Z2LA 4K4YA 1QSYA 2RU3A 5DDRC 2LQ8A 3UWTA 5CYJA 2C2EA 2KKHA 2V2QA 3FKBA 5DGAA 4E98A 1JWWA 1RBLA 2BKNA 3M1VB 1UJ4A 3FFIA 1BQMA 2VASA 1TKTA 3B54A 4TQSA 1M5KC 3BR9A 4JI6J 4ZVPB 1FF2A 4AXJA 3DYAA 2HLUA 4DXLA 2VICA 2HRUA 3CO0P 3RW7A 4ES1A 2GZOA 2VG6A 2EEYA 1ZA1B 4DSEA 2BABA 1DARA 1DTTA 2YKQA 4DL6A 1JLCA 4NLQA 2ZBQA 1KHWA 4TKTA 2FHKA 2CADA 2XG8A 3X3UA 1PC5A 4M5MA 1O8BA 2A2CA 3IR5B 5FD1A 3O1LA 4ID5A 4NE9C 2EPIA 4C3KA 3M2RB 4ZLNA 2N4DA 1WTBA 4BDPA 3KKFA 3NGDA 1PGZA 3ZZ0A 3QMQA 1OPIA 1T05B 5KG4A 3L7OA 4Q45A 1YZ7A 2XY7A 4N8NA 2FJBB 3GV5B 4ZHRB 2N3LA 3JQJA 4PXEA 2UV8A 2KFZA 4JV1A 2XC9A 2MKSA 1FDDA 3A3OB 5J2NB 1RSCA 2I1RA 4R0EA 2ZJPQ 3M8YA 3WC0A 4KC5A 1T02A 3Q8YA 4DR5F 3W64A 4Y6IA 4HEA9 3CJKB 2LU2A 3HHLB 2MLXA 1C0TB 2UVRA 1U1OA 4ZIWA 5H9EK 2ZC3A 2BVZA 3G82B 5DZ7A 4R5PB 3MPDA 5HSPA 1LW2B 5L9NA 1QD1A 2CG4A 4HKQA 2ZD1A 4C97A 3CJ3A 2BE7D 1XTZA 3E01B 4JV5J 3GZ7A 2XNRA 5LMUJ 5FDLA 3K0JA 2W2QP 1FKOB 2FHMA 3BEGB 4DX8H 2ZBRA 2BE2A 2DGWA 2P9EA 1T03A 2EFPA 1EARA 2G0JA 3Q8UA 4JYAF 5C2CA 3OQ2A 3UDVA 2ZH3A 2DYAA 3MXHP 3BSCA 3CCSS 2HZVA 4JI0J 4ZPVR 3KG0A 4OZLA 5KFFA 2ZH6A 2OAUA 4G1QA 1RAIB 4Y2IA 3K2YA 3UVJB 7FD1A 1PJ6A 3V2UC 3DLLQ 1AB8A 4DUYF 5KG1A 3DM2A 4QIGA 4F36A 2V4JB 1HD1A 5KFEA 1RBOB 2DNNA 5A8WA 5K9FA 1SV5B 1IKXB 3V6DA 1RT5A 3M7VA 2AX1A 2K06A 2GMLA 3J7YU 3O5TB 3PR4A 1RTJA 3MEEA 3V4IB 4KQZA 4GMKA 3R5JB 1PC4A 3PFOA 4F3QA 1M5VC 4MIWA 1S9EB 2B3TB 4NYZA 1WOOA 2HQCA 1ZM3A 3W8PA 4X4SA 4K4UA 1B0PA 2XSJB 1XMQF 3D1OA 1QUVA 1TFWA 2E66A 2ZJRQ 2QRRA 4TQRA 4PEOA 2FGOA 2HQGA 1L3UA 2DNOA 2AYBA 2HHVA 2LXIA 4RUCA 4RO0A 2BBEA 3FCHA 4XPEA 4CH7A 2B9XA 3CTRA 1GMWA 5F0UA 2WW8A 4ES2A 2XYHB 4M5JA 2V8GA 2EFOA 3DDKA 4Y2MA 3DGPA 3OPKA 2ZH5A 4CLLA 4NMXA 3MUVP 1RHJB 2XLIA 1W2BR 3B82A 1NLKL 3R5DA 3NGSA 2DGQA 1NDKA 1VJQA 1NU4A 2HG4A 3G6XA 1HQ2A 4YR3A 2CQCA 2DH8A 4DHVA 4LJMA 4X4PA 3GPAA 2IRUA 1UL3A 3I87A 4U6PA 1LEOA 3H4BA 4M5IA 2KL8A 3AA9A 1XEZA 1M1HA 4HTIA 3SCLE 5HMWA 2YNIB 6FD1A 3MCOA 2FGCA 1S77D 3E8OA 2B8QA 4DMZA 3RR7A 5HJYA 3UCZP 3D7SB 2XYGB 2C1EB 3T6JA 2HPUA 3KHRA 1VHIA 4DV0J 2WW4A 1YJ9S 1C0UB 5KFVA 1WEYA 2RVJA 3PJXA 4ED7A 3GV8B 1VQ8S 1SQEA 2B7CB 2FHJA 1H72C 3D3BJ 1YRUA 4IG0B 3QZ7A 1JXEA 1DTQB 2N82B 2Z0GA 3KMQA 4ENOA 3NNCA 2XBPA 3GCXP 3TZXA 4K2JA 3UNGC 4USIA 2QSWA 3MR3A 2WBMA 3TAMB 1FK9B 2BA9A 2O1PA 5AJ3F 1T3NA 1IR1A 4LF7F 5KFYA 3U27A 3ILLA 5DDQC 3HFZB 1GXUA 4OQJA 2CPXA 5LT5A 2GC8A 2VA3A 4CLWA 3SMZA 2AZ3A 3TI0A 4WP8A 2ILYA 4OJ3A 5KT4A 2QIFA 4IKAA 3QT5A 1SH3A 1N0VC 1BD6A 5HP1A 4OHYA 1TTHB 4K8RA 3TO8A 4FF1A 5KG0A 1WHXA 3I32A 4IR9A 1UTAA 3JQMA 4MYUA 2OLWA 2XY5A 3MM6B 4PABA 4RNHA 5HAOA 1BE4A 3K8VA 2RS8A 2ZC4A 3W2WB 3ZO7A 3PW0A 3WX8A 2XZWA 5J1NA 4NLYA 2ZE2B 4K5RA 6AT1B 3ZZUA 2PEBA 3C6TB 2JH3A 2L41A 4K4VA 1YZ6A 2JEIA 1PJ5A 2ZOGA 5D4NA 1S7HA 2QLFB 3H5YA 3V6JA 4MMOA 4C2MA 2E1PA 3LQVA 1X5PA 1YI2S 2RDDA 3UE2A 1XNRF 3FC9A 3CJTA 1WI8A 4JI5F 2VDIA 4IFVB 4N56A 1S79A 2B5JA 5EWGA 4G3IA 3G9CA 4DV1F 3K58A 4EZ6A 3PYFA 1ZM2A 2LP4A 2QLJB 2NQPA 1HNZF 1HPZB 4OJ1A 2QEXS 4RW4B 3UFCX 3I0RA 1RAAB 4U67Q 2MZRA 1Y5LB 5HQLA 2KRBA 2J0QD 5EDWA 5LMNJ 4ANCA 4DR4F 1Z2ZA 4UOFA 1C4AA 1FFWB 2V8VA 2BQRA 1VLYA 3BPSP 1YVFA 1H38A 2XMTA 3H25A 3LP0A 2U1AA 4JI3J 3GIKA 3MM9B 1RTHB 1CBKA 3HFVA 5THWA 4QQBA 1R27B 2GJ2A 3J7Z5 3RB3A 3SXLA 2GGPB 2AYEA 4LVNP 1F9FA 4LVOP 1RCOB 2BJ9A 1F9EB 5CD4H 1REGX 4OLPA 3CMQA 2DR9A 2HHTA 3ZZZA 1X9MA 2A1BA 2IM3A 4XDDA 3TUIC 3BGRA 1LWCB 4RZRA 2C2MB 1D09B 5GMDA 1UKUA 3KJNB 3ET6B 3OUYB 3TEHB 4LF9F 2FYXA 1UFLA 1NZ8A 2WB4A 3Q89A 2PEHA 3ZZRA 1EQMA 2YQ0A 5E3QA 3TZYA 4DS4A 3M8SA 1FO1A 1FFSB 2FLOA 3NCQA 4JI4J 2R2TA 4BCAA 1M5OC 4DR1F 2YX7A 4H4MB 1UMJA 4CCHA 3LF0A 3OTOJ 1UZDA 3IBCB 1LWXA 3IG1B 2COLA 4NEYA 1P9QC 2BJ1A 1GK8A 1XN9A 2HK2A 4OX6A 4C8LA 1ZTTA 1U2CA 2ZDPA 3MD1A 2VBXA 2XM3A 1RZMA 3BN7A 3EZOA 3K5OA 4EYHB 4USKA 2XB2D 4K4SA 3PRDA 1KFDA 3VVUA 1X4CA 1Y5NB 3CJ0A 4N47A 3BQ2A 2JHEA 2DNKA 3MMBA 5KG3A 3VTIA 4L72B 3KJVB 4QR0A 3CMAS 4L75A 3IWXA 3OVSA 1URNA 3Q0AA 4RW6B 2E7WA 5GAGI 3IA0A 2MSSA 2UU9J 4EFAC 1GTEA 2BZ2A 1HBUB 2V0NA 2H51B 4JI8J 5KFCA 4B9TA 1X0PA 2K1RA 4X4QA 2VPYB 2OPSB 4L76A 3VVTA 4Z2XA 3UDCA 1W26A 3CC2S 4OZ0A 2E44A 1YGYA 5E3PA 2VF3A 2XI3A 1JLAB 1VI7A 4CLKA 1WC3A 5D6GA 3M1VA 4IRCA 1U4BA 2OHDA 1AUDA 5L38A 3RAXA 2DVIA 4XTTA 4CYUB 5K8OA 2DNYA 1LNQA 5GADI 2UUCF 1U8WA 4WKRA 4OIXA 3HHNB 2ATCB 2OMOA 3IAS9 3JAMY 5HVHA 2IC3B 3A1YG 4GKKJ 5CQGA 4DQRA 2FDNA 5T7LB 4R25A 4W4MA 2PT0A 3HSZA 1M5SA 3GV7B 2OTLS 2O67A 4GVLA 3UR0A 5L46A 3DI6A 3BGOP 2IYIA 2C2ZB 3DOLA 3PJWA 4O23A 1KD1T 1W2IA 3M2RA 3NBPB 3EM1A 3ZTQA 3OXGA 2MHNA 1KTVA 4IFYB 5LL6d 4X4VA 4B17A 1KTQA 1T05A 3KLFB 1H2VZ 1PILA 4RNFA 4ZHRA 4IOCQ 4X4TA 3G86A 2E1CA 4RPFA 4KE5A 4DCOB 2VOOA 5H1SV 5J2NA 1NNDA 1ZAWA 3MM7B 3SEOA 3LPEA 3CJKA 3LP2B 3W8GA 2Q43A 2KU7A 4P10A 1R8CA 2CPZA 3G82A 2XZTB 4R5PA 2BMBA 1SL1A 2WVCA 1SUQA 2F3JA 3KG1A 4U7UK 1LW2A 3MMAB 3DLEB 3HJVA 3D6MB 4MKAA 1JLGB 2ZVIA 1RA7A 4CP5A 4QW8A 4K0KF 1U2FA 1AYEA 2BEFA 2OTJS 2MZJA 1H7XA 1RAHB 5ETTA 3M8QB 3MOZA 1FKOA 4O3NA 1P1LA 2AV5A 1CEZA 5J1EB 1S9GB 1IBLF 2RQMA 5L1LA 4IO9Q 4LSNA 1JJCB 2DGOA 4YQWA 1NPRA 4HH1A 1YBAA 2HZAA 1TKZB 2Z57B 2W01A 4WKYA 2HBRB 3EVMA 4ZCLA 1IKWB 1SC1B 1ZM9A 4KH0B 1RTIB 4KHPJ 3Q8SB 4KKOB 4UY8T 3I9ZA 5IT0A 1JX4A 1TV6A 5L9XA 1IKXA 2K7JA 1RAOA 1HFEL 2FB0A 2O66A 4OI2A 2HS0A 2PN6A 4DOZA 2AWZA 5CA5A 5I3QA 3V4IA 4WIIA 1K1QA 1DQAA 2HHHF 3KFWX 1HQUB 5T14A 4LFAF 1S9EA 3C16B 3M2VB 4GKJF 1NJZA 3RU0A 1U6ZA 1JNRB 4W90B 2XQCA 2XSJA 4L3NA 1JIHA 4KTQA 2UP1A 2MDAA 1OY9A 3BO4A 2PIIA 2BJ7A 2LKZA 1D9FA 1RE1B 4DL0C 4NL5A 2EFVA 4J9VA 3UD5A 2WSCC 4BLGA 2YWEA 2VFSA 3W9IA 5DM6Q 3PZPA 2BRKA 3CULA 3GFZA 2XMKA 2DPJA 4QIEA 5I3PA 3CJQA 2ZBPA 2BDPA 1B7YB 4WCEQ 5BR8F 2MTLA 2ZH1A 3ONQA 4P2SA 2WHOA 1YTYA 2Q79A 4RWXA 3CE8A 2CZ4A 1G1XA 1UW9A 1S0OA 1HWLA 2Y1LB 2PA3A 3CCMS 4RNOA 3EDRB 1K1SA 3FZBA 1SVDA 3BR8A 2Z58B 1YIJS 5K8NA 2EBEA 2OSRA 8RUCA 1S59A 4DU8A 2MY7A 3UNYA 4EU0A 4TY9A 2V63A 3NCRA 1DQ9A 2JC1A 2UVWA 2V9KA 1RU1A 5GAGU 2CQIA 1BLUA 4QJVA 2FZGB 4JI2F 2C28A 2B43A 1Y11A 3CIZA 3A8IA 1RHUB 3AA8A 5HN0A 1N54B 1OO0B 1QLNA 1LOUA 1PG5B 1XMOF 4MIAA 2FVPA 3A12A 2RD5C 3MM5B 2E5LJ 4DV2J 1N33F 1DZ5A 4PWDB 2QL7B 2XNQA 2VD3A 1C0UA 1GTHA 4R8UA 4F25A 4B3SJ 2ZBIA 4U95A 3H2LA 1HWIA 3OR2A 1HNWJ 4U7UD 2O01C 2NXCA 3QPIA 5F0WA 1DFDA 4WU2A 4IG0A 2EC0A 2CQ1A 4ZOSA 3PIPQ 5KFAA 1DTQA 3CD0A 5GADU 4P7VA 1AUSL 1MROB 3OHBA 2QYCA 1RK8A 5E3CA 3SCJE 1H2TZ 3GG0A 1TL4A 1YDLA 3TAMA 1FK9A 4MIBA 4WXOA 2BKOA 5IWAJ 4JV2A 4LBHA 2BE9B 3BSNA 1RYSA 1IXKA 2KZZA 3C6UB 2MJUA 3Q22A 1XERA 4JI1F 3H4DA 3R5GA 1DLOA 5F9LA 5F8IA 2VG7B 2R7QA 4C3LA 5FJ4A 4H54A 4KT0C 3G71S 2HS3A 5J1PA 2KM8B 2YWKA 1N6QB 1SIWB 5JVHQ 5MLCV 4YR0A 1KQFB 2PSZA 2J7WA 1S6QB 4PQAA 2KXHA 1WWHA 2OH2A 1YSJA 3W2WA 2IJNA 1X60A 4DX7A 3M4XA 4RX6A 3G4SS 2C3PA 2ZE2A 2ABYA
chains in the Genus database with same CATH topology
2BM1A 4M63A 4DV6F 1X9SA 3OTCA 2YH0A 1FTRA 4PG5A 5AXMA 4ZMMA 2R7WA 5F8MA 4I4BA 1CVJA 1UA0A 3RBDA 3VZIA 4LFBF 1QUPA 1S4FA 3M6XA 1T3OA 2CQBA 5AE2A 5EN1A 5E2QA 1NKCA 2WSFC 1IUJA 5HMZA 5HQ8A 3T9NA 4KHPF 2B5JB 5CYQB 4Q43A 4QYZJ 3F73A 3CCJS 1OIAA 3JYTA 3R3TA 3T5JA 1VFJA 1SJ4P 3LAMA 1S1XA 2HWIA 2MKIA 3Q23A 2OP5A 5CZVA 1AFJA 1TUVA 3SQGA 5DJBA 4AL5A 4FBTA 5GAHU 2MQNA 5KFMA 4JUZA 1UAWA 2QO3A 4C3MA 3HJFA 3R1LA 2W9BA 3I0RB 1HNVA 1OWXA 3HDSA 2NSCA 3D2WA 1GXLA 3OLAA 5J2MA 4FZVA 3IN5A 3QIPB 4MK9A 4LUBA 4DEZA 1RT4B 5JJBA 1B0VA 4PUOA 3G8QA 3GG1A 4RKUC 4LT6A 1SKWA 1TQLA 2F9DA 3PACA 4DFMA 4LMZA 1DAXA 3HX9A 1YQHA 2DH9A 4B9SA 5F3ZA 5M2UA 2MGZB 4LF8F 1HI1A 1E6VA 4IOBA 4OJGA 1JLQA 1X8DA 3HHLD 5AXNA 2AJ1A 1RDRA 1HPZA 1P8GA 2NSBA 2PA8D 3E51A 4ZPAA 2D3ZA 1JLEB 4ZCMA 1FXDA 4N5SA 2LA6A 2V5HG 2D7SA 1GNKA 2FVCA 1QJHA 4H4OA 4X66F 4RW4A 5F8NA 4NX9A 2ADBA 2ZVSA 5IXUA 2KHDA 3ZZOA 1J2VA 4UW2A 4BHQA 3OTBA 3PM9A 5DQHA 1AXQA 3PX4A 5FLXY 2OMLA 3PRBA 4Q5VA 4OZJA 2RU9A 3CJ2A 1Q16B 3IC1A 1C1CA 1X4GA 2AGQA 2I2YA 3FNNA 3D0GE 2CRLA 1IKVA 4A8YA 3SYZA 3LUYA 4QZVB 5A8RA 5T41A 1HNIB 4N77A 2MZ1A 2XY6A 1YRTA 3OL6A 2HQ3A 2HHSA 2RH3A 1T7PA 1WD6A 4CT8A 5J2PA 2XLJA 2QV6A 4IDKA 1ZYQA 1WNEA 3IBWA 5CCMA 3H5UA 4B3RF 3HI9A 1FXRA 2F8HA 2N3OA 2DGTA 2DO0A 3H20A 3N01A 2R7XA 2GO8A 5DQGA 4EYIB 4OZNA 4E0DA 2MZTA 5G4DA 1KVJA 1KN6A 1WELA 2HNDB 1N48A 2PI4A 4QWBA 3EUNA 5IQQA 5B0GA 3K5PA 3V81A 2G13A 1N88A 4MAKA 4AYBD 3TANA 2RS2A 2P6SA 4CNZA 2RUGA 1VIOA 2Q6BA 3M32A 3KK3A 2XS2A 3ENQA 5DLGA 4I6WA 1UVNA 1KFSA 2C42A 4YDXA 3BQ0A 4K4TA 1KLNA 4RW9A 2X1AA 1VQ5S 2VFRA 3MM9A 1NHVA 4MFBB 1WTFA 4O4RA 1VQYA 2JL9A 2MPUA 3TAQA 2ZITA 1S1VB 3NMAA 3NAHA 1JLFA 4LSLB 4B02A 3IS9B 3VAKA 1YRXA 1RT1A 5K14B 2EG1A 4ZDNA 1LKZA 2GGPA 2JZ5A 5HO4A 3KLVA 5C42B 3VAIA 4BC7A 1TL5A 4DQSA 2KRRA 1JJ4A 4PXCA 2IFXA 3CCQS 4EGLA 3T5HA 3K7RA 3U1NA 1OSDA 3CCZA 3HHLA 3TOQA 1C0TA 1FRXA 3AQOA 2EWHA 1QM9A 1JKHA 2QA4G 4I67A 2FPHX 2YNFA 3US5A 3MTJA 5KT6A 3DOMA 2RRNA 3VF0B 2UVUA 4R8UB 3EXCX 1QTMA 5F8HA 2VKRA 1U1LA 2BYCA 1MSWD 3MCSA 2EI5A 2QE5A 2HLTA 2IYGA 3OR2B 3OXFA 1OQ3A 3HKWA 2ATLA 2L9DA 3TA0A 3I5CA 4J9RA 2VC0A 1VQSA 1L5UA 5AXLA 4DQQA 2BR0A 1U45A 4RU2A 5AE1A 1LWCA 1RYRA 4IRDA 1VS3A 3FEZA 3N5BA 5L8RC 5KFIA 4H4KC 3OL7A 1VRTA 5KOWA 2ZNYA 1S1UB 3MPWA 2NZ4A 1B64A 5DS7A 3IO1A 4Y34A 1HA1A 3HVTA 3E01A 4NLWA 4NA3A 2HQIA 3LP1B 1L3KA 1C2PA 1ZBTA 2JDJA 4OZ1A 1A7GE 3OUYA 4KIAA 5KTQA 1JMTA 1J5OB 1FNMA 3MF5A 2YX1A 1Z4UA 2CPIA 3W7BA 2R2SA 3IXQA 4ZKAA 1HI0P 4TU9A 3WX4A 1LW0B 2CJBA 4NRUA 4QYRA 1UETA 4EO6A 3DOKB 2DPIA 3PO5A 2B4PA 4NA1A 2JLGA 5HBMB 2CQ4A 4IQXA 2E5LF 3N9UC 2HNZB 4YB7A 4ZP8A 5DLFA 2LQJA 3MZIA 3BS9A 3VQTA 4ITSA 4OHVA 2J0SD 3GR1A 2C3YA 3FZ2A 2APOA 3TRGA 5F41A 1N5SA 5LJ3Y 3F44A 1FD2A 1DJ0A 4DV4F 3OFHA 2AGOA 1HBNA 2YKAA 4H4MA 1C1BB 2SXLA 1RT3A 2WONB 3UR3C 1Q8BA 7FDRA 4DSJA 2D74B 2HYIB 1L3TA 2CVEA 1XR6A 4NYPA 3CCTA 4HHJA 2E9RX 1DLOB 1KONA 3M05A 3J80Y 2IHR1 3IG1A 2C3MA 4F4ZA 3QLHB 3DDNA 4B3SF 4F50A 1SJ3P 3MMBB 1HNWF 4J9PA 1GAOA 3KK1A 2AQ4A 2F40A 1N4LA 4WE1B 2A2DA 1TVRA 2EK1A 3P96A 3Q2SC 3TVKA 5KG2A 1U26A 2F7VA 3I6PA 4C8YA 5KFKA 4OJHA 1K9MT 2CPEA 3NNAA 3QGHA 3CDWA 3QWPA 1U09A 3DLKA 3MM8A 2IMOA 5DDPC 1HHSA 3NG8A 1APSA 1V9OA 1VOMA 2MB0B 2WAQD 1ZM4A 1KC8T 1TFYA 5KFTA 3R27A 1B0TA 4TYBA 4Y2CA 2V4JA 3TW0A 4URQU 1PO6A 1Y0HA 4IOAQ 2J6UA 1XNQF 4I56A 1QSSA 2AX0A 2YNGB 4BWJA 1F60B 4X84A 4KB7A 2MQLA 1IQTA 5J2QA 2NREA 2J7KA 2DHAA 3N28A 1SV5A 4YDDB 1X5TA 3KJVA 2PGCA 3EGNA 1VHFA 3UCGA 5IWAF 1FJ7A 1VIXA 2CJKA 1S6OA 3MDFA 4RW6A 3S6EA 4A48A 1WG4A 1NAQA 3JB9k 2GNKA 3KLGA 4EO8A 2RJZA 3MEDB 4AFFA 2R8KA 3LW5C 2MKCA 2HVIA 4Y28C 1TL1B 2LCWA 4NLXA 3GIIA 4MJKA 3KHGA 2CDQA 3RB0A 5KFJA 2Z2LA 4K4YA 5KG5A 3C8YA 3T1YF 1HBUA 2HNYA 3MMCA 1QSYA 2W8LA 3PW7A 2RU3A 1FRMA 2MKJA 4Q0BB 3OFGA 4IG3A 5MAOA 1BQXA 2FTRA 2HZCA 5DDRC 1Q1KA 1YJVA 3UWTA 5CYJA 2ZH2A 4DDFA 2C2EA 2KKHA 4QR2A 5DGAA 4E98A 4KHRA 5LSRA 3OLBA 1KVIA 4OI6A 3X1LB 4RUAA 1JWWA 4DFJA 3SV3A 3CDUA 3M1VB 4YY3F 4ZPCA 1UJ4A 1H2UX 1TP7A 3FFIA 5AXKA 2OIHA 3VCDA 2FC8A 3NP5A 1BQMA 3SQGB 3N79A 2VASA 2IA0A 3S7RA 1DURA 2AU0A 1TKTA 4TQSA 1M5KC 3BR9A 1REVA 2YKMA 1LWFB 2M4MA 5CHCB 1FF2A 3EX7B 4ZPBA 4AXJA 2W4CA 3DYAA 4FPRA 1I1GA 1RJJA 1FE0A 4DSLA 1JLAA 2HLUA 2J9DE 2HHPA 3MD3A 2HRUA 2PI5A 4F4YA 5KT2A 3RW7A 3O6QA 3PXGa 5LJ5Y 4CIOA 5C25A 4C4WA 4Q8FA 4ES1A 1NHUA 1E6VB 1WI6A 2VG6A 2YY3A 4YFUA 3FVYA 1JLQB 3EPIA 2BW2A 3ICLA 4C0HA 2IJFA 3C46A 5KFDA 1UP1A 3G96A 5HLFA 1K73T 2HIQA 4G1IA 1FNXH 2QT7A 2ZHBA 3TA2A 4DSEA 1YJUA 2BABA 2FJDB 3TP2A 1KLMA 3CSKA 1DARA 5KFWA 1DTTA 2YKQA 2HAIA 3CUNA 2JEFA 4JI7F 4DL6A 1JLCA 4K50A 3BREA 4MKBA 4NLQA 3QGGA 1FXLA 1KHWA 1FRJA 2LYVA 4TKTA 3LO3A 1XR7A 2FHKA 2VFVA 2XG8A 3X3UA 1VQKS 1PC5A 1XK8A 1O8BA 2A2CA 4QU7A 1MMLA 3IR5B 3MAQA 5FD1A 3O1LA 4ID5A 1YWXA 1NO8A 4O44B 5A8RB 2ZM6F 1GT8A 2EPIA 1FERA 2IC3A 2U2FA 3CEDA 3M2RB 4C3KA 5HMXA 3RTVA 4KSEB 3FJ2A 2N4DA 1S97A 4C8OA 1WTBA 5H9FJ 4BDPA 5T7LA 1N5YA 4I2QB 3KKFA 2ZOMA 3NGDA 3SCIE 4J9OA 1PGZA 1X4AA 2JEGA 4NCAA 3ZZ0A 3QMQA 1OPIA 1JNZB 4I69A 3QYYA 1T05B 2CZVC 5KG4A 3M30B 4JBCA 3L7OA 4Q45A 4PG7A 3V81B 2XY7A 4N8NA 2V9WA 3KG4A 5E7OB 3BZQA 2FJBB 3NGKA 4K2XA 3GV5B 3M32B 3VAHA 1S1WB 4ZHRB 2N3LA 4NLGA 1ULRA 2FJEB 4PXEA 4C0BA 2AJQA 3JSYA 2UV8A 2GQQA 5HMYA 1RKJA 2KFZA 4JV1A 2XC9A 3JTPA 2MKSA 1FDDA 5HROA 3CT9A 4LQ3A 3OFEA 3QJLA 5J2NB 4A8QA 2E1RA 1TR0A 3NBPA 2YNIA 2I1RA 4R0EA 2ZJPQ 3SSQA 1JLFB 3WC0A 2M52A 1RT1B 1T02A 4KC5A 1U49A 3IR7B 1UVJA 5A0YB 4DR5F 4NZ7A 1U47A 4Y6IA 3VR1A 4HEA9 3NS6A 3CJKB 1JLBB 2LU2A 2B0GA 2XI2A 2CQ0A 1C0TB 3HHLB 4PCQA 1NB7A 1XMBA 5DQIA 2UVRA 4FBUA 3H2UB 3KLFA 4J9SA 1U1OA 4K4ZA 1RAJA 2ZC3A 2M2BA 3QGIA 1EP4A 2BVZA 3M8PA 2WOMB 3N4WA 4WFBQ 2YH1A 2HS4A 4R5PB 2XLKA 3LH2S 2E7XA 4V19J 2HHUA 3MEGA 1R8HA 5CYMB 3HKZD 4PPDA 4ED2A 3TUJC 4DN0A 1LW2B 2XMWA 4Z37A 1LXJA 4ZVGA 3CD6S 2D9OA 2E29A 5D78A 5L9NA 4O3RA 3CMES 1S0VA 2CG4A 3GFXA 3CCWA 2V8DA 4IQMA 4FF4A 3AAWB 2AF6A 1JJHA 4HKQA 3SFGA 2ZD1A 3MM7A 5DO2A 3WDOA 2RKIB 4C97A 1NZAA 2WK4A 1NK6A 3IRXB 4QU6A 4Q8EA 2EK6A 2KFNA 2MKKA 3CJ3A 3H2VE 2BQ3A 1XTZA 3E01B 5G0RB 2R2UA 3OR1A 5F8GA 1N5QA 3PW4A 4ETZA 3WC2A 4C9DA 3GZ7A 3BGLA 4DFPA 4LIWA 2XNRA 5C24B 2QA2A 2J8AA 2PE8A 2OD4A 3M2UA 2VH7A 4P6QA 1VGYA 5FDLA 3K0JA 3P3DA 2W9CB 1FKOB 4J9LA 1N5VA 2V94A 4J5OA 2FHMA 3PKMA 3BEGB 4L6V3 4DX8H 3DLEA 2BE2A 2DGWA 2D3UA 2P9EA 3LOUA 2H5EA 5U47A 1T03A 1SXLA 2EFPA 4A8MP 1JLGA 2GX8A 4QOTA 1NK7A 3Q2TC 2DHGA 1O5JA 4I7FB 4JYAF 3UW1A 3BGFA 3QJPA 4FNIA 3DRSB 3OQ2A 2ZH3A 2G1DA 4LF6F 4CH0S 4F4WA 4OI4A 3NCPA 1DBDA 2J9DA 1HWUA 4QWAA 3EGZA 2KHCA 3EYZA 3HF5A 4NZ6A 4DG1A 3MXHP 3BSCA 3M8QA 3CCSS 2BJEA 2RT3A 1Y3JA 1GX6A 4ZPVR 3KG0A 3K5MA 2HHXA 3DMJB 2FD2A 1Q86T 1E6YA 5LSLA 4JOUA 3E3XA 2ZOFA 1NK5A 3NRBA 2OPPB 1IN0A 4OZLA 5KFFA 2ZH6A 4DQIA 1S9GA 5B0EA 2R7RA 1Q8IA 3GMGA 2OAUA 3FDSA 4G1QA 2CYYA 2P6TA 4Y2IA 2HGNA 4ALZA 3K2YA 2W8KA 1N8RT 2FLLA 7FD1A 2D9PA 4F3MA 3FSXA 3POTB 2NPFA 3V2UC 3DLLQ 4DUYF 1HYSA 2VV5A 5KG1A 3Q8QB 5KG6A 5C5JA 4RNNA 3DM2A 1Q78A 4GC7A 1QAIA 4QIGA 3RRHA 1D0EA 2JFDA 1HBOA 2V4JB 1HD1A 1Z2LA 2G9OA 2NS1B 5KFEA 4F26A 2DNNA 5A8WA 1LFPA 3J81Y 4F02A 3CC7S 4DR3F 4XIUA 2RF2B 2ZUGA 1KOHA 2LDIA 2G0CA 5K9FA 4RW7B 3TNVA 2XULA 1SV5B 3SSRA 1IKXB 2E5JA 4OHZA 1N0UA 1A9NB 3V6DA 1RT5A 2VFUA 2DB1A 4B9LA 1I94F 2AX1A 2VPWB 2GMLA 3MM6A 2JFKA 3J7YU 1Y00A 3ENWA 2OPQB 4C98A 3O5TB 4PG8A 4ILRA 4YUDA 3PR4A 2EW9A 1RTJA 3MEEA 3V4IB 5B0DA 2JLFA 2YWFA 2OFHX 4KQZA 1XC9A 4GMKA 4PXDA 3JSRA 1PC4A 3PFOA 4N41A 4F3QA 1M5VC 3H5SA 3OV7A 4ELTA 4MIWA 1S9EB 2B3TB 5B0BA 4I68A 4NYZA 3PX0A 1ZM3A 2F4VF 3UI3A 3OTEA 4IG3B 2AW0A 4J37A 1U1PA 2FVRA 4X4SA 4K4UA 5I42A 1LWEA 1B0PA 4HLBA 4ZVEA 3CJ5A 3QJJA 3C6TA 1WF1A 2XSJB 5AE3A 2NR0A 2FJAB 2FUG9 3MI7X 4WF9Q 1XMQF 3D1OA 2CPJA 1QUVA 1TFWA 2V8HA 4G6VB 1NKBA 3KK2A 4IYQA 4NPOA 1EETB 1N34F 2E66A 1HL6A 1WG1A 3FFIB 2ZJRQ 1TL3B 2QRRA 3ITHB 1SC6A 2PMHA 4TQRA 2DH7A 2FGOA 1KQKA 3BO2A 4B08A 2FJXA 3ETOA 2C3OA 1HQUA