1XNRJ

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1xnrJ00
4B3SJ 4K0KJ 4JI1J 4GKJJ 5FLXU 1XNQJ 4HHUA 5LMUJ 4LF5J 3R2CJ 5A2QU 4B3TJ 2E5LJ 5AJ3J 1IBLJ 4DV3J 4YHHJ 5IT9U 1N36J 4X65J 4JI0J 1IBMJ 1FJGJ 1N32J 1XMQJ 4LF6J 3J81U 2MQ8A 1XMOJ 4JI2J 4JI4J 1HNXJ 2MTLA 4JI5J 2F4VJ 2VQFJ 4DV6J 4NEZA 3T1YJ 4LFCJ 1N33J 5BR8J 1XNRJ 3J7AN 4JI6J 1HR0J 1HNWJ 2HHHJ 1I94J 4LFBJ 4PWWA 4DV7J 3IMQJ 4LF7J 4OX9J 3D3CJ 4JYAJ 4YY3J 2UXBJ 2VQEJ 4DR4J 4DUZJ 4DR7J 4DV0J 4DR1J 4LF4J 4B3RJ 4DR6J 3T1HJ 2KL8A 3J80U 3W1YC 3D3BJ 2UUBJ 4DV5J 4DR3J 4JI8J 2UXDJ 2UU9J 4LF9J 4DV1J 4JV5J 4DV2J 4DR2J 4JI3J 4AQYJ 4KY3A 4KYZA 4KHPJ 3OTOJ 2KVQE 4GKKJ 1HNZJ 4NEYA 4B3MJ 3R2DJ 1IBKJ 2UUAJ 2UXCJ 2UUCJ 3JAMU 2ZM6J 4DR5J 4LFAJ 4LF8J 4X62J 4JI7J 4RJVA 2MEWA 4X64J 5LMNJ 5LM7E 4V1Ak 4DUYJ 4DV4J 4X66J 5IWAJ 4NXMJ 1N34J 1J5EJ 4NXNJ
chains in the Genus database with same CATH superfamily
1P1LA 3GIRA 3NOGA 1IWAA 4WP9A 3OHAA 2VU5A 1YWXA 4UZCA 2EVZA 4Z7YA 1FDBA 2MDAA 3FBFA 1HWUA 4ELUA 3DM2A 1FESA 2ZZNA 2D3O1 3MM7A 1FRKA 3WX4A 5HMXA 2BOPA 4MKYA 3I0SB 4K4WA 1S59A 3L9ZA 1U7LA 4CLZA 2LCWA 3FSYA 3M6UA 4C8KA 4PZVA 4R8UB 2YNHA 3UO0A 2BQUA 3JS9A 3J80U 3QT6A 3TUIC 3ILOA 3GWCA 3D3BJ 2OSRA 1RCXB 4HH0A 2IFXA 2MPUA 4I4BA 5CA5A 3WX8A 4DQSA 1WHXA 1D8ZA 3GV7B 3RGIA 5KAKA 2M5YA 1O8BA 4LIRA 3IAM9 3K89A 1NZ8A 2QFJA 1HWIA 1WF0A 3BZQA 2CQGA 1TK0A 1VHFA 2F63A 2OFHX 4ZHRB 3W2VB 3J7YI 5A6WA 3MMAA 3CVKA 4GO7X 4ETZA 1RBLA 1Y11A 5J2PB 2R8HA 2Q43A 3VR1A 3GZ7A 3V6KA 5EWFA 3OQ2A 1N36J 1R6VA 3O6QA 1XMQJ 3K7RA 3MUVP 2GA7A 2J8AA 2KTQA 3KG0A 1S99A 4RBVA 5A0YA 1KC8T 1RT7A 4BWJA 4UUWA 1CJUA 1GXLA 2DNKA 2DPIA 5THWA 4LF6F 5L9XA 1HNXF 4DQRA 1OO0B 3DHXA 4ZLLA 3L95X 2UUBJ 3N28A 2HBRB 3OFFA 4F3OA 2PMZD 3I4HX 4DV2J 4LR7A 3K0JA 2E1PA 4DUZF 1U1OA 3JYTB 3NAIA 3FNNA 1HARA 1QE1B 3UDVA 3BGUA 2Q66A 2DJWA 3MMCB 5K20B 3ZZYA 1X4AA 4HH1A 3Q2TC 3QZ8A 1P9QC 4IDKA 2DR8A 5IC4B 2MY7A 4Y6IA 3ZNJ1 4LBHA 1FKAF 1RAGB 3H0PA 1FKPA 1YK9A 1YRXA 2CQ0A 2H1YA 4H4MA 4NI2A 4K0KF 1PIEA 2FZGB 2B56A 3LP2B 2OJ3A 1QLNA 4ED0A 1YI2S 3TO8A 4YR0A 2ZZTA 5B7WA 1WHVA 5HBMB 5J2MB 1IBLF 1IWGA 2OPPB 3BGRB 1FF2A 3WC2A 1S57A 4P52A 4DR7J 4DR1J 3I0RB 4M5IA 3GQCA 4P75A 2MHNA 2FLPA 3IS9A 2YWWA 3BF4A 3NXZA 1SV5A 5DQIA 3MPWA 1UVLA 4CNYA 1DRZA 2E44A 3H2VE 5CYJA 3K5NA 1CULA 1F5CA 2VUGA 2ZC4A 4XPEA 3DM2B 5KFIA 1WELA 3MM7B 1EKRA 1GQEA 2MEWA 1S0VA 3OPKA 2MB0B 3V6HA 1JMTA 4Q43A 4NLUA 3WHIA 4DPYA 4OYMA 1C1CB 2UXCF 3GTYX 3HSJA 3GV8B 2YNHB 1BQMB 2BQRA 4WKRA 1L3SA 1ZOTA 3D28A 3QGGA 2V4QA 3TA0A 4IH6A 4ANDA 5CZXA 1K1QA 2CQIA 5HQLA 2J9CA 5HLFA 3D67A 3FJ2A 3FCWA 4LSLA 2AX0A 2EXUA 2IBKA 1NBEB 4FYDA 1HBNA 2JOQA 4DV7J 2UUTA 2NUHA 2ZH5A 3D4JA 2M3DA 1UL3A 1VISA 3TX8A 3BSAA 2CQ1A 2PN6A 1X8DA 2ASLA 2HMIA 3PJWA 4AUKA 4DR2J 3FVYA 3OVSA 1RLCL 1M5SA 4OHXA 2NZCA 1SBRA 1VC6A 1VMBA 2B4PA 2CJAA 1MW7A 2V63A 3UN3A 1Q0NA 2MXYA 1RP5A 2ACYA 4L3KA 2EK6A 2HHTA 4OYBA 1Y5LB 4UOCA 1GFWB 3CO9A 1T3NA 3DDNA 3GE9A 5HJYA 5A0YB 4K4YA 1RT7B 1CJUB 4MKBA 3UVJA 1QVFR 2VV5A 3P49B 2ZBCA 3A8JA 1NKEA 1RHMB 2YX1A 1FNOA 3AFGA 1ZS6A 1RT1A 3H5SA 1DZ5A 3M30B 4P10A 4WZMA 3UCUP 4NA3A 1C0TB 1ZYQA 3VALA 4M5GA 4P73A 4KAIA 3VZIA 4C3KA 1VQ8S 1RTIA 3NNHA 4EWTA 2ZUAA 3HLUA 4R0JA 5AE2A 2HHHF 1U6ZA 4IDKB 2MJNA 1XK8A 2LA4A 2FLNA 4QIGA 3BREA 4KT0C 3NMRA 1FKPB 4MKAA 1C4CA 4H4MB 3E51A 1WKLA 3GU0A 4NI2B 3ZZ0A 3SYZA 2FJWA 5DDOC 2QN6B 4Y65A 5D78A 2CQDA 4QPXA 3LALA 1RT5A 1JLFA 2Z4PA 3RZAA 4OX8A 2BRLA 3DYAA 5H9EK 2C2KB 1FE0A 1RKJA 4S0MA 4MFBA 4DQPA 3OBIA 3V4MA 1WC6A 1RWNB 1TVRA 3VCDA 2QMWA 3MECA 1GMVA 4DUYF 2R2SA 1SV5B 3W5ZA 3TNVA 1LFWA 3EGNA 2XTJP 1CULB 3MUTP 2QT7A 2HVDA 2BKOA 3FGVA 2RAQA 4QW9A 4B9NA 2CVIA 2ZBQA 4J37A 4KTQA 4KIAA 5T41A 1OIAA 2VKRA 4ZP7A 4U7UD 5ETVA 1IQZA 3D66A 3EGVA 3PW5A 4NRUA 2Z2MA 2GHPA 5A8RA 3D6HB 1VRTA 4NLXA 4Q2LA 1NB2A 3I5CA 2AWZA 4OHYA 2VIHA 3J7ZT 2ZM6J 2ZWPA 1R89A 5EUHA 4LF8J 4ID5B 2DHAA 1IJFB 1FEHA 1A0OB 2FVSA 4LSLB 4FXDA 2K06A 2QZ8A 2YPYA 2WBRA 3HT0A 3SDEA 1XIQA 2EPIA 2X3DA 4OV6A 4J9NA 4QZVB 3ZTOA 2GHVC 1LXNA 4QR2A 2ZD1A 3R6LB 4DEZA 3LH2S 2NXNA 1YRTA 4KGVB 2KDOA 4ANCA 1VI7A 2DCUB 2XZDB 3OR1A 4DPUA 3BN4A 4NX9A 4A4JA 4JI4J 4F26A 5KFSA 2N3LA 1RYSA 2C2MB 4KSEB 1F0XA 3M32A 4UUXA 2KVIA 1NJWA 3MPUB 1PC5A 1ROFA 3C15A 1GK8A 2I8EA 2CPDA 4E2FB 1P6TA 1N0VC 2XEXA 5SZTA 4JBCA 5C7PA 1LW0A 4ZP9A 2JFKA 4J5OA 2JWNA 2CNOB 2JH3A 1BMQB 1G7CB 4A46A 1RHKB 2FJAB 2IA0A 3UVJB 1WHYA 4QYRA 3LTOA 3QATA 2M8HA 1OY9A 2C3PA 1QAIA 4ER8A 3HK2A 5LM7E 5KFHA 2I5JA 2KT5A 8AT1B 3JSMA 3CMES 1X5TA 2D41A 2DGOA 2IRXA 2R7XA 3H98A 2MZTA 2L9DA 2A2DA 2Q6CA 1RTIB 3CD0A 1UJ5A 1U09A 4NZ0A 1U24A 4P74A 1Z2LA 1BLUA 4ILMA 4DSEA 3CCWA 4WU3A 2YPZA 4CI0B 3SCKE 2JLFA 1WI6A 3IBFB 3G6VA 1X9SA 1BWEA 1FTCA 5DDPC 4LR8A 3RBZA 3Q8UA 3POTA 2MQQA 4C8MA 1KFDA 2DIVA 3RAQA 3N9UC 2RHQB 2XLJA 3MCOA 3HVAA 1RT5B 2F65A 1Q81T 4DSLA 1JLFB 1M5HA 4URSA 3MCMA 3W8PA 1Q4RA 1R7IA 3ZTQA 2O01C 3M8ZA 3OFGA 1RHQB 1CS4A 4MFBB 3QWUA 2JC0A 3OTDA 4UZBA 4YDXA 2NXUA 1NH8A 3MECB 1CC8A 5FJ4A 4P2SA 1SJFA 3Q8VA 2XS7A 1YBUA 3RAXA 2WVFA 4FYWB 4CLUA 2NCKL 2E1CA 2M70A 3CDAA 4PG5A 3GLJA 2AV5A 2AGPA 3M1VB 4EGLA 3SMZA 5IS2A 1FD2A 3ZXWA 2AJFE 5E3AA 2DGWA 4O44A 1HBMB 2J9EA 1WHWA 3JQKA 1KQGB 2NXJA 1JJ2R 3CCZA 2YKAA 4NASA 2EFPA 3M9MB 2PMWA 4LF6J 1RT4A 3KJNB 1XNQF 1HNXJ 1G6BA 5A8RB 2XGQA 1MU2A 2Q1LA 2WVDA 1SC6A 1VRTB 1D9FA 3C6TA 3H2LA 4OZJA 1R0BG 1DBDA 3H59A 4NLVA 2CPIA 1CQMA 4DUZJ 1FK9A 1KDNA 2W9BA 2IHR1 1PG5B 4YMEA 3DLLQ 1NSAA 1FRXA 5J1NA 4OI2A 2BV3A 1XMBA 1I94F 2DK2A 4UY8T 3SDEB 4FDFA 3DGPA 2ZD1B 4TVAB 1UVKA 4YQWA 1R8PA 4WIIA 1HMVA 4DV5F 1U1LA 4Q45A 2R7VA 3OR1B 1K1SA 1S48A 3VAGA 5ETLA 1RTJB 1HBOA 1AW0A 2I2YA 1UVNA 3QLHA 2PDAA 6FD1A 4K0KJ 2XM3A 2I1RA 3C15B 3D0GE 2ZBIA 4U6PA 2K1RB 4AL6A 1LW0B 3QO9A 1IBLJ 3TYTA 2LVWA 4PAAA 4IOCQ 1RT6A 3CCRS 1TL7A 1LKZA 3TEHB 1FERA 2EFGA 3AB4B 3VVUA 4WFZA 3QGPA 3AOAA 4NLSA 2GHWA 2ZWOA 4GKJF 4EZ6A 2K7KA 2B5JB 3IRWP 4ZPVR 2GQCA 4F4YA 4F36A 1TUWA 1U1QA 2QRRA 1SQEA 1D9AA 3MTJA 1JWWA 1XR5A 4CCHA 4B3OA 5HVHA 3VGUA 3CJ5A 4J9KA 4U9RA 2Y8WA 2CZ4A 2LP4A 4DX5A 4EBDA 3Q23A 2E7VA 3A3PB 3HMJG 1NJIT 5KG6A 4OX6A 3RAMA 3LGHA 2R9LA 2UXCJ 2DNLA 2C2RA 4LF9F 4XIUA 4RJVA 2BRKA 5ETTA 1U2RA 2R2RA 2DNPA 4ED5A 4KJIA 2QA4G 2R3VA 2HSEB 4JI1J 3MUMP 1LOUA 2XMMA 4A47A 3HM9A 3B82A 3A8IA 3POTB 5AXMA 1PKUA 5DM7Q 3EVWA 1NMEB 4C8NA 3EMTA 3AA8A 4DSIA 1VCTA 3TI0A 3V81A 1CS4B 1TKXA 2E29A 3IA0A 1VK3A 2YWGA 1JLGA 2VPWB 2JC1A 3NMAA 5A8WA 2UVUA 2HLTA 1K0VA 5E3PA 1FRJA 3M7VA 3LPYA 4Q7AA 1PJ7A 4CM2A 4DZ6A 3UW1A 1HD0A 4O44B 1V9OA 2UV8G 3VZHA 5B0CA 4U8VA 2G1HA 2GIRA 1JXEA 3Q0AA 3WQPA 4ZJQA 4EUVA 1MU2B 1U1PA 3P4UB 3N6LA 1IBCB 1FRHA 2ILYA 5H9FJ 1HHTP 3PXGa 3Q89A 2KHDA 3A12A 1FK9B 1GEHA 2J76E 1S97A 3G71S 2R7OA 1VR6A 1NUEA 4B3SF 2DNNA 2VFVA 3GIKA 1QAJA 4CO2A 3T9ZA 5GAEI 4L6V3 5DDRC 4C48A 4USIA 5KFZA 2FHMA 1JLCB 2OLWA 2K2PA 2HHHJ 1NJXA 3QAUA 3FUYA 4QW8A 3G8TA 3CDUA 1HBOB 4USHA 3HT3A 2J6TA 4RWXA 1S77D 4QU6A 3QLHB 3ZNUA 4JI6F 4LFBF 1F1BB 2HZCA 4K59A 5CYMA 3CCMS 3R27A 1EETB 2HIYA 4O3NA 1S0NA 2B43A 1JQGA 3E2EA 1DFDA 2DPJA 4AQYF 4ETXA 2PGCA 3KG4A 1HPZB 1SL0A 4DUYJ 3GP9A 5JVHQ 1C0UA 1Q7YT 3OVBA 2QA4S 3KLHA 3U7JA 2RUSA 4Q5VA 3MM8B 2E1MC 4DX8H 2HHXA 3NOCA 3BEGB 4G1QB 1S1XB 2HHPA 2YNIB 1HD1A 3V5RA 5KFNA 5SUHA 2IC3B 3C6UA 1H0HB 3BSCA 3PZPA 4JUZA 1N8RT 4NLGA 3WIVA 3CDBA 2OAUA 1Q79A 1SH3A 1WC1A 1VQNS 1M1HA 2XSJB 2H4WB 2R7RA 1T9VA 3KHGA 1TK5A 1KHWA 1YVFA 2NREA 3UDCA 1V6HA 2KVQE 4NWBA 1S1TA 1XBWA 2AYGA 4H54A 2HGNA 4V19J 2IMOA 2AEMA 3QRPA 4CT9A 2RU3A 3LAMA 1NPPA 3MR6A 1D1UA 2P2CB 3EE3A 1SJ3P 5KFAA 5ETQA 3V81B 4HDHA 5K8MA 2OFGX 2VB6A 2UV8A 2ALYB 2XMJA 4WWSA 4EK2A 3J7YU 5A8WB 1FDAA 1B3TA 1T11A 2VC0A 5T7LA 3Q8PB 1Q8KA 4N8OA 4A8YA 2V4JA 2PIIA 2ZH3A 4JV0A 2LYVA 3SIPB 1B99A 1S6UA 3EPGA 4FBUA 4PG6A 3LQVA 1LWFA 3MOZA 1S9FA 3GFZA 1YSJA 2OPQA 1U8SA 1AFJA 3M6XA 4OZ0A 2MQOA 2X3GA 2VA2A 3HP6A 3PRBA 1DARA 1A9NB 3CE8A 4O3QA 3MEDA 2E66A 2ZH9A 2QLBB 4OHZA 3AD8C 3H4BA 1RAFB 3I6PA 1Q16B 3ZZZA 1R31A 4C7QA 5F8GA 1U49A 2VFSA 1FJCA 3CCTA 4DWIA 3SQGA 2CJKA 3T5LA 4IRKA 3ENVA 4CLYA 2QL9B 3OJSA 4WXOA 2QEXS 2QJ3A 3EUNA 3GPAA 4MKVA 2ASJA 4QJVA 2B8PA 3HD2A 2FJXA 3MOJB 2QG9B 2JLEA 1J5OA 4RW4B 2XLIA 5BYRA 1YBTA 2RNEA 2VPYB 5HVGA 5CYMB 5GADI 2AKWB 3FC9A 4J7CA 2HVIA 4X65F 1M0SA 2C3YA 1BQXA 5KG3A 4RR5A 3D6FB 2KXHA 5J2QA 1Q7LB 2AD9A 5KG7A 2G13A 4I2QA 4M5LA 4OI1A 5HO4A 1R43A 1S6PA 4FYVB 4PUOB 1C0UB 2D9OA 1Z1ZA 2ASYA 1BWVA 4PCQA 4JYAF 3HZEA 1RWXB 3RB0A 4GC7A 2CRLA 5HQ8A 2BJ7A 1JJ4A 4AL7A 4N77A 1V3ZA 1R0AB 3MM5B 1H72C 3MTKA 2F40A 2DHGA 1QAYA 3BQ2A 5CD4A 2GS8A 1S1UB 1KQKA 1JLBA 4RBUA 1RTHB 4CO3A 2XZTB 2MSTA 3NWGA 1S0MA 5ETNA 1XNQJ 4KHRA 2HNDA 2FY8A 4C11A 1OPZA 2OHDA 3DOMA 5JUMA 4RUAA 3E3XA 4LBIA 5D0RA 5KFUA 2E5LF 4RKUC 4AFFA 3CJKB 1S1TB 1KQFB 1I94J 3OL9A 2DVIA 5KT7A 2DTJA 5HMZA 3C66A 2F4VF 4IO9Q 1RT3A 4DV5J 4LSZB 1NKCA 2CAJA 1IKWB 3TWZA 4LF7F 2FZCB 5H1SV 1RSCA 2JRSA 3K59A 2K8GA 1FI4A 3SEOA 3PEJA 3W8GA 5KFVA 5J2NA 2EBEA 2IVFB 3G4SS 1UW9A 4Y2IA 3M8WA 3PJXA 2HS0A 1SQFA 2V4JB 2WB1D 3K5PA 5DLFA 2HURA 1D9DA 1WF1A 5C42A 3MFIA 4A8WA 2I6WA 1QSLA 4GKJJ 3MWBA 3BB5A 3N5FA 1WDTA 2OD6A 5JMNA 1EZZB 5G0RA 4FYYB 3OTBA 2MTLA 5D4OA 3MEDB 4QR1A 3HPOA 4WZQA 2JSXA 4CLWA 2ROGA 2GVDA 4ED3A 1KLNA 1NH7A 1SJRA 3BBFA 2MZJA 3FMWA 3N01A 3OTEA 1R8CA 3D68A 4LF9J 3GR1A 2XYPB 2YKMA 3IC1A 3OLBA 3HSZA 2J5AA 4CO1A 3UDLA 1IXKA 3UPFA 4N5SA 3TVZA 1NU4A 1FE4A 1LWCB 2MKHA 4JI3F 1J5OB 2BM0A 1H98A 4OJ3A 4ZVEA 4CWBA 4L73A 5C2CA 2XGPA 2BQ3A 1LNQA 4KO0A 5B0AA 2P6TA 5E5NA 5DQHA 1TP7A 2LXFA 4ZJLA 2CJYB 1HWKA 3SI8A 5J2QB 4I2QB 1SKUB 1NB7A 1VOMA 3MURP 3AXMA 4U95A 5L1KA 5AJ3F 4M95A 5IV4A 2CQ2A 3MAQA 2X7IA 2Y1LB 1VRQC 2RDDA 2HHVA 1NHKL 3CCVS 3CJSA 1SCJB 2CPXA 3EVMA 2HHQA 1Q8IA 4J90A 1IR0A 2FUG9 3KUGA 3LUYA 2ZHBA 4WFYA 2CDQA 3VQSA 4B08A 3NS5A 4C11B 2FGOA 2MKYA 3DOMB 1FRIA 3LPEA 2KXNB 1P27B 2A6MA 1VLOA 1GX6A 3BJYA 1RWUA 3I96A 4B3SJ 1NO8A 1U4BA 1HHQA 2FLOA 1EHWA 4F0HA 1Q8BA 4WF9Q 2WK4A 2DR7A 2WW8A 5I42A 2IRUA 3BDPA 2Q6BA 3KK2B 1ZM9A 4A8MP 2ZE2A 1RT3B 1K9MT 2Z56B 4Q8EA 5L1LA 3CJQA 4F3QA 2BJ8A 1U1KA 2AJQA 3QT8A 2KRRA 4RW8A 2BKPA 3J7AN 3ZZRA 4JI6J 5HROA 4C6AA 4ZVHA 4LFBJ 3PY8A 1RU2A 5F0UA 4QOTA 1WORA 2UUWA 2O1PA 2XI2A 3R6GB 2HVEA 1WOSA 1Q86T 2NXEA 2U1AA 2V5HG 4ELVA 3W7BA 5C42B 1CQNA 2DNGA 4AQYJ 5HI7A 3MM9A 4C4WA 4B3RF 3OFEA 1RHRB 3CJRA 2GZOA 5G0RB 2E9TA 2ZH8A 3DLBA 4KBIA 3IFEA 1FFGB 4ECYA 4DV1F 3DLKB 1B64A 2BW2A 3OL6A 2ZDPA 1NRKA 3C16A 1WTBA 3HKZD 3AQPA 2R8KA 2YY3A 4LFAF 4MH8A 2X51A 3Q24A 4ZDNA 1UCNA 3V2UC 1F60B 3SSRA 4ZVUB 2F9DA 2BKNA 3I5AA 3ZTSA 2UZAA 3DKDA 3QJJA 2YKMB 3AD7C 5KG2A 4NLPA 2YX4A 4H4OB 3EYZA 4DV3F 1S10A 2W25A 5KFDA 4KFBA 2QSFA 3X3UA 3CJ0A 2MGZA 4UTGA 2WSFC 4X4RA 3M9NB 3Q2SC 5BJRA 2YH1A 3P8BB 2C2OB 2IM2A 5LT5A 4KO0B 4TY8A 3BKUA 3GFYA 2CKWA 1PO6A 4OZ2A 1YLXA 5HP1A 1BHNA 1VBXA 3HHEA 2DD8S 4UOFA 3UD3P 3PW0A 2W2MP 1BQNA 1BY9A 3PVXA 4RL1A 3BPDA 3IN5A 1RCOB 1NK9A 5F8JA 3MDFA 3M05A 3A8EA 3MD1A 5DZ6A 3R2CJ 3R5AA 4TYBA 4EYHB 1R8BA 1W26A 3BM7A 4J9OA 1FJEB 2HWTA 2CNNB 3VAMA 1HFEL 1YJRA 4DMZA 2AP6A 2XS2A 4LJMA 2GC8A 2R7WA 4OYPA 2B9EA 5B0BA 3NGRA 1URNA 3CC7S 5CABA 3ISZA 1NK5A 5GMKa 2I38A 3H5XA 5KG5A 3PX6A 3DXBA 1KNZA 2WAQD 3RB3A 4W90B 2OEMA 4ZP8A 5ETSA 4OX9F 3BKTA 3BV8A 1TZ0A 3OTCA 4B02A 1Q53A 2PC6A 2R2TA 3DRSB 3QT7A 1LK5A 1XERA 4ZK7M 2H5JB 4C8OA 3LO3A 2L41A 1PYOB 3IP0A 1N56A 2OO4A 5E41A 2EBGA 1B4SA 4RW8B 2R7SA 2PI5A 3K5LA 1KOOA 2HK2A 5HROB 4X62F 2NR0A 3CEDA 3M8SA 1N6QB 4KR0B 1IM4A 3BR9A 4X65J 4NXMF 2E9RX 4FS2A 1CPZA 4A8KA 2UP1A 1VC5A 3UR3C 4LRDA 2B4OA 2ADCA 3PRDA 2XY7A 3ISNC 3KLFA 3Q8QB 2V2VA 4A8QA 3MM9B 1FRLA 2A0FB 3L7UA 2QX0A 1GXUA 4JYAJ 3NNAA 2E9ZA 1UJ4A 3UNGC 3B6BA 3C16B 4MTPA 4ZIVA 4C8ZA 2GQ2A 4WPAA 3CIZA 5LL6d 3M2VA 3TJAA 4Q44A 2WTFA 5D15A 2L48A 3T1HF 1SJ4P 4M5DB 1ZETA 2DO0A 3THTA 4R5PA 1VIXA 4DR3F 1N88A 4EBCA 1PAEX 4OYOA 2G2OA 4YP3A 2MKJA 4CLKA 2G2YA 4M5JA 4IH7A 2HNZA 1XWLA 2BJDA 4J9VA 4R25A 4V1Ak 4M63A 2GGPB 2B6AA 4HL9A 4B9TA 1DQ8A 1VQMS 2JJ4D 2ROEA 4OLOA 4KFBB 4K4UA 4AT1B 2MGZB 2PE8A 3EZ5A 1S1WA 2E5LJ 2W2PP 1S6QB 3GIMA 4QWAA 1JNZB 3ETMA 2ZH1A 4TU9A 2CQCA 1MMDA 3FEZA 4ED4A 1S79A 2RB7A 3I32A 4TY8B 4JOUA 2NPFA 2F4VJ 2HBZB 5HP1B 3NCPA 1TK8A 3MXHP 4TKTA 4I7FB 2W8LA 4OYIA 3TEGA 2W4CA 4P9SA 1TKTA 4O0IA 2LDIA 1BQNB 4XDDA 3PYFA 5K14A 4LF7J 1DLOB 2H54B 3A8KA 1HIYA 3DRXA 4DL0C 4RW9A 4DJBA 3VHQA 4RU9A 2IDEA 3IAS9 4J9RA 1ZAWA 1VQ7S 2MSSA 7FD1A 1UJ6A 2HFUA 2KYZA 4EI2A 5A6PA 4F7VA 4HLBA 3FQKA 2ZNYA 4ILRA 1QJHA 3IM8A 3FEXB 4QIWD 1OQ3A 1RB0A 7FDRA 4YOEA 3OTOF 3OVAA 3V4IA 4GO5X 3GFXA 3R9LA 3N0VA 2DNYA 4O3OA 4EYIB 4DFPA 2W24A 3IBWA 3F41A 3THPA 2YWEA 2VJVA 1LK7A 3CGIA 5LJ3Y 5IC6B 4RW6B 3O44A 5KFKA 1NAQA 1EIYB 3OLAA 2ACMA 4ITSA 5GAEU 2QLXA 4Y3CA 1IKYA 2MYFA 3SBMA 4M8LA 2FHKA 4E8UA 1IBMF 5E0OA 4U7CA 2VG5A 3OFHA 5HATA 5FD1A 4MK8A 4IO1A 1TMJA 2CZVC 2VZ9A 4JI3J 2KT3A 2RUGA 3AODA 4IOAQ 3TZZA 2D7SA 3MR2A 1UAWA 4NLDA 2MQMA 3SCJE 2V8VA 1YITS 2VG6A 4USMA 5H9FK 4KHPF 3N4WA 1WG5A 4IR1A 1IQTA 2LQJA 2P6SA 4PR6A 4CTAA 2OSQA 1UWBB 2N4CA 3NGTA 1H7WA 3R5CA 5FDLA 4C0HA 4NYZA 3UR0A 2DRAA 4LBPA 5CCMA 5AJ3J 3D1OA 3B54A 2MZSA 4O3SA 2DXDA 4FKXA 4DXLA 5KG0A 2B7CB 5GMEA 1JJHA 4BDPA 1YJTA 2PSZA 1H2TZ 2FJBB 3M2VB 2GO9A 2DHSA 3CJ3A 5F3TA 4ZLJA 1NJYA 2I9SA 5LSOA 2FC8A 2HWIA 1L3UA 2KG1A 3VAJA 5AXNA 3U02A 4I6YA 3KOAA 4R8UA 3EPIA 5T14A 5JVGQ 3G86A 3QSIA 2QL5B 1H7XA 2XYHB 2BACA 1S1WB 4RNMA 2GAHC 1TUGB 2AEJA 1NLKL 2DXFA 4QIEA 2MQLA 5D6GA 4KPCA 2VICA 4RWWA 5LXYA 3TA2A 2D1CA 1WC4A 5EGYA 1N48A 3GONA 1EB0A 2V8DA 2LQBA 1M1GA 5K14B 1PJ5A 3DLGB 4ECVA 3W2VA 2Y1JA 4LR9A 4YB6A 1K44A 1OY6A 1VQSA 5M2PA 3G9CA 4RW9B 4ECUA 2J7WA 3FBCA 2AJ1A 1XMOJ 2HNYB 4EO6A 2KFYA 4IR9A 4MK7A 3G82A 3GYXB 1NDPA 5HMYA 3P96A 3HJVA 5RUBA 2YKOA 3DDKA 1Z2ZA 2WONA 4B3RJ 2FVRA 1U25A 3CJ2A 3DHWC 3W1YC 3V4IB 2W2NP 4RBTA 4G65A 5DZ7A 4KHMA 2CPHA 4DV1J 4PWUA 4PQUA 2HQGA 2BJEA 4DL6A 2V2KA 5DJBA 1MMNA 2FJDB 1IKVA 1WUUA 3JQJA 3ENQA 1FX4A 2F8MA 3JYTA 4LFAJ 2ZH6A 1FWPA 4B9SA 1SVDA 3I9ZA 2CNKB 1FDDA 3N5BA 1IKYB 3DXSX 3HHDA 2UUCF 2X1BA 5CXTA 2QFIA 2V2QA 2NSBA 2K3IA 3QRRA 3RUBL 1Q5VA 4IG0A 2BVZA 3SXLA 3N6NA 4DV3J 4YN3B 4ZMMA 4LVOP 2DY9A 1RXOB 3T5JA 4ZVTB 4AYBD 1ZM2A 1VQ4S 1VQOS 2XYGB 5IT0A 5GADU 2FVPA 3QBCA 4KRWA 4ICLA 5J2MA 3GIJA 3MAAA 3KJFB 4CLPA 4PYDA 2NS1B 4G3IA 3GJRB 2M9KA 5EWEA 2CPYA 2Q3PA 2RQKA 1CG2A 1BC6A 2C3MA 3BPSP 3KFWX 5CHCB 4YY3F 4OZNA 2YH0A 2Z8QA 2GNKA 3SCIE 4I6AA 1RAEB 3LWLA 5B0DA 1WKJA 4A8OA 2XMWA 2OTJS 4KQZA 4J9SA 5F8IA 4WE1B 2QE5A 2CA9A 4CYUA 2VL1A 4ZITA 4G1IA 2BANA 1SIZA 4RUBA 3US5A 1C1CA 3BBBA 4XPCA 1BQMA 2CQHA 1AA1B 4PXDA 4UOHA 1ZZNA 1AROP 2RILA 2RRNA 2V34A 3FZBA 4OIXA 2G4BA 2AW0A 4NLYA 4ZN1A 3ENWA 3PW2A 4M5MA 1L5UA 3OSNA 1CEZA 4QQBA 4X4UA 2JX2A 3PDNA 2D9PA 1D8YA 4O4RA 2P9GA 2V2ZA 4IQXA 4OX9J 2NUUG 4Y2MA 4IKAA 2HQ3A 1KVIA 4I64A 1ZAVA 1VJQA 2DRBA 2RMLA 9ATCB 4ES3A 2J9DE 4F4XA 1WC3A 1XNRF 2RH3A 1VFJA 4L72B 2L9NA 1HBUB 1N0UA 3HKWA 1AUDA 4NEYA 4A8XA 3CC2S 3ZTRA 2L08A 2J0WA 2FQQB 2IIHA 5KFQA 3G2XA 4LSNA 4X62J 3MMJA 4DSKA 3UI3A 4HVZA 3NCQA 5F9LA 2DHHA 2ZOFA 1S9GA 4NXMJ 6FDRA 2CQBA 2CIMA 1NDCA 3G82B 2HVZA 3UWTA 5IZHA 4HHUA 1T9TA 3GJTB 2G0CA 2WONB 2QYCA 3MFHA 4OMFG 3TAMB 1UEUA 1R8AA 2D74B 4WP8A 2DITA 4PQUB 1KS2A 3CCES 2R8IA 3PR4A 4N7TA 2ATCB 4B9MA 4U67Q 3M30A 1IKVB 3JAMY 3L3CA 4X4TA 1C0TA 2ROPA 1VQ6S 3T1HJ 4PYAA 1N54B 4DR3J 4OL8A 3CD7A 1MROA 2J7KA 3HHKA 4IUFA 4I69A 5EX3A 1HHSA 2C2ZB 1MNEA 4P72A 5DO2A 4OQJA 1AYEA 1KTQA 1F2HA 3KLIA 4KV8A 4IG0B 3RG6A 3UCZP 4CO0A 3EICA 1IJEB 4I2PA 2BX6A 1TQLA 4USVA 2DH8A 4WFXA 2OD4A 1HI0P 4DU7A 2J8SA 2UUAF 2A3JA 1QY7A 2OUGA 1HW9A 3FZ2A 4ICLB 1IR1A 3MAAB 3PV8A 3PHEA 2YBVA 4HHJA 1WOPA 2OGUA 3KLEA 4ZPDA 3BGFA 3R1LA 4MIWA 1YQHA 1X9MA 4Z2XA 2MQPA 2QLWA 1J27A 1TTHB 1SQGA 1U1RA 5D4LA 5LXRA 4F8RA 5A76A 2JEGA 4M1KA 4ZIWA 5KT6A 5BYQA 1AZSA 4CM0A 1T0TV 2BUNA 1XTZA 1UFWA 3QNWB 4L76A 3GSDA 1OSCA 1T05A 3QJLA 7AT1B 5JJBA 4CYUB 1UVMA 3D5MA 2BANB 2IRYA 3OTOJ 3M9OB 2CNLB 2JEFA 3ZZOA 2LFVA 1U02A 2B4UA 4ZS6A 3T3FA 3RR7A 2FPHX 5KG4A 2W4PA 4AE5A 4NA2A 4WKYA 4ID5A 4JI1F 4IYQA 3HFVA 1KOHA 5EWGA 2V9WA 4XAKA 2G2ZA 2QA1A 1NPRA 4K2XA 3GJQB 1WTFA 3FDSA 1ZPWX 2QL7B 3EGZA 4BCAA 1N34F 1JLAA 2O66A 1IBMJ 2HQCA 1VQ5S 2WVCA 4ZPAA 3CIMA 2EW9A 3HHLC 4B3TF 1VK8A 1N5SA 2W2QP 5IQ6A 1JLQA 1KRPA 4LSNB 2DGXA 2XI3A 2XHWA 2M2BA 5DG9A 2CWXA 3GIIA 4K4TA 3AY0A 2YQ0A 1S9GB 3MPVA 4USUA 5C25A 3FBEA 2H5EA 2L9WA 3QWPA 3QSYB 1ZTWA 1X4EA 4KHPJ 2QC3A 2POKA 2GMLA 3TAQA 4EO8A 2VF3A 4LRFA 4M5HA 4LF4F 3D6MB 1GAOA 4C2MA 2MKSA 3N79A 3ZZUA 3CCUS 5EX0A 1U48A 5MLCV 1JX4A 2XO6A 3W66A 2DISA 2IVMA 4X84A 5DGAA 3PX0A 2Y9HA 4LQ9A 4ECXA 3H90A 1UTAA 3BKFA 3OL7A 3VQTA 2BZ2A 4FNIA 1YTYA 4NCGA 3G87A 4OYZA 2EFVA 4IRDA 4UY85 2FIUA 2AZ1A 2KYXA 2HLUA 3O8WA 4ZVFA 1VBZA 2Z57B 3M6WA 3PG9A 3GB0A 3HHLA 4K5SA 2J7UA 1MROB 3X1LB 1Q5YA 2RQMA 4MT1A 3KLIB 4KV8B 4FF3A 1V5VA 3G8QA 1U2CA 3FSXA 2YX7A 3AT1B 4LRCA 2DGVA 2RD5C 4I2PB 3IWNC 1DTQA 3IR6B 2Y0SD 4KGXB 2LQ8A 5IT9Y 4XK8C 3I4PA 2BE9B 2LECA 1B7YB 2IJNA 3RRHA 1TFWA 2UU9F 5E2QA 1HQEB 3KXDA 3KLEB 1HNIB 5DRKA 2F9JA 1AT1B 3P5BP 1F9EB 4GKKF 2JFDA 3C2PA 4OHWA 4QU7A 2CPFA 4DLEA 3MM6A 2DHXA 3KLGA 5L1JA 1C2PA 5G4DA 3M1VA 2RHSB 3JXOA 1AZSB 1HI1A 1HBMA 2F8HA 1HI8A 2DCLA 1T05B 5HSPA 1V5IB 4N76A 1RHJB 1G4CA 3H42A 1MLAA 3FRYA 2GFFA 2KM8C 3SCLE 5KFCA 1HYSB 1FDNA 3BH6B 3IMQJ 3PCOB 4DFKA 2HQIA 2KJVA 3RTVA 2WVBA 4PXCA 1NHUA 2C3UA 4JI5F 3BDEA 1WKKA 3M8YA 4QYZJ 1GT8A 3TRGA 5E3CA 1FNMA 1X31C 1SKRA 2H5IB 2ZFHA 3AXKA 4WP3A 4LQ3A 3ITHB 3W62A 1ZAXA 4NRTA 4QWBA 2ZBRA 2UUCJ 1JLAB 2NLWA 5CCLA 3KHHA 3LOUA 1NXIA 3DGVA 1H74A 1RTJA 2OEKA 1JLQB 4NMXA 4FYXB 4DCPB 3DI6A 3GJSB 1QSSA 1CBKA 2K1RA 3T9NA 4DDFA 2W9AA 1OMSA 3HHNB 5C25B 1K0TA 4FVCA 2HRYA 3O3LA 1GX5A 1APSA 3DRPA 3Q8RB 4NEZA 4UW2A 2GV1A 3G6YA 2F4FA 2B5JA 3PFOA 4ECWA 2BE7D 3GCWP 4U8YA 5IT4A 1UZHA 4YY3J 4DOZA 2OH2A 2QSWA 1H3DA 4PPZA 2W8KA 1X4GA 1IM6A 5E7OB 4NCGB 3W5YA 2EI5A 4ERDA 3LGNA 3TZWA 2IDLA 1RISA 3JSYA 3W60A 3TANA 1PC4A 5L9NA 2W4DA 2CJQA 3HHLB 3DNCA 1EQMA 2NQPA 2CQ4A 2JVRA 5E3RA 2FD2A 1UEKA 1ZTTA 1M1KT 2HRTA 5KT2A 5HL7Q 2YWFA 4Y0FA 1FKOB 1YJ7A 4M94A 2CXEA 5K8OA 9RUBA 1NSKL 4ZCMA 4F25A 4WIQA 4ELTA 2B8QA 2G0JA 3DRYA 1DTQB 2Y8YA 1HQUA 2LQ9A 1FCAA 2GVZA 3KLVA 2HFVA 4C9DA 1OQ6A 2VFTA 2KXFA 2AYEA 5KFMA 3CCJS 2HW3A 2BMBA 4WFNQ 2V8HA 3EXYA 3C14A 5E3QA 3TW0A 3CD6S 1XNRJ 2IJFA 1SC3B 3PEHA 4HTJA 1X4CA 2CPEA 1N32F 2OTLS 3JQMA 4J9QA 4CO4A 5B09A 1X4FA 4ZP6A 3ETOA 3T6BA 3RW6A 1TKZA 2RE1A 3MM6B 5KOXA 3KLGB 4DV0F 1MSWD 3T1AA 3R2DJ 4ALZA 3D0HE 5KFFA 4DL7A 4K2JA 2DNMA 2ZH7A 1QVGR 3TR5A 1BXNA 1F6TA 4IFYB 2ZJRQ 1TL4A 3SFUA 1JKHA 2HS3A 3NL0A 1L3KA 5I3UA 3ET6B 2GO8A 4AXJA 4G6VB 3QYYA 4CLTA 2AX1A 3TAPA 1PAUB 2RDJA 5B0EA 4KH1B 3K17A 1RKIA 3D0IE 5K8PA 4X4PA 5DETA 2VODA 4NLWA 1I51B 2AGOA 4WYWA 2F8EX 4LF1A 4YR2A 2OI2A 4DPOA 4D3HA 3MAHA 4JI0F 2M52A 1JLCA 3W61A 1REVB 3U27A 2LXIA 1DQ9A 1HL6A 1GTHA 2C28A 3D6TB 1X4HA 4ZCKA 4LVNP 4KYZA 1UETA 3EGWB 3R5BA 3TVYA 3DI6B 2MKCA 2XY5A 1VRUA 2UUAJ 3LWMA 1C4AA 5I4MA 1VQ9S 3M2RB 1EETA 2FJEB 3L7OA 5ETMA 5DLGA 3DRPB 5J1EA 2DNRA 3GYGA 1IBKF 2HWHA 2RF2B 1HPZA 3KHRA 2AYBA 1RLDA 1LWEA 1YX2A 8ATCB 1CJTB 4CDIA 4U96A 4ZCIA 4ED2A 1Y3KA 4CLSA 2ILZA 3MCNA 5C5JA 3EZUA 2AHOB 1S12A 1PJ6A 1WSRA 1XR6A 4DS5A 3MM8A 2ZHAA 3GG0A 4B9UA 1RYRA 2GJIA 3VAIA 4G1QA 1S1XA 3BO2A 4TQSA 2BW7A 4PWWA 3ELHA 2YNIA 1YZ7A 2YQ3A 2LKZA 2IC3A 4CRJA 2Q79A 2LQ5A 4TU7A 4KB7A 5DQGA 1DTTA 1TAUA 5ETOA 1WI8A 1HR0F 2OEJA 4XTTA 2BEFA 4PG7A 3IRXB 2KZZA 4A48A 2XSJA 2M7SA 3TUZC 2MLYA 2FDNA 2W7OA 3JAMU 1HQUB 1YGYA 4AL5A 2GVZB 4GVLA 2ZHOA 2O3DA 2Z58B 3IWXA 1KN6A 4K7QA 1F5AA 3LAKA 1FFWB 1N34J 3C14B 2IVYA 3RBEA 1DJ0A 1XC9A 4DR5F 2CDRB 2VDIA 5KFBA 4B3TJ 3RJMB 1TL3A 1UPPA 3ZZTA 3OV7A 1KQSR 4USJC 2Z30B 3R8YA 2NZ4A 1TKZB 1IUJA 5IM0A 4LUBA 3O5TB 2VPZB 4DS4A 1Y9OA 3IGNA 2YNGA 1E6VA 2D3UA 3BQ1A 2Z0GA 3NGUA 3BGOP 3R97A 2ATLA 2QMXA 2QGFB 4LF4J 2XNRA 2AJ0A 1NK0A 3C8YA 3PJ9A 2ABYA 4KGZB 2W2OP 1NM2A 2EWHA 5E33A 1JKHB 4N8NA 3OR2B 4NPOA 4IH5A 2FY1A 5I3UB 5HANA 1FTRA 1R8HA 2HS4A 4ZVRB 1Y00A 3BH7B 1FXRA 2KJWA 1ZBTA 3ZO7A 4RNNA 2CPJA 3M8RA 3SV3A 2VBZA 4URQU 3LANA 3LP0B 4LRAA 3JTPA 1JLEA 2EKYA 2J0XA 3M8QA 1S4FA 3MEGB 3TARA 3T6JA 2BOAA 3IG1A 3CDWA 5CAAA 4RZRA 1EAYC 1G1XA 4USTA 4WTOB 2DNHA 1XJWB 3NEKA 3FSIA 4RW4A 4RO0A 1VQYA 3CF5Q 1VRUB 4FF4A 4W92B 5IOLA 1PBAA 4DX7A 5I3PA 1SI9A 4WXWA 2EK1A 3E01A 4J9UE 2IYIA 2P8IA 4EBEA 4QPTA 2WRMA 3T1YF 4LFCF 3QIDA 4CP5A 5J1EB 2UU9J 4LRBA 2OPRA 4ZVSB 3DN9A 4PUOA 2ZDOA 1X0FA 4UQGA 4NCAA 2AMCB 1LWEB 4NLTA 1V3RA 4GKKJ 4WBFA 3K8WA 2ASDA 1RA7A 4DPWA 2DNQA 4JV5F 2R7UA 1KLMA 1R0AA 3MM5A 3M8PA 4ZCLA 5AE3A 4OLPA 2OIHA 1D0EA 1S1UA 5B0FA 4Q2MA 1MN7A 3A1YG 1RTHA 1ZA1B 4LREA 4JI7F 4DFMA 3PIOQ 4P2FA 1RWWB 3AH6A 2A1BA 5I3QA 4C8LA 1WG4A 4E0DA 1NNDA 1DTTB 4OJHA 3GMGA 1NJZA 2HGMA 1TR0A 4LF5F 4JI5J 3WZ0A 4ECTA 2QTWA 3VV2B 4PWDB 3RBDA 3FBBA 4MJKA 4YR3A 3CJKA 1Q78A 3FK4A 3HVWA 5D0GA 4DQIA 4ED6A 1PCAA 3C19A 1Y0HA 3B8HA 3BR8A 5M2RA 1XQIA 3W9JA 2FHJA 1T94A 1IKWA 1MWZA 1FA0A 1TL3B 3KJVB 2D3ZA 3QIPA 3S1TA 3QZ7A 1TFYA 1FT8A 4BLGA 3FMBA 1SIWB 3QMQA 5IM0B 1RWPB 3ILIA 1UA1A 5IT9U 1YJNS 5J1PA 2YNGB 3MR3A 1E6VB 3QAEA 3I87A 4CH0S 3MEKA 3RRKA 2GIFA 2GW8A 2KU7A 2VASA 2ZNZA 4YB7A 2N3OA 2B7BB 2VONA 2C42A 2MQ8A 1O51A 1YRUA 3T5KA 2RRAA 2ZVIA 1X9WA 2F7VA 4BS2A 3GR0A 1NK8A 2X1AA 4OJ1A 1YBAA 3HVTA 1UVJA 2AEFA 1KKHA 3T5HA 1T9UA 2WW4A 1NK4A 2K3KA 1UA0A 4CLLA 4HI2A 3RRGA 3ONQA 1YZ6A 1JLEB 3M8QB 5FLXY 3CDEA 1N4LA 3IG1B 3KYLA 3PACA 5D4NA 3LF0A 3RBXA 5HAOA 4ZVQB 5K9FA 1IN0A 3MMAB 3UN5A 1LWCA 5IWAJ 2GMHA 4ZKAA 4H4KC 5D77A 3VWSA 3AB2B 4F0KA 3E01B 4ZPBA 2MHEA 2WZ1A 3O2IA 2PA3A 3SZ2A 4TLRA 3K2YA 1HQ2A 1UP1A 1N32J 1U47A 2OPRB 1O0PA 4FPIA 4AXIA 5GAGI 3ICLA 2C2NA 3PM9A 4DV0J 1KLMB 2RVJA 4JV1A 2VDHA 3TOQA 3M8PB 4YB1P 3V6DA 4ZJOA 1VC0A 4CQ1A 3HSDA 2B4VA 4F3MA 3T19A 4KY3A 2LEPA 4B9LA 1PGZA 2EEYA 4JI8F 2HQFA 4GC6A 4ID8A 3I55S 1VQKS 2CJBA 4H4KA 3UNYA 4DQQA 1Z4UA 2L3MA 2BM1A 4ES1A 3HFZB 2XQCA 4K4VA 1RWMB 4DN9A 2XCAA 3G96A 2KO1A 2EKNA 2VFUA 1X5PA 4P71A 1QDUB 3BO3A 2R7TA 1EQ0A 1R27B 2E5IA 4P6QA 4JI0J 2XS5A 2VHGA 3KTQA 3KK2A 1FO1A 4DL4A 2I0XA 4AD6A 3QT5A 1EP4A 1EARA 4WU2A 3KMSA 2IBOA 3HHLD 4CLFA 1FJGF 3IS9B 5D8HB 3QIPB 4ZLPA 3W64A 2QV6A 1RBAA 3PNIA 1ACMB 6AT1B 4CH1A 2OKQA 2RS2A 4PABA 2XULA 2QLFB 4TU8A 3DFEA 4Y2AA 2B9WA 2WOMA 2HBQB 1KVKA 4J9PA 3CTRA 3I56S 4OHVA 2AU0A 4UOGA 2HBYB 1IBKJ 2DY1A 2V0NA 2DT9A 4ZVOB 4A8FA 1U6BA 2Z2ZA 2LXUA 3VGTA 2VD3A 3KDOA 3B4MA 3DLKA 4WK1A 1K47A 1DQAA 5M2UA 3HVTB 5HQMA 1EX8A 5DGBA 3A4TA 2XZWA 2AF6A 1CJKA 5HLFB 1HWLA 3F73A 4NLRA 4DBQA 1R6YA 5D4PA 2AJ4A 5C24A 4ED7A 1HBNB 4HKQA 3SFGA 2V4RA 1HR0J 3MHYA 1VYAA 1NCLA 1WEXA 4ANEA 3MPYA 2DEIA 1VBYA 4I68A 1FX2A 4H4OA 1T7PA 5F8HA 2HMIB 5IV3A 2J0SD 1GNKA 2CJXB 3ADAC 3NS6A 4ZVGA 4G1PA 4UF4A 3H7HB 4OZ1A 4C3MA 5EN1A 3QGHA 3WDOA 1XR7A 1F9HA 1NK7A 4KPYA 3R3TA 4K5RA 3VTIA 1F3VA 2VFRA 2ZZMA 4DR5J 2GCFA 5EHHA 1QSYA 3MF5A 2AJ2A 3TA1A 1WNEA 2M0GB 2MKKA 3Q83A 1L3TA 1W25A 3AOCA 4U7UK 1U1NA 1HWJA 4RU2A 5AE1A 2X1FA 4I0WA 1FNXH 1RT1B 2NSCA 4FXVA 4PXEA 2CYYA 3V6DB 2C2DA 1B7FA 5CH7B 4MYUA 4RUHA 1OS5A 2VBYA 1Q82T 5KFLA 3UN2A 2KFZA 3DU5A 5ETPA 3AD9C 1YG0A 2HHUA 3IO1A 3D1QA 4WTYA 1T3OA 1VQLS 2KRBA 5IFMA 2JEIA 3W3SA 1P1TA 5DM6Q 5HJXA 2DGSA 4XDCA 3Q8YA 1Q8LA 4X4QA 5HMWA 1JNRB 3FRZA 3FCHA 3UCGA 5CQGA 2J6SA 2PT0A 2VA3A 2FTRA 2FYXA 3DRSA 3DYAB 3PKYA 1T8EA 1MWYA 1WEYA 1EP4B 4N47A 1KSPA 2PI4A 1TVRB 3NBPA 4PRFA 2V8PA 4RNHA 3CSKA 2BJ1A 5KFWA 4J91A 4OX7A 3JTNA 1VGYA 1LQ9A 1M90T 3EWGA 1QD1A 2WSCC 1JIHA 1CSJA 5KFPA 3VF0B 3KNGA 1P8GA 2DEJA 1XMOF 1N6QA 4OI0A 2KFNA 2HHSA 3UD4P 1GTEA 2WOMB 5KT5A 2R8JA 1SL1A 3T1YJ 4LFCJ 1S7IA 2MMYA 4OZ3A 3BO4A 4QYZK 2DH7A 2U2FA 2DNOA 2BABA 3PTWA 3RYLA 1AB8A 3GV5B 4MMOA 4JV5J 3H5YA 3BYPA 2COLA 3WIUA 2HZVA 3GCXP 1CJKB 4RX6A 2R4FA 1WC5A 2D3OR 1KBRA 4JI7J 1OYDA 4M5DA 4BBYA 2JDJA 5DDQC 2LU2A 5C24B 5GAHI 2EFQA 1L3VA 2FC9A 2HFSA 2ZJPQ 2GGPA 2AT1B 5DG7A 4M5KA 4LF5J 5L39A 3DOLA 3R5GA 3MI7X 2JVOA 4X64F 4Q0BA 4TNOA 4ED8A 4NL5A 1N52B 1Y10A 2HG4A 1S6QA 1RAAB 1REGX 3M32B 2AYMA 1SH2A 1FJ7A 3K5MA 5LMUF 2LMIA 3TVKA 5IQQA 1GH8A 3DMJA 1WWHA 3AJ2A 4OI6A 3CD5A 2VH7A 1U0SA 4O3PA 4P7TA 5ITHA 4I7FA 1SKWA 1UFKA 1FVQA 4ILLA 3DLEA 4Q8FA 5C2GA 1DLOA 1NHVA 3QQCD 4WK3A 3GYNA 3DCAA 3HULA 3M2UA 1KEKA 3P5TL 5A2QY 2J0QD 4MAKA 3GSIA 2IM0A 1OJ4A 4K4ZA 2I5JB 3KK1A 1VJWA 1WSVA 2EC2A 3JSMB 2ZEJA 1RWKB 1HNZF 4E98A 2Y1IA 1GMWA 3LA0A 2R7QA 4OYXA 3NNCA 4IG3A 2MY8A 5KTQA 4OFZA 2AZ3A 4ENOA 3KJQB 3SV4A 4F04B 3T41A 2IAJA 4HT5A 1TELA 4USKA 2IY5B 3OSPA 2MKIA 2DBBA 2DRDA 3JSBA 5L8RC 4DL3A 3W5XA 4TYAA 2A6OA 1YDLA 2EG1A 1JXVA 4RW6A 4YEAA 3MPDA 1P9YA 2CPZA 2M88A 3R5JB 2XWXA 2CWKA 3D3CJ 2YWHA 2IM3A 2LLZA 3CW2C 4FN5A 4DSJA 3AHPA 3DLJA 3ENAA 2XO7A 4P2XA 3TUJC 3CPWR 2ZH4A 2HGLA 3NBPB 4EEYA 2ZKUA 1RABB 1MMLA 4CIOA 4DF8A 5AXLA 4DR6F 1LW2A 3HD1A 5F0WA 1F2GA 2HFNA 3IM9A 3HCXA 1X5SA 3MEEA 1RAIB 1FWLA 2XB2D 2MLZA 4LIWA 1NPKA 4QIVA 4KGKA 2GJ2A 2NXCA 5F41A 5DG8A 1SL2A 1RJJA 2ZBPA 1UWBA 3RB4A 1RT4B 2IJRA 2RQCA 3TQEA 1TV6A 1SB6A 1RUSA 3NG8A 2PEHA 1H2VZ 1WF2A 1XN9A 2DGTA 1U8WA 5KFEA 4CNZA 2C2EA 3C6TB 1O5JA 2XLKA 4I56A 1DAXA 2GIQA 4DL2A 2OELA 3BQ0A 2W9BB 3L09A 2N82B 4OV1A 4JI2F 4I1TA 3D1HA 2XG8A 1X4DA 4JI8J 5L38A 3DGPB 4DU8A 1CLFA 1HNWF 4NLQA 1KR4A 3L7PA 2V9KA 1HMVB 2VKZG 4FP9A 1WD6A 3LGMA 3DOLB 5EDWA 2XC9A 4Q0BB 3GILA 3R7SB 2HFZA 3DOKA 4ZOSA 1FVSA 2C3OA 3NCRA 1MG7A 3EVOA 2YQ1A 2BJ9A 3DMJB 3PO5A 4ES2A 3S6EA 3ZTPA 5B0GA 3NGSA 3QO9B 5FLXU 4BC7A 1RT6B 2Y3YA 1TL7B 2B3TB 4Y2KA 1T9WA 4P2MA 3DRRA 1VDHA 2XY6A 3DLEB 1MWQA 2ZKTA 3HO1A 4DPXA 1KHVA 2DIUA 3DLGA 2XNQA 1FJGJ 2PD1A 3UD5A 1HA1A 1Y5IB 3M2UB 3H4DA 4FF1A 2C22A 5KT3A 3OT9A 2MJUA 1D3WA 1M5OC 1R3NA 2HNYA 3MGJA 1ELOA 4B3OB 1JK9B 2RSQA 3OHBA 4DX6A 3KK1B 4O4GA 1DY3A 5HK4A 1GMUA 2VQFF 2CQPA 4TQRA 2VG7A 4IFVA 2DXEA 2E7XA 2RS8A 1FD8A 4IG3B 4EZ9A 2BA9A 3CUNA 2VQEF 2H48B 3KUEA 1T9YA 4ZA1A 1FXDA 5D0EA 2IAJB 3KKFA 5F8LA 2RDIA 3JSRA 4F4WA 3WBZA 1WG1A 2N4DA 2GAGC 2HEKA 4WFAQ 4LF2A 4XO0A 4J9LA 3BSOA 4CZCA 4JV2A 1OWXA 2BXJA 2LEBA 3BS9A 2EG2A 4NYOA 4M5NA 4R0EA 4HTIA 4C3LA 1TKXB 1SUQA 1JLGB 3LP1A 4FF2A 1OYEA 1W7WA 4YHHF 3ZC4A 1LW2B 3PFEA 5L1IA 1OSDA 1RGVA 3QFHA 3VGSA 2VOPA 4ED1A 1RHUB 1VIOA 3H2UB 4EMDA 2QA2A 2WB4A 3MEEB 1S1VA 3I9V9 5ETRA 3RB6A 5U47A 5CYQA 4ECZA 3CWJA 1M5PC 1T9XA 1V3SA 2PEBA 4QR0A 1TV6B 2UXDF 2QMUB 2WHOA 3JB9k 3RR8A 4X4VA 3OD2A 1ZPVA 3OXGA 2CJ9A 4DG1A 2FHJD 1F3FA 4B3MF 4FZVA 2Y1RI 2RKIA 5HN0A 1H6KX 4WE1A 2YTCA 2B9XA 2W01A 1AFIA 3CNQP 3VAFA 4NOHA 1XEZA 3U1MA 1QTMA 3S7RA 1RQ0A 3CJ4A 4DHVA 1KTVA 2MQNA 1LV5A 2WSEC 1QUVA 1J2VA 3Q22A 3HX9A 3DOKB 1O6XA 1C1BA 1RTZA 2ERRA 4QBUA 4URGA 2XBPA 1YKWA 4F2SA 2M8DB 2E1AA 4DFJA 4NYPA 2CFXA 3PR5B 4F4ZA 3Q86A 3H20A 3GFHA 4L74A 2WCXA 4X4NA 5BR8F 2HAIA 1S5ZA 3NGDA 2C1EB 4FS1A 4NZ6A 4ZPTR 3W63A 3DRRB 2H4YB 1SPBP 1HBUA 2CG4A 3KDNA 1NKBA 3IWLA 4MIAA 4DCJB 3JTOA 2EC0A 3L4BC 3KLHB 2HK3A 3EZOA 1A6LA 4LT6A 1NK6A 1QTNB 3HSGA 5ADZA 2VPXB 1OPIA 4MIBA 3TJ9A 2JNJA 1WACA 4F2RA 2RU9A 1UEVA 2HKEA 2VC1A 3DLHA 2EFOA 4O4GB 2V94A 5KFYA 1S4EA 2AIRB 2YKQA 1WOOA 2DGUA 3BBCA 4Z7CA 2KZMA 2VG7B 4IFVB 1KVJA 4TLQA 1Y3JA 3D54A 3OXLA 3PW4A 4ZPWR 3C6UB 3EX7B 3TAMA 3K58A 2BR0A 2EFNA 3PIPQ 2W1BA 2IMWP 3A3NB 3AOBA 2OPSA 2R42A 4DV6F 2P9CA 1BD6A 3K5OA 4PPDA 4NZ7A 2D69A 1H38A 3PYDA 2PMHA 2E5GA 1HW8A 3J81j 1TU0B 1HNVA 4HR2A 4C0OC 3J81Y 4X64J 4KKOA 3V6JA 1SUQB 3C46A 3LP1B 3G6ES 3QPIA 3H40A 4JP8A 4WCEQ 3H5UA 5LMUJ 4X4SA 1QM9A 5LMNF 2KI2A 5T7LB 1UKUA 2HAFA 1S1VB 1LEOA 2ZOMA 1TKDA 3ULHA 5CYQB 2CZ9A 1SC1B 1LWFB 1N5VA 3IXQA 2HFOA 1RWVB 1U1MA 2OPQB 2BDPA 2UVVA 4IQMA 2G1DA 5GAGU 1UVIA 1RAHB 3F0NA 4DG1B 2RKIB 1RA6A 4RPFA 2DO4A 3PHTA 3R5DA 4WJBA 2YXLA 1HNZJ 2RIJA 4RW7A 4TY9A 1PILA 4ZLNA 4X2BA 1FRMA 3KWMA 2YVSA 4NE9C 2XMUA 3BYRA 3GG1A 3SQGB 2P5VA 5MAOA 1N5YA 1Q1KA 3THVA 2VOOA 3CJ8A 1QUPA 1C1BB 2JEJA 4X4OA 1JB0C 2RT3A 3PYEA 1KWMA 1KD1T 4NXNF 2KH9A 3S01A 2V50A 1SXLA 2GMJA 2DR6A 4HDGA 3G6XA 5GVQA 1UFLA 3MMBA 5AT1B 1S6OA 5LJ5Y 1S6PB 2W7AA 1EJ7L 1NDLA 1X7VA 4DLGA 2UVWA 4DR6J 3MCSA 1IVZA 1TL1A 3ZZPA 3KK3A 4ZVPB 1M5VC 2XCPA 4QCLA 1ZZFA 3HFKA 2ZJQQ 1SKSA 1RTDA 3NGKA 2UXBF 1UZDA 3OW2R 2OMOA 5F8MA 2AQ4A 1JLBB 1I5OB 2HIQA 1S9EA 1E6YA 1RWOB 1SC4B 2IM1A 3J7Z5 3W65A 3D2WA 1FXLA 3QRQA 2BE2A 3AA9A 2HNDB 5A2QU 2HYIB 4I67A 2O5DA 3PW7A 2RRBA 2OPSB 1VLYA 3TZXA 2E7WA 1B0VA 4X66F 3VAHA 1BE4A 2FJVA 4JI2J 3R1HA 3OJUA 4O23A 1JXLA 4JB8B 2H65B 3CO0P 1HNWJ 2WBMA 1YJVA 2RQ4A 1RE1B 1S0OA 1HNVB 2HQDA 4KKOB 3FFIA 1N33F 1T02A 3RW7A 3HZGA 3PX4A 2KHCA 5DS7A 2V8GA 5J2NB 2R8GA 3DDIA 4GVBA 4N56A 2G9OA 1JJCB 2QO3A 2DB1A 4QWCA 1TMMA 1ZH5A 3D9BA 3NKYA 3CT9A 1HQEA 2V6AA 1HNIA 2W9CA 1M5KC 1B0PA 4DUTA 4B9VA 4EFAC 2MLXA 2YNFA 1H73A 4GMKA 2NYIA 1KP6A 2KN4A 2W7PA 2NPIA 1YJUA 5H9EJ 3HJFA 3J80Y 4OJGA 4DV4F 3SSQA 2ADBA 3PO4A 1J5EF 3I31A 2CQ3A 1WDDA 2N7CA 2GVDB 1H2UX 2VQFJ 1NSQA 4RW7B 3CCLS 5KFTA 3CC4S 4NMLA 2DYAA 4QIFA 2XMTA 3E8OA 2VQEJ 1HYSA 2B0GA 4DPTA 1I3OB 4LMZA 3NWRA 1U6FA 1N5YB 2SXLA 1FWKA 1T95A 4Y28C 1A7GE 1RDRA 2LEAA 1YJ9S 5HVFA 2FVQA 2G0IA 3CCSS 3EJMA 3HI9A 3KG1A 1U0HA 2DR5A 5FIIA 1CJVA 4DR4F 1RU1A 3F56A 3VVTA 3QGIA 3EDRB 3ITHA 1IKXA 1UWAA 5JXSA 4GRSA 3EXCX 3B4DA 2KT2A 4HEA9 2ZOGA 2HVHA 2LA6A 5D0HA 2ZC3A 1TUVA 1CC7A 3MMBB 4WYLA 3W2WA 1ULRA 1MN9A 3CULA 1WC0A 2APOA 4PKDB 1RI7A 4YHHJ 3ILJA 2GJFA 1TL1B 1RZMA 4YUDA 3KK3B 4OZ5A 3CB4A 2IPOB 8RUCA 1RTDB 2KB2A 3TUPA 4B17A 1FEEA 4W98A 3BN7A 2V68A 4FBTA 1S9EB 1E6YB 5CD4H 2JHEA 2KL8A 3KHLA 2B51A 1N5TA 3D7SB 4C98A 3S8SA 2DGQA 3AAWB 3UDEA 2UXDJ 2KKHA 5LOQA 4YB5A 4EU0A 2BE2B 4CO5A 1LWXA 3FKBA 2MZ1A 4DZDA 1OY8A 3H25A 4ECSA 4B3MJ 2H3EB 2DR9A 4HACA 4ATNA 2HHWA 3CJTA 1S49A 1NSPA 2QLJB 1B0TA 1HKAA 1B70B 5GAHU 5I42B 4L3NA 2A2CA 3CMQA 2XMVA 2ZE2B 5KFXA 3P6YC 2YWKA 1FKOA 4FPRA 3FFIB 2VJUA 1GMWD 1RT2A 3PYGA 3NS7B 4O0NA 2Y0BB 3TJ8A 1TL5A 1W2BR 5D3GA 5BR8J 4GVBB 1N36F 2FGCA 4KE5A 1URRA 1Y7PA 1XMQF 3UFCX 1U2FA 2ZH2A 5LSLA 4C97A 2X1GA 1T03A 2W9CB 1UMJA 1PYTA 3NAHA 2IA6A 4BHQA 4DL5A 2YNFB 5K5MA 4PEOA 1Q95G 3TP2A 5K8NA 3CCQS 2UUBF 1YIJS 4NLOA 1X5OA 2PA8D 4Z37A 2HPUA 4DV2F 3N6MA 3FEYB 3OXFA 2ZVSA 4HHHA 1WEZA 2LU1A 4IFYA 4TN2A 3KNAA 4BWMA 2IYGA 2ZUGA 3ET6A 1BUXA 4F0MA 3TX0A 4YS2A 3SSSA 4QWDA 4PXBA 2CADA 4K8RA 2J9DA 4DV6J 1X4BA 1U0HB 3AJ1A 1CJVB 4D3GA 4F4AA 2P9EA 1Y5NB 4OI3A 1RK8A 1IKXB 1I1GA 3J7A1 3OUYA 3K57A 2PO4A 1VQPS 1VS3A 4CT8A 2A18A 1RAJA 5KFGA 2MZRA 2HZAA 1S76D 1SJQA 1D09B 2R2UA 3K8VA 1REVA 3W2WB 3CMAS 4C0BA 4Y00A 4DR7F 1FHTA 4DR1F 2QIFA 4F67A 1ZM4A 4PQAA 1FFSB 2FHOB 3UQSA 5LMNJ 2KG0A 1ICEB 4W4MA 2DH9A 2LDYA 5KFJA 3W9IA 3M2RA 4QWEA 3UE2A 2DKOB 4MK9A 2XWYA 2OMLA 2FLLA 2F1FA 3TZYA 1TAQA 1PSDA 2RF2A 1SH0A 1X60A 3ISND 2FVCA 4K4XA 3FQLA 2VBXA 1CJTA 4A8SA 3A13A 3OL8A 2YKNA 2PFDA 1I6JA 3Q8SB 4WFBQ 3ZFVA 4FXWA 1RBOB 4L75A 4ECRA 1U26A 4HYKA 4HACB 1G3OA 4F4KA 3MZIA 2JL9A 4FKYA 1N5QA 3M4XA 3C3LA 1RADB 3VAKA 4DV7F 4DN0A 2XMKA 3FCVA 2XMAA 1UW4A 4IRCA 1S7HA 3VGVA 3IRXA 2CUYA 4USWA 2DNZA 1AUSL 1U45A 1RT2B 2K7JA 3I82A 3B78A 2B9YA 2V69A 4DR2F 3I5BA 4MYTA 4YFUA 1LXJA 4F02A 2HRUA 5IWAF 5F8NA 2BYCA 3HXMA 1EKSA 3DU6A 4I6WA 4ZN3A 5D3GB 2RJZA 4NXNJ 3PRVA 3HDSA 1W2IA 5B08A 1PYSB 3CXCR 2NYHA 1AXQA 3BGLA 4BC9A 1NEEA 2M4MA 1T03B 4FVMA 3KLFB 5IXUA 2O67A 3J81U 3NP5A 4UQTA 2FB0A 3WC0A 5A8KA 1DURA 2UVRA 2ALZA 3R7BB 2A10A 4ECQA 3G8SA 3A3OB 2Z2YB 2UXBJ 3NLCA 4RLEA 3F44A 2JLGA 3HVRA 4CH7A 5KG1A 1ITPA 4RNFA 4OI4A 1R0CB 4K50A 4TXSA 5KOWA 3I0SA 3RU0A 4R5PB 3P3DA 1QAXA 1F9FA 4NA1A 3H8YA 2HNZB 3OR2A 3IBCB 1UPMB 5BYSA 1S72S 4PG4A 5KFRA 1ZM3A 2B6AB 4DSFA 3IR7B 4O3RA 1BGXT 3EDQB 2FZKB 4KH0B 2GQQA 4PG8A 4X66J 4OYAA 3PKMA 1Y4ZB 4FNHA 3P45B 3IR5B 4V19X 2V67A 2XSFA 3OUYB 4J9MA 3LP0A 1K8AT 2CVEA 3MEGA 2E1RA 1RACB 3KMQA 2E5JA 4KC5A 3MD3A 3ILLA 1G2EA 1TKTB 3SQOP 2JZ5A 3O1LA 1N33J 1ZA2B 4ZHRA 5CZVA 2J6UA 3NRBA 5J2PA 2H51B 4DI6A 4UT4A 4RUCA 4Y2CA 5AXKA 1NZAA 5ETKA 3IGVA 5F3ZA 5KFOA 1K73T 5BXIA 2KM8B 3LW5C 4Y34A 1NDKA 2VBWA 1YHQS 3MR5A 2BBEA 1KONA 1X0PA 1WJ9A 3R7NB 4F50A 2YKNB 1LFPA 4DV4J 2AGQA 3QFWA 1J5EJ 4ZPCA 3KUHA 4OYWA 2ZITA 4KGMA 4DCOB 5LSRA 2ZM6F 3DC2A 4LF8F 1CVJA 1DHMA 3NY0A 5KT4A 4DF4A 4OZLA 3AJDA 4P7VA 2GX8A 5L46A 1IR2A 1QE1A 4HT7A 2Z2LA 1RAOA 3MMCA 1GXTA 4K4SA 3U1LA 1PBUA 4YDDB 3M6VA 2VG5B 3EM1A 5GMDA 3HF5A 4HI1A 4NCBA 1HLWA 4PWDA 3BSNA 2WVEA 4IOBA 4DR4J 4JI4F 2OP5A 1KFSA 2YKPA 3QJPA 2H9ZA 3LP2A 3TQ1A 2CG8A 3MR7A 2PFFB 1SJ1A 2E5HA 2QYGA 5HBMA 5F9NA 2OPPA 3U1NA 1YJWS 3BGRA 1F5BA 2VG6B 2XHCA 1VHIA 3AQOA 4N41A 1VBKA 2F5GA 2N7YA 3KJVA 2MZQA 3I0RA 2F3JA 4CTAB 2BJ3A 4RNOA 5FDLB 5A8KB 3W9HA 4C8YA
chains in the Genus database with same CATH topology
4B3SJ 4K0KJ 4JI1J 4GKJJ 5FLXU 1XNQJ 4HHUA 5LMUJ 4LF5J 3R2CJ 5A2QU 4B3TJ 2E5LJ 5AJ3J 1IBLJ 4DV3J 4YHHJ 5IT9U 1N36J 4X65J 4JI0J 1IBMJ 1FJGJ 1N32J 1XMQJ 4LF6J 3J81U 2MQ8A 1XMOJ 4JI2J 4JI4J 1HNXJ 2MTLA 4JI5J 2F4VJ 2VQFJ 4DV6J 4NEZA 3T1YJ 4LFCJ 1N33J 5BR8J 1XNRJ 3J7AN 4JI6J 1HR0J 1HNWJ 2HHHJ 1I94J 4LFBJ 4PWWA 4DV7J 3IMQJ 4LF7J 4OX9J 3D3CJ 4JYAJ 4YY3J 2UXBJ 2VQEJ 4DR4J 4DUZJ 4DR7J 4DV0J 4DR1J 4LF4J 4B3RJ 4DR6J 3T1HJ 2KL8A 3J80U 3W1YC 3D3BJ 2UUBJ 4DV5J 4DR3J 4JI8J 2UXDJ 2UU9J 4LF9J 4DV1J 4JV5J 4DV2J 4DR2J 4JI3J 4AQYJ 4KY3A 4KYZA 4KHPJ 3OTOJ 2KVQE 4GKKJ 1HNZJ 4NEYA 4B3MJ 3R2DJ 1IBKJ 2UUAJ 2UXCJ 2UUCJ 3JAMU 2ZM6J 4DR5J 4LFAJ 4LF8J 4X62J 4JI7J 4RJVA 2MEWA 4X64J 5LMNJ 5LM7E 4V1Ak 4DUYJ 4DV4J 4X66J 5IWAJ 4NXMJ 1N34J 1J5EJ 4NXNJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S J;  4K0K J;  4JI1 J;  4GKJ J;  5FLX U;  1XNQ J;  4HHU A;  5LMU J;  4LF5 J;  3R2C J;  5A2Q U;  4B3T J;  2E5L J;  5AJ3 J;  1IBL J;  4DV3 J;  4YHH J;  5IT9 U;  1N36 J;  4X65 J;  4JI0 J;  1IBM J;  1FJG J;  1N32 J;  1XMQ J;  4LF6 J;  3J81 U;  2MQ8 A;  1XMO J;  4JI2 J;  4JI4 J;  1HNX J;  2MTL A;  4JI5 J;  2F4V J;  2VQF J;  4DV6 J;  4NEZ A;  3T1Y J;  4LFC J;  1N33 J;  5BR8 J;  1XNR J;  3J7A N;  4JI6 J;  1HR0 J;  1HNW J;  2HHH J;  1I94 J;  4LFB J;  4PWW A;  4DV7 J;  3IMQ J;  4LF7 J;  4OX9 J;  3D3C J;  4JYA J;  4YY3 J;  2UXB J;  2VQE J;  4DR4 J;  4DUZ J;  4DR7 J;  4DV0 J;  4DR1 J;  4LF4 J;  4B3R J;  4DR6 J;  3T1H J;  2KL8 A;  3J80 U;  3W1Y C;  3D3B J;  2UUB J;  4DV5 J;  4DR3 J;  4JI8 J;  2UXD J;  2UU9 J;  4LF9 J;  4DV1 J;  4JV5 J;  4DV2 J;  4DR2 J;  4JI3 J;  4AQY J;  4KY3 A;  4KYZ A;  4KHP J;  3OTO J;  2KVQ E;  4GKK J;  1HNZ J;  4NEY A;  4B3M J;  3R2D J;  1IBK J;  2UUA J;  2UXC J;  2UUC J;  3JAM U;  2ZM6 J;  4DR5 J;  4LFA J;  4LF8 J;  4X62 J;  4JI7 J;  4RJV A;  2MEW A;  4X64 J;  5LMN J;  5LM7 E;  4V1A k;  4DUY J;  4DV4 J;  4X66 J;  5IWA J;  4NXM J;  1N34 J;  1J5E J;  4NXN J; 
#chains in the Genus database with same CATH topology
 1P1L A;  3GIR A;  3NOG A;  1IWA A;  4WP9 A;  3OHA A;  2VU5 A;  1YWX A;  4UZC A;  2EVZ A;  4Z7Y A;  1FDB A;  2MDA A;  3FBF A;  1HWU A;  4ELU A;  3DM2 A;  1FES A;  2ZZN A;  2D3O 1;  3MM7 A;  1FRK A;  3WX4 A;  5HMX A;  2BOP A;  4MKY A;  3I0S B;  4K4W A;  1S59 A;  3L9Z A;  1U7L A;  4CLZ A;  2LCW A;  3FSY A;  3M6U A;  4C8K A;  4PZV A;  4R8U B;  2YNH A;  3UO0 A;  2BQU A;  3JS9 A;  3J80 U;  3QT6 A;  3TUI C;  3ILO A;  3GWC A;  3D3B J;  2OSR A;  1RCX B;  4HH0 A;  2IFX A;  2MPU A;  4I4B A;  5CA5 A;  3WX8 A;  4DQS A;  1WHX A;  1D8Z A;  3GV7 B;  3RGI A;  5KAK A;  2M5Y A;  1O8B A;  4LIR A;  3IAM 9;  3K89 A;  1NZ8 A;  2QFJ A;  1HWI A;  1WF0 A;  3BZQ A;  2CQG A;  1TK0 A;  1VHF A;  2F63 A;  2OFH X;  4ZHR B;  3W2V B;  3J7Y I;  5A6W A;  3MMA A;  3CVK A;  4GO7 X;  4ETZ A;  1RBL A;  1Y11 A;  5J2P B;  2R8H A;  2Q43 A;  3VR1 A;  3GZ7 A;  3V6K A;  5EWF A;  3OQ2 A;  1N36 J;  1R6V A;  3O6Q A;  1XMQ J;  3K7R A;  3MUV P;  2GA7 A;  2J8A A;  2KTQ A;  3KG0 A;  1S99 A;  4RBV A;  5A0Y A;  1KC8 T;  1RT7 A;  4BWJ A;  4UUW A;  1CJU A;  1GXL A;  2DNK A;  2DPI A;  5THW A;  4LF6 F;  5L9X A;  1HNX F;  4DQR A;  1OO0 B;  3DHX A;  4ZLL A;  3L95 X;  2UUB J;  3N28 A;  2HBR B;  3OFF A;  4F3O A;  2PMZ D;  3I4H X;  4DV2 J;  4LR7 A;  3K0J A;  2E1P A;  4DUZ F;  1U1O A;  3JYT B;  3NAI A;  3FNN A;  1HAR A;  1QE1 B;  3UDV A;  3BGU A;  2Q66 A;  2DJW A;  3MMC B;  5K20 B;  3ZZY A;  1X4A A;  4HH1 A;  3Q2T C;  3QZ8 A;  1P9Q C;  4IDK A;  2DR8 A;  5IC4 B;  2MY7 A;  4Y6I A;  3ZNJ 1;  4LBH A;  1FKA F;  1RAG B;  3H0P A;  1FKP A;  1YK9 A;  1YRX A;  2CQ0 A;  2H1Y A;  4H4M A;  4NI2 A;  4K0K F;  1PIE A;  2FZG B;  2B56 A;  3LP2 B;  2OJ3 A;  1QLN A;  4ED0 A;  1YI2 S;  3TO8 A;  4YR0 A;  2ZZT A;  5B7W A;  1WHV A;  5HBM B;  5J2M B;  1IBL F;  1IWG A;  2OPP B;  3BGR B;  1FF2 A;  3WC2 A;  1S57 A;  4P52 A;  4DR7 J;  4DR1 J;  3I0R B;  4M5I A;  3GQC A;  4P75 A;  2MHN A;  2FLP A;  3IS9 A;  2YWW A;  3BF4 A;  3NXZ A;  1SV5 A;  5DQI A;  3MPW A;  1UVL A;  4CNY A;  1DRZ A;  2E44 A;  3H2V E;  5CYJ A;  3K5N A;  1CUL A;  1F5C A;  2VUG A;  2ZC4 A;  4XPE A;  3DM2 B;  5KFI A;  1WEL A;  3MM7 B;  1EKR A;  1GQE A;  2MEW A;  1S0V A;  3OPK A;  2MB0 B;  3V6H A;  1JMT A;  4Q43 A;  4NLU A;  3WHI A;  4DPY A;  4OYM A;  1C1C B;  2UXC F;  3GTY X;  3HSJ A;  3GV8 B;  2YNH B;  1BQM B;  2BQR A;  4WKR A;  1L3S A;  1ZOT A;  3D28 A;  3QGG A;  2V4Q A;  3TA0 A;  4IH6 A;  4AND A;  5CZX A;  1K1Q A;  2CQI A;  5HQL A;  2J9C A;  5HLF A;  3D67 A;  3FJ2 A;  3FCW A;  4LSL A;  2AX0 A;  2EXU A;  2IBK A;  1NBE B;  4FYD A;  1HBN A;  2JOQ A;  4DV7 J;  2UUT A;  2NUH A;  2ZH5 A;  3D4J A;  2M3D A;  1UL3 A;  1VIS A;  3TX8 A;  3BSA A;  2CQ1 A;  2PN6 A;  1X8D A;  2ASL A;  2HMI A;  3PJW A;  4AUK A;  4DR2 J;  3FVY A;  3OVS A;  1RLC L;  1M5S A;  4OHX A;  2NZC A;  1SBR A;  1VC6 A;  1VMB A;  2B4P A;  2CJA A;  1MW7 A;  2V63 A;  3UN3 A;  1Q0N A;  2MXY A;  1RP5 A;  2ACY A;  4L3K A;  2EK6 A;  2HHT A;  4OYB A;  1Y5L B;  4UOC A;  1GFW B;  3CO9 A;  1T3N A;  3DDN A;  3GE9 A;  5HJY A;  5A0Y B;  4K4Y A;  1RT7 B;  1CJU B;  4MKB A;  3UVJ A;  1QVF R;  2VV5 A;  3P49 B;  2ZBC A;  3A8J A;  1NKE A;  1RHM B;  2YX1 A;  1FNO A;  3AFG A;  1ZS6 A;  1RT1 A;  3H5S A;  1DZ5 A;  3M30 B;  4P10 A;  4WZM A;  3UCU P;  4NA3 A;  1C0T B;  1ZYQ A;  3VAL A;  4M5G A;  4P73 A;  4KAI A;  3VZI A;  4C3K A;  1VQ8 S;  1RTI A;  3NNH A;  4EWT A;  2ZUA A;  3HLU A;  4R0J A;  5AE2 A;  2HHH F;  1U6Z A;  4IDK B;  2MJN A;  1XK8 A;  2LA4 A;  2FLN A;  4QIG A;  3BRE A;  4KT0 C;  3NMR A;  1FKP B;  4MKA A;  1C4C A;  4H4M B;  3E51 A;  1WKL A;  3GU0 A;  4NI2 B;  3ZZ0 A;  3SYZ A;  2FJW A;  5DDO C;  2QN6 B;  4Y65 A;  5D78 A;  2CQD A;  4QPX A;  3LAL A;  1RT5 A;  1JLF A;  2Z4P A;  3RZA A;  4OX8 A;  2BRL A;  3DYA A;  5H9E K;  2C2K B;  1FE0 A;  1RKJ A;  4S0M A;  4MFB A;  4DQP A;  3OBI A;  3V4M A;  1WC6 A;  1RWN B;  1TVR A;  3VCD A;  2QMW A;  3MEC A;  1GMV A;  4DUY F;  2R2S A;  1SV5 B;  3W5Z A;  3TNV A;  1LFW A;  3EGN A;  2XTJ P;  1CUL B;  3MUT P;  2QT7 A;  2HVD A;  2BKO A;  3FGV A;  2RAQ A;  4QW9 A;  4B9N A;  2CVI A;  2ZBQ A;  4J37 A;  4KTQ A;  4KIA A;  5T41 A;  1OIA A;  2VKR A;  4ZP7 A;  4U7U D;  5ETV A;  1IQZ A;  3D66 A;  3EGV A;  3PW5 A;  4NRU A;  2Z2M A;  2GHP A;  5A8R A;  3D6H B;  1VRT A;  4NLX A;  4Q2L A;  1NB2 A;  3I5C A;  2AWZ A;  4OHY A;  2VIH A;  3J7Z T;  2ZM6 J;  2ZWP A;  1R89 A;  5EUH A;  4LF8 J;  4ID5 B;  2DHA A;  1IJF B;  1FEH A;  1A0O B;  2FVS A;  4LSL B;  4FXD A;  2K06 A;  2QZ8 A;  2YPY A;  2WBR A;  3HT0 A;  3SDE A;  1XIQ A;  2EPI A;  2X3D A;  4OV6 A;  4J9N A;  4QZV B;  3ZTO A;  2GHV C;  1LXN A;  4QR2 A;  2ZD1 A;  3R6L B;  4DEZ A;  3LH2 S;  2NXN A;  1YRT A;  4KGV B;  2KDO A;  4ANC A;  1VI7 A;  2DCU B;  2XZD B;  3OR1 A;  4DPU A;  3BN4 A;  4NX9 A;  4A4J A;  4JI4 J;  4F26 A;  5KFS A;  2N3L A;  1RYS A;  2C2M B;  4KSE B;  1F0X A;  3M32 A;  4UUX A;  2KVI A;  1NJW A;  3MPU B;  1PC5 A;  1ROF A;  3C15 A;  1GK8 A;  2I8E A;  2CPD A;  4E2F B;  1P6T A;  1N0V C;  2XEX A;  5SZT A;  4JBC A;  5C7P A;  1LW0 A;  4ZP9 A;  2JFK A;  4J5O A;  2JWN A;  2CNO B;  2JH3 A;  1BMQ B;  1G7C B;  4A46 A;  1RHK B;  2FJA B;  2IA0 A;  3UVJ B;  1WHY A;  4QYR A;  3LTO A;  3QAT A;  2M8H A;  1OY9 A;  2C3P A;  1QAI A;  4ER8 A;  3HK2 A;  5LM7 E;  5KFH A;  2I5J A;  2KT5 A;  8AT1 B;  3JSM A;  3CME S;  1X5T A;  2D41 A;  2DGO A;  2IRX A;  2R7X A;  3H98 A;  2MZT A;  2L9D A;  2A2D A;  2Q6C A;  1RTI B;  3CD0 A;  1UJ5 A;  1U09 A;  4NZ0 A;  1U24 A;  4P74 A;  1Z2L A;  1BLU A;  4ILM A;  4DSE A;  3CCW A;  4WU3 A;  2YPZ A;  4CI0 B;  3SCK E;  2JLF A;  1WI6 A;  3IBF B;  3G6V A;  1X9S A;  1BWE A;  1FTC A;  5DDP C;  4LR8 A;  3RBZ A;  3Q8U A;  3POT A;  2MQQ A;  4C8M A;  1KFD A;  2DIV A;  3RAQ A;  3N9U C;  2RHQ B;  2XLJ A;  3MCO A;  3HVA A;  1RT5 B;  2F65 A;  1Q81 T;  4DSL A;  1JLF B;  1M5H A;  4URS A;  3MCM A;  3W8P A;  1Q4R A;  1R7I A;  3ZTQ A;  2O01 C;  3M8Z A;  3OFG A;  1RHQ B;  1CS4 A;  4MFB B;  3QWU A;  2JC0 A;  3OTD A;  4UZB A;  4YDX A;  2NXU A;  1NH8 A;  3MEC B;  1CC8 A;  5FJ4 A;  4P2S A;  1SJF A;  3Q8V A;  2XS7 A;  1YBU A;  3RAX A;  2WVF A;  4FYW B;  4CLU A;  2NCK L;  2E1C A;  2M70 A;  3CDA A;  4PG5 A;  3GLJ A;  2AV5 A;  2AGP A;  3M1V B;  4EGL A;  3SMZ A;  5IS2 A;  1FD2 A;  3ZXW A;  2AJF E;  5E3A A;  2DGW A;  4O44 A;  1HBM B;  2J9E A;  1WHW A;  3JQK A;  1KQG B;  2NXJ A;  1JJ2 R;  3CCZ A;  2YKA A;  4NAS A;  2EFP A;  3M9M B;  2PMW A;  4LF6 J;  1RT4 A;  3KJN B;  1XNQ F;  1HNX J;  1G6B A;  5A8R B;  2XGQ A;  1MU2 A;  2Q1L A;  2WVD A;  1SC6 A;  1VRT B;  1D9F A;  3C6T A;  3H2L A;  4OZJ A;  1R0B G;  1DBD A;  3H59 A;  4NLV A;  2CPI A;  1CQM A;  4DUZ J;  1FK9 A;  1KDN A;  2W9B A;  2IHR 1;  1PG5 B;  4YME A;  3DLL Q;  1NSA A;  1FRX A;  5J1N A;  4OI2 A;  2BV3 A;  1XMB A;  1I94 F;  2DK2 A;  4UY8 T;  3SDE B;  4FDF A;  3DGP A;  2ZD1 B;  4TVA B;  1UVK A;  4YQW A;  1R8P A;  4WII A;  1HMV A;  4DV5 F;  1U1L A;  4Q45 A;  2R7V A;  3OR1 B;  1K1S A;  1S48 A;  3VAG A;  5ETL A;  1RTJ B;  1HBO A;  1AW0 A;  2I2Y A;  1UVN A;  3QLH A;  2PDA A;  6FD1 A;  4K0K J;  2XM3 A;  2I1R A;  3C15 B;  3D0G E;  2ZBI A;  4U6P A;  2K1R B;  4AL6 A;  1LW0 B;  3QO9 A;  1IBL J;  3TYT A;  2LVW A;  4PAA A;  4IOC Q;  1RT6 A;  3CCR S;  1TL7 A;  1LKZ A;  3TEH B;  1FER A;  2EFG A;  3AB4 B;  3VVU A;  4WFZ A;  3QGP A;  3AOA A;  4NLS A;  2GHW A;  2ZWO A;  4GKJ F;  4EZ6 A;  2K7K A;  2B5J B;  3IRW P;  4ZPV R;  2GQC A;  4F4Y A;  4F36 A;  1TUW A;  1U1Q A;  2QRR A;  1SQE A;  1D9A A;  3MTJ A;  1JWW A;  1XR5 A;  4CCH A;  4B3O A;  5HVH A;  3VGU A;  3CJ5 A;  4J9K A;  4U9R A;  2Y8W A;  2CZ4 A;  2LP4 A;  4DX5 A;  4EBD A;  3Q23 A;  2E7V A;  3A3P B;  3HMJ G;  1NJI T;  5KG6 A;  4OX6 A;  3RAM A;  3LGH A;  2R9L A;  2UXC J;  2DNL A;  2C2R A;  4LF9 F;  4XIU A;  4RJV A;  2BRK A;  5ETT A;  1U2R A;  2R2R A;  2DNP A;  4ED5 A;  4KJI A;  2QA4 G;  2R3V A;  2HSE B;  4JI1 J;  3MUM P;  1LOU A;  2XMM A;  4A47 A;  3HM9 A;  3B82 A;  3A8I A;  3POT B;  5AXM A;  1PKU A;  5DM7 Q;  3EVW A;  1NME B;  4C8N A;  3EMT A;  3AA8 A;  4DSI A;  1VCT A;  3TI0 A;  3V81 A;  1CS4 B;  1TKX A;  2E29 A;  3IA0 A;  1VK3 A;  2YWG A;  1JLG A;  2VPW B;  2JC1 A;  3NMA A;  5A8W A;  2UVU A;  2HLT A;  1K0V A;  5E3P A;  1FRJ A;  3M7V A;  3LPY A;  4Q7A A;  1PJ7 A;  4CM2 A;  4DZ6 A;  3UW1 A;  1HD0 A;  4O44 B;  1V9O A;  2UV8 G;  3VZH A;  5B0C A;  4U8V A;  2G1H A;  2GIR A;  1JXE A;  3Q0A A;  3WQP A;  4ZJQ A;  4EUV A;  1MU2 B;  1U1P A;  3P4U B;  3N6L A;  1IBC B;  1FRH A;  2ILY A;  5H9F J;  1HHT P;  3PXG a;  3Q89 A;  2KHD A;  3A12 A;  1FK9 B;  1GEH A;  2J76 E;  1S97 A;  3G71 S;  2R7O A;  1VR6 A;  1NUE A;  4B3S F;  2DNN A;  2VFV A;  3GIK A;  1QAJ A;  4CO2 A;  3T9Z A;  5GAE I;  4L6V 3;  5DDR C;  4C48 A;  4USI A;  5KFZ A;  2FHM A;  1JLC B;  2OLW A;  2K2P A;  2HHH J;  1NJX A;  3QAU A;  3FUY A;  4QW8 A;  3G8T A;  3CDU A;  1HBO B;  4USH A;  3HT3 A;  2J6T A;  4RWX A;  1S77 D;  4QU6 A;  3QLH B;  3ZNU A;  4JI6 F;  4LFB F;  1F1B B;  2HZC A;  4K59 A;  5CYM A;  3CCM S;  3R27 A;  1EET B;  2HIY A;  4O3N A;  1S0N A;  2B43 A;  1JQG A;  3E2E A;  1DFD A;  2DPJ A;  4AQY F;  4ETX A;  2PGC A;  3KG4 A;  1HPZ B;  1SL0 A;  4DUY J;  3GP9 A;  5JVH Q;  1C0U A;  1Q7Y T;  3OVB A;  2QA4 S;  3KLH A;  3U7J A;  2RUS A;  4Q5V A;  3MM8 B;  2E1M C;  4DX8 H;  2HHX A;  3NOC A;  3BEG B;  4G1Q B;  1S1X B;  2HHP A;  2YNI B;  1HD1 A;  3V5R A;  5KFN A;  5SUH A;  2IC3 B;  3C6U A;  1H0H B;  3BSC A;  3PZP A;  4JUZ A;  1N8R T;  4NLG A;  3WIV A;  3CDB A;  2OAU A;  1Q79 A;  1SH3 A;  1WC1 A;  1VQN S;  1M1H A;  2XSJ B;  2H4W B;  2R7R A;  1T9V A;  3KHG A;  1TK5 A;  1KHW A;  1YVF A;  2NRE A;  3UDC A;  1V6H A;  2KVQ E;  4NWB A;  1S1T A;  1XBW A;  2AYG A;  4H54 A;  2HGN A;  4V19 J;  2IMO A;  2AEM A;  3QRP A;  4CT9 A;  2RU3 A;  3LAM A;  1NPP A;  3MR6 A;  1D1U A;  2P2C B;  3EE3 A;  1SJ3 P;  5KFA A;  5ETQ A;  3V81 B;  4HDH A;  5K8M A;  2OFG X;  2VB6 A;  2UV8 A;  2ALY B;  2XMJ A;  4WWS A;  4EK2 A;  3J7Y U;  5A8W B;  1FDA A;  1B3T A;  1T11 A;  2VC0 A;  5T7L A;  3Q8P B;  1Q8K A;  4N8O A;  4A8Y A;  2V4J A;  2PII A;  2ZH3 A;  4JV0 A;  2LYV A;  3SIP B;  1B99 A;  1S6U A;  3EPG A;  4FBU A;  4PG6 A;  3LQV A;  1LWF A;  3MOZ A;  1S9F A;  3GFZ A;  1YSJ A;  2OPQ A;  1U8S A;  1AFJ A;  3M6X A;  4OZ0 A;  2MQO A;  2X3G A;  2VA2 A;  3HP6 A;  3PRB A;  1DAR A;  1A9N B;  3CE8 A;  4O3Q A;  3MED A;  2E66 A;  2ZH9 A;  2QLB B;  4OHZ A;  3AD8 C;  3H4B A;  1RAF B;  3I6P A;  1Q16 B;  3ZZZ A;  1R31 A;  4C7Q A;  5F8G A;  1U49 A;  2VFS A;  1FJC A;  3CCT A;  4DWI A;  3SQG A;  2CJK A;  3T5L A;  4IRK A;  3ENV A;  4CLY A;  2QL9 B;  3OJS A;  4WXO A;  2QEX S;  2QJ3 A;  3EUN A;  3GPA A;  4MKV A;  2ASJ A;  4QJV A;  2B8P A;  3HD2 A;  2FJX A;  3MOJ B;  2QG9 B;  2JLE A;  1J5O A;  4RW4 B;  2XLI A;  5BYR A;  1YBT A;  2RNE A;  2VPY B;  5HVG A;  5CYM B;  5GAD I;  2AKW B;  3FC9 A;  4J7C A;  2HVI A;  4X65 F;  1M0S A;  2C3Y A;  1BQX A;  5KG3 A;  4RR5 A;  3D6F B;  2KXH A;  5J2Q A;  1Q7L B;  2AD9 A;  5KG7 A;  2G13 A;  4I2Q A;  4M5L A;  4OI1 A;  5HO4 A;  1R43 A;  1S6P A;  4FYV B;  4PUO B;  1C0U B;  2D9O A;  1Z1Z A;  2ASY A;  1BWV A;  4PCQ A;  4JYA F;  3HZE A;  1RWX B;  3RB0 A;  4GC7 A;  2CRL A;  5HQ8 A;  2BJ7 A;  1JJ4 A;  4AL7 A;  4N77 A;  1V3Z A;  1R0A B;  3MM5 B;  1H72 C;  3MTK A;  2F40 A;  2DHG A;  1QAY A;  3BQ2 A;  5CD4 A;  2GS8 A;  1S1U B;  1KQK A;  1JLB A;  4RBU A;  1RTH B;  4CO3 A;  2XZT B;  2MST A;  3NWG A;  1S0M A;  5ETN A;  1XNQ J;  4KHR A;  2HND A;  2FY8 A;  4C11 A;  1OPZ A;  2OHD A;  3DOM A;  5JUM A;  4RUA A;  3E3X A;  4LBI A;  5D0R A;  5KFU A;  2E5L F;  4RKU C;  4AFF A;  3CJK B;  1S1T B;  1KQF B;  1I94 J;  3OL9 A;  2DVI A;  5KT7 A;  2DTJ A;  5HMZ A;  3C66 A;  2F4V F;  4IO9 Q;  1RT3 A;  4DV5 J;  4LSZ B;  1NKC A;  2CAJ A;  1IKW B;  3TWZ A;  4LF7 F;  2FZC B;  5H1S V;  1RSC A;  2JRS A;  3K59 A;  2K8G A;  1FI4 A;  3SEO A;  3PEJ A;  3W8G A;  5KFV A;  5J2N A;  2EBE A;  2IVF B;  3G4S S;  1UW9 A;  4Y2I A;  3M8W A;  3PJX A;  2HS0 A;  1SQF A;  2V4J B;  2WB1 D;  3K5P A;  5DLF A;  2HUR A;  1D9D A;  1WF1 A;  5C42 A;  3MFI A;  4A8W A;  2I6W A;  1QSL A;  4GKJ J;  3MWB A;  3BB5 A;  3N5F A;  1WDT A;  2OD6 A;  5JMN A;  1EZZ B;  5G0R A;  4FYY B;  3OTB A;  2MTL A;  5D4O A;  3MED B;  4QR1 A;  3HPO A;  4WZQ A;  2JSX A;  4CLW A;  2ROG A;  2GVD A;  4ED3 A;  1KLN A;  1NH7 A;  1SJR A;  3BBF A;  2MZJ A;  3FMW A;  3N01 A;  3OTE A;  1R8C A;  3D68 A;  4LF9 J;  3GR1 A;  2XYP B;  2YKM A;  3IC1 A;  3OLB A;  3HSZ A;  2J5A A;  4CO1 A;  3UDL A;  1IXK A;  3UPF A;  4N5S A;  3TVZ A;  1NU4 A;  1FE4 A;  1LWC B;  2MKH A;  4JI3 F;  1J5O B;  2BM0 A;  1H98 A;  4OJ3 A;  4ZVE A;  4CWB A;  4L73 A;  5C2C A;  2XGP A;  2BQ3 A;  1LNQ A;  4KO0 A;  5B0A A;  2P6T A;  5E5N A;  5DQH A;  1TP7 A;  2LXF A;  4ZJL A;  2CJY B;  1HWK A;  3SI8 A;  5J2Q B;  4I2Q B;  1SKU B;  1NB7 A;  1VOM A;  3MUR P;  3AXM A;  4U95 A;  5L1K A;  5AJ3 F;  4M95 A;  5IV4 A;  2CQ2 A;  3MAQ A;  2X7I A;  2Y1L B;  1VRQ C;  2RDD A;  2HHV A;  1NHK L;  3CCV S;  3CJS A;  1SCJ B;  2CPX A;  3EVM A;  2HHQ A;  1Q8I A;  4J90 A;  1IR0 A;  2FUG 9;  3KUG A;  3LUY A;  2ZHB A;  4WFY A;  2CDQ A;  3VQS A;  4B08 A;  3NS5 A;  4C11 B;  2FGO A;  2MKY A;  3DOM B;  1FRI A;  3LPE A;  2KXN B;  1P27 B;  2A6M A;  1VLO A;  1GX6 A;  3BJY A;  1RWU A;  3I96 A;  4B3S J;  1NO8 A;  1U4B A;  1HHQ A;  2FLO A;  1EHW A;  4F0H A;  1Q8B A;  4WF9 Q;  2WK4 A;  2DR7 A;  2WW8 A;  5I42 A;  2IRU A;  3BDP A;  2Q6B A;  3KK2 B;  1ZM9 A;  4A8M P;  2ZE2 A;  1RT3 B;  1K9M T;  2Z56 B;  4Q8E A;  5L1L A;  3CJQ A;  4F3Q A;  2BJ8 A;  1U1K A;  2AJQ A;  3QT8 A;  2KRR A;  4RW8 A;  2BKP A;  3J7A N;  3ZZR A;  4JI6 J;  5HRO A;  4C6A A;  4ZVH A;  4LFB J;  3PY8 A;  1RU2 A;  5F0U A;  4QOT A;  1WOR A;  2UUW A;  2O1P A;  2XI2 A;  3R6G B;  2HVE A;  1WOS A;  1Q86 T;  2NXE A;  2U1A A;  2V5H G;  4ELV A;  3W7B A;  5C42 B;  1CQN A;  2DNG A;  4AQY J;  5HI7 A;  3MM9 A;  4C4W A;  4B3R F;  3OFE A;  1RHR B;  3CJR A;  2GZO A;  5G0R B;  2E9T A;  2ZH8 A;  3DLB A;  4KBI A;  3IFE A;  1FFG B;  4ECY A;  4DV1 F;  3DLK B;  1B64 A;  2BW2 A;  3OL6 A;  2ZDP A;  1NRK A;  3C16 A;  1WTB A;  3HKZ D;  3AQP A;  2R8K A;  2YY3 A;  4LFA F;  4MH8 A;  2X51 A;  3Q24 A;  4ZDN A;  1UCN A;  3V2U C;  1F60 B;  3SSR A;  4ZVU B;  2F9D A;  2BKN A;  3I5A A;  3ZTS A;  2UZA A;  3DKD A;  3QJJ A;  2YKM B;  3AD7 C;  5KG2 A;  4NLP A;  2YX4 A;  4H4O B;  3EYZ A;  4DV3 F;  1S10 A;  2W25 A;  5KFD A;  4KFB A;  2QSF A;  3X3U A;  3CJ0 A;  2MGZ A;  4UTG A;  2WSF C;  4X4R A;  3M9N B;  3Q2S C;  5BJR A;  2YH1 A;  3P8B B;  2C2O B;  2IM2 A;  5LT5 A;  4KO0 B;  4TY8 A;  3BKU A;  3GFY A;  2CKW A;  1PO6 A;  4OZ2 A;  1YLX A;  5HP1 A;  1BHN A;  1VBX A;  3HHE A;  2DD8 S;  4UOF A;  3UD3 P;  3PW0 A;  2W2M P;  1BQN A;  1BY9 A;  3PVX A;  4RL1 A;  3BPD A;  3IN5 A;  1RCO B;  1NK9 A;  5F8J A;  3MDF A;  3M05 A;  3A8E A;  3MD1 A;  5DZ6 A;  3R2C J;  3R5A A;  4TYB A;  4EYH B;  1R8B A;  1W26 A;  3BM7 A;  4J9O A;  1FJE B;  2HWT A;  2CNN B;  3VAM A;  1HFE L;  1YJR A;  4DMZ A;  2AP6 A;  2XS2 A;  4LJM A;  2GC8 A;  2R7W A;  4OYP A;  2B9E A;  5B0B A;  3NGR A;  1URN A;  3CC7 S;  5CAB A;  3ISZ A;  1NK5 A;  5GMK a;  2I38 A;  3H5X A;  5KG5 A;  3PX6 A;  3DXB A;  1KNZ A;  2WAQ D;  3RB3 A;  4W90 B;  2OEM A;  4ZP8 A;  5ETS A;  4OX9 F;  3BKT A;  3BV8 A;  1TZ0 A;  3OTC A;  4B02 A;  1Q53 A;  2PC6 A;  2R2T A;  3DRS B;  3QT7 A;  1LK5 A;  1XER A;  4ZK7 M;  2H5J B;  4C8O A;  3LO3 A;  2L41 A;  1PYO B;  3IP0 A;  1N56 A;  2OO4 A;  5E41 A;  2EBG A;  1B4S A;  4RW8 B;  2R7S A;  2PI5 A;  3K5L A;  1KOO A;  2HK2 A;  5HRO B;  4X62 F;  2NR0 A;  3CED A;  3M8S A;  1N6Q B;  4KR0 B;  1IM4 A;  3BR9 A;  4X65 J;  4NXM F;  2E9R X;  4FS2 A;  1CPZ A;  4A8K A;  2UP1 A;  1VC5 A;  3UR3 C;  4LRD A;  2B4O A;  2ADC A;  3PRD A;  2XY7 A;  3ISN C;  3KLF A;  3Q8Q B;  2V2V A;  4A8Q A;  3MM9 B;  1FRL A;  2A0F B;  3L7U A;  2QX0 A;  1GXU A;  4JYA J;  3NNA A;  2E9Z A;  1UJ4 A;  3UNG C;  3B6B A;  3C16 B;  4MTP A;  4ZIV A;  4C8Z A;  2GQ2 A;  4WPA A;  3CIZ A;  5LL6 d;  3M2V A;  3TJA A;  4Q44 A;  2WTF A;  5D15 A;  2L48 A;  3T1H F;  1SJ4 P;  4M5D B;  1ZET A;  2DO0 A;  3THT A;  4R5P A;  1VIX A;  4DR3 F;  1N88 A;  4EBC A;  1PAE X;  4OYO A;  2G2O A;  4YP3 A;  2MKJ A;  4CLK A;  2G2Y A;  4M5J A;  4IH7 A;  2HNZ A;  1XWL A;  2BJD A;  4J9V A;  4R25 A;  4V1A k;  4M63 A;  2GGP B;  2B6A A;  4HL9 A;  4B9T A;  1DQ8 A;  1VQM S;  2JJ4 D;  2ROE A;  4OLO A;  4KFB B;  4K4U A;  4AT1 B;  2MGZ B;  2PE8 A;  3EZ5 A;  1S1W A;  2E5L J;  2W2P P;  1S6Q B;  3GIM A;  4QWA A;  1JNZ B;  3ETM A;  2ZH1 A;  4TU9 A;  2CQC A;  1MMD A;  3FEZ A;  4ED4 A;  1S79 A;  2RB7 A;  3I32 A;  4TY8 B;  4JOU A;  2NPF A;  2F4V J;  2HBZ B;  5HP1 B;  3NCP A;  1TK8 A;  3MXH P;  4TKT A;  4I7F B;  2W8L A;  4OYI A;  3TEG A;  2W4C A;  4P9S A;  1TKT A;  4O0I A;  2LDI A;  1BQN B;  4XDD A;  3PYF A;  5K14 A;  4LF7 J;  1DLO B;  2H54 B;  3A8K A;  1HIY A;  3DRX A;  4DL0 C;  4RW9 A;  4DJB A;  3VHQ A;  4RU9 A;  2IDE A;  3IAS 9;  4J9R A;  1ZAW A;  1VQ7 S;  2MSS A;  7FD1 A;  1UJ6 A;  2HFU A;  2KYZ A;  4EI2 A;  5A6P A;  4F7V A;  4HLB A;  3FQK A;  2ZNY A;  4ILR A;  1QJH A;  3IM8 A;  3FEX B;  4QIW D;  1OQ3 A;  1RB0 A;  7FDR A;  4YOE A;  3OTO F;  3OVA A;  3V4I A;  4GO5 X;  3GFX A;  3R9L A;  3N0V A;  2DNY A;  4O3O A;  4EYI B;  4DFP A;  2W24 A;  3IBW A;  3F41 A;  3THP A;  2YWE A;  2VJV A;  1LK7 A;  3CGI A;  5LJ3 Y;  5IC6 B;  4RW6 B;  3O44 A;  5KFK A;  1NAQ A;  1EIY B;  3OLA A;  2ACM A;  4ITS A;  5GAE U;  2QLX A;  4Y3C A;  1IKY A;  2MYF A;  3SBM A;  4M8L A;  2FHK A;  4E8U A;  1IBM F;  5E0O A;  4U7C A;  2VG5 A;  3OFH A;  5HAT A;  5FD1 A;  4MK8 A;  4IO1 A;  1TMJ A;  2CZV C;  2VZ9 A;  4JI3 J;  2KT3 A;  2RUG A;  3AOD A;  4IOA Q;  3TZZ A;  2D7S A;  3MR2 A;  1UAW A;  4NLD A;  2MQM A;  3SCJ E;  2V8V A;  1YIT S;  2VG6 A;  4USM A;  5H9F K;  4KHP F;  3N4W A;  1WG5 A;  4IR1 A;  1IQT A;  2LQJ A;  2P6S A;  4PR6 A;  4CTA A;  2OSQ A;  1UWB B;  2N4C A;  3NGT A;  1H7W A;  3R5C A;  5FDL A;  4C0H A;  4NYZ A;  3UR0 A;  2DRA A;  4LBP A;  5CCM A;  5AJ3 J;  3D1O A;  3B54 A;  2MZS A;  4O3S A;  2DXD A;  4FKX A;  4DXL A;  5KG0 A;  2B7C B;  5GME A;  1JJH A;  4BDP A;  1YJT A;  2PSZ A;  1H2T Z;  2FJB B;  3M2V B;  2GO9 A;  2DHS A;  3CJ3 A;  5F3T A;  4ZLJ A;  1NJY A;  2I9S A;  5LSO A;  2FC8 A;  2HWI A;  1L3U A;  2KG1 A;  3VAJ A;  5AXN A;  3U02 A;  4I6Y A;  3KOA A;  4R8U A;  3EPI A;  5T14 A;  5JVG Q;  3G86 A;  3QSI A;  2QL5 B;  1H7X A;  2XYH B;  2BAC A;  1S1W B;  4RNM A;  2GAH C;  1TUG B;  2AEJ A;  1NLK L;  2DXF A;  4QIE A;  2MQL A;  5D6G A;  4KPC A;  2VIC A;  4RWW A;  5LXY A;  3TA2 A;  2D1C A;  1WC4 A;  5EGY A;  1N48 A;  3GON A;  1EB0 A;  2V8D A;  2LQB A;  1M1G A;  5K14 B;  1PJ5 A;  3DLG B;  4ECV A;  3W2V A;  2Y1J A;  4LR9 A;  4YB6 A;  1K44 A;  1OY6 A;  1VQS A;  5M2P A;  3G9C A;  4RW9 B;  4ECU A;  2J7W A;  3FBC A;  2AJ1 A;  1XMO J;  2HNY B;  4EO6 A;  2KFY A;  4IR9 A;  4MK7 A;  3G82 A;  3GYX B;  1NDP A;  5HMY A;  3P96 A;  3HJV A;  5RUB A;  2YKO A;  3DDK A;  1Z2Z A;  2WON A;  4B3R J;  2FVR A;  1U25 A;  3CJ2 A;  3DHW C;  3W1Y C;  3V4I B;  2W2N P;  4RBT A;  4G65 A;  5DZ7 A;  4KHM A;  2CPH A;  4DV1 J;  4PWU A;  4PQU A;  2HQG A;  2BJE A;  4DL6 A;  2V2K A;  5DJB A;  1MMN A;  2FJD B;  1IKV A;  1WUU A;  3JQJ A;  3ENQ A;  1FX4 A;  2F8M A;  3JYT A;  4LFA J;  2ZH6 A;  1FWP A;  4B9S A;  1SVD A;  3I9Z A;  2CNK B;  1FDD A;  3N5B A;  1IKY B;  3DXS X;  3HHD A;  2UUC F;  2X1B A;  5CXT A;  2QFI A;  2V2Q A;  2NSB A;  2K3I A;  3QRR A;  3RUB L;  1Q5V A;  4IG0 A;  2BVZ A;  3SXL A;  3N6N A;  4DV3 J;  4YN3 B;  4ZMM A;  4LVO P;  2DY9 A;  1RXO B;  3T5J A;  4ZVT B;  4AYB D;  1ZM2 A;  1VQ4 S;  1VQO S;  2XYG B;  5IT0 A;  5GAD U;  2FVP A;  3QBC A;  4KRW A;  4ICL A;  5J2M A;  3GIJ A;  3MAA A;  3KJF B;  4CLP A;  4PYD A;  2NS1 B;  4G3I A;  3GJR B;  2M9K A;  5EWE A;  2CPY A;  2Q3P A;  2RQK A;  1CG2 A;  1BC6 A;  2C3M A;  3BPS P;  3KFW X;  5CHC B;  4YY3 F;  4OZN A;  2YH0 A;  2Z8Q A;  2GNK A;  3SCI E;  4I6A A;  1RAE B;  3LWL A;  5B0D A;  1WKJ A;  4A8O A;  2XMW A;  2OTJ S;  4KQZ A;  4J9S A;  5F8I A;  4WE1 B;  2QE5 A;  2CA9 A;  4CYU A;  2VL1 A;  4ZIT A;  4G1I A;  2BAN A;  1SIZ A;  4RUB A;  3US5 A;  1C1C A;  3BBB A;  4XPC A;  1BQM A;  2CQH A;  1AA1 B;  4PXD A;  4UOH A;  1ZZN A;  1ARO P;  2RIL A;  2RRN A;  2V34 A;  3FZB A;  4OIX A;  2G4B A;  2AW0 A;  4NLY A;  4ZN1 A;  3ENW A;  3PW2 A;  4M5M A;  1L5U A;  3OSN A;  1CEZ A;  4QQB A;  4X4U A;  2JX2 A;  3PDN A;  2D9P A;  1D8Y A;  4O4R A;  2P9G A;  2V2Z A;  4IQX A;  4OX9 J;  2NUU G;  4Y2M A;  4IKA A;  2HQ3 A;  1KVI A;  4I64 A;  1ZAV A;  1VJQ A;  2DRB A;  2RML A;  9ATC B;  4ES3 A;  2J9D E;  4F4X A;  1WC3 A;  1XNR F;  2RH3 A;  1VFJ A;  4L72 B;  2L9N A;  1HBU B;  1N0U A;  3HKW A;  1AUD A;  4NEY A;  4A8X A;  3CC2 S;  3ZTR A;  2L08 A;  2J0W A;  2FQQ B;  2IIH A;  5KFQ A;  3G2X A;  4LSN A;  4X62 J;  3MMJ A;  4DSK A;  3UI3 A;  4HVZ A;  3NCQ A;  5F9L A;  2DHH A;  2ZOF A;  1S9G A;  4NXM J;  6FDR A;  2CQB A;  2CIM A;  1NDC A;  3G82 B;  2HVZ A;  3UWT A;  5IZH A;  4HHU A;  1T9T A;  3GJT B;  2G0C A;  2WON B;  2QYC A;  3MFH A;  4OMF G;  3TAM B;  1UEU A;  1R8A A;  2D74 B;  4WP8 A;  2DIT A;  4PQU B;  1KS2 A;  3CCE S;  2R8I A;  3PR4 A;  4N7T A;  2ATC B;  4B9M A;  4U67 Q;  3M30 A;  1IKV B;  3JAM Y;  3L3C A;  4X4T A;  1C0T A;  2ROP A;  1VQ6 S;  3T1H J;  4PYA A;  1N54 B;  4DR3 J;  4OL8 A;  3CD7 A;  1MRO A;  2J7K A;  3HHK A;  4IUF A;  4I69 A;  5EX3 A;  1HHS A;  2C2Z B;  1MNE A;  4P72 A;  5DO2 A;  4OQJ A;  1AYE A;  1KTQ A;  1F2H A;  3KLI A;  4KV8 A;  4IG0 B;  3RG6 A;  3UCZ P;  4CO0 A;  3EIC A;  1IJE B;  4I2P A;  2BX6 A;  1TQL A;  4USV A;  2DH8 A;  4WFX A;  2OD4 A;  1HI0 P;  4DU7 A;  2J8S A;  2UUA F;  2A3J A;  1QY7 A;  2OUG A;  1HW9 A;  3FZ2 A;  4ICL B;  1IR1 A;  3MAA B;  3PV8 A;  3PHE A;  2YBV A;  4HHJ A;  1WOP A;  2OGU A;  3KLE A;  4ZPD A;  3BGF A;  3R1L A;  4MIW A;  1YQH A;  1X9M A;  4Z2X A;  2MQP A;  2QLW A;  1J27 A;  1TTH B;  1SQG A;  1U1R A;  5D4L A;  5LXR A;  4F8R A;  5A76 A;  2JEG A;  4M1K A;  4ZIW A;  5KT6 A;  5BYQ A;  1AZS A;  4CM0 A;  1T0T V;  2BUN A;  1XTZ A;  1UFW A;  3QNW B;  4L76 A;  3GSD A;  1OSC A;  1T05 A;  3QJL A;  7AT1 B;  5JJB A;  4CYU B;  1UVM A;  3D5M A;  2BAN B;  2IRY A;  3OTO J;  3M9O B;  2CNL B;  2JEF A;  3ZZO A;  2LFV A;  1U02 A;  2B4U A;  4ZS6 A;  3T3F A;  3RR7 A;  2FPH X;  5KG4 A;  2W4P A;  4AE5 A;  4NA2 A;  4WKY A;  4ID5 A;  4JI1 F;  4IYQ A;  3HFV A;  1KOH A;  5EWG A;  2V9W A;  4XAK A;  2G2Z A;  2QA1 A;  1NPR A;  4K2X A;  3GJQ B;  1WTF A;  3FDS A;  1ZPW X;  2QL7 B;  3EGZ A;  4BCA A;  1N34 F;  1JLA A;  2O66 A;  1IBM J;  2HQC A;  1VQ5 S;  2WVC A;  4ZPA A;  3CIM A;  2EW9 A;  3HHL C;  4B3T F;  1VK8 A;  1N5S A;  2W2Q P;  5IQ6 A;  1JLQ A;  1KRP A;  4LSN B;  2DGX A;  2XI3 A;  2XHW A;  2M2B A;  5DG9 A;  2CWX A;  3GII A;  4K4T A;  3AY0 A;  2YQ0 A;  1S9G B;  3MPV A;  4USU A;  5C25 A;  3FBE A;  2H5E A;  2L9W A;  3QWP A;  3QSY B;  1ZTW A;  1X4E A;  4KHP J;  2QC3 A;  2POK A;  2GML A;  3TAQ A;  4EO8 A;  2VF3 A;  4LRF A;  4M5H A;  4LF4 F;  3D6M B;  1GAO A;  4C2M A;  2MKS A;  3N79 A;  3ZZU A;  3CCU S;  5EX0 A;  1U48 A;  5MLC V;  1JX4 A;  2XO6 A;  3W66 A;  2DIS A;  2IVM A;  4X84 A;  5DGA A;  3PX0 A;  2Y9H A;  4LQ9 A;  4ECX A;  3H90 A;  1UTA A;  3BKF A;  3OL7 A;  3VQT A;  2BZ2 A;  4FNI A;  1YTY A;  4NCG A;  3G87 A;  4OYZ A;  2EFV A;  4IRD A;  4UY8 5;  2FIU A;  2AZ1 A;  2KYX A;  2HLU A;  3O8W A;  4ZVF A;  1VBZ A;  2Z57 B;  3M6W A;  3PG9 A;  3GB0 A;  3HHL A;  4K5S A;  2J7U A;  1MRO B;  3X1L B;  1Q5Y A;  2RQM A;  4MT1 A;  3KLI B;  4KV8 B;  4FF3 A;  1V5V A;  3G8Q A;  1U2C A;  3FSX A;  2YX7 A;  3AT1 B;  4LRC A;  2DGV A;  2RD5 C;  4I2P B;  3IWN C;  1DTQ A;  3IR6 B;  2Y0S D;  4KGX B;  2LQ8 A;  5IT9 Y;  4XK8 C;  3I4P A;  2BE9 B;  2LEC A;  1B7Y B;  2IJN A;  3RRH A;  1TFW A;  2UU9 F;  5E2Q A;  1HQE B;  3KXD A;  3KLE B;  1HNI B;  5DRK A;  2F9J A;  1AT1 B;  3P5B P;  1F9E B;  4GKK F;  2JFD A;  3C2P A;  4OHW A;  4QU7 A;  2CPF A;  4DLE A;  3MM6 A;  2DHX A;  3KLG A;  5L1J A;  1C2P A;  5G4D A;  3M1V A;  2RHS B;  3JXO A;  1AZS B;  1HI1 A;  1HBM A;  2F8H A;  1HI8 A;  2DCL A;  1T05 B;  5HSP A;  1V5I B;  4N76 A;  1RHJ B;  1G4C A;  3H42 A;  1MLA A;  3FRY A;  2GFF A;  2KM8 C;  3SCL E;  5KFC A;  1HYS B;  1FDN A;  3BH6 B;  3IMQ J;  3PCO B;  4DFK A;  2HQI A;  2KJV A;  3RTV A;  2WVB A;  4PXC A;  1NHU A;  2C3U A;  4JI5 F;  3BDE A;  1WKK A;  3M8Y A;  4QYZ J;  1GT8 A;  3TRG A;  5E3C A;  1FNM A;  1X31 C;  1SKR A;  2H5I B;  2ZFH A;  3AXK A;  4WP3 A;  4LQ3 A;  3ITH B;  3W62 A;  1ZAX A;  4NRT A;  4QWB A;  2ZBR A;  2UUC J;  1JLA B;  2NLW A;  5CCL A;  3KHH A;  3LOU A;  1NXI A;  3DGV A;  1H74 A;  1RTJ A;  2OEK A;  1JLQ B;  4NMX A;  4FYX B;  4DCP B;  3DI6 A;  3GJS B;  1QSS A;  1CBK A;  2K1R A;  3T9N A;  4DDF A;  2W9A A;  1OMS A;  3HHN B;  5C25 B;  1K0T A;  4FVC A;  2HRY A;  3O3L A;  1GX5 A;  1APS A;  3DRP A;  3Q8R B;  4NEZ A;  4UW2 A;  2GV1 A;  3G6Y A;  2F4F A;  2B5J A;  3PFO A;  4ECW A;  2BE7 D;  3GCW P;  4U8Y A;  5IT4 A;  1UZH A;  4YY3 J;  4DOZ A;  2OH2 A;  2QSW A;  1H3D A;  4PPZ A;  2W8K A;  1X4G A;  1IM6 A;  5E7O B;  4NCG B;  3W5Y A;  2EI5 A;  4ERD A;  3LGN A;  3TZW A;  2IDL A;  1RIS A;  3JSY A;  3W60 A;  3TAN A;  1PC4 A;  5L9N A;  2W4D A;  2CJQ A;  3HHL B;  3DNC A;  1EQM A;  2NQP A;  2CQ4 A;  2JVR A;  5E3R A;  2FD2 A;  1UEK A;  1ZTT A;  1M1K T;  2HRT A;  5KT2 A;  5HL7 Q;  2YWF A;  4Y0F A;  1FKO B;  1YJ7 A;  4M94 A;  2CXE A;  5K8O A;  9RUB A;  1NSK L;  4ZCM A;  4F25 A;  4WIQ A;  4ELT A;  2B8Q A;  2G0J A;  3DRY A;  1DTQ B;  2Y8Y A;  1HQU A;  2LQ9 A;  1FCA A;  2GVZ A;  3KLV A;  2HFV A;  4C9D A;  1OQ6 A;  2VFT A;  2KXF A;  2AYE A;  5KFM A;  3CCJ S;  2HW3 A;  2BMB A;  4WFN Q;  2V8H A;  3EXY A;  3C14 A;  5E3Q A;  3TW0 A;  3CD6 S;  1XNR J;  2IJF A;  1SC3 B;  3PEH A;  4HTJ A;  1X4C A;  2CPE A;  1N32 F;  2OTL S;  3JQM A;  4J9Q A;  4CO4 A;  5B09 A;  1X4F A;  4ZP6 A;  3ETO A;  3T6B A;  3RW6 A;  1TKZ A;  2RE1 A;  3MM6 B;  5KOX A;  3KLG B;  4DV0 F;  1MSW D;  3T1A A;  3R2D J;  4ALZ A;  3D0H E;  5KFF A;  4DL7 A;  4K2J A;  2DNM A;  2ZH7 A;  1QVG R;  3TR5 A;  1BXN A;  1F6T A;  4IFY B;  2ZJR Q;  1TL4 A;  3SFU A;  1JKH A;  2HS3 A;  3NL0 A;  1L3K A;  5I3U A;  3ET6 B;  2GO8 A;  4AXJ A;  4G6V B;  3QYY A;  4CLT A;  2AX1 A;  3TAP A;  1PAU B;  2RDJ A;  5B0E A;  4KH1 B;  3K17 A;  1RKI A;  3D0I E;  5K8P A;  4X4P A;  5DET A;  2VOD A;  4NLW A;  1I51 B;  2AGO A;  4WYW A;  2F8E X;  4LF1 A;  4YR2 A;  2OI2 A;  4DPO A;  4D3H A;  3MAH A;  4JI0 F;  2M52 A;  1JLC A;  3W61 A;  1REV B;  3U27 A;  2LXI A;  1DQ9 A;  1HL6 A;  1GTH A;  2C28 A;  3D6T B;  1X4H A;  4ZCK A;  4LVN P;  4KYZ A;  1UET A;  3EGW B;  3R5B A;  3TVY A;  3DI6 B;  2MKC A;  2XY5 A;  1VRU A;  2UUA J;  3LWM A;  1C4A A;  5I4M A;  1VQ9 S;  3M2R B;  1EET A;  2FJE B;  3L7O A;  5ETM A;  5DLG A;  3DRP B;  5J1E A;  2DNR A;  3GYG A;  1IBK F;  2HWH A;  2RF2 B;  1HPZ A;  3KHR A;  2AYB A;  1RLD A;  1LWE A;  1YX2 A;  8ATC B;  1CJT B;  4CDI A;  4U96 A;  4ZCI A;  4ED2 A;  1Y3K A;  4CLS A;  2ILZ A;  3MCN A;  5C5J A;  3EZU A;  2AHO B;  1S12 A;  1PJ6 A;  1WSR A;  1XR6 A;  4DS5 A;  3MM8 A;  2ZHA A;  3GG0 A;  4B9U A;  1RYR A;  2GJI A;  3VAI A;  4G1Q A;  1S1X A;  3BO2 A;  4TQS A;  2BW7 A;  4PWW A;  3ELH A;  2YNI A;  1YZ7 A;  2YQ3 A;  2LKZ A;  2IC3 A;  4CRJ A;  2Q79 A;  2LQ5 A;  4TU7 A;  4KB7 A;  5DQG A;  1DTT A;  1TAU A;  5ETO A;  1WI8 A;  1HR0 F;  2OEJ A;  4XTT A;  2BEF A;  4PG7 A;  3IRX B;  2KZZ A;  4A48 A;  2XSJ A;  2M7S A;  3TUZ C;  2MLY A;  2FDN A;  2W7O A;  3JAM U;  1HQU B;  1YGY A;  4AL5 A;  2GVZ B;  4GVL A;  2ZHO A;  2O3D A;  2Z58 B;  3IWX A;  1KN6 A;  4K7Q A;  1F5A A;  3LAK A;  1FFW B;  1N34 J;  3C14 B;  2IVY A;  3RBE A;  1DJ0 A;  1XC9 A;  4DR5 F;  2CDR B;  2VDI A;  5KFB A;  4B3T J;  3RJM B;  1TL3 A;  1UPP A;  3ZZT A;  3OV7 A;  1KQS R;  4USJ C;  2Z30 B;  3R8Y A;  2NZ4 A;  1TKZ B;  1IUJ A;  5IM0 A;  4LUB A;  3O5T B;  2VPZ B;  4DS4 A;  1Y9O A;  3IGN A;  2YNG A;  1E6V A;  2D3U A;  3BQ1 A;  2Z0G A;  3NGU A;  3BGO P;  3R97 A;  2ATL A;  2QMX A;  2QGF B;  4LF4 J;  2XNR A;  2AJ0 A;  1NK0 A;  3C8Y A;  3PJ9 A;  2ABY A;  4KGZ B;  2W2O P;  1NM2 A;  2EWH A;  5E33 A;  1JKH B;  4N8N A;  3OR2 B;  4NPO A;  4IH5 A;  2FY1 A;  5I3U B;  5HAN A;  1FTR A;  1R8H A;  2HS4 A;  4ZVR B;  1Y00 A;  3BH7 B;  1FXR A;  2KJW A;  1ZBT A;  3ZO7 A;  4RNN A;  2CPJ A;  3M8R A;  3SV3 A;  2VBZ A;  4URQ U;  3LAN A;  3LP0 B;  4LRA A;  3JTP A;  1JLE A;  2EKY A;  2J0X A;  3M8Q A;  1S4F A;  3MEG B;  3TAR A;  3T6J A;  2BOA A;  3IG1 A;  3CDW A;  5CAA A;  4RZR A;  1EAY C;  1G1X A;  4UST A;  4WTO B;  2DNH A;  1XJW B;  3NEK A;  3FSI A;  4RW4 A;  4RO0 A;  1VQY A;  3CF5 Q;  1VRU B;  4FF4 A;  4W92 B;  5IOL A;  1PBA A;  4DX7 A;  5I3P A;  1SI9 A;  4WXW A;  2EK1 A;  3E01 A;  4J9U E;  2IYI A;  2P8I A;  4EBE A;  4QPT A;  2WRM A;  3T1Y F;  4LFC F;  3QID A;  4CP5 A;  5J1E B;  2UU9 J;  4LRB A;  2OPR A;  4ZVS B;  3DN9 A;  4PUO A;  2ZDO A;  1X0F A;  4UQG A;  4NCA A;  2AMC B;  1LWE B;  4NLT A;  1V3R A;  4GKK J;  4WBF A;  3K8W A;  2ASD A;  1RA7 A;  4DPW A;  2DNQ A;  4JV5 F;  2R7U A;  1KLM A;  1R0A A;  3MM5 A;  3M8P A;  4ZCL A;  5AE3 A;  4OLP A;  2OIH A;  1D0E A;  1S1U A;  5B0F A;  4Q2M A;  1MN7 A;  3A1Y G;  1RTH A;  1ZA1 B;  4LRE A;  4JI7 F;  4DFM A;  3PIO Q;  4P2F A;  1RWW B;  3AH6 A;  2A1B A;  5I3Q A;  4C8L A;  1WG4 A;  4E0D A;  1NND A;  1DTT B;  4OJH A;  3GMG A;  1NJZ A;  2HGM A;  1TR0 A;  4LF5 F;  4JI5 J;  3WZ0 A;  4ECT A;  2QTW A;  3VV2 B;  4PWD B;  3RBD A;  3FBB A;  4MJK A;  4YR3 A;  3CJK A;  1Q78 A;  3FK4 A;  3HVW A;  5D0G A;  4DQI A;  4ED6 A;  1PCA A;  3C19 A;  1Y0H A;  3B8H A;  3BR8 A;  5M2R A;  1XQI A;  3W9J A;  2FHJ A;  1T94 A;  1IKW A;  1MWZ A;  1FA0 A;  1TL3 B;  3KJV B;  2D3Z A;  3QIP A;  3S1T A;  3QZ7 A;  1TFY A;  1FT8 A;  4BLG A;  3FMB A;  1SIW B;  3QMQ A;  5IM0 B;  1RWP B;  3ILI A;  1UA1 A;  5IT9 U;  1YJN S;  5J1P A;  2YNG B;  3MR3 A;  1E6V B;  3QAE A;  3I87 A;  4CH0 S;  3MEK A;  3RRK A;  2GIF A;  2GW8 A;  2KU7 A;  2VAS A;  2ZNZ A;  4YB7 A;  2N3O A;  2B7B B;  2VON A;  2C42 A;  2MQ8 A;  1O51 A;  1YRU A;  3T5K A;  2RRA A;  2ZVI A;  1X9W A;  2F7V A;  4BS2 A;  3GR0 A;  1NK8 A;  2X1A A;  4OJ1 A;  1YBA A;  3HVT A;  1UVJ A;  2AEF A;  1KKH A;  3T5H A;  1T9U A;  2WW4 A;  1NK4 A;  2K3K A;  1UA0 A;  4CLL A;  4HI2 A;  3RRG A;  3ONQ A;  1YZ6 A;  1JLE B;  3M8Q B;  5FLX Y;  3CDE A;  1N4L A;  3IG1 B;  3KYL A;  3PAC A;  5D4N A;  3LF0 A;  3RBX A;  5HAO A;  4ZVQ B;  5K9F A;  1IN0 A;  3MMA B;  3UN5 A;  1LWC A;  5IWA J;  2GMH A;  4ZKA A;  4H4K C;  5D77 A;  3VWS A;  3AB2 B;  4F0K A;  3E01 B;  4ZPB A;  2MHE A;  2WZ1 A;  3O2I A;  2PA3 A;  3SZ2 A;  4TLR A;  3K2Y A;  1HQ2 A;  1UP1 A;  1N32 J;  1U47 A;  2OPR B;  1O0P A;  4FPI A;  4AXI A;  5GAG I;  3ICL A;  2C2N A;  3PM9 A;  4DV0 J;  1KLM B;  2RVJ A;  4JV1 A;  2VDH A;  3TOQ A;  3M8P B;  4YB1 P;  3V6D A;  4ZJO A;  1VC0 A;  4CQ1 A;  3HSD A;  2B4V A;  4F3M A;  3T19 A;  4KY3 A;  2LEP A;  4B9L A;  1PGZ A;  2EEY A;  4JI8 F;  2HQF A;  4GC6 A;  4ID8 A;  3I55 S;  1VQK S;  2CJB A;  4H4K A;  3UNY A;  4DQQ A;  1Z4U A;  2L3M A;  2BM1 A;  4ES1 A;  3HFZ B;  2XQC A;  4K4V A;  1RWM B;  4DN9 A;  2XCA A;  3G96 A;  2KO1 A;  2EKN A;  2VFU A;  1X5P A;  4P71 A;  1QDU B;  3BO3 A;  2R7T A;  1EQ0 A;  1R27 B;  2E5I A;  4P6Q A;  4JI0 J;  2XS5 A;  2VHG A;  3KTQ A;  3KK2 A;  1FO1 A;  4DL4 A;  2I0X A;  4AD6 A;  3QT5 A;  1EP4 A;  1EAR A;  4WU2 A;  3KMS A;  2IBO A;  3HHL D;  4CLF A;  1FJG F;  3IS9 B;  5D8H B;  3QIP B;  4ZLP A;  3W64 A;  2QV6 A;  1RBA A;  3PNI A;  1ACM B;  6AT1 B;  4CH1 A;  2OKQ A;  2RS2 A;  4PAB A;  2XUL A;  2QLF B;  4TU8 A;  3DFE A;  4Y2A A;  2B9W A;  2WOM A;  2HBQ B;  1KVK A;  4J9P A;  3CTR A;  3I56 S;  4OHV A;  2AU0 A;  4UOG A;  2HBY B;  1IBK J;  2DY1 A;  2V0N A;  2DT9 A;  4ZVO B;  4A8F A;  1U6B A;  2Z2Z A;  2LXU A;  3VGT A;  2VD3 A;  3KDO A;  3B4M A;  3DLK A;  4WK1 A;  1K47 A;  1DQA A;  5M2U A;  3HVT B;  5HQM A;  1EX8 A;  5DGB A;  3A4T A;  2XZW A;  2AF6 A;  1CJK A;  5HLF B;  1HWL A;  3F73 A;  4NLR A;  4DBQ A;  1R6Y A;  5D4P A;  2AJ4 A;  5C24 A;  4ED7 A;  1HBN B;  4HKQ A;  3SFG A;  2V4R A;  1HR0 J;  3MHY A;  1VYA A;  1NCL A;  1WEX A;  4ANE A;  3MPY A;  2DEI A;  1VBY A;  4I68 A;  1FX2 A;  4H4O A;  1T7P A;  5F8H A;  2HMI B;  5IV3 A;  2J0S D;  1GNK A;  2CJX B;  3ADA C;  3NS6 A;  4ZVG A;  4G1P A;  4UF4 A;  3H7H B;  4OZ1 A;  4C3M A;  5EN1 A;  3QGH A;  3WDO A;  1XR7 A;  1F9H A;  1NK7 A;  4KPY A;  3R3T A;  4K5R A;  3VTI A;  1F3V A;  2VFR A;  2ZZM A;  4DR5 J;  2GCF A;  5EHH A;  1QSY A;  3MF5 A;  2AJ2 A;  3TA1 A;  1WNE A;  2M0G B;  2MKK A;  3Q83 A;  1L3T A;  1W25 A;  3AOC A;  4U7U K;  1U1N A;  1HWJ A;  4RU2 A;  5AE1 A;  2X1F A;  4I0W A;  1FNX H;  1RT1 B;  2NSC A;  4FXV A;  4PXE A;  2CYY A;  3V6D B;  2C2D A;  1B7F A;  5CH7 B;  4MYU A;  4RUH A;  1OS5 A;  2VBY A;  1Q82 T;  5KFL A;  3UN2 A;  2KFZ A;  3DU5 A;  5ETP A;  3AD9 C;  1YG0 A;  2HHU A;  3IO1 A;  3D1Q A;  4WTY A;  1T3O A;  1VQL S;  2KRB A;  5IFM A;  2JEI A;  3W3S A;  1P1T A;  5DM6 Q;  5HJX A;  2DGS A;  4XDC A;  3Q8Y A;  1Q8L A;  4X4Q A;  5HMW A;  1JNR B;  3FRZ A;  3FCH A;  3UCG A;  5CQG A;  2J6S A;  2PT0 A;  2VA3 A;  2FTR A;  2FYX A;  3DRS A;  3DYA B;  3PKY A;  1T8E A;  1MWY A;  1WEY A;  1EP4 B;  4N47 A;  1KSP A;  2PI4 A;  1TVR B;  3NBP A;  4PRF A;  2V8P A;  4RNH A;  3CSK A;  2BJ1 A;  5KFW A;  4J91 A;  4OX7 A;  3JTN A;  1VGY A;  1LQ9 A;  1M90 T;  3EWG A;  1QD1 A;  2WSC C;  1JIH A;  1CSJ A;  5KFP A;  3VF0 B;  3KNG A;  1P8G A;  2DEJ A;  1XMO F;  1N6Q A;  4OI0 A;  2KFN A;  2HHS A;  3UD4 P;  1GTE A;  2WOM B;  5KT5 A;  2R8J A;  1SL1 A;  3T1Y J;  4LFC J;  1S7I A;  2MMY A;  4OZ3 A;  3BO4 A;  4QYZ K;  2DH7 A;  2U2F A;  2DNO A;  2BAB A;  3PTW A;  3RYL A;  1AB8 A;  3GV5 B;  4MMO A;  4JV5 J;  3H5Y A;  3BYP A;  2COL A;  3WIU A;  2HZV A;  3GCX P;  1CJK B;  4RX6 A;  2R4F A;  1WC5 A;  2D3O R;  1KBR A;  4JI7 J;  1OYD A;  4M5D A;  4BBY A;  2JDJ A;  5DDQ C;  2LU2 A;  5C24 B;  5GAH I;  2EFQ A;  1L3V A;  2FC9 A;  2HFS A;  2ZJP Q;  2GGP A;  2AT1 B;  5DG7 A;  4M5K A;  4LF5 J;  5L39 A;  3DOL A;  3R5G A;  3MI7 X;  2JVO A;  4X64 F;  4Q0B A;  4TNO A;  4ED8 A;  4NL5 A;  1N52 B;  1Y10 A;  2HG4 A;  1S6Q A;  1RAA B;  1REG X;  3M32 B;  2AYM A;  1SH2 A;  1FJ7 A;  3K5M A;  5LMU F;  2LMI A;  3TVK A;  5IQQ A;  1GH8 A;  3DMJ A;  1WWH A;  3AJ2 A;  4OI6 A;  3CD5 A;  2VH7 A;  1U0S A;  4O3P A;  4P7T A;  5ITH A;  4I7F A;  1SKW A;  1UFK A;  1FVQ A;  4ILL A;  3DLE A;  4Q8F A;  5C2G A;  1DLO A;  1NHV A;  3QQC D;  4WK3 A;  3GYN A;  3DCA A;  3HUL A;  3M2U A;  1KEK A;  3P5T L;  5A2Q Y;  2J0Q D;  4MAK A;  3GSI A;  2IM0 A;  1OJ4 A;  4K4Z A;  2I5J B;  3KK1 A;  1VJW A;  1WSV A;  2EC2 A;  3JSM B;  2ZEJ A;  1RWK B;  1HNZ F;  4E98 A;  2Y1I A;  1GMW A;  3LA0 A;  2R7Q A;  4OYX A;  3NNC A;  4IG3 A;  2MY8 A;  5KTQ A;  4OFZ A;  2AZ3 A;  4ENO A;  3KJQ B;  3SV4 A;  4F04 B;  3T41 A;  2IAJ A;  4HT5 A;  1TEL A;  4USK A;  2IY5 B;  3OSP A;  2MKI A;  2DBB A;  2DRD A;  3JSB A;  5L8R C;  4DL3 A;  3W5X A;  4TYA A;  2A6O A;  1YDL A;  2EG1 A;  1JXV A;  4RW6 A;  4YEA A;  3MPD A;  1P9Y A;  2CPZ A;  2M88 A;  3R5J B;  2XWX A;  2CWK A;  3D3C J;  2YWH A;  2IM3 A;  2LLZ A;  3CW2 C;  4FN5 A;  4DSJ A;  3AHP A;  3DLJ A;  3ENA A;  2XO7 A;  4P2X A;  3TUJ C;  3CPW R;  2ZH4 A;  2HGL A;  3NBP B;  4EEY A;  2ZKU A;  1RAB B;  1MML A;  4CIO A;  4DF8 A;  5AXL A;  4DR6 F;  1LW2 A;  3HD1 A;  5F0W A;  1F2G A;  2HFN A;  3IM9 A;  3HCX A;  1X5S A;  3MEE A;  1RAI B;  1FWL A;  2XB2 D;  2MLZ A;  4LIW A;  1NPK A;  4QIV A;  4KGK A;  2GJ2 A;  2NXC A;  5F41 A;  5DG8 A;  1SL2 A;  1RJJ A;  2ZBP A;  1UWB A;  3RB4 A;  1RT4 B;  2IJR A;  2RQC A;  3TQE A;  1TV6 A;  1SB6 A;  1RUS A;  3NG8 A;  2PEH A;  1H2V Z;  1WF2 A;  1XN9 A;  2DGT A;  1U8W A;  5KFE A;  4CNZ A;  2C2E A;  3C6T B;  1O5J A;  2XLK A;  4I56 A;  1DAX A;  2GIQ A;  4DL2 A;  2OEL A;  3BQ0 A;  2W9B B;  3L09 A;  2N82 B;  4OV1 A;  4JI2 F;  4I1T A;  3D1H A;  2XG8 A;  1X4D A;  4JI8 J;  5L38 A;  3DGP B;  4DU8 A;  1CLF A;  1HNW F;  4NLQ A;  1KR4 A;  3L7P A;  2V9K A;  1HMV B;  2VKZ G;  4FP9 A;  1WD6 A;  3LGM A;  3DOL B;  5EDW A;  2XC9 A;  4Q0B B;  3GIL A;  3R7S B;  2HFZ A;  3DOK A;  4ZOS A;  1FVS A;  2C3O A;  3NCR A;  1MG7 A;  3EVO A;  2YQ1 A;  2BJ9 A;  3DMJ B;  3PO5 A;  4ES2 A;  3S6E A;  3ZTP A;  5B0G A;  3NGS A;  3QO9 B;  5FLX U;  4BC7 A;  1RT6 B;  2Y3Y A;  1TL7 B;  2B3T B;  4Y2K A;  1T9W A;  4P2M A;  3DRR A;  1VDH A;  2XY6 A;  3DLE B;  1MWQ A;  2ZKT A;  3HO1 A;  4DPX A;  1KHV A;  2DIU A;  3DLG A;  2XNQ A;  1FJG J;  2PD1 A;  3UD5 A;  1HA1 A;  1Y5I B;  3M2U B;  3H4D A;  4FF1 A;  2C22 A;  5KT3 A;  3OT9 A;  2MJU A;  1D3W A;  1M5O C;  1R3N A;  2HNY A;  3MGJ A;  1ELO A;  4B3O B;  1JK9 B;  2RSQ A;  3OHB A;  4DX6 A;  3KK1 B;  4O4G A;  1DY3 A;  5HK4 A;  1GMU A;  2VQF F;  2CQP A;  4TQR A;  2VG7 A;  4IFV A;  2DXE A;  2E7X A;  2RS8 A;  1FD8 A;  4IG3 B;  4EZ9 A;  2BA9 A;  3CUN A;  2VQE F;  2H48 B;  3KUE A;  1T9Y A;  4ZA1 A;  1FXD A;  5D0E A;  2IAJ B;  3KKF A;  5F8L A;  2RDI A;  3JSR A;  4F4W A;  3WBZ A;  1WG1 A;  2N4D A;  2GAG C;  2HEK A;  4WFA Q;  4LF2 A;  4XO0 A;  4J9L A;  3BSO A;  4CZC A;  4JV2 A;  1OWX A;  2BXJ A;  2LEB A;  3BS9 A;  2EG2 A;  4NYO A;  4M5N A;  4R0E A;  4HTI A;  4C3L A;  1TKX B;  1SUQ A;  1JLG B;  3LP1 A;  4FF2 A;  1OYE A;  1W7W A;  4YHH F;  3ZC4 A;  1LW2 B;  3PFE A;  5L1I A;  1OSD A;  1RGV A;  3QFH A;  3VGS A;  2VOP A;  4ED1 A;  1RHU B;  1VIO A;  3H2U B;  4EMD A;  2QA2 A;  2WB4 A;  3MEE B;  1S1V A;  3I9V 9;  5ETR A;  3RB6 A;  5U47 A;  5CYQ A;  4ECZ A;  3CWJ A;  1M5P C;  1T9X A;  1V3S A;  2PEB A;  4QR0 A;  1TV6 B;  2UXD F;  2QMU B;  2WHO A;  3JB9 k;  3RR8 A;  4X4V A;  3OD2 A;  1ZPV A;  3OXG A;  2CJ9 A;  4DG1 A;  2FHJ D;  1F3F A;  4B3M F;  4FZV A;  2Y1R I;  2RKI A;  5HN0 A;  1H6K X;  4WE1 A;  2YTC A;  2B9X A;  2W01 A;  1AFI A;  3CNQ P;  3VAF A;  4NOH A;  1XEZ A;  3U1M A;  1QTM A;  3S7R A;  1RQ0 A;  3CJ4 A;  4DHV A;  1KTV A;  2MQN A;  1LV5 A;  2WSE C;  1QUV A;  1J2V A;  3Q22 A;  3HX9 A;  3DOK B;  1O6X A;  1C1B A;  1RTZ A;  2ERR A;  4QBU A;  4URG A;  2XBP A;  1YKW A;  4F2S A;  2M8D B;  2E1A A;  4DFJ A;  4NYP A;  2CFX A;  3PR5 B;  4F4Z A;  3Q86 A;  3H20 A;  3GFH A;  4L74 A;  2WCX A;  4X4N A;  5BR8 F;  2HAI A;  1S5Z A;  3NGD A;  2C1E B;  4FS1 A;  4NZ6 A;  4ZPT R;  3W63 A;  3DRR B;  2H4Y B;  1SPB P;  1HBU A;  2CG4 A;  3KDN A;  1NKB A;  3IWL A;  4MIA A;  4DCJ B;  3JTO A;  2EC0 A;  3L4B C;  3KLH B;  2HK3 A;  3EZO A;  1A6L A;  4LT6 A;  1NK6 A;  1QTN B;  3HSG A;  5ADZ A;  2VPX B;  1OPI A;  4MIB A;  3TJ9 A;  2JNJ A;  1WAC A;  4F2R A;  2RU9 A;  1UEV A;  2HKE A;  2VC1 A;  3DLH A;  2EFO A;  4O4G B;  2V94 A;  5KFY A;  1S4E A;  2AIR B;  2YKQ A;  1WOO A;  2DGU A;  3BBC A;  4Z7C A;  2KZM A;  2VG7 B;  4IFV B;  1KVJ A;  4TLQ A;  1Y3J A;  3D54 A;  3OXL A;  3PW4 A;  4ZPW R;  3C6U B;  3EX7 B;  3TAM A;  3K58 A;  2BR0 A;  2EFN A;  3PIP Q;  2W1B A;  2IMW P;  3A3N B;  3AOB A;  2OPS A;  2R42 A;  4DV6 F;  2P9C A;  1BD6 A;  3K5O A;  4PPD A;  4NZ7 A;  2D69 A;  1H38 A;  3PYD A;  2PMH A;  2E5G A;  1HW8 A;  3J81 j;  1TU0 B;  1HNV A;  4HR2 A;  4C0O C;  3J81 Y;  4X64 J;  4KKO A;  3V6J A;  1SUQ B;  3C46 A;  3LP1 B;  3G6E S;  3QPI A;  3H40 A;  4JP8 A;  4WCE Q;  3H5U A;  5LMU J;  4X4S A;  1QM9 A;  5LMN F;  2KI2 A;  5T7L B;  1UKU A;  2HAF A;  1S1V B;  1LEO A;  2ZOM A;  1TKD A;  3ULH A;  5CYQ B;  2CZ9 A;  1SC1 B;  1LWF B;  1N5V A;  3IXQ A;  2HFO A;  1RWV B;  1U1M A;  2OPQ B;  2BDP A;  2UVV A;  4IQM A;  2G1D A;  5GAG U;  1UVI A;  1RAH B;  3F0N A;  4DG1 B;  2RKI B;  1RA6 A;  4RPF A;  2DO4 A;  3PHT A;  3R5D A;  4WJB A;  2YXL A;  1HNZ J;  2RIJ A;  4RW7 A;  4TY9 A;  1PIL A;  4ZLN A;  4X2B A;  1FRM A;  3KWM A;  2YVS A;  4NE9 C;  2XMU A;  3BYR A;  3GG1 A;  3SQG B;  2P5V A;  5MAO A;  1N5Y A;  1Q1K A;  3THV A;  2VOO A;  3CJ8 A;  1QUP A;  1C1B B;  2JEJ A;  4X4O A;  1JB0 C;  2RT3 A;  3PYE A;  1KWM A;  1KD1 T;  4NXN F;  2KH9 A;  3S01 A;  2V50 A;  1SXL A;  2GMJ A;  2DR6 A;  4HDG A;  3G6X A;  5GVQ A;  1UFL A;  3MMB A;  5AT1 B;  1S6O A;  5LJ5 Y;  1S6P B;  2W7A A;  1EJ7 L;  1NDL A;  1X7V A;  4DLG A;  2UVW A;  4DR6 J;  3MCS A;  1IVZ A;  1TL1 A;  3ZZP A;  3KK3 A;  4ZVP B;  1M5V C;  2XCP A;  4QCL A;  1ZZF A;  3HFK A;  2ZJQ Q;  1SKS A;  1RTD A;  3NGK A;  2UXB F;  1UZD A;  3OW2 R;  2OMO A;  5F8M A;  2AQ4 A;  1JLB B;  1I5O B;  2HIQ A;  1S9E A;  1E6Y A;  1RWO B;  1SC4 B;  2IM1 A;  3J7Z 5;  3W65 A;  3D2W A;  1FXL A;  3QRQ A;  2BE2 A;  3AA9 A;  2HND B;  5A2Q U;  2HYI B;  4I67 A;  2O5D A;  3PW7 A;  2RRB A;  2OPS B;  1VLY A;  3TZX A;  2E7W A;  1B0V A;  4X66 F;  3VAH A;  1BE4 A;  2FJV A;  4JI2 J;  3R1H A;  3OJU A;  4O23 A;  1JXL A;  4JB8 B;  2H65 B;  3CO0 P;  1HNW J;  2WBM A;  1YJV A;  2RQ4 A;  1RE1 B;  1S0O A;  1HNV B;  2HQD A;  4KKO B;  3FFI A;  1N33 F;  1T02 A;  3RW7 A;  3HZG A;  3PX4 A;  2KHC A;  5DS7 A;  2V8G A;  5J2N B;  2R8G A;  3DDI A;  4GVB A;  4N56 A;  2G9O A;  1JJC B;  2QO3 A;  2DB1 A;  4QWC A;  1TMM A;  1ZH5 A;  3D9B A;  3NKY A;  3CT9 A;  1HQE A;  2V6A A;  1HNI A;  2W9C A;  1M5K C;  1B0P A;  4DUT A;  4B9V A;  4EFA C;  2MLX A;  2YNF A;  1H73 A;  4GMK A;  2NYI A;  1KP6 A;  2KN4 A;  2W7P A;  2NPI A;  1YJU A;  5H9E J;  3HJF A;  3J80 Y;  4OJG A;  4DV4 F;  3SSQ A;  2ADB A;  3PO4 A;  1J5E F;  3I31 A;  2CQ3 A;  1WDD A;  2N7C A;  2GVD B;  1H2U X;  2VQF J;  1NSQ A;  4RW7 B;  3CCL S;  5KFT A;  3CC4 S;  4NML A;  2DYA A;  4QIF A;  2XMT A;  3E8O A;  2VQE J;  1HYS A;  2B0G A;  4DPT A;  1I3O B;  4LMZ A;  3NWR A;  1U6F A;  1N5Y B;  2SXL A;  1FWK A;  1T95 A;  4Y28 C;  1A7G E;  1RDR A;  2LEA A;  1YJ9 S;  5HVF A;  2FVQ A;  2G0I A;  3CCS S;  3EJM A;  3HI9 A;  3KG1 A;  1U0H A;  2DR5 A;  5FII A;  1CJV A;  4DR4 F;  1RU1 A;  3F56 A;  3VVT A;  3QGI A;  3EDR B;  3ITH A;  1IKX A;  1UWA A;  5JXS A;  4GRS A;  3EXC X;  3B4D A;  2KT2 A;  4HEA 9;  2ZOG A;  2HVH A;  2LA6 A;  5D0H A;  2ZC3 A;  1TUV A;  1CC7 A;  3MMB B;  4WYL A;  3W2W A;  1ULR A;  1MN9 A;  3CUL A;  1WC0 A;  2APO A;  4PKD B;  1RI7 A;  4YHH J;  3ILJ A;  2GJF A;  1TL1 B;  1RZM A;  4YUD A;  3KK3 B;  4OZ5 A;  3CB4 A;  2IPO B;  8RUC A;  1RTD B;  2KB2 A;  3TUP A;  4B17 A;  1FEE A;  4W98 A;  3BN7 A;  2V68 A;  4FBT A;  1S9E B;  1E6Y B;  5CD4 H;  2JHE A;  2KL8 A;  3KHL A;  2B51 A;  1N5T A;  3D7S B;  4C98 A;  3S8S A;  2DGQ A;  3AAW B;  3UDE A;  2UXD J;  2KKH A;  5LOQ A;  4YB5 A;  4EU0 A;  2BE2 B;  4CO5 A;  1LWX A;  3FKB A;  2MZ1 A;  4DZD A;  1OY8 A;  3H25 A;  4ECS A;  4B3M J;  2H3E B;  2DR9 A;  4HAC A;  4ATN A;  2HHW A;  3CJT A;  1S49 A;  1NSP A;  2QLJ B;  1B0T A;  1HKA A;  1B70 B;  5GAH U;  5I42 B;  4L3N A;  2A2C A;  3CMQ A;  2XMV A;  2ZE2 B;  5KFX A;  3P6Y C;  2YWK A;  1FKO A;  4FPR A;  3FFI B;  2VJU A;  1GMW D;  1RT2 A;  3PYG A;  3NS7 B;  4O0N A;  2Y0B B;  3TJ8 A;  1TL5 A;  1W2B R;  5D3G A;  5BR8 J;  4GVB B;  1N36 F;  2FGC A;  4KE5 A;  1URR A;  1Y7P A;  1XMQ F;  3UFC X;  1U2F A;  2ZH2 A;  5LSL A;  4C97 A;  2X1G A;  1T03 A;  2W9C B;  1UMJ A;  1PYT A;  3NAH A;  2IA6 A;  4BHQ A;  4DL5 A;  2YNF B;  5K5M A;  4PEO A;  1Q95 G;  3TP2 A;  5K8N A;  3CCQ S;  2UUB F;  1YIJ S;  4NLO A;  1X5O A;  2PA8 D;  4Z37 A;  2HPU A;  4DV2 F;  3N6M A;  3FEY B;  3OXF A;  2ZVS A;  4HHH A;  1WEZ A;  2LU1 A;  4IFY A;  4TN2 A;  3KNA A;  4BWM A;  2IYG A;  2ZUG A;  3ET6 A;  1BUX A;  4F0M A;  3TX0 A;  4YS2 A;  3SSS A;  4QWD A;  4PXB A;  2CAD A;  4K8R A;  2J9D A;  4DV6 J;  1X4B A;  1U0H B;  3AJ1 A;  1CJV B;  4D3G A;  4F4A A;  2P9E A;  1Y5N B;  4OI3 A;  1RK8 A;  1IKX B;  1I1G A;  3J7A 1;  3OUY A;  3K57 A;  2PO4 A;  1VQP S;  1VS3 A;  4CT8 A;  2A18 A;  1RAJ A;  5KFG A;  2MZR A;  2HZA A;  1S76 D;  1SJQ A;  1D09 B;  2R2U A;  3K8V A;  1REV A;  3W2W B;  3CMA S;  4C0B A;  4Y00 A;  4DR7 F;  1FHT A;  4DR1 F;  2QIF A;  4F67 A;  1ZM4 A;  4PQA A;  1FFS B;  2FHO B;  3UQS A;  5LMN J;  2KG0 A;  1ICE B;  4W4M A;  2DH9 A;  2LDY A;  5KFJ A;  3W9I A;  3M2R A;  4QWE A;  3UE2 A;  2DKO B;  4MK9 A;  2XWY A;  2OML A;  2FLL A;  2F1F A;  3TZY A;  1TAQ A;  1PSD A;  2RF2 A;  1SH0 A;  1X60 A;  3ISN D;  2FVC A;  4K4X A;  3FQL A;  2VBX A;  1CJT A;  4A8S A;  3A13 A;  3OL8 A;  2YKN A;  2PFD A;  1I6J A;  3Q8S B;  4WFB Q;  3ZFV A;  4FXW A;  1RBO B;  4L75 A;  4ECR A;  1U26 A;  4HYK A;  4HAC B;  1G3O A;  4F4K A;  3MZI A;  2JL9 A;  4FKY A;  1N5Q A;  3M4X A;  3C3L A;  1RAD B;  3VAK A;  4DV7 F;  4DN0 A;  2XMK A;  3FCV A;  2XMA A;  1UW4 A;  4IRC A;  1S7H A;  3VGV A;  3IRX A;  2CUY A;  4USW A;  2DNZ A;  1AUS L;  1U45 A;  1RT2 B;  2K7J A;  3I82 A;  3B78 A;  2B9Y A;  2V69 A;  4DR2 F;  3I5B A;  4MYT A;  4YFU A;  1LXJ A;  4F02 A;  2HRU A;  5IWA F;  5F8N A;  2BYC A;  3HXM A;  1EKS A;  3DU6 A;  4I6W A;  4ZN3 A;  5D3G B;  2RJZ A;  4NXN J;  3PRV A;  3HDS A;  1W2I A;  5B08 A;  1PYS B;  3CXC R;  2NYH A;  1AXQ A;  3BGL A;  4BC9 A;  1NEE A;  2M4M A;  1T03 B;  4FVM A;  3KLF B;  5IXU A;  2O67 A;  3J81 U;  3NP5 A;  4UQT A;  2FB0 A;  3WC0 A;  5A8K A;  1DUR A;  2UVR A;  2ALZ A;  3R7B B;  2A10 A;  4ECQ A;  3G8S A;  3A3O B;  2Z2Y B;  2UXB J;  3NLC A;  4RLE A;  3F44 A;  2JLG A;  3HVR A;  4CH7 A;  5KG1 A;  1ITP A;  4RNF A;  4OI4 A;  1R0C B;  4K50 A;  4TXS A;  5KOW A;  3I0S A;  3RU0 A;  4R5P B;  3P3D A;  1QAX A;  1F9F A;  4NA1 A;  3H8Y A;  2HNZ B;  3OR2 A;  3IBC B;  1UPM B;  5BYS A;  1S72 S;  4PG4 A;  5KFR A;  1ZM3 A;  2B6A B;  4DSF A;  3IR7 B;  4O3R A;  1BGX T;  3EDQ B;  2FZK B;  4KH0 B;  2GQQ A;  4PG8 A;  4X66 J;  4OYA A;  3PKM A;  1Y4Z B;  4FNH A;  3P45 B;  3IR5 B;  4V19 X;  2V67 A;  2XSF A;  3OUY B;  4J9M A;  3LP0 A;  1K8A T;  2CVE A;  3MEG A;  2E1R A;  1RAC B;  3KMQ A;  2E5J A;  4KC5 A;  3MD3 A;  3ILL A;  1G2E A;  1TKT B;  3SQO P;  2JZ5 A;  3O1L A;  1N33 J;  1ZA2 B;  4ZHR A;  5CZV A;  2J6U A;  3NRB A;  5J2P A;  2H51 B;  4DI6 A;  4UT4 A;  4RUC A;  4Y2C A;  5AXK A;  1NZA A;  5ETK A;  3IGV A;  5F3Z A;  5KFO A;  1K73 T;  5BXI A;  2KM8 B;  3LW5 C;  4Y34 A;  1NDK A;  2VBW A;  1YHQ S;  3MR5 A;  2BBE A;  1KON A;  1X0P A;  1WJ9 A;  3R7N B;  4F50 A;  2YKN B;  1LFP A;  4DV4 J;  2AGQ A;  3QFW A;  1J5E J;  4ZPC A;  3KUH A;  4OYW A;  2ZIT A;  4KGM A;  4DCO B;  5LSR A;  2ZM6 F;  3DC2 A;  4LF8 F;  1CVJ A;  1DHM A;  3NY0 A;  5KT4 A;  4DF4 A;  4OZL A;  3AJD A;  4P7V A;  2GX8 A;  5L46 A;  1IR2 A;  1QE1 A;  4HT7 A;  2Z2L A;  1RAO A;  3MMC A;  1GXT A;  4K4S A;  3U1L A;  1PBU A;  4YDD B;  3M6V A;  2VG5 B;  3EM1 A;  5GMD A;  3HF5 A;  4HI1 A;  4NCB A;  1HLW A;  4PWD A;  3BSN A;  2WVE A;  4IOB A;  4DR4 J;  4JI4 F;  2OP5 A;  1KFS A;  2YKP A;  3QJP A;  2H9Z A;  3LP2 A;  3TQ1 A;  2CG8 A;  3MR7 A;  2PFF B;  1SJ1 A;  2E5H A;  2QYG A;  5HBM A;  5F9N A;  2OPP A;  3U1N A;  1YJW S;  3BGR A;  1F5B A;  2VG6 B;  2XHC A;  1VHI A;  3AQO A;  4N41 A;  1VBK A;  2F5G A;  2N7Y A;  3KJV A;  2MZQ A;  3I0R A;  2F3J A;  4CTA B;  2BJ3 A;  4RNO A;  5FDL B;  5A8K B;  3W9H A;  4C8Y A; 
#chains in the Genus database with same CATH homology
 4B3S J;  4K0K J;  4JI1 J;  4GKJ J;  5FLX U;  1XNQ J;  4HHU A;  5LMU J;  4LF5 J;  3R2C J;  5A2Q U;  4B3T J;  2E5L J;  5AJ3 J;  1IBL J;  4DV3 J;  4YHH J;  5IT9 U;  1N36 J;  4X65 J;  4JI0 J;  1IBM J;  1FJG J;  1N32 J;  1XMQ J;  4LF6 J;  3J81 U;  2MQ8 A;  1XMO J;  4JI2 J;  4JI4 J;  1HNX J;  2MTL A;  4JI5 J;  2F4V J;  2VQF J;  4DV6 J;  4NEZ A;  3T1Y J;  4LFC J;  1N33 J;  5BR8 J;  1XNR J;  3J7A N;  4JI6 J;  1HR0 J;  1HNW J;  2HHH J;  1I94 J;  4LFB J;  4PWW A;  4DV7 J;  3IMQ J;  4LF7 J;  4OX9 J;  3D3C J;  4JYA J;  4YY3 J;  2UXB J;  2VQE J;  4DR4 J;  4DUZ J;  4DR7 J;  4DV0 J;  4DR1 J;  4LF4 J;  4B3R J;  4DR6 J;  3T1H J;  2KL8 A;  3J80 U;  3W1Y C;  3D3B J;  2UUB J;  4DV5 J;  4DR3 J;  4JI8 J;  2UXD J;  2UU9 J;  4LF9 J;  4DV1 J;  4JV5 J;  4DV2 J;  4DR2 J;  4JI3 J;  4AQY J;  4KY3 A;  4KYZ A;  4KHP J;  3OTO J;  2KVQ E;  4GKK J;  1HNZ J;  4NEY A;  4B3M J;  3R2D J;  1IBK J;  2UUA J;  2UXC J;  2UUC J;  3JAM U;  2ZM6 J;  4DR5 J;  4LFA J;  4LF8 J;  4X62 J;  4JI7 J;  4RJV A;  2MEW A;  4X64 J;  5LMN J;  5LM7 E;  4V1A k;  4DUY J;  4DV4 J;  4X66 J;  5IWA J;  4NXM J;  1N34 J;  1J5E J;  4NXN J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...