1XNRJ

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1xnrJ00
4DV5J 2UUAJ 1XNQJ 4KY3A 5LM7E 4DV0J 1IBMJ 3IMQJ 4JI4J 4X64J 2UXDJ 1N36J 2UUBJ 1HNZJ 5A2QU 5AJ3J 4JI8J 4JV5J 4HHUA 1J5EJ 2E5LJ 1HNWJ 3D3BJ 4LFAJ 4B3MJ 4LFCJ 4RJVA 4K0KJ 5LMUJ 1N32J 2VQFJ 1N33J 3J81U 2UXBJ 4DV3J 1HNXJ 4LF6J 4GKJJ 4NEZA 1N34J 3T1HJ 4YY3J 1FJGJ 4JYAJ 4JI3J 2MEWA 4LF5J 4LF7J 4LF9J 1XNRJ 3OTOJ 1IBKJ 4NEYA 1IBLJ 4X66J 2ZM6J 4JI7J 2KVQE 4DV6J 4X62J 3J80U 4DV4J 1XMOJ 2F4VJ 3R2DJ 4DR3J 5IWAJ 4KHPJ 4DV2J 4GKKJ 3D3CJ 2MQ8A 4NXMJ 3W1YC 2KL8A 4OX9J 4V1Ak 4PWWA 3JAMU 4JI5J 1XMQJ 4JI0J 4DR6J 4DR7J 1I94J 2UUCJ 2HHHJ 4DR1J 4LF4J 4AQYJ 4JI2J 5IT9U 4DV1J 4NXNJ 4JI6J 4LFBJ 4LF8J 5FLXU 3T1YJ 4X65J 5LMNJ 4DUZJ 4DR2J 2MTLA 3J7AN 2UXCJ 4KYZA 2UU9J 4JI1J 4B3TJ 4YHHJ 5BR8J 4B3RJ 4DV7J 4DUYJ 4DR5J 3R2CJ 4DR4J 2VQEJ 4B3SJ 1HR0J
chains in the Genus database with same CATH superfamily
1WF2A 4A46A 3OTDA 4IOBA 2UUTA 1SH0A 1HNZF 4QU6A 2NPFA 4GO7X 2CUYA 2ALZA 4X4PA 2V50A 2BE2A 3RG6A 3SV3A 1RHUB 2R7QA 4HDGA 1XR5A 3MTKA 3F41A 1ZAWA 4K4TA 1HARA 3ZC4A 3SSSA 2Z58B 2FZGB 3C6UA 4A8SA 2LQBA 2A2CA 2RQKA 3TAQA 3NS7B 1DARA 2O3DA 1M0SA 1U7LA 5K14A 2HK2A 3S7RA 3NY0A 2YH1A 4I68A 4KHPJ 3QQCD 4PUOB 3OR2B 1WELA 3DM2A 4DU8A 1PJ6A 3T41A 2DKOB 4YEAA 3KOAA 3QJJA 2YKPA 3KMQA 1HHSA 5DJBA 1TMJA 2QX0A 3GIKA 2VBZA 2VPWB 5F8IA 5CYJA 1B0TA 2MZJA 3CCLS 1DY3A 1Y9OA 1CJTA 1VLYA 5GMDA 2HMIB 2R42A 2Y1IA 2ATCB 3HVRA 1JLFA 3PACA 4ZVTB 2A6OA 2ABYA 1RLCL 2UVWA 2UV8G 2RQ4A 4C7QA 4XO0A 5F8MA 3TZYA 3MMAB 2HBZB 4QWDA 4DFJA 4ELTA 1S1WB 2YX1A 1B0PA 4GKJJ 5A8RA 2ZH8A 3KK3A 3NG8A 3FMBA 2W1BA 3VAMA 3ZTPA 4OX6A 5HI7A 3LGHA 1KWMA 3TVKA 3M30A 4R8UB 1SJ3P 2EFPA 4ZPWR 3IG1A 2C3MA 3KLIB 1S1XA 4NLDA 1JNZB 3M8PA 1N6QB 3MDFA 1GXUA 1MWQA 4J9UE 4C2MA 4KGMA 2MYFA 1S6PB 1KOOA 1LW0B 2YKMA 2DEIA 5KFWA 4NLPA 2OTJS 3IRXB 2A6MA 3I96A 2DNKA 2V2KA 4NLUA 3MXHP 3OR1A 4IQMA 2VFTA 4LR7A 4PCQA 4GC7A 4F50A 2DNZA 2F65A 3TAMB 3A3OB 3QAEA 4O3PA 1LWFB 5KFXA 1N4LA 1TL5A 2OIHA 1C1BA 4DPWA 1CJVB 1NNDA 5E0OA 1EP4B 3KLVA 2VPYB 2U2FA 1BC6A 1ZS6A 2LEPA 3QJPA 3SZ2A 4QR0A 2BJ7A 3H2VE 3PX0A 1FFWB 2EC0A 1WHWA 1T03A 3NBPA 1R0AB 1NDKA 4DXLA 1J5OA 5IT9Y 1S99A 2BANB 3MECB 4QW8A 2CXEA 4Y2KA 3UWTA 4M5LA 3HFVA 4NL5A 2J9CA 4RL1A 4DF8A 4A47A 1H0HB 4DG1A 2JRSA 2X3GA 5DLFA 4GMKA 3G71S 1U2FA 2W2PP 3BBFA 2EI5A 4MK7A 1HMVA 3M2VB 3EX7B 2HNZA 2Y1JA 4V19X 1IKYB 4L74A 4OZ1A 3ZZRA 1VK3A 1SPBP 3AA8A 3BYPA 2ZH3A 2CPIA 1TK0A 2IYIA 4DV3J 2B8QA 3TUPA 3JXOA 2H9ZA 4DJBA 1FRKA 4DS5A 5HAOA 3NKYA 1UVLA 1FTCA 2CPHA 1VQYA 1HYSB 1D0EA 5I4MA 4KIAA 3LWMA 4IH7A 4OLOA 1HWLA 3HHLA 1S1VB 1S10A 3R7NB 3W1YC 2KYZA 3TARA 2C3PA 1W7WA 2L41A 1V5IB 1N48A 1M5PC 3Q8PB 1CS4A 2CPDA 1S7IA 1BQMB 2AGPA 4HT7A 2HZVA 4TLQA 3JTOA 3AQOA 1H7XA 3L9ZA 4I6YA 2HIQA 2Q43A 4YHHJ 4O4RA 1NKBA 4DFPA 1S77D 2HK3A 2UXDF 4ZLJA 3VVTA 1B99A 2Z0GA 2V34A 1VR6A 4UZCA 3QSIA 2G2YA 3CCZA 4BWJA 1VQ8S 2E9TA 2FGOA 2IDLA 4NWBA 2M2BA 3E51A 2CPZA 3EMTA 3RJMB 2IM2A 2MZRA 3DLBA 3K5OA 4K4VA 4DL7A 5KFJA 5C5JA 2R2SA 4DX7A 1JLEA 1K44A 3ZTOA 2B9EA 1NZ8A 3IBCB 5I3UA 4I67A 5HVFA 2QO3A 2R4FA 3D0GE 1M1GA 2I1RA 3K2YA 4DV1J 3GLJA 3H2UB 2YKAA 1VDHA 5AXMA 2QL5B 1KS2A 5J2PA 3LF0A 4TNOA 4Z7YA 4DV5F 4DR4J 2CZVC 2OPPA 4C8MA 1VBKA 3ISND 1MU2A 4KB7A 3G82A 1IR0A 1JLBB 4X64J 5HLFB 1N36J 3FUYA 3MPWA 1N5SA 2IIHA 2ZE2B 3G6VA 4HH1A 1JLGB 2P5VA 4DBQA 2IAJA 3TAPA 3X3UA 4OI6A 1RQ0A 3R7SB 1N33J 1UW9A 1TTHB 2Q1LA 4H4KA 1XTZA 3PKMA 3P3DA 1UWBA 4OI3A 5C25B 4IO9Q 5KFMA 2BMBA 2O1PA 3CD0A 4KJIA 2EFVA 1RWKB 3LUYA 2G4BA 4LR9A 1JNRB 2HNDB 2H1YA 1R8BA 4DR1F 1WTBA 1ZAVA 1TVRB 3T5HA 2DITA 4HACB 3WIVA 5EGYA 2FQQB 1UVIA 2YPYA 5FLXU 4NYOA 4USJC 1RTIB 1R89A 4CLZA 2CPXA 3C6TB 1UFKA 2DO0A 1HBNA 2J6SA 1UA0A 4M5GA 2K1RA 2RU3A 2XSFA 4DCOB 3ENQA 2MJNA 1NKCA 5L39A 1X4BA 1NU4A 2CG8A 1HFEL 1U0HA 4OYXA 1NSPA 3W64A 2C42A 3DDNA 3S8SA 2A10A 3RRGA 4UOFA 3GFZA 2M0GB 3AXMA 3ILLA 3T19A 1RBOB 4YDXA 2KI2A 4QU7A 2VD3A 3MM6A 2OI2A 1SV5A 3C3LA 3FZ2A 3IS9A 2DRDA 1UJ5A 4LF4F 2ZNZA 4DQPA 2J9EA 5SZTA 2BR0A 2J7KA 5T14A 4AE5A 3N5BA 1B4SA 1TAQA 4PWDA 2HG4A 5HSPA 4DV7F 1K73T 3CMAS 2CPEA 4MYUA 1CC7A 4JV2A 3PYGA 1PYOB 4ECUA 4N5SA 3TJ9A 4ZPAA 2ZH9A 2YNIA 5IS2A 3LALA 4ED8A 5KG5A 4RNHA 1ZH5A 2E66A 2IJFA 1LK7A 3ENWA 4W90B 5I3QA 1D9FA 2Z30B 1IKVA 2RS8A 3PCOB 5KFPA 2XMWA 1QAJA 1OWXA 4IDKB 4C8YA 4F7VA 3A8IA 2Y3YA 3FQLA 4EK2A 1LW2A 1E6VA 4HHJA 4J9QA 2DBBA 3P8BB 2XHWA 4LSZB 2CNOB 1WOSA 3GIRA 4NA3A 1KD1T 1UMJA 3L3CA 5HBMA 2AEFA 2CQIA 4KPYA 3KUHA 1Q8BA 4C8LA 4X62F 3J81Y 2WONA 2F4VF 1TUVA 1CVJA 3EYZA 3ELHA 1LWEA 2HVEA 3M2UA 5KFIA 3JB9k 3HP6A 4DR6F 3DDKA 2ILYA 3WX4A 1P6TA 5DLGA 2UUCJ 2HURA 3K5LA 3SCJE 2E44A 3PVXA 3V6DA 1HPZB 3MMBA 4RNFA 2UXCF 2JEGA 4LFBJ 1BUXA 1BXNA 3AD8C 2GVZA 2YTCA 1GK8A 2Y1LB 4RUHA 1AYEA 2HS4A 2HFSA 2R7RA 1F9HA 3ITHB 2EWHA 3DOMB 2WOMB 2CWKA 3T5LA 1Y3JA 1OYDA 1OY6A 5KFDA 1UJ6A 1WD6A 4F4AA 1BWEA 4OMFG 4Y2IA 1KBRA 5F8GA 3ZNJ1 2QA4G 2VONA 3CDWA 4J37A 1G2EA 1ZPVA 1N32J 2VQFJ 4FXVA 4A8YA 3CO0P 4CRJA 2KZZA 2OUGA 1FF2A 1VQ7S 4LRDA 2BX6A 5A76A 2DK2A 1IBLJ 4U96A 4UZBA 4DL0C 1U8SA 3ZO7A 2IPOB 1V9OA 4A8KA 1W25A 2EVZA 3TEHB 2XCAA 4GKKJ 1YRXA 2Z56B 5ETTA 4DUTA 1ZPWX 2JC0A 1PGZA 1A6LA 4JI2F 3DHWC 4G3IA 2B5JB 1YTYA 4NLWA 1RAEB 2W4DA 1BD6A 2WRMA 4N77A 5IOLA 5ETOA 2HGMA 3D6TB 3C19A 3HSDA 2VQEJ 3I55S 2M8DB 4F36A 2HS0A 1A7GE 1KHVA 1YJRA 3TA2A 4DPUA 4QWEA 1ROFA 3QO9A 4WTOB 1SQEA 3VQSA 4DZDA 1SCJB 2W7AA 3MD1A 2BQRA 5LJ5Y 3HHEA 3H90A 1EETB 2VC0A 4ZP8A 1WKLA 1TV6A 1T3OA 2CA9A 3VZHA 4LF9J 2CQPA 4L75A 4DR3F 2VG5B 2PSZA 1S0NA 2IFXA 4DL6A 1AROP 3NGDA 4DR7F 1UVKA 3E01B 1F3FA 2HHHF 5GMKa 2CDQA 2JNJA 3K0JA 4B9NA 5BYQA 1UZHA 4HYKA 2DNYA 2A1BA 1FKOB 2E7WA 5J2NA 3HZGA 4XK8C 3HM9A 2R2RA 2ZH4A 2IC3B 3FCWA 3WDOA 3JSMB 3V4IB 1U1QA 1OYEA 4CLSA 1X4CA 3LP0A 1JLCA 4KY3A 3GIIA 5FDLA 1M90T 1UEUA 3LAKA 2DRBA 2RILA 4P71A 3R7BB 4JV5J 3F0NA 1U6ZA 1VQMS 1YKWA 1REVA 4WKRA 4LFCJ 2XMJA 2P6SA 3VV2B 5B0FA 4OZLA 4ZCLA 4JI3F 3TO8A 1LFWA 1S4EA 1MNEA 4NLQA 3V5RA 1T3NA 2MZSA 3SI8A 2MLYA 3RBZA 5AE1A 4Q7AA 4OLPA 1S9EB 2XTJP 2ZKTA 3CSKA 2ZDOA 1HL6A 1IQTA 5C24B 2XO6A 1FJ7A 4N56A 2QLJB 2RT3A 4F02A 2DT9A 1WC3A 2ZJRQ 3PZPA 3KJQB 3I0RB 4O3SA 1GTEA 1RYSA 2GO9A 4KGXB 3NOCA 3QLHA 5GAGU 3OPKA 3W60A 1KQSR 3FVYA 3QIPB 3R2CJ 1U1MA 3OJUA 2E29A 2QA1A 3CJQA 1FEHA 3KDOA 1F9FA 3I4HX 4Q5VA 5E7OB 4BWMA 5IM0B 3R1LA 2B0GA 2E5JA 2J7WA 1IKXA 3WHIA 4WZQA 4ZPBA 2W4CA 2J9DA 1NM2A 4O0IA 1ZYQA 1CULA 5E5NA 4FPRA 5A2QY 5CH7B 2ZNYA 3IP0A 3A3NB 2FLLA 4DL3A 4EYHB 4AYBD 4FNIA 3J80Y 2HFOA 1VGYA 1MWYA 1NJXA 4CYUB 4DQIA 3OV7A 3T5JA 1KOHA 1R8AA 2HAIA 2PC6A 3QGIA 4LSLB 2AGQA 1SJRA 2FPHX 5DRKA 2ASYA 2BE9B 4Q44A 5L8RC 3AOAA 1F1BB 4FVMA 1VHFA 1YJVA 3ZTRA 1VJWA 2XHCA 2N3LA 4PYAA 3TI0A 2F3JA 1OQ6A 2KHDA 2FYXA 3CC4S 2UU9F 3AJ2A 2G13A 4USKA 4KV8B 2BOAA 2VFSA 1FKAF 4IFYB 1EKSA 2B6AA 2V0NA 4USHA 4K4XA 3Q2SC 2PDAA 2OEMA 2AJ1A 3BGOP 1N5VA 1HNIB 3TZWA 2WB4A 4CQ1A 1G1XA 3BBBA 1TL3B 5KG1A 1FCAA 1AXQA 3KLHB 1HNXF 1VIXA 1NJYA 4KGVB 3KLFA 4O3QA 2XY6A 3R3TA 1WC5A 3EPIA 1F5CA 5ETVA 4TVAB 1SJFA 1QTNB 2HFVA 4I6WA 1AUDA 2DTJA 2PD1A 5KFBA 1GH8A 3D0IE 3EICA 1S6OA 4HTIA 4OX8A 4NI2B 3K5MA 3N6LA 3D3CJ 3A8KA 1PJ5A 3JQMA 2DIVA 3KK1B 3HMJG 3KJVB 4KBIA 4MIAA 1LXJA 3M7VA 5AXKA 1XJWB 1RA6A 3K8WA 2EKYA 3KHHA 1VC6A 2DHXA 3N9UC 1RT2B 2FZKB 3LP2B 3S1TA 1SJQA 1P1TA 4K4UA 3TZXA 2UUBF 3CULA 3GG1A 3N4WA 3G96A 3Q0AA 2ZZNA 3RRKA 1U2RA 3DOLB 4Z37A 4FZVA 3OFEA 4CIOA 2IRUA 3NCRA 1PBUA 1T05A 1IVZA 3GFXA 2ROEA 1XMBA 1NDCA 3KLEA 4KHMA 2VODA 4YY3J 3MR3A 3TANA 1NRKA 4TY8A 2HNYA 1S6QB 2M8HA 2ZOGA 2VZ9A 2MLXA 1KC8T 2KVQE 3PFEA 3JSYA 2ZD1A 2YKNA 1VRTA 4ECVA 3R5BA 5ETPA 3OTBA 4JI0F 1MWZA 1KVIA 1RLDA 5KAKA 4WFXA 1PCAA 3T6BA 3RAXA 4QZVB 4DFKA 1RU2A 2O5DA 3G8QA 4X65F 3AY0A 1TKTA 3IBFB 2W9BB 5KFSA 3RR7A 4RPFA 1URNA 1FE4A 5D6GA 1XNQF 2IM3A 3M9NB 3BQ2A 2D41A 2G0CA 2V4JB 2WVBA 5B0BA 1YQHA 3EVMA 3WQPA 2KJVA 2R2TA 4DV0J 1KKHA 2MDAA 2KN4A 1T9XA 5A0YB 2B43A 2FJDB 3CJTA 1Q86T 2HYIB 4EGLA 4ED2A 5B08A 1TKDA 1NB7A 3QFWA 3MD3A 4USTA 1RT1B 1KN6A 2Q66A 2GJFA 1S1UA 2CJBA 1WHYA 5F9LA 4UOCA 5GAEU 2MSTA 2NREA 4FVCA 1T9VA 1QLNA 5GAGI 2WK4A 4NXMF 3J7YU 1N5YB 3C14B 3G8SA 2CPJA 4RWWA 2QT7A 2YNFB 3GE9A 3GJRB 1Y5LB 3MAQA 3MMCA 2X1FA 1G7CB 1RBLA 4P7TA 1RWUA 2VBWA 1TFYA 4ZPTR 5ETNA 5IT9U 3SFGA 2C1EB 2YX4A 2M4MA 1DRZA 3FSXA 4Y6IA 3B82A 1YVFA 4IO1A 4C4WA 3AB2B 4PXEA 3OXGA 1R31A 3ENAA 4P74A 3FDSA 4YMEA 2KRRA 1PYTA 4C0HA 2V9WA 4PQAA 2XSJA 3OLAA 1FHTA 4RUCA 4X4VA 2UP1A 2D3OR 4B9UA 2BJDA 1FESA 1UETA 3CC7S 3HPOA 4P2MA 3T1HF 1RGVA 4QQBA 5T7LA 3MEKA 4K4SA 2OPRB 2U1AA 1H3DA 4R5PB 2WSFC 3GQCA 1FA0A 3TNVA 1HWUA 4KFBB 1JK9B 3KKFA 3T3FA 3HJFA 4JI5F 4ITSA 5KFKA 4CWBA 5HVHA 2HQIA 5J1EA 1N0UA 3MPYA 1VRUB 4NXNF 3SCIE 2D3ZA 1VQ9S 3BO3A 1B7FA 3ADAC 1HKAA 4DX5A 1VQ6S 1SH2A 1BWVA 3I56S 2HQFA 4C6AA 1EIYB 3RBXA 3CDBA 1HHTP 1TL7A 5LOQA 4Q8EA 2DGWA 1M5VC 5J1PA 1I5OB 4M5KA 1KVKA 2OPQB 2QGFB 2E5HA 3BGRA 3CD6S 3V81A 5K20B 1FRIA 4M8LA 2GC8A 2FLOA 5D0HA 5A8WA 3R5JB 2E1CA 5L38A 3H7HB 1FJGF 1SH3A 5HQLA 2MGZA 4B9MA 4LBHA 5CZXA 1N34J 3NAIA 3QGGA 5IQQA 2ZBRA 2RQMA 1N5QA 3D0HE 2IBOA 5KFCA 1U8WA 5J2MB 5IWAF 4WFBQ 2C3YA 4OX9F 3C6UB 3M8RA 3D28A 5E33A 1VLOA 2LMIA 1GTHA 5K14B 1ZTTA 2YXLA 5KFGA 2ZHBA 1T9UA 1VQPS 4IG3B 1HBMA 1DQ8A 3DRPA 3VVUA 3R5GA 2ZOMA 1ZETA 2X1AA 3E8OA 1JKHB 4AUKA 3RR8A 1B7YB 3CXCR 1DTTA 3UR3C 1HNWF 3DRRA 1S9GA 3TVZA 4OZNA 2C2RA 2F9DA 4F2RA 3O44A 3QRQA 3HHNB 3PM9A 3GB0A 5KFAA 3QIDA 1PAUB 1R8HA 1APSA 4G6VB 2IM1A 2ASJA 4IG0A 4CTAA 3KUGA 3KHLA 3PYFA 5D3GA 3K5NA 1IJEB 2CIMA 2DCUB 2FHJA 2NPIA 4O3RA 4ECSA 4RW4B 5D4NA 1WUUA 3HZEA 4LF8F 4KC5A 4AQYJ 5IC6B 2C22A 4USWA 1RJJA 1NK4A 9ATCB 2VC1A 5D8HB 2R7OA 1RAIB 3PR5B 3IG1B 2V94A 5F3TA 2HHVA 2H3EB 4NCGA 3N28A 3O1LA 4M5DB 3ILOA 3HD2A 4NZ7A 4OI0A 3KYLA 4H4OB 3FRZA 9RUBA 3FGVA 4OYAA 1GMWA 3O5TB 3FBBA 4DPXA 4B3MF 3OBIA 4RBUA 1BGXT 4HR2A 1TQLA 5KG4A 3OR1B 2E1MC 4U7UD 1AA1B 1YRUA 3CO9A 4PRFA 2I8EA 1SKSA 2KDOA 3HK2A 4NOHA 4USVA 4DX8H 3V6HA 5KFVA 1N0VC 2COLA 4OL8A 3GZ7A 5HQMA 5HMWA 5KFNA 2I2YA 4RNNA 3KLGB 1UPMB 4YB1P 4CO1A 4I2QB 2AU0A 3NBPB 1J5OB 2F40A 1FXLA 2WVCA 1ACMB 3KK2B 3MM9A 3UVJA 4OZJA 2LXUA 3E3XA 3BGUA 1XK8A 2LQJA 2NXNA 2ALYB 1KLMA 4KH1B 1P8GA 3E2EA 1Y5IB 2DNOA 4DSIA 2UUAJ 2D3O1 2V69A 2ZOFA 3CCQS 2BJ1A 4RU9A 4PG7A 2VJVA 3FSIA 1HQEA 2MZ1A 4IRKA 4LFAF 4WXOA 4ZVHA 1N56A 2DNGA 3OFGA 2HNZB 4O44A 2HWIA 1DZ5A 2DHAA 4NZ0A 2ASDA 3C66A 3UNGC 2DHGA 3OTOF 2LA4A 7AT1B 3D1HA 1O5JA 1HHQA 1TMMA 3M1VB 3PDNA 1JXVA 2IVYA 2ZM6J 2V63A 4O4GB 2B4PA 4IUFA 1FNMA 1ZAXA 2CQCA 2KG1A 1ZM4A 3TX8A 3AD7C 3DHXA 2B7BB 4YFUA 2XGQA 3FK4A 3ZNUA 4P75A 1SUQA 5SUHA 2AJ0A 4BLGA 1Q7YT 3UW1A 2B9WA 1H72C 3UFCX 3H2LA 3UCZP 1DLOB 4B3RF 3GMGA 3T1YJ 1SIZA 1LWCA 5LMNJ 4QBUA 1C1CB 4ED1A 1ULRA 1H98A 1FJCA 1OSCA 2QFIA 3QNWB 4ED0A 3ET6B 1VFJA 1CLFA 4RW6A 2UVUA 3OL7A 2VDHA 2VIHA 5AJ3F 2K3IA 4QR1A 3SDEA 2I9SA 2BM1A 4CLUA 1S0MA 1BQNA 4Y65A 1GXTA 1CSJA 1KLNA 2BYCA 2RH3A 4YP3A 2V5HG 3Q22A 5D0GA 3NGKA 1OJ4A 2VG7A 2UXBJ 4PG8A 3HXMA 3C16A 2DNPA 2ZVSA 1RHMB 4KPCA 2EFGA 2J8AA 2Q6BA 2WTFA 2FDNA 4A8XA 5HMXA 3T9NA 1ZZNA 1NSKL 2W7PA 1XMOJ 3B4MA 4CO4A 2GVDA 4ZK7M 1C0TB 2HKEA 3CJ8A 4D3GA 2AQ4A 1QUVA 1YI2S 2EBEA 4GO5X 2RD5C 4WFNQ 2NYIA 4JI1J 2OLWA 4OZ5A 2ZH6A 2HVIA 2HRYA 4WTYA 3CDUA 2QIFA 2IJNA 2QL7B 5D0RA 4BC7A 4ES1A 1GX6A 2F63A 5LT5A 4DOZA 4QPTA 1VC0A 2E5LF 5C2GA 1EHWA 2E1PA 4QCLA 3W3SA 2KVIA 1SKWA 1J5EJ 4NASA 5KOXA 1MROB 3ENVA 3G82B 3L7OA 4KR0B 3DGPA 1SKUB 4MIBA 3H42A 1UFLA 3HJVA 4CLPA 3TUIC 1EARA 4NLYA 4N41A 4DL4A 3B6BA 3ZZOA 3PHTA 3W2WA 1WDDA 3CF5Q 5AE2A 3BGLA 1FJEB 2GMLA 2OHDA 4LJMA 4UQTA 3OR2A 1R0CB 3SFUA 1N88A 2FJAB 3VTIA 3OFFA 4U8VA 2FVSA 4LBPA 3UN3A 1NK0A 2HHUA 1NSQA 2B56A 1U47A 3MOJB 4MKAA 3HI9A 3W63A 2OEJA 3H20A 1OPZA 1RABB 4NPOA 4OHVA 1X4AA 3Q8RB 3CIMA 3CDEA 3I4PA 3I5BA 3UDEA 2HBYB 2CQ3A 4JI8F 1NJZA 1EKRA 1SQGA 1TK8A 2RRBA 2HMIA 2OTLS 1R3NA 1LQ9A 2WBRA 3CCMS 1TP7A 5LXRA 5D4LA 4PG4A 2QYCA 4ATNA 2W2MP 4RJVA 5M2RA 1FT8A 5LMUJ 4F25A 3FQKA 1TKZB 3MMAA 1NH7A 3V4MA 1OY8A 3EZUA 1U0HB 1WNEA 4JYAJ 1S1WA 2A0FB 3P96A 1HI8A 5EHHA 3G6XA 4QOTA 3I0SB 5JXSA 1FDNA 1WG4A 3HVTB 2Y0SD 1FWLA 4ZOSA 4XDCA 3FBCA 1RT4B 3RGIA 1KFDA 4DL2A 4RBVA 4R8UA 2DYAA 1Z2LA 1KP6A 2JOQA 1I94J 3BQ1A 4P52A 4RKUC 1JJ2R 2VBYA 2RKIA 4ALZA 3UNYA 3EVOA 4JBCA 2AJFE 3MM7B 1Z2ZA 4PZVA 3KLIA 1N6QA 1SXLA 1HR0F 2D7SA 1RHJB 5EX0A 2BKOA 4B9SA 2RJZA 4A8FA 2M3DA 2EFNA 3I9V9 3UD5A 1Q82T 2MXYA 1YGYA 4LRFA 1S6PA 2VU5A 4DX6A 3A8EA 3GPAA 1LW0A 3CCWA 5G0RB 3SQOP 3PW7A 3IRXA 4PWUA 5C7PA 1LEOA 4ECYA 2XI2A 3K59A 3IO1A 1ZOTA 2G0IA 1RXOB 5FJ4A 3TAMA 4NMLA 2HBQB 3GG0A 1LWFA 4LF7F 2XZWA 1IN0A 1CJVA 1EP4A 4WBFA 2YWHA 4ZHRA 1ZBTA 3J80U 1NK6A 3NMAA 2JLGA 4OHWA 3V6JA 1RE1B 1D9AA 2VL1A 1RWMB 4F3MA 5F41A 3C15B 1R0AA 2XY5A 3MECA 4WU3A 3W9IA 2WZ1A 2YWGA 5F8JA 2J5AA 5E2QA 1LXNA 5BJRA 1U1OA 3N6NA 1IR2A 2QLBB 4DR5J 1IBMF 1RP5A 2GA7A 5EX3A 1NDPA 3B4DA 2MZTA 3OTCA 2AV5A 1HNZJ 3SMZA 4Q0BB 3H40A 2RHSB 1RHKB 2HHTA 4UY8T 2FHKA 1NO8A 4GVLA 4B9LA 2P9EA 1DQ9A 2LDYA 3VGVA 5B09A 1JWWA 3FFIB 2RRAA 5H9FK 3W5XA 4A8OA 2F9JA 3MUMP 5KT4A 3RU0A 4QWBA 4EZ9A 1HYSA 3ZZTA 2LFVA 1NHKL 2GQ2A 1VHIA 1D8YA 4NCBA 3DNCA 2NR0A 2QV6A 4I4BA 4OHYA 3LAMA 4QYZK 4LMZA 1F3VA 3SQGA 1PILA 2YQ3A 3CCTA 3HSZA 2XCPA 3HVWA 1FFGB 5THWA 2H5JB 1X5OA 1BQMA 3CCRS 1CJKB 3VCDA 3RYLA 4C8NA 2R9LA 2AW0A 3BBCA 4Y0FA 4IR9A 1W2BR 4MKYA 2KXNB 2VBXA 2VDIA 1B0VA 1FD8A 2V2ZA 1YJ7A 3M8WA 2UVVA 4YN3B 5K8OA 2KO1A 2LU1A 4MK9A 4HHHA 1ZA1B 1QJHA 2O66A 2NUUG 4DWIA 2DGUA 1X7VA 4F4XA 1U09A 2R7UA 3EDQB 5B0EA 3QRPA 4YDDB 5IZHA 2Z8QA 5L1IA 5FD1A 4X4UA 2H4YB 1S0OA 4XAKA 1Q8KA 1MN9A 1VQLS 2CJQA 2NSBA 1UFWA 3ILJA 5T41A 2BJEA 1V5VA 2KL8A 4OYWA 4M95A 3IFEA 3FJ2A 2WVDA 4P10A 2ZDPA 1Q7LB 4NLTA 4OYIA 2Z57B 1G6BA 2XB2D 3MCMA 5DETA 4WIQA 4ZCMA 3M8YA 4DSLA 5E3CA 4G1PA 2CQDA 1IM4A 2XMVA 3LGNA 1VBXA 2L48A 2K06A 3HHLD 2YQ1A 2EG2A 5KT6A 2PMWA 2CADA 2OMOA 1G3OA 4P2SA 1RT6B 3MM5B 2BABA 1S5ZA 2Z2MA 3QRRA 2XS7A 3BQ0A 3UI3A 1YX2A 2GHVC 5DO2A 1JLBA 5C42B 3OW2R 2V68A 2ZE2A 5ETMA 3UE2A 4PAAA 5FDLB 1JLGA 2PA8D 4ZPDA 2GO8A 3EGWB 2OELA 4WP3A 1IBKF 2KXFA 3FKBA 4ED4A 1Q8LA 2M7SA 3UCGA 3OVSA 2RHQB 2Z4PA 4LRCA 4FF1A 4F8RA 1WSRA 1FDAA 1TK5A 3OT9A 2CYYA 5CYQA 3NMRA 4NA2A 2HNDA 1C0UB 1U2CA 1NKEA 1KDNA 1KFSA 3K58A 2EKNA 1TVRA 2VG6B 2G0JA 3D7SB 3GP9A 3CMES 3BKUA 1RHRB 4QJVA 1V3SA 5B0CA 3AOBA 3IR5B 1RTIA 2AZ3A 4UTGA 3IBWA 3IM9A 1CJUB 4RO0A 2VPXB 2M52A 3C6TA 1QSYA 4CLYA 4I69A 4DF4A 2MY8A 3DLHA 2GHWA 1K0TA 3ZFVA 3ZTQA 3BN7A 3MUVP 2DH7A 3C2PA 3Q24A 2E1AA 4RU2A 2E7XA 3BSNA 3VHQA 5ADZA 1S79A 1DAXA 1HWKA 3Q8UA 4DV6F 3PIOQ 3DI6B 1WOOA 3GU0A 3IR6B 3LQVA 1H38A 4PXCA 3DLEB 4C0BA 3F44A 5AXLA 4P73A 1ICEB 2V8PA 2XC9A 5B0AA 3IA0A 5L9NA 2B51A 2IY5B 2H4WB 5E3PA 1FI4A 1KR4A 2JWNA 1SL2A 4ZPCA 4Y28C 3KDNA 3TYTA 1WEYA 5GADU 1YIJS 2HLUA 2D1CA 3CCUS 3TX0A 2XLIA 3RB4A 3IC1A 4J9LA 2IVMA 3TEGA 3FBEA 4J9MA 1UVMA 3SSQA 4EO6A 3CUNA 1YJTA 1FK9B 3SIPB 2HHPA 1I6JA 2UXDJ 1XR6A 3O8WA 1XN9A 4HTJA 3DCAA 2CVIA 4KTQA 1GQEA 4ZVRB 2ZH2A 3ETMA 1WSVA 4H4MA 4LF5F 2PI5A 4U9RA 4J9KA 4ZVOB 4LVOP 3PTWA 4JB8B 1CQNA 4WFYA 3HLUA 3D2WA 3N79A 1H74A 1XC9A 4ECWA 4L72B 1BY9A 2PMHA 1VS3A 4XIUA 2XZDB 5DQIA 4K5RA 4CNZA 3CPWR 2FC9A 3GYGA 1DTQB 5HO4A 1HPZA 1D09B 1RAFB 2XLJA 4TQRA 2CVEA 2NSCA 1NPKA 3D4JA 2RDIA 3AJDA 4QIWD 1YSJA 4CH7A 4DV5J 4ES2A 4Y34A 2X51A 5KFTA 2MQMA 5IFMA 2I5JB 1NK8A 3ITHA 2A2DA 3DOMA 2WOMA 2GS8A 2PEHA 4M63A 1RDRA 3GYXB 3W9JA 3QBCA 4FXDA 4P9SA 4DU7A 4KKOA 3UN5A 1U48A 2IRXA 3D67A 5ITHA 2F5GA 3CNQP 2RRNA 3QT5A 4ZN1A 2OPSB 3R6LB 4WKYA 3BDPA 4KSEB 2EK6A 3ZZUA 4ECXA 4DN0A 1ZZFA 1SC1B 2HVZA 3VAKA 4QYRA 5H9FJ 1TFWA 2WW4A 3CJ0A 4OV6A 2ZD1B 2YKNB 4DR1J 1VRTB 3BM7A 3RAMA 4DMZA 2B5JA 4HI1A 1A9NB 4WXWA 1KNZA 3OHBA 2NS1B 4QYZJ 3DLJA 2HWTA 3U1NA 5A8KB 3BGFA 2YQ0A 3GCWP 4AL5A 2H5EA 2NUHA 1ELOA 2DXDA 3NGSA 3Q8SB 2UUWA 1VCTA 5F9NA 3PW0A 4X4RA 1U45A 2B4VA 3K5PA 3PHEA 4AL7A 4RW9A 1I3OB 1TZ0A 3TRGA 1OY9A 3MM8A 4WJBA 3HHKA 3DMJB 2AHOB 4FPIA 2XYHB 3HVAA 1Q16B 3HCXA 1YDLA 1EETA 1T0TV 4QWAA 2QL9B 5KFHA 3KJFB 3CCJS 4ZP6A 1HQ2A 3JTNA 3R2DJ 3WZ0A 3QFHA 4G1QB 1Q95G 1KRPA 4FBTA 3UD4P 3JS9A 3JTPA 4ANEA 1RB0A 1D9DA 4JI6F 1VOMA 2WAQD 3E01A 4LF4J 2DR9A 3G8TA 1M5KC 4FYXB 4DUZF 4DR2F 3Q8QB 2RVJA 1KVJA 1FKOA 2G1HA 1HQUA 1HNVB 3HULA 4WCEQ 2ATLA 1QE1B 4WP8A 4B3OB 4CLTA 4DV7J 1NZAA 2JJ4D 2IC3A 1VC5A 1AFIA 2LU2A 2W01A 3U1MA 2JH3A 2AYEA 3V4IA 3CT9A 4ED5A 5EWGA 4OZ2A 3MR2A 2R7WA 2ZH5A 5EDWA 3GR0A 2DNQA 1SJ1A 4K0KF 1H2TZ 2G1DA 4C9DA 2MY7A 2DR7A 3NNAA 3ZXWA 2XS2A 2RMLA 4LBIA 4LIRA 4IRCA 3EGNA 5GADI 3OL9A 1RAHB 5T7LB 2DXEA 2RAQA 4X62J 2F4VJ 4OJ1A 5GAHU 1S9EA 4TU8A 4DR6J 5C24A 1SVDA 5HP1A 5J1EB 4PQUB 2IMOA 4YR3A 5FIIA 4NYPA 3TOQA 2UXCJ 1FRXA 4ZLLA 3L4BC 4LSNB 4CO0A 1DJ0A 2LLZA 4IFVB 3NLCA 2FZCB 4FF4A 3TR5A 1NDLA 3LGMA 2DVIA 2LEBA 1TL7B 1S0VA 2C3UA 2AEMA 2JZ5A 2ZITA 5IM0A 3DFEA 4GRSA 1OS5A 5LSOA 4UW2A 4RLEA 2YPZA 5J2QB 3BH7B 1TR0A 2MQLA 3RAQA 2MLZA 5DG9A 1U6FA 4JV1A 5HK4A 4GVBA 1RWVB 3D5MA 3K17A 3DLLQ 2FHMA 1UL3A 4I1TA 4LSLA 4DCJB 4OFZA 1IM6A 1D1UA 4ZVFA 2K2PA 3TZZA 3QT7A 2J0WA 5ETSA 2JEJA 4PYDA 4FYYB 4JI2J 1UWAA 1WJ9A 1FXRA 4UOGA 3NOGA 1RAJA 1F5BA 3I5AA 3FSYA 5L1JA 2J76E 4KV8A 2KXHA 3M6XA 3A4TA 2HHXA 4WP9A 4IFYA 3ICLA 4K4ZA 2HIYA 5BYSA 1K1SA 4Q8FA 5DDQC 3D1OA 4CLLA 1HW8A 2IMWP 2BQUA 4G1IA 3QPIA 3D3BJ 1HNIA 4LF6F 1FWKA 4MT1A 4EUVA 1EX8A 1TL3A 1S9GB 2J0SD 1WC0A 3FEZA 3PX4A 4ZIWA 4M5MA 3R9LA 3MEEB 3UR0A 2LYVA 4NLXA 1SB6A 3C8YA 4R0JA 2K8GA 1KEKA 1P9QC 5I42B 2BJ9A 3JAMY 2F8EX 4X4NA 4DR3J 3W2VB 3VQTA 4OIXA 4RW8B 1WC4A 2AZ1A 1KTVA 4EFAC 5AE3A 1HWJA 4U7UK 4HL9A 4CZCA 4NI2A 4DR7J 2QLFB 3ULHA 2KM8B 4F3OA 5KFOA 2HHHJ 5IT4A 4CLFA 3PJXA 3V2UC 3CD5A 5E3AA 2C3OA 4C11B 3KJVA 2KT5A 5DGBA 1GNKA 2IBKA 1NHUA 1GXLA 3PFOA 2MKCA 3L09A 4DSKA 3M32A 1NK7A 1PSDA 3EGVA 1Y00A 2FTRA 4RNOA 3GFHA 1PAEX 2RU9A 1RT2A 4TKTA 2VKZG 4XTTA 3LP2A 1YZ6A 1HBOB 4ZVGA 2GIFA 3GTYX 4Y2CA 2L3MA 2XMKA 1HD0A 4NA1A 4PEOA 3DOLA 2QZ8A 1FDBA 3RB0A 1IUJA 3TW0A 3FBFA 3I87A 1JX4A 3AFGA 1XNRF 3N01A 1QSSA 4JI3J 2FHOB 2ZEJA 1IR1A 1BE4A 2D69A 1KHWA 1RTDB 1X5PA 1LK5A 4RW7B 1S7HA 3DYAB 1LWXA 1S6QA 2ASLA 5JUMA 2R7VA 2V8VA 2J6TA 2FVCA 1U1PA 1RT3B 3QGPA 2IDEA 2B8PA 4YOEA 2RDJA 2KRBA 2R8JA 3H59A 3NNHA 5BR8F 3IXQA 3EPGA 2WW8A 1RZMA 3W5ZA 4DUYF 2CFXA 4KQZA 2W9BA 3HDSA 5KG3A 5HL7Q 3ONQA 5HROA 4JI4F 5F3ZA 5LM7E 4PABA 5ETRA 3IGNA 2V4JA 4MFBB 1JIHA 5KOWA 1WWHA 2BRKA 1QM9A 5A0YA 4CCHA 1RWNB 4FYWB 5GAHI 1N8RT 2XWXA 1HQEB 2RS2A 2G2OA 4Q2MA 4TU7A 4I2PB 4N8OA 1OPIA 2X1GA 2GX8A 4J9OA 2POKA 1NJIT 1X31C 4YB7A 2DGTA 3OFHA 4TYBA 3AHPA 4RR5A 1XMQF 2PT0A 4JYAF 3CD7A 2PE8A 1N5YA 3MCNA 3C14A 1RU1A 4B08A 5B7WA 1VBYA 1DURA 4ZJOA 2MKHA 2YNFA 1JLQA 1FWPA 3H0PA 2XQCA 2ZUAA 1RCXB 1RAAB 3M2RB 3FEYB 2UU9J 2LDIA 3MF5A 1RT7A 3VGUA 4DSEA 5LSLA 3M6UA 3CTRA 2HHWA 4FKYA 3Q8VA 2PIIA 1WI6A 1X4FA 1RCOB 4OJHA 1TL1B 1FX2A 1VQKS 4A8WA 3WX8A 4PG5A 3T6JA 4PG6A 2R8HA 1FVSA 1P1LA 3R97A 2Y0BB 3OHAA 2KKHA 4X4QA 4EO8A 1G4CA 3NWGA 4EEYA 5MAOA 2XO7A 3WC0A 4XPEA 2LXFA 1BQNB 2E5GA 2B9YA 4RX6A 1HNXJ 4B9TA 2QC3A 4E2FB 4L3NA 4JI7F 5LL6d 4DPYA 2OPRA 2XULA 4R5PA 3BYRA 3C16B 4KFBA 4WU2A 4C0OC 4OJ3A 3HFZB 4X4TA 1NLKL 3MHYA 1X9SA 4K4YA 5EN1A 2HRUA 5E3QA 3DRSB 3KG4A 2HQGA 3FNNA 3P5TL 3A12A 1VRUA 2FJBB 4KGKA 4B3TF 4ZVSB 4IH6A 3EZOA 1TKXB 2MTLA 5DGAA 4DDFA 1N52B 3QWPA 2QLXA 3ZZZA 4W92B 4ERDA 4CT9A 3MEGA 2OH2A 3D6MB 5G4DA 5KT5A 2EEYA 3J7ZT 3Q23A 1JLAB 2UUBJ 2GAGC 1URRA 4DR5F 5BYRA 2OPQA 3FZBA 1RTJA 2W9AA 4WIIA 3OUYB 3HHDA 4EI2A 1M1HA 2HQCA 3CEDA 2CQ0A 4ZJLA 5HANA 3AA9A 5KFFA 3I32A 4RWXA 2ZBCA 1T7PA 3QSYB 1R0BG 4ZVQB 4ZVUB 3DGPB 5D15A 2AP6A 3J81j 5J2MA 3MPVA 4ID5A 3QGHA 3MAAB 2YNGB 2HHQA 2K3KA 4I7FB 4JI0J 4DN9A 3BR8A 3W2WB 1RKIA 3G9CA 2HQ3A 2VJUA 2RF2B 3U7JA 4DHVA 4X65J 1RTHB 2BVZA 3DOKA 4B3SF 3M6VA 3BB5A 4URQU 4IG3A 2AT1B 3D9BA 1SJ4P 1EJ7L 3JYTB 5CYMB 2RUGA 1XNQJ 1JKHA 3PNIA 3FCVA 2VB6A 1C2PA 5DM6Q 2F8MA 4C3KA 3PRVA 2RDDA 1CQMA 5CABA 8AT1B 2QJ3A 4MTPA 1UW4A 2W2NP 4PXDA 2GW8A 2OFHX 2XY7A 3CB4A 4X66F 1T95A 4ZVPB 2N7CA 3BS9A 4K2XA 3ZZYA 3K8VA 2CQGA 2EK1A 1NAQA 3LTOA 4NXMJ 5K8NA 4M1KA 2Q79A 4RW4A 3LANA 3BSOA 3BKTA 3S6EA 3CJKB 4FP9A 2DRAA 3GWCA 2ZFHA 4OQJA 3GONA 4CO5A 2RKIB 6AT1B 2XBPA 1B70B 5DG7A 1PKUA 5F0WA 2SXLA 1ZA2B 2GGPA 3CVKA 2NCKL 1WF1A 4UQGA 4M5DA 1RISA 4LF1A 2IRYA 4M5HA 2VFRA 4ETXA 3B54A 2YWWA 3ISNC 6FDRA 4ELUA 4KO0B 4H4OA 2EG1A 2FVPA 3CJSA 5DQGA 5CA5A 3OSNA 2Z2ZA 4AD6A 3DRXA 4OI4A 3MEDB 8RUCA 1DFDA 1AT1B 5CCLA 3T1HJ 3NS6A 2MQQA 1M5HA 2KU7A 2HAFA 4DV4F 4WK3A 4E98A 2ZC3A 2PEBA 3THPA 2LXIA 4L73A 2BDPA 5KFYA 3BKFA 4DV2J 5K9FA 2HWHA 4JI5J 2VUGA 3P45B 4ZHRB 1LOUA 4JOUA 4NXNJ 4TQSA 3KLGA 2EC2A 3DLGB 1FRLA 2LKZA 2XYPB 4I2QA 3AODA 2W2QP 2RUSA 1X0PA 2FHJD 1Y4ZB 3KK2A 5DG8A 1NH8A 3FEXB 1F2HA 1FRHA 2GJIA 1W26A 3PR4A 3LP1B 3O3LA 2OSQA 2KZMA 2ACMA 4HHUA 3PRBA 2KG0A 5HJYA 1YJ9S 3AJ1A 4HH0A 2YWEA 3N0VA 4NLGA 1X5SA 5H1SV 2DIUA 4KHRA 2FJXA 1VRQC 5I3PA 4X84A 1FJGJ 1T9YA 5M2PA 1VMBA 4QW9A 1GMWD 4KHPF 2Q6CA 3M1VA 2P9GA 2DGSA 5IWAJ 3Q2TC 2XMMA 3NGRA 4O4GA 2ZHAA 1Y3KA 4J9NA 4OX9J 2ERRA 4HVZA 1FTRA 5F8HA 2YWFA 3RBDA 2JFDA 3R5DA 1UZDA 1IBCB 5GMEA 4DPTA 4S0MA 1S76D 4OI2A 1L3UA 2W9CB 1DLOA 2JEFA 3SQGB 4WYWA 1OMSA 3RBEA 3SCKE 1C1CA 2CNLB 2C2EA 4YQWA 3POTA 4TLRA 3ET6A 4DEZA 1WC6A 2OSRA 2IHR1 3W65A 4NLVA 2VHGA 1PIEA 4ILMA 1QY7A 4K59A 1NCLA 2DH8A 3G86A 5CHCB 3JQJA 1HNWJ 1GX5A 3K89A 4GKJF 5DM7Q 1HBUB 5D4OA 4PR6A 2CZ9A 3T5KA 4KE5A 1XQIA 2GCFA 5HMYA 1VYAA 4Y2AA 4ICLB 1RT5B 1JXEA 2JSXA 1D8ZA 3TJAA 4F4WA 1MSWD 3CIZA 3PO5A 4X2BA 1M5SA 2MQPA 4WE1A 2LECA 3NNCA 3BZQA 4USUA 1UEKA 4FNHA 2MMYA 2QTWA 4BS2A 2VFVA 3VAHA 4XPCA 3R6GB 3PXGa 1C0TA 3CE8A 4BCAA 3QZ8A 5CCMA 5L9XA 2MHNA 4LF8J 2WVFA 4ES3A 1VK8A 4QIEA 1AZSB 1RWWB 3NCPA 1SC3B 5KT3A 1XEZA 1T11A 4CH1A 3TUJC 3RW6A 5LXYA 2ZZMA 2QFJA 1V6HA 1RA7A 2PGCA 1H2VZ 3A13A 3IMQJ 1UJ4A 1YHQS 2RE1A 4MYTA 4AT1B 4RZRA 4MKVA 3ETOA 3PW5A 4ZCKA 2DO4A 2RIJA 1M1KT 4MJKA 4PXBA 4HEA9 4B3MJ 2QN6B 3GJSB 2DY1A 1RWPB 3Q86A 1Y5NB 1MROA 2J6UA 4AXIA 4KGZB 2D74B 2GMJA 2DEJA 1NPRA 4TU9A 1MMLA 4W4MA 2JVRA 2NXJA 4CI0B 2YNHA 2ZJPQ 5CZVA 2OJ3A 5D0EA 1SKRA 3MI7X 3OQ2A 3UD3P 2R7XA 2Z2YB 4DI6A 4IH5A 2R3VA 2BM0A 3IRWP 4U6PA 3GSIA 2EXUA 2B4OA 4M94A 5CYQB 3HO1A 4QIFA 1S1TB 3VAIA 2W25A 3M8QA 4DQRA 3BR9A 3MZIA 4A4JA 3HSGA 1MG7A 2LCWA 3M9MB 2VASA 1UP1A 3M9OB 2G2ZA 2CJKA 3W61A 2BE2B 1VQNS 4W98A 4F67A 2BW7A 4KAIA 5ETLA 4HLBA 2C2OB 4LFAJ 5KFZA 4DV3F 3QT8A 1S72S 3US5A 3VF0B 1FNXH 3PJ9A 2XWYA 4F2SA 1L5UA 1X0FA 4UT4A 4Q43A 3OTOJ 1TKZA 2XS5A 5L46A 4IYQA 1LV5A 3DM2B 2M5YA 3MPUB 3I0SA 1E6YA 2MQ8A 4CLWA 4EMDA 3HVTA 1RHQB 3EUNA 1RT4A 4FS2A 2OAUA 4WF9Q 2VA2A 3PX6A 4YHHF 1FDDA 2CPFA 1IKWA 3J7AN 3NEKA 2QSWA 3F56A 4B3RJ 3TWZA 1CJTB 3MM7A 1UEVA 4ILLA 4QPXA 2O01C 1JLFB 3G2XA 2GHPA 2PA3A 1K9MT 1PC5A 4ZIVA 3CJ2A 5E41A 5AJ3J 2HGLA 1F60B 5G0RA 1U49A 4K4WA 5A8RB 3KK3B 1UCNA 4P2XA 1K0VA 4MIWA 4NZ6A 1U1LA 3M30B 4H4MB 3KXDA 3SXLA 2KYXA 3BSCA 1O8BA 5A6PA 1UTAA 4YB5A 5IV3A 1S1XB 4D3HA 4DV1F 3M8PB 2W24A 3BPSP 2C2NA 4TY9A 5AT1B 3KUEA 2D9OA 2MPUA 3C15A 2KFZA 1GEHA 2AYMA 3R27A 1OSDA 4DR4F 2YKMB 3KTQA 5DQHA 2QEXS 2GIRA 1X4EA 3V6KA 2N4DA 2CG4A 4HT5A 4X64F 2MKYA 1N36F 4WFAQ 1TUGB 2A3JA 2QMWA 2NXCA 4I0WA 2LQ5A 3D1QA 2E5LJ 1C1BB 1W2IA 1N33F 1RTZA 3J7A1 3I6PA 4J5OA 2EFOA 5IC4B 4Q0BA 4YB6A 1RBAA 2Q3PA 3PY8A 3LO3A 1Q8IA 3Q8YA 2FY8A 4E0DA 4FBUA 3MCOA 4KKOB 3D6HB 5CAAA 3SEOA 1SQFA 2BOPA 3FCHA 4NE9C 3SV4A 1T03B 2OP5A 3FFIA 4IOAQ 4BC9A 3DLKA 5K8PA 3QMQA 5DS7A 2B4UA 3PEHA 1ZM2A 7FDRA 3MAHA 4L3KA 1O51A 2DGOA 3JAMU 4JP8A 5AXNA 4R0EA 1U24A 2J0XA 4BBYA 2JDJA 1Y0HA 4DG1B 2XZTB 5ETQA 2D9PA 1TU0B 1DHMA 3GJQB 5HMZA 3HX9A 2V2VA 1UVNA 4ED7A 1SBRA 4EBEA 1CJKA 1S12A 1HMVB 3G87A 4TN2A 3BH6B 2KH9A 2ZZTA 2X1BA 1NJWA 4JI8J 4MAKA 1AFJA 4N8NA 3HT3A 1V3ZA 4CM0A 3U1LA 1UA1A 3J81U 3KHRA 4PPDA 3VWSA 4RW9B 3UDVA 2HS3A 2YX7A 3PW2A 5C2CA 2C2KB 2V67A 3MM8B 2BXJA 3IAM9 4J90A 1JJHA 3GYNA 3HHLB 2FGCA 4BDPA 2ZC4A 1JJ4A 4M5JA 2DNLA 1CS4B 5CD4H 2V6AA 4ZITA 1NPPA 1RWOB 1F2GA 1S97A 2H48B 4F26A 4PPZA 1NB2A 2HHSA 1QDUB 2DJWA 2GNKA 3DKDA 1R6VA 4FKXA 1HR0J 1SL0A 3SYZA 4ECRA 1HQUB 4ZS6A 4CLKA 4Y3CA 5DZ7A 3BV8A 5KT7A 1GMVA 2FC8A 1RT6A 3MM5A 2DGXA 1XBWA 1H73A 3DU6A 4ZP9A 5C42A 2KM8C 4P6QA 2FLPA 4F4KA 2AGOA 3MOZA 2Z2LA 3G6YA 2XNRA 2LQ8A 4LT6A 4ANDA 4ER8A 4ENOA 4IR1A 4LF7J 1JLEB 3KNAA 3A8JA 3THTA 3PV8A 1Q4RA 2ADBA 4RUBA 3I82A 1YLXA 3OLBA 3SBMA 1X9MA 5I3UB 3TQ1A 1T94A 3BJYA 2UUCF 3CJ5A 3RRHA 1FKPA 4OV1A 2XLKA 2K7JA 4J9SA 4LFBF 4DSJA 3LOUA 2CAJA 1C0UA 5J2PB 3BSAA 2C2MB 3M8SA 1K8AT 2PN6A 1P27B 2VG6A 2AJQA 1MLAA 2OPPB 3OJSA 2NYHA 4ELVA 3W62A 5HP1B 2OKQA 1HWIA 1MU2B 1LFPA 3H5SA 2HLTA 4NLSA 4J9RA 5HQ8A 1SC4B 1F6TA 2CQBA 5HJXA 2XG8A 4OI1A 1IBMJ 2HGNA 2IAJB 1CJUA 1QD1A 4UY85 1Q0NA 4N47A 4DPOA 3AAWB 3GCXP 1N32F 2VQFF 2H5IB 2ACYA 3M05A 5IT0A 3PKYA 1HLWA 2XYGB 1YBAA 3DGVA 4B9VA 1SI9A 1RYRA 4Z7CA 4ECTA 1UWBB 1IBLF 1OIAA 1WHXA 3LPYA 4PUOA 2MEWA 3JQKA 3TA1A 3TP2A 1T02A 1YBUA 3SCLE 4OZ0A 4GKKF 5L1KA 3DI6A 2JX2A 4GVBB 1MW7A 2QRRA 3DLEA 1GFWB 2EPIA 2IA0A 3OD2A 3WIUA 1RUSA 4OYPA 2OD4A 2VOOA 3LWLA 1S4FA 2NLWA 1WACA 2LVWA 3VR1A 1HW9A 3DDIA 2ZBPA 2VQEF 4CNYA 1HBNB 1WEXA 3BF4A 2BRLA 2K1RB 3AQPA 1R43A 2KHCA 3CC2S 3NXZA 3G6ES 4NX9A 3U02A 3W7BA 4ZKAA 3L95X 2DNNA 2DGVA 4ED3A 2JLEA 1RADB 2OFGX 4DQQA 4O23A 1FK9A 3EDRB 2IM0A 1WTFA 1DQAA 1Q79A 1X4DA 3MM6B 4LF9F 1SV5B 3FMWA 4DQSA 3IS9B 1NK5A 5EWFA 2P2CB 4USMA 1L3SA 1RI7A 3THVA 3FRYA 2DB1A 3D68A 3P4UB 1IQZA 2JC1A 2HEKA 1U1NA 5CXTA 3T9ZA 1PBAA 2J7UA 2BJ8A 3L7PA 3BO4A 1R8CA 4I6AA 4PWDB 2HSEB 5KG6A 3M6WA 4OYMA 3CJ4A 2YNIB 1NK9A 2R8GA 4FS1A 1RAGB 1VI7A 3MR7A 1DTQA 1YZ7A 2FJVA 1IKVB 5H9EK 4I56A 3M32B 4F04B 3MCSA 3NP5A 1WI8A 4JV5F 5A2QU 5GVQA 2ROGA 2I5JA 1LW2B 1E6VB 2HPUA 3EWGA 4LFCF 2DPJA 4ID8A 4WK1A 3GV5B 2XMAA 3NS5A 4H54A 1Z1ZA 2MJUA 1WC1A 5HBMB 2EFQA 4O0NA 1S6UA 3S01A 2ROPA 2WONB 2C28A 1PO6A 1Y7PA 3KG0A 2OPSA 1LWEB 2H51B 3M2UB 2QSFA 3VAJA 1IBKJ 3DN9A 2GZOA 2BANA 4O3NA 4CM2A 2J8SA 4QIGA 1RKJA 4BHQA 3PIPQ 2BA9A 3N6MA 2XNQA 5IV4A 1VJQA 4YR2A 3V6DB 3C46A 3MMBB 3PG9A 4LVNP 4RUAA 3KG1A 2JHEA 2L9DA 2VICA 1FE0A 1AUSL 1IWGA 2GVZB 4EU0A 1A0OB 1GT8A 4USIA 1PJ7A 2ZBIA 3MUTP 5A6WA 4C97A 4FDFA 3CJRA 3QJLA 3M2VA 1IKYA 2CQ1A 5A8KA 3EVWA 3B78A 1S48A 1EQ0A 5KG0A 1Q78A 1LKZA 1Q81T 2KTQA 4L6V3 1MMDA 3CJ3A 2I6WA 5HROB 3A3PB 3MPDA 3Q89A 4X4SA 2FVRA 2NZ4A 2P6TA 1YRTA 3MR6A 4K2JA 3O2IA 3DMJA 1FEEA 1S1VA 1VQ5S 3OVBA 2QA2A 4NLOA 3PW4A 5HN0A 1RK8A 2MKIA 2F8HA 4DV6J 4R25A 2RB7A 1JXLA 2UV8A 1QAXA 5KT2A 5KTQA 3KWMA 1VQSA 4NRUA 4G1QA 1HI1A 2ZH1A 1F5AA 1NMEB 5IQ6A 1QAIA 4NCAA 2N82B 4E8UA 2WB1D 3R8YA 1H6KX 2AJ2A 1X4HA 1U1KA 4DZ6A 2DPIA 2FD2A 4LIWA 4KYZA 5MLCV 4Q2LA 1JLQB 1NXIA 1Q1KA 3M8ZA 1OQ3A 2GFFA 4J91A 4C8OA 1HNVA 1QE1A 4OYZA 4B3OA 1QSLA 4EZ6A 4WWSA 1LNQA 2HFUA 1RT7B 2IA6A 2OO4A 3QO9B 3GFYA 3IWLA 4UOHA 5JVHQ 2J9DE 2CZ4A 2HQDA 5IXUA 2FVQA 2LA6A 1QUPA 3UQSA 5DZ6A 1YBTA 1CC8A 3I31A 1TV6B 3R5AA 2OGUA 2YBVA 3OXLA 3NCQA 3G4SS 4LF5J 2WSEC 3KFWX 4MH8A 2XM3A 1VISA 2L9NA 2DNRA 4GC6A 4M5NA 2BKNA 3UDLA 3H98A 2DY9A 1H2UX 1X60A 5KFUA 5J2NB 2PMZD 1YJWS 3GR1A 3H25A 1YJUA 2Y9HA 2ZJQQ 4DV2F 2QLWA 2LEAA 5U47A 2A18A 3CDAA 3EGZA 4PQUA 1S59A 3HF5A 1RAOA 1REGX 3LP0B 1JLCB 3TUZC 5HLFA 3BREA 1UAWA 4LSNA 1WKKA 3UCUP 3GJTB 4AXJA 4IFVA 2IVFB 2MSSA 1Y10A 2QE5A 1REVB 1R8PA 4K8RA 1AW0A 1BHNA 3MEGB 3H8YA 2FB0A 3UDCA 2H65B 2KT3A 3OSPA 1WORA 1DBDA 4WYLA 4YY3F 2V8HA 5C25A 4NLRA 1RTJB 1TELA 2R2UA 4DLGA 5J2QA 4YS2A 2GQQA 4B17A 4QWCA 3K57A 3QAUA 1FXDA 2MHEA 3TVYA 3RB3A 2OEKA 3CWJA 4X4OA 4HACA 1X9WA 1K1QA 2GV1A 1D3WA 4P72A 2CNNB 3TQEA 4YR0A 4LREA 1H7WA 3KJNB 4OHXA 3GIMA 4ILRA 5B0GA 3MGJA 1KQGB 5D78A 2KFNA 4ID5B 2V8GA 3QLHB 2CWXA 3U27A 3ILIA 1N54B 4P2FA 1T8EA 2E5IA 4F0HA 3EM1A 4DV0F 4N76A 5E3RA 4UF4A 2AX1A 2K7KA 3DOKB 4B02A 2NZCA 1I1GA 4C98A 1IKXB 2X3DA 1CULB 4LQ9A 1SC6A 3HSJA 3NWRA 4CO3A 3VZIA 1L3VA 3NGUA 3LPEA 3HD1A 1FD2A 1Y11A 2GIQA 1U6BA 1FNOA 2DR5A 1IXKA 2NXEA 4RBTA 3NAHA 1NHVA 2I38A 3EXYA 4FYDA 4M5IA 3UN2A 3MEEA 1SIWB 1R6YA 2JL9A 1WHVA 5I42A 2H54B 1EAYC 2FY1A 2F4FA 3W2VA 1Z4UA 4RW8A 5RUBA 3EZ5A 4QIVA 1U0SA 1FRMA 3W8GA 4JI6J 2F7VA 3IWXA 2BBEA 4DUZJ 4DR2J 4K50A 2B6AB 3HKWA 4C11A 1J2VA 2WHOA 3TJ8A 5DDPC 3H4DA 2RSQA 3NRBA 4KH0B 4IDKA 3QT6A 1YK9A 4CH0S 4OHZA 3NGTA 4OX7A 2APOA 1HBOA 1R7IA 1O0PA 1I51B 2JEIA 5H9EJ 2GGPB 3KLFB 3H5UA 4WFZA 4F3QA 2BV3A 4K0KJ 1UKUA 2YVSA 5GAEI 4FXWA 3T1AA 3HKZD 3KHGA 3D54A 4ZVEA 5BXIA 3QZ7A 3W9HA 2M9KA 3J7YI 3GV8B 1RWXB 2MKJA 3CCSS 3BPDA 3M4XA 1PYSB 2AWZA 1QVFR 4RNMA 1RTDA 3DU5A 2HVHA 2R8IA 4ZMMA 4RW7A 3O6QA 3DYAA 4DS4A 3AD9C 2BZ2A 3SSRA 2BE7D 1XWLA 1PG5B 1MMNA 2CJXB 2JFKA 1FRJA 4C48A 1RT3A 1RSCA 4UUXA 4LR8A 3LA0A 1BMQB 1VIOA 1UVJA 2ZWPA 2CQ4A 4LRBA 3H5YA 1O6XA 2XMUA 4DLEA 4AL6A 3IN5A 1NBEB 4MFBA 3BO2A 1FO1A 1T05B 3KLEB 1R27B 2NXUA 1N34F 1HA1A 3CMQA 3UO0A 4JV0A 2NQPA 5F8LA 2XGPA 4TY8B 2HNYB 2HRTA 4Z2XA 4ZLNA 2VOPA 4K5SA 3AOCA 2JLFA 4ZJQA 2DH9A 4FF2A 4I2PA 4NEYA 3IM8A 3AXKA 3DRYA 2WVEA 2B3TB 2IJRA 2OMLA 3GIJA 4KRWA 1K47A 1TKTB 1KQKA 2E9RX 2ILZA 3MMJA 3RW7A 1HIYA 3X1LB 5LJ3Y 1EQMA 3PYDA 4FYVB 2AJ4A 3K7RA 1TAUA 1PC4A 2DHHA 1EZZB 2QMXA 2WSCC 2GMHA 3M2RA 3DXBA 2N3OA 3RB6A 2FLNA 2Y8YA 2FJWA 2DGQA 2HFZA 2YH0A 4MMOA 4U8YA 4XDDA 2RQCA 1X8DA 2B7CB 1TL1A 4A8QA 4NRTA 3P5BP 3POTB 1S49A 2LP4A 4ZA1A 3VALA 5D4PA 4F4ZA 1HI0P 1QVGR 4LRAA 2EBGA 4FF3A 3QYYA 4DFMA 2YWKA 3MR5A 1S1UB 4CP5A 4LF2A 2VG5A 7FD1A 4LF6J 3ZZ0A 3VGTA 4OJGA 1U1RA 4LUBA 2R7SA 2R7TA 5D77A 2VA3A 3PO4A 4YUDA 2KJWA 4U67Q 3MMCB 2YKQA 1AB8A 3IR7B 1JB0C 4AQYF 4WE1B 2MKKA 5FLXY 2ZHOA 3JSMA 2G9OA 3LW5C 3P6YC 5K8MA 3DRSA 1N5TA 4P7VA 1WF0A 2DXFA 4ZCIA 2BKPA 5HVGA 1TKXA 2C2ZB 2HW3A 3PJWA 5JJBA 4OYOA 3Q83A 2XSJB 5J1NA 2CDRB 2XMTA 4Y2MA 4EWTA 1JQGA 2AKWB 1JLAA 3UPFA 2R8KA 2CQHA 5KG2A 4C8KA 3PEJA 3OUYA 4ANCA 3BDEA 4NEZA 1JJCB 3EE3A 3MWBA 2L9WA 2VH7A 4UUWA 4A8MP 1XNRJ 2BACA 1TUWA 2AD9A 2JVOA 3I0RA 4EBDA 3NL0A 4V1Ak 4PWWA 3MAAA 2YNHB 2YNGA 3IAS9 2DISA 5EUHA 4I7FA 3QIPA 3MFIA 1U4BA 4C3MA 3F73A 4K7QA 2PO4A 2GQCA 4OYBA 2RF2A 3N5FA 3AT1B 4DL5A 2AIRB 5BR8J 3JSRA 2UUAF 2V2QA 3CW2C 4DUYJ 5ETKA 1RTHA 5KFLA 3R1HA 2VKRA 3BGRB 1Q53A 3V81B 4U95A 2WBMA 3DC2A 2VFUA 5L1LA 3M8QB 3JYTA 5CYMA 4JI4J 2J0QD 2MKSA 1QAYA 1TL4A 5A8WB 4F4YA 4MK8A 5CQGA 2MQOA 3D66A 3A1YG 2VV5A 5F0UA 1T9WA 2DR8A 2MGZB 1X5TA 4CYUA 5K5MA 1KONA 1CEZA 5JVGQ 1VQ4S 1Q5VA 2ZM6F 4IOCQ 4NMXA 1BQXA 1IJFB 5KFRA 2DNHA 2KFYA 2C2DA 1CBKA 1IWAA 6FD1A 5JMNA 2V8DA 4J7CA 4C8ZA 2AEJA 4KT0C 1FFSB 1C4CA 1XMQJ 2HVDA 1NUEA 3OVAA 2E9ZA 1F0XA 2KT2A 2N7YA 3T1YF 5LMNF 1HBMB 3DRPB 1KQFB 1E6YB 3W5YA 4ZP7A 1GMUA 5KFEA 4A48A 4PKDB 2X7IA 4IQXA 1T9TA 3CJKA 2ZVIA 2MZQA 2I0XA 5KFQA 1J27A 4C3LA 4ZDNA 3EXCX 2N4CA 3JSBA 2AYGA 5EWEA 2ZBQA 1RACB 4ZPVR 1IKWB 1DTTB 3DRRB 2PI4A 3KLHA 2QMUB 3HHLC 4ED6A 3FC9A 2CJAA 2DNMA 1MN7A 2UXBF 4IKAA 2W8LA 4KO0A 2EW9A 3RUBL 8ATCB 4IG0B 2QYGA 4CTAB 4CT8A 3B8HA 5D3GB 2P8IA 1EB0A 3TA0A 4CO2A 3AH6A 3OL8A 3WBZA 3MEDA 3KNGA 1HD1A 3GSDA 2UVRA 1XMOF 2W4PA 4JI7J 3KK1A 3PYEA 1B3TA 1YWXA 2E7VA 2HBRB 2CKWA 4NYZA 2FUG9 3MTJA 4OZ3A 2AYBA 3L7UA 1ZTWA 2V9KA 4JUZA 4FN5A 2V4RA 4JI1F 3D6FB 4G65A 1WKJA 4DSFA 4L76A 2HZAA 2XI3A 4U7CA 4NCGB 4B3TJ 2MB0B 3DLGA 2YY3A 3J7Z5 2PFDA 2HZCA 4F0KA 2AX0A 3ZZPA 4AFFA 3ZTSA 4N7TA 5LSRA 1J5EF 1KTQA 4TYAA 3RZAA 4CDIA 1OO0B 1YITS 1WG1A 2DR6A 2CNKB 4Y00A 4DCPB 3LP1A 3WC2A 4ZLPA 1B64A 2Y1RI 5DDOC 4WZMA 4J9VA 2ADCA 2M70A 5F8NA 2GAHC 4TXSA 3PRDA 4URGA 2ZWOA 1WG5A 1XR7A 1P9YA 2BJ3A 2DD8S 4MKBA 2CJ9A 3VAFA 2BQ3A 4HI2A 2CPYA 4F0MA 3MM9B 3DLKB 3UVJB 2O67A 1YG0A 3GILA 2RNEA 1KLMB 3RTVA 2ZUGA 4H4KC 2B9XA 4ECQA 2KB2A 2W9CA 4B3SJ 1NEEA 4URSA 1QTMA 3CCES 1KSPA 3VGSA 3W8PA 3OL6A 3R5CA 3H4BA 2CRLA 1XERA 1WDTA 3P49B 2DHSA 2MQNA 4O44B 5DDRC 4EYIB 1RT1A 4LQ3A 3ISZA 4ETZA 1S57A 5LMUF 4HKQA 2ZKUA 2L08A 4EBCA 1FVQA 2YKOA 3OXFA 3QWUA 1U25A 3W66A 2FIUA 1HBUA 3MFHA 4Q45A 2Y8WA 3DXSX 5HATA 4ICLA 3OTEA 1RT5A 1VQOS 4X66J 2AMCB 3GV7B 2BUNA 2HFNA 4V19J 2E1RA 2CQ2A 1WOPA 1SUQB 1I94F 3IWNC 2W2OP 3I9ZA 2CJYB 5M2UA 2QA4S 1JMTA 2LQ9A 1M5OC 1S9FA 1LWCB 2F1FA 2VPZB 4RW6B 3BEGB 2AF6A 3EJMA 1AZSA 4IRDA 2OD6A 3SDEB 4WPAA 1V3RA 1C4AA 2ZH7A 5CD4A 2GJ2A 2VF3A 3IGVA 2P9CA 3CGIA 3KMSA 1Q5YA 2D3UA 4HDHA 1YJNS 1UPPA 1U02A 2PFFB 2BW2A 2VG7B 1L3TA 3AB4B 4O3OA 4ZN3A 3BN4A 3H5XA 1GAOA 3CCVS 2DCLA 4I64A 3QATA 2GVDB 1ZM3A 4DV4J 5KG7A 2QG9B 3VAGA 3MURP 2BEFA 2W7OA 1WEZA 2W8KA 2UZAA 1BLUA 1XIQA 1VBZA 1U26A 1ZM9A 3I5CA 2IYGA 3LH2S 2V4QA 4QR2A 1CG2A 2XEXA 1FX4A 1SL1A 1CPZA 1X4GA 1FERA 1FKPB 1NSAA 3HFKA 4ECZA 2WCXA 5B0DA 1ITPA 4J9PA 2M88A 3HT0A 1S1TA 2FJEB 1L3KA 1F9EB
chains in the Genus database with same CATH topology
4DV5J 2UUAJ 1XNQJ 4KY3A 5LM7E 4DV0J 1IBMJ 3IMQJ 4JI4J 4X64J 2UXDJ 1N36J 2UUBJ 1HNZJ 5A2QU 5AJ3J 4JI8J 4JV5J 4HHUA 1J5EJ 2E5LJ 1HNWJ 3D3BJ 4LFAJ 4B3MJ 4LFCJ 4RJVA 4K0KJ 5LMUJ 1N32J 2VQFJ 1N33J 3J81U 2UXBJ 4DV3J 1HNXJ 4LF6J 4GKJJ 4NEZA 1N34J 3T1HJ 4YY3J 1FJGJ 4JYAJ 4JI3J 2MEWA 4LF5J 4LF7J 4LF9J 1XNRJ 3OTOJ 1IBKJ 4NEYA 1IBLJ 4X66J 2ZM6J 4JI7J 2KVQE 4DV6J 4X62J 3J80U 4DV4J 1XMOJ 2F4VJ 3R2DJ 4DR3J 5IWAJ 4KHPJ 4DV2J 4GKKJ 3D3CJ 2MQ8A 4NXMJ 3W1YC 2KL8A 4OX9J 4V1Ak 4PWWA 3JAMU 4JI5J 1XMQJ 4JI0J 4DR6J 4DR7J 1I94J 2UUCJ 2HHHJ 4DR1J 4LF4J 4AQYJ 4JI2J 5IT9U 4DV1J 4NXNJ 4JI6J 4LFBJ 4LF8J 5FLXU 3T1YJ 4X65J 5LMNJ 4DUZJ 4DR2J 2MTLA 3J7AN 2UXCJ 4KYZA 2UU9J 4JI1J 4B3TJ 4YHHJ 5BR8J 4B3RJ 4DV7J 4DUYJ 4DR5J 3R2CJ 4DR4J 2VQEJ 4B3SJ 1HR0J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 J;  2UUA J;  1XNQ J;  4KY3 A;  5LM7 E;  4DV0 J;  1IBM J;  3IMQ J;  4JI4 J;  4X64 J;  2UXD J;  1N36 J;  2UUB J;  1HNZ J;  5A2Q U;  5AJ3 J;  4JI8 J;  4JV5 J;  4HHU A;  1J5E J;  2E5L J;  1HNW J;  3D3B J;  4LFA J;  4B3M J;  4LFC J;  4RJV A;  4K0K J;  5LMU J;  1N32 J;  2VQF J;  1N33 J;  3J81 U;  2UXB J;  4DV3 J;  1HNX J;  4LF6 J;  4GKJ J;  4NEZ A;  1N34 J;  3T1H J;  4YY3 J;  1FJG J;  4JYA J;  4JI3 J;  2MEW A;  4LF5 J;  4LF7 J;  4LF9 J;  1XNR J;  3OTO J;  1IBK J;  4NEY A;  1IBL J;  4X66 J;  2ZM6 J;  4JI7 J;  2KVQ E;  4DV6 J;  4X62 J;  3J80 U;  4DV4 J;  1XMO J;  2F4V J;  3R2D J;  4DR3 J;  5IWA J;  4KHP J;  4DV2 J;  4GKK J;  3D3C J;  2MQ8 A;  4NXM J;  3W1Y C;  2KL8 A;  4OX9 J;  4V1A k;  4PWW A;  3JAM U;  4JI5 J;  1XMQ J;  4JI0 J;  4DR6 J;  4DR7 J;  1I94 J;  2UUC J;  2HHH J;  4DR1 J;  4LF4 J;  4AQY J;  4JI2 J;  5IT9 U;  4DV1 J;  4NXN J;  4JI6 J;  4LFB J;  4LF8 J;  5FLX U;  3T1Y J;  4X65 J;  5LMN J;  4DUZ J;  4DR2 J;  2MTL A;  3J7A N;  2UXC J;  4KYZ A;  2UU9 J;  4JI1 J;  4B3T J;  4YHH J;  5BR8 J;  4B3R J;  4DV7 J;  4DUY J;  4DR5 J;  3R2C J;  4DR4 J;  2VQE J;  4B3S J;  1HR0 J; 
#chains in the Genus database with same CATH topology
 1WF2 A;  4A46 A;  3OTD A;  4IOB A;  2UUT A;  1SH0 A;  1HNZ F;  4QU6 A;  2NPF A;  4GO7 X;  2CUY A;  2ALZ A;  4X4P A;  2V50 A;  2BE2 A;  3RG6 A;  3SV3 A;  1RHU B;  2R7Q A;  4HDG A;  1XR5 A;  3MTK A;  3F41 A;  1ZAW A;  4K4T A;  1HAR A;  3ZC4 A;  3SSS A;  2Z58 B;  2FZG B;  3C6U A;  4A8S A;  2LQB A;  2A2C A;  2RQK A;  3TAQ A;  3NS7 B;  1DAR A;  2O3D A;  1M0S A;  1U7L A;  5K14 A;  2HK2 A;  3S7R A;  3NY0 A;  2YH1 A;  4I68 A;  4KHP J;  3QQC D;  4PUO B;  3OR2 B;  1WEL A;  3DM2 A;  4DU8 A;  1PJ6 A;  3T41 A;  2DKO B;  4YEA A;  3KOA A;  3QJJ A;  2YKP A;  3KMQ A;  1HHS A;  5DJB A;  1TMJ A;  2QX0 A;  3GIK A;  2VBZ A;  2VPW B;  5F8I A;  5CYJ A;  1B0T A;  2MZJ A;  3CCL S;  1DY3 A;  1Y9O A;  1CJT A;  1VLY A;  5GMD A;  2HMI B;  2R42 A;  2Y1I A;  2ATC B;  3HVR A;  1JLF A;  3PAC A;  4ZVT B;  2A6O A;  2ABY A;  1RLC L;  2UVW A;  2UV8 G;  2RQ4 A;  4C7Q A;  4XO0 A;  5F8M A;  3TZY A;  3MMA B;  2HBZ B;  4QWD A;  4DFJ A;  4ELT A;  1S1W B;  2YX1 A;  1B0P A;  4GKJ J;  5A8R A;  2ZH8 A;  3KK3 A;  3NG8 A;  3FMB A;  2W1B A;  3VAM A;  3ZTP A;  4OX6 A;  5HI7 A;  3LGH A;  1KWM A;  3TVK A;  3M30 A;  4R8U B;  1SJ3 P;  2EFP A;  4ZPW R;  3IG1 A;  2C3M A;  3KLI B;  1S1X A;  4NLD A;  1JNZ B;  3M8P A;  1N6Q B;  3MDF A;  1GXU A;  1MWQ A;  4J9U E;  4C2M A;  4KGM A;  2MYF A;  1S6P B;  1KOO A;  1LW0 B;  2YKM A;  2DEI A;  5KFW A;  4NLP A;  2OTJ S;  3IRX B;  2A6M A;  3I96 A;  2DNK A;  2V2K A;  4NLU A;  3MXH P;  3OR1 A;  4IQM A;  2VFT A;  4LR7 A;  4PCQ A;  4GC7 A;  4F50 A;  2DNZ A;  2F65 A;  3TAM B;  3A3O B;  3QAE A;  4O3P A;  1LWF B;  5KFX A;  1N4L A;  1TL5 A;  2OIH A;  1C1B A;  4DPW A;  1CJV B;  1NND A;  5E0O A;  1EP4 B;  3KLV A;  2VPY B;  2U2F A;  1BC6 A;  1ZS6 A;  2LEP A;  3QJP A;  3SZ2 A;  4QR0 A;  2BJ7 A;  3H2V E;  3PX0 A;  1FFW B;  2EC0 A;  1WHW A;  1T03 A;  3NBP A;  1R0A B;  1NDK A;  4DXL A;  1J5O A;  5IT9 Y;  1S99 A;  2BAN B;  3MEC B;  4QW8 A;  2CXE A;  4Y2K A;  3UWT A;  4M5L A;  3HFV A;  4NL5 A;  2J9C A;  4RL1 A;  4DF8 A;  4A47 A;  1H0H B;  4DG1 A;  2JRS A;  2X3G A;  5DLF A;  4GMK A;  3G71 S;  1U2F A;  2W2P P;  3BBF A;  2EI5 A;  4MK7 A;  1HMV A;  3M2V B;  3EX7 B;  2HNZ A;  2Y1J A;  4V19 X;  1IKY B;  4L74 A;  4OZ1 A;  3ZZR A;  1VK3 A;  1SPB P;  3AA8 A;  3BYP A;  2ZH3 A;  2CPI A;  1TK0 A;  2IYI A;  4DV3 J;  2B8Q A;  3TUP A;  3JXO A;  2H9Z A;  4DJB A;  1FRK A;  4DS5 A;  5HAO A;  3NKY A;  1UVL A;  1FTC A;  2CPH A;  1VQY A;  1HYS B;  1D0E A;  5I4M A;  4KIA A;  3LWM A;  4IH7 A;  4OLO A;  1HWL A;  3HHL A;  1S1V B;  1S10 A;  3R7N B;  3W1Y C;  2KYZ A;  3TAR A;  2C3P A;  1W7W A;  2L41 A;  1V5I B;  1N48 A;  1M5P C;  3Q8P B;  1CS4 A;  2CPD A;  1S7I A;  1BQM B;  2AGP A;  4HT7 A;  2HZV A;  4TLQ A;  3JTO A;  3AQO A;  1H7X A;  3L9Z A;  4I6Y A;  2HIQ A;  2Q43 A;  4YHH J;  4O4R A;  1NKB A;  4DFP A;  1S77 D;  2HK3 A;  2UXD F;  4ZLJ A;  3VVT A;  1B99 A;  2Z0G A;  2V34 A;  1VR6 A;  4UZC A;  3QSI A;  2G2Y A;  3CCZ A;  4BWJ A;  1VQ8 S;  2E9T A;  2FGO A;  2IDL A;  4NWB A;  2M2B A;  3E51 A;  2CPZ A;  3EMT A;  3RJM B;  2IM2 A;  2MZR A;  3DLB A;  3K5O A;  4K4V A;  4DL7 A;  5KFJ A;  5C5J A;  2R2S A;  4DX7 A;  1JLE A;  1K44 A;  3ZTO A;  2B9E A;  1NZ8 A;  3IBC B;  5I3U A;  4I67 A;  5HVF A;  2QO3 A;  2R4F A;  3D0G E;  1M1G A;  2I1R A;  3K2Y A;  4DV1 J;  3GLJ A;  3H2U B;  2YKA A;  1VDH A;  5AXM A;  2QL5 B;  1KS2 A;  5J2P A;  3LF0 A;  4TNO A;  4Z7Y A;  4DV5 F;  4DR4 J;  2CZV C;  2OPP A;  4C8M A;  1VBK A;  3ISN D;  1MU2 A;  4KB7 A;  3G82 A;  1IR0 A;  1JLB B;  4X64 J;  5HLF B;  1N36 J;  3FUY A;  3MPW A;  1N5S A;  2IIH A;  2ZE2 B;  3G6V A;  4HH1 A;  1JLG B;  2P5V A;  4DBQ A;  2IAJ A;  3TAP A;  3X3U A;  4OI6 A;  1RQ0 A;  3R7S B;  1N33 J;  1UW9 A;  1TTH B;  2Q1L A;  4H4K A;  1XTZ A;  3PKM A;  3P3D A;  1UWB A;  4OI3 A;  5C25 B;  4IO9 Q;  5KFM A;  2BMB A;  2O1P A;  3CD0 A;  4KJI A;  2EFV A;  1RWK B;  3LUY A;  2G4B A;  4LR9 A;  1JNR B;  2HND B;  2H1Y A;  1R8B A;  4DR1 F;  1WTB A;  1ZAV A;  1TVR B;  3T5H A;  2DIT A;  4HAC B;  3WIV A;  5EGY A;  2FQQ B;  1UVI A;  2YPY A;  5FLX U;  4NYO A;  4USJ C;  1RTI B;  1R89 A;  4CLZ A;  2CPX A;  3C6T B;  1UFK A;  2DO0 A;  1HBN A;  2J6S A;  1UA0 A;  4M5G A;  2K1R A;  2RU3 A;  2XSF A;  4DCO B;  3ENQ A;  2MJN A;  1NKC A;  5L39 A;  1X4B A;  1NU4 A;  2CG8 A;  1HFE L;  1U0H A;  4OYX A;  1NSP A;  3W64 A;  2C42 A;  3DDN A;  3S8S A;  2A10 A;  3RRG A;  4UOF A;  3GFZ A;  2M0G B;  3AXM A;  3ILL A;  3T19 A;  1RBO B;  4YDX A;  2KI2 A;  4QU7 A;  2VD3 A;  3MM6 A;  2OI2 A;  1SV5 A;  3C3L A;  3FZ2 A;  3IS9 A;  2DRD A;  1UJ5 A;  4LF4 F;  2ZNZ A;  4DQP A;  2J9E A;  5SZT A;  2BR0 A;  2J7K A;  5T14 A;  4AE5 A;  3N5B A;  1B4S A;  1TAQ A;  4PWD A;  2HG4 A;  5HSP A;  4DV7 F;  1K73 T;  3CMA S;  2CPE A;  4MYU A;  1CC7 A;  4JV2 A;  3PYG A;  1PYO B;  4ECU A;  4N5S A;  3TJ9 A;  4ZPA A;  2ZH9 A;  2YNI A;  5IS2 A;  3LAL A;  4ED8 A;  5KG5 A;  4RNH A;  1ZH5 A;  2E66 A;  2IJF A;  1LK7 A;  3ENW A;  4W90 B;  5I3Q A;  1D9F A;  2Z30 B;  1IKV A;  2RS8 A;  3PCO B;  5KFP A;  2XMW A;  1QAJ A;  1OWX A;  4IDK B;  4C8Y A;  4F7V A;  3A8I A;  2Y3Y A;  3FQL A;  4EK2 A;  1LW2 A;  1E6V A;  4HHJ A;  4J9Q A;  2DBB A;  3P8B B;  2XHW A;  4LSZ B;  2CNO B;  1WOS A;  3GIR A;  4NA3 A;  1KD1 T;  1UMJ A;  3L3C A;  5HBM A;  2AEF A;  2CQI A;  4KPY A;  3KUH A;  1Q8B A;  4C8L A;  4X62 F;  3J81 Y;  2WON A;  2F4V F;  1TUV A;  1CVJ A;  3EYZ A;  3ELH A;  1LWE A;  2HVE A;  3M2U A;  5KFI A;  3JB9 k;  3HP6 A;  4DR6 F;  3DDK A;  2ILY A;  3WX4 A;  1P6T A;  5DLG A;  2UUC J;  2HUR A;  3K5L A;  3SCJ E;  2E44 A;  3PVX A;  3V6D A;  1HPZ B;  3MMB A;  4RNF A;  2UXC F;  2JEG A;  4LFB J;  1BUX A;  1BXN A;  3AD8 C;  2GVZ A;  2YTC A;  1GK8 A;  2Y1L B;  4RUH A;  1AYE A;  2HS4 A;  2HFS A;  2R7R A;  1F9H A;  3ITH B;  2EWH A;  3DOM B;  2WOM B;  2CWK A;  3T5L A;  1Y3J A;  1OYD A;  1OY6 A;  5KFD A;  1UJ6 A;  1WD6 A;  4F4A A;  1BWE A;  4OMF G;  4Y2I A;  1KBR A;  5F8G A;  3ZNJ 1;  2QA4 G;  2VON A;  3CDW A;  4J37 A;  1G2E A;  1ZPV A;  1N32 J;  2VQF J;  4FXV A;  4A8Y A;  3CO0 P;  4CRJ A;  2KZZ A;  2OUG A;  1FF2 A;  1VQ7 S;  4LRD A;  2BX6 A;  5A76 A;  2DK2 A;  1IBL J;  4U96 A;  4UZB A;  4DL0 C;  1U8S A;  3ZO7 A;  2IPO B;  1V9O A;  4A8K A;  1W25 A;  2EVZ A;  3TEH B;  2XCA A;  4GKK J;  1YRX A;  2Z56 B;  5ETT A;  4DUT A;  1ZPW X;  2JC0 A;  1PGZ A;  1A6L A;  4JI2 F;  3DHW C;  4G3I A;  2B5J B;  1YTY A;  4NLW A;  1RAE B;  2W4D A;  1BD6 A;  2WRM A;  4N77 A;  5IOL A;  5ETO A;  2HGM A;  3D6T B;  3C19 A;  3HSD A;  2VQE J;  3I55 S;  2M8D B;  4F36 A;  2HS0 A;  1A7G E;  1KHV A;  1YJR A;  3TA2 A;  4DPU A;  4QWE A;  1ROF A;  3QO9 A;  4WTO B;  1SQE A;  3VQS A;  4DZD A;  1SCJ B;  2W7A A;  3MD1 A;  2BQR A;  5LJ5 Y;  3HHE A;  3H90 A;  1EET B;  2VC0 A;  4ZP8 A;  1WKL A;  1TV6 A;  1T3O A;  2CA9 A;  3VZH A;  4LF9 J;  2CQP A;  4L75 A;  4DR3 F;  2VG5 B;  2PSZ A;  1S0N A;  2IFX A;  4DL6 A;  1ARO P;  3NGD A;  4DR7 F;  1UVK A;  3E01 B;  1F3F A;  2HHH F;  5GMK a;  2CDQ A;  2JNJ A;  3K0J A;  4B9N A;  5BYQ A;  1UZH A;  4HYK A;  2DNY A;  2A1B A;  1FKO B;  2E7W A;  5J2N A;  3HZG A;  4XK8 C;  3HM9 A;  2R2R A;  2ZH4 A;  2IC3 B;  3FCW A;  3WDO A;  3JSM B;  3V4I B;  1U1Q A;  1OYE A;  4CLS A;  1X4C A;  3LP0 A;  1JLC A;  4KY3 A;  3GII A;  5FDL A;  1M90 T;  1UEU A;  3LAK A;  2DRB A;  2RIL A;  4P71 A;  3R7B B;  4JV5 J;  3F0N A;  1U6Z A;  1VQM S;  1YKW A;  1REV A;  4WKR A;  4LFC J;  2XMJ A;  2P6S A;  3VV2 B;  5B0F A;  4OZL A;  4ZCL A;  4JI3 F;  3TO8 A;  1LFW A;  1S4E A;  1MNE A;  4NLQ A;  3V5R A;  1T3N A;  2MZS A;  3SI8 A;  2MLY A;  3RBZ A;  5AE1 A;  4Q7A A;  4OLP A;  1S9E B;  2XTJ P;  2ZKT A;  3CSK A;  2ZDO A;  1HL6 A;  1IQT A;  5C24 B;  2XO6 A;  1FJ7 A;  4N56 A;  2QLJ B;  2RT3 A;  4F02 A;  2DT9 A;  1WC3 A;  2ZJR Q;  3PZP A;  3KJQ B;  3I0R B;  4O3S A;  1GTE A;  1RYS A;  2GO9 A;  4KGX B;  3NOC A;  3QLH A;  5GAG U;  3OPK A;  3W60 A;  1KQS R;  3FVY A;  3QIP B;  3R2C J;  1U1M A;  3OJU A;  2E29 A;  2QA1 A;  3CJQ A;  1FEH A;  3KDO A;  1F9F A;  3I4H X;  4Q5V A;  5E7O B;  4BWM A;  5IM0 B;  3R1L A;  2B0G A;  2E5J A;  2J7W A;  1IKX A;  3WHI A;  4WZQ A;  4ZPB A;  2W4C A;  2J9D A;  1NM2 A;  4O0I A;  1ZYQ A;  1CUL A;  5E5N A;  4FPR A;  5A2Q Y;  5CH7 B;  2ZNY A;  3IP0 A;  3A3N B;  2FLL A;  4DL3 A;  4EYH B;  4AYB D;  4FNI A;  3J80 Y;  2HFO A;  1VGY A;  1MWY A;  1NJX A;  4CYU B;  4DQI A;  3OV7 A;  3T5J A;  1KOH A;  1R8A A;  2HAI A;  2PC6 A;  3QGI A;  4LSL B;  2AGQ A;  1SJR A;  2FPH X;  5DRK A;  2ASY A;  2BE9 B;  4Q44 A;  5L8R C;  3AOA A;  1F1B B;  4FVM A;  1VHF A;  1YJV A;  3ZTR A;  1VJW A;  2XHC A;  2N3L A;  4PYA A;  3TI0 A;  2F3J A;  1OQ6 A;  2KHD A;  2FYX A;  3CC4 S;  2UU9 F;  3AJ2 A;  2G13 A;  4USK A;  4KV8 B;  2BOA A;  2VFS A;  1FKA F;  4IFY B;  1EKS A;  2B6A A;  2V0N A;  4USH A;  4K4X A;  3Q2S C;  2PDA A;  2OEM A;  2AJ1 A;  3BGO P;  1N5V A;  1HNI B;  3TZW A;  2WB4 A;  4CQ1 A;  1G1X A;  3BBB A;  1TL3 B;  5KG1 A;  1FCA A;  1AXQ A;  3KLH B;  1HNX F;  1VIX A;  1NJY A;  4KGV B;  3KLF A;  4O3Q A;  2XY6 A;  3R3T A;  1WC5 A;  3EPI A;  1F5C A;  5ETV A;  4TVA B;  1SJF A;  1QTN B;  2HFV A;  4I6W A;  1AUD A;  2DTJ A;  2PD1 A;  5KFB A;  1GH8 A;  3D0I E;  3EIC A;  1S6O A;  4HTI A;  4OX8 A;  4NI2 B;  3K5M A;  3N6L A;  3D3C J;  3A8K A;  1PJ5 A;  3JQM A;  2DIV A;  3KK1 B;  3HMJ G;  3KJV B;  4KBI A;  4MIA A;  1LXJ A;  3M7V A;  5AXK A;  1XJW B;  1RA6 A;  3K8W A;  2EKY A;  3KHH A;  1VC6 A;  2DHX A;  3N9U C;  1RT2 B;  2FZK B;  3LP2 B;  3S1T A;  1SJQ A;  1P1T A;  4K4U A;  3TZX A;  2UUB F;  3CUL A;  3GG1 A;  3N4W A;  3G96 A;  3Q0A A;  2ZZN A;  3RRK A;  1U2R A;  3DOL B;  4Z37 A;  4FZV A;  3OFE A;  4CIO A;  2IRU A;  3NCR A;  1PBU A;  1T05 A;  1IVZ A;  3GFX A;  2ROE A;  1XMB A;  1NDC A;  3KLE A;  4KHM A;  2VOD A;  4YY3 J;  3MR3 A;  3TAN A;  1NRK A;  4TY8 A;  2HNY A;  1S6Q B;  2M8H A;  2ZOG A;  2VZ9 A;  2MLX A;  1KC8 T;  2KVQ E;  3PFE A;  3JSY A;  2ZD1 A;  2YKN A;  1VRT A;  4ECV A;  3R5B A;  5ETP A;  3OTB A;  4JI0 F;  1MWZ A;  1KVI A;  1RLD A;  5KAK A;  4WFX A;  1PCA A;  3T6B A;  3RAX A;  4QZV B;  4DFK A;  1RU2 A;  2O5D A;  3G8Q A;  4X65 F;  3AY0 A;  1TKT A;  3IBF B;  2W9B B;  5KFS A;  3RR7 A;  4RPF A;  1URN A;  1FE4 A;  5D6G A;  1XNQ F;  2IM3 A;  3M9N B;  3BQ2 A;  2D41 A;  2G0C A;  2V4J B;  2WVB A;  5B0B A;  1YQH A;  3EVM A;  3WQP A;  2KJV A;  2R2T A;  4DV0 J;  1KKH A;  2MDA A;  2KN4 A;  1T9X A;  5A0Y B;  2B43 A;  2FJD B;  3CJT A;  1Q86 T;  2HYI B;  4EGL A;  4ED2 A;  5B08 A;  1TKD A;  1NB7 A;  3QFW A;  3MD3 A;  4UST A;  1RT1 B;  1KN6 A;  2Q66 A;  2GJF A;  1S1U A;  2CJB A;  1WHY A;  5F9L A;  4UOC A;  5GAE U;  2MST A;  2NRE A;  4FVC A;  1T9V A;  1QLN A;  5GAG I;  2WK4 A;  4NXM F;  3J7Y U;  1N5Y B;  3C14 B;  3G8S A;  2CPJ A;  4RWW A;  2QT7 A;  2YNF B;  3GE9 A;  3GJR B;  1Y5L B;  3MAQ A;  3MMC A;  2X1F A;  1G7C B;  1RBL A;  4P7T A;  1RWU A;  2VBW A;  1TFY A;  4ZPT R;  5ETN A;  5IT9 U;  3SFG A;  2C1E B;  2YX4 A;  2M4M A;  1DRZ A;  3FSX A;  4Y6I A;  3B82 A;  1YVF A;  4IO1 A;  4C4W A;  3AB2 B;  4PXE A;  3OXG A;  1R31 A;  3ENA A;  4P74 A;  3FDS A;  4YME A;  2KRR A;  1PYT A;  4C0H A;  2V9W A;  4PQA A;  2XSJ A;  3OLA A;  1FHT A;  4RUC A;  4X4V A;  2UP1 A;  2D3O R;  4B9U A;  2BJD A;  1FES A;  1UET A;  3CC7 S;  3HPO A;  4P2M A;  3T1H F;  1RGV A;  4QQB A;  5T7L A;  3MEK A;  4K4S A;  2OPR B;  2U1A A;  1H3D A;  4R5P B;  2WSF C;  3GQC A;  1FA0 A;  3TNV A;  1HWU A;  4KFB B;  1JK9 B;  3KKF A;  3T3F A;  3HJF A;  4JI5 F;  4ITS A;  5KFK A;  4CWB A;  5HVH A;  2HQI A;  5J1E A;  1N0U A;  3MPY A;  1VRU B;  4NXN F;  3SCI E;  2D3Z A;  1VQ9 S;  3BO3 A;  1B7F A;  3ADA C;  1HKA A;  4DX5 A;  1VQ6 S;  1SH2 A;  1BWV A;  3I56 S;  2HQF A;  4C6A A;  1EIY B;  3RBX A;  3CDB A;  1HHT P;  1TL7 A;  5LOQ A;  4Q8E A;  2DGW A;  1M5V C;  5J1P A;  1I5O B;  4M5K A;  1KVK A;  2OPQ B;  2QGF B;  2E5H A;  3BGR A;  3CD6 S;  3V81 A;  5K20 B;  1FRI A;  4M8L A;  2GC8 A;  2FLO A;  5D0H A;  5A8W A;  3R5J B;  2E1C A;  5L38 A;  3H7H B;  1FJG F;  1SH3 A;  5HQL A;  2MGZ A;  4B9M A;  4LBH A;  5CZX A;  1N34 J;  3NAI A;  3QGG A;  5IQQ A;  2ZBR A;  2RQM A;  1N5Q A;  3D0H E;  2IBO A;  5KFC A;  1U8W A;  5J2M B;  5IWA F;  4WFB Q;  2C3Y A;  4OX9 F;  3C6U B;  3M8R A;  3D28 A;  5E33 A;  1VLO A;  2LMI A;  1GTH A;  5K14 B;  1ZTT A;  2YXL A;  5KFG A;  2ZHB A;  1T9U A;  1VQP S;  4IG3 B;  1HBM A;  1DQ8 A;  3DRP A;  3VVU A;  3R5G A;  2ZOM A;  1ZET A;  2X1A A;  3E8O A;  1JKH B;  4AUK A;  3RR8 A;  1B7Y B;  3CXC R;  1DTT A;  3UR3 C;  1HNW F;  3DRR A;  1S9G A;  3TVZ A;  4OZN A;  2C2R A;  2F9D A;  4F2R A;  3O44 A;  3QRQ A;  3HHN B;  3PM9 A;  3GB0 A;  5KFA A;  3QID A;  1PAU B;  1R8H A;  1APS A;  4G6V B;  2IM1 A;  2ASJ A;  4IG0 A;  4CTA A;  3KUG A;  3KHL A;  3PYF A;  5D3G A;  3K5N A;  1IJE B;  2CIM A;  2DCU B;  2FHJ A;  2NPI A;  4O3R A;  4ECS A;  4RW4 B;  5D4N A;  1WUU A;  3HZE A;  4LF8 F;  4KC5 A;  4AQY J;  5IC6 B;  2C22 A;  4USW A;  1RJJ A;  1NK4 A;  9ATC B;  2VC1 A;  5D8H B;  2R7O A;  1RAI B;  3PR5 B;  3IG1 B;  2V94 A;  5F3T A;  2HHV A;  2H3E B;  4NCG A;  3N28 A;  3O1L A;  4M5D B;  3ILO A;  3HD2 A;  4NZ7 A;  4OI0 A;  3KYL A;  4H4O B;  3FRZ A;  9RUB A;  3FGV A;  4OYA A;  1GMW A;  3O5T B;  3FBB A;  4DPX A;  4B3M F;  3OBI A;  4RBU A;  1BGX T;  4HR2 A;  1TQL A;  5KG4 A;  3OR1 B;  2E1M C;  4U7U D;  1AA1 B;  1YRU A;  3CO9 A;  4PRF A;  2I8E A;  1SKS A;  2KDO A;  3HK2 A;  4NOH A;  4USV A;  4DX8 H;  3V6H A;  5KFV A;  1N0V C;  2COL A;  4OL8 A;  3GZ7 A;  5HQM A;  5HMW A;  5KFN A;  2I2Y A;  4RNN A;  3KLG B;  1UPM B;  4YB1 P;  4CO1 A;  4I2Q B;  2AU0 A;  3NBP B;  1J5O B;  2F40 A;  1FXL A;  2WVC A;  1ACM B;  3KK2 B;  3MM9 A;  3UVJ A;  4OZJ A;  2LXU A;  3E3X A;  3BGU A;  1XK8 A;  2LQJ A;  2NXN A;  2ALY B;  1KLM A;  4KH1 B;  1P8G A;  3E2E A;  1Y5I B;  2DNO A;  4DSI A;  2UUA J;  2D3O 1;  2V69 A;  2ZOF A;  3CCQ S;  2BJ1 A;  4RU9 A;  4PG7 A;  2VJV A;  3FSI A;  1HQE A;  2MZ1 A;  4IRK A;  4LFA F;  4WXO A;  4ZVH A;  1N56 A;  2DNG A;  3OFG A;  2HNZ B;  4O44 A;  2HWI A;  1DZ5 A;  2DHA A;  4NZ0 A;  2ASD A;  3C66 A;  3UNG C;  2DHG A;  3OTO F;  2LA4 A;  7AT1 B;  3D1H A;  1O5J A;  1HHQ A;  1TMM A;  3M1V B;  3PDN A;  1JXV A;  2IVY A;  2ZM6 J;  2V63 A;  4O4G B;  2B4P A;  4IUF A;  1FNM A;  1ZAX A;  2CQC A;  2KG1 A;  1ZM4 A;  3TX8 A;  3AD7 C;  3DHX A;  2B7B B;  4YFU A;  2XGQ A;  3FK4 A;  3ZNU A;  4P75 A;  1SUQ A;  5SUH A;  2AJ0 A;  4BLG A;  1Q7Y T;  3UW1 A;  2B9W A;  1H72 C;  3UFC X;  3H2L A;  3UCZ P;  1DLO B;  4B3R F;  3GMG A;  3T1Y J;  1SIZ A;  1LWC A;  5LMN J;  4QBU A;  1C1C B;  4ED1 A;  1ULR A;  1H98 A;  1FJC A;  1OSC A;  2QFI A;  3QNW B;  4ED0 A;  3ET6 B;  1VFJ A;  1CLF A;  4RW6 A;  2UVU A;  3OL7 A;  2VDH A;  2VIH A;  5AJ3 F;  2K3I A;  4QR1 A;  3SDE A;  2I9S A;  2BM1 A;  4CLU A;  1S0M A;  1BQN A;  4Y65 A;  1GXT A;  1CSJ A;  1KLN A;  2BYC A;  2RH3 A;  4YP3 A;  2V5H G;  3Q22 A;  5D0G A;  3NGK A;  1OJ4 A;  2VG7 A;  2UXB J;  4PG8 A;  3HXM A;  3C16 A;  2DNP A;  2ZVS A;  1RHM B;  4KPC A;  2EFG A;  2J8A A;  2Q6B A;  2WTF A;  2FDN A;  4A8X A;  5HMX A;  3T9N A;  1ZZN A;  1NSK L;  2W7P A;  1XMO J;  3B4M A;  4CO4 A;  2GVD A;  4ZK7 M;  1C0T B;  2HKE A;  3CJ8 A;  4D3G A;  2AQ4 A;  1QUV A;  1YI2 S;  2EBE A;  4GO5 X;  2RD5 C;  4WFN Q;  2NYI A;  4JI1 J;  2OLW A;  4OZ5 A;  2ZH6 A;  2HVI A;  2HRY A;  4WTY A;  3CDU A;  2QIF A;  2IJN A;  2QL7 B;  5D0R A;  4BC7 A;  4ES1 A;  1GX6 A;  2F63 A;  5LT5 A;  4DOZ A;  4QPT A;  1VC0 A;  2E5L F;  5C2G A;  1EHW A;  2E1P A;  4QCL A;  3W3S A;  2KVI A;  1SKW A;  1J5E J;  4NAS A;  5KOX A;  1MRO B;  3ENV A;  3G82 B;  3L7O A;  4KR0 B;  3DGP A;  1SKU B;  4MIB A;  3H42 A;  1UFL A;  3HJV A;  4CLP A;  3TUI C;  1EAR A;  4NLY A;  4N41 A;  4DL4 A;  3B6B A;  3ZZO A;  3PHT A;  3W2W A;  1WDD A;  3CF5 Q;  5AE2 A;  3BGL A;  1FJE B;  2GML A;  2OHD A;  4LJM A;  4UQT A;  3OR2 A;  1R0C B;  3SFU A;  1N88 A;  2FJA B;  3VTI A;  3OFF A;  4U8V A;  2FVS A;  4LBP A;  3UN3 A;  1NK0 A;  2HHU A;  1NSQ A;  2B56 A;  1U47 A;  3MOJ B;  4MKA A;  3HI9 A;  3W63 A;  2OEJ A;  3H20 A;  1OPZ A;  1RAB B;  4NPO A;  4OHV A;  1X4A A;  3Q8R B;  3CIM A;  3CDE A;  3I4P A;  3I5B A;  3UDE A;  2HBY B;  2CQ3 A;  4JI8 F;  1NJZ A;  1EKR A;  1SQG A;  1TK8 A;  2RRB A;  2HMI A;  2OTL S;  1R3N A;  1LQ9 A;  2WBR A;  3CCM S;  1TP7 A;  5LXR A;  5D4L A;  4PG4 A;  2QYC A;  4ATN A;  2W2M P;  4RJV A;  5M2R A;  1FT8 A;  5LMU J;  4F25 A;  3FQK A;  1TKZ B;  3MMA A;  1NH7 A;  3V4M A;  1OY8 A;  3EZU A;  1U0H B;  1WNE A;  4JYA J;  1S1W A;  2A0F B;  3P96 A;  1HI8 A;  5EHH A;  3G6X A;  4QOT A;  3I0S B;  5JXS A;  1FDN A;  1WG4 A;  3HVT B;  2Y0S D;  1FWL A;  4ZOS A;  4XDC A;  3FBC A;  1RT4 B;  3RGI A;  1KFD A;  4DL2 A;  4RBV A;  4R8U A;  2DYA A;  1Z2L A;  1KP6 A;  2JOQ A;  1I94 J;  3BQ1 A;  4P52 A;  4RKU C;  1JJ2 R;  2VBY A;  2RKI A;  4ALZ A;  3UNY A;  3EVO A;  4JBC A;  2AJF E;  3MM7 B;  1Z2Z A;  4PZV A;  3KLI A;  1N6Q A;  1SXL A;  1HR0 F;  2D7S A;  1RHJ B;  5EX0 A;  2BKO A;  4B9S A;  2RJZ A;  4A8F A;  2M3D A;  2EFN A;  3I9V 9;  3UD5 A;  1Q82 T;  2MXY A;  1YGY A;  4LRF A;  1S6P A;  2VU5 A;  4DX6 A;  3A8E A;  3GPA A;  1LW0 A;  3CCW A;  5G0R B;  3SQO P;  3PW7 A;  3IRX A;  4PWU A;  5C7P A;  1LEO A;  4ECY A;  2XI2 A;  3K59 A;  3IO1 A;  1ZOT A;  2G0I A;  1RXO B;  5FJ4 A;  3TAM A;  4NML A;  2HBQ B;  3GG0 A;  1LWF A;  4LF7 F;  2XZW A;  1IN0 A;  1CJV A;  1EP4 A;  4WBF A;  2YWH A;  4ZHR A;  1ZBT A;  3J80 U;  1NK6 A;  3NMA A;  2JLG A;  4OHW A;  3V6J A;  1RE1 B;  1D9A A;  2VL1 A;  1RWM B;  4F3M A;  5F41 A;  3C15 B;  1R0A A;  2XY5 A;  3MEC A;  4WU3 A;  3W9I A;  2WZ1 A;  2YWG A;  5F8J A;  2J5A A;  5E2Q A;  1LXN A;  5BJR A;  1U1O A;  3N6N A;  1IR2 A;  2QLB B;  4DR5 J;  1IBM F;  1RP5 A;  2GA7 A;  5EX3 A;  1NDP A;  3B4D A;  2MZT A;  3OTC A;  2AV5 A;  1HNZ J;  3SMZ A;  4Q0B B;  3H40 A;  2RHS B;  1RHK B;  2HHT A;  4UY8 T;  2FHK A;  1NO8 A;  4GVL A;  4B9L A;  2P9E A;  1DQ9 A;  2LDY A;  3VGV A;  5B09 A;  1JWW A;  3FFI B;  2RRA A;  5H9F K;  3W5X A;  4A8O A;  2F9J A;  3MUM P;  5KT4 A;  3RU0 A;  4QWB A;  4EZ9 A;  1HYS A;  3ZZT A;  2LFV A;  1NHK L;  2GQ2 A;  1VHI A;  1D8Y A;  4NCB A;  3DNC A;  2NR0 A;  2QV6 A;  4I4B A;  4OHY A;  3LAM A;  4QYZ K;  4LMZ A;  1F3V A;  3SQG A;  1PIL A;  2YQ3 A;  3CCT A;  3HSZ A;  2XCP A;  3HVW A;  1FFG B;  5THW A;  2H5J B;  1X5O A;  1BQM A;  3CCR S;  1CJK B;  3VCD A;  3RYL A;  4C8N A;  2R9L A;  2AW0 A;  3BBC A;  4Y0F A;  4IR9 A;  1W2B R;  4MKY A;  2KXN B;  2VBX A;  2VDI A;  1B0V A;  1FD8 A;  2V2Z A;  1YJ7 A;  3M8W A;  2UVV A;  4YN3 B;  5K8O A;  2KO1 A;  2LU1 A;  4MK9 A;  4HHH A;  1ZA1 B;  1QJH A;  2O66 A;  2NUU G;  4DWI A;  2DGU A;  1X7V A;  4F4X A;  1U09 A;  2R7U A;  3EDQ B;  5B0E A;  3QRP A;  4YDD B;  5IZH A;  2Z8Q A;  5L1I A;  5FD1 A;  4X4U A;  2H4Y B;  1S0O A;  4XAK A;  1Q8K A;  1MN9 A;  1VQL S;  2CJQ A;  2NSB A;  1UFW A;  3ILJ A;  5T41 A;  2BJE A;  1V5V A;  2KL8 A;  4OYW A;  4M95 A;  3IFE A;  3FJ2 A;  2WVD A;  4P10 A;  2ZDP A;  1Q7L B;  4NLT A;  4OYI A;  2Z57 B;  1G6B A;  2XB2 D;  3MCM A;  5DET A;  4WIQ A;  4ZCM A;  3M8Y A;  4DSL A;  5E3C A;  4G1P A;  2CQD A;  1IM4 A;  2XMV A;  3LGN A;  1VBX A;  2L48 A;  2K06 A;  3HHL D;  2YQ1 A;  2EG2 A;  5KT6 A;  2PMW A;  2CAD A;  2OMO A;  1G3O A;  4P2S A;  1RT6 B;  3MM5 B;  2BAB A;  1S5Z A;  2Z2M A;  3QRR A;  2XS7 A;  3BQ0 A;  3UI3 A;  1YX2 A;  2GHV C;  5DO2 A;  1JLB A;  5C42 B;  3OW2 R;  2V68 A;  2ZE2 A;  5ETM A;  3UE2 A;  4PAA A;  5FDL B;  1JLG A;  2PA8 D;  4ZPD A;  2GO8 A;  3EGW B;  2OEL A;  4WP3 A;  1IBK F;  2KXF A;  3FKB A;  4ED4 A;  1Q8L A;  2M7S A;  3UCG A;  3OVS A;  2RHQ B;  2Z4P A;  4LRC A;  4FF1 A;  4F8R A;  1WSR A;  1FDA A;  1TK5 A;  3OT9 A;  2CYY A;  5CYQ A;  3NMR A;  4NA2 A;  2HND A;  1C0U B;  1U2C A;  1NKE A;  1KDN A;  1KFS A;  3K58 A;  2EKN A;  1TVR A;  2VG6 B;  2G0J A;  3D7S B;  3GP9 A;  3CME S;  3BKU A;  1RHR B;  4QJV A;  1V3S A;  5B0C A;  3AOB A;  3IR5 B;  1RTI A;  2AZ3 A;  4UTG A;  3IBW A;  3IM9 A;  1CJU B;  4RO0 A;  2VPX B;  2M52 A;  3C6T A;  1QSY A;  4CLY A;  4I69 A;  4DF4 A;  2MY8 A;  3DLH A;  2GHW A;  1K0T A;  3ZFV A;  3ZTQ A;  3BN7 A;  3MUV P;  2DH7 A;  3C2P A;  3Q24 A;  2E1A A;  4RU2 A;  2E7X A;  3BSN A;  3VHQ A;  5ADZ A;  1S79 A;  1DAX A;  1HWK A;  3Q8U A;  4DV6 F;  3PIO Q;  3DI6 B;  1WOO A;  3GU0 A;  3IR6 B;  3LQV A;  1H38 A;  4PXC A;  3DLE B;  4C0B A;  3F44 A;  5AXL A;  4P73 A;  1ICE B;  2V8P A;  2XC9 A;  5B0A A;  3IA0 A;  5L9N A;  2B51 A;  2IY5 B;  2H4W B;  5E3P A;  1FI4 A;  1KR4 A;  2JWN A;  1SL2 A;  4ZPC A;  4Y28 C;  3KDN A;  3TYT A;  1WEY A;  5GAD U;  1YIJ S;  2HLU A;  2D1C A;  3CCU S;  3TX0 A;  2XLI A;  3RB4 A;  3IC1 A;  4J9L A;  2IVM A;  3TEG A;  3FBE A;  4J9M A;  1UVM A;  3SSQ A;  4EO6 A;  3CUN A;  1YJT A;  1FK9 B;  3SIP B;  2HHP A;  1I6J A;  2UXD J;  1XR6 A;  3O8W A;  1XN9 A;  4HTJ A;  3DCA A;  2CVI A;  4KTQ A;  1GQE A;  4ZVR B;  2ZH2 A;  3ETM A;  1WSV A;  4H4M A;  4LF5 F;  2PI5 A;  4U9R A;  4J9K A;  4ZVO B;  4LVO P;  3PTW A;  4JB8 B;  1CQN A;  4WFY A;  3HLU A;  3D2W A;  3N79 A;  1H74 A;  1XC9 A;  4ECW A;  4L72 B;  1BY9 A;  2PMH A;  1VS3 A;  4XIU A;  2XZD B;  5DQI A;  4K5R A;  4CNZ A;  3CPW R;  2FC9 A;  3GYG A;  1DTQ B;  5HO4 A;  1HPZ A;  1D09 B;  1RAF B;  2XLJ A;  4TQR A;  2CVE A;  2NSC A;  1NPK A;  3D4J A;  2RDI A;  3AJD A;  4QIW D;  1YSJ A;  4CH7 A;  4DV5 J;  4ES2 A;  4Y34 A;  2X51 A;  5KFT A;  2MQM A;  5IFM A;  2I5J B;  1NK8 A;  3ITH A;  2A2D A;  3DOM A;  2WOM A;  2GS8 A;  2PEH A;  4M63 A;  1RDR A;  3GYX B;  3W9J A;  3QBC A;  4FXD A;  4P9S A;  4DU7 A;  4KKO A;  3UN5 A;  1U48 A;  2IRX A;  3D67 A;  5ITH A;  2F5G A;  3CNQ P;  2RRN A;  3QT5 A;  4ZN1 A;  2OPS B;  3R6L B;  4WKY A;  3BDP A;  4KSE B;  2EK6 A;  3ZZU A;  4ECX A;  4DN0 A;  1ZZF A;  1SC1 B;  2HVZ A;  3VAK A;  4QYR A;  5H9F J;  1TFW A;  2WW4 A;  3CJ0 A;  4OV6 A;  2ZD1 B;  2YKN B;  4DR1 J;  1VRT B;  3BM7 A;  3RAM A;  4DMZ A;  2B5J A;  4HI1 A;  1A9N B;  4WXW A;  1KNZ A;  3OHB A;  2NS1 B;  4QYZ J;  3DLJ A;  2HWT A;  3U1N A;  5A8K B;  3BGF A;  2YQ0 A;  3GCW P;  4AL5 A;  2H5E A;  2NUH A;  1ELO A;  2DXD A;  3NGS A;  3Q8S B;  2UUW A;  1VCT A;  5F9N A;  3PW0 A;  4X4R A;  1U45 A;  2B4V A;  3K5P A;  3PHE A;  4AL7 A;  4RW9 A;  1I3O B;  1TZ0 A;  3TRG A;  1OY9 A;  3MM8 A;  4WJB A;  3HHK A;  3DMJ B;  2AHO B;  4FPI A;  2XYH B;  3HVA A;  1Q16 B;  3HCX A;  1YDL A;  1EET A;  1T0T V;  4QWA A;  2QL9 B;  5KFH A;  3KJF B;  3CCJ S;  4ZP6 A;  1HQ2 A;  3JTN A;  3R2D J;  3WZ0 A;  3QFH A;  4G1Q B;  1Q95 G;  1KRP A;  4FBT A;  3UD4 P;  3JS9 A;  3JTP A;  4ANE A;  1RB0 A;  1D9D A;  4JI6 F;  1VOM A;  2WAQ D;  3E01 A;  4LF4 J;  2DR9 A;  3G8T A;  1M5K C;  4FYX B;  4DUZ F;  4DR2 F;  3Q8Q B;  2RVJ A;  1KVJ A;  1FKO A;  2G1H A;  1HQU A;  1HNV B;  3HUL A;  4WCE Q;  2ATL A;  1QE1 B;  4WP8 A;  4B3O B;  4CLT A;  4DV7 J;  1NZA A;  2JJ4 D;  2IC3 A;  1VC5 A;  1AFI A;  2LU2 A;  2W01 A;  3U1M A;  2JH3 A;  2AYE A;  3V4I A;  3CT9 A;  4ED5 A;  5EWG A;  4OZ2 A;  3MR2 A;  2R7W A;  2ZH5 A;  5EDW A;  3GR0 A;  2DNQ A;  1SJ1 A;  4K0K F;  1H2T Z;  2G1D A;  4C9D A;  2MY7 A;  2DR7 A;  3NNA A;  3ZXW A;  2XS2 A;  2RML A;  4LBI A;  4LIR A;  4IRC A;  3EGN A;  5GAD I;  3OL9 A;  1RAH B;  5T7L B;  2DXE A;  2RAQ A;  4X62 J;  2F4V J;  4OJ1 A;  5GAH U;  1S9E A;  4TU8 A;  4DR6 J;  5C24 A;  1SVD A;  5HP1 A;  5J1E B;  4PQU B;  2IMO A;  4YR3 A;  5FII A;  4NYP A;  3TOQ A;  2UXC J;  1FRX A;  4ZLL A;  3L4B C;  4LSN B;  4CO0 A;  1DJ0 A;  2LLZ A;  4IFV B;  3NLC A;  2FZC B;  4FF4 A;  3TR5 A;  1NDL A;  3LGM A;  2DVI A;  2LEB A;  1TL7 B;  1S0V A;  2C3U A;  2AEM A;  2JZ5 A;  2ZIT A;  5IM0 A;  3DFE A;  4GRS A;  1OS5 A;  5LSO A;  4UW2 A;  4RLE A;  2YPZ A;  5J2Q B;  3BH7 B;  1TR0 A;  2MQL A;  3RAQ A;  2MLZ A;  5DG9 A;  1U6F A;  4JV1 A;  5HK4 A;  4GVB A;  1RWV B;  3D5M A;  3K17 A;  3DLL Q;  2FHM A;  1UL3 A;  4I1T A;  4LSL A;  4DCJ B;  4OFZ A;  1IM6 A;  1D1U A;  4ZVF A;  2K2P A;  3TZZ A;  3QT7 A;  2J0W A;  5ETS A;  2JEJ A;  4PYD A;  4FYY B;  4JI2 J;  1UWA A;  1WJ9 A;  1FXR A;  4UOG A;  3NOG A;  1RAJ A;  1F5B A;  3I5A A;  3FSY A;  5L1J A;  2J76 E;  4KV8 A;  2KXH A;  3M6X A;  3A4T A;  2HHX A;  4WP9 A;  4IFY A;  3ICL A;  4K4Z A;  2HIY A;  5BYS A;  1K1S A;  4Q8F A;  5DDQ C;  3D1O A;  4CLL A;  1HW8 A;  2IMW P;  2BQU A;  4G1I A;  3QPI A;  3D3B J;  1HNI A;  4LF6 F;  1FWK A;  4MT1 A;  4EUV A;  1EX8 A;  1TL3 A;  1S9G B;  2J0S D;  1WC0 A;  3FEZ A;  3PX4 A;  4ZIW A;  4M5M A;  3R9L A;  3MEE B;  3UR0 A;  2LYV A;  4NLX A;  1SB6 A;  3C8Y A;  4R0J A;  2K8G A;  1KEK A;  1P9Q C;  5I42 B;  2BJ9 A;  3JAM Y;  2F8E X;  4X4N A;  4DR3 J;  3W2V B;  3VQT A;  4OIX A;  4RW8 B;  1WC4 A;  2AZ1 A;  1KTV A;  4EFA C;  5AE3 A;  1HWJ A;  4U7U K;  4HL9 A;  4CZC A;  4NI2 A;  4DR7 J;  2QLF B;  3ULH A;  2KM8 B;  4F3O A;  5KFO A;  2HHH J;  5IT4 A;  4CLF A;  3PJX A;  3V2U C;  3CD5 A;  5E3A A;  2C3O A;  4C11 B;  3KJV A;  2KT5 A;  5DGB A;  1GNK A;  2IBK A;  1NHU A;  1GXL A;  3PFO A;  2MKC A;  3L09 A;  4DSK A;  3M32 A;  1NK7 A;  1PSD A;  3EGV A;  1Y00 A;  2FTR A;  4RNO A;  3GFH A;  1PAE X;  2RU9 A;  1RT2 A;  4TKT A;  2VKZ G;  4XTT A;  3LP2 A;  1YZ6 A;  1HBO B;  4ZVG A;  2GIF A;  3GTY X;  4Y2C A;  2L3M A;  2XMK A;  1HD0 A;  4NA1 A;  4PEO A;  3DOL A;  2QZ8 A;  1FDB A;  3RB0 A;  1IUJ A;  3TW0 A;  3FBF A;  3I87 A;  1JX4 A;  3AFG A;  1XNR F;  3N01 A;  1QSS A;  4JI3 J;  2FHO B;  2ZEJ A;  1IR1 A;  1BE4 A;  2D69 A;  1KHW A;  1RTD B;  1X5P A;  1LK5 A;  4RW7 B;  1S7H A;  3DYA B;  1LWX A;  1S6Q A;  2ASL A;  5JUM A;  2R7V A;  2V8V A;  2J6T A;  2FVC A;  1U1P A;  1RT3 B;  3QGP A;  2IDE A;  2B8P A;  4YOE A;  2RDJ A;  2KRB A;  2R8J A;  3H59 A;  3NNH A;  5BR8 F;  3IXQ A;  3EPG A;  2WW8 A;  1RZM A;  3W5Z A;  4DUY F;  2CFX A;  4KQZ A;  2W9B A;  3HDS A;  5KG3 A;  5HL7 Q;  3ONQ A;  5HRO A;  4JI4 F;  5F3Z A;  5LM7 E;  4PAB A;  5ETR A;  3IGN A;  2V4J A;  4MFB B;  1JIH A;  5KOW A;  1WWH A;  2BRK A;  1QM9 A;  5A0Y A;  4CCH A;  1RWN B;  4FYW B;  5GAH I;  1N8R T;  2XWX A;  1HQE B;  2RS2 A;  2G2O A;  4Q2M A;  4TU7 A;  4I2P B;  4N8O A;  1OPI A;  2X1G A;  2GX8 A;  4J9O A;  2POK A;  1NJI T;  1X31 C;  4YB7 A;  2DGT A;  3OFH A;  4TYB A;  3AHP A;  4RR5 A;  1XMQ F;  2PT0 A;  4JYA F;  3CD7 A;  2PE8 A;  1N5Y A;  3MCN A;  3C14 A;  1RU1 A;  4B08 A;  5B7W A;  1VBY A;  1DUR A;  4ZJO A;  2MKH A;  2YNF A;  1JLQ A;  1FWP A;  3H0P A;  2XQC A;  2ZUA A;  1RCX B;  1RAA B;  3M2R B;  3FEY B;  2UU9 J;  2LDI A;  3MF5 A;  1RT7 A;  3VGU A;  4DSE A;  5LSL A;  3M6U A;  3CTR A;  2HHW A;  4FKY A;  3Q8V A;  2PII A;  1WI6 A;  1X4F A;  1RCO B;  4OJH A;  1TL1 B;  1FX2 A;  1VQK S;  4A8W A;  3WX8 A;  4PG5 A;  3T6J A;  4PG6 A;  2R8H A;  1FVS A;  1P1L A;  3R97 A;  2Y0B B;  3OHA A;  2KKH A;  4X4Q A;  4EO8 A;  1G4C A;  3NWG A;  4EEY A;  5MAO A;  2XO7 A;  3WC0 A;  4XPE A;  2LXF A;  1BQN B;  2E5G A;  2B9Y A;  4RX6 A;  1HNX J;  4B9T A;  2QC3 A;  4E2F B;  4L3N A;  4JI7 F;  5LL6 d;  4DPY A;  2OPR A;  2XUL A;  4R5P A;  3BYR A;  3C16 B;  4KFB A;  4WU2 A;  4C0O C;  4OJ3 A;  3HFZ B;  4X4T A;  1NLK L;  3MHY A;  1X9S A;  4K4Y A;  5EN1 A;  2HRU A;  5E3Q A;  3DRS B;  3KG4 A;  2HQG A;  3FNN A;  3P5T L;  3A12 A;  1VRU A;  2FJB B;  4KGK A;  4B3T F;  4ZVS B;  4IH6 A;  3EZO A;  1TKX B;  2MTL A;  5DGA A;  4DDF A;  1N52 B;  3QWP A;  2QLX A;  3ZZZ A;  4W92 B;  4ERD A;  4CT9 A;  3MEG A;  2OH2 A;  3D6M B;  5G4D A;  5KT5 A;  2EEY A;  3J7Z T;  3Q23 A;  1JLA B;  2UUB J;  2GAG C;  1URR A;  4DR5 F;  5BYR A;  2OPQ A;  3FZB A;  1RTJ A;  2W9A A;  4WII A;  3OUY B;  3HHD A;  4EI2 A;  1M1H A;  2HQC A;  3CED A;  2CQ0 A;  4ZJL A;  5HAN A;  3AA9 A;  5KFF A;  3I32 A;  4RWX A;  2ZBC A;  1T7P A;  3QSY B;  1R0B G;  4ZVQ B;  4ZVU B;  3DGP B;  5D15 A;  2AP6 A;  3J81 j;  5J2M A;  3MPV A;  4ID5 A;  3QGH A;  3MAA B;  2YNG B;  2HHQ A;  2K3K A;  4I7F B;  4JI0 J;  4DN9 A;  3BR8 A;  3W2W B;  1RKI A;  3G9C A;  2HQ3 A;  2VJU A;  2RF2 B;  3U7J A;  4DHV A;  4X65 J;  1RTH B;  2BVZ A;  3DOK A;  4B3S F;  3M6V A;  3BB5 A;  4URQ U;  4IG3 A;  2AT1 B;  3D9B A;  1SJ4 P;  1EJ7 L;  3JYT B;  5CYM B;  2RUG A;  1XNQ J;  1JKH A;  3PNI A;  3FCV A;  2VB6 A;  1C2P A;  5DM6 Q;  2F8M A;  4C3K A;  3PRV A;  2RDD A;  1CQM A;  5CAB A;  8AT1 B;  2QJ3 A;  4MTP A;  1UW4 A;  2W2N P;  4PXD A;  2GW8 A;  2OFH X;  2XY7 A;  3CB4 A;  4X66 F;  1T95 A;  4ZVP B;  2N7C A;  3BS9 A;  4K2X A;  3ZZY A;  3K8V A;  2CQG A;  2EK1 A;  1NAQ A;  3LTO A;  4NXM J;  5K8N A;  4M1K A;  2Q79 A;  4RW4 A;  3LAN A;  3BSO A;  3BKT A;  3S6E A;  3CJK B;  4FP9 A;  2DRA A;  3GWC A;  2ZFH A;  4OQJ A;  3GON A;  4CO5 A;  2RKI B;  6AT1 B;  2XBP A;  1B70 B;  5DG7 A;  1PKU A;  5F0W A;  2SXL A;  1ZA2 B;  2GGP A;  3CVK A;  2NCK L;  1WF1 A;  4UQG A;  4M5D A;  1RIS A;  4LF1 A;  2IRY A;  4M5H A;  2VFR A;  4ETX A;  3B54 A;  2YWW A;  3ISN C;  6FDR A;  4ELU A;  4KO0 B;  4H4O A;  2EG1 A;  2FVP A;  3CJS A;  5DQG A;  5CA5 A;  3OSN A;  2Z2Z A;  4AD6 A;  3DRX A;  4OI4 A;  3MED B;  8RUC A;  1DFD A;  1AT1 B;  5CCL A;  3T1H J;  3NS6 A;  2MQQ A;  1M5H A;  2KU7 A;  2HAF A;  4DV4 F;  4WK3 A;  4E98 A;  2ZC3 A;  2PEB A;  3THP A;  2LXI A;  4L73 A;  2BDP A;  5KFY A;  3BKF A;  4DV2 J;  5K9F A;  2HWH A;  4JI5 J;  2VUG A;  3P45 B;  4ZHR B;  1LOU A;  4JOU A;  4NXN J;  4TQS A;  3KLG A;  2EC2 A;  3DLG B;  1FRL A;  2LKZ A;  2XYP B;  4I2Q A;  3AOD A;  2W2Q P;  2RUS A;  1X0P A;  2FHJ D;  1Y4Z B;  3KK2 A;  5DG8 A;  1NH8 A;  3FEX B;  1F2H A;  1FRH A;  2GJI A;  1W26 A;  3PR4 A;  3LP1 B;  3O3L A;  2OSQ A;  2KZM A;  2ACM A;  4HHU A;  3PRB A;  2KG0 A;  5HJY A;  1YJ9 S;  3AJ1 A;  4HH0 A;  2YWE A;  3N0V A;  4NLG A;  1X5S A;  5H1S V;  2DIU A;  4KHR A;  2FJX A;  1VRQ C;  5I3P A;  4X84 A;  1FJG J;  1T9Y A;  5M2P A;  1VMB A;  4QW9 A;  1GMW D;  4KHP F;  2Q6C A;  3M1V A;  2P9G A;  2DGS A;  5IWA J;  3Q2T C;  2XMM A;  3NGR A;  4O4G A;  2ZHA A;  1Y3K A;  4J9N A;  4OX9 J;  2ERR A;  4HVZ A;  1FTR A;  5F8H A;  2YWF A;  3RBD A;  2JFD A;  3R5D A;  1UZD A;  1IBC B;  5GME A;  4DPT A;  4S0M A;  1S76 D;  4OI2 A;  1L3U A;  2W9C B;  1DLO A;  2JEF A;  3SQG B;  4WYW A;  1OMS A;  3RBE A;  3SCK E;  1C1C A;  2CNL B;  2C2E A;  4YQW A;  3POT A;  4TLR A;  3ET6 A;  4DEZ A;  1WC6 A;  2OSR A;  2IHR 1;  3W65 A;  4NLV A;  2VHG A;  1PIE A;  4ILM A;  1QY7 A;  4K59 A;  1NCL A;  2DH8 A;  3G86 A;  5CHC B;  3JQJ A;  1HNW J;  1GX5 A;  3K89 A;  4GKJ F;  5DM7 Q;  1HBU B;  5D4O A;  4PR6 A;  2CZ9 A;  3T5K A;  4KE5 A;  1XQI A;  2GCF A;  5HMY A;  1VYA A;  4Y2A A;  4ICL B;  1RT5 B;  1JXE A;  2JSX A;  1D8Z A;  3TJA A;  4F4W A;  1MSW D;  3CIZ A;  3PO5 A;  4X2B A;  1M5S A;  2MQP A;  4WE1 A;  2LEC A;  3NNC A;  3BZQ A;  4USU A;  1UEK A;  4FNH A;  2MMY A;  2QTW A;  4BS2 A;  2VFV A;  3VAH A;  4XPC A;  3R6G B;  3PXG a;  1C0T A;  3CE8 A;  4BCA A;  3QZ8 A;  5CCM A;  5L9X A;  2MHN A;  4LF8 J;  2WVF A;  4ES3 A;  1VK8 A;  4QIE A;  1AZS B;  1RWW B;  3NCP A;  1SC3 B;  5KT3 A;  1XEZ A;  1T11 A;  4CH1 A;  3TUJ C;  3RW6 A;  5LXY A;  2ZZM A;  2QFJ A;  1V6H A;  1RA7 A;  2PGC A;  1H2V Z;  3A13 A;  3IMQ J;  1UJ4 A;  1YHQ S;  2RE1 A;  4MYT A;  4AT1 B;  4RZR A;  4MKV A;  3ETO A;  3PW5 A;  4ZCK A;  2DO4 A;  2RIJ A;  1M1K T;  4MJK A;  4PXB A;  4HEA 9;  4B3M J;  2QN6 B;  3GJS B;  2DY1 A;  1RWP B;  3Q86 A;  1Y5N B;  1MRO A;  2J6U A;  4AXI A;  4KGZ B;  2D74 B;  2GMJ A;  2DEJ A;  1NPR A;  4TU9 A;  1MML A;  4W4M A;  2JVR A;  2NXJ A;  4CI0 B;  2YNH A;  2ZJP Q;  5CZV A;  2OJ3 A;  5D0E A;  1SKR A;  3MI7 X;  3OQ2 A;  3UD3 P;  2R7X A;  2Z2Y B;  4DI6 A;  4IH5 A;  2R3V A;  2BM0 A;  3IRW P;  4U6P A;  3GSI A;  2EXU A;  2B4O A;  4M94 A;  5CYQ B;  3HO1 A;  4QIF A;  1S1T B;  3VAI A;  2W25 A;  3M8Q A;  4DQR A;  3BR9 A;  3MZI A;  4A4J A;  3HSG A;  1MG7 A;  2LCW A;  3M9M B;  2VAS A;  1UP1 A;  3M9O B;  2G2Z A;  2CJK A;  3W61 A;  2BE2 B;  1VQN S;  4W98 A;  4F67 A;  2BW7 A;  4KAI A;  5ETL A;  4HLB A;  2C2O B;  4LFA J;  5KFZ A;  4DV3 F;  3QT8 A;  1S72 S;  3US5 A;  3VF0 B;  1FNX H;  3PJ9 A;  2XWY A;  4F2S A;  1L5U A;  1X0F A;  4UT4 A;  4Q43 A;  3OTO J;  1TKZ A;  2XS5 A;  5L46 A;  4IYQ A;  1LV5 A;  3DM2 B;  2M5Y A;  3MPU B;  3I0S A;  1E6Y A;  2MQ8 A;  4CLW A;  4EMD A;  3HVT A;  1RHQ B;  3EUN A;  1RT4 A;  4FS2 A;  2OAU A;  4WF9 Q;  2VA2 A;  3PX6 A;  4YHH F;  1FDD A;  2CPF A;  1IKW A;  3J7A N;  3NEK A;  2QSW A;  3F56 A;  4B3R J;  3TWZ A;  1CJT B;  3MM7 A;  1UEV A;  4ILL A;  4QPX A;  2O01 C;  1JLF B;  3G2X A;  2GHP A;  2PA3 A;  1K9M T;  1PC5 A;  4ZIV A;  3CJ2 A;  5E41 A;  5AJ3 J;  2HGL A;  1F60 B;  5G0R A;  1U49 A;  4K4W A;  5A8R B;  3KK3 B;  1UCN A;  4P2X A;  1K0V A;  4MIW A;  4NZ6 A;  1U1L A;  3M30 B;  4H4M B;  3KXD A;  3SXL A;  2KYX A;  3BSC A;  1O8B A;  5A6P A;  1UTA A;  4YB5 A;  5IV3 A;  1S1X B;  4D3H A;  4DV1 F;  3M8P B;  2W24 A;  3BPS P;  2C2N A;  4TY9 A;  5AT1 B;  3KUE A;  2D9O A;  2MPU A;  3C15 A;  2KFZ A;  1GEH A;  2AYM A;  3R27 A;  1OSD A;  4DR4 F;  2YKM B;  3KTQ A;  5DQH A;  2QEX S;  2GIR A;  1X4E A;  3V6K A;  2N4D A;  2CG4 A;  4HT5 A;  4X64 F;  2MKY A;  1N36 F;  4WFA Q;  1TUG B;  2A3J A;  2QMW A;  2NXC A;  4I0W A;  2LQ5 A;  3D1Q A;  2E5L J;  1C1B B;  1W2I A;  1N33 F;  1RTZ A;  3J7A 1;  3I6P A;  4J5O A;  2EFO A;  5IC4 B;  4Q0B A;  4YB6 A;  1RBA A;  2Q3P A;  3PY8 A;  3LO3 A;  1Q8I A;  3Q8Y A;  2FY8 A;  4E0D A;  4FBU A;  3MCO A;  4KKO B;  3D6H B;  5CAA A;  3SEO A;  1SQF A;  2BOP A;  3FCH A;  4NE9 C;  3SV4 A;  1T03 B;  2OP5 A;  3FFI A;  4IOA Q;  4BC9 A;  3DLK A;  5K8P A;  3QMQ A;  5DS7 A;  2B4U A;  3PEH A;  1ZM2 A;  7FDR A;  3MAH A;  4L3K A;  1O51 A;  2DGO A;  3JAM U;  4JP8 A;  5AXN A;  4R0E A;  1U24 A;  2J0X A;  4BBY A;  2JDJ A;  1Y0H A;  4DG1 B;  2XZT B;  5ETQ A;  2D9P A;  1TU0 B;  1DHM A;  3GJQ B;  5HMZ A;  3HX9 A;  2V2V A;  1UVN A;  4ED7 A;  1SBR A;  4EBE A;  1CJK A;  1S12 A;  1HMV B;  3G87 A;  4TN2 A;  3BH6 B;  2KH9 A;  2ZZT A;  2X1B A;  1NJW A;  4JI8 J;  4MAK A;  1AFJ A;  4N8N A;  3HT3 A;  1V3Z A;  4CM0 A;  3U1L A;  1UA1 A;  3J81 U;  3KHR A;  4PPD A;  3VWS A;  4RW9 B;  3UDV A;  2HS3 A;  2YX7 A;  3PW2 A;  5C2C A;  2C2K B;  2V67 A;  3MM8 B;  2BXJ A;  3IAM 9;  4J90 A;  1JJH A;  3GYN A;  3HHL B;  2FGC A;  4BDP A;  2ZC4 A;  1JJ4 A;  4M5J A;  2DNL A;  1CS4 B;  5CD4 H;  2V6A A;  4ZIT A;  1NPP A;  1RWO B;  1F2G A;  1S97 A;  2H48 B;  4F26 A;  4PPZ A;  1NB2 A;  2HHS A;  1QDU B;  2DJW A;  2GNK A;  3DKD A;  1R6V A;  4FKX A;  1HR0 J;  1SL0 A;  3SYZ A;  4ECR A;  1HQU B;  4ZS6 A;  4CLK A;  4Y3C A;  5DZ7 A;  3BV8 A;  5KT7 A;  1GMV A;  2FC8 A;  1RT6 A;  3MM5 A;  2DGX A;  1XBW A;  1H73 A;  3DU6 A;  4ZP9 A;  5C42 A;  2KM8 C;  4P6Q A;  2FLP A;  4F4K A;  2AGO A;  3MOZ A;  2Z2L A;  3G6Y A;  2XNR A;  2LQ8 A;  4LT6 A;  4AND A;  4ER8 A;  4ENO A;  4IR1 A;  4LF7 J;  1JLE B;  3KNA A;  3A8J A;  3THT A;  3PV8 A;  1Q4R A;  2ADB A;  4RUB A;  3I82 A;  1YLX A;  3OLB A;  3SBM A;  1X9M A;  5I3U B;  3TQ1 A;  1T94 A;  3BJY A;  2UUC F;  3CJ5 A;  3RRH A;  1FKP A;  4OV1 A;  2XLK A;  2K7J A;  4J9S A;  4LFB F;  4DSJ A;  3LOU A;  2CAJ A;  1C0U A;  5J2P B;  3BSA A;  2C2M B;  3M8S A;  1K8A T;  2PN6 A;  1P27 B;  2VG6 A;  2AJQ A;  1MLA A;  2OPP B;  3OJS A;  2NYH A;  4ELV A;  3W62 A;  5HP1 B;  2OKQ A;  1HWI A;  1MU2 B;  1LFP A;  3H5S A;  2HLT A;  4NLS A;  4J9R A;  5HQ8 A;  1SC4 B;  1F6T A;  2CQB A;  5HJX A;  2XG8 A;  4OI1 A;  1IBM J;  2HGN A;  2IAJ B;  1CJU A;  1QD1 A;  4UY8 5;  1Q0N A;  4N47 A;  4DPO A;  3AAW B;  3GCX P;  1N32 F;  2VQF F;  2H5I B;  2ACY A;  3M05 A;  5IT0 A;  3PKY A;  1HLW A;  2XYG B;  1YBA A;  3DGV A;  4B9V A;  1SI9 A;  1RYR A;  4Z7C A;  4ECT A;  1UWB B;  1IBL F;  1OIA A;  1WHX A;  3LPY A;  4PUO A;  2MEW A;  3JQK A;  3TA1 A;  3TP2 A;  1T02 A;  1YBU A;  3SCL E;  4OZ0 A;  4GKK F;  5L1K A;  3DI6 A;  2JX2 A;  4GVB B;  1MW7 A;  2QRR A;  3DLE A;  1GFW B;  2EPI A;  2IA0 A;  3OD2 A;  3WIU A;  1RUS A;  4OYP A;  2OD4 A;  2VOO A;  3LWL A;  1S4F A;  2NLW A;  1WAC A;  2LVW A;  3VR1 A;  1HW9 A;  3DDI A;  2ZBP A;  2VQE F;  4CNY A;  1HBN B;  1WEX A;  3BF4 A;  2BRL A;  2K1R B;  3AQP A;  1R43 A;  2KHC A;  3CC2 S;  3NXZ A;  3G6E S;  4NX9 A;  3U02 A;  3W7B A;  4ZKA A;  3L95 X;  2DNN A;  2DGV A;  4ED3 A;  2JLE A;  1RAD B;  2OFG X;  4DQQ A;  4O23 A;  1FK9 A;  3EDR B;  2IM0 A;  1WTF A;  1DQA A;  1Q79 A;  1X4D A;  3MM6 B;  4LF9 F;  1SV5 B;  3FMW A;  4DQS A;  3IS9 B;  1NK5 A;  5EWF A;  2P2C B;  4USM A;  1L3S A;  1RI7 A;  3THV A;  3FRY A;  2DB1 A;  3D68 A;  3P4U B;  1IQZ A;  2JC1 A;  2HEK A;  1U1N A;  5CXT A;  3T9Z A;  1PBA A;  2J7U A;  2BJ8 A;  3L7P A;  3BO4 A;  1R8C A;  4I6A A;  4PWD B;  2HSE B;  5KG6 A;  3M6W A;  4OYM A;  3CJ4 A;  2YNI B;  1NK9 A;  2R8G A;  4FS1 A;  1RAG B;  1VI7 A;  3MR7 A;  1DTQ A;  1YZ7 A;  2FJV A;  1IKV B;  5H9E K;  4I56 A;  3M32 B;  4F04 B;  3MCS A;  3NP5 A;  1WI8 A;  4JV5 F;  5A2Q U;  5GVQ A;  2ROG A;  2I5J A;  1LW2 B;  1E6V B;  2HPU A;  3EWG A;  4LFC F;  2DPJ A;  4ID8 A;  4WK1 A;  3GV5 B;  2XMA A;  3NS5 A;  4H54 A;  1Z1Z A;  2MJU A;  1WC1 A;  5HBM B;  2EFQ A;  4O0N A;  1S6U A;  3S01 A;  2ROP A;  2WON B;  2C28 A;  1PO6 A;  1Y7P A;  3KG0 A;  2OPS A;  1LWE B;  2H51 B;  3M2U B;  2QSF A;  3VAJ A;  1IBK J;  3DN9 A;  2GZO A;  2BAN A;  4O3N A;  4CM2 A;  2J8S A;  4QIG A;  1RKJ A;  4BHQ A;  3PIP Q;  2BA9 A;  3N6M A;  2XNQ A;  5IV4 A;  1VJQ A;  4YR2 A;  3V6D B;  3C46 A;  3MMB B;  3PG9 A;  4LVN P;  4RUA A;  3KG1 A;  2JHE A;  2L9D A;  2VIC A;  1FE0 A;  1AUS L;  1IWG A;  2GVZ B;  4EU0 A;  1A0O B;  1GT8 A;  4USI A;  1PJ7 A;  2ZBI A;  3MUT P;  5A6W A;  4C97 A;  4FDF A;  3CJR A;  3QJL A;  3M2V A;  1IKY A;  2CQ1 A;  5A8K A;  3EVW A;  3B78 A;  1S48 A;  1EQ0 A;  5KG0 A;  1Q78 A;  1LKZ A;  1Q81 T;  2KTQ A;  4L6V 3;  1MMD A;  3CJ3 A;  2I6W A;  5HRO B;  3A3P B;  3MPD A;  3Q89 A;  4X4S A;  2FVR A;  2NZ4 A;  2P6T A;  1YRT A;  3MR6 A;  4K2J A;  3O2I A;  3DMJ A;  1FEE A;  1S1V A;  1VQ5 S;  3OVB A;  2QA2 A;  4NLO A;  3PW4 A;  5HN0 A;  1RK8 A;  2MKI A;  2F8H A;  4DV6 J;  4R25 A;  2RB7 A;  1JXL A;  2UV8 A;  1QAX A;  5KT2 A;  5KTQ A;  3KWM A;  1VQS A;  4NRU A;  4G1Q A;  1HI1 A;  2ZH1 A;  1F5A A;  1NME B;  5IQ6 A;  1QAI A;  4NCA A;  2N82 B;  4E8U A;  2WB1 D;  3R8Y A;  1H6K X;  2AJ2 A;  1X4H A;  1U1K A;  4DZ6 A;  2DPI A;  2FD2 A;  4LIW A;  4KYZ A;  5MLC V;  4Q2L A;  1JLQ B;  1NXI A;  1Q1K A;  3M8Z A;  1OQ3 A;  2GFF A;  4J91 A;  4C8O A;  1HNV A;  1QE1 A;  4OYZ A;  4B3O A;  1QSL A;  4EZ6 A;  4WWS A;  1LNQ A;  2HFU A;  1RT7 B;  2IA6 A;  2OO4 A;  3QO9 B;  3GFY A;  3IWL A;  4UOH A;  5JVH Q;  2J9D E;  2CZ4 A;  2HQD A;  5IXU A;  2FVQ A;  2LA6 A;  1QUP A;  3UQS A;  5DZ6 A;  1YBT A;  1CC8 A;  3I31 A;  1TV6 B;  3R5A A;  2OGU A;  2YBV A;  3OXL A;  3NCQ A;  3G4S S;  4LF5 J;  2WSE C;  3KFW X;  4MH8 A;  2XM3 A;  1VIS A;  2L9N A;  2DNR A;  4GC6 A;  4M5N A;  2BKN A;  3UDL A;  3H98 A;  2DY9 A;  1H2U X;  1X60 A;  5KFU A;  5J2N B;  2PMZ D;  1YJW S;  3GR1 A;  3H25 A;  1YJU A;  2Y9H A;  2ZJQ Q;  4DV2 F;  2QLW A;  2LEA A;  5U47 A;  2A18 A;  3CDA A;  3EGZ A;  4PQU A;  1S59 A;  3HF5 A;  1RAO A;  1REG X;  3LP0 B;  1JLC B;  3TUZ C;  5HLF A;  3BRE A;  1UAW A;  4LSN A;  1WKK A;  3UCU P;  3GJT B;  4AXJ A;  4IFV A;  2IVF B;  2MSS A;  1Y10 A;  2QE5 A;  1REV B;  1R8P A;  4K8R A;  1AW0 A;  1BHN A;  3MEG B;  3H8Y A;  2FB0 A;  3UDC A;  2H65 B;  2KT3 A;  3OSP A;  1WOR A;  1DBD A;  4WYL A;  4YY3 F;  2V8H A;  5C25 A;  4NLR A;  1RTJ B;  1TEL A;  2R2U A;  4DLG A;  5J2Q A;  4YS2 A;  2GQQ A;  4B17 A;  4QWC A;  3K57 A;  3QAU A;  1FXD A;  2MHE A;  3TVY A;  3RB3 A;  2OEK A;  3CWJ A;  4X4O A;  4HAC A;  1X9W A;  1K1Q A;  2GV1 A;  1D3W A;  4P72 A;  2CNN B;  3TQE A;  4YR0 A;  4LRE A;  1H7W A;  3KJN B;  4OHX A;  3GIM A;  4ILR A;  5B0G A;  3MGJ A;  1KQG B;  5D78 A;  2KFN A;  4ID5 B;  2V8G A;  3QLH B;  2CWX A;  3U27 A;  3ILI A;  1N54 B;  4P2F A;  1T8E A;  2E5I A;  4F0H A;  3EM1 A;  4DV0 F;  4N76 A;  5E3R A;  4UF4 A;  2AX1 A;  2K7K A;  3DOK B;  4B02 A;  2NZC A;  1I1G A;  4C98 A;  1IKX B;  2X3D A;  1CUL B;  4LQ9 A;  1SC6 A;  3HSJ A;  3NWR A;  4CO3 A;  3VZI A;  1L3V A;  3NGU A;  3LPE A;  3HD1 A;  1FD2 A;  1Y11 A;  2GIQ A;  1U6B A;  1FNO A;  2DR5 A;  1IXK A;  2NXE A;  4RBT A;  3NAH A;  1NHV A;  2I38 A;  3EXY A;  4FYD A;  4M5I A;  3UN2 A;  3MEE A;  1SIW B;  1R6Y A;  2JL9 A;  1WHV A;  5I42 A;  2H54 B;  1EAY C;  2FY1 A;  2F4F A;  3W2V A;  1Z4U A;  4RW8 A;  5RUB A;  3EZ5 A;  4QIV A;  1U0S A;  1FRM A;  3W8G A;  4JI6 J;  2F7V A;  3IWX A;  2BBE A;  4DUZ J;  4DR2 J;  4K50 A;  2B6A B;  3HKW A;  4C11 A;  1J2V A;  2WHO A;  3TJ8 A;  5DDP C;  3H4D A;  2RSQ A;  3NRB A;  4KH0 B;  4IDK A;  3QT6 A;  1YK9 A;  4CH0 S;  4OHZ A;  3NGT A;  4OX7 A;  2APO A;  1HBO A;  1R7I A;  1O0P A;  1I51 B;  2JEI A;  5H9E J;  2GGP B;  3KLF B;  3H5U A;  4WFZ A;  4F3Q A;  2BV3 A;  4K0K J;  1UKU A;  2YVS A;  5GAE I;  4FXW A;  3T1A A;  3HKZ D;  3KHG A;  3D54 A;  4ZVE A;  5BXI A;  3QZ7 A;  3W9H A;  2M9K A;  3J7Y I;  3GV8 B;  1RWX B;  2MKJ A;  3CCS S;  3BPD A;  3M4X A;  1PYS B;  2AWZ A;  1QVF R;  4RNM A;  1RTD A;  3DU5 A;  2HVH A;  2R8I A;  4ZMM A;  4RW7 A;  3O6Q A;  3DYA A;  4DS4 A;  3AD9 C;  2BZ2 A;  3SSR A;  2BE7 D;  1XWL A;  1PG5 B;  1MMN A;  2CJX B;  2JFK A;  1FRJ A;  4C48 A;  1RT3 A;  1RSC A;  4UUX A;  4LR8 A;  3LA0 A;  1BMQ B;  1VIO A;  1UVJ A;  2ZWP A;  2CQ4 A;  4LRB A;  3H5Y A;  1O6X A;  2XMU A;  4DLE A;  4AL6 A;  3IN5 A;  1NBE B;  4MFB A;  3BO2 A;  1FO1 A;  1T05 B;  3KLE B;  1R27 B;  2NXU A;  1N34 F;  1HA1 A;  3CMQ A;  3UO0 A;  4JV0 A;  2NQP A;  5F8L A;  2XGP A;  4TY8 B;  2HNY B;  2HRT A;  4Z2X A;  4ZLN A;  2VOP A;  4K5S A;  3AOC A;  2JLF A;  4ZJQ A;  2DH9 A;  4FF2 A;  4I2P A;  4NEY A;  3IM8 A;  3AXK A;  3DRY A;  2WVE A;  2B3T B;  2IJR A;  2OML A;  3GIJ A;  4KRW A;  1K47 A;  1TKT B;  1KQK A;  2E9R X;  2ILZ A;  3MMJ A;  3RW7 A;  1HIY A;  3X1L B;  5LJ3 Y;  1EQM A;  3PYD A;  4FYV B;  2AJ4 A;  3K7R A;  1TAU A;  1PC4 A;  2DHH A;  1EZZ B;  2QMX A;  2WSC C;  2GMH A;  3M2R A;  3DXB A;  2N3O A;  3RB6 A;  2FLN A;  2Y8Y A;  2FJW A;  2DGQ A;  2HFZ A;  2YH0 A;  4MMO A;  4U8Y A;  4XDD A;  2RQC A;  1X8D A;  2B7C B;  1TL1 A;  4A8Q A;  4NRT A;  3P5B P;  3POT B;  1S49 A;  2LP4 A;  4ZA1 A;  3VAL A;  5D4P A;  4F4Z A;  1HI0 P;  1QVG R;  4LRA A;  2EBG A;  4FF3 A;  3QYY A;  4DFM A;  2YWK A;  3MR5 A;  1S1U B;  4CP5 A;  4LF2 A;  2VG5 A;  7FD1 A;  4LF6 J;  3ZZ0 A;  3VGT A;  4OJG A;  1U1R A;  4LUB A;  2R7S A;  2R7T A;  5D77 A;  2VA3 A;  3PO4 A;  4YUD A;  2KJW A;  4U67 Q;  3MMC B;  2YKQ A;  1AB8 A;  3IR7 B;  1JB0 C;  4AQY F;  4WE1 B;  2MKK A;  5FLX Y;  2ZHO A;  3JSM A;  2G9O A;  3LW5 C;  3P6Y C;  5K8M A;  3DRS A;  1N5T A;  4P7V A;  1WF0 A;  2DXF A;  4ZCI A;  2BKP A;  5HVG A;  1TKX A;  2C2Z B;  2HW3 A;  3PJW A;  5JJB A;  4OYO A;  3Q83 A;  2XSJ B;  5J1N A;  2CDR B;  2XMT A;  4Y2M A;  4EWT A;  1JQG A;  2AKW B;  1JLA A;  3UPF A;  2R8K A;  2CQH A;  5KG2 A;  4C8K A;  3PEJ A;  3OUY A;  4ANC A;  3BDE A;  4NEZ A;  1JJC B;  3EE3 A;  3MWB A;  2L9W A;  2VH7 A;  4UUW A;  4A8M P;  1XNR J;  2BAC A;  1TUW A;  2AD9 A;  2JVO A;  3I0R A;  4EBD A;  3NL0 A;  4V1A k;  4PWW A;  3MAA A;  2YNH B;  2YNG A;  3IAS 9;  2DIS A;  5EUH A;  4I7F A;  3QIP A;  3MFI A;  1U4B A;  4C3M A;  3F73 A;  4K7Q A;  2PO4 A;  2GQC A;  4OYB A;  2RF2 A;  3N5F A;  3AT1 B;  4DL5 A;  2AIR B;  5BR8 J;  3JSR A;  2UUA F;  2V2Q A;  3CW2 C;  4DUY J;  5ETK A;  1RTH A;  5KFL A;  3R1H A;  2VKR A;  3BGR B;  1Q53 A;  3V81 B;  4U95 A;  2WBM A;  3DC2 A;  2VFU A;  5L1L A;  3M8Q B;  3JYT A;  5CYM A;  4JI4 J;  2J0Q D;  2MKS A;  1QAY A;  1TL4 A;  5A8W B;  4F4Y A;  4MK8 A;  5CQG A;  2MQO A;  3D66 A;  3A1Y G;  2VV5 A;  5F0U A;  1T9W A;  2DR8 A;  2MGZ B;  1X5T A;  4CYU A;  5K5M A;  1KON A;  1CEZ A;  5JVG Q;  1VQ4 S;  1Q5V A;  2ZM6 F;  4IOC Q;  4NMX A;  1BQX A;  1IJF B;  5KFR A;  2DNH A;  2KFY A;  2C2D A;  1CBK A;  1IWA A;  6FD1 A;  5JMN A;  2V8D A;  4J7C A;  4C8Z A;  2AEJ A;  4KT0 C;  1FFS B;  1C4C A;  1XMQ J;  2HVD A;  1NUE A;  3OVA A;  2E9Z A;  1F0X A;  2KT2 A;  2N7Y A;  3T1Y F;  5LMN F;  1HBM B;  3DRP B;  1KQF B;  1E6Y B;  3W5Y A;  4ZP7 A;  1GMU A;  5KFE A;  4A48 A;  4PKD B;  2X7I A;  4IQX A;  1T9T A;  3CJK A;  2ZVI A;  2MZQ A;  2I0X A;  5KFQ A;  1J27 A;  4C3L A;  4ZDN A;  3EXC X;  2N4C A;  3JSB A;  2AYG A;  5EWE A;  2ZBQ A;  1RAC B;  4ZPV R;  1IKW B;  1DTT B;  3DRR B;  2PI4 A;  3KLH A;  2QMU B;  3HHL C;  4ED6 A;  3FC9 A;  2CJA A;  2DNM A;  1MN7 A;  2UXB F;  4IKA A;  2W8L A;  4KO0 A;  2EW9 A;  3RUB L;  8ATC B;  4IG0 B;  2QYG A;  4CTA B;  4CT8 A;  3B8H A;  5D3G B;  2P8I A;  1EB0 A;  3TA0 A;  4CO2 A;  3AH6 A;  3OL8 A;  3WBZ A;  3MED A;  3KNG A;  1HD1 A;  3GSD A;  2UVR A;  1XMO F;  2W4P A;  4JI7 J;  3KK1 A;  3PYE A;  1B3T A;  1YWX A;  2E7V A;  2HBR B;  2CKW A;  4NYZ A;  2FUG 9;  3MTJ A;  4OZ3 A;  2AYB A;  3L7U A;  1ZTW A;  2V9K A;  4JUZ A;  4FN5 A;  2V4R A;  4JI1 F;  3D6F B;  4G65 A;  1WKJ A;  4DSF A;  4L76 A;  2HZA A;  2XI3 A;  4U7C A;  4NCG B;  4B3T J;  2MB0 B;  3DLG A;  2YY3 A;  3J7Z 5;  2PFD A;  2HZC A;  4F0K A;  2AX0 A;  3ZZP A;  4AFF A;  3ZTS A;  4N7T A;  5LSR A;  1J5E F;  1KTQ A;  4TYA A;  3RZA A;  4CDI A;  1OO0 B;  1YIT S;  1WG1 A;  2DR6 A;  2CNK B;  4Y00 A;  4DCP B;  3LP1 A;  3WC2 A;  4ZLP A;  1B64 A;  2Y1R I;  5DDO C;  4WZM A;  4J9V A;  2ADC A;  2M70 A;  5F8N A;  2GAH C;  4TXS A;  3PRD A;  4URG A;  2ZWO A;  1WG5 A;  1XR7 A;  1P9Y A;  2BJ3 A;  2DD8 S;  4MKB A;  2CJ9 A;  3VAF A;  2BQ3 A;  4HI2 A;  2CPY A;  4F0M A;  3MM9 B;  3DLK B;  3UVJ B;  2O67 A;  1YG0 A;  3GIL A;  2RNE A;  1KLM B;  3RTV A;  2ZUG A;  4H4K C;  2B9X A;  4ECQ A;  2KB2 A;  2W9C A;  4B3S J;  1NEE A;  4URS A;  1QTM A;  3CCE S;  1KSP A;  3VGS A;  3W8P A;  3OL6 A;  3R5C A;  3H4B A;  2CRL A;  1XER A;  1WDT A;  3P49 B;  2DHS A;  2MQN A;  4O44 B;  5DDR C;  4EYI B;  1RT1 A;  4LQ3 A;  3ISZ A;  4ETZ A;  1S57 A;  5LMU F;  4HKQ A;  2ZKU A;  2L08 A;  4EBC A;  1FVQ A;  2YKO A;  3OXF A;  3QWU A;  1U25 A;  3W66 A;  2FIU A;  1HBU A;  3MFH A;  4Q45 A;  2Y8W A;  3DXS X;  5HAT A;  4ICL A;  3OTE A;  1RT5 A;  1VQO S;  4X66 J;  2AMC B;  3GV7 B;  2BUN A;  2HFN A;  4V19 J;  2E1R A;  2CQ2 A;  1WOP A;  1SUQ B;  1I94 F;  3IWN C;  2W2O P;  3I9Z A;  2CJY B;  5M2U A;  2QA4 S;  1JMT A;  2LQ9 A;  1M5O C;  1S9F A;  1LWC B;  2F1F A;  2VPZ B;  4RW6 B;  3BEG B;  2AF6 A;  3EJM A;  1AZS A;  4IRD A;  2OD6 A;  3SDE B;  4WPA A;  1V3R A;  1C4A A;  2ZH7 A;  5CD4 A;  2GJ2 A;  2VF3 A;  3IGV A;  2P9C A;  3CGI A;  3KMS A;  1Q5Y A;  2D3U A;  4HDH A;  1YJN S;  1UPP A;  1U02 A;  2PFF B;  2BW2 A;  2VG7 B;  1L3T A;  3AB4 B;  4O3O A;  4ZN3 A;  3BN4 A;  3H5X A;  1GAO A;  3CCV S;  2DCL A;  4I64 A;  3QAT A;  2GVD B;  1ZM3 A;  4DV4 J;  5KG7 A;  2QG9 B;  3VAG A;  3MUR P;  2BEF A;  2W7O A;  1WEZ A;  2W8K A;  2UZA A;  1BLU A;  1XIQ A;  1VBZ A;  1U26 A;  1ZM9 A;  3I5C A;  2IYG A;  3LH2 S;  2V4Q A;  4QR2 A;  1CG2 A;  2XEX A;  1FX4 A;  1SL1 A;  1CPZ A;  1X4G A;  1FER A;  1FKP B;  1NSA A;  3HFK A;  4ECZ A;  2WCX A;  5B0D A;  1ITP A;  4J9P A;  2M88 A;  3HT0 A;  1S1T A;  2FJE B;  1L3K A;  1F9E B; 
#chains in the Genus database with same CATH homology
 4DV5 J;  2UUA J;  1XNQ J;  4KY3 A;  5LM7 E;  4DV0 J;  1IBM J;  3IMQ J;  4JI4 J;  4X64 J;  2UXD J;  1N36 J;  2UUB J;  1HNZ J;  5A2Q U;  5AJ3 J;  4JI8 J;  4JV5 J;  4HHU A;  1J5E J;  2E5L J;  1HNW J;  3D3B J;  4LFA J;  4B3M J;  4LFC J;  4RJV A;  4K0K J;  5LMU J;  1N32 J;  2VQF J;  1N33 J;  3J81 U;  2UXB J;  4DV3 J;  1HNX J;  4LF6 J;  4GKJ J;  4NEZ A;  1N34 J;  3T1H J;  4YY3 J;  1FJG J;  4JYA J;  4JI3 J;  2MEW A;  4LF5 J;  4LF7 J;  4LF9 J;  1XNR J;  3OTO J;  1IBK J;  4NEY A;  1IBL J;  4X66 J;  2ZM6 J;  4JI7 J;  2KVQ E;  4DV6 J;  4X62 J;  3J80 U;  4DV4 J;  1XMO J;  2F4V J;  3R2D J;  4DR3 J;  5IWA J;  4KHP J;  4DV2 J;  4GKK J;  3D3C J;  2MQ8 A;  4NXM J;  3W1Y C;  2KL8 A;  4OX9 J;  4V1A k;  4PWW A;  3JAM U;  4JI5 J;  1XMQ J;  4JI0 J;  4DR6 J;  4DR7 J;  1I94 J;  2UUC J;  2HHH J;  4DR1 J;  4LF4 J;  4AQY J;  4JI2 J;  5IT9 U;  4DV1 J;  4NXN J;  4JI6 J;  4LFB J;  4LF8 J;  5FLX U;  3T1Y J;  4X65 J;  5LMN J;  4DUZ J;  4DR2 J;  2MTL A;  3J7A N;  2UXC J;  4KYZ A;  2UU9 J;  4JI1 J;  4B3T J;  4YHH J;  5BR8 J;  4B3R J;  4DV7 J;  4DUY J;  4DR5 J;  3R2C J;  4DR4 J;  2VQE J;  4B3S J;  1HR0 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...