1XNRJ

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1xnrJ00
4NXNJ 3R2DJ 1IBMJ 1N32J 2KVQE 4B3SJ 2UXBJ 4JI8J 3D3CJ 1IBKJ 3T1YJ 4LFBJ 2UU9J 4X64J 4KY3A 4DV6J 4LF5J 5IWAJ 2MQ8A 3IMQJ 2VQFJ 5BR8J 1HNZJ 2UXCJ 1HR0J 3J80U 2MTLA 4LF7J 4JI2J 5LMUJ 1HNWJ 5A2QU 4LF6J 4DV1J 4K0KJ 4JI3J 4DV0J 4JI4J 3J81U 4KHPJ 1J5EJ 4V1Ak 4LF9J 4GKJJ 2ZM6J 1N33J 4DR3J 4LFAJ 4JI6J 4YHHJ 2UUCJ 4DR6J 4DV3J 3JAMU 4JYAJ 4DV4J 4DR5J 4X66J 1XNQJ 1N36J 5FLXU 1I94J 1FJGJ 5LMNJ 4PWWA 3J7AN 4AQYJ 4DV5J 2F4VJ 4B3TJ 5AJ3J 5LM7E 2MEWA 1HNXJ 4HHUA 4OX9J 4B3RJ 4GKKJ 4JI1J 3T1HJ 4JI0J 4LF4J 2KL8A 4B3MJ 2HHHJ 4NEYA 3OTOJ 1XMOJ 3D3BJ 4RJVA 4YY3J 2UUAJ 2UUBJ 4DUZJ 4JI7J 3R2CJ 4DV7J 1XMQJ 2UXDJ 4JV5J 4NEZA 4X65J 4DR4J 5IT9U 3W1YC 1N34J 4LF8J 4JI5J 4NXMJ 4DUYJ 4DV2J 4KYZA 4DR1J 4DR7J 2E5LJ 2VQEJ 4DR2J 1IBLJ 4X62J 1XNRJ 4LFCJ
chains in the Genus database with same CATH superfamily
3CPWR 3CJ8A 3CJSA 3GJRB 3RBZA 3W3SA 3ZC4A 3BSOA 5KFHA 2AJ1A 2J0SD 4JB8B 1S79A 3JQMA 3MI7X 4N77A 3CWJA 2EFQA 1VRUB 3CW2C 5A2QU 3FGVA 1RKJA 3MPYA 2XGPA 1SJ3P 4C97A 4F0MA 2QG9B 3GCWP 4JI3F 1RYSA 4FXDA 1GMUA 1U0HA 1XBWA 1SKRA 5D8HB 2MKYA 3J7AN 2G13A 4WYWA 2EG2A 3EM1A 3T19A 2KYXA 2JEGA 3NRBA 4DWIA 1WC0A 3QO9B 1DQ8A 3MR3A 4GRSA 2CQ1A 4P72A 3NWRA 3H4DA 3G71S 1HNVB 2RS8A 2W2OP 3V6HA 1N0UA 2RRAA 2VG5A 3LGNA 1RQ0A 1S9EB 2CJQA 1KEKA 5ETPA 2JL9A 1R8CA 4NMLA 3VAMA 5DQGA 2GAGC 1V6HA 1TL5A 2E66A 2E5JA 1NDLA 4OLPA 3DM2A 1CPZA 2DITA 4RW8B 4UOFA 2JLEA 4KAIA 1K73T 1N32J 3QSYB 1HWLA 4X2BA 1IR1A 5IWAJ 2W4PA 1F9EB 3W5XA 4Y65A 1IKVB 1LW2B 5GAEU 4USJC 3KLIA 3BN7A 4BHQA 3M8YA 1YKWA 3I5BA 4DEZA 1UETA 2M0GB 4OYOA 1F2GA 4DR6J 2UVRA 4G1PA 4NCAA 2MB0B 1L3TA 1VQOS 2RH3A 3ZO7A 1RT7A 3E01B 2HFOA 3QLHA 1QVFR 1Y9OA 5ETKA 1N0VC 2JEFA 2QN6B 3R6LB 4L3KA 1NUEA 2GIRA 3G96A 4JI5F 3S8SA 4PWDA 4RWXA 2V9KA 3O3LA 4I0WA 4Q0BA 4WWSA 1GH8A 3PEHA 3PXGa 4K4UA 2Z0GA 5CA5A 1S97A 2XS7A 2LQJA 4CYUB 3LP2A 1S0NA 3RAMA 3NOGA 1ROFA 2FJBB 3QBCA 4NXNJ 2OIHA 2LQ9A 3MMCB 4IFVB 2R7RA 2EKYA 2E1RA 4X62F 1RISA 3O2IA 2DGXA 1U8WA 2ZHBA 4UOHA 3G8QA 1KOOA 3JXOA 1N4LA 4ZHRA 2POKA 1FRLA 4LF9J 1IN0A 4CM2A 3IR6B 5JJBA 3R6GB 5E5NA 3I55S 5L8RC 7AT1B 5J2NA 3A13A 4N7TA 2Y0BB 2C3OA 3TO8A 4RUBA 2BRLA 4UW2A 4BWMA 4ZLNA 5KFVA 4L74A 5ETRA 3UCUP 1LWCA 2R3VA 3PW5A 2XC9A 2V67A 1U0SA 3L4BC 5J2MB 1R31A 1UEVA 3JB9k 2JC1A 3AJ2A 3QT8A 2ZFHA 3SV3A 4F04B 4X4UA 1OSDA 1VOMA 2O3DA 3W2VA 2OSQA 4NA3A 3DRSA 3M8QA 2Y1IA 3FMBA 2CQGA 2CPHA 4KT0C 2XB2D 4O4GB 2CKWA 5AT1B 2AYBA 1RACB 1PYTA 1FJ7A 4WK1A 4ID5A 3H7HB 3HSJA 2W8KA 5CAAA 2HAFA 2HHWA 1HNXF 2HBRB 4JI6F 1S1VA 1KVKA 1IWAA 1JNRB 1UZHA 1DTTB 4LUBA 4EZ6A 1P1TA 3AODA 2IM1A 4RW9B 1MU2B 2MQOA 2BQ3A 1PILA 2EPIA 2RJZA 3I4HX 2VB6A 1X0PA 1C1BA 2MKIA 2E5GA 1NSAA 1CJVB 3MGJA 1T9WA 1NB7A 1WACA 2HFSA 4DCJB 3MR7A 2ZJQQ 4HVZA 4OYAA 1IM6A 1HNVA 1ZA1B 2F8HA 2QLWA 3HHLB 1S9EA 4PPDA 1JB0C 3OJUA 2V50A 3D9BA 5DG7A 3TANA 2DGUA 4KSEB 2NREA 5DJBA 2XY5A 3K2YA 2HIQA 2IBOA 1HBMB 3R5DA 1VLYA 2YWGA 4IOCQ 5CH7B 4G3IA 4BC7A 3NAIA 3P6YC 3A3PB 4TXSA 3G82A 1CJKA 1GFWB 1ZOTA 5L38A 1IKVA 4RU9A 3PV8A 1YBAA 3SDEB 2OFGX 1KOHA 2HQFA 3TJ8A 3KHLA 1VBZA 4NASA 1YBUA 3M9OB 1MWZA 2NXJA 1FNOA 2CDQA 1FRKA 1QAJA 4C8OA 3K7RA 1TMMA 3KHGA 3SZ2A 3RTVA 2AEJA 4WP9A 3E01A 4QR2A 4PKDB 1OPZA 2QTWA 4O0IA 1HNIA 4NPOA 4DSIA 4I6AA 5GAHI 3VAGA 4LF8F 3D3CJ 4YQWA 3GFXA 3FMWA 2A3JA 3G4SS 2XMKA 5I4MA 2AGOA 1FFGB 1Q16B 2MTLA 2KXNB 2MHNA 2F63A 4NA1A 1AUDA 1WKJA 1PGZA 1S1XA 2XTJP 1UVIA 1KONA 4C0HA 4DSFA 3MMCA 4DCOB 1FX2A 4R0JA 3CUNA 5KFSA 5KG1A 1RCOB 1T05B 5D3GB 3H2UB 3UCGA 5KFYA 3CCWA 2DR8A 2MEWA 1XQIA 4DV4F 3HJVA 2ZBIA 1RT2B 4AXIA 3CMAS 3NCPA 3B82A 3CCZA 1XR6A 1U1LA 2J7UA 2BE9B 1QLNA 3AAWB 4LBPA 3G6YA 2XM3A 1S1UA 4ZVOB 3MURP 2VQEJ 4ECYA 3BGOP 3RB6A 5C5JA 4B9LA 3MOJB 4CNZA 1K1QA 1H3DA 2BW7A 3FK4A 2XO7A 1DURA 3VGUA 5J2MA 3BSCA 1DJ0A 3L3CA 1S77D 2H4WB 3Q86A 3N9UC 3DOLB 3RAQA 1EIYB 2QSWA 4M5DB 2Z2ZA 2YKOA 1Z1ZA 2XHCA 4O3PA 2V34A 2LFVA 2D74B 5A0YB 4KPYA 1WG1A 5DG8A 5KOWA 4C8YA 2NZCA 2ZD1A 3CDEA 1J5OB 4TNOA 4M5IA 4ZN3A 1R8HA 3UD4P 2HKEA 1WKKA 5SUHA 2W25A 2OPRB 3GCXP 2HBZB 1VC6A 5E33A 4QWBA 1YJTA 4PZVA 1DY3A 4DV2F 2V2VA 2E5LF 2JH3A 5IZHA 3W66A 4FNIA 2ASDA 4GO5X 2V94A 3T9NA 1H6KX 4WFXA 1DTTA 3HVWA 3Q89A 4EBDA 4NOHA 4RW9A 1MU2A 4DFPA 3T1AA 4KKOB 2VASA 2VQFF 1BWVA 3QGHA 2WVCA 4ED7A 5L39A 4FXVA 2E29A 2FHMA 4PUOB 4S0MA 1RT3B 1H2VZ 2QL9B 2CVEA 2BABA 1NCLA 4GKJF 4KE5A 9RUBA 1S4EA 3IWLA 2R7WA 1EP4A 5KFTA 3ZZPA 2HPUA 3D1OA 5HVHA 4F4AA 5D4LA 2A0FB 2XMJA 2YQ3A 3BGFA 1ZM2A 5AJ3F 3EGZA 1UPPA 2E1AA 2K1RB 4U6PA 1RAJA 2IC3B 2GIFA 5IM0B 1Z2ZA 1HBMA 4ELUA 4AE5A 1FEHA 3Q8PB 1HBOA 2C2OB 3NLCA 5KFQA 6FDRA 2ZZTA 2OD4A 1JX4A 1LWFB 1R0AB 3QJPA 2ZJPQ 3ZZRA 4RKUC 4JI0F 1SB6A 4NYZA 3RU0A 2FLPA 1SVDA 5B0AA 1AROP 1ITPA 3CJKB 4KO0B 3N79A 4ERDA 2ATCB 3S1TA 2WSCC 4C8ZA 4PR6A 3T1YJ 1RTZA 3C16B 4J9RA 1U09A 5E41A 3TJAA 1ICEB 4K0KF 4WJBA 1C2PA 2R7QA 3KJQB 3T6BA 3KDOA 2Y8WA 4I6YA 1X9SA 4YB1P 5AXNA 2IVYA 1P9YA 1UZDA 1Q79A 4DQPA 4ZCLA 1ZYQA 3MAAA 2R8IA 4N41A 3KMSA 2YH1A 1X4HA 2Z2LA 4DV3J 2HNZB 1TAUA 5J1NA 3LO3A 2DGVA 4CM0A 4RBTA 1OMSA 2QMWA 2HS3A 4JYAF 2IA0A 4ZP9A 2QSFA 2KH9A 3ONQA 2BE2A 4QPXA 4IQXA 4DV7F 4NRTA 3CJ3A 1MMDA 4ZVGA 2CPXA 2OPSB 4CH7A 2UVWA 1VR6A 2RKIB 4DR1J 1WC6A 3GYGA 1RAEB 3K5NA 2Q43A 1RT2A 4ICLA 4Y34A 4DR4F 4Z7YA 5BR8F 2JVOA 3QT7A 1YLXA 4U8YA 5K14A 4WTOB 3TEHB 3GYNA 4OYBA 2I9SA 5CXTA 1MSWD 2E9ZA 1S9FA 3VR1A 5LMUJ 5A8RB 2VJUA 5KFDA 1XTZA 5EUHA 4MJKA 2YQ1A 2YWEA 4NCGB 1HQEB 4CT9A 3KJVA 1WHWA 4Y0FA 3TEGA 2KZZA 4UOGA 4CLFA 3C46A 5CZVA 4M5DA 2IRYA 3HSGA 2LKZA 3V6KA 4BBYA 4ZOSA 1LK5A 2QEXS 3GIKA 2RAQA 1RSCA 5A0YA 1RWKB 3QGPA 2HRYA 4LSZB 1RHJB 4LIRA 4CZCA 5LXYA 4MT1A 1CS4A 3ZTQA 3D68A 2GC8A 2Y1JA 2XLJA 1R6YA 1OYEA 2V8VA 4OI1A 3CIZA 5J2PB 3PKMA 3MM8A 1R0BG 3MEDB 5IQQA 1PAEX 5E7OB 3ZNUA 5D78A 4J9UE 2ASJA 2V2KA 2WB4A 2HZVA 2IYGA 3WDOA 3TZYA 2HW3A 3BEGB 4FF2A 2G9OA 4NLDA 2NYIA 4Y00A 5CYJA 1DFDA 1MG7A 4A8SA 2ABYA 5HROB 2XMTA 2BBEA 3U02A 1R89A 4KGZB 1ZTTA 4UT4A 2LXUA 2DHHA 3MCNA 3IGVA 2KVIA 4PUOA 3D0IE 1RT3A 5RUBA 3RRHA 1AA1B 3HVAA 2ZH6A 4DSKA 1H7XA 1RTHB 1SKSA 1HWIA 1TFYA 4IH6A 3HSZA 5KAKA 2BKNA 2YKAA 4ZJQA 4JOUA 2XLIA 1XMQF 2AD9A 4QR0A 4WIIA 1WEYA 2OI2A 5DM6Q 3RW7A 1NXIA 2MQPA 3GZ7A 3US5A 1RWMB 4LRAA 1VQ9S 3FUYA 4JI5J 1L3VA 5KFMA 1Q5VA 4A8FA 5CQGA 1NJZA 2P9GA 4NLPA 2XEXA 5E0OA 1EARA 1RTDB 4IDKB 4ANCA 4U96A 4JI8J 4P2FA 1RBLA 1RE1B 3WQPA 5HMWA 3CJTA 3CJ4A 3CD6S 3EZ5A 3CJKA 4KO0A 2CQ2A 4DV6F 3NEKA 2C2RA 3M2RA 2BVZA 3BKUA 1UP1A 1D9DA 1JNZB 5LMNF 5C24B 3C16A 1VQLS 5CABA 5JUMA 2M9KA 3SCJE 5KT7A 1IKWB 2RT3A 1KQKA 1O8BA 2LU1A 2ZOMA 2KG0A 1KHVA 4Q44A 4C98A 3GQCA 2J9EA 4IR9A 2HNZA 2LLZA 1FDBA 2DNKA 3X1LB 1D1UA 4MKAA 2DNHA 4N47A 4CLUA 1PJ7A 2G2YA 2EC0A 4IKAA 1KKHA 2DEIA 3N0VA 3BYPA 2AW0A 4YP3A 2XSFA 4YFUA 2ADBA 5I3UB 2IPOB 2RDIA 4ZPTR 3W9HA 4LBHA 5HATA 2GMHA 2OPSA 2CJKA 3OXLA 1W2BR 2RKIA 1OY9A 3ILLA 2DBBA 5DRKA 3V6JA 4P2SA 3J81U 3GV7B 2XULA 4ZP8A 4TLRA 4AL6A 2LEBA 2LMIA 5AE2A 1N6QA 1UMJA 3HDSA 1UWAA 1KD1T 2VIHA 2AP6A 1I94J 3MUVP 1VRTB 4C7QA 5A8RA 1H98A 1UL3A 1HNXJ 5GADU 2E7XA 4ATNA 4QR1A 1HQEA 2HIYA 1FVSA 1UPMB 2EK6A 1QVGR 2V0NA 5KG6A 1ZPVA 5A8WA 1F1BB 1Q8IA 4JUZA 3N01A 2VC0A 4I4BA 3EXCX 2H51B 2XY6A 2L41A 3PW0A 4OI2A 4HH1A 2IDLA 4I6WA 2M52A 2FJAB 2DIVA 3HHLC 2GMLA 2ATLA 2DR5A 1IKXB 1YBTA 3KLHB 3IRXB 4JI4F 4QIFA 2FLNA 2WB1D 1RKIA 4LF6J 1RBAA 4OYXA 2B4UA 2J6TA 1YQHA 3R7SB 4OI0A 4UY8T 1EKSA 2YNGB 3GSDA 4ETZA 4FYXB 3W7BA 4J9OA 5HVGA 3C6UB 3EGWB 1FJGJ 1WDTA 4K4XA 1MN7A 3DLLQ 1IR0A 4YHHF 4PXBA 2HHTA 2FB0A 1JJ2R 4IR1A 3HHEA 2OD6A 4CO0A 2CRLA 3BB5A 1UJ5A 4KH0B 5F8HA 4DQQA 4R5PB 1C0TB 4G1QA 2I8EA 3BSNA 2GS8A 1P9QC 4K8RA 4OZ1A 1DTQA 1X4AA 1RWUA 3ILIA 2D3UA 4ECSA 1HHTP 1PIEA 3HJFA 3OR1B 3H4BA 2CQIA 5J1EB 3EVMA 4V19X 1WELA 4X65F 3UO0A 1F6TA 2B3TB 1SQEA 2NSBA 5H1SV 2HGNA 4IOAQ 2J9DE 2ROPA 2HQIA 2VG7B 5BYRA 4C3LA 2MQLA 4DUTA 4JV0A 4XDDA 2G2ZA 4K4ZA 3CCVS 4F7VA 4V1Ak 1RTDA 3C14A 4WP8A 4IDKA 4ED3A 2CYYA 3ENVA 1Y5NB 1YI2S 1NPKA 4P75A 3CB4A 4RW4A 2RF2B 4XIUA 4RU2A 3A8IA 3P3DA 4RO0A 2DPIA 4OHWA 4MK7A 4WP3A 2JEJA 2DHXA 4JV2A 2HQCA 3IO1A 3IM8A 2HSEB 3VV2B 3T1HF 5M2PA 4N5SA 3QIPB 6AT1B 4F2SA 4O23A 2PGCA 3KYLA 2F1FA 2GHPA 1G6BA 1Q7LB 1HQUB 1WC4A 4C4WA 1TUVA 1LW0A 2NUHA 2NQPA 1TKZA 1FXDA 3FKBA 3B54A 5L9XA 2BYCA 5KOXA 3MR5A 3JAMY 1MLAA 2V9WA 4LQ3A 3P5TL 2ZBPA 5THWA 2R2SA 3LAMA 5CZXA 1DLOB 3AB4B 2UVVA 3KUGA 5I3UA 2UP1A 3BR8A 3HKWA 4C0OC 4CLYA 3O6QA 4KTQA 1AZSB 1W26A 3IXQA 4N8NA 4DJBA 3Q8SB 4O3NA 3MMBB 1UWBB 2RD5C 2M70A 3DNCA 5D0GA 5F8IA 3JTOA 3QRPA 3GR1A 2GHVC 2RHQB 3PDNA 5LXRA 2BMBA 3RRGA 2EI5A 2WW8A 3OVBA 2N3LA 1NM2A 2C28A 4DN9A 4DV2J 1VCTA 1TKTA 4Z7CA 4KHMA 2E5LJ 4B17A 1SXLA 3CC4S 3FEZA 2OAUA 2W9AA 1D09B 2VU5A 3MHYA 4DQSA 2GQ2A 2L3MA 2QFJA 2G0CA 1LFPA 1SJRA 2VQFJ 2XQCA 3WHIA 1IBMF 3MOZA 1PC4A 2DNGA 1BE4A 3M8PB 2AWZA 1NK9A 2J9DA 4DZDA 1K47A 1RYRA 4GKJJ 3LUYA 4WCEQ 5D0RA 3THTA 4WK3A 1S7IA 3OVAA 4Q2LA 3KLHA 1RT5B 3IRXA 3CT9A 4OYZA 1AB8A 3HHLD 3BGUA 1C1CA 5AJ3J 1H2TZ 1M5HA 3MMAB 2HHXA 3W62A 3PJ9A 4KGKA 2XMUA 1SKUB 3TUPA 3FFIB 3D6MB 1UFLA 2F4FA 3IWNC 2MKJA 1RTJA 2EBEA 4MIAA 4DUZF 1HPZA 2UXDF 3A12A 2HRTA 2XMWA 3VGTA 3OR2B 1REGX 4DL6A 2UUWA 1LV5A 4K7QA 2RQMA 5HVFA 3A3OB 5CCLA 5HBMB 2NYHA 4A4JA 2LEAA 3I0RB 1CQMA 3BPSP 4XO0A 3OTOF 1V5IB 2H9ZA 2HZCA 3IAS9 1WUUA 3IRWP 4CLPA 4MFBB 4GC6A 2RU3A 5L1JA 4JP8A 1C0TA 3IR7B 3CDUA 2ZH3A 5DLGA 2BRKA 2OPPA 1F9FA 1KDNA 1GXLA 4U9RA 4BS2A 2DXFA 1U02A 3GFZA 3MCOA 3FNNA 3ZZZA 3OR1A 2E5IA 1YJUA 5J1EA 1EJ7L 4K0KJ 2KKHA 4DR3F 3V81B 4WXOA 1X31C 1ZAWA 2C3PA 4Q5VA 2MPUA 2IA6A 2ZC4A 2IM2A 1FK9A 2V6AA 3UR0A 1VBYA 2VG7A 2HBYB 1S76D 5CYQB 3KKFA 4WFBQ 4UQTA 1CJTB 3SSSA 4ALZA 1HL6A 2XYPB 1RHRB 2HBQB 1UFWA 4WE1A 3SXLA 3AD9C 3KLEB 3T5HA 4NLQA 5F3ZA 2AJQA 4NXMF 3L7UA 4ECUA 5IC6B 2W2MP 4DV7J 4DR2F 3J81j 2GQCA 3NKYA 4DF8A 2RE1A 4DS5A 3J7YU 2RF2A 3V4MA 4FF3A 2DISA 1F5CA 1ZS6A 5JXSA 4DPUA 5GAEI 4PXDA 1G4CA 5A76A 3EXYA 2NPFA 3VHQA 3QIPA 5BR8J 4LFCF 2YNHA 3ZXWA 3J80U 5KFLA 2MKHA 1KQSR 1Q82T 1Q8LA 2E7VA 1HQUA 2Z4PA 4EO6A 4L6V3 4UUWA 1CULB 4WZMA 2NSCA 2RQKA 1NSKL 3QJJA 3E51A 3UVJB 4AYBD 3RBXA 4FPRA 3HZGA 2OEJA 5EDWA 4URSA 4MKBA 2FD2A 1RABB 3R8YA 3HI9A 3GU0A 3I9ZA 1X7VA 4QOTA 4JI1J 3LA0A 4I7FB 4JI7F 1AZSA 3T9ZA 3GLJA 1PCAA 3BKTA 4C11B 1BUXA 3BKFA 1FE4A 1VISA 2DGOA 1UWBA 2GVDB 4NEZA 2KFYA 2BEFA 2CNKB 2DO4A 3CJRA 3R7BB 1GX5A 5EWGA 4P74A 4G65A 1N5SA 1XNRJ 1Y11A 4USKA 3GR0A 3F41A 3D28A 1SC6A 3MZIA 1TFWA 3GWCA 4NE9C 2M8DB 3QJLA 3SQGB 2XZWA 3LALA 1U25A 1R8AA 5EN1A 1HW9A 4NL5A 3EGNA 3UDCA 4KC5A 2YTCA 4I2PB 4ZLPA 3CMES 1JLQA 3IG1B 4H54A 2HYIB 1JLEA 1S48A 4RR5A 5KFZA 4KR0B 2JDJA 3OTEA 1G1XA 3MM5A 3QYYA 1N5YB 4AQYJ 1E6YB 3GPAA 3J7ZT 3M8PA 3VCDA 4OZ3A 4ZMMA 4WFZA 4QYZK 5U47A 6FD1A 1UEUA 2XHWA 1G3OA 2IHR1 4W90B 1HW8A 1WEXA 1RT5A 1S1TA 1XMQJ 3GP9A 2QYGA 2U1AA 5B0EA 3MMAA 4KYZA 4C9DA 4KFBA 3H5XA 3ILOA 2R7SA 2VKZG 1HARA 4URQU 3FFIA 4TY8B 4Y6IA 3VTIA 4LFBF 1S9GB 2DNMA 2CJBA 1KS2A 3BBBA 5D0EA 1NDPA 5KFUA 2HVZA 3K5PA 2QA4S 2JNJA 1T3NA 2QL7B 1S0VA 3P49B 1BQNA 3NS7B 5FJ4A 3TAQA 3DOKA 1RHMB 2BOAA 1CG2A 3JYTB 3LPYA 4NLYA 3FBEA 2QO3A 2YKMA 4C8MA 2IRUA 5T7LA 2F9JA 2AT1B 1J5EF 3PX4A 5LMNJ 2EKNA 1ZAVA 1S72S 4ITSA 3IM9A 1ZPWX 3PR4A 2J0QD 3BGLA 1PSDA 3V81A 5HN0A 3EVWA 2KDOA 1BQMB 3PO4A 1OY8A 2WHOA 3RYLA 5HANA 3K5OA 2VDHA 3HKZD 3UQSA 4F4XA 5CYQA 2B7BB 2E1MC 3KHRA 3BGRB 4RZRA 5G0RA 2W7OA 4RW6B 4XTTA 2YPZA 2XMAA 3KLEA 2P9EA 3MM7B 3M6UA 1X9MA 4XPEA 2P8IA 1LWXA 3VQSA 3H59A 2V63A 4FBUA 1MROA 1W2IA 3UDLA 2OTJS 1RT4B 3JSBA 3ZFVA 2DHAA 4F2RA 2OHDA 1U6ZA 4OZ0A 1O0PA 4LBIA 3M8WA 1YJVA 2Z57B 4ECRA 3QPIA 1REVA 1VQPS 1K8AT 3GIMA 1SV5B 2AKWB 1KWMA 4NX9A 4L76A 2D7SA 1VQYA 2YVSA 3LGMA 1HBUB 2KU7A 1VMBA 4K4WA 2WRMA 3HVTA 3KTQA 2ZKTA 5K8OA 4C48A 2M7SA 2HHHJ 2E9TA 2YY3A 1K9MT 3C8YA 4N76A 4K4YA 4B02A 4ELTA 2N3OA 3M6WA 5ETVA 2NXEA 2DGWA 4WXWA 1YJ7A 4I7FA 2EK1A 2FPHX 3OLBA 1HR0F 2P6SA 3KK2A 2Y9HA 3L95X 2GVDA 3PW7A 4NLSA 3RB3A 2BJDA 4DV0F 2CJYB 3OUYA 2HWTA 2KYZA 2MY7A 4LF5F 4JI4J 1X4BA 5L1KA 1RWVB 2OMOA 5SZTA 1U6BA 3KNGA 2BKOA 3SQGA 2BV3A 1H73A 3E2EA 2BR0A 2HURA 1APSA 1FWPA 4B3TJ 3BSAA 4J9QA 1TK0A 1M5SA 2X1AA 2GGPB 1S6OA 1WG4A 5KG4A 2MKSA 4X4OA 4I2PA 3MM6B 4ENOA 3IG1A 5EX0A 3QT6A 2ZVIA 1EETB 3DFEA 4MYTA 1OQ6A 4QIWD 5EWFA 4M5NA 2J0XA 1JLCB 2MLYA 3W1YC 2CFXA 3OPKA 2HHUA 1Q78A 3BJYA 2PC6A 3R9LA 4YB6A 2DCUB 4DPYA 3HSDA 4H4KC 4GVLA 1B0VA 3IP0A 3N4WA 4G1IA 3PKYA 3GG1A 2I2YA 4PXEA 4Y2IA 2DB1A 3I0SB 5L1LA 1B4SA 1A7GE 1TV6B 2VPYB 5HLFA 1HIYA 1S9GA 2YWWA 3I5CA 1W25A 1VFJA 2GA7A 3V6DB 1N48A 4EO8A 1QDUB 2KJVA 5H9FK 2R4FA 1FEEA 4LIWA 3TWZA 4FKYA 1YG0A 3R7NB 2DRAA 1VQ7S 2RDJA 2VFRA 2N4CA 3JYTA 2CZ9A 1YK9A 2MZTA 3FJ2A 5DETA 4QYRA 1VQSA 4B9TA 1WKLA 1PO6A 1V3ZA 2F65A 4OV6A 4WPAA 4LF1A 3NGTA 5ITHA 1U0HB 3G9CA 1I6JA 4YY3F 1SC3B 4F67A 3OTCA 2EFNA 2WBRA 4ZPAA 1NJIT 2BJ1A 2WK4A 1JJCB 2YWFA 1SIZA 2FJXA 1T03B 2PI4A 1NRKA 3HM9A 3FBBA 4Y2AA 2WONA 3UW1A 4RW6A 3GE9A 4O3SA 1SQFA 4P7TA 3CC2S 3AOAA 3PX6A 4HACA 3TZXA 2VDIA 4FS2A 4B9UA 2EXUA 1NU4A 3DM2B 2M8HA 4ZP7A 1U47A 3BYRA 4FBTA 1A0OB 1RT4A 4ED0A 1XWLA 1BWEA 3HLUA 5D4OA 1UJ6A 1FDAA 3KLIB 3V4IA 5KG3A 5I42A 2YH0A 1DQAA 1URRA 4DU7A 3H2VE 1FKPB 2X1BA 2B9XA 4KGVB 2VFUA 3CJ0A 1FF2A 1HBUA 3D6TB 4K4SA 1A9NB 3AA8A 2E1CA 3BREA 3R5AA 1QJHA 2C2ZB 1RT7B 3R2DJ 2XZTB 3QLHB 2KVQE 3UD3P 3TRGA 2MMYA 4A8YA 2ALZA 3KUEA 2ZWPA 2YKNA 5HO4A 5HJYA 4K5RA 3TI0A 5C42A 1QM9A 3I96A 5KFEA 4IG0A 1TL4A 2Z30B 1B3TA 3ET6A 2I38A 2SXLA 2DHGA 3AXKA 2A10A 3LANA 4K4TA 5LJ5Y 1Y4ZB 2MYFA 2WVBA 2PI5A 9ATCB 3WX8A 1X60A 3LP2B 2LU2A 3N5BA 5IT4A 1RA6A 1VS3A 3GTYX 1KQGB 1X4EA 5B08A 3AD7C 4DQIA 4QYZJ 4LF4F 2ASYA 3JSMB 2CVIA 1CC8A 2Y1RI 4F02A 1M1GA 3M9MB 3M1VB 3MPVA 4ZHRB 3MM9B 2FDNA 4DUZJ 3GV8B 2UXDJ 3D0GE 1CJUB 5ETNA 5J2NB 4AXJA 3VAHA 1TL1B 2A2CA 3TVYA 4U7UK 1EETA 4WU3A 3RBEA 4PXCA 1I51B 1K44A 3ADAC 3D5MA 1FVQA 1LWCB 3Q23A 3MFIA 4BWJA 3AD8C 1PJ5A 2V8PA 4A8XA 1X0FA 1Z2LA 1WTBA 1VQ5S 4CLWA 2ZBRA 3LTOA 3K17A 3SYZA 2YWKA 4X66F 2VH7A 2PE8A 4YDDB 3CCJS 1NSPA 1S99A 4EYIB 4DR3J 1YX2A 3BQ1A 3W2VB 2CQ3A 1UA0A 1U49A 3FCWA 3I0SA 2ZWOA 3DRSB 3HMJG 2DIUA 1TV6A 2YXLA 1TK8A 2PDAA 3EVOA 3RGIA 3TA0A 5FIIA 2HHSA 4ZPWR 3LH2S 5KFPA 2D9OA 2DRBA 3V6DA 3FRYA 3HF5A 2KTQA 5DLFA 3HCXA 2DY1A 1WNEA 2GO8A 1HKAA 4LRBA 2ZH4A 4ID5B 3S01A 4NXMJ 4DR2J 3ICLA 3TA2A 2GCFA 2FC8A 1T11A 1S1VB 4MYUA 2DJWA 1LOUA 2AF6A 2F7VA 3EE3A 2KFZA 2B4VA 3VAJA 2E1PA 1NNDA 2K3KA 2OEMA 1C1BB 1AFJA 2CZ4A 4MTPA 3DDIA 8RUCA 4URGA 1F3FA 1N36F 1GXUA 3HX9A 1VBXA 2DPJA 1T03A 4DBQA 4FN5A 2B4OA 1X4DA 3TVKA 1Z4UA 3ZZUA 5B0BA 1M5KC 4PYAA 2B9WA 1Y3JA 4OX9J 4RBUA 4OFZA 2CQDA 2L9NA 3FSYA 2P9CA 2HG4A 1YITS 2BZ2A 1FD8A 1WTFA 1WF2A 4JI7J 2W9CA 1ZM4A 4QWCA 4LVNP 3G82B 1CJKB 1PC5A 2UVUA 4ZPCA 2UUBF 4MIBA 3NMRA 2MXYA 1AW0A 2VZ9A 3J81Y 4FNHA 3C6TA 2H5JB 5GAGU 1FE0A 3TX0A 3AQPA 2ZH5A 1FKPA 2WTFA 3KK1B 3SEOA 3CD0A 5DGAA 2R8GA 4KBIA 2CG8A 3W2WA 3I4PA 2IYIA 2VBZA 1K1SA 1CBKA 1JLGA 2GVZA 5KT2A 1NZAA 1HNIB 2W24A 3F44A 2D9PA 4FYWB 4Y2MA 4OI4A 3QNWB 2E44A 3GMGA 3KMQA 2FJWA 4DV5J 1CEZA 1NHVA 3RUBL 5KG0A 2CPDA 1R7IA 5B0CA 2QYCA 4JV5F 2RSQA 1S1XB 2PA8D 2Y3YA 3BBFA 3NS5A 5KFNA 2XGQA 1IUJA 4I1TA 2ZH2A 3OTDA 4M95A 5KTQA 5D77A 3JSMA 3P8BB 2DYAA 1P8GA 1X4FA 4PABA 2AYMA 4FPIA 3M1VA 4UY85 3MM9A 4LFBJ 2AGPA 1U1KA 4DX5A 1GTHA 3FEYB 5KG7A 4CDIA 1N54B 2VBYA 4ZN1A 1CJUA 5DDQC 1B99A 1TL1A 4LQ9A 4BC9A 4ELVA 5IWAF 1S1UB 1ZETA 4P10A 1XN9A 3MEKA 2W4CA 5DDRC 4PAAA 2ZM6J 5H9FJ 1Y00A 3OQ2A 2HVDA 1DBDA 2XCAA 4C8NA 1FFWB 3VQTA 2JEIA 5GADI 3ETOA 4YOEA 1UCNA 2BANA 4TN2A 1C4CA 1VQ8S 4QWDA 2KL8A 3PCOB 1SBRA 2LQ8A 4Y3CA 3G6VA 2QMUB 2X7IA 2DNLA 1F5AA 2QA2A 2VG6B 4ZVTB 2D1CA 4OL8A 2OELA 4ECZA 3NBPA 2IJRA 2ZD1B 2B43A 3ULHA 4AUKA 4OI6A 1D9AA 2AYGA 2DH9A 3KNAA 2J8AA 4HEA9 1FJEB 1FJCA 4YR2A 3UNGC 3M30B 5ETMA 2HVHA 4KHRA 3EJMA 1F5BA 2H3EB 3HHKA 3VGSA 1CQNA 2PMHA 1TL3B 1R8BA 3EZUA 4BDPA 5KFBA 2QGFB 3BF4A 4B9NA 1S12A 3NCRA 5IS2A 1ZTWA 4RBVA 4LF9F 1KC8T 2L9WA 3WZ0A 3JQJA 4OJ1A 4F4WA 2HVIA 1GMVA 4R25A 4DFKA 3SCLE 4DL5A 2XS5A 2QX0A 2MSTA 2MKKA 3KHHA 1MNEA 3H5SA 3M2VB 1N34F 2C42A 1M5OC 3D4JA 4N8OA 3P96A 1EP4B 5F9LA 3MR6A 2RUGA 2J6SA 4P9SA 3FQKA 3CULA 1U2FA 4OQJA 3LP0A 1YTYA 3OHBA 1HBOB 3MEGA 1U1NA 2DR6A 3MUTP 1HR0J 3H5YA 2ZH8A 2IFXA 2DCLA 3AY0A 4KHPF 2NR0A 2CNOB 5DO2A 4DV0J 2CA9A 4LFAF 3KXDA 5HQMA 2UUCF 3OSNA 4V19J 4EFAC 1SPBP 2ZE2A 3KK1A 1FXRA 2IRXA 2FHJD 4B3RF 2CAJA 2ZBCA 3CJQA 4X4PA 3T5KA 4USVA 1Q8BA 5H9EJ 2VODA 4DX8H 2AJ2A 1NKEA 5A8KA 1Q95G 4DUYF 3ISNC 1X5PA 3MAAB 1RAAB 4M1KA 2YX1A 5DS7A 3SFGA 4UZBA 5DZ7A 4QQBA 5KFCA 4X64F 4CIOA 1RLCL 3DXBA 4PQUB 2XBPA 1NHUA 2W2NP 3A8KA 2BE2B 4JI2F 1MN9A 2R8HA 1RAGB 2FVSA 2C2KB 2QV6A 1FTRA 4GVBA 1KTVA 4ED8A 2HNYA 4DDFA 3IBCB 4HH0A 4ILLA 3AH6A 4AL7A 1XNQF 5KFWA 1SCJB 2QFIA 2R9LA 2X51A 4ICLB 1SJ4P 2BJ7A 4DXLA 1Q81T 2HLUA 1QSSA 4PRFA 4A8WA 5K14B 4PWWA 2HAIA 5AXLA 4HDHA 5DZ6A 5C7PA 2XCPA 3I5AA 3UCZP 4NYPA 2HRUA 4B3MJ 2FIUA 3OVSA 1X5SA 1Q53A 3KK3A 4DL3A 2OFHX 5E2QA 3KJVB 4NLVA 1WEZA 3I31A 2XY7A 4O3OA 3MEEB 4ZPVR 3B6BA 5LT5A 1FNXH 4DR7J 3T5LA 2KM8B 2LDYA 3UFCX 4WF9Q 1NJXA 5F3TA 4J90A 3GIRA 2J5AA 2VG6A 5F8LA 3M8SA 1CS4B 3D0HE 3GFHA 2NUUG 3KLFA 1F2HA 3SIPB 3ZTOA 2R2TA 4G6VB 4A48A 1UVJA 1N33F 3TP2A 1H72C 3MM8B 4ZVEA 1KRPA 3SMZA 1NMEB 4J7CA 3OV7A 5CYMB 4OI3A 1ZM9A 4YR0A 3CNQP 1FT8A 4CRJA 3EPIA 2G0IA 3M30A 2PSZA 2OH2A 4NZ0A 3CCLS 3P4UB 4ZIWA 4ZVSB 3TNVA 1TL3A 2XSJA 1S1WA 3QT5A 4EMDA 4CLLA 5JVGQ 3H20A 4H4OA 3BO2A 5HK4A 1S4FA 2CJ9A 3AXMA 1U1OA 1RXOB 3BDPA 1FKAF 4FVMA 1WORA 1JXVA 1DRZA 2WBMA 3J80Y 1FTCA 2Y8YA 1L3SA 2VICA 3HVRA 4OJHA 2WAQD 1FRIA 2MQNA 3M2VA 5IQ6A 3CDWA 2VQEF 2MLZA 4KY3A 1UW9A 4KQZA 2PFFB 3AJ1A 2A2DA 5DG9A 2HQGA 1U1MA 2CG4A 2AZ1A 1KHWA 2BACA 3TUIC 2J8SA 3OLAA 2JC0A 3PR5B 1BLUA 4F4KA 2ADCA 2BQUA 3LF0A 4O44B 4WFAQ 3A4TA 3NGDA 1XIQA 1PYSB 1WJ9A 1CC7A 4HHUA 4F4ZA 2V4JB 3UDEA 2B8PA 4X4TA 2WOMB 4LF4J 1WC1A 2MSSA 4M63A 1VHIA 1U2CA 3M2RB 3T41A 2D3O1 2CJAA 3D6HB 2J7WA 3DYAA 4DF4A 3J7YI 4OHZA 4TYAA 4NMXA 3DRPA 2LP4A 4HHHA 2FGCA 2QZ8A 2X3GA 8AT1B 4LF2A 1T9VA 2DGQA 4Y2KA 3G6XA 3NXZA 5HMXA 5KT6A 3VAFA 3C15A 1AXQA 1HNWJ 3J7Z5 3ISND 4IH5A 4ED5A 2NZ4A 1VRQC 3DMJA 4J9PA 4PQUA 2RB7A 1T02A 5BXIA 2AQ4A 4DL2A 3UR3C 4X66J 2CPYA 2DNYA 2B5JA 4HI1A 1WF1A 5KFXA 4Q8EA 2PD1A 4EEYA 5MLCV 1N5VA 2AJ0A 3DDNA 1RAIB 4PG4A 5M2UA 2FZCB 3OBIA 3K57A 4ZITA 1XEZA 4ILMA 2M2BA 4QW8A 4FF4A 1N6QB 4BCAA 3W64A 1IBKF 1BD6A 5HL7Q 3MFHA 3C2PA 2ZHOA 3F56A 5HI7A 2NCKL 2DNQA 3Q24A 2JJ4D 3O5TB 3MF5A 1VQ6S 3MEEA 1TU0B 2QT7A 2RNEA 3WBZA 5A8WB 3T1YF 4P71A 2CQBA 4W4MA 4JI3J 1SC4B 2UV8A 4P52A 3TAMA 4OV1A 4OHXA 2K2PA 2HFNA 3FZ2A 2R7OA 3SV4A 1N36J 2Z58B 2H65B 4KIAA 1OJ4A 3PYEA 2VD3A 1B7FA 4DV3F 5CYMA 2FC9A 3RBDA 1LEOA 1QY7A 1RT1B 2ACMA 3CCTA 1D9FA 1U8SA 1WI6A 4OZNA 5KG2A 1AT1B 3CEDA 1U1PA 4B9VA 3G8TA 3JSYA 1LWEB 2FQQB 1L3UA 2HEKA 1Y3KA 1KTQA 2CADA 2MZRA 3DOMA 4DU8A 5KFAA 1B7YB 3BQ2A 3DHXA 2RMLA 3DI6B 2B6AA 3D1QA 2VL1A 3P45B 4G1QB 1ZA2B 1JLBA 3CCRS 1DTQB 5HJXA 4ED4A 3DLHA 1U48A 4ZCKA 1YJWS 2VOPA 1IR2A 4EBCA 4GO7X 4NA2A 3W65A 2CQHA 1UVNA 4P6QA 1HI8A 4PWUA 5LMUF 4NLGA 4CLKA 4LMZA 1B0TA 3WIUA 3QQCD 2B8QA 3DRYA 3M6XA 4ES3A 3TOQA 4KV8A 5ETSA 1VBKA 5LM7E 4YB5A 4ZPDA 2DTJA 1TQLA 4F36A 3GIJA 1SC1B 1RWPB 4DG1A 2B7CB 1M5PC 3C14B 3U7JA 1WHXA 1BC6A 4O44A 4JV5J 4UF4A 3DLJA 2NXCA 4CT8A 4DL0C 2CPJA 2H1YA 2V4JA 4UZCA 3DLEA 1HBNB 2L9DA 2DH7A 2WOMA 5IT0A 1QAIA 2LA4A 4X62J 2XNQA 5KFOA 4RW4B 2UXCF 2Z56B 2OP5A 1F3VA 3FQLA 3NGKA 4RW7B 5MAOA 1S6PA 2ZUGA 3WC0A 4ZVFA 4K2XA 3N6LA 2DRDA 4YMEA 4N56A 5CCMA 2BE7D 3Q2TC 2CIMA 1HYSB 1FWLA 1VC5A 4NI2A 3VAKA 2V8GA 1LW0B 1WSVA 1TKZB 2QA4G 4DFMA 2RUSA 1NEEA 2RHSB 5LL6d 1TL7B 3IS9B 1EAYC 1TVRB 4B9MA 5DQIA 2GMJA 1S6QA 1XR5A 3CIMA 3HULA 1S5ZA 2R7UA 1YWXA 1JJHA 1ZZNA 3LPEA 4CQ1A 2Z2MA 1N88A 2A1BA 2HQDA 1DARA 1RWXB 2W4DA 1IQZA 4NLTA 3GIIA 4JI8F 1TR0A 1M5VC 3HHDA 3PG9A 3R97A 3P5BP 4HKQA 1S49A 2KXFA 2BXJA 1HA1A 2ACYA 1TKTB 4NLRA 2QMXA 1RTIB 1IVZA 1SI9A 2DR7A 3MUMP 5IC4B 4OJGA 3ZZTA 4JI6J 3QIDA 2FVCA 3W9JA 1JKHA 2MQMA 3M32A 4E2FB 4F26A 4LRCA 3CCUS 5B0FA 4WZQA 5K5MA 5C2CA 2O5DA 5CD4A 2W9BB 3OXGA 1TKXA 2E5HA 3G86A 3Q22A 3B8HA 3UWTA 1VQMS 3GFYA 3TUZC 2ROEA 2XI2A 4Y2CA 2KZMA 2XMMA 1VHFA 2Z2YB 1N8RT 1NK8A 1X8DA 3R2CJ 2QLBB 4YR3A 3PRDA 2KFNA 5KFGA 2DT9A 2CQ4A 3PFEA 1N34J 1K0VA 5I3QA 2IVMA 1SL2A 2IAJB 3MCSA 1BHNA 3QFHA 4EYHB 1ZAXA 1OQ3A 1C1CB 3JQKA 1RT1A 1U1QA 1XERA 2OLWA 4TLQA 4MKYA 2HHVA 5KG5A 5BYSA 1RTJB 1HPZB 3O44A 4ES2A 5A6PA 3HFZB 2KT5A 1LWEA 2IVFB 3NNHA 3K0JA 2M5YA 2WCXA 4KHPJ 4H4MB 4DFJA 1UVKA 3HFVA 3POTB 2D41A 2W7PA 1Q86T 4LFAJ 3DI6A 1SIWB 3A3NB 2UUCJ 3RZAA 2LQBA 1IJEB 2Q6BA 1U7LA 2OPPB 3MPWA 2M88A 4DLGA 2CPZA 1FRJA 1Q5YA 3H0PA 1RLDA 1HLWA 2DKOB 4B3RJ 5LJ3Y 4NWBA 1I94F 2LEPA 1S6UA 2XS2A 3LWMA 4CLTA 5IFMA 3I6PA 1PYOB 3PHTA 5K8MA 1VRUA 4NCBA 1FK9B 5IT9U 4LF8J 4DUYJ 4NRUA 1UVMA 2AGQA 3AOCA 4KH1B 4ZJOA 2N4DA 2EBGA 2KT3A 3QAUA 2GJIA 3QMQA 4X64J 4WE1B 4LF7F 4CH1A 5JVHQ 2QRRA 5DQHA 3D1HA 3CDAA 3QO9A 3HT0A 4Y28C 3AQOA 3DRRB 1YGYA 4I56A 4JI2J 2XYGB 1HBNA 2HNDB 2F8EX 4CO3A 1S57A 2FZGB 4RUHA 4RW7A 5HAOA 4LF6F 4M5LA 4DV4J 2PMWA 4TU7A 1LK7A 2AMCB 1XNQJ 3PM9A 5C2GA 2RRBA 1FA0A 4RW8A 1YJRA 1EX8A 2YNHB 1RP5A 5KFRA 3QRRA 5D4NA 1HYSA 3PW4A 1FJGF 2PN6A 1Q7YT 4RX6A 1EKRA 2VFTA 3W8GA 4L3NA 3WX4A 3RR7A 3W9IA 3SFUA 1LW2A 1M0SA 5GMKa 5D15A 2FHOB 4U95A 4M8LA 3R5GA 1B64A 1HQ2A 4XAKA 2VHGA 2DNOA 1RI7A 3JS9A 2DD8S 3PZPA 2EFVA 1TL7A 3IS9A 4YB7A 1HWKA 2KM8C 3BS9A 5M2RA 3RW6A 3ZTPA 1TVRA 2CXEA 1N5QA 2B0GA 2LVWA 5F41A 1LNQA 4J9KA 2FTRA 4RNOA 4ZVHA 2MZJA 1EHWA 1GAOA 5I3PA 4M5MA 2VPZB 1LQ9A 1NK6A 1OSCA 2RDDA 3HK2A 3I82A 1N33J 1R3NA 3KJFB 2DO0A 4YS2A 4DPTA 2AZ3A 1RWWB 1S7HA 4ZJLA 2Y1LB 3CO9A 4DN0A 4IFYB 4K59A 2AIRB 1YRTA 1CSJA 4CYUA 4TYBA 4XK8C 5LSRA 1T9XA 2FJVA 3RRKA 3B4DA 1RTIA 3GYXB 2KRBA 3OFGA 4NZ7A 3KJNB 2UUAF 1WWHA 5A2QY 4IFVA 4QPTA 4L72B 1GX6A 1I5OB 3PX0A 4F8RA 1ZBTA 2EFGA 2GO9A 2OSRA 4FYDA 1JLQB 1IJFB 2W9BA 1JLEB 4CI0B 1FI4A 2ZITA 4X4VA 4OZ5A 5B0DA 2HS0A 2JVRA 2JSXA 3Q2SC 1FHTA 3MM5B 2IM0A 4ED1A 3CCSS 2RQCA 4C6AA 2HK2A 3NGSA 3S6EA 3QWUA 3MTJA 1NH7A 2N7YA 2RVJA 2AYEA 2RQ4A 4F4YA 2MY8A 3KG1A 4YN3B 3MWBA 3UDVA 3L7PA 4K4VA 2IAJA 3JTPA 2ZZMA 1RU1A 2X3DA 2AV5A 1S1TB 1DZ5A 1SJFA 3H98A 1JIHA 1JJ4A 2O01C 4KFBB 2YPYA 1XC9A 5D6GA 1SQGA 4I69A 1WC3A 2MJNA 2VUGA 4OX7A 2ILYA 3Q8VA 2FY1A 3OL8A 2ZHAA 4GKKF 5G4DA 4OIXA 3T6JA 1Y10A 1HD0A 2PT0A 3PJWA 4H4MA 3KUHA 1BQNB 1FCAA 4JI0J 3POTA 4TVAB 5KT4A 2HFVA 3M4XA 3ENAA 2DXEA 2DHSA 3DOKB 1TK5A 4C3KA 4QZVB 4O4GA 3Q8RB 4KRWA 5ETLA 1Q4RA 2YKMB 3CVKA 4D3GA 5T7LB 2JFKA 3EYZA 4HYKA 2R7TA 3WIVA 1SL0A 1M90T 3FBFA 4KB7A 2J0WA 2KXHA 2IDEA 2PEBA 1NZ8A 2LYVA 2FUG9 1WSRA 4EWTA 1NH8A 2KT2A 4WTYA 3SBMA 3C3LA 2DNZA 3BV8A 2EWHA 7FD1A 4Z37A 4C8LA 1JMTA 1JLAB 1HFEL 5G0RB 2ZUAA 2ZNZA 4CWBA 1FNMA 5K8PA 3MTKA 1CJVA 4YDXA 5E3AA 4JYAJ 3HZEA 3OXFA 4HTJA 4MKVA 1JQGA 1VK8A 3DRRA 3MECB 1LFWA 4Q2MA 2HNDA 1Y5LB 1MROB 3QATA 3HHLA 5HSPA 3CF5Q 1WC5A 2VBWA 1XMOF 2Q6CA 3JSRA 4M94A 5LOQA 1RHKB 2AX0A 5F8JA 2DK2A 4ZVQB 1SKWA 4RNNA 3J7A1 1QUVA 1VIOA 1NDKA 4DR4J 1REVB 3DN9A 3FRZA 3UD5A 5GAGI 1NHKL 4JV1A 3HVTB 1YRXA 3PFOA 1HNZF 1O6XA 1IBKJ 2P5VA 3NMAA 3SDEA 1U26A 2VA2A 3OL7A 3N6MA 2F9DA 5D4PA 2H5IB 2Q1LA 3CO0P 4L73A 2V5HG 1K0TA 2BUNA 2OGUA 1WHYA 3FZBA 4IUFA 3AHPA 5F0WA 4LT6A 5DGBA 1GQEA 4ZVRB 2PO4A 5KFIA 3KK2B 2AX1A 3TR5A 3FSIA 5F8MA 2MDAA 4MIWA 4LR9A 2M4MA 1H0HB 2HK3A 4YUDA 3OUYB 4F25A 1NBEB 1O5JA 3GSIA 1YRUA 1RAFB 3PRVA 1WHVA 1QTMA 4IFYA 3CC7S 1JXEA 2OPQB 4FP9A 4PG8A 3GJQB 1HHSA 2VA3A 3PIOQ 4A46A 4OYPA 4OYMA 5E3PA 4KJIA 2MHEA 1TMJA 2YQ0A 4QIVA 4P2XA 2ZH9A 2KN4A 1T05A 2K8GA 5D3GA 2LXFA 2W1BA 3GV5B 3LOUA 4OLOA 4WKRA 2R8JA 1QSLA 2HVEA 1T8EA 2W8LA 1GMWA 2FLLA 4YEAA 4CP5A 1V3SA 1V5VA 1U45A 2F4VF 3FBCA 1UW4A 3B78A 3RG6A 4QU6A 2R2UA 5KFJA 4QU7A 1X5TA 3V2UC 2V4RA 3KLGB 2OKQA 3DLGB 1TZ0A 1GXTA 1FXLA 2ZOFA 4ECQA 4WKYA 4UOCA 5HLFB 1RHQB 2B56A 3DOLA 2YX7A 5CHCB 2IM3A 4JI1F 5JMNA 1SJ1A 2ZH1A 3S7RA 1IQTA 3AA9A 1IBLF 4NZ6A 1YZ6A 4U7CA 2CQCA 5HQ8A 1QE1B 1SUQB 4CO2A 2HQ3A 4IYQA 3HHNB 4K50A 4OX6A 1F9HA 1X4CA 3PY8A 1J5OA 4DV6J 2BX6A 1S59A 1XNRF 3ZZYA 4CLZA 2UXCJ 1N56A 2EVZA 1FESA 2OPRA 4ZVPB 5E3QA 1AYEA 4IO9Q 3UN2A 3GG0A 1GK8A 4R0EA 3ZTSA 3NGUA 3ZZOA 4ZCMA 2BJ3A 2P6TA 1H2UX 2ILZA 4CO4A 5FLXU 3QSIA 3SCKE 1R6VA 4KKOA 1JLAA 3OT9A 3KLVA 4MH8A 2WONB 1KLMB 4AQYF 4XPCA 1L3KA 3LGHA 2IJNA 2CWXA 2BM0A 2HS4A 3FEXB 2C2DA 4HACB 3MECA 1NAQA 3CCES 4FXWA 3CDBA 1UA1A 2DGTA 2RU9A 1D0EA 3IN5A 3FC9A 1FDDA 3UN5A 3CJ2A 3H8YA 2B51A 2MGZB 2UU9F 2IBKA 3R3TA 1URNA 4CH0S 2K1RA 4DPWA 5KFFA 3LWLA 3V4IB 3FSXA 1FRXA 1NO8A 5I42B 5GVQA 3BR9A 2IC3A 4ECXA 3FCVA 1TTHB 5IM0A 2C1EB 5F8NA 1P27B 1E6VB 4ZVUB 1ZZFA 1LWFA 2BJ9A 1R0AA 4FDFA 1MW7A 4HDGA 2HLTA 1WD6A 1NPRA 2NPIA 1B70B 4M5KA 1QAXA 1OO0B 3W8PA 2K7KA 1OPIA 4RWWA 2YKNB 3VF0B 1VQ4S 4ZS6A 4EGLA 5C42B 2NXNA 3IC1A 4IG0B 4HR2A 3ET6B 4GMKA 3R5JB 1UAWA 3QGIA 4WFYA 1KSPA 1M1KT 4LSLB 3MMJA 2QC3A 1JK9B 2XWYA 4PCQA 1EQMA 4IH7A 4P73A 2ZEJA 2VV5A 1YSJA 2J9CA 5IOLA 3W61A 2EG1A 2OPQA 1VLOA 3ENWA 2FJEB 4FYVB 2KG1A 3OFEA 1T0TV 3MAQA 3LQVA 1PAUB 4K2JA 2HHQA 2C2MB 3GILA 3QGGA 1VYAA 2D3OR 1P1LA 1R27B 4YHHJ 4OZJA 2EC2A 1QTNB 2JWNA 3PJXA 5EWEA 2YKQA 3EICA 2O66A 5E3RA 3RB4A 3DGPB 4AL5A 1WG5A 2ZOGA 4B3OB 4OX8A 2AU0A 2JHEA 1RU2A 2MZSA 4Q45A 2HMIB 4TKTA 3MD3A 4OHYA 4A8QA 5IV4A 2IIHA 1MMLA 3D67A 3KDNA 2A6MA 2CQ0A 3HP6A 5B09A 2VFSA 2NLWA 2F5GA 4X65J 2X1GA 2HHHF 3KLGA 4NCGA 2VJVA 3DLGA 4TU8A 4C3MA 3W5ZA 3FVYA 4QWAA 3G8SA 5EX3A 2FHKA 4U7UD 1PG5B 3DC2A 2W01A 2W7AA 3D54A 4DCPB 2MQ8A 2YBVA 4IOBA 2CDRB 1C0UB 2DR9A 4E0DA 2GNKA 2PFDA 2Q79A 3THVA 4LF7J 4EU0A 1FD2A 1QE1A 3F0NA 3NP5A 1SUQA 3IAM9 2JLGA 2MZ1A 3HFKA 2V69A 4DR5F 2QE5A 4FS1A 1BQXA 1CVJA 5J2PA 5BYQA 2PIIA 3IGNA 3MEDA 3PRBA 3BO3A 1VK3A 1HWJA 3LW5C 3MXHP 2I6WA 1X9WA 4QWEA 1RZMA 4DZ6A 2FJDB 3NOCA 3A1YG 2A6OA 3TZWA 2GJ2A 3T1HJ 2I0XA 1N5TA 1TKDA 2RS2A 4B3TF 2G0JA 5KT3A 3K8VA 3H5UA 2ERRA 2CWKA 4IO1A 3NS6A 3CGIA 3OHAA 5HROA 4RNFA 5LSOA 2IY5B 2WW4A 4DQRA 3BN4A 1Q0NA 4B3SF 1KLMA 2QLFB 4IG3B 3HPOA 3AOBA 1N52B 3L7OA 1ZM3A 2JFDA 1RTHA 4DV1F 1FERA 3TJ9A 1FRHA 2B9EA 4A8KA 3AB2B 1F60B 2W9CB 3FDSA 1LXNA 4O4RA 2MGZA 3HD1A 3Q0AA 1VQKS 2ROGA 2QL5B 4DX7A 3BQ0A 1RAOA 3N6NA 3C6TB 4ECVA 2ASLA 4KGXB 4HT7A 5K8NA 1I3OB 1PKUA 1PBAA 3UPFA 4R8UB 1E6VA 1RCXB 4LREA 1WDDA 4IRCA 1EQ0A 4W98A 1PJ6A 3Q83A 2R8KA 3LAKA 3OFHA 2J6UA 2X1FA 4I68A 3W2WB 4B9SA 4F3MA 4LRDA 4J9NA 3I9V9 2GVZB 1JLGB 2U2FA 2UUAJ 1GTEA 4X4SA 3L9ZA 2YKPA 1HHQA 1NK7A 2CZVC 1RWNB 2C3UA 1GEHA 2IMWP 3K59A 3C19A 3PEJA 2JLFA 5DDOC 4NYOA 4EI2A 1VC0A 3FCHA 5C24A 4LVOP 4WU2A 4L75A 1YZ7A 1IBMJ 2B9YA 1ZH5A 3RR8A 5GAHU 1RT6B 3B4MA 2Q66A 2ZNYA 1RDRA 2DH8A 5IV3A 2O67A 4AT1B 1HWUA 1IKWA 4QCLA 4LSLA 4QW9A 4CLSA 5L9NA 2ZVSA 1JWWA 5F0UA 3D7SB 2K06A 2R42A 4NLUA 5ETOA 4TU9A 1LXJA 3V5RA 1NDCA 4E98A 4HTIA 4ER8A 2MKCA 1T9TA 3BO4A 2AEMA 2CPFA 2FVRA 3M05A 3CXCR 4ETXA 2MQQA 3BH7B 2MZQA 2VF3A 5T41A 1V3RA 3MPUB 3ILJA 1ACMB 3R5CA 4RLEA 1U4BA 1YJ9S 3DU6A 4GKKJ 2EEYA 3CMQA 2FVPA 1FRMA 2N7CA 2Z8QA 3OTOJ 4J5OA 4ZCIA 3N28A 5D0HA 4ED2A 3DGPA 1IXKA 2XNRA 4HHJA 2GIQA 3R5BA 1VI7A 4B3OA 2HMIA 1LKZA 4DLEA 2UXBF 2C2EA 4PG5A 3BBCA 3E3XA 3M6VA 3G87A 3VWSA 3M2UB 1OY6A 2MJUA 2BANB 1Y5IB 3PTWA 3NL0A 1VRTA 5J2QB 3E8OA 3G6ES 1XJWB 1G7CB 1UJ4A 5HP1B 2MLXA 1AUSL 1JXLA 4QIGA 3NNCA 1KNZA 3NBPB 3SCIE 5F9NA 1HI0P 1KN6A 1BY9A 2BDPA 2APOA 1RADB 2C22A 1C0UA 4USMA 2FLOA 2W2PP 4U8VA 4AFFA 2EFOA 1NKCA 3EGVA 3W5YA 1NB2A 2HZAA 1PBUA 1M1HA 4PG6A 3OSPA 2WZ1A 4OYIA 1IKXA 1XMOJ 3JTNA 2BM1A 5K20B 4O3RA 2LDIA 4MAKA 2LQ5A 3AT1B 1G2EA 1X5OA 3KG4A 4J9SA 1U6FA 3G2XA 3TZZA 5ETTA 2KO1A 2YNGA 3OFFA 5EGYA 4LFCJ 3C6UA 5HMYA 3K5LA 1TUWA 4ZP6A 1HNZJ 3M7VA 2ZBQA 3QAEA 5AE3A 1T9YA 1EZZB 3TQ1A 4PG7A 4R5PA 4IG3A 4ZPBA 2C3YA 4ZA1A 1SH2A 4HT5A 4WFNQ 3Q8QB 2I1RA 2R7VA 1B0PA 3LP0B 4F0KA 3PHEA 4DSJA 3MEGB 4H4KA 4LR8A 3IR5B 4LRFA 3ZNJ1 2KRRA 1A6LA 2DXDA 3TW0A 1H7WA 1JLFB 4ANEA 4TQSA 2BKPA 1VJQA 1ULRA 2M3DA 4IQMA 2VFVA 2CUYA 2V68A 1S0OA 4RNHA 4ZLJA 3DRXA 1YIJS 1TP7A 4R8UA 1OWXA 2G2OA 3NNAA 2ZE2B 5GMEA 1Q1KA 3IWXA 1NJYA 1RUSA 4ANDA 5A6WA 3RAXA 4J91A 1NK0A 1UTAA 3AJDA 2RRNA 3UNYA 3SQOP 3U1NA 5A8KB 1VJWA 4RL1A 1FO1A 1T7PA 1TAQA 1XR7A 2VPXB 3ELHA 2KB2A 3KWMA 3DGVA 3TVZA 3RB0A 2VONA 4DI6A 2KI2A 1RT6A 2HWIA 1FWKA 4OZ2A 2D3ZA 2AJ4A 3D66A 4C2MA 5HMZA 1EB0A 1GMWD 2F4VJ 2AEFA 4TY9A 4GVBB 2KHCA 2XI3A 2C3MA 2VC1A 2BW2A 1C4AA 4WBFA 4QIEA 2HNYB 2D69A 1V9OA 3M9NB 1GNKA 4OX9F 4O0NA 3NAHA 3KOAA 1SJQA 1DLOA 2BJ8A 1DQ9A 2J76E 1MWQA 1KFDA 2YNFB 4F0HA 2E7WA 2GV1A 2VOOA 4C8KA 1N32F 3H40A 4CO1A 4ILRA 3OJSA 5DM7Q 4J9VA 1IBLJ 2EW9A 2JRSA 3PYGA 4DSEA 3NCQA 1S10A 1TELA 4XDCA 3CJ5A 4Q8FA 3MMBA 4A8OA 4E8UA 3EDRB 3UN3A 3IMQJ 3VGVA 3R1LA 3MD1A 4PYDA 3KK3B 3OD2A 2XO6A 2HFUA 1KVJA 5J1PA 5HQLA 1RK8A 4DR6F 1J5EJ 2RIJA 3M2UA 3NGRA 3UI3A 2GHWA 2JOQA 1KFSA 2XLKA 3MPDA 2FVQA 5J2QA 1NLKL 2LA6A 5HP1A 2FGOA 5IT9Y 2GZOA 1NKBA 1WOPA 4EK2A 3K5MA 4OHVA 3KLFB 4C0BA 1F0XA 1SL1A 4RUCA 2OJ3A 4D3HA 4DV5F 1FX4A 2CPEA 4F50A 1Q8KA 2DGSA 1T9UA 2QLJB 3DHWC 1NK5A 4EZ9A 4X4NA 3EDQB 1QUPA 2QJ3A 4NXNF 3IBWA 2VPWB 3PYFA 1QAYA 1RWOB 1T94A 3PVXA 1HMVB 3PNIA 4WIQA 3RJMB 4DL4A 2XSJB 1S1WB 2UU9J 4FVCA 2V4QA 2PEHA 1AFIA 1DHMA 4H4OB 2C2NA 4U67Q 4M5HA 2KHDA 4BLGA 1IKYB 3R27A 3DLKB 3L09A 3K8WA 2OTLS 1J27A 4I67A 2I5JB 4HL9A 2EFPA 3MAHA 3W63A 2COLA 3OR2A 3BZQA 5FDLB 3U1MA 2WVDA 1RA7A 3TUJC 2ZKUA 5HBMA 3I0RA 1KVIA 2YNIB 4PQAA 1UEKA 4F3QA 1O51A 4ECWA 2ZM6F 3OL9A 4I2QB 3VZHA 5T14A 2GFFA 4J9MA 4MFBA 1H38A 4HI2A 4LJMA 2V2QA 5K9FA 3M8RA 4AD6A 3H90A 2R2RA 4ECTA 1S0MA 4MK8A 2OMLA 3LP1B 2FZKB 1WOOA 2NXUA 1KQFB 2HGLA 3I87A 2CJXB 4KGMA 4PPZA 3VVUA 5KFKA 3K58A 3VAIA 1JLFA 1BXNA 3IBFB 4IRKA 1WI8A 3GB0A 4LF5J 5L46A 1U2RA 3M8ZA 1RAHB 1D8ZA 1CJTA 2V8HA 1RBOB 4M5JA 2LECA 3TQEA 4FF1A 3MCMA 1OIAA 2QLXA 2PMZD 3OW2R 2XMVA 3U27A 3DYAB 3GJSB 3CTRA 3DRPB 2G1DA 3MR2A 2FYXA 1FDNA 2GJFA 3DLBA 2F3JA 4PEOA 4F3OA 4Q43A 3SSQA 2GAHC 3HD2A 5C25B 2NS1B 4CO5A 2LCWA 3TA1A 1IM4A 2P2CB 3C15B 1X4GA 1RB0A 3PW2A 2UZAA 4USIA 4LSNB 2J7KA 3QFWA 3HT3A 3CCQS 2W2QP 2JX2A 3TARA 1U24A 3DMJB 5IXUA 5GMDA 3T5JA 3D2WA 3A8JA 1CULA 4LR7A 1BGXT 1HI1A 4OMFG 2G1HA 4ZLLA 3WC2A 2Q3PA 3EWGA 3F73A 1QD1A 3UVJA 3PYDA 2B5JB 3PACA 2BQRA 4ZK7M 2DNRA 3EMTA 4ES1A 2WVEA 1L5UA 2YX4A 1KBRA 2YNFA 2XWXA 5CD4H 3H25A 4UUXA 4DX6A 4NLOA 4CTAB 3EUNA 2DNNA 4C11A 3K89A 3HXMA 3UE2A 1OYDA 1VDHA 3Q8UA 3VZIA 3CD5A 4DR5J 1SH0A 2DVIA 4ID8A 2FHJA 1MMNA 2OUGA 1T95A 2QIFA 4ZDNA 2BJEA 3T3FA 1DAXA 4DMZA 2OEKA 4MMOA 3DKDA 1FKOB 4UQGA 3TAMB 2ZJRQ 4YY3J 2VKRA 3ZTRA 1VQNS 1UVLA 1W7WA 3ITHB 4B08A 2UV8G 3ETMA 5F8GA 1VGYA 4GC7A 1NK4A 1I1GA 4B3SJ 1XK8A 1KLNA 2Y0SD 2ZDPA 1N5YA 3Q8YA 1NJWA 5AXMA 1U1RA 1E6YA 2JZ5A 3PO5A 1RHUB 1WOSA 3CE8A 2H5EA 5E3CA 3PIPQ 1TUGB 4DV1J 3THPA 1HMVA 2HWHA 5ETQA 3H42A 3SSRA 3DXSX 4I64A 4USUA 3TAPA 4W92B 3W60A 3DOMB 3DU5A 4TY8A 2WSFC 2WSEC 3NWGA 1IKYA 2AHOB 3DLKA 4OZLA 2GW8A 2B6AB 3CCMS 3DDKA 2I5JA 1JLBB 1RJJA 4NLWA 5FDLA 4K5SA 4DS4A 4EBEA 2XG8A 4CCHA 2YNIA 4RJVA 1ELOA 3VALA 3AFGA 4B3MF 3ISZA 4I2QA 2DNPA 3D6FB 1OS5A 4QBUA 4OYWA 4KV8B 4NLXA 3QZ8A 3NY0A 3H2LA 2ZDOA 5AE1A 2ZH7A 2DY9A 4DR7F 3TX8A 1KR4A 3LP1A 1D8YA 2H4YB 1BMQB 1YHQS 4DG1B 4HLBA 2IJFA 2CNLB 3CD7A 1BQMA 2F40A 4FKXA 3BPDA 1YDLA 3IA0A 3DLEB 2LXIA 3GONA 2VG5B 3X3UA 4X4RA 3BGRA 1D3WA 2L48A 3QRQA 1S6PB 1YJNS 2RILA 5BJRA 3MM7A 4TQRA 3ENQA 4KPCA 4MK9A 5DDPC 4DL7A 3I56S 5B7WA 1KP6A 4Q7AA 2BA9A 4QJVA 4X4QA 2BOPA 5C25A 4NI2B 8ATCB 2WVFA 1MWYA 3OL6A 3MDFA 1RGVA 4FZVA 2YWHA 2V8DA 2PA3A 4M5GA 4LSNA 2AJFE 3VVTA 1SV5A 2UXBJ 3GJTB 4RUAA 2DEJA 2E9RX 1H74A 3N5FA 1FFSB 2H54B 3U1LA 4P2MA 4A8MP 7FDRA 5EHHA 2FY8A 2V2ZA 1S6QB 4ED6A 3EPGA 3OTBA 4CNYA 5AXKA 3NG8A 4DHVA 4O3QA 5FD1A 4DPOA 3CSKA 4EUVA 1XMBA 4DOZA 2F8MA 5ADZA 4PWDB 4Z2XA 3O1LA 4Q0BB 1QSYA 2N82B 2K7JA 3A8EA 3I32A 4CTAA 2QA1A 4FYYB 2O1PA 4P7VA 5LSLA 2XYHB 4DSLA 1YVFA 2IMOA 3BH6B 1UFKA 4USHA 2ZC3A 4NEYA 4J37A 3DCAA 2L08A 3D3BJ 4RNMA 2HGMA 1Y0HA 3IFEA 2K3IA 4ZIVA 5B0GA 3ZZ0A 2G4BA 1JKHB 4A47A 1WF0A 3KFWX 3M32B 3QWPA 2KJWA 1CLFA 1TKXB 1GT8A 5H9EK 2H48B 1FKOA 1VIXA 2HFZA 3EX7B 5L1IA 3ITHA 2GGPA 5FLXY 1IWGA 2UUTA 1P6TA 2B4PA 3MM6A 3QZ7A 4ZKAA 1T3OA 4RPFA 2VBXA 1IBCB 5KT5A 4IRDA 1R8PA 3KG0A 2OO4A 4X84A 1NSQA 1HNWF 1JLCA 3JAMU 3EZOA 1J2VA 4USWA 1UKUA 3BM7A 1R0CB 4OJ3A 3BDEA 3C66A 4USTA 4DPXA 4J9LA 2GX8A 1Y7PA 2ALYB 1R43A 2CPIA 1HD1A 2CQPA 3R1HA 2UUBJ 3M8QB 4DR1F 2HHPA 4JBCA 2ZZNA 3O8WA 2XZDB 3TYTA 4WYLA 1SH3A 2CNNB 3HO1A 1NPPA 2R7XA 3SI8A 2A18A 2GQQA 4UTGA
chains in the Genus database with same CATH topology
4NXNJ 3R2DJ 1IBMJ 1N32J 2KVQE 4B3SJ 2UXBJ 4JI8J 3D3CJ 1IBKJ 3T1YJ 4LFBJ 2UU9J 4X64J 4KY3A 4DV6J 4LF5J 5IWAJ 2MQ8A 3IMQJ 2VQFJ 5BR8J 1HNZJ 2UXCJ 1HR0J 3J80U 2MTLA 4LF7J 4JI2J 5LMUJ 1HNWJ 5A2QU 4LF6J 4DV1J 4K0KJ 4JI3J 4DV0J 4JI4J 3J81U 4KHPJ 1J5EJ 4V1Ak 4LF9J 4GKJJ 2ZM6J 1N33J 4DR3J 4LFAJ 4JI6J 4YHHJ 2UUCJ 4DR6J 4DV3J 3JAMU 4JYAJ 4DV4J 4DR5J 4X66J 1XNQJ 1N36J 5FLXU 1I94J 1FJGJ 5LMNJ 4PWWA 3J7AN 4AQYJ 4DV5J 2F4VJ 4B3TJ 5AJ3J 5LM7E 2MEWA 1HNXJ 4HHUA 4OX9J 4B3RJ 4GKKJ 4JI1J 3T1HJ 4JI0J 4LF4J 2KL8A 4B3MJ 2HHHJ 4NEYA 3OTOJ 1XMOJ 3D3BJ 4RJVA 4YY3J 2UUAJ 2UUBJ 4DUZJ 4JI7J 3R2CJ 4DV7J 1XMQJ 2UXDJ 4JV5J 4NEZA 4X65J 4DR4J 5IT9U 3W1YC 1N34J 4LF8J 4JI5J 4NXMJ 4DUYJ 4DV2J 4KYZA 4DR1J 4DR7J 2E5LJ 2VQEJ 4DR2J 1IBLJ 4X62J 1XNRJ 4LFCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN J;  3R2D J;  1IBM J;  1N32 J;  2KVQ E;  4B3S J;  2UXB J;  4JI8 J;  3D3C J;  1IBK J;  3T1Y J;  4LFB J;  2UU9 J;  4X64 J;  4KY3 A;  4DV6 J;  4LF5 J;  5IWA J;  2MQ8 A;  3IMQ J;  2VQF J;  5BR8 J;  1HNZ J;  2UXC J;  1HR0 J;  3J80 U;  2MTL A;  4LF7 J;  4JI2 J;  5LMU J;  1HNW J;  5A2Q U;  4LF6 J;  4DV1 J;  4K0K J;  4JI3 J;  4DV0 J;  4JI4 J;  3J81 U;  4KHP J;  1J5E J;  4V1A k;  4LF9 J;  4GKJ J;  2ZM6 J;  1N33 J;  4DR3 J;  4LFA J;  4JI6 J;  4YHH J;  2UUC J;  4DR6 J;  4DV3 J;  3JAM U;  4JYA J;  4DV4 J;  4DR5 J;  4X66 J;  1XNQ J;  1N36 J;  5FLX U;  1I94 J;  1FJG J;  5LMN J;  4PWW A;  3J7A N;  4AQY J;  4DV5 J;  2F4V J;  4B3T J;  5AJ3 J;  5LM7 E;  2MEW A;  1HNX J;  4HHU A;  4OX9 J;  4B3R J;  4GKK J;  4JI1 J;  3T1H J;  4JI0 J;  4LF4 J;  2KL8 A;  4B3M J;  2HHH J;  4NEY A;  3OTO J;  1XMO J;  3D3B J;  4RJV A;  4YY3 J;  2UUA J;  2UUB J;  4DUZ J;  4JI7 J;  3R2C J;  4DV7 J;  1XMQ J;  2UXD J;  4JV5 J;  4NEZ A;  4X65 J;  4DR4 J;  5IT9 U;  3W1Y C;  1N34 J;  4LF8 J;  4JI5 J;  4NXM J;  4DUY J;  4DV2 J;  4KYZ A;  4DR1 J;  4DR7 J;  2E5L J;  2VQE J;  4DR2 J;  1IBL J;  4X62 J;  1XNR J;  4LFC J; 
#chains in the Genus database with same CATH topology
 3CPW R;  3CJ8 A;  3CJS A;  3GJR B;  3RBZ A;  3W3S A;  3ZC4 A;  3BSO A;  5KFH A;  2AJ1 A;  2J0S D;  4JB8 B;  1S79 A;  3JQM A;  3MI7 X;  4N77 A;  3CWJ A;  2EFQ A;  1VRU B;  3CW2 C;  5A2Q U;  3FGV A;  1RKJ A;  3MPY A;  2XGP A;  1SJ3 P;  4C97 A;  4F0M A;  2QG9 B;  3GCW P;  4JI3 F;  1RYS A;  4FXD A;  1GMU A;  1U0H A;  1XBW A;  1SKR A;  5D8H B;  2MKY A;  3J7A N;  2G13 A;  4WYW A;  2EG2 A;  3EM1 A;  3T19 A;  2KYX A;  2JEG A;  3NRB A;  4DWI A;  1WC0 A;  3QO9 B;  1DQ8 A;  3MR3 A;  4GRS A;  2CQ1 A;  4P72 A;  3NWR A;  3H4D A;  3G71 S;  1HNV B;  2RS8 A;  2W2O P;  3V6H A;  1N0U A;  2RRA A;  2VG5 A;  3LGN A;  1RQ0 A;  1S9E B;  2CJQ A;  1KEK A;  5ETP A;  2JL9 A;  1R8C A;  4NML A;  3VAM A;  5DQG A;  2GAG C;  1V6H A;  1TL5 A;  2E66 A;  2E5J A;  1NDL A;  4OLP A;  3DM2 A;  1CPZ A;  2DIT A;  4RW8 B;  4UOF A;  2JLE A;  4KAI A;  1K73 T;  1N32 J;  3QSY B;  1HWL A;  4X2B A;  1IR1 A;  5IWA J;  2W4P A;  1F9E B;  3W5X A;  4Y65 A;  1IKV B;  1LW2 B;  5GAE U;  4USJ C;  3KLI A;  3BN7 A;  4BHQ A;  3M8Y A;  1YKW A;  3I5B A;  4DEZ A;  1UET A;  2M0G B;  4OYO A;  1F2G A;  4DR6 J;  2UVR A;  4G1P A;  4NCA A;  2MB0 B;  1L3T A;  1VQO S;  2RH3 A;  3ZO7 A;  1RT7 A;  3E01 B;  2HFO A;  3QLH A;  1QVF R;  1Y9O A;  5ETK A;  1N0V C;  2JEF A;  2QN6 B;  3R6L B;  4L3K A;  1NUE A;  2GIR A;  3G96 A;  4JI5 F;  3S8S A;  4PWD A;  4RWX A;  2V9K A;  3O3L A;  4I0W A;  4Q0B A;  4WWS A;  1GH8 A;  3PEH A;  3PXG a;  4K4U A;  2Z0G A;  5CA5 A;  1S97 A;  2XS7 A;  2LQJ A;  4CYU B;  3LP2 A;  1S0N A;  3RAM A;  3NOG A;  1ROF A;  2FJB B;  3QBC A;  4NXN J;  2OIH A;  2LQ9 A;  3MMC B;  4IFV B;  2R7R A;  2EKY A;  2E1R A;  4X62 F;  1RIS A;  3O2I A;  2DGX A;  1U8W A;  2ZHB A;  4UOH A;  3G8Q A;  1KOO A;  3JXO A;  1N4L A;  4ZHR A;  2POK A;  1FRL A;  4LF9 J;  1IN0 A;  4CM2 A;  3IR6 B;  5JJB A;  3R6G B;  5E5N A;  3I55 S;  5L8R C;  7AT1 B;  5J2N A;  3A13 A;  4N7T A;  2Y0B B;  2C3O A;  3TO8 A;  4RUB A;  2BRL A;  4UW2 A;  4BWM A;  4ZLN A;  5KFV A;  4L74 A;  5ETR A;  3UCU P;  1LWC A;  2R3V A;  3PW5 A;  2XC9 A;  2V67 A;  1U0S A;  3L4B C;  5J2M B;  1R31 A;  1UEV A;  3JB9 k;  2JC1 A;  3AJ2 A;  3QT8 A;  2ZFH A;  3SV3 A;  4F04 B;  4X4U A;  1OSD A;  1VOM A;  2O3D A;  3W2V A;  2OSQ A;  4NA3 A;  3DRS A;  3M8Q A;  2Y1I A;  3FMB A;  2CQG A;  2CPH A;  4KT0 C;  2XB2 D;  4O4G B;  2CKW A;  5AT1 B;  2AYB A;  1RAC B;  1PYT A;  1FJ7 A;  4WK1 A;  4ID5 A;  3H7H B;  3HSJ A;  2W8K A;  5CAA A;  2HAF A;  2HHW A;  1HNX F;  2HBR B;  4JI6 F;  1S1V A;  1KVK A;  1IWA A;  1JNR B;  1UZH A;  1DTT B;  4LUB A;  4EZ6 A;  1P1T A;  3AOD A;  2IM1 A;  4RW9 B;  1MU2 B;  2MQO A;  2BQ3 A;  1PIL A;  2EPI A;  2RJZ A;  3I4H X;  2VB6 A;  1X0P A;  1C1B A;  2MKI A;  2E5G A;  1NSA A;  1CJV B;  3MGJ A;  1T9W A;  1NB7 A;  1WAC A;  2HFS A;  4DCJ B;  3MR7 A;  2ZJQ Q;  4HVZ A;  4OYA A;  1IM6 A;  1HNV A;  1ZA1 B;  2F8H A;  2QLW A;  3HHL B;  1S9E A;  4PPD A;  1JB0 C;  3OJU A;  2V50 A;  3D9B A;  5DG7 A;  3TAN A;  2DGU A;  4KSE B;  2NRE A;  5DJB A;  2XY5 A;  3K2Y A;  2HIQ A;  2IBO A;  1HBM B;  3R5D A;  1VLY A;  2YWG A;  4IOC Q;  5CH7 B;  4G3I A;  4BC7 A;  3NAI A;  3P6Y C;  3A3P B;  4TXS A;  3G82 A;  1CJK A;  1GFW B;  1ZOT A;  5L38 A;  1IKV A;  4RU9 A;  3PV8 A;  1YBA A;  3SDE B;  2OFG X;  1KOH A;  2HQF A;  3TJ8 A;  3KHL A;  1VBZ A;  4NAS A;  1YBU A;  3M9O B;  1MWZ A;  2NXJ A;  1FNO A;  2CDQ A;  1FRK A;  1QAJ A;  4C8O A;  3K7R A;  1TMM A;  3KHG A;  3SZ2 A;  3RTV A;  2AEJ A;  4WP9 A;  3E01 A;  4QR2 A;  4PKD B;  1OPZ A;  2QTW A;  4O0I A;  1HNI A;  4NPO A;  4DSI A;  4I6A A;  5GAH I;  3VAG A;  4LF8 F;  3D3C J;  4YQW A;  3GFX A;  3FMW A;  2A3J A;  3G4S S;  2XMK A;  5I4M A;  2AGO A;  1FFG B;  1Q16 B;  2MTL A;  2KXN B;  2MHN A;  2F63 A;  4NA1 A;  1AUD A;  1WKJ A;  1PGZ A;  1S1X A;  2XTJ P;  1UVI A;  1KON A;  4C0H A;  4DSF A;  3MMC A;  4DCO B;  1FX2 A;  4R0J A;  3CUN A;  5KFS A;  5KG1 A;  1RCO B;  1T05 B;  5D3G B;  3H2U B;  3UCG A;  5KFY A;  3CCW A;  2DR8 A;  2MEW A;  1XQI A;  4DV4 F;  3HJV A;  2ZBI A;  1RT2 B;  4AXI A;  3CMA S;  3NCP A;  3B82 A;  3CCZ A;  1XR6 A;  1U1L A;  2J7U A;  2BE9 B;  1QLN A;  3AAW B;  4LBP A;  3G6Y A;  2XM3 A;  1S1U A;  4ZVO B;  3MUR P;  2VQE J;  4ECY A;  3BGO P;  3RB6 A;  5C5J A;  4B9L A;  3MOJ B;  4CNZ A;  1K1Q A;  1H3D A;  2BW7 A;  3FK4 A;  2XO7 A;  1DUR A;  3VGU A;  5J2M A;  3BSC A;  1DJ0 A;  3L3C A;  1S77 D;  2H4W B;  3Q86 A;  3N9U C;  3DOL B;  3RAQ A;  1EIY B;  2QSW A;  4M5D B;  2Z2Z A;  2YKO A;  1Z1Z A;  2XHC A;  4O3P A;  2V34 A;  2LFV A;  2D74 B;  5A0Y B;  4KPY A;  1WG1 A;  5DG8 A;  5KOW A;  4C8Y A;  2NZC A;  2ZD1 A;  3CDE A;  1J5O B;  4TNO A;  4M5I A;  4ZN3 A;  1R8H A;  3UD4 P;  2HKE A;  1WKK A;  5SUH A;  2W25 A;  2OPR B;  3GCX P;  2HBZ B;  1VC6 A;  5E33 A;  4QWB A;  1YJT A;  4PZV A;  1DY3 A;  4DV2 F;  2V2V A;  2E5L F;  2JH3 A;  5IZH A;  3W66 A;  4FNI A;  2ASD A;  4GO5 X;  2V94 A;  3T9N A;  1H6K X;  4WFX A;  1DTT A;  3HVW A;  3Q89 A;  4EBD A;  4NOH A;  4RW9 A;  1MU2 A;  4DFP A;  3T1A A;  4KKO B;  2VAS A;  2VQF F;  1BWV A;  3QGH A;  2WVC A;  4ED7 A;  5L39 A;  4FXV A;  2E29 A;  2FHM A;  4PUO B;  4S0M A;  1RT3 B;  1H2V Z;  2QL9 B;  2CVE A;  2BAB A;  1NCL A;  4GKJ F;  4KE5 A;  9RUB A;  1S4E A;  3IWL A;  2R7W A;  1EP4 A;  5KFT A;  3ZZP A;  2HPU A;  3D1O A;  5HVH A;  4F4A A;  5D4L A;  2A0F B;  2XMJ A;  2YQ3 A;  3BGF A;  1ZM2 A;  5AJ3 F;  3EGZ A;  1UPP A;  2E1A A;  2K1R B;  4U6P A;  1RAJ A;  2IC3 B;  2GIF A;  5IM0 B;  1Z2Z A;  1HBM A;  4ELU A;  4AE5 A;  1FEH A;  3Q8P B;  1HBO A;  2C2O B;  3NLC A;  5KFQ A;  6FDR A;  2ZZT A;  2OD4 A;  1JX4 A;  1LWF B;  1R0A B;  3QJP A;  2ZJP Q;  3ZZR A;  4RKU C;  4JI0 F;  1SB6 A;  4NYZ A;  3RU0 A;  2FLP A;  1SVD A;  5B0A A;  1ARO P;  1ITP A;  3CJK B;  4KO0 B;  3N79 A;  4ERD A;  2ATC B;  3S1T A;  2WSC C;  4C8Z A;  4PR6 A;  3T1Y J;  1RTZ A;  3C16 B;  4J9R A;  1U09 A;  5E41 A;  3TJA A;  1ICE B;  4K0K F;  4WJB A;  1C2P A;  2R7Q A;  3KJQ B;  3T6B A;  3KDO A;  2Y8W A;  4I6Y A;  1X9S A;  4YB1 P;  5AXN A;  2IVY A;  1P9Y A;  1UZD A;  1Q79 A;  4DQP A;  4ZCL A;  1ZYQ A;  3MAA A;  2R8I A;  4N41 A;  3KMS A;  2YH1 A;  1X4H A;  2Z2L A;  4DV3 J;  2HNZ B;  1TAU A;  5J1N A;  3LO3 A;  2DGV A;  4CM0 A;  4RBT A;  1OMS A;  2QMW A;  2HS3 A;  4JYA F;  2IA0 A;  4ZP9 A;  2QSF A;  2KH9 A;  3ONQ A;  2BE2 A;  4QPX A;  4IQX A;  4DV7 F;  4NRT A;  3CJ3 A;  1MMD A;  4ZVG A;  2CPX A;  2OPS B;  4CH7 A;  2UVW A;  1VR6 A;  2RKI B;  4DR1 J;  1WC6 A;  3GYG A;  1RAE B;  3K5N A;  2Q43 A;  1RT2 A;  4ICL A;  4Y34 A;  4DR4 F;  4Z7Y A;  5BR8 F;  2JVO A;  3QT7 A;  1YLX A;  4U8Y A;  5K14 A;  4WTO B;  3TEH B;  3GYN A;  4OYB A;  2I9S A;  5CXT A;  1MSW D;  2E9Z A;  1S9F A;  3VR1 A;  5LMU J;  5A8R B;  2VJU A;  5KFD A;  1XTZ A;  5EUH A;  4MJK A;  2YQ1 A;  2YWE A;  4NCG B;  1HQE B;  4CT9 A;  3KJV A;  1WHW A;  4Y0F A;  3TEG A;  2KZZ A;  4UOG A;  4CLF A;  3C46 A;  5CZV A;  4M5D A;  2IRY A;  3HSG A;  2LKZ A;  3V6K A;  4BBY A;  4ZOS A;  1LK5 A;  2QEX S;  3GIK A;  2RAQ A;  1RSC A;  5A0Y A;  1RWK B;  3QGP A;  2HRY A;  4LSZ B;  1RHJ B;  4LIR A;  4CZC A;  5LXY A;  4MT1 A;  1CS4 A;  3ZTQ A;  3D68 A;  2GC8 A;  2Y1J A;  2XLJ A;  1R6Y A;  1OYE A;  2V8V A;  4OI1 A;  3CIZ A;  5J2P B;  3PKM A;  3MM8 A;  1R0B G;  3MED B;  5IQQ A;  1PAE X;  5E7O B;  3ZNU A;  5D78 A;  4J9U E;  2ASJ A;  2V2K A;  2WB4 A;  2HZV A;  2IYG A;  3WDO A;  3TZY A;  2HW3 A;  3BEG B;  4FF2 A;  2G9O A;  4NLD A;  2NYI A;  4Y00 A;  5CYJ A;  1DFD A;  1MG7 A;  4A8S A;  2ABY A;  5HRO B;  2XMT A;  2BBE A;  3U02 A;  1R89 A;  4KGZ B;  1ZTT A;  4UT4 A;  2LXU A;  2DHH A;  3MCN A;  3IGV A;  2KVI A;  4PUO A;  3D0I E;  1RT3 A;  5RUB A;  3RRH A;  1AA1 B;  3HVA A;  2ZH6 A;  4DSK A;  1H7X A;  1RTH B;  1SKS A;  1HWI A;  1TFY A;  4IH6 A;  3HSZ A;  5KAK A;  2BKN A;  2YKA A;  4ZJQ A;  4JOU A;  2XLI A;  1XMQ F;  2AD9 A;  4QR0 A;  4WII A;  1WEY A;  2OI2 A;  5DM6 Q;  3RW7 A;  1NXI A;  2MQP A;  3GZ7 A;  3US5 A;  1RWM B;  4LRA A;  1VQ9 S;  3FUY A;  4JI5 J;  1L3V A;  5KFM A;  1Q5V A;  4A8F A;  5CQG A;  1NJZ A;  2P9G A;  4NLP A;  2XEX A;  5E0O A;  1EAR A;  1RTD B;  4IDK B;  4ANC A;  4U96 A;  4JI8 J;  4P2F A;  1RBL A;  1RE1 B;  3WQP A;  5HMW A;  3CJT A;  3CJ4 A;  3CD6 S;  3EZ5 A;  3CJK A;  4KO0 A;  2CQ2 A;  4DV6 F;  3NEK A;  2C2R A;  3M2R A;  2BVZ A;  3BKU A;  1UP1 A;  1D9D A;  1JNZ B;  5LMN F;  5C24 B;  3C16 A;  1VQL S;  5CAB A;  5JUM A;  2M9K A;  3SCJ E;  5KT7 A;  1IKW B;  2RT3 A;  1KQK A;  1O8B A;  2LU1 A;  2ZOM A;  2KG0 A;  1KHV A;  4Q44 A;  4C98 A;  3GQC A;  2J9E A;  4IR9 A;  2HNZ A;  2LLZ A;  1FDB A;  2DNK A;  3X1L B;  1D1U A;  4MKA A;  2DNH A;  4N47 A;  4CLU A;  1PJ7 A;  2G2Y A;  2EC0 A;  4IKA A;  1KKH A;  2DEI A;  3N0V A;  3BYP A;  2AW0 A;  4YP3 A;  2XSF A;  4YFU A;  2ADB A;  5I3U B;  2IPO B;  2RDI A;  4ZPT R;  3W9H A;  4LBH A;  5HAT A;  2GMH A;  2OPS A;  2CJK A;  3OXL A;  1W2B R;  2RKI A;  1OY9 A;  3ILL A;  2DBB A;  5DRK A;  3V6J A;  4P2S A;  3J81 U;  3GV7 B;  2XUL A;  4ZP8 A;  4TLR A;  4AL6 A;  2LEB A;  2LMI A;  5AE2 A;  1N6Q A;  1UMJ A;  3HDS A;  1UWA A;  1KD1 T;  2VIH A;  2AP6 A;  1I94 J;  3MUV P;  1VRT B;  4C7Q A;  5A8R A;  1H98 A;  1UL3 A;  1HNX J;  5GAD U;  2E7X A;  4ATN A;  4QR1 A;  1HQE A;  2HIY A;  1FVS A;  1UPM B;  2EK6 A;  1QVG R;  2V0N A;  5KG6 A;  1ZPV A;  5A8W A;  1F1B B;  1Q8I A;  4JUZ A;  3N01 A;  2VC0 A;  4I4B A;  3EXC X;  2H51 B;  2XY6 A;  2L41 A;  3PW0 A;  4OI2 A;  4HH1 A;  2IDL A;  4I6W A;  2M52 A;  2FJA B;  2DIV A;  3HHL C;  2GML A;  2ATL A;  2DR5 A;  1IKX B;  1YBT A;  3KLH B;  3IRX B;  4JI4 F;  4QIF A;  2FLN A;  2WB1 D;  1RKI A;  4LF6 J;  1RBA A;  4OYX A;  2B4U A;  2J6T A;  1YQH A;  3R7S B;  4OI0 A;  4UY8 T;  1EKS A;  2YNG B;  3GSD A;  4ETZ A;  4FYX B;  3W7B A;  4J9O A;  5HVG A;  3C6U B;  3EGW B;  1FJG J;  1WDT A;  4K4X A;  1MN7 A;  3DLL Q;  1IR0 A;  4YHH F;  4PXB A;  2HHT A;  2FB0 A;  1JJ2 R;  4IR1 A;  3HHE A;  2OD6 A;  4CO0 A;  2CRL A;  3BB5 A;  1UJ5 A;  4KH0 B;  5F8H A;  4DQQ A;  4R5P B;  1C0T B;  4G1Q A;  2I8E A;  3BSN A;  2GS8 A;  1P9Q C;  4K8R A;  4OZ1 A;  1DTQ A;  1X4A A;  1RWU A;  3ILI A;  2D3U A;  4ECS A;  1HHT P;  1PIE A;  3HJF A;  3OR1 B;  3H4B A;  2CQI A;  5J1E B;  3EVM A;  4V19 X;  1WEL A;  4X65 F;  3UO0 A;  1F6T A;  2B3T B;  1SQE A;  2NSB A;  5H1S V;  2HGN A;  4IOA Q;  2J9D E;  2ROP A;  2HQI A;  2VG7 B;  5BYR A;  4C3L A;  2MQL A;  4DUT A;  4JV0 A;  4XDD A;  2G2Z A;  4K4Z A;  3CCV S;  4F7V A;  4V1A k;  1RTD A;  3C14 A;  4WP8 A;  4IDK A;  4ED3 A;  2CYY A;  3ENV A;  1Y5N B;  1YI2 S;  1NPK A;  4P75 A;  3CB4 A;  4RW4 A;  2RF2 B;  4XIU A;  4RU2 A;  3A8I A;  3P3D A;  4RO0 A;  2DPI A;  4OHW A;  4MK7 A;  4WP3 A;  2JEJ A;  2DHX A;  4JV2 A;  2HQC A;  3IO1 A;  3IM8 A;  2HSE B;  3VV2 B;  3T1H F;  5M2P A;  4N5S A;  3QIP B;  6AT1 B;  4F2S A;  4O23 A;  2PGC A;  3KYL A;  2F1F A;  2GHP A;  1G6B A;  1Q7L B;  1HQU B;  1WC4 A;  4C4W A;  1TUV A;  1LW0 A;  2NUH A;  2NQP A;  1TKZ A;  1FXD A;  3FKB A;  3B54 A;  5L9X A;  2BYC A;  5KOX A;  3MR5 A;  3JAM Y;  1MLA A;  2V9W A;  4LQ3 A;  3P5T L;  2ZBP A;  5THW A;  2R2S A;  3LAM A;  5CZX A;  1DLO B;  3AB4 B;  2UVV A;  3KUG A;  5I3U A;  2UP1 A;  3BR8 A;  3HKW A;  4C0O C;  4CLY A;  3O6Q A;  4KTQ A;  1AZS B;  1W26 A;  3IXQ A;  4N8N A;  4DJB A;  3Q8S B;  4O3N A;  3MMB B;  1UWB B;  2RD5 C;  2M70 A;  3DNC A;  5D0G A;  5F8I A;  3JTO A;  3QRP A;  3GR1 A;  2GHV C;  2RHQ B;  3PDN A;  5LXR A;  2BMB A;  3RRG A;  2EI5 A;  2WW8 A;  3OVB A;  2N3L A;  1NM2 A;  2C28 A;  4DN9 A;  4DV2 J;  1VCT A;  1TKT A;  4Z7C A;  4KHM A;  2E5L J;  4B17 A;  1SXL A;  3CC4 S;  3FEZ A;  2OAU A;  2W9A A;  1D09 B;  2VU5 A;  3MHY A;  4DQS A;  2GQ2 A;  2L3M A;  2QFJ A;  2G0C A;  1LFP A;  1SJR A;  2VQF J;  2XQC A;  3WHI A;  1IBM F;  3MOZ A;  1PC4 A;  2DNG A;  1BE4 A;  3M8P B;  2AWZ A;  1NK9 A;  2J9D A;  4DZD A;  1K47 A;  1RYR A;  4GKJ J;  3LUY A;  4WCE Q;  5D0R A;  3THT A;  4WK3 A;  1S7I A;  3OVA A;  4Q2L A;  3KLH A;  1RT5 B;  3IRX A;  3CT9 A;  4OYZ A;  1AB8 A;  3HHL D;  3BGU A;  1C1C A;  5AJ3 J;  1H2T Z;  1M5H A;  3MMA B;  2HHX A;  3W62 A;  3PJ9 A;  4KGK A;  2XMU A;  1SKU B;  3TUP A;  3FFI B;  3D6M B;  1UFL A;  2F4F A;  3IWN C;  2MKJ A;  1RTJ A;  2EBE A;  4MIA A;  4DUZ F;  1HPZ A;  2UXD F;  3A12 A;  2HRT A;  2XMW A;  3VGT A;  3OR2 B;  1REG X;  4DL6 A;  2UUW A;  1LV5 A;  4K7Q A;  2RQM A;  5HVF A;  3A3O B;  5CCL A;  5HBM B;  2NYH A;  4A4J A;  2LEA A;  3I0R B;  1CQM A;  3BPS P;  4XO0 A;  3OTO F;  1V5I B;  2H9Z A;  2HZC A;  3IAS 9;  1WUU A;  3IRW P;  4CLP A;  4MFB B;  4GC6 A;  2RU3 A;  5L1J A;  4JP8 A;  1C0T A;  3IR7 B;  3CDU A;  2ZH3 A;  5DLG A;  2BRK A;  2OPP A;  1F9F A;  1KDN A;  1GXL A;  4U9R A;  4BS2 A;  2DXF A;  1U02 A;  3GFZ A;  3MCO A;  3FNN A;  3ZZZ A;  3OR1 A;  2E5I A;  1YJU A;  5J1E A;  1EJ7 L;  4K0K J;  2KKH A;  4DR3 F;  3V81 B;  4WXO A;  1X31 C;  1ZAW A;  2C3P A;  4Q5V A;  2MPU A;  2IA6 A;  2ZC4 A;  2IM2 A;  1FK9 A;  2V6A A;  3UR0 A;  1VBY A;  2VG7 A;  2HBY B;  1S76 D;  5CYQ B;  3KKF A;  4WFB Q;  4UQT A;  1CJT B;  3SSS A;  4ALZ A;  1HL6 A;  2XYP B;  1RHR B;  2HBQ B;  1UFW A;  4WE1 A;  3SXL A;  3AD9 C;  3KLE B;  3T5H A;  4NLQ A;  5F3Z A;  2AJQ A;  4NXM F;  3L7U A;  4ECU A;  5IC6 B;  2W2M P;  4DV7 J;  4DR2 F;  3J81 j;  2GQC A;  3NKY A;  4DF8 A;  2RE1 A;  4DS5 A;  3J7Y U;  2RF2 A;  3V4M A;  4FF3 A;  2DIS A;  1F5C A;  1ZS6 A;  5JXS A;  4DPU A;  5GAE I;  4PXD A;  1G4C A;  5A76 A;  3EXY A;  2NPF A;  3VHQ A;  3QIP A;  5BR8 J;  4LFC F;  2YNH A;  3ZXW A;  3J80 U;  5KFL A;  2MKH A;  1KQS R;  1Q82 T;  1Q8L A;  2E7V A;  1HQU A;  2Z4P A;  4EO6 A;  4L6V 3;  4UUW A;  1CUL B;  4WZM A;  2NSC A;  2RQK A;  1NSK L;  3QJJ A;  3E51 A;  3UVJ B;  4AYB D;  3RBX A;  4FPR A;  3HZG A;  2OEJ A;  5EDW A;  4URS A;  4MKB A;  2FD2 A;  1RAB B;  3R8Y A;  3HI9 A;  3GU0 A;  3I9Z A;  1X7V A;  4QOT A;  4JI1 J;  3LA0 A;  4I7F B;  4JI7 F;  1AZS A;  3T9Z A;  3GLJ A;  1PCA A;  3BKT A;  4C11 B;  1BUX A;  3BKF A;  1FE4 A;  1VIS A;  2DGO A;  1UWB A;  2GVD B;  4NEZ A;  2KFY A;  2BEF A;  2CNK B;  2DO4 A;  3CJR A;  3R7B B;  1GX5 A;  5EWG A;  4P74 A;  4G65 A;  1N5S A;  1XNR J;  1Y11 A;  4USK A;  3GR0 A;  3F41 A;  3D28 A;  1SC6 A;  3MZI A;  1TFW A;  3GWC A;  4NE9 C;  2M8D B;  3QJL A;  3SQG B;  2XZW A;  3LAL A;  1U25 A;  1R8A A;  5EN1 A;  1HW9 A;  4NL5 A;  3EGN A;  3UDC A;  4KC5 A;  2YTC A;  4I2P B;  4ZLP A;  3CME S;  1JLQ A;  3IG1 B;  4H54 A;  2HYI B;  1JLE A;  1S48 A;  4RR5 A;  5KFZ A;  4KR0 B;  2JDJ A;  3OTE A;  1G1X A;  3MM5 A;  3QYY A;  1N5Y B;  4AQY J;  1E6Y B;  3GPA A;  3J7Z T;  3M8P A;  3VCD A;  4OZ3 A;  4ZMM A;  4WFZ A;  4QYZ K;  5U47 A;  6FD1 A;  1UEU A;  2XHW A;  1G3O A;  2IHR 1;  4W90 B;  1HW8 A;  1WEX A;  1RT5 A;  1S1T A;  1XMQ J;  3GP9 A;  2QYG A;  2U1A A;  5B0E A;  3MMA A;  4KYZ A;  4C9D A;  4KFB A;  3H5X A;  3ILO A;  2R7S A;  2VKZ G;  1HAR A;  4URQ U;  3FFI A;  4TY8 B;  4Y6I A;  3VTI A;  4LFB F;  1S9G B;  2DNM A;  2CJB A;  1KS2 A;  3BBB A;  5D0E A;  1NDP A;  5KFU A;  2HVZ A;  3K5P A;  2QA4 S;  2JNJ A;  1T3N A;  2QL7 B;  1S0V A;  3P49 B;  1BQN A;  3NS7 B;  5FJ4 A;  3TAQ A;  3DOK A;  1RHM B;  2BOA A;  1CG2 A;  3JYT B;  3LPY A;  4NLY A;  3FBE A;  2QO3 A;  2YKM A;  4C8M A;  2IRU A;  5T7L A;  2F9J A;  2AT1 B;  1J5E F;  3PX4 A;  5LMN J;  2EKN A;  1ZAV A;  1S72 S;  4ITS A;  3IM9 A;  1ZPW X;  3PR4 A;  2J0Q D;  3BGL A;  1PSD A;  3V81 A;  5HN0 A;  3EVW A;  2KDO A;  1BQM B;  3PO4 A;  1OY8 A;  2WHO A;  3RYL A;  5HAN A;  3K5O A;  2VDH A;  3HKZ D;  3UQS A;  4F4X A;  5CYQ A;  2B7B B;  2E1M C;  3KHR A;  3BGR B;  4RZR A;  5G0R A;  2W7O A;  4RW6 B;  4XTT A;  2YPZ A;  2XMA A;  3KLE A;  2P9E A;  3MM7 B;  3M6U A;  1X9M A;  4XPE A;  2P8I A;  1LWX A;  3VQS A;  3H59 A;  2V63 A;  4FBU A;  1MRO A;  1W2I A;  3UDL A;  2OTJ S;  1RT4 B;  3JSB A;  3ZFV A;  2DHA A;  4F2R A;  2OHD A;  1U6Z A;  4OZ0 A;  1O0P A;  4LBI A;  3M8W A;  1YJV A;  2Z57 B;  4ECR A;  3QPI A;  1REV A;  1VQP S;  1K8A T;  3GIM A;  1SV5 B;  2AKW B;  1KWM A;  4NX9 A;  4L76 A;  2D7S A;  1VQY A;  2YVS A;  3LGM A;  1HBU B;  2KU7 A;  1VMB A;  4K4W A;  2WRM A;  3HVT A;  3KTQ A;  2ZKT A;  5K8O A;  4C48 A;  2M7S A;  2HHH J;  2E9T A;  2YY3 A;  1K9M T;  3C8Y A;  4N76 A;  4K4Y A;  4B02 A;  4ELT A;  2N3O A;  3M6W A;  5ETV A;  2NXE A;  2DGW A;  4WXW A;  1YJ7 A;  4I7F A;  2EK1 A;  2FPH X;  3OLB A;  1HR0 F;  2P6S A;  3KK2 A;  2Y9H A;  3L95 X;  2GVD A;  3PW7 A;  4NLS A;  3RB3 A;  2BJD A;  4DV0 F;  2CJY B;  3OUY A;  2HWT A;  2KYZ A;  2MY7 A;  4LF5 F;  4JI4 J;  1X4B A;  5L1K A;  1RWV B;  2OMO A;  5SZT A;  1U6B A;  3KNG A;  2BKO A;  3SQG A;  2BV3 A;  1H73 A;  3E2E A;  2BR0 A;  2HUR A;  1APS A;  1FWP A;  4B3T J;  3BSA A;  4J9Q A;  1TK0 A;  1M5S A;  2X1A A;  2GGP B;  1S6O A;  1WG4 A;  5KG4 A;  2MKS A;  4X4O A;  4I2P A;  3MM6 B;  4ENO A;  3IG1 A;  5EX0 A;  3QT6 A;  2ZVI A;  1EET B;  3DFE A;  4MYT A;  1OQ6 A;  4QIW D;  5EWF A;  4M5N A;  2J0X A;  1JLC B;  2MLY A;  3W1Y C;  2CFX A;  3OPK A;  2HHU A;  1Q78 A;  3BJY A;  2PC6 A;  3R9L A;  4YB6 A;  2DCU B;  4DPY A;  3HSD A;  4H4K C;  4GVL A;  1B0V A;  3IP0 A;  3N4W A;  4G1I A;  3PKY A;  3GG1 A;  2I2Y A;  4PXE A;  4Y2I A;  2DB1 A;  3I0S B;  5L1L A;  1B4S A;  1A7G E;  1TV6 B;  2VPY B;  5HLF A;  1HIY A;  1S9G A;  2YWW A;  3I5C A;  1W25 A;  1VFJ A;  2GA7 A;  3V6D B;  1N48 A;  4EO8 A;  1QDU B;  2KJV A;  5H9F K;  2R4F A;  1FEE A;  4LIW A;  3TWZ A;  4FKY A;  1YG0 A;  3R7N B;  2DRA A;  1VQ7 S;  2RDJ A;  2VFR A;  2N4C A;  3JYT A;  2CZ9 A;  1YK9 A;  2MZT A;  3FJ2 A;  5DET A;  4QYR A;  1VQS A;  4B9T A;  1WKL A;  1PO6 A;  1V3Z A;  2F65 A;  4OV6 A;  4WPA A;  4LF1 A;  3NGT A;  5ITH A;  1U0H B;  3G9C A;  1I6J A;  4YY3 F;  1SC3 B;  4F67 A;  3OTC A;  2EFN A;  2WBR A;  4ZPA A;  1NJI T;  2BJ1 A;  2WK4 A;  1JJC B;  2YWF A;  1SIZ A;  2FJX A;  1T03 B;  2PI4 A;  1NRK A;  3HM9 A;  3FBB A;  4Y2A A;  2WON A;  3UW1 A;  4RW6 A;  3GE9 A;  4O3S A;  1SQF A;  4P7T A;  3CC2 S;  3AOA A;  3PX6 A;  4HAC A;  3TZX A;  2VDI A;  4FS2 A;  4B9U A;  2EXU A;  1NU4 A;  3DM2 B;  2M8H A;  4ZP7 A;  1U47 A;  3BYR A;  4FBT A;  1A0O B;  1RT4 A;  4ED0 A;  1XWL A;  1BWE A;  3HLU A;  5D4O A;  1UJ6 A;  1FDA A;  3KLI B;  3V4I A;  5KG3 A;  5I42 A;  2YH0 A;  1DQA A;  1URR A;  4DU7 A;  3H2V E;  1FKP B;  2X1B A;  2B9X A;  4KGV B;  2VFU A;  3CJ0 A;  1FF2 A;  1HBU A;  3D6T B;  4K4S A;  1A9N B;  3AA8 A;  2E1C A;  3BRE A;  3R5A A;  1QJH A;  2C2Z B;  1RT7 B;  3R2D J;  2XZT B;  3QLH B;  2KVQ E;  3UD3 P;  3TRG A;  2MMY A;  4A8Y A;  2ALZ A;  3KUE A;  2ZWP A;  2YKN A;  5HO4 A;  5HJY A;  4K5R A;  3TI0 A;  5C42 A;  1QM9 A;  3I96 A;  5KFE A;  4IG0 A;  1TL4 A;  2Z30 B;  1B3T A;  3ET6 A;  2I38 A;  2SXL A;  2DHG A;  3AXK A;  2A10 A;  3LAN A;  4K4T A;  5LJ5 Y;  1Y4Z B;  2MYF A;  2WVB A;  2PI5 A;  9ATC B;  3WX8 A;  1X60 A;  3LP2 B;  2LU2 A;  3N5B A;  5IT4 A;  1RA6 A;  1VS3 A;  3GTY X;  1KQG B;  1X4E A;  5B08 A;  3AD7 C;  4DQI A;  4QYZ J;  4LF4 F;  2ASY A;  3JSM B;  2CVI A;  1CC8 A;  2Y1R I;  4F02 A;  1M1G A;  3M9M B;  3M1V B;  3MPV A;  4ZHR B;  3MM9 B;  2FDN A;  4DUZ J;  3GV8 B;  2UXD J;  3D0G E;  1CJU B;  5ETN A;  5J2N B;  4AXJ A;  3VAH A;  1TL1 B;  2A2C A;  3TVY A;  4U7U K;  1EET A;  4WU3 A;  3RBE A;  4PXC A;  1I51 B;  1K44 A;  3ADA C;  3D5M A;  1FVQ A;  1LWC B;  3Q23 A;  3MFI A;  4BWJ A;  3AD8 C;  1PJ5 A;  2V8P A;  4A8X A;  1X0F A;  1Z2L A;  1WTB A;  1VQ5 S;  4CLW A;  2ZBR A;  3LTO A;  3K17 A;  3SYZ A;  2YWK A;  4X66 F;  2VH7 A;  2PE8 A;  4YDD B;  3CCJ S;  1NSP A;  1S99 A;  4EYI B;  4DR3 J;  1YX2 A;  3BQ1 A;  3W2V B;  2CQ3 A;  1UA0 A;  1U49 A;  3FCW A;  3I0S A;  2ZWO A;  3DRS B;  3HMJ G;  2DIU A;  1TV6 A;  2YXL A;  1TK8 A;  2PDA A;  3EVO A;  3RGI A;  3TA0 A;  5FII A;  2HHS A;  4ZPW R;  3LH2 S;  5KFP A;  2D9O A;  2DRB A;  3V6D A;  3FRY A;  3HF5 A;  2KTQ A;  5DLF A;  3HCX A;  2DY1 A;  1WNE A;  2GO8 A;  1HKA A;  4LRB A;  2ZH4 A;  4ID5 B;  3S01 A;  4NXM J;  4DR2 J;  3ICL A;  3TA2 A;  2GCF A;  2FC8 A;  1T11 A;  1S1V B;  4MYU A;  2DJW A;  1LOU A;  2AF6 A;  2F7V A;  3EE3 A;  2KFZ A;  2B4V A;  3VAJ A;  2E1P A;  1NND A;  2K3K A;  2OEM A;  1C1B B;  1AFJ A;  2CZ4 A;  4MTP A;  3DDI A;  8RUC A;  4URG A;  1F3F A;  1N36 F;  1GXU A;  3HX9 A;  1VBX A;  2DPJ A;  1T03 A;  4DBQ A;  4FN5 A;  2B4O A;  1X4D A;  3TVK A;  1Z4U A;  3ZZU A;  5B0B A;  1M5K C;  4PYA A;  2B9W A;  1Y3J A;  4OX9 J;  4RBU A;  4OFZ A;  2CQD A;  2L9N A;  3FSY A;  2P9C A;  2HG4 A;  1YIT S;  2BZ2 A;  1FD8 A;  1WTF A;  1WF2 A;  4JI7 J;  2W9C A;  1ZM4 A;  4QWC A;  4LVN P;  3G82 B;  1CJK B;  1PC5 A;  2UVU A;  4ZPC A;  2UUB F;  4MIB A;  3NMR A;  2MXY A;  1AW0 A;  2VZ9 A;  3J81 Y;  4FNH A;  3C6T A;  2H5J B;  5GAG U;  1FE0 A;  3TX0 A;  3AQP A;  2ZH5 A;  1FKP A;  2WTF A;  3KK1 B;  3SEO A;  3CD0 A;  5DGA A;  2R8G A;  4KBI A;  2CG8 A;  3W2W A;  3I4P A;  2IYI A;  2VBZ A;  1K1S A;  1CBK A;  1JLG A;  2GVZ A;  5KT2 A;  1NZA A;  1HNI B;  2W24 A;  3F44 A;  2D9P A;  4FYW B;  4Y2M A;  4OI4 A;  3QNW B;  2E44 A;  3GMG A;  3KMQ A;  2FJW A;  4DV5 J;  1CEZ A;  1NHV A;  3RUB L;  5KG0 A;  2CPD A;  1R7I A;  5B0C A;  2QYC A;  4JV5 F;  2RSQ A;  1S1X B;  2PA8 D;  2Y3Y A;  3BBF A;  3NS5 A;  5KFN A;  2XGQ A;  1IUJ A;  4I1T A;  2ZH2 A;  3OTD A;  4M95 A;  5KTQ A;  5D77 A;  3JSM A;  3P8B B;  2DYA A;  1P8G A;  1X4F A;  4PAB A;  2AYM A;  4FPI A;  3M1V A;  4UY8 5;  3MM9 A;  4LFB J;  2AGP A;  1U1K A;  4DX5 A;  1GTH A;  3FEY B;  5KG7 A;  4CDI A;  1N54 B;  2VBY A;  4ZN1 A;  1CJU A;  5DDQ C;  1B99 A;  1TL1 A;  4LQ9 A;  4BC9 A;  4ELV A;  5IWA F;  1S1U B;  1ZET A;  4P10 A;  1XN9 A;  3MEK A;  2W4C A;  5DDR C;  4PAA A;  2ZM6 J;  5H9F J;  1Y00 A;  3OQ2 A;  2HVD A;  1DBD A;  2XCA A;  4C8N A;  1FFW B;  3VQT A;  2JEI A;  5GAD I;  3ETO A;  4YOE A;  1UCN A;  2BAN A;  4TN2 A;  1C4C A;  1VQ8 S;  4QWD A;  2KL8 A;  3PCO B;  1SBR A;  2LQ8 A;  4Y3C A;  3G6V A;  2QMU B;  2X7I A;  2DNL A;  1F5A A;  2QA2 A;  2VG6 B;  4ZVT B;  2D1C A;  4OL8 A;  2OEL A;  4ECZ A;  3NBP A;  2IJR A;  2ZD1 B;  2B43 A;  3ULH A;  4AUK A;  4OI6 A;  1D9A A;  2AYG A;  2DH9 A;  3KNA A;  2J8A A;  4HEA 9;  1FJE B;  1FJC A;  4YR2 A;  3UNG C;  3M30 B;  5ETM A;  2HVH A;  4KHR A;  3EJM A;  1F5B A;  2H3E B;  3HHK A;  3VGS A;  1CQN A;  2PMH A;  1TL3 B;  1R8B A;  3EZU A;  4BDP A;  5KFB A;  2QGF B;  3BF4 A;  4B9N A;  1S12 A;  3NCR A;  5IS2 A;  1ZTW A;  4RBV A;  4LF9 F;  1KC8 T;  2L9W A;  3WZ0 A;  3JQJ A;  4OJ1 A;  4F4W A;  2HVI A;  1GMV A;  4R25 A;  4DFK A;  3SCL E;  4DL5 A;  2XS5 A;  2QX0 A;  2MST A;  2MKK A;  3KHH A;  1MNE A;  3H5S A;  3M2V B;  1N34 F;  2C42 A;  1M5O C;  3D4J A;  4N8O A;  3P96 A;  1EP4 B;  5F9L A;  3MR6 A;  2RUG A;  2J6S A;  4P9S A;  3FQK A;  3CUL A;  1U2F A;  4OQJ A;  3LP0 A;  1YTY A;  3OHB A;  1HBO B;  3MEG A;  1U1N A;  2DR6 A;  3MUT P;  1HR0 J;  3H5Y A;  2ZH8 A;  2IFX A;  2DCL A;  3AY0 A;  4KHP F;  2NR0 A;  2CNO B;  5DO2 A;  4DV0 J;  2CA9 A;  4LFA F;  3KXD A;  5HQM A;  2UUC F;  3OSN A;  4V19 J;  4EFA C;  1SPB P;  2ZE2 A;  3KK1 A;  1FXR A;  2IRX A;  2FHJ D;  4B3R F;  2CAJ A;  2ZBC A;  3CJQ A;  4X4P A;  3T5K A;  4USV A;  1Q8B A;  5H9E J;  2VOD A;  4DX8 H;  2AJ2 A;  1NKE A;  5A8K A;  1Q95 G;  4DUY F;  3ISN C;  1X5P A;  3MAA B;  1RAA B;  4M1K A;  2YX1 A;  5DS7 A;  3SFG A;  4UZB A;  5DZ7 A;  4QQB A;  5KFC A;  4X64 F;  4CIO A;  1RLC L;  3DXB A;  4PQU B;  2XBP A;  1NHU A;  2W2N P;  3A8K A;  2BE2 B;  4JI2 F;  1MN9 A;  2R8H A;  1RAG B;  2FVS A;  2C2K B;  2QV6 A;  1FTR A;  4GVB A;  1KTV A;  4ED8 A;  2HNY A;  4DDF A;  3IBC B;  4HH0 A;  4ILL A;  3AH6 A;  4AL7 A;  1XNQ F;  5KFW A;  1SCJ B;  2QFI A;  2R9L A;  2X51 A;  4ICL B;  1SJ4 P;  2BJ7 A;  4DXL A;  1Q81 T;  2HLU A;  1QSS A;  4PRF A;  4A8W A;  5K14 B;  4PWW A;  2HAI A;  5AXL A;  4HDH A;  5DZ6 A;  5C7P A;  2XCP A;  3I5A A;  3UCZ P;  4NYP A;  2HRU A;  4B3M J;  2FIU A;  3OVS A;  1X5S A;  1Q53 A;  3KK3 A;  4DL3 A;  2OFH X;  5E2Q A;  3KJV B;  4NLV A;  1WEZ A;  3I31 A;  2XY7 A;  4O3O A;  3MEE B;  4ZPV R;  3B6B A;  5LT5 A;  1FNX H;  4DR7 J;  3T5L A;  2KM8 B;  2LDY A;  3UFC X;  4WF9 Q;  1NJX A;  5F3T A;  4J90 A;  3GIR A;  2J5A A;  2VG6 A;  5F8L A;  3M8S A;  1CS4 B;  3D0H E;  3GFH A;  2NUU G;  3KLF A;  1F2H A;  3SIP B;  3ZTO A;  2R2T A;  4G6V B;  4A48 A;  1UVJ A;  1N33 F;  3TP2 A;  1H72 C;  3MM8 B;  4ZVE A;  1KRP A;  3SMZ A;  1NME B;  4J7C A;  3OV7 A;  5CYM B;  4OI3 A;  1ZM9 A;  4YR0 A;  3CNQ P;  1FT8 A;  4CRJ A;  3EPI A;  2G0I A;  3M30 A;  2PSZ A;  2OH2 A;  4NZ0 A;  3CCL S;  3P4U B;  4ZIW A;  4ZVS B;  3TNV A;  1TL3 A;  2XSJ A;  1S1W A;  3QT5 A;  4EMD A;  4CLL A;  5JVG Q;  3H20 A;  4H4O A;  3BO2 A;  5HK4 A;  1S4F A;  2CJ9 A;  3AXM A;  1U1O A;  1RXO B;  3BDP A;  1FKA F;  4FVM A;  1WOR A;  1JXV A;  1DRZ A;  2WBM A;  3J80 Y;  1FTC A;  2Y8Y A;  1L3S A;  2VIC A;  3HVR A;  4OJH A;  2WAQ D;  1FRI A;  2MQN A;  3M2V A;  5IQ6 A;  3CDW A;  2VQE F;  2MLZ A;  4KY3 A;  1UW9 A;  4KQZ A;  2PFF B;  3AJ1 A;  2A2D A;  5DG9 A;  2HQG A;  1U1M A;  2CG4 A;  2AZ1 A;  1KHW A;  2BAC A;  3TUI C;  2J8S A;  3OLA A;  2JC0 A;  3PR5 B;  1BLU A;  4F4K A;  2ADC A;  2BQU A;  3LF0 A;  4O44 B;  4WFA Q;  3A4T A;  3NGD A;  1XIQ A;  1PYS B;  1WJ9 A;  1CC7 A;  4HHU A;  4F4Z A;  2V4J B;  3UDE A;  2B8P A;  4X4T A;  2WOM B;  4LF4 J;  1WC1 A;  2MSS A;  4M63 A;  1VHI A;  1U2C A;  3M2R B;  3T41 A;  2D3O 1;  2CJA A;  3D6H B;  2J7W A;  3DYA A;  4DF4 A;  3J7Y I;  4OHZ A;  4TYA A;  4NMX A;  3DRP A;  2LP4 A;  4HHH A;  2FGC A;  2QZ8 A;  2X3G A;  8AT1 B;  4LF2 A;  1T9V A;  2DGQ A;  4Y2K A;  3G6X A;  3NXZ A;  5HMX A;  5KT6 A;  3VAF A;  3C15 A;  1AXQ A;  1HNW J;  3J7Z 5;  3ISN D;  4IH5 A;  4ED5 A;  2NZ4 A;  1VRQ C;  3DMJ A;  4J9P A;  4PQU A;  2RB7 A;  1T02 A;  5BXI A;  2AQ4 A;  4DL2 A;  3UR3 C;  4X66 J;  2CPY A;  2DNY A;  2B5J A;  4HI1 A;  1WF1 A;  5KFX A;  4Q8E A;  2PD1 A;  4EEY A;  5MLC V;  1N5V A;  2AJ0 A;  3DDN A;  1RAI B;  4PG4 A;  5M2U A;  2FZC B;  3OBI A;  3K57 A;  4ZIT A;  1XEZ A;  4ILM A;  2M2B A;  4QW8 A;  4FF4 A;  1N6Q B;  4BCA A;  3W64 A;  1IBK F;  1BD6 A;  5HL7 Q;  3MFH A;  3C2P A;  2ZHO A;  3F56 A;  5HI7 A;  2NCK L;  2DNQ A;  3Q24 A;  2JJ4 D;  3O5T B;  3MF5 A;  1VQ6 S;  3MEE A;  1TU0 B;  2QT7 A;  2RNE A;  3WBZ A;  5A8W B;  3T1Y F;  4P71 A;  2CQB A;  4W4M A;  4JI3 J;  1SC4 B;  2UV8 A;  4P52 A;  3TAM A;  4OV1 A;  4OHX A;  2K2P A;  2HFN A;  3FZ2 A;  2R7O A;  3SV4 A;  1N36 J;  2Z58 B;  2H65 B;  4KIA A;  1OJ4 A;  3PYE A;  2VD3 A;  1B7F A;  4DV3 F;  5CYM A;  2FC9 A;  3RBD A;  1LEO A;  1QY7 A;  1RT1 B;  2ACM A;  3CCT A;  1D9F A;  1U8S A;  1WI6 A;  4OZN A;  5KG2 A;  1AT1 B;  3CED A;  1U1P A;  4B9V A;  3G8T A;  3JSY A;  1LWE B;  2FQQ B;  1L3U A;  2HEK A;  1Y3K A;  1KTQ A;  2CAD A;  2MZR A;  3DOM A;  4DU8 A;  5KFA A;  1B7Y B;  3BQ2 A;  3DHX A;  2RML A;  3DI6 B;  2B6A A;  3D1Q A;  2VL1 A;  3P45 B;  4G1Q B;  1ZA2 B;  1JLB A;  3CCR S;  1DTQ B;  5HJX A;  4ED4 A;  3DLH A;  1U48 A;  4ZCK A;  1YJW S;  2VOP A;  1IR2 A;  4EBC A;  4GO7 X;  4NA2 A;  3W65 A;  2CQH A;  1UVN A;  4P6Q A;  1HI8 A;  4PWU A;  5LMU F;  4NLG A;  4CLK A;  4LMZ A;  1B0T A;  3WIU A;  3QQC D;  2B8Q A;  3DRY A;  3M6X A;  4ES3 A;  3TOQ A;  4KV8 A;  5ETS A;  1VBK A;  5LM7 E;  4YB5 A;  4ZPD A;  2DTJ A;  1TQL A;  4F36 A;  3GIJ A;  1SC1 B;  1RWP B;  4DG1 A;  2B7C B;  1M5P C;  3C14 B;  3U7J A;  1WHX A;  1BC6 A;  4O44 A;  4JV5 J;  4UF4 A;  3DLJ A;  2NXC A;  4CT8 A;  4DL0 C;  2CPJ A;  2H1Y A;  2V4J A;  4UZC A;  3DLE A;  1HBN B;  2L9D A;  2DH7 A;  2WOM A;  5IT0 A;  1QAI A;  2LA4 A;  4X62 J;  2XNQ A;  5KFO A;  4RW4 B;  2UXC F;  2Z56 B;  2OP5 A;  1F3V A;  3FQL A;  3NGK A;  4RW7 B;  5MAO A;  1S6P A;  2ZUG A;  3WC0 A;  4ZVF A;  4K2X A;  3N6L A;  2DRD A;  4YME A;  4N56 A;  5CCM A;  2BE7 D;  3Q2T C;  2CIM A;  1HYS B;  1FWL A;  1VC5 A;  4NI2 A;  3VAK A;  2V8G A;  1LW0 B;  1WSV A;  1TKZ B;  2QA4 G;  4DFM A;  2RUS A;  1NEE A;  2RHS B;  5LL6 d;  1TL7 B;  3IS9 B;  1EAY C;  1TVR B;  4B9M A;  5DQI A;  2GMJ A;  1S6Q A;  1XR5 A;  3CIM A;  3HUL A;  1S5Z A;  2R7U A;  1YWX A;  1JJH A;  1ZZN A;  3LPE A;  4CQ1 A;  2Z2M A;  1N88 A;  2A1B A;  2HQD A;  1DAR A;  1RWX B;  2W4D A;  1IQZ A;  4NLT A;  3GII A;  4JI8 F;  1TR0 A;  1M5V C;  3HHD A;  3PG9 A;  3R97 A;  3P5B P;  4HKQ A;  1S49 A;  2KXF A;  2BXJ A;  1HA1 A;  2ACY A;  1TKT B;  4NLR A;  2QMX A;  1RTI B;  1IVZ A;  1SI9 A;  2DR7 A;  3MUM P;  5IC4 B;  4OJG A;  3ZZT A;  4JI6 J;  3QID A;  2FVC A;  3W9J A;  1JKH A;  2MQM A;  3M32 A;  4E2F B;  4F26 A;  4LRC A;  3CCU S;  5B0F A;  4WZQ A;  5K5M A;  5C2C A;  2O5D A;  5CD4 A;  2W9B B;  3OXG A;  1TKX A;  2E5H A;  3G86 A;  3Q22 A;  3B8H A;  3UWT A;  1VQM S;  3GFY A;  3TUZ C;  2ROE A;  2XI2 A;  4Y2C A;  2KZM A;  2XMM A;  1VHF A;  2Z2Y B;  1N8R T;  1NK8 A;  1X8D A;  3R2C J;  2QLB B;  4YR3 A;  3PRD A;  2KFN A;  5KFG A;  2DT9 A;  2CQ4 A;  3PFE A;  1N34 J;  1K0V A;  5I3Q A;  2IVM A;  1SL2 A;  2IAJ B;  3MCS A;  1BHN A;  3QFH A;  4EYH B;  1ZAX A;  1OQ3 A;  1C1C B;  3JQK A;  1RT1 A;  1U1Q A;  1XER A;  2OLW A;  4TLQ A;  4MKY A;  2HHV A;  5KG5 A;  5BYS A;  1RTJ B;  1HPZ B;  3O44 A;  4ES2 A;  5A6P A;  3HFZ B;  2KT5 A;  1LWE A;  2IVF B;  3NNH A;  3K0J A;  2M5Y A;  2WCX A;  4KHP J;  4H4M B;  4DFJ A;  1UVK A;  3HFV A;  3POT B;  2D41 A;  2W7P A;  1Q86 T;  4LFA J;  3DI6 A;  1SIW B;  3A3N B;  2UUC J;  3RZA A;  2LQB A;  1IJE B;  2Q6B A;  1U7L A;  2OPP B;  3MPW A;  2M88 A;  4DLG A;  2CPZ A;  1FRJ A;  1Q5Y A;  3H0P A;  1RLD A;  1HLW A;  2DKO B;  4B3R J;  5LJ3 Y;  4NWB A;  1I94 F;  2LEP A;  1S6U A;  2XS2 A;  3LWM A;  4CLT A;  5IFM A;  3I6P A;  1PYO B;  3PHT A;  5K8M A;  1VRU A;  4NCB A;  1FK9 B;  5IT9 U;  4LF8 J;  4DUY J;  4NRU A;  1UVM A;  2AGQ A;  3AOC A;  4KH1 B;  4ZJO A;  2N4D A;  2EBG A;  2KT3 A;  3QAU A;  2GJI A;  3QMQ A;  4X64 J;  4WE1 B;  4LF7 F;  4CH1 A;  5JVH Q;  2QRR A;  5DQH A;  3D1H A;  3CDA A;  3QO9 A;  3HT0 A;  4Y28 C;  3AQO A;  3DRR B;  1YGY A;  4I56 A;  4JI2 J;  2XYG B;  1HBN A;  2HND B;  2F8E X;  4CO3 A;  1S57 A;  2FZG B;  4RUH A;  4RW7 A;  5HAO A;  4LF6 F;  4M5L A;  4DV4 J;  2PMW A;  4TU7 A;  1LK7 A;  2AMC B;  1XNQ J;  3PM9 A;  5C2G A;  2RRB A;  1FA0 A;  4RW8 A;  1YJR A;  1EX8 A;  2YNH B;  1RP5 A;  5KFR A;  3QRR A;  5D4N A;  1HYS A;  3PW4 A;  1FJG F;  2PN6 A;  1Q7Y T;  4RX6 A;  1EKR A;  2VFT A;  3W8G A;  4L3N A;  3WX4 A;  3RR7 A;  3W9I A;  3SFU A;  1LW2 A;  1M0S A;  5GMK a;  5D15 A;  2FHO B;  4U95 A;  4M8L A;  3R5G A;  1B64 A;  1HQ2 A;  4XAK A;  2VHG A;  2DNO A;  1RI7 A;  3JS9 A;  2DD8 S;  3PZP A;  2EFV A;  1TL7 A;  3IS9 A;  4YB7 A;  1HWK A;  2KM8 C;  3BS9 A;  5M2R A;  3RW6 A;  3ZTP A;  1TVR A;  2CXE A;  1N5Q A;  2B0G A;  2LVW A;  5F41 A;  1LNQ A;  4J9K A;  2FTR A;  4RNO A;  4ZVH A;  2MZJ A;  1EHW A;  1GAO A;  5I3P A;  4M5M A;  2VPZ B;  1LQ9 A;  1NK6 A;  1OSC A;  2RDD A;  3HK2 A;  3I82 A;  1N33 J;  1R3N A;  3KJF B;  2DO0 A;  4YS2 A;  4DPT A;  2AZ3 A;  1RWW B;  1S7H A;  4ZJL A;  2Y1L B;  3CO9 A;  4DN0 A;  4IFY B;  4K59 A;  2AIR B;  1YRT A;  1CSJ A;  4CYU A;  4TYB A;  4XK8 C;  5LSR A;  1T9X A;  2FJV A;  3RRK A;  3B4D A;  1RTI A;  3GYX B;  2KRB A;  3OFG A;  4NZ7 A;  3KJN B;  2UUA F;  1WWH A;  5A2Q Y;  4IFV A;  4QPT A;  4L72 B;  1GX6 A;  1I5O B;  3PX0 A;  4F8R A;  1ZBT A;  2EFG A;  2GO9 A;  2OSR A;  4FYD A;  1JLQ B;  1IJF B;  2W9B A;  1JLE B;  4CI0 B;  1FI4 A;  2ZIT A;  4X4V A;  4OZ5 A;  5B0D A;  2HS0 A;  2JVR A;  2JSX A;  3Q2S C;  1FHT A;  3MM5 B;  2IM0 A;  4ED1 A;  3CCS S;  2RQC A;  4C6A A;  2HK2 A;  3NGS A;  3S6E A;  3QWU A;  3MTJ A;  1NH7 A;  2N7Y A;  2RVJ A;  2AYE A;  2RQ4 A;  4F4Y A;  2MY8 A;  3KG1 A;  4YN3 B;  3MWB A;  3UDV A;  3L7P A;  4K4V A;  2IAJ A;  3JTP A;  2ZZM A;  1RU1 A;  2X3D A;  2AV5 A;  1S1T B;  1DZ5 A;  1SJF A;  3H98 A;  1JIH A;  1JJ4 A;  2O01 C;  4KFB B;  2YPY A;  1XC9 A;  5D6G A;  1SQG A;  4I69 A;  1WC3 A;  2MJN A;  2VUG A;  4OX7 A;  2ILY A;  3Q8V A;  2FY1 A;  3OL8 A;  2ZHA A;  4GKK F;  5G4D A;  4OIX A;  3T6J A;  1Y10 A;  1HD0 A;  2PT0 A;  3PJW A;  4H4M A;  3KUH A;  1BQN B;  1FCA A;  4JI0 J;  3POT A;  4TVA B;  5KT4 A;  2HFV A;  3M4X A;  3ENA A;  2DXE A;  2DHS A;  3DOK B;  1TK5 A;  4C3K A;  4QZV B;  4O4G A;  3Q8R B;  4KRW A;  5ETL A;  1Q4R A;  2YKM B;  3CVK A;  4D3G A;  5T7L B;  2JFK A;  3EYZ A;  4HYK A;  2R7T A;  3WIV A;  1SL0 A;  1M90 T;  3FBF A;  4KB7 A;  2J0W A;  2KXH A;  2IDE A;  2PEB A;  1NZ8 A;  2LYV A;  2FUG 9;  1WSR A;  4EWT A;  1NH8 A;  2KT2 A;  4WTY A;  3SBM A;  3C3L A;  2DNZ A;  3BV8 A;  2EWH A;  7FD1 A;  4Z37 A;  4C8L A;  1JMT A;  1JLA B;  1HFE L;  5G0R B;  2ZUA A;  2ZNZ A;  4CWB A;  1FNM A;  5K8P A;  3MTK A;  1CJV A;  4YDX A;  5E3A A;  4JYA J;  3HZE A;  3OXF A;  4HTJ A;  4MKV A;  1JQG A;  1VK8 A;  3DRR A;  3MEC B;  1LFW A;  4Q2M A;  2HND A;  1Y5L B;  1MRO B;  3QAT A;  3HHL A;  5HSP A;  3CF5 Q;  1WC5 A;  2VBW A;  1XMO F;  2Q6C A;  3JSR A;  4M94 A;  5LOQ A;  1RHK B;  2AX0 A;  5F8J A;  2DK2 A;  4ZVQ B;  1SKW A;  4RNN A;  3J7A 1;  1QUV A;  1VIO A;  1NDK A;  4DR4 J;  1REV B;  3DN9 A;  3FRZ A;  3UD5 A;  5GAG I;  1NHK L;  4JV1 A;  3HVT B;  1YRX A;  3PFO A;  1HNZ F;  1O6X A;  1IBK J;  2P5V A;  3NMA A;  3SDE A;  1U26 A;  2VA2 A;  3OL7 A;  3N6M A;  2F9D A;  5D4P A;  2H5I B;  2Q1L A;  3CO0 P;  4L73 A;  2V5H G;  1K0T A;  2BUN A;  2OGU A;  1WHY A;  3FZB A;  4IUF A;  3AHP A;  5F0W A;  4LT6 A;  5DGB A;  1GQE A;  4ZVR B;  2PO4 A;  5KFI A;  3KK2 B;  2AX1 A;  3TR5 A;  3FSI A;  5F8M A;  2MDA A;  4MIW A;  4LR9 A;  2M4M A;  1H0H B;  2HK3 A;  4YUD A;  3OUY B;  4F25 A;  1NBE B;  1O5J A;  3GSI A;  1YRU A;  1RAF B;  3PRV A;  1WHV A;  1QTM A;  4IFY A;  3CC7 S;  1JXE A;  2OPQ B;  4FP9 A;  4PG8 A;  3GJQ B;  1HHS A;  2VA3 A;  3PIO Q;  4A46 A;  4OYP A;  4OYM A;  5E3P A;  4KJI A;  2MHE A;  1TMJ A;  2YQ0 A;  4QIV A;  4P2X A;  2ZH9 A;  2KN4 A;  1T05 A;  2K8G A;  5D3G A;  2LXF A;  2W1B A;  3GV5 B;  3LOU A;  4OLO A;  4WKR A;  2R8J A;  1QSL A;  2HVE A;  1T8E A;  2W8L A;  1GMW A;  2FLL A;  4YEA A;  4CP5 A;  1V3S A;  1V5V A;  1U45 A;  2F4V F;  3FBC A;  1UW4 A;  3B78 A;  3RG6 A;  4QU6 A;  2R2U A;  5KFJ A;  4QU7 A;  1X5T A;  3V2U C;  2V4R A;  3KLG B;  2OKQ A;  3DLG B;  1TZ0 A;  1GXT A;  1FXL A;  2ZOF A;  4ECQ A;  4WKY A;  4UOC A;  5HLF B;  1RHQ B;  2B56 A;  3DOL A;  2YX7 A;  5CHC B;  2IM3 A;  4JI1 F;  5JMN A;  1SJ1 A;  2ZH1 A;  3S7R A;  1IQT A;  3AA9 A;  1IBL F;  4NZ6 A;  1YZ6 A;  4U7C A;  2CQC A;  5HQ8 A;  1QE1 B;  1SUQ B;  4CO2 A;  2HQ3 A;  4IYQ A;  3HHN B;  4K50 A;  4OX6 A;  1F9H A;  1X4C A;  3PY8 A;  1J5O A;  4DV6 J;  2BX6 A;  1S59 A;  1XNR F;  3ZZY A;  4CLZ A;  2UXC J;  1N56 A;  2EVZ A;  1FES A;  2OPR A;  4ZVP B;  5E3Q A;  1AYE A;  4IO9 Q;  3UN2 A;  3GG0 A;  1GK8 A;  4R0E A;  3ZTS A;  3NGU A;  3ZZO A;  4ZCM A;  2BJ3 A;  2P6T A;  1H2U X;  2ILZ A;  4CO4 A;  5FLX U;  3QSI A;  3SCK E;  1R6V A;  4KKO A;  1JLA A;  3OT9 A;  3KLV A;  4MH8 A;  2WON B;  1KLM B;  4AQY F;  4XPC A;  1L3K A;  3LGH A;  2IJN A;  2CWX A;  2BM0 A;  2HS4 A;  3FEX B;  2C2D A;  4HAC B;  3MEC A;  1NAQ A;  3CCE S;  4FXW A;  3CDB A;  1UA1 A;  2DGT A;  2RU9 A;  1D0E A;  3IN5 A;  3FC9 A;  1FDD A;  3UN5 A;  3CJ2 A;  3H8Y A;  2B51 A;  2MGZ B;  2UU9 F;  2IBK A;  3R3T A;  1URN A;  4CH0 S;  2K1R A;  4DPW A;  5KFF A;  3LWL A;  3V4I B;  3FSX A;  1FRX A;  1NO8 A;  5I42 B;  5GVQ A;  3BR9 A;  2IC3 A;  4ECX A;  3FCV A;  1TTH B;  5IM0 A;  2C1E B;  5F8N A;  1P27 B;  1E6V B;  4ZVU B;  1ZZF A;  1LWF A;  2BJ9 A;  1R0A A;  4FDF A;  1MW7 A;  4HDG A;  2HLT A;  1WD6 A;  1NPR A;  2NPI A;  1B70 B;  4M5K A;  1QAX A;  1OO0 B;  3W8P A;  2K7K A;  1OPI A;  4RWW A;  2YKN B;  3VF0 B;  1VQ4 S;  4ZS6 A;  4EGL A;  5C42 B;  2NXN A;  3IC1 A;  4IG0 B;  4HR2 A;  3ET6 B;  4GMK A;  3R5J B;  1UAW A;  3QGI A;  4WFY A;  1KSP A;  1M1K T;  4LSL B;  3MMJ A;  2QC3 A;  1JK9 B;  2XWY A;  4PCQ A;  1EQM A;  4IH7 A;  4P73 A;  2ZEJ A;  2VV5 A;  1YSJ A;  2J9C A;  5IOL A;  3W61 A;  2EG1 A;  2OPQ A;  1VLO A;  3ENW A;  2FJE B;  4FYV B;  2KG1 A;  3OFE A;  1T0T V;  3MAQ A;  3LQV A;  1PAU B;  4K2J A;  2HHQ A;  2C2M B;  3GIL A;  3QGG A;  1VYA A;  2D3O R;  1P1L A;  1R27 B;  4YHH J;  4OZJ A;  2EC2 A;  1QTN B;  2JWN A;  3PJX A;  5EWE A;  2YKQ A;  3EIC A;  2O66 A;  5E3R A;  3RB4 A;  3DGP B;  4AL5 A;  1WG5 A;  2ZOG A;  4B3O B;  4OX8 A;  2AU0 A;  2JHE A;  1RU2 A;  2MZS A;  4Q45 A;  2HMI B;  4TKT A;  3MD3 A;  4OHY A;  4A8Q A;  5IV4 A;  2IIH A;  1MML A;  3D67 A;  3KDN A;  2A6M A;  2CQ0 A;  3HP6 A;  5B09 A;  2VFS A;  2NLW A;  2F5G A;  4X65 J;  2X1G A;  2HHH F;  3KLG A;  4NCG A;  2VJV A;  3DLG A;  4TU8 A;  4C3M A;  3W5Z A;  3FVY A;  4QWA A;  3G8S A;  5EX3 A;  2FHK A;  4U7U D;  1PG5 B;  3DC2 A;  2W01 A;  2W7A A;  3D54 A;  4DCP B;  2MQ8 A;  2YBV A;  4IOB A;  2CDR B;  1C0U B;  2DR9 A;  4E0D A;  2GNK A;  2PFD A;  2Q79 A;  3THV A;  4LF7 J;  4EU0 A;  1FD2 A;  1QE1 A;  3F0N A;  3NP5 A;  1SUQ A;  3IAM 9;  2JLG A;  2MZ1 A;  3HFK A;  2V69 A;  4DR5 F;  2QE5 A;  4FS1 A;  1BQX A;  1CVJ A;  5J2P A;  5BYQ A;  2PII A;  3IGN A;  3MED A;  3PRB A;  3BO3 A;  1VK3 A;  1HWJ A;  3LW5 C;  3MXH P;  2I6W A;  1X9W A;  4QWE A;  1RZM A;  4DZ6 A;  2FJD B;  3NOC A;  3A1Y G;  2A6O A;  3TZW A;  2GJ2 A;  3T1H J;  2I0X A;  1N5T A;  1TKD A;  2RS2 A;  4B3T F;  2G0J A;  5KT3 A;  3K8V A;  3H5U A;  2ERR A;  2CWK A;  4IO1 A;  3NS6 A;  3CGI A;  3OHA A;  5HRO A;  4RNF A;  5LSO A;  2IY5 B;  2WW4 A;  4DQR A;  3BN4 A;  1Q0N A;  4B3S F;  1KLM A;  2QLF B;  4IG3 B;  3HPO A;  3AOB A;  1N52 B;  3L7O A;  1ZM3 A;  2JFD A;  1RTH A;  4DV1 F;  1FER A;  3TJ9 A;  1FRH A;  2B9E A;  4A8K A;  3AB2 B;  1F60 B;  2W9C B;  3FDS A;  1LXN A;  4O4R A;  2MGZ A;  3HD1 A;  3Q0A A;  1VQK S;  2ROG A;  2QL5 B;  4DX7 A;  3BQ0 A;  1RAO A;  3N6N A;  3C6T B;  4ECV A;  2ASL A;  4KGX B;  4HT7 A;  5K8N A;  1I3O B;  1PKU A;  1PBA A;  3UPF A;  4R8U B;  1E6V A;  1RCX B;  4LRE A;  1WDD A;  4IRC A;  1EQ0 A;  4W98 A;  1PJ6 A;  3Q83 A;  2R8K A;  3LAK A;  3OFH A;  2J6U A;  2X1F A;  4I68 A;  3W2W B;  4B9S A;  4F3M A;  4LRD A;  4J9N A;  3I9V 9;  2GVZ B;  1JLG B;  2U2F A;  2UUA J;  1GTE A;  4X4S A;  3L9Z A;  2YKP A;  1HHQ A;  1NK7 A;  2CZV C;  1RWN B;  2C3U A;  1GEH A;  2IMW P;  3K59 A;  3C19 A;  3PEJ A;  2JLF A;  5DDO C;  4NYO A;  4EI2 A;  1VC0 A;  3FCH A;  5C24 A;  4LVO P;  4WU2 A;  4L75 A;  1YZ7 A;  1IBM J;  2B9Y A;  1ZH5 A;  3RR8 A;  5GAH U;  1RT6 B;  3B4M A;  2Q66 A;  2ZNY A;  1RDR A;  2DH8 A;  5IV3 A;  2O67 A;  4AT1 B;  1HWU A;  1IKW A;  4QCL A;  4LSL A;  4QW9 A;  4CLS A;  5L9N A;  2ZVS A;  1JWW A;  5F0U A;  3D7S B;  2K06 A;  2R42 A;  4NLU A;  5ETO A;  4TU9 A;  1LXJ A;  3V5R A;  1NDC A;  4E98 A;  4HTI A;  4ER8 A;  2MKC A;  1T9T A;  3BO4 A;  2AEM A;  2CPF A;  2FVR A;  3M05 A;  3CXC R;  4ETX A;  2MQQ A;  3BH7 B;  2MZQ A;  2VF3 A;  5T41 A;  1V3R A;  3MPU B;  3ILJ A;  1ACM B;  3R5C A;  4RLE A;  1U4B A;  1YJ9 S;  3DU6 A;  4GKK J;  2EEY A;  3CMQ A;  2FVP A;  1FRM A;  2N7C A;  2Z8Q A;  3OTO J;  4J5O A;  4ZCI A;  3N28 A;  5D0H A;  4ED2 A;  3DGP A;  1IXK A;  2XNR A;  4HHJ A;  2GIQ A;  3R5B A;  1VI7 A;  4B3O A;  2HMI A;  1LKZ A;  4DLE A;  2UXB F;  2C2E A;  4PG5 A;  3BBC A;  3E3X A;  3M6V A;  3G87 A;  3VWS A;  3M2U B;  1OY6 A;  2MJU A;  2BAN B;  1Y5I B;  3PTW A;  3NL0 A;  1VRT A;  5J2Q B;  3E8O A;  3G6E S;  1XJW B;  1G7C B;  1UJ4 A;  5HP1 B;  2MLX A;  1AUS L;  1JXL A;  4QIG A;  3NNC A;  1KNZ A;  3NBP B;  3SCI E;  5F9N A;  1HI0 P;  1KN6 A;  1BY9 A;  2BDP A;  2APO A;  1RAD B;  2C22 A;  1C0U A;  4USM A;  2FLO A;  2W2P P;  4U8V A;  4AFF A;  2EFO A;  1NKC A;  3EGV A;  3W5Y A;  1NB2 A;  2HZA A;  1PBU A;  1M1H A;  4PG6 A;  3OSP A;  2WZ1 A;  4OYI A;  1IKX A;  1XMO J;  3JTN A;  2BM1 A;  5K20 B;  4O3R A;  2LDI A;  4MAK A;  2LQ5 A;  3AT1 B;  1G2E A;  1X5O A;  3KG4 A;  4J9S A;  1U6F A;  3G2X A;  3TZZ A;  5ETT A;  2KO1 A;  2YNG A;  3OFF A;  5EGY A;  4LFC J;  3C6U A;  5HMY A;  3K5L A;  1TUW A;  4ZP6 A;  1HNZ J;  3M7V A;  2ZBQ A;  3QAE A;  5AE3 A;  1T9Y A;  1EZZ B;  3TQ1 A;  4PG7 A;  4R5P A;  4IG3 A;  4ZPB A;  2C3Y A;  4ZA1 A;  1SH2 A;  4HT5 A;  4WFN Q;  3Q8Q B;  2I1R A;  2R7V A;  1B0P A;  3LP0 B;  4F0K A;  3PHE A;  4DSJ A;  3MEG B;  4H4K A;  4LR8 A;  3IR5 B;  4LRF A;  3ZNJ 1;  2KRR A;  1A6L A;  2DXD A;  3TW0 A;  1H7W A;  1JLF B;  4ANE A;  4TQS A;  2BKP A;  1VJQ A;  1ULR A;  2M3D A;  4IQM A;  2VFV A;  2CUY A;  2V68 A;  1S0O A;  4RNH A;  4ZLJ A;  3DRX A;  1YIJ S;  1TP7 A;  4R8U A;  1OWX A;  2G2O A;  3NNA A;  2ZE2 B;  5GME A;  1Q1K A;  3IWX A;  1NJY A;  1RUS A;  4AND A;  5A6W A;  3RAX A;  4J91 A;  1NK0 A;  1UTA A;  3AJD A;  2RRN A;  3UNY A;  3SQO P;  3U1N A;  5A8K B;  1VJW A;  4RL1 A;  1FO1 A;  1T7P A;  1TAQ A;  1XR7 A;  2VPX B;  3ELH A;  2KB2 A;  3KWM A;  3DGV A;  3TVZ A;  3RB0 A;  2VON A;  4DI6 A;  2KI2 A;  1RT6 A;  2HWI A;  1FWK A;  4OZ2 A;  2D3Z A;  2AJ4 A;  3D66 A;  4C2M A;  5HMZ A;  1EB0 A;  1GMW D;  2F4V J;  2AEF A;  4TY9 A;  4GVB B;  2KHC A;  2XI3 A;  2C3M A;  2VC1 A;  2BW2 A;  1C4A A;  4WBF A;  4QIE A;  2HNY B;  2D69 A;  1V9O A;  3M9N B;  1GNK A;  4OX9 F;  4O0N A;  3NAH A;  3KOA A;  1SJQ A;  1DLO A;  2BJ8 A;  1DQ9 A;  2J76 E;  1MWQ A;  1KFD A;  2YNF B;  4F0H A;  2E7W A;  2GV1 A;  2VOO A;  4C8K A;  1N32 F;  3H40 A;  4CO1 A;  4ILR A;  3OJS A;  5DM7 Q;  4J9V A;  1IBL J;  2EW9 A;  2JRS A;  3PYG A;  4DSE A;  3NCQ A;  1S10 A;  1TEL A;  4XDC A;  3CJ5 A;  4Q8F A;  3MMB A;  4A8O A;  4E8U A;  3EDR B;  3UN3 A;  3IMQ J;  3VGV A;  3R1L A;  3MD1 A;  4PYD A;  3KK3 B;  3OD2 A;  2XO6 A;  2HFU A;  1KVJ A;  5J1P A;  5HQL A;  1RK8 A;  4DR6 F;  1J5E J;  2RIJ A;  3M2U A;  3NGR A;  3UI3 A;  2GHW A;  2JOQ A;  1KFS A;  2XLK A;  3MPD A;  2FVQ A;  5J2Q A;  1NLK L;  2LA6 A;  5HP1 A;  2FGO A;  5IT9 Y;  2GZO A;  1NKB A;  1WOP A;  4EK2 A;  3K5M A;  4OHV A;  3KLF B;  4C0B A;  1F0X A;  1SL1 A;  4RUC A;  2OJ3 A;  4D3H A;  4DV5 F;  1FX4 A;  2CPE A;  4F50 A;  1Q8K A;  2DGS A;  1T9U A;  2QLJ B;  3DHW C;  1NK5 A;  4EZ9 A;  4X4N A;  3EDQ B;  1QUP A;  2QJ3 A;  4NXN F;  3IBW A;  2VPW B;  3PYF A;  1QAY A;  1RWO B;  1T94 A;  3PVX A;  1HMV B;  3PNI A;  4WIQ A;  3RJM B;  4DL4 A;  2XSJ B;  1S1W B;  2UU9 J;  4FVC A;  2V4Q A;  2PEH A;  1AFI A;  1DHM A;  4H4O B;  2C2N A;  4U67 Q;  4M5H A;  2KHD A;  4BLG A;  1IKY B;  3R27 A;  3DLK B;  3L09 A;  3K8W A;  2OTL S;  1J27 A;  4I67 A;  2I5J B;  4HL9 A;  2EFP A;  3MAH A;  3W63 A;  2COL A;  3OR2 A;  3BZQ A;  5FDL B;  3U1M A;  2WVD A;  1RA7 A;  3TUJ C;  2ZKU A;  5HBM A;  3I0R A;  1KVI A;  2YNI B;  4PQA A;  1UEK A;  4F3Q A;  1O51 A;  4ECW A;  2ZM6 F;  3OL9 A;  4I2Q B;  3VZH A;  5T14 A;  2GFF A;  4J9M A;  4MFB A;  1H38 A;  4HI2 A;  4LJM A;  2V2Q A;  5K9F A;  3M8R A;  4AD6 A;  3H90 A;  2R2R A;  4ECT A;  1S0M A;  4MK8 A;  2OML A;  3LP1 B;  2FZK B;  1WOO A;  2NXU A;  1KQF B;  2HGL A;  3I87 A;  2CJX B;  4KGM A;  4PPZ A;  3VVU A;  5KFK A;  3K58 A;  3VAI A;  1JLF A;  1BXN A;  3IBF B;  4IRK A;  1WI8 A;  3GB0 A;  4LF5 J;  5L46 A;  1U2R A;  3M8Z A;  1RAH B;  1D8Z A;  1CJT A;  2V8H A;  1RBO B;  4M5J A;  2LEC A;  3TQE A;  4FF1 A;  3MCM A;  1OIA A;  2QLX A;  2PMZ D;  3OW2 R;  2XMV A;  3U27 A;  3DYA B;  3GJS B;  3CTR A;  3DRP B;  2G1D A;  3MR2 A;  2FYX A;  1FDN A;  2GJF A;  3DLB A;  2F3J A;  4PEO A;  4F3O A;  4Q43 A;  3SSQ A;  2GAH C;  3HD2 A;  5C25 B;  2NS1 B;  4CO5 A;  2LCW A;  3TA1 A;  1IM4 A;  2P2C B;  3C15 B;  1X4G A;  1RB0 A;  3PW2 A;  2UZA A;  4USI A;  4LSN B;  2J7K A;  3QFW A;  3HT3 A;  3CCQ S;  2W2Q P;  2JX2 A;  3TAR A;  1U24 A;  3DMJ B;  5IXU A;  5GMD A;  3T5J A;  3D2W A;  3A8J A;  1CUL A;  4LR7 A;  1BGX T;  1HI1 A;  4OMF G;  2G1H A;  4ZLL A;  3WC2 A;  2Q3P A;  3EWG A;  3F73 A;  1QD1 A;  3UVJ A;  3PYD A;  2B5J B;  3PAC A;  2BQR A;  4ZK7 M;  2DNR A;  3EMT A;  4ES1 A;  2WVE A;  1L5U A;  2YX4 A;  1KBR A;  2YNF A;  2XWX A;  5CD4 H;  3H25 A;  4UUX A;  4DX6 A;  4NLO A;  4CTA B;  3EUN A;  2DNN A;  4C11 A;  3K89 A;  3HXM A;  3UE2 A;  1OYD A;  1VDH A;  3Q8U A;  3VZI A;  3CD5 A;  4DR5 J;  1SH0 A;  2DVI A;  4ID8 A;  2FHJ A;  1MMN A;  2OUG A;  1T95 A;  2QIF A;  4ZDN A;  2BJE A;  3T3F A;  1DAX A;  4DMZ A;  2OEK A;  4MMO A;  3DKD A;  1FKO B;  4UQG A;  3TAM B;  2ZJR Q;  4YY3 J;  2VKR A;  3ZTR A;  1VQN S;  1UVL A;  1W7W A;  3ITH B;  4B08 A;  2UV8 G;  3ETM A;  5F8G A;  1VGY A;  4GC7 A;  1NK4 A;  1I1G A;  4B3S J;  1XK8 A;  1KLN A;  2Y0S D;  2ZDP A;  1N5Y A;  3Q8Y A;  1NJW A;  5AXM A;  1U1R A;  1E6Y A;  2JZ5 A;  3PO5 A;  1RHU B;  1WOS A;  3CE8 A;  2H5E A;  5E3C A;  3PIP Q;  1TUG B;  4DV1 J;  3THP A;  1HMV A;  2HWH A;  5ETQ A;  3H42 A;  3SSR A;  3DXS X;  4I64 A;  4USU A;  3TAP A;  4W92 B;  3W60 A;  3DOM B;  3DU5 A;  4TY8 A;  2WSF C;  2WSE C;  3NWG A;  1IKY A;  2AHO B;  3DLK A;  4OZL A;  2GW8 A;  2B6A B;  3CCM S;  3DDK A;  2I5J A;  1JLB B;  1RJJ A;  4NLW A;  5FDL A;  4K5S A;  4DS4 A;  4EBE A;  2XG8 A;  4CCH A;  2YNI A;  4RJV A;  1ELO A;  3VAL A;  3AFG A;  4B3M F;  3ISZ A;  4I2Q A;  2DNP A;  3D6F B;  1OS5 A;  4QBU A;  4OYW A;  4KV8 B;  4NLX A;  3QZ8 A;  3NY0 A;  3H2L A;  2ZDO A;  5AE1 A;  2ZH7 A;  2DY9 A;  4DR7 F;  3TX8 A;  1KR4 A;  3LP1 A;  1D8Y A;  2H4Y B;  1BMQ B;  1YHQ S;  4DG1 B;  4HLB A;  2IJF A;  2CNL B;  3CD7 A;  1BQM A;  2F40 A;  4FKX A;  3BPD A;  1YDL A;  3IA0 A;  3DLE B;  2LXI A;  3GON A;  2VG5 B;  3X3U A;  4X4R A;  3BGR A;  1D3W A;  2L48 A;  3QRQ A;  1S6P B;  1YJN S;  2RIL A;  5BJR A;  3MM7 A;  4TQR A;  3ENQ A;  4KPC A;  4MK9 A;  5DDP C;  4DL7 A;  3I56 S;  5B7W A;  1KP6 A;  4Q7A A;  2BA9 A;  4QJV A;  4X4Q A;  2BOP A;  5C25 A;  4NI2 B;  8ATC B;  2WVF A;  1MWY A;  3OL6 A;  3MDF A;  1RGV A;  4FZV A;  2YWH A;  2V8D A;  2PA3 A;  4M5G A;  4LSN A;  2AJF E;  3VVT A;  1SV5 A;  2UXB J;  3GJT B;  4RUA A;  2DEJ A;  2E9R X;  1H74 A;  3N5F A;  1FFS B;  2H54 B;  3U1L A;  4P2M A;  4A8M P;  7FDR A;  5EHH A;  2FY8 A;  2V2Z A;  1S6Q B;  4ED6 A;  3EPG A;  3OTB A;  4CNY A;  5AXK A;  3NG8 A;  4DHV A;  4O3Q A;  5FD1 A;  4DPO A;  3CSK A;  4EUV A;  1XMB A;  4DOZ A;  2F8M A;  5ADZ A;  4PWD B;  4Z2X A;  3O1L A;  4Q0B B;  1QSY A;  2N82 B;  2K7J A;  3A8E A;  3I32 A;  4CTA A;  2QA1 A;  4FYY B;  2O1P A;  4P7V A;  5LSL A;  2XYH B;  4DSL A;  1YVF A;  2IMO A;  3BH6 B;  1UFK A;  4USH A;  2ZC3 A;  4NEY A;  4J37 A;  3DCA A;  2L08 A;  3D3B J;  4RNM A;  2HGM A;  1Y0H A;  3IFE A;  2K3I A;  4ZIV A;  5B0G A;  3ZZ0 A;  2G4B A;  1JKH B;  4A47 A;  1WF0 A;  3KFW X;  3M32 B;  3QWP A;  2KJW A;  1CLF A;  1TKX B;  1GT8 A;  5H9E K;  2H48 B;  1FKO A;  1VIX A;  2HFZ A;  3EX7 B;  5L1I A;  3ITH A;  2GGP A;  5FLX Y;  1IWG A;  2UUT A;  1P6T A;  2B4P A;  3MM6 A;  3QZ7 A;  4ZKA A;  1T3O A;  4RPF A;  2VBX A;  1IBC B;  5KT5 A;  4IRD A;  1R8P A;  3KG0 A;  2OO4 A;  4X84 A;  1NSQ A;  1HNW F;  1JLC A;  3JAM U;  3EZO A;  1J2V A;  4USW A;  1UKU A;  3BM7 A;  1R0C B;  4OJ3 A;  3BDE A;  3C66 A;  4UST A;  4DPX A;  4J9L A;  2GX8 A;  1Y7P A;  2ALY B;  1R43 A;  2CPI A;  1HD1 A;  2CQP A;  3R1H A;  2UUB J;  3M8Q B;  4DR1 F;  2HHP A;  4JBC A;  2ZZN A;  3O8W A;  2XZD B;  3TYT A;  4WYL A;  1SH3 A;  2CNN B;  3HO1 A;  1NPP A;  2R7X A;  3SI8 A;  2A18 A;  2GQQ A;  4UTG A; 
#chains in the Genus database with same CATH homology
 4NXN J;  3R2D J;  1IBM J;  1N32 J;  2KVQ E;  4B3S J;  2UXB J;  4JI8 J;  3D3C J;  1IBK J;  3T1Y J;  4LFB J;  2UU9 J;  4X64 J;  4KY3 A;  4DV6 J;  4LF5 J;  5IWA J;  2MQ8 A;  3IMQ J;  2VQF J;  5BR8 J;  1HNZ J;  2UXC J;  1HR0 J;  3J80 U;  2MTL A;  4LF7 J;  4JI2 J;  5LMU J;  1HNW J;  5A2Q U;  4LF6 J;  4DV1 J;  4K0K J;  4JI3 J;  4DV0 J;  4JI4 J;  3J81 U;  4KHP J;  1J5E J;  4V1A k;  4LF9 J;  4GKJ J;  2ZM6 J;  1N33 J;  4DR3 J;  4LFA J;  4JI6 J;  4YHH J;  2UUC J;  4DR6 J;  4DV3 J;  3JAM U;  4JYA J;  4DV4 J;  4DR5 J;  4X66 J;  1XNQ J;  1N36 J;  5FLX U;  1I94 J;  1FJG J;  5LMN J;  4PWW A;  3J7A N;  4AQY J;  4DV5 J;  2F4V J;  4B3T J;  5AJ3 J;  5LM7 E;  2MEW A;  1HNX J;  4HHU A;  4OX9 J;  4B3R J;  4GKK J;  4JI1 J;  3T1H J;  4JI0 J;  4LF4 J;  2KL8 A;  4B3M J;  2HHH J;  4NEY A;  3OTO J;  1XMO J;  3D3B J;  4RJV A;  4YY3 J;  2UUA J;  2UUB J;  4DUZ J;  4JI7 J;  3R2C J;  4DV7 J;  1XMQ J;  2UXD J;  4JV5 J;  4NEZ A;  4X65 J;  4DR4 J;  5IT9 U;  3W1Y C;  1N34 J;  4LF8 J;  4JI5 J;  4NXM J;  4DUY J;  4DV2 J;  4KYZ A;  4DR1 J;  4DR7 J;  2E5L J;  2VQE J;  4DR2 J;  1IBL J;  4X62 J;  1XNR J;  4LFC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...