1XNRJ

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1xnrJ00
3D3CJ 1XNQJ 4NXMJ 3J80U 4DV0J 4DV3J 4DV1J 4DR4J 1XMOJ 4LF6J 5AJ3J 5FLXU 4B3TJ 4DR2J 4HHUA 4LF4J 2MTLA 1HR0J 5IWAJ 4JI8J 3J7AN 2KL8A 4DUZJ 1FJGJ 4DV7J 4DR3J 2MEWA 4RJVA 4DV2J 1I94J 4B3RJ 4LF5J 3W1YC 4KYZA 4DUYJ 4K0KJ 4JV5J 4OX9J 4X64J 3D3BJ 2UXCJ 4YY3J 2UXDJ 4X62J 4DR5J 3OTOJ 4DV4J 2UXBJ 4JI7J 4DV5J 4LFCJ 1IBKJ 4LF9J 2F4VJ 4DR6J 4NXNJ 4KY3A 1XNRJ 4DR1J 1N36J 1HNZJ 4LFBJ 2UUAJ 1HNXJ 1IBLJ 4AQYJ 4LFAJ 4X66J 4JI2J 3T1YJ 4NEZA 4JYAJ 1J5EJ 4YHHJ 2VQEJ 4GKKJ 5LM7E 5LMNJ 4B3SJ 3R2DJ 5IT9U 2UU9J 4LF8J 2KVQE 1IBMJ 2ZM6J 3IMQJ 4DV6J 1XMQJ 4JI3J 4KHPJ 4JI6J 3J81U 4JI1J 2E5LJ 4NEYA 3T1HJ 1N33J 4V1Ak 1N34J 4JI5J 4JI4J 4JI0J 1N32J 4X65J 3JAMU 2MQ8A 4PWWA 5BR8J 2VQFJ 5LMUJ 4DR7J 2UUCJ 1HNWJ 4LF7J 4B3MJ 2UUBJ 2HHHJ 5A2QU 3R2CJ 4GKJJ
chains in the Genus database with same CATH superfamily
3JQMA 4ALZA 1S77D 4F0HA 1LWEB 5ADZA 4B02A 4NXMJ 3A3OB 3D1HA 2VFRA 3DYAA 2X7IA 2B56A 2YX1A 4DU8A 5B0BA 4QYZK 2W2NP 1JXLA 3QAUA 1ELOA 3QGHA 1RWVB 3KMSA 2XY7A 4DQPA 2D41A 4RNFA 4W98A 3TARA 3WDOA 1RT2A 4PEOA 2FB0A 4NLWA 4U6PA 1XMOJ 5CD4H 4DSKA 2XB2D 1EHWA 2BJ3A 3Q86A 3U7JA 5DG7A 3LP0A 4FYYB 1KDNA 1NB2A 3GIMA 3A8EA 3UWTA 1TUGB 4ECZA 1QLNA 1MLAA 3CCRS 2MKKA 4B3TF 1X31C 1FTRA 3GJRB 3MURP 2BACA 2YWKA 3TA2A 3D6FB 2AD9A 3HMJG 1WTBA 2EK6A 2VDHA 1OPZA 3MUTP 2BW2A 4NPOA 1RBLA 2MGZA 4JI5F 3EVWA 4ZPWR 3O44A 5L38A 2CADA 1QDUB 2H5IB 2QLFB 4MMOA 1BMQB 1U02A 2CDQA 2DGOA 2WSEC 2G0CA 1YK9A 1XK8A 4ZP6A 4JI6F 2R4FA 2W9BB 3EX7B 1I6JA 4LFBF 4ES2A 5CYJA 3QO9A 3W5XA 4C4WA 5HBMA 1S97A 2JVRA 3MMCA 2W2MP 2R7SA 4URGA 4OJ1A 3IN5A 1JMTA 3OFFA 4CH0S 2CQBA 2Q3PA 4ID5B 2RSQA 4CLPA 1NKEA 4DL0C 1UWBB 3W60A 2OFHX 2ACMA 4KH0B 2MQOA 1LOUA 4CLSA 1BQNA 2V2QA 3OVAA 1VBZA 4PQUB 1KP6A 2PMHA 3P8BB 1C0TB 3QT5A 3C46A 1EQMA 2HFOA 1UFLA 1P1TA 3BGRB 3MDFA 2XSJA 5KTQA 1F5BA 1QTMA 2DNRA 1HNXF 4EEYA 5ETOA 4JV5F 3N01A 4GVBB 1VOMA 3EWGA 3KWMA 4ICLA 2M0GB 1NZAA 4O3NA 3UN3A 4KGKA 4M1KA 4P2FA 3HO1A 2QZ8A 1TFYA 3NKYA 3AD8C 2QT7A 3NOGA 5KT4A 5J2MA 3ETOA 3ET6A 4I2PA 2Z2YB 3P96A 2IAJA 5HLFB 2NXNA 3CD6S 3HVTA 3HPOA 4DSLA 2FC9A 1AW0A 5LM7E 4A8MP 4CCHA 1O5JA 2J8AA 3JYTB 1HYSA 3PJXA 4OJHA 3KHLA 2KVQE 4IDKB 1Y4ZB 1FRMA 4RNOA 4JB8B 2GMLA 2UVVA 4EBDA 3CXCR 3H42A 4HI1A 5DDQC 6FDRA 3RTVA 4ID8A 1TUVA 3WX8A 1YJVA 1U1RA 1IKYB 1EETB 4C7QA 4ZLLA 5DDRC 3MCNA 4K50A 1C1CB 3KK1A 4ZLJA 4TXSA 3M30A 3ZTOA 1Z4UA 3IG1B 3PRDA 5ETMA 5KFXA 1RI7A 5HAOA 3TJAA 2VDIA 3JAMU 3I5CA 2R7RA 2DIVA 4DOZA 4RUCA 1RP5A 2DHHA 2FHOB 2L9NA 3TX8A 2KHCA 3FC9A 3MR6A 1VYAA 2W2OP 3DU6A 3GFYA 4NI2B 3BGLA 2XQCA 2ZH6A 3OW2R 2LFVA 3DRRB 3NNAA 1TZ0A 4DU7A 6AT1B 1S0NA 1FKPB 3VWSA 1VBYA 1RGVA 1SIZA 3AB4B 2EI5A 2I2YA 2MSSA 4NRTA 2RHSB 1SQFA 4OZ0A 1UW4A 1OQ6A 4FNIA 3KLEB 5IOLA 1X4GA 2IJNA 2OD4A 2XMMA 1BWEA 2GVDB 4IO9Q 1TL3B 3R2CJ 1YRTA 1HQUB 1RB0A 2ZITA 3ISND 4NYZA 1U1KA 2QLBB 1C0UB 2RRNA 2ZDPA 4OV1A 4ZVPB 5CCMA 1XNRF 1Y5IB 3IAM9 1FXRA 3CMQA 4Z2XA 5MAOA 3J80U 3V6DB 3UDVA 1YI2S 4KHMA 4PG5A 4N8NA 1HBMA 1VGYA 2CJYB 4A8OA 4DV7F 3PYGA 3UDLA 2OO4A 1K0VA 2CUYA 2N4DA 2XO6A 2C3MA 2B51A 3GP9A 1YSJA 2YX7A 3AXMA 1P9QC 1BQMB 2C3UA 2HAFA 3M8PB 3TUJC 3B54A 4A8KA 1HR0J 3BQ2A 1WDDA 4DSIA 3O6QA 1X9SA 4ES1A 1R3NA 4EGLA 5IT9Y 2QA4G 1NJIT 2YH0A 2O5DA 1KLMB 2RU9A 2NXJA 3EZUA 2GGPA 3NS7B 4IQMA 2G4BA 3CDBA 3GFHA 2VBXA 4IOAQ 4CP5A 1GMWD 2DNQA 2H4WB 3H20A 2UV8G 2LU1A 3OXFA 5G0RA 5D0GA 4DUYJ 1TR0A 3PX0A 4USHA 2FHJD 3AJDA 1DY3A 1XIQA 5HROA 4C8YA 2IMOA 2EPIA 1TL5A 5KT6A 3BQ1A 5L9XA 3MM6A 4O44A 1D8YA 4B3MF 1UMJA 2NLWA 5D0HA 1NO8A 4HTIA 4YY3J 2X51A 3DI6A 2FD2A 1UEVA 3Q83A 4H4KA 2X1GA 3AXKA 4PYAA 4ZCMA 2KFNA 3LP1A 2VASA 1YRXA 3G96A 3UD4P 3MUVP 5HP1B 2WB1D 3RR7A 1NKCA 1IBKJ 4N7TA 1U0HB 1PAEX 4HDGA 3BO3A 1X9MA 3MWBA 4RPFA 5C2GA 3CPWR 3EXCX 1F0XA 3C14B 3LWMA 2KZMA 1W2IA 2B4VA 2ROGA 1C1BA 4NLQA 4AQYF 5FLXY 1YGYA 2BM0A 3BJYA 3MCOA 3KLGB 5D4LA 1ULRA 2KRBA 2ZFHA 2CJKA 5DO2A 2L41A 1QSLA 3BGUA 3GWCA 3RB6A 4PCQA 2F63A 3DYAB 3OXGA 4PUOA 2WBMA 2V8HA 4E0DA 2ZUGA 3NGDA 2R7XA 4OI2A 4JYAJ 2Z58B 3R7NB 1OSDA 2MY8A 3ILOA 5EUHA 4K5SA 4ZVHA 3OSPA 3HT0A 2HIYA 1NZ8A 2ROPA 1YBUA 2WBRA 2DNLA 4H4OA 1F2GA 2WSFC 4YUDA 2OELA 1U47A 1H74A 4YY3F 1U8WA 3M6VA 4OMFG 1YJRA 2GHVC 5CA5A 2JZ5A 4CLUA 3I82A 4KH1B 4KHPJ 3V81A 2COLA 2LVWA 4YR0A 2DPIA 5A6PA 2QMXA 1RWOB 2F40A 2RF2B 3H7HB 2NPIA 1PYSB 5ETPA 2ZBIA 3QT7A 5HQMA 1N33J 3RRHA 3LQVA 3RB0A 1FJ7A 1RBAA 3LOUA 5L39A 3PFEA 2NR0A 3PR4A 2Y1IA 2HQDA 4QYRA 1U6FA 1YDLA 2BVZA 3MCSA 2PMZD 1CJUB 3Q8SB 3B6BA 4M95A 3QSYB 2QGFB 1HNWJ 3UVJA 2JRSA 1WD6A 3UVJB 4IFYB 3WC2A 1NK4A 1D0EA 4MKYA 3D28A 1CSJA 2DXFA 4WU2A 2HHHJ 2ZH9A 3MOJB 2D7SA 1WOSA 3H5UA 3ILJA 4X4SA 1R8CA 5A2QU 1HHQA 2DNHA 2DNNA 2MQMA 1S4FA 1HMVA 3LGMA 1L3VA 3AOCA 3PKYA 4UY85 1DURA 1MROA 4X4PA 1U2RA 4G1IA 3MECA 3T5HA 1WDTA 1XERA 4CH7A 4CNZA 4DF8A 1YJNS 2JVOA 4GKJJ 2HNDB 4DR7F 5AE2A 2VC1A 1FE0A 1UP1A 2F9JA 5KG1A 2Z0GA 4CLWA 2WZ1A 3ILLA 5GAHI 5DM6Q 4NLGA 2G9OA 1PJ6A 4DL6A 2NYHA 2NXUA 4GVLA 2HFZA 4FPRA 3UCZP 2KFZA 3K8VA 1KKHA 1SVDA 2W01A 4RUAA 5I42A 4LFCF 3L3CA 3QRRA 4LMZA 4XPEA 1S1TA 1X7VA 5A8WB 2DRDA 4X4NA 2A6MA 1U6ZA 3BDEA 3KLHB 1HL6A 3U1NA 1WKKA 2DTJA 2RILA 3HT3A 3Q89A 1VQOS 2VPXB 1CC8A 4M5DA 3S8SA 2VC0A 2ROEA 4FPIA 1KVIA 3TUIC 1ZTWA 1N54B 3BEGB 3HZEA 3GV7B 3K7RA 3NGUA 3HFKA 5FD1A 1HHSA 2EFPA 4IG3A 2R7TA 3GB0A 4NLSA 2AEFA 2I9SA 3GJQB 4LREA 4PXEA 3AQPA 1M5SA 3TUPA 5BJRA 4FKXA 2P2CB 3LH2S 4MK7A 2HNZB 3D3BJ 2CQ3A 3CMAS 3MMBB 4FN5A 3FCHA 1HBNA 1B3TA 1PC4A 4P75A 3BSOA 1W25A 2N7CA 4USJC 4DFKA 3DLGB 1NU4A 1FRLA 3DRXA 3B82A 4OYPA 5AE3A 1VBXA 4ELTA 4NLRA 3QJPA 2HQCA 1Z2ZA 2HVZA 2MKJA 3A1YG 3FNNA 1ZYQA 3A8IA 1FWPA 2ATLA 4FYDA 2EFNA 2HZVA 4USTA 4TY8A 2IM0A 3H2VE 2HS3A 2FZKB 1RTJA 1GK8A 2CPZA 1Q1KA 2DK2A 4RR5A 3HF5A 2ZJPQ 3DDNA 4ZN3A 4JP8A 4IFVA 3PR5B 2RQ4A 4WBFA 2QFIA 4UOHA 4DMZA 2JSXA 3EUNA 4DBQA 3T1HF 5KFNA 3I55S 2BKPA 4ZJOA 2V2VA 2V8PA 1OPIA 3TVZA 1HPZB 1FRJA 3DHXA 3LP1B 1RTHA 5LXYA 1RYRA 2LA4A 4YHHJ 2BM1A 1UVMA 3CCVS 4M63A 2GX8A 1Y9OA 3FDSA 2VQEJ 1APSA 1U45A 2HNZA 1GX5A 5E0OA 2AKWB 2BE2A 5CH7B 2EKYA 2G2YA 5HI7A 5EX3A 1WF0A 1J5EF 1RAGB 3TVYA 4I64A 4K4VA 1OJ4A 1WEYA 1BGXT 2I0XA 1JK9B 2P8IA 3G8QA 5AXNA 4U7CA 2JLFA 1GQEA 2NUUG 5A0YA 1WTFA 1VRUB 1Z1ZA 2Q6BA 3KYLA 4K4SA 1UZDA 4ZKAA 1RAEB 3C6TB 3CSKA 1ICEB 1FT8A 2CQHA 5J2MB 4ECRA 2J5AA 1N34J 5KFTA 2HHUA 3PO5A 1U1OA 3THVA 3LA0A 2YKQA 4EYIB 2FJVA 2B4OA 2IM3A 3A3NB 4J5OA 4ECYA 1TL7B 2AGQA 4I7FB 3QQCD 2ZZNA 3GR1A 1TKTA 2VH7A 2UZAA 5ETNA 1ZETA 2F5GA 1MWQA 1RTZA 1H6KX 2MKCA 3GSDA 2WW4A 2A18A 3D6MB 3TNVA 4X4TA 4A8FA 1RADB 2BA9A 2HNYB 2D9PA 3M8SA 5GAGU 4ZN1A 2MMYA 2VUGA 1FFSB 5D78A 4ZHRB 5IC6B 2OIHA 2GJ2A 1XMBA 2YKMA 2BJ1A 3M8YA 2XYGB 2B6AB 2DGUA 3UN2A 1XNQJ 2JLEA 1CG2A 2CAJA 2K3IA 3CJKB 4XIUA 1AYEA 2X3DA 4P73A 3KJVA 4MK8A 3MEDB 1VISA 5B0EA 2ZBRA 3C16A 4ATNA 5KFFA 3MR3A 1OY8A 4ER8A 3LALA 4FKYA 3E8OA 2MZRA 2JEGA 3NAIA 1BE4A 1QAXA 4P74A 3X3UA 4F2SA 3KLIA 4L74A 1RU2A 2CNNB 4OYIA 5DJBA 5AJ3J 2Q43A 2RE1A 1B0PA 3PXGa 1CULB 2PT0A 4J9LA 3HHDA 2Z30B 2G1HA 3IM8A 2A6OA 2DHGA 3C6UA 2LA6A 3DLEB 1E6VB 3U1MA 3ZZOA 5IWAJ 4CDIA 2NYIA 3CDWA 4QIEA 4EU0A 4U67Q 2R2RA 4RLEA 3BPSP 2AF6A 1NJXA 1IVZA 3MF5A 1C1CA 4L72B 3RYLA 2VIHA 1RHRB 1QD1A 3GG0A 4Y2CA 3LP0B 3T3FA 1S72S 3RRKA 3FJ2A 2EBEA 1OYEA 2CXEA 2XSJB 3NGKA 4DCJB 1Y5LB 3QFWA 1RWUA 2J0SD 3DCAA 3MXHP 3J7YI 2IDEA 3W1YC 1U2FA 2VF3A 2X1BA 4MFBB 4JI1F 4ZVGA 2Q1LA 4GKJF 5AE1A 4QR1A 4OX9J 2B5JA 4HACA 4KQZA 1WF1A 1VQNS 2UXDJ 2JLGA 3K57A 2VG5A 1FKOA 2EFOA 3K5MA 2VFVA 2VG5B 4HVZA 3R8YA 2QLXA 1YJ7A 2FDNA 5B0GA 2KTQA 5A8RA 4LFCJ 3I6PA 4WTYA 3KXDA 1FVSA 3W63A 5LSOA 3KLEA 4PUOB 4NLXA 4OHVA 4WE1A 1X4FA 5ETTA 2WOMB 5M2RA 2IHR1 4ETXA 3QRPA 3SV4A 1NK0A 1EB0A 4C0OC 3PX6A 3GV8B 1FE4A 2YWHA 2VOPA 3LPEA 1DQ8A 3BGRA 5MLCV 3H4BA 1FTCA 3UD3P 4K0KF 1BQNB 2L48A 2XZTB 3UR3C 2YBVA 1T02A 3IRWP 4MAKA 1U0HA 2DHAA 4X66J 5J1EA 3KK1B 1S1VB 4I4BA 1TKDA 1D1UA 2HHHF 2XMKA 3M2RA 4DV6F 4KT0C 2IMWP 4DR6F 3PVXA 2YQ0A 4UOGA 4DX8H 2ZE2A 1R0AB 1OWXA 4HACB 3QMQA 2E9RX 4GO7X 4C8KA 3HSGA 4MIWA 4BS2A 1FRHA 3GE9A 1VJQA 5F8IA 2MQPA 4ED6A 2QMWA 4NLDA 4OYBA 2MDAA 1XMQJ 1QSYA 3QT6A 3QRQA 2ZH2A 1WG4A 1CJVA 2I1RA 2VA3A 3MHYA 4ZVUB 3HVTB 3CB4A 2IRYA 4IFYA 3VGVA 4DEZA 2DHXA 2Z57B 3GCWP 2C2OB 1H73A 2B9EA 9ATCB 1N5YB 1QVFR 1NBEB 1H0HB 1P6TA 4V1Ak 2DNKA 4YN3B 4AE5A 3VZIA 2XC9A 2ZH3A 2RDIA 4CZCA 1WHXA 4R8UA 4NCGA 2PD1A 4R8UB 1RXOB 2WONA 2MLXA 3M30B 4FS1A 4RW6A 2E1PA 5CYMB 4LSNA 1T05A 1VQ6S 2B7BB 4JI8F 4Y34A 3MM5A 3IRXB 3OD2A 4ZVFA 2J7UA 3V81B 2ZZTA 5E7OB 1U48A 4QIVA 3F44A 2ERRA 3D0HE 3EGZA 1LW0A 1CJKA 4PPZA 4EO8A 5D3GB 2XYHB 1KFDA 2CQPA 2F4FA 1NDPA 1D9DA 3H5XA 1YBTA 1U7LA 2C2DA 1FRIA 2NSBA 3C6TA 2FJXA 2PO4A 2ZD1B 5IM0B 5HLFA 1YJUA 4WKRA 1OO0B 1NSQA 3MD3A 4I2PB 3MAHA 3D9BA 1F6TA 3QO9B 2Z56B 2YWEA 2P5VA 3CIZA 1VBKA 3KLFA 2OSQA 1S79A 2KO1A 5KOWA 2M2BA 3WBZA 3MAAB 2IC3A 4H4MB 1VRTB 5KAKA 2R2TA 5ETKA 5DLFA 1DAXA 1SB6A 3MD1A 4C11A 5IFMA 3PEHA 1URRA 1G7CB 1RWXB 2OSRA 4QZVB 4Z37A 3JSRA 2ZJQQ 1HD0A 3Q0AA 5M2PA 4LF4J 3US5A 4Y0FA 2UXCF 2ZBCA 2C28A 2DT9A 3VALA 2U1AA 3G86A 5L1IA 4LF7F 4B3SF 1YLXA 2IDLA 2PEHA 5HP1A 4LF5F 3JQKA 1N6QA 2XMJA 3BKTA 3DM2A 4DV7J 4RNMA 2CPYA 2G13A 4B9NA 5LJ5Y 2WAQD 4KKOA 3CGIA 3NMRA 3DOLA 1C2PA 1X8DA 2W7AA 3GFZA 4IRKA 1BC6A 3VGTA 4CH1A 2A2CA 4X4RA 4QCLA 1K1QA 4P2MA 3FZ2A 5FJ4A 2HHVA 4X84A 1FNOA 2Z2ZA 3NL0A 4Q7AA 4DI6A 1PAUB 4DFPA 5C24B 2W9CA 1N56A 2JX2A 3AJ2A 3MPYA 5KFRA 1Y5NB 3OTOJ 4DQSA 1N5VA 5F3TA 2IRXA 3LAKA 3IGVA 2UXBJ 3ENQA 4OYOA 3FEYB 4O0IA 4DV1F 1TL4A 1X60A 1HWUA 2MQLA 4ED7A 4Q8EA 2VBZA 3KDOA 2QO3A 4ZK7M 1VQPS 3IFEA 4JYAF 2DO0A 2JL9A 2RIJA 3OV7A 4XPCA 2J8SA 5L9NA 2L3MA 2GV1A 4DLEA 1FRXA 1FX2A 4DPWA 1FCAA 3JQJA 3Q8RB 1XWLA 2VJVA 1OY9A 2LLZA 5F8LA 2XS7A 5I3PA 3UNGC 1SXLA 2CIMA 2CG8A 2JNJA 2DPJA 4P10A 3DXBA 1RE1B 3UN5A 3DLGA 1K1SA 4WU3A 4NEZA 1VHFA 1X5PA 3T1AA 4C98A 3I0SA 3QGPA 1MMDA 3AQOA 1AXQA 2GVDA 3W3SA 2ZKUA 3PCOB 4FVMA 2W9BA 5LMNJ 4XDCA 1X4DA 4ANCA 4OL8A 1RSCA 4Q45A 4ZCKA 1XQIA 5LMNF 3M8QA 3KHGA 4ZVQB 3FCVA 1S6UA 2DEJA 2HKEA 3CT9A 4E2FB 4CLKA 4FXWA 4DUYF 2J6SA 4MKVA 5HJYA 2B9XA 2YWGA 2X1FA 4HEA9 1SH0A 5CYMA 2VFTA 4ECTA 1KOHA 1VK8A 2DH9A 1XTZA 4ZS6A 4TU8A 1B70B 1J27A 1U1MA 2PA3A 1DFDA 2XWYA 2VONA 1O6XA 2BRLA 4TNOA 4NWBA 3HP6A 1G3OA 3JSMB 2K3KA 1WEZA 2VPYB 2ATCB 2RH3A 3VGSA 3I4HX 2OGUA 4MJKA 2F4VF 4CQ1A 1RLCL 2AW0A 2FVQA 4HT5A 5IV4A 2H65B 1TAUA 4YP3A 4KFBA 4EYHB 2XZDB 1TQLA 3SSQA 1RKJA 1F3VA 4DLGA 2YXLA 3I32A 3IBCB 3D5MA 2ZC3A 1NRKA 5F3ZA 2XLKA 1S6QB 3UDCA 4DX7A 5D4OA 3L9ZA 3P5BP 1JXEA 3MEGB 2ASLA 1JLAB 1NPRA 2ZH8A 3D3CJ 1RWNB 4DQIA 1FI4A 2YTCA 1GMUA 1SQEA 5DS7A 1ZAWA 5F41A 4OIXA 4P9SA 1GMVA 1X4EA 2VBYA 3VTIA 3D0IE 1HNVB 4USKA 2XBPA 3A8JA 3BPDA 2DB1A 2E1MC 4PAAA 3MM8B 4P7VA 3RGIA 3W2WB 4L76A 1IKXB 2C2KB 1CBKA 4V19J 4ZA1A 4Y65A 2DVIA 4HHUA 4CI0B 3SXLA 3WHIA 4J9OA 1HQ2A 4I2QA 2C3OA 3GIIA 4P7TA 3DLKA 1S4EA 3CIMA 3KTQA 4X2BA 1U1QA 4JI8J 5H9FK 4F04B 5HQLA 2B9YA 3M2UB 2M7SA 9RUBA 5A8RB 1T8EA 1FD2A 4ZMMA 1RHJB 2KJVA 5A8WA 1I94F 2DJWA 2V0NA 3KK3B 4DWIA 4NLYA 5HBMB 2XM3A 3H8YA 2YNGB 4I0WA 2ALZA 2BR0A 2X3GA 4BHQA 8AT1B 5LXRA 5KFIA 1U25A 3O8WA 3VQSA 2AT1B 4F0KA 1RAIB 2PDAA 2XGQA 4JV2A 2XEXA 4XDDA 2GO8A 2O1PA 4H4OB 4O3PA 1EP4B 4IG0B 4LIWA 5U47A 4OZNA 1Q82T 1QAJA 3QBCA 4LVNP 3NS5A 3QIPB 2SXLA 2JFKA 3W7BA 1MW7A 1VDHA 2DGTA 3MECB 4A8SA 3KDNA 3MM7A 1DTTA 2FLOA 3WX4A 2XI3A 4B9LA 2DIUA 2HLTA 4KO0B 4LF9J 1UJ5A 3JTOA 2HGNA 5IQQA 2G0IA 2V8DA 4ZJLA 3CJTA 3MFHA 3VAHA 2E1AA 4DQQA 5M2UA 1HWLA 2FLPA 2MJNA 4NX9A 4S0MA 3F41A 1HFEL 5BR8F 2HBZB 2HVHA 2GGPB 4OX8A 4F3OA 3QGIA 1RAOA 3JSMA 4AL6A 2E29A 8ATCB 4DSFA 4DF4A 1N36J 1SCJB 1T3OA 3UFCX 1HNXJ 5CXTA 4U7UD 2MYFA 2N4CA 1VI7A 1UFWA 3SCJE 2P6TA 4KBIA 1AUDA 4HYKA 4WIIA 2LEAA 3L95X 1IBMF 4YQWA 1T0TV 4OJ3A 1MU2B 4A8WA 1VQYA 3MEGA 3PTWA 4OI3A 4C11B 1MROB 3KUGA 2BJ8A 2CNLB 3MM6B 4JBCA 3M8QB 4O44B 1O8BA 3N9UC 2NXEA 3T6JA 1QM9A 5L46A 5LMUF 4DUZF 2DGXA 4TVAB 4G6VB 5KT5A 3P49B 1H7WA 1UJ6A 4UQTA 4A8QA 3PKMA 1B4SA 1FWKA 1QUVA 4JI6J 5KFGA 3JSYA 3N6NA 3ZZYA 3DLJA 2WRMA 2GA7A 3D4JA 3GYXB 4C8ZA 4ZOSA 1PYTA 5H1SV 1HBUB 2PFDA 4AL5A 4EMDA 1Y3KA 4QPTA 4DV3F 2ZNZA 2HFUA 1VMBA 5B0DA 2F8EX 3B8HA 3UD5A 3PV8A 2XG8A 1X0FA 4ED0A 2LQ9A 1Y10A 2OHDA 4OZ3A 5KFSA 4P71A 4KFBB 2VQFJ 3VAFA 5LMUJ 4X4UA 1FXDA 1YZ6A 3NRBA 4RWWA 3V4MA 3G8TA 4DQRA 2D3OR 3G71S 3W5YA 4WZMA 3R1HA 2B7CB 4N41A 2ZHOA 5HSPA 1LW2B 4NYPA 4YR3A 2EKNA 5A2QY 3CCUS 3V6DA 2M3DA 1IXKA 1RKIA 5KFJA 4M5GA 1DLOA 4KIAA 4Y2KA 4KC5A 3FMBA 2QLWA 1MU2A 3CCTA 3OT9A 1ACMB 4NA3A 3R7SB 3ZNUA 1RTHB 3C15B 2BANB 3LP2A 2NUHA 3N4WA 4LR7A 5AT1B 5IT4A 4DFMA 1FJCA 3OR1B 5I3QA 3PHTA 4X4OA 1S6OA 2XHCA 3IWNC 2GJFA 2XMWA 3BQ0A 2V2ZA 1N5QA 2MLYA 2V4JA 1LWFB 3DOLB 3SCLE 2ZVIA 2ZE2B 3ZNJ1 2W4DA 4M8LA 4CO4A 3KLGA 1R0AA 1T11A 5LJ3Y 2MQNA 2OAUA 1KEKA 1JJ4A 3TW0A 4WFBQ 3ZFVA 1KLMA 4TY8B 1JNZB 1RAFB 1XMQF 1KQSR 2I8EA 2XY5A 5E33A 5B09A 5F0UA 2RQMA 3DRSB 3FZBA 3T19A 2P6SA 2ZH1A 1R8PA 2E7WA 1RT4A 3PX4A 2R7WA 4J9UE 4F3MA 1UTAA 2Y0SD 1VQ9S 2AJ1A 2DKOB 4P2XA 3R5AA 2W8LA 4F50A 1HHTP 1I94J 4FF4A 1EP4A 2ZOGA 4IG0A 1VC6A 3C3LA 1LXJA 1X4BA 4UZBA 1S9GB 4RW7B 5GMDA 1NMEB 2ASYA 2J0WA 1S0OA 4LF2A 5KFQA 1R31A 3LGHA 2GVZB 2LEPA 4RUBA 4DS5A 5J2PA 1WOPA 2MY7A 4F7VA 1RDRA 2CQDA 5J2PB 2P9EA 4F67A 4UOFA 2HEKA 3R1LA 1FA0A 2BOAA 3FQLA 3ZTRA 4DV4J 1N6QB 2FHMA 4FZVA 4FF1A 5J1NA 2J9DA 3M2UA 3DGPB 1LFWA 3P4UB 5CYQA 4YHHF 3IO1A 3NS6A 3UQSA 1SC3B 1LK7A 4PG7A 4WFZA 1K8AT 1EQ0A 2PN6A 1WC1A 3LO3A 3MPUB 4U8VA 5D15A 3VGUA 3SQGB 3FBCA 4MH8A 2F3JA 4QW8A 3QJLA 3ENAA 2BYCA 3MZIA 5DDOC 2UXDF 1RWMB 2F8MA 4E8UA 3L7OA 3Q22A 3J80Y 2HMIA 2E5IA 3EPGA 1RTIB 1UZHA 4RW8A 1JLQB 2GC8A 2WONB 3TAMB 3NNHA 2CA9A 1RA7A 1OS5A 5EDWA 1FEEA 2VHGA 3T1YJ 1VQKS 4LFBJ 2AHOB 2EXUA 3FSYA 3GYNA 4ZP9A 1L5UA 2XS5A 5KFZA 3GG1A 1N0VC 4R25A 3HFZB 2R9LA 3V4IA 2M52A 2C22A 4DS4A 2WVBA 3HVRA 1XJWB 1KQKA 1HNWF 1Q95G 1LWFA 1TKXB 1TV6B 4ZP7A 2XI2A 5IT9U 2KZZA 1H2VZ 2HBRB 3M1VA 3OTCA 2AIRB 4AXIA 4ILRA 5HO4A 3KJVB 2W8KA 1SL1A 3UDEA 1SJ1A 2GO9A 3CJ8A 2HVDA 2DNMA 4A8YA 2H5JB 2B6AA 2IAJB 2DY1A 2CJBA 2LDYA 2GIFA 2QJ3A 2ZD1A 3ET6B 3TOQA 4MK9A 2RDDA 1W7WA 3H5YA 4DSEA 3DRYA 4QWBA 5KG3A 4YOEA 2OFGX 4C0HA 2YQ1A 4IRDA 7FD1A 1AFIA 3M4XA 3HLUA 3ZO7A 1RTIA 3EDQB 4RW8B 3RRGA 1LW2A 1KHVA 1SJ3P 3HK2A 1A6LA 1AROP 1URNA 3QLHB 2KH9A 4FYXB 1SL0A 4HHJA 2AYMA 1MN9A 2OTJS 2CPXA 3OFHA 3CCSS 3N6LA 1GTHA 1BQXA 1HBMB 1IKWA 1DQ9A 1X0PA 1TP7A 3HHLD 1JLCB 2AX1A 4YDDB 1SJ4P 4IR9A 4IUFA 2CWXA 3IBFB 1X9WA 4K2XA 1SJQA 2EVZA 4UZCA 4Y28C 1PGZA 4I6YA 1REVA 2LDIA 3H2LA 2XSFA 1KNZA 1V9OA 5C2CA 3M8RA 1WOOA 2XYPB 2MJUA 5HL7Q 4DCPB 4RZRA 3B4MA 5F8HA 5KT2A 3Q24A 1GH8A 1SH2A 1XR7A 2V9KA 2XLJA 3PY8A 3TAPA 4D3GA 2PGCA 3CCES 2LEBA 2OLWA 3BGFA 2N3LA 4TYBA 3T5KA 2W1BA 3FSIA 2YKOA 2W2QP 1OYDA 1VCTA 2RKIB 5CD4A 4DV1J 1FKPA 4DV3J 4EBEA 4ILLA 3ZZPA 1S7HA 2IIHA 4YB1P 2CQ0A 1GTEA 3CDUA 2VG6B 2HZCA 1RUSA 1NPKA 4AL7A 1S9FA 2DNGA 4K4TA 4X64F 2V34A 3D7SB 4LF1A 4O4GB 5HMZA 5CABA 4WE1B 5D6GA 4NCGB 1BHNA 3J7AN 2KL8A 4Q2MA 5IS2A 4ID5A 1E6VA 4OYWA 5DQIA 3CC4S 3MM9B 3M8WA 5BXIA 4FS2A 1UPPA 2HGLA 4AD6A 2YNIB 1IKYA 2H48B 2Y9HA 4B9TA 4DV0F 2BX6A 1GXLA 1JLFA 3ITHA 5SUHA 5KG4A 4EUVA 5KFCA 1AA1B 1RCOB 4CIOA 1RACB 4TQSA 3Q23A 1K73T 3FFIB 2YNHB 3QYYA 3R5CA 5CAAA 3FFIA 3T5LA 1DZ5A 3D67A 3QAEA 2E44A 2DEIA 1TK0A 1FWLA 4KKOB 4EBCA 2AGOA 4LF4F 2UXCJ 3CCJS 4UY8T 5J2QA 4OZ1A 5H9EK 2ADBA 1DJ0A 4WJBA 1Q8IA 2QX0A 5I4MA 3KLVA 4LF6F 3PG9A 4IOBA 1D8ZA 1FDNA 3QZ7A 3EVMA 3NBPA 5THWA 4DV5J 4NXNF 4WF9Q 3ELHA 2F4VJ 2C2NA 1YWXA 2UUBF 1R43A 2J76E 3GTYX 4OYZA 4O3QA 2HK3A 2HMIB 3BKFA 3P6YC 2DY9A 1XNRJ 1VQ8S 4KTQA 2ZWPA 2EG2A 2FLLA 1NK7A 4RO0A 4C8NA 1IBLF 2R7QA 2KI2A 1RT2B 3IWLA 1F5CA 2DXDA 2KKHA 4PQUA 1FFGB 1S6PA 1ZS6A 4Y3CA 2HGMA 1JB0C 1P1LA 1VHIA 3IXQA 2N82B 1EJ7L 2P9CA 2JEJA 3RR8A 5K20B 4NA1A 1ZZNA 1TKZA 1S0VA 2IBKA 3UCUP 1V3ZA 3ZZUA 1PG5B 2QN6B 4LJMA 2H5EA 5LSLA 2R2UA 2FPHX 3OR2B 1FKOB 2HPUA 5A0YB 1REVB 1N52B 5KG2A 5AXMA 4J9RA 4B3OB 1H7XA 1ZA2B 3FK4A 3O5TB 4E98A 4PZVA 2XY6A 1CJKB 4X62F 3PZPA 5D3GA 1S1WB 3KMQA 1WWHA 4DPTA 3OFGA 4UUXA 4F36A 1L3TA 2QMUB 2VD3A 5T7LB 2M4MA 3TQ1A 2POKA 5K5MA 3L4BC 3SFGA 3BYPA 2DNOA 2QA2A 4OJGA 2QTWA 4WTOB 3J81Y 2DITA 3K89A 2DR8A 3K59A 2CRLA 4ZPAA 3IP0A 2IYIA 3CEDA 4NRUA 2X1AA 4DV2F 1CEZA 1TL7A 5E3AA 3I5AA 4J37A 2XCAA 1Z2LA 2DISA 4LBPA 3C8YA 4QJVA 4CO0A 4KPYA 1RAAB 3BN7A 1HNIB 3A3PB 2CFXA 3DOKB 4HDHA 2L9DA 1RT1A 2BE7D 3V2UC 2KRRA 2W25A 3NCQA 1E6YB 3JXOA 1RHUB 2HYIB 1TVRB 2FZGB 1E6YA 1AZSA 2D9OA 4MYTA 3HX9A 1I51B 2D74B 3SFUA 2LYVA 3BGOP 4F4AA 4X66F 1VQLS 3PRBA 4JV0A 3CJ2A 3M7VA 3C16B 3W9JA 3DGPA 1TTHB 2L9WA 1PBUA 3QFHA 1UCNA 5CYQB 4F0MA 2E7VA 1T94A 1T3NA 3R5BA 1NHVA 2VB6A 3I0SB 2UV8A 3DRPB 3ZZZA 4CLLA 1NLKL 1LWXA 2LU2A 2XZWA 3EPIA 4QWCA 2RD5C 1YZ7A 2H3EB 1VRUA 1KTQA 2YX4A 5F9NA 1V6HA 4TU9A 4F2RA 1M5KC 3CNQP 2XS2A 3P5TL 1GAOA 5IC4B 3EICA 3FEXB 3C2PA 2HIQA 5K8MA 3NGRA 1RWPB 3TAMA 4DV0J 2RRAA 1R8HA 4TN2A 4OYMA 2PMWA 3BR8A 4G65A 2EG1A 4Y2AA 1ZAVA 3CJQA 3H40A 1KR4A 1MN7A 2HS0A 1F3FA 5K9FA 2ALYB 4R0JA 3RAQA 2HRTA 3MGJA 2YVSA 4KPCA 4P52A 1A0OB 1HPZA 1P9YA 5CZXA 2QV6A 2R8JA 1Q8BA 2AYBA 2J0XA 1HWJA 1L3UA 3UR0A 1S48A 1NDKA 1KSPA 1OQ3A 4FNHA 1JLGA 4K4XA 2OPPA 3HDSA 3DLKB 1WHVA 2IM1A 3IAS9 2HHWA 2P9GA 2FY8A 1HBUA 3FRZA 5L8RC 1NSAA 1S1TB 1YVFA 3DOMA 1C1BB 2FYXA 4DV2J 4F4WA 2DR9A 3VAKA 2JH3A 3I87A 3IS9A 2NPFA 4B3RJ 2AJQA 4QWEA 2HQGA 3LANA 1R27B 3ZZRA 3PO4A 3NOCA 2R8GA 3NGTA 3M32B 4IH5A 3QPIA 1FXLA 1RT6A 1RT6B 3CJSA 1UWAA 3RBXA 3TA1A 3GV5B 1KFSA 2BKOA 1VFJA 3D1OA 2NCKL 2PC6A 3RAMA 4MIBA 3R6LB 1I3OB 1EKSA 4NZ6A 1WF2A 5H9EJ 1TK8A 1Q5VA 2DXEA 3EM1A 4K5RA 2KDOA 1PKUA 4OQJA 1RHKB 4NXNJ 5DM7Q 2ABYA 1UW9A 1JLFB 3ITHB 5JJBA 2VOOA 3HHKA 2JOQA 1HQEA 1QAYA 4MYUA 3ZZTA 5HMXA 2CPDA 5RUBA 2QEXS 3ISZA 3FCWA 3KG1A 1QUPA 2OEJA 2OPSB 2NQPA 4U7UK 2RDJA 3RUBL 1NB7A 4WKYA 3VZHA 5HJXA 1FJEB 2CZ4A 2LMIA 3Q8QB 2LQ5A 5KFDA 1SKSA 3HFVA 1QJHA 4C9DA 3U1LA 3PW7A 4ELVA 2WB4A 1IKVA 3GLJA 4MIAA 4LQ9A 4WP3A 2AJ2A 1FJGF 2UUCF 4DL7A 4GKKJ 5C42B 4YFUA 3AJ1A 3RJMB 4B3SJ 2R7VA 2W7OA 2HQ3A 2N7YA 4XAKA 5DGAA 4BDPA 1HW8A 3MTKA 1UVLA 3G6XA 2CVEA 1UJ4A 2MSTA 3EGNA 4IG3B 4C3MA 3V6KA 4DL3A 2XNRA 2ZZMA 3NWRA 1X5SA 4NCAA 1WJ9A 2YKNB 1VC5A 1G4CA 1HI8A 3QGGA 2LQBA 4LQ3A 2ACYA 7FDRA 5J2NB 3HD2A 5KG6A 4QIGA 5IXUA 4X65J 4DL5A 4X4VA 3TP2A 1NK6A 1QTNB 1ZM9A 3G4SS 3AY0A 3I31A 4I2QB 1UAWA 2XMUA 5E3QA 2CKWA 1X5OA 3GMGA 2BW7A 4M94A 1QY7A 4OYAA 4AFFA 3ONQA 3DRRA 1DBDA 3FUYA 4CM0A 4WZQA 3I4PA 4ZJQA 3OJUA 3GSIA 4PQAA 2VJUA 3SZ2A 1Q86T 1GXUA 4RL1A 1CJUA 1IR2A 3HHLA 1MNEA 1FO1A 4DPOA 2UVRA 1IJEB 3UPFA 3K2YA 1MSWD 5IV3A 5C42A 2FHKA 3LWLA 3TZYA 3LF0A 5B0AA 2AV5A 1W2BR 1HNZF 3NCPA 2YKPA 3T9NA 4B08A 4F3QA 4ECSA 1UA0A 1YQHA 3GPAA 2JC1A 4WIQA 3V6JA 2OJ3A 2JFDA 5F9LA 2EC2A 3OJSA 3W66A 2FC8A 2VKZG 2B0GA 5BYSA 2E1CA 4HHHA 3I56S 3JSBA 2OMLA 4EO6A 1KQFB 2VICA 4PWDA 2PEBA 3GILA 5EX0A 4JI7F 2OPSA 1S1UB 3N0VA 4YB6A 2CPHA 3HSJA 4FVCA 1S7IA 5DZ7A 2OTLS 4B9MA 3LUYA 3W5ZA 3OR2A 2XGPA 4KAIA 3DM2B 5A6WA 5FLXU 3DGVA 1Q7LB 2F9DA 5DGBA 2IVMA 1RISA 2BKNA 3QSIA 4NLVA 3N28A 3WIVA 2MZTA 4ZITA 3NEKA 2PI5A 3KFWX 2CG4A 1N5TA 2CPFA 3K5LA 2E5GA 1S49A 2H9ZA 2FJDB 1F5AA 2WVFA 3U02A 3RAXA 2RRBA 3HSZA 2Y8WA 4A8XA 1A9NB 3GJTB 1B7YB 1BWVA 2KN4A 4DR7J 4JI0F 2DBBA 3CCWA 5HN0A 1S1XA 3FRYA 3IBWA 4Q43A 4I68A 1OMSA 2HQFA 3H4DA 4RKUC 2KHDA 1U1LA 3CJ5A 5EN1A 1R0CB 1RU1A 4OX6A 5K8NA 1XNQF 4ENOA 3D2WA 4N76A 3Q2TC 1H98A 4JV5J 1RWKB 2RB7A 2ZNYA 3ZTSA 1VS3A 5KOXA 1RT5B 3DXSX 3DI6B 2VODA 1NDCA 2I5JB 4QW9A 4K8RA 3D6HB 2KM8C 3LGNA 5E3RA 4CYUB 1WC4A 3POTB 4N56A 2BABA 4RW7A 2GNKA 3OFEA 4NLPA 2PE8A 2A3JA 4ERDA 2ZH4A 1M1GA 2IA6A 2GQCA 2V6AA 3BSCA 4FP9A 3Q8VA 3KHHA 2E5HA 2OH2A 3C19A 1XBWA 1TMMA 3MMAA 4X65F 1X4AA 2XMVA 5I42B 1M5VC 4OZLA 3TUZC 1DQAA 3RBEA 1RTDA 3CULA 2KXNB 3NY0A 5DLGA 1PBAA 2CQ4A 3QNWB 2VKRA 3IC1A 1GEHA 1N5SA 3PIOQ 2V63A 3DLEA 2MKSA 1SH3A 3NBPB 4KR0B 4OFZA 4UF4A 3OSNA 3N5FA 4DX5A 1XC9A 2AWZA 1IR0A 3GIRA 1J5EJ 4H4KC 2RQKA 2I38A 2Y1LB 1HW9A 1TL3A 4HLBA 5ETSA 4DXLA 3OTDA 4J9KA 3H0PA 2DR7A 1CQMA 1HMVB 3DMJA 3TYTA 2W4PA 2Z2MA 1SV5B 2OPQB 5D77A 2DNZA 3IMQJ 4WXWA 4JI4F 2HW3A 4WFAQ 2WVCA 4Z7YA 3VQTA 5B0CA 1AZSB 2YQ3A 2FVPA 1LEOA 2XHWA 3OXLA 3T1HJ 3QATA 2H54B 1U1PA 3AT1B 3PNIA 2MZQA 1P8GA 4USMA 1XN9A 5GAEI 2QA4S 2CZVC 2KB2A 3W2VB 1EAYC 4J9SA 3SI8A 1T9WA 3ILIA 1N8RT 2E1RA 2FVRA 4B9UA 1G1XA 1ZM4A 4G1PA 4JUZA 5GAHU 3J7ZT 3T41A 1VQ7S 1ZOTA 2RMLA 2GFFA 4QR2A 5KT3A 2AGPA 2GQQA 2JEIA 2D69A 3PW2A 4NE9C 1D9AA 2GW8A 4B3MJ 5DQHA 3QLHA 2GHPA 3G82B 3AD9C 5EWEA 1JJ2R 2FGOA 1IM4A 2V69A 4H4MA 2WCXA 3UCGA 4LFAF 4IDKA 3U27A 4L6V3 2QIFA 4ITSA 4RU2A 1U26A 3DU5A 4LSLB 3HKZD 5G4DA 1TL1A 1C4CA 3AFGA 5C5JA 4J9MA 3CJ0A 3CDAA 3R5DA 1T9UA 1EETA 2G1DA 2RNEA 4N8OA 3G9CA 3UI3A 1RAJA 2YPYA 4ZLPA 5KFHA 4ECXA 4MKAA 2CJ9A 4OX7A 1PJ7A 3TEHB 1SBRA 2EC0A 1TKZB 3SSRA 1SV5A 2OPQA 4W92B 1LW0B 1JIHA 1U0SA 2YNHA 2XMAA 4NLOA 1DHMA 2BE2B 4LUBA 4PWUA 1ZM2A 4PABA 1HLWA 2ZBPA 4ZIVA 4HH0A 1J5OA 1QSSA 4OHXA 3NXZA 4USVA 1YKWA 3HHNB 3TZWA 5KFMA 4QOTA 1R6VA 3T5JA 5IZHA 1DTQA 1WG1A 2HAIA 3L7PA 1O51A 5IT0A 2HRUA 4QQBA 2B3TB 3RZAA 4DDFA 3D68A 1FEHA 1QE1B 1ZBTA 2CQ1A 2MPUA 4I69A 4ZDNA 3TR5A 4P2SA 1FJGJ 1T9XA 3KUEA 2VQEF 4I67A 4Q44A 1M5PC 3H5SA 2XTJP 1U2CA 3MMCB 1FDAA 3R7BB 4HH1A 3ZC4A 4DX6A 2MZ1A 4F4YA 2KT2A 4PPDA 1C0TA 1BY9A 3P45B 3UO0A 4R5PA 1VRTA 4ED1A 5K8OA 4PWDB 3MEEB 1EX8A 2GCFA 4TLRA 1UWBA 2EBGA 4U9RA 1SI9A 1HBOA 4WWSA 1WG5A 1IBCB 5F0WA 3W9IA 1TKXA 2CNKB 3G6ES 3RBDA 3K58A 4CYUA 1ZM3A 1LNQA 2GAGC 3KOAA 2D3UA 3AD7C 3MCMA 4CLYA 2UU9F 5A76A 5KFOA 2AQ4A 4OI4A 2ASDA 2MZJA 2CPIA 4ZHRA 2B5JB 1Q79A 5GMEA 5F8NA 3BBFA 1F9HA 2HHTA 2BV3A 1UPMB 1X5TA 1CJTA 2D1CA 1PCAA 2VU5A 4CLTA 1OY6A 3E01B 1TELA 4LF9F 4QU6A 2RVJA 2AJFE 2DH8A 1RTDB 1RZMA 3I0RA 1WELA 4ECWA 3MI7X 5CQGA 3KK3A 3G6VA 4M5DB 1REGX 4DL4A 3HJVA 2CDRB 4M5KA 3MAAA 3OLBA 4DR1F 4TYAA 3KLHA 4X4QA 4KV8B 4P72A 2K7JA 2WVDA 4ECVA 2ADCA 3C6UB 3HKWA 4N77A 1NK5A 4HT7A 2Q79A 5FIIA 3J7Z5 3H59A 2HS4A 4NMLA 3WZ0A 4EK2A 3G87A 3OTEA 3CCLS 5DRKA 1N0UA 1XEZA 2OD6A 3TI0A 2RT3A 4I6WA 3VAJA 4AUKA 4WK3A 5D4NA 1JJCB 3BYRA 1T95A 1Q5YA 2DGQA 2M9KA 2IVYA 1HBOB 2FTRA 2R8KA 4FF3A 4DN9A 5IQ6A 3BBCA 2CPJA 4LRCA 2RU3A 4Z7CA 1TV6A 4K7QA 2EFQA 4OI6A 3CJKA 1UA1A 2YNFB 3K5PA 1RHMB 2ZEJA 3M2VA 5DZ6A 5HANA 1NK8A 2RHQB 5JMNA 1HA1A 3EGVA 3BS9A 2ZH5A 1RJJA 1CQNA 2ZHBA 3VVUA 3JB9k 1FNMA 3DRSA 3PYDA 4DN0A 4FXVA 3PIPQ 2V4RA 3GZ7A 2A2DA 3QWPA 1J5OB 2CQIA 4LVOP 4O4GA 1N48A 2ZWOA 3TWZA 4C3KA 2J7WA 2EW9A 4OHYA 4PRFA 2CJAA 5I3UA 5B0FA 2GQ2A 1SUQA 2HQIA 4CRJA 5GADI 2QC3A 3BH6B 1YJWS 1ZZFA 4LRDA 5EGYA 3OL7A 1ZH5A 3ETMA 2HHQA 4KO0A 2R7UA 2CQGA 1FHTA 2C2ZB 2Y0BB 1LV5A 5L1KA 2IM2A 3MEKA 2I6WA 1YRUA 2RS2A 2BANA 2V67A 3LP2B 4OZ2A 1I5OB 2K06A 2O67A 2YKMB 4JV1A 1H72C 1RLDA 1Y11A 2KJWA 4DSJA 1FVQA 1TK5A 1SKUB 3TZZA 4UUWA 2OI2A 3HHLB 5KFKA 4L75A 1SIWB 2E5JA 1N33F 4IQXA 4AYBD 3KJQB 1K9MT 4LSZB 3G82A 4OLPA 4NZ7A 5E41A 4FYWB 4BC7A 4LF6J 4QWDA 4GC6A 1TKTB 3GYGA 1UEUA 1RK8A 2QL5B 2VFSA 2RUSA 2V50A 4F4KA 1RT4B 1HKAA 4L73A 3QWUA 4L3NA 4XO0A 2PA8D 2D3O1 5D4PA 2G2ZA 4HL9A 1JLEA 3POTA 4QR0A 2QSWA 4OZ5A 5HVHA 4DHVA 2KT3A 3C66A 2I5JA 1F9FA 2H51B 2RUGA 3M9NB 2BJEA 1NJWA 1S1UA 2E7XA 3M9MB 4LRAA 1HNVA 1Q16B 2J0QD 1I1GA 4J9VA 1RHQB 3W8GA 4M5IA 4RBVA 2MKHA 1H38A 4ZPCA 3M1VB 4F8RA 3HJFA 2MXYA 1H2TZ 2YPZA 3MEDA 2GJIA 1B99A 3WIUA 3KK2A 4O0NA 3VCDA 3MTJA 4ELUA 1NDLA 4DG1A 3BKUA 2MGZB 2UVUA 1L3SA 2OPRA 3M6XA 2IY5B 4URQU 2OPRB 5KFVA 4XK8C 3HVWA 4CTAB 4RUHA 3GQCA 1XMOF 3Q8YA 2HLUA 3P3DA 1WI6A 2DGVA 4YR2A 1T9VA 1QE1A 1MWZA 3O3LA 4WFNQ 1IN0A 2ZC4A 2CZ9A 2J6TA 2HHXA 1JWWA 1JLQA 5GAGI 4C0BA 4DV5F 1QAIA 1U8SA 5G0RB 2VV5A 2PIIA 3OL9A 4KHRA 2FLNA 2Y3YA 1CULA 3CCMS 2BMBA 2IBOA 1CS4A 5HQ8A 1F1BB 1GX6A 1WSVA 3VAMA 3CW2C 3KHRA 1FNXH 4G1QA 2AJ4A 3M8ZA 3MPDA 2C3PA 4I6AA 3OHBA 1Y0HA 1JLGB 3EJMA 3G2XA 1NH7A 2UVWA 1YIJS 3CC2S 1S59A 3M8PA 1DTTB 1RBOB 5LOQA 1YITS 1UVIA 4F25A 2ZOFA 2RF2A 4DCOB 1IKXA 3T9ZA 2AEJA 3B4DA 2VA2A 2FQQB 2J9CA 5GVQA 3MR2A 5F8GA 2Y8YA 3A12A 3CMES 4WFXA 4KGZB 2V8GA 2UU9J 1VR6A 2DD8S 3EVOA 4DPYA 1NJYA 3OBIA 4PXBA 1HR0F 4DV6J 1G2EA 4W90B 3J7A1 2AP6A 2VZ9A 3SQOP 5KFLA 1HI0P 4LT6A 1Y7PA 1IM6A 1R0BG 2ZKTA 4U96A 5CZVA 3J81U 3PACA 1HQUA 2DNYA 1JLAA 1S9EA 1YX2A 4NEYA 3S7RA 2M5YA 2NZ4A 2MHNA 4UOCA 1UVNA 4ETZA 1WHYA 1S10A 3VAGA 1N32J 3CVKA 2APOA 2B8QA 2R3VA 1FRKA 1KTVA 3FBEA 3TX0A 3FGVA 1SUQB 4ZVRB 1D3WA 4LF8F 1SC4B 3FSXA 4EWTA 1NKBA 4LF7J 4C8MA 4PXDA 3ISNC 1NH8A 1AB8A 3SEOA 1FKAF 3W2WA 2CWKA 3MM8A 1F9EB 1RT1B 1KQGB 3KJFB 4DJBA 4EZ9A 2QFJA 3N79A 5HATA 1R6YA 2V4JB 3T1YF 1XR6A 1S76D 4QU7A 2YY3A 3BF4A 3LAMA 4QIWD 2MKIA 1WC0A 1KD1T 2AYEA 5AXLA 3DHWC 5K14B 2GAHC 3HCXA 1FK9A 2ZVSA 2B43A 2UUAF 4KGVB 1TMJA 4WYWA 1VQ5S 5J2QB 3IR6B 4FYVB 3BBBA 4CT9A 2FY1A 5L1JA 1JJHA 2OMOA 3SSSA 5E5NA 5T7LA 1S6QA 3EYZA 3CC7S 2QA1A 1D09B 5HROB 3EGWB 4C97A 3IWXA 4RWXA 2GHWA 2IJRA 3N6MA 1K44A 3KUHA 4G1QB 4IKAA 5D0RA 2CNOB 3BO2A 1LQ9A 2B4UA 3HHEA 5ETLA 1TAQA 1BUXA 3DN9A 2BE9B 1OIAA 1SPBP 1HNIA 1RABB 3EDRB 2NREA 2KYXA 2DR5A 2BUNA 1D9FA 2YWFA 5T14A 2FHJA 5AJ3F 1Q78A 2WHOA 1T9TA 1SL2A 4M5HA 3RW6A 3F56A 1R8BA 2MQQA 2E9TA 4CNYA 1PJ5A 1WEXA 4K4UA 1HBNB 2J9EA 2MEWA 4BWJA 4DR3J 1T03A 1Q8LA 5DG8A 4RJVA 5DETA 3F73A 4C8OA 3M2VB 3FKBA 4JI2F 3OTBA 3QZ8A 3FBFA 2LQ8A 1JKHB 3CJ3A 5FDLA 3KK2B 3MPVA 3OQ2A 4UTGA 4KYZA 7AT1B 3GR0A 2FGCA 2RQCA 1BD6A 3ZTPA 1NM2A 4K0KJ 5CHCB 4ZVOB 3ENWA 3H25A 4KRWA 1S1XB 1SC6A 1FX4A 1KRPA 3CCQS 1PIEA 4ES3A 4HTJA 1RT3B 1K47A 4K4ZA 1R89A 4NASA 4K4YA 2EFVA 5JXSA 2F65A 4J90A 4DR6J 3R5JB 1KN6A 1XR5A 4KV8A 2W2PP 4RW4B 1NSKL 2DO4A 3MEEA 4L3KA 4DFJA 1S6PB 4M5MA 2DRAA 1SC1B 4DV4F 4KY3A 4PKDB 4TLQA 3TVKA 4DZ6A 3BN4A 1ZPVA 3SYZA 2QL9B 2VPZB 3K5OA 4Q5VA 1T05B 2AJ0A 2A10A 2HWTA 1PILA 2UUAJ 4V19X 2PSZA 2KG1A 4ED2A 1R8AA 2BEFA 3OVBA 2VG7B 4LIRA 3CJRA 1LWCA 1Y3JA 4CM2A 4IR1A 1NCLA 3IR5B 4M5LA 1HARA 4CTAA 3OVSA 2MKYA 4F4XA 1VC0A 5T41A 3KLIB 5C24A 1CJVB 3Q8PB 2DYAA 4ZP8A 5E3PA 3DC2A 2CJQA 3M32A 3O1LA 3PHEA 1GXTA 1NUEA 1ZA1B 2IYGA 5HVFA 4A46A 4GRSA 3KLFB 2PI4A 2K1RA 4R5PB 4HR2A 4JI3J 1M5HA 3BV8A 3QIDA 5I3UB 2O01C 1JX4A 2F1FA 4M5JA 3V6HA 4QWAA 2HFSA 1IQTA 3EZ5A 2A1BA 4ZPBA 4ECUA 5GMKa 3DLHA 5ETRA 3N5BA 4O3SA 1VRQC 3PEJA 5KG5A 2OPPB 1N36F 1FDBA 4LBHA 4AXJA 2HNYA 3K5NA 4DR3F 1X4HA 4F02A 2CJXB 3DNCA 4PYDA 5BR8J 1CLFA 2G2OA 4GVBA 5HVGA 2UUCJ 2DCLA 1NXIA 3UNYA 4ANEA 5L1LA 4Q0BB 3IR7B 1GT8A 1WHWA 1ZAXA 3SDEA 2QSFA 2BZ2A 2UUTA 2GS8A 2YNFA 3NGSA 1U09A 4NI2A 4WP8A 2ZOMA 3SQGA 4RNNA 3RW7A 4IOCQ 1UVJA 4NA2A 2KFYA 2BRKA 3EMTA 1NAQA 4ZIWA 1GNKA 2BBEA 2J9DE 2K8GA 3W9HA 2XCPA 4NLTA 2QE5A 4YS2A 4FF2A 3K8WA 1C4AA 1EKRA 3O2IA 5LT5A 3B78A 2HVEA 3NCRA 4U95A 1N5YA 4I56A 2M8DB 2AYGA 2OUGA 3AODA 4GO5X 4F26A 2VQFF 5BYQA 1WKJA 4Y00A 5H9FJ 2IRUA 4LSLA 5E2QA 2AZ1A 4EZ6A 1JLCA 3K17A 2OEMA 4Y2IA 1DARA 1IKWB 2R42A 4Y6IA 4ED3A 2JHEA 1LFPA 2DCUB 3TO8A 1BLUA 1H2UX 3V4IB 1B0TA 1R7IA 3BSAA 5HK4A 5D8HB 1TVRA 1HQEB 3VVTA 4LR8A 1WC3A 3M2RB 2WK4A 4FDFA 3MAQA 5EHHA 2MTLA 3E3XA 4WXOA 2JJ4D 2V5HG 2QLJB 4NYOA 2J7KA 4OZJA 4DUZJ 1S99A 1DTQB 1VIXA 3BREA 3T6BA 4BCAA 3RB4A 2NSCA 2IPOB 3IGNA 1UEKA 4RX6A 3AOBA 4ZPDA 4FBUA 4B3RF 4NL5A 2BOPA 3KG4A 4ED5A 3HI9A 1MG7A 4C2MA 1VLOA 2KT5A 4IYQA 3HVAA 3CTRA 3VV2B 3L7UA 4PXCA 2RKIA 2IVFB 3UE2A 2IC3B 2CQ2A 2V68A 5F8JA 2WOMA 3D66A 4P6QA 2LKZA 1M5OC 5GAEU 4Q0BA 2AZ3A 3DMJB 3AHPA 3TZXA 4TY9A 1SJRA 2N3OA 1C0UA 4LRFA 2NS1B 3J81j 4NCBA 3C15A 1HD1A 1AT1B 1H3DA 4DUTA 2C2EA 4ECQA 4Q8FA 3H90A 2JC0A 2KU7A 1N4LA 3E51A 4QYZJ 4KGMA 4Y2MA 2CVIA 1J2VA 3KG0A 1DLOB 1RAHB 3R3TA 4DPXA 3MM9A 3H2UB 3PM9A 2O3DA 3HSDA 3TJ8A 1FF2A 4USUA 2K7KA 1V5IB 3BH7B 1RQ0A 4O4RA 2JDJA 3MR7A 3BM7A 2LCWA 4IH6A 3GCXP 4ICLB 1UETA 1BQMA 1EARA 2FZCB 3IRXA 4N5SA 3ADAC 1U6BA 4BBYA 3BO4A 4LBIA 3NP5A 2HWHA 3I0RB 1RCXB 1V5VA 4I1TA 2FJBB 1JXVA 4OYXA 3E01A 1N88A 2ZUAA 1CJTB 4D3HA 1HWKA 4DZDA 5ITHA 4DL2A 1W26A 5JVHQ 4RBUA 3JS9A 1LK5A 4JI2J 5A8KB 1CPZA 3R27A 4QIFA 1IQZA 4CO2A 3AAWB 1RT5A 2XNQA 2HHSA 1FERA 2QRRA 2HZAA 2R8HA 1YBAA 2HFNA 1CVJA 3THPA 4BC9A 3EXYA 1T7PA 2DHSA 3RBZA 2ASJA 4GMKA 4RW9B 4USIA 3PJWA 3OHAA 4KJIA 4HI2A 4ZCIA 3CJ4A 3I9ZA 1UFKA 2EEYA 3ZTQA 1HIYA 3NWGA 2EFGA 2QYGA 5KFBA 3R97A 2ZM6J 2JEFA 5ETQA 4ZCLA 2KYZA 3W64A 3MM5B 2LXFA 2LXUA 3CD0A 2KM8B 3KNGA 3A4TA 4U8YA 2HHPA 4USWA 3Q2SC 4H54A 3PDNA 4WYLA 3JAMY 1M0SA 4J9QA 3MMJA 3VF0B 1DRZA 4DR4F 2ZM6F 4K4WA 2VG7A 4C48A 1KVJA 2MQ8A 4PWWA 4YB5A 2CPEA 5KFUA 2FVSA 4B9VA 2ZDOA 3W2VA 1U1NA 1FFWB 3KNAA 3EZOA 1SKRA 1AFJA 3NLCA 3AB2B 1SJFA 2CQCA 4NOHA 3ULHA 1Q7YT 2UUBJ 1RWWB 1RTJB 1IR1A 2Q66A 5HMYA 5C25B 4CWBA 4BLGA 8RUCA 2FUG9 3D0GE 2XWXA 1WC6A 5KFAA 3W61A 5J1PA 2R7OA 4CO3A 4GC7A 3OTOF 2GIRA 3JYTA 1HYSB 1SQGA 4RW9A 2VPWB 3NMAA 2RJZA 4A47A 3CDEA 3MM7B 1KVKA 3AH6A 2DNPA 4WK1A 3HZGA 2YKNA 2XLIA 1YG0A 4B9SA 3QIPA 4XTTA 3AOAA 5DQGA 2BQUA 4TKTA 1S12A 2JWNA 3DKDA 1B64A 5J1EB 3FBBA 1PC5A 2HRYA 4BWMA 3R9LA 1K0TA 3PJ9A 3HHLC 4MFBA 3SMZA 1VQMS 2DRBA 1WSRA 3M05A 1RT7A 3MPWA 2Z8QA 1JKHA 1MMLA 1PSDA 2F7VA 2F8HA 3H98A 4KSEB 4Q2LA 1WKLA 2Z2LA 1IWAA 4WFYA 3WQPA 2E5LF 2MB0B 4ZLNA 4F4ZA 2IA0A 3CO0P 1T03B 3QT8A 5KG7A 2EK1A 4KHPF 3I5BA 4DR2J 1OSCA 2C42A 1S5ZA 3GFXA 2ILZA 3M9OB 1M1KT 2OKQA 2C1EB 3AA8A 2RS8A 5F8MA 3D1QA 3GJSB 3CF5Q 2YKAA 4KB7A 4CLZA 5DG9A 2W4CA 2A0FB 3IM9A 4KGXB 3LPYA 4RBTA 5D0EA 3NNCA 3MOZA 1X4CA 3K0JA 1V3RA 1P27B 1RT3A 4CLFA 5EWGA 1M1HA 3DLBA 4LF5J 3GU0A 5KFYA 1NPPA 2K1RB 4ZPTR 4ZVTB 5K8PA 4RW4A 2DH7A 1HWIA 1S9GA 4CO5A 2BQRA 1FDDA 1NK9A 1Q81T 3TQEA 4ED4A 2LP4A 3OR1A 1B0VA 3NAHA 3OL6A 1IWGA 4ANDA 4X64J 3TA0A 3UW1A 2J6UA 2QYCA 2D3ZA 3VHQA 4X62J 3PRVA 2B8PA 4PG4A 3OUYB 1S1VA 3THTA 3A8KA 2AX0A 5K14A 1NHKL 2ZBQA 4WCEQ 1VJWA 1SKWA 4HKQA 3FMWA 2K2PA 4YB7A 2WSCC 3DDKA 2LECA 1IBKF 3R5GA 3DFEA 2OEKA 4URSA 1NEEA 5FDLB 3SCIE 2UXBF 2KG0A 2E66A 2DR6A 4IFVB 3MMAB 2VG6A 1U24A 4N47A 3Q8UA 3I96A 4MT1A 3KKFA 2HVIA 4IRCA 4DR1J 2W7PA 1WUUA 3CCZA 4YEAA 2HURA 3LW5C 1YJTA 3D54A 2ZJRQ 1Q8KA 1IBLJ 2PFFB 1UKUA 2MZSA 3ENVA 4AQYJ 2GZOA 4J9PA 4LFAJ 1GMWA 1FD8A 2Q6CA 2V8VA 4ZPVR 1M90T 2FJWA 3M6WA 2NXCA 5HMWA 4YMEA 4ED8A 2FJEB 2AEMA 2MHEA 2U2FA 5SZTA 2GVZA 1NJZA 1RYSA 1WACA 4NMXA 4CO1A 1EZZB 4ILMA 2ILYA 3PYEA 3S1TA 3CD7A 3W62A 1KLNA 2XULA 3S6EA 4LF8J 3CUNA 1JLBA 1ZPWX 3CO9A 2LQJA 2LXIA 4IH7A 3VAIA 2BJ7A 4DR2F 2M70A 5GADU 2H1YA 3DOMB 3ICLA 2G0JA 3FEZA 1IKVB 3SDEB 2B4PA 2E5LJ 2DGWA 4FXDA 3DRPA 2V9WA 3OLAA 1A7GE 3TRGA 4JI3F 2HFVA 1VIOA 2H4YB 2UUWA 4WP9A 2AU0A 4JI4J 1LKZA 2O66A 3IA0A 3LTOA 5KT7A 1FESA 2YH1A 1HI1A 2WTFA 1KHWA 1CC7A 1PYOB 1RA6A 3TEGA 1S9EB 2KXHA 3BSNA 1ITPA 4DPUA 5E3CA 3DOKA 1JNRB 3CD5A 4RNHA 5KFEA 3FVYA 1WC5A 3HM9A 5EWFA 2FVCA 3IG1A 5AXKA 3RG6A 3SBMA 3TJ9A 2W9AA 2AMCB 4A4JA 2ZH7A 2YWWA 3OUYA 4NZ0A 2HNDA 1UL3A 1F60B 4LRBA 4J9NA 1S0MA 1G6BA 4CT8A 2WW8A 5KFWA 5ETVA 1YHQS 4K59A 4LR9A 4O3RA 1LWCB 2C3YA 1JLBB 3FQKA 3S01A 4UQGA 3SV3A 1LXNA 4PG8A 5LL6d 2OP5A 3OL8A 1Q53A 3ZXWA 4OI0A 3BB5A 3JTNA 2BDPA 4DR4J 1VQSA 2MLZA 3J7YU 1KS2A 3GIKA 1UVKA 3HULA 2CYYA 2HBYB 2VFUA 3KJNB 1ZTTA 1GFWB 5BYRA 4B3TJ 3PYFA 4C8LA 4OHZA 3QJJA 2L08A 4I7FA 2NZCA 2FIUA 4YDXA 2Y1RI 4OI1A 4QBUA 1F2HA 4G3IA 4K2JA 3DDIA 5KFPA 4NLUA 3CWJA 4EFAC 4OHWA 3PFOA 4UW2A 2W24A 3MFIA 3NG8A 3TANA 2GIQA 4WPAA 1WNEA 1TUWA 1CS4B 3GONA 5LSRA 4ZVSB 3RU0A 3A13A 5KG0A 3C14A 1S57A 4ZVEA 3HD1A 1KC8T 3BDPA 5DDPC 4RU9A 2BQ3A 3MUMP 3X1LB 3PW5A 3IS9B 5IWAF 2IJFA 2M8HA 2Z4PA 4IO1A 4B3OA 4DR5J 5IM0A 2RAQA 3BZQA 2W9CB 3SIPB 4DG1B 2KXFA 2C2RA 4JI7J 4FBTA 4W4MA 1VLYA 2BJ9A 2GMJA 5B7WA 5C7PA 5CCLA 1B7FA 4MTPA 3V5RA 5B08A 2ZHAA 1TU0B 4J7CA 5JVGQ 3PW4A 2IFXA 1MWYA 2HG4A 4A48A 3I9V9 5C25A 1Y00A 4TQRA 4TU7A 1JQGA 2R2SA 1YJ9S 3BR9A 3GIJA 2E9ZA 1KWMA 2YNIA 4QPXA 3EE3A 4LSNB 4OX9F 2R8IA 1V3SA 2B9WA 4RW6B 2Y1JA 1HNZJ 1JLEB 4OLOA 3AA9A 1TFWA 1IJFB 1YTYA 3OPKA 3HXMA 2FJAB 3ZZ0A 4EI2A 3MR5A 3JTPA 1U49A 1EIYB 3E2EA 4C3LA 3G8SA 1KONA 3MMBA 3DLLQ 1KBRA 4JOUA 2GMHA 2HSEB 1MMNA 4AT1B 1FK9B 1Q4RA 2XMTA 3VR1A 3PW0A 1VQ4S 1RT7B 2WVEA 1QVGR 4UT4A 3R2DJ 1S1WA 2QL7B 3W8PA 4O3OA 1IBMJ 1N32F 2DGSA 1IUJA 2V4QA 1LWEA 2HK2A 1N34F 2YNGA 4O23A 3G6YA 1PO6A 2M88A 4JI1J 4PR6A 2BJDA 3D6TB 1VK3A 2C2MB 2HBQB 1BXNA 5A8KA 3TAQA 1ROFA 2VBWA 3CE8A 1AUSL 3SCKE 2XO7A 1TL1B 4JI5J 2HWIA 2QG9B 2V94A 4JI0J 6FD1A 3M6UA 2V2KA 2VL1A 3L09A 1O0PA 4MKBA 5J2NA 1T9YA 4PG6A 4NXMF 4GKKF 4R0EA 1WI8A 4M5NA 1NHUA 4C6AA 4J91A 1L3KA 3F0NA 4OV6A 5JUMA 1U4BA 1KOOA 2EWHA 3WC0A 4B17A 4KE5A 4DR5F 1NNDA 3W65A 2BXJA 3R6GB 1WORA 3RB3A 1Q0NA 2UP1A 1NSPA 2KVIA
chains in the Genus database with same CATH topology
3D3CJ 1XNQJ 4NXMJ 3J80U 4DV0J 4DV3J 4DV1J 4DR4J 1XMOJ 4LF6J 5AJ3J 5FLXU 4B3TJ 4DR2J 4HHUA 4LF4J 2MTLA 1HR0J 5IWAJ 4JI8J 3J7AN 2KL8A 4DUZJ 1FJGJ 4DV7J 4DR3J 2MEWA 4RJVA 4DV2J 1I94J 4B3RJ 4LF5J 3W1YC 4KYZA 4DUYJ 4K0KJ 4JV5J 4OX9J 4X64J 3D3BJ 2UXCJ 4YY3J 2UXDJ 4X62J 4DR5J 3OTOJ 4DV4J 2UXBJ 4JI7J 4DV5J 4LFCJ 1IBKJ 4LF9J 2F4VJ 4DR6J 4NXNJ 4KY3A 1XNRJ 4DR1J 1N36J 1HNZJ 4LFBJ 2UUAJ 1HNXJ 1IBLJ 4AQYJ 4LFAJ 4X66J 4JI2J 3T1YJ 4NEZA 4JYAJ 1J5EJ 4YHHJ 2VQEJ 4GKKJ 5LM7E 5LMNJ 4B3SJ 3R2DJ 5IT9U 2UU9J 4LF8J 2KVQE 1IBMJ 2ZM6J 3IMQJ 4DV6J 1XMQJ 4JI3J 4KHPJ 4JI6J 3J81U 4JI1J 2E5LJ 4NEYA 3T1HJ 1N33J 4V1Ak 1N34J 4JI5J 4JI4J 4JI0J 1N32J 4X65J 3JAMU 2MQ8A 4PWWA 5BR8J 2VQFJ 5LMUJ 4DR7J 2UUCJ 1HNWJ 4LF7J 4B3MJ 2UUBJ 2HHHJ 5A2QU 3R2CJ 4GKJJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3C J;  1XNQ J;  4NXM J;  3J80 U;  4DV0 J;  4DV3 J;  4DV1 J;  4DR4 J;  1XMO J;  4LF6 J;  5AJ3 J;  5FLX U;  4B3T J;  4DR2 J;  4HHU A;  4LF4 J;  2MTL A;  1HR0 J;  5IWA J;  4JI8 J;  3J7A N;  2KL8 A;  4DUZ J;  1FJG J;  4DV7 J;  4DR3 J;  2MEW A;  4RJV A;  4DV2 J;  1I94 J;  4B3R J;  4LF5 J;  3W1Y C;  4KYZ A;  4DUY J;  4K0K J;  4JV5 J;  4OX9 J;  4X64 J;  3D3B J;  2UXC J;  4YY3 J;  2UXD J;  4X62 J;  4DR5 J;  3OTO J;  4DV4 J;  2UXB J;  4JI7 J;  4DV5 J;  4LFC J;  1IBK J;  4LF9 J;  2F4V J;  4DR6 J;  4NXN J;  4KY3 A;  1XNR J;  4DR1 J;  1N36 J;  1HNZ J;  4LFB J;  2UUA J;  1HNX J;  1IBL J;  4AQY J;  4LFA J;  4X66 J;  4JI2 J;  3T1Y J;  4NEZ A;  4JYA J;  1J5E J;  4YHH J;  2VQE J;  4GKK J;  5LM7 E;  5LMN J;  4B3S J;  3R2D J;  5IT9 U;  2UU9 J;  4LF8 J;  2KVQ E;  1IBM J;  2ZM6 J;  3IMQ J;  4DV6 J;  1XMQ J;  4JI3 J;  4KHP J;  4JI6 J;  3J81 U;  4JI1 J;  2E5L J;  4NEY A;  3T1H J;  1N33 J;  4V1A k;  1N34 J;  4JI5 J;  4JI4 J;  4JI0 J;  1N32 J;  4X65 J;  3JAM U;  2MQ8 A;  4PWW A;  5BR8 J;  2VQF J;  5LMU J;  4DR7 J;  2UUC J;  1HNW J;  4LF7 J;  4B3M J;  2UUB J;  2HHH J;  5A2Q U;  3R2C J;  4GKJ J; 
#chains in the Genus database with same CATH topology
 3JQM A;  4ALZ A;  1S77 D;  4F0H A;  1LWE B;  5ADZ A;  4B02 A;  4NXM J;  3A3O B;  3D1H A;  2VFR A;  3DYA A;  2X7I A;  2B56 A;  2YX1 A;  4DU8 A;  5B0B A;  4QYZ K;  2W2N P;  1JXL A;  3QAU A;  1ELO A;  3QGH A;  1RWV B;  3KMS A;  2XY7 A;  4DQP A;  2D41 A;  4RNF A;  4W98 A;  3TAR A;  3WDO A;  1RT2 A;  4PEO A;  2FB0 A;  4NLW A;  4U6P A;  1XMO J;  5CD4 H;  4DSK A;  2XB2 D;  1EHW A;  2BJ3 A;  3Q86 A;  3U7J A;  5DG7 A;  3LP0 A;  4FYY B;  1KDN A;  1NB2 A;  3GIM A;  3A8E A;  3UWT A;  1TUG B;  4ECZ A;  1QLN A;  1MLA A;  3CCR S;  2MKK A;  4B3T F;  1X31 C;  1FTR A;  3GJR B;  3MUR P;  2BAC A;  2YWK A;  3TA2 A;  3D6F B;  2AD9 A;  3HMJ G;  1WTB A;  2EK6 A;  2VDH A;  1OPZ A;  3MUT P;  2BW2 A;  4NPO A;  1RBL A;  2MGZ A;  4JI5 F;  3EVW A;  4ZPW R;  3O44 A;  5L38 A;  2CAD A;  1QDU B;  2H5I B;  2QLF B;  4MMO A;  1BMQ B;  1U02 A;  2CDQ A;  2DGO A;  2WSE C;  2G0C A;  1YK9 A;  1XK8 A;  4ZP6 A;  4JI6 F;  2R4F A;  2W9B B;  3EX7 B;  1I6J A;  4LFB F;  4ES2 A;  5CYJ A;  3QO9 A;  3W5X A;  4C4W A;  5HBM A;  1S97 A;  2JVR A;  3MMC A;  2W2M P;  2R7S A;  4URG A;  4OJ1 A;  3IN5 A;  1JMT A;  3OFF A;  4CH0 S;  2CQB A;  2Q3P A;  4ID5 B;  2RSQ A;  4CLP A;  1NKE A;  4DL0 C;  1UWB B;  3W60 A;  2OFH X;  2ACM A;  4KH0 B;  2MQO A;  1LOU A;  4CLS A;  1BQN A;  2V2Q A;  3OVA A;  1VBZ A;  4PQU B;  1KP6 A;  2PMH A;  3P8B B;  1C0T B;  3QT5 A;  3C46 A;  1EQM A;  2HFO A;  1UFL A;  1P1T A;  3BGR B;  3MDF A;  2XSJ A;  5KTQ A;  1F5B A;  1QTM A;  2DNR A;  1HNX F;  4EEY A;  5ETO A;  4JV5 F;  3N01 A;  4GVB B;  1VOM A;  3EWG A;  3KWM A;  4ICL A;  2M0G B;  1NZA A;  4O3N A;  3UN3 A;  4KGK A;  4M1K A;  4P2F A;  3HO1 A;  2QZ8 A;  1TFY A;  3NKY A;  3AD8 C;  2QT7 A;  3NOG A;  5KT4 A;  5J2M A;  3ETO A;  3ET6 A;  4I2P A;  2Z2Y B;  3P96 A;  2IAJ A;  5HLF B;  2NXN A;  3CD6 S;  3HVT A;  3HPO A;  4DSL A;  2FC9 A;  1AW0 A;  5LM7 E;  4A8M P;  4CCH A;  1O5J A;  2J8A A;  3JYT B;  1HYS A;  3PJX A;  4OJH A;  3KHL A;  2KVQ E;  4IDK B;  1Y4Z B;  1FRM A;  4RNO A;  4JB8 B;  2GML A;  2UVV A;  4EBD A;  3CXC R;  3H42 A;  4HI1 A;  5DDQ C;  6FDR A;  3RTV A;  4ID8 A;  1TUV A;  3WX8 A;  1YJV A;  1U1R A;  1IKY B;  1EET B;  4C7Q A;  4ZLL A;  5DDR C;  3MCN A;  4K50 A;  1C1C B;  3KK1 A;  4ZLJ A;  4TXS A;  3M30 A;  3ZTO A;  1Z4U A;  3IG1 B;  3PRD A;  5ETM A;  5KFX A;  1RI7 A;  5HAO A;  3TJA A;  2VDI A;  3JAM U;  3I5C A;  2R7R A;  2DIV A;  4DOZ A;  4RUC A;  1RP5 A;  2DHH A;  2FHO B;  2L9N A;  3TX8 A;  2KHC A;  3FC9 A;  3MR6 A;  1VYA A;  2W2O P;  3DU6 A;  3GFY A;  4NI2 B;  3BGL A;  2XQC A;  2ZH6 A;  3OW2 R;  2LFV A;  3DRR B;  3NNA A;  1TZ0 A;  4DU7 A;  6AT1 B;  1S0N A;  1FKP B;  3VWS A;  1VBY A;  1RGV A;  1SIZ A;  3AB4 B;  2EI5 A;  2I2Y A;  2MSS A;  4NRT A;  2RHS B;  1SQF A;  4OZ0 A;  1UW4 A;  1OQ6 A;  4FNI A;  3KLE B;  5IOL A;  1X4G A;  2IJN A;  2OD4 A;  2XMM A;  1BWE A;  2GVD B;  4IO9 Q;  1TL3 B;  3R2C J;  1YRT A;  1HQU B;  1RB0 A;  2ZIT A;  3ISN D;  4NYZ A;  1U1K A;  2QLB B;  1C0U B;  2RRN A;  2ZDP A;  4OV1 A;  4ZVP B;  5CCM A;  1XNR F;  1Y5I B;  3IAM 9;  1FXR A;  3CMQ A;  4Z2X A;  5MAO A;  3J80 U;  3V6D B;  3UDV A;  1YI2 S;  4KHM A;  4PG5 A;  4N8N A;  1HBM A;  1VGY A;  2CJY B;  4A8O A;  4DV7 F;  3PYG A;  3UDL A;  2OO4 A;  1K0V A;  2CUY A;  2N4D A;  2XO6 A;  2C3M A;  2B51 A;  3GP9 A;  1YSJ A;  2YX7 A;  3AXM A;  1P9Q C;  1BQM B;  2C3U A;  2HAF A;  3M8P B;  3TUJ C;  3B54 A;  4A8K A;  1HR0 J;  3BQ2 A;  1WDD A;  4DSI A;  3O6Q A;  1X9S A;  4ES1 A;  1R3N A;  4EGL A;  5IT9 Y;  2QA4 G;  1NJI T;  2YH0 A;  2O5D A;  1KLM B;  2RU9 A;  2NXJ A;  3EZU A;  2GGP A;  3NS7 B;  4IQM A;  2G4B A;  3CDB A;  3GFH A;  2VBX A;  4IOA Q;  4CP5 A;  1GMW D;  2DNQ A;  2H4W B;  3H20 A;  2UV8 G;  2LU1 A;  3OXF A;  5G0R A;  5D0G A;  4DUY J;  1TR0 A;  3PX0 A;  4USH A;  2FHJ D;  3AJD A;  1DY3 A;  1XIQ A;  5HRO A;  4C8Y A;  2IMO A;  2EPI A;  1TL5 A;  5KT6 A;  3BQ1 A;  5L9X A;  3MM6 A;  4O44 A;  1D8Y A;  4B3M F;  1UMJ A;  2NLW A;  5D0H A;  1NO8 A;  4HTI A;  4YY3 J;  2X51 A;  3DI6 A;  2FD2 A;  1UEV A;  3Q83 A;  4H4K A;  2X1G A;  3AXK A;  4PYA A;  4ZCM A;  2KFN A;  3LP1 A;  2VAS A;  1YRX A;  3G96 A;  3UD4 P;  3MUV P;  5HP1 B;  2WB1 D;  3RR7 A;  1NKC A;  1IBK J;  4N7T A;  1U0H B;  1PAE X;  4HDG A;  3BO3 A;  1X9M A;  3MWB A;  4RPF A;  5C2G A;  3CPW R;  3EXC X;  1F0X A;  3C14 B;  3LWM A;  2KZM A;  1W2I A;  2B4V A;  2ROG A;  1C1B A;  4NLQ A;  4AQY F;  5FLX Y;  1YGY A;  2BM0 A;  3BJY A;  3MCO A;  3KLG B;  5D4L A;  1ULR A;  2KRB A;  2ZFH A;  2CJK A;  5DO2 A;  2L41 A;  1QSL A;  3BGU A;  3GWC A;  3RB6 A;  4PCQ A;  2F63 A;  3DYA B;  3OXG A;  4PUO A;  2WBM A;  2V8H A;  4E0D A;  2ZUG A;  3NGD A;  2R7X A;  4OI2 A;  4JYA J;  2Z58 B;  3R7N B;  1OSD A;  2MY8 A;  3ILO A;  5EUH A;  4K5S A;  4ZVH A;  3OSP A;  3HT0 A;  2HIY A;  1NZ8 A;  2ROP A;  1YBU A;  2WBR A;  2DNL A;  4H4O A;  1F2G A;  2WSF C;  4YUD A;  2OEL A;  1U47 A;  1H74 A;  4YY3 F;  1U8W A;  3M6V A;  4OMF G;  1YJR A;  2GHV C;  5CA5 A;  2JZ5 A;  4CLU A;  3I82 A;  4KH1 B;  4KHP J;  3V81 A;  2COL A;  2LVW A;  4YR0 A;  2DPI A;  5A6P A;  2QMX A;  1RWO B;  2F40 A;  2RF2 B;  3H7H B;  2NPI A;  1PYS B;  5ETP A;  2ZBI A;  3QT7 A;  5HQM A;  1N33 J;  3RRH A;  3LQV A;  3RB0 A;  1FJ7 A;  1RBA A;  3LOU A;  5L39 A;  3PFE A;  2NR0 A;  3PR4 A;  2Y1I A;  2HQD A;  4QYR A;  1U6F A;  1YDL A;  2BVZ A;  3MCS A;  2PMZ D;  1CJU B;  3Q8S B;  3B6B A;  4M95 A;  3QSY B;  2QGF B;  1HNW J;  3UVJ A;  2JRS A;  1WD6 A;  3UVJ B;  4IFY B;  3WC2 A;  1NK4 A;  1D0E A;  4MKY A;  3D28 A;  1CSJ A;  2DXF A;  4WU2 A;  2HHH J;  2ZH9 A;  3MOJ B;  2D7S A;  1WOS A;  3H5U A;  3ILJ A;  4X4S A;  1R8C A;  5A2Q U;  1HHQ A;  2DNH A;  2DNN A;  2MQM A;  1S4F A;  1HMV A;  3LGM A;  1L3V A;  3AOC A;  3PKY A;  4UY8 5;  1DUR A;  1MRO A;  4X4P A;  1U2R A;  4G1I A;  3MEC A;  3T5H A;  1WDT A;  1XER A;  4CH7 A;  4CNZ A;  4DF8 A;  1YJN S;  2JVO A;  4GKJ J;  2HND B;  4DR7 F;  5AE2 A;  2VC1 A;  1FE0 A;  1UP1 A;  2F9J A;  5KG1 A;  2Z0G A;  4CLW A;  2WZ1 A;  3ILL A;  5GAH I;  5DM6 Q;  4NLG A;  2G9O A;  1PJ6 A;  4DL6 A;  2NYH A;  2NXU A;  4GVL A;  2HFZ A;  4FPR A;  3UCZ P;  2KFZ A;  3K8V A;  1KKH A;  1SVD A;  2W01 A;  4RUA A;  5I42 A;  4LFC F;  3L3C A;  3QRR A;  4LMZ A;  4XPE A;  1S1T A;  1X7V A;  5A8W B;  2DRD A;  4X4N A;  2A6M A;  1U6Z A;  3BDE A;  3KLH B;  1HL6 A;  3U1N A;  1WKK A;  2DTJ A;  2RIL A;  3HT3 A;  3Q89 A;  1VQO S;  2VPX B;  1CC8 A;  4M5D A;  3S8S A;  2VC0 A;  2ROE A;  4FPI A;  1KVI A;  3TUI C;  1ZTW A;  1N54 B;  3BEG B;  3HZE A;  3GV7 B;  3K7R A;  3NGU A;  3HFK A;  5FD1 A;  1HHS A;  2EFP A;  4IG3 A;  2R7T A;  3GB0 A;  4NLS A;  2AEF A;  2I9S A;  3GJQ B;  4LRE A;  4PXE A;  3AQP A;  1M5S A;  3TUP A;  5BJR A;  4FKX A;  2P2C B;  3LH2 S;  4MK7 A;  2HNZ B;  3D3B J;  2CQ3 A;  3CMA S;  3MMB B;  4FN5 A;  3FCH A;  1HBN A;  1B3T A;  1PC4 A;  4P75 A;  3BSO A;  1W25 A;  2N7C A;  4USJ C;  4DFK A;  3DLG B;  1NU4 A;  1FRL A;  3DRX A;  3B82 A;  4OYP A;  5AE3 A;  1VBX A;  4ELT A;  4NLR A;  3QJP A;  2HQC A;  1Z2Z A;  2HVZ A;  2MKJ A;  3A1Y G;  3FNN A;  1ZYQ A;  3A8I A;  1FWP A;  2ATL A;  4FYD A;  2EFN A;  2HZV A;  4UST A;  4TY8 A;  2IM0 A;  3H2V E;  2HS3 A;  2FZK B;  1RTJ A;  1GK8 A;  2CPZ A;  1Q1K A;  2DK2 A;  4RR5 A;  3HF5 A;  2ZJP Q;  3DDN A;  4ZN3 A;  4JP8 A;  4IFV A;  3PR5 B;  2RQ4 A;  4WBF A;  2QFI A;  4UOH A;  4DMZ A;  2JSX A;  3EUN A;  4DBQ A;  3T1H F;  5KFN A;  3I55 S;  2BKP A;  4ZJO A;  2V2V A;  2V8P A;  1OPI A;  3TVZ A;  1HPZ B;  1FRJ A;  3DHX A;  3LP1 B;  1RTH A;  5LXY A;  1RYR A;  2LA4 A;  4YHH J;  2BM1 A;  1UVM A;  3CCV S;  4M63 A;  2GX8 A;  1Y9O A;  3FDS A;  2VQE J;  1APS A;  1U45 A;  2HNZ A;  1GX5 A;  5E0O A;  2AKW B;  2BE2 A;  5CH7 B;  2EKY A;  2G2Y A;  5HI7 A;  5EX3 A;  1WF0 A;  1J5E F;  1RAG B;  3TVY A;  4I64 A;  4K4V A;  1OJ4 A;  1WEY A;  1BGX T;  2I0X A;  1JK9 B;  2P8I A;  3G8Q A;  5AXN A;  4U7C A;  2JLF A;  1GQE A;  2NUU G;  5A0Y A;  1WTF A;  1VRU B;  1Z1Z A;  2Q6B A;  3KYL A;  4K4S A;  1UZD A;  4ZKA A;  1RAE B;  3C6T B;  3CSK A;  1ICE B;  1FT8 A;  2CQH A;  5J2M B;  4ECR A;  2J5A A;  1N34 J;  5KFT A;  2HHU A;  3PO5 A;  1U1O A;  3THV A;  3LA0 A;  2YKQ A;  4EYI B;  2FJV A;  2B4O A;  2IM3 A;  3A3N B;  4J5O A;  4ECY A;  1TL7 B;  2AGQ A;  4I7F B;  3QQC D;  2ZZN A;  3GR1 A;  1TKT A;  2VH7 A;  2UZA A;  5ETN A;  1ZET A;  2F5G A;  1MWQ A;  1RTZ A;  1H6K X;  2MKC A;  3GSD A;  2WW4 A;  2A18 A;  3D6M B;  3TNV A;  4X4T A;  4A8F A;  1RAD B;  2BA9 A;  2HNY B;  2D9P A;  3M8S A;  5GAG U;  4ZN1 A;  2MMY A;  2VUG A;  1FFS B;  5D78 A;  4ZHR B;  5IC6 B;  2OIH A;  2GJ2 A;  1XMB A;  2YKM A;  2BJ1 A;  3M8Y A;  2XYG B;  2B6A B;  2DGU A;  3UN2 A;  1XNQ J;  2JLE A;  1CG2 A;  2CAJ A;  2K3I A;  3CJK B;  4XIU A;  1AYE A;  2X3D A;  4P73 A;  3KJV A;  4MK8 A;  3MED B;  1VIS A;  5B0E A;  2ZBR A;  3C16 A;  4ATN A;  5KFF A;  3MR3 A;  1OY8 A;  4ER8 A;  3LAL A;  4FKY A;  3E8O A;  2MZR A;  2JEG A;  3NAI A;  1BE4 A;  1QAX A;  4P74 A;  3X3U A;  4F2S A;  3KLI A;  4L74 A;  1RU2 A;  2CNN B;  4OYI A;  5DJB A;  5AJ3 J;  2Q43 A;  2RE1 A;  1B0P A;  3PXG a;  1CUL B;  2PT0 A;  4J9L A;  3HHD A;  2Z30 B;  2G1H A;  3IM8 A;  2A6O A;  2DHG A;  3C6U A;  2LA6 A;  3DLE B;  1E6V B;  3U1M A;  3ZZO A;  5IWA J;  4CDI A;  2NYI A;  3CDW A;  4QIE A;  4EU0 A;  4U67 Q;  2R2R A;  4RLE A;  3BPS P;  2AF6 A;  1NJX A;  1IVZ A;  3MF5 A;  1C1C A;  4L72 B;  3RYL A;  2VIH A;  1RHR B;  1QD1 A;  3GG0 A;  4Y2C A;  3LP0 B;  3T3F A;  1S72 S;  3RRK A;  3FJ2 A;  2EBE A;  1OYE A;  2CXE A;  2XSJ B;  3NGK A;  4DCJ B;  1Y5L B;  3QFW A;  1RWU A;  2J0S D;  3DCA A;  3MXH P;  3J7Y I;  2IDE A;  3W1Y C;  1U2F A;  2VF3 A;  2X1B A;  4MFB B;  4JI1 F;  4ZVG A;  2Q1L A;  4GKJ F;  5AE1 A;  4QR1 A;  4OX9 J;  2B5J A;  4HAC A;  4KQZ A;  1WF1 A;  1VQN S;  2UXD J;  2JLG A;  3K57 A;  2VG5 A;  1FKO A;  2EFO A;  3K5M A;  2VFV A;  2VG5 B;  4HVZ A;  3R8Y A;  2QLX A;  1YJ7 A;  2FDN A;  5B0G A;  2KTQ A;  5A8R A;  4LFC J;  3I6P A;  4WTY A;  3KXD A;  1FVS A;  3W63 A;  5LSO A;  3KLE A;  4PUO B;  4NLX A;  4OHV A;  4WE1 A;  1X4F A;  5ETT A;  2WOM B;  5M2R A;  2IHR 1;  4ETX A;  3QRP A;  3SV4 A;  1NK0 A;  1EB0 A;  4C0O C;  3PX6 A;  3GV8 B;  1FE4 A;  2YWH A;  2VOP A;  3LPE A;  1DQ8 A;  3BGR A;  5MLC V;  3H4B A;  1FTC A;  3UD3 P;  4K0K F;  1BQN B;  2L48 A;  2XZT B;  3UR3 C;  2YBV A;  1T02 A;  3IRW P;  4MAK A;  1U0H A;  2DHA A;  4X66 J;  5J1E A;  3KK1 B;  1S1V B;  4I4B A;  1TKD A;  1D1U A;  2HHH F;  2XMK A;  3M2R A;  4DV6 F;  4KT0 C;  2IMW P;  4DR6 F;  3PVX A;  2YQ0 A;  4UOG A;  4DX8 H;  2ZE2 A;  1R0A B;  1OWX A;  4HAC B;  3QMQ A;  2E9R X;  4GO7 X;  4C8K A;  3HSG A;  4MIW A;  4BS2 A;  1FRH A;  3GE9 A;  1VJQ A;  5F8I A;  2MQP A;  4ED6 A;  2QMW A;  4NLD A;  4OYB A;  2MDA A;  1XMQ J;  1QSY A;  3QT6 A;  3QRQ A;  2ZH2 A;  1WG4 A;  1CJV A;  2I1R A;  2VA3 A;  3MHY A;  4ZVU B;  3HVT B;  3CB4 A;  2IRY A;  4IFY A;  3VGV A;  4DEZ A;  2DHX A;  2Z57 B;  3GCW P;  2C2O B;  1H73 A;  2B9E A;  9ATC B;  1N5Y B;  1QVF R;  1NBE B;  1H0H B;  1P6T A;  4V1A k;  2DNK A;  4YN3 B;  4AE5 A;  3VZI A;  2XC9 A;  2ZH3 A;  2RDI A;  4CZC A;  1WHX A;  4R8U A;  4NCG A;  2PD1 A;  4R8U B;  1RXO B;  2WON A;  2MLX A;  3M30 B;  4FS1 A;  4RW6 A;  2E1P A;  5CYM B;  4LSN A;  1T05 A;  1VQ6 S;  2B7B B;  4JI8 F;  4Y34 A;  3MM5 A;  3IRX B;  3OD2 A;  4ZVF A;  2J7U A;  3V81 B;  2ZZT A;  5E7O B;  1U48 A;  4QIV A;  3F44 A;  2ERR A;  3D0H E;  3EGZ A;  1LW0 A;  1CJK A;  4PPZ A;  4EO8 A;  5D3G B;  2XYH B;  1KFD A;  2CQP A;  2F4F A;  1NDP A;  1D9D A;  3H5X A;  1YBT A;  1U7L A;  2C2D A;  1FRI A;  2NSB A;  3C6T A;  2FJX A;  2PO4 A;  2ZD1 B;  5IM0 B;  5HLF A;  1YJU A;  4WKR A;  1OO0 B;  1NSQ A;  3MD3 A;  4I2P B;  3MAH A;  3D9B A;  1F6T A;  3QO9 B;  2Z56 B;  2YWE A;  2P5V A;  3CIZ A;  1VBK A;  3KLF A;  2OSQ A;  1S79 A;  2KO1 A;  5KOW A;  2M2B A;  3WBZ A;  3MAA B;  2IC3 A;  4H4M B;  1VRT B;  5KAK A;  2R2T A;  5ETK A;  5DLF A;  1DAX A;  1SB6 A;  3MD1 A;  4C11 A;  5IFM A;  3PEH A;  1URR A;  1G7C B;  1RWX B;  2OSR A;  4QZV B;  4Z37 A;  3JSR A;  2ZJQ Q;  1HD0 A;  3Q0A A;  5M2P A;  4LF4 J;  3US5 A;  4Y0F A;  2UXC F;  2ZBC A;  2C28 A;  2DT9 A;  3VAL A;  2U1A A;  3G86 A;  5L1I A;  4LF7 F;  4B3S F;  1YLX A;  2IDL A;  2PEH A;  5HP1 A;  4LF5 F;  3JQK A;  1N6Q A;  2XMJ A;  3BKT A;  3DM2 A;  4DV7 J;  4RNM A;  2CPY A;  2G13 A;  4B9N A;  5LJ5 Y;  2WAQ D;  4KKO A;  3CGI A;  3NMR A;  3DOL A;  1C2P A;  1X8D A;  2W7A A;  3GFZ A;  4IRK A;  1BC6 A;  3VGT A;  4CH1 A;  2A2C A;  4X4R A;  4QCL A;  1K1Q A;  4P2M A;  3FZ2 A;  5FJ4 A;  2HHV A;  4X84 A;  1FNO A;  2Z2Z A;  3NL0 A;  4Q7A A;  4DI6 A;  1PAU B;  4DFP A;  5C24 B;  2W9C A;  1N56 A;  2JX2 A;  3AJ2 A;  3MPY A;  5KFR A;  1Y5N B;  3OTO J;  4DQS A;  1N5V A;  5F3T A;  2IRX A;  3LAK A;  3IGV A;  2UXB J;  3ENQ A;  4OYO A;  3FEY B;  4O0I A;  4DV1 F;  1TL4 A;  1X60 A;  1HWU A;  2MQL A;  4ED7 A;  4Q8E A;  2VBZ A;  3KDO A;  2QO3 A;  4ZK7 M;  1VQP S;  3IFE A;  4JYA F;  2DO0 A;  2JL9 A;  2RIJ A;  3OV7 A;  4XPC A;  2J8S A;  5L9N A;  2L3M A;  2GV1 A;  4DLE A;  1FRX A;  1FX2 A;  4DPW A;  1FCA A;  3JQJ A;  3Q8R B;  1XWL A;  2VJV A;  1OY9 A;  2LLZ A;  5F8L A;  2XS7 A;  5I3P A;  3UNG C;  1SXL A;  2CIM A;  2CG8 A;  2JNJ A;  2DPJ A;  4P10 A;  3DXB A;  1RE1 B;  3UN5 A;  3DLG A;  1K1S A;  4WU3 A;  4NEZ A;  1VHF A;  1X5P A;  3T1A A;  4C98 A;  3I0S A;  3QGP A;  1MMD A;  3AQO A;  1AXQ A;  2GVD A;  3W3S A;  2ZKU A;  3PCO B;  4FVM A;  2W9B A;  5LMN J;  4XDC A;  1X4D A;  4ANC A;  4OL8 A;  1RSC A;  4Q45 A;  4ZCK A;  1XQI A;  5LMN F;  3M8Q A;  3KHG A;  4ZVQ B;  3FCV A;  1S6U A;  2DEJ A;  2HKE A;  3CT9 A;  4E2F B;  4CLK A;  4FXW A;  4DUY F;  2J6S A;  4MKV A;  5HJY A;  2B9X A;  2YWG A;  2X1F A;  4HEA 9;  1SH0 A;  5CYM A;  2VFT A;  4ECT A;  1KOH A;  1VK8 A;  2DH9 A;  1XTZ A;  4ZS6 A;  4TU8 A;  1B70 B;  1J27 A;  1U1M A;  2PA3 A;  1DFD A;  2XWY A;  2VON A;  1O6X A;  2BRL A;  4TNO A;  4NWB A;  3HP6 A;  1G3O A;  3JSM B;  2K3K A;  1WEZ A;  2VPY B;  2ATC B;  2RH3 A;  3VGS A;  3I4H X;  2OGU A;  4MJK A;  2F4V F;  4CQ1 A;  1RLC L;  2AW0 A;  2FVQ A;  4HT5 A;  5IV4 A;  2H65 B;  1TAU A;  4YP3 A;  4KFB A;  4EYH B;  2XZD B;  1TQL A;  3SSQ A;  1RKJ A;  1F3V A;  4DLG A;  2YXL A;  3I32 A;  3IBC B;  3D5M A;  2ZC3 A;  1NRK A;  5F3Z A;  2XLK A;  1S6Q B;  3UDC A;  4DX7 A;  5D4O A;  3L9Z A;  3P5B P;  1JXE A;  3MEG B;  2ASL A;  1JLA B;  1NPR A;  2ZH8 A;  3D3C J;  1RWN B;  4DQI A;  1FI4 A;  2YTC A;  1GMU A;  1SQE A;  5DS7 A;  1ZAW A;  5F41 A;  4OIX A;  4P9S A;  1GMV A;  1X4E A;  2VBY A;  3VTI A;  3D0I E;  1HNV B;  4USK A;  2XBP A;  3A8J A;  3BPD A;  2DB1 A;  2E1M C;  4PAA A;  3MM8 B;  4P7V A;  3RGI A;  3W2W B;  4L76 A;  1IKX B;  2C2K B;  1CBK A;  4V19 J;  4ZA1 A;  4Y65 A;  2DVI A;  4HHU A;  4CI0 B;  3SXL A;  3WHI A;  4J9O A;  1HQ2 A;  4I2Q A;  2C3O A;  3GII A;  4P7T A;  3DLK A;  1S4E A;  3CIM A;  3KTQ A;  4X2B A;  1U1Q A;  4JI8 J;  5H9F K;  4F04 B;  5HQL A;  2B9Y A;  3M2U B;  2M7S A;  9RUB A;  5A8R B;  1T8E A;  1FD2 A;  4ZMM A;  1RHJ B;  2KJV A;  5A8W A;  1I94 F;  2DJW A;  2V0N A;  3KK3 B;  4DWI A;  4NLY A;  5HBM B;  2XM3 A;  3H8Y A;  2YNG B;  4I0W A;  2ALZ A;  2BR0 A;  2X3G A;  4BHQ A;  8AT1 B;  5LXR A;  5KFI A;  1U25 A;  3O8W A;  3VQS A;  2AT1 B;  4F0K A;  1RAI B;  2PDA A;  2XGQ A;  4JV2 A;  2XEX A;  4XDD A;  2GO8 A;  2O1P A;  4H4O B;  4O3P A;  1EP4 B;  4IG0 B;  4LIW A;  5U47 A;  4OZN A;  1Q82 T;  1QAJ A;  3QBC A;  4LVN P;  3NS5 A;  3QIP B;  2SXL A;  2JFK A;  3W7B A;  1MW7 A;  1VDH A;  2DGT A;  3MEC B;  4A8S A;  3KDN A;  3MM7 A;  1DTT A;  2FLO A;  3WX4 A;  2XI3 A;  4B9L A;  2DIU A;  2HLT A;  4KO0 B;  4LF9 J;  1UJ5 A;  3JTO A;  2HGN A;  5IQQ A;  2G0I A;  2V8D A;  4ZJL A;  3CJT A;  3MFH A;  3VAH A;  2E1A A;  4DQQ A;  5M2U A;  1HWL A;  2FLP A;  2MJN A;  4NX9 A;  4S0M A;  3F41 A;  1HFE L;  5BR8 F;  2HBZ B;  2HVH A;  2GGP B;  4OX8 A;  4F3O A;  3QGI A;  1RAO A;  3JSM A;  4AL6 A;  2E29 A;  8ATC B;  4DSF A;  4DF4 A;  1N36 J;  1SCJ B;  1T3O A;  3UFC X;  1HNX J;  5CXT A;  4U7U D;  2MYF A;  2N4C A;  1VI7 A;  1UFW A;  3SCJ E;  2P6T A;  4KBI A;  1AUD A;  4HYK A;  4WII A;  2LEA A;  3L95 X;  1IBM F;  4YQW A;  1T0T V;  4OJ3 A;  1MU2 B;  4A8W A;  1VQY A;  3MEG A;  3PTW A;  4OI3 A;  4C11 B;  1MRO B;  3KUG A;  2BJ8 A;  2CNL B;  3MM6 B;  4JBC A;  3M8Q B;  4O44 B;  1O8B A;  3N9U C;  2NXE A;  3T6J A;  1QM9 A;  5L46 A;  5LMU F;  4DUZ F;  2DGX A;  4TVA B;  4G6V B;  5KT5 A;  3P49 B;  1H7W A;  1UJ6 A;  4UQT A;  4A8Q A;  3PKM A;  1B4S A;  1FWK A;  1QUV A;  4JI6 J;  5KFG A;  3JSY A;  3N6N A;  3ZZY A;  3DLJ A;  2WRM A;  2GA7 A;  3D4J A;  3GYX B;  4C8Z A;  4ZOS A;  1PYT A;  5H1S V;  1HBU B;  2PFD A;  4AL5 A;  4EMD A;  1Y3K A;  4QPT A;  4DV3 F;  2ZNZ A;  2HFU A;  1VMB A;  5B0D A;  2F8E X;  3B8H A;  3UD5 A;  3PV8 A;  2XG8 A;  1X0F A;  4ED0 A;  2LQ9 A;  1Y10 A;  2OHD A;  4OZ3 A;  5KFS A;  4P71 A;  4KFB B;  2VQF J;  3VAF A;  5LMU J;  4X4U A;  1FXD A;  1YZ6 A;  3NRB A;  4RWW A;  3V4M A;  3G8T A;  4DQR A;  2D3O R;  3G71 S;  3W5Y A;  4WZM A;  3R1H A;  2B7C B;  4N41 A;  2ZHO A;  5HSP A;  1LW2 B;  4NYP A;  4YR3 A;  2EKN A;  5A2Q Y;  3CCU S;  3V6D A;  2M3D A;  1IXK A;  1RKI A;  5KFJ A;  4M5G A;  1DLO A;  4KIA A;  4Y2K A;  4KC5 A;  3FMB A;  2QLW A;  1MU2 A;  3CCT A;  3OT9 A;  1ACM B;  4NA3 A;  3R7S B;  3ZNU A;  1RTH B;  3C15 B;  2BAN B;  3LP2 A;  2NUH A;  3N4W A;  4LR7 A;  5AT1 B;  5IT4 A;  4DFM A;  1FJC A;  3OR1 B;  5I3Q A;  3PHT A;  4X4O A;  1S6O A;  2XHC A;  3IWN C;  2GJF A;  2XMW A;  3BQ0 A;  2V2Z A;  1N5Q A;  2MLY A;  2V4J A;  1LWF B;  3DOL B;  3SCL E;  2ZVI A;  2ZE2 B;  3ZNJ 1;  2W4D A;  4M8L A;  4CO4 A;  3KLG A;  1R0A A;  1T11 A;  5LJ3 Y;  2MQN A;  2OAU A;  1KEK A;  1JJ4 A;  3TW0 A;  4WFB Q;  3ZFV A;  1KLM A;  4TY8 B;  1JNZ B;  1RAF B;  1XMQ F;  1KQS R;  2I8E A;  2XY5 A;  5E33 A;  5B09 A;  5F0U A;  2RQM A;  3DRS B;  3FZB A;  3T19 A;  2P6S A;  2ZH1 A;  1R8P A;  2E7W A;  1RT4 A;  3PX4 A;  2R7W A;  4J9U E;  4F3M A;  1UTA A;  2Y0S D;  1VQ9 S;  2AJ1 A;  2DKO B;  4P2X A;  3R5A A;  2W8L A;  4F50 A;  1HHT P;  1I94 J;  4FF4 A;  1EP4 A;  2ZOG A;  4IG0 A;  1VC6 A;  3C3L A;  1LXJ A;  1X4B A;  4UZB A;  1S9G B;  4RW7 B;  5GMD A;  1NME B;  2ASY A;  2J0W A;  1S0O A;  4LF2 A;  5KFQ A;  1R31 A;  3LGH A;  2GVZ B;  2LEP A;  4RUB A;  4DS5 A;  5J2P A;  1WOP A;  2MY7 A;  4F7V A;  1RDR A;  2CQD A;  5J2P B;  2P9E A;  4F67 A;  4UOF A;  2HEK A;  3R1L A;  1FA0 A;  2BOA A;  3FQL A;  3ZTR A;  4DV4 J;  1N6Q B;  2FHM A;  4FZV A;  4FF1 A;  5J1N A;  2J9D A;  3M2U A;  3DGP B;  1LFW A;  3P4U B;  5CYQ A;  4YHH F;  3IO1 A;  3NS6 A;  3UQS A;  1SC3 B;  1LK7 A;  4PG7 A;  4WFZ A;  1K8A T;  1EQ0 A;  2PN6 A;  1WC1 A;  3LO3 A;  3MPU B;  4U8V A;  5D15 A;  3VGU A;  3SQG B;  3FBC A;  4MH8 A;  2F3J A;  4QW8 A;  3QJL A;  3ENA A;  2BYC A;  3MZI A;  5DDO C;  2UXD F;  1RWM B;  2F8M A;  4E8U A;  3L7O A;  3Q22 A;  3J80 Y;  2HMI A;  2E5I A;  3EPG A;  1RTI B;  1UZH A;  4RW8 A;  1JLQ B;  2GC8 A;  2WON B;  3TAM B;  3NNH A;  2CA9 A;  1RA7 A;  1OS5 A;  5EDW A;  1FEE A;  2VHG A;  3T1Y J;  1VQK S;  4LFB J;  2AHO B;  2EXU A;  3FSY A;  3GYN A;  4ZP9 A;  1L5U A;  2XS5 A;  5KFZ A;  3GG1 A;  1N0V C;  4R25 A;  3HFZ B;  2R9L A;  3V4I A;  2M52 A;  2C22 A;  4DS4 A;  2WVB A;  3HVR A;  1XJW B;  1KQK A;  1HNW F;  1Q95 G;  1LWF A;  1TKX B;  1TV6 B;  4ZP7 A;  2XI2 A;  5IT9 U;  2KZZ A;  1H2V Z;  2HBR B;  3M1V A;  3OTC A;  2AIR B;  4AXI A;  4ILR A;  5HO4 A;  3KJV B;  2W8K A;  1SL1 A;  3UDE A;  1SJ1 A;  2GO9 A;  3CJ8 A;  2HVD A;  2DNM A;  4A8Y A;  2H5J B;  2B6A A;  2IAJ B;  2DY1 A;  2CJB A;  2LDY A;  2GIF A;  2QJ3 A;  2ZD1 A;  3ET6 B;  3TOQ A;  4MK9 A;  2RDD A;  1W7W A;  3H5Y A;  4DSE A;  3DRY A;  4QWB A;  5KG3 A;  4YOE A;  2OFG X;  4C0H A;  2YQ1 A;  4IRD A;  7FD1 A;  1AFI A;  3M4X A;  3HLU A;  3ZO7 A;  1RTI A;  3EDQ B;  4RW8 B;  3RRG A;  1LW2 A;  1KHV A;  1SJ3 P;  3HK2 A;  1A6L A;  1ARO P;  1URN A;  3QLH B;  2KH9 A;  4FYX B;  1SL0 A;  4HHJ A;  2AYM A;  1MN9 A;  2OTJ S;  2CPX A;  3OFH A;  3CCS S;  3N6L A;  1GTH A;  1BQX A;  1HBM B;  1IKW A;  1DQ9 A;  1X0P A;  1TP7 A;  3HHL D;  1JLC B;  2AX1 A;  4YDD B;  1SJ4 P;  4IR9 A;  4IUF A;  2CWX A;  3IBF B;  1X9W A;  4K2X A;  1SJQ A;  2EVZ A;  4UZC A;  4Y28 C;  1PGZ A;  4I6Y A;  1REV A;  2LDI A;  3H2L A;  2XSF A;  1KNZ A;  1V9O A;  5C2C A;  3M8R A;  1WOO A;  2XYP B;  2MJU A;  5HL7 Q;  4DCP B;  4RZR A;  3B4M A;  5F8H A;  5KT2 A;  3Q24 A;  1GH8 A;  1SH2 A;  1XR7 A;  2V9K A;  2XLJ A;  3PY8 A;  3TAP A;  4D3G A;  2PGC A;  3CCE S;  2LEB A;  2OLW A;  3BGF A;  2N3L A;  4TYB A;  3T5K A;  2W1B A;  3FSI A;  2YKO A;  2W2Q P;  1OYD A;  1VCT A;  2RKI B;  5CD4 A;  4DV1 J;  1FKP A;  4DV3 J;  4EBE A;  4ILL A;  3ZZP A;  1S7H A;  2IIH A;  4YB1 P;  2CQ0 A;  1GTE A;  3CDU A;  2VG6 B;  2HZC A;  1RUS A;  1NPK A;  4AL7 A;  1S9F A;  2DNG A;  4K4T A;  4X64 F;  2V34 A;  3D7S B;  4LF1 A;  4O4G B;  5HMZ A;  5CAB A;  4WE1 B;  5D6G A;  4NCG B;  1BHN A;  3J7A N;  2KL8 A;  4Q2M A;  5IS2 A;  4ID5 A;  1E6V A;  4OYW A;  5DQI A;  3CC4 S;  3MM9 B;  3M8W A;  5BXI A;  4FS2 A;  1UPP A;  2HGL A;  4AD6 A;  2YNI B;  1IKY A;  2H48 B;  2Y9H A;  4B9T A;  4DV0 F;  2BX6 A;  1GXL A;  1JLF A;  3ITH A;  5SUH A;  5KG4 A;  4EUV A;  5KFC A;  1AA1 B;  1RCO B;  4CIO A;  1RAC B;  4TQS A;  3Q23 A;  1K73 T;  3FFI B;  2YNH B;  3QYY A;  3R5C A;  5CAA A;  3FFI A;  3T5L A;  1DZ5 A;  3D67 A;  3QAE A;  2E44 A;  2DEI A;  1TK0 A;  1FWL A;  4KKO B;  4EBC A;  2AGO A;  4LF4 F;  2UXC J;  3CCJ S;  4UY8 T;  5J2Q A;  4OZ1 A;  5H9E K;  2ADB A;  1DJ0 A;  4WJB A;  1Q8I A;  2QX0 A;  5I4M A;  3KLV A;  4LF6 F;  3PG9 A;  4IOB A;  1D8Z A;  1FDN A;  3QZ7 A;  3EVM A;  3NBP A;  5THW A;  4DV5 J;  4NXN F;  4WF9 Q;  3ELH A;  2F4V J;  2C2N A;  1YWX A;  2UUB F;  1R43 A;  2J76 E;  3GTY X;  4OYZ A;  4O3Q A;  2HK3 A;  2HMI B;  3BKF A;  3P6Y C;  2DY9 A;  1XNR J;  1VQ8 S;  4KTQ A;  2ZWP A;  2EG2 A;  2FLL A;  1NK7 A;  4RO0 A;  4C8N A;  1IBL F;  2R7Q A;  2KI2 A;  1RT2 B;  3IWL A;  1F5C A;  2DXD A;  2KKH A;  4PQU A;  1FFG B;  1S6P A;  1ZS6 A;  4Y3C A;  2HGM A;  1JB0 C;  1P1L A;  1VHI A;  3IXQ A;  2N82 B;  1EJ7 L;  2P9C A;  2JEJ A;  3RR8 A;  5K20 B;  4NA1 A;  1ZZN A;  1TKZ A;  1S0V A;  2IBK A;  3UCU P;  1V3Z A;  3ZZU A;  1PG5 B;  2QN6 B;  4LJM A;  2H5E A;  5LSL A;  2R2U A;  2FPH X;  3OR2 B;  1FKO B;  2HPU A;  5A0Y B;  1REV B;  1N52 B;  5KG2 A;  5AXM A;  4J9R A;  4B3O B;  1H7X A;  1ZA2 B;  3FK4 A;  3O5T B;  4E98 A;  4PZV A;  2XY6 A;  1CJK B;  4X62 F;  3PZP A;  5D3G A;  1S1W B;  3KMQ A;  1WWH A;  4DPT A;  3OFG A;  4UUX A;  4F36 A;  1L3T A;  2QMU B;  2VD3 A;  5T7L B;  2M4M A;  3TQ1 A;  2POK A;  5K5M A;  3L4B C;  3SFG A;  3BYP A;  2DNO A;  2QA2 A;  4OJG A;  2QTW A;  4WTO B;  3J81 Y;  2DIT A;  3K89 A;  2DR8 A;  3K59 A;  2CRL A;  4ZPA A;  3IP0 A;  2IYI A;  3CED A;  4NRU A;  2X1A A;  4DV2 F;  1CEZ A;  1TL7 A;  5E3A A;  3I5A A;  4J37 A;  2XCA A;  1Z2L A;  2DIS A;  4LBP A;  3C8Y A;  4QJV A;  4CO0 A;  4KPY A;  1RAA B;  3BN7 A;  1HNI B;  3A3P B;  2CFX A;  3DOK B;  4HDH A;  2L9D A;  1RT1 A;  2BE7 D;  3V2U C;  2KRR A;  2W25 A;  3NCQ A;  1E6Y B;  3JXO A;  1RHU B;  2HYI B;  1TVR B;  2FZG B;  1E6Y A;  1AZS A;  2D9O A;  4MYT A;  3HX9 A;  1I51 B;  2D74 B;  3SFU A;  2LYV A;  3BGO P;  4F4A A;  4X66 F;  1VQL S;  3PRB A;  4JV0 A;  3CJ2 A;  3M7V A;  3C16 B;  3W9J A;  3DGP A;  1TTH B;  2L9W A;  1PBU A;  3QFH A;  1UCN A;  5CYQ B;  4F0M A;  2E7V A;  1T94 A;  1T3N A;  3R5B A;  1NHV A;  2VB6 A;  3I0S B;  2UV8 A;  3DRP B;  3ZZZ A;  4CLL A;  1NLK L;  1LWX A;  2LU2 A;  2XZW A;  3EPI A;  4QWC A;  2RD5 C;  1YZ7 A;  2H3E B;  1VRU A;  1KTQ A;  2YX4 A;  5F9N A;  1V6H A;  4TU9 A;  4F2R A;  1M5K C;  3CNQ P;  2XS2 A;  3P5T L;  1GAO A;  5IC4 B;  3EIC A;  3FEX B;  3C2P A;  2HIQ A;  5K8M A;  3NGR A;  1RWP B;  3TAM A;  4DV0 J;  2RRA A;  1R8H A;  4TN2 A;  4OYM A;  2PMW A;  3BR8 A;  4G65 A;  2EG1 A;  4Y2A A;  1ZAV A;  3CJQ A;  3H40 A;  1KR4 A;  1MN7 A;  2HS0 A;  1F3F A;  5K9F A;  2ALY B;  4R0J A;  3RAQ A;  2HRT A;  3MGJ A;  2YVS A;  4KPC A;  4P52 A;  1A0O B;  1HPZ A;  1P9Y A;  5CZX A;  2QV6 A;  2R8J A;  1Q8B A;  2AYB A;  2J0X A;  1HWJ A;  1L3U A;  3UR0 A;  1S48 A;  1NDK A;  1KSP A;  1OQ3 A;  4FNH A;  1JLG A;  4K4X A;  2OPP A;  3HDS A;  3DLK B;  1WHV A;  2IM1 A;  3IAS 9;  2HHW A;  2P9G A;  2FY8 A;  1HBU A;  3FRZ A;  5L8R C;  1NSA A;  1S1T B;  1YVF A;  3DOM A;  1C1B B;  2FYX A;  4DV2 J;  4F4W A;  2DR9 A;  3VAK A;  2JH3 A;  3I87 A;  3IS9 A;  2NPF A;  4B3R J;  2AJQ A;  4QWE A;  2HQG A;  3LAN A;  1R27 B;  3ZZR A;  3PO4 A;  3NOC A;  2R8G A;  3NGT A;  3M32 B;  4IH5 A;  3QPI A;  1FXL A;  1RT6 A;  1RT6 B;  3CJS A;  1UWA A;  3RBX A;  3TA1 A;  3GV5 B;  1KFS A;  2BKO A;  1VFJ A;  3D1O A;  2NCK L;  2PC6 A;  3RAM A;  4MIB A;  3R6L B;  1I3O B;  1EKS A;  4NZ6 A;  1WF2 A;  5H9E J;  1TK8 A;  1Q5V A;  2DXE A;  3EM1 A;  4K5R A;  2KDO A;  1PKU A;  4OQJ A;  1RHK B;  4NXN J;  5DM7 Q;  2ABY A;  1UW9 A;  1JLF B;  3ITH B;  5JJB A;  2VOO A;  3HHK A;  2JOQ A;  1HQE A;  1QAY A;  4MYU A;  3ZZT A;  5HMX A;  2CPD A;  5RUB A;  2QEX S;  3ISZ A;  3FCW A;  3KG1 A;  1QUP A;  2OEJ A;  2OPS B;  2NQP A;  4U7U K;  2RDJ A;  3RUB L;  1NB7 A;  4WKY A;  3VZH A;  5HJX A;  1FJE B;  2CZ4 A;  2LMI A;  3Q8Q B;  2LQ5 A;  5KFD A;  1SKS A;  3HFV A;  1QJH A;  4C9D A;  3U1L A;  3PW7 A;  4ELV A;  2WB4 A;  1IKV A;  3GLJ A;  4MIA A;  4LQ9 A;  4WP3 A;  2AJ2 A;  1FJG F;  2UUC F;  4DL7 A;  4GKK J;  5C42 B;  4YFU A;  3AJ1 A;  3RJM B;  4B3S J;  2R7V A;  2W7O A;  2HQ3 A;  2N7Y A;  4XAK A;  5DGA A;  4BDP A;  1HW8 A;  3MTK A;  1UVL A;  3G6X A;  2CVE A;  1UJ4 A;  2MST A;  3EGN A;  4IG3 B;  4C3M A;  3V6K A;  4DL3 A;  2XNR A;  2ZZM A;  3NWR A;  1X5S A;  4NCA A;  1WJ9 A;  2YKN B;  1VC5 A;  1G4C A;  1HI8 A;  3QGG A;  2LQB A;  4LQ3 A;  2ACY A;  7FDR A;  5J2N B;  3HD2 A;  5KG6 A;  4QIG A;  5IXU A;  4X65 J;  4DL5 A;  4X4V A;  3TP2 A;  1NK6 A;  1QTN B;  1ZM9 A;  3G4S S;  3AY0 A;  3I31 A;  4I2Q B;  1UAW A;  2XMU A;  5E3Q A;  2CKW A;  1X5O A;  3GMG A;  2BW7 A;  4M94 A;  1QY7 A;  4OYA A;  4AFF A;  3ONQ A;  3DRR A;  1DBD A;  3FUY A;  4CM0 A;  4WZQ A;  3I4P A;  4ZJQ A;  3OJU A;  3GSI A;  4PQA A;  2VJU A;  3SZ2 A;  1Q86 T;  1GXU A;  4RL1 A;  1CJU A;  1IR2 A;  3HHL A;  1MNE A;  1FO1 A;  4DPO A;  2UVR A;  1IJE B;  3UPF A;  3K2Y A;  1MSW D;  5IV3 A;  5C42 A;  2FHK A;  3LWL A;  3TZY A;  3LF0 A;  5B0A A;  2AV5 A;  1W2B R;  1HNZ F;  3NCP A;  2YKP A;  3T9N A;  4B08 A;  4F3Q A;  4ECS A;  1UA0 A;  1YQH A;  3GPA A;  2JC1 A;  4WIQ A;  3V6J A;  2OJ3 A;  2JFD A;  5F9L A;  2EC2 A;  3OJS A;  3W66 A;  2FC8 A;  2VKZ G;  2B0G A;  5BYS A;  2E1C A;  4HHH A;  3I56 S;  3JSB A;  2OML A;  4EO6 A;  1KQF B;  2VIC A;  4PWD A;  2PEB A;  3GIL A;  5EX0 A;  4JI7 F;  2OPS A;  1S1U B;  3N0V A;  4YB6 A;  2CPH A;  3HSJ A;  4FVC A;  1S7I A;  5DZ7 A;  2OTL S;  4B9M A;  3LUY A;  3W5Z A;  3OR2 A;  2XGP A;  4KAI A;  3DM2 B;  5A6W A;  5FLX U;  3DGV A;  1Q7L B;  2F9D A;  5DGB A;  2IVM A;  1RIS A;  2BKN A;  3QSI A;  4NLV A;  3N28 A;  3WIV A;  2MZT A;  4ZIT A;  3NEK A;  2PI5 A;  3KFW X;  2CG4 A;  1N5T A;  2CPF A;  3K5L A;  2E5G A;  1S49 A;  2H9Z A;  2FJD B;  1F5A A;  2WVF A;  3U02 A;  3RAX A;  2RRB A;  3HSZ A;  2Y8W A;  4A8X A;  1A9N B;  3GJT B;  1B7Y B;  1BWV A;  2KN4 A;  4DR7 J;  4JI0 F;  2DBB A;  3CCW A;  5HN0 A;  1S1X A;  3FRY A;  3IBW A;  4Q43 A;  4I68 A;  1OMS A;  2HQF A;  3H4D A;  4RKU C;  2KHD A;  1U1L A;  3CJ5 A;  5EN1 A;  1R0C B;  1RU1 A;  4OX6 A;  5K8N A;  1XNQ F;  4ENO A;  3D2W A;  4N76 A;  3Q2T C;  1H98 A;  4JV5 J;  1RWK B;  2RB7 A;  2ZNY A;  3ZTS A;  1VS3 A;  5KOX A;  1RT5 B;  3DXS X;  3DI6 B;  2VOD A;  1NDC A;  2I5J B;  4QW9 A;  4K8R A;  3D6H B;  2KM8 C;  3LGN A;  5E3R A;  4CYU B;  1WC4 A;  3POT B;  4N56 A;  2BAB A;  4RW7 A;  2GNK A;  3OFE A;  4NLP A;  2PE8 A;  2A3J A;  4ERD A;  2ZH4 A;  1M1G A;  2IA6 A;  2GQC A;  2V6A A;  3BSC A;  4FP9 A;  3Q8V A;  3KHH A;  2E5H A;  2OH2 A;  3C19 A;  1XBW A;  1TMM A;  3MMA A;  4X65 F;  1X4A A;  2XMV A;  5I42 B;  1M5V C;  4OZL A;  3TUZ C;  1DQA A;  3RBE A;  1RTD A;  3CUL A;  2KXN B;  3NY0 A;  5DLG A;  1PBA A;  2CQ4 A;  3QNW B;  2VKR A;  3IC1 A;  1GEH A;  1N5S A;  3PIO Q;  2V63 A;  3DLE A;  2MKS A;  1SH3 A;  3NBP B;  4KR0 B;  4OFZ A;  4UF4 A;  3OSN A;  3N5F A;  4DX5 A;  1XC9 A;  2AWZ A;  1IR0 A;  3GIR A;  1J5E J;  4H4K C;  2RQK A;  2I38 A;  2Y1L B;  1HW9 A;  1TL3 A;  4HLB A;  5ETS A;  4DXL A;  3OTD A;  4J9K A;  3H0P A;  2DR7 A;  1CQM A;  1HMV B;  3DMJ A;  3TYT A;  2W4P A;  2Z2M A;  1SV5 B;  2OPQ B;  5D77 A;  2DNZ A;  3IMQ J;  4WXW A;  4JI4 F;  2HW3 A;  4WFA Q;  2WVC A;  4Z7Y A;  3VQT A;  5B0C A;  1AZS B;  2YQ3 A;  2FVP A;  1LEO A;  2XHW A;  3OXL A;  3T1H J;  3QAT A;  2H54 B;  1U1P A;  3AT1 B;  3PNI A;  2MZQ A;  1P8G A;  4USM A;  1XN9 A;  5GAE I;  2QA4 S;  2CZV C;  2KB2 A;  3W2V B;  1EAY C;  4J9S A;  3SI8 A;  1T9W A;  3ILI A;  1N8R T;  2E1R A;  2FVR A;  4B9U A;  1G1X A;  1ZM4 A;  4G1P A;  4JUZ A;  5GAH U;  3J7Z T;  3T41 A;  1VQ7 S;  1ZOT A;  2RML A;  2GFF A;  4QR2 A;  5KT3 A;  2AGP A;  2GQQ A;  2JEI A;  2D69 A;  3PW2 A;  4NE9 C;  1D9A A;  2GW8 A;  4B3M J;  5DQH A;  3QLH A;  2GHP A;  3G82 B;  3AD9 C;  5EWE A;  1JJ2 R;  2FGO A;  1IM4 A;  2V69 A;  4H4M A;  2WCX A;  3UCG A;  4LFA F;  4IDK A;  3U27 A;  4L6V 3;  2QIF A;  4ITS A;  4RU2 A;  1U26 A;  3DU5 A;  4LSL B;  3HKZ D;  5G4D A;  1TL1 A;  1C4C A;  3AFG A;  5C5J A;  4J9M A;  3CJ0 A;  3CDA A;  3R5D A;  1T9U A;  1EET A;  2G1D A;  2RNE A;  4N8O A;  3G9C A;  3UI3 A;  1RAJ A;  2YPY A;  4ZLP A;  5KFH A;  4ECX A;  4MKA A;  2CJ9 A;  4OX7 A;  1PJ7 A;  3TEH B;  1SBR A;  2EC0 A;  1TKZ B;  3SSR A;  1SV5 A;  2OPQ A;  4W92 B;  1LW0 B;  1JIH A;  1U0S A;  2YNH A;  2XMA A;  4NLO A;  1DHM A;  2BE2 B;  4LUB A;  4PWU A;  1ZM2 A;  4PAB A;  1HLW A;  2ZBP A;  4ZIV A;  4HH0 A;  1J5O A;  1QSS A;  4OHX A;  3NXZ A;  4USV A;  1YKW A;  3HHN B;  3TZW A;  5KFM A;  4QOT A;  1R6V A;  3T5J A;  5IZH A;  1DTQ A;  1WG1 A;  2HAI A;  3L7P A;  1O51 A;  5IT0 A;  2HRU A;  4QQB A;  2B3T B;  3RZA A;  4DDF A;  3D68 A;  1FEH A;  1QE1 B;  1ZBT A;  2CQ1 A;  2MPU A;  4I69 A;  4ZDN A;  3TR5 A;  4P2S A;  1FJG J;  1T9X A;  3KUE A;  2VQE F;  4I67 A;  4Q44 A;  1M5P C;  3H5S A;  2XTJ P;  1U2C A;  3MMC B;  1FDA A;  3R7B B;  4HH1 A;  3ZC4 A;  4DX6 A;  2MZ1 A;  4F4Y A;  2KT2 A;  4PPD A;  1C0T A;  1BY9 A;  3P45 B;  3UO0 A;  4R5P A;  1VRT A;  4ED1 A;  5K8O A;  4PWD B;  3MEE B;  1EX8 A;  2GCF A;  4TLR A;  1UWB A;  2EBG A;  4U9R A;  1SI9 A;  1HBO A;  4WWS A;  1WG5 A;  1IBC B;  5F0W A;  3W9I A;  1TKX A;  2CNK B;  3G6E S;  3RBD A;  3K58 A;  4CYU A;  1ZM3 A;  1LNQ A;  2GAG C;  3KOA A;  2D3U A;  3AD7 C;  3MCM A;  4CLY A;  2UU9 F;  5A76 A;  5KFO A;  2AQ4 A;  4OI4 A;  2ASD A;  2MZJ A;  2CPI A;  4ZHR A;  2B5J B;  1Q79 A;  5GME A;  5F8N A;  3BBF A;  1F9H A;  2HHT A;  2BV3 A;  1UPM B;  1X5T A;  1CJT A;  2D1C A;  1PCA A;  2VU5 A;  4CLT A;  1OY6 A;  3E01 B;  1TEL A;  4LF9 F;  4QU6 A;  2RVJ A;  2AJF E;  2DH8 A;  1RTD B;  1RZM A;  3I0R A;  1WEL A;  4ECW A;  3MI7 X;  5CQG A;  3KK3 A;  3G6V A;  4M5D B;  1REG X;  4DL4 A;  3HJV A;  2CDR B;  4M5K A;  3MAA A;  3OLB A;  4DR1 F;  4TYA A;  3KLH A;  4X4Q A;  4KV8 B;  4P72 A;  2K7J A;  2WVD A;  4ECV A;  2ADC A;  3C6U B;  3HKW A;  4N77 A;  1NK5 A;  4HT7 A;  2Q79 A;  5FII A;  3J7Z 5;  3H59 A;  2HS4 A;  4NML A;  3WZ0 A;  4EK2 A;  3G87 A;  3OTE A;  3CCL S;  5DRK A;  1N0U A;  1XEZ A;  2OD6 A;  3TI0 A;  2RT3 A;  4I6W A;  3VAJ A;  4AUK A;  4WK3 A;  5D4N A;  1JJC B;  3BYR A;  1T95 A;  1Q5Y A;  2DGQ A;  2M9K A;  2IVY A;  1HBO B;  2FTR A;  2R8K A;  4FF3 A;  4DN9 A;  5IQ6 A;  3BBC A;  2CPJ A;  4LRC A;  2RU3 A;  4Z7C A;  1TV6 A;  4K7Q A;  2EFQ A;  4OI6 A;  3CJK A;  1UA1 A;  2YNF B;  3K5P A;  1RHM B;  2ZEJ A;  3M2V A;  5DZ6 A;  5HAN A;  1NK8 A;  2RHQ B;  5JMN A;  1HA1 A;  3EGV A;  3BS9 A;  2ZH5 A;  1RJJ A;  1CQN A;  2ZHB A;  3VVU A;  3JB9 k;  1FNM A;  3DRS A;  3PYD A;  4DN0 A;  4FXV A;  3PIP Q;  2V4R A;  3GZ7 A;  2A2D A;  3QWP A;  1J5O B;  2CQI A;  4LVO P;  4O4G A;  1N48 A;  2ZWO A;  3TWZ A;  4C3K A;  2J7W A;  2EW9 A;  4OHY A;  4PRF A;  2CJA A;  5I3U A;  5B0F A;  2GQ2 A;  1SUQ A;  2HQI A;  4CRJ A;  5GAD I;  2QC3 A;  3BH6 B;  1YJW S;  1ZZF A;  4LRD A;  5EGY A;  3OL7 A;  1ZH5 A;  3ETM A;  2HHQ A;  4KO0 A;  2R7U A;  2CQG A;  1FHT A;  2C2Z B;  2Y0B B;  1LV5 A;  5L1K A;  2IM2 A;  3MEK A;  2I6W A;  1YRU A;  2RS2 A;  2BAN A;  2V67 A;  3LP2 B;  4OZ2 A;  1I5O B;  2K06 A;  2O67 A;  2YKM B;  4JV1 A;  1H72 C;  1RLD A;  1Y11 A;  2KJW A;  4DSJ A;  1FVQ A;  1TK5 A;  1SKU B;  3TZZ A;  4UUW A;  2OI2 A;  3HHL B;  5KFK A;  4L75 A;  1SIW B;  2E5J A;  1N33 F;  4IQX A;  4AYB D;  3KJQ B;  1K9M T;  4LSZ B;  3G82 A;  4OLP A;  4NZ7 A;  5E41 A;  4FYW B;  4BC7 A;  4LF6 J;  4QWD A;  4GC6 A;  1TKT B;  3GYG A;  1UEU A;  1RK8 A;  2QL5 B;  2VFS A;  2RUS A;  2V50 A;  4F4K A;  1RT4 B;  1HKA A;  4L73 A;  3QWU A;  4L3N A;  4XO0 A;  2PA8 D;  2D3O 1;  5D4P A;  2G2Z A;  4HL9 A;  1JLE A;  3POT A;  4QR0 A;  2QSW A;  4OZ5 A;  5HVH A;  4DHV A;  2KT3 A;  3C66 A;  2I5J A;  1F9F A;  2H51 B;  2RUG A;  3M9N B;  2BJE A;  1NJW A;  1S1U A;  2E7X A;  3M9M B;  4LRA A;  1HNV A;  1Q16 B;  2J0Q D;  1I1G A;  4J9V A;  1RHQ B;  3W8G A;  4M5I A;  4RBV A;  2MKH A;  1H38 A;  4ZPC A;  3M1V B;  4F8R A;  3HJF A;  2MXY A;  1H2T Z;  2YPZ A;  3MED A;  2GJI A;  1B99 A;  3WIU A;  3KK2 A;  4O0N A;  3VCD A;  3MTJ A;  4ELU A;  1NDL A;  4DG1 A;  3BKU A;  2MGZ B;  2UVU A;  1L3S A;  2OPR A;  3M6X A;  2IY5 B;  4URQ U;  2OPR B;  5KFV A;  4XK8 C;  3HVW A;  4CTA B;  4RUH A;  3GQC A;  1XMO F;  3Q8Y A;  2HLU A;  3P3D A;  1WI6 A;  2DGV A;  4YR2 A;  1T9V A;  1QE1 A;  1MWZ A;  3O3L A;  4WFN Q;  1IN0 A;  2ZC4 A;  2CZ9 A;  2J6T A;  2HHX A;  1JWW A;  1JLQ A;  5GAG I;  4C0B A;  4DV5 F;  1QAI A;  1U8S A;  5G0R B;  2VV5 A;  2PII A;  3OL9 A;  4KHR A;  2FLN A;  2Y3Y A;  1CUL A;  3CCM S;  2BMB A;  2IBO A;  1CS4 A;  5HQ8 A;  1F1B B;  1GX6 A;  1WSV A;  3VAM A;  3CW2 C;  3KHR A;  1FNX H;  4G1Q A;  2AJ4 A;  3M8Z A;  3MPD A;  2C3P A;  4I6A A;  3OHB A;  1Y0H A;  1JLG B;  3EJM A;  3G2X A;  1NH7 A;  2UVW A;  1YIJ S;  3CC2 S;  1S59 A;  3M8P A;  1DTT B;  1RBO B;  5LOQ A;  1YIT S;  1UVI A;  4F25 A;  2ZOF A;  2RF2 A;  4DCO B;  1IKX A;  3T9Z A;  2AEJ A;  3B4D A;  2VA2 A;  2FQQ B;  2J9C A;  5GVQ A;  3MR2 A;  5F8G A;  2Y8Y A;  3A12 A;  3CME S;  4WFX A;  4KGZ B;  2V8G A;  2UU9 J;  1VR6 A;  2DD8 S;  3EVO A;  4DPY A;  1NJY A;  3OBI A;  4PXB A;  1HR0 F;  4DV6 J;  1G2E A;  4W90 B;  3J7A 1;  2AP6 A;  2VZ9 A;  3SQO P;  5KFL A;  1HI0 P;  4LT6 A;  1Y7P A;  1IM6 A;  1R0B G;  2ZKT A;  4U96 A;  5CZV A;  3J81 U;  3PAC A;  1HQU A;  2DNY A;  1JLA A;  1S9E A;  1YX2 A;  4NEY A;  3S7R A;  2M5Y A;  2NZ4 A;  2MHN A;  4UOC A;  1UVN A;  4ETZ A;  1WHY A;  1S10 A;  3VAG A;  1N32 J;  3CVK A;  2APO A;  2B8Q A;  2R3V A;  1FRK A;  1KTV A;  3FBE A;  3TX0 A;  3FGV A;  1SUQ B;  4ZVR B;  1D3W A;  4LF8 F;  1SC4 B;  3FSX A;  4EWT A;  1NKB A;  4LF7 J;  4C8M A;  4PXD A;  3ISN C;  1NH8 A;  1AB8 A;  3SEO A;  1FKA F;  3W2W A;  2CWK A;  3MM8 A;  1F9E B;  1RT1 B;  1KQG B;  3KJF B;  4DJB A;  4EZ9 A;  2QFJ A;  3N79 A;  5HAT A;  1R6Y A;  2V4J B;  3T1Y F;  1XR6 A;  1S76 D;  4QU7 A;  2YY3 A;  3BF4 A;  3LAM A;  4QIW D;  2MKI A;  1WC0 A;  1KD1 T;  2AYE A;  5AXL A;  3DHW C;  5K14 B;  2GAH C;  3HCX A;  1FK9 A;  2ZVS A;  2B43 A;  2UUA F;  4KGV B;  1TMJ A;  4WYW A;  1VQ5 S;  5J2Q B;  3IR6 B;  4FYV B;  3BBB A;  4CT9 A;  2FY1 A;  5L1J A;  1JJH A;  2OMO A;  3SSS A;  5E5N A;  5T7L A;  1S6Q A;  3EYZ A;  3CC7 S;  2QA1 A;  1D09 B;  5HRO B;  3EGW B;  4C97 A;  3IWX A;  4RWX A;  2GHW A;  2IJR A;  3N6M A;  1K44 A;  3KUH A;  4G1Q B;  4IKA A;  5D0R A;  2CNO B;  3BO2 A;  1LQ9 A;  2B4U A;  3HHE A;  5ETL A;  1TAQ A;  1BUX A;  3DN9 A;  2BE9 B;  1OIA A;  1SPB P;  1HNI A;  1RAB B;  3EDR B;  2NRE A;  2KYX A;  2DR5 A;  2BUN A;  1D9F A;  2YWF A;  5T14 A;  2FHJ A;  5AJ3 F;  1Q78 A;  2WHO A;  1T9T A;  1SL2 A;  4M5H A;  3RW6 A;  3F56 A;  1R8B A;  2MQQ A;  2E9T A;  4CNY A;  1PJ5 A;  1WEX A;  4K4U A;  1HBN B;  2J9E A;  2MEW A;  4BWJ A;  4DR3 J;  1T03 A;  1Q8L A;  5DG8 A;  4RJV A;  5DET A;  3F73 A;  4C8O A;  3M2V B;  3FKB A;  4JI2 F;  3OTB A;  3QZ8 A;  3FBF A;  2LQ8 A;  1JKH B;  3CJ3 A;  5FDL A;  3KK2 B;  3MPV A;  3OQ2 A;  4UTG A;  4KYZ A;  7AT1 B;  3GR0 A;  2FGC A;  2RQC A;  1BD6 A;  3ZTP A;  1NM2 A;  4K0K J;  5CHC B;  4ZVO B;  3ENW A;  3H25 A;  4KRW A;  1S1X B;  1SC6 A;  1FX4 A;  1KRP A;  3CCQ S;  1PIE A;  4ES3 A;  4HTJ A;  1RT3 B;  1K47 A;  4K4Z A;  1R89 A;  4NAS A;  4K4Y A;  2EFV A;  5JXS A;  2F65 A;  4J90 A;  4DR6 J;  3R5J B;  1KN6 A;  1XR5 A;  4KV8 A;  2W2P P;  4RW4 B;  1NSK L;  2DO4 A;  3MEE A;  4L3K A;  4DFJ A;  1S6P B;  4M5M A;  2DRA A;  1SC1 B;  4DV4 F;  4KY3 A;  4PKD B;  4TLQ A;  3TVK A;  4DZ6 A;  3BN4 A;  1ZPV A;  3SYZ A;  2QL9 B;  2VPZ B;  3K5O A;  4Q5V A;  1T05 B;  2AJ0 A;  2A10 A;  2HWT A;  1PIL A;  2UUA J;  4V19 X;  2PSZ A;  2KG1 A;  4ED2 A;  1R8A A;  2BEF A;  3OVB A;  2VG7 B;  4LIR A;  3CJR A;  1LWC A;  1Y3J A;  4CM2 A;  4IR1 A;  1NCL A;  3IR5 B;  4M5L A;  1HAR A;  4CTA A;  3OVS A;  2MKY A;  4F4X A;  1VC0 A;  5T41 A;  3KLI B;  5C24 A;  1CJV B;  3Q8P B;  2DYA A;  4ZP8 A;  5E3P A;  3DC2 A;  2CJQ A;  3M32 A;  3O1L A;  3PHE A;  1GXT A;  1NUE A;  1ZA1 B;  2IYG A;  5HVF A;  4A46 A;  4GRS A;  3KLF B;  2PI4 A;  2K1R A;  4R5P B;  4HR2 A;  4JI3 J;  1M5H A;  3BV8 A;  3QID A;  5I3U B;  2O01 C;  1JX4 A;  2F1F A;  4M5J A;  3V6H A;  4QWA A;  2HFS A;  1IQT A;  3EZ5 A;  2A1B A;  4ZPB A;  4ECU A;  5GMK a;  3DLH A;  5ETR A;  3N5B A;  4O3S A;  1VRQ C;  3PEJ A;  5KG5 A;  2OPP B;  1N36 F;  1FDB A;  4LBH A;  4AXJ A;  2HNY A;  3K5N A;  4DR3 F;  1X4H A;  4F02 A;  2CJX B;  3DNC A;  4PYD A;  5BR8 J;  1CLF A;  2G2O A;  4GVB A;  5HVG A;  2UUC J;  2DCL A;  1NXI A;  3UNY A;  4ANE A;  5L1L A;  4Q0B B;  3IR7 B;  1GT8 A;  1WHW A;  1ZAX A;  3SDE A;  2QSF A;  2BZ2 A;  2UUT A;  2GS8 A;  2YNF A;  3NGS A;  1U09 A;  4NI2 A;  4WP8 A;  2ZOM A;  3SQG A;  4RNN A;  3RW7 A;  4IOC Q;  1UVJ A;  4NA2 A;  2KFY A;  2BRK A;  3EMT A;  1NAQ A;  4ZIW A;  1GNK A;  2BBE A;  2J9D E;  2K8G A;  3W9H A;  2XCP A;  4NLT A;  2QE5 A;  4YS2 A;  4FF2 A;  3K8W A;  1C4A A;  1EKR A;  3O2I A;  5LT5 A;  3B78 A;  2HVE A;  3NCR A;  4U95 A;  1N5Y A;  4I56 A;  2M8D B;  2AYG A;  2OUG A;  3AOD A;  4GO5 X;  4F26 A;  2VQF F;  5BYQ A;  1WKJ A;  4Y00 A;  5H9F J;  2IRU A;  4LSL A;  5E2Q A;  2AZ1 A;  4EZ6 A;  1JLC A;  3K17 A;  2OEM A;  4Y2I A;  1DAR A;  1IKW B;  2R42 A;  4Y6I A;  4ED3 A;  2JHE A;  1LFP A;  2DCU B;  3TO8 A;  1BLU A;  1H2U X;  3V4I B;  1B0T A;  1R7I A;  3BSA A;  5HK4 A;  5D8H B;  1TVR A;  1HQE B;  3VVT A;  4LR8 A;  1WC3 A;  3M2R B;  2WK4 A;  4FDF A;  3MAQ A;  5EHH A;  2MTL A;  3E3X A;  4WXO A;  2JJ4 D;  2V5H G;  2QLJ B;  4NYO A;  2J7K A;  4OZJ A;  4DUZ J;  1S99 A;  1DTQ B;  1VIX A;  3BRE A;  3T6B A;  4BCA A;  3RB4 A;  2NSC A;  2IPO B;  3IGN A;  1UEK A;  4RX6 A;  3AOB A;  4ZPD A;  4FBU A;  4B3R F;  4NL5 A;  2BOP A;  3KG4 A;  4ED5 A;  3HI9 A;  1MG7 A;  4C2M A;  1VLO A;  2KT5 A;  4IYQ A;  3HVA A;  3CTR A;  3VV2 B;  3L7U A;  4PXC A;  2RKI A;  2IVF B;  3UE2 A;  2IC3 B;  2CQ2 A;  2V68 A;  5F8J A;  2WOM A;  3D66 A;  4P6Q A;  2LKZ A;  1M5O C;  5GAE U;  4Q0B A;  2AZ3 A;  3DMJ B;  3AHP A;  3TZX A;  4TY9 A;  1SJR A;  2N3O A;  1C0U A;  4LRF A;  2NS1 B;  3J81 j;  4NCB A;  3C15 A;  1HD1 A;  1AT1 B;  1H3D A;  4DUT A;  2C2E A;  4ECQ A;  4Q8F A;  3H90 A;  2JC0 A;  2KU7 A;  1N4L A;  3E51 A;  4QYZ J;  4KGM A;  4Y2M A;  2CVI A;  1J2V A;  3KG0 A;  1DLO B;  1RAH B;  3R3T A;  4DPX A;  3MM9 A;  3H2U B;  3PM9 A;  2O3D A;  3HSD A;  3TJ8 A;  1FF2 A;  4USU A;  2K7K A;  1V5I B;  3BH7 B;  1RQ0 A;  4O4R A;  2JDJ A;  3MR7 A;  3BM7 A;  2LCW A;  4IH6 A;  3GCX P;  4ICL B;  1UET A;  1BQM A;  1EAR A;  2FZC B;  3IRX A;  4N5S A;  3ADA C;  1U6B A;  4BBY A;  3BO4 A;  4LBI A;  3NP5 A;  2HWH A;  3I0R B;  1RCX B;  1V5V A;  4I1T A;  2FJB B;  1JXV A;  4OYX A;  3E01 A;  1N88 A;  2ZUA A;  1CJT B;  4D3H A;  1HWK A;  4DZD A;  5ITH A;  4DL2 A;  1W26 A;  5JVH Q;  4RBU A;  3JS9 A;  1LK5 A;  4JI2 J;  5A8K B;  1CPZ A;  3R27 A;  4QIF A;  1IQZ A;  4CO2 A;  3AAW B;  1RT5 A;  2XNQ A;  2HHS A;  1FER A;  2QRR A;  2HZA A;  2R8H A;  1YBA A;  2HFN A;  1CVJ A;  3THP A;  4BC9 A;  3EXY A;  1T7P A;  2DHS A;  3RBZ A;  2ASJ A;  4GMK A;  4RW9 B;  4USI A;  3PJW A;  3OHA A;  4KJI A;  4HI2 A;  4ZCI A;  3CJ4 A;  3I9Z A;  1UFK A;  2EEY A;  3ZTQ A;  1HIY A;  3NWG A;  2EFG A;  2QYG A;  5KFB A;  3R97 A;  2ZM6 J;  2JEF A;  5ETQ A;  4ZCL A;  2KYZ A;  3W64 A;  3MM5 B;  2LXF A;  2LXU A;  3CD0 A;  2KM8 B;  3KNG A;  3A4T A;  4U8Y A;  2HHP A;  4USW A;  3Q2S C;  4H54 A;  3PDN A;  4WYL A;  3JAM Y;  1M0S A;  4J9Q A;  3MMJ A;  3VF0 B;  1DRZ A;  4DR4 F;  2ZM6 F;  4K4W A;  2VG7 A;  4C48 A;  1KVJ A;  2MQ8 A;  4PWW A;  4YB5 A;  2CPE A;  5KFU A;  2FVS A;  4B9V A;  2ZDO A;  3W2V A;  1U1N A;  1FFW B;  3KNA A;  3EZO A;  1SKR A;  1AFJ A;  3NLC A;  3AB2 B;  1SJF A;  2CQC A;  4NOH A;  3ULH A;  1Q7Y T;  2UUB J;  1RWW B;  1RTJ B;  1IR1 A;  2Q66 A;  5HMY A;  5C25 B;  4CWB A;  4BLG A;  8RUC A;  2FUG 9;  3D0G E;  2XWX A;  1WC6 A;  5KFA A;  3W61 A;  5J1P A;  2R7O A;  4CO3 A;  4GC7 A;  3OTO F;  2GIR A;  3JYT A;  1HYS B;  1SQG A;  4RW9 A;  2VPW B;  3NMA A;  2RJZ A;  4A47 A;  3CDE A;  3MM7 B;  1KVK A;  3AH6 A;  2DNP A;  4WK1 A;  3HZG A;  2YKN A;  2XLI A;  1YG0 A;  4B9S A;  3QIP A;  4XTT A;  3AOA A;  5DQG A;  2BQU A;  4TKT A;  1S12 A;  2JWN A;  3DKD A;  1B64 A;  5J1E B;  3FBB A;  1PC5 A;  2HRY A;  4BWM A;  3R9L A;  1K0T A;  3PJ9 A;  3HHL C;  4MFB A;  3SMZ A;  1VQM S;  2DRB A;  1WSR A;  3M05 A;  1RT7 A;  3MPW A;  2Z8Q A;  1JKH A;  1MML A;  1PSD A;  2F7V A;  2F8H A;  3H98 A;  4KSE B;  4Q2L A;  1WKL A;  2Z2L A;  1IWA A;  4WFY A;  3WQP A;  2E5L F;  2MB0 B;  4ZLN A;  4F4Z A;  2IA0 A;  3CO0 P;  1T03 B;  3QT8 A;  5KG7 A;  2EK1 A;  4KHP F;  3I5B A;  4DR2 J;  1OSC A;  2C42 A;  1S5Z A;  3GFX A;  2ILZ A;  3M9O B;  1M1K T;  2OKQ A;  2C1E B;  3AA8 A;  2RS8 A;  5F8M A;  3D1Q A;  3GJS B;  3CF5 Q;  2YKA A;  4KB7 A;  4CLZ A;  5DG9 A;  2W4C A;  2A0F B;  3IM9 A;  4KGX B;  3LPY A;  4RBT A;  5D0E A;  3NNC A;  3MOZ A;  1X4C A;  3K0J A;  1V3R A;  1P27 B;  1RT3 A;  4CLF A;  5EWG A;  1M1H A;  3DLB A;  4LF5 J;  3GU0 A;  5KFY A;  1NPP A;  2K1R B;  4ZPT R;  4ZVT B;  5K8P A;  4RW4 A;  2DH7 A;  1HWI A;  1S9G A;  4CO5 A;  2BQR A;  1FDD A;  1NK9 A;  1Q81 T;  3TQE A;  4ED4 A;  2LP4 A;  3OR1 A;  1B0V A;  3NAH A;  3OL6 A;  1IWG A;  4AND A;  4X64 J;  3TA0 A;  3UW1 A;  2J6U A;  2QYC A;  2D3Z A;  3VHQ A;  4X62 J;  3PRV A;  2B8P A;  4PG4 A;  3OUY B;  1S1V A;  3THT A;  3A8K A;  2AX0 A;  5K14 A;  1NHK L;  2ZBQ A;  4WCE Q;  1VJW A;  1SKW A;  4HKQ A;  3FMW A;  2K2P A;  4YB7 A;  2WSC C;  3DDK A;  2LEC A;  1IBK F;  3R5G A;  3DFE A;  2OEK A;  4URS A;  1NEE A;  5FDL B;  3SCI E;  2UXB F;  2KG0 A;  2E66 A;  2DR6 A;  4IFV B;  3MMA B;  2VG6 A;  1U24 A;  4N47 A;  3Q8U A;  3I96 A;  4MT1 A;  3KKF A;  2HVI A;  4IRC A;  4DR1 J;  2W7P A;  1WUU A;  3CCZ A;  4YEA A;  2HUR A;  3LW5 C;  1YJT A;  3D54 A;  2ZJR Q;  1Q8K A;  1IBL J;  2PFF B;  1UKU A;  2MZS A;  3ENV A;  4AQY J;  2GZO A;  4J9P A;  4LFA J;  1GMW A;  1FD8 A;  2Q6C A;  2V8V A;  4ZPV R;  1M90 T;  2FJW A;  3M6W A;  2NXC A;  5HMW A;  4YME A;  4ED8 A;  2FJE B;  2AEM A;  2MHE A;  2U2F A;  5SZT A;  2GVZ A;  1NJZ A;  1RYS A;  1WAC A;  4NMX A;  4CO1 A;  1EZZ B;  4ILM A;  2ILY A;  3PYE A;  3S1T A;  3CD7 A;  3W62 A;  1KLN A;  2XUL A;  3S6E A;  4LF8 J;  3CUN A;  1JLB A;  1ZPW X;  3CO9 A;  2LQJ A;  2LXI A;  4IH7 A;  3VAI A;  2BJ7 A;  4DR2 F;  2M70 A;  5GAD U;  2H1Y A;  3DOM B;  3ICL A;  2G0J A;  3FEZ A;  1IKV B;  3SDE B;  2B4P A;  2E5L J;  2DGW A;  4FXD A;  3DRP A;  2V9W A;  3OLA A;  1A7G E;  3TRG A;  4JI3 F;  2HFV A;  1VIO A;  2H4Y B;  2UUW A;  4WP9 A;  2AU0 A;  4JI4 J;  1LKZ A;  2O66 A;  3IA0 A;  3LTO A;  5KT7 A;  1FES A;  2YH1 A;  1HI1 A;  2WTF A;  1KHW A;  1CC7 A;  1PYO B;  1RA6 A;  3TEG A;  1S9E B;  2KXH A;  3BSN A;  1ITP A;  4DPU A;  5E3C A;  3DOK A;  1JNR B;  3CD5 A;  4RNH A;  5KFE A;  3FVY A;  1WC5 A;  3HM9 A;  5EWF A;  2FVC A;  3IG1 A;  5AXK A;  3RG6 A;  3SBM A;  3TJ9 A;  2W9A A;  2AMC B;  4A4J A;  2ZH7 A;  2YWW A;  3OUY A;  4NZ0 A;  2HND A;  1UL3 A;  1F60 B;  4LRB A;  4J9N A;  1S0M A;  1G6B A;  4CT8 A;  2WW8 A;  5KFW A;  5ETV A;  1YHQ S;  4K59 A;  4LR9 A;  4O3R A;  1LWC B;  2C3Y A;  1JLB B;  3FQK A;  3S01 A;  4UQG A;  3SV3 A;  1LXN A;  4PG8 A;  5LL6 d;  2OP5 A;  3OL8 A;  1Q53 A;  3ZXW A;  4OI0 A;  3BB5 A;  3JTN A;  2BDP A;  4DR4 J;  1VQS A;  2MLZ A;  3J7Y U;  1KS2 A;  3GIK A;  1UVK A;  3HUL A;  2CYY A;  2HBY B;  2VFU A;  3KJN B;  1ZTT A;  1GFW B;  5BYR A;  4B3T J;  3PYF A;  4C8L A;  4OHZ A;  3QJJ A;  2L08 A;  4I7F A;  2NZC A;  2FIU A;  4YDX A;  2Y1R I;  4OI1 A;  4QBU A;  1F2H A;  4G3I A;  4K2J A;  3DDI A;  5KFP A;  4NLU A;  3CWJ A;  4EFA C;  4OHW A;  3PFO A;  4UW2 A;  2W24 A;  3MFI A;  3NG8 A;  3TAN A;  2GIQ A;  4WPA A;  1WNE A;  1TUW A;  1CS4 B;  3GON A;  5LSR A;  4ZVS B;  3RU0 A;  3A13 A;  5KG0 A;  3C14 A;  1S57 A;  4ZVE A;  3HD1 A;  1KC8 T;  3BDP A;  5DDP C;  4RU9 A;  2BQ3 A;  3MUM P;  3X1L B;  3PW5 A;  3IS9 B;  5IWA F;  2IJF A;  2M8H A;  2Z4P A;  4IO1 A;  4B3O A;  4DR5 J;  5IM0 A;  2RAQ A;  3BZQ A;  2W9C B;  3SIP B;  4DG1 B;  2KXF A;  2C2R A;  4JI7 J;  4FBT A;  4W4M A;  1VLY A;  2BJ9 A;  2GMJ A;  5B7W A;  5C7P A;  5CCL A;  1B7F A;  4MTP A;  3V5R A;  5B08 A;  2ZHA A;  1TU0 B;  4J7C A;  5JVG Q;  3PW4 A;  2IFX A;  1MWY A;  2HG4 A;  4A48 A;  3I9V 9;  5C25 A;  1Y00 A;  4TQR A;  4TU7 A;  1JQG A;  2R2S A;  1YJ9 S;  3BR9 A;  3GIJ A;  2E9Z A;  1KWM A;  2YNI A;  4QPX A;  3EE3 A;  4LSN B;  4OX9 F;  2R8I A;  1V3S A;  2B9W A;  4RW6 B;  2Y1J A;  1HNZ J;  1JLE B;  4OLO A;  3AA9 A;  1TFW A;  1IJF B;  1YTY A;  3OPK A;  3HXM A;  2FJA B;  3ZZ0 A;  4EI2 A;  3MR5 A;  3JTP A;  1U49 A;  1EIY B;  3E2E A;  4C3L A;  3G8S A;  1KON A;  3MMB A;  3DLL Q;  1KBR A;  4JOU A;  2GMH A;  2HSE B;  1MMN A;  4AT1 B;  1FK9 B;  1Q4R A;  2XMT A;  3VR1 A;  3PW0 A;  1VQ4 S;  1RT7 B;  2WVE A;  1QVG R;  4UT4 A;  3R2D J;  1S1W A;  2QL7 B;  3W8P A;  4O3O A;  1IBM J;  1N32 F;  2DGS A;  1IUJ A;  2V4Q A;  1LWE A;  2HK2 A;  1N34 F;  2YNG A;  4O23 A;  3G6Y A;  1PO6 A;  2M88 A;  4JI1 J;  4PR6 A;  2BJD A;  3D6T B;  1VK3 A;  2C2M B;  2HBQ B;  1BXN A;  5A8K A;  3TAQ A;  1ROF A;  2VBW A;  3CE8 A;  1AUS L;  3SCK E;  2XO7 A;  1TL1 B;  4JI5 J;  2HWI A;  2QG9 B;  2V94 A;  4JI0 J;  6FD1 A;  3M6U A;  2V2K A;  2VL1 A;  3L09 A;  1O0P A;  4MKB A;  5J2N A;  1T9Y A;  4PG6 A;  4NXM F;  4GKK F;  4R0E A;  1WI8 A;  4M5N A;  1NHU A;  4C6A A;  4J91 A;  1L3K A;  3F0N A;  4OV6 A;  5JUM A;  1U4B A;  1KOO A;  2EWH A;  3WC0 A;  4B17 A;  4KE5 A;  4DR5 F;  1NND A;  3W65 A;  2BXJ A;  3R6G B;  1WOR A;  3RB3 A;  1Q0N A;  2UP1 A;  1NSP A;  2KVI A; 
#chains in the Genus database with same CATH homology
 3D3C J;  1XNQ J;  4NXM J;  3J80 U;  4DV0 J;  4DV3 J;  4DV1 J;  4DR4 J;  1XMO J;  4LF6 J;  5AJ3 J;  5FLX U;  4B3T J;  4DR2 J;  4HHU A;  4LF4 J;  2MTL A;  1HR0 J;  5IWA J;  4JI8 J;  3J7A N;  2KL8 A;  4DUZ J;  1FJG J;  4DV7 J;  4DR3 J;  2MEW A;  4RJV A;  4DV2 J;  1I94 J;  4B3R J;  4LF5 J;  3W1Y C;  4KYZ A;  4DUY J;  4K0K J;  4JV5 J;  4OX9 J;  4X64 J;  3D3B J;  2UXC J;  4YY3 J;  2UXD J;  4X62 J;  4DR5 J;  3OTO J;  4DV4 J;  2UXB J;  4JI7 J;  4DV5 J;  4LFC J;  1IBK J;  4LF9 J;  2F4V J;  4DR6 J;  4NXN J;  4KY3 A;  1XNR J;  4DR1 J;  1N36 J;  1HNZ J;  4LFB J;  2UUA J;  1HNX J;  1IBL J;  4AQY J;  4LFA J;  4X66 J;  4JI2 J;  3T1Y J;  4NEZ A;  4JYA J;  1J5E J;  4YHH J;  2VQE J;  4GKK J;  5LM7 E;  5LMN J;  4B3S J;  3R2D J;  5IT9 U;  2UU9 J;  4LF8 J;  2KVQ E;  1IBM J;  2ZM6 J;  3IMQ J;  4DV6 J;  1XMQ J;  4JI3 J;  4KHP J;  4JI6 J;  3J81 U;  4JI1 J;  2E5L J;  4NEY A;  3T1H J;  1N33 J;  4V1A k;  1N34 J;  4JI5 J;  4JI4 J;  4JI0 J;  1N32 J;  4X65 J;  3JAM U;  2MQ8 A;  4PWW A;  5BR8 J;  2VQF J;  5LMU J;  4DR7 J;  2UUC J;  1HNW J;  4LF7 J;  4B3M J;  2UUB J;  2HHH J;  5A2Q U;  3R2C J;  4GKJ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...