3D2WA

Crystal structure of mouse tdp-43 rrm2 domain in complex with dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
b'GSKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAR DNA-binding protein 43
publication title Structural insights into TDP-43 in nucleic-acid binding and domain interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna/rna binding protein
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d2wA00
3UCZP 1ZZFA 1K9MT 5DDOC 5IM0A 3SMZA 3CUNA 2CQBA 2CPHA 1H2VZ 1U1PA 3VAJA 2ADBA 1YJWS 2M8HA 3UCUP 2E5IA 1JMTA 2LEAA 5IQQA 2O3DA 3MD3A 4WKRA 2DNKA 3IWNC 3CC4S 3MUVP 1JJHA 1Q82T 1PO6A 1M1KT 1WG4A 1A9NB 2MSSA 2YWKA 3EGNA 2CPIA 2AD9A 2VOOA 1VQMS 2JRSA 2RRAA 1XN9A 4CH1A 5CXTA 1N88A 5GMKa 2CQ3A 2MJUA 3U1LA 3D2WA 3CPWR 2DGTA 2OJ3A 3VF0B 4U67Q 1U1MA 3L3CA 1WTBA 2M7SA 2XS5A 2M0GB 2KU7A 2MZJA 4YUDA 4C4WA 2LA6A 3UCGA 3BEGB 3I56S 5CA5A 1KOOA 4LJMA 1X4BA 2K3KA 2RU3A 2LECA 1JJ2R 2MB0B 2MKJA 2CQHA 3NNCA 1S79A 4ED5A 2BOPA 1Q81T 2SXLA 2N3LA 1R8PA 4TLQA 4YB1P 1U1KA 3CCJS 1FJ7A 2DNPA 2DHXA 1WF1A 2DIVA 3VAHA 2G4BA 3CCES 2DH9A 1HD1A 4PRFA 2KT5A 1H6KX 1X5OA 2VOPA 1NO8A 3G96A 3CCLS 5JVHQ 3N9UC 2UP1A 2OTJS 4OZ1A 1VQLS 1VQNS 2M8DB 2HGLA 2CQPA 1WHXA 2E5HA 2LYVA 4W92B 1O0PA 3SDEA 2LA4A 2RQCA 1YJ9S 2E5GA 2CPFA 2L08A 5GVQA 3CCUS 4PR6A 1WHVA 5DDRC 2HGNA 3J7ZT 2XS2A 1DRZA 2DNNA 1U1NA 2YTCA 4WFBQ 5DM7Q 2RVJA 4CIOA 4LMZA 1D8ZA 5LSLA 1K73T 2CQCA 4EGLA 3VAMA 1SJ3P 3MDFA 2FC8A 3US5A 1NU4A 1FJCA 2HZCA 3S7RA 2AYEA 1Q7YT 4IOCQ 1WEXA 1OIAA 1OPIA 3CCQS 2YKAA 4IUFA 2OSQA 3VALA 2CQ1A 1YHQS 3MOJB 2DH7A 2GHPA 4IO9Q 2DNQA 3G8TA 4FXVA 2DITA 4V19X 2ZJRQ 4UQTA 1L3KA 5DETA 4UY8T 1M5KC 2LQ5A 2KM8B 2AYGA 2XNQA 1U1QA 3VAGA 2DNLA 2CQ2A 1M90T 2LXUA 1U2FA 1P27B 2NZ4A 1B7FA 2MKKA 5LSOA 1FNXH 3CMES 1X4DA 2DGOA 2YH0A 4Y00A 4CH0S 2X1AA 2VONA 1X4EA 1DHMA 3VAIA 4FXWA 3RW6A 2M52A 1FXLA 1YIJS 3NS5A 2DNYA 3CTRA 1M5OC 3NS6A 1VC0A 2DGSA 1WHYA 4LIRA 2LCWA 2MZ1A 3Q2SC 1VQKS 4P6QA 5JVGQ 2DNOA 1X5SA 2DIUA 1KOHA 2GO9A 5BJRA 2CQDA 5LJ5Y 2CJKA 2LKZA 2QFJA 1KC8T 2XS7A 5GAHU 1X4GA 2RS8A 5CYJA 2MPUA 2DHSA 3R27A 4WFNQ 1OO0B 2DK2A 1DBDA 2QA4S 2J0SD 2LMIA 4F26A 3CD6S 3TYTA 2MKCA 2MZTA 5GADU 2OIHA 3H2VE 2DHAA 4M5DB 3Q2TC 2MYFA 3SXLA 1P1TA 4QQBA 2MZQA 2LEBA 1FO1A 1JJ4A 3P49B 2MJNA 3FEXB 1WI6A 2U2FA 4ZKAA 2MKHA 2M2BA 2D9PA 2VODA 4Y0FA 2XNRA 2MQOA 1N8RT 1IQTA 1A7GE 2MZSA 1ZZNA 1VC6A 5IFMA 5EN1A 3B4MA 5HO4A 2RT3A 3MI7X 4WCEQ 1WF2A 1YITS 3THPA 3BS9A 1SJ4P 1WG1A 1H2TZ 1X5PA 3J7YU 1M5PC 1WHWA 2I2YA 2ZJQQ 3NMRA 2DO4A 3VAFA 2QEXS 2DB1A 3TP2A 1N52B 5DDQC 3G4SS 3CC2S 2A3JA 3BO2A 2ADCA 5LJ3Y 3S8SA 4QU7A 1X4AA 2MGZB 4RU2A 3THTA 2X1GA 2B0GA 4QU6A 1WEZA 2MQLA 5LXYA 3TO8A 2YH1A 3EGZA 1SJQA 3MXHP 2DISA 1NJIT 2CPJA 2KYXA 1RKJA 1SJFA 2KN4A 1VQOS 1YJNS 3NNAA 4WFAQ 1W2BR 3RW7A 2OTLS 2RNEA 3U1MA 1ZH5A 2F9JA 2LXIA 5GAGU 1U6BA 2BZ2A 1VC5A 3HHNB 2RUGA 3CCVS 4QPTA 2DNRA 3CCMS 4F02A 2MHNA 1U1LA 1KQSR 2J0QD 2OSRA 3OW2R 2Q79A 3CCSS 2XB2D 2DGVA 2WBRA 2ERRA 3BO3A 4YOEA 3K0JA 3B4DA 3MD1A 2CPZA 2MY7A 1PGZA 1U6FA 2G0CA 4C0OC 3S01A 4J5OA 5DDPC 1CVJA 2D3OR 1WG5A 4WIIA 1URNA 2MSTA 2KRRA 1H2UX 3G9CA 2DNZA 1VQ5S 3UD3P 5HL7Q 2DGWA 1X4CA 2DO0A 1HD0A 2DGUA 3MUTP 3CCRS 2MKIA 4BS2A 1VBXA 1VQ8S 2E5JA 1VQ6S 1R8HA 3LQVA 4CQ1A 2DNHA 3CMAS 2J76E 2CPDA 3ZZZA 1FHTA 4ERDA 1YTYA 1SXLA 2M88A 4A8XA 2KRBA 3JB9k 2MQQA 1UP1A 1X0FA 3ZZYA 2KVIA 1VBYA 5IM0B 3MUMP 2XSFA 2CQ0A 2MQMA 3PIPQ 3P3DA 4W90B 3R1LA 3LPYA 1WELA 2F9DA 5LXRA 2JVOA 1UAWA 2FHOB 2CQIA 3PIOQ 1Q86T 2RS2A 3NNHA 5GAEU 2CQ4A 2JWNA 1YWXA 2KXNB 2FY1A 2CPXA 4IOAQ 3G8SA 2M4MA 4C7QA 3EX7B 1VBZA 3UD4P 1VQ4S 3P6YC 5D77A 2KXFA 2EK6A 3DXBA 2G1DA 1HA1A 1U1RA 2N7CA 2X1BA 2NLWA 1G2EA 2N3OA 2MY8A 1RK8A 2DGQA 2MGZA 2FPHX 4OZ0A 1SJRA 3IRWP 1HL6A 3S6EA 2MZRA 2DH8A 2CQGA 2KHCA 5DM6Q 5FJ4A 1X5TA 3MURP 3HI9A 2X1FA 2MQPA 2PE8A 1OWXA 3CF5Q 1AUDA 5MLCV 2HGMA 1U1OA 2CPYA 2MMYA 1DZ5A 4TU7A 1WWHA 2KFYA 2U1AA 3P5TL 1VQ7S 2AYBA 2EVZA 1VQPS 2L41A 4PKDB 3UWTA 1X4HA 2V94A 2M9KA 2KG0A 3H2UB 2I38A 2KM8C 1X4FA 3ULHA 2KH9A 1S72S 2K8GA 2JX2A 2DNMA 2EK1A 2FC9A 1FJEB 2M70A 1FT8A 2KXHA 2L9WA 1WEYA 2DHGA 3R1HA 2DNGA 1K8AT 4F25A 4TU9A 1N54B 2RQ4A 3FEYB 2AYMA 1M5VC 2ZJPQ 2HYIB 2CPEA 1QM9A 1D9AA 2PEHA 1YI2S 3SDEB 2N82B 2RRBA 1UFWA 3V4MA 4Z2XA 1KD1T 2J8AA 1UW4A 2HVZA 3BO4A 1QVGR 3G71S 2MKSA 5D78A 3DLLQ 1BY9A 2F3JA 2KI2A 5ITHA 1WF0A 3I55S 3VAKA 1VQ9S 3CULA 3CC7S 4WF9Q 1WI8A 2E44A 2JVRA 2DGXA 3UE2A 1QVFR 2MXYA 5H1SV 2KG1A 2D9OA 4TU8A 1F9FA 3CXCR 2MQNA 3G6ES
chains in the Genus database with same CATH superfamily
4I2QB 4JV0A 3BN7A 2BKNA 2K1RA 5HANA 3BKFA 1P8GA 2K7KA 4IH6A 1U1PA 1ITPA 4UQGA 2GW8A 3AD9C 1WG4A 3RJMB 2JRSA 3IRXB 5HAOA 4K2JA 3OXLA 4DV0F 4LSZB 2F7VA 1EIYB 4LRFA 1IN0A 1S9GA 2IPOB 1OSDA 4QR1A 2R8JA 5K14A 1U09A 2N3LA 4KTQA 4DZ6A 1RCXB 4WIQA 1RKIA 3NWGA 3BQ1A 5CD4A 2KJWA 3BZQA 5IC4B 2V69A 4FYYB 4OZ3A 3K5OA 2HLUA 3DMJA 4ZVEA 1D8ZA 2VDIA 4UY85 3M8PB 4LF5F 4NLXA 2GVZB 3SEOA 2DR8A 2WSCC 1TK8A 4ZVFA 5D15A 1B0VA 2BYCA 2V8GA 3D3BJ 1BMQB 4HEA9 2HBZB 1Q8BA 1HQUB 2EI5A 4PCQA 4AXJA 3BYRA 4KBIA 1Y11A 2H48B 3KJQB 3T5LA 4ZN1A 3CMES 2ZE2B 4J9KA 4KH0B 4RX6A 3OL8A 1YIJS 3GFZA 5IT9U 4F8RA 2VFUA 2YNFB 3EJMA 2ZH4A 1IBLF 1VQKS 4JI2F 4ZPBA 2HQ3A 2L3MA 1KC8T 4IR9A 3ILOA 5HBMB 1N6QB 3CDBA 3ZTRA 4NLQA 4ZIVA 1HARA 3Q8RB 2MKYA 3KDNA 1WD6A 4M5DB 1KQGB 2Z30B 1NK9A 3GR1A 3FEXB 3EZ5A 4NCBA 4M5HA 5LT5A 4DJBA 5GADI 4WXOA 3PRDA 2Y8YA 4LSLB 4Y0FA 1QTNB 5HQMA 1DQ9A 4HR2A 4USVA 4ZJLA 3MM5B 3RRKA 4AL5A 1ZZNA 1VC6A 4X4UA 2FHKA 1DTTB 3HXMA 3GZ7A 4WYLA 1S5ZA 4HYKA 5DG7A 3IBCB 3I32A 2V4JA 1RT7B 4NLWA 3SQOP 3AHPA 4DR2F 1X4AA 2Y1JA 1NJWA 1WEZA 4NRTA 1PBAA 3MM9B 5KG5A 2CWKA 2WHOA 3A8IA 2VDHA 1XK8A 4YB6A 3L4BC 3VV2B 4ANCA 2HHUA 3Q8VA 4P74A 4KGMA 5A0YB 2IJNA 2DGVA 4ZPTR 5KFUA 5F8JA 1SPBP 2B56A 4X64J 4DL0C 3JYTA 2FHMA 4X66F 1R0AA 3D9BA 4BS2A 4TQSA 5LM7E 3A3PB 1SC4B 4RUHA 5A8WA 2JL9A 1W7WA 4A8XA 1TKXA 2LVWA 3UVJA 2CZ4A 4B3MF 3PYFA 4URGA 4J91A 3MUMP 2R2RA 1D9DA 4ZP6A 3TNVA 4Q8FA 5JMNA 1ZS6A 1VK3A 3TZYA 5IXUA 1PJ6A 1RTIA 3NNHA 1RE1B 3EZUA 1RTJB 1O51A 2Y1LB 4P73A 4UUWA 2I9SA 2NLWA 2F8MA 2DGQA 1SJRA 1LK7A 3GIIA 3CIZA 4PEOA 2MQPA 2AU0A 1T9UA 3CF5Q 4JI3F 1U1OA 1QY7A 2NSCA 4UOGA 3OTOF 2BMBA 4R8UA 3H7HB 1EKRA 2KXHA 2Q6CA 5JJBA 3IAM9 4P2SA 4DMZA 3M8QA 1FI4A 2JJ4D 4LRAA 2LEPA 4Z37A 4OYIA 1L3TA 2DR6A 2W4DA 3G71S 4PXDA 1TAUA 5ITHA 1NSQA 2JVRA 2EKNA 2DY9A 2WVBA 1YRXA 2H5EA 4A47A 3NOCA 2XHCA 1HWIA 2CPHA 2HHVA 1M0SA 2A6OA 3CC4S 1IUJA 1F5CA 3JSBA 4DR3F 5F0UA 1SVDA 4ZJQA 3OT9A 1V3RA 3D2WA 3VF0B 3PJ9A 1EB0A 4UTGA 1W2IA 3DRSB 2Q66A 4KV8A 1SL2A 4AL7A 1HNVA 1K1SA 1DLOB 1JLBA 1JLEA 4ZPDA 1X4BA 3UDEA 2LECA 4H4MA 4MIBA 4YN3B 3PDNA 4IRCA 4OMFG 1ICEB 3EMTA 1NSAA 2P9EA 4TLQA 5B0GA 1A0OB 2DBBA 2NXEA 1HD1A 5KFDA 3W5XA 2KDOA 2QA2A 5IV3A 1X5OA 3E8OA 2CQPA 1Z1ZA 3I5CA 4DN9A 3K2YA 4JI2J 2ZKUA 2UXDJ 4RLEA 3W9JA 4IR1A 2W9CB 4LMZA 4OI4A 2RB7A 3GWCA 5HK4A 1U47A 2CDRB 2VPWB 4KR0B 4EGLA 1EP4A 2GGPB 3KFWX 4DG1A 1TL7A 3OBIA 1U0SA 2QL5B 2R2TA 1S9EB 3NBPB 4NRUA 3N0VA 2DR9A 2VJUA 2BBEA 2C2DA 5KFVA 1TV6A 4NLSA 3P45B 3TAMA 3LGMA 1KVJA 5GAGI 5T41A 2LXUA 1UZHA 3MR2A 1AUSL 1X4DA 4N41A 3CJ8A 1IKXA 4BWJA 4DR2J 4CWBA 4KHPF 1FDDA 1UPMB 1QAIA 1LWCA 4P6QA 5JVGQ 1PYTA 1CSJA 1B70B 5SUHA 1FRMA 5GAHU 4BWMA 2BJ9A 2ZVSA 4CLUA 5HQLA 3CJ0A 2IVYA 5FIIA 1T7PA 4W4MA 3KLHA 4X4TA 4LF4J 4RNNA 5GMEA 3KLGB 1HQEB 4J9VA 4EWTA 1G6BA 2QA1A 3THVA 3WX8A 3IG1A 1FCAA 2E7WA 1F9EB 2HPUA 4X66J 5KFRA 3UNGC 4JI0J 5AE1A 3DOLA 4ED1A 4B02A 4DV7F 5LOQA 2OPPB 3MI7X 3V6JA 4LBPA 3GCXP 4ZA1A 3QGGA 4HVZA 1YJVA 2WCXA 3K5LA 2OLWA 1HWLA 3CC2S 2XMVA 4DV1F 2CXEA 1KDNA 4QU7A 3R5BA 2YNGB 5LMNF 3FQKA 3EGZA 2DISA 4ZOSA 1T11A 3TRGA 4WFAQ 5F9LA 1FXDA 2HQGA 1QTMA 2GVDA 2W9AA 1ZH5A 5I3UA 1N32F 3C8YA 4RUAA 4K4ZA 2DNRA 3VR1A 4WFZA 2B9EA 4PG5A 2MTLA 5DQGA 2CIMA 1HHSA 4V1Ak 4Q43A 1PC5A 1HBUB 1N5VA 1WG5A 4JI3J 2RH3A 2UV8A 2EC0A 4IFVA 2B5JB 2R7QA 1RWUA 1KTQA 2AJ4A 4N77A 2AW0A 3T3FA 2F5GA 1AFIA 3JQJA 1JX4A 2VFSA 2UUBF 1SL0A 5EGYA 1SKWA 1LFPA 5BYSA 1RHRB 4KSEB 3FUYA 1S1VB 1TAQA 4CTAB 2AHOB 4C6AA 2F9DA 3NGUA 4G65A 2X3GA 2YQ0A 4JYAF 3KHLA 1F0XA 3UD4P 3EE3A 4XPCA 2AX1A 3P6YC 1WJ9A 3KG1A 2MGZA 3B78A 3QYYA 4RU9A 2KHCA 3HZGA 1J5OA 1KEKA 1T0TV 1RA7A 2KG0A 2ZH6A 3EYZA 3MM6B 2JLGA 1KR4A 1Q7LB 1P6TA 5L1KA 2B4VA 2VA3A 4FS2A 4B9SA 2ZD1B 3LWLA 4TY8B 5KOWA 2PEHA 2O5DA 4Z2XA 3V4MA 4EU0A 3DYAA 4QJVA 2BABA 2PI4A 3VAKA 4WF9Q 3T5HA 2NXNA 2VG5A 3AY0A 2XYPB 1R6YA 4KRWA 1CJKA 5A6WA 3UCZP 2AT1B 4R0JA 3Q8QB 2BKOA 2GQQA 5IQQA 4WKRA 5DRKA 3MUVP 3HK2A 2XO7A 2H9ZA 2YWKA 4A8OA 3VHQA 2BVZA 2ROEA 4F4ZA 1WC5A 3VGVA 1EZZB 3NAIA 2XSJA 4A8QA 3W2VB 3DRYA 2HHSA 3L3CA 2HAIA 2M0GB 5C2CA 3J80Y 5F3TA 2WVFA 4O44A 4OX6A 1HKAA 1XQIA 5KG2A 4ZCMA 2ASLA 5IQ6A 4DPUA 3MR6A 4K59A 5HSPA 1HWJA 3PW5A 5KFWA 3W65A 3R7BB 3PO5A 4X4SA 2ALYB 1RADB 1XTZA 2HNZB 2FZKB 2DEJA 2IBOA 2L08A 3BGLA 3CE8A 2BV3A 4E2FB 1WHVA 3LP1A 3KJVB 1N5YB 3JSRA 2YKNA 1NM2A 4WJBA 1OY8A 2HNYB 2GC8A 3VAMA 3V6KA 2QFIA 3US5A 5H9FJ 2JLFA 4O3QA 2M5YA 2GIQA 4Q8EA 4Q2LA 3PO4A 2VH7A 4L75A 3BDPA 4KIAA 3AT1B 3MMBA 4DV7J 5G0RB 2IYGA 1B7FA 1HFEL 4J7CA 3RB6A 2QSWA 3W9IA 4Y2MA 1Z4UA 3GJRB 4OHXA 4CLFA 2RU9A 2BE2B 1SUQA 4DV1J 1VJQA 2AMCB 2LU2A 3EGVA 1NSPA 2ZFHA 2ZM6F 4RW6B 2RS8A 4KGXB 2XBPA 4MMOA 3H25A 4IQXA 4CLPA 1UWAA 3FBBA 2CG8A 3BBCA 4MT1A 3T6BA 2KYZA 4P75A 1PJ7A 4HHUA 3SXLA 4NA1A 3DNCA 2GCFA 2HW3A 3DM2B 1MW7A 2AJ2A 3N5BA 1U45A 3G2XA 3PCOB 4CZCA 1XNRF 1HI8A 3LA0A 2GFFA 1N36F 2GJFA 3BSNA 2X3DA 3GIMA 1TFWA 2B7BB 2LDIA 2PFFB 2YX4A 2UUBJ 2HKEA 3NMRA 2DO4A 2QT7A 2HQIA 3RRGA 2ASDA 1UKUA 2AEFA 2OI2A 4C97A 1U24A 2HS4A 4DF8A 4HH1A 3DGPA 3HVRA 2D1CA 1T8EA 3HSZA 4NI2A 3QRQA 4DL7A 5C5JA 4E0DA 2LXIA 5GAGU 1FTRA 1UL3A 3M32A 4X4NA 5C7PA 4DS4A 3CCMS 4F02A 4IH7A 1U1LA 4ID5A 4NLPA 5J2MB 4GKJF 3FK4A 2B9YA 2DCLA 3BQ2A 1U6FA 1K1QA 1REGX 4WE1B 5KFNA 3HZEA 3SCIE 1R8HA 3LQVA 1LWFB 5J2NA 1TL1A 4DL2A 1RTHB 3K59A 1S4FA 4DSLA 2HHXA 2MLXA 2WOMB 4JI5J 1H7WA 4IG3B 2ZC3A 5KT5A 5CZXA 1LK5A 4F7VA 3PYEA 1X31C 2XSFA 2VV5A 5A8KA 3J81j 2IM2A 1MU2A 1UAWA 2C2NA 3V81A 2CQ4A 1YWXA 3RZAA 3OTCA 3CW2C 1SL1A 3OR1A 3GPAA 2F65A 4DV5F 1IKYA 1BQMA 5T7LA 1ZM3A 3I4PA 1JLGB 1U0HA 1X5TA 1ZA1B 4ANDA 1IBKJ 5DQHA 3CO0P 4BBYA 3KK2A 5MLCV 4R5PB 5KT3A 3EZOA 1FK9A 3A3NB 1VRTB 4U8VA 4DWIA 1RB0A 2R7SA 5E7OB 1JLQB 2B4PA 2ZH5A 2ROGA 1Y5IB 4JV2A 4KC5A 4PQUA 1BQXA 4M95A 2ZHAA 5EWGA 1YZ7A 1EHWA 1ELOA 4QWDA 1VR6A 3TJ8A 2V2VA 4C8NA 1YI2S 4B3RF 5KG7A 1N0VC 1TU0B 3TA1A 2QA4G 5KOXA 2R2SA 1S0NA 5A2QU 1S1XB 4LFAJ 4MKAA 1RP5A 3FSYA 4OJHA 2PA3A 4ZS6A 1K9MT 3G8QA 3IWXA 1MROB 4M63A 3IWNC 4Y28C 2YX7A 1PO6A 2IMWP 1A9NB 3JAMY 4IRDA 2MJUA 3LP2A 2PFDA 3MMCB 3KNAA 1JKHA 1PAEX 2JHEA 1RUSA 4CCHA 4OYXA 3LANA 3RBEA 2POKA 1TVRA 3IN5A 3JS9A 4OX9J 4ED5A 3HKZD 4LSNB 3OV7A 3UD5A 3CCJS 4ZVGA 2X51A 2V9KA 2ACYA 2CJBA 2OPRB 1QSLA 4PRFA 5HVGA 2ZEJA 2W2OP 4ECRA 1FESA 5FDLB 3UPFA 1S1UB 4RKUC 1LEOA 3TVYA 2EFQA 3DDNA 2R8KA 4M5KA 5C25A 4O23A 3OHBA 5B0BA 3DRRA 1ZTWA 2O1PA 2ZM6J 2E7XA 4O0IA 1AW0A 1U1NA 1QDUB 3I5AA 3J7YI 2KJVA 3QT6A 4HI1A 3QPIA 3DRPB 1SJ3P 2BJ8A 4OI6A 3X3UA 2UXBF 4LF6J 5BXIA 4ZVQB 4FNIA 1T3OA 2J6UA 5DS7A 4JV5J 1T9YA 3IRXA 5L1IA 2R8GA 5DETA 4RBUA 1NCLA 1P27B 1FNXH 1V3SA 2LQ8A 4QZVB 5K8MA 1YKWA 2FJEB 2ZZMA 2WB4A 2YY3A 3RBDA 3IWLA 1WHYA 4WP9A 4L3NA 2F8EX 2W2NP 4LUBA 4RW7B 2R7WA 4ZCLA 1YRUA 4NLYA 5CHCB 2QLFB 1REVB 4CP5A 2EKYA 1LW2B 2WBMA 5L1LA 1V3ZA 5JUMA 1FO1A 4AT1B 1OQ6A 4D3HA 2VQFF 4HTIA 2VA2A 3AQOA 3ETOA 4L76A 3B4MA 4QIEA 4P71A 3VTIA 1WF2A 3M8PA 1X5PA 4JI6F 1E6VB 3GB0A 2GVZA 3MCMA 3VCDA 1N52B 4OX8A 4H4OB 1WKLA 5LSRA 3G4SS 1KSPA 4NCAA 2Y1IA 3NXZA 5CZVA 2LDYA 3D4JA 1S9FA 1HQUA 1JLCB 4K4UA 2HVEA 1W2BR 5AE2A 2BE9B 2P2CB 1UCNA 2ZE2A 2NYHA 4WPAA 3C2PA 3AB2B 2ATLA 4NEYA 2UU9J 3NGDA 1KS2A 1UVLA 3CDEA 2YNFA 3BO3A 3L95X 3RUBL 3KK1A 2RAQA 2MSTA 2W4PA 3G9CA 2DGWA 4NYZA 2D3UA 1VQ8S 4CLZA 4DX5A 3SV3A 3DI6B 4Q0BA 1T05B 1BD6A 1ZM9A 2OAUA 4RJVA 1HNZF 2PDAA 3OL7A 4MK9A 2CNOB 3PJWA 1IXKA 3PHTA 2W2MP 1RGVA 4LSLA 2CQ0A 4O3NA 3T9NA 4I6AA 3MZIA 2HS3A 2ZOFA 3AXKA 1DTTA 2YWHA 1RAEB 1UA0A 1QSSA 5C24B 3P4UB 1FDNA 1RT7A 1C0UB 3Q89A 4Q5VA 4OZ0A 1BWVA 2EFGA 1BWEA 3MM9A 2VF3A 3KMQA 2GIRA 4B3SF 5H9FK 2FTRA 3PYDA 1HBOB 2U1AA 2CFXA 3RAMA 1VQPS 2V8HA 4UOFA 4LF7J 2G2OA 2M9KA 4Y65A 3QIPB 1IKWB 2VL1A 1VQSA 1FT8A 5A0YA 4NZ6A 4JV1A 1K8AT 3HD1A 3U7JA 2VFRA 2ZJPQ 1T03B 3GIJA 4RW4B 1B64A 3RG6A 2IM1A 4ZDNA 3OFEA 2BA9A 3BO4A 1FX4A 4UW2A 4XK8C 3E2EA 1NKBA 2MKSA 3MM8B 2W7AA 2HHHJ 2FZCB 3HHLD 4WBFA 3UE2A 2RKIB 3I87A 4NXNJ 2D9OA 4H4KC 1KQKA 1RAJA 3QGPA 5KT4A 1H2VZ 4IH5A 2LQJA 3MFIA 1LXJA 2UUCJ 3QGHA 2BANA 1WC3A 1EJ7L 4AQYF 3TZZA 4OI3A 4CH1A 1I5OB 1G3OA 3MCNA 2YQ1A 1FFWB 3JSMB 4DF4A 3G6XA 3CJKA 2DGTA 4FZVA 2BACA 5E3PA 5A8RB 4X62F 2BJ7A 1C1BB 4YUDA 5AJ3J 3MEGA 5F3ZA 4PUOB 9RUBA 3T1HF 3UDVA 3C16B 2HBQB 3IS9B 5DJBA 1IBMJ 2GMLA 1RYRA 1S6QB 4NA2A 4Y2AA 3CCES 4FN5A 4EBEA 1H38A 3DGVA 4E98A 3T5KA 4RNFA 3BM7A 2CZ9A 2EC2A 3HHLB 2BE7D 1FKAF 3R8YA 5FLXY 3AOAA 1BLUA 3OSPA 4LFCJ 2B6AB 3J7ZT 2Y3YA 1S7HA 2ZH8A 1XWLA 3AFGA 3I96A 4QWEA 3KHRA 4M94A 2WVDA 1FRJA 4B9UA 4C3MA 3QAEA 4I6YA 4EBCA 4LT6A 3H20A 1VHIA 4LREA 1QE1B 2C1EB 1L3KA 1TMJA 3QLHB 4MFBA 3H5XA 3DRSA 1IJEB 3UQSA 3FVYA 6AT1B 3W64A 4I7FB 1DHMA 2D41A 2NPFA 4OIXA 2MZ1A 1YDLA 5HVFA 2LKZA 1RWMB 4KPCA 4ES3A 2J7KA 2FUG9 2CZVC 2Q1LA 3AJDA 3O8WA 4W98A 5KFPA 3QO9B 3NCPA 5THWA 1S1TA 2IAJB 1P1TA 4QW8A 2H3EB 1FF2A 2IVFB 4DV6F 2DR7A 2B43A 3LF0A 3IO1A 3HDSA 2JDJA 2RT3A 2GGPA 2B4OA 2OPSB 4QWAA 1F5BA 1H2TZ 3J7YU 1RT5B 2ZJQQ 3POTB 1S9EA 3NBPA 2MDAA 1RHJB 4QR0A 2RRNA 2LU1A 3PX0A 4PG8A 4QIWD 1UJ5A 5KFJA 3GJTB 3MAAA 2L48A 3NCQA 5LMUJ 2AQ4A 3BQ0A 1VQOS 2R7VA 1SKSA 3GYGA 4QW9A 1FEHA 4Y2KA 3FNNA 1SKUB 4ZLLA 1FRKA 2DXEA 1BC6A 2EWHA 2UXCJ 1NPRA 1QSYA 2OMLA 4YOEA 2KFZA 4LF9F 5L9XA 3ILJA 1HNXF 2OPQB 2NQPA 4CT9A 3TJ9A 2FLLA 4I2PB 2P8IA 4NXMF 3KLGA 2FLOA 4DX6A 2EBEA 3W60A 3HPOA 1VISA 1HQEA 3D5MA 5IM0B 1RT2B 2W4CA 4B9TA 2JVOA 1RWOB 2CNNB 4F3QA 1P9QC 2QSFA 1RZMA 4OV1A 2EK6A 3F44A 1HI0P 1G2EA 3WC0A 2YNGA 2V67A 2JEIA 3OUYA 4PABA 3HI9A 2FB0A 4B9MA 3VZHA 3PNIA 2MMYA 1TP7A 3GE9A 3UWTA 4YHHF 1SH3A 5KFZA 3H2UB 4DX7A 3MWBA 2PO4A 1CULA 3KLEB 2HEKA 5AT1B 4ZPWR 3NGSA 3D0IE 4J90A 1HBUA 3D3CJ 4LQ3A 1VCTA 1M5VC 2IRXA 4XTTA 3IM9A 2YXLA 2CPEA 1NDKA 2B5JA 2EFVA 2N82B 1F6TA 4CM2A 5D78A 3DLLQ 4O3PA 1T9XA 4OLOA 1FVSA 3H42A 1S97A 5KFSA 1E6YB 4U96A 1S1VA 3KXDA 4DSJA 4CTAA 3FDSA 2LEAA 4ZITA 1UVMA 3BF4A 3M2UB 2ATCB 3K17A 3EGNA 1SCJB 1ACMB 3CJ2A 4ELUA 2OJ3A 3CJSA 1V5VA 1NMEB 3NS7B 4GVBB 3GQCA 5IT9Y 1VHFA 4C4WA 3UCGA 4EI2A 1LWEB 1CC8A 1R0BG 1JJ2R 5KT6A 4ZPVR 3M6VA 4DCJB 2M3DA 2K7JA 2C28A 1RHQB 1JXLA 4HT5A 2VG6B 1U1KA 2DNPA 1WDDA 4JI7F 2DHXA 3MM6A 2E1PA 4X2BA 2GS8A 4IYQA 1U4BA 3CCLS 3MM7A 2UP1A 4TY8A 1JLFA 1SQEA 3ETMA 2VASA 3W2WB 5GVQA 1IM4A 3HHKA 3LP0A 3OXGA 3CJTA 4PXEA 1TL3B 2NPIA 5LSLA 2XMUA 1OSCA 4P2XA 4DPOA 4A8FA 4P9SA 3C15A 3K57A 3SFGA 5IV4A 2QYCA 2R7OA 3N28A 1V9OA 4IO9Q 4HLBA 3AQPA 3HVWA 5KT2A 4UQTA 4UZCA 5KG6A 4DV3J 2CNKB 5HMZA 5U47A 1RBAA 1WSVA 1JLAB 2W1BA 1R7IA 4OHYA 4ED8A 4FXWA 2M52A 1C4CA 4FKXA 1U26A 3LTOA 4KGVB 1FKPA 3JTNA 4FPRA 1FERA 3D6TB 1X5SA 1KOHA 5BJRA 2XO6A 3AJ2A 1YX2A 3P5BP 6FD1A 3HF5A 1SKRA 4YDXA 4N7TA 5M2PA 3EDQB 3EUNA 2E5LJ 2Z57B 2MJNA 2NREA 3GFHA 1FE0A 2KVQE 2HFVA 1HR0J 1I94J 2BJDA 3KJVA 1NHKL 8AT1B 1N5YA 1A7GE 1YJUA 3NGRA 4RNHA 5DG8A 3H4DA 2NYIA 2QIFA 4YP3A 2JC0A 2HNYA 4CLWA 3OXFA 3N01A 4Y2IA 3BS9A 4XIUA 1B99A 2QEXS 3TP2A 5DDQC 3KG0A 3SSSA 4I0WA 3ZXWA 4DOZA 1T9WA 3OL6A 4KFBA 2DCUB 3W7BA 3SCLE 4UUXA 2Z2ZA 3M2VB 4DDFA 5G0RA 1KQFB 3DOMB 4OX7A 4USUA 4ATNA 1U6BA 4EBDA 2GJIA 4DR5J 1VC5A 4CO4A 4OYBA 2BE2A 4NLRA 1J5EF 2J0QD 2Q79A 4ED0A 2CPZA 3M6UA 3HP6A 2CNLB 1URNA 1VQ5S 4RW6A 1Y5LB 4LR8A 4OZNA 2J0XA 4EO6A 4WFXA 4EYIB 2AEJA 4ERDA 1YTYA 3I5BA 2M88A 2KT2A 2DRDA 2C22A 5HROB 1GT8A 1EKSA 4RUBA 3E01B 4P2FA 3DM2A 3KKFA 5K8PA 5D3GB 2E1AA 1GX6A 4Y34A 5CAAA 3VGTA 3O3LA 2RS2A 3DLKB 2G2YA 1IKVB 4B3OB 4GVLA 2CWXA 4KB7A 4ER8A 1MWQA 2ROPA 2N7CA 2X1BA 3GJSB 1RK8A 1R8BA 4DEZA 4GRSA 1SQFA 2C3OA 3Q83A 4I69A 4C2MA 5FJ4A 2YBVA 2HGMA 3OL9A 1S0MA 1WWHA 2EVZA 4J37A 2XM3A 1L3SA 3W63A 1HWKA 2VBXA 2G2ZA 2DNMA 3GFYA 1U2CA 3NOGA 4OZJA 1JXVA 2L9DA 1UVJA 3Q8UA 1SC3B 2RQ4A 5J2MA 4K5RA 2V4RA 2FLNA 3C6TB 3V2UC 4WE1A 1RACB 2HVZA 1LWFA 5AXMA 4F67A 3PW0A 1OY9A 2WOMA 4IG3A 1M5SA 3G6ES 1KLMA 4YMEA 4IO1A 1VLYA 2E5IA 4WYWA 4RWXA 1JQGA 4A8MP 3NRBA 1M1KT 4DL3A 1FTCA 4G1QB 1XN9A 2K1RB 4PYDA 3D6MB 4D3GA 1AA1B 3TUPA 1FA0A 1F60B 1JLGA 2WTFA 3I56S 4DUZJ 4USMA 4R5PA 5E41A 4A46A 2MKJA 3NNCA 8RUCA 1FD2A 2RMLA 4YB1P 4NYPA 2GHWA 1JLQA 1YJRA 4CYUA 2ZKTA 5K20B 4JI4F 3HSGA 1HHTP 2VOPA 4B3TJ 5K14B 1WKKA 3WBZA 2LYVA 1CQNA 2Q43A 4R25A 2LA4A 3KNGA 3VGUA 1UA1A 1SI9A 3HM9A 2QLBB 3ENAA 4DR6J 1JWWA 4O4RA 2XS2A 1IR0A 1HYSB 5D0HA 1S1XA 3SI8A 2BW2A 4V19J 2IIHA 3MDFA 1MROA 2HBYB 3TAPA 1X9WA 3CD7A 2XC9A 5I42B 2I5JB 1RLCL 2OSQA 4CLYA 4WFYA 5K5MA 3ZO7A 5JXSA 3PYGA 3L7PA 1TELA 3TARA 2AYGA 3MMCA 3J81U 1XMQJ 3VVTA 1WDTA 1G7CB 4AXIA 3HSJA 3TW0A 3PEHA 1NH7A 4NMXA 4KAIA 2R4FA 3PX6A 3D1HA 2J9CA 4ES1A 3CTRA 4TYBA 4YFUA 1JNZB 2KO1A 2BOAA 4F0KA 3RB3A 2B7CB 2LCWA 2FHJA 2LXFA 1DURA 2CQDA 3OFHA 2QFJA 2KB2A 1RWNB 2I0XA 3Q0AA 1C0TB 4OJ1A 1EAYC 3V6DA 1T9TA 1R0CB 4F4KA 3MPUB 5FDLA 3H2VE 1DTQA 1S1UA 3MEDB 3OHAA 2R9LA 2XY6A 1MN7A 3EVOA 4FF4A 1D9FA 4ECSA 2C2EA 1KKHA 3KUHA 2W25A 3W1YC 2D9PA 3WDOA 2ZNZA 2BM0A 2V34A 2E1MC 2MZSA 1TQLA 1C1CA 2QTWA 5EN1A 4A48A 4X64F 3AA8A 1SJ4P 3GR0A 4R0EA 2XGQA 1NKEA 4NEZA 1RAGB 5ETTA 2VPZB 3R5DA 2BJ3A 1GTEA 2FDNA 3T9ZA 6FDRA 1LXNA 4DCPB 4DPWA 2N4DA 5CQGA 3B8HA 4RNMA 4DQRA 1NK6A 4USKA 2V4JB 4I68A 1L3VA 2GV1A 3GIKA 3CCVS 1VLOA 2IC3B 2AJFE 3OW2R 1RXOB 4RW9A 3N79A 5DO2A 3K0JA 2OFHX 3MD1A 4J5OA 4KJIA 3QJPA 4GO5X 1XMOJ 1AFJA 4Q2MA 1WOPA 1Y0HA 3QT7A 1NPPA 1REVA 3ZZZA 2GHVC 4KT0C 4LIWA 4EO8A 1SV5B 4U9RA 4ZP8A 3M9NB 3LAKA 2H54B 4OQJA 4DFKA 4P10A 3B54A 2FQQB 2CQIA 3ZNJ1 4DU8A 4LVNP 2QMWA 1I1GA 2FY1A 2CPXA 4IOAQ 3UVJB 3JXOA 4H4OA 4MYTA 3CEDA 2ZITA 4O4GB 2DH8A 4DPTA 5IWAJ 1VIXA 4K0KJ 1YGYA 1X4FA 3LUYA 5HATA 2FC9A 3TAQA 2M70A 4KO0A 4J9MA 2AP6A 2IJRA 1TKDA 3D1QA 1QD1A 4QCLA 2YWWA 3WIUA 4Z7CA 4KE5A 1VDHA 3KG4A 3QNWB 4WU2A 3UR0A 1VQ9S 4Q44A 3CULA 5SZTA 4UOHA 5AXLA 8ATCB 4JI4J 2R3VA 1CEZA 4OHWA 1CPZA 3EWGA 3CUNA 1JMTA 2OGUA 3BBBA 2E29A 4ECVA 4DPXA 1S1WB 3UFCX 4DQSA 1RBOB 2CPIA 2VBWA 3U1LA 2XMMA 4B08A 4WZQA 2ZOGA 3PTWA 1C0UA 2HMIA 2UXDF 4ZK7M 2WONA 4C8MA 3PX4A 1S12A 2HQCA 1SB6A 2BOPA 1RT4A 1M1HA 5D4PA 1FJ7A 1TKTB 5MAOA 1HNVB 1VS3A 4LBIA 3VAHA 2ILZA 2FZGB 2JFKA 4FYDA 1YBAA 1VQLS 1T03A 3OTDA 4QIFA 1U8WA 2HBRB 1YJ9S 3EDRB 3VGSA 4Y6IA 4DFJA 2F4VJ 2UUTA 3FKBA 1CJTB 1HQ2A 2DNNA 2RKIA 3GV5B 3GJQB 3RAXA 4L72B 2DKOB 2YPYA 4ZLJA 4X4VA 4B9NA 3S7RA 3HKWA 4DUTA 3TVKA 3UNYA 4JI8J 2OFGX 2CA9A 4HT7A 1MSWD 3ZTPA 3VALA 1SH2A 3X1LB 2HLTA 3FCVA 4USJC 4DV4F 5GMDA 1RAFB 2HSEB 4LF4F 2VKRA 4RW8B 1TL7B 1M5KC 3T1AA 3QRPA 2NZ4A 3IFEA 3D68A 5A76A 1C1BA 4JI0F 4CH0S 3UN2A 2DD8S 3VAIA 5EX0A 1FXLA 4PUOA 3G6VA 4JI1J 3A8KA 3OVSA 1H98A 2P9GA 3R6GB 3E51A 4PAAA 1OQ3A 3C16A 2V8DA 1NZ8A 3IS9A 5B09A 2D7SA 3KWMA 3KMSA 2GIFA 4LQ9A 1WACA 2DHSA 3CJQA 2MHEA 1F5AA 2MKCA 2MZTA 5C2GA 2QLWA 3Q2TC 1Q5VA 1MLAA 5CCMA 2D74B 1YK9A 3PZPA 2D3ZA 2XCPA 3UDLA 1U48A 2DJWA 4ECUA 3FBEA 2XMJA 2B6AA 5KG4A 2F63A 1KONA 4MTPA 4WCEQ 1WG1A 2J7WA 2NCKL 1LQ9A 4URQU 4DR7F 4YY3J 2DB1A 3DLEB 2Z56B 3M8RA 4UF4A 3KDOA 3DOLB 1IQZA 4QU6A 3KHHA 1N5QA 2QL7B 1NJIT 1QE1A 2C3UA 4RL1A 1RKJA 3ZTSA 4LFBJ 2HRYA 1KTVA 3NG8A 5ETMA 5KFYA 3CJ3A 1ZM4A 2DHHA 1RABB 2IM0A 3JSYA 4I7FA 2ZHBA 3Q86A 3UI3A 3A3OB 2J6TA 2QN6B 3TZWA 3CCSS 2XB2D 1R27B 3JAMU 1D1UA 2GVDB 4WIIA 2VZ9A 4OV6A 3BSOA 3CCRS 5A2QY 2QLJB 3TR5A 4NLTA 3RR7A 2XULA 3HX9A 4WTYA 2VU5A 4F4XA 3BB5A 3QO9A 5K9FA 3HVTA 4CT8A 2GO8A 5E5NA 3ZTQA 3KUGA 1MMNA 4N8OA 4IFVB 3SFUA 1NJYA 1RTDA 2H5IB 2MQMA 4W90B 3P3DA 4A8WA 1WELA 1RU1A 4ILRA 2J5AA 2JWNA 3QT8A 4J9PA 2OPSA 1KFSA 1Q8KA 1RT5A 3H90A 5GAEI 5LL6d 2G1DA 3BPDA 1U7LA 2J7UA 3BV8A 3IRWP 1HL6A 5HMWA 4WWSA 1XNQF 1FFSB 4MKYA 5DGBA 4XAKA 4EEYA 4MK7A 2A6MA 3DLHA 3O5TB 4DHVA 3FSIA 2JX2A 1RSCA 5L46A 1GAOA 2VG7B 3FRZA 4O0NA 4A4JA 2VC1A 1KVKA 1NDLA 1J5OB 3C14B 1VQYA 3MF5A 4CLTA 3D1OA 4PPDA 2XZWA 2A10A 4BC7A 4K5SA 2HK2A 3DLJA 1S99A 1UW4A 2A2DA 3FC9A 1RLDA 2Z2MA 4HHJA 4GC7A 2MQNA 1ZZFA 4WK3A 1WORA 5IM0A 2I1RA 1RT2A 1CQMA 2EW9A 4WK1A 2QE5A 2DNKA 4U7UD 1R3NA 2MSSA 2VOOA 1CJKB 1FWKA 3MECB 1F2GA 1HLWA 3FFIB 1U6ZA 2C2ZB 4JB8B 1NJZA 3HULA 5D0EA 1LOUA 1UVNA 2VBYA 3M1VA 2VICA 5DLGA 2QC3A 4DV4J 5L9NA 1FX2A 4ECTA 5FD1A 1PYOB 2XZDB 2ZBCA 1P1LA 2DIVA 1GNKA 4O44B 4QWCA 2W9BA 2RDIA 4FNHA 2OTJS 2M8DB 3CDAA 4MIWA 3TANA 2YKPA 3PEJA 4ZVUB 3GG1A 3CCUS 2ZBQA 3LGNA 4PR6A 1FNMA 2VJVA 1G1XA 1UJ6A 4RR5A 2CQCA 2NZCA 2DXDA 3Q8YA 2IDLA 2E7VA 2HZCA 4K4TA 3IGNA 1Q7YT 1FNOA 1HNWJ 3M2UA 2MLYA 3AODA 1U8SA 3D0HE 4FXVA 1D3WA 2WB1D 4V19X 2IHR1 2GQCA 2EG2A 3BGUA 4ZCKA 1ZAVA 1FDAA 2CQ2A 2WSFC 2HIYA 1X7VA 4GVBA 5BR8J 2V0NA 2FVSA 1YBUA 4OFZA 3SBMA 4NCGA 4ICLB 4DR7J 2YH0A 1IWAA 3IAS9 1LWEA 1NDCA 2KL8A 2FVCA 2C3YA 1GK8A 3MMBB 3TJAA 3LAMA 1AXQA 2VG6A 3A4TA 4DQQA 2FGCA 3ITHB 3MMAB 4HH0A 3WHIA 2BQRA 4N76A 1UEVA 2DK2A 3GG0A 1CBKA 4L3KA 5GADU 1S6PA 4A8KA 1HNIB 2MZQA 1AYEA 3W2WA 1HBNB 2IMOA 4QYZK 4OHVA 1QAYA 2E1CA 4YB5A 1IQTA 1TL3A 4ALZA 3IC1A 2Y9HA 3PRBA 4QIVA 1RT3B 5CYQB 3FEZA 4CRJA 2YVSA 3PACA 3TA2A 2A3JA 3S8SA 2Y0BB 1KHVA 1N34J 3ADAC 4NZ0A 5KFGA 3FMWA 3B82A 2ABYA 1VOMA 4JI5F 2KN4A 4X4QA 1GXTA 2OO4A 1IR1A 4ECZA 4K4VA 3GIRA 3QFWA 4DLEA 2FLPA 2RNEA 1RHUB 1JLAA 3CDWA 1Y3JA 4CNYA 2JEGA 5G4DA 3R7SB 2PEBA 3DGPB 5H9EK 4F04B 1XNQJ 3BJYA 2G0CA 2D3OR 2V8VA 2DGUA 1RHKB 1IBKF 2HNDB 1HPZA 4ED6A 3W5YA 3CSKA 1R8CA 4ZIWA 1PG5B 2KRBA 1X0FA 3A1YG 3JTOA 2ZUGA 3I6PA 4ZPCA 5J2NB 4C9DA 1EX8A 2E66A 2J9DA 4LR9A 5HN0A 1GX5A 2QGFB 2WW4A 4F3MA 3EX7B 1VBZA 5D77A 4J9QA 2KXFA 5A8KB 1Q95G 4OZLA 5KFLA 2ZHOA 4M5LA 2FPHX 3BGRA 1UWBA 3KUEA 1Q79A 3M2VA 4LFAF 1YJTA 1PILA 1V6HA 2DEIA 4TU7A 2KFYA 1HBMB 3DOMA 1IKYB 1U49A 1WKJA 1X4HA 4HDGA 3TI0A 2KM8C 1K0VA 1S72S 1FKOA 4DR4J 5F8IA 2EK1A 4NYOA 1B0PA 4F2RA 4X65J 1C4AA 4F25A 3M9MB 1XBWA 2AYMA 1ZBTA 4O3RA 3M05A 4DL4A 3SDEB 1KD1T 4S0MA 5IC6B 3BKTA 3DXSX 4KKOB 1AZSA 2F3JA 4HACA 4PQUB 3CC7S 1HMVA 2FGOA 2E44A 2DGXA 1FJGF 3F56A 4TNOA 2MXYA 2FVQA 3OPKA 5HROA 4OX9F 4TU8A 3JTPA 3E01A 3NCRA 2Z58B 2CQBA 2B51A 3UCUP 3MCOA 1KVIA 3CT9A 1IKVA 2RRAA 3BBFA 2IA0A 4KYZA 3DN9A 2G1HA 3IM8A 2BKPA 2QLXA 3C46A 4NPOA 4J9NA 3AH6A 4EK2A 2OD4A 1KOOA 3OJSA 4ELVA 4LJMA 4FS1A 1F3VA 2K3KA 2RU3A 4HKQA 4FPIA 2KZZA 4H54A 2B9XA 1QAJA 1JKHB 3AB4B 4U95A 4NA3A 4LF6F 3JQMA 2V6AA 2UUAJ 2Z2LA 2GMHA 3GYNA 4JV5F 1S76D 1NHUA 5KG1A 3W66A 2W2QP 4AUKA 2UVUA 4OZ1A 2O01C 4HDHA 3C6TA 4OJGA 3O1LA 3V4IB 2E5GA 1H3DA 1NK8A 5DDRC 1FEEA 4DBQA 4K4YA 5DM7Q 5T14A 1URRA 4YEAA 2YKMA 2AEMA 4MKVA 1OYEA 3SYZA 4MAKA 2H65B 1RCOB 3DRRB 4UT4A 3I0SB 4F36A 3GTYX 2UZAA 2YKAA 2AZ3A 1BHNA 1BQNB 4CDIA 2G9OA 2LQ5A 1NBEB 2YNHB 1B3TA 2ZBPA 4ZHRA 9ATCB 1X4EA 5ADZA 3RW6A 3CB4A 2HQDA 3FCWA 3K7RA 3C6UB 3CCTA 4LRCA 1GH8A 2FJXA 3Q22A 1PKUA 2W8LA 2YKQA 4LIRA 3EXCX 3MTKA 2DNOA 4TN2A 2DPJA 3H5YA 2ZC4A 2RQMA 2ZZTA 1WOOA 3PHEA 3R27A 2KFNA 3HT3A 5GAHI 1CJUA 4DQIA 4NMLA 4EFAC 5KG0A 2MKHA 2RHQB 4AFFA 5CYMB 4C8ZA 3O6QA 3EICA 2MQOA 2UU9F 3CJRA 1HYSA 3BDEA 3EXYA 5HO4A 1KFDA 1AB8A 5A6PA 3OR2B 2N7YA 1WHWA 5J2PB 2BQUA 5I42A 2I5JA 2ZDPA 1YLXA 3VWSA 4KHRA 4LF8J 2K2PA 2BJEA 7FD1A 1RA6A 1SBRA 3UDCA 1S77D 3D66A 4PWDB 4FVMA 3HD2A 3AOBA 2VQEF 4QBUA 3SCKE 4QPTA 1H0HB 5KFQA 1NNDA 3KK3B 3M2RB 2ERRA 2R8IA 1GEHA 2ZOMA 2J6SA 4C0OC 5F8MA 1X9MA 2ALZA 2BUNA 4P52A 2DNZA 4CO1A 5J2QA 1C0TA 2E5JA 3MEEB 3FJ2A 1VQ6S 1IWGA 2APOA 4CQ1A 2AGOA 5IZHA 2GQ2A 2QMXA 1NKCA 3MEDA 5D8HB 3KK1B 2MQQA 3ZC4A 1RWXB 2NXCA 4ANEA 4LF7F 4J9LA 1NSKL 3R1LA 2BW7A 3H2LA 4LR7A 4Q0BB 3DLGB 1VQ4S 3DFEA 4NOHA 2XLIA 1FJGJ 1GMWA 3W8GA 1U1RA 4ED7A 1U02A 2HHHF 4NXNF 1B0TA 4DFPA 3GLJA 4PG6A 1FE4A 3P5TL 2AYBA 4DR1J 3I31A 4M5NA 1Y5NB 2IC3A 2UUCF 3TA0A 2AF6A 4ZVSB 5ETOA 1LWXA 3PFEA 4K4WA 4X4RA 1G4CA 1QM9A 2OH2A 3FBFA 3HO1A 1CJVA 1D9AA 4I2QA 2V5HG 2N4CA 3OTBA 3CNQP 4OZ5A 3KLIB 5AJ3F 1LFWA 5EWFA 2IA6A 2K06A 1QVFR 2E9TA 1ZPVA 1UMJA 1SV5A 3CD5A 3CXCR 3CCQS 3NEKA 5E33A 4DSEA 3I0RB 1IBMF 1YJWS 3BGFA 4IFYB 4OI2A 2NXJA 3V5RA 2WRMA 2ZWPA 3PW7A 1L5UA 2C2MB 3N5FA 2AD9A 1MWZA 5GMKa 3N6LA 2OEKA 1R8AA 5D4LA 2VUGA 1B7YB 3QGIA 2YPZA 4U67Q 1WTBA 5L38A 2M7SA 4O4GA 2BANB 5L8RC 3DCAA 5KFMA 3ILLA 2ASJA 4HL9A 1SJ1A 2ZBRA 4LFCF 5KG3A 3T1YJ 1SIZA 2CQHA 2Z4PA 3CJKB 3CO9A 2HZVA 3PXGa 4N5SA 4CLLA 3Q23A 2GZOA 2UUWA 1BE4A 3T6JA 3MEGB 2DH9A 4C11B 2KT5A 3H59A 3J7Z5 1RWKB 4ILMA 3HT0A 1VQNS 4CI0B 5J1EB 2HVDA 3QFHA 4DV0J 4HI2A 1J2VA 1HW8A 4ZN3A 1R89A 1WTFA 3PG9A 2RVJA 3DU6A 4JP8A 3ZZTA 3M8ZA 1H7XA 2NSBA 4A8SA 5ETKA 1S1WA 3AD7C 2GHPA 4IG0B 3VQTA 4OJ3A 2QZ8A 3DRXA 1UEUA 3F73A 2L9NA 4UY8T 2XLKA 2DNLA 4QIGA 2O67A 4OYAA 1YG0A 1VJWA 3E3XA 2XMKA 4ZVHA 5HBMA 1N6QA 1QUVA 3C3LA 1I51B 2DNYA 1M5OC 4MFBB 4M5DA 2DIUA 4I56A 1EETB 1TKTA 4LF5J 1RU2A 5CYJA 5DGAA 4F50A 2VQEJ 1XC9A 1KBRA 3MM5A 2OIHA 5LMUF 2EG1A 3RBXA 3BH6B 4FVCA 2MYFA 3IBWA 1RT6B 4BHQA 2M2BA 1NK7A 2ZBIA 1CJTA 1SH0A 3CJ4A 4E8UA 2UXCF 3QT5A 1S1TB 1KHWA 5DZ6A 2BR0A 4OYWA 5EUHA 1IBLJ 4ZMMA 2I2YA 1LW0B 3VAFA 2WVEA 3PRVA 3K5NA 4PXCA 1NK4A 4RUCA 4MKBA 3GU0A 1NAQA 2X1GA 3TO8A 2J8SA 1X0PA 5KFAA 2HRUA 2CJYB 1H72C 4RW8A 3HCXA 1SJFA 4ITSA 4DI6A 3TUJC 2ZNYA 4DL6A 1WC4A 5E2QA 3G82B 2RUGA 5HP1B 3P96A 3MAAB 4ZVRB 2DRAA 3ZNUA 2WBRA 3TUIC 1RWVB 2IRUA 5F8LA 1XIQA 4C3LA 2DO0A 3MUTP 3D7SB 4TKTA 2IYIA 2HHQA 1M1GA 1XMBA 4ECQA 5KFTA 5D4NA 1VI7A 1S10A 2ZH2A 4PYAA 4RWWA 2HHPA 4DXLA 7AT1B 2HVIA 1RTJA 2BQ3A 2HURA 2KVIA 3H98A 3QMQA 3NL0A 1GXLA 3M7VA 3AOCA 4DS5A 4WP8A 3W3SA 5ETSA 1TFYA 5AE3A 1RT1B 2XCAA 2AJ0A 1HA1A 3DLEA 2C2RA 2V2ZA 2N3OA 2MY8A 3CIMA 4CNZA 2MZRA 3R7NB 1NEEA 3GSIA 2IY5B 1CC7A 3CGIA 1ZETA 3QAUA 1VQ7S 4B3MJ 2V94A 3TEHB 5KFIA 3OUYB 1UVIA 1F9HA 1DY3A 5CABA 2JZ5A 3RBZA 4DPYA 1SC1B 1N54B 3MPWA 2YNIB 2AX0A 1TKZB 4IDKB 2HHTA 4ETZA 5KAKA 3M6WA 1CULB 2X7IA 2KKHA 4BLGA 4LBHA 1ZTTA 1N5TA 5CH7B 5EHHA 1NUEA 3I82A 1F9FA 5M2UA 1B4SA 5ETNA 2DT9A 3OTOJ 4U8YA 5AXNA 3SMZA 3OQ2A 4DX8H 4ZJOA 4FYWB 1VK8A 2O3DA 3MD3A 4B9LA 3FGVA 2W7OA 1D0EA 3O44A 2RE1A 3PV8A 3J81Y 1DLOA 1PSDA 3R5AA 3ISNC 1X8DA 1Y00A 1U1MA 5ETVA 1R6VA 1I6JA 2KU7A 2H5JB 2OEJA 2JC1A 3IR7B 2W24A 3MPDA 4YR3A 1Q81T 2MEWA 5E3QA 4ECXA 1O6XA 3UO0A 4C8KA 4USIA 1VMBA 2XY5A 2VG7A 2Q6BA 3ENQA 3ZZUA 2RF2B 4DR3J 3C14A 1PC4A 2W9CA 4WP3A 3MPVA 4DV3F 1RBLA 1WHXA 4WU3A 2Y8WA 3NAHA 3HFKA 4RNOA 4L6V3 1ZOTA 1LNQA 3A8EA 3AAWB 4I6WA 3QJLA 2CJAA 2CKWA 3D6HB 1YJ7A 3MM7B 2YTCA 1MWYA 3UR3C 4X4OA 2IRYA 2LP4A 1DQAA 1JLFB 1O5JA 2FC8A 4LF2A 3LP0B 4IOCQ 1RAHB 2VFTA 4CLSA 2DH7A 2DNQA 3MECA 1Q1KA 1N5SA 2E5LF 3BKUA 1U1QA 3FFIA 2GNKA 1HR0F 3C15B 1I94F 1PCAA 2HFUA 2HFZA 3KYLA 2VONA 3NS5A 1ROFA 3QWUA 4BC9A 1FRLA 1S48A 1X4GA 1S0OA 5D4OA 5B0DA 4BDPA 1OO0B 2GA7A 1DBDA 1GFWB 2QA4S 4K4XA 1GQEA 3TYTA 1FKPB 2MQ8A 1Z2ZA 2OPPA 1WI6A 3M8WA 2WZ1A 5ETPA 1AT1B 4DR5F 4L73A 1S4EA 3M30B 3ZZ0A 2XI2A 2CUYA 1OMSA 5IFMA 2G13A 4KHPJ 4USWA 2GJ2A 2BRKA 2AJ1A 3SIPB 1OY6A 3PFOA 3EVWA 3D67A 3BO2A 4AL6A 3M8YA 3KLFB 4RU2A 4DLGA 1W26A 4TLRA 5ETRA 3W5ZA 2IVMA 3PVXA 2KYXA 3FSXA 3RW7A 4DSKA 2R7XA 3U1MA 2D3O1 4KFBB 4LRDA 3LOUA 1V5IB 4ICLA 4TYAA 4B17A 1ZM2A 3B4DA 4U6PA 1HWUA 3ITHA 3MMAA 3UD3P 5F41A 4H4KA 5LMNJ 2PA8D 1FWLA 3LALA 4X84A 1FHTA 4F0MA 1HNIA 1VRUB 3JB9k 2A0FB 3BREA 1HBNA 3MHYA 1YSJA 3EM1A 4FYVB 2XMTA 2FHOB 1N32J 1N0UA 1IVZA 3M6XA 3I9ZA 3KJFB 1Q8LA 2XWYA 3N6NA 1GMUA 1H73A 4DV2F 2RUSA 1RT3A 4M5JA 2CJXB 5CYQA 3DXBA 2W7PA 3BGOP 3BSCA 4J9OA 3QQCD 1Y9OA 2V9WA 3S6EA 2CQGA 5DM6Q 4I1TA 3KJNB 3W9HA 2W01A 1DZ5A 1SQGA 4OL8A 2L41A 2ZD1A 2YWFA 3OVAA 2NR0A 1OS5A 3ULHA 4QYRA 4PWUA 5IOLA 3OD2A 2C3MA 4JYAJ 5I3PA 4OYZA 1WUUA 3DLBA 4XDCA 4P2MA 3ZTOA 4PZVA 4NL5A 3BYPA 3AJ1A 4EMDA 4ZPAA 2RDDA 3IMQJ 2PSZA 2R7TA 1ZYQA 3HVAA 1TL5A 3L9ZA 3NLCA 4USTA 2ZH1A 3ET6B 2HNDA 4DUZF 1BY9A 3I55S 2B8QA 1WI8A 1VFJA 2YKOA 1XERA 5IS2A 1NDPA 2CAJA 4YQWA 3SQGB 1UJ4A 3GYXB 2AV5A 3ZFVA 3W2VA 4UZBA 2M8HA 1Z2LA 2CADA 3HSDA 2CJ9A 1Q82T 3QSYB 3K5MA 4B3TF 5BYQA 5K8OA 1KLMB 2CQ3A 4YS2A 5KFXA 3ENVA 2HIQA 4DR6F 1XJWB 2BM1A 1T3NA 2LA6A 4FKYA 3S1TA 2FJVA 1S79A 4GO7X 1HBMA 3CMQA 1S7IA 2SXLA 4FF3A 2HNZA 2IBKA 1OPZA 2PI5A 2RJZA 3NMAA 3G86A 1PJ5A 1N4LA 1IBCB 3H4BA 2UVWA 1XMQF 4K7QA 3SDEA 4ID8A 4CYUB 3DDKA 4KKOA 2FHJD 4RPFA 2J9EA 2FVPA 3RB0A 2XGPA 2FJBB 2YWEA 1FXRA 4K8RA 2NUUG 1F2HA 2BXJA 2WAQD 4OZ2A 1WEXA 2CVIA 1ZAWA 2CVEA 3D54A 2P6SA 2NUHA 3MOJB 4WZMA 2MLZA 2E9ZA 4I67A 3OJUA 3TX0A 3ELHA 2VC0A 1SC6A 5B0AA 2C2OB 1TUVA 1VIOA 2CRLA 4K2XA 4PG4A 1T95A 2OUGA 3HFVA 4N56A 4G6VB 2X1AA 2HK3A 3SSRA 3HHEA 2W8KA 2K3IA 2E1RA 1VC0A 3NY0A 2RIJA 2GO9A 5LJ5Y 2CJKA 2HWIA 1VBKA 2ZH9A 1CS4B 2DRBA 3IA0A 2V2QA 2ZH7A 4NLUA 4IQMA 3U27A 2B9WA 4TXSA 3V4IA 3P49B 4WKYA 4ZVTB 2U2FA 2HQFA 4C3KA 1VYAA 3NP5A 5K8NA 4RBTA 3V6DB 2A1BA 4JUZA 4F3OA 2XNRA 3A13A 4LVOP 3SV4A 3MTJA 1DTQB 2KT3A 5HLFB 2ZWOA 5KFEA 2OHDA 4JOUA 3I0SA 2IJFA 3TQEA 2HS0A 2XLJA 1XMOF 3MCSA 1BQNA 1C1CB 4CLKA 2B0GA 2MQLA 3VZIA 3MXHP 4I64A 4RBVA 2QMUB 2QX0A 2BDPA 2DY1A 4ELTA 3I4HX 5CCLA 2KTQA 4USHA 2FJDB 4MH8A 2YNHA 5KFBA 4DV2J 3UW1A 1R31A 5DLFA 3P8BB 2XMAA 3MAQA 1XNRJ 1WC6A 1ZPWX 2RILA 4NWBA 1N36J 3G87A 2UVVA 2OSRA 3C6UA 5HMXA 1RI7A 1RTHA 1FRIA 2MY7A 1CVJA 4AE5A 2KRRA 4ZLNA 5HL7Q 5C42B 2MKIA 3DOKB 1YRTA 5KTQA 3CMAS 2J76E 5IWAF 1UVKA 4RW9B 3SSQA 2RSQA 3IBFB 1NRKA 4RZRA 4U7UK 4K0KF 4KH1B 4ZP9A 3EPGA 4EZ6A 5CYMA 2WK4A 3PIPQ 4KHMA 1RISA 4L74A 5HQ8A 2V4QA 2M4MA 2HFNA 4QR2A 7FDRA 3OR2A 2EXUA 4GKJJ 1QJHA 4DUYF 5J2PA 3H40A 4C0BA 1VRTA 2EFPA 4MYUA 1MG7A 3HMJG 2V8PA 2FIUA 3QJJA 2X1FA 1S9GB 1DARA 1K47A 4DL5A 1AUDA 2HRTA 4PWDA 4PKDB 1U25A 2V50A 1MN9A 1GXUA 3GMGA 3BH7B 4IKAA 4ED3A 2L9WA 3KK3A 1F1BB 2FVRA 3M2RA 2V68A 4ZLPA 2XQCA 4IOBA 4ILLA 1HI1A 2VPYB 3TUZC 2HYIB 4Q7AA 2YWGA 2DYAA 4DV5J 1UFWA 4PXBA 1S49A 4KO0B 3MEEA 4YR0A 5IT4A 3N4WA 1D09B 1T02A 2A18A 3MMJA 4TVAB 3DMJB 5H1SV 2KZMA 3BPSP 3R5GA 5DG9A 2ASYA 3VAJA 1N33F 3RGIA 1NLKL 1Y3KA 1FFGB 4WXWA 2C42A 3DLGA 1VQMS 3CCWA 1JB0C 4ZVOB 1S59A 1S6OA 2QG9B 5KFOA 3CPWR 1EQMA 2R2UA 4B3RJ 4LSNA 3FQLA 3SCJE 2F4VF 5B0FA 4A8YA 3MR5A 1J27A 2JLEA 4XPEA 3JQKA 2OPRA 1K44A 2MB0B 4OYOA 2HMIB 1R8PA 4GKKF 4JI8F 4OYPA 2WONB 4KGKA 3MPYA 1JNRB 1UW9A 2HWHA 2BEFA 5KFFA 1H6KX 5CD4H 4AD6A 1RT4B 1NO8A 4C0HA 3N9UC 5E0OA 2NS1B 1FD8A 3W8PA 3T19A 3DRPA 2RQCA 5E3AA 5EWEA 3DKDA 3KLIA 5J1PA 1RTZA 3AA9A 4JI1F 5KT7A 5KFKA 2OEMA 1K73T 2F1FA 2H1YA 1RYSA 1RAAB 3RYLA 3I0RA 1WNEA 1PAUB 4IFYA 2JEJA 4G1IA 1OIAA 4IUFA 2A2CA 2EBGA 2DITA 2CJQA 2ZJRQ 3L09A 1VGYA 3QATA 2B3TB 2HFSA 4CO3A 3MAHA 2KM8B 4Y3CA 1U2RA 2MKKA 4PQAA 5LSOA 1PIEA 1KWMA 4RW7A 2AKWB 1NB2A 1PYSB 3R5CA 4Y00A 3MGJA 1FRXA 1AROP 3D28A 3J80U 2ZUAA 1GMVA 1TK5A 2DGSA 1LW2A 3Q2SC 1ZAXA 3WQPA 3JYTB 4YY3F 1R0AB 3FMBA 2UXBJ 2XMWA 4C11A 3U1NA 4DN0A 3GV8B 2EEYA 2LMIA 4F26A 3CD6S 5KFHA 5A8WB 4LFBF 2ZZNA 5J1EA 1TKXB 3R3TA 1FVQA 1JJ4A 3UN5A 3Q8PB 4ZCIA 4DCOB 1E6VA 1TUGB 3V6HA 2VFVA 3LO3A 3OTEA 2Z2YB 1RTIB 2XI3A 2GX8A 2JOQA 5I4MA 3THPA 1JLCA 5E3RA 3MOZA 1Y10A 4C98A 4WTOB 2DVIA 4CM0A 4IG0A 3THTA 2XY7A 3ISZA 2I6WA 1PBUA 3DHWC 1YJNS 3NNAA 2JFDA 4QYZJ 4DFMA 3A12A 2ACMA 4K4SA 4QOTA 2OTLS 3R2DJ 2J9DE 4R8UB 4LF1A 3EVMA 2P6TA 3HHNB 4DUYJ 2VQFJ 2GAHC 3OLAA 5F8GA 3GSDA 5B0CA 4O3OA 4MIAA 4N47A 3DI6A 5HJYA 1ZA2B 1T05A 1EETA 3S01A 2R7RA 2PMWA 3M8QB 4JI6J 4BCAA 2HFOA 1H2UX 3Q24A 1ULRA 4NLOA 1X4CA 1HD0A 2FJWA 1VBXA 3WZ0A 3NGTA 2PD1A 4KGZB 1Q0NA 1SXLA 1CLFA 1LV5A 1RT6A 1S6UA 1MMDA 4NLVA 5H9EJ 5B0EA 5L39A 2ILYA 5C24A 1X60A 2FYXA 1S0VA 5LXRA 3PIOQ 3HVTB 2BRLA 3PJXA 2KXNB 3G8SA 4C7QA 3K5PA 1LW0A 1T94A 3DU5A 1RTDB 3PKYA 1HBOA 5EX3A 1NB7A 1BUXA 4KV8B 3SZ2A 3QIPA 2PMHA 3MURP 1IKWA 4U7CA 1DFDA 2LQBA 1N33J 1JLBB 1JLEB 1GTHA 4H4MB 1HNZJ 1RWPB 3H8YA 3G82A 4OYMA 3KTQA 1TR0A 4RW4A 5HP1A 1MMLA 3BR9A 3J7AN 3RRHA 3K8VA 4DQPA 1FDBA 4LRBA 2HAFA 3MM8A 1R43A 3CWJA 1JIHA 4X4PA 1NJXA 1FWPA 1NZAA 3R97A 3FZBA 2D69A 4F4YA 4F4WA 1UTAA 5HI7A 1Q78A 2HZAA 4GKKJ 1Q5YA 1M5HA 3ILIA 3QBCA 5F0WA 2B8PA 3F41A 2KG1A 2C2KB 4B3SJ 4NLDA 4NZ7A 2AIRB 5DDOC 1EP4B 2GMJA 3MR7A 3JSMA 3M9OB 4DG1B 1BXNA 2ADBA 4B9VA 1RDRA 3N6MA 4MK8A 3R5JB 4P7TA 1JJHA 5B7WA 5A8RA 1XR6A 1CG2A 1N88A 1TV6B 1RT1A 1TUWA 3BSAA 3ZZOA 3TAMB 2LQ9A 2Z0GA 5E3CA 3GFXA 1YBTA 1DAXA 3TWZA 2XS5A 2MZJA 3PW2A 2JEFA 3BEGB 5CA5A 1S6QA 1IKXB 1NH8A 1TMMA 3WC2A 4YR2A 1LWCB 3HHLA 4KY3A 1HNWF 4FDFA 1WF1A 3M1VB 1P9YA 2UVRA 2W2PP 2G4BA 3ZZRA 2XWXA 2YNIA 3KLHB 4AQYJ 3LW5C 1TKZA 4C8OA 2HGLA 4IDKA 5BR8F 2PMZD 2CPFA 5L1JA 5DQIA 3IG1B 2W9BB 1F3FA 2HGNA 4X62J 1I3OB 4C8LA 4WFBQ 2OP5A 4CIOA 2VHGA 3T1HJ 2XEXA 3RAQA 3VQSA 2OD6A 4CO2A 1FJCA 4PPZA 2GAGC 2XTJP 3QLHA 3J7A1 1OPIA 3KOAA 4FP9A 2VPXB 5D6GA 1HHQA 4DZDA 2R8HA 3TOQA 2PC6A 3QRRA 4I4BA 2AGPA 4ECYA 1M90T 3W61A 3VVUA 1WC1A 5I3UB 1FRHA 2DGOA 2VB6A 3D0GE 3OVBA 4ES2A 3NS6A 5HJXA 5D0GA 3LH2S 1NK5A 3PR5B 3R9LA 2IAJA 3ZZPA 2EFOA 2XS7A 4NCGB 2MPUA 1UETA 4WFNQ 1N34F 2RF2A 2XHWA 2Q3PA 2XG8A 2CYYA 2DHAA 3C66A 4GMKA 3FRYA 1KNZA 2V63A 2Y1RI 2BJ1A 4ZKAA 3WIVA 3POTA 1Y4ZB 2AWZA 3TZXA 1D8YA 2EFNA 1S6PB 3PKMA 2UV8G 2LLZA 2G0IA 1QUPA 3IXQA 3ENWA 4NASA 2I8EA 2XYHB 1WOSA 2G0JA 4M5IA 2EPIA 3RR8A 3BN4A 2IFXA 2WW8A 4ENOA 1XR7A 5LJ3Y 3MR3A 3NKYA 2MGZB 2IDEA 1MNEA 3O2IA 5LXYA 2CPJA 2H4WB 4FYXB 3TX8A 5M2RA 2BX6A 3QWPA 4URSA 1N56A 3EGWB 1BGXT 4FBTA 4DV6J 2OPQA 4HTJA 1KQSR 3I9V9 4I2PA 5DZ7A 3DDIA 2IM3A 5DDPC 3HJVA 1L3UA 3W62A 3DYAB 5HVHA 2DNHA 1JJCB 3H0PA 4G1PA 3IR6B 1HIYA 2VG5B 1UP1A 3ZZYA 3PM9A 3K58A 4O3SA 4DR4F 3M30A 1HPZB 4X65F 2JSXA 3FZ2A 1Q86T 1QAXA 2J0WA 2HVHA 3TVZA 3AXMA 2P5VA 2XSJB 1RAOA 2DR5A 4LF9J 1HNXJ 3KLFA 4UOCA 3PR4A 3GILA 3KLEA 5F8NA 1OWXA 3HLUA 4NXMJ 4M5MA 4N8NA 4FBUA 5KFCA 4YB7A 2OELA 4GC6A 2KH9A 3BGRB 1UWBB 2K8GA 2VKZG 5F8HA 2ZH3A 1WEYA 2DHGA 1TTHB 4NX9A 4CO5A 3R6LB 3TEGA 1FKOB 3GV7B 5F9NA 1E6YA 4K50A 2J8AA 1RJJA 3QIDA 3AD8C 1EQ0A 1QVGR 3UN3A 1RHMB 2KI2A 3LP1B 2YKNB 1VRUA 3M4XA 1CJVB 5BYRA 5AXKA 5ETLA 4MJKA 2QJ3A 4YHHJ 2AZ1A 2UUAF 1AZSB 4HACB 5I3QA 1HMVB 4QWBA 2RD5C 4JBCA 4OI1A 4OLPA 4QPXA 5CXTA 5HMYA 1X9SA 4NLGA 3IR5B 3K8WA 2XZTB 1NHVA 2YX1A 4P7VA 3RU0A 1Q8IA 4RO0A 2DPIA 3PY8A 3LWMA 3MFHA 2B4UA 1DQ8A 3D6FB 1SUQB 1IJFB 2CG4A 1TL4A 2F8HA 2QYGA 5J1NA 4C8YA 1NK0A 2H51B 4CO0A 2V2KA 2Z8QA 2P9CA 2OKQA 3T5JA 3G96A 5JVHQ 3M8SA 1K0TA 2E5HA 4W92B 1O0PA 1RQ0A 2VIHA 4YDDB 2QL9B 3KLVA 2COLA 1QLNA 1XR5A 3ET6A 1SIWB 1Y7PA 1DRZA 2PIIA 4C48A 4DSIA 2F4FA 4FXDA 3SQGA 3K89A 3F0NA 1NU4A 1W25A 2AYEA 4ZP7A 2FJAB 1DJ0A 1YZ6A 4JI7J 4OI0A 3DC2A 5D0RA 4F4AA 3ISND 2CQ1A 1YHQS 1UZDA 4PG7A 3U02A 3G8TA 2H4YB 1UFKA 3HHDA 1RAIB 2YKMB 4PWWA 3OLBA 4NI2B 2C3PA 2XNQA 3ONQA 5B08A 3VAGA 2XYGB 1U2FA 3T41A 4Z7YA 1KRPA 3GCWP 2HG4A 3M32B 4EZ9A 3HFZB 3H5SA 3G6YA 5ETQA 1Q16B 1EARA 1C2PA 4HHHA 4ID5B 3CJ5A 5RUBA 4CH7A 2RQKA 2PN6A 4NE9C 2NXUA 3EPIA 3RB4A 4ZHRB 1UFLA 4LF8F 2CDQA 3QZ8A 1APSA 1WSRA 3TQ1A 2J0SD 1YVFA 1TL1B 3A8JA 2OMOA 2Y0SD 1KN6A 3OFGA 3CCZA 2WVCA 3BR8A 4FF2A 2E9RX 4QQBA 2LEBA 2QO3A 1TK0A 3CD0A 2JNJA 2VODA 4Q45A 4F0HA 4KQZA 3NWRA 4M8LA 4F2SA 5FLXU 1N8RT 1MU2B 4M5GA 1IR2A 3V81B 1CJUB 3IP0A 5EDWA 1YITS 3L7OA 3OR1B 4OHZA 1M5PC 3ICLA 3IGVA 3L7UA 2LFVA 1BQMB 2ADCA 2WSEC 2DTJA 3CDUA 5T7LB 4KPYA 1U0HB 4ECWA 2YH1A 1SJQA 1YQHA 3KK2B 3R2CJ 4P72A 2VD3A 4ED2A 3PW4A 2O66A 1FK9B 1UPPA 4FF1A 1HW9A 2HHWA 1N48A 1OYDA 4TQRA 1H74A 3OSNA 4J9RA 2FD2A 2F9JA 2JH3A 1JK9B 2BZ2A 3KHGA 1IM6A 3GONA 4ED4A 1GMWD 4G3IA 2MHNA 2R42A 4XO0A 2AGQA 1PGZA 1NXIA 3RTVA 3Q8SB 5D3GA 1CS4A 1JXEA 3QZ7A 3WX4A 2R7UA 2CPDA 1Q4RA 1T9VA 2RHSB 3DLKA 1OJ4A 4M1KA 3HJFA 3DHXA 3GP9A 4B3OA 2F40A 4DR1F 2QRRA 1VBYA 3C19A 1XEZA 5J2QB 1TZ0A 2DXFA 3HHLC 2QV6A 4J9UE 4ETXA 3LPYA 1O8BA 2KHDA 5IT0A 4DU7A 1LKZA 3H5UA 5GAEU 1J5EJ 3FBCA 5HLFA 2RDJA 1NPKA 1VRQC 3LP2B 4J9SA 2PT0A 2YQ3A 3MEKA 2ZDOA 4IRKA 4EUVA 1WC0A 4XDDA 2PE8A 1RWWB 1TVRB 2HWTA 2CPYA 4Y2CA 1KLNA 3B6BA 4DSFA 2AJQA 4ZVPB 3NGKA 3FCHA 2I38A 4EYHB 4TY9A 1FJEB 1S57A 3R1HA 2DNGA 1Q53A 3CVKA 4TU9A 1KP6A 3FEYB 3QSIA 2VBZA 2ZVIA 5C42A 2RRBA 5C25B 3DOKA 2PGCA 1A6LA 3OFFA 1WF0A 2FY8A 3T1YF 1UEKA 3LGHA 3LPEA 4AYBD 4G1QA
chains in the Genus database with same CATH topology
3SQGB 1UJ4A 1ZZFA 4I2QB 4WK3A 3GYXB 1KQKA 1RAJA 3QGPA 2AV5A 2I1RA 3BN7A 4JV0A 3ZFVA 5IM0A 5KT4A 2K1RA 3W2VA 1RT2A 1CQMA 1H2VZ 1P8GA 2EW9A 2K7KA 4IH6A 2M8HA 4WK1A 1U1PA 4IH5A 2QE5A 1Z2LA 2DNKA 2LQJA 2CJ9A 3MFIA 1LXJA 1Q82T 3QGHA 2BANA 1R3NA 4UQGA 2GW8A 1WG4A 2MSSA 2VOOA 3K5MA 2JRSA 4AQYF 4B3TF 3IRXB 5BYQA 5K8OA 4OI3A 4CH1A 1KLMB 2CQ3A 3MECB 1G3OA 1F2GA 3OXLA 3JSMB 5KFXA 4DF4A 3G6XA 3CJKA 4DV0F 3ENVA 2DGTA 3FFIB 2F7VA 1U6ZA 2HIQA 4DR6F 4FZVA 1NJZA 2BACA 5E3PA 2BM1A 5A8RB 1T3NA 4X62F 1LOUA 1C1BB 4YUDA 2LA6A 1UVNA 1IN0A 1S9GA 2VBYA 3M1VA 3MEGA 5F3ZA 5DLGA 3S1TA 4PUOB 1OSDA 3T1HF 2FJVA 1S79A 4GO7X 1HBMA 5L9NA 4QR1A 2R8JA 4ECTA 5K14A 2SXLA 1U09A 2N3LA 4KTQA 5FD1A 4FF3A 3IS9B 2HNZA 2IBKA 5DJBA 1OPZA 2PI5A 1RKIA 2RJZA 2ZBCA 1P1LA 2GMLA 1RYRA 2DIVA 3NMAA 1S6QB 4NA2A 4Y2AA 3CCES 1GNKA 4O44B 4QWCA 4FN5A 2W9BA 3G86A 4EBEA 1H38A 4E98A 1N4LA 2RDIA 3NWGA 4FNHA 3BQ1A 3T5KA 4RNFA 3BM7A 2OTJS 3H4BA 2M8DB 3CDAA 4MIWA 3TANA 2UVWA 2YKPA 3HHLB 1XMQF 1FKAF 3PEJA 3SDEA 5FLXY 2KJWA 4ID8A 3GG1A 1BLUA 3BZQA 3DDKA 3CCUS 4KKOA 3LGNA 4PR6A 1FNMA 2FHJD 3OSPA 2B6AB 3J7ZT 2J9EA 1S7HA 3K5OA 2ZH8A 2HLUA 1G1XA 2FVPA 3DMJA 4ZVEA 3RB0A 1XWLA 1UJ6A 1D8ZA 2XGPA 3I96A 2FJBB 2YWEA 1FXRA 2CQCA 2NUUG 4QWEA 4UY85 3KHRA 4M94A 3M8PB 2HZCA 4K4TA 4LF5F 3IGNA 1FRJA 4B9UA 4NLXA 2BXJA 2WAQD 3SEOA 1Q7YT 2DR8A 1FNOA 2WSCC 4C3MA 1TK8A 3M2UA 1WEXA 3QAEA 4I6YA 2CVIA 1ZAWA 2CVEA 3D54A 4ZVFA 4EBCA 4LT6A 2P6SA 3H20A 2NUHA 3MOJB 1B0VA 1U8SA 3D0HE 4WZMA 4FXVA 1D3WA 2BYCA 2V8GA 2WB1D 4V19X 2E9ZA 4I67A 1QE1B 3OJUA 2IHR1 2GQCA 2EG2A 4HEA9 2VC0A 1L3KA 1SC6A 1Q8BA 1HQUB 5B0AA 3BGUA 2EI5A 4ZCKA 4PCQA 4AXJA 1ZAVA 1FDAA 2CQ2A 3QLHB 4MFBA 3H5XA 2WSFC 1TUVA 3DRSA 1X7VA 1VIOA 4KBIA 2V0NA 1IJEB 2CRLA 3UQSA 3T5LA 3FVYA 4K2XA 3CMES 4PG4A 1T95A 2FVSA 2ZE2B 4OFZA 4NCGA 4ICLB 4N56A 2YH0A 4G6VB 4I7FB 4J9KA 2X1AA 4RX6A 3SSRA 1DHMA 3IAS9 3HHEA 3OL8A 1LWEA 1YIJS 2W8KA 3GFZA 2FVCA 2K3IA 2D41A 2C3YA 2E1RA 4F8RA 1VC0A 2VFUA 3MMBB 2YNFB 2NPFA 4OIXA 3LAMA 2MZ1A 2ZH4A 1IBLF 1VQKS 4JI2F 1AXQA 2RIJA 2VG6A 4ZPBA 2GO9A 5LJ5Y 4DQQA 2CJKA 2HWIA 2LKZA 2FGCA 3ITHB 3MMAB 2HQ3A 2L3MA 4HH0A 2BQRA 1KC8T 4IR9A 4ES3A 4N76A 2J7KA 5HBMB 2ZH9A 1N6QB 3CDBA 4NLQA 1UEVA 2DK2A 2FUG9 2DRBA 2CZVC 2Q1LA 1HARA 3Q8RB 3IA0A 1WD6A 3GG0A 3O8WA 5GADU 1S6PA 5KFPA 2ZH7A 3QO9B 3NCPA 5THWA 4NLUA 4M5DB 4A8KA 1KQGB 4IQMA 3U27A 1HNIB 1S1TA 2B9WA 2IAJB 1P1TA 4QW8A 2MZQA 4TXSA 3V4IA 1NK9A 1FF2A 3GR1A 3P49B 3FEXB 4WKYA 3EZ5A 4NCBA 2IVFB 2U2FA 3W2WA 4DJBA 5LT5A 5GADI 4C3KA 4WXOA 3NP5A 3PRDA 5K8NA 1HBNB 4RBTA 3V6DB 2A1BA 4JUZA 4LSLB 2IMOA 4Y0FA 4F3OA 2XNRA 1DQ9A 4DV6F 4OHVA 4LVOP 1QAYA 3MM5B 4YB5A 2B43A 3RRKA 3SV4A 2E1CA 3MTJA 3LF0A 2DR7A 4AL5A 1TL3A 4ALZA 1ZZNA 1VC6A 1DTQB 2FHKA 4X4UA 3IC1A 3IO1A 3HDSA 1DTTB 2JDJA 2KT3A 3HXMA 2RT3A 3GZ7A 3PRBA 5HLFB 2GGPA 4QIVA 2B4OA 2OPSB 4QWAA 4WYLA 1F5BA 1H2TZ 1RT3B 5KFEA 3J7YU 5CYQB 1RT5B 2ZJQQ 4HYKA 3POTB 5DG7A 4JOUA 1S9EA 3I0SA 3FEZA 3NBPA 3I32A 2V4JA 2YVSA 2MDAA 2IJFA 3PACA 1RT7B 4NLWA 3TA2A 4QR0A 2HS0A 2A3JA 2RRNA 2XLJA 1XMOF 2LU1A 3PX0A 3MCSA 3AHPA 4DR2F 4PG8A 4QIWD 1UJ5A 3S8SA 1X4AA 5KFJA 1KHVA 1BQNA 1C1CB 2Y1JA 1NJWA 2B0GA 1WEZA 2MQLA 4NZ0A 5KFGA 3VZIA 3MXHP 3FMWA 3B82A 4NRTA 4I64A 4RBVA 2ABYA 3MM9B 1VOMA 2L48A 4JI5F 3NCQA 2AQ4A 3BQ0A 2KN4A 1VQOS 4X4QA 1GXTA 5KG5A 2BDPA 2OO4A 2R7VA 4ELTA 1SKSA 2WHOA 3I4HX 4ECZA 5CCLA 4QW9A 4K4VA 4USHA 2FJDB 4MH8A 4DLEA 2KTQA 1FEHA 2FLPA 1XK8A 2RNEA 2YNHA 4YB6A 5KFBA 4Y2KA 3UW1A 3FNNA 1R31A 1JLAA 1FRKA 3CDWA 1Y3JA 4CNYA 2JEGA 5DLFA 2HHUA 5G4DA 3MAQA 1BC6A 4KGMA 2EWHA 1ZPWX 2RILA 4NWBA 2UVVA 5A0YB 2OSRA 3C6UA 1QSYA 2IJNA 2DGVA 4ZPTR 5HMXA 5KFUA 1RI7A 5F8JA 2OMLA 1RTHA 3BJYA 4YOEA 1FRIA 2B56A 2MY7A 4DL0C 2KFZA 2G0CA 1CVJA 3JYTA 2D3OR 2FHMA 4AE5A 4X66F 2KRRA 1R0AA 4LF9F 5L9XA 5HL7Q 2V8VA 2DGUA 1HNXF 5C42B 2MKIA 4BS2A 4TQSA 2OPQB 2NQPA 4CT9A 3DOKB 1YRTA 5KTQA 1IBKF 3CMAS 2J76E 5IWAF 1UVKA 2HNDB 2FLLA 4I2PB 4RW9B 3SSQA 1HPZA 2RSQA 4ED6A 4RUHA 1NRKA 5A8WA 4RZRA 4NXMF 3CSKA 3KLGA 2FLOA 2JL9A 1R8CA 4A8XA 1TKXA 2LVWA 2EBEA 3HPOA 2KRBA 2CZ4A 4U7UK 4B3MF 1HQEA 1X0FA 3A1YG 4K0KF 3JTOA 2ZUGA 3I6PA 4ZPCA 4URGA 3D5MA 4ZP9A 5IM0B 3MUMP 3EPGA 2R2RA 1D9DA 4ZP6A 5CYMA 3TNVA 2WK4A 1RT2B 3PIPQ 4EZ6A 4Q8FA 2W4CA 1VK3A 4B9TA 5J2NB 5IXUA 2JVOA 4KHMA 4C9DA 1RTIA 2E66A 2J9DA 1RISA 3NNHA 5HQ8A 5HN0A 1GX5A 4F3QA 2V4QA 2M4MA 1P9QC 2QSFA 3EZUA 2HFNA 4F3MA 1RTJB 3EX7B 1VBZA 4QR2A 7FDRA 1O51A 3OR2A 5D77A 4OV1A 4J9QA 2KXFA 2EK6A 1QJHA 4DUYF 5J2PA 3F44A 5A8KB 3H40A 4UUWA 4OZLA 2I9SA 1HI0P 5KFLA 2NLWA 4C0BA 1G2EA 1VRTA 2ZHOA 2F8MA 2DGQA 3WC0A 2EFPA 2FPHX 2YNGA 1SJRA 4MYUA 3HMJG 3BGRA 1UWBA 3OUYA 2JEIA 1LK7A 2FIUA 3HI9A 3QJJA 1Q79A 3GIIA 2X1FA 3M2VA 3CIZA 1S9GB 2FB0A 2MQPA 2AU0A 1DARA 4LFAF 3CF5Q 4B9MA 4DL5A 1AUDA 4JI3F 1YJTA 1PILA 1U1OA