3D2WA

Crystal structure of mouse tdp-43 rrm2 domain in complex with dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
GSKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAR DNA-binding protein 43
publication title Structural insights into TDP-43 in nucleic-acid binding and domain interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna/rna binding protein
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d2wA00
1CVJA 2X1BA 1KC8T 3MXHP 1X4GA 2X1AA 3MUTP 1VBYA 1X4AA 5CYJA 1WG1A 3ULHA 1VQ6S 2DNRA 1WI8A 1N54B 2CQIA 1WEYA 3V4MA 4YB1P 2LEBA 2DGSA 1X5SA 1D8ZA 3MD1A 1AUDA 1HD0A 2M2BA 1S79A 4IOCQ 2MY8A 2L08A 1VC0A 5GADU 3SXLA 1FJEB 2DGTA 3CCQS 3VAFA 2UP1A 4TU8A 2FY1A 4PRFA 2X1GA 3VAHA 1WF1A 5HO4A 1XN9A 2MSSA 3S7RA 1D9AA 2MXYA 3G9CA 5LXRA 2XS7A 4YOEA 2DO4A 2DNPA 2X1FA 1YTYA 2YH1A 2RRAA 2CQ4A 3P5TL 2KXNB 2KFYA 2KHCA 4A8XA 1RK8A 2KYXA 3VAJA 2HVZA 3CCRS 3CULA 3U1LA 3BO3A 1SJQA 2DIUA 2OJ3A 1VQLS 2KRBA 2CPIA 2MZJA 4EGLA 3THTA 5GAEU 3MOJB 1SJ4P 2D9PA 4OZ0A 3S6EA 2N3LA 3MUVP 2DB1A 2DGQA 2QA4S 3CCMS 2ERRA 3UE2A 2ZJRQ 1FJ7A 2MZTA 4QU6A 1N88A 1H2UX 2MY7A 2KRRA 3VAGA 3LQVA 1YHQS 2CPFA 2VOOA 2MGZA 2MKCA 4U67Q 5IM0A 2GO9A 2M7SA 4Y00A 1FT8A 3NNAA 3S01A 2JVOA 3DLLQ 2A3JA 4F26A 2DISA 3US5A 4ZKAA 2G1DA 2B0GA 1NU4A 2J8AA 2MPUA 3CCSS 3MURP 3U1MA 4QU7A 1FHTA 1VC6A 4RU2A 2I2YA 3R1HA 1H6KX 4PR6A 1N8RT 3RW6A 1WHYA 2K8GA 2CQPA 1M1KT 2M8DB 2MZ1A 1X5PA 2FPHX 4ERDA 1UW4A 1U1NA 4WF9Q 2G0CA 2WBRA 1KQSR 2LEAA 5DETA 1IQTA 1M5PC 4WFBQ 2CQ3A 2VODA 2K3KA 2NLWA 1WTBA 2OSRA 4W92B 2EK1A 2CPZA 1U6FA 4CIOA 2RU3A 1Q81T 1Q86T 3PIOQ 1VQ7S 4C7QA 2KG0A 2XS5A 2JX2A 1G2EA 2PEHA 4P6QA 4V19X 4FXWA 3NNHA 2CQGA 4ED5A 3HHNB 1VBZA 2J76E 3TO8A 3SDEB 4LIRA 2ZJPQ 5HL7Q 1JJ4A 3CPWR 1VQPS 3NMRA 3OW2R 2OSQA 1K8AT 2KM8B 3CMAS 4YUDA 2DNGA 5D77A 2DGOA 1DBDA 2DH8A 2LXIA 2CPHA 3I56S 2DGVA 1FO1A 2VOPA 2OIHA 2AD9A 1X4CA 1UP1A 3PIPQ 2L9WA 2YH0A 1OPIA 1U1OA 4PKDB 4WIIA 2N82B 3H2VE 1ZZFA 1WHXA 2KN4A 2AYMA 2N3OA 2M88A 1WELA 2SXLA 2DGUA 3NS6A 1VC5A 3BO2A 2CPYA 1BY9A 2XSFA 3VF0B 4WCEQ 2MMYA 2J0SD 2AYEA 4C0OC 3J7ZT 2EK6A 3LPYA 5IFMA 2DNHA 1WHVA 2CPJA 3P49B 2HYIB 3JB9k 2D3OR 1VQNS 3CCUS 2LYVA 4TU7A 2PE8A 3SMZA 2CPDA 2MSTA 2BZ2A 3RW7A 3CC4S 1PO6A 5CXTA 3UCUP 2DO0A 1U1MA 3K0JA 1U6BA 2HGMA 2RNEA 5JVHQ 4F25A 3D2WA 1W2BR 2RVJA 3MDFA 2BOPA 2E5GA 1X4HA 2OTJS 1ZZNA 2KT5A 5LJ5Y 4CH0S 2M0GB 5EN1A 1X4FA 2I38A 2MKIA 3MI7X 1U1PA 1WHWA 2KU7A 4UY8T 3DXBA 4UQTA 2KVIA 2DNKA 2DNNA 3BO4A 3Q2SC 1U1LA 4CQ1A 4IUFA 1VQOS 5DM7Q 1KOHA 1Q82T 1WG5A 1YIJS 2F9JA 1YJ9S 1Q7YT 2U1AA 2DH9A 3CMES 3UD3P 2G4BA 2YKAA 2L41A 1VQ5S 2DGWA 3UD4P 1M5VC 1OO0B 3SDEA 4CH1A 2DHAA 3I55S 3VAKA 1X4EA 3G6ES 1WF2A 2FC9A 4OZ1A 3B4MA 3G4SS 2QFJA 1WEZA 2LMIA 3G71S 1VQ8S 2LXUA 3VAMA 3G8SA 4TLQA 2CPXA 3CCES 2KM8C 3P3DA 1VQKS 5DDOC 2HZCA 2JWNA 3ZZZA 1H2VZ 2CPEA 3IRWP 1FXLA 1P1TA 3B4DA 2HGLA 5GAGU 4BS2A 5DDPC 1PGZA 2MQNA 2E44A 1OWXA 2M9KA 3R27A 2LCWA 3NNCA 2AYBA 3BEGB 2VONA 3J7YU 2MQLA 5D78A 1NO8A 1SJFA 1QM9A 2LQ5A 2XS2A 5LXYA 1UFWA 1HA1A 2ADCA 3CC2S 2E5HA 2AYGA 1URNA 1K9MT 1M90T 3CCVS 1VQ4S 3N9UC 5IQQA 4Y0FA 2MB0B 1KOOA 2CQHA 5LSOA 5CA5A 2XNRA 3R1LA 1QVFR 1JJ2R 2MKSA 2CJKA 3CCLS 2DIVA 1VQMS 5GMKa 1L3KA 1X5TA 2E5JA 2LA6A 2MYFA 5LSLA 4FXVA 3HI9A 3TP2A 2M8HA 3BS9A 4Z2XA 5MLCV 2MQOA 1JMTA 1DZ5A 2Q79A 2LECA 4C4WA 3NS5A 3CUNA 1S72S 3UWTA 1VQ9S 1K73T 5GAHU 2MHNA 1X4BA 3CD6S 1SJ3P 2DNOA 4WKRA 1A7GE 3UCZP 1WF0A 1YI2S 2JRSA 2CQDA 2DNQA 5DM6Q 2LKZA 2CQ0A 4TU9A 1YITS 1WWHA 2MJUA 3CF5Q 3H2UB 1U1KA 2XB2D 2MZQA 2KH9A 1YWXA 2RS8A 2DK2A 2MZSA 2ZJQQ 2MQPA 2RS2A 3CXCR 2DNYA 2V94A 1SJRA 1F9FA 2HGNA 3CTRA 2CQBA 3S8SA 1X4DA 2DNZA 2RUGA 1NJIT 2OTLS 1B7FA 5DDRC 1YJWS 1FNXH 2JVRA 3VALA 3FEYB 2RT3A 1WEXA 1H2TZ 4IO9Q 1DHMA 2DHSA 3THPA 4WFNQ 1O0PA 1HD1A 2DITA 2E5IA 1M5OC 4QQBA 3CCJS 2EVZA 3G8TA 3Q2TC 2CQ2A 2F9DA 1A9NB 2MQQA 5LJ3Y 4LJMA 1N52B 2DHGA 1X0FA 1QVGR 2QEXS 1OIAA 5ITHA 3MD3A 4WFAQ 2ADBA 3EGZA 5H1SV 2NZ4A 5GVQA 3FEXB 4IOAQ 2F3JA 3G96A 4LMZA 2YWKA 1U1QA 4J5OA 1UAWA 2MKHA 2DH7A 2XNQA 2CQCA 1FJCA 2DHXA 2M52A 2MZRA 2DNLA 2M70A 1R8HA 2O3DA 2DGXA 2J0QD 1U1RA 1X5OA 3EGNA 2RQCA 2CQ1A 1KD1T 5FJ4A 1DRZA 3TYTA 1RKJA 1WI6A 2U2FA 2FC8A 2RQ4A 2KXFA 2N7CA 4M5DB 2GHPA 3L3CA 1YJNS 4F02A 3P6YC 1HL6A 4W90B 2LA4A 2MKJA 3EX7B 2KI2A 2D9OA 5BJRA 1R8PA 2KXHA 1P27B 2YTCA 1ZH5A 1U2FA 2MJNA 4QPTA 3IWNC 1M5KC 3UCGA 2KG1A 2MGZB 1WG4A 2DNMA 5IM0B 1SXLA 2MQMA 3VAIA 5DDQC 3ZZYA 5JVGQ 2FHOB 1JJHA 2RRBA 3CC7S 3MUMP 1VBXA 2MKKA 2M4MA
chains in the Genus database with same CATH superfamily
1NK9A 2H5EA 3TANA 1QTMA 2O5DA 2VH7A 4HLBA 4RW9B 1VRTA 1SUQA 5GAGI 4NL5A 4F7VA 1FA0A 3M30B 4V19J 5AXLA 4K50A 3W1YC 1PBAA 3W62A 3B8HA 2MSSA 4OHZA 4O4RA 3QZ8A 1RT6B 2V8GA 3DI6A 4OV6A 3TARA 2JEIA 4E0DA 3SFGA 3D1QA 1FEHA 2DNPA 3GIMA 4AL7A 3BV8A 2KFYA 2HVZA 3DFEA 1S10A 1H98A 2PA8D 3NKYA 3OJSA 1HBNA 1L5UA 2OAUA 4TYAA 5E3RA 3OLAA 3L7PA 2YKMA 4P2MA 2OPRB 4NI2B 4C98A 2ROEA 2GAGC 3I6PA 4KV8B 3TWZA 3NOGA 1IKXA 3I82A 1TKTB 4BWMA 2HHHJ 2HNDB 3PO4A 1I1GA 2GO9A 2M7SA 1U0HA 3THVA 2A3JA 4PG5A 3P45B 1Y3JA 3MMBB 2JZ5A 1NU4A 2ZD1B 5D4OA 2F63A 4M5HA 4WPAA 3RW6A 1UW4A 4RW8A 1FRMA 4HKQA 2G0CA 2HBZB 5D3GB 3DLBA 1S9EA 2DR8A 2IBOA 3RRKA 3AOBA 4DPUA 1WTBA 1WSRA 3NY0A 2J6UA 5HJYA 2C3MA 1HQEA 3ET6A 2PT0A 1J5EJ 4UTGA 1N36F 2FHKA 5K8MA 3IGNA 2J76E 3KDNA 4IFVA 4QPXA 1N5SA 1H74A 5LL6d 3GLJA 3QGHA 1RISA 1LWFB 1UEVA 2UUAF 1ZTWA 3MCSA 1I6JA 4X4UA 2N82B 3F73A 1H0HB 2AT1B 2QMXA 3QLHB 3MEGB 3BDPA 2UXDJ 3VWSA 3TZXA 1XMQJ 1L3SA 3K8VA 5FLXY 4DHVA 1BWEA 1UZHA 2WSCC 3JB9k 1UWAA 2ZUAA 3MEEB 1Q79A 4YB5A 3IC1A 4QIFA 3VGVA 4QR0A 4Y3CA 1B4SA 1UEUA 4NLPA 1HBUB 5LT5A 2CNNB 1C0TB 4R0JA 5EN1A 4OYIA 2FZCB 1WHWA 4X2BA 3BBCA 2WBMA 4N5SA 4DV3F 3Q0AA 3I5AA 1FK9B 4F2RA 2VFRA 2E5LF 4ZK7M 1TAQA 5HLFB 2QJ3A 2OFHX 3G71S 3NBPA 4PXCA 3OR2A 3LGNA 4J9KA 1DJ0A 2V9WA 1A6LA 4HDHA 4DFKA 2KFNA 3QGGA 1FXLA 2KTQA 4IFYB 5EX0A 1XR5A 1RTDA 2LQJA 1S77D 3BGLA 3GQCA 4N76A 4DFPA 3KLEA 4FYDA 4GO7X 4KPCA 1LFWA 4IDKB 1DLOB 3R5AA 5JMNA 3H4DA 3LAMA 5KFDA 4ZS6A 4YDXA 1GT8A 3N4WA 3BGRA 2HQCA 3M8WA 3GV5B 2W9BB 4ILMA 5AXMA 5CQGA 4KE5A 2UUCF 4QYZJ 4C8OA 5K14B 4C8YA 2DEIA 2MJUA 1RAJA 2E1AA 4RBTA 2XB2D 3V5RA 4R5PA 1CBKA 2XEXA 3QAEA 2DNYA 1DAXA 2V94A 3RB4A 3QRPA 4KBIA 2B8PA 4H4MA 1S1UB 3P5BP 1YJWS 4DQIA 2OMOA 2FLOA 3HSGA 4DU8A 3EPGA 4F36A 1HBMB 1LW0B 2F9DA 4L76A 5GMDA 4LFBF 1OS5A 2XMUA 5HQ8A 3C14B 5IXUA 1RKIA 1SH3A 1LK5A 4K2XA 2MKHA 3D5MA 4WP8A 1NJYA 3BJYA 4K0KF 4HI1A 1AZSB 4DV4J 1U1RA 2V4JA 5D8HB 4NYZA 2HBQB 1RU2A 5F0UA 2YNFA 2LA4A 2KI2A 2D3ZA 3M2RA 4QPTA 3AH6A 2GZOA 2JOQA 2GVZB 4A8OA 3L9ZA 4KJIA 2CIMA 2V9KA 2YNHB 1CJKB 1IKWA 1RGVA 2RB7A 3IFEA 1X4GA 3HJFA 1S6PB 5KG4A 1IBKF 1T03B 2B4VA 2ZEJA 4MTPA 4LQ3A 4CO3A 2HVDA 3NLCA 1MU2B 3E2EA 1X7VA 1JLQB 1BQXA 2MQ8A 3KXDA 2Q3PA 3H98A 5HO4A 2MHEA 3GSIA 3NEKA 1MW7A 3T5LA 1SCJB 3R8YA 4DV6J 3M6WA 1S1TB 2VZ9A 1JLGB 2E9RX 4ZN1A 1HI0P 2RRAA 4CLUA 2RAQA 1ZM9A 1GEHA 4J9QA 3CCRS 1APSA 5KFVA 1FE0A 1AT1B 3MMCA 1NSKL 3MOJB 4F3MA 1YJRA 2ERRA 4RUAA 4OX9F 2A2DA 4CO1A 2VOOA 3QT5A 1PAEX 3K5LA 2CXEA 4RU9A 4F26A 2GMLA 3MURP 3V6JA 2I2YA 4CM0A 2BKOA 4DPWA 3LANA 3DLKB 4HL9A 3R5BA 2MZ1A 1BC6A 3Q8PB 3KLHA 3M2VB 3HHLC 2XI3A 1RLCL 3A1YG 2VG5A 1RT3A 2YKNA 3MTKA 4JI3J 5HQLA 2OHDA 3HM9A 4HR2A 2OH2A 3NNHA 3SSQA 3PHEA 5L1KA 3A8IA 2PN6A 2CJAA 1XBWA 2CJXB 1JJ4A 1ZYQA 4LF4F 1VQPS 3OW2R 1TL1A 3IAM9 1K8AT 2KM8B 3HP6A 2WB1D 1S9GB 1F9HA 2YKQA 4O3RA 3I96A 2KVQE 3DLEB 3BQ0A 3V6KA 2BQ3A 4X4QA 3HVWA 1AUSL 5T7LB 5CCLA 3Q8YA 3TVYA 3NS6A 2E1PA 4PABA 1R8CA 2HURA 3NG8A 4JI8F 2BW7A 5KG5A 3BYRA 3JSMB 1ZAVA 2O1PA 8AT1B 1ICEB 1PO6A 1XNQF 4B3RJ 2R7RA 2E5GA 2NZCA 4ZVFA 2K2PA 5HJXA 4P73A 3RAXA 2DNKA 1NK5A 1T95A 3Q2SC 1TV6A 3J81U 2ZH6A 1U1LA 1T05A 2FJBB 5DM7Q 4G1QB 2PD1A 4IH6A 2Z2MA 1YIJS 3R2CJ 1KVJA 5KFUA 2VPXB 3DU6A 4EYIB 5D4PA 3H90A 1RT7A 5J1PA 3TI0A 2AX1A 3OSNA 4PYDA 2XMKA 3D0HE 4M8LA 1OY6A 2OO4A 3CJKB 1Y5LB 1UWBB 2V0NA 2FVPA 4B17A 1JKHA 3MGJA 5K20B 1AW0A 3IBWA 2E1CA 2QA4G 3AQPA 1NDCA 1Z1ZA 4CO0A 4QW8A 1OWXA 3W2VA 3UDVA 1OPZA 3Q8QB 3C6TB 3N79A 4MKYA 2R42A 4YEAA 2V4RA 2IJNA 4H4KA 2FJWA 1VQMS 2DIVA 3TAMA 2V63A 4QBUA 3W3SA 1EHWA 2W2NP 5ETNA 4Z2XA 4M5GA 3JQMA 5MLCV 1S4FA 1ZTTA 4O3QA 2HHHF 1JLCB 1H7WA 4FVMA 4RWWA 1WC0A 2Y0SD 3G6VA 2NSCA 2XO6A 1H38A 1YLXA 3D4JA 4K5SA 3C3LA 1S6QA 4OYWA 1LWXA 3TVKA 2I9SA 2RILA 4Y28C 4ECYA 3SCIE 2CQ0A 3M2UA 4G1PA 3H2UB 1SI9A 4OI4A 1H73A 5C5JA 2VPYB 1RTIA 4RW6A 1FI4A 2FHMA 2N7YA 1H3DA 5KFTA 5C25A 4DSKA 1WJ9A 2IVMA 1RTJA 1U2CA 3QIDA 1J5EF 2B5JA 2AMCB 1DHMA 3EXCX 4MJKA 3ELHA 3ZTQA 2QX0A 7FD1A 1A9NB 1RAFB 2R7VA 1FFGB 2QEXS 1OIAA 3NCPA 2ASLA 2XMMA 2F3JA 1JWWA 2M52A 2DGXA 2CWXA 2CQ1A 4OMFG 3EZUA 5K8OA 2U2FA 2VDIA 2N7CA 4F02A 1KKHA 1G1XA 3C16A 2D3O1 2HVHA 4KHPJ 1WSVA 2RRBA 4FPIA 4OX6A 3EDRB 4DF8A 3K8WA 4P7TA 1YRUA 4FYYB 3CJSA 1VQ6S 3OQ2A 1GX5A 2CZVC 4M63A 4HHJA 1JQGA 2I5JB 1HD0A 4CO4A 2QGFB 1JLEB 4ZPAA 2FY8A 3KDOA 4QR2A 5I3PA 1NZ8A 1O5JA 4YN3B 5B0GA 3R6GB 1LEOA 4J91A 1NAQA 1H72C 4WZQA 1ROFA 2VFUA 3PM9A 2WW8A 4O23A 2WSFC 4AE5A 4ZLLA 4EU0A 2Q1LA 3ZO7A 4O4GA 3JTNA 1HYSA 3VVTA 1RWKB 4PWDB 1VMBA 3BR8A 1ZA2B 3C46A 4NLWA 3J7A1 3C15A 1D09B 2IRYA 4LF2A 3CO9A 2CRLA 2R2UA 2BVZA 2EXUA 4PQUB 3GG1A 4KGMA 5DGAA 3RYLA 3CE8A 1RUSA 3MM7B 1SKWA 1Q8IA 2YVSA 2VODA 2VBWA 3C2PA 4WTYA 2OPQA 2YPYA 4R8UB 5AT1B 2UZAA 4A8MP 4PZVA 2H4WB 2HQ3A 4DX6A 5IT9U 1ZM2A 2ASJA 3E3XA 4BBYA 2CPHA 2KKHA 2B43A 3TOQA 4C97A 1C4AA 2L9WA 3H2VE 1OQ3A 1HQUA 4U7UK 4N41A 4I67A 4DV4F 2R2RA 4ECRA 4DV7J 1UA0A 3LPYA 2D41A 4TXSA 4OI2A 4Y2CA 1XWLA 2GV1A 1EB0A 1RTHA 4X64J 3RW7A 3CJ5A 4U8YA 1T3OA 1NDKA 2H65B 1KQKA 1UFLA 1LW2B 3MM6A 2YX7A 1UVNA 1PJ5A 1ZA1B 4PWUA 1TFWA 5FLXU 3OHBA 3IBFB 5GMEA 3SFUA 1X9SA 1F60B 4QJVA 1Q7LB 2ZOMA 1SV5A 2W7AA 1WG5A 2DH9A 1F6TA 3BSNA 2I1RA 4DI6A 3CT9A 2HFZA 2A1BA 4N56A 4CH1A 5KFZA 1QSYA 3SV3A 3BPSP 2RSQA 2BKNA 2UUWA 1TELA 4ANEA 3DC2A 3S1TA 5KFFA 3AB2B 1NNDA 2HGLA 4UOGA 2GX8A 2J6SA 4FZVA 2AYBA 2F1FA 4ETXA 3OJUA 3W61A 1SJFA 2R8JA 4IH7A 4X62F 1L3UA 3ZTSA 3L7UA 1UFWA 2IM2A 2QTWA 3PJ9A 2ZWPA 4F67A 5IV3A 4NMLA 4Y0FA 2HFNA 2XWXA 4ZP6A 2CJKA 5E0OA 1L3VA 4ZVOB 1EARA 5LSLA 2YX1A 4F4KA 3H5SA 5F9NA 5HROB 1XQIA 3QSYB 1LFPA 4ITSA 1K73T 5GAHU 2ZBCA 3MAAB 1RJJA 3D0IE 4H4OB 3GILA 1RU1A 1WF0A 2FJAB 4A8SA 3IXQA 1YITS 1V6HA 3FGVA 2MZQA 4UZBA 4DR2F 4OIXA 4WYWA 2ZJQQ 2Y1LB 3NCQA 2MQPA 3W5ZA 5EWEA 3CTRA 1NJIT 1PILA 3TUZC 1O0PA 1R6VA 1M5OC 4I2QA 4PYAA 3SCLE 1VJQA 2B9YA 1WOSA 2EFGA 2GJFA 3SCJE 2VD3A 1HWKA 5HVHA 2WOMA 4IQXA 5IWAJ 1TL7B 2WZ1A 3PJWA 4Q2MA 1NPRA 3AT1B 2QRRA 4M94A 3VQSA 5ETVA 1OMSA 3KLGA 4DPOA 4M5DB 4ZJOA 5A8RB 1HNIA 4B9TA 4LT6A 4BLGA 2HNYB 3G8QA 4FYXB 4CLPA 2XLIA 2PO4A 4DUZF 3D54A 4Y34A 2B9WA 3QNWB 2WK4A 1BHNA 3CD0A 3DOMA 2FLLA 2W2OP 4JI1F 4LF6F 1RT5A 4PUOB 1C4CA 3Q86A 2FVCA 3U1NA 4O44A 1KN6A 2ZBRA 5F8MA 4OHXA 2MY8A 3GE9A 1A0OB 1F2GA 4M5MA 1NKBA 4F2SA 2AU0A 2NQPA 2HKEA 1P9QC 2KL8A 4Y65A 1CG2A 2X1FA 2F65A 3BKFA 4FF1A 3QO9B 3QWUA 2UU9F 3BO3A 1LV5A 1EZZB 5GAEU 3OLBA 1LNQA 2ZJRQ 2GVDB 4DZ6A 4QU6A 1RBLA 2B51A 5ETLA 4KT0C 1EX8A 1YG0A 1C1BB 2MY7A 1PC5A 3IAS9 2E1MC 3DLLQ 5M2UA 1RXOB 4QYRA 3H20A 3US5A 3WZ0A 1RP5A 3N0VA 4TN2A 2HHWA 1H6KX 3KJNB 2M8DB 3PW4A 2FPHX 4WWSA 1KQSR 1M5PC 1DARA 4DR3J 5L1LA 3GCXP 4MAKA 5B0CA 2ZH8A 4CIOA 1Q81T 2FGOA 4ZP7A 1QSSA 2XS5A 5KFMA 2OPSB 3V6DB 3HHLB 1QSLA 5G0RA 3POTB 2FJXA 1K44A 4KR0B 1BWVA 4DCPB 1S0MA 2LXIA 2RJZA 3GWCA 4CTAA 3UW1A 4AQYJ 2KJWA 2OIHA 3BN7A 4QIGA 1RAEB 4WU3A 2LU2A 2XG8A 2KN4A 2J6TA 1WELA 4AXJA 1HMVA 2HVEA 3BO2A 2WVBA 5KOWA 4UF4A 2UUBJ 2AYEA 3ZTOA 3HK2A 1NMEB 4KRWA 1JX4A 3UCUP 3RB6A 1GNKA 1RWPB 5E3PA 4MFBA 3T1HJ 3D2WA 4F04B 2BANA 2YBVA 4KPYA 2M0GB 5M2RA 3NL0A 3MI7X 1U1PA 3O8WA 4C9DA 3DLGA 3RR8A 4UUWA 2V6AA 4PG6A 4DR1J 1VQ5S 1NHUA 2G2YA 4DL0C 5A6WA 2PFFB 4OYBA 2V8PA 5CYQA 4X66F 1RAGB 3BPDA 2Y8YA 1W25A 2GMJA 2COLA 4I7FA 2J5AA 2FD2A 2HQGA 4KC5A 2BR0A 5DDPC 4Y2AA 2VA3A 5DG8A 4DV1J 2XLKA 4LSNA 5BR8J 2HBYB 1PCAA 1K0VA 5KG2A 2Y0BB 1GAOA 3D67A 1XNRF 3HHDA 5KT7A 2K1RA 1IKVA 5A0YA 3R1LA 1U0SA 3ILIA 1V9OA 3FNNA 4A8QA 4NYOA 2VFSA 2H51B 3HDSA 3KHGA 2YWEA 3L4BC 3NP5A 5A2QY 5A8WA 1VCTA 2RKIB 3KFWX 4DX5A 1MWYA 2B9XA 4B9MA 2DY9A 3PW7A 4DV2F 3C6UA 9ATCB 4YS2A 3ISNC 2XY6A 4DUYF 3LWMA 2QIFA 4EZ6A 3V4IB 1FNXH 1HQ2A 3VALA 1WEXA 3U27A 1X31C 2QYCA 3K5MA 2E5IA 5G4DA 5EX3A 2HSEB 3BYPA 2DHGA 2J8SA 4EO8A 2V2ZA 1HHSA 1K47A 2J9DA 1X60A 2CZ9A 1NPPA 3HVRA 3QIPA 2NXUA 4NCGB 3TQEA 2DPIA 4B08A 2CJBA 4Q45A 3GJQB 1U8WA 2ZH7A 1JLFA 2RQ4A 2KXFA 3MR3A 3A3NB 2GHPA 1N6QB 1GTEA 3R9LA 2VPZB 4A8KA 2GIRA 1WKLA 2FB0A 4X64F 4JI7F 3O1LA 4WBFA 4WYLA 3L7OA 3LP1A 4MYUA 3OUYA 4TY8B 2VKZG 1HNZJ 3T9ZA 3M9OB 4C8NA 2XHWA 1UCNA 1SBRA 3W65A 3R7BB 1F1BB 3NOCA 3OFEA 4ER8A 4TU8A 2EBGA 4DV0F 3QT7A 1VHIA 4C6AA 1FDBA 2H3EB 4RL1A 5LOQA 4O3PA 1FX2A 4FF4A 5B0DA 2C2EA 5DQGA 1U49A 4WK1A 1RK8A 3W60A 1RQ0A 3CULA 2Q6BA 4NXMF 5L39A 1TFYA 4OYOA 1RB0A 1LXJA 4IH5A 1FDDA 1U45A 4B3TF 1JB0C 2XULA 4X84A 3LP2A 4Y00A 4GKKF 3NNAA 3DRSA 2R2SA 3UVJB 3AXMA 4FYVB 1NJXA 2JFKA 2AZ3A 1IXKA 1XMBA 3CJ3A 1U1NA 3DLHA 1IQTA 3PFEA 2EPIA 4USVA 2ZC4A 1TKDA 3HD2A 2VPWB 4JI2J 4D3GA 2NXJA 3HHNB 2GQQA 2W7OA 3EGVA 4PEOA 3KYLA 2A6OA 3N6MA 4ID5B 2CJ9A 5KG1A 1K0TA 4KIAA 1NZAA 2IA6A 2YPZA 3M8RA 3NGDA 3WQPA 2FJEB 1DFDA 2AYMA 5T14A 5IWAF 3Q24A 2O66A 2Z2YB 2DNHA 1WHVA 3GJTB 2R7OA 3PY8A 2GMHA 3CD7A 4X4TA 3AFGA 1IVZA 5DRKA 1HNWF 2IDLA 3L09A 5KFNA 2ZZNA 3GMGA 4Y6IA 1REVA 4IR1A 1CJTA 3HD1A 1KLMA 4ED7A 3RG6A 2I38A 1RYRA 1VISA 4U8VA 2RF2B 1RT2B 1OYEA 4UT4A 4HH1A 2R7UA 2VBXA 1FVQA 2L41A 3UD4P 2IYIA 1WACA 1AB8A 3SDEA 4G6VB 2GIQA 3LOUA 4NA1A 3DRXA 2PEBA 4HDGA 4DPYA 2QL9B 3GU0A 2B7CB 4ENOA 2IJFA 3CWJA 4LFCF 1RWXB 1U26A 1VQKS 3IRWP 3KUEA 2CPEA 2XGQA 3R5DA 3LP0A 3MEDB 1EETB 1XERA 3IBCB 3CD5A 4OZ3A 3PEHA 1HHTP 1FXDA 3PRBA 4NPOA 3CCLS 1MN7A 1T9WA 2XGPA 2BBEA 5IQ6A 3BS9A 1T9XA 5J1NA 5BYRA 2K3IA 4LF9J 2JC0A 1P9YA 2ZE2B 3K59A 1U48A 4DL7A 2BQUA 4WKRA 1A7GE 3VZIA 4DFMA 2YKPA 4P52A 2JRSA 1R3NA 2CQDA 4I64A 4X4SA 4NCBA 1RHRB 2FUG9 1V3SA 2Z57B 4DSIA 4HYKA 3HLUA 2DXEA 3BH6B 2ZM6J 2P8IA 3VR1A 2DNZA 4F4XA 4WFZA 3MM9A 2JVRA 2GIFA 4IO9Q 3ZZOA 3PTWA 1SC4B 1T3NA 3MM5A 3LPEA 4N8OA 4AQYF 2VV5A 1X8DA 3P96A 2DNLA 2PMHA 4OYZA 3PX6A 4USJC 2J0QD 1X5OA 3DU5A 2C2MB 4XDCA 1TL4A 3MEKA 4AFFA 2PC6A 2R4FA 1RBOB 4W90B 2JEGA 1RI7A 1DTQB 1WG4A 2DNMA 1WC3A 2MQMA 3I0RA 4M95A 2QYGA 2VQFF 3X3UA 1Q4RA 3BBBA 1QTNB 5ETKA 2ZH4A 3HZEA 1NB7A 4DLGA 4CH7A 4KHMA 2LEBA 4CM2A 1M1HA 2F4VJ 4IOCQ 4K4ZA 3J7AN 2BE2A 2YNGB 3AA9A 2E66A 2FY1A 4PRFA 3OL8A 4TVAB 5FDLB 1CS4A 2HFVA 1TU0B 5LXRA 2ACYA 2Y9HA 4I56A 1N5YB 3DRRA 1DTTB 4B02A 3R3TA 1TKZB 4A8XA 1ITPA 1N34J 3HFVA 4XPEA 5GAHI 4BCAA 2AP6A 1VQLS 1BQNA 3ISND 3OD2A 4OZ2A 4A47A 4EI2A 3GFYA 3CJRA 5KFJA 4LRCA 3VAGA 3ICLA 3WHIA 1D8YA 1HNXF 4NZ7A 4ED0A 2J8AA 4LSLB 3K58A 3R1HA 3CEDA 5F8GA 3EYZA 3SQOP 2L3MA 4YHHF 2EFOA 3MR2A 3TAQA 1K1SA 1LKZA 3LO3A 1RHMB 4OLPA 5DS7A 4W92B 4C8LA 2GNKA 1U6FA 4YR0A 1KTVA 2EFQA 4NRTA 3PJXA 5HL7Q 2KT3A 1UVJA 3EWGA 4P7VA 2V4QA 1FTRA 3NWGA 4IG0B 2DNGA 2DGOA 3DOLB 1DBDA 1N48A 3CIMA 2BABA 2WONB 3AOCA 1WOPA 2HFUA 1X4CA 2VIHA 1Z4UA 4NEYA 1YRXA 3UN5A 2XO7A 4X4VA 2DY1A 1B70B 2Z2LA 1MG7A 4U7UD 3SMZA 4KO0A 1RWVB 1SH0A 3KLFB 1FRLA 3QJPA 1LQ9A 1W2BR 2BOPA 1S49A 1X9WA 5IT0A 1N36J 4CH0S 5RUBA 1MLAA 3DCAA 3G6YA 2OFGX 1NB2A 4YQWA 4IUFA 2G1HA 3D6HB 1Q82T 3CMES 4PCQA 1CJVA 2JEJA 3M8PA 3PX0A 3VAKA 2RD5C 4RBVA 4URSA 2ATLA 5D0EA 2LXUA 4YR2A 3N01A 4OX7A 2AJ4A 5I42A 3HVTA 5A8KB 1FCAA 2MQNA 2M9KA 2W8LA 2GAHC 3J7YU 4P72A 3T1YF 4FS2A 1B0PA 1GMWD 3DMJB 5J2NB 1VDHA 3N6NA 2JDJA 1URNA 4QIVA 2WTFA 2XNRA 1RAHB 1IJEB 1X5TA 4ZPDA 2LP4A 4ETZA 4DV3J 1DQ9A 3UFCX 5KG6A 7AT1B 2HBRB 4PQAA 1FD2A 4C4WA 3NS5A 4PG8A 3OFHA 3ZFVA 4U9RA 2HLUA 4QIEA 4PG7A 3VVUA 3T5KA 1CPZA 4ZMMA 3MFHA 2HMIA 1SC1B 4ZVTB 1QUPA 3OTOF 1MROA 1VRTB 4RX6A 1SUQB 1MNEA 5A2QU 2VG7A 4ECTA 2YWWA 4GO5X 2HGNA 3QRQA 4F4WA 3THPA 1JK9B 1KDNA 5HI7A 2Z0GA 2J9CA 3GIJA 2EBEA 3DI6B 4CLTA 2DCUB 4NZ0A 4DJBA 3C66A 1QLNA 1R0AA 2ADBA 5H1SV 4J9SA 2GGPA 1UAWA 1FJCA 2ZWOA 5D4LA 4CLSA 2QL5B 1HBNB 3ZZPA 1C0UA 4ZCMA 3PW0A 1DRZA 4CLWA 1R7IA 1N5TA 2YKMB 2LDYA 2AX0A 2X7IA 2UUCJ 4M5IA 1HL6A 3MM8A 4YY3J 1LWCA 1HNVA 1KR4A 1IKXB 2BM1A 2YQ3A 3VAIA 1JXVA 2G2OA 4B3SJ 4LQ9A 1U0HB 3DOKA 4QYZK 3UDLA 4L72B 1CULA 3MUMP 1F2HA 4CT9A 2ZUGA 4DSFA 3ENVA 1CSJA 3JQKA 1XTZA 2XZWA 5B0EA 4F4ZA 2AEMA 2DNRA 2HAIA 4RW8B 1N54B 1HHQA 3V4MA 2QV6A 1S9EB 1VRUA 1S48A 1SC6A 3IR6B 5KFXA 5GADU 1KVKA 1VBKA 4JUZA 1HQEB 3ET6B 3JYTA 3S7RA 4IFVB 3VQTA 3G9CA 4H54A 3KLVA 5IOLA 1VHFA 1FNMA 3VAJA 4USTA 4P10A 2VQEF 2P6SA 2QN6B 2DIUA 4ECVA 2AW0A 3N6LA 4ZIWA 3LF0A 3OFGA 3VGTA 4B9VA 4ZPBA 4Z7YA 3ITHA 2GHVC 3SSSA 3CDBA 3UDEA 3D6TB 3NXZA 4OYAA 3HSZA 2R8HA 4UOCA 2DISA 4LF9F 4ZHRA 5HP1A 1UJ5A 2LU1A 2B6AA 1WHYA 2K8GA 3GONA 4CNYA 1D9FA 1YJTA 4IQMA 2HHUA 2CQ3A 5C24A 2NLWA 4I2PA 4PPZA 3QMQA 2NYHA 1NH7A 3DM2A 2C2RA 2UVWA 2KYZA 2APOA 1XR6A 4RNNA 2AJQA 2LFVA 1JJCB 1V5IB 1FFSB 4W4MA 3NMRA 3FEZA 4KGXB 5F3ZA 3CMAS 5L1IA 2BEFA 3NBPB 3OR2B 4OX9J 4DL3A 1GX6A 5D0RA 4XIUA 3PV8A 3RBEA 4RW4A 1N0VC 2W2QP 3M6XA 1NHKL 1ZZFA 1RTDB 1F9EB 4DEZA 5IZHA 3A8KA 2DGUA 4A8FA 2J7WA 2OI2A 3H8YA 3SIPB 2LLZA 4PG4A 1FRXA 2XSFA 2YY3A 3TZYA 5IFMA 2HQIA 2G0IA 1BD6A 1RTZA 3KLEB 2LYVA 2XMTA 3K0JA 3DN9A 3DRYA 2RNEA 4MIBA 1PC4A 1ZAXA 3AY0A 1G7CB 2CG8A 3T3FA 2OTJS 3BGRB 3PACA 1ZZNA 2V2QA 1ZPVA 1IBCB 2D3UA 3ETMA 3UR0A 4USWA 2KVIA 3FFIA 1DY3A 3LGHA 3OL7A 1KOHA 1X0PA 2C3OA 3EM1A 2YQ1A 4UOFA 2F4VF 4R5PB 2GW8A 2PMWA 4Q5VA 4NCAA 1T9VA 1WF2A 4H4MB 4OZ1A 3MPUB 3OVAA 1IUJA 1RHQB 4HI2A 4TLQA 2XCPA 1F5AA 5KOXA 4JI8J 3NWRA 4LREA 3P3DA 2XI2A 4FP9A 3PCOB 4A4JA 4X4RA 1N34F 2VU5A 5BYSA 1OJ4A 5CHCB 1QM9A 4N8NA 2FZKB 3I4HX 2XQCA 4OFZA 3HPOA 5KFKA 1REGX 2V4JB 5D0HA 3N9UC 1FKOA 2CQHA 2RDIA 2YNFB 4LFAF 2AQ4A 2MQOA 2OLWA 3M2RB 1GMUA 1X4BA 4TNOA 1TR0A 2RMLA 3K57A 3T9NA 3TRGA 1IKWB 3BGFA 1E6YA 3W64A 1G3OA 2HEKA 4U6PA 1WD6A 4HTJA 3ZC4A 4PXEA 2AJ1A 5K8PA 3DNCA 5HAOA 4J9VA 5HQMA 4EBCA 1RYSA 5KT5A 4ZN3A 3G87A 4WFNQ 4C8KA 2DITA 2HAFA 1JNZB 4AXIA 2W7PA 2PA3A 3G8TA 2CJYB 2WVCA 1PG5B 1U7LA 3TEGA 2BXJA 2DH7A 2CQCA 3TX8A 3KTQA 1NSAA 5E7OB 3Q89A 3VTIA 2EI5A 4O3SA 4PWWA 2HWTA 3MMCB 4Q8FA 3BSCA 4KY3A 3AQOA 4TKTA 2F8EX 2KG1A 4LF5F 1WOOA 2W01A 3C19A 3PNIA 5IS2A 1VFJA 3TR5A 4ELUA 4LVOP 3KK1A 3WIUA 1EJ7L 1RWMB 2X1BA 4JI4F 1CC7A 3PYDA 2FLPA 4ED8A 4EBEA 5C42A 3M7VA 3T1AA 3FJ2A 1JLBA 1XIQA 1SL0A 3KLHB 2LEPA 2VBYA 1WEYA 2VG5B 4ATNA 1X5SA 1RT3B 2YKNB 5KFWA 2B56A 2GJ2A 3IGVA 4OV1A 4C2MA 3WC2A 3FZBA 3JS9A 5B7WA 1J27A 1HR0J 3I9V9 2HRYA 1SL2A 1WF1A 4KH0B 4DCOB 1ZPWX 2FYXA 3GFZA 1KHWA 2I0XA 1TL1B 4QWEA 4MIAA 3RRGA 5L46A 1WUUA 1Q95G 4EK2A 2IMWP 4ED1A 1XK8A 2GQ2A 4OYMA 1S1WA 3S6EA 2N3LA 2DGQA 2DJWA 2UVUA 4B3MF 2DXDA 1N88A 3V2UC 1CJUA 2W9AA 2XZTB 3E01A 3H25A 3S01A 2VG6A 1NK7A 3CCSS 3RTVA 1VC6A 2YXLA 5L8RC 4NX9A 4PR6A 3UR3C 4XO0A 2RDDA 1M1KT 3UI3A 1GMWA 2WBRA 3JAMY 1HWIA 4RR5A 2K3KA 3D28A 4DFJA 1TV6B 3CVKA 1T05B 2CPZA 2VL1A 3GV7B 2QA1A 3PIOQ 1CLFA 1CQNA 3FMWA 4MMOA 1RT7B 3SQGA 1VGYA 1IWAA 2HVIA 1FRIA 3CPWR 3M8QA 2R8KA 3H4BA 2G0JA 3IO1A 5B0BA 4URGA 4ZITA 1BQMA 2QLXA 4DXLA 1GXTA 1JKHB 2XMJA 2UXBF 4P2XA 1OPIA 3E8OA 4DL4A 3W2VB 1WNEA 1S59A 4FBTA 5ADZA 4ZA1A 2UV8G 2R8IA 2EK6A 1WKKA 3TAMB 3P49B 1TTHB 2ZH9A 3EJMA 4YY3F 4FVCA 4E98A 2ROGA 3SI8A 4L6V3 3B82A 2X51A 3A8JA 4B3SF 1S0OA 2E9ZA 2F40A 3QPIA 2HFSA 1X4FA 4N7TA 1S6QB 3AHPA 2WVEA 3HHKA 2HNZA 2ZH2A 3QYYA 3A3PB 3W8GA 1VRQC 3M2UB 4ECWA 1Q7YT 2HS3A 3Q8UA 2CZ4A 1FWLA 1I94F 1OO0B 1PAUB 4EUVA 1RTIB 2X3GA 4NLYA 1KONA 2I8EA 5C25B 3OPKA 1RTJB 2CFXA 1ZM3A 3G4SS 2B5JB 4L3NA 2R7TA 1W2IA 4EEYA 4U96A 2JSXA 4NLDA 3VAMA 4NOHA 2YKOA 4HT5A 1F0XA 1J5OA 1FJGJ 2WW4A 3OR1A 5F8JA 4C3MA 1PGZA 1RE1B 3FRYA 4ED2A 2RE1A 4QWDA 3NNCA 4Y2KA 2XS2A 3KG4A 1HA1A 5LSOA 4I0WA 4DV5J 3D66A 1FKPA 3M1VA 3DRPA 2BUNA 2P2CB 3LTOA 4JYAJ 1VIXA 4NRUA 2F8MA 3C16B 4IYQA 1SQFA 1DZ5A 4LF7J 3H2LA 1HKAA 2WSEC 1TK0A 5EHHA 1D0EA 5KFQA 1FERA 4Y2IA 1EIYB 4HACB 4JI6F 4KFBA 3UCZP 2MLZA 2V68A 4LVNP 4M5LA 4DSJA 5I3UA 2ZC3A 3MECA 2K7JA 1U1KA 2NUHA 4L75A 1RLDA 3MPWA 2JL9A 5CH7B 5HMWA 2RS2A 2C2ZB 1X4DA 4ECSA 2W24A 4X62J 2RT3A 1H2TZ 4OLOA 5AXKA 5ETRA 3GG0A 5LJ3Y 2FDNA 3FMBA 1QE1A 3QFHA 2HRUA 4EBDA 2YWHA 3M8SA 3MD3A 2YWKA 3QQCD 2MZRA 2M70A 4DQPA 2O3DA 4ZVSB 4GVBA 4O4GB 2BJ1A 1HYSB 2J7UA 2EEYA 4OHWA 4K4UA 4CLKA 1AFJA 3EXYA 4O3NA 3HT0A 1Y3KA 1P27B 2CADA 1TK8A 3AB4B 1B64A 3C15B 1U47A 3QAUA 2HQDA 4UUXA 4WE1A 4DR2J 5L9XA 4DZDA 2M4MA 1CVJA 3WC0A 1ZETA 3MXHP 2X1AA 3OSPA 5BYQA 1ZOTA 1UVMA 3ADAC 4JP8A 5KFHA 4YB1P 4OZ5A 2IC3A 3Q23A 1S76D 2M2BA 1S79A 3IS9A 2LXFA 4J9OA 1FJEB 2DGTA 3M32A 3MR7A 2OPQB 5ETQA 1S6OA 3OXFA 4ZVUB 1RADB 3NGTA 1QY7A 1KHVA 2C3PA 4ZVEA 5AJ3F 4JI5F 2E7WA 3AODA 2XS7A 2R7SA 2OD6A 2CG4A 1NK4A 2DO4A 5LMUF 2KHCA 4QR1A 1Q53A 4DOZA 3VCDA 1SVDA 2XM3A 2OJ3A 4DUZJ 2RUSA 4OJ1A 1HQUB 1RBAA 1FDAA 4ZVPB 2CYYA 2DB1A 3OTEA 4NWBA 3R2DJ 4JI1J 4JI0F 3GTYX 2MZTA 4Q44A 2IJRA 3R97A 4LF6J 4LBIA 5J2MA 3H5UA 1K1QA 2KRRA 3HFZB 2WHOA 3IMQJ 2MGZA 2Y3YA 3DKDA 5IM0A 4NLQA 1KFDA 3CJTA 1RTHB 5HATA 1NH8A 3R5CA 4K4XA 4DUTA 1N8RT 2ZZMA 3TJ9A 3MM6B 1QAYA 1PJ6A 3OL9A 2HG4A 3ENAA 3M9NB 4XK8C 3OXGA 1SV5B 3IWLA 2MLYA 3QJLA 2B9EA 3HSDA 1F3FA 1G2EA 3KK2A 1S1XA 1RT1A 2UU9J 1HLWA 4RUHA 5FIIA 1RCOB 2EKYA 3D1HA 1QUVA 5HANA 3BH7B 2ZJPQ 3DDNA 4OI0A 4OJ3A 2OSQA 3HMJG 3CDEA 3TQ1A 1ZAWA 5J1EA 3JSRA 1IBLF 2BDPA 4FF2A 2BJDA 1EAYC 3R5GA 3J7ZT 2OMLA 1IN0A 3JSYA 5ETTA 2Z56B 2MSTA 2BZ2A 5E33A 5AE3A 1U6BA 4F25A 2M5YA 3HXMA 2RQKA 4K4SA 1NPKA 1X4HA 3EE3A 3K5NA 2RDJA 4CYUA 4I6AA 2MKIA 2IVFB 2E7VA 3SEOA 4DS5A 2BW2A 1HBOA 2U1AA 3VGSA 3K5OA 4ICLA 3CSKA 2DGWA 5ETMA 4K5RA 5AE2A 1HR0F 5J2PA 3G6ES 3QFWA 1NDLA 2OPPA 3FBEA 4LRFA 2AHOB 4K7QA 4K2JA 1FRKA 3G8SA 4I2QB 1SKSA 2KM8C 3KHHA 3ZZZA 2J9EA 3GYNA 4NLXA 4JV5F 2BV3A 3RZAA 4RW7A 3R27A 2IAJA 2MQLA 3HKZD 2WOMB 4X4PA 3AD7C 3ENWA 5LXYA 1MN9A 4RPFA 4C11A 5CA5A 4WKYA 2ZHBA 3GJSB 5GMKa 3KLGB 5L9NA 1HNIB 2V69A 5D4NA 3D3CJ 1NSPA 3EVWA 2ZOGA 1S72S 3CJ4A 1GK8A 3CD6S 4QWAA 3DOMB 4K4WA 1UJ6A 4X66J 1FDNA 1RT5B 2NSBA 1P8GA 3F44A 2QSFA 5B08A 2BM0A 4O44B 4OHYA 2PIIA 1F9FA 3T5JA 2GO8A 4BC9A 3HO1A 2R7WA 4ED4A 2O01C 1XNRJ 4M5NA 2VASA 1PYSB 4JOUA 2HZAA 4NZ6A 4ZCIA 4B9UA 2MQQA 5ETOA 3MMAA 3TZWA 2CNLB 2ASYA 5GVQA 5T41A 3DDKA 1NDPA 1TL3A 3I0SA 3A8EA 5CAAA 1PKUA 1S9FA 2BRLA 5LM7E 1YGYA 3IRXA 3TUPA 4K4YA 1OYDA 3CCZA 3GB0A 4HT7A 1RHJB 4DV2J 1T94A 2W9CA 2IMOA 4DUYJ 4M5KA 4LIWA 2DRAA 4J9NA 1X4AA 4DMZA 5CYJA 1WG1A 2ZNZA 4IG3A 1UVLA 3W8PA 4XDDA 3MD1A 1NRKA 3AJDA 5M2PA 1IKYA 4DU7A 5J2QA 3VAHA 2Y1RI 2ZVIA 4E2FB 5G0RB 1UPMB 3VZHA 5EGYA 1RA6A 3EDQB 2A0FB 3I9ZA 3EPIA 3W9JA 3P5TL 2KXNB 1FJGF 1HPZA 4CTAB 2AV5A 2GA7A 3MCMA 3NCRA 1SJQA 4NLGA 4JI7J 1UVIA 1WC1A 2ALYB 4KB7A 2D9PA 1HMVB 2QA4S 1Z2LA 1Q16B 1YZ6A 1XJWB 1PIEA 4DV5F 4F4AA 1OSCA 1U25A 4JYAF 4NLVA 3FCVA 4RZRA 2AIRB 2ZVSA 4LF7F 2G1DA 2HQFA 3M4XA 4MFBB 4WFYA 2AEFA 2BANB 4DQQA 2CQPA 1B0VA 2KB2A 3NAHA 2VKRA 4DV0J 2LEAA 4HH0A 3T5HA 3KK3A 5HSPA 4J37A 3EMTA 3O6QA 1B7YB 2F5GA 1HWLA 3O2IA 1RAOA 1Q86T 3H59A 4PPDA 2XYGB 3FQLA 4P6QA 4NXMJ 2QL7B 1Q8LA 4FXWA 4V19X 2CQGA 2C3YA 3DGPA 3FZ2A 4Q7AA 3IWXA 4R25A 1XEZA 3JAMU 2F8HA 1Y5NB 5CYQB 5D77A 3QRRA 2DH8A 4B3TJ 2OEJA 3HJVA 2HWIA 2CJQA 4I7FB 1FTCA 1FE4A 4JB8B 4WIIA 1ZS6A 4GKKJ 1WHXA 3QGPA 2DT9A 4LSNB 4HHHA 1Q8KA 1S0NA 3R7NB 5E3CA 3VF0B 4IOBA 3GR1A 2K1RB 1IKVB 5A0YB 2GQCA 3JSBA 3TVZA 1YX2A 3P8BB 3CCUS 3ILOA 4LSZB 1E6VA 5CXTA 2DO0A 1LOUA 4ED6A 3U02A 2FHJD 3GIRA 3D6FB 1FRHA 5A8WB 1RWWB 3MR5A 2J9DE 4X4NA 3PHTA 1UEKA 3DYAA 1EQMA 5CYMA 2DR9A 4QZVB 4DG1A 3C6UB 3G82A 1VQOS 1R8AA 1UW9A 2EFVA 2C42A 1TZ0A 2RHQB 1PYTA 1M5VC 1IBMJ 1Q78A 4DF4A 3BB5A 5H9EJ 1M1GA 2GFFA 2IM3A 4LUBA 2Z30B 3T6JA 2CPXA 3CCES 5IT9Y 5DDOC 4J7CA 4CO5A 3BKUA 5KFRA 3T6BA 1SH2A 3C8YA 1HNWJ 2CDQA 4LBHA 3MPYA 3QIPB 1VQ4S 2MB0B 5IQQA 4TY9A 3BF4A 1JLFB 2MYFA 2M8HA 2PI4A 3WX8A 5KFOA 3H0PA 2Q79A 5KTQA 4KSEB 4B3OA 5DQHA 4ZVQB 5EWFA 3D0GE 3LP1B 4DR7F 3OUYB 2FVSA 1TKXA 4KKOA 4O3OA 1T9TA 2DYAA 4LFCJ 2XSJA 2QLWA 1M5HA 2VJUA 2IPOB 3K2YA 3A12A 3UNGC 3ZZTA 2PMZD 3SCKE 1SJRA 3PW2A 5KFPA 2BE9B 4WTOB 1PBUA 4DR4F 4LF8F 1AYEA 2JC1A 2FQQB 1T02A 4QQBA 3MAHA 2EVZA 1Q8BA 3Q2TC 3KJFB 3UNYA 4RWXA 4I68A 1Y10A 3KJVA 3CNQP 3T41A 4OI6A 2IYGA 1TP7A 3KG1A 4CRJA 3EGNA 1TAUA 4C0BA 3PYEA 1KD1T 2GC8A 3RBDA 3W2WA 1VI7A 3NGSA 3KLIA 1R31A 4UW2A 2QMUB 4X65F 2B4PA 2EC2A 3FSYA 5F41A 4AT1B 1QJHA 2KO1A 2W4DA 3RUBL 2XMWA 3NGUA 1DURA 1Q5YA 3LP2B 3NAIA 5HBMA 1S1VA 3DRSB 2QLBB 3A4TA 4QCLA 2ZZTA 1TUVA 1KC8T 2CWKA 5B0AA 2IA0A 3ULHA 2E9TA 1VK8A 2CQIA 2AWZA 2DCLA 1JLAA 3GYXB 1RABB 2L08A 4F3OA 2EG1A 2FZGB 3CCQS 1YVFA 1WDTA 2MXYA 1C1CA 2VDHA 3PO5A 3H7HB 5K5MA 2YH1A 1TVRA 4CCHA 2CQ4A 4KGZB 1Y0HA 1FVSA 4F0HA 3W5XA 1EP4A 5L38A 3V81A 2QG9B 2BMBA 3IG1A 1S12A 3PX4A 2VQFJ 2MDAA 3UE2A 4DS4A 6FD1A 2CPFA 3GCWP 1N32F 1LWEA 3NGKA 4Q0BA 4K4TA 1BGXT 1FWPA 2B7BB 4GKJF 3BSAA 1PYOB 2HS0A 3TJ8A 2XMAA 1REVB 3UPFA 3J7Z5 1CJTB 4DR6F 1KLMB 1UKUA 1KSPA 1YKWA 4RW9A 3M30A 2MKYA 2JH3A 1NSQA 3GZ7A 4JBCA 3DGVA 4NLSA 2KJVA 4OZLA 4ZCLA 4A8YA 3DLJA 3SDEB 4WK3A 4LIRA 3TNVA 1RT6A 3PFOA 3K5PA 4EYHB 4WP3A 4OJHA 3I56S 2DGVA 2BJEA 3LP0B 1PSDA 1HNXJ 4TQSA 4KHRA 4RLEA 3UDCA 1S57A 2AGPA 5DLFA 2B4UA 3H42A 1IQZA 4E8UA 2OPRA 1VQSA 2N4DA 4WP9A 1N4LA 2DKOB 4NI2A 4WCEQ 2IRXA 2HHTA 4KV8A 4YHHJ 2JLEA 2NXNA 4YDDB 1TKTA 2HNDA 3ZZUA 2PE8A 3MOZA 2CPDA 4DL6A 4J9RA 3WBZA 3MMBA 1Y9OA 2ZD1A 1SQEA 4EFAC 2BYCA 2QLJB 1NUEA 2FJDB 2LQ9A 2KT5A 5LJ5Y 4RNFA 5D3GA 3HSJA 5F8IA 1IWGA 4MK7A 4IRCA 3BO4A 4ZDNA 5EDWA 3MWBA 4ZLPA 3M6VA 1MWZA 5KFYA 2G4BA 2CNOB 4YMEA 1FWKA 1NK0A 1MMLA 2BQRA 4RNHA 2FC9A 2JNJA 3ILJA 3MM9B 3KNAA 1LWFA 2ZBPA 3CIZA 4FNHA 4TQRA 2VB6A 2IFXA 3MM5B 1HWJA 3U7JA 1O6XA 2VUGA 3PEJA 5U47A 2LCWA 5D78A 5KT6A 4CLFA 3QLHA 2H48B 3MEGA 3FBBA 4LR9A 3I87A 1KOOA 2L48A 4FDFA 2WRMA 1YZ7A 2BJ8A 3MEEA 4FYWB 4GVLA 3J81j 1JMTA 3UN2A 3SZ2A 1U2RA 3CUNA 3QJJA 1HBUA 2MHNA 4C8MA 4L3KA 1C0TA 3I0RB 2WVDA 5H9FJ 2V34A 4NLOA 5CD4A 9RUBA 4LRDA 3OXLA 1TMMA 4TU9A 4DQSA 1YRTA 5BXIA 4DSEA 3CF5Q 4QW9A 1Q5VA 1FK9A 2V8HA 1UVKA 3ZZRA 2BE2B 5ETPA 3FK4A 3T1YJ 5HLFA 1RT4B 4JV2A 2A2CA 3CO0P 1VQYA 1CS4B 5E5NA 3CCJS 1I5OB 4PXDA 2CQ2A 2J0WA 4IFYA 1QVGR 2Q43A 3I31A 3TUJC 4WFAQ 3DRRB 1NJWA 3RAMA 2XNQA 4ZVGA 2DHXA 3W9HA 4RUCA 1BQNB 2RQCA 3RAQA 5E2QA 1JNRB 2K06A 1FFWB 5FD1A 3L3CA 4IDKA 1DLOA 4RBUA 3OTOJ 2MJNA 2I6WA 2OEMA 7FDRA 5DDQC 4ZIVA 5KAKA 2IHR1 1JJHA 2W9BA 4I69A 2HHXA 4DWIA 4F50A 2XC9A 5F8NA 1FF2A 1WDDA 5K14A 3LGMA 1D9DA 4MT1A 3RB0A 4WXOA 1GFWB 3N28A 1YK9A 2HIQA 5ETSA 1IR0A 1S1UA 1IBMF 2H9ZA 4I4BA 2LDIA 4ANCA 2DBBA 3TA1A 1HBMA 1LW0A 2FHJA 1R0CB 3W7BA 3AAWB 1SB6A 3C14A 2KYXA 3KMQA 1DQAA 3D7SB 4MKBA 1AZSA 1SPBP 2GJIA 1SJ4P 2AGOA 4OZ0A 2NUUG 1KWMA 3RR7A 2XCAA 3HVAA 3MPVA 3BSOA 2BJ3A 4AUKA 3UN3A 2GVZA 3OFFA 2W4CA 2R3VA 3FDSA 3EUNA 1KQGB 4KO0B 2AJ0A 4JV1A 2YNHA 4ZKAA 1CJKA 2B0GA 3MCOA 4FKXA 3HF5A 2POKA 4QU7A 4DX8H 4LRAA 2UXDF 3HULA 1XMQF 1S6PA 4ALZA 4ERDA 1T03A 3A3OB 2ABYA 2C2NA 3W5YA 4WF9Q 3IA0A 4I1TA 4WJBA 3BR9A 5DETA 4WFBQ 4L73A 1MU2A 4HACA 3TA0A 1CJVB 4HVZA 1JLQA 2ZFHA 4CLLA 2VQEJ 3M8PB 4ECUA 1YQHA 1ACMB 2AJ2A 4CNZA 1S1TA 2R7XA 1ULRA 2HHQA 1JLGA 1URRA 3H5XA 5DG7A 1RWNB 2QO3A 5I42B 2IBKA 3HVTB 2DRBA 4AL5A 5HMYA 1U1OA 1W26A 4PKDB 2HHVA 4UOHA 1D3WA 1VC5A 4F0KA 4J9MA 4MKVA 2ASDA 1NHVA 1QAXA 3TA2A 4DLEA 2HYIB 4UZCA 1R6YA 4FXDA 3CDWA 2NXCA 3BM7A 2HK3A 1TL5A 2HGMA 1Q1KA 3ZTRA 3MDFA 4P75A 3NRBA 2P9GA 1IM6A 3DLKA 4XPCA 3GJRB 3M2VA 2KU7A 2FTRA 2X3DA 5KFAA 4PAAA 1S7HA 1UETA 4USUA 3M9MB 4QWBA 2HMIB 5F3TA 2HHSA 5IV4A 2F9JA 1MROB 2VG7B 3GIKA 3R5JB 3DHWC 2XY7A 4DR5J 3MR6A 1SKRA 3B4MA 2XBPA 1S9GA 2Y8WA 3WDOA 3PRVA 2XYPB 1RAAB 1MMDA 2NS1B 1KS2A 3B78A 1Y5IB 2JWNA 3QZ7A 1TQLA 2E44A 1R0AB 3DLEA 2GGPB 4G3IA 2IM1A 5T7LA 2AYGA 4MYTA 1C0UB 5MAOA 1QVFR 2CNKB 5DZ7A 3JSMA 2E5JA 3OL6A 3QATA 1VS3A 3MM8B 2C28A 1LWCB 4ZPVR 1HNVB 2Q6CA 3PDNA 3UWTA 4YR3A 3LALA 1GQEA 1QD1A 3DOKB 4C3KA 4NMXA 1CULB 2B4OA 4EMDA 2XHCA 4J90A 1YI2S 1JIHA 2L9DA 5DM6Q 1KTQA 4Z7CA 2LKZA 4G1QA 3Q8VA 4URQU 3RB3A 4ANDA 3M05A 2KDOA 3MPDA 1VRUB 2NYIA 2ZH5A 1UA1A 4RNMA 4ILRA 4J9PA 4A48A 5KFCA 2V2KA 1M0SA 3CJKA 1B7FA 1UWBA 2W2PP 1UPPA 2EG2A 1LXNA 3Q83A 3JYTB 2AJFE 3D6MB 3KG0A 1N52B 4ZP8A 2NXEA 4LFAJ 3T19A 2NZ4A 3G96A 5DGBA 3C6TA 3O44A 2XMVA 1R8HA 3I5CA 4ZVHA 2WB4A 3Q8SB 3QWPA 5CZXA 1R27B 4DV6F 2FC8A 3ITHB 2PI5A 2PSZA 3LWLA 3HHLD 3P4UB 2D9OA 3BQ1A 4C48A 2YTCA 1U2FA 1AFIA 1M5KC 1JLCA 4DBQA 3PKYA 3HHEA 1F5CA 1U4BA 4HTIA 1L3TA 4RO0A 2HRTA 2W2MP 1OY9A 4NXNJ 4ZHRB 2ZNYA 3TAPA 5SZTA 5HP1B 4ZJQA 3DHXA 2B6AB 1VBYA 4CZCA 2XY5A 4OZNA 2E29A 3IR7B 4ELVA 5B0FA 5C24B 4KQZA 4I2PB 2LVWA 2VJVA 3PW5A 4EZ9A 3LUYA 4NLTA 2LQBA 3RU0A 3DM2B 3VAFA 3CW2C 2JHEA 4AD6A 4NLUA 3GR0A 3H40A 2A6MA 4JI3F 3QT6A 1QAIA 3OVBA 4ES1A 2YNIB 1HI1A 4LF5J 3K89A 4RW4B 4ES2A 2MZJA 4EGLA 4FBUA 1W7WA 4BWJA 5B09A 4M1KA 4JI4J 4AYBD 5K8NA 4IO1A 3LQVA 3BBFA 2JVOA 2H4YB 3AD9C 2P9CA 1FHTA 4RU2A 3NGRA 5GAEI 2ZBQA 2O67A 8ATCB 2AGQA 3FFIB 1MMNA 2I5JA 3W66A 2RU3A 1VQ7S 4B3RF 1JLEA 2KG0A 2HIYA 4OJGA 2CVIA 2D74B 4Y2MA 2OEKA 1RZMA 4DPXA 1JXLA 2IDEA 4B3MJ 2DR7A 5KFGA 1N33J 1RCXB 2VOPA 3GIIA 2AD9A 1WC4A 2F7VA 2XLJA 3MZIA 5CCMA 2M88A 3CJ2A 3B6BA 4CWBA 4PWDA 1H7XA 1HW9A 5DQIA 1KBRA 5C7PA 2VC1A 4P2SA 2BRKA 1FKOB 2CPJA 2GHWA 1U24A 2QA2A 2KHDA 4TU7A 3R7SB 1SKUB 1U1MA 4PQUA 4HEA9 2BKPA 2ILYA 2VFTA 2ROPA 1T0TV 5DZ6A 1RHKB 3KNGA 1U6ZA 3TZZA 3CDUA 4NLRA 1X9MA 3MM7A 3G6XA 3EZ5A 1E6YB 3KKFA 5A6PA 2DPJA 4Q2LA 4IRDA 3GFHA 2UXBJ 2YKAA 4R8UA 3PG9A 2CA9A 2A10A 4JV0A 3I55S 1NLKL 2EW9A 4YP3A 3TEHB 4G65A 4WXWA 4USKA 1UJ4A 3CMQA 1Y4ZB 3MMJA 3NS7B 2HZCA 1H2VZ 1U02A 3VV2B 4Z37A 4CLZA 4TYBA 2VONA 3BEGB 4CP5A 5JXSA 2VA2A 2ADCA 1G4CA 2FVQA 3CCVS 2ATCB 3ISZA 4PXBA 4YFUA 1I51B 1N56A 2LA6A 5C2GA 2YX4A 4ZCKA 1WC5A 4OZJA 2DEJA 4F3QA 1LW2A 4NA2A 5IT4A 1I94J 3KK1B 2DNOA 3CB4A 3K7RA 1BLUA 4DL2A 3Q22A 3CDAA 4FPRA 5C42B 2HHPA 2RHSB 2Q66A 1JLBB 3ETOA 4KHPF 4IRKA 3GSDA 1YWXA 2RS8A 3BDEA 2PDAA 2CQBA 3S8SA 2RUGA 1TUWA 2OTLS 2YQ0A 1SIWB 3FEYB 4CI0B 5KFSA 2R9LA 4OI3A 4OYPA 3VGUA 4J9LA 3AOAA 3FEXB 1U1QA 4J5OA 3ZTPA 2QMWA 3PR4A 5E41A 4BHQA 1RAIB 3JTPA 2LQ8A 1XMOJ 4ES3A 1S1WB 4U95A 2ZHAA 4JI6J 3I32A 1FXRA 2NPIA 2C22A 4CDIA 3P6YC 5HROA 2NPFA 4ILLA 2UV8A 5BJRA 1CJUB 4GC6A 1D1UA 3HZGA 1GH8A 3FKBA 2Y1JA 3R6LB 3E01B 2VG6B 3MAAA 5HVGA 1F5BA 4H4OA 1B99A 4MK9A 2C2DA 1ELOA 4USMA 4ID8A 4OL8A 4DN0A 1Y11A 1ZM4A 2KT2A 3W63A 4QWCA 3KUHA 2CUYA 3SXLA 2JJ4D 2V8VA 1FRJA 3FSIA 2ZH1A 4DR5F 1XN9A 3SQGB 3M8QB 3OTDA 1NM2A 1BQMB 4DDFA 3PR5B 1O8BA 1IR1A 4C3LA 3QBCA 2DHHA 1TL7A 3U1LA 2CPIA 1KRPA 2BX6A 3FC9A 3A13A 5CZVA 3CCMS 4M5DA 5A8RA 2CDRB 1WKJA 1H2UX 2JEFA 5D0GA 2W1BA 4U67Q 3EVMA 2HNYA 1AA1B 3EGWB 4J9UE 3U1MA 1J2VA 4DV7F 3FCWA 2HWHA 4PUOA 3DDIA 5AJ3J 4JI5J 3L95X 2HNZB 4NYPA 4I6YA 1KFSA 2VHGA 1UMJA 5LMUJ 4WU2A 3SSRA 4X4OA 4C7QA 1ZBTA 2JX2A 5HMXA 4GMKA 3TO8A 2P9EA 5JJBA 2VBZA 3HFKA 2Z2ZA 5DJBA 4FKYA 3RRHA 1IM4A 3PZPA 3ILLA 4JI0J 4WZMA 2F4FA 2C3UA 4YUDA 3W9IA 1FO1A 3BGOP 1J5OB 3OR1B 3QO9A 1YJ7A 1S5ZA 2PGCA 2BJ9A 5HVFA 2SXLA 2QSWA 2AF6A 2XYHB 2CPYA 2GVDA 5KG0A 3BGUA 4C0OC 1RACB 1C1BA 4A8WA 2E7XA 1FKPB 2DR6A 3M1VB 4F4YA 3DRPB 2FGCA 1VQNS 2BOAA 4RUBA 5D6GA 5CD4H 1MSWD 3KWMA 2RVJA 2QLFB 4NXNF 2EKNA 4KFBB 2JLFA 4UY8T 2DNNA 3FBCA 5I3UB 3BQ2A 3MECB 4CQ1A 1YDLA 3OT9A 2OELA 4V1Ak 1VK3A 1IBLJ 4NEZA 2OPSA 3AXKA 1I3OB 3V6DA 3HHLA 4ECXA 2ALZA 4L74A 3POTA 2RH3A 3V6HA 2QFJA 1T11A 1WEZA 2WCXA 3HX9A 1KP6A 1VQ8S 1XC9A 3IM9A 2C1EB 2HW3A 1YBTA 5E3QA 1QE1B 1NK8A 5GAGU 1BMQB 1R8BA 2DRDA 2LQ5A 4BDPA 4GVBB 2KFZA 1M90T 3TUIC 5I3QA 1UL3A 4A46A 4XTTA 2HK2A 1AXQA 3CJ0A 1RA7A 1JJ2R 1NXIA 2CAJA 2V5HG 2XZDB 3F41A 5DLGA 4B9NA 3KHRA 3UQSA 4O0NA 2LECA 1S99A 4WE1B 1VJWA 4DCJB 2QC3A 3GPAA 3JTOA 4KAIA 4OYXA 3WIVA 4LR8A 2NREA 2AKWB 1WTFA 3EZOA 3NMAA 3WX4A 2AEJA 1NK6A 2DK2A 2IC3B 3FVYA 4JV5J 3ZZ0A 3KUGA 3QT8A 2R8GA 3IS9B 3M32B 4WIQA 3ZNUA 4P2FA 1HD1A 1QDUB 1HFEL 3E51A 1X0FA 1N33F 2DD8S 3K17A 3EICA 3J80Y 3F0NA 3SYZA 1UFKA 3Q8RB 3TYTA 1RKJA 1WI6A 2UXCJ 1UZDA 4Q43A 2MKJA 3EX7B 5J2MB 1R8PA 3IN5A 3JXOA 2MGZB 1PJ7A 5IM0B 1SXLA 1VR6A 1V3RA 2OGUA 3JQJA 1VLYA 2RKIA 2J0XA 4NE9C 5EUHA 5LMNJ 2MKKA 1VBXA 3KJQB 2QFIA 4DPTA 5LSRA 3LW5C 1N5VA 5KT3A 5F8HA 4MKAA 2DGSA 4CLYA 3AA8A 1D8ZA 4IR9A 1VC0A 1HWUA 3V4IA 2QZ8A 1Q0NA 3MF5A 2UP1A 1LK7A 2HLTA 2ZDPA 5KG7A 3KK2B 1S1XB 4ZVRB 1B0TA 1RT1B 3BZQA 3M8YA 2E1RA 1D9AA 2ZKTA 3UO0A 3I4PA 4DR3F 4YOEA 4RNOA 1T9UA 1Z2ZA 5J1EB 5CABA 3THTA 4NCGA 2J7KA 3D9BA 2W4PA 4ZOSA 4ZPWR 4EO6A 2V50A 4FS1A 1N6QA 3LH2S 4GRSA 4DL5A 3MHYA 2FLNA 3F56A 2H1YA 5AE1A 1N5QA 2KZZA 1FT8A 4N47A 1DQ8A 4KH1B 1YBUA 2FJVA 1SJ1A 4O0IA 1GMVA 2JFDA 4TY8A 4RW6B 2UUBF 1MWQA 4Q8EA 4G1IA 4MH8A 3RBZA 4CYUB 2ZHOA 1EKRA 2ZITA 4S0MA 4B9LA 4LR7A 4UQGA 2OSRA 4ZP9A 1HBOB 3T1HF 4ICLB 1U09A 4DN9A 1S7IA 5J2PB 1VYAA 2OPPB 3LA0A 4DQRA 1R89A 1KLNA 3PRDA 2UUTA 3QGIA 4I6WA 2JLGA 2Z58B 3CGIA 1TUGB 2DR5A 1GXUA 3FRZA 2HS4A 1UTAA 4DR1F 1RT4A 2YH0A 2N3OA 1HARA 4RW7B 2B3TB 2IAJB 3CCWA 1XMOF 1BY9A 3LAKA 2J0SD 4C11B 4C8ZA 3G86A 1F3VA 3FBFA 1SC3B 2UVRA 1WORA 4DV1F 5DO2A 3UVJA 2R2TA 5BR8F 5JVHQ 2FVRA 2IRUA 1TK5A 2W25A 3RBXA 1R43A 1C2PA 1YBAA 2GS8A 4M5JA 1S4EA 1G6BA 4ZPCA 2A18A 3MFIA 3UD3P 2DTJA 2RRNA 4AL6A 4ZJLA 4MK8A 4K59A 3OTCA 3FCHA 4ID5A 1RDRA 3N5BA 5EWGA 2LMIA 1JXEA 5KT4A 1CC8A 2OP5A 5I4MA 3MMAB 2G13A 1XR7A 4YB7A 1AROP 1TL3B 3I0SB 6AT1B 3GYGA 4ELTA 2DXFA 2E5HA 1K9MT 1CQMA 2VICA 3IRXB 5F8LA 1YSJA 1V3ZA 4H4KC 3PVXA 2P6TA 1S6UA 2Y1IA 1NKEA 3B54A 3GV8B 3VHQA 2W9CB 3BREA 4D3HA 4KYZA 1VQ9S 2V8DA 1R0BG 3J7YI 2HPUA 3FUYA 3TW0A 2DNQA 2RF2A 1RT2A 2M3DA 1WWHA 2ACMA 3D3BJ 3ENQA 4IG3B 1SIZA 5H9EK 3OTBA 2ZKUA 1WC6A 4OQJA 3OHAA 1KQFB 3ONQA 1IKYB 3GP9A 4NA3A 2XTJP 4U7CA 3MCNA 5DDRC 4TLRA 4KGVB 1BXNA 5J2QB 2DHSA 1N0UA 2IIHA 1HNZF 2HZVA 3PXGa 2UUAJ 3MEDA 1KEKA 1EETA 3H5YA 2BJ7A 4LJMA 4W98A 3HT3A 1T8EA 2CKWA 4IOAQ 1HPZB 1OSDA 3IM8A 2WAQD 1KNZA 4FN5A 2RQMA 3KOAA 4QOTA 4DR7J 5KFLA 5HN0A 1V5VA 2EWHA 1YJNS 4KGKA 2KXHA 3OVSA 3UCGA 3MAQA 1EKSA 4F0MA 2ZE2A 2FHOB 3SV4A 2ILZA 5IC4B 4DR4J 4LF8J 2ZH3A 4OHVA 4QIWD 3MUTP 2NR0A 2B8QA 3ZXWA 1WI8A 1GXLA 3CJQA 1HIYA 1BUXA 3FQKA 2IM0A 4OI1A 3KK3B 4HHUA 1AUDA 1RHUB 3OV7A 4P74A 5HK4A 2E5LJ 2X1GA 3DGPB 2VFVA 5D15A 4WFXA 1O51A 2C2KB 3G2XA 2MLXA 4FF3A 4EWTA 3IP0A 3QSIA 3D1OA 5KFIA 3TX0A 4X65J 1YTYA 3M8ZA 2G9OA 2OKQA 3FSXA 4FNIA 8RUCA 4JI2F 5F9LA 2KRBA 5GADI 1IR2A 1RWOB 5AXNA 3KHLA 4CT8A 3SBMA 3MUVP 4K4VA 4F8RA 3CCTA 3D68A 1FJ7A 2MTLA 4LF1A 1HI8A 5L1JA 4XAKA 1DTQA 1YHQS 2MKCA 2H54B 1E6VB 6FDRA 2MPUA 2L9NA 4P9SA 1FESA 2H5IB 3BKTA 2IY5B 1EQ0A 5KFBA 4DX7A 1X5PA 1TMJA 1OY8A 3DYAB 5CYMB 3BN4A 4DG1B 2EK1A 3G82B 4C0HA 2ZOFA 2YNGA 5JUMA 2PEHA 5THWA 3KMSA 4ED5A 5FDLA 1VBZA 3O5TB 1NEEA 3MTJA 2EFNA 4UY85 2EC0A 1FEEA 5A76A 4LFBJ 2RU9A 1N5YA 2V2VA 4P71A 1DTTA 3O3LA 1TKZA 4B9SA 1IJFB 2D7SA 4R0EA 1Y7PA 1N32J 1UP1A 3PIPQ 2YWFA 4K0KJ 2IVYA 5DG9A 3PKMA 4GKJJ 2YWGA 2NCKL 5IC6B 4YB6A 2C2OB 2MMYA 4DR6J 2UXCF 4USIA 1CEZA 2UVVA 1NJZA 2H5JB 2D3OR 3CC4S 3J81Y 2KZMA 4LSLA 3PYFA 1QAJA 3CJ8A 4B3OB 1NCLA 1RSCA 5LMNF 3IR5B 1FD8A 5HMZA 1IBKJ 1HW8A 3DXBA 1TKXB 4UQTA 4KKOB 3AJ1A 1FKAF 2BACA 2ZDOA 2BA9A 5F0WA 5KT2A 3EVOA 1YJ9S 2XSJB 2N4CA 3HKWA 4LRBA 2DHAA 1X4EA 3OBIA 2VF3A 4ZPTR 1T9YA 2XWYA 2D1CA 3HCXA 4IG0A 3DOLA 2ZBIA 2GCFA 2DVIA 2WONA 5KG3A 1P1TA 4K8RA 4LBPA 2QE5A 3B4DA 2ZM6F 4BS2A 1SL1A 4ZLJA 1NO8A 4KTQA 3KJVB 2HFOA 3DXSX 4RKUC 5SUHA 1FNOA 2MEWA 1FX4A 3CC2S 4LMZA 4GC7A 2Z8QA 3ZNJ1 3W2WB 2MKSA 1YJUA 3KLIB 2YNIA 3I5BA 1L3KA 2R7QA 4FXVA 3HI9A 3TP2A 4N77A 3KLFA 1NBEB 2PFDA 4ZLNA 1M5SA 1VIOA 2CVEA 5HBMB 1S1VB 1SJ3P 2EFPA 2OUGA 2OD4A 3TJAA 1VOMA 4NASA 4OX8A 1SQGA 1BE4A 2G2ZA 2K7KA 2KH9A 2MZSA 1JLAB 3CXCR 2QT7A 2D69A 1B3TA 5E3AA 2RIJA 1OQ6A 2V67A 2WVFA 4ED3A 4LF4J 4CO2A 1C1CB 1U8SA 5A8KA 3PYGA 5ITHA 3AD8C 1TVRB 1S0VA 3EGZA 1RWUA 1VLOA 3AJ2A 3DMJA 2FIUA 5J2NA 2AZ1A 3M6UA 4BC7A 1EP4B 3V81B 1Y00A 2W8KA 2P5VA 5KFEA 4IKAA 1S97A 5FJ4A 3IG1B 1KVIA 1P1LA 3UD5A 4MIWA 4ECZA 4ECQA 5C2CA 3RGIA 2VC0A 2Z4PA 1GTHA 4DSLA 1P6TA 1ZH5A 4RJVA 2BE7D 3IWNC 3DLGB 3X1LB 5K9FA 5H9FK 1LWEB 3GFXA 1XNQJ 1NKCA 3J80U 1YJVA 3ZZYA 5JVGQ 3N5FA 4Q0BB 3CC7S 4USHA 1T7PA 3RJMB
chains in the Genus database with same CATH topology
4WYLA 3L7OA 1CVJA 3LP1A 4MYUA 3OUYA 1NK9A 3WC0A 2H5EA 4ZHRB 3TANA 2ZNYA 1ZETA 3TAPA 5SZTA 4TY8B 1QTMA 5HP1B 2O5DA 2VH7A 3DHXA 3MXHP 2X1AA 3OSPA 2B6AB 5BYQA 1VBYA 4CZCA 4HLBA 2XY5A 4OZNA 2VKZG 2E29A 1ZOTA 1UVMA 3IR7B 4RW9B 1VRTA 5KFHA 3T9ZA 4YB1P 4ELVA 1SUQA 3M9OB 5GAGI 4NL5A 4C8NA 1FA0A 3M30B 2XHWA 4OZ5A 2IC3A 5B0FA 3Q23A 5C24B 4KQZA 4V19J 1S76D 2M2BA 1S79A 1SBRA 4I2PB 2LVWA 3PW5A 4EZ9A 3IS9A 2LXFA 4J9OA 1FJEB 3LUYA 2DGTA 4NLTA 3M32A 2LQBA 5AXLA 3RU0A 3DM2B 3VAFA 3OFEA 4TU8A 2OPQB 4K50A 1S6OA 3OXFA 2EBGA 2JHEA 3B8HA 2MSSA 1QY7A 4DV0F 1KHVA 2C3PA 4OHZA 4O4RA 3QZ8A 1RT6B 2V8GA 4ZVEA 3DI6A 4NLUA 3GR0A 5AJ3F 4JI5F 1FDBA 2E7WA 2R7SA 3TARA 2XS7A 2JEIA 3H40A 2OD6A 4E0DA 2CG4A 4O3PA 1NK4A 2DO4A 3SFGA 5LMUF 3D1QA 4JI3F 1FEHA 2DNPA 3GIMA 4FF4A 4AL7A 5B0DA 2C2EA 5DQGA 1QAIA 1U49A 3OVBA 2KFYA 2KHCA 4QR1A 1Q53A 4WK1A 1RK8A 4ES1A 2YNIB 1HI1A 2HVZA 1RQ0A 3DFEA 4DOZA 1S10A 1H98A 2Q6BA 4NXMF 5L39A 1TFYA 2PA8D 4RW4B 3VCDA 3NKYA 4ES2A 3OJSA 1HBNA 2OJ3A 2MZJA 1L5UA 2OAUA 4EGLA 4TYAA 4OJ1A 4FBUA 1HQUB 5E3RA 4BWJA 1LXJA 3OLAA 1FDAA 5B09A 3L7PA 2CYYA 2DB1A 2YKMA 3OTEA 4M1KA 4NWBA 4IH5A 1FDDA 4JI0F 2OPRB 1U45A 2MZTA 4AYBD 5K8NA 4Q44A 2HHHF 4IO1A 4B3TF 4C98A 2ROEA 5J2MA 1JB0C 2XULA 3I6PA 4KV8B 1IKXA 3H5UA 1K1QA 2KRRA 3LQVA 2WHOA 2MGZA 3I82A 5IM0A 1TKTB 4BWMA 2HNDB 3LP2A 4NLQA 1I1GA 4X84A 3PO4A 1KFDA 2GO9A 2M7SA 4Y00A 3NNAA 1RTHB 4GKKF 2JVOA 3DRSA 3THVA 2A3JA 4PG5A 2R2SA 1Y3JA 3MMBB 2P9CA 2JZ5A 1NU4A 2ZD1B 1NH8A 3R5CA 1NJXA 2JFKA 5D4OA 1IXKA 1FHTA 4RU2A 5GAEI 4K4XA 1N8RT 1XMBA 2ZZMA 3RW6A 3MM6B 3CJ3A 1QAYA 1UW4A 4RW8A 1FRMA 1U1NA 3OL9A 4HKQA 2HG4A 3M9NB 2O67A 3DLHA 2G0CA 5D3GB 2AGQA 3DLBA 4XK8C 1IQTA 1S9EA 2DR8A 2IBOA 3FFIB 3RRKA 1MMNA 2I5JA 3OXGA 3PFEA 1WTBA 2EPIA 1SV5B 3IWLA 2J6UA 2RU3A 3QJLA 1VQ7S 4B3RF 1JLEA 2KG0A 4OJGA 2C3MA 2ZC4A 2CVIA 1TKDA 1HQEA 2D74B 4Y2MA 1G2EA 2PT0A 2VPWB 3KK2A 1S1XA 1RT1A 4D3GA 3HHNB 4RUHA 2GQQA 5FIIA 2W7OA 2FHKA 1N36F 5K8MA 2EKYA 3D1HA 1QUVA 3IGNA 2J76E 3KYLA 2ZJPQ 1JXLA 4IFVA 3DDNA 3N6MA 4ID5B 4QPXA 1N5SA 2CJ9A 5KG1A 5LL6d 4OI0A 1K0TA 4OJ3A 3QGHA 2OSQA 3HMJG 1RISA 3CDEA 1LWFB 3TQ1A 4KIAA 2DR7A 1UEVA 2UUAF 1NZAA 1ZAWA 5J1EA 2IA6A 3JSRA 5KFGA 1IBLF 2VOPA 3GIIA 2BDPA 2AD9A 2F7VA 1ZTWA 3M8RA 3NGDA 4FF2A 3MCSA 1I6JA 4X4UA 2XLJA 2FJEB 2N82B 1DFDA 2BJDA 3MZIA 2AYMA 5T14A 3F73A 5CCMA 1H0HB 5IWAF 2M88A 3CJ2A 3Q24A 2O66A 4PWDA 1H7XA 2QMXA 3QLHB 3MEGB 1HW9A 5DQIA 3BDPA 3J7ZT 2VC1A 4P2SA 3VWSA 2BRKA 1FKOB 2OMLA 2DNHA 1WHVA 2CPJA 1IN0A 1L3SA 3K8VA 2R7OA 3JSYA 5FLXY 3PY8A 2GHWA 4DHVA 1U24A 1BWEA 2GMHA 2WSCC 2QA2A 3CD7A 3JB9k 2KHDA 3MEEB 1Q79A 4TU7A 4X4TA 2MSTA 2BZ2A 4YB5A 3IC1A 4QIFA 4QR0A 4Y3CA 5DRKA 1HNWF 5E33A 3L09A 5AE3A 1U1MA 1U6BA 5KFNA 4PQUA 4HEA9 4F25A 2M5YA 2ILYA 3HXMA 3GMGA 2RQKA 2ZZNA 4Y6IA 4K4SA 1REVA 2VFTA 1UEUA 4NLPA 1HBUB 1X4HA 2ROPA 5LT5A 4IR1A 3K5NA 1C0TB 1KLMA 2RDJA 4ED7A 4R0JA 5EN1A 2I38A 4I6AA 2MKIA 3KNGA 1RYRA 1WHWA 1U6ZA 2IVFB 3CDUA 4NLRA 1X9MA 4X2BA 3MM7A 3G6XA 3EZ5A 3SEOA 2RF2B 1RT2B 1E6YB 3KKFA 2WBMA 4N5SA 4DS5A 4DV3F 5A6PA 2BW2A 2DPJA 1HBOA 3Q0AA 3I5AA 2U1AA 4Q2LA 1FK9B 4HH1A 3GFHA 2VBXA 4IRDA 2R7UA 1FVQA 3K5OA 4ICLA 3CSKA 2YKAA 2L41A 4F2RA 2DGWA 4R8UA 2IYIA 3UD4P 1WACA 4K5RA 5AE2A 3SDEA 2A10A 4JV0A 2VFRA 3I55S 4G6VB 5J2PA 1HR0F 2GIQA 2EW9A 4YP3A 3G6ES 2E5LF 3LOUA 4ZK7M 4NA1A 2OPPA 1TAQA 3DRXA 5HLFB 2OFHX 4HDGA 3G71S 2B7CB 4WXWA 3NBPA 4PXCA 2IJFA 1UJ4A 3CWJA 3OR2A 1FRKA 3LGNA 4LFCF 3G8SA 4I2QB 1Y4ZB 1DJ0A 4J9KA 1SKSA 2V9WA 1U26A 1A6LA 4HDHA 4DFKA 2KM8C 3MMJA 2KFNA 3QGGA 3KHHA 1VQKS 3IRWP 2HZCA 1FXLA 3ZZZA 1H2VZ 2CPEA 2XGQA 2KTQA 3R5DA 3LP0A 3MEDB 4IFYB 1EETB 2J9EA 1XERA 3GYNA 4NLXA 5EX0A 4Z37A 4JV5F 4TYBA 1XR5A 2BV3A 3CD5A 3RZAA 4RW7A 1RTDA 3R27A 2VONA 3BEGB 2IAJA 5JXSA 2MQLA 3HKZD 3PEHA 2WOMB 2VA2A 2LQJA 4X4PA 3ENWA 1HHTP 3BGLA 5LXYA 1S77D 2ADCA 2FVQA 3CCVS 4C11A 5CA5A 3ISZA 4PXBA 4WKYA 4YFUA 3GQCA 2ZHBA 1FXDA 3PRBA 4DFPA 4N76A 4NPOA 3CCLS 3KLEA 4FYDA 4GO7X 5GMKa 3KLGB 2LA6A 1N56A 5L9NA 1LFWA 2XGPA 4IDKB 1DLOB 3R5AA 1HNIB 2BBEA 2YX4A 3H4DA 5IQ6A 3BS9A 3LAMA 5D4NA 4ZCKA 5KFDA 4OZJA 5J1NA 4ZS6A 2K3IA 5BYRA 2ZOGA 4YDXA 2JC0A 1S72S 4F3QA 1GT8A 1LW2A 3N4WA 2ZE2B 4NA2A 5IT4A 3CJ4A 3BGRA 3KK1B 3K59A 1U48A 3CD6S 4DL7A 2BQUA 2DNOA 4WKRA 3GV5B 2W9BB 4QWAA 3CB4A 3K7RA 1BLUA 1A7GE 3VZIA 4DL2A 4ILMA 4DFMA 5AXMA 5CQGA 2YKPA 3Q22A 4KE5A 2UUCF 4QYZJ 2JRSA 1R3NA 2CQDA 1UJ6A 3CDAA 4I64A 4K4WA 4X4SA 4FPRA 5C42B 4C8OA 2HHPA 5K14B 2Q66A 1FDNA 4C8YA 4NCBA 2MJUA 1RT5B 1JLBB 3ETOA 1RAJA 2E1AA 4RBTA 2XB2D 4KHPF 4IRKA 2FUG9 1P8GA 2NSBA 1V3SA 4DSIA 3GSDA 3F44A 4HYKA 2QSFA 1YWXA 2RS8A 3HLUA 3V5RA 5B08A 4R5PA 3BDEA 2BM0A 2XEXA 4O44B 4OHYA 3QAEA 2PDAA 2PIIA 2DNYA 1DAXA 2V94A 3VR1A 3RB4A 1F9FA 2CQBA 3S8SA 2DNZA 2RUGA 4KBIA 4WFZA 4F4XA 3T5JA 2OTLS 4H4MA 1S1UB 2GO8A