3D2WA

Crystal structure of mouse tdp-43 rrm2 domain in complex with dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
GSKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna/rna binding protein
molecule keywords TAR DNA-binding protein 43
publication title Structural insights into TDP-43 in nucleic-acid binding and domain interactions
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d2wA00
3P49B 2X1FA 2F3JA 2DGQA 2CQ4A 3U1LA 2YTCA 2MGZB 3CCLS 2F9DA 3CCRS 4YB1P 2YH0A 5MLCV 1H6KX 2MHNA 2XS7A 1PGZA 2MKHA 2AYMA 2DO4A 3PIPQ 3UWTA 3P6YC 4ED5A 1VQ7S 2MY8A 1VQ9S 4UQTA 2D3OR 2EVZA 2MZJA 2CJKA 1OWXA 2M8HA 3THPA 3VAJA 2E5JA 2DISA 2DIVA 4WKRA 4M5DB 3G9CA 2KHCA 1NU4A 2RNEA 2MQPA 2DHXA 3UCUP 2JWNA 1U6BA 3R27A 1UAWA 2O3DA 1X4HA 4FXVA 1U1MA 1X5PA 1Q81T 4TU8A 3IWNC 3B4MA 1A9NB 4F26A 5FJ4A 5DM7Q 2D9OA 1VC0A 2VOPA 2LMIA 2HVZA 1WF1A 5IM0A 4CIOA 2J0SD 1VQ4S 2ZJPQ 2ZJRQ 3LQVA 3D2WA 5D78A 2B0GA 5LSOA 2MZSA 4V19X 1XN9A 1KD1T 2VOOA 2G0CA 1YWXA 3EGZA 3MD1A 4W92B 3CULA 2E44A 1FJCA 3G71S 5GADU 3BS9A 3Q2TC 3MD3A 5GAEU 2CPDA 3MUVP 1DBDA 3RW7A 3BO4A 2KXHA 4WIIA 2DNNA 1VQ5S 1HA1A 3VAIA 3UD4P 1X4FA 2K8GA 1WG1A 2XNRA 2Q79A 5HL7Q 1K8AT 3ZZZA 2DNMA 1B7FA 1JMTA 2DGUA 4WFAQ 1JJ4A 2XB2D 3NNCA 1ZH5A 4CQ1A 2RQCA 1M5PC 1YTYA 3NS5A 2YKAA 1VQPS 4F02A 5CXTA 3CCVS 1U1OA 1VQKS 4ERDA 2CQIA 1X5SA 2FHOB 1U1NA 1HD0A 3UCGA 1A7GE 2D9PA 3FEYB 1DRZA 2AYEA 2MKCA 1K9MT 3SDEA 1UP1A 2JRSA 4QPTA 2M88A 1P1TA 3L3CA 2CQ0A 1M5VC 1AUDA 2CPJA 5IM0B 2RS2A 2DGOA 1WTBA 2JVOA 2CQ3A 1YHQS 2KN4A 2CPXA 1SJQA 1U6FA 3MUTP 2MPUA 4C0OC 2KI2A 1YJNS 2RRAA 1RKJA 3CTRA 1OPIA 5DDPC 2BZ2A 2AYGA 2E5HA 4A8XA 1VC5A 2LXIA 2DGVA 3V4MA 2CPIA 2MMYA 3CPWR 1VBXA 2LQ5A 2RRBA 1W2BR 4IOAQ 2DGTA 2LEBA 2DITA 2MZRA 2CPFA 2DNKA 5D77A 1R8HA 3B4DA 1X5OA 4WFNQ 5GAGU 2N3OA 4CH1A 2KXFA 3S01A 2MKJA 1SXLA 2CPYA 4LIRA 3SXLA 3CF5Q 1VQOS 4UY8T 4WCEQ 5IQQA 3JB9k 5BJRA 3MI7X 1NO8A 1WF0A 3NNAA 2YWKA 2N3LA 3TP2A 1X4CA 5DETA 4ZKAA 1JJ2R 2KU7A 1X4BA 5LJ5Y 1WI6A 2MJUA 5DM6Q 1FNXH 2N82B 1YJWS 4IUFA 3UCZP 3J7ZT 1UW4A 2EK1A 3UE2A 2G1DA 2A3JA 2HGNA 3VAMA 4WFBQ 1KOHA 5LJ3Y 2UP1A 1PO6A 2MZTA 3N9UC 2LEAA 1L3KA 2E5GA 1VQLS 2CQGA 3CCMS 2J0QD 1FJ7A 2X1GA 1D8ZA 2MQNA 2MJNA 2OSRA 3IRWP 2VONA 2DGWA 1Q86T 2SXLA 3CCJS 5JVGQ 1ZZNA 1S79A 2J8AA 4C7QA 3DXBA 1N8RT 1IQTA 3VAGA 3NNHA 2M0GB 2CQ1A 1WELA 2I38A 2QFJA 3VF0B 1X4EA 2LA4A 2FC9A 2HZCA 1HL6A 3VAKA 1KOOA 3HI9A 3G6ES 2DNQA 2EK6A 2ERRA 2NZ4A 2DH8A 3LPYA 1VQ6S 1VC6A 2MKKA 2LECA 4QQBA 2DNRA 2AYBA 2AD9A 3BEGB 4TU7A 1WI8A 2NLWA 2DIUA 2M4MA 1ZZFA 3S7RA 1Q82T 2OTJS 2K3KA 2DH7A 4TLQA 1YJ9S 1WHWA 3MURP 1G2EA 2CQCA 3PIOQ 1D9AA 3Q2SC 3DLLQ 3TO8A 1U1QA 2L08A 1F9FA 5LXRA 1WG4A 1X4AA 2CPZA 1U1RA 1X4GA 2MSTA 2LCWA 4EGLA 1M90T 3H2VE 4IOCQ 3BO3A 2YH1A 2N7CA 4IO9Q 1URNA 2MXYA 2PEHA 2JVRA 3P5TL 2XS5A 2BOPA 3TYTA 4W90B 1OIAA 3G4SS 4WF9Q 4Y00A 1WEYA 2U1AA 4QU6A 4U67Q 2M2BA 4CH0S 1CVJA 2E5IA 1YIJS 3FEXB 1FHTA 2CQDA 2LYVA 4OZ0A 1VQ8S 2CQPA 2M7SA 2M70A 2DGXA 2MKSA 4RU2A 1WF2A 2L41A 5CYJA 1N88A 1S72S 3CMES 1QM9A 2DHGA 1X0FA 2KVIA 2DB1A 2OTLS 1M5OC 2CPHA 2LA6A 3OW2R 2OJ3A 5EN1A 3BO2A 5DDQC 3EX7B 4Z2XA 3G96A 2DNPA 3ZZYA 2MKIA 3NMRA 3J7YU 2DNLA 5GVQA 1VBZA 2DNZA 2RS8A 2LXUA 1FJEB 2DNHA 3CCUS 4PKDB 2RUGA 3S8SA 1KQSR 2KYXA 4YOEA 1N52B 2VODA 5HO4A 1VBYA 5DDOC 4QU7A 3R1LA 2V94A 3HHNB 1UFWA 4PR6A 3SDEB 2GHPA 2DNOA 1HD1A 5H1SV 3VALA 3I56S 3CC4S 1RK8A 2KXNB 2U2FA 1H2UX 1SJRA 3CUNA 2OIHA 1WWHA 2RVJA 3P3DA 2RT3A 1M5KC 2M8DB 5GAHU 3I55S 2RQ4A 5CA5A 3MUMP 4TU9A 2M9KA 3VAHA 3K0JA 1X4DA 3CCES 1VQMS 3THTA 1SJ3P 3H2UB 2DHSA 5DDRC 3ULHA 1O0PA 1QVFR 2KG0A 2FPHX 1WEXA 2KRRA 3S6EA 2XSFA 2LKZA 2KFYA 4YUDA 1U1PA 3CCQS 4C4WA 3US5A 1DZ5A 1JJHA 3VAFA 2WBRA 2OSQA 2G4BA 2HGLA 1WHYA 2QA4S 3SMZA 2MSSA 2CQ2A 1OO0B 2QEXS 3MDFA 2DO0A 2J76E 2KH9A 1DHMA 3U1MA 2GO9A 5LXYA 2MYFA 3CD6S 1U1KA 2MGZA 2MQLA 2DHAA 2XS2A 2HGMA 1R8PA 4LJMA 1SJFA 4F25A 4LMZA 2KRBA 1VQNS 1WEZA 2CQHA 2MQMA 1U2FA 1WG5A 2I2YA 3R1HA 2ADBA 3EGNA 2M52A 2X1BA 1FT8A 2DNGA 2KM8C 1BY9A 2FC8A 3RW6A 1H2TZ 2XNQA 2CQBA 3MXHP 1WHXA 2L9WA 3CC2S 1X5TA 2MQQA 1YITS 5IFMA 3CMAS 1FO1A 5JVHQ 1YI2S 1Q7YT 1QVGR 4J5OA 5ITHA 1U1LA 1H2VZ 2KT5A 2DH9A 3NS6A 4OZ1A 2MB0B 2RU3A 4PRFA 3CCSS 2JX2A 1SJ4P 3MOJB 2CPEA 1P27B 2MQOA 1M1KT 2HYIB 3CC7S 4FXWA 4Y0FA 2KG1A 1KC8T 1WHVA 2MY7A 5LSLA 2MZ1A 2ADCA 2KM8B 2DGSA 3CXCR 4BS2A 2PE8A 5GMKa 2FY1A 2F9JA 2DK2A 4P6QA 1NJIT 1N54B 2ZJQQ 1FXLA 2MZQA 3UD3P 1K73T 2DNYA 3G8TA 3G8SA 2X1AA
chains in the Genus database with same CATH superfamily
2QGFB 2BANA 3MM7B 4HL9A 4GVLA 1BMQB 4YQWA 4JP8A 1XMOF 1LWFB 2YH0A 3BDEA 4DFPA 3PIPQ 3O44A 4CLSA 3P6YC 5M2UA 2MY8A 4NZ7A 3SIPB 4FNHA 5IV3A 4LQ9A 2OUGA 4WKRA 2UXCJ 1RAFB 3KK2A 1IBLJ 1F1BB 4F2RA 2MQPA 4R8UA 2XMWA 4G6VB 2VJUA 1JWWA 1OSDA 5FJ4A 4X4NA 2L9NA 3NBPB 5EX3A 4CIOA 4RUBA 4JI6J 3HPOA 2VOOA 2CDRB 3D9BA 5K14B 4URSA 3G71S 3M8WA 1D1UA 2WBMA 1JLFA 4UF4A 4NRUA 4WIIA 5G4DA 1Q8KA 2NQPA 1F2HA 4BLGA 5BYRA 4IFYA 5BR8J 2CQIA 1HMVA 3V6DB 3SDEA 2N7YA 3MPDA 3BPDA 1PILA 1D09B 2KN4A 3H98A 1U6FA 4HEA9 2HMIB 2MPUA 4C0OC 1EHWA 1B0PA 1D0EA 4IG3B 4XO0A 3OXGA 1R8CA 2BKPA 1EQ0A 2GAHC 2LQ5A 2GX8A 5L9XA 5KFAA 1L3SA 3L7OA 3SCKE 3NNAA 3TP2A 1B70B 1RWVB 4M94A 5KT5A 2VG6B 2MEWA 1F2GA 2O5DA 1IWGA 2NXJA 2A3JA 2RIJA 4N77A 4QW8A 2CVEA 2V34A 2WB1D 2UXCF 2OPPA 1VJWA 1IBLF 4OHVA 1FDNA 4K4TA 3EPGA 4NPOA 2DGWA 4NI2B 2AP6A 5CYQB 5JVGQ 3DXBA 2H48B 1GNKA 4PG6A 2YWEA 1T05B 3HMJG 3W3SA 1YDLA 4JI6F 2I38A 4J9UE 2J9EA 2FC9A 3T9ZA 1ZM2A 5KG7A 1TV6B 2G13A 1PJ7A 2GVZA 2VFVA 4DV1J 2DEIA 2NLWA 4M8LA 4ED0A 2XSJA 3MPVA 4Q7AA 4IQMA 3SFUA 4CLTA 4NLDA 1PC4A 3PX6A 3BQ2A 3SFGA 1YRUA 3RR7A 5KT3A 2R7UA 5DG7A 1QAXA 4ZVHA 3PW4A 2F7VA 2R8JA 3NY0A 3IBFB 2VUGA 2YXLA 1JLEB 1T3NA 1V3ZA 1OQ6A 1UMJA 3BM7A 4J9QA 3PNIA 1S6PB 4OX9J 4WE1A 3TUPA 2DB1A 3M8ZA 1VRQC 2PA3A 3PYDA 2HK2A 3W65A 3LO3A 4DSIA 4I6AA 3MMBB 1TAUA 2FHKA 4CLFA 2VODA 4C2MA 4CO2A 1UJ6A 3K8VA 3HVAA 3Q8SB 4ICLA 1UVLA 4WBFA 4WYLA 4Y65A 2AX0A 3P3DA 5GAHU 4F4YA 2Y1JA 2N4CA 4ECUA 1SJ3P 5AE2A 2F8EX 2D69A 2VG5B 2UUCJ 4YUDA 3M05A 2IHR1 3VVUA 4DUYJ 1NSPA 2W9AA 4LF9J 3ZZRA 3L9ZA 1DHMA 3TVKA 2HGMA 2YBVA 3M2UA 3GG0A 4I69A 3ZO7A 2MQMA 4YN3B 2W2NP 2B56A 1GXLA 3BQ1A 4DV1F 3R5GA 3C6UA 4I68A 4WXWA 3M9NB 2XYPB 1SH2A 1MWYA 1U0HA 1LW2A 2L9WA 1RTIA 2D74B 1HBUB 1YITS 4DR1J 3KUGA 1QVGR 2G9OA 3R7BB 2WHOA 5LL6d 2KG1A 5EDWA 1D3WA 4ZITA 5LSLA 3DLKA 3J80Y 3LGMA 3GG1A 1NJIT 4QIVA 5T7LB 5DLFA 3H2LA 5KFTA 3GQCA 4YMEA 1PG5B 1AA1B 2F9DA 4OX9F 3W7BA 1BHNA 3TX8A 1FWKA 1ULRA 2MHNA 2XS7A 3KJVB 3G87A 2OEKA 5A2QY 2CJKA 1OWXA 3THPA 3VAJA 4DR3J 4U7UD 5HQLA 2BE2A 3G9CA 2EW9A 2KHCA 4NMLA 1JXLA 2DHXA 2VFSA 1U6BA 4LRCA 1LEOA 1IKWB 4IDKB 4ELUA 1U1MA 5C25A 2XBPA 4UY85 1SC1B 2BQRA 3N6LA 3DRSA 1MMNA 3DFEA 2ZJPQ 5D4NA 2GJ2A 2QRRA 1UWAA 2QMXA 1Q5VA 4RPFA 1TKZA 2UUCF 4K4XA 3D28A 4DUYF 1TL1B 1REVA 4LF9F 1XNRJ 3U7JA 3OL8A 1S1UB 1VQ5S 1HA1A 1K8AT 3TVYA 4KGKA 2QE5A 2V68A 1RHRB 3DLGB 3PJXA 2E7XA 3A12A 2VA3A 5HBMA 4ZN1A 4J9RA 3IP0A 1NJYA 3HHLA 5KG0A 3OR2A 3VR1A 3P4UB 5D0RA 3RBDA 5I42B 3IRXA 4H4KC 3OSNA 4YDDB 3SEOA 5KFFA 2EKNA 4A8XA 4M63A 4MIBA 4EWTA 2VBYA 2DGTA 4TY9A 1WDDA 4G65A 2RQKA 1SIWB 3JSBA 2D7SA 1RGVA 5GMEA 4KBIA 1TK5A 4DI6A 5DM6Q 2AQ4A 1FE0A 2EK1A 2HWHA 3RUBL 5F8NA 4DR3F 5F8LA 1PO6A 1HLWA 5FDLA 3DDKA 1VQLS 2J0QD 2YNIB 2FJVA 3UFCX 3QJPA 2CNLB 4P2SA 3OR1A 3KKFA 4O3SA 1SQEA 3IC1A 4F3OA 3X1LB 4QW9A 1KEKA 5F3ZA 4Z7YA 1U25A 4DG1A 3ISNC 4ECRA 4B3RJ 3CSKA 3K2YA 2XGQA 1CS4B 3A3NB 2QMWA 3QJJA 1SKSA 1XNRF 1ZA1B 3S7RA 5KT4A 3GV5B 3F56A 1FCAA 2VH7A 1RLCL 2R7TA 4MIAA 2UV8A 1IKXB 4DFKA 5EWGA 2DR9A 3SV4A 3Q0AA 3J81U 1URNA 3BR9A 3I4HX 2IBOA 1IUJA 4PXEA 2HVDA 1N5QA 5C42B 1O6XA 2E7WA 3LTOA 4CLPA 4O3NA 2PSZA 3OW2R 3IO1A 1HNIB 4RWXA 3K57A 5HSPA 1IM6A 4P52A 2V2KA 1T03A 4CRJA 3TAMA 2VL1A 2X7IA 4QU7A 4DL0C 2QYCA 4FYVB 3TANA 3OVAA 3HD1A 4RBVA 2FLNA 4USMA 5CCMA 2NXEA 2OPQB 4NXNJ 1H38A 3SSSA 3CUNA 1TL5A 3GP9A 4HYKA 1L3UA 4PG4A 2HG4A 5HAOA 4M5IA 2WTFA 3G2XA 3E01A 4Y2KA 2V4RA 4JI1F 4PQUB 2EBGA 2POKA 3GZ7A 3T1YJ 1JX4A 1EKRA 4RBTA 1E6YB 2GJFA 2WB4A 3EDRB 4L6V3 4Z7CA 1R8PA 1P8GA 4NLUA 3W63A 2HHSA 2LU2A 4M5KA 4K5RA 1R6VA 5F0WA 1VGYA 1FK9B 4RKUC 2QTWA 2HW3A 2A1BA 3UDCA 1HHQA 3CMAS 5JVHQ 2IM0A 1H74A 4ZVTB 2KT5A 4LF6J 4PPDA 2JX2A 3W5ZA 2XM3A 1WC3A 1QY7A 3TQEA 4WZMA 2UXDJ 5EHHA 4DUZJ 4DV2J 1S0MA 3T5LA 1FXLA 4ILMA 3PHTA 3DOKB 4UTGA 3MZIA 3BYRA 5AXMA 1PIEA 2DGQA 5C24A 4KAIA 4LF1A 4KPYA 3GIMA 3NGTA 4LRFA 2ZOMA 8RUCA 5I4MA 3LA0A 2CJBA 1MN7A 2MZJA 1SC3B 2H5IB 5KFLA 1FRXA 2GMHA 3FMWA 4EO6A 2R7VA 4WK1A 5AE3A 2L3MA 4NXNF 4TQSA 4ITSA 3PCOB 3AD8C 4DR5J 3M2VB 3HJVA 3D6HB 2QA1A 4NCGA 5AXNA 2ZJRQ 2PEBA 5K9FA 1DQ9A 1TAQA 1EB0A 4XPEA 3T1YF 3DDIA 3M30B 3PZPA 2CXEA 3RB0A 4A48A 1DBDA 4RNMA 4K4WA 3AFGA 1K47A 3AJ1A 3ZZZA 1JJ4A 1V5VA 3KHHA 3LUYA 1LFWA 1UVIA 4YR3A 1XR5A 1U1OA 1QUVA 2AF6A 1G4CA 5E2QA 1X60A 4HACA 2QL5B 3DOLB 3RGIA 1RDRA 1LWCA 1NDLA 2BJ8A 4DQIA 4AUKA 4NEZA 1DTTA 1P9QC 2OMLA 3A8IA 2Y0SD 1HHTP 3OL9A 5IM0B 4LF6F 2ATCB 1WTBA 3KLHA 1AXQA 3CJ5A 2FVQA 3I82A 2E5HA 2HQIA 1RHMB 2UXDF 1U24A 1TVRA 2LEPA 5AE1A 4LBHA 4DUZF 4DV2F 3K5PA 3IAS9 4B9NA 1NBEB 1PJ5A 2LQBA 3G8QA 2PMWA 1N56A 1X5OA 1N5VA 2IM1A 4DQPA 5A8RB 3M4XA 1FD2A 3BV8A 3Q8YA 4UZCA 3EE3A 3MI7X 3MM9A 2VA2A 4XK8C 3NLCA 4DPOA 1Y3KA 3R2DJ 2HS3A 3MEEA 1FNXH 2ZOGA 4IUFA 4N56A 3UR0A 4F50A 1MWQA 2C22A 3KUEA 4A8FA 2BJ1A 1SCJB 1M0SA 3CJTA 3EJMA 2GAGC 2RHQB 3TQ1A 1YRXA 2P9GA 2QA4G 4DDFA 2Y1RI 4DR5F 5A8WA 2CQ1A 2NS1B 4X64J 3UPFA 5K20B 1JIHA 3V81A 2HNYB 4RUHA 1GEHA 4USWA 1YK9A 2CKWA 2ZWOA 2AJFE 3MM7A 1LWFA 1XIQA 2DY9A 3MURP 3AY0A 1RTHB 5LXRA 1WACA 5L8RC 2WRMA 2YH1A 3OTOJ 5J2QA 4W4MA 4CP5A 4W90B 1NPKA 2DYAA 2MQ8A 2V67A 5ETQA 4DQRA 1FHTA 2FVCA 1TZ0A 5HVHA 4DPUA 4OHXA 1Y11A 1RT4B 4D3HA 3NBPA 3BH6B 2ASLA 2OJ3A 3DI6B 3ILJA 3SZ2A 3ZZYA 2QLBB 2BV3A 4R0JA 1URRA 3TNVA 4DU7A 2BW2A 3SCLE 3OUYB 1EP4B 4QWBA 1UVNA 1RAIB 4NYPA 3FVYA 4WFYA 4DL2A 1OYDA 2IRYA 4KT0C 2FLOA 1VK3A 2J6SA 5T14A 3MR3A 4GC7A 2RT3A 1ZM4A 2XO6A 3J81Y 1NHUA 1YLXA 5J2PB 3UNGC 4L3KA 2HBQB 1X4DA 1VQMS 1YG0A 3THTA 4DZ6A 2ZH4A 3W64A 3V6DA 1S0NA 1R27B 2XSFA 2FJDB 1YKWA 1U1PA 2YY3A 4UUXA 5GAGI 4FKYA 3TOQA 5RUBA 2QA4S 1BQNB 2VKRA 2RE1A 4X64F 4IG3A 2NZCA 1F5AA 1Y7PA 3I4PA 4J9MA 1K1QA 1WG5A 2I2YA 3Q24A 3HVTB 1FRMA 3W8PA 5F8MA 1BY9A 3IGVA 3AXKA 4DPYA 4TN2A 1YGYA 2PFDA 1RZMA 5I3UA 3VZIA 4PABA 3OTOF 2DGSA 2AEJA 3IWXA 3H40A 2F8MA 2GIFA 2F9JA 4HI1A 2MZQA 1IWAA 3VVTA 3UD3P 5CYQA 3N79A 5B08A 4E8UA 2VU5A 1DURA 2RD5C 3VQTA 1KDNA 5MLCV 2YKMB 2IC3A 2BQ3A 4LREA 4ECVA 3GMGA 2DO4A 3ZC4A 3IN5A 2X3DA 1RLDA 2XMKA 4P9SA 2EVZA 2W25A 1WJ9A 3D4JA 1S97A 1T9WA 4KIAA 1YZ7A 1D8YA 3C14B 1SIZA 5LM7E 4O4GB 2HS4A 4DS5A 3OLBA 1C4AA 1UAWA 3FBCA 1N34F 2C2KB 4ZVGA 1X5PA 2WAQD 2R7WA 4F26A 2UUWA 1NHVA 2YWGA 1RHKB 3WIVA 1VQ4S 5C2CA 2QT7A 2YPYA 4PXCA 3VZHA 5LSOA 1NKCA 2G0CA 5LMNF 5A0YB 4EEYA 1NJWA 3A4TA 4MKVA 3Q2TC 3C2PA 1RP5A 2I0XA 4OQJA 5F41A 1N0UA 2V2QA 3UN5A 4FVCA 4OJGA 5FIIA 1S6PA 4OZLA 3D3BJ 2DGUA 4NLRA 5K8MA 3R5CA 3HHDA 3A1YG 5IOLA 4K4SA 3MMBA 3GYNA 5DGAA 4W98A 1M5SA 2AYEA 2MKCA 2ZHBA 3KDNA 4UT4A 2IA6A 2IRUA 2CZVC 1YHQS 3R5JB 2ZBCA 3F73A 3ICLA 3TX0A 4EFAC 2DHHA 5DDPC 1VC5A 2FLPA 1G6BA 2CPIA 2FGOA 4RW4B 3BN7A 3QGIA 4IOAQ 2BQUA 3M6WA 1RWUA 2VG5A 1NSAA 2VICA 2R7XA 3GR1A 1F5CA 4CH1A 2KXFA 3OXLA 2HHWA 2HQCA 2KT2A 3CF5Q 3UN2A 2ABYA 4LT6A 2VDIA 3H0PA 4WPAA 2HBZB 3Q23A 5L1KA 2E29A 2YNGA 2MJUA 2N82B 5E3PA 1LXNA 2ZZMA 5E3CA 2UP1A 3LWLA 3MM6A 5KFXA 2E5GA 2XWYA 3CCMS 2BBEA 3ILIA 1D8ZA 2P9EA 1HBUA 2FYXA 4RU9A 2QL7B 3W5XA 2O01C 3MEGB 4ED7A 4S0MA 4A8WA 1H73A 3VF0B 1UWBB 3PX4A 1X4EA 3KMQA 3FSXA 1J5EJ 1X9MA 2VBWA 3VAKA 1RT1B 2AU0A 2QC3A 2Z56B 4UOHA 2ZE2B 1BQMB 2UV8G 4P2MA 2HLUA 2MKKA 2HHQA 4QQBA 3EMTA 3T5JA 1GMVA 4B9TA 1U2RA 4LF8F 3DMJA 1QLNA 2DVIA 1IR0A 1U1QA 4J9LA 3C16B 1JLAA 4MKBA 4GMKA 4Y00A 1IBKF 4DLGA 2HFZA 1JLQB 3CJQA 1S0OA 4IDKA 3L7UA 2E5IA 4DXLA 3IM8A 3EZUA 4ZA1A 2L41A 1S72S 1X0FA 1AFIA 4B9SA 2FZCB 3BO2A 5DDQC 4BWMA 3GFXA 4BDPA 5KTQA 2LXUA 3ENVA 3SV3A 4PKDB 1VLOA 1TL1A 4B02A 4MT1A 3JQJA 2B3TB 3HHNB 1UFWA 1B3TA 5H1SV 4NX9A 5G0RB 2U2FA 5DJBA 1IBCB 1T95A 1ZAVA 3I55S 5CA5A 4CLUA 2HQFA 3CCES 1QVFR 2JOQA 1O0PA 3P45B 4XIUA 3D7SB 2H4YB 5KFCA 3UDLA 2FVSA 3GV8B 1WD6A 4KGMA 3CMQA 1IKVB 2BUNA 3HVRA 3D66A 2MSSA 4DQQA 2CQ2A 1XERA 1OYEA 2W2QP 4CLZA 2FJAB 2A10A 3CD6S 2ILYA 1J5EF 2ASYA 3CGIA 4LJMA 1S9GB 4RZRA 2OEMA 1VQNS 2KFZA 1U2FA 2EPIA 2CIMA 5LSRA 1RUSA 4HVZA 3GB0A 2BRKA 1S0VA 4RNNA 4J37A 3MECB 3OFHA 1OY6A 4NE9C 1LW0B 3TRGA 1U1LA 3VGTA 3GYXB 4IRDA 1R0CB 1R3NA 3OTEA 1EARA 1RACB 3M8SA 2HHVA 4M1KA 2MZ1A 2YNIA 2C2NA 2FY1A 3ZNJ1 5KFSA 4NZ6A 1O8BA 2VPYB 3HK2A 4NWBA 1F9EB 3D67A 3ZTQA 3R6LB 3QGPA 2A6MA 2DRAA 1S1TB 2VASA 3NGRA 3C15B 3EGVA 1NSQA 1U26A 2LVWA 1JLCB 4N41A 2RB7A 3MR5A 2VG7B 5DQHA 1IKXA 4OYPA 3GPAA 3N28A 1S1WA 3BBCA 5T41A 1QE1B 2KHDA 2PDAA 4PPZA 4X62F 2IY5B 5C42A 4DQSA 4P2XA 2K3IA 2OO4A 3M6XA 3MCSA 1HNIA 1TKDA 3OT9A 3KK2B 4ERDA 4ANEA 1IJFB 1JNRB 4R8UB 1EAYC 3PKYA 4HHJA 4J9NA 4B9LA 1GXTA 1C1BB 3CIMA 2W1BA 3HSJA 1Y5NB 2CPJA 2JVOA 1NK0A 4LFCJ 2OD6A 2AYGA 3TA0A 1HKAA 1WOOA 1P6TA 2BYCA 4DV0J 1W2IA 4PQUA 2LQJA 4ZHRB 1JLFB 4ZP8A 2DNKA 2B5JB 3DHXA 3WQPA 2CAJA 2B9WA 1RCXB 1E6YA 5IQQA 4KHRA 2AMCB 3FK4A 1GX6A 4ZKAA 4OMFG 3LWMA 2H3EB 4A8KA 1U4BA 3EZOA 1UW4A 3LAMA 3V6JA 4IRCA 1XBWA 2MZTA 3C66A 1FK9A 2F1FA 4QYRA 2E5LJ 1REGX 2MQNA 4AQYJ 2VONA 2F65A 3WDOA 4OYOA 1AUSL 4DF8A 2J8AA 1Q8BA 1TKXA 3W2WB 1RYSA 4MFBA 4ZPVR 1EIYB 1S5ZA 3JSYA 4Y3CA 1AYEA 2PI4A 3DOKA 3P8BB 3IR5B 2LECA 3MMAA 2AYBA 4DSKA 3BKUA 3P5BP 2QX0A 2EFOA 4I6WA 3MR6A 4DX7A 3NL0A 2HVIA 5GMDA 1HNXF 1D9AA 3Q2SC 3GLJA 3BGUA 1NK7A 1TUGB 2BR0A 3O3LA 1HW9A 3KWMA 2E9TA 4F3MA 2B9EA 2N7CA 2JVRA 1YJRA 2G0JA 1HR0F 3I0RB 4G3IA 4UOGA 2JSXA 3FCHA 4LFCF 5GAEI 4RU2A 2LQ8A 2HEKA 2WW8A 4HDGA 3NKYA 2ZITA 3R3TA 4DV0F 2MKIA 2QO3A 2B6AB 5ETOA 4OYBA 2B7BB 4LBIA 1IKYB 2XSJB 3KTQA 5HP1A 2GHWA 3DGPB 4NYZA 2FVRA 3RZAA 3NXZA 2V4JB 2CRLA 3KHGA 2AIRB 4AXIA 2ZNYA 3CC4S 4DHVA 2ALZA 4OLOA 1JLBA 3ELHA 1VDHA 4YR0A 2FGCA 3DOLA 4NEYA 2DHSA 1ZPWX 1B0VA 2XMUA 3CCWA 1CEZA 1JJHA 4WE1B 2VV5A 4OI6A 2IA0A 1HBNB 4KHPJ 1FEHA 2V69A 1NRKA 4F25A 3QFHA 2YQ0A 4K4ZA 1BGXT 2PGCA 3R1HA 2ADBA 4FPRA 3KFWX 2UVWA 3R5BA 2KM8C 5A8RA 4OJ1A 3DKDA 3FFIA 3RW6A 4B3SJ 2GMLA 2C3UA 2V8PA 2XNQA 3MMCB 3QO9B 4C0HA 2Y1LB 3N4WA 2P9CA 3M8QB 2RU3A 3CCSS 2B9XA 2C2OB 3QSIA 2HYIB 2JHEA 1QTNB 4CLYA 3KMSA 4MK7A 3RTVA 3N5FA 3QIPB 3D1OA 1N54B 2B4OA 1U45A 4ZLPA 1OMSA 3EXYA 3M2UB 3T6JA 4PQAA 2HURA 3U1NA 1I94J 1EQMA 2HNYA 3C6UB 3W60A 2BJDA 1U0HB 1LW2B 4NCBA 1S57A 2CJQA 4DR6J 1Y10A 3KLIB 5HJYA 3D1HA 2XY6A 1DTQB 1BXNA 2HHHJ 1RTHA 4ZVSB 1ZAXA 4ANCA 2AJ0A 1RBOB 1UKUA 3DLKB 4M5MA 2PI5A 3AB4B 3T1HJ 1PYSB 4USUA 3J7YI 4NMXA 1HQ2A 4ZCKA 3K17A 4CTAA 1YX2A 2HKEA 4B3OB 5D4PA 4KHPF 1UVKA 1RT4A 1VK8A 1FWPA 4NLWA 2WSEC 3AOBA 3DI6A 4OX7A 5KFUA 4B9UA 2C3PA 1PBUA 3EZ5A 1XK8A 2BE2B 3OUYA 2Q3PA 1EP4A 3ISZA 3P96A 5KFKA 2I5JB 3UI3A 3ZXWA 1RT5B 2JH3A 4B3SF 3NGKA 1AT1B 2HNDB 4QR1A 3AODA 3GYGA 3R7NB 4HT7A 2X51A 3NWRA 1YSJA 1WTFA 3SYZA 3CPWR 4QIFA 3HP6A 3ILOA 5A8KB 1SVDA 3AQOA 3GCWP 4DLEA 2CPFA 3JXOA 5D77A 1XC9A 1WUUA 1VRTA 4ZPWR 2R7QA 1BQNA 2N3LA 3NGUA 3CB4A 1I94F 1VISA 5LJ5Y 3DYAB 5D4LA 1UTAA 2KTQA 2QL9B 3IR6B 3J7ZT 4DL5A 4QR2A 3OFGA 4TXSA 2KKHA 4Q8EA 1OS5A 3MCMA 4ZPBA 4YB5A 3JQMA 3FSYA 4AXJA 1MNEA 1Y9OA 4DR6F 1V3SA 3IRWP 2HRTA 3O5TB 4TQRA 4XDDA 2HHHF 2FY8A 5KOXA 1KFSA 1HI0P 2LA4A 4DFMA 3GIJA 1CJVB 3T1HF 2XYHB 5B7WA 3HI9A 3O8WA 3DLEB 4OYZA 1FNMA 5K8OA 3ZTOA 3DDNA 4DS4A 3CJRA 3MFHA 4B3TF 1ZZFA 2DBBA 3PR5B 2Z58B 1VCTA 2R7SA 2GNKA 2VD3A 1HPZA 2CPZA 1CBKA 1TP7A 4DJBA 1M90T 2FJXA 1YJVA 1Q4RA 3C14A 4I7FA 2WZ1A 3C6TB 4N8NA 4KKOA 4OV6A 3HLUA 3MHYA 4O4GA 1OIAA 3W9HA 4F67A 3RU0A 3FBBA 4UOCA 4OZ0A 3I6PA 1WF2A 3OBIA 5EX0A 2XMAA 4MTPA 3UR3C 4J9KA 4R0EA 2Z2YB 2P6SA 5A0YA 3LP0A 3K5OA 1N52B 2FJEB 2WSCC 4CO4A 2M5YA 2FJWA 5U47A 4XTTA 1JB0C 3D0GE 2GHPA 5E0OA 4RX6A 3VALA 4K2JA 2JEGA 2A2CA 3V5RA 2FVPA 3HHEA 4QWEA 4TY8B 2OIHA 4YHHF 3BR8A 2RQ4A 4Q44A 4TVAB 3AHPA 4AT1B 4V1Ak 4F2SA 1ACMB 2KFYA 1DZ5A 3MPYA 1HBOB 2OSQA 1NPPA 4X4UA 2DO0A 4FYXB 2VZ9A 1T03B 2JDJA 3KG0A 1DLOB 2IRXA 2ZNZA 4NYOA 1HQEB 3UDEA 5A76A 1MROB 5E5NA 4X4PA 2BE7D 2HQDA 1NH8A 2CYYA 2C3OA 1HWUA 4PCQA 1CG2A 1RYRA 3NS6A 1FFWB 3E01B 4QOTA 1PYOB 2UXBF 4B9MA 3G82A 1O5JA 2V0NA 2QN6B 1X8DA 3NEKA 5F9LA 1ELOA 4UQGA 3QYYA 1BWVA 2YKPA 4F3QA 3MEGA 3AOAA 2D3UA 2HRUA 4DPTA 3RB6A 3LP1A 1UWBA 1H6KX 4WFZA 3HCXA 4AL6A 1PGZA 2MKHA 2AYMA 1RT1A 1UEVA 2ZE2A 1Q79A 1MWZA 4L72B 1N5YB 4Y6IA 2R8GA 2HIYA 1KNZA 2FDNA 2OPSB 3IA0A 2GMJA 4ECQA 1APSA 4RW6A 1S12A 5KFDA 4TU8A 4EYHB 1L3VA 2HSEB 3D54A 5CABA 2C2ZB 1IQZA 3M2RB 4JI8J 4LF7J 4CO3A 2E9RX 3CULA 4JI3F 4C97A 4F04B 3TUIC 4QIWD 4JI5J 4TYBA 1W7WA 2Z2MA 2XNRA 4ECWA 3NNCA 3LAKA 5KFMA 4JI4F 2EKYA 2OI2A 1FKPA 3CCVS 5B0CA 2R2SA 3DN9A 2D9PA 5K5MA 1RXOB 1FX2A 5CH7B 2XQCA 4ECXA 2C28A 2LLZA 3POTB 4B17A 1ZETA 1QD1A 2DPIA 3PYFA 2NUUG 3PYGA 3L3CA 5G0RA 4WZQA 4NCGB 2AGPA 2CPXA 4JYAJ 3MUTP 5AXLA 1VI7A 5KFPA 1RWMB 2F4VJ 2DGVA 1EZZB 5GADI 3A8EA 1NB2A 3RR8A 3A3OB 1GXUA 1IKVA 4HR2A 3K5MA 2Z57B 1Y5IB 3AD9C 1OSCA 1NMEB 3S01A 3M1VB 3DNCA 1S1XB 4IR1A 3PKMA 5BYQA 1YJUA 1JQGA 1H0HB 1S9GA 2M3DA 1UFLA 1RWWB 2NYHA 2RSQA 4FF3A 2G1DA 2PMHA 1LWCB 2FQQB 4WFBQ 1HWIA 3CJKB 3V4IB 3MECA 5FD1A 4F8RA 3MTKA 3KLHB 3O1LA 4ID5B 5HLFB 3PVXA 4IH7A 5IT0A 2ZBPA 1LW0A 2JC0A 1S79A 2WVFA 3QPIA 3J7Z5 1IQTA 1TVRB 3GFHA 3R5AA 5F0UA 1K0VA 4NLTA 1WC6A 5C2GA 4ZS6A 2NPFA 4ZLLA 4URQU 4LF7F 2OPRA 4DR4F 1XMQJ 2VKZG 3ISND 4EU0A 3ENAA 1BE4A 3MCNA 3MM9B 4I56A 4KFBA 2RQMA 1Q78A 1CLFA 3BN4A 1N32J 4ZN3A 2UUBJ 3MEEB 3PW5A 4JI5F 5LOQA 2XYGB 2K3KA 4J7CA 3K8WA 2CQCA 5B0FA 3DM2B 4O3RA 3KNAA 2O66A 3C15A 4ZIVA 3BSOA 4NLVA 3PEJA 2JLFA 3F44A 2WOMB 2DEJA 1NCLA 5A8WB 1JLCA 4CH0S 2ZFHA 2HBYB 3QWPA 1YIJS 1VQ8S 3RJMB 2F63A 2M7SA 2VG7A 2M70A 4A8MP 3V81B 4QR0A 1UA0A 1GK8A 3PJWA 1RU1A 1QM9A 2F4VF 4DEZA 2LA6A 5EN1A 4C8ZA 2QFIA 3EX7B 1QE1A 1VOMA 5HMXA 3NMRA 2BX6A 1UW9A 2RS8A 3GR0A 1RCOB 3SQGA 1KKHA 3S8SA 3IG1A 1WC5A 2V94A 5B0BA 5D4OA 3DGVA 2EFQA 4F4WA 5J2QB 3AOCA 3MUMP 4M5HA 3OFEA 4OYIA 3UN3A 3OSPA 5M2RA 3ULHA 2LKZA 1C1BA 1CJTB 1FDDA 2HHUA 3LOUA 3MDFA 4CO1A 2B9YA 1U1KA 1VRUA 4ZHRA 3NG8A 2KRBA 1XMQF 2CQHA 5D8HB 2B5JA 3W5YA 4FYYB 4K8RA 3FZBA 4USKA 1N32F 2FC8A 2UUBF 1H2TZ 2X3GA 3G6VA 2HFUA 5HVGA 2GVDB 2QLFB 4DWIA 4KE5A 4OI4A 1HYSA 4HI2A 3A3PB 3R6GB 2IJNA 2ZVSA 3CJ8A 2KZMA 3FCVA 1TKTB 3RB3A 2J6TA 3LW5C 4LSLB 2Z0GA 2DK2A 2C2EA 3O2IA 2ZJQQ 5ETVA 2EG2A 2Q1LA 4OYMA 5KFYA 4PYAA 5H9EK 4LSNB 3CCLS 3G6YA 4JI2J 1FRKA 3HSZA 3W2WA 1FE4A 3CD5A 2UVUA 4ZK7M 2KFNA 3JYTB 2IFXA 2JL9A 4UQTA 2FZKB 1Q8IA 3ET6B 1PAUB 3A8KA 1NU4A 3W2VB 1YBAA 1GMWA 4MKAA 2W24A 5A6WA 2YVSA 3PO4A 4FDFA 1S77D 5I3UB 2H5EA 4LR8A 4RW9B 1PC5A 5DM7Q 1VC0A 2LMIA 1JXVA 1WF1A 5CZVA 2CWKA 2E1CA 3V6KA 2C42A 2MZSA 4OZ5A 3I0RA 4O3OA 5KG5A 5GADU 3WX8A 2IC3B 4WU2A 1V9OA 2HHXA 1FDAA 4HH0A 5ADZA 3VQSA 4CQ1A 4M5JA 3NOCA 2B6AA 4RUAA 1IKYA 1X5SA 2FHOB 2J7WA 1NK6A 1H7XA 1U1NA 3DGPA 1X31C 1A7GE 1XQIA 2ZBRA 4OYWA 1FXDA 1K9MT 4HLBA 1B64A 1PAEX 2HAFA 2V4JA 1OQ3A 2RS2A 3MTJA 2CADA 2VQEJ 3IMQJ 1DAXA 3CTRA 3PXGa 2CG4A 2W4PA 2LXIA 2MMYA 2BE9B 1I51B 2LEBA 2UU9F 2DR8A 3B4DA 1HBNA 4JI2F 4LIRA 1N0VC 4NASA 3J7AN 2CNOB 3HT3A 1IJEB 5ETNA 1X4BA 1VQYA 2HZAA 2NYIA 4Q45A 2O67A 5HVFA 2J0XA 3RBEA 1H7WA 3GJRB 2EFGA 5KAKA 4ZJLA 2LEAA 3W66A 2CQGA 3MMCA 3MCOA 2K7JA 1TL3B 3QO9A 1ROFA 4EZ6A 1MG7A 3M8QA 3W62A 4K7QA 5D3GA 3H4BA 1N8RT 4CT8A 3MWBA 2IVMA 1A0OB 2AJQA 1IM4A 2RDJA 3QIPA 2DNQA 3MPWA 1EX8A 2AWZA 3CWJA 1VC6A 1VIOA 4TU7A 1WI8A 3I9ZA 5D15A 2FHJD 1FFSB 2YNGB 1Q82T 1U6ZA 3OFFA 1MN9A 3PV8A 2VPZB 3MM6B 1SL1A 1WG4A 2KT3A 3FKBA 2BKNA 2R9LA 3CIZA 3UQSA 1NDPA 3QT5A 3TYTA 1RTJA 3W8GA 1FI4A 5DLGA 3KLIA 1RAHB 5KFIA 4F4KA 2V6AA 4HHUA 1DTQA 1Y0HA 1T9XA 4YY3J 4OI2A 4I0WA 3HD2A 2MKSA 4RWWA 1SL2A 4LRBA 2VQEF 1S99A 2FIUA 4IFVB 2COLA 1FTCA 2CG8A 1HNVB 3UDVA 1VBZA 1FJEB 2DCLA 3WBZA 1RT7A 1NNDA 1KQSR 5KFJA 3DMJB 4B3OA 2BXJA 2J9CA 1Q1KA 5L39A 1VBYA 1CJUA 4WJBA 1GAOA 1JLAB 4ED2A 3QRRA 3W61A 3BKFA 3D6MB 2V50A 2I5JA 5ETRA 1RT5A 2XLIA 4QIGA 2HNDA 1TK8A 3ZTRA 5EWEA 3I5CA 3PW7A 2BJ3A 2H9ZA 2G4BA 4PWWA 3QNWB 2MYFA 2MGZA 5A8KA 2YKOA 2V2VA 4FN5A 4JV2A 1JK9B 4JV1A 4ZLJA 4RJVA 1S1VA 2DNGA 2ZZNA 4U96A 4H4KA 4ES1A 1X5TA 5C7PA 3NMAA 3DYAA 4OZ1A 3MOJB 2Q43A 1TUVA 2E1AA 4WFXA 1YRTA 4ZOSA 2AEMA 1I1GA 1RT2B 2XHWA 2PE8A 3EDQB 4RNFA 1NXIA 2HHTA 5L1IA 5IZHA 4A4JA 4YY3F 1T3OA 3MAQA 3DRRA 1L5UA 3H8YA 5AJ3F 2YTCA 2ZH6A 1TFWA 2V2ZA 4X4OA 3CCRS 3T19A 1YBTA 3H90A 1CJVA 2HZVA 3ONQA 1T02A 2D3OR 3DLEA 3K5LA 2FD2A 1U09A 4KC5A 1FTRA 2CJYB 4X66F 4ZIWA 2HLTA 1JKHB 3KDOA 2WVBA 3FCWA 1BWEA 1NZAA 1RHJB 4DL4A 1MMDA 1FWLA 2RH3A 4JI1J 2VOPA 4KRWA 5H9FK 3C6TA 3JSMA 3DLJA 4DV6J 1FJCA 2EBEA 1RT3A 3BS9A 3BF4A 2DPJA 2CPDA 2B7CB 2ROEA 3WHIA 1Y5LB 2V4QA 1CULA 5HL7Q 2XB2D 1CJKB 2W7PA 1U8WA 4DF4A 1VS3A 2CNNB 3AA8A 5FLXU 3KHRA 1UZDA 2ZKUA 4C8MA 4CLKA 3KXDA 3GSIA 4Y2MA 4WTYA 1RHQB 4DPWA 4DMZA 2JRSA 3D6TB 3BSAA 1PBAA 1I5OB 1HI1A 2CQ0A 1S1WB 4TY8A 2CQ3A 5KFQA 3AT1B 2F5GA 1G1XA 2XI2A 4QCLA 3LANA 5IXUA 1MW7A 3CNQP 2RRBA 1KHWA 2MZRA 1GT8A 4OZJA 2J5AA 4P10A 4ECYA 1HBOA 1SXLA 2CPYA 3H20A 3TZWA 4QWDA 3E8OA 2F4FA 5DETA 2KU7A 3VTIA 3DU5A 3UCZP 1DLOA 3PO5A 1HQEA 1MROA 3BGRB 2MTLA 4F4XA 5DGBA 1I3OB 2AJ2A 4YEAA 4EUVA 2BM1A 3IM9A 2OELA 2MKYA 3HSDA 2ZD1B 5SZTA 3NNHA 1UZHA 4OHYA 3I5AA 4DR7J 2ALYB 1DARA 3BREA 1QAYA 2IYIA 1HL6A 3TW0A 4GVBB 4DV6F 3ZZ0A 1FJGJ 4OX6A 4Z37A 4KB7A 4O0NA 2M4MA 1OJ4A 2OTJS 4J91A 2DH7A 5KFOA 2IAJB 4H4MB 2IJRA 3PW2A 4Y34A 3WZ0A 2B4PA 2L08A 2NR0A 2JZ5A 3W9IA 3BJYA 2PO4A 3RG6A 1RAJA 1N5YA 4NOHA 2XLJA 5LMUJ 3PW0A 2BJ7A 3BBBA 5IT9U 2PEHA 2OPSA 2BOPA 4N5SA 2PN6A 4OX8A 1TKXB 2IMOA 3KG1A 4X84A 1FNOA 3I31A 3BBFA 1VMBA 2CQDA 4MFBB 4X4QA 1JNZB 3PEHA 4D3GA 1UA1A 4CNZA 2WK4A 2P6TA 3M2RA 4WP9A 3RAMA 3MMAB 4BC7A 3M6UA 4C0BA 4PEOA 3QT6A 1HQUA 4M5NA 3PR4A 2KVQE 4KSEB 1NKEA 4EBEA 2VFUA 4ALZA 1HWLA 1SI9A 4ER8A 4YDXA 5B0AA 1T9YA 2NUHA 1WWHA 1SB6A 1BQXA 2AZ3A 2WW4A 3BYPA 1UL3A 2C3MA 3Q22A 4MH8A 3POTA 3OLAA 1ICEB 4QWAA 4QYZJ 4OZ2A 1C0UA 1S4FA 4CO0A 4RO0A 1OO0B 3LP2A 2QEXS 4DR7F 3L95X 1V5IB 2XMTA 2VQFJ 4P72A 5HP1B 4USVA 3HX9A 4I2PB 1CC8A 4KGVB 4KYZA 4B9VA 1FJGF 3HFZB 1FEEA 1P9YA 3AJDA 3M1VA 4CH7A 1S1XA 5L46A 1RI7A 1JLBB 3NGDA 1NK8A 1KP6A 4KH1B 3ETMA 2YNHA 2GV1A 4O3QA 4PRFA 2H5JB 3G86A 3KLVA 4F0HA 2CPEA 4QZVB 4G1IA 2I6WA 1Z2LA 5LMUF 1FERA 4J9OA 4Y0FA 1VQSA 3CJKA 1TU0B 3QGHA 2VPWB 4EO8A 3V4IA 2KM8B 2HFNA 4QPXA 5GMKa 1O51A 5E41A 5E7OB 4ID5A 4GO7X 3HHLD 5HLFA 2HBRB 2BABA 2NPIA 4RL1A 1RB0A 3VGUA 2R8IA 3SCIE 1V6HA 2OKQA 1XR7A 2E1RA 3FJ2A 3DRPB 1VQ7S 3FZ2A 3FFIB 5CCLA 4C11B 2UVRA 3MEKA 2XLKA 2CA9A 2DISA 2G2OA 4BC9A 1FA0A 2V63A 3UCUP 1LWEA 5DS7A 1X4HA 5L1JA 2IVFB 1FXRA 3DM2A 4FXVA 4NCAA 4TNOA 3IWNC 2Z2ZA 4DSJA 2FHJA 1E6VB 2WOMA 1RWOB 2HFSA 2ZH1A 3OPKA 1KQGB 1XN9A 1UJ4A 2H54B 2OD4A 5BYSA 5IT4A 1SC6A 3LALA 4OI1A 3BO4A 2YQ1A 5DG8A 2DNNA 4MJKA 1H98A 1ZS6A 3FMBA 1B7YB 1JMTA 4MYTA 2VQFF 2L9DA 4IRKA 2YKAA 5GAHI 4F02A 3E51A 1VQKS 4P74A 3HJFA 3UCGA 1S9EB 1KWMA 1DRZA 3UNYA 3NWGA 3OV7A 3IBWA 3ZTSA 4PYDA 4Y2CA 4X2BA 1P1TA 1AUDA 2DGOA 4JBCA 2QSFA 2HS0A 3IGNA 3ZTPA 1NZ8A 4L3NA 4H54A 1I6JA 3Q8QB 2IYGA 3ZZTA 4CTAB 3H5SA 4PXDA 4NLGA 2JLEA 1BD6A 1CJTA 1R8AA 2E7VA 4WFNQ 4DX8H 1TL7B 3SXLA 4UY8T 5EGYA 2C2DA 1X4CA 3C3LA 4P2FA 1Q95G 4FYDA 2C1EB 3SSQA 1CQNA 5FLXY 1S4EA 3TEGA 2EC2A 6FD1A 1QJHA 1N34J 2A6OA 2X1GA 2GVDA 3HFVA 1OPZA 2R3VA 3CJ2A 3FNNA 1UEUA 1NAQA 5AT1B 1NK9A 3D68A 2QFJA 5LMNJ 1TKTA 3OVSA 1UEKA 1RAGB 2IDEA 4LSLA 1VRTB 4DCJB 4P75A 4G1QA 2MLZA 4LSNA 1KQFB 3BEGB 3Q8UA 4Q8FA 2ZH9A 5LT5A 3Q83A 3MM5A 1HBMA 4PG7A 4USTA 1S6OA 2H1YA 3JYTA 2NXUA 1N33F 1HFEL 3OHBA 3ET6A 3IS9B 2V9WA 2ILZA 2YX1A 3H7HB 4IO9Q 4MKYA 1HHSA 4HTJA 2WSFC 3G4SS 4WF9Q 3W2VA 1RWXB 3FQKA 4U67Q 2OFGX 1UCNA 2XZDB 2GA7A 1H3DA 3W9JA 3HULA 4RW9A 2R2UA 1UVJA 4AYBD 1F3FA 1GQEA 3R97A 5MAOA 2PFFB 2JEIA 2H51B 3TJ8A 2W8KA 2OTLS 1ZTTA 4ZVFA 2DNPA 1BC6A 5GVQA 5I3PA 1IVZA 4R5PB 2JEJA 3L09A 1UJ5A 4DBQA 3ENWA 2PA8D 3QBCA 4FF4A 3GE9A 2F40A 4HTIA 1HPZB 1WOSA 1SV5A 3CO0P 4FS1A 1NKBA 5IQ6A 4I7FB 2CJ9A 1SJRA 4KKOB 5IT9Y 5CYMA 3RAXA 3OXFA 3QIDA 4KGZB 3GIRA 2DRDA 5KFVA 3ZZUA 2IPOB 2BA9A 2XMJA 4DL7A 1RBAA 1RWPB 3NS7B 2LXFA 2RKIB 5HROB 3U1MA 4URGA 3MM8A 2MQLA 2XS2A 3LP0B 1SJFA 2ZOFA 1WEZA 3SBMA 4LF8J 2BACA 2V8GA 5CHCB 2XO7A 5BR8F 2W9CA 1KQKA 1VLYA 5L1LA 3D5MA 4LQ3A 3UVJA 1AZSA 4M5DA 1Q7YT 4J5OA 2LFVA 4CYUA 1CC7A 4OZ3A 3DU6A 4IO1A 2KO1A 1IBKJ 4GKKJ 1WHVA 2MY7A 1TL3A 1RAOA 4P6QA 2XEXA 4ZP7A 2W4CA 5IV4A 3P49B 1P1LA 2X1FA 3DC2A 1CPZA 1WKLA 4LUBA 4YB1P 1PKUA 1ZTWA 2NSCA 4I64A 4USIA 4X4VA 3QRQA 3D1QA 1KSPA 4U6PA 3B6BA 4ZPAA 5KFBA 3ZFVA 5H9EJ 3R27A 2O3DA 4K2XA 4DL3A 2QV6A 2G2ZA 3B4MA 4ZCIA 4I1TA 3G82B 1Y4ZB 3RRGA 3LQVA 3D2WA 5THWA 4A47A 3GWCA 2YWHA 4AD6A 4V19X 1Z1ZA 4W92B 2P5VA 3MR7A 2RJZA 3LP1B 2XI3A 3I87A 4C48A 2JFKA 4IFVA 3BQ0A 3QQCD 2FZGB 5IC6B 3A8JA 1HNVA 4GO5X 1B7FA 4OJ3A 4WFAQ 1FFGB 2WVDA 2QLXA 4EMDA 5DQGA 2BEFA 4RW6B 3ZZOA 3F0NA 4ZVUB 2YPZA 2R7OA 2J7KA 2R4FA 3GU0A 4FS2A 1GTEA 4ZJQA 4ECTA 1YJNS 4GKKF 5HQ8A 1VBXA 4WP3A 3D3CJ 3PACA 4ZPCA 4WWSA 3TA2A 5GAGU 4NXMJ 3HHKA 3CD7A 2BVZA 1T9VA 1FKOA 5BJRA 2ZH5A 1R0AA 3FDSA 3OTCA 1FKPB 2V8DA 2Z4PA 1B99A 5A6PA 3NCRA 2GZOA 4Q2LA 2ZUGA 4CCHA 4H4OA 2GHVC 2DKOB 2JC1A 5ETLA 4OZNA 1WOPA 2Y3YA 3CCJS 4AL7A 1WKJA 2OFHX 3X3UA 2ZDPA 3VGVA 4K50A 3VAGA 3SQOP 4G1PA 1PYTA 3B82A 4DSLA 4X62J 4LBPA 1RT2A 3M32A 3BB5A 5DRKA 2FTRA 1VQ6S 5D0GA 2ACYA 5IC4B 3THVA 1YVFA 3KLEB 1G2EA 4JV5J 1VHIA 3ZZPA 2ZBIA 4PUOB 4DR1F 1QSSA 2EC0A 4ZP6A 2XCPA 1TFYA 4IG0A 4CM0A 1OY9A 5KFRA 1WEYA 1JKHA 3AJ2A 4CDIA 2M2BA 1RWKB 3CD0A 1CVJA 2CQPA 3HHLC 2VPXB 4L75A 1GFWB 2OPRB 4DOZA 3CMES 3IAM9 2GQCA 2PMZD 1S59A 3PM9A 4KFBB 2CJAA 2DNHA 3D0IE 2RUGA 2K1RB 4NXMF 1NPRA 5DDOC 2FLLA 4Y2IA 5KFWA 2DNOA 3I56S 1RT6B 4GRSA 2XY5A 1CJKA 3TA1A 9RUBA 4FNIA 2M9KA 3T6BA 1KRPA 2R7RA 4E2FB 4WKYA 1F6TA 1RBLA 5DO2A 3US5A 5J1EB 1AROP 1SKRA 1NH7A 4EI2A 1UPMB 3J7A1 1EJ7L 4Y28C 3M8PB 2DRBA 5LXYA 2VJVA 2XMMA 3SQGB 2WVEA 4CLLA 3LGHA 2DHAA 3QAEA 3CDAA 3IG1B 4LMZA 3DOMB 2C2MB 4I2QA 1QUPA 4OIXA 2X1BA 4ZCLA 3PRDA 3EVWA 1KLNA 1HNXJ 1T0TV 1WHXA 4XPCA 2GJIA 4JV5F 1FO1A 2EFVA 4MMOA 8ATCB 1RAEB 3BGLA 1Q53A 2MQOA 1T8EA 3CJ3A 2Y9HA 3CC7S 1NEEA 3KK3A 4HKQA 1KC8T 3BGRA 1HR0J 3CDUA 4ED4A 3PYEA 1G3OA 1TMJA 4HDHA 4LFAJ 1IR1A 2F8HA 2Q66A 1K73T 1YQHA 1RU2A 2YNFB 3BGFA 5K8PA 2Q6BA 2ZD1A 1VRUB 3K7RA 4YB7A 1Q16B 1EETB 1F60B 1OY8A 3KJQB 3PRBA 4GVBA 1R31A 1XNQJ 3GFZA 3OTBA 1HYSB 3HDSA 3EXCX 4P71A 3DCAA 3M8RA 2XGPA 2JWNA 2Y8YA 2IAJA 4H4MA 4U95A 3OQ2A 4LF4J 2AKWB 4LFBJ 4DV4J 3JQKA 2D9OA 3GILA 2QMUB 4HHHA 5BXIA 1S6QB 2GIRA 4RNOA 1C1CA 1WORA 2BM0A 2JLGA 3GJQB 2G2YA 1SQFA 4Q2MA 4B3RF 4CI0B 3O6QA 3BSNA 2O1PA 2RUSA 3KLGA 2OLWA 3NRBA 3KUHA 1K44A 2RRNA 5KG4A 2Q79A 2DXFA 2DT9A 5H9FJ 5CXTA 1HD0A 2D3O1 3N6MA 5F8GA 1Q7LB 2ACMA 4WP8A 3CE8A 2H4WB 3GCXP 3JSRA 1UVMA 2HHPA 4KV8A 1HI8A 3MF5A 4B3MJ 1RJJA 2G0IA 3JTNA 3I9V9 1S9FA 4DV5J 3R5DA 3PJ9A 4IYQA 2B43A 5HMZA 4PXBA 2BOAA 3MEDA 1M5HA 3CDBA 1DJ0A 4LFAF 4CO5A 2AGQA 4ED6A 3UD5A 1H72C 1KLMB 2W4DA 1F3VA 2YWFA 1NO8A 1WF0A 4A8OA 2ZH7A 4LVOP 3WX4A 2A2DA 4I4BA 5KG3A 4I2PA 4PWUA 3UE2A 1XNQF 1QTMA 4NLQA 5HMYA 2J8SA 4M5LA 2OSRA 1U49A 2LQ9A 4NZ0A 4LF4F 4J9VA 3RRHA 1YBUA 1T9UA 4LFBF 4DV4F 3IFEA 3M9OB 4N76A 4U9RA 4UUWA 1FRHA 2YKNA 2HK3A 4X4SA 4OFZA 2DNRA 1DFDA 1D9FA 1LOUA 1Y3JA 2DD8S 1C0TA 4LR7A 4E0DA 1X7VA 4BCAA 2RILA 3TWZA 3DRPA 1J27A 3OJUA 1FRIA 4C11A 2ZDOA 1KONA 1S49A 2HFVA 1GMUA 3ITHB 3GIIA 5D3GB 1SKWA 4MK9A 3GTYX 3H42A 4J9SA 4QU6A 1FESA 3GV7B 1MU2B 5E3RA 2PIIA 3MAHA 2IM2A 2LYVA 3DHWC 4B08A 4B3MF 3H5XA 4IH6A 2XCAA 4M95A 1N88A 3DLHA 4DV5F 1VBKA 1E6VA 3C19A 3QLHB 3G96A 2IJFA 1GH8A 3CT9A 1N4LA 1HARA 1SUQA 5CD4A 3AH6A 3HT0A 2I9SA 2GIQA 4DFJA 1KVJA 3B54A 1WSVA 3FGVA 3KG4A 1VFJA 2FUG9 3FC9A 2W9BB 2W8LA 2HNZA 3JTPA 1R89A 2RVJA 3TJAA 1M5KC 1RTJB 1XTZA 4ZPDA 4TU9A 3TAQA 1S9EA 4LIWA 3ETOA 4Q0BB 5F8HA 4QWCA 5E33A 4LRDA 2DR6A 4FZVA 3K89A 2WBRA 1JLGB 4F4ZA 2YQ3A 5ETMA 1ZM9A 3H5UA 2W01A 2KH9A 3QMQA 1RT7B 4ZCMA 1UPPA 3HKZD 3KK1B 4B3TJ 1ZM3A 2XMVA 1CJUB 4DU8A 1TL7A 2AGOA 4LRAA 1B0TA 3KNGA 2CQBA 3H5YA 3CW2C 2MLXA 3CC2S 4AFFA 3TI0A 1P27B 3KJNB 5HI7A 3KLFB 2K2PA 4DSEA 4N7TA 2AEFA 4I6YA 2MDAA 1IR2A 2GC8A 4C3LA 3KHLA 4DV7J 3LH2S 4DR2J 1SJ1A 3TJ9A 5F8JA 2X1AA 1YJTA 2CQ4A 2MGZB 2QSWA 2XZTB 5K14A 1R6YA 2H65B 2VFRA 3RBZA 4UOFA 3K58A 5DZ7A 1S1VB 5KG1A 1VR6A 3CJSA 3AAWB 1VQ9S 2M8HA 3HVWA 2DIVA 4F7VA 1FVQA 3BH7B 4YHHJ 1HWKA 1TTHB 2GGPB 3BPSP 4NL5A 1JJCB 2ZH8A 2BJEA 3AA9A 3R2CJ 3IS9A 4CNYA 4DUTA 5EWFA 2HVZA 3QJLA 1U7LA 2JNJA 2B0GA 2HAIA 2HMIA 3DRRB 4JI7J 3I5BA 1YWXA 1N5SA 3EGZA 2XY7A 4K0KJ 2E44A 5M2PA 1R7IA 3I0SB 2EI5A 2OAUA 1QSLA 2AZ1A 3MD3A 5GAEU 3MUVP 2EWHA 3RW7A 2KXHA 8AT1B 1X4FA 3MR2A 3IWLA 1C4CA 2ATLA 3MPUB 4R5PA 3TR5A 3CCTA 2WVCA 4ELTA 3A13A 4LSZB 4Y2AA 1VQPS 1CQMA 2HRYA 3PY8A 2VG6A 4KO0B 4ED1A 4OI0A 3ENQA 1WNEA 4IKAA 3HO1A 2XG8A 3JSMB 2UXBJ 4RLEA 4NI2A 3EPIA 2NCKL 4NA1A 3V4MA 1T05A 1RT3B 5ETKA 2OHDA 2B8PA 4DV7F 1Q0NA 4DR2F 3RRKA 2ZH3A 2N3OA 1CULB 2QIFA 2Y1IA 4AE5A 1NHKL 1TV6A 4ES3A 1Z2ZA 3JB9k 3K59A 2RKIA 3QRPA 5HROA 1Q8LA 1JJ2R 2RAQA 1WI6A 4WXOA 4QYZK 1WDTA 3V6HA 3N9UC 1U48A 4K5SA 4ECSA 4ETXA 4RW7B 1FJ7A 4O44B 1TL4A 3H59A 4ENOA 1RHUB 2W2MP 4RR5A 4CLWA 2HWIA 1JLEA 4JI3J 4JI7F 5J2NB 3AQPA 2EK6A 2ERRA 4K0KF 5JMNA 1U0SA 3TZYA 3ILLA 2ZBQA 4WTOB 3PG9A 2NXNA 4JI4J 3NGSA 2ZC3A 5E3AA 3ZNUA 3TO8A 3CDEA 1HW8A 2VHGA 4A8YA 1X4AA 4PWDB 4NA2A 2ROGA 2DXEA 3H2VE 4K4UA 2P8IA 2XS5A 1SKUB 3VV2B 4DN0A 4C98A 1XR6A 5J2MB 3N0VA 4J9PA 1GX5A 1XWLA 5B0GA 3FEZA 1T11A 3FEXB 2OMOA 5DG9A 4F4AA 3U02A 1N6QB 4C6AA 2DTJA 4WIQA 1VYAA 5AXKA 3J7YU 3T5KA 1F5BA 7FD1A 5HATA 6FDRA 4ATNA 3I32A 5HO4A 1S7IA 4PR6A 4CZCA 3ADAC 5HQMA 2MLYA 4YB6A 2B4UA 3PTWA 5SUHA 5L9NA 1J5OB 5DDRC 1RADB 2UZAA 2KG0A 2KRRA 3DXSX 3OVBA 1RTZA 5HK4A 1ZPVA 1NLKL 2JJ4D 2VBXA 4BBYA 1S48A 4KPCA 2HGLA 2J9DA 3MAAB 2EEYA 3M7VA 5T7LA 4DR4J 3SCJE 3EVOA 4X4TA 2GO9A 3FSIA 1HQUB 4KR0B 1ZYQA 4KHMA 1T9TA 3KJVA 2XHCA 2DJWA 3OL6A 2E9ZA 5F3TA 5E3QA 2OGUA 4NLOA 4ILRA 2YX7A 3OJSA 5IFMA 2R42A 1YI2S 5ITHA 1RTDB 1N5TA 4P73A 1R0BG 1IKWA 3L4BC 2Z2LA 4CWBA 2CJXB 1U2CA 1C0UB 2IMWP 1YJ7A 2K7KA 3LP2B 3G8TA 2V5HG 2F3JA 2CVIA 2AJ4A 1W26A 4RW8B 1LK5A 3UWTA 1QAIA 1S1UA 3H4DA 2YNHB 3DLGA 3KYLA 2DR7A 4FPIA 3KLEA 4ETZA 1EKSA 2JFDA 3MGJA 2HWTA 2HVEA 1X0PA 4PUOA 2HQ3A 1QSYA 4ZPTR 5I42A 4NLYA 4U8YA 1C2PA 2J7UA 4TLRA 3J81j 3TEHB 4KTQA 3W1YC 1PSDA 3MD1A 3T3FA 2VF3A 3V2UC 4DCPB 5JUMA 3QT8A 4A8QA 3H25A 3PDNA 2XWXA 2WONB 4ED3A 4ZVQB 1M5PC 1WC1A 3NS5A 4ECZA 5CAAA 2K1RA 4ZDNA 1LWEB 4OHZA 4ZVRB 3FEYB 2C2RA 5F9NA 1UP1A 5KFGA 4TYAA 4DL6A 1RT6A 2M88A 2KJVA 1SJQA 1W25A 4RNHA 3EM1A 2KI2A 4IQXA 2IVYA 1CSJA 3PRVA 2BZ2A 4DSFA 4OV1A 4C8KA 3Q86A 1W2BR 4OYXA 1TK0A 5J1EA 2VBZA 2Y0BB 1CS4A 1T94A 3NOGA 2E66A 4ILLA 3FRZA 3QWUA 1B4SA 3M8PA 3LGNA 1F0XA 2VFTA 3JTOA 2FJBB 1YJWS 1UETA 4J90A 3DOMA 4OHWA 1FDBA 1KOHA 3M9MB 5KFNA 3QZ7A 2D3ZA 1ITPA 2RF2B 1SL0A 3VWSA 3R7SB 3IBCB 4FKXA 3VCDA 1U8SA 2GW8A 2SXLA 5B09A 2BANB 4LF5J 3GIKA 4MK8A 4C3MA 1FRLA 1NUEA 2EFNA 4IOBA 3RB4A 1TQLA 3GSDA 1NSKL 2NZ4A 3HSGA 2DH8A 4C8YA 4IR9A 2YNFA 5KG2A 1SH0A 2ZZTA 3CVKA 2VC0A 4YS2A 1WHWA 1IXKA 1EETA 1UFKA 1QAJA 2ZEJA 4C9DA 2ZWPA 2W2PP 1KFDA 1KHVA 2OPQA 2AT1B 3P5TL 3OD2A 2CWXA 2N4DA 3Q8RB 2U1AA 4NLXA 1LXJA 4UW2A 1BLUA 1S7HA 2GFFA 2ZUAA 2DGXA 1R43A 2ZH2A 3VHQA 2E1PA 2ZHOA 2XULA 2KB2A 3JAMU 4FBTA 3TARA 2UU9J 2CPHA 4G1QB 1KVIA 1S6QA 3S1TA 1KR4A 4Z2XA 4IFYB 1ZA2B 1TR0A 3CCUS 3MM5B 2KYXA 1HBMB 1HMVB 5IS2A 2A0FB 4BWJA 3Q89A 2R2RA 4LR9A 3SDEB 2HVHA 1ZAWA 2Z30B 2KXNB 3CO9A 1H2UX 2PC6A 5KT7A 3H2UB 4WYWA 1WEXA 4C4WA 5KFZA 1RKIA 4YP3A 3VAFA 3FRYA 4AL5A 2AV5A 4LF5F 3JS9A 4ANDA 2J76E 3AXMA 2ZM6J 5CZXA 3FQLA 1HWJA 2DXDA 4TKTA 4ES2A 3EGNA 4U8VA 1KLMA 3MFIA 1SV5B 2OPPB 2CZ9A 2GS8A 2RU9A 4R25A 1N36J 4FYWB 1NJXA 2RMLA 5HANA 4EK2A 3GJTB 5CYMB 2MQQA 3E2EA 3C8YA 1MMLA 3TVZA 1H2VZ 2DH9A 4RUCA 2VIHA 2PD1A 1R8BA 3T5HA 1SBRA 1J2VA 3KJFB 4PAAA 3M2VA 1RQ0A 2DNYA 2GVZB 2GQQA 3MM8B 1NK5A 3U27A 5L38A 4DV3J 2W7OA 4LVNP 4O23A 3M30A 1WC4A 2CZ4A 4RBUA 4P7TA 4ED5A 4JI0J 2ZHAA 2W9CB 3EGWB 3N6NA 4NRTA 2VC1A 3BKTA 2E5JA 3UVJB 1AZSB 4M5DB 3BSCA 9ATCB 4EZ9A 2XC9A 2V9KA 1XJWB 3PHEA 4CYUB 4FXDA 1DQ8A 2E5LF 1A9NB 4AQYF 5IM0A 3NCQA 4P7VA 3QT7A 3ITHA 2CUYA 4ZVPB 2BKOA 1MU2A 4HH1A 1TMMA 2BMBA 3M6VA 4L73A 4OLPA 4CT9A 4M5GA 1WSRA 1RABB 3DRYA 4PG5A 2ASDA 3QZ8A 3MOZA 5CD4H 2ZM6F 4ICLB 2R8KA 2QJ3A 2ZKTA 1XEZA 1AB8A 7AT1B 2DNMA 3QLHA 1SH3A 1ZBTA 4U7UK 1LNQA 3QGGA 5ETSA 3RBXA 2J9DE 1X9SA 5EUHA 3TZXA 1YZ6A 4GC6A 1M1HA 4X65J 1N36F 1NDKA 4QPTA 1KTVA 2KZZA 2DY1A 2APOA 4WU3A 2W9BA 1M5VC 3GFYA 3B78A 1MLAA 2UVVA 2RRAA 1OPIA 4O0IA 4Q5VA 1SPBP 4A8SA 2EXUA 4Q0BA 5AJ3J 3L7PA 2R8HA 1MSWD 5KFHA 1SQGA 2OEJA 1Q5YA 1JLGA 2VB6A 2MKJA 4DV3F 4PZVA 2WCXA 1RTIB 2A18A 4F36A 4JI0F 3KK1A 3UO0A 2P2CB 3M8YA 2HGNA 3VAMA 4X66J 5LJ3Y 4ZP9A 3CJ4A 2CFXA 5JXSA 4K4VA 5ETTA 2RDDA 1Q86T 1ZZNA 4C7QA 4FBUA 3N5BA 2M0GB 1L3TA 3KLFA 5J1PA 4I67A 3G6ES 1QDUB 3LPYA 1FKOB 3PFOA 3EWGA 3D6FB 1R0AB 2AD9A 2DIUA 1FD8A 2J6UA 2Z8QA 4USJC 2YWWA 5HN0A 2EFPA 2DCUB 1AW0A 2LDYA 3DLLQ 4N47A 2D41A 4H4OB 5C25B 1X4GA 2MSTA 1FX4A 2LCWA 4EGLA 1JXEA 3DRSB 4IOCQ 2C3YA 3BO3A 1RA7A 3AB2B 2MXYA 4X65F 5K8NA 2RDIA 3B8HA 4USHA 1TKZB 5J2PA 4ZMMA 2GGPA 2QG9B 1PJ6A 4UZBA 4GKJJ 1REVB 2G1HA 4F0MA 3M32B 5JJBA 2KVIA 2LDIA 7FDRA 2GCFA 2DNLA 2ZC4A 3HXMA 3GONA 2W2OP 3BGOP 3I0SA 1AFJA 4YOEA 3MMJA 5HBMB 3BDPA 2BDPA 4EYIB 3R1LA 3HHLB 1VHFA 4KY3A 4FF2A 3OR2B 3HVTA 2HPUA 5F8IA 1RK8A 2UUAJ 3IRXB 4IG0B 3VAHA 4KO0A 2JEFA 4K59A 1LK7A 2FPHX 3S6EA 5CQGA 2IM3A 3CCQS 3EICA 1GMWD 3JAMY 2KL8A 1WHYA 3SMZA 4Q43A 1KN6A 1RA6A 1S10A 1IN0A 2E1MC 2YKMA 4C8NA 1FF2A 1LWXA 2W7AA 2M52A 2BRLA 2ROPA 3HFKA 1FT8A 1PCAA 2NREA 5FDLB 4DX6A 3RAQA 5KT6A 1VIXA 3OL7A 4PG8A 1F9HA 3OR1B 1HIYA 1V3RA 5HJXA 4DX5A 2Q6CA 2QYGA 3TZZA 2HFOA 3QATA 3R8YA 1SJ4P 5D6GA 4FXWA 4DN9A 3KOAA 4L74A 3VGSA 1RSCA 2HIQA 1XMBA 4DG1B 5D0EA 2ADCA 4RW7A 3CXCR 4OL8A 5B0DA 4CM2A 3UW1A 4ZLNA 3BZQA 5HMWA 4O44A 3WC0A 3FBEA 1RAAB 2QZ8A 3HF5A 4GKJF 3U1LA 1U02A 3HZGA 5KT2A 2QLWA 4I2QB 1NDCA 5J2NA 4C8LA 3PFEA 2I8EA 1KTQA 1NJZA 2OP5A 2L48A 2KYZA 5D0HA 2Y8WA 3RYLA 2RNEA 1S6UA 4JV0A 3KK3B 3HZEA 2UUAF 4MIWA 1Q81T 3SI8A 4PWDA 4N8OA 2B8QA 1Y00A 4JB8B 1NM2A 2J0SD 2ZVIA 3HM9A 4FP9A 3QSYB 5D78A 1KD1T 5J2MA 4KJIA 1RWNB 4EBDA 3TAMB 4RW4A 2QA2A 1DY3A 3EYZA 3QFWA 2LP4A 1N6QA 1BUXA 4F0KA 3VAIA 3UD4P 3F41A 2K8GA 4YFUA 2FHMA 1WG1A 2AJ1A 4C3KA 2J0WA 2R2TA 1ZH5A 3CEDA 2RQCA 4MYUA 1YTYA 4WK3A 2AW0A 4ZJOA 5KFEA 3G6XA 1FVSA 5ETPA 1D9DA 1HNWJ 3AD7C 5KOWA 4JUZA 1T7PA 5I3QA 3DLBA 4IH5A 1DQAA 3E3XA 3OHAA 2IBKA 2RHSB 4ED8A 1C1CB 1X9WA 1RKJA 3DRXA 1LKZA 1S76D 4FVMA 3WIUA 5DZ6A 1J5OA 2BW7A 1RE1B 3KLGB 2DITA 2XZWA 1R8HA 1G7CB 2NSBA 4A46A 1WKKA 2FB0A 4ZVEA 3C46A 2VDHA 2UUTA 3Q8PB 3MAAA 2LU1A 1VQOS 1BQMA 3NP5A 3CJ0A 4WCEQ 1SC4B 1N48A 2YWKA 2NXCA 3LF0A 4ZVOB 2B51A 2D1CA 4E98A 4ID8A 4NA3A 1TELA 3I96A 2OH2A 3HKWA 2K06A 3GJSB 5DQIA 3NAHA 2BJ9A 1LV5A 4EBCA 1L3KA 2IIHA 3C16A 2DR5A 4KV8B 2MJNA 4YR2A 5KG6A 2YKQA 3TAPA 1U47A 1RTDA 2B4VA 2HQGA 3WC2A 3CCZA 3MEDB 1A6LA 5C24B 1JLQA 2CNKB 4O3PA 4JOUA 4OJHA 1WELA 4NLSA 4MAKA 3NCPA 2QLJB 5IWAJ 4O4RA 2HZCA 1K0TA 4BHQA 3D0HE 1KOOA 4DPXA 1HNZJ 4ELVA 6AT1B 4QIEA 4NLPA 1YJ9S 4TLQA 1NB7A 4RW8A 5B0EA 3PIOQ 1F9FA 3QAUA 1IBMJ 5J1NA 3N01A 3TUJC 4XAKA 1U1RA 2V8HA 5C5JA 2MHEA 1HNWF 4XDCA 3CDWA 3T1AA 1TUWA 3R9LA 2V8VA 3FUYA 3EUNA 3T9NA 2AHOB 4OI3A 1ZOTA 1XMOJ 5CYJA 4DZDA 2DHGA 4X4RA 4LF2A 1M5OC 2YKNB 1Z4UA 3LPEA 2YX4A 1RISA 2DNZA 1FKAF 3FBFA 2KDOA 4V19J 1C0TB 1KBRA 4U7CA 1WC0A 4HACB 2AX1A 2XTJP 2WONA 4OYAA 4L76A 1HD1A 1DTTB 1KVKA 3T41A 2ASJA 1K1SA 2M8DB 3K0JA 1KS2A 2EG1A 2KJWA 4QJVA 3Q8VA 3PX0A 4JI8F 3J80U 1LFPA 3TUZC 3K5NA 3EVMA 1SUQB 5IWAF 2GQ2A 4QBUA 1LQ9A 3SSRA 1HNZF 3OTDA 4KQZA 4KH0B 3NAIA 4C8OA 5A2QU 1S1TA 4FF1A 2IDLA 2CDQA 3IR7B 1FRJA 1GTHA 2HNZB 1N33J 3MXHP 2MB0B 1IBMF 1M1KT 1NK4A 4JYAF 1VJQA 4KGXB 4BS2A 2PT0A 2RF2A 2GO8A 4K4YA 4DCOB 1M1GA 4HT5A 3G8SA 3IXQA 2I1RA
chains in the Genus database with same CATH topology
3H8YA 5AJ3F 4NWBA 2CQ4A 2BANA 2YTCA 2ZH6A 3MM7B 4HL9A 2MGZB 1TFWA 4QU6A 4YQWA 2QSWA 4X4OA 1XMOF 3CCRS 3T19A 5K14A 1R6YA 1LWFB 2VFRA 2YH0A 3BDEA 3K58A 4DFPA 3QGPA 2DRAA 1S1VB 5KG1A 3O44A 3PIPQ 3AAWB 1S1TB 3P6YC 3ONQA 2VASA 5M2UA 2MY8A 4NZ7A 1T02A 1VQ9S 2D3OR 3DLEA 3K5LA 2FD2A 4FNHA 1U09A 2M8HA 3HVWA 4KC5A 1FTRA 4LQ9A 2DIVA 1U26A 4WKRA 3KK2A 4F2RA 4X66F 2MQPA 2LVWA 1FVQA 1JKHB 2HLTA 1JLCB 1BWEA 4R8UA 1NZAA 2XMWA 1HWKA 4G6VB 4N41A 4DL4A 2GGPB 4NL5A 1MMDA 2RB7A 2ZH8A 3MR5A 2BJEA 1JWWA 2VG7B 1OSDA 5DQHA 1IKXA 3AA9A 5FJ4A 2RH3A 4X4NA 2L9NA 3IS9A 3NBPB 5EX3A 4CNYA 3N28A 2HVZA 5EWFA 2VOPA 4KRWA 4CIOA 1S1WA 3HPOA 3C6TA 3QJLA 1U7LA 3JSMA 5T41A 1QE1B 2B0GA 2HAIA 2HMIA 2KHDA 3DRRB 3I5BA 2VOOA 2PDAA 4PPZA 1YWXA 3DLJA 1N5SA 3EGZA 4X62F 2XY7A 5K14B 4URSA 2E44A 1FJCA 3G71S 2EBEA 5M2PA 1RT3A 1R7IA 3BS9A 3I0SB 3BF4A 5C42A 2EI5A 2DPJA 1D1UA 2OAUA 1QSLA 4DQSA 3MD3A 2WBMA 2CPDA 5GAEU 1JLFA 2EWHA 3MUVP 3RW7A 4NRUA 2KXHA 2K3IA 2B7CB 2OO4A 4WIIA 5G4DA 2ROEA 1X4FA 3M6XA 3MCSA 3MR2A 1Y5LB 2NQPA 2V4QA 1HNIA 5HL7Q 3IWLA 1C4CA 2ATLA 1TKDA 2XB2D 2W7PA 4DF4A 5BYRA 1VS3A 4IFYA 4R5PA 3TR5A 3CCTA 4ELTA 4Y2AA 1T3OA 3KK2B 1VQPS 1CQMA 2HRYA 2CQIA 3AA8A 4ERDA 1HMVA 3PY8A 1IJFB 3KHRA 1JNRB 4C8MA 2ZKUA 4R8UB 2VG6A 4KO0B 4ED1A 3PKYA 4Y2MA 4HHJA 4WTYA 3V6DB 3SDEA 2N7YA 4DMZA 2JRSA 4J9NA 4B9LA 4OI0A 1GXTA 3ENQA 1WNEA 3BSAA 1C1BB 3CIMA 1PILA 1HI1A 1Y5NB 2CQ0A 2CPJA 4IKAA 1S1WB 4TY8A 3HO1A 2JVOA 2CQ3A 2KN4A 3H98A 2XG8A 5KFQA 3JSMB 1NK0A 1U6FA 4HEA9 4RLEA 2HMIB 2MPUA 4C0OC 2OD6A 1G1XA 3EPIA 1B0PA 2XI2A 4QCLA 2AYGA 3TA0A 1D0EA 3LANA 5IXUA 4NA1A 1MW7A 4IG3B 1P6TA 2BYCA 3V4MA 3OXGA 4XO0A 1R8CA 1W2IA 1T05A 2LQ5A 1RT3B 4PQUA 2LQJA 2RRBA 4ZHRB 2GX8A 1KHWA 4DV7F 4DR2F 3RRKA 1JLFB 2MZRA 1GT8A 2DNKA 4OZJA 4ZP8A 5L9XA 2B5JB 3DHXA 2ZH3A 5KFAA 2J5AA 4ECYA 5F8JA 2N3OA 1L3SA 1HBOA 2QIFA 2B9WA 2Y1IA 1SXLA 2CPYA 1E6YA 3H20A 4AE5A 1TV6A 3L7OA 3SCKE 4ES3A 1Z2ZA 5IQQA 3JB9k 4KHRA 3K59A 2RKIA 4QWDA 3NNAA 5HROA 1GX6A 3E8OA 3TP2A 5DETA 4ZKAA 1Q8LA 1JJ2R 2KU7A 4M94A 4OMFG 3LWMA 1WI6A 4WXOA 3VTIA 4A8KA 1U4BA 5KT5A 3DU5A 2VG6B 3UCZP 1DLOA 1UW4A 3LAMA 2O5DA 1F2GA 3V6JA 2A3JA 2RIJA 4N77A 3PO5A 4IRCA 1XBWA 4QW8A 1HQEA 2MZTA 1MROA 3C66A 3BGRB 2CVEA 3N9UC 3V6HA 1U48A 1FK9A 4K5SA 2WB1D 2UXCF 4F4XA 5DGBA 2OPPA 1VJWA 4ECSA 1IBLF 4ETXA 2F1FA 4OHVA 4RW7B 4QYRA 1FJ7A 1FDNA 4K4TA 2MQNA 3EPGA 2VONA 4NPOA 2DGWA 4O44B 1TL4A 3H59A 3WDOA 2AP6A 5CYQB 4YEAA 4DF8A 4EUVA 5JVGQ 2BM1A 2J8AA 1Q8BA 3DXBA 1TKXA 2ZD1B 1GNKA 5SZTA 4PG6A 2YWEA 1T05B 3HMJG 3W3SA 3W2WB 3NNHA 1RYSA 2HWIA 1JLEA 4OHYA 4JI6F 3I5AA 2I38A 1DARA 4MFBA 4ZPVR 2J9EA 3BREA 2FC9A 1QAYA 4JI7F 5J2NB 3T9ZA 2IYIA 1HL6A 1ZM2A 3JSYA 4Y3CA 3TW0A 3AQPA 5KG7A 2EK6A 2ERRA 4DV6F 3ZZ0A 2PI4A 1TV6B 2G13A 4K0KF 3DOKA 2LECA 3IR5B 3MMAA 4OX6A 2AYBA 2VFVA 4DSKA 2NLWA 4KB7A 4Z37A 2M4MA 2EFOA 4M8LA 4I6WA 3MR6A 4ED0A 2XSJA 3MPVA 3NL0A 2OTJS 4Q7AA 4IQMA 2DH7A 5KFOA 2IAJB 4H4MB 3SFUA 2HVIA 2ZC3A 1HNXF 1D9AA 3Q2SC 5E3AA 3TO8A 3PW2A 4Y34A 3WZ0A 2B4PA 3BGUA 1HW8A 3CDEA 1NK7A 4NLDA 2L08A 2NR0A 1PC4A 2BR0A 2JZ5A 4A8YA 3BJYA 3PX6A 1X4AA 2PO4A 4PWDB 3BQ2A 4NA2A 3SFGA 1YRUA 2ROGA 1RAJA 5KT3A 3RR7A 2R7UA 5DG7A 4NOHA 2XLJA 3O3LA 3PW0A 1N5YA 1HW9A 1QAXA 3KWMA 4ZVHA 2E9TA 3H2VE 4F3MA 2N7CA 3PW4A 4K4UA 2XS5A 2PEHA 2JVRA 2OPSA 4DN0A 2F7VA 2BOPA 2R8JA 4N5SA 1YJRA 2PN6A 4C98A 4OX8A 1TKXB 1XR6A 2IMOA 5J2MB 3KG1A 3N0VA 1HR0F 4J9PA 1GX5A 2VUGA 1XWLA 3I0RB 4G3IA 4X84A 5B0GA 1FNOA 1JLEB 1T3NA 3FEZA 3I31A 1VMBA 1V3ZA 3FEXB 2CQDA 4MFBB 1OQ6A 2JSXA 4X4QA 1JNZB 2OMOA 5DG9A 3FCHA 4LFCF 5GAEI 4RU2A 1UMJA 2WW8A 3BM7A 4HDGA 3U02A 3PEHA 4J9QA 1N6QB 3PNIA 1S6PB 4D3GA 1UA1A 2DTJA 3NKYA 4CNZA 4WE1A 2ZITA 2DB1A 3R3TA 4DV0F 2WK4A 2PA3A 2P6TA 3M2RA 5AXKA 3RAMA 3MMAB 4BC7A 2MKIA 3M6UA 3J7YU 2QO3A 4C0BA 2B6AB 3T5KA 2B7BB 1F5BA 3LO3A 4DSIA 1HQUA 1IKYB 7FD1A 4I6AA 2XSJB 3MMBB 1TAUA 3KTQA 3PR4A 2FHKA 4KSEB 1NKEA 6FDRA 5HP1A 2GHWA 4ATNA 4EBEA 2VODA 3I32A 4C2MA 4CO2A 5HO4A 1UJ6A 2VFUA 4ALZA 3K8VA 4NYZA 2FVRA 3HVAA 1HWLA 4PR6A 3Q8SB 3RZAA 4ICLA 4CZCA 1SI9A 1UVLA 2V4JB 4YDXA 2CRLA 3KHGA 4AXIA 4WYLA 2ZNYA 3CC4S 4DHVA 2ALZA 5B0AA 4Y65A 2NUHA 4OLOA 2AX0A 1JLBA 1WWHA 4YR0A 3P3DA 1SB6A 5GAHU 1BQXA 4F4YA 2FGCA 4YB6A 2B4UA 1UL3A 2Y1JA 2C3MA 2N4CA 5SUHA 5L9NA 4ECUA 3DOLA 3Q22A 1SJ3P 4MH8A 5AE2A 2DHSA 1J5OB 1ZPWX 5DDRC 3POTA 1B0VA 2UZAA 2KG0A 2KRRA 3DXSX 3OVBA 2XMUA 2F8EX 4QWAA 3OLAA 3CCWA 1ZPVA 2VG5B 4QYZJ 1CEZA 4YUDA 2JJ4D 2IHR1 1JJHA 2VBXA 3M05A 4WE1B 2VV5A 4OI6A 4BBYA 2IA0A 2W9AA 1C0UA 1HBNB 1S4FA 1S48A 4CO0A 2HGLA 2J9DA 5T7LA 3ZZRA 1OO0B 3LP2A 2QEXS 4DR7F 3SCJE 3L95X 4X4TA 1DHMA 2GO9A 3FSIA 3TVKA 1FEHA 1HQUB 2X1AA 2HGMA 3M2UA 2XMTA 1NRKA 4KR0B 4F25A 3GG0A 4I69A 5HP1B 4KHMA 1ZYQA 3HX9A 4I2PB 1CC8A 4K4ZA 1BGXT 2PGCA 4B9VA 2MQMA 1FJGF 3R1HA 2ADBA 4FPRA