3D2WA

Crystal structure of mouse tdp-43 rrm2 domain in complex with dna
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
72
structure length
72
Chain Sequence
GSKVFVGRCTEDMTAEELQQFFCQYGEVVDVFIPKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into TDP-43 in nucleic-acid binding and domain interactions
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna/rna binding protein
molecule keywords TAR DNA-binding protein 43
total genus 19
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d2wA00
5BJRA 1R8HA 4Y0FA 1WEYA 3N9UC 3HI9A 2MMYA 3TO8A 3V4MA 3CCVS 3TYTA 3G4SS 3G6ES 1YI2S 4QU6A 2XS7A 4LMZA 1Q7YT 4YUDA 1RKJA 3K0JA 1N54B 1X4FA 4FXVA 4Y00A 2RQCA 1RK8A 3J7ZT 1U1OA 2DGQA 2DGUA 2DH9A 2OTLS 5IFMA 2M88A 2AYBA 2CQBA 2VOPA 2YTCA 2FC9A 3CCSS 2NZ4A 2DO4A 3UCGA 3IRWP 2HYIB 1HA1A 2N82B 3PIOQ 2RU3A 4TLQA 2FPHX 3MURP 3EGNA 1X5TA 2LECA 3SMZA 2MQNA 3THTA 2DNZA 3G96A 2ADBA 2I2YA 1FHTA 2LEAA 3VAJA 2ZJRQ 5LXRA 1KOHA 2A3JA 2CQ1A 3S7RA 2MJNA 3G8TA 1N8RT 3UCUP 2LYVA 2CQPA 2PE8A 2PEHA 2DNRA 3P5TL 5JVHQ 2LXUA 1VC6A 1VQKS 2DGWA 2MGZA 1WG4A 1H2UX 2KN4A 2MKJA 4EGLA 2KG0A 1NO8A 3ZZZA 3BO4A 2U1AA 3DLLQ 2CPFA 2L41A 4PRFA 4J5OA 4IO9Q 2M8DB 1H6KX 1CVJA 1JJHA 1L3KA 2CQCA 2KFYA 2ZJQQ 3CMES 3NNHA 2MJUA 3CXCR 1U1NA 3B4DA 3CPWR 1UAWA 1VQMS 1YHQS 2YH1A 1HL6A 3NS5A 4BS2A 4C0OC 2DITA 1D9AA 2MSSA 2CQDA 2DHAA 2U2FA 2X1BA 4Z2XA 2MQQA 1ZZNA 2LA6A 2JX2A 2HVZA 2KYXA 2YWKA 1ZH5A 1YWXA 5GAEU 3UE2A 5H1SV 1BY9A 2AYEA 3P49B 2NLWA 3HHNB 2KRRA 3D2WA 2VOOA 1X5PA 1VC5A 1WI8A 2RVJA 3G8SA 2M52A 5IM0A 2D9OA 2ZJPQ 1N88A 1JJ4A 2DNGA 2E5GA 1KC8T 2X1AA 3UD4P 1U1KA 2EK6A 2N7CA 3BO2A 1HD0A 2MZTA 2M7SA 2LMIA 1KQSR 1O0PA 2YKAA 2I38A 2X1GA 2RS8A 1U2FA 5CYJA 2VODA 2LKZA 3VF0B 2FC8A 1WTBA 2MY7A 1SJ3P 1Q82T 3MI7X 1QM9A 5ITHA 2K3KA 2AYMA 1DZ5A 3TP2A 1VC0A 3H2UB 3SDEB 4WCEQ 2JVRA 4QPTA 3J7YU 3MUTP 2QA4S 3R27A 5LJ3Y 2M2BA 1JJ2R 1SJQA 3BS9A 4TU7A 2G4BA 2KXHA 1WHYA 4C4WA 1OIAA 4UQTA 1VQPS 1VBXA 1Q86T 1G2EA 1UP1A 1VQ5S 2XNRA 1U6FA 2MHNA 2QFJA 4ED5A 2EK1A 2OSQA 1NU4A 3R1LA 2M0GB 5LSOA 5MLCV 1FNXH 2E44A 1FXLA 3CC7S 1U1PA 4TU8A 1FJEB 2DIUA 1WHXA 5GAHU 2MKKA 3CCMS 2KVIA 2RS2A 1NJIT 3NNAA 3VAIA 3G9CA 1FJCA 5LJ5Y 1X5OA 2DNPA 2M4MA 3JB9k 2N3LA 1R8PA 2UP1A 1XN9A 3MUMP 1X0FA 2F9JA 1F9FA 4WKRA 2J76E 2MZ1A 2OIHA 2JWNA 2CQ2A 2MZRA 3DXBA 1KD1T 3VAHA 2MZJA 3CTRA 3R1HA 2CPDA 3ULHA 2GO9A 1VBZA 2CPEA 1U1RA 1M5OC 3NNCA 2DNHA 2MKHA 2K8GA 3VAKA 2ERRA 2XB2D 2KXFA 2DNKA 2CQ3A 3RW7A 2MZSA 1YJNS 1QVFR 2FY1A 3EX7B 2DGSA 2HGMA 1WWHA 2L08A 3NS6A 2RQ4A 4M5DB 1FO1A 3LQVA 1X4DA 1A9NB 2RNEA 2KG1A 1PGZA 1FJ7A 2MKIA 4YOEA 5DETA 1VQNS 2MPUA 2MY8A 1JMTA 2BZ2A 2M8HA 4RU2A 1WF0A 3MXHP 3MDFA 4WFNQ 2RT3A 5GMKa 2SXLA 2HGNA 1S72S 2WBRA 3MD3A 3MUVP 4WFAQ 3G71S 1WF2A 2DNQA 2KM8B 3L3CA 3PIPQ 1M90T 3NMRA 2CPXA 2M9KA 2J8AA 4OZ1A 1URNA 2MQMA 1P1TA 3CF5Q 4F26A 3UCZP 5CXTA 5EN1A 2HGLA 2KU7A 3Q2TC 1WEXA 2KRBA 2OJ3A 2QEXS 1YIJS 2D9PA 3CCUS 4CH1A 1M5PC 3FEYB 3VAGA 3S01A 3I55S 2RRAA 1U1MA 5GADU 2DGOA 3MD1A 1S79A 2O3DA 4WIIA 2MQOA 2J0QD 4P6QA 2CPHA 2DNMA 2FHOB 4A8XA 1OWXA 3CCES 1UFWA 1A7GE 4QU7A 2CQ4A 1X4EA 2MSTA 1PO6A 1P27B 1N52B 4TU9A 1SJ4P 2DK2A 2E5JA 4W90B 1X4AA 2MZQA 4QQBA 4IOAQ 2DO0A 1VQLS 4CH0S 1U1LA 3CULA 2DH7A 2DHXA 2DGXA 1X4CA 2KXNB 2MGZB 2MYFA 5CA5A 1WF1A 1WG1A 2EVZA 2CPIA 2F9DA 1DRZA 2E5HA 2LCWA 1HD1A 1H2TZ 1X4BA 2OTJS 2CPJA 5DDOC 1WG5A 5DDPC 4YB1P 1X5SA 2E5IA 2MB0B 1VQ4S 2D3OR 2VONA 2MXYA 5GAGU 1VQ7S 2DHGA 2DGVA 4PKDB 3CMAS 2DB1A 2XS5A 5D77A 5D78A 5HO4A 1K8AT 1UW4A 2GHPA 2XS2A 3S6EA 2MKCA 3SXLA 3CUNA 2MKSA 1DHMA 5GVQA 2KH9A 2CQIA 1K9MT 3P3DA 2KI2A 2XNQA 2DH8A 3FEXB 3P6YC 2F3JA 3MOJB 1SXLA 2OSRA 3S8SA 1X4GA 3LPYA 1WHVA 3VAMA 2G0CA 1YJWS 1WELA 3US5A 2DGTA 4ZKAA 3SDEA 4W92B 1VQ6S 5HL7Q 2LEBA 2YH0A 2BOPA 2JVOA 1IQTA 3Q2SC 3RW6A 5IM0B 2MQLA 1WI6A 1D8ZA 5DM7Q 2ADCA 2X1FA 3BO3A 2B0GA 3I56S 4PR6A 1YJ9S 4CIOA 3THPA 4V19X 5DM6Q 4F02A 3CCLS 3CC2S 2CPZA 1M5VC 2DNYA 1K73T 3U1MA 2DNOA 2DIVA 1DBDA 2LXIA 3CCQS 1VBYA 1VQ8S 5DDRC 2MQPA 1U1QA 4WF9Q 2CQ0A 2KT5A 1VQOS 1H2VZ 1AUDA 1KOOA 2L9WA 5LXYA 1FT8A 1B7FA 2RUGA 4F25A 1VQ9S 4WFBQ 2M70A 1ZZFA 1X4HA 2CPYA 5LSLA 1QVGR 4IUFA 3CD6S 3VALA 2DNNA 2AYGA 1Q81T 2V94A 4CQ1A 4ERDA 1SJFA 3IWNC 3CCRS 3OW2R 4C7QA 2JRSA 4U67Q 3B4MA 1SJRA 3CC4S 1M5KC 2KHCA 1WHWA 2LA4A 2LQ5A 3EGZA 2Q79A 5IQQA 2G1DA 2DHSA 4OZ0A 2AD9A 2CQHA 2CQGA 1OPIA 3BEGB 2DISA 1W2BR 1U6BA 3UWTA 2J0SD 3UD3P 2CJKA 3H2VE 5JVGQ 4IOCQ 2KM8C 2XSFA 5DDQC 1YTYA 4LJMA 4LIRA 1WEZA 3CCJS 5FJ4A 1YITS 2N3OA 3ZZYA 2DNLA 2HZCA 4FXWA 4UY8T 1OO0B 3VAFA 3U1LA 2RRBA 1M1KT
chains in the Genus database with same CATH superfamily
1Y5LB 1S9EA 3H42A 3TI0A 3MPWA 4NXMF 4DV5J 3QSIA 4Y0FA 1FCAA 2RIJA 3N9UC 1EIYB 3D0GE 4O3RA 1AB8A 3HI9A 1XC9A 4YP3A 3RGIA 3TYTA 1GQEA 1NM2A 1PKUA 5IV3A 3PJ9A 4BC7A 3G4SS 2R7OA 4CNZA 1SIZA 3T9ZA 1IKVA 2LLZA 4LMZA 4NZ6A 4YEAA 2AGPA 3GG0A 3MEGA 2GVZB 5IOLA 4C48A 2EFQA 3DRSB 5B0BA 1Y3KA 4WTYA 1X4FA 2GVDB 2A18A 3QPIA 5HBMA 4TY8A 4A8FA 1AYEA 5I3UB 4WIQA 5L46A 1UW9A 3O2IA 1IN0A 1TK8A 4DCJB 5K8NA 2HRUA 2PDAA 3BV8A 2NUHA 2EG2A 2OH2A 2GNKA 4OIXA 1S6PB 2DGUA 1EB0A 2VB6A 3MAHA 4DPWA 2M88A 4FKYA 2AYBA 2UUBF 2LFVA 2YTCA 1JLGB 1UA1A 1S9GA 3UCGA 4CLZA 3IRWP 1HNZJ 3ITHA 3CDEA 4EU0A 2GZOA 4BHQA 2HYIB 1HA1A 4G1QA 4NLPA 4NLDA 2GMLA 2Y0SD 4TLQA 1ZTWA 4GKKJ 1QUVA 3MURP 4PEOA 3EGNA 4RU9A 3PFOA 3TRGA 1J2VA 4I0WA 2GHVC 1MMNA 1EETA 4MT1A 3THTA 4J9VA 3KLFB 1FHTA 2ASYA 4OI0A 2ZBRA 1KOHA 3PXGa 8AT1B 2B4PA 3NEKA 3JSMB 2LU1A 4OQJA 1S0NA 3AODA 3JQKA 3NKYA 4OYOA 5IWAF 1RWOB 1BQXA 1RTDB 3ZXWA 4KIAA 4B9NA 2E1AA 3LW5C 3G6VA 2HURA 1LWFA 3JTPA 4C0HA 1KSPA 2R7RA 2QL5B 3L7PA 2HHVA 4JV5J 1UVIA 2DGWA 3HHLC 3V4IB 5FD1A 3VZIA 4X84A 4K4TA 4F8RA 3H20A 2A2CA 1EX8A 2ZH8A 3TEGA 1UJ6A 1SL2A 2K1RB 2WSEC 5KG6A 2MKJA 1LOUA 2B8PA 3NP5A 4OX6A 3W9IA 2KG0A 2I9SA 4RW8A 3KG1A 4GO5X 4B9VA 2ZEJA 3JS9A 4RBVA 5H9FK 5FLXY 2B9EA 2C2DA 1YITS 3H5YA 5CH7B 1YJ7A 2M8DB 4LBHA 2IRYA 1TKTA 3KNGA 2ZJQQ 4N5SA 2IC3B 3DCAA 2XTJP 2V8PA 3K2YA 3BDPA 2CJAA 4LFBJ 2W2MP 1U1NA 2RAQA 3FZBA 1VQMS 2YNHB 4WU3A 1M1HA 4QOTA 1M5SA 4KRWA 4WP9A 3AJDA 1ITPA 3A12A 3H5SA 1DTQB 2G2OA 1NK5A 2POKA 4C0OC 3FDSA 2CQDA 1F2HA 2Z2YB 2DHAA 4OHWA 1KVIA 1JNRB 1RT7A 4ELVA 5G4DA 1RCXB 2JX2A 5E3QA 3H40A 3U1LA 4RW7B 3RRKA 4DSIA 3R2CJ 5KFYA 2HSEB 2HVZA 3K5LA 3W3SA 1UA0A 1SV5A 2YWKA 1KVKA 3M2UB 3QJJA 1HQEB 3MM8A 1RHUB 2RE1A 5F3TA 5HJYA 2FTRA 2AYEA 1SKRA 3M2VA 2NLWA 1IJEB 2KJWA 2O1PA 3PCOB 2KRRA 3HLUA 3ICLA 3HHNB 3GZ7A 4CRJA 2FLPA 1X5PA 1WC6A 1WI8A 4UUXA 4WFZA 1WACA 1L3TA 5D6GA 4KGKA 1HNVB 3NWRA 1U26A 2EXUA 3RU0A 1N88A 1R8AA 3ZO7A 4EI2A 4YHHJ 4WYLA 2XMMA 5HLFA 3DYAA 3EXCX 3MAAA 1XMOF 2UUTA 4CO4A 3UD4P 1U4BA 3HVRA 4ED8A 3OHBA 4B9MA 1V5IB 3D4JA 4DL5A 3QO9A 5C7PA 1BHNA 4ZVEA 3M4XA 5B0EA 2GA7A 3QGHA 3ZNJ1 2JEIA 2DCUB 4FVCA 2LMIA 2Z2ZA 4M5KA 4DX5A 3SYZA 2HNYA 4U8VA 3MMCA 2DXEA 1ELOA 3FEZA 3CB4A 3HX9A 4NOHA 1NKCA 4UUWA 5IXUA 3D1OA 1TVRA 4H4KA 1D3WA 1U2FA 2P9GA 2ZWOA 3DFEA 4JI5F 4A4JA 3DOLA 1FE4A 1DTTA 2KFNA 3MEKA 1YRUA 1S1TB 3AXMA 2KL8A 1FD2A 1ROFA 3UO0A 1SJ3P 4J9SA 4DEZA 1T05A 3MI7X 1N34J 4QYZK 4WE1B 5ETNA 5BYQA 2L3MA 1W26A 3DU6A 4KO0A 1VHIA 2CIMA 2WVDA 3A4TA 2ZDOA 1VS3A 4OJ3A 2E1CA 1GXUA 3KXDA 4FF4A 5EWGA 1DLOB 1MROB 3B82A 2DEJA 2O01C 4GMKA 4AT1B 3LP2A 3N6MA 5AE1A 4DL4A 5AE2A 4QPTA 3EWGA 2ZUAA 3ENAA 1RT6A 3J7YU 4ZMMA 3KK2A 1KFDA 3QGGA 4NA3A 4LRDA 4QIGA 4ZVHA 5HMZA 5LJ3Y 4R5PA 2R2RA 1UJ5A 2HMIB 3C6UB 1VQPS 2C2RA 2H48B 1Q86T 2FJWA 4KC5A 2AKWB 1VQ5S 2QJ3A 2RD5C 4I6AA 3EDQB 2MHNA 2QFJA 1OSCA 2A6MA 1RAOA 1IM6A 1QJHA 1Z1ZA 1NU4A 4CLFA 2HHSA 3RUBL 4G1QB 3SFGA 1BQNA 3VCDA 5MLCV 2PD1A 3TAQA 2OPQA 3HO1A 3FMBA 4H4OB 2YKNA 3M8PA 4J9QA 2DIUA 3K5OA 1FJEB 1HLWA 1VDHA 4YFUA 4DPUA 2MKKA 3RBEA 3KWMA 4CLTA 1U8SA 5CZXA 3CCMS 5L9XA 1SQEA 1JLQB 2IRXA 4OI6A 3FVYA 3QGIA 4FYVB 2B43A 4DV3F 3VAIA 4O44B 1S0MA 1Q8IA 4B9LA 3AB4B 1RAHB 1O5JA 3CJKA 4DSEA 1MMDA 3T5JA 3N28A 3JB9k 5D0RA 3JSMA 2BKOA 1FDDA 1JX4A 3I9ZA 3HFKA 2UP1A 3TZWA 5HQ8A 3HHDA 1HMVA 2Y0BB 2ZUGA 4LSNB 3N4WA 1RHMB 1URRA 2P2CB 3TAMB 1X0FA 2E5LF 4JI3J 3FFIA 1HNIA 2AJ4A 5DGBA 3TR5A 2IMOA 5SUHA 1TV6A 3UPFA 5I3UA 2HVEA 3W2WB 3NXZA 3TA2A 1T02A 2RILA 2GO9A 2IYGA 2CPEA 2ALZA 3NNCA 2MKHA 2ERRA 2K8GA 2X3DA 3GTYX 3PRBA 4OYBA 3VAKA 3UVJB 4ZLPA 1RTZA 3U1NA 4RUHA 2KXFA 4DR6J 4LFCJ 3OL9A 4K4UA 3KK3B 2R42A 2VPZB 4FF2A 2MZSA 3VQSA 3EMTA 1CS4A 1KDNA 2C2MB 2YWEA 5B0DA 3OL6A 1GXTA 1WWHA 3AFGA 3LQVA 5L39A 3LP2B 5THWA 1S59A 2RNEA 4FYYB 1RAAB 1VR6A 4W4MA 2JEFA 4K50A 4LF2A 4TY8B 4RUCA 2CNKB 2M5YA 2FJAB 2FJDB 2H9ZA 4ZOSA 5JMNA 4QYRA 2MPUA 1U2CA 3BSCA 2OAUA 9RUBA 2MY8A 2W1BA 4HEA9 1WF0A 4NASA 2YKMB 1VBKA 4C2MA 4WFNQ 3R5CA 1PBUA 5M2PA 2RT3A 2IHR1 2SXLA 2PMZD 3E51A 1KLMA 1RWPB 3M8WA 4ZLNA 2WBRA 3MD3A 1SV5B 1ZPVA 3BR8A 4WFAQ 2HNYB 2RQKA 3IS9B 2FB0A 5KT6A 2KM8B 4EZ9A 2XYGB 5DZ7A 4JI1F 3PIPQ 3TA1A 4A8MP 4M8LA 2PT0A 1Q7LB 5FIIA 3IAM9 2M9KA 4K4WA 1N32J 3MM6A 4ANEA 2J8AA 4ECSA 4LF8F 3CD7A 4KY3A 1OPZA 1UVNA 1RHQB 1U25A 4FVMA 1V3ZA 1T3OA 1PAUB 1RABB 4KFBB 6FD1A 2DHHA 4PUOA 4L75A 2J6SA 4JI1J 1WC1A 2HHWA 2RUSA 4D3GA 2KRBA 2V8VA 3TANA 1HNXF 2UU9J 2D9PA 2QEXS 4MKBA 4JI6J 4IKAA 1I3OB 3SFUA 4ETXA 2VF3A 4DN9A 4O3PA 5A6WA 3NGDA 2RRAA 2J9CA 5F8IA 3GFYA 2C42A 2UXCJ 4XDDA 4ALZA 3MD1A 1S79A 4KAIA 2F65A 4DV7J 1IKXB 4WIIA 3HSGA 2D41A 2VZ9A 3DLJA 4J9PA 3BZQA 3KHLA 2DNMA 2FHOB 3DMJB 3QIDA 3R8YA 4A8XA 3TJAA 3MECB 3A3PB 4IG3B 4QIEA 1JXVA 4IDKB 1I1GA 4WXWA 3T5LA 1VCTA 2CQ4A 2HAIA 4HHHA 4QU7A 2VBWA 2K1RA 1SBRA 4URGA 4HL9A 5HI7A 5LL6d 4URSA 1UTAA 3M8QA 1P27B 3G6YA 5KG7A 1S77D 2FVQA 3A3OB 2AEMA 4X4VA 4Q8FA 2OPRB 2XHCA 3MFIA 2DKOB 1U48A 3Q0AA 4IOAQ 4RJVA 2QLBB 3PEHA 3QFHA 2DO0A 3HVTA 4PAAA 1X9WA 3ZTQA 3V6JA 1PYTA 2KT2A 1H38A 4PQAA 4CDIA 4RNFA 3FGVA 1SKWA 1VQLS 4B3MJ 1D8YA 2ZOGA 1EP4B 4FS2A 2HQDA 2DHXA 3HD1A 4ZPAA 2DGXA 3IG1A 2X3GA 2V34A 3AD7C 2KXNB 4Q2MA 3V4IA 2GAHC 5CA5A 2DPIA 3DOKB 3W63A 4MMOA 4ZVQB 5KFTA 5L38A 4LFBF 1FDAA 4KYZA 2HS3A 1ZM9A 2BJDA 3TZYA 3NLCA 1WORA 4AFFA 4ETZA 4CLWA 1CJUB 2VA2A 3R5JB 4TYBA 1VRUB 3GU0A 2Q43A 3EJMA 1WOSA 3OR2B 4M1KA 1HQUB 2JFDA 2LCWA 4OI4A 5D3GB 1HD1A 2V68A 5BYRA 1RWMB 1X4BA 2XSJA 3PX6A 2OTJS 3MHYA 4J9RA 4I2PA 1BQMA 2BA9A 3T1HJ 2ZBIA 5DZ6A 4GC7A 3TOQA 2G9OA 1Z2LA 1SL0A 1OY6A 5IC6B 2NPIA 5HQMA 1L3UA 5D15A 4KPCA 3CJQA 2MDAA 1RZMA 5EX0A 3C3LA 2E5IA 3PYDA 1CULB 1VQ4S 3H4BA 3MCOA 4RL1A 1N34F 2QL9B 3CC2S 2OEKA 2GQ2A 1F2GA 3R97A 5GAGU 1XTZA 3HSZA 4ZPCA 4NMXA 3HJVA 4USWA 2DB1A 4WFXA 3T9NA 4DR3J 5D77A 5D78A 4X64F 1TTHB 3MMAB 4DMZA 5HROA 4B9TA 2E7WA 2PC6A 2EBGA 3J81Y 1UZHA 3BDEA 4KGXB 2OP5A 4YB7A 1RE1B 1DTTB 1EARA 5GVQA 3U27A 1WTFA 4ZK7M 2XZWA 4WK3A 1K9MT 4ZCMA 5A8KA 2YKPA 5IT9Y 1TKZA 2YNGA 4Q45A 1IBLF 2H4YB 3I5CA 2Y3YA 3G6XA 1S97A 1FDNA 1SC1B 3QMQA 4P9SA 2E1RA 3SCKE 2ZH9A 4BDPA 4QIVA 2J7UA 1KTQA 5D0HA 4X4OA 4IG0A 2ZD1B 3C14B 3OTEA 3LAKA 5FDLB 2YQ0A 2GJ2A 2Z4PA 2H1YA 4YB5A 3CIZA 5GMDA 2FVSA 2B8QA 3O44A 4BC9A 3GSIA 1Q8LA 4QPXA 1B0PA 1M5HA 1Q78A 5IS2A 1G3OA 3OBIA 2EEYA 3ZTSA 1FRHA 2F4FA 1BXNA 3H59A 1N56A 4DX8H 4W92B 5M2RA 2YBVA 2LEBA 2B9XA 1TAQA 2YH0A 2GVZA 3DHWC 4BWJA 3Q2SC 2Q66A 1Y3JA 2B5JA 4KB7A 1RP5A 2ZHBA 3RW6A 2W9CB 4UT4A 2RHQB 2B3TB 2MQLA 4OYAA 3MTJA 1RWVB 2UU9F 2BANA 5DM7Q 1HYSB 2BXJA 4NWBA 1SKSA 2XI3A 3RBZA 3BO3A 1K47A 2Q3PA 3M2VB 1FTCA 4M94A 4X4UA 4YDXA 3IGNA 2AW0A 5CYMB 4FF3A 2DR7A 4KQZA 3I0SB 1X9MA 1LW0A 4NEYA 4R0EA 1W25A 3EZOA 1T7PA 2DNYA 2OMOA 2OMLA 2F8EX 3TUIC 2NYHA 2V69A 2CADA 2VD3A 1RSCA 3OXFA 3D66A 3UDEA 4ZDNA 3OUYB 3CCQS 4B3RJ 2ATCB 4B3MF 3HDSA 2QO3A 2AJ0A 1Q0NA 5E5NA 2XWYA 3JYTB 1NXIA 1B4SA 2ZFHA 4BCAA 4Z7CA 4PWWA 2V4RA 3TA0A 1H2VZ 1CJKA 4X66F 1AUDA 4ED1A 3M8YA 2QMUB 2QMWA 4WJBA 3TAPA 4KHPJ 3ENVA 2FJBB 3ET6A 1HQ2A 3MM5B 5LXYA 5D4OA 1UMJA 5ADZA 2RUGA 1OQ6A 1R89A 2XWXA 2CNOB 3PM9A 4LSZB 1VQ9S 2F1FA 3ZTPA 2VUGA 2CZVC 2LQ9A 4QIWD 1RT2A 4JI8J 1I5OB 1X4HA 1QVGR 3CD6S 1TL7B 2J0WA 2CWKA 1PJ7A 3TZXA 3MR3A 3HHEA 4IOBA 4ERDA 1FVSA 4TYAA 4OI2A 3EGVA 3WDOA 4DBQA 3IBFB 1SJ1A 3SSSA 5KFJA 1BE4A 3PRVA 4IFVA 3LGNA 3VVUA 4CO1A 4FP9A 1HWKA 4U67Q 5SZTA 4ECZA 1SJRA 3MPVA 4FPIA 2MQ8A 2HNDB 1FK9A 4DL2A 2WZ1A 2ZITA 1JIHA 1H7WA 4J91A 4CO3A 3K5NA 4F4XA 5E7OB 5IQQA 4OJ1A 2VIHA 1QE1B 4J7CA 2F63A 2YNHA 5KG5A 1MSWD 2CQGA 3SZ2A 1W2BR 2HHHF 1Y11A 2BVZA 1U6BA 4HLBA 3OFFA 3UD3P 3H2VE 5JVGQ 1TL5A 4GVBB 4ZVSB 4U7UD 1FJGF 3CCJS 4NLTA 1S1UA 2W4PA 3C8YA 3Q89A 4ZVRB 5KT4A 1MG7A 5J2QA 5DG8A 4LSNA 2IJNA 3EXYA 4IO1A 1I94J 1NHKL 1TKXB 2VBZA 1R3NA 5E0OA 4AE5A 5BJRA 3BGUA 5E3AA 1R8HA 2EFGA 4B3TJ 4I7FB 1G7CB 1WEYA 2GJFA 4EO6A 4K4YA 4ZJLA 3FCVA 4QR0A 3TO8A 4J37A 3V4MA 2QT7A 4C11B 1FNOA 5F8HA 4DV6J 1H73A 4KH1B 3CCVS 3IO1A 2YVSA 4RW6A 2E1PA 3W62A 5KFBA 1Q16B 3G6ES 4QU6A 2XS7A 4FKXA 4OV6A 1F3VA 4U8YA 5IC4B 4CTAB 4XPEA 3FSIA 3A8EA 3EZUA 3M1VB 4MK8A 4A8YA 3K58A 1N54B 3UQSA 3M9OB 3KOAA 3DRYA 1DLOA 1MROA 1XJWB 4OZNA 3HVTB 3W60A 2AGOA 4WU2A 2VG6A 3D0IE 2RQCA 3M32A 4USHA 1RK8A 1TQLA 3VGSA 2HNDA 4RW4B 3W8PA 3UDLA 3HXMA 1RHKB 2BOAA 2DH9A 3MF5A 3PO4A 5A8WA 2VJUA 3M05A 4DL0C 5I3PA 4N41A 5HP1B 2QA4G 2HHXA 3Q8QB 1KR4A 1C0TA 1MU2A 1YSJA 2DO4A 2FGOA 1NPKA 1TVRB 4OHYA 1S0OA 2AEJA 1S1XA 3A1YG 3KMQA 4P2XA 3DLGB 2APOA 4DPYA 2C3UA 2P5VA 3IM9A 1F3FA 3QNWB 1QSLA 3TNVA 3PIOQ 2UXBF 2F7VA 4C8YA 5KFHA 1UVLA 4ED4A 1RT5B 2V8DA 3MR7A 2ROEA 4OMFG 2XLJA 4FS1A 2BEFA 3BYRA 3QSYB 2ADBA 2MTLA 4K2JA 3KMSA 1P9YA 1S5ZA 3EDRB 1YJVA 4DR1F 5LXRA 1QDUB 1CJKB 3NGKA 4C9DA 2A3JA 4HYKA 1TU0B 1OYEA 3FKBA 2DR5A 2W2QP 3N79A 1U6ZA 2LDYA 4DZDA 2PSZA 4USUA 2JLFA 3CJRA 4DCOB 4ECQA 5J2QB 3UCUP 1RT2B 1XR6A 2LYVA 3GFXA 4DN0A 3MR5A 2CQPA 2PE8A 3KJVA 2V2QA 4YR2A 5KFOA 1SH3A 3FC9A 5KFGA 2HWTA 2R3VA 3SIPB 2BJ3A 3D0HE 3Q8VA 4Q7AA 3FJ2A 3LA0A 4N8NA 3W65A 3TZZA 3FBEA 4GKJJ 2IY5B 2EFPA 4RW7A 1NO8A 5K20B 5KFQA 4X4NA 1W7WA 3HHLA 2XMKA 4NL5A 1FI4A 1C4CA 1TK0A 3M2RA 3DLLQ 2CPFA 2L41A 2AP6A 3UN5A 4IO9Q 1H6KX 4K4XA 2ALYB 1JJHA 1L3KA 3ZTOA 2V63A 5C25A 3JQMA 3G82B 5GAHI 2KFYA 2G2YA 3OUYA 2FZKB 1RU2A 3MPYA 1ZYQA 4F2SA 2HW3A 2MJUA 1OS5A 2FLOA 4ED2A 1YBAA 3CXCR 1CVJA 2QN6B 1YHQS 4DF4A 3D6HB 4Y34A 2QIFA 1A6LA 2FZCB 2NXNA 4DI6A 4DU8A 2YH1A 1JXLA 3P49B 2BR0A 1HL6A 2HZAA 2Z0GA 1XWLA 2XMWA 3SBMA 1SKUB 4MYTA 4KV8A 2MSSA 3RRHA 1OQ3A 3MMAA 2U2FA 5H9EJ 3QO9B 5KFVA 1FNMA 3AT1B 3GWCA 1VIXA 1JLBB 2LA6A 5KFZA 3PO5A 1VRQC 4J90A 1YQHA 2J0XA 2VFSA 3GFHA 2V6AA 3AH6A 3QQCD 5ETQA 1ZH5A 4I6WA 2JLGA 2R7TA 2N4CA 1WUUA 3M8ZA 4G65A 2ZH3A 1NZ8A 3UN2A 2BJEA 2AT1B 2ZH4A 3UDCA 1VFJA 5K8OA 3FNNA 4ANCA 3R9LA 3GIIA 1IBKJ 4PPDA 3GPAA 3D2WA 2E7XA 2J7KA 4CO0A 1RLCL 4OZ5A 7FDRA 1VC5A 1N6QB 4NCAA 2BW7A 1DQAA 3BB5A 5DG9A 3G8SA 4NCGB 5IM0A 2ZJPQ 2DR9A 3GJTB 3GE9A 3H8YA 2V0NA 5BYSA 1LV5A 1JJ4A 1N33F 3GJQB 2NSBA 2E5GA 3RTVA 4DWIA 3V5RA 4J9KA 5E2QA 1KC8T 4N7TA 2Z58B 5M2UA 1SIWB 1JKHA 1YKWA 1WC4A 2F5GA 3CWJA 1TR0A 4O0NA 5HROB 2XMVA 3HT3A 5DGAA 1HD0A 2ACYA 4X66J 2MZTA 4J9MA 4DL6A 3J7Z5 1SC6A 3H5UA 1KQSR 2DRBA 1FWPA 1O0PA 1YRTA 2BMBA 2COLA 2YKAA 5A2QY 3J80U 1JLCB 1KQKA 5L1IA 1TKXA 4YB6A 2Y1RI 5CYJA 2VODA 2LKZA 2C3MA 3VF0B 2FC8A 1Z4UA 3ZC4A 3SI8A 1E6VA 1WTBA 4C97A 3L9ZA 4LF6J 4CWBA 3U7JA 1Q82T 3DDNA 4IG0B 2ZC4A 5F8GA 1BQMB 3O6QA 1QM9A 1FKOA 4HDHA 4QCLA 3AA8A 1ZAXA 2BQRA 3PDNA 4O4RA 4EBDA 1DZ5A 3RR8A 3D54A 4Y2MA 2QLFB 1FJGJ 5H9EK 5DQHA 2HBYB 4OYZA 4NLYA 3ENQA 3SDEB 5KFIA 1S48A 4C3MA 4ZHRA 5HBMB 4AL5A 3DRSA 4DR4J 4WCEQ 2VFRA 3VGTA 2AZ3A 4ICLA 3P5BP 5DJBA 3GV8B 2QA4S 3R27A 2G4BA 2M2BA 3E3XA 1SJQA 4F2RA 3B54A 1Y00A 2XGQA 3OSNA 4WKYA 5KG0A 2BM1A 3CD5A 1UP1A 1LWFB 3O1LA 4CYUA 2W8KA 3DRPB 4EYIB 1T9TA 2V8GA 3J80Y 4KBIA 4N77A 7AT1B 1IR0A 1K44A 2I1RA 1FA0A 1FRLA 4ELUA 4HKQA 4RBTA 5EGYA 3R1LA 3ENWA 4YY3F 5LSOA 4QBUA 5KFMA 3CC7S 3D68A 1HR0F 5C5JA 1EKRA 1N6QA 4MKYA 4DG1B 3GILA 4PUOB 3MM7A 3IWXA 2KVIA 4OFZA 4DUZJ 2HQFA 1R27B 1XMOJ 4MJKA 4LFAJ 3NNAA 4ANDA 3TX0A 5LJ5Y 1JQGA 1X5OA 3OTBA 2DNPA 2VFUA 2M4MA 2W4CA 2YNIA 1BMQB 2B51A 2EBEA 1RHJB 2N3LA 2AEFA 2VU5A 1UPMB 2YKQA 3JTOA 4OX9F 2R8KA 1R8PA 5CHCB 2R7VA 3I4PA 5DLGA 3T6BA 2QGFB 4C8ZA 2RDJA 1GEHA 1XN9A 1NK9A 1XNRJ 3MMJA 4NPOA 3AB2B 3GMGA 4OI1A 1ZPWX 4FNHA 4DV0F 2E7VA 3BM7A 2LQBA 2VFTA 3PJXA 4CO2A 1S6PA 1RYSA 2P9CA 3WHIA 3ZZ0A 2MZ1A 2OIHA 3BBFA 3DXBA 2NYIA 1KP6A 4Y2CA 4ED6A 1FF2A 2GX8A 3CTRA 3HVWA 2BJ8A 4MTPA 1SL1A 3MM9B 1KKHA 1L3VA 1M5OC 3J7AN 3HF5A 2C28A 1TUVA 3MR6A 2RDIA 1K0TA 1ZM3A 2DNKA 2CQ3A 2ZDPA 2BKPA 3CJ2A 2VG7A 2HBQB 4ZPWR 1PILA 2OD4A 4NZ7A 4DDFA 3EX7B 2FY1A 2HGMA 4IFYB 2L08A 3WIUA 5ETOA 3NS6A 4JI0F 2CNLB 4XO0A 2EW9A 2RQ4A 3K5PA 2I0XA 4M5DB 1IKWA 2AX1A 2QLXA 3TJ9A 3HM9A 3PKMA 1FJ7A 1T9YA 2DYAA 2GCFA 3JQJA 4I56A 4UQGA 2DXFA 1OSDA 2FDNA 3D1QA 5DETA 4DHVA 1NH7A 4EBEA 3WX8A 1JMTA 2DY1A 3KLEA 2BZ2A 2XZDB 5IT0A 5F8LA 5C2GA 3MXHP 1EQMA 1UFKA 1BD6A 2CDRB 2GIRA 1C0UA 1MNEA 3MEDB 3QIPA 1ZS6A 3R3TA 4GC6A 2R8GA 4F0HA 5EHHA 4DS5A 1VQSA 2D69A 3MEEA 4LBIA 1GK8A 5A8KB 1KEKA 4NLGA 1Q95G 3I32A 1RB0A 1DQ9A 1FFWB 1WF2A 1X31C 2AIRB 4L73A 5CYQA 4CI0B 3DGVA 3GJRB 2XGPA 5AXMA 1M90T 5A0YA 3V2UC 2W01A 1HNIB 4L76A 4DFJA 2OPPB 5EWFA 2KB2A 5J2PA 2RJZA 1WD6A 3J81U 2AU0A 1FERA 1RBAA 2W9BB 1TK5A 4DR4F 1LEOA 1RBLA 4PXEA 4NZ0A 3QT5A 1URNA 2MQMA 3CF5Q 4LF1A 4LRBA 3OL8A 2KU7A 3H7HB 4CT9A 1V3RA 3Q2TC 5T7LA 4ZPTR 3NMRA 3UVJA 2OJ3A 5IT4A 1OY9A 3BH7B 3ZZOA 3GIMA 2W7PA 3CJSA 1K1QA 3OJSA 1MU2B 5H9FJ 1NDKA 5HMWA 4K59A 1XR5A 4YQWA 1T9XA 4R25A 1CQNA 2ZNZA 3AHPA 3OV7A 3UNGC 1S1UB 3KJVB 2J6TA 4HVZA 4RPFA 2HHUA 3M6WA 4P7VA 3JSBA 2XO7A 2HMIA 3POTB 1JNZB 1OWXA 3CCES 4AQYF 4KPYA 1JLFA 2DXDA 1PJ5A 1RTHB 3BREA 3ISNC 2FJVA 1A7GE 1QLNA 2Q6BA 5F0WA 3ISZA 3PYGA 1RISA 2ZVSA 1NSAA 2O66A 5HAOA 1F9HA 4ZP7A 1SUQB 2GAGC 2PA3A 1EAYC 1PO6A 3D5MA 3GONA 4P75A 5KFFA 3CSKA 3QAEA 4HACA 2HLTA 1VHFA 2DK2A 2OGUA 5D0EA 1LK7A 4C6AA 3E01B 1RTJB 2LVWA 4F4AA 2F4VJ 1TUGB 1X4AA 4QZVB 3DLEB 3LGHA 1QSSA 4PYAA 3W7BA 2GV1A 1NK4A 1RA6A 1UFLA 1RHRB 4RKUC 1DY3A 2HS4A 3D6MB 5E3RA 4B17A 3IA0A 2G1HA 3NRBA 3LGMA 1LW2B 4CH0S 5B09A 2YQ1A 1U1LA 1RKIA 2DH7A 5JXSA 2UVWA 1APSA 3IWLA 1X4CA 3R7BB 3C6UA 4USTA 4N56A 2AV5A 4PQUB 4ITSA 4PPZA 4DPTA 4OJHA 2QX0A 4I2QA 3KUEA 4I64A 1WG1A 5KT2A 4M5MA 1HI1A 4UOCA 1MW7A 2CPIA 4DV0J 3FRYA 4XTTA 2UXCF 1DRZA 3IP0A 5D4PA 1RBOB 4ED3A 1UZDA 5EX3A 3POTA 2PGCA 5KG4A 4JI6F 1HNXJ 5T41A 5DDOC 4FDFA 3PX0A 2HFOA 3RB0A 2HEKA 2YX7A 9ATCB 3OSPA 3M6XA 4NLVA 1L3SA 4IFVB 3CIMA 5KG1A 2R9LA 3I5AA 1X5SA 5C24B 5K5MA 1H72C 2GIFA 1LWCA 4P2MA 2XYHB 1GMWD 1NH8A 3D3BJ 5HATA 4DV2J 4KR0B 1N33J 4NCGA 5KFPA 2I6WA 5J2NA 1VQ7S 4KT0C 1ZETA 2B4UA 3LP0B 1H74A 3CDBA 3OR1B 3BSOA 4AXIA 2JHEA 2OI2A 1ZA1B 2GS8A 2XS2A 2MKCA 3ET6B 4MKAA 5EWEA 2V8HA 3EUNA 2ZH5A 4DS4A 2CQIA 2VG5A 2G0IA 4DUZF 4ZPDA 1HW8A 2MKYA 2IM2A 2KI2A 1RT7B 2LEPA 2M3DA 3DRRB 5J1EB 3HZGA 1FRXA 3I5BA 4PABA 4WK1A 8ATCB 2W9BA 1SQFA 1G1XA 2ZBPA 3GJSB 5KOWA 2H5EA 2OPPA 3MM7B 5J2PB 5KFNA 3OTOJ 4PXCA 2HVIA 2NXJA 3IBWA 2HQCA 2J9EA 1N5SA 4LFAF 2Z8QA 4EK2A 3P8BB 1RGVA 2NR0A 2PN6A 1WC3A 2DGTA 4A8OA 4ZKAA 2BJ7A 2F40A 3HSDA 3DLHA 2BOPA 4DR6F 2JVOA 1KNZA 3UD5A 1LWEA 4DPOA 1C1CA 3OHAA 2I5JA 4PRFA 2ADCA 3MM5A 2X1FA 4KGMA 2WCXA 2HHTA 4JOUA 1O51A 3AOAA 1SH0A 2B0GA 3CMQA 3BKTA 5EN1A 3BSNA 1FESA 2F4VF 2R7UA 1VLYA 2HRYA 2RH3A 4FZVA 5AJ3F 4F02A 4R8UA 3DDIA 3CCLS 2PI4A 5I4MA 2JC1A 3TEHB 4LF8J 5ETTA 3NG8A 4MIWA 1WC0A 4DZ6A 2FQQB 4U6PA 1D9FA 1K73T 3U1MA 2BDPA 5GADI 5CZVA 4HTIA 2UVUA 1AFIA 2HRTA 1DBDA 3KLGA 2IC3A 3KG4A 3UFCX 1EETB 1F0XA 1FKOB 2VDIA 1TKTB 3GR0A 4B08A 1VQ8S 2RMLA 3I0RB 3N0VA 4KHMA 1S1WB 1NKEA 5HANA 2VC1A 2R7WA 4YN3B 2CZ4A 3HSJA 2R8IA 1U1QA 1TKZB 2KT5A 2YNGB 2R7SA 4F3OA 2BJ1A 4NLQA 3CJ3A 4NYOA 4JV2A 1U24A 3UDVA 5HMXA 1CC7A 1OYDA 4JV5F 3VGVA 3SV3A 1H7XA 5HN0A 1R6YA 2BE2A 4O44A 3ILIA 1FRKA 1NEEA 2EI5A 4Z7YA 1FKAF 2N4DA 4MKVA 1B7FA 3H2LA 1RT4B 1YX2A 4NXMJ 2QL7B 3VWSA 1TMJA 3BR9A 3IGVA 4XAKA 3OVAA 1TKDA 4G3IA 2HPUA 1Q53A 2CPYA 4H4OA 2XY7A 4IUFA 1S7IA 1T9WA 2GC8A 3NAIA 5CCLA 3T3FA 4CLKA 1N5TA 4CQ1A 1SJFA 4ZVOB 2GVDA 3IWNC 2W7OA 3OW2R 1BWVA 2F8HA 3ILOA 4DV7F 4C7QA 5LMUF 2JRSA 2HWHA 1NBEB 4H4MB 4I2PB 1PSDA 1RWXB 1YK9A 2JC0A 4U7CA 1FEEA 4WZMA 1SCJB 1C4AA 1IM4A 4NLWA 4R5PB 2EKNA 2GIQA 3IXQA 5B0CA 2LA4A 3MCSA 1UKUA 3EGZA 1QAJA 5F8JA 1SVDA 4PWDA 1RADB 1AW0A 1HHSA 3ETMA 4OHZA 4IQMA 2EC2A 2CRLA 3KDOA 2AD9A 2P6SA 4DSJA 3ITHB 1OPIA 3BEGB 2HS0A 4HHJA 4B3RF 4AYBD 3HULA 2G0JA 3CCTA 3ZNUA 2XSFA 3DI6A 3GP9A 1B0TA 2IVMA 1TP7A 5U47A 1R8BA 1WEZA 1JJCB 5DQGA 2I5JB 2CJYB 1VK3A 5IQ6A 2HZCA 4P2FA 2AF6A 2GHWA 2HNZA 3M30B 4RLEA 4UOHA 2ABYA 3SQGB 5T14A 3OVBA 2IYIA 3ADAC 3SCLE 2ZH6A 2WW8A 4I6YA 5KFRA 1NPRA 1TMMA 4PXDA 5KFEA 3NCRA 1UEKA 1UWBA 5L1LA 1RWKB 1WKLA 4ECXA 4C8LA 1R43A 2YPYA 4LQ9A 2ASDA 3IR5B 4DV6F 3OPKA 2JEGA 1FX4A 1KWMA 3G82A 2JLEA 3N5FA 3KLGB 3Q22A 3PW5A 3I9V9 2JL9A 2FJXA 5KG2A 4F4ZA 3WZ0A 1MWYA 2XYPB 4HHUA 4NYPA 5F9LA 5MAOA 3UR3C 2OFHX 1WOOA 5A8RA 4M95A 2L48A 1RA7A 2OLWA 4JP8A 4FXVA 1NJXA 3B6BA 3IR7B 2JDJA 4GO7X 4F04B 4JI2J 1S7HA 4Y00A 3OTOF 2WVEA 3PTWA 2X7IA 4E8UA 3J7ZT 2DPJA 1Q8BA 1U1OA 1N5QA 1S99A 3UI3A 1QTMA 4DQSA 3A8JA 2ZE2A 3I4HX 4F67A 7FD1A 4DR2J 1IKXA 1X60A 2EFOA 1C1CB 2WONB 4MIAA 5IFMA 3HPOA 2R2SA 4ECVA 2CQBA 2VOPA 3WQPA 2FC9A 1JLAB 4RUAA 3CCSS 5A0YB 4IRKA 2UUCJ 1N0UA 2VH7A 3QYYA 1RT3B 1GMUA 1HQEA 4ID5A 1D09B 4GRSA 2YNFA 2CVIA 4K4SA 2CZ9A 2N82B 2BX6A 4R8UB 3UN3A 2DRAA 3CW2C 1G6BA 4Q43A 4ES2A 1EHWA 2W2NP 1U8WA 2XI2A 1R0CB 5GMEA 1GTHA 2IA0A 2MQNA 3M8QB 3G96A 3R5AA 1K1SA 1XMBA 4DR1J 1IBMF 3KUHA 5IV4A 2RF2B 1CG2A 4M5GA 2CQ1A 1NK8A 4UOGA 1HWUA 3S7RA 2BV3A 2LQJA 2MJNA 3CJ8A 3N6LA 5J1PA 1GTEA 4ZCIA 3MAQA 2W24A 3G8TA 4DL7A 3DMJA 2QLJB 4NA2A 4B02A 3CDWA 2HHHJ 4RBUA 2AJFE 4WTOB 1F6TA 1KTVA 2DNRA 2IPOB 2PEHA 1QD1A 1S57A 2VDHA 3JXOA 2AHOB 3L7UA 3LP0A 5J1NA 1VC6A 1D0EA 5D4NA 1H3DA 1WG4A 5C2CA 2MGZA 3PACA 3W61A 1JWWA 1M1GA 4PG8A 2NREA 3IN5A 4KKOB 1H2UX 1RAIB 2OEJA 2ZNYA 2VG6B 4QW8A 1RYRA 4AQYJ 3KNAA 3PRDA 3R5DA 2XCAA 2LU2A 1KRPA 2CG4A 4EGLA 5LOQA 1NKBA 2XM3A 4NLSA 2I8EA 1RWWB 2JSXA 3BO4A 4DR5F 2BQ3A 2BKNA 3M1VA 2U1AA 2HQ3A 2HK2A 3AY0A 4K7QA 3ZZUA 4FYDA 4F3MA 4JBCA 1NSQA 5B7WA 3CJ5A 1FRJA 2FD2A 4J5OA 2JH3A 2KT3A 2V2VA 1P9QC 4C8NA 4YMEA 4DLEA 2D7SA 2XY5A 2ZOMA 1ZM2A 2GGPA 5J2NB 3FBFA 3B4DA 2QRRA 5C42B 1I51B 5CABA 3HHLD 3PZPA 1LWCB 1CJVB 1NZAA 2W9AA 1RTHA 4U7UK 1C0TB 2ZHOA 2IBOA 4CO5A 4I4BA 3I96A 1QSYA 2QSFA 4AUKA 4U95A 4BLGA 4YR0A 3CJ4A 5K14B 1YBTA 4F4KA 4P52A 3AOBA 4CP5A 1HMVB 2MQQA 4NXNJ 1RI7A 5AE3A 5IT9U 2Z2MA 5HSPA 4YR3A 1CLFA 1S6UA 2FZGB 5ETKA 3QJLA 4QYZJ 1YWXA 1XR7A 1IQZA 4P72A 4DOZA 5FLXU 1NK6A 3WIVA 1KVJA 4LREA 1GNKA 3CJ0A 5H1SV 1BY9A 3G86A 3SSQA 1PIEA 4Z37A 4DV5F 4O4GA 1RTJA 1U47A 3FCWA 3Q8RB 3GLJA 4HI2A 2VOOA 3HK2A 1DURA 1PAEX 2RVJA 2HFSA 3EE3A 3AA9A 1HWJA 1T05B 2R7XA 3M8PB 2M52A 4LR8A 1UEUA 4DJBA 3IBCB 2XG8A 1LFWA 2KDOA 4RW4A 1R0AA 1WDDA 3D7SB 3R7NB 2ZZNA 1J5EF 4MFBB 2HKEA 3TX8A 2DEIA 1LXJA 3MMBB 3NCQA 3TQ1A 5HP1A 1NSPA 1IWAA 1U1KA 3FFIB 1C0UB 2EK6A 3MEDA 2FHJA 1LWXA 3BQ0A 4K4VA 1TZ0A 1WSVA 2HFNA 2DR8A 1B70B 4HT5A 3VHQA 4IRCA 2UXDJ 2HQIA 2MLZA 2VBXA 5KT7A 2HFUA 2GW8A 3C15B 5KFXA 3CJTA 2E66A 1C1BA 5F0UA 4OI3A 1SUQA 3PNIA 4NI2A 1CJUA 4DR2F 1S9EB 1KN6A 2IJRA 3AAWB 3BGRB 3M7VA 2B4OA 3NS7B 1VIOA 3MCMA 4WP8A 2CJBA 2MY7A 4NX9A 4TXSA 3BBBA 2VICA 2MLYA 4DFKA 2VG7B 2K3KA 1SB6A 1S1TA 1CEZA 4QWDA 2BE2B 3HKZD 2DRDA 2AYMA 1QY7A 1RWUA 2AZ1A 2L9NA 3MPUB 4OX7A 3AD8C 3TP2A 3ZZTA 1VC0A 3H2UB 3A3NB 1F60B 4Q8EA 1ZTTA 2ACMA 3BPSP 4CH7A 1FVQA 5C42A 4JUZA 4C8OA 1VRTB 2BUNA 2G13A 4DX6A 3MUTP 1KFSA 2AJQA 2XMTA 3BS9A 1FX2A 4RO0A 4TU7A 2KXHA 2PMWA 4GVBA 1U7LA 4USJC 4DFPA 1HYSA 2OEMA 1OIAA 1JLEA 4UQTA 4DR5J 1G2EA 1YLXA 2O67A 1HBMA 2V67A 1U6FA 3CDUA 4O3NA 1AZSB 2E9ZA 3H0PA 3MAAB 1SI9A 3Q86A 2EK1A 2OSQA 4HR2A 2ZBQA 5DO2A 3VVTA 2HIQA 4ZPVR 2PI5A 3D3CJ 1XEZA 4CZCA 4LF4J 2E44A 2EKYA 1FXLA 3CGIA 2E29A 3EM1A 2CYYA 3GIRA 4ID5B 1HNVA 4RWWA 4TU8A 3JYTA 1TL7A 4AXJA 4ECYA 1U1PA 1WHXA 1GH8A 5GAHU 1VJQA 2K7KA 1DFDA 3W9JA 2MLXA 4LIWA 3RB3A 4EZ6A 2ZD1A 5FDLA 1HBUB 2IIHA 1TELA 3OTCA 5HVFA 1NJIT 2KZZA 3B78A 1N4LA 1OMSA 2C2NA 3C16B 4N76A 1FJCA 1RT1B 3GYNA 2XQCA 1WDTA 2B6AB 2H3EB 4X4SA 4LR7A 4TNOA 3DLKA 2H51B 1XK8A 2YXLA 3CT9A 5CYMA 3ISND 3NBPB 2ILYA 2XULA 1N5VA 1ZM4A 2J5AA 3K7RA 3SCIE 2VKRA 3QWPA 3MUMP 4DU7A 5DLFA 3DLBA 2IVFB 1XMQJ 2F9JA 2LDIA 2JEJA 2DT9A 2XEXA 1HNWF 1Y0HA 2J76E 4ZIVA 1DTQA 2A10A 2JWNA 2H5JB 4AD6A 3DHXA 4A48A 3BGRA 2R8JA 2KYZA 3LALA 3VAHA 1NK7A 2CPDA 4LF6F 3D1HA 1MMLA 2JZ5A 1VBZA 3KLHA 2E9RX 2YNFB 2RKIB 2HFZA 1C1BB 2K7JA 4PG6A 1VISA 4PCQA 1PBAA 1YJRA 3K8VA 1HWLA 2HBZB 1ZBTA 2D3ZA 5DQIA 1C2PA 2WB4A 4HH1A 3VV2B 1YJNS 4NCBA 1QVFR 1U02A 4ENOA 1DJ0A 5CAAA 2XLKA 2CWXA 4RNMA 1ZA2B 3IRXB 3SSRA 4DSLA 2BE7D 3RAXA 3MMBA 1FO1A 2CFXA 2OPSB 1A9NB 1VGYA 3EPGA 1REVB 2KG1A 3UNYA 2ASLA 2MKIA 4X64J 2IRUA 2VQFF 1KONA 3HD2A 3HT0A 2BRLA 5KFAA 4B9SA 1N32F 4A47A 3DGPA 1O8BA 2QG9B 4OLPA 1HR0J 5CQGA 1WNEA 4DR7J 3GIJA 3C15A 1CPZA 1JB0C 4LF7F 4C3LA 2PFFB 1RTIA 3H5XA 2J9DA 1V9OA 4E0DA 3BKFA 3MDFA 4L3NA 1WOPA 4CT8A 1FXDA 3TVYA 5GMKa 2HGNA 1RACB 1O6XA 2IAJA 3HZEA 4WFYA 1S72S 4FNIA 1RTDA 4FBTA 4I2QB 2KFZA 4QWBA 1FTRA 1FFSB 3ZFVA 1F5AA 3QAUA 2DVIA 3KLFA 3DN9A 3C14A 4H4MA 1IKVB 3RB4A 2XSJB 2R7QA 1IJFB 2PMHA 4OZ1A 4DLGA 3X1LB 4F26A 1HQUA 2HGLA 4I1TA 5KAKA 4CLLA 3CD0A 1WEXA 2QSWA 4CM2A 1PC4A 3QT7A 5EUHA 5A6PA 5K8PA 1YIJS 3PHEA 3OXLA 1M5PC 4XIUA 4ZHRB 1P6TA 3HFVA 3I55S 2DBBA 2EPIA 3FBBA 5GADU 1U1MA 3NGSA 1MWQA 2GMJA 3VQTA 3IRXA 4M5NA 4RW9B 2O3DA 1JKHB 2W7AA 3JSYA 5BR8J 2HBRB 4KV8B 2XY6A 4CNYA 2J0QD 3A8KA 4F0MA 1U49A 2UUAF 4K0KJ 1N5YA 2JNJA 1HPZA 3UW1A 3F56A 3T1AA 2QFIA 2W2OP 2VPXB 4Y65A 1IBMJ 3GV7B 4YDDB 3H25A 4NXNF 2UUCF 3JAMY 3OTDA 1AT1B 4OYXA 5I3QA 1S10A 2YWWA 2FGCA 3QLHA 1EQ0A 1YZ6A 3IM8A 1Y7PA 5A2QU 1EJ7L 3N6NA 1L5UA 4KFBA 1T8EA 4O3SA 4HDGA 4QWCA 4DX7A 1TL1A 4UZCA 3OFEA 4W98A 3MTKA 4UTGA 2VKZG 3T19A 1Q5YA 4OYPA 3LTOA 2GFFA 4ILMA 4ZN3A 1DQ8A 4DR3F 3C46A 3KJNB 1REVA 2CJXB 1S9GB 1YBUA 3IMQJ 4WPAA 2ZOFA 3LPEA 3CULA 2QV6A 4KKOA 2OHDA 4J9UE 4NLOA 5L9NA 1NJWA 3M6UA 4Q5VA 2HWIA 1NDCA 1T0TV 1Y5IB 3QZ7A 3MR2A 2MGZB 3PW7A 2ZKTA 2VPYB 4B3SF 4LF5J 4C8MA 4IH6A 4NYZA 5G0RA 2HVHA 2LQ8A 4A8KA 3FK4A 4ZP9A 4EFAC 2E5LJ 1XERA 1UETA 2EVZA 3PEJA 3KLHB 3VTIA 4HTJA 2QLWA 2F9DA 1D9DA 4WBFA 3LWLA 3LWMA 1XIQA 3SCJE 5AT1B 4LVOP 4RUBA 3DM2A 1YGYA 2XC9A 4FXDA 1CS4B 2CPJA 1WG5A 2FLLA 5DDPC 4ZVGA 5HVGA 3BH6B 2KTQA 3OLBA 1F5CA 4URQU 1EZZB 3K89A 2DJWA 1IKWB 1FEHA 4O23A 3DU5A 2QC3A 1Z2ZA 1H98A 2ZBCA 1F1BB 5LMNF 2D3OR 2UZAA 2VONA 4JI4F 4JB8B 1RJJA 2CXEA 2DGVA 4PKDB 5B0FA 1YRXA 1JLAA 1YVFA 2W2PP 3R6LB 4ECTA 1K8AT 2XS5A 2V2ZA 1UW4A 1F5BA 3K59A 1HARA 3CVKA 3DNCA 3LO3A 4HT7A 4WYWA 3QLHB 2BRKA 3OLAA 1P1LA 3WX4A 3CO0P 3ETOA 1DHMA 3PR4A 2V5HG 4ZJQA 3DRRA 3TARA 3HFZB 3NGUA 4MAKA 5F41A 3M2UA 1GAOA 5A76A 3G71S 2YWHA 3P3DA 5KFDA 2XNQA 3D9BA 3OT9A 3B8HA 5KTQA 2VQEF 1ZAWA 5KT3A 3FEXB 1HBMB 1HBOB 3IFEA 3L95X 1U0HB 2F3JA 3MOJB 2OSRA 5KFUA 3S8SA 4Q0BA 4RNNA 2Y9HA 2QYGA 1WHVA 2AGQA 3VAMA 2UV8G 2HHQA 2G0CA 4ATNA 1YJWS 1WELA 1VRTA 3CNQP 2C3PA 2UUAJ 4K0KF 1GMVA 1V3SA 2Q1LA 2Z2LA 1P8GA 3Q8YA 4MFBA 4LRAA 3GB0A 4TKTA 5HL7Q 2ZZTA 2DCLA 1V5VA 3FCHA 4KSEB 1RWNB 1AXQA 2FHJD 2XMUA 1FD8A 4KHRA 5ETRA 3MFHA 4Y3CA 2R2UA 3KTQA 1QUPA 2ZZMA 1D8ZA 4RX6A 4P10A 5IWAJ 2WAQD 2HNZB 2ZH7A 1RAEB 4A8QA 2HIYA 3L09A 3PJWA 4OZ3A 4FPRA 4JV1A 4DFMA 4USIA 4H54A 3I56S 2UXDF 2QZ8A 2WSCC 3IAS9 4CIOA 4RW8B 3NMAA 5DM6Q 2L9DA 5K9FA 3P45B 1R31A 3W64A 2CPZA 2IAJB 2OFGX 2YPZA 4L72B 3GSDA 3EVMA 3M30A 4MYUA 4WXOA 3RR7A 4PWDB 3JAMU 1DAXA 2CJQA 4ZIWA 1QAYA 2IM1A 2VC0A 4C98A 1TV6B 3FQKA 4RZRA 2VQFJ 5L1JA 4K5RA 4BBYA 1VBYA 3W8GA 4B9UA 4DQIA 1GFWB 1S49A 5DDRC 1FE0A 4DV1F 3Q8SB 4JI7J 1AA1B 4IR9A 3LAMA 4C11A 3KKFA 2YKNB 2MQPA 2BYCA 2YX1A 5AXLA 2B9WA 5HVHA 1LW2A 1NCLA 2CQ0A 3PHTA 4D3HA 5CD4H 1NRKA 1SC3B 2V4QA 3V6DB 1VQOS 1IWGA 2C1EB 2FVPA 4DUYF 2E1MC 2KJVA 2L9WA 4H4KC 4DV2F 4LRCA 4QIFA 5ETLA 3K57A 1IVZA 1HBNA 3J7YI 1PG5B 1FWKA 1PC5A 4PYDA 4QW9A 2IA6A 1FT8A 3TAMA 4F25A 4GKJF 3CE8A 4X4RA 4NLUA 1X8DA 3SEOA 2YX4A 5L1KA 3PW4A 1ZZFA 3BKUA 2HVDA 5LSLA 4F7VA 3PV8A 4KGZB 3DGPB 2DNNA 1NHUA 3VALA 3KDNA 2MHEA 4LF7J 1RAFB 3RAQA 2B56A 2QE5A 5ETSA 3IC1A 5D4LA 3TJ8A 2Y8WA 3E2EA 5F3ZA 1VYAA 2DD8S 1FK9B 2OPSA 3PFEA 3X3UA 4DV4F 3B4MA 3CC4S 3EGWB 4G6VB 1T03B 4UW2A 1M5KC 3QRRA 2OPQB 1I94F 1WHWA 3NBPA 4NEZA 2HLUA 1HI8A 4MK9A 3R5BA 4ZVUB 2E9TA 4A46A 2G1DA 2DHSA 4OZ0A 8RUCA 3EVWA 3GV5B 2CQHA 2CG8A 2Y1LB 3FMWA 3ONQA 2JOQA 3FSYA 2NPFA 5GAEI 5RUBA 1FXRA 3NWGA 4JI5J 3GFZA 3I0RA 2J0SD 4ILLA 3U02A 4UZBA 2KM8C 4LF9F 1E6YA 2P9EA 2IM0A 1OY8A 2VQEJ 1TL3A 3BN4A 4LJMA 5L8RC 5DG7A 1YTYA 4RR5A 2N3OA 1CC8A 4QR2A 1UWAA 2DNLA 4FXWA 3ZZYA 4OHVA 4TY9A 4UY8T 2RRBA 4J9OA 3W66A 4CCHA 2WSFC 3ELHA 1GMWA 1PYOB 2Z56B 4OYIA 1M0SA 1U2RA 2KHDA 2QTWA 2CVEA 3CO9A 2NXUA 1LNQA 1JLBA 2MMYA 2B6AA 4IFYA 2R2TA 4ZS6A 4EWTA 4WE1A 3PY8A 3JTNA 2ROPA 1YI2S 1HBUA 2IBKA 3BPDA 1Q7YT 4YUDA 4DQRA 3F41A 2EWHA 3V6KA 1RKJA 3K0JA 4ZJOA 1FDBA 4LUBA 4C8KA 1HW9A 1BLUA 1FFGB 2J7WA 1S4EA 4TVAB 3NGTA 3NOCA 3ZZPA 4B3SJ 4LF5F 1DARA 5A8RB 2VFVA 4M5DA 1SC4B 3LANA 4CLPA 1QTNB 1TL1B 2DGQA 2OUGA 4Y2KA 4F50A 2NXEA 2BANB 2CA9A 3CCWA 1J27A 4FN5A 3WC0A 2OTLS 5HK4A 1JLEB 3RG6A 3KYLA 4TLRA 2W9CA 2FVRA 2EC0A 2IM3A 3OR1A 1B0VA 1X0PA 1LK5A 2NZ4A 3HJFA 1IKYA 1S6QA 3KLIB 2VHGA 4F4WA 4M5JA 1I6JA 4E2FB 1CQMA 2BABA 4NI2B 2J8SA 1NMEB 2WK4A 5E3CA 4XPCA 1U45A 2RU3A 4B3OA 5I42A 5J2MB 2FPHX 4GKKF 3ZTRA 4ZITA 4PQUA 5BR8F 4PG5A 1N36J 4B3TF 1NJZA 4HH0A 4DG1A 1T03A 2W25A 1J5OA 1X5TA 2LECA 3SMZA 3C19A 2A2DA 2XMJA 3L7OA 4OZLA 5CCMA 2DNZA 2I2YA 1JXEA 2LEAA 3PW0A 3VAJA 4NLXA 1VRUA 2ZJRQ 5C24A 4ICLB 3TW0A 2FUG9 4ZCKA 3VGUA 2XCPA 3I82A 3V6DA 3QRPA 2K3IA 2UUWA 4EMDA 4DV1J 3CCZA 3K8WA 4IRDA 1NAQA 2NXCA 2Z30B 3T6JA 5KFCA 1N8RT 1UCNA 3MPDA 1G4CA 3P96A 4MK7A 3P5TL 5JVHQ 2LXUA 3D6TB 2Y1JA 3IG1B 2FLNA 1VQKS 2AJ1A 1IXKA 3WC2A 3GR1A 4OYMA 2C3YA 4CM0A 2KN4A 4JI3F 2ROGA 1NK0A 2H4WB 5EDWA 1IBKF 4V19J 3AD9C 4DSKA 1T95A 3LOUA 1R0AB 3ZZZA 2OPRA 3F44A 4NRUA 4X4PA 1T3NA 1S9FA 3DLEA 2IDEA 2CQCA 4O3QA 3RJMB 3CMES 2ASJA 3NNHA 3M9NB 2XZTB 4O4GB 3M32B 3OFGA 3M8RA 1CJVA 2AX0A 3OFHA 4HACB 1R6VA 3C66A 4DPXA 3CPWR 1UAWA 2OKQA 2R8HA 4R0JA 2ILZA 4OLOA 4V1Ak 2P8IA 2BW2A 3CEDA 4P7TA 2KKHA 2XMAA 4TQRA 4LFCF 1AFJA 2RHSB 4MIBA 1NDLA 1JLGA 2DTJA 5B0AA 4JI2F 2A1BA 3OXGA 4UF4A 3NS5A 4BS2A 2DITA 3GYGA 1D9AA 4X4QA 1Y4ZB 2BM0A 3ILLA 4Z2XA 2X1BA 3RYLA 4DSFA 1YG0A 3R5GA 2C3OA 1ZZNA 5DRKA 2OD6A 4B3OB 1KLNA 1YZ7A 3MZIA 5LM7E 3UR0A 1PYSB 2KYXA 3DXSX 2YWFA 4LRFA 6FDRA 2V9KA 5DS7A 3EYZA 4UY85 3PX4A 2GJIA 3MEGB 4X62J 4X65F 5GAEU 3UE2A 3LUYA 2LXFA 4DUYJ 2IMWP 3FZ2A 1IQTA 2UV8A 3Q24A 1BWEA 4WP3A 2B9YA 3BGLA 5JUMA 5B08A 4NRTA 1T9VA 2D9OA 2BJ9A 1WKKA 2IFXA 2CNNB 3QJPA 3QBCA 2HK3A 4QJVA 2FIUA 2N7YA 1BGXT 2DNGA 3AOCA 3ILJA 3MOZA 4DV3J 2X1AA 5LMUJ 3C6TB 1RLDA 4LVNP 1YJUA 1TFYA 4WWSA 1QAXA 4E98A 2N7CA 3BO2A 3NL0A 3QIPB 3A8IA 3GCXP 4LSLB 2M7SA 5HJXA 3W5ZA 4X4TA 1LXNA 3PKYA 4KTQA 2WHOA 3T5KA 2AWZA 3O3LA 5J1EA 5CYQB 3KLEB 5F8NA 3GIKA 2BBEA 2I38A 2X1GA 3QGPA 2RS8A 3MWBA 3MMCB 2B7CB 4OJGA 1FRMA 3M8SA 3LP1B 2GGPB 1IBCB 5CD4A 5C25B 2NQPA 1GX5A 2H54B 1R7IA 3FUYA 4Q0BB 3M2RB 5ITHA 3KK3A 3FBCA 2QA1A 2HHPA 4CLYA 5KT5A 1LWEB 2WRMA 2X51A 1GT8A 3AJ2A 3DYAB 3FQLA 4EO8A 3PVXA 1XNRF 2RRNA 2BE9B 3H98A 4USVA 4DV4J 4NLRA 2JVRA 4K5SA 5D0GA 3W2WA 1KQGB 2K2PA 2NCKL 3BSAA 2Y1IA 4FYWB 1M1KT 2RDDA 4ES3A 4FBUA 1RAJA 2YKMA 3D6FB 4LSLA 1JJ2R 1CJTB 1IUJA 2RU9A 1YDLA 1QAIA 1WHYA 1MLAA 4IH7A 2V2KA 1VBXA 2WONA 4C4WA 4NE9C 1VMBA 3QZ8A 2XNRA 3V6HA 2V4JB 3T5HA 3NAHA 3RZAA 4EBCA 2UVVA 4ED5A 4QWAA 3OQ2A 3MM8B 1NUEA 3W2VA 1LW0B 3FRZA 4F3QA 4DQQA 4AL7A 2M0GB 4LF9J 1RUSA 1UJ4A 1KS2A 1S1VB 4ECUA 1HPZB 4CLSA 1FNXH 4LF4F 4NA1A 1TFWA 4OHXA 3HMJG 1MN9A 2Q6CA 4ID8A 1RT5A 3I87A 4OL8A 4ILRA 2WTFA 1Y10A 2RS2A 2D74B 1X9SA 3KLVA 2ZVIA 3QWUA 5E33A 4USKA 6AT1B 3G9CA 4JI7F 2A0FB 3NY0A 3T1HF 2IDLA 2JFKA 4P2SA 2YY3A 1FWLA 3TUZC 4K2XA 4Y28C 3DOMB 4ZN1A 2GMHA 2XO6A 3FSXA 2RSQA 3H90A 3BQ1A 2VASA 4A8SA 2NS1B 2FJEB 2F8MA 3DRPA 4ECRA 2HAFA 1RCOB 1UVJA 1F9FA 4WKRA 1RDRA 3AJ1A 4USMA 4RW9A 4PWUA 3F73A 1HKAA 2CJ9A 1RTIB 2CQ2A 2MZRA 1KD1T 4U96A 1U0SA 3NCPA 2MZJA 2D3O1 1A0OB 3QT6A 4LR9A 2R4FA 1UPPA 4JV0A 3R1HA 3HKWA 3D67A 3ULHA 5BXIA 1H0HB 1U09A 1JK9B 3DLGA 2DNHA 3R6GB 4EEYA 3AQPA 3SV4A 1U1RA 1B3TA 1UVMA 3EVOA 1GXLA 2WB1D 4J9LA 2XB2D 1JLFB 1NNDA 1VQYA 5B0GA 3RW7A 1T9UA 1XNQF 2ZHAA 1Y9OA 4LQ3A 3BBCA 5KFKA 3V81B 2DGSA 2CKWA 1S0VA 3N01A 2GO8A 4G1PA 4X2BA 2ZWPA 3MCNA 3PW2A 1FRIA 1X4DA 1BQNB 4OX8A 4EYHB 1CULA 4FF1A 1XBWA 1PGZA 2JJ4D 3BGOP 1N36F 2C2ZB 1V6HA 4YOEA 3DRXA 2ZC3A 3NOGA 2PEBA 3G8QA 3TUJC 3QRQA 1VQNS 1CSJA 3T41A 3Q23A 1AUSL 3SQGA 1IKYB 4IH5A 4KE5A 4DR7F 2M8HA 2ZKUA 4RU2A 2YKOA 3EICA 1NSKL 1RAGB 1TAUA 1KHVA 3LF0A 4C0BA 3W5YA 4YS2A 1IR2A 2DY9A 3AQOA 4FYXB 2RKIA 3THVA 5LSRA 4JI0J 3MUVP 3I6PA 2ZM6J 3P4UB 4Y6IA 2DNQA 2NZCA 4K8RA 4WZQA 4IDKA 3L3CA 4IQXA 4KO0B 3C2PA 1B99A 2CPXA 3TQEA 3AXKA 2BACA 3T1YF 5KFWA 4F36A 2V50A 3MGJA 1EP4A 1HHQA 2UUBJ 1YJTA 1P1TA 4PZVA 4ER8A 3UCZP 5I42B 3KUGA 3OD2A 3J81j 5J2MA 1J5EJ 5CXTA 3DLKB 3KK2B 4TN2A 4JYAF 3BGFA 4IYQA 3CCUS 5ETVA 2VA3A 4CH1A 1RT1A 1GX6A 3FEYB 3VAGA 2WVCA 3S01A 2C22A 3OVSA 3BN7A 2DGOA 3W1YC 2QYCA 5HQLA 1RQ0A 2J9DE 2MEWA 4MH8A 1RT4A 1S6OA 4NMLA 3KG0A 1SQGA 4P6QA 2MQOA 4ED0A 2CPHA 3GCWP 5KFLA 1REGX 3G2XA 2IVYA 5HMYA 3NGRA 3M6VA 2IJFA 2G2ZA 3K5MA 1UFWA 1XQIA 4N47A 3OL7A 2QMXA 3HVAA 4PG4A 1KBRA 1AZSA 4JI8F 4CLUA 2WOMA 3MECA 4IG3A 1X4EA 3W2VB 3Q8PB 3SQOP 1T11A 2MSTA 1B64A 4DL3A 2FVCA 4ZA1A 1N52B 3C16A 4X62F 4X65J 2E5JA 1S1WA 1SJ4P 1J5OB 1BUXA 1NDPA 1R8CA 5AXKA 4W90B 4YY3J 4BWMA 1W2IA 2HQGA 4XK8C 3VZHA 1WC5A 3JSRA 3Q83A 3EPIA 2KO1A 1R0BG 2WVBA 2MZQA 2A6OA 4LT6A 1AROP 2YQ3A 4UOFA 4QQBA 2J6UA 1SPBP 5F9NA 3L4BC 1Q8KA 1S6QB 3KLIA 3O5TB 2YNIB 1X7VA 5KOXA 2K06A 1IBLJ 2DR6A 2FYXA 5FJ4A 4AL6A 2CUYA 2EFNA 1EKSA 1S4FA 3IR6B 2W8LA 1TL3B 4OX9J 1WJ9A 4M63A 2ZH2A 2MYFA 4Q44A 1ZAVA 3HHLB 5ETMA 1HBNB 1WF1A 1WSRA 3IS9A 1UWBB 2RQMA 3MM9A 4I68A 4ZLJA 3HCXA 1HFEL 1KLMB 4QWEA 1VJWA 2VJVA 3RB6A 2UVRA 3I0SA 2E5HA 5GAGI 1IR1A 1H2TZ 1N5YB 2NSCA 1HWIA 1HNZF 2O5DA 1VOMA 3V81A 2Y8YA 3N5BA 3LH2S 4DF8A 1HI0P 2VV5A 3PG9A 3RAMA 3DDKA 2GQCA 3C6TA 2WOMB 3DI6B 3HHKA 5JJBA 3QATA 4YB1P 2PA8D 1MN7A 4P73A 3WBZA 3CDAA 1RU1A 1ZOTA 1NB7A 2MB0B 2V9WA 1VQ6S 1XNQJ 3S1TA 1BC6A 3CJKB 1XMQF 1HNWJ 4ZCLA 1N0VC 2H5IB 1NHVA 2MXYA 3RBDA 3TVZA 1RXOB 1LQ9A 2DHGA 3CMAS 5KG3A 1E6YB 4ZP6A 5AJ3J 3W9HA 5HO4A 3TWZA 1T94A 1KHWA 2GHPA 3A13A 4G1IA 4P71A 5A8WB 3KHGA 3S6EA 4L6V3 4N8OA 2Z57B 1VK8A 3SXLA 3CUNA 1E6VB 2MKSA 3KJQB 4DXLA 2PO4A 4ELTA 3J7A1 2KH9A 2C2EA 4U9RA 1S1XB 3OR2A 4Y2AA 4DQPA 1S76D 5AXNA 3KHHA 4TQSA 2DH8A 3DKDA 1ULRA 2C2KB 1B7YB 3E8OA 4PXBA 4CYUB 3P6YC 1SXLA 4CTAA 2UXBJ 1X4GA 2KVQE 3W5XA 3GYXB 3LPYA 4A8WA 3RBXA 3E01A 4L74A 5D8HB 1U0HA 4F4YA 5IZHA 1D1UA 1RT6B 4RW6B 4RNOA 3US5A 2FY8A 4ZVFA 3PR5B 4RWXA 2EFVA 4ES1A 5LT5A 3Q8UA 4M5HA 3SDEA 3T1YJ 4K4ZA 5T7LB 3R2DJ 4ZVTB 1ICEB 2D1CA 3DOKA 5KFSA 2XBPA 3QFWA 1LFPA 5F8MA 5IM0B 1JLQA 2LP4A 3F0NA 4L3KA 1WI6A 3GQCA 1TL4A 2AJ2A 4ZLLA 2KZMA 5K14A 5E3PA 2CDQA 2YWGA 1UVKA 2GQQA 4S0MA 1KQFB 3G87A 1NB2A 2EG1A 1FKPA 4PR6A 3DOLB 4LBPA 4J9NA 2FHKA 3DOMA 4I7FA 1YJ9S 5D3GA 3GG1A 3THPA 1CBKA 4C3KA 4V19X 2HG4A 1JLCA 4TU9A 1PCAA 3ZZRA 2BQUA 3KHRA 3MEEB 4JI4J 1M5VC 5K8MA 1QE1A 3M9MB 2DNOA 4EUVA 4I67A 2DIVA 3PYFA 3OJUA 4Q2LA 2LXIA 5ETPA 4ZVPB 3KFWX 2B4VA 2VL1A 2QA2A 2OELA 1Q5VA 4ZPBA 1S12A 2OO4A 3DM2B 4Y2IA 3HP6A 2HZVA 4IR1A 3LP1A 2WW4A 4WF9Q 3R7SB 4ZP8A 1VI7A 2W4DA 3DC2A 2RF2A 4P74A 1NLKL 4XDCA 4KHPF 1KOOA 2B7BB 2V4JA 4I69A 5G0RB 2FHMA 4OV1A 3KK1A 2ZH1A 2ZM6F 4GVLA 3RRGA 2PFDA 4OYWA 1Q4RA 2XLIA 4YHHF 3KK1B 4WFBQ 2M70A 1TUWA 2ZE2B 3PYEA 3VR1A 3H4DA 4M5LA 3I31A 2CAJA 2AYGA 4ED7A 3D28A 1NJYA 1Q81T 1MWZA 1S1VA 1PJ6A 2D3UA 2V94A 2VG5B 1UEVA 2VPWB 4HI1A 1ACMB 3CCRS 1Q79A 2NUUG 3MM6B 4RNHA 3QT8A 1HIYA 2RB7A 1HHTP 4M5IA 1HBOA 3TUPA 2KHCA 2P6TA 1CJTA 2B5JB 2LQ5A 4KJIA 2Q79A 4QR1A 2AMCB 1LKZA 2C2OB 3O8WA 3TVKA 4OZJA 1F9EB 5HLFB 3BQ2A 4O3OA 2ATLA 5LMNJ 1OJ4A 1Y5NB 4O0IA 1NPPA 1RT3A 1VLOA 1SH2A 2DISA 2WBMA 4KH0B 1FKPB 4DUTA 3UWTA 2PIIA 4F0KA 1N48A 1K0VA 2CJKA 5E41A 4IOCQ 3EZ5A 2WVFA 4PG7A 4OZ2A 3BYPA 5DDQC 4JYAJ 3BJYA 2XHWA 4LIRA 2HFVA 4KGVB 1UL3A 3K17A 1WKJA 2H65B 1OO0B 2VBYA 1Q1KA 4DCPB 3BF4A 3VAFA 3KJFB 4ECWA 2AQ4A
chains in the Genus database with same CATH topology
1Y5LB 1S9EA 3TI0A 3MPWA 4NXMF 4Y0FA 1FCAA 2RIJA 3N9UC 3D0GE 4O3RA 3HI9A 1XC9A 4YP3A 3TYTA 1GQEA 3G4SS 4BC7A 2R7OA 4CNZA 1SIZA 3T9ZA 1IKVA 2LLZA 4LMZA 4NZ6A 4YEAA 2AGPA 3GG0A 3MEGA 2EFQA 3DRSB 5B0BA 1Y3KA 4WTYA 1X4FA 3QPIA 2A18A 5HBMA 4TY8A 4A8FA 5I3UB 3O2IA 1IN0A 1TK8A 5K8NA 2HRUA 2PDAA 2NUHA 2EG2A 2OH2A 2GNKA 4OIXA 1S6PB 2DGUA 2VB6A 3MAHA 2M88A 2AYBA 2UUBF 2YTCA 1JLGB 1UA1A 1S9GA 3UCGA 3IRWP 3ITHA 3CDEA 4EU0A 4BHQA 2HYIB 1HA1A 4G1QA 4NLPA 4NLDA 2GMLA 2Y0SD 4TLQA 1ZTWA 1QUVA 3MURP 3EGNA 4RU9A 3PFOA 3TRGA 1J2VA 4I0WA 2GHVC 1MMNA 1EETA 3THTA 1FHTA 3KLFB 2ASYA 4OI0A 1KOHA 3PXGa 2B4PA 3JSMB 2LU1A 4OQJA 1S0NA 3NKYA 5IWAF 1RTDB 1BQXA 4KIAA 4B9NA 2E1AA 3LW5C 3G6VA 1LWFA 3JTPA 4C0HA 1KSPA 2R7RA 3L7PA 2HHVA 1UVIA 2DGWA 3HHLC 3V4IB 5FD1A 3VZIA 4X84A 4F8RA 3H20A 2A2CA 2ZH8A 1UJ6A 1SL2A 2K1RB 2WSEC 5KG6A 2MKJA 1LOUA 3NP5A 4OX6A 2KG0A 2I9SA 4RW8A 3KG1A 4GO5X 4B9VA 4RBVA 5FLXY 2C2DA 3H5YA 5CH7B 2M8DB 2IRYA 1TKTA 3KNGA 2ZJQQ 4N5SA 2IC3B 3DCAA 3BDPA 3K2YA 2CJAA 1U1NA 3FZBA 1VQMS 2YNHB 4WU3A 4QOTA 1M5SA 4KRWA 3H5SA 1DTQB 1NK5A 2POKA 4C0OC 3FDSA 2CQDA 2DHAA 4OHWA 1KVIA 1JNRB 1RT7A 4ELVA 5G4DA 2JX2A 5E3QA 3H40A 3U1LA 4RW7B 3RRKA 4DSIA 5KFYA 3W3SA 2HVZA 3K5LA 1UA0A 1SV5A 2YWKA 3M2UB 3QJJA 1HQEB 3MM8A 2RE1A 5F3TA 2FTRA 2AYEA 1SKRA 3M2VA 2NLWA 1IJEB 2KJWA 2O1PA 3HHNB 2KRRA 3HLUA 3ICLA 3GZ7A 2FLPA 1X5PA 1WI8A 4UUXA 4WFZA 1WACA 1L3TA 5D6GA 4KGKA 1HNVB 3RU0A 1U26A 1N88A 1R8AA 4WYLA 2XMMA 5HLFA 3DYAA 3EXCX 1XMOF 2UUTA 4CO4A 3UD4P 1U4BA 3HVRA 4ED8A 3OHBA 4B9MA 4DL5A 3QO9A 4ZVEA 3M4XA 5B0EA 2GA7A 3QGHA 2JEIA 2DCUB 4FVCA 2LMIA 3SYZA 2HNYA 3MMCA 3HX9A 1ELOA 3FEZA 3CB4A 4NOHA 1NKCA 4UUWA 5IXUA 3D1OA 1TVRA 4H4KA 1D3WA 1U2FA 2P9GA 3DFEA 4JI5F 4A4JA 3DOLA 1FE4A 1DTTA 3MEKA 1YRUA 1S1TB 1FD2A 1ROFA 1SJ3P 1T05A 4DEZA 3MI7X 4WE1B 5BYQA 2L3MA 3DU6A 4KO0A 2CIMA 2ZDOA 1VS3A 4OJ3A 2E1CA 1GXUA 4FF4A 5EWGA 1DLOB 1MROB 3B82A 2O01C 4GMKA 5HMXA 4DL4A 3LP2A 3N6MA 5AE1A 5AE2A 4QPTA 3J7YU 1RT6A 3KK2A 4ZMMA 1KFDA 3QGGA 4NA3A 4QIGA 4ZVHA 5HMZA 5LJ3Y 4R5PA 2R2RA 1UJ5A 2HMIB 3C6UB 1VQPS 2C2RA 1Q86T 2FJWA 4KC5A 1VQ5S 2RD5C 4I6AA 2MHNA 2QFJA 1OSCA 1QJHA 2HHSA 1Z1ZA 1NU4A 4G1QB 3SFGA 1BQNA 3VCDA 5MLCV 2PD1A 3TAQA 2OPQA 3HO1A 3FMBA 4H4OB 2YKNA 3M8PA 4J9QA 2DIUA 3K5OA 1FJEB 4YFUA 2MKKA 3RBEA 3KWMA 1U8SA 5CZXA 3CCMS 5L9XA 1SQEA 1JLQB 2IRXA 4OI6A 3FVYA 3QGIA 4DV3F 2B43A 3VAIA 4O44B 1S0MA 1Q8IA 4B9LA 3AB4B 3CJKA 1O5JA 4DSEA 1MMDA 3T5JA 3N28A 3JB9k 3JSMA 1FDDA 1JX4A 3I9ZA 3HFKA 2UP1A 5HQ8A 3HHDA 1HMVA 2ZUGA 4LSNB 3N4WA 1URRA 3TAMB 1X0FA 2E5LF 3FFIA 1HNIA 2AJ4A 5DGBA 3TR5A 2IMOA 5SUHA 1TV6A 3UPFA 5I3UA 3W2WB 3TA2A 1T02A 2RILA 2GO9A 2IYGA 2CPEA 2ALZA 3NNCA 2MKHA 2ERRA 2K8GA 3VAKA 3PRBA 4ZLPA 3U1NA 4RUHA 2KXFA 4K4UA 3OL9A 3KK3B 2VPZB 4FF2A 2MZSA 3VQSA 5B0DA 2YWEA 3OL6A 1GXTA 1WWHA 5L39A 3LQVA 3LP2B 5THWA 2RNEA 2JEFA 4K50A 4TY8B 4RUCA 2M5YA 4ZOSA 2FJAB 2FJDB 2H9ZA 4QYRA 2MPUA 3BSCA 2OAUA 2MY8A 4HEA9 1WF0A 2YKMB 4C2MA 4WFNQ 3R5CA 5M2PA 2RT3A 2IHR1 2SXLA 2PMZD 3E51A 1KLMA 2WBRA 3MD3A 1SV5B 1ZPVA 3BR8A 4WFAQ 2HNYB 2RQKA 3IS9B 2FB0A 5KT6A 2KM8B 4EZ9A 3PIPQ 3TA1A 4A8MP 4M8LA 2PT0A 1Q7LB 5FIIA 3IAM9 2M9KA 4K4WA 3MM6A 4LF8F 2J8AA 4ECSA 3CD7A 1OPZA 1UVNA 4FVMA 1U25A 1V3ZA 1T3OA 4KFBB 6FD1A 4PUOA 2HHWA 2J6SA 4D3GA 3TANA 2KRBA 2V8VA 1HNXF 2QEXS 2D9PA 4MKBA 4IKAA 3SFUA 4ETXA 4DN9A 4O3PA 5A6WA 3NGDA 2RRAA 2J9CA 5F8IA 3GFYA 2C42A 4XDDA 4ALZA 3MD1A 1S79A 4KAIA 1IKXB 4WIIA 2D41A 2VZ9A 3DLJA 4J9PA 3BZQA 3KHLA 2DNMA 2FHOB 3DMJB 3QIDA 4A8XA 3MECB 4IG3B 4QIEA 4WXWA 3T5LA 4IDKB 1I1GA 4QU7A 2HAIA 2CQ4A 2VBWA 2K1RA 1SBRA 4URGA 4HL9A 5HI7A 5LL6d 4URSA 3M8QA 1P27B 3G6YA 5KG7A 1S77D 2FVQA 4X4VA 4Q8FA 2OPRB 3MFIA 1U48A 3Q0AA 4IOAQ 3PEHA 2DO0A 3HVTA 1X9WA 3V6JA 2KT2A 1H38A 4PQAA 4RNFA 3FGVA 1SKWA 1VQLS 1D8YA 2ZOGA 1EP4B 4FS2A 2DHXA 4ZPAA 2DGXA 3IG1A 2X3GA 2KXNB 4Q2MA 3V4IA 5CA5A 2DPIA 3DOKB 4MMOA 5KFTA 5L38A 4LFBF 1FDAA 2HS3A 1ZM9A 2BJDA 3NLCA 4ETZA 4AFFA 2VA2A 4TYBA 1VRUB 2Q43A 3OR2B 4M1KA 1HQUB 2JFDA 2LCWA 4OI4A 5D3GB 1HD1A 5BYRA 2XSJA 1X4BA 3PX6A 2OTJS 3MHYA 4J9RA 4I2PA 1BQMA 2BA9A 2ZBIA 4GC7A 3TOQA 2G9OA 1Z2LA 1SL0A 1L3UA 2NPIA 2MDAA 5EX0A 3C3LA 2E5IA 1VQ4S 3H4BA 1N34F 2GQ2A 1F2GA 5GAGU 1XTZA 4ZPCA 4WFXA 2DB1A 3T9NA 5D77A 5D78A 4X64F 3MMAB 5HROA 4DMZA 4B9TA 2E7WA 2PC6A 2EBGA 3J81Y 3BDEA 2OP5A 4YB7A 1DTTB 5GVQA 3U27A 1WTFA 4ZK7M 2XZWA 4WK3A 1K9MT 4ZCMA 5A8KA 2YKPA 5IT9Y 1TKZA 2YNGA 1IBLF 3I5CA 3G6XA 1S97A 1FDNA 3QMQA 3SCKE 2ZH9A 2E1RA 4BDPA 4QIVA 2J7UA 1KTQA 4X4OA 4IG0A 2ZD1B 3OTEA 5FDLB 3LAKA 2GJ2A 2Z4PA 2FVSA 4YB5A 3CIZA 3O44A 4BC9A 1Q8LA 4QPXA 1B0PA 1M5HA 1Q78A 5IS2A 1G3OA 3OBIA 1FRHA 3H59A 1N56A 4DX8H 4W92B 5M2RA 2LEBA 1VQ6S 2B9XA 1TAQA 2YH0A 3DHWC 4BWJA 1IQTA 3Q2SC 2Q66A 1Y3JA 2B5JA 4KB7A 1RP5A 2ZHBA 3RW6A 2W9CB 2B3TB 2MQLA 3MTJA 2UU9F