1U1LA

Crystal structure of up1 complexed with d(ttagggtt prn ggg); a human telomeric repeat containing nebularine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*(PRN)P*GP*GP*G)-3'
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/dna
total genus 50
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1lA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1lA02
1U6FA 3CTRA 1JJ2R 3EGZA 2FC9A 3UCGA 3CCLS 3TO8A 1M5VC 3VF0B 5ITHA 2DO4A 4CH1A 2MQQA 1JJ4A 1OPIA 2DGWA 2WBRA 2KYXA 2HYIB 4TLQA 2MQPA 2D3OR 3G71S 3MURP 3Q2TC 3CCJS 4QPTA 1YJWS 5CYJA 4J5OA 2QEXS 2RS8A 1A7GE 2N3OA 2X1BA 2E5IA 3SDEA 4UQTA 3J7ZT 5DM6Q 1YJNS 3I56S 2B0GA 1BY9A 2I38A 3NNAA 4Y0FA 1KOHA 1VQOS 1VC5A 1H2VZ 4TU7A 2CQPA 1JJHA 1M5OC 1DBDA 1SXLA 2O3DA 2CPFA 1WHVA 2MZRA 4IOCQ 2MKCA 2MZ1A 1JMTA 2QFJA 2OTJS 3BO4A 1U2FA 1N88A 2VODA 2CPDA 5LXYA 1U1OA 1FXLA 1YI2S 2CPIA 3BO3A 3CXCR 1PO6A 2DHXA 2MPUA 1UP1A 2CQ4A 2BOPA 4TU8A 3US5A 1K9MT 3CC4S 1VQ8S 2KFYA 3B4MA 2OTLS 1DZ5A 5EN1A 3S6EA 2F9DA 2OIHA 3MDFA 4LIRA 1W2BR 2DNPA 3U1MA 1QVFR 2MKHA 1WF2A 2LCWA 1D9AA 2DISA 2CQBA 2GHPA 2J0QD 2KU7A 2M70A 2MHNA 1WEXA 3SXLA 4FXVA 1WTBA 2VOOA 1N54B 1CVJA 4LMZA 3EGNA 2XB2D 4WCEQ 3CUNA 2EK1A 3UD4P 2KI2A 2XNQA 2CPHA 1YJ9S 2MKIA 2DGTA 2MQLA 4WF9Q 2MZTA 1WF1A 2JVOA 2YH0A 2MGZB 3U1LA 3VAJA 1HA1A 2RS2A 5DDPC 2YH1A 2DIUA 2ADBA 1VQ9S 2L9WA 2RQ4A 4ED5A 3NNCA 5DDOC 3H2VE 1H2TZ 1Q81T 2NLWA 1RKJA 4OZ1A 1DHMA 1P1TA 2KRBA 3NS5A 2UP1A 3NMRA 2BZ2A 2CPEA 3ULHA 2HGMA 1YHQS 2YTCA 1YIJS 1X0FA 3CCVS 5CXTA 3V4MA 1FJ7A 1WF0A 5BJRA 2N7CA 3S01A 3CMES 4A8XA 1WI6A 2PE8A 3NNHA 1OWXA 2MMYA 3B4DA 3J7YU 1QVGR 1U1QA 1HD1A 2SXLA 1X4EA 2DNGA 2HVZA 2G4BA 2DGVA 2DO0A 2OSRA 1FO1A 2MYFA 2CQ0A 3ZZYA 2KH9A 2CPJA 3VAIA 1WEZA 3G4SS 4RU2A 4V19X 2L08A 2RRAA 3D2WA 2DNZA 1VQKS 2X1FA 2LXIA 1VQPS 2DNNA 3RW6A 1PGZA 2DIVA 2DH7A 2M2BA 3G9CA 2X1AA 2KXNB 2NZ4A 1VQ4S 2KT5A 2MGZA 2RU3A 4F02A 2ZJRQ 3PIPQ 2F3JA 2ZJPQ 2LYVA 5H1SV 3MXHP 5JVGQ 3R1LA 2AYGA 5D77A 1U6BA 2RUGA 1M90T 3MUVP 2L41A 2VOPA 3CCES 2XS5A 2KRRA 5HO4A 2RVJA 4FXWA 5CA5A 2DB1A 1VBZA 4IO9Q 5GAGU 3RW7A 2G1DA 4ERDA 3IWNC 3EX7B 2K8GA 3UWTA 2DH8A 2D9PA 1FJEB 5FJ4A 1KOOA 3LQVA 3CCRS 1QM9A 1ZZNA 2OSQA 1WELA 2M88A 1KC8T 1IQTA 2CPYA 3BS9A 4U67Q 4C0OC 4CH0S 2CQDA 2GO9A 1VQMS 4PRFA 2MKKA 2DNRA 1M1KT 1WHWA 2E5HA 2G0CA 5IQQA 5LSLA 1VQNS 2KXFA 1U1KA 2DGOA 3IRWP 2M7SA 2N82B 1R8PA 4P6QA 2M8HA 4QU7A 2LA4A 3G8SA 2MY8A 5HL7Q 2KM8B 1M5KC 2FY1A 2MY7A 3MI7X 3BO2A 5D78A 1SJRA 3TYTA 3CC7S 2D9OA 1WG4A 2HGNA 5GAEU 4OZ0A 1XN9A 1WG1A 3Q2SC 2MZQA 2FPHX 2CQ3A 2M4MA 4F26A 1ZZFA 2YKAA 3G6ES 1F9FA 1Q82T 2CQHA 2DK2A 3LPYA 1U1PA 1S72S 1KQSR 1X5SA 1X4CA 3OW2R 2DNLA 2JWNA 3VAFA 1X4HA 2MJNA 2V94A 1VQ6S 1WHXA 2MSTA 1X4AA 4IUFA 2DNHA 2DITA 1VC0A 2MKSA 1WEYA 2KM8C 2DHSA 4QU6A 2I2YA 3CC2S 2CQ1A 2KXHA 1K73T 4YOEA 2EVZA 3R27A 4UY8T 2MB0B 2N3LA 2CPZA 4QQBA 3CD6S 2CQGA 5DDQC 2M9KA 5IFMA 4WFBQ 1N52B 3JB9k 1X5OA 2QA4S 1D8ZA 3MD3A 4WFAQ 2JVRA 3DXBA 2HGLA 1X5TA 5GAHU 1R8HA 3ZZZA 4ZKAA 3CF5Q 4WIIA 2CJKA 2E44A 2JRSA 2MZSA 1WWHA 2KHCA 2AYMA 3THTA 2FC8A 2HZCA 1VQ7S 2VONA 2MSSA 2EK6A 2PEHA 1HL6A 5JVHQ 2DNQA 1N8RT 2MJUA 1H2UX 1X4GA 3VAKA 2LEBA 3CPWR 1YTYA 1Q7YT 3CCQS 1WG5A 3CCMS 3I55S 1UFWA 5IM0B 1WHYA 3R1HA 4WFNQ 2X1GA 3UD3P 3P6YC 2DGSA 2ADCA 2MQMA 2DGQA 4EGLA 2CPXA 2AYBA 2JX2A 2XS2A 3SMZA 3CCSS 4M5DB 1VQLS 1X4FA 1SJ3P 4IOAQ 3VAGA 2DGXA 2YWKA 2LMIA 2KN4A 2A3JA 1YWXA 2LECA 2E5JA 1M5PC 2DHGA 2XSFA 2MQNA 2J8AA 2DHAA 3S8SA 1K8AT 2RNEA 2CQCA 3MD1A 1OIAA 2J0SD 1VC6A 1OO0B 3K0JA 2ZJQQ 1H6KX 1P27B 2RQCA 1VBYA 3VAMA 4YUDA 2DGUA 1G2EA 1VBXA 3TP2A 5GVQA 2M8DB 1FHTA 3MUMP 1SJQA 3N9UC 2XS7A 4W92B 2AYEA 2LKZA 3HHNB 4WKRA 4PR6A 1S79A 5IM0A 3MOJB 4C4WA 2F9JA 4TU9A 4LJMA 2DNKA 1FNXH 3UE2A 2MQOA 4C7QA 3G8TA 1X4BA 2XNRA 3P3DA 1Q86T 4PKDB 1YITS 5GMKa 1RK8A 1B7FA 3G96A 2E5GA 1X5PA 2LA6A 4Y00A 2DNYA 1VQ5S 4F25A 1X4DA 3MUTP 1DRZA 5DETA 5GADU 2MZJA 4CIOA 1UAWA 2KG1A 1U1LA 4W90B 5DM7Q 2U2FA 2LQ5A 1NJIT 1L3KA 2CQ2A 5LJ5Y 1WI8A 3P5TL 3S7RA 5MLCV 3VAHA 3CCUS 5LXRA 1KD1T 3FEYB 2LXUA 2OJ3A 4BS2A 2MXYA 4YB1P 3UCZP 4CQ1A 2KVIA 2LEAA 2DH9A 2RT3A 2Q79A 3BEGB 3NS6A 3H2UB 3CULA 3THPA 1URNA 1NO8A 3SDEB 1O0PA 3CMAS 5LSOA 1SJFA 1SJ4P 3FEXB 1U1NA 1NU4A 2K3KA 2MKJA 1HD0A 1A9NB 3L3CA 2M52A 2CQIA 2FHOB 2M0GB 2DNMA 2J76E 2AD9A 5DDRC 2KG0A 1ZH5A 1FJCA 3PIOQ 3UCUP 2RRBA 1UW4A 3VALA 2U1AA 1FT8A 3P49B 1U1MA 2DNOA 2ERRA 4Z2XA 3DLLQ 3HI9A 1AUDA 5LJ3Y 1U1RA
chains in the Genus database with same CATH superfamily
2UV8A 4CLZA 2R2RA 1N34F 1M5VC 2ZBPA 4Y6IA 4ZPTR 1REGX 3N5FA 1HBUB 2QLJB 4GRSA 5HROB 1CJKA 4EMDA 1Y3JA 1DJ0A 3L7UA 1CC7A 1MWZA 3DLGB 1U49A 4ZMMA 1QUPA 1UWBA 1Q1KA 4WPAA 4DCPB 4CO0A 2AJQA 1RT1A 1VQOS 2GQCA 2WOMA 4C8NA 4JI0F 1ULRA 4O4GA 5HI7A 1Z2ZA 3RAQA 3W62A 1ZYQA 2UXCF 3TJ8A 2EFGA 4U7CA 4ZCMA 3OPKA 4PXBA 1RWMB 2GW8A 4ED6A 3A12A 4NCGB 3AHPA 3FVYA 5FD1A 2YQ0A 3I4PA 3CC4S 4ELVA 2W8KA 1SV5A 3A1YG 1J5OA 3ETMA 4LVOP 4M5HA 1FE0A 4HACA 3W5ZA 4G1PA 2NZCA 5DG7A 4KH1B 4J7CA 4DX7A 1HA1A 2L3MA 2YH1A 3JQJA 2L9WA 2RQ4A 4ED5A 4A48A 3IR5B 4KFBB 2R8JA 1G7CB 2ZNZA 3D1OA 1TL7A 4DJBA 2G2OA 2ZDOA 2W9BA 4F50A 2ZC4A 1VLOA 1WJ9A 4C9DA 2HVZA 3AQPA 1SC4B 1XQIA 5CQGA 2CQ0A 1WC0A 3LTOA 2XMTA 3DGVA 1HNVA 3DDIA 4DR3J 3QZ7A 3JAMU 2ZJPQ 3PEJA 1SC3B 3I5AA 3FK4A 3AAWB 1Q8LA 8AT1B 5HQ8A 4KRWA 4R25A 1UW9A 3NS7B 2AZ1A 1EIYB 2RVJA 1FVSA 3HCXA 2W2PP 4FXWA 3W66A 1URRA 5CA5A 4LRAA 4DOZA 3ENVA 3OV7A 1GQEA 2CDQA 1LFPA 1KC8T 3F0NA 1HI8A 4MYUA 1RT3A 2C2OB 3JTNA 4IFYB 3MR3A 2M8HA 1M5KC 2IJFA 1CLFA 4CRJA 3KLVA 2DPJA 4LBHA 4NA2A 1RWNB 3KDNA 2OEMA 4BWMA 2HS0A 4JV2A 4RLEA 2IVMA 4ECVA 5G4DA 2HLTA 4IUFA 4M5LA 1WEYA 3N4WA 4NLSA 3M2UA 4HVZA 4FF1A 4LSNB 3ZNJ1 2KT2A 2H5EA 4LFBJ 4UUWA 1N6QA 2M3DA 4FYWB 5AXMA 4LF7F 1U4BA 4QYZJ 1SC1B 1MMLA 3MR7A 1SPBP 3KLEA 4XDCA 2NXCA 2OP5A 4KBIA 5J2NB 1RCOB 1APSA 4PYDA 3DDKA 2EK6A 5JVHQ 2ZBQA 2GGPB 4DCJB 2V0NA 3WC2A 3FC9A 1NNDA 4DCOB 2BDPA 3K7RA 3UD3P 1BQMA 3JSMB 2GHVC 1TP7A 3W1YC 4LSLB 4JI7F 1RTHB 1S77D 2UXBF 3T1AA 1IBLF 1S1VB 3M8PB 4WIQA 3CD0A 1NJYA 2DGXA 2Z8QA 2KN4A 3KNAA 4KIAA 4ZVFA 3J7AN 3HVTB 1XNRF 2W7AA 3DLEB 1R8CA 3QRPA 1NZAA 4NA3A 4MKAA 2RQCA 4YUDA 4NLDA 4NZ7A 3PR4A 1KRPA 3M30A 2B9EA 2HMIA 1N5SA 4C8KA 2HZVA 1X0PA 2I5JA 5GMEA 1TQLA 4ID8A 5G0RB 4BCAA 1VQSA 1FNXH 4HHUA 1TL1B 1TAUA 1O51A 2L9DA 5T14A 2VJVA 4I64A 3N6MA 3MUTP 5J2MB 3TI0A 4JI5J 4RWXA 1U1LA 5T7LA 4PWDA 3UDVA 3RR7A 4FN5A 4Z7YA 4NWBA 2AQ4A 1XR6A 5F8NA 4N7TA 2DY9A 3HD1A 4OI0A 3GFZA 5KT6A 2OPQB 2IM1A 2P9EA 2G2ZA 4I69A 4QYRA 3QO9A 2G13A 2OKQA 4YS2A 2XM3A 3ILOA 3KLHA 1HNXF 2COLA 1RXOB 2V68A 1MSWD 5L9XA 4DV5J 2HHHJ 5DS7A 3VHQA 4V1Ak 4BC7A 1NH7A 2FHMA 2JL9A 4ZIWA 4ZVPB 3DOLA 2MQQA 1T8EA 5IZHA 2WBRA 2Y9HA 3RR8A 2D3OR 4QPTA 1F5AA 2JHEA 4NMXA 3RGIA 2R8HA 1RHRB 4P9SA 5IV4A 1C0UB 2UVRA 1GTEA 1VC5A 1JWWA 4LSZB 2HK2A 2HWTA 1DBDA 1FEHA 3OR2B 2CPFA 4XPCA 1PSDA 4Q43A 2OTJS 1N88A 3CJ5A 1TKZB 1FXLA 1YI2S 1P8GA 2VDHA 3UO0A 2EXUA 2RKIA 3BGLA 4LFBF 3PM9A 4YY3J 2E9RX 4DZ6A 4N76A 3NXZA 3JYTB 2VASA 2V4QA 4O44B 3EZOA 3U1NA 1XNQF 2J0WA 2XI2A 3FNNA 1EHWA 4ZLLA 3EGNA 5F3TA 4G1IA 2E1CA 2UZAA 2YH0A 5GAGI 1LWXA 3OR1A 1VHIA 3CJ4A 4YB5A 1O6XA 3AD9C 2A18A 4J9OA 2IDLA 3NGRA 1QSSA 1IJFB 3NMRA 1R31A 1IBKF 2YKQA 4J9MA 4PQUA 5I3QA 3T3FA 5ETVA 4IR1A 4HKQA 4M5NA 2CG8A 3C15A 3A4TA 1RDRA 5MAOA 1X4EA 1VISA 1I3OB 1CJUB 3AOBA 3J7A1 3ZZYA 2N4CA 2DNNA 3RW6A 4B08A 2DIVA 2LLZA 2B9WA 2M2BA 3MCNA 1YJUA 1KR4A 5J1NA 1XMOJ 5B09A 3DRPA 4LFAJ 2HS3A 1LFWA 4IO9Q 3U02A 4ZVOB 2V2ZA 4X4TA 4KAIA 1KOOA 3UR3C 2J7WA 2AT1B 4MYTA 1WELA 3LGHA 5EWGA 1C2PA 2FD2A 1JLCB 2E5HA 5DQGA 2D41A 2B4PA 1WC5A 4F3QA 2CZVC 2KO1A 1ZAVA 2B4UA 4N8OA 1Q79A 4DS5A 4A8MP 1JXVA 3Q8SB 4FF3A 4EU0A 1S57A 2AX1A 4OJGA 3M8SA 4MFBB 1VBKA 1I94J 1X4HA 2XY6A 3T1YF 1QSYA 1H73A 5L46A 1DQ8A 4OYBA 4F4WA 4C3MA 1UZHA 2Y1LB 4AE5A 1ACMB 3T1HJ 4PZVA 1RTDB 2VIHA 2I6WA 1CBKA 5D8HB 1D8YA 3ZTRA 1LWFA 3QJLA 1BC6A 3Q8YA 1PG5B 1S1UA 1VQ7S 3Q83A 2HVDA 1Q7YT 3AQOA 3QQCD 2C2MB 4KSEB 1S0VA 3KLFA 2BJDA 2QN6B 3PDNA 1UFKA 1C4CA 1XJWB 4NEZA 5HP1A 2ZE2A 1LXJA 2VFVA 3MPYA 2VICA 3ZZOA 1WD6A 2CIMA 5IT9Y 2IBKA 4TLRA 1NSAA 2UUTA 3VTIA 1VBYA 4ECRA 2HLUA 3EGWB 2GIRA 1KONA 2IPOB 2ZD1B 4FZVA 3I0RA 2VDIA 1K47A 1OJ4A 2LEPA 3AJDA 3M4XA 3UE2A 4K4WA 5B7WA 3AODA 1X4BA 1TKXB 4Y00A 2Z2LA 2AMCB 4B9UA 1UEKA 3EXYA 3A3NB 1WOSA 4R5PA 1HBMA 4X65J 3NAHA 3UVJB 4C3LA 2QLWA 4YB1P 4NCBA 4RNOA 4F4ZA 3D54A 2HAFA 5U47A 4ZIVA 2GA7A 3SDEB 2XWXA 1RAHB 1CJTB 4K8RA 3IGNA 2IYGA 5CZXA 2M0GB 1WOOA 2XULA 4B17A 3NGDA 4P2SA 2RRBA 2UUCJ 2BJ9A 4P2XA 3PV8A 3A3OB 4DFJA 4UZBA 4P74A 3CCLS 2B7CB 4JI3F 1C0TA 3H5YA 3ILJA 5LOQA 5KFQA 4F04B 4PG8A 2J9CA 4J5OA 5L38A 2OEJA 1X9WA 1RHQB 1UVKA 1ZETA 1CEZA 4NYPA 5SUHA 2ZH2A 2ZVIA 3FBBA 4RW6B 2D3ZA 3OQ2A 2MZ1A 3PW4A 2PMWA 1JLQA 3IP0A 3IG1B 3MFHA 4F2RA 2D3O1 2YBVA 3KK3B 5EN1A 3PVXA 3I5CA 2AF6A 1HBOB 2C42A 4N47A 2K7KA 1R6VA 1R6YA 3PW5A 1FF2A 4NZ6A 4O3NA 2RF2A 5K14B 2VH7A 3H5XA 2VV5A 3ZXWA 2BE2B 3LF0A 2MQLA 3GU0A 5EHHA 3U1LA 1IVZA 1PBUA 4M5GA 1NLKL 1TUVA 5L1KA 1RKJA 3DLKA 4WK3A 3R2DJ 3HVWA 2C1EB 1CPZA 3BJYA 2KZMA 5LSRA 3NKYA 1WF0A 4C8YA 1FWPA 4DSKA 2PE8A 2MMYA 4P2FA 2SXLA 2R2UA 4WE1B 4FS1A 5E33A 2NS1B 2OMLA 4V19X 2VF3A 2LXIA 2IJNA 2YKNA 2Q66A 3QT7A 2KT5A 2ZJRQ 1RYSA 2R7QA 3QFWA 3HKZD 3IAS9 2VQFF 1U6BA 3KHLA 5EWEA 1MG7A 1NDKA 1R89A 5GAGU 3CIZA 3N6LA 4K59A 1FJEB 3CCRS 1QE1B 3T5LA 2OSQA 3D9BA 1KLNA 2HHWA 4ECQA 5FIIA 4IRDA 3M1VB 2FQQB 1JNZB 3QGGA 1UCNA 5D4OA 2YPYA 4WP8A 1SJRA 4ZN1A 4KYZA 3M6VA 4K5SA 3C16B 2BOAA 3IS9A 1RT4B 1ZZFA 1N0VC 3GCWP 1YZ6A 2YQ1A 2P6SA 3LP1A 1VJWA 2ZH5A 5D4PA 2DR8A 5LMNF 1RT6B 2VG6A 1VQ6S 2B51A 4YOEA 3CD6S 3W2VA 1B3TA 1AZSA 3D5MA 3B78A 1X5TA 1T95A 4PAAA 1U02A 4DV7F 1YJ7A 4F0HA 3K2YA 4X62J 3KJVA 1EETB 1H2UX 1IKYB 4XAKA 3CCQS 1O8BA 2BJ3A 1V5VA 3NWGA 2DGQA 3BPDA 3ISND 3M9OB 4L73A 5DLFA 2YNHB 4IFVB 4JI1J 2DHGA 3IBWA 2BJEA 3SV3A 3M8QB 4F0MA 1KQFB 2H1YA 1H6KX 1WOPA 2HAIA 4Z37A 2HHSA 1N36J 5GVQA 2V8HA 3D6HB 2LKZA 2PC6A 4Y65A 3EVWA 2V34A 5CD4H 1WC1A 1JXLA 1FI4A 2ZEJA 3W9JA 3MAAB 2YWFA 4E98A 3UPFA 4PKDB 2LA6A 5ETTA 4OYOA 3G82A 4CIOA 1RBAA 3QGIA 4OHXA 3A8EA 3SQGB 3DLGA 2C22A 3G6VA 2C28A 5BR8F 3WBZA 5HQMA 3R97A 2EEYA 3KLIB 2DH9A 3NS6A 2OPPB 4DR4J 4UUXA 1K1QA 1T03B 2RIJA 3TZXA 4PXEA 3L3CA 2FLOA 4RW9A 4NCGA 2QT7A 3E01A 3VVTA 3VALA 4CCHA 4C11B 2ILZA 5HVFA 1SH3A 5LJ3Y 3T9NA 2Q1LA 2JC0A 3MGJA 3MR6A 4FYYB 1XMQJ 3LAMA 2W1BA 3OVSA 3FBEA 1U25A 3D1HA 3HJFA 5A8RB 1XBWA 1VDHA 3TARA 3OTDA 3PJWA 2ZHBA 2HHQA 1A7GE 2E5IA 4G65A 5DM6Q 3BBFA 2CJXB 3GIMA 4ED3A 1FRKA 4ES2A 1VK3A 3DGPA 2NPFA 3Q8RB 3FCVA 1WHVA 2YX1A 3ENWA 3ZNUA 1KSPA 1NB7A 1JMTA 2V5HG 1J5EF 3W64A 2F65A 5AT1B 3F44A 2BABA 2OFGX 1PO6A 4ER8A 1DURA 2XYGB 3IN5A 1KVIA 4U7UK 2B43A 4LIRA 3R5BA 3D0GE 3EWGA 5F8HA 3KJFB 1D9AA 4B3OB 2DISA 4PXDA 1EP4B 2AIRB 4OYXA 3BQ2A 3K89A 2B9YA 2C3UA 4EUVA 2V8GA 2Y3YA 2W4PA 4TVAB 3AFGA 1VS3A 5HBMB 1LK7A 3SCJE 3TWZA 5EGYA 3MM9B 1VQ9S 4AYBD 3QFHA 4ETXA 5C25B 2RQMA 1MW7A 4ZP6A 3B54A 2NLWA 3BGRB 1NKBA 2KRBA 4DX8H 2G0IA 4AFFA 1BGXT 4IFYA 1FK9A 1VIOA 3FBFA 5K5MA 5I3PA 3VAIA 4DV6J 1S97A 1NAQA 4IQXA 2BE7D 1SH0A 4DR5F 5KFPA 3CVKA 4LSNA 2XS5A 1VBZA 5EWFA 2HPUA 3J7Z5 2EBGA 2FJAB 1VJQA 2M88A 5A6PA 3T5HA 1VLYA 4R0JA 2GO9A 4LF4F 2CDRB 5KFCA 1T9TA 3RG6A 2QFIA 1CULB 4LF6F 2DGOA 4P6QA 2W2MP 2ZVSA 1RTIB 3JSMA 1WORA 1RI7A 5D78A 4NPOA 4GKKJ 3N6NA 1XN9A 4NX9A 4TYAA 1E6YA 3C6UA 4JOUA 2HFZA 1TR0A 1S1XB 3KFWX 1FERA 4MT1A 1LWCB 4OHZA 1KQSR 3BREA 4ZLJA 3HVTA 2JWNA 4FXDA 3DLBA 5BYSA 4CT9A 1R7IA 5ETQA 4OQJA 4Y2AA 1K73T 2HNDA 2EC2A 2CYYA 3HHDA 1HNWF 3M05A 3MR2A 1HYSA 3QRQA 2KHCA 2VONA 2ACMA 2N7YA 3JSRA 1TL1A 2DNQA 1X9SA 4HT5A 4OYMA 3UR0A 1UVIA 1HBNB 1HNZJ 1UVJA 2ADCA 1V3SA 5DG8A 4Y2CA 1TV6B 1G3OA 3SMZA 3TUZC 4ATNA 1UTAA 3K5MA 3TJ9A 3ISNC 2EFPA 2QZ8A 4ED1A 2IAJB 1C1CA 3K5PA 2OPQA 1S1WB 3OL7A 4OI3A 4LFCJ 3C14B 3HM9A 1OO0B 5KFGA 5LL6d 4KGKA 1T11A 3N9UC 2XS7A 5A76A 4GVLA 4RR5A 3DLHA 1FKPB 3CD7A 3M2VA 4LQ9A 1Y9OA 2FLLA 3ZFVA 4TU9A 4YR2A 2XI3A 2QE5A 3DN9A 2AW0A 2ZZTA 1FTRA 2CQ2A 3Q86A 1PKUA 5DZ7A 2J6UA 1YJTA 4Q2MA 5I3UB 2P6TA 3H42A 3PY8A 2QA2A 4CLLA 3OR2A 2YWGA 1KDNA 2B7BB 2K3KA 2K06A 4RZRA 1ROFA 1Q53A 1RT1B 3DU6A 4WXOA 2WOMB 4O4GB 4M5KA 1TKZA 4UF4A 1FT8A 4Q0BA 1IKVB 4NI2B 2PFFB 2IHR1 5BXIA 1AUDA 3B6BA 4CO4A 2O66A 3NGTA 3SSRA 5BYRA 3CTRA 2V2VA 1R0CB 4CH1A 4EBEA 3CCWA 1OPIA 5ETLA 5F8JA 1ELOA 1HHSA 2Q3PA 4WWSA 1J5OB 3TRGA 3W3SA 5E3QA 5KG7A 4ZVTB 2E7VA 1YJNS 2E9ZA 4X4VA 2V4RA 4HACB 1LXNA 3ZZ0A 1RACB 1H2VZ 4TU7A 3BKFA 4ID5A 1FWKA 1Q4RA 3G6YA 2A6OA 1DTTA 5ETOA 5KG3A 2FUG9 3GJQB 4OX6A 3HXMA 2F7VA 3DDNA 2R8IA 3BO4A 1T7PA 3W60A 4CLYA 2A2DA 5L1JA 2VODA 4DUZJ 1D0EA 1M1HA 1U1OA 4ANDA 3J80Y 2KFNA 3CXCR 4J9UE 2E1PA 5KFEA 3SCIE 1TL7B 3LP0A 2VPZB 2W2OP 1CJUA 3QGHA 3U7JA 2JNJA 4ZVEA 1RAJA 1RLDA 4J91A 2W9BB 3GTYX 4NLWA 2B3TB 3BYRA 1NH8A 3QAUA 4ZPAA 1Y3KA 3M8RA 4L3NA 5EUHA 3BSOA 1PAEX 1QTNB 2GIFA 1HNVB 2V8VA 1TK8A 3V4IB 2IDEA 4M5MA 1DY3A 2FJDB 2HBQB 4DUYF 3QZ8A 3D3CJ 1GMWD 1S6PB 4WYLA 1UL3A 1XC9A 2PN6A 1TUGB 2GFFA 4HH0A 4LF5J 1BWVA 1VRUB 1RJJA 2HQFA 1LNQA 3QJJA 4WYWA 3B4DA 2HNYB 2CWXA 1N32J 2OSRA 3FMWA 3NGSA 2Z56B 3PG9A 1RT3B 3BQ1A 1WC4A 4MFBA 1NJXA 2DH7A 4B9MA 1UZDA 3M32A 3DKDA 4N8NA 5B0DA 2RU3A 1YQHA 4ZP9A 3MXHP 3CJ0A 1M90T 3GV7B 2GC8A 4HYKA 1KQKA 3CCES 2VOPA 1V9OA 4ZCIA 5KFAA 3TVYA 1HWKA 4DV0J 3PW2A 2K8GA 3VGUA 1U6ZA 2ZDPA 4IKAA 1HMVA 2UUAF 1SUQA 1W7WA 1N6QB 2CPYA 3FQLA 2DNRA 3ELHA 4WP9A 4H54A 3D6TB 4JI6F 4OZ2A 2VQEF 2V8PA 2K3IA 4WZMA 2BANA 3NBPB 3LUYA 1KEKA 3CC7S 4FBTA 3UN3A 4JI8F 1KP6A 3H4DA 1BQMB 3CWJA 2FDNA 3VV2B 3ZZRA 4A8QA 1NCLA 3ISZA 5B0AA 2V94A 3PZPA 1WHXA 4YB7A 1MN7A 1VRTA 4ZVSB 3K8WA 5IWAF 2KXHA 2VZ9A 3TZYA 4LF8F 3ETOA 3DLJA 2J5AA 2QA4S 5KG4A 2YX4A 3IR7B 3D6FB 3OVAA 3R5CA 3CF5Q 4WIIA 2CJKA 3OTBA 1RABB 3BZQA 4GC7A 4ZPWR 3P96A 2CFXA 2UXDF 2XCPA 2HMIB 1REVA 3BH7B 4RW7A 3W65A 3D1QA 1OPZA 3R1HA 3GYXB 3M6WA 1FESA 2AGPA 2E1MC 3UVJA 2I0XA 3QIPA 5T7LB 2IRXA 4ZPBA 3M7VA 1RWUA 3IMQJ 3WX4A 2DHAA 2B8QA 2HBYB 1CJTA 3L9ZA 2J0SD 4USUA 1TVRA 5E0OA 3GFXA 1G2EA 1Z1ZA 3GIRA 4W92B 4DHVA 3TAPA 4WTOB 2HK3A 4EEYA 1KBRA 4J9RA 3KLHB 2IA0A 2VBZA 3FDSA 3P3DA 2YNFB 3PX6A 4RNHA 2U2FA 1CJVB 4B9VA 3P5TL 3DOLB 4LQ3A 3KUHA 4JI4J 3BB5A 4OI6A 2R7OA 4PXCA 3UCZP 1ZA1B 1B64A 4F4YA 1NO8A 2W9AA 3ZZPA 2W9CB 3EUNA 1RTJA 4F4KA 3I4HX 4OHVA 2HIYA 3PIOQ 1PCAA 4ITSA 5KT3A 4K4ZA 1S9GA 3P49B 1U1MA 2OELA 2MQ8A 1S9FA 3N5BA 3MPWA 3C66A 2F5GA 3DU5A 3O8WA 3PJXA 3QYYA 4P10A 2JLFA 1K0TA 1Q8BA 3Q2TC 4QYZK 2RKIB 3J80U 2BE2A 3R2CJ 5H9EJ 1GTHA 3QATA 3MECA 2LQ9A 3Q8VA 1KVKA 2AJ2A 1W25A 2MZRA 4OHYA 4P75A 1BUXA 2QFJA 1PJ7A 1LWEA 4XIUA 2RAQA 3FGVA 1YGYA 5KFRA 2CA9A 3CDAA 1EARA 3PRBA 3RB6A 2E5LJ 2CQ4A 5HMZA 3PX0A 4PQUB 4W4MA 3QLHA 2DEJA 5AE2A 2MDAA 3FBCA 1HKAA 2MKHA 2F8EX 1IBMJ 2R7TA 3C15B 2FJEB 2A6MA 3CT9A 5KFUA 3CMQA 4K0KF 2ZM6F 1WACA 4JV1A 2UUWA 1X7VA 2RUSA 4IG3B 4F8RA 3DRPB 1NBEB 4KPYA 2D1CA 3E3XA 4OIXA 1HNIA 4OZ1A 2POKA 2CPEA 3ULHA 2VBWA 2W7PA 1T9YA 1JQGA 2I8EA 1SH2A 5J1PA 4A8XA 1WKJA 5KFXA 4JYAJ 3C16A 3DXSX 2VKZG 2PFDA 2RRAA 2FHKA 2Y1JA 2X1FA 5GADI 3RB4A 6FDRA 4EZ9A 1VRQC 4USHA 1A6LA 1IKXB 1SL1A 2GX8A 1PYOB 1NKEA 2B6AA 5JXSA 3CD5A 2K2PA 4CO1A 1V5IB 1HI0P 1QAJA 2GJIA 2ZKUA 1JK9B 1Q5YA 3CB4A 3NGKA 1XR7A 2CJAA 4HEA9 2LP4A 1XWLA 2HURA 4PWUA 2M7SA 5I42B 1I1GA 3G8SA 1LWFB 4ED2A 1S1UB 3BO2A 4DV1J 2D9OA 4OZ0A 2KKHA 2ALZA 2R3VA 2HVEA 4I6YA 3PJ9A 1U1PA 4CLSA 1CSJA 2YNHA 3MHYA 3KLFB 4IFVA 3T41A 4F7VA 2HWHA 5HP1B 2ZE2B 4NXMJ 2WVDA 3NOGA 4I2QB 1YRTA 4QJVA 2CQ1A 1N4LA 1Q16B 5F9LA 2D7SA 2MB0B 2HNZB 2M9KA 3CJQA 3MD3A 1PBAA 2R7VA 2B5JA 3HHLA 2JRSA 1WWHA 2FC8A 2HZCA 1U24A 1Y4ZB 3MZIA 3VAKA 5I4MA 3CJ8A 3QT5A 1GT8A 4RO0A 1SKRA 3I0RB 4LF9F 1NK0A 2ZC3A 1M5SA 5A8KB 1H3DA 1U2CA 1YRXA 3AT1B 3GJTB 2UVWA 3KLIA 3HP6A 3H5SA 4DFKA 4DV2J 3DNCA 1R0AA 4R5PB 1S0MA 3RBXA 1T03A 1OIAA 2HQ3A 4ZVUB 3IWXA 4DR1F 4EZ6A 5HQLA 4ILLA 3TQEA 3TP2A 1SJQA 1V3RA 4WKRA 1TKTA 4PR6A 2CXEA 5E3CA 4JI2J 1VMBA 1AFJA 1UFLA 4RW8A 5E41A 3NY0A 3CEDA 5A8RA 4U8YA 1BLUA 2E5GA 3R7NB 5F0UA 4YDXA 2ROEA 1JKHA 3H0PA 5EDWA 2LQ5A 4I67A 1C0TB 2LDYA 4DN9A 1IQZA 1RP5A 3DCAA 2RD5C 1SKWA 2LDIA 2ROPA 3TA1A 4PUOA 1FX2A 2BMBA 4YHHF 2J76E 2DKOB 2IM3A 2UU9J 3TUIC 4NE9C 2XMJA 4C0HA 2KVQE 3EE3A 3W9IA 5F0WA 4DL6A 3K5OA 3PYDA 1JJ2R 4EBDA 1N48A 4B3OA 1VK8A 3AXMA 2UUBF 2BW7A 2XSJB 2ZNYA 3O6QA 4B3TJ 1KKHA 2B4VA 3TEGA 3J7ZT 2XO6A 3WZ0A 1IBCB 3GFHA 2BXJA 4DFMA 1F2GA 4UTGA 1J2VA 1JJHA 2RF2B 2O3DA 2CJ9A 4CM2A 2HHUA 1QAXA 1U2FA 1BHNA 5KG6A 2ZUAA 5LXYA 3JTOA 4H4MB 1L3UA 4GVBA 4JP8A 2MPUA 2MTLA 3JAMY 5DLGA 1O5JA 3B4MA 1BQNA 3CDBA 2F9DA 1SC6A 2ATCB 4KHPJ 4MK8A 3I31A 3CJKA 3EPGA 5LMUF 2HVHA 2YQ3A 1NSKL 4KY3A 2IC3A 2HFSA 4GKJF 3TZWA 5ETRA 2CPHA 1YJ9S 2YKNB 2NUUG 2HFOA 3J81U 1SQGA 3DOKA 3ENAA 1F5CA 3OUYB 1S10A 1KS2A 4M5JA 4OMFG 4FVCA 2F4VJ 1RT2A 3BGUA 3QRRA 1CULA 4J37A 3V4MA 2Q6CA 4AXIA 2X3DA 3R5JB 4DV2F 5A2QY 3NNHA 1LW0A 3OTOF 1H98A 2UV8G 9ATCB 3DC2A 4ZVQB 5AE1A 3PTWA 2ASDA 3PXGa 3G4SS 1S1XA 5KG5A 3WX8A 2NZ4A 2WB1D 4X64F 4P73A 3LP1B 2QIFA 5D3GB 4PG7A 2VG6B 3M8YA 2Y8YA 4DR2J 4NLXA 4ETZA 1HWIA 2CVIA 1QM9A 5L1LA 4H4OB 4PPDA 3IAM9 5L1IA 1M1KT 1WHWA 5AJ3F 4DLEA 1N56A 2C2ZB 3I9ZA 1HBNA 2WRMA 1IR2A 3PR5B 2GCFA 5A0YB 2NYIA 2KFZA 3KJVB 3HSZA 4IDKA 1TV6A 1SKUB 3GR0A 1EKSA 1U47A 2RB7A 1S1WA 2MJNA 1RAOA 4B3MJ 4L74A 5IQ6A 1Q0NA 2MKSA 4I7FA 3C14A 4EFAC 4DX6A 2XLIA 2H4YB 1V3ZA 2O67A 3VZIA 3MM5B 2RRNA 5KTQA 3EZ5A 4WFBQ 2R7SA 1N52B 3MPDA 5KFVA 5CABA 2RILA 2APOA 1FE4A 1QY7A 4CP5A 5GAHU 3ZZZA 1GMVA 3PRDA 1XEZA 2D3UA 3HVRA 4OFZA 3CCMS 1KFDA 2QGFB 1WDTA 5F3ZA 3OFHA 5LT5A 1FJGF 3CCZA 1UJ5A 4EGLA 4HTJA 4U7UD 4M5DB 4QIEA 4MIWA 2Z2YB 4GO5X 5I3UA 3G82B 1BWEA 4X66F 4EWTA 2BUNA 1HWUA 1GFWB 1BE4A 2CQCA 2JEJA 4K7QA 2XZDB 4CNZA 2ATLA 1CQMA 3I5BA 1ZA2B 4DV4J 4J9KA 4X2BA 2O01C 1IM4A 1UEVA 2WSEC 2V2KA 1IKVA 3T9ZA 4NI2A 4RW9B 3MOJB 2F9JA 1PAUB 4OLOA 3IO1A 2DNKA 3E01B 4C7QA 3FRZA 3HFKA 1T9XA 1JNRB 2C3OA 4B3SF 4DR7J 2CADA 2XMWA 2Y1RI 1JLBA 2C2RA 2R42A 3TA2A 5KOWA 2FVSA 3CSKA 3GJSB 5HN0A 2R2TA 4CQ1A 2RT3A 2QSWA 3GE9A 4O3PA 3CULA 5DQHA 5M2PA 1SJFA 2LXFA 3H5UA 1KTVA 4DG1A 5HVHA 2JOQA 1N0UA 3DGPB 5D0GA 2VA2A 1UW4A 2FB0A 2VFTA 3DLLQ 3UDEA 3DM2A 4AUKA 2GAHC 1B4SA 4JV0A 1TFWA 1GAOA 4A8YA 2PA8D 3M9MB 3MURP 4NXNJ 2BQ3A 5CYQB 5FLXU 1FFGB 1PC5A 2V67A 4AQYJ 4CZCA 3V4IA 1MMNA 2EKNA 4OX9F 1KOHA 4D3GA 3Q22A 4QZVB 5C2GA 2JC1A 2Z58B 4CH7A 1S6PA 1HHTP 5GMDA 2V9KA 3W7BA 3OSNA 2LQJA 5CYMB 1H74A 1RYRA 1VRUA 2IM0A 4DZDA 4CTAA 4OZJA 1UVNA 1KVJA 3NL0A 2HNYA 3MM6B 4KPCA 1U45A 3ZZUA 1G6BA 1TL4A 5KFHA 1LW2A 1KHWA 1RTZA 3KUGA 1FK9B 3WIUA 1HQEB 2YPZA 4X4PA 1S7HA 4PCQA 1HQ2A 4LUBA 3LWMA 2MHNA 2E66A 1RA7A 4ZCLA 3I0SA 2WVEA 1YSJA 3ZTSA 1L3VA 4Q7AA 5KFSA 2HFNA 2VHGA 2EW9A 4ILMA 5A2QU 2K1RA 2E1RA 4URQU 4QIGA 2RS2A 4G3IA 5DDPC 2DIUA 2FJVA 1YJRA 4JUZA 3KDOA 3H2VE 1GX5A 2BKPA 4NLOA 4RPFA 4ZDNA 1VGYA 4ZJLA 2BW2A 1KLMB 4DR6J 1D1UA 3KXDA 1BD6A 1FJ7A 3DRYA 3V5RA 4QWCA 1WI6A 3NBPA 2EG2A 3BR8A 5CHCB 3MFIA 2OO4A 4HHJA 4QOTA 3V81A 3UW1A 1OYEA 4TKTA 1WSVA 4LBIA 2YNGA 1E6YB 5D6GA 4ED4A 3C6UB 1B0TA 5D15A 4IG0A 3X3UA 1DTQA 1JLFA 3DI6B 3MM8A 5KFKA 4ZHRA 2KT3A 2C3PA 4RW4A 2GNKA 2HQCA 3BS9A 1F6TA 2HNDB 5A8WA 1NB2A 3EZUA 1HPZB 4NYOA 1HYSB 1RISA 3R6LB 2RHSB 2MY7A 4OZ3A 3H4BA 3FZ2A 2DK2A 4L72B 3C19A 2W7OA 3LOUA 2NYHA 5HAOA 4DPTA 4KT0C 1NK7A 1U48A 4Q8EA 4CO5A 4O0NA 4ZOSA 2DNHA 1SIZA 1VC0A 2EC0A 3I96A 3HJVA 2CRLA 3RZAA 1C1CB 4URGA 4QQBA 2CWKA 2ZZNA 4M5IA 4P2MA 1CS4A 2VC0A 3H2LA 4DUTA 1TL5A 3PYFA 5K8OA 3GSDA 1RBOB 4DR3F 2YNFA 5J1EA 2JJ4D 3M2VB 4GO7X 3TQ1A 3B8HA 4AXJA 2DXEA 2VJUA 1CJVA 3K57A 3MMCB 2CPXA 3KJNB 4LVNP 2JX2A 3SBMA 1G4CA 1X4FA 3TNVA 1VI7A 2PI4A 3W2WB 1ICEB 2OI2A 3IRXB 2W9CA 1OYDA 2ZBCA 4DS4A 2C2EA 1EX8A 4G1QA 5F9NA 4CNYA 3Q8QB 1S6QA 3OFEA 3QIDA 4JV5J 3HHNB 3POTA 2E29A 4ALZA 4IH5A 4C4WA 1WKKA 5IT4A 4Q0BB 2ZOGA 3D0IE 1SCJB 2MHEA 1NPPA 1FCAA 1N5QA 1M1GA 2Z0GA 2ZZMA 5LJ5Y 2NXEA 4O0IA 1KD1T 4OJ3A 1XMBA 4KB7A 4K4YA 4YDDB 3H2UB 4W98A 2F4FA 5L9NA 1HD0A 1Q8IA 1HWLA 1A9NB 3F73A 2VUGA 4ID5B 1FEEA 2GIQA 1N33J 2E9TA 5E3RA 1DTTB 2OHDA 3GV8B 4MK7A 3CGIA 3IM9A 5L39A 3HI9A 4D3HA 3QSYB 4F0KA 3UCGA 1F2HA 3VF0B 3NOCA 5ITHA 3UFCX 4ZN3A 4CLFA 1OS5A 3LP0B 2CUYA 4EO8A 2FVQA 1V6HA 3HMJG 1NK9A 4M95A 4NOHA 4Y0FA 2A10A 4IG3A 2V4JB 2H5IB 4USVA 2F1FA 3MEEA 3CJSA 1R0BG 1XERA 5HJXA 3C6TB 5C2CA 4JI5F 6AT1B 4ED7A 3MEGA 4PG5A 2BEFA 1FKOA 4RL1A 1B0VA 1EQMA 1WUUA 3SIPB 3PKMA 2KTQA 2BJ8A 3Q23A 3X1LB 2YNIA 1W2BR 3U1MA 1D9FA 3EPIA 5KT7A 1WF2A 3LANA 2F63A 4ZLNA 2AGOA 1IKXA 3C46A 2M70A 1WEXA 3VGSA 1RWPB 4ILRA 4WCEQ 4FKYA 3BPSP 5F8MA 2XNQA 1B70B 2HRYA 2V63A 3M32B 4DV5F 1N5VA 1YBTA 5M2UA 2HHHF 3BF4A 1LOUA 1VFJA 2Y0BB 1NHKL 2CAJA 2G9OA 4FF4A 4ECXA 2OPSA 3QGPA 4RU9A 2C2NA 4LRBA 1YIJS 2DYAA 5I42A 1HMVB 1SUQB 4RKUC 1IM6A 1VOMA 2AX0A 3J7YU 1U1QA 1EJ7L 3LH2S 3EM1A 2DGVA 1FO1A 5B0BA 3N0VA 1RA6A 2HW3A 2KDOA 3TANA 1RADB 2BANB 1PGZA 5H9FJ 4H4KA 2X1AA 2P5VA 2J0XA 5DJBA 5H1SV 4KQZA 4HHHA 3OT9A 3MAHA 2ZBRA 4I2QA 5D77A 2L9NA 2V50A 2HNZA 3HPOA 2DRBA 4NLTA 1ZAXA 1VRTB 1ZOTA 2PD1A 3KNGA 4U67Q 3V6DA 2Z4PA 1VQMS 1RZMA 4YY3F 1F3FA 5IQQA 4CT8A 2KXFA 1U1KA 3R7BB 4FPRA 1KQGB 2YXLA 5BYQA 3R5AA 2B9XA 3N79A 2CG4A 3KK1A 2R9LA 1WG4A 5GAEU 3RBZA 2VD3A 4CYUA 5A8KA 1KWMA 2YKAA 1REVB 2H4WB 2QG9B 4ANEA 1Q7LB 4QCLA 4RW7B 4YR3A 3E51A 2IBOA 2JEFA 1X4CA 3R5GA 1HR0J 1ZAWA 4DSIA 1RU2A 4B3RJ 3QIPB 4IRKA 3PO5A 3KMSA 4WFXA 1Y0HA 2DXFA 3CO0P 1X5OA 3GIIA 2GMLA 4H4KC 1TVRB 3HVAA 4P71A 5B0CA 4DV3J 1F9HA 1S6UA 1PJ5A 2OEKA 1X4GA 4DQSA 1UFWA 1XMOF 3JSBA 1UPPA 4CI0B 2FVCA 3MMBB 4E2FB 1H7XA 1T9UA 5K8PA 4OI1A 4LFAF 3ET6A 3CCSS 4KTQA 1S76D 4KJIA 2NREA 1N34J 3OL6A 2R8GA 3LWLA 4KGMA 2DD8S 4LR7A 3BM7A 5HMYA 1FHTA 3MUMP 2P2CB 2V8DA 1RTJB 4I2PA 3R7SB 4JI0J 2VA3A 3K59A 3G8TA 1UWAA 4I56A 1S9GB 1I94F 3MPVA 3MMJA 2UXCJ 3GB0A 1YITS 3M8ZA 1RK8A 1HW8A 2VG7A 2XSJA 4HI2A 5KFJA 4RNFA 1L3KA 3CJTA 1WI8A 5MLCV 4OYAA 3RU0A 1R43A 2C3MA 5LXRA 1T05B 3T1HF 1MMDA 2KVIA 3DRRA 2Q79A 3BEGB 4ECTA 4HL9A 2VB6A 4QWDA 3P45B 1SJ4P 1ITPA 2GV1A 3AH6A 3NG8A 4HH1A 4K2JA 5IS2A 1NJWA 1S4FA 2A2CA 3L09A 2I9SA 2ASLA 3MECB 1ZBTA 4DEZA 2U1AA 4H4MA 4WP3A 4HDHA 4M94A 3RYLA 3GV5B 2ZBIA 1LWEB 4DWIA 1FDAA 4K4VA 1MU2B 3TO8A 1XR5A 3KLGB 4ZVHA 4F3MA 3QLHB 1TK0A 4TLQA 1AB8A 1H0HB 3TEHB 2BV3A 4FBUA 2QL5B 1IKWA 1NDPA 2HHVA 3OUYA 2QSFA 2MKYA 2QLXA 1TMMA 3FJ2A 4DL7A 3TX8A 5KFNA 2XY5A 3FCWA 2X51A 3G6XA 3F41A 2CPIA 5K9FA 5C7PA 1HNIB 4J9QA 4X65F 4TU8A 1S1TB 1K9MT 3IGVA 5KFOA 2ZITA 4B9LA 1Q78A 4F67A 4ZP7A 1S99A 1AA1B 5D3GA 2KI2A 1D9DA 2KB2A 1WC6A 2UUCF 2DGTA 3VAJA 4J9LA 4DI6A 2XY7A 3NNCA 1RU1A 2B6AB 3P8BB 5KAKA 4H4OA 1F1BB 3DYAA 3NS5A 1X9MA 1XK8A 2BZ2A 5KT2A 4I4BA 2HGMA 2CNNB 2QA1A 3TUJC 2C2KB 1U09A 3LPEA 4DF8A 5BJRA 4FPIA 3CMES 2CZ9A 1DAXA 4LF7J 5A0YA 4C2MA 2RH3A 3M6UA 3RUBL 2KH9A 2CPJA 1NDCA 1T0TV 1FDDA 5DGBA 4O3QA 2CNKB 2JZ5A 1VQ4S 5HJYA 4F02A 4ZCKA 1DQ9A 1RGVA 1QSLA 3ZTQA 2H54B 1T9VA 4A8KA 4JI7J 3MM5A 2UXBJ 1RHJB 3NP5A 1IBLJ 3EX7B 2BBEA 3HULA 1PYSB 1RWWB 1T9WA 3KYLA 1AXQA 3AD8C 2XMMA 1WDDA 1FRIA 4I68A 1XNRJ 4CLTA 1SL2A 3V2UC 3JTPA 2BX6A 2N82B 2B5JB 3RRHA 4KR0B 2BVZA 3QSIA 3HHLB 2QC3A 1NM2A 2HGNA 4KHMA 5H9EK 1JB0C 4NLGA 4M5DA 1S72S 1S4EA 2BQUA 2NXNA 1IR1A 5E3PA 2MSTA 1X4AA 2XBPA 2V6AA 2W01A 4C6AA 3T19A 2XHWA 1R0AB 5DDQC 4RNNA 3VR1A 2VPXB 2VFSA 3GP9A 3AXKA 4WFZA 5KFMA 1ZM3A 1FTCA 4QR2A 2E44A 4Q44A 4IR9A 2MZSA 3THTA 5ETNA 3EXCX 4DL4A 1N8RT 5JJBA 5DQIA 2XMVA 3CPWR 1TKTB 1YTYA 3I55S 3HSJA 3UDLA 4EI2A 1GXUA 1HNXJ 4RW8B 2J9DA 2DTJA 1GXLA 3MCOA 3SV4A 1JKHB 1NMEB 3VAGA 1UETA 2A3JA 1N5YB 5F41A 2GHWA 1FVQA 4Y2MA 2HHXA 3MD1A 4OHWA 3T6JA 1HARA 3W63A 1RUSA 1MLAA 3KUEA 3SEOA 1VBXA 4C8MA 4PUOB 3KK2A 4K4UA 4OZ5A 4C0BA 4L75A 2J6SA 2YWHA 1U2RA 3R3TA 2FHJA 3CW2C 3UQSA 4LJMA 2BKOA 5KT5A 3L7OA 1Q86T 1TKDA 1B7FA 2HBZB 2Z2ZA 4OI4A 5DETA 4W90B 4QWBA 5CYQA 2IRUA 5DM7Q 2AGQA 3MF5A 1RE1B 2FJXA 3O2IA 3SCKE 5T41A 3RBEA 2OUGA 1UA1A 2LXUA 4BS2A 2MXYA 1VHFA 2ZH1A 2DXDA 5AXKA 2J7UA 2VPWB 4X62F 2DRAA 3KMQA 2MKJA 1FRXA 1XNQJ 2CQIA 5CYMA 1M0SA 2AD9A 2KG0A 1ZH5A 3OXLA 3QJPA 4DPYA 3MM6A 3T5JA 3MM7A 2I1RA 2FGOA 2F8MA 2BRLA 4M63A 3GJRB 1NSPA 3ZZTA 1HQEA 1Q8KA 4GVBB 4JI1F 1IBKJ 2HFVA 1CQNA 1BQNB 4N41A 1YJVA 1YJWS 3BDEA 4OYPA 2PA3A 2QEXS 4F36A 2CNOB 2X1BA 1N36F 3CJKB 3I56S 1NPRA 2AEMA 2IC3B 3NCQA 2CQPA 4XPEA 4J90A 3ENQA 1SXLA 5ETPA 2FLNA 4DSEA 2GO8A 5KFYA 2UVUA 2MKCA 3LO3A 3LAKA 3CCTA 1KLMA 3PACA 3DOKB 3EICA 4IH7A 3AB2B 3GLJA 2DHXA 2IYIA 3Q8PB 1UA0A 1TELA 1JLEA 2QRRA 3US5A 1FRLA 1RT2B 2OTLS 4LF1A 4IRCA 3A13A 4Y3CA 4DR4F 3D28A 4ECYA 2Z57B 4UOFA 2W4CA 1LW0B 2L48A 5J2QA 3GSIA 3OTEA 3RBDA 4UOHA 3KG1A 2UVVA 4ICLA 1I6JA 3DI6A 2MZTA 1NK4A 2VG5A 3TZZA 1RAGB 2JEIA 2ZH7A 2QMXA 2RDIA 1XMQF 1Y7PA 2GZOA 3HDSA 3CDWA 7FD1A 2ZWPA 1DHMA 3T1YJ 4BBYA 2BJ1A 1S48A 4CWBA 1HPZA 2YTCA 1AUSL 2N7CA 5KT4A 2R7WA 3BGOP 4QIWD 1HD1A 2JH3A 3A8IA 3GIKA 2DO0A 2XGPA 8RUCA 4RU2A 2ROGA 3H25A 1SIWB 1VQPS 4C8LA 2WW8A 4BLGA 3RB3A 3NCRA 4IDKB 1TL3A 2MGZA 3EVMA 3IWLA 4A8SA 1FKAF 2L41A 2LVWA 5HO4A 3GCXP 4CM0A 1BMQB 5J2PA 3IBCB 3OFGA 3EJMA 3IWNC 1FD2A 2D9PA 4I7FB 5FJ4A 4M1KA 1FWLA 3JSYA 4USMA 4X4UA 2EI5A 4XO0A 1OY6A 3QPIA 3MPUB 4DL3A 4QU7A 2KM8B 3MI7X 2GQ2A 1U0HA 3MMCA 2BM1A 2HG4A 1MN9A 3BH6B 7FDRA 3NGUA 3K58A 3M9NB 1Q82T 4E0DA 1EZZB 5DGAA 3W2WA 3OW2R 4IO1A 4QBUA 1PIEA 4DPWA 2W24A 2DITA 2WONA 3IRXA 1KTQA 2EVZA 2WK4A 2VBYA 3R27A 4WBFA 5IFMA 4LIWA 4ENOA 2JVRA 2J9EA 3DXBA 1Z2LA 4DV6F 3EVOA 2MSSA 1HL6A 2LFVA 4UT4A 2BE9B 2LEBA 2ZHAA 5IT0A 2HEKA 3AOCA 4Z7CA 2X1GA 3GG0A 2DGSA 1N5TA 3PYGA 2AYBA 5KFFA 1SJ3P 3D68A 4QIFA 4N56A 2YWKA 2LMIA 1GH8A 1VR6A 1YWXA 1JLBB 4JI3J 1R8BA 2MQNA 3I9V9 2GJ2A 3AA9A 4B02A 4MKVA 4HT7A 2JEGA 2BYCA 2IMOA 3GFYA 2FGCA 2MLXA 3FRYA 2M8DB 5B0GA 4GKKF 1QAYA 1Y00A 2AYEA 2OH2A 4ECWA 1RBLA 3KG0A 4DG1B 5IM0A 3DMJB 1ZM9A 3Q24A 3KG4A 1GK8A 3NCPA 4DPXA 4FYXB 2MQOA 2MLYA 3BSAA 5KFBA 2XNRA 3FSIA 2DNYA 4YMEA 3DM2B 2EFQA 4NLRA 4YR0A 2NPIA 4BDPA 2LU2A 2W4DA 4K4XA 1MNEA 2V4JA 2LU1A 4XK8C 4DSJA 1O0PA 1WNEA 3VVUA 1JJCB 2E1AA 1NU4A 3HX9A 4DPUA 5C24B 1R27B 1R8AA 4Y34A 3C6TA 2VC1A 2PIIA 1HNZF 4NLUA 1FRMA 3RRGA 1U0SA 1PJ6A 2ERRA 3WQPA 5CZVA 3KHRA 3BR9A 1AW0A 2WB4A 4CTAB 2HQDA 3OLBA 1TMJA 3AOAA 2DO4A 3IA0A 1JJ4A 4K50A 2HHPA 1LW2B 4LFCF 5CYJA 4WU2A 4UQTA 1QDUB 4ZA1A 1F9EB 3NNAA 5DG9A 1Y5LB 4L3KA 4F3OA 2PI5A 3I0SB 1RQ0A 4QW9A 1ZM4A 2K1RB 1P6TA 2A0FB 2OMOA 4F2SA 3OJUA 2WVBA 2CNLB 3DRSA 2VQFJ 4A46A 4JB8B 1S9EB 2XGQA 4PQAA 3K17A 4ZK7M 4R8UB 5C42A 1VIXA 2ZOMA 2XEXA 2OIHA 4KO0B 3GPAA 2OPRA 2WVCA 4IYQA 2CQBA 2IVFB 1JLAB 2G2YA 1WTBA 3CUNA 3TUPA 3V81B 2R7UA 2MKIA 3MEDA 2JVOA 2YNGB 1B7YB 2ZFHA 3H40A 3TJAA 4U9RA 2AJ1A 5LMNJ 4IG0B 1DTQB 4AL6A 1HI1A 4OV1A 2PT0A 5HLFB 1JLFB 3PFEA 3MM8B 4TY8A 2HZAA 1SI9A 1L5UA 3PFOA 4KKOB 2NXJA 4ZHRB 3MCSA 4GC6A 4RW4B 1RT7B 2R4FA 3S01A 4U95A 1GNKA 5IC6B 1WKLA 1AFIA 5A8WB 2R2SA 3FFIA 2XLJA 2MYFA 3BV8A 3O5TB 4DV7J 4IQMA 3OJSA 1U7LA 3H90A 2KZZA 5HVGA 3CJ3A 1RWKB 3L7PA 3PEHA 5IOLA 4USWA 4DU8A 2RUGA 4X4OA 2BR0A 4DUZF 2QYCA 2ZOFA 2DB1A 2ALYB 2G1DA 5FDLA 2C2DA 3BN4A 3MEKA 2YX7A 4TN2A 2CQDA 3A3PB 2W2NP 1PILA 1CS4B 4WKYA 1NK8A 4RUAA 3MMAB 5M2RA 5DRKA 2VU5A 2IFXA 3MMBA 4BWJA 4PABA 3KWMA 2MZQA 3JQMA 2CQ3A 1JLGA 1IXKA 5J1EB 3AY0A 4LR9A 5CCMA 4MMOA 1HQUA 2DNLA 2IRYA 1I51B 3HHLD 3D4JA 3WC0A 2QLFB 4CLKA 1E6VA 5E5NA 3RAXA 4LF5F 1HHQA 4K4TA 1HLWA 1RSCA 2CQGA 4NCAA 5BR8J 3GR1A 1LV5A 4TYBA 4CDIA 1N32F 1YK9A 3PHEA 3NLCA 1QD1A 2LQBA 4G1QB 1DLOB 2P8IA 1RHMB 1S6QB 3POTB 2D69A 2JLEA 4FNHA 3G87A 1CC8A 2EBEA 4Q5VA 1T3NA 4LRDA 1FNOA 4C98A 2XS2A 3C3LA 1IWGA 1PC4A 1T05A 4DV0F 1P1LA 4IOAQ 2DEIA 4DQIA 3AJ1A 2LECA 1KN6A 1M5PC 4N5SA 2CKWA 1D3WA 4ZITA 4ZPVR 3M2RA 1A0OB 1VC6A 3K0JA 2ZJQQ 2QV6A 3PKYA 1K1SA 3ZC4A 2DGUA 2GJFA 1S6OA 3ITHA 2GVZB 3PCOB 4MH8A 2YKOA 2VKRA 2JFKA 1MU2A 2JDJA 1MWQA 3KLGA 3G86A 3T6BA 3VWSA 1J5EJ 3MCMA 1FDBA 1F60B 3FKBA 2FVPA 4YEAA 4OX7A 3S7RA 1LQ9A 5F8IA 2B56A 3ILIA 1TTHB 3SCLE 3J81j 4X4QA 1SBRA 1OSCA 5E2QA 3DOMA 5IC4B 3BSCA 1C1BB 3TAMB 5AXLA 2M52A 2FHOB 2DNMA 4F4XA 3B82A 4LR8A 2R7XA 4HR2A 2EFOA 3MEEB 2OLWA 4IOBA 1AYEA 5IT9U 4UY85 1S1TA 4HTIA 5AE3A 3SFUA 2FJWA 4FF2A 2ASYA 4U96A 3MEGB 4BC9A 1ZTWA 2YWWA 1EB0A 1FKOB 2QJ3A 2DGWA 3J81Y 3CCJS 3TOQA 2CJQA 2YNIB 2RS8A 4ZVGA 3CDEA 3C8YA 1RT5A 2B0GA 1MROA 1BY9A 4ZLPA 2PEBA 1C4AA 1VCTA 4P7TA 2GVDB 2B4OA 4UZCA 2XG8A 4I1TA 4DU7A 1M5OC 1H72C 3LP2B 3WHIA 1XIQA 4A8OA 2AV5A 4X4RA 2V2QA 4DR5J 3CE8A 3LW5C 4RUCA 3EDRB 4UOGA 5GAHI 2OPSB 3TVKA 3PO4A 1UP1A 2RU9A 1HBUA 4JI4F 2KL8A 4IH6A 3QNWB 5HROA 4Y28C 2DNPA 2DR5A 1QVFR 2QO3A 3OHAA 1EKRA 4R0EA 1RWXB 4LF2A 2DPIA 4NZ0A 4LF4J 3QAEA 1QTMA 5HK4A 4LF6J 2JSXA 3QBCA 3I82A 3AB4B 2VOOA 1N54B 4C8OA 3HZEA 3D6MB 3CO9A 1SKSA 1UPMB 2EK1A 2J8SA 3HK2A 3HLUA 3GONA 4A8FA 2FY8A 4WU3A 4YQWA 1T02A 1AROP 3SQOP 1P1TA 3M8WA 4ED0A 3KOAA 1UVMA 2PO4A 2QL7B 3PRVA 3V6DB 2AWZA 1HNWJ 2OD6A 2JLGA 3QMQA 7AT1B 4QR1A 4K5RA 2BJ7A 3R8YA 1HIYA 2XMKA 4B9TA 4C97A 2FZKB 2VBXA 4DL0C 3KK1B 4KV8B 5HMWA 4KC5A 5ADZA 4CYUB 2H9ZA 5C5JA 5JVGQ 2AYGA 4LREA 3H59A 4KFBA 1GMUA 3TAQA 1WC3A 1TZ0A 3RW7A 1JX4A 2E5LF 2WW4A 2XYHB 3VCDA 1RAIB 2GQQA 1ZZNA 2F40A 5KFIA 2BQRA 4C0OC 5SZTA 4J9PA 1IBMF 2KHDA 2WTFA 4RUBA 5LSLA 1UJ4A 3R5DA 4OI2A 3E8OA 4ECSA 1OY9A 1QAIA 4TQRA 1YX2A 2PGCA 1WG1A 3Q2SC 3SZ2A 4O23A 2XMAA 3LPYA 4YP3A 2W8LA 4ES3A 3ZTOA 1X5SA 1N5YA 1WSRA 5JMNA 2RMLA 3ET6B 4NLQA 3HHLC 2H65B 1SQFA 1FXRA 3SSQA 1W2IA 3G2XA 4JYAF 4QWEA 1FXDA 3NEKA 3NWRA 4ELTA 2QTWA 4NL5A 1RAAB 2NR0A 4NRTA 4QR0A 1WG5A 4A4JA 4I2PB 3L95X 1EAYC 5ETSA 4KGVB 2ZUGA 3FUYA 4Q45A 3GYGA 2VG7B 2KJWA 4FYDA 2XZTB 3T5KA 4O4RA 3RTVA 1X31C 3OTCA 2M5YA 2BRKA 2E5JA 1TU0B 2HRTA 2XSFA 2O1PA 3S8SA 1YZ7A 2GMJA 3DRRB 2QL9B 5J2NA 1H38A 1LKZA 4FNIA 2YKMB 4RJVA 2KJVA 3RRKA 4DDFA 1NDLA 5THWA 4DV1F 2GGPA 2IM2A 4OV6A 5D0RA 5H9FK 5FLXY 1X60A 2ZKTA 1L3SA 4LSLA 4DSLA 3LGMA 1RTHA 2GAGC 3G96A 4I6AA 4F25A 1S1VA 3M8PA 4NMLA 1UKUA 4NXMF 3K8VA 4FDFA 3OHBA 2WSCC 4NASA 3CCUS 2DY1A 1QLNA 3DLEA 2XHCA 2IA6A 3THPA 3EDQB 1IJEB 5LSOA 3O44A 1U1NA 4I0WA 3OL9A 2F8HA 2V69A 1Q95G 1IKWB 5DDRC 3AA8A 5G0RA 3FEZA 4Z2XA 3BN7A 1LK5A 3D0HE 5J2MA 1U1RA 3FSYA 4DUYJ 1U6FA 5HANA 3EGZA 1P9QC 4ELUA 2AHOB 1CG2A 2Z30B 2BKNA 4LRCA 2N3OA 1YLXA 3JXOA 4K4SA 2A1BA 2I38A 1TUWA 2XMUA 2RQKA 5KFTA 3H8YA 4JI2F 2Y0SD 2FZGB 3MTKA 2LQ8A 3UDCA 4IOCQ 1PYTA 4TQSA 4RNMA 2RHQB 2HKEA 4DL2A 3DYAB 2RDJA 3KTQA 3GMGA 2EWHA 1DZ5A 2UUAJ 5CH7B 3HSDA 2ZH3A 4FVMA 2N4DA 1U26A 4JI6J 1C0UA 2VQEJ 4MIAA 1CJKB 3SXLA 3ICLA 1CVJA 5K8MA 3UD4P 3GILA 3HHKA 4X4SA 2UU9F 4CLPA 1UWBB 4JI8J 3SYZA 4FS2A 3D67A 5DDOC 2H5JB 1UJ6A 2XC9A 3MWBA 4LT6A 1W26A 3VGTA 3TX0A 4QWAA 2BM0A 4TXSA 3W8PA 1YHQS 3SI8A 4V19J 1FFWB 4B3TF 5IWAJ 4LF8J 2E7XA 3V6JA 1ZTTA 2VL1A 1OWXA 4DLGA 1U8WA 3ZO7A 3JYTA 4O44A 1YVFA 1SV5B 2L08A 5E7OB 2DNZA 1VQKS 3IR6B 3O3LA 3ONQA 1K0VA 2MLZA 3G9CA 2UXDJ 3PYEA 3PIPQ 4Y2IA 3MUVP 2KRRA 2XQCA 4WTYA 4O3OA 2NXUA 1RAEB 2AEFA 3K5LA 1IQTA 2AJFE 2ZH4A 5IXUA 4KHPF 1RCXB 2G0CA 1S49A 1VQNS 2O5DA 2XO7A 4USJC 4OYZA 2LA4A 2IJRA 3OD2A 2IY5B 3GIJA 3TYTA 3VGVA 3UN5A 4ZJOA 2M4MA 3G6ES 2CQHA 3IM8A 2OAUA 4U8VA 4FP9A 3VAFA 1FRJA 1S12A 3OSPA 2W2QP 2KM8C 2F4VF 2DHSA 2Y8WA 1T94A 3DHXA 1NKCA 4QU6A 2I2YA 3KHHA 1JIHA 3JS9A 1JLCA 1BQXA 3Q89A 1IR0A 4KHRA 3JB9k 2XYPB 3AD7C 3CNQP 4RBVA 2AU0A 1R8HA 3DMJA 4A47A 4PG4A 3NAIA 3IFEA 1Z4UA 2DCLA 4ES1A 4KH0B 4URSA 2WCXA 3KK2B 3VZHA 2FZCB 1B99A 3QT6A 3BYPA 1FA0A 4FYVB 1VQLS 4DR2F 2CJBA 4HI1A 2HQGA 2NCKL 2JFDA 2WZ1A 1NZ8A 5KOXA 2RNEA 2OFHX 1RTDA 5C24A 9RUBA 1IUJA 3M2UB 4USKA 1P27B 2VPYB 3KLEB 4B9NA 1UMJA 4C3KA 4LBPA 3LALA 6FD1A 3P5BP 2FLPA 4ZP8A 4DQQA 4OJHA 5HSPA 2QMUB 2PDAA 2HQIA 4B3MF 3G8QA 5ETKA 1DQAA 5B0EA 3J7YI 1X4DA 2YWEA 3MM7B 3W8GA 2KG1A 2YY3A 4N77A 2MZJA 1UAWA 5CD4A 2FYXA 3VAHA 1X8DA 1FFSB 1RB0A 3FEYB 3L4BC 3UNYA 2LEAA 1UVLA 3RJMB 4U6PA 4ZPDA 2ZD1A 3BQ0A 3CJ2A 2VFUA 1KNZA 1XTZA 3NMAA 3OFFA 4EYHB 4K0KJ 2ZM6J 1FJCA 3GQCA 2K7JA 1S9EA 3F56A 3M30B 5D4LA 1QJHA 1TKXA 4R8UA 3WDOA 4NA1A 4OL8A 2I5JB 5HMXA 4KO0A 3V6KA 4MKBA 3QWPA 1GXTA 1JLEB 3HFVA 3HFZB 2KYXA 1RKIA 5GAEI 2HYIB 2MQPA 1ZS6A 3CJRA 4ECUA 4PWDB 1JLAA 1OSDA 8ATCB 3SDEA 2IIHA 4DV4F 3QWUA 5J2QB 1I5OB 4OZLA 3TW0A 3OLAA 2PMZD 4ICLB 4UQGA 5HLFA 3DHWC 2ZH9A 2GMHA 3QO9B 2BA9A 2VG5B 2EPIA 4KKOA 3KHGA 4DR7F 5D0HA 2CPDA 4C48A 1RT7A 4OZNA 3H7HB 3UNGC 1S5ZA 5CAAA 2X3GA 4NLYA 4EYIB 2BOPA 1RLCL 3A8KA 3VQSA 1D09B 3S6EA 3THVA 3MDFA 3W5XA 2XZWA 2XTJP 2GHPA 1KFSA 3MR5A 2KU7A 4ECZA 4FXVA 2HHTA 2C3YA 1F3VA 4LMZA 2XB2D 2DBBA 1TAQA 4RW6A 3IXQA 1QUVA 4DL5A 1TL3B 2MGZB 1WF1A 1RWOB 4MK9A 2FJBB 1J27A 4QIVA 3FMBA 2ADBA 4L6V3 4ZS6A 5ETMA 2DR7A 1Q81T 2R8KA 3IC1A 5J2PB 2RE1A 3W61A 2UP1A 3HZGA 3BKUA 3V6HA 3IG1A 2P9GA 3MMAA 4B9SA 3KK3A 1X0FA 5CXTA 2BACA 4NXNF 1HBOA 4CO2A 4YB6A 1NRKA 4DMZA 2HRUA 4AQYF 3H20A 3HO1A 4RUHA 2DNGA 4WZQA 1OMSA 1GMWA 2R7RA 4FKXA 5DO2A 1WEZA 3D2WA 4MIBA 5K14A 1U0HB 1L3TA 5HATA 4TNOA 2KXNB 4USIA 1Y5IB 3AJ2A 2HIQA 2WAQD 3DRXA 2LYVA 4ED8A 3R1LA 2XLKA 3IBFB 4LF9J 4EO6A 1HFEL 4ERDA 3UWTA 2DH8A 3OR1B 1FDNA 2WONB 3LQVA 2ILYA 4NLPA 3HSGA 3OVBA 1DLOA 2J6TA 4PRFA 4QW8A 2MKKA 3OXGA 3EGVA 4S0MA 4WE1A 4WXWA 2NQPA 4PPZA 4DSFA 2AKWB 5KG2A 4DR1J 2DR9A 2FY1A 3MOZA 1VYAA 4UOCA 3GWCA 4J9VA 4MKYA 4EK2A 3LGNA 3I6PA 4KGXB 4Y2KA 5KFDA 1H7WA 2EFNA 4UW2A 1QE1A 1SB6A 4CO3A 4DR6F 3CC2S 1JXEA 4UY8T 3MTJA 4DBQA 5K8NA 4O3SA 4G6VB 1LEOA 3GYNA 3U27A 4WFAQ 2GVZA 3M1VA 1ZPWX 3HD2A 3GG1A 3K5NA 1SVDA 4O3RA 2DJWA 2CJYB 3DFEA 2PEHA 4J9NA 2ASJA 1IWAA 1HWJA 5EX0A 2RSQA 1RT4A 3HHEA 2DR6A 5IV3A 4YHHJ 3BKTA 4P52A 5IM0B 1WTFA 4WK1A 1WHYA 4WFNQ 2WBMA 1P9YA 2DVIA 3P6YC 4DFPA 1RT6A 1GEHA 3KJQB 2CZ4A 3WIVA 5B08A 2EKYA 2CVEA 1YBAA 3PNIA 4OYIA 3RB0A 1S0NA 2OD4A 4BHQA 1K8AT 2UUBJ 3HT3A 1C1BA 3TAMA 4KE5A 1BXNA 3R6GB 2NUHA 4OX8A 3VAMA 4DN0A 1NJZA 1SL0A 1S0OA 2HBRB 1EETA 3UN2A 1IKYA 5B0FA 2QX0A 4X84A 4ANCA 2QMWA 4NYZA 2ABYA 2Q6BA 4E8UA 4CLUA 1YBUA 5GMKa 3JQKA 1F5BA 1VQ5S 2DHHA 5RUBA 3GZ7A 1F0XA 3UD5A 1NJIT 1G1XA 2DRDA 2HFUA 2AJ4A 4RWWA 4USTA 3M8QA 1NXIA 2H3EB 5KG1A 2GVDA 2IVYA 1SJ1A 3NRBA 3ADAC 1URNA 3LP2A 5LMUJ 3KKFA 2D74B 3FEXB 1FX4A 4GKJJ 3MAAA 2AJ0A 4AD6A 3UCUP 2H48B 3O1LA 2W25A 2IMWP 4ZJQA 5F8GA 3BBCA 1Y11A 4PEOA 2WHOA 4RX6A 2ACYA 4L76A 3DRSB 5L8RC 1YDLA 2FC9A 3SQGA 4Q8FA 1VQYA 5KFZA 4LRFA 3W5YA 4A8WA 3HT0A 2G0JA 3VQTA 1RHKB 5C42B 3QT8A 1HW9A 4F4AA 3G71S 2OPPA 2DCUB 1HBMB 1KHVA 2OPRB 3OTOJ 4JV5F 2Y1IA 5D4NA 1Y10A 4JBCA 4MJKA 3N01A 4NLVA 4C11A 2FIUA 3MEDB 2KYZA 3ILLA 4NRUA 4X64J 4WFYA 2ZH8A 2QYGA 4PG6A 3BO3A 3OBIA 1DARA 4DF4A 4TY8B 4I6WA 3SSSA 1VQ8S 2KFYA 2PMHA 3BSNA 2OGUA 1NSQA 4YN3B 5D0EA 1B0PA 5KG0A 2LCWA 4KV8A 3FFIB 1YKWA 5AJ3J 1ZM2A 2J0QD 1K44A 1M5HA 2RJZA 4C8ZA 2AP6A 4J9SA 4QPXA 1N33F 4PYAA 4WF9Q 3I87A 3A8JA 1TFYA 4MTPA 2FTRA 2B8PA 5E3AA 4P7VA 1H2TZ 4XTTA 5FDLB 4AL5A 2NSCA 3CCVS 2H51B 3PW7A 2X7IA 1U8SA 3FSXA 4X4NA 3RAMA 1JLQB 1QVGR 2QLBB 1NUEA 2HVIA 1Y5NB 2G4BA 1SQEA 1NPKA 1EP4A 2QA4G 3TVZA 1FNMA 4OLPA 1UEUA 3HF5A 1NEEA 3UI3A 5A6WA 2P9CA 5HBMA 1JLGB 1OQ6A 2F3JA 2J9DE 3MM9A 5C25A 2MEWA 1FJGJ 4RBUA 5AXNA 1TK5A 1HQUB 3BGRA 4DPOA 2NSBA 3P4UB 5K20B 3HKWA 1NK5A 4MAKA 1E6VB 2GS8A 4X66J 3EMTA 5DZ6A 4CH0S 3DLKB 2ZWOA 1DFDA 3H98A 4DQPA 4YFUA 2HSEB 3IRWP 1NHVA 1R8PA 2MY8A 5F8LA 5HL7Q 2YKPA 2FPHX 4F26A 4NEYA 1F9FA 4OYWA 1Q5VA 5JUMA 2VFRA 3EYZA 2EG1A 2Q43A 4RBTA 4P72A 3I32A 4AL7A 2Z2MA 1RWVB 3FQKA 1T3OA 2E7WA 4B3SJ 2XCAA 3D66A 3OXFA 2HS4A 2YKMA 3C2PA 2N3LA 2CPZA 4ZVRB 3TR5A 1D8ZA 1YG0A 2HGLA 3M2RB 3M6XA 5EX3A 4ZKAA 4GMKA 1RTIA 3S1TA 2FVRA 4ZPCA 2HWIA 2AYMA 2V9WA 4PWWA 1IN0A 3BBBA 2MJUA 4XDDA 4DX5A 3ITHB 1AT1B 2AZ3A 1OQ3A 3BGFA 3SFGA 1LWCA 2MQMA 1MWYA 2EFVA 3D7SB 1S7IA 3IS9B 5CCLA 3Q0AA 4K2XA 4WJBA 2XWYA 1ZPVA 2RDDA 3PHTA 2J8AA 2G1HA 2FHJD 2AEJA 5LM7E 4AT1B 1GX6A 2J7KA 3D3BJ 5KFLA 3N28A 5KFWA 3W2VB 1R3NA 3DOMB 1AZSB 1S59A 4OX9J 3FZBA 1S79A 1OY8A 2PSZA 3PX4A 2WSFC 4TY9A 3ZTPA 4CLWA 3W9HA 1HR0F 1X5PA 2YVSA 4B3RF 1EQ0A 3MAQA 1DRZA 1NK6A 5GADU 2IAJA 2ZHOA 4HLBA 2WVFA 4DQRA 4EBCA 2OJ3A 1YRUA 3E2EA 3LA0A 3CIMA 3PW0A 4Q2LA 3TA0A 3BDPA 1RT5B 3CMAS 4M8LA 4DV3F 1MROB 1NHUA 4DXLA 3Q8UA 4OJ1A 4HDGA 1FD8A 4KGZB 1FKPA 1RAFB 3FCHA 1RHUB 2DNOA 3R9LA 3OL8A 3CDUA 1FRHA 2ZH6A 2DT9A
chains in the Genus database with same CATH topology
2UV8A 2FJWA 4FF2A 4CO4A 2O66A 3SSRA 5BYRA 2ASYA 3CTRA 2R2RA 3MEGB 1N34F 3UCGA 1M5VC 3VF0B 4BC9A 1ZTWA 5ITHA 4CH1A 4Y6IA 1FKOB 4ZPTR 4EBEA 3UFCX 3CCWA 3N5FA 1HBUB 1OPIA 2DGWA 1OS5A 3LP0B 3J81Y 5HROB 4EO8A 5F8JA 1ELOA 1HHSA 3CCJS 1Y3JA 2Q3PA 3TOQA 1DJ0A 2CJQA 1J5OB 2YNIB 1CC7A 1MWZA 1V6HA 3TRGA 3HMJG 5E3QA 2RS8A 5KG7A 3W3SA 1NK9A 4ZVGA 3DLGB 3CDEA 4M95A 1U49A 3C8YA 1RT5A 1YJNS 4ZMMA 2E9ZA 2B0GA 1QUPA 4X4VA 1UWBA 2V4RA 1MROA 1BY9A 4ZLPA 4NOHA 1Q1KA 1C4AA 4P7TA 4Y0FA 1LXNA 2A10A 4CO0A 3ZZ0A 2B4OA 1RT1A 2AJQA 1VQOS 1H2VZ 4IG3A 2GQCA 4TU7A 2WOMA 4C8NA 2V4JB 2XG8A 1ULRA 4I1TA 4O4GA 4JI0F 4ID5A 1M5OC 2F1FA 1Q4RA 3G6YA 5HI7A 3LP2B 1Z2ZA 3MEEA 3RAQA 1ZYQA 1DTTA 5KG3A 2UXCF 2FUG9 4OX6A 4A8OA 2AV5A 3HXMA 1XERA 2EFGA 2F7VA 4U7CA 4ZCMA 4X4RA 3OPKA 3DDNA 4PXBA 2R8IA 3C6TB 3CE8A 3LW5C 4RUCA 3BO4A 1T7PA 2GW8A 4JI5F 2A2DA 5L1JA 2VODA 4ED6A 4NCGB 4ED7A 5GAHI 1D0EA 3AHPA 1U1OA 2OPSB 3MEGA 3J80Y 3TVKA 2KFNA 3FVYA 3CXCR 3PO4A 5FD1A 4PG5A 1FKOA 1UP1A 2RU9A 1B0VA 3I4PA 1HBUA 3CC4S 4JI4F 5KFEA 3SCIE 3PKMA 4ELVA 3LP0A 2VPZB 4IH6A 3QGHA 2W8KA 5HROA 3U7JA 1SV5A 2KTQA 3A1YG 3Q23A 3X1LB 4ZVEA 1RAJA 4Y28C 1J5OA 2YNIA 1W2BR 2DNPA 3U1MA 2DR5A 2W9BB 1D9FA 2QO3A 3OHAA 1QVFR 4NLWA 4R0EA 3EPIA 5KT7A 1WF2A 2DPIA 4NZ0A 3LANA 2B3TB 3QAEA 4LVOP 2AGOA 1NH8A 1FE0A 3QAUA 4ZPAA 1QTMA 1IKXA 3C46A 1Y3KA 3M8RA 4L3NA 2JSXA 2M70A 5EUHA 3BSOA 1WEXA 4G1PA 3I82A 3AB4B 2VOOA 1N54B 4C8OA 3HZEA 3CO9A 4ILRA 1SKSA 4WCEQ 5DG7A 2EK1A 3HK2A 3HLUA 1HNVB 2V8VA 5F8MA 1TK8A 2XNQA 3V4IB 4A8FA 2HRYA 3M32B 4DV5F 1N5VA 5M2UA 2HHHF 3BF4A 1LOUA 1HA1A 2L3MA 1VFJA 2YH1A 2L9WA 2RQ4A 4ED5A 2G9OA 4FF4A 4A48A 2FJDB 4ECXA 3IR5B 4KFBB 4WU3A 3QZ8A 4DUYF 2R8JA 1G7CB 4YQWA 2ZNZA 1S6PB 2OPSA 1T02A 3QGPA 1AROP 4WYLA 1UL3A 1P1TA 4ED0A 3KOAA 4RU9A 1XC9A 1UVMA 3D1OA 4DJBA 2PN6A 1YIJS 2PO4A 2GFFA 2ZDOA 5I42A 4HH0A 1HMVB 1SUQB 1VRUB 1RJJA 2W9BA 4RKUC 4F50A 3V6DB 2ZC4A 3QJJA 4WYWA 1VOMA 2AWZA 2AX0A 3B4DA 3J7YU 1U1QA 2HNYB 4C9DA 3LH2S 2HVZA 3AQPA 2DGVA 2OSRA 3FMWA 2OD6A 2JLGA 1FO1A 5CQGA 5B0BA 2CQ0A 1RT3B 3N0VA 3QMQA 1RA6A 4QR1A 4K5RA 2HW3A 2KDOA 3TANA 2XMKA 2XMTA 3BQ1A 4B9TA 2BANB 4C97A 2VBXA 4MFBA 1PGZA 5H9FJ 1NJXA 4DL0C 1HNVA 3KK1B 2DH7A 4KV8B 4H4KA 5HMWA 2X1AA 4B9MA 4KC5A 2P5VA 3M32A 5ADZA 4N8NA 5B0DA 2RU3A 2H9ZA 3QZ7A 2J0XA 3PEJA 5DJBA 2ZJPQ 1YQHA 3I5AA 4ZP9A 5H1SV 3MXHP 4KQZA 5C5JA 5JVGQ 3AAWB 1Q8LA 2AYGA 3MAHA 5HQ8A 3H59A 4KRWA 3CJ0A 4I2QA 4KFBA 4R25A 5D77A 3TAQA 1M90T 3GV7B 2GC8A 4HYKA 1KQKA 3CCES 2VOPA 2L9NA 1V9OA 2RVJA 4ZCIA 1FVSA 4FXWA 1TZ0A 1URRA 5CA5A 2HNZA 5KFAA 3RW7A 3HPOA 3TVYA 1JX4A 2DRBA 2E5LF 1HWKA 3PW2A 2K8GA 4DOZA 3VCDA 3ENVA 1U6ZA 4NLTA 1ZAXA 2ZDPA 1VRTB 2GQQA 1HMVA 4IKAA 1SUQA 1ZOTA 3OV7A 1GQEA 2CDQA 2F40A 1LFPA 2PD1A 3KNGA 1KC8T 1N6QB 2CPYA 4U67Q 3FQLA 5KFIA 2BQRA 1HI8A 3V6DA 4C0OC 2Z4PA 5SZTA 1VQMS 4J9PA 2DNRA 1IBMF 4YY3F 2KHDA 2WTFA 4H54A 5IQQA 5LSLA 4JI6F 4CT8A 1UJ4A 3R5DA 2KXFA 4OI2A 4MYUA 1U1KA 3E8OA 4ECSA 2VQEF 1RT3A 4IFYB 3JTNA 4FPRA 3MR3A 1KQGB 5BYQA 2M8HA 1QAIA 2K3IA 3R5AA 2FVQA 4WZMA 4TQRA 1M5KC 2BANA 2B9XA 2IJFA 3N79A 3NBPB 2CG4A 1CLFA 3LUYA 3KK1A 1KEKA 2R9LA 3CC7S 1WG4A 2PGCA 5GAEU 4FBTA 1WG1A 2VD3A 3Q2SC 3SZ2A 5A8KA 3KLVA 2DPJA 4JI8F 2YKAA 4O23A 1REVB 3H4DA 4NA2A 1Q7LB 4QCLA 4RW7B 4YR3A 3LPYA 1BQMB 2IBOA 3E51A 4YP3A 4BWMA 2W8LA 2HS0A 4ES3A 4JV2A 3CWJA 2JEFA 1X5SA 2FDNA 1X4CA 4RLEA 1N5YA 3ZZRA 4A8QA 3ISZA 5B0AA 1ZAWA 2IVMA 2V94A 4ECVA 2RMLA 3PZPA 4DSIA 1WHXA 5G4DA 2HLTA 4YB7A 4IUFA 4NLQA 3HHLC 1WEYA 3N4WA 4NLSA 3QIPB 4IRKA 1VRTA 1FXRA 3M2UA 1W2IA 4HVZA 3K8WA 4LSNB 3SSQA 2KT2A 2H5EA 3PO5A 4UUWA 3KMSA 1N6QA 5IWAF 2KXHA 2M3DA 4WFXA 1Y0HA 2VZ9A 5AXMA 4LF8F 3ETOA 1U4BA 4LF7F 4QYZJ 1MMLA 3DLJA 2J5AA 3KLEA 4XDCA 1X5OA 2QA4S 4JYAF 5KG4A 2YX4A 3IR7B 3OVAA 4QWEA 2OP5A 3GIIA 2GMLA 3R5CA 3CF5Q 4WIIA 2CJKA 4H4KC 1TVRB 3HVAA 4KBIA 5J2NB 1APSA 1FXDA 3OTBA 5B0CA 3BZQA 4ELTA 4GC7A 3DDKA 4NL5A 2EK6A 2NR0A 5JVHQ 4NRTA 4ZPWR 3P96A 2CFXA 4QR0A 1S6UA 2GGPB 2UXDF 1X4GA 2V0NA 2XCPA 3WC2A 4DQSA 2HMIB 1REVA 1WG5A 4A4JA 1UFWA 1XMOF 4RW7A 1NNDA 3D1QA 4I2PB 1OPZA 3JSBA 4CI0B 3K7RA 2FVCA 3UD3P 3R1HA 3L95X 1BQMA 2BDPA 3JSMB 3MMBB 2GHVC 1H7XA 1TP7A 5K8PA 2ZUGA 4LSLB 4OI1A 3GYXB 4LFAF 4Q45A 4JI7F 1RTHB 3M6WA 1S77D 2UXBF 1FESA 3T1AA 3CCSS 2VG7B 2KJWA 1IBLF 2AGPA 2E1MC 4KTQA 4FYDA 3T5KA 1S76D 4O4RA 2I0XA 3QIPA 1S1VB 3M8PB 3RTVA 3CD0A 1NJYA 4KJIA 2DGXA 2Z8QA 5T7LB 3OTCA 2NREA 2KN4A 2IRXA 2M5YA 2BRKA 3KNAA 4ZPBA 4KIAA 4ZVFA 2E5JA 3OL6A 3HVTB 1RWUA 3WX4A 2XSFA 2DHAA 2O1PA 3S8SA 1XNRF 2W7AA 2R8GA 3LWLA 2GMJA 3DLEB 1R8CA 4KGMA 2J0SD 2DD8S 1NZAA 3DRRB 4NA3A 3BM7A 1TVRA 5E0OA 4MKAA 2RQCA 5J2NA 1H38A 5HMYA 1LKZA 4FNIA 2YKMB 4YUDA 3GFXA 4NLDA