1U1LA

Crystal structure of up1 complexed with d(ttagggtt prn ggg); a human telomeric repeat containing nebularine
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/dna
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*(PRN)P*GP*GP*G)-3'
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1lA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1lA02
2X1FA 2ERRA 1P27B 2LEAA 3MUTP 5EN1A 1YJWS 2DNLA 2DHSA 1VQ6S 4CIOA 1AUDA 1DZ5A 2KYXA 1OPIA 2CQ0A 2N82B 3CTRA 1ZZNA 2KXHA 1X4AA 2KM8C 2DH7A 4U67Q 3NNAA 4UQTA 1M90T 3CCSS 2HGNA 2XNQA 4IUFA 2CQ2A 3U1LA 2LEBA 4LMZA 2X1GA 2G1DA 2J8AA 1H2VZ 2MQQA 3NS5A 1U1RA 2ZJQQ 2D3OR 1YITS 3MOJB 1FHTA 2N7CA 2DNRA 1U1MA 2FY1A 3CULA 3VAFA 2U2FA 2ZJPQ 4WF9Q 4QPTA 4W92B 1YWXA 2MZQA 2CQCA 2MKKA 2NZ4A 2MQLA 2LXUA 4QQBA 2MB0B 3EGNA 3BO4A 1SJ4P 3CD6S 1H6KX 4C7QA 2LA6A 1U1KA 2FHOB 1X4FA 1X5SA 1U1QA 2M0GB 2RQ4A 1VQ4S 1QVGR 2CQPA 4C4WA 3MDFA 2KG1A 1U1NA 3CXCR 1VQNS 5CA5A 3FEXB 2CPJA 1M5OC 2CPHA 4RU2A 5ITHA 1YTYA 2RNEA 5GMKa 1A9NB 2MXYA 4Y0FA 1K9MT 2DNNA 1NJIT 2YKAA 1N54B 1VQKS 4A8XA 3CCES 3G6ES 1FT8A 4PR6A 1VQ7S 1X4GA 5JVGQ 1WF2A 2DGOA 1R8HA 4WFBQ 2CQBA 3CPWR 4PRFA 2MZJA 2CQIA 2L41A 5GAGU 1FJEB 2HZCA 2VOPA 3HHNB 1WG4A 2HVZA 1WTBA 1SXLA 1FNXH 2YH0A 4WFAQ 4CH1A 3VAGA 2XSFA 2FC8A 5GADU 2EK6A 2DGUA 5IM0B 1N52B 1VQMS 2JWNA 2M70A 1YI2S 2I2YA 2YH1A 3NMRA 2ADCA 2DGXA 3P6YC 1U6FA 3P49B 2E44A 2XNRA 1WHVA 5GVQA 2KG0A 1KD1T 2JX2A 1VC6A 4IO9Q 2MY7A 5IQQA 2X1BA 2DGWA 1X4HA 1XN9A 2DNGA 2YTCA 1FO1A 1VQ8S 2KFYA 3CCMS 1NU4A 3G4SS 2SXLA 1U1OA 2AYMA 3RW7A 4YB1P 2KH9A 2CPIA 5LXRA 3LPYA 3CC4S 2DNMA 3L3CA 1X0FA 2ZJRQ 2F9DA 2KRBA 2MY8A 2KN4A 2MYFA 1KC8T 3VAIA 2CQ1A 3MI7X 3S7RA 2VODA 2JVOA 2MQMA 3CC7S 3VAKA 2XS7A 2MZRA 2DH8A 3R27A 1K73T 3TO8A 1S79A 2KRRA 2GHPA 2LKZA 5CYJA 2MHNA 3PIPQ 3I55S 5JVHQ 2B0GA 1VC5A 2MKHA 1VQPS 1UAWA 3V4MA 1W2BR 3N9UC 1WEYA 1JJ2R 1QVFR 3NS6A 5IFMA 3UD4P 2MGZB 1CVJA 4QU7A 1H2TZ 4YOEA 3G96A 2KU7A 2DNZA 3MUMP 3Q2SC 1WEXA 1HL6A 1YHQS 2MJUA 2DNQA 3J7YU 1BY9A 3S6EA 1N88A 2M52A 5MLCV 4TU7A 3NNHA 2DHXA 5D78A 2JRSA 1FJ7A 2OTLS 1WHXA 1KOOA 2G4BA 2DHAA 2KXFA 1Q82T 3UD3P 2MKIA 1SJFA 1FJCA 5DDRC 2J0SD 3VF0B 4IOAQ 2DB1A 2RU3A 5H1SV 2QFJA 1UFWA 2KHCA 2D9OA 1UP1A 2RS2A 2N3OA 2M88A 1VBZA 2KT5A 2DGQA 2OIHA 3K0JA 3H2UB 2CPYA 2MSSA 3CCQS 4OZ0A 4WFNQ 2DITA 1L3KA 3MXHP 2MPUA 2Q79A 2L08A 1ZH5A 3MURP 5HL7Q 2KM8B 2CPFA 3CCRS 1O0PA 1OO0B 1URNA 3UWTA 1WHYA 2YWKA 3THTA 5LJ5Y 1HD1A 3CCUS 2WBRA 2M8HA 2CPEA 4QU6A 1F9FA 2LQ5A 1DRZA 1H2UX 1M1KT 1DHMA 3P3DA 1M5PC 4ED5A 3G9CA 3SDEA 3D2WA 2MQNA 4M5DB 2J76E 2LECA 2OTJS 3R1LA 1U2FA 2QA4S 2HGMA 1PO6A 4W90B 1WELA 2BOPA 2DNYA 2N3LA 2PEHA 2GO9A 2CQ3A 5FJ4A 3CF5Q 2ADBA 1YIJS 1M5VC 2LCWA 3U1MA 5LJ3Y 2DIVA 3Q2TC 1HA1A 4WIIA 2KVIA 4FXVA 3CCLS 1IQTA 3CCJS 2U1AA 2DHGA 2CPZA 3NNCA 1K8AT 3R1HA 4ERDA 2JVRA 2CPDA 1JJHA 2MKCA 1X5TA 2J0QD 2LA4A 3G71S 1UW4A 1WF1A 2I38A 3IRWP 4PKDB 1P1TA 1X4BA 2EVZA 2MKJA 2E5GA 2X1AA 5DETA 1B7FA 3BO3A 2K3KA 2FC9A 2MQPA 2F3JA 3HI9A 2DGTA 2F9JA 3ULHA 3CCVS 1JJ4A 2E5JA 3G8SA 4TU8A 2O3DA 2HGLA 1N8RT 2UP1A 2CQDA 3RW6A 2RRBA 2OSRA 3EX7B 3VAHA 5DDQC 3PIOQ 2CQHA 3THPA 4Z2XA 2DNPA 1HD0A 4BS2A 1WEZA 1D8ZA 1R8PA 2OSQA 2RQCA 1RK8A 2RRAA 4OZ1A 3TP2A 1OIAA 2M7SA 2MKSA 1RKJA 2DNKA 2FPHX 1Q7YT 2BZ2A 1SJ3P 3BO2A 1ZZFA 3SMZA 3CMAS 1WI6A 2DGSA 3MD1A 2XS2A 2RS8A 1G2EA 5HO4A 3UCGA 5DM7Q 3P5TL 4WKRA 5DDPC 3G8TA 1VQOS 2A3JA 1NO8A 2KXNB 1VQ5S 3EGZA 1YJ9S 2AYGA 2V94A 4EGLA 5BJRA 2LMIA 1WF0A 4WCEQ 2E5HA 1A7GE 2CQ4A 1VBYA 3CUNA 2DH9A 4TU9A 1JMTA 2DO4A 2EK1A 3ZZYA 5IM0A 1PGZA 3DLLQ 4IOCQ 2M4MA 3IWNC 3SXLA 1X4EA 3JB9k 1VC0A 2DNOA 3VAJA 1YJNS 4Y00A 3VALA 1FXLA 3J7ZT 1WG1A 2VOOA 2M9KA 2MZTA 2DIUA 1U6BA 1OWXA 2DO0A 3LQVA 2DISA 3OW2R 3UCZP 2PE8A 1DBDA 3FEYB 1U1PA 2NLWA 3MD3A 2CJKA 4F02A 2AYBA 4FXWA 4YUDA 2M8DB 3BS9A 2G0CA 2HYIB 2KI2A 3B4DA 3S8SA 3H2VE 3VAMA 2AD9A 1X4DA 1D9AA 1M5KC 1KQSR 2MSTA 1X5OA 2CPXA 2DK2A 2LXIA 1Q86T 1VQ9S 5D77A 1S72S 1WG5A 4CQ1A 5LSLA 2LYVA 1WHWA 3BEGB 1WWHA 2DGVA 3I56S 3CMES 2L9WA 2D9PA 3TYTA 2MQOA 5LSOA 5DM6Q 1VQLS 4P6QA 4LIRA 4C0OC 3S01A 3CC2S 2MZ1A 2DNHA 4F25A 4TLQA 4V19X 2MGZA 3DXBA 4CH0S 1X5PA 2XB2D 2K8GA 4LJMA 2QEXS 2RVJA 1QM9A 4J5OA 1SJQA 2E5IA 1U1LA 2MMYA 5GAEU 2AYEA 2RT3A 1VBXA 1KOHA 2OJ3A 4UY8T 5GAHU 2MZSA 3ZZZA 5LXYA 2CQGA 5CXTA 2M2BA 1X4CA 2XS5A 2VONA 5DDOC 2MJNA 3US5A 4F26A 1WI8A 3B4MA 2RUGA 1Q81T 1SJRA 3MUVP 4ZKAA 3UE2A 3UCUP 3SDEB
chains in the Genus database with same CATH superfamily
5ETRA 1VLYA 3ETMA 2DHSA 2ATCB 4CIOA 3KUGA 2J7UA 4B3OB 3DOLB 5KG3A 2W9BA 4ED3A 4B3SF 2V8HA 3HPOA 1KS2A 3LP0A 2AMCB 4XPEA 2E1CA 4GRSA 1SPBP 5J2PB 2ZH9A 1OSCA 3TX8A 1JLAB 4M5NA 2LXUA 4QQBA 4DR4F 5E2QA 3KMQA 5E3PA 2V8DA 1X5SA 2M0GB 1YSJA 1FJGF 3MDFA 4PWUA 4F4YA 5CA5A 2CPJA 3M6VA 4BWJA 1WKKA 2KTQA 2FJXA 1CJTA 5D4LA 3R7BB 3CDUA 3VTIA 2Z2YB 3QSIA 3LAMA 1R3NA 4QYZJ 3PKYA 2BA9A 3VAGA 1RTIB 4IR1A 2GC8A 4M5GA 4XDCA 1IKVB 8ATCB 2GVZA 2BQUA 1YI2S 4V1Ak 3TAPA 2D7SA 1KLMB 1CS4B 2H54B 2ZOMA 2Y1LB 3LA0A 1WSVA 1UJ6A 2W9CB 4RNHA 4DUYJ 2YTCA 2ZHAA 3G4SS 2AYMA 1NKEA 1JLBA 4ECVA 3RGIA 1SB6A 1H3DA 3VAIA 2RKIB 3L7PA 5ETNA 3NMAA 4M95A 4I69A 4ZVUB 4NLPA 2WBMA 1WEYA 4YOEA 2WVDA 3BJYA 4K0KF 1Q8IA 4KGKA 3J7YU 4USKA 1TL3B 1N88A 2FVSA 2XTJP 1QAYA 2JRSA 1Q16B 2GFFA 1GXTA 3UR3C 2DPIA 2FLNA 1S76D 4UZCA 3FDSA 4NI2A 2AEFA 3PZPA 1GMUA 4DUTA 5E5NA 4D3HA 1KWMA 4ES1A 1L3KA 1VS3A 3O44A 4E0DA 4USIA 1URNA 2UU9F 1S77D 1SKRA 1CULB 3IRXB 1WD6A 3MM6A 4P9SA 4CO5A 3EYZA 3M6WA 3EDRB 1Q1KA 1NNDA 4ECZA 1SC4B 1T02A 3R1LA 2QA4S 2JEJA 1H38A 2Z56B 5FJ4A 4J9UE 3DM2A 4ED7A 3QRPA 1F2HA 4WYLA 1URRA 2KVIA 2B3TB 1I51B 1TQLA 1HWIA 1Y0HA 4ZS6A 5KFLA 1IJEB 1HNZF 3W61A 5KOWA 2HQ3A 2I8EA 4JV0A 5FIIA 3CCVS 4CYUA 4ZVFA 1LWFB 1WUUA 2FLPA 4L3NA 1E6YB 2ABYA 3ZO7A 4KQZA 2IRXA 5HBMA 5KFAA 1S59A 2BZ2A 3KLGB 2FHJA 4A8KA 2EXUA 2AYGA 3D3BJ 2H65B 2IDEA 4KV8B 5HJYA 2D41A 2DO4A 4USWA 3JB9k 1M1GA 1FXLA 1S6UA 1OWXA 3CIMA 4ELUA 3PEHA 2FTRA 1M5SA 5EX3A 2E9ZA 5D4NA 3MCMA 4RWXA 4YB7A 3EPIA 2H5EA 1D9AA 3MAAB 1Q86T 3GJQB 3GCWP 1WG5A 2VG6B 4CQ1A 1NJXA 4USJC 2HVDA 1KHWA 3HZGA 4NMLA 1E6VB 4X64F 3DFEA 3HHLA 2MMYA 4NOHA 2RD5C 3HO1A 3PW7A 1KOHA 3OXFA 4E98A 4DEZA 2CQGA 4NCBA 1RISA 4N8NA 1RTJB 2R4FA 4O4GB 2BMBA 4BLGA 1U0HA 3UCUP 2OEKA 1HR0J 4ZPAA 1CJKA 1JQGA 1RWNB 2W7AA 4UUXA 1H72C 4HI1A 1RAHB 3HVTB 3CCSS 1UEVA 3PYGA 1YJRA 2CIMA 2WK4A 3LGMA 1G3OA 3GR1A 1FHTA 3D66A 1HNWF 4MIBA 1LXNA 1S1TA 2FY1A 3JSBA 2W8LA 2ZJPQ 4JI6J 4AQYF 2HRYA 2ZH7A 1YJUA 2YQ0A 3DGVA 4OI3A 5KFGA 2IM3A 4LSZB 3AH6A 3M9OB 1JWWA 5IT9U 2FHOB 4UT4A 2HPUA 4YS2A 1X4FA 3QRQA 1S1WB 1IBMF 1HQUB 3R97A 4A46A 1R8BA 1DY3A 3M2RA 1U25A 3AD9C 4YEAA 2XZTB 5DQGA 2BDPA 2VKZG 4NXMF 2BJ9A 4JOUA 1SIWB 3Q8YA 4HVZA 1XNRJ 2OUGA 5CD4A 2I2YA 3UN5A 3NMRA 3DOKA 2ADCA 3PW4A 2OPSA 3PW5A 2BEFA 2KG0A 3I4PA 4IO9Q 4RW6A 2QL9B 2UUTA 3QZ8A 4USMA 3BPDA 3EICA 3RW7A 4DJBA 4DSJA 4J9QA 5HVFA 5IT0A 3IA0A 4LF6F 1ZPWX 3MM8A 4HTIA 3TJ9A 1VHFA 3TO8A 4J9LA 3PRDA 4ELTA 3MCNA 3M1VB 2XGPA 3SQGB 2LFVA 1B64A 3UR0A 2HAIA 4KPCA 2DEJA 4WP8A 1CLFA 4ZPDA 2L3MA 3B8HA 2JFDA 3Q2SC 1TL1B 3I9ZA 3DYAB 5GAEI 3JAMY 5HN0A 2DNQA 3JQMA 4H4KC 4IR9A 2YKQA 5H9EK 1GXUA 1BQMA 3DRXA 2V6AA 1FE0A 1NB7A 1QY7A 2IM0A 3KK1A 1NHVA 2DR9A 4B3TJ 2Z2LA 3Q89A 2FUG9 2OIHA 3BGUA 1WC1A 2PSZA 2X51A 3OTOJ 4X4UA 2N7YA 5KFBA 2QA2A 3UWTA 3LP0B 4DV0J 2W8KA 1YVFA 1PYTA 1ZPVA 1CJVA 2KFNA 4ETXA 1KFSA 3M05A 4M5KA 4U95A 3D2WA 1F2GA 2AWZA 5DG7A 3MM7A 2J76E 2W7PA 2DTJA 5CYQA 1KNZA 2DNYA 3RAXA 1JLFA 3IS9A 5H9EJ 2H48B 2J0WA 3U1MA 3J81Y 4OZNA 4IFVB 5KFYA 1NZAA 1GNKA 3MM9A 5AE2A 1I94F 4PKDB 1P1TA 2QSWA 2YWWA 3V81B 2CQDA 2NUHA 2F40A 4A48A 3OHAA 1LEOA 1RA7A 2LQ9A 4KFBA 3ISND 2RB7A 2GVZB 4Q0BB 3T9NA 5C25A 4DV3J 5M2PA 4NLUA 2E5LF 5K14A 1OQ3A 3UN2A 3NAHA 4WKRA 2R7WA 4I7FA 1LWXA 1JLBB 3M8SA 1A7GE 2B4PA 4WU2A 3MPUB 3QFHA 1JMTA 1B70B 2ZBQA 4I2PA 2HNZA 1JLGA 1TKDA 2MZTA 4DV1J 5C2CA 4NXNJ 2VBWA 1GTEA 5KFKA 2M8DB 3G2XA 4ECUA 3GPAA 1RT3A 1RAIB 2CZ9A 4K2XA 2HHPA 1VQ9S 2DR5A 5LSLA 2DR8A 1SV5A 4NCAA 4I6YA 3TYTA 3CO0P 1U4BA 1UVNA 2UXBJ 5F9NA 3WIVA 4DR5F 3MCOA 3LP2A 2HVEA 1S1UA 4JYAJ 1HBUA 1IM6A 3DXBA 3WDOA 3CJ8A 4L73A 2W4DA 3GONA 4U6PA 5D3GA 4QCLA 2RHQB 2YX4A 1M1HA 2C2RA 1HWKA 1LW0A 3DOMB 4DU8A 2RSQA 1X8DA 2B51A 3V6JA 4KBIA 3D54A 1AFIA 4ID8A 2VDHA 1C1CB 4UY85 1DQ8A 1XK8A 2RMLA 1IBKJ 3DM2B 2G0JA 3IR5B 3O5TB 4K4XA 2HNYA 1OMSA 3KLHB 2RDJA 2N7CA 1UA1A 4USUA 3PW0A 1AB8A 4NRUA 4LFAF 4WF9Q 2XZWA 2MZQA 1N4LA 3MEDA 4CYUB 4RUCA 3G87A 5HK4A 1U1KA 2KJWA 2BACA 2JHEA 2VQFJ 1U1QA 4RU9A 1Y7PA 4OL8A 3ZC4A 5B08A 1JKHB 5HBMB 3KYLA 3DLEB 2N4CA 2OAUA 4AL5A 4ED8A 4JI4J 2XC9A 2PI4A 3VGTA 4IO1A 4PR6A 4CP5A 2C1EB 2L41A 5GAGU 2FHKA 1NSAA 2YH0A 4ZCLA 4CH1A 4OLPA 1TMJA 2DGXA 3MOZA 4QW9A 4AL6A 4ZCIA 5GVQA 3HJVA 1FRXA 2JX2A 4LF5F 4ES2A 4CI0B 2KFYA 1TUWA 2SXLA 3FK4A 5KTQA 1AZSA 4K50A 4UTGA 2XI2A 3FRYA 4NCGB 3NWRA 4OJ3A 2B0GA 2R8IA 2MKHA 3GMGA 2HQCA 2AZ1A 4KC5A 2QLXA 5LMUJ 2B8PA 2ZDOA 3GTYX 4IG0A 3FC9A 3D68A 4KHPF 1QAXA 3OLAA 1ZS6A 3ZXWA 3P8BB 2QA4G 1IBCB 2BANA 4AE5A 1U0HB 3FRZA 4A4JA 1CQNA 2RILA 2XMVA 1UFWA 3K0JA 4O44B 3PKMA 1FVQA 1JJCB 3FUYA 5EHHA 2JH3A 2B43A 3MMCB 1YBUA 2V5HG 2IA0A 3BKTA 1RHQB 1S1TB 4QU6A 4U7UD 2J7WA 2HG4A 1N48A 3P3DA 1M5PC 5D0EA 4LBPA 1N5SA 4F4XA 4G1QB 3O1LA 5J2MA 1VI7A 2VC1A 2OD6A 1NPKA 2G2YA 3QIPA 4OYPA 4AFFA 1FD8A 3CCJS 1QUVA 2AJFE 4EO6A 3NNCA 5HVHA 1PJ6A 4N56A 2G13A 2MKCA 5HMYA 2R7SA 4Q8EA 3M7VA 1IBLF 3NKYA 4MYTA 1IWAA 4DUZF 2M5YA 2HIYA 4L3KA 1N8RT 1WOOA 4JBCA 3EGWB 5ETLA 3VAHA 1K1SA 1EETA 5G0RA 1OIAA 3LGNA 5I42A 1SI9A 3LWMA 1ZZFA 3SMZA 4DU7A 4DL5A 4X66J 3EGZA 3M9MB 4WTOB 3C8YA 4IRDA 3ZTSA 3O8WA 2I5JA 3MM8B 3CD0A 1B99A 5KFHA 3TR5A 2GIQA 3BV8A 4MIAA 3FBCA 1ZTWA 3VAJA 1VK3A 4I0WA 4NA2A 2C3OA 3DI6B 2CZVC 2VUGA 1XNQF 2ASLA 2XYGB 4EYHB 5AJ3J 3J7YI 2NLWA 3IBWA 4HI2A 4F02A 2Y0BB 2Z30B 3OT9A 2G0CA 1FWPA 5A2QY 1CBKA 2YQ3A 3EVMA 2AD9A 1KQSR 5CZXA 2HWTA 5E33A 3SV4A 1BQMB 3KJQB 3CMES 3W65A 5E41A 1Y9OA 2MQOA 1OPZA 4QBUA 3SYZA 5CYMB 1OSDA 1EQ0A 1SIZA 1FD2A 3D3CJ 4B3RF 2QEXS 1RCOB 3PO5A 2H1YA 2GVDA 4CTAA 5H9FJ 3O2IA 1IN0A 4DV4J 3FMBA 3BH7B 4ZPTR 2VZ9A 2RUGA 3W3SA 3H2LA 1YDLA 1IKXA 1ACMB 3MM7B 3T1HF 1GK8A 1S1XA 2IBOA 3I87A 2DH7A 3IS9B 1P9YA 4DV5F 4CM2A 2LEBA 1TUVA 2J8AA 4N41A 2BRKA 5A2QU 3M8QA 3IFEA 4AYBD 4DZDA 3RRGA 2DNRA 5J1NA 5HROA 4J9MA 4DQQA 3K5PA 1YWXA 2ASJA 1X9WA 1NK9A 1MROA 1VRTA 4PQAA 1B4SA 5B0CA 1V3RA 1D09B 2DPJA 1LKZA 2W25A 1NK7A 2KG1A 3I4HX 2HMIA 5I3UA 1C2PA 4X65F 5C25B 3F44A 1T9UA 2VG5A 1SH3A 5D15A 2FHMA 5K14B 1WJ9A 2ZH1A 3K5NA 4I7FB 1JLQA 4G1PA 3H98A 2O66A 4IDKA 3MTJA 2F7VA 2HVZA 2NUUG 3Q8UA 1UPPA 4JI1F 1PBUA 1RAOA 3PRBA 3H5XA 3R5DA 2X1BA 4NLGA 1FNOA 2FHJD 2HURA 3LALA 4DPWA 4DL4A 5HANA 1RSCA 1SKWA 1RT3B 5K9FA 2YNFA 3QJLA 2CQ1A 4OMFG 4ZK7M 2ACYA 1EZZB 1YRTA 1P8GA 1PAEX 3UDCA 5L8RC 4OZ5A 2OD4A 5KFRA 5JVHQ 3V4MA 2KT3A 5I4MA 3N9UC 2ZH5A 1HYSA 3BQ2A 3QWUA 3ILJA 1S7HA 3DU6A 1Q79A 1HMVA 2ZZMA 1T3OA 4KT0C 2MJUA 1YRUA 5D3GB 3RZAA 1BY9A 2R8GA 3D0HE 1I3OB 2QT7A 2HLUA 3DDKA 2P6TA 2VFRA 2GMLA 4FVMA 2LQJA 5T14A 3GIRA 5DDRC 2RU3A 5H1SV 1FRMA 1SJ1A 5CABA 5D4PA 2M88A 2Z58B 2GS8A 4YB5A 5KT7A 4LF9F 3HXMA 2CAJA 3ICLA 2V68A 4ZHRA 2E9RX 1LK7A 1LWCB 4O3SA 3CCQS 3AJ2A 3D7SB 3MXHP 4KTQA 1O6XA 1VQSA 1WOSA 4X2BA 4LRDA 4ANEA 3B6BA 2CPEA 2UUCJ 2FVCA 4DV7J 2QYGA 1DRZA 3A12A 1SVDA 4JI7J 1TK8A 2HFSA 3MEDB 3KJFB 5L46A 3IWLA 3M8WA 2PEHA 4NA1A 2GO9A 1Y11A 3ZZ0A 5DLGA 3CCLS 2F8MA 4LF1A 1Y00A 1EP4B 3AOCA 3ZTOA 4Y2AA 1ZM9A 3DC2A 4X62F 4LF4F 2LA4A 1O51A 3BSCA 1X4BA 2EVZA 3ENVA 3GWCA 2YWFA 1TL5A 3HMJG 2VJUA 3BGRA 2F3JA 3HI9A 3T6JA 1T9TA 3Q0AA 4CLPA 3KDNA 4ZCMA 1BMQB 4RPFA 3TAQA 4DX8H 1NDLA 1N34F 5SZTA 2A2CA 3PIOQ 1RKIA 1FEHA 2DNPA 4BS2A 3KDOA 2HQFA 2BJ7A 4UUWA 3CMAS 3CMQA 2V8GA 3EZUA 1NB2A 2JNJA 3A4TA 2R2TA 4NEYA 1D1UA 1M0SA 3N0VA 4S0MA 2CQ4A 1D3WA 3WC2A 2G0IA 3ILLA 4C8OA 2R7XA 4M5DA 1SC1B 3M2VA 1Z2ZA 1NH7A 2EEYA 1CC7A 3AXKA 3R7NB 1U6BA 3DRSB 3L7OA 3BBFA 3ET6A 4ID5A 1EIYB 4LBIA 2NYHA 2PGCA 3Q86A 3BQ1A 5GMDA 1FCAA 4F3QA 2IPOB 3FBEA 1M5KC 3N6MA 4B9NA 4DN0A 2B5JA 1PYOB 1Q5YA 3T41A 2VASA 3BEGB 3I5CA 1VYAA 2L9WA 1RHRB 3VR1A 3EGVA 5DM6Q 1VQLS 2KHDA 1IM4A 4HT7A 4B02A 4C8YA 2Y3YA 1N33F 5HATA 1REGX 2GAGC 5GAHU 1RBOB 3OXLA 2VONA 5DDOC 2HHWA 1WI8A 3B4MA 1HBNA 2YNHB 2UZAA 4F50A 3BQ0A 3WX4A 2CWKA 3OSNA 1RHKB 3KNGA 2FY8A 3S1TA 4JI3J 2XMWA 3CIZA 4JI8J 4LSLB 4UW2A 3PX6A 1YITS 3MOJB 4HYKA 5HVGA 1SQGA 5ETSA 1TU0B 2WAQD 4KE5A 2MQ8A 5F8LA 1N0VC 5L9NA 5KFQA 1G1XA 2RQ4A 5I3QA 4C11A 5G0RB 4XPCA 4RU2A 5I42B 1UCNA 2YKAA 4QIVA 1FT8A 1K44A 1FRKA 1UVKA 1R8HA 5EWFA 2CQIA 5KG0A 1HBOA 3EM1A 1VMBA 2VOPA 1I1GA 2DCUB 3J80U 3CJ3A 1UPMB 5J2QB 1P6TA 2AX1A 1F0XA 3UDVA 3V5RA 2Z2MA 2R7OA 1FO1A 3MGJA 3DDNA 2DJWA 1U48A 4DPOA 3C6TA 3PFEA 1WNEA 3L3CA 3GU0A 2KRBA 1S0OA 3MI7X 3S7RA 4DL0C 4K7QA 2F4VJ 3HKZD 3IO1A 4P74A 5GMEA 4DR3F 3SFGA 1NK0A 4JI5J 4ZVSB 3IBCB 1QVFR 4O23A 4NLWA 3BM7A 4J37A 2HRTA 2GVDB 3W64A 3R5AA 3PYDA 4RW4A 2LDIA 5D78A 3FFIA 4CWBA 4RBUA 1H0HB 1UP1A 1P9QC 2GGPA 5M2RA 4K5RA 1FXDA 2CPYA 3GZ7A 2UVVA 2BXJA 3HT0A 2CPFA 1OO0B 2HS3A 5BYSA 3M8QB 1HD1A 4C9DA 3ZNUA 1ZM3A 3GV7B 3CDWA 2BE2B 2A1BA 3DN9A 5I3PA 4JV2A 1M1KT 4O3OA 3SDEA 3JS9A 4RL1A 1VRTB 2DYAA 3QO9B 4LUBA 1TAUA 5F41A 1MN9A 4OX9J 2G9OA 2ZUAA 5F8MA 1WSRA 4W90B 1TKZB 3CEDA 1WC6A 3DNCA 3CF5Q 5CCLA 1S6OA 1YIJS 1KBRA 3R5GA 5I3UB 2U1AA 5E0OA 3DCAA 3R1HA 4MYUA 4QR1A 3TRGA 1QAJA 3H0PA 1JLQB 3OFFA 1Q8LA 4NLQA 5GAGI 3BO3A 1HBMB 2IRYA 2QE5A 4V19J 3RW6A 2E66A 3N4WA 4Z2XA 1N36J 1HD0A 5CCMA 2BYCA 5K8MA 3P96A 5F0UA 2QV6A 3KHHA 3EDQB 2XS2A 3TWZA 4ZMMA 3HM9A 3SCIE 3BREA 2AJ4A 1NO8A 3FGVA 3W2VB 1HFEL 2LQBA 5F9LA 2YNFB 3KFWX 1VBYA 2QG9B 4RR5A 2DH9A 2HS0A 3QT5A 2C2EA 3C19A 3QAUA 3SXLA 2OELA 4M94A 4M5HA 3HSGA 3JTNA 5KG6A 1HYSB 3VQTA 2NXJA 2OLWA 3G6XA 4P71A 4DR4J 3JSRA 3QGIA 4LR9A 2RF2B 1UETA 4DUYF 1RAJA 2AJ2A 1FDAA 1RTDB 1WHWA 1L3VA 3KNAA 4ANCA 3AHPA 1HQEB 1WC4A 3FMWA 3W5XA 2AGOA 4LRFA 3C66A 4GVBB 3NGUA 4J5OA 4DG1B 4KH1B 3H7HB 4PCQA 2RT3A 2WCXA 5LXYA 2H9ZA 2XS5A 1I5OB 2XBPA 1X9SA 1N5QA 1FFWB 7FDRA 3EPGA 2AQ4A 1X60A 1J2VA 2ZH4A 1AUDA 1DZ5A 3T5HA 3BBBA 4MIWA 1R0AA 4K2JA 1FX4A 4H4MA 1D8YA 4FYXB 4LIWA 5EX0A 5F3TA 3OVSA 4YR3A 1TFYA 2QFIA 1U1RA 1FK9B 4H54A 4F7VA 3P45B 1YQHA 4WYWA 3HF5A 4P72A 5A8KB 2XMMA 2Q6BA 2EI5A 2NZ4A 2B4VA 3BGRB 3UDLA 2WONB 1RT1A 4LVOP 4ED0A 2OMLA 2XLIA 3GV8B 4DL3A 4C4WA 2RIJA 2CA9A 4IG3A 4PYDA 1HNIA 1RT5A 1VQNS 1DFDA 4OV1A 1YTYA 2V8PA 2QLFB 2VU5A 2DNNA 1CJUA 4DLGA 3R5JB 4LF2A 2OMOA 4AT1B 1SC6A 4OHWA 4OJ1A 3HK2A 1B7YB 1WTBA 4UF4A 3HX9A 4R8UA 5IQ6A 2ZBCA 3MM5B 3MZIA 3NG8A 2GAHC 1SKSA 1IKYB 1T9WA 3ONQA 1KD1T 3H25A 4ID5B 2WSCC 5A6WA 4HHHA 3KG1A 2CPIA 2BJ3A 4WK1A 2MYFA 4ZCKA 5J2PA 2HK2A 3I82A 4ZVHA 2B5JB 3R27A 1HWUA 2XLJA 2R2SA 2MHNA 2VPYB 1L3TA 4XTTA 5KFXA 1N32F 1VJWA 2HWHA 4K4UA 2YKMB 3NBPB 2KB2A 1H2TZ 4DFKA 2XCPA 1Q53A 1TMMA 4J90A 1UTAA 2GA7A 5IV3A 2UUBJ 2ZOGA 3KK3B 4ILRA 3T5LA 4DQRA 4QZVB 1S9EA 1Z2LA 1HBNB 2HVIA 1QLNA 2V2VA 2KXFA 5HP1B 1Y10A 3QPIA 2J0SD 3DLGB 3IWXA 4G3IA 5KFMA 2UV8G 1G4CA 1KLMA 4GO5X 5KFNA 2W9CA 3GSDA 2C2NA 2V9KA 3LANA 3K57A 4YDXA 1ZAWA 4I64A 2VD3A 3BYRA 4BWMA 1HR0F 2ZE2A 4C11B 4NZ6A 1M5VC 5LJ3Y 2XHWA 3W7BA 4WJBA 3OFHA 3GG0A 2DR7A 3G71S 2XULA 4Z7YA 1G6BA 1TL3A 2C2ZB 4GO7X 3GCXP 1ZETA 3U02A 3JYTB 4ECTA 2F9JA 2F5GA 4I6AA 4X64J 2ZBIA 2OSRA 4JI6F 5L1JA 5DDQC 4YMEA 3FSYA 4NYOA 2VFTA 4CM0A 4N5SA 1FVSA 4IFYA 3TQEA 1T94A 3CJRA 4M1KA 2FPHX 4IH5A 7FD1A 2CNKB 3LWLA 5HO4A 2ZITA 2QMWA 2KXNB 2YKPA 5AXLA 2ZWOA 2LMIA 2ZHBA 2P9GA 1QUPA 3ZZYA 2AJ0A 3KUHA 3ZZOA 1XNRF 3A8EA 3GYGA 2WB1D 2NXUA 2QC3A 2X7IA 4AQYJ 3OW2R 4WP3A 4OI0A 3LH2S 2DHHA 3H40A 2VQEJ 5B0EA 3ITHB 2AIRB 2JL9A 3DDIA 3HVWA 3VGSA 2KI2A 2XHCA 3L4BC 1KQGB 4FF4A 3ENWA 5D77A 4O0IA 1LWFA 2D9PA 3FCWA 2HHUA 2DRDA 3AFGA 1E6YA 2DNHA 2GGPB 2MGZA 4K4WA 2E5IA 2ZC4A 1U1LA 2F8HA 4RKUC 2W2MP 3KLGA 4ZN1A 1Y3KA 4HH0A 2BKOA 3M6XA 2BKNA 4YFUA 3SDEB 1TK5A 1HI1A 1YJWS 4KV8A 4WXOA 1VQ6S 5DGAA 2BJEA 3AOBA 5D0RA 1S12A 1UW9A 4U67Q 2HZVA 4ZDNA 3AAWB 1IUJA 2ZJQQ 2COLA 1WC0A 3OTOF 3MF5A 2POKA 1N5TA 4EUVA 2DRBA 4W92B 2CQCA 2P9CA 3MAAA 3GFYA 4C8ZA 3W62A 1TELA 2GHWA 4KHMA 1Y4ZB 2QRRA 2GO8A 5HMZA 4PUOA 4OJGA 5KFUA 1DLOA 3C14B 3M8ZA 1L3UA 3CXCR 5B0AA 5KT4A 1HI0P 3LW5C 2CJBA 1KTQA 1TV6A 3AODA 2FJAB 1K9MT 1MU2A 2ROGA 2CFXA 4JB8B 4DX5A 3ZZPA 1U0SA 2Z2ZA 5JVGQ 3TANA 1FX2A 4WBFA 1RTJA 2IRUA 1WOPA 3J7A1 5GADU 2EK6A 2F63A 4ZVTB 5C7PA 4ECQA 2EWHA 3KHLA 1U6FA 2QLBB 3HVTA 2AW0A 2XY7A 3TZZA 1XJWB 1MW7A 4PQUB 1ICEB 4DV3F 1TVRA 1NJYA 4YHHF 2DNMA 4KSEB 1FFSB 4P10A 3GP9A 3WIUA 1QSYA 3CGIA 1T8EA 2JVOA 3GR0A 3SZ2A 2XS7A 4LRBA 3PG9A 2DH8A 2BUNA 2QN6B 4ANDA 3FJ2A 1HHSA 1RHUB 1JLEA 4NLXA 1S1WA 2AGPA 1I94J 3UD4P 3QATA 3G96A 3BSNA 3A8KA 3JSYA 2H5IB 4DV1F 5KFOA 3ENAA 5GAHI 1KQFB 5KG5A 5MLCV 4NXNF 4CRJA 4O0NA 2CJXB 2OTLS 4ZJLA 4O4RA 2G4BA 3QT8A 1U02A 2DHAA 3PYEA 4F04B 4P73A 2RUSA 2HHHF 2WTFA 2QFJA 2R8JA 3OJSA 4DWIA 2N3OA 3KHGA 3TARA 3R6GB 2EC0A 4KGMA 1R0AB 3CDBA 2UXBF 2PMZD 4F67A 3EZOA 2ZC3A 4OZ0A 1SBRA 4H4MB 5A0YA 3MURP 2ZM6J 3RYLA 4JYAF 3SSQA 5EGYA 1VIOA 3KLVA 4Q2LA 4Q8FA 2WSFC 3I32A 1RAFB 4PWDB 1BXNA 3R3TA 1RT1B 2BOPA 4RLEA 4KO0A 2EBGA 1V3ZA 3OL9A 3M1VA 2ILZA 4MKYA 2E1AA 5J1EB 1VDHA 4IG3B 4WIIA 1SL0A 3K7RA 3H20A 5T7LB 1IBKF 2JVRA 2J0QD 3H59A 2M3DA 3MFHA 4URQU 1CJUB 4DR5J 2MKJA 2E5GA 5THWA 4DPYA 2B7CB 3G8SA 2V8VA 4R8UB 4KH0B 3BR8A 4X4QA 5IS2A 2BW2A 4NL5A 2VQFF 3E01B 1TL4A 1S0VA 5KFDA 2E1RA 5SUHA 3KLIB 4BC9A 4LSNB 3W9IA 1LW2B 1G2EA 3I5BA 2KL8A 4ZP9A 3CW2C 2HFZA 2V34A 2YNIA 4QYZK 4K4VA 4CLUA 2BE7D 4EGLA 2K3IA 3SCLE 4F4ZA 3ISNC 3IWNC 3Q23A 2IC3B 3J7ZT 3OL7A 2YWGA 1Z1ZA 4OI4A 2EBEA 4LFAJ 4G65A 1R31A 4NPOA 1U1PA 3MD3A 3LP1A 4FXWA 4IFVA 3GFZA 3KWMA 1FI4A 2MSTA 4KIAA 1GMWD 4C8LA 3V81A 1S9EB 2YPYA 1CEZA 1XBWA 2LU1A 4KGZB 4PG7A 2ZKTA 1ZAVA 4NWBA 4LIRA 4M5IA 4ZOSA 1S6QB 1CSJA 2VHGA 4Y2IA 1PSDA 4Q0BA 4TVAB 1PYSB 3PX4A 2KKHA 2HK3A 2FQQB 3M2UB 4RNNA 3PFOA 3GIKA 4ITSA 3V6HA 3C3LA 5IT4A 2VIHA 3ZZZA 4J9OA 2C28A 4W4MA 1UA0A 1RUSA 4E8UA 2E7XA 5F8NA 3OL8A 4EK2A 3MWBA 2RDDA 4ZKAA 1TAQA 5AXNA 5HLFB 1EX8A 4FF3A 2X1FA 4OV6A 4LFCF 1P27B 4LF5J 1VRUB 1MWYA 2KXHA 1YJTA 5C24A 1AROP 2ZE2B 4IUFA 1R0CB 1YKWA 4ZJQA 1Q8BA 3O6QA 2MQQA 2QL5B 3NS5A 3HJFA 4KGVB 2PMWA 4OYOA 2RAQA 3GJTB 3HHEA 1YBTA 4WZQA 2BKPA 4OHXA 3BN4A 1VFJA 1FA0A 1SJ4P 3QBCA 3T9ZA 4H4KA 4DQPA 4HKQA 4B9TA 4AXJA 4YY3F 2XMTA 4KHPJ 2CNLB 4IFYB 3MFIA 4OLOA 4DX6A 1CQMA 3M32A 3SCKE 3GFHA 1A9NB 2UUAJ 2DXEA 1KTVA 2I9SA 3A3OB 2D3O1 3ADAC 2F4FA 2A18A 3DOMA 1VBKA 2Z57B 4BHQA 3HHNB 2ZH8A 3UPFA 1FDNA 1T3NA 2VG7A 1C1CA 2YH1A 5JXSA 3FKBA 2XMAA 2E44A 4DFJA 4LRAA 4BDPA 1H7WA 4AL7A 1VC6A 2ZD1B 3G6YA 3QGHA 3KLHA 4P2MA 1RLCL 2F9DA 1KC8T 3VV2B 1Q7LB 1YK9A 1FRLA 4L72B 3I55S 3PY8A 9RUBA 1UAWA 2MLZA 2VFVA 2FLOA 5AXKA 3KLFB 3DLKA 1TKTA 4KY3A 2E1PA 2MGZB 4DUZJ 1KRPA 1JKHA 2X3GA 3T5KA 5LL6d 3DLEA 1BD6A 3T1YJ 3TUIC 4TU7A 1OQ6A 4DL7A 4RNFA 2DT9A 1UWAA 1SL1A 4KRWA 1U47A 1WHXA 4EFAC 2MKYA 4EEYA 4U7CA 5CHCB 4TQRA 2AX0A 1NLKL 1KFDA 3HSJA 1NM2A 2DITA 1ULRA 3GJRB 4U96A 3CCRS 1O0PA 4OHYA 3ZNJ1 3NGTA 4DZ6A 2I0XA 2QO3A 4C97A 1F9FA 4CDIA 1ZYQA 4CLWA 2CJQA 2GJFA 4HDHA 4CLLA 1HNVA 4NYZA 3ISZA 2HHTA 4DV2F 5HAOA 3RB4A 5LMNJ 4DV4F 4NCGA 3PVXA 2CADA 1LXJA 4TY9A 2CQ3A 4WZMA 1Q78A 4PUOB 1DLOB 3Q2TC 5IT9Y 1H74A 3N6LA 2CZ4A 5E3QA 1EJ7L 4HACB 4DSKA 1TV6B 7AT1B 2CPDA 1JJHA 3I6PA 1X5TA 5F8IA 1MU2B 5KT2A 3OHBA 2EG2A 3HHKA 2DR6A 2GCFA 2IM2A 4DBQA 2HGLA 3DLBA 3HP6A 4ZLNA 2CQHA 8AT1B 2K1RB 2RQCA 4O3PA 4HHUA 5E3RA 4PXDA 4QIWD 2MKSA 4O44A 3GG1A 1GQEA 1XR5A 4EBCA 3OPKA 2H4WB 3PTWA 5DM7Q 3MMCA 3DGPA 2VDIA 1RE1B 4A8OA 1TVRB 2GJ2A 2C2DA 4DSLA 2R2RA 1Q95G 1NK4A 4N76A 4WCEQ 4FS2A 3J81j 3DMJB 4EO8A 3CSKA 5AE1A 4G1QA 4WWSA 5T41A 2ASYA 3NGSA 1VC0A 1WORA 1SC3B 1JLEB 3M9NB 1BQXA 5KFPA 4NRTA 2ROPA 3LOUA 2H3EB 2DIUA 4MT1A 3LQVA 2RJZA 1ZM2A 2PC6A 1DBDA 3FEYB 1XMBA 3C2PA 1PG5B 3BS9A 2HYIB 1NHUA 1FRIA 4F0KA 2NPFA 2W01A 1EARA 1TP7A 2LYVA 3MECA 4X65J 4QW8A 4C8NA 4OI6A 4Y6IA 2NYIA 2MZ1A 4F25A 3IXQA 4TLQA 4V19X 4NE9C 3TUZC 2CYYA 2WVBA 2Q43A 5A0YB 1G7CB 1XC9A 1VOMA 1RT6A 3K8WA 2JLEA 3DU5A 3GB0A 2ERRA 2MTLA 5KG2A 1ZZNA 2CJYB 3I31A 4KO0B 5JUMA 4EBDA 2Y9HA 3MR7A 4IOBA 6FDRA 3DI6A 2O01C 2ZUGA 1CG2A 5D8HB 2U2FA 1YZ6A 2HQIA 3DHXA 1F5CA 4NZ0A 2UUCF 1NKBA 1XWLA 4DV7F 3QAEA 4DQIA 3EZ5A 4JI7F 4Y3CA 3T1AA 2LEPA 5CYMA 1T9XA 3U7JA 4N8OA 4DS4A 5GMKa 4NLRA 4ED2A 1AYEA 2XG8A 1N54B 1VQKS 5KOXA 2W7OA 5L1IA 1RWKB 1VQ7S 1X4GA 2YNIB 4WFBQ 2MEWA 3FCVA 5AXMA 1HWLA 2MZJA 2R7QA 1FJEB 3POTB 1DTTA 2NPIA 3TA1A 1GH8A 2XYHB 2AKWB 3O3LA 2J7KA 2NS1B 4ZJOA 4K4TA 4JI0F 2IAJA 3H5UA 1PBAA 2BE9B 3Q8VA 5FDLB 2QYCA 4KR0B 4I2QB 1VQ8S 4JV5J 3CCMS 3IR7B 3LP1B 2BM0A 1J27A 4C0BA 1X0FA 2KN4A 1TKXA 2MDAA 2VODA 4MKBA 1IWGA 1WDTA 2LKZA 1GX5A 2VBYA 4ZVOB 2YWHA 2P5VA 4LF4J 4QIEA 5DO2A 4EI2A 1SUQB 2B7BB 2V4QA 3PRVA 2VA2A 3FVYA 2FD2A 2IDLA 3AB2B 3IGNA 1IVZA 3TW0A 3K8VA 2OEMA 3A8JA 4DV6J 3NNHA 1IXKA 2DHXA 1XERA 2NSBA 5M2UA 2O1PA 3D6TB 5ETTA 1ROFA 4A8QA 2YPZA 1WTFA 3GSIA 1J5EJ 3TZWA 2OPPA 5IZHA 4PYAA 5C24B 5ETMA 2MSSA 4MK9A 3OFEA 4JI2F 4EYIB 4DPTA 2YWKA 3GYXB 2WBRA 4K5SA 1RA6A 3PM9A 2XO7A 1U45A 2B9WA 4OYXA 3BSAA 2A2DA 3AQPA 2Y8WA 5A6PA 4DL2A 2LLZA 1TL7B 3ZZTA 3RAMA 3MHYA 1JIHA 2DD8S 3RAQA 1UKUA 4F3MA 4LF8J 2Q6CA 3RJMB 1XMOF 1RT7B 4C3LA 3I5AA 3M32B 1RTZA 2PEBA 4JI3F 2BBEA 1F5AA 4JI8F 3UO0A 3G6VA 1JJ4A 3GIIA 2UP1A 3OD2A 5GADI 1HW9A 2VG7B 4Q45A 2WB4A 1WEZA 1D8ZA 1R8PA 2OSQA 3RG6A 4CO1A 4I68A 3FSXA 1RWWB 1LWCA 5KG4A 5DS7A 2V2KA 2X3DA 3IM8A 2RS8A 1NSKL 2JEGA 3Q22A 2XCAA 1X0PA 1GFWB 3K2YA 3GYNA 5B0GA 2A3JA 4A8FA 3N79A 5KT5A 3IN5A 1UWBB 2C3UA 2BJ8A 5KFSA 3FSIA 2FZCB 3LO3A 4B9VA 4RW8B 2IA6A 1LQ9A 2M4MA 3MTKA 3IG1B 2DNOA 1TFWA 2YKNA 3NGRA 3DLKB 1TKTB 3MEEA 2DO0A 1C4CA 1R43A 2VPWB 4FVCA 3Q8QB 1EP4A 4DSIA 3IAS9 2JJ4D 4X4VA 3RR8A 4QOTA 5LT5A 4X4NA 3KLEB 4UZBA 5IC6B 2XY6A 2QIFA 2F4VF 1T95A 4KKOB 3UI3A 3HKWA 1QDUB 4GC6A 3TJAA 5BR8J 4LJMA 1DJ0A 1O8BA 4JI5F 4K4SA 2DKOB 4QWCA 2AYEA 5DG8A 4WE1B 5K8NA 1VBXA 5KT3A 2MZSA 1S6PA 4PZVA 1Q81T 3G82B 1HNVB 3TUPA 1RDRA 2IVYA 3IMQJ 1HHQA 1X4AA 4LREA 4U8VA 1M90T 1R27B 3IP0A 1S0NA 2ZBPA 3NGKA 2X1GA 3DRSA 3M6UA 1VHIA 1RGVA 4DR3J 3R5BA 1U8WA 4CT9A 4DR1J 3LAKA 2DY9A 4QYRA 1HPZA 1RXOB 2YXLA 4NLTA 3CD6S 4ETZA 3SBMA 1PJ7A 3LGHA 1N5YB 3K5LA 2UXCJ 4OX9F 3TVZA 3GQCA 1QTNB 3QGGA 3IBFB 1NZ8A 3FEXB 5ITHA 4UQGA 2RNEA 4I67A 4DFPA 1NJIT 3TX0A 3BSOA 3G6ES 2PFFB 3DGPB 1IR2A 5KFJA 3B78A 2RU9A 2W2OP 4EMDA 2CQBA 1Q5VA 3QNWB 2GMHA 3W8PA 4U9RA 1SXLA 2YNHA 1EKRA 5FLXY 2M70A 2DXDA 5ETPA 1RAAB 1N36F 5L9XA 4JUZA 2HHQA 2DGWA 1KSPA 2DRAA 2ZNYA 4FBUA 4IKAA 1NU4A 4LSLA 8RUCA 2MY8A 3C6UB 5DRKA 3Q83A 4A47A 1FRJA 1U7LA 3MECB 1PIEA 1RAEB 2G1HA 2W2PP 1W2BR 4DR6F 2RE1A 1QJHA 2XGQA 2DNZA 4RBVA 3OLBA 4TYBA 4GKJF 3V2UC 2OPRB 3S6EA 2J9DA 1T03A 4HL9A 2C2KB 1C0TB 4CLTA 2XWYA 1U26A 2OGUA 1RT6B 3CE8A 2XO6A 3IGVA 5C42A 4LQ3A 2IVMA 3EJMA 5FLXU 3OUYB 2ZVSA 2MKIA 4I56A 1KVKA 2YKOA 4Q44A 3QFWA 5K20B 1SL2A 2KT5A 5J2QA 1HARA 5H9FK 4WFNQ 2MPUA 2UUWA 1YLXA 4NLSA 2NREA 2LU2A 4DR2F 3OXGA 1R8AA 3K5OA 3FQLA 2AP6A 3H4DA 3SFUA 3HVAA 3CD5A 3BGFA 1MSWD 1DHMA 3W60A 3PDNA 3G9CA 1BWEA 2XY5A 2QGFB 2IYGA 1MG7A 5B0BA 4FPIA 1IR1A 4PG4A 4HR2A 1GAOA 3GE9A 2DHGA 4I1TA 4P52A 1K8AT 5HQLA 2GIFA 4MK8A 2FYXA 2I38A 2KO1A 2GQCA 1DTTB 1NRKA 1RK8A 4TLRA 2RRAA 4DN9A 2UXDJ 2IAJB 3V4IB 3OSPA 1UEKA 5EUHA 2K7JA 3BKUA 2Z8QA 3I0SA 2LQ8A 4EU0A 5HSPA 3K5MA 3OR2B 2JZ5A 2BE2A 2AU0A 2BABA 1TKXB 5DLFA 3MMJA 3H90A 4TQSA 2EKYA 5IWAJ 1JX4A 2VBXA 1PGZA 3QO9A 4WFYA 4F0MA 1YJNS 1TKZA 4OYMA 1SQFA 3AB4B 4KB7A 3AQOA 3TAMA 3S8SA 5B0DA 4C3KA 3VAMA 1X4DA 3PHEA 2VPXB 1FFGB 4DF8A 1S72S 1BHNA 1RT4B 3ZTPA 5KFIA 2PI5A 4QWAA 3MPWA 3M30A 5J1PA 4ICLA 1HBMA 1T05B 1HIYA 1RZMA 4H4OA 2AEJA 2IBKA 2OPPB 2EFGA 2XB2D 1X5PA 4N77A 4HDGA 2FLLA 3KTQA 1QM9A 1SJQA 2BJDA 2W24A 4YB6A 1I6JA 3M8RA 2PDAA 1S1VA 1GX6A 4RW7A 2MJNA 1U09A 4DR7F 3FBBA 4LQ9A 5K8PA 3BGOP 3W2VA 3OBIA 2UUBF 2HHSA 1U6ZA 2QSFA 3D5MA 2KM8C 2AEMA 2IHR1 2G2ZA 2HGNA 3GIJA 2B8QA 1SH2A 3NWGA 4WP9A 4E2FB 5KG1A 1UFLA 3BB5A 4NZ7A 4FYVB 4XDDA 1SCJB 1XTZA 2V69A 4CZCA 1FERA 1U1MA 4C2MA 4MFBA 2LVWA 2GV1A 4QPTA 2RF2A 2EPIA 1N32J 1S9FA 4B08A 4FP9A 3QQCD 4QWBA 2MB0B 2D3ZA 1QTMA 4C7QA 4XAKA 2BOAA 1RTDA 1HQEA 1UVJA 2NXCA 3HT3A 4LRCA 4OQJA 3OQ2A 1Y5IB 2W4CA 2QTWA 4LFBF 4GVBA 5KFCA 1CC8A 3QSYB 2W2QP 1U8SA 4DG1A 1T9YA 5HJXA 3CCES 4ED4A 1RTHA 1JLCB 3CB4A 2RQMA 1MMDA 4JV1A 1IJFB 5MAOA 4PRFA 2FJDB 3EXCX 3K58A 4MH8A 3F0NA 1KVJA 2EFVA 4Q5VA 5D4OA 2JWNA 5ADZA 4QWDA 4DMZA 1VCTA 2J9CA 3PJ9A 2YKNB 3P6YC 1JNZB 2CJ9A 3QT7A 2XSJB 3MEEB 2ZH3A 3KK2B 1VJQA 1W25A 3HVRA 3NEKA 5CH7B 4ECSA 2VFSA 2OP5A 1FK9A 2IJNA 3EMTA 3H42A 3R6LB 4NLYA 3QWPA 1BUXA 2KZMA 2ZZNA 5A8KA 4LF7J 4WXWA 4B3MJ 1FTRA 2E7WA 2GHPA 3F41A 2Z4PA 4KHRA 2WONA 1K1QA 3HFVA 3ENQA 4RBTA 3DLJA 3VVTA 1S97A 2KU7A 2LDYA 2FJVA 3KUEA 1WDDA 3KXDA 1FEEA 1QSSA 4F4KA 2VQEF 1S6PB 4J7CA 2KJVA 4M5LA 1X31C 4M63A 1LWEB 2EG1A 4W98A 1XMQJ 3LUYA 3RB3A 3UD5A 2RS2A 2QMUB 4WFZA 3MM5A 3TNVA 5AE3A 5F8JA 1IKYA 4Y2CA 2HZAA 3CJ4A 4WPAA 2B4UA 1O5JA 4DI6A 2V4RA 2B6AB 2KM8B 1WKJA 4ZVEA 1V5IB 1BLUA 1HW8A 2VJVA 3IR6B 1MN7A 1RT2A 2PFDA 2V4JB 3BN7A 3DRRA 3H8YA 3CCTA 1SKUB 5A8RA 1NAQA 4YR2A 3QMQA 4GKKF 2V2ZA 3HD2A 4TNOA 1HPZB 3MMBA 1X9MA 1PO6A 4KJIA 4HH1A 2N3LA 4KAIA 1X7VA 4P2FA 2J6TA 4IH6A 1FKPB 3P4UB 1D9FA 1LOUA 2D74B 4FXVA 2YKMA 3NBPA 4CH7A 2HBZB 1DAXA 5F3ZA 3MAQA 3ZTQA 2EFPA 3KK3A 2Z0GA 2G2OA 2K3KA 2E5JA 2O3DA 1UFKA 3DLHA 4U7UK 2KDOA 3D6FB 2XEXA 5HP1A 3T5JA 3KJNB 3DLGA 3J80Y 1QE1B 4OZ1A 4RNMA 1RKJA 1XQIA 2HNDA 4PXBA 4WIQA 4ECWA 3MEGA 3A13A 3KOAA 5BJRA 2VL1A 2ZH6A 4URGA 2C3YA 2NXNA 3BYPA 3RB0A 1KEKA 2A10A 5HMWA 2EK1A 2ZEJA 3R7SB 3NY0A 1AA1B 2W9BB 1HNXJ 5CQGA 4MTPA 1PC5A 1J5OA 2CJKA 4L75A 3NP5A 1OJ4A 4FYDA 2PA8D 2P6SA 1T03B 4HTJA 2UVWA 2CPXA 3D6HB 4RUAA 4LT6A 4Y2KA 4ELVA 3R2CJ 3JYTA 5C42B 2DGVA 1U49A 2LP4A 2B9EA 2BQ3A 2IMWP 3CCWA 3JAMU 3S01A 2GX8A 1S57A 1RLDA 1CJTB 1RYSA 2RVJA 3HZEA 3CJ5A 1ITPA 3R2DJ 4C48A 4UY8T 3MR6A 4YP3A 2H51B 2BVZA 3MUVP 3UE2A 4KPYA 4I6WA 1GMWA 1T7PA 5DJBA 5EN1A 3RBXA 3G8QA 1RWOB 3GIMA 4UQTA 4YHHJ 4ZPVR 5ETKA 2D3UA 4LMZA 2G1DA 2VICA 1H2VZ 2Q1LA 3ITHA 3NCPA 2ZM6F 2XLKA 2JLFA 2BV3A 2MQLA 3N5FA 3CCZA 3EGNA 1K47A 1H6KX 1PC4A 4YDDB 2Y1IA 1NDPA 4CLZA 3J81U 2C3PA 2CNNB 1U1NA 3GV5B 3FNNA 2NXEA 4XK8C 1OS5A 1M5OC 2WZ1A 1N6QA 4ZVQB 1Y5LB 1LK5A 3HSDA 2YY3A 3V6DA 4A8XA 2BJ1A 2Q3PA 3I0SB 2HHHJ 2IJRA 3CPWR 2IFXA 3E51A 4ZLJA 2ZZTA 4NI2B 2C2MB 5DZ7A 5L39A 1B3TA 4WFAQ 3HHLC 2FC8A 3BF4A 4ZIVA 5F0WA 1N52B 1VQMS 2PO4A 2IM1A 2AJQA 3W2WA 3T19A 4D3GA 3EVWA 2W1BA 3CJSA 2AHOB 1U1OA 3TAMB 4OI1A 3TA2A 3MM6B 1U2CA 1FNMA 1V5VA 3AA9A 2MQMA 3HD1A 1K73T 2WW4A 3AOAA 4Y2MA 4B17A 2KRRA 4FF2A 3T3FA 3M30B 1MNEA 4ICLB 2WVFA 4H4OB 5KFVA 5C5JA 3D0IE 1NDCA 3C14A 3NS6A 5IFMA 4OYAA 2R8KA 3MUMP 3NGDA 2JEFA 4OHVA 5KT6A 4A8WA 3EWGA 4NEZA 4L74A 1S1VB 4HT5A 4RW7B 2GMJA 3RRHA 1OYEA 3Q8SB 4Z37A 3PNIA 4B9LA 5BXIA 2ATLA 3UD3P 3W1YC 3RU0A 1RACB 2OHDA 4B3SJ 3N01A 1S9GA 2D9OA 2JSXA 3NCRA 2L9NA 2F8EX 2XM3A 2EFQA 1UMJA 1S99A 4RUHA 3X3UA 1UZHA 5LJ5Y 1F60B 3CCUS 5KFZA 4LR7A 5B09A 5CZVA 1FE4A 4PQUA 3L9ZA 4MFBB 1H2UX 4ED5A 2R3VA 4RWWA 2WRMA 2CUYA 1FKAF 1FJGJ 2LECA 2GQQA 2HGMA 2A0FB 3QRRA 1R89A 1HA1A 1IQTA 2KYZA 2XI3A 3L95X 4GVLA 3WQPA 1RHJB 1RTHB 4EBEA 3WC0A 4ES3A 3D1OA 2ZDPA 1RWXB 4TU8A 2H4YB 2IVFB 3OR1A 3SCJE 1BE4A 3RBDA 3C15A 1FDBA 5IXUA 3D0GE 3HHLB 1SJ3P 2I1RA 5HMXA 4X4OA 2A6OA 4LFCJ 2VPZB 3A3NB 4O3NA 1VQ5S 4TN2A 3W8GA 3OL6A 2O67A 2UUAF 1CJKB 3CUNA 2J9DE 3JQJA 2XMKA 4B9MA 4CCHA 4PWDA 4RW9A 3SQOP 3CDAA 3VALA 1LV5A 3AJ1A 4K0KJ 2OFHX 3MPVA 2M9KA 2JFKA 2R9LA 2I6WA 3MPYA 1V6HA 5J1EA 1TUGB 4XIUA 5T7LA 4R0EA 1PKUA 1ZA1B 3CVKA 3FZBA 4FYYB 4IRCA 4ZA1A 2FJBB 4YY3J 4YR0A 3MR5A 2HRUA 3W5YA 2NSCA 4ZP6A 1Y3JA 3I56S 1C4AA 3CJ0A 3VZHA 3HHDA 3NXZA 4C0OC 4ZITA 1SQEA 3M2RB 1MMNA 4MK7A 3HCXA 2EC2A 3M8YA 3E8OA 2UU9J 3OVAA 4HEA9 3E01A 2OO4A 1S10A 3KLIA 1FKOA 4LSNA 1LW2A 2GZOA 2QL7B 4DS5A 2FJWA 4R25A 2XQCA 3VHQA 1RT2B 2CXEA 4F26A 3DRRB 4FNIA 3T1YF 1HQ2A 5A8RB 2RQKA 2VA3A 4RO0A 4ZIWA 3MUTP 1N5VA 3SEOA 4DXLA 3MMBB 2IIHA 2N82B 3DOKB 4OYZA 1BC6A 2OPSB 2AV5A 4Z7CA 1AUSL 2IC3A 1HNZJ 3KMSA 4RW6B 3FBFA 4CLSA 2V50A 1KDNA 1RWUA 4B9UA 5DZ6A 4DQSA 4I4BA 1HWJA 3DXSX 3CJQA 2IYIA 2MKKA 5L1LA 4OZLA 3OTDA 3N28A 3MR3A 2LA6A 1YBAA 4G1IA 1RB0A 3VGUA 5LMNF 1NEEA 4QWEA 1S6QA 4X4SA 4FF1A 4CO3A 4X4RA 3CD7A 4PXCA 2DXFA 3BGLA 4IYQA 2HNDB 3HFZB 2QLWA 2BX6A 2OEJA 4OX6A 3BDEA 3M2UA 3NL0A 2QZ8A 3MEGB 2DCLA 2FVRA 3IC1A 3G86A 4IRKA 5LSRA 3MCSA 3KK1B 1FXRA 1YG0A 2KVQE 1XR6A 5HLFA 4DOZA 2ZOFA 3OJUA 1C0UA 2ASDA 2J9EA 1VRUA 3DRYA 4O3QA 2HVHA 4J9KA 1GTHA 2E7VA 3QZ7A 3AT1B 3QYYA 4BC7A 1J5OB 4DV2J 4RJVA 2AGQA 4YB1P 1CJVB 4PPDA 1NH8A 2KH9A 4TYAA 1FWLA 3JSMA 4AUKA 3D1HA 3I9V9 4Q7AA 2PA3A 3VAKA 2MZRA 3EVOA 3H4BA 1NJWA 2DVIA 4P2XA 5CYQB 4DL6A 5CYJA 1JLFB 2CJAA 4EZ9A 1JXEA 1WC3A 3WZ0A 3RRKA 1W7WA 3PYFA 4UOGA 1ZAXA 1RBAA 3UFCX 1H98A 2JEIA 2JLGA 4FN5A 1R6VA 1HL6A 3MM9B 5KG7A 1VLOA 5FD1A 1NKCA 4J9NA 4F4WA 1HHTP 1FF2A 1R6YA 2VV5A 4BBYA 2BQRA 4FS1A 4IQXA 3ZTRA 1SJFA 3QGPA 4KFBB 4IOAQ 3DRPA 1U2RA 2R7TA 3W9HA 2GIRA 3VWSA 1HNWJ 4Q2MA 1ZH5A 4P2SA 1NK8A 1AW0A 2ZD1A 3THTA 5DG9A 2LQ5A 3OFGA 3PHTA 5J2NA 4ZP8A 3FZ2A 1IBMJ 2BW7A 1S49A 4I2PB 2WOMA 4M5JA 2HNZB 1JLGB 5IC4B 5ETVA 1ZOTA 4URSA 2BR0A 2LCWA 3KLFA 4Y28C 3D1QA 4NXMJ 4USHA 2E9TA 1N6QB 1YJVA 2NR0A 4QPXA 3U27A 3V6DB 2W9AA 3IRWP 3AA8A 4LR8A 1RAGB 3TEGA 1SV5B 5DETA 2FC9A 5K8OA 2N4DA 4QR2A 3THPA 3LP2B 1S1UB 1IQZA 1HBUB 1KN6A 1DURA 4YN3B 2M7SA 1JB0C 1Q7YT 3W2WB 4PEOA 2DGSA 4B3TF 4DCJB 2XMJA 2FZKB 2GNKA 4FPRA 1LW0B 4LF6J 5DDPC 1VQOS 3OVBA 1LNQA 5ETQA 3KKFA 2CVIA 3GLJA 4DLEA 4DV0F 3WHIA 1RADB 2ILYA 1BQNA 3UVJA 4R0JA 3DLLQ 5IM0A 4QJVA 2CNOB 4K8RA 2L48A 1GT8A 2YQ1A 2BRLA 4OHZA 3HHLD 2HNYB 3ELHA 3UCZP 4N7TA 1D0EA 2JOQA 4YUDA 4HACA 2APOA 2CKWA 1TTHB 4M8LA 5KFWA 3B4DA 3TJ8A 2ZBRA 1QAIA 4JV5F 1LFPA 1DQAA 3WBZA 3A8IA 1WWHA 2GW8A 3LPEA 4MKAA 1VRQC 1S9GB 3CC2S 2K1RA 2UV8A 1R0BG 1AXQA 1Y5NB 2M2BA 4A8SA 4FYWB 2XZDB 2B4OA 1IKWA 3PCOB 1RWVB 1YJ7A 4GC7A 1KVIA 4DV6F 4JI0J 2LEAA 1ZTTA 2J5AA 3DMJA 1C1BA 1EB0A 4PABA 2KYXA 4LBHA 1TK0A 3QT6A 2KFZA 2QLJB 4FKYA 2FB0A 1J5EF 2VB6A 4DF4A 3OV7A 5JMNA 1AZSB 1S5ZA 3IM9A 3D6MB 1VK8A 5C2GA 5EDWA 3BO4A 1MLAA 4K4YA 3D9BA 5RUBA 3TZXA 2PN6A 2CVEA 1LFWA 3OR1B 2OH2A 3C15B 2VBZA 1L5UA 1XIQA 1CPZA 2FIUA 3PXGa 2HHXA 2E5LJ 2HFOA 2CPHA 4IG0B 3J7AN 4LF8F 3E2EA 4NMXA 3K89A 1S0MA 1EHWA 2R7VA 2OKQA 2C3MA 1R7IA 2CDQA 3TEHB 3BZQA 2D1CA 3ETOA 4FBTA 3BPSP 2C2OB 4PWWA 2BANB 3JQKA 1RU1A 2CDRB 1WG4A 4JI2J 3AJDA 3I0RA 2ALZA 4RW9B 1S4EA 3P49B 1BWVA 2FVQA 2XNRA 2R7RA 3TA0A 2PT0A 1RP5A 2V63A 2FGOA 2WVCA 1X4HA 1VISA 2Y1JA 4F3OA 5LXRA 3PR5B 2QJ3A 1NK5A 1QSLA 3CC7S 1W26A 3LF0A 5J2MB 4ED1A 1XMOJ 3PIPQ 4PG6A 3SI8A 4C3MA 2HHVA 3QIPB 3V6KA 2K7KA 3QLHA 4TY8A 4QIFA 3E3XA 4F0HA 2FJEB 2YX7A 1A6LA 1FKOB 3TUJC 1RWPB 3N5BA 3QIDA 4MMOA 2ZVIA 1MWQA 1NK6A 3N6NA 3VZIA 4JI4F 4ATNA 1FESA 2FGCA 3POTA 4NA3A 1EETB 1FJCA 3VF0B 2WW8A 2KHCA 5ETOA 2DGQA 1PJ5A 1RU2A 2HFVA 3H2UB 3D28A 4A8YA 5KFTA 3AXMA 2WVEA 3AD7C 2PD1A 1B0VA 4TXSA 4EWTA 5FDLA 5BR8F 1WHYA 2B56A 4I2QA 1KLNA 4N47A 3UNGC 2YVSA 1NPRA 1ZM4A 2I5JB 1OY8A 2EFNA 3PO4A 3ZZUA 3NOCA 3W63A 1WELA 2EFOA 3TQ1A 4PXEA 4QR0A 2ADBA 3B54A 2J6SA 3HULA 4A8MP 3K17A 5KFFA 1MWZA 2MLXA 2HEKA 2V9WA 2W2NP 1UVIA 5HI7A 4FZVA 1SUQA 4RX6A 1K0TA 2L9DA 4WTYA 1UW4A 5LMUF 2X1AA 4F36A 4PG8A 1W2IA 2HFUA 4BCAA 4USVA 5K5MA 4DR1F 1AFJA 3RBZA 2R7UA 1HI8A 5BYRA 4CLFA 4FNHA 1C0UB 5AT1B 3TP2A 2C22A 4R5PA 1AT1B 3UW1A 4MJKA 1RWMB 3OTCA 2H5JB 2UXCF 3ZFVA 4CTAB 2ZH2A 4OZ2A 4C98A 1NMEB 3P5TL 1YJ9S 4UOCA 1IKXB 1H73A 3JSMB 2YNGA 4OJHA 3CJKA 2GHVC 1S1XB 4MAKA 4ALZA 3I96A 1X4EA 3C46A 1RQ0A 1T0TV 4DFMA 4L76A 4K4ZA 3SIPB 2HKEA 4ZPWR 1TL7A 1R8CA 1PCAA 1KR4A 3THVA 2DISA 3EXYA 2W4PA 2FVPA 4OYIA 1RT7A 4C8MA 2WSEC 5HROB 1B0TA 2AYBA 1EKSA 2GQ2A 3J7Z5 3H2VE 4WFXA 1KHVA 1MROB 1X5OA 2LXIA 3FCHA 3ILOA 1GXLA 5DGBA 3MMAA 3MEKA 1ZA2B 4OX7A 3DRPB 4RUBA 2HMIB 2ZKUA 2B9XA 4CH0S 5A8WA 2K8GA 2VG5B 3Q8RB 4PAAA 5DQHA 2B9YA 1Q0NA 3W66A 5B7WA 3FEZA 4IDKB 4OYBA 1EAYC 3CJTA 1UWBA 5J2NB 1F5BA 1YGYA 3VQSA 3KJVA 2AZ3A 2UVUA 4X66F 3TI0A 3A3PB 2DNLA 3PEJA 4RW8A 4WKYA 4ENOA 5DQIA 1OPIA 2CQ0A 2WOMB 4ECRA 2PMHA 3IG1A 5JJBA 3X1LB 1UJ5A 4P7VA 2HQGA 3U1LA 4DSEA 1IBLJ 4NLOA 5LOQA 5F8GA 2D3OR 1XR7A 5KFEA 3CULA 3VAFA 5B0FA 1TR0A 1RI7A 3C16A 4YQWA 4DR6J 5AJ3F 1S7IA 4M5MA 4NX9A 3CWJA 4ECYA 3TZYA 1T9VA 1NPPA 3KLEA 1WACA 4OI2A 2HWIA 2ZHOA 4GKJJ 1QVGR 4DDFA 4KKOA 1HMVB 3R9LA 1HLWA 3HLUA 4Y0FA 1RCXB 4RZRA 2IMOA 4ZVPB 1KKHA 4DCOB 1DTQA 1A0OB 4WE1A 3KG4A 1WF2A 2Q66A 1GMVA 1PILA 2GJIA 2DGOA 5CAAA 2HZCA 3HFKA 6AT1B 2VF3A 1FNXH 3G82A 3MPDA 1BQNB 3UVJB 4DR2J 2DGUA 4OX8A 5E7OB 5IM0B 1XNQJ 4ZHRB 3W5ZA 1XEZA 3NAIA 4HLBA 4WK3A 3KHRA 3MAHA 4ZN3A 2HQDA 4USTA 2HBQB 2RHSB 4ZPBA 4DPUA 1XN9A 2ACMA 2FZGB 3BKFA 4ZPCA 2UXDF 2BM1A 4ZLLA 2RRNA 5IV4A 1V9OA 4CT8A 3LPYA 1NXIA 3P5BP 4X4TA 2FDNA 4HHJA 3PJWA 1S79A 3M8PA 1N0UA 1VC5A 4B3RJ 3NS7B 1N5YA 2PIIA 4ZVGA 4TKTA 3RUBL 3LTOA 2JC0A 5IWAF 2Y0SD 1OY6A 2V0NA 1CVJA 2IJFA 1WEXA 1YHQS 1B0PA 3TVYA 1VR6A 5D0GA 2M52A 4NASA 5D0HA 2HAFA 2E29A 2DEIA 3T1HJ 4FDFA 4XO0A 3HDSA 2OFGX 2NZCA 1IKWB 1REVA 3EE3A 2OPQA 4CO2A 1C1BB 2DB1A 4DV5J 2J6UA 5EWGA 1VBZA 2HW3A 1RBLA 4ZP7A 3D4JA 4CO4A 2Q79A 2L08A 3BBCA 3CJ2A 3JTOA 2V2QA 1ZBTA 3K59A 1KONA 3GJSB 2AF6A 2XYPB 3ILIA 4M5DB 3C6UA 2CWXA 3M2VB 2OTJS 1U2FA 4LVNP 1F1BB 4B3OA 3DOLA 1UZDA 2HBRB 5BYQA 1KP6A 3ET6B 5LM7E 3NLCA 1UJ4A 2CPZA 4ERDA 4ILMA 3SV3A 1M5HA 3CNQP 2OPRA 1WC5A 3BH6B 3DHWC 4PPZA 4OYWA 1C0TA 1JLAA 4KYZA 1UVLA 2Y1RI 1B7FA 3ZZRA 1NSQA 1JK9B 4JI1J 4UOHA 3PJXA 3EX7B 1F3FA 3OUYA 3RBEA 4ECXA 4Y34A 3I0RB 3PACA 3NOGA 3CO9A 2AJ1A 5L38A 3BO2A 4DR7J 3HSZA 4G6VB 3A1YG 3UCGA 3G8TA 3R5CA 3T6BA 4OZJA 1RJJA 3H5SA 1L3SA 6FD1A 1YRXA 2A6MA 2KT2A 5A76A 2XWXA 3BR9A 1Q4RA 1RTIA 2LXFA 1IKVA 4IOCQ 4IQMA 1K0VA 4FKXA 3L09A 4Y00A 1NDKA 1CS4A 4L6V3 4ZVRB 2PE8A 3QLHB 4TY8B 1P1LA 1N56A 4J91A 4K59A 4DSFA 1RABB 4FXDA 3F56A 5EWEA 4EZ6A 4MKVA 2CRLA 2DK2A 2EKNA 2RKIA 2VH7A 3OTBA 3GILA 1F6TA 3UDEA 4LF9J 1T11A 4LFBJ 4LF7F 4P6QA 4B3MF 4X4PA 2P8IA 4GMKA 2P9EA 3BDPA 2QA1A 2HIQA 3V4IA 5GAEU 1ELOA 1X4CA 3CDEA 4NYPA 3GFXA 1SH0A 1HBOB 3OR2A 1SJRA 3UN3A 2K2PA 1F9HA 1JNRB 5HQMA 4NLDA 2ZNZA 1YX2A 1IR0A 3CTRA 2J8SA 1F9EB 2YBVA 3NNAA 1XMQF 2K06A 2XNQA 4X62J 2CQ2A 2D69A 2NCKL 3W9JA 2OI2A 3C6TB 1CULA 3IRXA 3VCDA 2ROEA 1RHMB 1N34J 4J9PA 2F1FA 1NHKL 1RT4A 2HFNA 9ATCB 2R8HA 4CNZA 1T05A 1VQ4S 1DARA 2CQPA 1UL3A 1S4FA 4CNYA 2O5DA 2R2UA 4R5PB 5D6GA 3JTPA 2MXYA 2HBYB 2HS4A 4RW4B 4ZLPA 1NSPA 2VC0A 4P7TA 2RDIA 3FFIB 1NBEB 1VQYA 5E3CA 2YNGB 3CJKB 4F8RA 1OY9A 3AD8C 2XSFA 5CD4H 5IOLA 3SSSA 4B9SA 2CG4A 1PAUB 1WHVA 1QD1A 1TZ0A 2DY1A 3AY0A 2MY7A 5IQQA 3UQSA 2DNGA 4GKKJ 2AT1B 4U8YA 1DQ9A 4Y65A 1S48A 1VIXA 3CC4S 3M4XA 3NRBA 2ZJRQ 2ZWPA 2ALYB 4C6AA 4F2SA 3R8YA 3DKDA 4UOFA 1VQPS 3MMAB 1N33J 2EW9A 1JJ2R 3PX0A 1U24A 1GEHA 4QU7A 5A8WB 4X84A 3VVUA 1FTCA 2JC1A 1HNXF 3EUNA 1JXVA 3Q8PB 2QMXA 3RB6A 1JLCA 2VG6A 1FJ7A 1OYDA 2C42A 2NQPA 1KOOA 1HKAA 1NJZA 1KQKA 1Q82T 3KJVB 2VFUA 4QIGA 4CLKA 4PG5A 1E6VA 2E1MC 3RTVA 4J9RA 2MLYA 1BGXT 4O3RA 5HL7Q 2XSJA 2CG8A 4J9SA 3KK2A 3TVKA 1APSA 3Q24A 4OIXA 2M8HA 1UVMA 5F8HA 4O4GA 5G4DA 3B82A 3C16B 4AXIA 3IAM9 4NLVA 2MQNA 4DPXA 1VGYA 2XMUA 3MR2A 3PV8A 2UVRA 2DIVA 3F73A 5U47A 4JP8A 4C8KA 4WU3A 1DTQB 1EQMA 1WF1A 2F65A 4F2RA 2R42A 4P75A 4AD6A 4C0HA 3PR4A 5KAKA 2MQPA 2DGTA 3ULHA 2KZZA 4OZ3A 3QJJA 2RRBA 4DHVA 1LWEA 5HQ8A 1F3VA 1HQUA 2RH3A 3L7UA 1YZ7A 3OTEA 2JDJA 2DNKA 4J9VA 5L1KA 3NCQA 1WI6A 3MD1A 3JXOA 2B6AA 2DBBA 1H7XA 5E3AA 1D9DA 3PW2A 2V94A 2HSEB 1WF0A 2V4JA 2E5HA 3WX8A 3RR7A 1Q8KA 4ER8A 1UEUA 4TU9A 3KG0A 3M8PB 1Z4UA 4Q43A 3D67A 4IH7A 2MHEA 2HLTA 1WG1A 2VOOA 2J0XA 4DCPB 4DX7A 2IY5B 3SSRA 4ILLA 1FKPA 2YX1A 4F4AA 4CLYA 1WKLA 3FQKA 3CT9A 4ED6A 4RNOA 2WHOA 3QJPA 4CO0A 1FWKA 3VGVA 2YWEA 1REVB 4KGXB 2OPQB 2V67A 3SQGA 2QX0A 2ZFHA 5LSOA 1HNIB 1NCLA 1RT5B 2P2CB 1NUEA 1JXLA 1QE1A 2VKRA 1TL1A 3DYAA 4OFZA 1RYRA 1V3SA 1MMLA 2OJ3A 5CXTA 3U1NA 1FDDA 3US5A 1FRHA 3TOQA 3H5YA 3UNYA 2Y8YA
chains in the Genus database with same CATH topology
4F50A 3BQ0A 2ERRA 3MUTP 1N5VA 3WX4A 3SEOA 1VLYA 2DHSA 5KG2A 4CIOA 3MMBB 2N82B 3OSNA 3DOKB 1ZZNA 2J7UA 4B3OB 1BC6A 3I31A 2OPSB 2AV5A 4KO0B 5JUMA 3DOLB 5KG3A 4EBDA 2IC3A 3KNGA 2W9BA 3KMSA 3S1TA 4IOBA 4ED3A 4B3SF 4RW6B 2V8HA 6FDRA 3DI6A 2O01C 3HPOA 2XMWA 3CIZA 1RWUA 1KS2A 2ZUGA 3LP0A 1CG2A 4LSLB 4UW2A 3PX6A 4B9UA 1YITS 3MOJB 4HYKA 5D8HB 4XPEA 4DQSA 2E1CA 2U2FA 4I4BA 2HQIA 3DHXA 1HWJA 3DXSX 2WAQD 5J2PB 2ZH9A 1OSCA 1F5CA 2IYIA 3TX8A 2MKKA 1JLAB 5L1LA 4NZ0A 4KE5A 2LXUA 4QQBA 4DR4F 2UUCF 1NKBA 4OZLA 3OTDA 5E2QA 3N28A 3MR3A 1XWLA 3KMQA 4DV7F 5E3PA 1N0VC 2LA6A 3QAEA 2V8DA 1YBAA 5F8LA 4DQIA 3EZ5A 4JI7F 4G1IA 5L9NA 1X5SA 5KFQA 2M0GB 1G1XA 2RQ4A 5I3QA 4C11A 1YSJA 4Y3CA 1FJGF 3MDFA 5G0RB 4PWUA 5LMNF 4F4YA 1NEEA 3T1AA 4QWEA 1S6QA 2LEPA 5CYMA 5CA5A 4XPCA 2CPJA 4CO3A 4X4RA 4X4SA 3M6VA 4FF1A 3CD7A 4BWJA 4PXCA 3U7JA 4RU2A 5I42B 4N8OA 2KTQA 4IYQA 3BGLA 2FJXA 2HNDB 4DS4A 5GMKa 5D4LA 4NLRA 2QLWA 4OX6A 4ED2A 3BDEA 3M2UA 3CDUA 2XG8A 2YKAA 3NL0A 1N54B 1VQKS 5KOXA 3VTIA 2QZ8A 3MEGB 4QIVA 2DCLA 2W7OA 5L1IA 1FT8A 2FVRA 1FRKA 1VQ7S 3IC1A 1UVKA 1X4GA 1R8HA 3G86A 2YNIB 4WFBQ 4IRKA 5EWFA 5LSRA 3LAMA 5AXMA 1HWLA 2MZJA 2CQIA 1R3NA 5KG0A 2R7QA 1HBOA 1VMBA 1FJEB 3MCSA 3KK1B 3POTB 1DTTA 1FXRA 2VOPA 1YG0A 1I1GA 2DCUB 1XR6A 2NPIA 4QYZJ 3PKYA 2BA9A 5HLFA 3TA1A 1GH8A 3CJ3A 3VAGA 4DOZA 1RTIB 3O3LA 4IR1A 2GC8A 4XDCA 1IKVB 2ZOFA 3OJUA 2BQUA 1C0UA 2J7KA 2ASDA 2NS1B 5J2QB 1YI2S 2J9EA 1VRUA 3TAPA 2D7SA 3DRYA 4O3QA 4K4TA 1P6TA 2HVHA 1KLMB 2AX1A 2IAJA 1F0XA 4JI0F 4J9KA 1GTHA 3H5UA 3V5RA 3QZ7A 2Z2MA 2ZOMA 5FDLB 2QYCA 3QYYA 4BC7A 2R7OA 1UJ6A 2W9CB 4KR0B 4I2QB 4RNHA 2YTCA 1J5OB 1FO1A 3MGJA 1VQ8S 3CCMS 3IR7B 2ZHAA 3LP1B 2BM0A 3G4SS 3DDNA 2AYMA 2AGQA 2DJWA 4YB1P 1NKEA 1U48A 4PPDA 1NH8A 1JLBA 4DPOA 2KH9A 4TYAA 3C6TA 4ECVA 3JSMA 3PFEA 4AUKA 4C0BA 1WNEA 3L3CA 1SB6A 1X0FA 3D1HA 2KRBA 1H3DA 3I9V9 4Q7AA 2KN4A 1TKXA 1S0OA 3VAIA 3MI7X 2MDAA 2PA3A 3S7RA 2VODA 4MKBA 4DL0C 2RKIB 3HKZD 3VAKA 2MZRA 3L7PA 3IO1A 3H4BA 3NMAA 1NJWA 2DVIA 5CYQB 4M95A 4DL6A 2LKZA 1GX5A 5CYJA 1JLFB 4DR3F 2CJAA 2VBYA 3SFGA 4EZ9A 2YWHA 4I69A 1JXEA 1NK0A 3WZ0A 2P5VA 4NLPA 3RRKA 2WBMA 1WEYA 4QIEA 5DO2A 1QVFR 4O23A 1ZAXA 4NLWA 1SUQB 3UFCX 4YOEA 1H98A 3BJYA 2B7BB 2V4QA 2JEIA 2JLGA 2VA2A 4FN5A 3FVYA 2FD2A 4K0KF 1HL6A 3MM9B 3AB2B 3BM7A 1Q8IA 3IGNA 4KGKA 4J37A 3TW0A 5KG7A 3J7YU 3K8VA 1TL3B 1N88A 2FVSA 3R5AA 1QAYA 5FD1A 1NKCA 4RW4A 4J9NA 2LDIA 3NNHA 4F4WA 1IXKA 1HHTP 1FF2A 2DHXA 5D78A 1R6YA 1XERA 2VV5A 2JRSA 1Q16B 2GFFA 2NSBA 1GXTA 3FFIA 3UR3C 4BBYA 5M2UA 2BQRA 2DPIA 2FLNA 2O1PA 4FS1A 4RBUA 1S76D 3FDSA 4IQXA 1ROFA 4A8QA 1SJFA 3QGPA 4KFBB 1WTFA 3PZPA 4IOAQ 1H0HB 3DRPA 1U2RA 1UP1A 1P9QC 2R7TA 5E5NA 2OPPA 2GIRA 2GGPA 5M2RA 4K5RA 5IZHA 1FXDA 5C24B 3VWSA 2CPYA 3GZ7A 4D3HA 2MSSA 4MK9A 4ES1A 2UVVA 1L3KA 3OFEA 2BXJA 1VS3A 3O44A 4Q2MA 1ZH5A 4E0DA 4JI2F 4P2SA 1NK8A 2CPFA 1OO0B 4EYIB 1AW0A 4USIA 2HS3A 1URNA 5BYSA 2ZD1A 2YWKA 3THTA 3GYXB 3M8QB 1HD1A 4C9DA 2WBRA 1ZM3A 4K5SA 1RA6A 3GV7B 2UU9F 1S77D 3CDWA 3PM9A 2BE2B 2XO7A 1U45A 5DG9A 1SKRA 2B9WA 2A1BA 3BSAA 3IRXB 2A2DA 2LQ5A 1WD6A 3DN9A 3MM6A 5I3PA 3OFGA 4CO5A 4JV2A 1M1KT 4O3OA 5J2NA 3EYZA 3M6WA 3SDEA 4ZP8A 3AQPA 1Q1KA 3FZ2A 1NNDA 4ECZA 1VRTB 3QO9B 5A6PA 4LUBA 1TAUA 5F41A 1T02A 2G9OA 3R1LA 2QA4S 1S49A 2JEJA 5F8MA 4I2PB 2WOMA 4W90B 2HNZB 1TKZB 1H38A 3CEDA 1JLGB 4DL2A 2LLZA 5FJ4A 3ZZTA 3RAMA 1ZOTA 4URSA 2BR0A 3DM2A 3MHYA 3DNCA 3CF5Q 4ED7A 1JIHA 5CCLA 2DD8S 3RAQA 1S6OA 1UKUA 1YIJS 2LCWA 4F3MA 2Q6CA 4WYLA 1URRA 2KVIA 1RT7B 5I3UB 3KLFA 1XMOF 2B3TB 4Y28C 4C3LA 3D1QA 1TQLA 3I5AA 1HWIA 1Y0HA 4ZS6A 2U1AA 3M32B 4USHA 5E0OA 5KFLA 1IJEB 2E9TA 3DCAA 1HNZF 1N6QB 1YJVA 2NR0A 3R1HA 4QPXA 4MYUA 5KOWA 3U27A 2BBEA 4JI3F 2HQ3A 3V6DB 4QR1A 2W9AA 3IRWP 2I8EA 3AA8A 1F5AA 4JI8F 3TRGA 1QAJA 4JV0A 5FIIA 1JLQB 3OFFA 1SV5B 3G6VA 1Q8LA 4NLQA 5DETA 5GAGI 3BO3A 2FC9A 3CCVS 1JJ4A 4ZVFA 5K8OA 3GIIA 1LWFB 1HBMB 2IRYA 2QE5A 4V19J 2UP1A 2N4DA 3RW6A 4QR2A 5GADI 2FLPA 2E66A 3N4WA 1HW9A 4L3NA 1E6YB 3LP2B 1S1UB 3THPA 1IQZA 4Z2XA 2ABYA 2VG7B 1HD0A 5CCMA 4Q45A 1HBUB 2WB4A 1WEZA 1D8ZA 1R8PA 2OSQA 4KQZA 4CO1A 1KN6A 2IRXA 1DURA 5HBMA 4I68A 5KFAA 2M7SA 3FSXA 2BYCA 5K8MA 3P96A 5F0UA 2QV6A 3KHHA 1JB0C 1Q7YT 2BZ2A 3W2WB 1LWCA 5KG4A 5DS7A 2DGSA 2V2KA 4B3TF 2XS2A 3KLGB 2RS8A 2FHJA 4ZMMA 2XMJA 3HM9A 2JEGA 3SCIE 2GNKA 4FPRA 3Q22A 1LW0B 2XCAA 4A8KA 1X0PA 5DDPC 3K2YA 3GYNA 1VQOS 3BREA 2AJ4A 2A3JA 5B0GA 1NO8A 3OVBA 4A8FA 2AYGA 3KKFA 3N79A 5KT5A 3IN5A 3FGVA 1UWBB 3W2VB 2C3UA 1HFEL 2CVIA 2LQBA 5KFSA 5F9LA 3FSIA 2YNFB 3KFWX 1VBYA 3LO3A 4DLEA 4B9VA 4RW8B 4KV8B 2DH9A 1LQ9A 2IA6A 2HS0A 4DV0F 2C2EA 2ILYA 1BQNA 4R0JA 3DLLQ 2D41A 2DO4A 5IM0A 3QAUA 2M4MA 3MTKA 4QJVA 3IG1B