1KQSR

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqsR00
1FXLA 1FHTA 2MZTA 3CCSS 1VQ5S 4IOCQ 2ZJRQ 3G8TA 3S8SA 4IOAQ 5LJ3Y 1M5OC 2RRAA 2DIUA 1WEXA 3UCGA 2WBRA 3G4SS 2ZJQQ 3R1LA 3G96A 4TLQA 2KRBA 3DLLQ 4LIRA 5H1SV 4F26A 2CQPA 4QPTA 4WIIA 3CC7S 2AYEA 3IRWP 2LEBA 3VF0B 3EGNA 2DNPA 2X1GA 2M9KA 2KYXA 2DNQA 3TYTA 1WI6A 4W90B 1U1PA 4LJMA 2DGSA 1FJ7A 2LA4A 1L3KA 2M52A 2CQ2A 2DGWA 3MDFA 2CPJA 3S6EA 5EN1A 2MY7A 2DNHA 1X4BA 2CQBA 5GVQA 2KG1A 2FY1A 1U1OA 3MI7X 3BO3A 2MZQA 2L41A 2DNKA 2D9OA 3MUMP 3RW6A 5IFMA 4RU2A 1YTYA 2RS8A 1M5VC 1M5KC 1P1TA 1YWXA 3U1MA 1VQ9S 4OZ1A 1K9MT 3CPWR 3CCVS 3J7ZT 1JJHA 2CQIA 2KHCA 2DGTA 2CQ1A 4C0OC 1S72S 3EX7B 3BS9A 3JB9k 1NJIT 2J0QD 3P49B 2CPEA 2HVZA 1WF0A 3CC4S 1B7FA 3P5TL 4TU7A 1F9FA 2CQGA 1WI8A 3J7YU 1WHVA 2XB2D 3S01A 4U67Q 1SXLA 1UW4A 2DGQA 2MQNA 3SDEA 2KH9A 2KXHA 3CD6S 3PIOQ 5GMKa 1WG1A 2JVRA 2KM8C 3RW7A 2DK2A 1VBYA 3CULA 1WG5A 1A7GE 2K8GA 3SDEB 1U1MA 2X1AA 1VC0A 1N52B 1CVJA 2DH7A 1X4GA 5FJ4A 1WEYA 2RT3A 2DH9A 2F9DA 3G71S 3OW2R 3MUTP 3UWTA 2ZJPQ 4J5OA 2RRBA 1N88A 2MGZA 2N3LA 4PRFA 1WHWA 1VQPS 4C4WA 2MKSA 1A9NB 2YH0A 2F9JA 2M8HA 2MGZB 1WHXA 5DDRC 4C7QA 3R1HA 4OZ0A 5GAHU 2Q79A 4WFAQ 2CPXA 4CH1A 2U2FA 2DH8A 1VQ8S 2EVZA 3FEXB 3Q2SC 2CPIA 4FXVA 2SXLA 5LSOA 3US5A 1URNA 2OSQA 3VAKA 2LEAA 2RUGA 2DNNA 4Y0FA 1U1LA 3G8SA 2LXUA 3MOJB 2MQOA 2MPUA 1X5TA 1Q86T 2DNLA 2UP1A 5ITHA 2A3JA 1BY9A 3H2UB 3CCUS 1SJFA 2MB0B 2CQ4A 2N3OA 1P27B 2DNZA 2V94A 3BO4A 3CC2S 1YITS 2MQQA 2FPHX 2XNRA 2M2BA 3MURP 2G4BA 2XNQA 2ERRA 1W2BR 3VAFA 2ADCA 3CCMS 2GO9A 2D9PA 2JWNA 1WELA 1U1RA 2KXNB 1X4CA 2AD9A 2MMYA 3DXBA 2RQCA 4UQTA 2CPDA 1N8RT 2K3KA 1M5PC 2XS2A 1ZH5A 2EK6A 2DO0A 2YH1A 2CJKA 3ZZYA 1RK8A 2LCWA 2MZ1A 3UE2A 3NS6A 2RNEA 3L3CA 4BS2A 2CPYA 4WFBQ 1OWXA 2YWKA 1VC5A 2GHPA 3SXLA 2MQPA 1IQTA 4CH0S 1HL6A 1M1KT 1AUDA 5CXTA 2MXYA 5JVGQ 4PR6A 5GADU 1U6FA 3LPYA 1VBZA 4V19X 2HGNA 1DHMA 3VAIA 3SMZA 2RU3A 1Q82T 4IUFA 4QU7A 3ULHA 2F3JA 2HGMA 1WF2A 5DETA 4IO9Q 1FO1A 2LQ5A 3MUVP 4TU8A 3R27A 1WHYA 3UCUP 4P6QA 3THTA 1WG4A 2LECA 4WCEQ 5LXYA 2E5JA 3THPA 1YI2S 2QA4S 4YOEA 5IM0A 5JVHQ 2PE8A 2MZSA 2M88A 2FC8A 2CPHA 2KRRA 4M5DB 3PIPQ 5IQQA 1VC6A 3Q2TC 5IM0B 3HHNB 2NZ4A 2DNGA 1VQLS 2MQMA 4W92B 2EK1A 3ZZZA 4QQBA 2DHGA 2LA6A 2M70A 1H2VZ 1OIAA 5BJRA 5GAGU 3B4MA 5LJ5Y 3I56S 2PEHA 2RQ4A 2XSFA 1YHQS 1DRZA 2L9WA 4F02A 2CPFA 3K0JA 3D2WA 5DDOC 2RVJA 3G9CA 3I55S 1R8HA 3TP2A 2CQCA 2J76E 1NU4A 1JJ4A 3UD4P 3P6YC 2MY8A 3CF5Q 1SJ4P 1H2TZ 2DNMA 3CCJS 2HGLA 5CA5A 1D9AA 1VQKS 1SJRA 2RS2A 1X4AA 2M0GB 2MKCA 2LYVA 1YJ9S 1OO0B 1VQNS 3H2VE 2M4MA 2LXIA 1PO6A 5D77A 2NLWA 3FEYB 4F25A 1U2FA 2O3DA 1NO8A 2DGOA 2ADBA 2AYBA 3V4MA 1QM9A 3IWNC 5GAEU 5DM7Q 2XS5A 1PGZA 1YIJS 1KC8T 1X5SA 2KVIA 3CMES 2DHAA 3TO8A 2J8AA 5HO4A 2DNRA 3MXHP 2CQ0A 2M7SA 3S7RA 2MJNA 4CIOA 1YJWS 2BOPA 1SJ3P 3CUNA 2QFJA 2OSRA 3NS5A 2CQ3A 4QU6A 5D78A 2JVOA 2DIVA 1QVFR 3HI9A 1FT8A 4YUDA 2MQLA 4LMZA 2E44A 4WFNQ 1S79A 2KFYA 2YKAA 1R8PA 2FC9A 1VQMS 1HD0A 2DITA 4CQ1A 2DB1A 2HZCA 4EGLA 4ERDA 3VALA 2J0SD 2E5IA 1Q7YT 2KN4A 2DNOA 1DZ5A 2E5HA 2KU7A 4YB1P 2MSSA 2MZJA 2KT5A 3MD1A 1SJQA 2B0GA 1KQSR 1RKJA 2KG0A 1VBXA 1DBDA 5MLCV 2X1BA 2XS7A 1FJCA 1X4FA 1VQOS 2AYMA 2CPZA 1O0PA 1JMTA 1ZZNA 5DM6Q 2JRSA 2MKHA 1YJNS 2DHXA 2YTCA 2AYGA 2QEXS 2CQDA 3NNCA 2MJUA 5DDPC 3NMRA 3CCQS 2I2YA 3UD3P 3BO2A 2OTJS 1WTBA 2OIHA 2OJ3A 1X4HA 1H6KX 2CQHA 2N7CA 1U1KA 1ZZFA 3EGZA 2VONA 2MKJA 1KD1T 3LQVA 1WWHA 1N54B 2VOPA 2U1AA 2E5GA 3BEGB 2VOOA 1OPIA 1X5OA 3CXCR 3VAHA 2DNYA 2I38A 2MSTA 2DGXA 1KOHA 2L08A 2HYIB 5HL7Q 1U1QA 1QVGR 1XN9A 2KM8B 2VODA 1JJ2R 3NNHA 3MD3A 1FNXH 1D8ZA 1VQ4S 4FXWA 1K73T 4ED5A 1G2EA 2DISA 5LXRA 3B4DA 3N9UC 3NNAA 1UFWA 2MKIA 1U1NA 2OTLS 1HD1A 1X5PA 2DHSA 2KXFA 2G0CA 2G1DA 5LSLA 3CTRA 1VQ7S 1U6BA 4Y00A 1UAWA 3CMAS 2JX2A 4A8XA 4WF9Q 2N82B 1KOOA 1X4EA 2MZRA 1HA1A 1Q81T 2DGVA 2M8DB 3U1LA 4UY8T 4WKRA 3P3DA 4TU9A 3CCRS 2MHNA 5CYJA 3CCLS 3G6ES 2D3OR 1FJEB 2MYFA 3CCES 4ZKAA 1X4DA 1WEZA 1K8AT 2BZ2A 1VQ6S 1X0FA 4PKDB 3VAGA 3VAMA 3VAJA 4Z2XA 2LKZA 3UCZP 2MKKA 1WF1A 1UP1A 2LMIA 1H2UX 2X1FA 2FHOB 5DDQC 2KI2A 2DO4A 2DGUA 1M90T
chains in the Genus database with same CATH superfamily
2V69A 4LF4F 1M5SA 2VV5A 1VQ5S 2X3DA 4ZPDA 1LW0A 2WBRA 4I2PA 1YRUA 4C3LA 4WWSA 4B3OA 4RNHA 2DNPA 2M9KA 3IMQJ 4BWJA 1JNZB 3LP2B 1FJGJ 2DGSA 4DFPA 3C8YA 2L3MA 3R6LB 2V34A 2W7OA 2CNNB 1LWCB 2F5GA 4XAKA 2EFPA 3IAM9 1Y0HA 4UUWA 3BSNA 4JV5J 5EN1A 1S4FA 1G7CB 2GFFA 5AJ3J 1KEKA 2OKQA 1U1OA 3DOLB 2DNKA 1NJWA 1VHFA 2E9ZA 1IR1A 3ETOA 3Q22A 1V9OA 1AFIA 2QMXA 1S0NA 2CQIA 5B0DA 3BS9A 3P49B 1U45A 3KDOA 4TY8B 4ED7A 3EMTA 1XIQA 4MT1A 1GNKA 5L9NA 1T9WA 2DGQA 2I5JB 4DJBA 5G0RA 1P6TA 4LF7F 3KLEB 4IQMA 3CDWA 3MM7A 4QYRA 4ES2A 2GAHC 3HKZD 2HWTA 2YNIA 2MGZA 2VBWA 2WOMB 2I1RA 4HACB 2MKSA 2ZOMA 1CQMA 1VJWA 3A8EA 3OL9A 1HFEL 4OZ0A 2DH8A 3EWGA 3FEXB 1URNA 2V4QA 2AJ0A 2B7CB 1W7WA 1VQYA 4I0WA 2KYZA 4NXMJ 2OPQA 2QL5B 4RW8B 1N32J 1X5TA 4WZQA 2R7XA 2CQ4A 2KJVA 4FNHA 3MPWA 3MMAB 2G4BA 2OD4A 1L3SA 5KFEA 2AT1B 2ROPA 1OY6A 3PKMA 3LGMA 3GV7B 3EUNA 4AXJA 2AP6A 1GT8A 3PW5A 1ZAVA 3CW2C 1VC5A 3LP1A 2MQPA 1HWUA 3VQTA 4M8LA 2OPSB 4OZJA 3R5AA 5KT3A 1Q82T 2XG8A 1AXQA 3QT5A 1WG4A 2R42A 2VG5A 2HG4A 4QIFA 2Y1JA 5J2QB 2CJBA 3UVJA 5HROA 2DRAA 1FESA 2CDRB 2HFOA 5IM0B 1S1UB 3W5YA 1SUQB 1NSAA 4OHZA 3M30A 3B4MA 4PYAA 2Y1RI 1TMMA 1NPPA 2IMOA 1GXTA 3R7BB 4QR2A 1N56A 1FFWB 1HLWA 3M8WA 4I6WA 2R7SA 3RR8A 2AX0A 3NGRA 3UD4P 4MKYA 3M8RA 1H2TZ 2GIRA 2FJEB 3GYXB 3QPIA 1XMOJ 3KJVB 3H2VE 3BBFA 3CO9A 4ILMA 1MWZA 3ET6A 3P96A 4HKQA 1TKDA 4TXSA 5A8KA 5DM7Q 4OI4A 4FP9A 1GMVA 4DR2J 2KL8A 4JI2F 5GADI 4RJVA 1Q1KA 3IBFB 3UR0A 2OSRA 1LK5A 1YQHA 2QRRA 2YNFB 4CLSA 2NPFA 2YKAA 3QRQA 3M1VB 2D1CA 1AFJA 1UZDA 2W9CA 2GW8A 1UJ5A 4Y28C 4DUZF 4OHVA 2GC8A 3G82B 3POTA 2UVWA 3P8BB 5F8NA 2DNOA 2CXEA 4DV5F 1UVNA 1Q5YA 5KFNA 3I4HX 2N4CA 1IKXB 3GSIA 5IT9Y 5DZ7A 1J5EJ 4HL9A 5A2QU 3GFHA 1WOOA 2R3VA 1DAXA 2VDHA 3M8SA 2F7VA 3BSOA 1NSKL 2ZNYA 4QJVA 4Y2AA 3HULA 2DR8A 2I6WA 2JDJA 3DM2A 3CDAA 3DNCA 5HLFA 4LF1A 4RWXA 3ZZPA 1RHUB 1KLNA 3KMQA 1K73T 2AHOB 4ZVHA 3P45B 2VQEJ 2WW8A 8AT1B 2EPIA 4K4VA 3CTRA 2CRLA 4LQ9A 3L7OA 4KKOA 4FBUA 3TANA 4FYWB 2OH2A 3SV3A 3P3DA 1CJVA 2H5IB 3AODA 3BREA 1B64A 2ZNZA 2MHNA 3KJFB 2D3OR 4NOHA 4KBIA 1TL7B 3UI3A 3OLBA 5LMUJ 2HQDA 2XI3A 3IR7B 4NLDA 4OYXA 5CYMB 3GV8B 5HVFA 2K1RA 3BH6B 3TJAA 1IR2A 2HS3A 3DDNA 2Z57B 3UCGA 1IR0A 4TVAB 3MMBA 4ED4A 2BBEA 1WTFA 2WVDA 2HMIB 4QWAA 1CS4B 3D0GE 3TX0A 2LEBA 1MSWD 4WE1B 1RT2B 2GIFA 3QIPA 4LJMA 3T5KA 4DFKA 4XPEA 1HNWF 4I7FB 5D4NA 1RXOB 2VFSA 1XC9A 5AXNA 1D8YA 1JLBB 1BGXT 3TAMB 2DNHA 1LKZA 2KG1A 3VR1A 1CEZA 2FHJA 2GAGC 2B4OA 2QG9B 3GR0A 3QNWB 1FRJA 3EX7B 3I82A 3BSCA 2DRDA 2CQGA 3M9OB 2D7SA 4ECRA 4DL2A 3RUBL 2Y1IA 1S10A 3FNNA 3OXGA 3IWLA 1FX4A 3PJ9A 4Y2IA 3DN9A 2YWEA 3MUTP 2C1EB 1H73A 3TJ8A 4PRFA 1WHWA 3O6QA 5J2MA 2VBXA 1NZ8A 1V5VA 4DS4A 3HHKA 2GJFA 2QT7A 4O3OA 1U2RA 4KC5A 1ZM3A 1WC5A 4NCGB 4B3RF 4IOBA 4ID8A 4AL6A 4CTAB 4FS1A 3EDRB 4HT7A 3HDSA 4ECSA 4U7UD 5I3PA 2VPXB 4MH8A 4KV8A 1C0TA 2HBZB 4ANCA 3MM5A 1BMQB 2DNZA 2V94A 2CZ9A 3OUYB 1Y5LB 4D3GA 2WSCC 4USJC 4FYXB 4R0EA 1X4CA 4B3TF 1E6YB 1ZH5A 3FKBA 3PACA 3DLEA 4NYOA 2CPYA 4K7QA 1KLMA 3TVZA 2HURA 1F6TA 2UV8A 3NGSA 4Z37A 2MXYA 2YWFA 2B51A 3QWUA 4DQIA 1VBZA 3A1YG 2QV6A 2HGMA 1WF2A 4QWEA 1VRUB 3HHEA 5DGBA 3W9JA 4P6QA 1TFYA 4F7VA 4NEZA 1KNZA 1T9XA 4YOEA 2M88A 4YDDB 5IQQA 4PEOA 2DNGA 1I51B 4JYAF 3T5JA 2XTJP 1BWEA 9ATCB 2L9WA 4C8NA 5ETPA 5KFCA 1FCAA 2FJVA 4DV6J 4YB6A 2ZC3A 5B09A 1K44A 1HWLA 1S9EA 5A8RA 2OMOA 1X31C 3Q23A 3KHGA 1C2PA 2GQCA 4RW6B 2JJ4D 3MPUB 4FF1A 4ZVUB 1X9MA 3CMES 1KTQA 3D1QA 2DXDA 2YQ3A 3ZZUA 1ZTTA 4QU6A 1P8GA 1DQ9A 2HKEA 3LAMA 5KFPA 3QGGA 1H74A 1B4SA 4O0NA 1C1BA 4NXNF 3QATA 5D4PA 1SJQA 4GO5X 1DBDA 2J9DE 2NREA 3B6BA 4B3MJ 2ALYB 5EWFA 3U1NA 3GP9A 2OP5A 3GYGA 1FVSA 2ZOGA 4EZ9A 4CLFA 2CQHA 3JXOA 4ZHRA 2BUNA 3MM8B 4DV2J 1W2IA 2R7TA 1GX5A 4NRTA 3Q8RB 3R5GA 3SI8A 4DV7J 2XZTB 4ZPVR 3KK1B 2OPPB 4ZJQA 3GSDA 3VWSA 5HN0A 3RAXA 1TU0B 1VHIA 4CO4A 1TVRA 4BHQA 1I1GA 1RT4A 4LIWA 1EJ7L 3HZEA 1MMLA 3DGPB 3QAEA 4WKRA 3LP0B 2RH3A 1VR6A 4YHHJ 4DSJA 4PYDA 3W2VA 1U0HA 3C14A 4EBCA 5I3QA 3CCSS 1FDAA 2GQ2A 1TUVA 3M9NB 2UUBF 3OR2B 2IVFB 1F60B 4J37A 4KAIA 3W8PA 4AL7A 2X1GA 1RTHA 2D3O1 1TL1B 2FZCB 1NUEA 1TZ0A 4C8MA 4G65A 3HM9A 3MPYA 1QTNB 1BLUA 1SL1A 3KK2B 2L41A 2RD5C 3MUMP 4KB7A 5K14A 3Q24A 1VQ9S 1K9MT 2ZWPA 1T03B 2ZH1A 1HR0J 4I69A 2UU9F 3CC4S 3P5TL 4FF2A 1UCNA 2ZD1A 2XMAA 1SXLA 4DU8A 4BC7A 2KH9A 1T9TA 1TAUA 2K8GA 3NMAA 4Y2MA 1YZ6A 2BE9B 2X51A 2DH7A 5LMNJ 3X3UA 4NLYA 2JC1A 4P2SA 4XTTA 3B8HA 1UWBB 5KFSA 5L9XA 1B0TA 2HRUA 4IG0A 4RZRA 4O3PA 5GAHU 2LDYA 1QAJA 4O4GA 2E1AA 3PW0A 2Q3PA 2MKYA 2OD6A 3BGRB 5IXUA 4LSNA 4E0DA 2RHQB 4PXEA 4KR0B 4DOZA 1NRKA 3PX0A 3EXYA 1LW2A 3SV4A 1T05B 4ZVSB 4BLGA 1RACB 1SV5B 4JP8A 1SJFA 3HSJA 4WPAA 1HNIA 4J9MA 1H98A 2O01C 2XNQA 2D9PA 5BYQA 3M2VA 3MEDA 3L4BC 2NUUG 1CG2A 1U7LA 3DXBA 4DHVA 2JEGA 2J5AA 1TKZA 3C15A 3LAKA 5SUHA 1F5BA 4BS2A 3SCIE 3G2XA 4KFBB 1FD2A 2QLXA 4X2BA 2ZBRA 1HPZB 4ZP9A 3U02A 3RG6A 3TZXA 1F2GA 3LA0A 4KHRA 3QZ8A 1CJUB 1HMVB 2UVUA 3MM6B 1IKYA 2ZHAA 4CLKA 2G9OA 1GFWB 4USMA 2ZM6J 2FLPA 2Y0SD 5DZ6A 3W5ZA 3CDUA 3ISZA 2YPZA 4X4RA 4ECXA 2LA6A 4LRAA 5CQGA 3UR3C 2BJ9A 3IS9A 4ZVGA 4X62F 3ILLA 3OTOF 2XSFA 2VJVA 1V3ZA 3QBCA 2A2CA 1NK7A 2FJAB 2G2OA 1RAAB 5DDOC 1LNQA 4XIUA 3JQKA 4IH7A 5KFUA 3THVA 3MEGB 3SCKE 4LFCF 1RJJA 1SJ4P 1HQEB 3OTEA 3M2UA 2QSFA 3C6UA 2J9EA 2HWHA 4MKBA 1L3VA 3N6LA 4NZ7A 2CKWA 2HQ3A 2AGOA 1HI1A 4YMEA 3IWNC 1Q8KA 3GE9A 4K2XA 3KG1A 4I68A 1N5SA 1YJ7A 1TR0A 3HK2A 4WFNQ 1JLCA 2IBOA 4RO0A 2FC9A 3SEOA 3MF5A 1PBAA 4CLTA 1S6OA 1WC3A 1N33J 2XY5A 4OI3A 2WB1D 3UN3A 2CVIA 3R5CA 4RUBA 4E8UA 5F8MA 1KONA 1X4FA 3UN2A 4LF5F 1TP7A 4DQRA 3BM7A 2HRYA 3C16A 1OYDA 1PYTA 2R8KA 2C2MB 3BGOP 1G1XA 2UUWA 5CABA 4JI4J 4DL0C 5HMZA 2KJWA 3DXSX 3IR5B 3LO3A 2U1AA 2E5GA 4GMKA 4DV0J 2IA0A 1WKKA 2HEKA 1N48A 2FLNA 2KZZA 2P9EA 2MSTA 2UXDF 2RQMA 2UUTA 1AW0A 2Z58B 1RT7B 1FNXH 5ETSA 3GIMA 5F9LA 3B4DA 2PMWA 3DLGA 3W66A 2QN6B 1HD1A 4K4WA 1TUWA 4Y00A 3PW7A 4FVMA 4MIBA 5F0WA 3C6TB 5K8MA 2ZBCA 1U8SA 1Q4RA 4LFBJ 4X66J 3NLCA 2VICA 2YNHB 1E6VB 2HIQA 3FBBA 2AJ4A 1FJEB 2GX8A 3CCES 4OX9F 4TY9A 2IYGA 4DUYJ 2BVZA 3RBZA 2LMIA 4OJ3A 1F1BB 2Q6CA 5HJYA 4CT8A 5M2PA 4YB5A 4NLRA 2BANA 1M5HA 5THWA 3BBCA 3GJSB 1JLEB 2AJFE 4TN2A 3G96A 3ZZ0A 5H1SV 3OSNA 1NLKL 1YLXA 3VGUA 3IRWP 3EGNA 2RHSB 4MIWA 5LSRA 3TYTA 2LA4A 3HKWA 2M52A 5J2PA 2VDIA 3RYLA 1XK8A 3GFZA 1LXNA 4X4SA 2OPRA 3FCWA 3PRVA 1XQIA 3TA0A 2M5YA 1YTYA 2WB4A 3D66A 4H54A 3H5XA 4K5SA 4CYUB 2VG6A 1H7WA 2QIFA 3MR3A 3PV8A 2B5JA 3KKFA 2G0JA 4MK7A 1F3FA 5L1JA 2W4CA 3S01A 1ELOA 4KY3A 4J9OA 4PG5A 3EPGA 2R7VA 1ZAWA 4C3KA 4ECVA 1JLQB 2RT3A 3CJKA 1YRXA 2DH9A 2K7JA 2CZ4A 2FJXA 4UZBA 3Q0AA 4WBFA 1JLAB 2XBPA 1APSA 4ITSA 2CPIA 3H20A 4IDKB 2CNOB 3W9IA 1HBMB 1N5QA 2MQOA 3MTJA 1R8CA 4KGZB 1Q86T 1C1CA 2YNGB 2MB0B 2B9WA 2VASA 1NB7A 3RU0A 5C24A 3OBIA 1NBEB 3H5SA 1EP4A 2XY7A 7FDRA 3HVTB 5M2RA 1LWXA 2VG7A 4UQTA 1UMJA 3I31A 2GV1A 2MZ1A 5F8LA 3L3CA 2IAJB 3RAMA 4KIAA 3PG9A 4P72A 2YBVA 5RUBA 1DTTA 1IQTA 3MR6A 1HL6A 3AT1B 4X4TA 1RWOB 4V19X 4NL5A 3FCHA 1O6XA 1X0PA 2BE2B 1RLDA 2VPYB 4TU8A 1WHYA 1HQUA 3KWMA 5JVHQ 4ICLB 5LOQA 3UW1A 1T7PA 1VC6A 1M1GA 4LRBA 4HHUA 1P1LA 2EK1A 1RTJA 3ZZZA 2HBQB 2UZAA 1PILA 2V8GA 2M70A 1OIAA 3JTOA 2QLJB 2WVFA 3I6PA 3R7NB 2K06A 2PMZD 2RSQA 1KRPA 1V5IB 2M3DA 2ZHBA 4X65J 3CF5Q 2DNMA 1S0OA 1GEHA 4ZP6A 2ZUAA 2RS2A 2LXIA 4ZVEA 3BPSP 4GVLA 3H8YA 4K4UA 2JEIA 3S7RA 3CJ2A 3CUNA 5B0FA 1QD1A 5KG4A 2R2TA 5D3GA 1RT3B 1FT8A 2MQLA 3DDKA 3G87A 2W01A 4C97A 1R6YA 1R8PA 4CM0A 1VQMS 4J9NA 3TUIC 3I0SA 2H1YA 5JUMA 1F9EB 4IFVB 3K5OA 4Y3CA 5K8OA 4RUCA 2V8HA 1FDDA 2W1BA 1FKOB 3MECA 8RUCA 4DBQA 2CPZA 5C2GA 2QSWA 1YJNS 2YTCA 1S49A 1IBMF 3ZZTA 3CJ4A 1VYAA 3OPKA 5GAHI 3UD3P 4ZVOB 4R5PB 2AV5A 4OZ5A 3KNAA 3WX4A 3IA0A 1U1KA 3DRPB 3I5BA 1FRHA 1RWWB 1NJXA 2VOPA 3D7SB 1FE0A 2WBMA 5HP1A 2RE1A 5A6WA 2L08A 1XN9A 1YJTA 1SB6A 2VODA 2ZE2A 2ASYA 3BF4A 5IT0A 1KVIA 1VRTA 1RU1A 3ILJA 5KFAA 3PYDA 4Y34A 1UAWA 2V8PA 2CFXA 3TZYA 2EFQA 2HAFA 4WF9Q 1XR7A 4N76A 3CDEA 5J1EB 3CCRS 4PWDB 1UVJA 5DQIA 1CULA 5E3AA 1S1TB 4LT6A 2RAQA 3TA2A 3VAMA 1UP1A 4DUTA 1S6QB 2I9SA 3GIKA 4Q5VA 4M1KA 3D4JA 5FLXU 2ZJQQ 2RKIB 2GCFA 3GLJA 3SQOP 7AT1B 3CC7S 1EB0A 5K20B 2AYEA 2UXBF 2HVDA 3D6HB 4ZVFA 3G6VA 4K4SA 1N6QB 4KGXB 1K0TA 1RI7A 2CQBA 2Z4PA 4F36A 1RAJA 2CG4A 3RBEA 4K0KJ 1NKCA 3T1YF 2Z2ZA 1XERA 2C2RA 3J7Z5 3R2DJ 2IJRA 1S72S 5DG9A 3J80U 3MOZA 3PJWA 1T9YA 2PI5A 3ILOA 1S5ZA 5EDWA 2XYPB 4JI2J 1UW4A 4USHA 2BJ1A 4WZMA 2K7KA 2IVYA 2IBKA 5HLFB 5E0OA 1FA0A 4ZMMA 1WJ9A 5IOLA 2HBYB 2L9NA 2X1AA 3T19A 1RABB 2EBGA 5C42A 2IDEA 2ZZTA 3D1HA 3ZFVA 2RRBA 4DUZJ 2F65A 4OX8A 2NXCA 4OIXA 5DGAA 4X4QA 2ATLA 5CZVA 4DV5J 1I94F 5HMXA 1I6JA 3R1HA 1REVB 2V2VA 2HHSA 2AJ1A 2HNYB 2NR0A 8ATCB 3W3SA 1D09B 1S1XB 2XZWA 3J7AN 1NPKA 1GMWD 4A48A 2W2OP 4E2FB 4OYIA 1FDNA 2DNLA 1MNEA 3DU6A 3NL0A 3GV5B 1XWLA 1Y5NB 1SKUB 5J2NA 3EJMA 4P73A 3NGDA 4FF4A 2KZMA 1W2BR 1WOPA 4F3MA 5ETMA 1RYSA 1YZ7A 1XNRF 2ROGA 4WTOB 4OZNA 4ZVRB 1RWKB 4JI1J 4L75A 2B4VA 2KT2A 1BWVA 3F44A 3DLJA 2XMMA 5KFYA 4Q2LA 3MR2A 2Z2MA 3DCAA 1KHWA 3G6YA 4IUFA 3GJTB 4OZ3A 4ZP8A 3ULHA 2QFIA 2F4VJ 1V3RA 3T41A 1RYRA 4DV1F 3OFGA 2PE8A 4DR3J 4J9PA 5EX0A 1RTDA 1W25A 4YN3B 3U7JA 4ECWA 2WVCA 2C3MA 2HHQA 1NDLA 2HFSA 5LJ5Y 1WKLA 2KB2A 3JYTB 2MHEA 4C48A 3V81B 1TKXB 2RVJA 6FDRA 4ED1A 3V6KA 1R8HA 2J76E 3SQGA 2E5LF 1BQNA 3BKUA 5CA5A 4J9VA 5HVGA 1HNWJ 2MKCA 1Q5VA 2XLIA 3ZTOA 5DRKA 3ICLA 2ADBA 3R9LA 1RQ0A 1F5CA 3V4MA 2XS5A 2V6AA 3E01A 4D3HA 1SJ3P 3W8GA 2CQ3A 5D78A 3PO5A 3G6XA 4LVOP 2KFYA 4F3OA 3DOKA 4LFAF 1T02A 3R7SB 5DQHA 4I64A 4YB1P 5I3UA 2P6SA 4C11B 3MD1A 4YS2A 1YKWA 3QO9A 2W2PP 2RJZA 3IN5A 2KFZA 2C42A 2GA7A 1KP6A 4WFZA 2B43A 1HYSB 2AEMA 4YY3J 3FUYA 2HVHA 2YKMA 5DDPC 2W8KA 3KUEA 4OJGA 3ZC4A 2RDDA 1NKBA 3J81j 1EHWA 4DLGA 4UF4A 4B3RJ 5T7LA 2A6OA 4I6YA 1RWPB 3K5NA 3CXCR 4K4TA 1VDHA 1P9YA 2E1CA 4NPOA 1PAEX 2H3EB 1T9VA 2HS4A 1AZSA 2HS0A 3MMCA 5L39A 3PXGa 1X5PA 1FWLA 2GMLA 1TL4A 3GZ7A 2K3IA 1SQEA 3NY0A 5E3CA 3OVSA 4KQZA 2YQ0A 3T9ZA 4JI7J 2OFHX 5CYJA 2HBRB 6AT1B 1SI9A 3QLHA 1KBRA 4F67A 2NCKL 4OMFG 2DO4A 3EE3A 2KT3A 3H4BA 1UKUA 1AYEA 2OAUA 1SC1B 5ETOA 4LSZB 4IOAQ 1M5OC 3DGVA 4USUA 2RRAA 2G0IA 2XYHB 2IRUA 3UN5A 4F26A 3DRSA 5ETVA 4WIIA 2FD2A 3DLKB 3V6DB 3M6XA 3VF0B 4JYAJ 1FK9B 5KFOA 2DNQA 4W90B 1RSCA 4H4OB 4FKXA 1NHUA 4IFYA 1AUSL 4ETXA 3K17A 3BV8A 1NKEA 2A18A 5GVQA 1GXLA 1TAQA 1SL2A 4MYUA 1S6PB 2XZDB 2FLLA 1RWXB 5FDLA 4RU2A 1MU2A 3CPWR 1L3UA 2HQIA 1SC6A 3DRRA 4X4NA 1HI8A 1N0VC 2NXEA 3J7YU 1V3SA 2XB2D 3BN7A 5GMKa 1OY9A 4O44B 4YR2A 4DFMA 2VZ9A 2R8JA 5KFTA 3HF5A 2F9DA 4ZITA 3C66A 2LQJA 2EBEA 2N3LA 1C4AA 1FXDA 3LWMA 2PSZA 1Y10A 3D3BJ 5DLGA 4EEYA 1JLGA 2SXLA 2DTJA 4ALZA 4P2MA 1O8BA 3QSYB 3BGFA 1SJ1A 4IRKA 1FRLA 2FVQA 3IG1A 4PG6A 3MAHA 2ZH2A 3OFHA 3CJ5A 1Q8BA 3PRDA 4PWUA 3TVKA 3CCUS 4JUZA 2WTFA 4FXDA 4KHMA 3CCTA 1HHSA 3CGIA 1X60A 5FIIA 2M2BA 1ITPA 3W64A 1HNXF 4L76A 3H0PA 3PZPA 3W7BA 1WELA 1GMUA 3D68A 6FD1A 4KGMA 4GKJF 1FNOA 3TNVA 4DLEA 5AE1A 4LBHA 2CA9A 1UETA 4JI6J 1JIHA 3IRXA 4NE9C 3BDPA 2HHHF 5KT6A 2A0FB 4CH0S 1AUDA 1DLOA 1RT1B 4ZPBA 3GG1A 2IC3B 4UZCA 1DHMA 5DETA 4ED2A 3U27A 2HHPA 4RBUA 4WCEQ 2B6AA 3THPA 2JSXA 4UT4A 4EYIB 4A8FA 4L72B 3DMJB 5CYQA 2EKYA 4ED8A 1UPPA 4AFFA 1NDKA 1KVJA 1NCLA 1YHQS 2XMTA 4U6PA 5A8WA 1GMWA 3DOMB 1BQMB 5JMNA 4X4PA 3I55S 3P5BP 3BPDA 1EIYB 3UNYA 3LTOA 1YG0A 4LF8F 2M0GB 1RAGB 2B9XA 2OEMA 2E9RX 4RNMA 2ACYA 5CD4H 3ETMA 4CIOA 1RLCL 3NEKA 4PPZA 3FMWA 2ZOFA 2GVDA 2KFNA 1N34J 5KTQA 4JI5F 2JVOA 4A8YA 2V5HG 2ALZA 3OLAA 1SCJB 4NZ0A 2UU9J 3UO0A 2KU7A 5ETKA 2R7UA 3BQ2A 1NK0A 3NWGA 4IRCA 2AMCB 4HTJA 2ASJA 2QE5A 1RKJA 3MPVA 5IQ6A 1T3NA 3NBPB 1ZPVA 1F0XA 4WP8A 4E98A 4NLSA 1FRXA 3NNCA 5A0YB 2I2YA 3ADAC 3IP0A 5BXIA 2OJ3A 3MFHA 1T0TV 1MLAA 5I42B 2R7QA 2CJAA 1SKWA 2V0NA 4GKKJ 4KO0B 1X5OA 4KSEB 1B99A 3I5AA 3ENAA 2ZDPA 5AJ3F 4P7TA 1RT6A 5LXRA 3N9UC 5KOXA 3FK4A 3PYEA 2DHSA 2G0CA 3SIPB 2WONA 1ZETA 1Z1ZA 3OTDA 4DEZA 3KLGB 4UQGA 5KAKA 5K8NA 4TU9A 4RW9A 4OHYA 3QAUA 3KLIA 3JSMB 1HNVA 4PQAA 1SH0A 3SBMA 5L8RC 5I4MA 3DLHA 2FVCA 3RB0A 3N6MA 4JV1A 2ASLA 4FZVA 1DTQB 2GJIA 4M5MA 3S8SA 4FYYB 4ID5B 2EC2A 3G4SS 1WEXA 2KRBA 3DLLQ 3ZZRA 3LP2A 3Q8VA 2XQCA 4OLOA 3V6HA 2NQPA 1LWCA 1IM4A 1L3KA 4C0HA 2IRYA 2DR5A 5HAOA 3QRPA 3DOLA 2VC0A 5IWAF 1SIWB 4DG1A 4J9SA 4LFCJ 1YBAA 3FBFA 1WC4A 2B9EA 1OYEA 3LW5C 3IR6B 2GO8A 4TY8A 4WU3A 5IC4B 2HW3A 2I5JA 5DG7A 2W9AA 3M32A 4TU7A 4DR1F 3KLEA 2PDAA 4Q43A 3CD6S 5CH7B 1WG1A 1EAYC 5H9EK 2WOMA 4HACA 3W63A 3TJ9A 1MN9A 2DT9A 5KFWA 1SH2A 3VQSA 2D3UA 2VD3A 4ELVA 2C22A 4U95A 1WOSA 3MCOA 4RW8A 2DNNA 4Y0FA 3IC1A 4Q0BB 2VIHA 2UP1A 3TQ1A 1CPZA 2VFRA 1BY9A 2MQ8A 1N5YB 2ILZA 3MMAA 4ZVTB 3WC2A 1YK9A 3BO4A 2EEYA 2FPHX 2XNRA 1KTVA 3DHWC 1GTHA 1KR4A 4MK9A 3W5XA 4KYZA 2HHXA 4TYBA 1XMOF 2RQCA 2CPDA 4C8ZA 2K3KA 3PFEA 1CJKB 1IBCB 1NJZA 2JLGA 4B9SA 2X3GA 3ZNJ1 5DJBA 2NPIA 3UE2A 3V4IB 5E3QA 3UD5A 1FWPA 4Y2KA 2OPSA 1S9FA 5IZHA 4ELTA 3SXLA 1VK8A 3HJVA 4JI8F 1QTMA 1TFWA 3R2CJ 2F3JA 3PX6A 4ECQA 3H98A 2LQ5A 4I56A 5J2QA 2F8EX 5U47A 2FJWA 5LXYA 2FVPA 1EETB 5IM0A 5B7WA 1S1UA 4OX9J 2FVRA 1SUQA 2FC8A 2CPHA 2J6TA 2QTWA 3RGIA 2NZCA 2ZH7A 4DSKA 3CCZA 3OL7A 2LFVA 1QSYA 5KFQA 3H59A 4HVZA 4N47A 4G1IA 3IXQA 3MPDA 3CJKB 4J9RA 4X4VA 4OI1A 1R43A 5DS7A 3D3CJ 3MCMA 5KFGA 1JJ4A 4F4YA 4WFXA 2MY8A 3KJVA 3AOCA 1RTZA 2HGLA 5HMWA 5A76A 2IVMA 3RTVA 2PMHA 3HJFA 1PO6A 4OV1A 2XCPA 1KC8T 4K4ZA 1VQSA 2Z2YB 3OD2A 2MJNA 2YNFA 4RW4B 5CZXA 2ZC4A 3M1VA 4JI3J 2VQEF 3LUYA 3Q8QB 3KLFB 3G82A 4CQ1A 3VALA 5KT7A 5AE3A 2J0SD 3TUJC 2Z2LA 4ZJLA 4EMDA 4DR7J 2N7YA 2ROEA 1IKXA 3Q86A 1F9HA 3PO4A 1VBXA 4LF6J 4DX5A 4A8MP 2XS7A 5C5JA 2FGCA 5K8PA 4IYQA 4O3NA 1DTTB 1QSLA 3AJ1A 4LVNP 3AOBA 3ITHB 3AFGA 4OYOA 4MAKA 2V9KA 1JKHB 2E7XA 3LQVA 4DX8H 4I2QB 1UWAA 3DYAB 2DXEA 1HQ2A 2BKOA 2UUAF 3NNHA 3SFGA 3D5MA 1T9UA 1RWMB 3HSDA 3L9ZA 2M8DB 3OQ2A 4G1PA 1PC4A 4GVBB 3CCLS 3F41A 2H54B 4NLGA 1TL7A 2MTLA 3NAIA 3VAGA 1TL3B 1BE4A 5CYMA 5T41A 1FXLA 5HSPA 5KFFA 1JLFB 3CJ8A 2YX4A 4WXOA 3JSBA 1CS4A 3R1LA 4O23A 4WE1A 1RT2A 1IKWA 1G6BA 3KJNB 2ZKUA 4EFAC 2YKQA 4I7FA 2OLWA 1U47A 2QA4G 5H9FK 4J7CA 4FDFA 1JLBA 1AROP 3TAMA 3EZ5A 1RZMA 2CVEA 2CPJA 1QAYA 3S6EA 5KG7A 2D9OA 5AT1B 3RW6A 4IG3B 3PFOA 1M5KC 2VQFF 2HAIA 3GPAA 2DGTA 4FYDA 5C2CA 2CPEA 3KK3B 4UUXA 4V1Ak 1WI8A 2FGOA 3KMSA 1BUXA 2E1PA 5HVHA 2QJ3A 3FGVA 1RHJB 1VBYA 4ZN1A 1RKIA 4K4XA 1VC0A 1ZOTA 4ZVPB 4WK1A 2ZITA 2GZOA 4DR5F 4ZCKA 2YH0A 2RRNA 2HNDA 1NXIA 2AF6A 3IFEA 4XK8C 3FZBA 4CTAA 1TKTB 1LFPA 1RBLA 2ZEJA 2GQQA 4EBDA 1U1LA 1RUSA 2NSCA 4PQUB 3Q8PB 1DQAA 1CLFA 4HLBA 5KG3A 1UEUA 2LQ9A 3OUYA 3H2UB 4L6V3 1SIZA 1T95A 1J5OB 1LXJA 1YITS 1Q7LB 3D0IE 1RA6A 1HBOB 4PWWA 5HBMB 2AIRB 4GC6A 3RB3A 3C2PA 3D6TB 2KXNB 3GB0A 1FKPB 1FX2A 1IWGA 5DLFA 3L7PA 1KQFB 4EBEA 2VKZG 4KGKA 3HFZB 2B4PA 3D6MB 2DVIA 3BB5A 1K1QA 1U6FA 1VRUA 1O5JA 3M2RB 3I0RB 3ZTQA 3EDQB 2A6MA 3TEGA 3EM1A 4QIGA 4YR0A 3H5UA 4Y6IA 1YI2S 2UVRA 4P2XA 2J0WA 2MZSA 1IKVB 4M5DB 3FVYA 4NA1A 3Q2TC 1VQLS 2JLEA 1RHMB 4QQBA 2IIHA 3QFWA 1Y9OA 5D0GA 2UV8G 3HHLA 5GAGU 1GK8A 1PCAA 5IV3A 2CPFA 5KFZA 3KNGA 2HIYA 3KFWX 1NU4A 2CUYA 4RW6A 1S0VA 4Q8FA 4CO3A 4B9LA 3NAHA 1IWAA 1TUGB 4DV2F 1OO0B 4Y65A 5C25B 4F25A 1U2FA 4DV7F 2DR6A 1PGZA 3HMJG 2EG2A 3EVMA 2BOPA 3JQJA 2WK4A 3CVKA 1SVDA 2HHVA 2E44A 2PI4A 3DU5A 4KJIA 4USVA 1HBUB 2W9BA 2CWXA 4ER8A 2XWYA 2Z8QA 4U7CA 3I5CA 4YHHF 2D3ZA 5D15A 5KG6A 1D9DA 2W7PA 5HQMA 3CT9A 1JMTA 3KOAA 3GFXA 1CQNA 2BJ3A 2QEXS 3OXFA 3MAQA 2MJUA 1NHKL 3MM8A 3BO2A 2OTJS 1VIXA 4NLXA 1ZZFA 3NKYA 2VC1A 3NGKA 2MKJA 1KD1T 5H9EJ 1IM6A 1XMQJ 1N54B 4QW9A 1FI4A 3KK1A 4IH6A 2OPPA 2KTQA 1RB0A 2JFDA 3DHXA 1OPIA 1R0AB 3OR1B 4FBTA 1NH7A 1OY8A 5C7PA 2DEJA 3CJRA 4DQQA 4FXWA 3S1TA 3W65A 4AE5A 2ZH5A 3DGPA 4ZIWA 3CMAS 2AZ1A 3LP0A 2JX2A 4A8XA 3SYZA 1KOOA 2LXFA 4CDIA 1BQNB 2JC0A 3BQ0A 2IRXA 3G6ES 4G6VB 1XNRJ 3HLUA 2PFDA 3T6JA 2MEWA 4RUAA 4K8RA 4Q45A 3M8PB 1N5VA 3VAJA 1DARA 4RWWA 5DDQC 3GU0A 2W2NP 4LR8A 2MZTA 1UA1A 5LMNF 3KG4A 4QOTA 3OR2A 3UNGC 3AHPA 3W9HA 3JTPA 4DV1J 2CYYA 1H3DA 1MROB 4QIEA 4YP3A 3D67A 2MLYA 1TL1A 2KYXA 4XO0A 2ABYA 5I3UB 4EU0A 4ZPCA 5IC6B 4KRWA 2E1RA 2FY1A 3VTIA 3PW4A 2VH7A 5F0UA 1T03A 2E5LJ 2YVSA 1M5VC 4U8VA 3U1MA 3J7ZT 4C0OC 3FSXA 4CT9A 3EVWA 5F3ZA 4MMOA 2HVZA 2KVQE 3WX8A 4IH5A 2YWHA 3FC9A 4DN9A 1HHTP 4Q8EA 3HHLC 2ACMA 2KM8C 3CULA 1U1MA 1UWBA 1N52B 2LDIA 1AZSB 1RHQB 1WEYA 1NMEB 1U2CA 3TW0A 1KKHA 3CO0P 4KT0C 3LOUA 3KXDA 3KJQB 2BYCA 4URSA 2U2FA 3LGNA 1EARA 3BGRA 3GG0A 2EVZA 5D4OA 1VQ8S 2HK3A 2JEFA 2ZM6F 4DF8A 2OSQA 4PUOB 2VJUA 1FEHA 2RF2B 2HQGA 2FZGB 1CC8A 4O3RA 5E33A 1SV5A 1MW7A 3JS9A 4LF9J 2KHDA 2BMBA 4H4KA 4C8YA 3FFIB 1LV5A 1M0SA 4DL7A 1OMSA 3VV2B 3NRBA 2CIMA 2ADCA 2GO9A 4PPDA 4CNYA 4C8OA 4MKAA 1N8RT 1FVQA 2XY6A 4KFBA 2DKOB 3D9BA 3ZZYA 1OJ4A 3HFVA 1HPZA 3NS6A 2J6UA 4P9SA 2E7WA 4Q7AA 4BCAA 4ED3A 1YX2A 3HO1A 5GADU 4EUVA 3LPYA 1CJUA 1OQ3A 1B7YB 1HMVA 2HNZB 3MM6A 1HI0P 1W26A 2JEJA 2LECA 2V8VA 3VVTA 1TELA 1NSPA 1N33F 2X7IA 1DJ0A 4M5LA 1NK8A 2NZ4A 2MQMA 1PC5A 2V2KA 2LEPA 2YY3A 5BR8F 4ZLLA 4DSLA 4C3MA 4A8QA 4F02A 3MEGA 2GHVC 2J9CA 5G4DA 1HQEA 5E41A 4YFUA 4JI4F 4USIA 1UZHA 3M6WA 1NH8A 3R5BA 3HSGA 1X4AA 3FBEA 4V19J 2Z56B 1JLGB 3HP6A 2RB7A 2BA9A 3RRKA 2J8AA 4HYKA 2DNRA 3MXHP 2CNKB 4MKVA 2M7SA 1WD6A 1X7VA 3NCPA 1S79A 5BYRA 1KFDA 2HZCA 1VK3A 3T9NA 1OPZA 5EWGA 4LFBF 4X66F 4ZLPA 1Q7YT 1YRTA 2Y8YA 1S9GB 3IBCB 2XCAA 1R6VA 4ZS6A 4DUYF 5MLCV 2X1BA 4O0IA 1FJCA 4ED6A 1JJCB 4XDDA 5DQGA 2MKHA 5E2QA 2Q66A 2DRBA 1S1WB 2HVEA 1PJ7A 2ASDA 1H6KX 2CNLB 1C0UA 3M7VA 2FY8A 2VL1A 4P74A 3T5LA 2DHHA 3GCWP 1WSVA 3HSZA 1IJFB 2OMLA 1KQKA 1YBUA 2RDIA 4C6AA 1RT7A 1KOHA 3HD1A 3PEJA 5IT4A 5ETQA 3D28A 2Q1LA 1S48A 3WZ0A 1QE1B 4M94A 3C6TA 3GYNA 1TTHB 1FERA 2YNHA 4GRSA 4G3IA 1E6VA 4GKJJ 2DGVA 1RHKB 4K4YA 5KG1A 2IY5B 4B3SJ 2DCUB 4IQXA 4U8YA 4LREA 4F4WA 1WEZA 4QZVB 2BZ2A 2HHHJ 4KPYA 2LKZA 1AT1B 2XULA 1T3OA 2LVWA 2FHOB 2GGPB 4OLPA 1QY7A 1UL3A 4U7UK 2PC6A 5ADZA 4CLUA 1JLEA 1IBKJ 3D1OA 3CJQA 3CEDA 4IOCQ 3MWBA 2CJ9A 4QYZK 2WAQD 1U48A 2PEBA 4TLQA 2AEFA 2NXNA 2Y1LB 3GR1A 1JXEA 5D0HA 1URRA 2BJEA 1N36F 3JAMU 1NM2A 1FJ7A 2L9DA 4NEYA 1VISA 2CQ2A 1KFSA 4IR9A 1WORA 1LWFB 2IPOB 3OT9A 1X4BA 4CM2A 2HHUA 2H5EA 3BO3A 2MZQA 2UXCJ 2RS8A 1P1TA 3AQOA 4H4MB 4LF8J 1LOUA 2C2OB 3JB9k 2P5VA 2QYCA 3PM9A 4X64J 2FUG9 2FHJD 3JSRA 3HFKA 3TZWA 5FD1A 3PIOQ 2QA1A 3OTBA 3RW7A 4NYZA 1FTCA 2V4JB 4JI5J 1A7GE 3SDEB 2FJBB 3JTNA 3M6UA 3G71S 4OYZA 4OHWA 1WC0A 3UWTA 4J5OA 1JLAA 1FFSB 3RAQA 4C4WA 4CRJA 3Q8YA 3UDLA 1WHXA 4IDKA 3DLBA 1XNQF 1HBMA 1UPMB 2YNGA 4DZDA 5K9FA 1IXKA 2C2KB 5DO2A 4ZPWR 3LWLA 2R2SA 3TUPA 1HBNB 4A8SA 3OTCA 3OJSA 3AA9A 3HVTA 1H0HB 1IBLJ 4X65F 4GC7A 5KT4A 3AD8C 2J7WA 1M5PC 2IAJA 4NLUA 1RK8A 1FE4A 2XMWA 2XGQA 1R0CB 1LWEB 1AB8A 4B9NA 1OWXA 1VLYA 2BE2A 4F4ZA 1U02A 3MFIA 2CAJA 4MFBB 4C0BA 4DG1B 3HXMA 3N79A 2FQQB 1JXVA 4ICLA 3FJ2A 3C46A 3KLHA 5GMDA 1WDTA 2AGQA 1WSRA 3T1HF 4DR4J 5HANA 1RAIB 2DD8S 3M32B 1IUJA 2DHGA 2NXJA 1CJTB 3WDOA 4B9UA 5L46A 2QA2A 3TEHB 2P9GA 3K0JA 1HKAA 4OV6A 3M6VA 2CQCA 2IM0A 2XMJA 2YX7A 1YJ9S 2M4MA 5D77A 4CO0A 5GAEU 3QJLA 4WYWA 1HHQA 5IWAJ 3T1AA 1ZM9A 4K59A 3EGVA 3H7HB 1RT3A 3HVRA 2W4PA 2HWIA 2EG1A 4HDHA 3NGUA 4LUBA 3BKTA 1EQMA 2VBZA 5F8JA 4FS2A 1UVMA 4IFVA 3TZZA 4N8OA 1RT5B 1FRKA 3ZNUA 4DR1J 3L7UA 4R8UB 2C3OA 1FKOA 3KG0A 1BD6A 2GS8A 5KFBA 3FMBA 1KQSR 4DL6A 4PAAA 4F0KA 2AYMA 3PRBA 2BV3A 2O66A 2PFFB 5DM6Q 3MM9A 5GMEA 4R5PA 5L1LA 3W2WA 3DRPA 1WTBA 1X4HA 3FDSA 3MEEB 4KTQA 4CCHA 3EGZA 2FYXA 1EKSA 2P2CB 1WWHA 4NMLA 4RW7B 1GH8A 4OZLA 2YKNB 4F0MA 3NXZA 3VAHA 4QCLA 4OJ1A 5B0CA 4WU2A 4ZLJA 3CWJA 3MEKA 3PX4A 4P7VA 2ILYA 4G1QB 2AGPA 3DI6B 1VQ4S 3PHEA 1Q79A 3BKFA 4M5NA 4K0KF 2EFVA 5J1EA 1X4EA 4PWDA 4DX6A 1HA1A 2F63A 2HLTA 3U1LA 1S1TA 2ZH9A 1M1HA 2VA3A 1D0EA 4CLYA 4KHPJ 2W24A 1X0FA 1S6QA 2Z30B 2UUCJ 2YXLA 4JI8J 4N8NA 2KKHA 3QGHA 1PJ5A 3TAQA 1BQXA 1M90T 3ENVA 2RKIA 2XSJB 2DIUA 4JB8B 2RIJA 3RR7A 1LW0B 4I2PB 1N4LA 1TL5A 3A13A 9RUBA 3F0NA 1WI6A 2HLUA 1N6QA 4B3OB 2VU5A 2NUHA 1S76D 1RTIA 1QUPA 4DS5A 1U0SA 1D1UA 1TQLA 1PJ6A 2G2YA 3QT6A 2DGWA 3N6NA 1I5OB 3OVBA 4M63A 4TQRA 3EVOA 2JLFA 5IT9U 1RISA 4OZ1A 1J2VA 4ZA1A 1Y3KA 2J0QD 3MHYA 1WF0A 1F9FA 4ANDA 4A4JA 1WHVA 3GFYA 2QX0A 2V4RA 3Q89A 3IGVA 4JI1F 1WG5A 3FSIA 3UQSA 5G0RB 1U26A 4LF4J 2HHWA 3VGSA 1FFGB 2D41A 3MM7B 4NLPA 2LQBA 2HQFA 1REVA 1VFJA 2F4VF 1SL0A 5K5MA 1LEOA 2DYAA 2YNIB 2JH3A 2HNYA 3WC0A 2MGZB 4LBPA 4ELUA 4C7QA 3TAPA 1S1XA 2CPXA 4IO1A 1WNEA 4DR3F 4FXVA 4U9RA 2ZZMA 1UJ6A 4QWBA 3VAKA 1LK7A 2XHWA 4ZLNA 4DSIA 5B0GA 2EC0A 5HMYA 2JNJA 3GTYX 2RILA 2OPQB 2GNKA 1RE1B 4OX6A 1GQEA 2MQQA 3C3LA 1IKWB 3NP5A 1S6UA 3PYGA 2JWNA 2R9LA 4TLRA 2AD9A 2VB6A 2MMYA 4BWMA 2CJKA 3H25A 5F8GA 4P52A 3QFHA 2RNEA 2UUAJ 2HFNA 4LF7J 4DMZA 1S1VA 3AJ2A 2XLJA 5D8HB 2IA6A 4EK2A 2FHKA 1ZBTA 1REGX 3LP1B 3SMZA 1R8AA 4JBCA 4U96A 3N0VA 1ULRA 2FDNA 2VG5B 1Q16B 3HHNB 4XDCA 4J9KA 1KHVA 4W92B 3UVJB 5HROB 3A12A 3UDEA 3R5JB 4FPIA 1KWMA 2MLZA 3JYTA 1S0MA 2V2QA 3I56S 2XHCA 3L09A 3V81A 4Q44A 5CHCB 1TKXA 3LGHA 3M30B 4YY3F 1Y3JA 3KYLA 1NK9A 2Q43A 2W25A 4OI0A 2JFKA 3RB6A 1Y4ZB 1I3OB 3UDVA 4I4BA 4UOCA 2HNDB 3TQEA 4P2FA 2EFGA 1D9AA 1Y11A 3MZIA 4M5KA 4WK3A 3KDNA 1WKJA 4F04B 3A3NB 2WRMA 3B54A 2O3DA 1NO8A 4TKTA 4QYZJ 1DURA 4AL5A 4FKYA 1YIJS 4NLVA 2KVIA 3SSRA 3BJYA 2C2ZB 3ET6B 3PYFA 5B0BA 4A8OA 1CC7A 5A8KB 5FLXY 3EZOA 1ZM2A 2QFJA 5KOWA 4B17A 5KG0A 2VQFJ 1B0PA 1TV6A 3MR7A 2DR7A 3MMJA 4DV4F 4NMXA 5KFHA 5LL6d 1IJEB 4C11A 2W9CB 1RWNB 3K8VA 4DQSA 4JI7F 1B0VA 3POTB 4FYVB 5CAAA 2KG0A 1HNZF 1V6HA 1HYSA 1XMBA 4OZ2A 4KGVB 4ZCMA 3E2EA 3N4WA 4DR5J 4LRFA 3SSQA 2B8PA 5JJBA 3J80Y 3BQ1A 3MCNA 4ZN3A 3WIVA 2VONA 2G2ZA 3UPFA 4DSFA 1F2HA 4USWA 4YR3A 2B8QA 3HHLB 1KN6A 2F40A 2KM8B 3FZ2A 3DM2B 3PDNA 3VHQA 1VLOA 2GIQA 3RZAA 2ZVIA 5KFMA 1D8ZA 1Q0NA 3W1YC 1U49A 2DISA 3NNAA 2QO3A 3QJJA 3SCLE 3W60A 1PBUA 5LSLA 4OI2A 4EI2A 3N5FA 4FF3A 4KKOB 4UY85 2EXUA 2MYFA 1DFDA 2FHMA 1CJVB 4ZP7A 1D9FA 5CCMA 1K8AT 3NOGA 1H2UX 4OQJA 1RU2A 2HSEB 3EZUA 2R2RA 3VZHA 4ECZA 3CE8A 1VRQC 3M05A 5LJ3Y 3BH7B 3DLKA 3V6DA 2K1RB 4F2RA 1FK9A 4H4OA 2W9BB 3ENQA 3ZTSA 2R8GA 3MMBB 4J91A 3LH2S 4QR0A 3KHLA 3UDCA 3PKYA 3DDIA 2V2ZA 1JK9B 4BBYA 2NS1B 3QIPB 2FB0A 3MDFA 4QIWD 5HATA 1S6PA 4B08A 2H9ZA 1EKRA 4ZK7M 4F8RA 1YWXA 3HPOA 3CCVS 1JJHA 3R8YA 3K7RA 5GAEI 4N41A 1S99A 3DKDA 2IM2A 2R7RA 1B7FA 2R8HA 4O44A 2MQNA 5KG5A 4OYWA 4WXWA 4JI6F 4RNFA 3IM8A 4FN5A 3M8ZA 1J27A 3LANA 2VFVA 2IFXA 1C4CA 5KFJA 2M8HA 2AJ2A 4A47A 5BYSA 1MN7A 5J2MB 3K5LA 1NK4A 2AJQA 3BGLA 3VGTA 1FWKA 3AH6A 2QL9B 2LEAA 1U24A 2ZH8A 2HHTA 3OVAA 3MOJB 1DY3A 3TRGA 2R7WA 3ISND 2BABA 5EX3A 4DPTA 5KFVA 1UA0A 1R27B 4KV8B 4CO2A 1C0TB 3BYRA 3MGJA 2WCXA 3MM5B 3VAFA 2COLA 4AD6A 2QC3A 4MK8A 3TARA 2EK6A 3FBCA 5F41A 2B9YA 4NI2A 1UEVA 2BM1A 5E3PA 1RT1A 2YWKA 2IC3A 3DLEB 1M1KT 4RBTA 4PR6A 1KLMB 1N34F 3VAIA 4J9QA 2VHGA 2HFVA 2XLKA 2EFNA 4EWTA 2BJ7A 3R27A 1B3TA 3VVUA 2E5JA 3QRRA 3DMJA 3HD2A 4M5HA 4OYBA 4DF4A 4MIAA 1UTAA 5F3TA 1U8WA 4YQWA 2DJWA 4C8KA 5KFRA 4QWCA 4RNOA 5BJRA 4NA2A 3D54A 3DOMA 1BQMA 2WHOA 3BR9A 4S0MA 2QYGA 3LPEA 4QPXA 3I96A 3X1LB 5J1NA 1S9EB 5A8RB 3ZTPA 3CCJS 3NS7B 1VQKS 4B3TJ 2LYVA 2BKPA 4GKKF 2OGUA 4KH0B 1YJRA 1RWVB 1S57A 3QSIA 1G4CA 2CQ0A 1R8BA 1XR6A 3D6FB 2FZKB 3OSPA 4N7TA 2DIVA 2WVEA 4YUDA 2PA3A 1Z4UA 5SZTA 2O1PA 2XEXA 2DB1A 4WIQA 4HH1A 4ERDA 4CLWA 2C28A 3EGWB 3F56A 4L3NA 2HPUA 3ZXWA 3NBPA 1C1BB 2KT5A 1N5TA 4A8KA 4OYPA 1PYSB 1Q8LA 1BHNA 5HQ8A 5A0YA 2LU1A 1O0PA 3M8QA 1ZZNA 1XBWA 2VUGA 1FD8A 4F3QA 4DL4A 5I42A 4ZPAA 4W98A 1NB2A 3OJUA 4IKAA 2N7CA 4LRDA 1RADB 2AEJA 3DRXA 4W4MA 3FCVA 2RUSA 4KO0A 4DPUA 4ZHRB 1R3NA 3PNIA 3DRYA 2ZBQA 2DGXA 2HYIB 3Q83A 1A0OB 4N77A 3DFEA 3KLGA 1U1NA 2KXFA 2C2EA 1XR5A 1A6LA 1XTZA 2V63A 1TVRB 4DCOB 2N82B 4DR6F 2NSBA 2XI2A 1RT4B 3JSMA 5KFLA 2FLOA 4NXNJ 1GAOA 3QJPA 4AQYF 3GMGA 4JI0F 4LQ3A 1F3VA 3UCZP 2O5DA 1DTQA 2IM3A 2E29A 3W2VB 4ID5A 3RRHA 3NCRA 1U0HB 3C14B 1PSDA 3K89A 2ZJRQ 4CI0B 4OJHA 1KSPA 3QT8A 4DXLA 4QPTA 3CD5A 4F4AA 5ETTA 2APOA 4YEAA 4RNNA 2BEFA 2IJNA 5ETLA 2BQ3A 3QZ7A 5BR8J 2HVIA 1RTHB 3C19A 4RUHA 2PA8D 4NA3A 2QL7B 4CLZA 4FNIA 3RRGA 2MY7A 2QGFB 4PCQA 3KLVA 3ILIA 4CNZA 1U6ZA 3ELHA 2JL9A 1RDRA 4RKUC 1ROFA 2CZVC 1S7HA 2O67A 1C0UB 5LM7E 2B3TB 2KHCA 4OYAA 5K14B 2PN6A 5AXMA 2DEIA 4B9MA 2IHR1 3FSYA 2J9DA 2IYIA 2BJ8A 4FVCA 4K5RA 3ENWA 2JVRA 2ZD1B 2A2DA 1QLNA 5F8HA 5AXKA 4HT5A 1EZZB 1D3WA 4L3KA 4LR7A 5D0EA 1ZYQA 4DV3F 3PR4A 2V50A 3OW2R 4MJKA 5HK4A 5J1PA 2UUBJ 3E3XA 4GO7X 3TI0A 1FDBA 2AZ3A 4UOHA 4WTYA 2XGPA 4IG0B 3RBDA 3E51A 2XC9A 3Q2SC 3IGNA 5LSOA 4Q0BA 4NWBA 3I9ZA 4O4GB 1PG5B 1S97A 2Z0GA 1HARA 2MPUA 4LSNB 4ETZA 1N5YA 1YVFA 1LW2B 1H7XA 4ECTA 3CC2S 1HNIB 4JV0A 4ZPTR 2ERRA 2GVZA 3CCMS 1CJKA 1R89A 3AXMA 4M5GA 1U1RA 4LSLA 4YB7A 3OL8A 2XS2A 3CJTA 3V4IA 3M2VB 3MEDB 1JB0C 1Y5IB 2P6TA 2C3UA 1ZS6A 3A3PB 1RA7A 1JWWA 1PKUA 3V2UC 1TKZB 3C15B 2H65B 4EZ6A 2CWKA 3HVAA 4F4XA 1RBAA 5JVGQ 4JI3F 4UOFA 3G86A 2DY1A 1EETA 1FO1A 3MUVP 3BDEA 3H40A 1YDLA 2H4YB 1R31A 3A8IA 3K8WA 1IKYB 4DR7F 1HIYA 1QJHA 5B0EA 5KFIA 1JX4A 5AE2A 3SSSA 2FJDB 4LF6F 1FJGF 2JHEA 1RCXB 2PEHA 2RQ4A 3GWCA 2BJDA 4WFYA 5D0RA 4HR2A 1H72C 3IS9B 3D2WA 4JV5F 2WVBA 3VZIA 4ECYA 3G9CA 4ATNA 1SKSA 4ZJOA 3FRZA 2K2PA 1N36J 3MR5A 1T8EA 4IR1A 1AA1B 3MAAA 3M2UB 3FEYB 3C6UB 1QM9A 3AAWB 4RW4A 2XYGB 1K1SA 1YJWS 3KLFA 2BDPA 2G13A 4LMZA 4Z7CA 2AKWB 2CJQA 4ENOA 4J9UE 1FNMA 4R25A 1X8DA 1FF2A 1JLCB 2E5IA 1U4BA 4QBUA 3K57A 1RWUA 3M4XA 2F4FA 4NLQA 5ETNA 2MZJA 4DX7A 4CLPA 2B0GA 2J6SA 3HHDA 1VQOS 4LRCA 4X62J 5EWEA 1GX6A 3OTOJ 4UTGA 4NASA 2VF3A 4NXMF 3ITHA 4C8LA 3BYPA 4DL5A 1N32F 2RMLA 1JKHA 3C16B 1WACA 3J81Y 4J9LA 3K58A 5CD4A 1JXLA 2FVSA 1OQ6A 3I32A 3QT7A 3KLHB 1XNQJ 3IO1A 3CDBA 4I2QA 2XM3A 2RQKA 4CLLA 4CO5A 4F0HA 3DYAA 4DSEA 3SCJE 4L73A 1NZAA 4ZCLA 1NK5A 5HL7Q 1QVGR 2QLWA 2ZDOA 4DCPB 2GMJA 2DPJA 4RR5A 2AWZA 2P9CA 2OTLS 3JSYA 2PD1A 4HEA9 1VQ7S 4USTA 4AYBD 3DLGB 4DDFA 4GVBA 3K5MA 1WC1A 1F5AA 4WYLA 1OS5A 3HX9A 4J90A 4JV2A 2DY9A 1YJUA 1TL3A 4ZKAA 4ILLA 1NDPA 2W2QP 4PKDB 2C3YA 4LF5J 2X1FA 1JLFA 2LQ8A 2GJ2A 3IM9A 1FXRA 1X9SA 1UVLA 4R0JA 3T1HJ 1MWYA 2BANB 2CJXB 3TVYA 2VBYA 3T6BA 4NRUA 3LALA 1UFLA 1UW9A 2UXDJ 4ES3A 5E5NA 5J2PB 3MM9B 4ZDNA 4IG3A 4DR2F 4P71A 3HZGA 2B56A 4NLTA 2LP4A 1MWQA 2DBBA 3W2WB 2OPRB 4JOUA 4C2MA 4ES1A 2AX1A 2PIIA 3KK3A 2V8DA 2CQ1A 2CJYB 1VJQA 1NJIT 3HT3A 2ZHOA 2H4WB 4CO1A 4F4KA 3O8WA 2Y0BB 5F9NA 3M9MB 2VG6B 4U67Q 2B5JB 2NYHA 4P10A 5HI7A 2KXHA 2HFZA 2DK2A 3H5YA 4EO8A 2BM0A 1UEKA 3SFUA 3PY8A 4NX9A 1J5EF 2BX6A 4RL1A 3ISNC 4X4OA 1T11A 1TKTA 1TMJA 2F9JA 5DDRC 3MCSA 4WKYA 1LFWA 4C98A 2Q79A 1ACMB 2EW9A 1ICEB 4PQUA 2Y8WA 4ED0A 4DFJA 2VKRA 2RUGA 4B02A 7FD1A 3QWPA 4OL8A 3HT0A 3T5HA 2H51B 2YQ1A 2PT0A 2BW7A 2F8HA 1J5OA 5ITHA 2EI5A 1P27B 1C1CB 3P4UB 1HBOA 2BE7D 5HBMA 2WW4A 2E7VA 1VBKA 2IM1A 5C24B 3PW2A 3HVWA 3OV7A 1FKPA 4WP9A 1KS2A 1EP4B 3J7YI 2MDAA 1RTIB 2DO0A 2VG7B 4NCAA 2W4DA 1K47A 3M2RA 3MTKA 3I0RA 2BRLA 3OHAA 2HK2A 5CXTA 1S4EA 5LMUF 1TK0A 2RU3A 5L1IA 1Q95G 4Z7YA 3UCUP 1IKVA 4M5DA 4B9TA 1Z2ZA 4N56A 3CJ0A 2MLXA 4HI2A 2KRRA 1HQUB 3J7A1 2J7UA 4M95A 1ZPWX 3E8OA 1S77D 2VFTA 3R5DA 2WSEC 1G3OA 3RB4A 3I4PA 1RTJB 2W8LA 1QUVA 1NDCA 4UOGA 5L38A 3A8JA 2XMVA 4PZVA 3GQCA 5T14A 4QWDA 1L5UA 3CJSA 5C25A 1XMQF 1VQNS 4O3SA 4WP3A 4FPRA 3OFFA 1XJWB 2DPIA 1WUUA 5MAOA 1UFKA 3TA1A 3IBWA 3NS5A 2R8IA 1QAXA 2WZ1A 5HJXA 3FEZA 1HBUA 3BR8A 2EKNA 3QYYA 3BSAA 4USKA 3IWXA 5D3GB 2I0XA 2HMIA 1HWIA 4ZOSA 2E5HA 1R7IA 3A3OB 4CZCA 3I0SB 3UFCX 1CBKA 1VCTA 1UVKA 2D69A 2DXFA 4DPXA 4KE5A 4Q2MA 3MECB 1S1VB 2JRSA 3T3FA 4YDXA 1SH3A 1SKRA 3NMRA 1GTEA 4TQSA 2ZUGA 3I87A 3R6GB 4ECUA 2W2MP 3FRYA 3CD0A 3H90A 4CH7A 2OFGX 3GONA 1R0AA 4F2SA 3CIZA 3OR1A 1KQGB 2H48B 3BZQA 2QZ8A 3WIUA 3R97A 2F8MA 1UVIA 5KT5A 1U1QA 2EWHA 3AJDA 3TWZA 2YPYA 5HP1B 1Y7PA 2ZE2B 1UFWA 1YJVA 3N5BA 2OI2A 1VRTB 3WQPA 1WDDA 2B7BB 3H4DA 2J7KA 1O51A 4NCGA 3M8PA 4TYAA 2QLFB 3NCQA 2C2NA 3AA8A 1CULB 4RLEA 1YSJA 1S12A 2KI2A 2DGUA 1IBMJ 4PABA 1MMNA 2HZVA 4X84A 5ETRA 1TV6B 1MROA 5KG2A 3AB4B 4HI1A 4DV6F 2CQPA 3GILA 4CP5A 4A8WA 4URGA 2ZH6A 3L95X 2ZWOA 1E6YA 2ZH4A 3VGVA 3PHTA 3CIMA 4OYMA 3CB4A 2H5JB 1NPRA 3TOQA 1K0VA 5A2QY 4LF9F 3EXCX 1PYOB 1RAHB 3MI7X 3GIJA 1NSQA 4K50A 3PEHA 3AOAA 2ATCB 4AUKA 3K2YA 1ZTWA 4A46A 1B70B 1FRMA 3D0HE 4O4RA 1IN0A 4UW2A 2YKOA 3F73A 3K59A 1RGVA 2PO4A 1EQ0A 2DCLA 3GJRB 3NGTA 4B3MF 4RU9A 4DV4J 1NK6A 1N88A 2PGCA 3TUZC 4QW8A 5C42B 1A9NB 2FTRA 4RBVA 2UXBJ 5B08A 2BRKA 4I1TA 4WFAQ 4PUOA 2RF2A 1HNZJ 4LF2A 4HHJA 4OX7A 1SC4B 4L74A 1Q53A 2NXUA 3FFIA 1HWKA 4BDPA 1JQGA 2IMWP 5KT2A 2A3JA 1EX8A 1FKAF 1P9QC 2A1BA 2XO6A 1BC6A 3T1YJ 4NLOA 5J2NB 4DL3A 3MURP 1NNDA 4PG8A 4LR9A 3B82A 1ZM4A 2E66A 3QQCD 2YH1A 1WC6A 4F50A 4WFBQ 2IJFA 1SQFA 4DWIA 2GHPA 1RAFB 2HNZA 3QGIA 2HGNA 2OEKA 4QU7A 2XMKA 2CG8A 2GHWA 2UVVA 1I94J 2LLZA 4NYPA 2F1FA 5CCLA 2QA4S 4ZVQB 3CMQA 2G1HA 2A10A 3TR5A 4PG4A 3I9V9 1RBOB 4QR1A 1H2VZ 1RTDB 1ZAXA 4RX6A 2KDOA 1DRZA 3AQPA 2POKA 3O1LA 2E1MC 2OO4A 2VPWB 4NCBA 4PXDA 1FEEA 1VI7A 2VPZB 4X4UA 3P6YC 3NOCA 1YBTA 1L3TA 1QAIA 2CADA 3SQGB 1S59A 1HR0F 4DPYA 2V67A 2AYBA 3EYZA 3A4TA 1X5SA 3TO8A 5F8IA 3CCWA 1RAOA 3E01B 1QVFR 3AD9C 3CD7A 5AXLA 4DU7A 2DITA 4ZIVA 4OHXA 4HDGA 1S9GA 3DOKB 3CNQP 1FRIA 4B3SF 1T94A 2KN4A 1DZ5A 2IDLA 2ZH3A 1VOMA 1VS3A 1JNRB 4HTIA 1ZA1B 4NI2B 4HHHA 3R3TA 4RPFA 1S1WA 3PJXA 3QO9B 2C2DA 3KK2A 4AT1B 2AYGA 1IBKF 2C3PA 3CCQS 4PG7A 2YKMB 1QDUB 3H42A 4EO6A 1TK8A 5EUHA 2OUGA 1TK5A 3KTQA 4URQU 1FTRA 5T7LB 3FQKA 1X9WA 2RU9A 3M8YA 2FIUA 1VIOA 1JJ2R 1QE1A 3EPIA 2V9WA 3QIDA 2UXCF 3BGUA 2ZBIA 1U6BA 3N28A 3MMCB 4QIVA 1RHRB 3AD7C 1IVZA 4OI6A 2R7OA 1NEEA 4LFAJ 4DZ6A 3O5TB 2MZRA 1Q81T 3CSKA 1SC3B 4UY8T 5HQLA 2BACA 1X4DA 4ANEA 4X64F 2GGPA 2V68A 2BOAA 2MKKA 2ZBPA 1RP5A 2NYIA 3QLHB 1T05A 5E7OB 2P8IA 4P75A 1FHTA 3V5RA 1IQZA 2Y3YA 3ONQA 5JXSA 2YKPA 5B0AA 2BQRA 3VCDA 3G8TA 4NLWA 3ZTRA 2QMWA 3ZZOA 4LIRA 4DI6A 5LT5A 4XPCA 4M5IA 2KO1A 3DRSB 1HW9A 1U1PA 1RAEB 3AY0A 1S7IA 4N5SA 1OSCA 2HFUA 5D6GA 1LWFA 1U25A 5EHHA 5M2UA 3RJMB 4IFYB 3M8QB 1Q78A 4DN0A 4H4MA 5IFMA 1CSJA 3ZO7A 2N4DA 3PCOB 1IBLF 4NZ6A 5FDLB 4DPWA 1MU2B 4CWBA 3NWRA 3B78A 2JOQA 2E9TA 3DRRB 2W7AA 1HWJA 2AW0A 2V4JA 2YWWA 3SDEA 2VA2A 3Q8SB 3KUGA 1DQ8A 2HQCA 1CVJA 1X4GA 3EICA 5FJ4A 2XWXA 4ZCIA 5DG8A 2ZJPQ 1Y00A 1MMDA 3TX8A 1VQPS 3QMQA 2DR9A 3O44A 5KFXA 1GXUA 4DR4F 4CH1A 3O3LA 3US5A 5EGYA 2GMHA 3LF0A 3O2IA 1RCOB 3G8SA 2LXUA 4DV0F 1XEZA 3DC2A 1HBNA 4DCJB 3FQLA 1YGYA 3IG1B 3PVXA 2R2UA 4C9DA 5E3RA 2N3OA 5KFKA 3SZ2A 5H9FJ 1MG7A 1Q8IA 3RBXA 2AQ4A 1Z2LA 3KUHA 3BBBA 4TNOA 1HW8A 1LWEA 4K2JA 2J8SA 4Y2CA 4B9VA 2LCWA 3W62A 3OXLA 1PAUB 1VGYA 3BN4A 4MFBA 3KHRA 5L1KA 3NG8A 3IRXB 1H38A 4ILRA 2OEJA 4DR6J 1SBRA 2YWGA 1DLOB 2YX1A 4AXIA 4IO9Q 3J81U 3THTA 5KFDA 4AQYJ 3QGPA 4JI0J 3PR5B 4I67A 3PIPQ 2B6AB 1CJTA 1QSSA 3GIRA 3A8KA 4PXBA 3HCXA 4MTPA 2B4UA 3IAS9 1KVKA 5CYQB 4OFZA 4I6AA 3CJ3A 4MYTA 4LBIA 1BXNA 1NAQA 1KDNA 3N01A 2R4FA 5A8WB 3TP2A 4DQPA 3G8QA 1NHVA 3HHLD 1HNXJ 4M5JA 3OHBA 1SJRA 2BW2A 3V6JA 2NLWA 1UJ4A 2JZ5A 3Q8UA 2DGOA 2AU0A 1OSDA 4WJBA 2XO7A 2DHAA 4HH0A 5HO4A 2RDJA 2HRTA 1SQGA 3GIIA 3HI9A 1RT5A 2GVDB 2ZKTA 2WSFC 4H4KC 2OHDA 1HD0A 4R8UA 3JAMY 4EGLA 4IRDA 4EYHB 5D4LA 2ZVSA 2GVZB 4DPOA 4LSLB 2MSSA 1SPBP 2L48A 2Y9HA 4KHPF 4PXCA 2Q6BA 3PTWA 5GAGI 3JQMA 2UUCF 4DV3J 2DHXA 2CQDA 3AXKA 2LU2A 3MEEA 2HZAA 4BC9A 2J0XA 2BQUA 3W61A 2OIHA 1NJYA 4RW7A 1VMBA 2YKNA 1N0UA 2D74B 2EFOA 3K5PA 4CYUA 1LQ9A 3H2LA 2BKNA 3BEGB 2VFUA 2VOOA 4G1QA 2DNYA 2I8EA 3DI6A 2I38A 1R0BG 3OL6A 1U09A 1ZA2B 3MD3A 1G2EA 4ED5A 3WHIA 1JLQA 2MKIA 2G1DA 3GCXP 1RT6B 5IS2A 3AB2B 3KHHA 3GJQB 2WONB 2XMUA 2QMUB 5IV4A 2BR0A 2CDQA 4KPCA 3MAAB 4RW9B 2ZZNA 4KH1B 2OELA 1PIEA 5A6PA 1VQ6S 4Z2XA 3KLIB 1WF1A 4O3QA 1HNVB 3WBZA 2QLBB 2XSJA 2BXJA 3OFEA 2ZFHA
chains in the Genus database with same CATH topology
3RRHA 4Q5VA 3NCRA 2MZTA 4LF4F 1UA1A 1M5SA 5LMNF 3KG4A 2VV5A 1PSDA 4QOTA 4M1KA 1VQ5S 3OR2A 3UNGC 2ZJRQ 3AHPA 4ZPDA 4CI0B 1LW0A 3JTPA 2WBRA 2RKIB 2GCFA 2ZJQQ 4I2PA 4OJHA 1YRUA 4C3LA 1KSPA 2CYYA 1H3DA 1MROB 4QPTA 3CD5A 3CC7S 4QIEA 2AYEA 4YP3A 4B3OA 2UXBF 4RNHA 1TL1A 2APOA 2DNPA 2M9KA 4BWJA 2KYXA 4YEAA 4XO0A 2ABYA 1JNZB 4RNNA 3LP2B 5I3UB 2DGSA 4DFPA 2IJNA 3C8YA 2L3MA 4ZVFA 2BQ3A 4EU0A 4ZPCA 3QZ7A 2W7OA 2HVIA 1RTHB 3G6VA 4K4SA 1N6QB 4RUHA 1LWCB 2PA8D 4KRWA 4XAKA 2EFPA 4NA3A 3IAM9 1Y0HA 2E1RA 4UUWA 3BSNA 4FNIA 1K0TA 3RRGA 5EN1A 2MY7A 1S4FA 1G7CB 2GFFA 4PCQA 1RI7A 3KLVA 2CQBA 1KEKA 4CNZA 2FY1A 2OKQA 3VTIA 3PW4A 1U6ZA 1U1OA 2VH7A 2Z4PA 3DOLB 5F0UA 2DNKA 1T03A 1RAJA 1NJWA 2JL9A 1VHFA 2CG4A 1RDRA 4RKUC 3RBEA 2E9ZA 1ROFA 2CZVC 1NKCA 1S7HA 2YVSA 1M5VC 3ETOA 3T1YF 3Q22A 2O67A 3U1MA 1XERA 3J7ZT 1V9OA 1AFIA 1C0UB 2QMXA 1S0NA 2CQIA 2B3TB 2C2RA 2KHCA 4C0OC 3J7Z5 5B0DA 5K14B 2PN6A 3FSXA 5AXMA 1S72S 3BS9A 4B9MA 4CT9A 5F3ZA 5DG9A 3P49B 4MMOA 3MOZA 2HVZA 2IHR1 1U45A 3PJWA 3FSYA 4TY8B 2PI5A 4ED7A 2J9DA 4IH5A 2IYIA 2YWHA 4DN9A 5EDWA 1HHTP 4FVCA 1GNKA 5L9NA 4K5RA 1UW4A 2DGQA 2I5JB 3ENWA 4USHA 4DJBA 4Q8EA 4WZMA 2K7KA 5G0RA 3HHLC 2IVYA 2IBKA 5HLFB 5E0OA 1P6TA 2JVRA 2ZD1B 2KM8C 4LF7F 1FA0A 3KLEB 3CULA 4IQMA 4ZMMA 2A2DA 1QLNA 3CDWA 2L9NA 1U1MA 5F8HA 2X1AA 3T19A 5AXKA 1UWBA 3MM7A 4HT5A 1N52B 2LDIA 4QYRA 1D3WA 1WEYA 2EBGA 4ES2A 5C42A 4DV3F 1ZYQA 3PR4A 3HKZD 3OW2R 2HWTA 2YNIA 3D1HA 3ZFVA 4MJKA 5J1PA 2RRBA 2MGZA 2VBWA 2WOMB 3E3XA 2I1RA 4OX8A 3TW0A 4OIXA 5DGAA 4X4QA 2ATLA 2MKSA 2ZOMA 1CQMA 5CZVA 4KT0C 1VJWA 3A8EA 1I94F 3LOUA 5HMXA 4GO7X 1I6JA 3TI0A 3OL9A 1FDBA 3R1HA 1HFEL 4OZ0A 4WTYA 1REVB 2XGPA 2HHSA 2BYCA 2AJ1A 4URSA 2U2FA 2DH8A 3LGNA 3BGRA 3GG0A 5D4OA 2EVZA 2HNYB 4IG0B 3RBDA 1VQ8S 2NR0A 3E51A 3FEXB 3Q2SC 2XC9A 2JEFA 3W3SA 3IGNA 5LSOA 2ZM6F 4NWBA 4Q0BA 3I9ZA 1S1XB 4DF8A 2XZWA 1URNA 2OSQA 4PUOB 4O4GB 4A48A 1FEHA 2RF2B 2V4QA 2AJ0A 2B7CB 1VQYA 1CC8A 1FDNA 4I0WA 4O3RA 2KYZA 1S97A 5E33A 1SV5A 2Z0GA 2OPQA 1MW7A 4RW8B 1HARA 2MPUA 4LSNB 4ETZA 1N5YA 1X5TA 2KHDA 2DNLA 4WZQA 1MNEA 1YVFA 2R7XA 3DU6A 3NL0A 3GV5B 1XWLA 1LW2B 1Y5NB 4H4KA 4C8YA 3FFIB 2CQ4A 1H7XA 4ECTA 1LV5A 5J2NA 2KJVA 1M0SA 4DL7A 3NGDA 4FNHA 3CC2S 3MPWA 3NRBA 1HNIB 4FF4A 2KZMA 3MMAB 4JV0A 4ZPTR 2G4BA 2CIMA 2ERRA 1W2BR 2ADCA 3CCMS 1R89A 2GO9A 2OD4A 1L3SA 5KFEA 4PPDA 4CNYA 1U1RA 4C8OA 2ROPA 4LSLA 4YB7A 3OL8A 4MKAA 3PKMA 4F3MA 3LGMA 3GV7B 1N8RT 2XS2A 1FVQA 3V4IA 2XY6A 1RYSA 4KFBA 3M2VB 3MEDB 3EUNA 1JB0C 4AXJA 1Y5IB 2AP6A 3ZZYA 2P6TA 1GT8A 1XNRF 2C3UA 2ROGA 3NS6A 1HPZA 3PW5A 4OZNA 1ZAVA 1RA7A 2J6UA 1JWWA 2E7WA 3V2UC 2B4VA 1TKZB 2KT2A 4Q7AA 3F44A 4BCAA 4EZ6A 1VC5A 4ED3A 3HVAA 3LP1A 2MQPA 3HO1A 4F4XA 1HWUA 3DLJA 3VQTA 2XMMA 5GADU 5JVGQ 4M8LA 4EUVA 3LPYA 2OPSB 5KFYA 1OQ3A 4Q2LA 4OZJA 3MR2A 4JI3F 2Z2MA 1HMVA 3G86A 2HNZB 3DCAA 3R5AA 1KHWA 3G6YA 3MM6A 5KT3A 1Q82T 1HI0P 4IUFA 3ULHA 4ZP8A 2XG8A 1EETA 1FO1A 3MUVP 1AXQA 2JEJA 1V3RA 3BDEA 1WG4A 2LECA 2V8VA 3H40A 1RYRA 2VG5A 4DV1F 3OFGA 2HG4A 1R31A 2PE8A 4QIFA 1N33F 2Y1JA 5J2QB 2CJBA 5HROA 3K8WA 2DRAA 1IKYB 1FESA 4DR7F 4J9PA 1DJ0A 5EX0A 2HFOA 1RTDA 1W25A 5IM0B 1NK8A 2NZ4A 1QJHA 1S1UB 2MQMA 3U7JA 1SUQB 5B0EA 5KFIA 1JX4A 1PC5A 5AE2A 2V2KA 4ECWA 3SSSA 2FJDB 2LEPA 4LF6F 1FJGF 2C3MA 4OHZA 2JHEA 3M30A 2HHQA 3B4MA 2Y1RI 2YY3A 5LJ5Y 5BR8F 2PEHA 2RQ4A 4DSLA 4C3MA 3GWCA 2BJDA 2KB2A 4A8QA 4WFYA 4F02A 3JYTB 3IS9B 3D2WA 2MHEA 3MEGA 4JV5F 2GHVC 2IMOA 1GXTA 3V81B 3VZIA 4QR2A 1N56A 1TKXB 4ECYA 2J9CA 2RVJA 6FDRA 4ED1A 3G9CA 4I6WA 2R7SA 3V6KA 1R8HA 5G4DA 1HQEA 3RR8A 2J76E 2AX0A 5E41A 4YFUA 3SQGA 4ATNA 1SKSA 3UD4P 4JI4F 4MKYA 3M8RA 1BQNA 1H2TZ 3FRZA 2K2PA 4USIA 2E5LF 2GIRA 2FJEB 3M6WA 3MR5A 3GYXB 1T8EA 5CA5A 1NH8A 3R5BA 3QPIA 1X4AA 2MKCA 4IR1A 3KJVB 2XLIA 3H2VE 4V19J 3M2UB 3FEYB 1JLGB 3CO9A 3C6UB 5DRKA 3ICLA 1MWZA 3HP6A 2ADBA 3P96A 4ILMA 4HKQA 1RQ0A 1TKDA 1F5CA 4TXSA 3V4MA 1QM9A 3AAWB 2RB7A 5A8KA 5DM7Q 4RW4A 2XS5A 2BA9A 4OI4A 1K1SA 4FP9A 3RRKA 2J8AA 4HYKA 2DNRA 3MXHP 2M7SA 4JI2F 3E01A 5GADI 1YJWS 4D3HA 1WD6A 1SJ3P 1Q1KA 3UR0A 2OSRA 3KLFA 1X7VA 1LK5A 2CQ3A 2G13A 2BDPA 1YQHA 5D78A 2QRRA 3PO5A 2YNFB 4LMZA 3G6XA 3NCPA 1S79A 4LVOP 2KFYA 4F3OA 2NPFA 2YKAA 5BYRA 3M1VB 2CJQA 2D1CA 3DOKA 1AFJA 2W9CA 2GW8A 1KFDA 1UJ5A 4Y28C 2HZCA 1VK3A 1FNMA 3T9NA 4R25A 4LFAF 4DUZF 1X8DA 1T02A 4OHVA 2GC8A 1OPZA 1FF2A 1JLCB 5EWGA 2E5IA 4LFBF 4X66F 3POTA 1U4BA 4ZLPA 4QBUA 3K57A 1Q7YT 2UVWA 5F8NA 1RWUA 2DNOA 3M4XA 4DV5F 5DQHA 4I64A 4YB1P 1YRTA 4NLQA 1S9GB 2P6SA 2MZJA 5I3UA 1UVNA 4C11B 3MD1A 2XCAA 5KFNA 4ZS6A 2B0GA 2J6SA 3QO9A 3I4HX 2N4CA 3HHDA 4DUYF 5MLCV 2X1BA 4O0IA 2RJZA 1FJCA 4ED6A 3IN5A 1VQOS 1IKXB 2KFZA 4XDDA 5EWEA 1GX6A 2C42A 5IT9Y 5DQGA 2GA7A 4WFZA 2B43A 2MKHA 5E2QA 1HYSB 4HL9A