1KQSR

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqsR00
1WEYA 1H2VZ 1WELA 1VQ7S 2MJNA 2KRRA 1M5VC 3P5TL 2KXNB 1X4FA 1QM9A 4IOAQ 2MGZA 4WKRA 1D8ZA 2Q79A 2X1BA 2ZJPQ 2AYEA 3EX7B 2U2FA 2J76E 2LCWA 2CQ0A 3FEXB 1RK8A 3S01A 2RU3A 1U1MA 1KD1T 2KHCA 4OZ0A 5IM0B 2MQNA 1KOOA 2DB1A 3CTRA 3L3CA 1VQ5S 1K8AT 3MDFA 2XS5A 2HGNA 2DH7A 1X4EA 2DNPA 4PR6A 2BOPA 2M0GB 5GAHU 1VQ9S 4Y00A 2DGUA 5DDOC 2HVZA 4TU7A 3G96A 5D77A 1X4GA 2RQCA 2CQBA 3UE2A 1HA1A 1FJCA 2K3KA 2KM8B 2ZJRQ 2A3JA 1X5TA 4YUDA 2KG0A 3V4MA 1A9NB 1KOHA 2MKCA 1VBZA 1M90T 4ZKAA 1JMTA 3BO4A 2AYGA 1WEXA 3RW6A 2CPIA 5GMKa 5LXRA 2SXLA 3VAFA 2CPFA 1FNXH 1U2FA 2JVRA 2KT5A 4C0OC 2CQ1A 3HI9A 1L3KA 1VQ4S 3CF5Q 2EK1A 2DIVA 2RT3A 4YB1P 2M4MA 1YJNS 3D2WA 3UD4P 1U1OA 2B0GA 3CMES 1SJQA 5LJ5Y 2LA6A 2D9PA 2HZCA 3BO2A 2DHGA 1UW4A 1N52B 2LXUA 2MHNA 2DHXA 1IQTA 1H6KX 2MQMA 2MQQA 3MI7X 1FHTA 3VAGA 2OIHA 2F3JA 3ULHA 3CMAS 3UCUP 3SXLA 2GHPA 3THTA 2DGVA 1VQOS 1FJEB 4WFBQ 4F02A 1WHXA 3S7RA 3R27A 2LECA 3R1HA 2DGXA 2E5GA 2GO9A 1VQNS 1OO0B 2CPDA 3VF0B 2QEXS 3CCVS 5GADU 1U1QA 3US5A 2CQDA 1ZZFA 1VQ8S 3NNAA 5CXTA 1M5PC 2CQHA 3MUTP 3NS5A 1NU4A 2DISA 4J5OA 3IRWP 2EK6A 3B4MA 1VC0A 2G1DA 3U1LA 2XNRA 3DXBA 2I38A 2LYVA 1U6BA 5LXYA 1VBXA 4P6QA 5DM6Q 1R8PA 3VALA 3CULA 2LQ5A 1SXLA 2XB2D 2M88A 2CQ2A 2DO4A 2DNZA 2K8GA 3VAJA 4V19X 2FC9A 2M2BA 1M5KC 2XS2A 1YHQS 2KXHA 4FXWA 3I56S 2X1GA 5IQQA 2CQ3A 1U1RA 3Q2TC 2KXFA 2DNOA 1X5SA 2PE8A 2DK2A 1F9FA 2KFYA 1U1KA 4ED5A 2L41A 1SJ4P 2HGMA 1QVFR 4C4WA 1VQMS 3CCUS 2PEHA 2N7CA 2DGWA 4TU8A 2MKIA 2CQIA 3G8TA 3EGZA 1O0PA 2RRAA 1B7FA 4QQBA 2MB0B 2RS2A 1WG5A 2NLWA 4W92B 1YITS 2VOOA 5GAGU 1VQPS 2DNKA 3SDEB 4WCEQ 3CXCR 4TLQA 1OWXA 2D3OR 1N54B 2RUGA 1CVJA 3BEGB 2YKAA 1U1LA 3NMRA 2M9KA 1K9MT 2MPUA 1X0FA 4Z2XA 4IO9Q 4LJMA 5GVQA 1N8RT 2MQLA 5ITHA 2N82B 1AUDA 2OJ3A 3HHNB 3TYTA 2MZSA 5FJ4A 2CPJA 2FPHX 4A8XA 1VQKS 2CJKA 1SJRA 3S8SA 4QU6A 2E5HA 3ZZZA 2LMIA 3PIPQ 2HGLA 3THPA 1HL6A 2DNNA 2DNLA 2KRBA 4BS2A 1WTBA 1S72S 1WG4A 3N9UC 1U1NA 2DNRA 2DNHA 3G71S 1M1KT 2MYFA 2JVOA 4IOCQ 1WHYA 2DGSA 2RQ4A 1UP1A 2MGZB 2CQPA 3H2VE 1Q7YT 3CC7S 3ZZYA 2HYIB 2YWKA 2O3DA 4QPTA 4M5DB 2XS7A 1KQSR 3CCQS 5JVGQ 2VONA 2CQCA 5DETA 2NZ4A 2RVJA 1YJ9S 1OIAA 4UQTA 4CH0S 2MY8A 2MSTA 1DBDA 5IM0A 1X4CA 1XN9A 5IFMA 1SJ3P 3BO3A 1PGZA 2MQPA 2MKKA 3EGNA 4EGLA 2CPHA 1BY9A 2I2YA 4LMZA 3MXHP 1ZZNA 3FEYB 3NNCA 2XNQA 2F9JA 2JWNA 3VAIA 2MZJA 1FJ7A 2M70A 3MUMP 3G8SA 2DO0A 1U6FA 3SMZA 2CPYA 1A7GE 1WF0A 1WI6A 1VC5A 2OTJS 5DDRC 3IWNC 3B4DA 1DZ5A 2MMYA 2M52A 2M8DB 2MKSA 1X5OA 2KG1A 2DNYA 5CA5A 3J7ZT 1FO1A 2ADCA 2KU7A 4ERDA 4CIOA 2MQOA 4Y0FA 3R1LA 4PRFA 1WI8A 2XSFA 1UAWA 1SJFA 3K0JA 5GAEU 1G2EA 2LEBA 1P27B 2VODA 3MD1A 3CPWR 3VAHA 2LA4A 3PIOQ 2QFJA 3LQVA 3CCRS 1H2UX 2JRSA 2N3LA 5MLCV 2OSQA 1YI2S 2YH1A 3RW7A 2DITA 5D78A 4F26A 1NO8A 1ZH5A 4RU2A 4WF9Q 3I55S 2KYXA 2RRBA 2FY1A 1VQ6S 1WEZA 2JX2A 2MZTA 1JJ2R 3H2UB 1WHWA 4UY8T 2DH8A 2J0QD 2KH9A 4CQ1A 3G6ES 2G4BA 1Q82T 2DHSA 1JJ4A 1W2BR 5BJRA 2U1AA 2E44A 2VOPA 1X4AA 1RKJA 2M7SA 2KVIA 2M8HA 1Q81T 4WFNQ 3G4SS 4F25A 1JJHA 1YWXA 2RNEA 3MUVP 1Q86T 5CYJA 3CC4S 3CC2S 2MZ1A 2X1FA 2LKZA 4OZ1A 2MKHA 5DM7Q 3CD6S 1U1PA 4LIRA 1X4HA 2OTLS 1D9AA 1NJIT 3MOJB 3OW2R 1R8HA 4CH1A 1HD0A 1M5OC 2L9WA 1VQLS 2E5IA 4IUFA 3CCLS 3NNHA 1UFWA 1S79A 2G0CA 1KC8T 3CCJS 3CCES 3P3DA 3MD3A 1X4DA 3CCSS 5LSLA 4FXVA 1YTYA 2EVZA 2AYMA 2L08A 2LXIA 2FC8A 2ZJQQ 2CPXA 1WHVA 2DH9A 2J8AA 2DHAA 5DDQC 5HO4A 2CQGA 2E5JA 3TP2A 1K73T 2KM8C 5HL7Q 2WBRA 2DNQA 2DGTA 2DGOA 3BS9A 4U67Q 4C7QA 2AD9A 1YJWS 1YIJS 1DHMA 2CPZA 2MXYA 4WIIA 3MURP 2MJUA 2YTCA 2MZRA 1WF2A 1WF1A 3TO8A 4TU9A 2RS8A 4W90B 5LJ3Y 1FXLA 1FT8A 3NS6A 2ADBA 2DIUA 2N3OA 3Q2SC 2FHOB 3VAMA 2ERRA 3J7YU 2V94A 2YH0A 4PKDB 5JVHQ 2LEAA 3SDEA 3CCMS 3P49B 1VBYA 3S6EA 2OSRA 3U1MA 2DNMA 2X1AA 3P6YC 2DGQA 2F9DA 1X5PA 5H1SV 5DDPC 1X4BA 1PO6A 3DLLQ 2DNGA 1OPIA 2KI2A 2KN4A 3UCGA 3LPYA 2UP1A 1P1TA 1HD1A 2CPEA 1H2TZ 3VAKA 4YOEA 2BZ2A 1WG1A 3UWTA 4WFAQ 2CQ4A 4QU7A 2MKJA 2D9OA 2AYBA 2J0SD 2MY7A 2MZQA 1VC6A 3UD3P 1DRZA 3CUNA 1QVGR 5LSOA 5EN1A 2QA4S 3JB9k 2MSSA 1WWHA 3G9CA 3UCZP 1N88A 1URNA
chains in the Genus database with same CATH superfamily
5KFDA 4J7CA 1N5QA 4M5DA 3IBCB 2ZITA 1U47A 1TL1A 3OLBA 1WD6A 3RTVA 4K7QA 4J37A 1U1MA 3M9OB 4PG4A 5CZVA 2XI2A 4ES2A 5AXKA 3HZEA 4WZQA 2IFXA 1ZM2A 2UZAA 2NUUG 2ZH8A 3MDFA 1GFWB 1J27A 2OEMA 2IYGA 2PMZD 4EEYA 1H74A 1I6JA 4TU7A 3WQPA 5LOQA 5RUBA 5CAAA 3IN5A 3DOMB 1RBAA 3UE2A 3GFZA 1PJ5A 2ZBIA 1YDLA 4DSLA 1HARA 2XMMA 3RW6A 2XULA 3J80Y 2QL7B 3CMES 2AZ3A 1NUEA 4KAIA 5D4NA 5JMNA 2V34A 4USMA 2BANB 4CLSA 1KSPA 3FQLA 3LP0A 1RWKB 5GMEA 2XGPA 4CDIA 2H9ZA 4HKQA 2JEIA 2AX0A 1R6YA 4ER8A 3M8WA 2NS1B 3CCWA 2V9WA 2E66A 2W9CB 3I4PA 1U8SA 2AQ4A 2CQDA 4DR7J 3SYZA 1RTJA 3NNAA 4DPWA 3TZZA 2GJFA 1RHUB 1KS2A 1ZBTA 3HHEA 4RX6A 1QE1B 1G1XA 3D3BJ 1RBLA 2FC9A 2XMUA 2GJ2A 5KT3A 1LQ9A 4IQMA 1RT2B 1GTEA 2C22A 4LRFA 2XZWA 1G7CB 3CCUS 1CJTA 2CKWA 2ZOFA 1BGXT 1JB0C 4S0MA 4QQBA 2MB0B 3B78A 4DZ6A 2R7QA 4OZ3A 5K14B 1KFDA 4I6YA 3IFEA 1DARA 2N82B 3FGVA 4OYXA 3J81Y 4GC6A 4IRCA 2PFFB 3AH6A 3PRBA 1JNRB 1T02A 4DR6J 4QW9A 2E7XA 3O6QA 2UXDJ 1KR4A 3TEHB 2DNHA 3IXQA 4F3MA 4NMLA 3I87A 1Q7YT 5B0GA 1ZTWA 4OX9J 2VA2A 1T03A 4M95A 3MM8A 3G6VA 2PC6A 2MSTA 3BB5A 1S1UB 2V67A 2XY7A 4BHQA 3CJ2A 2F9JA 2B8QA 1R89A 3N5BA 2C42A 3BBFA 1VC5A 3B4DA 3T3FA 1S0MA 1EZZB 4FVMA 3FFIB 2IIHA 1CJKA 1TV6B 5K9FA 4ERDA 1FWPA 4Y0FA 4M63A 1WI8A 4USKA 3FBCA 2HK2A 4Z7YA 4URSA 5HROA 2LA4A 3TVKA 5MLCV 2IM2A 1IKYB 3VGVA 3HHLA 2BW7A 4DCPB 2UU9F 3BKTA 6AT1B 4YHHF 3K7RA 2KYXA 2ZD1A 1VQ6S 3J7A1 4B9TA 1BWVA 4LBPA 4C8LA 2YQ0A 3I32A 4CQ1A 2YPYA 5G4DA 2BM1A 3DLBA 1NK0A 1LFPA 2AMCB 4LF5J 3UN5A 1WKLA 4UZBA 1Q86T 1RWVB 3CC2S 4FPIA 2QX0A 3CD6S 3I96A 3TZWA 1R8HA 1S6UA 3WBZA 1U2RA 3MWBA 2L9WA 2PO4A 2X7IA 1YQHA 3KWMA 3KLEB 1T9WA 4YY3F 2HS3A 4EZ6A 3CIZA 4ETXA 2XG8A 1X4DA 3CCSS 4Q2LA 1RISA 3HD1A 4ZP8A 4C97A 1P9QC 1Z2ZA 3HHLD 1FJGJ 2A1BA 3IBFB 4NE9C 1TMJA 4PQUA 1RT7A 4GVBA 5J2MB 4LFCJ 5H9EJ 1U0HA 1VRTA 4W98A 2MJUA 2OHDA 2A10A 3HLUA 3QGGA 4H4KA 1U49A 4WE1B 2ZH9A 4OV6A 2FJWA 5DQHA 4DG1A 1UCNA 2HQDA 3UCGA 4KH1B 1SVDA 4LF6J 1HD1A 1IJFB 1WOOA 3Q8YA 1HNWJ 4HH1A 1U45A 3QPIA 4LSNB 1D1UA 1HWKA 2ACYA 2HBRB 2E9ZA 3WDOA 3D6HB 1JKHB 2CXEA 1NDPA 2AEJA 5M2UA 2MGZA 2Q79A 2XC9A 1FNOA 2NYIA 3K5OA 3LPEA 1BQNB 2WTFA 2YQ3A 3BGLA 3NOGA 3W1YC 1XC9A 5KFOA 2B9YA 1RCOB 4DR3J 3MHYA 3BM7A 1K8AT 1NLKL 4DQSA 5KFYA 3CCZA 2ROPA 2CG8A 2JH3A 2DPJA 2P2CB 3H40A 1QUVA 3DLJA 1QTMA 3QJJA 2V8GA 4Q7AA 3KMSA 5C2GA 1HNIB 2W1BA 1JLFB 1MROA 2EKYA 4OMFG 3ZTOA 5LXRA 2BE2A 3HI9A 1UKUA 1S4FA 3PX6A 1F6TA 2FLNA 1EETB 2CDRB 2DHGA 3ZO7A 1S77D 2XYGB 1IQTA 3KHRA 2IBOA 3EXYA 3TEGA 1FHTA 5KFZA 1PYTA 3VAGA 3KK3B 5HLFB 1KHWA 3UCUP 1RT6B 3K58A 3Q8PB 4ZVHA 2ACMA 1TMMA 1RT5B 3S7RA 2D3O1 3KJFB 3R1HA 2DGXA 3ISZA 4CLLA 5F8NA 3TUZC 4ZCMA 4I4BA 1FWKA 1DQ8A 2B4VA 4FF3A 2W8KA 2UUCJ 3J80U 1B3TA 2V6AA 3B4MA 2DBBA 4C0BA 3PFOA 1U6BA 4MK7A 2KTQA 2N4DA 4X4VA 3AFGA 1C0TB 3MCOA 1RTHA 3BPSP 3ILOA 1T3OA 3AXKA 2KFYA 2EKNA 3R8YA 1XERA 1SJ4P 2QV6A 2HAFA 1YRXA 2AX1A 1B7YB 4JV0A 1WG5A 2MLYA 1PAUB 4G1QA 4NXNF 1VHIA 3W2VA 2AF6A 4DV7F 2R8GA 1SH2A 3NMRA 1DLOB 3LGHA 2QG9B 1OPZA 2MQLA 3POTB 2OPRB 4MKVA 4ZOSA 1N5YB 2EFPA 1VQKS 4K4XA 4O4GA 3OXLA 3BGRB 3PM9A 1PCAA 2HK3A 3AOBA 3SSQA 4BS2A 1UW9A 2Q1LA 5EHHA 1U1NA 2IRYA 4DUYJ 3BR8A 4ICLA 2AJ1A 4ZVUB 4C8ZA 4JV5F 4X66J 3ILJA 4A47A 1OIAA 4LRDA 3D6TB 3T5HA 4QWAA 5KTQA 4IDKA 4OV1A 3R5JB 3J81U 2R8JA 2B6AB 2ATCB 1SJ1A 3GCXP 4F4ZA 2I6WA 1WI6A 2GMJA 3C14B 3PHEA 1WORA 3HMJG 1VLYA 2BRKA 1IBLF 3DOKB 2OEKA 1A6LA 4O44B 1U4BA 3K0JA 4FKYA 1H98A 5I3QA 3PW2A 4ZPCA 3Q8VA 3HSDA 1PYSB 4F26A 3T1YJ 3NCPA 1Q95G 1LFWA 3ISND 4U95A 7FDRA 3BQ1A 2J0QD 1RWOB 4MKAA 5F41A 2VOPA 2V2ZA 3AD8C 4WFNQ 1HQEA 1N36F 3L9ZA 4ID5A 4OZNA 1RAOA 2VHGA 1HBNB 3V4IA 1FWLA 3QWUA 4MIWA 3FJ2A 4DEZA 1UJ4A 5K8OA 2XYHB 4HHUA 1GT8A 2WONB 3ENWA 3H42A 1S7HA 1F1BB 4DV3J 2E1PA 4IFYA 2FC8A 5B09A 3GYNA 2DHAA 2HWHA 3W66A 3DRSA 2OPPA 3JSYA 4HH0A 1CC7A 3OFEA 5HVHA 5KFCA 1U25A 2VFUA 1GX6A 1T7PA 3OR2B 1WF2A 1NHUA 3R7SB 2ADBA 4XK8C 3Q89A 1KVKA 3R5DA 3C8YA 3S6EA 4O3PA 3U1MA 3KLIB 2B4PA 2VG7A 2F9DA 4DR1F 1YLXA 3C3LA 1OPIA 2NPFA 3MR5A 5CYQB 1P1TA 3J7Z5 2XZTB 2X3GA 3TAQA 5KFAA 3RB6A 3EXCX 1KBRA 1QVGR 4CYUA 3SQGA 4JI2J 3G9CA 1F5AA 4B3SJ 1VOMA 2KXNB 4ECRA 1KQGB 4LBHA 3SCLE 2QMUB 2IDLA 3BBBA 3KJNB 1IWAA 5E3QA 4YQWA 3M8RA 2J76E 2MKYA 4ANCA 1TVRA 1FDDA 4WU2A 2R7OA 4PG5A 5JUMA 4FBUA 3IR6B 1YK9A 3A1YG 3WIVA 1I3OB 4P74A 4RNFA 3M1VB 3TR5A 2L3MA 3G82B 4BWMA 5IT9Y 5F8MA 5DDOC 4A8MP 4PUOA 5A8KA 5ETSA 1MN9A 5D77A 1HA1A 3RAMA 5HQ8A 4DV5F 3MR6A 2IBKA 1HQUA 2KG0A 2FJDB 4LUBA 1S48A 2BYCA 3FZBA 5CYMB 4IG3A 1S76D 2AT1B 5GMKa 4NI2A 1FNXH 4HR2A 1T95A 1HBOA 3PVXA 2A6OA 1PC4A 4FKXA 1HW8A 4L76A 1MWYA 2YBVA 4LSLA 4UTGA 2B56A 2W4PA 5B08A 2W7PA 5A6WA 3CMAS 1SQEA 2DTJA 5H9FK 2JLFA 4WZMA 4WYWA 2ZZNA 3GP9A 3KK2B 2HLTA 1IUJA 4ALZA 2G2YA 1L3TA 1YRTA 5F8JA 2ZH1A 4K4VA 2FLPA 4HACB 2EC2A 2RD5C 2DO4A 3VAJA 4V19X 3EZ5A 3DRPB 3ZNJ1 4CM2A 1Y5LB 3VVTA 4ZPTR 1U1KA 3QT7A 1UVJA 1NKEA 3DI6B 2DXDA 4USTA 2UVWA 4RNNA 3QAUA 2DNKA 2JLEA 3NGRA 3DU5A 1CVJA 4LVNP 2MPUA 4NCGA 4QIWD 5IZHA 2OO4A 3QBCA 3QSIA 2FPHX 4LF8F 4XO0A 2E5HA 2J0WA 1RT3A 2YKNA 1LW2A 1WTBA 4NLDA 1RWNB 2CAJA 2GNKA 3GU0A 4V19J 3H5XA 4K2XA 3IO1A 2UUAF 4YHHJ 3FCWA 3BZQA 4LFAJ 5HQLA 3OL8A 4QIVA 3MTKA 4OZ2A 1DY3A 3K89A 2E1MC 4UZCA 4LF4F 3MR7A 4D3HA 2ZWPA 1F9EB 4KGKA 3HKWA 1J5EJ 4YY3J 2G1HA 3C16B 1CG2A 3ADAC 3V6HA 4RU2A 3LH2S 2K1RA 4H4MB 4I2PB 2YNFA 2BE9B 2ZUGA 2ZFHA 3ZFVA 4HLBA 1JLEA 1S10A 2IA6A 5B0AA 4IR9A 1XK8A 3HVAA 3EZOA 1KHVA 1C1BA 2LU1A 4U8YA 4C9DA 2W25A 1HWIA 4WK3A 1ZETA 4UF4A 3I82A 2M8HA 1Q81T 2V0NA 3AD7C 3HVWA 3MM9A 2C2DA 2XHWA 3E01A 1JLCB 1NK9A 1NKBA 4QR0A 3BSOA 1D0EA 1BXNA 3P3DA 2ALYB 2GCFA 4LSZB 4CLUA 3OTDA 1HI8A 5KT7A 2XSJB 2L08A 2LXIA 3CO9A 3JTNA 3QGIA 1OYDA 4OYPA 3N28A 2I0XA 3M2UB 3MR2A 1NM2A 2W2MP 4BDPA 4C7QA 1TAUA 2AD9A 1SH0A 2HNDA 2OLWA 4DX7A 3SCJE 3MM5B 2IAJA 2F1FA 1HYSA 4DFPA 3Q2SC 2YWWA 2WB1D 2ZVIA 3CE8A 1Q8IA 3J7YU 4PKDB 4OYIA 1NAQA 4F8RA 1IBKF 4FF1A 4RUBA 4P10A 3OL7A 1G6BA 1P8GA 4ZP6A 1S1WA 5D0RA 2ABYA 2HHUA 4RJVA 2MSSA 3T19A 3VZHA 1VQYA 3MMAB 4Q0BB 2H54B 4I64A 2AP6A 5E3AA 2O5DA 2ASYA 3BGUA 4O4RA 2ZJPQ 2HBQB 2PT0A 3HVTA 4CP5A 5KFFA 2MQNA 3GZ7A 1DURA 1FERA 2IDEA 4F4AA 2XY5A 3LO3A 2CYYA 4F3OA 1X0PA 2ZBCA 2YNHB 4WP9A 1N6QA 1VDHA 4DR2J 2KM8B 2ZJRQ 3ENQA 3LGNA 3C6TB 5KFGA 4ZCLA 3HFKA 1M90T 1JMTA 3I0SB 2CPFA 4USJC 3SZ2A 2I5JA 2A0FB 4MKBA 2M4MA 3GFHA 3D2WA 4ZVRB 5A8RA 4DS4A 4PG8A 5A0YB 3I5CA 1NPPA 5KFRA 1DTTB 3B54A 5L1JA 5IT9U 2QSWA 5B0DA 1OQ6A 1QAJA 5J1PA 3FC9A 2C3MA 4M5MA 4ED1A 1VIOA 3AA8A 3FKBA 3NOCA 1YBTA 5KG4A 2W9AA 3AOCA 1IKXA 2EFOA 4P2MA 5SZTA 4QR1A 4MTPA 3IRWP 4NLXA 1Y7PA 1R8PA 3V6DA 4M5IA 3ETOA 3KLGB 1FDBA 2FB0A 3BH6B 2JFDA 3MGJA 3SSRA 3Q2TC 4XAKA 3CO0P 2WZ1A 4C4WA 2HAIA 4P7TA 2N7CA 2MKIA 1BQMA 1RA7A 3I4HX 2FDNA 4NXMJ 1YKWA 4LREA 1N54B 4K0KF 1T9YA 2G2OA 1K9MT 2LQ9A 1WTFA 2GX8A 4Z2XA 4XPCA 3D6FB 3CJKA 2CPJA 1TU0B 2OI2A 4EI2A 1IBLJ 1RTZA 2HGLA 2DNNA 4RW9B 4OJHA 3I9V9 4KHPF 2R7TA 5HP1A 2VBXA 4PPZA 3NGTA 1N32F 3EUNA 1SUQB 3PRDA 4PXEA 5IM0A 3PZPA 2RB7A 1SQFA 3EGNA 3LA0A 3MECB 1C4AA 1GEHA 2NZCA 2QE5A 1R31A 1HNZF 2DO0A 2CPYA 1N36J 4F36A 2JOQA 3M32B 2YY3A 2MKSA 4QYZJ 2KG1A 1XR7A 2OUGA 4ZJOA 2IC3A 1NK8A 1MNEA 5HQMA 1XNQJ 2NSCA 3PG9A 3JSMA 4X4SA 2EFQA 3ONQA 4JI7F 3MD1A 3CPWR 2G13A 5DZ7A 2OPQB 3PCOB 4EBEA 4X62F 4KJIA 2R7VA 4LF7J 4L74A 1N5TA 2BMBA 3Q83A 2ZH6A 4LRCA 1RWMB 3KMQA 4FF4A 2WRMA 2W8LA 5AXLA 1X9WA 5D3GB 2BXJA 3DM2B 3V5RA 1W2BR 4JI4J 5BJRA 1X4AA 2HQFA 1TR0A 4K4SA 1R0CB 2FLOA 4QBUA 5DM7Q 1SKSA 5LMUF 1O51A 1MLAA 2HMIA 3OW2R 5I42A 1I51B 1HNVA 3GV5B 4IUFA 2HPUA 2CJBA 3NGDA 4KR0B 1QJHA 3GJTB 1QSSA 2CJXB 2VF3A 3UN2A 1UTAA 1FDNA 4HI2A 2HNYB 3NAHA 1CPZA 1SC1B 5HMZA 1M1GA 4F0HA 3RB4A 1S1XB 4P2XA 4JI8F 3AD9C 3MURP 1XMQF 2EW9A 1RT4B 3QZ8A 1OYEA 5D4OA 1FK9A 2XWYA 4TU9A 5LJ3Y 1AFIA 4YMEA 1ACMB 1RU2A 4C8OA 2EG1A 4OI4A 3SDEA 3OLAA 3OVBA 3P6YC 1X4BA 3DLLQ 2DNGA 4KFBA 4WP8A 5IQ6A 3KHGA 1R0AA 4KTQA 3CUNA 4DV5J 4YS2A 1H2VZ 4JV1A 1S9GA 5E3PA 1VJQA 2QYGA 2RJZA 2HVDA 1QAYA 3EDRB 2XMWA 2R8KA 4WKRA 1CJVB 1NSAA 2P9CA 3JTOA 4Q5VA 2D3ZA 1KFSA 2P6TA 4G1IA 3OSPA 1MMLA 2RUSA 5GAHU 4ED8A 2F8EX 3HD2A 1V3ZA 4WFZA 5I3PA 1NZAA 2A3JA 4YDXA 4ZN3A 2Y9HA 1NB7A 3CGIA 3QT8A 2AYGA 1RWPB 4X4PA 1Q78A 3VAFA 1UEVA 1H73A 1T94A 1HNXJ 1FFWB 4TXSA 2J7UA 1RTIB 2ZH5A 1KRPA 1XMBA 3GJSB 4WK1A 4A46A 4NA1A 2GFFA 1R3NA 1S1VB 2C2RA 3GG0A 2MQQA 4PABA 1TUVA 1WC0A 3JXOA 3RGIA 2F3JA 3RBZA 3OR1A 3W64A 1VQOS 4IFVA 1GK8A 3W62A 1XJWB 4I2QB 3PYFA 5IOLA 2QT7A 5D0EA 4ENOA 3LWLA 3CCVS 4YDDB 2A18A 3M6XA 5HBMA 1NPKA 2QC3A 3MEGA 4MT1A 1WACA 4HVZA 2AJ0A 1IBMJ 3R5AA 1VC0A 5G0RA 4TY8A 4IYQA 3CT9A 1PC5A 3T6JA 2Y1IA 2EI5A 3C6UA 3CNQP 4NLTA 4TLRA 3DNCA 1SXLA 3O8WA 2XB2D 2V8PA 1BHNA 1GQEA 3QRRA 1S0OA 3GCWP 3N6MA 1P9YA 2HEKA 1RABB 5JXSA 1KEKA 3QQCD 1K1SA 1RLCL 4UY85 1EB0A 2CJQA 5B0CA 1VQMS 3BR9A 1UWAA 2LEPA 3G8TA 1HBMA 1KLMA 4W92B 2GIRA 3IAM9 4RW6B 1VQPS 4X2BA 3M9NB 4PWDA 1OWXA 2AGQA 4OJ1A 4DQQA 2OJ3A 2BJDA 1T05B 3UDVA 1IKWA 3AB2B 4CRJA 5ETKA 1OY9A 5IV3A 4USVA 2CUYA 3EPIA 1EIYB 2OD4A 3F73A 2B9WA 1IBCB 1Q53A 3PJWA 3IP0A 5B7WA 2NYHA 3TQEA 4L73A 4IQXA 4CH0S 1DBDA 4N41A 1XN9A 1JLGB 1RBOB 2LXFA 4DL0C 3LP1B 3FEYB 3G2XA 2VD3A 2E29A 1S0NA 2MZJA 1FJ7A 1U6FA 3QJPA 2QSFA 3IWNC 2QMWA 2BJ7A 3OVSA 2YPZA 2LFVA 3ZZPA 2DNYA 2GV1A 4DV4J 3T1HF 2CJ9A 4KC5A 3TA2A 3DOMA 3OD2A 2FHMA 4C3KA 3AY0A 2YXLA 4I69A 4PEOA 2VODA 4O3SA 4DN0A 2LQJA 5DGBA 2R8IA 2Y8WA 2UV8A 4J9UE 1WUUA 3EVWA 5LSRA 4OYZA 4DCJB 2BANA 1WSVA 1S1TB 2YVSA 3SI8A 4UY8T 1KONA 4A8FA 3BF4A 2ROEA 4BCAA 4ANDA 3HSJA 3PEJA 2WB4A 2BKPA 5DQIA 3N5FA 2W9CA 1RCXB 1D9AA 3IMQJ 1Q1KA 4C98A 1Y3KA 5HVGA 2P9EA 4CH1A 3KJVB 2ZNZA 3QATA 3BSNA 4LF1A 3CCES 4Q8FA 3HK2A 5CCMA 1TKXB 5I3UB 2CNNB 4GO7X 5A2QY 1R7IA 1QE1A 1RTDB 2WSEC 4O23A 4DF8A 1LOUA 3JQKA 1BQXA 4KQZA 1RT2A 3FMWA 8RUCA 2ALZA 1WF1A 2RS8A 1D8YA 2AW0A 2P6SA 2B3TB 3ZZUA 4DV0J 5KFIA 2Z56B 5JVHQ 3MAAB 3MF5A 5K14A 1NSQA 5T14A 1VCTA 4GKJJ 2UXCF 4C3MA 2POKA 4X65F 4QIGA 2CA9A 4QWDA 4ECYA 1URNA 3KLHB 5LM7E 2BR0A 3A8KA 3P5TL 3DDIA 4WPAA 3SBMA 1E6VB 3A3PB 2GVZB 3AQPA 4MYUA 3TAMB 1KD1T 1OQ3A 4K4WA 2C3UA 4M8LA 1S1UA 4O3OA 2RSQA 4ID8A 1S6PB 3FEZA 1SCJB 2IHR1 3CD5A 1S97A 2HGNA 2H5IB 3GIKA 2DNPA 2IM1A 3FFIA 1NK4A 1TV6A 3N6LA 3HSZA 1X4GA 2EEYA 4F0KA 1JX4A 4DQIA 1SL1A 4YUDA 4EO8A 4AYBD 3H59A 5AJ3J 3RZAA 4Z37A 2JEFA 2GAHC 1IKYA 4WTOB 5LJ5Y 1FRKA 4U7UD 4USIA 4ZDNA 5EGYA 3BO2A 1HHTP 4MFBB 1ZM9A 2RIJA 4ECSA 3R6LB 2IM3A 2VPZB 3EWGA 2NCKL 2RH3A 4LRBA 3EZUA 3IM9A 4L72B 2MHEA 2CPDA 2QZ8A 3M6UA 1BWEA 1U1QA 1T9UA 1ZPWX 1FKOB 2GIQA 2HFZA 1Q8BA 2MDAA 1KVJA 3HJFA 1FKPB 3KLEA 5F3TA 4J5OA 3NEKA 1OY8A 3U1LA 4FYXB 2HHSA 1IKVB 4WKYA 2OEJA 3TVYA 1BD6A 2CQ2A 2B4OA 2DNZA 2A2CA 2WBMA 3NCRA 2XS2A 2HWTA 3SSSA 3QFWA 2KJVA 5J2MA 3WZ0A 1Y0HA 3M7VA 2BEFA 2ZOMA 4NYPA 2Y3YA 4ZVQB 4USHA 4IO1A 3K2YA 4P7VA 4WE1A 1B7FA 2BQUA 4M94A 2B51A 2YX4A 3FBEA 2XWXA 2D3OR 1HHQA 2D3UA 1OSCA 2C2MB 1X0FA 1H7WA 1N8RT 5ADZA 3TZXA 4DL7A 2YKQA 3KDOA 3Q23A 2CJKA 3G6XA 3FRZA 3DGPB 4RUAA 4LSNA 4FF2A 3SV4A 4AXIA 2DKOB 3N9UC 4JI7J 4AQYF 2Q6BA 1JKHA 1VRUB 1XEZA 1ULRA 2YWKA 2IRUA 4X62J 4ECTA 1BQNA 2E5LF 3CCQS 1Y5NB 4F67A 3K5NA 4ZLLA 3Q8QB 4I56A 3BN7A 4NYOA 2FHJD 3A12A 3R9LA 1ZZNA 3D1QA 5B0FA 1IN0A 4K5RA 1AROP 3TUIC 2KFNA 2CFXA 2HVIA 4PXDA 1F3FA 5LMUJ 2J6UA 1B0VA 2R7WA 1YX2A 3F44A 4J9KA 1XTZA 4ILRA 4P73A 5J1EB 1HNIA 1JLFA 2LEBA 1RADB 3LQVA 2CRLA 1JXVA 2WW8A 1YI2S 3GFXA 4OYBA 5L8RC 2DITA 2K7JA 3MTJA 4R5PB 4ED3A 4B3TJ 1EETA 5A8WB 2JLGA 1QSLA 5LL6d 4A8SA 3GB0A 1RJJA 2VJUA 3EDQB 3CJ8A 3ZC4A 2G4BA 2GC8A 3KK3A 5HLFA 1RT6A 1IQZA 4A48A 3G4SS 1SV5B 1RT5A 3V81B 3MUVP 3DMJB 3VGUA 5B0BA 1IXKA 4K4TA 3I5AA 4JV2A 5K8PA 3DRRB 1D9FA 2DR7A 4J90A 4OZ5A 4P52A 2OH2A 3TANA 2BW2A 3AA9A 3GIMA 1C0TA 3VQTA 4U67Q 2OAUA 1N56A 5D4LA 3PXGa 2WOMB 2R2RA 1OSDA 4KIAA 3GIIA 2P8IA 2YH0A 1FRIA 1Y9OA 4RNHA 2UV8G 3QIPB 1RHRB 1DLOA 3G86A 2KI2A 1V9OA 3POTA 3LPYA 2OPRA 1N5YA 3OFHA 5A2QU 1H2TZ 1S6OA 3EVMA 3BGRA 2DY1A 1CBKA 5CH7B 4B9VA 1NK7A 2PN6A 4DV1F 2V4JB 3N4WA 1X60A 1F2GA 2EXUA 4ZHRB 1Q8KA 2B5JB 3IS9B 4UW2A 3CTRA 1F3VA 5KFNA 2B6AA 4TYAA 2BOPA 4ZP9A 2ZM6J 1X8DA 3C14A 5HSPA 3I0RB 1G4CA 2H4WB 1RI7A 4FYVB 3TI0A 4CO1A 3D0GE 3VCDA 3DOKA 1XWLA 4O44A 4FN5A 2Z2YB 1VBZA 2JVRA 2LDYA 4RU9A 4HEA9 3CF5Q 1VHFA 4J9OA 1MWZA 1GMVA 5D0HA 3WIUA 2HZCA 2LXUA 3ICLA 2BE7D 2MHNA 2PMWA 4YB6A 5HJYA 3O2IA 3CJ3A 5J2PB 3NGUA 2FGCA 2XQCA 3A3NB 1ZA2B 1GMWA 2E1CA 3M30B 1ZS6A 5B0EA 3GMGA 2ZDPA 5FDLB 1HBNA 4EYIB 3HJVA 4CLWA 3ETMA 1J5OB 2UUBJ 2HBZB 4O3QA 3CDBA 1O8BA 3FCHA 4ZLJA 2WONA 1VBXA 1UEKA 2GHWA 3GPAA 1XMOF 2M2BA 3MAQA 1X31C 2KB2A 4PQAA 2JFKA 1RAIB 4I0WA 4I6WA 1VYAA 2FQQB 1F9FA 3UFCX 2JNJA 1R43A 1U8WA 2FJEB 3OR2A 1FF2A 3HT0A 3E8OA 1T0TV 5IC4B 2E7VA 1VQSA 5DS7A 4OHZA 3PV8A 2G9OA 1HR0F 3KLIA 4UOFA 5L1LA 1Q4RA 3RB3A 1RAHB 5GVQA 3TOQA 5CYQA 1XIQA 3T1HJ 3KG1A 3S8SA 4OI6A 2GVDB 3OTOF 1PIEA 1Q8LA 5AE2A 4N8NA 2FZKB 1RZMA 3PKMA 1UP1A 3HP6A 2CQPA 2YNGB 4E2FB 3TNVA 1F60B 4ZLPA 3MPWA 3KDNA 3LP2B 1H38A 5U47A 2XCAA 2ZKUA 3AQOA 2NXUA 3NGSA 3TJ8A 1FD8A 2R7RA 4DL2A 4ANEA 2ZC4A 4LVOP 4J9QA 1EQMA 2JWNA 2QGFB 3M1VA 5DJBA 4DV6J 4CTAB 2OTJS 4OI3A 3RAQA 4JI1J 2OD6A 3G82A 1X5OA 5HANA 1Q5VA 4DV2F 1KTVA 3UD5A 4ZP7A 2OFGX 4QJVA 4DJBA 1KQKA 3KHLA 2IVYA 5CYMA 4A8QA 1FRLA 2FHKA 4WP3A 3CCRS 2JRSA 1NH7A 2LQBA 2YH1A 3K17A 4RR5A 3NG8A 4IRKA 3TW0A 3L7OA 2JX2A 3OFGA 4WXWA 5ETPA 1WHWA 4YB5A 1JIHA 1TFWA 2RKIB 2U1AA 1RKJA 4KO0B 3FVYA 1UA0A 1D9DA 3KK2A 2HQIA 4LIRA 1TK0A 1O6XA 3RG6A 1NJIT 4IR1A 1VQLS 2GW8A 4B3RJ 1KC8T 3GQCA 4MK9A 2J6TA 4D3GA 2PMHA 3CJRA 4EFAC 1FEHA 3F0NA 1PJ7A 4HACA 2AYMA 4NCAA 4CT8A 1NXIA 3DKDA 3TP2A 4LIWA 3I6PA 4DLGA 5KFLA 3ILLA 2FVQA 2YNIB 3MPVA 4GO5X 3DRPA 1YBUA 2CPZA 4QWEA 1Y4ZB 3RJMB 2YTCA 1UMJA 3DI6A 1FCAA 4HDGA 1FT8A 3CDEA 1LXJA 2V8DA 5C25B 2VQEF 5KOWA 4JI5J 1VBYA 2OSRA 3VR1A 3R7NB 3FNNA 3W63A 5J2NB 1UVLA 1X5PA 2EFGA 5H1SV 1PJ6A 3ZZRA 2CPEA 2ZBRA 2MY7A 1VC6A 1YJRA 2AWZA 3UCZP 2CJYB 2GIFA 2BX6A 5C7PA 1RA6A 3NKYA 4GVLA 4NLPA 8ATCB 4DL3A 1YBAA 4JI0F 3ZTRA 4C0HA 1KOOA 3UVJB 1VQ5S 4DOZA 1TL3B 3HT3A 3DOLB 1S9EB 2UXBF 3D0IE 1GXTA 3AJ1A 2Q66A 2B7BB 1U6ZA 2JEGA 4ETZA 3GILA 4OX8A 1K47A 4CM0A 1DTQB 4ATNA 1OJ4A 1J2VA 3C16A 3QT6A 2RDDA 4C0OC 2DEIA 4IG0B 3LTOA 1U1OA 5KFSA 2LA6A 3TWZA 3QRPA 4H4MA 4I2PA 1D09B 4RW7B 2XLKA 1H6KX 2MQMA 3ILIA 1E6YB 4LFBF 2OIHA 4YEAA 4B3OB 1MN7A 2F63A 4F02A 4F0MA 2QO3A 1R0BG 4UOCA 2HQ3A 1LWCB 1JLCA 5KG6A 5E3CA 1ZZFA 4B17A 2EFNA 2HRTA 2DISA 4DX6A 3QGPA 1RHKB 2HBYB 2XSJA 1LWXA 3N01A 1NCLA 2V2KA 2K8GA 3L7UA 3M2UA 4NLRA 3T1AA 4C8MA 3I56S 4NLGA 1MW7A 2HWIA 2X1GA 1RKIA 2ASDA 1WDDA 2ZH3A 3MM5A 2LP4A 5ETMA 2PEHA 3H2LA 2W7AA 2W2OP 4DR5F 1JLAB 3NS7B 4ZS6A 3OJUA 2V4RA 3SIPB 4WCEQ 3PR4A 1U0SA 3H0PA 4NLSA 1VGYA 4DI6A 2W2PP 2R7SA 1AUDA 2WVBA 4QIEA 3L09A 3HDSA 4YR2A 4QU6A 1UEUA 2D7SA 2XI3A 3KNAA 4CCHA 2VICA 1S72S 3MMAA 4Q0BA 3PW5A 1EKSA 1FX2A 4FP9A 3EM1A 4EBDA 4WFXA 4EWTA 3KUGA 2XS7A 1KN6A 3IG1B 1KKHA 2YKPA 4NX9A 2OMLA 2HIQA 4NLWA 4LMZA 2EG2A 3ENVA 5DZ6A 3GIRA 2JC1A 4I7FB 4DR4J 1PKUA 3L7PA 3QO9B 5KFMA 2MMYA 4ED7A 3AB4B 1FTCA 2V69A 2HNZB 3CIMA 2E1RA 4RL1A 7FD1A 2YNHA 4KRWA 3TUJC 1L3UA 4B3MJ 1UAWA 3C6TA 3C15B 3I0SA 2HVHA 3KG0A 2ZC3A 2YWEA 2N3LA 3MOZA 3K5PA 3LUYA 2WVFA 4IH6A 1NO8A 2CWKA 1WKKA 1S7IA 5KG5A 2MZTA 4KPYA 1JJ2R 5A0YA 3R3TA 3GV8B 1DTTA 3BREA 3ELHA 1YGYA 3IAS9 3OL9A 2KVIA 2DR9A 3MR3A 4F25A 3HHDA 2LKZA 2VZ9A 2Z4PA 5KFKA 3MPDA 4NZ6A 2VQFF 3CCLS 4XTTA 3G8QA 4ECUA 3HFVA 5DG7A 2FUG9 5FD1A 2DH9A 3KLGA 3V6KA 4H4OB 1PSDA 3PHTA 5F0WA 3QT5A 3K59A 1YJWS 4NZ7A 1DHMA 4R8UB 5T7LB 4NYZA 3HHLC 2VPXB 4ECVA 2MZRA 4HL9A 4DQPA 1H3DA 3TO8A 1TKDA 1FD2A 2DT9A 1FXLA 4LQ3A 2CZ9A 3IBWA 3OVAA 2Z58B 3FMBA 3ZTPA 5L1KA 4P72A 2AHOB 3CJ5A 4OX6A 2ZKTA 5BYSA 5KG3A 2NQPA 5HMYA 5F8GA 4DR6F 4J9MA 2DCLA 3O1LA 3VAKA 3CD0A 2UXDF 4WFAQ 2MKJA 4DU7A 2RDJA 5EDWA 2RMLA 4G6VB 2OP5A 3JB9k 4RW9A 5HK4A 3DLEB 4OX9F 3QWPA 4DU8A 4CT9A 3DHWC 2CNKB 4CH7A 1WOSA 2X1BA 4P2SA 2AYEA 1SUQA 2M3DA 4DWIA 1HWUA 2KHCA 7AT1B 4KGVB 3QFHA 1LWEB 3M8ZA 2DB1A 1CLFA 3MECA 3IRXB 2VFSA 4OHXA 3D4JA 3HULA 1WC1A 4ECWA 2DH7A 3RB0A 4H4KC 3M32A 4EO6A 3PFEA 3UQSA 5KFWA 2JEJA 3T9NA 4JI3J 5GMDA 3MEEB 1UJ5A 2K3KA 2LDIA 2YKMB 3D66A 5M2PA 2EBGA 2MKCA 4KSEB 2IYIA 4ES3A 2XHCA 2KT5A 4RWWA 2FZGB 2OPQA 2ZH2A 3OXFA 4RW4B 2QFIA 4OJ3A 1XMOJ 1IR1A 2VB6A 4ED4A 1ZPVA 5F8IA 1RWWB 1N52B 4FYWB 4DBQA 4LF5F 3OTCA 2GMHA 3RYLA 5D3GA 4HHHA 1CC8A 1RUSA 3DM2A 1HLWA 3M4XA 1FJEB 4ZVSB 5DO2A 3H5SA 2PI5A 1VQNS 1MU2B 3D6MB 3B8HA 4DMZA 3AXMA 2VL1A 5HAOA 3HHKA 4FXDA 3UNGC 5CD4H 1EQ0A 4NRTA 1S99A 1NU4A 1ZYQA 2ZH7A 1FJGF 3VALA 4U6PA 4LFCF 3MMCB 1KNZA 2HNYA 1NJZA 4OYAA 3RAXA 5IQQA 2KXFA 2XMAA 1EAYC 4A8OA 2PE8A 1WC5A 1S1XA 2H48B 1DFDA 4DUTA 1RT4A 4RKUC 1N0VC 4TU8A 1O0PA 1L5UA 5HVFA 3L95X 3H5UA 1SC4B 5E5NA 4RBUA 2CIMA 4LF9J 5F3ZA 2R7UA 4X4OA 4TKTA 3KLVA 2MZSA 3TARA 3JQJA 3ZZZA 1TKTB 2LMIA 4J91A 2KYZA 3CJSA 3MEDB 3W9IA 2VBWA 2DNLA 2VPWB 4DFJA 3BKUA 4ZVPB 3PRVA 2AJQA 2DNRA 2AV5A 1GMUA 4ZN1A 2MYFA 4U8VA 1WHYA 2JZ5A 5AXNA 1LNQA 1UWBB 1T9VA 2XMJA 1CJVA 4NWBA 4UQTA 4XPEA 1QAXA 5AE3A 2Z2ZA 3BO3A 1VK8A 1FRHA 2E9RX 3PW4A 2VFVA 1UVMA 2C3YA 2M70A 2C2KB 4Y2IA 4AL6A 3H25A 2VG5B 3OV7A 1WF0A 2F7VA 5DDRC 4UQGA 3M2RB 2GA7A 4F3QA 1AB8A 4CIOA 2MQOA 3MEKA 4O3NA 1UETA 1G2EA 1ZAWA 1OY6A 2F4FA 1RTIA 2QN6B 1JK9B 1QAIA 2RRBA 3W61A 4BWJA 3WX4A 4H54A 1HHSA 1S1VA 4PG7A 3T9ZA 4K2JA 3C2PA 2KH9A 3ZZOA 3D3CJ 4CLPA 1JJ4A 2CZ4A 2IA0A 3ET6B 2OPSB 1SQGA 4AL7A 3ISNC 1JJHA 1YWXA 2Z57B 2VQEJ 3CC4S 2MZ1A 2ZBQA 5ETRA 4I2QA 5CCLA 1X4HA 2UUCF 3MOJB 4CO2A 3O3LA 3VGSA 4K59A 1ZOTA 4DXLA 4NOHA 1GTHA 1HBUB 4HI1A 2EVZA 1Y5IB 3SFGA 2J8AA 2DR6A 4K5SA 2OGUA 1JLBB 4HT5A 3KNGA 4ZA1A 2RE1A 2MQ8A 3S1TA 2D1CA 4LQ9A 4OYMA 1U7LA 5AT1B 4ZJLA 4CO5A 4DFMA 4JI0J 2BRLA 2V50A 3NS6A 2N3OA 3QJLA 4CNYA 2ERRA 4RW6A 2F4VF 3QGHA 1JLQB 1FVSA 2DNMA 1TELA 3RUBL 3HM9A 5E33A 3CCTA 2GGPB 2UXBJ 3BN4A 2GHVC 2ASLA 3OXGA 2Q6CA 1T05A 4QIFA 2O66A 4YOEA 3UWTA 4AXJA 2ZWOA 2R2SA 4X4TA 3GJRB 1KP6A 4X66F 4DL5A 4QZVB 1H72C 3W7BA 5F8HA 2IM0A 1RK8A 5FLXY 2GS8A 3AT1B 2DVIA 1SKRA 4U7UK 1JLGA 3T5LA 3L3CA 4PZVA 3CW2C 3LP1A 4JYAF 1HWJA 1HWLA 1RB0A 3G87A 2ZVSA 1RT1B 1UVKA 3ZZ0A 4FBTA 4NZ0A 3KHHA 4FNIA 2AU0A 1ZAVA 4Y28C 2HZVA 1FJCA 4PXCA 4YFUA 2C28A 1S0VA 3V4MA 2MLZA 4RUCA 5L46A 1F2HA 2RHQB 3UD4P 3PEHA 3Q0AA 1NH8A 2GO8A 1VR6A 3U02A 3M05A 2F40A 4AUKA 4DLEA 3HPOA 3VGTA 1H0HB 2UU9J 1S1TA 1SKUB 1S4EA 3ULHA 1LWFB 3UDLA 3R27A 4DR5J 3EPGA 4X64F 1OO0B 1BE4A 5KFBA 2EPIA 3UR3C 1G3OA 1KTQA 5ETOA 1TP7A 3NAIA 3GR1A 2Y1LB 2QYCA 3KJVA 4ZIVA 3LAMA 1TQLA 3IWLA 3W5XA 5LXYA 3DDKA 3NP5A 1F5CA 1TKXA 5I3UA 3CULA 2FJAB 1RTDA 5J2QB 5L1IA 1AXQA 4FXWA 1YJUA 4KGZB 3Q8SB 2GZOA 5DRKA 2B43A 3H7HB 1AZSB 1VLOA 3I9ZA 2RRAA 5F0UA 3GJQB 1RAEB 1NRKA 2BJEA 3RRGA 3RBEA 2CDQA 3MAAA 3VVUA 3U7JA 3EGVA 4LJMA 2DXFA 4OZJA 5FJ4A 4OHWA 3AOAA 4HYKA 4M5HA 4JI2F 4B3SF 1WOPA 1O5JA 3THPA 2H5JB 1TL5A 3KLHA 1FFGB 3RR7A 1M1KT 4LRAA 4N7TA 1Q7LB 2JVOA 4IOCQ 3NBPB 1E6VA 3T5KA 1FX4A 2GVZA 5C5JA 3DRYA 1FXRA 3TAMA 2OKQA 1SKWA 2MQPA 2MKKA 3M8PB 4EGLA 3QSYB 4RWXA 1S6PA 3KFWX 2IVMA 4L3NA 3UW1A 3KUHA 1XBWA 4G3IA 1XNRF 1RWXB 1REGX 5KFEA 4N5SA 3JTPA 4JUZA 1H7XA 1VRQC 4DPTA 5DQGA 3T5JA 4C6AA 1FE0A 5CA5A 3D28A 1FO1A 4QYRA 2VQFJ 4OLPA 4PRFA 4E98A 3U1NA 4DHVA 4ELUA 5L9NA 1P27B 5KAKA 2F5GA 3DYAB 1F9HA 2HKEA 4MJKA 4ZVGA 1AA1B 5D78A 1CEZA 2HHXA 2VG6B 2YKOA 2GJIA 3MAHA 4MFBA 3KXDA 4DQRA 5D15A 1QY7A 4P2FA 4EU0A 4ED6A 3BQ2A 2ZEJA 4K4YA 2WVEA 4AFFA 2M7SA 5K8MA 2Q3PA 3DLKB 4MIBA 3BV8A 4OZ1A 4DSEA 4P9SA 1FKOA 3R7BB 1S5ZA 1YSJA 3N6NA 4Y2AA 1VBKA 2Z30B 1FKPA 1Q0NA 2K06A 2QRRA 4RW8B 3CCJS 2W2QP 4ZPWR 4OYOA 5LT5A 1IKVA 5KT2A 2RQMA 2XMTA 1WHVA 5HO4A 3IC1A 2QLWA 1ITPA 1IJEB 2DNQA 3GR0A 4PXBA 3WC0A 2DGOA 2B9EA 3CB4A 3CWJA 4A8YA 2HRYA 2YWGA 1UL3A 6FD1A 3LF0A 4V1Ak 1AFJA 1OMSA 4C11B 2IVFB 1WKJA 4KKOB 2R42A 3K57A 2C2NA 2O67A 3BGOP 4PG6A 3FBBA 3VAMA 4Y34A 3LGMA 5DGAA 4WWSA 3MPYA 1XR6A 2BM0A 2X1AA 6FDRA 2DGQA 4NXNJ 1HPZB 3BQ0A 1WJ9A 4DV7J 1N48A 3M8YA 4IKAA 1PYOB 2CQ4A 2AYBA 2MZQA 3UD3P 5EX0A 3DGPA 2R9LA 4JI6F 2C2EA 1WELA 1FESA 1HKAA 4LFAF 1QM9A 1VRUA 1D8ZA 2V63A 3ITHB 4DPXA 1SC3B 2XO7A 4QW8A 3J81j 2U2FA 2RHSB 2RU3A 3OQ2A 4JV5J 1C1CB 4ZCKA 4UOHA 5IT0A 1FRXA 4F04B 4KBIA 1NHKL 2V68A 5C42B 1J5EF 2DGUA 3MMBB 4C2MA 1V5IB 4WIQA 2Z8QA 1RP5A 2RQCA 2CQBA 3TJAA 4JBCA 5J1EA 2HHQA 4J9VA 1A9NB 4Y6IA 4ZKAA 3BO4A 4CWBA 1U2CA 1U48A 5FLXU 3H20A 4E0DA 2NSBA 1Y11A 4K8RA 3NXZA 4WJBA 4R5PA 3W2WB 2D9PA 5A8WA 2D74B 1UW4A 2K3IA 1LW0B 3PX0A 3THTA 1TKZB 3W5YA 1SV5A 3V81A 3DMJA 1FEEA 2GO9A 1RLDA 4CLTA 4P71A 2R2UA 1RAAB 3CMQA 2HHHF 1TL7B 3DRRA 4WYLA 5F9NA 2BJ3A 1M5PC 2BACA 3NS5A 1CQMA 4ILLA 1KVIA 2G1DA 2I38A 2BQRA 1CJUB 4P6QA 2IPOB 3F56A 3UN3A 2XEXA 1BMQB 2N7YA 2ZHOA 2LQ5A 2B8PA 2J9EA 2ZBPA 4USUA 1RYSA 1YHQS 4NEZA 4IH7A 2WOMA 5E7OB 2DXEA 3JS9A 2HGMA 1VISA 1OS5A 1QDUB 2E7WA 5MAOA 1NSKL 2DGWA 2UUWA 3LANA 4AT1B 4O3RA 2JC0A 2J6SA 1CQNA 2QLFB 2G0JA 4WTYA 1TK5A 4FYDA 4L6V3 5E3RA 3QIPA 4Y2CA 5EUHA 1N0UA 4ZPDA 3TYTA 3AJ2A 4OI1A 2RQKA 4DR1J 2HFVA 1JNZB 3PJ9A 2I9SA 4NLUA 1NJWA 2P5VA 3CJTA 2Y1RI 3FRYA 3G71S 4RUHA 2ROGA 3HO1A 2XZDB 4FVCA 2V4JA 2ZNYA 5JVGQ 2DRAA 5CABA 2FY8A 2AGPA 4ZHRA 2B5JA 3IS9A 3DLGB 4E8UA 3MXHP 3GONA 3FSYA 3BBCA 1TZ0A 1AYEA 3G8SA 1RAGB 3RBDA 4ZVFA 2F65A 3UNYA 5IV4A 1DZ5A 4DR2F 1UPPA 2DCUB 2M52A 3I0RA 3Q24A 4KHRA 2AJFE 3GE9A 2PIIA 3CDAA 2H51B 1FRJA 3R1LA 1REVB 3PW0A 2COLA 2X51A 3TAPA 1UFLA 3PX4A 1PBAA 2UVRA 1WEZA 3DXSX 1S6QB 4IH5A 4AL5A 4TYBA 5J2PA 4DFKA 4PWWA 2Y0BB 5DG8A 2WCXA 1SC6A 3M30A 4C3LA 4Y65A 2F4VJ 3F41A 3JAMY 2X1FA 5FDLA 2CNOB 1GX5A 3SCIE 4Q43A 1T9XA 3GYGA 4M5LA 1FTRA 4LR8A 1J5OA 1S79A 2G0CA 4CO3A 5C2CA 4GMKA 5CQGA 5LSLA 3TX0A 2J7KA 5KFJA 4F50A 2XYPB 3M2VB 2W9BB 2ZJQQ 2FJVA 4CO0A 1XR5A 4HT7A 2GAGC 3JSRA 1APSA 4QCLA 2HS4A 2Z2LA 4CZCA 3SFUA 4DDFA 1Y10A 2HIYA 3A3OB 3D9BA 4YB7A 4NXMF 4QOTA 1RHMB 5KFXA 3MM6B 2FHOB 4W4MA 3W8PA 3TQ1A 4JYAJ 2YX7A 2V94A 2CJAA 1LK7A 1FE4A 2DRBA 3BYRA 5DDPC 4NA3A 3E51A 5HMWA 2KZMA 1XQIA 2V8VA 2GVDA 1DRZA 3KJQB 3HZGA 4NCBA 4ZVEA 4LF8J 3P5BP 1VQ7S 5C24B 2KFZA 2E1AA 2FVPA 2YNGA 4PCQA 1I94F 3LP2A 2LCWA 4MH8A 2FVSA 2CQ0A 3FEXB 3FZ2A 4EUVA 4OZ0A 2BV3A 2PA3A 2UUAJ 1CS4B 4K4ZA 3V6JA 3M9MB 3E2EA 1HI1A 2JDJA 3OFFA 4PR6A 4YR0A 4CTAA 4X64J 4FS1A 4O0NA 1XNQF 4USWA 2HVEA 2PA8D 3MCMA 2ILYA 4LF4J 3J7AN 2IJFA 4LF7F 2BJ9A 3JYTB 3R5CA 5D0GA 3KLFB 4DL6A 3CJ0A 3LOUA 2DIVA 4N56A 3PO4A 1SJQA 4X4NA 5K20B 2R7XA 2CNLB 1CULB 3SEOA 4JI4F 2DHXA 2LLZA 3MCSA 3KK1B 5ETLA 1NJXA 3MM7B 3CJQA 2RKIA 3C66A 3RRKA 4RPFA 4KO0A 4DZDA 3UDCA 1ICEB 3J7YI 3PDNA 1WC3A 1VQ8S 4XIUA 1P6TA 3OUYB 1C0UB 5CXTA 2CQHA 1M5SA 4QWCA 2VBYA 1UZHA 2PEBA 1HMVB 1AUSL 3H90A 4KV8B 1PAEX 3K8WA 2Z0GA 2YNIA 2FLLA 3BJYA 1U1RA 2H1YA 1B99A 3EMTA 1URRA 2RF2B 1NDCA 3GWCA 3QZ7A 5C25A 1PILA 4OIXA 1CSJA 2BUNA 4FYYB 3QRQA 4PPDA 3RRHA 2RUGA 3BEGB 2V2QA 3QLHB 1U1LA 2M9KA 3D68A 1XNRJ 5J2NA 1EP4B 4I6AA 1WSRA 2IJRA 1RYRA 1IBKJ 1R8BA 1IM4A 3TA1A 4O0IA 2RRNA 2VKRA 4J9RA 2ZE2B 3M8QB 2KRBA 4JOUA 1IR0A 1SIZA 1WG4A 4HDHA 3OL6A 4RZRA 4DF4A 4YP3A 2VDHA 4ZPAA 1MSWD 3CC7S 3ZZYA 1X9SA 2CVEA 3M6VA 4M5DB 5DETA 1TL1B 1MMNA 2MLXA 5IFMA 5KT4A 3UVJA 4TQSA 1TL3A 3IM8A 3DOLA 1X7VA 2FGOA 1S9EA 1EX8A 5IWAF 3BDEA 2W4CA 5ETQA 5F9LA 3J7ZT 1DTQA 3NWGA 5HN0A 1IM6A 3X3UA 1HNXF 3FSIA 1LK5A 3Q8RB 1JWWA 3NY0A 4B9SA 3IR5B 4IG0A 1Z1ZA 1T9TA 3DRXA 1ZH5A 1FA0A 1YJVA 4WF9Q 3I55S 2VC1A 4RW7A 1RU1A 2HHWA 3VV2B 4CLZA 4KB7A 3CSKA 3LP0B 1E6YA 2KJWA 4B3OA 3BDPA 2RNEA 4M5KA 3X1LB 2MKHA 1EKRA 1LWCA 2K7KA 3PKYA 1IBMF 3ZTQA 3D7SB 2H65B 4Z7CA 1RTJB 2VU5A 4KT0C 3NNHA 1NB2A 3IGVA 3T6BA 2R4FA 3MD3A 4C8NA 1DJ0A 3P96A 3OTBA 3PYEA 4JI6J 5L9XA 2CQGA 1V6HA 2HFOA 1V3SA 1YIJS 4ES1A 1RAFB 2EBEA 4ECQA 4NL5A 4WIIA 3JAMU 1CJTB 5I4MA 1U02A 4F2SA 1Y3JA 2RAQA 3B6BA 1JLAA 3R97A 3SQOP 4I67A 2VUGA 3P49B 4ZPBA 1JXLA 2BJ1A 2W2NP 3HX9A 5KG7A 4YN3B 4TVAB 4K0KJ 3NL0A 1WG1A 2H4YB 4L75A 3ZNUA 2KT3A 2QA4S 2KL8A 1WEYA 1SL2A 2MJNA 3AODA 1RHJB 2CVIA 1X4FA 3QMQA 4X4RA 3GLJA 3EX7B 1T03B 1ZAXA 1T8EA 1LV5A 2IRXA 4FZVA 3IG1A 4KHPJ 3MM8B 3S01A 4WXOA 2NPIA 3JQMA 2CADA 1N32J 3A8JA 1NBEB 4RBVA 2FTRA 3MZIA 3HFZB 5LMNF 4GKKF 2ZDOA 2HHVA 2VIHA 5KFQA 4I7FA 4DV4F 3QO9A 3VWSA 1GNKA 4ED0A 4Y00A 3IR7B 2HNZA 1HNZJ 2HHHJ 1HW9A 1CJKB 3A4TA 4Q44A 1X5TA 2I1RA 4AD6A 3MFIA 3C15A 5HROB 2RDIA 1L3KA 4JB8B 2RT3A 3HHLB 1YJNS 1S9FA 4M1KA 4UT4A 2ZD1B 1HFEL 2KZZA 3MI7X 4L3KA 3M8SA 1YZ7A 2GHPA 3IWXA 3CVKA 1BC6A 3R6GB 2LECA 2E5GA 4Q45A 1K0TA 3I31A 1U09A 3VF0B 3WHIA 3US5A 3OSNA 2QIFA 4ILMA 4NLVA 4J9NA 1MG7A 2J0XA 4PAAA 2XNRA 2LYVA 5DM6Q 1LKZA 2A6MA 4H4OA 2GMLA 4F7VA 3RU0A 4EBCA 1UZDA 2D41A 4PQUB 3OTEA 1RT7B 4GVBB 4RNOA 4ZITA 4R8UA 1U0HB 2QLJB 5T7LA 4ED5A 1VRTB 5ETVA 4DV0F 5KFHA 3SCKE 1VIXA 3QIDA 4M5NA 2CQIA 1Z2LA 4ECXA 3EGZA 3LW5C 4JI8J 2RS2A 1XMQJ 4GKJF 8AT1B 3CXCR 4RLEA 4DG1B 3OBIA 2KT2A 4IO9Q 2Y0SD 1FKAF 5GAHI 5HATA 3G6YA 2DYAA 2R3VA 3DDNA 1ZM4A 3TA0A 2HG4A 2WAQD 3DLEA 4OHVA 3EE3A 3KYLA 2BBEA 2RQ4A 2MGZB 2FZCB 3NMAA 3R2CJ 1NMEB 2VONA 2NZ4A 2HS0A 4OZLA 1X4CA 4MMOA 1LWEA 1SL0A 1TTHB 3IRXA 1M1HA 3NNCA 1FXDA 5JJBA 3FQKA 3MUMP 2ZUAA 2HLUA 3SMZA 1KWMA 5H9EK 3WX8A 1X9MA 3D67A 3BGFA 2ADCA 5ETNA 3MEEA 5AJ3F 4ZK7M 3UR0A 2XTJP 2IMWP 2YKMA 1MROB 1IWGA 5KG1A 1F0XA 2BQ3A 2BE2B 2OSQA 2DR8A 3FDSA 4RW4A 4DCOB 3CDUA 2E9TA 1FVQA 2JSXA 5BR8F 4WBFA 3H2UB 3P8BB 4UUWA 5L39A 2O1PA 4LR7A 2MEWA 2Y1JA 3AAWB 1MU2A 1I1GA 2QL5B 2J7WA 1U1PA 2OTLS 4MAKA 4KY3A 1ZM3A 2E5IA 2YQ1A 3R2DJ 2IJNA 1UFWA 4G1PA 1VS3A 2E5JA 3MMCA 2QA1A 1TUGB 1RTHB 3BS9A 4MKYA 1I94J 1JXEA 2EC0A 3MPUB 2BVZA 3BYPA 5T41A 3C19A 2IY5B 1RHQB 2W24A 4ECZA 1N33F 4CLKA 4G1QB 2LEAA 3W2VB 3CCMS 3DU6A 3VHQA 4Y2KA 4TN2A 3SV3A 2HFUA 5CHCB 3UDEA 5CZXA 2UP1A 3C46A 1ROFA 4CI0B 4NASA 4DPOA 4O4GB 1TKTA 3MEDA 5EN1A 5DG9A 2VA3A 3HF5A 5K8NA 5HMXA 2KRRA 2DJWA 3QYYA 4ICLB 2BKNA 2J9DE 1UWBA 4CNZA 2FJBB 4ELTA 3KG4A 1EJ7L 1RAJA 4IDKB 5BYQA 2XS5A 2VG5A 1KLNA 1GMWD 1X4EA 5KG2A 3EVOA 2M0GB 4I1TA 1FI4A 2R8HA 2B4UA 4UUXA 1R8CA 4KGXB 5KFTA 3M2RA 4FS2A 3ZTSA 2EWHA 3P45B 4LT6A 4ZJQA 2QA2A 2NR0A 3E3XA 2FYXA 1WEXA 2CPIA 1U2FA 4B3TF 4GRSA 2HHPA 5HI7A 3DHXA 5H9FJ 1B4SA 1M0SA 3ET6A 2DGVA 2OPSA 2KKHA 4OX7A 5KT5A 4KH0B 4TQRA 1HQEB 3RBXA 1Q16B 5M2RA 4ID5B 2QEXS 4URGA 3V4IB 1K0VA 2EK6A 3PR5B 2XLIA 1HBUA 3CD7A 4IFYB 3H5YA 3D5MA 3OHBA 4KPCA 4Y2MA 2M88A 2C2ZB 4FDFA 1U26A 3DRSB 1UFKA 3GIJA 2OPPB 1JLBA 1FRMA 3GV7B 2BJ8A 2CQ3A 4X84A 2VBZA 2V5HG 1X5SA 2HFNA 1ZA1B 1QVFR 2BKOA 5D4PA 4ELVA 1S57A 3DN9A 1JJCB 3N79A 1WDTA 2NLWA 2VOOA 2DD8S 5E0OA 1JLQA 2VG7B 2GGPA 3RR8A 4ZCIA 1W2IA 5IWAJ 4KHMA 4Q8EA 1AW0A 2QL9B 5GAGI 1NK5A 1L3VA 2V8HA 4A8XA 1UJ6A 4EZ9A 3LWMA 5FIIA 1YJ7A 4YR3A 3GSIA 2UXCJ 2G0IA 1VMBA 4CYUB 3SQGB 1NEEA 1LXNA 1NSPA 3H8YA 2VC0A 4X65J 1T11A 4ZPVR 1C4CA 4F4WA 1DAXA 3H2VE 1P1LA 1YZ6A 1UA1A 2CQCA 2RVJA 3W3SA 4LBIA 5EX3A 4URQU 1TVRB 1PGZA 5KFVA 1PBUA 2CPHA 2I2YA 2H3EB 2ZM6F 1QLNA 2XNQA 4DSIA 2C1EB 2V4QA 4MYTA 3DCAA 1RT1A 2ZOGA 1Y00A 5BYRA 2N4CA 4PUOB 5A8KB 2A2DA 3IA0A 2KU7A 4LF2A 4A8KA 5E41A 1HQUB 1SJFA 4ZVOB 4IG3B 1N5VA 1NDLA 4NI2B 2QFJA 2NXCA 4UOGA 4M5GA 1H2UX 5IS2A 1HBOB 2HFSA 3D1OA 2EFVA 3PACA 4AE5A 4B02A 2NXJA 2HURA 2MTLA 1SH3A 5GAEI 4HTIA 2ZHAA 4LSLB 4RNMA 3D0HE 1SI9A 3O5TB 3EICA 2DH8A 3G6ES 4N47A 5KG0A 1LWFA 3FSXA 2GQCA 3K8VA 4Q2MA 3LALA 4ZIWA 1MWQA 2I8EA 3HVRA 2XY6A 2LU2A 2QTWA 2UUBF 4GC7A 1HD0A 1M5OC 3W5ZA 3EYZA 9RUBA 4QWBA 4C48A 4FXVA 5EWEA 1NJYA 3H98A 3UPFA 1EARA 2WVCA 5K5MA 2AKWB 3NGKA 5J2QA 5HL7Q 4J9SA 1W7WA 2DGTA 4PWUA 4DUZF 2VDIA 4TNOA 5SUHA 4EK2A 2AIRB 4I68A 1I5OB 4CLFA 2MXYA 4RO0A 1AZSA 2FIUA 1SB6A 5HJXA 4W90B 4OJGA 2ZH4A 1C2PA 2DRDA 5LMNJ 4GKKJ 4XDDA 5ETTA 1V3RA 5D8HB 4BC7A 2NXNA 4NCGB 2HSEB 2NXEA 5A76A 1HQ2A 1N34F 3VTIA 3TVZA 2VPYB 2L48A 4FNHA 5KOXA 1RT3B 2ZZTA 4U96A 2YKNB 3VZIA 1LW2B 2HHTA 1KQFB 2ASJA 2RILA 1DQAA 1M5VC 3W8GA 1SPBP 1RE1B 4IOAQ 3NBPA 4IRDA 4NLOA 3NLCA 4KYZA 5A6PA 1HI0P 4AQYJ 2PFDA 2AEMA 2Z2MA 2E5LJ 1NDKA 3M8PA 4DV6F 2KHDA 3THVA 4JI1F 4F4KA 3A8EA 2BDPA 2UVVA 4A4JA 4KE5A 4DSFA 3ENAA 3BKFA 3CEDA 2JL9A 5KT6A 3T41A 2FVRA 2HVZA 1FNMA 3G96A 3D1HA 1N5SA 3BSAA 4X4QA 3Q22A 3OPKA 4DX8H 1KOHA 5THWA 2APOA 3PW7A 3DYAA 4KGMA 1R6VA 2YWFA 2CQ1A 1VQ4S 3FK4A 4ZVTB 1Z4UA 4LR9A 4OFZA 3HKZD 2K1RB 2NUHA 2VG6A 2KVQE 2YNFB 2DEJA 1GXLA 3GTYX 1JLEB 4B08A 1NPRA 4OI0A 1C1BB 3UO0A 4WFBQ 1QUPA 3DLKA 3H4BA 2WHOA 3MM9B 2XMVA 2W7OA 2B9XA 4R0EA 1ELOA 3E01B 4B3RF 4MIAA 1IVZA 2QLBB 2HQCA 4RW8A 5GADI 1M5HA 2LVWA 4OYWA 2GQ2A 2NREA 2P9GA 3VQSA 3MCNA 2CWXA 3D54A 1YVFA 2XMKA 2KXHA 4G65A 1R27B 1RGVA 4NRUA 1BUXA 2DNOA 1W26A 4R0JA 2HNDB 4J9PA 2L41A 2PSZA 3M6WA 2IAJB 3KUEA 3TZYA 3PYGA 4C11A 1HYSB 4KKOA 4DSKA 4C8YA 4JI5F 4ITSA 2WK4A 1YITS 5GAGU 1TFYA 2VFRA 3W9JA 4JP8A 2CZVC 4TY9A 2O01C 4K50A 4ZMMA 2VKZG 1UPMB 5EWGA 1HPZA 4DR7F 3HHNB 1S1WB 1L3SA 2J9DA 2UVUA 1QSYA 1Q79A 4DPUA 4Y3CA 3PIPQ 1HL6A 3MMJA 1S49A 1ZTTA 2XO6A 2DGSA 4OL8A 5CD4A 4DPYA 1VI7A 4U7CA 2BA9A 2O3DA 3ITHA 1KQSR 4DN9A 3QAEA 2MY8A 2YWHA 2OFHX 3HVTB 5BR8J 4DV1J 2BOAA 2PD1A 1R8AA 1C1CA 1BY9A 3OHAA 5C42A 4BBYA 1S12A 3FBFA 2M8DB 3MMBA 2FVCA 2F8MA 5KFPA 2KDOA 1TK8A 1N6QB 5EWFA 3ZZTA 2HZAA 3KTQA 2DHHA 1UVNA 5GAEU 2IMOA 1WNEA 3KKFA 3GSDA 3L4BC 2I5JB 2QA4G 1WC4A 2L9DA 4NLQA 3W2WA 5A8RB 2FY1A 3TJ9A 3LAKA 1B64A 2HW3A 3PNIA 4DX5A 2FHJA 5DLFA 4PYDA 1LW0A 3DC2A 4NLYA 1Q82T 2FD2A 2W4DA 1TKZA 2J5AA 2VV5A 1N33J 5IC6B 1NHVA 5CYJA 4B9UA 3PTWA 3AHPA 1IKXB 4BLGA 1TL7A 3U27A 1GXUA 4OI2A 2WVDA 2FJXA 1YTYA 3FCVA 3AJDA 1CJUA 3V6DB 3Q86A 3H4DA 4RBTA 1V5VA 4MK8A 2CPXA 3W9HA 3PO5A 2KM8C 4QPXA 1K44A 3GYXB 2WSFC 1EHWA 3HSGA 1SBRA 2XBPA 3ZXWA 1FDAA 2QLXA 1BQMB 4J9LA 2DIUA 1IR2A 1S59A 2VH7A 1NK6A 4XDCA 4ZLNA 2PDAA 1U24A 1RDRA 4OHYA 2C3OA 1HR0J 3CJKB 3DLHA 5KFUA 1DQ9A 4QU7A 2J0SD 2DY9A 2G2ZA 4QR2A 1TL4A 2XCPA 2J9CA 2Q43A 3WC2A 5IXUA 1TAQA 3OTOJ 1B0TA 5HP1B 2AJ4A 1Q5YA 1JQGA 4F2RA 4P75A 1SIWB 3K5MA 2LQ8A 5IM0B 1K1QA 3IGNA 4DR4F 3DLGA 1KDNA 3NWRA 3TX8A 3CJ4A 1VQ9S 2R2TA 1HIYA 2JHEA 4LF6F 4OQJA 4U9RA 2DR5A 2DPIA 4B3MF 2IC3B 2VASA 1HNWF 2V2VA 1VK3A 4DV2J 1YJTA 2YX1A 3JSMB 1REVA 1AT1B 2SXLA 2CG4A 2AZ1A 2EK1A 3NCQA 3O44A 4YB1P 1NZ8A 4HTJA 2B0GA 3R5GA 1T3NA 4F4YA 4DSJA 1S6QA 4A8WA 2C3PA 4DR3F 4F4XA 3SXLA 1WHXA 3HCXA 1TUWA 3GFYA 4N77A 5GADU 2HMIB 3GG1A 5I42B 3OT9A 1HNVB 1VJWA 2VFTA 3EGWB 3MUTP 1QD1A 4EMDA 4DL4A 2OMOA 3DXBA 2W01A 3NRBA 1MMDA 2OELA 3M2VA 2W9BA 4NMXA 3TUPA 1F5BA 4NA2A 2J8SA 4QYZK 1M5KC 3PY8A 3EJMA 4HHJA 2DK2A 1D3WA 5D6GA 3N0VA 1FK9B 2XLJA 5E2QA 3MM6A 3SDEB 3JSBA 4TLQA 2QJ3A 1FFSB 2HQGA 2YKAA 3QNWB 9ATCB 3OJSA 2ILZA 4KFBB 4CO4A 5ITHA 2L9NA 1SJRA 1R0AB 1N4LA 1GAOA 2QMXA 3KOAA 3FUYA 2ATLA 1NKCA 2X3DA 5C24A 1S9GB 2V9KA 4N76A 1PG5B 1W25A 2F8HA 2HYIB 4QPTA 3UI3A 1NNDA 2KO1A 1A0OB 1YJ9S 2JJ4D 2H5EA 2AGOA 4B9LA 1SJ3P 2M5YA 1CS4A 2BABA 2C2OB 1RACB 1RSCA 3VAIA 5J1NA 4NPOA 3B82A 4PYAA 2WSCC 1A7GE 4JI3F 2RU9A 2VJVA 1RXOB 3W60A 3DFEA 3HXMA 4X4UA 4WU3A 2XGQA 4B9MA 2XSFA 3K5LA 3MFHA 1UVIA 3JYTA 3VAHA 3PIOQ 4DUYF 3CDWA 4DS5A 3KLFA 5F8LA 2ZHBA 5DLGA 1LEOA 3RW7A 3TRGA 4BC9A 4EYHB 2PI4A 2B7CB 4DUZJ 1CULA 4K4UA 3KK1A 1WC6A 2HRUA 2DHSA 3MM7A 3OR1B 2E44A 4IFVB 1GH8A 4IOBA 4LFBJ 3DGVA 4B9NA 3PYDA 1VFJA 3R5BA 1B0PA 5HBMB 3BH7B 3MEGB 3OUYA 1N34J 4ED2A 1C0UA 5AE1A 4M5JA 1QTNB 3W65A 5G0RB 4TY8B 5BXIA 2AJ2A 2UUTA 1B70B 3C6UB 1HMVA 5DDQC 1YRUA 4C8KA 4CLYA 4KV8A 1K73T 2AEFA 3BPDA 3PJXA 5L38A 2XM3A 1YG0A 2PGCA 2WBRA 3T1YF 2K2PA 3A8IA 2GQQA 2RF2A 4NEYA 3I5BA 2D69A 1HBMB 1KLMB 4LF9F 2ZZMA 4PWDB 4FPRA 5AXMA 3Q8UA 1BLUA 3QLHA 4OLOA 1EP4A 1PO6A 1RQ0A 2KN4A 4WFYA 4R25A 1RWUA 3BSCA 1IKWB 2BZ2A 2Y8YA 5IT4A 2D9OA 4N8OA 3V2UC 2WW4A 5LSOA 4DV3F 2ZE2A 3M8QA 3A13A 3P4UB 1WWHA 1N88A
chains in the Genus database with same CATH topology
4RW9A 1WEYA 1H2VZ 1SL2A 4JV1A 5KFDA 2MJNA 3DLEB 4OX9F 1S9GA 5E3PA 3QWPA 2RJZA 2CVIA 4CT9A 1X4FA 1N5QA 1QAYA 3DHWC 3QMQA 2XMWA 2R8KA 4WKRA 4CH7A 4X4RA 4M5DA 2P9CA 2X1BA 2ZITA 4P2SA 2AYEA 1U47A 3EX7B 1SUQA 1TL1A 1ZAXA 1T03B 1T8EA 1LV5A 2M3DA 2IRXA 4FZVA 3OLBA 4DWIA 3IG1A 1HWUA 1WD6A 3JTOA 3MM8B 4Q5VA 3RTVA 3S01A 4J37A 1U1MA 4WXOA 2NPIA 2KHCA 3M9OB 2D3ZA 4PG4A 5CZVA 1KFSA 2XI2A 1LWEB 4ES2A 5AXKA 2DB1A 3HZEA 4WZQA 1CLFA 3MECA 2IFXA 4RBVA 2FTRA 3IRXB 3MZIA 2VFSA 1ZM2A 2UZAA 2NUUG 4OHXA 5LMNF 4GKKF 2ZDOA 2ZH8A 3MDFA 2P6TA 2DVIA 2HHVA 4ECWA 4G1IA 5KFQA 4I7FA 4DV4F 3OSPA 2DH7A 2IYGA 3QO9A 2PMZD 3VWSA 4EEYA 3RB0A 4H4KC 1MMLA 3M32A 4EO6A 1GNKA 3PFEA 3UQSA 5GAHU 4ED0A 4Y00A 5KFWA 1I6JA 3IR7B 2HNZA 4TU7A 4ED8A 2JEJA 2F8EX 3T9NA 1V3ZA 1HW9A 4WFZA 3MEEB 3IN5A 5I3PA 3UE2A 1UJ5A 2K3KA 4Q44A 2LDIA 1NZAA 2A3JA 3GFZA 2YKMB 1X5TA 2ZBIA 4YDXA 5M2PA 1NB7A 2EBGA 2I1RA 4DSLA 2MKCA 1HARA 3CGIA 2IYIA 2XMMA 4KSEB 4ES3A 3MFIA 2AYGA 4X4PA 3RW6A 1Q78A 5HROB 3VAFA 1UEVA 2KT5A 1T94A 4RWWA 2RDIA 1L3KA 2OPQA 2J7UA 4TXSA 1RTIB 2ZH2A 2XULA 2RT3A 3OXFA 3HHLB 1XMBA 4RW4B 3J80Y 2ZH5A 1KRPA 4WK1A 4OJ3A 1YJNS 1S9FA 2VB6A 4A46A 3CMES 4M1KA 4NA1A 1ZPVA 5F8IA 2GFFA 4KAIA 1R3NA 2ZD1B 5D4NA 1N52B 1S1VB 4DBQA 4LF5F 3OTCA 2C2RA 3GG0A 2GMHA 2BANB 1HFEL 2MQQA 2KZZA 3RYLA 5D3GA 3MI7X 1KSPA 1TUVA 3FQLA 3M8SA 3LP0A 1CC8A 3DM2A 2F3JA 2XGPA 2H9ZA 2GHPA 3OR1A 1VQOS 3M4XA 4HKQA 3IWXA 4IFVA 1FJEB 2AX0A 2JEIA 1R6YA 3CVKA 2NS1B 1BC6A 5DO2A 2LECA 3CCWA 2V9WA 2E5GA 2E66A 3H5SA 4Q45A 2PI5A 1K0TA 1VQNS 1MU2B 4I2QB 3I31A 1U09A 3VF0B 2QT7A 2W9CB 3CCVS 3I4PA 3LWLA 3US5A 3B8HA 4DMZA 1U8SA 3OSNA 2AQ4A 2CQDA 4YDDB 2A18A 2QIFA 3M6XA 2VL1A 4FXDA 3HHKA 4ILMA 5HBMA 3UNGC 3MEGA 4NLVA 5CD4H 3SYZA 1RTJA 4NRTA 1WACA 3NNAA 4HVZA 4J9NA 2J0XA 2AJ0A 1S99A 1NU4A 3R5AA 1ZYQA 1VC0A 2ZH7A 5G0RA 2XNRA 2LYVA 4TY8A 1FJGF 5DM6Q 4IYQA 3CT9A 3VALA 1LKZA 1PC5A 3T6JA 2Y1IA 1KS2A 1ZBTA 3HHEA 2EI5A 3C6UA 4NLTA 4TLRA 4RX6A 3DNCA 1SXLA 3O8WA 4U6PA 4H4OA 1QE1B 2XB2D 1G1XA 1GQEA 2FC9A 4LFCF 2XMUA 3MMCB 1S0OA 3N6MA 1KNZA 2HNYA 2GMLA 2GJ2A 1NJZA 3RU0A 5JXSA 1KEKA 4EBCA 3RAXA 5IQQA 5KT3A 2D41A 4PQUB 3OTEA 1K1SA 1RT7B 1LQ9A 2KXFA 4A8OA 4RNOA 2PE8A 4IQMA 1RT2B 4R8UA 5T7LA 1GTEA 4ED5A 1S1XA 1VRTB 4UY85 2C22A 1DFDA 2CJQA 5B0CA 1VQMS 2XZWA 1G7CB 3CCUS 4DV0F 3BR9A 2CKWA 5KFHA 1RT4A 3SCKE 1VIXA 2LEPA 2ZOFA 1N0VC 1BGXT 3QIDA 4RKUC 4TU8A 2CQIA 3G8TA 1Z2LA 4ECXA 3EGZA 1HBMA 1O0PA 3LW5C 1JB0C 1KLMA 4QQBA 2MB0B 2RS2A 4W92B 1L5UA 3B78A 4GKJF 2GIRA 3IAM9 4RW6B 1VQPS 2R7QA 3M9NB 4X2BA 4PWDA 3CXCR 1OWXA 4RLEA 3L95X 5K14B 4DG1B 3H5UA 2AGQA 5E5NA 4RBUA 1KFDA 2CIMA 3OBIA 2KT2A 4I6YA 5F3ZA 4OJ1A 4IO9Q 4DQQA 3IFEA 1DARA 2R7UA 2N82B 4X4OA 2OJ3A 2BJDA 2Y0SD 4TKTA 3KLVA 3FGVA 1T05B 2MZSA 1FKAF 3J81Y 4GC6A 5GAHI 4IRCA 2PFFB 1IKWA 3G6YA 3AB2B 3AH6A 3PRBA 3TARA 1JNRB 1T02A 3DDNA 3ZZZA 1TKTB 2LMIA 2KYZA 3MEDB 1ZM4A 4QW9A 2E7XA 2VBWA 3TA0A 2HG4A 2DNLA 3O6QA 2VPWB 4DFJA 1KR4A 3EPIA 2AJQA 2WAQD 2DNRA 3DLEA 2DNHA 4OHVA 3IXQA 2AV5A 4F3MA 2OD4A 4NMLA 2MYFA 3KYLA 3F73A 1WHYA 2B9WA 2BBEA 1Q53A 2JZ5A 2RQ4A 5AXNA 3PJWA 3I87A 2MGZB 1Q7YT 5B7WA 1UWBB 3NMAA 2XMJA 4NWBA 5B0GA 1ZTWA 2VONA 2VA2A 1T03A 2NZ4A 2HS0A 4OZLA 4M95A 4IQXA 4UQTA 3MM8A 4CH0S 3G6VA 2PC6A 2MSTA 1DBDA 4N41A 3BB5A 1X4CA 1XN9A 4XPEA 1JLGB 1QAXA 1S1UB 4MMOA 5AE3A 1LWEA 3BO3A 2LXFA 1SL0A 4DL0C 1VK8A 2XY7A 1FRHA 3IRXA 2E9RX 3LP1B 4BHQA 3PW4A 3CJ2A 3FEYB 3NNCA 2VD3A 2E29A 2VFVA 1S0NA 1UVMA 2F9JA 1FXDA 2C3YA 2MZJA 5JJBA 1FJ7A 2M70A 3FQKA 3MUMP 4Y2IA 1U6FA 4AL6A 2HLUA 3SMZA 3H25A 2VG5B 3OV7A 3QJPA 1WF0A 1R89A 3N5BA 2C42A 2F7VA 1VC5A 2QSFA 5DDRC 4UQGA 3IWNC 2QMWA 3B4DA 3OVSA 3T3FA 3ZZPA 1X9MA 1S0MA 2DNYA 3M2RB 2GV1A 2GA7A 3T1HF 4FVMA 2CJ9A 3BGFA 2ADCA 3FFIB 1TV6B 4KC5A 3MEEA 3TA2A 5AJ3F 4ZK7M 3UR0A 5K9FA 4ERDA 4F3QA 4CIOA 2MQOA 3DOMA 2FHMA 3MEKA 4Y0FA 4O3NA 2IMWP 4C3KA 3AY0A 4M63A 1WI8A 1UETA 1MROB 2YKMA 4I69A 5KG1A 1F0XA 2BQ3A 1G2EA 4URSA 1ZAWA 2VODA 4O3SA 5HROA 2LA4A 2BE2B 4DN0A 3TVKA 2LQJA 5MLCV 2IM2A 2OSQA 1IKYB 2DR8A 1RTIA 5DGBA 3FDSA 2R8IA 3HHLA 4RW4A 3CDUA 1JK9B 1QAIA 2UU9F 2E9TA 4YHHF 2UV8A 3K7RA 2KYXA 2RRBA 2ZD1A 1FVQA 1VQ6S 3J7A1 2JSXA 4BWJA 3WX4A 4B9TA 4H54A 1HHSA 1S1VA 5BR8F 4PG7A 5LSRA 3H2UB 2BANA 4C8LA 3T9ZA 2YVSA 1S1TB 3I32A 3SI8A 4UY8T 3C2PA 2KH9A 4UUWA 4CQ1A 5L39A 1KONA 3ZZOA 2O1PA 1JJ4A 2CZ4A 5G4DA 2BM1A 2IA0A 3DLBA 1NK0A 4A8FA 1LFPA 3BF4A 2ROEA 2OPSB 4BCAA 3PEJA 4AL7A 3ISNC 2Y1JA 1JJHA 1YWXA 1Q86T 2WB4A 3AAWB 3CC4S 3CC2S 2MZ1A 5DQIA 1MU2A 4I2QA 1I1GA 3N5FA 3CD6S 5CCLA 2J7WA 1U1PA 1X4HA 2W9CA 2OTLS 3I96A 4MAKA 1D9AA 2UUCF 3MOJB 1Q1KA 4C98A 4CO2A 1R8HA 1S6UA 1Y3KA 3WBZA 3O3LA 2P9EA 4CH1A 1ZM3A 1U2RA 3MWBA 2L9WA 3KJVB 2E5IA 4K59A 2ZNZA 1ZOTA 2PO4A 3KWMA 1YQHA