3K89A

Structure of x. oryzae pv. oryzae kacc10331, xoo0880(fabd) complexed with glycerol
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
MTESTLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALSQGGPEEMLNRTEYTQPALLAAGVAVWRLWTAQRGQRPALLAGHSLGEYTALVAAGVLSLHDGAHLVRLRGQFMQAAAPAGVGAMAAVLGAEDAVVLEVCAEAAGSQVVVPANFNSPGQIVIGGDAAAVDRALALLAERGVRKAVKLAVSVPSHTPLMRDAANQLGEAMAGLSWHAPQIPVVQNVDARVHDGSAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGKVLSGLIKRIDKSLDARPLATPADYAGALDAWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of X. oryzae pv. oryzae KACC10331, Xoo0880(fabD) complexed with glycerol
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Transferase
molecule keywords Malonyl CoA-ACP transacylase
total genus 108
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3k89A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3k89A01
3TZWA 3TZZA 3QATA 2HG4A 2G1HA 3H0PA 3CJ8A 2VZ8A 3HHDA 2G2OA 2VKZG 3TQEA 2G2ZA 2VZ9A 2JFKA 2QJ3A 3IM9A 4QBUA 3TZXA 3BV8A 3TZYA 2UV8G 2CUYA 1NM2A 1MLAA 3IM8A 5DZ6A 2JFDA 3R97A 2G2YA 4RL1A 3G87A 5DZ7A 3HJVA 3K89A 3PTWA 2QC3A 2C2NA 2QO3A 2PFFB 3EZOA 4RR5A 3RGIA 3R8YA 3SBMA 5CZCA 3HMJG 2H1YA 5CZDA
chains in the Genus database with same CATH superfamily
4W92B 2EW9A 3X1LB 1KVKA 4USJC 3HSJA 4EGLA 3AXKA 1NJXA 3FBBA 5CQGA 4HTJA 4EZ6A 3TUPA 4USMA 4F2RA 4WP9A 4X4RA 1IJEB 1M5SA 5KFDA 2QL9B 5IZHA 2QLFB 4U8VA 2YPZA 1SC1B 2KXNB 2O1PA 2F8HA 4FZVA 1RAIB 1XNQJ 4X64F 3Q8PB 4CI0B 4E8UA 2KM8C 3F44A 1XMQF 2YX4A 2G13A 4U7UD 1IBCB 3VZIA 4F04B 2UXDF 4ZCKA 1WD6A 3KUEA 4EYHB 4F4KA 3OVSA 1TL4A 3POTB 1TAUA 2H4WB 3N9UC 3QO9B 5KG6A 4Q0BA 2QSWA 1KONA 3G8QA 3HFZB 4HDGA 3VV2B 3BO3A 3OXFA 1XR7A 2Z0GA 1SJFA 5CXTA 5KG2A 3O2IA 2PFDA 3FMBA 3FUYA 3PYGA 3NCRA 2BQ3A 2MTLA 1KRPA 3IG1B 1GNKA 4D3GA 4XPCA 4LBPA 4DV5J 2VL1A 3HO1A 2V6AA 3QRQA 4NCGB 3V2UC 3X3UA 3JQMA 2OTLS 2GX8A 3OFFA 3R5BA 3C6TA 4KGXB 5DDQC 3FRYA 4AL5A 3TZYA 2PI4A 1QLNA 1AXQA 2HFVA 3K8WA 3M2UA 4CIOA 3T19A 2GHVC 3LWMA 4B9SA 1TUWA 2CG4A 5IWAJ 2QL7B 3MUTP 2AEMA 4DU8A 4ZVTB 1D8ZA 2EK1A 5E3RA 2OO4A 1V3ZA 4M5MA 4NWBA 1JKHA 1V3SA 1WG1A 2JDJA 4TU7A 4M5HA 2JL9A 3BZQA 3V6JA 3W63A 1JLAB 1ZAWA 3M2UB 2J0QD 1F9FA 2A6MA 2IFXA 5GADI 4UZCA 3FEZA 2KFNA 1RADB 3C19A 4K4XA 1L3TA 3DC2A 3FBEA 3OLBA 3KLHA 3DCAA 2PMZD 2E7WA 2L48A 4XDDA 1KDNA 5I3UA 2EBGA 1IWGA 1BE4A 3HHNB 4DBQA 2ZOFA 1HYSB 2R2RA 1N5YA 2BZ2A 2JFKA 3OSPA 1UL3A 3M1VB 4Z37A 1HR0J 3K5OA 2GJFA 1NPRA 2HWHA 2QZ8A 4XDCA 2C2EA 2IJRA 2Y9HA 5ETTA 1BD6A 1RHMB 2JFDA 1U24A 4RW7A 1CJVA 5KT7A 4RL1A 1L3SA 1HNWF 4YMEA 5F3ZA 5A6WA 2RRNA 4Y65A 1MMLA 1CLFA 2MKYA 3CDBA 3EVOA 2CJKA 3HVWA 4ED7A 1B0TA 4DV3J 1QE1A 1N33J 2GA7A 3D4JA 3I5CA 4AYBD 2IRYA 1YK9A 4RW4B 1WDTA 3PRDA 2O67A 1UKUA 3IR5B 4LR8A 4LFAJ 1NKBA 2SXLA 1QUPA 1CJVB 1WF1A 1SL2A 3PCOB 4OYMA 4PQAA 5C24B 4EBEA 2BJ7A 1N88A 4NXMF 4CT8A 1RI7A 1CSJA 1RT7B 5LJ3Y 3M8RA 3P3DA 4WE1B 3IFEA 4K4ZA 1KTQA 3ISZA 3GSIA 4KV8B 1R89A 2QG9B 2GMHA 3KNGA 4DOZA 4ZVFA 1FNXH 4NLUA 1M90T 3UN5A 2QEXS 2UV8G 4YHHF 1JXLA 1NH7A 1RBLA 7FDRA 1KQKA 2ZH9A 4RUHA 2UV8A 2DGTA 4LVOP 3T5LA 4RBVA 2HGMA 1EAYC 2V34A 5DQIA 4C8KA 3Q2TC 1UETA 4ETZA 1IQTA 2IM1A 3QT5A 4MMOA 2DITA 1BLUA 2ROPA 1VRTB 2V4JB 4A8FA 1NZAA 5KFNA 3UDLA 5HLFA 2FVPA 1S79A 2DXFA 2IIHA 3MUVP 4OZJA 1YGYA 3NGRA 3M30B 3CJKA 4BCAA 3EZUA 4NX9A 5U47A 4OMFG 1AW0A 4KT0C 4QYRA 2DGVA 3NMAA 3AT1B 4CCHA 1VDHA 2P9GA 3MMAB 1GX6A 3SI8A 2Y0SD 2R8KA 3MMCB 2F8MA 1S4FA 3T5HA 2H5JB 2R4FA 2ZWOA 3T1YF 1JWWA 4DCOB 3IS9A 2C42A 4CTAB 1ROFA 1SKUB 4G1IA 1HBUB 2CVEA 4P71A 2QFIA 1DURA 3I56S 2GS8A 2CJBA 1X4GA 2W2QP 4HH1A 3TARA 4ZN1A 2YVSA 4FNHA 2C28A 2FVRA 3POTA 3CF5Q 3O1LA 5HJYA 1U45A 4LFBJ 1CS4A 5KFTA 1Q0NA 2AP6A 3MFIA 4WBFA 1VLYA 4LF8F 4DR6F 4ELVA 1VFJA 2DXDA 2XULA 2H54B 1N0VC 1YJ7A 3LAMA 3NGTA 2FHMA 4KGKA 4KE5A 2MZ1A 2DR9A 1IQZA 3THPA 4K2XA 2XCPA 3D0GE 4I56A 2LQ8A 3O6QA 3HKZD 3Q8VA 5HQ8A 4LF9F 4WZQA 3KUGA 3O44A 1YLXA 3WX8A 3M6XA 3CULA 2N3OA 4O4GB 5AXMA 3CO0P 4J9OA 3WBZA 2DR8A 4JV1A 2U2FA 5KFUA 1PCAA 2Z2YB 3TAMB 1H0HB 4ZPDA 4TY9A 3IM9A 3SXLA 3TZXA 4DV2J 2HZVA 2KVQE 4FPIA 3Q8RB 1XMOF 2W4PA 1YRTA 2HVDA 2R42A 1S6PB 3CB4A 2JEIA 5MLCV 3B82A 3US5A 2XY5A 2HQIA 3TP2A 3D28A 1ZBTA 2FB0A 2Q43A 5LM7E 1YIJS 2BE7D 2MHNA 3R8YA 3JQKA 3ET6A 3THVA 1P1LA 2ERRA 2GJ2A 3R2CJ 3RUBL 1OWXA 1T05B 1HHQA 3PHTA 2NCKL 2R2UA 2FVSA 2ASYA 1X4HA 5JJBA 1LKZA 2CNNB 5HROB 3GIMA 1F5CA 1FTCA 1RT5B 2HHPA 5EX0A 5CZVA 2CDQA 3KLHB 2FDNA 3LP1B 3A3OB 3DI6A 3AA9A 3GMGA 3HHDA 4ZIWA 3MD1A 4ZS6A 5KOWA 2YWEA 1KEKA 1GTHA 1U47A 1MROB 2XI3A 4LVNP 4C3LA 4CNZA 1JJ4A 2FLPA 3HHLD 2NR0A 3QAUA 5CA5A 1FFSB 4K4VA 3OL7A 4PZVA 3W5XA 3BB5A 2LMIA 2OEMA 4NLVA 3R5DA 1MMNA 4OI1A 1KOOA 5L9NA 5HO4A 1NDCA 3GZ7A 4W98A 4KBIA 4KO0A 4DV4F 1NDPA 5L1IA 3I4HX 4YHHJ 5ETOA 3LP2A 2PFFB 2GO9A 4YB5A 2J8AA 3MAAA 2W9BA 1SL0A 3F73A 3W5YA 1OY6A 1RTIB 2XEXA 3H59A 3SEOA 2ZJPQ 4FS1A 3T5KA 3TI0A 2IAJA 4KHPJ 1Q4RA 1S1TA 5B7WA 2ZC3A 1N52B 1JXVA 1CVJA 1B64A 4Y6IA 5EX3A 2A2CA 3IBWA 1N32J 4ILMA 3HJFA 4U95A 2JWNA 1NJWA 4Z2XA 2MJNA 5THWA 5J2NA 1TAQA 4O4RA 2VHGA 2CQ4A 3GB0A 2GVDB 1XWLA 4K8RA 3MCSA 2WBMA 1HPZA 4OX9F 3W8GA 2W7OA 2LQ5A 1Q16B 4YOEA 1BXNA 3ZTQA 5KTQA 1FNMA 4C3KA 2XMUA 4PRFA 2A10A 2H48B 5KT2A 4Q43A 2KT2A 4IRKA 1S1XA 3DMJA 1QM9A 2B9WA 3P8BB 2XNRA 3I0RA 8AT1B 4WJBA 2AX0A 2FZGB 3KDNA 4X62J 2YQ0A 2ZH3A 4DN9A 1F2HA 2CWKA 2C2MB 2HRTA 1H72C 4HHUA 2RB7A 2BE2B 1X4FA 4FVCA 2FJDB 4NLYA 2CPJA 4NZ7A 4O3PA 5BXIA 1TQLA 1X0FA 2XM3A 3E3XA 3HD1A 3PW5A 4J91A 5C2CA 4P74A 5DLGA 4JI3F 2OPSB 2WZ1A 2E44A 1N5TA 3BPDA 4UOCA 2VKRA 4GC7A 2XY7A 2MZQA 4X65J 3J7ZT 5J2PB 4OHZA 4LF4F 3IMQJ 2YNHB 2YQ3A 3P4UB 1N34F 1JLCB 2PGCA 2UUWA 4USIA 5KFYA 1ZM3A 3HSZA 5A8WA 5B0CA 2R9LA 2HBQB 4EBCA 1IKVA 1Z2ZA 1FJGF 1FJCA 1R7IA 1UVKA 3KLEB 1FX2A 2V2ZA 3R27A 2HMIA 2W4CA 2GO8A 4K5RA 4OYBA 5BYSA 3SV3A 2KTQA 1M5KC 2AYEA 3TZZA 5C7PA 2NPIA 3D67A 5CZXA 4FPRA 3IWXA 2DNRA 5KFVA 3Q8QB 4ZVEA 4H4MB 4YFUA 3CCLS 3GJQB 4ECYA 4ED0A 3Q0AA 3SSSA 1J5OB 2VA2A 3DM2B 1UVJA 3KG0A 2KXFA 1YI2S 3T1AA 4LFCF 4I2PA 2YWWA 2AZ1A 2IPOB 2PEBA 3KLIB 4FXWA 4R8UB 2RJZA 3IWNC 3D0HE 1REGX 2CADA 4KY3A 7AT1B 4LR9A 3FEXB 3M8QB 3HCXA 2UVVA 3JB9k 4GKJJ 2PC6A 1ICEB 1U0HB 3HK2A 5IQ6A 2JVRA 2BKNA 3PX6A 3BDEA 1PYOB 2F8EX 2BKPA 4CM2A 1C1BB 4F0HA 3AHPA 2CJAA 2BJ9A 4NI2A 3CCRS 1ZOTA 2IBOA 2CQBA 2J76E 3A8EA 4WYWA 1JLGB 1R27B 1I51B 4G6VB 4F0KA 1RWOB 3SQOP 1SBRA 1K0VA 1WG4A 4WCEQ 2HG4A 2WK4A 1RT5A 3BBBA 3IGNA 2K06A 1SJ3P 1RAHB 4DFMA 1TZ0A 2BYCA 1IR2A 3ISND 4IO9Q 2OGUA 2L9WA 3AOCA 2QLXA 5A2QU 2XHCA 1YRXA 2X1GA 3DOLB 4WK1A 2EVZA 4IH5A 5DO2A 3GWCA 3IA0A 2DO4A 2WB4A 4MK8A 1S49A 4RW4A 3NEKA 1F5AA 4I2QB 2R2SA 3OJUA 1WI6A 1RAAB 3PO4A 4C0OC 4M5JA 1VQ7S 4YB6A 2C22A 4B3TF 3UNYA 1PC4A 2W2OP 1ZS6A 1RYSA 1SUQB 1LW0A 3FCHA 3TNVA 3VZHA 4CLYA 2W9CA 5KFLA 1T9VA 1S7IA 2WSFC 2R7OA 4R8UA 4DV0J 4USKA 5SUHA 4DV7J 2XMTA 1MU2A 4X84A 3J7YI 3DRSA 4UOGA 5T14A 1QTMA 4N8OA 5J2QB 1LWEA 2D69A 4WF9Q 1CJTB 4LRBA 2ILYA 1X60A 1T3OA 4Z7YA 2AGQA 1MG7A 1RYRA 1AZSB 2X3GA 1WHYA 2RU3A 2B5JA 4QIGA 1S10A 4X4SA 3HZGA 5LMNF 4NA2A 3HXMA 3M32A 4JI0F 1HHTP 4C3MA 2MKHA 1MWYA 2ZD1B 4ANDA 5LXRA 4QYZJ 2ZWPA 2LLZA 2AJQA 1G6BA 2C3YA 4FKXA 2RDIA 2ZZNA 1N5QA 4S0MA 3LOUA 4KGVB 3I0SB 1OYEA 5HI7A 2A2DA 2AJ1A 1R0AA 2DKOB 1OMSA 2DHHA 2V2VA 3ILIA 2CPHA 3BREA 4CQ1A 2WB1D 2O66A 2RNEA 3ILLA 4WFZA 4WWSA 1FKAF 1MMDA 4YP3A 1MROA 4CWBA 3CVKA 2MMYA 4X66J 1U0SA 1F3FA 1JLFB 1HQEA 3TAPA 1RTDA 1L3VA 1GXTA 3CMQA 3MM5B 3MTKA 3Q23A 3HX9A 3FVYA 1RDRA 1RJJA 3A8IA 3IM8A 1P8GA 3LP0A 3MM8B 4HI1A 1LXNA 2CFXA 2WOMB 4L74A 5D4LA 1HNXJ 1S59A 4I67A 3NNAA 2K1RB 5CYQB 2BBEA 3B78A 5DZ7A 1N36F 1D8YA 1TFYA 1X4AA 4TY8A 1DFDA 5F8NA 1FO1A 1R6VA 2JC0A 2DK2A 1HW8A 1NH8A 2XYPB 1FDBA 4LSNA 2WW4A 3AJDA 1FDNA 2C2RA 1ELOA 3T9ZA 3FGVA 1Y00A 2KM8B 2WONB 1L3KA 2ZE2B 2B7CB 2HNDB 2GMJA 5K8MA 2KL8A 2KT3A 2B6AA 2JH3A 3MTJA 4PG6A 2ALYB 2F5GA 2XZTB 3NCQA 1RWNB 4RU9A 3NBPA 1Q81T 2OPQB 2QMWA 2HHSA 2YKAA 4B3MJ 2HHVA 5HANA 5AXNA 4DR5F 1NJIT 5F8JA 2RKIB 4ZDNA 4HLBA 4Q7AA 1U1OA 3M30A 3CJKB 1HHSA 4YDDB 2DB1A 5A8RB 4X4NA 4FN5A 3DLJA 3R7SB 3KK2B 5CD4H 2EI5A 2GQ2A 4F67A 2KI2A 1KS2A 3OR1A 1Q82T 3FJ2A 3RGIA 5HN0A 3MOJB 4F3MA 1HD0A 3QZ7A 3UD3P 1VQNS 5LMUJ 4ZVRB 3GTYX 2EPIA 1EJ7L 1WEYA 2ZHAA 1FJ7A 2OUGA 2WSCC 5KFRA 4EO6A 1DTQA 2E5LJ 3HULA 3UN2A 1SQEA 3TYTA 1S5ZA 1A7GE 1VLOA 4ILLA 4QU7A 4L76A 5GMEA 1RISA 4C6AA 5KFEA 4JI4F 1WNEA 1R8AA 3DLBA 4RW8B 5KG5A 4E2FB 1T03B 1RWXB 3EDRB 2XI2A 5HROA 1IM6A 2CNOB 3SFUA 1EKSA 2APOA 2WVFA 1NU4A 4MIAA 9ATCB 2XLJA 4DV1J 3CCES 1NKCA 2VQFJ 4DSJA 4N8NA 4JI7J 2PIIA 3R2DJ 3GR1A 2GFFA 1W2IA 2E5GA 3QIPB 1IUJA 2MB0B 2R7SA 4K4SA 3K5NA 4YR2A 2R7VA 2E9TA 1QE1B 4LF5F 3DGPA 2VPZB 3A3PB 1VQPS 2ASDA 4FDFA 3ZXWA 1IR1A 2O5DA 2GZOA 3BR9A 3MD3A 2GMLA 3C46A 3MPYA 3CCVS 2IA6A 2R7QA 3GPAA 5C24A 3OL9A 1S76D 3EICA 4CH1A 2GV1A 2HWTA 4L72B 2QLWA 3KK1B 2OI2A 4NL5A 4ZCLA 5F8GA 4K59A 3KHLA 4QZVB 2OEJA 5B0GA 2OD4A 1AFIA 1PAEX 3ZZPA 5CYMA 3CD7A 4ITSA 1S7HA 1T9YA 1HW9A 2KYXA 4IFYA 5EUHA 5J2MB 1KTVA 3I96A 2FJVA 4C8ZA 2LQ9A 4JV5J 4UUWA 2N7YA 1QY7A 4ZPCA 1GXLA 3ZZTA 2R8IA 4F8RA 3JSRA 3FFIA 3FEYB 4NLOA 3JAMU 2HQ3A 3CT9A 4U96A 2QA4S 1U1NA 1UA1A 2N4DA 2QO3A 5KFCA 1K47A 2LDYA 2QMXA 1VQ8S 1FE4A 2KZMA 2CKWA 3TEGA 4K0KJ 2XBPA 3ZTOA 3BDPA 4LJMA 3GCWP 2HVZA 1NK7A 1A9NB 1DTQB 5B0BA 5HL7Q 2IMOA 4L3KA 1VIXA 1Q8IA 2DNZA 2NYIA 2W1BA 2HURA 1CC8A 3FKBA 2MQOA 5BR8J 3BEGB 2W7PA 3G6YA 3DYAA 3E01B 1GX5A 1UEKA 3HVTB 3QWUA 4OQJA 3BN4A 4RW8A 2YKOA 4TLRA 1T9UA 4I64A 1AB8A 3KJFB 2QT7A 4X64J 1XNQF 3KNAA 2YX1A 4FP9A 3IO1A 1ZM4A 2XHWA 2B4VA 1XMQJ 1TKDA 2ATCB 3MCMA 1WC3A 4TLQA 3GIJA 1G7CB 1XERA 3MECA 2HLUA 3IAS9 1Q8KA 4P6QA 3TX0A 5KFQA 1ZTWA 1VBXA 2QSFA 4FBUA 1PC5A 1DTTA 2JLEA 4F36A 1GMUA 2VG7B 1PGZA 3D7SB 3MR6A 1WHXA 2HNDA 3F0NA 3BQ2A 4I6YA 1TL3A 2B6AB 2XSJB 1RHJB 4WE1A 3H4DA 3D6HB 3DRSB 3ZTPA 5KFZA 3D68A 3W7BA 2BEFA 2CJXB 2Y1JA 1TL5A 4PWUA 2ZH7A 4FF1A 1UFLA 2NUUG 3HM9A 3NBPB 2MHEA 4CP5A 4NLXA 4B9LA 1ACMB 2VH7A 4ECUA 3G8TA 2VPYB 3W66A 1EB0A 2YKPA 5IWAF 3VALA 3NMRA 2MYFA 3QLHB 3D1OA 1U2RA 4V19X 3QRPA 4N5SA 1YVFA 4NYZA 2C3MA 2F63A 5C42B 3PKMA 5E3PA 2XTJP 4L6V3 4LRAA 1FX4A 2DISA 3MEEB 3ZFVA 4RNMA 3MF5A 1Y10A 1NHKL 2C3UA 2WVCA 2DNKA 3DLKA 3SCKE 4B08A 1K1SA 1RU2A 5D4PA 2B3TB 3HVRA 1N36J 4UZBA 4J7CA 2DHGA 2ZC4A 3T6JA 2R2TA 2CQPA 1HQUA 2UUCF 2KRBA 4PQUA 1UJ6A 3K58A 1X5TA 1H3DA 3KJVA 4MIWA 3PJ9A 1UAWA 2MKKA 3MPDA 1URNA 2FVCA 1JLGA 2OAUA 3BGRA 1HR0F 2H65B 4JI1F 3Q8SB 3TANA 2K3IA 2AYBA 4ID5B 4RUAA 4NCAA 1JXEA 5F0WA 3EPIA 4DR4J 2HSEB 2P5VA 1RBAA 1HNWJ 3ZTRA 4E0DA 4YUDA 3CSKA 4CDIA 1Q5YA 4XIUA 1EIYB 2QRRA 3BBCA 4GC6A 2W4DA 3DRPB 3JTNA 1WKLA 4Y3CA 4ED4A 1XMBA 3CDUA 5J2QA 4OV1A 3MAAB 3IN5A 1TMJA 4CZCA 2PA8D 4FYDA 1QAIA 1QSLA 5HAOA 2ZH1A 4DUZJ 3MMJA 1DJ0A 2EFPA 4DSEA 3DDNA 4NXMJ 1RXOB 1WJ9A 2DR6A 2RRBA 4PAAA 3C15B 2DXEA 1TP7A 2IHR1 1KD1T 1LEOA 1AROP 3PX0A 4MFBB 3V6DB 2VB6A 4H54A 3OUYA 1YJ9S 3MM9A 4M5LA 3KHHA 2QJ3A 1H2VZ 2ILZA 3H42A 3KJQB 4ZK7M 1RGVA 1T7PA 2F65A 1VQLS 1GTEA 4IR9A 3BM7A 4DL6A 3PVXA 1VBKA 2MZJA 1TVRB 4C11B 2HPUA 4P52A 1YBAA 4WK3A 4Y2CA 1RAJA 4YS2A 1Y3JA 3D54A 2NYHA 4ATNA 2GAGC 3DLGB 5A6PA 4ECVA 4JV2A 1H7WA 1RE1B 3IAM9 5L38A 2XYHB 1RT3A 3M8SA 2DH8A 3KK3A 3HHLB 3PYFA 4LSZB 2P9EA 4WFAQ 1JK9B 3JSBA 3MM8A 1FD8A 5J1NA 2CPXA 1EX8A 1X4EA 2KJVA 1X9MA 2BVZA 1S77D 3OXLA 3NNCA 2M0GB 2E5JA 3DLEA 1NK6A 4OYAA 4CRJA 2I9SA 4QBUA 2Y1LB 1UA0A 1M5PC 4ZVQB 3TAQA 2VFSA 2O3DA 4RUCA 1AT1B 2DR5A 3HD2A 3VQTA 1WEXA 2CVIA 4AMOA 1SC6A 3CEDA 2DO0A 4LFBF 4C8LA 4RUBA 3G6VA 3DNCA 3MXHP 4I7FA 4J9PA 3M2VB 4FYWB 2HFNA 4ZHRB 5I4MA 5ETRA 3G71S 1TK0A 4KPYA 4LF8J 2XMMA 4USHA 3OBIA 1TL7A 3RW7A 1I94F 2IVMA 3NL0A 1NHVA 3P45B 4U8YA 4NYOA 3UDVA 1B7YB 5DQGA 3QFHA 4BWJA 5GAGU 5F8LA 2DGQA 3MR5A 3MPUB 4DS5A 2B4UA 1N56A 5ETKA 2G2ZA 4HACA 2AMCB 1S99A 2ZVSA 3DDIA 4KFBB 4NLSA 2VFRA 4OX8A 1Y9OA 4DV2F 5K8NA 3PO5A 1G1XA 1XMOJ 3H8YA 3M8WA 5D0RA 3NRBA 1WOOA 4FKYA 4W90B 3CC2S 3H20A 1BQMA 2WCXA 4CM0A 1HI8A 4NOHA 2ZJRQ 3MMCA 4BS2A 4A8WA 5JUMA 4NASA 3NNHA 5M2RA 4B9UA 1O5JA 5BYQA 2JC1A 4NZ6A 1T02A 5AT1B 2MKIA 2M8HA 3IRXB 2Y1RI 4GVBA 4ZPVR 2E1PA 3GIRA 3KKFA 3N4WA 3PV8A 4P7TA 5I42A 1X5SA 5C5JA 2LXIA 4ZVGA 2B8PA 2P6TA 3H2VE 2ZH5A 3NLCA 2QA4G 3KJVB 1TELA 4F26A 1IVZA 1FVSA 2NZCA 5ETPA 5H1SV 3VAMA 2AYMA 2WSEC 3CW2C 1RTDB 3JAMY 4ZHRA 3D66A 4ID5A 4DFKA 3MR2A 2XB2D 1G3OA 2YNFA 1I3OB 2ZH6A 5HVGA 2VG6A 4F2SA 1TU0B 1T9WA 4DV4J 3CCMS 1HD1A 1KOHA 3M2RB 3RR8A 3DRRB 1YJNS 2E9ZA 1T9TA 4ECSA 3CIMA 2DEIA 4EWTA 1U1MA 3BGUA 3ISNC 3EYZA 1SI9A 4NRTA 4LRDA 3WQPA 4ZLLA 3HFKA 4QOTA 5KT5A 1NAQA 1UEUA 4KHPF 1RKIA 3BO4A 2K8GA 5FJ4A 5HP1B 2BQRA 5LJ5Y 1SH0A 2GQCA 1CEZA 3W8PA 1Q8BA 4KGMA 3KG4A 5FD1A 1BQMB 2R8GA 1G2EA 2A1BA 2AGPA 3OUYB 1RZMA 2NXEA 4KH1B 1QSSA 3CCZA 3N6NA 4P75A 4ZVPB 4U7CA 3DRXA 2ZBIA 1Q7YT 1C1CA 2Y3YA 4URQU 3VCDA 4X4QA 1QUVA 4AT1B 4ZLPA 4UQGA 2V94A 3SMZA 1SKRA 1C0TA 3C6UB 4H4OB 4OI3A 3MURP 4HKQA 2L41A 2XMWA 2ZOMA 1KQSR 4WP3A 5KFMA 1D1UA 5DLFA 3OTOJ 3SBMA 4FF4A 5JVHQ 2GC8A 2XGPA 2HHUA 8RUCA 3CCWA 1PYSB 1N54B 1Y3KA 2E7VA 2J9DA 2W24A 2YWGA 3M6VA 3UFCX 2YTCA 5MAOA 3N28A 2CQCA 3KJNB 5CABA 2G1DA 3CE8A 3KTQA 3DN9A 2LECA 3MMAA 2G2OA 1IKYB 1IJFB 4ZMMA 2XO7A 2LA6A 1IBMJ 3RBDA 3LPYA 4JI3J 2MZSA 2Q79A 2JOQA 4RW9B 1SQFA 3BV8A 4YR3A 4DG1A 1JB0C 1DZ5A 3LH2S 4X65F 4MKBA 3OSNA 1WF0A 4DS4A 3ETMA 2ZVIA 1Q5VA 4LQ3A 4U67Q 3GJTB 1D9FA 1N34J 5SZTA 2CQ1A 3OR2B 4WTOB 1RU1A 3CDEA 3M2RA 2Z2LA 3NY0A 3RTVA 1UWBB 2N4CA 1FJGJ 1QAYA 1FKOB 4F7VA 3ICLA 2IJFA 2DBBA 5CYMB 3OTEA 4OLOA 4LRCA 4MYTA 5GVQA 2MXYA 4ECTA 3P49B 1S0NA 4DL5A 2CPYA 1VQYA 5HBMB 1XNRJ 3OTDA 3S01A 3QLHA 7FD1A 1S1WB 1GFWB 2VPXB 3KK1A 3ZZOA 2VV5A 2B4OA 2FUG9 4DPOA 1VHFA 1D9DA 2RU9A 4CO3A 2IM0A 4TQRA 3BSNA 2J9CA 4J9NA 4DV6F 1U8SA 2ZJQQ 2BUNA 2W2PP 2HNZB 2FJBB 3KLVA 3GONA 2PI5A 2JZ5A 3RBXA 2MQPA 2M52A 2YKMB 4CO1A 2F3JA 4B3RF 4GKJF 5T7LB 2XZWA 2WHOA 4DN0A 3V6DA 2D3ZA 2XWXA 3LGNA 2RILA 1BWVA 5IC4B 3U02A 4WFNQ 4RNFA 2M8DB 4O3RA 2K7JA 2IA0A 5F9LA 1BMQB 3L7OA 4O3NA 1HYSA 1R0AB 2PT0A 2RAQA 3TZWA 2H51B 3CTRA 5DETA 2DNHA 1TK5A 2IRUA 2VBWA 4GO5X 1VQ4S 4ZVUB 4DF4A 4P2XA 3TJ8A 1L3UA 2GQQA 4DQSA 1WOPA 3Q89A 5L9XA 2C3OA 1RWPB 2B9EA 2Z8QA 3IP0A 2RF2B 3RB4A 4ECRA 5CD4A 4OYZA 2BANB 2AHOB 1M1HA 4L73A 4NEYA 5CCLA 1D9AA 1HQUB 1LNQA 1SH2A 3EGWB 1A6LA 4WPAA 4B9NA 1J5EJ 2Z4PA 2R7TA 3I6PA 3TOQA 1PSDA 1IN0A 2EG1A 3A13A 4B3TJ 1HNIB 2HBYB 2AIRB 1W2BR 2E5HA 4CO2A 5IQQA 2DNLA 3BGRB 2E1RA 4HT5A 4NLGA 1H73A 2Z2ZA 1RHRB 4DPXA 3MPVA 2H1YA 2HS4A 2V8GA 1BQNA 4CO0A 2AYGA 4NLDA 2V9WA 2FHOB 2CPIA 1VJQA 2K3KA 1HBNA 2KT5A 2XNQA 3TUIC 4ECWA 4GRSA 1U1LA 4WU3A 1WORA 4DU7A 3UDCA 3QT6A 4DQRA 2FGCA 4XAKA 1Q95G 2M7SA 4DCPB 1S1WA 2DIVA 1FRLA 4X4UA 2V69A 2MSTA 3J7YU 2VZ9A 3Q24A 3HKWA 5KT3A 2X3DA 5J2MA 2P8IA 4NLQA 5KFAA 1OSDA 2WONA 1NM2A 2ZHOA 3CNQP 3KWMA 4N47A 1SJQA 1X0PA 4NEZA 2EG2A 3VVTA 1KNZA 1R8CA 3FFIB 5LMNJ 4MIBA 3V4IB 4ED1A 1V6HA 1U1QA 3NGUA 1FDAA 4KIAA 4IO1A 3OW2R 3K89A 3Q8UA 4JI0J 2CWXA 5KOXA 2XS7A 2UUAJ 1HWKA 1OS5A 3H25A 2VOPA 4HTIA 1S48A 4ZP8A 2ZBRA 4AL7A 1C4CA 1DBDA 2NZ4A 5KG7A 2BABA 5KFFA 1IBLF 2KB2A 4MKVA 3B6BA 5B0DA 1HBUA 2I0XA 2WW8A 1NO8A 2CZ4A 3GCXP 1PG5B 4JBCA 3AY0A 4Q2MA 5HJXA 1LWXA 3JTOA 2MKJA 3THTA 1X9SA 2BW2A 4LF7J 2VQEF 2ZZMA 4X66F 1SL1A 4URSA 4P73A 1T03A 3UWTA 4QYZK 1N5YB 3NOGA 4MT1A 3FBFA 3T1HJ 2ASLA 1NK8A 4UQTA 4NLWA 3GR0A 3I82A 3CJTA 4QIEA 3H40A 5DGBA 1EHWA 4A8SA 4K4WA 3CJ5A 3DI6B 4Y28C 1XTZA 3BSAA 2WVEA 4DPWA 1WELA 1HBOA 1PILA 3PNIA 1RK8A 1EETB 3D1HA 3KUHA 4TVAB 4Q5VA 3QNWB 1WTFA 1HNIA 4R0EA 1C0UB 1VQSA 4O3OA 2V8DA 5EGYA 5C25B 1KLMA 3RRGA 2OSRA 1SKWA 4C4WA 2V67A 4Q44A 1S6QB 4ZPTR 4U7UK 3W2WB 1KBRA 2KN4A 4EYIB 1VHIA 2GNKA 2XWYA 3HHEA 3RRHA 2MZRA 2CQ3A 1EETA 3IG1A 1KP6A 2EWHA 2D9PA 3RAMA 2KDOA 3VGTA 2W01A 3MM6A 4A47A 1MU2B 1ZA1B 4NCGA 4P72A 1LFPA 1S6UA 4JP8A 4CLLA 4C2MA 1NSQA 4IUFA 4WIQA 3W9IA 5D3GB 2MQ8A 3DOKA 2DHAA 4I6AA 4F0MA 4J9RA 4DR5J 4IR1A 2HNZA 2XLIA 1QSYA 1FDDA 2VBZA 2V9KA 4HT7A 5T7LA 1VGYA 4ZIVA 4R5PB 4JYAF 2JX2A 1UPMB 1O51A 3PXGa 2ZDOA 2EFOA 2ZKTA 4CO5A 3K17A 3I4PA 4K5SA 2HS0A 2QN6B 2J6TA 5F41A 3DRYA 3DKDA 3GFZA 5LMUF 1RACB 1HNZJ 3O8WA 5F8HA 1RTJB 4OYIA 4ZP6A 1RTHA 1RT6A 2E5LF 1P27B 4NCBA 4R5PA 3ONQA 3I9V9 1RAEB 4X4VA 3L95X 4JI8F 3WC0A 2IM2A 3MR7A 3CMAS 5IS2A 2IM3A 4P10A 5GAHI 1K44A 1Y5LB 1H38A 2VG5A 5LSLA 2IDLA 5F3TA 2J6UA 2HFSA 4K7QA 2ZEJA 4DV1F 1DQ9A 4WIIA 2DHSA 2VFUA 2UXBF 2FQQB 3DU5A 3N79A 2BMBA 4ZLJA 1MN9A 2VQFF 3ZZRA 1VRUA 1U02A 2G0JA 3OXGA 2VJVA 1FD2A 1LXJA 1NK5A 2QMUB 3ZO7A 1YWXA 3OR2A 5F8MA 5IM0A 4ZJQA 2BACA 5E5NA 5JVGQ 2RDDA 3MOZA 4TN2A 1S72S 4YB1P 4OI2A 5E7OB 1B70B 2OMOA 2K2PA 5DGAA 3GV7B 3T3FA 3I31A 4LQ9A 3PIPQ 3SV4A 1M1KT 1XR6A 2Q6CA 2RKIA 3DLHA 2MKCA 2QTWA 3IR7B 2O01C 2JNJA 2GCFA 5BJRA 4OYPA 1J5OA 3PW4A 3L4BC 1FJEB 4F4ZA 3CJSA 2J7WA 4OJGA 3UDEA 1XEZA 2AGOA 4WZMA 1B0PA 3FSXA 3VGVA 4JI5J 2KH9A 5L1LA 2QGFB 2RMLA 4LSLB 3D1QA 4QWAA 4ANEA 1UWAA 2DGSA 3G87A 3D6FB 3ZZUA 1REVA 3U1MA 2IDEA 1LQ9A 4RR5A 3W2VA 2RUGA 1UEVA 2Y0BB 3DOMA 1U1RA 1S0VA 1SB6A 2GHWA 1U2CA 2UXCF 2KO1A 3MR3A 3IBFB 1FRXA 2E66A 2OELA 5LXYA 4KYZA 4IFVB 2AEJA 1F9EB 3UD5A 3HSGA 4GKKJ 4BHQA 3J7AN 3MI7X 3N6LA 3H0PA 4PG5A 4RNHA 1TV6B 3SSRA 5KFJA 5BR8F 4ERDA 4ICLB 2W7AA 4WYLA 5L1JA 1NDLA 3IWLA 2VG5B 4J9LA 2FPHX 3F41A 2ZM6J 1WC6A 5K8PA 5E3QA 1TMMA 3J7A1 1ZH5A 3J81U 1RWWB 2DNOA 3UN3A 1FTRA 2LVWA 5B08A 2HIQA 5DG8A 3UCZP 2XMVA 3M4XA 2PE8A 5IXUA 1IBKJ 1N5VA 1KQGB 5KFIA 2ZH4A 2BA9A 4J9QA 1QAJA 1H74A 1I1GA 3QRRA 1QAXA 1WDDA 4EO8A 2IMWP 4KHMA 3QSYB 4CNYA 3HFVA 2LP4A 2GVDA 2NREA 2DNMA 2HHTA 2Q6BA 3M8QA 3UNGC 4QU6A 5A8KB 2ZH8A 2BJ8A 2JLFA 1UJ4A 2VKZG 4USVA 4EU0A 3GFHA 4HH0A 1F0XA 4WFBQ 2HMIB 3RAQA 4NI2B 4KFBA 4UT4A 3PEJA 4RNNA 2Z30B 4IH6A 1TTHB 2DVIA 1EP4A 3LQVA 2R8HA 4ZN3A 1LFWA 1CQMA 4H4MA 1X8DA 5KFSA 1CJTA 1N48A 4DR1J 4OX6A 4WFXA 3KYLA 1S9EA 1Z1ZA 4RJVA 1HNVB 2AZ3A 1FWLA 4NMLA 5ETNA 3BBFA 2EFQA 4RLEA 4DXLA 2AW0A 1BC6A 1PJ6A 1RWUA 2E1AA 3NWRA 3J80Y 3TX8A 2UUCJ 1P9QC 2DT9A 5GAHU 4TYBA 2FC9A 5J2PA 2ACMA 1GEHA 1NDKA 2E1CA 2X51A 3H5YA 3KOAA 2YNHA 3GSDA 3GJSB 3E51A 4BBYA 2D3OR 2GGPB 3W3SA 2YKNB 2RDJA 3AODA 4JV0A 4QCLA 1IKVB 4JI1J 5K8OA 1D3WA 1MLAA 4XTTA 1VR6A 4PXBA 4DR4F 3R97A 5J1EA 4BC7A 3S8SA 1OSCA 1VRUB 1OJ4A 1SC3B 1RAFB 1ZA2B 2M9KA 3D3CJ 2CQ0A 2E7XA 3DLEB 1NPPA 2BJ1A 2UUTA 3QT8A 3HHKA 4ECQA 2LEBA 1UVMA 3HP6A 1UWBA 4OV6A 2HBZB 4QW9A 5J1EB 4XO0A 2WOMA 5AE2A 1BHNA 2DNPA 2OPPB 2OEKA 4FYYB 4M5DA 4DUZF 1VQ6S 1S1UB 3CJQA 4ZP9A 3K5MA 1JJCB 1S1TB 4EMDA 1NK0A 2KZZA 2IAJB 3VR1A 1NUEA 1TVRA 3W60A 2LYVA 4O44B 4RKUC 3VAKA 4KAIA 1S4EA 4ZITA 1RQ0A 4YY3F 5GADU 4IG3B 2OFGX 3SCJE 2CQGA 5K9FA 1VBZA 2Q3PA 3CWJA 3MDFA 3K0JA 3I0SA 4N77A 5KFPA 2ZUAA 3W1YC 4O4GA 4MFBA 3CD5A 1JLBB 3CJ3A 4QWCA 3W2VB 1X5PA 2DD8S 2EKNA 3MZIA 4FF3A 1MNEA 2RHQB 2VFVA 2P2CB 4PXEA 1NPKA 1YHQS 5IT9U 1UW9A 2V2KA 4DMZA 2DGXA 3NKYA 4IFVA 4I0WA 2W2NP 5DG7A 1WSVA 1R3NA 2CJYB 4O0IA 5GAEU 1U4BA 3OVBA 3BR8A 4IG0B 3T6BA 2NQPA 2G0IA 5LL6d 1S1VB 1Y5IB 3G2XA 6AT1B 5KFBA 2AQ4A 4RO0A 3CDWA 4IOBA 2DEJA 5D4OA 1C0UA 2OP5A 3UQSA 4CYUB 1W7WA 2IJNA 2M88A 4I7FB 1B7FA 4ID8A 2BJEA 2LU2A 4OZ3A 3PACA 1E6VA 1RA6A 3GG1A 3PW0A 5D0EA 2ALZA 4Q45A 2BQUA 3R7BB 4IOAQ 2BM0A 3RG6A 5L1KA 2YKQA 1GH8A 3PY8A 3V81B 1VJWA 4OI4A 3DRRA 4OZNA 5AJ3J 2QE5A 4MKYA 1LW0B 2XG8A 1DY3A 4Q8EA 1XN9A 4FVMA 1AYEA 1SIWB 3A8JA 3Q8YA 4M5IA 4JI6F 2CYYA 3WDOA 3TAMA 4OHYA 4DPTA 4LF2A 3KG1A 2KHDA 4A8YA 3BSOA 1B4SA 1I94J 2CPEA 3R9LA 2CQ2A 3M8PB 1N0UA 2DGOA 4DL3A 1S6PA 2L08A 2YNIA 4NA1A 5A8RA 3T5JA 2AX1A 3EE3A 3H5SA 2YXLA 4OIXA 4USWA 3PIOQ 4ZVHA 4ECXA 2KFYA 1LK7A 4M94A 1QJHA 5EN1A 4PXDA 1RCOB 3MMBB 5LSRA 3ET6B 1N4LA 2Y8WA 2R7UA 1PAUB 1NSPA 3NG8A 4Y2IA 1ZM9A 3BF4A 2YWKA 1NSAA 2EBEA 4DR2F 4LBIA 3C66A 2HQDA 4YDXA 1NKEA 4ED8A 1C1BA 1NJZA 4UY85 3EZOA 4OHXA 1CQNA 1UFKA 4B17A 3H4BA 3BQ0A 2XGQA 5H9EJ 3BSCA 1FK9B 5B0FA 4NLPA 4RNOA 4LF6F 4LSLA 4PEOA 5CZDA 1CULB 1HMVA 2CJ9A 3BKTA 3LTOA 5KAKA 3RJMB 4IRCA 4FYVB 2IC3A 5I3UB 5EWFA 1CJUB 4DX7A 4DUTA 3JTPA 3OFHA 4HHHA 4DFJA 3V6KA 4K4TA 3PRBA 3G6ES 2MQLA 4ER8A 3DGPB 1ZYQA 5D0GA 1XK8A 4DSIA 1UTAA 1HQEB 1U6BA 5GAEI 4F25A 2FHJA 3BJYA 3LO3A 1HWJA 3C8YA 3ZTSA 4DUYF 2JEJA 1R8PA 2FY8A 3W2WA 3HVAA 1XR5A 3AOBA 1BQXA 3AQOA 1TL7B 1XBWA 3ILOA 4DZ6A 4TQSA 1ZTTA 1SQGA 4EK2A 1U7LA 3G86A 4TNOA 2M2BA 1F2GA 4LRFA 3FZBA 4BDPA 2J0XA 1K0TA 1Q7LB 2CNKB 3MWBA 1NB2A 2OKQA 4WU2A 2XCAA 3CCUS 1YRUA 2OMLA 3M2VA 2QLJB 2V5HG 3KFWX 5F8IA 1GK8A 1M5OC 1KLNA 2FGOA 3CMES 3GYXB 3KLFB 1S9GA 1JLQB 1RT2B 4DZDA 3OL6A 3KMQA 1KFDA 3P5TL 2VF3A 2AJ2A 1FA0A 5A8KA 2DYAA 1TKXA 1RT7A 2D3UA 4PWWA 3SCLE 5IV3A 2AT1B 4NLTA 5LT5A 5IM0B 3FQKA 3NXZA 2HEKA 2HZCA 1WACA 1SH3A 1FRMA 1UCNA 2QA2A 1YSJA 4PWDA 1NLKL 2X1AA 1R0CB 1WHVA 3FSIA 2CUYA 3DHXA 1M5HA 4USTA 5D0HA 5DRKA 2XS5A 5HQMA 1FESA 3D5MA 2IC3B 4PABA 3TA0A 1P9YA 3P6YC 4WFYA 3KXDA 2OHDA 2ZFHA 2C3PA 3C16B 4IFYB 3OTOF 2Z56B 3ENQA 1RHQB 4KB7A 4R0JA 1FK9A 3TJAA 4HI2A 4KHRA 3KLGA 3UD4P 4DWIA 2HHHF 5KG0A 2BOPA 3MEGB 1PBUA 1IKXA 2JHEA 2VFTA 3D6MB 3PZPA 2GIRA 4KGZB 4OI6A 1B3TA 4B3SJ 4ZOSA 1PYTA 3GILA 1MWZA 1RLDA 4L75A 1IBMF 2WVBA 2RT3A 4FXDA 2B0GA 2LQJA 1KR4A 4C48A 2IBKA 2JLGA 3A8KA 5BYRA 2P9CA 3RU0A 5LOQA 3EVMA 1TK8A 1YBTA 1OY8A 3MM5A 4ZPAA 1U09A 1QTNB 2OH2A 3BKUA 3KLFA 1SJ4P 2V68A 2ROGA 1U8WA 1TL3B 1HBOB 2F40A 3T41A 2HW3A 4OI0A 3PTWA 3WIUA 1NRKA 4ZLNA 1EARA 3H98A 2R7RA 3ULHA 2NSBA 1YITS 4OZ2A 5CZCA 1WHWA 1ZM2A 3SQGA 1HBNB 3PR5B 4DL2A 2A3JA 4ES1A 4WTYA 4J9MA 5K14B 3RB6A 1VC6A 4I1TA 2UP1A 1ZPVA 4LREA 4DX5A 2KG0A 4AQYF 4UY8T 2NXUA 3ENAA 2V4QA 5HMYA 4HEA9 1LW2B 2HKEA 2IVYA 1KVJA 4QW8A 1FI4A 2CZ9A 2EXUA 5L8RC 4DV6J 4M95A 2DRDA 3V4MA 2EEYA 1FT8A 2VA3A 5D78A 1RWVB 2G9OA 4Y34A 5DDOC 1ZZNA 3TQ1A 2HHQA 1FEHA 4B3RJ 4AL6A 3OV7A 1LWEB 1VYAA 5DDPC 2VODA 1LWCA 1HKAA 1S12A 1VCTA 2IRXA 1U26A 4ES2A 4JI2J 2DPJA 3AB2B 4J90A 4M8LA 4M5NA 2HWIA 5K5MA 3J81Y 3HPOA 2HNYA 1DQAA 1VMBA 2M4MA 1I5OB 1FXRA 1Q53A 1EZZB 2QA1A 2W25A 3R3TA 4J9VA 3R7NB 1CULA 1HMVB 2PMHA 3AAWB 3C2PA 3SDEA 1OO0B 2BDPA 1FFWB 4RW6A 1FRIA 4CLPA 2X7IA 1U25A 2LXFA 4KSEB 3D3BJ 5FIIA 1FVQA 5A0YB 5RUBA 3VTIA 2HNYB 2OPRB 1BY9A 2OPSA 2GVZA 1J27A 1FXDA 4QPTA 3A1YG 2KRRA 4RPFA 4Z7CA 3K5LA 4Q0BB 5B0EA 2DNNA 4DG1B 2VG6B 3C14B 4M63A 2G2YA 4A8KA 3MHYA 3QIPA 3V5RA 4A8QA 1U1KA 1J5EF 1ZPWX 4N76A 4DPUA 3R5JB 3AJ1A 2RUSA 1RHUB 3QJLA 3BH6B 4NPOA 4DR7J 3L9ZA 4ANCA 2IY5B 4Q2LA 2J7KA 4ZP7A 3FCVA 2HRYA 4ENOA 4NE9C 3LP0B 2UU9F 2YPYA 3PX4A 5D77A 4F4WA 2HAFA 2RVJA 3FZ2A 4LBHA 1JJ2R 2I2YA 3QGPA 1RT2A 2FVQA 2X1FA 1H2UX 2ZKUA 5CH7B 1WOSA 3FK4A 3MM6B 4KKOB 2XSFA 1LK5A 5E3AA 2RHSB 3FMWA 3ETOA 3TVZA 1CJKA 1Q78A 3PW2A 1YZ6A 4H4KA 1R6YA 5KFKA 2Y1IA 1RB0A 2VICA 1HNVA 1TUVA 3OTCA 2F7VA 1PO6A 1C1CB 4IQXA 4LFCJ 4OJ3A 5ETSA 2R7WA 1N6QA 3H7HB 5I3PA 4ELTA 2I5JA 2ZUGA 4H4OA 4MK7A 4OJHA 3WZ0A 3W64A 2QFJA 4AUKA 4PCQA 5ETLA 2UUAF 4DCJB 2XO6A 2MSSA 2CZVC 4BC9A 1VK3A 2B5JB 4Y00A 4X4PA 1IBLJ 3VGSA 1KSPA 2PMWA 1RT4A 3AQPA 2MQQA 3H2UB 4NRUA 3S6EA 2ROEA 3H5XA 4HR2A 4IOCQ 2HYIB 3TUZC 3M8YA 2VQEJ 4LF7F 2MPUA 1KN6A 2C2KB 4OL8A 3CDAA 2RIJA 1KQFB 3T1HF 2C2DA 3PFOA 3IGVA 2E5IA 4UW2A 9RUBA 2W2MP 1T9XA 3LP1A 2ZNZA 3QQCD 2BX6A 1TKZA 1JQGA 2AKWB 1XC9A 3MCOA 1OPZA 3PKYA 3LAKA 3NWGA 5JXSA 3PM9A 3MGJA 1T11A 1F3VA 4JOUA 4NZ0A 1SV5A 4YN3B 4AD6A 1LV5A 2P6SA 2KFZA 4P9SA 3NAIA 1UZDA 2F9DA 2HQFA 2YNFB 1UVLA 4DI6A 5DS7A 1PJ7A 3FBCA 4ZVOB 3M8ZA 4WP8A 2FJAB 1WUUA 3QJJA 3G82A 2ASJA 4EI2A 3JSMA 3EUNA 2COLA 3KMSA 1BUXA 2J8SA 3DLLQ 2POKA 4A4JA 1WF2A 3JQJA 2DCLA 3VQSA 4D3HA 1YJRA 1S9GB 2DRBA 2ZDPA 3W61A 4WXWA 4Q8FA 3PR4A 5IFMA 1AFJA 3GG0A 4GO7X 1Z2LA 4JI7F 2QYGA 4G65A 2XQCA 4JYAJ 3EGNA 3SCIE 1TFWA 5HMWA 1CC7A 4HACB 4N41A 5J2NB 3L7UA 1I6JA 1JKHB 2AJ0A 2HQCA 1S9EB 2KXHA 1ZAXA 1ZETA 4PUOB 1HA1A 1GMWA 1RAOA 1GMVA 2DCUB 3ILJA 4UUXA 1FNOA 4F4XA 1HNZF 3HHLC 2HHWA 2PA3A 5FLXY 1E6VB 2ZBQA 1X4CA 1REVB 3OT9A 3QWPA 4JI8J 1FRJA 3LWLA 4H4KC 2JSXA 4P2FA 4CLWA 4DPYA 4YEAA 1P1TA 2QYCA 3NGKA 5IC6B 2Z57B 2Q1LA 3IS9B 1HBMB 5CYJA 2ZITA 4A46A 2UXBJ 3M6UA 5C2GA 1Q1KA 2CAJA 3TRGA 4O23A 2B8QA 3M7VA 5M2UA 5A2QY 2ZE2A 3DHWC 2BW7A 3H90A 3RRKA 3OJSA 3EGVA 3GYNA 1RP5A 2LFVA 2F4FA 2RH3A 2NXCA 3CD0A 3M9OB 5HP1A 4TY8B 2RRAA 2DPIA 5HSPA 2FYXA 2LDIA 3SZ2A 3ZZZA 5KFXA 1RT1B 2U1AA 2W9CB 2CA9A 2JVOA 2UUBJ 2L3MA 5IT4A 1VRQC 1S1UA 1DLOA 4EZ9A 2GJIA 4OYXA 4DSKA 4NXNJ 3MM7B 4ED5A 4HL9A 1CPZA 4IDKA 2LEPA 3SFGA 5D4NA 1YBUA 2DGWA 2EC2A 1RT1A 1GAOA 1KKHA 4PPDA 1DAXA 2FZKB 5KT6A 2ZZTA 3CIZA 1DLOB 4LIRA 3JS9A 2I1RA 4JI5F 5D6GA 5IV4A 5D15A 3H5UA 4DR3F 4C8MA 3GFYA 2UZAA 2YY3A 2L9NA 4C8NA 4UF4A 2HLTA 2QX0A 4QPXA 3UW1A 3MFHA 3Q22A 3NAHA 1KFSA 2PN6A 3FDSA 2R8JA 2YWFA 2I38A 4I2PB 1APSA 2UVRA 4DLGA 3EM1A 3HMJG 4AE5A 3P5BP 4ICLA 2UXCJ 4OHVA 1HPZB 5E33A 4ZPBA 3T9NA 1EP4B 3QGHA 2V50A 2F4VF 2W9AA 2H5EA 1E6YB 3CJ4A 4GKKF 1LWFA 2G1HA 1LWCB 1N8RT 1T0TV 4PXCA 2NPFA 1SKSA 3CJ2A 3LALA 4A8OA 3NOCA 1NZ8A 3CPWR 1V3RA 2J0WA 4P2MA 3M1VA 4DQPA 3PEHA 3J80U 3RZAA 2MDAA 2ZM6F 3UO0A 5AE3A 2B7BB 2PSZA 1LWFB 2J9DE 2W9BB 4B9TA 1AUDA 1FRKA 3IBCB 1H98A 1XQIA 2VPWB 5CHCB 4CLUA 2H5IB 1FKPB 1NJYA 4CT9A 2UXDJ 5E2QA 2H3EB 2HRUA 3NS7B 2N82B 2CQDA 2FJWA 3DYAB 3E01A 4NYPA 2VONA 1IBKF 2CQHA 1A0OB 2VUGA 1RUSA 1X31C 3VAHA 3PG9A 3QAEA 1R43A 4CH0S 5HMXA 3D2WA 1W26A 1LOUA 2D3O1 1S6QA 2MQMA 2VD3A 3FC9A 4ZVSB 4PG7A 4CLSA 3BGFA 2HBRB 1U6FA 1WWHA 2VJUA 3VAGA 1GQEA 3AXMA 5HK4A 3JSYA 3TEHB 2HIYA 1RABB 3FNNA 2VZ8A 2HZAA 4DV5F 3G8SA 6FDRA 4URGA 4KV8A 3OLAA 5E3CA 4NA3A 3SSQA 3BO2A 3MMBA 4P7VA 3K2YA 4I4BA 3R5GA 3GIIA 2QLBB 5EHHA 2ZH2A 4M5KA 2ZBPA 1WEZA 2E9RX 2DH7A 3CXCR 2CDRB 3VHQA 2LXUA 2NXNA 1SIZA 3EPGA 3MPWA 8ATCB 3V4IA 2E29A 4C8OA 4QR2A 2OD6A 2AWZA 2VDHA 4ZJOA 3EXYA 2KHCA 3DLGA 4DR1F 2VU5A 4FYXB 4RWXA 1UP1A 2C2OB 1RT3B 4LUBA 4F4YA 2VC1A 3R6GB 2YKNA 1S0OA 3E2EA 2OPRA 4I6WA 2HK3A 3K59A 1UPPA 3ELHA 3NGSA 1F60B 3TVYA 2XYGB 2GAHC 5ITHA 5GMDA 4G3IA 4G1QB 3TUJC 5L39A 2LKZA 3N5BA 1K9MT 4W4MA 1U49A 2DHXA 1EQMA 2D1CA 3IR6B 2YX7A 4TXSA 4A48A 2KKHA 1ITPA 2MZTA 2YWHA 5KG3A 1JNZB 2NSCA 2W8KA 3EVWA 3DFEA 5DQHA 4KO0B 4PG4A 4FS2A 5CAAA 4ECZA 3ENWA 3MECB 4DV3F 2XMKA 3C15A 1KLMB 2ATLA 1N33F 1PIEA 4MJKA 1HL6A 3BYRA 2ZHBA 1SC4B 2MLYA 1NEEA 4QJVA 4IQMA 1UW4A 5HVHA 2WTFA 4LFAF 1KVIA 5G4DA 3HF5A 1JLQA 1Y5NB 2OSQA 3VAIA 1HI1A 3N01A 3VWSA 1WKKA 2F1FA 5F9NA 1NB7A 1N6QB 2GW8A 5CCMA 3CJ8A 3DRPA 5IT9Y 2JRSA 5C25A 3ITHB 4AMNA 3AOAA 1F9HA 3CO9A 4C97A 4OLPA 1Q8LA 4FF2A 1R0BG 2H4YB 4YY3J 5KT4A 4K4UA 2V2QA 3LW5C 2AJFE 1VISA 5IOLA 1VS3A 3TW0A 1YJWS 3I5BA 2HK2A 1WTBA 3S1TA 4CH7A 3GIKA 3HLUA 4ETXA 1RA7A 4JUZA 2N7CA 5K20B 4ILRA 2JEGA 3KK2A 5HMZA 2YKMA 3CJ0A 4FNIA 4PQUB 2ZBCA 4B02A 2OPQA 4C9DA 2CNLB 2PD1A 3AJ2A 4G1QA 5DG9A 1Q86T 5A0YA 3HI9A 1VQOS 3IC1A 3TR5A 5JMNA 2LCWA 1X4DA 2RS8A 1D0EA 1RTJA 2XLKA 3UVJA 2RQCA 1FERA 3OFEA 3CCSS 4K4YA 1S97A 3MEGA 3TWZA 3EWGA 4GVLA 3HZEA 3SDEB 5DDRC 3RAXA 2MJUA 3D0IE 1JMTA 4MH8A 1K73T 3T1YJ 2KJWA 4KR0B 3OPKA 4PYAA 5AXLA 3KK3B 4K50A 1G4CA 3F56A 3DOLA 4ZJLA 3UVJB 2OJ3A 1O6XA 4CLZA 3VAJA 3ADAC 4UTGA 4C7QA 3JYTA 1FWPA 4LIWA 4IKAA 3LUYA 1MSWD 1TUGB 1FCAA 3PRVA 2N3LA 2RD5C 2VDIA 3TVKA 3LP2B 1JLFA 3LGMA 5AJ3F 2V8PA 3MUMP 3CUNA 1M5VC 2CXEA 1NXIA 2YH0A 3UCGA 3ZC4A 4JI6J 1AA1B 4ZCIA 2NLWA 3H2LA 3MM9B 4IRDA 5GAGI 3QFWA 5K14A 3OVAA 5H9EK 1SJRA 3D6TB 1X9WA 2K7KA 2J7UA 2NS1B 1TKTA 4LF9J 2B51A 1PBAA 3GLJA 3A12A 3N0VA 3O3LA 5DJBA 2KG1A 1C4AA 1FF2A 3ZZYA 4F02A 3ITHA 3BGLA 2BV3A 1ULRA 4PR6A 1L5UA 4MTPA 1O8BA 3KDOA 2IYGA 3K8VA 4LMZA 1WSRA 4K2JA 5ETQA 4PKDB 1URRA 2NUHA 2VBXA 1TKTB 4DR2J 5GMKa 4EFAC 1FE0A 1HQ2A 4BWMA 3CCQS 3PDNA 1Y0HA 1S1VA 3PJWA 2M3DA 3E8OA 1K8AT 4Y2KA 3PFEA 3G96A 4RBTA 1JNRB 1U1PA 2HFUA 4FBTA 1OYDA 2X1BA 4LF6J 5H9FJ 1VK8A 1NNDA 4RX6A 1KWMA 2EK6A 2KU7A 1SJ1A 2J5AA 4TKTA 3QATA 1XJWB 3AD8C 2DR7A 1XNRF 4OZ0A 1C0TB 3C6UA 1KHVA 1QD1A 3A4TA 4KRWA 2CJQA 4BLGA 1R8BA 4M1KA 4F3OA 4AMPA 1RBOB 3C16A 2ADCA 2BJ3A 3CGIA 3OQ2A 1H2TZ 1WC0A 4NLRA 4PPZA 4F3QA 5FDLB 2DH9A 4B9MA 5D8HB 2ADBA 1RT6B 1RTHB 4DUYJ 2AV5A 1B0VA 4WKRA 2MLZA 2B9YA 1EKRA 2KVIA 3C14A 3U1LA 1IKXB 1M0SA 3AA8A 2HVEA 3VGUA 1IR0A 3PHEA 4QWBA 4MKAA 1YZ7A 3R1HA 1V9OA 2A0FB 1WKJA 2FD2A 2FTRA 5ETVA 5FDLA 1U6ZA 1SXLA 1DTTB 4U9RA 4HDHA 5I3QA 1FKOA 3UE2A 1SCJB 2CPDA 1Y7PA 3QPIA 2B9XA 3BH7B 2OPPA 1BQNB 3GP9A 4M5DB 3DOKB 3RBZA 2F9JA 3BYPA 4MAKA 4A8XA 4C0BA 4DQIA 1DARA 2QL5B 3DXSX 3RYLA 1JX4A 1OY9A 1WI8A 2YNIB 3VVUA 4MK9A 1N32F 3MEDB 4ES3A 3I87A 1GXUA 1UJ5A 1M1GA 3AFGA 3D9BA 1X7VA 3P96A 1S0MA 1NBEB 4LT6A 2WAQD 2D7SA 2BKOA 2D41A 5E0OA 3WC2A 4OX9J 1VQKS 4XK8C 1TKXB 3LANA 1NCLA 5EWGA 3QIDA 2YH1A 3MAQA 3QGGA 3DU6A 2ZD1A 3FRZA 4I69A 4MYUA 3S7RA 3M32B 4J9KA 3FSYA 3OR1B 3TO8A 1VRTA 2V4JA 4Y2AA 3NS5A 4AFFA 3KLIA 3R5AA 4X62F 1JLAA 4G1PA 4DLEA 3HVTA 2XC9A 2HAIA 1OPIA 3B4DA 2DTJA 3UI3A 4HVZA 3N6MA 5E41A 2HHHJ 3TA2A 1RSCA 4OFZA 5KFWA 3CD6S 1SVDA 3WHIA 2MKSA 4KQZA 4B3SF 4IG0A 3B4MA 3MAHA 4PYDA 2J6SA 4O3QA 3FCWA 4KC5A 3HT3A 4QIFA 5A8WB 2GVZB 2YBVA 3A3NB 5HVFA 5T41A 4WKYA 2OIHA 1GMWD 5G0RB 1E6YA 3JYTB 2DY1A 2YNGB 4C98A 4EBDA 5B09A 2CG8A 4DQQA 1JLEA 2ZNYA 3BKFA 2A6OA 4RW6B 4B3OA 3G6XA 2M70A 3OHBA 2WVDA 4QQBA 2VOOA 4A8MP 3RB0A 4CLKA 1SUQA 3GV8B 1QVGR 2JEFA 2OLWA 1EQ0A 5HBMA 1RAGB 1RHKB 1W25A 3OL8A 5DM7Q 1GT8A 4ED3A 2B4PA 3MCNA 4AXIA 2V4RA 4I2QA 1JIHA 1MW7A 4CLFA 1AUSL 1R8HA 3B54A 3GJRB 3M8PA 3W5ZA 2BOAA 1D09B 3CCTA 3O5TB 3GQCA 5AE1A 2FLNA 4ELUA 3EMTA 4AQYJ 3EJMA 2RQMA 4RBUA 2AJ4A 4ZPWR 2C2ZB 4I68A 1YKWA 4IDKB 3RR7A 3HT0A 3W65A 4CO4A 2UVWA 2ACYA 2DGUA 3OTBA 4TU8A 5D3GA 2R3VA 3HSDA 4TYAA 2FC8A 4DL7A 3HDSA 4HYKA 3R1LA 4AMMA 5KG4A 4KH0B 2LEAA 4IYQA 3WIVA 4N7TA 1VC5A 4C11A 3KHRA 4O3SA 2J9EA 3K5PA 4R25A 1IKWB 3DM2A 1XIQA 1DQ8A 1VI7A 2Z2MA 2FIUA 3EXCX 2EFVA 4X4OA 2CPZA 1TV6A 4JI2F 2HFZA 1HLWA 2W8LA 1QDUB 1AZSA 3SIPB 3DGVA 2RF2A 1DHMA 1RT4B 2BR0A 2BANA 1DRZA 1N5SA 3MEKA 1TL1B 3EX7B 1FXLA 3PJXA 5I42B 4USUA 4ED2A 3R5CA 1BGXT 2XMJA 2KYZA 5KFGA 2BRKA 1KC8T 1SPBP 1NK4A 2DJWA 3QT7A 1HIYA 4CTAA 2C1EB 5A76A 2FY1A 2E1MC 4V1Ak 2DY9A 1TL1A 2PO4A 3LA0A 3Q83A 4ALZA 5F0UA 2L9DA 2DNGA 3KLEA 2Z58B 3L09A 4L3NA 3AD9C 4DEZA 2V63A 4RU2A 1X4BA 3UPFA 4EUVA 4DR7F 2FHJD 4LF1A 1J2VA 2HVIA 4LSNB 2B43A 4O44A 1QVFR 3QO9A 5KFHA 4V19J 4GMKA 2EC0A 3M05A 2UU9J 1FWKA 1IWAA 1OQ6A 4X4TA 2XMAA 1NSKL 2MQNA 2D9OA 4DV0F 2K1RA 5CYQA 4DV7F 3DDKA 3LF0A 3CCJS 3MM7A 4J5OA 2VC0A 2EFNA 3JXOA 3IXQA 3QSIA 4KPCA 1Q79A 1U2FA 3ZNUA 3RBEA 2BRLA 1HARA 2IYIA 5HQLA 2CQIA 3PW7A 2RQ4A 3FQLA 3NP5A 1R31A 3M6WA 3L3CA 2RQKA 3K57A 3BQ1A 4PWDB 2V8HA 3G9CA 2OTJS 2WRMA 1VOMA 5L46A 1OIAA 1P6TA 3OFGA 1YQHA 1C2PA 4P2SA 2IVFB 4DFPA 3JSMB 1U0HA 1UFWA 1B99A 2GHPA 4AXJA 2MY7A 2Y8YA 2HFOA 3I0RB 4UOFA 3G4SS 2JJ4D 4J9UE 4OJ1A 2MGZA 3UCUP 3ZZ0A 4ZA1A 2BXJA 4DSLA 3CC7S 3QJPA 2QV6A 1V5VA 2FJEB 3IRXA 4GVBB 1YG0A 2BE2A 3IRWP 4FXVA 4DDFA 3QGIA 1S6OA 4DF8A 2HVHA 4DL4A 5ETMA 1K1QA 3J7Z5 2H9ZA 3WX4A 4QR1A 1T94A 1IKYA 4KTQA 1YTYA 1VQ9S 2AF6A 3I9ZA 1NHUA 5B0AA 3BS9A 3I5AA 4OX7A 3GE9A 3TJ9A 4DL0C 4YR0A 3VAFA 3V81A 1VQ5S 1YJUA 2GGPA 2DIUA 5FLXU 3B8HA 2VBYA 2MY8A 2EKYA 1IM4A 1YJTA 3VF0B 1JLEB 1MN7A 1HNXF 4B3OB 4DX8H 1O0PA 1FKPA 1VC0A 1CJUA 4LR7A 4QIVA 1UMJA 1JLCA 3UR0A 4DHVA 1HFEL 3ENVA 2BJDA 2C2NA 2AD9A 2QIFA 4B9VA 4ZKAA 5H9FK 1HBMA 4DSFA 4C8YA 1RWKB 3V6HA 2VG7A 3RB3A 4KJIA 1PKUA 1RTIA 2NXJA 5KFOA 1YJVA 2LA4A 3SQGB 1T95A 4RZRA 4ED6A 1T8EA 2V0NA 5J1PA 3GFXA 3EZ5A 1RWMB 3AD7C 1HWUA 1ZAVA 1YDLA 4IH7A 3BPSP 3MEDA 1RLCL 3TQEA 3QBCA 2HGLA 1CJKB 2I5JB 2XZDB 4QIWD 5KG1A 1JLBA 2XY6A 1HWIA 3AB4B 3C6TB 1VBYA 2MEWA 4J37A 2MGZB 4ZCMA 5HLFB 4B3MF 4F4AA 3NGDA 3GU0A 5EDWA 1TR0A 5M2PA 1V5IB 1T3NA 1UVIA 1WC4A 4Y2MA 2WBRA 3G82B 1BWEA 3I55S 2FLLA 1H7XA 2CRLA 2J0SD 1ZZFA 3DMJB 2R7XA 4CLTA 4C0HA 2UVUA 4O0NA 2DNQA 3W62A 2HGNA 1X5OA 2LU1A 3AH6A 1Y11A 5HATA 5C42A 3ZNJ1 3DLKB 2GIQA 3K7RA 3LPEA 4Y0FA 3MEEA 4F50A 4OYWA 4OZ5A 4RWWA 2RS2A 1VIOA 3QYYA 3W9JA 4PG8A 4OZ1A 6FD1A 3HHLA 3KLGB 2HS3A 4EEYA 2CPFA 2RE1A 4UOHA 4YQWA 1S1XB 3BGOP 2FZCB 2LQBA 3PYEA 4X2BA 1FRHA 1PJ5A 1F6TA 4U6PA 4NMXA 1HI0P 2BM1A 2FHKA 2FLOA 3DOMB 1VQMS 4JI4J 1H6KX 5IT0A 2FJXA 2VASA 1KHWA 1YX2A 1WG5A 3GYGA 4RW9A 3M9NB 5G0RA 4CYUA 5EWEA 1RKJA 1SV5B 4LF4J 2OFHX 1U48A 2HHXA 3N5FA 2B56A 3NCPA 3DXBA 1Y4ZB 4OYOA 5ADZA 4RW7B 4DR6J 3GV5B 1TKZB 1IXKA 3OD2A 4N56A 4HHJA 2RSQA 3HJVA 2M5YA 1S57A 4LF5J 3LGHA 2PDAA 4QWEA 1CS4B 2AU0A 3UR3C 2EFGA 2ABYA 4TU9A 4WXOA 2XS2A 1WC5A 2HQGA 2YNGA 1CBKA 5AXKA 3U1NA 2I8EA 4QWDA 2UUBF 2V8VA 2Q66A 3W9HA 1FEEA 3BN7A 3CJRA 2GIFA 2XSJA 3QMQA 4KKOA 4JB8B 4OHWA 3R6LB 4NXNF 1UZHA 4M5GA 4OZLA 4QR0A 5DM6Q 1JJHA 3C3LA 1FFGB 3EGZA 1LW2A 1Z4UA 2YQ1A 1S9FA 2I6WA 3OHAA 4J9SA 4PUOA 4IG3A 1UVNA 2DNYA 2VIHA 2AEFA 3SYZA 4YB7A 1MWQA 3EDQB 5DZ6A 3Q86A 3J81j 4JV5F 3CC4S 1RTZA 3L7PA 3QZ8A 3M9MB 4DR3J 1CG2A 1RCXB 1OQ3A 4DX6A 1IKWA 3RW6A 3I32A 4DJBA 2G4BA 3Q2SC 4XPEA 1NK9A 4E98A 2CIMA 1F5BA 1HWLA 2PEHA 2QC3A 1NMEB 2BE9B 3NS6A 3U27A 3KHGA 2A18A 2MLXA 1FHTA 1F1BB 2D74B 2ZOGA 3PYDA 5LSOA 4K0KF 3TA1A 2F4VJ 1WC1A 3U7JA 1T05A 2DRAA 2G0CA
chains in the Genus database with same CATH topology
3TZWA 3TZZA 3QATA 2HG4A 2G1HA 3H0PA 3CJ8A 2VZ8A 3HHDA 2G2OA 2VKZG 3TQEA 2G2ZA 2VZ9A 2JFKA 2QJ3A 3IM9A 4QBUA 3TZXA 3BV8A 3TZYA 2UV8G 2CUYA 1NM2A 1MLAA 3IM8A 5DZ6A 2JFDA 3R97A 2G2YA 4RL1A 3G87A 5DZ7A 3HJVA 3K89A 3PTWA 2QC3A 2C2NA 2QO3A 2PFFB 3EZOA 4RR5A 3RGIA 3R8YA 3SBMA 5CZCA 3HMJG 2H1YA 5CZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZW A;  3TZZ A;  3QAT A;  2HG4 A;  2G1H A;  3H0P A;  3CJ8 A;  2VZ8 A;  3HHD A;  2G2O A;  2VKZ G;  3TQE A;  2G2Z A;  2VZ9 A;  2JFK A;  2QJ3 A;  3IM9 A;  4QBU A;  3TZX A;  3BV8 A;  3TZY A;  2UV8 G;  2CUY A;  1NM2 A;  1MLA A;  3IM8 A;  5DZ6 A;  2JFD A;  3R97 A;  2G2Y A;  4RL1 A;  3G87 A;  5DZ7 A;  3HJV A;  3K89 A;  3PTW A;  2QC3 A;  2C2N A;  2QO3 A;  2PFF B;  3EZO A;  4RR5 A;  3RGI A;  3R8Y A;  3SBM A;  5CZC A;  3HMJ G;  2H1Y A;  5CZD A; 
#chains in the Genus database with same CATH topology
 4W92 B;  2EW9 A;  3X1L B;  1KVK A;  4USJ C;  3HSJ A;  4EGL A;  3AXK A;  1NJX A;  3FBB A;  5CQG A;  4HTJ A;  4EZ6 A;  3TUP A;  4USM A;  4F2R A;  4WP9 A;  4X4R A;  1IJE B;  1M5S A;  5KFD A;  2QL9 B;  5IZH A;  2QLF B;  4U8V A;  2YPZ A;  1SC1 B;  2KXN B;  2O1P A;  2F8H A;  4FZV A;  1RAI B;  1XNQ J;  4X64 F;  3Q8P B;  4CI0 B;  4E8U A;  2KM8 C;  3F44 A;  1XMQ F;  2YX4 A;  2G13 A;  4U7U D;  1IBC B;  3VZI A;  4F04 B;  2UXD F;  4ZCK A;  1WD6 A;  3KUE A;  4EYH B;  4F4K A;  3OVS A;  1TL4 A;  3POT B;  1TAU A;  2H4W B;  3N9U C;  3QO9 B;  5KG6 A;  4Q0B A;  2QSW A;  1KON A;  3G8Q A;  3HFZ B;  4HDG A;  3VV2 B;  3BO3 A;  3OXF A;  1XR7 A;  2Z0G A;  1SJF A;  5CXT A;  5KG2 A;  3O2I A;  2PFD A;  3FMB A;  3FUY A;  3PYG A;  3NCR A;  2BQ3 A;  2MTL A;  1KRP A;  3IG1 B;  1GNK A;  4D3G A;  4XPC A;  4LBP A;  4DV5 J;  2VL1 A;  3HO1 A;  2V6A A;  3QRQ A;  4NCG B;  3V2U C;  3X3U A;  3JQM A;  2OTL S;  2GX8 A;  3OFF A;  3R5B A;  3C6T A;  4KGX B;  5DDQ C;  3FRY A;  4AL5 A;  3TZY A;  2PI4 A;  1QLN A;  1AXQ A;  2HFV A;  3K8W A;  3M2U A;  4CIO A;  3T19 A;  2GHV C;  3LWM A;  4B9S A;  1TUW A;  2CG4 A;  5IWA J;  2QL7 B;  3MUT P;  2AEM A;  4DU8 A;  4ZVT B;  1D8Z A;  2EK1 A;  5E3R A;  2OO4 A;  1V3Z A;  4M5M A;  4NWB A;  1JKH A;  1V3S A;  1WG1 A;  2JDJ A;  4TU7 A;  4M5H A;  2JL9 A;  3BZQ A;  3V6J A;  3W63 A;  1JLA B;  1ZAW A;  3M2U B;  2J0Q D;  1F9F A;  2A6M A;  2IFX A;  5GAD I;  4UZC A;  3FEZ A;  2KFN A;  1RAD B;  3C19 A;  4K4X A;  1L3T A;  3DC2 A;  3FBE A;  3OLB A;  3KLH A;  3DCA A;  2PMZ D;  2E7W A;  2L48 A;  4XDD A;  1KDN A;  5I3U A;  2EBG A;  1IWG A;  1BE4 A;  3HHN B;  4DBQ A;  2ZOF A;  1HYS B;  2R2R A;  1N5Y A;  2BZ2 A;  2JFK A;  3OSP A;  1UL3 A;  3M1V B;  4Z37 A;  1HR0 J;  3K5O A;  2GJF A;  1NPR A;  2HWH A;  2QZ8 A;  4XDC A;  2C2E A;  2IJR A;  2Y9H A;  5ETT A;  1BD6 A;  1RHM B;  2JFD A;  1U24 A;  4RW7 A;  1CJV A;  5KT7 A;  4RL1 A;  1L3S A;  1HNW F;  4YME A;  5F3Z A;  5A6W A;  2RRN A;  4Y65 A;  1MML A;  1CLF A;  2MKY A;  3CDB A;  3EVO A;  2CJK A;  3HVW A;  4ED7 A;  1B0T A;  4DV3 J;  1QE1 A;  1N33 J;  2GA7 A;  3D4J A;  3I5C A;  4AYB D;  2IRY A;  1YK9 A;  4RW4 B;  1WDT A;  3PRD A;  2O67 A;  1UKU A;  3IR5 B;  4LR8 A;  4LFA J;  1NKB A;  2SXL A;  1QUP A;  1CJV B;  1WF1 A;  1SL2 A;  3PCO B;  4OYM A;  4PQA A;  5C24 B;  4EBE A;  2BJ7 A;  1N88 A;  4NXM F;  4CT8 A;  1RI7 A;  1CSJ A;  1RT7 B;  5LJ3 Y;  3M8R A;  3P3D A;  4WE1 B;  3IFE A;  4K4Z A;  1KTQ A;  3ISZ A;  3GSI A;  4KV8 B;  1R89 A;  2QG9 B;  2GMH A;  3KNG A;  4DOZ A;  4ZVF A;  1FNX H;  4NLU A;  1M90 T;  3UN5 A;  2QEX S;  2UV8 G;  4YHH F;  1JXL A;  1NH7 A;  1RBL A;  7FDR A;  1KQK A;  2ZH9 A;  4RUH A;  2UV8 A;  2DGT A;  4LVO P;  3T5L A;  4RBV A;  2HGM A;  1EAY C;  2V34 A;  5DQI A;  4C8K A;  3Q2T C;  1UET A;  4ETZ A;  1IQT A;  2IM1 A;  3QT5 A;  4MMO A;  2DIT A;  1BLU A;  2ROP A;  1VRT B;  2V4J B;  4A8F A;  1NZA A;  5KFN A;  3UDL A;  5HLF A;  2FVP A;  1S79 A;  2DXF A;  2IIH A;  3MUV P;  4OZJ A;  1YGY A;  3NGR A;  3M30 B;  3CJK A;  4BCA A;  3EZU A;  4NX9 A;  5U47 A;  4OMF G;  1AW0 A;  4KT0 C;  4QYR A;  2DGV A;  3NMA A;  3AT1 B;  4CCH A;  1VDH A;  2P9G A;  3MMA B;  1GX6 A;  3SI8 A;  2Y0S D;  2R8K A;  3MMC B;  2F8M A;  1S4F A;  3T5H A;  2H5J B;  2R4F A;  2ZWO A;  3T1Y F;  1JWW A;  4DCO B;  3IS9 A;  2C42 A;  4CTA B;  1ROF A;  1SKU B;  4G1I A;  1HBU B;  2CVE A;  4P71 A;  2QFI A;  1DUR A;  3I56 S;  2GS8 A;  2CJB A;  1X4G A;  2W2Q P;  4HH1 A;  3TAR A;  4ZN1 A;  2YVS A;  4FNH A;  2C28 A;  2FVR A;  3POT A;  3CF5 Q;  3O1L A;  5HJY A;  1U45 A;  4LFB J;  1CS4 A;  5KFT A;  1Q0N A;  2AP6 A;  3MFI A;  4WBF A;  1VLY A;  4LF8 F;  4DR6 F;  4ELV A;  1VFJ A;  2DXD A;  2XUL A;  2H54 B;  1N0V C;  1YJ7 A;  3LAM A;  3NGT A;  2FHM A;  4KGK A;  4KE5 A;  2MZ1 A;  2DR9 A;  1IQZ A;  3THP A;  4K2X A;  2XCP A;  3D0G E;  4I56 A;  2LQ8 A;  3O6Q A;  3HKZ D;  3Q8V A;  5HQ8 A;  4LF9 F;  4WZQ A;  3KUG A;  3O44 A;  1YLX A;  3WX8 A;  3M6X A;  3CUL A;  2N3O A;  4O4G B;  5AXM A;  3CO0 P;  4J9O A;  3WBZ A;  2DR8 A;  4JV1 A;  2U2F A;  5KFU A;  1PCA A;  2Z2Y B;  3TAM B;  1H0H B;  4ZPD A;  4TY9 A;  3IM9 A;  3SXL A;  3TZX A;  4DV2 J;  2HZV A;  2KVQ E;  4FPI A;  3Q8R B;  1XMO F;  2W4P A;  1YRT A;  2HVD A;  2R42 A;  1S6P B;  3CB4 A;  2JEI A;  5MLC V;  3B82 A;  3US5 A;  2XY5 A;  2HQI A;  3TP2 A;  3D28 A;  1ZBT A;  2FB0 A;  2Q43 A;  5LM7 E;  1YIJ S;  2BE7 D;  2MHN A;  3R8Y A;  3JQK A;  3ET6 A;  3THV A;  1P1L A;  2ERR A;  2GJ2 A;  3R2C J;  3RUB L;  1OWX A;  1T05 B;  1HHQ A;  3PHT A;  2NCK L;  2R2U A;  2FVS A;  2ASY A;  1X4H A;  5JJB A;  1LKZ A;  2CNN B;  5HRO B;  3GIM A;  1F5C A;  1FTC A;  1RT5 B;  2HHP A;  5EX0 A;  5CZV A;  2CDQ A;  3KLH B;  2FDN A;  3LP1 B;  3A3O B;  3DI6 A;  3AA9 A;  3GMG A;  3HHD A;  4ZIW A;  3MD1 A;  4ZS6 A;  5KOW A;  2YWE A;  1KEK A;  1GTH A;  1U47 A;  1MRO B;  2XI3 A;  4LVN P;  4C3L A;  4CNZ A;  1JJ4 A;  2FLP A;  3HHL D;  2NR0 A;  3QAU A;  5CA5 A;  1FFS B;  4K4V A;  3OL7 A;  4PZV A;  3W5X A;  3BB5 A;  2LMI A;  2OEM A;  4NLV A;  3R5D A;  1MMN A;  4OI1 A;  1KOO A;  5L9N A;  5HO4 A;  1NDC A;  3GZ7 A;  4W98 A;  4KBI A;  4KO0 A;  4DV4 F;  1NDP A;  5L1I A;  3I4H X;  4YHH J;  5ETO A;  3LP2 A;  2PFF B;  2GO9 A;  4YB5 A;  2J8A A;  3MAA A;  2W9B A;  1SL0 A;  3F73 A;  3W5Y A;  1OY6 A;  1RTI B;  2XEX A;  3H59 A;  3SEO A;  2ZJP Q;  4FS1 A;  3T5K A;  3TI0 A;  2IAJ A;  4KHP J;  1Q4R A;  1S1T A;  5B7W A;  2ZC3 A;  1N52 B;  1JXV A;  1CVJ A;  1B64 A;  4Y6I A;  5EX3 A;  2A2C A;  3IBW A;  1N32 J;  4ILM A;  3HJF A;  4U95 A;  2JWN A;  1NJW A;  4Z2X A;  2MJN A;  5THW A;  5J2N A;  1TAQ A;  4O4R A;  2VHG A;  2CQ4 A;  3GB0 A;  2GVD B;  1XWL A;  4K8R A;  3MCS A;  2WBM A;  1HPZ A;  4OX9 F;  3W8G A;  2W7O A;  2LQ5 A;  1Q16 B;  4YOE A;  1BXN A;  3ZTQ A;  5KTQ A;  1FNM A;  4C3K A;  2XMU A;  4PRF A;  2A10 A;  2H48 B;  5KT2 A;  4Q43 A;  2KT2 A;  4IRK A;  1S1X A;  3DMJ A;  1QM9 A;  2B9W A;  3P8B B;  2XNR A;  3I0R A;  8AT1 B;  4WJB A;  2AX0 A;  2FZG B;  3KDN A;  4X62 J;  2YQ0 A;  2ZH3 A;  4DN9 A;  1F2H A;  2CWK A;  2C2M B;  2HRT A;  1H72 C;  4HHU A;  2RB7 A;  2BE2 B;  1X4F A;  4FVC A;  2FJD B;  4NLY A;  2CPJ A;  4NZ7 A;  4O3P A;  5BXI A;  1TQL A;  1X0F A;  2XM3 A;  3E3X A;  3HD1 A;  3PW5 A;  4J91 A;  5C2C A;  4P74 A;  5DLG A;  4JI3 F;  2OPS B;  2WZ1 A;  2E44 A;  1N5T A;  3BPD A;  4UOC A;  2VKR A;  4GC7 A;  2XY7 A;  2MZQ A;  4X65 J;  3J7Z T;  5J2P B;  4OHZ A;  4LF4 F;  3IMQ J;  2YNH B;  2YQ3 A;  3P4U B;  1N34 F;  1JLC B;  2PGC A;  2UUW A;  4USI A;  5KFY A;  1ZM3 A;  3HSZ A;  5A8W A;  5B0C A;  2R9L A;  2HBQ B;  4EBC A;  1IKV A;  1Z2Z A;  1FJG F;  1FJC A;  1R7I A;  1UVK A;  3KLE B;  1FX2 A;  2V2Z A;  3R27 A;  2HMI A;  2W4C A;  2GO8 A;  4K5R A;  4OYB A;  5BYS A;  3SV3 A;  2KTQ A;  1M5K C;  2AYE A;  3TZZ A;  5C7P A;  2NPI A;  3D67 A;  5CZX A;  4FPR A;  3IWX A;  2DNR A;  5KFV A;  3Q8Q B;  4ZVE A;  4H4M B;  4YFU A;  3CCL S;  3GJQ B;  4ECY A;  4ED0 A;  3Q0A A;  3SSS A;  1J5O B;  2VA2 A;  3DM2 B;  1UVJ A;  3KG0 A;  2KXF A;  1YI2 S;  3T1A A;  4LFC F;  4I2P A;  2YWW A;  2AZ1 A;  2IPO B;  2PEB A;  3KLI B;  4FXW A;  4R8U B;  2RJZ A;  3IWN C;  3D0H E;  1REG X;  2CAD A;  4KY3 A;  7AT1 B;  4LR9 A;  3FEX B;  3M8Q B;  3HCX A;  2UVV A;  3JB9 k;  4GKJ J;  2PC6 A;  1ICE B;  1U0H B;  3HK2 A;  5IQ6 A;  2JVR A;  2BKN A;  3PX6 A;  3BDE A;  1PYO B;  2F8E X;  2BKP A;  4CM2 A;  1C1B B;  4F0H A;  3AHP A;  2CJA A;  2BJ9 A;  4NI2 A;  3CCR S;  1ZOT A;  2IBO A;  2CQB A;  2J76 E;  3A8E A;  4WYW A;  1JLG B;  1R27 B;  1I51 B;  4G6V B;  4F0K A;  1RWO B;  3SQO P;  1SBR A;  1K0V A;  1WG4 A;  4WCE Q;  2HG4 A;  2WK4 A;  1RT5 A;  3BBB A;  3IGN A;  2K06 A;  1SJ3 P;  1RAH B;  4DFM A;  1TZ0 A;  2BYC A;  1IR2 A;  3ISN D;  4IO9 Q;  2OGU A;  2L9W A;  3AOC A;  2QLX A;  5A2Q U;  2XHC A;  1YRX A;  2X1G A;  3DOL B;  4WK1 A;  2EVZ A;  4IH5 A;  5DO2 A;  3GWC A;  3IA0 A;  2DO4 A;  2WB4 A;  4MK8 A;  1S49 A;  4RW4 A;  3NEK A;  1F5A A;  4I2Q B;  2R2S A;  3OJU A;  1WI6 A;  1RAA B;  3PO4 A;  4C0O C;  4M5J A;  1VQ7 S;  4YB6 A;  2C22 A;  4B3T F;  3UNY A;  1PC4 A;  2W2O P;  1ZS6 A;  1RYS A;  1SUQ B;  1LW0 A;  3FCH A;  3TNV A;  3VZH A;  4CLY A;  2W9C A;  5KFL A;  1T9V A;  1S7I A;  2WSF C;  2R7O A;  4R8U A;  4DV0 J;  4USK A;  5SUH A;  4DV7 J;  2XMT A;  1MU2 A;  4X84 A;  3J7Y I;  3DRS A;  4UOG A;  5T14 A;  1QTM A;  4N8O A;  5J2Q B;  1LWE A;  2D69 A;  4WF9 Q;  1CJT B;  4LRB A;  2ILY A;  1X60 A;  1T3O A;  4Z7Y A;  2AGQ A;  1MG7 A;  1RYR A;  1AZS B;  2X3G A;  1WHY A;  2RU3 A;  2B5J A;  4QIG A;  1S10 A;  4X4S A;  3HZG A;  5LMN F;  4NA2 A;  3HXM A;  3M32 A;  4JI0 F;  1HHT P;  4C3M A;  2MKH A;  1MWY A;  2ZD1 B;  4AND A;  5LXR A;  4QYZ J;  2ZWP A;  2LLZ A;  2AJQ A;  1G6B A;  2C3Y A;  4FKX A;  2RDI A;  2ZZN A;  1N5Q A;  4S0M A;  3LOU A;  4KGV B;  3I0S B;  1OYE A;  5HI7 A;  2A2D A;  2AJ1 A;  1R0A A;  2DKO B;  1OMS A;  2DHH A;  2V2V A;  3ILI A;  2CPH A;  3BRE A;  4CQ1 A;  2WB1 D;  2O66 A;  2RNE A;  3ILL A;  4WFZ A;  4WWS A;  1FKA F;  1MMD A;  4YP3 A;  1MRO A;  4CWB A;  3CVK A;  2MMY A;  4X66 J;  1U0S A;  1F3F A;  1JLF B;  1HQE A;  3TAP A;  1RTD A;  1L3V A;  1GXT A;  3CMQ A;  3MM5 B;  3MTK A;  3Q23 A;  3HX9 A;  3FVY A;  1RDR A;  1RJJ A;  3A8I A;  3IM8 A;  1P8G A;  3LP0 A;  3MM8 B;  4HI1 A;  1LXN A;  2CFX A;  2WOM B;  4L74 A;  5D4L A;  1HNX J;  1S59 A;  4I67 A;  3NNA A;  2K1R B;  5CYQ B;  2BBE A;  3B78 A;  5DZ7 A;  1N36 F;  1D8Y A;  1TFY A;  1X4A A;  4TY8 A;  1DFD A;  5F8N A;  1FO1 A;  1R6V A;  2JC0 A;  2DK2 A;  1HW8 A;  1NH8 A;  2XYP B;  1FDB A;  4LSN A;  2WW4 A;  3AJD A;  1FDN A;  2C2R A;  1ELO A;  3T9Z A;  3FGV A;  1Y00 A;  2KM8 B;  2WON B;  1L3K A;  2ZE2 B;  2B7C B;  2HND B;  2GMJ A;  5K8M A;  2KL8 A;  2KT3 A;  2B6A A;  2JH3 A;  3MTJ A;  4PG6 A;  2ALY B;  2F5G A;  2XZT B;  3NCQ A;  1RWN B;  4RU9 A;  3NBP A;  1Q81 T;  2OPQ B;  2QMW A;  2HHS A;  2YKA A;  4B3M J;  2HHV A;  5HAN A;  5AXN A;  4DR5 F;  1NJI T;  5F8J A;  2RKI B;  4ZDN A;  4HLB A;  4Q7A A;  1U1O A;  3M30 A;  3CJK B;  1HHS A;  4YDD B;  2DB1 A;  5A8R B;  4X4N A;  4FN5 A;  3DLJ A;  3R7S B;  3KK2 B;  5CD4 H;  2EI5 A;  2GQ2 A;  4F67 A;  2KI2 A;  1KS2 A;  3OR1 A;  1Q82 T;  3FJ2 A;  3RGI A;  5HN0 A;  3MOJ B;  4F3M A;  1HD0 A;  3QZ7 A;  3UD3 P;  1VQN S;  5LMU J;  4ZVR B;  3GTY X;  2EPI A;  1EJ7 L;  1WEY A;  2ZHA A;  1FJ7 A;  2OUG A;  2WSC C;  5KFR A;  4EO6 A;  1DTQ A;  2E5L J;  3HUL A;  3UN2 A;  1SQE A;  3TYT A;  1S5Z A;  1A7G E;  1VLO A;  4ILL A;  4QU7 A;  4L76 A;  5GME A;  1RIS A;  4C6A A;  5KFE A;  4JI4 F;  1WNE A;  1R8A A;  3DLB A;  4RW8 B;  5KG5 A;  4E2F B;  1T03 B;  1RWX B;  3EDR B;  2XI2 A;  5HRO A;  1IM6 A;  2CNO B;  3SFU A;  1EKS A;  2APO A;  2WVF A;  1NU4 A;  4MIA A;  9ATC B;  2XLJ A;  4DV1 J;  3CCE S;  1NKC A;  2VQF J;  4DSJ A;  4N8N A;  4JI7 J;  2PII A;  3R2D J;  3GR1 A;  2GFF A;  1W2I A;  2E5G A;  3QIP B;  1IUJ A;  2MB0 B;  2R7S A;  4K4S A;  3K5N A;  4YR2 A;  2R7V A;  2E9T A;  1QE1 B;  4LF5 F;  3DGP A;  2VPZ B;  3A3P B;  1VQP S;  2ASD A;  4FDF A;  3ZXW A;  1IR1 A;  2O5D A;  2GZO A;  3BR9 A;  3MD3 A;  2GML A;  3C46 A;  3MPY A;  3CCV S;  2IA6 A;  2R7Q A;  3GPA A;  5C24 A;  3OL9 A;  1S76 D;  3EIC A;  4CH1 A;  2GV1 A;  2HWT A;  4L72 B;  2QLW A;  3KK1 B;  2OI2 A;  4NL5 A;  4ZCL A;  5F8G A;  4K59 A;  3KHL A;  4QZV B;  2OEJ A;  5B0G A;  2OD4 A;  1AFI A;  1PAE X;  3ZZP A;  5CYM A;  3CD7 A;  4ITS A;  1S7H A;  1T9Y A;  1HW9 A;  2KYX A;  4IFY A;  5EUH A;  5J2M B;  1KTV A;  3I96 A;  2FJV A;  4C8Z A;  2LQ9 A;  4JV5 J;  4UUW A;  2N7Y A;  1QY7 A;  4ZPC A;  1GXL A;  3ZZT A;  2R8I A;  4F8R A;  3JSR A;  3FFI A;  3FEY B;  4NLO A;  3JAM U;  2HQ3 A;  3CT9 A;  4U96 A;  2QA4 S;  1U1N A;  1UA1 A;  2N4D A;  2QO3 A;  5KFC A;  1K47 A;  2LDY A;  2QMX A;  1VQ8 S;  1FE4 A;  2KZM A;  2CKW A;  3TEG A;  4K0K J;  2XBP A;  3ZTO A;  3BDP A;  4LJM A;  3GCW P;  2HVZ A;  1NK7 A;  1A9N B;  1DTQ B;  5B0B A;  5HL7 Q;  2IMO A;  4L3K A;  1VIX A;  1Q8I A;  2DNZ A;  2NYI A;  2W1B A;  2HUR A;  1CC8 A;  3FKB A;  2MQO A;  5BR8 J;  3BEG B;  2W7P A;  3G6Y A;  3DYA A;  3E01 B;  1GX5 A;  1UEK A;  3HVT B;  3QWU A;  4OQJ A;  3BN4 A;  4RW8 A;  2YKO A;  4TLR A;  1T9U A;  4I64 A;  1AB8 A;  3KJF B;  2QT7 A;  4X64 J;  1XNQ F;  3KNA A;  2YX1 A;  4FP9 A;  3IO1 A;  1ZM4 A;  2XHW A;  2B4V A;  1XMQ J;  1TKD A;  2ATC B;  3MCM A;  1WC3 A;  4TLQ A;  3GIJ A;  1G7C B;  1XER A;  3MEC A;  2HLU A;  3IAS 9;  1Q8K A;  4P6Q A;  3TX0 A;  5KFQ A;  1ZTW A;  1VBX A;  2QSF A;  4FBU A;  1PC5 A;  1DTT A;  2JLE A;  4F36 A;  1GMU A;  2VG7 B;  1PGZ A;  3D7S B;  3MR6 A;  1WHX A;  2HND A;  3F0N A;  3BQ2 A;  4I6Y A;  1TL3 A;  2B6A B;  2XSJ B;  1RHJ B;  4WE1 A;  3H4D A;  3D6H B;  3DRS B;  3ZTP A;  5KFZ A;  3D68 A;  3W7B A;  2BEF A;  2CJX B;  2Y1J A;  1TL5 A;  4PWU A;  2ZH7 A;  4FF1 A;  1UFL A;  2NUU G;  3HM9 A;  3NBP B;  2MHE A;  4CP5 A;  4NLX A;  4B9L A;  1ACM B;  2VH7 A;  4ECU A;  3G8T A;  2VPY B;  3W66 A;  1EB0 A;  2YKP A;  5IWA F;  3VAL A;  3NMR A;  2MYF A;  3QLH B;  3D1O A;  1U2R A;  4V19 X;  3QRP A;  4N5S A;  1YVF A;  4NYZ A;  2C3M A;  2F63 A;  5C42 B;  3PKM A;  5E3P A;  2XTJ P;  4L6V 3;  4LRA A;  1FX4 A;  2DIS A;  3MEE B;  3ZFV A;  4RNM A;  3MF5 A;  1Y10 A;  1NHK L;  2C3U A;  2WVC A;  2DNK A;  3DLK A;  3SCK E;  4B08 A;  1K1S A;  1RU2 A;  5D4P A;  2B3T B;  3HVR A;  1N36 J;  4UZB A;  4J7C A;  2DHG A;  2ZC4 A;  3T6J A;  2R2T A;  2CQP A;  1HQU A;  2UUC F;  2KRB A;  4PQU A;  1UJ6 A;  3K58 A;  1X5T A;  1H3D A;  3KJV A;  4MIW A;  3PJ9 A;  1UAW A;  2MKK A;  3MPD A;  1URN A;  2FVC A;  1JLG A;  2OAU A;  3BGR A;  1HR0 F;  2H65 B;  4JI1 F;  3Q8S B;  3TAN A;  2K3I A;  2AYB A;  4ID5 B;  4RUA A;  4NCA A;  1JXE A;  5F0W A;  3EPI A;  4DR4 J;  2HSE B;  2P5V A;  1RBA A;  1HNW J;  3ZTR A;  4E0D A;  4YUD A;  3CSK A;  4CDI A;  1Q5Y A;  4XIU A;  1EIY B;  2QRR A;  3BBC A;  4GC6 A;  2W4D A;  3DRP B;  3JTN A;  1WKL A;  4Y3C A;  4ED4 A;  1XMB A;  3CDU A;  5J2Q A;  4OV1 A;  3MAA B;  3IN5 A;  1TMJ A;  4CZC A;  2PA8 D;  4FYD A;  1QAI A;  1QSL A;  5HAO A;  2ZH1 A;  4DUZ J;  3MMJ A;  1DJ0 A;  2EFP A;  4DSE A;  3DDN A;  4NXM J;  1RXO B;  1WJ9 A;  2DR6 A;  2RRB A;  4PAA A;  3C15 B;  2DXE A;  1TP7 A;  2IHR 1;  1KD1 T;  1LEO A;  1ARO P;  3PX0 A;  4MFB B;  3V6D B;  2VB6 A;  4H54 A;  3OUY A;  1YJ9 S;  3MM9 A;  4M5L A;  3KHH A;  2QJ3 A;  1H2V Z;  2ILZ A;  3H42 A;  3KJQ B;  4ZK7 M;  1RGV A;  1T7P A;  2F65 A;  1VQL S;  1GTE A;  4IR9 A;  3BM7 A;  4DL6 A;  3PVX A;  1VBK A;  2MZJ A;  1TVR B;  4C11 B;  2HPU A;  4P52 A;  1YBA A;  4WK3 A;  4Y2C A;  1RAJ A;  4YS2 A;  1Y3J A;  3D54 A;  2NYH A;  4ATN A;  2GAG C;  3DLG B;  5A6P A;  4ECV A;  4JV2 A;  1H7W A;  1RE1 B;  3IAM 9;  5L38 A;  2XYH B;  1RT3 A;  3M8S A;  2DH8 A;  3KK3 A;  3HHL B;  3PYF A;  4LSZ B;  2P9E A;  4WFA Q;  1JK9 B;  3JSB A;  3MM8 A;  1FD8 A;  5J1N A;  2CPX A;  1EX8 A;  1X4E A;  2KJV A;  1X9M A;  2BVZ A;  1S77 D;  3OXL A;  3NNC A;  2M0G B;  2E5J A;  3DLE A;  1NK6 A;  4OYA A;  4CRJ A;  2I9S A;  4QBU A;  2Y1L B;  1UA0 A;  1M5P C;  4ZVQ B;  3TAQ A;  2VFS A;  2O3D A;  4RUC A;  1AT1 B;  2DR5 A;  3HD2 A;  3VQT A;  1WEX A;  2CVI A;  4AMO A;  1SC6 A;  3CED A;  2DO0 A;  4LFB F;  4C8L A;  4RUB A;  3G6V A;  3DNC A;  3MXH P;  4I7F A;  4J9P A;  3M2V B;  4FYW B;  2HFN A;  4ZHR B;  5I4M A;  5ETR A;  3G71 S;  1TK0 A;  4KPY A;  4LF8 J;  2XMM A;  4USH A;  3OBI A;  1TL7 A;  3RW7 A;  1I94 F;  2IVM A;  3NL0 A;  1NHV A;  3P45 B;  4U8Y A;  4NYO A;  3UDV A;  1B7Y B;  5DQG A;  3QFH A;  4BWJ A;  5GAG U;  5F8L A;  2DGQ A;  3MR5 A;  3MPU B;  4DS5 A;  2B4U A;  1N56 A;  5ETK A;  2G2Z A;  4HAC A;  2AMC B;  1S99 A;  2ZVS A;  3DDI A;  4KFB B;  4NLS A;  2VFR A;  4OX8 A;  1Y9O A;  4DV2 F;  5K8N A;  3PO5 A;  1G1X A;  1XMO J;  3H8Y A;  3M8W A;  5D0R A;  3NRB A;  1WOO A;  4FKY A;  4W90 B;  3CC2 S;  3H20 A;  1BQM A;  2WCX A;  4CM0 A;  1HI8 A;  4NOH A;  2ZJR Q;  3MMC A;  4BS2 A;  4A8W A;  5JUM A;  4NAS A;  3NNH A;  5M2R A;  4B9U A;  1O5J A;  5BYQ A;  2JC1 A;  4NZ6 A;  1T02 A;  5AT1 B;  2MKI A;  2M8H A;  3IRX B;  2Y1R I;  4GVB A;  4ZPV R;  2E1P A;  3GIR A;  3KKF A;  3N4W A;  3PV8 A;  4P7T A;  5I42 A;  1X5S A;  5C5J A;  2LXI A;  4ZVG A;  2B8P A;  2P6T A;  3H2V E;  2ZH5 A;  3NLC A;  2QA4 G;  3KJV B;  1TEL A;  4F26 A;  1IVZ A;  1FVS A;  2NZC A;  5ETP A;  5H1S V;  3VAM A;  2AYM A;  2WSE C;  3CW2 C;  1RTD B;  3JAM Y;  4ZHR A;  3D66 A;  4ID5 A;  4DFK A;  3MR2 A;  2XB2 D;  1G3O A;  2YNF A;  1I3O B;  2ZH6 A;  5HVG A;  2VG6 A;  4F2S A;  1TU0 B;  1T9W A;  4DV4 J;  3CCM S;  1HD1 A;  1KOH A;  3M2R B;  3RR8 A;  3DRR B;  1YJN S;  2E9Z A;  1T9T A;  4ECS A;  3CIM A;  2DEI A;  4EWT A;  1U1M A;  3BGU A;  3ISN C;  3EYZ A;  1SI9 A;  4NRT A;  4LRD A;  3WQP A;  4ZLL A;  3HFK A;  4QOT A;  5KT5 A;  1NAQ A;  1UEU A;  4KHP F;  1RKI A;  3BO4 A;  2K8G A;  5FJ4 A;  5HP1 B;  2BQR A;  5LJ5 Y;  1SH0 A;  2GQC A;  1CEZ A;  3W8P A;  1Q8B A;  4KGM A;  3KG4 A;  5FD1 A;  1BQM B;  2R8G A;  1G2E A;  2A1B A;  2AGP A;  3OUY B;  1RZM A;  2NXE A;  4KH1 B;  1QSS A;  3CCZ A;  3N6N A;  4P75 A;  4ZVP B;  4U7C A;  3DRX A;  2ZBI A;  1Q7Y T;  1C1C A;  2Y3Y A;  4URQ U;  3VCD A;  4X4Q A;  1QUV A;  4AT1 B;  4ZLP A;  4UQG A;  2V94 A;  3SMZ A;  1SKR A;  1C0T A;  3C6U B;  4H4O B;  4OI3 A;  3MUR P;  4HKQ A;  2L41 A;  2XMW A;  2ZOM A;  1KQS R;  4WP3 A;  5KFM A;  1D1U A;  5DLF A;  3OTO J;  3SBM A;  4FF4 A;  5JVH Q;  2GC8 A;  2XGP A;  2HHU A;  8RUC A;  3CCW A;  1PYS B;  1N54 B;  1Y3K A;  2E7V A;  2J9D A;  2W24 A;  2YWG A;  3M6V A;  3UFC X;  2YTC A;  5MAO A;  3N28 A;  2CQC A;  3KJN B;  5CAB A;  2G1D A;  3CE8 A;  3KTQ A;  3DN9 A;  2LEC A;  3MMA A;  2G2O A;  1IKY B;  1IJF B;  4ZMM A;  2XO7 A;  2LA6 A;  1IBM J;  3RBD A;  3LPY A;  4JI3 J;  2MZS A;  2Q79 A;  2JOQ A;  4RW9 B;  1SQF A;  3BV8 A;  4YR3 A;  4DG1 A;  1JB0 C;  1DZ5 A;  3LH2 S;  4X65 F;  4MKB A;  3OSN A;  1WF0 A;  4DS4 A;  3ETM A;  2ZVI A;  1Q5V A;  4LQ3 A;  4U67 Q;  3GJT B;  1D9F A;  1N34 J;  5SZT A;  2CQ1 A;  3OR2 B;  4WTO B;  1RU1 A;  3CDE A;  3M2R A;  2Z2L A;  3NY0 A;  3RTV A;  1UWB B;  2N4C A;  1FJG J;  1QAY A;  1FKO B;  4F7V A;  3ICL A;  2IJF A;  2DBB A;  5CYM B;  3OTE A;  4OLO A;  4LRC A;  4MYT A;  5GVQ A;  2MXY A;  4ECT A;  3P49 B;  1S0N A;  4DL5 A;  2CPY A;  1VQY A;  5HBM B;  1XNR J;  3OTD A;  3S01 A;  3QLH A;  7FD1 A;  1S1W B;  1GFW B;  2VPX B;  3KK1 A;  3ZZO A;  2VV5 A;  2B4O A;  2FUG 9;  4DPO A;  1VHF A;  1D9D A;  2RU9 A;  4CO3 A;  2IM0 A;  4TQR A;  3BSN A;  2J9C A;  4J9N A;  4DV6 F;  1U8S A;  2ZJQ Q;  2BUN A;  2W2P P;  2HNZ B;  2FJB B;  3KLV A;  3GON A;  2PI5 A;  2JZ5 A;  3RBX A;  2MQP A;  2M52 A;  2YKM B;  4CO1 A;  2F3J A;  4B3R F;  4GKJ F;  5T7L B;  2XZW A;  2WHO A;  4DN0 A;  3V6D A;  2D3Z A;  2XWX A;  3LGN A;  2RIL A;  1BWV A;  5IC4 B;  3U02 A;  4WFN Q;  4RNF A;  2M8D B;  4O3R A;  2K7J A;  2IA0 A;  5F9L A;  1BMQ B;  3L7O A;  4O3N A;  1HYS A;  1R0A B;  2PT0 A;  2RAQ A;  3TZW A;  2H51 B;  3CTR A;  5DET A;  2DNH A;  1TK5 A;  2IRU A;  2VBW A;  4GO5 X;  1VQ4 S;  4ZVU B;  4DF4 A;  4P2X A;  3TJ8 A;  1L3U A;  2GQQ A;  4DQS A;  1WOP A;  3Q89 A;  5L9X A;  2C3O A;  1RWP B;  2B9E A;  2Z8Q A;  3IP0 A;  2RF2 B;  3RB4 A;  4ECR A;  5CD4 A;  4OYZ A;  2BAN B;  2AHO B;  1M1H A;  4L73 A;  4NEY A;  5CCL A;  1D9A A;  1HQU B;  1LNQ A;  1SH2 A;  3EGW B;  1A6L A;  4WPA A;  4B9N A;  1J5E J;  2Z4P A;  2R7T A;  3I6P A;  3TOQ A;  1PSD A;  1IN0 A;  2EG1 A;  3A13 A;  4B3T J;  1HNI B;  2HBY B;  2AIR B;  1W2B R;  2E5H A;  4CO2 A;  5IQQ A;  2DNL A;  3BGR B;  2E1R A;  4HT5 A;  4NLG A;  1H73 A;  2Z2Z A;  1RHR B;  4DPX A;  3MPV A;  2H1Y A;  2HS4 A;  2V8G A;  1BQN A;  4CO0 A;  2AYG A;  4NLD A;  2V9W A;  2FHO B;  2CPI A;  1VJQ A;  2K3K A;  1HBN A;  2KT5 A;  2XNQ A;  3TUI C;  4ECW A;  4GRS A;  1U1L A;  4WU3 A;  1WOR A;  4DU7 A;  3UDC A;  3QT6 A;  4DQR A;  2FGC A;  4XAK A;  1Q95 G;  2M7S A;  4DCP B;  1S1W A;  2DIV A;  1FRL A;  4X4U A;  2V69 A;  2MST A;  3J7Y U;  2VZ9 A;  3Q24 A;  3HKW A;  5KT3 A;  2X3D A;  5J2M A;  2P8I A;  4NLQ A;  5KFA A;  1OSD A;  2WON A;  1NM2 A;  2ZHO A;  3CNQ P;  3KWM A;  4N47 A;  1SJQ A;  1X0P A;  4NEZ A;  2EG2 A;  3VVT A;  1KNZ A;  1R8C A;  3FFI B;  5LMN J;  4MIB A;  3V4I B;  4ED1 A;  1V6H A;  1U1Q A;  3NGU A;  1FDA A;  4KIA A;  4IO1 A;  3OW2 R;  3K89 A;  3Q8U A;  4JI0 J;  2CWX A;  5KOX A;  2XS7 A;  2UUA J;  1HWK A;  1OS5 A;  3H25 A;  2VOP A;  4HTI A;  1S48 A;  4ZP8 A;  2ZBR A;  4AL7 A;  1C4C A;  1DBD A;  2NZ4 A;  5KG7 A;  2BAB A;  5KFF A;  1IBL F;  2KB2 A;  4MKV A;  3B6B A;  5B0D A;  1HBU A;  2I0X A;  2WW8 A;  1NO8 A;  2CZ4 A;  3GCX P;  1PG5 B;  4JBC A;  3AY0 A;  4Q2M A;  5HJX A;  1LWX A;  3JTO A;  2MKJ A;  3THT A;  1X9S A;  2BW2 A;  4LF7 J;  2VQE F;  2ZZM A;  4X66 F;  1SL1 A;  4URS A;  4P73 A;  1T03 A;  3UWT A;  4QYZ K;  1N5Y B;  3NOG A;  4MT1 A;  3FBF A;  3T1H J;  2ASL A;  1NK8 A;  4UQT A;  4NLW A;  3GR0 A;  3I82 A;  3CJT A;  4QIE A;  3H40 A;  5DGB A;  1EHW A;  4A8S A;  4K4W A;  3CJ5 A;  3DI6 B;  4Y28 C;  1XTZ A;  3BSA A;  2WVE A;  4DPW A;  1WEL A;  1HBO A;  1PIL A;  3PNI A;  1RK8 A;  1EET B;  3D1H A;  3KUH A;  4TVA B;  4Q5V A;  3QNW B;  1WTF A;  1HNI A;  4R0E A;  1C0U B;  1VQS A;  4O3O A;  2V8D A;  5EGY A;  5C25 B;  1KLM A;  3RRG A;  2OSR A;  1SKW A;  4C4W A;  2V67 A;  4Q44 A;  1S6Q B;  4ZPT R;  4U7U K;  3W2W B;  1KBR A;  2KN4 A;  4EYI B;  1VHI A;  2GNK A;  2XWY A;  3HHE A;  3RRH A;  2MZR A;  2CQ3 A;  1EET A;  3IG1 A;  1KP6 A;  2EWH A;  2D9P A;  3RAM A;  2KDO A;  3VGT A;  2W01 A;  3MM6 A;  4A47 A;  1MU2 B;  1ZA1 B;  4NCG A;  4P72 A;  1LFP A;  1S6U A;  4JP8 A;  4CLL A;  4C2M A;  1NSQ A;  4IUF A;  4WIQ A;  3W9I A;  5D3G B;  2MQ8 A;  3DOK A;  2DHA A;  4I6A A;  4F0M A;  4J9R A;  4DR5 J;  4IR1 A;  2HNZ A;  2XLI A;  1QSY A;  1FDD A;  2VBZ A;  2V9K A;  4HT7 A;  5T7L A;  1VGY A;  4ZIV A;  4R5P B;  4JYA F;  2JX2 A;  1UPM B;  1O51 A;  3PXG a;  2ZDO A;  2EFO A;  2ZKT A;  4CO5 A;  3K17 A;  3I4P A;  4K5S A;  2HS0 A;  2QN6 B;  2J6T A;  5F41 A;  3DRY A;  3DKD A;  3GFZ A;  5LMU F;  1RAC B;  1HNZ J;  3O8W A;  5F8H A;  1RTJ B;  4OYI A;  4ZP6 A;  1RTH A;  1RT6 A;  2E5L F;  1P27 B;  4NCB A;  4R5P A;  3ONQ A;  3I9V 9;  1RAE B;  4X4V A;  3L95 X;  4JI8 F;  3WC0 A;  2IM2 A;  3MR7 A;  3CMA S;  5IS2 A;  2IM3 A;  4P10 A;  5GAH I;  1K44 A;  1Y5L B;  1H38 A;  2VG5 A;  5LSL A;  2IDL A;  5F3T A;  2J6U A;  2HFS A;  4K7Q A;  2ZEJ A;  4DV1 F;  1DQ9 A;  4WII A;  2DHS A;  2VFU A;  2UXB F;  2FQQ B;  3DU5 A;  3N79 A;  2BMB A;  4ZLJ A;  1MN9 A;  2VQF F;  3ZZR A;  1VRU A;  1U02 A;  2G0J A;  3OXG A;  2VJV A;  1FD2 A;  1LXJ A;  1NK5 A;  2QMU B;  3ZO7 A;  1YWX A;  3OR2 A;  5F8M A;  5IM0 A;  4ZJQ A;  2BAC A;  5E5N A;  5JVG Q;  2RDD A;  3MOZ A;  4TN2 A;  1S72 S;  4YB1 P;  4OI2 A;  5E7O B;  1B70 B;  2OMO A;  2K2P A;  5DGA A;  3GV7 B;  3T3F A;  3I31 A;  4LQ9 A;  3PIP Q;  3SV4 A;  1M1K T;  1XR6 A;  2Q6C A;  2RKI A;  3DLH A;  2MKC A;  2QTW A;  3IR7 B;  2O01 C;  2JNJ A;  2GCF A;  5BJR A;  4OYP A;  1J5O A;  3PW4 A;  3L4B C;  1FJE B;  4F4Z A;  3CJS A;  2J7W A;  4OJG A;  3UDE A;  1XEZ A;  2AGO A;  4WZM A;  1B0P A;  3FSX A;  3VGV A;  4JI5 J;  2KH9 A;  5L1L A;  2QGF B;  2RML A;  4LSL B;  3D1Q A;  4QWA A;  4ANE A;  1UWA A;  2DGS A;  3G87 A;  3D6F B;  3ZZU A;  1REV A;  3U1M A;  2IDE A;  1LQ9 A;  4RR5 A;  3W2V A;  2RUG A;  1UEV A;  2Y0B B;  3DOM A;  1U1R A;  1S0V A;  1SB6 A;  2GHW A;  1U2C A;  2UXC F;  2KO1 A;  3MR3 A;  3IBF B;  1FRX A;  2E66 A;  2OEL A;  5LXY A;  4KYZ A;  4IFV B;  2AEJ A;  1F9E B;  3UD5 A;  3HSG A;  4GKK J;  4BHQ A;  3J7A N;  3MI7 X;  3N6L A;  3H0P A;  4PG5 A;  4RNH A;  1TV6 B;  3SSR A;  5KFJ A;  5BR8 F;  4ERD A;  4ICL B;  2W7A A;  4WYL A;  5L1J A;  1NDL A;  3IWL A;  2VG5 B;  4J9L A;  2FPH X;  3F41 A;  2ZM6 J;  1WC6 A;  5K8P A;  5E3Q A;  1TMM A;  3J7A 1;  1ZH5 A;  3J81 U;  1RWW B;  2DNO A;  3UN3 A;  1FTR A;  2LVW A;  5B08 A;  2HIQ A;  5DG8 A;  3UCZ P;  2XMV A;  3M4X A;  2PE8 A;  5IXU A;  1IBK J;  1N5V A;  1KQG B;  5KFI A;  2ZH4 A;  2BA9 A;  4J9Q A;  1QAJ A;  1H74 A;  1I1G A;  3QRR A;  1QAX A;  1WDD A;  4EO8 A;  2IMW P;  4KHM A;  3QSY B;  4CNY A;  3HFV A;  2LP4 A;  2GVD A;  2NRE A;  2DNM A;  2HHT A;  2Q6B A;  3M8Q A;  3UNG C;  4QU6 A;  5A8K B;  2ZH8 A;  2BJ8 A;  2JLF A;  1UJ4 A;  2VKZ G;  4USV A;  4EU0 A;  3GFH A;  4HH0 A;  1F0X A;  4WFB Q;  2HMI B;  3RAQ A;  4NI2 B;  4KFB A;  4UT4 A;  3PEJ A;  4RNN A;  2Z30 B;  4IH6 A;  1TTH B;  2DVI A;  1EP4 A;  3LQV A;  2R8H A;  4ZN3 A;  1LFW A;  1CQM A;  4H4M A;  1X8D A;  5KFS A;  1CJT A;  1N48 A;  4DR1 J;  4OX6 A;  4WFX A;  3KYL A;  1S9E A;  1Z1Z A;  4RJV A;  1HNV B;  2AZ3 A;  1FWL A;  4NML A;  5ETN A;  3BBF A;  2EFQ A;  4RLE A;  4DXL A;  2AW0 A;  1BC6 A;  1PJ6 A;  1RWU A;  2E1A A;  3NWR A;  3J80 Y;  3TX8 A;  2UUC J;  1P9Q C;  2DT9 A;  5GAH U;  4TYB A;  2FC9 A;  5J2P A;  2ACM A;  1GEH A;  1NDK A;  2E1C A;  2X51 A;  3H5Y A;  3KOA A;  2YNH A;  3GSD A;  3GJS B;  3E51 A;  4BBY A;  2D3O R;  2GGP B;  3W3S A;  2YKN B;  2RDJ A;  3AOD A;  4JV0 A;  4QCL A;  1IKV B;  4JI1 J;  5K8O A;  1D3W A;  1MLA A;  4XTT A;  1VR6 A;  4PXB A;  4DR4 F;  3R97 A;  5J1E A;  4BC7 A;  3S8S A;  1OSC A;  1VRU B;  1OJ4 A;  1SC3 B;  1RAF B;  1ZA2 B;  2M9K A;  3D3C J;  2CQ0 A;  2E7X A;  3DLE B;  1NPP A;  2BJ1 A;  2UUT A;  3QT8 A;  3HHK A;  4ECQ A;  2LEB A;  1UVM A;  3HP6 A;  1UWB A;  4OV6 A;  2HBZ B;  4QW9 A;  5J1E B;  4XO0 A;  2WOM A;  5AE2 A;  1BHN A;  2DNP A;  2OPP B;  2OEK A;  4FYY B;  4M5D A;  4DUZ F;  1VQ6 S;  1S1U B;  3CJQ A;  4ZP9 A;  3K5M A;  1JJC B;  1S1T B;  4EMD A;  1NK0 A;  2KZZ A;  2IAJ B;  3VR1 A;  1NUE A;  1TVR A;  3W60 A;  2LYV A;  4O44 B;  4RKU C;  3VAK A;  4KAI A;  1S4E A;  4ZIT A;  1RQ0 A;  4YY3 F;  5GAD U;  4IG3 B;  2OFG X;  3SCJ E;  2CQG A;  5K9F A;  1VBZ A;  2Q3P A;  3CWJ A;  3MDF A;  3K0J A;  3I0S A;  4N77 A;  5KFP A;  2ZUA A;  3W1Y C;  4O4G A;  4MFB A;  3CD5 A;  1JLB B;  3CJ3 A;  4QWC A;  3W2V B;  1X5P A;  2DD8 S;  2EKN A;  3MZI A;  4FF3 A;  1MNE A;  2RHQ B;  2VFV A;  2P2C B;  4PXE A;  1NPK A;  1YHQ S;  5IT9 U;  1UW9 A;  2V2K A;  4DMZ A;  2DGX A;  3NKY A;  4IFV A;  4I0W A;  2W2N P;  5DG7 A;  1WSV A;  1R3N A;  2CJY B;  4O0I A;  5GAE U;  1U4B A;  3OVB A;  3BR8 A;  4IG0 B;  3T6B A;  2NQP A;  2G0I A;  5LL6 d;  1S1V B;  1Y5I B;  3G2X A;  6AT1 B;  5KFB A;  2AQ4 A;  4RO0 A;  3CDW A;  4IOB A;  2DEJ A;  5D4O A;  1C0U A;  2OP5 A;  3UQS A;  4CYU B;  1W7W A;  2IJN A;  2M88 A;  4I7F B;  1B7F A;  4ID8 A;  2BJE A;  2LU2 A;  4OZ3 A;  3PAC A;  1E6V A;  1RA6 A;  3GG1 A;  3PW0 A;  5D0E A;  2ALZ A;  4Q45 A;  2BQU A;  3R7B B;  4IOA Q;  2BM0 A;  3RG6 A;  5L1K A;  2YKQ A;  1GH8 A;  3PY8 A;  3V81 B;  1VJW A;  4OI4 A;  3DRR A;  4OZN A;  5AJ3 J;  2QE5 A;  4MKY A;  1LW0 B;  2XG8 A;  1DY3 A;  4Q8E A;  1XN9 A;  4FVM A;  1AYE A;  1SIW B;  3A8J A;  3Q8Y A;  4M5I A;  4JI6 F;  2CYY A;  3WDO A;  3TAM A;  4OHY A;  4DPT A;  4LF2 A;  3KG1 A;  2KHD A;  4A8Y A;  3BSO A;  1B4S A;  1I94 J;  2CPE A;  3R9L A;  2CQ2 A;  3M8P B;  1N0U A;  2DGO A;  4DL3 A;  1S6P A;  2L08 A;  2YNI A;  4NA1 A;  5A8R A;  3T5J A;  2AX1 A;  3EE3 A;  3H5S A;  2YXL A;  4OIX A;  4USW A;  3PIO Q;  4ZVH A;  4ECX A;  2KFY A;  1LK7 A;  4M94 A;  1QJH A;  5EN1 A;  4PXD A;  1RCO B;  3MMB B;  5LSR A;  3ET6 B;  1N4L A;  2Y8W A;  2R7U A;  1PAU B;  1NSP A;  3NG8 A;  4Y2I A;  1ZM9 A;  3BF4 A;  2YWK A;  1NSA A;  2EBE A;  4DR2 F;  4LBI A;  3C66 A;  2HQD A;  4YDX A;  1NKE A;  4ED8 A;  1C1B A;  1NJZ A;  4UY8 5;  3EZO A;  4OHX A;  1CQN A;  1UFK A;  4B17 A;  3H4B A;  3BQ0 A;  2XGQ A;  5H9E J;  3BSC A;  1FK9 B;  5B0F A;  4NLP A;  4RNO A;  4LF6 F;  4LSL A;  4PEO A;  5CZD A;  1CUL B;  1HMV A;  2CJ9 A;  3BKT A;  3LTO A;  5KAK A;  3RJM B;  4IRC A;  4FYV B;  2IC3 A;  5I3U B;  5EWF A;  1CJU B;  4DX7 A;  4DUT A;  3JTP A;  3OFH A;  4HHH A;  4DFJ A;  3V6K A;  4K4T A;  3PRB A;  3G6E S;  2MQL A;  4ER8 A;  3DGP B;  1ZYQ A;  5D0G A;  1XK8 A;  4DSI A;  1UTA A;  1HQE B;  1U6B A;  5GAE I;  4F25 A;  2FHJ A;  3BJY A;  3LO3 A;  1HWJ A;  3C8Y A;  3ZTS A;  4DUY F;  2JEJ A;  1R8P A;  2FY8 A;  3W2W A;  3HVA A;  1XR5 A;  3AOB A;  1BQX A;  3AQO A;  1TL7 B;  1XBW A;  3ILO A;  4DZ6 A;  4TQS A;  1ZTT A;  1SQG A;  4EK2 A;  1U7L A;  3G86 A;  4TNO A;  2M2B A;  1F2G A;  4LRF A;  3FZB A;  4BDP A;  2J0X A;  1K0T A;  1Q7L B;  2CNK B;  3MWB A;  1NB2 A;  2OKQ A;  4WU2 A;  2XCA A;  3CCU S;  1YRU A;  2OML A;  3M2V A;  2QLJ B;  2V5H G;  3KFW X;  5F8I A;  1GK8 A;  1M5O C;  1KLN A;  2FGO A;  3CME S;  3GYX B;  3KLF B;  1S9G A;  1JLQ B;  1RT2 B;  4DZD A;  3OL6 A;  3KMQ A;  1KFD A;  3P5T L;  2VF3 A;  2AJ2 A;  1FA0 A;  5A8K A;  2DYA A;  1TKX A;  1RT7 A;  2D3U A;  4PWW A;  3SCL E;  5IV3 A;  2AT1 B;  4NLT A;  5LT5 A;  5IM0 B;  3FQK A;  3NXZ A;  2HEK A;  2HZC A;  1WAC A;  1SH3 A;  1FRM A;  1UCN A;  2QA2 A;  1YSJ A;  4PWD A;  1NLK L;  2X1A A;  1R0C B;  1WHV A;  3FSI A;  2CUY A;  3DHX A;  1M5H A;  4UST A;  5D0H A;  5DRK A;  2XS5 A;  5HQM A;  1FES A;  3D5M A;  2IC3 B;  4PAB A;  3TA0 A;  1P9Y A;  3P6Y C;  4WFY A;  3KXD A;  2OHD A;  2ZFH A;  2C3P A;  3C16 B;  4IFY B;  3OTO F;  2Z56 B;  3ENQ A;  1RHQ B;  4KB7 A;  4R0J A;  1FK9 A;  3TJA A;  4HI2 A;  4KHR A;  3KLG A;  3UD4 P;  4DWI A;  2HHH F;  5KG0 A;  2BOP A;  3MEG B;  1PBU A;  1IKX A;  2JHE A;  2VFT A;  3D6M B;  3PZP A;  2GIR A;  4KGZ B;  4OI6 A;  1B3T A;  4B3S J;  4ZOS A;  1PYT A;  3GIL A;  1MWZ A;  1RLD A;  4L75 A;  1IBM F;  2WVB A;  2RT3 A;  4FXD A;  2B0G A;  2LQJ A;  1KR4 A;  4C48 A;  2IBK A;  2JLG A;  3A8K A;  5BYR A;  2P9C A;  3RU0 A;  5LOQ A;  3EVM A;  1TK8 A;  1YBT A;  1OY8 A;  3MM5 A;  4ZPA A;  1U09 A;  1QTN B;  2OH2 A;  3BKU A;  3KLF A;  1SJ4 P;  2V68 A;  2ROG A;  1U8W A;  1TL3 B;  1HBO B;  2F40 A;  3T41 A;  2HW3 A;  4OI0 A;  3PTW A;  3WIU A;  1NRK A;  4ZLN A;  1EAR A;  3H98 A;  2R7R A;  3ULH A;  2NSB A;  1YIT S;  4OZ2 A;  5CZC A;  1WHW A;  1ZM2 A;  3SQG A;  1HBN B;  3PR5 B;  4DL2 A;  2A3J A;  4ES1 A;  4WTY A;  4J9M A;  5K14 B;  3RB6 A;  1VC6 A;  4I1T A;  2UP1 A;  1ZPV A;  4LRE A;  4DX5 A;  2KG0 A;  4AQY F;  4UY8 T;  2NXU A;  3ENA A;  2V4Q A;  5HMY A;  4HEA 9;  1LW2 B;  2HKE A;  2IVY A;  1KVJ A;  4QW8 A;  1FI4 A;  2CZ9 A;  2EXU A;  5L8R C;  4DV6 J;  4M95 A;  2DRD A;  3V4M A;  2EEY A;  1FT8 A;  2VA3 A;  5D78 A;  1RWV B;  2G9O A;  4Y34 A;  5DDO C;  1ZZN A;  3TQ1 A;  2HHQ A;  1FEH A;  4B3R J;  4AL6 A;  3OV7 A;  1LWE B;  1VYA A;  5DDP C;  2VOD A;  1LWC A;  1HKA A;  1S12 A;  1VCT A;  2IRX A;  1U26 A;  4ES2 A;  4JI2 J;  2DPJ A;  3AB2 B;  4J90 A;  4M8L A;  4M5N A;  2HWI A;  5K5M A;  3J81 Y;  3HPO A;  2HNY A;  1DQA A;  1VMB A;  2M4M A;  1I5O B;  1FXR A;  1Q53 A;  1EZZ B;  2QA1 A;  2W25 A;  3R3T A;  4J9V A;  3R7N B;  1CUL A;  1HMV B;  2PMH A;  3AAW B;  3C2P A;  3SDE A;  1OO0 B;  2BDP A;  1FFW B;  4RW6 A;  1FRI A;  4CLP A;  2X7I A;  1U25 A;  2LXF A;  4KSE B;  3D3B J;  5FII A;  1FVQ A;  5A0Y B;  5RUB A;  3VTI A;  2HNY B;  2OPR B;  1BY9 A;  2OPS A;  2GVZ A;  1J27 A;  1FXD A;  4QPT A;  3A1Y G;  2KRR A;  4RPF A;  4Z7C A;  3K5L A;  4Q0B B;  5B0E A;  2DNN A;  4DG1 B;  2VG6 B;  3C14 B;  4M63 A;  2G2Y A;  4A8K A;  3MHY A;  3QIP A;  3V5R A;  4A8Q A;  1U1K A;  1J5E F;  1ZPW X;  4N76 A;  4DPU A;  3R5J B;  3AJ1 A;  2RUS A;  1RHU B;  3QJL A;  3BH6 B;  4NPO A;  4DR7 J;  3L9Z A;  4ANC A;  2IY5 B;  4Q2L A;  2J7K A;  4ZP7 A;  3FCV A;  2HRY A;  4ENO A;  4NE9 C;  3LP0 B;  2UU9 F;  2YPY A;  3PX4 A;  5D77 A;  4F4W A;  2HAF A;  2RVJ A;  3FZ2 A;  4LBH A;  1JJ2 R;  2I2Y A;  3QGP A;  1RT2 A;  2FVQ A;  2X1F A;  1H2U X;  2ZKU A;  5CH7 B;  1WOS A;  3FK4 A;  3MM6 B;  4KKO B;  2XSF A;  1LK5 A;  5E3A A;  2RHS B;  3FMW A;  3ETO A;  3TVZ A;  1CJK A;  1Q78 A;  3PW2 A;  1YZ6 A;  4H4K A;  1R6Y A;  5KFK A;  2Y1I A;  1RB0 A;  2VIC A;  1HNV A;  1TUV A;  3OTC A;  2F7V A;  1PO6 A;  1C1C B;  4IQX A;  4LFC J;  4OJ3 A;  5ETS A;  2R7W A;  1N6Q A;  3H7H B;  5I3P A;  4ELT A;  2I5J A;  2ZUG A;  4H4O A;  4MK7 A;  4OJH A;  3WZ0 A;  3W64 A;  2QFJ A;  4AUK A;  4PCQ A;  5ETL A;  2UUA F;  4DCJ B;  2XO6 A;  2MSS A;  2CZV C;  4BC9 A;  1VK3 A;  2B5J B;  4Y00 A;  4X4P A;  1IBL J;  3VGS A;  1KSP A;  2PMW A;  1RT4 A;  3AQP A;  2MQQ A;  3H2U B;  4NRU A;  3S6E A;  2ROE A;  3H5X A;  4HR2 A;  4IOC Q;  2HYI B;  3TUZ C;  3M8Y A;  2VQE J;  4LF7 F;  2MPU A;  1KN6 A;  2C2K B;  4OL8 A;  3CDA A;  2RIJ A;  1KQF B;  3T1H F;  2C2D A;  3PFO A;  3IGV A;  2E5I A;  4UW2 A;  9RUB A;  2W2M P;  1T9X A;  3LP1 A;  2ZNZ A;  3QQC D;  2BX6 A;  1TKZ A;  1JQG A;  2AKW B;  1XC9 A;  3MCO A;  1OPZ A;  3PKY A;  3LAK A;  3NWG A;  5JXS A;  3PM9 A;  3MGJ A;  1T11 A;  1F3V A;  4JOU A;  4NZ0 A;  1SV5 A;  4YN3 B;  4AD6 A;  1LV5 A;  2P6S A;  2KFZ A;  4P9S A;  3NAI A;  1UZD A;  2F9D A;  2HQF A;  2YNF B;  1UVL A;  4DI6 A;  5DS7 A;  1PJ7 A;  3FBC A;  4ZVO B;  3M8Z A;  4WP8 A;  2FJA B;  1WUU A;  3QJJ A;  3G82 A;  2ASJ A;  4EI2 A;  3JSM A;  3EUN A;  2COL A;  3KMS A;  1BUX A;  2J8S A;  3DLL Q;  2POK A;  4A4J A;  1WF2 A;  3JQJ A;  2DCL A;  3VQS A;  4D3H A;  1YJR A;  1S9G B;  2DRB A;  2ZDP A;  3W61 A;  4WXW A;  4Q8F A;  3PR4 A;  5IFM A;  1AFJ A;  3GG0 A;  4GO7 X;  1Z2L A;  4JI7 F;  2QYG A;  4G65 A;  2XQC A;  4JYA J;  3EGN A;  3SCI E;  1TFW A;  5HMW A;  1CC7 A;  4HAC B;  4N41 A;  5J2N B;  3L7U A;  1I6J A;  1JKH B;  2AJ0 A;  2HQC A;  1S9E B;  2KXH A;  1ZAX A;  1ZET A;  4PUO B;  1HA1 A;  1GMW A;  1RAO A;  1GMV A;  2DCU B;  3ILJ A;  4UUX A;  1FNO A;  4F4X A;  1HNZ F;  3HHL C;  2HHW A;  2PA3 A;  5FLX Y;  1E6V B;  2ZBQ A;  1X4C A;  1REV B;  3OT9 A;  3QWP A;  4JI8 J;  1FRJ A;  3LWL A;  4H4K C;  2JSX A;  4P2F A;  4CLW A;  4DPY A;  4YEA A;  1P1T A;  2QYC A;  3NGK A;  5IC6 B;  2Z57 B;  2Q1L A;  3IS9 B;  1HBM B;  5CYJ A;  2ZIT A;  4A46 A;  2UXB J;  3M6U A;  5C2G A;  1Q1K A;  2CAJ A;  3TRG A;  4O23 A;  2B8Q A;  3M7V A;  5M2U A;  5A2Q Y;  2ZE2 A;  3DHW C;  2BW7 A;  3H90 A;  3RRK A;  3OJS A;  3EGV A;  3GYN A;  1RP5 A;  2LFV A;  2F4F A;  2RH3 A;  2NXC A;  3CD0 A;  3M9O B;  5HP1 A;  4TY8 B;  2RRA A;  2DPI A;  5HSP A;  2FYX A;  2LDI A;  3SZ2 A;  3ZZZ A;  5KFX A;  1RT1 B;  2U1A A;  2W9C B;  2CA9 A;  2JVO A;  2UUB J;  2L3M A;  5IT4 A;  1VRQ C;  1S1U A;  1DLO A;  4EZ9 A;  2GJI A;  4OYX A;  4DSK A;  4NXN J;  3MM7 B;  4ED5 A;  4HL9 A;  1CPZ A;  4IDK A;  2LEP A;  3SFG A;  5D4N A;  1YBU A;  2DGW A;  2EC2 A;  1RT1 A;  1GAO A;  1KKH A;  4PPD A;  1DAX A;  2FZK B;  5KT6 A;  2ZZT A;  3CIZ A;  1DLO B;  4LIR A;  3JS9 A;  2I1R A;  4JI5 F;  5D6G A;  5IV4 A;  5D15 A;  3H5U A;  4DR3 F;  4C8M A;  3GFY A;  2UZA A;  2YY3 A;  2L9N A;  4C8N A;  4UF4 A;  2HLT A;  2QX0 A;  4QPX A;  3UW1 A;  3MFH A;  3Q22 A;  3NAH A;  1KFS A;  2PN6 A;  3FDS A;  2R8J A;  2YWF A;  2I38 A;  4I2P B;  1APS A;  2UVR A;  4DLG A;  3EM1 A;  3HMJ G;  4AE5 A;  3P5B P;  4ICL A;  2UXC J;  4OHV A;  1HPZ B;  5E33 A;  4ZPB A;  3T9N A;  1EP4 B;  3QGH A;  2V50 A;  2F4V F;  2W9A A;  2H5E A;  1E6Y B;  3CJ4 A;  4GKK F;  1LWF A;  2G1H A;  1LWC B;  1N8R T;  1T0T V;  4PXC A;  2NPF A;  1SKS A;  3CJ2 A;  3LAL A;  4A8O A;  3NOC A;  1NZ8 A;  3CPW R;  1V3R A;  2J0W A;  4P2M A;  3M1V A;  4DQP A;  3PEH A;  3J80 U;  3RZA A;  2MDA A;  2ZM6 F;  3UO0 A;  5AE3 A;  2B7B B;  2PSZ A;  1LWF B;  2J9D E;  2W9B B;  4B9T A;  1AUD A;  1FRK A;  3IBC B;  1H98 A;  1XQI A;  2VPW B;  5CHC B;  4CLU A;  2H5I B;  1FKP B;  1NJY A;  4CT9 A;  2UXD J;  5E2Q A;  2H3E B;  2HRU A;  3NS7 B;  2N82 B;  2CQD A;  2FJW A;  3DYA B;  3E01 A;  4NYP A;  2VON A;  1IBK F;  2CQH A;  1A0O B;  2VUG A;  1RUS A;  1X31 C;  3VAH A;  3PG9 A;  3QAE A;  1R43 A;  4CH0 S;  5HMX A;  3D2W A;  1W26 A;  1LOU A;  2D3O 1;  1S6Q A;  2MQM A;  2VD3 A;  3FC9 A;  4ZVS B;  4PG7 A;  4CLS A;  3BGF A;  2HBR B;  1U6F A;  1WWH A;  2VJU A;  3VAG A;  1GQE A;  3AXM A;  5HK4 A;  3JSY A;  3TEH B;  2HIY A;  1RAB B;  3FNN A;  2VZ8 A;  2HZA A;  4DV5 F;  3G8S A;  6FDR A;  4URG A;  4KV8 A;  3OLA A;  5E3C A;  4NA3 A;  3SSQ A;  3BO2 A;  3MMB A;  4P7V A;  3K2Y A;  4I4B A;  3R5G A;  3GII A;  2QLB B;  5EHH A;  2ZH2 A;  4M5K A;  2ZBP A;  1WEZ A;  2E9R X;  2DH7 A;  3CXC R;  2CDR B;  3VHQ A;  2LXU A;  2NXN A;  1SIZ A;  3EPG A;  3MPW A;  8ATC B;  3V4I A;  2E29 A;  4C8O A;  4QR2 A;  2OD6 A;  2AWZ A;  2VDH A;  4ZJO A;  3EXY A;  2KHC A;  3DLG A;  4DR1 F;  2VU5 A;  4FYX B;  4RWX A;  1UP1 A;  2C2O B;  1RT3 B;  4LUB A;  4F4Y A;  2VC1 A;  3R6G B;  2YKN A;  1S0O A;  3E2E A;  2OPR A;  4I6W A;  2HK3 A;  3K59 A;  1UPP A;  3ELH A;  3NGS A;  1F60 B;  3TVY A;  2XYG B;  2GAH C;  5ITH A;  5GMD A;  4G3I A;  4G1Q B;  3TUJ C;  5L39 A;  2LKZ A;  3N5B A;  1K9M T;  4W4M A;  1U49 A;  2DHX A;  1EQM A;  2D1C A;  3IR6 B;  2YX7 A;  4TXS A;  4A48 A;  2KKH A;  1ITP A;  2MZT A;  2YWH A;  5KG3 A;  1JNZ B;  2NSC A;  2W8K A;  3EVW A;  3DFE A;  5DQH A;  4KO0 B;  4PG4 A;  4FS2 A;  5CAA A;  4ECZ A;  3ENW A;  3MEC B;  4DV3 F;  2XMK A;  3C15 A;  1KLM B;  2ATL A;  1N33 F;  1PIE A;  4MJK A;  1HL6 A;  3BYR A;  2ZHB A;  1SC4 B;  2MLY A;  1NEE A;  4QJV A;  4IQM A;  1UW4 A;  5HVH A;  2WTF A;  4LFA F;  1KVI A;  5G4D A;  3HF5 A;  1JLQ A;  1Y5N B;  2OSQ A;  3VAI A;  1HI1 A;  3N01 A;  3VWS A;  1WKK A;  2F1F A;  5F9N A;  1NB7 A;  1N6Q B;  2GW8 A;  5CCM A;  3CJ8 A;  3DRP A;  5IT9 Y;  2JRS A;  5C25 A;  3ITH B;  4AMN A;  3AOA A;  1F9H A;  3CO9 A;  4C97 A;  4OLP A;  1Q8L A;  4FF2 A;  1R0B G;  2H4Y B;  4YY3 J;  5KT4 A;  4K4U A;  2V2Q A;  3LW5 C;  2AJF E;  1VIS A;  5IOL A;  1VS3 A;  3TW0 A;  1YJW S;  3I5B A;  2HK2 A;  1WTB A;  3S1T A;  4CH7 A;  3GIK A;  3HLU A;  4ETX A;  1RA7 A;  4JUZ A;  2N7C A;  5K20 B;  4ILR A;  2JEG A;  3KK2 A;  5HMZ A;  2YKM A;  3CJ0 A;  4FNI A;  4PQU B;  2ZBC A;  4B02 A;  2OPQ A;  4C9D A;  2CNL B;  2PD1 A;  3AJ2 A;  4G1Q A;  5DG9 A;  1Q86 T;  5A0Y A;  3HI9 A;  1VQO S;  3IC1 A;  3TR5 A;  5JMN A;  2LCW A;  1X4D A;  2RS8 A;  1D0E A;  1RTJ A;  2XLK A;  3UVJ A;  2RQC A;  1FER A;  3OFE A;  3CCS S;  4K4Y A;  1S97 A;  3MEG A;  3TWZ A;  3EWG A;  4GVL A;  3HZE A;  3SDE B;  5DDR C;  3RAX A;  2MJU A;  3D0I E;  1JMT A;  4MH8 A;  1K73 T;  3T1Y J;  2KJW A;  4KR0 B;  3OPK A;  4PYA A;  5AXL A;  3KK3 B;  4K50 A;  1G4C A;  3F56 A;  3DOL A;  4ZJL A;  3UVJ B;  2OJ3 A;  1O6X A;  4CLZ A;  3VAJ A;  3ADA C;  4UTG A;  4C7Q A;  3JYT A;  1FWP A;  4LIW A;  4IKA A;  3LUY A;  1MSW D;  1TUG B;  1FCA A;  3PRV A;  2N3L A;  2RD5 C;  2VDI A;  3TVK A;  3LP2 B;  1JLF A;  3LGM A;  5AJ3 F;  2V8P A;  3MUM P;  3CUN A;  1M5V C;  2CXE A;  1NXI A;  2YH0 A;  3UCG A;  3ZC4 A;  4JI6 J;  1AA1 B;  4ZCI A;  2NLW A;  3H2L A;  3MM9 B;  4IRD A;  5GAG I;  3QFW A;  5K14 A;  3OVA A;  5H9E K;  1SJR A;  3D6T B;  1X9W A;  2K7K A;  2J7U A;  2NS1 B;  1TKT A;  4LF9 J;  2B51 A;  1PBA A;  3GLJ A;  3A12 A;  3N0V A;  3O3L A;  5DJB A;  2KG1 A;  1C4A A;  1FF2 A;  3ZZY A;  4F02 A;  3ITH A;  3BGL A;  2BV3 A;  1ULR A;  4PR6 A;  1L5U A;  4MTP A;  1O8B A;  3KDO A;  2IYG A;  3K8V A;  4LMZ A;  1WSR A;  4K2J A;  5ETQ A;  4PKD B;  1URR A;  2NUH A;  2VBX A;  1TKT B;  4DR2 J;  5GMK a;  4EFA C;  1FE0 A;  1HQ2 A;  4BWM A;  3CCQ S;  3PDN A;  1Y0H A;  1S1V A;  3PJW A;  2M3D A;  3E8O A;  1K8A T;  4Y2K A;  3PFE A;  3G96 A;  4RBT A;  1JNR B;  1U1P A;  2HFU A;  4FBT A;  1OYD A;  2X1B A;  4LF6 J;  5H9F J;  1VK8 A;  1NND A;  4RX6 A;  1KWM A;  2EK6 A;  2KU7 A;  1SJ1 A;  2J5A A;  4TKT A;  3QAT A;  1XJW B;  3AD8 C;  2DR7 A;  1XNR F;  4OZ0 A;  1C0T B;  3C6U A;  1KHV A;  1QD1 A;  3A4T A;  4KRW A;  2CJQ A;  4BLG A;  1R8B A;  4M1K A;  4F3O A;  4AMP A;  1RBO B;  3C16 A;  2ADC A;  2BJ3 A;  3CGI A;  3OQ2 A;  1H2T Z;  1WC0 A;  4NLR A;  4PPZ A;  4F3Q A;  5FDL B;  2DH9 A;  4B9M A;  5D8H B;  2ADB A;  1RT6 B;  1RTH B;  4DUY J;  2AV5 A;  1B0V A;  4WKR A;  2MLZ A;  2B9Y A;  1EKR A;  2KVI A;  3C14 A;  3U1L A;  1IKX B;  1M0S A;  3AA8 A;  2HVE A;  3VGU A;  1IR0 A;  3PHE A;  4QWB A;  4MKA A;  1YZ7 A;  3R1H A;  1V9O A;  2A0F B;  1WKJ A;  2FD2 A;  2FTR A;  5ETV A;  5FDL A;  1U6Z A;  1SXL A;  1DTT B;  4U9R A;  4HDH A;  5I3Q A;  1FKO A;  3UE2 A;  1SCJ B;  2CPD A;  1Y7P A;  3QPI A;  2B9X A;  3BH7 B;  2OPP A;  1BQN B;  3GP9 A;  4M5D B;  3DOK B;  3RBZ A;  2F9J A;  3BYP A;  4MAK A;  4A8X A;  4C0B A;  4DQI A;  1DAR A;  2QL5 B;  3DXS X;  3RYL A;  1JX4 A;  1OY9 A;  1WI8 A;  2YNI B;  3VVU A;  4MK9 A;  1N32 F;  3MED B;  4ES3 A;  3I87 A;  1GXU A;  1UJ5 A;  1M1G A;  3AFG A;  3D9B A;  1X7V A;  3P96 A;  1S0M A;  1NBE B;  4LT6 A;  2WAQ D;  2D7S A;  2BKO A;  2D41 A;  5E0O A;  3WC2 A;  4OX9 J;  1VQK S;  4XK8 C;  1TKX B;  3LAN A;  1NCL A;  5EWG A;  3QID A;  2YH1 A;  3MAQ A;  3QGG A;  3DU6 A;  2ZD1 A;  3FRZ A;  4I69 A;  4MYU A;  3S7R A;  3M32 B;  4J9K A;  3FSY A;  3OR1 B;  3TO8 A;  1VRT A;  2V4J A;  4Y2A A;  3NS5 A;  4AFF A;  3KLI A;  3R5A A;  4X62 F;  1JLA A;  4G1P A;  4DLE A;  3HVT A;  2XC9 A;  2HAI A;  1OPI A;  3B4D A;  2DTJ A;  3UI3 A;  4HVZ A;  3N6M A;  5E41 A;  2HHH J;  3TA2 A;  1RSC A;  4OFZ A;  5KFW A;  3CD6 S;  1SVD A;  3WHI A;  2MKS A;  4KQZ A;  4B3S F;  4IG0 A;  3B4M A;  3MAH A;  4PYD A;  2J6S A;  4O3Q A;  3FCW A;  4KC5 A;  3HT3 A;  4QIF A;  5A8W B;  2GVZ B;  2YBV A;  3A3N B;  5HVF A;  5T41 A;  4WKY A;  2OIH A;  1GMW D;  5G0R B;  1E6Y A;  3JYT B;  2DY1 A;  2YNG B;  4C98 A;  4EBD A;  5B09 A;  2CG8 A;  4DQQ A;  1JLE A;  2ZNY A;  3BKF A;  2A6O A;  4RW6 B;  4B3O A;  3G6X A;  2M70 A;  3OHB A;  2WVD A;  4QQB A;  2VOO A;  4A8M P;  3RB0 A;  4CLK A;  1SUQ A;  3GV8 B;  1QVG R;  2JEF A;  2OLW A;  1EQ0 A;  5HBM A;  1RAG B;  1RHK B;  1W25 A;  3OL8 A;  5DM7 Q;  1GT8 A;  4ED3 A;  2B4P A;  3MCN A;  4AXI A;  2V4R A;  4I2Q A;  1JIH A;  1MW7 A;  4CLF A;  1AUS L;  1R8H A;  3B54 A;  3GJR B;  3M8P A;  3W5Z A;  2BOA A;  1D09 B;  3CCT A;  3O5T B;  3GQC A;  5AE1 A;  2FLN A;  4ELU A;  3EMT A;  4AQY J;  3EJM A;  2RQM A;  4RBU A;  2AJ4 A;  4ZPW R;  2C2Z B;  4I68 A;  1YKW A;  4IDK B;  3RR7 A;  3HT0 A;  3W65 A;  4CO4 A;  2UVW A;  2ACY A;  2DGU A;  3OTB A;  4TU8 A;  5D3G A;  2R3V A;  3HSD A;  4TYA A;  2FC8 A;  4DL7 A;  3HDS A;  4HYK A;  3R1L A;  4AMM A;  5KG4 A;  4KH0 B;  2LEA A;  4IYQ A;  3WIV A;  4N7T A;  1VC5 A;  4C11 A;  3KHR A;  4O3S A;  2J9E A;  3K5P A;  4R25 A;  1IKW B;  3DM2 A;  1XIQ A;  1DQ8 A;  1VI7 A;  2Z2M A;  2FIU A;  3EXC X;  2EFV A;  4X4O A;  2CPZ A;  1TV6 A;  4JI2 F;  2HFZ A;  1HLW A;  2W8L A;  1QDU B;  1AZS A;  3SIP B;  3DGV A;  2RF2 A;  1DHM A;  1RT4 B;  2BR0 A;  2BAN A;  1DRZ A;  1N5S A;  3MEK A;  1TL1 B;  3EX7 B;  1FXL A;  3PJX A;  5I42 B;  4USU A;  4ED2 A;  3R5C A;  1BGX T;  2XMJ A;  2KYZ A;  5KFG A;  2BRK A;  1KC8 T;  1SPB P;  1NK4 A;  2DJW A;  3QT7 A;  1HIY A;  4CTA A;  2C1E B;  5A76 A;  2FY1 A;  2E1M C;  4V1A k;  2DY9 A;  1TL1 A;  2PO4 A;  3LA0 A;  3Q83 A;  4ALZ A;  5F0U A;  2L9D A;  2DNG A;  3KLE A;  2Z58 B;  3L09 A;  4L3N A;  3AD9 C;  4DEZ A;  2V63 A;  4RU2 A;  1X4B A;  3UPF A;  4EUV A;  4DR7 F;  2FHJ D;  4LF1 A;  1J2V A;  2HVI A;  4LSN B;  2B43 A;  4O44 A;  1QVF R;  3QO9 A;  5KFH A;  4V19 J;  4GMK A;  2EC0 A;  3M05 A;  2UU9 J;  1FWK A;  1IWA A;  1OQ6 A;  4X4T A;  2XMA A;  1NSK L;  2MQN A;  2D9O A;  4DV0 F;  2K1R A;  5CYQ A;  4DV7 F;  3DDK A;  3LF0 A;  3CCJ S;  3MM7 A;  4J5O A;  2VC0 A;  2EFN A;  3JXO A;  3IXQ A;  3QSI A;  4KPC A;  1Q79 A;  1U2F A;  3ZNU A;  3RBE A;  2BRL A;  1HAR A;  2IYI A;  5HQL A;  2CQI A;  3PW7 A;  2RQ4 A;  3FQL A;  3NP5 A;  1R31 A;  3M6W A;  3L3C A;  2RQK A;  3K57 A;  3BQ1 A;  4PWD B;  2V8H A;  3G9C A;  2OTJ S;  2WRM A;  1VOM A;  5L46 A;  1OIA A;  1P6T A;  3OFG A;  1YQH A;  1C2P A;  4P2S A;  2IVF B;  4DFP A;  3JSM B;  1U0H A;  1UFW A;  1B99 A;  2GHP A;  4AXJ A;  2MY7 A;  2Y8Y A;  2HFO A;  3I0R B;  4UOF A;  3G4S S;  2JJ4 D;  4J9U E;  4OJ1 A;  2MGZ A;  3UCU P;  3ZZ0 A;  4ZA1 A;  2BXJ A;  4DSL A;  3CC7 S;  3QJP A;  2QV6 A;  1V5V A;  2FJE B;  3IRX A;  4GVB B;  1YG0 A;  2BE2 A;  3IRW P;  4FXV A;  4DDF A;  3QGI A;  1S6O A;  4DF8 A;  2HVH A;  4DL4 A;  5ETM A;  1K1Q A;  3J7Z 5;  2H9Z A;  3WX4 A;  4QR1 A;  1T94 A;  1IKY A;  4KTQ A;  1YTY A;  1VQ9 S;  2AF6 A;  3I9Z A;  1NHU A;  5B0A A;  3BS9 A;  3I5A A;  4OX7 A;  3GE9 A;  3TJ9 A;  4DL0 C;  4YR0 A;  3VAF A;  3V81 A;  1VQ5 S;  1YJU A;  2GGP A;  2DIU A;  5FLX U;  3B8H A;  2VBY A;  2MY8 A;  2EKY A;  1IM4 A;  1YJT A;  3VF0 B;  1JLE B;  1MN7 A;  1HNX F;  4B3O B;  4DX8 H;  1O0P A;  1FKP A;  1VC0 A;  1CJU A;  4LR7 A;  4QIV A;  1UMJ A;  1JLC A;  3UR0 A;  4DHV A;  1HFE L;  3ENV A;  2BJD A;  2C2N A;  2AD9 A;  2QIF A;  4B9V A;  4ZKA A;  5H9F K;  1HBM A;  4DSF A;  4C8Y A;  1RWK B;  3V6H A;  2VG7 A;  3RB3 A;  4KJI A;  1PKU A;  1RTI A;  2NXJ A;  5KFO A;  1YJV A;  2LA4 A;  3SQG B;  1T95 A;  4RZR A;  4ED6 A;  1T8E A;  2V0N A;  5J1P A;  3GFX A;  3EZ5 A;  1RWM B;  3AD7 C;  1HWU A;  1ZAV A;  1YDL A;  4IH7 A;  3BPS P;  3MED A;  1RLC L;  3TQE A;  3QBC A;  2HGL A;  1CJK B;  2I5J B;  2XZD B;  4QIW D;  5KG1 A;  1JLB A;  2XY6 A;  1HWI A;  3AB4 B;  3C6T B;  1VBY A;  2MEW A;  4J37 A;  2MGZ B;  4ZCM A;  5HLF B;  4B3M F;  4F4A A;  3NGD A;  3GU0 A;  5EDW A;  1TR0 A;  5M2P A;  1V5I B;  1T3N A;  1UVI A;  1WC4 A;  4Y2M A;  2WBR A;  3G82 B;  1BWE A;  3I55 S;  2FLL A;  1H7X A;  2CRL A;  2J0S D;  1ZZF A;  3DMJ B;  2R7X A;  4CLT A;  4C0H A;  2UVU A;  4O0N A;  2DNQ A;  3W62 A;  2HGN A;  1X5O A;  2LU1 A;  3AH6 A;  1Y11 A;  5HAT A;  5C42 A;  3ZNJ 1;  3DLK B;  2GIQ A;  3K7R A;  3LPE A;  4Y0F A;  3MEE A;  4F50 A;  4OYW A;  4OZ5 A;  4RWW A;  2RS2 A;  1VIO A;  3QYY A;  3W9J A;  4PG8 A;  4OZ1 A;  6FD1 A;  3HHL A;  3KLG B;  2HS3 A;  4EEY A;  2CPF A;  2RE1 A;  4UOH A;  4YQW A;  1S1X B;  3BGO P;  2FZC B;  2LQB A;  3PYE A;  4X2B A;  1FRH A;  1PJ5 A;  1F6T A;  4U6P A;  4NMX A;  1HI0 P;  2BM1 A;  2FHK A;  2FLO A;  3DOM B;  1VQM S;  4JI4 J;  1H6K X;  5IT0 A;  2FJX A;  2VAS A;  1KHW A;  1YX2 A;  1WG5 A;  3GYG A;  4RW9 A;  3M9N B;  5G0R A;  4CYU A;  5EWE A;  1RKJ A;  1SV5 B;  4LF4 J;  2OFH X;  1U48 A;  2HHX A;  3N5F A;  2B56 A;  3NCP A;  3DXB A;  1Y4Z B;  4OYO A;  5ADZ A;  4RW7 B;  4DR6 J;  3GV5 B;  1TKZ B;  1IXK A;  3OD2 A;  4N56 A;  4HHJ A;  2RSQ A;  3HJV A;  2M5Y A;  1S57 A;  4LF5 J;  3LGH A;  2PDA A;  4QWE A;  1CS4 B;  2AU0 A;  3UR3 C;  2EFG A;  2ABY A;  4TU9 A;  4WXO A;  2XS2 A;  1WC5 A;  2HQG A;  2YNG A;  1CBK A;  5AXK A;  3U1N A;  2I8E A;  4QWD A;  2UUB F;  2V8V A;  2Q66 A;  3W9H A;  1FEE A;  3BN7 A;  3CJR A;  2GIF A;  2XSJ A;  3QMQ A;  4KKO A;  4JB8 B;  4OHW A;  3R6L B;  4NXN F;  1UZH A;  4M5G A;  4OZL A;  4QR0 A;  5DM6 Q;  1JJH A;  3C3L A;  1FFG B;  3EGZ A;  1LW2 A;  1Z4U A;  2YQ1 A;  1S9F A;  2I6W A;  3OHA A;  4J9S A;  4PUO A;  4IG3 A;  1UVN A;  2DNY A;  2VIH A;  2AEF A;  3SYZ A;  4YB7 A;  1MWQ A;  3EDQ B;  5DZ6 A;  3Q86 A;  3J81 j;  4JV5 F;  3CC4 S;  1RTZ A;  3L7P A;  3QZ8 A;  3M9M B;  4DR3 J;  1CG2 A;  1RCX B;  1OQ3 A;  4DX6 A;  1IKW A;  3RW6 A;  3I32 A;  4DJB A;  2G4B A;  3Q2S C;  4XPE A;  1NK9 A;  4E98 A;  2CIM A;  1F5B A;  1HWL A;  2PEH A;  2QC3 A;  1NME B;  2BE9 B;  3NS6 A;  3U27 A;  3KHG A;  2A18 A;  2MLX A;  1FHT A;  1F1B B;  2D74 B;  2ZOG A;  3PYD A;  5LSO A;  4K0K F;  3TA1 A;  2F4V J;  1WC1 A;  3U7J A;  1T05 A;  2DRA A;  2G0C A; 
#chains in the Genus database with same CATH homology
 3TZW A;  3TZZ A;  3QAT A;  2HG4 A;  2G1H A;  3H0P A;  3CJ8 A;  2VZ8 A;  3HHD A;  2G2O A;  2VKZ G;  3TQE A;  2G2Z A;  2VZ9 A;  2JFK A;  2QJ3 A;  3IM9 A;  4QBU A;  3TZX A;  3BV8 A;  3TZY A;  2UV8 G;  2CUY A;  1NM2 A;  1MLA A;  3IM8 A;  5DZ6 A;  2JFD A;  3R97 A;  2G2Y A;  4RL1 A;  3G87 A;  5DZ7 A;  3HJV A;  3K89 A;  3PTW A;  2QC3 A;  2C2N A;  2QO3 A;  2PFF B;  3EZO A;  4RR5 A;  3RGI A;  3R8Y A;  3SBM A;  5CZC A;  3HMJ G;  2H1Y A;  5CZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...