3K89A

Structure of x. oryzae pv. oryzae kacc10331, xoo0880(fabd) complexed with glycerol
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
MTESTLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALSQGGPEEMLNRTEYTQPALLAAGVAVWRLWTAQRGQRPALLAGHSLGEYTALVAAGVLSLHDGAHLVRLRGQFMQAAAPAGVGAMAAVLGAEDAVVLEVCAEAAGSQVVVPANFNSPGQIVIGGDAAAVDRALALLAERGVRKAVKLAVSVPSHTPLMRDAANQLGEAMAGLSWHAPQIPVVQNVDARVHDGSAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGKVLSGLIKRIDKSLDARPLATPADYAGALDAWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Malonyl CoA-ACP transacylase
publication title Structure of X. oryzae pv. oryzae KACC10331, Xoo0880(fabD) complexed with glycerol
rcsb
source organism Xanthomonas oryzae pv. oryzae
total genus 108
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3k89A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3k89A01
4RL1A 3IM8A 2VZ9A 2UV8G 1MLAA 5CZDA 2QC3A 5CZCA 3TZXA 4RR5A 2VKZG 4QBUA 3TQEA 3TZZA 2PFFB 2H1YA 2CUYA 3RGIA 2JFKA 5DZ7A 2G2YA 3H0PA 3K89A 2JFDA 2VZ8A 3HHDA 5DZ6A 3HMJG 2G2OA 2QJ3A 2G2ZA 3TZWA 3TZYA 3HJVA 3R8YA 2G1HA 3R97A 3SBMA 3QATA 3G87A 3EZOA 2C2NA 2HG4A 3PTWA 1NM2A 2QO3A 3CJ8A 3IM9A 3BV8A
chains in the Genus database with same CATH superfamily
1U0HB 4JI5F 2IFXA 3NXZA 4LFAF 3M1VA 2EFQA 2J5AA 2Z2LA 4QJVA 1FI4A 4L73A 2K1RB 1R6YA 4I2QB 1FTRA 1D8YA 3CC4S 2WK4A 3CCES 4I1TA 3GJSB 1WSRA 1NJXA 4RO0A 1LFWA 3TJ9A 2J7UA 1NU4A 4KHPF 4URQU 4FN5A 1WTFA 2LU1A 2IRXA 4NRUA 1DJ0A 2D1CA 4TKTA 2KT5A 2E5JA 4RNHA 4DFMA 2VODA 3VAJA 1JKHB 3HFKA 2AW0A 3GJRB 3BPDA 3IR5B 1CJKB 2PFDA 1JLGA 1QLNA 1FFSB 3VAGA 1VQYA 4YQWA 3ZZUA 1FKOA 2XG8A 3HHLD 4DL7A 2BQUA 3KK2A 1N54B 1WKJA 3ENAA 3MURP 4H4OA 4ZJOA 3C46A 1TKTB 3FNNA 4L3KA 1YHQS 4LFBJ 1Q8LA 4KRWA 3BS9A 1VBXA 2ZH4A 1Q1KA 3UFCX 3MECB 1HWKA 5J2NB 1RTDB 3OD2A 2QV6A 4P7VA 3LUYA 1FFGB 1T3OA 1S1VA 3OBIA 4J91A 1S1UB 1RAJA 5IOLA 3SIPB 1DURA 2VB6A 4RR5A 1M1HA 4AUKA 2BUNA 4JI3J 1Y4ZB 4CLFA 1SKRA 3SXLA 3DLEB 1WG4A 4ES2A 4OX9J 2UUCJ 4DSJA 1NLKL 1HPZB 3QZ7A 3WBZA 5D6GA 4ECSA 2HGNA 3IMQJ 1RXOB 1MN7A 4K4WA 2RIJA 2XWXA 2VUGA 3MEDA 2CJBA 3MAAA 5D0RA 1Y9OA 1RHMB 2PDAA 3AOBA 4LFBF 4C6AA 3FBBA 5A6PA 1HBNA 3IM8A 4TQRA 4DCJB 1S76D 3TUPA 3SEOA 2MHEA 1TKXB 1VIXA 1QAJA 4FPRA 2HZAA 4WP3A 4LRBA 4YB5A 1XERA 2DR7A 4JI3F 1OWXA 1BUXA 4OX9F 2ZUAA 2UUCF 2VJVA 2J9EA 4I6AA 2HK2A 3UVJB 2FY8A 1D9AA 2FHOB 4HHUA 3PEHA 3IO1A 1YJVA 4RW6A 5J2PB 3TZXA 4GRSA 4I64A 4U96A 3C14B 2FLNA 1GFWB 2DEJA 1TMMA 4PABA 1YZ7A 1OY8A 1UTAA 3M2UB 3HT0A 2LVWA 4B9VA 1X9SA 3D0HE 3JTNA 1Y10A 3MTKA 3HFVA 2V2ZA 1HW9A 2MQPA 4CLKA 2OI2A 4OYOA 4FKYA 3GQCA 4A8QA 1JLAB 2NXUA 5A6WA 2H5JB 2MB0B 3W7BA 2CIMA 2P9GA 2JDJA 2A2CA 3TRGA 1F5CA 2Y0SD 3V2UC 1X0PA 3U27A 3KLEB 1HNIA 5E33A 2LLZA 3G9CA 3UDLA 2BKPA 3T5KA 2HHSA 2DRDA 3TJAA 4CO3A 4J5OA 2VBWA 3R5DA 1T7PA 2VKRA 5GADU 2ABYA 4USKA 3GFZA 3CCSS 1GXUA 2V67A 1ZA2B 3GV5B 4NA1A 1RU1A 3RAQA 2YBVA 3DRSB 3CMAS 1NK9A 2DBBA 4Y28C 2Z58B 5LL6d 4OFZA 2D41A 1TL4A 4Q45A 1V3ZA 3PXGa 4IG3B 1JLQA 1RWOB 3FKBA 1NSQA 3QSYB 4HTIA 1RDRA 4YY3J 2FVPA 2DHXA 2ZH3A 5D4PA 2RILA 2GAHC 5LJ5Y 1AFJA 1VOMA 5CA5A 2WSFC 2G1DA 2QJ3A 3JYTA 4AQYJ 2IC3B 2XMWA 3FRZA 5FDLA 4M5GA 3OPKA 3I4PA 2V2KA 2YKOA 1FF2A 3BH6B 3TI0A 4IG0B 1TL7B 3MMBA 4I6YA 2CPYA 3KJVA 2Z4PA 4F50A 3PFEA 5K14B 2D3OR 4OI4A 3UQSA 2GHWA 2E5HA 4BDPA 4DUTA 4YY3F 2QYGA 2CNKB 5CXTA 3L7PA 2D74B 3NOGA 3IRXA 1YJNS 2OPRA 4RUBA 3QYYA 2KRBA 4ERDA 4C4WA 1VRUA 5I3QA 4J9RA 2CYYA 3MM9A 4RW7B 4AQYF 1S48A 1H6KX 4PR6A 1U1PA 2KRRA 3N5FA 4AMMA 2V6AA 2ZH8A 2ZH5A 4Q0BB 2R8IA 2D3ZA 1OMSA 2CPHA 5GAGI 2YNGA 3HD2A 3QGGA 3IRWP 2MPUA 3AOCA 3BR8A 2DCUB 2ATCB 5KFJA 5F8IA 3RBZA 1SB6A 1RYSA 4OYXA 5CH7B 5HBMA 3TANA 1BWVA 4TN2A 3M8PA 3KLHB 2E9RX 2V8VA 4C3KA 5A8RB 4R8UA 3J7ZT 1T95A 1SKSA 2NSCA 2OGUA 1LKZA 4USMA 5AXMA 4DL3A 2BE7D 5KT4A 2B4VA 3IGNA 2J0SD 4D3HA 2DR6A 3LAKA 1VGYA 4K4UA 1IKXA 2XZDB 2AZ3A 3BSAA 2JOQA 2GFFA 4ICLB 1B0VA 2IMWP 4P7TA 3AAWB 1SC1B 3IN5A 3K57A 3UD4P 2LU2A 3N6MA 1X5SA 3QAEA 3AA8A 4FNHA 1WDTA 5B0AA 5IV3A 2F63A 2GJIA 3Q89A 1OQ6A 3KMQA 2FGCA 1PSDA 4ED6A 2XS5A 1KHVA 4WU3A 1DLOB 1JLBB 2P2CB 4F26A 3TZWA 3HVAA 3NGRA 1XNRJ 2HHXA 1IUJA 3CB4A 4NLQA 1UJ6A 1ZM3A 2CQIA 1S9FA 2MKJA 3CJKB 4LUBA 2YKPA 4A46A 1NBEB 4K2XA 1IR0A 2PGCA 2BE9B 2HHTA 2PN6A 2MZJA 2YKNB 5C24B 4E8UA 2I0XA 3PZPA 1SC4B 2C3PA 2RQKA 2WVFA 3ETMA 1MU2A 2E1AA 3D1QA 1R27B 4AMOA 2HQ3A 2QRRA 2HURA 5G0RB 4X4UA 1N6QB 1TUGB 4ZN3A 3SCJE 1YQHA 2BVZA 3D1OA 3VAIA 4PG6A 1CULA 4LMZA 1S0MA 3KJQB 2DNPA 3D4JA 2VIHA 4JV5J 4EK2A 3KHLA 1X5PA 2FJBB 4ED8A 1UVIA 3OHBA 5DM6Q 4YR2A 3N6NA 4CLYA 1TTHB 2HWIA 1TU0B 2V8GA 1EETA 5DG8A 3IG1A 4ZMMA 2PO4A 2FZCB 1C4CA 2Q43A 4TVAB 3LWLA 3ETOA 1D8ZA 2ALZA 4OJGA 2NZ4A 3GR1A 2E9TA 3AXKA 4ID5B 4QU6A 5HROA 1TZ0A 4HR2A 2RSQA 5JVGQ 1PIEA 3CPWR 2UV8A 1IVZA 1XIQA 1HKAA 3DGPA 2GIQA 2MY8A 4KAIA 2NPFA 3H98A 4PWDB 1DRZA 2CA9A 2J9DA 1Y3JA 3AH6A 4PG7A 3V5RA 1JLCB 4QPTA 1VHFA 4JV5F 2CZ4A 2KI2A 2ROEA 5A2QY 3PX4A 3R9LA 3MM8B 5ETMA 3QO9B 2BJ7A 2BMBA 1REVA 1LWCB 2PSZA 4WWSA 1KNZA 2N3OA 4MAKA 3JSYA 3D9BA 5FJ4A 1NSPA 4KKOB 2L48A 4X84A 4Y2IA 5J1EA 1V6HA 1V5IB 2DNYA 1URNA 1U6ZA 1IXKA 2C3YA 1RHQB 3TYTA 2KG0A 3C2PA 1PBUA 3ADAC 4W4MA 3NGKA 1ZS6A 2FJVA 3GR0A 1CVJA 2EFPA 2VPXB 1HNVB 2AX0A 1C0TA 2M70A 2MQOA 3SFUA 4EO8A 4EU0A 2CJAA 4IO9Q 1YVFA 1QSSA 5A8WA 2XB2D 3TO8A 2HYIB 1BQNB 2XMUA 5DJBA 3HI9A 1D3WA 3G6ES 2HS0A 5KFMA 4LIRA 1QE1B 1UW9A 1B70B 3CDEA 1WOSA 3BKFA 4AD6A 4J7CA 3IM9A 5ETSA 2EWHA 2QLXA 3PEJA 5GADI 5HJXA 4EUVA 3DM2A 2PMZD 3TARA 2VG7A 4F4YA 5KFRA 2XY6A 1GMWA 3D3CJ 1NHVA 1RTHA 2NZCA 5EDWA 2ASDA 1RI7A 3RU0A 3LGMA 1P1TA 3D68A 1MROA 3RYLA 5C2CA 4K50A 2LA6A 2W9AA 2OEKA 1VQKS 1G4CA 2C3UA 1FK9B 2L9WA 3CWJA 1U8WA 3RW6A 3KK1A 3R7BB 4XTTA 3MEEA 4ATNA 5DO2A 3AD8C 1EIYB 2K06A 4NLRA 1Q86T 3B78A 3DOLB 1VJWA 4DPUA 2J0XA 4I4BA 2KZMA 5IM0B 3ZZRA 2R7UA 2ZOFA 2V0NA 3BYPA 5JVHQ 1ZM4A 3BBBA 2F4FA 5I3UA 2ZD1B 1T11A 2LDYA 4DG1B 1GXLA 1Q5VA 1MWYA 5A2QU 2WVEA 2FIUA 5EHHA 4QWBA 2D3UA 2RRBA 3G8SA 2HVEA 5HQ8A 1RACB 5H9FJ 2VG5B 1S9GB 1F0XA 3BGRB 2Y3YA 3R1HA 5H9EK 5LT5A 2UZAA 1HBMB 2AEJA 2AU0A 3KLIA 2FZGB 2MZQA 2KXNB 2DGVA 4C8NA 2VC1A 2ZZNA 1NJIT 4C11A 1UFKA 1RAHB 5E3PA 4F02A 1RISA 3S1TA 4ECQA 1VC0A 4MT1A 5DQHA 4CLUA 4B3SJ 3HLUA 3V81B 2QLJB 1IBMJ 1NDPA 5KG0A 4Y0FA 1FNOA 3W2VA 3MCSA 3AD7C 1AZSA 2RKIA 1L5UA 2HBQB 4WFAQ 4LBIA 3ONQA 3E01A 5KG7A 2DGUA 4PPDA 2VPZB 2DCLA 3FSYA 1LQ9A 2VBXA 1F3FA 2WVBA 2WBRA 3HCXA 2XHWA 3T1HJ 3EM1A 2E1PA 3HVWA 1F2GA 4ZIVA 4P73A 4LF5J 4F0MA 4Q2LA 1RGVA 3HPOA 2B43A 4RW4A 1EQ0A 2CQ1A 5BJRA 1OY6A 5A8KB 3M6WA 3TVKA 2WHOA 4B3SF 2XSJB 1YX2A 4OZ0A 1IBMF 1HR0J 4JI7J 2QFIA 3K2YA 4CH7A 4QWDA 5EX3A 2HNYB 3BYRA 3MPUB 4N7TA 4FP9A 1F60B 4EBEA 3MCOA 3T5JA 4DCOB 2QL7B 4OI1A 4P2XA 1S79A 1L3UA 2GV1A 2BBEA 3EZOA 2LDIA 2CDQA 4LF5F 4USHA 4QYZJ 1KN6A 4L74A 4DSLA 2IBKA 3GB0A 1HMVB 4OQJA 1HQUA 1Q0NA 3MPYA 3SDEB 1RBLA 4HDHA 2I8EA 1HR0F 4JI7F 3QFHA 4ZHRB 4F3QA 3OR2B 4XPCA 1NNDA 3ZZPA 5A76A 1M5KC 1UVKA 3VAHA 1U0HA 3BKUA 4WTOB 3F73A 3PJXA 2QG9B 4OLOA 1U8SA 3M9OB 4R0JA 2IVFB 2I9SA 2VD3A 4PG8A 1KLMB 3ZZOA 4F0KA 1NZAA 4OZ1A 3FUYA 5A0YB 1AA1B 3M30B 1FXLA 4CYUB 1AROP 2K1RA 2W2OP 3Q8PB 4I2QA 1JX4A 5ETPA 1VBZA 1XK8A 1AYEA 4KSEB 4QIVA 3AT1B 1U02A 2B51A 5HVGA 1PYSB 1U0SA 4M63A 2RT3A 1Y5NB 2U2FA 3FRYA 3GU0A 1JKHA 2F1FA 4J9PA 4QR1A 2JFKA 3MM6B 3T19A 1CJKA 3FC9A 3NWRA 2IM1A 3NNHA 3ITHB 5KFKA 4DMZA 2B4PA 5IS2A 4CNYA 4LF4F 4EGLA 1FA0A 4RNFA 1ZM9A 3H5UA 2WW8A 1BXNA 3KDOA 1KONA 1FDBA 1OSCA 1TKTA 4U7UK 4YP3A 3M6VA 4Z7YA 3HHLB 4O4GB 2ALYB 3QPIA 3MECA 5J2NA 1RTDA 3DI6B 3GCWP 4DX5A 4UOGA 3VR1A 3C3LA 2KJWA 4H4KA 1S1UA 2Y9HA 3HM9A 4ED7A 3OFFA 1VQLS 1JXLA 1VK8A 7FDRA 3GYNA 3LGNA 2CVEA 4NX9A 4DR7F 3CIMA 3DLEA 4FZVA 2B8QA 4LIWA 1HPZA 1EX8A 4UY8T 2KVIA 4C97A 3RG6A 3NMAA 1UL3A 3CJ5A 1UKUA 5B0DA 2KTQA 3TQ1A 1WSVA 4PQAA 2UXBJ 3GFYA 1W26A 2OEMA 3H5XA 2NUHA 2UXDJ 4OHVA 2KL8A 3BBFA 1TQLA 3BEGB 1TKXA 2BANB 4PXCA 3DOMB 1NK4A 4WIQA 3OFHA 3SV4A 1BLUA 4DL6A 1WC3A 3AQOA 3UD3P 4JI2F 1S57A 3NEKA 4LF7J 3ZTOA 2GMHA 1I3OB 4ECYA 2RVJA 3W8GA 1S6PB 1UA1A 1FD2A 3FZ2A 2YPYA 3PRVA 4ECUA 3UVJA 3IBCB 2OIHA 3V6HA 3D6MB 2UXBF 1E6VB 2FVQA 1NB2A 5J2PA 1J2VA 2YWWA 2CQ2A 4PZVA 3C14A 5HLFB 3K17A 3PACA 2XYPB 5EGYA 3D6TB 2UXDF 1TMJA 1UCNA 2QE5A 3M2UA 2MKHA 3H4BA 3KG1A 4LR8A 4X64J 2RQ4A 3N5BA 2PT0A 4A8XA 4JI8J 2J76E 1U45A 1FNXH 3TAQA 2JFDA 2ZUGA 4DR2J 3PR5B 1NZ8A 1JLAA 3GTYX 4RUHA 1Y00A 3CCVS 3FGVA 1CSJA 2BACA 4LF7F 2XMKA 4DS5A 4M5KA 2DYAA 1N8RT 2JSXA 3CDUA 2K3KA 4ELUA 3P4UB 1KOOA 3OR1A 4ZVRB 1SQEA 3A13A 3J81Y 3KLEA 4OZJA 3CO0P 2VZ9A 1GMVA 2OLWA 3K5MA 1UFWA 3N4WA 3QLHB 2UUWA 2Z57B 2RNEA 3G82B 1Q81T 2XO7A 4X64F 3M8WA 3I82A 2RU3A 2GHVC 1R6VA 3E8OA 4QZVB 4JI8F 1SV5B 1QM9A 1N52B 2R9LA 3OSPA 4EYIB 1H7WA 3WHIA 1RTIB 1PJ6A 4AL6A 3DRSA 3D1HA 1OYEA 1YITS 4WF9Q 1UW4A 5IXUA 1FT8A 2AWZA 4M1KA 1RJJA 1YI2S 3F56A 4IG3A 3DXSX 2SXLA 1VQ8S 1KQGB 3NLCA 2KM8B 2KJVA 1GQEA 4EYHB 1WC4A 1YRUA 1WHYA 5J1PA 5HL7Q 3PM9A 3KUGA 3EVMA 1H2VZ 3LWMA 3CO9A 2IC3A 2QSFA 1LW0B 5CABA 3EPGA 4WXWA 3Q8VA 3EVOA 4EZ9A 2A10A 4IG0A 1TL7A 3O3LA 2MMYA 2LQ9A 1P8GA 5I4MA 2YWFA 2DPIA 2W2MP 5K14A 1UFLA 2C2EA 2C28A 3KNGA 5KOWA 2HW3A 4P2MA 1PYTA 3KHGA 1FRXA 3BQ1A 3QGIA 1SBRA 2V63A 1QTMA 3UCGA 1FFWB 5KT5A 1IWGA 4AL5A 1WACA 4KE5A 4LR7A 4HH0A 4MK9A 1VQ5S 1EQMA 3AJ2A 4RW7A 4I69A 2BM0A 4NCAA 2XYHB 4CRJA 3ZTQA 1J5EJ 2XQCA 2HS4A 1TR0A 3VQTA 3MDFA 2OSQA 1HWJA 1T8EA 3OVAA 1YGYA 1SH2A 4Q8FA 3C15A 3JQMA 2V34A 3J81U 4OJHA 2QA4S 4UQGA 4F0HA 4GKKJ 3W9HA 5DQIA 3O6QA 4NEZA 3KLHA 2XLJA 1WHWA 3W3SA 4DF4A 1HYSB 3CSKA 5C5JA 2W8KA 1N0UA 1SJ4P 1MN9A 1TK0A 2JH3A 2BRLA 1UJ4A 2AGPA 2EPIA 3KNAA 4GO7X 1J5EF 2GO9A 2N7YA 1NSKL 2DB1A 1CJUB 3TEHB 3HO1A 1NDLA 2JC0A 4L75A 3P5TL 3M4XA 3R5JB 2ASJA 2BR0A 1ZZNA 4ICLA 4ECWA 5IZHA 4NRTA 4RNMA 2W8LA 2NXCA 4GKKF 2DH9A 4HI1A 1AFIA 2ACMA 4OZ3A 3AQPA 4DPXA 2FB0A 3I0RA 4D3GA 3PYDA 3K0JA 2ADCA 3HT3A 3GILA 2LQBA 3OTEA 1F1BB 1KHWA 1S4EA 1DLOA 1JLBA 3CIZA 3R3TA 4NMXA 2KHDA 5G4DA 3SBMA 4IRCA 2CNLB 1FX2A 3KHRA 3CJKA 5K20B 5BYSA 1P9QC 3IWNC 2XNQA 1F9EB 1RBAA 2QN6B 2YKNA 3ELHA 5ETRA 5C24A 4DR4F 3OHAA 3M2VB 3F44A 5D0HA 1FERA 2PI4A 3DCAA 2MKSA 2MHNA 1JIHA 2LQ8A 2X1AA 4ZK7M 1K47A 3HXMA 1YJUA 3LTOA 2BKNA 1A7GE 1LXNA 1U49A 1YK9A 2OTJS 4KPYA 5G0RA 3MGJA 1N6QA 3RBDA 3MM7B 1Q78A 1KEKA 2J7WA 5HQMA 3GIKA 4XK8C 1ZETA 2FQQB 3FBCA 1D1UA 2CPXA 1RADB 1YRXA 4N77A 2JHEA 2QC3A 1WHVA 3HSDA 2DH7A 3OSNA 1Q79A 3EGZA 4A8MP 4DS4A 3EGNA 5GMDA 4WPAA 2HEKA 1RTZA 2DNOA 3MM5B 4OYWA 2RDDA 3W9IA 3CCTA 3PNIA 3S8SA 1N5TA 1H38A 2OO4A 2W2QP 4ID5A 1L3VA 5DS7A 2CG4A 1PAUB 5B7WA 3JTOA 2QA2A 3NNCA 1EZZB 3DRXA 3MR3A 3H7HB 1RT7B 4PWDA 5D8HB 2WB4A 2EEYA 4MTPA 2LXFA 3PX6A 1K9MT 3MR7A 4IOAQ 2XGPA 1JLCA 4CZCA 4A8WA 4P2SA 4JI0J 3MEGB 1ZTWA 1GAOA 2KG1A 3MM8A 3HSZA 2FVSA 1QY7A 3QO9A 1HBOB 2G2YA 2YWHA 1LWCA 1ZOTA 1ITPA 4AE5A 1YRTA 2ZH2A 4QIGA 4WBFA 4KKOA 2DNNA 3AB2B 3IAS9 5KG6A 1LWFB 3ET6B 3FCVA 3IS9B 2YTCA 2VBZA 4RU9A 4LRFA 2E7XA 4J90A 1K8AT 4XDCA 1SJQA 4G1IA 3H59A 1HNVA 5CZDA 3T5LA 2V9KA 2M8HA 3EPIA 1NPPA 2RHSB 2LEBA 4JI0F 2FLLA 2ZBQA 2VFUA 1N5SA 1BQNA 1RHJB 4MJKA 1U1RA 3LPEA 2NXNA 1YJTA 2QLFB 1FESA 1QE1A 1GT8A 1A6LA 1QJHA 4CQ1A 3C6TB 4F2RA 1QUPA 2ASLA 2MQQA 1CQNA 3T6BA 4O23A 3PV8A 1K1QA 3N0VA 4A47A 3NGDA 2DH8A 1TFWA 2QTWA 3B6BA 1RA6A 4QBUA 5KFWA 3C8YA 1ACMB 5DRKA 2JEFA 1V9OA 1EP4B 1X4BA 2HPUA 1ICEB 2YNFB 2MLYA 5JJBA 4B08A 3SSSA 3FVYA 3ZZ0A 1RWXB 1U24A 2VDHA 2W7PA 3OXGA 3FDSA 3R5BA 1Y7PA 3RB0A 2RD5C 2OFHX 4PUOB 1FK9A 2AT1B 4V19J 1G2EA 4LREA 1U25A 3ZC4A 4KGMA 2WTFA 3GSIA 1NRKA 4ALZA 2UVVA 1MLAA 3DOLA 4KFBB 2VOOA 5IM0A 3CD6S 1J5OB 2R2UA 3PCOB 3KLFB 5DZ7A 1FRIA 5DZ6A 1FXRA 4N47A 4P6QA 2HLUA 2DISA 2ZD1A 2GJ2A 5ETOA 4DG1A 3AHPA 4EEYA 2OPPB 5KFNA 2J0QD 3ENWA 2V9WA 1FE0A 1FO1A 2PC6A 3M7VA 5B09A 2HHUA 4IQMA 4RBTA 2ERRA 1GH8A 1TUWA 2VG5A 1T94A 4U6PA 1S9GA 3BGRA 3M32B 4RNOA 1HBMA 2F8MA 2VZ8A 3EVWA 2C2KB 5D77A 2FJXA 3MF5A 1KQKA 1Z2LA 2E1MC 4ECRA 2BYCA 3LALA 4DPOA 4KTQA 1Z2ZA 4OZNA 5HN0A 2W4DA 2OPQB 4O4RA 2ZH1A 3ISZA 3V81A 1WC5A 3NOCA 2J8AA 4R5PB 1RT3B 4ZPTR 1BD6A 1EETB 2DHHA 2A3JA 1DAXA 4LF9J 2MZRA 4Q8EA 2F7VA 1KOHA 4F36A 1EARA 2AGOA 1I94J 1YJRA 4ZP6A 2AQ4A 3OL8A 3DKDA 3U7JA 4ED0A 4QWAA 3L09A 5RUBA 4IYQA 1X60A 1FEEA 3EGWB 5E0OA 2IRYA 1RUSA 2EFOA 1U6BA 4O0NA 3OLBA 3CCQS 1XR5A 3H42A 1FRJA 4X4VA 5A8KA 2XSJA 1TV6B 4PAAA 2IBOA 4CIOA 2GIRA 1I1GA 1WC0A 1C1BB 4FYXB 2WW4A 2J6TA 3G6XA 1HQ2A 4LF9F 4A8SA 5DQGA 2HNYA 1XR7A 1XBWA 2HBYB 2BE2B 1U2RA 1FNMA 1HNZJ 1I94F 1HBUB 2WSCC 3VALA 2XY7A 4MKVA 5D15A 5L1JA 3U1MA 2D9OA 4ZPWR 2YXLA 4ZVEA 1SCJB 3I5CA 2LEAA 4GMKA 1VBYA 4KB7A 3ENQA 2HZVA 4OYBA 2NREA 2J7KA 3IR7B 4MIAA 1HMVA 3GIMA 4NLVA 4A8OA 4RNNA 4F25A 4CO4A 4M5MA 3SDEA 3MR2A 3NS6A 4RL1A 4ZPCA 4HTJA 3THTA 4MK7A 4ZHRA 3OR2A 2I1RA 2OH2A 2IJRA 1WUUA 1HD1A 1HNZF 3H2LA 2YX7A 4P9SA 2MJNA 3OUYB 1X4FA 3UR0A 2OSRA 2BJDA 2MGZB 4F3OA 1KLMA 2A6MA 1OPZA 2G2ZA 5A0YA 2KH9A 1RSCA 1WG1A 4M5DB 3M30A 4CYUA 3C19A 4KH1B 2VPYB 2UUAJ 1N4LA 1MW7A 3CCZA 4X4QA 2B6AA 3GP9A 3MEKA 3A1YG 1D0EA 3AJ1A 4ZVPB 2HVHA 3NY0A 4RBUA 1T9TA 5CQGA 3SMZA 4ECZA 3L7UA 3CJ8A 3X1LB 5KFCA 3HVTB 5JXSA 3TVZA 4A8FA 2HWHA 3MM6A 2M8DB 1P6TA 2ZBPA 3SSQA 1HHSA 3ITHA 3PYFA 4U8VA 2KZZA 3MOZA 1BWEA 4FYVB 5CYQB 4QW9A 3FSXA 5D78A 2AYEA 4EO6A 3RGIA 2CPZA 1WOOA 2UUAF 3IA0A 4YEAA 2LQJA 4KT0C 5KFDA 4NYZA 4DV4J 3HHLA 4NLGA 3PHEA 4O4GA 3UR3C 2HQFA 4O3NA 3DI6A 2E1CA 1RU2A 2AJ2A 2AJFE 2VG6B 2FDNA 1X7VA 1NK7A 4OJ1A 5LMUJ 5AJ3J 5B08A 3AOAA 5ADZA 4PQUB 1NAQA 2OKQA 1UEVA 2Z2YB 2W9BB 2F3JA 5KFOA 2ZDPA 3TAPA 3KJFB 1NH8A 4N8OA 4ZIWA 2CWKA 3GZ7A 2ZJPQ 2EVZA 3VGSA 3G8QA 4TXSA 1BQMB 2B5JB 1S6OA 3PDNA 2XCPA 4RBVA 3EZUA 4DXLA 2J6UA 4DV4F 1Q7LB 5IV4A 1WEZA 4ZS6A 3PKYA 1VDHA 3K59A 3DRPB 3JAMU 2BANA 1CC7A 3DOMA 5AJ3F 5LXYA 1VRTB 3TEGA 4WE1B 1OPIA 5EWFA 3M9NB 1KR4A 1NHKL 2DHSA 2E7VA 2UV8G 4DUZJ 3N79A 3MD3A 3SFGA 1E6YB 2BQ3A 3ILOA 1WOPA 1S6PA 4NZ7A 4NLOA 2R7TA 2AZ1A 3BR9A 1E6VA 1SJ3P 2ZNYA 2VPWB 5HLFA 2CRLA 1LWXA 3HX9A 1B3TA 2OD6A 5LSRA 2FYXA 4B9TA 1IJEB 2MJUA 3CCRS 1XMBA 3KK3B 4MKAA 3NGUA 4LFAJ 1S7HA 5KFFA 3OJSA 4DUZF 3VZIA 4LSLB 1KP6A 3KOAA 5M2PA 4Z37A 3DLGB 4ZA1A 1WJ9A 3SV3A 2VQFJ 5LOQA 4O3SA 2HNZB 4CCHA 1TFYA 5KFPA 4C3MA 4EBCA 3K5LA 3QRQA 1FWPA 3H20A 1H72C 1Y3KA 3QLHA 3QMQA 2C3MA 1GEHA 5DGBA 3DDKA 1SKUB 3G82A 4B02A 1YIJS 4IO1A 2BDPA 1SV5A 5LXRA 4KY3A 1VQSA 4QR2A 3MD1A 4ZCLA 4AMPA 2YQ0A 4FF4A 1OQ3A 1RTIA 5IFMA 2ZKTA 3F41A 5ETNA 4FVCA 4OYZA 4CNZA 3TW0A 3R7SB 3K8WA 1S5ZA 3J7Z5 2DNLA 3UPFA 2VQFF 2B9WA 3NMRA 1R89A 4JOUA 5CZXA 3QT8A 4DUYJ 5T7LA 2YPZA 1S99A 4PWWA 2O5DA 4ZCIA 4UZBA 4FPIA 4RUAA 5E7OB 3JS9A 3OXLA 3IP0A 1SJRA 3V6JA 1VC6A 1RHKB 1XN9A 3BF4A 1VK3A 4P52A 1Z1ZA 1RHUB 3TQEA 4C8LA 2ROGA 3BGOP 3T41A 2K8GA 2ZHBA 1H3DA 1LW0A 5KG3A 1NPRA 3WZ0A 1Q95G 2M5YA 1WELA 2OP5A 4ELTA 2X3GA 1ELOA 4B9UA 2MYFA 2G4BA 2GW8A 3P8BB 1IR2A 1VS3A 4L6V3 1AT1B 3J7YU 4ECTA 4OZLA 2RS2A 4DUYF 1IBLF 4M5IA 1L3TA 1VBKA 3T9ZA 4BCAA 2P9CA 3QIPB 1RAOA 2IYIA 4A48A 4NLTA 3RRHA 5FIIA 2YX4A 3O5TB 2CWXA 2V8PA 4WCEQ 4ZVHA 2OPSB 4WK1A 1XR6A 3Q8RB 3W5ZA 1RLCL 4JV0A 3NBPB 4PCQA 3DOKB 2HGLA 3EMTA 2EC0A 3UN2A 2ZHOA 1CJVB 4UT4A 3HHNB 4AT1B 1S1TB 2O67A 2U1AA 1OSDA 2VV5A 3O44A 3OL7A 2VQEJ 3BO3A 4QCLA 4DOZA 4K5SA 1B7FA 2CNOB 2X1GA 5K5MA 3EXCX 1HYSA 3CTRA 1XMQJ 1MWZA 2XBPA 3GYXB 1NDKA 2LEPA 1VQMS 2NQPA 5HMZA 1ZM2A 2HFUA 4F7VA 2WONB 1T02A 4G65A 4CO5A 1RT1B 3IAM9 1CJUA 2KFYA 2H51B 1QSLA 4YR0A 5F41A 2HVDA 2MSTA 3D0GE 3HHDA 5KTQA 4OLPA 3WC0A 2C2ZB 3TR5A 1WKLA 2VQEF 2DPJA 1HWIA 1RT2B 3WX8A 5HK4A 2R7WA 2QGFB 4IQXA 5JUMA 1VQNS 1XMQF 3BSCA 3CCUS 1RBOB 1VC5A 4OI2A 1Q8BA 1TL1B 1KSPA 3RR7A 3HJVA 2WCXA 1C0UB 1HI1A 1JNZB 4KIAA 5THWA 4ZVFA 3NKYA 3PY8A 1K44A 5CYMB 3IGVA 2G9OA 4FDFA 1KVKA 3RR8A 3BJYA 1F5BA 2YQ1A 3OR1B 3POTB 2CJYB 2GS8A 1HNWJ 1HHTP 1U26A 1B4SA 3M2VA 4LRCA 2FTRA 1RLDA 1IQTA 2CPEA 1T05B 4FS1A 2W7AA 1Y5LB 4P10A 5BYRA 3GWCA 3B8HA 3BH7B 2D9PA 4WJBA 3GIIA 1SPBP 4DPYA 2LKZA 1T9YA 3N01A 4C8OA 2AJ0A 4BC7A 1VQOS 2LXUA 3MM7A 4NPOA 2IDLA 4TQSA 2WVCA 4J9NA 3CF5Q 3UD5A 4AXJA 3W60A 3DLKB 4P71A 1HNWF 4OHXA 2N4CA 2C2DA 4XO0A 1FJ7A 4LF8J 1UPPA 5IQQA 5F8LA 1VQPS 2XLIA 5HJYA 4LSNB 3MM5A 4ANCA 3ZFVA 5IC6B 3LA0A 4KV8B 1CC8A 1S0OA 2PMWA 5DDQC 1OYDA 1EAYC 2VA2A 2DD8S 3VTIA 2ILZA 4J9LA 3UWTA 4DX6A 2CQ3A 4X65J 1NKCA 1RT7A 1CS4B 4ZITA 4PXBA 2MKIA 1U1MA 4M8LA 1S77D 3LH2S 3GLJA 8ATCB 3BDEA 3MEGA 3D54A 1YKWA 4LF8F 4FXVA 1HBOA 3OT9A 5E3CA 4NL5A 3B54A 2YWEA 2EG2A 3QAUA 5HAOA 2X51A 3Q86A 2YH0A 3P6YC 4WKRA 2HSEB 4DSIA 1UA0A 4FBTA 2XS2A 1LWFA 3FEYB 4WZQA 1UP1A 4WFXA 2RAQA 3ET6A 3IS9A 4UOFA 2QIFA 1Y11A 2ZHAA 3GG1A 4BLGA 2ZVIA 4X65F 1SQFA 3Q24A 5KFTA 2H5IB 2FJDB 3ICLA 2JZ5A 4K7QA 4K4YA 2CADA 4WU2A 2COLA 1X4AA 3C15B 4HEA9 5CYJA 4IFVB 3NAHA 4Q44A 3BQ2A 1H98A 5M2RA 1YWXA 2GVDB 2DR8A 1F5AA 3VAFA 2E66A 2LYVA 3IBFB 1VRQC 1PJ5A 1XMOJ 5K8PA 3C6TA 2Y8WA 1IM4A 3WIVA 1NJZA 2JLGA 2EC2A 2FY1A 4RW9B 2C2RA 2G0CA 2V2VA 4CO0A 4DR1F 1L3KA 3SCKE 2HBRB 3K89A 3V6KA 2G2OA 2ZITA 4ELVA 2DGTA 1YBTA 3B82A 5KG4A 4C98A 3V6DB 3GCXP 5K9FA 3R2DJ 1NJWA 3BSOA 2CJ9A 1EP4A 1YJ7A 2AYMA 4L3NA 2YNFA 5GAHU 1VIOA 3A8JA 3R27A 4DU8A 3PW2A 1XNQJ 4FF2A 4USVA 3I0RB 1XMOF 4PUOA 1V5VA 1T3NA 3RAMA 1R8HA 1DTTB 1FKPB 4LR9A 3NP5A 3QBCA 2HQCA 3MHYA 2VOPA 3MFHA 1VQ4S 2JX2A 4K8RA 1GNKA 4KFBA 4N5SA 1J5OA 4PG4A 3KLFA 1DQ8A 3QGHA 3B4DA 2Y1RI 2O3DA 1FDDA 8AT1B 5HVHA 1NDCA 1QDUB 3MZIA 1CG2A 4J9VA 5KG5A 3PKMA 2OPPA 5IT9Y 2XHCA 4Y6IA 4YB1P 4ED5A 3SCLE 1XNQF 2HNDB 4ANEA 4B3MF 1UWBB 2R7XA 4ZKAA 1RAIB 1VYAA 3M32A 1YJWS 2Z2ZA 2HFVA 1VMBA 3QNWB 3KXDA 1LOUA 5KFIA 1WF0A 2BJEA 2VH7A 3DRRB 4TNOA 1WHXA 3GE9A 4IOBA 1M1GA 2OPQA 4DR3J 1NKEA 1CJTB 4UOCA 2AEFA 4R5PA 1M0SA 1RT3A 4AFFA 4FYWB 5F3TA 1RT6B 1R0BG 2UUTA 4K4VA 1FRMA 5EN1A 3VVUA 2FHJD 1G3OA 1WEYA 2OHDA 2QLBB 3R8YA 1X9WA 3D0IE 3LANA 5EWEA 1WF2A 2ZDOA 4ID8A 2YH1A 2X1FA 4FXDA 1L3SA 4NE9C 5C42B 2HQGA 5AE3A 2E1RA 1R0AB 3R5CA 1X5TA 2KKHA 3M8YA 1N33J 1TV6A 4DR3F 2HBZB 2MKYA 3CW2C 1C1BA 4F8RA 5AXKA 2C2NA 2BE2A 3C6UB 4G3IA 1HBUA 4KGVB 2QLWA 2CJXB 4DFPA 1RABB 5HI7A 3WDOA 4K4XA 2L41A 3QRPA 3PRBA 3CVKA 5T41A 2AX1A 4ZP8A 4IKAA 2VJUA 2XS7A 3EZ5A 1KKHA 4ILMA 1B64A 1SL2A 1N33F 3AODA 4UY85 3THPA 2IJNA 3A3PB 3HSGA 5IT9U 2CUYA 3UE2A 4YB7A 1UAWA 2G0JA 2J9DE 1RWMB 4EBDA 3R5GA 2EI5A 3Q22A 3OUYA 3NCPA 2CQDA 2OMOA 1QUVA 2YX1A 2MGZA 1N88A 2W25A 1HD0A 4M5DA 4RKUC 3PO5A 3CJ3A 2ZWOA 1U48A 3PHTA 2DNQA 1YLXA 2ZOGA 3QJPA 1FVSA 4X2BA 3E3XA 2I6WA 1S7IA 4H4MA 2JEIA 4YN3B 4RWXA 3HVTA 4JI6F 2GC8A 2P6TA 2MQMA 2XMAA 1ZH5A 3PW0A 1HNXJ 3JQKA 1RKJA 2CQ4A 2YVSA 3DLBA 1RAEB 5U47A 1LWEA 4CTAB 4N76A 2H4WB 2LXIA 5CYQA 3QFWA 4GVBB 4P2FA 2DGSA 2HMIA 3L7OA 4OV1A 3T3FA 4X4NA 3A4TA 4FVMA 2MZ1A 3IXQA 2W4PA 1WD6A 2KVQE 4KBIA 1S12A 2WRMA 2PE8A 3CXCR 5H9FK 3W61A 3E2EA 2CZVC 4I2PB 3TA0A 2LECA 2VG6A 3J7AN 4P72A 4QIWD 1Y5IB 1DQ9A 4USJC 2GQQA 1M1KT 1C1CB 4PQUA 2UXCJ 1HNXF 2W9BA 2KXFA 2WZ1A 4WK3A 2F9DA 4CM0A 1WDDA 3O2IA 4LFCJ 1YBUA 2RRAA 3NGSA 4PKDB 4DV6J 1BQMA 3RB6A 1UEKA 2GO8A 2GHPA 2B5JA 1YG0A 2E44A 4AXIA 2FJWA 4ETXA 8RUCA 1X9MA 4NZ6A 2JVRA 1T9XA 2L9NA 4K4ZA 3MMCB 1VR6A 3ZNUA 1PAEX 3DRPA 3NS5A 2DNHA 2H4YB 3RB4A 5MLCV 5I42B 1VRTA 5KFHA 2CJKA 4WE1A 3CMES 3QT5A 2UXCF 1PCAA 2DNMA 3NNAA 4NLDA 2GMLA 5CD4A 2J9CA 2V4JB 1DFDA 2R8JA 4LFCF 4PEOA 3DGVA 3BGFA 2B0GA 2Y8YA 2KYZA 1E6YA 3UNYA 2DY1A 4DV6F 3U1NA 4B9LA 1UVJA 9ATCB 2VFTA 5KFGA 2C2OB 3R2CJ 4ZOSA 3MMAB 4HLBA 2BEFA 4FF3A 3OTDA 4U9RA 1R8CA 3I9ZA 4ZJLA 4QYZK 1DZ5A 2JEGA 2DR5A 1PC5A 1KRPA 3HULA 5GAHI 3PVXA 4NLPA 2B3TB 4RUCA 1EHWA 4NOHA 3KK3A 1KS2A 3R1LA 4OMFG 3HF5A 2KFNA 4A8KA 4LSLA 1X4HA 3KTQA 4C8YA 4AMNA 3DLGA 2N4DA 1T03B 3PW5A 3PJ9A 2DJWA 2V50A 3NGTA 3RW7A 4USWA 2ZH9A 5GMKa 1RCXB 3VGTA 3EGVA 2HNZA 4IDKB 3FBEA 4ZP7A 1RAAB 1ZPWX 1BC6A 3K5PA 2BQRA 7AT1B 4O44A 4NI2B 4ETZA 2GAGC 1J27A 3SQGB 2W7OA 1DTQB 3PIOQ 1AB8A 4Q7AA 4CO1A 2HLTA 4ITSA 1K1SA 3I96A 3V4IB 1S9EB 1U1KA 3LP1B 3LO3A 1PGZA 3JSMB 3UCZP 4LT6A 3GSDA 2DTJA 3G86A 4LF4J 1HA1A 5KFQA 4DSKA 4DHVA 3CJ2A 2AP6A 2J0WA 1WI8A 2F9JA 2UVUA 3A3OB 2HG4A 1TKZB 4Q2MA 1ZAXA 4C8ZA 2B6AB 4CH1A 4ILLA 5KFUA 3C16B 2FHKA 3BPSP 3MPVA 1PYOB 3FSIA 1VI7A 3MR6A 2R7QA 5ETQA 1SJ1A 4M5JA 4UOHA 2GQ2A 4OX7A 3ZTRA 3GIJA 1RWVB 5F9NA 4YOEA 4F3MA 4NLWA 4DEZA 3FFIB 3BDPA 4CLPA 3KLGB 1W2BR 1IN0A 4DR7J 1IKYB 2RJZA 2WAQD 2GVZB 2AHOB 1JLFB 4C48A 4QWEA 2RRNA 3HDSA 1IJFB 3AFGA 4DPWA 4ZVUB 3OVSA 1IM6A 2NYHA 2N7CA 3L95X 4KGKA 3PW4A 3JSBA 1M5HA 3VGUA 1WTBA 3QIPA 1FKAF 4TU9A 2YKAA 2IJFA 1K0VA 1UVMA 3MCNA 4ZVOB 4ZDNA 3UDVA 3OVBA 2ZWPA 2NCKL 2OPSA 2CPIA 1B7YB 4JI2J 1NH7A 2B7CB 1ZZFA 3OJUA 2CJQA 2IHR1 1C4AA 3NBPA 4DV1J 2AEMA 4M5LA 3DOKA 2A18A 1ZTTA 1CJVA 3IWXA 3FK4A 2XY5A 1S1TA 1W7WA 4CLWA 4J9QA 4HHHA 3SSRA 2PI5A 2XWYA 2HFOA 2FHMA 1DQAA 4B3TJ 3WIUA 2Z30B 1FHTA 2AD9A 3US5A 1SC3B 3E51A 5IQ6A 2YWGA 3U02A 2ZJQQ 2D69A 2M88A 2AYBA 4KPCA 3HD1A 5FD1A 5E2QA 1IKVB 1ZA1B 3ISND 2JRSA 1VCTA 2BJ8A 2PIIA 2WONA 3CCJS 2GZOA 5HMYA 2ZE2A 1RT1A 4DV1F 2VICA 2CNNB 4NCGB 1F9FA 2GCFA 3HKZD 2F4VJ 2ZM6J 3M05A 1IR1A 4N41A 4P74A 3WQPA 3DLLQ 2QZ8A 5L39A 1HI0P 3WC2A 5D3GB 4NA2A 4JV1A 1MMDA 4KJIA 3H5YA 1GX6A 1WC1A 1P27B 1K0TA 4B3TF 1RT2A 2GGPB 5BYQA 1KVIA 2EKYA 3VWSA 3GMGA 1U6FA 1EB0A 1TL1A 2BOPA 5ETLA 2OTLS 3NAIA 1C0UA 2ZKUA 4AYBD 1C2PA 4NYPA 3DXBA 5HMWA 4ZPBA 2AGQA 5CYMA 3H2VE 2C42A 2F4VF 2ZM6F 3POTA 2C1EB 1M5SA 2MEWA 2IM2A 4WIIA 3BO4A 3FQLA 5JMNA 4X66J 1G1XA 1LW2B 3MFIA 2IYGA 1T05A 2IDEA 1YSJA 2DIVA 4EFAC 5J1NA 2MSSA 5CD4H 3CC2S 4DWIA 2DXEA 1SH3A 2R42A 2YNIA 1VQ6S 2HHPA 5L9NA 4Y2CA 5L8RC 4PPZA 2Y1JA 2DO4A 5HQLA 2V68A 1U1LA 4DX8H 2UVWA 4LRAA 1NKBA 3F0NA 2GX8A 3DLKA 3BO2A 4ZLLA 3P45B 3DLHA 2HVZA 3M9MB 3LPYA 4EMDA 4X4OA 4W92B 2UUBJ 3TA2A 3HZGA 2FJEB 4C2MA 2V5HG 4M94A 4OL8A 3QJLA 3T9NA 4X66F 5T7LB 2W4CA 4X4RA 3CJQA 3T1AA 1MSWD 4LSNA 4DSFA 4YS2A 1WI6A 1K73T 4HACB 4KV8A 3PIPQ 1HIYA 2R7RA 3MUMP 2O01C 2EBEA 1R43A 4UUXA 3HHEA 3T1YJ 2XMTA 1S1XB 4WFBQ 1NMEB 1CS4A 4M95A 1RWUA 2EG1A 4ZLPA 2HFNA 1R3NA 4BWJA 2XLKA 2UUBF 5CHCB 2XMVA 5F0WA 2R2TA 5C7PA 4ZVSB 5F0UA 3VVTA 4MMOA 4J9UE 1H73A 1HL6A 3D6FB 2I5JB 2ZEJA 1QVGR 2BW2A 3X3UA 3I55S 3UN3A 1LFPA 5EUHA 3MWBA 4Y00A 5F3ZA 3T1YF 2DNZA 1U2FA 5LSLA 1RHRB 4IRKA 2IAJB 1APSA 2LA4A 4XAKA 3SCIE 4R0EA 4O3OA 3CJSA 2QSWA 3BB5A 3AXMA 4NLYA 4MK8A 2R4FA 2DKOB 3D67A 2CPDA 2IVMA 4ZCKA 3H2UB 4IFVA 3GYGA 3LOUA 5D4LA 1GTEA 3FEXB 2VONA 4Y2AA 5KFVA 4FKXA 4DV2J 2GVDA 1HARA 2A2DA 3W2WB 2V69A 4FYDA 1KFSA 4N56A 1U09A 1QTNB 1B99A 1JK9B 3BKTA 3LF0A 3VHQA 1N34J 1IKWB 2EFNA 4RW9A 4CLSA 2NLWA 3M6XA 1YJ9S 1TVRB 2DXFA 2MKCA 4QU7A 1QD1A 3HSJA 3ILJA 1JNRB 4YR3A 3UW1A 3D3BJ 3NRBA 3D2WA 4B3OB 1XNRF 3N6LA 2VFVA 1SJFA 3OFEA 2HQIA 2E5GA 3V6DA 1RT5B 2VFRA 1NK8A 1SKWA 1SI9A 4HKQA 3OQ2A 4LF2A 4DR4J 4I0WA 2R3VA 4DV2F 4ZVGA 4KO0B 3BGLA 1YZ6A 3JTPA 1DTTA 1FKPA 3FBFA 2IA6A 4DV3J 1N34F 4Y3CA 1I51B 3GFXA 3H4DA 3CCLS 1NJYA 4IR1A 1DARA 1U1QA 3Q8SB 1RWNB 1U1OA 1WORA 2XNRA 2CXEA 2HFSA 1B0TA 3PYGA 2Q79A 3R5AA 1FEHA 1GK8A 5K8MA 4NXMJ 3BBCA 4QW8A 4ZVQB 2RDIA 3LQVA 2HKEA 1S49A 3KFWX 4F2SA 1FJCA 5CCMA 4ED2A 1IQZA 1TK5A 2V8HA 1U47A 4O3QA 2BRKA 2YY3A 1MMNA 2QMXA 2HHVA 2HNDA 5AE2A 2R2SA 2L08A 2M52A 1M5VC 1UWBA 3GV8B 5HP1B 3SYZA 5K8NA 1Q8IA 1FVQA 1SH0A 1FWKA 2K2PA 4DV3F 3DDIA 3IC1A 1TL3B 4IFYB 4C8MA 1JB0C 2W9CB 1G6BA 4G1QB 4RJVA 4Q43A 2FC8A 3LP0B 4CDIA 3FCHA 2IVYA 3PJWA 1QAYA 3MI7X 3PFOA 3DRRA 1WWHA 1PC4A 4NXMF 5KT7A 1CJTA 2F65A 3D28A 2G1HA 1RT6A 3G71S 3W63A 3DHWC 1MNEA 4UF4A 2MKKA 2YNHB 2GJFA 4QQBA 3DYAA 7FD1A 2NSBA 5C42A 4C0OC 3M2RB 4K5RA 2F8HA 4DPTA 2HRTA 1RWPB 3WX4A 1R0AA 1RP5A 3RBEA 2I38A 1M90T 3J81j 2NUUG 1KTVA 2ZZMA 1FJGJ 1Q8KA 3ZZTA 3M8QB 1RT4B 4MIWA 1KVJA 2AYGA 2YQ3A 4WFZA 1XQIA 3ILLA 3OLAA 1HHQA 4IOCQ 1AUDA 4LRDA 2MDAA 4U95A 2ZJRQ 3PX0A 1N48A 4UW2A 4URGA 1U1NA 2R8KA 3C6UA 5KFYA 4Q5VA 2DO0A 4LSZB 5B0CA 2KHCA 4M5HA 4E2FB 4ZVTB 4U7CA 4OZ2A 1H2UX 2M4MA 5B0GA 1REGX 4V1Ak 1F6TA 2ATLA 2RUSA 2Z0GA 4DCPB 1FJGF 5L9XA 1FCAA 2QYCA 4PRFA 1VISA 4LBPA 2BJ9A 2BXJA 4LF1A 4RW8B 4EZ6A 4OX8A 2MQ8A 1UMJA 3CUNA 3UN5A 3ZTSA 6FDRA 2WSEC 3CJ0A 2CDRB 2VBYA 2W1BA 4DV5J 1RQ0A 4NLUA 3BQ0A 4MIBA 3MAQA 1XTZA 2RQMA 5DLFA 1CQMA 4Z7CA 4KYZA 4UQTA 2E5LJ 2Y1IA 2B9XA 2XM3A 1ROFA 5DDPC 4CO2A 1S6UA 5DDOC 3TOQA 1UZDA 5J2QB 5H9EJ 1QSYA 1QAIA 1Z4UA 4KC5A 2HVIA 4OI6A 4H4KC 2F8EX 2DGWA 4CLZA 4QIFA 1Y0HA 2LQ5A 1LNQA 4DR6J 3H0PA 4HHJA 4HH1A 1AXQA 1T0TV 2RB7A 2MLXA 1Q16B 4CTAA 1KLNA 3IBWA 1XC9A 1XWLA 4GVBA 4IH6A 3FEZA 4RU2A 4DV5F 1GTHA 2LMIA 1DY3A 4OJ3A 4HVZA 2BA9A 2ZBIA 2DITA 1LK5A 5C2GA 5J2MB 4U8YA 2A1BA 2E5LF 2E5IA 1TKDA 2H5EA 3BN7A 4U7UD 3QWUA 4ZCMA 2N3LA 4I2PA 4KHMA 2HGMA 3UI3A 3H90A 2OJ3A 3CJRA 4J9OA 2IIHA 4DU7A 4MFBB 1C1CA 3NL0A 1RZMA 3R97A 2Z56B 3W8PA 1BGXT 3CCMS 4G1PA 4PWUA 3ZZZA 5DGAA 4DR6F 5F8NA 3BM7A 2AIRB 1HLWA 2UP1A 2KT3A 5AT1B 1OS5A 3H8YA 3OTCA 3KUEA 2XTJP 5SZTA 3T1HF 4NYOA 3PO4A 2M3DA 4JV2A 2F5GA 3CEDA 3QATA 2RDJA 2BV3A 4YFUA 1R8PA 4ILRA 5ETVA 4PXEA 2VA3A 3A12A 2LCWA 4WYLA 3MMCA 1ZBTA 3TUIC 1SXLA 4I7FB 4UUWA 1XEZA 4LVOP 3ZXWA 5I42A 1T9VA 2PFFB 2ZH7A 1S0VA 1KTQA 3PR4A 1S1WB 2V4JA 3CD5A 2D7SA 4QPXA 3MPWA 1GMWD 4X4SA 2BJ3A 2KB2A 4NASA 2VASA 4DQQA 4CI0B 2DNGA 4IRDA 1U7LA 4H54A 3CULA 4C0BA 1RK8A 2DIUA 1ZPVA 2ZFHA 3S7RA 5AE1A 3MMAA 4DQIA 2BW7A 1OO0B 4CH0S 3RTVA 5E5NA 3NG8A 1IBKJ 2R7VA 3ZTPA 4BS2A 4IR9A 2DNKA 3N28A 3AD9C 3HK2A 2AKWB 4ZPAA 1HQEB 2CG8A 1RTJB 2M2BA 2BABA 3RJMB 2AJ4A 2XI3A 2JVOA 2QA4G 2EXUA 2GNKA 2RF2B 1LXJA 3DRYA 3R6GB 3Q0AA 2IRUA 4ED4A 4WZMA 1RYRA 5GMEA 2I2YA 1T03A 4OI0A 2P5VA 1VHIA 1OJ4A 4DF8A 4QWCA 2OUGA 1WF1A 4IDKA 2PEBA 1CBKA 2HWTA 1NK5A 2AF6A 2EFGA 4TLRA 1IBKF 2GIFA 2NS1B 3HFZB 2HHQA 4NI2A 5EX0A 1S4FA 1N5VA 3SQGA 1DTQA 2CZ9A 2W01A 1RWKB 4XIUA 3V4IA 1S9EA 3LP1A 3D6HB 5DDRC 1UVNA 3JSMA 1JQGA 5BXIA 3BGUA 3QGPA 3LAMA 1N5YB 1NCLA 2NR0A 5DG7A 1RKIA 2J6SA 5L38A 1TKZA 3T5HA 1SIZA 2FC9A 1EKSA 4A8YA 2B9EA 3C16A 3VF0B 4F4WA 4CWBA 3KHHA 2YKMB 3I0SB 2XMMA 4ENOA 4H4MB 4DL5A 2QL5B 4DSEA 4B9NA 3TAMB 3QT6A 4KQZA 2ADBA 3DDNA 3FFIA 4KGXB 3UDCA 1XJWB 3W64A 1O51A 3KLGA 2APOA 2WVDA 1IKYA 2LFVA 1LWEB 2GVZA 2UU9J 1VQ7S 2ZC4A 1F2HA 1JLFA 2W24A 3T6JA 2HMIB 1S6QB 4TY8B 2QX0A 2FPHX 2E7WA 4AL7A 1NO8A 5MAOA 2G13A 3FZBA 2W2PP 4OHZA 3DMJB 3QZ8A 5GAEU 4WP9A 4DV7J 2VHGA 3MOJB 5H1SV 1R8AA 5C25B 1X5OA 3Q8YA 2FVCA 1JLEB 1ULRA 3NCRA 3L4BC 4LQ3A 2HRYA 4CLTA 1SUQB 2QO3A 3KKFA 1A9NB 2ILYA 4OYMA 3CCWA 3KJNB 4GC6A 4JUZA 2R7SA 2UU9F 2DK2A 2KU7A 1FDAA 4USTA 4K4SA 4W98A 2RS8A 4WXOA 3K5NA 3HVRA 1S72S 2JC1A 3LP2B 4OZ5A 3EYZA 4DX7A 4C0HA 1JJ2R 3OV7A 3DFEA 5HVFA 3JQJA 4G6VB 4DV7F 4NLXA 4XPEA 3IFEA 1YDLA 3BZQA 2WOMB 1O5JA 4ER8A 1MWQA 5IWAJ 4NCBA 2IM0A 3DU5A 1Q7YT 1HWUA 1RAFB 1M5PC 4DJBA 2V94A 5IT0A 5KFXA 2X7IA 5E3AA 5D0EA 1IKVA 1MG7A 4DZ6A 2L3MA 4JI1J 2MXYA 1WG5A 3QRRA 2QA1A 4DR2F 3M1VB 4YHHJ 4NCGA 5CAAA 3UNGC 3FMWA 1WKKA 1UPMB 1URRA 3OFGA 1FWLA 5KFBA 5D3GA 3RUBL 2DXDA 3KUHA 5IWAF 3OL6A 4ES3A 2QT7A 3SQOP 4RLEA 1AUSL 2MZTA 2GGPA 2XZTB 3MCMA 1JMTA 1YBAA 3D66A 4KHRA 3CNQP 3CJTA 4E98A 4K59A 1RA7A 4KR0B 1HW8A 4L72B 3TUZC 1D9DA 2CPJA 1JLGB 4JI1F 2CQPA 3ZNJ1 5BR8J 4CP5A 4XDDA 5D0GA 1FKOB 2V4QA 3AJDA 5E3RA 4YHHF 4KGZB 3W66A 2FLPA 3KK2B 5KFEA 3PYEA 3HP6A 4E0DA 4WKYA 1OIAA 5E3QA 1CPZA 4DQPA 3I5BA 3DU6A 4K4TA 1I6JA 4H4OB 4YB6A 3MR5A 1O6XA 3A8KA 3RB3A 3P49B 1LW2A 3D5MA 4O44B 2YWKA 9RUBA 2MTLA 5CZVA 3BREA 1TL5A 2OD4A 3K5OA 1M5OC 4NZ0A 3O1LA 3W1YC 1RB0A 3I32A 3TZYA 4WYWA 1S1VB 3DC2A 4HYKA 2OEJA 2CAJA 2L9DA 2M7SA 4DDFA 3G8TA 4F67A 2JNJA 2ZBCA 2DHAA 5BR8F 3PG9A 4LF6J 3G2XA 2IA0A 1BQXA 3NCQA 4FXWA 1FTCA 4C9DA 4Q0BA 1UJ5A 1R0CB 1YTYA 4KH0B 1OY9A 1VLOA 1B0PA 4IH5A 1SL1A 4LJMA 3TA1A 1IBLJ 3MEDB 3MAAB 4HACA 3PTWA 1NM2A 1PJ7A 1HBNB 3THVA 1Q53A 3EXYA 5D4NA 3GPAA 2DEIA 5L46A 3L3CA 4PYAA 4U67Q 5A8RA 5HO4A 1S1XA 1JWWA 4WP8A 4NLSA 2AMCB 2Q6CA 4LF6F 1NXIA 4CT8A 1DHMA 1KBRA 2EBGA 1UVLA 5B0BA 4DV0J 4HL9A 2RU9A 5B0FA 3TVYA 4PYDA 1O0PA 4RX6A 2ASYA 4RW6B 2FLOA 4X4PA 3CMQA 1FRLA 3HMJG 2I5JA 2KFZA 2CPFA 3KG4A 4GC7A 4ECXA 4C7QA 3OTOJ 2A0FB 4M5NA 3GFHA 3AY0A 2KYXA 2VU5A 5FLXY 2IAJA 4DQRA 4CT9A 3AA9A 2WBMA 1KQFB 1LK7A 5HMXA 2FZKB 1NUEA 5GVQA 3A8IA 1KDNA 4DV0F 1AW0A 2YKQA 4DQSA 2JWNA 2LP4A 3SI8A 1A0OB 5D4OA 3CGIA 4I68A 1TUVA 4R25A 1JXEA 4BC9A 1HNIB 3W2WA 2EFVA 3M8RA 3J7A1 4OHYA 1N5QA 3QQCD 4TLQA 1SVDA 3NWGA 2B4UA 3FCWA 3OTOF 3VAKA 3UO0A 4JB8B 1IKWA 3P5BP 1FRHA 4ZJQA 1H7XA 1PKUA 3G96A 2ZOMA 5KFAA 4V19X 1TVRA 4X4TA 2XMJA 1ZAVA 1KQSR 1NB7A 3HZEA 2ZE2B 4B3OA 1G7CB 4F4KA 4FF1A 3OW2R 1RWWB 1RT5A 1UETA 3I31A 2M9KA 2DGOA 4P75A 2VF3A 2EK1A 3M8ZA 1KD1T 1JJCB 5DM7Q 1NPKA 3DN9A 3MAHA 4IH7A 2HHWA 1JLQB 4KO0A 4QYRA 3GV7B 4NEYA 2XSFA 4OYIA 2X3DA 5KG1A 2PA8D 3SZ2A 4B9SA 3GG0A 3RRGA 2C2MB 2P9EA 1TP7A 3P3DA 3EDQB 3G6YA 2HIQA 4TU7A 1UZHA 1S59A 3I5AA 4YMEA 4ED1A 3JYTB 4FS2A 3PRDA 3OXFA 5FDLB 2JL9A 1RCOB 3BV8A 4A4JA 2KT2A 3C66A 4OIXA 5L1LA 1GX5A 1WC6A 5KG2A 4O3PA 3MMBB 1X4DA 2KDOA 4FBUA 4Y2MA 2C3OA 4ZLNA 2CQCA 3KJVB 4J9KA 1X8DA 4BWMA 4X62J 1SQGA 4RZRA 3BN4A 1KWMA 3HHKA 5GAEI 4URSA 3JSRA 2CFXA 4EI2A 3EE3A 2POKA 1KC8T 5E41A 5HP1A 1IWAA 3W5YA 2YNIB 2MQLA 3IRXB 4TYAA 1DBDA 2OPRB 1VRUB 2C22A 1TL3A 1ZAWA 3MM9B 4IFYA 2RQCA 3MXHP 2DGXA 1BE4A 2W9CA 1S97A 1LV5A 3P96A 4G1QA 2DVIA 3H5SA 3LP0A 5FLXU 4JP8A 3TX8A 5KT2A 2HIYA 4YDDB 4USUA 2YNGB 1FX4A 2JLFA 3OTBA 3QWPA 2E9ZA 2CKWA 4X62F 2NPIA 3O8WA 1X4CA 2GMJA 3G87A 3ULHA 3TWZA 4DL4A 4DLEA 2ZNZA 1CLFA 4YUDA 5HBMB 2XGQA 4QOTA 4ED3A 2YNHA 4J9SA 4MYUA 3M8PB 2B9YA 3R7NB 4UZCA 2H48B 4R8UB 1JXVA 3J80Y 3M2RA 1R7IA 4I67A 2FHJA 2H1YA 1R31A 2V4RA 2PA3A 2B4OA 3G6VA 2DGQA 4J37A 1V3RA 3M6UA 1IKXB 4C3LA 3M8QA 2HK3A 1RT4A 2OFGX 3G4SS 2Q3PA 3MUVP 1BY9A 2P6SA 4HT5A 3ZO7A 1PG5B 2AV5A 4NA3A 2DHGA 4DZDA 1IBCB 4DFJA 2ZZTA 4ZPDA 1UEUA 2HAIA 3R6LB 3W9JA 3GJTB 2XYGB 1BHNA 1X31C 3JXOA 4J9MA 1EJ7L 2GQCA 3UCUP 2IM3A 4O3RA 2ZH6A 4DFKA 3Q2SC 5F8GA 1PILA 4DR1J 4Z2XA 1SC6A 3TUJC 4CLLA 2E29A 2RMLA 3I6PA 1X0FA 5F8HA 3TJ8A 5KT6A 3EWGA 2MLZA 2JJ4D 5T14A 4I6WA 1D9FA 5LJ3Y 3M8SA 2IPOB 1HFEL 2N82B 5M2UA 1FD8A 3VV2B 3GIRA 4RW8A 3DHXA 2Y1LB 4LVNP 4RWWA 3K58A 2QL9B 3DNCA 1Q5YA 3RAXA 2XI2A 2CQ0A 3RZAA 3D7SB 1MU2B 2H9ZA 2Q6BA 4QR0A 2DRBA 2XZWA 1NHUA 4ZLJA 4WFNQ 4RPFA 2QMWA 2O1PA 3MUTP 1V3SA 4ZN1A 3I9V9 4BHQA 4B3RJ 2BZ2A 1NK0A 2CVIA 4HDGA 5SUHA 4I56A 1VJQA 2K3IA 2B56A 1CULB 1Q4RA 1I5OB 2HAFA 2MY7A 2V8DA 5ETTA 3FMBA 3N9UC 5I3PA 3HHLC 5F8MA 5J2QA 2FJAB 5HSPA 1T9WA 1FJEB 3U1LA 1X4EA 6AT1B 4K0KJ 5EWGA 4B3MJ 3OL9A 3VAMA 1HI8A 4MYTA 2XO6A 3IG1B 4TYBA 4O0IA 1BMQB 4L76A 3ZZYA 3Q8QB 2OELA 3CDAA 2FVRA 3CT9A 5LMNJ 5LM7E 2VDIA 5HROB 4TU8A 2DR9A 5DETA 4F4ZA 2UVRA 2VKZG 3MPDA 2R8HA 3DGPB 3J80U 3TZZA 4B3RF 1TK8A 2CQBA 4S0MA 4DBQA 2NXJA 5J2MA 3B4MA 4W90B 4F4XA 2X1BA 1P9YA 3H40A 4ZPVR 1W25A 5LSOA 4Y34A 3VGVA 5L1IA 3J7YI 3VQSA 5F8JA 2FGOA 2BJ1A 3TX0A 1NSAA 1ZYQA 4MFBA 4K0KF 1PO6A 1REVB 2EW9A 2IY5B 3ENVA 2PD1A 1RAGB 4OHWA 1GXTA 4B9MA 1H74A 2NXEA 2HQDA 2ZVSA 2R7OA 1KFDA 4OX6A 5LMNF 5KFZA 5J1EB 4USIA 3KLVA 2PMHA 2OMLA 5KFSA 2BOAA 2DY9A 2AJ1A 2PEHA 3CD7A 1VLYA 4GVLA 5IT4A 2B7BB 2QFJA 3KG0A 2HZCA 1JJ4A 3H25A 1C0TB 1N32J 1FE4A 3ILIA 5KFLA 2ZBRA 2KN4A 4DI6A 4F4AA 5A8WB 4I7FA 1GMUA 3JAMY 1VFJA 4LQ9A 3KYLA 2K7KA 4TY9A 3S6EA 4K2JA 2FD2A 2XEXA 1S1WA 4LBHA 3DYAB 2HHHJ 2Y0BB 3CDWA 4WTYA 1TAUA 1SL0A 2WB1D 2R8GA 1S0NA 4DN9A 2AJQA 3FQKA 3DM2B 4JI4J 3HJFA 2ZC3A 2B8PA 2VG7B 2DT9A 1N32F 3Q23A 2KXHA 3W62A 2HS3A 1RTHB 1S10A 1D09B 4OYAA 6FD1A 1FXDA 2Z8QA 1MROB 1HQEA 1RTJA 2HRUA 4ES1A 2RHQB 4UTGA 2Z2MA 1Q82T 3S01A 3W65A 3EX7B 4HT7A 2RF2A 4JBCA 1NK6A 4NXNJ 5F9LA 4DR5J 3CD0A 2EK6A 3LW5C 3KK1B 5HANA 2HHHF 2VFSA 3TP2A 3MEEB 4GO5X 1HWLA 5ITHA 5AXLA 2BM1A 3K7RA 3VZHA 4JI4F 4GKJJ 3CDBA 2IMOA 2Q1LA 2H54B 3ISNC 4NMLA 4F04B 1UWAA 5I3UB 4DN0A 2BX6A 5K8OA 3K8VA 5IC4B 2KM8C 3TNVA 1WNEA 5CZCA 4DL0C 4JI6J 4Y65A 2DNRA 2XC9A 3QT7A 1RE1B 3EUNA 2Q66A 4EWTA 2H3EB 1N0VC 1NEEA 2KO1A 4NXNF 4DR5F 3KWMA 3PW7A 2O66A 2JEJA 3EDRB 3QSIA 4OV6A 1N5YA 3MTJA 1TAQA 3L9ZA 3UDEA 3DLJA 3KLIB 5AXNA 4WFYA 1PBAA 2G0IA 3AB4B 4GKJF 1FRKA 3A3NB 1LEOA 4MH8A 1MMLA 3I56S 3MMJA 1F3VA 2MQNA 4C11B 4ZP9A 4FNIA 2V2QA 1EKRA 4C8KA 2ACYA 2YKMA 3I0SA 4OI3A 1O8BA 4QIEA 4ECVA 1QVFR 2EKNA 4FYYB 5KT3A 3W5XA 2R2RA 3TAMA 2XULA 2XCAA 3GONA 1WEXA 3W2VB 2D3O1 2RE1A 1AZSB 5LMUF 2RKIB 2JLEA 3E01B 3RRKA 2NYIA 4HI2A 2CQHA 4Y2KA 2DRAA 5ETKA 4DLGA 1S6QA 5KOXA 1JJHA 4TY8A 3HKWA 4DL2A 3EJMA 4MKBA 4NWBA 2H65B 2J8SA 1SIWB 2VC0A 4OYPA 2F40A 3DMJA 3FJ2A 1X4GA 4RW4B 2HFZA 2ROPA 3QJJA 5CCLA 4ANDA 4YDXA 1CEZA 5C25A 3CE8A 1R8BA 3GJQB 5DG9A 3VCDA 1QAXA 4BBYA 1JLEA 1N36J 2A6OA 3KMSA 3V4MA 1SUQA 2QMUB 1TELA 2FUG9 3QIDA 2BKOA 4JYAJ 2W2NP 1U4BA 3IR6B 2M0GB 2K7JA 1FDNA 1U2CA 2RUGA 4JI5J 3Q8UA 4CM2A 3NS7B 2P8IA 5GAGU 1P1LA 3EICA 3LP2A 1H0HB 3JB9k 1N56A 3RBXA 5B0EA 3CC7S 1T9UA 1VQ9S 3KDNA 1W2IA 2VL1A 4B17A 5DLGA 4N8NA 1F9HA 2WOMA 2CQGA 1HQUB 3I87A 2GA7A 4KHPJ 4PG5A 2RH3A 3CJ4A 1N36F 4PXDA 3Q83A 5KAKA 5L1KA 3BSNA 4IUFA 3A8EA 2OAUA 5HATA 1H2TZ 3LGHA 4MKYA 3IWLA 4JYAF 3Q2TC 2QEXS 2MZSA 3I4HX
chains in the Genus database with same CATH topology
4RL1A 3IM8A 2VZ9A 2UV8G 1MLAA 5CZDA 2QC3A 5CZCA 3TZXA 4RR5A 2VKZG 4QBUA 3TQEA 3TZZA 2PFFB 2H1YA 2CUYA 3RGIA 2JFKA 5DZ7A 2G2YA 3H0PA 3K89A 2JFDA 2VZ8A 3HHDA 5DZ6A 3HMJG 2G2OA 2QJ3A 2G2ZA 3TZWA 3TZYA 3HJVA 3R8YA 2G1HA 3R97A 3SBMA 3QATA 3G87A 3EZOA 2C2NA 2HG4A 3PTWA 1NM2A 2QO3A 3CJ8A 3IM9A 3BV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RL1 A;  3IM8 A;  2VZ9 A;  2UV8 G;  1MLA A;  5CZD A;  2QC3 A;  5CZC A;  3TZX A;  4RR5 A;  2VKZ G;  4QBU A;  3TQE A;  3TZZ A;  2PFF B;  2H1Y A;  2CUY A;  3RGI A;  2JFK A;  5DZ7 A;  2G2Y A;  3H0P A;  3K89 A;  2JFD A;  2VZ8 A;  3HHD A;  5DZ6 A;  3HMJ G;  2G2O A;  2QJ3 A;  2G2Z A;  3TZW A;  3TZY A;  3HJV A;  3R8Y A;  2G1H A;  3R97 A;  3SBM A;  3QAT A;  3G87 A;  3EZO A;  2C2N A;  2HG4 A;  3PTW A;  1NM2 A;  2QO3 A;  3CJ8 A;  3IM9 A;  3BV8 A; 
#chains in the Genus database with same CATH topology
 1U0H B;  4JI5 F;  2IFX A;  3NXZ A;  4LFA F;  3M1V A;  2EFQ A;  2J5A A;  2Z2L A;  4QJV A;  1FI4 A;  4L73 A;  2K1R B;  1R6Y A;  4I2Q B;  1FTR A;  1D8Y A;  3CC4 S;  2WK4 A;  3CCE S;  4I1T A;  3GJS B;  1WSR A;  1NJX A;  4RO0 A;  1LFW A;  3TJ9 A;  2J7U A;  1NU4 A;  4KHP F;  4URQ U;  4FN5 A;  1WTF A;  2LU1 A;  2IRX A;  4NRU A;  1DJ0 A;  2D1C A;  4TKT A;  2KT5 A;  2E5J A;  4RNH A;  4DFM A;  2VOD A;  3VAJ A;  1JKH B;  3HFK A;  2AW0 A;  3GJR B;  3BPD A;  3IR5 B;  1CJK B;  2PFD A;  1JLG A;  1QLN A;  1FFS B;  3VAG A;  1VQY A;  4YQW A;  3ZZU A;  1FKO A;  2XG8 A;  3HHL D;  4DL7 A;  2BQU A;  3KK2 A;  1N54 B;  1WKJ A;  3ENA A;  3MUR P;  4H4O A;  4ZJO A;  3C46 A;  1TKT B;  3FNN A;  4L3K A;  1YHQ S;  4LFB J;  1Q8L A;  4KRW A;  3BS9 A;  1VBX A;  2ZH4 A;  1Q1K A;  3UFC X;  3MEC B;  1HWK A;  5J2N B;  1RTD B;  3OD2 A;  2QV6 A;  4P7V A;  3LUY A;  1FFG B;  1T3O A;  1S1V A;  3OBI A;  4J91 A;  1S1U B;  1RAJ A;  5IOL A;  3SIP B;  1DUR A;  2VB6 A;  4RR5 A;  1M1H A;  4AUK A;  2BUN A;  4JI3 J;  1Y4Z B;  4CLF A;  1SKR A;  3SXL A;  3DLE B;  1WG4 A;  4ES2 A;  4OX9 J;  2UUC J;  4DSJ A;  1NLK L;  1HPZ B;  3QZ7 A;  3WBZ A;  5D6G A;  4ECS A;  2HGN A;  3IMQ J;  1RXO B;  1MN7 A;  4K4W A;  2RIJ A;  2XWX A;  2VUG A;  3MED A;  2CJB A;  3MAA A;  5D0R A;  1Y9O A;  1RHM B;  2PDA A;  3AOB A;  4LFB F;  4C6A A;  3FBB A;  5A6P A;  1HBN A;  3IM8 A;  4TQR A;  4DCJ B;  1S76 D;  3TUP A;  3SEO A;  2MHE A;  1TKX B;  1VIX A;  1QAJ A;  4FPR A;  2HZA A;  4WP3 A;  4LRB A;  4YB5 A;  1XER A;  2DR7 A;  4JI3 F;  1OWX A;  1BUX A;  4OX9 F;  2ZUA A;  2UUC F;  2VJV A;  2J9E A;  4I6A A;  2HK2 A;  3UVJ B;  2FY8 A;  1D9A A;  2FHO B;  4HHU A;  3PEH A;  3IO1 A;  1YJV A;  4RW6 A;  5J2P B;  3TZX A;  4GRS A;  4I64 A;  4U96 A;  3C14 B;  2FLN A;  1GFW B;  2DEJ A;  1TMM A;  4PAB A;  1YZ7 A;  1OY8 A;  1UTA A;  3M2U B;  3HT0 A;  2LVW A;  4B9V A;  1X9S A;  3D0H E;  3JTN A;  1Y10 A;  3MTK A;  3HFV A;  2V2Z A;  1HW9 A;  2MQP A;  4CLK A;  2OI2 A;  4OYO A;  4FKY A;  3GQC A;  4A8Q A;  1JLA B;  2NXU A;  5A6W A;  2H5J B;  2MB0 B;  3W7B A;  2CIM A;  2P9G A;  2JDJ A;  2A2C A;  3TRG A;  1F5C A;  2Y0S D;  3V2U C;  1X0P A;  3U27 A;  3KLE B;  1HNI A;  5E33 A;  2LLZ A;  3G9C A;  3UDL A;  2BKP A;  3T5K A;  2HHS A;  2DRD A;  3TJA A;  4CO3 A;  4J5O A;  2VBW A;  3R5D A;  1T7P A;  2VKR A;  5GAD U;  2ABY A;  4USK A;  3GFZ A;  3CCS S;  1GXU A;  2V67 A;  1ZA2 B;  3GV5 B;  4NA1 A;  1RU1 A;  3RAQ A;  2YBV A;  3DRS B;  3CMA S;  1NK9 A;  2DBB A;  4Y28 C;  2Z58 B;  5LL6 d;  4OFZ A;  2D41 A;  1TL4 A;  4Q45 A;  1V3Z A;  3PXG a;  4IG3 B;  1JLQ A;  1RWO B;  3FKB A;  1NSQ A;  3QSY B;  4HTI A;  1RDR A;  4YY3 J;  2FVP A;  2DHX A;  2ZH3 A;  5D4P A;  2RIL A;  2GAH C;  5LJ5 Y;  1AFJ A;  1VOM A;  5CA5 A;  2WSF C;  2G1D A;  2QJ3 A;  3JYT A;  4AQY J;  2IC3 B;  2XMW A;  3FRZ A;  5FDL A;  4M5G A;  3OPK A;  3I4P A;  2V2K A;  2YKO A;  1FF2 A;  3BH6 B;  3TI0 A;  4IG0 B;  1TL7 B;  3MMB A;  4I6Y A;  2CPY A;  3KJV A;  2Z4P A;  4F50 A;  3PFE A;  5K14 B;  2D3O R;  4OI4 A;  3UQS A;  2GHW A;  2E5H A;  4BDP A;  4DUT A;  4YY3 F;  2QYG A;  2CNK B;  5CXT A;  3L7P A;  2D74 B;  3NOG A;  3IRX A;  1YJN S;  2OPR A;  4RUB A;  3QYY A;  2KRB A;  4ERD A;  4C4W A;  1VRU A;  5I3Q A;  4J9R A;  2CYY A;  3MM9 A;  4RW7 B;  4AQY F;  1S48 A;  1H6K X;  4PR6 A;  1U1P A;  2KRR A;  3N5F A;  4AMM A;  2V6A A;  2ZH8 A;  2ZH5 A;  4Q0B B;  2R8I A;  2D3Z A;  1OMS A;  2CPH A;  5GAG I;  2YNG A;  3HD2 A;  3QGG A;  3IRW P;  2MPU A;  3AOC A;  3BR8 A;  2DCU B;  2ATC B;  5KFJ A;  5F8I A;  3RBZ A;  1SB6 A;  1RYS A;  4OYX A;  5CH7 B;  5HBM A;  3TAN A;  1BWV A;  4TN2 A;  3M8P A;  3KLH B;  2E9R X;  2V8V A;  4C3K A;  5A8R B;  4R8U A;  3J7Z T;  1T95 A;  1SKS A;  2NSC A;  2OGU A;  1LKZ A;  4USM A;  5AXM A;  4DL3 A;  2BE7 D;  5KT4 A;  2B4V A;  3IGN A;  2J0S D;  4D3H A;  2DR6 A;  3LAK A;  1VGY A;  4K4U A;  1IKX A;  2XZD B;  2AZ3 A;  3BSA A;  2JOQ A;  2GFF A;  4ICL B;  1B0V A;  2IMW P;  4P7T A;  3AAW B;  1SC1 B;  3IN5 A;  3K57 A;  3UD4 P;  2LU2 A;  3N6M A;  1X5S A;  3QAE A;  3AA8 A;  4FNH A;  1WDT A;  5B0A A;  5IV3 A;  2F63 A;  2GJI A;  3Q89 A;  1OQ6 A;  3KMQ A;  2FGC A;  1PSD A;  4ED6 A;  2XS5 A;  1KHV A;  4WU3 A;  1DLO B;  1JLB B;  2P2C B;  4F26 A;  3TZW A;  3HVA A;  3NGR A;  1XNR J;  2HHX A;  1IUJ A;  3CB4 A;  4NLQ A;  1UJ6 A;  1ZM3 A;  2CQI A;  1S9F A;  2MKJ A;  3CJK B;  4LUB A;  2YKP A;  4A46 A;  1NBE B;  4K2X A;  1IR0 A;  2PGC A;  2BE9 B;  2HHT A;  2PN6 A;  2MZJ A;  2YKN B;  5C24 B;  4E8U A;  2I0X A;  3PZP A;  1SC4 B;  2C3P A;  2RQK A;  2WVF A;  3ETM A;  1MU2 A;  2E1A A;  3D1Q A;  1R27 B;  4AMO A;  2HQ3 A;  2QRR A;  2HUR A;  5G0R B;  4X4U A;  1N6Q B;  1TUG B;  4ZN3 A;  3SCJ E;  1YQH A;  2BVZ A;  3D1O A;  3VAI A;  4PG6 A;  1CUL A;  4LMZ A;  1S0M A;  3KJQ B;  2DNP A;  3D4J A;  2VIH A;  4JV5 J;  4EK2 A;  3KHL A;  1X5P A;  2FJB B;  4ED8 A;  1UVI A;  3OHB A;  5DM6 Q;  4YR2 A;  3N6N A;  4CLY A;  1TTH B;  2HWI A;  1TU0 B;  2V8G A;  1EET A;  5DG8 A;  3IG1 A;  4ZMM A;  2PO4 A;  2FZC B;  1C4C A;  2Q43 A;  4TVA B;  3LWL A;  3ETO A;  1D8Z A;  2ALZ A;  4OJG A;  2NZ4 A;  3GR1 A;  2E9T A;  3AXK A;  4ID5 B;  4QU6 A;  5HRO A;  1TZ0 A;  4HR2 A;  2RSQ A;  5JVG Q;  1PIE A;  3CPW R;  2UV8 A;  1IVZ A;  1XIQ A;  1HKA A;  3DGP A;  2GIQ A;  2MY8 A;  4KAI A;  2NPF A;  3H98 A;  4PWD B;  1DRZ A;  2CA9 A;  2J9D A;  1Y3J A;  3AH6 A;  4PG7 A;  3V5R A;  1JLC B;  4QPT A;  1VHF A;  4JV5 F;  2CZ4 A;  2KI2 A;  2ROE A;  5A2Q Y;  3PX4 A;  3R9L A;  3MM8 B;  5ETM A;  3QO9 B;  2BJ7 A;  2BMB A;  1REV A;  1LWC B;  2PSZ A;  4WWS A;  1KNZ A;  2N3O A;  4MAK A;  3JSY A;  3D9B A;  5FJ4 A;  1NSP A;  4KKO B;  2L48 A;  4X84 A;  4Y2I A;  5J1E A;  1V6H A;  1V5I B;  2DNY A;  1URN A;  1U6Z A;  1IXK A;  2C3Y A;  1RHQ B;  3TYT A;  2KG0 A;  3C2P A;  1PBU A;  3ADA C;  4W4M A;  3NGK A;  1ZS6 A;  2FJV A;  3GR0 A;  1CVJ A;  2EFP A;  2VPX B;  1HNV B;  2AX0 A;  1C0T A;  2M70 A;  2MQO A;  3SFU A;  4EO8 A;  4EU0 A;  2CJA A;  4IO9 Q;  1YVF A;  1QSS A;  5A8W A;  2XB2 D;  3TO8 A;  2HYI B;  1BQN B;  2XMU A;  5DJB A;  3HI9 A;  1D3W A;  3G6E S;  2HS0 A;  5KFM A;  4LIR A;  1QE1 B;  1UW9 A;  1B70 B;  3CDE A;  1WOS A;  3BKF A;  4AD6 A;  4J7C A;  3IM9 A;  5ETS A;  2EWH A;  2QLX A;  3PEJ A;  5GAD I;  5HJX A;  4EUV A;  3DM2 A;  2PMZ D;  3TAR A;  2VG7 A;  4F4Y A;  5KFR A;  2XY6 A;  1GMW A;  3D3C J;  1NHV A;  1RTH A;  2NZC A;  5EDW A;  2ASD A;  1RI7 A;  3RU0 A;  3LGM A;  1P1T A;  3D68 A;  1MRO A;  3RYL A;  5C2C A;  4K50 A;  2LA6 A;  2W9A A;  2OEK A;  1VQK S;  1G4C A;  2C3U A;  1FK9 B;  2L9W A;  3CWJ A;  1U8W A;  3RW6 A;  3KK1 A;  3R7B B;  4XTT A;  3MEE A;  4ATN A;  5DO2 A;  3AD8 C;  1EIY B;  2K06 A;  4NLR A;  1Q86 T;  3B78 A;  3DOL B;  1VJW A;  4DPU A;  2J0X A;  4I4B A;  2KZM A;  5IM0 B;  3ZZR A;  2R7U A;  2ZOF A;  2V0N A;  3BYP A;  5JVH Q;  1ZM4 A;  3BBB A;  2F4F A;  5I3U A;  2ZD1 B;  1T11 A;  2LDY A;  4DG1 B;  1GXL A;  1Q5V A;  1MWY A;  5A2Q U;  2WVE A;  2FIU A;  5EHH A;  4QWB A;  2D3U A;  2RRB A;  3G8S A;  2HVE A;  5HQ8 A;  1RAC B;  5H9F J;  2VG5 B;  1S9G B;  1F0X A;  3BGR B;  2Y3Y A;  3R1H A;  5H9E K;  5LT5 A;  2UZA A;  1HBM B;  2AEJ A;  2AU0 A;  3KLI A;  2FZG B;  2MZQ A;  2KXN B;  2DGV A;  4C8N A;  2VC1 A;  2ZZN A;  1NJI T;  4C11 A;  1UFK A;  1RAH B;  5E3P A;  4F02 A;  1RIS A;  3S1T A;  4ECQ A;  1VC0 A;  4MT1 A;  5DQH A;  4CLU A;  4B3S J;  3HLU A;  3V81 B;  2QLJ B;  1IBM J;  1NDP A;  5KG0 A;  4Y0F A;  1FNO A;  3W2V A;  3MCS A;  3AD7 C;  1AZS A;  2RKI A;  1L5U A;  2HBQ B;  4WFA Q;  4LBI A;  3ONQ A;  3E01 A;  5KG7 A;  2DGU A;  4PPD A;  2VPZ B;  2DCL A;  3FSY A;  1LQ9 A;  2VBX A;  1F3F A;  2WVB A;  2WBR A;  3HCX A;  2XHW A;  3T1H J;  3EM1 A;  2E1P A;  3HVW A;  1F2G A;  4ZIV A;  4P73 A;  4LF5 J;  4F0M A;  4Q2L A;  1RGV A;  3HPO A;  2B43 A;  4RW4 A;  1EQ0 A;  2CQ1 A;  5BJR A;  1OY6 A;  5A8K B;  3M6W A;  3TVK A;  2WHO A;  4B3S F;  2XSJ B;  1YX2 A;  4OZ0 A;  1IBM F;  1HR0 J;  4JI7 J;  2QFI A;  3K2Y A;  4CH7 A;  4QWD A;  5EX3 A;  2HNY B;  3BYR A;  3MPU B;  4N7T A;  4FP9 A;  1F60 B;  4EBE A;  3MCO A;  3T5J A;  4DCO B;  2QL7 B;  4OI1 A;  4P2X A;  1S79 A;  1L3U A;  2GV1 A;  2BBE A;  3EZO A;  2LDI A;  2CDQ A;  4LF5 F;  4USH A;  4QYZ J;  1KN6 A;  4L74 A;  4DSL A;  2IBK A;  3GB0 A;  1HMV B;  4OQJ A;  1HQU A;  1Q0N A;  3MPY A;  3SDE B;  1RBL A;  4HDH A;  2I8E A;  1HR0 F;  4JI7 F;  3QFH A;  4ZHR B;  4F3Q A;  3OR2 B;  4XPC A;  1NND A;  3ZZP A;  5A76 A;  1M5K C;  1UVK A;  3VAH A;  1U0H A;  3BKU A;  4WTO B;  3F73 A;  3PJX A;  2QG9 B;  4OLO A;  1U8S A;  3M9O B;  4R0J A;  2IVF B;  2I9S A;  2VD3 A;  4PG8 A;  1KLM B;  3ZZO A;  4F0K A;  1NZA A;  4OZ1 A;  3FUY A;  5A0Y B;  1AA1 B;  3M30 B;  1FXL A;  4CYU B;  1ARO P;  2K1R A;  2W2O P;  3Q8P B;  4I2Q A;  1JX4 A;  5ETP A;  1VBZ A;  1XK8 A;  1AYE A;  4KSE B;  4QIV A;  3AT1 B;  1U02 A;  2B51 A;  5HVG A;  1PYS B;  1U0S A;  4M63 A;  2RT3 A;  1Y5N B;  2U2F A;  3FRY A;  3GU0 A;  1JKH A;  2F1F A;  4J9P A;  4QR1 A;  2JFK A;  3MM6 B;  3T19 A;  1CJK A;  3FC9 A;  3NWR A;  2IM1 A;  3NNH A;  3ITH B;  5KFK A;  4DMZ A;  2B4P A;  5IS2 A;  4CNY A;  4LF4 F;  4EGL A;  1FA0 A;  4RNF A;  1ZM9 A;  3H5U A;  2WW8 A;  1BXN A;  3KDO A;  1KON A;  1FDB A;  1OSC A;  1TKT A;  4U7U K;  4YP3 A;  3M6V A;  4Z7Y A;  3HHL B;  4O4G B;  2ALY B;  3QPI A;  3MEC A;  5J2N A;  1RTD A;  3DI6 B;  3GCW P;  4DX5 A;  4UOG A;  3VR1 A;  3C3L A;  2KJW A;  4H4K A;  1S1U A;  2Y9H A;  3HM9 A;  4ED7 A;  3OFF A;  1VQL S;  1JXL A;  1VK8 A;  7FDR A;  3GYN A;  3LGN A;  2CVE A;  4NX9 A;  4DR7 F;  3CIM A;  3DLE A;  4FZV A;  2B8Q A;  4LIW A;  1HPZ A;  1EX8 A;  4UY8 T;  2KVI A;  4C97 A;  3RG6 A;  3NMA A;  1UL3 A;  3CJ5 A;  1UKU A;  5B0D A;  2KTQ A;  3TQ1 A;  1WSV A;  4PQA A;  2UXB J;  3GFY A;  1W26 A;  2OEM A;  3H5X A;  2NUH A;  2UXD J;  4OHV A;  2KL8 A;  3BBF A;  1TQL A;  3BEG B;  1TKX A;  2BAN B;  4PXC A;  3DOM B;  1NK4 A;  4WIQ A;  3OFH A;  3SV4 A;  1BLU A;  4DL6 A;  1WC3 A;  3AQO A;  3UD3 P;  4JI2 F;  1S57 A;  3NEK A;  4LF7 J;  3ZTO A;  2GMH A;  1I3O B;  4ECY A;  2RVJ A;  3W8G A;  1S6P B;  1UA1 A;  1FD2 A;  3FZ2 A;  2YPY A;  3PRV A;  4ECU A;  3UVJ A;  3IBC B;  2OIH A;  3V6H A;  3D6M B;  2UXB F;  1E6V B;  2FVQ A;  1NB2 A;  5J2P A;  1J2V A;  2YWW A;  2CQ2 A;  4PZV A;  3C14 A;  5HLF B;  3K17 A;  3PAC A;  2XYP B;  5EGY A;  3D6T B;  2UXD F;  1TMJ A;  1UCN A;  2QE5 A;  3M2U A;  2MKH A;  3H4B A;  3KG1 A;  4LR8 A;  4X64 J;  2RQ4 A;  3N5B A;  2PT0 A;  4A8X A;  4JI8 J;  2J76 E;  1U45 A;  1FNX H;  3TAQ A;  2JFD A;  2ZUG A;  4DR2 J;  3PR5 B;  1NZ8 A;  1JLA A;  3GTY X;  4RUH A;  1Y00 A;  3CCV S;  3FGV A;  1CSJ A;  2BAC A;  4LF7 F;  2XMK A;  4DS5 A;  4M5K A;  2DYA A;  1N8R T;  2JSX A;  3CDU A;  2K3K A;  4ELU A;  3P4U B;  1KOO A;  3OR1 A;  4ZVR B;  1SQE A;  3A13 A;  3J81 Y;  3KLE A;  4OZJ A;  3CO0 P;  2VZ9 A;  1GMV A;  2OLW A;  3K5M A;  1UFW A;  3N4W A;  3QLH B;  2UUW A;  2Z57 B;  2RNE A;  3G82 B;  1Q81 T;  2XO7 A;  4X64 F;  3M8W A;  3I82 A;  2RU3 A;  2GHV C;  1R6V A;  3E8O A;  4QZV B;  4JI8 F;  1SV5 B;  1QM9 A;  1N52 B;  2R9L A;  3OSP A;  4EYI B;  1H7W A;  3WHI A;  1RTI B;  1PJ6 A;  4AL6 A;  3DRS A;  3D1H A;  1OYE A;  1YIT S;  4WF9 Q;  1UW4 A;  5IXU A;  1FT8 A;  2AWZ A;  4M1K A;  1RJJ A;  1YI2 S;  3F56 A;  4IG3 A;  3DXS X;  2SXL A;  1VQ8 S;  1KQG B;  3NLC A;  2KM8 B;  2KJV A;  1GQE A;  4EYH B;  1WC4 A;  1YRU A;  1WHY A;  5J1P A;  5HL7 Q;  3PM9 A;  3KUG A;  3EVM A;  1H2V Z;  3LWM A;  3CO9 A;  2IC3 A;  2QSF A;  1LW0 B;  5CAB A;  3EPG A;  4WXW A;  3Q8V A;  3EVO A;  4EZ9 A;  2A10 A;  4IG0 A;  1TL7 A;  3O3L A;  2MMY A;  2LQ9 A;  1P8G A;  5I4M A;  2YWF A;  2DPI A;  2W2M P;  5K14 A;  1UFL A;  2C2E A;  2C28 A;  3KNG A;  5KOW A;  2HW3 A;  4P2M A;  1PYT A;  3KHG A;  1FRX A;  3BQ1 A;  3QGI A;  1SBR A;  2V63 A;  1QTM A;  3UCG A;  1FFW B;  5KT5 A;  1IWG A;  4AL5 A;  1WAC A;  4KE5 A;  4LR7 A;  4HH0 A;  4MK9 A;  1VQ5 S;  1EQM A;  3AJ2 A;  4RW7 A;  4I69 A;  2BM0 A;  4NCA A;  2XYH B;  4CRJ A;  3ZTQ A;  1J5E J;  2XQC A;  2HS4 A;  1TR0 A;  3VQT A;  3MDF A;  2OSQ A;  1HWJ A;  1T8E A;  3OVA A;  1YGY A;  1SH2 A;  4Q8F A;  3C15 A;  3JQM A;  2V34 A;  3J81 U;  4OJH A;  2QA4 S;  4UQG A;  4F0H A;  4GKK J;  3W9H A;  5DQI A;  3O6Q A;  4NEZ A;  3KLH A;  2XLJ A;  1WHW A;  3W3S A;  4DF4 A;  1HYS B;  3CSK A;  5C5J A;  2W8K A;  1N0U A;  1SJ4 P;  1MN9 A;  1TK0 A;  2JH3 A;  2BRL A;  1UJ4 A;  2AGP A;  2EPI A;  3KNA A;  4GO7 X;  1J5E F;  2GO9 A;  2N7Y A;  1NSK L;  2DB1 A;  1CJU B;  3TEH B;  3HO1 A;  1NDL A;  2JC0 A;  4L75 A;  3P5T L;  3M4X A;  3R5J B;  2ASJ A;  2BR0 A;  1ZZN A;  4ICL A;  4ECW A;  5IZH A;  4NRT A;  4RNM A;  2W8L A;  2NXC A;  4GKK F;  2DH9 A;  4HI1 A;  1AFI A;  2ACM A;  4OZ3 A;  3AQP A;  4DPX A;  2FB0 A;  3I0R A;  4D3G A;  3PYD A;  3K0J A;  2ADC A;  3HT3 A;  3GIL A;  2LQB A;  3OTE A;  1F1B B;  1KHW A;  1S4E A;  1DLO A;  1JLB A;  3CIZ A;  3R3T A;  4NMX A;  2KHD A;  5G4D A;  3SBM A;  4IRC A;  2CNL B;  1FX2 A;  3KHR A;  3CJK A;  5K20 B;  5BYS A;  1P9Q C;  3IWN C;  2XNQ A;  1F9E B;  1RBA A;  2QN6 B;  2YKN A;  3ELH A;  5ETR A;  5C24 A;  4DR4 F;  3OHA A;  3M2V B;  3F44 A;  5D0H A;  1FER A;  2PI4 A;  3DCA A;  2MKS A;  2MHN A;  1JIH A;  2LQ8 A;  2X1A A;  4ZK7 M;  1K47 A;  3HXM A;  1YJU A;  3LTO A;  2BKN A;  1A7G E;  1LXN A;  1U49 A;  1YK9 A;  2OTJ S;  4KPY A;  5G0R A;  3MGJ A;  1N6Q A;  3RBD A;  3MM7 B;  1Q78 A;  1KEK A;  2J7W A;  5HQM A;  3GIK A;  4XK8 C;  1ZET A;  2FQQ B;  3FBC A;  1D1U A;  2CPX A;  1RAD B;  1YRX A;  4N77 A;  2JHE A;  2QC3 A;  1WHV A;  3HSD A;  2DH7 A;  3OSN A;  1Q79 A;  3EGZ A;  4A8M P;  4DS4 A;  3EGN A;  5GMD A;  4WPA A;  2HEK A;  1RTZ A;  2DNO A;  3MM5 B;  4OYW A;  2RDD A;  3W9I A;  3CCT A;  3PNI A;  3S8S A;  1N5T A;  1H38 A;  2OO4 A;  2W2Q P;  4ID5 A;  1L3V A;  5DS7 A;  2CG4 A;  1PAU B;  5B7W A;  3JTO A;  2QA2 A;  3NNC A;  1EZZ B;  3DRX A;  3MR3 A;  3H7H B;  1RT7 B;  4PWD A;  5D8H B;  2WB4 A;  2EEY A;  4MTP A;  2LXF A;  3PX6 A;  1K9M T;  3MR7 A;  4IOA Q;  2XGP A;  1JLC A;  4CZC A;  4A8W A;  4P2S A;  4JI0 J;  3MEG B;  1ZTW A;  1GAO A;  2KG1 A;  3MM8 A;  3HSZ A;  2FVS A;  1QY7 A;  3QO9 A;  1HBO B;  2G2Y A;  2YWH A;  1LWC A;  1ZOT A;  1ITP A;  4AE5 A;  1YRT A;  2ZH2 A;  4QIG A;  4WBF A;  4KKO A;  2DNN A;  3AB2 B;  3IAS 9;  5KG6 A;  1LWF B;  3ET6 B;  3FCV A;  3IS9 B;  2YTC A;  2VBZ A;  4RU9 A;  4LRF A;  2E7X A;  4J90 A;  1K8A T;  4XDC A;  1SJQ A;  4G1I A;  3H59 A;  1HNV A;  5CZD A;  3T5L A;  2V9K A;  2M8H A;  3EPI A;  1NPP A;  2RHS B;  2LEB A;  4JI0 F;  2FLL A;  2ZBQ A;  2VFU A;  1N5S A;  1BQN A;  1RHJ B;  4MJK A;  1U1R A;  3LPE A;  2NXN A;  1YJT A;  2QLF B;  1FES A;  1QE1 A;  1GT8 A;  1A6L A;  1QJH A;  4CQ1 A;  3C6T B;  4F2R A;  1QUP A;  2ASL A;  2MQQ A;  1CQN A;  3T6B A;  4O23 A;  3PV8 A;  1K1Q A;  3N0V A;  4A47 A;  3NGD A;  2DH8 A;  1TFW A;  2QTW A;  3B6B A;  1RA6 A;  4QBU A;  5KFW A;  3C8Y A;  1ACM B;  5DRK A;  2JEF A;  1V9O A;  1EP4 B;  1X4B A;  2HPU A;  1ICE B;  2YNF B;  2MLY A;  5JJB A;  4B08 A;  3SSS A;  3FVY A;  3ZZ0 A;  1RWX B;  1U24 A;  2VDH A;  2W7P A;  3OXG A;  3FDS A;  3R5B A;  1Y7P A;  3RB0 A;  2RD5 C;  2OFH X;  4PUO B;  1FK9 A;  2AT1 B;  4V19 J;  1G2E A;  4LRE A;  1U25 A;  3ZC4 A;  4KGM A;  2WTF A;  3GSI A;  1NRK A;  4ALZ A;  2UVV A;  1MLA A;  3DOL A;  4KFB B;  2VOO A;  5IM0 A;  3CD6 S;  1J5O B;  2R2U A;  3PCO B;  3KLF B;  5DZ7 A;  1FRI A;  5DZ6 A;  1FXR A;  4N47 A;  4P6Q A;  2HLU A;  2DIS A;  2ZD1 A;  2GJ2 A;  5ETO A;  4DG1 A;  3AHP A;  4EEY A;  2OPP B;  5KFN A;  2J0Q D;  3ENW A;  2V9W A;  1FE0 A;  1FO1 A;  2PC6 A;  3M7V A;  5B09 A;  2HHU A;  4IQM A;  4RBT A;  2ERR A;  1GH8 A;  1TUW A;  2VG5 A;  1T94 A;  4U6P A;  1S9G A;  3BGR A;  3M32 B;  4RNO A;  1HBM A;  2F8M A;  2VZ8 A;  3EVW A;  2C2K B;  5D77 A;  2FJX A;  3MF5 A;  1KQK A;  1Z2L A;  2E1M C;  4ECR A;  2BYC A;  3LAL A;  4DPO A;  4KTQ A;  1Z2Z A;  4OZN A;  5HN0 A;  2W4D A;  2OPQ B;  4O4R A;  2ZH1 A;  3ISZ A;  3V81 A;  1WC5 A;  3NOC A;  2J8A A;  4R5P B;  1RT3 B;  4ZPT R;  1BD6 A;  1EET B;  2DHH A;  2A3J A;  1DAX A;  4LF9 J;  2MZR A;  4Q8E A;  2F7V A;  1KOH A;  4F36 A;  1EAR A;  2AGO A;  1I94 J;  1YJR A;  4ZP6 A;  2AQ4 A;  3OL8 A;  3DKD A;  3U7J A;  4ED0 A;  4QWA A;  3L09 A;  5RUB A;  4IYQ A;  1X60 A;  1FEE A;  3EGW B;  5E0O A;  2IRY A;  1RUS A;  2EFO A;  1U6B A;  4O0N A;  3OLB A;  3CCQ S;  1XR5 A;  3H42 A;  1FRJ A;  4X4V A;  5A8K A;  2XSJ A;  1TV6 B;  4PAA A;  2IBO A;  4CIO A;  2GIR A;  1I1G A;  1WC0 A;  1C1B B;  4FYX B;  2WW4 A;  2J6T A;  3G6X A;  1HQ2 A;  4LF9 F;  4A8S A;  5DQG A;  2HNY A;  1XR7 A;  1XBW A;  2HBY B;  2BE2 B;  1U2R A;  1FNM A;  1HNZ J;  1I94 F;  1HBU B;  2WSC C;  3VAL A;  2XY7 A;  4MKV A;  5D15 A;  5L1J A;  3U1M A;  2D9O A;  4ZPW R;  2YXL A;  4ZVE A;  1SCJ B;  3I5C A;  2LEA A;  4GMK A;  1VBY A;  4KB7 A;  3ENQ A;  2HZV A;  4OYB A;  2NRE A;  2J7K A;  3IR7 B;  4MIA A;  1HMV A;  3GIM A;  4NLV A;  4A8O A;  4RNN A;  4F25 A;  4CO4 A;  4M5M A;  3SDE A;  3MR2 A;  3NS6 A;  4RL1 A;  4ZPC A;  4HTJ A;  3THT A;  4MK7 A;  4ZHR A;  3OR2 A;  2I1R A;  2OH2 A;  2IJR A;  1WUU A;  1HD1 A;  1HNZ F;  3H2L A;  2YX7 A;  4P9S A;  2MJN A;  3OUY B;  1X4F A;  3UR0 A;  2OSR A;  2BJD A;  2MGZ B;  4F3O A;  1KLM A;  2A6M A;  1OPZ A;  2G2Z A;  5A0Y A;  2KH9 A;  1RSC A;  1WG1 A;  4M5D B;  3M30 A;  4CYU A;  3C19 A;  4KH1 B;  2VPY B;  2UUA J;  1N4L A;  1MW7 A;  3CCZ A;  4X4Q A;  2B6A A;  3GP9 A;  3MEK A;  3A1Y G;  1D0E A;  3AJ1 A;  4ZVP B;  2HVH A;  3NY0 A;  4RBU A;  1T9T A;  5CQG A;  3SMZ A;  4ECZ A;  3L7U A;  3CJ8 A;  3X1L B;  5KFC A;  3HVT B;  5JXS A;  3TVZ A;  4A8F A;  2HWH A;  3MM6 A;  2M8D B;  1P6T A;  2ZBP A;  3SSQ A;  1HHS A;  3ITH A;  3PYF A;  4U8V A;  2KZZ A;  3MOZ A;  1BWE A;  4FYV B;  5CYQ B;  4QW9 A;  3FSX A;  5D78 A;  2AYE A;  4EO6 A;  3RGI A;  2CPZ A;  1WOO A;  2UUA F;  3IA0 A;  4YEA A;  2LQJ A;  4KT0 C;  5KFD A;  4NYZ A;  4DV4 J;  3HHL A;  4NLG A;  3PHE A;  4O4G A;  3UR3 C;  2HQF A;  4O3N A;  3DI6 A;  2E1C A;  1RU2 A;  2AJ2 A;  2AJF E;  2VG6 B;  2FDN A;  1X7V A;  1NK7 A;  4OJ1 A;  5LMU J;  5AJ3 J;  5B08 A;  3AOA A;  5ADZ A;  4PQU B;  1NAQ A;  2OKQ A;  1UEV A;  2Z2Y B;  2W9B B;  2F3J A;  5KFO A;  2ZDP A;  3TAP A;  3KJF B;  1NH8 A;  4N8O A;  4ZIW A;  2CWK A;  3GZ7 A;  2ZJP Q;  2EVZ A;  3VGS A;  3G8Q A;  4TXS A;  1BQM B;  2B5J B;  1S6O A;  3PDN A;  2XCP A;  4RBV A;  3EZU A;  4DXL A;  2J6U A;  4DV4 F;  1Q7L B;  5IV4 A;  1WEZ A;  4ZS6 A;  3PKY A;  1VDH A;  3K59 A;  3DRP B;  3JAM U;  2BAN A;  1CC7 A;  3DOM A;  5AJ3 F;  5LXY A;  1VRT B;  3TEG A;  4WE1 B;  1OPI A;  5EWF A;  3M9N B;  1KR4 A;  1NHK L;  2DHS A;  2E7V A;  2UV8 G;  4DUZ J;  3N79 A;  3MD3 A;  3SFG A;  1E6Y B;  2BQ3 A;  3ILO A;  1WOP A;  1S6P A;  4NZ7 A;  4NLO A;  2R7T A;  2AZ1 A;  3BR9 A;  1E6V A;  1SJ3 P;  2ZNY A;  2VPW B;  5HLF A;  2CRL A;  1LWX A;  3HX9 A;  1B3T A;  2OD6 A;  5LSR A;  2FYX A;  4B9T A;  1IJE B;  2MJU A;  3CCR S;  1XMB A;  3KK3 B;  4MKA A;  3NGU A;  4LFA J;  1S7H A;  5KFF A;  3OJS A;  4DUZ F;  3VZI A;  4LSL B;  1KP6 A;  3KOA A;  5M2P A;  4Z37 A;  3DLG B;  4ZA1 A;  1WJ9 A;  3SV3 A;  2VQF J;  5LOQ A;  4O3S A;  2HNZ B;  4CCH A;  1TFY A;  5KFP A;  4C3M A;  4EBC A;  3K5L A;  3QRQ A;  1FWP A;  3H20 A;  1H72 C;  1Y3K A;  3QLH A;  3QMQ A;  2C3M A;  1GEH A;  5DGB A;  3DDK A;  1SKU B;  3G82 A;  4B02 A;  1YIJ S;  4IO1 A;  2BDP A;  1SV5 A;  5LXR A;  4KY3 A;  1VQS A;  4QR2 A;  3MD1 A;  4ZCL A;  4AMP A;  2YQ0 A;  4FF4 A;  1OQ3 A;  1RTI A;  5IFM A;  2ZKT A;  3F41 A;  5ETN A;  4FVC A;  4OYZ A;  4CNZ A;  3TW0 A;  3R7S B;  3K8W A;  1S5Z A;  3J7Z 5;  2DNL A;  3UPF A;  2VQF F;  2B9W A;  3NMR A;  1R89 A;  4JOU A;  5CZX A;  3QT8 A;  4DUY J;  5T7L A;  2YPZ A;  1S99 A;  4PWW A;  2O5D A;  4ZCI A;  4UZB A;  4FPI A;  4RUA A;  5E7O B;  3JS9 A;  3OXL A;  3IP0 A;  1SJR A;  3V6J A;  1VC6 A;  1RHK B;  1XN9 A;  3BF4 A;  1VK3 A;  4P52 A;  1Z1Z A;  1RHU B;  3TQE A;  4C8L A;  2ROG A;  3BGO P;  3T41 A;  2K8G A;  2ZHB A;  1H3D A;  1LW0 A;  5KG3 A;  1NPR A;  3WZ0 A;  1Q95 G;  2M5Y A;  1WEL A;  2OP5 A;  4ELT A;  2X3G A;  1ELO A;  4B9U A;  2MYF A;  2G4B A;  2GW8 A;  3P8B B;  1IR2 A;  1VS3 A;  4L6V 3;  1AT1 B;  3J7Y U;  4ECT A;  4OZL A;  2RS2 A;  4DUY F;  1IBL F;  4M5I A;  1L3T A;  1VBK A;  3T9Z A;  4BCA A;  2P9C A;  3QIP B;  1RAO A;  2IYI A;  4A48 A;  4NLT A;  3RRH A;  5FII A;  2YX4 A;  3O5T B;  2CWX A;  2V8P A;  4WCE Q;  4ZVH A;  2OPS B;  4WK1 A;  1XR6 A;  3Q8R B;  3W5Z A;  1RLC L;  4JV0 A;  3NBP B;  4PCQ A;  3DOK B;  2HGL A;  3EMT A;  2EC0 A;  3UN2 A;  2ZHO A;  1CJV B;  4UT4 A;  3HHN B;  4AT1 B;  1S1T B;  2O67 A;  2U1A A;  1OSD A;  2VV5 A;  3O44 A;  3OL7 A;  2VQE J;  3BO3 A;  4QCL A;  4DOZ A;  4K5S A;  1B7F A;  2CNO B;  2X1G A;  5K5M A;  3EXC X;  1HYS A;  3CTR A;  1XMQ J;  1MWZ A;  2XBP A;  3GYX B;  1NDK A;  2LEP A;  1VQM S;  2NQP A;  5HMZ A;  1ZM2 A;  2HFU A;  4F7V A;  2WON B;  1T02 A;  4G65 A;  4CO5 A;  1RT1 B;  3IAM 9;  1CJU A;  2KFY A;  2H51 B;  1QSL A;  4YR0 A;  5F41 A;  2HVD A;  2MST A;  3D0G E;  3HHD A;  5KTQ A;  4OLP A;  3WC0 A;  2C2Z B;  3TR5 A;  1WKL A;  2VQE F;  2DPJ A;  1HWI A;  1RT2 B;  3WX8 A;  5HK4 A;  2R7W A;  2QGF B;  4IQX A;  5JUM A;  1VQN S;  1XMQ F;  3BSC A;  3CCU S;  1RBO B;  1VC5 A;  4OI2 A;  1Q8B A;  1TL1 B;  1KSP A;  3RR7 A;  3HJV A;  2WCX A;  1C0U B;  1HI1 A;  1JNZ B;  4KIA A;  5THW A;  4ZVF A;  3NKY A;  3PY8 A;  1K44 A;  5CYM B;  3IGV A;  2G9O A;  4FDF A;  1KVK A;  3RR8 A;  3BJY A;  1F5B A;  2YQ1 A;  3OR1 B;  3POT B;  2CJY B;  2GS8 A;  1HNW J;  1HHT P;  1U26 A;  1B4S A;  3M2V A;  4LRC A;  2FTR A;  1RLD A;  1IQT A;  2CPE A;  1T05 B;  4FS1 A;  2W7A A;  1Y5L B;  4P10 A;  5BYR A;  3GWC A;  3B8H A;  3BH7 B;  2D9P A;  4WJB A;  3GII A;  1SPB P;  4DPY A;  2LKZ A;  1T9Y A;  3N01 A;  4C8O A;  2AJ0 A;  4BC7 A;  1VQO S;  2LXU A;  3MM7 A;  4NPO A;  2IDL A;  4TQS A;  2WVC A;  4J9N A;  3CF5 Q;  3UD5 A;  4AXJ A;  3W60 A;  3DLK B;  4P71 A;  1HNW F;  4OHX A;  2N4C A;  2C2D A;  4XO0 A;  1FJ7 A;  4LF8 J;  1UPP A;  5IQQ A;  5F8L A;  1VQP S;  2XLI A;  5HJY A;  4LSN B;  3MM5 A;  4ANC A;  3ZFV A;  5IC6 B;  3LA0 A;  4KV8 B;  1CC8 A;  1S0O A;  2PMW A;  5DDQ C;  1OYD A;  1EAY C;  2VA2 A;  2DD8 S;  3VTI A;  2ILZ A;  4J9L A;  3UWT A;  4DX6 A;  2CQ3 A;  4X65 J;  1NKC A;  1RT7 A;  1CS4 B;  4ZIT A;  4PXB A;  2MKI A;  1U1M A;  4M8L A;  1S77 D;  3LH2 S;  3GLJ A;  8ATC B;  3BDE A;  3MEG A;  3D54 A;  1YKW A;  4LF8 F;  4FXV A;  1HBO A;  3OT9 A;  5E3C A;  4NL5 A;  3B54 A;  2YWE A;  2EG2 A;  3QAU A;  5HAO A;  2X51 A;  3Q86 A;  2YH0 A;  3P6Y C;  4WKR A;  2HSE B;  4DSI A;  1UA0 A;  4FBT A;  2XS2 A;  1LWF A;  3FEY B;  4WZQ A;  1UP1 A;  4WFX A;  2RAQ A;  3ET6 A;  3IS9 A;  4UOF A;  2QIF A;  1Y11 A;  2ZHA A;  3GG1 A;  4BLG A;  2ZVI A;  4X65 F;  1SQF A;  3Q24 A;  5KFT A;  2H5I B;  2FJD B;  3ICL A;  2JZ5 A;  4K7Q A;  4K4Y A;  2CAD A;  4WU2 A;  2COL A;  1X4A A;  3C15 B;  4HEA 9;  5CYJ A;  4IFV B;  3NAH A;  4Q44 A;  3BQ2 A;  1H98 A;  5M2R A;  1YWX A;  2GVD B;  2DR8 A;  1F5A A;  3VAF A;  2E66 A;  2LYV A;  3IBF B;  1VRQ C;  1PJ5 A;  1XMO J;  5K8P A;  3C6T A;  2Y8W A;  1IM4 A;  3WIV A;  1NJZ A;  2JLG A;  2EC2 A;  2FY1 A;  4RW9 B;  2C2R A;  2G0C A;  2V2V A;  4CO0 A;  4DR1 F;  1L3K A;  3SCK E;  2HBR B;  3K89 A;  3V6K A;  2G2O A;  2ZIT A;  4ELV A;  2DGT A;  1YBT A;  3B82 A;  5KG4 A;  4C98 A;  3V6D B;  3GCX P;  5K9F A;  3R2D J;  1NJW A;  3BSO A;  2CJ9 A;  1EP4 A;  1YJ7 A;  2AYM A;  4L3N A;  2YNF A;  5GAH U;  1VIO A;  3A8J A;  3R27 A;  4DU8 A;  3PW2 A;  1XNQ J;  4FF2 A;  4USV A;  3I0R B;  1XMO F;  4PUO A;  1V5V A;  1T3N A;  3RAM A;  1R8H A;  1DTT B;  1FKP B;  4LR9 A;  3NP5 A;  3QBC A;  2HQC A;  3MHY A;  2VOP A;  3MFH A;  1VQ4 S;  2JX2 A;  4K8R A;  1GNK A;  4KFB A;  4N5S A;  1J5O A;  4PG4 A;  3KLF A;  1DQ8 A;  3QGH A;  3B4D A;  2Y1R I;  2O3D A;  1FDD A;  8AT1 B;  5HVH A;  1NDC A;  1QDU B;  3MZI A;  1CG2 A;  4J9V A;  5KG5 A;  3PKM A;  2OPP A;  5IT9 Y;  2XHC A;  4Y6I A;  4YB1 P;  4ED5 A;  3SCL E;  1XNQ F;  2HND B;  4ANE A;  4B3M F;  1UWB B;  2R7X A;  4ZKA A;  1RAI B;  1VYA A;  3M32 A;  1YJW S;  2Z2Z A;  2HFV A;  1VMB A;  3QNW B;  3KXD A;  1LOU A;  5KFI A;  1WF0 A;  2BJE A;  2VH7 A;  3DRR B;  4TNO A;  1WHX A;  3GE9 A;  4IOB A;  1M1G A;  2OPQ A;  4DR3 J;  1NKE A;  1CJT B;  4UOC A;  2AEF A;  4R5P A;  1M0S A;  1RT3 A;  4AFF A;  4FYW B;  5F3T A;  1RT6 B;  1R0B G;  2UUT A;  4K4V A;  1FRM A;  5EN1 A;  3VVU A;  2FHJ D;  1G3O A;  1WEY A;  2OHD A;  2QLB B;  3R8Y A;  1X9W A;  3D0I E;  3LAN A;  5EWE A;  1WF2 A;  2ZDO A;  4ID8 A;  2YH1 A;  2X1F A;  4FXD A;  1L3S A;  4NE9 C;  5C42 B;  2HQG A;  5AE3 A;  2E1R A;  1R0A B;  3R5C A;  1X5T A;  2KKH A;  3M8Y A;  1N33 J;  1TV6 A;  4DR3 F;  2HBZ B;  2MKY A;  3CW2 C;  1C1B A;  4F8R A;  5AXK A;  2C2N A;  2BE2 A;  3C6U B;  4G3I A;  1HBU A;  4KGV B;  2QLW A;  2CJX B;  4DFP A;  1RAB B;  5HI7 A;  3WDO A;  4K4X A;  2L41 A;  3QRP A;  3PRB A;  3CVK A;  5T41 A;  2AX1 A;  4ZP8 A;  4IKA A;  2VJU A;  2XS7 A;  3EZ5 A;  1KKH A;  4ILM A;  1B64 A;  1SL2 A;  1N33 F;  3AOD A;  4UY8 5;  3THP A;  2IJN A;  3A3P B;  3HSG A;  5IT9 U;  2CUY A;  3UE2 A;  4YB7 A;  1UAW A;  2G0J A;  2J9D E;  1RWM B;  4EBD A;  3R5G A;  2EI5 A;  3Q22 A;  3OUY A;  3NCP A;  2CQD A;  2OMO A;  1QUV A;  2YX1 A;  2MGZ A;  1N88 A;  2W25 A;  1HD0 A;  4M5D A;  4RKU C;  3PO5 A;  3CJ3 A;  2ZWO A;  1U48 A;  3PHT A;  2DNQ A;  1YLX A;  2ZOG A;  3QJP A;  1FVS A;  4X2B A;  3E3X A;  2I6W A;  1S7I A;  4H4M A;  2JEI A;  4YN3 B;  4RWX A;  3HVT A;  4JI6 F;  2GC8 A;  2P6T A;  2MQM A;  2XMA A;  1ZH5 A;  3PW0 A;  1HNX J;  3JQK A;  1RKJ A;  2CQ4 A;  2YVS A;  3DLB A;  1RAE B;  5U47 A;  1LWE A;  4CTA B;  4N76 A;  2H4W B;  2LXI A;  5CYQ A;  3QFW A;  4GVB B;  4P2F A;  2DGS A;  2HMI A;  3L7O A;  4OV1 A;  3T3F A;  4X4N A;  3A4T A;  4FVM A;  2MZ1 A;  3IXQ A;  2W4P A;  1WD6 A;  2KVQ E;  4KBI A;  1S12 A;  2WRM A;  2PE8 A;  3CXC R;  5H9F K;  3W61 A;  3E2E A;  2CZV C;  4I2P B;  3TA0 A;  2LEC A;  2VG6 A;  3J7A N;  4P72 A;  4QIW D;  1Y5I B;  1DQ9 A;  4USJ C;  2GQQ A;  1M1K T;  1C1C B;  4PQU A;  2UXC J;  1HNX F;  2W9B A;  2KXF A;  2WZ1 A;  4WK3 A;  2F9D A;  4CM0 A;  1WDD A;  3O2I A;  4LFC J;  1YBU A;  2RRA A;  3NGS A;  4PKD B;  4DV6 J;  1BQM A;  3RB6 A;  1UEK A;  2GO8 A;  2GHP A;  2B5J A;  1YG0 A;  2E44 A;  4AXI A;  2FJW A;  4ETX A;  8RUC A;  1X9M A;  4NZ6 A;  2JVR A;  1T9X A;  2L9N A;  4K4Z A;  3MMC B;  1VR6 A;  3ZNU A;  1PAE X;  3DRP A;  3NS5 A;  2DNH A;  2H4Y B;  3RB4 A;  5MLC V;  5I42 B;  1VRT A;  5KFH A;  2CJK A;  4WE1 A;  3CME S;  3QT5 A;  2UXC F;  1PCA A;  2DNM A;  3NNA A;  4NLD A;  2GML A;  5CD4 A;  2J9C A;  2V4J B;  1DFD A;  2R8J A;  4LFC F;  4PEO A;  3DGV A;  3BGF A;  2B0G A;  2Y8Y A;  2KYZ A;  1E6Y A;  3UNY A;  2DY1 A;  4DV6 F;  3U1N A;  4B9L A;  1UVJ A;  9ATC B;  2VFT A;  5KFG A;  2C2O B;  3R2C J;  4ZOS A;  3MMA B;  4HLB A;  2BEF A;  4FF3 A;  3OTD A;  4U9R A;  1R8C A;  3I9Z A;  4ZJL A;  4QYZ K;  1DZ5 A;  2JEG A;  2DR5 A;  1PC5 A;  1KRP A;  3HUL A;  5GAH I;  3PVX A;  4NLP A;  2B3T B;  4RUC A;  1EHW A;  4NOH A;  3KK3 A;  1KS2 A;  3R1L A;  4OMF G;  3HF5 A;  2KFN A;  4A8K A;  4LSL A;  1X4H A;  3KTQ A;  4C8Y A;  4AMN A;  3DLG A;  2N4D A;  1T03 B;  3PW5 A;  3PJ9 A;  2DJW A;  2V50 A;  3NGT A;  3RW7 A;  4USW A;  2ZH9 A;  5GMK a;  1RCX B;  3VGT A;  3EGV A;  2HNZ A;  4IDK B;  3FBE A;  4ZP7 A;  1RAA B;  1ZPW X;  1BC6 A;  3K5P A;  2BQR A;  7AT1 B;  4O44 A;  4NI2 B;  4ETZ A;  2GAG C;  1J27 A;  3SQG B;  2W7O A;  1DTQ B;  3PIO Q;  1AB8 A;  4Q7A A;  4CO1 A;  2HLT A;  4ITS A;  1K1S A;  3I96 A;  3V4I B;  1S9E B;  1U1K A;  3LP1 B;  3LO3 A;  1PGZ A;  3JSM B;  3UCZ P;  4LT6 A;  3GSD A;  2DTJ A;  3G86 A;  4LF4 J;  1HA1 A;  5KFQ A;  4DSK A;  4DHV A;  3CJ2 A;  2AP6 A;  2J0W A;  1WI8 A;  2F9J A;  2UVU A;  3A3O B;  2HG4 A;  1TKZ B;  4Q2M A;  1ZAX A;  4C8Z A;  2B6A B;  4CH1 A;  4ILL A;  5KFU A;  3C16 B;  2FHK A;  3BPS P;  3MPV A;  1PYO B;  3FSI A;  1VI7 A;  3MR6 A;  2R7Q A;  5ETQ A;  1SJ1 A;  4M5J A;  4UOH A;  2GQ2 A;  4OX7 A;  3ZTR A;  3GIJ A;  1RWV B;  5F9N A;  4YOE A;  4F3M A;  4NLW A;  4DEZ A;  3FFI B;  3BDP A;  4CLP A;  3KLG B;  1W2B R;  1IN0 A;  4DR7 J;  1IKY B;  2RJZ A;  2WAQ D;  2GVZ B;  2AHO B;  1JLF B;  4C48 A;  4QWE A;  2RRN A;  3HDS A;  1IJF B;  3AFG A;  4DPW A;  4ZVU B;  3OVS A;  1IM6 A;  2NYH A;  2N7C A;  3L95 X;  4KGK A;  3PW4 A;  3JSB A;  1M5H A;  3VGU A;  1WTB A;  3QIP A;  1FKA F;  4TU9 A;  2YKA A;  2IJF A;  1K0V A;  1UVM A;  3MCN A;  4ZVO B;  4ZDN A;  3UDV A;  3OVB A;  2ZWP A;  2NCK L;  2OPS A;  2CPI A;  1B7Y B;  4JI2 J;  1NH7 A;  2B7C B;  1ZZF A;  3OJU A;  2CJQ A;  2IHR 1;  1C4A A;  3NBP A;  4DV1 J;  2AEM A;  4M5L A;  3DOK A;  2A18 A;  1ZTT A;  1CJV A;  3IWX A;  3FK4 A;  2XY5 A;  1S1T A;  1W7W A;  4CLW A;  4J9Q A;  4HHH A;  3SSR A;  2PI5 A;  2XWY A;  2HFO A;  2FHM A;  1DQA A;  4B3T J;  3WIU A;  2Z30 B;  1FHT A;  2AD9 A;  3US5 A;  1SC3 B;  3E51 A;  5IQ6 A;  2YWG A;  3U02 A;  2ZJQ Q;  2D69 A;  2M88 A;  2AYB A;  4KPC A;  3HD1 A;  5FD1 A;  5E2Q A;  1IKV B;  1ZA1 B;  3ISN D;  2JRS A;  1VCT A;  2BJ8 A;  2PII A;  2WON A;  3CCJ S;  2GZO A;  5HMY A;  2ZE2 A;  1RT1 A;  4DV1 F;  2VIC A;  2CNN B;  4NCG B;  1F9F A;  2GCF A;  3HKZ D;  2F4V J;  2ZM6 J;  3M05 A;  1IR1 A;  4N41 A;  4P74 A;  3WQP A;  3DLL Q;  2QZ8 A;  5L39 A;  1HI0 P;  3WC2 A;  5D3G B;  4NA2 A;  4JV1 A;  1MMD A;  4KJI A;  3H5Y A;  1GX6 A;  1WC1 A;  1P27 B;  1K0T A;  4B3T F;  1RT2 A;  2GGP B;  5BYQ A;  1KVI A;  2EKY A;  3VWS A;  3GMG A;  1U6F A;  1EB0 A;  1TL1 A;  2BOP A;  5ETL A;  2OTL S;  3NAI A;  1C0U A;  2ZKU A;  4AYB D;  1C2P A;  4NYP A;  3DXB A;  5HMW A;  4ZPB A;  2AGQ A;  5CYM A;  3H2V E;  2C42 A;  2F4V F;  2ZM6 F;  3POT A;  2C1E B;  1M5S A;  2MEW A;  2IM2 A;  4WII A;  3BO4 A;  3FQL A;  5JMN A;  4X66 J;  1G1X A;  1LW2 B;  3MFI A;  2IYG A;  1T05 A;  2IDE A;  1YSJ A;  2DIV A;  4EFA C;  5J1N A;  2MSS A;  5CD4 H;  3CC2 S;  4DWI A;  2DXE A;  1SH3 A;  2R42 A;  2YNI A;  1VQ6 S;  2HHP A;  5L9N A;  4Y2C A;  5L8R C;  4PPZ A;  2Y1J A;  2DO4 A;  5HQL A;  2V68 A;  1U1L A;  4DX8 H;  2UVW A;  4LRA A;  1NKB A;  3F0N A;  2GX8 A;  3DLK A;  3BO2 A;  4ZLL A;  3P45 B;  3DLH A;  2HVZ A;  3M9M B;  3LPY A;  4EMD A;  4X4O A;  4W92 B;  2UUB J;  3TA2 A;  3HZG A;  2FJE B;  4C2M A;  2V5H G;  4M94 A;  4OL8 A;  3QJL A;  3T9N A;  4X66 F;  5T7L B;  2W4C A;  4X4R A;  3CJQ A;  3T1A A;  1MSW D;  4LSN A;  4DSF A;  4YS2 A;  1WI6 A;  1K73 T;  4HAC B;  4KV8 A;  3PIP Q;  1HIY A;  2R7R A;  3MUM P;  2O01 C;  2EBE A;  1R43 A;  4UUX A;  3HHE A;  3T1Y J;  2XMT A;  1S1X B;  4WFB Q;  1NME B;  1CS4 A;  4M95 A;  1RWU A;  2EG1 A;  4ZLP A;  2HFN A;  1R3N A;  4BWJ A;  2XLK A;  2UUB F;  5CHC B;  2XMV A;  5F0W A;  2R2T A;  5C7P A;  4ZVS B;  5F0U A;  3VVT A;  4MMO A;  4J9U E;  1H73 A;  1HL6 A;  3D6F B;  2I5J B;  2ZEJ A;  1QVG R;  2BW2 A;  3X3U A;  3I55 S;  3UN3 A;  1LFP A;  5EUH A;  3MWB A;  4Y00 A;  5F3Z A;  3T1Y F;  2DNZ A;  1U2F A;  5LSL A;  1RHR B;  4IRK A;  2IAJ B;  1APS A;  2LA4 A;  4XAK A;  3SCI E;  4R0E A;  4O3O A;  3CJS A;  2QSW A;  3BB5 A;  3AXM A;  4NLY A;  4MK8 A;  2R4F A;  2DKO B;  3D67 A;  2CPD A;  2IVM A;  4ZCK A;  3H2U B;  4IFV A;  3GYG A;  3LOU A;  5D4L A;  1GTE A;  3FEX B;  2VON A;  4Y2A A;  5KFV A;  4FKX A;  4DV2 J;  2GVD A;  1HAR A;  2A2D A;  3W2W B;  2V69 A;  4FYD A;  1KFS A;  4N56 A;  1U09 A;  1QTN B;  1B99 A;  1JK9 B;  3BKT A;  3LF0 A;  3VHQ A;  1N34 J;  1IKW B;  2EFN A;  4RW9 A;  4CLS A;  2NLW A;  3M6X A;  1YJ9 S;  1TVR B;  2DXF A;  2MKC A;  4QU7 A;  1QD1 A;  3HSJ A;  3ILJ A;  1JNR B;  4YR3 A;  3UW1 A;  3D3B J;  3NRB A;  3D2W A;  4B3O B;  1XNR F;  3N6L A;  2VFV A;  1SJF A;  3OFE A;  2HQI A;  2E5G A;  3V6D A;  1RT5 B;  2VFR A;  1NK8 A;  1SKW A;  1SI9 A;  4HKQ A;  3OQ2 A;  4LF2 A;  4DR4 J;  4I0W A;  2R3V A;  4DV2 F;  4ZVG A;  4KO0 B;  3BGL A;  1YZ6 A;  3JTP A;  1DTT A;  1FKP A;  3FBF A;  2IA6 A;  4DV3 J;  1N34 F;  4Y3C A;  1I51 B;  3GFX A;  3H4D A;  3CCL S;  1NJY A;  4IR1 A;  1DAR A;  1U1Q A;  3Q8S B;  1RWN B;  1U1O A;  1WOR A;  2XNR A;  2CXE A;  2HFS A;  1B0T A;  3PYG A;  2Q79 A;  3R5A A;  1FEH A;  1GK8 A;  5K8M A;  4NXM J;  3BBC A;  4QW8 A;  4ZVQ B;  2RDI A;  3LQV A;  2HKE A;  1S49 A;  3KFW X;  4F2S A;  1FJC A;  5CCM A;  4ED2 A;  1IQZ A;  1TK5 A;  2V8H A;  1U47 A;  4O3Q A;  2BRK A;  2YY3 A;  1MMN A;  2QMX A;  2HHV A;  2HND A;  5AE2 A;  2R2S A;  2L08 A;  2M52 A;  1M5V C;  1UWB A;  3GV8 B;  5HP1 B;  3SYZ A;  5K8N A;  1Q8I A;  1FVQ A;  1SH0 A;  1FWK A;  2K2P A;  4DV3 F;  3DDI A;  3IC1 A;  1TL3 B;  4IFY B;  4C8M A;  1JB0 C;  2W9C B;  1G6B A;  4G1Q B;  4RJV A;  4Q43 A;  2FC8 A;  3LP0 B;  4CDI A;  3FCH A;  2IVY A;  3PJW A;  1QAY A;  3MI7 X;  3PFO A;  3DRR A;  1WWH A;  1PC4 A;  4NXM F;  5KT7 A;  1CJT A;  2F65 A;  3D28 A;  2G1H A;  1RT6 A;  3G71 S;  3W63 A;  3DHW C;  1MNE A;  4UF4 A;  2MKK A;  2YNH B;  2GJF A;  4QQB A;  3DYA A;  7FD1 A;  2NSB A;  5C42 A;  4C0O C;  3M2R B;  4K5R A;  2F8H A;  4DPT A;  2HRT A;  1RWP B;  3WX4 A;  1R0A A;  1RP5 A;  3RBE A;  2I38 A;  1M90 T;  3J81 j;  2NUU G;  1KTV A;  2ZZM A;  1FJG J;  1Q8K A;  3ZZT A;  3M8Q B;  1RT4 B;  4MIW A;  1KVJ A;  2AYG A;  2YQ3 A;  4WFZ A;  1XQI A;  3ILL A;  3OLA A;  1HHQ A;  4IOC Q;  1AUD A;  4LRD A;  2MDA A;  4U95 A;  2ZJR Q;  3PX0 A;  1N48 A;  4UW2 A;  4URG A;  1U1N A;  2R8K A;  3C6U A;  5KFY A;  4Q5V A;  2DO0 A;  4LSZ B;  5B0C A;  2KHC A;  4M5H A;  4E2F B;  4ZVT B;  4U7C A;  4OZ2 A;  1H2U X;  2M4M A;  5B0G A;  1REG X;  4V1A k;  1F6T A;  2ATL A;  2RUS A;  2Z0G A;  4DCP B;  1FJG F;  5L9X A;  1FCA A;  2QYC A;  4PRF A;  1VIS A;  4LBP A;  2BJ9 A;  2BXJ A;  4LF1 A;  4RW8 B;  4EZ6 A;  4OX8 A;  2MQ8 A;  1UMJ A;  3CUN A;  3UN5 A;  3ZTS A;  6FDR A;  2WSE C;  3CJ0 A;  2CDR B;  2VBY A;  2W1B A;  4DV5 J;  1RQ0 A;  4NLU A;  3BQ0 A;  4MIB A;  3MAQ A;  1XTZ A;  2RQM A;  5DLF A;  1CQM A;  4Z7C A;  4KYZ A;  4UQT A;  2E5L J;  2Y1I A;  2B9X A;  2XM3 A;  1ROF A;  5DDP C;  4CO2 A;  1S6U A;  5DDO C;  3TOQ A;  1UZD A;  5J2Q B;  5H9E J;  1QSY A;  1QAI A;  1Z4U A;  4KC5 A;  2HVI A;  4OI6 A;  4H4K C;  2F8E X;  2DGW A;  4CLZ A;  4QIF A;  1Y0H A;  2LQ5 A;  1LNQ A;  4DR6 J;  3H0P A;  4HHJ A;  4HH1 A;  1AXQ A;  1T0T V;  2RB7 A;  2MLX A;  1Q16 B;  4CTA A;  1KLN A;  3IBW A;  1XC9 A;  1XWL A;  4GVB A;  4IH6 A;  3FEZ A;  4RU2 A;  4DV5 F;  1GTH A;  2LMI A;  1DY3 A;  4OJ3 A;  4HVZ A;  2BA9 A;  2ZBI A;  2DIT A;  1LK5 A;  5C2G A;  5J2M B;  4U8Y A;  2A1B A;  2E5L F;  2E5I A;  1TKD A;  2H5E A;  3BN7 A;  4U7U D;  3QWU A;  4ZCM A;  2N3L A;  4I2P A;  4KHM A;  2HGM A;  3UI3 A;  3H90 A;  2OJ3 A;  3CJR A;  4J9O A;  2IIH A;  4DU7 A;  4MFB B;  1C1C A;  3NL0 A;  1RZM A;  3R97 A;  2Z56 B;  3W8P A;  1BGX T;  3CCM S;  4G1P A;  4PWU A;  3ZZZ A;  5DGA A;  4DR6 F;  5F8N A;  3BM7 A;  2AIR B;  1HLW A;  2UP1 A;  2KT3 A;  5AT1 B;  1OS5 A;  3H8Y A;  3OTC A;  3KUE A;  2XTJ P;  5SZT A;  3T1H F;  4NYO A;  3PO4 A;  2M3D A;  4JV2 A;  2F5G A;  3CED A;  3QAT A;  2RDJ A;  2BV3 A;  4YFU A;  1R8P A;  4ILR A;  5ETV A;  4PXE A;  2VA3 A;  3A12 A;  2LCW A;  4WYL A;  3MMC A;  1ZBT A;  3TUI C;  1SXL A;  4I7F B;  4UUW A;  1XEZ A;  4LVO P;  3ZXW A;  5I42 A;  1T9V A;  2PFF B;  2ZH7 A;  1S0V A;  1KTQ A;  3PR4 A;  1S1W B;  2V4J A;  3CD5 A;  2D7S A;  4QPX A;  3MPW A;  1GMW D;  4X4S A;  2BJ3 A;  2KB2 A;  4NAS A;  2VAS A;  4DQQ A;  4CI0 B;  2DNG A;  4IRD A;  1U7L A;  4H54 A;  3CUL A;  4C0B A;  1RK8 A;  2DIU A;  1ZPV A;  2ZFH A;  3S7R A;  5AE1 A;  3MMA A;  4DQI A;  2BW7 A;  1OO0 B;  4CH0 S;  3RTV A;  5E5N A;  3NG8 A;  1IBK J;  2R7V A;  3ZTP A;  4BS2 A;  4IR9 A;  2DNK A;  3N28 A;  3AD9 C;  3HK2 A;  2AKW B;  4ZPA A;  1HQE B;  2CG8 A;  1RTJ B;  2M2B A;  2BAB A;  3RJM B;  2AJ4 A;  2XI3 A;  2JVO A;  2QA4 G;  2EXU A;  2GNK A;  2RF2 B;  1LXJ A;  3DRY A;  3R6G B;  3Q0A A;  2IRU A;  4ED4 A;  4WZM A;  1RYR A;  5GME A;  2I2Y A;  1T03 A;  4OI0 A;  2P5V A;  1VHI A;  1OJ4 A;  4DF8 A;  4QWC A;  2OUG A;  1WF1 A;  4IDK A;  2PEB A;  1CBK A;  2HWT A;  1NK5 A;  2AF6 A;  2EFG A;  4TLR A;  1IBK F;  2GIF A;  2NS1 B;  3HFZ B;  2HHQ A;  4NI2 A;  5EX0 A;  1S4F A;  1N5V A;  3SQG A;  1DTQ A;  2CZ9 A;  2W01 A;  1RWK B;  4XIU A;  3V4I A;  1S9E A;  3LP1 A;  3D6H B;  5DDR C;  1UVN A;  3JSM A;  1JQG A;  5BXI A;  3BGU A;  3QGP A;  3LAM A;  1N5Y B;  1NCL A;  2NR0 A;  5DG7 A;  1RKI A;  2J6S A;  5L38 A;  1TKZ A;  3T5H A;  1SIZ A;  2FC9 A;  1EKS A;  4A8Y A;  2B9E A;  3C16 A;  3VF0 B;  4F4W A;  4CWB A;  3KHH A;  2YKM B;  3I0S B;  2XMM A;  4ENO A;  4H4M B;  4DL5 A;  2QL5 B;  4DSE A;  4B9N A;  3TAM B;  3QT6 A;  4KQZ A;  2ADB A;  3DDN A;  3FFI A;  4KGX B;  3UDC A;  1XJW B;  3W64 A;  1O51 A;  3KLG A;  2APO A;  2WVD A;  1IKY A;  2LFV A;  1LWE B;  2GVZ A;  2UU9 J;  1VQ7 S;  2ZC4 A;  1F2H A;  1JLF A;  2W24 A;  3T6J A;  2HMI B;  1S6Q B;  4TY8 B;  2QX0 A;  2FPH X;  2E7W A;  4AL7 A;  1NO8 A;  5MAO A;  2G13 A;  3FZB A;  2W2P P;  4OHZ A;  3DMJ B;  3QZ8 A;  5GAE U;  4WP9 A;  4DV7 J;  2VHG A;  3MOJ B;  5H1S V;  1R8A A;  5C25 B;  1X5O A;  3Q8Y A;  2FVC A;  1JLE B;  1ULR A;  3NCR A;  3L4B C;  4LQ3 A;  2HRY A;  4CLT A;  1SUQ B;  2QO3 A;  3KKF A;  1A9N B;  2ILY A;  4OYM A;  3CCW A;  3KJN B;  4GC6 A;  4JUZ A;  2R7S A;  2UU9 F;  2DK2 A;  2KU7 A;  1FDA A;  4UST A;  4K4S A;  4W98 A;  2RS8 A;  4WXO A;  3K5N A;  3HVR A;  1S72 S;  2JC1 A;  3LP2 B;  4OZ5 A;  3EYZ A;  4DX7 A;  4C0H A;  1JJ2 R;  3OV7 A;  3DFE A;  5HVF A;  3JQJ A;  4G6V B;  4DV7 F;  4NLX A;  4XPE A;  3IFE A;  1YDL A;  3BZQ A;  2WOM B;  1O5J A;  4ER8 A;  1MWQ A;  5IWA J;  4NCB A;  2IM0 A;  3DU5 A;  1Q7Y T;  1HWU A;  1RAF B;  1M5P C;  4DJB A;  2V94 A;  5IT0 A;  5KFX A;  2X7I A;  5E3A A;  5D0E A;  1IKV A;  1MG7 A;  4DZ6 A;  2L3M A;  4JI1 J;  2MXY A;  1WG5 A;  3QRR A;  2QA1 A;  4DR2 F;  3M1V B;  4YHH J;  4NCG A;  5CAA A;  3UNG C;  3FMW A;  1WKK A;  1UPM B;  1URR A;  3OFG A;  1FWL A;  5KFB A;  5D3G A;  3RUB L;  2DXD A;  3KUH A;  5IWA F;  3OL6 A;  4ES3 A;  2QT7 A;  3SQO P;  4RLE A;  1AUS L;  2MZT A;  2GGP A;  2XZT B;  3MCM A;  1JMT A;  1YBA A;  3D66 A;  4KHR A;  3CNQ P;  3CJT A;  4E98 A;  4K59 A;  1RA7 A;  4KR0 B;  1HW8 A;  4L72 B;  3TUZ C;  1D9D A;  2CPJ A;  1JLG B;  4JI1 F;  2CQP A;  3ZNJ 1;  5BR8 J;  4CP5 A;  4XDD A;  5D0G A;  1FKO B;  2V4Q A;  3AJD A;  5E3R A;  4YHH F;  4KGZ B;  3W66 A;  2FLP A;  3KK2 B;  5KFE A;  3PYE A;  3HP6 A;  4E0D A;  4WKY A;  1OIA A;  5E3Q A;  1CPZ A;  4DQP A;  3I5B A;  3DU6 A;  4K4T A;  1I6J A;  4H4O B;  4YB6 A;  3MR5 A;  1O6X A;  3A8K A;  3RB3 A;  3P49 B;  1LW2 A;  3D5M A;  4O44 B;  2YWK A;  9RUB A;  2MTL A;  5CZV A;  3BRE A;  1TL5 A;  2OD4 A;  3K5O A;  1M5O C;  4NZ0 A;  3O1L A;  3W1Y C;  1RB0 A;  3I32 A;  3TZY A;  4WYW A;  1S1V B;  3DC2 A;  4HYK A;  2OEJ A;  2CAJ A;  2L9D A;  2M7S A;  4DDF A;  3G8T A;  4F67 A;  2JNJ A;  2ZBC A;  2DHA A;  5BR8 F;  3PG9 A;  4LF6 J;  3G2X A;  2IA0 A;  1BQX A;  3NCQ A;  4FXW A;  1FTC A;  4C9D A;  4Q0B A;  1UJ5 A;  1R0C B;  1YTY A;  4KH0 B;  1OY9 A;  1VLO A;  1B0P A;  4IH5 A;  1SL1 A;  4LJM A;  3TA1 A;  1IBL J;  3MED B;  3MAA B;  4HAC A;  3PTW A;  1NM2 A;  1PJ7 A;  1HBN B;  3THV A;  1Q53 A;  3EXY A;  5D4N A;  3GPA A;  2DEI A;  5L46 A;  3L3C A;  4PYA A;  4U67 Q;  5A8R A;  5HO4 A;  1S1X A;  1JWW A;  4WP8 A;  4NLS A;  2AMC B;  2Q6C A;  4LF6 F;  1NXI A;  4CT8 A;  1DHM A;  1KBR A;  2EBG A;  1UVL A;  5B0B A;  4DV0 J;  4HL9 A;  2RU9 A;  5B0F A;  3TVY A;  4PYD A;  1O0P A;  4RX6 A;  2ASY A;  4RW6 B;  2FLO A;  4X4P A;  3CMQ A;  1FRL A;  3HMJ G;  2I5J A;  2KFZ A;  2CPF A;  3KG4 A;  4GC7 A;  4ECX A;  4C7Q A;  3OTO J;  2A0F B;  4M5N A;  3GFH A;  3AY0 A;  2KYX A;  2VU5 A;  5FLX Y;  2IAJ A;  4DQR A;  4CT9 A;  3AA9 A;  2WBM A;  1KQF B;  1LK7 A;  5HMX A;  2FZK B;  1NUE A;  5GVQ A;  3A8I A;  1KDN A;  4DV0 F;  1AW0 A;  2YKQ A;  4DQS A;  2JWN A;  2LP4 A;  3SI8 A;  1A0O B;  5D4O A;  3CGI A;  4I68 A;  1TUV A;  4R25 A;  1JXE A;  4BC9 A;  1HNI B;  3W2W A;  2EFV A;  3M8R A;  3J7A 1;  4OHY A;  1N5Q A;  3QQC D;  4TLQ A;  1SVD A;  3NWG A;  2B4U A;  3FCW A;  3OTO F;  3VAK A;  3UO0 A;  4JB8 B;  1IKW A;  3P5B P;  1FRH A;  4ZJQ A;  1H7X A;  1PKU A;  3G96 A;  2ZOM A;  5KFA A;  4V19 X;  1TVR A;  4X4T A;  2XMJ A;  1ZAV A;  1KQS R;  1NB7 A;  3HZE A;  2ZE2 B;  4B3O A;  1G7C B;  4F4K A;  4FF1 A;  3OW2 R;  1RWW B;  1RT5 A;  1UET A;  3I31 A;  2M9K A;  2DGO A;  4P75 A;  2VF3 A;  2EK1 A;  3M8Z A;  1KD1 T;  1JJC B;  5DM7 Q;  1NPK A;  3DN9 A;  3MAH A;  4IH7 A;  2HHW A;  1JLQ B;  4KO0 A;  4QYR A;  3GV7 B;  4NEY A;  2XSF A;  4OYI A;  2X3D A;  5KG1 A;  2PA8 D;  3SZ2 A;  4B9S A;  3GG0 A;  3RRG A;  2C2M B;  2P9E A;  1TP7 A;  3P3D A;  3EDQ B;  3G6Y A;  2HIQ A;  4TU7 A;  1UZH A;  1S59 A;  3I5A A;  4YME A;  4ED1 A;  3JYT B;  4FS2 A;  3PRD A;  3OXF A;  5FDL B;  2JL9 A;  1RCO B;  3BV8 A;  4A4J A;  2KT2 A;  3C66 A;  4OIX A;  5L1L A;  1GX5 A;  1WC6 A;  5KG2 A;  4O3P A;  3MMB B;  1X4D A;  2KDO A;  4FBU A;  4Y2M A;  2C3O A;  4ZLN A;  2CQC A;  3KJV B;  4J9K A;  1X8D A;  4BWM A;  4X62 J;  1SQG A;  4RZR A;  3BN4 A;  1KWM A;  3HHK A;  5GAE I;  4URS A;  3JSR A;  2CFX A;  4EI2 A;  3EE3 A;  2POK A;  1KC8 T;  5E41 A;  5HP1 A;  1IWA A;  3W5Y A;  2YNI B;  2MQL A;  3IRX B;  4TYA A;  1DBD A;  2OPR B;  1VRU B;  2C22 A;  1TL3 A;  1ZAW A;  3MM9 B;  4IFY A;  2RQC A;  3MXH P;  2DGX A;  1BE4 A;  2W9C A;  1S97 A;  1LV5 A;  3P96 A;  4G1Q A;  2DVI A;  3H5S A;  3LP0 A;  5FLX U;  4JP8 A;  3TX8 A;  5KT2 A;  2HIY A;  4YDD B;  4USU A;  2YNG B;  1FX4 A;  2JLF A;  3OTB A;  3QWP A;  2E9Z A;  2CKW A;  4X62 F;  2NPI A;  3O8W A;  1X4C A;  2GMJ A;  3G87 A;  3ULH A;  3TWZ A;  4DL4 A;  4DLE A;  2ZNZ A;  1CLF A;  4YUD A;  5HBM B;  2XGQ A;  4QOT A;  4ED3 A;  2YNH A;  4J9S A;  4MYU A;  3M8P B;  2B9Y A;  3R7N B;  4UZC A;  2H48 B;  4R8U B;  1JXV A;  3J80 Y;  3M2R A;  1R7I A;  4I67 A;  2FHJ A;  2H1Y A;  1R31 A;  2V4R A;  2PA3 A;  2B4O A;  3G6V A;  2DGQ A;  4J37 A;  1V3R A;  3M6U A;  1IKX B;  4C3L A;  3M8Q A;  2HK3 A;  1RT4 A;  2OFG X;  3G4S S;  2Q3P A;  3MUV P;  1BY9 A;  2P6S A;  4HT5 A;  3ZO7 A;  1PG5 B;  2AV5 A;  4NA3 A;  2DHG A;  4DZD A;  1IBC B;  4DFJ A;  2ZZT A;  4ZPD A;  1UEU A;  2HAI A;  3R6L B;  3W9J A;  3GJT B;  2XYG B;  1BHN A;  1X31 C;  3JXO A;  4J9M A;  1EJ7 L;  2GQC A;  3UCU P;  2IM3 A;  4O3R A;  2ZH6 A;  4DFK A;  3Q2S C;  5F8G A;  1PIL A;  4DR1 J;  4Z2X A;  1SC6 A;  3TUJ C;  4CLL A;  2E29 A;  2RML A;  3I6P A;  1X0F A;  5F8H A;  3TJ8 A;  5KT6 A;  3EWG A;  2MLZ A;  2JJ4 D;  5T14 A;  4I6W A;  1D9F A;  5LJ3 Y;  3M8S A;  2IPO B;  1HFE L;  2N82 B;  5M2U A;  1FD8 A;  3VV2 B;  3GIR A;  4RW8 A;  3DHX A;  2Y1L B;  4LVN P;  4RWW A;  3K58 A;  2QL9 B;  3DNC A;  1Q5Y A;  3RAX A;  2XI2 A;  2CQ0 A;  3RZA A;  3D7S B;  1MU2 B;  2H9Z A;  2Q6B A;  4QR0 A;  2DRB A;  2XZW A;  1NHU A;  4ZLJ A;  4WFN Q;  4RPF A;  2QMW A;  2O1P A;  3MUT P;  1V3S A;  4ZN1 A;  3I9V 9;  4BHQ A;  4B3R J;  2BZ2 A;  1NK0 A;  2CVI A;  4HDG A;  5SUH A;  4I56 A;  1VJQ A;  2K3I A;  2B56 A;  1CUL B;  1Q4R A;  1I5O B;  2HAF A;  2MY7 A;  2V8D A;  5ETT A;  3FMB A;  3N9U C;  5I3P A;  3HHL C;  5F8M A;  5J2Q A;  2FJA B;  5HSP A;  1T9W A;  1FJE B;  3U1L A;  1X4E A;  6AT1 B;  4K0K J;  5EWG A;  4B3M J;  3OL9 A;  3VAM A;  1HI8 A;  4MYT A;  2XO6 A;  3IG1 B;  4TYB A;  4O0I A;  1BMQ B;  4L76 A;  3ZZY A;  3Q8Q B;  2OEL A;  3CDA A;  2FVR A;  3CT9 A;  5LMN J;  5LM7 E;  2VDI A;  5HRO B;  4TU8 A;  2DR9 A;  5DET A;  4F4Z A;  2UVR A;  2VKZ G;  3MPD A;  2R8H A;  3DGP B;  3J80 U;  3TZZ A;  4B3R F;  1TK8 A;  2CQB A;  4S0M A;  4DBQ A;  2NXJ A;  5J2M A;  3B4M A;  4W90 B;  4F4X A;  2X1B A;  1P9Y A;  3H40 A;  4ZPV R;  1W25 A;  5LSO A;  4Y34 A;  3VGV A;  5L1I A;  3J7Y I;  3VQS A;  5F8J A;  2FGO A;  2BJ1 A;  3TX0 A;  1NSA A;  1ZYQ A;  4MFB A;  4K0K F;  1PO6 A;  1REV B;  2EW9 A;  2IY5 B;  3ENV A;  2PD1 A;  1RAG B;  4OHW A;  1GXT A;  4B9M A;  1H74 A;  2NXE A;  2HQD A;  2ZVS A;  2R7O A;  1KFD A;  4OX6 A;  5LMN F;  5KFZ A;  5J1E B;  4USI A;  3KLV A;  2PMH A;  2OML A;  5KFS A;  2BOA A;  2DY9 A;  2AJ1 A;  2PEH A;  3CD7 A;  1VLY A;  4GVL A;  5IT4 A;  2B7B B;  2QFJ A;  3KG0 A;  2HZC A;  1JJ4 A;  3H25 A;  1C0T B;  1N32 J;  1FE4 A;  3ILI A;  5KFL A;  2ZBR A;  2KN4 A;  4DI6 A;  4F4A A;  5A8W B;  4I7F A;  1GMU A;  3JAM Y;  1VFJ A;  4LQ9 A;  3KYL A;  2K7K A;  4TY9 A;  3S6E A;  4K2J A;  2FD2 A;  2XEX A;  1S1W A;  4LBH A;  3DYA B;  2HHH J;  2Y0B B;  3CDW A;  4WTY A;  1TAU A;  1SL0 A;  2WB1 D;  2R8G A;  1S0N A;  4DN9 A;  2AJQ A;  3FQK A;  3DM2 B;  4JI4 J;  3HJF A;  2ZC3 A;  2B8P A;  2VG7 B;  2DT9 A;  1N32 F;  3Q23 A;  2KXH A;  3W62 A;  2HS3 A;  1RTH B;  1S10 A;  1D09 B;  4OYA A;  6FD1 A;  1FXD A;  2Z8Q A;  1MRO B;  1HQE A;  1RTJ A;  2HRU A;  4ES1 A;  2RHQ B;  4UTG A;  2Z2M A;  1Q82 T;  3S01 A;  3W65 A;  3EX7 B;  4HT7 A;  2RF2 A;  4JBC A;  1NK6 A;  4NXN J;  5F9L A;  4DR5 J;  3CD0 A;  2EK6 A;  3LW5 C;  3KK1 B;  5HAN A;  2HHH F;  2VFS A;  3TP2 A;  3MEE B;  4GO5 X;  1HWL A;  5ITH A;  5AXL A;  2BM1 A;  3K7R A;  3VZH A;  4JI4 F;  4GKJ J;  3CDB A;  2IMO A;  2Q1L A;  2H54 B;  3ISN C;  4NML A;  4F04 B;  1UWA A;  5I3U B;  4DN0 A;  2BX6 A;  5K8O A;  3K8V A;  5IC4 B;  2KM8 C;  3TNV A;  1WNE A;  5CZC A;  4DL0 C;  4JI6 J;  4Y65 A;  2DNR A;  2XC9 A;  3QT7 A;  1RE1 B;  3EUN A;  2Q66 A;  4EWT A;  2H3E B;  1N0V C;  1NEE A;  2KO1 A;  4NXN F;  4DR5 F;  3KWM A;  3PW7 A;  2O66 A;  2JEJ A;  3EDR B;  3QSI A;  4OV6 A;  1N5Y A;  3MTJ A;  1TAQ A;  3L9Z A;  3UDE A;  3DLJ A;  3KLI B;  5AXN A;  4WFY A;  1PBA A;  2G0I A;  3AB4 B;  4GKJ F;  1FRK A;  3A3N B;  1LEO A;  4MH8 A;  1MML A;  3I56 S;  3MMJ A;  1F3V A;  2MQN A;  4C11 B;  4ZP9 A;  4FNI A;  2V2Q A;  1EKR A;  4C8K A;  2ACY A;  2YKM A;  3I0S A;  4OI3 A;  1O8B A;  4QIE A;  4ECV A;  1QVF R;  2EKN A;  4FYY B;  5KT3 A;  3W5X A;  2R2R A;  3TAM A;  2XUL A;  2XCA A;  3GON A;  1WEX A;  3W2V B;  2D3O 1;  2RE1 A;  1AZS B;  5LMU F;  2RKI B;  2JLE A;  3E01 B;  3RRK A;  2NYI A;  4HI2 A;  2CQH A;  4Y2K A;  2DRA A;  5ETK A;  4DLG A;  1S6Q A;  5KOX A;  1JJH A;  4TY8 A;  3HKW A;  4DL2 A;  3EJM A;  4MKB A;  4NWB A;  2H65 B;  2J8S A;  1SIW B;  2VC0 A;  4OYP A;  2F40 A;  3DMJ A;  3FJ2 A;  1X4G A;  4RW4 B;  2HFZ A;  2ROP A;  3QJJ A;  5CCL A;  4AND A;  4YDX A;  1CEZ A;  5C25 A;  3CE8 A;  1R8B A;  3GJQ B;  5DG9 A;  3VCD A;  1QAX A;  4BBY A;  1JLE A;  1N36 J;  2A6O A;  3KMS A;  3V4M A;  1SUQ A;  2QMU B;  1TEL A;  2FUG 9;  3QID A;  2BKO A;  4JYA J;  2W2N P;  1U4B A;  3IR6 B;  2M0G B;  2K7J A;  1FDN A;  1U2C A;  2RUG A;  4JI5 J;  3Q8U A;  4CM2 A;  3NS7 B;  2P8I A;  5GAG U;  1P1L A;  3EIC A;  3LP2 A;  1H0H B;  3JB9 k;  1N56 A;  3RBX A;  5B0E A;  3CC7 S;  1T9U A;  1VQ9 S;  3KDN A;  1W2I A;  2VL1 A;  4B17 A;  5DLG A;  4N8N A;  1F9H A;  2WOM A;  2CQG A;  1HQU B;  3I87 A;  2GA7 A;  4KHP J;  4PG5 A;  2RH3 A;  3CJ4 A;  1N36 F;  4PXD A;  3Q83 A;  5KAK A;  5L1K A;  3BSN A;  4IUF A;  3A8E A;  2OAU A;  5HAT A;  1H2T Z;  3LGH A;  4MKY A;  3IWL A;  4JYA F;  3Q2T C;  2QEX S;  2MZS A;  3I4H X; 
#chains in the Genus database with same CATH homology
 4RL1 A;  3IM8 A;  2VZ9 A;  2UV8 G;  1MLA A;  5CZD A;  2QC3 A;  5CZC A;  3TZX A;  4RR5 A;  2VKZ G;  4QBU A;  3TQE A;  3TZZ A;  2PFF B;  2H1Y A;  2CUY A;  3RGI A;  2JFK A;  5DZ7 A;  2G2Y A;  3H0P A;  3K89 A;  2JFD A;  2VZ8 A;  3HHD A;  5DZ6 A;  3HMJ G;  2G2O A;  2QJ3 A;  2G2Z A;  3TZW A;  3TZY A;  3HJV A;  3R8Y A;  2G1H A;  3R97 A;  3SBM A;  3QAT A;  3G87 A;  3EZO A;  2C2N A;  2HG4 A;  3PTW A;  1NM2 A;  2QO3 A;  3CJ8 A;  3IM9 A;  3BV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...