3K89A

Structure of x. oryzae pv. oryzae kacc10331, xoo0880(fabd) complexed with glycerol
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
MTESTLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALSQGGPEEMLNRTEYTQPALLAAGVAVWRLWTAQRGQRPALLAGHSLGEYTALVAAGVLSLHDGAHLVRLRGQFMQAAAPAGVGAMAAVLGAEDAVVLEVCAEAAGSQVVVPANFNSPGQIVIGGDAAAVDRALALLAERGVRKAVKLAVSVPSHTPLMRDAANQLGEAMAGLSWHAPQIPVVQNVDARVHDGSAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGKVLSGLIKRIDKSLDARPLATPADYAGALDAWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl CoA-ACP transacylase
publication title Structure of X. oryzae pv. oryzae KACC10331, Xoo0880(fabD) complexed with glycerol
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Transferase
total genus 108
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3k89A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3k89A01
5DZ7A 3G87A 3HMJG 3H0PA 2JFDA 3TZWA 2HG4A 3BV8A 3IM8A 2PFFB 2CUYA 3QATA 2QJ3A 5DZ6A 3PTWA 2VKZG 3TZYA 3SBMA 3EZOA 4QBUA 3HJVA 2C2NA 3IM9A 2G2OA 2VZ8A 3TQEA 3CJ8A 3HHDA 4RL1A 3RGIA 2JFKA 1NM2A 2G2YA 2H1YA 4RR5A 3R8YA 5CZCA 1MLAA 2G1HA 3TZZA 5CZDA 2VZ9A 2QO3A 2UV8G 3K89A 3R97A 3TZXA 2QC3A 2G2ZA
chains in the Genus database with same CATH superfamily
2BR0A 1X5OA 2B7CB 1IVZA 1S12A 4KGKA 3VGSA 4JI7F 4JI6J 1V3ZA 2DYAA 2IAJA 3R1LA 3HD2A 1RB0A 4Y2IA 3SQOP 2F8HA 4TY8B 5EUHA 2QV6A 2E44A 1ZZFA 1UJ5A 3DLLQ 1ZH5A 1RWWB 4Q7AA 1ZPVA 2RQ4A 1UVNA 4DQQA 1KS2A 4P73A 2CDRB 2ZUGA 4C8MA 1RT2A 4WBFA 1JLAA 4DV6J 4DQIA 2FGOA 4JI1F 4DL4A 2ZE2A 4USIA 3C6UB 1OYEA 4Q0BA 4P72A 2AGPA 3DLKB 1NHVA 3K0JA 4N8OA 4PUOB 9RUBA 1N0UA 3MFIA 3FGVA 4K7QA 3BYRA 4C8NA 2ACYA 5GAHU 1RZMA 4K2JA 1SUQB 1Q8KA 2IFXA 4DV0J 3NG8A 4EZ6A 3M6VA 2I2YA 1T03A 2WSFC 5IT0A 2IPOB 1EETB 1KHWA 1IKWA 1UFKA 3CJTA 1B3TA 2LQ5A 1R0AB 2HBYB 5KFAA 3N9UC 1Q86T 2E5LJ 2EG1A 3EZ5A 2DHXA 4ILMA 2XMJA 2A18A 4JI2F 1AYEA 3FCWA 3CJSA 4O3QA 5LMNF 3WBZA 2XYHB 3T5LA 4PQUB 3OXFA 2FGCA 2DXDA 2XB2D 3M7VA 3H0PA 3HVTB 4UF4A 3QIPB 2W2NP 4LSLB 3MR2A 3CVKA 5L1JA 2OPRA 2WSCC 1RAJA 3T1AA 3RB0A 1V5IB 2OEJA 5F8JA 3UDEA 3GR0A 3AFGA 5L39A 1LV5A 3KUHA 2IM2A 4DX8H 1WG1A 4RWXA 1U1NA 4Y65A 1WC4A 2WBRA 4G65A 3K59A 3CC4S 2IVYA 2B4PA 4ZA1A 1HR0F 2EVZA 4KTQA 3DRRB 2G1DA 3HFVA 4YR2A 3FEYB 3CJ0A 3BB5A 3R7NB 1SL1A 2K1RA 2DNNA 1B64A 2HQFA 3D0IE 2XYGB 4NXMF 1C0TA 5DM6Q 1RYSA 4AQYJ 1WOPA 2XS7A 2CAJA 1NH8A 2V68A 3PKMA 1XMQJ 5A2QY 4R0EA 4AMOA 1OJ4A 2RRBA 5LXRA 1SIWB 5HN0A 3NNHA 3RJMB 4N8NA 1TKTB 2LQ8A 1WWHA 3R2DJ 3MMBB 3GFZA 2VQEJ 2W9BA 4K4YA 3PIPQ 3HZGA 4F7VA 2KVIA 5DZ7A 4USHA 4I69A 1K9MT 3HHLC 1RCXB 4NLOA 1YKWA 4YHHF 4UTGA 3NGSA 1LWEA 2PSZA 3OTOF 3BSOA 5HMZA 1B0TA 1PKUA 1RLCL 1JK9B 5KT5A 3OR1A 3GYNA 2AGOA 3GPAA 1HBOA 4ZP8A 1WTFA 1XK8A 4J9LA 5I42A 4ICLA 1U45A 4UOGA 2DHGA 2E9ZA 1J5EJ 2ZOGA 4WFZA 5DLFA 3H59A 1KSPA 4DR4J 4CIOA 1AW0A 2IY5B 2I9SA 3UQSA 3HHLD 5D0EA 1SJQA 2RJZA 5A76A 2BQRA 4Y2AA 4KYZA 3PYFA 1R8CA 1JWWA 1NNDA 4GKJJ 3MR5A 3VTIA 3M2RA 3BGLA 5AJ3J 5GMDA 3THTA 5M2RA 4LMZA 2GVDA 4CO1A 3K5MA 4MKVA 2Z8QA 5G0RA 5L9NA 5KFUA 1YG0A 2PC6A 4N41A 3GYGA 3MEGB 1H3DA 2RILA 2XLJA 3V4MA 5H9FK 5IZHA 3ZTPA 3CD7A 5CH7B 2UUAJ 2XMVA 3OJUA 3Q8PB 1GFWB 2UXBJ 5FDLB 3G6YA 3EE3A 3NAHA 1KLMA 5J2PA 3TZYA 2YNFA 2LCWA 3DHWC 2V8HA 3FK4A 2BJ9A 4OI3A 4OHXA 2OD4A 2C2OB 1Q1KA 5K8PA 3H4DA 3BBCA 4LSZB 4CYUA 2CWXA 4RBTA 4WIQA 2F40A 1PAEX 1YJ9S 3HJFA 2EKNA 2GHPA 2YKOA 1RWNB 1KFSA 5L1KA 4X2BA 2F65A 5CABA 5KT4A 4RW7B 3RB3A 4R8UA 3FJ2A 5J1NA 4FYDA 4QIEA 2C2EA 4EFAC 2HIYA 1XWLA 1RKJA 4NLGA 1CULB 2CQCA 2VPXB 1IKYB 3R7BB 3MM6B 3AQPA 1CJTB 4DFJA 4RU2A 5B0AA 1SQFA 2NXUA 1FXLA 5JVGQ 3GV8B 4MIAA 2DPJA 3DLGB 2E7VA 1LW2B 1N33F 4HKQA 4RUAA 2MLZA 1UZHA 1HLWA 2E1MC 5T41A 1UVIA 3UDLA 2LKZA 1RWVB 3DM2A 4G3IA 2IM0A 1NLKL 4RW4B 2N7CA 3MCNA 1LWXA 1CJUB 1HKAA 3TX0A 3W9JA 3X3UA 4QU7A 5ETNA 1RT4A 2H1YA 1IJEB 1BMQB 4Y2MA 1F6TA 4DUZF 1DTTB 3JAMU 2OGUA 1VQNS 3R7SB 4M94A 2EC2A 4LBHA 1E6YB 2UUCF 2BM1A 4TY9A 4FKXA 4K50A 5D0RA 4ZKAA 4ECXA 4BWMA 3WC0A 5HP1A 5DDQC 2D9PA 3E2EA 5CYMA 1JKHA 4LBPA 5D15A 2OMLA 4XPEA 1X5SA 5KG6A 4A8KA 1RT3B 2VDHA 1Q79A 4I56A 4UQGA 2IDEA 1S6QB 4DN9A 3V81B 1PYOB 3PEJA 2AU0A 3DRPB 4KKOB 4LF5F 2IVMA 1KLNA 2AF6A 2BXJA 2HZCA 4IKAA 4RUCA 5B0EA 2Z2ZA 1IKXB 4ED3A 1C0UA 1S9FA 3IG1A 4M1KA 1D9AA 1VBKA 5KT7A 2D3OR 2ADCA 6FDRA 1NK6A 1N5VA 2J6TA 2RF2B 3OTDA 2BE2B 3AOBA 1KHVA 2AMCB 4GKKJ 3BREA 2Z0GA 1KFDA 2DTJA 1FRKA 1P1LA 2CWKA 1TTHB 3HXMA 2YWWA 1JLEB 1XERA 2K3KA 1GTEA 2YKMB 2CFXA 1BQNB 4K0KF 3D0GE 2VH7A 2VC1A 1UFLA 3FNNA 1WC3A 1HI8A 2HWIA 1T7PA 2BJ7A 2B4OA 2UV8G 3D28A 2KKHA 2MZSA 4C6AA 4KO0A 3MEKA 2GX8A 3N79A 2CNOB 2VPYB 4DS5A 4AQYF 1RT6B 1FFSB 2A2DA 1TK0A 2KVQE 1R43A 4F4KA 4PEOA 2JDJA 2CADA 4NX9A 4MK9A 3C16A 1X4GA 4KPCA 2IJRA 2JZ5A 3J7AN 1H2UX 2K7KA 3BKFA 2R2SA 4K4VA 2MYFA 2OMOA 2QA4S 1Q78A 2B56A 2WOMB 3IAS9 3UD3P 4I64A 1V3SA 3T9ZA 3OJSA 2RB7A 4CO2A 3ZZ0A 4CWBA 4IG0B 2ZDPA 4YOEA 2F7VA 2WBMA 4C7QA 1OY9A 2XMAA 4LRFA 2UV8A 3RG6A 1YBAA 2FHOB 2KXNB 3M2UB 2WVEA 1GK8A 3D0HE 4FKYA 3AB2B 2F63A 1IBKJ 4DDFA 1KVJA 5AJ3F 4P71A 4A48A 4XIUA 2AT1B 3U1MA 4DQRA 2UXCJ 2W2OP 2FLLA 5H9FJ 4JI5J 5F9NA 5HBMA 2QX0A 4PR6A 1U6ZA 4LF6J 2FVSA 1TL1B 2UUAF 3POTA 1DY3A 3NNAA 5D0HA 5IM0A 4C8ZA 5DETA 2RVJA 5IQ6A 4DV3J 3SI8A 3DLEB 3UO0A 4NLPA 1KN6A 3ET6B 2XHWA 5ETSA 4Z37A 5DRKA 3MD1A 1U4BA 1YSJA 1S48A 2V6AA 4KFBB 1UFWA 2VD3A 1X7VA 2W4PA 5CD4A 3JYTA 2B43A 2B7BB 3IS9A 3VAGA 1RU1A 2ZWOA 1HNIA 2VG7A 5KG7A 4WFYA 3UE2A 2Q66A 3H2VE 3H90A 2GW8A 2E9TA 4KGXB 1MN7A 2HNDA 1NMEB 2IA6A 2NUHA 2C22A 2Z58B 3W1YC 3BO4A 1TELA 2MSSA 1YJVA 3OD2A 3T1HJ 2ZOFA 3UFCX 2MB0B 4IG3A 1ZAXA 5A8WB 1C2PA 1S6UA 4C8KA 1Y5LB 1X5PA 3P45B 2GAHC 4GO5X 4DG1A 4DPYA 1FI4A 4WPAA 3MOZA 4O44B 4DMZA 4C98A 2LECA 1E6VA 1CJKA 4TYBA 3P6YC 2DRDA 1GMUA 2QC3A 3V6DA 1N88A 4IH5A 2GQ2A 3QZ7A 2Y9HA 2B4UA 1N36J 4TU8A 3SDEB 4ECZA 2XO6A 1EHWA 3TUZC 3Q8QB 3I5CA 4JB8B 2V63A 4DR2F 3LP2B 4QU6A 3QLHA 2UUBF 2FZGB 1ZYQA 5KFXA 2CJ9A 3MECB 4YY3J 2V50A 3AXMA 4OI0A 3KLEB 3PDNA 1HNZJ 3HK2A 5KT2A 3O2IA 2IA0A 3DCAA 4QW9A 3M30A 1YITS 1DLOA 3MCOA 3QGIA 1T9WA 1OQ6A 2L9DA 4KB7A 4H4OB 4PXEA 4F3MA 3ULHA 2Q43A 4Y2CA 3V4IA 2CQ2A 4I4BA 4FF2A 3HHLA 5ETMA 2KTQA 4ZN1A 5LSRA 1JMTA 1FF2A 3AD7C 3B4DA 4ZJOA 3TO8A 1BQMA 4UOHA 3J7YU 4O0IA 2HRTA 2I1RA 2XY6A 2BVZA 1JJCB 2J76E 1QVFR 3C3LA 4A8YA 1FFGB 3BGUA 2ATCB 5KFTA 2HAIA 1O6XA 4KV8B 3PHTA 2XMMA 3MTJA 3MGJA 1VQ8S 2MDAA 4QZVB 3GG1A 1NCLA 1VRTA 1L3VA 3QJLA 2KL8A 3AH6A 2HHPA 1FFWB 2L48A 2EXUA 4OX9J 5E2QA 2ZKUA 3CCWA 5EDWA 4KBIA 2QFJA 4W90B 3K8VA 2BRLA 1YRXA 1RTHA 5HANA 1NEEA 4LBIA 4RKUC 3KLHB 3GE9A 1TL3B 5C2GA 1SCJB 4F3OA 1VBYA 4WP8A 2KFZA 2R7SA 3LGNA 2VOPA 2D9OA 1U6FA 3CDBA 1JIHA 3W61A 3TUPA 4QIFA 4JYAF 1UMJA 4EBCA 4PWDA 3PW0A 3LTOA 4DR5F 1HQUB 5C42A 3ONQA 3UCZP 4ZVTB 1BC6A 2HEKA 3W8PA 2FJWA 2MQLA 4IFVB 4HT7A 1X9SA 2ZH7A 1S1XA 3NL0A 4GRSA 4DI6A 2MZQA 2W24A 3C2PA 4ZVHA 2W7PA 4JV5F 3WIUA 5KFHA 1R89A 3LP0B 1FCAA 2CJBA 3G96A 4OLPA 4DQSA 1CJVB 2FLOA 3N6LA 4U67Q 1S4EA 2RD5C 1EKRA 3DRYA 3QT7A 4F4XA 2BW7A 2W01A 5DJBA 3KWMA 3GLJA 2HFSA 1RWPB 3NGKA 5DGBA 2C3PA 2DB1A 4ETXA 5G4DA 3Q22A 1BD6A 1CC7A 3CCUS 3RBEA 2GQCA 1C1CB 4YUDA 2YNIB 4FDFA 4ES2A 1TAQA 5C24B 2ZBIA 1S9GA 2CJQA 4UQTA 3Q8RB 3QMQA 3SXLA 4YN3B 3C6TB 4EEYA 2VJUA 3HZEA 1S1WB 5DS7A 2I5JB 1G4CA 3WX4A 4F0MA 4M5DB 3NNCA 5I3UB 1SH2A 2J9DE 1OSDA 3G4SS 1WHVA 2OD6A 2UXCF 2W9CA 2HK3A 3M8RA 2QLWA 4UT4A 5KG4A 2ILYA 4DR6F 3IR5B 5HO4A 3L09A 4B3SJ 4OQJA 1CPZA 3GYXB 2JHEA 3I0SB 2HIQA 5D0GA 3W2WB 1Y10A 2F1FA 1RHMB 3M1VA 3PG9A 5JMNA 3SZ2A 2H4WB 4WZQA 2DITA 4DLGA 3SCLE 2IC3B 3KLFB 1FEHA 4U7UK 4CLUA 3ZO7A 4NYZA 1WDTA 1FKOB 2AJ4A 4LF7J 1CSJA 4LVNP 1IBCB 2PA8D 5IOLA 2HYIB 1NPPA 2WK4A 4ECSA 4B3RF 3VVTA 1U1PA 1JLQB 1JXVA 4RJVA 3MM8B 1N5YA 1NPKA 2YKAA 4WCEQ 2IRXA 1WTBA 5U47A 1R8PA 1VQPS 3IP0A 4ZHRA 4XPCA 3R6LB 1RHKB 4DL5A 4LF4J 5LSLA 3QJJA 4QWEA 4NLQA 2C42A 4O23A 4JV1A 5KFFA 2CUYA 5C7PA 3NOGA 4LF9J 3QWUA 2HQDA 3OT9A 4OYMA 3NY0A 5LJ5Y 2QYCA 1U48A 4DSJA 2OH2A 3R97A 1VQ7S 1SC6A 2DGUA 5LMUJ 3MAAB 2WVDA 2VFUA 1TUGB 5LOQA 3CB4A 2R42A 3FDSA 4KGZB 1M90T 1XTZA 4J37A 3AD9C 4OIXA 2AX1A 2XSJB 2HS4A 2EFQA 4IH6A 1H98A 3JSMB 1SJ4P 1IKVA 1V6HA 1NUEA 2ROEA 2RKIA 1NSPA 5I3QA 1WNEA 5GMEA 3O8WA 3K5PA 3VAFA 4LF8F 3HHEA 5F8MA 4A8WA 1NJWA 2PN6A 3CXCR 2K8GA 1AUSL 3VZHA 3FMBA 2LLZA 3HP6A 5HJXA 5A8KA 4KGMA 3A3PB 3S7RA 3KUGA 5KFOA 3P8BB 1JLBA 1L3SA 4RNOA 1T9XA 1QDUB 4Z2XA 2HVZA 4NL5A 1PCAA 5CYQA 1HWKA 3DGPB 4ALZA 2SXLA 1FTCA 3PYEA 3VF0B 1YJWS 4QWAA 1RTIB 1RE1B 3CIMA 1F2GA 2OPQA 1ZM4A 1DRZA 1REVB 2B9XA 1Y0HA 3JSBA 5HL7Q 3WQPA 1QE1B 4RWWA 3D6FB 3R5BA 3W3SA 3D54A 4DOZA 1U02A 1FRHA 4OI6A 2XMWA 1NO8A 4ZJLA 4J9SA 2OTJS 3G6VA 1SKSA 2KH9A 3BJYA 4B9TA 4ZP7A 2VG5A 4I2PB 4ECRA 4WU3A 1NK0A 4NCGA 5BR8J 1I6JA 3IMQJ 2KHCA 2POKA 3ZZRA 1RAAB 1SPBP 5B0CA 1TL7B 4CO0A 1JLFB 3UVJB 1O5JA 2AYGA 5IWAF 1MMLA 3PFOA 4P2MA 1NDCA 2KXHA 1VIOA 3EGZA 2J0SD 2R8KA 4ES3A 3MEDB 1KQSR 3V2UC 1QM9A 3F44A 1T9UA 4NLSA 2XULA 2DO0A 2FHJD 3PW7A 2ZVSA 1T8EA 2PMWA 4K8RA 4YMEA 3Q8UA 4NA1A 1IQTA 1S1TB 1KDNA 3LP1A 1CBKA 3BGFA 3DMJB 3I82A 2CVEA 2AV5A 2UXDJ 4UZCA 1C1BA 4LFBF 3N5FA 2GC8A 4PQAA 3FBEA 3OXGA 2MXYA 2XY7A 3L7OA 4RLEA 5K5MA 4ECUA 1VQYA 5SUHA 4NPOA 4ZJQA 1LQ9A 2F8MA 3HHKA 2VFSA 3Q23A 4ZPAA 2O01C 4C8OA 3T5HA 3QQCD 1BE4A 4OX6A 3NGRA 4JOUA 2LU2A 3RBXA 3J7Z5 2HRYA 1QTNB 5GADU 2B6AB 1S6OA 5L1LA 3DOLA 3VAIA 4MYTA 1XR7A 4DV5J 1H38A 2MKSA 2DNPA 2WONA 4DV1F 3THPA 2V67A 1U24A 4QCLA 5IT9U 4LSLA 4YP3A 4HI2A 3BF4A 3THVA 4DV4F 4RW6B 1Q81T 2PGCA 2BA9A 5E3QA 3LH2S 4DR1J 1J2VA 4DUYF 2G9OA 1AFIA 2XY5A 2HK2A 2DGQA 1VJQA 2BJ3A 2CPYA 4ERDA 4C3MA 1Y4ZB 1OPZA 3AA9A 4IRCA 4USVA 3OTBA 3JSYA 3JXOA 3H7HB 1HHQA 1L5UA 2WB1D 4C0BA 1GMVA 1RLDA 3DDNA 4K5RA 1XNQJ 2EG2A 3NP5A 4P2XA 1RP5A 3D4JA 1B7YB 3NS5A 3T1YJ 1S6PB 5D3GA 3FUYA 2D7SA 2YH1A 1U1LA 1G2EA 2HNYB 2PMZD 7AT1B 4LSNB 1DTQB 4AL5A 5HROB 3UI3A 1MU2B 3F0NA 1ZA1B 4K59A 2VFVA 4TU7A 1QUVA 4HDHA 3HMJG 3TUJC 2H65B 3MM5A 2JLEA 2R7UA 4GVBA 1VBZA 1TKZA 2QL7B 2HHQA 2D3ZA 1JXEA 3M2VB 4I6YA 3CJKA 2N3OA 2X1BA 1SV5A 1UJ4A 3FZ2A 4X66F 5L38A 1Y5IB 3AB4B 4J9VA 4ELTA 3CC7S 1VQKS 1K44A 2JFKA 3O3LA 4USMA 5F8NA 4OZJA 4WKYA 3BGRB 3VCDA 4K4ZA 2DH8A 3D67A 3FC9A 3IC1A 2C2RA 1HQEA 2XZTB 3EX7B 3UPFA 1SJFA 1S1VB 2P2CB 3G9CA 3ILLA 3DLHA 4CNZA 3NCRA 2D1CA 4NYPA 3OR2A 4OMFG 2ZM6F 2KO1A 2Z2YB 5LJ3Y 4QYZK 2MQNA 2VQFF 1WD6A 4RX6A 2HQ3A 1OSCA 3DU5A 1SC3B 3K5OA 1ZPWX 2ZFHA 4DPTA 3TOQA 3UR3C 2FVRA 1HBUA 4F8RA 3DYAA 1I5OB 2Z2LA 1AA1B 4AXJA 4DV7F 4BC7A 1PGZA 3SEOA 1X0PA 2HHTA 4NMXA 1APSA 2MKCA 1GNKA 3EWGA 7FDRA 4ZLPA 3KK2A 1KVKA 2OO4A 1UW9A 2XQCA 1CULA 1GXTA 1X4CA 2QMUB 2LXIA 3HO1A 3MM6A 2MGZB 3PM9A 1A0OB 1QUPA 2ZD1B 2GVZB 4ZCMA 4H4MB 2ZH2A 3HDSA 1X31C 5A0YB 3LWLA 2EK6A 5KOXA 3NGUA 2L9NA 1B99A 4DSFA 4TQSA 1WEXA 1EQ0A 3BQ2A 3GJQB 3CNQP 1NKBA 3MAQA 1XBWA 2PA3A 2V4JA 5HMWA 3X1LB 2W4CA 3OW2R 3KFWX 1OO0B 5KG3A 5C25B 1GMWA 2BKPA 1FK9A 1HBNB 3QGHA 4G6VB 4KJIA 2ALZA 3ILOA 3M05A 2HG4A 2QJ3A 3ETOA 2G13A 2L41A 2PDAA 1TVRB 4X4TA 1TZ0A 3L7PA 5F8GA 1PC4A 4ENOA 4OL8A 2MPUA 1R6YA 1WJ9A 1LXNA 5MLCV 3PR5B 3QZ8A 1KONA 4J7CA 3KJFB 4NEYA 2AD9A 3KLVA 2VOOA 5EHHA 3CCES 5D78A 1SL0A 2EKYA 3QT8A 2XCAA 1A6LA 1YX2A 1GX6A 3SFGA 1WOSA 3MI7X 1Y00A 4Z7CA 2DXEA 1ZTWA 2MQOA 3I5AA 1FD8A 1VQ4S 1Q53A 2VF3A 3DOMB 4K4UA 2KT2A 4ED8A 4WU2A 1KD1T 3QO9B 3D3CJ 5CZDA 4NI2B 2BKOA 5KFYA 3ISND 3CD0A 3R5AA 4BHQA 5K8MA 3V5RA 1IKXA 2LDYA 4NA3A 4RW8B 3DDIA 2NCKL 2CNNB 1Q0NA 4YB6A 2HMIB 1PJ5A 4F25A 1VI7A 1WORA 2DGVA 3E01A 3MTKA 1GX5A 3I56S 1CLFA 2ZJQQ 5KFJA 1LK7A 3KK1A 1NK8A 1S7HA 2IAJB 3M9OB 3MUTP 4JI8F 4O4GA 2JEJA 2YKMA 3QFWA 2CQ4A 1OMSA 4LRAA 4FVMA 1SH3A 1XMOF 4OZ3A 5GVQA 1LEOA 3CJ2A 1RT2B 4DR3F 3GU0A 4X4VA 3K2YA 1JLAB 1RWMB 2FJEB 3L95X 4LR9A 1PC5A 2ZE2B 1UETA 4J9RA 2K3IA 4Q0BB 3O6QA 4ZIVA 4KH0B 4CTAA 4RW9A 3I96A 5KAKA 5I4MA 4TQRA 2WVFA 2RS8A 3OV7A 2EFVA 1VQ5S 3QATA 1G1XA 3VQSA 4CDIA 4FNIA 4GVLA 3PIOQ 3G86A 3CCRS 1XEZA 1T03B 4LF1A 2IBKA 3VV2B 2UVRA 1LXJA 3M32B 1W25A 2YQ3A 1UAWA 1IKWB 4AUKA 4NZ6A 3DRSA 2J7KA 4FS2A 4OZ1A 3KHRA 4OJ1A 2VICA 3DU6A 1OY6A 4JI4J 2MY8A 1VQMS 5FLXU 1SIZA 2NXNA 3TWZA 1AZSA 2BDPA 3OVAA 5GAGI 4ECQA 1NJIT 5DO2A 1RAEB 3SFUA 4ELVA 2LMIA 5IFMA 4KRWA 3TA1A 4IQMA 2OEKA 1RUSA 2MMYA 2HHUA 3BKUA 3CGIA 1FJGF 2HURA 4JI3F 2N82B 4J9UE 5EX0A 2OPRB 4I0WA 2I0XA 4NLTA 2F4VJ 4QIWD 2FHJA 2D3O1 1EQMA 1NBEB 1HWIA 4F50A 8AT1B 2GMLA 4HYKA 4QQBA 1LK5A 3LGHA 3ZTRA 2R2RA 4KHMA 2A10A 4LRDA 2XMKA 4RZRA 2PEHA 1IBMJ 5DGAA 3M8PA 1F9EB 5KFKA 2LEBA 2K1RB 1ICEB 4H4KA 5CYJA 1U26A 1O8BA 2CQDA 2JEIA 3PR4A 4QYZJ 1HD0A 2QA2A 5HATA 2AEMA 1QSSA 1RHQB 3GCXP 2Y1LB 2FJBB 3G82A 4YEAA 3T41A 1UVKA 3W65A 2DGTA 4JI0J 2M8HA 3MMCA 1L3KA 3HFKA 3TVYA 1RT5A 5LT5A 2M7SA 5B0GA 3PO5A 3TJ8A 3C66A 1EX8A 5IV4A 1LWEB 2GGPA 1JLGA 3OR1B 3QT6A 2NYHA 1HBOB 1L3TA 4MKAA 3W64A 2ZH6A 5I42B 4ICLB 1ZBTA 2EEYA 3KXDA 3M9MB 3R5JB 4EBDA 3I4HX 2FDNA 5KFEA 3TVZA 1VQOS 1PG5B 2QMWA 1XC9A 3OL7A 4N76A 4DV2F 3ITHB 1NJYA 4URGA 3RW6A 4NLXA 3W66A 3ENWA 3HVRA 3CMAS 1EB0A 3NMAA 3HLUA 1JNRB 1VJWA 2J0QD 4NZ7A 2AJ0A 4LIRA 3T3FA 3M2RB 2W2QP 3CUNA 2PD1A 4OYPA 3PJXA 1F60B 1IBLF 2GVDB 1XNRJ 3K89A 3BKTA 5DG7A 1XMBA 3KK3A 5G0RB 5F0WA 1IN0A 4DL6A 2R8JA 3EVWA 4QR2A 2LXFA 5EGYA 3LP2A 2DKOB 3HPOA 1H74A 5DQHA 4RNMA 5J2PB 3U02A 1HWJA 2YNFB 2JEFA 2FTRA 1SKWA 3H5YA 1O0PA 4ZLNA 4R5PA 1AROP 5MAOA 2LEAA 3KLEA 4USJC 2HRUA 3OTCA 1HL6A 5HVFA 3CDAA 4CYUB 1HYSA 4ZVGA 3OUYA 4MK7A 4LR8A 4ECYA 4ZS6A 4PG4A 2DRBA 1N32J 4B9NA 1IWAA 3CCVS 3MM9A 3IRWP 2EFNA 2KM8B 3NBPB 4F2RA 3RRGA 4EYIB 2QLXA 1V3RA 2XWYA 3G2XA 4R8UB 1HW9A 1CS4A 2YWFA 1ZETA 2HZAA 3R1HA 3PRBA 1H73A 1RACB 4DSKA 4NLWA 4LT6A 3M8QA 2NYIA 1WHYA 3I5BA 1RAFB 3W60A 2JC1A 3RBZA 5HVHA 3K8WA 4OJGA 4A8MP 3D2WA 3KHGA 1UEVA 2W8KA 2I6WA 3HD1A 2ZC3A 2LQ9A 4QPXA 4ZCLA 2DRAA 3AXKA 3EPGA 7FD1A 5E7OB 2P6SA 3VGUA 4X84A 2Q3PA 4OYXA 2ZHBA 4HDGA 2N4DA 2YQ0A 2UU9J 3R6GB 1IM6A 3DM2B 3E3XA 3RAXA 3T5KA 3BM7A 1H6KX 4JBCA 1RADB 2HSEB 3M8YA 1RDRA 1YJRA 2CDQA 4FXWA 3MMAA 2VG6A 1RT4B 3CCTA 2DK2A 1D9DA 3C14A 1U47A 2WW4A 3CJQA 1I94F 2V4RA 1G6BA 3LPYA 1W2IA 3KJVA 1KNZA 4C0OC 4G1PA 3EYZA 4JV0A 1FRLA 1T9TA 4CH1A 2DHAA 4F4YA 1JJ2R 1XN9A 3J7ZT 2N3LA 4HH1A 5HP1B 1WHXA 3BV8A 1JKHB 1S9EA 2IDLA 3AY0A 4HACA 1FE0A 3MM7A 4R0JA 3VAJA 5BXIA 2EFPA 1ZA2B 3MEEA 5GAHI 4J9MA 1BQXA 2HHHF 1YRUA 2VFRA 2VL1A 4CLTA 1RWUA 2HPUA 2XEXA 3OL6A 5KFZA 3KNAA 1T9VA 2DGXA 3IR7B 4C3LA 1RWXB 2CZ9A 2QT7A 2YPYA 5ETTA 4DWIA 3MCSA 4OI1A 2APOA 2W25A 5KFLA 1HNWF 1JXLA 4ZPVR 1C0UB 3IG1B 1TFYA 1TKXA 3UN3A 2R7QA 1U49A 2VKRA 3DLBA 2YBVA 1WI6A 2BJ8A 1VLYA 2IRYA 4I6AA 4X62F 4C3KA 3PO4A 2R8GA 2ASJA 2HHWA 2CNKB 1S1WA 1N48A 4XTTA 2GO9A 4WE1A 2W1BA 5E3PA 4URSA 2X1FA 5J2QA 1UWBA 3GTYX 3T6BA 2ACMA 3I0SA 3CCJS 2FB0A 4RNFA 4PYDA 3NCQA 3FSIA 5KFPA 2HNZA 4ZMMA 3FKBA 3W2VA 3MDFA 3DRXA 4KO0B 1UCNA 2BW2A 5K8NA 1VDHA 1JLCA 4DN0A 2VKZG 3A4TA 4LFCF 2LA6A 1O51A 4ID5A 4NLUA 4V1Ak 1JJHA 3C16B 3TW0A 2BM0A 4U95A 2ZBRA 2ZH9A 1U1RA 3BN7A 2JRSA 3IGVA 4URQU 1VIXA 2Q6BA 4NXNJ 1FHTA 4U7CA 2FIUA 2W4DA 1YVFA 2W7AA 2EW9A 5AE2A 3FCHA 4ZVEA 1WKLA 2ERRA 3CO0P 4NE9C 2RQKA 3OL9A 1SXLA 3Q8VA 3BGOP 4KH1B 4ED7A 4YDDB 3NGDA 2VBXA 4P74A 2HLTA 2DNLA 5HVGA 4B3MF 3M6UA 2H48B 2VDIA 3I0RA 2OSQA 3TAQA 1YRTA 1MMDA 3PW2A 2AZ1A 1FRIA 1F9FA 1FRXA 1FKPA 3Q8YA 3A12A 2C2MB 1T3NA 4OZNA 1S57A 3W7BA 2G2OA 2YTCA 4ZCKA 3IN5A 4EO6A 3LAMA 1KOHA 1RISA 4DF8A 5HBMB 3PNIA 2AWZA 4DL3A 1Z2ZA 3BQ0A 5IC6B 3POTB 4WXWA 1Y5NB 2CQ0A 5ETPA 1YQHA 5IM0B 4TVAB 3ZC4A 1S0NA 4W92B 2Y8WA 2YKNA 1WEZA 2GQQA 1HQ2A 4Q8FA 1TV6A 3OLBA 6FD1A 4ZVFA 3H2LA 1NM2A 4C48A 2IRUA 2ZEJA 1NK4A 4IR9A 1UTAA 3JYTB 2RNEA 3M6XA 3IS9B 5DQIA 3A8KA 4F3QA 5KFCA 4ECTA 4FNHA 2HHXA 1HNIB 2VG7B 2P9EA 3R8YA 4DCOB 4MFBA 2DIVA 2HBQB 4Q2LA 2HNDB 2E29A 1NHUA 5HI7A 5HLFA 3D1QA 3MZIA 2CG8A 1MWZA 4B3OB 1D9FA 5IXUA 2ZJRQ 4OX7A 1N5QA 1FESA 3CJ3A 2WCXA 4IG3B 5KFGA 2ZJPQ 1D1UA 2VZ8A 1TR0A 3S6EA 2HWHA 5EN1A 3PW5A 1HIYA 1K0TA 4QR0A 5LXYA 1HD1A 4DG1B 1CC8A 4PPDA 2C3MA 2BOAA 2LA4A 2GMHA 2ZBQA 3LO3A 5F41A 2DH9A 3IM9A 3KDNA 1CJKB 5D6GA 2ASLA 5IC4B 3HKWA 3NCPA 3IAM9 2FJDB 2ZBPA 4LQ3A 3LF0A 4OZ2A 3CCZA 3OHBA 1RSCA 2HVDA 3T6JA 1T05A 1F0XA 3Q2SC 3QLHB 1S99A 1A9NB 1RT7A 4C11A 3AJDA 2H5IB 1WF1A 2C1EB 2EFGA 3QAEA 4ANDA 1HBMA 2DXFA 2J9CA 4JI6F 3UN5A 6AT1B 2R7WA 2LU1A 2R9LA 1WSVA 2M0GB 1XQIA 2AKWB 3M30B 3U7JA 1DLOB 3RR8A 1F1BB 5HMYA 1PYSB 2MKJA 3MHYA 2R7OA 3KNGA 5CZVA 4HLBA 1S77D 1TL4A 1U0HA 1Q8BA 2OJ3A 5E3CA 1XJWB 1LWFA 3V4IB 4DV6F 4P2FA 2NREA 2B9YA 1K0VA 4DF4A 5A2QU 1X5TA 1N34J 2W2PP 2VONA 3J81j 1X8DA 2VFTA 4CH7A 4AL7A 2QGFB 4P52A 4DR7J 3SQGA 1BQMB 5J1EA 3OFGA 5A8RA 1Z4UA 4IFYA 1G7CB 4QR1A 3O44A 2YWHA 1SB6A 2O5DA 2XHCA 5F8HA 2Y1JA 3QBCA 4DV0F 3I32A 3KUEA 4USWA 2YNGA 1K73T 3DDKA 3H5SA 1B0VA 4CLWA 4I68A 5T14A 3CULA 1VRTB 2CJAA 1S59A 1H7XA 4NASA 2V8PA 3NLCA 5KFQA 2E5LF 4UY8T 2Z2MA 4NRUA 1K1QA 2ZHAA 4B9SA 4YB7A 1H72C 2XTJP 2UZAA 2AYEA 1RTHB 4EO8A 1Y11A 2J0XA 2OUGA 4IO9Q 2IM3A 2PMHA 2B9WA 5F8LA 1U2CA 1MNEA 2ATLA 2AJ1A 1HNXJ 5AE1A 4JI1J 2ZZNA 2OHDA 3CF5Q 4O3SA 4CLSA 3PX0A 4A46A 4M5KA 3HVAA 1VCTA 4PWDB 1M0SA 1KOOA 1DARA 3CMQA 3H5UA 1RTJA 5C42B 2MQQA 3K5LA 3RB6A 2ROPA 5B0BA 1TKDA 4ZPTR 3W5XA 5T7LA 3DGVA 2MSTA 2QLFB 1P8GA 3NGTA 2DNYA 4IO1A 1S1XB 3QWPA 2FVPA 1UA1A 4TYAA 2BQUA 1ZM9A 1PIEA 2ZBCA 3JQJA 3KLIA 2KM8C 1XMQF 2Z56B 5HROA 2M52A 5E0OA 2V9WA 2VQEF 4OYZA 2WRMA 4JI2J 4F26A 3AJ2A 2C2DA 1Z1ZA 2XLIA 4I2QB 5LMNJ 1LW0A 4QPTA 1PJ6A 3CD6S 2AJFE 3PRDA 3RYLA 3RRHA 1U6BA 3M2VA 2BANB 3MF5A 1S9GB 4RBUA 3KG0A 3H4BA 2W7OA 1HWUA 3W5YA 1VC5A 3A13A 2EFOA 1S0OA 1LFPA 1N54B 1KBRA 3LOUA 3MCMA 2HS0A 1J5EF 4MH8A 4DR4F 2XGPA 2XM3A 1X60A 1S1UA 2QLJB 3SSRA 2ZNZA 2W9CB 5L1IA 3ILIA 1TU0B 1HR0J 3NAIA 4M63A 3KMSA 3SCKE 2H5JB 3UNGC 4CZCA 1K8AT 1FE4A 3NXZA 4ECVA 5KFVA 4GKJF 4WFBQ 2XYPB 4NXMJ 1YHQS 3DFEA 4XAKA 3M1VB 3RB4A 2IJFA 2YNHA 2V69A 1VQ9S 2R2TA 1S0MA 4G1QB 2AZ3A 3G8SA 3UCGA 1UKUA 1PILA 5HSPA 1P27B 4X4OA 4X4RA 4KHPJ 5GAEU 3CSKA 1XR5A 2B5JA 3N6MA 4F04B 2YPZA 1ROFA 1HPZA 1JNZB 1OWXA 3B78A 3QIDA 4DFKA 2UXBF 2IMWP 1T9YA 2CG4A 2XZWA 1B7FA 2MZRA 3GV7B 4ILRA 4YHHJ 1N5YB 3OTOJ 4BBYA 1EP4A 3AOCA 5ETOA 2XO7A 2HGNA 2OP5A 3IBCB 5KFNA 4ZHRB 3EXCX 4DHVA 1UEKA 5M2PA 2QN6B 3J80U 1U09A 1TQLA 3WIVA 1QVGR 2MQPA 4Q8EA 3W62A 2FVCA 1KWMA 3BH6B 4RUHA 4IDKA 4H4MA 4USKA 4DZ6A 4MIBA 1SI9A 4Z7YA 1SJ1A 1P6TA 3HT0A 1N0VC 1EKSA 1DJ0A 1TL5A 2CNLB 1RT1A 3B82A 3MURP 3KDOA 1N56A 2KRRA 3MR7A 4TLRA 3KLGA 3AA8A 2WB4A 2F9DA 2FHMA 4ZPBA 2LP4A 4WYWA 4F4WA 2BV3A 9ATCB 3TZZA 1NB7A 4MT1A 2J0WA 1IKVB 2GO8A 2LEPA 4L76A 4B08A 3FEXB 1FDNA 4NYOA 1MROA 5E3AA 2RKIB 5C25A 1TP7A 4KSEB 3DHXA 1A7GE 3SYZA 4C4WA 3MPUB 3IGNA 2AX0A 4ZOSA 3BSAA 3FBBA 1LWCA 1MMNA 3MXHP 2DR7A 2DCUB 3BQ1A 1F9HA 3PRVA 3GG0A 4E2FB 4O3OA 2CPDA 3BDEA 4ZK7M 2J9EA 5CYQB 3RAMA 1RI7A 4B9VA 5KFIA 3GIKA 4QYRA 2IYIA 2FQQB 1RCOB 1YJTA 4HVZA 5K9FA 3TQ1A 5DZ6A 1HI1A 1VFJA 1URRA 2OPQB 2UUTA 5F3TA 1RHRB 4DR7F 2G2YA 2A3JA 3HHNB 2E7XA 5DM7Q 1Q5YA 1HNVA 1NB2A 2KXFA 1QJHA 2DR5A 1WG4A 4UUXA 3J7YI 2XI3A 5H1SV 1S76D 5HQMA 3GIMA 1WEYA 4FXVA 3VAMA 1NKCA 1KEKA 2JVRA 4B9MA 4PYAA 3RR7A 2VG5B 1N33J 3OFFA 4NCGB 2ZC4A 4M5HA 2FJAB 5A6PA 4CO3A 2HMIA 2O1PA 3D5MA 5AXLA 1DHMA 4ZVPB 2NSBA 2BABA 1SQGA 2RE1A 1R8BA 4OV6A 3GFYA 5D77A 1BWEA 1FDDA 2FPHX 3PXGa 1DURA 4I1TA 3BZQA 4ILLA 4IOBA 3MUMP 2DNKA 1WELA 4USUA 2V9KA 1S7IA 2BE7D 3A8IA 4GKKF 4DUZJ 1HNXF 1EZZB 4U8YA 1I51B 3CE8A 2DR9A 3R27A 5EWFA 2GV1A 2J9DA 2UUCJ 2JOQA 2ASDA 2QE5A 3GJRB 4N77A 3LP1B 2DNZA 4YQWA 3C46A 2EPIA 1C1BB 1L3UA 2D69A 2VBWA 2E1CA 1NSKL 3RTVA 3AAWB 4NLRA 4CO4A 3TAMA 2KB2A 3C19A 4ELUA 3M32A 4LF5J 2MKYA 3E51A 5HK4A 4LR7A 3FZBA 3QJPA 2CQBA 2ZH5A 1RGVA 1VOMA 2WHOA 2R4FA 2KZMA 2Q79A 3FFIA 1VC0A 1B0PA 1NK5A 3DOLB 2HBRB 4R25A 2WONB 1HA1A 4F4ZA 1JB0C 4KR0B 4DUTA 4MMOA 4RNHA 2ZH4A 2U1AA 2LQBA 4Q44A 4MK8A 2OPSA 3FEZA 1ZM3A 1FT8A 1YI2S 1RKIA 1Q82T 4WP3A 2B8PA 3V6KA 3AOAA 3LGMA 4K0KJ 2DNRA 3W8GA 2J6UA 1LNQA 2K7JA 2YX1A 2HVHA 1C4AA 1WHWA 4IOCQ 1N52B 1KQGB 2AJQA 1P9QC 5B08A 3IRXA 1H2TZ 3LANA 1NK9A 4F0HA 3QGPA 2JFDA 4USTA 4DL7A 2QSFA 1FRMA 3CJ5A 3VHQA 1IBKF 5K14B 3AODA 2GCFA 2GJFA 3LPEA 1J5OB 3JAMY 4QW8A 5IQQA 1WF0A 2RAQA 1ELOA 3HVWA 1U1MA 3M8SA 3H8YA 3C15A 2AQ4A 4QOTA 3LALA 4KHPF 4JI5F 2XG8A 1FX2A 5THWA 5B0FA 5D3GB 4LF6F 1DQ9A 4PCQA 4TN2A 5J2MA 4DV3F 2NZ4A 4YR3A 1VHIA 4F2SA 3DI6A 3TANA 3G8QA 4CP5A 2M2BA 2WVBA 2VODA 1VK3A 1YDLA 5M2UA 4GO7X 2ZZMA 3SV4A 2ZH3A 1S10A 4OZ5A 3VZIA 4OYAA 3MM5B 2Z4PA 2HS3A 4GVBB 3W9IA 3ZTOA 1TKZB 1VRUA 3ITHA 2JWNA 1IWGA 1UP1A 4TLQA 5CQGA 4NLYA 3CJKB 3VWSA 2BUNA 1SV5B 3D1OA 1UVLA 1WACA 5DDPC 1GXUA 3M4XA 2X1AA 1H7WA 3DOKA 3T1HF 3DKDA 1WOOA 1S0VA 2CZ4A 2D3UA 1UJ6A 1FTRA 2LFVA 2OFGX 1HQEB 1Y3KA 2KJVA 4NOHA 4X65J 2AIRB 3JTNA 4M5GA 4C0HA 2QMXA 2CZVC 4ED2A 4FBUA 3EDQB 1U8WA 4EMDA 1PSDA 4L3KA 3DNCA 3OR2B 3TA0A 2KHDA 4X4SA 4CRJA 4MKYA 1N36F 3U27A 2HVIA 3P5BP 4RBVA 3S01A 2CQ3A 1WC1A 2BX6A 1T0TV 1WKJA 2VA2A 2XC9A 1QAYA 1HBUB 3GIJA 2R7TA 4XK8C 3EVOA 4Q43A 1TAUA 3DYAB 4JUZA 2HW3A 2CPEA 1N8RT 4YY3F 2QL9B 4P7VA 3BSCA 3H98A 2V8GA 4ZN3A 3NBPA 4IUFA 1HNZF 2AYBA 5GMKa 1X4DA 2G2ZA 4J90A 3KK2B 3IBFB 5CHCB 4UW2A 4TU9A 3IFEA 1BGXT 4F67A 2EK1A 2F8EX 1MG7A 1GXLA 3Q86A 2V2ZA 2V2VA 1Y7PA 1F3VA 1ULRA 4LF2A 2YKPA 3EGVA 1HMVB 3HM9A 2OPPA 2M3DA 3D1HA 4I7FA 5K8OA 2XNRA 2MJNA 3CT9A 4FPIA 3BBBA 2C28A 1Y3JA 3G6XA 2CA9A 3BO2A 4X4NA 1RAGB 4OLOA 2DNHA 4OV1A 3EZOA 2A2CA 3P5TL 4QWDA 1RTDA 4DR2J 4ZP9A 2V4JB 1T3OA 1UPMB 2UUBJ 4WFXA 3EPIA 4ID8A 3JTPA 5AXNA 2RH3A 3ENVA 3TAPA 2DGOA 1REGX 1VS3A 3JS9A 2KG1A 2EBEA 2YH0A 4OX9F 1F5BA 3RU0A 1TFWA 4PPZA 1FK9B 4ZVUB 2D74B 1QTMA 4BDPA 2E9RX 1SC4B 4P2SA 4ER8A 4TY8A 1DAXA 3IBWA 4UOFA 3G71S 3CJ8A 3CDWA 2E5GA 2GFFA 4PXCA 3UDCA 3NKYA 4PG5A 2E5IA 3J80Y 5CCLA 2DR8A 5FIIA 3C6UA 3I31A 4OX8A 2W9AA 1URNA 2FUG9 3DLKA 4A8OA 4PUOA 2XLKA 2J8AA 3BSNA 2DEJA 4HH0A 3HI9A 1SUQA 4HTJA 3EICA 4EUVA 1OS5A 4DFMA 3CMES 1X4EA 3D6HB 2HKEA 1QAJA 2MHNA 2IYGA 3Q0AA 4LREA 4DJBA 2DVIA 1EETA 4AYBD 3K17A 4IRDA 2CYYA 4P7TA 3TRGA 1R0AA 4DSEA 4EK2A 2GIFA 1M5HA 2QG9B 1QLNA 3E01B 4DPOA 5GADI 2H4YB 1HARA 5JXSA 1FD2A 3CJRA 3GZ7A 4FP9A 3KK1B 3KHHA 2R3VA 4XO0A 2MHEA 4DL2A 4O4GB 3KMQA 3JB9k 4N56A 1FXDA 4PQUA 2MZ1A 3RRKA 1TUWA 1M5SA 2O66A 3HVTA 3IWXA 3QIPA 5AXMA 2M88A 4FBTA 3QAUA 2IVFB 1H2VZ 1U7LA 4KC5A 4YB5A 4JYAJ 2MZTA 1NDKA 2I38A 3Q24A 4DS4A 3GMGA 1NU4A 2ALYB 1OIAA 1NSAA 2L3MA 4DR5J 3ENAA 3BPSP 1VRQC 3EJMA 3PYGA 4IYQA 5DLGA 1RYRA 4NA2A 1Q7LB 4CTAB 4RW9B 2KT3A 1R0BG 1M5PC 3HULA 2XI2A 3CPWR 3DRRA 1RTZA 3HSDA 1PBAA 4B3SF 4TNOA 2FC9A 3PVXA 1EARA 1V9OA 1WG5A 3C8YA 4JV5J 1RAOA 3CDUA 3Q2TC 3UCUP 4J9QA 4LF7F 1FNOA 4PAAA 3DRSB 5KG5A 1TKTA 3AHPA 3MMBA 2KFNA 4LIWA 1JX4A 3ADAC 4AXIA 4WKRA 3M8WA 1AZSB 3MMJA 4J9OA 2RHSB 2FZCB 1AUDA 2CPXA 2M8DB 2J7WA 4Y6IA 3HSJA 2V8DA 1WI8A 2VB6A 5B0DA 2R7XA 4ZDNA 2KG0A 5ADZA 4HI1A 1SJ3P 3OBIA 4Y28C 2BJ1A 2BRKA 1PJ7A 4RUBA 3G87A 3D6MB 4UUWA 1NKEA 4L74A 2E1RA 4LF4F 1SKUB 2P9CA 2YY3A 3HT3A 2QL5B 3QGGA 3ZZYA 3U1NA 1ACMB 3OXLA 2IHR1 5D4PA 8RUCA 1Q8IA 1X4HA 1U8SA 4LF9F 1S79A 4DU7A 4DR6J 1FERA 2RQMA 3JSRA 1R7IA 3GJTB 4I6WA 2DBBA 4X65F 3M8PB 2JLFA 4ECWA 4OHVA 5LMUF 1RK8A 4FYXB 1N4LA 4LQ9A 3G6ES 2RRNA 2MLYA 4HHJA 3OLAA 1HHTP 2WW8A 3DC2A 3P96A 3MEGA 2Q6CA 4DZDA 2UUWA 4WTYA 3B4MA 1U2FA 1NZ8A 5CAAA 3EZUA 2FJVA 3LAKA 4ZVSB 5BJRA 1SH0A 1RHJB 3B8HA 3G82B 2NS1B 4ED6A 2AGQA 4W98A 5FDLA 3MMCB 2JVOA 1CEZA 1U0SA 4B3RJ 2VV5A 2YWGA 1RT5B 3Q8SB 5AT1B 1D09B 4X4PA 4L3NA 5JVHQ 5HAOA 2W8LA 1R0CB 2MKKA 4O3NA 3RW7A 1M1KT 2DCLA 1EJ7L 2BQ3A 1GAOA 2KRBA 2GGPB 1JLGB 2VASA 4NMLA 3PJWA 1NZAA 1I1GA 4HEA9 5ETRA 4B3OA 3EXYA 1FEEA 2GZOA 3VR1A 2HQIA 1TMMA 2GNKA 1R8AA 1WUUA 4ZITA 4MJKA 4RW7A 1K47A 3NOCA 3ENQA 3O1LA 3NRBA 5IV3A 4Y0FA 1FDBA 5KT6A 2DR6A 5C5JA 2FD2A 1N6QB 4FPRA 2XS5A 4XDDA 1R6VA 2HFUA 1IKYA 2EWHA 3KKFA 2OIHA 1NHKL 3VGTA 3Q89A 3KK3B 5K20B 1CJTA 4K2XA 2NLWA 3OPKA 1XR6A 2CQGA 4QBUA 3OL8A 5KFDA 5DG9A 1YGYA 1ZAVA 4DXLA 2JL9A 1F5AA 1RJJA 2XNQA 3R5DA 2VBZA 3DLGA 3V6HA 4LF8J 1LW2A 1FNXH 5BR8F 4BS2A 3AD8C 5LM7E 4R5PB 3PY8A 4K4SA 4DPWA 2MEWA 3K5NA 1FXRA 3BBFA 4RW4A 1HYSB 2FJXA 4LFAJ 3OUYB 1CJUA 2GIRA 2V94A 2CQPA 1VHFA 4F4AA 4PG7A 4AMPA 2QA4G 3ZTSA 2VC0A 4DEZA 3GONA 3MM9B 3GFHA 1DTTA 1NPRA 2NUUG 1AFJA 1CS4B 3OTEA 1E6YA 2P9GA 2PFDA 5HJYA 4CI0B 4JV2A 3T9NA 2Y1RI 3M8QB 4GC6A 3QRPA 3H40A 2UXDF 1KP6A 4A4JA 3KTQA 2LVWA 2GJ2A 1X9MA 4WFNQ 1DBDA 2KJWA 2XS2A 2M4MA 4WIIA 2HAFA 4J9PA 1RT3A 1P9YA 3GCWP 5J2NB 5KFMA 1W2BR 4PZVA 2B0GA 1S6QA 3ZZOA 3V81A 2JLGA 1R8HA 3DRPA 1X4BA 4KKOA 4A8QA 3HHDA 3GFXA 4RL1A 1YJUA 1T11A 1Q4RA 5BYSA 2QSWA 1R27B 2O3DA 5IWAJ 4FZVA 2DD8S 1KKHA 3LUYA 3FQKA 3GIRA 3AQOA 4F02A 3WZ0A 3I87A 2RF2A 4ZPWR 4DV5F 1AB8A 4N7TA 1SBRA 4ES1A 3GJSB 5D4LA 5F0UA 3GIIA 2COLA 5KFWA 2BE2A 2PI4A 4WZMA 2HVEA 4KT0C 4C9DA 4P9SA 3MMAB 2VG6B 4WYLA 4PWUA 4HHUA 1RWOB 3C14B 3SSQA 2A1BA 2CPIA 2JJ4D 3TNVA 1JLEA 2EBGA 1B4SA 3SV3A 2VPZB 3KJVB 1NAQA 1BQNA 1W7WA 4DR1F 3F56A 4ZVRB 2XMUA 3ZNUA 4O4RA 1Q5VA 3UDVA 4EU0A 1MWYA 3QT5A 4D3HA 2ZKTA 2OKQA 1UVJA 4IOAQ 4LFBJ 1RXOB 4CLYA 5KOWA 1S9EB 1FVSA 2X7IA 2RDDA 4HACB 2MTLA 4ZVOB 2MLXA 2FYXA 3MM7B 2UVVA 4DCPB 2MKHA 1RT6A 3MEEB 4N47A 2XZDB 3PW4A 2H54B 4IRKA 3KHLA 3H5XA 1XNQF 3B6BA 1Z2LA 3GSDA 3T1YF 3N0VA 4RU9A 4CLZA 1SJRA 4LRCA 2PEBA 3QSIA 3CC2S 1EIYB 3W9HA 4I2QA 2JSXA 1KQKA 1FA0A 3HKZD 3IM8A 2RHQB 1NJZA 1TKXB 4DV1J 2QYGA 2CVIA 4DX6A 3ICLA 4OYIA 2RUSA 1HHSA 2BANA 2WOMA 5BYQA 4DV4J 1K1SA 3I9V9 2BZ2A 3BEGB 4CQ1A 2IM1A 4OHZA 3TVKA 1VQSA 4BC9A 3BYPA 2RU9A 2F4FA 4IG0A 4ANEA 4WE1B 2N7YA 4QWCA 5F8IA 4DU8A 4DUYJ 1VQ6S 4WK1A 1OYDA 2HZVA 4N5SA 1KC8T 3PX6A 3IA0A 1D8ZA 3VALA 2V34A 4Y00A 3M2UA 5J2QB 2MQ8A 1Q7YT 3TYTA 1UWBB 4AMMA 3MPYA 1R3NA 3JQKA 1M5KC 3A8JA 4PABA 2A6OA 2HNZB 4X64J 1HW8A 3W2VB 4G1QA 1OY8A 4OYBA 1M1GA 1JLCB 1BWVA 3K58A 3TUIC 1QSLA 2D41A 2RMLA 2GHVC 1Y9OA 4ID5B 1GT8A 1TL1A 3DXBA 3GV5B 3IWLA 4Q45A 3IR6B 2XCPA 1C0TB 1MN9A 3DLEA 2UVWA 4AMNA 2KT5A 1GMWD 2DGWA 2YWEA 3ET6A 5ITHA 3SCIE 5E41A 2DY9A 2V2QA 4E0DA 1HWLA 5BYRA 3MPDA 2ROGA 3R5GA 4M5IA 4KIAA 2HGLA 4FF1A 3QYYA 2W9BB 4KFBA 2H3EB 2AEJA 3MFHA 1M5VC 1AT1B 2ZHOA 4RR5A 3BDPA 1NK7A 3SCJE 1RABB 4OFZA 3PZPA 4DSIA 2RS2A 3BR9A 2FZKB 2E66A 3I0RB 1YLXA 1N5TA 5A6WA 4X66J 3OHAA 2HQGA 1FJEB 4GMKA 1IR1A 2BJEA 5IT9Y 1FKPB 2ZH1A 1FWPA 4NCAA 4OHWA 1IXKA 1ITPA 4MAKA 2FLPA 3R9LA 4FF4A 2LXUA 4YB1P 5A8WA 3MR6A 1LKZA 4E98A 2VZ9A 2NSCA 2ZITA 5FJ4A 3SSSA 3DLJA 5E3RA 3EGNA 4O44A 4M5NA 1GH8A 4DL0C 5SZTA 3KOAA 2C2KB 5KT3A 3KG4A 1VK8A 4B02A 3T19A 1IUJA 2GMJA 5JUMA 2YKNB 2ZM6J 4ZCIA 3SDEA 2VQFJ 1TV6B 3QRQA 3CO9A 1V5VA 1YZ7A 3OFEA 3A8EA 2GIQA 2VUGA 1DQAA 1KLMB 2EC0A 2DGSA 3EUNA 3L9ZA 5KG1A 4LFAF 3DXSX 3HJVA 3MECA 2NQPA 4Y2KA 5DDRC 2E7WA 4DV7J 4MFBB 1JJ4A 3D9BA 3FBCA 1WF2A 5KFRA 4L6V3 1VLOA 2OTLS 1IQZA 5HLFB 2R7RA 2DH7A 1ZAWA 1S72S 2JNJA 4K5SA 3ZZPA 4H4OA 3I6PA 2J7UA 3IXQA 5IT4A 3L4BC 1X0FA 2QO3A 2FY1A 4C8LA 1EAYC 3ZTQA 3UR0A 5CCMA 5EWEA 2DISA 3HX9A 2ZOMA 2PO4A 4L72B 4A8FA 2M5YA 2KFYA 1BXNA 4DQPA 4WF9Q 2DNOA 4X4QA 4AL6A 2AP6A 1OPIA 3TJAA 2PFFB 4Y3CA 1WC6A 3GWCA 2FY8A 3PKYA 3TP2A 1UWAA 1S97A 2ZWPA 4NEZA 3WX8A 4KV8A 2B4VA 3S1TA 3PEHA 2R8HA 5KG2A 3PTWA 4WWSA 1UEUA 1T05B 2KYZA 2FLNA 1Q95G 4KY3A 2HHSA 1IJFB 1RT7B 4C11B 4O3RA 3EVMA 4B9UA 1RQ0A 3OVSA 1HBMB 4L73A 2CRLA 4H4KC 4OHYA 2YWKA 3CCSS 2KYXA 2C2NA 3TQEA 3KLHA 1TL3A 3N4WA 4WTOB 4V19X 4ZPDA 2X3DA 3FQLA 5CD4H 5CA5A 2CPHA 3HF5A 3CW2C 1U0HB 2BACA 4B9LA 2H5EA 2FC8A 5H9EK 1QD1A 4ATNA 1LWFB 1P1TA 3RGIA 4DX5A 1VGYA 2NPFA 4P10A 1Q16B 3HSGA 2Y3YA 4U6PA 2B3TB 4M5LA 1HQUA 3GR1A 2RDIA 3GQCA 3RZAA 1FO1A 3ZFVA 2IJNA 3SQGB 5J1EB 5A8RB 4IFVA 4IFYB 4ZIWA 1C4CA 4BCAA 1IR0A 2HQCA 4ETZA 3OSNA 5CYMB 3BS9A 1FKAF 4OJ3A 1UVMA 2YNGB 3H42A 1TK8A 1KQFB 4U7UD 4M5MA 3CCMS 4HHHA 3LP0A 3JQMA 3M8ZA 4FF3A 1CJVA 2QFIA 5KFSA 3MOJB 3UWTA 1F5CA 5DG8A 4JI4F 1G3OA 2XSFA 3GILA 4NWBA 4KAIA 3W5ZA 1SQEA 4EWTA 2B51A 4JI8J 5ETQA 3ZZTA 1QAXA 3MUVP 2U2FA 2ZVIA 4PG8A 1XMOJ 2FHKA 4Y34A 1C1CA 1IM4A 2YNIA 1CG2A 4ZLJA 2KZZA 1BUXA 1UZDA 4M5JA 5C24A 3A3NB 4DR3J 3GB0A 3BR8A 3C6TA 1NSQA 3ZZUA 2AJ2A 4LUBA 3NWRA 2PT0A 2F4VF 3RBDA 2I5JA 1UW4A 3AT1B 4M5DA 5I3UA 5K14A 2RT3A 4W4MA 1VYAA 4X64F 5C2CA 1RTJB 1J5OA 4J5OA 1JQGA 3R2CJ 2QA1A 4K4WA 2O67A 2G4BA 4WK3A 3NS6A 2BE9B 3TA2A 5T7LB 1FDAA 4NZ0A 4DLEA 1KRPA 2GJIA 4CH0S 5EWGA 4ED0A 1IBMF 4NLVA 3W2WA 2MY7A 5CXTA 4KE5A 3CCQS 1R31A 2ZZTA 2KN4A 4TKTA 2VHGA 2HHVA 5LSOA 2IC3A 3KLIB 3KLFA 4NCBA 1FKOA 1D8YA 2IMOA 1UL3A 4K4XA 1SVDA 4C2MA 2Y0SD 1PBUA 4YS2A 4XDCA 4J9NA 5B09A 2UVUA 3OSPA 4DSLA 2E5JA 4MIWA 1SC1B 4DCJB 1UA0A 3FVYA 1U1OA 1U25A 4JI0F 2QZ8A 4CM2A 2ADBA 4K4TA 3L7UA 1JLQA 4WXOA 1LW0B 4JP8A 1TUVA 1S4FA 3MM8A 2LYVA 4FYWB 1WKKA 2CQ1A 3UW1A 1D0EA 5KFBA 3TARA 3BO3A 1VISA 4DPXA 2RQCA 1FJGJ 2ZH8A 2ASYA 4JI3J 3J81U 1W26A 3ISZA 3ELHA 4U8VA 3RAQA 4NRTA 1DZ5A 1BLUA 2XBPA 3N6NA 4OI2A 3I4PA 4BWJA 2F9JA 2ILZA 2CQHA 3JTOA 2P8IA 4DX7A 4NLDA 1PAUB 1S1UB 4HT5A 3ZXWA 3SBMA 1J27A 3MPVA 2RIJA 2HGMA 1AXQA 5CZCA 4DPUA 2Y1IA 2MJUA 1HFEL 4KHRA 4ED1A 1VBXA 1NRKA 3MAAA 2GS8A 2V2KA 3QFHA 5ETVA 4IR1A 2YNHB 4EZ9A 3OQ2A 4CM0A 1SKRA 1XNRF 1CQMA 3US5A 2XSJA 1KVIA 3Q83A 2NXCA 2P6TA 2NR0A 4QJVA 2CKWA 2NXEA 1FJ7A 3JSMA 2B5JB 3PCOB 2PE8A 1S5ZA 4OI4A 2DHHA 1FVQA 3PYDA 3MAHA 3H25A 5CZXA 1HPZB 1N5SA 2AYMA 1TK5A 2BKNA 4P75A 3FRYA 2BJDA 5I3PA 2OLWA 3MR3A 3PJ9A 3V6JA 1WSRA 1LFWA 1EP4B 4PRFA 2C3YA 3P4UB 1FX4A 3MPWA 1F3FA 3D66A 2PI5A 2OI2A 4UZBA 1NXIA 4PKDB 5FLXY 4CLFA 4DV2J 4MYUA 1FRJA 4GC7A 1N32F 2G1HA 1ZTTA 2FVQA 3DGPA 2Y0BB 4IDKB 2HLUA 2G0JA 1WC0A 1HMVA 4FYVB 1KTQA 4OYOA 4CLPA 2Q1LA 1RTIA 4LJMA 1RU2A 4OZLA 4LRBA 3SMZA 3LW5C 1REVA 4A8SA 3HCXA 1IBLJ 2DHSA 2OELA 2K2PA 1RT1B 1QE1A 3A1YG 3KLGB 4EGLA 4Q2MA 1M1HA 2R7VA 2HFOA 2XGQA 4IH7A 3EGWB 3GSIA 1RWKB 2DNGA 2HFVA 3SIPB 2RUGA 2LDIA 3UN2A 1X4FA 3EM1A 1MROB 4I2PA 2F5GA 1WC5A 3CDEA 3VQTA 1E6VB 1FWLA 3U1LA 5KG0A 5L9XA 1YTYA 3V6DB 1TL7A 5B7WA 3WHIA 3FBFA 1JLFA 2YX7A 3UVJA 5RUBA 1LWCB 3CCLS 2DY1A 5L8RC 2UU9F 2G0CA 2YKQA 1VC6A 1IR2A 2XWXA 3UD4P 3EMTA 4CLLA 1RHUB 3KJNB 4Q5VA 4WJBA 3MEDA 5H9EJ 3E8OA 2PIIA 1T94A 3TEHB 3ISNC 1LOUA 4B17A 3B54A 2F3JA 2LQJA 1WDDA 1X9WA 2DT9A 3LA0A 1MLAA 2GAGC 2WAQD 4MTPA 3CD5A 2CPJA 3A3OB 3MD3A 1S1TA 3EDRB 2B8QA 2IBOA 4CNYA 3G8TA 3DMJA 3BN4A 2V4QA 1VMBA 3M6WA 1HNVB 3HHLB 4ZLLA 4IQXA 4B3TJ 4X4UA 2CJXB 2W2MP 5AE3A 1DQ8A 4RPFA 5EX3A 2OEMA 1HI0P 5KTQA 2MQMA 4YFUA 4FXDA 2XMTA 1X4AA 1M5OC 2Z30B 5IS2A 1QSYA 3J7A1 2DNMA 2B6AA 2NXJA 3TZWA 2YX4A 2X1GA 2G0IA 4M8LA 5E5NA 5ETLA 1QAIA 1GEHA 3TR5A 2QEXS 4JI7J 5E33A 3H20A 3TI0A 3FRZA 3O5TB 4RW6A 2VA3A 3DN9A 2WZ1A 1RAHB 3ZNJ1 2BYCA 1I94J 1FWKA 3T5JA 2L08A 4OZ0A 4UY85 1PYTA 4ITSA 2J5AA 1RA7A 3IWNC 3IO1A 3D68A 1BHNA 2C3UA 3F73A 4ED5A 1YK9A 3KG1A 1VR6A 3NMRA 2HFZA 1SL2A 5JJBA 4LVOP 3P49B 3FSXA 1S49A 3TAMB 3PHEA 2GHWA 2JEGA 1NDPA 2HHHJ 2CIMA 1MW7A 2R2UA 2DEIA 5D4OA 4AT1B 2X51A 1S6PA 2AHOB 2YQ1A 4ANCA 3QPIA 1NJXA 2OSRA 2KI2A 3CIZA 4FVCA 4PG6A 5AXKA 2CPZA 4TXSA 1QY7A 4U9RA 4EYHB 4U96A 2HNYA 1HNWJ 3N01A 4KQZA 2Z57B 4LSNA 1DTQA 3FFIB 4NXNF 1MWQA 4A47A 3HSZA 4PXDA 4F36A 3HFZB 3CWJA 3P3DA 1MU2A 5GAGU 3VAKA 4KPYA 5HQ8A 2DIUA 1RA6A 3PX4A 3LWMA 2A0FB 4X62J 2M70A 4DBQA 1ZM2A 2V8VA 2CJKA 5J1PA 2RDJA 2BMBA 2VPWB 4C97A 3N28A 2AEFA 3KYLA 2OPSB 1U2RA 2HBZB 3N5BA 2WSEC 3KJQB 2CQIA 2OFHX 2B9EA 2DJWA 4CLKA 3TEGA 2J6SA 3CEDA 5L46A 3L3CA 4DFPA 2C3OA 3IRXB 3TZXA 3K57A 3S8SA 1Q8LA 4OJHA 4O3PA 1GQEA 4S0MA 3BGRA 2L9WA 2NPIA 2RRAA 2AW0A 1RBLA 2K06A 3M9NB 1DFDA 4LFCJ 2VIHA 3OVBA 1YJ7A 2N4CA 3C15B 3FSYA 4CT8A 1T95A 2VBYA 4P6QA 1S1VA 3UNYA 2EI5A 1MSWD 3W63A 2DPIA 2V0NA 3OFHA 1NDLA 4PXBA 4QIGA 1VQLS 1YBTA 4I67A 4J91A 5J2MB 4AFFA 5GAEI 1TMJA 3DI6B 5DDOC 4ZVQB 1PO6A 2RU3A 3MWBA 2V5HG 4HL9A 2MKIA 2ABYA 2BEFA 4F0KA 1FJCA 5FD1A 2QRRA 1T02A 1I3OB 4CCHA 2Y8YA 4AD6A 1YJNS 2CJYB 3NS7B 3BH7B 1FNMA 3ILJA 4B3MJ 3QSYB 4QIVA 1VRUB 2DNQA 1KR4A 5HQLA 4QWBA 2H51B 4D3GA 4FS1A 2BBEA 3D7SB 2YXLA 2E1AA 1YWXA 4KGVB 1BY9A 1N6QA 3BPDA 4O0NA 3H2UB 3FCVA 3DOKB 3D6TB 3CJ4A 3R3TA 2MGZA 3VVUA 1YZ6A 2CPFA 2ZD1A 4PWWA 2A6MA 2GVZA 5F9LA 4G1IA 5A0YA 4EBEA 3NEKA 1H0HB 2VJVA 2R8IA 2KDOA 4YR0A 1GTHA 5D8HB 1RBOB 3PV8A 4V19J 2UP1A 2WVCA 2P5VA 3LQVA 3K7RA 3ETMA 2CXEA 3UD5A 4M95A 2I8EA 1RAIB 4E8UA 3ZZZA 5DQGA 3VAHA 1U1KA 2H9ZA 4BLGA 3F41A 2X3GA 2E5HA 3AJ1A 3CTRA 2C2ZB 2YVSA 5D4NA 3NWGA 2J8SA 4HTIA 3QRRA 2ZDOA 3GP9A 5F3ZA 2E1PA 1F2HA 4UOCA 2QLBB 1HBNA 4ED4A 4ZP6A 2KU7A 1B70B 4H54A 1UPPA 3D3BJ 2JX2A 2WTFA 5ETKA 1YBUA 3TJ9A 4WP9A 1D3WA 1TVRA 5A8KB 1RBAA 2VU5A 2HWTA 2QTWA 4FN5A 3J81Y 4CT9A 3QNWB 2DO4A 3VGVA 1JLBB 2MZJA 2GA7A 2JH3A 2ZNYA 3FMWA 2RSQA 3RUBL 2OAUA 4HR2A 2ZUAA 1CQNA 4B3TF 2OPPB 2BOPA 1N34F 5J2NA 4YDXA 1OQ3A 1ZS6A 1ZOTA 2M9KA 4AE5A 4RNNA 2IIHA 4C8YA 1NH7A 4I7FB 4RO0A 1YIJS 4EI2A 4J9KA 3I55S 2NZCA 4L75A 4OYWA 4CO5A 3WC2A 3DOMA 4FYYB 3PFEA 3PACA 4WFAQ 4ZPCA 3QO9A 1KTVA 3I9ZA 4NI2A 3WDOA 1XIQA 3TX8A 2HFNA 1ZZNA 5HMXA 2QIFA 1CVJA 8ATCB 1RTDB 4RW8A 1U1QA 4MKBA 3R5CA 5LL6d 4A8XA 2JC0A
chains in the Genus database with same CATH topology
5DZ7A 3G87A 3HMJG 3H0PA 2JFDA 3TZWA 2HG4A 3BV8A 3IM8A 2PFFB 2CUYA 3QATA 2QJ3A 5DZ6A 3PTWA 2VKZG 3TZYA 3SBMA 3EZOA 4QBUA 3HJVA 2C2NA 3IM9A 2G2OA 2VZ8A 3TQEA 3CJ8A 3HHDA 4RL1A 3RGIA 2JFKA 1NM2A 2G2YA 2H1YA 4RR5A 3R8YA 5CZCA 1MLAA 2G1HA 3TZZA 5CZDA 2VZ9A 2QO3A 2UV8G 3K89A 3R97A 3TZXA 2QC3A 2G2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DZ7 A;  3G87 A;  3HMJ G;  3H0P A;  2JFD A;  3TZW A;  2HG4 A;  3BV8 A;  3IM8 A;  2PFF B;  2CUY A;  3QAT A;  2QJ3 A;  5DZ6 A;  3PTW A;  2VKZ G;  3TZY A;  3SBM A;  3EZO A;  4QBU A;  3HJV A;  2C2N A;  3IM9 A;  2G2O A;  2VZ8 A;  3TQE A;  3CJ8 A;  3HHD A;  4RL1 A;  3RGI A;  2JFK A;  1NM2 A;  2G2Y A;  2H1Y A;  4RR5 A;  3R8Y A;  5CZC A;  1MLA A;  2G1H A;  3TZZ A;  5CZD A;  2VZ9 A;  2QO3 A;  2UV8 G;  3K89 A;  3R97 A;  3TZX A;  2QC3 A;  2G2Z A; 
#chains in the Genus database with same CATH topology
 2BR0 A;  1X5O A;  2B7C B;  1IVZ A;  1S12 A;  4KGK A;  3VGS A;  4JI7 F;  4JI6 J;  1V3Z A;  2DYA A;  2IAJ A;  3R1L A;  3HD2 A;  1RB0 A;  4Y2I A;  3SQO P;  2F8H A;  4TY8 B;  5EUH A;  2QV6 A;  2E44 A;  1ZZF A;  1UJ5 A;  3DLL Q;  1ZH5 A;  1RWW B;  4Q7A A;  1ZPV A;  2RQ4 A;  1UVN A;  4DQQ A;  1KS2 A;  4P73 A;  2CDR B;  2ZUG A;  4C8M A;  1RT2 A;  4WBF A;  1JLA A;  4DV6 J;  4DQI A;  2FGO A;  4JI1 F;  4DL4 A;  2ZE2 A;  4USI A;  3C6U B;  1OYE A;  4Q0B A;  4P72 A;  2AGP A;  3DLK B;  1NHV A;  3K0J A;  4N8O A;  4PUO B;  9RUB A;  1N0U A;  3MFI A;  3FGV A;  4K7Q A;  3BYR A;  4C8N A;  2ACY A;  5GAH U;  1RZM A;  4K2J A;  1SUQ B;  1Q8K A;  2IFX A;  4DV0 J;  3NG8 A;  4EZ6 A;  3M6V A;  2I2Y A;  1T03 A;  2WSF C;  5IT0 A;  2IPO B;  1EET B;  1KHW A;  1IKW A;  1UFK A;  3CJT A;  1B3T A;  2LQ5 A;  1R0A B;  2HBY B;  5KFA A;  3N9U C;  1Q86 T;  2E5L J;  2EG1 A;  3EZ5 A;  2DHX A;  4ILM A;  2XMJ A;  2A18 A;  4JI2 F;  1AYE A;  3FCW A;  3CJS A;  4O3Q A;  5LMN F;  3WBZ A;  2XYH B;  3T5L A;  4PQU B;  3OXF A;  2FGC A;  2DXD A;  2XB2 D;  3M7V A;  3H0P A;  3HVT B;  4UF4 A;  3QIP B;  2W2N P;  4LSL B;  3MR2 A;  3CVK A;  5L1J A;  2OPR A;  2WSC C;  1RAJ A;  3T1A A;  3RB0 A;  1V5I B;  2OEJ A;  5F8J A;  3UDE A;  3GR0 A;  3AFG A;  5L39 A;  1LV5 A;  3KUH A;  2IM2 A;  4DX8 H;  1WG1 A;  4RWX A;  1U1N A;  4Y65 A;  1WC4 A;  2WBR A;  4G65 A;  3K59 A;  3CC4 S;  2IVY A;  2B4P A;  4ZA1 A;  1HR0 F;  2EVZ A;  4KTQ A;  3DRR B;  2G1D A;  3HFV A;  4YR2 A;  3FEY B;  3CJ0 A;  3BB5 A;  3R7N B;  1SL1 A;  2K1R A;  2DNN A;  1B64 A;  2HQF A;  3D0I E;  2XYG B;  4NXM F;  1C0T A;  5DM6 Q;  1RYS A;  4AQY J;  1WOP A;  2XS7 A;  2CAJ A;  1NH8 A;  2V68 A;  3PKM A;  1XMQ J;  5A2Q Y;  4R0E A;  4AMO A;  1OJ4 A;  2RRB A;  5LXR A;  1SIW B;  5HN0 A;  3NNH A;  3RJM B;  4N8N A;  1TKT B;  2LQ8 A;  1WWH A;  3R2D J;  3MMB B;  3GFZ A;  2VQE J;  2W9B A;  4K4Y A;  3PIP Q;  3HZG A;  4F7V A;  2KVI A;  5DZ7 A;  4USH A;  4I69 A;  1K9M T;  3HHL C;  1RCX B;  4NLO A;  1YKW A;  4YHH F;  4UTG A;  3NGS A;  1LWE A;  2PSZ A;  3OTO F;  3BSO A;  5HMZ A;  1B0T A;  1PKU A;  1RLC L;  1JK9 B;  5KT5 A;  3OR1 A;  3GYN A;  2AGO A;  3GPA A;  1HBO A;  4ZP8 A;  1WTF A;  1XK8 A;  4J9L A;  5I42 A;  4ICL A;  1U45 A;  4UOG A;  2DHG A;  2E9Z A;  1J5E J;  2ZOG A;  4WFZ A;  5DLF A;  3H59 A;  1KSP A;  4DR4 J;  4CIO A;  1AW0 A;  2IY5 B;  2I9S A;  3UQS A;  3HHL D;  5D0E A;  1SJQ A;  2RJZ A;  5A76 A;  2BQR A;  4Y2A A;  4KYZ A;  3PYF A;  1R8C A;  1JWW A;  1NND A;  4GKJ J;  3MR5 A;  3VTI A;  3M2R A;  3BGL A;  5AJ3 J;  5GMD A;  3THT A;  5M2R A;  4LMZ A;  2GVD A;  4CO1 A;  3K5M A;  4MKV A;  2Z8Q A;  5G0R A;  5L9N A;  5KFU A;  1YG0 A;  2PC6 A;  4N41 A;  3GYG A;  3MEG B;  1H3D A;  2RIL A;  2XLJ A;  3V4M A;  5H9F K;  5IZH A;  3ZTP A;  3CD7 A;  5CH7 B;  2UUA J;  2XMV A;  3OJU A;  3Q8P B;  1GFW B;  2UXB J;  5FDL B;  3G6Y A;  3EE3 A;  3NAH A;  1KLM A;  5J2P A;  3TZY A;  2YNF A;  2LCW A;  3DHW C;  2V8H A;  3FK4 A;  2BJ9 A;  4OI3 A;  4OHX A;  2OD4 A;  2C2O B;  1Q1K A;  5K8P A;  3H4D A;  3BBC A;  4LSZ B;  4CYU A;  2CWX A;  4RBT A;  4WIQ A;  2F40 A;  1PAE X;  1YJ9 S;  3HJF A;  2EKN A;  2GHP A;  2YKO A;  1RWN B;  1KFS A;  5L1K A;  4X2B A;  2F65 A;  5CAB A;  5KT4 A;  4RW7 B;  3RB3 A;  4R8U A;  3FJ2 A;  5J1N A;  4FYD A;  4QIE A;  2C2E A;  4EFA C;  2HIY A;  1XWL A;  1RKJ A;  4NLG A;  1CUL B;  2CQC A;  2VPX B;  1IKY B;  3R7B B;  3MM6 B;  3AQP A;  1CJT B;  4DFJ A;  4RU2 A;  5B0A A;  1SQF A;  2NXU A;  1FXL A;  5JVG Q;  3GV8 B;  4MIA A;  2DPJ A;  3DLG B;  2E7V A;  1LW2 B;  1N33 F;  4HKQ A;  4RUA A;  2MLZ A;  1UZH A;  1HLW A;  2E1M C;  5T41 A;  1UVI A;  3UDL A;  2LKZ A;  1RWV B;  3DM2 A;  4G3I A;  2IM0 A;  1NLK L;  4RW4 B;  2N7C A;  3MCN A;  1LWX A;  1CJU B;  1HKA A;  3TX0 A;  3W9J A;  3X3U A;  4QU7 A;  5ETN A;  1RT4 A;  2H1Y A;  1IJE B;  1BMQ B;  4Y2M A;  1F6T A;  4DUZ F;  1DTT B;  3JAM U;  2OGU A;  1VQN S;  3R7S B;  4M94 A;  2EC2 A;  4LBH A;  1E6Y B;  2UUC F;  2BM1 A;  4TY9 A;  4FKX A;  4K50 A;  5D0R A;  4ZKA A;  4ECX A;  4BWM A;  3WC0 A;  5HP1 A;  5DDQ C;  2D9P A;  3E2E A;  5CYM A;  1JKH A;  4LBP A;  5D15 A;  2OML A;  4XPE A;  1X5S A;  5KG6 A;  4A8K A;  1RT3 B;  2VDH A;  1Q79 A;  4I56 A;  4UQG A;  2IDE A;  1S6Q B;  4DN9 A;  3V81 B;  1PYO B;  3PEJ A;  2AU0 A;  3DRP B;  4KKO B;  4LF5 F;  2IVM A;  1KLN A;  2AF6 A;  2BXJ A;  2HZC A;  4IKA A;  4RUC A;  5B0E A;  2Z2Z A;  1IKX B;  4ED3 A;  1C0U A;  1S9F A;  3IG1 A;  4M1K A;  1D9A A;  1VBK A;  5KT7 A;  2D3O R;  2ADC A;  6FDR A;  1NK6 A;  1N5V A;  2J6T A;  2RF2 B;  3OTD A;  2BE2 B;  3AOB A;  1KHV A;  2AMC B;  4GKK J;  3BRE A;  2Z0G A;  1KFD A;  2DTJ A;  1FRK A;  1P1L A;  2CWK A;  1TTH B;  3HXM A;  2YWW A;  1JLE B;  1XER A;  2K3K A;  1GTE A;  2YKM B;  2CFX A;  1BQN B;  4K0K F;  3D0G E;  2VH7 A;  2VC1 A;  1UFL A;  3FNN A;  1WC3 A;  1HI8 A;  2HWI A;  1T7P A;  2BJ7 A;  2B4O A;  2UV8 G;  3D28 A;  2KKH A;  2MZS A;  4C6A A;  4KO0 A;  3MEK A;  2GX8 A;  3N79 A;  2CNO B;  2VPY B;  4DS5 A;  4AQY F;  1RT6 B;  1FFS B;  2A2D A;  1TK0 A;  2KVQ E;  1R43 A;  4F4K A;  4PEO A;  2JDJ A;  2CAD A;  4NX9 A;  4MK9 A;  3C16 A;  1X4G A;  4KPC A;  2IJR A;  2JZ5 A;  3J7A N;  1H2U X;  2K7K A;  3BKF A;  2R2S A;  4K4V A;  2MYF A;  2OMO A;  2QA4 S;  1Q78 A;  2B56 A;  2WOM B;  3IAS 9;  3UD3 P;  4I64 A;  1V3S A;  3T9Z A;  3OJS A;  2RB7 A;  4CO2 A;  3ZZ0 A;  4CWB A;  4IG0 B;  2ZDP A;  4YOE A;  2F7V A;  2WBM A;  4C7Q A;  1OY9 A;  2XMA A;  4LRF A;  2UV8 A;  3RG6 A;  1YBA A;  2FHO B;  2KXN B;  3M2U B;  2WVE A;  1GK8 A;  3D0H E;  4FKY A;  3AB2 B;  2F63 A;  1IBK J;  4DDF A;  1KVJ A;  5AJ3 F;  4P71 A;  4A48 A;  4XIU A;  2AT1 B;  3U1M A;  4DQR A;  2UXC J;  2W2O P;  2FLL A;  5H9F J;  4JI5 J;  5F9N A;  5HBM A;  2QX0 A;  4PR6 A;  1U6Z A;  4LF6 J;  2FVS A;  1TL1 B;  2UUA F;  3POT A;  1DY3 A;  3NNA A;  5D0H A;  5IM0 A;  4C8Z A;  5DET A;  2RVJ A;  5IQ6 A;  4DV3 J;  3SI8 A;  3DLE B;  3UO0 A;  4NLP A;  1KN6 A;  3ET6 B;  2XHW A;  5ETS A;  4Z37 A;  5DRK A;  3MD1 A;  1U4B A;  1YSJ A;  1S48 A;  2V6A A;  4KFB B;  1UFW A;  2VD3 A;  1X7V A;  2W4P A;  5CD4 A;  3JYT A;  2B43 A;  2B7B B;  3IS9 A;  3VAG A;  1RU1 A;  2ZWO A;  1HNI A;  2VG7 A;  5KG7 A;  4WFY A;  3UE2 A;  2Q66 A;  3H2V E;  3H90 A;  2GW8 A;  2E9T A;  4KGX B;  1MN7 A;  2HND A;  1NME B;  2IA6 A;  2NUH A;  2C22 A;  2Z58 B;  3W1Y C;  3BO4 A;  1TEL A;  2MSS A;  1YJV A;  3OD2 A;  3T1H J;  2ZOF A;  3UFC X;  2MB0 B;  4IG3 A;  1ZAX A;  5A8W B;  1C2P A;  1S6U A;  4C8K A;  1Y5L B;  1X5P A;  3P45 B;  2GAH C;  4GO5 X;  4DG1 A;  4DPY A;  1FI4 A;  4WPA A;  3MOZ A;  4O44 B;  4DMZ A;  4C98 A;  2LEC A;  1E6V A;  1CJK A;  4TYB A;  3P6Y C;  2DRD A;  1GMU A;  2QC3 A;  3V6D A;  1N88 A;  4IH5 A;  2GQ2 A;  3QZ7 A;  2Y9H A;  2B4U A;  1N36 J;  4TU8 A;  3SDE B;  4ECZ A;  2XO6 A;  1EHW A;  3TUZ C;  3Q8Q B;  3I5C A;  4JB8 B;  2V63 A;  4DR2 F;  3LP2 B;  4QU6 A;  3QLH A;  2UUB F;  2FZG B;  1ZYQ A;  5KFX A;  2CJ9 A;  3MEC B;  4YY3 J;  2V50 A;  3AXM A;  4OI0 A;  3KLE B;  3PDN A;  1HNZ J;  3HK2 A;  5KT2 A;  3O2I A;  2IA0 A;  3DCA A;  4QW9 A;  3M30 A;  1YIT S;  1DLO A;  3MCO A;  3QGI A;  1T9W A;  1OQ6 A;  2L9D A;  4KB7 A;  4H4O B;  4PXE A;  4F3M A;  3ULH A;  2Q43 A;  4Y2C A;  3V4I A;  2CQ2 A;  4I4B A;  4FF2 A;  3HHL A;  5ETM A;  2KTQ A;  4ZN1 A;  5LSR A;  1JMT A;  1FF2 A;  3AD7 C;  3B4D A;  4ZJO A;  3TO8 A;  1BQM A;  4UOH A;  3J7Y U;  4O0I A;  2HRT A;  2I1R A;  2XY6 A;  2BVZ A;  1JJC B;  2J76 E;  1QVF R;  3C3L A;  4A8Y A;  1FFG B;  3BGU A;  2ATC B;  5KFT A;  2HAI A;  1O6X A;  4KV8 B;  3PHT A;  2XMM A;  3MTJ A;  3MGJ A;  1VQ8 S;  2MDA A;  4QZV B;  3GG1 A;  1NCL A;  1VRT A;  1L3V A;  3QJL A;  2KL8 A;  3AH6 A;  2HHP A;  1FFW B;  2L48 A;  2EXU A;  4OX9 J;  5E2Q A;  2ZKU A;  3CCW A;  5EDW A;  4KBI A;  2QFJ A;  4W90 B;  3K8V A;  2BRL A;  1YRX A;  1RTH A;  5HAN A;  1NEE A;  4LBI A;  4RKU C;  3KLH B;  3GE9 A;  1TL3 B;  5C2G A;  1SCJ B;  4F3O A;  1VBY A;  4WP8 A;  2KFZ A;  2R7S A;  3LGN A;  2VOP A;  2D9O A;  1U6F A;  3CDB A;  1JIH A;  3W61 A;  3TUP A;  4QIF A;  4JYA F;  1UMJ A;  4EBC A;  4PWD A;  3PW0 A;  3LTO A;  4DR5 F;  1HQU B;  5C42 A;  3ONQ A;  3UCZ P;  4ZVT B;  1BC6 A;  2HEK A;  3W8P A;  2FJW A;  2MQL A;  4IFV B;  4HT7 A;  1X9S A;  2ZH7 A;  1S1X A;  3NL0 A;  4GRS A;  4DI6 A;  2MZQ A;  2W24 A;  3C2P A;  4ZVH A;  2W7P A;  4JV5 F;  3WIU A;  5KFH A;  1R89 A;  3LP0 B;  1FCA A;  2CJB A;  3G96 A;  4OLP A;  4DQS A;  1CJV B;  2FLO A;  3N6L A;  4U67 Q;  1S4E A;  2RD5 C;  1EKR A;  3DRY A;  3QT7 A;  4F4X A;  2BW7 A;  2W01 A;  5DJB A;  3KWM A;  3GLJ A;  2HFS A;  1RWP B;  3NGK A;  5DGB A;  2C3P A;  2DB1 A;  4ETX A;  5G4D A;  3Q22 A;  1BD6 A;  1CC7 A;  3CCU S;  3RBE A;  2GQC A;  1C1C B;  4YUD A;  2YNI B;  4FDF A;  4ES2 A;  1TAQ A;  5C24 B;  2ZBI A;  1S9G A;  2CJQ A;  4UQT A;  3Q8R B;  3QMQ A;  3SXL A;  4YN3 B;  3C6T B;  4EEY A;  2VJU A;  3HZE A;  1S1W B;  5DS7 A;  2I5J B;  1G4C A;  3WX4 A;  4F0M A;  4M5D B;  3NNC A;  5I3U B;  1SH2 A;  2J9D E;  1OSD A;  3G4S S;  1WHV A;  2OD6 A;  2UXC F;  2W9C A;  2HK3 A;  3M8R A;  2QLW A;  4UT4 A;  5KG4 A;  2ILY A;  4DR6 F;  3IR5 B;  5HO4 A;  3L09 A;  4B3S J;  4OQJ A;  1CPZ A;  3GYX B;  2JHE A;  3I0S B;  2HIQ A;  5D0G A;  3W2W B;  1Y10 A;  2F1F A;  1RHM B;  3M1V A;  3PG9 A;  5JMN A;  3SZ2 A;  2H4W B;  4WZQ A;  2DIT A;  4DLG A;  3SCL E;  2IC3 B;  3KLF B;  1FEH A;  4U7U K;  4CLU A;  3ZO7 A;  4NYZ A;  1WDT A;  1FKO B;  2AJ4 A;  4LF7 J;  1CSJ A;  4LVN P;  1IBC B;  2PA8 D;  5IOL A;  2HYI B;  1NPP A;  2WK4 A;  4ECS A;  4B3R F;  3VVT A;  1U1P A;  1JLQ B;  1JXV A;  4RJV A;  3MM8 B;  1N5Y A;  1NPK A;  2YKA A;  4WCE Q;  2IRX A;  1WTB A;  5U47 A;  1R8P A;  1VQP S;  3IP0 A;  4ZHR A;  4XPC A;  3R6L B;  1RHK B;  4DL5 A;  4LF4 J;  5LSL A;  3QJJ A;  4QWE A;  4NLQ A;  2C42 A;  4O23 A;  4JV1 A;  5KFF A;  2CUY A;  5C7P A;  3NOG A;  4LF9 J;  3QWU A;  2HQD A;  3OT9 A;  4OYM A;  3NY0 A;  5LJ5 Y;  2QYC A;  1U48 A;  4DSJ A;  2OH2 A;  3R97 A;  1VQ7 S;  1SC6 A;  2DGU A;  5LMU J;  3MAA B;  2WVD A;  2VFU A;  1TUG B;  5LOQ A;  3CB4 A;  2R42 A;  3FDS A;  4KGZ B;  1M90 T;  1XTZ A;  4J37 A;  3AD9 C;  4OIX A;  2AX1 A;  2XSJ B;  2HS4 A;  2EFQ A;  4IH6 A;  1H98 A;  3JSM B;  1SJ4 P;  1IKV A;  1V6H A;  1NUE A;  2ROE A;  2RKI A;  1NSP A;  5I3Q A;  1WNE A;  5GME A;  3O8W A;  3K5P A;  3VAF A;  4LF8 F;  3HHE A;  5F8M A;  4A8W A;  1NJW A;  2PN6 A;  3CXC R;  2K8G A;  1AUS L;  3VZH A;  3FMB A;  2LLZ A;  3HP6 A;  5HJX A;  5A8K A;  4KGM A;  3A3P B;  3S7R A;  3KUG A;  5KFO A;  3P8B B;  1JLB A;  1L3S A;  4RNO A;  1T9X A;  1QDU B;  4Z2X A;  2HVZ A;  4NL5 A;  1PCA A;  5CYQ A;  1HWK A;  3DGP B;  4ALZ A;  2SXL A;  1FTC A;  3PYE A;  3VF0 B;  1YJW S;  4QWA A;  1RTI B;  1RE1 B;  3CIM A;  1F2G A;  2OPQ A;  1ZM4 A;  1DRZ A;  1REV B;  2B9X A;  1Y0H A;  3JSB A;  5HL7 Q;  3WQP A;  1QE1 B;  4RWW A;  3D6F B;  3R5B A;  3W3S A;  3D54 A;  4DOZ A;  1U02 A;  1FRH A;  4OI6 A;  2XMW A;  1NO8 A;  4ZJL A;  4J9S A;  2OTJ S;  3G6V A;  1SKS A;  2KH9 A;  3BJY A;  4B9T A;  4ZP7 A;  2VG5 A;  4I2P B;  4ECR A;  4WU3 A;  1NK0 A;  4NCG A;  5BR8 J;  1I6J A;  3IMQ J;  2KHC A;  2POK A;  3ZZR A;  1RAA B;  1SPB P;  5B0C A;  1TL7 B;  4CO0 A;  1JLF B;  3UVJ B;  1O5J A;  2AYG A;  5IWA F;  1MML A;  3PFO A;  4P2M A;  1NDC A;  2KXH A;  1VIO A;  3EGZ A;  2J0S D;  2R8K A;  4ES3 A;  3MED B;  1KQS R;  3V2U C;  1QM9 A;  3F44 A;  1T9U A;  4NLS A;  2XUL A;  2DO0 A;  2FHJ D;  3PW7 A;  2ZVS A;  1T8E A;  2PMW A;  4K8R A;  4YME A;  3Q8U A;  4NA1 A;  1IQT A;  1S1T B;  1KDN A;  3LP1 A;  1CBK A;  3BGF A;  3DMJ B;  3I82 A;  2CVE A;  2AV5 A;  2UXD J;  4UZC A;  1C1B A;  4LFB F;  3N5F A;  2GC8 A;  4PQA A;  3FBE A;  3OXG A;  2MXY A;  2XY7 A;  3L7O A;  4RLE A;  5K5M A;  4ECU A;  1VQY A;  5SUH A;  4NPO A;  4ZJQ A;  1LQ9 A;  2F8M A;  3HHK A;  2VFS A;  3Q23 A;  4ZPA A;  2O01 C;  4C8O A;  3T5H A;  3QQC D;  1BE4 A;  4OX6 A;  3NGR A;  4JOU A;  2LU2 A;  3RBX A;  3J7Z 5;  2HRY A;  1QTN B;  5GAD U;  2B6A B;  1S6O A;  5L1L A;  3DOL A;  3VAI A;  4MYT A;  1XR7 A;  4DV5 J;  1H38 A;  2MKS A;  2DNP A;  2WON A;  4DV1 F;  3THP A;  2V67 A;  1U24 A;  4QCL A;  5IT9 U;  4LSL A;  4YP3 A;  4HI2 A;  3BF4 A;  3THV A;  4DV4 F;  4RW6 B;  1Q81 T;  2PGC A;  2BA9 A;  5E3Q A;  3LH2 S;  4DR1 J;  1J2V A;  4DUY F;  2G9O A;  1AFI A;  2XY5 A;  2HK2 A;  2DGQ A;  1VJQ A;  2BJ3 A;  2CPY A;  4ERD A;  4C3M A;  1Y4Z B;  1OPZ A;  3AA9 A;  4IRC A;  4USV A;  3OTB A;  3JSY A;  3JXO A;  3H7H B;  1HHQ A;  1L5U A;  2WB1 D;  4C0B A;  1GMV A;  1RLD A;  3DDN A;  4K5R A;  1XNQ J;  2EG2 A;  3NP5 A;  4P2X A;  1RP5 A;  3D4J A;  1B7Y B;  3NS5 A;  3T1Y J;  1S6P B;  5D3G A;  3FUY A;  2D7S A;  2YH1 A;  1U1L A;  1G2E A;  2HNY B;  2PMZ D;  7AT1 B;  4LSN B;  1DTQ B;  4AL5 A;  5HRO B;  3UI3 A;  1MU2 B;  3F0N A;  1ZA1 B;  4K59 A;  2VFV A;  4TU7 A;  1QUV A;  4HDH A;  3HMJ G;  3TUJ C;  2H65 B;  3MM5 A;  2JLE A;  2R7U A;  4GVB A;  1VBZ A;  1TKZ A;  2QL7 B;  2HHQ A;  2D3Z A;  1JXE A;  3M2V B;  4I6Y A;  3CJK A;  2N3O A;  2X1B A;  1SV5 A;  1UJ4 A;  3FZ2 A;  4X66 F;  5L38 A;  1Y5I B;  3AB4 B;  4J9V A;  4ELT A;  3CC7 S;  1VQK S;  1K44 A;  2JFK A;  3O3L A;  4USM A;  5F8N A;  4OZJ A;  4WKY A;  3BGR B;  3VCD A;  4K4Z A;  2DH8 A;  3D67 A;  3FC9 A;  3IC1 A;  2C2R A;  1HQE A;  2XZT B;  3EX7 B;  3UPF A;  1SJF A;  1S1V B;  2P2C B;  3G9C A;  3ILL A;  3DLH A;  4CNZ A;  3NCR A;  2D1C A;  4NYP A;  3OR2 A;  4OMF G;  2ZM6 F;  2KO1 A;  2Z2Y B;  5LJ3 Y;  4QYZ K;  2MQN A;  2VQF F;  1WD6 A;  4RX6 A;  2HQ3 A;  1OSC A;  3DU5 A;  1SC3 B;  3K5O A;  1ZPW X;  2ZFH A;  4DPT A;  3TOQ A;  3UR3 C;  2FVR A;  1HBU A;  4F8R A;  3DYA A;  1I5O B;  2Z2L A;  1AA1 B;  4AXJ A;  4DV7 F;  4BC7 A;  1PGZ A;  3SEO A;  1X0P A;  2HHT A;  4NMX A;  1APS A;  2MKC A;  1GNK A;  3EWG A;  7FDR A;  4ZLP A;  3KK2 A;  1KVK A;  2OO4 A;  1UW9 A;  2XQC A;  1CUL A;  1GXT A;  1X4C A;  2QMU B;  2LXI A;  3HO1 A;  3MM6 A;  2MGZ B;  3PM9 A;  1A0O B;  1QUP A;  2ZD1 B;  2GVZ B;  4ZCM A;  4H4M B;  2ZH2 A;  3HDS A;  1X31 C;  5A0Y B;  3LWL A;  2EK6 A;  5KOX A;  3NGU A;  2L9N A;  1B99 A;  4DSF A;  4TQS A;  1WEX A;  1EQ0 A;  3BQ2 A;  3GJQ B;  3CNQ P;  1NKB A;  3MAQ A;  1XBW A;  2PA3 A;  2V4J A;  5HMW A;  3X1L B;  2W4C A;  3OW2 R;  3KFW X;  1OO0 B;  5KG3 A;  5C25 B;  1GMW A;  2BKP A;  1FK9 A;  1HBN B;  3QGH A;  4G6V B;  4KJI A;  2ALZ A;  3ILO A;  3M05 A;  2HG4 A;  2QJ3 A;  3ETO A;  2G13 A;  2L41 A;  2PDA A;  1TVR B;  4X4T A;  1TZ0 A;  3L7P A;  5F8G A;  1PC4 A;  4ENO A;  4OL8 A;  2MPU A;  1R6Y A;  1WJ9 A;  1LXN A;  5MLC V;  3PR5 B;  3QZ8 A;  1KON A;  4J7C A;  3KJF B;  4NEY A;  2AD9 A;  3KLV A;  2VOO A;  5EHH A;  3CCE S;  5D78 A;  1SL0 A;  2EKY A;  3QT8 A;  2XCA A;  1A6L A;  1YX2 A;  1GX6 A;  3SFG A;  1WOS A;  3MI7 X;  1Y00 A;  4Z7C A;  2DXE A;  1ZTW A;  2MQO A;  3I5A A;  1FD8 A;  1VQ4 S;  1Q53 A;  2VF3 A;  3DOM B;  4K4U A;  2KT2 A;  4ED8 A;  4WU2 A;  1KD1 T;  3QO9 B;  3D3C J;  5CZD A;  4NI2 B;  2BKO A;  5KFY A;  3ISN D;  3CD0 A;  3R5A A;  4BHQ A;  5K8M A;  3V5R A;  1IKX A;  2LDY A;  4NA3 A;  4RW8 B;  3DDI A;  2NCK L;  2CNN B;  1Q0N A;  4YB6 A;  2HMI B;  1PJ5 A;  4F25 A;  1VI7 A;  1WOR A;  2DGV A;  3E01 A;  3MTK A;  1GX5 A;  3I56 S;  1CLF A;  2ZJQ Q;  5KFJ A;  1LK7 A;  3KK1 A;  1NK8 A;  1S7H A;  2IAJ B;  3M9O B;  3MUT P;  4JI8 F;  4O4G A;  2JEJ A;  2YKM A;  3QFW A;  2CQ4 A;  1OMS A;  4LRA A;  4FVM A;  1SH3 A;  1XMO F;  4OZ3 A;  5GVQ A;  1LEO A;  3CJ2 A;  1RT2 B;  4DR3 F;  3GU0 A;  4X4V A;  3K2Y A;  1JLA B;  1RWM B;  2FJE B;  3L95 X;  4LR9 A;  1PC5 A;  2ZE2 B;  1UET A;  4J9R A;  2K3I A;  4Q0B B;  3O6Q A;  4ZIV A;  4KH0 B;  4CTA A;  4RW9 A;  3I96 A;  5KAK A;  5I4M A;  4TQR A;  2WVF A;  2RS8 A;  3OV7 A;  2EFV A;  1VQ5 S;  3QAT A;  1G1X A;  3VQS A;  4CDI A;  4FNI A;  4GVL A;  3PIO Q;  3G86 A;  3CCR S;  1XEZ A;  1T03 B;  4LF1 A;  2IBK A;  3VV2 B;  2UVR A;  1LXJ A;  3M32 B;  1W25 A;  2YQ3 A;  1UAW A;  1IKW B;  4AUK A;  4NZ6 A;  3DRS A;  2J7K A;  4FS2 A;  4OZ1 A;  3KHR A;  4OJ1 A;  2VIC A;  3DU6 A;  1OY6 A;  4JI4 J;  2MY8 A;  1VQM S;  5FLX U;  1SIZ A;  2NXN A;  3TWZ A;  1AZS A;  2BDP A;  3OVA A;  5GAG I;  4ECQ A;  1NJI T;  5DO2 A;  1RAE B;  3SFU A;  4ELV A;  2LMI A;  5IFM A;  4KRW A;  3TA1 A;  4IQM A;  2OEK A;  1RUS A;  2MMY A;  2HHU A;  3BKU A;  3CGI A;  1FJG F;  2HUR A;  4JI3 F;  2N82 B;  4J9U E;  5EX0 A;  2OPR B;  4I0W A;  2I0X A;  4NLT A;  2F4V J;  4QIW D;  2FHJ A;  2D3O 1;  1EQM A;  1NBE B;  1HWI A;  4F50 A;  8AT1 B;  2GML A;  4HYK A;  4QQB A;  1LK5 A;  3LGH A;  3ZTR A;  2R2R A;  4KHM A;  2A10 A;  4LRD A;  2XMK A;  4RZR A;  2PEH A;  1IBM J;  5DGA A;  3M8P A;  1F9E B;  5KFK A;  2LEB A;  2K1R B;  1ICE B;  4H4K A;  5CYJ A;  1U26 A;  1O8B A;  2CQD A;  2JEI A;  3PR4 A;  4QYZ J;  1HD0 A;  2QA2 A;  5HAT A;  2AEM A;  1QSS A;  1RHQ B;  3GCX P;  2Y1L B;  2FJB B;  3G82 A;  4YEA A;  3T41 A;  1UVK A;  3W65 A;  2DGT A;  4JI0 J;  2M8H A;  3MMC A;  1L3K A;  3HFK A;  3TVY A;  1RT5 A;  5LT5 A;  2M7S A;  5B0G A;  3PO5 A;  3TJ8 A;  3C66 A;  1EX8 A;  5IV4 A;  1LWE B;  2GGP A;  1JLG A;  3OR1 B;  3QT6 A;  2NYH A;  1HBO B;  1L3T A;  4MKA A;  3W64 A;  2ZH6 A;  5I42 B;  4ICL B;  1ZBT A;  2EEY A;  3KXD A;  3M9M B;  3R5J B;  4EBD A;  3I4H X;  2FDN A;  5KFE A;  3TVZ A;  1VQO S;  1PG5 B;  2QMW A;  1XC9 A;  3OL7 A;  4N76 A;  4DV2 F;  3ITH B;  1NJY A;  4URG A;  3RW6 A;  4NLX A;  3W66 A;  3ENW A;  3HVR A;  3CMA S;  1EB0 A;  3NMA A;  3HLU A;  1JNR B;  1VJW A;  2J0Q D;  4NZ7 A;  2AJ0 A;  4LIR A;  3T3F A;  3M2R B;  2W2Q P;  3CUN A;  2PD1 A;  4OYP A;  3PJX A;  1F60 B;  1IBL F;  2GVD B;  1XNR J;  3K89 A;  3BKT A;  5DG7 A;  1XMB A;  3KK3 A;  5G0R B;  5F0W A;  1IN0 A;  4DL6 A;  2R8J A;  3EVW A;  4QR2 A;  2LXF A;  5EGY A;  3LP2 A;  2DKO B;  3HPO A;  1H74 A;  5DQH A;  4RNM A;  5J2P B;  3U02 A;  1HWJ A;  2YNF B;  2JEF A;  2FTR A;  1SKW A;  3H5Y A;  1O0P A;  4ZLN A;  4R5P A;  1ARO P;  5MAO A;  2LEA A;  3KLE A;  4USJ C;  2HRU A;  3OTC A;  1HL6 A;  5HVF A;  3CDA A;  4CYU B;  1HYS A;  4ZVG A;  3OUY A;  4MK7 A;  4LR8 A;  4ECY A;  4ZS6 A;  4PG4 A;  2DRB A;  1N32 J;  4B9N A;  1IWA A;  3CCV S;  3MM9 A;  3IRW P;  2EFN A;  2KM8 B;  3NBP B;  4F2R A;  3RRG A;  4EYI B;  2QLX A;  1V3R A;  2XWY A;  3G2X A;  4R8U B;  1HW9 A;  1CS4 A;  2YWF A;  1ZET A;  2HZA A;  3R1H A;  3PRB A;  1H73 A;  1RAC B;  4DSK A;  4NLW A;  4LT6 A;  3M8Q A;  2NYI A;  1WHY A;  3I5B A;  1RAF B;  3W60 A;  2JC1 A;  3RBZ A;  5HVH A;  3K8W A;  4OJG A;  4A8M P;  3D2W A;  3KHG A;  1UEV A;  2W8K A;  2I6W A;  3HD1 A;  2ZC3 A;  2LQ9 A;  4QPX A;  4ZCL A;  2DRA A;  3AXK A;  3EPG A;  7FD1 A;  5E7O B;  2P6S A;  3VGU A;  4X84 A;  2Q3P A;  4OYX A;  2ZHB A;  4HDG A;  2N4D A;  2YQ0 A;  2UU9 J;  3R6G B;  1IM6 A;  3DM2 B;  3E3X A;  3RAX A;  3T5K A;  3BM7 A;  1H6K X;  4JBC A;  1RAD B;  2HSE B;  3M8Y A;  1RDR A;  1YJR A;  2CDQ A;  4FXW A;  3MMA A;  2VG6 A;  1RT4 B;  3CCT A;  2DK2 A;  1D9D A;  3C14 A;  1U47 A;  2WW4 A;  3CJQ A;  1I94 F;  2V4R A;  1G6B A;  3LPY A;  1W2I A;  3KJV A;  1KNZ A;  4C0O C;  4G1P A;  3EYZ A;  4JV0 A;  1FRL A;  1T9T A;  4CH1 A;  2DHA A;  4F4Y A;  1JJ2 R;  1XN9 A;  3J7Z T;  2N3L A;  4HH1 A;  5HP1 B;  1WHX A;  3BV8 A;  1JKH B;  1S9E A;  2IDL A;  3AY0 A;  4HAC A;  1FE0 A;  3MM7 A;  4R0J A;  3VAJ A;  5BXI A;  2EFP A;  1ZA2 B;  3MEE A;  5GAH I;  4J9M A;  1BQX A;  2HHH F;  1YRU A;  2VFR A;  2VL1 A;  4CLT A;  1RWU A;  2HPU A;  2XEX A;  3OL6 A;  5KFZ A;  3KNA A;  1T9V A;  2DGX A;  3IR7 B;  4C3L A;  1RWX B;  2CZ9 A;  2QT7 A;  2YPY A;  5ETT A;  4DWI A;  3MCS A;  4OI1 A;  2APO A;  2W25 A;  5KFL A;  1HNW F;  1JXL A;  4ZPV R;  1C0U B;  3IG1 B;  1TFY A;  1TKX A;  3UN3 A;  2R7Q A;  1U49 A;  2VKR A;  3DLB A;  2YBV A;  1WI6 A;  2BJ8 A;  1VLY A;  2IRY A;  4I6A A;  4X62 F;  4C3K A;  3PO4 A;  2R8G A;  2ASJ A;  2HHW A;  2CNK B;  1S1W A;  1N48 A;  4XTT A;  2GO9 A;  4WE1 A;  2W1B A;  5E3P A;  4URS A;  2X1F A;  5J2Q A;  1UWB A;  3GTY X;  3T6B A;  2ACM A;  3I0S A;  3CCJ S;  2FB0 A;  4RNF A;  4PYD A;  3NCQ A;  3FSI A;  5KFP A;  2HNZ A;  4ZMM A;  3FKB A;  3W2V A;  3MDF A;  3DRX A;  4KO0 B;  1UCN A;  2BW2 A;  5K8N A;  1VDH A;  1JLC A;  4DN0 A;  2VKZ G;  3A4T A;  4LFC F;  2LA6 A;  1O51 A;  4ID5 A;  4NLU A;  4V1A k;  1JJH A;  3C16 B;  3TW0 A;  2BM0 A;  4U95 A;  2ZBR A;  2ZH9 A;  1U1R A;  3BN7 A;  2JRS A;  3IGV A;  4URQ U;  1VIX A;  2Q6B A;  4NXN J;  1FHT A;  4U7C A;  2FIU A;  2W4D A;  1YVF A;  2W7A A;  2EW9 A;  5AE2 A;  3FCH A;  4ZVE A;  1WKL A;  2ERR A;  3CO0 P;  4NE9 C;  2RQK A;  3OL9 A;  1SXL A;  3Q8V A;  3BGO P;  4KH1 B;  4ED7 A;  4YDD B;  3NGD A;  2VBX A;  4P74 A;  2HLT A;  2DNL A;  5HVG A;  4B3M F;  3M6U A;  2H48 B;  2VDI A;  3I0R A;  2OSQ A;  3TAQ A;  1YRT A;  1MMD A;  3PW2 A;  2AZ1 A;  1FRI A;  1F9F A;  1FRX A;  1FKP A;  3Q8Y A;  3A12 A;  2C2M B;  1T3N A;  4OZN A;  1S57 A;  3W7B A;  2G2O A;  2YTC A;  4ZCK A;  3IN5 A;  4EO6 A;  3LAM A;  1KOH A;  1RIS A;  4DF8 A;  5HBM B;  3PNI A;  2AWZ A;  4DL3 A;  1Z2Z A;  3BQ0 A;  5IC6 B;  3POT B;  4WXW A;  1Y5N B;  2CQ0 A;  5ETP A;  1YQH A;  5IM0 B;  4TVA B;  3ZC4 A;  1S0N A;  4W92 B;  2Y8W A;  2YKN A;  1WEZ A;  2GQQ A;  1HQ2 A;  4Q8F A;  1TV6 A;  3OLB A;  6FD1 A;  4ZVF A;  3H2L A;  1NM2 A;  4C48 A;  2IRU A;  2ZEJ A;  1NK4 A;  4IR9 A;  1UTA A;  3JYT B;  2RNE A;  3M6X A;  3IS9 B;  5DQI A;  3A8K A;  4F3Q A;  5KFC A;  4ECT A;  4FNH A;  2HHX A;  1HNI B;  2VG7 B;  2P9E A;  3R8Y A;  4DCO B;  4MFB A;  2DIV A;  2HBQ B;  4Q2L A;  2HND B;  2E29 A;  1NHU A;  5HI7 A;  5HLF A;  3D1Q A;  3MZI A;  2CG8 A;  1MWZ A;  4B3O B;  1D9F A;  5IXU A;  2ZJR Q;  4OX7 A;  1N5Q A;  1FES A;  3CJ3 A;  2WCX A;  4IG3 B;  5KFG A;  2ZJP Q;  1D1U A;  2VZ8 A;  1TR0 A;  3S6E A;  2HWH A;  5EN1 A;  3PW5 A;  1HIY A;  1K0T A;  4QR0 A;  5LXY A;  1HD1 A;  4DG1 B;  1CC8 A;  4PPD A;  2C3M A;  2BOA A;  2LA4 A;  2GMH A;  2ZBQ A;  3LO3 A;  5F41 A;  2DH9 A;  3IM9 A;  3KDN A;  1CJK B;  5D6G A;  2ASL A;  5IC4 B;  3HKW A;  3NCP A;  3IAM 9;  2FJD B;  2ZBP A;  4LQ3 A;  3LF0 A;  4OZ2 A;  3CCZ A;  3OHB A;  1RSC A;  2HVD A;  3T6J A;  1T05 A;  1F0X A;  3Q2S C;  3QLH B;  1S99 A;  1A9N B;  1RT7 A;  4C11 A;  3AJD A;  2H5I B;  1WF1 A;  2C1E B;  2EFG A;  3QAE A;  4AND A;  1HBM A;  2DXF A;  2J9C A;  4JI6 F;  3UN5 A;  6AT1 B;  2R7W A;  2LU1 A;  2R9L A;  1WSV A;  2M0G B;  1XQI A;  2AKW B;  3M30 B;  3U7J A;  1DLO B;  3RR8 A;  1F1B B;  5HMY A;  1PYS B;  2MKJ A;  3MHY A;  2R7O A;  3KNG A;  5CZV A;  4HLB A;  1S77 D;  1TL4 A;  1U0H A;  1Q8B A;  2OJ3 A;  5E3C A;  1XJW B;  1LWF A;  3V4I B;  4DV6 F;  4P2F A;  2NRE A;  2B9Y A;  1K0V A;  4DF4 A;  5A2Q U;  1X5T A;  1N34 J;  2W2P P;  2VON A;  3J81 j;  1X8D A;  2VFT A;  4CH7 A;  4AL7 A;  2QGF B;  4P52 A;  4DR7 J;  3SQG A;  1BQM B;  5J1E A;  3OFG A;  5A8R A;  1Z4U A;  4IFY A;  1G7C B;  4QR1 A;  3O44 A;  2YWH A;  1SB6 A;  2O5D A;  2XHC A;  5F8H A;  2Y1J A;  3QBC A;  4DV0 F;  3I32 A;  3KUE A;  4USW A;  2YNG A;  1K73 T;  3DDK A;  3H5S A;  1B0V A;  4CLW A;  4I68 A;  5T14 A;  3CUL A;  1VRT B;  2CJA A;  1S59 A;  1H7X A;  4NAS A;  2V8P A;  3NLC A;  5KFQ A;  2E5L F;  4UY8 T;  2Z2M A;  4NRU A;  1K1Q A;  2ZHA A;  4B9S A;  4YB7 A;  1H72 C;  2XTJ P;  2UZA A;  2AYE A;  1RTH B;  4EO8 A;  1Y11 A;  2J0X A;  2OUG A;  4IO9 Q;  2IM3 A;  2PMH A;  2B9W A;  5F8L A;  1U2C A;  1MNE A;  2ATL A;  2AJ1 A;  1HNX J;  5AE1 A;  4JI1 J;  2ZZN A;  2OHD A;  3CF5 Q;  4O3S A;  4CLS A;  3PX0 A;  4A46 A;  4M5K A;  3HVA A;  1VCT A;  4PWD B;  1M0S A;  1KOO A;  1DAR A;  3CMQ A;  3H5U A;  1RTJ A;  5C42 B;  2MQQ A;  3K5L A;  3RB6 A;  2ROP A;  5B0B A;  1TKD A;  4ZPT R;  3W5X A;  5T7L A;  3DGV A;  2MST A;  2QLF B;  1P8G A;  3NGT A;  2DNY A;  4IO1 A;  1S1X B;  3QWP A;  2FVP A;  1UA1 A;  4TYA A;  2BQU A;  1ZM9 A;  1PIE A;  2ZBC A;  3JQJ A;  3KLI A;  2KM8 C;  1XMQ F;  2Z56 B;  5HRO A;  2M52 A;  5E0O A;  2V9W A;  2VQE F;  4OYZ A;  2WRM A;  4JI2 J;  4F26 A;  3AJ2 A;  2C2D A;  1Z1Z A;  2XLI A;  4I2Q B;  5LMN J;  1LW0 A;  4QPT A;  1PJ6 A;  3CD6 S;  2AJF E;  3PRD A;  3RYL A;  3RRH A;  1U6B A;  3M2V A;  2BAN B;  3MF5 A;  1S9G B;  4RBU A;  3KG0 A;  3H4B A;  2W7O A;  1HWU A;  3W5Y A;  1VC5 A;  3A13 A;  2EFO A;  1S0O A;  1LFP A;  1N54 B;  1KBR A;  3LOU A;  3MCM A;  2HS0 A;  1J5E F;  4MH8 A;  4DR4 F;  2XGP A;  2XM3 A;  1X60 A;  1S1U A;  2QLJ B;  3SSR A;  2ZNZ A;  2W9C B;  5L1I A;  3ILI A;  1TU0 B;  1HR0 J;  3NAI A;  4M63 A;  3KMS A;  3SCK E;  2H5J B;  3UNG C;  4CZC A;  1K8A T;  1FE4 A;  3NXZ A;  4ECV A;  5KFV A;  4GKJ F;  4WFB Q;  2XYP B;  4NXM J;  1YHQ S;  3DFE A;  4XAK A;  3M1V B;  3RB4 A;  2IJF A;  2YNH A;  2V69 A;  1VQ9 S;  2R2T A;  1S0M A;  4G1Q B;  2AZ3 A;  3G8S A;  3UCG A;  1UKU A;  1PIL A;  5HSP A;  1P27 B;  4X4O A;  4X4R A;  4KHP J;  5GAE U;  3CSK A;  1XR5 A;  2B5J A;  3N6M A;  4F04 B;  2YPZ A;  1ROF A;  1HPZ A;  1JNZ B;  1OWX A;  3B78 A;  3QID A;  4DFK A;  2UXB F;  2IMW P;  1T9Y A;  2CG4 A;  2XZW A;  1B7F A;  2MZR A;  3GV7 B;  4ILR A;  4YHH J;  1N5Y B;  3OTO J;  4BBY A;  1EP4 A;  3AOC A;  5ETO A;  2XO7 A;  2HGN A;  2OP5 A;  3IBC B;  5KFN A;  4ZHR B;  3EXC X;  4DHV A;  1UEK A;  5M2P A;  2QN6 B;  3J80 U;  1U09 A;  1TQL A;  3WIV A;  1QVG R;  2MQP A;  4Q8E A;  3W62 A;  2FVC A;  1KWM A;  3BH6 B;  4RUH A;  4IDK A;  4H4M A;  4USK A;  4DZ6 A;  4MIB A;  1SI9 A;  4Z7Y A;  1SJ1 A;  1P6T A;  3HT0 A;  1N0V C;  1EKS A;  1DJ0 A;  1TL5 A;  2CNL B;  1RT1 A;  3B82 A;  3MUR P;  3KDO A;  1N56 A;  2KRR A;  3MR7 A;  4TLR A;  3KLG A;  3AA8 A;  2WB4 A;  2F9D A;  2FHM A;  4ZPB A;  2LP4 A;  4WYW A;  4F4W A;  2BV3 A;  9ATC B;  3TZZ A;  1NB7 A;  4MT1 A;  2J0W A;  1IKV B;  2GO8 A;  2LEP A;  4L76 A;  4B08 A;  3FEX B;  1FDN A;  4NYO A;  1MRO A;  5E3A A;  2RKI B;  5C25 A;  1TP7 A;  4KSE B;  3DHX A;  1A7G E;  3SYZ A;  4C4W A;  3MPU B;  3IGN A;  2AX0 A;  4ZOS A;  3BSA A;  3FBB A;  1LWC A;  1MMN A;  3MXH P;  2DR7 A;  2DCU B;  3BQ1 A;  1F9H A;  3PRV A;  3GG0 A;  4E2F B;  4O3O A;  2CPD A;  3BDE A;  4ZK7 M;  2J9E A;  5CYQ B;  3RAM A;  1RI7 A;  4B9V A;  5KFI A;  3GIK A;  4QYR A;  2IYI A;  2FQQ B;  1RCO B;  1YJT A;  4HVZ A;  5K9F A;  3TQ1 A;  5DZ6 A;  1HI1 A;  1VFJ A;  1URR A;  2OPQ B;  2UUT A;  5F3T A;  1RHR B;  4DR7 F;  2G2Y A;  2A3J A;  3HHN B;  2E7X A;  5DM7 Q;  1Q5Y A;  1HNV A;  1NB2 A;  2KXF A;  1QJH A;  2DR5 A;  1WG4 A;  4UUX A;  3J7Y I;  2XI3 A;  5H1S V;  1S76 D;  5HQM A;  3GIM A;  1WEY A;  4FXV A;  3VAM A;  1NKC A;  1KEK A;  2JVR A;  4B9M A;  4PYA A;  3RR7 A;  2VG5 B;  1N33 J;  3OFF A;  4NCG B;  2ZC4 A;  4M5H A;  2FJA B;  5A6P A;  4CO3 A;  2HMI A;  2O1P A;  3D5M A;  5AXL A;  1DHM A;  4ZVP B;  2NSB A;  2BAB A;  1SQG A;  2RE1 A;  1R8B A;  4OV6 A;  3GFY A;  5D77 A;  1BWE A;  1FDD A;  2FPH X;  3PXG a;  1DUR A;  4I1T A;  3BZQ A;  4ILL A;  4IOB A;  3MUM P;  2DNK A;  1WEL A;  4USU A;  2V9K A;  1S7I A;  2BE7 D;  3A8I A;  4GKK F;  4DUZ J;  1HNX F;  1EZZ B;  4U8Y A;  1I51 B;  3CE8 A;  2DR9 A;  3R27 A;  5EWF A;  2GV1 A;  2J9D A;  2UUC J;  2JOQ A;  2ASD A;  2QE5 A;  3GJR B;  4N77 A;  3LP1 B;  2DNZ A;  4YQW A;  3C46 A;  2EPI A;  1C1B B;  1L3U A;  2D69 A;  2VBW A;  2E1C A;  1NSK L;  3RTV A;  3AAW B;  4NLR A;  4CO4 A;  3TAM A;  2KB2 A;  3C19 A;  4ELU A;  3M32 A;  4LF5 J;  2MKY A;  3E51 A;  5HK4 A;  4LR7 A;  3FZB A;  3QJP A;  2CQB A;  2ZH5 A;  1RGV A;  1VOM A;  2WHO A;  2R4F A;  2KZM A;  2Q79 A;  3FFI A;  1VC0 A;  1B0P A;  1NK5 A;  3DOL B;  2HBR B;  4R25 A;  2WON B;  1HA1 A;  4F4Z A;  1JB0 C;  4KR0 B;  4DUT A;  4MMO A;  4RNH A;  2ZH4 A;  2U1A A;  2LQB A;  4Q44 A;  4MK8 A;  2OPS A;  3FEZ A;  1ZM3 A;  1FT8 A;  1YI2 S;  1RKI A;  1Q82 T;  4WP3 A;  2B8P A;  3V6K A;  3AOA A;  3LGM A;  4K0K J;  2DNR A;  3W8G A;  2J6U A;  1LNQ A;  2K7J A;  2YX1 A;  2HVH A;  1C4A A;  1WHW A;  4IOC Q;  1N52 B;  1KQG B;  2AJQ A;  1P9Q C;  5B08 A;  3IRX A;  1H2T Z;  3LAN A;  1NK9 A;  4F0H A;  3QGP A;  2JFD A;  4UST A;  4DL7 A;  2QSF A;  1FRM A;  3CJ5 A;  3VHQ A;  1IBK F;  5K14 B;  3AOD A;  2GCF A;  2GJF A;  3LPE A;  1J5O B;  3JAM Y;  4QW8 A;  5IQQ A;  1WF0 A;  2RAQ A;  1ELO A;  3HVW A;  1U1M A;  3M8S A;  3H8Y A;  3C15 A;  2AQ4 A;  4QOT A;  3LAL A;  4KHP F;  4JI5 F;  2XG8 A;  1FX2 A;  5THW A;  5B0F A;  5D3G B;  4LF6 F;  1DQ9 A;  4PCQ A;  4TN2 A;  5J2M A;  4DV3 F;  2NZ4 A;  4YR3 A;  1VHI A;  4F2S A;  3DI6 A;  3TAN A;  3G8Q A;  4CP5 A;  2M2B A;  2WVB A;  2VOD A;  1VK3 A;  1YDL A;  5M2U A;  4GO7 X;  2ZZM A;  3SV4 A;  2ZH3 A;  1S10 A;  4OZ5 A;  3VZI A;  4OYA A;  3MM5 B;  2Z4P A;  2HS3 A;  4GVB B;  3W9I A;  3ZTO A;  1TKZ B;  1VRU A;  3ITH A;  2JWN A;  1IWG A;  1UP1 A;  4TLQ A;  5CQG A;  4NLY A;  3CJK B;  3VWS A;  2BUN A;  1SV5 B;  3D1O A;  1UVL A;  1WAC A;  5DDP C;  1GXU A;  3M4X A;  2X1A A;  1H7W A;  3DOK A;  3T1H F;  3DKD A;  1WOO A;  1S0V A;  2CZ4 A;  2D3U A;  1UJ6 A;  1FTR A;  2LFV A;  2OFG X;  1HQE B;  1Y3K A;  2KJV A;  4NOH A;  4X65 J;  2AIR B;  3JTN A;  4M5G A;  4C0H A;  2QMX A;  2CZV C;  4ED2 A;  4FBU A;  3EDQ B;  1U8W A;  4EMD A;  1PSD A;  4L3K A;  3DNC A;  3OR2 B;  3TA0 A;  2KHD A;  4X4S A;  4CRJ A;  4MKY A;  1N36 F;  3U27 A;  2HVI A;  3P5B P;  4RBV A;  3S01 A;  2CQ3 A;  1WC1 A;  2BX6 A;  1T0T V;  1WKJ A;  2VA2 A;  2XC9 A;  1QAY A;  1HBU B;  3GIJ A;  2R7T A;  4XK8 C;  3EVO A;  4Q43 A;  1TAU A;  3DYA B;  4JUZ A;  2HW3 A;  2CPE A;  1N8R T;  4YY3 F;  2QL9 B;  4P7V A;  3BSC A;  3H98 A;  2V8G A;  4ZN3 A;  3NBP A;  4IUF A;  1HNZ F;  2AYB A;  5GMK a;  1X4D A;  2G2Z A;  4J90 A;  3KK2 B;  3IBF B;  5CHC B;  4UW2 A;  4TU9 A;  3IFE A;  1BGX T;  4F67 A;  2EK1 A;  2F8E X;  1MG7 A;  1GXL A;  3Q86 A;  2V2Z A;  2V2V A;  1Y7P A;  1F3V A;  1ULR A;  4LF2 A;  2YKP A;  3EGV A;  1HMV B;  3HM9 A;  2OPP A;  2M3D A;  3D1H A;  4I7F A;  5K8O A;  2XNR A;  2MJN A;  3CT9 A;  4FPI A;  3BBB A;  2C28 A;  1Y3J A;  3G6X A;  2CA9 A;  3BO2 A;  4X4N A;  1RAG B;  4OLO A;  2DNH A;  4OV1 A;  3EZO A;  2A2C A;  3P5T L;  4QWD A;  1RTD A;  4DR2 J;  4ZP9 A;  2V4J B;  1T3O A;  1UPM B;  2UUB J;  4WFX A;  3EPI A;  4ID8 A;  3JTP A;  5AXN A;  2RH3 A;  3ENV A;  3TAP A;  2DGO A;  1REG X;  1VS3 A;  3JS9 A;  2KG1 A;  2EBE A;  2YH0 A;  4OX9 F;  1F5B A;  3RU0 A;  1TFW A;  4PPZ A;  1FK9 B;  4ZVU B;  2D74 B;  1QTM A;  4BDP A;  2E9R X;  1SC4 B;  4P2S A;  4ER8 A;  4TY8 A;  1DAX A;  3IBW A;  4UOF A;  3G71 S;  3CJ8 A;  3CDW A;  2E5G A;  2GFF A;  4PXC A;  3UDC A;  3NKY A;  4PG5 A;  2E5I A;  3J80 Y;  5CCL A;  2DR8 A;  5FII A;  3C6U A;  3I31 A;  4OX8 A;  2W9A A;  1URN A;  2FUG 9;  3DLK A;  4A8O A;  4PUO A;  2XLK A;  2J8A A;  3BSN A;  2DEJ A;  4HH0 A;  3HI9 A;  1SUQ A;  4HTJ A;  3EIC A;  4EUV A;  1OS5 A;  4DFM A;  3CME S;  1X4E A;  3D6H B;  2HKE A;  1QAJ A;  2MHN A;  2IYG A;  3Q0A A;  4LRE A;  4DJB A;  2DVI A;  1EET A;  4AYB D;  3K17 A;  4IRD A;  2CYY A;  4P7T A;  3TRG A;  1R0A A;  4DSE A;  4EK2 A;  2GIF A;  1M5H A;  2QG9 B;  1QLN A;  3E01 B;  4DPO A;  5GAD I;  2H4Y B;  1HAR A;  5JXS A;  1FD2 A;  3CJR A;  3GZ7 A;  4FP9 A;  3KK1 B;  3KHH A;  2R3V A;  4XO0 A;  2MHE A;  4DL2 A;  4O4G B;  3KMQ A;  3JB9 k;  4N56 A;  1FXD A;  4PQU A;  2MZ1 A;  3RRK A;  1TUW A;  1M5S A;  2O66 A;  3HVT A;  3IWX A;  3QIP A;  5AXM A;  2M88 A;  4FBT A;  3QAU A;  2IVF B;  1H2V Z;  1U7L A;  4KC5 A;  4YB5 A;  4JYA J;  2MZT A;  1NDK A;  2I38 A;  3Q24 A;  4DS4 A;  3GMG A;  1NU4 A;  2ALY B;  1OIA A;  1NSA A;  2L3M A;  4DR5 J;  3ENA A;  3BPS P;  1VRQ C;  3EJM A;  3PYG A;  4IYQ A;  5DLG A;  1RYR A;  4NA2 A;  1Q7L B;  4CTA B;  4RW9 B;  2KT3 A;  1R0B G;  1M5P C;  3HUL A;  2XI2 A;  3CPW R;  3DRR A;  1RTZ A;  3HSD A;  1PBA A;  4B3S F;  4TNO A;  2FC9 A;  3PVX A;  1EAR A;  1V9O A;  1WG5 A;  3C8Y A;  4JV5 J;  1RAO A;  3CDU A;  3Q2T C;  3UCU P;  4J9Q A;  4LF7 F;  1FNO A;  4PAA A;  3DRS B;  5KG5 A;  1TKT A;  3AHP A;  3MMB A;  2KFN A;  4LIW A;  1JX4 A;  3ADA C;  4AXI A;  4WKR A;  3M8W A;  1AZS B;  3MMJ A;  4J9O A;  2RHS B;  2FZC B;  1AUD A;  2CPX A;  2M8D B;  2J7W A;  4Y6I A;  3HSJ A;  2V8D A;  1WI8 A;  2VB6 A;  5B0D A;  2R7X A;  4ZDN A;  2KG0 A;  5ADZ A;  4HI1 A;  1SJ3 P;  3OBI A;  4Y28 C;  2BJ1 A;  2BRK A;  1PJ7 A;  4RUB A;  3G87 A;  3D6M B;  4UUW A;  1NKE A;  4L74 A;  2E1R A;  4LF4 F;  1SKU B;  2P9C A;  2YY3 A;  3HT3 A;  2QL5 B;  3QGG A;  3ZZY A;  3U1N A;  1ACM B;  3OXL A;  2IHR 1;  5D4P A;  8RUC A;  1Q8I A;  1X4H A;  1U8S A;  4LF9 F;  1S79 A;  4DU7 A;  4DR6 J;  1FER A;  2RQM A;  3JSR A;  1R7I A;  3GJT B;  4I6W A;  2DBB A;  4X65 F;  3M8P B;  2JLF A;  4ECW A;  4OHV A;  5LMU F;  1RK8 A;  4FYX B;  1N4L A;  4LQ9 A;  3G6E S;  2RRN A;  2MLY A;  4HHJ A;  3OLA A;  1HHT P;  2WW8 A;  3DC2 A;  3P96 A;  3MEG A;  2Q6C A;  4DZD A;  2UUW A;  4WTY A;  3B4M A;  1U2F A;  1NZ8 A;  5CAA A;  3EZU A;  2FJV A;  3LAK A;  4ZVS B;  5BJR A;  1SH0 A;  1RHJ B;  3B8H A;  3G82 B;  2NS1 B;  4ED6 A;  2AGQ A;  4W98 A;  5FDL A;  3MMC B;  2JVO A;  1CEZ A;  1U0S A;  4B3R J;  2VV5 A;  2YWG A;  1RT5 B;  3Q8S B;  5AT1 B;  1D09 B;  4X4P A;  4L3N A;  5JVH Q;  5HAO A;  2W8L A;  1R0C B;  2MKK A;  4O3N A;  3RW7 A;  1M1K T;  2DCL A;  1EJ7 L;  2BQ3 A;  1GAO A;  2KRB A;  2GGP B;  1JLG B;  2VAS A;  4NML A;  3PJW A;  1NZA A;  1I1G A;  4HEA 9;  5ETR A;  4B3O A;  3EXY A;  1FEE A;  2GZO A;  3VR1 A;  2HQI A;  1TMM A;  2GNK A;  1R8A A;  1WUU A;  4ZIT A;  4MJK A;  4RW7 A;  1K47 A;  3NOC A;  3ENQ A;  3O1L A;  3NRB A;  5IV3 A;  4Y0F A;  1FDB A;  5KT6 A;  2DR6 A;  5C5J A;  2FD2 A;  1N6Q B;  4FPR A;  2XS5 A;  4XDD A;  1R6V A;  2HFU A;  1IKY A;  2EWH A;  3KKF A;  2OIH A;  1NHK L;  3VGT A;  3Q89 A;  3KK3 B;  5K20 B;  1CJT A;  4K2X A;  2NLW A;  3OPK A;  1XR6 A;  2CQG A;  4QBU A;  3OL8 A;  5KFD A;  5DG9 A;  1YGY A;  1ZAV A;  4DXL A;  2JL9 A;  1F5A A;  1RJJ A;  2XNQ A;  3R5D A;  2VBZ A;  3DLG A;  3V6H A;  4LF8 J;  1LW2 A;  1FNX H;  5BR8 F;  4BS2 A;  3AD8 C;  5LM7 E;  4R5P B;  3PY8 A;  4K4S A;  4DPW A;  2MEW A;  3K5N A;  1FXR A;  3BBF A;  4RW4 A;  1HYS B;  2FJX A;  4LFA J;  3OUY B;  1CJU A;  2GIR A;  2V94 A;  2CQP A;  1VHF A;  4F4A A;  4PG7 A;  4AMP A;  2QA4 G;  3ZTS A;  2VC0 A;  4DEZ A;  3GON A;  3MM9 B;  3GFH A;  1DTT A;  1NPR A;  2NUU G;  1AFJ A;  1CS4 B;  3OTE A;  1E6Y A;  2P9G A;  2PFD A;  5HJY A;  4CI0 B;  4JV2 A;  3T9N A;  2Y1R I;  3M8Q B;  4GC6 A;  3QRP A;  3H40 A;  2UXD F;  1KP6 A;  4A4J A;  3KTQ A;  2LVW A;  2GJ2 A;  1X9M A;  4WFN Q;  1DBD A;  2KJW A;  2XS2 A;  2M4M A;  4WII A;  2HAF A;  4J9P A;  1RT3 A;  1P9Y A;  3GCW P;  5J2N B;  5KFM A;  1W2B R;  4PZV A;  2B0G A;  1S6Q A;  3ZZO A;  3V81 A;  2JLG A;  1R8H A;  3DRP A;  1X4B A;  4KKO A;  4A8Q A;  3HHD A;  3GFX A;  4RL1 A;  1YJU A;  1T11 A;  1Q4R A;  5BYS A;  2QSW A;  1R27 B;  2O3D A;  5IWA J;  4FZV A;  2DD8 S;  1KKH A;  3LUY A;  3FQK A;  3GIR A;  3AQO A;  4F02 A;  3WZ0 A;  3I87 A;  2RF2 A;  4ZPW R;  4DV5 F;  1AB8 A;  4N7T A;  1SBR A;  4ES1 A;  3GJS B;  5D4L A;  5F0U A;  3GII A;  2COL A;  5KFW A;  2BE2 A;  2PI4 A;  4WZM A;  2HVE A;  4KT0 C;  4C9D A;  4P9S A;  3MMA B;  2VG6 B;  4WYL A;  4PWU A;  4HHU A;  1RWO B;  3C14 B;  3SSQ A;  2A1B A;  2CPI A;  2JJ4 D;  3TNV A;  1JLE A;  2EBG A;  1B4S A;  3SV3 A;  2VPZ B;  3KJV B;  1NAQ A;  1BQN A;  1W7W A;  4DR1 F;  3F56 A;  4ZVR B;  2XMU A;  3ZNU A;  4O4R A;  1Q5V A;  3UDV A;  4EU0 A;  1MWY A;  3QT5 A;  4D3H A;  2ZKT A;  2OKQ A;  1UVJ A;  4IOA Q;  4LFB J;  1RXO B;  4CLY A;  5KOW A;  1S9E B;  1FVS A;  2X7I A;  2RDD A;  4HAC B;  2MTL A;  4ZVO B;  2MLX A;  2FYX A;  3MM7 B;  2UVV A;  4DCP B;  2MKH A;  1RT6 A;  3MEE B;  4N47 A;  2XZD B;  3PW4 A;  2H54 B;  4IRK A;  3KHL A;  3H5X A;  1XNQ F;  3B6B A;  1Z2L A;  3GSD A;  3T1Y F;  3N0V A;  4RU9 A;  4CLZ A;  1SJR A;  4LRC A;  2PEB A;  3QSI A;  3CC2 S;  1EIY B;  3W9H A;  4I2Q A;  2JSX A;  1KQK A;  1FA0 A;  3HKZ D;  3IM8 A;  2RHQ B;  1NJZ A;  1TKX B;  4DV1 J;  2QYG A;  2CVI A;  4DX6 A;  3ICL A;  4OYI A;  2RUS A;  1HHS A;  2BAN A;  2WOM A;  5BYQ A;  4DV4 J;  1K1S A;  3I9V 9;  2BZ2 A;  3BEG B;  4CQ1 A;  2IM1 A;  4OHZ A;  3TVK A;  1VQS A;  4BC9 A;  3BYP A;  2RU9 A;  2F4F A;  4IG0 A;  4ANE A;  4WE1 B;  2N7Y A;  4QWC A;  5F8I A;  4DU8 A;  4DUY J;  1VQ6 S;  4WK1 A;  1OYD A;  2HZV A;  4N5S A;  1KC8 T;  3PX6 A;  3IA0 A;  1D8Z A;  3VAL A;  2V34 A;  4Y00 A;  3M2U A;  5J2Q B;  2MQ8 A;  1Q7Y T;  3TYT A;  1UWB B;  4AMM A;  3MPY A;  1R3N A;  3JQK A;  1M5K C;  3A8J A;  4PAB A;  2A6O A;  2HNZ B;  4X64 J;  1HW8 A;  3W2V B;  4G1Q A;  1OY8 A;  4OYB A;  1M1G A;  1JLC B;  1BWV A;  3K58 A;  3TUI C;  1QSL A;  2D41 A;  2RML A;  2GHV C;  1Y9O A;  4ID5 B;  1GT8 A;  1TL1 A;  3DXB A;  3GV5 B;  3IWL A;  4Q45 A;  3IR6 B;  2XCP A;  1C0T B;  1MN9 A;  3DLE A;  2UVW A;  4AMN A;  2KT5 A;  1GMW D;  2DGW A;  2YWE A;  3ET6 A;  5ITH A;  3SCI E;  5E41 A;  2DY9 A;  2V2Q A;  4E0D A;  1HWL A;  5BYR A;  3MPD A;  2ROG A;  3R5G A;  4M5I A;  4KIA A;  2HGL A;  4FF1 A;  3QYY A;  2W9B B;  4KFB A;  2H3E B;  2AEJ A;  3MFH A;  1M5V C;  1AT1 B;  2ZHO A;  4RR5 A;  3BDP A;  1NK7 A;  3SCJ E;  1RAB B;  4OFZ A;  3PZP A;  4DSI A;  2RS2 A;  3BR9 A;  2FZK B;  2E66 A;  3I0R B;  1YLX A;  1N5T A;  5A6W A;  4X66 J;  3OHA A;  2HQG A;  1FJE B;  4GMK A;  1IR1 A;  2BJE A;  5IT9 Y;  1FKP B;  2ZH1 A;  1FWP A;  4NCA A;  4OHW A;  1IXK A;  1ITP A;  4MAK A;  2FLP A;  3R9L A;  4FF4 A;  2LXU A;  4YB1 P;  5A8W A;  3MR6 A;  1LKZ A;  4E98 A;  2VZ9 A;  2NSC A;  2ZIT A;  5FJ4 A;  3SSS A;  3DLJ A;  5E3R A;  3EGN A;  4O44 A;  4M5N A;  1GH8 A;  4DL0 C;  5SZT A;  3KOA A;  2C2K B;  5KT3 A;  3KG4 A;  1VK8 A;  4B02 A;  3T19 A;  1IUJ A;  2GMJ A;  5JUM A;  2YKN B;  2ZM6 J;  4ZCI A;  3SDE A;  2VQF J;  1TV6 B;  3QRQ A;  3CO9 A;  1V5V A;  1YZ7 A;  3OFE A;  3A8E A;  2GIQ A;  2VUG A;  1DQA A;  1KLM B;  2EC0 A;  2DGS A;  3EUN A;  3L9Z A;  5KG1 A;  4LFA F;  3DXS X;  3HJV A;  3MEC A;  2NQP A;  4Y2K A;  5DDR C;  2E7W A;  4DV7 J;  4MFB B;  1JJ4 A;  3D9B A;  3FBC A;  1WF2 A;  5KFR A;  4L6V 3;  1VLO A;  2OTL S;  1IQZ A;  5HLF B;  2R7R A;  2DH7 A;  1ZAW A;  1S72 S;  2JNJ A;  4K5S A;  3ZZP A;  4H4O A;  3I6P A;  2J7U A;  3IXQ A;  5IT4 A;  3L4B C;  1X0F A;  2QO3 A;  2FY1 A;  4C8L A;  1EAY C;  3ZTQ A;  3UR0 A;  5CCM A;  5EWE A;  2DIS A;  3HX9 A;  2ZOM A;  2PO4 A;  4L72 B;  4A8F A;  2M5Y A;  2KFY A;  1BXN A;  4DQP A;  4WF9 Q;  2DNO A;  4X4Q A;  4AL6 A;  2AP6 A;  1OPI A;  3TJA A;  2PFF B;  4Y3C A;  1WC6 A;  3GWC A;  2FY8 A;  3PKY A;  3TP2 A;  1UWA A;  1S97 A;  2ZWP A;  4NEZ A;  3WX8 A;  4KV8 A;  2B4V A;  3S1T A;  3PEH A;  2R8H A;  5KG2 A;  3PTW A;  4WWS A;  1UEU A;  1T05 B;  2KYZ A;  2FLN A;  1Q95 G;  4KY3 A;  2HHS A;  1IJF B;  1RT7 B;  4C11 B;  4O3R A;  3EVM A;  4B9U A;  1RQ0 A;  3OVS A;  1HBM B;  4L73 A;  2CRL A;  4H4K C;  4OHY A;  2YWK A;  3CCS S;  2KYX A;  2C2N A;  3TQE A;  3KLH A;  1TL3 A;  3N4W A;  4WTO B;  4V19 X;  4ZPD A;  2X3D A;  3FQL A;  5CD4 H;  5CA5 A;  2CPH A;  3HF5 A;  3CW2 C;  1U0H B;  2BAC A;  4B9L A;  2H5E A;  2FC8 A;  5H9E K;  1QD1 A;  4ATN A;  1LWF B;  1P1T A;  3RGI A;  4DX5 A;  1VGY A;  2NPF A;  4P10 A;  1Q16 B;  3HSG A;  2Y3Y A;  4U6P A;  2B3T B;  4M5L A;  1HQU A;  3GR1 A;  2RDI A;  3GQC A;  3RZA A;  1FO1 A;  3ZFV A;  2IJN A;  3SQG B;  5J1E B;  5A8R B;  4IFV A;  4IFY B;  4ZIW A;  1C4C A;  4BCA A;  1IR0 A;  2HQC A;  4ETZ A;  3OSN A;  5CYM B;  3BS9 A;  1FKA F;  4OJ3 A;  1UVM A;  2YNG B;  3H42 A;  1TK8 A;  1KQF B;  4U7U D;  4M5M A;  3CCM S;  4HHH A;  3LP0 A;  3JQM A;  3M8Z A;  4FF3 A;  1CJV A;  2QFI A;  5KFS A;  3MOJ B;  3UWT A;  1F5C A;  5DG8 A;  4JI4 F;  1G3O A;  2XSF A;  3GIL A;  4NWB A;  4KAI A;  3W5Z A;  1SQE A;  4EWT A;  2B51 A;  4JI8 J;  5ETQ A;  3ZZT A;  1QAX A;  3MUV P;  2U2F A;  2ZVI A;  4PG8 A;  1XMO J;  2FHK A;  4Y34 A;  1C1C A;  1IM4 A;  2YNI A;  1CG2 A;  4ZLJ A;  2KZZ A;  1BUX A;  1UZD A;  4M5J A;  5C24 A;  3A3N B;  4DR3 J;  3GB0 A;  3BR8 A;  3C6T A;  1NSQ A;  3ZZU A;  2AJ2 A;  4LUB A;  3NWR A;  2PT0 A;  2F4V F;  3RBD A;  2I5J A;  1UW4 A;  3AT1 B;  4M5D A;  5I3U A;  5K14 A;  2RT3 A;  4W4M A;  1VYA A;  4X64 F;  5C2C A;  1RTJ B;  1J5O A;  4J5O A;  1JQG A;  3R2C J;  2QA1 A;  4K4W A;  2O67 A;  2G4B A;  4WK3 A;  3NS6 A;  2BE9 B;  3TA2 A;  5T7L B;  1FDA A;  4NZ0 A;  4DLE A;  1KRP A;  2GJI A;  4CH0 S;  5EWG A;  4ED0 A;  1IBM F;  4NLV A;  3W2W A;  2MY7 A;  5CXT A;  4KE5 A;  3CCQ S;  1R31 A;  2ZZT A;  2KN4 A;  4TKT A;  2VHG A;  2HHV A;  5LSO A;  2IC3 A;  3KLI B;  3KLF A;  4NCB A;  1FKO A;  1D8Y A;  2IMO A;  1UL3 A;  4K4X A;  1SVD A;  4C2M A;  2Y0S D;  1PBU A;  4YS2 A;  4XDC A;  4J9N A;  5B09 A;  2UVU A;  3OSP A;  4DSL A;  2E5J A;  4MIW A;  1SC1 B;  4DCJ B;  1UA0 A;  3FVY A;  1U1O A;  1U25 A;  4JI0 F;  2QZ8 A;  4CM2 A;  2ADB A;  4K4T A;  3L7U A;  1JLQ A;  4WXO A;  1LW0 B;  4JP8 A;  1TUV A;  1S4F A;  3MM8 A;  2LYV A;  4FYW B;  1WKK A;  2CQ1 A;  3UW1 A;  1D0E A;  5KFB A;  3TAR A;  3BO3 A;  1VIS A;  4DPX A;  2RQC A;  1FJG J;  2ZH8 A;  2ASY A;  4JI3 J;  3J81 U;  1W26 A;  3ISZ A;  3ELH A;  4U8V A;  3RAQ A;  4NRT A;  1DZ5 A;  1BLU A;  2XBP A;  3N6N A;  4OI2 A;  3I4P A;  4BWJ A;  2F9J A;  2ILZ A;  2CQH A;  3JTO A;  2P8I A;  4DX7 A;  4NLD A;  1PAU B;  1S1U B;  4HT5 A;  3ZXW A;  3SBM A;  1J27 A;  3MPV A;  2RIJ A;  2HGM A;  1AXQ A;  5CZC A;  4DPU A;  2Y1I A;  2MJU A;  1HFE L;  4KHR A;  4ED1 A;  1VBX A;  1NRK A;  3MAA A;  2GS8 A;  2V2K A;  3QFH A;  5ETV A;  4IR1 A;  2YNH B;  4EZ9 A;  3OQ2 A;  4CM0 A;  1SKR A;  1XNR F;  1CQM A;  3US5 A;  2XSJ A;  1KVI A;  3Q83 A;  2NXC A;  2P6T A;  2NR0 A;  4QJV A;  2CKW A;  2NXE A;  1FJ7 A;  3JSM A;  2B5J B;  3PCO B;  2PE8 A;  1S5Z A;  4OI4 A;  2DHH A;  1FVQ A;  3PYD A;  3MAH A;  3H25 A;  5CZX A;  1HPZ B;  1N5S A;  2AYM A;  1TK5 A;  2BKN A;  4P75 A;  3FRY A;  2BJD A;  5I3P A;  2OLW A;  3MR3 A;  3PJ9 A;  3V6J A;  1WSR A;  1LFW A;  1EP4 B;  4PRF A;  2C3Y A;  3P4U B;  1FX4 A;  3MPW A;  1F3F A;  3D66 A;  2PI5 A;  2OI2 A;  4UZB A;  1NXI A;  4PKD B;  5FLX Y;  4CLF A;  4DV2 J;  4MYU A;  1FRJ A;  4GC7 A;  1N32 F;  2G1H A;  1ZTT A;  2FVQ A;  3DGP A;  2Y0B B;  4IDK B;  2HLU A;  2G0J A;  1WC0 A;  1HMV A;  4FYV B;  1KTQ A;  4OYO A;  4CLP A;  2Q1L A;  1RTI A;  4LJM A;  1RU2 A;  4OZL A;  4LRB A;  3SMZ A;  3LW5 C;  1REV A;  4A8S A;  3HCX A;  1IBL J;  2DHS A;  2OEL A;  2K2P A;  1RT1 B;  1QE1 A;  3A1Y G;  3KLG B;  4EGL A;  4Q2M A;  1M1H A;  2R7V A;  2HFO A;  2XGQ A;  4IH7 A;  3EGW B;  3GSI A;  1RWK B;  2DNG A;  2HFV A;  3SIP B;  2RUG A;  2LDI A;  3UN2 A;  1X4F A;  3EM1 A;  1MRO B;  4I2P A;  2F5G A;  1WC5 A;  3CDE A;  3VQT A;  1E6V B;  1FWL A;  3U1L A;  5KG0 A;  5L9X A;  1YTY A;  3V6D B;  1TL7 A;  5B7W A;  3WHI A;  3FBF A;  1JLF A;  2YX7 A;  3UVJ A;  5RUB A;  1LWC B;  3CCL S;  2DY1 A;  5L8R C;  2UU9 F;  2G0C A;  2YKQ A;  1VC6 A;  1IR2 A;  2XWX A;  3UD4 P;  3EMT A;  4CLL A;  1RHU B;  3KJN B;  4Q5V A;  4WJB A;  3MED A;  5H9E J;  3E8O A;  2PII A;  1T94 A;  3TEH B;  3ISN C;  1LOU A;  4B17 A;  3B54 A;  2F3J A;  2LQJ A;  1WDD A;  1X9W A;  2DT9 A;  3LA0 A;  1MLA A;  2GAG C;  2WAQ D;  4MTP A;  3CD5 A;  2CPJ A;  3A3O B;  3MD3 A;  1S1T A;  3EDR B;  2B8Q A;  2IBO A;  4CNY A;  3G8T A;  3DMJ A;  3BN4 A;  2V4Q A;  1VMB A;  3M6W A;  1HNV B;  3HHL B;  4ZLL A;  4IQX A;  4B3T J;  4X4U A;  2CJX B;  2W2M P;  5AE3 A;  1DQ8 A;  4RPF A;  5EX3 A;  2OEM A;  1HI0 P;  5KTQ A;  2MQM A;  4YFU A;  4FXD A;  2XMT A;  1X4A A;  1M5O C;  2Z30 B;  5IS2 A;  1QSY A;  3J7A 1;  2DNM A;  2B6A A;  2NXJ A;  3TZW A;  2YX4 A;  2X1G A;  2G0I A;  4M8L A;  5E5N A;  5ETL A;  1QAI A;  1GEH A;  3TR5 A;  2QEX S;  4JI7 J;  5E33 A;  3H20 A;  3TI0 A;  3FRZ A;  3O5T B;  4RW6 A;  2VA3 A;  3DN9 A;  2WZ1 A;  1RAH B;  3ZNJ 1;  2BYC A;  1I94 J;  1FWK A;  3T5J A;  2L08 A;  4OZ0 A;  4UY8 5;  1PYT A;  4ITS A;  2J5A A;  1RA7 A;  3IWN C;  3IO1 A;  3D68 A;  1BHN A;  2C3U A;  3F73 A;  4ED5 A;  1YK9 A;  3KG1 A;  1VR6 A;  3NMR A;  2HFZ A;  1SL2 A;  5JJB A;  4LVO P;  3P49 B;  3FSX A;  1S49 A;  3TAM B;  3PHE A;  2GHW A;  2JEG A;  1NDP A;  2HHH J;  2CIM A;  1MW7 A;  2R2U A;  2DEI A;  5D4O A;  4AT1 B;  2X51 A;  1S6P A;  2AHO B;  2YQ1 A;  4ANC A;  3QPI A;  1NJX A;  2OSR A;  2KI2 A;  3CIZ A;  4FVC A;  4PG6 A;  5AXK A;  2CPZ A;  4TXS A;  1QY7 A;  4U9R A;  4EYH B;  4U96 A;  2HNY A;  1HNW J;  3N01 A;  4KQZ A;  2Z57 B;  4LSN A;  1DTQ A;  3FFI B;  4NXN F;  1MWQ A;  4A47 A;  3HSZ A;  4PXD A;  4F36 A;  3HFZ B;  3CWJ A;  3P3D A;  1MU2 A;  5GAG U;  3VAK A;  4KPY A;  5HQ8 A;  2DIU A;  1RA6 A;  3PX4 A;  3LWM A;  2A0F B;  4X62 J;  2M70 A;  4DBQ A;  1ZM2 A;  2V8V A;  2CJK A;  5J1P A;  2RDJ A;  2BMB A;  2VPW B;  4C97 A;  3N28 A;  2AEF A;  3KYL A;  2OPS B;  1U2R A;  2HBZ B;  3N5B A;  2WSE C;  3KJQ B;  2CQI A;  2OFH X;  2B9E A;  2DJW A;  4CLK A;  3TEG A;  2J6S A;  3CED A;  5L46 A;  3L3C A;  4DFP A;  2C3O A;  3IRX B;  3TZX A;  3K57 A;  3S8S A;  1Q8L A;  4OJH A;  4O3P A;  1GQE A;  4S0M A;  3BGR A;  2L9W A;  2NPI A;  2RRA A;  2AW0 A;  1RBL A;  2K06 A;  3M9N B;  1DFD A;  4LFC J;  2VIH A;  3OVB A;  1YJ7 A;  2N4C A;  3C15 B;  3FSY A;  4CT8 A;  1T95 A;  2VBY A;  4P6Q A;  1S1V A;  3UNY A;  2EI5 A;  1MSW D;  3W63 A;  2DPI A;  2V0N A;  3OFH A;  1NDL A;  4PXB A;  4QIG A;  1VQL S;  1YBT A;  4I67 A;  4J91 A;  5J2M B;  4AFF A;  5GAE I;  1TMJ A;  3DI6 B;  5DDO C;  4ZVQ B;  1PO6 A;  2RU3 A;  3MWB A;  2V5H G;  4HL9 A;  2MKI A;  2ABY A;  2BEF A;  4F0K A;  1FJC A;  5FD1 A;  2QRR A;  1T02 A;  1I3O B;  4CCH A;  2Y8Y A;  4AD6 A;  1YJN S;  2CJY B;  3NS7 B;  3BH7 B;  1FNM A;  3ILJ A;  4B3M J;  3QSY B;  4QIV A;  1VRU B;  2DNQ A;  1KR4 A;  5HQL A;  4QWB A;  2H51 B;  4D3G A;  4FS1 A;  2BBE A;  3D7S B;  2YXL A;  2E1A A;  1YWX A;  4KGV B;  1BY9 A;  1N6Q A;  3BPD A;  4O0N A;  3H2U B;  3FCV A;  3DOK B;  3D6T B;  3CJ4 A;  3R3T A;  2MGZ A;  3VVU A;  1YZ6 A;  2CPF A;  2ZD1 A;  4PWW A;  2A6M A;  2GVZ A;  5F9L A;  4G1I A;  5A0Y A;  4EBE A;  3NEK A;  1H0H B;  2VJV A;  2R8I A;  2KDO A;  4YR0 A;  1GTH A;  5D8H B;  1RBO B;  3PV8 A;  4V19 J;  2UP1 A;  2WVC A;  2P5V A;  3LQV A;  3K7R A;  3ETM A;  2CXE A;  3UD5 A;  4M95 A;  2I8E A;  1RAI B;  4E8U A;  3ZZZ A;  5DQG A;  3VAH A;  1U1K A;  2H9Z A;  4BLG A;  3F41 A;  2X3G A;  2E5H A;  3AJ1 A;  3CTR A;  2C2Z B;  2YVS A;  5D4N A;  3NWG A;  2J8S A;  4HTI A;  3QRR A;  2ZDO A;  3GP9 A;  5F3Z A;  2E1P A;  1F2H A;  4UOC A;  2QLB B;  1HBN A;  4ED4 A;  4ZP6 A;  2KU7 A;  1B70 B;  4H54 A;  1UPP A;  3D3B J;  2JX2 A;  2WTF A;  5ETK A;  1YBU A;  3TJ9 A;  4WP9 A;  1D3W A;  1TVR A;  5A8K B;  1RBA A;  2VU5 A;  2HWT A;  2QTW A;  4FN5 A;  3J81 Y;  4CT9 A;  3QNW B;  2DO4 A;  3VGV A;  1JLB B;  2MZJ A;  2GA7 A;  2JH3 A;  2ZNY A;  3FMW A;  2RSQ A;  3RUB L;  2OAU A;  4HR2 A;  2ZUA A;  1CQN A;  4B3T F;  2OPP B;  2BOP A;  1N34 F;  5J2N A;  4YDX A;  1OQ3 A;  1ZS6 A;  1ZOT A;  2M9K A;  4AE5 A;  4RNN A;  2IIH A;  4C8Y A;  1NH7 A;  4I7F B;  4RO0 A;  1YIJ S;  4EI2 A;  4J9K A;  3I55 S;  2NZC A;  4L75 A;  4OYW A;  4CO5 A;  3WC2 A;  3DOM A;  4FYY B;  3PFE A;  3PAC A;  4WFA Q;  4ZPC A;  3QO9 A;  1KTV A;  3I9Z A;  4NI2 A;  3WDO A;  1XIQ A;  3TX8 A;  2HFN A;  1ZZN A;  5HMX A;  2QIF A;  1CVJ A;  8ATC B;  1RTD B;  4RW8 A;  1U1Q A;  4MKB A;  3R5C A;  5LL6 d;  4A8X A;  2JC0 A; 
#chains in the Genus database with same CATH homology
 5DZ7 A;  3G87 A;  3HMJ G;  3H0P A;  2JFD A;  3TZW A;  2HG4 A;  3BV8 A;  3IM8 A;  2PFF B;  2CUY A;  3QAT A;  2QJ3 A;  5DZ6 A;  3PTW A;  2VKZ G;  3TZY A;  3SBM A;  3EZO A;  4QBU A;  3HJV A;  2C2N A;  3IM9 A;  2G2O A;  2VZ8 A;  3TQE A;  3CJ8 A;  3HHD A;  4RL1 A;  3RGI A;  2JFK A;  1NM2 A;  2G2Y A;  2H1Y A;  4RR5 A;  3R8Y A;  5CZC A;  1MLA A;  2G1H A;  3TZZ A;  5CZD A;  2VZ9 A;  2QO3 A;  2UV8 G;  3K89 A;  3R97 A;  3TZX A;  2QC3 A;  2G2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...