3K89A

Structure of x. oryzae pv. oryzae kacc10331, xoo0880(fabd) complexed with glycerol
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
314
structure length
314
Chain Sequence
MTESTLAFVFPGQGSQSLGMLAELSELHPQIRETFAEASEGAGVDLWALSQGGPEEMLNRTEYTQPALLAAGVAVWRLWTAQRGQRPALLAGHSLGEYTALVAAGVLSLHDGAHLVRLRGQFMQAAAPAGVGAMAAVLGAEDAVVLEVCAEAAGSQVVVPANFNSPGQIVIGGDAAAVDRALALLAERGVRKAVKLAVSVPSHTPLMRDAANQLGEAMAGLSWHAPQIPVVQNVDARVHDGSAAIRQALVEQLYLPVQWTGCVQALASQGITRIAECGPGKVLSGLIKRIDKSLDARPLATPADYAGALDAWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of X. oryzae pv. oryzae KACC10331, Xoo0880(fabD) complexed with glycerol
rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Transferase
molecule keywords Malonyl CoA-ACP transacylase
total genus 108
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3k89A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3k89A01
2G1HA 3TZZA 1NM2A 2QO3A 3TQEA 3HHDA 5DZ7A 2G2ZA 4RR5A 3R97A 2VZ8A 3CJ8A 2H1YA 3HMJG 3QATA 2G2YA 3R8YA 3K89A 3SBMA 3IM8A 2UV8G 2CUYA 2G2OA 4QBUA 2QC3A 3RGIA 3H0PA 2HG4A 1MLAA 3IM9A 3PTWA 2JFDA 2VZ9A 5CZCA 3BV8A 3TZYA 2QJ3A 2JFKA 2PFFB 3EZOA 5CZDA 3G87A 4RL1A 3HJVA 3TZWA 2C2NA 5DZ6A 2VKZG 3TZXA
chains in the Genus database with same CATH superfamily
4ID5B 1B64A 2AZ3A 1ZM2A 3WDOA 1K8AT 4FN5A 4CQ1A 2JLEA 3GJSB 4ECUA 2K1RB 4LF6J 3IS9A 3CWJA 1WOOA 3S1TA 1JX4A 4DN9A 2XSJB 3DOKB 5GADU 2V50A 1WOSA 4XDCA 3BH7B 4A8MP 3EM1A 5C24A 1X8DA 4DF4A 1VLOA 2XY6A 5DM6Q 1N54B 2RKIB 4FYXB 5I42B 3OHAA 3OHBA 4ED4A 1KVJA 2ERRA 2KH9A 2MEWA 5EWEA 2H5IB 4CO1A 1MU2A 3N5FA 1X5TA 2HFOA 4USHA 2Z56B 4QR0A 1CSJA 2QA4S 2CWKA 2FGCA 2HGNA 2VA3A 4IRCA 4F4KA 1A7GE 2PMZD 4MH8A 2RU9A 4AD6A 3JSYA 4CP5A 3FZ2A 2DHGA 3I9V9 1NXIA 3CD7A 4OZLA 4KGZB 1RT2A 3LANA 1IM4A 4NASA 3LOUA 4RU2A 1D8ZA 4ZPCA 4P74A 1RAOA 1T05A 2I9SA 4YB1P 2JEGA 1SC6A 3RB0A 4M95A 2W2QP 4JUZA 1UVNA 4URQU 5D0HA 2MLYA 2HVHA 4JP8A 4LBIA 4A8OA 3V6DA 2VUGA 5AXKA 5G0RA 1KWMA 2HKEA 3DRPB 4CT9A 3IR6B 3OTEA 2ADCA 2M0GB 2DEIA 1HBOA 1OPZA 2P5VA 1WNEA 5J2PB 3D6FB 3CVKA 4NRUA 2LVWA 2KG0A 3Q22A 5GAGU 5DGAA 1MMDA 1ZBTA 3CCMS 4KT0C 3QT8A 4FKXA 1CPZA 1NEEA 1QSSA 4LF1A 4ED7A 2DY9A 4Z2XA 2BE2A 5KG5A 3UD4P 4JI7J 2XLKA 3L7UA 1PG5B 4F04B 5EDWA 3FUYA 5CAAA 1DLOA 2GHVC 3B4MA 3DRYA 2R8HA 2B3TB 1PC5A 2AP6A 1I6JA 3S8SA 3MTKA 4F3QA 4H4KC 1S72S 1RTIA 2D9OA 2WSCC 2JVOA 2QEXS 2E1RA 2MKJA 4ZHRA 4FVMA 4AXIA 4ZVPB 3FBBA 2VFTA 4K2JA 4F4ZA 4Q43A 4DV6J 4C8OA 4AMMA 1PO6A 3RTVA 2IJNA 3BS9A 3MEGA 1S79A 2IRUA 3QMQA 3OXLA 4KO0A 2QL9B 1G4CA 3OTOJ 4ECWA 3QIDA 4EI2A 1J5OB 3LGHA 2Q79A 4RW4A 2WVFA 1UA0A 3FFIA 1R8CA 4ZJOA 3PIOQ 1PIEA 1S4FA 1C0TA 1WTFA 1S5ZA 4TKTA 3CMAS 3C46A 2OH2A 1I5OB 3MTJA 1HW9A 4CH7A 2BABA 4P72A 1P1TA 3IM8A 3VZHA 1GMWD 3J81U 4F2SA 1SB6A 4RW6B 5ETKA 1HQUB 4EBDA 5JMNA 3BBFA 5LMNJ 2MJUA 3KLIB 4A48A 3EX7B 1F2GA 3TAMA 2DGUA 2COLA 2WVBA 3VV2B 2CNNB 2BOAA 3CSKA 4DSKA 2MKSA 2FB0A 3QJLA 3CF5Q 1KTVA 4B08A 3OXFA 1FKPB 2YKNB 1SQEA 3D68A 4FVCA 4O44B 2P9CA 1KVKA 3ITHA 2FHJA 1WELA 2G9OA 4ED8A 3M30A 4QZVB 3RAMA 1AT1B 2XYHB 3VZIA 1FJ7A 4IG0A 2O67A 4KV8B 1IXKA 1EKRA 3OW2R 2AU0A 1S97A 4OV1A 3DRRB 5F8LA 1KHWA 3MM8A 2GMLA 4F50A 2CAJA 1QD1A 3C19A 2KKHA 4KJIA 2ZDOA 4YP3A 1SH0A 3SQGA 1NDKA 3F0NA 5IT4A 2C2EA 4ED0A 1NNDA 2D3OR 4WFXA 2V4JA 2B9YA 2ZOGA 3W2VB 1XNRJ 2B4VA 5DJBA 4DX5A 4DV0F 4O3OA 1AZSB 4A46A 4UOGA 1QAXA 2CDRB 2EBEA 5KFUA 4ZIVA 2L41A 3IAM9 3NS6A 3CD6S 3CO9A 4WYLA 4P75A 2OPSA 5A8RA 1JXVA 1U6FA 3T1YJ 2BKPA 2RU3A 4TQRA 5A76A 4O3SA 2XEXA 3LP0A 3TUIC 2AYEA 1TR0A 3R7BB 7AT1B 2HNZA 3G82B 2PIIA 2MKYA 4M63A 4YDXA 4NCBA 3HHEA 3TEGA 2N3LA 3UVJB 3NNCA 4HHHA 3CE8A 3EYZA 2BBEA 3W5YA 1F5BA 3HD2A 2Q6BA 5DDOC 5L1IA 1R3NA 2YWGA 5ETTA 3HJFA 5KOXA 1ELOA 1O6XA 1IBMJ 4LREA 3HVWA 5C25B 1YHQS 3C3LA 2GIFA 4KGXB 4L72B 2VQEJ 2HMIB 4XK8C 1S1UB 3DMJA 3PY8A 2NR0A 2VONA 2BEFA 2C3YA 4XPEA 3DDKA 1XNQJ 4WZMA 4FYVB 1Q8BA 3B6BA 3CIZA 2WVCA 1YTYA 3V4MA 4JOUA 5I4MA 1VQ9S 4DFKA 1EB0A 3HSDA 2ZC4A 3IO1A 3A3PB 1LQ9A 2CQHA 2DIVA 3CB4A 3G6ES 3I0SA 3MOJB 4JI3J 3CCLS 5G4DA 2QRRA 3L7PA 4PWWA 2C42A 3MOZA 3W8GA 4CNZA 3MR5A 4RUAA 5D4OA 1M0SA 4NYPA 1SVDA 4HEA9 2V34A 3IN5A 2C28A 3BB5A 3JTPA 3AA8A 2WSFC 4DCPB 1NPPA 1PAUB 2CPHA 4DX8H 4NLYA 5LL6d 3RGIA 1EAYC 3VVUA 3NBPA 5AXNA 1NHKL 2FIUA 1Y10A 5CXTA 1BQMA 1YRXA 4F4AA 3CJSA 2MXYA 3KLGA 3AXMA 4P7TA 5EX0A 3JXOA 1SL1A 2UVUA 3EGNA 3VWSA 2R8KA 5H9FK 2DH7A 3NGKA 4WIQA 4DG1B 1UAWA 5IXUA 3PV8A 5HBMB 1SPBP 4UZCA 2M52A 3MHYA 2VKZG 2ZH7A 2V2VA 2WZ1A 1S1XB 2UXBJ 1RUSA 4BBYA 2A18A 4LFBJ 5FLXY 3GJQB 4CT8A 1R27B 1VBXA 2OHDA 4DV1F 5F8MA 1Q86T 4S0MA 2WAQD 2PC6A 1H73A 1BQNB 3IRXA 2MZTA 1MWYA 2YPZA 1VIXA 1IR1A 2V9KA 3GSIA 4JI8F 3OFFA 3RYLA 5ETPA 4IFVB 4EEYA 5HMYA 4A47A 2J0SD 1A0OB 3CCQS 1RHUB 4OI3A 4KYZA 3LPYA 5GADI 1LOUA 4RPFA 2OEMA 1U1OA 5JJBA 1EQMA 2Z8QA 1UMJA 2XI2A 3FBFA 2JWNA 1V3RA 3M6WA 3T9ZA 3BEGB 3O5TB 2HYIB 1UVJA 4B3OA 1UETA 4GKJF 4MKYA 3QJPA 1WG4A 5D0GA 4X4NA 1RLCL 4GO7X 2Y9HA 2K2PA 4DUZJ 1D9AA 4ZN1A 1XR5A 5I3UB 4CO2A 3QPIA 4LUBA 3TZZA 2DNPA 4U96A 1SXLA 2DH8A 3M4XA 1RT5A 1RYRA 4FF1A 5M2PA 3M1VB 1FRMA 4CO4A 1HL6A 2KRBA 1X9SA 2J6TA 4K0KJ 2G2YA 3OLAA 1RTZA 3CJRA 3NY0A 1DTTA 3KDNA 4U6PA 4A8FA 2X3DA 2FUG9 1C1BA 1KLMA 3RBZA 1U48A 5HROA 4NLXA 4F25A 1D8YA 3DNCA 1ZS6A 2MKIA 3VALA 3GWCA 3SMZA 3LWMA 2J9DA 3NGTA 5KFDA 2PGCA 3D66A 5IT9Y 2IC3A 2KVQE 3UCZP 3MPWA 3SEOA 2IM1A 4XPCA 1I51B 4HDGA 4NLTA 4NOHA 3C16A 4X2BA 3HT0A 1HNIA 3UI3A 4KKOA 1KQFB 4WFNQ 3T1HF 3NOCA 3KKFA 4WP9A 3MM7A 2DHSA 3MCSA 3KJQB 1GXLA 2IA0A 2JNJA 2QLFB 4TQSA 2IY5B 1APSA 3CJ8A 2VZ8A 1HHSA 1RA7A 9ATCB 4C6AA 3L95X 3IMQJ 1YI2S 3L09A 5IOLA 3J81Y 2AYMA 1XMQF 2DRAA 2BQRA 3S6EA 4ELVA 2RB7A 2HNYA 2R7SA 2DHHA 3PHEA 1T9TA 3N28A 2BJ9A 2DGXA 2Z58B 2AX1A 1FEEA 3KK3A 1GTEA 1VK8A 1JQGA 1WC1A 3IA0A 3M7VA 5LJ5Y 4RNNA 2RT3A 1D9FA 3KMSA 2B6AB 3B78A 1I94F 4ZVRB 2R7OA 4ZITA 3FEYB 2EC0A 2MPUA 3VAIA 1NZ8A 1VS3A 4ELUA 3B8HA 1WSRA 1C2PA 2LP4A 3LQVA 3PW5A 4E2FB 3HDSA 1GH8A 4M5NA 1NBEB 2DO0A 2CYYA 5CQGA 4ETXA 3BQ0A 1RWMB 2ZE2B 3P49B 4DSJA 5CCLA 4DR5J 3E51A 3T19A 3K57A 3OTOF 1JJ4A 3QO9B 2UXDJ 3H90A 2V63A 1JMTA 2QMWA 4HR2A 3U1NA 4LF4J 1VQNS 2XB2D 4HTJA 2OD6A 4KE5A 3QRQA 1EP4A 1FXDA 1TKZB 1VHIA 2V69A 2BW7A 1VQPS 1UJ4A 3OL7A 2FVRA 2KXFA 1TVRA 4DUZF 2E29A 3IR5B 1CG2A 1WC3A 4JI1J 4WP8A 2LA4A 5B0EA 5DQIA 4NA3A 3PG9A 3MMAB 2XMAA 1DBDA 2Z4PA 1YBUA 5ETLA 1NZAA 3T5LA 1C0UB 4L3KA 4OZ1A 5CD4A 1NK7A 1HBUB 5HVHA 1D9DA 1S49A 3NL0A 3CGIA 3T9NA 2CQ0A 3J7A1 1G6BA 1MMNA 4J37A 3ENWA 2HPUA 4NI2B 4WKRA 2BR0A 3AD7C 2FHOB 4HH0A 4QR1A 1O51A 5HP1A 4WIIA 1EETA 4G1IA 4DPUA 4DSIA 1XTZA 1RHKB 5K20B 1NSPA 2WB4A 2NPIA 4LVNP 4IOCQ 4B3RF 3IRWP 1GXTA 3DGPB 2BYCA 2FPHX 1TAQA 5HMZA 4GC6A 1B4SA 4Q45A 3TUJC 1JWWA 3CC2S 4KHPJ 5DETA 4NL5A 2OMLA 1C1CB 1NDLA 1RSCA 1FRKA 3N6NA 1LFPA 2DGWA 4ZN3A 1S0VA 3MFHA 5MLCV 1VBZA 2A6MA 2RIJA 2XS5A 2JHEA 4TY8B 3UN3A 4JI2J 1X4BA 5F3TA 1JLBA 2QMXA 4LF8F 2W7AA 2HIQA 4OX7A 2DNQA 5HSPA 2ZDPA 1E6YB 1VOMA 4CLTA 5C42A 2DNMA 3KWMA 4W4MA 3J7YI 3RZAA 2Y1JA 4K4ZA 1JLQB 1RBAA 1K44A 4V1Ak 4PZVA 3W5XA 5HO4A 4CZCA 2RQ4A 2R9LA 3PR5B 1NK6A 2VA2A 2CPYA 5KT6A 2MQPA 3DGVA 4DV4J 2UUCJ 3CC7S 2XY7A 3VCDA 1IJFB 3CCVS 4Y3CA 2HWHA 4K7QA 3TR5A 5KTQA 1Y5IB 5IQQA 4Y6IA 3KHHA 4OX6A 4H54A 4PPDA 4NCGB 4ECRA 2P9EA 1UWAA 1Y3KA 1JLCA 3QYYA 3Q2TC 1XNRF 5L9XA 1HHQA 2UV8A 2CQ1A 4H4OB 1NO8A 4QIEA 5EWFA 3QAEA 3KLHB 1FXRA 4DX7A 4F67A 4NPOA 2E5JA 2OELA 3G2XA 4RLEA 2JLGA 3K58A 3RR8A 1KLNA 3QWPA 3R7NB 3TP2A 3RU0A 1Q0NA 2FYXA 2XMTA 5SZTA 4DV0J 1KQGB 2DITA 4MK7A 3OUYB 3VHQA 2XTJP 5LXRA 5KFEA 3M2RA 5KFIA 2WBMA 4Y28C 4OL8A 2ZWOA 1IQTA 5KAKA 3GB0A 2HBZB 2RS8A 3HHLA 3WBZA 3NNHA 2KTQA 1VDHA 2MSTA 3BGRB 4O0IA 1M5HA 2ILZA 3I31A 3MR6A 1FJEB 4Q2LA 4RNHA 2AEJA 1JKHB 4C3LA 4DR2F 1VQ5S 1RHQB 4I69A 4ZVEA 1N4LA 4NXMJ 2HHHJ 1RWPB 2RILA 4UOFA 2RQKA 1B70B 2OSQA 4NLPA 4IOAQ 3S7RA 1ZA2B 1FESA 3ILOA 3AOCA 3K7RA 5A8WB 3ISND 2B5JB 4I56A 5E41A 3HVRA 1RP5A 2OEKA 4R8UA 3QQCD 1SV5B 1OSDA 2DXDA 2FTRA 2KFYA 2LXFA 1XMQJ 2I2YA 2AIRB 3DOMB 2XGPA 1RTJA 1NMEB 2P2CB 2W2PP 3THTA 3TARA 3GV7B 1MROA 4M5LA 4WXOA 1S57A 1LW2A 1AA1B 1QJHA 1KS2A 4OYZA 1VBKA 2NPFA 4BC9A 1IKYB 4X65J 4V19J 2BJEA 4A8SA 4X4RA 5KFFA 3C2PA 1P6TA 4WXWA 3P5TL 4FBTA 2HHVA 9RUBA 1X9WA 2HIYA 1NJWA 2RHSB 3FRYA 3CJ5A 3IG1B 4NLUA 1H2TZ 1NDPA 3HVTB 3C6UB 3FCHA 5THWA 4BLGA 3UN2A 4DL4A 1U0SA 4RX6A 1S9GA 3G96A 2X1BA 1SC3B 3GPAA 5SUHA 4RUCA 2DNKA 1K47A 4Y2IA 4ZVGA 3C66A 2XYGB 1S1WB 3Q2SC 1UVMA 2UXCJ 1FNXH 3CMES 5FJ4A 3NNAA 1RTHA 3H8YA 3HX9A 5KG7A 3R1HA 1T3OA 1RT1A 1LK7A 3FMWA 4QYZK 3DXSX 4G1QB 3ZC4A 5B0GA 1L3TA 4USKA 1QDUB 4F4XA 3T3FA 2IHR1 3HVAA 4Y2AA 3OBIA 4EUVA 3MCMA 4J9KA 1NJYA 3KJNB 3I56S 4ILMA 2KJVA 4IFYA 2HBQB 5A8KA 3PX6A 2W2OP 4NXNJ 2CNOB 1WI8A 5IV3A 5ITHA 1TL1B 1H38A 3C6TB 3PIPQ 2WCXA 4ZKAA 2XI3A 1HNZF 2ZH4A 3JQMA 5B0DA 2HVDA 2BRKA 1N0VC 2HQFA 5JVHQ 2V4RA 2MQ8A 3I5CA 4KGKA 4DV4F 4ENOA 1FD2A 4OLOA 4RR5A 2XWXA 4EBCA 3IS9B 3GP9A 1RWKB 2F8HA 2XSJA 2OKQA 3DOKA 4UOCA 1WUUA 3OTCA 2YKAA 4U7CA 3ELHA 3PCOB 5HK4A 3I5BA 4NLVA 1ZM3A 2C3PA 3M8PB 1ZYQA 4X4UA 4HYKA 2RKIA 5I42A 3KTQA 4J91A 4B3RJ 4JI0F 3TJ8A 4KB7A 3D0IE 2KHDA 4A8XA 2J6UA 4HT7A 2RQMA 1MU2B 4KGVB 1FVQA 2ZUGA 4JI2F 3CDEA 2UVRA 3JB9k 4DFJA 3R5AA 3CJ4A 1TL4A 4ZVQB 2GMJA 3E01B 2B4OA 3KJFB 1IBKJ 5KFKA 3H4BA 3GV8B 4URSA 2HFNA 3TAQA 1YJUA 2C2KB 2GV1A 3MPUB 2AW0A 3QGIA 4GRSA 2R2RA 4AMOA 1HBNA 5C5JA 3FGVA 1RT2B 3IGVA 3TEHB 4C2MA 2MQOA 4YFUA 4TYBA 3TOQA 1NJZA 1T05B 2NYIA 5B09A 2C2OB 2B56A 3TRGA 3ICLA 4CH1A 2WTFA 1QAYA 2GQ2A 1UEUA 2CVIA 1RZMA 1IBLJ 1FJGJ 3BBBA 4F36A 2KZZA 2ZKUA 3BR8A 4EYIB 2QX0A 2WHOA 3DC2A 1QE1B 1N34J 4E0DA 3OL9A 2R7TA 1Q8KA 2H65B 3AB2B 3BV8A 1HBOB 3GMGA 3RAXA 3UDLA 2HZVA 1FKOA 4NYOA 2J76E 4Z7CA 5I3QA 1VCTA 1T11A 3VAJA 3QZ7A 2ATLA 5AE2A 2IPOB 1U2RA 3K2YA 2I5JB 2UUBF 4OJGA 2DXEA 2E7XA 3QBCA 4USJC 1HQEA 2ZBCA 4ECSA 3AFGA 3BZQA 4OQJA 4ZDNA 3U27A 2WONA 1FWPA 4OYWA 1HD0A 2VODA 2HLUA 1LKZA 1RACB 2EFQA 1DLOB 1VK3A 1RBOB 1RLDA 4IH6A 2P6TA 5K5MA 5KFOA 4N7TA 1NB7A 2F63A 1D09B 4IDKB 3VGUA 1FCAA 4OI4A 1U26A 1BY9A 2MSSA 4B02A 2CVEA 3ILLA 3IWNC 2NXUA 3DRSA 2HK2A 3IC1A 5HATA 4PR6A 4ECTA 1T9VA 2HVZA 4ZHRB 5T41A 2J6SA 5BXIA 2EG1A 1TELA 4CO0A 2BJ7A 1YLXA 4DV7J 3HPOA 3VAHA 2KO1A 3JSRA 4DR7F 5B0BA 2VG6B 3VQSA 1RT3B 4CLUA 3MEGB 5E0OA 3HM9A 2UVVA 1N5YB 4FNIA 4KO0B 1H3DA 2YNFB 3D3BJ 3GSDA 1IR0A 4RW4B 2LMIA 3QT7A 3UWTA 4FS1A 4Y00A 1PILA 1F9EB 2EC2A 3GCWP 3GG0A 4Y2KA 1CEZA 1C0TB 2NSBA 1RAEB 4EO6A 1X0FA 4UY8T 4DPOA 4LF9J 4I67A 4K5RA 3MUTP 2YH0A 2FZGB 1I1GA 2Q3PA 1GNKA 4TVAB 4AFFA 3SZ2A 1Q8IA 2CXEA 1Y7PA 1ZAVA 2R4FA 4QJVA 4Y0FA 2BA9A 1HQUA 1B7FA 2UU9J 2R8GA 3KLIA 2CG4A 1H0HB 1TP7A 1LK5A 3H0PA 2FHJD 2XBPA 3KG1A 4R5PA 1SJFA 1FRHA 4GC7A 1UJ5A 2M9KA 1FDBA 1FKPA 2YKNA 4O3NA 5HJYA 3SDEA 4O44A 5ETQA 5IWAF 4IO9Q 2BJ1A 2KFZA 2MHNA 4LFAF 1MMLA 3M30B 2OTLS 1VQLS 1WHWA 2ZHBA 3QJJA 5T7LA 3BN7A 4Q44A 4DMZA 2DT9A 3W3SA 3H40A 2RJZA 3DRRA 2KYZA 4RNMA 2RRNA 3FNNA 2C3OA 4CLKA 1ZA1B 3AT1B 1URNA 3SQGB 4YQWA 4NEYA 5E3AA 1VC5A 1F3VA 2V6AA 1UEVA 5CZXA 5J2NB 4JV5J 3JQKA 2N7CA 4L75A 3M9OB 1RK8A 2B9WA 2CPJA 2Y0BB 3TAPA 2V4JB 3W2VA 4K4VA 1H2VZ 2VC0A 1AZSA 3IR7B 1ZAWA 1IWGA 4GO5X 3PX0A 3CDUA 3M2VA 3MAAA 4F0HA 2ZH9A 1Z2ZA 3K8WA 4B9SA 1YZ6A 1ZPVA 1ROFA 2ROGA 1YWXA 3VVTA 3C15A 2DBBA 1EQ0A 5IC4B 2MYFA 1JLGA 1P9QC 3PO5A 4B9MA 2CNLB 1NH8A 2WW4A 3LP0B 3NKYA 1CJVA 1SUQA 1M1HA 2HNZB 3G82A 4C8MA 3HO1A 4QIVA 3CT9A 4ZLPA 2YVSA 3SYZA 3FRZA 3M32B 2XMKA 1VJQA 1F2HA 4TU9A 2C22A 4CYUB 1VISA 2W7PA 2KG1A 4OMFG 3W7BA 3G6YA 1FX2A 4RW9B 5IV4A 1ZETA 3TA2A 3RW7A 5ETOA 3AOBA 4QPXA 3SIPB 2E5LF 2HQIA 4PYDA 3MEDA 4F4WA 3PM9A 3DLJA 3BSAA 3J81j 3W65A 4WWSA 1IR2A 4FPRA 1S1UA 3DMJB 3R5DA 3RRHA 2C3MA 2ZVSA 5JXSA 3WC0A 4CTAB 1NK9A 4C11B 1Q78A 2G1DA 1VQYA 3Q8QB 1SCJB 1AUDA 2D1CA 5CABA 4LIRA 4DR6F 4ZPWR 4PABA 2KN4A 3FBCA 3M8ZA 3UDVA 2QL7B 4ZCIA 2QIFA 2APOA 3EVWA 2UUWA 3LP1A 3I0SB 2ZWPA 1YZ7A 1XMOJ 3CNQP 1FTCA 3Q0AA 4OV6A 1Z2LA 1HD1A 3MUMP 4AT1B 1YBAA 2IMOA 3W66A 3PKYA 1GQEA 5F8GA 2FVPA 3FCVA 4NX9A 5BJRA 1TUVA 3G8SA 3NAIA 2VJUA 1ZPWX 4MAKA 1PJ5A 4BDPA 2JEIA 4EGLA 3CEDA 3J7AN 2OLWA 1TKTB 2H48B 4JV2A 2UUAF 4J9OA 4MKAA 4NXMF 2XNQA 4L6V3 4EZ9A 1CVJA 2DNYA 1SJ4P 3FQLA 2VV5A 2R7XA 3LO3A 4Q8FA 3DHWC 4K4XA 2VFVA 2P9GA 3CO0P 5CCMA 3EVMA 1NU4A 4OI6A 1F9FA 4QWEA 1XERA 3VGSA 2E5HA 2RD5C 4KTQA 1CJTB 3HFKA 2EXUA 2QLBB 3RG6A 3FC9A 2XCPA 2CQDA 2HURA 2VPYB 4L3NA 2CJAA 1BWEA 4X64F 2V4QA 1D3WA 4RBUA 1SKSA 3R8YA 2JVRA 2L9DA 3K89A 5D0RA 5BR8F 2XZWA 2MQQA 2MLXA 4DSLA 5D3GA 3IRXB 1LXJA 1S7HA 4AUKA 4J9LA 3T1YF 1N88A 4ECQA 1PBUA 2SXLA 2HGMA 2R42A 3BREA 3QLHB 1UWBB 4NA1A 3JSBA 2Y1IA 3MPYA 1HWIA 5KFWA 2QYGA 2EI5A 4C0BA 3EPIA 2E1AA 2HQDA 5C2CA 1RISA 3NG8A 2E44A 3AB4B 4ANEA 2MGZA 1T9XA 5ETMA 3UW1A 1HMVA 2D7SA 3M8YA 2W4PA 3MPDA 2F9JA 4YR2A 3MD3A 4B3OB 2WB1D 2ZOMA 2YNGB 1TK5A 1WEZA 2F5GA 3UQSA 2V8PA 2ZKTA 3TX0A 2DXFA 4AYBD 5I3UA 2J0QD 4Y34A 1FDDA 1X31C 2HWIA 2GAGC 5GAGI 3HT3A 1SI9A 5HI7A 4DS5A 1BGXT 2FJAB 3M1VA 2E5GA 1SIWB 5DDPC 3MR2A 1QSLA 3Q8UA 1MWQA 1RWNB 5FDLA 4JV1A 1U7LA 1U47A 2ZD1A 4X64J 3HHLD 2FLNA 2JEFA 4KH1B 3UCUP 4ZOSA 1C1BB 1KLMB 5HROB 2HG4A 3QAUA 5EUHA 1MLAA 2MB0B 4D3GA 5H1SV 4C3KA 3D1OA 2GIRA 2LXIA 4NLSA 1WACA 4X4VA 1HARA 2XO7A 2VICA 2IC3B 4RL1A 4Z7YA 4DL2A 2PMHA 4OYPA 3V6HA 4ZVHA 2R7QA 3J7Z5 4IRDA 4LF2A 1F3FA 1VRTB 2A2CA 2YX4A 4G6VB 5GAEI 5CHCB 4WKYA 3MR3A 2OPQB 4DUYF 4KKOB 3NGRA 3PJ9A 4ECXA 3NMAA 3MM7B 1RAFB 4PXBA 4ZCLA 3TVZA 1IBCB 4ED6A 2HRTA 3B82A 3A3OB 3BKUA 5E3CA 1N34F 1KONA 4LF8J 1DAXA 4M5JA 1H6KX 2GCFA 1UFWA 4KY3A 3R5CA 2QTWA 4BC7A 3NMRA 3DU6A 4USTA 5AXLA 1WOPA 2K7JA 4J9RA 3MI7X 2UXBF 3W9IA 2AYGA 2XC9A 2QC3A 5K14A 3CJ3A 2HNYB 3M6XA 5U47A 2EFPA 4UW2A 2FHMA 2IM0A 1G3OA 2Y1LB 2YBVA 3A12A 3UO0A 5K8MA 5J2QA 2WVEA 1SBRA 1U1PA 3DLBA 4ANDA 2XO6A 2IM2A 3RBXA 4CCHA 3D3CJ 2X1FA 2GZOA 1FRJA 1WWHA 2W25A 3D0GE 2C2NA 2RUGA 3JS9A 2DK2A 3W2WA 2NQPA 1WC4A 3R2CJ 1U0HA 1NPRA 1TQLA 2DR6A 5E7OB 1VQMS 5KG2A 2OFGX 1W2IA 4MKBA 4W98A 4LIWA 3RW6A 4C97A 5B7WA 1HWKA 3SV4A 2Y1RI 2ALZA 2N7YA 2V2ZA 3QSIA 4AQYJ 4WE1B 3BH6B 4AMNA 2ZE2A 1RAAB 4ZLNA 4NMLA 3ZZTA 5GAHU 4HACA 1DURA 4UZBA 4FYDA 1M5KC 1B7YB 2DB1A 4LR9A 4F3OA 1RQ0A 2JSXA 2ZNZA 3EVOA 3A4TA 4QOTA 2A10A 1AROP 2J7WA 1JB0C 4UQTA 3WIUA 1TVRB 5CA5A 6FDRA 2HHQA 2VG7A 5J2MB 2MHEA 3MD1A 4WK3A 4E8UA 1X4EA 3MMAA 4WYWA 3TA1A 1M5SA 4CNYA 1ZAXA 2DGSA 4ZVFA 1HBUA 2KDOA 3M6UA 1RCOB 1NKEA 4CH0S 3BDPA 4ZJLA 4O3RA 1SL0A 5DRKA 1V3SA 2Z2LA 4NI2A 2R8JA 1TKXB 4FPIA 4N8NA 4QR2A 2K3KA 3KJVB 3W63A 1X7VA 4LRCA 4XDDA 1F9HA 1IKVB 1NSAA 2DGVA 2NXNA 3DRXA 1KTQA 2CPFA 3AY0A 3NGSA 2JL9A 3ZZPA 1G2EA 2CPZA 2M70A 4ZMMA 1C4CA 1R0CB 1UW4A 1VI7A 2QT7A 4KHMA 4ZCMA 3Q24A 2VHGA 1VQ7S 2VZ9A 1XK8A 1R6YA 3ENQA 3THPA 1C1CA 4ECYA 5CZDA 1HI1A 1Q5YA 5F8HA 3HCXA 2VH7A 3GE9A 3Q8PB 3BKTA 4WU3A 4P2MA 5M2UA 2ZH3A 1YJVA 4TY8A 1LWXA 1NCLA 1VMBA 1VC6A 3D28A 2X3GA 5CYMB 3D5MA 1M90T 2EFNA 3G71S 4LFBF 1E6YA 2RH3A 3M8WA 5C42B 2A0FB 1SC1B 3KNGA 2U2FA 2Z0GA 2PFDA 4C48A 4ZK7M 4MIWA 2ZITA 3DI6A 1ZM4A 2EW9A 1RT6A 3V4IA 1HNWF 3SCJE 3KHLA 3BPDA 4YY3J 3VAMA 2ROPA 4LBHA 2ZVIA 4C0OC 4PAAA 1ICEB 3FVYA 4TLRA 5HVFA 1WTBA 2KZMA 4RNFA 3TZYA 4CIOA 4NYZA 1RB0A 3MR7A 4ID8A 4NCGA 1JLCB 2IFXA 2YWEA 4NE9C 4DR5F 3KK2B 3EDQB 3EZ5A 2UXDF 2O3DA 2FGOA 2O01C 5DG9A 1BC6A 2NSCA 2MZQA 3NP5A 2RQCA 1QVFR 3KLHA 4ETZA 5J1PA 1TKDA 2BJ8A 4TNOA 2CJQA 3JYTB 1S7IA 2QA4G 2DR8A 1RAJA 2AT1B 2QN6B 1LWEB 1PC4A 2I38A 2KM8B 1FNMA 3PDNA 5DQGA 2I6WA 1R8AA 4KFBA 4WFBQ 3V6KA 2FY8A 1HYSB 1EHWA 4OYXA 3VAFA 3HZEA 2G0IA 1F1BB 3M2RB 3WX8A 3CDWA 4URGA 3DM2B 2YKPA 3EXYA 2RDIA 2DPJA 2D74B 2BDPA 2AGPA 3E3XA 3H98A 4L74A 2JZ5A 2MMYA 3TA0A 3BO2A 1BLUA 1HR0J 3KG0A 4ZPTR 2JLFA 3CCRS 1VJWA 1RTDA 3MPVA 1DZ5A 4PWDB 4YR3A 1FFWB 2FLPA 2ABYA 3CCSS 4DV3J 2Q43A 5KG4A 4DR4J 1QVGR 5HLFA 5A8WA 4LSNB 4UT4A 1NM2A 4R8UB 3TQEA 1QUPA 1VRQC 1DHMA 3DOMA 1X4GA 3AH6A 2K7KA 3SCIE 2DR7A 2F4VJ 2CPIA 5L38A 4PG6A 2N4DA 3DYAA 2YNHB 2HAFA 1LW2B 1NB2A 3ENVA 4JV5F 1IKYA 2ZH1A 1XMOF 3TX8A 2JC1A 2MLZA 3EE3A 3ZZOA 3I9ZA 3GYNA 5IZHA 5DM7Q 2CZVC 1KD1T 3MAHA 3NOGA 3ISNC 3ETMA 5E5NA 3MEEB 4RBVA 4CLWA 3I96A 2HHSA 1YRUA 3A1YG 3IBWA 3BSCA 4F26A 3HP6A 3IG1A 3FKBA 1UZDA 3WZ0A 1LXNA 3I5AA 5A6PA 1GXUA 5CZVA 1KBRA 1OS5A 2A2DA 2DJWA 2HSEB 4I6YA 4CLFA 1RKJA 4DR3F 4P71A 1S9GB 1M5PC 1X5SA 2XQCA 2MZSA 3GYGA 2CQ2A 2V8DA 1S1WA 1RTHB 3POTA 3QGHA 3ZZUA 3N9UC 2YXLA 3L4BC 4DPTA 4F4YA 2UVWA 1O8BA 5M2RA 3OD2A 4EYHB 4G1QA 2VD3A 4N77A 3I32A 2O66A 5L46A 1NHUA 1RT4B 2WVDA 3KHGA 1ZZFA 4J9NA 4DR6J 4F0KA 3KLFB 2R3VA 1SJ1A 1L3SA 5JVGQ 4FS2A 4QU7A 3CJQA 5A8KB 4K2XA 3FJ2A 3H59A 4KR0B 4X4SA 2HZCA 1RADB 1N5VA 3L7OA 4QIGA 1E6VA 5K8PA 2PEBA 2ZH5A 3BQ1A 2BOPA 1IM6A 2GIQA 3BGOP 4DFMA 2DGTA 2GX8A 3MMJA 1VBYA 4ZLJA 3TZXA 3G6VA 4OI1A 5IFMA 2B51A 2QFJA 5DS7A 3HSJA 5KOWA 4ILRA 2LECA 4YB7A 4ZP6A 3OJSA 1UA1A 2BVZA 3N6MA 1S6PB 3KUEA 5DZ7A 3LPEA 4HKQA 4MKVA 2AD9A 2QFIA 2E66A 1CQMA 1N52B 3IAS9 3BYPA 4C7QA 4DLGA 1HNVA 2GGPA 4LSLA 3I87A 1V5IB 2NUHA 2AKWB 2DISA 5JUMA 4PRFA 3SQOP 2Q66A 3M8PA 1WC6A 1S99A 1B0PA 2HS4A 2NXEA 3QRPA 2QSWA 6AT1B 2M2BA 2RF2A 2YKMA 1HHTP 2NCKL 4ZS6A 1WF2A 4ED5A 3HLUA 1Q16B 2FJEB 1TAUA 3PO4A 4LRFA 1B0TA 2EBGA 1J5EF 4I6AA 5K8OA 2I8EA 3BKFA 3E01A 4WP3A 4AE5A 4FYYB 3ZTSA 3NGDA 2CQPA 3PYDA 1VC0A 3V81A 5A0YA 3P45B 1WC0A 3GJRB 2FHKA 3NCRA 4IH5A 2G1HA 1HBNB 5A6WA 2UU9F 3EDRB 3UPFA 2W9AA 3R9LA 2C2RA 2QA2A 4X66F 2V8GA 2DNHA 1PGZA 5J1NA 4HLBA 3FMBA 2BM0A 3BDEA 2BM1A 2CFXA 1NKBA 2XWYA 4B3TF 3RRKA 4TYAA 1T7PA 2ALYB 2DGOA 3HSGA 3WQPA 1QE1A 3D0HE 2GO8A 2H3EB 2YX1A 1EJ7L 1XR6A 2MKCA 1FKOB 3R27A 3K17A 5LMUF 2BV3A 2W4DA 3T1HJ 4IQXA 3JTNA 2JJ4D 4YR0A 3GV5B 2POKA 1L3KA 2I5JA 2ZUAA 3HZGA 3IP0A 1IKWA 3N6LA 1HQEB 1YJ9S 2XZDB 4IH7A 3HKWA 4WCEQ 1U6BA 1T94A 4CM2A 2WONB 4Q8EA 4OZ5A 5F8NA 4FF3A 2DNLA 4USMA 3SFGA 1QAJA 2MKHA 1FFSB 2D3UA 2V2KA 4IDKA 5CYQA 3X1LB 3AA9A 1DQ8A 1HQ2A 1KQKA 3F73A 4RUHA 3DRSB 5C7PA 1HNXF 3ET6B 4YOEA 1O5JA 3LH2S 1URRA 4A4JA 1DQAA 1R8PA 1VGYA 5F0WA 3H5UA 4OJHA 2QJ3A 2F3JA 4YEAA 2KXNB 3X3UA 1NK5A 1REVB 4MT1A 1KNZA 2VG6A 3S01A 1RT3A 2IDEA 4OJ1A 1Q7LB 4YY3F 1N5YA 2VG5B 3PW7A 1U1QA 2YNFA 3DLGA 1WC5A 1T9WA 1NUEA 3MM6B 3ZO7A 1MG7A 3TQ1A 2BKNA 2K3IA 2HHUA 1RHJB 3NLCA 1BD6A 4K50A 4PG8A 3PJXA 3R97A 4DOZA 1F5CA 1GAOA 3AQOA 1FK9B 1HWJA 3AAWB 4I2PA 1H74A 3QATA 4PWUA 1U1NA 3JSMA 1H72C 1TU0B 1IJEB 2YKOA 2CJBA 4P9SA 4DDFA 3L3CA 5F9NA 3RBEA 2AGQA 4P7VA 4EZ6A 2EEYA 1HBMB 2EKNA 3PEHA 1JJ2R 3J7YU 3QSYB 1EKSA 3W9HA 4CLSA 4A8WA 1H7XA 4ZVSB 3SXLA 4R5PB 5F9LA 2FDNA 1FRLA 3EZUA 4PG5A 1JIHA 3H20A 4OYOA 2AJ1A 4WFAQ 3SDEB 4C8LA 2R7UA 3D7SB 1HKAA 3RJMB 1SQFA 1UZHA 2RAQA 3HF5A 1RWVB 4DCOB 3LAKA 3FBEA 3H2VE 5T7LB 1SKUB 4Z37A 1DTQA 2HFZA 2L48A 2LLZA 2OEJA 3UFCX 1NH7A 2LEPA 1PAEX 3LAMA 3MMCA 1FA0A 1JXEA 1U25A 2LA6A 2GMHA 2QE5A 1R0BG 3BSOA 4QWAA 4DQSA 4LF4F 3CDBA 3UD5A 1KOHA 1BE4A 1Q95G 3U02A 2JDJA 3TVKA 3L9ZA 4EO8A 2PO4A 3SBMA 4KPYA 5J2NA 2L9NA 3W61A 1H2UX 2CPXA 4TU7A 4WK1A 2DHAA 2I1RA 3O1LA 4OLPA 1BXNA 4YN3B 2X1AA 1VQ6S 4IYQA 3ULHA 2GW8A 2FLOA 3ZXWA 4V19X 1CC8A 2JFDA 4MK9A 3M2VB 3MAAB 4WFYA 3CDAA 2HQCA 3BO3A 4U7UK 1DQ9A 3EZOA 1VQSA 3H25A 3G87A 3C15B 1NK8A 1CS4B 5CH7B 4W92B 1JLGB 1TUWA 4QCLA 3RBDA 3OVAA 2VPZB 3OVSA 5HAOA 2EK1A 1CJVB 1SUQB 5L8RC 2R8IA 2FZKB 3NEKA 3QNWB 1L3UA 1JLAA 5LSRA 3D6TB 2JH3A 2F9DA 3M32A 4UQGA 4CYUA 2IYGA 1FVSA 2HWTA 3M8SA 1UVKA 2B7CB 3P3DA 1MN9A 4RW9A 2NUUG 4PUOA 4DHVA 2WSEC 2DNGA 1RA6A 2DNRA 2GO9A 2LCWA 2LXUA 2Z2ZA 3MEDB 4PYAA 5F8IA 1N8RT 4IR1A 3GIRA 1S48A 2DCUB 4I0WA 2UXCF 3LA0A 2CRLA 1PCAA 2MQNA 2C2ZB 1LNQA 3A8KA 3GONA 3R5JB 4NLQA 5GAHI 3K5LA 3K5MA 4LSZB 2OIHA 2XHCA 4CTAA 1GMUA 1XBWA 1OPIA 3CCWA 4C11A 4A8QA 2BRLA 1S9EB 2V0NA 1RBLA 1I3OB 3HJVA 4RWWA 4X4OA 4YHHF 4DPXA 3GIMA 2XHWA 4USVA 3VAGA 3RR7A 3GU0A 4UTGA 5ADZA 2ZHOA 4EWTA 4RW7A 4H4MA 1ITPA 3NGUA 3LP1B 5AXMA 4DV2F 1X5PA 3KK1B 1FKAF 3T5KA 3MCOA 3RB3A 1N33J 3HHDA 3T41A 4LR7A 2OD4A 3R6GB 2DY1A 2XNRA 1OMSA 1OJ4A 4LRBA 4OZ3A 4DR4F 1I94J 1U02A 4NZ6A 1EARA 1N6QB 2XS7A 2QV6A 2VFUA 2LU2A 5LMUJ 1AFIA 4HDHA 4J9UE 1TKTA 4C8KA 2KVIA 4QIWD 3N4WA 1V3ZA 4O3PA 2IJRA 2NYHA 1NPKA 2RDDA 3O3LA 1UKUA 1FNOA 2MDAA 3A8IA 3SSSA 5L39A 1RYSA 1XWLA 2IVFB 1SQGA 2PD1A 2VFSA 2QGFB 2AYBA 2W1BA 2Y8WA 4ED1A 2MQMA 1FDAA 1CJTA 2GS8A 2IM3A 3FEZA 4P2SA 2DNOA 3CIMA 5DQHA 4USUA 4H4KA 2FD2A 1H7WA 4JI6J 3DN9A 1KC8T 2G4BA 5K8NA 1QUVA 4J7CA 4OHYA 4X84A 1L5UA 2CQBA 1FE0A 4M5KA 2B4PA 4RBTA 2WBRA 5L1LA 3UR0A 5D3GB 1GX6A 4NWBA 3FCWA 4UUWA 5F41A 5DLGA 2I0XA 1S9FA 2CUYA 4KAIA 4DXLA 2DR9A 2GVDB 2FC8A 1P27B 4K4SA 3JAMY 3LTOA 2W9CB 2QYCA 3QFWA 3BGUA 3QLHA 1UWBA 3BM7A 3IM9A 4R0JA 5B0AA 3SCKE 2U1AA 1R31A 2VJVA 3KUGA 2V67A 2JRSA 2M4MA 4LBPA 5B0CA 3SI8A 3DLHA 5HQ8A 2ATCB 2EFVA 2LU1A 1RABB 2MGZB 3MECB 1RT7B 1HMVB 2G0JA 4OFZA 1RWXB 5LOQA 4C0HA 2ZHAA 1VYAA 2YNGA 5C2GA 3GFZA 2LQJA 5D4PA 2XGQA 1XIQA 3UDCA 1RDRA 1F5AA 3KDOA 2M7SA 1TL3B 3P6YC 2O1PA 1FRXA 1X4FA 4UF4A 1IKXB 4ECVA 3DLEB 1QTMA 2BZ2A 1KFSA 2H4WB 1KRPA 2DKOB 3W9JA 2UUBJ 2GAHC 4OYBA 3GFXA 5FDLB 2DVIA 2ZD1B 3NAHA 1Y4ZB 2OPRB 1VRUA 2BMBA 5KFVA 4IQMA 4MTPA 2CIMA 3R2DJ 1JK9B 5KT2A 1UEKA 3CJTA 4M5DA 5B0FA 5H9EK 2F8MA 4I68A 1R7IA 4DPYA 3D9BA 4HH1A 2F1FA 2MZJA 4I6WA 4PKDB 4A8YA 5KFJA 2YNIB 2KT5A 3CC4S 1VRTA 2FQQB 5I3PA 5IM0A 3V6JA 4LF7J 4KHPF 1MNEA 3W5ZA 2OPQA 1U4BA 1K9MT 2HNDA 3D2WA 2OTJS 2MZ1A 4I7FB 2ZJPQ 1JJCB 2GC8A 4PEOA 2VOOA 2AF6A 4ICLA 4PQUA 4RU9A 2ZBIA 1IBKF 1U6ZA 2QMUB 2AQ4A 1D0EA 2Z2YB 2ASYA 3DFEA 2OO4A 1REGX 3O44A 4ZPBA 2A6OA 1SL2A 1YX2A 4QYRA 3MMBB 3A8JA 3WHIA 4FBUA 1WDDA 4DX6A 3GLJA 3T6JA 4WU2A 1BMQB 5K14B 3UNGC 2WW8A 4U8VA 3PTWA 1WHVA 5D4NA 3GILA 1WKJA 2PI4A 2K8GA 2IIHA 1PYSB 5J2QB 4IKAA 3B4DA 1CULB 3KXDA 2N4CA 2BE7D 3TNVA 2FJDB 2GJ2A 3NWRA 4HHUA 2UUTA 4K59A 4NRTA 1A6LA 5K9FA 3LGMA 1VQOS 4LF6F 2A1BA 3F44A 3W2WB 2BANA 2VDIA 2AEMA 3K59A 1U1RA 1U0HB 1U2FA 1NLKL 2CWXA 2XYPB 3KMQA 3MF5A 1U1KA 1HNXJ 1Q81T 3KLVA 1FFGB 3KLEA 2DEJA 1V5VA 2BQUA 4DR3J 5IS2A 3KFWX 3QZ8A 1J27A 4IOBA 3Q83A 3HMJG 4ZP8A 3D4JA 4DV3F 2ASDA 4WE1A 4YB5A 1FO1A 3JAMU 3BYRA 3I4PA 3OFHA 4NLOA 5KT5A 4XIUA 4HACB 1WHXA 3NS7B 1S12A 3CULA 3DDNA 1SH2A 3DOLA 4ZVTB 4ALZA 1X4DA 1XQIA 2EPIA 1HLWA 1YJ7A 1N5TA 2JFKA 4O23A 5FLXU 3PRDA 2ZJQQ 2FVSA 4J5OA 3C14B 3LP2B 1XJWB 2OI2A 2EWHA 2Z2MA 2VG7B 4MFBA 5HJXA 2XLJA 4JBCA 5J2MA 3PW0A 3ZZRA 2PE8A 4YS2A 5D6GA 3A3NB 1Q82T 2OPPA 4JV0A 1XEZA 2RS2A 3RB6A 4F02A 4L76A 2YQ1A 5HL7Q 2C2MB 2VFRA 1TMMA 3KOAA 5D8HB 1YSJA 2ROEA 3ZZZA 1S6QA 4RW8B 5H9FJ 2DRDA 1TKXA 4OZNA 1QSYA 4C9DA 3T6BA 4XO0A 1W26A 3OXGA 1UW9A 4P2FA 3KJVA 1LWFA 1S1TA 1OY6A 1TV6A 3A8EA 5ETNA 1IKVA 5KFAA 4DZ6A 4ZVOB 5D0EA 4P6QA 4Y2CA 5IWAJ 2UP1A 4U9RA 3N01A 1X5OA 2WOMA 1VQ4S 1F0XA 2BX6A 3M8QA 1DJ0A 4IG3A 1D1UA 2E7WA 3OL8A 1OWXA 3HHKA 3W1YC 4WBFA 4ZP7A 3NRBA 4PXCA 1P8GA 1X4HA 3OQ2A 4OHZA 4KH0B 1GX5A 2W8LA 2ZZNA 1S4EA 3WC2A 2CPEA 4RZRA 2AEFA 1RI7A 2NXJA 3D1HA 5CYMA 3ZNJ1 2DH9A 2FC9A 1MWZA 1HI8A 3MM9B 3QFHA 4MIAA 2RRAA 2VC1A 2Y3YA 3OFGA 3BPSP 5ETSA 4DEZA 4YHHJ 1LV5A 1Y0HA 1Q1KA 2IAJB 5H9EJ 3K0JA 1KHVA 3DI6B 4DV6F 1ACMB 1S6OA 1RT6B 1VLYA 3GFYA 3V4IB 1HI0P 1CJUA 4YUDA 4UY85 4OYIA 4OX9F 1TFWA 4K8RA 5DG7A 5IQ6A 2XCAA 2DCLA 3PYFA 1YQHA 3T5HA 4BWJA 1KN6A 1ULRA 2AMCB 4MJKA 4TN2A 1LW0B 1ZZNA 2HQGA 4AQYF 2BQ3A 1FX4A 1JLEB 1PYTA 5KG3A 4IR9A 5IC6B 3CCZA 1RU1A 3KK2A 4QIFA 2Y8YA 4HVZA 2IA6A 1IVZA 2AZ1A 3MM5A 2EVZA 4N47A 4MYTA 4QW9A 2B7BB 2UUAJ 4F8RA 4HHJA 1O0PA 3HHNB 3JYTA 2G0CA 2W2MP 4C3MA 1TZ0A 3DLKA 4LQ3A 2CZ9A 1LWEA 1YK9A 2YWHA 3GIIA 4JI5J 1KR4A 4N41A 2BW2A 4KFBB 1W7WA 3D54A 1HW8A 3IWLA 5KFZA 3PW2A 1HYSA 2M8HA 4DZDA 2R7WA 2XY5A 3U7JA 4JI7F 5AE3A 4KRWA 4MMOA 4NEZA 1T9YA 2JEJA 1UCNA 1XR7A 3DM2A 2Q1LA 3C8YA 2QL5B 3CTRA 2W4CA 4QW8A 3G6XA 4DV5F 3D6MB 2M88A 4JI5F 3OTDA 1KOOA 3VGTA 1RCXB 1WEXA 4WPAA 5ETVA 1RE1B 3RUBL 3OR2B 4YMEA 1SJRA 2MQLA 5KFPA 1OYDA 1RTDB 3GQCA 5D77A 5HANA 4PWDA 2ILYA 1PBAA 3N5BA 3I6PA 4USWA 1G7CB 2DRBA 4LF5J 2FJWA 2V9WA 1GFWB 4DFPA 1N0UA 1FERA 1VHFA 1UVIA 5HLFB 4F2RA 1SH3A 4CRJA 4LSNA 4B9UA 2M8DB 3OV7A 4ELTA 2E5LJ 4FF4A 3G86A 1SKRA 3HKZD 1FDNA 2KFNA 1K1QA 2ADBA 2NS1B 4I2QA 1EZZB 5GVQA 3W62A 3DYAB 2YNHA 1K73T 1FTRA 1LWCB 3PACA 3E8OA 3MGJA 1XC9A 3QIPA 1M1KT 3PFEA 4JI3F 3H5SA 1BQXA 4LRDA 3TWZA 4NMXA 2F8EX 1QM9A 1JNZB 3CJKB 3G8TA 1UFLA 2LKZA 2RNEA 3LGNA 3CMQA 1S1VB 3MEEA 1Z1ZA 3ZNUA 4ED3A 3CD0A 1RGVA 3I0RA 4DV5J 3UD3P 4NCAA 1OIAA 2LQ5A 2W9BA 2HFSA 1NSQA 5HQMA 2HZAA 3Q8VA 1QY7A 3CCJS 2BUNA 3GR1A 3OR1A 1AXQA 3M8RA 4AL6A 2GHWA 1JLFB 2JX2A 4Q0BA 4OHXA 4J9MA 1CJKA 2FZCB 3MEKA 3P4UB 5J1EA 1IBMF 1Q8LA 4CO5A 4KHRA 3RRGA 2VASA 2DYAA 3PVXA 1RJJA 2YX7A 3AQPA 4OI0A 3LW5C 2IBKA 1ZM9A 3D1QA 2HS0A 1HPZB 3POTB 4GVBA 2LQ8A 3I82A 3P8BB 4BHQA 1YDLA 3M2UB 4RNOA 2FJVA 2GVZB 4CWBA 1XNQF 4QYZJ 2W01A 4PPZA 1T03B 4Q5VA 1X4CA 4Q7AA 1RT4A 4FDFA 3V2UC 2F4VF 1FXLA 3KLFA 3DKDA 4AXJA 4LF9F 4BWMA 3QWUA 1UPMB 5E3RA 2JC0A 3UE2A 2FVQA 3U1LA 1K0TA 3P96A 1YRTA 4O4GB 3TANA 3IXQA 2ZOFA 4Y65A 2ZM6J 5DDRC 1YJWS 1NJIT 2VPXB 3UNYA 1E6VB 1S59A 3VGVA 1QAIA 4B3MF 1R0AB 4LFCF 1FHTA 1C4AA 1TL7A 1B3TA 8ATCB 2DO4A 4QWCA 1VQ8S 1AUSL 4X66J 2IRXA 1LEOA 7FDRA 4ID5A 1HNWJ 5FD1A 2ASLA 1Q79A 4OX9J 5KG1A 1S6PA 2OUGA 2HEKA 2IRYA 2HFVA 2H51B 2K1RA 2HHPA 3QGPA 5D78A 4EU0A 1SIZA 4U95A 4B3TJ 3DLLQ 4I64A 4F0MA 1TTHB 2LEAA 4HTIA 1HNVB 2GGPB 2HRYA 3ENAA 3EXCX 4LSLB 5KG6A 5C24B 2LQBA 2QA1A 1ZTTA 1Y9OA 2ZFHA 2GA7A 4J9QA 4ES3A 1VIOA 1DRZA 4DL7A 3ADAC 2RF2B 2YKMB 1RKIA 2OGUA 3FEXB 5MAOA 2HHTA 2MY7A 1YBTA 2XM3A 2J7KA 3MFIA 1P9YA 2W7OA 1AYEA 4ER8A 4IUFA 2PFFB 4I1TA 2LQ9A 4NLWA 3R1LA 2ZJRQ 4DF8A 2DNNA 3ZFVA 3V5RA 1CBKA 1R6VA 4M1KA 2CZ4A 3CW2C 2XLIA 2VQFF 4G1PA 1FT8A 2D9PA 4KSEB 1WD6A 4ZP9A 5A0YB 5LSOA 1OQ3A 5BR8J 1RWOB 4JYAF 1IUJA 1U49A 3Q8SB 3NWGA 3CUNA 4JI8J 5DGBA 4B3MJ 1QLNA 3D6HB 4QPTA 3P5BP 2KU7A 4P10A 1CC7A 4TU8A 4J9SA 1V9OA 3AJ2A 4K4TA 4ES2A 4X62J 1RHRB 2YQ3A 1T9UA 2ZZMA 3ZTQA 1CQNA 4DR2J 3PZPA 2YWKA 3V6DB 3W64A 2CADA 4NLGA 5F8JA 2EK6A 2PT0A 3M6VA 3DRPA 5G0RB 3VQTA 3HSZA 3O8WA 1WJ9A 4LR8A 4WFZA 4BS2A 4ZIWA 3BJYA 1S0NA 1FF2A 2GJIA 4DCJB 3PR4A 5J2PA 4AL5A 2J9EA 4DSFA 3IFEA 1IKWB 4USIA 1W2BR 3Q8YA 1T95A 1FE4A 2NXCA 3BO4A 2BJDA 4OX8A 1J5EJ 4IRKA 2BE2B 2DPIA 2YTCA 3G8QA 1KFDA 3K5OA 4KBIA 4B3SJ 1P1LA 4U8YA 5CYQB 3QGGA 2OSRA 5CD4H 1RTIB 4ZA1A 3BQ2A 4C4WA 4OZ2A 3FQKA 4JI1F 2PI5A 2H4YB 2O5DA 3ET6A 5IT0A 4DV1J 1TL5A 3PJWA 4EK2A 2YH1A 2Y0SD 2GHPA 5A2QY 4LF5F 1OQ6A 2XMVA 2CJYB 2AJ0A 3M05A 3OL6A 1REVA 2OFHX 2RMLA 8RUCA 1GEHA 4ES1A 4N76A 2F65A 2YQ0A 2VG5A 2DNZA 3CCTA 3DLGB 3EGWB 1U24A 7FD1A 2VIHA 2CQCA 2HQ3A 3MM6A 1J5OA 4JI0J 1U8SA 3FFIB 4CO3A 1OSCA 2KI2A 5KFQA 1U1LA 2QO3A 3OSNA 1NAQA 2VBWA 3EICA 1FK9A 4I2PB 1B99A 2GQCA 1UVLA 2J9CA 2L08A 3JSMB 1W25A 3GFHA 4WJBA 1Y00A 1N32J 3FSXA 1M5VC 3CCUS 1PSDA 4RW6A 1X60A 4X4TA 1HBMA 3TW0A 1WKKA 2EKYA 2K06A 2YKQA 2ZNYA 4J9VA 3TAMB 5KT4A 2VPWB 1T8EA 2PEHA 3OPKA 2MTLA 4DL3A 2CJKA 2YY3A 3UN5A 4I4BA 2KHCA 3GCXP 5GMKa 3MUVP 3ITHB 3ETOA 3NXZA 1YG0A 4ECZA 5DLFA 3H7HB 4JB8B 2N82B 5AJ3J 2J8SA 4IG0B 4KV8A 3SSRA 2E1CA 5ETRA 2P6SA 1DTQB 2V94A 2DTJA 1WEYA 2QG9B 3PYGA 4FKYA 5BYSA 2AGOA 1HR0F 3MMCB 3MM8B 1RHMB 2VDHA 4G65A 1NJXA 3SV3A 3D67A 4AMPA 3HI9A 2WK4A 3K5PA 4W90B 5E2QA 2NZCA 3HFVA 2UV8G 3ZTRA 3O2IA 3GIKA 4DR1F 2RRBA 2ZZTA 3I55S 3FK4A 2GQQA 3H2UB 1WKLA 4K5SA 4M5IA 1SKWA 2OJ3A 4P2XA 5KFHA 2IYIA 1TMJA 2PDAA 2UZAA 3N0VA 4DUTA 2IJFA 4B3SF 4LFCJ 1G1XA 1WG1A 2W8KA 3AHPA 3EUNA 2EG2A 2CPDA 2AJFE 3NCQA 2OPSB 2W24A 1RWUA 4NLDA 4NZ0A 5A8RB 3OT9A 3PRBA 2DGQA 5T14A 4EBEA 2C2DA 1KEKA 1CS4A 2FY1A 2ZC3A 4ZLLA 2ACYA 3PYEA 4CLYA 1T0TV 3EGZA 1WHYA 3GJTB 4U7UD 5EGYA 1JLAB 5GAEU 2NREA 5GMDA 4DR7J 4FXVA 4O0NA 3UVJA 3DXBA 1BHNA 3NS5A 4LRAA 4OHVA 5AT1B 2Z57B 1Y5LB 3ZZ0A 5KT3A 2R2SA 1WG5A 3QT5A 1R89A 2V5HG 4HL9A 2J5AA 4PUOB 1K1SA 2RSQA 3EWGA 1U1MA 4ZPDA 1Q4RA 2HW3A 1NKCA 4QBUA 5C25A 4B9TA 4IO1A 4CM0A 4CDIA 5AE1A 2AHOB 1UL3A 2HMIA 2X1GA 2HVEA 2J0WA 1AW0A 5KFNA 3ZTOA 1YIJS 2E5IA 4WZQA 2DIUA 4LMZA 2MZRA 1S9EA 4M5HA 3HXMA 4JI4F 5LMNF 2HBRB 1EX8A 4JI6F 3TVYA 4J9PA 2HBYB 1SC4B 3IBCB 2IMWP 5LJ3Y 2E1MC 4RW7B 4H4MB 4WTOB 1U45A 2HHXA 2X7IA 1H98A 2GJFA 3U1MA 4QWDA 1GMWA 3KK1A 1SJ3P 3NCPA 2DD8S 3AD8C 3K8VA 5A2QU 3CJ2A 3GG1A 5L1JA 4FYWB 1N48A 3R5BA 4DSEA 1N36J 1GT8A 3GTYX 2V68A 3EGVA 4P73A 1DARA 1N6QA 4G3IA 1MN7A 3SCLE 4K4YA 1WDTA 3PRVA 2RUSA 1XN9A 5L9NA 2HFUA 4DWIA 4ILLA 2LDIA 3MZIA 4K4UA 5CZCA 3NBPB 3AJDA 5HMXA 1BQMB 4ITSA 3KLGB 5FIIA 1U2CA 5B08A 2FLLA 4ZPAA 4DG1A 2QLWA 2RDJA 3MCNA 4DJBA 3M9MB 1KKHA 3R5GA 1LFWA 4KGMA 5HBMA 8AT1B 2OAUA 2PN6A 2XS2A 1HA1A 4CLZA 2ZH8A 1UFKA 2F4FA 4RKUC 1S1XA 3J7ZT 1GK8A 4LJMA 2J7UA 1KSPA 2DR5A 2E9ZA 1OY8A 3BN4A 1ZOTA 3ZTPA 3CCES 4WF9Q 3BBCA 4TXSA 5E3PA 1BQNA 4OIXA 3JTOA 5F0UA 4F3MA 2VU5A 2GVDA 1OY9A 1Y11A 4DBQA 4IFVA 1EIYB 2W9CA 5KG0A 1HNZJ 1WORA 1Z4UA 2E7VA 2XSFA 5AJ3F 3Q23A 1S76D 1HIYA 2X51A 4LT6A 1YKWA 1Y5NB 4LF7F 5IT9U 5KFLA 1IBLF 2VBYA 2FJXA 2UUCF 2PSZA 3QRRA 4PXDA 3TJ9A 3MECA 1RT7A 1FD8A 3E2EA 2CKWA 4UUXA 4M5MA 4L73A 3LF0A 5KFSA 4N56A 3V81B 1TL3A 4GKKJ 4TY9A 1UPPA 3FSIA 3MDFA 3T5JA 1IKXA 3RB4A 3DLEA 5HQLA 4NXNF 1RT5B 1YGYA 2JOQA 2L3MA 1U8WA 2HRUA 2OP5A 1F60B 2F40A 2W2NP 4KQZA 3SFUA 5HMWA 2Q6CA 3EPGA 1KQSR 3HULA 1YVFA 2BXJA 2BKOA 2FJBB 3VR1A 1DTTB 3H2LA 1UJ6A 2KYXA 2J8AA 2MY8A 4YDDB 2OPRA 1U09A 2FVCA 2XG8A 1VRUB 3K5NA 1AFJA 3B54A 4OJ3A 4ZJQA 2AJ2A 3PHTA 1RAGB 3WX4A 1YITS 1TK0A 2V2QA 1NK0A 4M5DB 3MAQA 2J9DE 2KXHA 2H5JB 2BACA 1N36F 2B8QA 2CDQA 3UCGA 1ZH5A 2CG8A 4C98A 5EWGA 4RO0A 3OSPA 5CYJA 2YNIA 2EFOA 3AXKA 3PEJA 5IM0B 4OI2A 3C16B 5LXYA 1T02A 1HNIB 1WSVA 2HNDB 3KYLA 3H5XA 2WRMA 2M3DA 4FXDA 1HFEL 4I7FA 5DG8A 4WTYA 1M1GA 2HHHF 2PMWA 4ICLB 4PQUB 1WI6A 1BWVA 2LFVA 2C3UA 4MYUA 2VBXA 4OYMA 1M5OC 5D4LA 2B4UA 2D41A 2J0XA 3BGFA 4O4RA 4FF2A 1AB8A 1MW7A 2XMUA 3MWBA 2KB2A 4OHWA 1F6TA 1Y3JA 3MMBA 5E33A 3F41A 3JQJA 4B9LA 2XZTB 2XMMA 1IQZA 2V8HA 2R2TA 4QU6A 4M5GA 5DDQC 2VOPA 4N8OA 4TLQA 3AODA 3BGLA 2IDLA 2HHWA 3KUHA 4DQQA 4ZCKA 4AL7A 3OVBA 4RWXA 1CULA 4J90A 4X65F 1S0OA 2BJ3A 4BCAA 3KHRA 4U67Q 3KK3B 2KM8C 2B9XA 4DV7F 4OZ0A 3MURP 2XMWA 2F7VA 2BANB 1JXLA 3G9CA 2B6AA 2QLJB 1GMVA 4QQBA 2MKKA 4KC5A 2B0GA 3I4HX 3AJ1A 3FDSA 2KT3A 2EFGA 4MK8A 4PG4A 3FZBA 5KFRA 5KFTA 3KLEB 5EN1A 3TO8A 4B9NA 1HWUA 4LFAJ 4KPCA 2KRRA 4FZVA 4DQPA 2HGLA 5EX3A 1PYOB 1RU2A 4N5SA 4CLPA 1R8BA 3LALA 1JJHA 2CJ9A 3F56A 4PXEA 2CA9A 3QO9A 4JI4J 3DOLB 1V6HA 3H4DA 4GKKF 1EP4B 1UP1A 1TKZA 5BYQA 4O3QA 1RAHB 1QTNB 3GYXB 2MJNA 2AX0A 3C14A 3LP2A 1N5SA 3PFOA 4M8LA 4MFBB 5HN0A 2IBOA 4D3HA 1N33F 1MSWD 5HVGA 2OPPB 3PW4A 3DHXA 1JNRB 5F3ZA 2VF3A 1C0UA 1FWKA 2CNKB 3W8PA 2ZM6F 4HI1A 3KNAA 3OFEA 1FJGF 3CD5A 3Q8RB 1S6QB 4RW8A 2C1EB 3WIVA 2GNKA 2QLXA 3OLBA 3QT6A 1ZTWA 2B43A 2H9ZA 3TUZC 5L1KA 3TYTA 5HP1B 1TV6B 1LWFB 1S1TB 2M5YA 5KFGA 1IN0A 1EETB 4NLRA 3BSNA 1S10A 1FJCA 3J80Y 1UTAA 1TUGB 2DHXA 2KT2A 2RHQB 2WOMB 3T1AA 4E98A 3DGPA 2HVIA 1S77D 2HLTA 3M8QB 4DI6A 2RVJA 2XULA 4IG3B 1T3NA 4K4WA 1X9MA 1Q7YT 4UOHA 1DY3A 2N3OA 2L9WA 2OMOA 3A13A 1NRKA 5LSLA 1N32F 1DFDA 1PJ7A 2LYVA 4XTTA 3VF0B 3GZ7A 4C8YA 3PNIA 1VR6A 4KIAA 5DZ6A 1RWWB 3DCAA 3J80U 3FSYA 4NA2A 1JLBB 1PJ6A 4FP9A 2ZBQA 3DU5A 1SJQA 4CLLA 4P52A 1NK4A 3MM9A 3US5A 4RJVA 1FRIA 4FXWA 3EJMA 1B0VA 1JLQA 1VFJA 3TI0A 2IAJA 1S0MA 2CQ3A 5D15A 2Z30B 3GIJA 2ZH2A 3DDIA 1OO0B 5RUBA 5GMEA 4QWBA 4GMKA 1CJUB 2VB6A 4DU7A 1Q53A 3HFZB 4MIBA 4OYAA 1VQKS 1X0PA 1IWAA 2YWFA 3PKMA 4Q2MA 2HK3A 4LVOP 5KFCA 4GVLA 4DU8A 3GR0A 3H42A 1KP6A 2E1PA 3THVA 1LW0A 4ZVUB 2KJWA 1RAIB 4PQAA 3LWLA 1A9NB 4DR1J 1YJNS 1JLEA 3ILIA 4CI0B 3TZWA 2LDYA 2KL8A 3HHLC 4NZ7A 3ISZA 6FD1A 4DS4A 4H4OA 2ZBRA 3M9NB 3MM5B 5LM7E 4ATNA 2NLWA 1R43A 1N56A 1HWLA 4B17A 3DLKB 3PX4A 5LT5A 1L3VA 4DQIA 2G2ZA 3O6QA 3UR3C 1FEHA 2H1YA 5KFBA 4YB6A 2H54B 3OUYA 1GTHA 2CQIA 3BR9A 3CJ0A 4ZPVR 4JYAJ 4F7VA 4DL6A 3AOAA 2A3JA 2D3O1 2CQ4A 3EMTA 4ERDA 4C8ZA 2E9TA 2NZ4A 4FNHA 1K0VA 4X4PA 3OJUA 1Q5VA 2R2UA 3CPWR 3HHLB 4DL0C 5KT7A 1X4AA 2AV5A 2HS3A 3AD9C 3BGRA 3OR2A 3W60A 4X62F 3LUYA 1NHVA 2P8IA 2LEBA 1JKHA 2CQGA 3OTBA 5DO2A 3R7SB 3MXHP 3PXGa 1J2VA 2AWZA 2PA8D 2VKRA 3N79A 4HT5A 4LQ9A 2VQEF 4PCQA 2R7VA 3CXCR 4RUBA 2R7RA 3KG4A 2B5JA 2AJ4A 1SV5A 4XAKA 2CJXB 2YWWA 4B9VA 2D3ZA 4ED2A 4DLEA 4A8KA 2BE9B 1NSKL 1RTJB 1FI4A 4I2QB 1MROB 5E3QA 4OZJA 4DV2J 1LWCA 5KFMA 2G2OA 3QIPB 3R6LB 2VQFJ 1TK8A 4ANCA 2ZEJA 4PG7A 2VL1A 3IWXA 2V8VA 3CJKA 1KVIA 4EMDA 2E9RX 1S1VA 3ILJA 3ONQA 4DL5A 3I0RB 1TFYA 4HI2A 1PKUA 3HVTA 1R8HA 2RE1A 3C6UA 3HD1A 3TJAA 3VTIA 2VBZA 2W9BB 3SSQA 2H5EA 1FWLA 3OR1B 3R3TA 3VAKA 2G13A 1BUXA 1WF0A 3Q89A 5BYRA 1JLFA 3H5YA 4Q0BB 3BF4A 2QSFA 1CJKB 2ZBPA 1YJRA 5J1EB 2ASJA 4R25A 1OYEA 5KFYA 2ZH6A 2XMJA 5KFXA 4DQRA 3UDEA 3HK2A 1HPZA 2HAIA 4GVBB 1RT1B 2GFFA 4DUYJ 3M2UA 2GVZA 3Q86A 4M94A 4R0EA 3G4SS 1T03A 3TUPA 4DN0A 4X4QA 1KDNA 4K0KF 1XMBA 4GKJJ 3ZZYA 2YPYA 4IFYB 1YJTA 2ACMA 4O4GA 4EFAC 1CLFA 2D69A 1WF1A 2B9EA 1TL1A 2IVMA 2IVYA 5EHHA 4Y2MA 3C6TA 1N5QA 4DPWA 3RAQA 1R0AA 1S6UA 4C8NA 2AJQA 1RXOB 1TL7B 2QZ8A 2B8PA 1NDCA 3IGNA 3IBFB 2PA3A
chains in the Genus database with same CATH topology
2G1HA 3TZZA 1NM2A 2QO3A 3TQEA 3HHDA 5DZ7A 2G2ZA 4RR5A 3R97A 2VZ8A 3CJ8A 2H1YA 3HMJG 3QATA 2G2YA 3R8YA 3K89A 3SBMA 3IM8A 2UV8G 2CUYA 2G2OA 4QBUA 2QC3A 3RGIA 3H0PA 2HG4A 1MLAA 3IM9A 3PTWA 2JFDA 2VZ9A 5CZCA 3BV8A 3TZYA 2QJ3A 2JFKA 2PFFB 3EZOA 5CZDA 3G87A 4RL1A 3HJVA 3TZWA 2C2NA 5DZ6A 2VKZG 3TZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1H A;  3TZZ A;  1NM2 A;  2QO3 A;  3TQE A;  3HHD A;  5DZ7 A;  2G2Z A;  4RR5 A;  3R97 A;  2VZ8 A;  3CJ8 A;  2H1Y A;  3HMJ G;  3QAT A;  2G2Y A;  3R8Y A;  3K89 A;  3SBM A;  3IM8 A;  2UV8 G;  2CUY A;  2G2O A;  4QBU A;  2QC3 A;  3RGI A;  3H0P A;  2HG4 A;  1MLA A;  3IM9 A;  3PTW A;  2JFD A;  2VZ9 A;  5CZC A;  3BV8 A;  3TZY A;  2QJ3 A;  2JFK A;  2PFF B;  3EZO A;  5CZD A;  3G87 A;  4RL1 A;  3HJV A;  3TZW A;  2C2N A;  5DZ6 A;  2VKZ G;  3TZX A; 
#chains in the Genus database with same CATH topology
 4ID5 B;  1B64 A;  2AZ3 A;  1ZM2 A;  3WDO A;  1K8A T;  4FN5 A;  4CQ1 A;  2JLE A;  3GJS B;  4ECU A;  2K1R B;  4LF6 J;  3IS9 A;  3CWJ A;  1WOO A;  3S1T A;  1JX4 A;  4DN9 A;  2XSJ B;  3DOK B;  5GAD U;  2V50 A;  1WOS A;  4XDC A;  3BH7 B;  4A8M P;  3EM1 A;  5C24 A;  1X8D A;  4DF4 A;  1VLO A;  2XY6 A;  5DM6 Q;  1N54 B;  2RKI B;  4FYX B;  5I42 B;  3OHA A;  3OHB A;  4ED4 A;  1KVJ A;  2ERR A;  2KH9 A;  2MEW A;  5EWE A;  2H5I B;  4CO1 A;  1MU2 A;  3N5F A;  1X5T A;  2HFO A;  4USH A;  2Z56 B;  4QR0 A;  1CSJ A;  2QA4 S;  2CWK A;  2FGC A;  2HGN A;  2VA3 A;  4IRC A;  4F4K A;  1A7G E;  2PMZ D;  4MH8 A;  2RU9 A;  4AD6 A;  3JSY A;  4CP5 A;  3FZ2 A;  2DHG A;  3I9V 9;  1NXI A;  3CD7 A;  4OZL A;  4KGZ B;  1RT2 A;  3LAN A;  1IM4 A;  4NAS A;  3LOU A;  4RU2 A;  1D8Z A;  4ZPC A;  4P74 A;  1RAO A;  1T05 A;  2I9S A;  4YB1 P;  2JEG A;  1SC6 A;  3RB0 A;  4M95 A;  2W2Q P;  4JUZ A;  1UVN A;  4URQ U;  5D0H A;  2MLY A;  2HVH A;  4JP8 A;  4LBI A;  4A8O A;  3V6D A;  2VUG A;  5AXK A;  5G0R A;  1KWM A;  2HKE A;  3DRP B;  4CT9 A;  3IR6 B;  3OTE A;  2ADC A;  2M0G B;  2DEI A;  1HBO A;  1OPZ A;  2P5V A;  1WNE A;  5J2P B;  3D6F B;  3CVK A;  4NRU A;  2LVW A;  2KG0 A;  3Q22 A;  5GAG U;  5DGA A;  1MMD A;  1ZBT A;  3CCM S;  4KT0 C;  3QT8 A;  4FKX A;  1CPZ A;  1NEE A;  1QSS A;  4LF1 A;  4ED7 A;  2DY9 A;  4Z2X A;  2BE2 A;  5KG5 A;  3UD4 P;  4JI7 J;  2XLK A;  3L7U A;  1PG5 B;  4F04 B;  5EDW A;  3FUY A;  5CAA A;  1DLO A;  2GHV C;  3B4M A;  3DRY A;  2R8H A;  2B3T B;  1PC5 A;  2AP6 A;  1I6J A;  3S8S A;  3MTK A;  4F3Q A;  4H4K C;  1S72 S;  1RTI A;  2D9O A;  2WSC C;  2JVO A;  2QEX S;  2E1R A;  2MKJ A;  4ZHR A;  4FVM A;  4AXI A;  4ZVP B;  3FBB A;  2VFT A;  4K2J A;  4F4Z A;  4Q43 A;  4DV6 J;  4C8O A;  4AMM A;  1PO6 A;  3RTV A;  2IJN A;  3BS9 A;  3MEG A;  1S79 A;  2IRU A;  3QMQ A;  3OXL A;  4KO0 A;  2QL9 B;  1G4C A;  3OTO J;  4ECW A;  3QID A;  4EI2 A;  1J5O B;  3LGH A;  2Q79 A;  4RW4 A;  2WVF A;  1UA0 A;  3FFI A;  1R8C A;  4ZJO A;  3PIO Q;  1PIE A;  1S4F A;  1C0T A;  1WTF A;  1S5Z A;  4TKT A;  3CMA S;  3C46 A;  2OH2 A;  1I5O B;  3MTJ A;  1HW9 A;  4CH7 A;  2BAB A;  4P72 A;  1P1T A;  3IM8 A;  3VZH A;  1GMW D;  3J81 U;  4F2S A;  1SB6 A;  4RW6 B;  5ETK A;  1HQU B;  4EBD A;  5JMN A;  3BBF A;  5LMN J;  2MJU A;  3KLI B;  4A48 A;  3EX7 B;  1F2G A;  3TAM A;  2DGU A;  2COL A;  2WVB A;  3VV2 B;  2CNN B;  2BOA A;  3CSK A;  4DSK A;  2MKS A;  2FB0 A;  3QJL A;  3CF5 Q;  1KTV A;  4B08 A;  3OXF A;  1FKP B;  2YKN B;  1SQE A;  3D68 A;  4FVC A;  4O44 B;  2P9C A;  1KVK A;  3ITH A;  2FHJ A;  1WEL A;  2G9O A;  4ED8 A;  3M30 A;  4QZV B;  3RAM A;  1AT1 B;  2XYH B;  3VZI A;  1FJ7 A;  4IG0 A;  2O67 A;  4KV8 B;  1IXK A;  1EKR A;  3OW2 R;  2AU0 A;  1S97 A;  4OV1 A;  3DRR B;  5F8L A;  1KHW A;  3MM8 A;  2GML A;  4F50 A;  2CAJ A;  1QD1 A;  3C19 A;  2KKH A;  4KJI A;  2ZDO A;  4YP3 A;  1SH0 A;  3SQG A;  1NDK A;  3F0N A;  5IT4 A;  2C2E A;  4ED0 A;  1NND A;  2D3O R;  4WFX A;  2V4J A;  2B9Y A;  2ZOG A;  3W2V B;  1XNR J;  2B4V A;  5DJB A;  4DX5 A;  4DV0 F;  4O3O A;  1AZS B;  4A46 A;  4UOG A;  1QAX A;  2CDR B;  2EBE A;  5KFU A;  4ZIV A;  2L41 A;  3IAM 9;  3NS6 A;  3CD6 S;  3CO9 A;  4WYL A;  4P75 A;  2OPS A;  5A8R A;  1JXV A;  1U6F A;  3T1Y J;  2BKP A;  2RU3 A;  4TQR A;  5A76 A;  4O3S A;  2XEX A;  3LP0 A;  3TUI C;  2AYE A;  1TR0 A;  3R7B B;  7AT1 B;  2HNZ A;  3G82 B;  2PII A;  2MKY A;  4M63 A;  4YDX A;  4NCB A;  3HHE A;  3TEG A;  2N3L A;  3UVJ B;  3NNC A;  4HHH A;  3CE8 A;  3EYZ A;  2BBE A;  3W5Y A;  1F5B A;  3HD2 A;  2Q6B A;  5DDO C;  5L1I A;  1R3N A;  2YWG A;  5ETT A;  3HJF A;  5KOX A;  1ELO A;  1O6X A;  1IBM J;  4LRE A;  3HVW A;  5C25 B;  1YHQ S;  3C3L A;  2GIF A;  4KGX B;  4L72 B;  2VQE J;  2HMI B;  4XK8 C;  1S1U B;  3DMJ A;  3PY8 A;  2NR0 A;  2VON A;  2BEF A;  2C3Y A;  4XPE A;  3DDK A;  1XNQ J;  4WZM A;  4FYV B;  1Q8B A;  3B6B A;  3CIZ A;  2WVC A;  1YTY A;  3V4M A;  4JOU A;  5I4M A;  1VQ9 S;  4DFK A;  1EB0 A;  3HSD A;  2ZC4 A;  3IO1 A;  3A3P B;  1LQ9 A;  2CQH A;  2DIV A;  3CB4 A;  3G6E S;  3I0S A;  3MOJ B;  4JI3 J;  3CCL S;  5G4D A;  2QRR A;  3L7P A;  4PWW A;  2C42 A;  3MOZ A;  3W8G A;  4CNZ A;  3MR5 A;  4RUA A;  5D4O A;  1M0S A;  4NYP A;  1SVD A;  4HEA 9;  2V34 A;  3IN5 A;  2C28 A;  3BB5 A;  3JTP A;  3AA8 A;  2WSF C;  4DCP B;  1NPP A;  1PAU B;  2CPH A;  4DX8 H;  4NLY A;  5LL6 d;  3RGI A;  1EAY C;  3VVU A;  3NBP A;  5AXN A;  1NHK L;  2FIU A;  1Y10 A;  5CXT A;  1BQM A;  1YRX A;  4F4A A;  3CJS A;  2MXY A;  3KLG A;  3AXM A;  4P7T A;  5EX0 A;  3JXO A;  1SL1 A;  2UVU A;  3EGN A;  3VWS A;  2R8K A;  5H9F K;  2DH7 A;  3NGK A;  4WIQ A;  4DG1 B;  1UAW A;  5IXU A;  3PV8 A;  5HBM B;  1SPB P;  4UZC A;  2M52 A;  3MHY A;  2VKZ G;  2ZH7 A;  2V2V A;  2WZ1 A;  1S1X B;  2UXB J;  1RUS A;  4BBY A;  2A18 A;  4LFB J;  5FLX Y;  3GJQ B;  4CT8 A;  1R27 B;  1VBX A;  2OHD A;  4DV1 F;  5F8M A;  1Q86 T;  4S0M A;  2WAQ D;  2PC6 A;  1H73 A;  1BQN B;  3IRX A;  2MZT A;  1MWY A;  2YPZ A;  1VIX A;  1IR1 A;  2V9K A;  3GSI A;  4JI8 F;  3OFF A;  3RYL A;  5ETP A;  4IFV B;  4EEY A;  5HMY A;  4A47 A;  2J0S D;  1A0O B;  3CCQ S;  1RHU B;  4OI3 A;  4KYZ A;  3LPY A;  5GAD I;  1LOU A;  4RPF A;  2OEM A;  1U1O A;  5JJB A;  1EQM A;  2Z8Q A;  1UMJ A;  2XI2 A;  3FBF A;  2JWN A;  1V3R A;  3M6W A;  3T9Z A;  3BEG B;  3O5T B;  2HYI B;  1UVJ A;  4B3O A;  1UET A;  4GKJ F;  4MKY A;  3QJP A;  1WG4 A;  5D0G A;  4X4N A;  1RLC L;  4GO7 X;  2Y9H A;  2K2P A;  4DUZ J;  1D9A A;  4ZN1 A;  1XR5 A;  5I3U B;  4CO2 A;  3QPI A;  4LUB A;  3TZZ A;  2DNP A;  4U96 A;  1SXL A;  2DH8 A;  3M4X A;  1RT5 A;  1RYR A;  4FF1 A;  5M2P A;  3M1V B;  1FRM A;  4CO4 A;  1HL6 A;  2KRB A;  1X9S A;  2J6T A;  4K0K J;  2G2Y A;  3OLA A;  1RTZ A;  3CJR A;  3NY0 A;  1DTT A;  3KDN A;  4U6P A;  4A8F A;  2X3D A;  2FUG 9;  1C1B A;  1KLM A;  3RBZ A;  1U48 A;  5HRO A;  4NLX A;  4F25 A;  1D8Y A;  3DNC A;  1ZS6 A;  2MKI A;  3VAL A;  3GWC A;  3SMZ A;  3LWM A;  2J9D A;  3NGT A;  5KFD A;  2PGC A;  3D66 A;  5IT9 Y;  2IC3 A;  2KVQ E;  3UCZ P;  3MPW A;  3SEO A;  2IM1 A;  4XPC A;  1I51 B;  4HDG A;  4NLT A;  4NOH A;  3C16 A;  4X2B A;  3HT0 A;  1HNI A;  3UI3 A;  4KKO A;  1KQF B;  4WFN Q;  3T1H F;  3NOC A;  3KKF A;  4WP9 A;  3MM7 A;  2DHS A;  3MCS A;  3KJQ B;  1GXL A;  2IA0 A;  2JNJ A;  2QLF B;  4TQS A;  2IY5 B;  1APS A;  3CJ8 A;  2VZ8 A;  1HHS A;  1RA7 A;  9ATC B;  4C6A A;  3L95 X;  3IMQ J;  1YI2 S;  3L09 A;  5IOL A;  3J81 Y;  2AYM A;  1XMQ F;  2DRA A;  2BQR A;  3S6E A;  4ELV A;  2RB7 A;  2HNY A;  2R7S A;  2DHH A;  3PHE A;  1T9T A;  3N28 A;  2BJ9 A;  2DGX A;  2Z58 B;  2AX1 A;  1FEE A;  3KK3 A;  1GTE A;  1VK8 A;  1JQG A;  1WC1 A;  3IA0 A;  3M7V A;  5LJ5 Y;  4RNN A;  2RT3 A;  1D9F A;  3KMS A;  2B6A B;  3B78 A;  1I94 F;  4ZVR B;  2R7O A;  4ZIT A;  3FEY B;  2EC0 A;  2MPU A;  3VAI A;  1NZ8 A;  1VS3 A;  4ELU A;  3B8H A;  1WSR A;  1C2P A;  2LP4 A;  3LQV A;  3PW5 A;  4E2F B;  3HDS A;  1GH8 A;  4M5N A;  1NBE B;  2DO0 A;  2CYY A;  5CQG A;  4ETX A;  3BQ0 A;  1RWM B;  2ZE2 B;  3P49 B;  4DSJ A;  5CCL A;  4DR5 J;  3E51 A;  3T19 A;  3K57 A;  3OTO F;  1JJ4 A;  3QO9 B;  2UXD J;  3H90 A;  2V63 A;  1JMT A;  2QMW A;  4HR2 A;  3U1N A;  4LF4 J;  1VQN S;  2XB2 D;  4HTJ A;  2OD6 A;  4KE5 A;  3QRQ A;  1EP4 A;  1FXD A;  1TKZ B;  1VHI A;  2V69 A;  2BW7 A;  1VQP S;  1UJ4 A;  3OL7 A;  2FVR A;  2KXF A;  1TVR A;  4DUZ F;  2E29 A;  3IR5 B;  1CG2 A;  1WC3 A;  4JI1 J;  4WP8 A;  2LA4 A;  5B0E A;  5DQI A;  4NA3 A;  3PG9 A;  3MMA B;  2XMA A;  1DBD A;  2Z4P A;  1YBU A;  5ETL A;  1NZA A;  3T5L A;  1C0U B;  4L3K A;  4OZ1 A;  5CD4 A;  1NK7 A;  1HBU B;  5HVH A;  1D9D A;  1S49 A;  3NL0 A;  3CGI A;  3T9N A;  2CQ0 A;  3J7A 1;  1G6B A;  1MMN A;  4J37 A;  3ENW A;  2HPU A;  4NI2 B;  4WKR A;  2BR0 A;  3AD7 C;  2FHO B;  4HH0 A;  4QR1 A;  1O51 A;  5HP1 A;  4WII A;  1EET A;  4G1I A;  4DPU A;  4DSI A;  1XTZ A;  1RHK B;  5K20 B;  1NSP A;  2WB4 A;  2NPI A;  4LVN P;  4IOC Q;  4B3R F;  3IRW P;  1GXT A;  3DGP B;  2BYC A;  2FPH X;  1TAQ A;  5HMZ A;  4GC6 A;  1B4S A;  4Q45 A;  3TUJ C;  1JWW A;  3CC2 S;  4KHP J;  5DET A;  4NL5 A;  2OML A;  1C1C B;  1NDL A;  1RSC A;  1FRK A;  3N6N A;  1LFP A;  2DGW A;  4ZN3 A;  1S0V A;  3MFH A;  5MLC V;  1VBZ A;  2A6M A;  2RIJ A;  2XS5 A;  2JHE A;  4TY8 B;  3UN3 A;  4JI2 J;  1X4B A;  5F3T A;  1JLB A;  2QMX A;  4LF8 F;  2W7A A;  2HIQ A;  4OX7 A;  2DNQ A;  5HSP A;  2ZDP A;  1E6Y B;  1VOM A;  4CLT A;  5C42 A;  2DNM A;  3KWM A;  4W4M A;  3J7Y I;  3RZA A;  2Y1J A;  4K4Z A;  1JLQ B;  1RBA A;  1K44 A;  4V1A k;  4PZV A;  3W5X A;  5HO4 A;  4CZC A;  2RQ4 A;  2R9L A;  3PR5 B;  1NK6 A;  2VA2 A;  2CPY A;  5KT6 A;  2MQP A;  3DGV A;  4DV4 J;  2UUC J;  3CC7 S;  2XY7 A;  3VCD A;  1IJF B;  3CCV S;  4Y3C A;  2HWH A;  4K7Q A;  3TR5 A;  5KTQ A;  1Y5I B;  5IQQ A;  4Y6I A;  3KHH A;  4OX6 A;  4H54 A;  4PPD A;  4NCG B;  4ECR A;  2P9E A;  1UWA A;  1Y3K A;  1JLC A;  3QYY A;  3Q2T C;  1XNR F;  5L9X A;  1HHQ A;  2UV8 A;  2CQ1 A;  4H4O B;  1NO8 A;  4QIE A;  5EWF A;  3QAE A;  3KLH B;  1FXR A;  4DX7 A;  4F67 A;  4NPO A;  2E5J A;  2OEL A;  3G2X A;  4RLE A;  2JLG A;  3K58 A;  3RR8 A;  1KLN A;  3QWP A;  3R7N B;  3TP2 A;  3RU0 A;  1Q0N A;  2FYX A;  2XMT A;  5SZT A;  4DV0 J;  1KQG B;  2DIT A;  4MK7 A;  3OUY B;  3VHQ A;  2XTJ P;  5LXR A;  5KFE A;  3M2R A;  5KFI A;  2WBM A;  4Y28 C;  4OL8 A;  2ZWO A;  1IQT A;  5KAK A;  3GB0 A;  2HBZ B;  2RS8 A;  3HHL A;  3WBZ A;  3NNH A;  2KTQ A;  1VDH A;  2MST A;  3BGR B;  4O0I A;  1M5H A;  2ILZ A;  3I31 A;  3MR6 A;  1FJE B;  4Q2L A;  4RNH A;  2AEJ A;  1JKH B;  4C3L A;  4DR2 F;  1VQ5 S;  1RHQ B;  4I69 A;  4ZVE A;  1N4L A;  4NXM J;  2HHH J;  1RWP B;  2RIL A;  4UOF A;  2RQK A;  1B70 B;  2OSQ A;  4NLP A;  4IOA Q;  3S7R A;  1ZA2 B;  1FES A;  3ILO A;  3AOC A;  3K7R A;  5A8W B;  3ISN D;  2B5J B;  4I56 A;  5E41 A;  3HVR A;  1RP5 A;  2OEK A;  4R8U A;  3QQC D;  1SV5 B;  1OSD A;  2DXD A;  2FTR A;  2KFY A;  2LXF A;  1XMQ J;  2I2Y A;  2AIR B;  3DOM B;  2XGP A;  1RTJ A;  1NME B;  2P2C B;  2W2P P;  3THT A;  3TAR A;  3GV7 B;  1MRO A;  4M5L A;  4WXO A;  1S57 A;  1LW2 A;  1AA1 B;  1QJH A;  1KS2 A;  4OYZ A;  1VBK A;  2NPF A;  4BC9 A;  1IKY B;  4X65 J;  4V19 J;  2BJE A;  4A8S A;  4X4R A;  5KFF A;  3C2P A;  1P6T A;  4WXW A;  3P5T L;  4FBT A;  2HHV A;  9RUB A;  1X9W A;  2HIY A;  1NJW A;  2RHS B;  3FRY A;  3CJ5 A;  3IG1 B;  4NLU A;  1H2T Z;  1NDP A;  3HVT B;  3C6U B;  3FCH A;  5THW A;  4BLG A;  3UN2 A;  4DL4 A;  1U0S A;  4RX6 A;  1S9G A;  3G96 A;  2X1B A;  1SC3 B;  3GPA A;  5SUH A;  4RUC A;  2DNK A;  1K47 A;  4Y2I A;  4ZVG A;  3C66 A;  2XYG B;  1S1W B;  3Q2S C;  1UVM A;  2UXC J;  1FNX H;  3CME S;  5FJ4 A;  3NNA A;  1RTH A;  3H8Y A;  3HX9 A;  5KG7 A;  3R1H A;  1T3O A;  1RT1 A;  1LK7 A;  3FMW A;  4QYZ K;  3DXS X;  4G1Q B;  3ZC4 A;  5B0G A;  1L3T A;  4USK A;  1QDU B;  4F4X A;  3T3F A;  2IHR 1;  3HVA A;  4Y2A A;  3OBI A;  4EUV A;  3MCM A;  4J9K A;  1NJY A;  3KJN B;  3I56 S;  4ILM A;  2KJV A;  4IFY A;  2HBQ B;  5A8K A;  3PX6 A;  2W2O P;  4NXN J;  2CNO B;  1WI8 A;  5IV3 A;  5ITH A;  1TL1 B;  1H38 A;  3C6T B;  3PIP Q;  2WCX A;  4ZKA A;  2XI3 A;  1HNZ F;  2ZH4 A;  3JQM A;  5B0D A;  2HVD A;  2BRK A;  1N0V C;  2HQF A;  5JVH Q;  2V4R A;  2MQ8 A;  3I5C A;  4KGK A;  4DV4 F;  4ENO A;  1FD2 A;  4OLO A;  4RR5 A;  2XWX A;  4EBC A;  3IS9 B;  3GP9 A;  1RWK B;  2F8H A;  2XSJ A;  2OKQ A;  3DOK A;  4UOC A;  1WUU A;  3OTC A;  2YKA A;  4U7C A;  3ELH A;  3PCO B;  5HK4 A;  3I5B A;  4NLV A;  1ZM3 A;  2C3P A;  3M8P B;  1ZYQ A;  4X4U A;  4HYK A;  2RKI A;  5I42 A;  3KTQ A;  4J91 A;  4B3R J;  4JI0 F;  3TJ8 A;  4KB7 A;  3D0I E;  2KHD A;  4A8X A;  2J6U A;  4HT7 A;  2RQM A;  1MU2 B;  4KGV B;  1FVQ A;  2ZUG A;  4JI2 F;  3CDE A;  2UVR A;  3JB9 k;  4DFJ A;  3R5A A;  3CJ4 A;  1TL4 A;  4ZVQ B;  2GMJ A;  3E01 B;  2B4O A;  3KJF B;  1IBK J;  5KFK A;  3H4B A;  3GV8 B;  4URS A;  2HFN A;  3TAQ A;  1YJU A;  2C2K B;  2GV1 A;  3MPU B;  2AW0 A;  3QGI A;  4GRS A;  2R2R A;  4AMO A;  1HBN A;  5C5J A;  3FGV A;  1RT2 B;  3IGV A;  3TEH B;  4C2M A;  2MQO A;  4YFU A;  4TYB A;  3TOQ A;  1NJZ A;  1T05 B;  2NYI A;  5B09 A;  2C2O B;  2B56 A;  3TRG A;  3ICL A;  4CH1 A;  2WTF A;  1QAY A;  2GQ2 A;  1UEU A;  2CVI A;  1RZM A;  1IBL J;  1FJG J;  3BBB A;  4F36 A;  2KZZ A;  2ZKU A;  3BR8 A;  4EYI B;  2QX0 A;  2WHO A;  3DC2 A;  1QE1 B;  1N34 J;  4E0D A;  3OL9 A;  2R7T A;  1Q8K A;  2H65 B;  3AB2 B;  3BV8 A;  1HBO B;  3GMG A;  3RAX A;  3UDL A;  2HZV A;  1FKO A;  4NYO A;  2J76 E;  4Z7C A;  5I3Q A;  1VCT A;  1T11 A;  3VAJ A;  3QZ7 A;  2ATL A;  5AE2 A;  2IPO B;  1U2R A;  3K2Y A;  2I5J B;  2UUB F;  4OJG A;  2DXE A;  2E7X A;  3QBC A;  4USJ C;  1HQE A;  2ZBC A;  4ECS A;  3AFG A;  3BZQ A;  4OQJ A;  4ZDN A;  3U27 A;  2WON A;  1FWP A;  4OYW A;  1HD0 A;  2VOD A;  2HLU A;  1LKZ A;  1RAC B;  2EFQ A;  1DLO B;  1VK3 A;  1RBO B;  1RLD A;  4IH6 A;  2P6T A;  5K5M A;  5KFO A;  4N7T A;  1NB7 A;  2F63 A;  1D09 B;  4IDK B;  3VGU A;  1FCA A;  4OI4 A;  1U26 A;  1BY9 A;  2MSS A;  4B02 A;  2CVE A;  3ILL A;  3IWN C;  2NXU A;  3DRS A;  2HK2 A;  3IC1 A;  5HAT A;  4PR6 A;  4ECT A;  1T9V A;  2HVZ A;  4ZHR B;  5T41 A;  2J6S A;  5BXI A;  2EG1 A;  1TEL A;  4CO0 A;  2BJ7 A;  1YLX A;  4DV7 J;  3HPO A;  3VAH A;  2KO1 A;  3JSR A;  4DR7 F;  5B0B A;  2VG6 B;  3VQS A;  1RT3 B;  4CLU A;  3MEG B;  5E0O A;  3HM9 A;  2UVV A;  1N5Y B;  4FNI A;  4KO0 B;  1H3D A;  2YNF B;  3D3B J;  3GSD A;  1IR0 A;  4RW4 B;  2LMI A;  3QT7 A;  3UWT A;  4FS1 A;  4Y00 A;  1PIL A;  1F9E B;  2EC2 A;  3GCW P;  3GG0 A;  4Y2K A;  1CEZ A;  1C0T B;  2NSB A;  1RAE B;  4EO6 A;  1X0F A;  4UY8 T;  4DPO A;  4LF9 J;  4I67 A;  4K5R A;  3MUT P;  2YH0 A;  2FZG B;  1I1G A;  2Q3P A;  1GNK A;  4TVA B;  4AFF A;  3SZ2 A;  1Q8I A;  2CXE A;  1Y7P A;  1ZAV A;  2R4F A;  4QJV A;  4Y0F A;  2BA9 A;  1HQU A;  1B7F A;  2UU9 J;  2R8G A;  3KLI A;  2CG4 A;  1H0H B;  1TP7 A;  1LK5 A;  3H0P A;  2FHJ D;  2XBP A;  3KG1 A;  4R5P A;  1SJF A;  1FRH A;  4GC7 A;  1UJ5 A;  2M9K A;  1FDB A;  1FKP A;  2YKN A;  4O3N A;  5HJY A;  3SDE A;  4O44 A;  5ETQ A;  5IWA F;  4IO9 Q;  2BJ1 A;  2KFZ A;  2MHN A;  4LFA F;  1MML A;  3M30 B;  2OTL S;  1VQL S;  1WHW A;  2ZHB A;  3QJJ A;  5T7L A;  3BN7 A;  4Q44 A;  4DMZ A;  2DT9 A;  3W3S A;  3H40 A;  2RJZ A;  3DRR A;  2KYZ A;  4RNM A;  2RRN A;  3FNN A;  2C3O A;  4CLK A;  1ZA1 B;  3AT1 B;  1URN A;  3SQG B;  4YQW A;  4NEY A;  5E3A A;  1VC5 A;  1F3V A;  2V6A A;  1UEV A;  5CZX A;  5J2N B;  4JV5 J;  3JQK A;  2N7C A;  4L75 A;  3M9O B;  1RK8 A;  2B9W A;  2CPJ A;  2Y0B B;  3TAP A;  2V4J B;  3W2V A;  4K4V A;  1H2V Z;  2VC0 A;  1AZS A;  3IR7 B;  1ZAW A;  1IWG A;  4GO5 X;  3PX0 A;  3CDU A;  3M2V A;  3MAA A;  4F0H A;  2ZH9 A;  1Z2Z A;  3K8W A;  4B9S A;  1YZ6 A;  1ZPV A;  1ROF A;  2ROG A;  1YWX A;  3VVT A;  3C15 A;  2DBB A;  1EQ0 A;  5IC4 B;  2MYF A;  1JLG A;  1P9Q C;  3PO5 A;  4B9M A;  2CNL B;  1NH8 A;  2WW4 A;  3LP0 B;  3NKY A;  1CJV A;  1SUQ A;  1M1H A;  2HNZ B;  3G82 A;  4C8M A;  3HO1 A;  4QIV A;  3CT9 A;  4ZLP A;  2YVS A;  3SYZ A;  3FRZ A;  3M32 B;  2XMK A;  1VJQ A;  1F2H A;  4TU9 A;  2C22 A;  4CYU B;  1VIS A;  2W7P A;  2KG1 A;  4OMF G;  3W7B A;  3G6Y A;  1FX2 A;  4RW9 B;  5IV4 A;  1ZET A;  3TA2 A;  3RW7 A;  5ETO A;  3AOB A;  4QPX A;  3SIP B;  2E5L F;  2HQI A;  4PYD A;  3MED A;  4F4W A;  3PM9 A;  3DLJ A;  3BSA A;  3J81 j;  3W65 A;  4WWS A;  1IR2 A;  4FPR A;  1S1U A;  3DMJ B;  3R5D A;  3RRH A;  2C3M A;  2ZVS A;  5JXS A;  3WC0 A;  4CTA B;  1NK9 A;  4C11 B;  1Q78 A;  2G1D A;  1VQY A;  3Q8Q B;  1SCJ B;  1AUD A;  2D1C A;  5CAB A;  4LIR A;  4DR6 F;  4ZPW R;  4PAB A;  2KN4 A;  3FBC A;  3M8Z A;  3UDV A;  2QL7 B;  4ZCI A;  2QIF A;  2APO A;  3EVW A;  2UUW A;  3LP1 A;  3I0S B;  2ZWP A;  1YZ7 A;  1XMO J;  3CNQ P;  1FTC A;  3Q0A A;  4OV6 A;  1Z2L A;  1HD1 A;  3MUM P;  4AT1 B;  1YBA A;  2IMO A;  3W66 A;  3PKY A;  1GQE A;  5F8G A;  2FVP A;  3FCV A;  4NX9 A;  5BJR A;  1TUV A;  3G8S A;  3NAI A;  2VJU A;  1ZPW X;  4MAK A;  1PJ5 A;  4BDP A;  2JEI A;  4EGL A;  3CED A;  3J7A N;  2OLW A;  1TKT B;  2H48 B;  4JV2 A;  2UUA F;  4J9O A;  4MKA A;  4NXM F;  2XNQ A;  4L6V 3;  4EZ9 A;  1CVJ A;  2DNY A;  1SJ4 P;  3FQL A;  2VV5 A;  2R7X A;  3LO3 A;  4Q8F A;  3DHW C;  4K4X A;  2VFV A;  2P9G A;  3CO0 P;  5CCM A;  3EVM A;  1NU4 A;  4OI6 A;  1F9F A;  4QWE A;  1XER A;  3VGS A;  2E5H A;  2RD5 C;  4KTQ A;  1CJT B;  3HFK A;  2EXU A;  2QLB B;  3RG6 A;  3FC9 A;  2XCP A;  2CQD A;  2HUR A;  2VPY B;  4L3N A;  2CJA A;  1BWE A;  4X64 F;  2V4Q A;  1D3W A;  4RBU A;  1SKS A;  3R8Y A;  2JVR A;  2L9D A;  3K89 A;  5D0R A;  5BR8 F;  2XZW A;  2MQQ A;  2MLX A;  4DSL A;  5D3G A;  3IRX B;  1LXJ A;  1S7H A;  4AUK A;  4J9L A;  3T1Y F;  1N88 A;  4ECQ A;  1PBU A;  2SXL A;  2HGM A;  2R42 A;  3BRE A;  3QLH B;  1UWB B;  4NA1 A;  3JSB A;  2Y1I A;  3MPY A;  1HWI A;  5KFW A;  2QYG A;  2EI5 A;  4C0B A;  3EPI A;  2E1A A;  2HQD A;  5C2C A;  1RIS A;  3NG8 A;  2E44 A;  3AB4 B;  4ANE A;  2MGZ A;  1T9X A;  5ETM A;  3UW1 A;  1HMV A;  2D7S A;  3M8Y A;  2W4P A;  3MPD A;  2F9J A;  4YR2 A;  3MD3 A;  4B3O B;  2WB1 D;  2ZOM A;  2YNG B;  1TK5 A;  1WEZ A;  2F5G A;  3UQS A;  2V8P A;  2ZKT A;  3TX0 A;  2DXF A;  4AYB D;  5I3U A;  2J0Q D;  4Y34 A;  1FDD A;  1X31 C;  2HWI A;  2GAG C;  5GAG I;  3HT3 A;  1SI9 A;  5HI7 A;  4DS5 A;  1BGX T;  2FJA B;  3M1V A;  2E5G A;  1SIW B;  5DDP C;  3MR2 A;  1QSL A;  3Q8U A;  1MWQ A;  1RWN B;  5FDL A;  4JV1 A;  1U7L A;  1U47 A;  2ZD1 A;  4X64 J;  3HHL D;  2FLN A;  2JEF A;  4KH1 B;  3UCU P;  4ZOS A;  1C1B B;  1KLM B;  5HRO B;  2HG4 A;  3QAU A;  5EUH A;  1MLA A;  2MB0 B;  4D3G A;  5H1S V;  4C3K A;  3D1O A;  2GIR A;  2LXI A;  4NLS A;  1WAC A;  4X4V A;  1HAR A;  2XO7 A;  2VIC A;  2IC3 B;  4RL1 A;  4Z7Y A;  4DL2 A;  2PMH A;  4OYP A;  3V6H A;  4ZVH A;  2R7Q A;  3J7Z 5;  4IRD A;  4LF2 A;  1F3F A;  1VRT B;  2A2C A;  2YX4 A;  4G6V B;  5GAE I;  5CHC B;  4WKY A;  3MR3 A;  2OPQ B;  4DUY F;  4KKO B;  3NGR A;  3PJ9 A;  4ECX A;  3NMA A;  3MM7 B;  1RAF B;  4PXB A;  4ZCL A;  3TVZ A;  1IBC B;  4ED6 A;  2HRT A;  3B82 A;  3A3O B;  3BKU A;  5E3C A;  1N34 F;  1KON A;  4LF8 J;  1DAX A;  4M5J A;  1H6K X;  2GCF A;  1UFW A;  4KY3 A;  3R5C A;  2QTW A;  4BC7 A;  3NMR A;  3DU6 A;  4UST A;  5AXL A;  1WOP A;  2K7J A;  4J9R A;  3MI7 X;  2UXB F;  3W9I A;  2AYG A;  2XC9 A;  2QC3 A;  5K14 A;  3CJ3 A;  2HNY B;  3M6X A;  5U47 A;  2EFP A;  4UW2 A;  2FHM A;  2IM0 A;  1G3O A;  2Y1L B;  2YBV A;  3A12 A;  3UO0 A;  5K8M A;  5J2Q A;  2WVE A;  1SBR A;  1U1P A;  3DLB A;  4AND A;  2XO6 A;  2IM2 A;  3RBX A;  4CCH A;  3D3C J;  2X1F A;  2GZO A;  1FRJ A;  1WWH A;  2W25 A;  3D0G E;  2C2N A;  2RUG A;  3JS9 A;  2DK2 A;  3W2W A;  2NQP A;  1WC4 A;  3R2C J;  1U0H A;  1NPR A;  1TQL A;  2DR6 A;  5E7O B;  1VQM S;  5KG2 A;  2OFG X;  1W2I A;  4MKB A;  4W98 A;  4LIW A;  3RW6 A;  4C97 A;  5B7W A;  1HWK A;  3SV4 A;  2Y1R I;  2ALZ A;  2N7Y A;  2V2Z A;  3QSI A;  4AQY J;  4WE1 B;  3BH6 B;  4AMN A;  2ZE2 A;  1RAA B;  4ZLN A;  4NML A;  3ZZT A;  5GAH U;  4HAC A;  1DUR A;  4UZB A;  4FYD A;  1M5K C;  1B7Y B;  2DB1 A;  4LR9 A;  4F3O A;  1RQ0 A;  2JSX A;  2ZNZ A;  3EVO A;  3A4T A;  4QOT A;  2A10 A;  1ARO P;  2J7W A;  1JB0 C;  4UQT A;  3WIU A;  1TVR B;  5CA5 A;  6FDR A;  2HHQ A;  2VG7 A;  5J2M B;  2MHE A;  3MD1 A;  4WK3 A;  4E8U A;  1X4E A;  3MMA A;  4WYW A;  3TA1 A;  1M5S A;  4CNY A;  1ZAX A;  2DGS A;  4ZVF A;  1HBU A;  2KDO A;  3M6U A;  1RCO B;  1NKE A;  4CH0 S;  3BDP A;  4ZJL A;  4O3R A;  1SL0 A;  5DRK A;  1V3S A;  2Z2L A;  4NI2 A;  2R8J A;  1TKX B;  4FPI A;  4N8N A;  4QR2 A;  2K3K A;  3KJV B;  3W63 A;  1X7V A;  4LRC A;  4XDD A;  1F9H A;  1IKV B;  1NSA A;  2DGV A;  2NXN A;  3DRX A;  1KTQ A;  2CPF A;  3AY0 A;  3NGS A;  2JL9 A;  3ZZP A;  1G2E A;  2CPZ A;  2M70 A;  4ZMM A;  1C4C A;  1R0C B;  1UW4 A;  1VI7 A;  2QT7 A;  4KHM A;  4ZCM A;  3Q24 A;  2VHG A;  1VQ7 S;  2VZ9 A;  1XK8 A;  1R6Y A;  3ENQ A;  3THP A;  1C1C A;  4ECY A;  5CZD A;  1HI1 A;  1Q5Y A;  5F8H A;  3HCX A;  2VH7 A;  3GE9 A;  3Q8P B;  3BKT A;  4WU3 A;  4P2M A;  5M2U A;  2ZH3 A;  1YJV A;  4TY8 A;  1LWX A;  1NCL A;  1VMB A;  1VC6 A;  3D28 A;  2X3G A;  5CYM B;  3D5M A;  1M90 T;  2EFN A;  3G71 S;  4LFB F;  1E6Y A;  2RH3 A;  3M8W A;  5C42 B;  2A0F B;  1SC1 B;  3KNG A;  2U2F A;  2Z0G A;  2PFD A;  4C48 A;  4ZK7 M;  4MIW A;  2ZIT A;  3DI6 A;  1ZM4 A;  2EW9 A;  1RT6 A;  3V4I A;  1HNW F;  3SCJ E;  3KHL A;  3BPD A;  4YY3 J;  3VAM A;  2ROP A;  4LBH A;  2ZVI A;  4C0O C;  4PAA A;  1ICE B;  3FVY A;  4TLR A;  5HVF A;  1WTB A;  2KZM A;  4RNF A;  3TZY A;  4CIO A;  4NYZ A;  1RB0 A;  3MR7 A;  4ID8 A;  4NCG A;  1JLC B;  2IFX A;  2YWE A;  4NE9 C;  4DR5 F;  3KK2 B;  3EDQ B;  3EZ5 A;  2UXD F;  2O3D A;  2FGO A;  2O01 C;  5DG9 A;  1BC6 A;  2NSC A;  2MZQ A;  3NP5 A;  2RQC A;  1QVF R;  3KLH A;  4ETZ A;  5J1P A;  1TKD A;  2BJ8 A;  4TNO A;  2CJQ A;  3JYT B;  1S7I A;  2QA4 G;  2DR8 A;  1RAJ A;  2AT1 B;  2QN6 B;  1LWE B;  1PC4 A;  2I38 A;  2KM8 B;  1FNM A;  3PDN A;  5DQG A;  2I6W A;  1R8A A;  4KFB A;  4WFB Q;  3V6K A;  2FY8 A;  1HYS B;  1EHW A;  4OYX A;  3VAF A;  3HZE A;  2G0I A;  1F1B B;  3M2R B;  3WX8 A;  3CDW A;  4URG A;  3DM2 B;  2YKP A;  3EXY A;  2RDI A;  2DPJ A;  2D74 B;  2BDP A;  2AGP A;  3E3X A;  3H98 A;  4L74 A;  2JZ5 A;  2MMY A;  3TA0 A;  3BO2 A;  1BLU A;  1HR0 J;  3KG0 A;  4ZPT R;  2JLF A;  3CCR S;  1VJW A;  1RTD A;  3MPV A;  1DZ5 A;  4PWD B;  4YR3 A;  1FFW B;  2FLP A;  2ABY A;  3CCS S;  4DV3 J;  2Q43 A;  5KG4 A;  4DR4 J;  1QVG R;  5HLF A;  5A8W A;  4LSN B;  4UT4 A;  1NM2 A;  4R8U B;  3TQE A;  1QUP A;  1VRQ C;  1DHM A;  3DOM A;  1X4G A;  3AH6 A;  2K7K A;  3SCI E;  2DR7 A;  2F4V J;  2CPI A;  5L38 A;  4PG6 A;  2N4D A;  3DYA A;  2YNH B;  2HAF A;  1LW2 B;  1NB2 A;  3ENV A;  4JV5 F;  1IKY A;  2ZH1 A;  1XMO F;  3TX8 A;  2JC1 A;  2MLZ A;  3EE3 A;  3ZZO A;  3I9Z A;  3GYN A;  5IZH A;  5DM7 Q;  2CZV C;  1KD1 T;  3MAH A;  3NOG A;  3ISN C;  3ETM A;  5E5N A;  3MEE B;  4RBV A;  4CLW A;  3I96 A;  2HHS A;  1YRU A;  3A1Y G;  3IBW A;  3BSC A;  4F26 A;  3HP6 A;  3IG1 A;  3FKB A;  1UZD A;  3WZ0 A;  1LXN A;  3I5A A;  5A6P A;  1GXU A;  5CZV A;  1KBR A;  1OS5 A;  2A2D A;  2DJW A;  2HSE B;  4I6Y A;  4CLF A;  1RKJ A;  4DR3 F;  4P71 A;  1S9G B;  1M5P C;  1X5S A;  2XQC A;  2MZS A;  3GYG A;  2CQ2 A;  2V8D A;  1S1W A;  1RTH B;  3POT A;  3QGH A;  3ZZU A;  3N9U C;  2YXL A;  3L4B C;  4DPT A;  4F4Y A;  2UVW A;  1O8B A;  5M2R A;  3OD2 A;  4EYH B;  4G1Q A;  2VD3 A;  4N77 A;  3I32 A;  2O66 A;  5L46 A;  1NHU A;  1RT4 B;  2WVD A;  3KHG A;  1ZZF A;  4J9N A;  4DR6 J;  4F0K A;  3KLF B;  2R3V A;  1SJ1 A;  1L3S A;  5JVG Q;  4FS2 A;  4QU7 A;  3CJQ A;  5A8K B;  4K2X A;  3FJ2 A;  3H59 A;  4KR0 B;  4X4S A;  2HZC A;  1RAD B;  1N5V A;  3L7O A;  4QIG A;  1E6V A;  5K8P A;  2PEB A;  2ZH5 A;  3BQ1 A;  2BOP A;  1IM6 A;  2GIQ A;  3BGO P;  4DFM A;  2DGT A;  2GX8 A;  3MMJ A;  1VBY A;  4ZLJ A;  3TZX A;  3G6V A;  4OI1 A;  5IFM A;  2B51 A;  2QFJ A;  5DS7 A;  3HSJ A;  5KOW A;  4ILR A;  2LEC A;  4YB7 A;  4ZP6 A;  3OJS A;  1UA1 A;  2BVZ A;  3N6M A;  1S6P B;  3KUE A;  5DZ7 A;  3LPE A;  4HKQ A;  4MKV A;  2AD9 A;  2QFI A;  2E66 A;  1CQM A;  1N52 B;  3IAS 9;  3BYP A;  4C7Q A;  4DLG A;  1HNV A;  2GGP A;  4LSL A;  3I87 A;  1V5I B;  2NUH A;  2AKW B;  2DIS A;  5JUM A;  4PRF A;  3SQO P;  2Q66 A;  3M8P A;  1WC6 A;  1S99 A;  1B0P A;  2HS4 A;  2NXE A;  3QRP A;  2QSW A;  6AT1 B;  2M2B A;  2RF2 A;  2YKM A;  1HHT P;  2NCK L;  4ZS6 A;  1WF2 A;  4ED5 A;  3HLU A;  1Q16 B;  2FJE B;  1TAU A;  3PO4 A;  4LRF A;  1B0T A;  2EBG A;  1J5E F;  4I6A A;  5K8O A;  2I8E A;  3BKF A;  3E01 A;  4WP3 A;  4AE5 A;  4FYY B;  3ZTS A;  3NGD A;  2CQP A;  3PYD A;  1VC0 A;  3V81 A;  5A0Y A;  3P45 B;  1WC0 A;  3GJR B;  2FHK A;  3NCR A;  4IH5 A;  2G1H A;  1HBN B;  5A6W A;  2UU9 F;  3EDR B;  3UPF A;  2W9A A;  3R9L A;  2C2R A;  2QA2 A;  4X66 F;  2V8G A;  2DNH A;  1PGZ A;  5J1N A;  4HLB A;  3FMB A;  2BM0 A;  3BDE A;  2BM1 A;  2CFX A;  1NKB A;  2XWY A;  4B3T F;  3RRK A;  4TYA A;  1T7P A;  2ALY B;  2DGO A;  3HSG A;  3WQP A;  1QE1 A;  3D0H E;  2GO8 A;  2H3E B;  2YX1 A;  1EJ7 L;  1XR6 A;  2MKC A;  1FKO B;  3R27 A;  3K17 A;  5LMU F;  2BV3 A;  2W4D A;  3T1H J;  4IQX A;  3JTN A;  2JJ4 D;  4YR0 A;  3GV5 B;  2POK A;  1L3K A;  2I5J A;  2ZUA A;  3HZG A;  3IP0 A;  1IKW A;  3N6L A;  1HQE B;  1YJ9 S;  2XZD B;  4IH7 A;  3HKW A;  4WCE Q;  1U6B A;  1T94 A;  4CM2 A;  2WON B;  4Q8E A;  4OZ5 A;  5F8N A;  4FF3 A;  2DNL A;  4USM A;  3SFG A;  1QAJ A;  2MKH A;  1FFS B;  2D3U A;  2V2K A;  4IDK A;  5CYQ A;  3X1L B;  3AA9 A;  1DQ8 A;  1HQ2 A;  1KQK A;  3F73 A;  4RUH A;  3DRS B;  5C7P A;  1HNX F;  3ET6 B;  4YOE A;  1O5J A;  3LH2 S;  1URR A;  4A4J A;  1DQA A;  1R8P A;  1VGY A;  5F0W A;  3H5U A;  4OJH A;  2QJ3 A;  2F3J A;  4YEA A;  2KXN B;  3X3U A;  1NK5 A;  1REV B;  4MT1 A;  1KNZ A;  2VG6 A;  3S01 A;  1RT3 A;  2IDE A;  4OJ1 A;  1Q7L B;  4YY3 F;  1N5Y A;  2VG5 B;  3PW7 A;  1U1Q A;  2YNF A;  3DLG A;  1WC5 A;  1T9W A;  1NUE A;  3MM6 B;  3ZO7 A;  1MG7 A;  3TQ1 A;  2BKN A;  2K3I A;  2HHU A;  1RHJ B;  3NLC A;  1BD6 A;  4K50 A;  4PG8 A;  3PJX A;  3R97 A;  4DOZ A;  1F5C A;  1GAO A;  3AQO A;  1FK9 B;  1HWJ A;  3AAW B;  4I2P A;  1H74 A;  3QAT A;  4PWU A;  1U1N A;  3JSM A;  1H72 C;  1TU0 B;  1IJE B;  2YKO A;  2CJB A;  4P9S A;  4DDF A;  3L3C A;  5F9N A;  3RBE A;  2AGQ A;  4P7V A;  4EZ6 A;  2EEY A;  1HBM B;  2EKN A;  3PEH A;  1JJ2 R;  3J7Y U;  3QSY B;  1EKS A;  3W9H A;  4CLS A;  4A8W A;  1H7X A;  4ZVS B;  3SXL A;  4R5P B;  5F9L A;  2FDN A;  1FRL A;  3EZU A;  4PG5 A;  1JIH A;  3H20 A;  4OYO A;  2AJ1 A;  4WFA Q;  3SDE B;  4C8L A;  2R7U A;  3D7S B;  1HKA A;  3RJM B;  1SQF A;  1UZH A;  2RAQ A;  3HF5 A;  1RWV B;  4DCO B;  3LAK A;  3FBE A;  3H2V E;  5T7L B;  1SKU B;  4Z37 A;  1DTQ A;  2HFZ A;  2L48 A;  2LLZ A;  2OEJ A;  3UFC X;  1NH7 A;  2LEP A;  1PAE X;  3LAM A;  3MMC A;  1FA0 A;  1JXE A;  1U25 A;  2LA6 A;  2GMH A;  2QE5 A;  1R0B G;  3BSO A;  4QWA A;  4DQS A;  4LF4 F;  3CDB A;  3UD5 A;  1KOH A;  1BE4 A;  1Q95 G;  3U02 A;  2JDJ A;  3TVK A;  3L9Z A;  4EO8 A;  2PO4 A;  3SBM A;  4KPY A;  5J2N A;  2L9N A;  3W61 A;  1H2U X;  2CPX A;  4TU7 A;  4WK1 A;  2DHA A;  2I1R A;  3O1L A;  4OLP A;  1BXN A;  4YN3 B;  2X1A A;  1VQ6 S;  4IYQ A;  3ULH A;  2GW8 A;  2FLO A;  3ZXW A;  4V19 X;  1CC8 A;  2JFD A;  4MK9 A;  3M2V B;  3MAA B;  4WFY A;  3CDA A;  2HQC A;  3BO3 A;  4U7U K;  1DQ9 A;  3EZO A;  1VQS A;  3H25 A;  3G87 A;  3C15 B;  1NK8 A;  1CS4 B;  5CH7 B;  4W92 B;  1JLG B;  1TUW A;  4QCL A;  3RBD A;  3OVA A;  2VPZ B;  3OVS A;  5HAO A;  2EK1 A;  1CJV B;  1SUQ B;  5L8R C;  2R8I A;  2FZK B;  3NEK A;  3QNW B;  1L3U A;  1JLA A;  5LSR A;  3D6T B;  2JH3 A;  2F9D A;  3M32 A;  4UQG A;  4CYU A;  2IYG A;  1FVS A;  2HWT A;  3M8S A;  1UVK A;  2B7C B;  3P3D A;  1MN9 A;  4RW9 A;  2NUU G;  4PUO A;  4DHV A;  2WSE C;  2DNG A;  1RA6 A;  2DNR A;  2GO9 A;  2LCW A;  2LXU A;  2Z2Z A;  3MED B;  4PYA A;  5F8I A;  1N8R T;  4IR1 A;  3GIR A;  1S48 A;  2DCU B;  4I0W A;  2UXC F;  3LA0 A;  2CRL A;  1PCA A;  2MQN A;  2C2Z B;  1LNQ A;  3A8K A;  3GON A;  3R5J B;  4NLQ A;  5GAH I;  3K5L A;  3K5M A;  4LSZ B;  2OIH A;  2XHC A;  4CTA A;  1GMU A;  1XBW A;  1OPI A;  3CCW A;  4C11 A;  4A8Q A;  2BRL A;  1S9E B;  2V0N A;  1RBL A;  1I3O B;  3HJV A;  4RWW A;  4X4O A;  4YHH F;  4DPX A;  3GIM A;  2XHW A;  4USV A;  3VAG A;  3RR7 A;  3GU0 A;  4UTG A;  5ADZ A;  2ZHO A;  4EWT A;  4RW7 A;  4H4M A;  1ITP A;  3NGU A;  3LP1 B;  5AXM A;  4DV2 F;  1X5P A;  3KK1 B;  1FKA F;  3T5K A;  3MCO A;  3RB3 A;  1N33 J;  3HHD A;  3T41 A;  4LR7 A;  2OD4 A;  3R6G B;  2DY1 A;  2XNR A;  1OMS A;  1OJ4 A;  4LRB A;  4OZ3 A;  4DR4 F;  1I94 J;  1U02 A;  4NZ6 A;  1EAR A;  1N6Q B;  2XS7 A;  2QV6 A;  2VFU A;  2LU2 A;  5LMU J;  1AFI A;  4HDH A;  4J9U E;  1TKT A;  4C8K A;  2KVI A;  4QIW D;  3N4W A;  1V3Z A;  4O3P A;  2IJR A;  2NYH A;  1NPK A;  2RDD A;  3O3L A;  1UKU A;  1FNO A;  2MDA A;  3A8I A;  3SSS A;  5L39 A;  1RYS A;  1XWL A;  2IVF B;  1SQG A;  2PD1 A;  2VFS A;  2QGF B;  2AYB A;  2W1B A;  2Y8W A;  4ED1 A;  2MQM A;  1FDA A;  1CJT A;  2GS8 A;  2IM3 A;  3FEZ A;  4P2S A;  2DNO A;  3CIM A;  5DQH A;  4USU A;  4H4K A;  2FD2 A;  1H7W A;  4JI6 J;  3DN9 A;  1KC8 T;  2G4B A;  5K8N A;  1QUV A;  4J7C A;  4OHY A;  4X84 A;  1L5U A;  2CQB A;  1FE0 A;  4M5K A;  2B4P A;  4RBT A;  2WBR A;  5L1L A;  3UR0 A;  5D3G B;  1GX6 A;  4NWB A;  3FCW A;  4UUW A;  5F41 A;  5DLG A;  2I0X A;  1S9F A;  2CUY A;  4KAI A;  4DXL A;  2DR9 A;  2GVD B;  2FC8 A;  1P27 B;  4K4S A;  3JAM Y;  3LTO A;  2W9C B;  2QYC A;  3QFW A;  3BGU A;  3QLH A;  1UWB A;  3BM7 A;  3IM9 A;  4R0J A;  5B0A A;  3SCK E;  2U1A A;  1R31 A;  2VJV A;  3KUG A;  2V67 A;  2JRS A;  2M4M A;  4LBP A;  5B0C A;  3SI8 A;  3DLH A;  5HQ8 A;  2ATC B;  2EFV A;  2LU1 A;  1RAB B;  2MGZ B;  3MEC B;  1RT7 B;  1HMV B;  2G0J A;  4OFZ A;  1RWX B;  5LOQ A;  4C0H A;  2ZHA A;  1VYA A;  2YNG A;  5C2G A;  3GFZ A;  2LQJ A;  5D4P A;  2XGQ A;  1XIQ A;  3UDC A;  1RDR A;  1F5A A;  3KDO A;  2M7S A;  1TL3 B;  3P6Y C;  2O1P A;  1FRX A;  1X4F A;  4UF4 A;  1IKX B;  4ECV A;  3DLE B;  1QTM A;  2BZ2 A;  1KFS A;  2H4W B;  1KRP A;  2DKO B;  3W9J A;  2UUB J;  2GAH C;  4OYB A;  3GFX A;  5FDL B;  2DVI A;  2ZD1 B;  3NAH A;  1Y4Z B;  2OPR B;  1VRU A;  2BMB A;  5KFV A;  4IQM A;  4MTP A;  2CIM A;  3R2D J;  1JK9 B;  5KT2 A;  1UEK A;  3CJT A;  4M5D A;  5B0F A;  5H9E K;  2F8M A;  4I68 A;  1R7I A;  4DPY A;  3D9B A;  4HH1 A;  2F1F A;  2MZJ A;  4I6W A;  4PKD B;  4A8Y A;  5KFJ A;  2YNI B;  2KT5 A;  3CC4 S;  1VRT A;  2FQQ B;  5I3P A;  5IM0 A;  3V6J A;  4LF7 J;  4KHP F;  1MNE A;  3W5Z A;  2OPQ A;  1U4B A;  1K9M T;  2HND A;  3D2W A;  2OTJ S;  2MZ1 A;  4I7F B;  2ZJP Q;  1JJC B;  2GC8 A;  4PEO A;  2VOO A;  2AF6 A;  4ICL A;  4PQU A;  4RU9 A;  2ZBI A;  1IBK F;  1U6Z A;  2QMU B;  2AQ4 A;  1D0E A;  2Z2Y B;  2ASY A;  3DFE A;  2OO4 A;  1REG X;  3O44 A;  4ZPB A;  2A6O A;  1SL2 A;  1YX2 A;  4QYR A;  3MMB B;  3A8J A;  3WHI A;  4FBU A;  1WDD A;  4DX6 A;  3GLJ A;  3T6J A;  4WU2 A;  1BMQ B;  5K14 B;  3UNG C;  2WW8 A;  4U8V A;  3PTW A;  1WHV A;  5D4N A;  3GIL A;  1WKJ A;  2PI4 A;  2K8G A;  2IIH A;  1PYS B;  5J2Q B;  4IKA A;  3B4D A;  1CUL B;  3KXD A;  2N4C A;  2BE7 D;  3TNV A;  2FJD B;  2GJ2 A;  3NWR A;  4HHU A;  2UUT A;  4K59 A;  4NRT A;  1A6L A;  5K9F A;  3LGM A;  1VQO S;  4LF6 F;  2A1B A;  3F44 A;  3W2W B;  2BAN A;  2VDI A;  2AEM A;  3K59 A;  1U1R A;  1U0H B;  1U2F A;  1NLK L;  2CWX A;  2XYP B;  3KMQ A;  3MF5 A;  1U1K A;  1HNX J;  1Q81 T;  3KLV A;  1FFG B;  3KLE A;  2DEJ A;  1V5V A;  2BQU A;  4DR3 J;  5IS2 A;  3KFW X;  3QZ8 A;  1J27 A;  4IOB A;  3Q83 A;  3HMJ G;  4ZP8 A;  3D4J A;  4DV3 F;  2ASD A;  4WE1 A;  4YB5 A;  1FO1 A;  3JAM U;  3BYR A;  3I4P A;  3OFH A;  4NLO A;  5KT5 A;  4XIU A;  4HAC B;  1WHX A;  3NS7 B;  1S12 A;  3CUL A;  3DDN A;  1SH2 A;  3DOL A;  4ZVT B;  4ALZ A;  1X4D A;  1XQI A;  2EPI A;  1HLW A;  1YJ7 A;  1N5T A;  2JFK A;  4O23 A;  5FLX U;  3PRD A;  2ZJQ Q;  2FVS A;  4J5O A;  3C14 B;  3LP2 B;  1XJW B;  2OI2 A;  2EWH A;  2Z2M A;  2VG7 B;  4MFB A;  5HJX A;  2XLJ A;  4JBC A;  5J2M A;  3PW0 A;  3ZZR A;  2PE8 A;  4YS2 A;  5D6G A;  3A3N B;  1Q82 T;  2OPP A;  4JV0 A;  1XEZ A;  2RS2 A;  3RB6 A;  4F02 A;  4L76 A;  2YQ1 A;  5HL7 Q;  2C2M B;  2VFR A;  1TMM A;  3KOA A;  5D8H B;  1YSJ A;  2ROE A;  3ZZZ A;  1S6Q A;  4RW8 B;  5H9F J;  2DRD A;  1TKX A;  4OZN A;  1QSY A;  4C9D A;  3T6B A;  4XO0 A;  1W26 A;  3OXG A;  1UW9 A;  4P2F A;  3KJV A;  1LWF A;  1S1T A;  1OY6 A;  1TV6 A;  3A8E A;  5ETN A;  1IKV A;  5KFA A;  4DZ6 A;  4ZVO B;  5D0E A;  4P6Q A;  4Y2C A;  5IWA J;  2UP1 A;  4U9R A;  3N01 A;  1X5O A;  2WOM A;  1VQ4 S;  1F0X A;  2BX6 A;  3M8Q A;  1DJ0 A;  4IG3 A;  1D1U A;  2E7W A;  3OL8 A;  1OWX A;  3HHK A;  3W1Y C;  4WBF A;  4ZP7 A;  3NRB A;  4PXC A;  1P8G A;  1X4H A;  3OQ2 A;  4OHZ A;  4KH0 B;  1GX5 A;  2W8L A;  2ZZN A;  1S4E A;  3WC2 A;  2CPE A;  4RZR A;  2AEF A;  1RI7 A;  2NXJ A;  3D1H A;  5CYM A;  3ZNJ 1;  2DH9 A;  2FC9 A;  1MWZ A;  1HI8 A;  3MM9 B;  3QFH A;  4MIA A;  2RRA A;  2VC1 A;  2Y3Y A;  3OFG A;  3BPS P;  5ETS A;  4DEZ A;  4YHH J;  1LV5 A;  1Y0H A;  1Q1K A;  2IAJ B;  5H9E J;  3K0J A;  1KHV A;  3DI6 B;  4DV6 F;  1ACM B;  1S6O A;  1RT6 B;  1VLY A;  3GFY A;  3V4I B;  1HI0 P;  1CJU A;  4YUD A;  4UY8 5;  4OYI A;  4OX9 F;  1TFW A;  4K8R A;  5DG7 A;  5IQ6 A;  2XCA A;  2DCL A;  3PYF A;  1YQH A;  3T5H A;  4BWJ A;  1KN6 A;  1ULR A;  2AMC B;  4MJK A;  4TN2 A;  1LW0 B;  1ZZN A;  2HQG A;  4AQY F;  2BQ3 A;  1FX4 A;  1JLE B;  1PYT A;  5KG3 A;  4IR9 A;  5IC6 B;  3CCZ A;  1RU1 A;  3KK2 A;  4QIF A;  2Y8Y A;  4HVZ A;  2IA6 A;  1IVZ A;  2AZ1 A;  3MM5 A;  2EVZ A;  4N47 A;  4MYT A;  4QW9 A;  2B7B B;  2UUA J;  4F8R A;  4HHJ A;  1O0P A;  3HHN B;  3JYT A;  2G0C A;  2W2M P;  4C3M A;  1TZ0 A;  3DLK A;  4LQ3 A;  2CZ9 A;  1LWE A;  1YK9 A;  2YWH A;  3GII A;  4JI5 J;  1KR4 A;  4N41 A;  2BW2 A;  4KFB B;  1W7W A;  3D54 A;  1HW8 A;  3IWL A;  5KFZ A;  3PW2 A;  1HYS A;  2M8H A;  4DZD A;  2R7W A;  2XY5 A;  3U7J A;  4JI7 F;  5AE3 A;  4KRW A;  4MMO A;  4NEZ A;  1T9Y A;  2JEJ A;  1UCN A;  1XR7 A;  3DM2 A;  2Q1L A;  3C8Y A;  2QL5 B;  3CTR A;  2W4C A;  4QW8 A;  3G6X A;  4DV5 F;  3D6M B;  2M88 A;  4JI5 F;  3OTD A;  1KOO A;  3VGT A;  1RCX B;  1WEX A;  4WPA A;  5ETV A;  1RE1 B;  3RUB L;  3OR2 B;  4YME A;  1SJR A;  2MQL A;  5KFP A;  1OYD A;  1RTD B;  3GQC A;  5D77 A;  5HAN A;  4PWD A;  2ILY A;  1PBA A;  3N5B A;  3I6P A;  4USW A;  1G7C B;  2DRB A;  4LF5 J;  2FJW A;  2V9W A;  1GFW B;  4DFP A;  1N0U A;  1FER A;  1VHF A;  1UVI A;  5HLF B;  4F2R A;  1SH3 A;  4CRJ A;  4LSN A;  4B9U A;  2M8D B;  3OV7 A;  4ELT A;  2E5L J;  4FF4 A;  3G86 A;  1SKR A;  3HKZ D;  1FDN A;  2KFN A;  1K1Q A;  2ADB A;  2NS1 B;  4I2Q A;  1EZZ B;  5GVQ A;  3W62 A;  3DYA B;  2YNH A;  1K73 T;  1FTR A;  1LWC B;  3PAC A;  3E8O A;  3MGJ A;  1XC9 A;  3QIP A;  1M1K T;  3PFE A;  4JI3 F;  3H5S A;  1BQX A;  4LRD A;  3TWZ A;  4NMX A;  2F8E X;  1QM9 A;  1JNZ B;  3CJK B;  3G8T A;  1UFL A;  2LKZ A;  2RNE A;  3LGN A;  3CMQ A;  1S1V B;  3MEE A;  1Z1Z A;  3ZNU A;  4ED3 A;  3CD0 A;  1RGV A;  3I0R A;  4DV5 J;  3UD3 P;  4NCA A;  1OIA A;  2LQ5 A;  2W9B A;  2HFS A;  1NSQ A;  5HQM A;  2HZA A;  3Q8V A;  1QY7 A;  3CCJ S;  2BUN A;  3GR1 A;  3OR1 A;  1AXQ A;  3M8R A;  4AL6 A;  2GHW A;  1JLF B;  2JX2 A;  4Q0B A;  4OHX A;  4J9M A;  1CJK A;  2FZC B;  3MEK A;  3P4U B;  5J1E A;  1IBM F;  1Q8L A;  4CO5 A;  4KHR A;  3RRG A;  2VAS A;  2DYA A;  3PVX A;  1RJJ A;  2YX7 A;  3AQP A;  4OI0 A;  3LW5 C;  2IBK A;  1ZM9 A;  3D1Q A;  2HS0 A;  1HPZ B;  3POT B;  4GVB A;  2LQ8 A;  3I82 A;  3P8B B;  4BHQ A;  1YDL A;  3M2U B;  4RNO A;  2FJV A;  2GVZ B;  4CWB A;  1XNQ F;  4QYZ J;  2W01 A;  4PPZ A;  1T03 B;  4Q5V A;  1X4C A;  4Q7A A;  1RT4 A;  4FDF A;  3V2U C;  2F4V F;  1FXL A;  3KLF A;  3DKD A;  4AXJ A;  4LF9 F;  4BWM A;  3QWU A;  1UPM B;  5E3R A;  2JC0 A;  3UE2 A;  2FVQ A;  3U1L A;  1K0T A;  3P96 A;  1YRT A;  4O4G B;  3TAN A;  3IXQ A;  2ZOF A;  4Y65 A;  2ZM6 J;  5DDR C;  1YJW S;  1NJI T;  2VPX B;  3UNY A;  1E6V B;  1S59 A;  3VGV A;  1QAI A;  4B3M F;  1R0A B;  4LFC F;  1FHT A;  1C4A A;  1TL7 A;  1B3T A;  8ATC B;  2DO4 A;  4QWC A;  1VQ8 S;  1AUS L;  4X66 J;  2IRX A;  1LEO A;  7FDR A;  4ID5 A;  1HNW J;  5FD1 A;  2ASL A;  1Q79 A;  4OX9 J;  5KG1 A;  1S6P A;  2OUG A;  2HEK A;  2IRY A;  2HFV A;  2H51 B;  2K1R A;  2HHP A;  3QGP A;  5D78 A;  4EU0 A;  1SIZ A;  4U95 A;  4B3T J;  3DLL Q;  4I64 A;  4F0M A;  1TTH B;  2LEA A;  4HTI A;  1HNV B;  2GGP B;  2HRY A;  3ENA A;  3EXC X;  4LSL B;  5KG6 A;  5C24 B;  2LQB A;  2QA1 A;  1ZTT A;  1Y9O A;  2ZFH A;  2GA7 A;  4J9Q A;  4ES3 A;  1VIO A;  1DRZ A;  4DL7 A;  3ADA C;  2RF2 B;  2YKM B;  1RKI A;  2OGU A;  3FEX B;  5MAO A;  2HHT A;  2MY7 A;  1YBT A;  2XM3 A;  2J7K A;  3MFI A;  1P9Y A;  2W7O A;  1AYE A;  4ER8 A;  4IUF A;  2PFF B;  4I1T A;  2LQ9 A;  4NLW A;  3R1L A;  2ZJR Q;  4DF8 A;  2DNN A;  3ZFV A;  3V5R A;  1CBK A;  1R6V A;  4M1K A;  2CZ4 A;  3CW2 C;  2XLI A;  2VQF F;  4G1P A;  1FT8 A;  2D9P A;  4KSE B;  1WD6 A;  4ZP9 A;  5A0Y B;  5LSO A;  1OQ3 A;  5BR8 J;  1RWO B;  4JYA F;  1IUJ A;  1U49 A;  3Q8S B;  3NWG A;  3CUN A;  4JI8 J;  5DGB A;  4B3M J;  1QLN A;  3D6H B;  4QPT A;  3P5B P;  2KU7 A;  4P10 A;  1CC7 A;  4TU8 A;  4J9S A;  1V9O A;  3AJ2 A;  4K4T A;  4ES2 A;  4X62 J;  1RHR B;  2YQ3 A;  1T9U A;  2ZZM A;  3ZTQ A;  1CQN A;  4DR2 J;  3PZP A;  2YWK A;  3V6D B;  3W64 A;  2CAD A;  4NLG A;  5F8J A;  2EK6 A;  2PT0 A;  3M6V A;  3DRP A;  5G0R B;  3VQT A;  3HSZ A;  3O8W A;  1WJ9 A;  4LR8 A;  4WFZ A;  4BS2 A;  4ZIW A;  3BJY A;  1S0N A;  1FF2 A;  2GJI A;  4DCJ B;  3PR4 A;  5J2P A;  4AL5 A;  2J9E A;  4DSF A;  3IFE A;  1IKW B;  4USI A;  1W2B R;  3Q8Y A;  1T95 A;  1FE4 A;  2NXC A;  3BO4 A;  2BJD A;  4OX8 A;  1J5E J;  4IRK A;  2BE2 B;  2DPI A;  2YTC A;  3G8Q A;  1KFD A;  3K5O A;  4KBI A;  4B3S J;  1P1L A;  4U8Y A;  5CYQ B;  3QGG A;  2OSR A;  5CD4 H;  1RTI B;  4ZA1 A;  3BQ2 A;  4C4W A;  4OZ2 A;  3FQK A;  4JI1 F;  2PI5 A;  2H4Y B;  2O5D A;  3ET6 A;  5IT0 A;  4DV1 J;  1TL5 A;  3PJW A;  4EK2 A;  2YH1 A;  2Y0S D;  2GHP A;  5A2Q Y;  4LF5 F;  1OQ6 A;  2XMV A;  2CJY B;  2AJ0 A;  3M05 A;  3OL6 A;  1REV A;  2OFH X;  2RML A;  8RUC A;  1GEH A;  4ES1 A;  4N76 A;  2F65 A;  2YQ0 A;  2VG5 A;  2DNZ A;  3CCT A;  3DLG B;  3EGW B;  1U24 A;  7FD1 A;  2VIH A;  2CQC A;  2HQ3 A;  3MM6 A;  1J5O A;  4JI0 J;  1U8S A;  3FFI B;  4CO3 A;  1OSC A;  2KI2 A;  5KFQ A;  1U1L A;  2QO3 A;  3OSN A;  1NAQ A;  2VBW A;  3EIC A;  1FK9 A;  4I2P B;  1B99 A;  2GQC A;  1UVL A;  2J9C A;  2L08 A;  3JSM B;  1W25 A;  3GFH A;  4WJB A;  1Y00 A;  1N32 J;  3FSX A;  1M5V C;  3CCU S;  1PSD A;  4RW6 A;  1X60 A;  4X4T A;  1HBM A;  3TW0 A;  1WKK A;  2EKY A;  2K06 A;  2YKQ A;  2ZNY A;  4J9V A;  3TAM B;  5KT4 A;  2VPW B;  1T8E A;  2PEH A;  3OPK A;  2MTL A;  4DL3 A;  2CJK A;  2YY3 A;  3UN5 A;  4I4B A;  2KHC A;  3GCX P;  5GMK a;  3MUV P;  3ITH B;  3ETO A;  3NXZ A;  1YG0 A;  4ECZ A;  5DLF A;  3H7H B;  4JB8 B;  2N82 B;  5AJ3 J;  2J8S A;  4IG0 B;  4KV8 A;  3SSR A;  2E1C A;  5ETR A;  2P6S A;  1DTQ B;  2V94 A;  2DTJ A;  1WEY A;  2QG9 B;  3PYG A;  4FKY A;  5BYS A;  2AGO A;  1HR0 F;  3MMC B;  3MM8 B;  1RHM B;  2VDH A;  4G65 A;  1NJX A;  3SV3 A;  3D67 A;  4AMP A;  3HI9 A;  2WK4 A;  3K5P A;  4W90 B;  5E2Q A;  2NZC A;  3HFV A;  2UV8 G;  3ZTR A;  3O2I A;  3GIK A;  4DR1 F;  2RRB A;  2ZZT A;  3I55 S;  3FK4 A;  2GQQ A;  3H2U B;  1WKL A;  4K5S A;  4M5I A;  1SKW A;  2OJ3 A;  4P2X A;  5KFH A;  2IYI A;  1TMJ A;  2PDA A;  2UZA A;  3N0V A;  4DUT A;  2IJF A;  4B3S F;  4LFC J;  1G1X A;  1WG1 A;  2W8K A;  3AHP A;  3EUN A;  2EG2 A;  2CPD A;  2AJF E;  3NCQ A;  2OPS B;  2W24 A;  1RWU A;  4NLD A;  4NZ0 A;  5A8R B;  3OT9 A;  3PRB A;  2DGQ A;  5T14 A;  4EBE A;  2C2D A;  1KEK A;  1CS4 A;  2FY1 A;  2ZC3 A;  4ZLL A;  2ACY A;  3PYE A;  4CLY A;  1T0T V;  3EGZ A;  1WHY A;  3GJT B;  4U7U D;  5EGY A;  1JLA B;  5GAE U;  2NRE A;  5GMD A;  4DR7 J;  4FXV A;  4O0N A;  3UVJ A;  3DXB A;  1BHN A;  3NS5 A;  4LRA A;  4OHV A;  5AT1 B;  2Z57 B;  1Y5L B;  3ZZ0 A;  5KT3 A;  2R2S A;  1WG5 A;  3QT5 A;  1R89 A;  2V5H G;  4HL9 A;  2J5A A;  4PUO B;  1K1S A;  2RSQ A;  3EWG A;  1U1M A;  4ZPD A;  1Q4R A;  2HW3 A;  1NKC A;  4QBU A;  5C25 A;  4B9T A;  4IO1 A;  4CM0 A;  4CDI A;  5AE1 A;  2AHO B;  1UL3 A;  2HMI A;  2X1G A;  2HVE A;  2J0W A;  1AW0 A;  5KFN A;  3ZTO A;  1YIJ S;  2E5I A;  4WZQ A;  2DIU A;  4LMZ A;  2MZR A;  1S9E A;  4M5H A;  3HXM A;  4JI4 F;  5LMN F;  2HBR B;  1EX8 A;  4JI6 F;  3TVY A;  4J9P A;  2HBY B;  1SC4 B;  3IBC B;  2IMW P;  5LJ3 Y;  2E1M C;  4RW7 B;  4H4M B;  4WTO B;  1U45 A;  2HHX A;  2X7I A;  1H98 A;  2GJF A;  3U1M A;  4QWD A;  1GMW A;  3KK1 A;  1SJ3 P;  3NCP A;  2DD8 S;  3AD8 C;  3K8V A;  5A2Q U;  3CJ2 A;  3GG1 A;  5L1J A;  4FYW B;  1N48 A;  3R5B A;  4DSE A;  1N36 J;  1GT8 A;  3GTY X;  2V68 A;  3EGV A;  4P73 A;  1DAR A;  1N6Q A;  4G3I A;  1MN7 A;  3SCL E;  4K4Y A;  1WDT A;  3PRV A;  2RUS A;  1XN9 A;  5L9N A;  2HFU A;  4DWI A;  4ILL A;  2LDI A;  3MZI A;  4K4U A;  5CZC A;  3NBP B;  3AJD A;  5HMX A;  1BQM B;  4ITS A;  3KLG B;  5FII A;  1U2C A;  5B08 A;  2FLL A;  4ZPA A;  4DG1 A;  2QLW A;  2RDJ A;  3MCN A;  4DJB A;  3M9M B;  1KKH A;  3R5G A;  1LFW A;  4KGM A;  5HBM A;  8AT1 B;  2OAU A;  2PN6 A;  2XS2 A;  1HA1 A;  4CLZ A;  2ZH8 A;  1UFK A;  2F4F A;  4RKU C;  1S1X A;  3J7Z T;  1GK8 A;  4LJM A;  2J7U A;  1KSP A;  2DR5 A;  2E9Z A;  1OY8 A;  3BN4 A;  1ZOT A;  3ZTP A;  3CCE S;  4WF9 Q;  3BBC A;  4TXS A;  5E3P A;  1BQN A;  4OIX A;  3JTO A;  5F0U A;  4F3M A;  2VU5 A;  2GVD A;  1OY9 A;  1Y11 A;  4DBQ A;  4IFV A;  1EIY B;  2W9C A;  5KG0 A;  1HNZ J;  1WOR A;  1Z4U A;  2E7V A;  2XSF A;  5AJ3 F;  3Q23 A;  1S76 D;  1HIY A;  2X51 A;  4LT6 A;  1YKW A;  1Y5N B;  4LF7 F;  5IT9 U;  5KFL A;  1IBL F;  2VBY A;  2FJX A;  2UUC F;  2PSZ A;  3QRR A;  4PXD A;  3TJ9 A;  3MEC A;  1RT7 A;  1FD8 A;  3E2E A;  2CKW A;  4UUX A;  4M5M A;  4L73 A;  3LF0 A;  5KFS A;  4N56 A;  3V81 B;  1TL3 A;  4GKK J;  4TY9 A;  1UPP A;  3FSI A;  3MDF A;  3T5J A;  1IKX A;  3RB4 A;  3DLE A;  5HQL A;  4NXN F;  1RT5 B;  1YGY A;  2JOQ A;  2L3M A;  1U8W A;  2HRU A;  2OP5 A;  1F60 B;  2F40 A;  2W2N P;  4KQZ A;  3SFU A;  5HMW A;  2Q6C A;  3EPG A;  1KQS R;  3HUL A;  1YVF A;  2BXJ A;  2BKO A;  2FJB B;  3VR1 A;  1DTT B;  3H2L A;  1UJ6 A;  2KYX A;  2J8A A;  2MY8 A;  4YDD B;  2OPR A;  1U09 A;  2FVC A;  2XG8 A;  1VRU B;  3K5N A;  1AFJ A;  3B54 A;  4OJ3 A;  4ZJQ A;  2AJ2 A;  3PHT A;  1RAG B;  3WX4 A;  1YIT S;  1TK0 A;  2V2Q A;  1NK0 A;  4M5D B;  3MAQ A;  2J9D E;  2KXH A;  2H5J B;  2BAC A;  1N36 F;  2B8Q A;  2CDQ A;  3UCG A;  1ZH5 A;  2CG8 A;  4C98 A;  5EWG A;  4RO0 A;  3OSP A;  5CYJ A;  2YNI A;  2EFO A;  3AXK A;  3PEJ A;  5IM0 B;  4OI2 A;  3C16 B;  5LXY A;  1T02 A;  1HNI B;  1WSV A;  2HND B;  3KYL A;  3H5X A;  2WRM A;  2M3D A;  4FXD A;  1HFE L;  4I7F A;  5DG8 A;  4WTY A;  1M1G A;  2HHH F;  2PMW A;  4ICL B;  4PQU B;  1WI6 A;  1BWV A;  2LFV A;  2C3U A;  4MYU A;  2VBX A;  4OYM A;  1M5O C;  5D4L A;  2B4U A;  2D41 A;  2J0X A;  3BGF A;  4O4R A;  4FF2 A;  1AB8 A;  1MW7 A;  2XMU A;  3MWB A;  2KB2 A;  4OHW A;  1F6T A;  1Y3J A;  3MMB A;  5E33 A;  3F41 A;  3JQJ A;  4B9L A;  2XZT B;  2XMM A;  1IQZ A;  2V8H A;  2R2T A;  4QU6 A;  4M5G A;  5DDQ C;  2VOP A;  4N8O A;  4TLQ A;  3AOD A;  3BGL A;  2IDL A;  2HHW A;  3KUH A;  4DQQ A;  4ZCK A;  4AL7 A;  3OVB A;  4RWX A;  1CUL A;  4J90 A;  4X65 F;  1S0O A;  2BJ3 A;  4BCA A;  3KHR A;  4U67 Q;  3KK3 B;  2KM8 C;  2B9X A;  4DV7 F;  4OZ0 A;  3MUR P;  2XMW A;  2F7V A;  2BAN B;  1JXL A;  3G9C A;  2B6A A;  2QLJ B;  1GMV A;  4QQB A;  2MKK A;  4KC5 A;  2B0G A;  3I4H X;  3AJ1 A;  3FDS A;  2KT3 A;  2EFG A;  4MK8 A;  4PG4 A;  3FZB A;  5KFR A;  5KFT A;  3KLE B;  5EN1 A;  3TO8 A;  4B9N A;  1HWU A;  4LFA J;  4KPC A;  2KRR A;  4FZV A;  4DQP A;  2HGL A;  5EX3 A;  1PYO B;  1RU2 A;  4N5S A;  4CLP A;  1R8B A;  3LAL A;  1JJH A;  2CJ9 A;  3F56 A;  4PXE A;  2CA9 A;  3QO9 A;  4JI4 J;  3DOL B;  1V6H A;  3H4D A;  4GKK F;  1EP4 B;  1UP1 A;  1TKZ A;  5BYQ A;  4O3Q A;  1RAH B;  1QTN B;  3GYX B;  2MJN A;  2AX0 A;  3C14 A;  3LP2 A;  1N5S A;  3PFO A;  4M8L A;  4MFB B;  5HN0 A;  2IBO A;  4D3H A;  1N33 F;  1MSW D;  5HVG A;  2OPP B;  3PW4 A;  3DHX A;  1JNR B;  5F3Z A;  2VF3 A;  1C0U A;  1FWK A;  2CNK B;  3W8P A;  2ZM6 F;  4HI1 A;  3KNA A;  3OFE A;  1FJG F;  3CD5 A;  3Q8R B;  1S6Q B;  4RW8 A;  2C1E B;  3WIV A;  2GNK A;  2QLX A;  3OLB A;  3QT6 A;  1ZTW A;  2B43 A;  2H9Z A;  3TUZ C;  5L1K A;  3TYT A;  5HP1 B;  1TV6 B;  1LWF B;  1S1T B;  2M5Y A;  5KFG A;  1IN0 A;  1EET B;  4NLR A;  3BSN A;  1S10 A;  1FJC A;  3J80 Y;  1UTA A;  1TUG B;  2DHX A;  2KT2 A;  2RHQ B;  2WOM B;  3T1A A;  4E98 A;  3DGP A;  2HVI A;  1S77 D;  2HLT A;  3M8Q B;  4DI6 A;  2RVJ A;  2XUL A;  4IG3 B;  1T3N A;  4K4W A;  1X9M A;  1Q7Y T;  4UOH A;  1DY3 A;  2N3O A;  2L9W A;  2OMO A;  3A13 A;  1NRK A;  5LSL A;  1N32 F;  1DFD A;  1PJ7 A;  2LYV A;  4XTT A;  3VF0 B;  3GZ7 A;  4C8Y A;  3PNI A;  1VR6 A;  4KIA A;  5DZ6 A;  1RWW B;  3DCA A;  3J80 U;  3FSY A;  4NA2 A;  1JLB B;  1PJ6 A;  4FP9 A;  2ZBQ A;  3DU5 A;  1SJQ A;  4CLL A;  4P52 A;  1NK4 A;  3MM9 A;  3US5 A;  4RJV A;  1FRI A;  4FXW A;  3EJM A;  1B0V A;  1JLQ A;  1VFJ A;  3TI0 A;  2IAJ A;  1S0M A;  2CQ3 A;  5D15 A;  2Z30 B;  3GIJ A;  2ZH2 A;  3DDI A;  1OO0 B;  5RUB A;  5GME A;  4QWB A;  4GMK A;  1CJU B;  2VB6 A;  4DU7 A;  1Q53 A;  3HFZ B;  4MIB A;  4OYA A;  1VQK S;  1X0P A;  1IWA A;  2YWF A;  3PKM A;  4Q2M A;  2HK3 A;  4LVO P;  5KFC A;  4GVL A;  4DU8 A;  3GR0 A;  3H42 A;  1KP6 A;  2E1P A;  3THV A;  1LW0 A;  4ZVU B;  2KJW A;  1RAI B;  4PQA A;  3LWL A;  1A9N B;  4DR1 J;  1YJN S;  1JLE A;  3ILI A;  4CI0 B;  3TZW A;  2LDY A;  2KL8 A;  3HHL C;  4NZ7 A;  3ISZ A;  6FD1 A;  4DS4 A;  4H4O A;  2ZBR A;  3M9N B;  3MM5 B;  5LM7 E;  4ATN A;  2NLW A;  1R43 A;  1N56 A;  1HWL A;  4B17 A;  3DLK B;  3PX4 A;  5LT5 A;  1L3V A;  4DQI A;  2G2Z A;  3O6Q A;  3UR3 C;  1FEH A;  2H1Y A;  5KFB A;  4YB6 A;  2H54 B;  3OUY A;  1GTH A;  2CQI A;  3BR9 A;  3CJ0 A;  4ZPV R;  4JYA J;  4F7V A;  4DL6 A;  3AOA A;  2A3J A;  2D3O 1;  2CQ4 A;  3EMT A;  4ERD A;  4C8Z A;  2E9T A;  2NZ4 A;  4FNH A;  1K0V A;  4X4P A;  3OJU A;  1Q5V A;  2R2U A;  3CPW R;  3HHL B;  4DL0 C;  5KT7 A;  1X4A A;  2AV5 A;  2HS3 A;  3AD9 C;  3BGR A;  3OR2 A;  3W60 A;  4X62 F;  3LUY A;  1NHV A;  2P8I A;  2LEB A;  1JKH A;  2CQG A;  3OTB A;  5DO2 A;  3R7S B;  3MXH P;  3PXG a;  1J2V A;  2AWZ A;  2PA8 D;  2VKR A;  3N79 A;  4HT5 A;  4LQ9 A;  2VQE F;  4PCQ A;  2R7V A;  3CXC R;  4RUB A;  2R7R A;  3KG4 A;  2B5J A;  2AJ4 A;  1SV5 A;  4XAK A;  2CJX B;  2YWW A;  4B9V A;  2D3Z A;  4ED2 A;  4DLE A;  4A8K A;  2BE9 B;  1NSK L;  1RTJ B;  1FI4 A;  4I2Q B;  1MRO B;  5E3Q A;  4OZJ A;  4DV2 J;  1LWC A;  5KFM A;  2G2O A;  3QIP B;  3R6L B;  2VQF J;  1TK8 A;  4ANC A;  2ZEJ A;  4PG7 A;  2VL1 A;  3IWX A;  2V8V A;  3CJK A;  1KVI A;  4EMD A;  2E9R X;  1S1V A;  3ILJ A;  3ONQ A;  4DL5 A;  3I0R B;  1TFY A;  4HI2 A;  1PKU A;  3HVT A;  1R8H A;  2RE1 A;  3C6U A;  3HD1 A;  3TJA A;  3VTI A;  2VBZ A;  2W9B B;  3SSQ A;  2H5E A;  1FWL A;  3OR1 B;  3R3T A;  3VAK A;  2G13 A;  1BUX A;  1WF0 A;  3Q89 A;  5BYR A;  1JLF A;  3H5Y A;  4Q0B B;  3BF4 A;  2QSF A;  1CJK B;  2ZBP A;  1YJR A;  5J1E B;  2ASJ A;  4R25 A;  1OYE A;  5KFY A;  2ZH6 A;  2XMJ A;  5KFX A;  4DQR A;  3UDE A;  3HK2 A;  1HPZ A;  2HAI A;  4GVB B;  1RT1 B;  2GFF A;  4DUY J;  3M2U A;  2GVZ A;  3Q86 A;  4M94 A;  4R0E A;  3G4S S;  1T03 A;  3TUP A;  4DN0 A;  4X4Q A;  1KDN A;  4K0K F;  1XMB A;  4GKJ J;  3ZZY A;  2YPY A;  4IFY B;  1YJT A;  2ACM A;  4O4G A;  4EFA C;  1CLF A;  2D69 A;  1WF1 A;  2B9E A;  1TL1 A;  2IVM A;  2IVY A;  5EHH A;  4Y2M A;  3C6T A;  1N5Q A;  4DPW A;  3RAQ A;  1R0A A;  1S6U A;  4C8N A;  2AJQ A;  1RXO B;  1TL7 B;  2QZ8 A;  2B8P A;  1NDC A;  3IGN A;  3IBF B;  2PA3 A; 
#chains in the Genus database with same CATH homology
 2G1H A;  3TZZ A;  1NM2 A;  2QO3 A;  3TQE A;  3HHD A;  5DZ7 A;  2G2Z A;  4RR5 A;  3R97 A;  2VZ8 A;  3CJ8 A;  2H1Y A;  3HMJ G;  3QAT A;  2G2Y A;  3R8Y A;  3K89 A;  3SBM A;  3IM8 A;  2UV8 G;  2CUY A;  2G2O A;  4QBU A;  2QC3 A;  3RGI A;  3H0P A;  2HG4 A;  1MLA A;  3IM9 A;  3PTW A;  2JFD A;  2VZ9 A;  5CZC A;  3BV8 A;  3TZY A;  2QJ3 A;  2JFK A;  2PFF B;  3EZO A;  5CZD A;  3G87 A;  4RL1 A;  3HJV A;  3TZW A;  2C2N A;  5DZ6 A;  2VKZ G;  3TZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...