3CEDA

Crystal structure of the c-terminal nil domain of an abc transporter protein homologue from staphylococcus aureus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
SNADDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the C-terminal NIL domain of an ABC transporter protein homologue from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords Methionine import ATP-binding protein metN 2
total genus 24
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 3.6.3.-:
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09383 NIL NIL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cedA00
1LKZA 2FGCA 3OFEA 3LUYA 2LVWA 2RE1A 3OBIA 2QRRA 1ZPVA 3TUJC 3O1LA 2JHEA 2F8MA 4LUBA 1YGYA 2QSWA 2J0XA 2PA3A 3OFFA 4NMLA 1U8SA 3ENQA 3CEDA 3L7OA 3TUZC 3KWMA 3W7BA 4X84A 5IT4A 2I9SA 3U7JA 2KO1A 3N0VA 2NYIA 3DHWC 1UJ4A 2H9ZA 3MTJA 3S1TA 2RQKA 1LK7A 3OFGA 1LK5A 3MAHA 2DTJA 3IXQA 2JOQA 4IO1A 4PWUA 3P96A 2CDQA 1O8BA 3AAWB 2PC6A 2P9CA 3IBWA 3UW1A 5JJBA 1PSDA 3TUIC 3MWBA 2QMWA 1RWUA 3AB2B 2LQJA 4GMKA 3OFHA 3DC2A 1M0SA 3DHXA 2P9GA 4GO7X 2J0WA 4GO5X 3HHEA 3ENWA 2P9EA 3LOUA 1UJ5A 2ZHOA 3DDNA 3K5PA 2F1FA 3AB4B 2QMXA 1KS2A 3NRBA 2RQMA 2DT9A 4M8LA 2MDAA 5IS2A 5IT0A 1XTZA 5T41A 1YBAA 1UJ6A 1Y7PA 3ENVA 5FIIA 1SC6A
chains in the Genus database with same CATH superfamily
2F8HA 4OYIA 2W9CB 1OYDA 1HNZF 2FGCA 2RDDA 4F26A 2JDJA 3CB4A 2J6UA 5KFSA 3FQKA 1MLAA 2BYCA 3IS9B 1BQMA 4QIGA 5K20B 5DG7A 3AFGA 4KV8B 4DFMA 1H2TZ 1VI7A 3JSRA 1S72S 3E8OA 1U6BA 2W7OA 3NL0A 2HAFA 3Q8YA 2HPUA 5HMYA 1CULA 1P9YA 2FHMA 2MLYA 2MQPA 1Q8LA 1JLEB 1Q8BA 2DXEA 2VF3A 3BREA 3HSJA 4WU2A 3O1LA 5GAEU 2C2RA 2KU7A 2NUUG 4J9VA 3G87A 2IBOA 3VVTA 1FK9B 1FK9A 1WHVA 1AUDA 2I8EA 4P72A 2AGQA 5LSRA 3BR8A 4LSLA 1HI0P 2MMYA 1TFYA 4O0NA 5EN1A 3ULHA 3PW2A 1X4HA 5F3ZA 3OTDA 1IBLF 3ILOA 3ENQA 4YMEA 3HHLD 3OLAA 1VRQC 1WSRA 4DV6J 3GIRA 3N28A 2D3OR 1WTBA 3Q86A 3FDSA 5IT4A 3L3CA 3CCZA 1Q16B 4ZJOA 3RG6A 1QY7A 1GXUA 1D0EA 3GG0A 2Q1LA 5KAKA 1NJZA 4P7TA 1S0NA 4IOBA 1R43A 1HQUA 2NYIA 4K2JA 3SSQA 2MKKA 3L7PA 2YKMA 4KV8A 4J9LA 2CPXA 3MTJA 1SVDA 3CMES 3CUNA 3IS9A 1UA0A 4U7UK 1NK5A 4NLGA 4ZK7M 1DZ5A 1DTQB 4X65F 2KFNA 4DUZF 2Y9HA 3A8EA 3UCZP 1U1LA 2DIVA 2IC3A 4CZCA 5IT9Y 2M2BA 4YB1P 2ZM6F 1TL3B 5FDLA 3N6NA 1OO0B 2ROGA 3L7UA 4WYWA 1FFGB 3NGTA 4XO0A 3M9NB 4EEYA 2FLNA 2WSCC 4RX6A 3MM7A 1UFKA 4MKBA 4CTAA 3GFXA 3I0SB 4CLPA 2LXFA 4OI3A 5IM0A 2ZKUA 4F8RA 2QIFA 3UCUP 5AE3A 2GX8A 1NB2A 4LMZA 2DGTA 3M9OB 4ZCKA 3LPYA 1SUQB 2YTCA 1JLAB 3C19A 2WHOA 4OIXA 1VOMA 1B0TA 2AWZA 3D1QA 4OZ5A 1HW8A 4ZVOB 5HMWA 2FJWA 4B9NA 5HANA 2WRMA 3OR2B 5LMNJ 3CCQS 1OJ4A 3C15B 5ETOA 1H72C 5IQQA 4O3SA 1TR0A 1WNEA 1RADB 4M5DB 4TY8A 3I6PA 1F9FA 3IGNA 3RGIA 5DETA 3CDUA 4GKKJ 3MR7A 2AX1A 1NK8A 4LQ9A 4WU3A 1TAUA 3W5YA 2XHWA 2BE2A 3HD1A 5D15A 3GILA 1K1SA 5KFHA 3UD4P 1YJ9S 2RSQA 2H5JB 2AP6A 2G13A 4QW9A 1FJGJ 1MMLA 2CJAA 3QAUA 3GZ7A 4R5PB 1KHWA 4ZOSA 1WDTA 2JFKA 2MEWA 3I4HX 3MMBA 3P6YC 3C3LA 2NPIA 2EXUA 2RQCA 2AF6A 2QEXS 1RDRA 2I5JB 2GIFA 2OSQA 3AB4B 3UN2A 1XNRJ 2HQ3A 4DX8H 3CCJS 1XEZA 4M5LA 2BMBA 2FJBB 3MOZA 2DGVA 3OTEA 3SDEB 2DR9A 4K4VA 1KOOA 2VZ9A 4BC9A 4F3OA 1S79A 1RWOB 4C11A 2ZHAA 1UVLA 3CWJA 3QT5A 2V34A 2XGPA 1RT2A 1QTMA 1UWAA 3HO1A 1SI9A 2MSSA 2HFVA 1KLMA 2IRUA 3KLIA 2PDAA 5CD4A 1DHMA 4GC6A 2PEBA 1LQ9A 4C2MA 1VQSA 4DR2F 3ZTOA 1TVRA 3KK2A 4KHRA 4ZLNA 1SKSA 2G1DA 4PXDA 1S1UA 1HHTP 1HFEL 5DDQC 4ID5A 1KWMA 5HSPA 2R2TA 1YBUA 5D0RA 2OHDA 2ZOMA 3EVWA 4NEYA 2GMHA 4LFCJ 4RUBA 1CJUA 1NZ8A 3UVJB 3NP5A 4IFVB 3UWTA 3W60A 5C24A 1FTRA 1NK7A 2AZ3A 1KLNA 1XERA 3EGNA 2CJKA 4U96A 2H3EB 3TVZA 1N5TA 4O3QA 3B78A 3EICA 1RT7A 1EHWA 2DY1A 2VG7B 2NR0A 2M0GB 2RS8A 3OL7A 5E5NA 1KKHA 1YJWS 2DCLA 4PWDB 4OZ2A 1VQ7S 1S1TA 2Y3YA 5B0FA 5A8WB 4JI1J 4YOEA 3TI0A 1K73T 3I31A 2KRRA 3TVYA 1Y10A 4MMOA 1NCLA 5LXYA 3NOCA 5DDOC 1JJ4A 4DPXA 1JLGA 1X4BA 4RW9B 4ZIWA 2ROPA 3ILLA 2DYAA 2EFGA 4JV0A 1KR4A 4ECSA 4KPYA 1CEZA 4RW6A 1T11A 2QFIA 1HMVB 2LEBA 5EHHA 2VOOA 4IG3B 4R8UB 4HHUA 1VQLS 4AL5A 2P2CB 4X4NA 4P52A 1BQMB 4XTTA 5K8MA 4ZVTB 5KOXA 2MKIA 3WX8A 2XMKA 2ZBCA 3GONA 2WOMB 3DRRA 3W65A 3MR6A 3J7ZT 1VK8A 3SIPB 9RUBA 1K1QA 1WELA 2GS8A 1LW0A 1N5QA 1PYOB 2LQ5A 2QE5A 5KFLA 3T1YF 1GMWA 4BDPA 3VTIA 1HPZA 1RU2A 2XLKA 2G9OA 2LLZA 3N01A 3TOQA 3PEHA 4I68A 2GO9A 4WFYA 2BJ3A 4F3MA 2WVCA 4DL4A 2QL5B 3M30A 1MMDA 2UVUA 3PY8A 3GFHA 3NXZA 4Q45A 5J2QA 3PHTA 1UCNA 2POKA 3TUPA 1BGXT 4PWDA 4JV5J 2FIUA 1RABB 2JEIA 2GIQA 1AROP 1P8GA 2HK2A 2E44A 5CYMB 1QAXA 3IMQJ 3ZZPA 1F5AA 1M5VC 1GMWD 3UDCA 2V9WA 1D9DA 2HZAA 2AKWB 1GT8A 4M1KA 5DRKA 3QYYA 3HHNB 1KDNA 3CPWR 2GGPB 2D3UA 3BGOP 4LF8J 2XG8A 4CP5A 4PG4A 4J9RA 1PSDA 2LDIA 3M1VA 3MECA 1RQ0A 4J9SA 2IVMA 3TEGA 3ZTQA 2I0XA 4RW4A 1ZTWA 4WIIA 1YIJS 3R27A 1S76D 4ZPVR 3DMJA 1HWJA 1FVQA 3CJ2A 2GC8A 2KJWA 3A8KA 1L3KA 1KBRA 3MCMA 3MPUB 3HHLA 2M52A 3KK2B 1HW9A 4K0KF 1IKVA 1O6XA 2CYYA 3T9ZA 1R31A 1OSDA 2DITA 2J7WA 3U1NA 1XR6A 2X7IA 1RT4A 1KRPA 3KTQA 5CYQA 4KTQA 3D6TB 3NS6A 1SCJB 2VQFF 1BXNA 5H9FK 2J9DA 2LA6A 3GTYX 4IOAQ 3EVOA 3DFEA 3C16B 3PFEA 1H73A 3QGIA 1RTIB 4L76A 3V81A 3PW5A 2R7UA 4RBTA 1LXNA 3MM5A 2FY8A 1MN7A 2HZVA 1PBUA 3LQVA 4UOHA 3C46A 3ZTSA 3ZXWA 4OLOA 4RW7B 2HVDA 2W8KA 1LV5A 2DXFA 2CQDA 1YQHA 4X4UA 2R9LA 4HDHA 4DS4A 1RLCL 2WONA 2DH7A 3I9ZA 4IH6A 3R3TA 5HO4A 2COLA 3D3BJ 5KG0A 4CT9A 2G0IA 1YRTA 4ICLA 3Q89A 2BOAA 1NH8A 3MCSA 2HS0A 3EGVA 3EYZA 1V5VA 3DLKB 1SJRA 4N56A 2YKPA 1KQSR 5A8KA 2M9KA 2QLBB 4OJ3A 3GFZA 2UV8G 3OHBA 1FWLA 2GHPA 2Z2LA 4EUVA 4XPCA 2R2SA 2J0SD 2NZ4A 2GFFA 2HHTA 2V8GA 2I5JA 4DMZA 4PQUB 3HD2A 1IJFB 3B82A 1NPRA 2GAGC 3PR4A 1OQ3A 3PEJA 4IYQA 4RJVA 5F41A 4ZHRA 4B9MA 3D2WA 1ITPA 1ZM3A 3NAIA 2WVEA 3C14B 1N8RT 2W24A 2V4RA 3K5LA 2FVPA 1HYSA 1RTIA 3RBDA 1NXIA 2CJXB 2HK3A 2WB4A 4M5HA 1T9WA 2RAQA 2V63A 1S9EA 5FLXY 3J7YI 4PG8A 2O66A 4PPDA 2VG6A 4DV0J 4DUYJ 3DOKB 3H42A 2SXLA 3VWSA 2LA4A 3JTOA 1RWNB 1D09B 2IM1A 4JI4J 2W25A 1T9XA 4PG7A 4FYWB 3TWZA 4G1QB 1SJFA 4OYBA 1FKAF 3G9CA 1A6LA 1UAWA 3W2WB 2ZH4A 1FX2A 1VIOA 3DDKA 2CWKA 4Q5VA 2KVQE 4DX7A 2DK2A 1NM2A 1S6PB 4X4PA 3KHRA 4JBCA 4V1Ak 3VZIA 2AU0A 1NMEB 1NLKL 2CG4A 4EFAC 2KHDA 1ELOA 1YSJA 3HX9A 3W61A 4HI2A 2CPFA 1RTHB 1W2IA 1T03B 1HNWJ 3CF5Q 1F60B 2YNHA 3HP6A 5J2QB 4LVNP 4YR2A 1C1CB 4A46A 1T02A 1MSWD 1WHYA 2HZCA 4ZCMA 2M4MA 2JLGA 1Z4UA 1YJNS 1GNKA 3QATA 4LSNB 2R7OA 5ETMA 3WDOA 3JB9k 1RTJB 4DUZJ 3JSMB 2AGPA 3A3PB 2BABA 2DO4A 1X4EA 4FVCA 3SSSA 3JSBA 4UZCA 4IRCA 3SV3A 3HULA 1X4AA 2V4JA 5DDRC 3CCSS 5H9FJ 4C8YA 5KTQA 4DR6F 1V3ZA 4N77A 3GU0A 4F0MA 4YR0A 4JI4F 1U49A 1F9EB 1Z2LA 1XNQJ 1S7HA 4NLDA 4ZVEA 4IG3A 1G3OA 1RAFB 4R8UA 2DO0A 3IBWA 4NMXA 4OYXA 4UUXA 2Z58B 4GC7A 1FVSA 1WC0A 4NLOA 2QLJB 4PPZA 2UVRA 3HZEA 5B0BA 3SQOP 2V8HA 4TU8A 3CD7A 3EMTA 2QSFA 2U2FA 2VPWB 2YPZA 3WX4A 1OPIA 2RMLA 4RLEA 2MQLA 5C42A 4YFUA 1H2UX 2FLOA 4K59A 2B4UA 1Q8IA 4DV0F 3IN5A 3GJSB 4NZ0A 2X1FA 1S1TB 2HFSA 2HS4A 2WSEC 3AT1B 5ETSA 1C1CA 3AA8A 1CVJA 1M0SA 4LRBA 3W3SA 4F4WA 2LQBA 1AZSB 1RTDB 3OD2A 1HNVB 2Y0SD 4OJ1A 4A8SA 3KNAA 2J0WA 1AXQA 2ZZNA 3GCWP 1JIHA 2D74B 4RW6B 4RNFA 4ECYA 3LP0B 1FDDA 1S4EA 2JFDA 5L1JA 4G1QA 2IMOA 1JLGB 2AYBA 2HWIA 1YI2S 2ZDOA 2U1AA 3Q2TC 5DM7Q 3IRXA 5KFYA 1Q78A 4WE1B 3P5BP 4EBCA 1WI6A 2RS2A 1UA1A 1S97A 3RRGA 1MNEA 3H90A 3GJQB 3H7HB 1K0TA 3RBEA 3T5LA 3JAMY 4G1PA 4JI3F 3H98A 2NSCA 4KT0C 5D0HA 3PW0A 3J7YU 3HVRA 2AMCB 1F3FA 3KG0A 4ETZA 5CD4H 2XGQA 5F9NA 4TVAB 2BJDA 4URSA 4ETXA 3TAQA 5EDWA 2LXUA 3LTOA 4YUDA 4OJGA 3OW2R 1D8YA 1H74A 1BWVA 5D0EA 1TFWA 2BOPA 1UMJA 1HD1A 1J5EF 2VC1A 3R7NB 1W7WA 2AZ1A 4I7FA 4YS2A 1WI8A 4ZS6A 4CCHA 4LF7F 3QT6A 1AUSL 3AJ2A 5CXTA 3MMCB 2OMOA 3OTBA 3UNGC 1DTTA 5AXMA 4DEZA 2ZH8A 3CCVS 4DV4F 1LKZA 4OHVA 2F8EX 1M1KT 1PAEX 3QAEA 4QU6A 2Q66A 5KFZA 4PKDB 3B54A 1FKPB 1H2VZ 4PXCA 5KFMA 3M8ZA 3ZTPA 7FD1A 1AW0A 3QZ8A 1XQIA 1RBLA 1REGX 3VAHA 1NU4A 4LRCA 5KFBA 3VALA 2GCFA 4NLWA 2HQIA 2HRTA 5KFIA 4BCAA 2OKQA 2FYXA 4BLGA 1X5PA 2WBRA 2RILA 1QSLA 4LUBA 4ILRA 2HNYA 4USVA 3UCGA 1NZAA 3GSDA 3RAQA 2DBBA 4KIAA 2W2NP 3MMCA 3LALA 1U8SA 3PNIA 2OI2A 2W2MP 4IO9Q 4N7TA 2QTWA 2FJDB 1S49A 2CADA 4WPAA 5E3CA 2H4YB 1HBMB 1W26A 3D68A 2F4VF 3MXHP 3MFIA 3V6DB 3IR6B 2KI2A 3BKUA 3FQLA 1TTHB 2I1RA 3QFWA 1LOUA 2KYXA 2KM8C 2DGQA 2BACA 2N82B 2LKZA 2H9ZA 2HBQB 4YY3F 3LGNA 1SJ3P 2HFNA 5HJYA 1HI1A 5DM6Q 5ETPA 3S1TA 1LK7A 4WFZA 4M5GA 4M63A 1OSCA 1X4FA 4KSEB 1EQMA 4M5DA 4TY8B 5F0UA 2IAJB 3BO2A 2ASDA 4KC5A 2DTJA 1IXKA 3R9LA 4X62J 1AYEA 2AJ1A 4U67Q 1OWXA 3A1YG 1RYSA 4PWWA 5DJBA 1PC5A 2IDLA 1J5OB 2FJVA 2JH3A 1SQFA 1V6HA 2IA0A 2HHUA 3EWGA 4FYVB 2B9EA 2OFGX 2VFUA 1X0PA 1EIYB 5E2QA 3ETMA 1S1WA 5A6PA 2P9CA 2DH8A 3MUTP 1IM4A 3M8RA 4ES3A 2ZBQA 5AXNA 3THPA 3C6TB 3M2RB 2KG1A 4NXNJ 3E01A 3V5RA 2N7CA 1T9YA 2K7JA 5C42B 4YR3A 4LBPA 5GMEA 4ZVFA 3L9ZA 4QW8A 4ED0A 2IY5B 2HS3A 2KN4A 2PFDA 2DNQA 5D4OA 2VQEF 1XBWA 5E3QA 5KG7A 2B6AB 3I87A 1VQ9S 4B3MF 4GMKA 3H5XA 4KYZA 1R0CB 2AJQA 4C4WA 3RBZA 4LBHA 4WJBA 4JV1A 1HNVA 1ZM9A 4TKTA 2YKAA 2ZD1A 1Y4ZB 1U25A 5IZHA 3DI6A 1R6VA 2DNNA 2R7RA 3HVTA 3CJQA 3KK1A 4KHPJ 5BR8F 2RNEA 4RO0A 2RQ4A 1UJ5A 3TNVA 2ZJRQ 1FJ7A 3O8WA 4FF1A 4MAKA 2F4VJ 3NBPB 4ED6A 1FDNA 2HQGA 3BGRA 4OX6A 3E01B 2VKZG 2DXDA 2DNMA 3MM8A 5E7OB 3FSIA 3R1LA 2WTFA 3QIPA 1CULB 1CQMA 1VQ4S 2RQMA 4ITSA 5K8OA 1DY3A 2XULA 4JYAF 1ULRA 2O5DA 2L9DA 1SH2A 3SSRA 4KHPF 2JRSA 4MTPA 3TP2A 1JLEA 1URRA 2JEFA 1WG1A 2GHWA 4RBVA 1IJEB 1RP5A 2H5EA 5C7PA 5IS2A 5DGAA 5HVGA 1NK0A 2NXJA 2ZH3A 2UUCJ 3JXOA 2EFPA 2HIYA 3QMQA 3IAS9 4FPRA 4OLPA 5C5JA 3MM6A 1DLOB 2RRNA 1Y7PA 1V5IB 3EXCX 1UPPA 1IKWA 3GG1A 4ID5B 1JLQA 2KT3A 3QRQA 4DSKA 2DNLA 1RTJA 1NSKL 3UN3A 3FSYA 4KGZB 2GIRA 2MPUA 4FP9A 5DS7A 4AUKA 3VAMA 2EVZA 3ADAC 5GAEI 1FRLA 3E2EA 3TANA 4HH1A 4DV3F 1OY9A 3KUEA 3W9HA 4ECXA 5KFRA 5GAGU 2E9TA 2BANA 2J9CA 2LCWA 3PCOB 4NYZA 4H4KC 3HSZA 2RE1A 5L39A 1XWLA 1RT3B 5KG2A 1K44A 3P4UB 3BO4A 3N5BA 2R8IA 1H38A 2ZZMA 4NZ7A 1UPMB 2ZH1A 1S48A 1AA1B 3P3DA 2UUTA 4ED7A 3DCAA 1YGYA 1U09A 2YNIA 3PFOA 2CQGA 2XLIA 2HBYB 4J91A 1RYRA 4Y28C 4P9SA 3BSNA 2XEXA 2JVRA 3EX7B 5KFEA 2MJNA 1IBKJ 2YNGA 3R1HA 2EC2A 2YVSA 2BM0A 4N8NA 2BBEA 5L1KA 2VH7A 1D8ZA 3KNGA 3OXGA 4C7QA 2UUBF 4I0WA 4ECVA 4NCBA 4WKRA 3A4TA 1IBLJ 2BQUA 1MG7A 3EXYA 1WEYA 4N47A 1F3VA 1QE1B 1FTCA 5IWAF 1U4BA 2VJVA 4C8LA 3NS5A 1R8BA 2CQBA 1VRTA 3RB0A 4J37A 3WIVA 2NSBA 5LJ3Y 2CNLB 5DZ6A 1UTAA 2DNYA 2XMTA 4WFAQ 5AXKA 4UOFA 4L74A 4AL7A 2F7VA 3KJFB 4FNHA 4CTAB 3KDOA 2HHHF 3DRSB 2IRYA 4D3HA 2OJ3A 1RT6A 2V0NA 4KO0B 4K5RA 4PZVA 2YH0A 1NH7A 3H4BA 2IYGA 4M5MA 4DR5F 1FKPA 2XY5A 1FI4A 3QWUA 4OV6A 3P8BB 3BQ2A 1YJRA 4OX8A 5I4MA 2MHNA 4DSLA 4NXMF 1UEVA 2K3KA 3TA0A 2CJYB 5ETKA 2VG6B 4HT7A 3RBXA 1HQUB 1HWLA 1ICEB 3AY0A 3UPFA 3KHGA 3ICLA 3TJAA 4CO4A 4C3KA 1DURA 4DG1B 2VHGA 2MY8A 2ZOFA 3TZWA 2Y1LB 1CS4A 1HLWA 2VUGA 3LP0A 4OZ1A 2H51B 5K14B 3FRZA 1HQEB 1WEZA 3DHXA 3ZZZA 3DM2A 4DQIA 4JI1F 3R6LB 5LM7E 2P9GA 1MW7A 4NE9C 4DV6F 1S9GB 4I2PB 3W5XA 5J2NA 1QTNB 1JXVA 4FNIA 2E5GA 2LMIA 2UUAJ 2PEHA 1J2VA 3FC9A 4OQJA 3DDNA 2MQQA 1QAIA 3K5PA 3BJYA 3KMQA 3UFCX 3M8YA 2UUAF 4WFBQ 3V4IB 1W25A 4O44B 4O0IA 1UVJA 2HLUA 1PJ7A 3MECB 5HQLA 1NK9A 4X2BA 1LWCB 2ZUGA 2DHAA 4PG6A 4X64F 1LW2A 1Y5IB 2XZTB 1WOOA 3M8PA 3W9JA 1K47A 2HWTA 1VJWA 4OYOA 4PAAA 1U0SA 4G65A 4RKUC 2AX0A 4RW7A 1NSAA 2DR5A 5KT4A 1MU2A 2FC8A 2RIJA 2NXUA 3BKFA 2Q6BA 5ETLA 3J7Z5 1OMSA 4B9TA 4RL1A 4K4TA 1L3VA 1N32J 3WIUA 2K06A 2XC9A 1SC6A 4DX6A 1RBOB 2X3GA 2HHPA 2NZCA 3W9IA 3TAMA 1RCXB 2VFSA 5CCLA 5KFNA 2V8DA 3KDNA 2B51A 3SV4A 2XI2A 2ASLA 3WQPA 1EARA 1RAOA 3HSDA 4OI6A 3W2VA 2KM8B 4UY8T 3TX8A 4JUZA 3C6TA 1N32F 4JI7J 2I2YA 1SPBP 1WJ9A 1RT7B 4B3SJ 5LOQA 4O3PA 1PKUA 5FD1A 5HN0A 1GXTA 1CC7A 2M5YA 4A8KA 3FJ2A 4M5NA 5EX3A 2AYMA 2OD6A 1XK8A 5HAOA 3G8TA 2YQ1A 4ED4A 4J9QA 1HNIB 2RKIB 2C22A 3EM1A 1RAJA 1DLOA 4I6AA 4JP8A 5J1EA 1RT5A 1X9WA 5B0CA 2E66A 4MT1A 1TKTA 2R3VA 1Q5VA 2PSZA 3DLGB 4U6PA 3T1YJ 4C8OA 2EW9A 3HHLC 5KFAA 2IAJA 1RT1A 1CSJA 3K2YA 1WC1A 2VPXB 3TUZC 4B3OB 2M7SA 3A8JA 4S0MA 1S5ZA 3UR3C 4FBUA 2VOPA 1JLCA 3TEHB 2DIUA 3BEGB 2QG9B 3GYXB 4WKYA 3PO4A 2H1YA 1S99A 1RWPB 1WWHA 1FA0A 1S6UA 3MMAA 3T5KA 5HP1A 3S6EA 2FZGB 2AHOB 4I2PA 5AE2A 3PZPA 1WF1A 2A0FB 3DOMB 6FDRA 2OD4A 5C2CA 3DHWC 1B64A 1JQGA 1L3TA 1UJ4A 2RHSB 1LW0B 3CD5A 3JAMU 2E1CA 5C24B 1PJ5A 1BMQB 2YPYA 4B3TF 1HYSB 1KEKA 4YY3J 1B7FA 1VLOA 1FO1A 2MQNA 3GIIA 1RA6A 3OT9A 3HI9A 2OPRB 3R8YA 1P1TA 4USTA 3GIKA 1N36F 1B0VA 4O23A 5CZXA 5EWGA 3NGRA 2R8KA 2ZUAA 4JI3J 4Q0BA 1RSCA 2KDOA 4DR2J 1LWCA 1RA7A 1WUUA 1PILA 3Q23A 4TYAA 3THTA 3M6WA 4JB8B 4QPTA 4YP3A 2WB1D 4QYZK 4H4KA 3JYTA 2CDQA 2PC6A 2RRBA 5JJBA 2WONB 2Y1RI 2PI5A 5F8NA 4MK9A 3H2VE 4OYWA 3H8YA 4OHZA 3ZNJ1 5KFKA 2XS5A 3TUIC 2MQ8A 4CLLA 3CXCR 3DLEA 3DRXA 4I2QB 1EKSA 4QWCA 2JL9A 3OJSA 4RU2A 2E7WA 2HYIB 1SL0A 4B3SF 3WC0A 1HA1A 1N5SA 2VPZB 2Q43A 2JX2A 2MKYA 2DCUB 3CDEA 3GP9A 1S1VB 1I51B 2E1PA 3HCXA 5DZ7A 5T14A 3OXFA 3PO5A 2F63A 5K14A 1X9MA 1RAGB 4F4XA 1JNRB 1WHWA 4I7FB 2ZE2A 4LR7A 2UXBJ 3LP1B 3D0HE 1WD6A 1Q86T 5IM0B 4IFYA 1WTFA 3BS9A 5E3AA 2Q6CA 2B56A 5BYRA 1L3SA 1R89A 2VG5B 4X4SA 1Q1KA 3KYLA 4CH7A 2NXCA 3R7SB 5A2QU 2GQCA 3QZ7A 2UXBF 1RGVA 2ZJQQ 2E9RX 3JYTB 4FZVA 2A1BA 1PYTA 2V5HG 2IJRA 2V2QA 3OR2A 1JX4A 2XZDB 1FD8A 3GFYA 3OTOF 3FBEA 1ZETA 2YKMB 3BGLA 2UXCF 3GCXP 4DV7F 2QYGA 4M94A 1R8HA 2ZC4A 4AQYF 4V19X 3QJLA 3CT9A 2WSFC 3IR7B 4G1IA 2Q3PA 1SB6A 2IDEA 4DPUA 3NMAA 2MDAA 4USIA 3DN9A 2LXIA 3LA0A 2KTQA 4NCGA 4ZPTR 2UUCF 2XQCA 4DZ6A 4W92B 2JNJA 2YKQA 2HVHA 4G3IA 1A0OB 3VHQA 5KG5A 4LFBJ 3POTB 2XCAA 3HM9A 1VC5A 4N5SA 1S0MA 2CFXA 4OJHA 4FYYB 2IC3B 3NEKA 4JI0J 2AJ0A 3BGUA 2ADCA 1B3TA 4WIQA 1X31C 2IRXA 1IBCB 2HMIB 1SQEA 2LVWA 3EZOA 3JQMA 3NOGA 2OTJS 3NY0A 2A18A 3AA9A 7FDRA 2MKSA 1PIEA 1JJCB 3C15A 5KFUA 5B08A 4NLYA 2E1AA 1ZM2A 1V9OA 5HLFB 1FJGF 1SUQA 2FPHX 2JEGA 2F8MA 1SL1A 4P71A 2G2ZA 4LSNA 3W64A 1G7CB 2B9WA 2V4JB 4LF5F 3RR8A 2XWXA 1N5YA 3OFFA 2ZFHA 2XCPA 3C66A 2XI3A 1FRHA 3FZBA 4Y00A 4KFBA 3CEDA 1IKYB 4OX9F 4LJMA 4Q43A 2VQEJ 1JLBA 2FHKA 3KWMA 3UDEA 5LSLA 4N8OA 3DLBA 3O6QA 4PABA 5IFMA 2GJ2A 4OHYA 4QOTA 2I9SA 1HHQA 2VASA 1WG5A 4CO2A 4Y0FA 3PACA 1N33F 3AJ1A 1T03A 1FWPA 1VQYA 1FRXA 1KFDA 3MEGA 3TA2A 5I42A 1VQ6S 3OVBA 5IWAJ 2HGLA 2RH3A 3IG1A 4K4SA 2ZOGA 3ILIA 3MAAA 1IR2A 3PW7A 3CJ4A 3KK3B 3J7A1 1SC3B 1Y5LB 2IHR1 4QWBA 2ALZA 1S10A 2MSTA 2ROEA 2RUGA 1HNZJ 3IAM9 4EI2A 3GB0A 4KQZA 4HH0A 4OV1A 3OFGA 4E98A 3VGUA 2D3O1 1RHRB 1J5EJ 4DJBA 4H4OB 4CDIA 1JLBB 1AZSA 2LYVA 3NS7B 4NLTA 1RI7A 7AT1B 2E5LF 1WOSA 3N6LA 4L3NA 2ZITA 5J1NA 2MQMA 4AT1B 1F0XA 3ZFVA 2BUNA 2DNRA 2W1BA 1O8BA 3R5CA 4NLRA 4BHQA 4IFVA 3GIMA 3QT7A 2PD1A 1A7GE 4IQXA 4J9PA 5GVQA 2NUHA 1PCAA 1RKIA 2D9OA 2YWEA 1U0HB 3RUBL 2OUGA 2JEJA 4F4KA 3VCDA 4I2QA 5IXUA 1FE4A 1VHFA 1U2CA 4NLQA 4XAKA 5GADU 4R0JA 3M32A 1M5SA 4KE5A 4RPFA 4R5PA 1KN6A 2ZWPA 1UW9A 4U9RA 3L4BC 2Z8QA 2FTRA 3MTKA 4LRAA 4ECTA 2V69A 4U95A 4GVBA 4Q44A 2O3DA 4WFXA 2W7PA 3EUNA 3BSOA 2B5JA 1QVGR 4ES2A 4C8ZA 1AT1B 2C3UA 1G4CA 2YWHA 5ETQA 4LF6F 4B9LA 3LH2S 5T7LB 4DL0C 1H7XA 1ZZNA 3MZIA 2EPIA 3M2VA 1CC8A 3QNWB 2DNHA 3PRBA 1XNRF 2XS2A 2CKWA 1DQ9A 2Z2MA 4KGXB 2AQ4A 2DHXA 2EG1A 3LGHA 3NRBA 4O4RA 3D5MA 3D9BA 3EZ5A 4X64J 1NB7A 2VV5A 2MKJA 4ED1A 4QU7A 5ITHA 5HP1B 1B7YB 3R6GB 3ZZRA 1GFWB 3BF4A 5LL6d 1S6PA 1R8AA 5IC6B 1IKXB 3ISND 2X51A 1H7WA 2VKRA 3QGHA 3K89A 2FB0A 2OELA 3BDEA 4DR1F 1N4LA 3PYGA 4X4OA 3D7SB 2VC0A 3W62A 4K8RA 4P2XA 3G8SA 2C28A 4GKKF 3DU5A 2F40A 3TVKA 3DU6A 1ZBTA 2B5JB 2N3LA 2LFVA 2HW3A 5A2QY 1F2HA 2FZCB 2HAIA 2V2VA 3BH6B 3MM6B 4ZVUB 3SQGA 2VJUA 4C0BA 4PUOA 4HI1A 2GVDB 4IG0B 2FQQB 2J9EA 2W01A 4I6WA 4JI8F 3SFGA 4RU9A 1YK9A 5LXRA 2VD3A 4CO0A 1XMQJ 1XMOJ 2VA3A 3PYFA 3VQSA 4MKVA 1S1VA 1B99A 2QMUB 5FDLB 5JXSA 1EB0A 2DGXA 2CUYA 2XYGB 3SI8A 1JWWA 2ZH7A 4PQUA 1P9QC 2J0XA 1I3OB 2PA3A 3SFUA 1M1HA 1Q95G 4BS2A 4CH1A 2BDPA 1DTQA 3Q8SB 2UP1A 1R6YA 2BJ9A 4WYLA 1VISA 3W63A 2CG8A 3O5TB 3FK4A 4P2MA 2B8PA 2X1BA 2DHGA 2EK1A 2F3JA 2GQQA 2XMWA 4IRKA 5LSOA 3W66A 4IH5A 1C4CA 4C0HA 1AFJA 3DYAA 3R5DA 2UVWA 4CLWA 2DPIA 2HFZA 1NJXA 2V68A 1IR1A 4YB7A 3D6FB 2P5VA 3OTCA 4ECUA 1P6TA 1Y3KA 3H59A 1ACMB 2B6AA 4YHHF 3CC2S 1G1XA 2M8HA 5H1SV 4L6V3 1RKJA 1M5OC 1S7IA 1PC4A 1TKXB 3QO9A 2LU1A 2MJUA 4DCJB 1CPZA 4IR1A 5DLFA 8RUCA 3CD0A 3K5NA 4DU7A 4JI6J 2F65A 2FHOB 3S01A 5DGBA 4JOUA 2DR7A 1WEXA 4HACA 4F3QA 2QLWA 4FXWA 3OSPA 1E6YA 2G2YA 1NAQA 4H54A 3Q8RB 2XSJA 1FNXH 1VQOS 2AEJA 3IRWP 3P96A 5HMZA 4ERDA 3RTVA 1CJUB 1U45A 2O01C 1BLUA 3M8QB 3QBCA 2MXYA 1TV6B 2LDYA 5L8RC 3TQEA 3MUVP 3CMAS 4FYDA 3BSAA 1NDPA 2ZJPQ 4I67A 3KK3A 1HQ2A 3D28A 3T1HJ 2D3ZA 2BR0A 1VMBA 3Q8QB 4F50A 2KFYA 2QFJA 1TL1B 2RRAA 3RB3A 1FNOA 3BZQA 3QLHA 5HLFA 1N52B 1C2PA 1U8WA 2ZWOA 4KR0B 4W4MA 2HGMA 4ZPBA 3DNCA 4Z7YA 4X66J 2XY6A 1R3NA 2MKCA 3W1YC 4Q8FA 3R5JB 1V3RA 1S1UB 1U6ZA 2W7AA 5DQGA 3H40A 1CJKA 1TAQA 3I32A 5MLCV 4GO7X 3SCKE 1D1UA 3PRDA 1RWMB 3DLHA 2D41A 4LF9J 3P49B 4HLBA 4J9OA 2D9PA 2ALYB 3VZHA 2HNDB 5L1LA 4TU9A 5ADZA 2QA4G 3TAMB 2HBRB 4ZN1A 5L1IA 4DL3A 5EUHA 3MR3A 3HFZB 1QLNA 1JXEA 1O0PA 3C6UA 3R97A 4YB5A 1YJVA 1K9MT 4KGVB 4NI2A 3VR1A 1IM6A 3ZZTA 4CYUA 4YDXA 4MFBA 3DYAB 3KOAA 1KC8T 2HRUA 2KKHA 2ASYA 5BYQA 2J0QD 4X65J 4USHA 1S0OA 4OZJA 4GVBB 4O44A 2J6TA 9ATCB 3GR1A 3ET6A 5GAGI 1OY8A 5BJRA 2XO6A 1NK6A 3H5UA 2DVIA 3HJFA 4RW9A 4RUCA 5AJ3J 3AXKA 2C2KB 4PCQA 1ZYQA 3NWRA 2W9BA 1RU1A 4DR1J 3GJRB 2BW2A 4Y34A 4DR5J 4HT5A 4Q2LA 1T3NA 4MYTA 1RLDA 4NCGB 4MIAA 4P73A 1FCAA 1BQNB 1VFJA 5L9XA 3M2UB 1MWYA 1FF2A 2QN6B 3HVWA 5C25B 5C2GA 1S77D 2FZKB 1RWWB 4PUOB 2QA1A 1VQPS 2A6MA 3ILJA 4Q7AA 2XB2D 4J9NA 1BUXA 3DLKA 3EDQB 3JS9A 4IDKB 3N6MA 3FZ2A 2MZQA 3MPVA 3UVJA 2HKEA 3UR0A 1C0UB 4W98A 5F8GA 3BQ1A 2B8QA 2CPHA 4OZ0A 2BKPA 5CH7B 2QL7B 3HHKA 2XHCA 5HK4A 2QSWA 1SKUB 2UV8A 3MM7B 2KG0A 4DR4J 1S59A 2NLWA 4C48A 2IPOB 4XDDA 4DV2F 4O3NA 1HBUA 1N5YB 1JLQB 3QSYB 2R7VA 2H48B 1YRXA 2OSRA 2P6SA 3I9V9 1VQ8S 5KFJA 3L7OA 1T8EA 4DQRA 1GAOA 3UQSA 4URQU 1NNDA 3W8PA 4QBUA 2CNNB 1HL6A 2PGCA 1QDUB 1U1OA 1LXJA 1G6BA 5AXLA 4ANDA 1S4FA 2VL1A 3PXGa 4KKOA 2YH1A 5HL7Q 4OZNA 2MYFA 4DPTA 1WC5A 4ZIVA 3T41A 2A3JA 4DV5J 2R7WA 2BQ3A 3D0IE 3NCPA 3U1LA 5E41A 3AOCA 3K17A 2J7UA 1IBKF 4RUHA 4KJIA 1LNQA 4C9DA 1H0HB 1WC4A 3BPDA 4ECWA 1I5OB 3PX4A 1IKYA 1L5UA 3ETOA 4NLUA 4K2XA 2R2RA 2FUG9 2UXCJ 4Z2XA 1SV5B 1XR5A 2BZ2A 5GAHU 3GV7B 4F4YA 2BE2B 2E5LJ 3CJ8A 1UVNA 4NYOA 3DGPB 4DCOB 4EYHB 1GK8A 4JI8J 4OHWA 4LF4F 5J2MA 2G0JA 2ZH5A 4RUAA 1RE1B 3HLUA 5J1PA 4A8MP 1CJVA 4P7VA 1TKZA 2D69A 2Z4PA 3I55S 3SZ2A 4ELUA 2C2MB 4LFCF 5BXIA 2RDIA 2CWXA 2E7XA 4LIWA 3HKZD 3JSMA 1RAEB 2B0GA 3F41A 2QMWA 3J80Y 4ED8A 2YWKA 1VK3A 2XMMA 2QT7A 3HF5A 1JNZB 3QFHA 2LP4A 4LF2A 3OSNA 1EQ0A 4P2FA 4JV2A 4TXSA 4Q2MA 4ZP9A 5LMNF 1BE4A 3IM9A 2WVBA 3NLCA 1ZPWX 3C2PA 1BC6A 3HSGA 5IV4A 4GO5X 4USKA 4OFZA 4X4RA 1RWVB 2CJ9A 3E51A 1TZ0A 2P9EA 3NGUA 3W2VB 2FHJA 2RJZA 3LGMA 4K7QA 4DUYF 4NX9A 3RB6A 2PI4A 3SCJE 5KFXA 2KFZA 4DR3F 4PEOA 5J2PB 3PYDA 2APOA 3VGVA 3KLEB 4IUFA 2L3MA 3MEDA 2LQ8A 3BM7A 4A48A 4DDFA 4IQMA 3Q2SC 3VAKA 4DLGA 2UU9F 2K1RB 2J9DE 3CMQA 1FDBA 3EE3A 3KG4A 5AE1A 4FS1A 1FE0A 4UTGA 1X5TA 1VRUB 5JUMA 1LW2B 3HZGA 4QWDA 2W2PP 3QWPA 4JI5F 1BWEA 2YY3A 3HMJG 3CC7S 2V8VA 4DI6A 4LRDA 4O3RA 1WKKA 1TL7B 3B4MA 3DRYA 2DKOB 4J9UE 3TX0A 3HVTB 2MQOA 4A8XA 3ISNC 2YNFA 4RW8A 3FFIA 1TK5A 1X5SA 1S6QB 3BGRB 3J81U 2ZD1B 1S0VA 1KP6A 4KKOB 3VAJA 5F8JA 4JI2F 2GHVC 2V6AA 3BBFA 3K5OA 5GADI 4Y2IA 4YHHJ 3PIPQ 3BGFA 3DRRB 2CQCA 4LBIA 4LF4J 2HVZA 1KHVA 3VVUA 5J2NB 3KLFA 1NKBA 4NXMJ 1ZAXA 4OHXA 3K8VA 4WWSA 1FFSB 1QUVA 2M88A 3ENAA 5KG4A 2RDJA 5D3GA 2YX4A 3LP2A 4WXWA 1HBUB 3V4IA 1SKRA 4LF9F 4M5KA 3U1MA 3TUJC 2O1PA 2NXEA 3O3LA 3VV2B 1QUPA 1DQAA 4CO5A 3R2DJ 2HQFA 1TL4A 5E3PA 3AD9C 1MROB 1SBRA 2K8GA 3CCTA 3DOLA 4P10A 4C11B 3D6HB 3SCIE 3MFHA 2B4VA 4DWIA 4OZ3A 2Z2ZA 3T1AA 4NMLA 4ZJLA 3RRHA 4JI7F 2AIRB 2IVYA 3I4PA 3IGVA 1TKDA 1REVA 2ZZTA 5C25A 1CJTA 4NLPA 2YKOA 1Q81T 3FBCA 2HNZB 3AHPA 3ONQA 3JSYA 1OQ6A 2L9WA 4CM2A 1IR0A 1N33J 2EKNA 1FRMA 1UKUA 5D77A 1F6TA 1JJHA 1RUSA 2PE8A 1DJ0A 3MCOA 3MR5A 3WC2A 2FJXA 3DOMA 2IJNA 1N5VA 4DF8A 1N56A 4V19J 5B7WA 2GMLA 5IV3A 2FVRA 3JQKA 5RUBA 3R5GA 4UOGA 5DG8A 5G4DA 4ILMA 4CI0B 1M1GA 2N4CA 4IH7A 3DXBA 4TNOA 5D4NA 4E8UA 5DQIA 3KLGA 3HHLB 3GSIA 3K0JA 2DEIA 4KGKA 3KHHA 2EFQA 2BQRA 3DLGA 5EWEA 2A2CA 3ET6B 4OYMA 2DRDA 2JOQA 1UETA 3A3OB 4KBIA 3UD3P 1O51A 2ZE2B 3RYLA 1JLAA 2CQ0A 4DPOA 1NPKA 2P6TA 2XM3A 2B7BB 1C1BB 1Q7YT 1CJTB 3EDRB 1Y11A 2UXDF 1BQNA 2BW7A 1NPPA 2KL8A 2OPPA 2XMJA 4NLXA 2AJ2A 4DFPA 1R0BG 1T94A 1T95A 1VRTB 4Q8EA 1F2GA 5KFVA 2GV1A 3EVMA 3CJTA 1M90T 1TL3A 2QZ8A 2AGOA 1R27B 4P2SA 3PX0A 1FXRA 5KFTA 1OIAA 2RB7A 2MZTA 2IMWP 3AB2B 2ZBPA 4EZ9A 2HEKA 1IQZA 2BV3A 3CJKB 1RT4B 3TO8A 3R5AA 2BX6A 5CABA 1RT3A 3UD5A 1VBKA 1X5OA 2DEJA 2G0CA 2KVIA 5M2PA 2E5IA 4X4TA 3HHEA 5HATA 2R7SA 2VBXA 8AT1B 3C6UB 3LOUA 1VDHA 5FLXU 1OY6A 3AQPA 3HFVA 3M1VB 2Y1JA 3IWLA 2JJ4D 4MK7A 1R0AA 4I56A 4CWBA 2KXFA 3ZO7A 2V4QA 2GGPA 2VQFJ 4ECRA 1NKEA 2ABYA 2QJ3A 1VHIA 2ZNYA 3K7RA 2OPQB 3H25A 1SC4B 2HNDA 4OI4A 4Z7CA 4DFKA 1APSA 1TL7A 2YBVA 5F0WA 3Q0AA 1Q53A 1HNXJ 2GMJA 5KG3A 4CT8A 2KYZA 5I3QA 4AE5A 4M8LA 4MKYA 3V6HA 2WK4A 1E6YB 2CQ2A 3QO9B 8ATCB 1EKRA 2ILZA 2ZVSA 3T5HA 1IN0A 4DV7J 4ZLJA 1UEKA 1HNXF 2VDHA 3IC1A 3OTOJ 2DJWA 3GV5B 2B4OA 1RHMB 2DNZA 4LR8A 5AJ3F 1NSPA 2RVJA 3AH6A 3D1OA 3L09A 2VICA 4K4YA 5J2PA 1VBZA 1RZMA 1RTDA 2E9ZA 4J5OA 2XLJA 1TKZB 1SL2A 1CJVB 2M8DB 1AFIA 1XJWB 2HRYA 3TRGA 1NO8A 4ILLA 2LU2A 4MKAA 1NJIT 3ZZOA 4WXOA 2ZH6A 5K5MA 2AJ4A 1RXOB 1VIXA 1WKLA 4K4UA 3CJRA 2QC3A 2UZAA 2VA2A 2N7YA 5A8RA 3G8QA 2CQ4A 2CQ1A 2FGOA 4TYBA 3V2UC 4ALZA 2JHEA 2YWFA 4PXBA 5DQHA 4K0KJ 3MCNA 1NDKA 3B4DA 4ZCIA 2R8GA 3DLLQ 4CLTA 5LT5A 3RJMB 2IM0A 5KFOA 4ZLPA 2Q79A 1TUVA 2Z56B 3DRPB 2CNKB 4FBTA 1S9GA 3DI6B 5JVHQ 1I6JA 1HNWF 3BKTA 1S1WB 3HHDA 5A8KB 2UUBJ 4HKQA 3MMBB 3UN5A 3SYZA 2UUWA 2EBEA 3MD3A 3QIDA 4ZDNA 4C6AA 1QJHA 2KO1A 3PW4A 3DGPA 1J5OA 3FBBA 1WF2A 4QZVB 4ZPWR 3H2UB 1GEHA 1JLFA 4LRFA 1EZZB 1Q5YA 2LQ9A 5LMUF 1YITS 3MDFA 4YEAA 1TL5A 3J7AN 3IO1A 4EO6A 2EG2A 1H98A 2JZ5A 5HQMA 3K58A 3D0GE 4DF4A 4K5SA 1FERA 3SCLE 2XZWA 4MJKA 2CIMA 2NPFA 4ZLLA 3TZZA 3MAHA 2IJFA 1S1XB 1RHJB 3A12A 1UZDA 3CCRS 3MM5B 4RWWA 5H9EJ 4EBEA 3IFEA 3JQJA 3BYRA 4FS2A 4FF4A 2FY1A 4DL5A 1HQEA 2MHEA 2PA8D 3AD8C 2GVDA 2W8LA 2HHHJ 3KG1A 4DUTA 4PWUA 3NGSA 2BJEA 1C1BA 3US5A 3KUHA 1NDCA 4DR4F 2M3DA 1ZA1B 3LWMA 5HMXA 4J9KA 1SXLA 4UZBA 1ZS6A 1N34J 4DR6J 2BM1A 1X4CA 2FVCA 4DL2A 3MGJA 4OI2A 4ES1A 4FXVA 4IFYB 2ZH2A 1QSYA 2XMVA 3D3CJ 4QIFA 1YTYA 4B3MJ 5HJXA 2AJFE 2LQJA 4A4JA 2DH9A 3Q24A 1T9VA 2BJ7A 3TARA 4ATNA 2ZDPA 3CDBA 4QJVA 1NHUA 4I4BA 2MZSA 4TLQA 1YG0A 1HD0A 5K8NA 2OTLS 2PMHA 1ZAVA 3GLJA 3PJWA 2Z30B 3ZC4A 4DLEA 3THVA 1FESA 5DO2A 2WW4A 1UW4A 2YKNA 5HVHA 1WG4A 5ETTA 2HNZA 4F67A 1A9NB 2DGOA 1D3WA 5ETVA 3FFIB 3VF0B 4LF5J 2Y8YA 3JTNA 3MOJB 3DRPA 4ICLB 1U0HA 1ZM4A 5A8RB 3MM8B 1KTVA 2GQ2A 3ZZYA 3MHYA 2HVIA 3KJVB 3Q83A 2GNKA 1Y3JA 2ZC3A 3LAKA 3PTWA 1KQKA 3T19A 1GTHA 2WOMA 3FUYA 4ZN3A 3CD6S 2HSEB 2RU3A 4FF3A 1IBMF 2XMUA 4NI2B 3W8GA 1TL1A 2UXDJ 3TJ9A 1B4SA 3ZTRA 5F8LA 3MPWA 4CO1A 2R7QA 4F36A 1KOHA 1N0VC 2CQIA 3ENVA 3M7VA 2J5AA 3KLEA 4K4ZA 3C16A 4LR9A 4C3MA 2HIQA 2W9CA 2EKYA 2B3TB 4UT4A 1YVFA 1BY9A 3ITHA 3N4WA 3KLHB 2WAQD 2OIHA 3BPSP 1JK9B 4RW8B 1HBNA 4DV1F 2OEMA 3E3XA 1I94J 3F56A 2HURA 1Q79A 1BD6A 3C8YA 1ZTTA 3MMAB 2KB2A 4ZCLA 1TKTB 2EBGA 2QYCA 3M05A 4DZDA 4NLSA 4NA2A 4L72B 4Y2CA 5G0RB 4F02A 2OFHX 2XYHB 4OZLA 4XK8C 1FRIA 4I6YA 5B09A 1HARA 1AB8A 5DG9A 2QX0A 2DB1A 2DISA 4G6VB 1X60A 1I1GA 2WVFA 3AOBA 2HHSA 2CPZA 2VBZA 3MEDB 4UOCA 4A8QA 2YWWA 3HFKA 4NOHA 3QGPA 3RU0A 5EX0A 5I42B 1N0UA 3Q8VA 4OX9J 2HHVA 3PRVA 3QQCD 2XSJB 3IBFB 5KG1A 2PFFB 5KFPA 1WC6A 2B43A 5M2UA 3PHEA 4QIWD 1Y00A 3G6ES 1U1KA 1IBMJ 2BVZA 1HBNB 1RK8A 5KT7A 4WTOB 2AW0A 1RCOB 2E29A 4B9VA 4DQSA 2N3OA 3JTPA 1JKHB 1HIYA 2RQKA 1CG2A 3H0PA 4KH0B 2VFTA 1KVKA 2BJ8A 4A8YA 1LWEB 4P74A 4DQQA 3R2CJ 1LK5A 3LPEA 4EGLA 4FKYA 5IOLA 2DR8A 3GE9A 4TLRA 2IM3A 2RF2B 3I5CA 3QSIA 1N88A 1IVZA 2Z57B 3CNQP 5SUHA 3DLJA 4QPXA 2VONA 4PXEA 3TZXA 5D8HB 3MAQA 1MN9A 1SKWA 2FVSA 4OI1A 2LECA 4LF8F 4LIRA 4DV4J 3NKYA 3KMSA 3NMRA 3UW1A 3KJVA 1EJ7L 1NJYA 5ETRA 5L9NA 2Z2YB 3OVAA 1UVMA 3A13A 3KLGB 2G1HA 3UI3A 1LWFA 1X8DA 1YZ7A 3ELHA 3LAMA 3M2RA 4XDCA 4J9MA 4DV3J 4DS5A 2FLPA 1U1NA 4B3RF 2VG7A 2E5JA 1RISA 5F9LA 4Y6IA 4LF1A 2W2QP 3OPKA 1KVIA 5A8WA 3QPIA 3G82A 1YZ6A 4WK1A 5CYJA 1VBYA 4L75A 4F2SA 2YKNB 4PQAA 3SBMA 3AD7C 1KD1T 2P8IA 5KOWA 3FBFA 5KT6A 1HR0F 1Q7LB 1FRKA 1P27B 1WC3A 2R42A 4HTIA 3J81Y 3G4SS 3LWLA 3BYPA 1XIQA 2HFOA 2EFNA 3M2UA 1N54B 5CA5A 2R7XA 2F4FA 3RW7A 2CZVC 1UP1A 1TVRB 2PT0A 1S57A 2HNYB 2V94A 3NGKA 1HWUA 2EC0A 3FEYB 2C2ZB 2F1FA 4BBYA 1WSVA 2Y0BB 1L3UA 1NBEB 3CJSA 1C0TB 3OLBA 3I0RA 4IDKA 4DHVA 5HI7A 3VGTA 1FT8A 4GKJF 3NAHA 2HVEA 3LP1A 1X9SA 1S9EB 4HYKA 1RT2B 3G96A 1YHQS 1HKAA 4ZP8A 5ETNA 2OPRA 2OAUA 1QM9A 3LP2B 3CSKA 1IUJA 3M32B 5HVFA 3ZZ0A 4DXLA 1FFWB 2D7SA 3J81j 3QRRA 5T41A 3T5JA 1FNMA 2W9AA 4Q0BB 1T05A 5L46A 3LANA 4E0DA 2YNFB 2NCKL 4RBUA 3FRYA 1TP7A 5FIIA 3F73A 4QWAA 4LFBF 2ACYA 1LWEA 1C4AA 4U8YA 6AT1B 1RAAB 4M95A 2BRLA 4F2RA 4DQPA 4IR9A 3K57A 3OFEA 4LFAF 2OEJA 4PYAA 3FKBA 3X1LB 2ZHBA 3PM9A 2ATCB 4RNOA 2EFOA 3BSCA 3G86A 5E3RA 4CYUB 5JMNA 2X1AA 3HK2A 2QV6A 1EETA 3ZNUA 3QJJA 1VJQA 1JMTA 2RF2A 4ZP7A 1IKVB 1TELA 1XMBA 1UZHA 1WDDA 1HNIA 2CZ4A 2RKIA 3CDAA 3HKWA 4C8KA 2K1RA 4N76A 4C98A 2VU5A 1XNQF 1FJCA 2FC9A 2I6WA 4K4XA 2KXHA 1RACB 4EYIB 1RT5B 2IA6A 2HFUA 4AXIA 1T7PA 2L08A 3NGDA 4TY9A 1FX4A 2HHQA 5GAHI 1QSSA 2V67A 3PX6A 4Y2MA 4C8MA 1U2RA 3QRPA 2H4WB 2HWHA 4CH0S 1VLYA 1KVJA 1Y5NB 3MM9B 4I69A 1WOPA 5HROA 2C2EA 1QAJA 2B4PA 4RR5A 3J80U 1H3DA 2NQPA 3CCES 3IP0A 4LVOP 3QLHB 5MAOA 2QLXA 1X4GA 5I3PA 1U1QA 2BJ1A 3GIJA 3G6VA 3GJTB 2BANB 3IA0A 1X7VA 3KJNB 3CO0P 3NNAA 2KXNB 4OMFG 2BEFA 2NS1B 5A0YA 4DN0A 3Q8PB 2AEMA 3H2LA 5KFWA 1YKWA 3CGIA 5K9FA 4P6QA 4WK3A 1R7IA 3FNNA 4LSZB 2PO4A 2HG4A 2CDRB 3FCHA 1PGZA 1YWXA 4EBDA 4DR7F 2KZZA 4DU8A 2KHCA 4HACB 1FD2A 4CIOA 2CQ3A 4NPOA 4CLFA 2H54B 3DGVA 3KLHA 4DPWA 3ITHB 1LEOA 4JI2J 3F0NA 5B0AA 1FKOA 4DSJA 4F25A 2ZNZA 2FJAB 2ZBIA 1RAIB 1RBAA 1EP4B 2DGWA 4NL5A 3TA1A 2V50A 3F44A 1VQMS 1D9FA 1RWKB 3MWBA 3G71S 4UUWA 4LF7J 3KXDA 4ED3A 1EX8A 1RWUA 3V4MA 1TKXA 3NCRA 4CQ1A 2XMAA 2R7TA 2YX7A 3EJMA 3B6BA 2MY7A 1Q0NA 2HQDA 4DL6A 1NEEA 4CNYA 4QCLA 1FRJA 1RHQB 2UU9J 4LQ3A 1YJTA 4NEZA 4FYXB 4CRJA 3NNCA 5FJ4A 2DHSA 5IT9U 1RTZA 2MB0B 1SJQA 1X0FA 1NKCA 1P1LA 2C3MA 3CJKA 1UVIA 2HMIA 4I1TA 3NNHA 4QYZJ 3PDNA 3BN7A 3FMWA 3FGVA 2BE7D 4C3LA 3X3UA 4DOZA 4U7UD 4AD6A 3SXLA 4B02A 1U1MA 4FPIA 3PYEA 4ZPDA 4HHHA 3HXMA 2XNQA 1TU0B 1UEUA 3TJ8A 3I0RB 2YNHB 3DOKA 1M5KC 1IKXA 2MZJA 4RNNA 3MEEA 2GJIA 3TW0A 1UL3A 4ID8A 2OPPB 3P5TL 4HVZA 2DGSA 4FDFA 4CLSA 4IRDA 2BXJA 3D66A 4FVMA 2H5IB 2B9XA 4KB7A 3DM2B 3LO3A 4W90B 2F5GA 3G82B 5IT0A 3IWNC 4DR7J 2BKNA 4KPCA 1HWKA 3N79A 2NYHA 1U26A 2N4DA 5T7LA 1Y9OA 2WVDA 3I82A 2IM2A 2MTLA 4LT6A 5F8MA 3TYTA 2OH2A 3CJ3A 2CAJA 5KFFA 2JWNA 3HJVA 5B0EA 4M5JA 4B9SA 1ZH5A 3LUYA 3PKYA 4X66F 1DRZA 1LWFB 2CPDA 1RT6B 4KO0A 3OBIA 2JSXA 5KFCA 3GPAA 1YJUA 1TUGB 2GAHC 1PAUB 5D3GB 1RHKB 4ZVHA 3SDEA 1ZPVA 3UNYA 3A8IA 4KGMA 1HHSA 3NWGA 3OVSA 1VYAA 3HVAA 2EFVA 3SEOA 2ACMA 3EGWB 3CCWA 4MFBB 3S8SA 3PR5B 1U47A 3CULA 4H4MB 1LFPA 1Z2ZA 4H4MA 3NCQA 4GKJJ 1G2EA 2ZH9A 5L38A 1JKHA 2JC1A 2I38A 1S6QA 4ZVRB 4MK8A 4KH1B 5D78A 3M2VB 3D54A 5DDPC 4ECQA 1XN9A 2AEFA 4U7CA 3MF5A 1MWQA 1NRKA 2RD5C 3MD1A 4X84A 4DBQA 4L73A 1XR7A 2V8PA 4DSFA 1B0PA 1T9UA 3U02A 3N0VA 2XYPB 2MZRA 2WCXA 3GR0A 5KFDA 3QJPA 4LF6J 1NHVA 1DQ8A 1N6QB 3CTRA 2J7KA 3FEZA 2O67A 2MGZB 4I64A 1U6FA 2G2OA 3DXSX 3OUYB 2AYGA 1TV6A 3FEXB 4OX7A 1IQTA 5DLGA 4O4GB 4TN2A 1PBAA 2IYIA 3BV8A 5KT5A 3VGSA 2ZVIA 2W2OP 4OYAA 1ZAWA 2QLFB 5KT2A 4CLUA 1FXLA 4CLZA 3OL9A 4QIVA 2PMZD 5J1EB 4DL7A 3OQ2A 3I0SA 4NA3A 4FF2A 1WACA 2MLXA 3LW5C 2VPYB 3Q8UA 1E6VB 4WF9Q 1E6VA 1NJWA 2EWHA 3HT3A 1YRUA 4D3GA 1K0VA 3FVYA 3AAWB 3OJUA 1H6KX 1GX5A 1PG5B 2JLEA 4KFBB 2QA4S 1RT1B 2XTJP 4B17A 4EO8A 4YB6A 3Q22A 1CBKA 2W4PA 2XY7A 5D4LA 2OPSA 3NBPA 1F5CA 2YWGA 4WE1A 5F8IA 4DV2J 5GMKa 3FCWA 3IWXA 4O4GA 4ECZA 1JJ2R 3GV8B 3N9UC 4BWJA 2W4DA 1O5JA 3D6MB 1SJ1A 5E33A 3M6UA 3O2IA 1X4DA 4DPYA 2R4FA 1NSQA 5A0YB 3KK1B 3QGGA 3OFHA 1VS3A 2DHHA 3AODA 3L95X 2QL9B 3K8WA 1I94F 1XC9A 2E5HA 3R5BA 4WP9A 5CYMA 5J2MB 1VQNS 2YQ3A 3FSXA 3VAGA 6FD1A 4F0KA 5K8PA 1FJEB 4PG5A 1LWXA 4F7VA 4N41A 3QIPB 1EP4A 5D4PA 2K2PA 1DBDA 2FHJD 3SMZA 2PN6A 4CLYA 3CDWA 1FKOB 5HROB 5BR8J 4DSIA 3H5SA 2VFVA 4DR3J 3VQTA 3CJ5A 4OL8A 1CLFA 4KY3A 1ZZFA 3HDSA 2V2KA 5BYSA 1WORA 2Z0GA 5U47A 1U1RA 2QA2A 3H5YA 2C2NA 3BBCA 4IG0A 4JI0F 1U2FA 2C2OB 3MI7X 4RNMA 3AJDA 3RW6A 3M8PB 4O3OA 1U24A 2HGNA 3CE8A 1KQGB 2JLFA 4F04B 2ZEJA 2CJQA 1EAYC 1HMVA 3UE2A 5B0DA 1RJJA 5IC4B 4QWEA 1WF0A 2DGUA 4KHMA 2H65B 3WHIA 4L3KA 1JXLA 3BQ0A 4NXNF 2MGZA 3OUYA 4UY85 1YBAA 2CPJA 1KFSA 3AXMA 3POTA 2GA7A 1KQFB 1BQXA 3OXLA 4UW2A 4AQYJ 1R8PA 3AOAA 2FVQA 1SH3A 1TQLA 4LFAJ 2VG5A 2VB6A 3NG8A 3O44A 2DNPA 3AQOA 1B70B 1VQ5S 1DFDA 1YDLA 4CLKA 2DRBA 1SQGA 2ZM6J 4ZKAA 4ANEA 1J27A 1KONA 2C3YA 2YQ0A 1RTHA 2GVZB 1ZA2B 2GVZA 2QRRA 3PJ9A 3OL6A 3T3FA 5I3UA 4BC7A 1Z1ZA 5A6WA 4ZPCA 4CO3A 2C1EB 4A8OA 3H4DA 2X1GA 3RR7A 2MZ1A 1IWAA 1REVB 4YN3B 3GYGA 1VQKS 1JB0C 3RZAA 3DLEB 4NA1A 2IVFB 1T9TA 4USMA 2WZ1A 2F9DA 1EETB 3M8WA 1C0TA 5CCMA 1UFLA 2L48A 1TMMA 4K4WA 5F3TA 2KT5A 3OV7A 2AV5A 1R8CA 2Y1IA 2CXEA 1WKJA 4B9UA 1Q82T 2F9JA 3P45B 4J7CA 3V6DA 2ZKTA 3U7JA 3K5MA 2ASJA 3C14A 3MEKA 4P75A 1PYSB 4X4QA 5CHCB 4ZHRB 1JLFB 4WP8A 2YNGB 4BWMA 3N5FA 3CIMA 4OI0A 4WZQA 1Q8KA 1T05B 1K8AT 1RHUB 3BB5A 4FKXA 3TR5A 1OPZA 5HBMB 5KT3A 3EPGA 2VIHA 3PV8A 4WZMA 3DOLB 1DTTB 4M5IA 5KG6A 4TQSA 4WP3A 1F5BA 4NCAA 3B8HA 3GYNA 1GMUA 1PJ6A 4QQBA 1FWKA 2FD2A 4PYDA 1SH0A 2OGUA 3OL8A 3V6JA 3D1HA 3IXQA 1UVKA 4EMDA 3GQCA 3FCVA 3FMBA 1N36J 1FHTA 1KSPA 4MIBA 5LMUJ 1OS5A 4CM0A 2J8SA 2CRLA 2IFXA 3KJQB 3PJXA 4QR0A 1VBXA 1PO6A 2NXNA 2V9KA 2CJBA 1GMVA 4DN9A 2AT1B 4ZVQB 5F8HA 5CZVA 3MURP 4B3OA 1CQNA 4EU0A 2OEKA 3KLFB 4Z37A 4DV1J 3EPIA 1QAYA 2K3IA 1Y0HA 5D0GA 3EZUA 4ZMMA 5HQ8A 1SIWB 5B0GA 4ANCA 2GJFA 3I96A 3MAAB 4TQRA 4XIUA 2R8HA 4AL6A 2ATLA 2CPYA 4OYPA 4WCEQ 1RAHB 3MEGB 1GQEA 3MPDA 4U8VA 1FXDA 3HT0A 3M8QA 1DAXA 1TK0A 1F1BB 2CVIA 3GWCA 4NLVA 5GMDA 1XMQF 5A76A 4USJC 3IG1B 5CYQB 3UDLA 1F9HA 3KUGA 2C3OA 4HHJA 2R8JA 5I3UB 2CVEA 2ZBRA 3MPYA 2RHQB 2YX1A 1VRUA 2HBZB 2XWYA 4QR1A 5D6GA 2W9BB 3CJ0A 1UFWA 2A10A 1HBOA 1UWBB 2VBWA 3ENWA 1NHKL 4ZVGA 2FDNA 2OPQA 4C8NA 4ED2A 3V6KA 2C3PA 2VDIA 3D4JA 4RW4B 3PG9A 4USUA 3MM9A 4NYPA 4ZP6A 2JVOA 4USWA 1QD1A 2VBYA 4Y65A 4ZVPB 5LJ5Y 1M5PC 4MIWA 3IRXB 1VCTA 2E1MC 1KTQA 2CQHA 3I56S 4K50A 3ISZA 4GVLA 3DMJB 2GZOA 3QT8A 4B08A 2ERRA 2KRBA 3BN4A 3IM8A 4MYUA 3T9NA 1N6QA 4R0EA 3UDVA 5CAAA 1S9FA 2G4BA 4LREA 4R25A 2VODA 5G0RA 4NASA 3TAPA 4OYZA 4J90A 2DT9A 4C97A 3CC4S 4ELVA 2C2DA 3H20A 4MH8A 2KT2A 3M6VA 3CVKA 4ZVSB 2DPJA 4PRFA 2M70A 4JI6F 5IQ6A 2IIHA 4ELTA 1SV5A 4XPEA 2DR6A 3VAFA 2HQCA 4Y3CA 3PIOQ 1HPZB 4FN5A 4UQTA 4LSLB 3T6BA 2A6OA 2BA9A 3I5AA 2PIIA 3UO0A 1VR6A 1NUEA 2KJVA 3LF0A 4EK2A 2C42A 1CJKB 4HEA9 4AXJA 3TQ1A 4E2FB 1HBOB 1UWBA 4RWXA 1T0TV 4IOCQ 1VC0A 2EI5A 1N34F 5M2RA 4EZ6A 4JI5J 4ZITA 3HPOA 4QYRA 1IWGA 1SIZA 1U7LA 2OPSB 3T6JA 1MU2B 4YQWA 2E1RA 3R7BB 3KHLA 3PVXA 1S12A 2UVVA 4ENOA 3RAMA 4DG1A 5CQGA 2RU9A 3M4XA 3KFWX 2DD8S 2J8AA 1W2BR 1M5HA 3M6XA 2IBKA 2AYEA 4F4ZA 4A8WA 5E0OA 1FEEA 3W2WA 1NDLA 1KNZA 1HWIA 1BHNA 2J76E 3OR1A 3M8SA 3BDPA 3G6XA 3U27A 2NREA 1MWZA 2WBMA 3IBCB 1ZOTA 4KAIA 3W7BA 1ROFA 2BKOA 5EWFA 2AD9A 4NWBA 4WTYA 1XMOF 2XNRA 2XS7A 2A2DA 2GO8A 4NRTA 1S6OA 1TK8A 3DRSA 4X62F 4TU7A 2B9YA 3CO9A 2XSFA 2V2ZA 4DV5F 4C0OC 2OP5A 4YDDB 4A8FA 3KLVA 1YLXA 3SQGB 2EK6A 3MEEB 1RWXB 4CNZA 4ZJQA 4B3TJ 1OYEA 2QGFB 1URNA 4FXDA 4GRSA 1R0AB 1U02A 1CS4B 3ZZUA 5HBMA 3EGZA 1U48A 4AYBD 3DKDA 1TUWA 3CCUS 1KLMB 3KLIB 3CCMS 2D1CA 2E7VA 3BBBA 4Y2KA 5EGYA 3DDIA 3OR1B 2J6SA 4JV5F 2FLLA 3CW2C 1C0UA 1U1PA 2WW8A 2LEAA 3T1HF 3G2XA 4ZA1A 2HHXA 4RNHA 1YX2A 3BR9A 2DNOA 3RAXA 4WBFA 4IO1A 1HBMA 2MLZA 5THWA 1SJ4P 4ED5A 2DY9A 4DCPB 2OMLA 1GH8A 4X4VA 2CQPA 1GX6A 1LFWA 4QR2A 2ILYA 4UQGA 3KKFA 1VGYA 3W5ZA 4ZPAA 1HI8A 1NK4A 2Y8WA 3RRKA 2X3DA 2HLTA 2CPIA 1QVFR 1RB0A 2DNGA 2PMWA 4URGA 1S1XA 2L9NA 4HTJA 4F0HA 2JC0A 2DRAA 3MMJA 1GTEA 5SZTA 2LEPA 3BO3A 1YBTA 3WZ0A 3G6YA 4HL9A 2GW8A 3VAIA 4DSEA 4Y2AA 3V81B 5H9EK 3DC2A 1QE1A 1JLCB 3PKMA 1SC1B 1Q4RA 2FJEB 1N48A 4B3RJ 2HHWA 3K59A 3A3NB 4EWTA 2XO7A 2RUSA 1MMNA 1GXLA 3RB4A 4HDGA 1FDAA 5AT1B 5KFGA 4NRUA 1FEHA 3M9MB 5JVGQ 2OO4A 2ZHOA 2EEYA 1HR0J 2YXLA 4NZ6A 1V3SA 2W4CA 2QMXA 3S7RA 1YJ7A 2CNOB 5KFQA 2KH9A 2R2UA 4DFJA 1KS2A 3CIZA 2BE9B 4A47A 1WHXA 3WBZA 4AFFA 2CZ9A 4RZRA 1VC6A 1TMJA 4IKAA 4KRWA 2OLWA 2YNIB 2BRKA 4UF4A 2MKHA 3MR2A 4F4AA 2K7KA 2ADBA 3M30B 2VFRA 4ER8A 3TZYA 2QO3A 3D67A 2L41A 2CA9A 2CPEA 2DNKA 2KZMA 1T3OA 1XTZA 2XBPA 4QIEA 4DX5A 4PR6A 4H4OA 1D9AA 3CCLS 3I5BA 2RT3A 4WFNQ 4JYAJ 1DARA 1UJ6A 2B7CB 3IR5B 1IKWB 3GMGA 3BH7B 3MUMP 1MROA 3OHAA 4HR2A
chains in the Genus database with same CATH topology
2F8HA 2W9CB 1HNZF 2FGCA 4F26A 2JDJA 3CB4A 2J6UA 5KFSA 3FQKA 2BYCA 3IS9B 1BQMA 4QIGA 5DG7A 4KV8B 4DFMA 1H2TZ 1VI7A 3JSRA 1S72S 3E8OA 1U6BA 2W7OA 3NL0A 2HPUA 5HMYA 2FHMA 2MQPA 1Q8LA 1JLEB 1Q8BA 3BREA 4WU2A 5GAEU 3O1LA 2C2RA 2KU7A 2NUUG 2IBOA 1FK9B 1FK9A 1WHVA 1AUDA 2I8EA 1HI0P 2AGQA 5LSRA 3BR8A 4LSLA 2MMYA 1TFYA 5EN1A 3ULHA 3PW2A 1X4HA 5F3ZA 3OTDA 1IBLF 3ENQA 4YMEA 3HHLD 3OLAA 2D3OR 3N28A 1WTBA 3FDSA 5IT4A 3L3CA 3CCZA 1Q16B 1QY7A 1GXUA 1D0EA 3GG0A 2Q1LA 5KAKA 1NJZA 4P7TA 1S0NA 4IOBA 1R43A 1HQUA 2NYIA 3SSQA 2MKKA 4J9LA 3L7PA 2YKMA 4KV8A 1RYRA 2CPXA 3MTJA 3CMES 3CUNA 3IS9A 1UA0A 4U7UK 1NK5A 4NLGA 4ZK7M 1DZ5A 1DTQB 4X65F 2KFNA 4DUZF 3A8EA 3UCZP 1U1LA 2DIVA 2IC3A 4CZCA 5IT9Y 2M2BA 4YB1P 2ZM6F 1TL3B 5FDLA 3N6NA 1OO0B 2ROGA 4WYWA 4XO0A 4EEYA 3M9NB 2FLNA 2WSCC 4RX6A 3MM7A 4MKBA 4CTAA 3GFXA 3I0SB 2LXFA 4OI3A 5IM0A 2ZKUA 4F8RA 2QIFA 3UCUP 5AE3A 2GX8A 4LMZA 2DGTA 3M9OB 4ZCKA 3LPYA 1SUQB 2YTCA 1JLAB 4OIXA 2WHOA 4OZ5A 1VOMA 1B0TA 2AWZA 3D1QA 1U1KA 1HW8A 5HMWA 2FJWA 4B9NA 2WRMA 3OR2B 3CCQS 5IQQA 4O3SA 1TR0A 1WNEA 4M5DB 4TY8A 3I6PA 1F9FA 3IGNA 5DETA 3CDUA 2AX1A 1NK8A 4LQ9A 4WU3A 1TAUA 2XHWA 2BE2A 3GILA 1K1SA 5KFHA 1YJ9S 2RSQA 4QW9A 2AP6A 2G13A 1MMLA 2CJAA 3QAUA 3GZ7A 4R5PB 1KHWA 4ZOSA 3UD4P 2JFKA 3I4HX 3P6YC 3MMBA 3C3LA 2NPIA 2RQCA 2AF6A 2QEXS 1RDRA 2I5JB 2OSQA 3AB4B 2HQ3A 4DX8H 3CCJS 1XEZA 2FJBB 3MOZA 2DGVA 3OTEA 3SDEB 2DR9A 4K4VA 1KOOA 2VZ9A 4BC9A 4F3OA 1S79A 4C11A 2ZHAA 1UVLA 3CWJA 2XGPA 1RT2A 1QTMA 3HO1A 1SI9A 2MSSA 2IRUA 1KLMA 3KLIA 4GC6A 2PDAA 1DHMA 1LQ9A 4C2MA 1VQSA 4DR2F 3KK2A 1TVRA 4KHRA 1SKSA 1HHTP 2G1DA 4PXDA 1S1UA 1HFEL 5DDQC 4ID5A 2R2TA 2ZOMA 2GMHA 3UWTA 1KLNA 3NP5A 4IFVB 1NK7A 1KNZA 5C24A 1FTRA 1XERA 3EGNA 2CJKA 3TVZA 1N5TA 4O3QA 3B78A 2NR0A 1RT7A 2VG7B 2M0GB 2RS8A 3OL7A 5E5NA 1YJWS 2DCLA 4PWDB 1VQ7S 1S1TA 5B0FA 4YOEA 5A8WB 3TI0A 1K73T 3I31A 2KRRA 3TVYA 1JJ4A 4MMOA 5LXYA 5DDOC 1JLGA 1X4BA 4RW9B 2ROPA 2EFGA 4JV0A 4ECSA 1KR4A 4KPYA 1CEZA 4RW6A 1HMVB 2LEBA 5EHHA 2VOOA 4IG3B 4R8UB 1VQLS 4AL5A 4X4NA 1BQMB 5K8MA 2MKIA 2XMKA 2ZBCA 2WOMB 3DRRA 3MR6A 3J7ZT 1VK8A 1K1QA 1WELA 1LW0A 1N5QA 2LQ5A 2QE5A 5KFLA 3T1YF 4BDPA 3VTIA 1HPZA 2XLKA 2G9OA 2LLZA 3N01A 3TOQA 3PEHA 4I68A 2GO9A 4WFYA 4F3MA 4DL4A 3M30A 1MMDA 2UVUA 3PY8A 3GFHA 4Q45A 5J2QA 2POKA 4PWDA 1BGXT 2FIUA 2JEIA 1AROP 1P8GA 2E44A 2GIQA 5CYMB 1QAXA 3ZZPA 1F5AA 1M5VC 3UDCA 2V9WA 1D9DA 1GT8A 4M1KA 5DRKA 3QYYA 3HHNB 3CPWR 2GGPB 2D3UA 2ZZNA 2XG8A 4J9RA 4PG4A 2MB0B 1PSDA 2LDIA 3M1VA 3MECA 1RQ0A 4J9SA 2IVMA 2I0XA 4RW4A 1ZTWA 4WIIA 1YIJS 3R27A 1S76D 4ZPVR 3DMJA 1HWJA 1FVQA 3CJ2A 2GC8A 2KJWA 3G71S 1L3KA 4RU2A 3HHLA 2M52A 3KK2B 1HW9A 4K0KF 1IKVA 2CYYA 3T9ZA 1R31A 1OSDA 2J7WA 2DITA 3U1NA 1XR6A 1KRPA 1RT4A 3KTQA 4KTQA 5CYQA 3NS6A 2VQFF 2J9DA 2LA6A 4IOAQ 3DFEA 3PFEA 3QGIA 1RTIB 3V81A 3PW5A 4RBTA 1LXNA 3MM5A 3LQVA 3C46A 4OLOA 4RW7B 2W8KA 1LV5A 2CQDA 1YQHA 4X4UA 2R9LA 4HDHA 4DS4A 2WONA 2DH7A 3I9ZA 4IH6A 3R3TA 5HO4A 2COLA 5KG0A 4CT9A 1YRTA 4ICLA 1NH8A 3MCSA 2HS0A 3EYZA 3DLKB 4N56A 1SJRA 2YKPA 1KQSR 5A8KA 2M9KA 4OJ3A 3GFZA 2UV8G 3OHBA 2GHPA 2Z2LA 4EUVA 4XPCA 2R2SA 2J0SD 2NZ4A 2HHTA 2GFFA 2V8GA 2I5JA 4DMZA 4PQUB 3B82A 1IJFB 3PR4A 4B9MA 1OQ3A 3PEJA 4IYQA 5F41A 4ZHRA 3D2WA 1ZM3A 3NAIA 1N8RT 2FVPA 2W24A 2V4RA 3K5LA 1HYSA 1RTIA 3RBDA 2WB4A 1S9EA 5FLXY 3J7YI 4PG8A 2O66A 4PPDA 2VG6A 3DOKB 2SXLA 3VWSA 2LA4A 3JTOA 2IM1A 2W25A 1FKAF 4PG7A 1SJFA 3G9CA 4G1QB 1A6LA 1UAWA 3W2WB 2ZH4A 1VIOA 3DDKA 4Q5VA 2DK2A 1S6PB 4X4PA 3KHRA 4JBCA 3VZIA 2AU0A 2CG4A 4EFAC 2KHDA 1ELOA 1YSJA 3HX9A 4HI2A 2CPFA 1RTHB 1W2IA 1T03B 3CF5Q 1F60B 2YNHA 3HP6A 5J2QB 4LVNP 4YR2A 1C1CB 4A46A 1T02A 1MSWD 1WHYA 2HZCA 4ZCMA 2M4MA 2JLGA 1Z4UA 1YJNS 1GNKA 4LSNB 2R7OA 3WDOA 3JB9k 1RTJB 3JSMB 2AGPA 2BABA 2DO4A 1X4EA 4FVCA 3SSSA 3JSBA 4IRCA 3SV3A 1X4AA 2V4JA 5DDRC 3CCSS 5H9FJ 4C8YA 5KTQA 4DR6F 1V3ZA 4N77A 4YR0A 1U49A 1Z2LA 1S7HA 4NLDA 4ZVEA 4IG3A 1G3OA 4R8UA 4GC7A 2DO0A 3IBWA 4UUXA 1FVSA 4NLOA 4PPZA 2UVRA 3HZEA 5B0BA 2V8HA 4TU8A 3CD7A 2QSFA 2U2FA 2VPWB 3WX4A 4YFUA 1OPIA 2RMLA 4RLEA 2MQLA 5C42A 1H2UX 2FLOA 4K59A 2B4UA 1Q8IA 4DV0F 3IN5A 4NZ0A 2X1FA 1S1TB 2HS4A 2WSEC 1CVJA 1C1CA 3AA8A 3W3SA 1M0SA 4F4WA 2LQBA 1RTDB 1HNVB 2Y0SD 4OJ1A 4A8SA 3KNAA 2J0WA 1AXQA 4RNFA 1JIHA 2D74B 4RW6B 4ECYA 3LP0B 1FDDA 2JFDA 5L1JA 4G1QA 2IMOA 1JLGB 2AYBA 2HWIA 1YI2S 2ZDOA 2U1AA 3Q2TC 5DM7Q 3IRXA 5KFYA 1Q78A 4WE1B 4EBCA 1UA1A 1WI6A 2RS2A 1S97A 3RRGA 1MNEA 1K0TA 3RBEA 3JAMY 4G1PA 4JI3F 3H98A 2NSCA 4KT0C 3PW0A 3J7YU 3HVRA 3KG0A 4ETZA 5CD4H 2XGQA 5F9NA 2BJDA 4URSA 4ETXA 3TAQA 5EDWA 2LXUA 1D8YA 4YUDA 4OJGA 3OW2R 3P49B 1KVJA 1HD1A 1TFWA 2BOPA 1UMJA 1J5EF 2VC1A 4I7FA 4LF7F 1WI8A 4ZS6A 4CCHA 3AJ2A 5CXTA 3MMCB 2OMOA 3OTBA 3UNGC 1DTTA 5AXMA 4DEZA 2ZH8A 3CCVS 4DV4F 1LKZA 4OHVA 2F8EX 1M1KT 3QAEA 4QU6A 2Q66A 5KFZA 4PKDB 1FKPB 1H2VZ 4PXCA 5KFMA 7FD1A 1AW0A 3QZ8A 3VAHA 1NU4A 5KFBA 3VALA 2GCFA 4NLWA 2HQIA 5KFIA 4BCAA 2OKQA 1X5PA 2WBRA 2RILA 1QSLA 4LUBA 4ILRA 2HNYA 3UCGA 1NZAA 3GSDA 3RAQA 2DBBA 4KIAA 3MMCA 3LALA 1U8SA 3PNIA 4IO9Q 2FJDB 1S49A 5E3CA 2F4VF 1HBMB 3MXHP 3MFIA 3V6DB 3IR6B 2KI2A 3FQLA 2I1RA 1LOUA 2KYXA 2KM8C 2DGQA 2BACA 2N82B 2LKZA 2H9ZA 4YY3F 3LGNA 1SJ3P 2HFNA 1HI1A 5DM6Q 3S1TA 1LK7A 4WFZA 4M63A 1OSCA 1X4FA 4KSEB 4M5DA 4TY8B 5F0UA 3BO2A 2IAJB 2ASDA 4KC5A 2DTJA 2AJ1A 4U67Q 1OWXA 3A1YG 1RYSA 5DJBA 2FJVA 1PC5A 1J5OB 2JH3A 1V6HA 2IA0A 2HHUA 2OFGX 2VFUA 1X0PA 5E2QA 1S1WA 5A6PA 2P9CA 2DH8A 3MUTP 1IM4A 3M8RA 4ES3A 5AXNA 3THPA 3C6TB 3M2RB 2KG1A 3E01A 3V5RA 2N7CA 2K7JA 5C42B 4YR3A 4ZVFA 4QW8A 4ED0A 2HS3A 2KN4A 2VQEF 2DNQA 5D4OA 1XBWA 5E3QA 5KG7A 2B6AB 3I87A 1VQ9S 4B3MF 4GMKA 3H5XA 2AJQA 4C4WA 4JV1A 4WJBA 1HNVA 1ZM9A 4TKTA 2YKAA 2ZD1A 1Y4ZB 1U25A 5IZHA 3DI6A 2DNNA 2R7RA 3HVTA 3KK1A 5BR8F 2RNEA 2RQ4A 1UJ5A 3TNVA 2ZJRQ 1FJ7A 3O8WA 4FF1A 4MAKA 3NBPB 4ED6A 1FDNA 3BGRA 4OX6A 3E01B 2VKZG 2DNMA 3MM8A 5E7OB 3FSIA 3R1LA 2WTFA 3QIPA 1CQMA 1VQ4S 2RQMA 4ITSA 5K8OA 2XULA 4JYAF 1ULRA 2O5DA 2L9DA 1SH2A 3SSRA 4KHPF 2JRSA 4MTPA 3TP2A 1JLEA 1URRA 2JEFA 1WG1A 2GHWA 4RBVA 1IJEB 1RP5A 2H5EA 5IS2A 5DGAA 1NK0A 2R7UA 2ZH3A 4FPRA 2EFPA 3QMQA 3IAS9 4OLPA 5C5JA 3MM6A 1DLOB 2RRNA 1Y7PA 3EXCX 4ID5B 1IKWA 3GG1A 2KT3A 1JLQA 4DSKA 2DNLA 1RTJA 3FSYA 5DS7A 2GIRA 2MPUA 4FP9A 4AUKA 3VAMA 2EVZA 5GAEI 1FRLA 3E2EA 3TANA 4HH1A 4DV3F 4ECXA 5KFRA 5GAGU 2E9TA 2BANA 2J9CA 2LCWA 4NYZA 4H4KC 2RE1A 5L39A 1XWLA 1RT3B 5KG2A 3BO4A 3N5BA 2R8IA 1H38A 2ZZMA 4NZ7A 2ZH1A 1S48A 3P3DA 2UUTA 4ED7A 3DCAA 1YGYA 1U09A 2YNIA 3PFOA 2CQGA 2XLIA 4Y28C 3BSNA 2XEXA 2JVRA 3EX7B 5KFEA 2MJNA 2YNGA 3R1HA 4N8NA 2YVSA 2BM0A 2BBEA 5L1KA 2VH7A 1D8ZA 3KNGA 3OXGA 4C7QA 2UUBF 4I0WA 4ECVA 4NCBA 4WKRA 2BQUA 3EXYA 1WEYA 4N47A 1QE1B 1FTCA 5IWAF 1U4BA 4C8LA 3NS5A 1R8BA 2CQBA 1VRTA 4J37A 2NSBA 5LJ3Y 2XMTA 2DNYA 4WFAQ 5AXKA 4AL7A 2F7VA 4FNHA 4CTAB 2HHHF 3DRSB 2IRYA 4D3HA 1RT6A 2V0NA 4KO0B 4K5RA 2YH0A 1NH7A 3H4BA 2IYGA 4DR5F 1FKPA 2XY5A 3QWUA 3BQ2A 1YJRA 4OX8A 5I4MA 2MHNA 4DSLA 4NXMF 1UEVA 2K3KA 3TA0A 5T14A 2VG6B 4HT7A 3KHGA 1HQUB 1HWLA 3AY0A 3UPFA 3ICLA 4CO4A 4C3KA 1DURA 4DG1B 2MY8A 2ZOFA 3LP0A 4OZ1A 2VUGA 5K14B 3ZZZA 4DQIA 3FRZA 1HQEB 1WEZA 3DHXA 4JI1F 3DM2A 2P9GA 1MW7A 4DV6F 1S9GB 4I2PB 5J2NA 4FNIA 2E5GA 2LMIA 2PEHA 1J2VA 4OQJA 3DDNA 2MQQA 1QAIA 3K5PA 3BJYA 3KMQA 3UFCX 2UUAF 4WFBQ 3V4IB 1W25A 4O44B 4O0IA 1UVJA 2HLUA 3MECB 1NK9A 4X2BA 1LWCB 2ZUGA 2DHAA 4PG6A 4X64F 1LW2A 1Y5IB 4XIUA 3M8PA 2HWTA 4RW7A 1VJWA 2DR5A 4RKUC 2AX0A 5KT4A 1MU2A 2FC8A 2RIJA 2NXUA 2Q6BA 3J7Z5 4B9TA 4K4TA 1L3VA 2XC9A 1SC6A 2X3GA 2HHPA 3TAMA 5CCLA 2VFSA 5KFNA 2V8DA 2B51A 3SV4A 2XI2A 2ASLA 4OI6A 3W2VA 2KM8B 4UY8T 3TX8A 4JUZA 3C6TA 1N32F 2I2YA 1RT7B 4O3PA 5FD1A 5HN0A 1GXTA 1CC7A 2M5YA 4A8KA 3FJ2A 5EX3A 2AYMA 2OD6A 1XK8A 3G8TA 4J9QA 1HNIB 2RKIB 2C22A 1RAJA 1DLOA 4I6AA 1RT5A 1X9WA 5B0CA 2E66A 1TKTA 3DLGB 2PSZA 4U6PA 4C8OA 2EW9A 3HHLC 5KFAA 2IAJA 1RT1A 1CSJA 3K2YA 3TUZC 2VPXB 4LF6F 4B3OB 2M7SA 4FBUA 3UR3C 2VOPA 1JLCA 2DIUA 3BEGB 4WKYA 3GYXB 3PO4A 1S99A 1WWHA 1FA0A 1S6UA 3MMAA 3T5KA 5HP1A 3S6EA 4I2PA 5AE2A 3PZPA 1WF1A 6FDRA 2OD4A 1B64A 3DHWC 1L3TA 1UJ4A 1LW0B 3CD5A 2E1CA 1HYSB 5C24B 4B3TF 1KEKA 1B7FA 1FO1A 2MQNA 3GIIA 1RA6A 3HI9A 2OPRB 3GIKA 1P1TA 1N36F 1B0VA 4O23