3CEDA

Crystal structure of the c-terminal nil domain of an abc transporter protein homologue from staphylococcus aureus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
SNADDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the C-terminal NIL domain of an ABC transporter protein homologue from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
molecule keywords Methionine import ATP-binding protein metN 2
total genus 24
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 3.6.3.-:
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09383 NIL NIL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cedA00
1LK7A 4LUBA 3ENQA 3DDNA 4GO7X 3W7BA 2QSWA 2J0WA 3L7OA 3ENVA 3OFFA 3TUJC 1XTZA 3OFHA 1RWUA 2MDAA 1UJ4A 1YGYA 1U8SA 2KO1A 2J0XA 2PA3A 2ZHOA 3LOUA 2P9GA 4GMKA 4M8LA 3TUZC 3MTJA 1LK5A 3P96A 2DT9A 1KS2A 1SC6A 3DHXA 4GO5X 1YBAA 3NRBA 2RQKA 3AB4B 4IO1A 3IXQA 3S1TA 5JJBA 5IT0A 2F8MA 2P9EA 1PSDA 3MAHA 4X84A 2JOQA 2DTJA 2NYIA 2LVWA 3O1LA 2RE1A 2QRRA 5IT4A 3OFEA 3DHWC 1M0SA 2FGCA 2F1FA 5FIIA 1UJ6A 2P9CA 3K5PA 1ZPVA 3N0VA 2H9ZA 3IBWA 2QMXA 1O8BA 3AAWB 2JHEA 3TUIC 3UW1A 3OFGA 1Y7PA 5T41A 1LKZA 3KWMA 3CEDA 5IS2A 4PWUA 2LQJA 4NMLA 3MWBA 3ENWA 3U7JA 2PC6A 3AB2B 2I9SA 2CDQA 3DC2A 2RQMA 3LUYA 3HHEA 3OBIA 1UJ5A 2QMWA
chains in the Genus database with same CATH superfamily
2WK4A 4F4WA 1HQUA 3UDLA 2DXDA 1AB8A 2HK3A 3CO0P 2ZH5A 4DF8A 3G6ES 2DISA 3AY0A 1K0VA 4Z2XA 1BQMA 4ELUA 3VQTA 3PY8A 4Y00A 3HMJG 5KFEA 3CCSS 4F50A 1C1BA 3HFVA 4WWSA 1ZAWA 3R9LA 1NSPA 2QFJA 1QVFR 1ZAXA 2BYCA 1N34F 1NDKA 2ZITA 3MM9A 2VOPA 2HPUA 1F9HA 2W9AA 1SPBP 2PMHA 1RHUB 3TZZA 4URGA 4E98A 1IBCB 2RRNA 4RR5A 1WOOA 2EFVA 2U1AA 2YWGA 5EHHA 1RAIB 3AD7C 1BE4A 1SC3B 2GZOA 3IBCB 1HNIA 3BYRA 1X0FA 1PYOB 2VFSA 3JYTA 4V19J 3DXSX 4OZJA 2B8QA 2OIHA 3RZAA 1U45A 3M2RB 1FRJA 4NRUA 3ZTRA 2FVRA 4OLPA 4IRCA 4Q2MA 4DS4A 4XO0A 2AW0A 1S9GB 4IG0A 3SSQA 5DDOC 2HVHA 4YOEA 2HVDA 3BB5A 2VPXB 3NCPA 4F7VA 3MR7A 1S0VA 2ZBRA 2JH3A 2C42A 4H4OB 3DLBA 3K89A 5KFPA 4F26A 2Y1LB 5J1EB 1NUEA 1UVNA 1JLFB 2ASYA 4EMDA 2DB1A 2CWXA 5KG1A 2DY1A 5I4MA 4ICLB 2G13A 4DBQA 4XPCA 4U7CA 5L46A 4NZ6A 1VLYA 3PRVA 1U1NA 2G0IA 2MZRA 2YWEA 1KQGB 3MAHA 4GVBA 4OI6A 4X84A 4WFBQ 4PUOA 3C16A 2R7RA 2MQMA 2LVWA 1T9TA 3DI6B 3E01A 2MKYA 2DR7A 3N6NA 4DR2J 2E5JA 3CJ5A 3QFHA 2NXNA 3GJQB 1X5SA 2CADA 4L74A 3CCVS 2EFOA 3HHLA 3FEYB 1HQEB 1SKSA 1A7GE 4PG5A 1AZSA 2VQFF 2AU0A 1QJHA 2CQIA 2MLXA 4QJVA 3QSYB 3V81B 2LEAA 1N5QA 2ZJRQ 2ZOGA 5F3ZA 3QT7A 3RAMA 2NZCA 2GAHC 3D0IE 1M5KC 3BO2A 1BD6A 1KKHA 2I8EA 1FT8A 4MH8A 5FDLA 2J76E 4X66J 1SL0A 2Y8WA 4RWWA 2ZWPA 3RB3A 3I9ZA 5G4DA 3BSNA 1PIEA 2WONB 3KJVB 2XO7A 1RT1B 2ZVIA 4GKJJ 2MHNA 4QZVB 3NOGA 2R8KA 4NXNJ 1CPZA 4B17A 2HW3A 5F9NA 3LP1A 3CUNA 3CT9A 1ZETA 1YI2S 4UOCA 1B7FA 1ELOA 4Y2IA 1EQ0A 1UVJA 1SL2A 5KT2A 1FVQA 1EP4B 2VBXA 2VV5A 4OIXA 3P49B 2DITA 4RUBA 3TI0A 1RT6B 4OYWA 3ITHA 4DFMA 3D6HB 4PWUA 3TAMB 4CM0A 5RUBA 1HQUB 2LQJA 4DV7F 1HNZJ 2GQ2A 3T9NA 3QAUA 4I56A 1F6TA 2RHSB 1HMVA 1RZMA 2RRAA 2VIHA 4HVZA 4I67A 1HR0J 2JZ5A 3HZEA 4YN3B 3JQJA 4YY3J 1L3SA 3OBIA 2MZ1A 1WOPA 1SKUB 2JJ4D 3G82B 1YK9A 1YJUA 2D7SA 2ACYA 2DHGA 4P71A 2XS5A 1KLMB 2HS0A 3R5AA 4NA2A 3D54A 3OTOF 1RJJA 4NCAA 3TA1A 2R7TA 2UUBJ 2UUAJ 1N32F 4ED2A 2XY5A 3TW0A 4DPOA 1RLDA 2H5EA 5IFMA 2CDRB 4WJBA 4Y28C 5DJBA 4YQWA 1IR0A 1VBZA 1VC5A 1XR6A 1RT1A 5GAEI 3MEKA 3WX4A 3NS7B 2HHTA 2ADCA 1IJFB 3IWLA 3FSIA 1OO0B 3KJVA 2MY7A 3UR3C 3MOJB 1V3RA 4OZ2A 4ZP9A 2FVSA 4C6AA 1RACB 3KFWX 1X4HA 4JUZA 3HO1A 2HHPA 3PKMA 4AL5A 1WG5A 3ET6B 5CQGA 1FRLA 2K7KA 4IFVB 5B0EA 4ZN3A 1IBKJ 1XQIA 5HK4A 5T14A 2R8JA 4LF7J 2EBEA 3DLEA 1W2BR 4CM2A 2MQQA 2BKNA 5E3CA 1HI0P 3OXLA 4HH1A 4NLWA 2DR6A 4A4JA 3TUPA 3M30B 2P9GA 5F8JA 3LP2B 1N5SA 1OJ4A 3WQPA 2AEJA 4K4ZA 3LH2S 2XY6A 2WSFC 3F56A 3HHNB 5DG7A 2VDHA 2G1DA 3I9V9 1VQOS 4DV5J 4LF4J 3FBCA 2V9KA 3D0HE 2LYVA 3SIPB 4RU9A 3C16B 4JI5F 3B4DA 2AV5A 3W3SA 5DZ7A 4OL8A 3NY0A 2V4QA 4DWIA 2Y3YA 4F3MA 3K5LA 2UXCJ 1NRKA 5E33A 3U1MA 4ZLJA 1RTIA 5E5NA 4XPEA 1NK8A 1LW0A 1EB0A 4ITSA 1JKHA 1QTMA 1J27A 2E7XA 4K7QA 1OQ3A 2IIHA 4LF8F 1U6ZA 3NMRA 1PYSB 4MKYA 4D3HA 1GNKA 2UU9J 1QD1A 4PYDA 2B51A 3LGHA 5JUMA 1G4CA 1S9EB 2FLNA 1JLAA 2GGPB 3R6LB 4IFVA 5KG5A 3CMQA 3FUYA 1VLOA 3P4UB 2AYBA 4ZVGA 3OFEA 3T1HJ 2XHCA 3SV4A 3RB4A 1JQGA 3I0RB 1BXNA 2IFXA 3EUNA 4JV0A 3GIKA 1CJTA 2M88A 3R5BA 1ZTTA 1VHFA 3KMSA 2OD6A 3PIPQ 4YR3A 1T95A 1S4EA 3BV8A 4KB7A 1N0VC 3THPA 5BYSA 3NEKA 4EYHB 3MR6A 3SCLE 2ZZTA 2OPPB 1CJKA 4RU2A 2DKOB 4C48A 3PO5A 2B4PA 1FXLA 2BQRA 4JV5F 5A2QY 1CJUB 4RWXA 2GNKA 2RIJA 4RL1A 2YKNA 5KFVA 2HFZA 5HJXA 3LPEA 2LQ5A 2E9ZA 3DLGA 4WE1B 2HLTA 2CQCA 2V8GA 1KQSR 4RW7A 1N56A 1BUXA 4QW8A 4G1PA 2K06A 1R8BA 2IVMA 1RU2A 3CD0A 1YTYA 2OAUA 2G9OA 2EKYA 2R4FA 3VTIA 2VHGA 1HNIB 1QTNB 2DNYA 2HWTA 2FC8A 3Q8YA 3UDCA 1JXLA 2VC1A 4FZVA 4ICLA 2GGPA 5D78A 3M2RA 3HD1A 3AJ2A 3OHBA 1SC1B 1XMBA 1REVA 2MTLA 2PC6A 3FMBA 2E5GA 3J7YI 4QW9A 5KAKA 1FDNA 2DRBA 1GEHA 3O8WA 1UEVA 4CO5A 4NCGB 1EZZB 2DHXA 4PZVA 1N33F 2C3PA 4M5DA 5G0RB 3CDEA 3ENAA 3MTKA 1Y5LB 3ZZYA 1S77D 2OPPA 1SV5A 5KFHA 3T1HF 3D0GE 4DV1J 2HHSA 2OFHX 1VRUB 1IN0A 1RCOB 8AT1B 4LF5F 1O51A 2YKQA 1GX5A 5HI7A 3TZYA 2VFTA 1YLXA 3UQSA 1I51B 1GH8A 2Z8QA 3R5CA 1N5VA 4QIFA 1TL7B 2W2NP 3EZ5A 3SSRA 3SDEA 4YDDB 1RAOA 2H1YA 2H48B 3HHLD 3QIPB 4X62J 1QSYA 1VQ8S 2WBRA 2GQQA 2Z2LA 3H40A 3MAQA 4HI2A 4PG8A 4ZLPA 2POKA 5I3QA 4WFAQ 1R0AB 4C8OA 2GQCA 2HVZA 3JTNA 4M95A 1RBLA 4OHWA 2GAGC 3BBFA 5E0OA 5EUHA 3QGIA 5L9NA 4UQGA 2JLGA 3OW2R 1G2EA 1ZYQA 2E1CA 4ZJOA 2PA3A 3LOUA 5CD4H 3Q0AA 1DBDA 1JKHB 1WTFA 1TL1A 4PEOA 1TKXA 4FYWB 4P75A 4X65J 3VV2B 3PHEA 1KHWA 1S1XA 1FWLA 3QZ7A 1G1XA 2AGPA 1EARA 3MR2A 1FKPB 1RAAB 1WG1A 3SQGA 1N6QA 1PJ7A 3CPWR 1K0TA 2RS8A 5K8MA 2VA3A 2CPYA 5GAEU 1BLUA 1F2HA 2NUUG 4PAAA 3F0NA 4QR0A 2FQQB 1VI7A 3EWGA 5F9LA 5AXNA 1TUGB 3W61A 5CZVA 4CO3A 2LECA 2JWNA 1ZZNA 3K2YA 2DPJA 2E5LJ 4NLQA 3JSRA 3PRBA 3NGKA 2QMUB 2Q6CA 3TJ8A 3MR5A 2HMIB 1XNRJ 3IXQA 3NNCA 5EDWA 1LWCA 4O3PA 3GIJA 3E3XA 5DDQC 3C2PA 2CJAA 1KONA 4R25A 5D4NA 3BZQA 3RJMB 4ECZA 5CXTA 2IRXA 3PO4A 3BGRA 2DJWA 2GO9A 3VAFA 4QWBA 1CLFA 2KU7A 2VKRA 1T9VA 2DY9A 1U6FA 3VVTA 3LWMA 1KVJA 1R27B 1VQYA 4N56A 5D8HB 2KZMA 2H3EB 1KQKA 3NL0A 4UOFA 3GYNA 2I2YA 2B7CB 4H54A 1CVJA 2W2QP 3D4JA 2VFVA 2B7BB 2W25A 4IFYB 3CJ8A 3N0VA 1NM2A 1JJ4A 3RBXA 1FDDA 1WD6A 2AYGA 2PDAA 2C1EB 4NLSA 1UEKA 4C98A 4NLTA 1JK9B 1BMQB 4HTJA 5K14B 3KTQA 2XSJA 3W1YC 2IBOA 1B0PA 3MPWA 4AE5A 3AA8A 3C14A 5KFBA 3FSXA 4LSLB 1N32J 2FYXA 2QV6A 3C6UB 3EDRB 1HD0A 1NAQA 3D1OA 3SXLA 4U8YA 4ETXA 1D8YA 4JV2A 3LPYA 4YR2A 2AX1A 4Q7AA 2X1AA 5IS2A 3PW0A 2OPRB 1NKBA 4IQXA 3OXFA 3VAGA 2XNRA 4ANDA 2OHDA 5LSOA 3H5SA 4NOHA 4WYLA 3U7JA 2VQEJ 1IKXB 3QMQA 5DG8A 2I9SA 1JXVA 3VHQA 4CYUB 1QSLA 3PX6A 4XDCA 3T6JA 2ZUGA 3HHEA 2LEPA 2FVCA 4RO0A 4ZK7M 1FJGF 1NZAA 1W7WA 2V69A 1HNXJ 2ACMA 1C0UB 1QAJA 1SI9A 4MK8A 1H73A 1R3NA 4FYVB 5D4OA 4Z37A 4RPFA 4AL7A 3T5LA 1HBNA 4B9MA 3MDFA 4QQBA 2QE5A 4LUBA 3ZZPA 4DR2F 2LEBA 2ASJA 3FJ2A 2ZD1B 4F4YA 1WDDA 2RB7A 4OYBA 1D3WA 3DU5A 2AYMA 3M8PB 4GO7X 3W7BA 3W8PA 1RE1B 1NNDA 2DBBA 1CJUA 4PUOB 1R6VA 1X0PA 1V6HA 4RNMA 3BKFA 4JI4F 2XLIA 2GW8A 2QLXA 1XMOJ 3GP9A 4J9KA 2HZVA 2MB0B 4G1QB 3MMBA 2ZBCA 3E01B 2MYFA 1CULB 2DNPA 1VBKA 4OZ3A 5A6WA 4ECWA 1K73T 3PG9A 5IOLA 4I1TA 4ILRA 2ADBA 3W9IA 1HPZB 3TVYA 1WJ9A 2HWIA 5HAOA 1QDUB 1XR7A 2B9XA 3TWZA 4CT9A 4RW4A 1GX6A 4DL3A 4J9PA 4ZS6A 3MTJA 1KP6A 2FY8A 3CCJS 3EICA 1ZH5A 3PHTA 1X9MA 1T05A 4RW8A 2O01C 2EG2A 4CLWA 1JX4A 5IQQA 2CPXA 5J2QB 1WTBA 4NLDA 1RB0A 2CQ1A 2QEXS 3WC2A 3RRGA 4RW7B 3DLJA 3NS6A 5DG9A 2GHVC 4KRWA 2CVEA 3J7YU 2IPOB 4M63A 2O5DA 3MPDA 4RBVA 5M2PA 3MEGB 1VQMS 3IG1A 3C19A 4PXDA 1EX8A 2HQGA 2X7IA 3DU6A 5HQLA 2HFUA 2PD1A 1L3VA 1NK4A 3KUHA 3QYYA 1CJVB 4J9NA 2NLWA 3A3PB 3CJ4A 3K7RA 3O6QA 3QO9B 4ZIWA 1TK8A 4EZ9A 5ETQA 1Q8KA 1Y0HA 2F8MA 1RWKB 4OHXA 1C2PA 3KG0A 3N79A 2PMWA 1H0HB 2PO4A 2HFSA 2JX2A 1NHUA 3DCAA 2E9TA 1QUVA 2VH7A 3HK2A 4LBIA 2KRBA 4DL0C 1DURA 2I6WA 2LCWA 2XY7A 4C0HA 2OO4A 2G2OA 1TL5A 2GMLA 2R8IA 2CQGA 3PW5A 1H6KX 2VJVA 4LRAA 4P73A 3RR8A 1MWZA 2RD5C 1XMQF 5E41A 5KOWA 5CZXA 4WF9Q 1SB6A 4LFBJ 5H9FJ 4BC7A 1O5JA 2DNZA 2OPQB 3H4DA 3V6DB 4LQ3A 2ROEA 3UCGA 2FHOB 2GO8A 3AH6A 4RW4B 5SZTA 4C8YA 1VQKS 1Z2LA 2IJNA 3ISZA 4MMOA 2DR5A 5KFIA 3QIPA 5KFZA 1LXNA 4Y2CA 2IM2A 3KXDA 2RQCA 4KTQA 2D74B 2M4MA 3HF5A 3MEGA 3RW7A 3DXBA 1UTAA 2CQ0A 3X1LB 1KOHA 4KT0C 1S99A 3GPAA 2ZE2A 4NA3A 1VR6A 2GA7A 2W7PA 2QSFA 2KN4A 3IG1B 1QM9A 3AJ1A 4MYUA 3JQMA 3QO9A 4CH7A 1JNZB 4DV3F 1FNXH 4JI5J 1C0UA 2LA4A 4DDFA 2W7OA 1KEKA 3M7VA 3KG1A 3TEHB 4QYZJ 4UTGA 2ZBQA 2DH7A 4UUWA 4CO4A 1FE0A 3TRGA 1P27B 3PYDA 1FRHA 1HBOB 2ZBIA 5GAGU 1U1OA 3WDOA 4YFUA 2ZJPQ 3MM5A 3FZ2A 3ZTPA 3AFGA 2OSQA 2AJ0A 5K20B 2V63A 3QWUA 2PE8A 3MM7A 1Q1KA 2AYEA 2YBVA 2Q1LA 3HHDA 4MTPA 4O3NA 4OZ1A 2QN6B 1IBKF 4C8KA 2D3ZA 1UZDA 3HHLB 4P10A 3HT3A 2PMZD 1SJQA 1W2IA 3W5YA 3RAQA 3EM1A 2ASDA 2GIRA 2W9CA 1CULA 1DQAA 2L41A 2HFVA 5IWAF 1Q0NA 2D3O1 5BXIA 2M8DB 2O1PA 3EDQB 2FJWA 4X4UA 4Q8EA 4I7FB 4DCJB 2GS8A 4B3RJ 9RUBA 5J2MA 4IFYA 5ETRA 4PWDA 4DR4J 3MCOA 3Q8SB 1WHVA 2GIFA 1TP7A 2WZ1A 4LSNB 1OMSA 2OKQA 4P6QA 3BGRB 3TNVA 3DKDA 1C1CA 4LIRA 2MDAA 3SYZA 2ZZMA 4GC7A 2WW4A 1D0EA 1RTDA 4FVCA 1S7IA 2C2MB 2LDYA 5LOQA 5A2QU 4FPIA 2V50A 2BACA 3A13A 3I96A 4QPTA 4FVMA 3L09A 1Q8LA 3MUVP 2QLBB 4KH0B 1HR0F 4NPOA 1CJTB 4WFXA 1WG4A 3GJSB 4NL5A 3S01A 2GC8A 5HP1A 3NBPB 4X65F 1PO6A 2XYHB 2X1FA 2OPRA 4X4NA 2K8GA 4DU7A 3GMGA 2DXFA 2K1RA 3MM5B 3QGHA 1S48A 4P2FA 4CQ1A 7FD1A 3HJFA 1IKXA 4DQPA 1PG5B 4DR1J 2V2KA 5AXMA 2KRRA 1QVGR 4F25A 2FDNA 5CYQB 2UXCF 1F2GA 2VQFJ 2JFDA 4DUZF 2KM8C 1SQGA 2J7KA 3MGJA 4KHMA 1JXEA 3FZBA 3R7SB 1N5YB 3M9NB 4USIA 4HTIA 1Q53A 1RDRA 2J9CA 3V5RA 1NPPA 2FJAB 5JMNA 1HNWJ 5CD4A 2RILA 2YQ1A 2OUGA 4I68A 1KTVA 4DR5J 5H9EK 5GADI 2BW7A 5J2MB 1S4FA 4NLOA 1K9MT 1NDCA 4NYOA 4DHVA 1DFDA 3GR1A 1U7LA 1DARA 4NEZA 2I5JA 2J6UA 5IV3A 2L9DA 3D3BJ 3ETOA 1MNEA 3LAMA 4DV1F 2A6OA 1FA0A 3O1LA 3IR5B 1C4AA 4HH0A 2MKCA 3NXZA 4DL6A 4NLUA 2XGPA 1FX2A 3FBBA 3G8SA 4YUDA 4IOCQ 1JNRB 3CJQA 3M05A 2F8EX 1ULRA 2LLZA 3AOAA 3FGVA 4USJC 4ER8A 2JLFA 3PR4A 4R8UA 2YWKA 3U1LA 2I38A 2VG7B 3TX8A 4RBUA 1YJ7A 2HIYA 1H7XA 1IKVA 1PBUA 2CJQA 5J1NA 1GMWA 3K5MA 2H4YB 3MM8A 1VISA 4U8VA 2ATLA 4NZ0A 3CD5A 2XNQA 2FLLA 3GONA 3CO9A 2ZBPA 5KFKA 2UUTA 4LF1A 5SUHA 2DCUB 5LJ5Y 2R7SA 2CKWA 4QWDA 2QZ8A 3QGGA 4OZ5A 2R2UA 3GIRA 3J81j 3KLFB 1FRKA 4DCOB 3HPOA 4AFFA 3CXCR 4EBEA 4J90A 2DH9A 4V1Ak 1K44A 4ALZA 2AIRB 4G3IA 3SZ2A 4B3SJ 2GJIA 1DHMA 1LEOA 3H7HB 1S1TB 3T9ZA 1KN6A 3QWPA 3IAS9 5LMNF 5I42B 5KFJA 5BR8J 3HSGA 5KG4A 3EVMA 2X3GA 3BDEA 3P5BP 4USUA 5EWEA 1RYSA 1JMTA 4OFZA 2V2ZA 3WBZA 5D0HA 2K2PA 1MW7A 4ES2A 2BJ7A 2J9DE 3ELHA 1U1PA 4X2BA 2KJWA 3VGTA 4JI6J 1HNZF 1CSJA 4BWJA 4I6YA 4DPXA 5I3UA 1Q79A 4N8NA 3RAXA 3JYTB 3BR9A 3P3DA 2YNFB 3RB0A 2KVQE 1FXRA 5DQIA 3AD8C 4QWCA 1SKWA 1TKTB 2L9NA 1H3DA 3H20A 3OR1A 3CB4A 5J2QA 5HLFA 4U7UD 3OUYA 1F5BA 2DRDA 2C2NA 4IKAA 3KHGA 2IC3A 4ZCMA 5DLGA 2B5JB 3HXMA 2GIQA 3KG4A 3RR7A 1A6LA 2QLWA 5EX3A 4ZMMA 4NXNF 4KC5A 1N34J 3NGDA 2VG7A 3TVZA 3MM8B 4DV6J 2B3TB 2LQ8A 5FLXY 2V2VA 1RTDB 5IT9U 2EK1A 1IKVB 2L9WA 4CRJA 4X66F 2UU9F 4MT1A 4FKXA 5KT7A 2A10A 1M5HA 1ZM2A 2OD4A 2HLUA 1C4CA 3QZ8A 2UXDJ 4AQYJ 4BHQA 3DYAA 4ZOSA 1JLBA 4LVNP 1NJXA 3EVWA 4OI0A 3K5NA 3GZ7A 3K17A 4J91A 1NDPA 3ETMA 4QU6A 3THTA 4KPYA 5CYJA 1DAXA 1E6VA 2HNDB 2WRMA 3H42A 4F8RA 1Y5IB 3FSYA 2M3DA 1S0MA 2C2ZB 2PIIA 3HI9A 1RT4A 4OX7A 1TR0A 4C7QA 3BQ0A 3RBEA 2C22A 4F02A 4EBCA 2AX0A 2V68A 4ZP6A 2RU3A 2EWHA 2KO1A 2A2CA 5KG3A 1LWEA 2CZVC 4GMKA 2F4FA 3D9BA 2HBQB 1XWLA 4FS2A 4PABA 3I0SB 4FYYB 4ECYA 3SFGA 1TK0A 1KS2A 2KB2A 2DNMA 3ILJA 4FPRA 4NCGA 4A46A 4DV6F 1HL6A 1MN9A 2KYZA 3QPIA 4OQJA 2FPHX 4JP8A 5KT4A 5A8KA 5HANA 1YJ9S 3U02A 1I5OB 2QA4S 1KD1T 4PQUA 1FRIA 5B0GA 3DMJA 2ZOFA 1SVDA 1O6XA 2W9CB 2ZDOA 2CPDA 3V2UC 4KE5A 4QPXA 3Q2TC 1KTQA 4O44B 3C6UA 3TX0A 1FCAA 2EPIA 1Z4UA 3J81U 4FYDA 3HSZA 3DYAB 3IR7B 2BA9A 2YVSA 2CPFA 2N4DA 2FC9A 3VF0B 4TLQA 3HVWA 3DGPA 4JI6F 3T1YF 2VKZG 4I7FA 4Y2KA 1YITS 4ZKAA 4ZCLA 5EWGA 2JVOA 1RTHA 4RNNA 1HQ2A 3KDOA 5KTQA 3KLHB 3B8HA 1GXUA 2F4VJ 4LSNA 5AJ3F 5KFTA 2JVRA 2HHUA 1C1CB 1FFWB 3CDAA 2AQ4A 1RT4B 2UZAA 5AJ3J 3AOCA 1M5VC 4YY3F 2R2SA 1T7PA 4FF2A 4PR6A 1WEZA 3H2UB 3K5PA 4NX9A 2XHWA 4RNOA 1G6BA 3BQ2A 3T1YJ 1FERA 3VVUA 1C0TA 2D41A 5EX0A 2W24A 4K5RA 1T03B 3KYLA 3PR5B 4I2PA 2FHMA 3OTEA 4I2QA 5L1JA 3H59A 1EHWA 3CSKA 3RRHA 4NA1A 5GADU 1VQSA 2K3KA 3GLJA 1BWEA 4ZCIA 3OSNA 3M8WA 3PFOA 4WXOA 4J9RA 4C8LA 5D0GA 5E7OB 3OUYB 5M2RA 4JI2F 1WWHA 2XWXA 3LW5C 4F2RA 3M4XA 1R8HA 2B5JA 4P9SA 3QLHB 3BO4A 1A0OB 1S59A 5GAHI 1UW9A 4PWWA 4WU2A 5HN0A 3GFYA 3OL7A 3VALA 3H5XA 1R31A 2YNHA 5U47A 3KWMA 1FK9A 4JI0F 4LT6A 2KZZA 2WVFA 3NS5A 5D3GB 1L3UA 3MWBA 3ENWA 5CYMA 4F2SA 4ID8A 4Q0BA 3W63A 3AB2B 2RSQA 2ZNZA 4ID5B 3B54A 4DV3J 2CQHA 4HDHA 3M32B 2ZE2B 3IRXA 4UQTA 2MKHA 2CNKB 5E3PA 5AE1A 2UVRA 2HHHF 1UJ5A 1HNVB 2VG6A 4JI8F 4DJBA 4ZITA 3EPGA 4ECRA 2Z4PA 4A8FA 2PT0A 1JLGB 3D1QA 1N4LA 1UAWA 1FX4A 5HMYA 2CQ2A 2GMJA 1U09A 4LFAJ 1J5EF 1WORA 3D2WA 4HDGA 3UNYA 3LGMA 2ZFHA 4PYAA 1IM4A 2W4CA 3FBFA 4L3NA 2WCXA 5HMXA 3CCES 4I2PB 3RBZA 3KOAA 4P7VA 2UXDF 4EBDA 3CJSA 3V4IA 4JI7F 3EGNA 5A76A 4N76A 2V4RA 1EETA 1NSKL 1XMQJ 1FKOB 2HNYB 4K2JA 4KFBB 5HMWA 3M2VB 3HKZD 3NWRA 4KAIA 3UN2A 1TAQA 5F0UA 1NK5A 1IM6A 4RW6A 5DQGA 3GE9A 1B70B 1YRXA 3WC0A 5CA5A 4DR4F 4B3OB 2J0XA 5C42A 3ZZ0A 2YNHB 1NHKL 3KUGA 3C46A 4BLGA 4QBUA 2YX7A 3CJKB 4YDXA 4WK3A 4F4AA 4LRFA 1N0UA 4B9SA 1H38A 3PX0A 3R3TA 3QQCD 1TFYA 3GFHA 2R7OA 5KT5A 2Z58B 3N5FA 4ECXA 3G82A 2MLZA 3DOKB 1SC6A 1FO1A 2IVYA 3LP0A 8RUCA 5A8WB 1IKWB 1YG0A 1TV6A 2M70A 3J7ZT 2AT1B 1Q5YA 2DGUA 4GO5X 4ZHRA 4IOAQ 1AFIA 3POTB 3LWLA 2F4VF 2VU5A 2N7CA 3MCNA 1CC7A 2F7VA 1WKLA 2PN6A 4C11B 1HYSB 2MLYA 2NS1B 3OPKA 5IM0A 3J7AN 5ETVA 2MJUA 1T8EA 5KG2A 1HA1A 2ROGA 1S6PB 4FXDA 2K1RB 2Z0GA 2RHQB 1NO8A 3OR2A 4EI2A 4CZCA 3I5AA 3M8QA 1KQFB 3CJ0A 1Y11A 4WPAA 1I94F 1UW4A 3BH6B 3CULA 3FK4A 2VB6A 4QIWD 4DL4A 1WF1A 2WSEC 4B3MF 4FKYA 3MFHA 2WONA 2M7SA 3KJQB 4DS5A 3AXMA 4WIQA 1Q16B 1XC9A 1UA1A 1PAUB 4KBIA 4RW6B 1UPPA 3TP2A 2Q79A 1K1QA 2XMJA 3D6FB 1UJ6A 3L9ZA 3CCTA 4IG3A 3UI3A 5HSPA 1Q81T 3MUTP 3MZIA 2XULA 4XAKA 2H5JB 3TO8A 2N7YA 3GTYX 1T11A 2QA1A 5KFYA 4J9SA 2P8IA 3US5A 2ERRA 2BE7D 3IR6B 5KFUA 3JTPA 3KLEB 3UVJA 4LR7A 1Q4RA 4ZVQB 4KJIA 2WB4A 4OI4A 3W5ZA 4TKTA 3M9OB 4RW8B 4A8WA 2HKEA 2L08A 3NNHA 1O8BA 1UWBB 2RMLA 1QUPA 3C15A 4Q2LA 4OYXA 5F3TA 1H7WA 4YB6A 2ZZNA 3HT0A 5B0BA 3M6VA 3I5CA 1HYSA 1YBUA 1TMMA 1YWXA 1FD8A 2IHR1 2G1HA 5KFDA 4KO0A 4WZMA 1Q8IA 2ZC4A 4IH7A 2YKPA 4PXEA 3AD9C 3DRSB 1BWVA 4WYWA 4CLLA 2CPIA 4O44A 3OVSA 1VRQC 4U7UK 4N47A 2JRSA 1Y5NB 2BXJA 2BANA 2OELA 4J9VA 2EBGA 1R43A 1RHQB 1YJRA 2GVDA 1LW2A 4PG7A 4XK8C 3CJ2A 3DC2A 3J80Y 3SQGB 2PSZA 4CLYA 4CWBA 2DR8A 4ZIVA 2YX4A 2LU1A 4CTAA 4DX6A 1JWWA 5CCLA 5IZHA 1HBUB 1V3ZA 2W4DA 3UD5A 4W4MA 5D4PA 2GHWA 3B4MA 4HEA9 4LREA 1SJ4P 3PYEA 5I3UB 2UVVA 1MSWD 3H4BA 2RQ4A 2MQ8A 1B7YB 5KFCA 5J2PA 2AEMA 1SKRA 3KHHA 5KFXA 3JSMA 4K8RA 2FHJA 1TELA 3L7OA 3FMWA 2B4UA 3PV8A 3L4BC 3TUJC 2H4WB 1NKCA 2WAQD 1DTQB 2AJ2A 2B43A 1HIYA 4DPYA 2E5LF 4B9VA 2ZJQQ 3I6PA 2DHAA 5LSRA 3A8IA 1U1QA 3QRPA 1S6UA 2KI2A 3MCSA 4ILLA 3EJMA 3HSJA 2CQ4A 3PNIA 4OYZA 4RW9A 2HIQA 3ZTSA 5KG7A 3BJYA 3W2WA 4QR2A 3UR0A 1VGYA 2W2OP 2EC2A 2MQLA 3EZOA 1RT5B 1YVFA 4HL9A 4DX8H 1FKAF 3DRRA 4IYQA 4NCBA 2M9KA 2LQBA 1REVB 9ATCB 1T03A 2CJKA 4K4UA 2NPFA 4DL5A 4LF9F 1S7HA 4PG6A 3EYZA 2F8HA 4ZN1A 3ZZUA 1D1UA 2KT3A 1VFJA 3JS9A 4GVLA 3KLVA 5G0RA 3MMCA 4Q43A 1U0HA 5C25A 3DRXA 4NEYA 1R89A 5KG0A 5EWFA 2JC0A 1OS5A 3M32A 4RLEA 4DUZJ 2C2EA 3KLFA 5IT9Y 1NEEA 4PCQA 2QA2A 2YPYA 3FDSA 2BJDA 4I69A 1S1VB 4PPZA 3C6TA 1NJYA 2RQKA 3FRYA 4JBCA 3HHKA 5KFLA 1HARA 1SH0A 3MM6A 5I42A 4ZLNA 1U4BA 1LV5A 3AT1B 5LJ3Y 2KHDA 2KHCA 1KVIA 2H65B 4NZ7A 3A8EA 3PYGA 3BO3A 5IQ6A 4OHYA 2M5YA 2QJ3A 1IBLF 4KKOB 2KVIA 2GHPA 3VGUA 2WB1D 3W9HA 2JFKA 2DTJA 2IDEA 2BX6A 3PJXA 1VQPS 3Q2SC 3JAMU 3GIIA 3SQOP 1JLCB 3A3NB 4CP5A 3ISNC 2A1BA 3DHWC 4UF4A 2CPZA 2VG5A 1VQ7S 1RABB 4DQSA 1JJHA 2JEJA 4OJGA 2DNHA 2C2RA 2E1PA 3EE3A 4LMZA 1NMEB 3MMAB 4TNOA 3TVKA 3W2VB 4NASA 5C2CA 5C7PA 2DIUA 4NLPA 4BC9A 4TN2A 3P8BB 2Z30B 3OLBA 2R7WA 3DGPB 2YPZA 4DV2J 3GB0A 4KHPF 1RQ0A 1EKSA 1NHVA 3FEXB 1RTHB 2MKJA 3UCUP 4Q8FA 1VS3A 5A8RB 1FHTA 1S0NA 1FKOA 1R8PA 1YZ7A 4WBFA 4M5GA 2QT7A 1N88A 1CG2A 3AAWB 4OX9J 1X60A 5LT5A 4TQSA 2YWFA 1B64A 2YY3A 3TUIC 1KRPA 1R8CA 2F9DA 4I4BA 1RCXB 5KFSA 2C3OA 1RWMB 1QLNA 1IKYA 2GJFA 1X5PA 3Q86A 2DEJA 3OFGA 1KOOA 2FD2A 5IM0B 4CLZA 2BBEA 4CLKA 3EGWB 4ZDNA 5LM7E 3RYLA 2IJRA 5FDLB 3Q89A 1Z1ZA 3MCMA 1S6PA 4ZPCA 4KGMA 3R8YA 3UDEA 2F9JA 2ZH2A 2WBMA 2XQCA 1OSCA 3IMQJ 2Y1RI 3CIMA 5T7LB 5A8WA 5CH7B 1S9EA 6FDRA 2RQMA 5D0RA 2E9RX 4IR1A 2XLKA 1S9GA 2B4VA 3HZGA 3NAHA 1GK8A 1URRA 1AROP 2DGTA 3SI8A 1IQZA 2XMUA 5H9FK 2DIVA 1FJ7A 2CZ9A 4ED4A 1NKEA 2DO0A 2DHHA 4DR3J 4K4YA 3NNAA 2ALZA 2IYIA 2XMKA 4LRBA 4ZJQA 5GMKa 4TU9A 2YQ3A 4RX6A 3G6YA 1RAFB 3FC9A 3M8QB 3E2EA 1LXJA 1FFSB 2QSWA 2J0WA 4JV5J 3LA0A 4B9UA 5HQ8A 4X4TA 4LFCJ 3GWCA 2EK6A 3FNNA 4KSEB 3BGOP 4J9LA 1HWUA 4B08A 2EKNA 3BKUA 1LFWA 1PC4A 2XI3A 3I56S 1NK0A 3BS9A 3C14B 3DM2B 4DPTA 4YHHJ 1N48A 3A1YG 2QFIA 1RWUA 1D9DA 3HFKA 3QSIA 3G71S 1YGYA 4OV6A 2XLJA 4OYMA 1FJGJ 1X4DA 2R8HA 2OMOA 2P6TA 4LJMA 1S10A 1RYRA 2N3LA 2HAIA 4M5IA 4TU8A 2ZH1A 4BDPA 1UWAA 2M52A 3PRDA 1QY7A 2R7QA 1HFEL 2XZTB 3QRQA 3FQKA 2E1RA 4LFCF 2QX0A 5ETMA 2KXHA 3PYFA 1EAYC 1SL1A 5DS7A 2ZNYA 1H72C 3DRPB 2X1GA 3T19A 1WC0A 3FCWA 3VAJA 4YB7A 3KK1A 2IA6A 1Q7LB 3UFCX 5L39A 4LF5J 5ETTA 3ZZRA 2VPZB 2RF2A 3P96A 2KM8B 5HLFB 1TUVA 2HVEA 3VAHA 4DR3F 1LWCB 5LMUJ 2IM3A 1B0VA 3H90A 2YNIA 2ZEJA 5LXYA 1HBMB 1AYEA 3KLIB 1WI8A 2EXUA 1QAXA 2R7XA 3K8VA 4FNIA 5ETNA 4M94A 4C9DA 1RHRB 3K5OA 1HWIA 1S6OA 2HBZB 2UUWA 4KR0B 4JOUA 3A4TA 1HBUA 4ZPDA 5DM7Q 1WSVA 1HHTP 2O3DA 3S8SA 5AE2A 5J2NB 5EGYA 5K8OA 2AMCB 3CF5Q 4DUYF 2EG1A 3ZNJ1 2KYXA 1RT6A 4DV5F 1MU2B 1VJQA 2CPEA 2O66A 3QLHA 4Y65A 2OP5A 2QG9B 3CJTA 3M6XA 4HHUA 4GKKF 2BQ3A 3FQLA 5HBMA 1NJZA 1PSDA 3H0PA 1XNQF 4EFAC 4IQMA 2E66A 1B4SA 3OTBA 4IR9A 3MAAB 1VOMA 2BE9B 2BJEA 1UEUA 2HNDA 2B56A 2N3OA 1UVMA 3M8ZA 2CJYB 2PI5A 4HR2A 2BKPA 4C8NA 1Q7YT 4C4WA 2AJ4A 2GMHA 2WW8A 3W65A 4DOZA 4DG1A 4O0IA 5F8LA 3GV5B 3EX7B 3H5UA 4C0OC 2NSBA 2P9CA 3ZO7A 2CRLA 4RW9B 5HVFA 3UD3P 1ZPVA 2VJUA 2XZDB 1KLMA 3VAIA 5C24B 3CE8A 5FJ4A 1NH7A 1VK3A 1UP1A 5D77A 1QAYA 1QAIA 1X4FA 4Y3CA 2KT2A 1GMWD 4MFBA 4MYTA 1OPZA 3MEEB 4M5KA 3SDEB 4N5SA 2W9BB 1RAGB 1UA0A 4OYOA 3M6UA 7FDRA 2VF3A 2RJZA 3GCWP 2RNEA 3PJWA 5I3PA 5L1KA 2IAJB 3CD7A 1NK9A 4USMA 5T7LA 1NPKA 2VPYB 4ETZA 3V6HA 3CDUA 1FDBA 3R5JB 2JHEA 2FVQA 1M5PC 1WF0A 5DZ6A 5J2NA 3W62A 4PQUB 3OV7A 4CLUA 2B0GA 2BJ1A 4I64A 2UV8A 2C2KB 2E1MC 5ITHA 1DJ0A 2DGWA 3JQKA 1WUUA 1XIQA 5T41A 3VWSA 2ZHBA 4B9NA 4JV1A 3P45B 4TY9A 3DLEB 5CAAA 3K58A 3HFZB 1HBNB 4JI7J 3DI6A 2EC0A 2IMOA 2XGQA 3DLKB 4NMLA 1XJWB 3G96A 3RBDA 2XM3A 4RJVA 2HZAA 1CC8A 3CW2C 5K5MA 4DV4F 2OGUA 4RUCA 1FJCA 2EI5A 4K2XA 1U1LA 4C97A 4QCLA 2ZWOA 2KG0A 2NXCA 5F8GA 4ED8A 1QSSA 1VQ4S 1RWVB 3R97A 4CNZA 4JI8J 4WCEQ 3OVAA 2L48A 2HG4A 4HT7A 3RU0A 2VASA 4DV4J 1YJTA 1ROFA 1GXLA 2BZ2A 3LQVA 2UV8G 1IR1A 4DN0A 3OJSA 3LGNA 1EJ7L 4PQAA 1RHKB 2IDLA 1LK7A 3I4HX 3ENQA 1WC5A 5DGAA 4IUFA 1YBTA 4CO1A 3ZXWA 2AD9A 1U2CA 4C0BA 1VK8A 2B9YA 4CI0B 3P5TL 2HEKA 4U96A 2CVIA 3ENVA 4NE9C 2W9BA 4ZPAA 2DNLA 2JSXA 4F4ZA 3TA0A 4CT8A 2D3OR 4ELVA 3PKYA 1WC3A 4E0DA 4F0HA 2MEWA 1UETA 4ANCA 4EGLA 2AHOB 2ZKTA 3BN4A 2DGXA 3EPIA 1VJWA 1MROB 3A8KA 3KJNB 3M8RA 1CQMA 3NGSA 2F3JA 3G4SS 1BC6A 1VCTA 4MKBA 1Y00A 1UL3A 1VRUA 4PKDB 1UKUA 5B0DA 2J7WA 2GV1A 4MJKA 3W8GA 2BDPA 3MHYA 4A8XA 1VBYA 2LXIA 4K4XA 1EKRA 2HAFA 1YJWS 5DDRC 4LF6J 1B0TA 2Y8YA 4FBTA 2DK2A 2AJFE 1I94J 2B4OA 3G2XA 4C3MA 1TMJA 4DPWA 1X8DA 4X4RA 4NLYA 3BYPA 3E8OA 1NZ8A 3I5BA 2VUGA 2QYCA 3N6MA 5K14A 5KFOA 3EXYA 3VGVA 4X4PA 4PXBA 2UUBF 2OH2A 1YZ6A 3ZTQA 2Y0BB 1NK6A 3ZFVA 5EN1A 1DRZA 1UMJA 2FZKB 2DVIA 5CCMA 4ZVPB 1D9AA 4FXVA 4ZPWR 3WIUA 1T94A 4A48A 4UY8T 2CUYA 2Z57B 3DRRB 1U47A 2MQNA 1TL3B 1NK7A 3Q23A 2XWYA 4FBUA 4UOGA 1RWOB 1GAOA 2J5AA 4WKRA 4F36A 1S97A 5JJBA 3ADAC 3TAPA 5KOXA 4WTYA 2N4CA 5IT0A 5H9EJ 2VODA 1FKPA 1OWXA 5F8HA 4YMEA 5GMEA 1U25A 1VHIA 1ZS6A 4P2XA 4X4QA 1BQMB 4DUYJ 1N6QB 2CPJA 1T0TV 1PGZA 3NMAA 1U0SA 2FHJD 1EETB 2Q66A 2OEKA 2XS7A 4DFKA 2DGSA 4TY8A 3M2VA 3MMBB 4JI1J 4ZPTR 2OPSB 2F1FA 3D28A 3CMES 2HQIA 4XIUA 2FLOA 3FFIB 2BMBA 4TLRA 4WU3A 5E3RA 5F41A 1KR4A 2G4BA 3T5JA 4ED7A 4CLPA 2HK2A 1UVIA 3M8SA 1O0PA 3RRKA 3ULHA 3N28A 1B99A 1RWWB 2U2FA 2FJDB 1S57A 4MIWA 4LF8J 4TYAA 1MWQA 4PXCA 1TVRA 1TL7A 4E8UA 1ZM3A 4BCAA 5HJYA 1HBOA 5B08A 5MLCV 2FUG9 3LP0B 3FRZA 3MPVA 3TJ9A 1SJFA 2BRLA 3BM7A 5LL6d 5DETA 1PC5A 4OHZA 4X4SA 3CDBA 2F5GA 4O23A 3W9JA 2UXBJ 3PDNA 4RZRA 3IM9A 4LQ9A 3J80U 1U1MA 2PI4A 1IR2A 3MXHP 2AJQA 3RUBL 3ZTOA 4UT4A 2FY1A 1IJEB 1X4EA 2KJVA 4OJ1A 4DZ6A 3C8YA 2KFZA 2LQ9A 3QT8A 3TA2A 1S1XB 2MMYA 5AT1B 3S6EA 2HHWA 1TKXB 5F8MA 3H2VE 2V4JA 1BY9A 1U2FA 2HQCA 3R2CJ 1X7VA 5AE3A 1FDAA 2RUSA 3CCRS 4TU7A 2C2DA 1KBRA 3AQPA 4J7CA 3R6GB 4ATNA 3CCLS 2RDDA 3ET6A 3N9UC 1R8AA 1SJRA 1Y3KA 3FFIA 2ZDPA 2HHVA 2DO4A 1FI4A 4AUKA 1VIXA 2CPHA 1VMBA 3L7UA 4WFNQ 4JI3J 2ILYA 4J9OA 2J9DA 2BM1A 1JIHA 4M5MA 1H2TZ 4IO9Q 1TFWA 1UVKA 3KLEA 4N77A 2QLFB 1F3FA 4OYIA 2HFOA 1H2VZ 1OIAA 5GMDA 4LVOP 4PG4A 1N36J 2UUAF 4K0KJ 2VPWB 3D6TB 3OFHA 1Y4ZB 2J0QD 3KUEA 2DYAA 2W1BA 3KLHA 2ZOMA 4KQZA 4JYAF 2W8KA 2B9WA 1MG7A 3M1VB 2R3VA 3OJUA 3P6YC 1Q8BA 2YH0A 3QJLA 2W2MP 4A8SA 3BSCA 2COLA 3V81A 2HFNA 1RT2B 2K3IA 2V2QA 2XEXA 2ZD1A 2AZ3A 2NXJA 5DQHA 3GIMA 2MHEA 4DR6J 2E29A 1D8ZA 4HLBA 1OSDA 1XR5A 4CLTA 1YQHA 3TUZC 5E3QA 3DLKA 2OEMA 1RUSA 2X51A 3GSIA 3IWXA 3K57A 4ZLLA 4RUHA 3CCWA 4DQIA 1FJEB 2BV3A 4M5DB 2R8GA 1D09B 2FHKA 4OI2A 4DCPB 2W8LA 3PFEA 3PW4A 1UCNA 4I0WA 4LRCA 4N7TA 2DGVA 2NYHA 4TVAB 3UNGC 3J81Y 3KK3A 4LSLA 1MMNA 1RI7A 2Z2YB 4ZJLA 2OTLS 4ZVUB 4LF4F 4A47A 2QL5B 4DFJA 4EZ6A 4H4KA 4QIEA 4DMZA 4XDDA 1GTEA 4B9LA 3FBEA 2AKWB 3FEZA 1IBMF 2FJEB 3ZC4A 3N01A 1ICEB 2SXLA 4IG0B 1UPMB 1PCAA 4PPDA 1YSJA 3D6MB 3G6XA 3AODA 4CH0S 1S6QA 4G65A 1Q5VA 4YS2A 3KK2A 3GFXA 1AW0A 1HI8A 2PFDA 2BOAA 2WVCA 4RKUC 3VQSA 1FWPA 4DU8A 2AGOA 2R2TA 3HJVA 1NPRA 4L72B 2C3MA 2X1BA 2HGMA 5B0AA 4K4WA 3TANA 2EFPA 5C2GA 3HLUA 2MJNA 4WK1A 1Q86T 3D5MA 3HD2A 2R7VA 1L3KA 2MZQA 4ANEA 1HHQA 3MEDB 2MQPA 4QOTA 2UP1A 1P1TA 4IRKA 1WSRA 4DUTA 4MIBA 4KGKA 4OYAA 1ZM4A 3J7A1 4G1QA 2ROPA 1VC6A 4FP9A 4M5LA 2XZWA 3AXKA 1FESA 1SC4B 3FVYA 4LBPA 2CJ9A 2YQ0A 3CWJA 2WTFA 4N8OA 2IC3B 3D68A 4S0MA 4KGZB 4OI1A 4J9MA 1YRTA 2VL1A 4KYZA 3PVXA 4K0KF 1V3SA 5A0YB 1RKJA 4DPUA 4O3RA 4DSLA 2ZH6A 1Z2ZA 4NLRA 5LXRA 3PTWA 2A18A 4DFPA 1KSPA 4O3SA 6FD1A 3JSYA 4FXWA 2VBZA 2Z2MA 5HROA 2DNKA 3BGUA 1TKZB 2C3UA 2RAQA 3DRPA 4R0JA 1S6QB 3KK2B 4PRFA 3BPSP 1X4GA 3CCZA 4I6AA 5JVGQ 1T05B 2F63A 1F0XA 3HX9A 2VONA 2NCKL 2XMWA 5F0WA 1E6YA 3DLHA 4M5JA 2LKZA 3NKYA 1Q82T 3IS9A 2HZCA 4UOHA 4DSEA 3M1VA 1ZA2B 3RB6A 1K47A 5M2UA 1M1HA 4ECUA 1S1WA 4OMFG 2DRAA 4H4OA 1X4AA 2V8VA 2E7VA 2J7UA 3MOZA 1CJKB 4O0NA 4ENOA 1XNQJ 5THWA 1I1GA 4JI3F 4WFZA 2F65A 3Q8PB 3HVRA 2MSSA 3DRYA 4OV1A 4Y2AA 2IVFB 1FF2A 2BJ8A 2XYPB 4ES1A 2W01A 3CGIA 3CD6S 2KG1A 3BREA 2RS2A 2BEFA 4TY8B 4U67Q 5ETSA 4KGVB 1UJ4A 3MAAA 1FWKA 3G86A 3NCRA 4R8UB 3DLGB 1HW8A 1KVKA 4WE1A 4DX5A 1VQ6S 4Y2MA 3F44A 2NPIA 2H51B 4ZVHA 3CDWA 1T9UA 4IG3B 1SIWB 2NR0A 4F4KA 4RNFA 3BF4A 2KDOA 2XB2D 1RT7A 3MR3A 3WIVA 4IDKA 3UE2A 1AZSB 3BQ1A 2RU9A 2DGOA 2ZHOA 4MAKA 5CYMB 5LMUF 3BKTA 3QAEA 1F5CA 2RUGA 4DZDA 2CYYA 4U95A 2M0GB 2HWHA 1GXTA 5B0CA 5D6GA 3OL8A 2E1AA 3GV8B 3MECB 2CFXA 5ETKA 3C3LA 2QLJB 2YKAA 3IWNC 4KY3A 1BGXT 4DR7J 1WKKA 1R6YA 1MMDA 3DN9A 4ZCKA 3VCDA 2PGCA 3IS9B 4A8MP 4WP3A 3T5KA 4LFBF 2D69A 3T41A 5AXKA 2ZHAA 1RWPB 4I6WA 5ETLA 4EU0A 1VQ5S 3ONQA 4B3MJ 1RKIA 2ZH4A 1HHSA 1WEXA 2BJ9A 2OMLA 2YWWA 3AB4B 3KKFA 4UZCA 5HP1B 4Q5VA 1NJIT 1GQEA 2PA8D 3DGVA 3EVOA 1X5TA 3C66A 3CJRA 3DRSA 2QIFA 3S7RA 1RBOB 1EQMA 1Q95G 1P9YA 2N82B 4DQRA 3ITHB 3ZZTA 2ALYB 2V9WA 4DR6F 2HGNA 3D66A 6AT1B 4OZLA 1S0OA 1WHWA 3VZIA 4ECVA 4BS2A 2CG4A 5KFRA 2QO3A 2XI2A 3PEJA 3QBCA 5KFWA 1U1RA 4J9QA 2HQFA 2MZSA 2WSCC 2ZUAA 3D67A 3T6BA 1ZOTA 1LNQA 4DF4A 4FF3A 3MM9B 2Q3PA 3NOCA 1XERA 3K8WA 1SJ1A 4ECSA 2XSJB 1RT7B 1SV5B 3B6BA 2PFFB 2E5IA 3EZUA 3TR5A 1MLAA 1OYEA 3ILIA 1N36F 3CMAS 1N5YA 5F8NA 4HACA 1LWFA 2GVZB 1UZHA 2IJFA 1FRMA 2QA4G 3T3FA 2NUHA 1RP5A 1P1LA 4Y0FA 1W25A 1LWEB 1JLAB 3TQ1A 1AUDA 3R5GA 1JB0C 2YKMB 2MSTA 1QE1A 2HS3A 3E51A 2FJBB 2V8HA 3I0RA 4HHJA 2JNJA 2DNOA 5BR8F 4DR5F 3V6KA 3PW7A 3PXGa 2MQOA 1X9SA 3OT9A 2XG8A 4CYUA 2XMVA 3SCIE 4NI2B 4C11A 4Q45A 3GQCA 1U49A 4DQQA 4B3SF 1S5ZA 1NH8A 2GCFA 2BABA 1PJ6A 2V6AA 4ZVOB 4OX9F 2DPIA 3GR0A 2QYGA 3UN5A 3DMJB 4JI4J 3OSPA 4P74A 5FD1A 1LKZA 3DOMA 3OLAA 2CQPA 3TOQA 3CEDA 1X4BA 3SCJE 3HM9A 3TARA 3V6JA 3CC4S 3NGUA 1U24A 2OFGX 2HRTA 2KXFA 3QT5A 2RDIA 3CJ3A 5IV4A 2HMIA 2NQPA 3NWGA 3LP2A 1NBEB 2UVUA 2BE2B 3UWTA 2QL9B 2APOA 1S1TA 2GX8A 2MZJA 3BSAA 2ILZA 3M6WA 3MMCB 3O5TB 4C3LA 4CIOA 2V0NA 2HHHJ 2D9PA 2MPUA 5IC4B 4L3KA 2ZH7A 1FNOA 3PJ9A 3AHPA 5MAOA 3V6DA 1FRXA 3GYXB 1WHYA 3IP0A 4QWAA 3NAIA 1NLKL 3HKWA 1TAUA 1F9EB 3KHRA 2OPQA 3Q8QB 1A9NB 3BEGB 5C24A 2FB0A 1SH3A 3GJTB 2Q43A 1IBMJ 4B3OA 3DDNA 4IDKB 5C42B 2NSCA 4MFBB 5DRKA 3AA9A 2BQUA 1PBAA 3ISND 3QFWA 3MEDA 1H98A 4MKAA 4P2SA 4I2QB 1XTZA 4FS1A 3H2LA 2UVWA 2AF6A 3BDPA 2NXEA 1B3TA 4AD6A 2XSFA 1ZA1B 3BBBA 2AP6A 2MZTA 3IO1A 1H2UX 3MPUB 5L9XA 4DEZA 4F0MA 3CC7S 3CCUS 3LP1B 1JLEB 2MXYA 2FLPA 4F04B 5L1LA 1CEZA 4M5NA 2G0CA 2D3UA 1HLWA 3MI7X 5L38A 2HNZA 5KT6A 1J5OA 2DNGA 2O67A 2OPSA 2KXNB 1F5AA 1C0TB 4Z7YA 4B02A 2Y1JA 2Y9HA 4DL7A 2XC9A 3O2IA 4TXSA 2V8PA 1KWMA 5CHCB 2GVDB 1CJVA 4A8KA 4K5SA 4NWBA 4KV8A 3QIDA 3MUMP 1RSCA 5HROB 2ZH3A 3OR2B 5IC6B 5IWAJ 3OL9A 5KG6A 1TKZA 5D0EA 2BE2A 3BGLA 5F8IA 3TZXA 1K1SA 4LR8A 1TVRB 2IM1A 1U02A 4HHHA 1L5UA 1UVLA 2IRYA 2AEFA 2YTCA 3HVTB 3LANA 4OLOA 2FJVA 3KMQA 1NU4A 2W4PA 3KLGB 3GCXP 2J8AA 5GAGI 3UO0A 3W66A 1YX2A 2BW2A 4XTTA 1TL1B 4F3OA 4B3RF 1Y10A 1UFWA 1VDHA 4LF2A 3KNAA 5LSLA 1FK9B 1APSA 1LQ9A 1LWFB 3AOBA 3JSBA 1SXLA 5L8RC 3KJFB 4O3OA 4GKKJ 4AYBD 3WZ0A 3SV3A 2Z2ZA 3VR1A 1KDNA 1AUSL 1NSAA 3H98A 4DSKA 4K4SA 3NGRA 4DV0J 2CA9A 2ZM6F 1OPIA 4OZNA 1MROA 1YJNS 2HNZB 1M0SA 2FGCA 1RAEB 3IFEA 1ITPA 4H4KC 5CABA 1WELA 5HO4A 3PCOB 2YNGB 4AXJA 1WACA 2XMAA 4NLGA 3HULA 2LP4A 4K59A 1JJCB 1XN9A 3SEOA 2JEFA 1SJ3P 3LF0A 1V9OA 3M8PA 4DSIA 4IRDA 1I3OB 5GVQA 4LBHA 3CCQS 1XK8A 1FNMA 3NG8A 5JXSA 1IQTA 2V67A 1URNA 2V8DA 3N6LA 1UFKA 1PYTA 5DDPC 3L3CA 1GTHA 3BPDA 2QMXA 1G7CB 1M1GA 2BANB 2BJ3A 1GMVA 1E6VB 1MWYA 1NCLA 1RHMB 1LW2B 3QRRA 3QT6A 3KLGA 1Y9OA 4QYRA 1XBWA 1PJ5A 4OX8A 1S1UB 4CH1A 3FCVA 5E3AA 1PKUA 5BYQA 4CO0A 1RTIB 1FTRA 1TQLA 2WVEA 3V4MA 4YHHF 3MF5A 3BSOA 3VGSA 2X3DA 1RTJA 2VBYA 3EGZA 4X64J 1X4CA 3IA0A 3IGVA 3MMJA 8ATCB 3MECA 1V5VA 3OVBA 2EFQA 2PEHA 3I0SA 3L7PA 3ILOA 3M8YA 3MD1A 1TV6B 1ZTWA 4LF6F 1N5TA 4ZHRB 2P5VA 2JEGA 5DLFA 1TZ0A 4JI1F 1KHVA 4LIWA 3M2UA 3B78A 1N8RT 4BWMA 4USKA 2CNLB 5A6PA 4UUXA 4A8OA 2YNGA 4Y6IA 2QMWA 2B6AA 4OZ0A 2BKOA 2OEJA 2XCPA 2ZM6J 2IY5B 1RA6A 4W92B 3F41A 4LR9A 2GVZA 3Q24A 2WHOA 2LU2A 5A8RA 3ILLA 5B09A 1CS4B 3F73A 3QNWB 2HHQA 2YKNB 1FFGB 5K8NA 5BJRA 1Y3JA 2AWZA 3I31A 3KDNA 1SBRA 2VDIA 2W7AA 2KKHA 1VYAA 1S76D 1BQNA 3HHLC 4UZBA 1MMLA 1RGVA 1VBXA 1RAHB 5KFFA 2FIUA 3HSDA 3AQOA 4KH1B 3ICLA 1SCJB 2KH9A 3R1HA 2KTQA 4FF4A 4URSA 4JYAJ 1TU0B 3Q8RB 1FD2A 1RTJB 4DG1B 4EYIB 1ZPWX 3A12A 3GG1A 3HVTA 4NXMJ 2JC1A 5B0FA 4A8QA 2E7WA 4ZVSB 3NLCA 2CJBA 4GRSA 1H74A 1OY9A 2RRBA 3GG0A 3SCKE 2AGQA 1IWGA 1TKTA 3OR1B 2BOPA 3RW6A 4R5PB 1GT8A 4M8LA 2XMMA 2MKSA 1NDLA 1Q78A 2BRKA 1LOUA 1LK5A 1HWKA 5ETPA 3G6VA 4O3QA 3MFIA 4USTA 4EK2A 3GSDA 1HNWF 2VOOA 3QGPA 4W98A 1G3OA 1J2VA 3I55S 1HNXF 2OI2A 4CCHA 4CTAB 1DLOA 1NJWA 1RU1A 1FVSA 2XCAA 2NXUA 1M1KT 4ERDA 1U8WA 1ZZFA 4IOBA 4DI6A 3BR8A 1XEZA 1DQ9A 2VQEF 5AXLA 1AT1B 1VC0A 5HATA 2RH3A 4X4VA 2V5HG 3TAMA 4CO2A 4ZPVR 3OL6A 5A0YA 4OYPA 1IBLJ 5D3GA 1D9FA 4Q0BB 3DM2A 3Q22A 3JB9k 1BHNA 2NYIA 4AT1B 2XO6A 2C2OB 2QRRA 3A8JA 2VZ9A 4OJ3A 1N52B 5IT4A 3R2DJ 2C28A 4NLXA 3TQEA 2HURA 1F9FA 4NRTA 5ETOA 1J5EJ 4O4GB 4LFAF 4ZVRB 3QJPA 3DDIA 4L75A 2LA6A 1E6YB 1RT2A 5FIIA 1NB2A 2WVDA 4Q44A 4X62F 4URQU 2CJXB 2H5IB 4FDFA 4HT5A 3I32A 3R7NB 2HYIB 3ZZZA 4QIGA 4HI1A 1S1WB 2G2ZA 1SH2A 1P9QC 1SQFA 4C8ZA 4H4MA 3Q8UA 2P2CB 3DDKA 1FXDA 3KLIA 1T9YA 1WDTA 3N5BA 2QGFB 2KFYA 4ZVEA 2YXLA 5E2QA 5CYQA 1WHXA 1TUWA 1FE4A 3H25A 4MK9A 2WVBA 3KK3B 2ZKUA 4R0EA 5B7WA 4HACB 3M2UB 2I0XA 1IUJA 2EFNA 5KFAA 2IM0A 2ASLA 5J1PA 1P6TA 5HBMB 3TEGA 1RHJB 4GVBB 3GILA 1M90T 4ZP8A 1YIJS 2J6TA 1RBAA 4P72A 4YP3A 4B9TA 4LF9J 2RDJA 1QE1B 4USHA 3QATA 4EO8A 2M2BA 2CNNB 4QYZK 3HP6A 1GFWB 3I82A 1WC1A 3PEHA 4RNHA 1R7IA 3W64A 3DOKA 2A6MA 3JTOA 4U9RA 4FF1A 1SUQB 1DTTA 4CNYA 5HVHA 4KO0B 4TYBA 2AJ1A 2CG8A 2XMTA 1PILA 2CAJA 3MM6B 4KPCA 4L6V3 2ZVSA 4YEAA 3T5HA 3W2VA 1M5SA 1TL4A 3FKBA 4DV2F 1K8AT 1YKWA 2F40A 3CTRA 4ZVFA 1NXIA 2LDIA 3G8QA 2QC3A 5ADZA 2VA2A 2Y0SD 2MY8A 2DEIA 2HQDA 3D3CJ 4MKVA 1T3OA 2GFFA 4GC6A 2CQDA 2D9OA 2J8SA 5K8PA 1WI6A 2VG5B 3OXGA 4KGXB 4DL2A 1U8SA 2DGQA 3UCZP 3IRWP 1OYDA 3MMAA 4QIVA 3EXCX 2VD3A 4EUVA 4GKJF 3THVA 2BM0A 3IM8A 3O3LA 3UDVA 1IVZA 5J1EA 2RT3A 4DXLA 2JL9A 2A0FB 1JJ2R 1JLFA 3L95X 1TKDA 3DOLA 1WC4A 4F67A 2CNOB 1W26A 2M8HA 4Y34A 4X64F 3PW2A 1I6JA 3G9CA 4DLEA 3VZHA 2E5HA 2RVJA 1DTQA 1X5OA 2YNFA 2DT9A 1LWXA 1WEYA 3J7Z5 3D1HA 2R42A 3N4WA 5K9FA 4EWTA 4U6PA 3SBMA 3RTVA 1DTTB 2IYGA 1VQLS 3IRXB 1NSQA 1JLGA 2ATCB 4K50A 4P7TA 2CQ3A 3DHXA 3CCMS 1ZM9A 2VG6B 4ECQA 2Y1IA 2J6SA 1U1KA 1JLQA 4P52A 5HMZA 4UY85 1T9XA 1YBAA 5DGBA 3NRBA 1RT5A 5DM6Q 2OTJS 2FJXA 1L3TA 2QL7B 2CQBA 4FNHA 2B6AB 2H54B 4ZPBA 2G0JA 4AXIA 4DR7F 2C3YA 3OQ2A 3V4IB 1FEEA 1VRTB 1CBKA 1HWJA 4CDIA 4IO1A 4KHRA 3S1TA 3WX8A 7AT1B 3TYTA 2P9EA 4WZQA 2EW9A 2LFVA 2HRYA 3DOMB 4DN9A 2JOQA 2DCLA 3IAM9 3SSSA 4AQYF 1F3VA 3QJJA 2HNYA 4KFBA 4TQRA 1IXKA 4FN5A 4ILMA 3MEEA 1P8GA 2MKIA 3LTOA 2KT5A 3NP5A 3KHLA 4EEYA 4LF7F 2DHSA 4WP9A 2IAJA 4CLSA 4YR0A 4KIAA 4C3KA 4BBYA 4F0KA 1FEHA 2ZH8A 5HQMA 4C2MA 4ZA1A 1M5OC 2VICA 1HPZA 1HI1A 1OY6A 5HVGA 2OSRA 4M5HA 4AL6A 3MPYA 1S79A 5KFGA 3DOLB 4NYPA 2I5JB 3R1LA 1RISA 1X31C 2GJ2A 2K7JA 3PACA 3OTDA 3JSMB 1WF2A 3D7SB 4WTOB 3PZPA 2P6SA 2I1RA 5J2PB 3Q8VA 2DNQA 4NXMF 4HKQA 2R7UA 3GJRB 1BQNB 5KFQA 3H5YA 1HMVB 1T3NA 3OTOJ 2JEIA 2WOMB 4USWA 3H8YA 5KT3A 4ZP7A 1R0AA 3POTA 3BBCA 4NMXA 3SMZA 1X9WA 4IH6A 5LMNJ 1XMOF 1DLOB 2FZGB 1HNVA 3M9MB 3X3UA 1EIYB 1SUQA 1YHQS 2HBRB 2VC0A 3UW1A 1F1BB 1Y7PA 1FTCA 1RXOB 2IA0A 3I87A 3JXOA 3NGTA 3W2WB 4QR1A 4KHPJ 2FTRA 2YX1A 2YH1A 1WNEA 4F3QA 1MU2A 2PEBA 5JVHQ 4DV7J 2YKOA 4ES3A 4N41A 2L3MA 3G8TA 2DNRA 2E44A 4WFYA 2V34A 3NBPA 4OI3A 1RLCL 5H1SV 1RTZA 3CIZA 3IBFB 4G1IA 4G6VB 2IRUA 4CLFA 2IBKA 4KV8B 3CVKA 1TTHB 1S1UA 1YDLA 1VQ9S 1ACMB 4NYZA 1AFJA 5A8KB 4JB8B 3PX4A 3U27A 4P2MA 1U0HB 5D15A 1CQNA 5C25B 1DZ5A 2UUCF 4W90B 1T02A 3EGVA 4LRDA 2LXFA 4YB5A 3TZWA 1RADB 3G87A 2LXUA 3K0JA 4WKYA 3ZZOA 3ZNUA 2B9EA 4D3GA 3UVJB 2G2YA 3W60A 1HWLA 4HYKA 2CZ4A 2BR0A 3VAMA 1REGX 1IWAA 3M30A 4JI0J 1HKAA 4ED5A 1RT3A 3OFFA 3HCXA 4H4MB 2YKMA 1WOSA 2AZ1A 1N54B 2EFGA 1S72S 3FCHA 3CNQP 4O4GA 4RBTA 4MK7A 4NI2A 3UD4P 2V94A 1HQEA 1R0BG 1JLCA 4DV0F 2XTJP 2FGOA 5KFNA 1R0CB 2QTWA 2BUNA 3OTCA 4A8YA 3PIOQ 1U48A 2HS4A 5HL7Q 2JLEA 2HVIA 4DR1F 3T1AA 1U26A 1LW0B 4FYXB 1JLBB 2CXEA 3UN3A 3OHAA 2D1CA 1SQEA 1YJVA 1VQNS 1XNRF 2EEYA 3SFUA 2XS2A 1KFSA 3R7BB 3DNCA 2ZC3A 1OQ6A 4ECTA 1RWXB 2CWKA 1SIZA 3MD3A 4IH5A 3CC2S 3MM7B 5FLXU 1AXQA 5C5JA 1S49A 1S9FA 3HVAA 3EMTA 2VBWA 2EVZA 2XYGB 4J37A 4F4XA 1GMUA 1KFDA 3LAKA 2DH8A 2NREA 2DR9A 2R9LA 1U6BA 2W2PP 4OHVA 2A2DA 3GYGA 4QWEA 1UFLA 2J9EA 4K4TA 3DFEA 3VAKA 1RT3B 3GV7B 1IKYB 2JDJA 4B3TJ 2OLWA 3MURP 3UPFA 3U1NA 4E2FB 2YWHA 3TAQA 4B3TF 4L73A 4UW2A 4ID5A 1NB7A 3B82A 2RKIB 2DD8S 2RE1A 3HDSA 2MGZA 4V19X 5L1IA 2KFNA 1HD1A 2HSEB 5KFMA 1RAJA 1PAEX 3I4PA 1JLEA 4M1KA 2ABYA 1ZBTA 1UWBA 3C15B 5D4LA 3RG6A 1VIOA 2WOMA 1BQXA 3LO3A 1LFPA 1S12A 1YRUA 3IC1A 1F60B 1J5OB 3R27A 3JAMY 2ZH9A 4NLVA 2KL8A 3NCQA 4Z7CA 2FVPA 1RWNB 3R5DA 4O4RA 2J0SD 4RUAA 2HHXA 1AA1B 2IMWP 4LSZB 4DX7A 3IGNA 1DQ8A 3DLLQ 2DNNA 1ZAVA 4ZVTB 2Q6BA 3K59A 4K4VA 4OJHA 4C8MA 4ED0A 2H9ZA 2HGLA 2HRUA 1CS4A 3IBWA 1C1BB 1HW9A 4MIAA 3WHIA 4ED1A 2A3JA 2R2RA 1DY3A 5BYRA 4DSJA 5GAHU 3BN7A 1S1VA 2XBPA 2V4JB 3BH7B 1IKWA 4QU7A 4USVA 3IN5A 2NZ4A 2UXBF 4WXWA 3C6TB 2CIMA 1JLQB 2BVZA 2DXEA 4ED3A 1V5IB 4DSFA 4ELTA 1KC8T 1T9WA 1KNZA 4KKOA 1RA7A 3A3OB 3KNGA 4WIIA 1MN7A 1TL3A 4WP8A 3CJKA 3W5XA 4DLGA 1TK5A 1RK8A 1WC6A 4X4OA 1VRTA 4YB1P 3KK1B 1WKJA 2B8PA 2HQ3A 2MKKA 1OY8A 2RKIA 2MGZB 3OD2A 4R5PA 3GFZA 3GU0A 2CDQA 2OJ3A 2LMIA 4ED6A 4EO6A 3Q83A 3LUYA 1HBMA 2FZCB 2RF2B 3RGIA 3TJAA 5IXUA 4JI2J 4PWDB 2VFRA 3BGFA 1N33J 2VFUA 2UUCJ 1EP4A 2YNIB 1KLNA 2Z56B 3LALA 3PM9A 4J5OA 4J9UE 4L76A 4OX6A 5DO2A 2HBYB 3O44A 1U2RA 3AJDA
chains in the Genus database with same CATH topology
2WK4A 4F4WA 1HQUA 3UDLA 2ZH5A 4DF8A 3G6ES 2DISA 3AY0A 1K0VA 4Z2XA 1BQMA 4ELUA 3VQTA 4Y00A 3HMJG 5KFEA 4F50A 1C1BA 1ZAWA 2QFJA 1QVFR 1ZAXA 2BYCA 1N34F 2ZITA 3MM9A 2VOPA 2HPUA 2W9AA 2PMHA 4URGA 4E98A 2RRNA 2EFVA 2U1AA 2YWGA 5EHHA 1HNIA 1X0FA 2VFSA 3JYTA 4V19J 3DXSX 4OZJA 2OIHA 3RZAA 1U45A 3M2RB 1FRJA 4NRUA 4IRCA 2FVRA 4OLPA 4Q2MA 4DS4A 4XO0A 2AW0A 1S9GB 4IG0A 3SSQA 5DDOC 2HVHA 4YOEA 3BB5A 2VPXB 3NCPA 1S0VA 2JH3A 2C42A 4H4OB 3DLBA 5KFPA 4F26A 5J1EB 1UVNA 1JLFB 2ASYA 2DB1A 5KG1A 5I4MA 4ICLB 2G13A 4DBQA 4XPCA 4U7CA 4NZ6A 1VLYA 1U1NA 4OI6A 2MZRA 2YWEA 1KQGB 3MAHA 4WFBQ 4X84A 2R7RA 2MQMA 2LVWA 3DI6B 3E01A 2DR7A 3N6NA 2E5JA 3CJ5A 1X5SA 3CCVS 2EFOA 3HHLA 3FEYB 1HQEB 1SKSA 1A7GE 4PG5A 2AU0A 2VQFF 1QJHA 2CQIA 4QJVA 3V81B 2LEAA 1N5QA 2ZJRQ 2ZOGA 5F3ZA 3RAMA 3D0IE 3BO2A 1BD6A 2I8EA 1FT8A 4MH8A 5FDLA 2J76E 1SL0A 4RWWA 3RB3A 3I9ZA 5G4DA 3BSNA 4PWDB 2WONB 3KJVB 2XO7A 1RT1B 2MHNA 4QZVB 2R8KA 1CPZA 4B17A 2HW3A 5F9NA 3LP1A 3CUNA 3CT9A 1ZETA 1YI2S 4UOCA 1B7FA 1ELOA 4Y2IA 1UVJA 1SL2A 5KT2A 1FVQA 1EP4B 2VBXA 2VV5A 4OIXA 3P49B 2DITA 3TI0A 1RT6B 3ITHA 4PWUA 3TAMB 1HQUB 2LQJA 4DV7F 2GQ2A 3T9NA 3QAUA 4I56A 2RRAA 1HMVA 4HVZA 4I67A 2JZ5A 3HZEA 1L3SA 3OBIA 2MZ1A 2JJ4D 1YJUA 2D7SA 2ACYA 2DHGA 2XS5A 1KLMB 2HS0A 3R5AA 4NA2A 3D54A 3OTOF 1RJJA 4NCAA 3TA1A 2R7TA 1N32F 4ED2A 2XY5A 3TW0A 4DPOA 2H5EA 5IFMA 4WJBA 4Y28C 5DJBA 4YQWA 1VBZA 1IR0A 1VC5A 1XR6A 1RT1A 5GAEI 3MEKA 3WX4A 2HHTA 2ADCA 1IJFB 3IWLA 3FSIA 1OO0B 3KJVA 2MY7A 3UR3C 3MOJB 1V3RA 4ZP9A 2FVSA 3HO1A 3KFWX 1X4HA 4JUZA 4AL5A 2HHPA 3PKMA 1WG5A 5CQGA 1FRLA 2K7KA 4IFVB 5B0EA 5T14A 2R8JA 2EBEA 3DLEA 1W2BR 2MQQA 5E3CA 1HI0P 3OXLA 4HH1A 4NLWA 4A4JA 3M30B 2P9GA 5F8JA 3LP2B 1N5SA 4K4ZA 3LH2S 2XY6A 2WSFC 3F56A 3HHNB 5DG7A 2G1DA 3I9V9 1VQOS 2V9KA 3D0HE 2LYVA 4RU9A 4JI5F 3W3SA 3B4DA 2AV5A 4OL8A 2V4QA 4DWIA 4F3MA 3K5LA 1NRKA 5E33A 3U1MA 4XPEA 1RTIA 5E5NA 1NK8A 1LW0A 1QTMA 4ITSA 1JKHA 2E7XA 1OQ3A 4LF8F 1U6ZA 3NMRA 4MKYA 4D3HA 1GNKA 2B51A 2FLNA 5JUMA 1S9EB 1JLAA 2GGPB 4IFVA 5KG5A 2AYBA 4ZVGA 3OFEA 3SV4A 3RB4A 3I0RB 2IFXA 3EUNA 4JV0A 3GIKA 3R5BA 2M88A 1ZTTA 1VHFA 3KMSA 2OD6A 3PIPQ 4YR3A 1T95A 4KB7A 1N0VC 3THPA 5BYSA 4EYHB 3MR6A 3SCLE 4RU2A 2OPPB 2B4PA 1FXLA 2BQRA 4JV5F 5A2QY 4RWXA 2GNKA 2RIJA 5KFVA 2YKNA 2HFZA 2LQ5A 2E9ZA 3DLGA 4WE1B 2HLTA 2CQCA 2V8GA 1KQSR 4RW7A 1N56A 4QW8A 4G1PA 1R8BA 2IVMA 3CD0A 1YTYA 2OAUA 2G9OA 2EKYA 2R4FA 3VTIA 1HNIB 2HWTA 2DNYA 3UDCA 2FC8A 1JXLA 2VC1A 4FZVA 4ICLA 2GGPA 5D78A 3M2RA 3AJ2A 3OHBA 1XMBA 2PC6A 1REVA 4LF6F 3FMBA 2E5GA 3J7YI 4QW9A 5KAKA 1FDNA 3O8WA 1UEVA 4CO5A 4NCGB 2DHXA 1N33F 2C3PA 4M5DA 5G0RB 3CDEA 3MTKA 1Y5LB 3ZZYA 1S77D 2OPPA 1SV5A 5KFHA 3T1HF 3D0GE 2HHSA 2OFHX 1VRUB 1IN0A 4LF5F 1O51A 2YKQA 1GX5A 5HI7A 2VFTA 3UQSA 1GH8A 2Z8QA 3R5CA 1N5VA 4QIFA 3EZ5A 3SSRA 3SDEA 4YDDB 3QIPB 3HHLD 1QSYA 1VQ8S 2WBRA 2GQQA 2Z2LA 3H40A 3MAQA 4HI2A 4PG8A 4ZLPA 2POKA 5I3QA 4WFAQ 1R0AB 4C8OA 2GQCA 2HVZA 3JTNA 4M95A 4OHWA 5L9NA 5E0OA 5EUHA 3QGIA 4UQGA 2JLGA 3OW2R 1G2EA 1ZYQA 2E1CA 5CD4H 2PA3A 3LOUA 3Q0AA 1DBDA 1JKHB 1WTFA 1TL1A 1TKXA 3PHEA 1KHWA 1S1XA 3QZ7A 1G1XA 2AGPA 3MR2A 1FKPB 1WG1A 3SQGA 1N6QA 3CPWR 1K0TA 2RS8A 5K8MA 2VA3A 2CPYA 5GAEU 1BLUA 2NUUG 4QR0A 1VI7A 5F9LA 5AXNA 2LECA 5CZVA 4CO3A 2JWNA 1ZZNA 3K2YA 2DPJA 4NLQA 3JSRA 3PRBA 3NGKA 2Q6CA 3MR5A 2HMIB 3IXQA 3NNCA 5EDWA 1LWCA 4O3PA 3GIJA 3E3XA 5DDQC 3C2PA 2CJAA 1KONA 4R25A 5D4NA 3BZQA 4ECZA 5CXTA 2IRXA 3BGRA 2DJWA 2GO9A 3VAFA 4QWBA 1CLFA 2KU7A 2VKRA 3LWMA 1U6FA 1KVJA 1R27B 1VQYA 4N56A 5D8HB 2KZMA 1KQKA 3NL0A 2I2YA 3GYNA 2B7CB 4H54A 1CVJA 2VFVA 2B7BB 2W25A 4IFYB 1JJ4A 3N0VA 1FDDA 1WD6A 2AYGA 2PDAA 4NLSA 4C98A 4NLTA 1JK9B 5K14B 4HTJA 3KTQA 2XSJA 2IBOA 1B0PA 3MPWA 4AE5A 3AA8A 5KFBA 3FSXA 4LSLB 2QV6A 3C6UB 3SXLA 1HD0A 1NAQA 3D1OA 4ETXA 1D8YA 4JV2A 3LPYA 4YR2A 2AX1A 4Q7AA 2X1AA 5IS2A 3PW0A 2OPRB 1NKBA 4IQXA 3OXFA 3VAGA 2XNRA 5LSOA 3H5SA 4NOHA 4WYLA 3U7JA 1IKXB 3QMQA 5DG8A 2I9SA 1QSLA 3PX6A 4XDCA 3T6JA 2ZUGA 3HHEA 2LEPA 2FVCA 4ZK7M 1FJGF 1NZAA 1C0UB 1QAJA 1SI9A 4MK8A 5D4OA 1R3NA 4B9MA 4Z37A 4AL7A 3T5LA 1HBNA 3MDFA 4QQBA 2QE5A 4LUBA 3ZZPA 4DR2F 2LEBA 2ASJA 3FJ2A 2ZD1B 4F4YA 2RB7A 1D3WA 3DU5A 2AYMA 3M8PB 4GO7X 3W7BA 1NNDA 2DBBA 4PUOB 1X0PA 1V6HA 4RNMA 4JI4F 2XLIA 2GW8A 2QLXA 4J9KA 2MB0B 4G1QB 3MMBA 2ZBCA 3E01B 2MYFA 2DNPA 1K73T 4ECWA 5A6WA 4I1TA 4ILRA 2ADBA 1HPZB 3TVYA 2HWIA 1XR7A 2B9XA 4CT9A 4RW4A 1GX6A 4DL3A 4J9PA 4ZS6A 3MTJA 3CCJS 1ZH5A 1X9MA 1T05A 4RW8A 2O01C 2EG2A 1JX4A 5IQQA 2CPXA 5J2QB 1WTBA 4NLDA 2CQ1A 2QEXS 3WC2A 3RRGA 4RW7B 3DLJA 3NS6A 5DG9A 2GHVC 4KRWA 2CVEA 3J7YU 4M63A 2O5DA 4RBVA 5M2PA 3MEGB 1VQMS 3IG1A 4PXDA 3DU6A 1L3VA 2PD1A 1NK4A 3QYYA 4J9NA 2NLWA 3K7RA 3CJ4A 3O6QA 3QO9B 4EZ9A 1TK8A 4OHXA 1Y0HA 2F8MA 3EGZA 1C2PA 3KG0A 3N79A 2E9TA 1H0HB 2PO4A 3DCAA 2JX2A 1NHUA 1QUVA 2VH7A 3HK2A 2KRBA 4DL0C 1DURA 2LCWA 4C0HA 2OO4A 1TL5A 2GMLA 2R8IA 2CQGA 3PW5A 1H6KX 3RR8A 1MWZA 2RD5C 1XMQF 5E41A 5KOWA 5CZXA 4WF9Q 1SB6A 5H9FJ 4BC7A 1O5JA 2DNZA 2OPQB 3H4DA 3V6DB 4LQ3A 2ROEA 3UCGA 2FHOB 2GO8A 3AH6A 4RW4B 5SZTA 4C8YA 1VQKS 1Z2LA 2IJNA 3ISZA 4MMOA 2DR5A 5KFIA 3QIPA 5KFZA 1LXNA 4Y2CA 2IM2A 2RQCA 4KTQA 2D74B 2M4MA 3HF5A 3MEGA 3RW7A 3DXBA 2CQ0A 3X1LB 1KOHA 4KT0C 1S99A 2ZE2A 4NA3A 2GA7A 2W7PA 2QSFA 2KN4A 3IG1B 1QM9A 3AJ1A 4MYUA 1FNXH 3QO9A 4CH7A 1JNZB 4DV3F 1C0UA 2LA4A 4DDFA 2W7OA 1KEKA 3KG1A 4QYZJ 2DH7A 4UUWA 4CO4A 1FE0A 3TRGA 1P27B 5GAGU 1FRHA 1HBOB 2ZBIA 1U1OA 3WDOA 4YFUA 2ZJPQ 3MM5A 3FZ2A 2OSQA 2AJ0A 3QWUA 2PE8A 3MM7A 1Q1KA 2AYEA 4MTPA 2Q1LA 3HHDA 4O3NA 4OZ1A 1IBKF 4C8KA 2D3ZA 3HHLB 3HT3A 2PMZD 1SJQA 1W2IA 3RAQA 2ASDA 2GIRA 2W9CA 2L41A 1DQAA 5IWAF 2M8DB 2O1PA 2FJWA 4X4UA 4Q8EA 4I7FB 5J2MA 4IFYA 4PWDA 3Q8SB 1WHVA 1TP7A 4LSNB 2OKQA 4P6QA 3BGRB 3TNVA 4LIRA 1C1CA 3SYZA 2MDAA 2ZZMA 4GC7A 1D0EA 1RTDA 4FVCA 2LDYA 3MUVP 2BACA 4QPTA 3I96A 5H9EJ 4FVMA 3L09A 1Q8LA 1HR0F 4NPOA 4WFXA 1WG4A 3S01A 4NL5A 2GC8A 5HP1A 3NBPB 4X65F 1PO6A 2X1FA 2OPRA 4X4NA 2K8GA 3GMGA 2K1RA 3MM5B 3QGHA 1S48A 4CQ1A 7FD1A 3HJFA 1IKXA 4DQPA 2V2KA 5AXMA 2KRRA 1QVGR 4F25A 2FDNA 5CYQB 2UXCF 1F2GA 2JFDA 4DUZF 2KM8C 4KHMA 2J7KA 3MGJA 1JXEA 3FZBA 1N5YB 3M9NB 4USIA 4HTIA 1Q53A 1RDRA 2J9CA 3V5RA 2FJAB 2RILA 4I68A 1KTVA 5GADI 5J2MB 1S4FA 4NLOA 1K9MT 4NYOA 4DHVA 1DFDA 3GR1A 1U7LA 1DARA 2J6UA 2I5JA 2L9DA 3ETOA 3LAMA 1MNEA 4DV1F 3PO4A 1FA0A 3O1LA 3IR5B 1C4AA 4HH0A 2MKCA 4DL6A 4NLUA 2XGPA 3G8SA 4IOCQ 4YUDA 1JNRB 3M05A 2F8EX 1ULRA 2LLZA 3FGVA 4USJC 2JLFA 3PR4A 4R8UA 2YWKA 3U1LA 2I38A 2VG7B 3TX8A 4RBUA 1H7XA 1IKVA 2CJQA 5J1NA 3K5MA 3MM8A 2ATLA 4NZ0A 3CD5A 2XNQA 2FLLA 3CO9A 5KFKA 2UUTA 5SUHA 2DCUB 5LJ5Y 2R7SA 2CKWA 4QWDA 2QZ8A 3QGGA 4OZ5A 2R2UA 4EBEA 3KLFB 3CXCR 1FRKA 3HPOA 3PO5A 4AFFA 4G3IA 4JYAF 4ALZA 2DH9A 3SZ2A 2GJIA 1DHMA 1KN6A 1S1TB 3T9ZA 3QWPA 3IAS9 5LMNF 5I42B 5KFJA 5KG4A 2X3GA 3BDEA 1RYSA 5EWEA 1JMTA 4OFZA 3WBZA 4ES2A 2K2PA 1MW7A 4X2BA 2J9DE 1U1PA 2KJWA 1HNZF 1CSJA 4BWJA 4I6YA 5I3UA 1Q79A 4N8NA 3RAXA 3JYTB 3BR9A 3P3DA 2YNFB 3RB0A 1FXRA 5DQIA 4QWCA 1SKWA 1TKTB 2L9NA 1H3DA 3H20A 3OR1A 3CB4A 5J2QA 5HLFA 3OUYA 1F5BA 4IKAA 3KHGA 2IC3A 4ZCMA 5DLGA 2B5JB 3HXMA 2GIQA 3KG4A 3RR7A 1A6LA 2QLWA 5EX3A 4ZMMA 4NXNF 4KC5A 3NGDA 2VG7A 3TVZA 3MM8B 1RTDB 2B3TB 5FLXY 2EK1A 1IKVB 2L9WA 4X66F 2UU9F 5KT7A 2A10A 1M5HA 1ZM2A 2OD4A 1C4CA 2HLUA 3QZ8A 4BHQA 3DYAA 4ZOSA 1JLBA 4LVNP 1NJXA 4OI0A 3K5NA 3GZ7A 4QU6A 3THTA 4KPYA 5CYJA 1DAXA 1E6VA 2HNDB 2WRMA 4F8RA 1Y5IB 3FSYA 2M3DA 1S0MA 2PIIA 4OX7A 3HI9A 1RT4A 4C7QA 1TR0A 3BQ0A 3RBEA 2C22A 4F02A 4EBCA 2AX0A 4ZP6A 2RU3A 2EWHA 2KO1A 2A2CA 5KG3A 1LWEA 2CZVC 4GMKA 1XWLA 4FS2A 3I0SB 4ECYA 3SFGA 1TK0A 1KS2A 2KB2A 2DNMA 4FPRA 4NCGA 4A46A 4DV6F 1HL6A 4OQJA 2KYZA 3QPIA 2FPHX 5KT4A 5A8KA 1YJ9S 3U02A 2QA4S 1KD1T 4PQUA 1FRIA 5B0GA 3DMJA 2ZOFA 2W9CB 2ZDOA 2CPDA 3V2UC 4KE5A 4QPXA 3Q2TC 1KTQA 4O44B 3C6UA 4FYDA 1FCAA 2EPIA 1Z4UA 3DYAB 3IR7B 2BA9A 2YVSA 2CPFA 2N4DA 2FC9A 3VF0B 4TLQA 3HVWA 3DGPA 4JI6F 3T1YF 2VKZG 4I7FA 4Y2KA 1YITS 4ZKAA 4ZCLA 5EWGA 2JVOA 1RTHA 4RNNA 5KTQA 3KLHB 3B8HA 1GXUA 4LSNA 5AJ3F 5KFTA 2JVRA 2HHUA 1C1CB 3CDAA 2AQ4A 1RT4B 2UZAA 1M5VC 4YY3F 2R2SA 1T7PA 4FF2A 4PR6A 1WEZA 3H2UB 3K5PA 4NX9A 2XHWA 4RNOA 1G6BA 3BQ2A 1FERA 1C0TA 2D41A 5EX0A 2W24A 4K5R