3CEDA

Crystal structure of the c-terminal nil domain of an abc transporter protein homologue from staphylococcus aureus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
SNADDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Methionine import ATP-binding protein metN 2
publication title The structure of the C-terminal NIL domain of an ABC transporter protein homologue from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 24
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 3.6.3.-:
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09383 NIL NIL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cedA00
2DT9A 3OFFA 2RE1A 2NYIA 3AAWB 3DHXA 3ENQA 3LUYA 1UJ5A 2RQKA 3OFGA 1KS2A 4X84A 2P9EA 1O8BA 3OBIA 3UW1A 3IXQA 2I9SA 3AB4B 3U7JA 3TUJC 3N0VA 2LQJA 4GO5X 2LVWA 2F1FA 2DTJA 3MAHA 5IT4A 3TUZC 3P96A 1PSDA 5IT0A 5JJBA 1XTZA 2PC6A 3ENWA 2JHEA 2P9GA 4M8LA 3TUIC 1LK7A 3W7BA 3K5PA 3OFEA 4GMKA 2ZHOA 4GO7X 5T41A 3MTJA 3DC2A 2F8MA 3HHEA 1YBAA 3CEDA 3DHWC 2P9CA 1U8SA 2J0XA 2QRRA 4PWUA 3L7OA 3AB2B 1UJ6A 2J0WA 1RWUA 3LOUA 5IS2A 4LUBA 3IBWA 3O1LA 2FGCA 1YGYA 3KWMA 2KO1A 1M0SA 1UJ4A 2QMWA 2MDAA 3S1TA 3NRBA 3DDNA 2PA3A 2JOQA 2RQMA 1LKZA 2CDQA 2H9ZA 2QSWA 3ENVA 3MWBA 1ZPVA 2QMXA 1SC6A 4IO1A 4NMLA 5FIIA 1LK5A 1Y7PA 3OFHA
chains in the Genus database with same CATH superfamily
3OFFA 3D28A 2Q6BA 4C97A 1NPRA 1KQFB 3JAMU 2KJVA 3FFIB 3RGIA 4BBYA 1RKJA 2ABYA 3CMQA 1UZHA 5L1LA 2AF6A 5JUMA 2ZH1A 3GFZA 3QATA 1FA0A 5LOQA 3BSNA 4IQXA 3J81U 3RB6A 2ZBCA 3KNAA 3EXCX 4CLSA 2FJAB 1HNZJ 3LP0A 2EFVA 2DRAA 4LQ9A 3QIDA 2UVWA 4I6YA 3VVTA 4ZCMA 1LQ9A 2CQ2A 2A2CA 1RT3B 1K1SA 5C2GA 2HNDA 3Q8RB 1JMTA 3DRSB 4QCLA 4USKA 3M8QB 3O2IA 2V8GA 1X60A 2XLKA 3EICA 4Z7YA 4BWMA 4Y65A 3J81j 3LQVA 4HI2A 4B9TA 1TV6B 4ID5A 3ZZTA 3DDKA 3NS7B 2UXBJ 5B0AA 5CA5A 3PRVA 4DQQA 2CQPA 2MDAA 1HBUA 1RE1B 1LW2A 4WFYA 2W1BA 3O6QA 1IUJA 2IY5B 4URQU 4NLUA 2J9DA 5T14A 1S10A 2W2QP 3IC1A 2M9KA 4JI3J 2XMTA 4USTA 1N5TA 2MZ1A 4MJKA 2H65B 5KFLA 4W90B 1GTHA 1J27A 3RB4A 2WSEC 1VK3A 4DSFA 2GIQA 5HO4A 3Q23A 3PTWA 3B78A 4PYDA 2XEXA 3M2VA 4Y2KA 1CQNA 4UF4A 4UW2A 4UQTA 3SBMA 1Q7YT 2CJKA 2O01C 2HHQA 1GX6A 1S1UB 4I0WA 3WHIA 4RUCA 2GJFA 2XSFA 1U1RA 3LOUA 3M9OB 4L3NA 3KWMA 2IC3A 3DDNA 5D8HB 3SDEB 2XZTB 2UUTA 1U1PA 2Z0GA 2L08A 4HHHA 3W66A 4NLSA 3UR0A 5FIIA 3SI8A 4RUHA 3DLJA 2YKQA 2IMWP 4J91A 2P2CB 4N47A 4DR2J 1UWAA 2NQPA 1EIYB 4G6VB 2FLPA 4K7QA 4IG0B 2J9EA 1KC8T 3LW5C 2GVZB 1IBCB 3HHDA 3D0GE 1H38A 5KG1A 1UW9A 2ROGA 3GFHA 4F7VA 2C1EB 2R8HA 1RT1A 2QFIA 3HSJA 2UUWA 3MCSA 3ZNUA 4C8KA 2UXDF 2DRDA 2VG5B 4IR1A 4M8LA 2KM8B 2KDOA 3M8SA 3IN5A 3LPEA 4PXCA 1SC1B 2WSCC 2B8QA 3AJ2A 3ZZYA 3AHPA 1A0OB 2GQQA 1S1TA 3KUGA 2JLGA 1T95A 1R0AA 2P6TA 5ETOA 3CDWA 3PYEA 3ZZ0A 1O51A 2ZITA 3ISND 1BMQB 3B6BA 3QO9B 4KY3A 1VRUA 2XZDB 4DSIA 1RTJB 2VPWB 3H4BA 3A8IA 4YOEA 1FKPA 3MR7A 4IQMA 1KHWA 3QBCA 2AHOB 1QUVA 4NLVA 3O44A 1HI0P 3DLGA 4CTAB 4ECSA 3MR5A 2DH8A 4NI2B 5L9NA 4RU9A 1F9FA 3SSQA 4X4UA 3UW1A 4P72A 3RB0A 2VPYB 2BJ9A 2YNGB 4LBHA 1UPMB 4CO2A 1CJUB 2LVWA 2CQGA 1S9FA 1UW4A 1FRHA 2HWTA 4CNZA 2FDNA 2BMBA 1FXLA 4WIIA 4ER8A 1VLOA 2XLJA 2XMAA 3ETOA 1R0BG 3CSKA 4LQ3A 3NAIA 1FRIA 3VWSA 2VDIA 3FBFA 4NX9A 4EO8A 5J1NA 4FKXA 1QTNB 4LFBF 1M5KC 3GIMA 3EDRB 3WBZA 4IOAQ 4D3HA 2AGPA 2EFPA 1B3TA 2GJ2A 1X5PA 2G1DA 1N88A 2F8EX 4DZ6A 2CJQA 1HNWJ 2AGQA 2AP6A 4OZ5A 2DR8A 4RX6A 1HW8A 1NK5A 1SQGA 1LWEB 1S4EA 1NAQA 4KE5A 1O8BA 1HWKA 4QWAA 2D41A 2KVQE 1XNRF 2R7QA 2ZH6A 3PV8A 2BA9A 2DKOB 4ANDA 2RDJA 2KT3A 4P75A 2HLTA 5K20B 3HSZA 4LIRA 1T8EA 2DHXA 3TA2A 3CJ5A 3MXHP 3M8WA 5KOWA 1T05A 5GADU 1NHUA 1F60B 1RT2B 2HFUA 2B0GA 2LQBA 1NSKL 3TA1A 3KDOA 4YHHJ 1FJGJ 1SC3B 2MQNA 3SIPB 2ZJRQ 2M4MA 2QA4S 2RDIA 5BYSA 2WBMA 2DEIA 2MLZA 1Q16B 3UFCX 1KDNA 4DV3J 4LFAJ 4CLKA 4DF4A 4WP8A 1WEXA 2RAQA 4XDCA 1ZAVA 1QE1A 2R7TA 3LTOA 1L3VA 3UCGA 2HQGA 5CCLA 4ZLLA 1RTHA 2U1AA 1CS4B 3NKYA 4OZ2A 2BQRA 1N5QA 1SH2A 2DISA 1WDTA 4ZVGA 2DXFA 5THWA 1S6PA 3G6XA 3TANA 1SUQB 3OBIA 3UNYA 4LF7F 3NBPA 5A6WA 1F0XA 3H5UA 4MFBB 4ZCLA 3MMAB 4F4KA 1YBUA 4DLGA 4E2FB 3RRHA 2BE7D 1IBKF 1HYSB 5CYJA 1IKWA 1VOMA 1X4FA 2RIJA 3ZO7A 3C6UB 2WB4A 4GKKF 1GMWD 3T3FA 3B82A 4J9MA 4OV1A 2YWWA 2H5JB 4F0HA 4B3MJ 1NJXA 1CJVB 2PA8D 4B3SJ 2MLYA 3TRGA 1WI6A 4I64A 4R0JA 2J0XA 4JI1J 3UVJB 5A8RA 3UNGC 1NJIT 1RK8A 1VQOS 1EB0A 2GHVC 4LUBA 2V4RA 3GV7B 1HQEB 3HHLD 1NLKL 2FJBB 4ANCA 3MM5B 5KG2A 4OYXA 3CDUA 2JVOA 4J9UE 1HWJA 3L9ZA 3X1LB 3MGJA 4F3QA 2PIIA 2RS8A 3ZC4A 3IR6B 1FNOA 1T3NA 3FVYA 3T5HA 3L7PA 2W7OA 3DXBA 4JI0F 5GMKa 4ID8A 1FXDA 2M8DB 2B5JA 4M5KA 1R8PA 1TVRA 2BYCA 1G6BA 1Q1KA 2XZWA 1U1NA 2IJNA 4IOCQ 3QQCD 5L39A 3BGFA 3Q8VA 3GE9A 2HHPA 2RNEA 3UDEA 4WE1B 2NCKL 2PI5A 1JXEA 5ETQA 5K8NA 3I56S 5E3AA 3Q22A 2YKAA 3M9MB 1HHTP 4OI0A 2IM1A 1V6HA 1GAOA 2FTRA 5KFGA 2GX8A 3KYLA 2DPJA 2NR0A 3N6NA 1HQ2A 3TARA 2HNYB 3TI0A 3RG6A 3PW5A 2VONA 4DPTA 1LFWA 2FC8A 4WFBQ 3G87A 2ZH8A 1SJFA 2F65A 1JNRB 4OZ1A 4ITSA 4OZLA 3KUHA 4C9DA 3C14B 3KLIA 2GVDB 1TZ0A 3CVKA 2CZVC 1BHNA 2KXNB 3JTOA 4MMOA 4C4WA 1AA1B 1KQKA 1TL7A 3CCSS 1KQGB 3HO1A 1QLNA 4ZJLA 5E2QA 3OL7A 2PI4A 1WG4A 3W9JA 2QMUB 1Z2ZA 4ENOA 2ATCB 1VCTA 5KFHA 1TL1B 2JEFA 3HKWA 2GZOA 2E1AA 1BQMB 1M5HA 4OX9F 1YBAA 3CEDA 2DNNA 5D0EA 2XO7A 4Q0BB 4QU6A 1FK9A 2AZ1A 3CDEA 1UL3A 4QU7A 3D1QA 2BE2B 1B0PA 3DMJB 4LF2A 4DPUA 2GFFA 2V69A 5CD4H 3DCAA 1JIHA 3BBFA 4RW9B 3ISNC 3M8RA 5L1IA 4AFFA 2BANA 1N54B 3TX8A 3FZ2A 4A8QA 2VG6A 2RE1A 3D6FB 1KSPA 1FVSA 4PXBA 3R7SB 1KVJA 1X8DA 2XMUA 4LVOP 2CPIA 2ZH2A 2IBOA 1FD2A 2CG8A 4F50A 1S1XB 3MEGA 5A8KB 2OO4A 4RU2A 4NLGA 1YJRA 5A2QY 4TLQA 1SL1A 5AXLA 4I6AA 2KYZA 4PQAA 2VF3A 1GTEA 4K59A 2LA4A 1XMOF 1NK0A 2L9DA 4ZPAA 3KTQA 1FHTA 2HQDA 1NXIA 2E1MC 2WRMA 1ZYQA 2IJRA 4ELUA 2QC3A 3MECB 2MMYA 4ED1A 1JX4A 3E51A 4CM2A 2K1RB 5LXYA 1JLQA 2NXNA 2KG1A 2G2YA 2ZWOA 2DYAA 2BOPA 1WSVA 2H3EB 3QAUA 1WG5A 3NRBA 3EUNA 4P9SA 2F4VF 2EBGA 4DUZF 4HACA 1B64A 4ZVOB 2B9EA 3VAKA 4P52A 5I3UB 4YB7A 1FRXA 2HIYA 1AZSA 3J7ZT 2ZZMA 3P6YC 2IYGA 3BM7A 1AFIA 1KS2A 3M8PA 2GQCA 1X4DA 2FLOA 5T7LB 1F5AA 3DNCA 2MKJA 3K5MA 1EZZB 4JI5F 1SPBP 1FERA 3H42A 3UN3A 5A0YB 4NLWA 4L6V3 2HVHA 1M90T 2KTQA 4NWBA 3H2LA 1C0UA 4OX6A 1MROA 1RWWB 1SV5B 4DQRA 2HRTA 3HHNB 4LFBJ 3TO8A 3JTPA 4GO7X 1NU4A 4LF6F 2KM8C 3G82A 2DHAA 5ADZA 2LU2A 3DYAA 2LQ5A 4OFZA 2CA9A 1DZ5A 3PYFA 2DNOA 3R27A 2JC0A 1RTDB 2MQMA 3D9BA 4ERDA 4PWDB 1N4LA 3HDSA 3W60A 2G0JA 1R43A 2HNZB 2FVSA 1XNRJ 4JP8A 3EZUA 3M2UA 1R6VA 1V3RA 2YKNB 1KKHA 2ZJQQ 3JSBA 3MMCA 2JJ4D 5GAEU 3NS5A 4U95A 3H90A 3EX7B 1U8WA 3L09A 4NCGB 3UO0A 2M52A 4OI3A 3OXLA 2DTJA 5M2PA 2VJVA 1URNA 3D2WA 4NLXA 4J9NA 3QIPB 5K8OA 1N6QB 4OI2A 2GMLA 2XO6A 4RW7A 4C98A 5HLFB 3IWLA 1TKTA 1SKSA 4MIBA 1UETA 2N3LA 4YDXA 1SKRA 3CJKB 1U1LA 2DGUA 3UI3A 4QWBA 2PMWA 3SCIE 2V0NA 3OQ2A 4IH5A 1JQGA 2ZOGA 3HVAA 3P5TL 2X7IA 1BXNA 1WELA 5B08A 3D3BJ 2E9RX 5C25B 4KGKA 1VFJA 1SJQA 3OLAA 2HBYB 1IQZA 4ILMA 4KKOB 1RHMB 4LF7J 5KFSA 1JLCA 3HHLC 1YSJA 1NK9A 5SZTA 3C8YA 3FMWA 2EFNA 4KH0B 4AD6A 1IBKJ 5I3PA 2ATLA 1RA6A 2OMOA 1RUSA 1HPZA 4NLRA 4GKKJ 3I55S 1V5IB 3CJTA 1N8RT 5IT4A 2D3OR 4DSKA 4ZA1A 2VBWA 5J2QA 1PCAA 3SFUA 3T6JA 2HVIA 1QJHA 3BEGB 2B56A 1DTTB 1RXOB 4DL2A 1XK8A 3D4JA 2MEWA 2IVFB 5J2MA 2VFUA 4S0MA 2CWKA 5ETSA 1S9GA 2XNRA 4A8FA 2R2SA 3D5MA 3M2RB 3HCXA 2HAFA 4CNYA 1RYSA 2GO9A 4QWEA 3CC7S 2DGOA 2E29A 2OPSB 2M88A 2VH7A 5HK4A 2I2YA 4HDGA 1G1XA 2LLZA 2KB2A 3OJSA 2LP4A 1N32J 3DXSX 2J0SD 4DSLA 3P45B 2F9JA 2FHJA 2EBEA 3MEDA 4KHMA 4OI4A 2DT9A 2XYGB 2K8GA 4KGZB 2OEJA 4FXWA 5BYQA 3FRYA 1WACA 3W2WA 1KQSR 5FJ4A 1HR0F 2ADBA 1T0TV 1PO6A 1N5SA 3AQPA 1CJTB 5AXNA 1FT8A 4OQJA 2GJIA 3ITHB 1RB0A 4NOHA 1RJJA 1Q8LA 3I9V9 2OFHX 4PEOA 1LEOA 2IDEA 4YR0A 3D0HE 4RR5A 3N6MA 1U7LA 2V8VA 5EDWA 4RO0A 1TKZB 4O0IA 4IDKB 1FEHA 4OI6A 1F5BA 2V8HA 4CLWA 1BUXA 2F63A 3EYZA 3OFEA 3RAQA 1KFDA 1U49A 2AX1A 4C3KA 3KLGA 2BJ1A 4OHZA 4OHVA 3QWPA 2C3UA 2HFVA 3PR5B 5AE3A 2BE9B 2M5YA 1TK5A 1HBNA 2VA3A 2R7XA 2CUYA 3EGVA 3PKMA 3GONA 4WIQA 2ZH3A 3V5RA 1RAIB 1ZPVA 2R8IA 4RJVA 5F8HA 3OL6A 4OYZA 1BGXT 2XNQA 2DNRA 2IVMA 3DOMA 1EHWA 4EFAC 1Y9OA 1NJZA 1VC6A 3GYNA 4A8YA 3P4UB 4DHVA 2OPQB 4JI6F 3CCZA 1K73T 1UP1A 4UUXA 9ATCB 1CC8A 1T7PA 4ECWA 5B0CA 2Z57B 5A8WB 3CJ0A 5KFQA 4EZ6A 3GG1A 2HNDB 1RAOA 3GCWP 3ZZRA 2NSBA 3V6JA 4M63A 4OX9J 2YQ1A 1F6TA 2HQCA 4J9KA 3PG9A 3NNCA 2R7WA 1BC6A 2W01A 4ID5B 1H74A 2ASLA 5HMXA 2F8MA 4K4ZA 1HBUB 3F41A 1YZ7A 1KRPA 3A3PB 1FTCA 4IFYA 2DVIA 4K4SA 2G4BA 5FLXY 1LW2B 1VYAA 1L3SA 2X1FA 2HIQA 1Y11A 1IKVA 1WTBA 5KTQA 1X7VA 4KC5A 5AT1B 1S1WA 2YY3A 3RJMB 1SC6A 2YWGA 3D68A 5D78A 1RKIA 5DQIA 1QSSA 3FSXA 1ZZNA 4WP3A 4I2PB 2XY6A 4ZVFA 3OVAA 2FLLA 2V6AA 4BWJA 3CGIA 4ZHRB 3PKYA 2ALZA 3PCOB 5BR8F 2CWXA 3M2VB 1RCOB 4U7CA 3CO9A 2L9WA 4WXWA 4E8UA 2MZJA 1RA7A 3AODA 2RT3A 4IO9Q 1RT3A 4DR4J 4WK1A 3PW4A 1OY6A 2QIFA 3GJRB 5EX3A 1JLBA 2F4VJ 1HQUA 2OH2A 4A4JA 4JI4F 5DG9A 4CH0S 3SMZA 1TV6A 1Z2LA 2R2TA 2DBBA 4I7FB 2L48A 2C2DA 4DFKA 3MEEB 3NCQA 4Z2XA 3TOQA 2W4DA 1RT5B 4DLEA 1JJ4A 2QV6A 4RUBA 4JI5J 4NYOA 3S7RA 4DXLA 1D9FA 4O3OA 3MMBB 3H5XA 2XGQA 3BYPA 5HSPA 4OHYA 2SXLA 2YKOA 1H3DA 2OELA 4OJ3A 1T3OA 3R7NB 1WC5A 3S01A 4ETZA 5DG8A 4QOTA 1PIEA 2AZ3A 4GVLA 4LF6J 3CCVS 4EU0A 2VZ9A 2KXHA 1R8HA 4HHUA 1VQPS 5CCMA 1S1TB 4HH1A 1OO0B 1S57A 5ETLA 1RISA 1S1UA 2BJ8A 4FPIA 1YRTA 2NXJA 2IA0A 2C3MA 3KXDA 3MD3A 5KFYA 1WHXA 4ATNA 2UXCF 4USMA 1C0TA 3SDEA 1TMJA 1UZDA 1WTFA 2G0IA 2HK3A 2HVZA 9RUBA 2MKKA 3BB5A 4NA2A 5B0DA 2F40A 5J2PA 3F73A 2RSQA 1RWMB 5KG6A 4LRBA 4AQYF 2ZKUA 1GK8A 4IRKA 3EGZA 2H5EA 2GVZA 4PPZA 4LF1A 3PEJA 4V1Ak 4UUWA 1YLXA 2AJ1A 4M5DB 3J80U 1XMQF 2VG5A 4UY85 3PW0A 2VUGA 3A8EA 2A6MA 3W8GA 4A8XA 2F3JA 1TAUA 2N3OA 1KOOA 3J7YI 1EETB 3C16B 1YVFA 1NDLA 2GIFA 2QEXS 4OIXA 1RHRB 4ZP7A 1VJQA 1SQEA 4F25A 2G0CA 4H54A 3MEKA 3B8HA 3CJQA 3ENVA 1H2TZ 3BV8A 2D3ZA 3LH2S 3BREA 4ZDNA 3SV4A 3GLJA 3TWZA 4B9MA 3IAM9 4PRFA 1TUWA 1OS5A 1BWEA 1E6VA 3VZHA 1SBRA 5JMNA 2KT5A 2JFDA 4F4WA 4EO6A 5IC6B 3CCMS 3V6KA 4LBIA 4ZN3A 1G7CB 1UA0A 2ZUGA 3MMJA 3LAMA 2FJXA 3SEOA 3W9HA 1NJWA 2O67A 3D6HB 1DHMA 1PJ5A 4X4RA 4J9QA 4A8KA 2WZ1A 3EVOA 2OSQA 4R5PB 4KO0B 3V6HA 2I8EA 1Y5IB 5CHCB 4ECVA 1REGX 2L41A 2VASA 4PR6A 2RKIA 5HP1B 3CPWR 3RAMA 3PIOQ 2C2KB 2UU9F 5F9LA 2EK1A 2XI3A 3IGVA 2CQCA 4DMZA 3HHLA 5H9FJ 2IJFA 4NRUA 4EBDA 5KFNA 2RB7A 4WFXA 4LBPA 1BY9A 4Y6IA 5IXUA 2BKNA 3NBPB 2XSJB 3K58A 1LWEA 4BDPA 3I5AA 2G2OA 2NXCA 1B99A 3PHEA 1SJRA 4NA1A 1DQ9A 5KFKA 4YEAA 2Z2LA 3CXCR 1NDCA 3G9CA 5LMUF 1Y4ZB 3NNAA 3V2UC 1YIJS 3MR6A 4N5SA 4ECYA 4N8NA 1RT2A 2FY1A 2ZDPA 2P9GA 4CLTA 3THPA 2Q1LA 4ANEA 4WFZA 2LDYA 1TMMA 3PYGA 1WD6A 3JYTB 3QT6A 4B02A 3C6TB 3HJFA 4DS5A 4EEYA 2YWEA 4HT7A 5F8IA 4FZVA 1WWHA 3AB2B 2BVZA 1NPKA 4GVBA 2Z30B 4O44B 3KMSA 1N34F 3GIKA 4X2BA 2HG4A 1CS4A 2NPFA 4ED3A 2UZAA 3EZ5A 2XBPA 4JI6J 3S6EA 1Q81T 1OQ3A 3CT9A 5KT5A 3AXMA 3FBEA 4KTQA 3UDLA 1GMVA 5DO2A 2HHVA 1TVRB 4MFBA 1VC5A 4N77A 2PE8A 4CP5A 1X5TA 1T11A 3MMAA 3K57A 4U96A 3TYTA 3PYDA 1FO1A 2H54B 2W8KA 2HMIA 1U24A 2POKA 1M5OC 4USIA 3RZAA 3U02A 5IT0A 3T5KA 4WTOB 4Y2IA 1VIOA 3TZXA 2RUGA 4ZMMA 3R5CA 1CJVA 3TJ8A 2AYEA 3KG0A 1Q4RA 2BR0A 2DGSA 2EI5A 1VQ5S 1Y00A 2VICA 5HN0A 3UVJA 3OD2A 1S59A 2VODA 4DR3J 1EKRA 2QE5A 3HZEA 1C2PA 4F3MA 4NXMF 5IQQA 3PHTA 3V4MA 4CLZA 2KO1A 1U0HB 2VKRA 3JXOA 3MM5A 5J1PA 4FPRA 2HKEA 4USUA 1J5EF 3I0RB 2DO4A 1G4CA 5CYMA 2EC2A 3H4DA 1XNQJ 1DAXA 1GT8A 2DXEA 2BM0A 1WF1A 4LR7A 1TL7B 3C19A 5BR8J 2VG7A 3SXLA 3GR0A 1C1CA 4EBEA 5EN1A 3K59A 2G2ZA 1VBZA 4A8OA 3SCKE 4XAKA 3POTA 3PFEA 2FLNA 3BQ1A 2GAHC 3W62A 2BX6A 1C4AA 1FDAA 1SJ4P 1GEHA 4XPCA 2ZH9A 4RLEA 3CCRS 2ZWPA 2OJ3A 4JI4J 3QZ7A 3FCVA 4CH7A 4DSEA 1CPZA 1R8CA 2FQQB 4P73A 1FK9B 4DR5F 3U27A 2HBZB 1RCXB 3TJAA 4J90A 1V3ZA 3NCRA 3ETMA 3M32A 4DV4F 2AQ4A 3BH6B 4OYBA 5KT3A 1B7FA 1XWLA 1WI8A 4Q44A 2HNYA 4XK8C 2PGCA 4PXDA 5F41A 2DCUB 1KFSA 2GW8A 5HI7A 3C15A 2VOPA 2A18A 5G0RA 4W98A 1RBAA 2DIVA 2R3VA 2AYGA 4NYZA 4ED7A 1VHFA 4GO5X 2BOAA 1X5OA 4TKTA 4FNIA 3WIVA 3HX9A 5IT9U 1NK8A 2QX0A 3FBBA 4MKYA 2CPXA 3H2VE 1BQNA 3EPIA 5KFIA 1SJ1A 1JLQB 5E0OA 1Q86T 1RAEB 4L72B 1SJ3P 4Q0BA 5E5NA 4DR7F 2ZBIA 4DZDA 1S4FA 1YTYA 3CD6S 2J6TA 4XO0A 3DMJA 3K2YA 1AZSB 2UXBF 1I3OB 1HARA 4LSLB 2AYBA 4AQYJ 5F8GA 3PW2A 3DM2A 2L9NA 3M8PB 2KHCA 2IIHA 2J7WA 3PRBA 2HW3A 2QYGA 4RBUA 1SXLA 2D3O1 1IBMF 5E3CA 3IBFB 1XMQJ 1S7HA 1QTMA 4PG7A 2WVBA 1S1XA 3BPSP 4EI2A 2R7UA 5D3GB 3CIZA 3NG8A 2B8PA 4Y2MA 2LXIA 3VGVA 5ETRA 3AQOA 3NOCA 2Q6CA 4KBIA 3G82B 3PX4A 3RRKA 4QYZJ 3PFOA 3E3XA 2CPJA 2WHOA 4MKAA 1RTIB 3H5YA 4F3OA 1FX4A 3MTJA 4J9PA 1RHKB 3G8SA 2YNHB 4WBFA 4M5LA 4KT0C 2XS7A 2LCWA 2JNJA 2W9CA 1XR5A 3GTYX 5HVHA 2PDAA 5LXRA 3MMCB 4ZLJA 2V34A 1VBYA 4M5HA 2KZZA 4ZPTR 1CVJA 1NMEB 1N5VA 3IFEA 5KFDA 2MKCA 3UQSA 3FZBA 2AX0A 2HVDA 2FHMA 3BR8A 3ET6A 1R8BA 3NLCA 5T7LA 2HEKA 3M6VA 3T1HF 2PO4A 3CNQP 4G65A 1DTQA 3Q8QB 4RW7B 5KFUA 3K5NA 1ZTWA 1GXTA 4ICLA 2HHXA 3AA8A 2QSFA 1YK9A 1I6JA 3R3TA 5E3QA 3HHKA 2HQ3A 1NHVA 3D1HA 4DPOA 1FRKA 5AXMA 4DX5A 3QJJA 3D6MB 1VGYA 2UU9J 1K47A 4P2MA 5KFTA 3ULHA 1RAHB 3BQ0A 5B09A 4ECRA 4ZK7M 1RHQB 1JLCB 1RDRA 2FB0A 2ZDOA 2QA4G 2YVSA 3M30B 1FTRA 4RUAA 2EPIA 3HVWA 2AIRB 1TFWA 2DGQA 2PSZA 2YH0A 2J76E 2OAUA 2CDQA 3M8ZA 1ZAWA 4PAAA 2XULA 5LJ3Y 2F8HA 2KJWA 1IKXA 1IQTA 1ITPA 3T5LA 4FBUA 5M2UA 5LMUJ 4Q7AA 3BSOA 1R31A 1KR4A 5F8NA 2QA1A 3RBDA 2CJBA 2G9OA 4IUFA 5IV3A 3JSYA 2ZM6F 3QIPA 3ILIA 2F1FA 3UE2A 1S6QA 1RGVA 2JEJA 6FDRA 1JLAB 2DJWA 1EJ7L 3AOAA 5HLFA 1S9GB 1XTZA 3BPDA 3CJKA 3DRYA 2ILZA 4C8YA 3OVBA 1YRXA 2LEAA 3GJSB 4IYQA 4KJIA 2BJ3A 1ZM2A 2LXUA 1N34J 4WWSA 3CIMA 4CDIA 4WU3A 4RWWA 1PBAA 2QLFB 5C25A 3KLFA 3QNWB 3M9NB 1R0CB 1UJ6A 3MEDB 3BDEA 1S6UA 3NMAA 3KG4A 2AU0A 3BN4A 3OHBA 4F4ZA 3QAEA 2WVDA 3QGIA 4B17A 4M5IA 2KI2A 4QIFA 5JVHQ 3GMGA 2H4YB 2H51B 3JS9A 4OJGA 1GXUA 4FYVB 4ECUA 4UOGA 1MWYA 2Z56B 2KHDA 5IWAF 4EBCA 4WYWA 1EAYC 2OPRB 1T9TA 1VQSA 3S8SA 2Q3PA 2CJYB 2JEGA 4O3QA 1SL2A 3CCWA 4HTIA 4ZP6A 4Y2CA 1FWPA 2B9XA 3TUZC 1HWUA 4PWWA 1YJWS 2HFNA 3L3CA 1TL4A 1M5PC 1D0EA 4CCHA 1WHWA 2JHEA 1FVQA 5DQGA 3MM6A 2O66A 3UD3P 3SQOP 4IFVA 5H9FK 1W7WA 1H6KX 5IQ6A 4Q2MA 1HNXJ 4NXMJ 3MTKA 2K2PA 1HBNB 4IOBA 5E33A 1IJFB 4LF8F 5HROB 1BD6A 3NOGA 1PBUA 2VU5A 1J5EJ 4QIVA 2XTJP 3D1OA 4DV3F 3R6GB 4LFAF 4KIAA 4P74A 2AKWB 2CPEA 4HDHA 1VR6A 2FJVA 3P8BB 1CJKB 2VOOA 4O4RA 1TL3A 2UVVA 3CCES 1CG2A 3IAS9 3T1YF 5IOLA 1TKXB 4KHPF 4M95A 1UVNA 1YJVA 3OR2B 2D7SA 1EKSA 3ITHA 2RQCA 4KYZA 3CE8A 4DR5J 2ZOFA 2V67A 4O4GB 2K7KA 2WONA 2IRUA 3TVYA 1D1UA 3N6LA 4Y34A 5AJ3F 4IDKA 2YBVA 4EMDA 4C8OA 2OLWA 4DR1F 4IRDA 2A2DA 5J2NA 3QYYA 1HBMA 2JWNA 1NH7A 3CTRA 4ED2A 4JI1F 1S1WB 2HQFA 4R25A 2R42A 2QRRA 4DL7A 2YQ3A 4P2XA 4X4SA 3KK2B 2DPIA 1PYSB 3PJWA 4KRWA 1EQMA 5SUHA 4Y3CA 3MCOA 1K44A 2VPXB 4FYDA 4ZCKA 3GR1A 3R8YA 3WC0A 5J1EA 1SQFA 3D6TB 4NCBA 3KOAA 4DBQA 2B4VA 1UCNA 2IMOA 1LOUA 5EWFA 2K3IA 3HT3A 2OPQA 5HATA 3FNNA 4JI8F 4JB8B 2DNZA 4IRCA 4W4MA 2V94A 5A8WA 5D0RA 1R3NA 2H4WB 3EVMA 1S49A 1VRTB 2BKOA 3BO2A 3WQPA 3RAXA 1OSDA 1JLBB 3QGHA 4DR7J 1FFGB 1CULA 4QWDA 1HQUB 4A8WA 1FCAA 2HWIA 3A12A 2BQUA 5G4DA 5L38A 1DQAA 5RUBA 1WOOA 1J2VA 2GNKA 5IZHA 4QW8A 4OZNA 4K0KF 3G86A 1O5JA 3B4MA 3QFWA 2RH3A 2HS4A 3QLHA 2W9AA 1IBMJ 3MFHA 3AH6A 1N36J 2BW2A 2GO8A 2FJDB 2E7XA 2XCAA 3BH7B 4X65F 2X1BA 3MURP 3P5BP 3OTDA 4FF1A 1H7WA 2RQMA 1TUGB 4L76A 3GYXB 4I2PA 4G1QA 3V6DB 1HNVA 1VK8A 1L3UA 3QZ8A 4OX7A 2XS2A 3Q8PB 2Z4PA 1F5CA 4ZHRA 3C3LA 1OSCA 1RLCL 2VFSA 4NLTA 2E1RA 5LL6d 3TW0A 4V19X 2BRLA 3G4SS 2O1PA 1S12A 2ZKTA 3MM9A 2RS2A 5I42B 3TQ1A 3J7A1 3BDPA 2MZSA 2CZ4A 2Y9HA 2HAIA 2F4FA 1ACMB 4LSZB 4Y0FA 1P27B 1UWBB 1C0TB 2VQEJ 1U45A 4I4BA 2BUNA 1DLOA 2LDIA 1VHIA 1U8SA 2CJXB 3A3NB 4I7FA 2ASJA 3MEEA 3DU6A 2ZD1A 5J2PB 4D3GA 4CIOA 5I4MA 1RT5A 3LWMA 2QL7B 3EMTA 4WKRA 3T1HJ 2RF2A 4WK3A 1D9AA 4BC7A 2AT1B 3OUYB 2MGZA 3CD5A 5M2RA 2MY7A 3MMBA 4AUKA 1Z1ZA 2HLUA 1X9SA 5IFMA 4N8OA 3VALA 3KK1A 4OJ1A 3I31A 3T6BA 5H9EK 4RZRA 5H1SV 4WTYA 1L5UA 2CQ4A 2ZH4A 3FCWA 2OD4A 4RWXA 2NUUG 4QQBA 1HA1A 1N56A 2DNKA 1WDDA 1T9UA 3OXGA 4RW8B 4XIUA 2Q79A 1W2BR 1TK8A 2E7WA 2DNGA 1FFWB 1FWLA 2ROEA 4JV2A 4N76A 4DPXA 2HGMA 2WBRA 8AT1B 3KK3A 1X9WA 4DQIA 1SKWA 5C42A 1NK7A 2JRSA 3SYZA 4O3SA 1K0VA 3EXYA 2FY8A 3O1LA 2GC8A 1U1OA 1YJ9S 2B7CB 1VI7A 5ETMA 4OI1A 5GAGU 2DNPA 2DGXA 5HBMA 3EM1A 2HHTA 1E6VB 2ZM6J 1IN0A 4CQ1A 3FBCA 4I6WA 2HGNA 4NZ0A 5CYQA 3VR1A 1XQIA 2XMWA 1MW7A 1GXLA 4QYZK 1QSLA 4AXJA 2XYHB 2JSXA 3I0SA 1WJ9A 4M5DA 2KFNA 4C8ZA 4FYYB 1PSDA 2J0QD 5KG7A 4DV6F 3H59A 4YS2A 1TFYA 2GHWA 3PACA 4NLOA 5LSRA 2RKIB 5A76A 1MNEA 3U1NA 3VQTA 3K5PA 1A7GE 2ZHOA 3N79A 1EETA 1OPIA 3G6VA 3HHLB 1VISA 3C16A 3G96A 3FJ2A 2W2PP 5GAHU 2OPPB 2OTLS 1QVFR 1DFDA 4XPEA 5IWAJ 3Q0AA 2MQPA 5C2CA 1IBLF 1QUPA 1Q0NA 4OYIA 2AJ4A 2ALYB 2BDPA 4ZN1A 3HVTA 3AOCA 4YB5A 1X0FA 3IWNC 2CG4A 4B3OB 2ZHBA 4ZVEA 3R2CJ 3A3OB 1ZZFA 1O6XA 4QZVB 4CLYA 2UV8A 3UN2A 2NLWA 4JV1A 2HRUA 4AE5A 1WSRA 4TVAB 1KLMB 1N52B 4YY3F 2B51A 1ZA2B 4LF8J 2HVEA 3NGSA 1VQYA 4WKYA 4X4NA 2KL8A 4R5PA 2R8KA 4KO0A 1RACB 2Z2YB 4KPYA 2WB1D 3ZTSA 4I67A 2CQIA 1X4BA 2E9ZA 2AJ0A 4GVBB 5F3TA 5DDOC 5HP1A 2JLFA 1FKAF 4PWUA 4L75A 4DCPB 2P5VA 3GCXP 2PEBA 4AL7A 2B6AB 2W4CA 3BGRB 3T1YJ 4KGXB 4TQSA 1M0SA 1UJ4A 1Q7LB 3FRZA 4ELVA 2HZVA 4KHPJ 4AYBD 3PO5A 4C3LA 5ETPA 2XSJA 2MSTA 1W26A 1AXQA 3KHHA 2FZCB 2MZTA 4F04B 3ENQA 2X1AA 4B9LA 1IKYA 2HMIB 5DLGA 5U47A 2QYCA 4FNHA 4DUTA 2OEKA 4LRDA 4IH7A 2CJ9A 5HMZA 5AJ3J 2VFVA 3Q8UA 2LYVA 4ECTA 1PKUA 2XHWA 4DR1J 3NGKA 3SZ2A 2E44A 1CSJA 1VC0A 3IO1A 1MG7A 1X4EA 2JC1A 1XEZA 2E5HA 3TAPA 1VS3A 1I94F 4J9RA 1WOSA 4B9NA 2MPUA 4ES2A 2AEJA 1NKEA 4PXEA 1Z4UA 4GMKA 5E3PA 3JYTA 4DV2F 2XGPA 3C6TA 4JUZA 4W92B 3B4DA 2VA2A 1NK4A 4ZPDA 4CYUB 5KG0A 5CYMB 3KHLA 4O44A 4TYAA 3JSRA 1X4HA 1M1HA 1UFLA 4KV8B 2CKWA 1N32F 2PFFB 4MIAA 1JLGB 1K8AT 4OYPA 4GC7A 2VG7B 4JI8J 1C1CB 4DDFA 1Y7PA 3AFGA 3GV5B 1FRMA 4WPAA 4NLQA 3RR7A 1ZPWX 3POTB 3MAAB 1IVZA 4QR1A 4WF9Q 2E5GA 2DH9A 3FEYB 1KBRA 2RU3A 3HM9A 3I4HX 2JZ5A 5D6GA 2BM1A 1LW0B 2MYFA 1N33F 4QJVA 3I87A 3W64A 3RRGA 5K8MA 1L3KA 1YKWA 3DOKB 4K0KJ 4ZCIA 3M32B 1XBWA 2DB1A 1YJNS 4RNOA 3JTNA 2AEMA 1UFKA 1VIXA 2E9TA 4LRFA 3J7Z5 5KT6A 1F2GA 3T41A 2HZCA 3BGOP 2RVJA 4X65J 6FD1A 3GP9A 4FS1A 1VQNS 1RWVB 2N82B 5L1JA 1U0HA 4K2JA 3C15B 1WHYA 2ZBQA 5G0RB 2UP1A 3I0RA 2CVIA 1T9YA 3MAQA 1F3FA 3MPVA 2RHSB 5CABA 3BN7A 5I3QA 2DK2A 3W9IA 4B3TF 2V2QA 4ES1A 4ZVHA 1RAFB 1DRZA 4ZJOA 2R2RA 4EGLA 3VF0B 1NB2A 1K9MT 2YWKA 1D3WA 4I2QB 2OP5A 2XG8A 1BQNB 3QT8A 2JL9A 5KT7A 1OMSA 1XERA 2QTWA 3E2EA 1Y5NB 4MH8A 4J7CA 4E98A 3TEHB 5A2QU 1PC5A 3ENWA 4Y2AA 1WC6A 3DRRB 2E7VA 2DNHA 2J8AA 4ZITA 1RU2A 3DOLB 1HMVB 3MHYA 4TY8B 4DV7F 1VMBA 4CI0B 4XDDA 2DHSA 4PG5A 2C2OB 3DM2B 5D15A 4F26A 2EFQA 2I6WA 4JYAJ 2VFRA 4BLGA 2A10A 2IM2A 4TN2A 4JI2F 3CCQS 4NA3A 3ZZZA 2C2EA 1HL6A 1GFWB 2KN4A 4HVZA 1QY7A 3N4WA 3CDAA 3K5LA 4UZBA 4ILRA 4GKJF 1ZM9A 3MFIA 4J37A 3R5DA 3VAFA 3HF5A 4P6QA 3G71S 3GILA 2RRAA 3VHQA 1YHQS 2QLXA 2RQ4A 5K8PA 1F9HA 1W2IA 5KT2A 4KR0B 1NBEB 3ZTQA 1KLNA 4DR4F 2GAGC 1F3VA 5AE2A 3VV2B 3BSCA 2W9CB 1XN9A 1YQHA 1CQMA 3L95X 5GADI 2QLBB 5HJXA 4KAIA 1URRA 4LSLA 4G1IA 3KG1A 1F1BB 3KHRA 3ET6B 4KGMA 2HPUA 1QAYA 1BE4A 2EG2A 1NJYA 1DTQB 1JNZB 2PT0A 3OFHA 2Y1IA 1S0NA 3FUYA 3QRQA 3E01A 4F2RA 4F02A 1Y0HA 4DPYA 4ICLB 2D3UA 4PG4A 2QL5B 1R8AA 2RRBA 3THVA 4DV6J 3A13A 5D3GA 3TUJC 4OYMA 4OMFG 2V4JB 3IR5B 1HIYA 1IR2A 3MAHA 2VHGA 1RI7A 3W61A 2NPIA 2IA6A 1U2RA 2PMZD 1DJ0A 5KG3A 4DN0A 2FVCA 3GU0A 3Q83A 1AUSL 1RTIA 1NK6A 1RT4A 4PYAA 2C2MB 4WXOA 3X3UA 4CT9A 3PX0A 1WHVA 1NZAA 2B4PA 2YNHA 1RT7B 2UVUA 1IBLJ 4DQPA 5KFJA 1S6OA 1RBOB 2C2RA 4CLPA 4K4YA 1VQ7S 1IKXB 4OJHA 3GB0A 4PUOA 4JV0A 3M8YA 1OY9A 3FQKA 1OIAA 1S0MA 4NASA 3IRXB 4OLOA 4RW4A 2JX2A 3CJ4A 4OYOA 3IMQJ 1U6ZA 2OD6A 5FDLB 3HP6A 3BF4A 2CADA 1Q5YA 4ILLA 4CO0A 5EWGA 1MMDA 3NCPA 1LK5A 4LREA 2YXLA 4CO3A 3RB3A 1S6QB 5EHHA 5KFMA 2MY8A 4YY3J 2VBXA 1T94A 2KFZA 2NXUA 3K89A 3GIIA 3H2UB 3TZZA 2WW4A 2YWFA 3EPGA 4DF8A 2EEYA 3US5A 2Y1RI 3MUTP 1WEZA 2BQ3A 3PIPQ 2DNYA 5BYRA 1U25A 3DFEA 2XMVA 7FD1A 2HQIA 3F0NA 4A8MP 1RWPB 3NGDA 3OHAA 3KLFB 4Q8FA 4DWIA 1ULRA 1BWVA 1JLEA 4WU2A 4DCJB 4P71A 1WC3A 5CQGA 5K14B 3AJ1A 3OT9A 2JLEA 4UTGA 2M0GB 3M30A 1XMBA 4DL0C 1WEYA 4ZP9A 1DURA 1HI8A 2UUAF 1SVDA 2IPOB 3R6LB 5F9NA 3FC9A 1LWXA 1X9MA 1X5SA 1ZOTA 2X51A 2DGWA 3CCLS 1WNEA 1V3SA 2OEMA 3JAMY 2BJDA 2N4DA 5DGAA 1T02A 4ELTA 1M1GA 2VBZA 1RAAB 3OTOJ 1UJ5A 5L8RC 1N5YB 3M7VA 2O5DA 4EUVA 2LKZA 1PJ7A 4RL1A 4GRSA 1VQ8S 1ZH5A 1DY3A 1OWXA 3AB4B 2WOMA 3MDFA 1I94J 1GX5A 2ADCA 3K8VA 3DN9A 2BRKA 3MM6B 1JLAA 4IFVB 1U2CA 3J81Y 5E7OB 4DV2J 5IM0A 1B70B 3CF5Q 1NSQA 4KFBB 3KLHB 4C48A 3D66A 1X0PA 4V19J 1S97A 2IBKA 3M6UA 3MOZA 4K5RA 3DGPA 2VFTA 3GIRA 3K8WA 4K4VA 3OSNA 5CD4A 3ADAC 5CAAA 1TL3B 4CLUA 2HYIB 3CJ3A 2OKQA 3AY0A 4Q8EA 2CPYA 2UUBF 1D9DA 4OL8A 3CJ2A 4U8YA 3GJQB 1C1BB 3KJQB 4LSNA 2XHCA 3W63A 1N33J 4HHJA 2EC0A 2OPRA 3TP2A 2BXJA 4ECQA 2RD5C 4OX8A 3IXQA 2WONB 5D0HA 4ETXA 3QWUA 4DV1F 3N0VA 2CQDA 2NREA 2ZE2B 4HL9A 3AJDA 2QN6B 1HWLA 2IYIA 3CJ8A 3W8PA 3ILJA 3PJ9A 4DX7A 5J2NB 1O0PA 4N56A 1U6BA 2GA7A 4ED4A 3ENAA 1HBMB 2DEJA 4ED5A 1Q53A 1NH8A 5E3RA 2XLIA 1VDHA 5HROA 2B9YA 3LP1B 2VL1A 3D3CJ 2I38A 2GGPB 3WDOA 4ECZA 2W8LA 2W25A 3E8OA 3CC4S 1OQ6A 2AW0A 1YZ6A 4DV5F 3T1AA 1KEKA 5J1EB 4Q5VA 4B3TJ 4A47A 2YWHA 5DDQC 1CJKA 2Y3YA 5KG4A 4TU9A 2QMWA 2W9BA 4O0NA 3CULA 1JXLA 3WZ0A 3NS6A 5FLXU 5DS7A 1I51B 4IR9A 1E6YB 3JB9k 2YNIA 1TKXA 2KYXA 3LUYA 3FDSA 3M05A 1TP7A 1JLFA 2MKYA 5DDPC 1RHJB 2IM0A 4NZ6A 2W7AA 4X4PA 1HD0A 4X84A 2K3KA 2FJEB 2J6UA 1VQLS 3OR2A 3PY8A 2ACMA 2C28A 1CULB 2IAJB 1W25A 4O4GA 1NUEA 1KN6A 4K5SA 4DV7J 3HI9A 1KHVA 4MTPA 2MKSA 2MZQA 2R7RA 2LA6A 1H72C 1NB7A 4WZQA 2XM3A 3CMES 5LMNF 2ZVIA 1PILA 2NUHA 4HT5A 1JB0C 3NMRA 4QW9A 2XCPA 4JI2J 3QLHB 1ZAXA 4PABA 4DR3F 3KK2A 2EK6A 1TQLA 3W2VA 3CUNA 4NYPA 4G1QB 1HNVB 3VCDA 2V5HG 4HYKA 4GKJJ 2YQ0A 1XNQF 2CVEA 4X66J 1Q78A 2H5IB 2F9DA 4H4MA 3DHXA 2XY7A 4WJBA 5DG7A 2RQKA 3A8KA 5L1KA 1WC1A 3PJXA 4WCEQ 2KVIA 3MM9B 1NDKA 3BR9A 1HBOB 3NY0A 2NSCA 2GQ2A 5GAEI 1VRTA 4ZKAA 4WP9A 1YITS 3ELHA 3MPWA 2E5IA 2BJEA 1VQ9S 5KAKA 4CWBA 2KG0A 3PVXA 1DLOB 4I69A 1PAEX 5DETA 1NZ8A 2CQ3A 5AE1A 1QM9A 4U9RA 2N4CA 1J5OB 2ZD1B 1REVB 1VQMS 4UOFA 3DI6B 3T9ZA 3MR3A 3JQMA 4DU7A 3BZQA 2ZVSA 5ETTA 4OLPA 4ZJQA 1S48A 2RF2B 1D8ZA 1G3OA 2MGZB 1RQ0A 4QYRA 4DEZA 3SFGA 4PZVA 1EP4A 4USVA 5D4PA 3OTEA 1NRKA 4OYAA 3CD7A 5FD1A 2JEIA 1LKZA 3KK1B 1LFPA 2B43A 1NEEA 1MWQA 5E41A 3V6DA 4RNNA 2M8HA 4WFAQ 4TYBA 2YKPA 2KRRA 1EQ0A 4CLLA 3OSPA 4L73A 2C22A 1FFSB 1GMUA 2N7YA 2BACA 2XY5A 2OIHA 3OVSA 4ED0A 4DX8H 2JVRA 5I42A 2M70A 2CJAA 2ZH5A 3EGNA 3KK3B 3OPKA 2AWZA 5C42B 3W7BA 1UWBA 4OZ0A 4ZLPA 2CZ9A 4K2XA 2E5JA 2F5GA 5F8JA 3HFKA 3LGHA 4AXIA 2PMHA 5K5MA 2MQOA 4QIEA 5HBMB 3DRXA 3OLBA 1RWKB 4PKDB 4M5MA 1Y10A 5KFFA 1WF2A 5CYQB 2HGLA 3ZXWA 3OUYA 2G13A 5L46A 2WVFA 3R5GA 3HFZB 1PG5B 3RBZA 1X4GA 3PRDA 3NWRA 3SCJE 3I0SB 4U7UD 2FC9A 1ROFA 3IGNA 2M2BA 4O23A 1VBXA 3CCJS 2HBQB 3TX0A 1RYRA 2JDJA 3MF5A 3OTCA 3LALA 2C2ZB 3CW2C 4HR2A 2HRYA 5KFOA 4RW8A 2D74B 3UD5A 2XMKA 4DPWA 1KONA 2D69A 2KFYA 5F0WA 3KNGA 1CLFA 2WAQD 3CC2S 3OR1B 3ZZPA 2UUAJ 1A9NB 2MB0B 3THTA 4F0KA 3ZTRA 2XC9A 4C7QA 3CCUS 3C46A 2ZJPQ 3ILLA 2DNQA 3HFVA 2B4OA 4MIWA 3U1MA 1L3TA 2HFOA 2CYYA 1NKCA 3HVTB 2HBRB 2ZBPA 3AD7C 4DG1B 4K4XA 3HK2A 4X62F 1IR1A 4MK7A 1PJ6A 3OTBA 4LF5F 2C3YA 2NYIA 4TU7A 4QBUA 4U7UK 4DR6F 1S0VA 4K4WA 3VZIA 3RYLA 1GMWA 1MMNA 1WUUA 1JJCB 2EKYA 1Q5VA 2R8GA 1SI9A 4O3NA 2NYHA 2IDLA 3FEZA 4URSA 2XMMA 2CNOB 2J6SA 4F2SA 3M6XA 4M5NA 4DL6A 1H98A 3AOBA 2UUBJ 3IG1B 5DJBA 2Z8QA 2CQHA 3GFYA 4R8UB 1FNXH 1WOPA 2OPPA 4QIWD 2Y8WA 3K5OA 4KHRA 2D1CA 1QSYA 3ZFVA 2WW8A 3GSIA 3AXKA 1IKYB 2JOQA 3PW7A 2OUGA 3G8TA 3MWBA 4YR2A 1WF0A 4IO1A 4DV1J 2IVYA 4F8RA 3GV8B 3QRRA 2LECA 2EFOA 3UDVA 3H40A 3N28A 4B3OA 1LWFB 2BBEA 1LXNA 1MWZA 2LEPA 4B9VA 4XTTA 1VQ6S 3TAQA 4QWCA 3W3SA 1RLDA 3NNHA 1S9EB 2YNFB 2FZGB 1KLMA 3IR7B 3TR5A 2VV5A 5KFZA 4BC9A 3RR8A 3MM7A 3OXFA 2UXDJ 1IWGA 1T9WA 3RW6A 1RZMA 4DV5J 3D7SB 1JKHB 4F4AA 4M1KA 3MD1A 3UPFA 2FJWA 2ZC3A 5T41A 1SKUB 3DRPA 4PPDA 5ETNA 4YUDA 2YTCA 1CEZA 4J5OA 1UVMA 1DARA 2B6AA 2FZKB 4OZ3A 3BGRA 5C24A 2MKIA 1UPPA 4CM0A 3HKZD 1I5OB 4H4OA 3MCNA 2NXEA 3BBBA 3UCUP 3IRWP 3MM8A 1H7XA 4NPOA 1UKUA 3BKUA 2ZEJA 3HPOA 2I5JB 3I9ZA 3AAWB 1RABB 5IV4A 1HNIB 2UVRA 4U67Q 4WFNQ 4BCAA 1SIZA 3TAMB 4ZVTB 1GQEA 2I9SA 3O5TB 2QZ8A 5DM7Q 3LWLA 2OGUA 2R7SA 3KLEA 5LMNJ 2MKHA 1JK9B 1U1QA 5DM6Q 3QSYB 3F56A 2DR6A 1S5ZA 3J7AN 3QPIA 3FKBA 3Q86A 1Q95G 2DIUA 1OPZA 2ASYA 1P1TA 1IWAA 1HNXF 1NM2A 1M5VC 1NCLA 1UA1A 2MQQA 4CYUA 1Y3JA 3DLEA 2M3DA 3V81B 4Z7CA 3CJRA 4KV8A 4C2MA 1VQ4S 1JLGA 2BV3A 3LP2A 3S1TA 4K4TA 5KFCA 2E1CA 3QRPA 5AXKA 4A8SA 2HHWA 2R9LA 1KOHA 1WC4A 4OYWA 1N0VC 4HKQA 4RBVA 2IRYA 2FUG9 3MAAA 2QO3A 2ZUAA 2R4FA 3H5SA 2LMIA 2MLXA 3RTVA 2LEBA 1MN7A 4U8VA 2FIUA 1PC4A 3GG0A 2E1PA 1LW0A 1S1VB 4RW6B 3DOKA 3HMJG 3R1LA 4IG3B 2MXYA 1U1KA 3K0JA 4DJBA 1NDPA 3M1VB 3DLKB 4E0DA 3ONQA 1U6FA 1F2HA 1V5VA 2MTLA 4DL4A 2J9DE 3TUPA 1AB8A 4CO5A 3H7HB 4TLRA 1AT1B 1SIWB 3TZWA 4CT8A 3TVKA 2ZH7A 2V8DA 1WG1A 4WZMA 4NLDA 2DR9A 4L74A 1YBTA 1EX8A 4N41A 3FQLA 5DZ7A 3KJVA 4ZVQB 7FDRA 1FRJA 3LANA 4K8RA 4N7TA 5HQLA 3CDBA 4YDDB 4MT1A 2GIRA 4QR0A 1Q79A 1ZS6A 3UDCA 2Y0SD 2P9EA 4RNMA 1P9YA 4C11B 4I2QA 2XS5A 1RWOB 3LO3A 2ZBRA 2ZFHA 4YB6A 5BJRA 1RTZA 3MPDA 3I82A 3CWJA 3A8JA 4LJMA 3TA0A 4FDFA 5LM7E 1XIQA 4PQUB 3KUEA 4USJC 1U4BA 1Y5LB 3DRRA 1RSCA 2V4QA 2V68A 2PC6A 1TTHB 1LWCA 3DOLA 1HMVA 2XQCA 4DI6A 4TY8A 3I32A 4C0OC 5KFRA 1S0OA 3SQGA 2ZHAA 2EFGA 2WCXA 1M1KT 1QAJA 3JSMB 1QDUB 1TAQA 2CPDA 1WKJA 3SSRA 3GQCA 4EYIB 1K1QA 3QMQA 1FKOB 1UAWA 1AROP 4P7VA 3WC2A 3E01B 1N36F 4HLBA 2QSWA 2HZAA 2Z2ZA 5KFWA 4QR2A 3UWTA 3DLHA 1APSA 5KFAA 4YFUA 4ES3A 2GMHA 2EVZA 3JQKA 3VTIA 3OFGA 2BJ7A 4EYHB 2C3OA 3VAJA 3KDNA 1HHQA 4JV5F 3IM9A 3HJVA 4YP3A 2LQJA 2ILYA 2JFKA 2QLJB 3C2PA 2YKMB 1VJWA 1T03B 4JI0J 3CJSA 3VGTA 1RT4B 4LR8A 1RT6B 4C8MA 2DO0A 1FRLA 3DKDA 5GMEA 2PN6A 2VD3A 1CBKA 3J7YU 1NO8A 3M6WA 1VBKA 1B0TA 3NXZA 2C2NA 3NEKA 4NZ7A 1YJTA 1KNZA 1GH8A 4DV0F 3W1YC 2VQEF 3DLBA 4PUOB 1TL5A 4JBCA 4L3KA 2EKNA 1U0SA 1MU2A 3FEXB 5JXSA 4RW4B 3DHWC 3IBCB 4X62J 1XC9A 4MYUA 4B08A 4DUYF 1S77D 4LF5J 5IS2A 2BZ2A 1N48A 4A46A 3P49B 4NRTA 3FCHA 1LXJA 4NLYA 1T9VA 3UCZP 3NGUA 4DR6J 2R8JA 3PM9A 5EX0A 1KVIA 3IS9B 3N5BA 3GSDA 1TUVA 4CO4A 3ISZA 4TQRA 2OSRA 2V4JA 4CZCA 2LFVA 2MJNA 3HD2A 5LSLA 2M7SA 2DCLA 4EZ9A 3K7RA 3MR2A 1FF2A 1TKDA 1AFJA 2IFXA 2CNNB 1JLEB 1RAJA 1FXRA 3BO3A 2DNMA 2WVCA 3GPAA 3HVRA 3TNVA 3LP0B 3SCLE 1ZBTA 3BBCA 1RT7A 2RMLA 1Q82T 3D67A 4I1TA 2ROPA 1UEVA 2YH1A 5EWEA 5HVFA 3LAKA 4FYWB 1IR0A 1FDBA 3MPYA 5CH7B 3QGPA 2AEFA 3IRXA 3Q89A 3WIUA 1YJ7A 5FDLA 3V4IA 1S72S 3Q8SB 1FNMA 4H4KC 3BKTA 4RNFA 4MAKA 3DGVA 2V2VA 5D77A 2WOMB 3VGSA 4Q45A 4B9SA 2D9PA 2FVRA 2X3DA 2KH9A 2IHR1 3W65A 5DGBA 5IM0B 5KFPA 4URGA 3W5XA 3SSSA 4USWA 4LF9F 2J5AA 3P3DA 3FFIA 5C5JA 2D9OA 4YQWA 2W2MP 2VPZB 3VGUA 1ELOA 1B0VA 4P2SA 1FE0A 1PGZA 4NCAA 3DGPB 5HL7Q 2KRBA 1M5SA 3ZTOA 2CRLA 2DH7A 1XMOJ 3KFWX 5D4NA 4A48A 1ZA1B 5K14A 5KFXA 4LIWA 2DY1A 1PYTA 2H48B 2YPZA 2ZZNA 4PG6A 3R2DJ 4FVMA 2BABA 2LXFA 4EK2A 1XJWB 4LSNB 3WX8A 3DRSA 2PA3A 3M8QA 4NXNF 4DUZJ 2IC3B 4TU8A 2V2KA 3NL0A 1F9EB 1PAUB 4HTJA 1N5YA 5DDRC 5DZ6A 3AA9A 1QVGR 1VQKS 1UVLA 3KHGA 1AYEA 2VJUA 3R5AA 4FN5A 2ASDA 3N9UC 1P1LA 1CC7A 3LGNA 1VLYA 2YX4A 4KFBA 3KLHA 3VQSA 1HFEL 1SCJB 2MZRA 2HS3A 2DD8S 5F0UA 3AT1B 1ZETA 4ALZA 1UTAA 1RT1B 3AD9C 3QT5A 1SC4B 2K06A 2CIMA 1MLAA 4IKAA 5D4OA 4J9VA 1D8YA 2MSSA 2NS1B 2HFZA 1KP6A 2W9BB 3TJ9A 2A0FB 4K50A 5B0GA 1YRUA 2P9CA 2QGFB 4AL6A 1VRQC 5HQMA 1R0AB 2YNIB 2DITA 1JLFB 2C42A 5HVGA 1P8GA 2AV5A 1VRUB 3H20A 2BKPA 1C1BA 1KVKA 1IM6A 1FKPB 2I0XA 1LV5A 3HXMA 4X64F 2XWXA 1HW9A 3QFHA 4F67A 1U26A 2LQ8A 3H0PA 4RBTA 3DLGB 3W5YA 4X4QA 1FE4A 1X4AA 2ZE2A 2EWHA 4FKYA 2VC1A 2P6SA 4JI7F 4YB1P 2YX1A 5CZXA 4C0HA 4LFCF 4ZVSB 4YR3A 2APOA 4IG0A 1MN9A 3PNIA 4B3RF 4DL3A 1ICEB 2XYPB 5DLFA 2VB6A 3GFXA 2FHKA 3LP1A 2GGPA 3IP0A 3R5JB 2ZZTA 3L7UA 3A4TA 2V63A 4Y28C 3W2VB 4O3PA 3G6ES 3I6PA 4DQSA 2XB2D 3Q2SC 1RWXB 3I96A 4ZIVA 3PO4A 2XI2A 4FVCA 3GIJA 2H1YA 5KT4A 3IBWA 4H4MB 2MHNA 1TK0A 2R7VA 4NE9C 3EJMA 3QJLA 1E6YA 4QPXA 2ZNZA 4ZIWA 5HQ8A 4OV6A 4CO1A 3PZPA 3QO9A 1FI4A 3H98A 3QT7A 2FYXA 1RTJA 2EG1A 2B7BB 3PR4A 4OHXA 1AW0A 2IAJA 5JVGQ 3LPYA 2V8PA 1YJUA 4ZOSA 3J80Y 3B54A 4CTAA 4F0MA 2X3GA 4NI2A 3BSAA 1IXKA 3HLUA 3FMBA 1HD1A 2YNGA 3AD8C 1IM4A 5ETVA 3ZZOA 1CJUA 2O3DA 2ZC4A 4CLFA 3Q24A 1T05B 2DGTA 4RKUC 4NMXA 1EP4B 5DRKA 3GZ7A 1JJHA 1NSPA 3R1HA 2OI2A 6AT1B 2QFJA 3L7OA 2DY9A 3OL9A 2U2FA 3CB4A 5B0BA 4LT6A 2OHDA 3EDQB 2N7CA 1QE1B 2H9ZA 3W5ZA 2PFDA 4JV5J 1WKKA 4KH1B 2LQ9A 4CRJA 3KLVA 3PDNA 2CPFA 1EARA 4F36A 1RTHB 1X4CA 3BKFA 5B0FA 2QT7A 3D54A 2B9WA 3T19A 4DL5A 2UUCF 1S6PB 4FF2A 3CO0P 2HHHF 5HJYA 2AJ2A 3OW2R 1HBOA 1HR0J 4Q43A 3KJFB 2DXDA 4TNOA 1S79A 2WSFC 4DV0J 1OJ4A 4DU8A 2I1RA 4MKVA 2GCFA 2GS8A 4X4OA 2RDDA 3JQJA 1KD1T 3PX6A 1IKWB 1J5OA 1TU0B 4DUYJ 2HHSA 1REVA 4TY9A 3MZIA 1U47A 3HSGA 4UQGA 3DI6A 1UFWA 2RJZA 2ACYA 4ZVPB 5EGYA 3EZOA 3OV7A 4JYAF 3BQ2A 3GJTB 1D09B 5KFBA 2LU1A 4UY8T 5A8RB 4ECXA 1V9OA 4M5JA 3RW7A 2CPZA 4Z37A 3ICLA 1U48A 4DFPA 4FF4A 1BLUA 1Y3KA 5LSOA 3M4XA 1RWNB 4ED6A 8ATCB 5F8MA 1RAGB 4P10A 3EGWB 4DFMA 4DS4A 3BGUA 4USHA 3G2XA 4M5GA 2VQFF 1X31C 2X1GA 5KFVA 1QAXA 2QA2A 2CNLB 1DQ8A 1A6LA 3MCMA 1SUQA 7AT1B 3P96A 2K7JA 4MK8A 2A1BA 2V9KA 4ED8A 5JJBA 1TELA 2B5JB 3UN5A 5HANA 4J9OA 2ZOMA 4LF4F 3ILOA 3TVZA 3TUIC 4TXSA 1WORA 1QAIA 1RP5A 4I56A 4C0BA 4ZP8A 1HI1A 2DR7A 2XMJA 4OHWA 1HYSA 1KTVA 5GMDA 1FD8A 1HWIA 2CPHA 3C6UA 2EW9A 3Q8YA 3NWGA 1C4CA 1ZM3A 2J0WA 1LNQA 4C6AA 1UVKA 2WK4A 2FGOA 4KGVB 3BYRA 2CQ0A 2E5LF 3C66A 1OY8A 4LF9J 3EVWA 2Y1LB 1YDLA 1HQEA 4P7TA 3IA0A 1FJ7A 4LRAA 3BJYA 2Z58B 5F3ZA 2HHUA 4YN3B 2VC0A 3LGMA 5KG5A 1FDNA 1BQXA 4G1PA 3KLIB 1H73A 3F44A 1U2FA 2A6OA 1KTQA 2Y1JA 2HFSA 3L4BC 1UEKA 1T9XA 5D4LA 3MPUB 2ZNYA 4DOZA 5CZVA 1YWXA 3OR1A 5A6PA 1LK7A 1OYDA 3T5JA 4LMZA 1Q8IA 2CNKB 3RBEA 4AL5A 4KSEB 4NXNJ 2NZ4A 2HURA 2KU7A 2F7VA 2HSEB 1AUDA 4WE1A 4H4KA 2AD9A 4DG1A 1R27B 3FK4A 3CMAS 1B7YB 1YX2A 2Q43A 1HKAA 2FD2A 1N0UA 2CAJA 1Q8KA 2BANB 1SB6A 1RADB 2DRBA 1R89A 1NPPA 2VG6B 2E66A 4MK9A 4F4YA 3O3LA 1SL0A 3MM7B 4NL5A 4Q2LA 5KOXA 4IH6A 3TQEA 4BHQA 2AJQA 3H8YA 2R7OA 3MEGB 4PCQA 1FJCA 3C14A 2GVDA 3VAMA 2QG9B 2RUSA 3DRPB 3MOJB 3RUBL 3KJNB 4UZCA 2YX7A 4Y00A 5C24B 2DHGA 4R0EA 4H4OB 3IG1A 2IRXA 3I5CA 4UT4A 3MM8B 4R8UA 1IJEB 3NGRA 3QGGA 2DR5A 1HNZF 3VAHA 1TL1A 1FX2A 5H9EJ 1NHKL 4X64J 4ZPWR 2Q66A 1BQMA 4P2FA 3R5BA 2UXCJ 3HSDA 2CDRB 2EXUA 2GMJA 2L3MA 2VIHA 4HACB 3IWXA 2BE2A 1LWFA 1YGYA 4JI7J 1R7IA 5B7WA 3T9NA 3OTOF 3KLEB 3QJPA 4KB7A 4DSJA 4LFCJ 1U02A 3R97A 2DNLA 4RW9A 4B3RJ 4FF3A 3TZYA 3VVUA 1S9EA 2MHEA 2FVQA 2YNFA 2XWYA 4ZPVR 5IT9Y 3R9LA 3O8WA 4HH0A 5BXIA 3A1YG 2DGVA 4JI3F 4LR9A 2UV8G 1C0UB 1UMJA 1NKBA 1JKHA 4FBTA 1MROB 5A8KA 3DLEB 4GC6A 2RILA 5HAOA 1NNDA 1G2EA 3FSIA 1ZTTA 3LP2B 2W4PA 2V50A 1MSWD 2CFXA 4G3IA 2Y0BB 4QPTA 1FEEA 2AGOA 2GHPA 2V2ZA 3DYAB 1RWUA 1SH3A 4UOCA 2WVEA 1MMLA 3ZTPA 2J7UA 3MECA 4C8LA 3R7BB 2I5JA 4MYTA 2K1RA 1WKLA 5D0GA 1SH0A 4C8NA 4M94A 1S7IA 2CQBA 1HNIA 3M2UB 3MUVP 4CH1A 2NZCA 1WC0A 3TAMA 1KWMA 3WX4A 4F4XA 1QD1A 5ITHA 5I3UA 3BGLA 2A3JA 4FXVA 4NEZA 3NP5A 2HWHA 4BS2A 2GV1A 8RUCA 4FYXB 2WTFA 2AJFE 4FS2A 1UVIA 3BO4A 3ZNJ1 2OFGX 5IC4B 1P6TA 4DR2F 2YPYA 3H25A 2BW7A 3UD4P 3N01A 1B4SA 3CCTA 1TKTB 4ZPBA 2W7PA 5A0YA 3RU0A 3G6YA 5LJ5Y 2J8SA 4PG8A 1H0HB 3U1LA 3EE3A 2OMLA 1SV5A 2JH3A 4FP9A 3V81A 3KJVB 2VBYA 2VDHA 2FGCA 2UUCJ 2HHHJ 4HEA9 4X4TA 2QMXA 3HT0A 5HMYA 1FWKA 2KKHA 4J9LA 4RPFA 1RTDA 2KT2A 4DX6A 3DDIA 4PWDA 5GAGI 2HNZA 2MQLA 2YKNA 4FXDA 2W24A 1LWCB 3IM8A 5MLCV 2J7KA 1S1VA 4YMEA 1HPZB 4RW6A 1RHUB 1Q8BA 3SQGB 3MUMP 4IG3A 4ZVRB 2QL9B 2FPHX 2AMCB 4NCGA 3HULA 3HZGA 1XR7A 4KPCA 5J2QB 3M1VA 3DLKA 1U1MA 2RRNA 1N6QA 1FESA 2QLWA 4U6PA 4QIGA 2QJ3A 4ZPCA 3QSIA 3DC2A 5J2MB 3HHEA 1JWWA 5MAOA 4OZJA 2P8IA 3PXGa 4MKBA 1P9QC 1FJEB 3K17A 5GVQA 4WYLA 3OL8A 1S99A 2BEFA 2G1HA 1U09A 5GAHI 4X66F 2VQFJ 3UR3C 1OYEA 1NSAA 2W2OP 3FSYA 2KZMA 2B4UA 4DCOB 3LF0A 1ZM4A 4KKOA 4C11A 3GYGA 3OJUA 2ERRA 2R2UA 2CQ1A 4DFJA 1H2UX 3W2WB 1UEUA 2FHOB 3U7JA 2J9CA 5CXTA 2OTJS 2B3TB 4LF4J 1RU1A 3NAHA 4ZS6A 1PYOB 1JXVA 1HNWF 3TEGA 3KMQA 4PQUA 2VKZG 1RBLA 4NLPA 4UOHA 2HK2A 4RNHA 3RBXA 3ZZUA 3HD1A 1TR0A 3NGTA 1JJ2R 2Y8YA 1MU2B 3I5BA 4KQZA 4JOUA 1H2VZ 3LA0A 3VAIA 2COLA 3JSMA 2MJUA 4X4VA 5EUHA 4I68A 4AT1B 3D0IE 2PD1A 4ZVUB 1DTTA 2E5LJ 3KLGB 1UVJA 1FKOA 5DQHA 2RU9A 4YHHF 1FJGF 3M2RA 2PEHA 3I4PA 3PEHA 1YG0A 3VAGA 2OPSA 3G8QA 3CD0A 2W2NP 4DN9A 3N5FA 3KKFA 2IM3A 2DHHA 4LVNP 5C7PA 2MQ8A 2KXFA 3DOMB 3FGVA 5ETKA 1HHSA 5L9XA 2YKMA 3EWGA 4C3MA 2Z2MA 1T03A 3BS9A 2FVPA 1I1GA 4LRCA 1RT6A 3MI7X 4O3RA 4ZLNA 2AYMA 3DLLQ 5F8LA 1CJTA 4EWTA 2C3PA 2RHQB 1HLWA 1FDDA 4J9SA 5KFEA 1YI2S 3Q2TC 5B0EA 5LT5A 1XR6A 1TKZA 3V4IB 1R6YA 4DV4J 4NEYA 3GWCA 5K9FA 2HS0A 2V9WA 4B3MF 4IFYB 3DU5A 4B3SF 3SV3A 4K4UA 1IKVB 4B9UA 5HMWA 1DBDA 3IS9A 1S76D 1GNKA 4HI1A 2CXEA 4NMLA 2FHJD 1K0TA
chains in the Genus database with same CATH topology
3OFFA 3D28A 3ENQA 2Q6BA 5KG6A 4C97A 2X1AA 3CDBA 1KQFB 1IKYA 4YDDB 2KJVA 3FFIB 2GIRA 2HMIB 5DLGA 4AQYF 4QR0A 5U47A 2ZKUA 1Q79A 2QYCA 3UDCA 4BBYA 2Y0SD 4FNHA 4IRKA 2P9EA 1RKJA 3EGZA 4RNMA 4IH7A 2H5EA 2CJ9A 4C11B 5HMZA 4PPZA 4I2QA 3PEJA 2XS5A 2VFVA 2ABYA 3LO3A 2ZFHA 2LYVA 4ECTA 5L1LA 4YB6A 4UUWA 2AF6A 5BJRA 5JUMA 2ZH1A 2XHWA 3GFZA 3I82A 3NGKA 2E44A 3SZ2A 1CSJA 3CWJA 4LJMA 1FA0A 3TA0A 2AJ1A 1VC0A 3IO1A 4M5DB 4PQUB 3BSNA 4IQXA 4USJC 1U4BA 1X4EA 1Y5LB 2JC1A 1XEZA 3DRRA 1XMQF 2V4QA 3RB6A 2E5HA 2VG5A 3TAPA 2PC6A 1LWCA 4UY85 2ZBCA 3DOLA 1VS3A 1I94F 1HMVA 4J9RA 3PW0A 3KNAA 4B9NA 2MPUA 3EXCX 4TY8A 2VUGA 2FJAB 3I32A 4C0OC 3A8EA 3LP0A 5KFRA 2EFVA 1S0OA 2DRAA 4LQ9A 3SQGA 4ES2A 2ZHAA 3QIDA 2UVWA 4I6YA 1NKEA 4PXEA 1Z4UA 2EFGA 2F3JA 4GMKA 5E3PA 1LQ9A 4A8XA 4ZCMA 2N3OA 2CQ2A 3C6TA 4JUZA 2WCXA 2A2CA 2XGPA 1M1KT 1QAJA 4W92B 1RT3B 1K1SA 2HNDA 3Q8RB 1KOOA 3JSMB 3B4DA 1JMTA 3DRSB 3J7YI 4QCLA 1EETB 2VA2A 1TAQA 3M8QB 1YVFA 2CPDA 3O2IA 2V8GA 1NK4A 3SSRA 2QEXS 4ZPDA 4OIXA 3GQCA 4EYIB 2XLKA 1K1QA 3QMQA 5KG0A 4BWMA 4Y65A 5CYMB 3KHLA 3LQVA 4O44A 4HI2A 4TYAA 3JSRA 4B9TA 1TV6B 1X4HA 1FKOB 1UAWA 4ID5A 4ZP7A 1AROP 3DDKA 3ZZTA 4P7VA 1SQEA 5B0AA 5CA5A 1UFLA 4DQQA 3E01B 2CQPA 4KV8B 2CKWA 2MDAA 4F25A 1HBUA 2G0CA 1N36F 1N32F 4H54A 3MEKA 2PFFB 4MIAA 1JLGB 1K8AT 4HLBA 3B8HA 2QSWA 3ENVA 1H2TZ 4GC7A 2VG7B 5KFWA 2D3ZA 4QR2A 3UWTA 1C1CB 4DDFA 3DLHA 1APSA 1Y7PA 1LW2A 5KFAA 4YFUA 3LH2S 3BREA 1FRMA 3GV5B 4ZDNA 3SV4A 4ES3A 2GMHA 4NLQA 2EVZA 4WFYA 3RR7A 4B9MA 3VTIA 3O6QA 1ZPWX 3OFGA 3POTB 1IUJA 3IAM9 4EYHB 4URQU 4PRFA 2C3OA 3VAJA 4NLUA 4QR1A 2J9DA 4WF9Q 5T14A 1S10A 1OS5A 2E5GA 1BWEA 4JV5F 3IC1A 2DH9A 2M9KA 3FEYB 4YP3A 1E6VA 2XMTA 3VZHA 1SBRA 2KT5A 2LQJA 2RU3A 2ILYA 2JFDA 2JFKA 4F4WA 3C2PA 4EO6A 2YKMB 1VJWA 3I4HX 2JZ5A 5D6GA 3HM9A 1T03B 1N5TA 2BM1A 1LW0B 2MYFA 3CCMS 3V6KA 2MZ1A 1N33F 4QJVA 3I87A 1G7CB 3RRGA 4MJKA 1UA0A 2ZUGA 3MMJA 1RT4B 3LAMA 1RT6B 2FJXA 4C8MA 3SEOA 5KFLA 2DO0A 1FRLA 5K8MA 1L3KA 1NJWA 2O67A 2PN6A 2VD3A 4W90B 1GTHA 3RB4A 2WSEC 3J7YU 1NO8A 3DOKB 3M6WA 1VK3A 4ZCIA 4DSFA 1B0TA 1DHMA 2GIQA 3M32B 5HO4A 4X4RA 3Q23A 1XBWA 4J9QA 4A8KA 2OSQA 2DB1A 1YJNS 4NZ7A 4R5PB 4KO0B 1YJTA 3V6HA 2I8EA 4RNOA 1Y5IB 1KNZA 3B78A 3JTNA 1GH8A 2XEXA 4DV0F 5CHCB 1VIXA 3M2VA 2E9TA 2VQEF 4Y2KA 3DLBA 4ECVA 4PUOB 1TL5A 4JBCA 1CQNA 1MU2A 4UW2A 3FEXB 5JXSA 3J7Z5 2L41A 5KT6A 2VASA 4UQTA 1F2GA 3WC2A 4RW4B 1Q7YT 2CJKA 2O01C 4PR6A 2HHQA 1GX6A 3DHWC 2HZCA 1S1UB 4I0WA 1XC9A 2RKIA 2RVJA 5HP1B 4MYUA 6FD1A 3CPWR 3RAMA 3PIOQ 4FS1A 4B08A 1VQNS 4RUCA 2XSFA 2N82B 4DUYF 5L1JA 5F9LA 1U1RA 2UU9F 3LOUA 1S77D 2EK1A 2XI3A 3IGVA 3M9OB 5IS2A 2BZ2A 2CQCA 4DMZA 3HHLA 5H9FJ 4L3NA 1N48A 3KWMA 1WHYA 4A46A 2IJFA 4NRUA 4EBDA 3P49B 4NRTA 3FCHA 5KFNA 2IC3A 3DDNA 2RB7A 5G0RB 2UP1A 3I0RA 4WFXA 2CVIA 5D8HB 3SDEB 2UUTA 3MAQA 1U1PA 1LXJA 1BY9A 4NLYA 2Z0GA 3MPVA 3UCZP 2L08A 4Y6IA 5IXUA 4NLSA 3UR0A 3BN7A 2R8JA 5I3QA 3PM9A 5EX0A 2DK2A 5FIIA 1KVIA 3NBPB 2XSJB 3IS9B 3K58A 3SI8A 4RUHA 3DLJA 1LWEA 3N5BA 4B3TF 4ES1A 4BDPA 4ZVHA 3I5AA 2YKQA 3GSDA 2IMWP 1DRZA 1TUVA 2R2RA 4CO4A 4EGLA 4N47A 3PHEA 3ISZA 3VF0B 1SJRA 4TQRA 4NA1A 2NQPA 4G6VB 1K9MT 2FLPA 1DQ9A 2OSRA 2V4JA 4IG0B 2YWKA 2J9EA 4CZCA 5KFKA 1KC8T 3LW5C 1D3WA 2MJNA 3HHDA 4I2QB 4YEAA 2OP5A 2Z2LA 3D0GE 5LSLA 3CXCR 2M7SA 2DCLA 4EZ9A 2XG8A 1BQNB 3K7RA 3MR2A 1FF2A 1H38A 3G9CA 5LMUF 5KG1A 2JL9A 5KT7A 1XERA 1TKDA 1Y4ZB 2ROGA 3NNAA 3V2UC 3E2EA 3GFHA 3MR6A 1YIJS 4N5SA 4ECYA 1Y5NB 1AFJA 4MH8A 2IFXA 2R8HA 4E98A 1RT1A 1JLEB 1RAJA 4N8NA 2UUWA 3MCSA 1FXRA 1PC5A 3ENWA 4Y2AA 3BO3A 4C8KA 2UXDF 3DRRB 1RT2A 2DNMA 2VG5B 2DNHA 2J8AA 2ZDPA 2P9GA 4M8LA 2FY1A 4IR1A 3HVRA 2KM8B 2KDOA 3DOLB 3TNVA 3M8SA 1HMVB 3MHYA 4TY8B 3THPA 3IN5A 2Q1LA 4PXCA 2WSCC 3LP0B 3SCLE 1ZBTA 4WFZA 1VMBA 4DV7F 4CI0B 2LDYA 1RT7A 2RMLA 1Q82T 1WD6A 4I1TA 4XDDA 3AJ2A 3JYTB 4B02A 2DHSA 3C6TB 4PG5A 2ROPA 3ZZYA 3DM2B 3HJFA 3AHPA 1UEVA 4F26A 2EFQA 2GQQA 4DS5A 4EEYA 2YH1A 1S1TA 2YWEA 4HT7A 5F8IA 4FZVA 5EWEA 2JLGA 1T95A 1R0AA 1WWHA 3LAKA 1IR0A 3AB2B 2P6TA 1FDBA 3CDWA 2BVZA 3MPYA 2VFRA 5CH7B 1O51A 2ZITA 3ISND 3QGPA 2A10A 3IRXA 3ZZ0A 3QO9B 2IM2A 4O44B 1VRUA 4TN2A 4JI2F 5FDLA 3KMSA 1N34F 4DSIA 3GIKA 3V4IA 1RTJB 1S72S 3CCQS 2VPWB 3H4BA 4X2BA 4YOEA 3Q8SB 1FNMA 2HG4A 1FKPA 4NA3A 3ZZZA 4H4KC 4RNFA 4MAKA 4IQMA 1KHWA 2NPFA 2C2EA 4ED3A 5D77A 2UZAA 3EZ5A 2XBPA 2WOMB 4Q45A 1HL6A 1QUVA 4B9SA 4NLVA 2KN4A 4HVZA 1QY7A 3O44A 3S6EA 1Q81T 1OQ3A 3CT9A 5KT5A 1HI0P 2D9PA 2FVRA 3DLGA 4CTAB 4ECSA 3N4WA 3MR5A 2DH8A 2KH9A 4KTQA 2IHR1 5DGBA 3CDAA 3K5LA 3UDLA 5L9NA 4RU9A 1F9FA 5IM0B 3SSQA 4X4UA 5DO2A 3UW1A 2HHVA 3RB0A 5KFPA 4ILRA 2VPYB 4GKJF 1ZM9A 1TVRB 4URGA 3MFIA 4MFBA 1VC5A 4N77A 2PE8A 2YNGB 3SSSA 1X5TA 4CO2A 3MMAA 4LF9F 2J5AA 4J37A 3R5DA 3P3DA 2LVWA 3K57A 2CQGA 1S9FA 1UW4A 3FFIA 1FRHA 3TYTA 5C5JA 3VAFA 1FO1A 2D9OA 2HWTA 2W8KA 2HMIA 3HF5A 1U24A 4CNZA 4YQWA 2FDNA 2POKA 2VPZB 4P6QA 3G71S 1M5OC 4USIA 3GILA 3RZAA 1FXLA 3U02A 1ELOA 2RRAA 1B0VA 5IT0A 3T5KA 4P2SA 4WIIA 1YHQS 4Y2IA 2QLXA 1FE0A 1PGZA 4NCAA 2RQ4A 1VIOA 5HL7Q 2KRBA 5K8PA 1M5SA 1W2IA 5KT2A 4KR0B 2XLJA 2CRLA 2RUGA 2DH7A 1KLNA 4ZMMA 3ETOA 3R5CA 3CSKA 4LQ3A 4DR4F 3KFWX 2AYEA 3NAIA 5D4NA 1FRIA 3KG0A 4A48A 5AE2A 1Q4RA 3VWSA 3BSCA 2W9CB 2BR0A 1XN9A 1YQHA 5K14A 2DGSA 2EI5A 5KFXA 4NX9A 4EO8A 4LIWA 1VQ5S 1Y00A 5J1NA 1CQMA 5HN0A 3L95X 5GADI 2VODA 2QE5A 2ZZNA 4PG6A 4LFBF 3HZEA 1C2PA 1URRA 4KAIA 4LSLA 4G1IA 4FVMA 4F3MA 2BABA 3GIMA 4NXMF 3WBZA 3KG1A 2LXFA 4IOAQ 5IQQA 3V4MA 4D3HA 2KO1A 4LSNB 2VKRA 3DRSA 3MM5A 2AGPA 2EFPA 5J1PA 2PA3A 4FPRA 3KHRA 3M8QA 4KGMA 2HPUA 1QAYA 2GJ2A 4NXNF 1X5PA 2IC3B 1J5EF 3I0RB 2EG2A 1NJYA 2DO4A 4TU8A 1N88A 2G1DA 5CYMA 1DTQB 2F8EX 2V2KA 3H4DA 3NL0A 1JNZB 2PT0A 2CJQA 4HTJA 1DAXA 1GT8A 3OFHA 2Y1IA 1S0NA 2AGQA 1N5YA 5DDRC 2BM0A 2AP6A 3E01A 4OZ5A 3AA9A 1QVGR 1WF1A 2DR8A 1VQKS 4F2RA 4RX6A 4F02A 1HW8A 1Y0HA 1UVLA 1NK5A 3KHGA 1LWEB 4ICLB 1NAQA 2D3UA 4PG4A 4KE5A 1R8AA 1O8BA 2RRBA 3THVA 1HWKA 2VG7A 3R5AA 3SXLA 4QWAA 2D41A 3GR0A 1C1CA 1XNRF 4EBEA 5EN1A 4FN5A 5D3GA 3K59A 2R7QA 3TUJC 1VBZA 2ASDA 3N9UC 4OMFG 4A8OA 2V4JB 3IR5B 1P1LA 3SCKE 1CC7A 3LGNA 2ZH6A 3PV8A 2BA9A 1VLYA 2YX4A 4XAKA 3POTA 3MAHA 3PFEA 2RDJA 4KFBA 3KLHA 1RI7A 2FLNA 2KT3A 2NPIA 3VQSA 3BQ1A 1HFEL 1U2RA 2HLTA 2PMZD 4LIRA 2IA6A 1T8EA 1DJ0A 2MZRA 2DHXA 2HS3A 1C4AA 2DD8S 5F0UA 1FDAA 5KG3A 1SJ4P 3TA2A 4XPCA 3CJ5A 2ZH9A 1ZETA 4RLEA 3CCRS 4ALZA 3MXHP 2OJ3A 1RT1B 4DN0A 2FVCA 3QZ7A 5KOWA 4CH7A 1T05A 4DSEA 5GADU 1CPZA 1NHUA 1R8CA 1F60B 1RT2B 2B0GA 1RTIA 2CIMA 1NK6A 4IKAA 2LQBA 1FK9B 3TA1A 5D4OA 4DR5F 1RT4A 1D8YA 2MSSA 3U27A 2NS1B 4WXOA 1V3ZA 3NCRA 2MQNA 2ZJRQ 3X3UA 4CT9A 3PX0A 2HFZA 1WHVA 1NZAA 2B4PA 2YNHA 2M4MA 1RT7B 2QA4S 2W9BB 2RDIA 2UVUA 5BYSA 2WBMA 3M32A 4K50A 4DV4F 4DQPA 5B0GA 2AQ4A 1Q16B 1YRUA 2P9CA 5KFJA 1S6OA 4AL6A 5KT3A 3UFCX 1B7FA 2C2RA 4K4YA 1XWLA 1WI8A 1VQ7S 4DF4A 1IKXB 1WEXA 4OJHA 1R0AB 4XDCA 3GB0A 4PUOA 1ZAVA 4JV0A 1QE1A 2YNIB 2R7TA 3FQKA 4Q44A 2HNYA 2DITA 1OIAA 1S0MA 3IRXB 4OLOA 4XK8C 1M5KC 1JLFB 4RW4A 1L3VA 2C42A 2JX2A 2PGCA 3CJ4A 1U6ZA 2OD6A 1P8GA 4PXDA 2AV5A 3UCGA 1VRUB 5CCLA 5FDLB 5F41A 3HP6A 3BF4A 3H20A 4ILLA 2DCUB 1C1BA 1KFSA 4CO0A 5EWGA 1RTHA 1MMDA 2GW8A 2U1AA 3NCPA 1FKPB 2I0XA 1LK5A 3NKYA 5HI7A 2BQRA 3HXMA 1N5QA 1SH2A 2DISA 2XWXA 4X64F 1LV5A 2VOPA 2A18A 4ZVGA 1HW9A 5THWA 1S6PA 4F67A 1U26A 3G6XA 5G0RA 4CO3A 3TANA 3RB3A 1S6QB 2DIVA 4RBTA 5EHHA 5KFMA 3DLGB 2MY8A 1SUQB 3OBIA 5FJ4A 4X4QA 2VBXA 1T94A 1FE4A 1X4AA 2KFZA 2AYGA 2NXUA 2EWHA 2ZE2A 3GIIA 4LF7F 3H2UB 3NBPA 2YWFA 5A6WA 4NYZA 1F0XA 3EPGA 3H5UA 4ED7A 4DF8A 4B9LA 2VC1A 1VHFA 2P6SA 3US5A 4GO5X 4MFBB 4JI7F 1X5OA 2Y1RI 4ZCLA 4TKTA 3MMAB 3MUTP 4FNIA 4YB1P 1WEZA 2YX1A 4F4KA 4DLGA 3HX9A 5CZXA 2BQ3A 1NK8A 4C0HA 4LFCF 4YR3A 3PIPQ 2DNYA 5BYRA 3RRHA 1U25A 1IBKF 2APOA 4IG0A 3PNIA 4MKYA 3DFEA 1HYSB 4B3RF 4DL3A 5CYJA 1IKWA 2CPXA 2XMVA 7FD1A 1VOMA 1X4FA 2RIJA 3H2VE 2HQIA 5DLFA 2VB6A 3GFXA 4A8MP 1BQNA 3EPIA 3C6UB 2FHKA 2WB4A 4GKKF 3T3FA 3B82A 3NGDA 5KFIA 3OHAA 1SJ1A 3KLFB 4J9MA 3LP1A 4Q8FA 4OV1A 2GGPA 1JLQB 5E0OA 1ULRA 4DWIA 1Q86T 1NJXA 4L72B 2PA8D 1JLEA 4Y28C 4WU2A 3W2VB 4O3PA 3G6ES 3I6PA 3TRGA 4DQSA 1WI6A 4I64A 2XB2D 4R0JA 1SJ3P 5CQGA 5K14B 4Q0BA