3CEDA

Crystal structure of the c-terminal nil domain of an abc transporter protein homologue from staphylococcus aureus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
98
structure length
98
Chain Sequence
SNADDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSLSTAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGKFEKELIERQVKMEVLRHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Methionine import ATP-binding protein metN 2
publication title The structure of the C-terminal NIL domain of an ABC transporter protein homologue from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 24
structure length 98
sequence length 98
chains with identical sequence B, C
ec nomenclature ec 3.6.3.-:
pdb deposition date 2008-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09383 NIL NIL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cedA00
2H9ZA 4LUBA 4GMKA 3O1LA 3S1TA 4GO5X 3ENWA 3IBWA 2F1FA 3AB4B 1SC6A 3KWMA 2PC6A 4NMLA 1YBAA 3UW1A 3P96A 3MAHA 2RQMA 2QMXA 2FGCA 4M8LA 3IXQA 2I9SA 1ZPVA 2MDAA 3DHXA 2LQJA 5IT0A 3CEDA 2J0WA 2JOQA 5JJBA 2J0XA 2QSWA 4GO7X 3W7BA 2JHEA 1LK5A 3N0VA 3OFHA 2LVWA 3U7JA 3L7OA 2P9CA 3DDNA 1PSDA 1KS2A 2QRRA 4X84A 2P9EA 2QMWA 3ENQA 3OFGA 2PA3A 4PWUA 3AAWB 3HHEA 1UJ6A 1RWUA 3AB2B 5IT4A 1M0SA 2CDQA 2RQKA 1LK7A 3LOUA 2DT9A 3OBIA 3NRBA 2F8MA 3MTJA 3ENVA 3OFEA 1O8BA 2KO1A 1XTZA 1Y7PA 2DTJA 3OFFA 5FIIA 3DC2A 5IS2A 2P9GA 3LUYA 1U8SA 4IO1A 2NYIA 1UJ4A 5T41A 1YGYA 1UJ5A 3TUJC 3DHWC 3MWBA 3TUZC 3TUIC 3K5PA 2ZHOA 1LKZA 2RE1A
chains in the Genus database with same CATH superfamily
1SCJB 4OZ2A 3RRGA 3MMCA 3HM9A 3Q2SC 1F0XA 5M2PA 4DL7A 3AT1B 4M1KA 3BGFA 3TX0A 1FVQA 3TARA 3AD7C 2CNNB 2UXCJ 2N7YA 2D1CA 2WVCA 4K5SA 1L3TA 3ZO7A 1N32F 1F9HA 4QYZJ 2XSJA 4DL0C 3QBCA 3P49B 1B70B 4LRBA 1XMOF 4LVNP 2V8DA 1GMWA 2M3DA 2OPSB 2MZJA 4ED1A 3MHYA 2Q3PA 3M8PA 3UR0A 3MTKA 4O3NA 4N7TA 3QYYA 4TKTA 1NK9A 3PFOA 1JIHA 2ZHAA 3Q23A 3GYXB 2QL9B 4TLRA 3TANA 4WFZA 1N5YA 4Q44A 2VG5A 3H2VE 1SJRA 3A4TA 4USVA 5DM7Q 4HACB 1NHKL 3RB6A 2RDIA 2MHNA 3KJFB 1AYEA 3QT7A 3GTYX 1U0SA 1CG2A 4I6YA 3FCVA 3MAAB 1IKXB 4B3MJ 4I7FA 4UUXA 4ZDNA 1S99A 2D41A 4LUBA 1J5OB 3DRSA 4LT6A 1AFIA 4TNOA 5L1KA 4C4WA 3TEHB 2HAIA 2R2RA 1RCXB 3W66A 3UN2A 3IWLA 3CDWA 2XM3A 1MWYA 1GMVA 3TAMA 1RHMB 5D0EA 1GX5A 4DR4J 4IG3B 3NGDA 3GZ7A 2UVUA 1SQGA 4MTPA 4ZVQB 2OPQB 1RLDA 3C14B 3OJUA 1HBMB 3PO5A 4BS2A 5KT3A 2LA4A 3IBCB 1I3OB 4EBCA 2UXDJ 2B9WA 1S9GB 5FIIA 4UTGA 1TKTA 4PYDA 3I0RA 2MGZA 2MB0B 1BQNB 2UXBF 1HI1A 2CZ9A 1UAWA 4RLEA 2FLLA 2AQ4A 1T7PA 2ZVIA 5H9FJ 3MM6B 1V9OA 4DR7J 2ZH6A 3R5GA 4DUZF 5F8MA 2V2VA 4USTA 4YHHJ 1TV6B 3LANA 4HHHA 3T5JA 2K3IA 4NLVA 1Z4UA 2J8AA 4UY85 1V5VA 4ZLPA 3GFHA 4UOGA 5DDQC 4LF7F 4ETXA 4WF9Q 4EBDA 4MMOA 2XMJA 1VLYA 2EI5A 4RW6A 3QGIA 4EUVA 2ZBPA 1JX4A 4N8OA 4A46A 5L8RC 2D3ZA 5ETLA 1Q8IA 5D0RA 5EWEA 2B9XA 3CNQP 2P5VA 1Q5VA 2XHWA 3NCPA 5T7LB 5B08A 4GKKJ 2UUCF 2BEFA 2W9BB 2FD2A 2HFSA 2NS1B 2VQEJ 2AHOB 3O3LA 4K4UA 1JB0C 2NXEA 3MPDA 1KLNA 1HQUA 4P72A 3CC4S 1JKHB 3K5PA 1LW2B 3QT5A 1IBLF 3AOBA 4ZP7A 2Z57B 3DRYA 4ID5B 3JSRA 4DX5A 4OLOA 2RKIA 3KJNB 2C2EA 2M0GB 2KL8A 2OELA 3KKFA 2GAHC 4QIEA 2DY1A 1HWUA 4LR9A 2GCFA 4LMZA 4TY9A 1QVGR 2F7VA 3DLEB 2VBZA 3SCLE 2C1EB 4H54A 4O4GA 3AQPA 4XDDA 3IBFB 4F2SA 2XQCA 2YKQA 3OQ2A 2FIUA 1CJKA 2ROEA 2FPHX 3C66A 2Z56B 3FQKA 1TMJA 2QLFB 5A8KB 3JSBA 5DG7A 3M1VA 3KFWX 1WI6A 4ZK7M 4ETZA 2HIQA 5ETNA 3M8SA 5CA5A 2XLKA 3T6JA 1PCAA 1VK8A 1FWKA 4MKVA 5AE2A 3EPIA 4K7QA 3SCJE 2I6WA 1SKSA 4NX9A 2IC3A 1WI8A 2G2ZA 1BWVA 3KLVA 5AE3A 3G82B 1HNZJ 4B3OA 5DS7A 4J9PA 3BDPA 2H5JB 2VPWB 1ZPVA 1BQMA 3CEDA 3TVKA 2XMAA 2VL1A 3PW2A 2G4BA 3TW0A 4A47A 1P9YA 1RT3B 2DHAA 1OMSA 3BGLA 1EZZB 1TK5A 1LWFB 4CLLA 4DFMA 5HI7A 4MIWA 4DQSA 4DR2J 4C0OC 3NNAA 3GIRA 3SQOP 5CAAA 3NY0A 4C3MA 3MEEB 5FLXU 3NG8A 2VZ9A 5KFCA 2DR7A 4KGKA 1Z2LA 3DLKB 1VRUA 2KT3A 2H54B 4L3KA 4V19J 3KHLA 4C2MA 1AXQA 3KLEA 3A3PB 2V34A 2KU7A 1JLQA 4ED5A 1Q79A 2HQGA 4F4WA 1IUJA 4HYKA 3EGWB 5K8NA 5I42B 1RKIA 1KC8T 3G8SA 2GGPB 2XO7A 2EPIA 1JLCB 1A6LA 3S8SA 2C2RA 4ECYA 2RQMA 1SQEA 4C8YA 2WOMA 1X4GA 4OI2A 1CJTA 3I82A 3CD5A 3KLGB 3ICLA 2IM3A 2FZKB 1SXLA 3MR2A 1NPKA 4RPFA 3T1YF 5A0YB 2X3DA 5KFZA 4UQGA 1UVLA 1EKSA 1S6QA 4Z2XA 2N3LA 1UTAA 2RSQA 2PMWA 3CJ3A 1FRHA 2YPYA 3OR2A 4ZVHA 5KFVA 4K0KF 2KM8B 4J9NA 2GQCA 1KQSR 2IBOA 2FJBB 4LRFA 4IOAQ 3GFZA 1TL7A 2DO4A 1I6JA 4C3KA 1U2FA 4J9LA 3BKUA 3IWNC 1HBUA 3R8YA 3TA1A 3MWBA 2D69A 5K20B 2PE8A 3IM8A 2CQDA 2DGWA 4CRJA 2HHUA 2R7XA 4DSJA 3IR5B 1T05B 2OJ3A 1TL3B 4NXMF 4KB7A 2FVCA 2CPJA 4IRCA 2MJUA 3FQLA 1NDLA 5J2PA 3DRPB 1U02A 2NPFA 2JEIA 2RNEA 4J9MA 1QTMA 4BWJA 4I2QB 5JVGQ 3QNWB 1U0HA 4NEYA 2MJNA 2ZBIA 3VZHA 4QOTA 3DDIA 2ATCB 3RW6A 3SZ2A 2JEFA 3PW5A 1R8AA 1HD0A 2VD3A 3EMTA 2W7PA 2BQRA 4PPDA 3BSNA 3TVZA 3W5ZA 1NKCA 2AMCB 4BDPA 5G4DA 3CMQA 4F25A 3M9NB 4RJVA 4ILMA 3TUZC 1IKWB 1XMQF 3JAMU 4KR0B 1QAXA 4Z7CA 1S6UA 2EK1A 3CO9A 3E8OA 4NCAA 1N4LA 4GKJF 3W2VB 3NL0A 3H4DA 3JQMA 4LBPA 2HHWA 3CJQA 1YTYA 4HI2A 5HMYA 2UV8G 2VFRA 1P6TA 5GMEA 1EETA 2HRUA 3J80Y 5DRKA 4ELVA 3ZXWA 2V69A 3HPOA 5LT5A 4NLUA 1AFJA 4LRAA 6FDRA 3UN5A 2J5AA 4RUAA 2B9YA 2R2SA 1SJ1A 2APOA 1QSLA 3BGOP 2EXUA 3W5XA 4DLEA 4IO9Q 4JI0J 4CDIA 5KG6A 3KLFA 3R5CA 2A3JA 1SI9A 2EBGA 2ZZTA 7FD1A 2V2QA 4NLPA 3IRXA 3GG0A 1PAEX 2K3KA 3Q86A 4ZN3A 4OHXA 2LQ5A 1C4CA 4IFVA 1UEKA 4WCEQ 1VC6A 4CQ1A 3UQSA 1NJZA 3EVWA 2ZHOA 4L74A 3RJMB 2Z2LA 3N9UC 1EKRA 3AY0A 3NCRA 2RVJA 3K2YA 4FNIA 1KSPA 2JSXA 3OT9A 3JTPA 2XS7A 4RNOA 2E1PA 2Q43A 3KHGA 2XC9A 3S7RA 2ZVSA 4CO5A 4NLYA 2WZ1A 2YKMB 5KFHA 2RMLA 2DK2A 2D9OA 5BXIA 3UD4P 4EI2A 2IIHA 1YJ9S 4EYIB 2HBYB 1SV5B 2EC2A 2HBRB 3VGSA 3D3BJ 1WDDA 2CA9A 3K5OA 5H9FK 4B9TA 2MZ1A 3HZEA 2DR6A 1FNOA 4HKQA 1RTHB 4RW4A 1FXRA 2B4PA 3DC2A 1SJFA 1HHTP 2NYIA 1DHMA 2YWGA 3HD2A 4USIA 3I55S 2W24A 5GADI 3CXCR 5F8HA 3KTQA 3EE3A 4ES1A 2BX6A 3TZWA 2RE1A 3S1TA 4ICLA 1FFWB 4HT7A 4X4VA 1YBAA 3TEGA 4DV1J 3ZTSA 4OHZA 1Y5LB 1JLEB 1ELOA 2LYVA 4KE5A 2JLFA 3BQ0A 5K9FA 3HX9A 1FWLA 3MFHA 2XHCA 2V8PA 4ZIWA 4EZ6A 5KFPA 2QTWA 4D3GA 1NJWA 2B5JA 3OVSA 5I3PA 4A8FA 5GADU 3BQ1A 3FZBA 3V2UC 1ZOTA 2QYGA 4ZJOA 2ZH7A 4IQMA 3CCQS 1FD8A 2LU2A 4DDFA 2VPZB 2VKRA 3GLJA 5CD4A 2NYHA 1RE1B 2F8EX 5DZ7A 4B9SA 3N6LA 5KFAA 1NCLA 1JJ2R 1HNIA 1MN9A 2GHPA 1F3FA 1RTDA 4PG8A 2D3O1 3CCMS 3DYAB 6FD1A 2FLOA 1HR0J 3FMBA 3GQCA 1S79A 1WF1A 2Q6CA 2VICA 2XTJP 1D9FA 2HHHF 1TUWA 1FKOA 4M94A 2JZ5A 1GK8A 2LFVA 2R7QA 2IFXA 1S0MA 1VBKA 4WZMA 2XI2A 4G1QB 2FHMA 4JI1J 2NSCA 3OVAA 1FFGB 2WTFA 4CT8A 2G9OA 4Y34A 4DF8A 4LF5F 1VRTB 2E5HA 4EK2A 4O3PA 3VGVA 3ZZTA 4NLQA 4DS5A 4RZRA 1FJGJ 1X4CA 3Q8RB 3HJVA 2O01C 2OPPB 2CWKA 2ZHBA 4I1TA 3GCWP 5A8RA 3V81B 2X1GA 4B17A 1AZSA 1YX2A 5T41A 3NWRA 1CULB 3R1HA 1TQLA 4EEYA 3UD3P 1MSWD 1SC1B 5HMXA 4ZVUB 2DR5A 2Q6BA 2FTRA 2V4JB 3TJ8A 4KC5A 2DGSA 4A8QA 5GMDA 3BKTA 3MMAA 1YRTA 2VA2A 3OTDA 2Y9HA 2AW0A 4TU7A 2MLZA 4YP3A 2GMLA 3V5RA 1T9WA 5HBMA 1YJTA 3C16B 3RAQA 3CDUA 2GS8A 4WU2A 1QD1A 3G6XA 3POTB 4P6QA 4B08A 2CJAA 3FBCA 4DL3A 2HNYA 1ZTTA 2OAUA 1SBRA 1RAGB 2RAQA 2YKNB 1XIQA 1RACB 5E3CA 3W9JA 3SDEA 3I9V9 1RAJA 4OYPA 4DUTA 2RQ4A 4FYWB 2X1AA 4WBFA 1B0PA 2GW8A 2EFVA 3KK3A 1M0SA 4A48A 2FZCB 8RUCA 1U49A 4WFAQ 4WK1A 3H5YA 3OVBA 4C8ZA 3DXBA 2K8GA 4R8UB 4DPWA 2ILYA 3R2DJ 3R6LB 3K58A 4CCHA 1S57A 4C98A 2UVWA 2YVSA 1HI8A 2IRUA 3BN4A 4OJHA 4RBTA 2HVZA 3Q8UA 3CD7A 2W9AA 4LJMA 1GH8A 4R0JA 2YKOA 3P6YC 3GJRB 5KG2A 2AV5A 2FVRA 2BJ7A 3CJ5A 5HL7Q 3DOMB 3RU0A 3KLHB 4NYPA 1OSDA 5LL6d 2VG7B 1NXIA 1R3NA 3RTVA 4TY8A 2RU9A 4CLTA 1CQMA 4M5JA 2RT3A 4TN2A 4N77A 2ZDOA 4X4UA 5FD1A 3DOKB 5B0EA 2ZH9A 2FJDB 4Q0BA 1MROB 3D5MA 1RWOB 3TP2A 4BBYA 3B8HA 5B0CA 1Y4ZB 3BM7A 1SKRA 4CM0A 2AYMA 4OHYA 3FEXB 3HHLA 5ETOA 1AUDA 3B4DA 3QPIA 4JI2J 1VI7A 2YH0A 1NSPA 1WC6A 7AT1B 1ZZNA 4DUYJ 1HMVB 1S6PB 2CJQA 3UWTA 3QLHB 4RKUC 1L3VA 2WONA 3J7AN 5HQ8A 2CPFA 2KZZA 3T1HJ 3SBMA 4DG1B 1ZAVA 4WYWA 1MMDA 2H9ZA 1ZA2B 1Q86T 2LEAA 5DO2A 3OTEA 1RAHB 4X64J 4Z7YA 1KTVA 1LXNA 4GVBB 3JTOA 2MLYA 2V9KA 1CJUB 2HSEB 3DHXA 3NOGA 3DRXA 3GR1A 4ID8A 4WFYA 3C15B 2ZWOA 1HBOA 2XO6A 3HHDA 3M30B 5IC6B 2X1BA 1KS2A 2C2DA 2QMWA 3OFGA 2FVQA 1SPBP 4RWXA 3MECA 5J2NA 4B3TF 3GONA 4ZCMA 2CQBA 4KHMA 4OQJA 5LJ3Y 1IBMJ 3Q8YA 1BGXT 2JWNA 3F73A 1RT5A 4NA2A 5HATA 2OSRA 4DPTA 4MJKA 1S1XA 2QA1A 1M1GA 3TNVA 1GMUA 3ENAA 2QG9B 4B3RF 4J9RA 4YOEA 2XCPA 1VC5A 2K7KA 3CMAS 2QMUB 1TU0B 2VDIA 2BM1A 3ENWA 1SL1A 1KLMB 1WJ9A 3FFIA 4CO4A 3SCKE 3C6UA 3HZGA 4NE9C 4CO1A 2ZJPQ 2LEPA 2FHKA 4N76A 4DMZA 4HH1A 1CSJA 3VGTA 1HBNB 3FEZA 5A2QY 3NP5A 4P7VA 2B6AB 2ZZMA 3JSMB 3ETMA 1FK9A 2FY8A 2CWXA 4FF1A 4ANDA 5B0FA 2DIVA 2W4CA 4DJBA 1TL1A 3CB4A 2WW8A 5A6WA 1XMBA 1G7CB 1W25A 1ZAWA 1AUSL 2KFNA 4OZLA 2C2MB 3NAHA 3AH6A 2IA0A 3HT3A 3PM9A 3MFIA 5J2QA 5HJYA 1HNWF 3CCTA 1X5TA 3DI6B 5F3TA 1FE0A 5C24B 3BEGB 3THVA 2ASDA 4I67A 1UMJA 4F3QA 4ECWA 2PSZA 3ILJA 5KFEA 1FKPB 1ZA1B 1X8DA 1SQFA 4EWTA 3W8PA 2ADCA 3QQCD 3MAHA 3NGTA 4EBEA 1WC4A 1WSVA 4RW8B 2ZH2A 3OXLA 3QIPB 4FYYB 2OPRA 4IRKA 3NGSA 2IM2A 2DISA 3GIIA 1UL3A 2BE7D 3M2RB 5HP1B 3M8YA 2CVIA 5ETTA 2XGPA 1VBZA 2R2TA 3WIUA 2IVYA 4HACA 1SL2A 1FESA 3FUYA 4I56A 5MLCV 3IA0A 2Z30B 1JLFB 2H5IB 1T02A 2M8DB 1Q8BA 2BANB 2BA9A 1Y7PA 3IN5A 2UUAF 5BYSA 3V6DA 3HVTA 2CUYA 4KFBA 2HW3A 3H5SA 1RHRB 4LSNA 2OEKA 5KFUA 5F8GA 4EO6A 2YNIB 3VAIA 1BLUA 1JMTA 4C7QA 3M6VA 4PKDB 1ZM3A 4DOZA 3I4HX 5HVGA 4DV4F 3CCZA 3D68A 3MUMP 4P73A 1RT2B 3DMJB 4O3SA 2LP4A 1B0TA 3PNIA 4NLSA 1VIOA 2DH8A 1NRKA 2V8HA 4IDKA 4URGA 2DNQA 2BACA 2IJRA 1RWKB 1BQNA 1CQNA 3W2WB 2G2OA 3N5BA 4Y2MA 4YDXA 2DY9A 3ISNC 1KD1T 4GVLA 1D09B 5KFNA 2MKCA 2HS0A 5JUMA 4MH8A 4NLWA 2NXUA 5IC4B 2AU0A 4ZIVA 2CQ4A 4W90B 1TV6A 1R0AB 2QLJB 2PI5A 4IRDA 4M5IA 1TL4A 2I5JB 4DL2A 4X65J 1JLBB 3TYTA 1D0EA 3BH6B 3HKZD 2FGOA 3MM8B 3O1LA 5J1EB 1B3TA 2ATLA 4O3QA 1KP6A 2E1AA 3NAIA 1NNDA 1UPMB 3DOLA 1U6FA 1VCTA 2BDPA 4CLPA 2WHOA 3H90A 2V0NA 2RRNA 4LFAJ 3LGHA 2RF2B 2UUBF 4AYBD 4MFBB 3MCNA 4BLGA 2W9BA 1UETA 2ERRA 1UWAA 2ZM6J 3K7RA 1DY3A 2CJBA 3ITHB 3T3FA 3OHBA 2CQ1A 2DH9A 2B4OA 2IAJA 3R5JB 1HWIA 5ETVA 3W65A 4FKXA 1WWHA 4QPTA 4UZCA 1MNEA 3L7UA 1HWKA 4MK8A 3CF5Q 2EFNA 2XYGB 4ZVOB 2DRBA 2R8KA 3ISZA 2W1BA 1UVJA 2FVPA 2VU5A 1VQSA 4KV8A 3PACA 1IKYB 4CTAB 2HHQA 3VZIA 2KG0A 4KO0B 4HL9A 3IBWA 3MOJB 1LNQA 2CADA 3DLEA 1RBLA 2F8HA 2AZ3A 4OLPA 4QU7A 3H42A 1RU1A 1YSJA 3NS7B 5D4NA 2MQ8A 3M7VA 3H20A 2O5DA 2NPIA 2JVOA 5KFKA 2D3UA 3EXYA 1H7WA 3I0SB 4WIIA 3W7BA 3OFHA 2XNQA 2J7UA 2KZMA 2A18A 3F41A 4NA1A 1HARA 2OO4A 1RA7A 1SJQA 3IMQJ 3W9HA 4TYAA 1K1SA 2DYAA 4I2PB 2GIRA 1XMOJ 1LK7A 4IR1A 2NCKL 1VFJA 1Y9OA 2KO1A 2BE9B 3EXCX 5H9EJ 3CJ8A 3LUYA 4DQQA 2P2CB 1XWLA 4WXOA 2W7OA 4LIRA 1K9MT 2HWIA 4YDDB 1XK8A 1LXJA 1UCNA 2DNRA 4CM2A 3TA2A 4TU8A 1VS3A 2X7IA 2Q1LA 4CLYA 4UUWA 3W5YA 3DRRA 1MN7A 4B3SJ 4KBIA 1UWBA 3DLGB 2YWEA 1NO8A 3G6VA 2XGQA 2PO4A 2OUGA 1R0BG 1PJ6A 2QSWA 3I6PA 1RADB 1NK5A 3PJWA 1DJ0A 3Q8SB 3QWPA 1RT1B 3G6YA 1PSDA 2XWYA 2KHDA 4K4WA 2GQQA 3IG1B 2B7BB 1PO6A 2LEBA 2RDDA 4KYZA 2H4YB 2JLGA 1LW0B 1WHWA 3D9BA 3LF0A 4PABA 1XEZA 2E7XA 2KYXA 1IXKA 2PEBA 3AD8C 2R7WA 3NNCA 5D15A 3PEHA 3SFGA 1U8SA 1JLCA 4J90A 3A12A 4DU7A 1UVNA 2HZVA 3M32A 4I4BA 2Z0GA 2E7WA 3J7A1 4ZP8A 1BD6A 3TX8A 3DGPA 1VBXA 3HVAA 3GE9A 1LWCB 4B3MF 2V8GA 2DEJA 3KLGA 2DNPA 2JH3A 4NLTA 2UVVA 2CNKB 2YY3A 4NZ0A 2MQNA 2QT7A 2L9NA 1SB6A 4AL7A 2VPXB 2O67A 3ET6B 3D1QA 1S4EA 2BJEA 3GYNA 5KFGA 1AA1B 2C3UA 1YJVA 1RTIB 3Q8PB 3UNGC 1I5OB 1NH8A 1HNVB 2ZUGA 1SUQA 4JUZA 3UCZP 3OUYB 1N0UA 2OH2A 3TQ1A 5C5JA 3I96A 4TQSA 1NBEB 3LP0A 3RB3A 4F50A 3BJYA 3QAEA 5A6PA 4JI5F 5CYQB 3LOUA 1S0VA 1JQGA 4NRTA 1TP7A 2F40A 4K4ZA 5IQ6A 1OSCA 2QGFB 2UXDF 2ZD1A 1B4SA 3PCOB 1Q7YT 3ZZ0A 4KH1B 4ZPVR 3TVYA 5B7WA 1Q16B 4ZVPB 2FY1A 2DXDA 2KFZA 3IM9A 4HTJA 4UOCA 2AIRB 1T03B 2VB6A 1ZM4A 1SC3B 1E6VA 2FVSA 3PV8A 4YHHF 4LF4F 3H5XA 3EVMA 4N56A 4KTQA 2HBQB 4I2QA 2HVIA 2YNFA 1KWMA 5KFOA 2Y8YA 1EB0A 3CULA 5KG5A 1J2VA 4FZVA 1IBLJ 1XERA 2LDIA 4O0NA 1R43A 1DARA 3FK4A 4RU9A 3PY8A 5EUHA 3MPVA 4RX6A 3OR1B 5DG8A 4F3MA 2CQ3A 2MSSA 3OTBA 5J1PA 5E41A 1UA0A 2J0SD 2DHGA 4WP3A 3RRHA 4RW7B 4DZDA 2QRRA 2P9EA 2OI2A 2DBBA 1VISA 2HQDA 3HFZB 4ILRA 2KHCA 4I0WA 2DCUB 3OTCA 4WFXA 2PIIA 2NXCA 4RU2A 4JOUA 3OD2A 2EKNA 2IVFB 4QWAA 5K8MA 3M8QB 4QYRA 3PZPA 1XTZA 4DV7J 4X4NA 4AL5A 4GKKF 2XMTA 1E6YB 1UJ4A 4MKAA 1GFWB 1FJEB 3MM5A 2CZVC 2VQEF 4J9OA 4YFUA 2V68A 2CIMA 5IOLA 2H65B 5GAEI 2KN4A 3VVUA 1I94F 1IVZA 1QM9A 6AT1B 2XYPB 1K44A 1S12A 1TKXB 1FNMA 4L6V3 3CCRS 1S1TB 4DQIA 2HIYA 1QVFR 3IS9B 1IBKF 1JLAA 2WB4A 3ZZZA 5KFYA 3G96A 3EJMA 1NLKL 3HDSA 3HVWA 1OJ4A 1TUGB 4OZNA 3CJKA 1UVKA 1CJVB 2DNHA 1PYOB 3I56S 1H98A 4OX7A 2O3DA 1NSAA 2ZNYA 2YBVA 2J9DE 1U2CA 3JXOA 2NR0A 4M5DA 2OLWA 3MMCB 4LF6J 2ZH4A 2B4VA 3MM9A 4ZKAA 1B99A 4F67A 3VCDA 1KRPA 1OO0B 3BV8A 1WF2A 3DGVA 1S0OA 4ZVEA 3VQSA 2FLPA 4MKYA 4KT0C 3FGVA 3WC0A 2IMOA 1VQNS 3E2EA 4P7TA 3HD1A 5LSLA 4K50A 2HQIA 1XN9A 4QWEA 3A13A 1G6BA 4PZVA 2HFOA 1NKEA 4ZOSA 1HNZF 2AYBA 2AYEA 3LH2S 1YRXA 4JYAJ 3UR3C 2RS2A 1N5YB 2VG5B 2Z4PA 2R8GA 1RSCA 1IR2A 3FSIA 4S0MA 3G9CA 3PW4A 2Y8WA 3FBFA 1OPIA 5D77A 3THTA 4DR2F 3QIDA 4I68A 4OYIA 2OMOA 1I51B 3DRSB 3DDKA 4PPZA 1MU2A 4F02A 4LSLA 1YWXA 4U95A 2IMWP 2VONA 3AQOA 3CJ2A 3G8TA 4M5NA 2C2NA 3LWLA 5FLXY 3TAMB 5KOWA 2EEYA 2MXYA 2NUUG 4K0KJ 3LALA 2WRMA 1MMLA 1GAOA 4WFBQ 1JLEA 3D4JA 5KT4A 3VV2B 1HFEL 2ALZA 4ZPWR 4ATNA 3KK1B 3ILLA 1UFLA 4JB8B 5C42A 1FX2A 5CXTA 2RHSB 4YY3J 4M8LA 1M5HA 2E5IA 1TK0A 3K89A 1WC3A 1RGVA 4HT5A 4O44A 4CLFA 5IT0A 2E5LF 3I0RB 2J0WA 1FEEA 2QIFA 3N79A 3VAHA 1FRXA 4NXMJ 3T19A 2HHVA 2KJWA 5C25A 4CNYA 2DNKA 2V94A 3LTOA 5F8IA 3RBDA 3DYAA 1JJ4A 2CJKA 1KHVA 5D4PA 3KLIA 1T9YA 3KOAA 5CH7B 4Y00A 2J6SA 2UVRA 3LW5C 5L1LA 4FYDA 5LXRA 4ECRA 1RQ0A 4JV2A 3EPGA 4U7UK 4QR0A 4J9KA 1TKDA 1URNA 3ZTOA 4G1QA 3FNNA 3DLHA 4O0IA 3CCVS 3EGVA 4H4MA 3KUHA 4W4MA 2P6SA 1S4FA 4RW6B 5CQGA 2GA7A 5HQMA 2BZ2A 1VRTA 3QSYB 2L9WA 5E33A 1D8ZA 1ZH5A 2YWWA 3K0JA 1XMQJ 1T3OA 1IM6A 1RLCL 1HYSA 1QSYA 3GB0A 5L38A 4R25A 4LF8J 2BVZA 3ZFVA 4RWWA 2E7VA 3D0HE 4Q2MA 5F41A 2EG2A 3FDSA 5GMKa 1S1UB 3QGPA 4CNZA 2UU9J 5IM0B 1WHXA 3UDVA 4LBIA 4FYXB 1HQUB 9ATCB 3N5FA 1YJWS 4AT1B 1TAUA 3G86A 4PQUA 2LQ8A 3TUPA 2KTQA 1URRA 2K7JA 2NSBA 2RKIB 2BKNA 2QZ8A 1O0PA 1WC0A 5L46A 4FS2A 5IS2A 3HHLD 4G65A 1YQHA 1TFWA 2G1DA 1WNEA 2BMBA 4QW9A 4NCBA 2VKZG 2X1FA 3M8RA 4WWSA 3QT6A 3DLLQ 3BR8A 2QEXS 1ICEB 1VBYA 5DLGA 3SEOA 1S59A 4O4GB 3GP9A 2N4CA 2YKNA 1DTTA 2Y1JA 5KTQA 2GVZA 4ECZA 1CJKB 5AE1A 3JAMY 3FBBA 4NWBA 2ZOMA 3NS6A 3R5DA 5KFTA 2C3OA 1S1VB 4HHJA 3PJ9A 3KJVB 1D9DA 1SH3A 4ZLLA 1NPPA 1RP5A 2MZTA 1RISA 2NLWA 3NGUA 1QAJA 4LFBF 2IC3B 2QLWA 1RXOB 3GPAA 1L5UA 4JI0F 2RQKA 2DT9A 2EW9A 5AXKA 4ZHRA 4NRUA 2KI2A 1L3SA 4B3OB 4Q8FA 4FXVA 1P9QC 5F0UA 2ILZA 5HANA 2CPXA 3JYTB 4ZMMA 3MI7X 5K8PA 2HK3A 2LECA 2NZCA 3T1AA 1FDDA 2AGQA 4K5RA 4WTOB 4HI1A 5D0GA 5FDLA 1P1LA 3M2UB 3OSPA 1RT6A 2FHJD 5HROA 2FLNA 1TAQA 4LRDA 3ADAC 3DOKA 1R7IA 1SKWA 4OJGA 4GC6A 1N88A 1MROA 1RAFB 2CPYA 3P5TL 1Q0NA 1BMQB 5KOXA 1TMMA 1VRUB 4LIWA 1X0FA 1FCAA 3J81U 3KLEB 1NZAA 3H4BA 4EO8A 1JLQB 4NLRA 2XLIA 3TR5A 2IJFA 1YIJS 1HQ2A 4JV1A 1WACA 1UEUA 2C3MA 3QLHA 3A8EA 4PWDA 1IQZA 4DCJB 4DG1A 4ELTA 5I3QA 1WG1A 4J91A 3OFFA 2AF6A 1REVB 1T3NA 2HHTA 1S7IA 2XMKA 2WOMB 2HMIA 1CJTB 5E2QA 1CJUA 3EZUA 4DR1F 1K0VA 1TVRA 3DCAA 3L95X 4CLZA 2AJ2A 3QFWA 4FP9A 2J7WA 2J0QD 1J27A 1S6QB 5I3UA 2KT5A 5AT1B 2DH7A 3OV7A 3OR2B 5CCMA 2FGCA 4DV1F 4H4KC 2MDAA 1X9MA 4U7CA 2M5YA 1NHUA 1RT4A 3QJJA 4WP8A 5KT6A 1HBUB 1WG4A 4G1PA 1NDPA 3UNYA 1VQ9S 4USUA 3LPYA 4LF5J 4DXLA 3F0NA 3CT9A 4I69A 2HHPA 1BHNA 2B43A 4CP5A 4DQRA 4AFFA 2QLXA 1KQGB 1QJHA 1Q7LB 2VQFJ 5J2PB 3GMGA 3HULA 4FXDA 1FWPA 2C2ZB 1UVIA 1FVSA 4X2BA 1RTJA 1U0HB 2BM0A 4R5PA 1RWMB 1YLXA 3PYFA 2BE2A 4F4KA 5HVHA 4ANCA 2F9JA 3PRBA 3RBEA 2LDYA 1N56A 4JI1F 4HEA9 2H51B 1YDLA 3CCWA 4NI2A 2HHXA 1R0CB 4NLXA 2XS5A 4F0HA 2PFDA 1M5VC 2ZH8A 3LAKA 3MUTP 3NKYA 3T9ZA 1WEXA 4X84A 1RUSA 4P2XA 2B0GA 1UW9A 3FC9A 5K14B 2F4VF 3LWMA 2J9DA 4USHA 5ETSA 3OTOF 3M05A 1F9EB 4A8OA 2DVIA 5C24A 2JC0A 4ZPAA 4N41A 1FNXH 3ONQA 2BOAA 2ZNZA 3M6WA 2YTCA 3KDNA 3SYZA 4OI6A 3QFHA 2C28A 5HMWA 1EETB 2ASYA 2OP5A 1R8HA 3MMJA 4PWWA 1WC1A 3GCXP 3UO0A 3ZTQA 2VG6A 3ZTRA 2XZTB 5HP1A 1QLNA 1S7HA 2N3OA 1S9EA 2GJIA 4GC7A 2W4PA 3T9NA 3KLFB 1VQ5S 4QR1A 2XSFA 1MWQA 1FDNA 1VLOA 3KHHA 2OIHA 2XULA 4RBUA 3F44A 3IAM9 3NLCA 3BGRA 3MURP 2MQMA 1WUUA 2EFGA 1HL6A 4CT9A 2HNZB 4OX9F 4PG7A 3CVKA 5DZ6A 3QSIA 3CSKA 5KG1A 2YNIA 4P74A 4ZPTR 5D6GA 5EGYA 5DQGA 4DLGA 5JMNA 3OHAA 1WHYA 3MTJA 2HVDA 4OJ1A 2PFFB 1DTQA 3PX0A 3AA8A 4UZBA 1RT2A 2PMHA 2K1RA 1WELA 3RR7A 4FF2A 1FO1A 4FNHA 4CI0B 1NDCA 1D3WA 4LBHA 5GVQA 1RYRA 2PA8D 1N5SA 2EFPA 4YQWA 1UFWA 3K5LA 3M6XA 3D54A 4NMLA 5IXUA 2AD9A 3CTRA 2VOPA 1H2UX 3VF0B 2YKPA 2B7CB 4FVMA 3I31A 3PKMA 2V67A 4RW4B 2AX1A 3IFEA 1KFDA 3RB0A 5DDRC 4NASA 4L3NA 4USJC 1Z2ZA 4AQYF 2XY7A 1DLOA 1X4DA 2JFKA 2OTJS 1DZ5A 1RCOB 4DR5F 1HHQA 1MMNA 3GJQB 3TJ9A 4H4KA 5KG3A 3LQVA 4OI1A 3R7NB 1YJ7A 5M2UA 3V4IA 4H4OA 4MIAA 4C3LA 1SJ4P 2G13A 4FYVB 1EAYC 2RD5C 1BQXA 3SSSA 3NS5A 2I2YA 2JC1A 5A8WA 5MAOA 3HK2A 1VR6A 3OFEA 1CS4A 3KG4A 3AOAA 2P9GA 1NM2A 5J1EA 2E44A 3TAQA 3CE8A 1JXVA 3EM1A 4JI2F 4O3OA 4B3TJ 1YGYA 3J7ZT 4O3RA 1AB8A 4KKOA 1V3ZA 3VAJA 3MMBA 2W9CA 2POKA 1U45A 4KGMA 1A7GE 2IVMA 2B5JB 4DV0J 1U1PA 2DKOB 2RF2A 5D4LA 3KWMA 5AXNA 4UW2A 1RWWB 1XNQF 4NLOA 3MM7A 3UDCA 4WU3A 4X64F 3L4BC 3OSNA 2H1YA 4ECQA 2I9SA 5J2MA 1PYSB 1HNIB 5LSRA 1RTDB 1FTCA 3R7BB 4K4SA 2BW7A 1TTHB 1U1KA 3RG6A 1RI7A 2ZH3A 2HVEA 3I87A 3ZZYA 3UVJA 2ADBA 3M8ZA 3DU5A 3HKWA 4KQZA 2YX1A 1IR0A 5CCLA 1M5PC 4PXDA 1UFKA 5E3AA 2W2OP 4ZVTB 3R9LA 2CNOB 1C1BA 4FPIA 1WF0A 3MR7A 1APSA 1F6TA 3SXLA 4QWCA 2CFXA 4F36A 2CQIA 5KFLA 3B4MA 2KDOA 2DPJA 5DJBA 3MOZA 2CPIA 3D3CJ 3E01A 3UD5A 1N34F 1HNWJ 3VAFA 2R8IA 2R2UA 5KFRA 4OMFG 2BJ1A 4GRSA 1U1RA 5IV3A 4P10A 5GAHI 4PEOA 2R7OA 3DU6A 1AZSB 1Y3JA 1N33J 2Y1RI 4CLUA 4UT4A 1FT8A 2CPEA 2GHVC 3DLJA 2ZE2A 1SKUB 4LR8A 2LMIA 2AEFA 1SIWB 3BYPA 2BW2A 1RHKB 3FCWA 5K8OA 3MMAB 3T5LA 3D6FB 3PR4A 1ULRA 5HBMB 4BWMA 4XIUA 4ED3A 1NK8A 1V5IB 3RBXA 2L9DA 2X51A 5A76A 1HQEB 3SQGA 2I1RA 4AXIA 4RNNA 2ABYA 1EX8A 2HNYB 5GAHU 3KYLA 3B54A 3W62A 1O51A 3AHPA 2ZOGA 1CLFA 3TWZA 2GIFA 2XNRA 2HZCA 1IWGA 2FDNA 5LXYA 1LFWA 2EVZA 2I0XA 3T5KA 3RAXA 2E5JA 1IBCB 3BSAA 3SDEB 3M2VA 3KK2A 1R27B 4DCOB 1M5OC 4E0DA 2EG1A 3KK3B 3B82A 4R0EA 4Y2IA 4DSFA 4I6AA 5KFBA 3PIPQ 3R2CJ 1LW0A 1LWEA 4A8XA 5E5NA 1IKVB 1FJ7A 1Y00A 4JBCA 3RB4A 2ZH5A 4M5MA 4JI6J 3I5CA 4IQXA 2YQ0A 4ZS6A 3G71S 5HN0A 3ILIA 2XMUA 5BYQA 3PXGa 3ENQA 1O6XA 4OV1A 4YN3B 3FSXA 3LO3A 4LRCA 1WHVA 3IC1A 1I1GA 2QFJA 2NREA 2IM0A 2FJWA 1VQLS 3CO0P 3BBFA 2QA4G 1Y0HA 3R5BA 2HS4A 2XMMA 4OZ5A 4KHRA 1QAIA 1C0UA 2WSFC 2KKHA 4DWIA 2CDRB 4WE1B 1XC9A 3PRDA 5F9LA 1ZBTA 3JS9A 4TY8B 4OI0A 1Q53A 3C19A 3CDAA 4OZ3A 4YB1P 4YR0A 1XR6A 2RHQB 4KPCA 4RUCA 3M6UA 5HQLA 4OYXA 2HGLA 4P71A 3CD6S 5F0WA 3A3OB 3OJSA 1OWXA 2M52A 4EMDA 1QTNB 4Q0BB 4FDFA 3UDEA 5IWAF 2KVQE 1OYEA 2FHOB 4HR2A 4OHWA 4N47A 3V4MA 3IR7B 4U96A 3K5MA 3HHLB 1QUVA 3GV7B 2Y1IA 4K59A 1L3UA 4PQAA 3CJSA 3I9ZA 5KG4A 1X9SA 1QY7A 2WONB 3EDQB 3CDBA 2KXFA 3G2XA 2QA4S 2GMJA 2UUBJ 1U7LA 1UEVA 3FJ2A 3DM2A 1W2IA 3LP2B 3D67A 1KNZA 4CH7A 1FHTA 5EWFA 3CC7S 2C2KB 4DPOA 4IFYA 2UZAA 1RWNB 5CHCB 1M90T 1HHSA 2JRSA 1HBOB 1Q5YA 5EWGA 2JX2A 1PAUB 2R9LA 4XK8C 3WC2A 3N28A 3MECB 2VOOA 4ED2A 5J2NB 4ANEA 2E1MC 3RZAA 1VRQC 2DXEA 1M5SA 3FRYA 4JI3J 2GVDA 3MZIA 1RT5B 4CIOA 2MY7A 1S1XB 3QRRA 1PBUA 1JWWA 4LFAF 2KJVA 1WC5A 2GHWA 1Q82T 2CPDA 3E51A 3AOCA 2ZKUA 1TKZA 5ADZA 1FI4A 1X9WA 2YNGA 3MR5A 1KVJA 3UN3A 2BKPA 4ES2A 3I4PA 4DV6J 4O4RA 3FFIB 4F3OA 2E66A 2M4MA 5EX3A 1X4BA 1S10A 2ZC3A 4KPYA 1HLWA 2RDJA 2IYGA 1FFSB 3A8JA 4DV3J 3EUNA 4TQRA 2HVHA 1S1WA 1FK9B 1SC6A 4K4YA 2GJFA 3TZZA 1N52B 1TL1B 1CJVA 2H48B 3UCGA 3NBPA 4M95A 2CQ0A 2ROPA 4XDCA 5C2CA 2B8QA 3S01A 4QCLA 4WXWA 4KIAA 3BQ2A 1NKBA 4DL4A 3ZC4A 5IT9U 4KY3A 2HEKA 3PR5B 3A8IA 5J2QB 2GIQA 2XLJA 3PHTA 1H2VZ 4DBQA 5CZXA 2Q79A 1GT8A 2G1HA 1VJQA 2AYGA 1M5KC 2K2PA 4DX7A 3OBIA 1NZ8A 3JQJA 3CPWR 4A8KA 3ZNUA 1U1OA 1QE1A 4EZ9A 3R27A 2DNOA 1WKKA 2HNDA 2OPRB 1X7VA 4B02A 4IG0A 5THWA 2OEMA 1JLGA 2A0FB 1PC4A 2Z2YB 3LGMA 2WBMA 3NXZA 4Q2LA 5DDPC 2YX4A 1KBRA 2FB0A 4ZCLA 3EZ5A 4AUKA 3R1LA 4XPEA 1WEZA 2MMYA 4B3SF 2LQBA 4X4QA 3BB5A 2MQQA 3E3XA 3U1MA 2VDHA 2FJAB 3V6DB 1WG5A 3HVTB 4KFBB 4NL5A 4LSNB 2B51A 4UOHA 5HLFB 3B6BA 1T9VA 2PA3A 4Q43A 1X4FA 3W9IA 3GG1A 1RJJA 3MEGA 1GXTA 2IY5B 4IKAA 1MLAA 4J7CA 1VJWA 1U24A 3GFYA 4TYBA 3GSDA 5ITHA 3QJLA 3KK1A 1OQ3A 2DGOA 3BPDA 2CG4A 3TJAA 4RUBA 4JI5J 3PHEA 4IDKB 3SIPB 1ACMB 1KDNA 1LEOA 4ZVRB 2OFHX 2BR0A 4ED7A 4G3IA 4ZP9A 1RA6A 1RWPB 5B0AA 5F8NA 2PEHA 1VOMA 4AD6A 4OYAA 4RUHA 3AJ2A 1NPRA 2RUSA 1TZ0A 4HDGA 3BS9A 2V9WA 4PUOA 3V6JA 2WCXA 1T9UA 3CMES 3RAMA 1T9XA 4YB5A 4LF4J 3T41A 3A1YG 1T9TA 1X4HA 2W2MP 1FDAA 1UPPA 3W63A 2HZAA 3VTIA 4F7VA 2P9CA 3VAKA 4ED4A 2CZ4A 2MKJA 3H2UB 1PIEA 4MAKA 2YNHA 2B8PA 9RUBA 3D1OA 1QUPA 1EARA 2EK6A 3VHQA 3L9ZA 1HNXF 2V4RA 4WTYA 3DOLB 3H0PA 4XPCA 5LMNJ 3PW0A 4TXSA 5G0RA 1EP4A 1R31A 2V6AA 2QLBB 1Y10A 3W61A 4C11A 4G1IA 3G6ES 3HCXA 2AGPA 1O5JA 5LMUJ 3C3LA 1T11A 2DHSA 4WJBA 4DU8A 1C0TA 2PC6A 1S1UA 4CYUA 3BO3A 5IM0A 3H59A 1N6QA 1KHWA 3JSYA 3OLAA 1X4AA 1I94J 2IAJB 2E9ZA 5SUHA 1GMWD 1NJIT 3RGIA 2RJZA 3H7HB 5B0DA 3FVYA 1NEEA 5D0HA 3QGGA 3MDFA 1SJ3P 2VODA 2R7SA 1S76D 1IBKJ 1RT7B 4Y0FA 1U47A 2U1AA 4KV8B 4DEZA 3HHEA 2DGUA 3LGNA 2FC8A 1FRMA 5L9XA 1Q81T 3D0GE 1K1QA 3FBEA 3PRVA 2FZGB 3N6NA 4DV7F 4LF2A 1J5EJ 3V6HA 5HMZA 4YUDA 3MEDA 3C6TA 5F3ZA 5CYMB 3MXHP 2F3JA 2QC3A 3IP0A 2WBRA 1S1VA 3HSZA 3WQPA 2ROGA 1X60A 5KFXA 2IBKA 2EBEA 3KJVA 2EFOA 3UPFA 3H98A 3VVTA 3RYLA 3HSDA 2G0JA 3CCSS 4OFZA 2G2YA 1SH0A 5AXMA 3GJTB 2AJ0A 2HFNA 1C4AA 4BC7A 2RRAA 1U1NA 1YK9A 3R6GB 1HPZB 3DNCA 2DNLA 5IZHA 3LPEA 3QO9A 4YMEA 4OYMA 1D8YA 1VDHA 4QR2A 2KRRA 4ITSA 3JYTA 3G87A 1U8WA 2HFVA 4QJVA 5EX0A 5E3QA 3MPYA 4JV5J 3AJDA 3PTWA 4OZ0A 3NGKA 2OMLA 3DRRB 3RR8A 2YX7A 4JI4J 3M2UA 2LU1A 1H7XA 4LF6F 2UV8A 1UWBB 2PDAA 1WOOA 2D3OR 5DG9A 1H38A 1H74A 3MEKA 2LQ9A 2OPSA 4DZ6A 1C1CB 2AEJA 3AXMA 2DR9A 2XEXA 3FKBA 4I6WA 1D1UA 3QRPA 3BZQA 4AXJA 3I5AA 1GNKA 4FVCA 3DN9A 4BCAA 2DNMA 5KT2A 4B9LA 2EC0A 5E0OA 4NZ7A 1G1XA 4HTIA 2W01A 1GTEA 2BJDA 3IWXA 4K2XA 1RZMA 4F4ZA 1CEZA 1X4EA 5JJBA 5AJ3J 3EYZA 4LFCJ 4JYAF 2V2KA 1Y3KA 4JI7F 2KB2A 3MAAA 1IKXA 3L7OA 3M32B 1FJCA 1REVA 1J5OA 2F63A 3HXMA 3AJ1A 4OYWA 4ZLJA 2E5LJ 2J6TA 4X66F 1PJ7A 1NDKA 3DGPB 5L1IA 4DR6F 1FA0A 5L1JA 4Y28C 1NSQA 2BRKA 1XNRJ 2PMZD 2Q66A 4ZCIA 2F8MA 4MT1A 1NB7A 4IG3A 2VASA 2DEIA 1R6YA 2VJUA 2MZRA 8AT1B 4DV2F 2M70A 2WW4A 3EWGA 2OPQA 3C14A 4CWBA 2Y1LB 2VBWA 1P27B 3QZ8A 1LKZA 1HBMA 4GMKA 1SUQB 2GC8A 4QIGA 3D28A 3N01A 1N5TA 1VQ7S 4F8RA 1S9GA 3LP0B 4IH6A 3AFGA 3KNAA 2ZJRQ 4YY3F 2NZ4A 4KHPJ 4C8LA 1W7WA 3MM6A 4RW9B 3FSYA 3SSRA 3JTNA 2G0CA 1UZDA 4M5LA 2ZD1B 3ZTPA 3PIOQ 1YJUA 2LVWA 1BY9A 5GAGI 1T0TV 2AJ4A 5LOQA 3DDNA 4JP8A 2KH9A 2CPZA 1FD2A 1NK7A 2QYCA 3HO1A 1VC0A 5IT4A 2ACYA 1E6VB 3SSQA 4PG6A 3KUEA 4NMXA 4WP9A 5L39A 2YNFB 1G4CA 3FCHA 1XBWA 1N48A 1FKAF 4L76A 3HSJA 5BR8J 1KQFB 2C3YA 3QGHA 1F60B 2E1CA 2OHDA 1N36J 4NCGB 2QV6A 3PFEA 4B9VA 3GYGA 2ZBCA 3RBZA 2KM8C 3PEJA 2A2CA 2DO0A 4F26A 3SMZA 4RNHA 3HT0A 1QSSA 4NXNJ 5KFMA 4X62J 4OX6A 2QJ3A 2D9PA 2BABA 3BKFA 1ZM2A 5GAGU 1IR1A 4EYHB 1NK0A 3DXSX 5T7LA 1H3DA 2MZQA 3KDOA 4DN0A 2ZZNA 1VMBA 5SZTA 2QA2A 4UY8T 5K14A 2YWKA 4LF9J 2PT0A 4BHQA 1Y5IB 4QYZK 4DR3J 2I38A 4LF8F 2DB1A 4QWDA 2AX0A 1JKHA 2AEMA 4C0BA 1LW2A 3SFUA 3HLUA 3MM5B 1HI0P 3MCSA 1KFSA 2UU9F 1NK6A 1HA1A 2M9KA 4ID5A 4JI8J 3VGUA 4Y2CA 2A6MA 2VUGA 3HSGA 3DKDA 3CIZA 2VBYA 1U09A 3WBZA 4OIXA 4LFBJ 1B0VA 2VFVA 3WX4A 1JLAB 3L7PA 4K8RA 3P5BP 3ZZRA 2J8SA 4DV5J 3V6KA 1RBAA 3P3DA 2WSCC 3UCUP 4DSLA 4JV0A 5HK4A 5DETA 3CJKB 2H5EA 4NLDA 3BDEA 4ILLA 2VH7A 2LXUA 4RO0A 2VFTA 3K8VA 2Z2ZA 3PG9A 4NA3A 5A8KA 2H4WB 4NYOA 2RQCA 2HNZA 4ZPCA 3GR0A 4M5DB 3PKYA 1NK4A 3BGUA 3OXFA 2DHXA 3QWUA 1N32J 1EQMA 4ZN1A 1S77D 3PDNA 4NEZA 2CJXB 1GXUA 3C2PA 3MM9B 4ZCKA 4B9UA 3AODA 3N0VA 1PYTA 4A8WA 3U7JA 1KEKA 1UW4A 4DFPA 1ZS6A 4HDHA 4X4TA 1NH7A 1Q8LA 2H3EB 3G82A 4WKRA 4J9VA 2BQ3A 5F9NA 1DQ8A 1S5ZA 2CXEA 3L3CA 4TVAB 4USMA 1NSKL 4ALZA 1KQKA 2JVRA 3FZ2A 2V4QA 3GJSB 1RT3A 1RKJA 5KAKA 1F9FA 4WPAA 3IAS9 1LWFA 5KT5A 1PILA 3MUVP 2V8VA 1RAIB 3LAMA 4UF4A 3MEEA 2UXCF 3NCQA 2WVDA 4X4OA 2KVIA 2R8JA 4PG4A 1G2EA 3DLKA 5B0GA 2DJWA 4DR1J 3VWSA 4URSA 1MU2B 4Y6IA 3GSIA 4U8YA 4LSLB 2AWZA 3WZ0A 2HFUA 5LM7E 1HD1A 1SC4B 1DBDA 2MKSA 2JOQA 1RTZA 2PD1A 3VAGA 5U47A 5FJ4A 5I42A 2MPUA 1BC6A 2EWHA 2GGPA 1KOHA 2DNGA 2ZDPA 3J7YI 2QL7B 2XBPA 4QU6A 5RUBA 1FERA 3J81Y 2MQLA 2HWHA 2CDQA 3CD0A 1SVDA 4YS2A 3GIKA 5KFWA 2UXBJ 3M8WA 4LR7A 3HHLC 5C42B 1M1HA 4DSEA 1RHQB 4RBVA 1YZ6A 1OS5A 2DNZA 2O66A 2CQPA 3ILOA 1ZM9A 1Q1KA 4O44B 2QE5A 5A0YA 4DUZJ 1KR4A 1KVIA 1RABB 2MKYA 1KOOA 2R4FA 5C25B 2FJVA 5M2RA 1OQ6A 3J7YU 1NJYA 4DR4F 4DCPB 4LF7J 3KLIB 4ECUA 1Y11A 3IGNA 2DGVA 2FC9A 4OJ3A 3A8KA 2M2BA 2VFUA 3D2WA 4H4MB 1IQTA 2KFYA 1UKUA 3HVRA 4IUFA 2XS2A 2KYZA 3KJQB 2FJXA 2HQCA 1T05A 1TL3A 2BUNA 4OYOA 1DURA 2B4UA 2ZOFA 1UZHA 4DR7F 4PXCA 2UUCJ 4XO0A 3DRPA 3R3TA 4L72B 2BV3A 2XYHB 2JDJA 2F4VJ 3OTOJ 4NOHA 1HYSB 3BO2A 3MPUB 4MYTA 4CO3A 2VQFF 3RUBL 1EIYB 3THPA 3BH7B 4GO5X 4DSKA 2QL5B 1RWVB 8ATCB 2HGNA 3K59A 5B0BA 4PQUB 4MYUA 2MTLA 3G8QA 2RUGA 2VIHA 5H1SV 4ED6A 2EFQA 2IM1A 2AZ1A 3HFKA 4LVOP 1IKWA 1X31C 2MYFA 3K8WA 4P52A 4QBUA 3DLBA 4HHUA 1HQEA 4F04B 3W2VA 2VC0A 3TRGA 2I8EA 2W8KA 4ZPBA 1HIYA 3QAUA 1FDBA 3TAPA 2HYIB 4ERDA 4OX9J 4OI4A 1N0VC 5D3GB 1DTTB 2GFFA 2GVZB 1Z1ZA 4ZA1A 1RAAB 1MW7A 4P75A 1CC7A 3ELHA 4EFAC 4ER8A 1IKVA 2NXJA 5DLFA 2AJQA 1UVMA 2RILA 1RAOA 1U48A 1K73T 3LP1B 1VQ8S 2R7UA 5IV4A 3QRQA 4Y2AA 1C2PA 4ZHRB 1YG0A 3NEKA 4C97A 2BKOA 2K06A 4FBTA 2FQQB 4ECXA 2ASLA 1VHIA 3PVXA 2BYCA 2CYYA 2Y3YA 4IOBA 4QIVA 2UP1A 3PO4A 1V6HA 5ETQA 4WE1A 2VPYB 3VAMA 3M9OB 1Q4RA 1A9NB 3AB2B 2GZOA 5FDLB 1RT6B 1YKWA 2CJ9A 5HROB 4AQYJ 1VQ4S 2JJ4D 3OW2R 2XSJB 3NOCA 4DR5J 2R7RA 1RDRA 5I4MA 3EGZA 3MGJA 2YKMA 1ZAXA 2J76E 2RB7A 1HW9A 2NXNA 1U2RA 3K57A 3QMQA 3MCMA 3M8PB 2EKYA 1RK8A 1SV5A 5D78A 3NMAA 2OSQA 1JJHA 1VYAA 1YI2S 3JB9k 1N54B 2M8HA 3W64A 1RWUA 4CH0S 3P8BB 4IR9A 2QFIA 2B56A 3HI9A 1RTHA 2VC1A 1TUVA 7FDRA 1WKLA 2ZJQQ 4PWDB 1R8CA 4ZPDA 2HWTA 1YBUA 1X5SA 2RU3A 5DM6Q 4I7FB 4C6AA 2CQGA 2C22A 1U25A 2XG8A 1XNQJ 4YB7A 1NB2A 3LP2A 3T1YJ 2LLZA 1S48A 5KFIA 2VA3A 4M5HA 2DNYA 1M1KT 3CCLS 4IYQA 1CC8A 2HMIB 4QZVB 4OZJA 4X4SA 1SH2A 1TK8A 4PR6A 1KONA 1ZPWX 1TVRB 2XWXA 3PX6A 2CKWA 3IR6B 3AD9C 2W8LA 5I3UB 1JK9B 2WB1D 4J37A 2Y0BB 1DQ9A 2AGOA 3OL7A 2GQ2A 3OL6A 2RIJA 3GU0A 4L75A 4USKA 3J81j 1RYSA 2UUWA 3UFCX 1RT4B 1UP1A 4LF1A 1S72S 2DHHA 1TKTB 1RHJB 2MGZB 5KFJA 4DV0F 3P45B 5IFMA 1PBAA 1VQ6S 5HO4A 4YB6A 2MHEA 3ULHA 2VV5A 3IXQA 2FHJA 1LQ9A 3Q24A 2LQJA 3NNHA 2RRBA 1N34J 1UA1A 1MWZA 2HRYA 2D74B 3F56A 3CUNA 3CIMA 2L48A 1GQEA 4DS4A 1U26A 4YEAA 3O5TB 3VR1A 2MKKA 3GV8B 3EZOA 4DI6A 1RTJB 2CG8A 1VQYA 4R5PB 2B9EA 1H6KX 4ZP6A 5LSOA 2BE2B 4KAIA 4F0KA 3Q83A 2W7AA 4DFKA 1CVJA 5KG0A 1FF2A 2R42A 5HVFA 2JL9A 1GEHA 5BYRA 4K4TA 3CCJS 1DQAA 1WOSA 1LV5A 2CRLA 1RBOB 2ACMA 4DPYA 4NI2B 1ZTWA 2HLUA 2BXJA 4WZQA 2WVBA 4LQ3A 2OPPA 1U6ZA 4GKJJ 2WVFA 5E7OB 3V81A 3J80U 2A10A 3OXGA 4M5KA 5J1NA 1N5QA 3X1LB 1CULA 4B9NA 5ETKA 4MIBA 2GMHA 3IO1A 4FS1A 1F1BB 2JNJA 4USWA 2ZH1A 4TU9A 5L9NA 4C0HA 2M7SA 1XJWB 2V4JA 1N33F 2NQPA 2BJ8A 5JVHQ 3O2IA 3HHNB 5BJRA 1FRIA 2V2ZA 4K4VA 3HP6A 3CCUS 1FE4A 2Y0SD 1Y5NB 3C16A 4FXWA 4ED8A 2VG6B 1VQKS 2WK4A 3WX8A 3BBBA 3UE2A 3I5BA 1S9EB 3POTA 3BPSP 3ZZOA 3NRBA 3BO4A 2DGXA 4NLGA 1O8BA 1EHWA 3D6TB 1VGYA 1HWLA 4CLWA 1S6OA 4PYAA 2IRYA 2HQFA 1G3OA 3QJPA 5IQQA 3EDRB 4KRWA 3BGRB 2CQ2A 4A8MP 4I64A 4X4RA 1NU4A 3M1VB 5DQHA 4MKBA 2W2QP 3EX7B 3QT8A 2D7SA 3AXKA 2WVEA 5HLFA 3GIMA 4HVZA 4OYBA 4R8UA 5B09A 1T94A 2CPHA 1DAXA 3KG0A 2AKWB 1W2BR 1JJCB 1K0TA 1KKHA 2DPIA 2L3MA 2OFGX 4O23A 1DTQB 1OYDA 1U1QA 5IWAJ 4U7UD 3EICA 2KG1A 1GX6A 2K1RB 4JI6F 1H73A 4ZVFA 3IRWP 2HKEA 1PG5B 2PI4A 3KMSA 4KGXB 4ZLNA 1BQMB 5C7PA 4ED0A 4CH1A 4DSIA 4EGLA 4RL1A 3U1LA 2HHSA 3DOMA 3KLHA 2VG7A 2ALYB 3C8YA 3J7Z5 4FBUA 3TZYA 2DNNA 5DQIA 2WSEC 2UUTA 2IDEA 1UJ5A 3NGRA 5KFQA 3TOQA 3N6MA 2XZDB 1U6BA 1DLOB 2N7CA 2DRDA 3KHRA 3EVOA 1F5CA 1FXDA 2P6TA 2HLTA 3KMQA 2W25A 3B78A 3TA0A 2R3VA 3V4IB 4H4OB 4ES3A 1K47A 1PKUA 2KT2A 2FJEB 5A8WB 2YWHA 3W60A 1HMVA 1S6PA 1CS4B 4NZ6A 1VQPS 1QAYA 2J9CA 1YJRA 4KKOB 5T14A 3FRZA 3MMBB 2W9CB 2RH3A 4ENOA 5ETMA 1B7YB 4GVBA 2HURA 2ZBRA 3D66A 1REGX 4D3HA 2M88A 5KFFA 2DRAA 1EJ7L 2DTJA 3MM7B 1PC5A 3PW7A 4XTTA 4IO1A 3C15A 1WTFA 4DX6A 5J2MB 1JXEA 3M30A 1Q95G 4A4JA 1XR5A 2HHHJ 4Q8EA 2DIUA 4Y3CA 2VF3A 4DF4A 1OY6A 1TFYA 1YITS 2CAJA 3UVJB 4RNMA 3X3UA 2OEJA 2OTLS 1TL7B 3BYRA 1BWEA 1FRLA 4NPOA 1YJNS 3BREA 1RT7A 1FX4A 4CLKA 1HW8A 4U9RA 3W1YC 2X3GA 2MEWA 1MG7A 4HH0A 1C1BB 4JI3F 2E9RX 3CJ0A 2JHEA 2DD8S 4OV6A 1L3KA 2IJNA 3HMJG 4C48A 5EHHA 1V3SA 2CQCA 4PXBA 4ZVGA 2J9EA 1WOPA 4OHVA 3GILA 2F65A 3ZNJ1 1KLMA 2HK2A 4UOFA 2QX0A 4C8MA 4QPXA 3OL9A 2DGTA 5CYMA 1LOUA 3QATA 1BE4A 3O8WA 3E01B 3MR3A 2ZUAA 1HR0F 1X0PA 1WORA 1F3VA 3Q22A 1HBNA 4DV6F 2MQPA 5HJXA 5F8LA 2P8IA 2B6AA 3GWCA 5ETRA 4NYZA 4KSEB 4ECSA 1FEHA 3JSMA 1S9FA 2MY8A 3DHWC 2N82B 1IWAA 3TUIC 1NMEB 4K2JA 5KT7A 1ITPA 2JEGA 4Q45A 2JLEA 4DV3F 2YQ1A 1HPZA 4ZJQA 2ZE2B 3AB4B 2IDLA 2IPOB 3O6QA 1VQOS 4N5SA 2W4DA 3S6EA 2E9TA 5DDOC 3C46A 4X4PA 2MZSA 4HLBA 2FUG9 4C9DA 2HS3A 2IA6A 1W26A 1H0HB 2OD6A 2V63A 2VHGA 3Q8QB 1FJGF 2FYXA 1R89A 2G0IA 4LREA 2KXNB 3DI6A 3SQGB 2HPUA 3BF4A 4FPRA 4KH0B 3US5A 1NJXA 2XY6A 5ETPA 2CJYB 2AJ1A 1FKPA 2R8HA 4P2SA 5IT9Y 3H8YA 1C1CA 2AT1B 3M2VB 4RW8A 1U1MA 3KK2B 3QIPA 1IJEB 3ENVA 3JQKA 5DGBA 3TZXA 3M2RA 2ASJA 3Q0AA 2XY5A 4F4XA 1TR0A 5CYJA 3MPWA 2ZBQA 1LWEB 4J9QA 1V3RA 2QN6B 1D9AA 2XCAA 1ROFA 1KN6A 2IRXA 4OI3A 4B9MA 2GJ2A 3IRXB 1F5AA 4W92B 2AJFE 4FF4A 1OPZA 3SCIE 1JLFA 4UQTA 4FKYA 4PRFA 1T95A 2WAQD 4IFVB 2BANA 2GAGC 4TLQA 2QSFA 1BUXA 5EN1A 1RB0A 5JXSA 1F2HA 3R5AA 4WK3A 3RRKA 1P1TA 2NUHA 2J0XA 1C0UB 2W2NP 1Q78A 1LWXA 3PJXA 3TO8A 2E1RA 2PN6A 4K4XA 3ZZUA 3IGVA 3AAWB 1T8EA 1YZ7A 2Z8QA 1WDTA 3DMJA 1TL5A 1VQMS 5HAOA 4ZVSB 3BN7A 3Q2TC 1X5OA 2LXFA 1NAQA 3WIVA 4FN5A 2GV1A 3QZ7A 1FTRA 4RR5A 2U2FA 3W2WA 2GO8A 4BC9A 1HNXJ 4IOCQ 2HBZB 4J9UE 1FXLA 3BBCA 1ZETA 2C2OB 2YPZA 3MF5A 4RW9A 5C2GA 1IN0A 5E3RA 4Q5VA 1SL0A 1GXLA 2IYIA 2LA6A 3MCOA 1R0AA 2V50A 3UW1A 1PJ5A 2O1PA 3NMRA 1AT1B 4MK9A 3DM2B 2I5JA 4QQBA 1JLBA 1R8PA 5DGAA 4IH5A 4ELUA 1KTQA 1N8RT 4ICLB 4F0MA 2J7KA 3MM8A 2SXLA 3MR6A 4YR2A 4IFYB 5LJ5Y 3H5UA 4NCGA 2JFDA 4F4AA 4ZITA 1EQ0A 4DUYF 2HAFA 3H40A 3CJTA 1F5BA 4Q7AA 4DN9A 2BRLA 4C8NA 3MD3A 3GFXA 3T1HF 5LMNF 2GVDB 4MFBA 4B3RJ 3UDLA 1VK3A 2ZWPA 5KFSA 5CD4H 3OL8A 3HHKA 4WFNQ 5LMUF 1SIZA 3FMWA 4QIWD 3ITHA 3M4XA 1JXLA 2OKQA 2L08A 2J6UA 3PX4A 1TKZB 5A2QU 2YNGB 2VJVA 1P8GA 3KNGA 2AP6A 4OX8A 1HWJA 3KXDA 3FEYB 2VBXA 3HFVA 5KFDA 4IH7A 1R6VA 1WTBA 4J5OA 1FKOB 4WIQA 1CBKA 1LK5A 2PGCA 3U02A 1IKYA 1NHVA 3CJ4A 1Q8KA 4CTAA 3LA0A 1S0NA 1IBMF 1FRKA 4RNFA 1S49A 4CZCA 2E29A 4ECTA 4KO0A 4PAAA 2DITA 4U6PA 2DXFA 2YWFA 1WEYA 1K8AT 3ISND 4LSZB 1S1WB 3MD1A 4DX8H 5CABA 3CGIA 3I0SA 1RU2A 3NBPB 3N4WA 3T5HA 2CVEA 4E8UA 5GAEU 4F4YA 1J5EF 3O44A 5D4OA 2XMWA 4Y65A 1H72C 5A8RB 1XR7A 2CQHA 3UI3A 4I2PA 1H2TZ 4ECVA 4F2RA 2A1BA 2KXHA 2BQUA 2L41A 4A8SA 1RHUB 4CLSA 1FRJA 4EU0A 5AXLA 2V5HG 3OPKA 2YXLA 4GO7X 1QE1B 1KVKA 1OIAA 2HNDB 3D7SB 3SV3A 1HKAA 3U27A 3W3SA 1U1LA 4IG0B 1IJFB 1JLGB 3I32A 5CZVA 1WSRA 2F5GA 4JI7J 3DLGA 4PG5A 1B64A 3PYGA 2R7TA 2UUAJ 4JV5F 3HJFA 1RAEB 1N5VA 1A0OB 2Z58B 2YH1A 4X66J 4JI4F 3P4UB 1YHQS 2LXIA 4DR6J 3D6HB 2C3PA 1RT1A 4PXEA 3IG1A 3NWGA 2OD4A 2YKAA 4DV4J 3VQTA 2DR8A 4DV2J 1VIXA 4P9SA 3WHIA 1ZZFA 4V19X 2W2PP 4DQPA 2MLXA 3GV5B 1YVFA 3MEGB 5HSPA 4DPXA 3A3NB 2YQ3A 4A8YA 4AE5A 2N4DA 1NUEA 3SV4A 3Q89A 2R7VA 3BSOA 5E3PA 3M9MB 4KGVB 2HFZA 5AJ3F 3DFEA 4LFCF 1LWCA 4DFJA 4P2FA 1JNZB 2GX8A 2MSTA 4OYZA 3W8GA 4Y2KA 4OZ1A 2IHR1 3SI8A 1YRUA 4PWUA 3MAQA 2COLA 1ZYQA 2KRBA 2DGQA 2OGUA 3ET6A 4U8VA 1OY9A 3U1NA 4C8KA 3T6BA 2JEJA 1YBTA 1XNRF 4PUOB 2BJ9A 2CNLB 1RTIA 3K17A 1HNVA 2BJ3A 4WYLA 3ZZPA 3VALA 3BR9A 3OUYA 1R8BA 2HRTA 1B7FA 3G4SS 3PYDA 3D6MB 1IM4A 3AA9A 2F1FA 1GTHA 4CO2A 5CYQA 4XAKA 1DFDA 3CDEA 2BOPA 2YNHB 4DL6A 4DPUA 1OY8A 3HF5A 2QMXA 2HGMA 2ZKTA 2B3TB 4E98A 4U67Q 3BSCA 3R7SB 3TI0A 4KHPF 5G0RB 2XMVA 4CO0A 4QIFA 1EP4B 2GNKA 1LFPA 3RW7A 1T03A 5K5MA 5F8JA 4P2MA 3R97A 4C11B 4V1Ak 2BBEA 4E2FB 4LQ9A 5EDWA 1UJ6A 1DRZA 1C0TB 4X65F 4G6VB 4CYUB 2MQOA 4DL5A 2RS8A 1PGZA 1S97A 2DCLA 1N6QB 5H9EK 4FF3A 3OR1A 3GIJA 2LCWA 5BR8F 3H25A 2ZITA 4MK7A 4YR3A 1N36F 3CCES 4N8NA 4RW7A 4M63A 2MKIA 4Z37A 4NXNF 3CC2S 3D0IE 4X62F 2ZC4A 4L73A 3D1HA 3M8QA 5D8HB 2F9DA 1X5PA 2C42A 3L09A 1F2GA 2MKHA 2Z2MA 1RWXB 3P96A 4WKYA 2HQ3A 1E6YA 4AL6A 4KJIA 1BXNA 2A2DA 2ZEJA 4M5GA 3ETOA 4URQU 3TQEA 2ZM6F 2XI3A 1TELA 4LF9F 4DR3F 4OL8A 5D3GA 1AW0A 2LKZA 3MEDB 1AROP 3C6TB 3C6UB 3WDOA 2VFSA 1QDUB 2XZWA 1WKJA 4J9SA 2ZFHA 3CJRA 3KUGA 3H2LA 2E5GA 2F4FA 3OLBA 1TKXA 1JNRB 4JI8F 1S1TA 4C8OA 2A6OA 4PCQA 2QO3A 3CW2C 3IS9A 2HG4A 1XQIA 4ZJLA 5KG7A 1VHFA 2GO9A 1U4BA 3Q8VA 3CWJA 3EGNA 4W98A 3K5NA 3LP1A 4KGZB 2XB2D 3TUJC 3PYEA 1CPZA 4QWBA 1WD6A 4DV5F 4QW8A 3KG1A 3QO9B 4DHVA
chains in the Genus database with same CATH topology
2B5JB 4DOZA 1U1PA 3I4HX 4GO5X 2RF2A 4DV4F 4DSKA 3CCZA 5D4LA 3RRGA 3KWMA 5AXNA 3MUMP 3MMCA 4UW2A 3HM9A 3Q2SC 2HGNA 3K59A 1XNQF 1F0XA 5M2PA 4DL7A 4M1KA 4NLOA 5B0BA 4PQUB 3MM7A 3UDCA 3BGFA 1FVQA 4WU3A 1RT2B 3TARA 4MYUA 4X64F 3DMJB 3OSNA 4O3SA 3G8QA 4ECQA 2I9SA 2D1CA 2N7YA 4K5SA 5J2MA 1B0TA 2RUGA 1HNIB 3PNIA 5H1SV 1L3TA 4NLSA 1VIOA 4ED6A 2DH8A 1NRKA 2EFQA 2V8HA 1N32F 2IM1A 5LSRA 4IDKA 1FTCA 1RTDB 4URGA 4QYZJ 2DNQA 3HFKA 4K4SA 2XSJA 4LVOP 1IKWA 2MYFA 4DL0C 3K8WA 1U1KA 2BACA 1RI7A 3P49B 2ZH3A 4QBUA 3I87A 1XMOF 1BQNA 3ZZYA 1CQNA 3DLBA 2ADBA 3W2WB 4LVNP 3DU5A 3HKWA 2V8DA 1HQEA 4KQZA 2M3DA 2YX1A 3N5BA 1IR0A 5CCLA 4Y2MA 1M5PC 2OPSB 4YDXA 3ISNC 1KD1T 2MZJA 4ED1A 3W2VA 2VC0A 4PXDA 3TRGA 2I8EA 3MHYA 5E3AA 2Q3PA 3M8PA 3UR0A 2W8KA 3MTKA 4O3NA 4ZPBA 5KFNA 2MKCA 2HS0A 3QAUA 5JUMA 1FDBA 3TAPA 4MH8A 2HYIB 3QYYA 4TKTA 4NLWA 1NK9A 4ERDA 3PFOA 4OI4A 2NXUA 1JIHA 1N0VC 2ZHAA 2AU0A 3Q23A 5D3GB 2CQ4A 4W90B 1DTTB 1TV6A 3GYXB 2GFFA 4TLRA 3TANA 1C1BA 1R0AB 1WF0A 2PI5A 1APSA 4WFZA 1Z1ZA 1N5YA 4IRDA 3SXLA 4Q44A 1TL4A 2VG5A 3H2VE 4QWCA 1SJRA 2CFXA 4ZA1A 2I5JB 4DL2A 2CQIA 5DM7Q 3RB6A 2RDIA 2MHNA 1JLBB 3TYTA 1D0EA 5KFLA 3B4MA 2KDOA 1CG2A 3HKZD 2DPJA 4I6YA 1MW7A 2FGOA 5DJBA 1IKXB 3MM8B 4I7FA 1CC7A 3MOZA 4EFAC 4UUXA 4ZDNA 1S99A 2CPIA 1IKVA 2D41A 4LUBA 3O1LA 1J5OB 3DRSA 3E01A 4LT6A 5DLFA 1AFIA 5J1EB 4TNOA 5L1KA 2AJQA 4C4WA 2ATLA 1UVMA 4O3QA 2E1AA 1N34F 3NAIA 1NNDA 2RILA 2HAIA 3DOLA 2R2RA 3VAFA 1U48A 1K73T 2R8IA 1U6FA 3LP1B 2R2UA 5KFRA 4OMFG 1VQ8S 1U1RA 2R7UA 3IWLA 3CDWA 1MWYA 4Y2AA 5GAHI 1C2PA 4ZHRB 2BDPA 1YG0A 3TAMA 2WHOA 1GX5A 2R7OA 3DU6A 4C97A 4FBTA 2V0NA 4ECXA 1Y3JA 4IG3B 2Y1RI 2RRNA 3NGDA 2ASLA 2RF2B 1FT8A 2UUBF 3PVXA 2CPEA 4AYBD 2BYCA 2CYYA 3GZ7A 2UVUA 2GHVC 4MFBB 4MTPA 2W9BA 1UETA 3DLJA 2ERRA 2ZE2A 4IOBA 4QIVA 2UP1A 3PO4A 1V6HA 2LMIA 2OPQB 1SIWB 3K7RA 4WE1A 2VPYB 2BW2A 2CJBA 3ITHB 3M9OB 1Q4RA 3VAMA 3T3FA 1A9NB 3OJUA 3AB2B 5K8OA 3MMAB 1HBMB 3T5LA 5FDLB 2CQ1A 2DH9A 3OHBA 1RT6B 2CJ9A 3PO5A 4BS2A 3PR4A 5HROB 5KT3A 2B4OA 2LA4A 1ULRA 1VQ4S 2IAJA 2JJ4D 1HWIA 3OW2R 2XSJB 1WWHA 4QPTA 5HBMB 2R7RA 1RDRA 5I4MA 4EBCA 4BWMA 4XIUA 4ED3A 3EGZA 3MGJA 2B9WA 1S9GB 1NK8A 5FIIA 2YKMA 1TKTA 2MGZA 3I0RA 2MB0B 2UXBF 1BQNB 1MNEA 1ZAXA 1HI1A 2L9DA 1HWKA 2X51A 4MK8A 1HQEB 1UAWA 2J76E 4RLEA 3SQGA 3CF5Q 2RB7A 2EFNA 2FLLA 2I1RA 1HW9A 2AQ4A 1U2RA 1T7PA 4AXIA 4RNNA 2ABYA 3K57A 5H9FJ 2HNYB 3QMQA 5GAHU 3KYLA 1O51A 2DRBA 3AHPA 2ZOGA 2R8KA 3MM6B 3M8PB 3ISZA 2EKYA 1RK8A 1SV5A 5D78A 1V9OA 1UVJA 2FVPA 1CLFA 2XNRA 2HZCA 2ZH6A 1VQSA 4DUZF 4KV8A 3NMAA 5F8MA 2OSQA 2FDNA 3PACA 1JJHA 5LXYA 1YI2S 3JB9k 1IKYB 1LFWA 1N54B 2M8HA 2EVZA 4CTAB 1RWUA 2I0XA 2HHQA 4CH0S 3T5KA 3VZIA 2KG0A 1TV6B 3LANA 3RAXA 2E5JA 3BSAA 3SDEB 4KO0B 4HL9A 3IBWA 3MOJB 3T5JA 3M2VA 4IR9A 3DLEA 3KK2A 1R27B 2K3IA 2F8HA 4NLVA 4OLPA 2B56A 1M5OC 1Z4UA 1RTHA 2J8AA 1YSJA 2VC1A 3HI9A 4E0DA 4QU7A 1TUVA 4UY85 2EG1A 5D4NA 3KK3B 3B82A 4R0EA 4Y2IA 7FDRA 4DSFA 4ZLPA 3H20A 2ZJQQ 2O5DA 3GFHA 4PWDB 4I6AA 2NPIA 5DDQC 1R8CA 4ZPDA 2JVOA 4LF7F 5KFKA 5KFBA 2HWTA 4ETXA 3PIPQ 2D3UA 4WF9Q 4EBDA 1X5SA 1LW0A 3EXYA 2RU3A 5DM6Q 1LWEA 4I7FB 4A8XA 2CQGA 1H7WA 4MMOA 1U25A 5E5NA 2C22A 1IKVB 2XG8A 3I0SB 2XMJA 4WIIA 1VLYA 3W7BA 2EI5A 1FJ7A 1Y00A 4JBCA 3OFHA 2XNQA 4YB7A 3LP2A 3RB4A 2ZH5A 2LLZA 2J7UA 4RW6A 1S48A 5KFIA 2VA3A 3QGIA 3I5CA 4IQXA 2DNYA 4ZS6A 2KZMA 3G71S 2A18A 3F41A 1M1KT 4EUVA 3CCLS 4IYQA 1CC8A 5HN0A 2XMUA 4NA1A 4QZVB 1HARA 4OZJA 2HMIB 4X4SA 1SH2A 2OO4A 1JX4A 1TK8A 1RA7A 5BYQA 3PXGa 3ENQA 4PR6A 1SJQA 4N8OA 1KONA 4OV1A 4A46A 5L8RC 1ZPWX 4TYAA 3FSXA 2D3ZA 3LO3A 1Q8IA 1TVRB 1WHVA 1K1SA 2XWXA 3IC1A 5EWEA 2B9XA 1I1GA 2QFJA 2NREA 2P5VA 3PX6A 4I2PB 2GIRA 2IM0A 2XHWA 1LK7A 2CKWA 4IR1A 3NCPA 5T7LB 2FJWA 3IR6B 1VQLS 5B08A 2QA4G 1Y0HA 3R5BA 1VFJA 2HS4A 1Y9OA 2KO1A 2W8LA 2XMMA 5I3UB 3EXCX 5H9EJ 4OZ5A 1JK9B 2WB1D 4KHRA 2UUCF 4J37A 2W9BB 3LUYA 1QAIA 1C0UA 4DQQA 1DQ9A 1XWLA 2KKHA 2WSFC 4WXOA 2W7OA 4DWIA 2FD2A 2AGOA 4LIRA 2NS1B 3OL7A 4WE1B 2GQ2A 1K9MT 2HWIA 3O3LA 4YDDB 3OL6A 2RIJA 1XK8A 1XC9A 4K4UA 1JB0C 3PRDA 1KLNA 5F9LA 1ZBTA 4OI0A 4TY8B 1HQUA 1Q53A 1LXJA 1RYSA 2DNRA 3CC4S 3CDAA 1JKHB 3K5PA 4YB1P 4YR0A 1XR6A 2UUWA 3UFCX 1LW2B 1RT4B 1IBLF 1UP1A 4RUCA 3M6UA 1S72S 2HGLA 3TA2A 4TU8A 1VS3A 1TKTB 2MGZB 4ZP7A 2Q1LA 5F0WA 5KFJA 3CD6S 4UUWA 3DRYA 4DV0F 3OJSA 5IFMA 1OWXA 2M52A 4ID5B 3JSRA 3DRRA 4OLOA 2RKIA 4Q0BB 1VQ6S 5HO4A 5IWAF 4YB6A 2MHEA 4KBIA 3ULHA 2C2EA 2FHOB 1UWBA 3DLGB 2M0GB 2VV5A 4OHWA 2YWEA 1NO8A 3G6VA 4N47A 3V4MA 3IXQA 2XGQA 2PO4A 3KKFA 2FHJA 3IR7B 1LQ9A 3Q24A 3K5MA 4QIEA 2LQJA 3HHLB 1HWUA 1QUVA 3GV7B 2GCFA 4LMZA 3NNHA 4TY9A 2RRBA 1QVGR 1UA1A 2QSWA 3I6PA 1MWZA 2Y1IA 4K59A 1NK5A 2HRYA 1L3UA 2F7VA 2D74B 3DLEB 3F56A 1DJ0A 3PJWA 4PQAA 3QWPA 3Q8SB 3CUNA 2VBZA 3SCLE 3I9ZA 5KG4A 1RT1B 3CIMA 4H54A 4O4GA 3G6YA 2L48A 3AQPA 1X9SA 4XDDA 1PSDA 1GQEA 1QY7A 2XWYA 4DS4A 2KHDA 4K4WA 2WONB 2GQQA 3CDBA 1U26A 3IG1B 4YEAA 3O5TB 2B7BB 4F2SA 2KXFA 1PO6A 2QA4S 3VR1A 2MKKA 2LEBA 3GV8B 2YKQA 3OQ2A 1RTJB 2JLGA 1VQYA 1LW0B 1WHWA 2GMJA 4R5PB 1U7LA 2FIUA 3LF0A 1UEVA 1H6KX 2ROEA 4ZP6A 2FPHX 1XEZA 5LSOA 2E7XA 2BE2B 3C66A 2KYXA 4KAIA 1IXKA 3FQKA 1VC6A 3FJ2A 5A8KB 2W7AA 3DM2A 3JSBA 1W2IA 2R7WA 5DG7A 3M1VA 4DFKA 1CVJA 3LP2B 5KG0A 1FF2A 3NNCA 3KFWX 3PEHA 2JL9A 1WI6A 4ZK7M 4ETZA 5BYRA 3SFGA 4K4TA 3CCJS 1KNZA 1U8SA 1JLCA 1DQAA 2HIQA 4CH7A 1FHTA 5EWFA 3M8SA 5CA5A 1LV5A 3CC7S 1UVNA 2CRLA 2XLKA 3M32A 3T6JA 4I4BA 1VK8A 4DPOA 4IFYA 2UZAA 2Z0GA 5AE2A 1ZTWA 2E7WA 2HLUA 3EPIA 3SCJE 3J7A1 2BXJA 5CHCB 4ZP8A 1BD6A 3TX8A 1M90T 1SKSA 1HHSA 2JRSA 1HBOB 4NX9A 3DGPA 1VBXA 3HVAA 2IC3A 1WI8A 1LWCB 3GE9A 4WZQA 4B3MF 4LQ3A 2OPPA 2V8GA 1U6ZA 3KLGA 2DNPA 5EWGA 2JH3A 4NLTA 2JX2A 3KLVA 5E7OB 2R9LA 2YY3A 4NZ0A 3V81A 2A10A 4XK8C 2UVVA 5AE3A 3WC2A 2MQNA 3MECB 3N28A 4B3OA 2QT7A 5DS7A 4J9PA 2VOOA 3BDPA 2L9NA 1SB6A 5J2NB 4AL7A 4ED2A 2E1MC 2VPXB 3OXGA 2O67A 5J1NA 1N5QA 3RZAA 3X1LB 4B9NA 3D1QA 2GMHA 2VPWB 3IO1A 1M5SA 2BJEA 1ZPVA 1BQMA 3FRYA 3MZIA 4FS1A 1RT5B 3GYNA 4CIOA 2ZH1A 4TU9A 5L9NA 2MY7A 4C0HA 3CEDA 2M7SA 3TVKA 2VL1A 3PW2A 5KFGA 1S1XB 2G4BA 3TW0A 2V4JA 2C3UA 4A47A 1N33F 2NQPA 1RT3B 2DHAA 1JWWA 4LFAF 5JVHQ 2KJVA 3BGLA 1YJVA 1RTIB 3O2IA 3Q8PB 3UNGC 3HHNB 5BJRA 1TK5A 1NH8A 1HNVB 1FRIA 4K4VA 2ZUGA 2GHWA 1SUQA 1LWFB 1Q82T 2CPDA 4JUZA 3HP6A 3CCUS 4DFMA 3E51A 1FE4A 3UCZP 2Y0SD 2ZKUA 1TKZA 5ADZA 1N0UA 5HI7A 3OUYB 2OH2A 3TQ1A 4MIWA 4DQSA 3NNAA 4C0OC 1Y5NB 5C5JA 1X9WA 3I96A 4FXWA 4ED8A 4TQSA 2YNGA 3LP0A 3MR5A 1KVJA 2VG6B 4C3MA 3RB3A 1VQKS 2WK4A 3MEEB 4F50A 3BJYA 3QAEA 5A6PA 4JI5F 5CYQB 3NG8A 4ES2A 3LOUA 3UE2A 3I5BA 3I4PA 1S9EB 3POTA 4O4RA 1S0VA 3FFIB 2VZ9A 3ZZOA 4NRTA 3NRBA 4F3OA 1TP7A 2E66A 2F40A 5KFCA 3BO4A 4K4ZA 2DGXA 5IQ6A 1O8BA 2DR7A 4NLGA 1OSCA 4KGKA 1Z2LA 3DLKB 1VRUA 2KT3A 2UXDF 1VGYA 2M4MA 2ZD1A 4V19J 5EX3A 1HWLA 3KHLA 4C2MA 1Q7YT 1X4BA 3ZZ0A 1AXQA 1S6OA 3KLEA 1S10A 2ZC3A 4ZPVR 3TVYA 4KPYA 5B7WA 2KU7A 1JLQA 2IRYA 1Q16B 4ED5A 1G3OA 3QJPA 1Q79A 2RDJA 2FY1A 2KFZA 5IQQA 4F4WA 1IUJA 4HTJA 2IYGA 4KRWA 4UOCA 4HYKA 3BGRB 3EGWB 2CQ2A 1T03B 5K8NA 5I42B 1RKIA 4I64A 3EUNA 4A8MP 4X4RA 1NU4A 2VB6A 3M1VB 5DQHA 4TQRA 1KC8T 2HVHA 3G8SA 1S1WA 1ZM4A 2FVSA 1E6VA 2GGPB 3PV8A 2XO7A 4YHHF 4LF4F 2EPIA 4MKBA 3H5XA 1FK9B 4N56A 4KTQA 1SC6A 3EX7B 1JLCB 4K4YA 4I2QA 2HVIA 2D7SA 2YNFA 1A6LA 5KFOA 5HLFA 1N52B 3S8SA 3GIMA 3CULA 5KG5A 1TL1B 4HVZA 1J2VA 4R8UA 2C2RA 4FZVA 3UCGA 3NBPA 4M95A 4ECYA 2RQMA 5B09A 1SQEA 4C8YA 2CQ0A 1XERA 2ROPA 2LDIA 1T94A 2CPHA 1DAXA 1R43A 1DARA 3KG0A 4XDCA 3S01A 1W2BR 4QCLA 4WXWA 2WOMA 1K0TA 1X4GA 4RU9A 4KIAA 2DPIA 3BQ2A 1NKBA 3PY8A 2L3MA 4DL4A 4OI2A 5EUHA 3MPVA 2OFGX 3I82A 3CD5A 4RX6A 3OR1B 1DTQB 4O23A 3KLGB 1U1QA 3ZC4A 5DG8A 4F3MA 2CQ3A 3ICLA 2IM3A 2MSSA 3OTBA 5J1PA 3PR5B 2KG1A 5E41A 1UA0A 2J0SD 1SXLA 2DHGA 3MR2A 1GX6A 3T1YF 2K1RB 3RRHA 5A0YB 5J2QB 4JI6F 4RW7B 5KFZA 4UQGA 2GIQA 2QRRA 2P9EA 4ZVFA 2XLJA 3IRWP 2DBBA 1UVLA 1H2VZ 1S6QA 4ILRA 4Z2XA 3KMSA 2PI4A 2N3LA 4DBQA 5CZXA 2KHCA 4I0WA 2RSQA 2Q79A 1BQMB 1GT8A 2DCUB 3CJ3A 1FRHA 2AYGA 3OTCA 1M5KC 4WFXA 2PIIA 4CH1A 4ED0A 4EGLA 4DSIA 4RU2A 3U1LA 4JOUA 2HHSA 2K2PA 2IVFB 3OR2A 3DOMA 4ZVHA 3OBIA 4QWAA 5K8MA 3M8QB 3KLHA 5KFVA 4K0KF 2KM8B 1KFSA