1RU1A

Crystal structure of a ternary complex of e. coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.40 angstrom resolution (monoclinic form)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
143
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPPDYLNAAVALETSLAPEELLNHTQRIELQQGRRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Essential Roles of a Dynamic Loop in the Catalysis of 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 41
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1ru1A00
3ILJA 5ETOA 3IP0A 1RAOA 1EQ0A 5ETLA 1TMJA 1TMMA 1RU2A 3HSJA 3MCMA 3HSZA 5ETVA 1F9HA 1Q0NA 4M5LA 5ETKA 3UDEA 5ETQA 4M5NA 4M5KA 3HD2A 2QX0A 2CG8A 3HSGA 3UDVA 1CBKA 2F63A 1DY3A 4AD6A 3KUHA 4M5GA 1HQ2A 4F7VA 4CRJA 1RU1A 1RTZA 1HKAA 2F65A 5ETMA 1RB0A 3MCOA 1G4CA 3HD1A 3MCNA 4M5JA 4M5MA 4CYUA 5ETNA 2BMBA 1EQMA 4PZVA 5ETSA 3ILLA 3ILOA 5ETTA 1IM6A 3HSDA 3HCXA 3HT0A 4M5HA 5ETRA 3UD5A 4CYUB 3KUEA 4CWBA 3ILIA 3QBCA 1EX8A 3KUGA 1KBRA 4M5IA 5ETPA
chains in the Genus database with same CATH superfamily
4KE5A 4FXDA 1CVJA 4O4GA 2VG5A 1FD2A 4BWMA 4NLOA 3LPEA 4DG1B 5AE2A 3Q8VA 3R5JB 1Y5LB 3HVAA 5ETVA 3M8QA 4TQRA 3VALA 2YNFA 4P74A 1Q8BA 5A6PA 1B0TA 4S0MA 3IAM9 2QE5A 1YBTA 1IBMJ 4JI1J 4PABA 3L7OA 2ATLA 2DTJA 2KYZA 5KFPA 3VAHA 2CDQA 3I31A 4JI7J 1HQUB 2HQCA 3QRPA 1RABB 3IGVA 3RR7A 5KFFA 4N41A 4IQXA 3UPFA 1ZA1B 2DGTA 2GMLA 2O3DA 3LW5C 4FXWA 3MR5A 5J1EB 1LOUA 2MZRA 1H0HB 1BQMA 2EBGA 3PY8A 4B3MJ 1OIAA 2JC1A 5FIIA 3NNAA 3GIIA 4XPEA 4F2RA 5HMYA 5AXKA 1C4AA 5C24A 4DR3F 3QJJA 3HHLB 2XMVA 3V81A 4P71A 1S72S 4JV2A 4OYIA 1T0TV 2AJ0A 1RQ0A 4FPIA 4HDHA 2FJBB 2EFPA 2GNKA 4FKYA 1P1TA 3DDIA 3HSZA 3UNGC 4L3KA 2Y1IA 1XC9A 2KI2A 2EC2A 3DKDA 5KG2A 1E6YB 2UXBJ 1RAGB 2PN6A 5KT5A 1LWXA 4PXBA 5IQ6A 2PI4A 3H5XA 2XMAA 2XMUA 3N6NA 1S79A 1JLGB 4Q8FA 2MJNA 2L3MA 4AFFA 3MF5A 2RF2B 3FNNA 1HI1A 3R1LA 2B6AA 3EUNA 1TL7A 3GYGA 3MPYA 4DR3J 4LF5J 3RRKA 3AOCA 3IWNC 5KFWA 1EQMA 3I87A 2IHR1 5D0GA 2DGOA 2GMJA 3CSKA 1LV5A 1SB6A 3TZXA 1RT7B 3GJSB 1QE1A 1UFLA 3PIPQ 2HRYA 5HROB 2V2VA 3QZ7A 2PMZD 2XS7A 1REVA 1Y4ZB 2E9TA 1NDPA 3DOMB 2ZD1B 2OSQA 3P5BP 2HIQA 4TU9A 4DJBA 1SKRA 2CJYB 2JHEA 1LW0A 2HG4A 4Q44A 3IXQA 2HKEA 4UOFA 1FCAA 1R27B 3GR0A 3QGPA 1U09A 2Z58B 3ZTSA 2ZBQA 1IWAA 2KT2A 1K47A 1AZSA 2HFNA 2NUUG 4USKA 4U96A 4CLKA 4P7VA 4CO3A 4G1QA 1MROA 3HSDA 3M1VA 3SQGA 2RSQA 2DK2A 5BYQA 5F8GA 5GAGI 2I0XA 2UUBJ 1EX8A 1WHXA 3QT7A 2XYPB 2XY5A 2JFDA 1AW0A 1EQ0A 2JX2A 3MZIA 3NKYA 4C8OA 4Q0BB 2GV1A 1OQ3A 2XB2D 5ETKA 3FCWA 2HURA 1REVB 4RL1A 3W8PA 4CO4A 5C2CA 1EETA 5HP1B 2CVEA 1XN9A 2NZCA 2RT3A 4NEZA 4LF9J 2DNKA 1R8PA 3WX4A 3M8ZA 4CH1A 2V8PA 1YQHA 4HT5A 3DLLQ 3P6YC 1D0EA 3PX4A 3PX6A 1J5OA 2K8GA 2RU9A 3RTVA 4FPRA 1X9WA 2E7WA 2F65A 3LP0A 4MFBA 4J5OA 4F4ZA 2B51A 2G1HA 3H4BA 4J9MA 1EAYC 3ILLA 2IDEA 2YX1A 4Y2CA 3NGUA 4CDIA 3NWRA 4KO0B 3VGUA 1NKEA 2I2YA 2VQFJ 4QPTA 2OEJA 2HEKA 1JIHA 3CF5Q 3GZ7A 3FFIA 3TA1A 3VAIA 1L3KA 1RGVA 4CTAB 2MQOA 2WBRA 1TFWA 5DM6Q 1T11A 4FBTA 1NDLA 3GCWP 1KQKA 3UFCX 5HSPA 2VA2A 3C6TB 1ZM4A 2GIQA 5A0YA 5BYRA 1JQGA 3CJ0A 3QIPA 4G1IA 4GVBA 5A8WB 4QYZK 1VHFA 3DMJA 4J9UE 2K3KA 2HWHA 2H4YB 4LBIA 5HK4A 2WBMA 1MMNA 4YB6A 2W25A 1QJHA 2GS8A 2YKMB 1YJNS 2EW9A 1DTTB 4DPYA 4YFUA 3IR6B 3PFOA 1NH7A 1XMBA 3PRVA 2MPUA 1U1NA 2DHAA 4EK2A 3RB0A 4NLSA 3EGZA 3D0IE 3JTNA 3OFEA 2IM1A 2ZBCA 4BCAA 4NLWA 4I6WA 2KJVA 3NNHA 5GAEI 4KFBA 1WF0A 1H7XA 1I5OB 5LMUJ 5H9FK 1BUXA 2ZH9A 2CJKA 3IGNA 5F9LA 1ZM3A 1EP4A 2I5JA 1EJ7L 1R8AA 1WDDA 2VBWA 2VFVA 3FZBA 3HZGA 3IR5B 4ZPVR 1LWEB 4ZLLA 3FCVA 1RHQB 3MGJA 1RT5B 4R25A 4RUAA 4DR5F 1S77D 2BA9A 1GFWB 2ILYA 2HBYB 5A8KB 2XSJB 2K7JA 1FNOA 2B4OA 2FUG9 4UUWA 2HHHJ 3P8BB 3WIVA 2L9WA 3D28A 3RAXA 1M90T 1Z2ZA 3KJFB 3OV7A 4JUZA 2C22A 1HLWA 3OXGA 1F9EB 2ASYA 3THTA 1RB0A 2LU1A 1HBNB 3CJTA 4NMXA 4QW9A 3CCJS 3RRHA 1PILA 4OI4A 4DMZA 2VPXB 3P96A 5KFBA 4QR1A 4KGVB 3OPKA 4NYPA 4WTOB 4PQUA 3GFYA 3ITHA 5F8HA 4DV5F 4L72B 2ZDOA 4QBUA 3MUMP 4NXMJ 2IC3A 4PQAA 3DU6A 1RISA 2VBZA 1JJCB 3IAS9 3M6XA 4ETZA 1RTDA 3ILJA 2FPHX 2QMUB 4WIQA 2ZHOA 3GFHA 5EX0A 3AQPA 4I6YA 5KG6A 5B0CA 4URGA 3EDRB 4NXNF 4LQ3A 1UJ6A 4DSJA 1HNWJ 3PJXA 3OHAA 3TAMA 3CE8A 2SXLA 1OMSA 4EI2A 3GFZA 1Q1KA 2B4UA 1WI8A 1RT5A 2DNNA 3CO9A 1GAOA 3Q8QB 4AQYF 1N32J 2O67A 3G8TA 1RTIA 3AAWB 3NP5A 1CC7A 2ZBIA 5CH7B 4TU7A 4ER8A 4H4KA 1T8EA 1BLUA 5IS2A 2VHGA 4RW7A 1Q8LA 1WTBA 4DR4J 2QJ3A 2RIJA 3HFKA 4HACB 4OHXA 5IT9Y 1O51A 2MQLA 4M5MA 1D9FA 1Q5VA 1R3NA 1HHSA 4ZN1A 1FDAA 4FF2A 3HT0A 4FNIA 2CWKA 4IG3B 4M5HA 1TKTA 3SCLE 4Q0BA 2D69A 1RHMB 5IT0A 2HGLA 3MMAB 1MMDA 5AE1A 1PG5B 2OTLS 1XWLA 2HVDA 1FESA 1YLXA 2GIRA 4DEZA 1KOOA 2ZUGA 3RYLA 3SQGB 4E0DA 4JV5J 4MKVA 4A8FA 2CJ9A 2GVZB 1SH0A 1WD6A 1C1CB 4HEA9 2CQGA 4LF2A 2D7SA 1U47A 2CPHA 3DRYA 3FSIA 1CS4A 2H65B 3K5MA 5F3TA 3NGSA 4UW2A 3K58A 2MMYA 3C6TA 4EU0A 1PYTA 3I32A 1YZ7A 3RRGA 2EG2A 1H2TZ 5CCLA 2G2ZA 5A2QU 4RNMA 4WF9Q 1S6QB 1X8DA 1JLFA 2YXLA 3R7BB 4DFJA 2AGQA 3MURP 2POKA 2VF3A 3G6VA 4YOEA 2ZH4A 2C2ZB 1T9YA 3PW7A 4OZ1A 4PZVA 2V8DA 1H2VZ 1RTJA 2HGMA 3BYRA 1W7WA 3CJKA 4MK8A 4Z37A 4OYXA 4YY3F 3OLAA 1HI8A 2J7KA 2J0WA 4V19J 1YBAA 4K4SA 1Q7LB 1YKWA 5E3PA 3ZZUA 2AQ4A 4DV0J 3SV3A 1L3UA 1RCOB 1QE1B 2Q1LA 5L46A 1RT7A 1RU2A 3NCPA 5KG4A 3C66A 1I94J 3QT5A 4USUA 2XCAA 1TAUA 2ZJQQ 3W2VA 4DDFA 1A7GE 2W4PA 5C2GA 1QAYA 2RF2A 4J9OA 4F8RA 2FGOA 4HH0A 1ZAWA 2GAHC 2XYGB 3Q83A 1VLOA 2UXBF 1HBMA 3GWCA 3WHIA 3CCVS 1WORA 2DCLA 3CO0P 1NRKA 1SC3B 1UA0A 1TU0B 2OIHA 1OSDA 1PSDA 2DHGA 4GKJJ 4OHZA 3M1VB 2ZUAA 1F2HA 2FLOA 3CJQA 3AY0A 3M30B 5F3ZA 4QZVB 1R43A 2QL7B 1FE0A 2HQFA 2RE1A 1AZSB 2UZAA 4I0WA 1BQXA 2KT5A 1GK8A 1TELA 2FVCA 1XMQF 1LFPA 5KT7A 4ED4A 3QATA 1RTHA 1DHMA 3ET6A 2IA0A 1GEHA 2DO4A 2LCWA 2AEMA 2RHSB 2CWXA 3R5CA 4HI2A 4LR7A 1TAQA 3H4DA 3IR7B 5DG8A 3IBFB 2EG1A 2X1BA 3EXYA 3MWBA 2IBKA 4IRCA 3ELHA 1VLYA 3I4HX 3N79A 1VQ6S 3EZUA 2E5HA 2R4FA 3FQKA 4TLRA 4K2XA 4NA3A 2FC8A 2BE2B 1VBZA 1LK5A 3OT9A 4MH8A 1UETA 1ZM2A 2WZ1A 4KYZA 1Z4UA 2GJFA 3IS9A 3M8PB 1KS2A 4L3NA 1YRXA 3MCNA 4ZA1A 2OMOA 2Z0GA 3D67A 3ISND 2BYCA 3B82A 1N5YA 4J9RA 5JMNA 5RUBA 3M6UA 1FTCA 3BN7A 2XO6A 5KTQA 1N5YB 2XMJA 2IA6A 2ZNYA 1VRUA 3D3CJ 1NU4A 4FXVA 1KLNA 4H4KC 2FJAB 4OIXA 1LNQA 2AJ2A 4CT9A 2MKIA 2B8QA 2V8VA 2BV3A 4LBHA 3NXZA 3A1YG 4B3RJ 1KFSA 3T1HJ 2VZ9A 2AHOB 1P8GA 3B4MA 3LP1B 3LUYA 3TVYA 1WC3A 5IV4A 3NGDA 3MUVP 2DHXA 3PDNA 3KHGA 4C4WA 3H98A 1KD1T 1YG0A 3LP2A 3NAIA 4KQZA 4DPOA 4F0HA 3TZYA 1BQNA 1BC6A 4PWWA 2LEPA 2APOA 4C11A 5DETA 2E44A 3MM5B 2DNYA 2BQRA 2RVJA 4QQBA 4F26A 2HFOA 3HVTB 4QU7A 1VQMS 5D0EA 5K14B 2PEBA 1IBLJ 1NZAA 1FXLA 3FK4A 1JLAB 1KBRA 2BBEA 1S0VA 3HPOA 2BJ1A 5EDWA 2QA4G 2UUAF 2AD9A 3KLFA 2WOMB 3MR6A 3VAFA 4C8YA 4L6V3 3PKYA 3ET6B 2HAFA 3OBIA 4MJKA 3DGPB 3AB4B 1HBMB 5CHCB 1TV6B 5ETQA 3GG0A 3RW7A 4CM0A 5L9NA 3G6XA 1T05B 1QUPA 5J2NB 3H2LA 2CZVC 1FWKA 5JXSA 3UW1A 2KO1A 2LDYA 1HA1A 1RT3A 2V8GA 2RNEA 3M7VA 4KGZB 4HDGA 3W2VB 3X1LB 2FQQB 4R5PA 2UXDJ 2HBZB 2GC8A 1VRTB 2J0XA 1IKWA 5L1IA 1UVLA 1S6PA 3G86A 1G4CA 1NJZA 3TX8A 2OD6A 5MAOA 2XS5A 2Y9HA 1ICEB 5ETSA 4KKOB 4JYAJ 2GHWA 2KM8B 2MHNA 1FRMA 3K0JA 4GKKF 1X4AA 1JJHA 3Q0AA 1TUVA 4KH1B 3U7JA 4DQPA 2B7CB 2R7QA 3MEDB 4ZPAA 4GVBB 3R5GA 3NRBA 3V2UC 5A8WA 3ZO7A 5IZHA 2LVWA 3N01A 3C14B 2J76E 5HQMA 4RWWA 4DCOB 5L1JA 1RT6B 2XZDB 2DH9A 2V2QA 2MLXA 1VQKS 5DLGA 5D78A 1WC5A 2ZJRQ 2V50A 3UR0A 3GE9A 1B3TA 3QPIA 3FBBA 3F56A 4ZVGA 2YQ3A 3D1OA 2F4FA 4WK3A 2C2RA 3J7A1 3B54A 4ZKAA 2CAJA 1N4LA 4LF8F 3BB5A 4WFBQ 4ECSA 4QWCA 1SV5A 2CJQA 1U2RA 3JQJA 4PWDB 3K5OA 4FVMA 4U8YA 4DS5A 5D4OA 4A8KA 1PO6A 3H0PA 5GADU 4X65J 2DEJA 5KG5A 1XERA 3PIOQ 1WF2A 4LVNP 1N34F 4RW6B 4G65A 2Z30B 2K1RA 5I42B 4M1KA 2HHQA 2WRMA 2AMCB 3MDFA 4DR6J 1EETB 2HIYA 3QWUA 1M1GA 2GAGC 4C98A 2C3OA 1RT1A 2P9CA 1M5VC 4XO0A 4CO0A 5DGAA 1H72C 4C48A 1XR7A 1Q81T 2Y8WA 5DJBA 3QRRA 2DRDA 4DR7F 3NLCA 4K0KF 1XIQA 2CPIA 4LF8J 1NK7A 4B08A 2UVVA 2HWIA 3SCIE 1JXVA 2JLFA 4P73A 4LFAJ 4GO7X 3ZZ0A 3D1HA 3S1TA 5DQHA 2VG6B 3BBBA 5ITHA 3TAMB 4U7CA 1JLBB 1WG5A 1S76D 1V9OA 2BKNA 4OYMA 2IFXA 5GAHI 1MWYA 2ZZTA 2VASA 1OSCA 1TUWA 1RBAA 2CDRB 5HVHA 1HQEA 2J8AA 3CIZA 4DL4A 3I6PA 4C8LA 5D77A 2YWHA 5D4NA 4P2SA 3I5BA 2ALZA 2XG8A 3MMBB 4DSEA 1JMTA 3Q8YA 2A10A 5DG7A 1CJVB 3EGVA 3PZPA 3BH6B 2LFVA 2VBXA 4MK7A 3H25A 4OQJA 3P49B 1N34J 1S1VA 4M5LA 2GIFA 4QR0A 5KFJA 2FVRA 2UXDF 4FS2A 3M2VA 4Z7CA 2GQCA 5H1SV 4NLDA 2FVQA 4LSNB 1JJ4A 3UN3A 1S6PB 3AD9C 3PG9A 2JRSA 3CDUA 1IKWB 3M32A 3V6JA 1IWGA 2NUHA 1HBNA 5EN1A 3J7YI 5IWAF 1FD8A 1EARA 2DXFA 3KK1A 3RB3A 4C7QA 4ECZA 4G3IA 6AT1B 5CD4H 2E5GA 2DD8S 2V9WA 1F5AA 1N36J 1RAJA 3GV5B 1Q82T 5LMUF 2B56A 4NEYA 3E51A 4U8VA 4L73A 1U6FA 4FN5A 1IKVA 5IOLA 1U6ZA 1GT8A 5F9NA 3KLFB 3HFZB 3J80U 4QWDA 3RR8A 3RBDA 1VGYA 3OVSA 4LJMA 1LWEA 3D6FB 4ZCMA 1JLAA 4OI3A 4DLGA 4CLYA 3W8GA 2Q3PA 5U47A 3OD2A 2QZ8A 3UDLA 4WJBA 4OI1A 1UPMB 4F4KA 1SQFA 3KXDA 4Q2MA 3ZXWA 1E6VA 2B5JA 4DV0F 1QSYA 3WQPA 4G6VB 5CAAA 3GJTB 1F60B 2Y0SD 1NHVA 2OHDA 3PNIA 3DNCA 4HHUA 3KMSA 1JK9B 4ZVQB 4HVZA 3Q2TC 1JWWA 1Y0HA 3DRPA 3CD5A 2LXUA 3CDBA 3EE3A 1Q8KA 4ETXA 1VQYA 4FF1A 4CTAA 2CQ0A 3ILOA 2XSFA 2VC0A 5AT1B 3G87A 4P52A 3UD5A 4CYUB 4M8LA 3IO1A 1JLCA 1FRHA 3I5CA 4OHVA 4QOTA 3QSIA 3CCMS 2YNFB 3C19A 1KSPA 3MMBA 4U7UD 2RKIB 2BW2A 3JSBA 3U27A 2CPZA 1M5SA 2CQCA 4NA1A 4DPUA 4W4MA 2B9WA 2CJXB 2ZOMA 1WKKA 2NXUA 1PJ5A 3A8IA 4TQSA 2FLPA 2UUCF 4DQIA 4RU9A 5T41A 2MGZA 1RJJA 1JB0C 2X3GA 1U1KA 2CQPA 4UY8T 2ZC3A 4FYYB 4DN9A 4F2SA 2CYYA 3IFEA 2XMTA 2Y1LB 1OYEA 3TUIC 4ZIWA 4LRFA 3TJ8A 4OZ0A 2WSCC 2HHTA 2VG7B 2BABA 1R0AB 1RTZA 1PYOB 1XK8A 3O5TB 2Z57B 1CSJA 3VAMA 1J5OB 1SIZA 5B0BA 3N4WA 1NBEB 2UVUA 1PCAA 1EKSA 4NA2A 4ZCKA 4J9PA 4ECVA 2XCPA 1QSLA 4C0OC 1RWWB 2QIFA 3PV8A 3ISNC 1UEVA 3OR1B 4RX6A 1X4CA 3ZNUA 3RAQA 4ECXA 1WDTA 4WP3A 2FGCA 3T9ZA 1XMOJ 3MEEA 2V94A 1H98A 3P45B 1FXRA 3BO3A 3B4DA 4IFVA 2DITA 2JEIA 4UZBA 4UOCA 3GIKA 3SV4A 4DPXA 3BM7A 1K0VA 4RZRA 3C8YA 1HW9A 1VS3A 2VDHA 4CLZA 1OYDA 1ACMB 4OJ3A 1SV5B 4ZS6A 5DDRC 4EBCA 4USIA 1WOSA 5HL7Q 2R8KA 2QLJB 3PCOB 2CPYA 3W2WB 2XO7A 1NK4A 1FNMA 5FLXY 2BQ3A 3T6BA 2JJ4D 1XTZA 4YR0A 2BUNA 1UWAA 2MXYA 1HW8A 1Z2LA 2HNDB 1LQ9A 3EVMA 4CZCA 4IQMA 1JKHA 4DV7F 2HBQB 3BR9A 3N28A 4DX6A 5ETPA 4C8MA 3C6UB 2E1MC 2DGSA 3CCZA 3FCHA 3TZZA 3GIMA 1U1QA 2FJVA 3GV8B 3KG1A 1VIXA 1JLEA 5DDQC 4P10A 4DN0A 4UOGA 4DV3J 1ZM9A 3I9ZA 1VQ4S 3QRQA 3NMAA 2ZH8A 5EHHA 1WKLA 1JLFB 3QMQA 3SBMA 1TL7B 3VAJA 2YX4A 1JNZB 3W66A 1DJ0A 5ETMA 1FTRA 4ZHRA 2AGOA 1Q86T 4M5JA 3C2PA 1RLCL 4WZMA 3KK2A 1LFWA 4LUBA 3ZFVA 3PEJA 2K3IA 3JYTB 4IO9Q 1TL3B 3AOBA 3IRXA 4DZ6A 2EC0A 2IVMA 2DKOB 1NLKL 4WE1A 5GADI 3WX8A 1OPZA 1B7YB 3IWLA 3ZZZA 3X3UA 4EBEA 1FVQA 5KFVA 2F4VF 3MPWA 2HHWA 1TK8A 3MAQA 2CPDA 1BD6A 2KM8C 4KIAA 2ADCA 2WONB 4HI1A 4B9TA 1CLFA 2RU3A 1HQUA 3LH2S 4K5RA 3RB4A 1FWPA 2O5DA 1MN7A 2Z2LA 3LF0A 4KGKA 4PKDB 1IBMF 4K5SA 2W8KA 1QM9A 2DGQA 2OP5A 3W5ZA 3OLBA 1BQMB 3BPSP 2AYGA 2KHCA 2CZ9A 1N54B 2YQ0A 1F9FA 2BEFA 2AEJA 4NWBA 4F3MA 1RTIB 4RNNA 5B0EA 3LP1A 4DU8A 3G6YA 3D6TB 1HWUA 1WTFA 3ULHA 1RWKB 1ZYQA 1HMVA 1YWXA 3BGUA 5BR8F 3AH6A 1FX4A 1HR0F 3AA9A 5J2QB 1FDNA 1R6YA 2W9CB 2MLZA 2JEJA 3D54A 5L9XA 4UZCA 4HH1A 4CQ1A 2D9OA 4E8UA 2ERRA 4BDPA 5KG0A 2YY3A 3DI6A 4J9QA 5LSOA 1FX2A 3M8QB 4FF4A 5KG3A 4DBQA 2QA1A 2FHJA 1AT1B 2BRKA 2VKZG 1RAHB 4L76A 4JI2J 3FZ2A 4FBUA 1KTVA 3HHLD 2OELA 3OTDA 3MOZA 4NI2B 2LQBA 4KTQA 4X64J 2FB0A 3ZTOA 1Z1ZA 2KFNA 4QJVA 1YZ6A 3BDEA 3RGIA 4ES3A 4PG8A 1J27A 2R7XA 3EGNA 3MECA 1F3VA 2R7RA 3K57A 2VA3A 1GH8A 3DLGB 7FDRA 1QAJA 3L95X 3JTOA 1CJKA 1RWOB 4WXOA 1A0OB 1TVRB 2B43A 2DY1A 4BWJA 3FC9A 3MPUB 1U1MA 1M0SA 2RH3A 2UUTA 3PR4A 5L1LA 1FE4A 2AV5A 4J9NA 3T1HF 4ENOA 4Y34A 4RW8B 1LXNA 1TL5A 4JI4F 2V68A 2HRUA 3SSQA 5K8MA 3AOAA 3C16A 4DV1J 3DLBA 5D4PA 4RNFA 5CD4A 2NPIA 2HWTA 4LR8A 3PX0A 2CG4A 3Q8PB 2B9EA 2LEAA 2HZVA 3CDAA 4YN3B 1N33J 4OI0A 2D1CA 3C15B 4ICLA 1HNWF 3S6EA 4JI2F 3CEDA 1VMBA 5KFHA 2MYFA 3J7Z5 1F5CA 2OPPB 2YH1A 2YPZA 3KLHA 1UFWA 4ANDA 5BYSA 1HWJA 1VC6A 4KGXB 4ZMMA 4F4XA 4LF7F 1NK6A 5ETRA 3MR7A 2AGPA 1CJTB 1QVGR 3T19A 4JI4J 1G1XA 1VRQC 3BQ1A 3DU5A 1SKSA 5A8RA 5DGBA 2BZ2A 4ECQA 2E1CA 1CULA 2E1RA 1Q78A 1S4EA 3FFIB 3IRXB 4OZLA 2BJ9A 4QIVA 3W62A 4IDKA 4MKAA 3KDOA 1N33F 2V2KA 3MM8B 1UEUA 2MDAA 2NPFA 4IDKB 4P2MA 5CABA 2HNYB 1YRTA 2XHWA 1M1HA 3AT1B 3HJVA 1YX2A 3PFEA 4ZK7M 3EYZA 1S6QA 1RT6A 4WTYA 1R0AA 1DTQB 2XC9A 3ENQA 1K8AT 1YGYA 4LRBA 4O44B 4ES2A 1Q8IA 3CD0A 3CIMA 3VZIA 1FFGB 1NO8A 3W9JA 3SI8A 2OAUA 1S0MA 3HULA 3VCDA 2AJ4A 4MAKA 1B70B 5KFQA 4FYWB 3J81j 1NPPA 1B0VA 3HX9A 4HR2A 2R2UA 1C0UA 5F8IA 1FO1A 2WVCA 2W1BA 2ZFHA 5LOQA 4FKXA 2ZH1A 4LF4F 2HAIA 4F02A 3OVBA 2AW0A 2YWWA 5HQ8A 1AROP 3HVRA 1F0XA 4LF6F 1SCJB 2W4DA 3JQKA 3Q8RB 4K4TA 1UJ5A 1JX4A 1H38A 5E41A 2XWYA 3A8EA 4ILMA 3TQEA 3DM2B 2LP4A 2R9LA 2OFGX 4I68A 2NXCA 3U1MA 1GTEA 2M5YA 2P6SA 2CNOB 3C16B 2OO4A 2WTFA 1YJRA 1TV6A 5KFIA 4DSFA 3HJFA 3UR3C 3D1QA 2QG9B 3OFFA 2ILZA 2FVPA 3R7NB 2ZDPA 3Q2SC 4DCPB 3NY0A 3MCOA 2VOPA 4KY3A 3KG4A 1AA1B 1NK9A 4ZP8A 4A46A 1SJQA 4WBFA 2F7VA 3DOKB 4LQ9A 4QIEA 3AJ2A 3F73A 2U2FA 2DGUA 3UNYA 2L9NA 2R7WA 1X4HA 2E7XA 1JNRB 2XZTB 3IN5A 3DDKA 2E1PA 3MM5A 1LK7A 1KKHA 4NRTA 5HATA 4LFAF 3SDEB 2V34A 4XTTA 2J6UA 3EDQB 4IFYB 4EUVA 1FWLA 5J2MB 3HSJA 4OYWA 1U1OA 2ZE2A 2M2BA 5CZXA 3K17A 4ED8A 4O3PA 1FJEB 4L74A 4ES1A 2L9DA 3POTB 3PM9A 2RAQA 5M2UA 4B3OA 4DX5A 3EM1A 3KHLA 1NZ8A 2W24A 3U1NA 3DDNA 1ELOA 1UWBA 2OPSB 4JI3F 4HHHA 3EZ5A 3UD3P 2UVWA 2W9CA 3THVA 3IA0A 1FA0A 2D9PA 4DR1F 2WCXA 5IC6B 3PW4A 1VQ9S 3DN9A 2BOPA 3NGTA 2I5JB 4TXSA 2IMOA 5F8MA 3FEZA 4NMLA 5IM0B 4DR7J 4X64F 4PXEA 5F8LA 3TUJC 4NZ7A 4DV7J 1V5IB 4ZLNA 4A8QA 3OL6A 1N8RT 3W60A 5FJ4A 3ONQA 4I56A 1W2IA 4AL6A 1EB0A 3CT9A 2UV8G 2CQ2A 2VIHA 2C1EB 3IG1A 3DRPB 1YJTA 2OJ3A 5JJBA 4MMOA 5F8JA 1SJRA 2XMKA 2OPRB 5AJ3J 2EI5A 5KFNA 3OQ2A 3PVXA 4WYWA 4JI6F 2J6SA 2HZAA 2XMWA 3H20A 2HNZA 1D09B 1RACB 1NB2A 2GZOA 2JOQA 2DGWA 3FBCA 1RTHB 5D0HA 5ETNA 3UN2A 4USMA 6FD1A 4QU6A 2XNQA 4ZHRB 3EVOA 3Q8SB 1SL2A 4NXNJ 2ZKTA 3OJUA 3HKWA 4OX8A 3M30A 4F7VA 4NCGA 3BGOP 5KT4A 1ZAVA 1SKUB 3C46A 4M94A 2CZ4A 5IT9U 1NUEA 4ZLPA 4DR1J 4ZJQA 1IM4A 2CXEA 3RBXA 3NG8A 3D3BJ 2W2NP 4YMEA 2FTRA 2OPSA 1SQEA 1T7PA 4Q8EA 1WG4A 4ZPBA 3D7SB 4N8NA 1YSJA 2V67A 2D3O1 3V6KA 1EZZB 4ZVOB 1N48A 3POTA 4KV8B 2XTJP 3KLGA 1RCXB 4LSNA 4WFZA 2Z8QA 1SXLA 4TLQA 3R3TA 3UCGA 1L3VA 1XNRJ 3MEGA 3D5MA 2DGVA 1MU2B 2PGCA 3M9MB 2YNGB 3BO4A 5F0WA 3ISZA 5I3QA 1S5ZA 2A3JA 4IH5A 3TQ1A 1CJVA 3RB6A 2PA8D 5EX3A 3M6WA 2CNKB 2FJXA 3DOKA 1S10A 3H42A 2YTCA 4C97A 4GVLA 1BE4A 4I2QB 2G9OA 4PG5A 1HYSA 2ZC4A 1EHWA 4LBPA 2OH2A 4PUOB 3NEKA 4R0EA 5HO4A 2HYIB 5CYMB 4EFAC 4ED0A 2LA4A 3C3LA 1LW2B 1TUGB 2CG8A 2CQHA 1VBKA 4OYPA 3MAAA 3UN5A 2C2MB 3FMWA 2G4BA 5KFGA 4EMDA 3CW2C 1WEZA 3OUYA 2YNHB 1HD1A 2G13A 2V8HA 2LQ9A 4C0BA 4DSKA 2RUGA 2A0FB 4RW9B 3Q24A 4DI6A 2H48B 1QY7A 3CJ2A 3MMAA 2GHPA 3E01A 4PPDA 3ZTQA 2H1YA 2OTJS 1ZAXA 2X7IA 4TYAA 4RUBA 2OKQA 2ZD1A 3CCTA 4EEYA 4JI8F 1JJ2R 4K2JA 1NMEB 1LWFA 1QTNB 3GSIA 3Q8UA 3KLEB 2D41A 1TK0A 5FDLB 3VR1A 5I42A 2DH8A 4WP8A 1F9HA 1DZ5A 2IMWP 4YR3A 4DV4F 5HMWA 3PW0A 2KT3A 3TZWA 2ROEA 2PDAA 4EO6A 4PWDA 2XZWA 3TVZA 2E9RX 2IBOA 2LLZA 4X2BA 3GCXP 3SSSA 1RWXB 1WSVA 2D74B 4DV6J 2ZVSA 2DCUB 4K0KJ 1ZBTA 2WW4A 3TYTA 2YWGA 4CH0S 3HLUA 2R7UA 2XY6A 3M2RA 2PMWA 4O3SA 3M4XA 3OFHA 2PC6A 2YKOA 4AXIA 5HN0A 1UVJA 3I0RA 4IKAA 3RZAA 4PAAA 3VZHA 4K4YA 2CPXA 1CQNA 3QIDA 1VR6A 2BM1A 1HBUA 5KFKA 3L09A 3DRSB 4YB5A 4WU3A 1RHUB 1XR6A 2HPUA 1W25A 3I82A 3T1YF 3HHLA 2EFVA 1ZTWA 1D8YA 5G0RB 2ZZMA 2NQPA 4KRWA 2PFFB 1TK5A 2J9DA 3DYAA 1GQEA 1T03A 3V4IA 5KFXA 1O5JA 2MKKA 1UW4A 3HKZD 1ZA2B 3N5FA 3LQVA 2GO9A 4ECYA 4K4ZA 3J7YU 2R42A 2ASLA 3TUPA 4PYAA 2EPIA 2CQ3A 4P6QA 2KXFA 1X4DA 4PCQA 4KHPJ 1N6QA 4W90B 1IKVB 2AJ1A 5CYQA 2HVIA 4J9VA 3S8SA 5CQGA 2DNMA 4EGLA 3LWLA 1TTHB 5F0UA 3S01A 3VGSA 5I3UB 1TL4A 1T9XA 5DRKA 4X66J 4ED1A 5HI7A 2DNGA 2HGNA 2W2QP 2V4QA 2V63A 3LGHA 4JV1A 2VG5B 2AYBA 1HPZA 3JS9A 2FLNA 3TA0A 5KFTA 1I94F 1DARA 1F3FA 4UOHA 3O1LA 3IG1B 5SZTA 4I4BA 2BKOA 3IBCB 2ALYB 2XULA 2IAJA 2MHEA 1HWLA 3KLVA 5G0RA 3HD2A 1IXKA 1S1VB 2RD5C 4O3OA 1CBKA 2EKNA 4NZ6A 5GVQA 2IIHA 1C1BA 2FHKA 3DRXA 2BM0A 2YKPA 4ZVTB 4U7UK 3RAMA 4NX9A 4QYRA 2V0NA 4JI8J 1REGX 4WFYA 3RUBL 4D3HA 1C0TA 2NS1B 1PBUA 2AX1A 5B0GA 5KFAA 3H7HB 1S1UB 1Y3KA 3KJQB 3BF4A 3M2RB 3VF0B 3WC0A 3GILA 2ZZNA 1VK3A 2X1GA 2NSBA 2WVBA 1H3DA 2F8HA 3QBCA 4FNHA 2EFOA 1SH3A 3BR8A 3K8WA 3I96A 7FD1A 1HBOA 1VYAA 1RK8A 1K1SA 2B4PA 3I0SB 5BXIA 4LFCJ 2AZ1A 4DPTA 1G2EA 3W5YA 4Q7AA 9RUBA 2W7AA 1U7LA 3CCLS 4B3OB 1KR4A 4M5NA 2GW8A 1VJQA 1YBUA 1XNQF 2LU2A 2C3MA 3CC2S 3PHEA 5J2MA 1RT1B 2QSFA 2OPQA 4DUZJ 2J8SA 2R8HA 2WHOA 1NK0A 2UV8A 1RYRA 4USHA 5C25A 1T03B 4FP9A 2LDIA 1MSWD 2KG0A 2K1RB 3U1LA 3JTPA 2GA7A 5KT6A 3HD1A 2KDOA 1X5OA 2JVRA 1RWPB 5EGYA 2V4RA 2MY7A 4DQRA 1EKRA 2BX6A 4RW9A 4U67Q 3MFIA 1SBRA 1XNRF 2VU5A 3AB2B 2MSTA 4G1QB 3DRRA 4YS2A 4BHQA 2RUSA 4CWBA 2GJ2A 3SIPB 1KHWA 1IBCB 1RADB 2KHDA 2KYXA 2QMWA 2RRNA 3GTYX 3DGVA 4ZCLA 4MYUA 5KOWA 2HHSA 2HFZA 4F04B 4U6PA 1N5SA 5A6WA 4QWEA 3TEHB 1IKYB 2Z2ZA 4NXMF 5HAOA 2FY8A 1PJ6A 2B8PA 4LSLA 1ZOTA 2XY7A 1VHIA 1M1KT 4LF7J 1RLDA 4DU7A 1NJXA 4QPXA 1OPIA 2DIUA 1DQAA 2NXJA 1VQSA 1ZH5A 4CIOA 3B8HA 3OHBA 1YRUA 5DDPC 1V3SA 2EWHA 2W2PP 3FRZA 5HLFB 2H5JB 4LFBF 4PG7A 2YNGA 3Q86A 3QYYA 4JOUA 4ECRA 3L7UA 3OTOJ 4M95A 4ZITA 2KTQA 3CNQP 1I6JA 2ZITA 3C6UA 3CTRA 4QIWD 4ELVA 2LYVA 1HL6A 2BJ3A 2XMMA 4DLEA 1D9AA 1AFIA 1HNVA 4RUCA 2BANB 4OFZA 3UI3A 2NLWA 4DV1F 3CC7S 5KT3A 1I51B 1B7FA 2F3JA 5JVHQ 4RU2A 3TA2A 4LRDA 4O3QA 5CZVA 2MQMA 4LT6A 4CT8A 1RAAB 3UO0A 3HT3A 1N52B 4ELUA 1TKXA 3AXMA 3CDWA 1Q4RA 1VBXA 2JWNA 3UQSA 1T9VA 1FJCA 2KL8A 5KFCA 3HM9A 1D1UA 5E3AA 1FF2A 2QFJA 3G82B 1NK8A 2F8MA 4ZCIA 3LALA 4IG0B 3KJVA 4B9NA 2XLKA 1AXQA 2OPPA 1JXEA 4C11B 1U45A 1SUQA 1S1XA 3UVJA 1NDCA 2DISA 4Y0FA 1Q79A 2K2PA 2KZZA 4H4MA 4OHYA 2FJWA 4QIGA 1M5PC 2GQ2A 1NSPA 3KJNB 2R8JA 2RDJA 4O4RA 4OX6A 5DM7Q 4K4UA 3M9NB 1S6UA 2X3DA 2DNPA 3MM6B 4I7FA 4M5DB 1YJ7A 2MKYA 1YJWS 2UU9F 4WP9A 2KKHA 1UVKA 4DL0C 2VD3A 1IKXA 1RU1A 2FD2A 1KQGB 1TVRA 2D3UA 2UP1A 1M5OC 2NZ4A 1UJ4A 5E3RA 1U2FA 2MEWA 5KFOA 1JLCB 5CA5A 2KXHA 3IS9B 3M8PA 3UDCA 1NSKL 1RT4B 3L4BC 3VGTA 3PR5B 3P5TL 1S1UA 3QGGA 4WKYA 3R2DJ 4BBYA 2BW7A 1KLMA 2F4VJ 5IC4B 3WC2A 4QCLA 2I38A 3QNWB 2QSWA 4A8XA 3D9BA 1P1LA 4ZVSB 3GIJA 2CFXA 3JYTA 4EZ9A 4KJIA 1K0TA 2UXCJ 1YIJS 3H8YA 3LOUA 4OZJA 3TJAA 1H2UX 2AWZA 2M9KA 4KHMA 2QX0A 4DL2A 3DLHA 3K89A 1HHTP 3GQCA 1NHKL 1YJVA 2PD1A 4ID5B 3MXHP 3D66A 1FERA 2NSCA 3JSMB 1VQ5S 2RHQB 5AXLA 2KN4A 4IG0A 3KJVB 2J0SD 2JEFA 4JYAF 4HLBA 4F4WA 1FNXH 2VICA 3TARA 2VB6A 1N5TA 5AXNA 2CNNB 4TNOA 4V19X 3E2EA 3HI9A 4JI0F 2Q43A 3NAHA 3U02A 4IOCQ 4QYZJ 1F6TA 1IR0A 3KUEA 1H73A 2ASDA 1B64A 1P27B 1RHKB 1G3OA 5KG7A 4ZPCA 4UY85 4A47A 3CJRA 4YHHJ 3G6ES 2XI3A 2OD4A 2HLTA 1Y7PA 3PJ9A 3G71S 2IVFB 2B9XA 2NXNA 1R6VA 5HQLA 4AQYJ 5AE3A 2YWEA 1SC6A 3N9UC 3DRSA 5A76A 1FDBA 5L8RC 3M32B 5B08A 3RBEA 2DNOA 2CJAA 2G0JA 2JDJA 1X60A 3D68A 1GMWD 3EJMA 4NCAA 5DO2A 2KG1A 5KFDA 3CJSA 2LXIA 1NSQA 2H3EB 4WKRA 3J81Y 2QT7A 4I2PB 2HQIA 3K5PA 3M8WA 4C8ZA 1RWUA 3OSPA 4NL5A 2WB4A 4TYBA 3IM9A 5K9FA 2N3OA 1IVZA 1TKZB 5DS7A 2K06A 3I0RB 1PC5A 3WZ0A 1WHVA 3NBPB 5E2QA 1HQEB 2H9ZA 3TAQA 1TKZA 1U6BA 1VQNS 4RJVA 2PIIA 5K8PA 2VFUA 1V3ZA 3BH7B 2UUBF 1FJ7A 2FC9A 1CS4B 1IBLF 3LO3A 3ZZPA 2M8DB 2ADBA 3O8WA 5HBMA 2AYEA 4CH7A 2GVZA 2VG6A 3LWMA 1TZ0A 1X5SA 2FZCB 2V2ZA 1O8BA 1FK9A 2VH7A 3ZZRA 4B17A 4CP5A 1FJGF 1DLOB 4DQSA 3A3PB 4PG4A 4X84A 4N7TA 5KFUA 4C8KA 2Y1JA 4YY3J 2HHHF 2QEXS 2L48A 3TW0A 3W61A 2HNDA 2ZH2A 3CMAS 4DXLA 2RDDA 3OTCA 1VC0A 4DR2F 2DHSA 4ZP6A 2HHPA 3BBFA 1NEEA 1QLNA 1S57A 2HQ3A 4Y2MA 3W9HA 2UUCJ 1HNIB 1XBWA 2CQIA 3A8JA 1XJWB 4OZ2A 3EXCX 2PE8A 2VPZB 5ETOA 4K4WA 4DR6F 3SFGA 1U8SA 2MZTA 4LREA 1PAEX 2JL9A 3DLEA 5K20B 4RNOA 4ZP9A 1HBOB 3I0SA 1TKDA 5T14A 4IUFA 2XGPA 5CCMA 3CC4S 4F3OA 2DYAA 2BJDA 1KHVA 3R27A 1RWNB 2QYCA 2G0CA 4M63A 3BREA 3FRYA 5E33A 5LM7E 4DSIA 1LW2A 3NCQA 4KT0C 5CYMA 3QT8A 2KH9A 1MU2A 4ID5A 4CM2A 4ZN3A 3MEGB 3UD4P 2ZWOA 2L41A 4E2FB 3GMGA 5GAGU 1S48A 1KQSR 4X4NA 1CPZA 2DJWA 2NREA 2BMBA 4AE5A 3SCKE 1IM6A 5BR8J 3UCUP 4I2PA 4F0KA 2R7VA 1IQTA 4PR6A 3PYDA 8AT1B 2XGQA 5SUHA 4DL7A 3ILIA 3PYEA 4DL6A 4I6AA 4UTGA 4ECTA 1Q16B 4PWUA 1TR0A 3FUYA 3GYNA 5GAEU 5GMKa 1N88A 1OWXA 3TRGA 2FYXA 4CNZA 2MGZB 3HHDA 3OXLA 2G2OA 3V4MA 1XMQJ 2LXFA 5B0AA 3R7SB 3TP2A 3LGNA 2AEFA 1RT3B 2E1AA 1GMWA 3T5KA 1X9MA 1GMUA 1KRPA 3H5SA 2XYHB 4OX7A 4ED7A 5I3UA 2VUGA 1T05A 4A4JA 4BS2A 4F25A 2HK3A 2YVSA 1YK9A 3GJQB 2CUYA 1CG2A 4NLQA 3WDOA 3ZTRA 3W65A 2BR0A 3LA0A 1NKBA 1BY9A 1KQFB 3W9IA 1WHWA 2KFYA 4PRFA 1RKJA 3AODA 3MHYA 1UA1A 3D6MB 1ZPVA 1NPRA 1CJUA 1S9GB 1AFJA 3R5BA 5K14A 4PXDA 3V4IB 1H7WA 3HVTA 4X4TA 1RE1B 3I4PA 2BE7D 4OMFG 1S1WB 1ZS6A 5ETLA 2MLYA 4X62J 3V81B 2BRLA 1E6VB 2B5JB 4ANCA 2PI5A 1FVSA 4JV0A 2QMXA 1FRKA 2V5HG 4DV3F 5FLXU 4DFMA 1K9MT 3HO1A 3TWZA 2DNRA 3BEGB 3JSYA 3T1YJ 1K73T 1RWMB 5G4DA 4X66F 2GVDA 3ENAA 3G9CA 3IRWP 1BHNA 2F8EX 7AT1B 3BQ0A 4W92B 3AD8C 3PO5A 4N76A 4KHRA 3KDNA 4JI5F 2XNRA 1ITPA 1RT4A 3ZZOA 3BKFA 1R8BA 1SJ4P 5IM0A 5EWGA 5EWFA 3D2WA 4RBVA 1FDDA 1HARA 2WVFA 4DG1A 3SEOA 4ZPWR 4O4GB 2J6TA 5KFZA 1U02A 2D3OR 1ZETA 4LFCF 4OLPA 3BGLA 3TEGA 3IBWA 3D0GE 4OYBA 3GV7B 2W9BB 1EIYB 2MZSA 3N6MA 4YB7A 3M8SA 3L7PA 1M5HA 4IFYA 3KLEA 3WIUA 1UCNA 2XEXA 3CVKA 1Y11A 2QFIA 4HHJA 3OVAA 4EYHB 4DFPA 3AXKA 5B0FA 4UQTA 1T02A 4EZ6A 3NS7B 1DY3A 3CGIA 4FYVB 5M2PA 2Y0BB 5HMXA 1WG1A 2H5EA 3E8OA 3VGVA 4LSLB 3MM7B 2DPJA 1AUDA 1WF1A 4LSZB 1S1XB 4ILRA 2JLEA 4ZPTR 5C5JA 2PT0A 3PO4A 3ZTPA 1RAIB 2MKJA 1JLQB 1VCTA 2IJNA 2CQ4A 3DLJA 3AJ1A 1VQ7S 4DQQA 4ED2A 4OX9F 1RI7A 3G82A 4OV6A 2DIVA 2MZ1A 2VC1A 3K59A 4AYBD 2HHXA 1S9EA 2DR8A 5HVFA 1WOPA 2EKYA 1JLQA 2IPOB 4OJGA 3T5JA 3GLJA 4ELTA 1VI7A 2IRUA 3D6HB 2VBYA 1O0PA 3DLKB 2IYIA 2Z56B 1DQ8A 4GC6A 4B9UA 5E3CA 4NYOA 4OLOA 1QAXA 2KB2A 2CVIA 4WIIA 2YWKA 1RZMA 3MEEB 4TN2A 3UDVA 4DOZA 3Q22A 4DR2J 4H54A 5C25B 3BSAA 4Z7YA 4CLSA 5JVGQ 1GTHA 1NPKA 4KPCA 2ROGA 3OR2A 3PW2A 3DM2A 3JB9k 1XNQJ 4O0NA 2R2SA 2FHOB 4CRJA 1G7CB 3GSDA 1SPBP 1L5UA 3FQLA 1AUSL 4RW6A 1BMQB 3OL9A 4O44A 1Y00A 1URNA 2BOAA 2YBVA 3EVWA 2DT9A 3JXOA 1W26A 4A8WA 2VJUA 1RXOB 1OY6A 2ZEJA 5DQIA 3DHXA 3CXCR 2QRRA 5LJ5Y 3KUGA 4M5IA 1RTJB 3NOCA 1I3OB 1X7VA 1GX5A 1QDUB 1Q53A 3MM8A 4X4SA 1IBKF 1BXNA 1UAWA 3L3CA 1MWQA 2R7OA 4CLWA 3I5AA 3MPVA 2QLFB 4RNHA 1DTQA 1CULB 3UCZP 1PYSB 4NLGA 3PRDA 4IYQA 4AL5A 2DGXA 4YEAA 2RKIA 3CUNA 2YKQA 3C14A 5THWA 5HMZA 4ED3A 3NWGA 1YVFA 1PJ7A 4AD6A 5KFLA 4JV5F 1RWVB 4URSA 2KZMA 3VVTA 4MIAA 1RHRB 3FKBA 2KVQE 3HZEA 1HKAA 4FVCA 3BSNA 1P9QC 2HHVA 4F36A 2Z2YB 4WU2A 5A8RB 2AYMA 2AT1B 3BGRA 4UQGA 2ZOFA 1CJUB 2E5IA 5J1EA 1TFYA 1KN6A 3VAGA 1ZTTA 4LRAA 4RKUC 1SVDA 4P9SA 4R8UB 3QGIA 4J91A 5IT4A 2N7CA 4IG3A 3UE2A 4YR2A 1R8CA 2LECA 2QN6B 4B9SA 1TQLA 4ZPDA 4C2MA 2FJDB 2H54B 3H5YA 2LQ5A 1WJ9A 3W64A 3OJSA 1IR2A 3O2IA 3F0NA 4WZQA 2NR0A 1Y5IB 8RUCA 1YDLA 3KWMA 1S0OA 1MN9A 3BJYA 5KFEA 2ZH6A 2ZBRA 4LR9A 4C3LA 1I1GA 1NM2A 5J2PB 2WB1D 5D3GA 1IQZA 1DRZA 4Y2KA 1B99A 1H74A 1SKWA 1DURA 5J1NA 4X4UA 2AX0A 3WBZA 4K4VA 3KG0A 1LXJA 4NE9C 1UP1A 4DUYJ 1HIYA 4A8MP 1NB7A 1D8ZA 3BS9A 2ZOGA 4PXCA 1KVKA 2OEKA 3H40A 2FZGB 2C42A 2RDIA 2IDLA 4OV1A 3KK1B 2MY8A 1S4FA 1BQNB 4IRKA 1NKCA 2RB7A 1RT2B 4J9KA 4QWAA 4DV2J 1Q5YA 1UEKA 2HBRB 3BSCA 1N5VA 2N4CA 4NI2A 3VHQA 2BXJA 4X65F 2MQNA 4KC5A 2FDNA 2J7UA 2HMIA 2BACA 4NZ0A 2XBPA 2JH3A 2HFUA 2CRLA 3PKMA 1KLMB 1VQ8S 2H4WB 3KKFA 4USWA 1PBAA 4X62F 4ED6A 2WSFC 3PHTA 1J5EJ 1S1TB 4K59A 4KBIA 1P9YA 1URRA 4FYXB 1UVMA 3EX7B 1OS5A 1WKJA 4FYDA 3RG6A 2A2DA 3R1HA 2PO4A 3NL0A 4OZ3A 1L3SA 5DLFA 2HVHA 2DNLA 1F1BB 2OI2A 3R8YA 2R2TA 3DI6B 2NYHA 2XI2A 2EEYA 2HS0A 5KFYA 4QR2A 4B9LA 1J2VA 4DSLA 5J2QA 2QLWA 1MNEA 3GJRB 3DLEB 3LTOA 4XDDA 1RAOA 2JNJA 3ETOA 4GMKA 3HDSA 1F2GA 2W4CA 4J9SA 3FEYB 3CMES 2K7KA 1KWMA 1MWZA 1QTMA 2RQCA 2N82B 2QO3A 3N5BA 5K8OA 2KVIA 2EXUA 2N4DA 1DTTA 2VDIA 5KOXA 1SL1A 3HSGA 4OZNA 1XEZA 2Y8YA 4A8SA 1OJ4A 1QSSA 3TR5A 1YJUA 5LXYA 2ZH7A 3QT6A 3I55S 2EFQA 3V6DB 1OY8A 3BV8A 4WK1A 1DAXA 3M05A 4WYLA 3ZC4A 1Y9OA 3IWXA 4BC7A 4OHWA 3KLIB 4DHVA 2ZH3A 2MQ8A 4J7CA 1KNZA 1RDRA 1WOOA 2J0QD 4YDDB 2XM3A 3BKUA 4DL3A 3MOJB 4WE1B 3NBPA 4K50A 1WNEA 1PAUB 3PYGA 4O23A 2ACMA 3BDPA 1HD0A 4CCHA 2VOOA 1SJ1A 2CIMA 4Y2AA 3AHPA 1IJEB 4JB8B 3P4UB 4KO0A 4UUXA 1YI2S 1V5VA 1JLEB 4XPCA 1S9FA 3T5HA 3OTBA 3W5XA 3CPWR 1TP7A 2VONA 3T5LA 1N0VC 3MTJA 2RQMA 5KFRA 2DR7A 1UZDA 2CPJA 2IM0A 3PYFA 4HKQA 1ZPWX 2JFKA 4CI0B 3KLIA 3PXGa 2W2OP 2RRBA 3DOLB 5D4LA 5KG1A 4RW4A 1H6KX 1VC5A 2A1BA 5LJ3Y 1CEZA 2WSEC 3QO9A 5DDOC 2X1AA 3PW5A 3GFXA 3MPDA 2MSSA 3W3SA 3EGWB 2CA9A 1RBLA 3HXMA 2RS2A 5LSLA 4P72A 3W2WA 4A8OA 2A2CA 1V3RA 4ZVFA 4Y00A 1U1PA 3KK3B 1KVIA 3R6LB 2GJIA 4NYZA 3DLKA 2B7BB 5K8NA 4NRUA 1L3TA 1IKYA 3FSYA 3K8VA 2ZHBA 1FJGJ 4LMZA 5EUHA 1J5EF 5F8NA 2AP6A 3LPYA 3T1AA 4C9DA 2E7VA 2ZWPA 3HF5A 3MI7X 3MAAB 4USJC 2DEIA 3CJ5A 4Q43A 2JLGA 2E5JA 4DV5J 1VDHA 2WOMA 5BJRA 5IXUA 2ZJPQ 1WSRA 4DS4A 4DL5A 4NOHA 3FJ2A 4DX8H 1HYSB 3FDSA 1NNDA 2OGUA 3MM7A 1YITS 2L08A 2G2YA 2DRBA 3AA8A 3GR1A 2QTWA 3TVKA 1S1TA 1TKTB 2XS2A 3R5DA 2GFFA 2WAQD 4WFNQ 2VG7A 4DR4F 2D3ZA 5I3PA 5IWAJ 1NK5A 1N5QA 3K5LA 4USTA 4HACA 4NLUA 4N8OA 2H5IB 2HMIB 2R8GA 2P9EA 3GPAA 5L38A 3PJWA 1B4SA 2LQ8A 2W9BA 2MKCA 2UVRA 1HWIA 1K1QA 3IP0A 3THPA 4BC9A 1RT2A 4XDCA 1TMJA 3G2XA 3KFWX 1KFDA 1Y10A 3IC1A 4F67A 3CCUS 1WUUA 4IOBA 2GGPB 4MYTA 4ZVEA 2Y1RI 3SXLA 5GMEA 4KGMA 3GG1A 5LXRA 3J81U 4HTJA 2DXDA 1JLGA 2M88A 2ZHAA 4D3GA 2VPWB 2Q6BA 2F63A 2QA2A 6FDRA 1UW9A 1E6YA 4C3KA 4MIBA 2BJ7A 5D6GA 2A18A 1AB8A 4ED5A 2HVZA 2EFNA 2YPYA 1O6XA 1VFJA 1RA6A 1VIOA 3ITHB 4J37A 4ZP7A 1KTQA 2CADA 4AXJA 4RBTA 2VJVA 2AU0A 2HLUA 3MMJA 4XAKA 3ETMA 2P8IA 4B3SJ 4NASA 1IR1A 4B02A 3K2YA 2DNQA 2DRAA 2M52A 1RHJB 4F50A 4JI5J 2RS8A 5LMNJ 2X1FA 2A6MA 5D15A 2WONA 2MJUA 3N0VA 3FMBA 5ADZA 1S9GA 4N5SA 3MR2A 2AJQA 1FHTA 4H4MB 2XSJA 4V1Ak 1X0FA 3UDEA 4AT1B 2R7SA 2FZKB 1RP5A 2PSZA 4OI6A 3US5A 1NSAA 2CJBA 2QV6A 3GP9A 3LANA 4MKBA 5E3QA 1GXLA 5IQQA 3CWJA 3VVUA 3MEKA 2XLIA 3NS6A 5A2QY 2P2CB 1RYSA 2EBEA 4CLUA 3T3FA 3IM8A 3KK2B 4IOAQ 2GX8A 4NLTA 3QJLA 3ZZTA 4EO8A 2G0IA 4OZ5A 4X4RA 1YHQS 4KFBB 2IVYA 4NLRA 1M5KC 2JEGA 2JSXA 3TI0A 1D3WA 1QD1A 1XQIA 5LSRA 4I1TA 1NJWA 3CMQA 3HCXA 2BJEA 3CULA 5B7WA 1R0CB 3DCAA 1UPPA 2R3VA 5HVGA 2O66A 1WI6A 2DR9A 3GYXB 4LRCA 3NGKA 3KOAA 1PKUA 4IR1A 1OO0B 1C0UB 2V6AA 3T6JA 4O3RA 3NNCA 3B78A 1FRLA 5HANA 4DUZF 4QIFA 2PA3A 2DB1A 2GMHA 4RW4B 1HBUB 3V6HA 3DOLA 3OL7A 1QVFR 5A0YB 4B9VA 1SH2A 3BSOA 1SIWB 3JSRA 3M2VB 2W8LA 3HK2A 5B09A 5B0DA 2HNYA 4X4VA 5K5MA 1NCLA 2UU9J 4Y2IA 2VQEJ 3AJDA 3Q89A 1JLBA 4DF8A 1FRIA 4MIWA 2HFSA 3DRRB 4C8NA 1UZHA 5AJ3F 1VK8A 1S6OA 3ZNJ1 1FKOA 1GXUA 3CJ8A 1N56A 2I9SA 1FFSB 2J7WA 4IFVB 1UVIA 1S9EB 2CQBA 2VFTA 1K44A 1BWVA 2CNLB 4ECWA 1RKIA 4NLXA 4TY8A 5FDLA 1HNXF 4HYKA 4HL9A 4R0JA 4EYIB 4WCEQ 3V6DA 1WEXA 1UKUA 4C6AA 4K7QA 4LIRA 3MD3A 5KT2A 3BO2A 4IO1A 5KAKA 3A3NB 3FVYA 2C2OB 2VL1A 3T9NA 3ENWA 4YDXA 4KH0B 2O01C 3E01B 2Z2MA 3LGMA 1HQ2A 1WC6A 3NGRA 3O6QA 3SCJE 4F4AA 4PYDA 2E66A 4WPAA 4P2XA 1N32F 1MROB 3H2VE 3OUYB 4LF4J 4EWTA 4X4QA 1R0BG 4WFXA 4WWSA 1U0SA 2EVZA 3H5UA 4TY9A 1T9WA 3TANA 5DQGA 4RW8A 4B3TJ 3QWPA 2KJWA 3MD1A 2M4MA 2QLBB 2FVSA 1C2PA 3W7BA 3DXBA 1WELA 4PEOA 1FKOB 4QWBA 3QFWA 4PUOA 3ENVA 4YUDA 3EPIA 4JI1F 2CQ1A 2OUGA 1WC1A 3LAMA 1A6LA 1GX6A 2DNHA 4L75A 3SYZA 3RW6A 1FEEA 1LWCB 5L39A 5EWEA 3KHRA 4DR5J 3HFVA 4KHPF 2MTLA 4F3QA 4TU8A 1G6BA 3G8QA 1YJ9S 4CO1A 2YWFA 1U4BA 1C0TB 2FLLA 2HVEA 2IAJB 3W1YC 3R2CJ 4KKOA 3KMQA 3HHEA 1S99A 3GIRA 5GMDA 4CO5A 1SJ3P 2ACYA 2AZ3A 1HNXJ 4KR0B 2I6WA 1CJTA 4J90A 3MMCB 1Q95G 4LIWA 3KLGB 2ROPA 1VRTA 1APSA 2GCFA 1HWKA 3MEDA 4R5PB 1NAQA 3SQOP 2IM3A 4Z2XA 3CCQS 2QLXA 3CCWA 3S7RA 3UWTA 4X4OA 2VQEF 3HMJG 2OEMA 2DPIA 2M0GB 4MKYA 5KFMA 2ZKUA 1S1WA 4GKKJ 1NH8A 1SC4B 3NS5A 1SQGA 2M7SA 3TO8A 2J9DE 1TMMA 3V5RA 3ICLA 3RU0A 5A8KA 2IYGA 4ZVHA 4HT7A 4XK8C 1AYEA 4M5KA 1ULRA 3QQCD 2C2KB 5D3GB 3KNAA 1OY9A 1RUSA 4PQUB 4ZJLA 1TL1A 1WEYA 2QYGA 4IH6A 1U1RA 2BDPA 3PACA 1SC1B 4XIUA 2A6OA 2W01A 3HVWA 4ILLA 4OYAA 3CB4A 5T7LA 3SSRA 3DFEA 3P3DA 5I4MA 2BQUA 2DH7A 2OPRA 3F44A 3QFHA 5H9EK 4Q45A 2BE9B 5D0RA 4R8UA 2DR6A 1WHYA 2EK1A 1XR5A 1KDNA 3MMCA 4KAIA 4DX7A 2MQPA 3KTQA 2IJRA 3MECB 4KPYA 3BGRB 1R8HA 3K5NA 2B9YA 1NJYA 2ABYA 3CCSS 3DYAB 4ALZA 5KFSA 5GAHU 3OW2R 4P7TA 2WVDA 2E9ZA 2Y3YA 3OL8A 1TL3A 4O3NA 2RQKA 3G4SS 5H9EJ 4RUHA 4K8RA 3VAKA 2YQ1A 8ATCB 4ZJOA 2B3TB 3VTIA 2FJEB 2M3DA 2VV5A 4TKTA 3R6GB 3FSXA 4UT4A 2DHHA 4FS1A 4WXWA 2UUAJ 3IMQJ 5HJYA 3QAUA 1IKXB 1LKZA 1Y5NB 2ATCB 2DY9A 2F1FA 3GONA 2MQQA 2Z4PA 3JAMU 3FEXB 3J7ZT 3CJ4A 2LMIA 2MZJA 2MKHA 2V4JB 4M5DA 1Y3JA 3D0HE 3CCES 2BVZA 1UWBB 2IRYA 5FD1A 2AJFE 2LQJA 2C2DA 3LP0B 4MFBB 1FFWB 1U48A 4I64A 4MT1A 1OQ6A 2UUWA 4GO5X 2W9AA 3MCSA 2YKAA 2IM2A 4DZDA 4C3MA 2ZE2B 1VQOS 1HNIA 2XHCA 1FEHA 2HZCA 4PPZA 2O1PA 3BPDA 2JZ5A 1LWFB 3H59A 3OR2B 2MB0B 2BE2A 1FXDA 1FKPA 2U1AA 3QGHA 3FBEA 4TY8B 4CLPA 3M2UB 3DXSX 2C28A 1T3NA 3QJPA 5AXMA 1DBDA 2PMHA 1HFEL 2P5VA 3Q23A 5D8HB 3CJ3A 3H2UB 1T3OA 1DLOA 4KSEB 1S97A 1FK9B 4HTIA 4CLLA 2YNHA 1S12A 1XMOF 3SZ2A 1P6TA 4JP8A 4RO0A 5CXTA 4OYOA 1CC8A 1MW7A 2CPEA 2VKRA 1ZZNA 1QAIA 2DNZA 4WFAQ 2FHMA 2HS3A 2YH0A 4DFKA 2KRBA 3T41A 4CLTA 5LT5A 5LMNF 4DCJB 3OTOF 2BANA 3CCRS 2ASJA 4OX9J 1HNVB 4LVOP 3M8YA 2DO0A 1FI4A 2YX7A 5J1PA 3KHHA 4FDFA 2ZNZA 3AFGA 5MLCV 3M9OB 4RPFA 4Y3CA 4CO2A 4JI6J 1B0PA 1RA7A 3BN4A 2KRRA 3DOMA 1N0UA 3FBFA 4Y6IA 2W7OA 4N77A 1IUJA 3QO9B 3RBZA 1NJIT 4X4PA 4GRSA 4MK9A 1S49A 2I1RA 2OSRA 3AQOA 4OJ1A 3G96A 2OLWA 4U95A 4GC7A 3NOGA 2C2NA 2RMLA 4OYZA 3DC2A 1R31A 4Y28C 1JKHB 2AF6A 4KV8A 4EBDA 5E0OA 4ZOSA 4FZVA 4NLVA 4NCGB 1FRJA 1U8WA 4F0MA 2B6AB 3EZOA 5ETTA 3MAHA 4N56A 2N3LA 5IV3A 4Q5VA 3QLHB 2AIRB 1R7IA 5HJXA 3CJKB 4DF4A 2J9EA 1X4FA 3R97A 3DGPA 2QA4S 3BYPA 2Q79A 4LF9F 1C1CA 2V9KA 4F4YA 2NYIA 3A4TA 4YP3A 3A8KA 4H4OA 2EK6A 1FRXA 2LEBA 1U26A 2IRXA 2C3UA 2GVDB 2ZH5A 1PC4A 2PFDA 3BGFA 1UVNA 4LFBJ 4ITSA 2MKSA 5DZ7A 1S0NA 4N47A 2E5LJ 1VJWA 1RAFB 4P75A 3F41A 1MG7A 3VQSA 2HNZB 1ROFA 1VISA 1UFKA 2J5AA 1JXLA 5C24B 3L9ZA 4ECUA 2C3YA 4KB7A 2XQCA 2ZVIA 3LP2B 3I56S 4RW7B 1X4EA 3C15A 4ICLB 5E5NA 4A48A 2R2RA 1SL0A 3OSNA 1X5PA 4DV6F 3HP6A 4AUKA 4B3RF 2AKWB 9ATCB 2DVIA 3PTWA 4NLPA 5L1KA 3BZQA 2UXCF 5C7PA 1T9TA 4ATNA 3BQ2A 4CNYA 3MR3A 4U9RA 4JI3J 1S7HA 3MCMA 1X31C 1X4GA 4ANEA 3AD7C 4DWIA 2BJ8A 3B6BA 2B4VA 1X5TA 1VRUB 1HNZF 3N6LA 3OXFA 1FT8A 4RR5A 4C0HA 2GGPA 2F9JA 5DG9A 2IY5B 4J9LA 4IRDA 4BLGA 2MZQA 2WVEA 4PG6A 1QUVA 4LF6J 2HK2A 2XLJA 3KUHA 1U24A 2G1DA 4JI0J 1IJFB 2GQQA 1KEKA 1C1BB 1U0HB 3MM6A 2YKNB 4I7FB 4RBUA 3CDEA 2KXNB 1VQPS 4CYUA 1C4CA 2E5LF 3BKTA 2VODA 2IC3B 4NPOA 3TOQA 4O0IA 1GNKA 2YKNA 3CD6S 1UL3A 5JUMA 4DV4J 5LL6d 1NDKA 2HS4A 1IN0A 2WW8A 5DZ6A 2B0GA 3HHNB 3I9V9 1HNZJ 3UVJB 1HPZB 1SUQB 2HRTA 1U1LA 3SDEA 1UMJA 2JVOA 2HSEB 1EP4B 5F41A 1RSCA 1IBKJ 2W7PA 1KOHA 2PEHA 4FF3A 5T7LB 3GU0A 2Q66A 2RILA 1RAEB 2GO8A 5CYQB 3R5AA 4JBCA 3EPGA 4NLYA 1N6QB 1TL1B 3EWGA 4IH7A 3R9LA 1HMVB 2F40A 4M5GA 3G8SA 1UTAA 4K4XA 1TKXB 2N7YA 3OFGA 5J2PA 2YNIB 1VBYA 3GB0A 3KK3A 3MFHA 1HI0P 2FIUA 3JQMA 4ZVPB 1U2CA 3A13A 4LF1A 3SFUA 2OFHX 4YQWA 2COLA 3JAMY 3MM9B 4B9MA 3NMRA 3MTKA 2H51B 4IR9A 1GMVA 3H90A 2QL9B 3M8RA 2WK4A 3NCRA 3TJ9A 1GXTA 1X4BA 3PEHA 3TUZC 1CQMA 4W98A 3QIPB 1W2BR 4I67A 1KONA 2VFSA 4USVA 2C3PA 2HQGA 2R8IA 3SMZA 1PIEA 1RBOB 2VPYB 2YKMA 3M6VA 3VV2B 5C42A 1FKAF 3EMTA 4H4OB 1Q7YT 4YB1P 1BGXT 5HLFA 2KU7A 5HBMB 3J80Y 2J9CA 3DMJB 2QGFB 1D9DA 4GKJF 4A8YA 1KC8T 1LWCA 2IJFA 2LKZA 4ZVRB 4B3SF 3HHKA 2ZBPA 3QLHA 1DQ9A 2QL5B 4I69A 1NHUA 2LA6A 1WACA 2EFGA 2V69A 4RWXA 2C2EA 3K7RA 2HQDA 4DUYF 4OJHA 3J7AN 3A12A 1A9NB 4ZDNA 4G1PA 1U25A 1WC0A 3E3XA 1WWHA 1BWEA 1F5BA 3PRBA 2RJZA 1WC4A 3ADAC 1U49A 3EICA 1SI9A 2CPFA 2GHVC 3OTEA 1SJFA 4ID8A 1HR0J 3LAKA 5C42B 2HHUA 3O3LA 1Q0NA 5E7OB 2I8EA 2X51A 3O44A 2FHJD 2F5GA 1X9SA 4URQU 3W63A 4DUTA 3FGVA 4OL8A 1PGZA 4LF5F 2M70A 2Q6CA 3HHLC 3KLHB 5HP1A 5H9FJ 2KFZA 2CQDA 5J2NA 1T9UA 2OMLA 2VFRA 2XWXA 3MM9A 3VWSA 2OPQB 1T94A 2CKWA 3TAPA 3TX0A 2VQFF 3KNGA 2ZM6J 1KVJA 4DV2F 2W2MP 2YNIA 4B3TF 2DR5A 5M2RA 4ZLJA 4I2QA 3KYLA 2P6TA 1CJKB 1S7IA 1DFDA 2NXEA 3BBCA 2DXEA 3TNVA 3QZ8A 1R89A 2NCKL 1VQLS 2HW3A 2RRAA 2E29A 3M2UA 4OI2A 1MLAA 4NCBA 3RJMB 1FKPB 3JSMA 3OR1A 1RTDB 3VQTA 3ZZYA 4RLEA 5IFMA 1S59A 2F9DA 3D4JA 2FY1A 4CLFA 4B3MF 1NXIA 1N36F 3DHWC 3DLGA 1LW0B 2ZM6F 3QAEA 4P2FA 4DPWA 4E98A 1X0PA 1LEOA 3A3OB 1YTYA 3MUTP 4Y65A 4ZVUB 2R7TA 4JI7F 1MMLA 4YHHF 1HHQA 4UF4A 2BKPA 2P9GA 4Q2LA 1V6HA 4AL7A 5HROA 1KP6A 2JC0A 3CD7A 4MTPA 1U0HA 2M8HA 4TVAB 2V4JA 4QW8A 4ERDA 2QC3A 5CYJA 1T95A 2DBBA 4ZIVA 1ZZFA 3QSYB 2HFVA 1VOMA 2RQ4A
chains in the Genus database with same CATH topology
3ILJA 5ETOA 3IP0A 1RAOA 1EQ0A 5ETLA 1TMJA 1TMMA 1RU2A 3HSJA 3MCMA 3HSZA 5ETVA 1F9HA 1Q0NA 4M5LA 5ETKA 3UDEA 5ETQA 4M5NA 4M5KA 3HD2A 2QX0A 2CG8A 3HSGA 3UDVA 1CBKA 2F63A 1DY3A 4AD6A 3KUHA 4M5GA 1HQ2A 4F7VA 4CRJA 1RU1A 1RTZA 1HKAA 2F65A 5ETMA 1RB0A 3MCOA 1G4CA 3HD1A 3MCNA 4M5JA 4M5MA 4CYUA 5ETNA 2BMBA 1EQMA 4PZVA 5ETSA 3ILLA 3ILOA 5ETTA 1IM6A 3HSDA 3HCXA 3HT0A 4M5HA 5ETRA 3UD5A 4CYUB 3KUEA 4CWBA 3ILIA 3QBCA 1EX8A 3KUGA 1KBRA 4M5IA 5ETPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ILJ A;  5ETO A;  3IP0 A;  1RAO A;  1EQ0 A;  5ETL A;  1TMJ A;  1TMM A;  1RU2 A;  3HSJ A;  3MCM A;  3HSZ A;  5ETV A;  1F9H A;  1Q0N A;  4M5L A;  5ETK A;  3UDE A;  5ETQ A;  4M5N A;  4M5K A;  3HD2 A;  2QX0 A;  2CG8 A;  3HSG A;  3UDV A;  1CBK A;  2F63 A;  1DY3 A;  4AD6 A;  3KUH A;  4M5G A;  1HQ2 A;  4F7V A;  4CRJ A;  1RU1 A;  1RTZ A;  1HKA A;  2F65 A;  5ETM A;  1RB0 A;  3MCO A;  1G4C A;  3HD1 A;  3MCN A;  4M5J A;  4M5M A;  4CYU A;  5ETN A;  2BMB A;  1EQM A;  4PZV A;  5ETS A;  3ILL A;  3ILO A;  5ETT A;  1IM6 A;  3HSD A;  3HCX A;  3HT0 A;  4M5H A;  5ETR A;  3UD5 A;  4CYU B;  3KUE A;  4CWB A;  3ILI A;  3QBC A;  1EX8 A;  3KUG A;  1KBR A;  4M5I A;  5ETP A; 
#chains in the Genus database with same CATH topology
 4KE5 A;  4FXD A;  1CVJ A;  4O4G A;  2VG5 A;  1FD2 A;  4BWM A;  4NLO A;  3LPE A;  4DG1 B;  5AE2 A;  3Q8V A;  3R5J B;  1Y5L B;  3HVA A;  5ETV A;  3M8Q A;  4TQR A;  3VAL A;  2YNF A;  4P74 A;  1Q8B A;  5A6P A;  1B0T A;  4S0M A;  3IAM 9;  2QE5 A;  1YBT A;  1IBM J;  4JI1 J;  4PAB A;  3L7O A;  2ATL A;  2DTJ A;  2KYZ A;  5KFP A;  3VAH A;  2CDQ A;  3I31 A;  4JI7 J;  1HQU B;  2HQC A;  3QRP A;  1RAB B;  3IGV A;  3RR7 A;  5KFF A;  4N41 A;  4IQX A;  3UPF A;  1ZA1 B;  2DGT A;  2GML A;  2O3D A;  3LW5 C;  4FXW A;  3MR5 A;  5J1E B;  1LOU A;  2MZR A;  1H0H B;  1BQM A;  2EBG A;  3PY8 A;  4B3M J;  1OIA A;  2JC1 A;  5FII A;  3NNA A;  3GII A;  4XPE A;  4F2R A;  5HMY A;  5AXK A;  1C4A A;  5C24 A;  4DR3 F;  3QJJ A;  3HHL B;  2XMV A;  3V81 A;  4P71 A;  1S72 S;  4JV2 A;  4OYI A;  1T0T V;  2AJ0 A;  1RQ0 A;  4FPI A;  4HDH A;  2FJB B;  2EFP A;  2GNK A;  4FKY A;  1P1T A;  3DDI A;  3HSZ A;  3UNG C;  4L3K A;  2Y1I A;  1XC9 A;  2KI2 A;  2EC2 A;  3DKD A;  5KG2 A;  1E6Y B;  2UXB J;  1RAG B;  2PN6 A;  5KT5 A;  1LWX A;  4PXB A;  5IQ6 A;  2PI4 A;  3H5X A;  2XMA A;  2XMU A;  3N6N A;  1S79 A;  1JLG B;  4Q8F A;  2MJN A;  2L3M A;  4AFF A;  3MF5 A;  2RF2 B;  3FNN A;  1HI1 A;  3R1L A;  2B6A A;  3EUN A;  1TL7 A;  3GYG A;  3MPY A;  4DR3 J;  4LF5 J;  3RRK A;  3AOC A;  3IWN C;  5KFW A;  1EQM A;  3I87 A;  2IHR 1;  5D0G A;  2DGO A;  2GMJ A;  3CSK A;  1LV5 A;  1SB6 A;  3TZX A;  1RT7 B;  3GJS B;  1QE1 A;  1UFL A;  3PIP Q;  2HRY A;  5HRO B;  2V2V A;  3QZ7 A;  2PMZ D;  2XS7 A;  1REV A;  1Y4Z B;  2E9T A;  1NDP A;  3DOM B;  2ZD1 B;  2OSQ A;  3P5B P;  2HIQ A;  4TU9 A;  4DJB A;  1SKR A;  2CJY B;  2JHE A;  1LW0 A;  2HG4 A;  4Q44 A;  3IXQ A;  2HKE A;  4UOF A;  1FCA A;  1R27 B;  3GR0 A;  3QGP A;  1U09 A;  2Z58 B;  3ZTS A;  2ZBQ A;  1IWA A;  2KT2 A;  1K47 A;  1AZS A;  2HFN A;  2NUU G;  4USK A;  4U96 A;  4CLK A;  4P7V A;  4CO3 A;  4G1Q A;  1MRO A;  3HSD A;  3M1V A;  3SQG A;  2RSQ A;  2DK2 A;  5BYQ A;  5F8G A;  5GAG I;  2I0X A;  2UUB J;  1EX8 A;  1WHX A;  3QT7 A;  2XYP B;  2XY5 A;  2JFD A;  1AW0 A;  1EQ0 A;  2JX2 A;  3MZI A;  3NKY A;  4C8O A;  4Q0B B;  2GV1 A;  1OQ3 A;  2XB2 D;  5ETK A;  3FCW A;  2HUR A;  1REV B;  4RL1 A;  3W8P A;  4CO4 A;  5C2C A;  1EET A;  5HP1 B;  2CVE A;  1XN9 A;  2NZC A;  2RT3 A;  4NEZ A;  4LF9 J;  2DNK A;  1R8P A;  3WX4 A;  3M8Z A;  4CH1 A;  2V8P A;  1YQH A;  4HT5 A;  3DLL Q;  3P6Y C;  1D0E A;  3PX4 A;  3PX6 A;  1J5O A;  2K8G A;  2RU9 A;  3RTV A;  4FPR A;  1X9W A;  2E7W A;  2F65 A;  3LP0 A;  4MFB A;  4J5O A;  4F4Z A;  2B51 A;  2G1H A;  3H4B A;  4J9M A;  1EAY C;  3ILL A;  2IDE A;  2YX1 A;  4Y2C A;  3NGU A;  4CDI A;  3NWR A;  4KO0 B;  3VGU A;  1NKE A;  2I2Y A;  2VQF J;  4QPT A;  2OEJ A;  2HEK A;  1JIH A;  3CF5 Q;  3GZ7 A;  3FFI A;  3TA1 A;  3VAI A;  1L3K A;  1RGV A;  4CTA B;  2MQO A;  2WBR A;  1TFW A;  5DM6 Q;  1T11 A;  4FBT A;  1NDL A;  3GCW P;  1KQK A;  3UFC X;  5HSP A;  2VA2 A;  3C6T B;  1ZM4 A;  2GIQ A;  5A0Y A;  5BYR A;  1JQG A;  3CJ0 A;  3QIP A;  4G1I A;  4GVB A;  5A8W B;  4QYZ K;  1VHF A;  3DMJ A;  4J9U E;  2K3K A;  2HWH A;  2H4Y B;  4LBI A;  5HK4 A;  2WBM A;  1MMN A;  4YB6 A;  2W25 A;  1QJH A;  2GS8 A;  2YKM B;  1YJN S;  2EW9 A;  1DTT B;  4DPY A;  4YFU A;  3IR6 B;  3PFO A;  1NH7 A;  1XMB A;  3PRV A;  2MPU A;  1U1N A;  2DHA A;  4EK2 A;  3RB0 A;  4NLS A;  3EGZ A;  3D0I E;  3JTN A;  3OFE A;  2IM1 A;  2ZBC A;  4BCA A;  4NLW A;  4I6W A;  2KJV A;  3NNH A;  5GAE I;  4KFB A;  1WF0 A;  1H7X A;  1I5O B;  5LMU J;  5H9F K;  1BUX A;  2ZH9 A;  2CJK A;  3IGN A;  5F9L A;  1ZM3 A;  1EP4 A;  2I5J A;  1EJ7 L;  1R8A A;  1WDD A;  2VBW A;  2VFV A;  3FZB A;  3HZG A;  3IR5 B;  4ZPV R;  1LWE B;  4ZLL A;  3FCV A;  1RHQ B;  3MGJ A;  1RT5 B;  4R25 A;  4RUA A;  4DR5 F;  1S77 D;  2BA9 A;  1GFW B;  2ILY A;  2HBY B;  5A8K B;  2XSJ B;  2K7J A;  1FNO A;  2B4O A;  2FUG 9;  4UUW A;  2HHH J;  3P8B B;  3WIV A;  2L9W A;  3D28 A;  3RAX A;  1M90 T;  1Z2Z A;  3KJF B;  3OV7 A;  4JUZ A;  2C22 A;  1HLW A;  3OXG A;  1F9E B;  2ASY A;  3THT A;  1RB0 A;  2LU1 A;  1HBN B;  3CJT A;  4NMX A;  4QW9 A;  3CCJ S;  3RRH A;  1PIL A;  4OI4 A;  4DMZ A;  2VPX B;  3P96 A;  5KFB A;  4QR1 A;  4KGV B;  3OPK A;  4NYP A;  4WTO B;  4PQU A;  3GFY A;  3ITH A;  5F8H A;  4DV5 F;  4L72 B;  2ZDO A;  4QBU A;  3MUM P;  4NXM J;  2IC3 A;  4PQA A;  3DU6 A;  1RIS A;  2VBZ A;  1JJC B;  3IAS 9;  3M6X A;  4ETZ A;  1RTD A;  3ILJ A;  2FPH X;  2QMU B;  4WIQ A;  2ZHO A;  3GFH A;  5EX0 A;  3AQP A;  4I6Y A;  5KG6 A;  5B0C A;  4URG A;  3EDR B;  4NXN F;  4LQ3 A;  1UJ6 A;  4DSJ A;  1HNW J;  3PJX A;  3OHA A;  3TAM A;  3CE8 A;  2SXL A;  1OMS A;  4EI2 A;  3GFZ A;  1Q1K A;  2B4U A;  1WI8 A;  1RT5 A;  2DNN A;  3CO9 A;  1GAO A;  3Q8Q B;  4AQY F;  1N32 J;  2O67 A;  3G8T A;  1RTI A;  3AAW B;  3NP5 A;  1CC7 A;  2ZBI A;  5CH7 B;  4TU7 A;  4ER8 A;  4H4K A;  1T8E A;  1BLU A;  5IS2 A;  2VHG A;  4RW7 A;  1Q8L A;  1WTB A;  4DR4 J;  2QJ3 A;  2RIJ A;  3HFK A;  4HAC B;  4OHX A;  5IT9 Y;  1O51 A;  2MQL A;  4M5M A;  1D9F A;  1Q5V A;  1R3N A;  1HHS A;  4ZN1 A;  1FDA A;  4FF2 A;  3HT0 A;  4FNI A;  2CWK A;  4IG3 B;  4M5H A;  1TKT A;  3SCL E;  4Q0B A;  2D69 A;  1RHM B;  5IT0 A;  2HGL A;  3MMA B;  1MMD A;  5AE1 A;  1PG5 B;  2OTL S;  1XWL A;  2HVD A;  1FES A;  1YLX A;  2GIR A;  4DEZ A;  1KOO A;  2ZUG A;  3RYL A;  3SQG B;  4E0D A;  4JV5 J;  4MKV A;  4A8F A;  2CJ9 A;  2GVZ B;  1SH0 A;  1WD6 A;  1C1C B;  4HEA 9;  2CQG A;  4LF2 A;  2D7S A;  1U47 A;  2CPH A;  3DRY A;  3FSI A;  1CS4 A;  2H65 B;  3K5M A;  5F3T A;  3NGS A;  4UW2 A;  3K58 A;  2MMY A;  3C6T A;  4EU0 A;  1PYT A;  3I32 A;  1YZ7 A;  3RRG A;  2EG2 A;  1H2T Z;  5CCL A;  2G2Z A;  5A2Q U;  4RNM A;  4WF9 Q;  1S6Q B;  1X8D A;  1JLF A;  2YXL A;  3R7B B;  4DFJ A;  2AGQ A;  3MUR P;  2POK A;  2VF3 A;  3G6V A;  4YOE A;  2ZH4 A;  2C2Z B;  1T9Y A;  3PW7 A;  4OZ1 A;  4PZV A;  2V8D A;  1H2V Z;  1RTJ A;  2HGM A;  3BYR A;  1W7W A;  3CJK A;  4MK8 A;  4Z37 A;  4OYX A;  4YY3 F;  3OLA A;  1HI8 A;  2J7K A;  2J0W A;  4V19 J;  1YBA A;  4K4S A;  1Q7L B;  1YKW A;  5E3P A;  3ZZU A;  2AQ4 A;  4DV0 J;  3SV3 A;  1L3U A;  1RCO B;  1QE1 B;  2Q1L A;  5L46 A;  1RT7 A;  1RU2 A;  3NCP A;  5KG4 A;  3C66 A;  1I94 J;  3QT5 A;  4USU A;  2XCA A;  1TAU A;  2ZJQ Q;  3W2V A;  4DDF A;  1A7G E;  2W4P A;  5C2G A;  1QAY A;  2RF2 A;  4J9O A;  4F8R A;  2FGO A;  4HH0 A;  1ZAW A;  2GAH C;  2XYG B;  3Q83 A;  1VLO A;  2UXB F;  1HBM A;  3GWC A;  3WHI A;  3CCV S;  1WOR A;  2DCL A;  3CO0 P;  1NRK A;  1SC3 B;  1UA0 A;  1TU0 B;  2OIH A;  1OSD A;  1PSD A;  2DHG A;  4GKJ J;  4OHZ A;  3M1V B;  2ZUA A;  1F2H A;  2FLO A;  3CJQ A;  3AY0 A;  3M30 B;  5F3Z A;  4QZV B;  1R43 A;  2QL7 B;  1FE0 A;  2HQF A;  2RE1 A;  1AZS B;  2UZA A;  4I0W A;  1BQX A;  2KT5 A;  1GK8 A;  1TEL A;  2FVC A;  1XMQ F;  1LFP A;  5KT7 A;  4ED4 A;  3QAT A;  1RTH A;  1DHM A;  3ET6 A;  2IA0 A;  1GEH A;  2DO4 A;  2LCW A;  2AEM A;  2RHS B;  2CWX A;  3R5C A;  4HI2 A;  4LR7 A;  1TAQ A;  3H4D A;  3IR7 B;  5DG8 A;  3IBF B;  2EG1 A;  2X1B A;  3EXY A;  3MWB A;  2IBK A;  4IRC A;  3ELH A;  1VLY A;  3I4H X;  3N79 A;  1VQ6 S;  3EZU A;  2E5H A;  2R4F A;  3FQK A;  4TLR A;  4K2X A;  4NA3 A;  2FC8 A;  2BE2 B;  1VBZ A;  1LK5 A;  3OT9 A;  4MH8 A;  1UET A;  1ZM2 A;  2WZ1 A;  4KYZ A;  1Z4U A;  2GJF A;  3IS9 A;  3M8P B;  1KS2 A;  4L3N A;  1YRX A;  3MCN A;  4ZA1 A;  2OMO A;  2Z0G A;  3D67 A;  3ISN D;  2BYC A;  3B82 A;  1N5Y A;  4J9R A;  5JMN A;  5RUB A;  3M6U A;  1FTC A;  3BN7 A;  2XO6 A;  5KTQ A;  1N5Y B;  2XMJ A;  2IA6 A;  2ZNY A;  1VRU A;  3D3C J;  1NU4 A;  4FXV A;  1KLN A;  4H4K C;  2FJA B;  4OIX A;  1LNQ A;  2AJ2 A;  4CT9 A;  2MKI A;  2B8Q A;  2V8V A;  2BV3 A;  4LBH A;  3NXZ A;  3A1Y G;  4B3R J;  1KFS A;  3T1H J;  2VZ9 A;  2AHO B;  1P8G A;  3B4M A;  3LP1 B;  3LUY A;  3TVY A;  1WC3 A;  5IV4 A;  3NGD A;  3MUV P;  2DHX A;  3PDN A;  3KHG A;  4C4W A;  3H98 A;  1KD1 T;  1YG0 A;  3LP2 A;  3NAI A;  4KQZ A;  4DPO A;  4F0H A;  3TZY A;  1BQN A;  1BC6 A;  4PWW A;  2LEP A;  2APO A;  4C11 A;  5DET A;  2E44 A;  3MM5 B;  2DNY A;  2BQR A;  2RVJ A;  4QQB A;  4F26 A;  2HFO A;  3HVT B;  4QU7 A;  1VQM S;  5D0E A;  5K14 B;  2PEB A;  1IBL J;  1NZA A;  1FXL A;  3FK4 A;  1JLA B;  1KBR A;  2BBE A;  1S0V A;  3HPO A;  2BJ1 A;  5EDW A;  2QA4 G;  2UUA F;  2AD9 A;  3KLF A;  2WOM B;  3MR6 A;  3VAF A;  4C8Y A;  4L6V 3;  3PKY A;  3ET6 B;  2HAF A;  3OBI A;  4MJK A;  3DGP B;  3AB4 B;  1HBM B;  5CHC B;  1TV6 B;  5ETQ A;  3GG0 A;  3RW7 A;  4CM0 A;  5L9N A;  3G6X A;  1T05 B;  1QUP A;  5J2N B;  3H2L A;  2CZV C;  1FWK A;  5JXS A;  3UW1 A;  2KO1 A;  2LDY A;  1HA1 A;  1RT3 A;  2V8G A;  2RNE A;  3M7V A;  4KGZ B;  4HDG A;  3W2V B;  3X1L B;  2FQQ B;  4R5P A;  2UXD J;  2HBZ B;  2GC8 A;  1VRT B;  2J0X A;  1IKW A;  5L1I A;  1UVL A;  1S6P A;  3G86 A;  1G4C A;  1NJZ A;  3TX8 A;  2OD6 A;  5MAO A;  2XS5 A;  2Y9H A;  1ICE B;  5ETS A;  4KKO B;  4JYA J;  2GHW A;  2KM8 B;  2MHN A;  1FRM A;  3K0J A;  4GKK F;  1X4A A;  1JJH A;  3Q0A A;  1TUV A;  4KH1 B;  3U7J A;  4DQP A;  2B7C B;  2R7Q A;  3MED B;  4ZPA A;  4GVB B;  3R5G A;  3NRB A;  3V2U C;  5A8W A;  3ZO7 A;  5IZH A;  2LVW A;  3N01 A;  3C14 B;  2J76 E;  5HQM A;  4RWW A;  4DCO B;  5L1J A;  1RT6 B;  2XZD B;  2DH9 A;  2V2Q A;  2MLX A;  1VQK S;  5DLG A;  5D78 A;  1WC5 A;  2ZJR Q;  2V50 A;  3UR0 A;  3GE9 A;  1B3T A;  3QPI A;  3FBB A;  3F56 A;  4ZVG A;  2YQ3 A;  3D1O A;  2F4F A;  4WK3 A;  2C2R A;  3J7A 1;  3B54 A;  4ZKA A;  2CAJ A;  1N4L A;  4LF8 F;  3BB5 A;  4WFB Q;  4ECS A;  4QWC A;  1SV5 A;  2CJQ A;  1U2R A;  3JQJ A;  4PWD B;  3K5O A;  4FVM A;  4U8Y A;  4DS5 A;  5D4O A;  4A8K A;  1PO6 A;  3H0P A;  5GAD U;  4X65 J;  2DEJ A;  5KG5 A;  1XER A;  3PIO Q;  1WF2 A;  4LVN P;  1N34 F;  4RW6 B;  4G65 A;  2Z30 B;  2K1R A;  5I42 B;  4M1K A;  2HHQ A;  2WRM A;  2AMC B;  3MDF A;  4DR6 J;  1EET B;  2HIY A;  3QWU A;  1M1G A;  2GAG C;  4C98 A;  2C3O A;  1RT1 A;  2P9C A;  1M5V C;  4XO0 A;  4CO0 A;  5DGA A;  1H72 C;  4C48 A;  1XR7 A;  1Q81 T;  2Y8W A;  5DJB A;  3QRR A;  2DRD A;  4DR7 F;  3NLC A;  4K0K F;  1XIQ A;  2CPI A;  4LF8 J;  1NK7 A;  4B08 A;  2UVV A;  2HWI A;  3SCI E;  1JXV A;  2JLF A;  4P73 A;  4LFA J;  4GO7 X;  3ZZ0 A;  3D1H A;  3S1T A;  5DQH A;  2VG6 B;  3BBB A;  5ITH A;  3TAM B;  4U7C A;  1JLB B;  1WG5 A;  1S76 D;  1V9O A;  2BKN A;  4OYM A;  2IFX A;  5GAH I;  1MWY A;  2ZZT A;  2VAS A;  1OSC A;  1TUW A;  1RBA A;  2CDR B;  5HVH A;  1HQE A;  2J8A A;  3CIZ A;  4DL4 A;  3I6P A;  4C8L A;  5D77 A;  2YWH A;  5D4N A;  4P2S A;  3I5B A;  2ALZ A;  2XG8 A;  3MMB B;  4DSE A;  1JMT A;  3Q8Y A;  2A10 A;  5DG7 A;  1CJV B;  3EGV A;  3PZP A;  3BH6 B;  2LFV A;  2VBX A;  4MK7 A;  3H25 A;  4OQJ A;  3P49 B;  1N34 J;  1S1V A;  4M5L A;  2GIF A;  4QR0 A;  5KFJ A;  2FVR A;  2UXD F;  4FS2 A;  3M2V A;  4Z7C A;  2GQC A;  5H1S V;  4NLD A;  2FVQ A;  4LSN B;  1JJ4 A;  3UN3 A;  1S6P B;  3AD9 C;  3PG9 A;  2JRS A;  3CDU A;  1IKW B;  3M32 A;  3V6J A;  1IWG A;  2NUH A;  1HBN A;  5EN1 A;  3J7Y I;  5IWA F;  1FD8 A;  1EAR A;  2DXF A;  3KK1 A;  3RB3 A;  4C7Q A;  4ECZ A;  4G3I A;  6AT1 B;  5CD4 H;  2E5G A;  2DD8 S;  2V9W A;  1F5A A;  1N36 J;  1RAJ A;  3GV5 B;  1Q82 T;  5LMU F;  2B56 A;  4NEY A;  3E51 A;  4U8V A;  4L73 A;  1U6F A;  4FN5 A;  1IKV A;  5IOL A;  1U6Z A;  1GT8 A;  5F9N A;  3KLF B;  3HFZ B;  3J80 U;  4QWD A;  3RR8 A;  3RBD A;  1VGY A;  3OVS A;  4LJM A;  1LWE A;  3D6F B;  4ZCM A;  1JLA A;  4OI3 A;  4DLG A;  4CLY A;  3W8G A;  2Q3P A;  5U47 A;  3OD2 A;  2QZ8 A;  3UDL A;  4WJB A;  4OI1 A;  1UPM B;  4F4K A;  1SQF A;  3KXD A;  4Q2M A;  3ZXW A;  1E6V A;  2B5J A;  4DV0 F;  1QSY A;  3WQP A;  4G6V B;  5CAA A;  3GJT B;  1F60 B;  2Y0S D;  1NHV A;  2OHD A;  3PNI A;  3DNC A;  4HHU A;  3KMS A;  1JK9 B;  4ZVQ B;  4HVZ A;  3Q2T C;  1JWW A;  1Y0H A;  3DRP A;  3CD5 A;  2LXU A;  3CDB A;  3EE3 A;  1Q8K A;  4ETX A;  1VQY A;  4FF1 A;  4CTA A;  2CQ0 A;  3ILO A;  2XSF A;  2VC0 A;  5AT1 B;  3G87 A;  4P52 A;  3UD5 A;  4CYU B;  4M8L A;  3IO1 A;  1JLC A;  1FRH A;  3I5C A;  4OHV A;  4QOT A;  3QSI A;  3CCM S;  2YNF B;  3C19 A;  1KSP A;  3MMB A;  4U7U D;  2RKI B;  2BW2 A;  3JSB A;  3U27 A;  2CPZ A;  1M5S A;  2CQC A;  4NA1 A;  4DPU A;  4W4M A;  2B9W A;  2CJX B;  2ZOM A;  1WKK A;  2NXU A;  1PJ5 A;  3A8I A;  4TQS A;  2FLP A;  2UUC F;  4DQI A;  4RU9 A;  5T41 A;  2MGZ A;  1RJJ A;  1JB0 C;  2X3G A;  1U1K A;  2CQP A;  4UY8 T;  2ZC3 A;  4FYY B;  4DN9 A;  4F2S A;  2CYY A;  3IFE A;  2XMT A;  2Y1L B;  1OYE A;  3TUI C;  4ZIW A;  4LRF A;  3TJ8 A;  4OZ0 A;  2WSC C;  2HHT A;  2VG7 B;  2BAB A;  1R0A B;  1RTZ A;  1PYO B;  1XK8 A;  3O5T B;  2Z57 B;  1CSJ A;  3VAM A;  1J5O B;  1SIZ A;  5B0B A;  3N4W A;  1NBE B;  2UVU A;  1PCA A;  1EKS A;  4NA2 A;  4ZCK A;  4J9P A;  4ECV A;  2XCP A;  1QSL A;  4C0O C;  1RWW B;  2QIF A;  3PV8 A;  3ISN C;  1UEV A;  3OR1 B;  4RX6 A;  1X4C A;  3ZNU A;  3RAQ A;  4ECX A;  1WDT A;  4WP3 A;  2FGC A;  3T9Z A;  1XMO J;  3MEE A;  2V94 A;  1H98 A;  3P45 B;  1FXR A;  3BO3 A;  3B4D A;  4IFV A;  2DIT A;  2JEI A;  4UZB A;  4UOC A;  3GIK A;  3SV4 A;  4DPX A;  3BM7 A;  1K0V A;  4RZR A;  3C8Y A;  1HW9 A;  1VS3 A;  2VDH A;  4CLZ A;  1OYD A;  1ACM B;  4OJ3 A;  1SV5 B;  4ZS6 A;  5DDR C;  4EBC A;  4USI A;  1WOS A;  5HL7 Q;  2R8K A;  2QLJ B;  3PCO B;  2CPY A;  3W2W B;  2XO7 A;  1NK4 A;  1FNM A;  5FLX Y;  2BQ3 A;  3T6B A;  2JJ4 D;  1XTZ A;  4YR0 A;  2BUN A;  1UWA A;  2MXY A;  1HW8 A;  1Z2L A;  2HND B;  1LQ9 A;  3EVM A;  4CZC A;  4IQM A;  1JKH A;  4DV7 F;  2HBQ B;  3BR9 A;  3N28 A;  4DX6 A;  5ETP A;  4C8M A;  3C6U B;  2E1M C;  2DGS A;  3CCZ A;  3FCH A;  3TZZ A;  3GIM A;  1U1Q A;  2FJV A;  3GV8 B;  3KG1 A;  1VIX A;  1JLE A;  5DDQ C;  4P10 A;  4DN0 A;  4UOG A;  4DV3 J;  1ZM9 A;  3I9Z A;  1VQ4 S;  3QRQ A;  3NMA A;  2ZH8 A;  5EHH A;  1WKL A;  1JLF B;  3QMQ A;  3SBM A;  1TL7 B;  3VAJ A;  2YX4 A;  1JNZ B;  3W66 A;  1DJ0 A;  5ETM A;  1FTR A;  4ZHR A;  2AGO A;  1Q86 T;  4M5J A;  3C2P A;  1RLC L;  4WZM A;  3KK2 A;  1LFW A;  4LUB A;  3ZFV A;  3PEJ A;  2K3I A;  3JYT B;  4IO9 Q;  1TL3 B;  3AOB A;  3IRX A;  4DZ6 A;  2EC0 A;  2IVM A;  2DKO B;  1NLK L;  4WE1 A;  5GAD I;  3WX8 A;  1OPZ A;  1B7Y B;  3IWL A;  3ZZZ A;  3X3U A;  4EBE A;  1FVQ A;  5KFV A;  2F4V F;  3MPW A;  2HHW A;  1TK8 A;  3MAQ A;  2CPD A;  1BD6 A;  2KM8 C;  4KIA A;  2ADC A;  2WON B;  4HI1 A;  4B9T A;  1CLF A;  2RU3 A;  1HQU A;  3LH2 S;  4K5R A;  3RB4 A;  1FWP A;  2O5D A;  1MN7 A;  2Z2L A;  3LF0 A;  4KGK A;  4PKD B;  1IBM F;  4K5S A;  2W8K A;  1QM9 A;  2DGQ A;  2OP5 A;  3W5Z A;  3OLB A;  1BQM B;  3BPS P;  2AYG A;  2KHC A;  2CZ9 A;  1N54 B;  2YQ0 A;  1F9F A;  2BEF A;  2AEJ A;  4NWB A;  4F3M A;  1RTI B;  4RNN A;  5B0E A;  3LP1 A;  4DU8 A;  3G6Y A;  3D6T B;  1HWU A;  1WTF A;  3ULH A;  1RWK B;  1ZYQ A;  1HMV A;  1YWX A;  3BGU A;  5BR8 F;  3AH6 A;  1FX4 A;  1HR0 F;  3AA9 A;  5J2Q B;  1FDN A;  1R6Y A;  2W9C B;  2MLZ A;  2JEJ A;  3D54 A;  5L9X A;  4UZC A;  4HH1 A;  4CQ1 A;  2D9O A;  4E8U A;  2ERR A;  4BDP A;  5KG0 A;  2YY3 A;  3DI6 A;  4J9Q A;  5LSO A;  1FX2 A;  3M8Q B;  4FF4 A;  5KG3 A;  4DBQ A;  2QA1 A;  2FHJ A;  1AT1 B;  2BRK A;  2VKZ G;  1RAH B;  4L76 A;  4JI2 J;  3FZ2 A;  4FBU A;  1KTV A;  3HHL D;  2OEL A;  3OTD A;  3MOZ A;  4NI2 B;  2LQB A;  4KTQ A;  4X64 J;  2FB0 A;  3ZTO A;  1Z1Z A;  2KFN A;  4QJV A;  1YZ6 A;  3BDE A;  3RGI A;  4ES3 A;  4PG8 A;  1J27 A;  2R7X A;  3EGN A;  3MEC A;  1F3V A;  2R7R A;  3K57 A;  2VA3 A;  1GH8 A;  3DLG B;  7FDR A;  1QAJ A;  3L95 X;  3JTO A;  1CJK A;  1RWO B;  4WXO A;  1A0O B;  1TVR B;  2B43 A;  2DY1 A;  4BWJ A;  3FC9 A;  3MPU B;  1U1M A;  1M0S A;  2RH3 A;  2UUT A;  3PR4 A;  5L1L A;  1FE4 A;  2AV5 A;  4J9N A;  3T1H F;  4ENO A;  4Y34 A;  4RW8 B;  1LXN A;  1TL5 A;  4JI4 F;  2V68 A;  2HRU A;  3SSQ A;  5K8M A;  3AOA A;  3C16 A;  4DV1 J;  3DLB A;  5D4P A;  4RNF A;  5CD4 A;  2NPI A;  2HWT A;  4LR8 A;  3PX0 A;  2CG4 A;  3Q8P B;  2B9E A;  2LEA A;  2HZV A;  3CDA A;  4YN3 B;  1N33 J;  4OI0 A;  2D1C A;  3C15 B;  4ICL A;  1HNW F;  3S6E A;  4JI2 F;  3CED A;  1VMB A;  5KFH A;  2MYF A;  3J7Z 5;  1F5C A;  2OPP B;  2YH1 A;  2YPZ A;  3KLH A;  1UFW A;  4AND A;  5BYS A;  1HWJ A;  1VC6 A;  4KGX B;  4ZMM A;  4F4X A;  4LF7 F;  1NK6 A;  5ETR A;  3MR7 A;  2AGP A;  1CJT B;  1QVG R;  3T19 A;  4JI4 J;  1G1X A;  1VRQ C;  3BQ1 A;  3DU5 A;  1SKS A;  5A8R A;  5DGB A;  2BZ2 A;  4ECQ A;  2E1C A;  1CUL A;  2E1R A;  1Q78 A;  1S4E A;  3FFI B;  3IRX B;  4OZL A;  2BJ9 A;  4QIV A;  3W62 A;  4IDK A;  4MKA A;  3KDO A;  1N33 F;  2V2K A;  3MM8 B;  1UEU A;  2MDA A;  2NPF A;  4IDK B;  4P2M A;  5CAB A;  2HNY B;  1YRT A;  2XHW A;  1M1H A;  3AT1 B;  3HJV A;  1YX2 A;  3PFE A;  4ZK7 M;  3EYZ A;  1S6Q A;  1RT6 A;  4WTY A;  1R0A A;  1DTQ B;  2XC9 A;  3ENQ A;  1K8A T;  1YGY A;  4LRB A;  4O44 B;  4ES2 A;  1Q8I A;  3CD0 A;  3CIM A;  3VZI A;  1FFG B;  1NO8 A;  3W9J A;  3SI8 A;  2OAU A;  1S0M A;  3HUL A;  3VCD A;  2AJ4 A;  4MAK A;  1B70 B;  5KFQ A;  4FYW B;  3J81 j;  1NPP A;  1B0V A;  3HX9 A;  4HR2 A;  2R2U A;  1C0U A;  5F8I A;  1FO1 A;  2WVC A;  2W1B A;  2ZFH A;  5LOQ A;  4FKX A;  2ZH1 A;  4LF4 F;  2HAI A;  4F02 A;  3OVB A;  2AW0 A;  2YWW A;  5HQ8 A;  1ARO P;  3HVR A;  1F0X A;  4LF6 F;  1SCJ B;  2W4D A;  3JQK A;  3Q8R B;  4K4T A;  1UJ5 A;  1JX4 A;  1H38 A;  5E41 A;  2XWY A;  3A8E A;  4ILM A;  3TQE A;  3DM2 B;  2LP4 A;  2R9L A;  2OFG X;  4I68 A;  2NXC A;  3U1M A;  1GTE A;  2M5Y A;  2P6S A;  2CNO B;  3C16 B;  2OO4 A;  2WTF A;  1YJR A;  1TV6 A;  5KFI A;  4DSF A;  3HJF A;  3UR3 C;  3D1Q A;  2QG9 B;  3OFF A;  2ILZ A;  2FVP A;  3R7N B;  2ZDP A;  3Q2S C;  4DCP B;  3NY0 A;  3MCO A;  2VOP A;  4KY3 A;  3KG4 A;  1AA1 B;  1NK9 A;  4ZP8 A;  4A46 A;  1SJQ A;  4WBF A;  2F7V A;  3DOK B;  4LQ9 A;  4QIE A;  3AJ2 A;  3F73 A;  2U2F A;  2DGU A;  3UNY A;  2L9N A;  2R7W A;  1X4H A;  2E7X A;  1JNR B;  2XZT B;  3IN5 A;  3DDK A;  2E1P A;  3MM5 A;  1LK7 A;  1KKH A;  4NRT A;  5HAT A;  4LFA F;  3SDE B;  2V34 A;  4XTT A;  2J6U A;  3EDQ B;  4IFY B;  4EUV A;  1FWL A;  5J2M B;  3HSJ A;  4OYW A;  1U1O A;  2ZE2 A;  2M2B A;  5CZX A;  3K17 A;  4ED8 A;  4O3P A;  1FJE B;  4L74 A;  4ES1 A;  2L9D A;  3POT B;  3PM9 A;  2RAQ A;  5M2U A;  4B3O A;  4DX5 A;  3EM1 A;  3KHL A;  1NZ8 A;  2W24 A;  3U1N A;  3DDN A;  1ELO A;  1UWB A;  2OPS B;  4JI3 F;  4HHH A;  3EZ5 A;  3UD3 P;  2UVW A;  2W9C A;  3THV A;  3IA0 A;  1FA0 A;  2D9P A;  4DR1 F;  2WCX A;  5IC6 B;  3PW4 A;  1VQ9 S;  3DN9 A;  2BOP A;  3NGT A;  2I5J B;  4TXS A;  2IMO A;  5F8M A;  3FEZ A;  4NML A;  5IM0 B;  4DR7 J;  4X64 F;  4PXE A;  5F8L A;  3TUJ C;  4NZ7 A;  4DV7 J;  1V5I B;  4ZLN A;  4A8Q A;  3OL6 A;  1N8R T;  3W60 A;  5FJ4 A;  3ONQ A;  4I56 A;  1W2I A;  4AL6 A;  1EB0 A;  3CT9 A;  2UV8 G;  2CQ2 A;  2VIH A;  2C1E B;  3IG1 A;  3DRP B;  1YJT A;  2OJ3 A;  5JJB A;  4MMO A;  5F8J A;  1SJR A;  2XMK A;  2OPR B;  5AJ3 J;  2EI5 A;  5KFN A;  3OQ2 A;  3PVX A;  4WYW A;  4JI6 F;  2J6S A;  2HZA A;  2XMW A;  3H20 A;  2HNZ A;  1D09 B;  1RAC B;  1NB2 A;  2GZO A;  2JOQ A;  2DGW A;  3FBC A;  1RTH B;  5D0H A;  5ETN A;  3UN2 A;  4USM A;  6FD1 A;  4QU6 A;  2XNQ A;  4ZHR B;  3EVO A;  3Q8S B;  1SL2 A;  4NXN J;  2ZKT A;  3OJU A;  3HKW A;  4OX8 A;  3M30 A;  4F7V A;  4NCG A;  3BGO P;  5KT4 A;  1ZAV A;  1SKU B;  3C46 A;  4M94 A;  2CZ4 A;  5IT9 U;  1NUE A;  4ZLP A;  4DR1 J;  4ZJQ A;  1IM4 A;  2CXE A;  3RBX A;  3NG8 A;  3D3B J;  2W2N P;  4YME A;  2FTR A;  2OPS A;  1SQE A;  1T7P A;  4Q8E A;  1WG4 A;  4ZPB A;  3D7S B;  4N8N A;  1YSJ A;  2V67 A;  2D3O 1;  3V6K A;  1EZZ B;  4ZVO B;  1N48 A;  3POT A;  4KV8 B;  2XTJ P;  3KLG A;  1RCX B;  4LSN A;  4WFZ A;  2Z8Q A;  1SXL A;  4TLQ A;  3R3T A;  3UCG A;  1L3V A;  1XNR J;  3MEG A;  3D5M A;  2DGV A;  1MU2 B;  2PGC A;  3M9M B;  2YNG B;  3BO4 A;  5F0W A;  3ISZ A;  5I3Q A;  1S5Z A;  2A3J A;  4IH5 A;  3TQ1 A;  1CJV A;  3RB6 A;  2PA8 D;  5EX3 A;  3M6W A;  2CNK B;  2FJX A;  3DOK A;  1S10 A;  3H42 A;  2YTC A;  4C97 A;  4GVL A;  1BE4 A;  4I2Q B;  2G9O A;  4PG5 A;  1HYS A;  2ZC4 A;  1EHW A;  4LBP A;  2OH2 A;  4PUO B;  3NEK A;  4R0E A;  5HO4 A;  2HYI B;  5CYM B;  4EFA C;  4ED0 A;  2LA4 A;  3C3L A;  1LW2 B;  1TUG B;  2CG8 A;  2CQH A;  1VBK A;  4OYP A;  3MAA A;  3UN5 A;  2C2M B;  3FMW A;  2G4B A;  5KFG A;  4EMD A;  3CW2 C;  1WEZ A;  3OUY A;  2YNH B;  1HD1 A;  2G13 A;  2V8H A;  2LQ9 A;  4C0B A;  4DSK A;  2RUG A;  2A0F B;  4RW9 B;  3Q24 A;  4DI6 A;  2H48 B;  1QY7 A;  3CJ2 A;  3MMA A;  2GHP A;  3E01 A;  4PPD A;  3ZTQ A;  2H1Y A;  2OTJ S;  1ZAX A;  2X7I A;  4TYA A;  4RUB A;  2OKQ A;  2ZD1 A;  3CCT A;  4EEY A;  4JI8 F;  1JJ2 R;  4K2J A;  1NME B;  1LWF A;  1QTN B;  3GSI A;  3Q8U A;  3KLE B;  2D41 A;  1TK0 A;  5FDL B;  3VR1 A;  5I42 A;  2DH8 A;  4WP8 A;  1F9H A;  1DZ5 A;  2IMW P;  4YR3 A;  4DV4 F;  5HMW A;  3PW0 A;  2KT3 A;  3TZW A;  2ROE A;  2PDA A;  4EO6 A;  4PWD A;  2XZW A;  3TVZ A;  2E9R X;  2IBO A;  2LLZ A;  4X2B A;  3GCX P;  3SSS A;  1RWX B;  1WSV A;  2D74 B;  4DV6 J;  2ZVS A;  2DCU B;  4K0K J;  1ZBT A;  2WW4 A;  3TYT A;  2YWG A;  4CH0 S;  3HLU A;  2R7U A;  2XY6 A;  3M2R A;  2PMW A;  4O3S A;  3M4X A;  3OFH A;  2PC6 A;  2YKO A;  4AXI A;  5HN0 A;  1UVJ A;  3I0R A;  4IKA A;  3RZA A;  4PAA A;  3VZH A;  4K4Y A;  2CPX A;  1CQN A;  3QID A;  1VR6 A;  2BM1 A;  1HBU A;  5KFK A;  3L09 A;  3DRS B;  4YB5 A;  4WU3 A;  1RHU B;  1XR6 A;  2HPU A;  1W25 A;  3I82 A;  3T1Y F;  3HHL A;  2EFV A;  1ZTW A;  1D8Y A;  5G0R B;  2ZZM A;  2NQP A;  4KRW A;  2PFF B;  1TK5 A;  2J9D A;  3DYA A;  1GQE A;  1T03 A;  3V4I A;  5KFX A;  1O5J A;  2MKK A;  1UW4 A;  3HKZ D;  1ZA2 B;  3N5F A;  3LQV A;  2GO9 A;  4ECY A;  4K4Z A;  3J7Y U;  2R42 A;  2ASL A;  3TUP A;  4PYA A;  2EPI A;  2CQ3 A;  4P6Q A;  2KXF A;  1X4D A;  4PCQ A;  4KHP J;  1N6Q A;  4W90 B;  1IKV B;  2AJ1 A;  5CYQ A;  2HVI A;  4J9V A;  3S8S A;  5CQG A;  2DNM A;  4EGL A;  3LWL A;  1TTH B;  5F0U A;  3S01 A;  3VGS A;  5I3U B;  1TL4 A;  1T9X A;  5DRK A;  4X66 J;  4ED1 A;  5HI7 A;  2DNG A;  2HGN A;  2W2Q P;  2V4Q A;  2V63 A;  3LGH A;  4JV1 A;  2VG5 B;  2AYB A;  1HPZ A;  3JS9 A;  2FLN A;  3TA0 A;  5KFT A;  1I94 F;  1DAR A;  1F3F A;  4UOH A;  3O1L A;  3IG1 B;  5SZT A;  4I4B A;  2BKO A;  3IBC B;  2ALY B;  2XUL A;  2IAJ A;  2MHE A;  1HWL A;  3KLV A;  5G0R A;  3HD2 A;  1IXK A;  1S1V B;  2RD5 C;  4O3O A;  1CBK A;  2EKN A;  4NZ6 A;  5GVQ A;  2IIH A;  1C1B A;  2FHK A;  3DRX A;  2BM0 A;  2YKP A;  4ZVT B;  4U7U K;  3RAM A;  4NX9 A;  4QYR A;  2V0N A;  4JI8 J;  1REG X;  4WFY A;  3RUB L;  4D3H A;  1C0T A;  2NS1 B;  1PBU A;  2AX1 A;  5B0G A;  5KFA A;  3H7H B;  1S1U B;  1Y3K A;  3KJQ B;  3BF4 A;  3M2R B;  3VF0 B;  3WC0 A;  3GIL A;  2ZZN A;  1VK3 A;  2X1G A;  2NSB A;  2WVB A;  1H3D A;  2F8H A;  3QBC A;  4FNH A;  2EFO A;  1SH3 A;  3BR8 A;  3K8W A;  3I96 A;  7FD1 A;  1HBO A;  1VYA A;  1RK8 A;  1K1S A;  2B4P A;  3I0S B;  5BXI A;  4LFC J;  2AZ1 A;  4DPT A;  1G2E A;  3W5Y A;  4Q7A A;  9RUB A;  2W7A A;  1U7L A;  3CCL S;  4B3O B;  1KR4 A;  4M5N A;  2GW8 A;  1VJQ A;  1YBU A;  1XNQ F;  2LU2 A;  2C3M A;  3CC2 S;  3PHE A;  5J2M A;  1RT1 B;  2QSF A;  2OPQ A;  4DUZ J;  2J8S A;  2R8H A;  2WHO A;  1NK0 A;  2UV8 A;  1RYR A;  4USH A;  5C25 A;  1T03 B;  4FP9 A;  2LDI A;  1MSW D;  2KG0 A;  2K1R B;  3U1L A;  3JTP A;  2GA7 A;  5KT6 A;  3HD1 A;  2KDO A;  1X5O A;  2JVR A;  1RWP B;  5EGY A;  2V4R A;  2MY7 A;  4DQR A;  1EKR A;  2BX6 A;  4RW9 A;  4U67 Q;  3MFI A;  1SBR A;  1XNR F;  2VU5 A;  3AB2 B;  2MST A;  4G1Q B;  3DRR A;  4YS2 A;  4BHQ A;  2RUS A;  4CWB A;  2GJ2 A;  3SIP B;  1KHW A;  1IBC B;  1RAD B;  2KHD A;  2KYX A;  2QMW A;  2RRN A;  3GTY X;  3DGV A;  4ZCL A;  4MYU A;  5KOW A;  2HHS A;  2HFZ A;  4F04 B;  4U6P A;  1N5S A;  5A6W A;  4QWE A;  3TEH B;  1IKY B;  2Z2Z A;  4NXM F;  5HAO A;  2FY8 A;  1PJ6 A;  2B8P A;  4LSL A;  1ZOT A;  2XY7 A;  1VHI A;  1M1K T;  4LF7 J;  1RLD A;  4DU7 A;  1NJX A;  4QPX A;  1OPI A;  2DIU A;  1DQA A;  2NXJ A;  1VQS A;  1ZH5 A;  4CIO A;  3B8H A;  3OHB A;  1YRU A;  5DDP C;  1V3S A;  2EWH A;  2W2P P;  3FRZ A;  5HLF B;  2H5J B;  4LFB F;  4PG7 A;  2YNG A;  3Q86 A;  3QYY A;  4JOU A;  4ECR A;  3L7U A;  3OTO J;  4M95 A;  4ZIT A;  2KTQ A;  3CNQ P;  1I6J A;  2ZIT A;  3C6U A;  3CTR A;  4QIW D;  4ELV A;  2LYV A;  1HL6 A;  2BJ3 A;  2XMM A;  4DLE A;  1D9A A;  1AFI A;  1HNV A;  4RUC A;  2BAN B;  4OFZ A;  3UI3 A;  2NLW A;  4DV1 F;  3CC7 S;  5KT3 A;  1I51 B;  1B7F A;  2F3J A;  5JVH Q;  4RU2 A;  3TA2 A;  4LRD A;  4O3Q A;  5CZV A;  2MQM A;  4LT6 A;  4CT8 A;  1RAA B;  3UO0 A;  3HT3 A;  1N52 B;  4ELU A;  1TKX A;  3AXM A;  3CDW A;  1Q4R A;  1VBX A;  2JWN A;  3UQS A;  1T9V A;  1FJC A;  2KL8 A;  5KFC A;  3HM9 A;  1D1U A;  5E3A A;  1FF2 A;  2QFJ A;  3G82 B;  1NK8 A;  2F8M A;  4ZCI A;  3LAL A;  4IG0 B;  3KJV A;  4B9N A;  2XLK A;  1AXQ A;  2OPP A;  1JXE A;  4C11 B;  1U45 A;  1SUQ A;  1S1X A;  3UVJ A;  1NDC A;  2DIS A;  4Y0F A;  1Q79 A;  2K2P A;  2KZZ A;  4H4M A;  4OHY A;  2FJW A;  4QIG A;  1M5P C;  2GQ2 A;  1NSP A;  3KJN B;  2R8J A;  2RDJ A;  4O4R A;  4OX6 A;  5DM7 Q;  4K4U A;  3M9N B;  1S6U A;  2X3D A;  2DNP A;  3MM6 B;  4I7F A;  4M5D B;  1YJ7 A;  2MKY A;  1YJW S;  2UU9 F;  4WP9 A;  2KKH A;  1UVK A;  4DL0 C;  2VD3 A;  1IKX A;  1RU1 A;  2FD2 A;  1KQG B;  1TVR A;  2D3U A;  2UP1 A;  1M5O C;  2NZ4 A;  1UJ4 A;  5E3R A;  1U2F A;  2MEW A;  5KFO A;  1JLC B;  5CA5 A;  2KXH A;  3IS9 B;  3M8P A;  3UDC A;  1NSK L;  1RT4 B;  3L4B C;  3VGT A;  3PR5 B;  3P5T L;  1S1U A;  3QGG A;  4WKY A;  3R2D J;  4BBY A;  2BW7 A;  1KLM A;  2F4V J;  5IC4 B;  3WC2 A;  4QCL A;  2I38 A;  3QNW B;  2QSW A;  4A8X A;  3D9B A;  1P1L A;  4ZVS B;  3GIJ A;  2CFX A;  3JYT A;  4EZ9 A;  4KJI A;  1K0T A;  2UXC J;  1YIJ S;  3H8Y A;  3LOU A;  4OZJ A;  3TJA A;  1H2U X;  2AWZ A;  2M9K A;  4KHM A;  2QX0 A;  4DL2 A;  3DLH A;  3K89 A;  1HHT P;  3GQC A;  1NHK L;  1YJV A;  2PD1 A;  4ID5 B;  3MXH P;  3D66 A;  1FER A;  2NSC A;  3JSM B;  1VQ5 S;  2RHQ B;  5AXL A;  2KN4 A;  4IG0 A;  3KJV B;  2J0S D;  2JEF A;  4JYA F;  4HLB A;  4F4W A;  1FNX H;  2VIC A;  3TAR A;  2VB6 A;  1N5T A;  5AXN A;  2CNN B;  4TNO A;  4V19 X;  3E2E A;  3HI9 A;  4JI0 F;  2Q43 A;  3NAH A;  3U02 A;  4IOC Q;  4QYZ J;  1F6T A;  1IR0 A;  3KUE A;  1H73 A;  2ASD A;  1B64 A;  1P27 B;  1RHK B;  1G3O A;  5KG7 A;  4ZPC A;  4UY8 5;  4A47 A;  3CJR A;  4YHH J;  3G6E S;  2XI3 A;  2OD4 A;  2HLT A;  1Y7P A;  3PJ9 A;  3G71 S;  2IVF B;  2B9X A;  2NXN A;  1R6V A;  5HQL A;  4AQY J;  5AE3 A;  2YWE A;  1SC6 A;  3N9U C;  3DRS A;  5A76 A;  1FDB A;  5L8R C;  3M32 B;  5B08 A;  3RBE A;  2DNO A;  2CJA A;  2G0J A;  2JDJ A;  1X60 A;  3D68 A;  1GMW D;  3EJM A;  4NCA A;  5DO2 A;  2KG1 A;  5KFD A;  3CJS A;  2LXI A;  1NSQ A;  2H3E B;  4WKR A;  3J81 Y;  2QT7 A;  4I2P B;  2HQI A;  3K5P A;  3M8W A;  4C8Z A;  1RWU A;  3OSP A;  4NL5 A;  2WB4 A;  4TYB A;  3IM9 A;  5K9F A;  2N3O A;  1IVZ A;  1TKZ B;  5DS7 A;  2K06 A;  3I0R B;  1PC5 A;  3WZ0 A;  1WHV A;  3NBP B;  5E2Q A;  1HQE B;  2H9Z A;  3TAQ A;  1TKZ A;  1U6B A;  1VQN S;  4RJV A;  2PII A;  5K8P A;  2VFU A;  1V3Z A;  3BH7 B;  2UUB F;  1FJ7 A;  2FC9 A;  1CS4 B;  1IBL F;  3LO3 A;  3ZZP A;  2M8D B;  2ADB A;  3O8W A;  5HBM A;  2AYE A;  4CH7 A;  2GVZ A;  2VG6 A;  3LWM A;  1TZ0 A;  1X5S A;  2FZC B;  2V2Z A;  1O8B A;  1FK9 A;  2VH7 A;  3ZZR A;  4B17 A;  4CP5 A;  1FJG F;  1DLO B;  4DQS A;  3A3P B;  4PG4 A;  4X84 A;  4N7T A;  5KFU A;  4C8K A;  2Y1J A;  4YY3 J;  2HHH F;  2QEX S;  2L48 A;  3TW0 A;  3W61 A;  2HND A;  2ZH2 A;  3CMA S;  4DXL A;  2RDD A;  3OTC A;  1VC0 A;  4DR2 F;  2DHS A;  4ZP6 A;  2HHP A;  3BBF A;  1NEE A;  1QLN A;  1S57 A;  2HQ3 A;  4Y2M A;  3W9H A;  2UUC J;  1HNI B;  1XBW A;  2CQI A;  3A8J A;  1XJW B;  4OZ2 A;  3EXC X;  2PE8 A;  2VPZ B;  5ETO A;  4K4W A;  4DR6 F;  3SFG A;  1U8S A;  2MZT A;  4LRE A;  1PAE X;  2JL9 A;  3DLE A;  5K20 B;  4RNO A;  4ZP9 A;  1HBO B;  3I0S A;  1TKD A;  5T14 A;  4IUF A;  2XGP A;  5CCM A;  3CC4 S;  4F3O A;  2DYA A;  2BJD A;  1KHV A;  3R27 A;  1RWN B;  2QYC A;  2G0C A;  4M63 A;  3BRE A;  3FRY A;  5E33 A;  5LM7 E;  4DSI A;  1LW2 A;  3NCQ A;  4KT0 C;  5CYM A;  3QT8 A;  2KH9 A;  1MU2 A;  4ID5 A;  4CM2 A;  4ZN3 A;  3MEG B;  3UD4 P;  2ZWO A;  2L41 A;  4E2F B;  3GMG A;  5GAG U;  1S48 A;  1KQS R;  4X4N A;  1CPZ A;  2DJW A;  2NRE A;  2BMB A;  4AE5 A;  3SCK E;  1IM6 A;  5BR8 J;  3UCU P;  4I2P A;  4F0K A;  2R7V A;  1IQT A;  4PR6 A;  3PYD A;  8AT1 B;  2XGQ A;  5SUH A;  4DL7 A;  3ILI A;  3PYE A;  4DL6 A;  4I6A A;  4UTG A;  4ECT A;  1Q16 B;  4PWU A;  1TR0 A;  3FUY A;  3GYN A;  5GAE U;  5GMK a;  1N88 A;  1OWX A;  3TRG A;  2FYX A;  4CNZ A;  2MGZ B;  3HHD A;  3OXL A;  2G2O A;  3V4M A;  1XMQ J;  2LXF A;  5B0A A;  3R7S B;  3TP2 A;  3LGN A;  2AEF A;  1RT3 B;  2E1A A;  1GMW A;  3T5K A;  1X9M A;  1GMU A;  1KRP A;  3H5S A;  2XYH B;  4OX7 A;  4ED7 A;  5I3U A;  2VUG A;  1T05 A;  4A4J A;  4BS2 A;  4F25 A;  2HK3 A;  2YVS A;  1YK9 A;  3GJQ B;  2CUY A;  1CG2 A;  4NLQ A;  3WDO A;  3ZTR A;  3W65 A;  2BR0 A;  3LA0 A;  1NKB A;  1BY9 A;  1KQF B;  3W9I A;  1WHW A;  2KFY A;  4PRF A;  1RKJ A;  3AOD A;  3MHY A;  1UA1 A;  3D6M B;  1ZPV A;  1NPR A;  1CJU A;  1S9G B;  1AFJ A;  3R5B A;  5K14 A;  4PXD A;  3V4I B;  1H7W A;  3HVT A;  4X4T A;  1RE1 B;  3I4P A;  2BE7 D;  4OMF G;  1S1W B;  1ZS6 A;  5ETL A;  2MLY A;  4X62 J;  3V81 B;  2BRL A;  1E6V B;  2B5J B;  4ANC A;  2PI5 A;  1FVS A;  4JV0 A;  2QMX A;  1FRK A;  2V5H G;  4DV3 F;  5FLX U;  4DFM A;  1K9M T;  3HO1 A;  3TWZ A;  2DNR A;  3BEG B;  3JSY A;  3T1Y J;  1K73 T;  1RWM B;  5G4D A;  4X66 F;  2GVD A;  3ENA A;  3G9C A;  3IRW P;  1BHN A;  2F8E X;  7AT1 B;  3BQ0 A;  4W92 B;  3AD8 C;  3PO5 A;  4N76 A;  4KHR A;  3KDN A;  4JI5 F;  2XNR A;  1ITP A;  1RT4 A;  3ZZO A;  3BKF A;  1R8B A;  1SJ4 P;  5IM0 A;  5EWG A;  5EWF A;  3D2W A;  4RBV A;  1FDD A;  1HAR A;  2WVF A;  4DG1 A;  3SEO A;  4ZPW R;  4O4G B;  2J6T A;  5KFZ A;  1U02 A;  2D3O R;  1ZET A;  4LFC F;  4OLP A;  3BGL A;  3TEG A;  3IBW A;  3D0G E;  4OYB A;  3GV7 B;  2W9B B;  1EIY B;  2MZS A;  3N6M A;  4YB7 A;  3M8S A;  3L7P A;  1M5H A;  4IFY A;  3KLE A;  3WIU A;  1UCN A;  2XEX A;  3CVK A;  1Y11 A;  2QFI A;  4HHJ A;  3OVA A;  4EYH B;  4DFP A;  3AXK A;  5B0F A;  4UQT A;  1T02 A;  4EZ6 A;  3NS7 B;  1DY3 A;  3CGI A;  4FYV B;  5M2P A;  2Y0B B;  5HMX A;  1WG1 A;  2H5E A;  3E8O A;  3VGV A;  4LSL B;  3MM7 B;  2DPJ A;  1AUD A;  1WF1 A;  4LSZ B;  1S1X B;  4ILR A;  2JLE A;  4ZPT R;  5C5J A;  2PT0 A;  3PO4 A;  3ZTP A;  1RAI B;  2MKJ A;  1JLQ B;  1VCT A;  2IJN A;  2CQ4 A;  3DLJ A;  3AJ1 A;  1VQ7 S;  4DQQ A;  4ED2 A;  4OX9 F;  1RI7 A;  3G82 A;  4OV6 A;  2DIV A;  2MZ1 A;  2VC1 A;  3K59 A;  4AYB D;  2HHX A;  1S9E A;  2DR8 A;  5HVF A;  1WOP A;  2EKY A;  1JLQ A;  2IPO B;  4OJG A;  3T5J A;  3GLJ A;  4ELT A;  1VI7 A;  2IRU A;  3D6H B;  2VBY A;  1O0P A;  3DLK B;  2IYI A;  2Z56 B;  1DQ8 A;  4GC6 A;  4B9U A;  5E3C A;  4NYO A;  4OLO A;  1QAX A;  2KB2 A;  2CVI A;  4WII A;  2YWK A;  1RZM A;  3MEE B;  4TN2 A;  3UDV A;  4DOZ A;  3Q22 A;  4DR2 J;  4H54 A;  5C25 B;  3BSA A;  4Z7Y A;  4CLS A;  5JVG Q;  1GTH A;  1NPK A;  4KPC A;  2ROG A;  3OR2 A;  3PW2 A;  3DM2 A;  3JB9 k;  1XNQ J;  4O0N A;  2R2S A;  2FHO B;  4CRJ A;  1G7C B;  3GSD A;  1SPB P;  1L5U A;  3FQL A;  1AUS L;  4RW6 A;  1BMQ B;  3OL9 A;  4O44 A;  1Y00 A;  1URN A;  2BOA A;  2YBV A;  3EVW A;  2DT9 A;  3JXO A;  1W26 A;  4A8W A;  2VJU A;  1RXO B;  1OY6 A;  2ZEJ A;  5DQI A;  3DHX A;  3CXC R;  2QRR A;  5LJ5 Y;  3KUG A;  4M5I A;  1RTJ B;  3NOC A;  1I3O B;  1X7V A;  1GX5 A;  1QDU B;  1Q53 A;  3MM8 A;  4X4S A;  1IBK F;  1BXN A;  1UAW A;  3L3C A;  1MWQ A;  2R7O A;  4CLW A;  3I5A A;  3MPV A;  2QLF B;  4RNH A;  1DTQ A;  1CUL B;  3UCZ P;  1PYS B;  4NLG A;  3PRD A;  4IYQ A;  4AL5 A;  2DGX A;  4YEA A;  2RKI A;  3CUN A;  2YKQ A;  3C14 A;  5THW A;  5HMZ A;  4ED3 A;  3NWG A;  1YVF A;  1PJ7 A;  4AD6 A;  5KFL A;  4JV5 F;  1RWV B;  4URS A;  2KZM A;  3VVT A;  4MIA A;  1RHR B;  3FKB A;  2KVQ E;  3HZE A;  1HKA A;  4FVC A;  3BSN A;  1P9Q C;  2HHV A;  4F36 A;  2Z2Y B;  4WU2 A;  5A8R B;  2AYM A;  2AT1 B;  3BGR A;  4UQG A;  2ZOF A;  1CJU B;  2E5I A;  5J1E A;  1TFY A;  1KN6 A;  3VAG A;  1ZTT A;  4LRA A;  4RKU C;  1SVD A;  4P9S A;  4R8U B;  3QGI A;  4J91 A;  5IT4 A;  2N7C A;  4IG3 A;  3UE2 A;  4YR2 A;  1R8C A;  2LEC A;  2QN6 B;  4B9S A;  1TQL A;  4ZPD A;  4C2M A;  2FJD B;  2H54 B;  3H5Y A;  2LQ5 A;  1WJ9 A;  3W64 A;  3OJS A;  1IR2 A;  3O2I A;  3F0N A;  4WZQ A;  2NR0 A;  1Y5I B;  8RUC A;  1YDL A;  3KWM A;  1S0O A;  1MN9 A;  3BJY A;  5KFE A;  2ZH6 A;  2ZBR A;  4LR9 A;  4C3L A;  1I1G A;  1NM2 A;  5J2P B;  2WB1 D;  5D3G A;  1IQZ A;  1DRZ A;  4Y2K A;  1B99 A;  1H74 A;  1SKW A;  1DUR A;  5J1N A;  4X4U A;  2AX0 A;  3WBZ A;  4K4V A;  3KG0 A;  1LXJ A;  4NE9 C;  1UP1 A;  4DUY J;  1HIY A;  4A8M P;  1NB7 A;  1D8Z A;  3BS9 A;  2ZOG A;  4PXC A;  1KVK A;  2OEK A;  3H40 A;  2FZG B;  2C42 A;  2RDI A;  2IDL A;  4OV1 A;  3KK1 B;  2MY8 A;  1S4F A;  1BQN B;  4IRK A;  1NKC A;  2RB7 A;  1RT2 B;  4J9K A;  4QWA A;  4DV2 J;  1Q5Y A;  1UEK A;  2HBR B;  3BSC A;  1N5V A;  2N4C A;  4NI2 A;  3VHQ A;  2BXJ A;  4X65 F;  2MQN A;  4KC5 A;  2FDN A;  2J7U A;  2HMI A;  2BAC A;  4NZ0 A;  2XBP A;  2JH3 A;  2HFU A;  2CRL A;  3PKM A;  1KLM B;  1VQ8 S;  2H4W B;  3KKF A;  4USW A;  1PBA A;  4X62 F;  4ED6 A;  2WSF C;  3PHT A;  1J5E J;  1S1T B;  4K59 A;  4KBI A;  1P9Y A;  1URR A;  4FYX B;  1UVM A;  3EX7 B;  1OS5 A;  1WKJ A;  4FYD A;  3RG6 A;  2A2D A;  3R1H A;  2PO4 A;  3NL0 A;  4OZ3 A;  1L3S A;  5DLF A;  2HVH A;  2DNL A;  1F1B B;  2OI2 A;  3R8Y A;  2R2T A;  3DI6 B;  2NYH A;  2XI2 A;  2EEY A;  2HS0 A;  5KFY A;  4QR2 A;  4B9L A;  1J2V A;  4DSL A;  5J2Q A;  2QLW A;  1MNE A;  3GJR B;  3DLE B;  3LTO A;  4XDD A;  1RAO A;  2JNJ A;  3ETO A;  4GMK A;  3HDS A;  1F2G A;  2W4C A;  4J9S A;  3FEY B;  3CME S;  2K7K A;  1KWM A;  1MWZ A;  1QTM A;  2RQC A;  2N82 B;  2QO3 A;  3N5B A;  5K8O A;  2KVI A;  2EXU A;  2N4D A;  1DTT A;  2VDI A;  5KOX A;  1SL1 A;  3HSG A;  4OZN A;  1XEZ A;  2Y8Y A;  4A8S A;  1OJ4 A;  1QSS A;  3TR5 A;  1YJU A;  5LXY A;  2ZH7 A;  3QT6 A;  3I55 S;  2EFQ A;  3V6D B;  1OY8 A;  3BV8 A;  4WK1 A;  1DAX A;  3M05 A;  4WYL A;  3ZC4 A;  1Y9O A;  3IWX A;  4BC7 A;  4OHW A;  3KLI B;  4DHV A;  2ZH3 A;  2MQ8 A;  4J7C A;  1KNZ A;  1RDR A;  1WOO A;  2J0Q D;  4YDD B;  2XM3 A;  3BKU A;  4DL3 A;  3MOJ B;  4WE1 B;  3NBP A;  4K50 A;  1WNE A;  1PAU B;  3PYG A;  4O23 A;  2ACM A;  3BDP A;  1HD0 A;  4CCH A;  2VOO A;  1SJ1 A;  2CIM A;  4Y2A A;  3AHP A;  1IJE B;  4JB8 B;  3P4U B;  4KO0 A;  4UUX A;  1YI2 S;  1V5V A;  1JLE B;  4XPC A;  1S9F A;  3T5H A;  3OTB A;  3W5X A;  3CPW R;  1TP7 A;  2VON A;  3T5L A;  1N0V C;  3MTJ A;  2RQM A;  5KFR A;  2DR7 A;  1UZD A;  2CPJ A;  2IM0 A;  3PYF A;  4HKQ A;  1ZPW X;  2JFK A;  4CI0 B;  3KLI A;  3PXG a;  2W2O P;  2RRB A;  3DOL B;  5D4L A;  5KG1 A;  4RW4 A;  1H6K X;  1VC5 A;  2A1B A;  5LJ3 Y;  1CEZ A;  2WSE C;  3QO9 A;  5DDO C;  2X1A A;  3PW5 A;  3GFX A;  3MPD A;  2MSS A;  3W3S A;  3EGW B;  2CA9 A;  1RBL A;  3HXM A;  2RS2 A;  5LSL A;  4P72 A;  3W2W A;  4A8O A;  2A2C A;  1V3R A;  4ZVF A;  4Y00 A;  1U1P A;  3KK3 B;  1KVI A;  3R6L B;  2GJI A;  4NYZ A;  3DLK A;  2B7B B;  5K8N A;  4NRU A;  1L3T A;  1IKY A;  3FSY A;  3K8V A;  2ZHB A;  1FJG J;  4LMZ A;  5EUH A;  1J5E F;  5F8N A;  2AP6 A;  3LPY A;  3T1A A;  4C9D A;  2E7V A;  2ZWP A;  3HF5 A;  3MI7 X;  3MAA B;  4USJ C;  2DEI A;  3CJ5 A;  4Q43 A;  2JLG A;  2E5J A;  4DV5 J;  1VDH A;  2WOM A;  5BJR A;  5IXU A;  2ZJP Q;  1WSR A;  4DS4 A;  4DL5 A;  4NOH A;  3FJ2 A;  4DX8 H;  1HYS B;  3FDS A;  1NND A;  2OGU A;  3MM7 A;  1YIT S;  2L08 A;  2G2Y A;  2DRB A;  3AA8 A;  3GR1 A;  2QTW A;  3TVK A;  1S1T A;  1TKT B;  2XS2 A;  3R5D A;  2GFF A;  2WAQ D;  4WFN Q;  2VG7 A;  4DR4 F;  2D3Z A;  5I3P A;  5IWA J;  1NK5 A;  1N5Q A;  3K5L A;  4UST A;  4HAC A;  4NLU A;  4N8O A;  2H5I B;  2HMI B;  2R8G A;  2P9E A;  3GPA A;  5L38 A;  3PJW A;  1B4S A;  2LQ8 A;  2W9B A;  2MKC A;  2UVR A;  1HWI A;  1K1Q A;  3IP0 A;  3THP A;  4BC9 A;  1RT2 A;  4XDC A;  1TMJ A;  3G2X A;  3KFW X;  1KFD A;  1Y10 A;  3IC1 A;  4F67 A;  3CCU S;  1WUU A;  4IOB A;  2GGP B;  4MYT A;  4ZVE A;  2Y1R I;  3SXL A;  5GME A;  4KGM A;  3GG1 A;  5LXR A;  3J81 U;  4HTJ A;  2DXD A;  1JLG A;  2M88 A;  2ZHA A;  4D3G A;  2VPW B;  2Q6B A;  2F63 A;  2QA2 A;  6FDR A;  1UW9 A;  1E6Y A;  4C3K A;  4MIB A;  2BJ7 A;  5D6G A;  2A18 A;  1AB8 A;  4ED5 A;  2HVZ A;  2EFN A;  2YPY A;  1O6X A;  1VFJ A;  1RA6 A;  1VIO A;  3ITH B;  4J37 A;  4ZP7 A;  1KTQ A;  2CAD A;  4AXJ A;  4RBT A;  2VJV A;  2AU0 A;  2HLU A;  3MMJ A;  4XAK A;  3ETM A;  2P8I A;  4B3S J;  4NAS A;  1IR1 A;  4B02 A;  3K2Y A;  2DNQ A;  2DRA A;  2M52 A;  1RHJ B;  4F50 A;  4JI5 J;  2RS8 A;  5LMN J;  2X1F A;  2A6M A;  5D15 A;  2WON A;  2MJU A;  3N0V A;  3FMB A;  5ADZ A;  1S9G A;  4N5S A;  3MR2 A;  2AJQ A;  1FHT A;  4H4M B;  2XSJ A;  4V1A k;  1X0F A;  3UDE A;  4AT1 B;  2R7S A;  2FZK B;  1RP5 A;  2PSZ A;  4OI6 A;  3US5 A;  1NSA A;  2CJB A;  2QV6 A;  3GP9 A;  3LAN A;  4MKB A;  5E3Q A;  1GXL A;  5IQQ A;  3CWJ A;  3VVU A;  3MEK A;  2XLI A;  3NS6 A;  5A2Q Y;  2P2C B;  1RYS A;  2EBE A;  4CLU A;  3T3F A;  3IM8 A;  3KK2 B;  4IOA Q;  2GX8 A;  4NLT A;  3QJL A;  3ZZT A;  4EO8 A;  2G0I A;  4OZ5 A;  4X4R A;  1YHQ S;  4KFB B;  2IVY A;  4NLR A;  1M5K C;  2JEG A;  2JSX A;  3TI0 A;  1D3W A;  1QD1 A;  1XQI A;  5LSR A;  4I1T A;  1NJW A;  3CMQ A;  3HCX A;  2BJE A;  3CUL A;  5B7W A;  1R0C B;  3DCA A;  1UPP A;  2R3V A;  5HVG A;  2O66 A;  1WI6 A;  2DR9 A;  3GYX B;  4LRC A;  3NGK A;  3KOA A;  1PKU A;  4IR1 A;  1OO0 B;  1C0U B;  2V6A A;  3T6J A;  4O3R A;  3NNC A;  3B78 A;  1FRL A;  5HAN A;  4DUZ F;  4QIF A;  2PA3 A;  2DB1 A;  2GMH A;  4RW4 B;  1HBU B;  3V6H A;  3DOL A;  3OL7 A;  1QVF R;  5A0Y B;  4B9V A;  1SH2 A;  3BSO A;  1SIW B;  3JSR A;  3M2V B;  2W8L A;  3HK2 A;  5B09 A;  5B0D A;  2HNY A;  4X4V A;  5K5M A;  1NCL A;  2UU9 J;  4Y2I A;  2VQE J;  3AJD A;  3Q89 A;  1JLB A;  4DF8 A;  1FRI A;  4MIW A;  2HFS A;  3DRR B;  4C8N A;  1UZH A;  5AJ3 F;  1VK8 A;  1S6O A;  3ZNJ 1;  1FKO A;  1GXU A;  3CJ8 A;  1N56 A;  2I9S A;  1FFS B;  2J7W A;  4IFV B;  1UVI A;  1S9E B;  2CQB A;  2VFT A;  1K44 A;  1BWV A;  2CNL B;  4ECW A;  1RKI A;  4NLX A;  4TY8 A;  5FDL A;  1HNX F;  4HYK A;  4HL9 A;  4R0J A;  4EYI B;  4WCE Q;  3V6D A;  1WEX A;  1UKU A;  4C6A A;  4K7Q A;  4LIR A;  3MD3 A;  5KT2 A;  3BO2 A;  4IO1 A;  5KAK A;  3A3N B;  3FVY A;  2C2O B;  2VL1 A;  3T9N A;  3ENW A;  4YDX A;  4KH0 B;  2O01 C;  3E01 B;  2Z2M A;  3LGM A;  1HQ2 A;  1WC6 A;  3NGR A;  3O6Q A;  3SCJ E;  4F4A A;  4PYD A;  2E66 A;  4WPA A;  4P2X A;  1N32 F;  1MRO B;  3H2V E;  3OUY B;  4LF4 J;  4EWT A;  4X4Q A;  1R0B G;  4WFX A;  4WWS A;  1U0S A;  2EVZ A;  3H5U A;  4TY9 A;  1T9W A;  3TAN A;  5DQG A;  4RW8 A;  4B3T J;  3QWP A;  2KJW A;  3MD1 A;  2M4M A;  2QLB B;  2FVS A;  1C2P A;  3W7B A;  3DXB A;  1WEL A;  4PEO A;  1FKO B;  4QWB A;  3QFW A;  4PUO A;  3ENV A;  4YUD A;  3EPI A;  4JI1 F;  2CQ1 A;  2OUG A;  1WC1 A;  3LAM A;  1A6L A;  1GX6 A;  2DNH A;  4L75 A;  3SYZ A;  3RW6 A;  1FEE A;  1LWC B;  5L39 A;  5EWE A;  3KHR A;  4DR5 J;  3HFV A;  4KHP F;  2MTL A;  4F3Q A;  4TU8 A;  1G6B A;  3G8Q A;  1YJ9 S;  4CO1 A;  2YWF A;  1U4B A;  1C0T B;  2FLL A;  2HVE A;  2IAJ B;  3W1Y C;  3R2C J;  4KKO A;  3KMQ A;  3HHE A;  1S99 A;  3GIR A;  5GMD A;  4CO5 A;  1SJ3 P;  2ACY A;  2AZ3 A;  1HNX J;  4KR0 B;  2I6W A;  1CJT A;  4J90 A;  3MMC B;  1Q95 G;  4LIW A;  3KLG B;  2ROP A;  1VRT A;  1APS A;  2GCF A;  1HWK A;  3MED A;  4R5P B;  1NAQ A;  3SQO P;  2IM3 A;  4Z2X A;  3CCQ S;  2QLX A;  3CCW A;  3S7R A;  3UWT A;  4X4O A;  2VQE F;  3HMJ G;  2OEM A;  2DPI A;  2M0G B;  4MKY A;  5KFM A;  2ZKU A;  1S1W A;  4GKK J;  1NH8 A;  1SC4 B;  3NS5 A;  1SQG A;  2M7S A;  3TO8 A;  2J9D E;  1TMM A;  3V5R A;  3ICL A;  3RU0 A;  5A8K A;  2IYG A;  4ZVH A;  4HT7 A;  4XK8 C;  1AYE A;  4M5K A;  1ULR A;  3QQC D;  2C2K B;  5D3G B;  3KNA A;  1OY9 A;  1RUS A;  4PQU B;  4ZJL A;  1TL1 A;  1WEY A;  2QYG A;  4IH6 A;  1U1R A;  2BDP A;  3PAC A;  1SC1 B;  4XIU A;  2A6O A;  2W01 A;  3HVW A;  4ILL A;  4OYA A;  3CB4 A;  5T7L A;  3SSR A;  3DFE A;  3P3D A;  5I4M A;  2BQU A;  2DH7 A;  2OPR A;  3F44 A;  3QFH A;  5H9E K;  4Q45 A;  2BE9 B;  5D0R A;  4R8U A;  2DR6 A;  1WHY A;  2EK1 A;  1XR5 A;  1KDN A;  3MMC A;  4KAI A;  4DX7 A;  2MQP A;  3KTQ A;  2IJR A;  3MEC B;  4KPY A;  3BGR B;  1R8H A;  3K5N A;  2B9Y A;  1NJY A;  2ABY A;  3CCS S;  3DYA B;  4ALZ A;  5KFS A;  5GAH U;  3OW2 R;  4P7T A;  2WVD A;  2E9Z A;  2Y3Y A;  3OL8 A;  1TL3 A;  4O3N A;  2RQK A;  3G4S S;  5H9E J;  4RUH A;  4K8R A;  3VAK A;  2YQ1 A;  8ATC B;  4ZJO A;  2B3T B;  3VTI A;  2FJE B;  2M3D A;  2VV5 A;  4TKT A;  3R6G B;  3FSX A;  4UT4 A;  2DHH A;  4FS1 A;  4WXW A;  2UUA J;  3IMQ J;  5HJY A;  3QAU A;  1IKX B;  1LKZ A;  1Y5N B;  2ATC B;  2DY9 A;  2F1F A;  3GON A;  2MQQ A;  2Z4P A;  3JAM U;  3FEX B;  3J7Z T;  3CJ4 A;  2LMI A;  2MZJ A;  2MKH A;  2V4J B;  4M5D A;  1Y3J A;  3D0H E;  3CCE S;  2BVZ A;  1UWB B;  2IRY A;  5FD1 A;  2AJF E;  2LQJ A;  2C2D A;  3LP0 B;  4MFB B;  1FFW B;  1U48 A;  4I64 A;  4MT1 A;  1OQ6 A;  2UUW A;  4GO5 X;  2W9A A;  3MCS A;  2YKA A;  2IM2 A;  4DZD A;  4C3M A;  2ZE2 B;  1VQO S;  1HNI A;  2XHC A;  1FEH A;  2HZC A;  4PPZ A;  2O1P A;  3BPD A;  2JZ5 A;  1LWF B;  3H59 A;  3OR2 B;  2MB0 B;  2BE2 A;  1FXD A;  1FKP A;  2U1A A;  3QGH A;  3FBE A;  4TY8 B;  4CLP A;  3M2U B;  3DXS X;  2C28 A;  1T3N A;  3QJP A;  5AXM A;  1DBD A;  2PMH A;  1HFE L;  2P5V A;  3Q23 A;  5D8H B;  3CJ3 A;  3H2U B;  1T3O A;  1DLO A;  4KSE B;  1S97 A;  1FK9 B;  4HTI A;  4CLL A;  2YNH A;  1S12 A;  1XMO F;  3SZ2 A;  1P6T A;  4JP8 A;  4RO0 A;  5CXT A;  4OYO A;  1CC8 A;  1MW7 A;  2CPE A;  2VKR A;  1ZZN A;  1QAI A;  2DNZ A;  4WFA Q;  2FHM A;  2HS3 A;  2YH0 A;  4DFK A;  2KRB A;  3T41 A;  4CLT A;  5LT5 A;  5LMN F;  4DCJ B;  3OTO F;  2BAN A;  3CCR S;  2ASJ A;  4OX9 J;  1HNV B;  4LVO P;  3M8Y A;  2DO0 A;  1FI4 A;  2YX7 A;  5J1P A;  3KHH A;  4FDF A;  2ZNZ A;  3AFG A;  5MLC V;  3M9O B;  4RPF A;  4Y3C A;  4CO2 A;  4JI6 J;  1B0P A;  1RA7 A;  3BN4 A;  2KRR A;  3DOM A;  1N0U A;  3FBF A;  4Y6I A;  2W7O A;  4N77 A;  1IUJ A;  3QO9 B;  3RBZ A;  1NJI T;  4X4P A;  4GRS A;  4MK9 A;  1S49 A;  2I1R A;  2OSR A;  3AQO A;  4OJ1 A;  3G96 A;  2OLW A;  4U95 A;  4GC7 A;  3NOG A;  2C2N A;  2RML A;  4OYZ A;  3DC2 A;  1R31 A;  4Y28 C;  1JKH B;  2AF6 A;  4KV8 A;  4EBD A;  5E0O A;  4ZOS A;  4FZV A;  4NLV A;  4NCG B;  1FRJ A;  1U8W A;  4F0M A;  2B6A B;  3EZO A;  5ETT A;  3MAH A;  4N56 A;  2N3L A;  5IV3 A;  4Q5V A;  3QLH B;  2AIR B;  1R7I A;  5HJX A;  3CJK B;  4DF4 A;  2J9E A;  1X4F A;  3R97 A;  3DGP A;  2QA4 S;  3BYP A;  2Q79 A;  4LF9 F;  1C1C A;  2V9K A;  4F4Y A;  2NYI A;  3A4T A;  4YP3 A;  3A8K A;  4H4O A;  2EK6 A;  1FRX A;  2LEB A;  1U26 A;  2IRX A;  2C3U A;  2GVD B;  2ZH5 A;  1PC4 A;  2PFD A;  3BGF A;  1UVN A;  4LFB J;  4ITS A;  2MKS A;  5DZ7 A;  1S0N A;  4N47 A;  2E5L J;  1VJW A;  1RAF B;  4P75 A;  3F41 A;  1MG7 A;  3VQS A;  2HNZ B;  1ROF A;  1VIS A;  1UFK A;  2J5A A;  1JXL A;  5C24 B;  3L9Z A;  4ECU A;  2C3Y A;  4KB7 A;  2XQC A;  2ZVI A;  3LP2 B;  3I56 S;  4RW7 B;  1X4E A;  3C15 A;  4ICL B;  5E5N A;  4A48 A;  2R2R A;  1SL0 A;  3OSN A;  1X5P A;  4DV6 F;  3HP6 A;  4AUK A;  4B3R F;  2AKW B;  9ATC B;  2DVI A;  3PTW A;  4NLP A;  5L1K A;  3BZQ A;  2UXC F;  5C7P A;  1T9T A;  4ATN A;  3BQ2 A;  4CNY A;  3MR3 A;  4U9R A;  4JI3 J;  1S7H A;  3MCM A;  1X31 C;  1X4G A;  4ANE A;  3AD7 C;  4DWI A;  2BJ8 A;  3B6B A;  2B4V A;  1X5T A;  1VRU B;  1HNZ F;  3N6L A;  3OXF A;  1FT8 A;  4RR5 A;  4C0H A;  2GGP A;  2F9J A;  5DG9 A;  2IY5 B;  4J9L A;  4IRD A;  4BLG A;  2MZQ A;  2WVE A;  4PG6 A;  1QUV A;  4LF6 J;  2HK2 A;  2XLJ A;  3KUH A;  1U24 A;  2G1D A;  4JI0 J;  1IJF B;  2GQQ A;  1KEK A;  1C1B B;  1U0H B;  3MM6 A;  2YKN B;  4I7F B;  4RBU A;  3CDE A;  2KXN B;  1VQP S;  4CYU A;  1C4C A;  2E5L F;  3BKT A;  2VOD A;  2IC3 B;  4NPO A;  3TOQ A;  4O0I A;  1GNK A;  2YKN A;  3CD6 S;  1UL3 A;  5JUM A;  4DV4 J;  5LL6 d;  1NDK A;  2HS4 A;  1IN0 A;  2WW8 A;  5DZ6 A;  2B0G A;  3HHN B;  3I9V 9;  1HNZ J;  3UVJ B;  1HPZ B;  1SUQ B;  2HRT A;  1U1L A;  3SDE A;  1UMJ A;  2JVO A;  2HSE B;  1EP4 B;  5F41 A;  1RSC A;  1IBK J;  2W7P A;  1KOH A;  2PEH A;  4FF3 A;  5T7L B;  3GU0 A;  2Q66 A;  2RIL A;  1RAE B;  2GO8 A;  5CYQ B;  3R5A A;  4JBC A;  3EPG A;  4NLY A;  1N6Q B;  1TL1 B;  3EWG A;  4IH7 A;  3R9L A;  1HMV B;  2F40 A;  4M5G A;  3G8S A;  1UTA A;  4K4X A;  1TKX B;  2N7Y A;  3OFG A;  5J2P A;  2YNI B;  1VBY A;  3GB0 A;  3KK3 A;  3MFH A;  1HI0 P;  2FIU A;  3JQM A;  4ZVP B;  1U2C A;  3A13 A;  4LF1 A;  3SFU A;  2OFH X;  4YQW A;  2COL A;  3JAM Y;  3MM9 B;  4B9M A;  3NMR A;  3MTK A;  2H51 B;  4IR9 A;  1GMV A;  3H90 A;  2QL9 B;  3M8R A;  2WK4 A;  3NCR A;  3TJ9 A;  1GXT A;  1X4B A;  3PEH A;  3TUZ C;  1CQM A;  4W98 A;  3QIP B;  1W2B R;  4I67 A;  1KON A;  2VFS A;  4USV A;  2C3P A;  2HQG A;  2R8I A;  3SMZ A;  1PIE A;  1RBO B;  2VPY B;  2YKM A;  3M6V A;  3VV2 B;  5C42 A;  1FKA F;  3EMT A;  4H4O B;  1Q7Y T;  4YB1 P;  1BGX T;  5HLF A;  2KU7 A;  5HBM B;  3J80 Y;  2J9C A;  3DMJ B;  2QGF B;  1D9D A;  4GKJ F;  4A8Y A;  1KC8 T;  1LWC A;  2IJF A;  2LKZ A;  4ZVR B;  4B3S F;  3HHK A;  2ZBP A;  3QLH A;  1DQ9 A;  2QL5 B;  4I69 A;  1NHU A;  2LA6 A;  1WAC A;  2EFG A;  2V69 A;  4RWX A;  2C2E A;  3K7R A;  2HQD A;  4DUY F;  4OJH A;  3J7A N;  3A12 A;  1A9N B;  4ZDN A;  4G1P A;  1U25 A;  1WC0 A;  3E3X A;  1WWH A;  1BWE A;  1F5B A;  3PRB A;  2RJZ A;  1WC4 A;  3ADA C;  1U49 A;  3EIC A;  1SI9 A;  2CPF A;  2GHV C;  3OTE A;  1SJF A;  4ID8 A;  1HR0 J;  3LAK A;  5C42 B;  2HHU A;  3O3L A;  1Q0N A;  5E7O B;  2I8E A;  2X51 A;  3O44 A;  2FHJ D;  2F5G A;  1X9S A;  4URQ U;  3W63 A;  4DUT A;  3FGV A;  4OL8 A;  1PGZ A;  4LF5 F;  2M70 A;  2Q6C A;  3HHL C;  3KLH B;  5HP1 A;  5H9F J;  2KFZ A;  2CQD A;  5J2N A;  1T9U A;  2OML A;  2VFR A;  2XWX A;  3MM9 A;  3VWS A;  2OPQ B;  1T94 A;  2CKW A;  3TAP A;  3TX0 A;  2VQF F;  3KNG A;  2ZM6 J;  1KVJ A;  4DV2 F;  2W2M P;  2YNI A;  4B3T F;  2DR5 A;  5M2R A;  4ZLJ A;  4I2Q A;  3KYL A;  2P6T A;  1CJK B;  1S7I A;  1DFD A;  2NXE A;  3BBC A;  2DXE A;  3TNV A;  3QZ8 A;  1R89 A;  2NCK L;  1VQL S;  2HW3 A;  2RRA A;  2E29 A;  3M2U A;  4OI2 A;  1MLA A;  4NCB A;  3RJM B;  1FKP B;  3JSM A;  3OR1 A;  1RTD B;  3VQT A;  3ZZY A;  4RLE A;  5IFM A;  1S59 A;  2F9D A;  3D4J A;  2FY1 A;  4CLF A;  4B3M F;  1NXI A;  1N36 F;  3DHW C;  3DLG A;  1LW0 B;  2ZM6 F;  3QAE A;  4P2F A;  4DPW A;  4E98 A;  1X0P A;  1LEO A;  3A3O B;  1YTY A;  3MUT P;  4Y65 A;  4ZVU B;  2R7T A;  4JI7 F;  1MML A;  4YHH F;  1HHQ A;  4UF4 A;  2BKP A;  2P9G A;  4Q2L A;  1V6H A;  4AL7 A;  5HRO A;  1KP6 A;  2JC0 A;  3CD7 A;  4MTP A;  1U0H A;  2M8H A;  4TVA B;  2V4J A;  4QW8 A;  4ERD A;  2QC3 A;  5CYJ A;  1T95 A;  2DBB A;  4ZIV A;  1ZZF A;  3QSY B;  2HFV A;  1VOM A;  2RQ4 A; 
#chains in the Genus database with same CATH homology
 3ILJ A;  5ETO A;  3IP0 A;  1RAO A;  1EQ0 A;  5ETL A;  1TMJ A;  1TMM A;  1RU2 A;  3HSJ A;  3MCM A;  3HSZ A;  5ETV A;  1F9H A;  1Q0N A;  4M5L A;  5ETK A;  3UDE A;  5ETQ A;  4M5N A;  4M5K A;  3HD2 A;  2QX0 A;  2CG8 A;  3HSG A;  3UDV A;  1CBK A;  2F63 A;  1DY3 A;  4AD6 A;  3KUH A;  4M5G A;  1HQ2 A;  4F7V A;  4CRJ A;  1RU1 A;  1RTZ A;  1HKA A;  2F65 A;  5ETM A;  1RB0 A;  3MCO A;  1G4C A;  3HD1 A;  3MCN A;  4M5J A;  4M5M A;  4CYU A;  5ETN A;  2BMB A;  1EQM A;  4PZV A;  5ETS A;  3ILL A;  3ILO A;  5ETT A;  1IM6 A;  3HSD A;  3HCX A;  3HT0 A;  4M5H A;  5ETR A;  3UD5 A;  4CYU B;  3KUE A;  4CWB A;  3ILI A;  3QBC A;  1EX8 A;  3KUG A;  1KBR A;  4M5I A;  5ETP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...