1RU1A

Crystal structure of a ternary complex of e. coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.40 angstrom resolution (monoclinic form)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
143
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPPDYLNAAVALETSLAPEELLNHTQRIELQQGRRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Essential Roles of a Dynamic Loop in the Catalysis of 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1ru1A00
4M5KA 3HT0A 3IP0A 1Q0NA 5ETRA 5ETLA 2BMBA 4F7VA 1HKAA 1RU1A 3HD2A 3ILJA 3MCMA 1EX8A 1CBKA 2F65A 3QBCA 3HSJA 3HSGA 3ILLA 5ETOA 5ETTA 1HQ2A 3ILIA 5ETQA 3HSDA 3UDEA 2QX0A 4M5GA 2F63A 4CRJA 1RB0A 1RU2A 3MCOA 5ETMA 1KBRA 1F9HA 4M5MA 1G4CA 1RAOA 3UD5A 4PZVA 1TMMA 3KUGA 4AD6A 1DY3A 4M5HA 3KUEA 3HSZA 1RTZA 2CG8A 5ETVA 3UDVA 1IM6A 3MCNA 5ETSA 1EQMA 4CYUB 1EQ0A 4M5NA 4M5JA 1TMJA 3HD1A 4CYUA 4M5LA 3HCXA 5ETNA 5ETKA 5ETPA 4M5IA 4CWBA 3ILOA 3KUHA
chains in the Genus database with same CATH superfamily
1T9TA 5IS2A 2RMLA 3CJTA 4C0OC 5A0YB 1WACA 5IQ6A 2OTLS 3AB4B 1T9YA 1S1WB 2VBXA 3LTOA 4CO5A 2HNDA 5HANA 3OVAA 1CC8A 5KFVA 1YJWS 2HQCA 1CC7A 2OIHA 3RB0A 2HHTA 3BSOA 4QJVA 3V81A 3UR3C 1JB0C 4TYBA 2AGOA 5A8KB 2WZ1A 4U9RA 3DRRB 4B9TA 4KQZA 2F4VJ 1S10A 3CCWA 5B0CA 5IWAF 2J6SA 4ZVFA 1DZ5A 3ENAA 3Q8UA 2HFZA 3FGVA 1CPZA 5B7WA 2B5JA 3D68A 3BH6B 3SCJE 3MMCB 4DL5A 2WVEA 3KG0A 3CMES 2U2FA 1D9AA 4LF1A 3AH6A 2EFOA 3OHAA 4DCJB 4C3MA 3EYZA 3BN4A 3UVJB 2N4CA 3IBCB 4YDDB 1XK8A 4R8UB 4HT5A 3OL8A 2YX1A 2WOMB 4RU9A 3R5AA 3AA9A 1HQUA 3BREA 1IR0A 3TJ9A 4X4RA 4DZ6A 1LWCB 3O44A 2DGQA 3ETOA 4YB7A 3W5XA 4IDKA 4P2SA 1A7GE 3QYYA 2ZD1B 4QQBA 1HPZA 3DLKA 5IT4A 5H9FJ 1SKUB 2LEBA 1R6YA 2VF3A 3GPAA 4Z7CA 2DIUA 4N76A 1C0UA 2CZVC 3J7Z5 1GAOA 2KM8C 1FJGF 2QRRA 3ILIA 3JSMB 4ZP6A 2YWGA 5B08A 3TAQA 2ZC3A 2W2NP 2NS1B 1T9XA 3CCUS 2ZUGA 4C9DA 5D0HA 1V3RA 2FZCB 2JLEA 1JLFA 3RRKA 1S9FA 1IN0A 1MMLA 1FA0A 2CWKA 3MAHA 3PW4A 3PG9A 2GVDA 3IR6B 2J5AA 1IQTA 1WEZA 2JVOA 1YBTA 2B56A 4A47A 5GAGI 5KG7A 3G2XA 5E3QA 3G6VA 2A3JA 4YR0A 5DGBA 2DPIA 1I5OB 3H90A 1RU2A 1RA7A 2FC9A 4IG0A 2PFFB 3KK2A 2XSJA 4Q7AA 5IWAJ 1U09A 3C16B 5KFAA 1FJ7A 1S7IA 2K7JA 3BJYA 3PR4A 1N33J 1MROB 1RT2A 3OBIA 3HSZA 5C42B 2BBEA 1VK8A 2JRSA 1XNRF 1VFJA 2VG7A 2VA3A 3BKTA 4FS2A 4ECRA 3ZO7A 3LO3A 3HFZB 2XLKA 5F8LA 2MQNA 4O3SA 4DWIA 3VTIA 3C14A 2VIHA 3QO9B 1QD1A 4I7FA 5C24A 3NNAA 1KVIA 1Y10A 2JC1A 4KPCA 3ITHB 4C0BA 1SJQA 3DFEA 1P9QC 1HR0J 1KD1T 2DYAA 4P75A 3T1YJ 1ZA2B 2KT5A 3QT5A 2DNKA 3AXMA 1FWKA 5AXMA 1AFIA 5I3PA 3HVRA 3CDUA 4O0IA 4WJBA 4K4TA 5EUHA 4X84A 2W2MP 5E3PA 1S9EB 2XLJA 1OSDA 3PJWA 1FJGJ 1RCOB 3CUNA 4DQQA 2MMYA 5H9FK 3HSDA 5CYMA 2I0XA 5A6PA 1RT6B 3KLEA 2W9CB 2CQIA 2FUG9 1MU2A 3N4WA 3ZZUA 4HHJA 1N5YB 3GYXB 1LQ9A 4BWMA 1IBKF 3C8YA 2BE9B 3I32A 3HHLA 3NMRA 3K7RA 1PG5B 5E41A 1N56A 3WC2A 1QDUB 2R2SA 5KFWA 4NEZA 4YMEA 2MKKA 3UR0A 1S57A 4MTPA 1I6JA 2OPRA 1KRPA 4JI1F 2GJIA 4A8YA 3C6UB 3AJ1A 4LVOP 2ZUAA 4WU2A 4TQRA 1HBMB 3TP2A 1HBOB 3DM2A 3HHNB 2PO4A 3MAAB 2RRAA 4LRBA 3QGHA 3VAFA 5DQIA 1SL2A 3FFIB 4TVAB 1S49A 4MKVA 1W26A 3FNNA 1FRMA 1MSWD 3HVAA 1S77D 3J7ZT 2Z0GA 2XC9A 2Q66A 3H25A 3MXHP 2MQPA 4CWBA 4J9MA 4TY8A 4KFBB 1FT8A 2F65A 3RB4A 4BBYA 3R2DJ 4IH7A 1JLEA 2BRLA 3H8YA 3DOLA 2J0WA 2VFRA 1XERA 5I42A 2AYBA 1VJQA 2XYPB 1HNVA 3W2VB 2V67A 2LQ5A 2WB1D 1C4CA 3JTPA 4CLKA 1H98A 2G0IA 1IKXA 2ZH2A 1Q7YT 2W01A 1NK0A 4FYYB 1HLWA 3KK1B 2VQFF 4YOEA 3GONA 3LGHA 2W2QP 1KBRA 3A8KA 3J81U 5CXTA 1UCNA 1RHKB 1UZDA 4X4UA 4DSLA 5IV3A 4KGKA 1IBKJ 3G96A 2CQ4A 2CNOB 4DV3F 4NI2A 1WC3A 3N79A 4PXBA 4JB8B 2O1PA 3OXFA 2QJ3A 3MPWA 2C3PA 3MMAB 4XK8C 2RDJA 5KFCA 4JI8F 3V6JA 3CCLS 1R0AA 4P72A 4CLLA 3MUTP 2KXNB 3PHTA 4JV5J 1OJ4A 1PYOB 2QSFA 5AE1A 4HVZA 4DJBA 4IH5A 4JV1A 4NYPA 4BS2A 2FZGB 4NLWA 4XPCA 1J27A 1RTZA 3WIUA 3MCNA 4WU3A 3PKYA 3R5JB 2XY6A 4A48A 1Q7LB 2FJAB 4LSNB 1JLAA 1NSKL 3QT8A 3MURP 1DJ0A 2NCKL 3D28A 3GQCA 3A4TA 3LF0A 4JI4F 1DBDA 2LMIA 1BQNB 4AXIA 2ZH5A 2DNHA 2ZVIA 2HFOA 1F5BA 2VG6B 4EGLA 3M9MB 1I3OB 2FQQB 3PXGa 1S0MA 3EVMA 5EX3A 1VRTA 3KTQA 1RAEB 3IAM9 2N3LA 3CPWR 2D9PA 1VRUA 3UCZP 1F5AA 5LMNF 2COLA 1S1TB 1Y5NB 4LVNP 4V1Ak 1LK7A 3FRZA 1WC0A 1HNIB 2WCXA 2NYHA 3I55S 1U48A 2ZH3A 3EZUA 4IYQA 1RDRA 4OZ1A 1J5EF 2ZZNA 1WSVA 4X64J 5J1EB 1S6PB 2HQFA 2IYGA 2QL5B 4N77A 3IMQJ 3KDNA 1N48A 1QTMA 1RT4B 3TYTA 4OI0A 2BQ3A 2IA6A 3CDWA 2KG1A 2LYVA 5KFDA 4ZPWR 1ZPWX 1R43A 4QCLA 3OHBA 4KSEB 1FD8A 4LRFA 1CEZA 4U8VA 2HNDB 3AT1B 1FKPA 2Z8QA 4JI8J 4ED4A 1AROP 4PYAA 3ELHA 4KAIA 4JI5F 4F3QA 4ED7A 2BJ9A 1S99A 3V81B 4ZVPB 1YI2S 3GIRA 4DU8A 5KFFA 2HHPA 4A8MP 3A8IA 3OR2A 2PSZA 3CCZA 3RZAA 8ATCB 4Y2KA 4ECYA 3SSSA 2P6SA 2Z58B 3MD3A 1U6ZA 3U1NA 4EI2A 2B5JB 1F9HA 1PGZA 1LWXA 2C2ZB 4RNNA 1FTRA 2X7IA 3MPDA 3TO8A 2CQ1A 1K1SA 1V9OA 1FDNA 1PJ6A 1JIHA 4ETXA 4XO0A 1NKBA 4ID8A 4E0DA 2RILA 5DM6Q 3DDNA 2RRBA 4URGA 2HWIA 1A6LA 2F8MA 1IBLF 1N5TA 2XMJA 2IMWP 2Y1LB 1X60A 4CM2A 3MEDA 1IKVA 1HQUB 2V8HA 2KJWA 4WP3A 3NAIA 2GMLA 3T1HF 4TYAA 1WJ9A 4ZHRA 1R8BA 1IWAA 4F0HA 4IDKB 2B9EA 4IR1A 4JI2J 4EU0A 2XO7A 3CD7A 2QO3A 2BE2A 4OYWA 5AXLA 1HPZB 2QLWA 2ZZMA 3DLKB 4E8UA 1TKZA 4KGVB 3IBFB 1J5EJ 1F1BB 1XN9A 3PHEA 1C0UB 2HVZA 5KG6A 4ZJQA 4ANEA 4IRCA 1EP4A 1TV6A 1VQ6S 1PJ7A 1G7CB 1Q16B 2EEYA 2PT0A 2ZE2A 5D0RA 3JSYA 3CSKA 4USJC 1C4AA 1K44A 1S7HA 4PPDA 1JLFB 1QSYA 4YR3A 2YNHA 3AOCA 2HQGA 3FDSA 3ETMA 1BMQB 5EHHA 2GVDB 2XB2D 4UOCA 2I2YA 1U1OA 1ZAVA 1MN7A 2DEIA 4UTGA 2IAJB 5DLFA 2QYCA 4DCPB 3PW7A 1IJEB 2DR6A 1TUWA 3QRQA 3BO4A 4IG0B 5KFZA 4YB1P 1HWUA 3MM7B 2JZ5A 4PG4A 1QM9A 1S0OA 3KK2B 5KFBA 2GA7A 3F73A 2XSJB 4EEYA 4PUOA 1VK3A 4DN9A 3CDBA 2AGPA 4DL4A 2B4UA 3IR5B 3SZ2A 1RT2B 4DX5A 2MQMA 3NAHA 1ZH5A 3PM9A 4MYUA 2VG7B 2RDDA 3AOBA 1YTYA 1OPZA 3Q86A 3P5TL 3W63A 3M8YA 5HVFA 1NRKA 4ECWA 3C14B 1IBLJ 1FXLA 3IG1A 4I7FB 5C24B 2QA4G 4C8YA 4DR6F 2GS8A 3AB2B 2RU9A 4DV4J 4NA2A 1FDAA 1Y3JA 4RKUC 4DI6A 4YY3F 5JVGQ 5KFXA 4CDIA 2Z30B 2DY1A 1RHUB 3M32A 3HZEA 4EYHB 3LP1A 2RUGA 5FD1A 4A46A 3OJUA 2LQ8A 4X4VA 2CJQA 4C8MA 1O5JA 1CJKA 2WSFC 4ED8A 4DUYF 4ELVA 2ASYA 1XTZA 2VZ9A 2RH3A 9ATCB 3C15A 2H65B 2E1CA 1FDBA 1VQ7S 3E01A 1H6KX 1N54B 2BJ3A 5CYMB 1U1KA 4QOTA 3QLHA 5M2PA 2AEMA 1VQKS 2HFNA 3LANA 4HDHA 3ZNJ1 3KLEB 3EVOA 3PX0A 3Q2SC 1U1RA 3TVKA 1MU2B 1M5HA 3FBBA 5L9XA 2FJWA 1DARA 3Q8VA 3C46A 3KLFA 4PXCA 3T9ZA 2A6OA 3B4MA 1Q86T 2YH0A 2Z2MA 5B0BA 1VC5A 2K7KA 1SJ4P 3ZZPA 5HQ8A 2XNRA 2V69A 4A8QA 3EXYA 3OW2R 2OPRB 3OTBA 2HURA 3CC7S 1M90T 4PEOA 1KVKA 5LJ3Y 2VC0A 1XMOF 3NWGA 1T94A 1RUSA 2AJ2A 2OFHX 2CA9A 3CCJS 3DM2B 2HBRB 1S6UA 3WQPA 2KU7A 4USMA 1QY7A 2KTQA 5GMEA 1F9EB 4OHVA 1MG7A 2HS4A 4YY3J 5DDPC 4TY8B 2JEJA 4M5KA 3SI8A 2CNLB 4FF3A 2C3UA 2V0NA 4ALZA 4DQIA 5IT0A 1ACMB 1JLEB 2J0XA 1UFKA 2FB0A 1WHYA 3DOLB 5A2QU 1JK9B 2J0SD 4LFBF 5I42B 2DR7A 3LW5C 1U7LA 1HNVB 2WBMA 4DUYJ 4N41A 3L09A 3D6FB 1NPRA 2IM2A 2BE7D 3JSBA 3Q24A 1IKXB 5CABA 1EZZB 4M5NA 4QPTA 4UY85 3NEKA 4OHXA 2QYGA 2F7VA 3GJTB 2EK1A 2R8GA 3H4DA 3TVZA 4J9KA 1WEXA 2IJRA 5HMWA 2HHWA 2OH2A 2BOPA 2LU2A 3CTRA 5KFPA 4OJGA 2W4DA 5CCLA 2CPXA 3M05A 5KG0A 2V6AA 2XYHB 2ATLA 5D4NA 2B3TB 4XAKA 5KG3A 3M7VA 3NGUA 5D8HB 3BGRA 1U2RA 4B3TJ 1I1GA 4NI2B 4F67A 1VDHA 3CIMA 2A1BA 1U47A 1BQMA 4C8KA 4X65J 3MM6A 2YKMA 1X5TA 2PDAA 2FHKA 1RT7B 2C2NA 2NLWA 4Z7YA 2ZJQQ 1BUXA 1OY8A 1R0AB 3EE3A 2K3IA 2OPQA 2HHVA 2E9ZA 2YKPA 3SIPB 3PX6A 1R8HA 2HBYB 3PACA 2ZBIA 1NPPA 1XC9A 2ACYA 3M2UA 1EB0A 4WP8A 3OL6A 2BKPA 3NY0A 4HL9A 2AZ1A 5AJ3F 5E7OB 4LF4F 3O5TB 4YDXA 4OYPA 1REVA 3AD9C 1JLAB 4ER8A 1WOSA 2HQIA 4ELTA 2EBGA 1YJRA 1VOMA 4CZCA 4DUZJ 4XDDA 1UJ4A 2UUWA 1LWFA 3MECA 3ZFVA 2Q6CA 5M2RA 2XLIA 2A2CA 4K0KF 4RW8B 3TR5A 3TW0A 3DHWC 3QJLA 2AMCB 4DR7J 4RNMA 3M6XA 2AF6A 3HFVA 5HJXA 3H98A 4K4XA 2HNYA 4H4OA 4LFBJ 4F50A 1WEYA 2GJ2A 1KFDA 1VRTB 2BR0A 1HWJA 1VRUB 3M8QA 1TAQA 1I51B 1SJFA 4K4YA 2AD9A 3ZTQA 3FBEA 3H59A 1WHWA 1TKXA 4F3MA 1GEHA 1RT1A 1LK5A 1NPKA 1NEEA 5DZ7A 3R7NB 4ZVHA 8RUCA 2EFQA 5DLGA 5L9NA 2ZOFA 3RTVA 3THTA 1RISA 4DBQA 4EZ6A 5CCMA 3UCGA 3W7BA 5LM7E 7FDRA 4WIIA 1OYDA 4LF6J 3HX9A 4WFAQ 2AV5A 2AZ3A 3RGIA 3MMJA 1GQEA 1CQNA 4NZ0A 2LEAA 9RUBA 1LFWA 1UL3A 4DUTA 3G86A 1SL0A 1NDCA 1DFDA 3QGPA 2P9GA 4NLDA 2G2OA 1TQLA 1FKPB 2MLZA 1FXDA 2NSCA 3Q22A 3L7UA 2E1RA 4ZDNA 1B64A 5K20B 1M5PC 2HBZB 1RT5A 2FD2A 5F3ZA 4I67A 3GR0A 2W1BA 2KXHA 5F3TA 5IT9Y 2LVWA 3OR2B 2MZ1A 5IZHA 5F41A 4AE5A 1TFWA 4C3LA 3H7HB 2YX4A 4ED5A 2ALZA 4IOBA 3NG8A 2YX7A 5AJ3J 5ETTA 4ZMMA 3HF5A 3QMQA 1UVKA 1QAJA 1X5OA 2ZC4A 3PTWA 5EDWA 1SQFA 1YSJA 2POKA 2OD4A 4A8OA 4RUHA 4Y2AA 3T6JA 4Z37A 4QR2A 1RQ0A 1U1LA 1F3VA 4LF9J 3B6BA 3VAMA 5CYQA 5I4MA 3D54A 3KG4A 1N34F 3RB3A 3I6PA 3MEDB 2RNEA 1IKVB 1EX8A 3SFGA 3BV8A 3MEGA 3A3OB 4ZHRB 5L1IA 3MM8A 4X62F 3QIPA 2VDHA 3KJNB 2VPWB 5ETKA 3ILOA 3CVKA 2BE2B 4F25A 1XEZA 3BGFA 1TKZB 5GAHU 4LF8F 1TMMA 1U25A 2Z56B 3QT7A 1KS2A 3J7YU 2R7WA 3M6UA 4O23A 2IRUA 3QATA 4NMXA 1SKWA 1EP4B 1TV6B 3BPDA 5RUBA 4DSEA 2FHOB 3D5MA 1FESA 1XQIA 2ZE2B 1UZHA 4IRDA 4Y2MA 5LMUF 2EPIA 4WYWA 3H2VE 3O3LA 5T7LA 4NWBA 1NBEB 4KHMA 3EXCX 4ITSA 2C22A 2JLFA 4K50A 1EHWA 4J9LA 2AIRB 4LF7F 5J1NA 2DHSA 5HMYA 2NPFA 2IPOB 2W4CA 1NSPA 5D4PA 3CDAA 2ZJRQ 1VHFA 4OI3A 3I56S 4NLTA 4ZLLA 3W65A 2CPFA 3UW1A 1YK9A 1DRZA 2N7YA 2Y1IA 1Y9OA 4PUOB 1Z4UA 2CPEA 4AL5A 4YP3A 3FC9A 4I6AA 3O2IA 2V2QA 3TQEA 1CG2A 5IC6B 1JXLA 4FF2A 1M5KC 2N7CA 3VV2B 2PI5A 4CYUA 1T3OA 3QWUA 5DETA 3VF0B 3M8PA 2B4VA 3PYDA 1FK9A 2GC8A 3IM8A 2WK4A 3KLGA 3CCES 2OSQA 4MIWA 3TANA 2P5VA 3IG1B 1X9WA 3R5CA 4B9VA 2NZCA 1XR7A 1N34J 1EQ0A 2BM0A 3QRRA 3D0GE 3K5NA 4B9NA 4DR1F 2L9WA 3JTOA 4G1PA 3RRHA 3M32B 5IQQA 1WHXA 4IFYA 2CQPA 3LP1B 3OSNA 3FSXA 1YJVA 4IO1A 1KQFB 5D6GA 3SCKE 3I82A 5GAEU 1Q95G 5ETRA 1CJKB 4B9SA 4LF8J 4C98A 2VJUA 1Q82T 1RTHA 2HFUA 1SH2A 1DY3A 1F0XA 3MD1A 4LF2A 1U6FA 2UXDF 2H4WB 3ZZYA 3E01B 3R1HA 1RP5A 1H3DA 2JVRA 3MFIA 2VOPA 3HHLC 3QLHB 4P2FA 3MR7A 1VYAA 2R4FA 5LMUJ 1S9GA 4MT1A 4Y3CA 1ZM3A 3K5LA 3CC2S 5CA5A 2P6TA 1JNZB 2NYIA 5CD4A 1K1QA 1RKIA 4O3PA 2I9SA 2C2RA 4P7TA 3NCQA 1PBAA 4DQSA 1ZZFA 3DOKA 3KLFB 1UW9A 1V3SA 3OTOJ 4PXEA 4WE1A 2K06A 1BWEA 1W25A 2DPJA 2WAQD 2KZMA 4WFXA 4ECSA 5J2QB 4IRKA 2Y0SD 1APSA 3WX8A 2PI4A 2MQOA 1UPPA 2YH1A 3CJRA 5HQMA 1Y4ZB 2JNJA 2XO6A 2ZZTA 2M2BA 4EK2A 3HSGA 1RYRA 4ZPAA 1BY9A 1LOUA 3KHHA 4DR3F 4LFAF 2MZJA 4M5HA 3VGVA 1EKSA 3GU0A 1OQ3A 3THVA 1T11A 1VBYA 4OZLA 2KI2A 2GVZB 4NA1A 2GFFA 4MH8A 4J9UE 3FKBA 4NRUA 3HVTA 1UVJA 2QL7B 4DR1J 4DQRA 2F8EX 1QSSA 3RBDA 3JAMY 2HPUA 3KHGA 5LSOA 5JMNA 2IVMA 4NLRA 4JBCA 2J6TA 4L73A 3TUPA 2FYXA 2X51A 3K2YA 2FHMA 4ZIVA 3M30A 3LAKA 4D3HA 2CPJA 2FTRA 2JH3A 4DR2F 3W9HA 3NXZA 1VLYA 2W7OA 1AT1B 2J0QD 2R42A 3TUIC 4L3NA 4WTYA 5KFEA 3PRDA 3MUMP 2F9JA 5KFQA 2HYIB 2XZDB 4L72B 2H48B 1IBCB 3S1TA 2J7UA 4ZJOA 2HFVA 3D6HB 2DGOA 2HHSA 3PEHA 5U47A 2B9WA 3BN7A 3BGRB 1YJ7A 1BQMB 4NZ6A 3MM6B 2CPIA 2YKMB 1VMBA 3VHQA 5J1PA 1WG5A 5KFUA 1N0VC 1XJWB 1OSCA 3K58A 4NPOA 1WSRA 2OPQB 3H0PA 4F4ZA 2MGZA 2EKNA 4DL2A 4PR6A 1YHQS 3M2UB 3WIVA 4FXWA 2EVZA 1YZ6A 2HS3A 4MFBA 3HHKA 4N47A 2ROEA 2ZEJA 4S0MA 1REVB 1E6YA 4BLGA 2HEKA 5DS7A 5C2GA 2J9CA 5EWEA 2HSEB 1R89A 3AD7C 3MECB 2NQPA 3KLHA 2VFTA 1J5OA 5IV4A 2IBOA 1FRLA 2HNYB 4H4OB 2GO8A 3UDEA 3EZ5A 2FPHX 3AFGA 5GVQA 4YEAA 3CB4A 4L74A 2IY5B 2LEPA 4XDCA 3M8QB 2MY7A 3KUHA 1ZTWA 3ZZ0A 3DRYA 4DR2J 4ZCIA 5HJYA 3ET6A 3TNVA 2DCLA 1TKXB 1VQMS 2YWWA 1RT1B 1GTHA 3V6DA 4QR1A 2QE5A 4HI1A 4V19J 1RACB 2FIUA 1U0HA 3MI7X 3KMQA 2CJYB 2IM1A 4FKXA 2Y8YA 4PABA 4QW8A 3OTEA 1NB7A 4M1KA 3GJQB 2YKQA 3GIIA 4UZBA 2CNKB 1WOPA 1YBAA 2D3ZA 5D77A 4DV1F 4LBPA 3D3CJ 1PILA 4O4RA 2V34A 1L3SA 2AYMA 4U96A 4KBIA 5L1LA 2ZNZA 4KE5A 5G0RA 4ECTA 1EQMA 4K7QA 2YWFA 2Y1JA 3U02A 1RT5B 2KHDA 5L38A 2ZH1A 1L5UA 2Z2YB 5BXIA 3Q8PB 5HATA 3CW2C 4F26A 4I56A 4HTIA 1PSDA 1RTDB 4GKKF 1N36F 4XTTA 4GRSA 2PMZD 3UO0A 4FNIA 1X5PA 1JJHA 2DH9A 3QQCD 5EGYA 5LOQA 2KM8B 3D7SB 2YKOA 4XIUA 3W66A 3IC1A 1HYSA 2BQUA 1KQSR 5HP1A 1Q53A 5KFOA 1YZ7A 2ZJPQ 2XG8A 4RBVA 5HROB 2QIFA 5F0WA 2CQ2A 4ZOSA 1UAWA 1PYSB 3TX0A 4FVCA 4JYAJ 5CYQB 4OI1A 3OVBA 1MMDA 5CH7B 4DV5J 4DLEA 2VPYB 3GILA 1HQEA 3G6ES 2MKIA 4ZITA 4USVA 5DRKA 1JKHA 4NLOA 2ZBRA 1B3TA 3MEGB 3MM8B 4RW6A 2P9CA 3GR1A 2V63A 3QIPB 3BQ2A 1HBNA 3R6LB 4QBUA 4ZVTB 1XMQF 2W25A 3TEGA 1IQZA 3CJ4A 1SVDA 2MKJA 2CKWA 2K1RA 3CJSA 2VICA 2NUUG 4X4OA 1NK6A 4NLXA 4YB5A 2NXEA 4I2QB 4WXOA 3GTYX 5F9LA 1B0PA 4Y65A 4HI2A 2ZFHA 3C6TA 1KFSA 4W98A 2G13A 2CUYA 1S1XA 1QAYA 2BW7A 2UUBF 5T7LB 1B0VA 2V9WA 1IXKA 4YN3B 3HXMA 4WZQA 3TJAA 2XWXA 4MIAA 1YQHA 3DNCA 3PO5A 5KOWA 2CJXB 1EKRA 1X31C 3VAJA 2L3MA 1O0PA 2YBVA 2KL8A 5DG7A 3KWMA 2EFNA 2BM1A 4Q5VA 3D2WA 2UUTA 4B3SF 4ES3A 2RE1A 1T9WA 2YNGA 2HAIA 4GKJF 5ETLA 3DXSX 5HMXA 4CNZA 5KFNA 2J7KA 4UZCA 5MLCV 3FCWA 4ED2A 3NRBA 1KLNA 4CYUB 4UOGA 1QLNA 5THWA 3CWJA 2HGMA 1FK9B 4DX7A 2GAHC 3VVUA 3P6YC 4QU6A 2MPUA 3KLGB 4ED3A 2GJFA 1L3TA 1U1PA 3MOZA 1FEHA 2QLJB 3N6MA 1R31A 1TFYA 3RBXA 5H9EJ 5F8JA 3FVYA 4IFYB 1L3VA 3KYLA 2XULA 2QMXA 4USIA 3I9ZA 3HP6A 5ETPA 3E8OA 1FEEA 1RTHB 4USKA 1QVGR 1HNWJ 2VUGA 5IXUA 7FD1A 3BGUA 4OYIA 4MJKA 4IFVA 2HHQA 1I94F 2WONB 2XTJP 2UUBJ 4NXNF 4CLTA 3PNIA 2FZKB 4K4UA 1SUQB 2MLXA 3UFCX 3DOKB 1KDNA 3IWLA 1FO1A 3P49B 1S6OA 1SCJB 4WE1B 3NKYA 2MQQA 2HAFA 2XMVA 1SH3A 4OI6A 3GZ7A 4TQSA 2XM3A 1LW2B 2AQ4A 2O66A 2H1YA 1GK8A 1FFGB 2HHHJ 2WB4A 4GKJJ 2QTWA 3DLGA 3D67A 2IFXA 1MN9A 4X66J 3DLBA 3U1MA 2YWHA 3GWCA 1FX4A 3PR5B 2PD1A 5LSLA 3KNAA 3MR3A 4DF4A 4RX6A 2ASDA 3VGSA 3TA0A 2E5JA 4IH6A 2VQEF 4C0HA 4X4PA 2BKNA 2BVZA 1WD6A 1FJCA 1JJ4A 4ATNA 3ICLA 3HVTB 4KH0B 3AODA 5E5NA 4J9PA 2ZWPA 1ZBTA 2HLTA 3MMBB 2VL1A 1SV5A 3LH2S 3PYFA 4M5IA 3UE2A 3HT0A 1KHWA 4F0MA 3D66A 1FRXA 2UXCJ 5ETQA 3BDPA 2ILYA 4O3QA 3TZWA 5FLXY 1YDLA 3M30B 1F9FA 5H9EK 4G65A 2JX2A 3IO1A 3NCPA 2AWZA 2Y9HA 2MDAA 3OFGA 4DR5J 4B3MJ 4JI3F 3NGKA 1DQ9A 3NWRA 1H2UX 5ETNA 3U7JA 2HFSA 1CVJA 4ID5A 1I94J 2PEHA 5ADZA 4ETZA 2JEGA 4TXSA 4K4SA 4RJVA 2DT9A 4DPYA 2C1EB 2C3MA 3RW7A 1TK8A 4DPXA 4DU7A 4LUBA 5IFMA 4QWAA 3ILJA 1GMWA 4EWTA 2IVFB 3MPYA 1JLCA 4NOHA 1VQ5S 2X1FA 3VGTA 3I5CA 2BYCA 2MZQA 4IUFA 1UWAA 3X1LB 4QYZK 2AX0A 3FEXB 1R3NA 3ULHA 3RBEA 2MGZB 3H20A 3FMWA 4G6VB 4C8LA 4NLVA 4LR7A 3KKFA 2IVYA 4DR4F 4USUA 3D1OA 3THPA 2MQLA 1AUDA 3N6NA 1LV5A 1MWYA 4ED6A 2CADA 4FF1A 1X4BA 3GP9A 4LFCF 4OZ2A 3EGNA 2E9TA 1FTCA 2QMWA 2QC3A 4MFBB 2L9DA 2H54B 2R7UA 2W24A 5LXRA 1SKRA 2GCFA 2KB2A 2QL9B 3CT9A 2VQEJ 3SYZA 4Y0FA 2IJNA 3IRWP 3S6EA 4OZ3A 4F4XA 2RQCA 3J7A1 3JTNA 3CXCR 4MAKA 3M4XA 1J5OB 1FE4A 4Y34A 3U27A 4ZLNA 3BR8A 4LBIA 3M9NB 2RVJA 5GAGU 4KO0B 6AT1B 1RI7A 1HNZJ 5GAHI 2LXUA 2UVWA 4IQXA 4OJHA 3F56A 2DNQA 2CPYA 4ZVOB 1NJWA 3R27A 1CJTA 1HNXJ 1OPIA 4YHHF 4OZ0A 3OPKA 4LR8A 4O3NA 3MEEA 3ET6B 1WI8A 3DKDA 1BE4A 3UDLA 3V6DB 1DTQA 2CVIA 4RU2A 1U0HB 1EJ7L 3J80Y 4F4KA 4HTJA 1Q8KA 4LSZB 3I5BA 2Y0BB 1O8BA 1B70B 3TAMA 4BC7A 1PCAA 1G6BA 2MKYA 2ZOGA 1RHJB 2C28A 4K4WA 1KONA 3PRBA 3RJMB 2QV6A 1FXRA 3I5AA 5HVGA 1IWGA 1VLOA 2ZM6F 2EKYA 3EZOA 5G0RB 1H7XA 1U45A 1E6VA 1QE1A 4DS4A 2A0FB 3BBFA 2ASJA 4RO0A 1KLMA 4CH7A 3JS9A 5ITHA 4DR4J 3OLAA 4DSKA 3R2CJ 4NRTA 3BYRA 2DXFA 5M2UA 4WFYA 3PJ9A 2MB0B 3RUBL 1KOOA 2O5DA 1C1BB 1FWLA 4NLYA 4PAAA 4PWDA 3E2EA 3HKWA 5BYRA 4CCHA 1PIEA 1X4AA 4JI6F 2C42A 3FRYA 1HYSB 2EBEA 5HP1B 3D1QA 2H5JB 5F8MA 3DRSB 1D1UA 3NGSA 1IR1A 2RDIA 3US5A 3S01A 4TU7A 1NSQA 3FUYA 1HQEB 4H54A 3N6LA 2LECA 4R5PA 1DAXA 1S72S 1HD0A 3CULA 1JKHB 4PQUA 4WIQA 1RAFB 4F0KA 2QGFB 3DLEA 3TZZA 2X1GA 5BYQA 4RW6B 1OQ6A 2HVHA 3LQVA 3QAUA 3CIZA 1D9FA 1HBNB 2ZKTA 4KTQA 1U02A 1WKJA 1VJWA 2KVIA 4YB6A 2XWYA 1CBKA 1QTNB 4WFNQ 5EWFA 2K1RB 3MM9A 2VHGA 2ZDPA 3HKZD 4IOAQ 1XR6A 1RAAB 1CJVA 4P7VA 1HKAA 2Y8WA 3L9ZA 4HH0A 2G1HA 4DPUA 3C6TB 3VALA 2UVRA 1S1XB 2ZM6J 3FZBA 1WTBA 3MF5A 3P45B 2VODA 3I4PA 3TUZC 5BR8F 2NXJA 3MM5A 2EFGA 1XIQA 4OI4A 5LSRA 5K8PA 4PWUA 2OEKA 3HPOA 4G1QB 3DOMA 5HBMA 1RE1B 3LALA 2KT3A 5B0DA 3HT3A 4UQGA 4IG3A 1FHTA 3SQGA 2LA4A 2HWTA 3D3BJ 2GZOA 3GSIA 4EUVA 2YQ3A 1DTTA 1F3FA 2VV5A 2MTLA 1FF2A 4FYXB 3Q83A 4MKBA 1S1WA 2CIMA 2CRLA 1WG1A 4N8NA 4LREA 3TX8A 5L1JA 3G6YA 1YIJS 4I2PB 5E2QA 1RA6A 3WC0A 1WC5A 2FGOA 1DLOA 3CCSS 2LLZA 4WTOB 4Q0BB 5DQHA 4WBFA 5A8KA 2RB7A 1JLBA 1H2TZ 1UEKA 3A3NB 1WI6A 3Q8QB 1GXLA 1XNRJ 2BXJA 1WOOA 5J2MA 3C2PA 4EBDA 4U8YA 2B7BB 3HHDA 5KT5A 4RR5A 4RUBA 3CJ0A 3BO2A 2FJXA 4U95A 1RCXB 4IFVB 4GVBA 2DHXA 3CJ5A 3N01A 4RW4A 3VWSA 2E5HA 3DYAA 1D3WA 4UW2A 2B9YA 4ANCA 1UJ5A 1GFWB 4F2RA 3MAQA 2ZBQA 2LDYA 2GHWA 1SH0A 1U6BA 2RT3A 1O6XA 1SIZA 2ADBA 1LKZA 1ICEB 1N88A 4DG1A 1P27B 4DPOA 2RQMA 3UI3A 4C97A 4AXJA 1PO6A 2CYYA 3MPVA 2KFZA 3V6HA 2LQBA 3KDOA 2DNMA 5HN0A 3AQPA 1B4SA 3ILLA 4OYMA 3I0SA 1U2CA 1HI0P 4OZJA 4AD6A 2E44A 2XMUA 3I96A 3DLGB 2FHJA 4M5DA 3G8QA 2BACA 4CO2A 4BC9A 5J2PB 3NNHA 4PXDA 2IMOA 2MSTA 3KUEA 4CLZA 5E3CA 2PMWA 3RBZA 2JDJA 1P1TA 5C25B 3FSIA 4M95A 1G3OA 3VZIA 4ZLJA 4ZPTR 2J9DE 2G0JA 2ZH4A 4JI1J 2VC1A 3IAS9 1SV5B 3AY0A 5DQGA 1NHKL 1NO8A 5IM0A 1HWIA 1ROFA 3R6GB 3CEDA 3VAIA 3V4IA 3R8YA 2DHHA 3OXLA 5C42A 1TL1B 5KOXA 4DDFA 2G2ZA 4ES1A 3NOGA 2V2VA 2HHUA 3RG6A 1RAGB 3BSCA 4ID5B 1ZS6A 3EJMA 2MKCA 2V9KA 1FRJA 5HSPA 3GIKA 3IGNA 1NJIT 2JFDA 3J81Y 5D15A 3R3TA 5I3QA 3P96A 5JXSA 4IKAA 3VAHA 2PEBA 1LXNA 1TAUA 1RWPB 1JLGA 5A8WA 4A8KA 2VU5A 2ZKUA 4O44A 5KFYA 5FDLA 3CJKB 2KRRA 1X0PA 2JLGA 4J37A 5F8HA 3AHPA 2VQFJ 1JQGA 5KFJA 1H72C 2HWHA 4MYTA 1LW0A 1ZTTA 2OFGX 1JWWA 3DLJA 3CDEA 1AFJA 2DXDA 2VH7A 4LRDA 2X1AA 3ADAC 5KG5A 2DK2A 4DV3J 1T95A 4CT8A 2DRDA 4DL3A 4M63A 2V2KA 1N5YA 2HVIA 3KUGA 2K8GA 2W8KA 4NXMF 2RUSA 4P2XA 3I87A 3UN5A 1AUSL 4C2MA 4MK8A 1YRXA 4C8NA 1FVSA 3SXLA 3N9UC 2B0GA 1X4CA 2XY5A 1ZETA 3EX7B 1SXLA 1V5IB 5HLFA 2EK6A 3DI6A 4ICLA 2R2TA 4JI0F 2X3DA 3BBBA 3W64A 4LF5F 1U49A 2IRYA 3MTJA 4WCEQ 2UP1A 2J7WA 4PZVA 3K59A 2MYFA 2RS8A 3SCIE 2UVVA 1CJTB 2CG4A 1QUPA 2AYGA 1H73A 3BB5A 5KT6A 3G8TA 3GG0A 2BMBA 4RLEA 5DG9A 4LRAA 2E7WA 1HQ2A 1U8SA 4JI4J 3RYLA 2VB6A 1DTQB 2ZITA 4MK9A 2RS2A 4F4YA 1Q8IA 2UU9F 1KVJA 3TAMB 4DL7A 2FVQA 1PC5A 4ILMA 2IIHA 4FPIA 4KFBA 3E51A 3KHRA 3NOCA 2EFVA 2E5LF 1RWOB 2B9XA 4CIOA 2JWNA 3NNCA 5LMNJ 4LQ3A 2PA8D 4KR0B 2PA3A 3QBCA 1YX2A 1E6VB 1QE1B 1HBUA 4LSLA 4J9OA 3MGJA 4KGZB 5EWGA 4L76A 4I69A 2V68A 3TI0A 3TAPA 3KK1A 1Y3KA 2ILZA 4A4JA 3BBCA 5KFTA 3ZXWA 1UKUA 3AOAA 3ISNC 3GV8B 1JLQA 2YTCA 3R97A 3HVWA 3OD2A 4BCAA 1TK0A 4RW7A 2WW4A 4TU9A 2LFVA 2BV3A 1EETA 5AE2A 1RKJA 4NMLA 4QIWD 4NX9A 4JI5J 3NL0A 2GIFA 4QWDA 3VVTA 4RUAA 1HI1A 1X9MA 1JMTA 4CO1A 4WZMA 2DD8S 2QMUB 3D0IE 2LDIA 2AJ1A 2JSXA 4R5PB 3BKUA 4LF5J 1UVNA 3W60A 4PQUB 1KTVA 2J8SA 2QA4S 3HHLD 5K14A 2FJVA 2F4VF 2JJ4D 2VKRA 1UFWA 3GCXP 4CH1A 2CXEA 2U1AA 4H4KA 4DN0A 1K0VA 1FNOA 3NP5A 3AA8A 4ZVQB 4A8FA 4A8WA 4ILLA 1OS5A 2V94A 3MM9B 1H74A 3C19A 1S4FA 2RHQB 1IM4A 1TELA 2UU9J 3UPFA 2VBZA 5ETSA 4PG6A 4Q8FA 2GW8A 1CJVB 1W7WA 1N52B 3O1LA 4O4GA 4M8LA 5CAAA 1T05A 2NPIA 2ZHOA 1ZM9A 4TNOA 3T1HJ 2R2UA 2V8VA 4DV7F 3RB6A 2UUAF 4I6WA 3V5RA 3FSYA 2HQ3A 1FNXH 3M8WA 3BGOP 4DSIA 4PG5A 4M5LA 3NGDA 2DCUB 3CJ8A 2DO4A 4P74A 2D1CA 1U2FA 2XMMA 3BYPA 3BZQA 2ATCB 2M52A 2DGXA 1K73T 5E3RA 2VOOA 1KQKA 1TZ0A 4AL7A 4OL8A 5CHCB 1NHVA 1N5QA 1C1CA 3DOMB 5HBMB 3IWNC 2XHWA 3IS9A 3UDCA 2HG4A 3D1HA 4G3IA 1R0BG 3JYTA 4U7CA 2A2DA 2YKNA 3CO9A 1CULA 3HLUA 4IG3B 3IBWA 1LXJA 1N6QA 1H7WA 3KOAA 3PRVA 3SQGB 1Y0HA 4KH1B 5KAKA 4ES2A 4F4WA 1NK5A 4K4VA 5HAOA 1DTTB 3LA0A 2KKHA 2DNPA 2CPHA 2HZCA 2V5HG 2DR8A 1L3KA 4KGXB 1NJZA 3HHLB 1EIYB 2HZVA 2E1MC 2Z57B 4TN2A 3CCTA 3SQOP 3M6VA 2XY7A 4CH0S 1H0HB 4CLSA 2FHJD 2WVDA 1VBKA 3H5XA 3GLJA 1ZAXA 1DLOB 3P3DA 4FKYA 3RAQA 4YQWA 3M2RA 4K2JA 1JLBB 1VQ8S 5KFRA 1TL5A 4PYDA 2CZ4A 3ZZOA 1N33F 1RWVB 4KHPF 1M5SA 5J2MB 1G2EA 3MPUB 5ETVA 1F60B 4NE9C 4WFBQ 3GFXA 3N0VA 2NUHA 4GMKA 1W2BR 1Z2LA 4DR6J 4GVBB 2KVQE 4RW4B 3DYAB 3IGVA 1NLKL 2DGVA 4H4MA 4OX9F 3W9JA 1ZYQA 4CO0A 4DV7J 1D8ZA 2UUAJ 1UP1A 2W2PP 4RBUA 5HI7A 3HK2A 1HR0F 4B02A 4F3OA 1Y5IB 2JC0A 3T1YF 5DO2A 1ZPVA 1HARA 2IJFA 4DG1B 2QX0A 3A1YG 1NZ8A 4QIVA 4M5MA 2HW3A 1Y00A 2I1RA 1TKDA 3GE9A 4IO9Q 4EBCA 3M1VA 1X9SA 3I0SB 1QSLA 4QYRA 4JV2A 4L3KA 1YRUA 4ZCMA 7AT1B 4M5DB 2HRUA 3R9LA 4CTAA 1NK9A 1FWPA 2G2YA 5GADU 3DN9A 4W90B 2GGPA 3HSJA 2DNOA 2UXBF 2CFXA 1VQYA 1D09B 3SBMA 4KV8A 1UJ6A 5HL7Q 3BO3A 4MKAA 4MKYA 3L7PA 2M9KA 3H2LA 1KTQA 5SZTA 2IAJA 2W7PA 2MJUA 3PIOQ 2MXYA 5JVHQ 4ZPDA 2F8HA 2D7SA 2ABYA 5KT4A 1WORA 1GMVA 4X4TA 3MM7A 4J9NA 3C66A 4ENOA 2QN6B 4ZVUB 5IM0B 1XMOJ 3I31A 3CGIA 3EUNA 4WKYA 2V2ZA 1ULRA 5F9NA 3PVXA 3V4IB 4KHPJ 3VAKA 1TU0B 1TR0A 4DEZA 5A2QY 2DGWA 2OJ3A 5F8GA 1R7IA 3P4UB 2GX8A 3PV8A 5C2CA 1B7FA 6FDRA 1PAEX 2F9DA 4ZVRB 1YGYA 1YBUA 1FERA 5J2NA 4OX9J 4FYVB 2E29A 1Q78A 5EN1A 2HIQA 2DRBA 4FYDA 4UUXA 4ZVEA 1T9UA 3ZTOA 5A6WA 3A8JA 2KYXA 3P5BP 1B99A 4EFAC 2KH9A 2BZ2A 3SEOA 1JLGB 3M2VA 5A8WB 1GH8A 4HDGA 2LXFA 1NSAA 4O44B 2OP5A 5FDLB 1KEKA 4A8SA 5F8NA 3OR1A 2RU3A 2HVDA 2B6AA 4I64A 3PCOB 3K0JA 4RW9A 2M7SA 1WF0A 4CLUA 5T41A 1ELOA 5D0EA 5D4LA 1LW0B 2EC0A 4W4MA 4DPWA 3MR6A 4J9SA 1RBLA 2E7XA 2CJAA 1F6TA 4DPTA 4NLGA 2UXBJ 3QNWB 4F02A 1S48A 1VIOA 4G1IA 4ZKAA 4U7UD 2XI3A 1V3ZA 1WWHA 2ZDOA 3CJ2A 1T3NA 2Z2ZA 2L08A 2VDIA 3OTCA 2IC3A 1S1UA 1Y7PA 3VQTA 1SB6A 1NDPA 1ZOTA 2BQRA 1L3UA 1WF1A 2GMHA 4O3OA 4DOZA 5HLFB 3AD8C 3DI6B 4ICLB 3G6XA 2HBQB 2YQ1A 4JV5F 2EC2A 2UV8A 3LWMA 4LF4J 1RXOB 2AEJA 4AT1B 2OLWA 4FXDA 5CZVA 1KC8T 4GO7X 3LP0A 1AW0A 2DNLA 1VC6A 1P8GA 4EO6A 1VQLS 2APOA 1Q8BA 5MAOA 4MMOA 4UY8T 5AXNA 1DQ8A 2VONA 3H2UB 4K0KJ 1N5SA 4B08A 3QSYB 1WUUA 2QT7A 3MDFA 1YITS 2HIYA 1VBZA 3DU6A 8AT1B 1VQOS 3UN3A 4X4NA 4WP9A 3CNQP 3B82A 3EDRB 2QLBB 2OHDA 1X4DA 3FZ2A 3KMSA 4OYBA 5DJBA 1OYEA 3JSRA 4Q2LA 3NS6A 1ZZNA 2CQ0A 4AFFA 1HBUB 4LSLB 2RRNA 1YJTA 3BF4A 1HWKA 4ZLPA 3TWZA 4FZVA 1O51A 2YY3A 3OFEA 3V4MA 1YRTA 4N8OA 2IM0A 1AXQA 2EWHA 4X64F 2K3KA 4CLWA 5JUMA 5K9FA 2CG8A 4QR0A 3M6WA 1JLQB 3S7RA 1WKLA 4RW7B 2A18A 2YNHB 3O6QA 3QT6A 1EETB 2JEIA 1B7YB 4P71A 1Z2ZA 3PZPA 3ENQA 2NZ4A 4ZP9A 3RW6A 2RF2A 3EM1A 3P8BB 1AZSA 1T03A 1D9DA 4K59A 4C8ZA 3B78A 1RT7A 3LP2A 3SDEA 2BANA 3IFEA 1RWMB 2KFYA 2MQ8A 4J90A 1Z1ZA 4ZPCA 1HMVA 2DO0A 3VZHA 1N8RT 2YNIA 1OMSA 2DGTA 3BKFA 1BGXT 3ZC4A 1WC1A 2D9OA 4B3OA 5K14B 1OY6A 2VASA 2CPDA 1UEVA 1ZM4A 2EW9A 1GNKA 2EXUA 3G87A 4KB7A 1V6HA 4F4AA 1IR2A 3BS9A 2XHCA 3S8SA 2H4YB 3GYNA 3FJ2A 3EPIA 1VR6A 4ZP7A 1Y11A 1NK4A 2IHR1 3PEJA 4Y6IA 2FVCA 3PO4A 1U8WA 2DH7A 1VIXA 2I38A 3HJVA 1DHMA 4FDFA 2ZH7A 1WNEA 4J9VA 2P8IA 1YWXA 4O4GB 2WVFA 1T05B 2FLNA 5KT3A 3NGTA 4RW8A 3VR1A 3JQKA 1HWLA 3D6MB 4TU8A 1GMUA 4X62J 4DF8A 1HHSA 2DNNA 4OX8A 1R0CB 4TY9A 3UD5A 3ZNUA 4PG7A 2C3YA 2FLLA 4YR2A 2VPZB 3HM9A 1JJCB 2Q43A 3MUVP 3CCMS 1NCLA 3I4HX 4JI2F 4KHRA 3V2UC 5DM7Q 4DV6F 5F8IA 1RWWB 4CQ1A 2I5JA 3OV7A 3C15B 1TL3A 2DR9A 2ZH6A 5B0GA 3K17A 2R7XA 2HQDA 1C1CB 5E0OA 2H5EA 1S6QA 3IS9B 3IXQA 5GMDA 2IBKA 3JYTB 4CO3A 4NYZA 2YKNB 1CULB 4U7UK 1N6QB 1P1LA 3MZIA 2BA9A 1IBMF 4C3KA 3G8SA 3HI9A 3MOJB 1UA0A 4LF7J 1T8EA 2RKIA 3LPYA 2CQCA 4CM0A 4R0JA 1T02A 2O67A 3CJQA 3UD3P 4OYAA 2XYGB 1VQSA 5LJ5Y 2B43A 1RAJA 2RAQA 2B51A 1RU1A 2M4MA 3OFFA 3M2RB 2NREA 1SBRA 1Q81T 2CWXA 5KFHA 4WYLA 4K8RA 1U1MA 3D9BA 3PW2A 3DCAA 3AAWB 2YPYA 1N4LA 3O8WA 4RL1A 5HO4A 2R7TA 3H5SA 2HNZA 1SQGA 3W3SA 4YFUA 3Q0AA 1YG0A 1RZMA 2C2OB 4X4SA 3CMAS 4PRFA 5A76A 1C0TA 3GFHA 2MY8A 3MWBA 2PIIA 3K8WA 1SPBP 2LXIA 1CSJA 4H4MB 2OELA 3T5KA 4DL6A 3HJFA 4DV4F 3RAXA 4HYKA 2PE8A 1SJ3P 3VGUA 2MJNA 4OQJA 3HD1A 2XGQA 3EWGA 4B9LA 1TKTA 4DSJA 4Z2XA 4DV6J 2CJ9A 2DHAA 1TTHB 2W9BA 3Q8YA 3W62A 2UXDJ 4Q43A 4OYZA 2R8HA 1FKAF 3M1VB 2WVBA 3I0RA 4FN5A 3LWLA 2DH8A 2GNKA 5ETOA 2OO4A 4QIGA 2GQCA 1RHMB 4ZVSB 1IBMJ 3R1LA 1TUGB 4Q2MA 4ED1A 4J5OA 4CTAB 5IOLA 5CZXA 2GGPB 4E2FB 1OO0B 4P2MA 4ZIWA 3TEHB 4KV8B 2MZTA 2F63A 2X3GA 3EVWA 2MHEA 3GIJA 2LCWA 1KN6A 3F41A 2AX1A 1FKOA 4RNFA 3DU5A 4WWSA 5SUHA 1A9NB 4LJMA 3K89A 3MCSA 2F3JA 3T9NA 2CQDA 1WHVA 1FRHA 3FQLA 3H42A 2PFDA 2WSEC 2P2CB 2VKZG 4DR3J 3KLIA 5KG4A 3MCMA 4LFAJ 1U24A 1YJNS 2WSCC 1ITPA 5DZ6A 4WFZA 2OPSA 3MEKA 1NKEA 3IA0A 1NB2A 2D3OR 1ZA1B 5KFSA 4DHVA 2DR5A 2RSQA 5D4OA 1RB0A 2E66A 5D3GA 1KKHA 2F1FA 4Q45A 1LWFB 1IKYA 5J2NB 5LXYA 3HCXA 1RT3A 3T19A 3CCQS 1NDLA 3UN2A 3PFEA 3UWTA 3NCRA 4ECXA 3ZZRA 3FQKA 2XEXA 1BQXA 1F2HA 3UDVA 2DNGA 1NMEB 1B0TA 2RD5C 3M2VB 4ZJLA 2M3DA 2F4FA 4OLPA 3OR1B 3R7SB 1NDKA 2B6AB 2P9EA 4U67Q 4FF4A 4LRCA 3AQOA 5F0UA 1KWMA 2FY8A 4QWBA 4ZVGA 2H3EB 2YXLA 2DVIA 1HI8A 1OY9A 4RW9B 2XZTB 1ZM2A 1RWNB 2R3VA 2HGNA 3M9OB 1HHQA 2G0CA 4R25A 4K4ZA 5KT7A 3BM7A 4AUKA 4FBTA 2Z2LA 2CPZA 2ZHAA 5K8MA 1RSCA 2FY1A 4ANDA 3POTA 3H4BA 3DC2A 1FDDA 2VBYA 2DHGA 4B3TF 2QSWA 4X65F 3SSRA 3M8SA 3RR7A 4ZPVR 2ACMA 2IC3B 2OUGA 2OMOA 1BHNA 1S1UB 1HW9A 4M94A 3UNGC 2Q1LA 1NNDA 5J2QA 1W2IA 1FVQA 4WK1A 3R5GA 2X1BA 3J81j 2FLPA 1VQPS 3CD5A 3QJJA 3N28A 1XWLA 3D6TB 4X4QA 2V4JA 1VS3A 2EFPA 4FP9A 2DY9A 1M1KT 4DX6A 3L95X 1KQGB 4DSFA 5C7PA 3LGMA 4U6PA 4OLOA 2CQBA 5B0FA 1FCAA 2AJ0A 4KRWA 2D3UA 5L46A 1Q8LA 1WDDA 3ZZZA 3T5HA 2DB1A 3KK3A 4DL0C 3LP0B 2KYZA 3CC4S 2DGUA 5LT5A 2BOAA 1HD1A 2MZRA 1U1QA 1GX5A 3BR9A 2GVZA 1RABB 1BC6A 2JFKA 4USWA 3OFHA 2DKOB 3A3PB 1U4BA 2OPPA 3TA1A 4DUZF 3NMAA 1SQEA 4OZ5A 1IVZA 1S12A 3MHYA 4RNOA 4NLUA 2BRKA 2DNZA 1RLCL 2V8DA 2ZVSA 4DR7F 5BYSA 1KR4A 4BHQA 4J7CA 3PKMA 3G9CA 1VRQC 1JXVA 2M88A 4ZPBA 4OFZA 4RZRA 1UVMA 3RRGA 4OIXA 1CS4A 3VCDA 1MNEA 1Q5VA 1PKUA 1RHRB 2AEFA 2BJDA 3NS5A 4KIAA 2XMWA 4DV1J 3EGZA 2XCPA 2MZSA 2N82B 4ERDA 4LF6F 1Q0NA 1NAQA 2IM3A 2HZAA 4NLQA 3GJSB 2DNYA 1NXIA 2Y1RI 5DGAA 4MK7A 2XQCA 2RF2B 2C2KB 3IN5A 2CDQA 1AZSB 1T03B 1RAIB 3HFKA 1WKKA 2E5IA 1CJUA 4LBHA 4Y2CA 3JQJA 4AQYF 2EI5A 3LP2B 2Q6BA 4ZA1A 3SDEB 2BANB 4DZDA 3W61A 1XR5A 4OHYA 1N36J 4GKKJ 3OTDA 3R7BB 1HMVB 2YKAA 5DDOC 1M5OC 4H4KC 2YNIB 4NZ7A 2VD3A 2R8JA 4NCAA 4EO8A 3ZTRA 4B3OB 1X7VA 3EMTA 5E3AA 3UCUP 5BJRA 1XBWA 4LIWA 2IDLA 3DMJA 3TVYA 4CLFA 3DLLQ 3J7AN 4HHHA 2XI2A 4ZN1A 1RGVA 1S1VA 3M8PB 2VFVA 2EG2A 1BXNA 2RQ4A 4KT0C 2JHEA 2YNFA 2FJBB 2ZNYA 3I9V9 1TL4A 3OUYA 5IT9U 4LF9F 2LKZA 2BUNA 3DGVA 1PYTA 2PN6A 2WBRA 2MKSA 2ASLA 1UEUA 4F7VA 2J9DA 4NCGA 1N32F 1S59A 2R9LA 1SI9A 1XMQJ 2VFUA 4JP8A 1FNMA 4PQAA 1H2VZ 4IQMA 4DFMA 1TVRA 2DRAA 3W5ZA 1P6TA 2NXNA 2GO9A 5L8RC 4PWWA 4I0WA 1LEOA 2I5JB 1UA1A 2XCAA 1TL3B 3TARA 3E3XA 1U0SA 1S6QB 5GADI 4I6YA 4NEYA 2SXLA 1VCTA 3HMJG 3FMBA 5KG2A 3C3LA 1S9GB 4OJ3A 2ALYB 2CAJA 2XMKA 4MIBA 2CQ3A 1KSPA 2UUCF 2V8GA 2B7CB 3OL9A 3TRGA 3MR5A 2RIJA 2RKIB 2FVPA 1X0FA 2GMJA 1FRIA 4OZNA 1M1GA 4RNHA 4AQYJ 3K5MA 2YVSA 4ZCLA 1RWUA 2QA2A 2BABA 2XZWA 1PAUB 3LUYA 3GIMA 2ZH9A 4B3SJ 1SIWB 1NM2A 1GXUA 3FBCA 1KHVA 2H9ZA 1XMBA 1N0UA 1NH8A 3IR7B 1RTDA 4C11A 2HLUA 2G1DA 2E1AA 1FD2A 2ADCA 1RWXB 3QAEA 3DRPA 2HNZB 4FXVA 5ETMA 4HH1A 3M8ZA 3CE8A 2HK2A 5AXKA 5K8OA 2AP6A 2VJVA 1YJUA 4A8XA 1C0TB 4CLYA 2H5IB 4EYIB 1S79A 3B4DA 5HROA 1X4EA 1IM6A 1QUVA 2KXFA 1RAHB 1HW8A 4DMZA 2ROPA 4UF4A 1N32J 4Y2IA 3SCLE 4CI0B 4QZVB 1DURA 4V19X 2V4RA 4KPYA 1RK8A 3OSPA 3PYEA 1HL6A 1J2VA 1TKTB 4C48A 1X5SA 1K0TA 1IKWA 2ERRA 4PKDB 2RQKA 2W9BB 5DDQC 4JOUA 3TA2A 2V4QA 4ECQA 5D0GA 4KKOA 2E5GA 3SV3A 5FIIA 3I0RB 1U1NA 2RJZA 2XS2A 3LOUA 1SC6A 3QJPA 4I2QA 1VQ4S 4NXNJ 3A13A 1IJFB 1TUVA 2FLOA 4KY3A 4IR9A 2UUCJ 5H1SV 1Q4RA 4ILRA 3NBPA 2WHOA 2VG5A 1Y5LB 2M8HA 2YWEA 3RU0A 4LMZA 2L41A 4EZ9A 1K9MT 2GHPA 3T1AA 4DV0F 2NR0A 4M5JA 2VPXB 1FKOB 1H38A 1LWEA 3CF5Q 3OTOF 2DBBA 4L75A 5LL6d 3RAMA 5I3UA 2BJ7A 2GIRA 3ZTPA 1FFSB 2MHNA 3OT9A 3A8EA 3KLIB 3IP0A 3IWXA 4FVMA 4IOCQ 2BJ8A 3KHLA 2AHOB 3N5FA 1YJ9S 1RWKB 3TJ8A 2OPSB 4OJ1A 3PDNA 5KG1A 1E6YB 2ZWOA 5KFKA 2KZZA 3QGIA 2IDEA 3OQ2A 3BSNA 1F2GA 3BH7B 2DIVA 3ZTSA 1VBXA 2WW8A 3D0HE 1SL1A 1JJ2R 5D3GB 4OV1A 1IKYB 1R6VA 3EPGA 6FD1A 1UWBA 3KLHB 3H5YA 3W1YC 2BJ1A 1RT3B 2N4DA 3WZ0A 4QW9A 3QZ7A 1SC3B 2GQ2A 4F36A 1U26A 1TL7A 2GV1A 3UQSA 3ISND 3Q2TC 2VA2A 4JUZA 3J7YI 4OI2A 3W8GA 1TMJA 2A10A 1N5VA 3DHXA 1RBAA 2OTJS 2MSSA 3EGWB 2AJQA 1UTAA 2AT1B 1WG4A 4JI3J 1URNA 2QEXS 2FVRA 1RBOB 1RAOA 2C2EA 2LP4A 2Q79A 3FEZA 1UVLA 4N56A 4OMFG 4NLSA 2W4PA 2CNNB 2CZ9A 2KN4A 4EBEA 3H5UA 3JAMU 4ELUA 2GAGC 4PCQA 2UVUA 3JQMA 3JB9k 1REGX 2WONA 3QPIA 1R27B 3QFHA 3POTB 4FBUA 2BKOA 4HR2A 1SUQA 2A6MA 4DV0J 3QSIA 3QRPA 4HKQA 4RWWA 4QIFA 2CQGA 3DDKA 3EDQB 4GO5X 4D3GA 1NK7A 1JX4A 3EGVA 2OI2A 1A0OB 4NA3A 2XMTA 4NLPA 5HVHA 2VBWA 3B8HA 3KJVA 1LW2A 4LFCJ 2V4JB 4QU7A 1NKCA 5E33A 2B8QA 1SJRA 2OEMA 2W9AA 3W2WA 3V6KA 1V5VA 5KFLA 4CT9A 5HMZA 2UV8G 1VGYA 3KK3B 1RTJA 4W92B 3GCWP 2HHXA 4FNHA 1QAIA 4HACA 3M8RA 3RR8A 2QZ8A 4RUCA 1JNRB 2XMAA 4N7TA 2V50A 1Q5YA 2AKWB 2OSRA 3W8PA 2DXEA 1SC4B 2OPPB 1T7PA 4NASA 1F5CA 5GAEI 3Q89A 3MMBA 4JV0A 1URRA 4B17A 3CD0A 3K57A 4TLRA 2WTFA 4JI7F 5KFIA 3G82A 4YHHJ 2E9RX 5B0EA 1HHTP 1FRKA 1RTIA 3T6BA 4P52A 2CVEA 4P9SA 2D74B 1R8AA 4TKTA 2J8AA 4DS5A 1FFWB 1S97A 3KG1A 1SC1B 1NU4A 4LQ9A 1CS4B 5A8RA 2IA0A 4ECUA 2HS0A 3PY8A 1PBUA 4ED0A 2I8EA 4B3RF 4QWEA 5GMKa 3F44A 4OX7A 2XS7A 4RBTA 1NUEA 4ZS6A 2AGQA 2R7OA 3MCOA 3TZYA 3KLVA 2XSFA 3K5OA 1WTFA 2NSBA 3CO0P 2H51B 3NLCA 4UQTA 1S0VA 2K2PA 2W8LA 4KC5A 4K5SA 2HMIA 1GTEA 2ZH8A 2QA1A 2CDRB 1CJUB 5G4DA 3SFUA 4C8OA 1MWZA 2FJEB 4I4BA 5T14A 3IRXA 4UOHA 4CNYA 1VQNS 2G9OA 3GG1A 2Q3PA 3T5JA 2VFSA 4WF9Q 1EAYC 4OHWA 1VQ9S 2JEFA 2YNGB 1NHUA 4CP5A 4JI6J 2CJKA 4ECVA 3DGPA 4TLQA 3LAMA 3CJ3A 3DMJB 1GT8A 3L4BC 3OJSA 3UNYA 2WVCA 5A0YA 2V8PA 3IM9A 3DXBA 4WK3A 4KYZA 3FBFA 2OGUA 4QWCA 1S1VB 5HQLA 2OKQA 1X4FA 3N5BA 4K2XA 2YNFB 3PIPQ 2W7AA 3VAGA 3OUYB 3UD4P 1HA1A 3LGNA 4EMDA 4JYAF 4BDPA 3DRRA 3QGGA 3BDEA 1AA1B 4NCGB 4JI7J 4DV5F 3TZXA 1UVIA 5KFGA 2G4BA 4KO0A 2M5YA 4F2SA 5L1KA 2BEFA 3GV7B 4P6QA 1TVRB 3MMCA 4OYOA 4P73A 4WXWA 1S4EA 2Y3YA 3HDSA 2PMHA 2DGSA 1FE0A 1PC4A 5AE3A 4B3RJ 2ZBPA 3UVJA 3WX4A 2B8PA 2RHSB 1Q1KA 1UPMB 4R8UA 2KFNA 5DDRC 2WOMA 1PJ5A 4C6AA 4C7QA 1MLAA 1SKSA 2AW0A 3H40A 3KXDA 5EX0A 2OAUA 1LWCA 4URSA 5BR8J 1X8DA 1M5VC 3PW0A 1R8PA 4KJIA 2KHCA 2ZD1A 3TQ1A 3F0NA 1VI7A 4E98A 5KTQA 1Q79A 4YS2A 4L6V3 4FYWB 4I68A 1S76D 2R8KA 3ENVA 1RHQB 4ECZA 1T0TV 2OD6A 2MLYA 3PJXA 1NK8A 5C5JA 1X4GA 4URQU 3JSMA 3BQ1A 3CCVS 4HEA9 1T9VA 2DJWA 1NZAA 1GMWD 2C2MB 4C11B 2HGLA 2DEJA 1C1BA 1VHIA 2B4OA 4Q44A 3DRPB 3FCVA 4FS1A 2QLXA 2YPZA 5CD4H 4RWXA 2LQ9A 3GJRB 4Y28C 4DX8H 3BSAA 4KGMA 5KFMA 1RADB 4XPEA 2GQQA 3Q23A 1HFEL 3T3FA 4B9MA 2R7RA 3T5LA 3DRSA 3L3CA 1KNZA 3Q8SB 3C16A 1CLFA 2M0GB 1VC0A 2HRYA 3HD2A 5D78A 2I6WA 4Q8EA 2D69A 1G4CA 1MROA 1AYEA 2E7VA 2L9NA 2CQHA 3PX4A 3ONQA 1IKWB 1WF2A 4NYOA 2KDOA 1SJ1A 2B4PA 1R8CA 1FX2A 1M1HA 2KG0A 5K8NA 4WKRA 3OL7A 4KKOB 4DLGA 3BGLA 4AL6A 1HNWF 4ZK7M 3QO9A 3ITHA 3DLHA 4OX6A 2ZHBA 4DFJA 1S0NA 1MMNA 4B9UA 3NBPB 2VG5B 3ENWA 2AU0A 4OV6A 3G4SS 3HO1A 1DQAA 4FPRA 2JL9A 1JLCB 5B09A 3GSDA 1BD6A 3EICA 3HZGA 3HULA 1OIAA 1RJJA 2HK3A 1LWEB 1VISA 1S9EA 2WRMA 2BX6A 1RLDA 1YKWA 2D3O1 1D8YA 5I3UB 2FJDB 4J91A 4CRJA 1EARA 4G1QA 1WC6A 3WDOA 3ZZTA 1YLXA 4HT7A 2C2DA 1CQMA 1RT6A 4P10A 3BPSP 2W9CA 1KP6A 2HHHF 2DTJA 3TUJC 5CYJA 1QVFR 3K8VA 4X66F 2NXUA 2M8DB 2YQ0A 2O3DA 5L39A 4DFPA 4O3RA 3KJFB 3WBZA 2DITA 2LU1A 1LFPA 2N3OA 4DFKA 4DV2F 1UMJA 1UW4A 3SSQA 4I2PA 3GFZA 2XS5A 4J9QA 2QFJA 3T41A 1UWBB 3FCHA 1LNQA 1ZAWA 3D4JA 4AYBD 4Q0BA 4ZN3A 3GV5B 2R2RA 2NXCA 3CMQA 1WDTA 3C6UA 4ZCKA 2QLFB 3OLBA 1TL7B 1YVFA 3GFYA 4ZP8A 3SV4A 1AB8A 3MTKA 1S5ZA 2OMLA 2UXCF 2R7VA 2QG9B 1HBMA 1HBOA 4F8RA 1GX6A 3MEEB 5DG8A 2HVEA 3HHEA 2F40A 3MAAA 3QZ8A 4RPFA 3FFIA 4GC7A 3SMZA 4C4WA 3LPEA 3QIDA 2O01C 1G1XA 1FI4A 4I1TA 3OXGA 2FDNA 1XNQF 2J9EA 4J9RA 5IC4B 1D0EA 4YUDA 3KNGA 4DR5F 4B3MF 2Z4PA 1MW7A 2HRTA 4UOFA 1RYSA 2L48A 4OYXA 3CD6S 1GXTA 2XNQA 2AYEA 3K5PA 2R7QA 3NS7B 4USHA 2ROGA 3PYGA 3FK4A 2FGCA 2KO1A 5FLXU 3R5BA 3W5YA 3W2VA 3U1LA 3OVSA 4QYZJ 2DNRA 4F04B 3KFWX 1KLMB 1NH7A 1OWXA 2LQJA 1P9YA 1UFLA 2DISA 2PGCA 2KJVA 3B54A 2GHVC 1JXEA 3KJVB 4LR9A 3PFOA 4PPZA 1TP7A 5HK4A 3CCRS 4K5RA 2PC6A 4PWDB 3AXKA 4USTA 2E1PA 4OHZA 3L7OA 2HKEA 3W2WB 5J2PA 1NJXA 4NXMJ 4CO4A 1NJYA 1RTJB 3R5DA 1UETA 3GYGA 2XBPA 4HACB 4DV2J 4R0EA 2F5GA 3TOQA 3G71S 1KOHA 4HLBA 2MKHA 2QFIA 4BWJA 5C25A 3GMGA 3MFHA 1IUJA 3MMAA 3QFWA 3AJ2A 2D41A 3Q8RB 1X4HA 4LT6A 2ZOMA 3GB0A 4JI0J 4DCOB 3FEYB 3PW5A 4DXLA 3QWPA 4QIEA 1TK5A 4HHUA 2KRBA 3DLEB 3DDIA 2W2OP 1FJEB 5KT2A 4O0NA 4LIRA 2LA6A 2AJFE 3G82B 3BEGB 1RTIB 1HNZF 3WHIA 3VQSA 4N5SA 2R8IA 2R7SA 2FC8A 1TL1A 2EG1A 3JXOA 5A8RB 2CJBA 3DRXA 2JOQA 4LSNA 4GC6A 4Y00A 1HNXF 1K47A 3MR2A 3ISZA 2MEWA 4UT4A 1XNQJ 3KJQB 2UZAA 3BQ0A 3A12A 2XGPA 1QAXA 2FVSA 1BQNA 1WC4A 2ZBCA 5B0AA 5AT1B 2M70A 2E5LJ 2VG6A 4M5GA 1M0SA 4WPAA 4NCBA 4DQPA 3NGRA 4PG8A 3AJDA 4NL5A 2J6UA 4UUWA 1K8AT 1BLUA 2BJEA 1C2PA 2J76E 3W9IA 2BDPA 3MM5B 1S1TA 2C3OA 2BW2A 2HMIB 4GVLA 4QPXA 3CJKA 1HNIA 2YWKA 2IYIA 5K5MA 3IRXB 3J80U 1WELA 1HIYA 5J1EA 2KT2A 2OEJA 5JJBA 3X3UA 2AJ4A 1S6PA 5CQGA 5FJ4A 2IRXA 1QJHA 2GIQA 4CLPA 1BWVA 3DGPB 4X2BA 1RT4A 1MWQA
chains in the Genus database with same CATH topology
4M5KA 3HT0A 3IP0A 1Q0NA 5ETRA 5ETLA 2BMBA 4F7VA 1HKAA 1RU1A 3HD2A 3ILJA 3MCMA 1EX8A 1CBKA 2F65A 3QBCA 3HSJA 3HSGA 3ILLA 5ETOA 5ETTA 1HQ2A 3ILIA 5ETQA 3HSDA 3UDEA 2QX0A 4M5GA 2F63A 4CRJA 1RB0A 1RU2A 3MCOA 5ETMA 1KBRA 1F9HA 4M5MA 1G4CA 1RAOA 3UD5A 4PZVA 1TMMA 3KUGA 4AD6A 1DY3A 4M5HA 3KUEA 3HSZA 1RTZA 2CG8A 5ETVA 3UDVA 1IM6A 3MCNA 5ETSA 1EQMA 4CYUB 1EQ0A 4M5NA 4M5JA 1TMJA 3HD1A 4CYUA 4M5LA 3HCXA 5ETNA 5ETKA 5ETPA 4M5IA 4CWBA 3ILOA 3KUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5K A;  3HT0 A;  3IP0 A;  1Q0N A;  5ETR A;  5ETL A;  2BMB A;  4F7V A;  1HKA A;  1RU1 A;  3HD2 A;  3ILJ A;  3MCM A;  1EX8 A;  1CBK A;  2F65 A;  3QBC A;  3HSJ A;  3HSG A;  3ILL A;  5ETO A;  5ETT A;  1HQ2 A;  3ILI A;  5ETQ A;  3HSD A;  3UDE A;  2QX0 A;  4M5G A;  2F63 A;  4CRJ A;  1RB0 A;  1RU2 A;  3MCO A;  5ETM A;  1KBR A;  1F9H A;  4M5M A;  1G4C A;  1RAO A;  3UD5 A;  4PZV A;  1TMM A;  3KUG A;  4AD6 A;  1DY3 A;  4M5H A;  3KUE A;  3HSZ A;  1RTZ A;  2CG8 A;  5ETV A;  3UDV A;  1IM6 A;  3MCN A;  5ETS A;  1EQM A;  4CYU B;  1EQ0 A;  4M5N A;  4M5J A;  1TMJ A;  3HD1 A;  4CYU A;  4M5L A;  3HCX A;  5ETN A;  5ETK A;  5ETP A;  4M5I A;  4CWB A;  3ILO A;  3KUH A; 
#chains in the Genus database with same CATH topology
 1T9T A;  5IS2 A;  2RML A;  3CJT A;  4C0O C;  5A0Y B;  1WAC A;  5IQ6 A;  2OTL S;  3AB4 B;  1T9Y A;  1S1W B;  2VBX A;  3LTO A;  4CO5 A;  2HND A;  5HAN A;  3OVA A;  1CC8 A;  5KFV A;  1YJW S;  2HQC A;  1CC7 A;  2OIH A;  3RB0 A;  2HHT A;  3BSO A;  4QJV A;  3V81 A;  3UR3 C;  1JB0 C;  4TYB A;  2AGO A;  5A8K B;  2WZ1 A;  4U9R A;  3DRR B;  4B9T A;  4KQZ A;  2F4V J;  1S10 A;  3CCW A;  5B0C A;  5IWA F;  2J6S A;  4ZVF A;  1DZ5 A;  3ENA A;  3Q8U A;  2HFZ A;  3FGV A;  1CPZ A;  5B7W A;  2B5J A;  3D68 A;  3BH6 B;  3SCJ E;  3MMC B;  4DL5 A;  2WVE A;  3KG0 A;  3CME S;  2U2F A;  1D9A A;  4LF1 A;  3AH6 A;  2EFO A;  3OHA A;  4DCJ B;  4C3M A;  3EYZ A;  3BN4 A;  3UVJ B;  2N4C A;  3IBC B;  4YDD B;  1XK8 A;  4R8U B;  4HT5 A;  3OL8 A;  2YX1 A;  2WOM B;  4RU9 A;  3R5A A;  3AA9 A;  1HQU A;  3BRE A;  1IR0 A;  3TJ9 A;  4X4R A;  4DZ6 A;  1LWC B;  3O44 A;  2DGQ A;  3ETO A;  4YB7 A;  3W5X A;  4IDK A;  4P2S A;  1A7G E;  3QYY A;  2ZD1 B;  4QQB A;  1HPZ A;  3DLK A;  5IT4 A;  5H9F J;  1SKU B;  2LEB A;  1R6Y A;  2VF3 A;  3GPA A;  4Z7C A;  2DIU A;  4N76 A;  1C0U A;  2CZV C;  3J7Z 5;  1GAO A;  2KM8 C;  1FJG F;  2QRR A;  3ILI A;  3JSM B;  4ZP6 A;  2YWG A;  5B08 A;  3TAQ A;  2ZC3 A;  2W2N P;  2NS1 B;  1T9X A;  3CCU S;  2ZUG A;  4C9D A;  5D0H A;  1V3R A;  2FZC B;  2JLE A;  1JLF A;  3RRK A;  1S9F A;  1IN0 A;  1MML A;  1FA0 A;  2CWK A;  3MAH A;  3PW4 A;  3PG9 A;  2GVD A;  3IR6 B;  2J5A A;  1IQT A;  1WEZ A;  2JVO A;  1YBT A;  2B56 A;  4A47 A;  5GAG I;  5KG7 A;  3G2X A;  5E3Q A;  3G6V A;  2A3J A;  4YR0 A;  5DGB A;  2DPI A;  1I5O B;  3H90 A;  1RU2 A;  1RA7 A;  2FC9 A;  4IG0 A;  2PFF B;  3KK2 A;  2XSJ A;  4Q7A A;  5IWA J;  1U09 A;  3C16 B;  5KFA A;  1FJ7 A;  1S7I A;  2K7J A;  3BJY A;  3PR4 A;  1N33 J;  1MRO B;  1RT2 A;  3OBI A;  3HSZ A;  5C42 B;  2BBE A;  1VK8 A;  2JRS A;  1XNR F;  1VFJ A;  2VG7 A;  2VA3 A;  3BKT A;  4FS2 A;  4ECR A;  3ZO7 A;  3LO3 A;  3HFZ B;  2XLK A;  5F8L A;  2MQN A;  4O3S A;  4DWI A;  3VTI A;  3C14 A;  2VIH A;  3QO9 B;  1QD1 A;  4I7F A;  5C24 A;  3NNA A;  1KVI A;  1Y10 A;  2JC1 A;  4KPC A;  3ITH B;  4C0B A;  1SJQ A;  3DFE A;  1P9Q C;  1HR0 J;  1KD1 T;  2DYA A;  4P75 A;  3T1Y J;  1ZA2 B;  2KT5 A;  3QT5 A;  2DNK A;  3AXM A;  1FWK A;  5AXM A;  1AFI A;  5I3P A;  3HVR A;  3CDU A;  4O0I A;  4WJB A;  4K4T A;  5EUH A;  4X84 A;  2W2M P;  5E3P A;  1S9E B;  2XLJ A;  1OSD A;  3PJW A;  1FJG J;  1RCO B;  3CUN A;  4DQQ A;  2MMY A;  5H9F K;  3HSD A;  5CYM A;  2I0X A;  5A6P A;  1RT6 B;  3KLE A;  2W9C B;  2CQI A;  2FUG 9;  1MU2 A;  3N4W A;  3ZZU A;  4HHJ A;  1N5Y B;  3GYX B;  1LQ9 A;  4BWM A;  1IBK F;  3C8Y A;  2BE9 B;  3I32 A;  3HHL A;  3NMR A;  3K7R A;  1PG5 B;  5E41 A;  1N56 A;  3WC2 A;  1QDU B;  2R2S A;  5KFW A;  4NEZ A;  4YME A;  2MKK A;  3UR0 A;  1S57 A;  4MTP A;  1I6J A;  2OPR A;  1KRP A;  4JI1 F;  2GJI A;  4A8Y A;  3C6U B;  3AJ1 A;  4LVO P;  2ZUA A;  4WU2 A;  4TQR A;  1HBM B;  3TP2 A;  1HBO B;  3DM2 A;  3HHN B;  2PO4 A;  3MAA B;  2RRA A;  4LRB A;  3QGH A;  3VAF A;  5DQI A;  1SL2 A;  3FFI B;  4TVA B;  1S49 A;  4MKV A;  1W26 A;  3FNN A;  1FRM A;  1MSW D;  3HVA A;  1S77 D;  3J7Z T;  2Z0G A;  2XC9 A;  2Q66 A;  3H25 A;  3MXH P;  2MQP A;  4CWB A;  4J9M A;  4TY8 A;  4KFB B;  1FT8 A;  2F65 A;  3RB4 A;  4BBY A;  3R2D J;  4IH7 A;  1JLE A;  2BRL A;  3H8Y A;  3DOL A;  2J0W A;  2VFR A;  1XER A;  5I42 A;  2AYB A;  1VJQ A;  2XYP B;  1HNV A;  3W2V B;  2V67 A;  2LQ5 A;  2WB1 D;  1C4C A;  3JTP A;  4CLK A;  1H98 A;  2G0I A;  1IKX A;  2ZH2 A;  1Q7Y T;  2W01 A;  1NK0 A;  4FYY B;  1HLW A;  3KK1 B;  2VQF F;  4YOE A;  3GON A;  3LGH A;  2W2Q P;  1KBR A;  3A8K A;  3J81 U;  5CXT A;  1UCN A;  1RHK B;  1UZD A;  4X4U A;  4DSL A;  5IV3 A;  4KGK A;  1IBK J;  3G96 A;  2CQ4 A;  2CNO B;  4DV3 F;  4NI2 A;  1WC3 A;  3N79 A;  4PXB A;  4JB8 B;  2O1P A;  3OXF A;  2QJ3 A;  3MPW A;  2C3P A;  3MMA B;  4XK8 C;  2RDJ A;  5KFC A;  4JI8 F;  3V6J A;  3CCL S;  1R0A A;  4P72 A;  4CLL A;  3MUT P;  2KXN B;  3PHT A;  4JV5 J;  1OJ4 A;  1PYO B;  2QSF A;  5AE1 A;  4HVZ A;  4DJB A;  4IH5 A;  4JV1 A;  4NYP A;  4BS2 A;  2FZG B;  4NLW A;  4XPC A;  1J27 A;  1RTZ A;  3WIU A;  3MCN A;  4WU3 A;  3PKY A;  3R5J B;  2XY6 A;  4A48 A;  1Q7L B;  2FJA B;  4LSN B;  1JLA A;  1NSK L;  3QT8 A;  3MUR P;  1DJ0 A;  2NCK L;  3D28 A;  3GQC A;  3A4T A;  3LF0 A;  4JI4 F;  1DBD A;  2LMI A;  1BQN B;  4AXI A;  2ZH5 A;  2DNH A;  2ZVI A;  2HFO A;  1F5B A;  2VG6 B;  4EGL A;  3M9M B;  1I3O B;  2FQQ B;  3PXG a;  1S0M A;  3EVM A;  5EX3 A;  1VRT A;  3KTQ A;  1RAE B;  3IAM 9;  2N3L A;  3CPW R;  2D9P A;  1VRU A;  3UCZ P;  1F5A A;  5LMN F;  2COL A;  1S1T B;  1Y5N B;  4LVN P;  4V1A k;  1LK7 A;  3FRZ A;  1WC0 A;  1HNI B;  2WCX A;  2NYH A;  3I55 S;  1U48 A;  2ZH3 A;  3EZU A;  4IYQ A;  1RDR A;  4OZ1 A;  1J5E F;  2ZZN A;  1WSV A;  4X64 J;  5J1E B;  1S6P B;  2HQF A;  2IYG A;  2QL5 B;  4N77 A;  3IMQ J;  3KDN A;  1N48 A;  1QTM A;  1RT4 B;  3TYT A;  4OI0 A;  2BQ3 A;  2IA6 A;  3CDW A;  2KG1 A;  2LYV A;  5KFD A;  4ZPW R;  1ZPW X;  1R43 A;  4QCL A;  3OHB A;  4KSE B;  1FD8 A;  4LRF A;  1CEZ A;  4U8V A;  2HND B;  3AT1 B;  1FKP A;  2Z8Q A;  4JI8 J;  4ED4 A;  1ARO P;  4PYA A;  3ELH A;  4KAI A;  4JI5 F;  4F3Q A;  4ED7 A;  2BJ9 A;  1S99 A;  3V81 B;  4ZVP B;  1YI2 S;  3GIR A;  4DU8 A;  5KFF A;  2HHP A;  4A8M P;  3A8I A;  3OR2 A;  2PSZ A;  3CCZ A;  3RZA A;  8ATC B;  4Y2K A;  4ECY A;  3SSS A;  2P6S A;  2Z58 B;  3MD3 A;  1U6Z A;  3U1N A;  4EI2 A;  2B5J B;  1F9H A;  1PGZ A;  1LWX A;  2C2Z B;  4RNN A;  1FTR A;  2X7I A;  3MPD A;  3TO8 A;  2CQ1 A;  1K1S A;  1V9O A;  1FDN A;  1PJ6 A;  1JIH A;  4ETX A;  4XO0 A;  1NKB A;  4ID8 A;  4E0D A;  2RIL A;  5DM6 Q;  3DDN A;  2RRB A;  4URG A;  2HWI A;  1A6L A;  2F8M A;  1IBL F;  1N5T A;  2XMJ A;  2IMW P;  2Y1L B;  1X60 A;  4CM2 A;  3MED A;  1IKV A;  1HQU B;  2V8H A;  2KJW A;  4WP3 A;  3NAI A;  2GML A;  3T1H F;  4TYA A;  1WJ9 A;  4ZHR A;  1R8B A;  1IWA A;  4F0H A;  4IDK B;  2B9E A;  4IR1 A;  4JI2 J;  4EU0 A;  2XO7 A;  3CD7 A;  2QO3 A;  2BE2 A;  4OYW A;  5AXL A;  1HPZ B;  2QLW A;  2ZZM A;  3DLK B;  4E8U A;  1TKZ A;  4KGV B;  3IBF B;  1J5E J;  1F1B B;  1XN9 A;  3PHE A;  1C0U B;  2HVZ A;  5KG6 A;  4ZJQ A;  4ANE A;  4IRC A;  1EP4 A;  1TV6 A;  1VQ6 S;  1PJ7 A;  1G7C B;  1Q16 B;  2EEY A;  2PT0 A;  2ZE2 A;  5D0R A;  3JSY A;  3CSK A;  4USJ C;  1C4A A;  1K44 A;  1S7H A;  4PPD A;  1JLF B;  1QSY A;  4YR3 A;  2YNH A;  3AOC A;  2HQG A;  3FDS A;  3ETM A;  1BMQ B;  5EHH A;  2GVD B;  2XB2 D;  4UOC A;  2I2Y A;  1U1O A;  1ZAV A;  1MN7 A;  2DEI A;  4UTG A;  2IAJ B;  5DLF A;  2QYC A;  4DCP B;  3PW7 A;  1IJE B;  2DR6 A;  1TUW A;  3QRQ A;  3BO4 A;  4IG0 B;  5KFZ A;  4YB1 P;  1HWU A;  3MM7 B;  2JZ5 A;  4PG4 A;  1QM9 A;  1S0O A;  3KK2 B;  5KFB A;  2GA7 A;  3F73 A;  2XSJ B;  4EEY A;  4PUO A;  1VK3 A;  4DN9 A;  3CDB A;  2AGP A;  4DL4 A;  2B4U A;  3IR5 B;  3SZ2 A;  1RT2 B;  4DX5 A;  2MQM A;  3NAH A;  1ZH5 A;  3PM9 A;  4MYU A;  2VG7 B;  2RDD A;  3AOB A;  1YTY A;  1OPZ A;  3Q86 A;  3P5T L;  3W63 A;  3M8Y A;  5HVF A;  1NRK A;  4ECW A;  3C14 B;  1IBL J;  1FXL A;  3IG1 A;  4I7F B;  5C24 B;  2QA4 G;  4C8Y A;  4DR6 F;  2GS8 A;  3AB2 B;  2RU9 A;  4DV4 J;  4NA2 A;  1FDA A;  1Y3J A;  4RKU C;  4DI6 A;  4YY3 F;  5JVG Q;  5KFX A;  4CDI A;  2Z30 B;  2DY1 A;  1RHU B;  3M32 A;  3HZE A;  4EYH B;  3LP1 A;  2RUG A;  5FD1 A;  4A46 A;  3OJU A;  2LQ8 A;  4X4V A;  2CJQ A;  4C8M A;  1O5J A;  1CJK A;  2WSF C;  4ED8 A;  4DUY F;  4ELV A;  2ASY A;  1XTZ A;  2VZ9 A;  2RH3 A;  9ATC B;  3C15 A;  2H65 B;  2E1C A;  1FDB A;  1VQ7 S;  3E01 A;  1H6K X;  1N54 B;  2BJ3 A;  5CYM B;  1U1K A;  4QOT A;  3QLH A;  5M2P A;  2AEM A;  1VQK S;  2HFN A;  3LAN A;  4HDH A;  3ZNJ 1;  3KLE B;  3EVO A;  3PX0 A;  3Q2S C;  1U1R A;  3TVK A;  1MU2 B;  1M5H A;  3FBB A;  5L9X A;  2FJW A;  1DAR A;  3Q8V A;  3C46 A;  3KLF A;  4PXC A;  3T9Z A;  2A6O A;  3B4M A;  1Q86 T;  2YH0 A;  2Z2M A;  5B0B A;  1VC5 A;  2K7K A;  1SJ4 P;  3ZZP A;  5HQ8 A;  2XNR A;  2V69 A;  4A8Q A;  3EXY A;  3OW2 R;  2OPR B;  3OTB A;  2HUR A;  3CC7 S;  1M90 T;  4PEO A;  1KVK A;  5LJ3 Y;  2VC0 A;  1XMO F;  3NWG A;  1T94 A;  1RUS A;  2AJ2 A;  2OFH X;  2CA9 A;  3CCJ S;  3DM2 B;  2HBR B;  1S6U A;  3WQP A;  2KU7 A;  4USM A;  1QY7 A;  2KTQ A;  5GME A;  1F9E B;  4OHV A;  1MG7 A;  2HS4 A;  4YY3 J;  5DDP C;  4TY8 B;  2JEJ A;  4M5K A;  3SI8 A;  2CNL B;  4FF3 A;  2C3U A;  2V0N A;  4ALZ A;  4DQI A;  5IT0 A;  1ACM B;  1JLE B;  2J0X A;  1UFK A;  2FB0 A;  1WHY A;  3DOL B;  5A2Q U;  1JK9 B;  2J0S D;  4LFB F;  5I42 B;  2DR7 A;  3LW5 C;  1U7L A;  1HNV B;  2WBM A;  4DUY J;  4N41 A;  3L09 A;  3D6F B;  1NPR A;  2IM2 A;  2BE7 D;  3JSB A;  3Q24 A;  1IKX B;  5CAB A;  1EZZ B;  4M5N A;  4QPT A;  4UY8 5;  3NEK A;  4OHX A;  2QYG A;  2F7V A;  3GJT B;  2EK1 A;  2R8G A;  3H4D A;  3TVZ A;  4J9K A;  1WEX A;  2IJR A;  5HMW A;  2HHW A;  2OH2 A;  2BOP A;  2LU2 A;  3CTR A;  5KFP A;  4OJG A;  2W4D A;  5CCL A;  2CPX A;  3M05 A;  5KG0 A;  2V6A A;  2XYH B;  2ATL A;  5D4N A;  2B3T B;  4XAK A;  5KG3 A;  3M7V A;  3NGU A;  5D8H B;  3BGR A;  1U2R A;  4B3T J;  1I1G A;  4NI2 B;  4F67 A;  1VDH A;  3CIM A;  2A1B A;  1U47 A;  1BQM A;  4C8K A;  4X65 J;  3MM6 A;  2YKM A;  1X5T A;  2PDA A;  2FHK A;  1RT7 B;  2C2N A;  2NLW A;  4Z7Y A;  2ZJQ Q;  1BUX A;  1OY8 A;  1R0A B;  3EE3 A;  2K3I A;  2OPQ A;  2HHV A;  2E9Z A;  2YKP A;  3SIP B;  3PX6 A;  1R8H A;  2HBY B;  3PAC A;  2ZBI A;  1NPP A;  1XC9 A;  2ACY A;  3M2U A;  1EB0 A;  4WP8 A;  3OL6 A;  2BKP A;  3NY0 A;  4HL9 A;  2AZ1 A;  5AJ3 F;  5E7O B;  4LF4 F;  3O5T B;  4YDX A;  4OYP A;  1REV A;  3AD9 C;  1JLA B;  4ER8 A;  1WOS A;  2HQI A;  4ELT A;  2EBG A;  1YJR A;  1VOM A;  4CZC A;  4DUZ J;  4XDD A;  1UJ4 A;  2UUW A;  1LWF A;  3MEC A;  3ZFV A;  2Q6C A;  5M2R A;  2XLI A;  2A2C A;  4K0K F;  4RW8 B;  3TR5 A;  3TW0 A;  3DHW C;  3QJL A;  2AMC B;  4DR7 J;  4RNM A;  3M6X A;  2AF6 A;  3HFV A;  5HJX A;  3H98 A;  4K4X A;  2HNY A;  4H4O A;  4LFB J;  4F50 A;  1WEY A;  2GJ2 A;  1KFD A;  1VRT B;  2BR0 A;  1HWJ A;  1VRU B;  3M8Q A;  1TAQ A;  1I51 B;  1SJF A;  4K4Y A;  2AD9 A;  3ZTQ A;  3FBE A;  3H59 A;  1WHW A;  1TKX A;  4F3M A;  1GEH A;  1RT1 A;  1LK5 A;  1NPK A;  1NEE A;  5DZ7 A;  3R7N B;  4ZVH A;  8RUC A;  2EFQ A;  5DLG A;  5L9N A;  2ZOF A;  3RTV A;  3THT A;  1RIS A;  4DBQ A;  4EZ6 A;  5CCM A;  3UCG A;  3W7B A;  5LM7 E;  7FDR A;  4WII A;  1OYD A;  4LF6 J;  3HX9 A;  4WFA Q;  2AV5 A;  2AZ3 A;  3RGI A;  3MMJ A;  1GQE A;  1CQN A;  4NZ0 A;  2LEA A;  9RUB A;  1LFW A;  1UL3 A;  4DUT A;  3G86 A;  1SL0 A;  1NDC A;  1DFD A;  3QGP A;  2P9G A;  4NLD A;  2G2O A;  1TQL A;  1FKP B;  2MLZ A;  1FXD A;  2NSC A;  3Q22 A;  3L7U A;  2E1R A;  4ZDN A;  1B64 A;  5K20 B;  1M5P C;  2HBZ B;  1RT5 A;  2FD2 A;  5F3Z A;  4I67 A;  3GR0 A;  2W1B A;  2KXH A;  5F3T A;  5IT9 Y;  2LVW A;  3OR2 B;  2MZ1 A;  5IZH A;  5F41 A;  4AE5 A;  1TFW A;  4C3L A;  3H7H B;  2YX4 A;  4ED5 A;  2ALZ A;  4IOB A;  3NG8 A;  2YX7 A;  5AJ3 J;  5ETT A;  4ZMM A;  3HF5 A;  3QMQ A;  1UVK A;  1QAJ A;  1X5O A;  2ZC4 A;  3PTW A;  5EDW A;  1SQF A;  1YSJ A;  2POK A;  2OD4 A;  4A8O A;  4RUH A;  4Y2A A;  3T6J A;  4Z37 A;  4QR2 A;  1RQ0 A;  1U1L A;  1F3V A;  4LF9 J;  3B6B A;  3VAM A;  5CYQ A;  5I4M A;  3D54 A;  3KG4 A;  1N34 F;  3RB3 A;  3I6P A;  3MED B;  2RNE A;  1IKV B;  1EX8 A;  3SFG A;  3BV8 A;  3MEG A;  3A3O B;  4ZHR B;  5L1I A;  3MM8 A;  4X62 F;  3QIP A;  2VDH A;  3KJN B;  2VPW B;  5ETK A;  3ILO A;  3CVK A;  2BE2 B;  4F25 A;  1XEZ A;  3BGF A;  1TKZ B;  5GAH U;  4LF8 F;  1TMM A;  1U25 A;  2Z56 B;  3QT7 A;  1KS2 A;  3J7Y U;  2R7W A;  3M6U A;  4O23 A;  2IRU A;  3QAT A;  4NMX A;  1SKW A;  1EP4 B;  1TV6 B;  3BPD A;  5RUB A;  4DSE A;  2FHO B;  3D5M A;  1FES A;  1XQI A;  2ZE2 B;  1UZH A;  4IRD A;  4Y2M A;  5LMU F;  2EPI A;  4WYW A;  3H2V E;  3O3L A;  5T7L A;  4NWB A;  1NBE B;  4KHM A;  3EXC X;  4ITS A;  2C22 A;  2JLF A;  4K50 A;  1EHW A;  4J9L A;  2AIR B;  4LF7 F;  5J1N A;  2DHS A;  5HMY A;  2NPF A;  2IPO B;  2W4C A;  1NSP A;  5D4P A;  3CDA A;  2ZJR Q;  1VHF A;  4OI3 A;  3I56 S;  4NLT A;  4ZLL A;  3W65 A;  2CPF A;  3UW1 A;  1YK9 A;  1DRZ A;  2N7Y A;  2Y1I A;  1Y9O A;  4PUO B;  1Z4U A;  2CPE A;  4AL5 A;  4YP3 A;  3FC9 A;  4I6A A;  3O2I A;  2V2Q A;  3TQE A;  1CG2 A;  5IC6 B;  1JXL A;  4FF2 A;  1M5K C;  2N7C A;  3VV2 B;  2PI5 A;  4CYU A;  1T3O A;  3QWU A;  5DET A;  3VF0 B;  3M8P A;  2B4V A;  3PYD A;  1FK9 A;  2GC8 A;  3IM8 A;  2WK4 A;  3KLG A;  3CCE S;  2OSQ A;  4MIW A;  3TAN A;  2P5V A;  3IG1 B;  1X9W A;  3R5C A;  4B9V A;  2NZC A;  1XR7 A;  1N34 J;  1EQ0 A;  2BM0 A;  3QRR A;  3D0G E;  3K5N A;  4B9N A;  4DR1 F;  2L9W A;  3JTO A;  4G1P A;  3RRH A;  3M32 B;  5IQQ A;  1WHX A;  4IFY A;  2CQP A;  3LP1 B;  3OSN A;  3FSX A;  1YJV A;  4IO1 A;  1KQF B;  5D6G A;  3SCK E;  3I82 A;  5GAE U;  1Q95 G;  5ETR A;  1CJK B;  4B9S A;  4LF8 J;  4C98 A;  2VJU A;  1Q82 T;  1RTH A;  2HFU A;  1SH2 A;  1DY3 A;  1F0X A;  3MD1 A;  4LF2 A;  1U6F A;  2UXD F;  2H4W B;  3ZZY A;  3E01 B;  3R1H A;  1RP5 A;  1H3D A;  2JVR A;  3MFI A;  2VOP A;  3HHL C;  3QLH B;  4P2F A;  3MR7 A;  1VYA A;  2R4F A;  5LMU J;  1S9G A;  4MT1 A;  4Y3C A;  1ZM3 A;  3K5L A;  3CC2 S;  5CA5 A;  2P6T A;  1JNZ B;  2NYI A;  5CD4 A;  1K1Q A;  1RKI A;  4O3P A;  2I9S A;  2C2R A;  4P7T A;  3NCQ A;  1PBA A;  4DQS A;  1ZZF A;  3DOK A;  3KLF B;  1UW9 A;  1V3S A;  3OTO J;  4PXE A;  4WE1 A;  2K06 A;  1BWE A;  1W25 A;  2DPJ A;  2WAQ D;  2KZM A;  4WFX A;  4ECS A;  5J2Q B;  4IRK A;  2Y0S D;  1APS A;  3WX8 A;  2PI4 A;  2MQO A;  1UPP A;  2YH1 A;  3CJR A;  5HQM A;  1Y4Z B;  2JNJ A;  2XO6 A;  2ZZT A;  2M2B A;  4EK2 A;  3HSG A;  1RYR A;  4ZPA A;  1BY9 A;  1LOU A;  3KHH A;  4DR3 F;  4LFA F;  2MZJ A;  4M5H A;  3VGV A;  1EKS A;  3GU0 A;  1OQ3 A;  3THV A;  1T11 A;  1VBY A;  4OZL A;  2KI2 A;  2GVZ B;  4NA1 A;  2GFF A;  4MH8 A;  4J9U E;  3FKB A;  4NRU A;  3HVT A;  1UVJ A;  2QL7 B;  4DR1 J;  4DQR A;  2F8E X;  1QSS A;  3RBD A;  3JAM Y;  2HPU A;  3KHG A;  5LSO A;  5JMN A;  2IVM A;  4NLR A;  4JBC A;  2J6T A;  4L73 A;  3TUP A;  2FYX A;  2X51 A;  3K2Y A;  2FHM A;  4ZIV A;  3M30 A;  3LAK A;  4D3H A;  2CPJ A;  2FTR A;  2JH3 A;  4DR2 F;  3W9H A;  3NXZ A;  1VLY A;  2W7O A;  1AT1 B;  2J0Q D;  2R42 A;  3TUI C;  4L3N A;  4WTY A;  5KFE A;  3PRD A;  3MUM P;  2F9J A;  5KFQ A;  2HYI B;  2XZD B;  4L72 B;  2H48 B;  1IBC B;  3S1T A;  2J7U A;  4ZJO A;  2HFV A;  3D6H B;  2DGO A;  2HHS A;  3PEH A;  5U47 A;  2B9W A;  3BN7 A;  3BGR B;  1YJ7 A;  1BQM B;  4NZ6 A;  3MM6 B;  2CPI A;  2YKM B;  1VMB A;  3VHQ A;  5J1P A;  1WG5 A;  5KFU A;  1N0V C;  1XJW B;  1OSC A;  3K58 A;  4NPO A;  1WSR A;  2OPQ B;  3H0P A;  4F4Z A;  2MGZ A;  2EKN A;  4DL2 A;  4PR6 A;  1YHQ S;  3M2U B;  3WIV A;  4FXW A;  2EVZ A;  1YZ6 A;  2HS3 A;  4MFB A;  3HHK A;  4N47 A;  2ROE A;  2ZEJ A;  4S0M A;  1REV B;  1E6Y A;  4BLG A;  2HEK A;  5DS7 A;  5C2G A;  2J9C A;  5EWE A;  2HSE B;  1R89 A;  3AD7 C;  3MEC B;  2NQP A;  3KLH A;  2VFT A;  1J5O A;  5IV4 A;  2IBO A;  1FRL A;  2HNY B;  4H4O B;  2GO8 A;  3UDE A;  3EZ5 A;  2FPH X;  3AFG A;  5GVQ A;  4YEA A;  3CB4 A;  4L74 A;  2IY5 B;  2LEP A;  4XDC A;  3M8Q B;  2MY7 A;  3KUH A;  1ZTW A;  3ZZ0 A;  3DRY A;  4DR2 J;  4ZCI A;  5HJY A;  3ET6 A;  3TNV A;  2DCL A;  1TKX B;  1VQM S;  2YWW A;  1RT1 B;  1GTH A;  3V6D A;  4QR1 A;  2QE5 A;  4HI1 A;  4V19 J;  1RAC B;  2FIU A;  1U0H A;  3MI7 X;  3KMQ A;  2CJY B;  2IM1 A;  4FKX A;  2Y8Y A;  4PAB A;  4QW8 A;  3OTE A;  1NB7 A;  4M1K A;  3GJQ B;  2YKQ A;  3GII A;  4UZB A;  2CNK B;  1WOP A;  1YBA A;  2D3Z A;  5D77 A;  4DV1 F;  4LBP A;  3D3C J;  1PIL A;  4O4R A;  2V34 A;  1L3S A;  2AYM A;  4U96 A;  4KBI A;  5L1L A;  2ZNZ A;  4KE5 A;  5G0R A;  4ECT A;  1EQM A;  4K7Q A;  2YWF A;  2Y1J A;  3U02 A;  1RT5 B;  2KHD A;  5L38 A;  2ZH1 A;  1L5U A;  2Z2Y B;  5BXI A;  3Q8P B;  5HAT A;  3CW2 C;  4F26 A;  4I56 A;  4HTI A;  1PSD A;  1RTD B;  4GKK F;  1N36 F;  4XTT A;  4GRS A;  2PMZ D;  3UO0 A;  4FNI A;  1X5P A;  1JJH A;  2DH9 A;  3QQC D;  5EGY A;  5LOQ A;  2KM8 B;  3D7S B;  2YKO A;  4XIU A;  3W66 A;  3IC1 A;  1HYS A;  2BQU A;  1KQS R;  5HP1 A;  1Q53 A;  5KFO A;  1YZ7 A;  2ZJP Q;  2XG8 A;  4RBV A;  5HRO B;  2QIF A;  5F0W A;  2CQ2 A;  4ZOS A;  1UAW A;  1PYS B;  3TX0 A;  4FVC A;  4JYA J;  5CYQ B;  4OI1 A;  3OVB A;  1MMD A;  5CH7 B;  4DV5 J;  4DLE A;  2VPY B;  3GIL A;  1HQE A;  3G6E S;  2MKI A;  4ZIT A;  4USV A;  5DRK A;  1JKH A;  4NLO A;  2ZBR A;  1B3T A;  3MEG B;  3MM8 B;  4RW6 A;  2P9C A;  3GR1 A;  2V63 A;  3QIP B;  3BQ2 A;  1HBN A;  3R6L B;  4QBU A;  4ZVT B;  1XMQ F;  2W25 A;  3TEG A;  1IQZ A;  3CJ4 A;  1SVD A;  2MKJ A;  2CKW A;  2K1R A;  3CJS A;  2VIC A;  2NUU G;  4X4O A;  1NK6 A;  4NLX A;  4YB5 A;  2NXE A;  4I2Q B;  4WXO A;  3GTY X;  5F9L A;  1B0P A;  4Y65 A;  4HI2 A;  2ZFH A;  3C6T A;  1KFS A;  4W98 A;  2G13 A;  2CUY A;  1S1X A;  1QAY A;  2BW7 A;  2UUB F;  5T7L B;  1B0V A;  2V9W A;  1IXK A;  4YN3 B;  3HXM A;  4WZQ A;  3TJA A;  2XWX A;  4MIA A;  1YQH A;  3DNC A;  3PO5 A;  5KOW A;  2CJX B;  1EKR A;  1X31 C;  3VAJ A;  2L3M A;  1O0P A;  2YBV A;  2KL8 A;  5DG7 A;  3KWM A;  2EFN A;  2BM1 A;  4Q5V A;  3D2W A;  2UUT A;  4B3S F;  4ES3 A;  2RE1 A;  1T9W A;  2YNG A;  2HAI A;  4GKJ F;  5ETL A;  3DXS X;  5HMX A;  4CNZ A;  5KFN A;  2J7K A;  4UZC A;  5MLC V;  3FCW A;  4ED2 A;  3NRB A;  1KLN A;  4CYU B;  4UOG A;  1QLN A;  5THW A;  3CWJ A;  2HGM A;  1FK9 B;  4DX7 A;  2GAH C;  3VVU A;  3P6Y C;  4QU6 A;  2MPU A;  3KLG B;  4ED3 A;  2GJF A;  1L3T A;  1U1P A;  3MOZ A;  1FEH A;  2QLJ B;  3N6M A;  1R31 A;  1TFY A;  3RBX A;  5H9E J;  5F8J A;  3FVY A;  4IFY B;  1L3V A;  3KYL A;  2XUL A;  2QMX A;  4USI A;  3I9Z A;  3HP6 A;  5ETP A;  3E8O A;  1FEE A;  1RTH B;  4USK A;  1QVG R;  1HNW J;  2VUG A;  5IXU A;  7FD1 A;  3BGU A;  4OYI A;  4MJK A;  4IFV A;  2HHQ A;  1I94 F;  2WON B;  2XTJ P;  2UUB J;  4NXN F;  4CLT A;  3PNI A;  2FZK B;  4K4U A;  1SUQ B;  2MLX A;  3UFC X;  3DOK B;  1KDN A;  3IWL A;  1FO1 A;  3P49 B;  1S6O A;  1SCJ B;  4WE1 B;  3NKY A;  2MQQ A;  2HAF A;  2XMV A;  1SH3 A;  4OI6 A;  3GZ7 A;  4TQS A;  2XM3 A;  1LW2 B;  2AQ4 A;  2O66 A;  2H1Y A;  1GK8 A;  1FFG B;  2HHH J;  2WB4 A;  4GKJ J;  2QTW A;  3DLG A;  3D67 A;  2IFX A;  1MN9 A;  4X66 J;  3DLB A;  3U1M A;  2YWH A;  3GWC A;  1FX4 A;  3PR5 B;  2PD1 A;  5LSL A;  3KNA A;  3MR3 A;  4DF4 A;  4RX6 A;  2ASD A;  3VGS A;  3TA0 A;  2E5J A;  4IH6 A;  2VQE F;  4C0H A;  4X4P A;  2BKN A;  2BVZ A;  1WD6 A;  1FJC A;  1JJ4 A;  4ATN A;  3ICL A;  3HVT B;  4KH0 B;  3AOD A;  5E5N A;  4J9P A;  2ZWP A;  1ZBT A;  2HLT A;  3MMB B;  2VL1 A;  1SV5 A;  3LH2 S;  3PYF A;  4M5I A;  3UE2 A;  3HT0 A;  1KHW A;  4F0M A;  3D66 A;  1FRX A;  2UXC J;  5ETQ A;  3BDP A;  2ILY A;  4O3Q A;  3TZW A;  5FLX Y;  1YDL A;  3M30 B;  1F9F A;  5H9E K;  4G65 A;  2JX2 A;  3IO1 A;  3NCP A;  2AWZ A;  2Y9H A;  2MDA A;  3OFG A;  4DR5 J;  4B3M J;  4JI3 F;  3NGK A;  1DQ9 A;  3NWR A;  1H2U X;  5ETN A;  3U7J A;  2HFS A;  1CVJ A;  4ID5 A;  1I94 J;  2PEH A;  5ADZ A;  4ETZ A;  2JEG A;  4TXS A;  4K4S A;  4RJV A;  2DT9 A;  4DPY A;  2C1E B;  2C3M A;  3RW7 A;  1TK8 A;  4DPX A;  4DU7 A;  4LUB A;  5IFM A;  4QWA A;  3ILJ A;  1GMW A;  4EWT A;  2IVF B;  3MPY A;  1JLC A;  4NOH A;  1VQ5 S;  2X1F A;  3VGT A;  3I5C A;  2BYC A;  2MZQ A;  4IUF A;  1UWA A;  3X1L B;  4QYZ K;  2AX0 A;  3FEX B;  1R3N A;  3ULH A;  3RBE A;  2MGZ B;  3H20 A;  3FMW A;  4G6V B;  4C8L A;  4NLV A;  4LR7 A;  3KKF A;  2IVY A;  4DR4 F;  4USU A;  3D1O A;  3THP A;  2MQL A;  1AUD A;  3N6N A;  1LV5 A;  1MWY A;  4ED6 A;  2CAD A;  4FF1 A;  1X4B A;  3GP9 A;  4LFC F;  4OZ2 A;  3EGN A;  2E9T A;  1FTC A;  2QMW A;  2QC3 A;  4MFB B;  2L9D A;  2H54 B;  2R7U A;  2W24 A;  5LXR A;  1SKR A;  2GCF A;  2KB2 A;  2QL9 B;  3CT9 A;  2VQE J;  3SYZ A;  4Y0F A;  2IJN A;  3IRW P;  3S6E A;  4OZ3 A;  4F4X A;  2RQC A;  3J7A 1;  3JTN A;  3CXC R;  4MAK A;  3M4X A;  1J5O B;  1FE4 A;  4Y34 A;  3U27 A;  4ZLN A;  3BR8 A;  4LBI A;  3M9N B;  2RVJ A;  5GAG U;  4KO0 B;  6AT1 B;  1RI7 A;  1HNZ J;  5GAH I;  2LXU A;  2UVW A;  4IQX A;  4OJH A;  3F56 A;  2DNQ A;  2CPY A;  4ZVO B;  1NJW A;  3R27 A;  1CJT A;  1HNX J;  1OPI A;  4YHH F;  4OZ0 A;  3OPK A;  4LR8 A;  4O3N A;  3MEE A;  3ET6 B;  1WI8 A;  3DKD A;  1BE4 A;  3UDL A;  3V6D B;  1DTQ A;  2CVI A;  4RU2 A;  1U0H B;  1EJ7 L;  3J80 Y;  4F4K A;  4HTJ A;  1Q8K A;  4LSZ B;  3I5B A;  2Y0B B;  1O8B A;  1B70 B;  3TAM A;  4BC7 A;  1PCA A;  1G6B A;  2MKY A;  2ZOG A;  1RHJ B;  2C28 A;  4K4W A;  1KON A;  3PRB A;  3RJM B;  2QV6 A;  1FXR A;  3I5A A;  5HVG A;  1IWG A;  1VLO A;  2ZM6 F;  2EKY A;  3EZO A;  5G0R B;  1H7X A;  1U45 A;  1E6V A;  1QE1 A;  4DS4 A;  2A0F B;  3BBF A;  2ASJ A;  4RO0 A;  1KLM A;  4CH7 A;  3JS9 A;  5ITH A;  4DR4 J;  3OLA A;  4DSK A;  3R2C J;  4NRT A;  3BYR A;  2DXF A;  5M2U A;  4WFY A;  3PJ9 A;  2MB0 B;  3RUB L;  1KOO A;  2O5D A;  1C1B B;  1FWL A;  4NLY A;  4PAA A;  4PWD A;  3E2E A;  3HKW A;  5BYR A;  4CCH A;  1PIE A;  1X4A A;  4JI6 F;  2C42 A;  3FRY A;  1HYS B;  2EBE A;  5HP1 B;  3D1Q A;  2H5J B;  5F8M A;  3DRS B;  1D1U A;  3NGS A;  1IR1 A;  2RDI A;  3US5 A;  3S01 A;  4TU7 A;  1NSQ A;  3FUY A;  1HQE B;  4H54 A;  3N6L A;  2LEC A;  4R5P A;  1DAX A;  1S72 S;  1HD0 A;  3CUL A;  1JKH B;  4PQU A;  4WIQ A;  1RAF B;  4F0K A;  2QGF B;  3DLE A;  3TZZ A;  2X1G A;  5BYQ A;  4RW6 B;  1OQ6 A;  2HVH A;  3LQV A;  3QAU A;  3CIZ A;  1D9F A;  1HBN B;  2ZKT A;  4KTQ A;  1U02 A;  1WKJ A;  1VJW A;  2KVI A;  4YB6 A;  2XWY A;  1CBK A;  1QTN B;  4WFN Q;  5EWF A;  2K1R B;  3MM9 A;  2VHG A;  2ZDP A;  3HKZ D;  4IOA Q;  1XR6 A;  1RAA B;  1CJV A;  4P7V A;  1HKA A;  2Y8W A;  3L9Z A;  4HH0 A;  2G1H A;  4DPU A;  3C6T B;  3VAL A;  2UVR A;  1S1X B;  2ZM6 J;  3FZB A;  1WTB A;  3MF5 A;  3P45 B;  2VOD A;  3I4P A;  3TUZ C;  5BR8 F;  2NXJ A;  3MM5 A;  2EFG A;  1XIQ A;  4OI4 A;  5LSR A;  5K8P A;  4PWU A;  2OEK A;  3HPO A;  4G1Q B;  3DOM A;  5HBM A;  1RE1 B;  3LAL A;  2KT3 A;  5B0D A;  3HT3 A;  4UQG A;  4IG3 A;  1FHT A;  3SQG A;  2LA4 A;  2HWT A;  3D3B J;  2GZO A;  3GSI A;  4EUV A;  2YQ3 A;  1DTT A;  1F3F A;  2VV5 A;  2MTL A;  1FF2 A;  4FYX B;  3Q83 A;  4MKB A;  1S1W A;  2CIM A;  2CRL A;  1WG1 A;  4N8N A;  4LRE A;  3TX8 A;  5L1J A;  3G6Y A;  1YIJ S;  4I2P B;  5E2Q A;  1RA6 A;  3WC0 A;  1WC5 A;  2FGO A;  1DLO A;  3CCS S;  2LLZ A;  4WTO B;  4Q0B B;  5DQH A;  4WBF A;  5A8K A;  2RB7 A;  1JLB A;  1H2T Z;  1UEK A;  3A3N B;  1WI6 A;  3Q8Q B;  1GXL A;  1XNR J;  2BXJ A;  1WOO A;  5J2M A;  3C2P A;  4EBD A;  4U8Y A;  2B7B B;  3HHD A;  5KT5 A;  4RR5 A;  4RUB A;  3CJ0 A;  3BO2 A;  2FJX A;  4U95 A;  1RCX B;  4IFV B;  4GVB A;  2DHX A;  3CJ5 A;  3N01 A;  4RW4 A;  3VWS A;  2E5H A;  3DYA A;  1D3W A;  4UW2 A;  2B9Y A;  4ANC A;  1UJ5 A;  1GFW B;  4F2R A;  3MAQ A;  2ZBQ A;  2LDY A;  2GHW A;  1SH0 A;  1U6B A;  2RT3 A;  1O6X A;  1SIZ A;  2ADB A;  1LKZ A;  1ICE B;  1N88 A;  4DG1 A;  1P27 B;  4DPO A;  2RQM A;  3UI3 A;  4C97 A;  4AXJ A;  1PO6 A;  2CYY A;  3MPV A;  2KFZ A;  3V6H A;  2LQB A;  3KDO A;  2DNM A;  5HN0 A;  3AQP A;  1B4S A;  3ILL A;  4OYM A;  3I0S A;  1U2C A;  1HI0 P;  4OZJ A;  4AD6 A;  2E44 A;  2XMU A;  3I96 A;  3DLG B;  2FHJ A;  4M5D A;  3G8Q A;  2BAC A;  4CO2 A;  4BC9 A;  5J2P B;  3NNH A;  4PXD A;  2IMO A;  2MST A;  3KUE A;  4CLZ A;  5E3C A;  2PMW A;  3RBZ A;  2JDJ A;  1P1T A;  5C25 B;  3FSI A;  4M95 A;  1G3O A;  3VZI A;  4ZLJ A;  4ZPT R;  2J9D E;  2G0J A;  2ZH4 A;  4JI1 J;  2VC1 A;  3IAS 9;  1SV5 B;  3AY0 A;  5DQG A;  1NHK L;  1NO8 A;  5IM0 A;  1HWI A;  1ROF A;  3R6G B;  3CED A;  3VAI A;  3V4I A;  3R8Y A;  2DHH A;  3OXL A;  5C42 A;  1TL1 B;  5KOX A;  4DDF A;  2G2Z A;  4ES1 A;  3NOG A;  2V2V A;  2HHU A;  3RG6 A;  1RAG B;  3BSC A;  4ID5 B;  1ZS6 A;  3EJM A;  2MKC A;  2V9K A;  1FRJ A;  5HSP A;  3GIK A;  3IGN A;  1NJI T;  2JFD A;  3J81 Y;  5D15 A;  3R3T A;  5I3Q A;  3P96 A;  5JXS A;  4IKA A;  3VAH A;  2PEB A;  1LXN A;  1TAU A;  1RWP B;  1JLG A;  5A8W A;  4A8K A;  2VU5 A;  2ZKU A;  4O44 A;  5KFY A;  5FDL A;  3CJK B;  2KRR A;  1X0P A;  2JLG A;  4J37 A;  5F8H A;  3AHP A;  2VQF J;  1JQG A;  5KFJ A;  1H72 C;  2HWH A;  4MYT A;  1LW0 A;  1ZTT A;  2OFG X;  1JWW A;  3DLJ A;  3CDE A;  1AFJ A;  2DXD A;  2VH7 A;  4LRD A;  2X1A A;  3ADA C;  5KG5 A;  2DK2 A;  4DV3 J;  1T95 A;  4CT8 A;  2DRD A;  4DL3 A;  4M63 A;  2V2K A;  1N5Y A;  2HVI A;  3KUG A;  2K8G A;  2W8K A;  4NXM F;  2RUS A;  4P2X A;  3I87 A;  3UN5 A;  1AUS L;  4C2M A;  4MK8 A;  1YRX A;  4C8N A;  1FVS A;  3SXL A;  3N9U C;  2B0G A;  1X4C A;  2XY5 A;  1ZET A;  3EX7 B;  1SXL A;  1V5I B;  5HLF A;  2EK6 A;  3DI6 A;  4ICL A;  2R2T A;  4JI0 F;  2X3D A;  3BBB A;  3W64 A;  4LF5 F;  1U49 A;  2IRY A;  3MTJ A;  4WCE Q;  2UP1 A;  2J7W A;  4PZV A;  3K59 A;  2MYF A;  2RS8 A;  3SCI E;  2UVV A;  1CJT B;  2CG4 A;  1QUP A;  2AYG A;  1H73 A;  3BB5 A;  5KT6 A;  3G8T A;  3GG0 A;  2BMB A;  4RLE A;  5DG9 A;  4LRA A;  2E7W A;  1HQ2 A;  1U8S A;  4JI4 J;  3RYL A;  2VB6 A;  1DTQ B;  2ZIT A;  4MK9 A;  2RS2 A;  4F4Y A;  1Q8I A;  2UU9 F;  1KVJ A;  3TAM B;  4DL7 A;  2FVQ A;  1PC5 A;  4ILM A;  2IIH A;  4FPI A;  4KFB A;  3E51 A;  3KHR A;  3NOC A;  2EFV A;  2E5L F;  1RWO B;  2B9X A;  4CIO A;  2JWN A;  3NNC A;  5LMN J;  4LQ3 A;  2PA8 D;  4KR0 B;  2PA3 A;  3QBC A;  1YX2 A;  1E6V B;  1QE1 B;  1HBU A;  4LSL A;  4J9O A;  3MGJ A;  4KGZ B;  5EWG A;  4L76 A;  4I69 A;  2V68 A;  3TI0 A;  3TAP A;  3KK1 A;  1Y3K A;  2ILZ A;  4A4J A;  3BBC A;  5KFT A;  3ZXW A;  1UKU A;  3AOA A;  3ISN C;  3GV8 B;  1JLQ A;  2YTC A;  3R97 A;  3HVW A;  3OD2 A;  4BCA A;  1TK0 A;  4RW7 A;  2WW4 A;  4TU9 A;  2LFV A;  2BV3 A;  1EET A;  5AE2 A;  1RKJ A;  4NML A;  4QIW D;  4NX9 A;  4JI5 J;  3NL0 A;  2GIF A;  4QWD A;  3VVT A;  4RUA A;  1HI1 A;  1X9M A;  1JMT A;  4CO1 A;  4WZM A;  2DD8 S;  2QMU B;  3D0I E;  2LDI A;  2AJ1 A;  2JSX A;  4R5P B;  3BKU A;  4LF5 J;  1UVN A;  3W60 A;  4PQU B;  1KTV A;  2J8S A;  2QA4 S;  3HHL D;  5K14 A;  2FJV A;  2F4V F;  2JJ4 D;  2VKR A;  1UFW A;  3GCX P;  4CH1 A;  2CXE A;  2U1A A;  4H4K A;  4DN0 A;  1K0V A;  1FNO A;  3NP5 A;  3AA8 A;  4ZVQ B;  4A8F A;  4A8W A;  4ILL A;  1OS5 A;  2V94 A;  3MM9 B;  1H74 A;  3C19 A;  1S4F A;  2RHQ B;  1IM4 A;  1TEL A;  2UU9 J;  3UPF A;  2VBZ A;  5ETS A;  4PG6 A;  4Q8F A;  2GW8 A;  1CJV B;  1W7W A;  1N52 B;  3O1L A;  4O4G A;  4M8L A;  5CAA A;  1T05 A;  2NPI A;  2ZHO A;  1ZM9 A;  4TNO A;  3T1H J;  2R2U A;  2V8V A;  4DV7 F;  3RB6 A;  2UUA F;  4I6W A;  3V5R A;  3FSY A;  2HQ3 A;  1FNX H;  3M8W A;  3BGO P;  4DSI A;  4PG5 A;  4M5L A;  3NGD A;  2DCU B;  3CJ8 A;  2DO4 A;  4P74 A;  2D1C A;  1U2F A;  2XMM A;  3BYP A;  3BZQ A;  2ATC B;  2M52 A;  2DGX A;  1K73 T;  5E3R A;  2VOO A;  1KQK A;  1TZ0 A;  4AL7 A;  4OL8 A;  5CHC B;  1NHV A;  1N5Q A;  1C1C A;  3DOM B;  5HBM B;  3IWN C;  2XHW A;  3IS9 A;  3UDC A;  2HG4 A;  3D1H A;  4G3I A;  1R0B G;  3JYT A;  4U7C A;  2A2D A;  2YKN A;  3CO9 A;  1CUL A;  3HLU A;  4IG3 B;  3IBW A;  1LXJ A;  1N6Q A;  1H7W A;  3KOA A;  3PRV A;  3SQG B;  1Y0H A;  4KH1 B;  5KAK A;  4ES2 A;  4F4W A;  1NK5 A;  4K4V A;  5HAO A;  1DTT B;  3LA0 A;  2KKH A;  2DNP A;  2CPH A;  2HZC A;  2V5H G;  2DR8 A;  1L3K A;  4KGX B;  1NJZ A;  3HHL B;  1EIY B;  2HZV A;  2E1M C;  2Z57 B;  4TN2 A;  3CCT A;  3SQO P;  3M6V A;  2XY7 A;  4CH0 S;  1H0H B;  4CLS A;  2FHJ D;  2WVD A;  1VBK A;  3H5X A;  3GLJ A;  1ZAX A;  1DLO B;  3P3D A;  4FKY A;  3RAQ A;  4YQW A;  3M2R A;  4K2J A;  1JLB B;  1VQ8 S;  5KFR A;  1TL5 A;  4PYD A;  2CZ4 A;  3ZZO A;  1N33 F;  1RWV B;  4KHP F;  1M5S A;  5J2M B;  1G2E A;  3MPU B;  5ETV A;  1F60 B;  4NE9 C;  4WFB Q;  3GFX A;  3N0V A;  2NUH A;  4GMK A;  1W2B R;  1Z2L A;  4DR6 J;  4GVB B;  2KVQ E;  4RW4 B;  3DYA B;  3IGV A;  1NLK L;  2DGV A;  4H4M A;  4OX9 F;  3W9J A;  1ZYQ A;  4CO0 A;  4DV7 J;  1D8Z A;  2UUA J;  1UP1 A;  2W2P P;  4RBU A;  5HI7 A;  3HK2 A;  1HR0 F;  4B02 A;  4F3O A;  1Y5I B;  2JC0 A;  3T1Y F;  5DO2 A;  1ZPV A;  1HAR A;  2IJF A;  4DG1 B;  2QX0 A;  3A1Y G;  1NZ8 A;  4QIV A;  4M5M A;  2HW3 A;  1Y00 A;  2I1R A;  1TKD A;  3GE9 A;  4IO9 Q;  4EBC A;  3M1V A;  1X9S A;  3I0S B;  1QSL A;  4QYR A;  4JV2 A;  4L3K A;  1YRU A;  4ZCM A;  7AT1 B;  4M5D B;  2HRU A;  3R9L A;  4CTA A;  1NK9 A;  1FWP A;  2G2Y A;  5GAD U;  3DN9 A;  4W90 B;  2GGP A;  3HSJ A;  2DNO A;  2UXB F;  2CFX A;  1VQY A;  1D09 B;  3SBM A;  4KV8 A;  1UJ6 A;  5HL7 Q;  3BO3 A;  4MKA A;  4MKY A;  3L7P A;  2M9K A;  3H2L A;  1KTQ A;  5SZT A;  2IAJ A;  2W7P A;  2MJU A;  3PIO Q;  2MXY A;  5JVH Q;  4ZPD A;  2F8H A;  2D7S A;  2ABY A;  5KT4 A;  1WOR A;  1GMV A;  4X4T A;  3MM7 A;  4J9N A;  3C66 A;  4ENO A;  2QN6 B;  4ZVU B;  5IM0 B;  1XMO J;  3I31 A;  3CGI A;  3EUN A;  4WKY A;  2V2Z A;  1ULR A;  5F9N A;  3PVX A;  3V4I B;  4KHP J;  3VAK A;  1TU0 B;  1TR0 A;  4DEZ A;  5A2Q Y;  2DGW A;  2OJ3 A;  5F8G A;  1R7I A;  3P4U B;  2GX8 A;  3PV8 A;  5C2C A;  1B7F A;  6FDR A;  1PAE X;  2F9D A;  4ZVR B;  1YGY A;  1YBU A;  1FER A;  5J2N A;  4OX9 J;  4FYV B;  2E29 A;  1Q78 A;  5EN1 A;  2HIQ A;  2DRB A;  4FYD A;  4UUX A;  4ZVE A;  1T9U A;  3ZTO A;  5A6W A;  3A8J A;  2KYX A;  3P5B P;  1B99 A;  4EFA C;  2KH9 A;  2BZ2 A;  3SEO A;  1JLG B;  3M2V A;  5A8W B;  1GH8 A;  4HDG A;  2LXF A;  1NSA A;  4O44 B;  2OP5 A;  5FDL B;  1KEK A;  4A8S A;  5F8N A;  3OR1 A;  2RU3 A;  2HVD A;  2B6A A;  4I64 A;  3PCO B;  3K0J A;  4RW9 A;  2M7S A;  1WF0 A;  4CLU A;  5T41 A;  1ELO A;  5D0E A;  5D4L A;  1LW0 B;  2EC0 A;  4W4M A;  4DPW A;  3MR6 A;  4J9S A;  1RBL A;  2E7X A;  2CJA A;  1F6T A;  4DPT A;  4NLG A;  2UXB J;  3QNW B;  4F02 A;  1S48 A;  1VIO A;  4G1I A;  4ZKA A;  4U7U D;  2XI3 A;  1V3Z A;  1WWH A;  2ZDO A;  3CJ2 A;  1T3N A;  2Z2Z A;  2L08 A;  2VDI A;  3OTC A;  2IC3 A;  1S1U A;  1Y7P A;  3VQT A;  1SB6 A;  1NDP A;  1ZOT A;  2BQR A;  1L3U A;  1WF1 A;  2GMH A;  4O3O A;  4DOZ A;  5HLF B;  3AD8 C;  3DI6 B;  4ICL B;  3G6X A;  2HBQ B;  2YQ1 A;  4JV5 F;  2EC2 A;  2UV8 A;  3LWM A;  4LF4 J;  1RXO B;  2AEJ A;  4AT1 B;  2OLW A;  4FXD A;  5CZV A;  1KC8 T;  4GO7 X;  3LP0 A;  1AW0 A;  2DNL A;  1VC6 A;  1P8G A;  4EO6 A;  1VQL S;  2APO A;  1Q8B A;  5MAO A;  4MMO A;  4UY8 T;  5AXN A;  1DQ8 A;  2VON A;  3H2U B;  4K0K J;  1N5S A;  4B08 A;  3QSY B;  1WUU A;  2QT7 A;  3MDF A;  1YIT S;  2HIY A;  1VBZ A;  3DU6 A;  8AT1 B;  1VQO S;  3UN3 A;  4X4N A;  4WP9 A;  3CNQ P;  3B82 A;  3EDR B;  2QLB B;  2OHD A;  1X4D A;  3FZ2 A;  3KMS A;  4OYB A;  5DJB A;  1OYE A;  3JSR A;  4Q2L A;  3NS6 A;  1ZZN A;  2CQ0 A;  4AFF A;  1HBU B;  4LSL B;  2RRN A;  1YJT A;  3BF4 A;  1HWK A;  4ZLP A;  3TWZ A;  4FZV A;  1O51 A;  2YY3 A;  3OFE A;  3V4M A;  1YRT A;  4N8O A;  2IM0 A;  1AXQ A;  2EWH A;  4X64 F;  2K3K A;  4CLW A;  5JUM A;  5K9F A;  2CG8 A;  4QR0 A;  3M6W A;  1JLQ B;  3S7R A;  1WKL A;  4RW7 B;  2A18 A;  2YNH B;  3O6Q A;  3QT6 A;  1EET B;  2JEI A;  1B7Y B;  4P71 A;  1Z2Z A;  3PZP A;  3ENQ A;  2NZ4 A;  4ZP9 A;  3RW6 A;  2RF2 A;  3EM1 A;  3P8B B;  1AZS A;  1T03 A;  1D9D A;  4K59 A;  4C8Z A;  3B78 A;  1RT7 A;  3LP2 A;  3SDE A;  2BAN A;  3IFE A;  1RWM B;  2KFY A;  2MQ8 A;  4J90 A;  1Z1Z A;  4ZPC A;  1HMV A;  2DO0 A;  3VZH A;  1N8R T;  2YNI A;  1OMS A;  2DGT A;  3BKF A;  1BGX T;  3ZC4 A;  1WC1 A;  2D9O A;  4B3O A;  5K14 B;  1OY6 A;  2VAS A;  2CPD A;  1UEV A;  1ZM4 A;  2EW9 A;  1GNK A;  2EXU A;  3G87 A;  4KB7 A;  1V6H A;  4F4A A;  1IR2 A;  3BS9 A;  2XHC A;  3S8S A;  2H4Y B;  3GYN A;  3FJ2 A;  3EPI A;  1VR6 A;  4ZP7 A;  1Y11 A;  1NK4 A;  2IHR 1;  3PEJ A;  4Y6I A;  2FVC A;  3PO4 A;  1U8W A;  2DH7 A;  1VIX A;  2I38 A;  3HJV A;  1DHM A;  4FDF A;  2ZH7 A;  1WNE A;  4J9V A;  2P8I A;  1YWX A;  4O4G B;  2WVF A;  1T05 B;  2FLN A;  5KT3 A;  3NGT A;  4RW8 A;  3VR1 A;  3JQK A;  1HWL A;  3D6M B;  4TU8 A;  1GMU A;  4X62 J;  4DF8 A;  1HHS A;  2DNN A;  4OX8 A;  1R0C B;  4TY9 A;  3UD5 A;  3ZNU A;  4PG7 A;  2C3Y A;  2FLL A;  4YR2 A;  2VPZ B;  3HM9 A;  1JJC B;  2Q43 A;  3MUV P;  3CCM S;  1NCL A;  3I4H X;  4JI2 F;  4KHR A;  3V2U C;  5DM7 Q;  4DV6 F;  5F8I A;  1RWW B;  4CQ1 A;  2I5J A;  3OV7 A;  3C15 B;  1TL3 A;  2DR9 A;  2ZH6 A;  5B0G A;  3K17 A;  2R7X A;  2HQD A;  1C1C B;  5E0O A;  2H5E A;  1S6Q A;  3IS9 B;  3IXQ A;  5GMD A;  2IBK A;  3JYT B;  4CO3 A;  4NYZ A;  2YKN B;  1CUL B;  4U7U K;  1N6Q B;  1P1L A;  3MZI A;  2BA9 A;  1IBM F;  4C3K A;  3G8S A;  3HI9 A;  3MOJ B;  1UA0 A;  4LF7 J;  1T8E A;  2RKI A;  3LPY A;  2CQC A;  4CM0 A;  4R0J A;  1T02 A;  2O67 A;  3CJQ A;  3UD3 P;  4OYA A;  2XYG B;  1VQS A;  5LJ5 Y;  2B43 A;  1RAJ A;  2RAQ A;  2B51 A;  1RU1 A;  2M4M A;  3OFF A;  3M2R B;  2NRE A;  1SBR A;  1Q81 T;  2CWX A;  5KFH A;  4WYL A;  4K8R A;  1U1M A;  3D9B A;  3PW2 A;  3DCA A;  3AAW B;  2YPY A;  1N4L A;  3O8W A;  4RL1 A;  5HO4 A;  2R7T A;  3H5S A;  2HNZ A;  1SQG A;  3W3S A;  4YFU A;  3Q0A A;  1YG0 A;  1RZM A;  2C2O B;  4X4S A;  3CMA S;  4PRF A;  5A76 A;  1C0T A;  3GFH A;  2MY8 A;  3MWB A;  2PII A;  3K8W A;  1SPB P;  2LXI A;  1CSJ A;  4H4M B;  2OEL A;  3T5K A;  4DL6 A;  3HJF A;  4DV4 F;  3RAX A;  4HYK A;  2PE8 A;  1SJ3 P;  3VGU A;  2MJN A;  4OQJ A;  3HD1 A;  2XGQ A;  3EWG A;  4B9L A;  1TKT A;  4DSJ A;  4Z2X A;  4DV6 J;  2CJ9 A;  2DHA A;  1TTH B;  2W9B A;  3Q8Y A;  3W62 A;  2UXD J;  4Q43 A;  4OYZ A;  2R8H A;  1FKA F;  3M1V B;  2WVB A;  3I0R A;  4FN5 A;  3LWL A;  2DH8 A;  2GNK A;  5ETO A;  2OO4 A;  4QIG A;  2GQC A;  1RHM B;  4ZVS B;  1IBM J;  3R1L A;  1TUG B;  4Q2M A;  4ED1 A;  4J5O A;  4CTA B;  5IOL A;  5CZX A;  2GGP B;  4E2F B;  1OO0 B;  4P2M A;  4ZIW A;  3TEH B;  4KV8 B;  2MZT A;  2F63 A;  2X3G A;  3EVW A;  2MHE A;  3GIJ A;  2LCW A;  1KN6 A;  3F41 A;  2AX1 A;  1FKO A;  4RNF A;  3DU5 A;  4WWS A;  5SUH A;  1A9N B;  4LJM A;  3K89 A;  3MCS A;  2F3J A;  3T9N A;  2CQD A;  1WHV A;  1FRH A;  3FQL A;  3H42 A;  2PFD A;  2WSE C;  2P2C B;  2VKZ G;  4DR3 J;  3KLI A;  5KG4 A;  3MCM A;  4LFA J;  1U24 A;  1YJN S;  2WSC C;  1ITP A;  5DZ6 A;  4WFZ A;  2OPS A;  3MEK A;  1NKE A;  3IA0 A;  1NB2 A;  2D3O R;  1ZA1 B;  5KFS A;  4DHV A;  2DR5 A;  2RSQ A;  5D4O A;  1RB0 A;  2E66 A;  5D3G A;  1KKH A;  2F1F A;  4Q45 A;  1LWF B;  1IKY A;  5J2N B;  5LXY A;  3HCX A;  1RT3 A;  3T19 A;  3CCQ S;  1NDL A;  3UN2 A;  3PFE A;  3UWT A;  3NCR A;  4ECX A;  3ZZR A;  3FQK A;  2XEX A;  1BQX A;  1F2H A;  3UDV A;  2DNG A;  1NME B;  1B0T A;  2RD5 C;  3M2V B;  4ZJL A;  2M3D A;  2F4F A;  4OLP A;  3OR1 B;  3R7S B;  1NDK A;  2B6A B;  2P9E A;  4U67 Q;  4FF4 A;  4LRC A;  3AQO A;  5F0U A;  1KWM A;  2FY8 A;  4QWB A;  4ZVG A;  2H3E B;  2YXL A;  2DVI A;  1HI8 A;  1OY9 A;  4RW9 B;  2XZT B;  1ZM2 A;  1RWN B;  2R3V A;  2HGN A;  3M9O B;  1HHQ A;  2G0C A;  4R25 A;  4K4Z A;  5KT7 A;  3BM7 A;  4AUK A;  4FBT A;  2Z2L A;  2CPZ A;  2ZHA A;  5K8M A;  1RSC A;  2FY1 A;  4AND A;  3POT A;  3H4B A;  3DC2 A;  1FDD A;  2VBY A;  2DHG A;  4B3T F;  2QSW A;  4X65 F;  3SSR A;  3M8S A;  3RR7 A;  4ZPV R;  2ACM A;  2IC3 B;  2OUG A;  2OMO A;  1BHN A;  1S1U B;  1HW9 A;  4M94 A;  3UNG C;  2Q1L A;  1NND A;  5J2Q A;  1W2I A;  1FVQ A;  4WK1 A;  3R5G A;  2X1B A;  3J81 j;  2FLP A;  1VQP S;  3CD5 A;  3QJJ A;  3N28 A;  1XWL A;  3D6T B;  4X4Q A;  2V4J A;  1VS3 A;  2EFP A;  4FP9 A;  2DY9 A;  1M1K T;  4DX6 A;  3L95 X;  1KQG B;  4DSF A;  5C7P A;  3LGM A;  4U6P A;  4OLO A;  2CQB A;  5B0F A;  1FCA A;  2AJ0 A;  4KRW A;  2D3U A;  5L46 A;  1Q8L A;  1WDD A;  3ZZZ A;  3T5H A;  2DB1 A;  3KK3 A;  4DL0 C;  3LP0 B;  2KYZ A;  3CC4 S;  2DGU A;  5LT5 A;  2BOA A;  1HD1 A;  2MZR A;  1U1Q A;  1GX5 A;  3BR9 A;  2GVZ A;  1RAB B;  1BC6 A;  2JFK A;  4USW A;  3OFH A;  2DKO B;  3A3P B;  1U4B A;  2OPP A;  3TA1 A;  4DUZ F;  3NMA A;  1SQE A;  4OZ5 A;  1IVZ A;  1S12 A;  3MHY A;  4RNO A;  4NLU A;  2BRK A;  2DNZ A;  1RLC L;  2V8D A;  2ZVS A;  4DR7 F;  5BYS A;  1KR4 A;  4BHQ A;  4J7C A;  3PKM A;  3G9C A;  1VRQ C;  1JXV A;  2M88 A;  4ZPB A;  4OFZ A;  4RZR A;  1UVM A;  3RRG A;  4OIX A;  1CS4 A;  3VCD A;  1MNE A;  1Q5V A;  1PKU A;  1RHR B;  2AEF A;  2BJD A;  3NS5 A;  4KIA A;  2XMW A;  4DV1 J;  3EGZ A;  2XCP A;  2MZS A;  2N82 B;  4ERD A;  4LF6 F;  1Q0N A;  1NAQ A;  2IM3 A;  2HZA A;  4NLQ A;  3GJS B;  2DNY A;  1NXI A;  2Y1R I;  5DGA A;  4MK7 A;  2XQC A;  2RF2 B;  2C2K B;  3IN5 A;  2CDQ A;  1AZS B;  1T03 B;  1RAI B;  3HFK A;  1WKK A;  2E5I A;  1CJU A;  4LBH A;  4Y2C A;  3JQJ A;  4AQY F;  2EI5 A;  3LP2 B;  2Q6B A;  4ZA1 A;  3SDE B;  2BAN B;  4DZD A;  3W61 A;  1XR5 A;  4OHY A;  1N36 J;  4GKK J;  3OTD A;  3R7B B;  1HMV B;  2YKA A;  5DDO C;  1M5O C;  4H4K C;  2YNI B;  4NZ7 A;  2VD3 A;  2R8J A;  4NCA A;  4EO8 A;  3ZTR A;  4B3O B;  1X7V A;  3EMT A;  5E3A A;  3UCU P;  5BJR A;  1XBW A;  4LIW A;  2IDL A;  3DMJ A;  3TVY A;  4CLF A;  3DLL Q;  3J7A N;  4HHH A;  2XI2 A;  4ZN1 A;  1RGV A;  1S1V A;  3M8P B;  2VFV A;  2EG2 A;  1BXN A;  2RQ4 A;  4KT0 C;  2JHE A;  2YNF A;  2FJB B;  2ZNY A;  3I9V 9;  1TL4 A;  3OUY A;  5IT9 U;  4LF9 F;  2LKZ A;  2BUN A;  3DGV A;  1PYT A;  2PN6 A;  2WBR A;  2MKS A;  2ASL A;  1UEU A;  4F7V A;  2J9D A;  4NCG A;  1N32 F;  1S59 A;  2R9L A;  1SI9 A;  1XMQ J;  2VFU A;  4JP8 A;  1FNM A;  4PQA A;  1H2V Z;  4IQM A;  4DFM A;  1TVR A;  2DRA A;  3W5Z A;  1P6T A;  2NXN A;  2GO9 A;  5L8R C;  4PWW A;  4I0W A;  1LEO A;  2I5J B;  1UA1 A;  2XCA A;  1TL3 B;  3TAR A;  3E3X A;  1U0S A;  1S6Q B;  5GAD I;  4I6Y A;  4NEY A;  2SXL A;  1VCT A;  3HMJ G;  3FMB A;  5KG2 A;  3C3L A;  1S9G B;  4OJ3 A;  2ALY B;  2CAJ A;  2XMK A;  4MIB A;  2CQ3 A;  1KSP A;  2UUC F;  2V8G A;  2B7C B;  3OL9 A;  3TRG A;  3MR5 A;  2RIJ A;  2RKI B;  2FVP A;  1X0F A;  2GMJ A;  1FRI A;  4OZN A;  1M1G A;  4RNH A;  4AQY J;  3K5M A;  2YVS A;  4ZCL A;  1RWU A;  2QA2 A;  2BAB A;  2XZW A;  1PAU B;  3LUY A;  3GIM A;  2ZH9 A;  4B3S J;  1SIW B;  1NM2 A;  1GXU A;  3FBC A;  1KHV A;  2H9Z A;  1XMB A;  1N0U A;  1NH8 A;  3IR7 B;  1RTD A;  4C11 A;  2HLU A;  2G1D A;  2E1A A;  1FD2 A;  2ADC A;  1RWX B;  3QAE A;  3DRP A;  2HNZ B;  4FXV A;  5ETM A;  4HH1 A;  3M8Z A;  3CE8 A;  2HK2 A;  5AXK A;  5K8O A;  2AP6 A;  2VJV A;  1YJU A;  4A8X A;  1C0T B;  4CLY A;  2H5I B;  4EYI B;  1S79 A;  3B4D A;  5HRO A;  1X4E A;  1IM6 A;  1QUV A;  2KXF A;  1RAH B;  1HW8 A;  4DMZ A;  2ROP A;  4UF4 A;  1N32 J;  4Y2I A;  3SCL E;  4CI0 B;  4QZV B;  1DUR A;  4V19 X;  2V4R A;  4KPY A;  1RK8 A;  3OSP A;  3PYE A;  1HL6 A;  1J2V A;  1TKT B;  4C48 A;  1X5S A;  1K0T A;  1IKW A;  2ERR A;  4PKD B;  2RQK A;  2W9B B;  5DDQ C;  4JOU A;  3TA2 A;  2V4Q A;  4ECQ A;  5D0G A;  4KKO A;  2E5G A;  3SV3 A;  5FII A;  3I0R B;  1U1N A;  2RJZ A;  2XS2 A;  3LOU A;  1SC6 A;  3QJP A;  4I2Q A;  1VQ4 S;  4NXN J;  3A13 A;  1IJF B;  1TUV A;  2FLO A;  4KY3 A;  4IR9 A;  2UUC J;  5H1S V;  1Q4R A;  4ILR A;  3NBP A;  2WHO A;  2VG5 A;  1Y5L B;  2M8H A;  2YWE A;  3RU0 A;  4LMZ A;  2L41 A;  4EZ9 A;  1K9M T;  2GHP A;  3T1A A;  4DV0 F;  2NR0 A;  4M5J A;  2VPX B;  1FKO B;  1H38 A;  1LWE A;  3CF5 Q;  3OTO F;  2DBB A;  4L75 A;  5LL6 d;  3RAM A;  5I3U A;  2BJ7 A;  2GIR A;  3ZTP A;  1FFS B;  2MHN A;  3OT9 A;  3A8E A;  3KLI B;  3IP0 A;  3IWX A;  4FVM A;  4IOC Q;  2BJ8 A;  3KHL A;  2AHO B;  3N5F A;  1YJ9 S;  1RWK B;  3TJ8 A;  2OPS B;  4OJ1 A;  3PDN A;  5KG1 A;  1E6Y B;  2ZWO A;  5KFK A;  2KZZ A;  3QGI A;  2IDE A;  3OQ2 A;  3BSN A;  1F2G A;  3BH7 B;  2DIV A;  3ZTS A;  1VBX A;  2WW8 A;  3D0H E;  1SL1 A;  1JJ2 R;  5D3G B;  4OV1 A;  1IKY B;  1R6V A;  3EPG A;  6FD1 A;  1UWB A;  3KLH B;  3H5Y A;  3W1Y C;  2BJ1 A;  1RT3 B;  2N4D A;  3WZ0 A;  4QW9 A;  3QZ7 A;  1SC3 B;  2GQ2 A;  4F36 A;  1U26 A;  1TL7 A;  2GV1 A;  3UQS A;  3ISN D;  3Q2T C;  2VA2 A;  4JUZ A;  3J7Y I;  4OI2 A;  3W8G A;  1TMJ A;  2A10 A;  1N5V A;  3DHX A;  1RBA A;  2OTJ S;  2MSS A;  3EGW B;  2AJQ A;  1UTA A;  2AT1 B;  1WG4 A;  4JI3 J;  1URN A;  2QEX S;  2FVR A;  1RBO B;  1RAO A;  2C2E A;  2LP4 A;  2Q79 A;  3FEZ A;  1UVL A;  4N56 A;  4OMF G;  4NLS A;  2W4P A;  2CNN B;  2CZ9 A;  2KN4 A;  4EBE A;  3H5U A;  3JAM U;  4ELU A;  2GAG C;  4PCQ A;  2UVU A;  3JQM A;  3JB9 k;  1REG X;  2WON A;  3QPI A;  1R27 B;  3QFH A;  3POT B;  4FBU A;  2BKO A;  4HR2 A;  1SUQ A;  2A6M A;  4DV0 J;  3QSI A;  3QRP A;  4HKQ A;  4RWW A;  4QIF A;  2CQG A;  3DDK A;  3EDQ B;  4GO5 X;  4D3G A;  1NK7 A;  1JX4 A;  3EGV A;  2OI2 A;  1A0O B;  4NA3 A;  2XMT A;  4NLP A;  5HVH A;  2VBW A;  3B8H A;  3KJV A;  1LW2 A;  4LFC J;  2V4J B;  4QU7 A;  1NKC A;  5E33 A;  2B8Q A;  1SJR A;  2OEM A;  2W9A A;  3W2W A;  3V6K A;  1V5V A;  5KFL A;  4CT9 A;  5HMZ A;  2UV8 G;  1VGY A;  3KK3 B;  1RTJ A;  4W92 B;  3GCW P;  2HHX A;  4FNH A;  1QAI A;  4HAC A;  3M8R A;  3RR8 A;  2QZ8 A;  4RUC A;  1JNR B;  2XMA A;  4N7T A;  2V50 A;  1Q5Y A;  2AKW B;  2OSR A;  3W8P A;  2DXE A;  1SC4 B;  2OPP B;  1T7P A;  4NAS A;  1F5C A;  5GAE I;  3Q89 A;  3MMB A;  4JV0 A;  1URR A;  4B17 A;  3CD0 A;  3K57 A;  4TLR A;  2WTF A;  4JI7 F;  5KFI A;  3G82 A;  4YHH J;  2E9R X;  5B0E A;  1HHT P;  1FRK A;  1RTI A;  3T6B A;  4P52 A;  2CVE A;  4P9S A;  2D74 B;  1R8A A;  4TKT A;  2J8A A;  4DS5 A;  1FFW B;  1S97 A;  3KG1 A;  1SC1 B;  1NU4 A;  4LQ9 A;  1CS4 B;  5A8R A;  2IA0 A;  4ECU A;  2HS0 A;  3PY8 A;  1PBU A;  4ED0 A;  2I8E A;  4B3R F;  4QWE A;  5GMK a;  3F44 A;  4OX7 A;  2XS7 A;  4RBT A;  1NUE A;  4ZS6 A;  2AGQ A;  2R7O A;  3MCO A;  3TZY A;  3KLV A;  2XSF A;  3K5O A;  1WTF A;  2NSB A;  3CO0 P;  2H51 B;  3NLC A;  4UQT A;  1S0V A;  2K2P A;  2W8L A;  4KC5 A;  4K5S A;  2HMI A;  1GTE A;  2ZH8 A;  2QA1 A;  2CDR B;  1CJU B;  5G4D A;  3SFU A;  4C8O A;  1MWZ A;  2FJE B;  4I4B A;  5T14 A;  3IRX A;  4UOH A;  4CNY A;  1VQN S;  2G9O A;  3GG1 A;  2Q3P A;  3T5J A;  2VFS A;  4WF9 Q;  1EAY C;  4OHW A;  1VQ9 S;  2JEF A;  2YNG B;  1NHU A;  4CP5 A;  4JI6 J;  2CJK A;  4ECV A;  3DGP A;  4TLQ A;  3LAM A;  3CJ3 A;  3DMJ B;  1GT8 A;  3L4B C;  3OJS A;  3UNY A;  2WVC A;  5A0Y A;  2V8P A;  3IM9 A;  3DXB A;  4WK3 A;  4KYZ A;  3FBF A;  2OGU A;  4QWC A;  1S1V B;  5HQL A;  2OKQ A;  1X4F A;  3N5B A;  4K2X A;  2YNF B;  3PIP Q;  2W7A A;  3VAG A;  3OUY B;  3UD4 P;  1HA1 A;  3LGN A;  4EMD A;  4JYA F;  4BDP A;  3DRR A;  3QGG A;  3BDE A;  1AA1 B;  4NCG B;  4JI7 J;  4DV5 F;  3TZX A;  1UVI A;  5KFG A;  2G4B A;  4KO0 A;  2M5Y A;  4F2S A;  5L1K A;  2BEF A;  3GV7 B;  4P6Q A;  1TVR B;  3MMC A;  4OYO A;  4P73 A;  4WXW A;  1S4E A;  2Y3Y A;  3HDS A;  2PMH A;  2DGS A;  1FE0 A;  1PC4 A;  5AE3 A;  4B3R J;  2ZBP A;  3UVJ A;  3WX4 A;  2B8P A;  2RHS B;  1Q1K A;  1UPM B;  4R8U A;  2KFN A;  5DDR C;  2WOM A;  1PJ5 A;  4C6A A;  4C7Q A;  1MLA A;  1SKS A;  2AW0 A;  3H40 A;  3KXD A;  5EX0 A;  2OAU A;  1LWC A;  4URS A;  5BR8 J;  1X8D A;  1M5V C;  3PW0 A;  1R8P A;  4KJI A;  2KHC A;  2ZD1 A;  3TQ1 A;  3F0N A;  1VI7 A;  4E98 A;  5KTQ A;  1Q79 A;  4YS2 A;  4L6V 3;  4FYW B;  4I68 A;  1S76 D;  2R8K A;  3ENV A;  1RHQ B;  4ECZ A;  1T0T V;  2OD6 A;  2MLY A;  3PJX A;  1NK8 A;  5C5J A;  1X4G A;  4URQ U;  3JSM A;  3BQ1 A;  3CCV S;  4HEA 9;  1T9V A;  2DJW A;  1NZA A;  1GMW D;  2C2M B;  4C11 B;  2HGL A;  2DEJ A;  1C1B A;  1VHI A;  2B4O A;  4Q44 A;  3DRP B;  3FCV A;  4FS1 A;  2QLX A;  2YPZ A;  5CD4 H;  4RWX A;  2LQ9 A;  3GJR B;  4Y28 C;  4DX8 H;  3BSA A;  4KGM A;  5KFM A;  1RAD B;  4XPE A;  2GQQ A;  3Q23 A;  1HFE L;  3T3F A;  4B9M A;  2R7R A;  3T5L A;  3DRS A;  3L3C A;  1KNZ A;  3Q8S B;  3C16 A;  1CLF A;  2M0G B;  1VC0 A;  2HRY A;  3HD2 A;  5D78 A;  2I6W A;  4Q8E A;  2D69 A;  1G4C A;  1MRO A;  1AYE A;  2E7V A;  2L9N A;  2CQH A;  3PX4 A;  3ONQ A;  1IKW B;  1WF2 A;  4NYO A;  2KDO A;  1SJ1 A;  2B4P A;  1R8C A;  1FX2 A;  1M1H A;  2KG0 A;  5K8N A;  4WKR A;  3OL7 A;  4KKO B;  4DLG A;  3BGL A;  4AL6 A;  1HNW F;  4ZK7 M;  3QO9 A;  3ITH A;  3DLH A;  4OX6 A;  2ZHB A;  4DFJ A;  1S0N A;  1MMN A;  4B9U A;  3NBP B;  2VG5 B;  3ENW A;  2AU0 A;  4OV6 A;  3G4S S;  3HO1 A;  1DQA A;  4FPR A;  2JL9 A;  1JLC B;  5B09 A;  3GSD A;  1BD6 A;  3EIC A;  3HZG A;  3HUL A;  1OIA A;  1RJJ A;  2HK3 A;  1LWE B;  1VIS A;  1S9E A;  2WRM A;  2BX6 A;  1RLD A;  1YKW A;  2D3O 1;  1D8Y A;  5I3U B;  2FJD B;  4J91 A;  4CRJ A;  1EAR A;  4G1Q A;  1WC6 A;  3WDO A;  3ZZT A;  1YLX A;  4HT7 A;  2C2D A;  1CQM A;  1RT6 A;  4P10 A;  3BPS P;  2W9C A;  1KP6 A;  2HHH F;  2DTJ A;  3TUJ C;  5CYJ A;  1QVF R;  3K8V A;  4X66 F;  2NXU A;  2M8D B;  2YQ0 A;  2O3D A;  5L39 A;  4DFP A;  4O3R A;  3KJF B;  3WBZ A;  2DIT A;  2LU1 A;  1LFP A;  2N3O A;  4DFK A;  4DV2 F;  1UMJ A;  1UW4 A;  3SSQ A;  4I2P A;  3GFZ A;  2XS5 A;  4J9Q A;  2QFJ A;  3T41 A;  1UWB B;  3FCH A;  1LNQ A;  1ZAW A;  3D4J A;  4AYB D;  4Q0B A;  4ZN3 A;  3GV5 B;  2R2R A;  2NXC A;  3CMQ A;  1WDT A;  3C6U A;  4ZCK A;  2QLF B;  3OLB A;  1TL7 B;  1YVF A;  3GFY A;  4ZP8 A;  3SV4 A;  1AB8 A;  3MTK A;  1S5Z A;  2OML A;  2UXC F;  2R7V A;  2QG9 B;  1HBM A;  1HBO A;  4F8R A;  1GX6 A;  3MEE B;  5DG8 A;  2HVE A;  3HHE A;  2F40 A;  3MAA A;  3QZ8 A;  4RPF A;  3FFI A;  4GC7 A;  3SMZ A;  4C4W A;  3LPE A;  3QID A;  2O01 C;  1G1X A;  1FI4 A;  4I1T A;  3OXG A;  2FDN A;  1XNQ F;  2J9E A;  4J9R A;  5IC4 B;  1D0E A;  4YUD A;  3KNG A;  4DR5 F;  4B3M F;  2Z4P A;  1MW7 A;  2HRT A;  4UOF A;  1RYS A;  2L48 A;  4OYX A;  3CD6 S;  1GXT A;  2XNQ A;  2AYE A;  3K5P A;  2R7Q A;  3NS7 B;  4USH A;  2ROG A;  3PYG A;  3FK4 A;  2FGC A;  2KO1 A;  5FLX U;  3R5B A;  3W5Y A;  3W2V A;  3U1L A;  3OVS A;  4QYZ J;  2DNR A;  4F04 B;  3KFW X;  1KLM B;  1NH7 A;  1OWX A;  2LQJ A;  1P9Y A;  1UFL A;  2DIS A;  2PGC A;  2KJV A;  3B54 A;  2GHV C;  1JXE A;  3KJV B;  4LR9 A;  3PFO A;  4PPZ A;  1TP7 A;  5HK4 A;  3CCR S;  4K5R A;  2PC6 A;  4PWD B;  3AXK A;  4UST A;  2E1P A;  4OHZ A;  3L7O A;  2HKE A;  3W2W B;  5J2P A;  1NJX A;  4NXM J;  4CO4 A;  1NJY A;  1RTJ B;  3R5D A;  1UET A;  3GYG A;  2XBP A;  4HAC B;  4DV2 J;  4R0E A;  2F5G A;  3TOQ A;  3G71 S;  1KOH A;  4HLB A;  2MKH A;  2QFI A;  4BWJ A;  5C25 A;  3GMG A;  3MFH A;  1IUJ A;  3MMA A;  3QFW A;  3AJ2 A;  2D41 A;  3Q8R B;  1X4H A;  4LT6 A;  2ZOM A;  3GB0 A;  4JI0 J;  4DCO B;  3FEY B;  3PW5 A;  4DXL A;  3QWP A;  4QIE A;  1TK5 A;  4HHU A;  2KRB A;  3DLE B;  3DDI A;  2W2O P;  1FJE B;  5KT2 A;  4O0N A;  4LIR A;  2LA6 A;  2AJF E;  3G82 B;  3BEG B;  1RTI B;  1HNZ F;  3WHI A;  3VQS A;  4N5S A;  2R8I A;  2R7S A;  2FC8 A;  1TL1 A;  2EG1 A;  3JXO A;  5A8R B;  2CJB A;  3DRX A;  2JOQ A;  4LSN A;  4GC6 A;  4Y00 A;  1HNX F;  1K47 A;  3MR2 A;  3ISZ A;  2MEW A;  4UT4 A;  1XNQ J;  3KJQ B;  2UZA A;  3BQ0 A;  3A12 A;  2XGP A;  1QAX A;  2FVS A;  1BQN A;  1WC4 A;  2ZBC A;  5B0A A;  5AT1 B;  2M70 A;  2E5L J;  2VG6 A;  4M5G A;  1M0S A;  4WPA A;  4NCB A;  4DQP A;  3NGR A;  4PG8 A;  3AJD A;  4NL5 A;  2J6U A;  4UUW A;  1K8A T;  1BLU A;  2BJE A;  1C2P A;  2J76 E;  3W9I A;  2BDP A;  3MM5 B;  1S1T A;  2C3O A;  2BW2 A;  2HMI B;  4GVL A;  4QPX A;  3CJK A;  1HNI A;  2YWK A;  2IYI A;  5K5M A;  3IRX B;  3J80 U;  1WEL A;  1HIY A;  5J1E A;  2KT2 A;  2OEJ A;  5JJB A;  3X3U A;  2AJ4 A;  1S6P A;  5CQG A;  5FJ4 A;  2IRX A;  1QJH A;  2GIQ A;  4CLP A;  1BWV A;  3DGP B;  4X2B A;  1RT4 A;  1MWQ A; 
#chains in the Genus database with same CATH homology
 4M5K A;  3HT0 A;  3IP0 A;  1Q0N A;  5ETR A;  5ETL A;  2BMB A;  4F7V A;  1HKA A;  1RU1 A;  3HD2 A;  3ILJ A;  3MCM A;  1EX8 A;  1CBK A;  2F65 A;  3QBC A;  3HSJ A;  3HSG A;  3ILL A;  5ETO A;  5ETT A;  1HQ2 A;  3ILI A;  5ETQ A;  3HSD A;  3UDE A;  2QX0 A;  4M5G A;  2F63 A;  4CRJ A;  1RB0 A;  1RU2 A;  3MCO A;  5ETM A;  1KBR A;  1F9H A;  4M5M A;  1G4C A;  1RAO A;  3UD5 A;  4PZV A;  1TMM A;  3KUG A;  4AD6 A;  1DY3 A;  4M5H A;  3KUE A;  3HSZ A;  1RTZ A;  2CG8 A;  5ETV A;  3UDV A;  1IM6 A;  3MCN A;  5ETS A;  1EQM A;  4CYU B;  1EQ0 A;  4M5N A;  4M5J A;  1TMJ A;  3HD1 A;  4CYU A;  4M5L A;  3HCX A;  5ETN A;  5ETK A;  5ETP A;  4M5I A;  4CWB A;  3ILO A;  3KUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...