1RU1A

Crystal structure of a ternary complex of e. coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin at 1.40 angstrom resolution (monoclinic form)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
143
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPPDYLNAAVALETSLAPEELLNHTQRIELQQGRRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Essential Roles of a Dynamic Loop in the Catalysis of 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 143
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1ru1A00
1RU2A 5ETKA 3MCMA 4PZVA 4CWBA 3HD2A 1RU1A 4AD6A 5ETRA 1HKAA 5ETQA 4M5KA 1EQMA 1RAOA 1HQ2A 3HD1A 3HCXA 3ILJA 5ETSA 3HT0A 3MCNA 1KBRA 3ILOA 5ETMA 2F65A 3UD5A 1IM6A 3HSDA 1TMMA 1G4CA 5ETOA 4M5LA 3KUGA 5ETPA 4F7VA 2QX0A 3ILIA 5ETNA 3HSJA 3UDEA 1RB0A 4M5HA 4CYUA 4M5GA 4M5MA 3MCOA 3ILLA 5ETLA 1EX8A 3KUHA 3IP0A 3QBCA 5ETVA 3KUEA 5ETTA 3HSGA 4M5IA 4M5JA 1DY3A 3UDVA 2BMBA 1Q0NA 2F63A 4CRJA 4CYUB 1EQ0A 1CBKA 1TMJA 3HSZA 1RTZA 2CG8A 4M5NA 1F9HA
chains in the Genus database with same CATH superfamily
3G8SA 4IO1A 1Y3JA 3SDEA 5KFVA 1J5EF 2OEMA 4UY8T 4JI8F 1X4GA 3UN5A 1QE1A 2DHHA 4CO4A 4CT9A 4NLTA 2DD8S 4B9SA 2AT1B 5F8HA 3CMAS 2XZWA 1YWXA 4LRFA 3CCRS 2BUNA 2N4CA 2CQ2A 3HJVA 2HLUA 3F41A 2XCPA 4UUXA 2R8IA 1QAIA 3FQKA 4ID8A 1NJXA 2R2SA 4V1Ak 1PSDA 3NXZA 2GGPA 1WOSA 2HK3A 2MKCA 2CVIA 1VHIA 2B4PA 2F4VJ 2YH0A 2POKA 1HA1A 3BZQA 3M8PA 4QYRA 1RAAB 1V3SA 3KK2A 2H54B 3MM8A 1S0OA 4LBPA 1WF2A 3UD5A 3GFZA 5EN1A 4PQUB 2XQCA 2GVZA 4YY3J 4PCQA 1FK9B 1OPIA 4PABA 1HBOB 2RDIA 1NHKL 3F73A 3HFVA 2MGZB 2BV3A 1SJRA 3KLHA 2G2YA 3W2VB 1RT4A 3Q23A 2ROGA 1ZA1B 1FDAA 1SQFA 1L3TA 3ZTRA 2HHQA 3W62A 1FRJA 1WSVA 3IWXA 4G1QB 3G71S 2XSFA 3QPIA 1HI1A 1PBAA 3KK3A 4I67A 3R97A 3H5UA 2OD6A 5C25B 3EGWB 3I32A 2WTFA 1RT1A 1CQNA 2FY1A 1TL1A 4FP9A 3D28A 3M9NB 2CZ9A 4K8RA 4P73A 2VQFF 3NGRA 4WP8A 3OV7A 3GB0A 4ZPDA 2C2RA 2AEFA 4QU7A 3BGUA 2YWGA 3FBBA 1QSSA 3CE8A 4OLPA 1KLNA 4ZVQB 2LLZA 4DUYF 2AQ4A 2WW4A 3HMJG 5KFPA 4HH1A 2K3IA 3CT9A 2AZ3A 3OFFA 3IM8A 3FRZA 3PYEA 3SBMA 4UF4A 3EXYA 1G6BA 1YTYA 5DZ7A 4MK9A 4B3SF 5KG4A 1EKSA 4CLLA 4GVBB 4XAKA 4P52A 4DV0J 3ETMA 1XERA 1FRXA 2ZD1A 2E1AA 3OHBA 2Y0BB 2G0JA 1KEKA 2LECA 1F2GA 2H3EB 1TL7A 4FXWA 3R5BA 3ELHA 4DR4J 4I1TA 4MK8A 3A8KA 1PJ7A 2BOAA 3TAQA 4DPOA 4K4YA 2AGQA 4PXEA 4RU9A 3AOBA 2J6UA 2P2CB 4LF7J 4RNOA 4RX6A 1MROA 2OFHX 3MM6B 3DLLQ 4O3SA 5ETKA 2NPFA 3JTOA 2ZJQQ 2HQGA 1FD8A 2A6MA 1DHMA 2QGFB 4OHXA 5L8RC 5KFAA 2R7QA 1TKZA 5A0YB 1Y9OA 1DAXA 1JLGA 1FWKA 5AJ3F 2KXHA 4V19X 2DGQA 1Y4ZB 1FVQA 2YKOA 4EO8A 2DNQA 2K8GA 4YMEA 2MZJA 3C2PA 4AL5A 2BRKA 1FT8A 2B5JB 1PJ6A 2FDNA 3US5A 1FA0A 4RW6A 3EVMA 2IM2A 2LU2A 3CULA 5A8RA 3VGVA 3JTPA 3E01A 4NZ6A 2RS8A 4KHPF 3UD4P 4ZLPA 4PEOA 3HT0A 2MEWA 1ZZFA 1FJEB 4C11A 4P2FA 1KTVA 1UVNA 5C5JA 5D3GA 3C19A 2G13A 4L73A 4B3TJ 4X66F 1VRUB 1QVGR 1GH8A 1JXEA 2YNHA 2H5EA 1NB7A 1RT7B 3QO9B 4C8NA 8ATCB 1T9VA 1K1SA 2C3OA 2CPXA 4X4OA 2DRDA 5F8NA 3LQVA 3W5YA 5DG9A 4DR5J 1M90T 3WX8A 1P6TA 1TK0A 3M6WA 3HSJA 3U1NA 1WEZA 4KKOB 4DCPB 1IBLJ 4P74A 2VONA 2MB0B 5K9FA 3P5TL 1HBMB 2RH3A 3IWNC 2ZBPA 1FJ7A 4IRKA 1REVB 4KC5A 2XMMA 2D7SA 1XK8A 3OL9A 1FNOA 2PIIA 2A2CA 1PAEX 2QYGA 1UWBB 2W9CA 1D9AA 3D3BJ 2BKNA 2VHGA 2KFYA 3AXKA 5BYRA 1ZPVA 4YP3A 2KYZA 2M52A 2VDIA 3VVUA 4ETZA 3R5DA 5EUHA 2NZ4A 5HSPA 3FCWA 1RLDA 1S77D 1HPZA 4NWBA 1LXNA 5E33A 2BR0A 2RB7A 1HQ2A 4WTYA 2CVEA 5FIIA 4HEA9 1SUQA 1TU0B 3ILLA 2GAGC 2ZH8A 1G7CB 2NUHA 2GC8A 4WXWA 1VQ5S 4DL5A 4DEZA 4L72B 3AH6A 5L1IA 4JI6F 3QBCA 4HI2A 1U24A 2D3O1 2C28A 4Y2AA 1U0SA 2HZAA 3GMGA 3MEDB 3MHYA 3BN4A 4YEAA 5LMNJ 4OLOA 1LW2B 2C22A 1FK9A 2VF3A 2R7XA 3PNIA 2MGZA 2HQ3A 4PG7A 1IVZA 2PT0A 3W2VA 2XS2A 2OUGA 3LW5C 4A8MP 1VQOS 3BGOP 1CULA 2FZGB 3EVWA 2W2PP 3D0IE 4UZCA 1S48A 5HMWA 2DO0A 4CO2A 2VFUA 4ECWA 4FNHA 3G82A 2B4VA 1DQ8A 2CNKB 5I3QA 1L3SA 3K5OA 5JUMA 4GVLA 3O1LA 3JYTA 4HT5A 1T8EA 2IMOA 3SFGA 1VRTB 3J7AN 3D66A 5C25A 3RZAA 1SPBP 3T6BA 3UN3A 3D7SB 2FUG9 3DFEA 2XSJA 2J6TA 5J2MB 4IFVB 4K0KJ 3KLFA 4C3KA 2EFPA 4QW8A 4LQ3A 2FJAB 4JBCA 2V2QA 3FDSA 4J9PA 3JSMA 1FO1A 1OIAA 3GQCA 1RDRA 3HD2A 2RQMA 3HVTA 1SQEA 2LQ9A 2HYIB 1D8ZA 1N0VC 4F2RA 4HI1A 3JS9A 1X0FA 4NA1A 4KSEB 3IRXB 2XYPB 1JXLA 3SI8A 5M2UA 4ICLA 4OI3A 2HZVA 4E98A 3E51A 2QSFA 3KDNA 2B9YA 1XMQF 2EFVA 5FDLA 4O23A 2H4YB 4DJBA 4ENOA 4R0EA 4ED2A 1Q79A 4DR6J 3HHNB 1VLYA 1UZDA 4NLRA 4G1IA 2JLFA 4EBDA 3KMSA 2AYGA 1N0UA 4JI2J 2UXBJ 5KFNA 2VKZG 2P5VA 2E5JA 3CB4A 3NWGA 2ASDA 3WIUA 4JV5F 4DSFA 3OTCA 2PC6A 1FFWB 1UPPA 4GKJJ 2XCAA 3PVXA 1CS4B 3DLKB 2DNNA 4C0HA 1UEKA 4UOGA 5HI7A 1OPZA 3FZBA 3KUEA 4IR9A 2IYIA 1D3WA 1NO8A 3UWTA 1QTMA 5F8JA 5GADI 3VAJA 3OFHA 4Q0BA 3CPWR 2J7KA 3H5YA 2ZDOA 1IN0A 1JJ4A 1U1PA 4CNZA 5E2QA 2HSEB 3CD7A 3W61A 2I9SA 2ZZTA 2NQPA 4ID5B 2W2MP 2ACMA 4CM2A 1AB8A 1DRZA 4BC9A 5HVFA 4NRUA 1QTNB 2ZHAA 2FHJD 4DR1J 3FSXA 3GJRB 2DH8A 1UCNA 1SKRA 2HHVA 1GMWD 5EX0A 4ALZA 4LMZA 2AX0A 3GIMA 5KFOA 4ERDA 1W2BR 3HSZA 2CJQA 1L3UA 2DITA 4IRDA 4WK1A 3VAKA 1JLEB 3VHQA 3PRVA 4JOUA 1P27B 1RTHA 3QO9A 2C2EA 2VG6B 4J37A 3HFZB 5H9EK 1N5VA 2AEJA 2DHAA 3UDVA 3D54A 4DV1J 2DPIA 3KXDA 3DU5A 2DRBA 2E7XA 5HLFB 4P7TA 5J2QB 4JI0F 4C8ZA 3R6GB 3N6MA 4KKOA 3RB4A 1WC3A 2CWXA 5KFDA 1KSPA 1S6QB 2YQ0A 3MAAA 1URRA 1NKBA 3VTIA 4C8LA 5IV3A 1FDNA 1WC6A 1RWWB 4MYTA 2B8PA 4ZP9A 4F0HA 2R8HA 2JHEA 3NP5A 5D8HB 5C42A 4CLYA 3P5BP 3I31A 3W66A 2V8VA 4ZA1A 2R2UA 5HAOA 2HHTA 3IM9A 4QR1A 2JLGA 4IG3A 1R89A 2E1CA 2N7CA 1VR6A 1H3DA 3K7RA 1S12A 2MQPA 4ER8A 3M6VA 1PYOB 1X4AA 1HD1A 1AROP 5GAHI 1O5JA 4NCBA 2B9WA 2YX1A 4NEZA 1RACB 3PO5A 2VG7B 1HNVA 2X3DA 2QA4G 1KDNA 4OZ2A 2VIHA 1S7HA 4ATNA 1C1BA 1V3ZA 2DNLA 4FYYB 2MQOA 5D4LA 5K8MA 4CLFA 3ZZUA 1OSCA 4EWTA 4Z37A 4U6PA 1RT3A 1Z1ZA 1Z2LA 3H2VE 1AW0A 5I3UB 1FKOA 2V9WA 1N88A 4RNFA 4AFFA 2HVHA 1R6YA 3FUYA 4RWWA 1YIJS 3DU6A 1YK9A 4LJMA 4TYBA 2UVWA 1J5OA 4WU2A 1U09A 2BJ1A 2HHWA 2R2TA 1C0TA 5ETMA 3PIOQ 2IAJB 2ZE2B 4HR2A 5ETLA 4RBUA 4O0NA 3FK4A 4Y28C 2EKNA 1VRTA 1ZOTA 2FJXA 4HKQA 4EK2A 1VK8A 2E5HA 4S0MA 2CPEA 5CABA 3EZ5A 4ECXA 2MQNA 3AB2B 5CCLA 2JSXA 1FNMA 1IBKF 2IA6A 4NA3A 2FVQA 5HL7Q 3IS9A 1B0TA 4NLPA 3PFEA 2HFNA 2UU9F 1PG5B 2W2QP 1B64A 2IM1A 4TYAA 3RBXA 3LANA 1HR0J 4IFYA 5B0AA 3SCLE 2NXCA 4ZJLA 3G4SS 4DV4J 5KT5A 1GMVA 1U48A 3OVAA 1HBNB 2XMKA 3DMJB 2FHMA 4QBUA 3Q83A 2N3LA 4FDFA 4U67Q 3DLGB 4M5NA 3ISNC 2K1RB 3R8YA 2RDJA 5DG7A 3IR6B 3KLGA 2AZ1A 1I94F 3W2WB 2RNEA 2YH1A 1IBMF 5ETPA 1PIEA 1RWPB 1EX8A 5BR8J 3CJKB 3I5BA 3A8JA 1OQ3A 2FTRA 3FRYA 4WPAA 1CJKB 2YVSA 3T9NA 1FKPB 7FDRA 1KQSR 1FRKA 4DSIA 4R8UB 3DLJA 2DH7A 1FX2A 2AD9A 1DBDA 3M8ZA 2CXEA 4A8OA 5D0EA 1CS4A 1GEHA 1S7IA 1NLKL 2F5GA 3N0VA 4ELVA 1RT5A 4IQMA 2QMUB 2J9EA 3BDEA 1RB0A 2J8AA 5DM7Q 2YTCA 3D67A 3UI3A 3DCAA 2RF2A 1PKUA 1VQ4S 1BHNA 2JDJA 5DQIA 2VD3A 2FJBB 1HFEL 3THVA 3RBZA 4OV6A 2Q43A 4OX8A 4C8KA 4J9VA 3JSYA 1RE1B 4OI1A 1V9OA 2FY8A 3Q8YA 2OAUA 4X4SA 2N7YA 2IJRA 4ZP7A 4ZVPB 3ZO7A 1GX6A 2FIUA 5D6GA 2GIQA 2IYGA 2KHDA 4DV5F 2R7RA 4ZIWA 5GAEU 3JB9k 1N33J 3WX4A 2Y1RI 2FC8A 5GMDA 3W63A 3WC0A 3QJPA 2NYHA 1ROFA 3JAMY 1OMSA 4NASA 4I6AA 3ENWA 4JI5F 3GFHA 2UXDJ 1VDHA 5LSLA 3BBCA 3MPVA 2DGVA 2J5AA 1IR1A 3H8YA 3BGFA 4P71A 1NKEA 2B9EA 2CJKA 5HATA 5HLFA 4CH0S 5D4NA 3ET6B 1FCAA 1HWIA 3Q8QB 1WG4A 3M4XA 3DRPB 3UPFA 2XMJA 5KFTA 4NLSA 3GR0A 3KLEB 4KY3A 2XC9A 3KG4A 5F9LA 1K8AT 3DC2A 1ZTWA 4QIEA 1CSJA 3PJWA 4Y00A 2CJBA 4AUKA 3CCES 4M5MA 3OSPA 2A1BA 1UVKA 4O3RA 3K8WA 4NEYA 4NCGB 2AIRB 3T3FA 1U0HB 3CMQA 3I82A 1SC4B 1N52B 2W9BB 3AODA 3BO2A 4NXMJ 1RHRB 3FC9A 2B56A 4PG5A 4B3OA 1NDLA 2P9CA 5J2PA 1KR4A 4WTOB 5A6PA 2DNPA 2KU7A 2BACA 2ZKTA 2C2KB 4F36A 3F44A 2PMZD 2ATLA 5AXLA 1WG5A 2OKQA 3CCTA 1VQNS 1RUSA 3VAGA 4MAKA 2V4RA 4MKYA 3JSBA 1YGYA 1T05B 5K8PA 3QSIA 6AT1B 5HBMB 5AXNA 2ADCA 4BWMA 3JTNA 2CQ3A 2KHCA 4FKXA 4PQAA 4DCJB 3CC7S 2D9PA 4U8YA 2JH3A 4B17A 3BPSP 3M9OB 3VGUA 4WJBA 2DCLA 2O66A 4F8RA 2HWTA 2M0GB 4A46A 2RIJA 1S9EB 4YUDA 1V5IB 2DYAA 5G4DA 4FKYA 3CC2S 1I3OB 2DXEA 4TKTA 5KT7A 3MMAA 2XY7A 4DG1B 1MMNA 2MHNA 4ED1A 5KFRA 4LF9F 1FRLA 4CZCA 1M5OC 2EC0A 3QQCD 3FMBA 1MNEA 4RW7A 2UZAA 1UETA 2GO8A 3MUVP 2J7UA 4OYAA 4CI0B 2RU3A 3B6BA 5LJ5Y 2V8GA 2MZSA 2WONB 2DT9A 2LQ5A 3L95X 1U1KA 2APOA 4IH5A 4HACB 3WDOA 2JEIA 1VC0A 5HO4A 1NKCA 2CDRB 2LVWA 1R27B 2CNLB 2CPDA 5K14A 3GJTB 3CMES 2R7OA 4Y2KA 2J76E 3DOMA 4LFBJ 3ZXWA 1EARA 1PC4A 3HXMA 4W92B 3V6KA 3KG1A 1U6FA 4DV2J 3BBBA 4CDIA 1HBNA 4QWDA 4M8LA 3DMJA 3VAHA 1VBYA 4CH7A 5DRKA 2HFUA 2G2ZA 3E2EA 2KG0A 4L3NA 3KHRA 1P9YA 1NDKA 4NXNJ 1DY3A 1TVRA 8AT1B 4DU8A 2RQCA 2IM3A 1TK8A 2E7VA 1GFWB 1EAYC 1TL4A 1MW7A 2GFFA 5KFQA 3CJKA 2C42A 3NBPA 5K5MA 2CQDA 4CO5A 3A3PB 3K8VA 2DNGA 4A8QA 4FS2A 2OPPB 1RWOB 4C97A 4LF6J 2EG2A 3CTRA 4BHQA 3HD1A 2C2NA 3HKZD 3TUZC 4KB7A 3UD3P 4C8OA 3C3LA 3M05A 3PTWA 2MKYA 4ZJQA 1OO0B 4WFNQ 4KV8A 2PSZA 3VQTA 2HK2A 2C3UA 1FWPA 1R43A 3CIMA 3HZEA 4N7TA 5L38A 4F4YA 1VBKA 4JB8B 1NB2A 4WFXA 2JL9A 1YZ7A 1R31A 1AUDA 4J91A 5AXMA 1YJRA 4KAIA 2EWHA 1N34F 1WC1A 5IT9Y 1V6HA 4WCEQ 2R7UA 3EZUA 4IOAQ 2DIUA 3DGVA 1F0XA 4KHRA 3BH7B 1T3OA 3H7HB 9RUBA 1HBUA 2WB4A 5C2CA 4UZBA 1SL0A 2Q3PA 4ELTA 3MEGA 1S6UA 4FF3A 1F9EB 2V2VA 4KT0C 5EWEA 5HROA 4WYLA 3N28A 1WKKA 2A0FB 3J7YU 5AE2A 2M7SA 2H9ZA 2KVQE 3GILA 3AFGA 3D0GE 1E6VA 4C4WA 2D1CA 1HNIB 3WQPA 1ZAWA 2DNRA 2QL7B 3M32A 4IDKA 4RW4A 1ZETA 1JLFA 3MMCB 3H98A 4OL8A 1NUEA 3VZHA 3OUYB 2ZH6A 1LNQA 3H20A 4NLUA 2FVSA 2C2ZB 1I51B 5FJ4A 3T19A 4LF8F 1RAIB 3FEZA 2HHUA 3SFUA 3K59A 2V2ZA 5AXKA 3R7BB 3BQ2A 2MZQA 4NLDA 5IOLA 2DGSA 1BQMB 4LF2A 5CD4A 2MDAA 2DNYA 3LH2S 5MAOA 3CCUS 2BRLA 3VALA 1Y3KA 3DYAB 3B82A 3LAKA 4B3RJ 4TLQA 1RK8A 2P8IA 4CYUA 4NOHA 2ZJPQ 1X4CA 4Y65A 5EWGA 3OTOJ 3VAMA 5LMUF 5B7WA 2JRSA 5KFIA 4G65A 3OTDA 3R1LA 1FTRA 1J2VA 3UR0A 4C8YA 3LAMA 3LP1A 2HIQA 1U25A 1VC6A 1BQNB 4ZCIA 4DPUA 1U02A 4N41A 2F4FA 3CGIA 2KH9A 2GQQA 2E5LF 1T9TA 4QPXA 2D3UA 1K9MT 1RA6A 4TVAB 3DXSX 3UW1A 1XWLA 3OXGA 3LP2B 3H40A 4P2SA 5JJBA 2E9TA 1S0NA 1JJHA 3EGZA 1H7XA 2GS8A 3EWGA 1HHSA 3N4WA 2Q1LA 2CPYA 1KC8T 2VFRA 2GZOA 1RLCL 4YHHJ 2RUSA 2ZNZA 1HMVB 2I1RA 2XY5A 3AJ2A 3ZZZA 5A8WB 3C8YA 2IRYA 1RHKB 5HBMA 2VJUA 3K2YA 2C3YA 4Y0FA 4ANCA 1LWXA 2UV8A 2OPSB 1TKTB 3R7SB 1YJTA 2CJ9A 3PEHA 4KHMA 2B9XA 1CBKA 2CQ0A 3G6XA 3HULA 3NKYA 3BGRB 4ECSA 3PRDA 2B3TB 4FYDA 2UXCJ 2F9DA 4DG1A 4MKBA 1GMWA 2N4DA 2QEXS 1YG0A 3GFXA 2KFZA 2J9DE 2E5IA 3ETOA 3IG1A 3UDCA 2W24A 4DMZA 1IR0A 3KUGA 4EMDA 3ENVA 2JC1A 5KG6A 2OFGX 3QFHA 1NHVA 4Q5VA 4JI1F 3CDBA 1KVJA 3MCMA 1N5TA 1Q8LA 2LDYA 4LFAJ 2KRRA 4ZITA 2GJFA 2OPRA 1H0HB 1SKWA 4NYZA 3AD8C 2K7KA 3IR5B 4BDPA 3OFGA 4USVA 3K57A 4QR2A 1ACMB 2X1GA 4DV3J 4MYUA 1F5BA 3HPOA 3QZ7A 2GVDA 1KD1T 4HDGA 4A8YA 3TARA 2AMCB 2Y1LB 4X2BA 2YWFA 4DDFA 5LXYA 1RP5A 4O44A 3LALA 2PE8A 2KM8C 2G1HA 2XB2D 4ZKAA 1Q78A 2CPFA 2VBYA 1BWVA 3QT7A 1NH8A 2O1PA 2XLIA 4JI4F 3PEJA 2I5JB 3T1YJ 3MEEA 2R2RA 1DTTB 3FGVA 2XS7A 1WOOA 2AKWB 4HYKA 4CLSA 2X7IA 1JIHA 1XNQF 1F9FA 4QIWD 4Y2CA 2OTJS 2ZKUA 3A4TA 3L9ZA 1K0VA 2OHDA 4LR9A 2ZH5A 1RAJA 4J7CA 2BJ3A 1TZ0A 1RSCA 1NM2A 2FVCA 1EP4B 1VC5A 1Q16B 3KK1A 3Q2TC 2WVDA 5C24B 2KJVA 2RE1A 1VQKS 2GMHA 1YITS 2ZDPA 3KYLA 1JK9B 4F04B 5E3AA 5CYMB 5DO2A 1EETA 1YKWA 2M8DB 4LT6A 2VUGA 2VBWA 3CO9A 4DFJA 4WWSA 1VQ7S 5FLXU 1KTQA 5LXRA 4NL5A 4EEYA 2EK1A 1UKUA 5HP1A 1PYTA 2HGNA 2ROPA 4YFUA 3RAXA 4AD6A 2NSBA 4CLKA 1U1RA 2XM3A 2HZCA 3NL0A 3R6LB 4KO0B 2WVFA 2NPIA 1HNIA 1VQPS 2FPHX 5T14A 1HW8A 3V6DB 1G1XA 4KQZA 3K5LA 2DY9A 3WHIA 2KZMA 3NNAA 1IQTA 1DTQA 2ABYA 1S1VB 2XLKA 3Q8SB 4JV2A 4YR0A 3AXMA 1S0MA 2JEJA 3NWRA 2DR7A 3FFIA 3BS9A 1SJ3P 4KFBB 1KS2A 3MECA 3FVYA 3CJTA 2MMYA 5IXUA 4F02A 1JJCB 3QLHA 2FJWA 4F3MA 2F40A 1BQMA 2W1BA 2GNKA 4ZPAA 4ZVHA 2HGLA 1RBOB 3R5AA 1D9DA 3MM5B 1RABB 2YKMB 3DYAA 4H4KA 3TEGA 5L1LA 2BOPA 2CRLA 1C0UA 4W4MA 1RAFB 3PCOB 5KOWA 5I4MA 1F1BB 3LPYA 2MSTA 1IKYB 4PPZA 5HVGA 1YJ9S 2E9RX 1M1KT 4PWDB 2Z2MA 1H6KX 1S9GB 3ILOA 2HFVA 3CNQP 2CQHA 1W7WA 2Q6BA 3AAWB 5L1KA 1Y7PA 2PGCA 4C0OC 1KKHA 3IBWA 1KFDA 4TNOA 2UUAJ 5HQLA 1DFDA 4R25A 3GR1A 4PAAA 3LP2A 1BD6A 1N6QA 5KFMA 4USIA 2O5DA 4RJVA 2L41A 3I0RB 3BN7A 2F7VA 1J5EJ 3C15B 1VIOA 5DDPC 1U8SA 5ETVA 1TMJA 2O01C 4JI8J 1ZPWX 1RWNB 3ISND 5LL6d 1MU2B 3CCVS 3QYYA 1X5OA 2I8EA 4OX7A 3MMBA 4QIGA 1U49A 2WOMA 3FSIA 4ZLLA 3BYPA 5KT2A 3NS7B 2HAIA 1TKTA 5A6WA 4OI6A 4DS5A 2BA9A 3AD7C 3VCDA 5JXSA 5J1EB 3DM2B 1FE0A 2G1DA 4X64F 3PIPQ 1N36F 3DRXA 3O5TB 4ZPCA 3M8QA 5GAEI 2MKJA 4OYZA 2E9ZA 2AW0A 2HIYA 1HWLA 4P72A 1REGX 2CQIA 5EHHA 2IC3A 5D15A 4DL0C 3GYXB 1VBZA 2GHVC 2HBQB 4X65F 3W8GA 4ES1A 2YKPA 3QT8A 1T11A 2BZ2A 2HBYB 4Q2LA 1WI6A 4XO0A 3OVBA 2KJWA 1MG7A 3UR3C 1ICEB 2FGCA 1KOOA 1WORA 2V63A 4PWUA 2IDEA 4WP9A 2EFNA 2XI3A 3RJMB 1IJFB 1AZSB 4ZHRA 3ZTSA 4PRFA 3MWBA 1B7YB 3EX7B 4DOZA 1S49A 4H4MB 1QE1B 2AJ4A 1F9HA 1JNRB 4C8MA 4A48A 3P96A 4MTPA 4YS2A 2HNYA 3KHGA 2ASYA 4FBTA 2JFKA 2KXNB 1E6YA 3VVTA 4CLPA 4L3KA 1F5AA 1WOPA 1R8BA 4IRCA 4WFZA 3S01A 4Q44A 1DURA 3WIVA 2VQFJ 2GGPB 4K4SA 1JLAA 4Z7CA 2E29A 3L09A 1C4AA 3DHXA 2BMBA 1MWZA 4DUYJ 3M8PB 1HHQA 3KK2B 1HWKA 3I87A 3MM8B 2MY7A 3HI9A 4GMKA 4ECZA 4DU7A 4N8OA 2BJ9A 1HIYA 4B3SJ 4E2FB 2Z58B 1IKWB 1QDUB 3QJLA 2V8DA 3NGSA 3UDLA 4DFMA 2A6OA 2NZCA 1D0EA 2VFTA 1A9NB 3KLHB 3KJQB 3GJSB 4AT1B 1EP4A 3CJ5A 5E7OB 5IQQA 5GAGU 2J9CA 2RDDA 1IKVB 1EQ0A 1X4BA 3N5FA 4ZP6A 4KGVB 1ZS6A 3B4MA 4GC7A 5CYMA 2CNNB 5M2RA 4I56A 2GMJA 4C0BA 3KK3B 1RAHB 3MM7A 4K4XA 1LK7A 1W25A 2MXYA 1UPMB 2Z2ZA 1TV6A 1S0VA 3TA2A 3PY8A 1RT1B 3DOLA 1BGXT 3TAMA 4NLVA 3FNNA 2DNOA 1SVDA 3IP0A 4WIQA 2KB2A 3TVZA 1LXJA 1KVKA 1YBUA 2PN6A 1ZM2A 4KO0A 5AJ3J 2QZ8A 4B3MF 3F0NA 4GKKF 5IC6B 4MJKA 3V6DA 5DGBA 2HMIA 3CCLS 2QA4S 2FD2A 2JX2A 4QWCA 2DR6A 3TANA 3EGNA 1U6ZA 2KVIA 4X84A 1VBXA 4ZMMA 1Y0HA 4KHPJ 4KFBA 5KG3A 2QLJB 2ZH1A 1SJFA 4UOHA 2WBRA 3RG6A 3QFWA 1VISA 4OHYA 1Q8IA 2YQ3A 2WZ1A 4BS2A 4LREA 1YHQS 1CG2A 4PR6A 4IOCQ 2YKMA 1TL7B 3Q89A 3SCJE 4X66J 3PV8A 2CG8A 2ZOGA 4GC6A 3N6LA 2HURA 4N47A 2E1RA 2PEBA 1JB0C 2Y9HA 2VQEF 3W64A 5IWAF 1S9GA 1N8RT 4B9MA 4I2QA 1MROB 3ILJA 3SSSA 2FZKB 1QLNA 4KR0B 3K5PA 2R9LA 1TKZB 1JLGB 4HHUA 1RQ0A 3B8HA 1XR6A 1SB6A 1KLMA 4J5OA 1AFJA 3TUIC 1R0CB 4ED7A 1RYSA 3U1MA 4J9QA 3LGMA 1RWXB 1EKRA 2HBZB 4RW6B 1S99A 3P4UB 5A8RB 2CJYB 4DSLA 3HM9A 3E01B 1S97A 2K7JA 1HNZF 4DUTA 1RTJA 2C2MB 2AHOB 2F63A 4C11B 3FCVA 1NAQA 5D3GB 2WRMA 1QAJA 2CA9A 1ZBTA 4F50A 1LV5A 1VQSA 3J7YI 3G9CA 3QMQA 4O4RA 2YNHB 4DHVA 2FLOA 1M5VC 3IFEA 4UTGA 3T5LA 1RU1A 4JI6J 3ONQA 4IOBA 2RAQA 3IMQJ 4WKYA 4CLTA 2P6TA 4EZ6A 2VKRA 4C98A 3CCMS 3KNGA 2VOPA 1UVLA 3N01A 4QIVA 1UP1A 4E8UA 1KQGB 1RBAA 3M8WA 3C16A 2QE5A 1RT2B 3BSCA 4NYPA 5KOXA 1R0BG 1PO6A 3AJ1A 2JOQA 3NMRA 1NMEB 4TQSA 3UCZP 1AZSA 1XEZA 1RAOA 3S7RA 2W9CB 3M30B 2HGMA 2JEGA 3ZNUA 1U2RA 5IV4A 2GO9A 2JZ5A 4H4MA 5GMKa 2ASJA 2YNGA 3LA0A 1NPRA 5DJBA 1HPZB 4OJ3A 2OEKA 2VFVA 1S79A 3CWJA 1H2VZ 2GV1A 5HMYA 1URNA 4DV6F 1SUQB 2AU0A 4WIIA 3I0SA 3GP9A 1FE4A 2HHSA 1HKAA 3UVJA 2E66A 1IJEB 1Z2ZA 2M70A 2BBEA 4RW9B 2E1MC 2V9KA 3HSGA 2ZC4A 2EVZA 2ZM6F 3PHEA 1Z4UA 4DF8A 1BLUA 1NSQA 4IH7A 3U7JA 2K06A 3L7OA 4MMOA 2OMOA 1I1GA 2DB1A 1UWAA 5E3RA 1XMQJ 1IKWA 1ZM4A 3B54A 2VC0A 3MCSA 4FF1A 5BYSA 3A8IA 5SUHA 1JJ2R 2W25A 4XIUA 4DR3F 2R7TA 1U47A 4A8WA 5H9FK 1IKVA 1CULB 3JQJA 4OZ5A 1C4CA 2BE2A 1EZZB 3D1OA 3KNAA 4EO6A 2HFOA 2EKYA 4JV5J 2LA6A 2P6SA 3G82B 2CWKA 5IT4A 3JYTB 4K59A 2ZHOA 2XSJB 3ZC4A 1VK3A 2B43A 4A8XA 3AOCA 1F3VA 1U45A 1SJQA 1X9SA 2HNDA 3KLFB 4J9KA 1XNRF 2HG4A 1V3RA 3JSMB 3W5ZA 2NSCA 4X4VA 3HVTB 1JWWA 3TQ1A 5LSRA 3LPEA 1WKJA 3IBFB 1S5ZA 1JLBB 3HVWA 1LWCA 3M1VB 3GSIA 4ICLB 2HRYA 5HJYA 3HFKA 4JYAJ 5FDLB 2E1PA 3VGTA 3DN9A 2ZH2A 4P75A 2DHGA 2CYYA 4FF2A 3L4BC 4Y3CA 1WC0A 4QWAA 4K2XA 2QSWA 3I6PA 3PJXA 1IM4A 5KFYA 2LMIA 1TTHB 1HQUA 2DR8A 2DGTA 1UVJA 1S59A 5D77A 4L76A 1Q5YA 2CQBA 2OEJA 2ZUAA 4LFCF 2OI2A 4NLYA 4JI0J 3PJ9A 2BXJA 4A47A 1S1XA 4ILMA 1KQKA 1Q8BA 2CADA 4ZVEA 4I2PB 1KQFB 4Q0BB 2PEHA 3TZWA 4GRSA 2HHPA 2HQFA 3GYNA 1M5SA 4DQQA 3D1QA 1HQEB 3IWLA 3PW5A 4OX9F 1HNWF 1WWHA 3FKBA 1U6BA 3CCSS 1NZ8A 3MFIA 4C2MA 3TYTA 4F0KA 4LF5F 1WDTA 3RYLA 2OIHA 2R8JA 4ELUA 1RU2A 3BREA 1VOMA 3IA0A 2ZJRQ 3RGIA 1R7IA 1KBRA 1BY9A 2QN6B 1FRHA 5EDWA 3J81Y 3H25A 1Q7LB 3MCOA 2BJ7A 2CQGA 2XWXA 3OVSA 2HVIA 1R8PA 1R8HA 1RHUB 1FERA 5ETRA 5KT4A 2E7WA 3D6HB 2M9KA 1RTHB 2BEFA 2L9DA 2N3OA 2MJUA 3W5XA 3QWPA 2ZZMA 4TY8A 4L74A 2PA3A 2DHSA 1T3NA 1DQAA 4ED3A 3KTQA 4LSNA 5KT6A 2H5JB 4FXVA 1L5UA 3OL6A 4M5JA 4A4JA 5IT0A 2ROEA 1SCJB 1WNEA 2V4JA 3TEHB 3MAAB 3GTYX 2V2KA 2JFDA 1UVMA 1RT2A 1X5TA 2OH2A 4F4AA 1KN6A 4DPYA 1XBWA 3NOCA 2KI2A 4ILLA 3M30A 1ZM3A 3AB4B 3RRHA 4PG8A 4DL4A 1RBLA 5C42B 1XQIA 2XS5A 1VRQC 1NCLA 4ECQA 2RKIA 4IG3B 2X3GA 1UA1A 3W1YC 4NLWA 3M7VA 1YVFA 2ZEJA 3QGGA 1WUUA 4KGXB 2J8SA 1IBKJ 3TR5A 3M8RA 3OR1A 2KZZA 3H90A 1HLWA 2VZ9A 4OV1A 1W2IA 2EG1A 2UU9J 2FJVA 2QLXA 3JQKA 2XNQA 4DV7F 1GMUA 4KTQA 2CZVC 4OI4A 1FJGF 1HNVB 2LDIA 1X31C 1T95A 4RW9A 5D0RA 5E3PA 3AD9C 4L6V3 1S1UB 1VS3A 3IN5A 3BSNA 1UZHA 1C1BB 2BDPA 2HVDA 3M2RB 4OMFG 5BXIA 3GZ7A 3T6JA 3UN2A 4ITSA 2Z8QA 4U96A 1LWEA 3TQEA 1FWLA 4LF1A 1RT3B 5HJXA 3NCPA 2BX6A 1FKOB 2QFIA 1I94J 5GMEA 4XK8C 2MHEA 1NEEA 1SH2A 1IBMJ 3ZTQA 4DFKA 1FJCA 3B4DA 1VJQA 3OL8A 2ATCB 3TNVA 1J5OB 3D5MA 4CO3A 3RAQA 1C0TB 2PI5A 2PFDA 1NDPA 2L08A 4EYHB 4DZ6A 4DBQA 1GXTA 1BXNA 2GQ2A 3T5KA 1H2UX 1SL2A 1VQ8S 3PR5B 3NGKA 2HNZB 2F3JA 2NR0A 3WC2A 4OJGA 4I7FA 1QSLA 2GJ2A 5F9NA 2ILZA 2QLWA 3PX4A 4DSJA 4AXJA 2QYCA 2M5YA 2W2NP 3QRPA 3QIPB 2B0GA 3MXHP 3PG9A 4OQJA 3N5BA 4RBVA 3IS9B 5BYQA 2RS2A 4NI2A 4MKAA 1UTAA 4QYZJ 2KN4A 3QZ8A 3D6FB 3SV4A 3H0PA 1RCOB 1N5YA 2MQ8A 5FLXY 4DQPA 4JI3F 3M8YA 4IFYB 2ZH7A 1JLBA 2PMHA 2V69A 4WFAQ 3U02A 3M1VA 1YSJA 2AYBA 4FXDA 2DIVA 3QGPA 3BPDA 4ZP8A 2DXFA 1Q86T 1YDLA 4YQWA 2AYEA 4ZPTR 5IC4B 4DV5J 1AT1B 2XTJP 3MR3A 1TKXB 3W65A 1MN9A 3KLGB 3CJ8A 4J9NA 4RUHA 1QM9A 5L1JA 3O2IA 4FZVA 1GTHA 4HHHA 1PCAA 2QV6A 3CVKA 4JI5J 2HBRB 4I64A 2AGPA 1XR5A 4TXSA 2Z56B 3EPIA 4OZ0A 2YXLA 2BQRA 1KFSA 5KFZA 2ZC3A 5KFHA 5KFSA 2PMWA 3OL7A 4RUBA 2D9OA 2F9JA 3PKMA 3KJVB 4PYDA 4EU0A 1FD2A 1T9UA 2NUUG 1JXVA 1RT5B 3D1HA 2KT3A 4LR8A 4I2PA 1LK5A 1OWXA 2RF2B 1SXLA 2FB0A 2XG8A 3NAHA 4RL1A 3R2CJ 4OHVA 2W01A 1YZ6A 3RBDA 1LFWA 1CLFA 1BQXA 4ZPVR 4ZN1A 1HQEA 1UEVA 4N77A 2RSQA 2ZBCA 5A8KA 1HWUA 3GCWP 2KO1A 4WKRA 2YKNA 5GAGI 2ZVSA 4RPFA 2GCFA 2Z30B 1WEYA 1KP6A 4M94A 3RTVA 2YNFB 2D3OR 1N32F 5F8IA 3OTEA 2RVJA 4YR3A 5SZTA 4JYAF 4WF9Q 5CYQA 4N76A 2VA3A 4V19J 4BLGA 3I56S 3SCKE 1H2TZ 1FNXH 2J0SD 3ZZTA 1AUSL 4KGKA 3I5AA 1IUJA 1XIQA 2ZOFA 3T9ZA 1YRUA 3SEOA 3CC4S 1IWGA 4OYXA 3MDFA 2WBMA 3G86A 3UNGC 1IR2A 2ZBQA 5DDRC 1T03B 1C1CA 5IM0B 4HH0A 4DX7A 3V81A 2FC9A 2HWHA 3G6VA 2ADBA 4QWEA 3QGIA 1OSDA 4PZVA 2C3MA 4OZ3A 2DR5A 6FDRA 2MQQA 4QZVB 3G87A 1U1LA 2QG9B 2G0CA 2NCKL 1TL3A 1VQMS 4CO1A 4ZJOA 4LF9J 4Q7AA 1VHFA 1HI8A 4RNNA 4LF4J 2VC1A 4HLBA 1RWKB 3CF5Q 2SXLA 1FKAF 2KTQA 2YKQA 2HS4A 2QL5B 2RILA 3V4MA 4DR7F 3TUPA 4B3OB 5J2PB 4B02A 2OGUA 3GG1A 3MR2A 3TX8A 3BQ0A 4O4GA 2LYVA 3D4JA 1VQ6S 1IBCB 1OYEA 3RRGA 2LFVA 2ZBIA 4ED6A 1HNXF 4BCAA 2R8KA 2LXFA 3HJFA 2ZH9A 4BC7A 2HQCA 4WE1A 3L7UA 2C2DA 3IGNA 1S1UA 5B0DA 3M2RA 2AJ0A 3UDEA 4DR2F 5KFEA 1SBRA 2O67A 3AJDA 4DX6A 2V0NA 1KHVA 1DLOA 4DPXA 2OELA 3HK2A 4ZPBA 2OP5A 1U1QA 1FXLA 1T9XA 4YDXA 3JAMU 3C6TA 1NJZA 3VAFA 5HQMA 2R7WA 4CCHA 3MMAB 1D9FA 2AGOA 2BVZA 2AEMA 2A2DA 3CSKA 3RRKA 2QFJA 4UOFA 4OIXA 5DDOC 3D9BA 1B3TA 3I96A 3CJSA 1B0VA 4RW7B 4AE5A 2XI2A 2HNZA 2BANA 1F60B 2CDQA 1WHWA 3PW2A 4O0IA 3QIPA 4RR5A 4K4ZA 2ZHBA 1RAEB 2MQLA 3OW2R 4GO5X 4H4OB 1N34J 3KFWX 3FBEA 1RHMB 4ZCMA 2UP1A 2RT3A 5K14B 3KHLA 1UMJA 5KFKA 3CEDA 3DOMB 1Q81T 3QNWB 3DRRA 2XMTA 4XDCA 2JLEA 4K5RA 3Q22A 4M5DA 4UW2A 4BWJA 4X62F 4HTIA 4J9OA 2MKKA 2L9WA 1CC8A 3EE3A 4PUOA 4NA2A 2FLPA 5CQGA 1WACA 2VPXB 4USUA 3JSRA 3IAS9 2YPYA 1FDDA 1PC5A 1TVRB 1TKXA 2CNOB 2GA7A 1IKXB 3MM9A 3BJYA 4OYOA 3CUNA 4F4ZA 1OJ4A 4EGLA 4LQ9A 2W7PA 5F8LA 2R7SA 3NBPB 2GIRA 1RKJA 2PA8D 1XR7A 1TL5A 2W8KA 3GCXP 4RU2A 2V50A 3HVRA 5FD1A 2YNIA 1YI2S 4LF8J 1NSKL 2YWKA 4DUZF 1S72S 4UT4A 4ZCKA 4ZVGA 4P2MA 4KV8B 1NJWA 3KJVA 3H2UB 1NNDA 3PW4A 3K5NA 4ED5A 1BUXA 5F0UA 3BEGB 3VAIA 3VGSA 5G0RA 2CIMA 3HVAA 2PD1A 2H4WB 3NLCA 5LJ3Y 3G8QA 3F56A 2WB1D 2P9GA 3IRWP 3M2UB 1NPPA 1YJUA 5LMUJ 1Q4RA 2HHHF 4NMXA 3NNCA 2IVYA 2ACYA 1HBUB 2XYGB 2F8EX 2J7WA 4CQ1A 2MLYA 3MEGB 5CH7B 4ECTA 5DGAA 1HARA 4USKA 1SV5A 2YNFA 3ENAA 1RXOB 5HROB 5L39A 2Z0GA 1HL6A 2E5LJ 3HF5A 5DDQC 5F3ZA 3TX0A 3DI6A 3PYGA 1GAOA 1RKIA 2R7VA 3BGLA 3MUMP 1E6VB 4LRAA 5E3CA 2CZ4A 4DLGA 1A0OB 1I5OB 3EM1A 3M32B 2DHXA 4Z7YA 4IDKB 2XYHB 4RW4B 1JLFB 1WEXA 1VMBA 4RWXA 2U2FA 2PO4A 4ZS6A 5BJRA 4WFYA 1G2EA 3AY0A 3TP2A 1XN9A 2JNJA 4K4TA 1M1HA 4QJVA 3ZTPA 4P10A 1T03A 1KRPA 1PJ5A 2XO7A 1X5PA 4KYZA 1WSRA 3SQGB 5IM0A 1LKZA 3VWSA 4WZQA 1FFGB 2M8HA 2Y3YA 2HEKA 4CYUB 3U1LA 4U9RA 3ITHA 3EGVA 8RUCA 2DNMA 5KTQA 3R1HA 2VPYB 2HVZA 5DLGA 3EXCX 3I9V9 1F2HA 2EEYA 3TI0A 3OLAA 2EI5A 2IM0A 3SYZA 3LP1B 1TK5A 1RTDB 1NK0A 1SIWB 4FYWB 3SSRA 1UA0A 4KH1B 3QIDA 3MFHA 2CQ4A 2XLJA 3FJ2A 4K4VA 3J80Y 1P1LA 1CEZA 2LCWA 3BR8A 4NE9C 1J27A 3TW0A 3PZPA 2BQUA 1D1UA 3MCNA 2N82B 2WSFC 5IT9U 4EFAC 4JI1J 3GWCA 3BQ1A 1UEUA 4ZIVA 2UUCF 5D78A 4BBYA 1KHWA 2BKOA 3W9IA 3CJ2A 2DTJA 1RHQB 4C6AA 1TKDA 3LP0A 1NRKA 3TAPA 4TU9A 3DOKB 4M5IA 4RZRA 3ZZPA 2YX4A 5RUBA 4QWBA 2XO6A 1TAUA 3MR6A 3SIPB 4JV1A 2I0XA 3TVKA 2C3PA 2V8PA 1SKSA 4JI4J 3VR1A 4E0DA 2ZUGA 3OBIA 3EDQB 2VG5A 4HVZA 5CAAA 3TJ8A 2CAJA 3T5JA 5CZVA 9ATCB 1XNQJ 2LEAA 1JLQA 3HHLC 4DN0A 1FX4A 2XZDB 1AYEA 2DXDA 3R7NB 4LF4F 4IYQA 2B51A 4DSEA 2WVCA 3IG1B 4ZOSA 2YX7A 5IQ6A 2UUBF 4N8NA 3DDIA 1FTCA 4H4OA 4DI6A 3OHAA 4OJ1A 4DN9A 3PR4A 4NX9A 2MY8A 1QUVA 2JJ4D 2RMLA 2RU9A 3GU0A 1XC9A 1XTZA 1P1TA 2L9NA 1DARA 4OYBA 5KFXA 5DS7A 2FVRA 4HL9A 1S9FA 1CC7A 2OPRB 3KJNB 1RTZA 1D09B 3EMTA 1KOHA 2JVRA 1NK7A 1AA1B 6FD1A 4OX6A 2GVDB 3CJQA 4W90B 5K8OA 3DRSA 1U1MA 3K5MA 3PX6A 3W9JA 1R8AA 1HW9A 3MTKA 1IKXA 5CZXA 4F67A 4DLEA 1FDBA 1ELOA 4O44B 1FESA 4G1PA 4NPOA 2I2YA 2LEBA 2KKHA 1R6VA 3QT5A 1JKHB 4Y2IA 3BKTA 2DR9A 4PPDA 4IG0B 1R0AB 3MEEB 1FRIA 3C66A 3PDNA 2HVEA 2ZFHA 2LA4A 5IZHA 2IRXA 3MZIA 4HDHA 1NH7A 1YBAA 4X4UA 4JI7F 1Y5LB 3S6EA 1HYSB 3FCHA 4AQYF 1SI9A 3W8PA 4J9MA 2LXIA 1DQ9A 3KK1B 1K47A 2V8HA 2NS1B 1RGVA 3Q86A 4U7CA 5K20B 3M2UA 1EETB 3RW7A 3T1HF 2JWNA 4PQUA 5AE1A 1RAGB 2CQ1A 1HBOA 2VV5A 3QGHA 1S57A 2DNHA 4I6YA 1ULRA 4OJHA 5HP1B 3PRBA 5F3TA 4ED0A 4DSKA 4ZK7M 3C14B 2ZWOA 5KG1A 1QAYA 3GV5B 2R4FA 4QOTA 4G1QA 2VL1A 1Y10A 1T02A 2J0WA 2V4QA 1DTQB 4IUFA 1X9WA 2UUWA 4MK7A 1FF2A 3T5HA 3FFIB 1X4DA 3MECB 4WK3A 4XTTA 2IRUA 1UW9A 1ZTTA 3FZ2A 3RU0A 3QLHB 3SQGA 1UVIA 1S6PB 2QMWA 3QRRA 4NMLA 3MOZA 3P8BB 3TRGA 1CJVB 4ED8A 2IBKA 2CPZA 2OMLA 2F4VF 4LUBA 1RZMA 4Y6IA 4X64J 4EYIB 2BW2A 3CDEA 4USMA 1SL1A 3DLHA 1TFYA 1N36J 3TWZA 4O3QA 4PWWA 2R3VA 2BM1A 3LWLA 1KNZA 1VQ9S 2IVMA 1C0UB 2CUYA 3TZZA 5H9EJ 3FEXB 4M63A 2DJWA 2Y8YA 4WP3A 2XEXA 3V2UC 4YY3F 2FVPA 4GVBA 4P9SA 1RTDA 3KWMA 4F7VA 4X65J 4CIOA 3H2LA 5K8NA 5ETTA 1BMQB 2LKZA 4YB1P 4CTAB 5LSOA 1N6QB 1QSYA 4F4XA 2ERRA 4QQBA 1GQEA 2RQKA 1B70B 3KMQA 1SJ1A 1W26A 3H5XA 3HP6A 1FVSA 4ZN3A 3VZIA 5CXTA 3QSYB 3TJ9A 2RRNA 3GE9A 4CH1A 3R5JB 3MM6A 4LBIA 5D4PA 3M2VB 5ITHA 3MMBB 2WOMB 3H5SA 3EVOA 1EHWA 3WZ0A 3PYDA 5A0YA 2RRAA 1NBEB 1LQ9A 3DOKA 1Q82T 1ZH5A 3DNCA 1PGZA 4ECRA 1FXDA 4ZVTB 2B5JA 2DCUB 2IDLA 3MMJA 4K7QA 3CD0A 5DG8A 2BE9B 2W2OP 3TUJC 3GIJA 3SQOP 4P6QA 5B0CA 3M8QB 3H4BA 4M5LA 2IBOA 2DGUA 1JMTA 3MPYA 3BB5A 1RYRA 1U8WA 2VOOA 1FEHA 3MR7A 3QATA 2WAQD 2V34A 4FN5A 1NHUA 2IC3B 2KFNA 2BJEA 4DV0F 1CPZA 2DPJA 2CQCA 2ZBRA 3CDAA 4CP5A 1VRUA 4F2SA 4A8FA 3KLIB 4DR4F 2LQ8A 1IM6A 2YWWA 1RT7A 3WBZA 2HWIA 4ZHRB 5HANA 5DETA 4LF7F 1FEEA 4I69A 3QAUA 3KOAA 4U7UK 2DK2A 5HMZA 2HNYB 3NNHA 4NZ0A 2LQJA 1E6YB 3PM9A 4LIRA 7AT1B 1HBMA 3V6JA 1H98A 1REVA 1LOUA 2AJQA 4USTA 3SXLA 2JVOA 3R5CA 2XMAA 2D41A 5HMXA 4B3MJ 2ZH3A 4NYOA 1T9WA 1UWBA 1JLAB 1RWVB 2VU5A 4GKKJ 4QIFA 1NJIT 3CCJS 5C7PA 4ZVFA 3ZTOA 5L9XA 1JKHA 4DL3A 3Q2SC 1QVFR 4IG0A 3ZZ0A 1R0AA 3CCWA 4XDDA 3I55S 3A3OB 1CVJA 1WI8A 3E8OA 4K50A 3HT3A 4MKVA 3PYFA 5A2QU 1HYSA 3O8WA 4LR7A 4B3TF 5KFCA 2ALZA 2P9EA 3THTA 1O0PA 3OXLA 2M2BA 4USHA 4RO0A 1OY6A 3A1YG 2M3DA 2HPUA 4F26A 1RA7A 2QT7A 2I38A 1WD6A 4CRJA 3BKFA 3MEDA 4DR5F 4TY9A 3JQMA 3OR2B 5ETQA 2VQEJ 4YN3B 3MM7B 5F8GA 1LW2A 2J6SA 5IWAJ 2A10A 3OXFA 3NS5A 1IBLF 3PW7A 2E44A 1TV6B 3AA8A 3KDOA 3DOLB 3TAMB 1ZYQA 3JXOA 1GK8A 2C1EB 4B08A 3J81j 2EXUA 1Q95G 3C14A 2GQCA 2O3DA 1RI7A 3TZYA 5U47A 3QAEA 3DHWC 4WFBQ 3QWUA 1P9QC 2HMIB 4JUZA 2LP4A 4PKDB 2COLA 1GX5A 1BWEA 2B7CB 2YPZA 1Y00A 2Q66A 1X7VA 1S10A 4ZVSB 1HNZJ 2QRRA 5J2MA 3V4IB 4IFVA 3LTOA 1HWJA 1ITPA 1S6PA 4FVMA 2D3ZA 2OSQA 1TP7A 1NK9A 3GSDA 1CJVA 1AXQA 5D4OA 4PYAA 4KPCA 2OLWA 2RJZA 3ZZYA 5EGYA 4J90A 2QA2A 2JC0A 4OZNA 3O3LA 4Y2MA 3IRXA 2WVEA 3J7A1 3UO0A 2QC3A 4F25A 2ZOMA 2HAFA 1SC6A 5JVHQ 1H7WA 4OZJA 4NCAA 3QRQA 2X1AA 3EDRB 2R8GA 4Q43A 2MKIA 5LMNF 2H65B 4LRDA 4FNIA 4LSZB 3KLVA 3GIIA 4HTJA 4I2QB 3D68A 3OJUA 2B4OA 4U95A 4CTAA 1XMBA 3Q8PB 3D0HE 2VDHA 1NPKA 3NCQA 3W9HA 1KLMB 2FLLA 1M5PC 2QX0A 2DKOB 1OQ6A 3BR9A 4Y34A 1L3KA 3L3CA 3DLKA 2G4BA 1MMDA 3FMWA 1UW4A 2UVVA 1NK5A 2LU1A 3LGNA 3M2VA 3M6XA 4A8KA 1UL3A 1B99A 4CLUA 4TN2A 5E3QA 4O3NA 3ULHA 2BW7A 4MFBB 3OT9A 1RTJB 3HZGA 2VODA 4B9LA 3S8SA 4R5PB 4K0KF 4DV6J 3TVYA 4DL6A 2DBBA 1NDCA 3DDKA 4ID5A 3A13A 2ASLA 4URSA 1FHTA 3G8TA 1JLCB 4F0MA 4DPWA 4P2XA 2M4MA 3HLUA 3H4DA 2GIFA 1EB0A 2ZM6J 1SKUB 2HHXA 1X4HA 2EFOA 2F8MA 5DM6Q 2Q6CA 4ED4A 3EUNA 3RB3A 2DNKA 4KGZB 2J0XA 4DR6F 1Q8KA 3OJSA 4URGA 3D6TB 4DL2A 4DR3J 4JI2F 2UXBF 3C16B 3KLIA 4RKUC 2BE7D 1JLEA 2HKEA 4R0JA 4CNYA 2ALYB 1YJ7A 2VG6A 4AYBD 1VI7A 4LVOP 2IA0A 3MD1A 4GKJF 3KUHA 4F3OA 1VCTA 2C2OB 1KVIA 3SCIE 3RUBL 2XHCA 2PI4A 2YNGB 5J2QA 1OY8A 4DQRA 1EQMA 4DQIA 4D3GA 2DH9A 4LBHA 1U1OA 2V6AA 1S6QA 3EICA 3UCGA 4ZLNA 4ZVUB 2W7OA 4OYMA 3CIZA 1R3NA 2VPWB 3I0SB 2D69A 4QW9A 4K5SA 3CW2C 2QLFB 1XNRJ 4ANEA 3UVJB 3RBEA 3UFCX 2QO3A 5MLCV 3CDUA 2H1YA 1UFLA 3MTJA 2NLWA 2IHR1 3W3SA 4DR1F 5CA5A 2HQIA 1WJ9A 1F5CA 4CLWA 3TO8A 4CO0A 1U2FA 1KONA 4DQSA 4DXLA 4ILRA 5DQHA 1SC1B 2MYFA 4K4WA 1BC6A 1YLXA 2RUGA 4FVCA 4NLOA 3CD6S 5C2GA 5CHCB 5DLFA 5HK4A 2VG7A 4GO7X 1RCXB 2Z4PA 2WSEC 3N9UC 3NRBA 5KFFA 5F0WA 5AE3A 3NEKA 3VQSA 2MKHA 2BE2B 1B4SA 2BJ8A 1Q1KA 2E5GA 4DV1F 3OFEA 5KFUA 3K89A 3RW6A 1WF0A 2KG1A 3OR2A 5I3UA 4B9NA 4LFCJ 2J0QD 1D8YA 4PXBA 1VQLS 3AQPA 3UE2A 4JP8A 1H74A 3CJ3A 5B0BA 3OD2A 4LVNP 4AL6A 5E41A 2HNDB 2IAJA 3R2DJ 2ZE2A 2FJDB 4FF4A 1Q53A 5ETOA 5CCMA 1TUGB 2L3MA 4OX9J 1HNWJ 3NGUA 2WCXA 1QY7A 4ZDNA 1Y5IB 1RWUA 3D3CJ 1LWCB 2JEFA 4LF5J 1GXUA 1OS5A 4QCLA 3IXQA 4ES2A 4EBEA 2J9DA 5D0GA 3V4IA 1VQYA 3MGJA 4XPCA 1FFSB 4ANDA 4OFZA 3GIRA 3MOJB 3K58A 5KFGA 1Y5NB 3PACA 2FHKA 3HHLD 2HS3A 1WC4A 2YKAA 1SC3B 4YDDB 2NXEA 1HQUB 2XNRA 2KL8A 2WHOA 3EPGA 2W4DA 3DLGA 2K1RA 3IBCB 3ZZOA 3UCUP 4QR0A 1N5SA 1ZAVA 3W2WA 2DO4A 5KG7A 2KT5A 4KGMA 1S1XB 4UOCA 1DJ0A 2MTLA 5CD4H 3KJFB 4QU6A 1CJKA 1YRTA 1FKPA 4UQTA 4R8UA 2XGQA 3N79A 2NXJA 1ZM9A 2XMUA 1ZA2B 2YY3A 1WKLA 3VV2B 4X4QA 3GG0A 3MPDA 2FGOA 3OPKA 4L75A 2DGWA 1WHYA 1NK4A 3ENQA 4JV0A 5T7LB 4M5KA 1S1WB 2UV8G 2BABA 2MZ1A 4MFBA 2ZVIA 1O6XA 2VICA 4X4NA 2W9AA 4R5PA 2VH7A 3LWMA 3B78A 3MEKA 3PKYA 5H1SV 1Q7YT 1TFWA 4KE5A 1TUVA 2GMLA 2IJNA 1AFIA 4FYVB 1GXLA 2RD5C 2VFSA 4DV7J 4DZDA 1HR0F 1JLCA 1TUWA 4PG6A 5L46A 1FJGJ 2EFQA 2B8QA 4DV4F 5I42B 3THPA 2Y1IA 4PXDA 3AA9A 2CJAA 5I3PA 2GW8A 4DWIA 3FBFA 4NLXA 1X60A 3DGPB 4HHJA 4TY8B 5LOQA 3MUTP 1TQLA 1F3FA 4LSNB 1A7GE 3Q8VA 2DEIA 5BR8F 2V4JB 2DEJA 2V5HG 4ECVA 5F41A 4USWA 1YJNS 3N6NA 5IFMA 3NG8A 2FQQB 2OSRA 3GV7B 1GNKA 1I6JA 2Y8WA 2LXUA 5JMNA 1EIYB 4TQRA 4EI2A 3K17A 2XMWA 1H72C 3DLBA 2RKIB 3ET6A 3Q0AA 4D3HA 2V94A 3EZOA 3DRPA 3KLEA 2CJXB 2FJEB 3LUYA 5EWFA 2A18A 3ZZRA 3FSYA 1NXIA 1UJ5A 3OR1B 3EYZA 4C48A 1FRMA 5KFBA 2Y0SD 3HHKA 5KG0A 2GJIA 1X4EA 2K2PA 3QT6A 5D0HA 3T1AA 1K73T 2FYXA 1U2CA 3SSQA 2F65A 1C2PA 4ES3A 4JI3J 5HN0A 4NCGA 1U0HA 4W98A 3AQOA 3D6MB 1CJUB 2W9BA 1U4BA 1LWEB 1S1TB 4P7VA 2VBZA 3AT1B 1N33F 2EPIA 3G6YA 3POTB 2XHWA 4OI0A 3C46A 3J81U 3E3XA 2NXNA 3S1TA 2YBVA 2EBGA 3C6UB 1V5VA 4USJC 2DGOA 2UXDF 3V6HA 2AP6A 1T05A 1P8GA 3TA0A 4J9SA 1T9YA 3U27A 3OTBA 1VYAA 3PX0A 4EZ9A 2UVUA 1RT6B 4I7FB 2HQDA 1CQMA 1WELA 2AF6A 1S9EA 4RUAA 5THWA 1S6OA 3P3DA 2H51B 1TR0A 1N56A 4NI2B 2FHJA 1HD0A 3X3UA 3ADAC 3LF0A 2XY6A 1N5YB 4ZVOB 1M5HA 2LQBA 2IVFB 4YB6A 1MWYA 1NZAA 2IIHA 3HHEA 4DL7A 4EBCA 2WONA 3DDNA 1N32J 4TLRA 4TU7A 2ZH4A 4NXMF 4I68A 4FYXB 5J1NA 3HCXA 1KWMA 4HACA 3P49B 4PG4A 2GX8A 3NGTA 2YQ1A 2A3JA 2OPQB 1G3OA 3NMAA 3G96A 2DISA 2NXUA 5EX3A 4I4BA 2HS0A 1R8CA 4LIWA 3DXBA 2Y1JA 2EC2A 2HW3A 1SH0A 2ZWPA 2WVBA 2G9OA 2U1AA 1VJWA 2YWEA 1M0SA 5KT3A 2EFGA 2BJDA 1YRXA 1VIXA 5F8MA 4ZLJA 2AX1A 1UAWA 4MT1A 3J7Z5 1QAXA 3O6QA 4WYWA 3MPWA 2K3KA 4DS4A 1CJTB 3CJ0A 1U26A 4RNMA 2XULA 1N4LA 3AHPA 1M1GA 4Q2MA 4FBUA 2FHOB 4F4KA 2MLXA 2OPPA 5E0OA 3ZNJ1 2AJ1A 2MJNA 5A8KB 2OJ3A 1WHXA 2G0IA 4C3MA 3A3NB 4X4RA 3AOAA 4IH6A 2YKNB 1FI4A 2HFZA 3GV8B 2HLTA 1FXRA 4YB5A 2VJVA 3CO0P 1N5QA 3DLEB 5T7LA 4H54A 1S1WA 2F8HA 1EJ7L 1RADB 5CYQB 4DR7J 4B9TA 2FLNA 2WK4A 2B6AB 4ECUA 4F4WA 3HDSA 4LFBF 1RHJB 1VGYA 4RW8B 3UQSA 1RJJA 1B0PA 3BO4A 3CD5A 4KH0B 2LEPA 1HNXJ 3BDPA 1WC5A 3QJJA 4DV2F 4WU3A 5I42A 4UQGA 3M6UA 3KKFA 1O8BA 1WG1A 2MLZA 1GTEA 4DR2J 3BYRA 4Z2XA 3J7ZT 3DGPA 4NZ7A 2CPHA 4NXNF 3ZFVA 4LRCA 1C1CB 2X1BA 2QMXA 3NAIA 3BM7A 1UJ4A 3EJMA 3V81B 2MZRA 3OSNA 2VBXA 3G2XA 3IAM9 1IQZA 4OZ1A 3GLJA 4J9LA 2NYIA 3GFYA 2HRUA 1RWMB 3MMCA 3OUYA 4LF6F 2KDOA 1SQGA 1TL3B 2Z2YB 1MN7A 3IR7B 4TU8A 1YJWS 2GHPA 1SJ4P 2RHSB 2CPIA 1LWFB 2QL9B 5T41A 5JVGQ 2CG4A 4OYPA 5IS2A 3R27A 1LEOA 1JX4A 1H73A 2MSSA 4DPTA 4AXIA 3HO1A 2OTLS 2HFSA 2VA2A 3HHLB 2XWYA 2IJFA 4O4GB 1X5SA 1XMOJ 2MZTA 4LSLB 1JQGA 1SH3A 2CQPA 4O3PA 4F3QA 3UNYA 5A76A 1GT8A 3IC1A 4RBTA 3BSAA 4OHWA 4WE1B 1BQNA 4X62J 3FQLA 3GJQB 4DCOB 4M95A 4IQXA 1CJUA 4KPYA 4CT8A 1QUPA 2M88A 1K44A 3RAMA 3MAHA 1S1TA 1NJYA 1BE4A 3TJAA 3I9ZA 4AL7A 5DQGA 4PXCA 4QPTA 3POTA 1DLOB 3MD3A 3RB0A 2MKSA 2H48B 5KAKA 3RR7A 1LW0B 3C6UA 3I4HX 1NSPA 3LO3A 3C6TB 3PW0A 2EW9A 1HMVA 5A8WA 4NLGA 1QD1A 1TELA 1RTIB 4N56A 4IO9Q 4WBFA 2CPJA 2IFXA 1WDDA 2F1FA 5J2NB 5A2QY 4DUZJ 2OPSA 2W8LA 2BANB 1RT6A 1SIZA 4M5HA 1UJ6A 1K1QA 4B3RF 2VB6A 3BGRA 1S4EA 1X9MA 2AYMA 4OYIA 3M9MB 1RISA 5KFWA 3OTOF 3PXGa 1UFWA 1UFKA 2CKWA 4FPRA 2R42A 3CDWA 2IPOB 4IKAA 2HHHJ 1S76D 3DRRB 2DY1A 1NK6A 4M5DB 1NSAA 2UVRA 4KIAA 4M1KA 4ETXA 3MURP 3HHDA 2WSCC 4G6VB 5CYJA 4PUOB 4XPEA 2AV5A 3ICLA 2DRAA 3FEYB 4OI2A 4KBIA 1N48A 1TAQA 4OYWA 4Q8FA 4OHZA 2RQ4A 2W4CA 2EBEA 2OPQA 2BM0A 4YOEA 3MM9B 3MR5A 3SDEB 3LOUA 2I6WA 4G3IA 3L7PA 1OYDA 1A6LA 4U8VA 3LGHA 2W7AA 1L3VA 1T0TV 4YHHF 2PDAA 1X0PA 2PFFB 1WTFA 3OLBA 1IWAA 4Q8EA 3X1LB 3H59A 3W7BA 3RR8A 3NCRA 2YNIB 4UUWA 1JNZB 2G2OA 4CWBA 3R3TA 4WZMA 1OY9A 2VASA 3Q8RB 4J9UE 3RB6A 2NREA 4ZPWR 4C3LA 3NS6A 5KFJA 7FD1A 1YX2A 3ILIA 1MLAA 2V67A 2ZZNA 3ISZA 1O51A 1CJTA 4KRWA 5B08A 5G0RB 4U7UD 2I5JA 3MI7X 1X8DA 4MIWA 3A12A 3KHHA 2UXCF 3P6YC 5ETNA 4J9RA 1DTTA 2KRBA 5GADU 1Y11A 1T7PA 2AWZA 5B0EA 3TA1A 4DX5A 2GVZB 4RNHA 2HRTA 4KJIA 3DLEA 1PYSB 1HHTP 4LRBA 3T41A 1SV5B 1APSA 2XMVA 1RT4B 3NOGA 3PO4A 4YR2A 3MAQA 2BQ3A 3DI6B 5C24A 3BO3A 4Q45A 1ZAXA 2XZTB 3A8EA 5B09A 2B6AA 3VF0B 4K2JA 2RHQB 4URQU 4QYZK 4RW8A 4MIBA 3NGDA 5KFLA 2QLBB 4LFAF 3V5RA 1IXKA 1S4FA 4FS1A 1B7FA 2UUCJ 2WW8A 4A8SA 3M8SA 4DV3F 3K0JA 2EK6A 2Z57B 1TL1B 2YWHA 1H38A 2Z2LA 3IGVA 3I4PA 3NY0A 1ZZNA 2Q79A 3GONA 1LFPA 4CM0A 2UUTA 2XBPA 2VPZB 3HKWA 1F6TA 4NRTA 2DVIA 4B9UA 2X51A 4ZCLA 2OO4A 3GIKA 1MSWD 3P45B 2X1FA 5ADZA 1K0TA 3G6ES 3TOQA 3CCQS 1HI0P 1NK8A 5KG5A 3T1YF 2FZCB 1S1VA 3ITHB 4N5SA 2KT2A 4DF4A 5HVHA 3HSDA 3BF4A 2XGPA 3BKUA 4K4UA 4I6WA 2OD4A 3W60A 2QIFA 4C7QA 2CFXA 5ETSA 1PBUA 2DNZA 4X4TA 1YBTA 3TZXA 1LWFA 2ZD1B 4C9DA 1TMMA 3DKDA 4ECYA 2KYXA 3GPAA 3BV8A 3MM5A 2UUBJ 1WTBA 1Q0NA 3SV3A 3HHLA 5LT5A 3CCZA 5J1PA 1Q5VA 3BSOA 4DX8H 4LSLA 2B4UA 3PFOA 2KXFA 1IKYA 1YQHA 2QA1A 4M5GA 3IO1A 4IR1A 2W4PA 2ZITA 4NLQA 4PWDA 5DZ6A 5GAHU 2MQMA 1YJVA 3R9LA 2D74B 2GAHC 3BBFA 1PILA 4ZVRB 1G4CA 1XJWB 1U7LA 3GYGA 3LP0B 1N54B 1DZ5A 4OZLA 4X4PA 4MH8A 4O3OA 2DGXA 4HT7A 2RRBA 3BH6B 3H42A 3I0RA 1U1NA 5B0GA 2IMWP 3D2WA 3OQ2A 3C15A 4MIAA 3KG0A 1LW0A 2QTWA 3DRYA 4RUCA 2AJFE 4UY85 2H5IB 1MU2A 3FBCA 5B0FA 2V68A 4EUVA 3I5CA 1RTIA 2KM8B 2VG5B 5M2PA 4H4KC 5J2NA 3MF5A 1JLQB 4DFPA 5KG2A 3MPUB 4JI7J 2QJ3A 3CXCR 5J1EA 3DM2A 1M5KC 1MMLA 4AQYJ 5GVQA 1VLOA 1NU4A 5H9FJ 3CJRA 3R5GA 4YB7A 2IY5B 4CLZA 2L48A 1XMOF 2MPUA 4RLEA 2BKPA 2B7BB 3Q8UA 3O44A 4B9VA 3HX9A 1MWQA 2AJ2A 4I0WA 1WF1A 3SMZA 2GHWA 1PAUB 1QJHA 5HQ8A 3T1HJ 2ILYA 4FPIA 5LM7E 3Q24A 3CJ4A 1T94A 2ZNYA 2UUAF 1VFJA 5L9NA 1X4FA 5AT1B 1WHVA 3J80U 3DRSB 4WXOA 5E5NA 3PHTA 3SZ2A 2BYCA
chains in the Genus database with same CATH topology
1RU2A 5ETKA 3MCMA 4PZVA 4CWBA 3HD2A 1RU1A 4AD6A 5ETRA 1HKAA 5ETQA 4M5KA 1EQMA 1RAOA 1HQ2A 3HD1A 3HCXA 3ILJA 5ETSA 3HT0A 3MCNA 1KBRA 3ILOA 5ETMA 2F65A 3UD5A 1IM6A 3HSDA 1TMMA 1G4CA 5ETOA 4M5LA 3KUGA 5ETPA 4F7VA 2QX0A 3ILIA 5ETNA 3HSJA 3UDEA 1RB0A 4M5HA 4CYUA 4M5GA 4M5MA 3MCOA 3ILLA 5ETLA 1EX8A 3KUHA 3IP0A 3QBCA 5ETVA 3KUEA 5ETTA 3HSGA 4M5IA 4M5JA 1DY3A 3UDVA 2BMBA 1Q0NA 2F63A 4CRJA 4CYUB 1EQ0A 1CBKA 1TMJA 3HSZA 1RTZA 2CG8A 4M5NA 1F9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU2 A;  5ETK A;  3MCM A;  4PZV A;  4CWB A;  3HD2 A;  1RU1 A;  4AD6 A;  5ETR A;  1HKA A;  5ETQ A;  4M5K A;  1EQM A;  1RAO A;  1HQ2 A;  3HD1 A;  3HCX A;  3ILJ A;  5ETS A;  3HT0 A;  3MCN A;  1KBR A;  3ILO A;  5ETM A;  2F65 A;  3UD5 A;  1IM6 A;  3HSD A;  1TMM A;  1G4C A;  5ETO A;  4M5L A;  3KUG A;  5ETP A;  4F7V A;  2QX0 A;  3ILI A;  5ETN A;  3HSJ A;  3UDE A;  1RB0 A;  4M5H A;  4CYU A;  4M5G A;  4M5M A;  3MCO A;  3ILL A;  5ETL A;  1EX8 A;  3KUH A;  3IP0 A;  3QBC A;  5ETV A;  3KUE A;  5ETT A;  3HSG A;  4M5I A;  4M5J A;  1DY3 A;  3UDV A;  2BMB A;  1Q0N A;  2F63 A;  4CRJ A;  4CYU B;  1EQ0 A;  1CBK A;  1TMJ A;  3HSZ A;  1RTZ A;  2CG8 A;  4M5N A;  1F9H A; 
#chains in the Genus database with same CATH topology
 3G8S A;  4IO1 A;  1Y3J A;  3SDE A;  5KFV A;  1J5E F;  2OEM A;  4UY8 T;  4JI8 F;  1X4G A;  3UN5 A;  1QE1 A;  2DHH A;  4CO4 A;  4CT9 A;  4NLT A;  2DD8 S;  4B9S A;  2AT1 B;  5F8H A;  3CMA S;  2XZW A;  1YWX A;  4LRF A;  3CCR S;  2BUN A;  2N4C A;  2CQ2 A;  3HJV A;  2HLU A;  3F41 A;  2XCP A;  4UUX A;  2R8I A;  1QAI A;  3FQK A;  4ID8 A;  1NJX A;  2R2S A;  4V1A k;  1PSD A;  3NXZ A;  2GGP A;  1WOS A;  2HK3 A;  2MKC A;  2CVI A;  1VHI A;  2B4P A;  2F4V J;  2YH0 A;  2POK A;  1HA1 A;  3BZQ A;  3M8P A;  4QYR A;  1RAA B;  1V3S A;  3KK2 A;  2H54 B;  3MM8 A;  1S0O A;  4LBP A;  1WF2 A;  3UD5 A;  3GFZ A;  5EN1 A;  4PQU B;  2XQC A;  2GVZ A;  4YY3 J;  4PCQ A;  1FK9 B;  1OPI A;  4PAB A;  1HBO B;  2RDI A;  1NHK L;  3F73 A;  3HFV A;  2MGZ B;  2BV3 A;  1SJR A;  3KLH A;  2G2Y A;  3W2V B;  1RT4 A;  3Q23 A;  2ROG A;  1ZA1 B;  1FDA A;  1SQF A;  1L3T A;  3ZTR A;  2HHQ A;  3W62 A;  1FRJ A;  1WSV A;  3IWX A;  4G1Q B;  3G71 S;  2XSF A;  3QPI A;  1HI1 A;  1PBA A;  3KK3 A;  4I67 A;  3R97 A;  3H5U A;  2OD6 A;  5C25 B;  3EGW B;  3I32 A;  2WTF A;  1RT1 A;  1CQN A;  2FY1 A;  1TL1 A;  4FP9 A;  3D28 A;  3M9N B;  2CZ9 A;  4K8R A;  4P73 A;  2VQF F;  3NGR A;  4WP8 A;  3OV7 A;  3GB0 A;  4ZPD A;  2C2R A;  2AEF A;  4QU7 A;  3BGU A;  2YWG A;  3FBB A;  1QSS A;  3CE8 A;  4OLP A;  1KLN A;  4ZVQ B;  2LLZ A;  4DUY F;  2AQ4 A;  2WW4 A;  3HMJ G;  5KFP A;  4HH1 A;  2K3I A;  3CT9 A;  2AZ3 A;  3OFF A;  3IM8 A;  3FRZ A;  3PYE A;  3SBM A;  4UF4 A;  3EXY A;  1G6B A;  1YTY A;  5DZ7 A;  4MK9 A;  4B3S F;  5KG4 A;  1EKS A;  4CLL A;  4GVB B;  4XAK A;  4P52 A;  4DV0 J;  3ETM A;  1XER A;  1FRX A;  2ZD1 A;  2E1A A;  3OHB A;  2Y0B B;  2G0J A;  1KEK A;  2LEC A;  1F2G A;  2H3E B;  1TL7 A;  4FXW A;  3R5B A;  3ELH A;  4DR4 J;  4I1T A;  4MK8 A;  3A8K A;  1PJ7 A;  2BOA A;  3TAQ A;  4DPO A;  4K4Y A;  2AGQ A;  4PXE A;  4RU9 A;  3AOB A;  2J6U A;  2P2C B;  4LF7 J;  4RNO A;  4RX6 A;  1MRO A;  2OFH X;  3MM6 B;  3DLL Q;  4O3S A;  5ETK A;  2NPF A;  3JTO A;  2ZJQ Q;  2HQG A;  1FD8 A;  2A6M A;  1DHM A;  2QGF B;  4OHX A;  5L8R C;  5KFA A;  2R7Q A;  1TKZ A;  5A0Y B;  1Y9O A;  1DAX A;  1JLG A;  1FWK A;  5AJ3 F;  2KXH A;  4V19 X;  2DGQ A;  1Y4Z B;  1FVQ A;  2YKO A;  4EO8 A;  2DNQ A;  2K8G A;  4YME A;  2MZJ A;  3C2P A;  4AL5 A;  2BRK A;  1FT8 A;  2B5J B;  1PJ6 A;  2FDN A;  3US5 A;  1FA0 A;  4RW6 A;  3EVM A;  2IM2 A;  2LU2 A;  3CUL A;  5A8R A;  3VGV A;  3JTP A;  3E01 A;  4NZ6 A;  2RS8 A;  4KHP F;  3UD4 P;  4ZLP A;  4PEO A;  3HT0 A;  2MEW A;  1ZZF A;  1FJE B;  4C11 A;  4P2F A;  1KTV A;  1UVN A;  5C5J A;  5D3G A;  3C19 A;  2G13 A;  4L73 A;  4B3T J;  4X66 F;  1VRU B;  1QVG R;  1GH8 A;  1JXE A;  2YNH A;  2H5E A;  1NB7 A;  1RT7 B;  3QO9 B;  4C8N A;  8ATC B;  1T9V A;  1K1S A;  2C3O A;  2CPX A;  4X4O A;  2DRD A;  5F8N A;  3LQV A;  3W5Y A;  5DG9 A;  4DR5 J;  1M90 T;  3WX8 A;  1P6T A;  1TK0 A;  3M6W A;  3HSJ A;  3U1N A;  1WEZ A;  4KKO B;  4DCP B;  1IBL J;  4P74 A;  2VON A;  2MB0 B;  5K9F A;  3P5T L;  1HBM B;  2RH3 A;  3IWN C;  2ZBP A;  1FJ7 A;  4IRK A;  1REV B;  4KC5 A;  2XMM A;  2D7S A;  1XK8 A;  3OL9 A;  1FNO A;  2PII A;  2A2C A;  1PAE X;  2QYG A;  1UWB B;  2W9C A;  1D9A A;  3D3B J;  2BKN A;  2VHG A;  2KFY A;  3AXK A;  5BYR A;  1ZPV A;  4YP3 A;  2KYZ A;  2M52 A;  2VDI A;  3VVU A;  4ETZ A;  3R5D A;  5EUH A;  2NZ4 A;  5HSP A;  3FCW A;  1RLD A;  1S77 D;  1HPZ A;  4NWB A;  1LXN A;  5E33 A;  2BR0 A;  2RB7 A;  1HQ2 A;  4WTY A;  2CVE A;  5FII A;  4HEA 9;  1SUQ A;  1TU0 B;  3ILL A;  2GAG C;  2ZH8 A;  1G7C B;  2NUH A;  2GC8 A;  4WXW A;  1VQ5 S;  4DL5 A;  4DEZ A;  4L72 B;  3AH6 A;  5L1I A;  4JI6 F;  3QBC A;  4HI2 A;  1U24 A;  2D3O 1;  2C28 A;  4Y2A A;  1U0S A;  2HZA A;  3GMG A;  3MED B;  3MHY A;  3BN4 A;  4YEA A;  5LMN J;  4OLO A;  1LW2 B;  2C22 A;  1FK9 A;  2VF3 A;  2R7X A;  3PNI A;  2MGZ A;  2HQ3 A;  4PG7 A;  1IVZ A;  2PT0 A;  3W2V A;  2XS2 A;  2OUG A;  3LW5 C;  4A8M P;  1VQO S;  3BGO P;  1CUL A;  2FZG B;  3EVW A;  2W2P P;  3D0I E;  4UZC A;  1S48 A;  5HMW A;  2DO0 A;  4CO2 A;  2VFU A;  4ECW A;  4FNH A;  3G82 A;  2B4V A;  1DQ8 A;  2CNK B;  5I3Q A;  1L3S A;  3K5O A;  5JUM A;  4GVL A;  3O1L A;  3JYT A;  4HT5 A;  1T8E A;  2IMO A;  3SFG A;  1VRT B;  3J7A N;  3D66 A;  5C25 A;  3RZA A;  1SPB P;  3T6B A;  3UN3 A;  3D7S B;  2FUG 9;  3DFE A;  2XSJ A;  2J6T A;  5J2M B;  4IFV B;  4K0K J;  3KLF A;  4C3K A;  2EFP A;  4QW8 A;  4LQ3 A;  2FJA B;  4JBC A;  2V2Q A;  3FDS A;  4J9P A;  3JSM A;  1FO1 A;  1OIA A;  3GQC A;  1RDR A;  3HD2 A;  2RQM A;  3HVT A;  1SQE A;  2LQ9 A;  2HYI B;  1D8Z A;  1N0V C;  4F2R A;  4HI1 A;  3JS9 A;  1X0F A;  4NA1 A;  4KSE B;  3IRX B;  2XYP B;  1JXL A;  3SI8 A;  5M2U A;  4ICL A;  4OI3 A;  2HZV A;  4E98 A;  3E51 A;  2QSF A;  3KDN A;  2B9Y A;  1XMQ F;  2EFV A;  5FDL A;  4O23 A;  2H4Y B;  4DJB A;  4ENO A;  4R0E A;  4ED2 A;  1Q79 A;  4DR6 J;  3HHN B;  1VLY A;  1UZD A;  4NLR A;  4G1I A;  2JLF A;  4EBD A;  3KMS A;  2AYG A;  1N0U A;  4JI2 J;  2UXB J;  5KFN A;  2VKZ G;  2P5V A;  2E5J A;  3CB4 A;  3NWG A;  2ASD A;  3WIU A;  4JV5 F;  4DSF A;  3OTC A;  2PC6 A;  1FFW B;  1UPP A;  4GKJ J;  2XCA A;  3PVX A;  1CS4 B;  3DLK B;  2DNN A;  4C0H A;  1UEK A;  4UOG A;  5HI7 A;  1OPZ A;  3FZB A;  3KUE A;  4IR9 A;  2IYI A;  1D3W A;  1NO8 A;  3UWT A;  1QTM A;  5F8J A;  5GAD I;  3VAJ A;  3OFH A;  4Q0B A;  3CPW R;  2J7K A;  3H5Y A;  2ZDO A;  1IN0 A;  1JJ4 A;  1U1P A;  4CNZ A;  5E2Q A;  2HSE B;  3CD7 A;  3W61 A;  2I9S A;  2ZZT A;  2NQP A;  4ID5 B;  2W2M P;  2ACM A;  4CM2 A;  1AB8 A;  1DRZ A;  4BC9 A;  5HVF A;  4NRU A;  1QTN B;  2ZHA A;  2FHJ D;  4DR1 J;  3FSX A;  3GJR B;  2DH8 A;  1UCN A;  1SKR A;  2HHV A;  1GMW D;  5EX0 A;  4ALZ A;  4LMZ A;  2AX0 A;  3GIM A;  5KFO A;  4ERD A;  1W2B R;  3HSZ A;  2CJQ A;  1L3U A;  2DIT A;  4IRD A;  4WK1 A;  3VAK A;  1JLE B;  3VHQ A;  3PRV A;  4JOU A;  1P27 B;  1RTH A;  3QO9 A;  2C2E A;  2VG6 B;  4J37 A;  3HFZ B;  5H9E K;  1N5V A;  2AEJ A;  2DHA A;  3UDV A;  3D54 A;  4DV1 J;  2DPI A;  3KXD A;  3DU5 A;  2DRB A;  2E7X A;  5HLF B;  4P7T A;  5J2Q B;  4JI0 F;  4C8Z A;  3R6G B;  3N6M A;  4KKO A;  3RB4 A;  1WC3 A;  2CWX A;  5KFD A;  1KSP A;  1S6Q B;  2YQ0 A;  3MAA A;  1URR A;  1NKB A;  3VTI A;  4C8L A;  5IV3 A;  1FDN A;  1WC6 A;  1RWW B;  4MYT A;  2B8P A;  4ZP9 A;  4F0H A;  2R8H A;  2JHE A;  3NP5 A;  5D8H B;  5C42 A;  4CLY A;  3P5B P;  3I31 A;  3W66 A;  2V8V A;  4ZA1 A;  2R2U A;  5HAO A;  2HHT A;  3IM9 A;  4QR1 A;  2JLG A;  4IG3 A;  1R89 A;  2E1C A;  2N7C A;  1VR6 A;  1H3D A;  3K7R A;  1S12 A;  2MQP A;  4ER8 A;  3M6V A;  1PYO B;  1X4A A;  1HD1 A;  1ARO P;  5GAH I;  1O5J A;  4NCB A;  2B9W A;  2YX1 A;  4NEZ A;  1RAC B;  3PO5 A;  2VG7 B;  1HNV A;  2X3D A;  2QA4 G;  1KDN A;  4OZ2 A;  2VIH A;  1S7H A;  4ATN A;  1C1B A;  1V3Z A;  2DNL A;  4FYY B;  2MQO A;  5D4L A;  5K8M A;  4CLF A;  3ZZU A;  1OSC A;  4EWT A;  4Z37 A;  4U6P A;  1RT3 A;  1Z1Z A;  1Z2L A;  3H2V E;  1AW0 A;  5I3U B;  1FKO A;  2V9W A;  1N88 A;  4RNF A;  4AFF A;  2HVH A;  1R6Y A;  3FUY A;  4RWW A;  1YIJ S;  3DU6 A;  1YK9 A;  4LJM A;  4TYB A;  2UVW A;  1J5O A;  4WU2 A;  1U09 A;  2BJ1 A;  2HHW A;  2R2T A;  1C0T A;  5ETM A;  3PIO Q;  2IAJ B;  2ZE2 B;  4HR2 A;  5ETL A;  4RBU A;  4O0N A;  3FK4 A;  4Y28 C;  2EKN A;  1VRT A;  1ZOT A;  2FJX A;  4HKQ A;  4EK2 A;  1VK8 A;  2E5H A;  4S0M A;  2CPE A;  5CAB A;  3EZ5 A;  4ECX A;  2MQN A;  3AB2 B;  5CCL A;  2JSX A;  1FNM A;  1IBK F;  2IA6 A;  4NA3 A;  2FVQ A;  5HL7 Q;  3IS9 A;  1B0T A;  4NLP A;  3PFE A;  2HFN A;  2UU9 F;  1PG5 B;  2W2Q P;  1B64 A;  2IM1 A;  4TYA A;  3RBX A;  3LAN A;  1HR0 J;  4IFY A;  5B0A A;  3SCL E;  2NXC A;  4ZJL A;  3G4S S;  4DV4 J;  5KT5 A;  1GMV A;  1U48 A;  3OVA A;  1HBN B;  2XMK A;  3DMJ B;  2FHM A;  4QBU A;  3Q83 A;  2N3L A;  4FDF A;  4U67 Q;  3DLG B;  4M5N A;  3ISN C;  2K1R B;  3R8Y A;  2RDJ A;  5DG7 A;  3IR6 B;  3KLG A;  2AZ1 A;  1I94 F;  3W2W B;  2RNE A;  2YH1 A;  1IBM F;  5ETP A;  1PIE A;  1RWP B;  1EX8 A;  5BR8 J;  3CJK B;  3I5B A;  3A8J A;  1OQ3 A;  2FTR A;  3FRY A;  4WPA A;  1CJK B;  2YVS A;  3T9N A;  1FKP B;  7FDR A;  1KQS R;  1FRK A;  4DSI A;  4R8U B;  3DLJ A;  2DH7 A;  1FX2 A;  2AD9 A;  1DBD A;  3M8Z A;  2CXE A;  4A8O A;  5D0E A;  1CS4 A;  1GEH A;  1S7I A;  1NLK L;  2F5G A;  3N0V A;  4ELV A;  1RT5 A;  4IQM A;  2QMU B;  2J9E A;  3BDE A;  1RB0 A;  2J8A A;  5DM7 Q;  2YTC A;  3D67 A;  3UI3 A;  3DCA A;  2RF2 A;  1PKU A;  1VQ4 S;  1BHN A;  2JDJ A;  5DQI A;  2VD3 A;  2FJB B;  1HFE L;  3THV A;  3RBZ A;  4OV6 A;  2Q43 A;  4OX8 A;  4C8K A;  4J9V A;  3JSY A;  1RE1 B;  4OI1 A;  1V9O A;  2FY8 A;  3Q8Y A;  2OAU A;  4X4S A;  2N7Y A;  2IJR A;  4ZP7 A;  4ZVP B;  3ZO7 A;  1GX6 A;  2FIU A;  5D6G A;  2GIQ A;  2IYG A;  2KHD A;  4DV5 F;  2R7R A;  4ZIW A;  5GAE U;  3JB9 k;  1N33 J;  3WX4 A;  2Y1R I;  2FC8 A;  5GMD A;  3W63 A;  3WC0 A;  3QJP A;  2NYH A;  1ROF A;  3JAM Y;  1OMS A;  4NAS A;  4I6A A;  3ENW A;  4JI5 F;  3GFH A;  2UXD J;  1VDH A;  5LSL A;  3BBC A;  3MPV A;  2DGV A;  2J5A A;  1IR1 A;  3H8Y A;  3BGF A;  4P71 A;  1NKE A;  2B9E A;  2CJK A;  5HAT A;  5HLF A;  4CH0 S;  5D4N A;  3ET6 B;  1FCA A;  1HWI A;  3Q8Q B;  1WG4 A;  3M4X A;  3DRP B;  3UPF A;  2XMJ A;  5KFT A;  4NLS A;  3GR0 A;  3KLE B;  4KY3 A;  2XC9 A;  3KG4 A;  5F9L A;  1K8A T;  3DC2 A;  1ZTW A;  4QIE A;  1CSJ A;  3PJW A;  4Y00 A;  2CJB A;  4AUK A;  3CCE S;  4M5M A;  3OSP A;  2A1B A;  1UVK A;  4O3R A;  3K8W A;  4NEY A;  4NCG B;  2AIR B;  3T3F A;  1U0H B;  3CMQ A;  3I82 A;  1SC4 B;  1N52 B;  2W9B B;  3AOD A;  3BO2 A;  4NXM J;  1RHR B;  3FC9 A;  2B56 A;  4PG5 A;  4B3O A;  1NDL A;  2P9C A;  5J2P A;  1KR4 A;  4WTO B;  5A6P A;  2DNP A;  2KU7 A;  2BAC A;  2ZKT A;  2C2K B;  4F36 A;  3F44 A;  2PMZ D;  2ATL A;  5AXL A;  1WG5 A;  2OKQ A;  3CCT A;  1VQN S;  1RUS A;  3VAG A;  4MAK A;  2V4R A;  4MKY A;  3JSB A;  1YGY A;  1T05 B;  5K8P A;  3QSI A;  6AT1 B;  5HBM B;  5AXN A;  2ADC A;  4BWM A;  3JTN A;  2CQ3 A;  2KHC A;  4FKX A;  4PQA A;  4DCJ B;  3CC7 S;  2D9P A;  4U8Y A;  2JH3 A;  4B17 A;  3BPS P;  3M9O B;  3VGU A;  4WJB A;  2DCL A;  2O66 A;  4F8R A;  2HWT A;  2M0G B;  4A46 A;  2RIJ A;  1S9E B;  4YUD A;  1V5I B;  2DYA A;  5G4D A;  4FKY A;  3CC2 S;  1I3O B;  2DXE A;  4TKT A;  5KT7 A;  3MMA A;  2XY7 A;  4DG1 B;  1MMN A;  2MHN A;  4ED1 A;  5KFR A;  4LF9 F;  1FRL A;  4CZC A;  1M5O C;  2EC0 A;  3QQC D;  3FMB A;  1MNE A;  4RW7 A;  2UZA A;  1UET A;  2GO8 A;  3MUV P;  2J7U A;  4OYA A;  4CI0 B;  2RU3 A;  3B6B A;  5LJ5 Y;  2V8G A;  2MZS A;  2WON B;  2DT9 A;  2LQ5 A;  3L95 X;  1U1K A;  2APO A;  4IH5 A;  4HAC B;  3WDO A;  2JEI A;  1VC0 A;  5HO4 A;  1NKC A;  2CDR B;  2LVW A;  1R27 B;  2CNL B;  2CPD A;  5K14 A;  3GJT B;  3CME S;  2R7O A;  4Y2K A;  2J76 E;  3DOM A;  4LFB J;  3ZXW A;  1EAR A;  1PC4 A;  3HXM A;  4W92 B;  3V6K A;  3KG1 A;  1U6F A;  4DV2 J;  3BBB A;  4CDI A;  1HBN A;  4QWD A;  4M8L A;  3DMJ A;  3VAH A;  1VBY A;  4CH7 A;  5DRK A;  2HFU A;  2G2Z A;  3E2E A;  2KG0 A;  4L3N A;  3KHR A;  1P9Y A;  1NDK A;  4NXN J;  1DY3 A;  1TVR A;  8AT1 B;  4DU8 A;  2RQC A;  2IM3 A;  1TK8 A;  2E7V A;  1GFW B;  1EAY C;  1TL4 A;  1MW7 A;  2GFF A;  5KFQ A;  3CJK A;  2C42 A;  3NBP A;  5K5M A;  2CQD A;  4CO5 A;  3A3P B;  3K8V A;  2DNG A;  4A8Q A;  4FS2 A;  2OPP B;  1RWO B;  4C97 A;  4LF6 J;  2EG2 A;  3CTR A;  4BHQ A;  3HD1 A;  2C2N A;  3HKZ D;  3TUZ C;  4KB7 A;  3UD3 P;  4C8O A;  3C3L A;  3M05 A;  3PTW A;  2MKY A;  4ZJQ A;  1OO0 B;  4WFN Q;  4KV8 A;  2PSZ A;  3VQT A;  2HK2 A;  2C3U A;  1FWP A;  1R43 A;  3CIM A;  3HZE A;  4N7T A;  5L38 A;  4F4Y A;  1VBK A;  4JB8 B;  1NB2 A;  4WFX A;  2JL9 A;  1YZ7 A;  1R31 A;  1AUD A;  4J91 A;  5AXM A;  1YJR A;  4KAI A;  2EWH A;  1N34 F;  1WC1 A;  5IT9 Y;  1V6H A;  4WCE Q;  2R7U A;  3EZU A;  4IOA Q;  2DIU A;  3DGV A;  1F0X A;  4KHR A;  3BH7 B;  1T3O A;  3H7H B;  9RUB A;  1HBU A;  2WB4 A;  5C2C A;  4UZB A;  1SL0 A;  2Q3P A;  4ELT A;  3MEG A;  1S6U A;  4FF3 A;  1F9E B;  2V2V A;  4KT0 C;  5EWE A;  5HRO A;  4WYL A;  3N28 A;  1WKK A;  2A0F B;  3J7Y U;  5AE2 A;  2M7S A;  2H9Z A;  2KVQ E;  3GIL A;  3AFG A;  3D0G E;  1E6V A;  4C4W A;  2D1C A;  1HNI B;  3WQP A;  1ZAW A;  2DNR A;  2QL7 B;  3M32 A;  4IDK A;  4RW4 A;  1ZET A;  1JLF A;  3MMC B;  3H98 A;  4OL8 A;  1NUE A;  3VZH A;  3OUY B;  2ZH6 A;  1LNQ A;  3H20 A;  4NLU A;  2FVS A;  2C2Z B;  1I51 B;  5FJ4 A;  3T19 A;  4LF8 F;  1RAI B;  3FEZ A;  2HHU A;  3SFU A;  3K59 A;  2V2Z A;  5AXK A;  3R7B B;  3BQ2 A;  2MZQ A;  4NLD A;  5IOL A;  2DGS A;  1BQM B;  4LF2 A;  5CD4 A;  2MDA A;  2DNY A;  3LH2 S;  5MAO A;  3CCU S;  2BRL A;  3VAL A;  1Y3K A;  3DYA B;  3B82 A;  3LAK A;  4B3R J;  4TLQ A;  1RK8 A;  2P8I A;  4CYU A;  4NOH A;  2ZJP Q;  1X4C A;  4Y65 A;  5EWG A;  3OTO J;  3VAM A;  5LMU F;  5B7W A;  2JRS A;  5KFI A;  4G65 A;  3OTD A;  3R1L A;  1FTR A;  1J2V A;  3UR0 A;  4C8Y A;  3LAM A;  3LP1 A;  2HIQ A;  1U25 A;  1VC6 A;  1BQN B;  4ZCI A;  4DPU A;  1U02 A;  4N41 A;  2F4F A;  3CGI A;  2KH9 A;  2GQQ A;  2E5L F;  1T9T A;  4QPX A;  2D3U A;  1K9M T;  1RA6 A;  4TVA B;  3DXS X;  3UW1 A;  1XWL A;  3OXG A;  3LP2 B;  3H40 A;  4P2S A;  5JJB A;  2E9T A;  1S0N A;  1JJH A;  3EGZ A;  1H7X A;  2GS8 A;  3EWG A;  1HHS A;  3N4W A;  2Q1L A;  2CPY A;  1KC8 T;  2VFR A;  2GZO A;  1RLC L;  4YHH J;  2RUS A;  2ZNZ A;  1HMV B;  2I1R A;  2XY5 A;  3AJ2 A;  3ZZZ A;  5A8W B;  3C8Y A;  2IRY A;  1RHK B;  5HBM A;  2VJU A;  3K2Y A;  2C3Y A;  4Y0F A;  4ANC A;  1LWX A;  2UV8 A;  2OPS B;  1TKT B;  3R7S B;  1YJT A;  2CJ9 A;  3PEH A;  4KHM A;  2B9X A;  1CBK A;  2CQ0 A;  3G6X A;  3HUL A;  3NKY A;  3BGR B;  4ECS A;  3PRD A;  2B3T B;  4FYD A;  2UXC J;  2F9D A;  4DG1 A;  4MKB A;  1GMW A;  2N4D A;  2QEX S;  1YG0 A;  3GFX A;  2KFZ A;  2J9D E;  2E5I A;  3ETO A;  3IG1 A;  3UDC A;  2W24 A;  4DMZ A;  1IR0 A;  3KUG A;  4EMD A;  3ENV A;  2JC1 A;  5KG6 A;  2OFG X;  3QFH A;  1NHV A;  4Q5V A;  4JI1 F;  3CDB A;  1KVJ A;  3MCM A;  1N5T A;  1Q8L A;  2LDY A;  4LFA J;  2KRR A;  4ZIT A;  2GJF A;  2OPR A;  1H0H B;  1SKW A;  4NYZ A;  3AD8 C;  2K7K A;  3IR5 B;  4BDP A;  3OFG A;  4USV A;  3K57 A;  4QR2 A;  1ACM B;  2X1G A;  4DV3 J;  4MYU A;  1F5B A;  3HPO A;  3QZ7 A;  2GVD A;  1KD1 T;  4HDG A;  4A8Y A;  3TAR A;  2AMC B;  2Y1L B;  4X2B A;  2YWF A;  4DDF A;  5LXY A;  1RP5 A;  4O44 A;  3LAL A;  2PE8 A;  2KM8 C;  2G1H A;  2XB2 D;  4ZKA A;  1Q78 A;  2CPF A;  2VBY A;  1BWV A;  3QT7 A;  1NH8 A;  2O1P A;  2XLI A;  4JI4 F;  3PEJ A;  2I5J B;  3T1Y J;  3MEE A;  2R2R A;  1DTT B;  3FGV A;  2XS7 A;  1WOO A;  2AKW B;  4HYK A;  4CLS A;  2X7I A;  1JIH A;  1XNQ F;  1F9F A;  4QIW D;  4Y2C A;  2OTJ S;  2ZKU A;  3A4T A;  3L9Z A;  1K0V A;  2OHD A;  4LR9 A;  2ZH5 A;  1RAJ A;  4J7C A;  2BJ3 A;  1TZ0 A;  1RSC A;  1NM2 A;  2FVC A;  1EP4 B;  1VC5 A;  1Q16 B;  3KK1 A;  3Q2T C;  2WVD A;  5C24 B;  2KJV A;  2RE1 A;  1VQK S;  2GMH A;  1YIT S;  2ZDP A;  3KYL A;  1JK9 B;  4F04 B;  5E3A A;  5CYM B;  5DO2 A;  1EET A;  1YKW A;  2M8D B;  4LT6 A;  2VUG A;  2VBW A;  3CO9 A;  4DFJ A;  4WWS A;  1VQ7 S;  5FLX U;  1KTQ A;  5LXR A;  4NL5 A;  4EEY A;  2EK1 A;  1UKU A;  5HP1 A;  1PYT A;  2HGN A;  2ROP A;  4YFU A;  3RAX A;  4AD6 A;  2NSB A;  4CLK A;  1U1R A;  2XM3 A;  2HZC A;  3NL0 A;  3R6L B;  4KO0 B;  2WVF A;  2NPI A;  1HNI A;  1VQP S;  2FPH X;  5T14 A;  1HW8 A;  3V6D B;  1G1X A;  4KQZ A;  3K5L A;  2DY9 A;  3WHI A;  2KZM A;  3NNA A;  1IQT A;  1DTQ A;  2ABY A;  1S1V B;  2XLK A;  3Q8S B;  4JV2 A;  4YR0 A;  3AXM A;  1S0M A;  2JEJ A;  3NWR A;  2DR7 A;  3FFI A;  3BS9 A;  1SJ3 P;  4KFB B;  1KS2 A;  3MEC A;  3FVY A;  3CJT A;  2MMY A;  5IXU A;  4F02 A;  1JJC B;  3QLH A;  2FJW A;  4F3M A;  2F40 A;  1BQM A;  2W1B A;  2GNK A;  4ZPA A;  4ZVH A;  2HGL A;  1RBO B;  3R5A A;  1D9D A;  3MM5 B;  1RAB B;  2YKM B;  3DYA A;  4H4K A;  3TEG A;  5L1L A;  2BOP A;  2CRL A;  1C0U A;  4W4M A;  1RAF B;  3PCO B;  5KOW A;  5I4M A;  1F1B B;  3LPY A;  2MST A;  1IKY B;  4PPZ A;  5HVG A;  1YJ9 S;  2E9R X;  1M1K T;  4PWD B;  2Z2M A;  1H6K X;  1S9G B;  3ILO A;  2HFV A;  3CNQ P;  2CQH A;  1W7W A;  2Q6B A;  3AAW B;  5L1K A;  1Y7P A;  2PGC A;  4C0O C;  1KKH A;  3IBW A;  1KFD A;  4TNO A;  2UUA J;  5HQL A;  1DFD A;  4R25 A;  3GR1 A;  4PAA A;  3LP2 A;  1BD6 A;  1N6Q A;  5KFM A;  4USI A;  2O5D A;  4RJV A;  2L41 A;  3I0R B;  3BN7 A;  2F7V A;  1J5E J;  3C15 B;  1VIO A;  5DDP C;  1U8S A;  5ETV A;  1TMJ A;  2O01 C;  4JI8 J;  1ZPW X;  1RWN B;  3ISN D;  5LL6 d;  1MU2 B;  3CCV S;  3QYY A;  1X5O A;  2I8E A;  4OX7 A;  3MMB A;  4QIG A;  1U49 A;  2WOM A;  3FSI A;  4ZLL A;  3BYP A;  5KT2 A;  3NS7 B;  2HAI A;  1TKT A;  5A6W A;  4OI6 A;  4DS5 A;  2BA9 A;  3AD7 C;  3VCD A;  5JXS A;  5J1E B;  3DM2 B;  1FE0 A;  2G1D A;  4X64 F;  3PIP Q;  1N36 F;  3DRX A;  3O5T B;  4ZPC A;  3M8Q A;  5GAE I;  2MKJ A;  4OYZ A;  2E9Z A;  2AW0 A;  2HIY A;  1HWL A;  4P72 A;  1REG X;  2CQI A;  5EHH A;  2IC3 A;  5D15 A;  4DL0 C;  3GYX B;  1VBZ A;  2GHV C;  2HBQ B;  4X65 F;  3W8G A;  4ES1 A;  2YKP A;  3QT8 A;  1T11 A;  2BZ2 A;  2HBY B;  4Q2L A;  1WI6 A;  4XO0 A;  3OVB A;  2KJW A;  1MG7 A;  3UR3 C;  1ICE B;  2FGC A;  1KOO A;  1WOR A;  2V63 A;  4PWU A;  2IDE A;  4WP9 A;  2EFN A;  2XI3 A;  3RJM B;  1IJF B;  1AZS B;  4ZHR A;  3ZTS A;  4PRF A;  3MWB A;  1B7Y B;  3EX7 B;  4DOZ A;  1S49 A;  4H4M B;  1QE1 B;  2AJ4 A;  1F9H A;  1JNR B;  4C8M A;  4A48 A;  3P96 A;  4MTP A;  4YS2 A;  2HNY A;  3KHG A;  2ASY A;  4FBT A;  2JFK A;  2KXN B;  1E6Y A;  3VVT A;  4CLP A;  4L3K A;  1F5A A;  1WOP A;  1R8B A;  4IRC A;  4WFZ A;  3S01 A;  4Q44 A;  1DUR A;  3WIV A;  2VQF J;  2GGP B;  4K4S A;  1JLA A;  4Z7C A;  2E29 A;  3L09 A;  1C4A A;  3DHX A;  2BMB A;  1MWZ A;  4DUY J;  3M8P B;  1HHQ A;  3KK2 B;  1HWK A;  3I87 A;  3MM8 B;  2MY7 A;  3HI9 A;  4GMK A;  4ECZ A;  4DU7 A;  4N8O A;  2BJ9 A;  1HIY A;  4B3S J;  4E2F B;  2Z58 B;  1IKW B;  1QDU B;  3QJL A;  2V8D A;  3NGS A;  3UDL A;  4DFM A;  2A6O A;  2NZC A;  1D0E A;  2VFT A;  1A9N B;  3KLH B;  3KJQ B;  3GJS B;  4AT1 B;  1EP4 A;  3CJ5 A;  5E7O B;  5IQQ A;  5GAG U;  2J9C A;  2RDD A;  1IKV B;  1EQ0 A;  1X4B A;  3N5F A;  4ZP6 A;  4KGV B;  1ZS6 A;  3B4M A;  4GC7 A;  5CYM A;  2CNN B;  5M2R A;  4I56 A;  2GMJ A;  4C0B A;  3KK3 B;  1RAH B;  3MM7 A;  4K4X A;  1LK7 A;  1W25 A;  2MXY A;  1UPM B;  2Z2Z A;  1TV6 A;  1S0V A;  3TA2 A;  3PY8 A;  1RT1 B;  3DOL A;  1BGX T;  3TAM A;  4NLV A;  3FNN A;  2DNO A;  1SVD A;  3IP0 A;  4WIQ A;  2KB2 A;  3TVZ A;  1LXJ A;  1KVK A;  1YBU A;  2PN6 A;  1ZM2 A;  4KO0 A;  5AJ3 J;  2QZ8 A;  4B3M F;  3F0N A;  4GKK F;  5IC6 B;  4MJK A;  3V6D A;  5DGB A;  2HMI A;  3CCL S;  2QA4 S;  2FD2 A;  2JX2 A;  4QWC A;  2DR6 A;  3TAN A;  3EGN A;  1U6Z A;  2KVI A;  4X84 A;  1VBX A;  4ZMM A;  1Y0H A;  4KHP J;  4KFB A;  5KG3 A;  2QLJ B;  2ZH1 A;  1SJF A;  4UOH A;  2WBR A;  3RG6 A;  3QFW A;  1VIS A;  4OHY A;  1Q8I A;  2YQ3 A;  2WZ1 A;  4BS2 A;  4LRE A;  1YHQ S;  1CG2 A;  4PR6 A;  4IOC Q;  2YKM A;  1TL7 B;  3Q89 A;  3SCJ E;  4X66 J;  3PV8 A;  2CG8 A;  2ZOG A;  4GC6 A;  3N6L A;  2HUR A;  4N47 A;  2E1R A;  2PEB A;  1JB0 C;  2Y9H A;  2VQE F;  3W64 A;  5IWA F;  1S9G A;  1N8R T;  4B9M A;  4I2Q A;  1MRO B;  3ILJ A;  3SSS A;  2FZK B;  1QLN A;  4KR0 B;  3K5P A;  2R9L A;  1TKZ B;  1JLG B;  4HHU A;  1RQ0 A;  3B8H A;  1XR6 A;  1SB6 A;  1KLM A;  4J5O A;  1AFJ A;  3TUI C;  1R0C B;  4ED7 A;  1RYS A;  3U1M A;  4J9Q A;  3LGM A;  1RWX B;  1EKR A;  2HBZ B;  4RW6 B;  1S99 A;  3P4U B;  5A8R B;  2CJY B;  4DSL A;  3HM9 A;  3E01 B;  1S97 A;  2K7J A;  1HNZ F;  4DUT A;  1RTJ A;  2C2M B;  2AHO B;  2F63 A;  4C11 B;  3FCV A;  1NAQ A;  5D3G B;  2WRM A;  1QAJ A;  2CA9 A;  1ZBT A;  4F50 A;  1LV5 A;  1VQS A;  3J7Y I;  3G9C A;  3QMQ A;  4O4R A;  2YNH B;  4DHV A;  2FLO A;  1M5V C;  3IFE A;  4UTG A;  3T5L A;  1RU1 A;  4JI6 J;  3ONQ A;  4IOB A;  2RAQ A;  3IMQ J;  4WKY A;  4CLT A;  2P6T A;  4EZ6 A;  2VKR A;  4C98 A;  3CCM S;  3KNG A;  2VOP A;  1UVL A;  3N01 A;  4QIV A;  1UP1 A;  4E8U A;  1KQG B;  1RBA A;  3M8W A;  3C16 A;  2QE5 A;  1RT2 B;  3BSC A;  4NYP A;  5KOX A;  1R0B G;  1PO6 A;  3AJ1 A;  2JOQ A;  3NMR A;  1NME B;  4TQS A;  3UCZ P;  1AZS A;  1XEZ A;  1RAO A;  3S7R A;  2W9C B;  3M30 B;  2HGM A;  2JEG A;  3ZNU A;  1U2R A;  5IV4 A;  2GO9 A;  2JZ5 A;  4H4M A;  5GMK a;  2ASJ A;  2YNG A;  3LA0 A;  1NPR A;  5DJB A;  1HPZ B;  4OJ3 A;  2OEK A;  2VFV A;  1S79 A;  3CWJ A;  1H2V Z;  2GV1 A;  5HMY A;  1URN A;  4DV6 F;  1SUQ B;  2AU0 A;  4WII A;  3I0S A;  3GP9 A;  1FE4 A;  2HHS A;  1HKA A;  3UVJ A;  2E66 A;  1IJE B;  1Z2Z A;  2M70 A;  2BBE A;  4RW9 B;  2E1M C;  2V9K A;  3HSG A;  2ZC4 A;  2EVZ A;  2ZM6 F;  3PHE A;  1Z4U A;  4DF8 A;  1BLU A;  1NSQ A;  4IH7 A;  3U7J A;  2K06 A;  3L7O A;  4MMO A;  2OMO A;  1I1G A;  2DB1 A;  1UWA A;  5E3R A;  1XMQ J;  1IKW A;  1ZM4 A;  3B54 A;  2VC0 A;  3MCS A;  4FF1 A;  5BYS A;  3A8I A;  5SUH A;  1JJ2 R;  2W25 A;  4XIU A;  4DR3 F;  2R7T A;  1U47 A;  4A8W A;  5H9F K;  1IKV A;  1CUL B;  3JQJ A;  4OZ5 A;  1C4C A;  2BE2 A;  1EZZ B;  3D1O A;  3KNA A;  4EO6 A;  2HFO A;  2EKY A;  4JV5 J;  2LA6 A;  2P6S A;  3G82 B;  2CWK A;  5IT4 A;  3JYT B;  4K59 A;  2ZHO A;  2XSJ B;  3ZC4 A;  1VK3 A;  2B43 A;  4A8X A;  3AOC A;  1F3V A;  1U45 A;  1SJQ A;  1X9S A;  2HND A;  3KLF B;  4J9K A;  1XNR F;  2HG4 A;  1V3R A;  3JSM B;  3W5Z A;  2NSC A;  4X4V A;  3HVT B;  1JWW A;  3TQ1 A;  5LSR A;  3LPE A;  1WKJ A;  3IBF B;  1S5Z A;  1JLB B;  3HVW A;  1LWC A;  3M1V B;  3GSI A;  4ICL B;  2HRY A;  5HJY A;  3HFK A;  4JYA J;  5FDL B;  2E1P A;  3VGT A;  3DN9 A;  2ZH2 A;  4P75 A;  2DHG A;  2CYY A;  4FF2 A;  3L4B C;  4Y3C A;  1WC0 A;  4QWA A;  4K2X A;  2QSW A;  3I6P A;  3PJX A;  1IM4 A;  5KFY A;  2LMI A;  1TTH B;  1HQU A;  2DR8 A;  2DGT A;  1UVJ A;  1S59 A;  5D77 A;  4L76 A;  1Q5Y A;  2CQB A;  2OEJ A;  2ZUA A;  4LFC F;  2OI2 A;  4NLY A;  4JI0 J;  3PJ9 A;  2BXJ A;  4A47 A;  1S1X A;  4ILM A;  1KQK A;  1Q8B A;  2CAD A;  4ZVE A;  4I2P B;  1KQF B;  4Q0B B;  2PEH A;  3TZW A;  4GRS A;  2HHP A;  2HQF A;  3GYN A;  1M5S A;  4DQQ A;  3D1Q A;  1HQE B;  3IWL A;  3PW5 A;  4OX9 F;  1HNW F;  1WWH A;  3FKB A;  1U6B A;  3CCS S;  1NZ8 A;  3MFI A;  4C2M A;  3TYT A;  4F0K A;  4LF5 F;  1WDT A;  3RYL A;  2OIH A;  2R8J A;  4ELU A;  1RU2 A;  3BRE A;  1VOM A;  3IA0 A;  2ZJR Q;  3RGI A;  1R7I A;  1KBR A;  1BY9 A;  2QN6 B;  1FRH A;  5EDW A;  3J81 Y;  3H25 A;  1Q7L B;  3MCO A;  2BJ7 A;  2CQG A;  2XWX A;  3OVS A;  2HVI A;  1R8P A;  1R8H A;  1RHU B;  1FER A;  5ETR A;  5KT4 A;  2E7W A;  3D6H B;  2M9K A;  1RTH B;  2BEF A;  2L9D A;  2N3O A;  2MJU A;  3W5X A;  3QWP A;  2ZZM A;  4TY8 A;  4L74 A;  2PA3 A;  2DHS A;  1T3N A;  1DQA A;  4ED3 A;  3KTQ A;  4LSN A;  5KT6 A;  2H5J B;  4FXV A;  1L5U A;  3OL6 A;  4M5J A;  4A4J A;  5IT0 A;  2ROE A;  1SCJ B;  1WNE A;  2V4J A;  3TEH B;  3MAA B;  3GTY X;  2V2K A;  2JFD A;  1UVM A;  1RT2 A;  1X5T A;  2OH2 A;  4F4A A;  1KN6 A;  4DPY A;  1XBW A;  3NOC A;  2KI2 A;  4ILL A;  3M30 A;  1ZM3 A;  3AB4 B;  3RRH A;  4PG8 A;  4DL4 A;  1RBL A;  5C42 B;  1XQI A;  2XS5 A;  1VRQ C;  1NCL A;  4ECQ A;  2RKI A;  4IG3 B;  2X3G A;  1UA1 A;  3W1Y C;  4NLW A;  3M7V A;  1YVF A;  2ZEJ A;  3QGG A;  1WUU A;  4KGX B;  2J8S A;  1IBK J;  3TR5 A;  3M8R A;  3OR1 A;  2KZZ A;  3H90 A;  1HLW A;  2VZ9 A;  4OV1 A;  1W2I A;  2EG1 A;  2UU9 J;  2FJV A;  2QLX A;  3JQK A;  2XNQ A;  4DV7 F;  1GMU A;  4KTQ A;  2CZV C;  4OI4 A;  1FJG F;  1HNV B;  2LDI A;  1X31 C;  1T95 A;  4RW9 A;  5D0R A;  5E3P A;  3AD9 C;  4L6V 3;  1S1U B;  1VS3 A;  3IN5 A;  3BSN A;  1UZH A;  1C1B B;  2BDP A;  2HVD A;  3M2R B;  4OMF G;  5BXI A;  3GZ7 A;  3T6J A;  3UN2 A;  4ITS A;  2Z8Q A;  4U96 A;  1LWE A;  3TQE A;  1FWL A;  4LF1 A;  1RT3 B;  5HJX A;  3NCP A;  2BX6 A;  1FKO B;  2QFI A;  1I94 J;  5GME A;  4XK8 C;  2MHE A;  1NEE A;  1SH2 A;  1IBM J;  3ZTQ A;  4DFK A;  1FJC A;  3B4D A;  1VJQ A;  3OL8 A;  2ATC B;  3TNV A;  1J5O B;  3D5M A;  4CO3 A;  3RAQ A;  1C0T B;  2PI5 A;  2PFD A;  1NDP A;  2L08 A;  4EYH B;  4DZ6 A;  4DBQ A;  1GXT A;  1BXN A;  2GQ2 A;  3T5K A;  1H2U X;  1SL2 A;  1VQ8 S;  3PR5 B;  3NGK A;  2HNZ B;  2F3J A;  2NR0 A;  3WC2 A;  4OJG A;  4I7F A;  1QSL A;  2GJ2 A;  5F9N A;  2ILZ A;  2QLW A;  3PX4 A;  4DSJ A;  4AXJ A;  2QYC A;  2M5Y A;  2W2N P;  3QRP A;  3QIP B;  2B0G A;  3MXH P;  3PG9 A;  4OQJ A;  3N5B A;  4RBV A;  3IS9 B;  5BYQ A;  2RS2 A;  4NI2 A;  4MKA A;  1UTA A;  4QYZ J;  2KN4 A;  3QZ8 A;  3D6F B;  3SV4 A;  3H0P A;  1RCO B;  1N5Y A;  2MQ8 A;  5FLX Y;  4DQP A;  4JI3 F;  3M8Y A;  4IFY B;  2ZH7 A;  1JLB A;  2PMH A;  2V69 A;  4WFA Q;  3U02 A;  3M1V A;  1YSJ A;  2AYB A;  4FXD A;  2DIV A;  3QGP A;  3BPD A;  4ZP8 A;  2DXF A;  1Q86 T;  1YDL A;  4YQW A;  2AYE A;  4ZPT R;  5IC4 B;  4DV5 J;  1AT1 B;  2XTJ P;  3MR3 A;  1TKX B;  3W65 A;  1MN9 A;  3KLG B;  3CJ8 A;  4J9N A;  4RUH A;  1QM9 A;  5L1J A;  3O2I A;  4FZV A;  1GTH A;  4HHH A;  1PCA A;  2QV6 A;  3CVK A;  4JI5 J;  2HBR B;  4I64 A;  2AGP A;  1XR5 A;  4TXS A;  2Z56 B;  3EPI A;  4OZ0 A;  2YXL A;  2BQR A;  1KFS A;  5KFZ A;  2ZC3 A;  5KFH A;  5KFS A;  2PMW A;  3OL7 A;  4RUB A;  2D9O A;  2F9J A;  3PKM A;  3KJV B;  4PYD A;  4EU0 A;  1FD2 A;  1T9U A;  2NUU G;  1JXV A;  1RT5 B;  3D1H A;  2KT3 A;  4LR8 A;  4I2P A;  1LK5 A;  1OWX A;  2RF2 B;  1SXL A;  2FB0 A;  2XG8 A;  3NAH A;  4RL1 A;  3R2C J;  4OHV A;  2W01 A;  1YZ6 A;  3RBD A;  1LFW A;  1CLF A;  1BQX A;  4ZPV R;  4ZN1 A;  1HQE A;  1UEV A;  4N77 A;  2RSQ A;  2ZBC A;  5A8K A;  1HWU A;  3GCW P;  2KO1 A;  4WKR A;  2YKN A;  5GAG I;  2ZVS A;  4RPF A;  2GCF A;  2Z30 B;  1WEY A;  1KP6 A;  4M94 A;  3RTV A;  2YNF B;  2D3O R;  1N32 F;  5F8I A;  3OTE A;  2RVJ A;  4YR3 A;  5SZT A;  4JYA F;  4WF9 Q;  5CYQ A;  4N76 A;  2VA3 A;  4V19 J;  4BLG A;  3I56 S;  3SCK E;  1H2T Z;  1FNX H;  2J0S D;  3ZZT A;  1AUS L;  4KGK A;  3I5A A;  1IUJ A;  1XIQ A;  2ZOF A;  3T9Z A;  1YRU A;  3SEO A;  3CC4 S;  1IWG A;  4OYX A;  3MDF A;  2WBM A;  3G86 A;  3UNG C;  1IR2 A;  2ZBQ A;  5DDR C;  1T03 B;  1C1C A;  5IM0 B;  4HH0 A;  4DX7 A;  3V81 A;  2FC9 A;  2HWH A;  3G6V A;  2ADB A;  4QWE A;  3QGI A;  1OSD A;  4PZV A;  2C3M A;  4OZ3 A;  2DR5 A;  6FDR A;  2MQQ A;  4QZV B;  3G87 A;  1U1L A;  2QG9 B;  2G0C A;  2NCK L;  1TL3 A;  1VQM S;  4CO1 A;  4ZJO A;  4LF9 J;  4Q7A A;  1VHF A;  1HI8 A;  4RNN A;  4LF4 J;  2VC1 A;  4HLB A;  1RWK B;  3CF5 Q;  2SXL A;  1FKA F;  2KTQ A;  2YKQ A;  2HS4 A;  2QL5 B;  2RIL A;  3V4M A;  4DR7 F;  3TUP A;  4B3O B;  5J2P B;  4B02 A;  2OGU A;  3GG1 A;  3MR2 A;  3TX8 A;  3BQ0 A;  4O4G A;  2LYV A;  3D4J A;  1VQ6 S;  1IBC B;  1OYE A;  3RRG A;  2LFV A;  2ZBI A;  4ED6 A;  1HNX F;  4BCA A;  2R8K A;  2LXF A;  3HJF A;  2ZH9 A;  4BC7 A;  2HQC A;  4WE1 A;  3L7U A;  2C2D A;  3IGN A;  1S1U A;  5B0D A;  3M2R A;  2AJ0 A;  3UDE A;  4DR2 F;  5KFE A;  1SBR A;  2O67 A;  3AJD A;  4DX6 A;  2V0N A;  1KHV A;  1DLO A;  4DPX A;  2OEL A;  3HK2 A;  4ZPB A;  2OP5 A;  1U1Q A;  1FXL A;  1T9X A;  4YDX A;  3JAM U;  3C6T A;  1NJZ A;  3VAF A;  5HQM A;  2R7W A;  4CCH A;  3MMA B;  1D9F A;  2AGO A;  2BVZ A;  2AEM A;  2A2D A;  3CSK A;  3RRK A;  2QFJ A;  4UOF A;  4OIX A;  5DDO C;  3D9B A;  1B3T A;  3I96 A;  3CJS A;  1B0V A;  4RW7 B;  4AE5 A;  2XI2 A;  2HNZ A;  2BAN A;  1F60 B;  2CDQ A;  1WHW A;  3PW2 A;  4O0I A;  3QIP A;  4RR5 A;  4K4Z A;  2ZHB A;  1RAE B;  2MQL A;  3OW2 R;  4GO5 X;  4H4O B;  1N34 J;  3KFW X;  3FBE A;  1RHM B;  4ZCM A;  2UP1 A;  2RT3 A;  5K14 B;  3KHL A;  1UMJ A;  5KFK A;  3CED A;  3DOM B;  1Q81 T;  3QNW B;  3DRR A;  2XMT A;  4XDC A;  2JLE A;  4K5R A;  3Q22 A;  4M5D A;  4UW2 A;  4BWJ A;  4X62 F;  4HTI A;  4J9O A;  2MKK A;  2L9W A;  1CC8 A;  3EE3 A;  4PUO A;  4NA2 A;  2FLP A;  5CQG A;  1WAC A;  2VPX B;  4USU A;  3JSR A;  3IAS 9;  2YPY A;  1FDD A;  1PC5 A;  1TVR B;  1TKX A;  2CNO B;  2GA7 A;  1IKX B;  3MM9 A;  3BJY A;  4OYO A;  3CUN A;  4F4Z A;  1OJ4 A;  4EGL A;  4LQ9 A;  2W7P A;  5F8L A;  2R7S A;  3NBP B;  2GIR A;  1RKJ A;  2PA8 D;  1XR7 A;  1TL5 A;  2W8K A;  3GCX P;  4RU2 A;  2V50 A;  3HVR A;  5FD1 A;  2YNI A;  1YI2 S;  4LF8 J;  1NSK L;  2YWK A;  4DUZ F;  1S72 S;  4UT4 A;  4ZCK A;  4ZVG A;  4P2M A;  4KV8 B;  1NJW A;  3KJV A;  3H2U B;  1NND A;  3PW4 A;  3K5N A;  4ED5 A;  1BUX A;  5F0U A;  3BEG B;  3VAI A;  3VGS A;  5G0R A;  2CIM A;  3HVA A;  2PD1 A;  2H4W B;  3NLC A;  5LJ3 Y;  3G8Q A;  3F56 A;  2WB1 D;  2P9G A;  3IRW P;  3M2U B;  1NPP A;  1YJU A;  5LMU J;  1Q4R A;  2HHH F;  4NMX A;  3NNC A;  2IVY A;  2ACY A;  1HBU B;  2XYG B;  2F8E X;  2J7W A;  4CQ1 A;  2MLY A;  3MEG B;  5CH7 B;  4ECT A;  5DGA A;  1HAR A;  4USK A;  1SV5 A;  2YNF A;  3ENA A;  1RXO B;  5HRO B;  5L39 A;  2Z0G A;  1HL6 A;  2E5L J;  3HF5 A;  5DDQ C;  5F3Z A;  3TX0 A;  3DI6 A;  3PYG A;  1GAO A;  1RKI A;  2R7V A;  3BGL A;  3MUM P;  1E6V B;  4LRA A;  5E3C A;  2CZ4 A;  4DLG A;  1A0O B;  1I5O B;  3EM1 A;  3M32 B;  2DHX A;  4Z7Y A;  4IDK B;  2XYH B;  4RW4 B;  1JLF B;  1WEX A;  1VMB A;  4RWX A;  2U2F A;  2PO4 A;  4ZS6 A;  5BJR A;  4WFY A;  1G2E A;  3AY0 A;  3TP2 A;  1XN9 A;  2JNJ A;  4K4T A;  1M1H A;  4QJV A;  3ZTP A;  4P10 A;  1T03 A;  1KRP A;  1PJ5 A;  2XO7 A;  1X5P A;  4KYZ A;  1WSR A;  3SQG B;  5IM0 A;  1LKZ A;  3VWS A;  4WZQ A;  1FFG B;  2M8H A;  2Y3Y A;  2HEK A;  4CYU B;  3U1L A;  4U9R A;  3ITH A;  3EGV A;  8RUC A;  2DNM A;  5KTQ A;  3R1H A;  2VPY B;  2HVZ A;  5DLG A;  3EXC X;  3I9V 9;  1F2H A;  2EEY A;  3TI0 A;  3OLA A;  2EI5 A;  2IM0 A;  3SYZ A;  3LP1 B;  1TK5 A;  1RTD B;  1NK0 A;  1SIW B;  4FYW B;  3SSR A;  1UA0 A;  4KH1 B;  3QID A;  3MFH A;  2CQ4 A;  2XLJ A;  3FJ2 A;  4K4V A;  3J80 Y;  1P1L A;  1CEZ A;  2LCW A;  3BR8 A;  4NE9 C;  1J27 A;  3TW0 A;  3PZP A;  2BQU A;  1D1U A;  3MCN A;  2N82 B;  2WSF C;  5IT9 U;  4EFA C;  4JI1 J;  3GWC A;  3BQ1 A;  1UEU A;  4ZIV A;  2UUC F;  5D78 A;  4BBY A;  1KHW A;  2BKO A;  3W9I A;  3CJ2 A;  2DTJ A;  1RHQ B;  4C6A A;  1TKD A;  3LP0 A;  1NRK A;  3TAP A;  4TU9 A;  3DOK B;  4M5I A;  4RZR A;  3ZZP A;  2YX4 A;  5RUB A;  4QWB A;  2XO6 A;  1TAU A;  3MR6 A;  3SIP B;  4JV1 A;  2I0X A;  3TVK A;  2C3P A;  2V8P A;  1SKS A;  4JI4 J;  3VR1 A;  4E0D A;  2ZUG A;  3OBI A;  3EDQ B;  2VG5 A;  4HVZ A;  5CAA A;  3TJ8 A;  2CAJ A;  3T5J A;  5CZV A;  9ATC B;  1XNQ J;  2LEA A;  1JLQ A;  3HHL C;  4DN0 A;  1FX4 A;  2XZD B;  1AYE A;  2DXD A;  3R7N B;  4LF4 F;  4IYQ A;  2B51 A;  4DSE A;  2WVC A;  3IG1 B;  4ZOS A;  2YX7 A;  5IQ6 A;  2UUB F;  4N8N A;  3DDI A;  1FTC A;  4H4O A;  4DI6 A;  3OHA A;  4OJ1 A;  4DN9 A;  3PR4 A;  4NX9 A;  2MY8 A;  1QUV A;  2JJ4 D;  2RML A;  2RU9 A;  3GU0 A;  1XC9 A;  1XTZ A;  1P1T A;  2L9N A;  1DAR A;  4OYB A;  5KFX A;  5DS7 A;  2FVR A;  4HL9 A;  1S9F A;  1CC7 A;  2OPR B;  3KJN B;  1RTZ A;  1D09 B;  3EMT A;  1KOH A;  2JVR A;  1NK7 A;  1AA1 B;  6FD1 A;  4OX6 A;  2GVD B;  3CJQ A;  4W90 B;  5K8O A;  3DRS A;  1U1M A;  3K5M A;  3PX6 A;  3W9J A;  1R8A A;  1HW9 A;  3MTK A;  1IKX A;  5CZX A;  4F67 A;  4DLE A;  1FDB A;  1ELO A;  4O44 B;  1FES A;  4G1P A;  4NPO A;  2I2Y A;  2LEB A;  2KKH A;  1R6V A;  3QT5 A;  1JKH B;  4Y2I A;  3BKT A;  2DR9 A;  4PPD A;  4IG0 B;  1R0A B;  3MEE B;  1FRI A;  3C66 A;  3PDN A;  2HVE A;  2ZFH A;  2LA4 A;  5IZH A;  2IRX A;  3MZI A;  4HDH A;  1NH7 A;  1YBA A;  4X4U A;  4JI7 F;  1Y5L B;  3S6E A;  1HYS B;  3FCH A;  4AQY F;  1SI9 A;  3W8P A;  4J9M A;  2LXI A;  1DQ9 A;  3KK1 B;  1K47 A;  2V8H A;  2NS1 B;  1RGV A;  3Q86 A;  4U7C A;  5K20 B;  3M2U A;  1EET B;  3RW7 A;  3T1H F;  2JWN A;  4PQU A;  5AE1 A;  1RAG B;  2CQ1 A;  1HBO A;  2VV5 A;  3QGH A;  1S57 A;  2DNH A;  4I6Y A;  1ULR A;  4OJH A;  5HP1 B;  3PRB A;  5F3T A;  4ED0 A;  4DSK A;  4ZK7 M;  3C14 B;  2ZWO A;  5KG1 A;  1QAY A;  3GV5 B;  2R4F A;  4QOT A;  4G1Q A;  2VL1 A;  1Y10 A;  1T02 A;  2J0W A;  2V4Q A;  1DTQ B;  4IUF A;  1X9W A;  2UUW A;  4MK7 A;  1FF2 A;  3T5H A;  3FFI B;  1X4D A;  3MEC B;  4WK3 A;  4XTT A;  2IRU A;  1UW9 A;  1ZTT A;  3FZ2 A;  3RU0 A;  3QLH B;  3SQG A;  1UVI A;  1S6P B;  2QMW A;  3QRR A;  4NML A;  3MOZ A;  3P8B B;  3TRG A;  1CJV B;  4ED8 A;  2IBK A;  2CPZ A;  2OML A;  2F4V F;  4LUB A;  1RZM A;  4Y6I A;  4X64 J;  4EYI B;  2BW2 A;  3CDE A;  4USM A;  1SL1 A;  3DLH A;  1TFY A;  1N36 J;  3TWZ A;  4O3Q A;  4PWW A;  2R3V A;  2BM1 A;  3LWL A;  1KNZ A;  1VQ9 S;  2IVM A;  1C0U B;  2CUY A;  3TZZ A;  5H9E J;  3FEX B;  4M63 A;  2DJW A;  2Y8Y A;  4WP3 A;  2XEX A;  3V2U C;  4YY3 F;  2FVP A;  4GVB A;  4P9S A;  1RTD A;  3KWM A;  4F7V A;  4X65 J;  4CIO A;  3H2L A;  5K8N A;  5ETT A;  1BMQ B;  2LKZ A;  4YB1 P;  4CTA B;  5LSO A;  1N6Q B;  1QSY A;  4F4X A;  2ERR A;  4QQB A;  1GQE A;  2RQK A;  1B70 B;  3KMQ A;  1SJ1 A;  1W26 A;  3H5X A;  3HP6 A;  1FVS A;  4ZN3 A;  3VZI A;  5CXT A;  3QSY B;  3TJ9 A;  2RRN A;  3GE9 A;  4CH1 A;  3R5J B;  3MM6 A;  4LBI A;  5D4P A;  3M2V B;  5ITH A;  3MMB B;  2WOM B;  3H5S A;  3EVO A;  1EHW A;  3WZ0 A;  3PYD A;  5A0Y A;  2RRA A;  1NBE B;  1LQ9 A;  3DOK A;  1Q82 T;  1ZH5 A;  3DNC A;  1PGZ A;  4ECR A;  1FXD A;  4ZVT B;  2B5J A;  2DCU B;  2IDL A;  3MMJ A;  4K7Q A;  3CD0 A;  5DG8 A;  2BE9 B;  2W2O P;  3TUJ C;  3GIJ A;  3SQO P;  4P6Q A;  5B0C A;  3M8Q B;  3H4B A;  4M5L A;  2IBO A;  2DGU A;  1JMT A;  3MPY A;  3BB5 A;  1RYR A;  1U8W A;  2VOO A;  1FEH A;  3MR7 A;  3QAT A;  2WAQ D;  2V34 A;  4FN5 A;  1NHU A;  2IC3 B;  2KFN A;  2BJE A;  4DV0 F;  1CPZ A;  2DPJ A;  2CQC A;  2ZBR A;  3CDA A;  4CP5 A;  1VRU A;  4F2S A;  4A8F A;  3KLI B;  4DR4 F;  2LQ8 A;  1IM6 A;  2YWW A;  1RT7 A;  3WBZ A;  2HWI A;  4ZHR B;  5HAN A;  5DET A;  4LF7 F;  1FEE A;  4I69 A;  3QAU A;  3KOA A;  4U7U K;  2DK2 A;  5HMZ A;  2HNY B;  3NNH A;  4NZ0 A;  2LQJ A;  1E6Y B;  3PM9 A;  4LIR A;  7AT1 B;  1HBM A;  3V6J A;  1H98 A;  1REV A;  1LOU A;  2AJQ A;  4UST A;  3SXL A;  2JVO A;  3R5C A;  2XMA A;  2D41 A;  5HMX A;  4B3M J;  2ZH3 A;  4NYO A;  1T9W A;  1UWB A;  1JLA B;  1RWV B;  2VU5 A;  4GKK J;  4QIF A;  1NJI T;  3CCJ S;  5C7P A;  4ZVF A;  3ZTO A;  5L9X A;  1JKH A;  4DL3 A;  3Q2S C;  1QVF R;  4IG0 A;  3ZZ0 A;  1R0A A;  3CCW A;  4XDD A;  3I55 S;  3A3O B;  1CVJ A;  1WI8 A;  3E8O A;  4K50 A;  3HT3 A;  4MKV A;  3PYF A;  5A2Q U;  1HYS A;  3O8W A;  4LR7 A;  4B3T F;  5KFC A;  2ALZ A;  2P9E A;  3THT A;  1O0P A;  3OXL A;  2M2B A;  4USH A;  4RO0 A;  1OY6 A;  3A1Y G;  2M3D A;  2HPU A;  4F26 A;  1RA7 A;  2QT7 A;  2I38 A;  1WD6 A;  4CRJ A;  3BKF A;  3MED A;  4DR5 F;  4TY9 A;  3JQM A;  3OR2 B;  5ETQ A;  2VQE J;  4YN3 B;  3MM7 B;  5F8G A;  1LW2 A;  2J6S A;  5IWA J;  2A10 A;  3OXF A;  3NS5 A;  1IBL F;  3PW7 A;  2E44 A;  1TV6 B;  3AA8 A;  3KDO A;  3DOL B;  3TAM B;  1ZYQ A;  3JXO A;  1GK8 A;  2C1E B;  4B08 A;  3J81 j;  2EXU A;  1Q95 G;  3C14 A;  2GQC A;  2O3D A;  1RI7 A;  3TZY A;  5U47 A;  3QAE A;  3DHW C;  4WFB Q;  3QWU A;  1P9Q C;  2HMI B;  4JUZ A;  2LP4 A;  4PKD B;  2COL A;  1GX5 A;  1BWE A;  2B7C B;  2YPZ A;  1Y00 A;  2Q66 A;  1X7V A;  1S10 A;  4ZVS B;  1HNZ J;  2QRR A;  5J2M A;  3V4I B;  4IFV A;  3LTO A;  1HWJ A;  1ITP A;  1S6P A;  4FVM A;  2D3Z A;  2OSQ A;  1TP7 A;  1NK9 A;  3GSD A;  1CJV A;  1AXQ A;  5D4O A;  4PYA A;  4KPC A;  2OLW A;  2RJZ A;  3ZZY A;  5EGY A;  4J90 A;  2QA2 A;  2JC0 A;  4OZN A;  3O3L A;  4Y2M A;  3IRX A;  2WVE A;  3J7A 1;  3UO0 A;  2QC3 A;  4F25 A;  2ZOM A;  2HAF A;  1SC6 A;  5JVH Q;  1H7W A;  4OZJ A;  4NCA A;  3QRQ A;  2X1A A;  3EDR B;  2R8G A;  4Q43 A;  2MKI A;  5LMN F;  2H65 B;  4LRD A;  4FNI A;  4LSZ B;  3KLV A;  3GII A;  4HTJ A;  4I2Q B;  3D68 A;  3OJU A;  2B4O A;  4U95 A;  4CTA A;  1XMB A;  3Q8P B;  3D0H E;  2VDH A;  1NPK A;  3NCQ A;  3W9H A;  1KLM B;  2FLL A;  1M5P C;  2QX0 A;  2DKO B;  1OQ6 A;  3BR9 A;  4Y34 A;  1L3K A;  3L3C A;  3DLK A;  2G4B A;  1MMD A;  3FMW A;  1UW4 A;  2UVV A;  1NK5 A;  2LU1 A;  3LGN A;  3M2V A;  3M6X A;  4A8K A;  1UL3 A;  1B99 A;  4CLU A;  4TN2 A;  5E3Q A;  4O3N A;  3ULH A;  2BW7 A;  4MFB B;  3OT9 A;  1RTJ B;  3HZG A;  2VOD A;  4B9L A;  3S8S A;  4R5P B;  4K0K F;  4DV6 J;  3TVY A;  4DL6 A;  2DBB A;  1NDC A;  3DDK A;  4ID5 A;  3A13 A;  2ASL A;  4URS A;  1FHT A;  3G8T A;  1JLC B;  4F0M A;  4DPW A;  4P2X A;  2M4M A;  3HLU A;  3H4D A;  2GIF A;  1EB0 A;  2ZM6 J;  1SKU B;  2HHX A;  1X4H A;  2EFO A;  2F8M A;  5DM6 Q;  2Q6C A;  4ED4 A;  3EUN A;  3RB3 A;  2DNK A;  4KGZ B;  2J0X A;  4DR6 F;  1Q8K A;  3OJS A;  4URG A;  3D6T B;  4DL2 A;  4DR3 J;  4JI2 F;  2UXB F;  3C16 B;  3KLI A;  4RKU C;  2BE7 D;  1JLE A;  2HKE A;  4R0J A;  4CNY A;  2ALY B;  1YJ7 A;  2VG6 A;  4AYB D;  1VI7 A;  4LVO P;  2IA0 A;  3MD1 A;  4GKJ F;  3KUH A;  4F3O A;  1VCT A;  2C2O B;  1KVI A;  3SCI E;  3RUB L;  2XHC A;  2PI4 A;  2YNG B;  5J2Q A;  1OY8 A;  4DQR A;  1EQM A;  4DQI A;  4D3G A;  2DH9 A;  4LBH A;  1U1O A;  2V6A A;  1S6Q A;  3EIC A;  3UCG A;  4ZLN A;  4ZVU B;  2W7O A;  4OYM A;  3CIZ A;  1R3N A;  2VPW B;  3I0S B;  2D69 A;  4QW9 A;  4K5S A;  3CW2 C;  2QLF B;  1XNR J;  4ANE A;  3UVJ B;  3RBE A;  3UFC X;  2QO3 A;  5MLC V;  3CDU A;  2H1Y A;  1UFL A;  3MTJ A;  2NLW A;  2IHR 1;  3W3S A;  4DR1 F;  5CA5 A;  2HQI A;  1WJ9 A;  1F5C A;  4CLW A;  3TO8 A;  4CO0 A;  1U2F A;  1KON A;  4DQS A;  4DXL A;  4ILR A;  5DQH A;  1SC1 B;  2MYF A;  4K4W A;  1BC6 A;  1YLX A;  2RUG A;  4FVC A;  4NLO A;  3CD6 S;  5C2G A;  5CHC B;  5DLF A;  5HK4 A;  2VG7 A;  4GO7 X;  1RCX B;  2Z4P A;  2WSE C;  3N9U C;  3NRB A;  5KFF A;  5F0W A;  5AE3 A;  3NEK A;  3VQS A;  2MKH A;  2BE2 B;  1B4S A;  2BJ8 A;  1Q1K A;  2E5G A;  4DV1 F;  3OFE A;  5KFU A;  3K89 A;  3RW6 A;  1WF0 A;  2KG1 A;  3OR2 A;  5I3U A;  4B9N A;  4LFC J;  2J0Q D;  1D8Y A;  4PXB A;  1VQL S;  3AQP A;  3UE2 A;  4JP8 A;  1H74 A;  3CJ3 A;  5B0B A;  3OD2 A;  4LVN P;  4AL6 A;  5E41 A;  2HND B;  2IAJ A;  3R2D J;  2ZE2 A;  2FJD B;  4FF4 A;  1Q53 A;  5ETO A;  5CCM A;  1TUG B;  2L3M A;  4OX9 J;  1HNW J;  3NGU A;  2WCX A;  1QY7 A;  4ZDN A;  1Y5I B;  1RWU A;  3D3C J;  1LWC B;  2JEF A;  4LF5 J;  1GXU A;  1OS5 A;  4QCL A;  3IXQ A;  4ES2 A;  4EBE A;  2J9D A;  5D0G A;  3V4I A;  1VQY A;  3MGJ A;  4XPC A;  1FFS B;  4AND A;  4OFZ A;  3GIR A;  3MOJ B;  3K58 A;  5KFG A;  1Y5N B;  3PAC A;  2FHK A;  3HHL D;  2HS3 A;  1WC4 A;  2YKA A;  1SC3 B;  4YDD B;  2NXE A;  1HQU B;  2XNR A;  2KL8 A;  2WHO A;  3EPG A;  2W4D A;  3DLG A;  2K1R A;  3IBC B;  3ZZO A;  3UCU P;  4QR0 A;  1N5S A;  1ZAV A;  3W2W A;  2DO4 A;  5KG7 A;  2KT5 A;  4KGM A;  1S1X B;  4UOC A;  1DJ0 A;  2MTL A;  5CD4 H;  3KJF B;  4QU6 A;  1CJK A;  1YRT A;  1FKP A;  4UQT A;  4R8U A;  2XGQ A;  3N79 A;  2NXJ A;  1ZM9 A;  2XMU A;  1ZA2 B;  2YY3 A;  1WKL A;  3VV2 B;  4X4Q A;  3GG0 A;  3MPD A;  2FGO A;  3OPK A;  4L75 A;  2DGW A;  1WHY A;  1NK4 A;  3ENQ A;  4JV0 A;  5T7L B;  4M5K A;  1S1W B;  2UV8 G;  2BAB A;  2MZ1 A;  4MFB A;  2ZVI A;  1O6X A;  2VIC A;  4X4N A;  2W9A A;  4R5P A;  2VH7 A;  3LWM A;  3B78 A;  3MEK A;  3PKY A;  5H1S V;  1Q7Y T;  1TFW A;  4KE5 A;  1TUV A;  2GML A;  2IJN A;  1AFI A;  4FYV B;  1GXL A;  2RD5 C;  2VFS A;  4DV7 J;  4DZD A;  1HR0 F;  1JLC A;  1TUW A;  4PG6 A;  5L46 A;  1FJG J;  2EFQ A;  2B8Q A;  4DV4 F;  5I42 B;  3THP A;  2Y1I A;  4PXD A;  3AA9 A;  2CJA A;  5I3P A;  2GW8 A;  4DWI A;  3FBF A;  4NLX A;  1X60 A;  3DGP B;  4HHJ A;  4TY8 B;  5LOQ A;  3MUT P;  1TQL A;  1F3F A;  4LSN B;  1A7G E;  3Q8V A;  2DEI A;  5BR8 F;  2V4J B;  2DEJ A;  2V5H G;  4ECV A;  5F41 A;  4USW A;  1YJN S;  3N6N A;  5IFM A;  3NG8 A;  2FQQ B;  2OSR A;  3GV7 B;  1GNK A;  1I6J A;  2Y8W A;  2LXU A;  5JMN A;  1EIY B;  4TQR A;  4EI2 A;  3K17 A;  2XMW A;  1H72 C;  3DLB A;  2RKI B;  3ET6 A;  3Q0A A;  4D3H A;  2V94 A;  3EZO A;  3DRP A;  3KLE A;  2CJX B;  2FJE B;  3LUY A;  5EWF A;  2A18 A;  3ZZR A;  3FSY A;  1NXI A;  1UJ5 A;  3OR1 B;  3EYZ A;  4C48 A;  1FRM A;  5KFB A;  2Y0S D;  3HHK A;  5KG0 A;  2GJI A;  1X4E A;  2K2P A;  3QT6 A;  5D0H A;  3T1A A;  1K73 T;  2FYX A;  1U2C A;  3SSQ A;  2F65 A;  1C2P A;  4ES3 A;  4JI3 J;  5HN0 A;  4NCG A;  1U0H A;  4W98 A;  3AQO A;  3D6M B;  1CJU B;  2W9B A;  1U4B A;  1LWE B;  1S1T B;  4P7V A;  2VBZ A;  3AT1 B;  1N33 F;  2EPI A;  3G6Y A;  3POT B;  2XHW A;  4OI0 A;  3C46 A;  3J81 U;  3E3X A;  2NXN A;  3S1T A;  2YBV A;  2EBG A;  3C6U B;  1V5V A;  4USJ C;  2DGO A;  2UXD F;  3V6H A;  2AP6 A;  1T05 A;  1P8G A;  3TA0 A;  4J9S A;  1T9Y A;  3U27 A;  3OTB A;  1VYA A;  3PX0 A;  4EZ9 A;  2UVU A;  1RT6 B;  4I7F B;  2HQD A;  1CQM A;  1WEL A;  2AF6 A;  1S9E A;  4RUA A;  5THW A;  1S6O A;  3P3D A;  2H51 B;  1TR0 A;  1N56 A;  4NI2 B;  2FHJ A;  1HD0 A;  3X3U A;  3ADA C;  3LF0 A;  2XY6 A;  1N5Y B;  4ZVO B;  1M5H A;  2LQB A;  2IVF B;  4YB6 A;  1MWY A;  1NZA A;  2IIH A;  3HHE A;  4DL7 A;  4EBC A;  2WON A;  3DDN A;  1N32 J;  4TLR A;  4TU7 A;  2ZH4 A;  4NXM F;  4I68 A;  4FYX B;  5J1N A;  3HCX A;  1KWM A;  4HAC A;  3P49 B;  4PG4 A;  2GX8 A;  3NGT A;  2YQ1 A;  2A3J A;  2OPQ B;  1G3O A;  3NMA A;  3G96 A;  2DIS A;  2NXU A;  5EX3 A;  4I4B A;  2HS0 A;  1R8C A;  4LIW A;  3DXB A;  2Y1J A;  2EC2 A;  2HW3 A;  1SH0 A;  2ZWP A;  2WVB A;  2G9O A;  2U1A A;  1VJW A;  2YWE A;  1M0S A;  5KT3 A;  2EFG A;  2BJD A;  1YRX A;  1VIX A;  5F8M A;  4ZLJ A;  2AX1 A;  1UAW A;  4MT1 A;  3J7Z 5;  1QAX A;  3O6Q A;  4WYW A;  3MPW A;  2K3K A;  4DS4 A;  1CJT B;  3CJ0 A;  1U26 A;  4RNM A;  2XUL A;  1N4L A;  3AHP A;  1M1G A;  4Q2M A;  4FBU A;  2FHO B;  4F4K A;  2MLX A;  2OPP A;  5E0O A;  3ZNJ 1;  2AJ1 A;  2MJN A;  5A8K B;  2OJ3 A;  1WHX A;  2G0I A;  4C3M A;  3A3N B;  4X4R A;  3AOA A;  4IH6 A;  2YKN B;  1FI4 A;  2HFZ A;  3GV8 B;  2HLT A;  1FXR A;  4YB5 A;  2VJV A;  3CO0 P;  1N5Q A;  3DLE B;  5T7L A;  4H54 A;  1S1W A;  2F8H A;  1EJ7 L;  1RAD B;  5CYQ B;  4DR7 J;  4B9T A;  2FLN A;  2WK4 A;  2B6A B;  4ECU A;  4F4W A;  3HDS A;  4LFB F;  1RHJ B;  1VGY A;  4RW8 B;  3UQS A;  1RJJ A;  1B0P A;  3BO4 A;  3CD5 A;  4KH0 B;  2LEP A;  1HNX J;  3BDP A;  1WC5 A;  3QJJ A;  4DV2 F;  4WU3 A;  5I42 A;  4UQG A;  3M6U A;  3KKF A;  1O8B A;  1WG1 A;  2MLZ A;  1GTE A;  4DR2 J;  3BYR A;  4Z2X A;  3J7Z T;  3DGP A;  4NZ7 A;  2CPH A;  4NXN F;  3ZFV A;  4LRC A;  1C1C B;  2X1B A;  2QMX A;  3NAI A;  3BM7 A;  1UJ4 A;  3EJM A;  3V81 B;  2MZR A;  3OSN A;  2VBX A;  3G2X A;  3IAM 9;  1IQZ A;  4OZ1 A;  3GLJ A;  4J9L A;  2NYI A;  3GFY A;  2HRU A;  1RWM B;  3MMC A;  3OUY A;  4LF6 F;  2KDO A;  1SQG A;  1TL3 B;  2Z2Y B;  1MN7 A;  3IR7 B;  4TU8 A;  1YJW S;  2GHP A;  1SJ4 P;  2RHS B;  2CPI A;  1LWF B;  2QL9 B;  5T41 A;  5JVG Q;  2CG4 A;  4OYP A;  5IS2 A;  3R27 A;  1LEO A;  1JX4 A;  1H73 A;  2MSS A;  4DPT A;  4AXI A;  3HO1 A;  2OTL S;  2HFS A;  2VA2 A;  3HHL B;  2XWY A;  2IJF A;  4O4G B;  1X5S A;  1XMO J;  2MZT A;  4LSL B;  1JQG A;  1SH3 A;  2CQP A;  4O3P A;  4F3Q A;  3UNY A;  5A76 A;  1GT8 A;  3IC1 A;  4RBT A;  3BSA A;  4OHW A;  4WE1 B;  1BQN A;  4X62 J;  3FQL A;  3GJQ B;  4DCO B;  4M95 A;  4IQX A;  1CJU A;  4KPY A;  4CT8 A;  1QUP A;  2M88 A;  1K44 A;  3RAM A;  3MAH A;  1S1T A;  1NJY A;  1BE4 A;  3TJA A;  3I9Z A;  4AL7 A;  5DQG A;  4PXC A;  4QPT A;  3POT A;  1DLO B;  3MD3 A;  3RB0 A;  2MKS A;  2H48 B;  5KAK A;  3RR7 A;  1LW0 B;  3C6U A;  3I4H X;  1NSP A;  3LO3 A;  3C6T B;  3PW0 A;  2EW9 A;  1HMV A;  5A8W A;  4NLG A;  1QD1 A;  1TEL A;  1RTI B;  4N56 A;  4IO9 Q;  4WBF A;  2CPJ A;  2IFX A;  1WDD A;  2F1F A;  5J2N B;  5A2Q Y;  4DUZ J;  2OPS A;  2W8L A;  2BAN B;  1RT6 A;  1SIZ A;  4M5H A;  1UJ6 A;  1K1Q A;  4B3R F;  2VB6 A;  3BGR A;  1S4E A;  1X9M A;  2AYM A;  4OYI A;  3M9M B;  1RIS A;  5KFW A;  3OTO F;  3PXG a;  1UFW A;  1UFK A;  2CKW A;  4FPR A;  2R42 A;  3CDW A;  2IPO B;  4IKA A;  2HHH J;  1S76 D;  3DRR B;  2DY1 A;  1NK6 A;  4M5D B;  1NSA A;  2UVR A;  4KIA A;  4M1K A;  4ETX A;  3MUR P;  3HHD A;  2WSC C;  4G6V B;  5CYJ A;  4PUO B;  4XPE A;  2AV5 A;  3ICL A;  2DRA A;  3FEY B;  4OI2 A;  4KBI A;  1N48 A;  1TAQ A;  4OYW A;  4Q8F A;  4OHZ A;  2RQ4 A;  2W4C A;  2EBE A;  2OPQ A;  2BM0 A;  4YOE A;  3MM9 B;  3MR5 A;  3SDE B;  3LOU A;  2I6W A;  4G3I A;  3L7P A;  1OYD A;  1A6L A;  4U8V A;  3LGH A;  2W7A A;  1L3V A;  1T0T V;  4YHH F;  2PDA A;  1X0P A;  2PFF B;  1WTF A;  3OLB A;  1IWA A;  4Q8E A;  3X1L B;  3H59 A;  3W7B A;  3RR8 A;  3NCR A;  2YNI B;  4UUW A;  1JNZ B;  2G2O A;  4CWB A;  3R3T A;  4WZM A;  1OY9 A;  2VAS A;  3Q8R B;  4J9U E;  3RB6 A;  2NRE A;  4ZPW R;  4C3L A;  3NS6 A;  5KFJ A;  7FD1 A;  1YX2 A;  3ILI A;  1MLA A;  2V67 A;  2ZZN A;  3ISZ A;  1O51 A;  1CJT A;  4KRW A;  5B08 A;  5G0R B;  4U7U D;  2I5J A;  3MI7 X;  1X8D A;  4MIW A;  3A12 A;  3KHH A;  2UXC F;  3P6Y C;  5ETN A;  4J9R A;  1DTT A;  2KRB A;  5GAD U;  1Y11 A;  1T7P A;  2AWZ A;  5B0E A;  3TA1 A;  4DX5 A;  2GVZ B;  4RNH A;  2HRT A;  4KJI A;  3DLE A;  1PYS B;  1HHT P;  4LRB A;  3T41 A;  1SV5 B;  1APS A;  2XMV A;  1RT4 B;  3NOG A;  3PO4 A;  4YR2 A;  3MAQ A;  2BQ3 A;  3DI6 B;  5C24 A;  3BO3 A;  4Q45 A;  1ZAX A;  2XZT B;  3A8E A;  5B09 A;  2B6A A;  3VF0 B;  4K2J A;  2RHQ B;  4URQ U;  4QYZ K;  4RW8 A;  4MIB A;  3NGD A;  5KFL A;  2QLB B;  4LFA F;  3V5R A;  1IXK A;  1S4F A;  4FS1 A;  1B7F A;  2UUC J;  2WW8 A;  4A8S A;  3M8S A;  4DV3 F;  3K0J A;  2EK6 A;  2Z57 B;  1TL1 B;  2YWH A;  1H38 A;  2Z2L A;  3IGV A;  3I4P A;  3NY0 A;  1ZZN A;  2Q79 A;  3GON A;  1LFP A;  4CM0 A;  2UUT A;  2XBP A;  2VPZ B;  3HKW A;  1F6T A;  4NRT A;  2DVI A;  4B9U A;  2X51 A;  4ZCL A;  2OO4 A;  3GIK A;  1MSW D;  3P45 B;  2X1F A;  5ADZ A;  1K0T A;  3G6E S;  3TOQ A;  3CCQ S;  1HI0 P;  1NK8 A;  5KG5 A;  3T1Y F;  2FZC B;  1S1V A;  3ITH B;  4N5S A;  2KT2 A;  4DF4 A;  5HVH A;  3HSD A;  3BF4 A;  2XGP A;  3BKU A;  4K4U A;  4I6W A;  2OD4 A;  3W60 A;  2QIF A;  4C7Q A;  2CFX A;  5ETS A;  1PBU A;  2DNZ A;  4X4T A;  1YBT A;  3TZX A;  1LWF A;  2ZD1 B;  4C9D A;  1TMM A;  3DKD A;  4ECY A;  2KYX A;  3GPA A;  3BV8 A;  3MM5 A;  2UUB J;  1WTB A;  1Q0N A;  3SV3 A;  3HHL A;  5LT5 A;  3CCZ A;  5J1P A;  1Q5V A;  3BSO A;  4DX8 H;  4LSL A;  2B4U A;  3PFO A;  2KXF A;  1IKY A;  1YQH A;  2QA1 A;  4M5G A;  3IO1 A;  4IR1 A;  2W4P A;  2ZIT A;  4NLQ A;  4PWD A;  5DZ6 A;  5GAH U;  2MQM A;  1YJV A;  3R9L A;  2D74 B;  2GAH C;  3BBF A;  1PIL A;  4ZVR B;  1G4C A;  1XJW B;  1U7L A;  3GYG A;  3LP0 B;  1N54 B;  1DZ5 A;  4OZL A;  4X4P A;  4MH8 A;  4O3O A;  2DGX A;  4HT7 A;  2RRB A;  3BH6 B;  3H42 A;  3I0R A;  1U1N A;  5B0G A;  2IMW P;  3D2W A;  3OQ2 A;  3C15 A;  4MIA A;  3KG0 A;  1LW0 A;  2QTW A;  3DRY A;  4RUC A;  2AJF E;  4UY8 5;  2H5I B;  1MU2 A;  3FBC A;  5B0F A;  2V68 A;  4EUV A;  3I5C A;  1RTI A;  2KM8 B;  2VG5 B;  5M2P A;  4H4K C;  5J2N A;  3MF5 A;  1JLQ B;  4DFP A;  5KG2 A;  3MPU B;  4JI7 J;  2QJ3 A;  3CXC R;  5J1E A;  3DM2 A;  1M5K C;  1MML A;  4AQY J;  5GVQ A;  1VLO A;  1NU4 A;  5H9F J;  3CJR A;  3R5G A;  4YB7 A;  2IY5 B;  4CLZ A;  2L48 A;  1XMO F;  2MPU A;  4RLE A;  2BKP A;  2B7B B;  3Q8U A;  3O44 A;  4B9V A;  3HX9 A;  1MWQ A;  2AJ2 A;  4I0W A;  1WF1 A;  3SMZ A;  2GHW A;  1PAU B;  1QJH A;  5HQ8 A;  3T1H J;  2ILY A;  4FPI A;  5LM7 E;  3Q24 A;  3CJ4 A;  1T94 A;  2ZNY A;  2UUA F;  1VFJ A;  5L9N A;  1X4F A;  5AT1 B;  1WHV A;  3J80 U;  3DRS B;  4WXO A;  5E5N A;  3PHT A;  3SZ2 A;  2BYC A; 
#chains in the Genus database with same CATH homology
 1RU2 A;  5ETK A;  3MCM A;  4PZV A;  4CWB A;  3HD2 A;  1RU1 A;  4AD6 A;  5ETR A;  1HKA A;  5ETQ A;  4M5K A;  1EQM A;  1RAO A;  1HQ2 A;  3HD1 A;  3HCX A;  3ILJ A;  5ETS A;  3HT0 A;  3MCN A;  1KBR A;  3ILO A;  5ETM A;  2F65 A;  3UD5 A;  1IM6 A;  3HSD A;  1TMM A;  1G4C A;  5ETO A;  4M5L A;  3KUG A;  5ETP A;  4F7V A;  2QX0 A;  3ILI A;  5ETN A;  3HSJ A;  3UDE A;  1RB0 A;  4M5H A;  4CYU A;  4M5G A;  4M5M A;  3MCO A;  3ILL A;  5ETL A;  1EX8 A;  3KUH A;  3IP0 A;  3QBC A;  5ETV A;  3KUE A;  5ETT A;  3HSG A;  4M5I A;  4M5J A;  1DY3 A;  3UDV A;  2BMB A;  1Q0N A;  2F63 A;  4CRJ A;  4CYU B;  1EQ0 A;  1CBK A;  1TMJ A;  3HSZ A;  1RTZ A;  2CG8 A;  4M5N A;  1F9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...