4OV6A

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4ov6A01
3H42A 3WIVA 2W2QP 1SPBP 2Z57B 3VV2B 2W2NP 3A3NB 2W2PP 3WHIA 3VHQA 2Z30B 1V5IB 2Z2ZA 3A3OB 3CNQP 4JP8A 2PMWA 2ZWPA 2Z2YB 1SCJB 2W2MP 2Z56B 3A3PB 4NMXA 2QTWA 2Z58B 2W2OP 2XTJP 1ITPA 4K8RA 3SQOP 3GCWP 3GCXP 3BGOP 3WIUA 2ZWOA 1R6VA 3P5BP 4NE9C 4YN3B 3T41A 3QFHA 3CO0P 3AFGA 3BPSP 4OV6A 2E1PA
chains in the Genus database with same CATH superfamily
1H2TZ 2LYVA 1LXJA 3QQCD 1Y0HA 4DR7F 2HQIA 2J7KA 2VPYB 1HR0J 2DGXA 2ADBA 1XR7A 2OTLS 4QYZK 3D6MB 1KWMA 3HHDA 3VAIA 2Y1JA 3M8RA 1F5AA 3G6VA 2K1RA 4OX9F 1JLGB 5LSLA 3I9V9 1LFWA 1Q8LA 3VHQA 2RF2A 1S9EA 2YWEA 1NLKL 1J5OB 3GWCA 2C3YA 1FKOA 1N88A 2OHDA 2J7WA 4KHMA 3SQGB 1FKAF 2VG5B 3UD3P 5I3UA 3MWBA 4QWEA 5AE3A 4LVOP 3Q8PB 4CTAA 2QA2A 3T9ZA 1WHWA 4K7QA 4M5GA 3LANA 1OPIA 3GB0A 1IM4A 4NXMF 3D67A 2OPQB 1IUJA 2V8HA 1NJYA 3B6BA 1YQHA 3HHNB 2XSFA 1U0HB 4M94A 3ZTOA 3QMQA 4DU7A 2HZAA 4MIWA 2RH3A 2MQOA 2W8LA 1T05B 4LF2A 4ED5A 3CCMS 3W8PA 2BW7A 3EZ5A 3JTOA 4C4WA 2I9SA 1C1CA 4HL9A 3LP2A 2J9DE 1EAYC 2GAHC 5D4OA 5KOWA 2Y1LB 2YKOA 2RDJA 2EWHA 4F4AA 1M5OC 3I6PA 1DFDA 1R3NA 5CYMA 1VJQA 1N34F 1XQIA 3RR8A 3CJ4A 3GE9A 4DJBA 2J5AA 2UUAF 2QLJB 3FRYA 1U1QA 2OH2A 5F8LA 2OPPA 1ZZFA 1UJ5A 2HEKA 4IRDA 1NK4A 2F65A 3FCHA 3ZTRA 4QWCA 5KFXA 4LF9F 3UFCX 2U1AA 3HHLA 1WC3A 1IR0A 3IXQA 2JLGA 2HHSA 4O23A 3RRKA 4DV0J 1U1PA 1L3VA 5D6GA 1RT6B 2W1BA 2BUNA 2XM3A 1Y7PA 4F8RA 4WU2A 2ZD1A 3FDSA 1NXIA 1HPZA 4LMZA 1N48A 2VDHA 4J9KA 1GAOA 3KDNA 1HNVB 1IKXA 3UD4P 1WELA 2AX0A 3KUEA 4LREA 4RW6A 4KV8B 2FVCA 4FKXA 4C3KA 2MLZA 2CQDA 4UT4A 1IBLF 3FQKA 4QU7A 2GVZB 3AXKA 2LU2A 2W9BB 4DR2F 2R2SA 1FXLA 3HHKA 1EARA 4KFBA 4OZ0A 2V4QA 4C3LA 2AW0A 3DOLA 3SSSA 3MM5B 1S1VB 2NXJA 3G6ES 2YY3A 1FVSA 5J2MA 2L48A 1VIXA 5EN1A 4WK3A 3T1YJ 3NAIA 3C46A 1RKIA 5DQGA 1S57A 1VC0A 2X51A 1VBZA 4J9LA 2W7OA 3ZXWA 3KUGA 2JJ4D 4UOGA 4F3OA 1Q8IA 2R8HA 2P5VA 1T94A 4F2RA 5J1EA 3IG1B 2QTWA 5KAKA 1FEHA 2F4FA 3D0IE 2UXBF 3N9UC 3RJMB 4E2FB 1QVGR 4C3MA 4DQRA 3DRYA 1F2HA 2P9EA 2G9OA 3N0VA 3EVOA 1U2RA 2NXCA 4ZVQB 1I5OB 4ZVEA 5L9XA 1IQTA 1NHKL 2E9ZA 5JUMA 2HAFA 3KLEB 4F4KA 2EI5A 2MQ8A 4ZP6A 3HI9A 2CWXA 2FHJD 1NHUA 2IRXA 3PDNA 2XULA 1R0AA 1S0NA 4ZKAA 2GMHA 4RU2A 2B7BB 3UI3A 2CPEA 4NI2B 5GAGI 3I5CA 1D8YA 2HBQB 3FSIA 1TQLA 4OHYA 4N7TA 4YDXA 3G8QA 3CIMA 2FDNA 1BD6A 4LF5F 1UVIA 2L9DA 3DRRA 1F9FA 2F4VF 2V9KA 5M2PA 1DTQB 3FCVA 4LSNB 1RT3A 4DV6J 4CT8A 1LWEA 1RISA 3U7JA 3O5TB 4CCHA 4RUHA 1Q8KA 2AJ4A 1JLAA 3TA0A 1YKWA 3D7SB 1B3TA 4ECWA 3CCVS 4OYBA 3MAHA 1CSJA 1X9MA 2BM0A 4LF4J 1UA0A 1VQPS 4MTPA 2YTCA 3I87A 3MOJB 3I55S 3VAJA 3KLVA 4F7VA 4M5KA 1BLUA 5GAHI 3K2YA 3RB3A 1TAUA 2KI2A 5GMEA 3OLBA 1RYRA 2FLNA 3TQ1A 4UY85 3GR1A 4TQRA 4OHXA 3C6TA 2R8GA 2V67A 4PABA 1U1NA 1PAEX 3MMAA 4ETZA 2QMXA 1Y5LB 4M5NA 3K8VA 1RWVB 2J9EA 5A8KA 2HGLA 5HVGA 2VASA 4KTQA 4KHPJ 1XMOJ 2CZ9A 2RS2A 4ED1A 2GV1A 2HBYB 4QIEA 4FXVA 1JLEA 4DR1J 1SL0A 1QTNB 4LFBJ 1EP4A 2KT5A 5DRKA 3H2LA 4DX8H 3T5HA 2D41A 1FX4A 1PKUA 3RR7A 2AT1B 3M2VB 4RW9B 3CIZA 1MU2A 4X66F 3PFEA 4U96A 4DV4F 2LQJA 3L4BC 3PTWA 1SUQB 2ACMA 4KH1B 3CE8A 5KFDA 2OFGX 5HMXA 2GJ2A 1EKRA 3AJDA 1FXRA 1OS5A 2VH7A 3N6NA 4F3MA 4W90B 2W7PA 5D3GA 1FJGJ 1UCNA 3MPWA 2IHR1 4MKAA 4RBVA 1X31C 4C11A 4HTJA 2BABA 2XWYA 4NASA 3PJWA 2QC3A 4IDKA 1HNWF 3D9BA 5ETRA 2MDAA 1ZAVA 2G13A 4CM2A 2MQPA 1VHFA 3TNVA 1VCTA 4UOCA 3D0HE 4M5DA 3CT9A 3PG9A 3M8PB 3D6HB 1RKJA 3SDEB 4F50A 1NB2A 2BJ1A 3ZZ0A 1H38A 4OZJA 4AD6A 2F8EX 2MLXA 1YLXA 5M2RA 2N3LA 1NDCA 2MQLA 2W24A 2BRLA 3IM9A 2E66A 4P2MA 1N8RT 4BDPA 3SMZA 1OQ3A 4DHVA 1QTMA 4ER8A 3J81Y 2DR9A 1ZOTA 2BBEA 1PYSB 3MXHP 2VQEF 4IH6A 2QLWA 4PG7A 5DETA 3DLGB 2Z2LA 5KG4A 2HNYB 2P2CB 5T14A 5KFRA 2FHOB 3H2VE 3TX0A 2LEPA 4PXBA 4DR5F 1W7WA 3GIRA 4ZOSA 3KK3A 1VISA 1OYDA 2JEJA 3EGVA 2VV5A 3AH6A 5C25A 1C4CA 2M52A 3EGZA 1S1UA 1ZPWX 3HSDA 4ED8A 2XC9A 4HR2A 1WTFA 2P9CA 1AT1B 1YK9A 3I56S 4GO5X 2VA3A 2CJBA 3S1TA 2MY7A 2ILYA 3HKWA 3E01A 4P75A 4ZDNA 2Y0BB 2KG0A 3NGUA 2D3O1 2X1GA 3KJFB 4ZK7M 1FWPA 4DR6F 1KHWA 3BV8A 1N52B 3H4BA 2JLFA 3SI8A 1Q8BA 1PGZA 4B9LA 3SCJE 1R8PA 1BWVA 2EFOA 2CIMA 4EYIB 4WP3A 4ED2A 2LEAA 1TKZA 2O3DA 2GS8A 2RVJA 3AY0A 4JBCA 3ZO7A 4ID5B 2WSCC 3WC2A 1HI1A 5AE2A 5IZHA 1T9WA 3JXOA 2UU9F 1TL3A 1FF2A 3J7Z5 2QRRA 3BQ2A 3Q8RB 1HNXJ 4PYDA 4H54A 4I2PA 3TX8A 2E5JA 4O3OA 3V4IB 3MF5A 2YXLA 2BVZA 2XMJA 2ZE2B 2XZDB 3PYFA 2OEJA 4C8ZA 5B09A 2XS7A 1A7GE 4G6VB 3MM8A 4F25A 4I56A 1FJCA 5EWFA 3CMAS 4TLRA 2FYXA 1RHRB 3R5AA 3C16B 1SKWA 4IG3B 3BKUA 2M0GB 3CJ0A 3P4UB 3DOMA 1PYTA 5CCLA 1RT2A 4N47A 1BUXA 3KLHA 1T3NA 5HMZA 1T9TA 1CJVB 2C2EA 3J7YU 2O01C 2EC2A 2V5HG 2APOA 1WHXA 2HHHF 2G2YA 3D1HA 1NSPA 4U7UD 2UUCJ 3ISZA 1RTZA 5AXMA 2A0FB 4ECQA 1AZSB 2I5JA 1TK0A 3HVTB 3OFHA 3TVKA 3NL0A 2HHWA 3OQ2A 3JQJA 1X4CA 3QJJA 2VC0A 5HAOA 1MROB 2DPIA 4USJC 1K47A 1R0BG 3QGGA 2VG7A 3NBPA 4R8UA 3KLFB 4W4MA 4QYZJ 4DQPA 3QLHA 1CJTB 3Q8SB 1U1LA 4K4VA 3PY8A 1I94J 3EXCX 1KS2A 5K14B 2ZBIA 4CIOA 3W64A 2MKHA 4IFYA 5A6PA 3PIOQ 5C24B 2CPDA 3R6LB 4IRKA 4RKUC 5ETMA 2FJEB 3BSOA 1ROFA 5DDOC 4B3TJ 2ASDA 3R5CA 3GP9A 4WFBQ 1Z2ZA 3BQ0A 1FA0A 3KJNB 4NA1A 2JL9A 2QA4G 3KHGA 2AGOA 3ICLA 3MHYA 2Y9HA 4IUFA 2DGWA 3CNQP 4CLYA 2XZWA 2NCKL 4DDFA 1VQ5S 3OLAA 1UPMB 3NNCA 4OX6A 4DR7J 1PCAA 4ZVUB 3HT0A 3W1YC 2XZTB 4A8MP 2A2DA 1K9MT 2L9WA 3WHIA 4OX9J 3KHHA 4OV1A 1RDRA 4DPYA 5KG3A 4PUOA 1FX2A 2XO7A 1FO1A 3CJQA 2DHGA 2ZKUA 3UCZP 5L1LA 4EBEA 3M6UA 3RBXA 3PVXA 1GT8A 1QAXA 4DI6A 1DAXA 3KG1A 2XWXA 2G2OA 4HACA 3UPFA 5HP1A 2IJFA 1S5ZA 4QIVA 5KFWA 1PC5A 1VBKA 1VJWA 4ZVRB 3BPDA 3H40A 4ZCIA 1YVFA 4EBCA 1MWYA 2IDEA 4KRWA 1DHMA 1LKZA 4NXMJ 3ET6B 1TV6B 1DLOB 2WB1D 2RRAA 1X9SA 3R2DJ 1GMWA 3CJ8A 5KT7A 2QN6B 3RGIA 5K9FA 3G4SS 5KFJA 1JNRB 4FKYA 2PDAA 1FRHA 1Q53A 2CG4A 3MEDB 3UN3A 4CRJA 4HDHA 4WF9Q 3N28A 2PA8D 2E5LF 4CO5A 2FVRA 1LW0A 3S01A 2XTJP 5C42B 5ETTA 4AYBD 3CDWA 3UN2A 4P7TA 4OYZA 4JI8J 4ZPDA 1HQUA 4J9VA 4LQ9A 1EETA 2AIRB 1U7LA 1XNRJ 2QYGA 1DTTB 2BE2A 1N34J 3QZ7A 4DR4F 4MIAA 2G0IA 1N5SA 2OMLA 2UUAJ 5G0RB 4ZCMA 5MLCV 1SIZA 3OVBA 3M30B 5CD4H 2IRYA 3J7AN 1UFWA 1FJ7A 1IKVA 3BN7A 2F63A 4KGMA 4ZITA 4HI1A 3F0NA 2UXDF 1VS3A 4GC6A 3VF0B 1KKHA 3HD1A 1D8ZA 1TK5A 4HH1A 3H0PA 1NJIT 2D1CA 4EI2A 3LUYA 3A4TA 1H6KX 4CLZA 1TKXA 4ZJLA 1R0CB 2MHNA 1S7HA 2MMYA 2ZBQA 2H3EB 4FBUA 1U0SA 2ZEJA 1OQ6A 3A3OB 5HROA 2Q66A 2BM1A 3SZ2A 1FRMA 4M5MA 3EJMA 1N6QA 3MD1A 1U8WA 1T7PA 2BOPA 2VICA 1SKUB 2AX1A 3P8BB 3CO0P 1R8AA 3DOKA 1P9YA 2QLFB 2IVMA 4NCBA 4RWWA 3GQCA 3RAQA 2KFYA 2IA0A 2DT9A 5T7LB 2RILA 2IM1A 2WB4A 1WEXA 1PBUA 1IBLJ 3G82B 3SQOP 4U95A 2MSTA 5KFNA 2B9WA 3D3CJ 2OD4A 4LFAF 1HBNB 3TR5A 3R1HA 4DR2J 1WJ9A 2WSEC 1X8DA 4X4TA 3CTRA 1L5UA 4G65A 3HHEA 4B9MA 4YY3F 4HVZA 5D0RA 2ZM6J 3W2VB 3BSNA 2HBZB 1VQOS 2A3JA 2AJ2A 4BCAA 2E1RA 1YDLA 1JLQB 5C2CA 5H9EJ 4CH7A 3PW0A 5ETPA 4CWBA 4NL5A 3MUMP 3EUNA 1XNQF 3PFOA 5K8OA 2FVQA 2AGPA 4A8XA 2DJWA 5E5NA 5JJBA 2B3TB 4RJVA 3NOGA 2E5IA 2ZH1A 1EX8A 3Q83A 2DCUB 2AF6A 3I5AA 4OJ3A 2XNRA 1WDDA 4WJBA 2HS4A 4YR3A 2YNFA 4JI4F 3NS7B 4NXNF 2DIVA 2FJVA 4WZQA 2B5JB 1LW2A 2CDRB 3PYDA 1HMVA 1RT5B 2CJKA 1GQEA 1B0PA 1SB6A 2K3IA 1FE4A 1UJ6A 1UVMA 3H98A 1UA1A 3SXLA 1Z2LA 2F1FA 1FFGB 2QJ3A 2RS8A 3BO3A 1MWZA 2OIHA 2PI5A 5KOXA 2ATCB 2HIYA 1NJXA 3NMRA 4HEA9 3DLEA 3TZYA 1HBMA 2E5HA 3UCUP 2KT3A 4LRBA 5F8JA 2YKMB 2UVWA 1SPBP 3DXBA 4CYUA 2WVDA 1KOOA 4X62J 2IDLA 4ZHRB 4K0KF 4ECZA 3K7RA 1U1OA 1RADB 5HANA 3NGDA 3LP0A 3KK1B 2IAJA 3AA9A 3C3LA 5HBMA 3G86A 3KLIB 4J9MA 5CYJA 4ILLA 4YR2A 1TKDA 1YJRA 1K8AT 4C8NA 2GQQA 3FBEA 4USVA 3NWGA 3W3SA 3RU0A 4ECXA 3H42A 4DL0C 4LSLA 3NOCA 2QLBB 4MKYA 1SJRA 4L74A 2ZVSA 2W9CA 4TY8B 3EZUA 3IP0A 2FY1A 1JJHA 3MI7X 3M9MB 2C22A 4FYWB 5DG9A 5G4DA 2R2RA 2GHWA 4CI0B 2ZHOA 5KT3A 3BS9A 3A8JA 1UMJA 1XTZA 1D3WA 2ZOMA 2C3PA 3JQMA 2AYBA 2OKQA 2QA4S 3ZNUA 4WCEQ 1XMBA 3RG6A 5J2PA 3B78A 3MM6A 4ECTA 1HWUA 2FVPA 4A8OA 2AV5A 5A8RA 2MY8A 5KFHA 1HQEA 3V6DA 3R3TA 2KJWA 3VVTA 3OR2A 3KDOA 4ICLB 1F6TA 1KDNA 2UZAA 1SL1A 4DL2A 1NO8A 4XIUA 3ZZRA 4D3HA 1VRUA 2YQ3A 1UP1A 1YG0A 3B4DA 2E1AA 4I69A 1YRTA 4QZVB 4X66J 1KTVA 4DV4J 3OJUA 3KTQA 1QLNA 4X4RA 5D78A 3FBFA 2RU9A 2HYIB 1RA7A 4WP9A 3PKMA 1UVJA 1SJ1A 3NKYA 1O6XA 4KO0A 2W2NP 1FDBA 2E1MC 2R7RA 2YWGA 1RAGB 3R5DA 1MMNA 2D7SA 3JS9A 2YWFA 3T19A 4I6AA 4RZRA 2MKCA 2C2MB 3M2UA 2IM3A 5F9NA 2RNEA 2KXNB 1M5PC 2OP5A 2GO9A 1SJQA 4IH5A 1RWWB 3FEYB 2XYPB 2BJEA 1JLBB 3W5XA 2X1AA 4NYZA 4BBYA 2BW2A 1R6YA 4OZ1A 5CYQB 3DI6A 2BDPA 1XR5A 4UQTA 2VBWA 2EFPA 4DV7F 3T5JA 3BSAA 4F4XA 2C28A 4EBDA 4MKBA 4RW7B 1FDNA 4N5SA 4QQBA 2VQEJ 3MZIA 1SJ3P 2A2CA 4I4BA 2M4MA 4C8KA 1MN9A 2B6AB 4PQUA 4DZDA 2HS3A 2Z0GA 1T9VA 2WONA 3ELHA 1RTIA 3S6EA 4DR5J 2J0QD 5ETSA 4X65F 3DRXA 2DVIA 3MURP 4J9SA 2RD5C 1BXNA 1HBOB 4CO1A 1X9WA 3K5LA 5DJBA 1UFKA 1HNIA 1LV5A 2DNRA 3PW2A 4DG1A 2V4RA 1RWPB 1S1TA 1FT8A 4DN9A 2N7YA 1ZM2A 2Q3PA 2HNZB 3QWPA 1HWKA 1BGXT 4DX5A 3N5FA 4JB8B 3AOCA 3BGRB 4C0HA 2GJFA 3G8SA 2KM8B 4HLBA 3F73A 2BANB 2R8IA 5E2QA 1SJ4P 5K8MA 2WSFC 4DR6J 5I3QA 2FZGB 2ADCA 1HBUA 2RQKA 2IM0A 4EO6A 2EFVA 5LMNF 4N76A 5SUHA 5J2QB 4DZ6A 1SL2A 3MEGA 2ACYA 1J2VA 4TU8A 4CT9A 3F41A 1J5OA 2R7WA 1J5EF 3IWNC 2Z58B 4CLLA 2BOAA 2VG6B 4P73A 5JVGQ 3FQLA 5DO2A 4A4JA 1KRPA 5KT4A 1FD8A 2IC3A 4YR0A 2VPXB 2FJDB 4USUA 4IR9A 2A18A 4NCGB 3W5ZA 1H2UX 1TL7A 3BM7A 2WAQD 4Y2IA 1UWAA 3I0SB 1WC0A 2V68A 4P9SA 2OEMA 3M8SA 3Q2TC 3WIVA 2Q6CA 2W7AA 5KFKA 4O4GB 2CQGA 1IKWB 2F9JA 3UN5A 5HO4A 2FHKA 2QGFB 1NJWA 1S99A 1U0HA 3VAHA 1QM9A 4NLGA 1Y00A 1U2CA 1KTQA 3G8TA 1KONA 3LPEA 4A8YA 2VBXA 2ZBPA 5EX0A 1I6JA 2OMOA 1MWQA 3DXSX 3RBZA 1LK7A 1URNA 2FTRA 4E0DA 2F7VA 4ZCLA 1WTBA 1N33F 4O3SA 2HRUA 4JI3F 2HHHJ 3HKZD 3IGNA 3JAMU 1NK9A 2M9KA 1REVA 2WOMB 4AXIA 3M1VB 1S6PB 2YNHB 1RYSA 1WKJA 1X5TA 3GYXB 3D28A 2C2ZB 2DNNA 4DPXA 5HLFB 1BWEA 3HSJA 4IFVA 3QO9A 4O3QA 4KHRA 4OYXA 4WYWA 4DXLA 4C0BA 2O66A 2EVZA 4ZA1A 1JB0C 1W26A 3BGFA 3NLCA 2KFNA 5E41A 5IM0B 1XWLA 3GIMA 3WDOA 1CEZA 4P74A 1KQGB 1U4BA 2UVUA 1S10A 2K06A 2GIFA 4OLOA 1S9FA 3UCGA 4Z7CA 4LF8F 5ADZA 4WP8A 3DRPB 3EICA 3EMTA 1VBXA 3H2UB 3POTA 5DDPC 1JLFA 4X4NA 1HQ2A 2MXYA 4YHHF 3HX9A 4DCJB 2YPZA 1WEYA 4GKKF 4EZ9A 4OZ2A 1VOMA 4AUKA 2C3UA 1IBCB 4KV8A 4I7FB 4DV0F 4HH0A 1Y9OA 2VFSA 2YKNB 5IT4A 3FVYA 3WC0A 4OI6A 1TAQA 3D54A 5I42A 4DBQA 5EUHA 1UW9A 3OFFA 2VA2A 1AUSL 4XDDA 1ZAWA 2BXJA 2FLPA 1SKSA 3CJ2A 1VQ7S 2ZFHA 1U02A 1ZM4A 2DH8A 2RRBA 1LWFA 2E44A 1WC6A 1IVZA 4MKVA 3W9HA 3VWSA 3R7BB 1YWXA 4BHQA 2GJIA 1JLCB 2XEXA 5KG0A 3IBWA 4K4SA 2R2TA 2GVDB 3OR1B 1L3UA 4PG5A 1BQNB 4O4RA 1U6ZA 1OMSA 4LBPA 4EGLA 3CCQS 1JXEA 2WVCA 2HK2A 1HNZJ 4IG0B 1F5CA 5F3ZA 2CQIA 4S0MA 1SC6A 3LA0A 2DB1A 4RWXA 1FTRA 1CVJA 1F5BA 5BXIA 3T5LA 2L08A 1YJWS 4Y00A 1N0VC 1BQMA 2K7KA 1D9AA 2E1PA 3UE2A 4J37A 1C0TB 4BWMA 5KFEA 4KKOA 2KU7A 5IV3A 4MK8A 1F60B 2AWZA 2ZHAA 4EWTA 1RLDA 3FJ2A 3HULA 4Q5VA 4J9NA 5GADI 5A8WB 3TZXA 2NZ4A 3GSIA 3DLBA 4ELVA 1YJ9S 3W63A 4DR4J 3SBMA 3QZ8A 1JJ4A 1Q5YA 5D4NA 2ZC3A 1WSVA 2Z57B 1VFJA 3P49B 2FD2A 3A8EA 1R31A 2Q43A 4DWIA 2K1RB 2R7SA 3QSYB 1Q5VA 2M8DB 1E6YB 2RF2B 1S9EB 3TO8A 1M1HA 3EXYA 1FKOB 5H1SV 4A48A 1JQGA 3KK2B 2K7JA 1KHVA 2AD9A 3GILA 1B64A 5I3UB 2CAJA 2V9WA 1X7VA 4CTAB 4IQXA 5AXKA 5JXSA 4AXJA 3OL8A 1TVRA 2KRRA 5F8NA 1X60A 4DV6F 3GJQB 3T1AA 3B8HA 4QIWD 9RUBA 1WC5A 1P6TA 3Q2SC 1S1XA 2P6TA 3VQSA 4DV1F 2RDIA 4BS2A 4PXCA 4QPTA 2JZ5A 1V5VA 3WIUA 5DZ6A 4R5PA 2Z8QA 1WDTA 3Q8YA 4KIAA 2E7XA 3VCDA 1DBDA 4LFAJ 1ACMB 5FD1A 4LQ3A 1B70B 2HVDA 1C1CB 4YY3J 3BF4A 3LP2B 3MMCB 2E7VA 4ED3A 1TMMA 1F3FA 3U1MA 2DHXA 4M5HA 2B8QA 3T5KA 3BDEA 4OHVA 4UZCA 3CXCR 3VAGA 3M2VA 5HI7A 2F9DA 4JI2J 3IR5B 5CYMB 3RRHA 3O3LA 3HT3A 1XNQJ 1XMQF 2YWHA 1XMOF 4OMFG 4I68A 3OT9A 1YBAA 4FF3A 1SC1B 1M5KC 2FZKB 4O44A 3GMGA 2MPUA 3ENAA 4NLQA 1LWCA 1ZM3A 4DL6A 1OY8A 3JSYA 4LFBF 1Q78A 4MFBA 4NXNJ 5AXLA 3HHLB 3L9ZA 3O1LA 1T03B 5B7WA 2RAQA 4RR5A 4NRTA 1VBYA 1C0UA 4FNHA 5B0CA 2AEFA 4CNYA 3CPWR 1EQ0A 4K4WA 4CO0A 1FFSB 4DX6A 5IS2A 5DDRC 2C1EB 1CJUB 3HPOA 4AL5A 1HIYA 3S7RA 3UO0A 2ZD1B 5HJXA 2XGPA 1HPZB 2WK4A 5E3AA 1KLNA 1FNXH 2K3KA 1RTHA 3H25A 4UF4A 1X0PA 4TN2A 1QJHA 4C0OC 3SV4A 2ZZNA 1FJGF 1NSQA 5D8HB 3W66A 3TUPA 1HKAA 3BB5A 4F02A 2XCPA 2NYHA 4K0KJ 3DDNA 2HNYA 5A6WA 4X4UA 5GAGU 3I96A 4LRFA 4KFBB 1VHIA 2DXFA 2CFXA 5KFTA 3K5MA 4GRSA 5T41A 3DOLB 3EPGA 2CPIA 4EO8A 1KP6A 2MYFA 4JI6F 5J2MB 3R6GB 3V81B 2FC8A 2N7CA 5F8HA 2Y1RI 1W2BR 3CCRS 3AD8C 4FF4A 2MQNA 3BBFA 5F8GA 2MKIA 2PI4A 2P8IA 1WOOA 5FJ4A 4DMZA 3L7PA 1VI7A 1WI6A 3CUNA 1RWKB 3RAMA 1MNEA 3GCWP 1ULRA 3PEJA 3SSQA 2CPFA 2CNOB 4OYMA 1AROP 4WFNQ 1CPZA 3J80U 2HHVA 4KGVB 2I38A 5GAHU 3MTKA 5ETVA 4ED0A 2MTLA 2HFOA 4NEZA 3CCWA 2HQGA 2J7UA 2BE7D 3N79A 4W92B 4DS4A 3LP1B 3C6UA 2K8GA 4YB6A 2LDYA 4HI2A 1ZAXA 2IIHA 2ZWPA 4C8YA 1MN7A 1R0AB 2JVOA 3V6JA 3WZ0A 1I51B 3PX6A 2MJNA 1U6FA 1T9YA 4MJKA 3V4IA 1SXLA 4H4OA 2B8PA 3C14B 4ELTA 4RLEA 4K4TA 3CMES 2B4UA 5H9FK 1V9OA 1K1QA 3E8OA 5EDWA 2EW9A 3IS9A 3DRRB 5FDLA 4J9QA 3DN9A 4IG3A 4AE5A 4L6V3 2DNGA 4UTGA 3FEXB 5F3TA 1RT3B 2GFFA 3IA0A 1LWEB 1TZ0A 1D9DA 1FJEB 4GKJJ 2B9YA 3CSKA 1HNXF 2OPRA 1JLAB 1NSKL 2KZZA 4TKTA 1UEKA 1GTEA 4DSEA 1Y10A 3PW7A 1KVJA 4XTTA 4HYKA 1NCLA 3H5XA 3K5NA 4IO9Q 3OL7A 2EK6A 1YX2A 3HVTA 3CO9A 3BR9A 3DHXA 4OQJA 4V19X 1VQ4S 4B3SF 2N4CA 4Q7AA 3RUBL 2FJAB 1ITPA 1RLCL 2ZNZA 3CCES 3E2EA 3MMJA 1JJCB 1RAIB 2JFDA 3MMAB 1RE1B 4QWAA 1DURA 5A8KB 3PRBA 5E3CA 4NMXA 3HHLD 4L3KA 3BQ1A 2LXIA 1T8EA 1CJTA 3LALA 3PV8A 4F04B 4KYZA 1JLEB 2ZH6A 5IXUA 2PGCA 3RW7A 3VTIA 1UPPA 1EP4B 4UUXA 2CJXB 4PYAA 1Y11A 2DR6A 1B7FA 1FFWB 3I4HX 1MU2B 1OWXA 4ECYA 3MECA 4QCLA 3TP2A 3CDEA 1I94F 4I2QA 4J9PA 2JEFA 4ZVOB 5J1PA 2HVZA 1Q7LB 2ZZMA 1MLAA 1T11A 4MT1A 4C6AA 2VKZG 2GMLA 1VQLS 2KH9A 4A8SA 5D3GB 2MKSA 3MEEA 4DL4A 2JSXA 4Z2XA 5LMNJ 2JVRA 2P9GA 1TFWA 3OPKA 1S0OA 2HS0A 4C11B 4OX7A 3A8KA 2OTJS 3EDQB 4IDKB 1UVKA 4DUYJ 2X3GA 1UVNA 4A46A 1J5EJ 5ETKA 2LQ8A 2DPJA 1IJEB 4M5DB 3P3DA 2F40A 2WCXA 3T3FA 3DM2A 2G1HA 3CDUA 2H48B 3PR5B 4M1KA 4F0HA 3K0JA 5LXRA 2LU1A 2HFVA 3MCOA 4PWDA 5E3QA 1ZETA 3OV7A 4NOHA 3ET6A 2W2OP 2EFQA 3GV8B 4JYAJ 2CADA 3M6VA 1M1GA 4B3MF 2AQ4A 1W25A 3DYAA 3IR7B 1YZ7A 3I5BA 2VKRA 3QAEA 3MM7B 5C25B 3C19A 2HQFA 3MEDA 1S1UB 4N56A 1BC6A 3G96A 1O8BA 4RNOA 4K2JA 5D0GA 3LH2S 2FHMA 3O2IA 4Y65A 3IBCB 3DLHA 2MB0B 4FYVB 1X4EA 3D1QA 1KN6A 1QE1A 4O0NA 1N33J 2DNHA 2NXUA 2JRSA 5D4LA 1H98A 4JI3J 2VFUA 4FZVA 1U48A 3LO3A 2DY9A 1N54B 3BR8A 2C2DA 1H73A 3E01B 2UVRA 1JXVA 5HMWA 2BKOA 4ZVHA 1QSLA 1A0OB 2UUWA 5HQMA 3LOUA 2Z56B 3GCXP 2JH3A 1H3DA 1WC1A 2ROEA 5LT5A 1FRXA 3RB0A 3TZWA 4Y2KA 4F26A 3N01A 3C15A 4YEAA 4RUBA 3NNHA 3NGRA 1KEKA 2B43A 2V63A 3P5TL 2VZ9A 2GAGC 4JI8F 4A8KA 4A8WA 1TKZB 2R7TA 2VPWB 3GZ7A 2GHVC 1XNRF 2BJ3A 2DEIA 4LF8J 2VB6A 1FHTA 1QAIA 2GX8A 1TL3B 1TUVA 2XMWA 2CRLA 3D0GE 1T95A 4YB1P 4I2PB 1L3SA 4YHHJ 4ZS6A 5ITHA 5AXNA 5F8IA 2MZQA 3OUYB 2M70A 4GKKJ 1S1WA 3MM8B 2RQMA 4B02A 2YNIA 3GR0A 1I1GA 4QWDA 1WKLA 2X7IA 4KH0B 4PKDB 5B0GA 2XLIA 1GK8A 4X2BA 3DOMB 4YS2A 4PEOA 3KLHB 4C97A 2RHSB 3OXLA 5KFCA 2UP1A 2IYIA 2M3DA 3CMQA 3W2VA 1YBUA 5K8PA 4Q8EA 2GNKA 3DLLQ 2Z2ZA 4IOCQ 2HZCA 1TMJA 3X1LB 3E51A 3UVJB 4CQ1A 2QFJA 3TJAA 3WX8A 2OLWA 4DX7A 3MAAA 3ZZTA 4FNIA 1M5SA 2W4CA 2MGZB 2QZ8A 1UZDA 3MPDA 2ZM6F 5BYRA 2VG7B 2ZOGA 4OYAA 1N4LA 1FWLA 5CHCB 3NBPB 4R8UB 4L72B 1PJ5A 1YZ6A 4X64F 4CP5A 4KE5A 4KPCA 2V8PA 4WTYA 1RWMB 3OTCA 1VK3A 1EHWA 2QSFA 3FEZA 1NMEB 3FUYA 4ZVTB 1RP5A 1X5SA 4ZP7A 4FF1A 1GH8A 5DDQC 2I2YA 2VPZB 3OXFA 2PFDA 2XBPA 3D3BJ 1H2VZ 1CC7A 2YX4A 3G6YA 3MFIA 1T3OA 2AMCB 1S59A 1FTCA 4NMLA 3V5RA 1J27A 4TXSA 1SC4B 1AB8A 1L3TA 2MKJA 4XDCA 1VQ8S 2ZUGA 4J9UE 1QY7A 1FDDA 4WE1B 1CQNA 3R7SB 1BMQB 1X4FA 2KHCA 4F0MA 2D3UA 4BWJA 5H9EK 4GMKA 3L7UA 2M2BA 3FBBA 4XO0A 3O6QA 4HDGA 1T9XA 1T02A 3FZBA 3BPSP 2C2RA 4JI7F 2G1DA 4PUOB 1M90T 5CAAA 2F3JA 5M2UA 3JAMY 2DR5A 2WW4A 4FS2A 1PSDA 2Z2MA 4QW8A 3HZGA 3HO1A 1K0VA 2DGSA 4PPZA 1ZBTA 3QFHA 4X62F 2KTQA 2KJVA 4HACB 3M8QA 2IJNA 4K4UA 2RB7A 1B0VA 3HJFA 2OPSB 3KWMA 4KSEB 4NE9C 4HT5A 1DY3A 4ZVPB 1OSDA 3D66A 5CD4A 1F0XA 2HWHA 2C2OB 5ETOA 2YQ1A 4ECSA 3W7BA 1EIYB 1TU0B 4DV1J 1VMBA 1SQGA 5B08A 2HAIA 1RT4A 1S76D 1S4EA 5L1KA 3BKTA 4NLXA 2EEYA 2JEIA 1X5PA 3K59A 4QR2A 3I0RA 1TELA 2HLUA 4OZNA 4IH7A 3DGPA 3J7A1 1HYSB 1LW0B 2B4PA 2RHQB 3NCPA 3LW5C 3SEOA 4PRFA 1IR2A 1YJUA 1ICEB 5JVHQ 1SC3B 3FK4A 4X4VA 1HQUB 1O5JA 3PO4A 1HARA 1FEEA 1KLMB 4PZVA 1EETB 4JV1A 2ZJRQ 5I3PA 3BJYA 5B0DA 3JYTA 5KG1A 3IRWP 1XMQJ 1FK9A 7FD1A 1MMDA 4RW4B 4F3QA 2VIHA 2V0NA 4RPFA 3A1YG 2XSJB 2KKHA 2KDOA 1OSCA 4ZCKA 1IKVB 2YX1A 1N36F 4OI4A 3KHRA 2CVEA 4DSJA 5K8NA 1R8HA 1QAYA 2HIQA 1V3RA 2EKYA 3MOZA 1PAUB 3GU0A 4M5LA 3IAS9 1WUUA 2V4JA 2R7QA 1T0TV 1TKXB 4PAAA 3MPVA 3QGHA 3AOAA 1OJ4A 3BEGB 5CCMA 5KFYA 2XB2D 2MQMA 4XAKA 3IC1A 1RT1A 3VGVA 1JXLA 1WG5A 4OI1A 1ZH5A 3U1NA 2V2VA 5HROB 3MUTP 3HMJG 4RNMA 3M9OB 3GG1A 2DH7A 2E5GA 1N6QB 4WXOA 4KAIA 3OBIA 1CULB 4DQQA 2VJUA 1Y5NB 3V4MA 3DOKB 4N8NA 1T9UA 2DNYA 2IMWP 3FFIA 4N41A 1DJ0A 1VK8A 2ZDOA 1MSWD 2OEKA 4OYPA 2B9XA 3GTYX 2X3DA 3IWXA 1PIEA 5CZVA 2A6OA 1RAEB 1YHQS 3R2CJ 2Y1IA 5ETNA 1YRUA 1XEZA 3FMWA 4UZBA 2Y3YA 1S6UA 3UR0A 3PIPQ 5THWA 3P6YC 2HNZA 1KSPA 4JI6J 2KXHA 4P2SA 1AUDA 1NDKA 2MQQA 2W8KA 2BKNA 2N3OA 2HK3A 5D0HA 4ZP9A 4B3OA 3G71S 2JOQA 2N4DA 2X1BA 3Q8VA 2YNFB 4WIIA 1D1UA 1Q4RA 3KJQB 2CDQA 2BA9A 2CQ1A 3ILJA 1N32F 1VIOA 5H9FJ 4DSFA 5FIIA 1LW2B 5D0EA 1VGYA 3EYZA 3CULA 1FRLA 1RZMA 3W2WA 3UWTA 1R6VA 3Q23A 4AL6A 4CM0A 1RCXB 3LAMA 4LR7A 1IBKJ 3A3NB 4OHWA 2ZC4A 2HWTA 2VG6A 3DLEB 1Z4UA 3EGWB 2ILZA 1R8BA 1NDLA 4C48A 2DRBA 1HBMB 4DUZF 3T41A 4NCGA 3EVWA 1UFLA 1PBAA 3SCIE 3I0SA 3TA2A 3AQPA 5MAOA 1WF0A 4CYUB 2EBGA 3CB4A 1Q95G 1FRJA 4O4GA 1F1BB 2QO3A 5F9LA 2BJ9A 3NGKA 5GMDA 4YQWA 2BX6A 2LCWA 3ULHA 2L9NA 2IAJB 4NYPA 2HPUA 2CWKA 5HBMB 2Y0SD 4LR8A 4CLUA 2H5JB 2BJ8A 5LM7E 1M5HA 3DU5A 3L95X 1UAWA 2CKWA 3QPIA 3OTOJ 1RBAA 4EEYA 4JI1F 4V19J 4LSLB 4BLGA 2ZH8A 4DR3F 1RHUB 4M5JA 4LFCF 2W9CB 4X4OA 4P72A 1NHVA 4B9VA 1RAOA 5F41A 2HGNA 4KGXB 4UQGA 1S6PA 4PQAA 1VQ9S 2PMHA 3THVA 2QSWA 3W60A 4B3SJ 2J9DA 1U6BA 2KN4A 1PILA 3OVAA 2MKKA 3AFGA 4KT0C 2VONA 5KFSA 4L73A 1CS4A 1TUGB 1TP7A 4TQSA 5DM7Q 2R8JA 3GIKA 1GFWB 4N77A 3DNCA 2FQQB 4ENOA 4MMOA 1JJ2R 5J2PB 1FNOA 3TUIC 1NEEA 1CJKB 5A8RB 2VC1A 2CJYB 1NPRA 3UW1A 4ETXA 1O51A 1HQEB 3V6DB 2CQHA 1IJFB 2LMIA 4NZ6A 1FE0A 3AD9C 3SCKE 1NRKA 1S4FA 1WEZA 3DMJA 4NLVA 2CJQA 2RUGA 3ENVA 3ILIA 1VRUB 3TUJC 4C98A 4LUBA 1SH3A 1RT7A 1S77D 1PJ7A 3NS5A 3TAMA 4ZPWR 4DQSA 3T6JA 4K59A 4YOEA 3P5BP 3R27A 4LIRA 2F8HA 2HURA 4FPRA 3ZFVA 1N5QA 4OZLA 2W2MP 3HJVA 4KO0B 2XLJA 2AJQA 4L76A 2ZHBA 2OAUA 4PR6A 2CJAA 4UOHA 4BC7A 1IXKA 2DO0A 5JMNA 1R43A 3WQPA 1KQKA 2NSBA 3DRSA 4CO2A 3AT1B 2RKIA 1EQMA 3M32B 4NA2A 4JI0F 4ZPBA 1JKHA 3R1LA 3FC9A 2DNLA 2FC9A 3KG4A 3MCSA 1G4CA 2D3ZA 3N6LA 2IBKA 1NH7A 4PG4A 3CCSS 2MKYA 1D9FA 4LRCA 3QGIA 3J80Y 3M8YA 5J2NA 3DI6B 3GFYA 1R27B 2XMKA 1FDAA 1HL6A 1FRKA 2RDDA 3H90A 2XCAA 1HD0A 3NMAA 2CA9A 2OSQA 3DHWC 8RUCA 2J0XA 4DCOB 2WZ1A 3D4JA 2ASYA 6FD1A 4Y0FA 2RIJA 5RUBA 4C8MA 2GA7A 1IN0A 1KBRA 4B3MJ 3LF0A 1WOSA 2WONB 4CLKA 1TL1A 5KFMA 4DV3F 1X4AA 2HFNA 4DOZA 2GGPA 3K5OA 1G7CB 2IYGA 1UKUA 3QJLA 1HNIB 3OFEA 4DG1B 1S1TB 3PJ9A 3QIPA 1QUPA 2DRDA 1U1MA 4IYQA 2IBOA 1IM6A 3ENQA 4DCPB 3KLGA 3M2RA 1HNZF 2HZVA 5J1NA 1QAJA 1REGX 4Y34A 1FXDA 3FGVA 4OJ1A 3CD5A 2CQ3A 8AT1B 3FSXA 1SV5A 3R5BA 4KGZB 5ETQA 1HBUB 3ZNJ1 1VQSA 3LQVA 3QT6A 3GPAA 1ZS6A 3MEGB 1E6YA 4RW8A 5GVQA 2EG2A 3NCQA 3TJ8A 2QMUB 1NZAA 1PO6A 3KK2A 1P1TA 3PYEA 1EJ7L 1X4HA 5KFAA 1NU4A 3PX4A 2QL5B 2HQCA 2IC3B 2LA4A 3Q0AA 5DS7A 3W61A 5A0YA 4WKRA 4ZMMA 1TL7B 2AZ3A 3KNGA 3LGNA 2ZDPA 4QR1A 1Q0NA 4TVAB 3G6XA 4ZN3A 4Q45A 3PXGa 2UV8A 4PCQA 3CJTA 3I9ZA 2XI3A 4ZN1A 3OTEA 3ITHA 7FDRA 2CZ4A 2Z4PA 1QSSA 2RU3A 3MMBA 1HWLA 4XPCA 3MCMA 3I4PA 4KGKA 3BBCA 3G87A 3RYLA 1NJZA 3QSIA 3EZOA 2H1YA 1VC6A 2LQ9A 4USKA 3H20A 4FVCA 3UDVA 1S72S 5IT9U 3MMCA 4ED7A 2RE1A 4ITSA 1SIWB 2V94A 2D9PA 1YITS 2DNQA 4WTOB 5KT5A 3KMSA 2DKOB 3RB4A 4OHZA 3MPUB 1S9GB 1REVB 2VFTA 2CG8A 2XMMA 4WFXA 4ZPCA 2VUGA 4GVBA 1V3ZA 1MW7A 3MR2A 1LQ9A 2JEGA 2KVIA 4IFVB 5KFFA 3QO9B 3IRXA 2V50A 1N5TA 2QEXS 4WFZA 4DFKA 5EWEA 4X64J 1T03A 3L3CA 3BKFA 4JI2F 1YJVA 2GQ2A 5C2GA 1U26A 3BSCA 3SSRA 3JSMA 1X4DA 1NDPA 3PCOB 4NLRA 1CJUA 2F8MA 2ZBCA 2R7UA 1Y3JA 3POTB 1JLFB 2YPYA 3UQSA 2VD3A 3CCUS 1VR6A 1IWGA 2IMOA 5HK4A 1S0VA 4WZMA 3VAMA 5BYSA 4CDIA 4JP8A 2Q79A 2FLLA 5GADU 3CDBA 3R5JB 3ENWA 5I42B 2NUHA 4ECVA 4O3PA 1U49A 2AJ0A 2N82B 1JIHA 2G4BA 2ZJQQ 1P1LA 2AJFE 1LWFB 4JI7J 4QR0A 1SCJB 2HFSA 2QIFA 1GMUA 2C2KB 1B0TA 4EYHB 4B9TA 3IO1A 1UEVA 2POKA 2EKNA 3V81A 2JC1A 1QDUB 3AHPA 3US5A 5L46A 5IC4B 3TYTA 1TKTA 2LXUA 2RRNA 4CO4A 2CPYA 3IFEA 2PMWA 3PACA 1PYOB 1FKPA 3FBCA 3IM8A 4C2MA 2XO6A 4P2FA 1Q86T 2IFXA 1BQXA 5LXYA 4LF7F 4Q44A 1ZM9A 3W8GA 1IKYA 3F44A 1VQNS 3B82A 2DTJA 1RTJA 2JHEA 1BQMB 3MM9A 4OI3A 3LP1A 2G2ZA 4ERDA 1KD1T 4KKOB 4L75A 5IOLA 3CJKB 1B99A 3PYGA 5LSOA 3GFXA 4GO7X 3NAHA 1RU1A 4IKAA 3MFHA 2CQ4A 1NKBA 5KFIA 1VRTA 2H54B 2XGQA 2DXEA 1ZYQA 4OI2A 3TAPA 2VFRA 3PZPA 4YP3A 2YKPA 3HF5A 3C14A 2IVYA 2HMIA 2VBZA 1WD6A 4EFAC 2QV6A 2UXCF 1QUVA 2E7WA 2H5IB 3NWRA 1N36J 1VQYA 1HW9A 1RTDA 2OUGA 4G1PA 1K73T 4IR1A 2YNGB 4P7VA 4FDFA 2NPFA 5HVFA 5DZ7A 4UUWA 5HATA 5L1IA 2DHAA 1M5VC 2HFUA 2NLWA 5HQLA 4YB7A 2AJ1A 2VQFF 3OW2R 4JOUA 2MSSA 4NZ0A 2WBMA 1UZHA 2W4DA 4Q2MA 5A2QU 2YQ0A 3CF5Q 5LJ3Y 4W98A 3ISND 2QG9B 1TVRB 3ISNC 4RNFA 2GCFA 1RHJB 1S0MA 5A76A 1EZZB 4GKJF 1C1BA 2MEWA 3GJSB 4G1QB 5GAEU 2KXFA 4F0KA 3TARA 1S1XB 1IWAA 1BY9A 3VGUA 2HQDA 4R5PB 2HHUA 3BN4A 1RSCA 4LF6F 4ECRA 3MR5A 1HI0P 3FNNA 4O0IA 4KBIA 4Q8FA 2H4WB 3MD3A 2W25A 4IRCA 1SI9A 4ZJQA 1WF2A 2DY1A 2HHQA 4K8RA 5GMKa 1UWBB 2AYMA 2FPHX 5KT2A 1RWXB 3DLKA 2HVIA 4K4YA 4UY8T 2C42A 2Y8WA 1GEHA 3VAFA 4LR9A 3QRRA 2R4FA 1NK6A 4ES1A 1RHQB 4J91A 1HI8A 1LK5A 2KYXA 1UEUA 3KNAA 3TQEA 1U24A 4EU0A 1GXTA 2AKWB 1HHQA 4JV0A 2DK2A 4QW9A 3HLUA 4O44B 4WXWA 5KFBA 1LWCB 2HG4A 1S48A 4MFBB 4I6WA 2KG1A 1S97A 4Y2AA 1N32J 4CH1A 2V34A 1H0HB 2UUBF 2VDIA 1D09B 1F9HA 1LNQA 4NYOA 1C0UB 2B4OA 1IBMF 2BACA 4HT7A 5EX3A 4WKYA 3KJVA 3Q8QB 1S6QB 4QIGA 2BYCA 3W62A 5DGBA 3D6TB 4P2XA 1ZTTA 1RTHB 4X4QA 4ALZA 4DUZJ 4J9OA 4ANDA 2XY7A 4GC7A 4OX8A 5KG5A 2LXFA 2VFVA 3HSZA 1NUEA 2OD6A 1JLGA 2XY5A 1ZA2B 3OFGA 1NK7A 3AXMA 4CLFA 1NH8A 4ES3A 4AQYJ 5IWAJ 1G3OA 4ZPAA 2MZTA 4DUYF 4DV5F 2EG1A 3CEDA 4Y28C 2ZNYA 2H9ZA 1NM2A 3D6FB 3MM7A 3R8YA 4FS1A 5FLXU 2JLEA 3M6XA 1NBEB 2FHJA 3BYPA 3SQGA 4QPXA 2VG5A 1D0EA 3AB4B 1WSRA 2YKAA 3M05A 1M1KT 1AXQA 1B7YB 1GX6A 1XJWB 3CCTA 5LMUF 4JI1J 1S79A 2HVHA 4M5IA 2AU0A 3HFKA 4DR3J 1K1SA 2OPQA 1HWIA 3DCAA 4JYAF 4LFCJ 4Q0BB 2ZH9A 4DEZA 4X4PA 2NR0A 4P6QA 4ZLJA 1IQZA 2B7CB 4K5SA 2XI2A 5L9NA 1X4BA 1RWOB 1QD1A 1T05A 1IR1A 4USIA 1RQ0A 1MMLA 3ZTPA 2DNZA 3MR6A 3ADAC 6FDRA 2ATLA 3W9JA 3DDIA 3VR1A 3LTOA 2VF3A 1KVIA 4ZVSB 3AAWB 3C6UB 3A3PB 3AJ1A 4TY9A 4DUTA 1E6VB 5HN0A 3HDSA 4ZIVA 3IMQJ 4I0WA 1YTYA 4OI0A 3U02A 3L7OA 4OYOA 4DSLA 1CG2A 3MEKA 4FF2A 3HCXA 4FP9A 2PSZA 4ZVFA 1A9NB 4KY3A 2LEBA 1RK8A 4P10A 3V6KA 1Y5IB 2VJVA 4K5RA 4JI5F 4H4OB 1NNDA 3IN5A 3OUYA 2ZZTA 3CC7S 4H4MB 4N8OA 1U47A 2V8GA 5IV4A 3GFZA 3IS9B 4EMDA 1HFEL 4Q2LA 1P9QC 5FDLB 1TTHB 2U2FA 2PMZD 3OD2A 1VQMS 5F0UA 1RT6A 2RMLA 3VVUA 2NREA 2MLYA 5DM6Q 8ATCB 2OPRB 3EPIA 5D77A 2WVEA 4EUVA 4OYIA 3C2PA 4JI0J 3J7ZT 3NY0A 3VAKA 1HNVA 3UVJA 2DNOA 2GIQA 5AT1B 3FRZA 4LT6A 1DQ8A 5AJ3F 1U25A 2GVZA 4PWUA 2CJ9A 4DLEA 3GIIA 2W9BA 1WG1A 2QYCA 1V6HA 4LJMA 3CJSA 2HNDB 2DHHA 2MGZA 2QX0A 3HK2A 5KG6A 3MM5A 4Z37A 1S1VA 3MR7A 2AYGA 2LKZA 2DH9A 4MK7A 1N0UA 1FI4A 3TAQA 2COLA 4DV3J 4NA3A 2RQCA 5IC6B 4B3RJ 4URGA 1CLFA 4R25A 2B0GA 5CA5A 2FIUA 4J5OA 3D1OA 4E8UA 2I8EA 1WHVA 2CVIA 2KM8C 4JUZA 4E98A 3CD0A 4OJHA 3QT7A 2J0WA 2CPHA 1NKCA 4RX6A 2WBRA 3MECB 4WE1A 3IG1A 3EX7B 4CLWA 3TW0A 1KFDA 4M63A 3N4WA 1N5YB 2L41A 2Q6BA 4YMEA 3M4XA 2OGUA 4URQU 2ROGA 3K5PA 2FJXA 4I2QB 5DG7A 4IQMA 2A1BA 4U7UK 4ECUA 3A8IA 2XHWA 4H4KC 4B17A 5KG7A 2B4VA 1Q1KA 2G0JA 3MEEB 3LGMA 3FMBA 5IQ6A 4UW2A 3KLEA 2ZH2A 2WTFA 3CD7A 2JX2A 3AB2B 2FZCB 2CYYA 3BBBA 3RB6A 2KZMA 2J8SA 3IWLA 2F5GA 1GXUA 4YUDA 1KNZA 4NI2A 1SBRA 2XMAA 2ZVIA 1WC4A 2BQ3A 1UJ4A 3DM2B 4R0JA 1KQFB 1R89A 5IT0A 4GVLA 4I67A 4P71A 2OPSA 1DTQA 1H7XA 2EK1A 4LSNA 4YDDB 4PWDB 3EVMA 4MYTA 5KFLA 3ZZPA 3GV7B 2V2ZA 2PEHA 1GTHA 2DGVA 2MZ1A 3DYAB 2RSQA 3QBCA 1KOHA 3IBFB 3AA8A 1F2GA 1HHSA 1RI7A 4ZVGA 4DLGA 2CQ2A 1WKKA 4OZ5A 2UVVA 1HWJA 1HYSA 4DPUA 2KVQE 2D69A 3D5MA 3JSBA 4ILMA 1QE1B 2C3OA 3IGVA 4HTIA 2QLXA 1KLMA 4USHA 1URRA 2LECA 3CCZA 5HJYA 9ATCB 4MAKA 5E33A 2IJRA 4QBUA 2IA6A 5KFVA 4RNNA 4PG6A 4PPDA 3QIDA 2FB0A 4RW4A 1VC5A 3SFGA 2GMJA 2M88A 2W2QP 2XSJA 3VV2B 1UTAA 3M8ZA 3C15B 4USMA 2R7XA 4DQIA 4LF9J 3X3UA 4U67Q 4DPOA 3CWJA 1RBLA 2CQPA 4IO1A 3PO5A 3HM9A 3K89A 3CVKA 1I3OB 5KFPA 1YJ7A 2RUSA 4A8FA 4RW9A 1U1RA 4NRUA 4M8LA 2FVSA 1Q7YT 4ZJOA 3SV3A 4Y2MA 4HHHA 3OHAA 1SUQA 4Z7YA 1G1XA 2OPPB 3CJ5A 1RWNB 1AA1B 1GNKA 4LBHA 1YIJS 3ILLA 5E3RA 1CULA 2R3VA 1S1WB 4DV2F 2YNIB 3HFVA 4LIWA 3ETMA 2NPIA 4TU9A 2LLZA 3U1LA 2OI2A 2PA3A 4DN0A 4FN5A 4JV2A 4TYBA 1Q81T 3O44A 3AQOA 5GAEI 2V2QA 2WHOA 3WBZA 1X4GA 3ILOA 3M8PA 1ELOA 3TA1A 2Z2YB 1ZPVA 3SDEA 2XLKA 4ANEA 3LPYA 4RL1A 3M7VA 3CC4S 1IKXB 2OJ3A 5C7PA 2V69A 3O8WA 5ETLA 4RW6B 3JTNA 4DFJA 1TK8A 3RBDA 3PM9A 2QL7B 3DLGA 3MAAB 1ZZNA 2J6UA 2KFZA 2G0CA 2ZKTA 5L38A 2Z30B 1Z1ZA 4ILRA 4QOTA 3R97A 3AOBA 2I6WA 2CXEA 1AYEA 2VODA 1DARA 2V2KA 1SJFA 2AZ1A 2KYZA 4QJVA 2UXBJ 1ZA1B 3SIPB 4IOAQ 2CPZA 4LF7J 3CJRA 2D9OA 2AEMA 4KQZA 3ZTQA 4RNHA 2H51B 2W9AA 3VZHA 3PR4A 3BH7B 1WI8A 4FYYB 2DO4A 1K44A 3T9NA 4OL8A 4NWBA 4USWA 4KJIA 4K2XA 3PW5A 4WPAA 3CC2S 4C7QA 4LSZB 2OFHX 4F36A 3OL9A 3TRGA 3W65A 2GHPA 2GW8A 1XK8A 2CPJA 3QT8A 5J1EB 5B0FA 1WORA 1XC9A 1QVFR 3M8WA 1O0PA 4I6YA 2VBYA 1M0SA 4UOFA 4ZPTR 2E9RX 3NG8A 3SYZA 4U8YA 4U6PA 4O3NA 2ALZA 3VQTA 4OFZA 1IBKF 4D3GA 4LF5J 4NCAA 1XERA 5F0WA 2UXCJ 3OTBA 3BO4A 2PE8A 5IT9Y 5LOQA 2DYAA 3WX4A 5E0OA 4ID5A 2F4VJ 1OY9A 4ID8A 2Y8YA 4A47A 2XMUA 3H8YA 2PD1A 1S12A 2ROPA 2DNPA 4ZPVR 1RGVA 4DF4A 1TL5A 4USTA 2OELA 1FWKA 2ZITA 2ZE2A 3CGIA 3W5YA 1Q79A 4NLSA 3HVAA 2VQFJ 1N56A 3M8QB 2UV8G 4B9UA 2C3MA 4RO0A 3C16A 2ZH3A 3PJXA 1KQSR 1WACA 2FY8A 2QFIA 5CH7B 1UETA 3CCLS 4K4ZA 2DR8A 5KFGA 4DSIA 4ZIWA 2HHTA 2XS5A 2PIIA 4G1IA 2D74B 4OV6A 1CJVA 3OTOF 1X5OA 2FUG9 1OO0B 1CJKA 1RT4B 3BGLA 3GONA 2M7SA 1KC8T 1QSYA 3MDFA 1RB0A 2KHDA 3S8SA 4FBTA 4LF6J 5BR8F 1AZSA 3H4DA 3I0RB 4WIQA 1APSA 2BQRA 3DGPB 3T1HF 3QATA 1XIQA 3N5BA 1RHKB 4FYDA 2AHOB 1LOUA 3C6TB 2IRUA 4PXEA 1MROA 2HQ3A 2Q1LA 1FD2A 2W01A 4NLYA 5BYQA 1AFJA 4PWWA 1V3SA 3Q24A 2CQCA 2QA1A 3M9NB 4KPYA 3E3XA 3JYTB 3Q86A 2VOPA 3KLFA 1FK9B 2B9EA 4J9RA 1U45A 3HHLC 2L3MA 4DFPA 2ZJPQ 4KR0B 4L3NA 3OTDA 5K14A 1RAJA 4F4YA 2WRMA 5CQGA 5C24A 2E29A 5CXTA 1SKRA 1DQAA 4NX9A 2MHEA 2M5YA 4CH0S 3TZZA 2UUBJ 4HKQA 3UDEA 1RUSA 3M32A 4B9SA 4AL7A 2V4JB 3UD5A 5BJRA 2WVBA 3MUVP 2CNKB 4URSA 1IBMJ 1HNWJ 2LFVA 1YSJA 1NKEA 2DEJA 3I82A 3RBEA 1U1KA 1YJTA 1RT1B 4RBTA 3J7YI 4DSKA 3GFHA 1VRQC 5EGYA 4PG8A 1GXLA 4DU8A 1SVDA 2HVEA 4CLSA 4F2SA 3R9LA 4JV5F 1SH2A 3DU6A 2CNNB 3FFIB 2CZVC 3BGUA 2BMBA 3H5SA 2NS1B 1UVLA 4DV5J 2KRBA 4ES2A 4FPIA 4KB7A 3TJ9A 2AEJA 3D2WA 3T6BA 2BV3A 1DQ9A 1NAQA 5E3PA 2K2PA 3VZIA 2E9TA 4FYXB 4RUAA 4NPOA 5LL6d 2LVWA 2BE9B 5LMUJ 2HWIA 2QL9B 1YRXA 2EFGA 2V6AA 2DGUA 2DISA 3OJSA 1TV6A 5IQQA 2ALYB 3N6MA 1DLOA 4B3OB 3U27A 2YWWA 1YI2S 4DPWA 3KK3B 4ZP8A 5E7OB 2NSCA 3HZEA 2BEFA 5K20B 2LQ5A 1GMVA 1WF1A 2IY5B 2OO4A 4YFUA 2CNLB 4HHJA 2PO4A 2J8AA 1RJJA 3W2WB 5C42A 1FESA 1S6OA 1RXOB 4Y2CA 1AW0A 3ZC4A 2YBVA 5A2QY 2NYIA 1DTTA 4NLOA 1H72C 3W9IA 1HR0F 5U47A 3HVWA 1WOPA 5G0RA 2UU9J 2BZ2A 1VLYA 3M30A 3A13A 1NK8A 1FRIA 2HW3A 3ZZZA 1RABB 3BZQA 2VOOA 4JI5J 3Q89A 3GG0A 3GSDA 1U09A 2XMTA 2JC0A 4MH8A 2J6SA 3OSNA 3CD6S 1Q16B 1VLOA 3DLJA 2RQ4A 3GLJA 2XS2A 3C8YA 4MYUA 4YB5A 1VYAA 2ABYA 3K17A 4OIXA 3UR3C 2R9LA 2R7OA 1SH0A 3DKDA 4F4WA 3JQKA 5HMYA 3NNAA 3LGHA 4C8LA 1S7IA 1TR0A 4K50A 3DFEA 2NXNA 2JDJA 5DGAA 5KG2A 6AT1B 3H5UA 1RAAB 4Y3CA 2ZH5A 1JK9B 2XYHB 5HSPA 1SQEA 4DS5A 2IPOB 1S9GA 3EWGA 1FNMA 2LDIA 2RJZA 5T7LA 1U2FA 3JSRA 5AJ3J 5EWGA 3G82A 3NS6A 3J81j 2BQUA 1PJ6A 4F4ZA 1V5IB 4M95A 1HBNA 5KFOA 1Y3KA 1RT2B 1CS4B 3QYYA 1H74A 4CO3A 2GQCA 2ZWOA 4EK2A 4NEYA 2DNMA 2J0SD 2CQ0A 3DC2A 1JLQA 2NXEA 4ANCA 2BJ7A 3NP5A 1B4SA 1JX4A 2FJWA 3TUZC 3OSPA 3QRPA 5IFMA 1P27B 3I32A 2I5JB 1U8SA 1JWWA 3BH6B 2NZCA 3UNYA 2HBRB 3DMJB 2DHSA 4OYWA 2DR7A 4U9RA 4CNZA 2I1RA 2HHPA 2MZRA 4LRDA 3FSYA 1RT7B 3TAMB 2VHGA 3EM1A 3KG0A 3KXDA 2B5JA 1PG5B 1RT5A 3QLHB 5FLXY 1WHYA 2KB2A 1C4AA 4HHUA 4RBUA 2DD8S 4CLTA 2HRYA 3RRGA 2XMVA 2PFFB 1VQKS 4IFYB 3GIJA 2YVSA 2O5DA 3PRVA 3R7NB 3DRSB 4WYLA 3OXGA 5L39A 5DG8A 1G2EA 2RKIB 1EKSA 2AP6A 4DPTA 1JKHB 1S49A 2YKMA 3NRBA 2P6SA 3QAUA 1JMTA 1RWUA 5KFQA 3P96A 1EB0A 3IAM9 1KVKA 4ZHRA 2YH1A 1TFYA 4XK8C 1NPKA 3TEHB 2QMWA 4RUCA 5J2NB 4WU3A 2KL8A 1HLWA 5D4PA 1UL3A 1P8GA 3KK1A 2SXLA 3GJTB 3MPYA 3FZ2A 1LEOA 3KLIA 3QGPA 1GX5A 4Y6IA 4NZ7A 2HGMA 2RT3A 4J90A 4CLPA 2B51A 2IVFB 5DLGA 2DGQA 1YBTA 1TL1B 3T1YF 2V8VA 4TNOA 2GGPB 3HFZB 2BJDA 3JTPA 4QU6A 3QRQA 4TY8A 4QIFA 5CABA 5HP1B 3CJKA 4ED4A 2DBBA 4WFYA 1AFIA 2E5LJ 3ZZYA 3QIPB 2VL1A 2J76E 3FKBA 3KLGB 2B56A 3M2RB 2R7VA 1R8CA 2GC8A 3CW2C 4ZLPA 2MZSA 2EXUA 2FLOA 1SV5B 2ZH7A 1LXNA 4O3RA 3J81U 3VGTA 2I0XA 3LWMA 3QFWA 4ICLA 3KYLA 4RW8B 2XG8A 2UXDJ 3GJRB 2YWKA 2YNGA 2YKQA 1RA6A 4AFFA 2X1FA 2UUTA 3PKYA 1OYEA 3UDLA 3HSGA 1XN9A 2BE2B 2DIUA 1CQMA 1FVQA 5B0BA 4BC9A 2R8KA 2ZUAA 3RW6A 5I4MA 2FGCA 2PC6A 4I1TA 5A0YB 2AYEA 3G2XA 4TYAA 2KO1A 3AD7C 1K0TA 5AE1A 4Q43A 1TUWA 1VQ6S 2O1PA 3AJ2A 2XQCA 4NLUA 1RCOB 3DDKA 4ED6A 3M6WA 2YX7A 4G1QA 3TVZA 1HD1A 4DV2J 5KFZA 3NXZA 3EE3A 2LQBA 4NLWA 1A6LA 3H59A 3ITHB 4LF4F 4LRAA 3MMBB 2M8HA 5LSRA 4ATNA 4LBIA 3TI0A 2MJUA 3BDPA 3ETOA 3A12A 2HRTA 2EBEA 2IM2A 1NSAA 5L8RC 1OIAA 3H5YA 1JLBA 3B54A 2A10A 2CQBA 2CPXA 2DNKA 4X4SA 2DXDA 3MAQA 5CYQA 2YH0A 2LA6A 3EGNA 1YGYA 3FCWA 1UWBA 2BKPA 4DL5A 2XHCA 2ZH4A 4RW7A 1HW8A 2V8DA 5CZXA 4KHPF 1RAHB 4MIBA 4GVBB 4P52A 2B6AA 2ZBRA 3R5GA 4TLQA 5HVHA 3ONQA 4ZLLA 4F67A 4DR1F 2DRAA 1F3VA 3IRXB 4OZ3A 1HBOA 4JI4J 3AODA 2WW8A 2HHXA 2DITA 3QT5A 3CDAA 2W4PA 4LVNP 4R0EA 3SFUA 2LP4A 3PX0A 3DGVA 3MR3A 1DRZA 5DQHA 3JSMB 3NGTA 3BGRA 2C2NA 5SZTA 2XYGB 1S6QA 3ZTSA 2KT2A 2ASJA 1FERA 4DL7A 4QYRA 1MG7A 4C8OA 2BANA 3UNGC 4B08A 3TOQA 5KTQA 3NCRA 4KC5A 3KHLA 5J2QA 1BE4A 1HMVB 1WWHA 2A6MA 3V6HA 2H5EA 4V1Ak 3BGOP 4H4KA 1JNZB 3ZZOA 2XNQA 2HSEB 4NLDA 3NGSA 2W2PP 1NK0A 2JNJA 1RAFB 3MTJA 4WK1A 4FXDA 4K4XA 1CC8A 3PHEA 3KOAA 3VALA 3HXMA 2BR0A 1Q82T 1RBOB 2CUYA 3TWZA 4MK9A 3OHBA 4LF1A 1W2IA 3IR6B 1LWXA 2JFKA 3RAXA 4AQYF 3K8WA 5DQIA 5IWAF 2PT0A 1IKWA 2ERRA 4Q0BA 3GV5B 2FGOA 2WVFA 2H4YB 1TKTB 2QE5A 1OY6A 3QJPA 3LAKA 1GMWD 5HQ8A 2FJBB 3LP0B 4NLTA 1N5VA 3QWUA 3UDCA 3VGSA 4AT1B 4DL3A 5L1JA 1CBKA 1FKPB 4OLPA 3EDRB 3NEKA 3BREA 3TANA 3JB9k 1XBWA 2NUUG 5C5JA 1IKYB 3PHTA 1HHTP 2ASLA 1Y4ZB 5KFUA 1RTJB 1XR6A 3MM9B 4U8VA 4G3IA 1UW4A 5BR8J 2WOMA 3PRDA 1E6VA 3M1VA 3KFWX 2J6TA 2YNHA 2XY6A 3T1HJ 3MCNA 4NLPA 3BYRA 1VRTB 4IOBA 4J7CA 2GZOA 1X0FA 2NQPA 3L09A 5HLFA 2HKEA 3F56A 4U7CA 4XPEA 3GYGA 1DZ5A 2H65B 3CCJS 2MZJA 4WFAQ 2BRKA 7AT1B 3B4MA 3MM6B 1FCAA 1WNEA 2HMIB 4H4MA 5IM0A 1L3KA 4DF8A 3SCLE 4FVMA 3TEGA 1H7WA 3K57A 2J9CA 1TL4A 3BO2A 1SQFA 3OR2B 1KFSA 2O67A 3RTVA 2GO8A 3TVYA 3Q22A 4TU7A 2DGOA 4PXDA 1RU2A 1KR4A 3DRPA 1HA1A 1RTDB 1PC4A 2EC0A 5HL7Q 1WG4A 1OPZA 2EPIA 4WBFA 3MGJA 2GIRA 3HP6A 3THPA 1F9EB 4C9DA 5K5MA 4EZ6A 4I7FA 4I64A 1LFPA 3KMQA 2YKNA 5B0EA 5B0AA 3PNIA 4WWSA 3CJ3A 2HNDA 1C1BB 4DV7J 4OJGA 3H7HB 3M2UB 3I31A 4JV5J 2AGQA 2JWNA 3LWLA 5LJ5Y 1NB7A 3KUHA 2DCLA 2PN6A 3PW4A 5KT6A 2UUCF 1RHMB 3THTA 1G6BA 2EFNA 1C2PA 4DFMA 1JLCA 3P45B 4RU9A 4X65J 4FXWA 3HD2A 1BHNA 5D15A 2GVDA 3OR1A 2R2UA 3G9CA 1BQNA 1ZTWA 4A8QA 4CZCA 1YJNS 1NK5A 1R7IA 2E1CA 2R42A 3QNWB 3DLKB 2HLTA 4QWBA 4IG0A 3HVRA 3OL6A 5EHHA 2DGTA 1NZ8A 1N5YA 4PQUB 2QT7A 3KKFA 3RZAA 3V2UC 1RTIB 5DLFA 3D68A 3OVSA 1VDHA 4ELUA 4B9NA 4B3RF 5F8MA 1C0TA 3GYNA 3PEHA 1NPPA 2PEBA 3Q8UA 4ZLNA 1RACB 2OSRA 2D3OR 4B3TF 2VU5A 3ZZUA 3K58A 4X84A 5A8WA 2HFZA 4YN3B 2ZOFA 3C66A 3KJVB
chains in the Genus database with same CATH topology
3H42A 3WIVA 2W2QP 1SPBP 2Z57B 3VV2B 2W2NP 3A3NB 2W2PP 3WHIA 3VHQA 2Z30B 1V5IB 2Z2ZA 3A3OB 3CNQP 4JP8A 2PMWA 2ZWPA 2Z2YB 1SCJB 2W2MP 2Z56B 3A3PB 4NMXA 2QTWA 2Z58B 2W2OP 2XTJP 1ITPA 4K8RA 3SQOP 3GCWP 3GCXP 3BGOP 3WIUA 2ZWOA 1R6VA 3P5BP 4NE9C 4YN3B 3T41A 3QFHA 3CO0P 3AFGA 3BPSP 4OV6A 2E1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H42 A;  3WIV A;  2W2Q P;  1SPB P;  2Z57 B;  3VV2 B;  2W2N P;  3A3N B;  2W2P P;  3WHI A;  3VHQ A;  2Z30 B;  1V5I B;  2Z2Z A;  3A3O B;  3CNQ P;  4JP8 A;  2PMW A;  2ZWP A;  2Z2Y B;  1SCJ B;  2W2M P;  2Z56 B;  3A3P B;  4NMX A;  2QTW A;  2Z58 B;  2W2O P;  2XTJ P;  1ITP A;  4K8R A;  3SQO P;  3GCW P;  3GCX P;  3BGO P;  3WIU A;  2ZWO A;  1R6V A;  3P5B P;  4NE9 C;  4YN3 B;  3T41 A;  3QFH A;  3CO0 P;  3AFG A;  3BPS P;  4OV6 A;  2E1P A; 
#chains in the Genus database with same CATH topology
 1H2T Z;  2LYV A;  1LXJ A;  3QQC D;  1Y0H A;  4DR7 F;  2HQI A;  2J7K A;  2VPY B;  1HR0 J;  2DGX A;  2ADB A;  1XR7 A;  2OTL S;  4QYZ K;  3D6M B;  1KWM A;  3HHD A;  3VAI A;  2Y1J A;  3M8R A;  1F5A A;  3G6V A;  2K1R A;  4OX9 F;  1JLG B;  5LSL A;  3I9V 9;  1LFW A;  1Q8L A;  3VHQ A;  2RF2 A;  1S9E A;  2YWE A;  1NLK L;  1J5O B;  3GWC A;  2C3Y A;  1FKO A;  1N88 A;  2OHD A;  2J7W A;  4KHM A;  3SQG B;  1FKA F;  2VG5 B;  3UD3 P;  5I3U A;  3MWB A;  4QWE A;  5AE3 A;  4LVO P;  3Q8P B;  4CTA A;  2QA2 A;  3T9Z A;  1WHW A;  4K7Q A;  4M5G A;  3LAN A;  1OPI A;  3GB0 A;  1IM4 A;  4NXM F;  3D67 A;  2OPQ B;  1IUJ A;  2V8H A;  1NJY A;  3B6B A;  1YQH A;  3HHN B;  2XSF A;  1U0H B;  4M94 A;  3ZTO A;  3QMQ A;  4DU7 A;  2HZA A;  4MIW A;  2RH3 A;  2MQO A;  2W8L A;  1T05 B;  4LF2 A;  4ED5 A;  3CCM S;  3W8P A;  2BW7 A;  3EZ5 A;  3JTO A;  4C4W A;  2I9S A;  1C1C A;  4HL9 A;  3LP2 A;  2J9D E;  1EAY C;  2GAH C;  5D4O A;  5KOW A;  2Y1L B;  2YKO A;  2RDJ A;  2EWH A;  4F4A A;  1M5O C;  3I6P A;  1DFD A;  1R3N A;  5CYM A;  1VJQ A;  1N34 F;  1XQI A;  3RR8 A;  3CJ4 A;  3GE9 A;  4DJB A;  2J5A A;  2UUA F;  2QLJ B;  3FRY A;  1U1Q A;  2OH2 A;  5F8L A;  2OPP A;  1ZZF A;  1UJ5 A;  2HEK A;  4IRD A;  1NK4 A;  2F65 A;  3FCH A;  3ZTR A;  4QWC A;  5KFX A;  4LF9 F;  3UFC X;  2U1A A;  3HHL A;  1WC3 A;  1IR0 A;  3IXQ A;  2JLG A;  2HHS A;  4O23 A;  3RRK A;  4DV0 J;  1U1P A;  1L3V A;  5D6G A;  1RT6 B;  2W1B A;  2BUN A;  2XM3 A;  1Y7P A;  4F8R A;  4WU2 A;  2ZD1 A;  3FDS A;  1NXI A;  1HPZ A;  4LMZ A;  1N48 A;  2VDH A;  4J9K A;  1GAO A;  3KDN A;  1HNV B;  1IKX A;  3UD4 P;  1WEL A;  2AX0 A;  3KUE A;  4LRE A;  4RW6 A;  4KV8 B;  2FVC A;  4FKX A;  4C3K A;  2MLZ A;  2CQD A;  4UT4 A;  1IBL F;  3FQK A;  4QU7 A;  2GVZ B;  3AXK A;  2LU2 A;  2W9B B;  4DR2 F;  2R2S A;  1FXL A;  3HHK A;  1EAR A;  4KFB A;  4OZ0 A;  2V4Q A;  4C3L A;  2AW0 A;  3DOL A;  3SSS A;  3MM5 B;  1S1V B;  2NXJ A;  3G6E S;  2YY3 A;  1FVS A;  5J2M A;  2L48 A;  1VIX A;  5EN1 A;  4WK3 A;  3T1Y J;  3NAI A;  3C46 A;  1RKI A;  5DQG A;  1S57 A;  1VC0 A;  2X51 A;  1VBZ A;  4J9L A;  2W7O A;  3ZXW A;  3KUG A;  2JJ4 D;  4UOG A;  4F3O A;  1Q8I A;  2R8H A;  2P5V A;  1T94 A;  4F2R A;  5J1E A;  3IG1 B;  2QTW A;  5KAK A;  1FEH A;  2F4F A;  3D0I E;  2UXB F;  3N9U C;  3RJM B;  4E2F B;  1QVG R;  4C3M A;  4DQR A;  3DRY A;  1F2H A;  2P9E A;  2G9O A;  3N0V A;  3EVO A;  1U2R A;  2NXC A;  4ZVQ B;  1I5O B;  4ZVE A;  5L9X A;  1IQT A;  1NHK L;  2E9Z A;  5JUM A;  2HAF A;  3KLE B;  4F4K A;  2EI5 A;  2MQ8 A;  4ZP6 A;  3HI9 A;  2CWX A;  2FHJ D;  1NHU A;  2IRX A;  3PDN A;  2XUL A;  1R0A A;  1S0N A;  4ZKA A;  2GMH A;  4RU2 A;  2B7B B;  3UI3 A;  2CPE A;  4NI2 B;  5GAG I;  3I5C A;  1D8Y A;  2HBQ B;  3FSI A;  1TQL A;  4OHY A;  4N7T A;  4YDX A;  3G8Q A;  3CIM A;  2FDN A;  1BD6 A;  4LF5 F;  1UVI A;  2L9D A;  3DRR A;  1F9F A;  2F4V F;  2V9K A;  5M2P A;  1DTQ B;  3FCV A;  4LSN B;  1RT3 A;  4DV6 J;  4CT8 A;  1LWE A;  1RIS A;  3U7J A;  3O5T B;  4CCH A;  4RUH A;  1Q8K A;  2AJ4 A;  1JLA A;  3TA0 A;  1YKW A;  3D7S B;  1B3T A;  4ECW A;  3CCV S;  4OYB A;  3MAH A;  1CSJ A;  1X9M A;  2BM0 A;  4LF4 J;  1UA0 A;  1VQP S;  4MTP A;  2YTC A;  3I87 A;  3MOJ B;  3I55 S;  3VAJ A;  3KLV A;  4F7V A;  4M5K A;  1BLU A;  5GAH I;  3K2Y A;  3RB3 A;  1TAU A;  2KI2 A;  5GME A;  3OLB A;  1RYR A;  2FLN A;  3TQ1 A;  4UY8 5;  3GR1 A;  4TQR A;  4OHX A;  3C6T A;  2R8G A;  2V67 A;  4PAB A;  1U1N A;  1PAE X;  3MMA A;  4ETZ A;  2QMX A;  1Y5L B;  4M5N A;  3K8V A;  1RWV B;  2J9E A;  5A8K A;  2HGL A;  5HVG A;  2VAS A;  4KTQ A;  4KHP J;  1XMO J;  2CZ9 A;  2RS2 A;  4ED1 A;  2GV1 A;  2HBY B;  4QIE A;  4FXV A;  1JLE A;  4DR1 J;  1SL0 A;  1QTN B;  4LFB J;  1EP4 A;  2KT5 A;  5DRK A;  3H2L A;  4DX8 H;  3T5H A;  2D41 A;  1FX4 A;  1PKU A;  3RR7 A;  2AT1 B;  3M2V B;  4RW9 B;  3CIZ A;  1MU2 A;  4X66 F;  3PFE A;  4U96 A;  4DV4 F;  2LQJ A;  3L4B C;  3PTW A;  1SUQ B;  2ACM A;  4KH1 B;  3CE8 A;  5KFD A;  2OFG X;  5HMX A;  2GJ2 A;  1EKR A;  3AJD A;  1FXR A;  1OS5 A;  2VH7 A;  3N6N A;  4F3M A;  4W90 B;  2W7P A;  5D3G A;  1FJG J;  1UCN A;  3MPW A;  2IHR 1;  4MKA A;  4RBV A;  1X31 C;  4C11 A;  4HTJ A;  2BAB A;  2XWY A;  4NAS A;  3PJW A;  2QC3 A;  4IDK A;  1HNW F;  3D9B A;  5ETR A;  2MDA A;  1ZAV A;  2G13 A;  4CM2 A;  2MQP A;  1VHF A;  3TNV A;  1VCT A;  4UOC A;  3D0H E;  4M5D A;  3CT9 A;  3PG9 A;  3M8P B;  3D6H B;  1RKJ A;  3SDE B;  4F50 A;  1NB2 A;  2BJ1 A;  3ZZ0 A;  1H38 A;  4OZJ A;  4AD6 A;  2F8E X;  2MLX A;  1YLX A;  5M2R A;  2N3L A;  1NDC A;  2MQL A;  2W24 A;  2BRL A;  3IM9 A;  2E66 A;  4P2M A;  1N8R T;  4BDP A;  3SMZ A;  1OQ3 A;  4DHV A;  1QTM A;  4ER8 A;  3J81 Y;  2DR9 A;  1ZOT A;  2BBE A;  1PYS B;  3MXH P;  2VQE F;  4IH6 A;  2QLW A;  4PG7 A;  5DET A;  3DLG B;  2Z2L A;  5KG4 A;  2HNY B;  2P2C B;  5T14 A;  5KFR A;  2FHO B;  3H2V E;  3TX0 A;  2LEP A;  4PXB A;  4DR5 F;  1W7W A;  3GIR A;  4ZOS A;  3KK3 A;  1VIS A;  1OYD A;  2JEJ A;  3EGV A;  2VV5 A;  3AH6 A;  5C25 A;  1C4C A;  2M52 A;  3EGZ A;  1S1U A;  1ZPW X;  3HSD A;  4ED8 A;  2XC9 A;  4HR2 A;  1WTF A;  2P9C A;  1AT1 B;  1YK9 A;  3I56 S;  4GO5 X;  2VA3 A;  2CJB A;  3S1T A;  2MY7 A;  2ILY A;  3HKW A;  3E01 A;  4P75 A;  4ZDN A;  2Y0B B;  2KG0 A;  3NGU A;  2D3O 1;  2X1G A;  3KJF B;  4ZK7 M;  1FWP A;  4DR6 F;  1KHW A;  3BV8 A;  1N52 B;  3H4B A;  2JLF A;  3SI8 A;  1Q8B A;  1PGZ A;  4B9L A;  3SCJ E;  1R8P A;  1BWV A;  2EFO A;  2CIM A;  4EYI B;  4WP3 A;  4ED2 A;  2LEA A;  1TKZ A;  2O3D A;  2GS8 A;  2RVJ A;  3AY0 A;  4JBC A;  3ZO7 A;  4ID5 B;  2WSC C;  3WC2 A;  1HI1 A;  5AE2 A;  5IZH A;  1T9W A;  3JXO A;  2UU9 F;  1TL3 A;  1FF2 A;  3J7Z 5;  2QRR A;  3BQ2 A;  3Q8R B;  1HNX J;  4PYD A;  4H54 A;  4I2P A;  3TX8 A;  2E5J A;  4O3O A;  3V4I B;  3MF5 A;  2YXL A;  2BVZ A;  2XMJ A;  2ZE2 B;  2XZD B;  3PYF A;  2OEJ A;  4C8Z A;  5B09 A;  2XS7 A;  1A7G E;  4G6V B;  3MM8 A;  4F25 A;  4I56 A;  1FJC A;  5EWF A;  3CMA S;  4TLR A;  2FYX A;  1RHR B;  3R5A A;  3C16 B;  1SKW A;  4IG3 B;  3BKU A;  2M0G B;  3CJ0 A;  3P4U B;  3DOM A;  1PYT A;  5CCL A;  1RT2 A;  4N47 A;  1BUX A;  3KLH A;  1T3N A;  5HMZ A;  1T9T A;  1CJV B;  2C2E A;  3J7Y U;  2O01 C;  2EC2 A;  2V5H G;  2APO A;  1WHX A;  2HHH F;  2G2Y A;  3D1H A;  1NSP A;  4U7U D;  2UUC J;  3ISZ A;  1RTZ A;  5AXM A;  2A0F B;  4ECQ A;  1AZS B;  2I5J A;  1TK0 A;  3HVT B;  3OFH A;  3TVK A;  3NL0 A;  2HHW A;  3OQ2 A;  3JQJ A;  1X4C A;  3QJJ A;  2VC0 A;  5HAO A;  1MRO B;  2DPI A;  4USJ C;  1K47 A;  1R0B G;  3QGG A;  2VG7 A;  3NBP A;  4R8U A;  3KLF B;  4W4M A;  4QYZ J;  4DQP A;  3QLH A;  1CJT B;  3Q8S B;  1U1L A;  4K4V A;  3PY8 A;  1I94 J;  3EXC X;  1KS2 A;  5K14 B;  2ZBI A;  4CIO A;  3W64 A;  2MKH A;  4IFY A;  5A6P A;  3PIO Q;  5C24 B;  2CPD A;  3R6L B;  4IRK A;  4RKU C;  5ETM A;  2FJE B;  3BSO A;  1ROF A;  5DDO C;  4B3T J;  2ASD A;  3R5C A;  3GP9 A;  4WFB Q;  1Z2Z A;  3BQ0 A;  1FA0 A;  3KJN B;  4NA1 A;  2JL9 A;  2QA4 G;  3KHG A;  2AGO A;  3ICL A;  3MHY A;  2Y9H A;  4IUF A;  2DGW A;  3CNQ P;  4CLY A;  2XZW A;  2NCK L;  4DDF A;  1VQ5 S;  3OLA A;  1UPM B;  3NNC A;  4OX6 A;  4DR7 J;  1PCA A;  4ZVU B;  3HT0 A;  3W1Y C;  2XZT B;  4A8M P;  2A2D A;  1K9M T;  2L9W A;  3WHI A;  4OX9 J;  3KHH A;  4OV1 A;  1RDR A;  4DPY A;  5KG3 A;  4PUO A;  1FX2 A;  2XO7 A;  1FO1 A;  3CJQ A;  2DHG A;  2ZKU A;  3UCZ P;  5L1L A;  4EBE A;  3M6U A;  3RBX A;  3PVX A;  1GT8 A;  1QAX A;  4DI6 A;  1DAX A;  3KG1 A;  2XWX A;  2G2O A;  4HAC A;  3UPF A;  5HP1 A;  2IJF A;  1S5Z A;  4QIV A;  5KFW A;  1PC5 A;  1VBK A;  1VJW A;  4ZVR B;  3BPD A;  3H40 A;  4ZCI A;  1YVF A;  4EBC A;  1MWY A;  2IDE A;  4KRW A;  1DHM A;  1LKZ A;  4NXM J;  3ET6 B;  1TV6 B;  1DLO B;  2WB1 D;  2RRA A;  1X9S A;  3R2D J;  1GMW A;  3CJ8 A;  5KT7 A;  2QN6 B;  3RGI A;  5K9F A;  3G4S S;  5KFJ A;  1JNR B;  4FKY A;  2PDA A;  1FRH A;  1Q53 A;  2CG4 A;  3MED B;  3UN3 A;  4CRJ A;  4HDH A;  4WF9 Q;  3N28 A;  2PA8 D;  2E5L F;  4CO5 A;  2FVR A;  1LW0 A;  3S01 A;  2XTJ P;  5C42 B;  5ETT A;  4AYB D;  3CDW A;  3UN2 A;  4P7T A;  4OYZ A;  4JI8 J;  4ZPD A;  1HQU A;  4J9V A;  4LQ9 A;  1EET A;  2AIR B;  1U7L A;  1XNR J;  2QYG A;  1DTT B;  2BE2 A;  1N34 J;  3QZ7 A;  4DR4 F;  4MIA A;  2G0I A;  1N5S A;  2OML A;  2UUA J;  5G0R B;  4ZCM A;  5MLC V;  1SIZ A;  3OVB A;  3M30 B;  5CD4 H;  2IRY A;  3J7A N;  1UFW A;  1FJ7 A;  1IKV A;  3BN7 A;  2F63 A;  4KGM A;  4ZIT A;  4HI1 A;  3F0N A;  2UXD F;  1VS3 A;  4GC6 A;  3VF0 B;  1KKH A;  3HD1 A;  1D8Z A;  1TK5 A;  4HH1 A;  3H0P A;  1NJI T;  2D1C A;  4EI2 A;  3LUY A;  3A4T A;  1H6K X;  4CLZ A;  1TKX A;  4ZJL A;  1R0C B;  2MHN A;  1S7H A;  2MMY A;  2ZBQ A;  2H3E B;  4FBU A;  1U0S A;  2ZEJ A;  1OQ6 A;  3A3O B;  5HRO A;  2Q66 A;  2BM1 A;  3SZ2 A;  1FRM A;  4M5M A;  3EJM A;  1N6Q A;  3MD1 A;  1U8W A;  1T7P A;  2BOP A;  2VIC A;  1SKU B;  2AX1 A;  3P8B B;  3CO0 P;  1R8A A;  3DOK A;  1P9Y A;  2QLF B;  2IVM A;  4NCB A;  4RWW A;  3GQC A;  3RAQ A;  2KFY A;  2IA0 A;  2DT9 A;  5T7L B;  2RIL A;  2IM1 A;  2WB4 A;  1WEX A;  1PBU A;  1IBL J;  3G82 B;  3SQO P;  4U95 A;  2MST A;  5KFN A;  2B9W A;  3D3C J;  2OD4 A;  4LFA F;  1HBN B;  3TR5 A;  3R1H A;  4DR2 J;  1WJ9 A;  2WSE C;  1X8D A;  4X4T A;  3CTR A;  1L5U A;  4G65 A;  3HHE A;  4B9M A;  4YY3 F;  4HVZ A;  5D0R A;  2ZM6 J;  3W2V B;  3BSN A;  2HBZ B;  1VQO S;  2A3J A;  2AJ2 A;  4BCA A;  2E1R A;  1YDL A;  1JLQ B;  5C2C A;  5H9E J;  4CH7 A;  3PW0 A;  5ETP A;  4CWB A;  4NL5 A;  3MUM P;  3EUN A;  1XNQ F;  3PFO A;  5K8O A;  2FVQ A;  2AGP A;  4A8X A;  2DJW A;  5E5N A;  5JJB A;  2B3T B;  4RJV A;  3NOG A;  2E5I A;  2ZH1 A;  1EX8 A;  3Q83 A;  2DCU B;  2AF6 A;  3I5A A;  4OJ3 A;  2XNR A;  1WDD A;  4WJB A;  2HS4 A;  4YR3 A;  2YNF A;  4JI4 F;  3NS7 B;  4NXN F;  2DIV A;  2FJV A;  4WZQ A;  2B5J B;  1LW2 A;  2CDR B;  3PYD A;  1HMV A;  1RT5 B;  2CJK A;  1GQE A;  1B0P A;  1SB6 A;  2K3I A;  1FE4 A;  1UJ6 A;  1UVM A;  3H98 A;  1UA1 A;  3SXL A;  1Z2L A;  2F1F A;  1FFG B;  2QJ3 A;  2RS8 A;  3BO3 A;  1MWZ A;  2OIH A;  2PI5 A;  5KOX A;  2ATC B;  2HIY A;  1NJX A;  3NMR A;  4HEA 9;  3DLE A;  3TZY A;  1HBM A;  2E5H A;  3UCU P;  2KT3 A;  4LRB A;  5F8J A;  2YKM B;  2UVW A;  1SPB P;  3DXB A;  4CYU A;  2WVD A;  1KOO A;  4X62 J;  2IDL A;  4ZHR B;  4K0K F;  4ECZ A;  3K7R A;  1U1O A;  1RAD B;  5HAN A;  3NGD A;  3LP0 A;  3KK1 B;  2IAJ A;  3AA9 A;  3C3L A;  5HBM A;  3G86 A;  3KLI B;  4J9M A;  5CYJ A;  4ILL A;  4YR2 A;  1TKD A;  1YJR A;  1K8A T;  4C8N A;  2GQQ A;  3FBE A;  4USV A;  3NWG A;  3W3S A;  3RU0 A;  4ECX A;  3H42 A;  4DL0 C;  4LSL A;  3NOC A;  2QLB B;  4MKY A;  1SJR A;  4L74 A;  2ZVS A;  2W9C A;  4TY8 B;  3EZU A;  3IP0 A;  2FY1 A;  1JJH A;  3MI7 X;  3M9M B;  2C22 A;  4FYW B;  5DG9 A;  5G4D A;  2R2R A;  2GHW A;  4CI0 B;  2ZHO A;  5KT3 A;  3BS9 A;  3A8J A;  1UMJ A;  1XTZ A;  1D3W A;  2ZOM A;  2C3P A;  3JQM A;  2AYB A;  2OKQ A;  2QA4 S;  3ZNU A;  4WCE Q;  1XMB A;  3RG6 A;  5J2P A;  3B78 A;  3MM6 A;  4ECT A;  1HWU A;  2FVP A;  4A8O A;  2AV5 A;  5A8R A;  2MY8 A;  5KFH A;  1HQE A;  3V6D A;  3R3T A;  2KJW A;  3VVT A;  3OR2 A;  3KDO A;  4ICL B;  1F6T A;  1KDN A;  2UZA A;  1SL1 A;  4DL2 A;  1NO8 A;  4XIU A;  3ZZR A;  4D3H A;  1VRU A;  2YQ3 A;  1UP1 A;  1YG0 A;  3B4D A;  2E1A A;  4I69 A;  1YRT A;  4QZV B;  4X66 J;  1KTV A;  4DV4 J;  3OJU A;  3KTQ A;  1QLN A;  4X4R A;  5D78 A;  3FBF A;  2RU9 A;  2HYI B;  1RA7 A;  4WP9 A;  3PKM A;  1UVJ A;  1SJ1 A;  3NKY A;  1O6X A;  4KO0 A;  2W2N P;  1FDB A;  2E1M C;  2R7R A;  2YWG A;  1RAG B;  3R5D A;  1MMN A;  2D7S A;  3JS9 A;  2YWF A;  3T19 A;  4I6A A;  4RZR A;  2MKC A;  2C2M B;  3M2U A;  2IM3 A;  5F9N A;  2RNE A;  2KXN B;  1M5P C;  2OP5 A;  2GO9 A;  1SJQ A;  4IH5 A;  1RWW B;  3FEY B;  2XYP B;  2BJE A;  1JLB B;  3W5X A;  2X1A A;  4NYZ A;  4BBY A;  2BW2 A;  1R6Y A;  4OZ1 A;  5CYQ B;  3DI6 A;  2BDP A;  1XR5 A;  4UQT A;  2VBW A;  2EFP A;  4DV7 F;  3T5J A;  3BSA A;  4F4X A;  2C28 A;  4EBD A;  4MKB A;  4RW7 B;  1FDN A;  4N5S A;  4QQB A;  2VQE J;  3MZI A;  1SJ3 P;  2A2C A;  4I4B A;  2M4M A;  4C8K A;  1MN9 A;  2B6A B;  4PQU A;  4DZD A;  2HS3 A;  2Z0G A;  1T9V A;  2WON A;  3ELH A;  1RTI A;  3S6E A;  4DR5 J;  2J0Q D;  5ETS A;  4X65 F;  3DRX A;  2DVI A;  3MUR P;  4J9S A;  2RD5 C;  1BXN A;  1HBO B;  4CO1 A;  1X9W A;  3K5L A;  5DJB A;  1UFK A;  1HNI A;  1LV5 A;  2DNR A;  3PW2 A;  4DG1 A;  2V4R A;  1RWP B;  1S1T A;  1FT8 A;  4DN9 A;  2N7Y A;  1ZM2 A;  2Q3P A;  2HNZ B;  3QWP A;  1HWK A;  1BGX T;  4DX5 A;  3N5F A;  4JB8 B;  3AOC A;  3BGR B;  4C0H A;  2GJF A;  3G8S A;  2KM8 B;  4HLB A;  3F73 A;  2BAN B;  2R8I A;  5E2Q A;  1SJ4 P;  5K8M A;  2WSF C;  4DR6 J;  5I3Q A;  2FZG B;  2ADC A;  1HBU A;  2RQK A;  2IM0 A;  4EO6 A;  2EFV A;  5LMN F;  4N76 A;  5SUH A;  5J2Q B;  4DZ6 A;  1SL2 A;  3MEG A;  2ACY A;  1J2V A;  4TU8 A;  4CT9 A;  3F41 A;  1J5O A;  2R7W A;  1J5E F;  3IWN C;  2Z58 B;  4CLL A;  2BOA A;  2VG6 B;  4P73 A;  5JVG Q;  3FQL A;  5DO2 A;  4A4J A;  1KRP A;  5KT4 A;  1FD8 A;  2IC3 A;  4YR0 A;  2VPX B;  2FJD B;  4USU A;  4IR9 A;  2A18 A;  4NCG B;  3W5Z A;  1H2U X;  1TL7 A;  3BM7 A;  2WAQ D;  4Y2I A;  1UWA A;  3I0S B;  1WC0 A;  2V68 A;  4P9S A;  2OEM A;  3M8S A;  3Q2T C;  3WIV A;  2Q6C A;  2W7A A;  5KFK A;  4O4G B;  2CQG A;  1IKW B;  2F9J A;  3UN5 A;  5HO4 A;  2FHK A;  2QGF B;  1NJW A;  1S99 A;  1U0H A;  3VAH A;  1QM9 A;  4NLG A;  1Y00 A;  1U2C A;  1KTQ A;  3G8T A;  1KON A;  3LPE A;  4A8Y A;  2VBX A;  2ZBP A;  5EX0 A;  1I6J A;  2OMO A;  1MWQ A;  3DXS X;  3RBZ A;  1LK7 A;  1URN A;  2FTR A;  4E0D A;  2F7V A;  4ZCL A;  1WTB A;  1N33 F;  4O3S A;  2HRU A;  4JI3 F;  2HHH J;  3HKZ D;  3IGN A;  3JAM U;  1NK9 A;  2M9K A;  1REV A;  2WOM B;  4AXI A;  3M1V B;  1S6P B;  2YNH B;  1RYS A;  1WKJ A;  1X5T A;  3GYX B;  3D28 A;  2C2Z B;  2DNN A;  4DPX A;  5HLF B;  1BWE A;  3HSJ A;  4IFV A;  3QO9 A;  4O3Q A;  4KHR A;  4OYX A;  4WYW A;  4DXL A;  4C0B A;  2O66 A;  2EVZ A;  4ZA1 A;  1JB0 C;  1W26 A;  3BGF A;  3NLC A;  2KFN A;  5E41 A;  5IM0 B;  1XWL A;  3GIM A;  3WDO A;  1CEZ A;  4P74 A;  1KQG B;  1U4B A;  2UVU A;  1S10 A;  2K06 A;  2GIF A;  4OLO A;  1S9F A;  3UCG A;  4Z7C A;  4LF8 F;  5ADZ A;  4WP8 A;  3DRP B;  3EIC A;  3EMT A;  1VBX A;  3H2U B;  3POT A;  5DDP C;  1JLF A;  4X4N A;  1HQ2 A;  2MXY A;  4YHH F;  3HX9 A;  4DCJ B;  2YPZ A;  1WEY A;  4GKK F;  4EZ9 A;  4OZ2 A;  1VOM A;  4AUK A;  2C3U A;  1IBC B;  4KV8 A;  4I7F B;  4DV0 F;  4HH0 A;  1Y9O A;  2VFS A;  2YKN B;  5IT4 A;  3FVY A;  3WC0 A;  4OI6 A;  1TAQ A;  3D54 A;  5I42 A;  4DBQ A;  5EUH A;  1UW9 A;  3OFF A;  2VA2 A;  1AUS L;  4XDD A;  1ZAW A;  2BXJ A;  2FLP A;  1SKS A;  3CJ2 A;  1VQ7 S;  2ZFH A;  1U02 A;  1ZM4 A;  2DH8 A;  2RRB A;  1LWF A;  2E44 A;  1WC6 A;  1IVZ A;  4MKV A;  3W9H A;  3VWS A;  3R7B B;  1YWX A;  4BHQ A;  2GJI A;  1JLC B;  2XEX A;  5KG0 A;  3IBW A;  4K4S A;  2R2T A;  2GVD B;  3OR1 B;  1L3U A;  4PG5 A;  1BQN B;  4O4R A;  1U6Z A;  1OMS A;  4LBP A;  4EGL A;  3CCQ S;  1JXE A;  2WVC A;  2HK2 A;  1HNZ J;  4IG0 B;  1F5C A;  5F3Z A;  2CQI A;  4S0M A;  1SC6 A;  3LA0 A;  2DB1 A;  4RWX A;  1FTR A;  1CVJ A;  1F5B A;  5BXI A;  3T5L A;  2L08 A;  1YJW S;  4Y00 A;  1N0V C;  1BQM A;  2K7K A;  1D9A A;  2E1P A;  3UE2 A;  4J37 A;  1C0T B;  4BWM A;  5KFE A;  4KKO A;  2KU7 A;  5IV3 A;  4MK8 A;  1F60 B;  2AWZ A;  2ZHA A;  4EWT A;  1RLD A;  3FJ2 A;  3HUL A;  4Q5V A;  4J9N A;  5GAD I;  5A8W B;  3TZX A;  2NZ4 A;  3GSI A;  3DLB A;  4ELV A;  1YJ9 S;  3W63 A;  4DR4 J;  3SBM A;  3QZ8 A;  1JJ4 A;  1Q5Y A;  5D4N A;  2ZC3 A;  1WSV A;  2Z57 B;  1VFJ A;  3P49 B;  2FD2 A;  3A8E A;  1R31 A;  2Q43 A;  4DWI A;  2K1R B;  2R7S A;  3QSY B;  1Q5V A;  2M8D B;  1E6Y B;  2RF2 B;  1S9E B;  3TO8 A;  1M1H A;  3EXY A;  1FKO B;  5H1S V;  4A48 A;  1JQG A;  3KK2 B;  2K7J A;  1KHV A;  2AD9 A;  3GIL A;  1B64 A;  5I3U B;  2CAJ A;  2V9W A;  1X7V A;  4CTA B;  4IQX A;  5AXK A;  5JXS A;  4AXJ A;  3OL8 A;  1TVR A;  2KRR A;  5F8N A;  1X60 A;  4DV6 F;  3GJQ B;  3T1A A;  3B8H A;  4QIW D;  9RUB A;  1WC5 A;  1P6T A;  3Q2S C;  1S1X A;  2P6T A;  3VQS A;  4DV1 F;  2RDI A;  4BS2 A;  4PXC A;  4QPT A;  2JZ5 A;  1V5V A;  3WIU A;  5DZ6 A;  4R5P A;  2Z8Q A;  1WDT A;  3Q8Y A;  4KIA A;  2E7X A;  3VCD A;  1DBD A;  4LFA J;  1ACM B;  5FD1 A;  4LQ3 A;  1B70 B;  2HVD A;  1C1C B;  4YY3 J;  3BF4 A;  3LP2 B;  3MMC B;  2E7V A;  4ED3 A;  1TMM A;  1F3F A;  3U1M A;  2DHX A;  4M5H A;  2B8Q A;  3T5K A;  3BDE A;  4OHV A;  4UZC A;  3CXC R;  3VAG A;  3M2V A;  5HI7 A;  2F9D A;  4JI2 J;  3IR5 B;  5CYM B;  3RRH A;  3O3L A;  3HT3 A;  1XNQ J;  1XMQ F;  2YWH A;  1XMO F;  4OMF G;  4I68 A;  3OT9 A;  1YBA A;  4FF3 A;  1SC1 B;  1M5K C;  2FZK B;  4O44 A;  3GMG A;  2MPU A;  3ENA A;  4NLQ A;  1LWC A;  1ZM3 A;  4DL6 A;  1OY8 A;  3JSY A;  4LFB F;  1Q78 A;  4MFB A;  4NXN J;  5AXL A;  3HHL B;  3L9Z A;  3O1L A;  1T03 B;  5B7W A;  2RAQ A;  4RR5 A;  4NRT A;  1VBY A;  1C0U A;  4FNH A;  5B0C A;  2AEF A;  4CNY A;  3CPW R;  1EQ0 A;  4K4W A;  4CO0 A;  1FFS B;  4DX6 A;  5IS2 A;  5DDR C;  2C1E B;  1CJU B;  3HPO A;  4AL5 A;  1HIY A;  3S7R A;  3UO0 A;  2ZD1 B;  5HJX A;  2XGP A;  1HPZ B;  2WK4 A;  5E3A A;  1KLN A;  1FNX H;  2K3K A;  1RTH A;  3H25 A;  4UF4 A;  1X0P A;  4TN2 A;  1QJH A;  4C0O C;  3SV4 A;  2ZZN A;  1FJG F;  1NSQ A;  5D8H B;  3W66 A;  3TUP A;  1HKA A;  3BB5 A;  4F02 A;  2XCP A;  2NYH A;  4K0K J;  3DDN A;  2HNY A;  5A6W A;  4X4U A;  5GAG U;  3I96 A;  4LRF A;  4KFB B;  1VHI A;  2DXF A;  2CFX A;  5KFT A;  3K5M A;  4GRS A;  5T41 A;  3DOL B;  3EPG A;  2CPI A;  4EO8 A;  1KP6 A;  2MYF A;  4JI6 F;  5J2M B;  3R6G B;  3V81 B;  2FC8 A;  2N7C A;  5F8H A;  2Y1R I;  1W2B R;  3CCR S;  3AD8 C;  4FF4 A;  2MQN A;  3BBF A;  5F8G A;  2MKI A;  2PI4 A;  2P8I A;  1WOO A;  5FJ4 A;  4DMZ A;  3L7P A;  1VI7 A;  1WI6 A;  3CUN A;  1RWK B;  3RAM A;  1MNE A;  3GCW P;  1ULR A;  3PEJ A;  3SSQ A;  2CPF A;  2CNO B;  4OYM A;  1ARO P;  4WFN Q;  1CPZ A;  3J80 U;  2HHV A;  4KGV B;  2I38 A;  5GAH U;  3MTK A;  5ETV A;  4ED0 A;  2MTL A;  2HFO A;  4NEZ A;  3CCW A;  2HQG A;  2J7U A;  2BE7 D;  3N79 A;  4W92 B;  4DS4 A;  3LP1 B;  3C6U A;  2K8G A;  4YB6 A;  2LDY A;  4HI2 A;  1ZAX A;  2IIH A;  2ZWP A;  4C8Y A;  1MN7 A;  1R0A B;  2JVO A;  3V6J A;  3WZ0 A;  1I51 B;  3PX6 A;  2MJN A;  1U6F A;  1T9Y A;  4MJK A;  3V4I A;  1SXL A;  4H4O A;  2B8P A;  3C14 B;  4ELT A;  4RLE A;  4K4T A;  3CME S;  2B4U A;  5H9F K;  1V9O A;  1K1Q A;  3E8O A;  5EDW A;  2EW9 A;  3IS9 A;  3DRR B;  5FDL A;  4J9Q A;  3DN9 A;  4IG3 A;  4AE5 A;  4L6V 3;  2DNG A;  4UTG A;  3FEX B;  5F3T A;  1RT3 B;  2GFF A;  3IA0 A;  1LWE B;  1TZ0 A;  1D9D A;  1FJE B;  4GKJ J;  2B9Y A;  3CSK A;  1HNX F;  2OPR A;  1JLA B;  1NSK L;  2KZZ A;  4TKT A;  1UEK A;  1GTE A;  4DSE A;  1Y10 A;  3PW7 A;  1KVJ A;  4XTT A;  4HYK A;  1NCL A;  3H5X A;  3K5N A;  4IO9 Q;  3OL7 A;  2EK6 A;  1YX2 A;  3HVT A;  3CO9 A;  3BR9 A;  3DHX A;  4OQJ A;  4V19 X;  1VQ4 S;  4B3S F;  2N4C A;  4Q7A A;  3RUB L;  2FJA B;  1ITP A;  1RLC L;  2ZNZ A;  3CCE S;  3E2E A;  3MMJ A;  1JJC B;  1RAI B;  2JFD A;  3MMA B;  1RE1 B;  4QWA A;  1DUR A;  5A8K B;  3PRB A;  5E3C A;  4NMX A;  3HHL D;  4L3K A;  3BQ1 A;  2LXI A;  1T8E A;  1CJT A;  3LAL A;  3PV8 A;  4F04 B;  4KYZ A;  1JLE B;  2ZH6 A;  5IXU A;  2PGC A;  3RW7 A;  3VTI A;  1UPP A;  1EP4 B;  4UUX A;  2CJX B;  4PYA A;  1Y11 A;  2DR6 A;  1B7F A;  1FFW B;  3I4H X;  1MU2 B;  1OWX A;  4ECY A;  3MEC A;  4QCL A;  3TP2 A;  3CDE A;  1I94 F;  4I2Q A;  4J9P A;  2JEF A;  4ZVO B;  5J1P A;  2HVZ A;  1Q7L B;  2ZZM A;  1MLA A;  1T11 A;  4MT1 A;  4C6A A;  2VKZ G;  2GML A;  1VQL S;  2KH9 A;  4A8S A;  5D3G B;  2MKS A;  3MEE A;  4DL4 A;  2JSX A;  4Z2X A;  5LMN J;  2JVR A;  2P9G A;  1TFW A;  3OPK A;  1S0O A;  2HS0 A;  4C11 B;  4OX7 A;  3A8K A;  2OTJ S;  3EDQ B;  4IDK B;  1UVK A;  4DUY J;  2X3G A;  1UVN A;  4A46 A;  1J5E J;  5ETK A;  2LQ8 A;  2DPJ A;  1IJE B;  4M5D B;  3P3D A;  2F40 A;  2WCX A;  3T3F A;  3DM2 A;  2G1H A;  3CDU A;  2H48 B;  3PR5 B;  4M1K A;  4F0H A;  3K0J A;  5LXR A;  2LU1 A;  2HFV A;  3MCO A;  4PWD A;  5E3Q A;  1ZET A;  3OV7 A;  4NOH A;  3ET6 A;  2W2O P;  2EFQ A;  3GV8 B;  4JYA J;  2CAD A;  3M6V A;  1M1G A;  4B3M F;  2AQ4 A;  1W25 A;  3DYA A;  3IR7 B;  1YZ7 A;  3I5B A;  2VKR A;  3QAE A;  3MM7 B;  5C25 B;  3C19 A;  2HQF A;  3MED A;  1S1U B;  4N56 A;  1BC6 A;  3G96 A;  1O8B A;  4RNO A;  4K2J A;  5D0G A;  3LH2 S;  2FHM A;  3O2I A;  4Y65 A;  3IBC B;  3DLH A;  2MB0 B;  4FYV B;  1X4E A;  3D1Q A;  1KN6 A;  1QE1 A;  4O0N A;  1N33 J;  2DNH A;  2NXU A;  2JRS A;  5D4L A;  1H98 A;  4JI3 J;  2VFU A;  4FZV A;  1U48 A;  3LO3 A;  2DY9 A;  1N54 B;  3BR8 A;  2C2D A;  1H73 A;  3E01 B;  2UVR A;  1JXV A;  5HMW A;  2BKO A;  4ZVH A;  1QSL A;  1A0O B;  2UUW A;  5HQM A;  3LOU A;  2Z56 B;  3GCX P;  2JH3 A;  1H3D A;  1WC1 A;  2ROE A;  5LT5 A;  1FRX A;  3RB0 A;  3TZW A;  4Y2K A;  4F26 A;  3N01 A;  3C15 A;  4YEA A;  4RUB A;  3NNH A;  3NGR A;  1KEK A;  2B43 A;  2V63 A;  3P5T L;  2VZ9 A;  2GAG C;  4JI8 F;  4A8K A;  4A8W A;  1TKZ B;  2R7T A;  2VPW B;  3GZ7 A;  2GHV C;  1XNR F;  2BJ3 A;  2DEI A;  4LF8 J;  2VB6 A;  1FHT A;  1QAI A;  2GX8 A;  1TL3 B;  1TUV A;  2XMW A;  2CRL A;  3D0G E;  1T95 A;  4YB1 P;  4I2P B;  1L3S A;  4YHH J;  4ZS6 A;  5ITH A;  5AXN A;  5F8I A;  2MZQ A;  3OUY B;  2M70 A;  4GKK J;  1S1W A;  3MM8 B;  2RQM A;  4B02 A;  2YNI A;  3GR0 A;  1I1G A;  4QWD A;  1WKL A;  2X7I A;  4KH0 B;  4PKD B;  5B0G A;  2XLI A;  1GK8 A;  4X2B A;  3DOM B;  4YS2 A;  4PEO A;  3KLH B;  4C97 A;  2RHS B;  3OXL A;  5KFC A;  2UP1 A;  2IYI A;  2M3D A;  3CMQ A;  3W2V A;  1YBU A;  5K8P A;  4Q8E A;  2GNK A;  3DLL Q;  2Z2Z A;  4IOC Q;  2HZC A;  1TMJ A;  3X1L B;  3E51 A;  3UVJ B;  4CQ1 A;  2QFJ A;  3TJA A;  3WX8 A;  2OLW A;  4DX7 A;  3MAA A;  3ZZT A;  4FNI A;  1M5S A;  2W4C A;  2MGZ B;  2QZ8 A;  1UZD A;  3MPD A;  2ZM6 F;  5BYR A;  2VG7 B;  2ZOG A;  4OYA A;  1N4L A;  1FWL A;  5CHC B;  3NBP B;  4R8U B;  4L72 B;  1PJ5 A;  1YZ6 A;  4X64 F;  4CP5 A;  4KE5 A;  4KPC A;  2V8P A;  4WTY A;  1RWM B;  3OTC A;  1VK3 A;  1EHW A;  2QSF A;  3FEZ A;  1NME B;  3FUY A;  4ZVT B;  1RP5 A;  1X5S A;  4ZP7 A;  4FF1 A;  1GH8 A;  5DDQ C;  2I2Y A;  2VPZ B;  3OXF A;  2PFD A;  2XBP A;  3D3B J;  1H2V Z;  1CC7 A;  2YX4 A;  3G6Y A;  3MFI A;  1T3O A;  2AMC B;  1S59 A;  1FTC A;  4NML A;  3V5R A;  1J27 A;  4TXS A;  1SC4 B;  1AB8 A;  1L3T A;  2MKJ A;  4XDC A;  1VQ8 S;  2ZUG A;  4J9U E;  1QY7 A;  1FDD A;  4WE1 B;  1CQN A;  3R7S B;  1BMQ B;  1X4F A;  2KHC A;  4F0M A;  2D3U A;  4BWJ A;  5H9E K;  4GMK A;  3L7U A;  2M2B A;  3FBB A;  4XO0 A;  3O6Q A;  4HDG A;  1T9X A;  1T02 A;  3FZB A;  3BPS P;  2C2R A;  4JI7 F;  2G1D A;  4PUO B;  1M90 T;  5CAA A;  2F3J A;  5M2U A;  3JAM Y;  2DR5 A;  2WW4 A;  4FS2 A;  1PSD A;  2Z2M A;  4QW8 A;  3HZG A;  3HO1 A;  1K0V A;  2DGS A;  4PPZ A;  1ZBT A;  3QFH A;  4X62 F;  2KTQ A;  2KJV A;  4HAC B;  3M8Q A;  2IJN A;  4K4U A;  2RB7 A;  1B0V A;  3HJF A;  2OPS B;  3KWM A;  4KSE B;  4NE9 C;  4HT5 A;  1DY3 A;  4ZVP B;  1OSD A;  3D66 A;  5CD4 A;  1F0X A;  2HWH A;  2C2O B;  5ETO A;  2YQ1 A;  4ECS A;  3W7B A;  1EIY B;  1TU0 B;  4DV1 J;  1VMB A;  1SQG A;  5B08 A;  2HAI A;  1RT4 A;  1S76 D;  1S4E A;  5L1K A;  3BKT A;  4NLX A;  2EEY A;  2JEI A;  1X5P A;  3K59 A;  4QR2 A;  3I0R A;  1TEL A;  2HLU A;  4OZN A;  4IH7 A;  3DGP A;  3J7A 1;  1HYS B;  1LW0 B;  2B4P A;  2RHQ B;  3NCP A;  3LW5 C;  3SEO A;  4PRF A;  1IR2 A;  1YJU A;  1ICE B;  5JVH Q;  1SC3 B;  3FK4 A;  4X4V A;  1HQU B;  1O5J A;  3PO4 A;  1HAR A;  1FEE A;  1KLM B;  4PZV A;  1EET B;  4JV1 A;  2ZJR Q;  5I3P A;  3BJY A;  5B0D A;  3JYT A;  5KG1 A;  3IRW P;  1XMQ J;  1FK9 A;  7FD1 A;  1MMD A;  4RW4 B;  4F3Q A;  2VIH A;  2V0N A;  4RPF A;  3A1Y G;  2XSJ B;  2KKH A;  2KDO A;  1OSC A;  4ZCK A;  1IKV B;  2YX1 A;  1N36 F;  4OI4 A;  3KHR A;  2CVE A;  4DSJ A;  5K8N A;  1R8H A;  1QAY A;  2HIQ A;  1V3R A;  2EKY A;  3MOZ A;  1PAU B;  3GU0 A;  4M5L A;  3IAS 9;  1WUU A;  2V4J A;  2R7Q A;  1T0T V;  1TKX B;  4PAA A;  3MPV A;  3QGH A;  3AOA A;  1OJ4 A;  3BEG B;  5CCM A;  5KFY A;  2XB2 D;  2MQM A;  4XAK A;  3IC1 A;  1RT1 A;  3VGV A;  1JXL A;  1WG5 A;  4OI1 A;  1ZH5 A;  3U1N A;  2V2V A;  5HRO B;  3MUT P;  3HMJ G;  4RNM A;  3M9O B;  3GG1 A;  2DH7 A;  2E5G A;  1N6Q B;  4WXO A;  4KAI A;  3OBI A;  1CUL B;  4DQQ A;  2VJU A;  1Y5N B;  3V4M A;  3DOK B;  4N8N A;  1T9U A;  2DNY A;  2IMW P;  3FFI A;  4N41 A;  1DJ0 A;  1VK8 A;  2ZDO A;  1MSW D;  2OEK A;  4OYP A;  2B9X A;  3GTY X;  2X3D A;  3IWX A;  1PIE A;  5CZV A;  2A6O A;  1RAE B;  1YHQ S;  3R2C J;  2Y1I A;  5ETN A;  1YRU A;  1XEZ A;  3FMW A;  4UZB A;  2Y3Y A;  1S6U A;  3UR0 A;  3PIP Q;  5THW A;  3P6Y C;  2HNZ A;  1KSP A;  4JI6 J;  2KXH A;  4P2S A;  1AUD A;  1NDK A;  2MQQ A;  2W8K A;  2BKN A;  2N3O A;  2HK3 A;  5D0H A;  4ZP9 A;  4B3O A;  3G71 S;  2JOQ A;  2N4D A;  2X1B A;  3Q8V A;  2YNF B;  4WII A;  1D1U A;  1Q4R A;  3KJQ B;  2CDQ A;  2BA9 A;  2CQ1 A;  3ILJ A;  1N32 F;  1VIO A;  5H9F J;  4DSF A;  5FII A;  1LW2 B;  5D0E A;  1VGY A;  3EYZ A;  3CUL A;  1FRL A;  1RZM A;  3W2W A;  3UWT A;  1R6V A;  3Q23 A;  4AL6 A;  4CM0 A;  1RCX B;  3LAM A;  4LR7 A;  1IBK J;  3A3N B;  4OHW A;  2ZC4 A;  2HWT A;  2VG6 A;  3DLE B;  1Z4U A;  3EGW B;  2ILZ A;  1R8B A;  1NDL A;  4C48 A;  2DRB A;  1HBM B;  4DUZ F;  3T41 A;  4NCG A;  3EVW A;  1UFL A;  1PBA A;  3SCI E;  3I0S A;  3TA2 A;  3AQP A;  5MAO A;  1WF0 A;  4CYU B;  2EBG A;  3CB4 A;  1Q95 G;  1FRJ A;  4O4G A;  1F1B B;  2QO3 A;  5F9L A;  2BJ9 A;  3NGK A;  5GMD A;  4YQW A;  2BX6 A;  2LCW A;  3ULH A;  2L9N A;  2IAJ B;  4NYP A;  2HPU A;  2CWK A;  5HBM B;  2Y0S D;  4LR8 A;  4CLU A;  2H5J B;  2BJ8 A;  5LM7 E;  1M5H A;  3DU5 A;  3L95 X;  1UAW A;  2CKW A;  3QPI A;  3OTO J;  1RBA A;  4EEY A;  4JI1 F;  4V19 J;  4LSL B;  4BLG A;  2ZH8 A;  4DR3 F;  1RHU B;  4M5J A;  4LFC F;  2W9C B;  4X4O A;  4P72 A;  1NHV A;  4B9V A;  1RAO A;  5F41 A;  2HGN A;  4KGX B;  4UQG A;  1S6P A;  4PQA A;  1VQ9 S;  2PMH A;  3THV A;  2QSW A;  3W60 A;  4B3S J;  2J9D A;  1U6B A;  2KN4 A;  1PIL A;  3OVA A;  2MKK A;  3AFG A;  4KT0 C;  2VON A;  5KFS A;  4L73 A;  1CS4 A;  1TUG B;  1TP7 A;  4TQS A;  5DM7 Q;  2R8J A;  3GIK A;  1GFW B;  4N77 A;  3DNC A;  2FQQ B;  4ENO A;  4MMO A;  1JJ2 R;  5J2P B;  1FNO A;  3TUI C;  1NEE A;  1CJK B;  5A8R B;  2VC1 A;  2CJY B;  1NPR A;  3UW1 A;  4ETX A;  1O51 A;  1HQE B;  3V6D B;  2CQH A;  1IJF B;  2LMI A;  4NZ6 A;  1FE0 A;  3AD9 C;  3SCK E;  1NRK A;  1S4F A;  1WEZ A;  3DMJ A;  4NLV A;  2CJQ A;  2RUG A;  3ENV A;  3ILI A;  1VRU B;  3TUJ C;  4C98 A;  4LUB A;  1SH3 A;  1RT7 A;  1S77 D;  1PJ7 A;  3NS5 A;  3TAM A;  4ZPW R;  4DQS A;  3T6J A;  4K59 A;  4YOE A;  3P5B P;  3R27 A;  4LIR A;  2F8H A;  2HUR A;  4FPR A;  3ZFV A;  1N5Q A;  4OZL A;  2W2M P;  3HJV A;  4KO0 B;  2XLJ A;  2AJQ A;  4L76 A;  2ZHB A;  2OAU A;  4PR6 A;  2CJA A;  4UOH A;  4BC7 A;  1IXK A;  2DO0 A;  5JMN A;  1R43 A;  3WQP A;  1KQK A;  2NSB A;  3DRS A;  4CO2 A;  3AT1 B;  2RKI A;  1EQM A;  3M32 B;  4NA2 A;  4JI0 F;  4ZPB A;  1JKH A;  3R1L A;  3FC9 A;  2DNL A;  2FC9 A;  3KG4 A;  3MCS A;  1G4C A;  2D3Z A;  3N6L A;  2IBK A;  1NH7 A;  4PG4 A;  3CCS S;  2MKY A;  1D9F A;  4LRC A;  3QGI A;  3J80 Y;  3M8Y A;  5J2N A;  3DI6 B;  3GFY A;  1R27 B;  2XMK A;  1FDA A;  1HL6 A;  1FRK A;  2RDD A;  3H90 A;  2XCA A;  1HD0 A;  3NMA A;  2CA9 A;  2OSQ A;  3DHW C;  8RUC A;  2J0X A;  4DCO B;  2WZ1 A;  3D4J A;  2ASY A;  6FD1 A;  4Y0F A;  2RIJ A;  5RUB A;  4C8M A;  2GA7 A;  1IN0 A;  1KBR A;  4B3M J;  3LF0 A;  1WOS A;  2WON B;  4CLK A;  1TL1 A;  5KFM A;  4DV3 F;  1X4A A;  2HFN A;  4DOZ A;  2GGP A;  3K5O A;  1G7C B;  2IYG A;  1UKU A;  3QJL A;  1HNI B;  3OFE A;  4DG1 B;  1S1T B;  3PJ9 A;  3QIP A;  1QUP A;  2DRD A;  1U1M A;  4IYQ A;  2IBO A;  1IM6 A;  3ENQ A;  4DCP B;  3KLG A;  3M2R A;  1HNZ F;  2HZV A;  5J1N A;  1QAJ A;  1REG X;  4Y34 A;  1FXD A;  3FGV A;  4OJ1 A;  3CD5 A;  2CQ3 A;  8AT1 B;  3FSX A;  1SV5 A;  3R5B A;  4KGZ B;  5ETQ A;  1HBU B;  3ZNJ 1;  1VQS A;  3LQV A;  3QT6 A;  3GPA A;  1ZS6 A;  3MEG B;  1E6Y A;  4RW8 A;  5GVQ A;  2EG2 A;  3NCQ A;  3TJ8 A;  2QMU B;  1NZA A;  1PO6 A;  3KK2 A;  1P1T A;  3PYE A;  1EJ7 L;  1X4H A;  5KFA A;  1NU4 A;  3PX4 A;  2QL5 B;  2HQC A;  2IC3 B;  2LA4 A;  3Q0A A;  5DS7 A;  3W61 A;  5A0Y A;  4WKR A;  4ZMM A;  1TL7 B;  2AZ3 A;  3KNG A;  3LGN A;  2ZDP A;  4QR1 A;  1Q0N A;  4TVA B;  3G6X A;  4ZN3 A;  4Q45 A;  3PXG a;  2UV8 A;  4PCQ A;  3CJT A;  3I9Z A;  2XI3 A;  4ZN1 A;  3OTE A;  3ITH A;  7FDR A;  2CZ4 A;  2Z4P A;  1QSS A;  2RU3 A;  3MMB A;  1HWL A;  4XPC A;  3MCM A;  3I4P A;  4KGK A;  3BBC A;  3G87 A;  3RYL A;  1NJZ A;  3QSI A;  3EZO A;  2H1Y A;  1VC6 A;  2LQ9 A;  4USK A;  3H20 A;  4FVC A;  3UDV A;  1S72 S;  5IT9 U;  3MMC A;  4ED7 A;  2RE1 A;  4ITS A;  1SIW B;  2V94 A;  2D9P A;  1YIT S;  2DNQ A;  4WTO B;  5KT5 A;  3KMS A;  2DKO B;  3RB4 A;  4OHZ A;  3MPU B;  1S9G B;  1REV B;  2VFT A;  2CG8 A;  2XMM A;  4WFX A;  4ZPC A;  2VUG A;  4GVB A;  1V3Z A;  1MW7 A;  3MR2 A;  1LQ9 A;  2JEG A;  2KVI A;  4IFV B;  5KFF A;  3QO9 B;  3IRX A;  2V50 A;  1N5T A;  2QEX S;  4WFZ A;  4DFK A;  5EWE A;  4X64 J;  1T03 A;  3L3C A;  3BKF A;  4JI2 F;  1YJV A;  2GQ2 A;  5C2G A;  1U26 A;  3BSC A;  3SSR A;  3JSM A;  1X4D A;  1NDP A;  3PCO B;  4NLR A;  1CJU A;  2F8M A;  2ZBC A;  2R7U A;  1Y3J A;  3POT B;  1JLF B;  2YPY A;  3UQS A;  2VD3 A;  3CCU S;  1VR6 A;  1IWG A;  2IMO A;  5HK4 A;  1S0V A;  4WZM A;  3VAM A;  5BYS A;  4CDI A;  4JP8 A;  2Q79 A;  2FLL A;  5GAD U;  3CDB A;  3R5J B;  3ENW A;  5I42 B;  2NUH A;  4ECV A;  4O3P A;  1U49 A;  2AJ0 A;  2N82 B;  1JIH A;  2G4B A;  2ZJQ Q;  1P1L A;  2AJF E;  1LWF B;  4JI7 J;  4QR0 A;  1SCJ B;  2HFS A;  2QIF A;  1GMU A;  2C2K B;  1B0T A;  4EYH B;  4B9T A;  3IO1 A;  1UEV A;  2POK A;  2EKN A;  3V81 A;  2JC1 A;  1QDU B;  3AHP A;  3US5 A;  5L46 A;  5IC4 B;  3TYT A;  1TKT A;  2LXU A;  2RRN A;  4CO4 A;  2CPY A;  3IFE A;  2PMW A;  3PAC A;  1PYO B;  1FKP A;  3FBC A;  3IM8 A;  4C2M A;  2XO6 A;  4P2F A;  1Q86 T;  2IFX A;  1BQX A;  5LXY A;  4LF7 F;  4Q44 A;  1ZM9 A;  3W8G A;  1IKY A;  3F44 A;  1VQN S;  3B82 A;  2DTJ A;  1RTJ A;  2JHE A;  1BQM B;  3MM9 A;  4OI3 A;  3LP1 A;  2G2Z A;  4ERD A;  1KD1 T;  4KKO B;  4L75 A;  5IOL A;  3CJK B;  1B99 A;  3PYG A;  5LSO A;  3GFX A;  4GO7 X;  3NAH A;  1RU1 A;  4IKA A;  3MFH A;  2CQ4 A;  1NKB A;  5KFI A;  1VRT A;  2H54 B;  2XGQ A;  2DXE A;  1ZYQ A;  4OI2 A;  3TAP A;  2VFR A;  3PZP A;  4YP3 A;  2YKP A;  3HF5 A;  3C14 A;  2IVY A;  2HMI A;  2VBZ A;  1WD6 A;  4EFA C;  2QV6 A;  2UXC F;  1QUV A;  2E7W A;  2H5I B;  3NWR A;  1N36 J;  1VQY A;  1HW9 A;  1RTD A;  2OUG A;  4G1P A;  1K73 T;  4IR1 A;  2YNG B;  4P7V A;  4FDF A;  2NPF A;  5HVF A;  5DZ7 A;  4UUW A;  5HAT A;  5L1I A;  2DHA A;  1M5V C;  2HFU A;  2NLW A;  5HQL A;  4YB7 A;  2AJ1 A;  2VQF F;  3OW2 R;  4JOU A;  2MSS A;  4NZ0 A;  2WBM A;  1UZH A;  2W4D A;  4Q2M A;  5A2Q U;  2YQ0 A;  3CF5 Q;  5LJ3 Y;  4W98 A;  3ISN D;  2QG9 B;  1TVR B;  3ISN C;  4RNF A;  2GCF A;  1RHJ B;  1S0M A;  5A76 A;  1EZZ B;  4GKJ F;  1C1B A;  2MEW A;  3GJS B;  4G1Q B;  5GAE U;  2KXF A;  4F0K A;  3TAR A;  1S1X B;  1IWA A;  1BY9 A;  3VGU A;  2HQD A;  4R5P B;  2HHU A;  3BN4 A;  1RSC A;  4LF6 F;  4ECR A;  3MR5 A;  1HI0 P;  3FNN A;  4O0I A;  4KBI A;  4Q8F A;  2H4W B;  3MD3 A;  2W25 A;  4IRC A;  1SI9 A;  4ZJQ A;  1WF2 A;  2DY1 A;  2HHQ A;  4K8R A;  5GMK a;  1UWB B;  2AYM A;  2FPH X;  5KT2 A;  1RWX B;  3DLK A;  2HVI A;  4K4Y A;  4UY8 T;  2C42 A;  2Y8W A;  1GEH A;  3VAF A;  4LR9 A;  3QRR A;  2R4F A;  1NK6 A;  4ES1 A;  1RHQ B;  4J91 A;  1HI8 A;  1LK5 A;  2KYX A;  1UEU A;  3KNA A;  3TQE A;  1U24 A;  4EU0 A;  1GXT A;  2AKW B;  1HHQ A;  4JV0 A;  2DK2 A;  4QW9 A;  3HLU A;  4O44 B;  4WXW A;  5KFB A;  1LWC B;  2HG4 A;  1S48 A;  4MFB B;  4I6W A;  2KG1 A;  1S97 A;  4Y2A A;  1N32 J;  4CH1 A;  2V34 A;  1H0H B;  2UUB F;  2VDI A;  1D09 B;  1F9H A;  1LNQ A;  4NYO A;  1C0U B;  2B4O A;  1IBM F;  2BAC A;  4HT7 A;  5EX3 A;  4WKY A;  3KJV A;  3Q8Q B;  1S6Q B;  4QIG A;  2BYC A;  3W62 A;  5DGB A;  3D6T B;  4P2X A;  1ZTT A;  1RTH B;  4X4Q A;  4ALZ A;  4DUZ J;  4J9O A;  4AND A;  2XY7 A;  4GC7 A;  4OX8 A;  5KG5 A;  2LXF A;  2VFV A;  3HSZ A;  1NUE A;  2OD6 A;  1JLG A;  2XY5 A;  1ZA2 B;  3OFG A;  1NK7 A;  3AXM A;  4CLF A;  1NH8 A;  4ES3 A;  4AQY J;  5IWA J;  1G3O A;  4ZPA A;  2MZT A;  4DUY F;  4DV5 F;  2EG1 A;  3CED A;  4Y28 C;  2ZNY A;  2H9Z A;  1NM2 A;  3D6F B;  3MM7 A;  3R8Y A;  4FS1 A;  5FLX U;  2JLE A;  3M6X A;  1NBE B;  2FHJ A;  3BYP A;  3SQG A;  4QPX A;  2VG5 A;  1D0E A;  3AB4 B;  1WSR A;  2YKA A;  3M05 A;  1M1K T;  1AXQ A;  1B7Y B;  1GX6 A;  1XJW B;  3CCT A;  5LMU F;  4JI1 J;  1S79 A;  2HVH A;  4M5I A;  2AU0 A;  3HFK A;  4DR3 J;  1K1S A;  2OPQ A;  1HWI A;  3DCA A;  4JYA F;  4LFC J;  4Q0B B;  2ZH9 A;  4DEZ A;  4X4P A;  2NR0 A;  4P6Q A;  4ZLJ A;  1IQZ A;  2B7C B;  4K5S A;  2XI2 A;  5L9N A;  1X4B A;  1RWO B;  1QD1 A;  1T05 A;  1IR1 A;  4USI A;  1RQ0 A;  1MML A;  3ZTP A;  2DNZ A;  3MR6 A;  3ADA C;  6FDR A;  2ATL A;  3W9J A;  3DDI A;  3VR1 A;  3LTO A;  2VF3 A;  1KVI A;  4ZVS B;  3AAW B;  3C6U B;  3A3P B;  3AJ1 A;  4TY9 A;  4DUT A;  1E6V B;  5HN0 A;  3HDS A;  4ZIV A;  3IMQ J;  4I0W A;  1YTY A;  4OI0 A;  3U02 A;  3L7O A;  4OYO A;  4DSL A;  1CG2 A;  3MEK A;  4FF2 A;  3HCX A;  4FP9 A;  2PSZ A;  4ZVF A;  1A9N B;  4KY3 A;  2LEB A;  1RK8 A;  4P10 A;  3V6K A;  1Y5I B;  2VJV A;  4K5R A;  4JI5 F;  4H4O B;  1NND A;  3IN5 A;  3OUY A;  2ZZT A;  3CC7 S;  4H4M B;  4N8O A;  1U47 A;  2V8G A;  5IV4 A;  3GFZ A;  3IS9 B;  4EMD A;  1HFE L;  4Q2L A;  1P9Q C;  5FDL B;  1TTH B;  2U2F A;  2PMZ D;  3OD2 A;  1VQM S;  5F0U A;  1RT6 A;  2RML A;  3VVU A;  2NRE A;  2MLY A;  5DM6 Q;  8ATC B;  2OPR B;  3EPI A;  5D77 A;  2WVE A;  4EUV A;  4OYI A;  3C2P A;  4JI0 J;  3J7Z T;  3NY0 A;  3VAK A;  1HNV A;  3UVJ A;  2DNO A;  2GIQ A;  5AT1 B;  3FRZ A;  4LT6 A;  1DQ8 A;  5AJ3 F;  1U25 A;  2GVZ A;  4PWU A;  2CJ9 A;  4DLE A;  3GII A;  2W9B A;  1WG1 A;  2QYC A;  1V6H A;  4LJM A;  3CJS A;  2HND B;  2DHH A;  2MGZ A;  2QX0 A;  3HK2 A;  5KG6 A;  3MM5 A;  4Z37 A;  1S1V A;  3MR7 A;  2AYG A;  2LKZ A;  2DH9 A;  4MK7 A;  1N0U A;  1FI4 A;  3TAQ A;  2COL A;  4DV3 J;  4NA3 A;  2RQC A;  5IC6 B;  4B3R J;  4URG A;  1CLF A;  4R25 A;  2B0G A;  5CA5 A;  2FIU A;  4J5O A;  3D1O A;  4E8U A;  2I8E A;  1WHV A;  2CVI A;  2KM8 C;  4JUZ A;  4E98 A;  3CD0 A;  4OJH A;  3QT7 A;  2J0W A;  2CPH A;  1NKC A;  4RX6 A;  2WBR A;  3MEC B;  4WE1 A;  3IG1 A;  3EX7 B;  4CLW A;  3TW0 A;  1KFD A;  4M63 A;  3N4W A;  1N5Y B;  2L41 A;  2Q6B A;  4YME A;  3M4X A;  2OGU A;  4URQ U;  2ROG A;  3K5P A;  2FJX A;  4I2Q B;  5DG7 A;  4IQM A;  2A1B A;  4U7U K;  4ECU A;  3A8I A;  2XHW A;  4H4K C;  4B17 A;  5KG7 A;  2B4V A;  1Q1K A;  2G0J A;  3MEE B;  3LGM A;  3FMB A;  5IQ6 A;  4UW2 A;  3KLE A;  2ZH2 A;  2WTF A;  3CD7 A;  2JX2 A;  3AB2 B;  2FZC B;  2CYY A;  3BBB A;  3RB6 A;  2KZM A;  2J8S A;  3IWL A;  2F5G A;  1GXU A;  4YUD A;  1KNZ A;  4NI2 A;  1SBR A;  2XMA A;  2ZVI A;  1WC4 A;  2BQ3 A;  1UJ4 A;  3DM2 B;  4R0J A;  1KQF B;  1R89 A;  5IT0 A;  4GVL A;  4I67 A;  4P71 A;  2OPS A;  1DTQ A;  1H7X A;  2EK1 A;  4LSN A;  4YDD B;  4PWD B;  3EVM A;  4MYT A;  5KFL A;  3ZZP A;  3GV7 B;  2V2Z A;  2PEH A;  1GTH A;  2DGV A;  2MZ1 A;  3DYA B;  2RSQ A;  3QBC A;  1KOH A;  3IBF B;  3AA8 A;  1F2G A;  1HHS A;  1RI7 A;  4ZVG A;  4DLG A;  2CQ2 A;  1WKK A;  4OZ5 A;  2UVV A;  1HWJ A;  1HYS A;  4DPU A;  2KVQ E;  2D69 A;  3D5M A;  3JSB A;  4ILM A;  1QE1 B;  2C3O A;  3IGV A;  4HTI A;  2QLX A;  1KLM A;  4USH A;  1URR A;  2LEC A;  3CCZ A;  5HJY A;  9ATC B;  4MAK A;  5E33 A;  2IJR A;  4QBU A;  2IA6 A;  5KFV A;  4RNN A;  4PG6 A;  4PPD A;  3QID A;  2FB0 A;  4RW4 A;  1VC5 A;  3SFG A;  2GMJ A;  2M88 A;  2W2Q P;  2XSJ A;  3VV2 B;  1UTA A;  3M8Z A;  3C15 B;  4USM A;  2R7X A;  4DQI A;  4LF9 J;  3X3U A;  4U67 Q;  4DPO A;  3CWJ A;  1RBL A;  2CQP A;  4IO1 A;  3PO5 A;  3HM9 A;  3K89 A;  3CVK A;  1I3O B;  5KFP A;  1YJ7 A;  2RUS A;  4A8F A;  4RW9 A;  1U1R A;  4NRU A;  4M8L A;  2FVS A;  1Q7Y T;  4ZJO A;  3SV3 A;  4Y2M A;  4HHH A;  3OHA A;  1SUQ A;  4Z7Y A;  1G1X A;  2OPP B;  3CJ5 A;  1RWN B;  1AA1 B;  1GNK A;  4LBH A;  1YIJ S;  3ILL A;  5E3R A;  1CUL A;  2R3V A;  1S1W B;  4DV2 F;  2YNI B;  3HFV A;  4LIW A;  3ETM A;  2NPI A;  4TU9 A;  2LLZ A;  3U1L A;  2OI2 A;  2PA3 A;  4DN0 A;  4FN5 A;  4JV2 A;  4TYB A;  1Q81 T;  3O44 A;  3AQO A;  5GAE I;  2V2Q A;  2WHO A;  3WBZ A;  1X4G A;  3ILO A;  3M8P A;  1ELO A;  3TA1 A;  2Z2Y B;  1ZPV A;  3SDE A;  2XLK A;  4ANE A;  3LPY A;  4RL1 A;  3M7V A;  3CC4 S;  1IKX B;  2OJ3 A;  5C7P A;  2V69 A;  3O8W A;  5ETL A;  4RW6 B;  3JTN A;  4DFJ A;  1TK8 A;  3RBD A;  3PM9 A;  2QL7 B;  3DLG A;  3MAA B;  1ZZN A;  2J6U A;  2KFZ A;  2G0C A;  2ZKT A;  5L38 A;  2Z30 B;  1Z1Z A;  4ILR A;  4QOT A;  3R97 A;  3AOB A;  2I6W A;  2CXE A;  1AYE A;  2VOD A;  1DAR A;  2V2K A;  1SJF A;  2AZ1 A;  2KYZ A;  4QJV A;  2UXB J;  1ZA1 B;  3SIP B;  4IOA Q;  2CPZ A;  4LF7 J;  3CJR A;  2D9O A;  2AEM A;  4KQZ A;  3ZTQ A;  4RNH A;  2H51 B;  2W9A A;  3VZH A;  3PR4 A;  3BH7 B;  1WI8 A;  4FYY B;  2DO4 A;  1K44 A;  3T9N A;  4OL8 A;  4NWB A;  4USW A;  4KJI A;  4K2X A;  3PW5 A;  4WPA A;  3CC2 S;  4C7Q A;  4LSZ B;  2OFH X;  4F36 A;  3OL9 A;  3TRG A;  3W65 A;  2GHP A;  2GW8 A;  1XK8 A;  2CPJ A;  3QT8 A;  5J1E B;  5B0F A;  1WOR A;  1XC9 A;  1QVF R;  3M8W A;  1O0P A;  4I6Y A;  2VBY A;  1M0S A;  4UOF A;  4ZPT R;  2E9R X;  3NG8 A;  3SYZ A;  4U8Y A;  4U6P A;  4O3N A;  2ALZ A;  3VQT A;  4OFZ A;  1IBK F;  4D3G A;  4LF5 J;  4NCA A;  1XER A;  5F0W A;  2UXC J;  3OTB A;  3BO4 A;  2PE8 A;  5IT9 Y;  5LOQ A;  2DYA A;  3WX4 A;  5E0O A;  4ID5 A;  2F4V J;  1OY9 A;  4ID8 A;  2Y8Y A;  4A47 A;  2XMU A;  3H8Y A;  2PD1 A;  1S12 A;  2ROP A;  2DNP A;  4ZPV R;  1RGV A;  4DF4 A;  1TL5 A;  4UST A;  2OEL A;  1FWK A;  2ZIT A;  2ZE2 A;  3CGI A;  3W5Y A;  1Q79 A;  4NLS A;  3HVA A;  2VQF J;  1N56 A;  3M8Q B;  2UV8 G;  4B9U A;  2C3M A;  4RO0 A;  3C16 A;  2ZH3 A;  3PJX A;  1KQS R;  1WAC A;  2FY8 A;  2QFI A;  5CH7 B;  1UET A;  3CCL S;  4K4Z A;  2DR8 A;  5KFG A;  4DSI A;  4ZIW A;  2HHT A;  2XS5 A;  2PII A;  4G1I A;  2D74 B;  4OV6 A;  1CJV A;  3OTO F;  1X5O A;  2FUG 9;  1OO0 B;  1CJK A;  1RT4 B;  3BGL A;  3GON A;  2M7S A;  1KC8 T;  1QSY A;  3MDF A;  1RB0 A;  2KHD A;  3S8S A;  4FBT A;  4LF6 J;  5BR8 F;  1AZS A;  3H4D A;  3I0R B;  4WIQ A;  1APS A;  2BQR A;  3DGP B;  3T1H F;  3QAT A;  1XIQ A;  3N5B A;  1RHK B;  4FYD A;  2AHO B;  1LOU A;  3C6T B;  2IRU A;  4PXE A;  1MRO A;  2HQ3 A;  2Q1L A;  1FD2 A;  2W01 A;  4NLY A;  5BYQ A;  1AFJ A;  4PWW A;  1V3S A;  3Q24 A;  2CQC A;  2QA1 A;  3M9N B;  4KPY A;  3E3X A;  3JYT B;  3Q86 A;  2VOP A;  3KLF A;  1FK9 B;  2B9E A;  4J9R A;  1U45 A;  3HHL C;  2L3M A;  4DFP A;  2ZJP Q;  4KR0 B;  4L3N A;  3OTD A;  5K14 A;  1RAJ A;  4F4Y A;  2WRM A;  5CQG A;  5C24 A;  2E29 A;  5CXT A;  1SKR A;  1DQA A;  4NX9 A;  2MHE A;  2M5Y A;  4CH0 S;  3TZZ A;  2UUB J;  4HKQ A;  3UDE A;  1RUS A;  3M32 A;  4B9S A;  4AL7 A;  2V4J B;  3UD5 A;  5BJR A;  2WVB A;  3MUV P;  2CNK B;  4URS A;  1IBM J;  1HNW J;  2LFV A;  1YSJ A;  1NKE A;  2DEJ A;  3I82 A;  3RBE A;  1U1K A;  1YJT A;  1RT1 B;  4RBT A;  3J7Y I;  4DSK A;  3GFH A;  1VRQ C;  5EGY A;  4PG8 A;  1GXL A;  4DU8 A;  1SVD A;  2HVE A;  4CLS A;  4F2S A;  3R9L A;  4JV5 F;  1SH2 A;  3DU6 A;  2CNN B;  3FFI B;  2CZV C;  3BGU A;  2BMB A;  3H5S A;  2NS1 B;  1UVL A;  4DV5 J;  2KRB A;  4ES2 A;  4FPI A;  4KB7 A;  3TJ9 A;  2AEJ A;  3D2W A;  3T6B A;  2BV3 A;  1DQ9 A;  1NAQ A;  5E3P A;  2K2P A;  3VZI A;  2E9T A;  4FYX B;  4RUA A;  4NPO A;  5LL6 d;  2LVW A;  2BE9 B;  5LMU J;  2HWI A;  2QL9 B;  1YRX A;  2EFG A;  2V6A A;  2DGU A;  2DIS A;  3OJS A;  1TV6 A;  5IQQ A;  2ALY B;  3N6M A;  1DLO A;  4B3O B;  3U27 A;  2YWW A;  1YI2 S;  4DPW A;  3KK3 B;  4ZP8 A;  5E7O B;  2NSC A;  3HZE A;  2BEF A;  5K20 B;  2LQ5 A;  1GMV A;  1WF1 A;  2IY5 B;  2OO4 A;  4YFU A;  2CNL B;  4HHJ A;  2PO4 A;  2J8A A;  1RJJ A;  3W2W B;  5C42 A;  1FES A;  1S6O A;  1RXO B;  4Y2C A;  1AW0 A;  3ZC4 A;  2YBV A;  5A2Q Y;  2NYI A;  1DTT A;  4NLO A;  1H72 C;  3W9I A;  1HR0 F;  5U47 A;  3HVW A;  1WOP A;  5G0R A;  2UU9 J;  2BZ2 A;  1VLY A;  3M30 A;  3A13 A;  1NK8 A;  1FRI A;  2HW3 A;  3ZZZ A;  1RAB B;  3BZQ A;  2VOO A;  4JI5 J;  3Q89 A;  3GG0 A;  3GSD A;  1U09 A;  2XMT A;  2JC0 A;  4MH8 A;  2J6S A;  3OSN A;  3CD6 S;  1Q16 B;  1VLO A;  3DLJ A;  2RQ4 A;  3GLJ A;  2XS2 A;  3C8Y A;  4MYU A;  4YB5 A;  1VYA A;  2ABY A;  3K17 A;  4OIX A;  3UR3 C;  2R9L A;  2R7O A;  1SH0 A;  3DKD A;  4F4W A;  3JQK A;  5HMY A;  3NNA A;  3LGH A;  4C8L A;  1S7I A;  1TR0 A;  4K50 A;  3DFE A;  2NXN A;  2JDJ A;  5DGA A;  5KG2 A;  6AT1 B;  3H5U A;  1RAA B;  4Y3C A;  2ZH5 A;  1JK9 B;  2XYH B;  5HSP A;  1SQE A;  4DS5 A;  2IPO B;  1S9G A;  3EWG A;  1FNM A;  2LDI A;  2RJZ A;  5T7L A;  1U2F A;  3JSR A;  5AJ3 J;  5EWG A;  3G82 A;  3NS6 A;  3J81 j;  2BQU A;  1PJ6 A;  4F4Z A;  1V5I B;  4M95 A;  1HBN A;  5KFO A;  1Y3K A;  1RT2 B;  1CS4 B;  3QYY A;  1H74 A;  4CO3 A;  2GQC A;  2ZWO A;  4EK2 A;  4NEY A;  2DNM A;  2J0S D;  2CQ0 A;  3DC2 A;  1JLQ A;  2NXE A;  4ANC A;  2BJ7 A;  3NP5 A;  1B4S A;  1JX4 A;  2FJW A;  3TUZ C;  3OSP A;  3QRP A;  5IFM A;  1P27 B;  3I32 A;  2I5J B;  1U8S A;  1JWW A;  3BH6 B;  2NZC A;  3UNY A;  2HBR B;  3DMJ B;  2DHS A;  4OYW A;  2DR7 A;  4U9R A;  4CNZ A;  2I1R A;  2HHP A;  2MZR A;  4LRD A;  3FSY A;  1RT7 B;  3TAM B;  2VHG A;  3EM1 A;  3KG0 A;  3KXD A;  2B5J A;  1PG5 B;  1RT5 A;  3QLH B;  5FLX Y;  1WHY A;  2KB2 A;  1C4A A;  4HHU A;  4RBU A;  2DD8 S;  4CLT A;  2HRY A;  3RRG A;  2XMV A;  2PFF B;  1VQK S;  4IFY B;  3GIJ A;  2YVS A;  2O5D A;  3PRV A;  3R7N B;  3DRS B;  4WYL A;  3OXG A;  5L39 A;  5DG8 A;  1G2E A;  2RKI B;  1EKS A;  2AP6 A;  4DPT A;  1JKH B;  1S49 A;  2YKM A;  3NRB A;  2P6S A;  3QAU A;  1JMT A;  1RWU A;  5KFQ A;  3P96 A;  1EB0 A;  3IAM 9;  1KVK A;  4ZHR A;  2YH1 A;  1TFY A;  4XK8 C;  1NPK A;  3TEH B;  2QMW A;  4RUC A;  5J2N B;  4WU3 A;  2KL8 A;  1HLW A;  5D4P A;  1UL3 A;  1P8G A;  3KK1 A;  2SXL A;  3GJT B;  3MPY A;  3FZ2 A;  1LEO A;  3KLI A;  3QGP A;  1GX5 A;  4Y6I A;  4NZ7 A;  2HGM A;  2RT3 A;  4J90 A;  4CLP A;  2B51 A;  2IVF B;  5DLG A;  2DGQ A;  1YBT A;  1TL1 B;  3T1Y F;  2V8V A;  4TNO A;  2GGP B;  3HFZ B;  2BJD A;  3JTP A;  4QU6 A;  3QRQ A;  4TY8 A;  4QIF A;  5CAB A;  5HP1 B;  3CJK A;  4ED4 A;  2DBB A;  4WFY A;  1AFI A;  2E5L J;  3ZZY A;  3QIP B;  2VL1 A;  2J76 E;  3FKB A;  3KLG B;  2B56 A;  3M2R B;  2R7V A;  1R8C A;  2GC8 A;  3CW2 C;  4ZLP A;  2MZS A;  2EXU A;  2FLO A;  1SV5 B;  2ZH7 A;  1LXN A;  4O3R A;  3J81 U;  3VGT A;  2I0X A;  3LWM A;  3QFW A;  4ICL A;  3KYL A;  4RW8 B;  2XG8 A;  2UXD J;  3GJR B;  2YWK A;  2YNG A;  2YKQ A;  1RA6 A;  4AFF A;  2X1F A;  2UUT A;  3PKY A;  1OYE A;  3UDL A;  3HSG A;  1XN9 A;  2BE2 B;  2DIU A;  1CQM A;  1FVQ A;  5B0B A;  4BC9 A;  2R8K A;  2ZUA A;  3RW6 A;  5I4M A;  2FGC A;  2PC6 A;  4I1T A;  5A0Y B;  2AYE A;  3G2X A;  4TYA A;  2KO1 A;  3AD7 C;  1K0T A;  5AE1 A;  4Q43 A;  1TUW A;  1VQ6 S;  2O1P A;  3AJ2 A;  2XQC A;  4NLU A;  1RCO B;  3DDK A;  4ED6 A;  3M6W A;  2YX7 A;  4G1Q A;  3TVZ A;  1HD1 A;  4DV2 J;  5KFZ A;  3NXZ A;  3EE3 A;  2LQB A;  4NLW A;  1A6L A;  3H59 A;  3ITH B;  4LF4 F;  4LRA A;  3MMB B;  2M8H A;  5LSR A;  4ATN A;  4LBI A;  3TI0 A;  2MJU A;  3BDP A;  3ETO A;  3A12 A;  2HRT A;  2EBE A;  2IM2 A;  1NSA A;  5L8R C;  1OIA A;  3H5Y A;  1JLB A;  3B54 A;  2A10 A;  2CQB A;  2CPX A;  2DNK A;  4X4S A;  2DXD A;  3MAQ A;  5CYQ A;  2YH0 A;  2LA6 A;  3EGN A;  1YGY A;  3FCW A;  1UWB A;  2BKP A;  4DL5 A;  2XHC A;  2ZH4 A;  4RW7 A;  1HW8 A;  2V8D A;  5CZX A;  4KHP F;  1RAH B;  4MIB A;  4GVB B;  4P52 A;  2B6A A;  2ZBR A;  3R5G A;  4TLQ A;  5HVH A;  3ONQ A;  4ZLL A;  4F67 A;  4DR1 F;  2DRA A;  1F3V A;  3IRX B;  4OZ3 A;  1HBO A;  4JI4 J;  3AOD A;  2WW8 A;  2HHX A;  2DIT A;  3QT5 A;  3CDA A;  2W4P A;  4LVN P;  4R0E A;  3SFU A;  2LP4 A;  3PX0 A;  3DGV A;  3MR3 A;  1DRZ A;  5DQH A;  3JSM B;  3NGT A;  3BGR A;  2C2N A;  5SZT A;  2XYG B;  1S6Q A;  3ZTS A;  2KT2 A;  2ASJ A;  1FER A;  4DL7 A;  4QYR A;  1MG7 A;  4C8O A;  2BAN A;  3UNG C;  4B08 A;  3TOQ A;  5KTQ A;  3NCR A;  4KC5 A;  3KHL A;  5J2Q A;  1BE4 A;  1HMV B;  1WWH A;  2A6M A;  3V6H A;  2H5E A;  4V1A k;  3BGO P;  4H4K A;  1JNZ B;  3ZZO A;  2XNQ A;  2HSE B;  4NLD A;  3NGS A;  2W2P P;  1NK0 A;  2JNJ A;  1RAF B;  3MTJ A;  4WK1 A;  4FXD A;  4K4X A;  1CC8 A;  3PHE A;  3KOA A;  3VAL A;  3HXM A;  2BR0 A;  1Q82 T;  1RBO B;  2CUY A;  3TWZ A;  4MK9 A;  3OHB A;  4LF1 A;  1W2I A;  3IR6 B;  1LWX A;  2JFK A;  3RAX A;  4AQY F;  3K8W A;  5DQI A;  5IWA F;  2PT0 A;  1IKW A;  2ERR A;  4Q0B A;  3GV5 B;  2FGO A;  2WVF A;  2H4Y B;  1TKT B;  2QE5 A;  1OY6 A;  3QJP A;  3LAK A;  1GMW D;  5HQ8 A;  2FJB B;  3LP0 B;  4NLT A;  1N5V A;  3QWU A;  3UDC A;  3VGS A;  4AT1 B;  4DL3 A;  5L1J A;  1CBK A;  1FKP B;  4OLP A;  3EDR B;  3NEK A;  3BRE A;  3TAN A;  3JB9 k;  1XBW A;  2NUU G;  5C5J A;  1IKY B;  3PHT A;  1HHT P;  2ASL A;  1Y4Z B;  5KFU A;  1RTJ B;  1XR6 A;  3MM9 B;  4U8V A;  4G3I A;  1UW4 A;  5BR8 J;  2WOM A;  3PRD A;  1E6V A;  3M1V A;  3KFW X;  2J6T A;  2YNH A;  2XY6 A;  3T1H J;  3MCN A;  4NLP A;  3BYR A;  1VRT B;  4IOB A;  4J7C A;  2GZO A;  1X0F A;  2NQP A;  3L09 A;  5HLF A;  2HKE A;  3F56 A;  4U7C A;  4XPE A;  3GYG A;  1DZ5 A;  2H65 B;  3CCJ S;  2MZJ A;  4WFA Q;  2BRK A;  7AT1 B;  3B4M A;  3MM6 B;  1FCA A;  1WNE A;  2HMI B;  4H4M A;  5IM0 A;  1L3K A;  4DF8 A;  3SCL E;  4FVM A;  3TEG A;  1H7W A;  3K57 A;  2J9C A;  1TL4 A;  3BO2 A;  1SQF A;  3OR2 B;  1KFS A;  2O67 A;  3RTV A;  2GO8 A;  3TVY A;  3Q22 A;  4TU7 A;  2DGO A;  4PXD A;  1RU2 A;  1KR4 A;  3DRP A;  1HA1 A;  1RTD B;  1PC4 A;  2EC0 A;  5HL7 Q;  1WG4 A;  1OPZ A;  2EPI A;  4WBF A;  3MGJ A;  2GIR A;  3HP6 A;  3THP A;  1F9E B;  4C9D A;  5K5M A;  4EZ6 A;  4I7F A;  4I64 A;  1LFP A;  3KMQ A;  2YKN A;  5B0E A;  5B0A A;  3PNI A;  4WWS A;  3CJ3 A;  2HND A;  1C1B B;  4DV7 J;  4OJG A;  3H7H B;  3M2U B;  3I31 A;  4JV5 J;  2AGQ A;  2JWN A;  3LWL A;  5LJ5 Y;  1NB7 A;  3KUH A;  2DCL A;  2PN6 A;  3PW4 A;  5KT6 A;  2UUC F;  1RHM B;  3THT A;  1G6B A;  2EFN A;  1C2P A;  4DFM A;  1JLC A;  3P45 B;  4RU9 A;  4X65 J;  4FXW A;  3HD2 A;  1BHN A;  5D15 A;  2GVD A;  3OR1 A;  2R2U A;  3G9C A;  1BQN A;  1ZTW A;  4A8Q A;  4CZC A;  1YJN S;  1NK5 A;  1R7I A;  2E1C A;  2R42 A;  3QNW B;  3DLK B;  2HLT A;  4QWB A;  4IG0 A;  3HVR A;  3OL6 A;  5EHH A;  2DGT A;  1NZ8 A;  1N5Y A;  4PQU B;  2QT7 A;  3KKF A;  3RZA A;  3V2U C;  1RTI B;  5DLF A;  3D68 A;  3OVS A;  1VDH A;  4ELU A;  4B9N A;  4B3R F;  5F8M A;  1C0T A;  3GYN A;  3PEH A;  1NPP A;  2PEB A;  3Q8U A;  4ZLN A;  1RAC B;  2OSR A;  2D3O R;  4B3T F;  2VU5 A;  3ZZU A;  3K58 A;  4X84 A;  5A8W A;  2HFZ A;  4YN3 B;  2ZOF A;  3C66 A;  3KJV B; 
#chains in the Genus database with same CATH homology
 3H42 A;  3WIV A;  2W2Q P;  1SPB P;  2Z57 B;  3VV2 B;  2W2N P;  3A3N B;  2W2P P;  3WHI A;  3VHQ A;  2Z30 B;  1V5I B;  2Z2Z A;  3A3O B;  3CNQ P;  4JP8 A;  2PMW A;  2ZWP A;  2Z2Y B;  1SCJ B;  2W2M P;  2Z56 B;  3A3P B;  4NMX A;  2QTW A;  2Z58 B;  2W2O P;  2XTJ P;  1ITP A;  4K8R A;  3SQO P;  3GCW P;  3GCX P;  3BGO P;  3WIU A;  2ZWO A;  1R6V A;  3P5B P;  4NE9 C;  4YN3 B;  3T41 A;  3QFH A;  3CO0 P;  3AFG A;  3BPS P;  4OV6 A;  2E1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...