4OV6A

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
b'TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4ov6A01
3QFHA 3BPSP 3AFGA 2E1PA 1V5IB 3GCWP 4K8RA 2W2PP 4NMXA 2QTWA 2XTJP 4OV6A 4YN3B 3H42A 4JP8A 2Z30B 2W2MP 3A3OB 3P5BP 3CNQP 3VV2B 1SCJB 3WIVA 3WHIA 2ZWOA 3BGOP 4NE9C 1ITPA 2ZWPA 3T41A 3A3PB 2W2NP 3CO0P 2Z58B 3VHQA 3WIUA 2Z57B 3SQOP 2Z2ZA 2PMWA 1SPBP 2W2QP 2Z56B 3A3NB 3GCXP 2W2OP 2Z2YB 1R6VA
chains in the Genus database with same CATH superfamily
2MEWA 2W2PP 3BGRB 1FKPB 4A8OA 1PBAA 2KZMA 4NEYA 1MN9A 2W2MP 5J2NB 4U7CA 4B3SF 2RUGA 2F8MA 3RTVA 3GIJA 2CFXA 3QWPA 1ZYQA 4F3QA 2ABYA 5IQ6A 3MFIA 4FF1A 3M2UA 3Q8QB 2KFYA 2PGCA 2WTFA 3Q86A 3QPIA 1APSA 4WZMA 1PIEA 3NWGA 4C8ZA 2HLTA 5KFXA 3PVXA 2MZJA 3IGVA 4OHXA 3GV8B 2D9OA 4JV0A 2FHJD 1FI4A 2AW0A 2P6SA 3M2RB 3M30A 3FFIB 3RAXA 1JLQB 3DOKA 2OSQA 3TA2A 1LXJA 4JI4J 3MCMA 3DRRA 1FO1A 1ZAVA 4ECRA 3EVMA 2GMHA 3T5LA 4ANDA 2MZQA 1N5QA 2XMUA 3LALA 2WONB 3VR1A 2VPYB 4XIUA 1UAWA 1GXUA 4DN0A 5KFZA 2GVZA 3QWUA 4OI2A 4OHZA 5KFGA 1WD6A 3OL6A 3PCOB 1WEZA 4ZPDA 5HN0A 4DR4J 2XY6A 4F3MA 5BYRA 1JLEB 1YQHA 1S9FA 2J7KA 3TUZC 1TK0A 5CXTA 2JZ5A 4A8KA 1V6HA 4RBTA 1VQYA 1SJ1A 4CLZA 2XTJP 1WG4A 2DK2A 3OXFA 3RBXA 3QQCD 2CQ3A 2CJYB 3WDOA 2DPJA 1U8SA 3WIUA 3OJUA 1U4BA 2CPFA 3HJVA 2BKPA 2BJDA 1S1VA 3M1VB 1WOSA 1EB0A 3T1HF 3R7NB 5IV3A 1TL3A 1S9GA 4A8SA 4OYXA 3EX7B 1C1BA 1M0SA 3NNHA 1EP4A 2RF2B 1FE0A 4U7UD 2MKJA 1FCAA 5L9NA 2PC6A 4OHVA 3NMRA 4C0OC 4CO4A 4JP8A 3D0GE 4XK8C 2K3IA 4YR2A 3JSRA 5EX0A 1XK8A 4I69A 1LK7A 1X4FA 3C15A 2VG6B 1YBAA 1MNEA 4C8NA 4K8RA 2QTWA 1S72S 1SV5A 2NXNA 4QW9A 3CDEA 3GWCA 2ZM6J 3GPAA 5C2CA 1Q78A 4CLPA 1N8RT 3WZ0A 2YKMB 2ZITA 3MGJA 1XMQJ 2RKIA 4I7FA 3TR5A 1RTZA 3THTA 1IWGA 4PQAA 2MQMA 1RWOB 3AQOA 4K4YA 3A12A 1HD0A 1RWUA 3Q8PB 5GAHI 5AXLA 4JV5J 3CNQP 2QT7A 1B7FA 2ZH4A 4C7QA 1DTQA 1X5OA 2AYGA 2EFNA 3US5A 4CTAA 1WHXA 4F02A 2DRAA 2QSFA 1WF1A 4O3QA 2UVUA 3IM8A 2VKZG 1MMNA 2OEJA 1JQGA 4IO1A 3ZNJ1 3HD1A 2C2OB 3FBEA 2C2EA 3RUBL 3MEKA 2MXYA 4DQQA 3C14B 3NGUA 4NLGA 1TKTA 1NH8A 2DHXA 1QAYA 1RBAA 1VISA 3MHYA 3HVRA 4G6VB 3ILOA 2XCAA 3HHDA 4C3MA 3C8YA 2HYIB 2N4DA 2BXJA 4WIIA 2EG1A 2FJBB 1C4CA 3H5UA 1NJWA 2KXHA 2BANB 4O4GA 3GONA 3JTNA 3PYFA 2RHSB 5HMXA 1UEKA 3VVTA 1S1UA 4ZVFA 3JYTA 1MMLA 3HJFA 4K4WA 1UJ5A 3BSAA 2O3DA 3L3CA 1TFWA 2CG8A 4EYHB 4DQIA 1LKZA 4R5PB 2V63A 2GQ2A 4R0JA 2W8LA 2ILZA 2OD6A 5KFRA 2UXCF 2MKYA 5HSPA 5KT7A 1U49A 1T7PA 2R7SA 1X5PA 1YITS 3VZIA 4A8XA 1BD6A 1YK9A 1H7WA 4PAAA 2F63A 5D0HA 3POTA 2HQGA 4IH7A 3M6WA 1H2VZ 1Y00A 2DVIA 4ILMA 1X0FA 3UCUP 3O3LA 1L3UA 1TK5A 4OX9F 2QLWA 2BYCA 2KJVA 4X84A 4JI3J 1IQZA 4NXMF 5C25B 1PSDA 3QRPA 2ZWOA 3CCLS 2BQ3A 5IC6B 1U26A 5IT9U 3IS9A 5L1LA 3FC9A 3HHKA 3AB4B 1DQ8A 1RBLA 2VQEJ 3PEJA 1ZM4A 4HL9A 3FBCA 3PJWA 4ENOA 1FJ7A 3OVAA 4K4VA 2QO3A 4X65J 2BEFA 3NBPB 4NPOA 3M8PB 3CCQS 4WK3A 5K14B 1NUEA 3KNAA 2GQCA 8AT1B 4WTOB 1RHMB 4KGXB 3MCSA 2M8DB 4FF4A 1T05A 4KHPF 4QR1A 2HS0A 2ZE2A 1DBDA 3NS6A 4D3GA 5F8HA 1TL1B 2DH7A 3MFHA 4ZPCA 2YY3A 2D7SA 2FC9A 5A8RB 3AD9C 1VC6A 3BGOP 3MURP 1X4GA 1SC6A 1IKVA 1MW7A 4G1IA 1F3VA 2YNHB 1WG5A 3O8WA 1VDHA 3FRZA 2HWIA 4IG0B 1V3ZA 3QGPA 4LF6F 3OL9A 3K5PA 1EHWA 4BC7A 1SIWB 5J2MB 2R4FA 3ULHA 4M5JA 4DQPA 1U1KA 2V50A 3QIDA 2XG8A 3TWZA 4OJ1A 2QC3A 3ILJA 1KHVA 2CWKA 3AQPA 3Q0AA 1HNWF 1SKRA 4ICLB 2CQ2A 5D0GA 3KYLA 1M5SA 2D9PA 3JAMU 1Q1KA 2NXUA 4DPXA 3HO1A 2OPSA 1SUQA 3H20A 3NMAA 2PDAA 1S1XB 3L7OA 1IKYB 3HFKA 4Y2CA 2R2SA 3Q22A 2D1CA 4YQWA 1N5YA 3OXGA 3BS9A 3CIMA 2HHHJ 3T41A 3TVYA 2E7XA 5I4MA 3PO4A 1U0HA 2ZEJA 2HS3A 3CTRA 2QA2A 1VJWA 4DV1F 3OTCA 3MM5A 5L1IA 2YX1A 1GEHA 2LA4A 5KT3A 3M2UB 4DPTA 3OSNA 2IVMA 4MFBA 3R1HA 4TVAB 5CYQA 4M5NA 1NPRA 3M2VA 1HIYA 4M5DA 5IT0A 2YH0A 4UF4A 3WX4A 3OSPA 4CT9A 2HHTA 3I82A 4U67Q 2KL8A 1RACB 1RAAB 2DGVA 2D3UA 3JSBA 2XQCA 1RTDA 1S1WA 1I5OB 3GE9A 1U45A 3M30B 2IMOA 3DDNA 2B5JA 3OR2A 1TU0B 4H4MA 1RA6A 2QMXA 4J9VA 3BF4A 2JEGA 2HAFA 4A4JA 3D68A 4P74A 3PW0A 2UXBF 1S99A 5E0OA 1G6BA 3FDSA 1XERA 1WSRA 1GX5A 1H72C 3B6BA 5KT5A 2PFDA 3V81A 3OVBA 1NK4A 3G8QA 3BR8A 1EKSA 4LFBF 4H4OA 1FFGB 1YBUA 3G8TA 5DJBA 4ZP6A 3NLCA 2GA7A 4YB5A 2UVWA 4OYZA 2JJ4D 3B54A 1LOUA 5DG8A 4U7UK 4RW9A 4JUZA 6FD1A 1C0TA 2YKPA 1RK8A 3ISND 2XULA 2KO1A 2EW9A 4NLTA 2D3O1 2E7VA 2GMJA 1QUVA 2CPYA 4LSZB 2NPFA 2B9XA 2HHUA 2B0GA 4WXOA 1NJZA 1O6XA 3GU0A 2ZH1A 1DJ0A 5DDPC 5B7WA 3MOJB 3RW6A 4DLGA 1PAUB 3DMJA 3UCGA 3FMBA 2JL9A 3AT1B 4CZCA 5D3GA 2ZHBA 4YB7A 1I94F 1G7CB 1TL3B 1UA0A 2YKNA 1C1BB 2W4CA 1U1QA 2G0CA 4DSFA 1EP4B 3B82A 2N7YA 2IFXA 3EUNA 2J9EA 3UNGC 1T03B 4X4NA 1H7XA 3SSQA 2X3GA 1P9YA 3VWSA 2KHDA 3SQGB 2XMAA 3C15B 4MT1A 2HNYA 3IBFB 2BJ3A 2IYIA 2VICA 3HM9A 4Q45A 1MMDA 2BV3A 1JXEA 1SV5B 4S0MA 1T9TA 1VR6A 3MPVA 4F0MA 2CJQA 2P5VA 5BYSA 3AAWB 4JI8F 2RKIB 2OAUA 3K2YA 2W1BA 1RI7A 3QJJA 3PJXA 3I0SA 3CC2S 4LFCF 2VD3A 2Z2MA 4PZVA 1D8YA 2VBXA 2A18A 1TFYA 2H4WB 4MIBA 3SCKE 5KT2A 3MR6A 2V2KA 2Y1LB 4CLFA 1B70B 1JLFB 4DV5J 1DTQB 1Q8IA 3DU6A 4CTAB 3UNYA 2DCLA 2QZ8A 4X4UA 4WIQA 3BGFA 4QW8A 2KKHA 5T7LB 3FEXB 1IBKJ 4YUDA 6FDRA 1SJ4P 2V34A 1UTAA 1TKTB 3M8RA 2RT3A 1KN6A 3R7BB 3CCWA 1KVIA 3R3TA 2IVYA 2G9OA 2KM8C 4I2QA 3KK2A 2JFKA 2X7IA 4KGZB 1Y4ZB 4O4GB 2XSJA 1GQEA 3RW7A 4KY3A 2BE9B 3HSJA 1S1UB 1M5PC 3JYTB 3W2VA 1ZETA 1NH7A 1TP7A 3D54A 2ZBIA 1Y9OA 2VC1A 2O67A 1XIQA 3I5AA 3TO8A 3TI0A 4WP9A 1TZ0A 4ZA1A 4WCEQ 4YHHF 2E9TA 1S10A 4PXCA 1XJWB 2DT9A 2GCFA 2J7UA 4ZLLA 4JBCA 1WF2A 2DGTA 3HD2A 3POTB 3ENWA 2BRLA 1RYSA 4CNYA 1KTVA 5IQQA 4NCGA 1JWWA 3CEDA 3HK2A 2V67A 3L4BC 2AMCB 3UQSA 2LQ8A 3QZ7A 4ECQA 5ETKA 3ET6A 2XNRA 3IS9B 3D28A 3OTOJ 2JRSA 1ZS6A 3P4UB 2WSEC 4FXWA 2V8DA 4NLXA 1IM6A 2ZWPA 1KOHA 2QMWA 2XMTA 3SCJE 4DZDA 2ZH7A 1B99A 1HWKA 3G9CA 1E6VA 3QGIA 4IH6A 2ZFHA 5K5MA 1Q7LB 3DFEA 4P73A 2CG4A 1VC0A 2DR5A 2OD4A 1EETA 5KFUA 1FF2A 3MM8B 3V6HA 2FPHX 2YKQA 2D3OR 1BGXT 3G87A 4ID5B 2DCUB 5B09A 2HRYA 2ACYA 3S01A 2WB1D 4P52A 2GAGC 5U47A 5ITHA 1HQ2A 2EI5A 1VRQC 3Q2TC 1AUSL 2HG4A 4NLRA 4M5MA 5DGAA 4DSJA 2MTLA 5HJXA 3FSYA 5A2QY 2E66A 2B56A 4R0EA 1T11A 4PKDB 4CLLA 1YRXA 3D0HE 1T95A 3NS7B 2B4OA 5I3UB 4K50A 1NNDA 2B8QA 1X4EA 1OSCA 1KDNA 1HARA 1QUPA 1YJVA 4OJHA 4TYBA 4QJVA 3C16B 1K44A 2IJRA 1UVNA 2MY8A 1E6YA 4A8WA 3SSRA 2OPSB 4NI2A 1SUQB 1M5KC 4TXSA 2BUNA 3AD7C 1RUSA 3OR1A 2DTJA 1NAQA 1HBMA 4DL3A 1N5YB 4DQSA 1VJQA 2J0XA 2K1RA 1MWYA 1PG5B 1F9HA 4TY8A 2RNEA 2KXFA 1VBXA 2LEAA 5KFPA 3EPGA 4URQU 4TQRA 8ATCB 3PACA 1U0HB 3PDNA 4OHYA 4PQUA 1D9FA 3K8WA 1RT2A 3W63A 2H5EA 3CCMS 4DG1A 2BKOA 2OJ3A 4CNZA 4PWUA 5KG1A 5D0RA 3G96A 3GIKA 3BDEA 2QLJB 5CYQB 2QRRA 1L3SA 1X5SA 3EPIA 4UOCA 3M2VB 4M5DB 1O0PA 2BJ1A 1SQEA 5DGBA 3V5RA 2YX4A 2I2YA 1M1KT 5KFCA 1FT8A 4JI6F 4G1QA 1QLNA 4EI2A 4X64F 1S1WB 3GG1A 3D6FB 2B5JB 4KB7A 3ZC4A 2UV8G 3OR2B 4ECXA 2HHPA 4UQTA 4CLTA 1JJCB 1HWIA 3LP2A 3OL7A 1CG2A 1VQKS 4NASA 2AKWB 3KUEA 2ZH6A 1YX2A 3TOQA 4F2RA 2ZUGA 4I6WA 2RDJA 3TARA 4KIAA 3CW2C 2HVZA 1W2BR 5K8MA 3BPSP 2NXCA 4H4KC 3BPDA 1R0AA 3T1HJ 3I5BA 3HSDA 4O44B 5HK4A 3JQMA 1H38A 4HYKA 4AYBD 2AP6A 4QZVB 2YWKA 3PNIA 3NS5A 3AD8C 1B0TA 1Y0HA 2V68A 1SXLA 3MUVP 1ZH5A 4RW9B 3T1YJ 1P9QC 2B51A 2HFUA 3CJ8A 2UZAA 2EG2A 4F26A 4URGA 4NLWA 5F8MA 1FJEB 3RBDA 1UVJA 3BH7B 3M8QA 2YNGB 3BYPA 3JXOA 4Q5VA 1TMJA 1GMWD 2FHJA 4K2JA 3H4BA 3OPKA 4K4XA 1RADB 1UW9A 4EYIB 2QSWA 1BY9A 4WFAQ 4MJKA 2QA1A 3DMJB 3CIZA 2MQPA 2QGFB 1N34F 2C3OA 2JC0A 1YG0A 3ICLA 4OYPA 4TU9A 3H59A 2YKNB 3ENQA 2E5JA 4EZ9A 4IUFA 2CRLA 1VRTB 4QQBA 2CPXA 1VFJA 4CM2A 2P9GA 2XYPB 2DR8A 1JLBA 1KP6A 3QRQA 4HH0A 3CD7A 1HBOB 2HNYB 2QA4S 3I0RA 1K1QA 2W9AA 2DJWA 4KFBA 1YZ6A 3QT8A 2E1PA 1X9SA 4BDPA 1KS2A 1WC3A 4I6YA 3FEZA 4ZVOB 3DRYA 1RAEB 3BREA 4NLPA 2IAJB 2BABA 5KG4A 4EBEA 5F0WA 4FYXB 2BQRA 4BWJA 4ZITA 1OS5A 3I0SB 5E33A 4KGMA 5J2PA 1LV5A 1WDTA 2DR7A 1NMEB 4U96A 1X0PA 1RABB 2UXDF 3KJVB 3PX4A 2XHWA 5KT6A 1N33F 1U2FA 4JB8B 5ETQA 4EU0A 1FESA 3L7PA 1SL2A 4LF5F 5DLFA 2OP5A 1RISA 3PG9A 4XDCA 1OQ3A 3BB5A 2UXCJ 1QD1A 3PW7A 1FKOB 4DS4A 1NK0A 4NMXA 4DDFA 1JK9B 3NOCA 4FXDA 2FD2A 4N77A 3CWJA 5KFTA 2MJUA 2MQLA 3CDAA 4JOUA 2BBEA 3G82A 2OSRA 2R7UA 1F9EB 1Q4RA 1AXQA 4KJIA 4ZPTR 2K2PA 2J8SA 3HSGA 2E44A 4TQSA 2KYZA 4OZ2A 2DB1A 4I2QB 2OFHX 2G13A 3R7SB 1YIJS 4I2PB 3PX0A 5FLXY 4CO1A 2P2CB 4N56A 1K47A 4KHRA 3TRGA 2ACMA 3L09A 1ZAXA 2Z2LA 5EHHA 2OHDA 2BDPA 2O01C 7FDRA 3CJKB 5A8KA 3T9NA 3NAHA 4JI1F 2R7TA 4C11A 4NA2A 4Y6IA 1JB0C 2V2VA 5H9EJ 1NDKA 2LU1A 1WI6A 4NMLA 3AA8A 4KHPJ 5CAAA 4UY8T 4NCGB 2MKIA 1CULB 2HZAA 3ETOA 3DLEA 2JX2A 3HDSA 4LF9F 1OPIA 1HNIA 5A8WB 1FHTA 3VTIA 3TEGA 2C3UA 2DH9A 2NUUG 5LT5A 3KK3A 2V4RA 3PHTA 3LA0A 3OTDA 2LCWA 4YY3F 2RD5C 3M9OB 1DY3A 2OTJS 1V3RA 4P2XA 2QYGA 5IS2A 1E6VB 3GILA 2IY5B 1QY7A 3THVA 4EEYA 4DV4F 5DQHA 3MMAA 2RU3A 4RX6A 3C6UB 1NDPA 3Q23A 3U27A 1HNWJ 5DDRC 3TX8A 3CE8A 4HT7A 4QWEA 2WVDA 1RLCL 5KFDA 5L46A 4PABA 2DGQA 2DIVA 1Q7YT 4OZ1A 3SDEB 4BC9A 3MDFA 1ZTWA 2M8HA 5D8HB 2JC1A 2FJEB 1U1RA 3P6YC 2PN6A 3KG1A 2FVPA 1KQFB 4UZCA 4W92B 1RHQB 1NDLA 5ETSA 4DV1J 1UVMA 3LO3A 2B9EA 5D4PA 2VFSA 3HULA 1PYSB 3ITHA 4L6V3 1Z4UA 2A2CA 4P6QA 1NJXA 4ZLPA 5F8IA 1E6YB 5LSOA 2J5AA 1X4BA 4TU8A 1K0VA 3FSXA 1CS4A 4NI2B 2BJ7A 3MTJA 3G71S 5MAOA 4AT1B 3A13A 1J5EF 1URRA 1EJ7L 4NLUA 3CUNA 2DO0A 1N52B 2CA9A 1HBMB 2CPIA 2AEFA 3A3NB 1R8AA 3J7ZT 4OYAA 3TJAA 2K1RB 1VLOA 3RBZA 1R0BG 4TY8B 4QBUA 3MM7B 3Q8RB 2QLBB 3W1YC 1IQTA 4LUBA 1Q8BA 2YTCA 1IJEB 2Y9HA 1NSKL 4PQUB 2V2QA 2UXBJ 3K7RA 2Q6CA 1VQLS 3BQ2A 4WFYA 2DGSA 4J7CA 1GH8A 4DG1B 4RPFA 3TQ1A 1S6PA 4OMFG 2HFOA 4LFBJ 3I9V9 2AGOA 5G4DA 4QR0A 2CIMA 4HHHA 1DFDA 1U1LA 3I96A 4AD6A 3J7AN 3NGKA 4LBIA 3F73A 2VFTA 4M5HA 2GIQA 3KG4A 2OH2A 3CCVS 2NXEA 4G1QB 3KK1A 2MJNA 2VPZB 2EWHA 1VLYA 3MZIA 1FRKA 2H9ZA 2EFOA 5L8RC 2BZ2A 2CNKB 2I5JA 2WSCC 1GT8A 2COLA 2Y1RI 3NWRA 3LP2B 4F36A 4DUZJ 1F5CA 4O0NA 2A3JA 1RT3A 3MAHA 1NK5A 1IBLF 2CJAA 2GFFA 5KAKA 1XEZA 2OFGX 1OY8A 1R0AB 4QIFA 4NXNF 2BW7A 3KLFA 4RR5A 3SQOP 4C9DA 1I94J 2PEBA 3IR6B 3BSOA 3BKFA 1LK5A 2MPUA 3AFGA 1NHKL 3LWLA 4MAKA 3QZ8A 1P6TA 1FRXA 4FS2A 2CPDA 2DHSA 1GTHA 1NB2A 4QIEA 4PG5A 3IBCB 5LOQA 2VF3A 4KQZA 3CPWR 3UD3P 3NOGA 2F5GA 4LSLA 3M8QB 3O1LA 4LR9A 5LSLA 3L7UA 4Q8FA 2VUGA 1VQ4S 2B43A 3MEEB 1HL6A 3VGTA 5E3CA 4JI8J 1RQ0A 4F4KA 3IFEA 4LRAA 4DV0F 3BO3A 1HHSA 3V4MA 2HKEA 3N9UC 1U25A 4OIXA 2ILYA 4AL6A 2JVRA 1Q81T 4DSLA 2KT5A 3OJSA 5AXMA 4ED8A 2X1BA 3T5HA 1D9AA 2WSFC 3JQKA 5IFMA 2GNKA 1NU4A 5EX3A 3HT0A 4HVZA 1SVDA 4X4QA 2YKOA 1M5HA 2HWTA 3GIMA 2MKCA 4KFBB 3HZEA 4I64A 3BO2A 2CQIA 4B9UA 3MXHP 4EBDA 2IC3B 1R8PA 2OUGA 5KG5A 4PRFA 1P27B 5SUHA 1VIXA 3TANA 2V8VA 2E1CA 4QIVA 2HRTA 4PXDA 4I6AA 2CNOB 2BJEA 3JB9k 5J2PB 3DLKA 3RJMB 4RU9A 3C6TA 4AXJA 4ATNA 1X4HA 5KFMA 4ZJOA 2FDNA 2POKA 3I87A 2MHEA 4R8UA 2VV5A 2XY5A 3K58A 2DY9A 5CYMA 4B08A 1AFIA 4KV8A 2HIYA 3SXLA 1S76D 4X65F 4KPYA 1U09A 5L39A 4FKXA 3GSIA 3BSCA 3ISZA 3ILIA 4B9TA 3I31A 5KFNA 4YHHJ 1RU2A 3RB3A 1UEUA 1BE4A 2FVQA 2C2RA 3J7YI 2EC0A 1T9UA 3MPYA 3OUYA 2DXEA 1LWFA 1K8AT 3TVZA 2C1EB 4EGLA 3G8SA 4PWWA 2IVFB 1CPZA 3G82B 1XR5A 2KI2A 3GYGA 2WB4A 3W61A 5F0UA 1RJJA 3IMQJ 4L3NA 2E1RA 1FKPA 3CGIA 4ZN3A 1WEYA 1W2IA 2P8IA 2RJZA 1PJ6A 3WX8A 2W25A 4CDIA 3TQEA 1AT1B 1BQNA 2KVIA 4RNNA 5L1KA 2LVWA 1H2UX 2J6TA 4CCHA 2L08A 4A8QA 1U2RA 1Q5VA 4MIWA 2D69A 4JI0J 1RAGB 2AV5A 5CD4H 1XQIA 3IAS9 2XZDB 2GS8A 4E8UA 4C11B 3CCES 2MZRA 2QX0A 2J0SD 1SH2A 4DLEA 3R1LA 5E3RA 3A4TA 2DRBA 2IHR1 3AXMA 3GV5B 4M94A 4HI2A 2XO7A 1GK8A 4PYAA 3W8PA 4KO0A 2UV8A 3NGSA 2V5HG 4ZP9A 3NCPA 1OPZA 2BRKA 2ZHOA 1RSCA 3R5JB 2XS5A 2M7SA 1Y11A 1XC9A 3A3PB 3FFIA 4ED4A 2LECA 1HNIB 1X60A 4CT8A 1KONA 3D6HB 5JMNA 2W01A 3FZ2A 3QAUA 3PW4A 4OX7A 4ID8A 1LEOA 1XN9A 3PY8A 1H6KX 1U7LA 2FY1A 2VH7A 1HWJA 2BACA 4IDKA 3GSDA 4FBTA 2KN4A 2CDRB 2IM3A 3HX9A 4PG7A 3UD5A 2A10A 4AL5A 2WONA 2VOOA 2AJFE 2HNDB 4JV2A 1FJGF 3W65A 3MMAB 4F4ZA 1R8BA 2CQGA 2WCXA 2YNFA 1KVKA 4G65A 1N32F 1GTEA 1H0HB 4DFKA 5BR8F 3DLJA 3DOMB 5KTQA 1JLEA 3EWGA 4WYLA 2B9YA 5J2QB 4MIAA 5KOWA 4ZKAA 3CO0P 3RZAA 3Q24A 5CA5A 1RA7A 5EWFA 5CCMA 2DNPA 5ETRA 1WSVA 5ETLA 2A6MA 4NLYA 3T5JA 4F3OA 3OLBA 3KDNA 1I1GA 4WU3A 2R9LA 3FCVA 1S4EA 3N5FA 5C5JA 2HW3A 3KUHA 4A8FA 4ZJLA 3KWMA 1NPKA 2FQQB 2RQ4A 3GJQB 2KU7A 5D0EA 1PC4A 2DNMA 2AU0A 2QFIA 5GMDA 2N7CA 4OYWA 2Z8QA 3KLGA 2RF2A 4DCJB 2F40A 3T9ZA 5D6GA 4XAKA 3BV8A 4DL4A 2JEFA 2YKAA 1UFLA 1IUJA 2BE2B 5IM0B 4JI6J 5JJBA 1IR0A 4L73A 2AJ4A 1ELOA 3IO1A 1HQEB 4X62F 1FWPA 4GO5X 1FERA 4TNOA 1QJHA 4F4WA 2M5YA 2LQ5A 4NE9C 1FJCA 2B4UA 4M1KA 2A1BA 4LF2A 2BVZA 2FZKB 4DL2A 3UCZP 1Q16B 1VQ8S 1VBYA 2HS4A 1S6PB 1UA1A 3LAKA 1KWMA 5E5NA 1YGYA 2EKYA 2AX0A 4HTIA 1CSJA 4B9VA 2DISA 1CJKA 4DX8H 4RWXA 1NCLA 4FNIA 4YS2A 4W90B 1M1HA 3KK1B 3GQCA 3ZZYA 3H5SA 2EBEA 3TYTA 2HFVA 5B0EA 3C14A 2I5JB 5IZHA 3KLHA 3EJMA 1TMMA 4LFAJ 3NY0A 1RT3B 4ZCKA 3P5BP 1S0NA 4MYUA 2HBYB 2V2ZA 2I8EA 2VFRA 2GIFA 3EGNA 1OJ4A 4F7VA 3OTBA 3KLFB 1N34J 3CDWA 4DV5F 3N4WA 2YX7A 3CDBA 4MK8A 3H2VE 3KMQA 3OD2A 4JI5J 2FGCA 2HGMA 4ZP8A 5K9FA 3KJQB 2AJQA 3VAFA 4DS5A 5G0RB 2CVIA 1O8BA 5A2QU 2XLKA 2MZTA 2QE5A 1IBKF 5JUMA 2CQ0A 1T9VA 2Y8YA 2NZ4A 2CDQA 2Y0BB 2CQ4A 1PCAA 5D78A 5KG0A 1NBEB 2IBKA 3QATA 1Q8KA 3CCUS 5IWAJ 2CPEA 1CEZA 4K4UA 4RNMA 5H9EK 2ASYA 2O5DA 2YNIA 2EEYA 4Z7YA 4GKJF 2UXDJ 4W4MA 3N6NA 1N33J 1C2PA 3VQTA 3A8IA 1NLKL 4FYVB 2FVRA 5E3AA 4TLQA 4FP9A 1AUDA 2EK6A 3CJ5A 3M8PA 2GO9A 3DKDA 2JFDA 1WC5A 3PYEA 4H54A 3KNGA 1HMVB 1BXNA 2E9ZA 2GGPA 3CD0A 3NGTA 3CD6S 1DTTB 1TL1A 4L72B 2RQCA 5A8RA 1B0PA 3M6XA 3UN3A 1ZOTA 2KHCA 3OTOF 3FBFA 3CXCR 1S0MA 4UQGA 1YBTA 1ZM9A 2IM1A 1VGYA 4AFFA 4QIGA 3DLKB 3BQ0A 3C6TB 4OV1A 1AA1B 5M2RA 5KFOA 4DXLA 2HHQA 1GMWA 4DFJA 2B9WA 2F8HA 4LF4F 2IA6A 5GMKa 1CC8A 4R8UB 2K8GA 2HLUA 5CYMB 2CQCA 2MLXA 4KV8B 1TAUA 2R7WA 3AHPA 3QFWA 1N56A 3ETMA 4KKOB 2BJ8A 1D1UA 3M8WA 1Y7PA 3D3CJ 5DS7A 4B9LA 2LQBA 4ICLA 5FDLB 4DU7A 2RDIA 4JI1J 3LP1B 2V4JA 2GJFA 1L3KA 5B0BA 1WG1A 3R5GA 1KFSA 2CQDA 3LH2S 2ZKTA 1WC1A 2FVCA 4UT4A 1V5IB 3W62A 4LF9J 1RZMA 4FPIA 3HHLC 2BOPA 1RT1A 2Y0SD 4DJBA 1BQNB 2QMUB 2DNLA 2PE8A 4TU7A 1XBWA 1KKHA 1VK8A 1SKUB 3M8ZA 4YY3J 2LDIA 4KPCA 5CZVA 3NG8A 4X4TA 1VOMA 4LRFA 2PFFB 4DR2J 4P72A 3GJRB 4WTYA 1OYEA 4DV4J 4P2MA 4Y34A 4LQ9A 5AJ3F 3N79A 3BBBA 4IH5A 2HRUA 1QDUB 2AX1A 4FVCA 4Y2MA 4F0HA 4KO0B 1MWQA 1R89A 2LMIA 3SMZA 2C3PA 2VG7B 4EMDA 3RG6A 5HQ8A 5M2PA 2CJ9A 2H51B 4DFMA 2W9BA 3QBCA 3GFZA 1UPMB 1WTFA 1R31A 4Q7AA 1MROB 1BHNA 3F41A 4RUBA 3TAPA 3VVUA 2ERRA 3EVWA 4ZVHA 4C4WA 3W9JA 4PWDB 1G4CA 3DI6B 4IDKB 1TL5A 4ELUA 3OL8A 3P96A 3CCSS 3BEGB 2R8JA 4A46A 1XWLA 4KSEB 1LWEB 2R8KA 5GAHU 4USMA 4AE5A 1DQAA 2ZUAA 2I0XA 3QAEA 2YNFB 3NP5A 3TUIC 3GCWP 3MWBA 4J9OA 4CO5A 1M90T 1SQGA 2EC2A 4B02A 3UDEA 1R8CA 4M5GA 1VQ9S 4F8RA 2DITA 4ZMMA 3TZWA 5H9FJ 4XPCA 3ZZZA 3R2DJ 4LR7A 1J5EJ 3LGHA 3GV7B 2XI2A 2D41A 1U24A 3IG1B 2UUBF 2GJ2A 3NXZA 4DUYJ 2GC8A 4RBVA 3VQSA 2WRMA 3GIRA 2F4VF 2M4MA 2VQFJ 1QE1A 1SBRA 1QTNB 1TVRB 2PEHA 2CQBA 1WEXA 2OO4A 3X3UA 4LIWA 1JJHA 4FNHA 4MKYA 5HMYA 2NSBA 3AOCA 2Z4PA 1UZHA 3KLGB 1S9EB 3EXYA 4NRTA 2UVVA 1R27B 1T03A 3R9LA 3M4XA 3PM9A 1C4AA 3DN9A 1S1TA 2RDDA 3T1YF 3HSZA 3SQGA 2HBZB 3MPWA 5FLXU 2E5LF 1PAEX 2OPQA 2U2FA 3CSKA 5JVHQ 4MK7A 1N4LA 4ED0A 4JYAF 5KFYA 4IRDA 1UWAA 2D74B 2XNQA 2HBRB 1V9OA 2APOA 4ZVQB 1RT4A 3M7VA 3ZTRA 4CO2A 3HKWA 3NGRA 2PMZD 3GJSB 4UTGA 5AE3A 1IBLJ 4HLBA 3SFGA 2FZCB 4BWMA 2VPXB 2ZOGA 1S12A 1VHIA 2O1PA 1WOPA 1JXVA 5ETTA 2L9DA 1FKAF 3GYXB 4NXNJ 1JLFA 1RHUB 3AOBA 3I55S 4N41A 2NXJA 3MPUB 2QLFB 1HI0P 5LMUF 2JH3A 3PYGA 2LYVA 4CO3A 1CJKB 3GYNA 3TUPA 5LJ5Y 3M05A 4FN5A 4NRUA 2ZZMA 3QT7A 5T7LA 2UU9F 1MU2B 3BZQA 3Q83A 1ZAWA 4ELTA 3LF0A 2N82B 1EQ0A 2ZKUA 4LJMA 3KLHB 5FIIA 4IG3A 2Y8WA 4V19X 4WXWA 3GB0A 5SZTA 4F4AA 2ASDA 4C2MA 4ECUA 4FF2A 1N5SA 2QYCA 1JLCB 3HVTB 2YBVA 3X1LB 5F3ZA 2Y1IA 5IOLA 2Z2YB 1QAXA 1HNVA 4XDDA 2MZSA 3DRSA 4HHJA 2FTRA 2KYXA 4DV0J 1OYDA 4OZJA 4OI1A 1L3VA 2I38A 4ZDNA 2UUAJ 4DV3F 4Q43A 3CO9A 1CJVA 2MSTA 4ES3A 3H0PA 4ECSA 3EE3A 4B3TF 4ED7A 1QSSA 2R3VA 2HEKA 4O4RA 1OY9A 3R5BA 4DX5A 4WFNQ 4OV6A 3OT9A 1NKEA 3OFGA 2NCKL 1WNEA 3MEDA 1IR2A 4Z7CA 3I5CA 4FYWB 2PMHA 1N0UA 3CD5A 4UUWA 4NX9A 1OWXA 2YNIB 2ZC3A 1S97A 3W66A 2W7OA 5B0AA 5RUBA 3CMQA 2GHWA 5EWGA 1VCTA 3F0NA 2CJKA 2OPPB 3ZZOA 2CPHA 2GVDA 1HI8A 3TUJC 2VB6A 4NLDA 2VHGA 2Z30B 2R2TA 1HWUA 3J7A1 3DHXA 4Q44A 2Q3PA 4MH8A 3MM8A 4NCAA 1EKRA 3K0JA 2GGPB 3G6ES 3G86A 2NR0A 3K5LA 4ID5A 3CCJS 2A2DA 3ONQA 1GXLA 1WACA 2NLWA 3WQPA 3C19A 2C3MA 2Q1LA 1F1BB 1C0UA 1AW0A 1U48A 3BH6B 4EO8A 2NUHA 5I3QA 4DZ6A 3GFXA 4F0KA 2GW8A 1RAOA 1CLFA 4WF9Q 4C8LA 2ATCB 4KH0B 2KVQE 2X3DA 4IFVA 4DQRA 4YR0A 3UPFA 3ZZRA 2RQMA 2E9RX 1JX4A 1CVJA 2G0IA 3W3SA 2F9JA 1REVA 4USTA 4YEAA 5I3UA 3K8VA 4W98A 4MKVA 5KFFA 5HAOA 3KHRA 4F4XA 3C16A 4WKRA 2V4JB 3FCWA 3U02A 4G1PA 4QPXA 1BQMA 1Q79A 4LR8A 1U2CA 4USIA 2QEXS 1WTBA 2EFPA 4LT6A 1HYSB 1BMQB 5A6PA 2CQPA 4DOZA 5GADU 2Y3YA 2HQIA 1IN0A 2AT1B 1AFJA 1R8HA 1RT1B 4DU8A 1YSJA 2ZH2A 3KHHA 3IR7B 2UP1A 2V69A 1B3TA 2ZDPA 2ZJQQ 3RRKA 2XZTB 1LFWA 3KG0A 1EZZB 3CC4S 3B4DA 3GCXP 2IRYA 2F7VA 1FJGJ 2DNYA 1G1XA 8RUCA 4NLSA 2PI5A 3PR5B 5EN1A 1SIZA 3O44A 1N32J 5EGYA 5BR8J 3CC7S 1NK7A 3N6LA 2FHOB 4QU7A 4P75A 1G2EA 1D09B 2W9BB 2BQUA 1KSPA 4GMKA 4ZJQA 3HI9A 3UW1A 4WU2A 1RTJB 2NYIA 4CO0A 3MEGB 1X4CA 2EXUA 4N7TA 3P3DA 2FGOA 4J9NA 3FQLA 4C8MA 4ZCIA 2V0NA 2HZVA 4U8VA 3PHEA 1SJQA 1M1GA 4Y65A 3K5OA 4AQYF 2K7JA 4IOAQ 5J1EA 1SJRA 3PEHA 4O44A 3CMAS 2R8IA 1JJ2R 2HNZA 4Q2MA 4QWAA 1HR0F 2DGXA 2VOPA 4P2SA 3EVOA 5DM6Q 1FDAA 4HTJA 4P10A 3IM9A 1U6FA 3DU5A 3UDCA 2A6OA 4C0HA 4A47A 2MY7A 4DUZF 3H4DA 1S7HA 3HHLD 2YNGA 5GADI 4EO6A 4X62J 1FA0A 1ZBTA 4Y28C 2XMJA 4L3KA 4BLGA 5ETPA 3H25A 1QE1B 4WFXA 1TUGB 3OFHA 1UCNA 2XYHB 3DC2A 2DKOB 5KG3A 4NEZA 2RRNA 1EX8A 2V8PA 1VRTA 3SI8A 1XMOF 2JEIA 1S1TB 5MLCV 2MKHA 3W5YA 4PG8A 1YKWA 1YRTA 2OKQA 4L76A 1HBOA 3QNWB 3N6MA 3R8YA 2OPQB 4C8KA 1FNXH 1JJ4A 2DGUA 3ELHA 4J9PA 4Y2AA 2HPUA 2IBOA 5CCLA 2EKNA 4U6PA 2M2BA 2IAJA 3DYAB 4OFZA 1RT4B 1Q5YA 3JTPA 3UN5A 2KM8B 4ECZA 1IM4A 3SCLE 3OTEA 5FD1A 3A8EA 4NOHA 4DI6A 4PR6A 3TNVA 4UOHA 2QL5B 4EBCA 3FMWA 2PIIA 2MKKA 3KJVA 4K7QA 3JSMB 1FTRA 3C2PA 1Q8LA 3M6VA 2HQ3A 1TUVA 4YP3A 2V8HA 2MQOA 4PPDA 3MUTP 1F9FA 3PFOA 5HQMA 3H42A 7FD1A 5EWEA 1FKOA 1KQKA 4ITSA 1N0VC 1RAJA 1Z1ZA 2DHGA 1CQNA 1N48A 2CPZA 1BWVA 4L74A 5HROA 4Y2KA 4IG3B 3VAGA 2RVJA 2EFQA 4TLRA 3CJRA 3PRDA 4ILRA 4X4PA 4DR5F 1ZPWX 2QG9B 2RH3A 3MR5A 1ZA2B 4I2PA 3SFUA 1HNVB 2MYFA 5ADZA 1RT5A 3W60A 2FJVA 3VAHA 3DRSB 1QSYA 3MPDA 5LMNF 4PYDA 3UN2A 2KTQA 4GKJJ 4IRCA 2ZJPQ 4USUA 1W25A 3CJKA 3TX0A 4J9RA 1CJVB 1FDDA 4ETXA 3PX6A 1HBUA 3LTOA 5A76A 1BUXA 1UL3A 3QYYA 2RS8A 5AXNA 2CNLB 2MDAA 1RTHB 3GR1A 1CULA 3NEKA 1VBKA 1FK9B 3CJ0A 2QFJA 3GLJA 4O3OA 2Z56B 4IOBA 1XR6A 5DRKA 1S7IA 3MEDB 1ZZFA 5A8WA 3JSYA 3QRRA 2M0GB 4N5SA 2W4DA 4X4OA 4OLOA 5E3QA 3KOAA 4WFBQ 2I6WA 3N0VA 5LJ3Y 2XCPA 2WW8A 3GZ7A 2JVOA 2BW2A 1LWXA 2XY7A 2IJFA 5L38A 4BCAA 2OGUA 1AYEA 3ENAA 4KTQA 2RRAA 1U6BA 4JI0F 4LF4J 1FNMA 2GVDB 3PJ9A 1X4DA 2DNHA 1RDRA 4C97A 1YJUA 2XHCA 2CKWA 3TAQA 4DN9A 3C6UA 1K9MT 2FJDB 1VRUA 3CCZA 1W26A 4I4BA 4ZP7A 2HAIA 3R5CA 1NK9A 3VGSA 3VALA 5BJRA 1DHMA 3TA0A 4WJBA 1S0OA 2ZH8A 5DZ6A 4LBPA 5L1JA 5I3PA 1C0UB 2VKRA 5E41A 3LP0B 3SV4A 2MZ1A 3SDEA 3G6XA 1KQGB 4OYIA 4WYWA 1EAYC 4Y0FA 3NNAA 3QMQA 4J9UE 2K3KA 5H9FK 4IFVB 1KTQA 2C2NA 2RSQA 1GMUA 1Z2ZA 2MQ8A 2F65A 4IR9A 2GO8A 1UP1A 1VQSA 1REVB 3E8OA 1NSAA 5DM7Q 5F8NA 1YJ9S 4C3LA 4MKAA 2W2NP 5AJ3J 3AA9A 1BQMB 5E2QA 3Q8YA 2AEMA 2IJNA 4NA3A 2NQPA 2J0WA 1UJ6A 1TL7B 3OVSA 3WHIA 3KJFB 2LQJA 5HVHA 3MUMP 1ZPVA 3MM7A 2RU9A 5CABA 5AE2A 4E2FB 2XEXA 2PD1A 5KFEA 5KFVA 2LFVA 4RW6B 2GAHC 2KJWA 3HHEA 2YWGA 3TW0A 2FYXA 4J9SA 3CJ2A 2DGOA 5KFKA 4J9KA 3AY0A 2G0JA 2SXLA 3IP0A 4DPOA 1RAFB 4NYOA 3QT6A 2DR9A 4LMZA 1W7WA 2FJXA 3E01A 4ED2A 2W7AA 4WWSA 4RO0A 1FXLA 3U1LA 1GNKA 4IQMA 4ZS6A 4KYZA 1TR0A 4QR2A 2HVDA 1FWKA 1HHQA 4X66J 7AT1B 3ZZUA 1T9WA 3FCHA 4PUOB 1SB6A 4DR7F 1AB8A 3QO9B 2QLXA 4RW8B 4UUXA 4RUHA 2Q66A 4OZ0A 3UFCX 4C8OA 2UUBJ 1H98A 4DSKA 1FNOA 3MAQA 1RYRA 2F4VJ 3O6QA 1XNQJ 4G3IA 3UDLA 2F4FA 1K0TA 3D0IE 4F25A 2VFVA 3LOUA 3UDVA 4QYZJ 5J1EB 1PJ7A 1YLXA 1PYTA 4FPRA 1FRHA 4U95A 2CWXA 2HNZB 4LSNB 2BM0A 2BM1A 3H2LA 2W2OP 4BHQA 5DZ7A 3I6PA 2WOMA 1KLNA 4DL7A 1PO6A 1FVQA 2MLYA 3B8HA 3K57A 2RB7A 2V9WA 1F6TA 4GKKF 2XLJA 4C3KA 1SCJB 3G4SS 5A0YA 1B64A 3H7HB 4ZVTB 3RR8A 3H40A 4O3SA 2R7QA 4V1Ak 2FB0A 2E5LJ 3EZOA 4J90A 4HACB 4LFAF 3RAQA 3FGVA 4M8LA 2HBQB 3DRPA 4RBUA 3J80Y 2PA8D 4JYAJ 5C42B 1LFPA 5ETVA 2UUCJ 2FLLA 3KTQA 3MEEA 2FLNA 9RUBA 5GAGU 2B3TB 1J2VA 4I67A 5DETA 3SYZA 2F1FA 2JOQA 1WUUA 2XM3A 4LF1A 4JI5F 2KT3A 2VZ9A 1VK3A 3DXSX 4LQ3A 2R7VA 4KC5A 3VAKA 1UMJA 2ZNYA 4ZIWA 2HHSA 4ALZA 2H5IB 3OHBA 3W2WA 1NJYA 3OLAA 1SC4B 1CQMA 1WHVA 3HP6A 1WWHA 1REGX 1RE1B 4I56A 5LMUJ 4HI1A 2YWWA 3PW5A 3H8YA 3GIIA 4FYYB 1F60B 3MMBA 3QIPA 5KFQA 2L3MA 2UU9J 1UWBB 4O23A 2IC3A 4WP8A 1ZTTA 2KG1A 3W9HA 3WIVA 3RRHA 5C24B 1HQUA 2R42A 5IWAF 2P9CA 2HMIA 4AXIA 5HANA 3FK4A 4USJC 1TUWA 3D1OA 2WBRA 4ED1A 4DR3F 1T9YA 2YWEA 3PFEA 4PG6A 1G3OA 1JKHB 3EDQB 2IRUA 4HEA9 2OLWA 1TQLA 4QIWD 1AZSB 2ROEA 4YB6A 3S6EA 4HT5A 2DNOA 1RHRB 1A9NB 3CJQA 1I51B 1WC0A 2ZVIA 2ZBQA 1IXKA 4ZVSB 4TKTA 4O3NA 4DV2F 3T19A 1SH0A 5J1NA 4LRBA 4P7VA 5GAEU 4A8YA 2PMWA 2H1YA 3FSIA 4DV3J 3DGVA 5F41A 2N3LA 2UUTA 5HP1B 2X51A 3PIOQ 3CF5Q 1C1CA 4EWTA 3V6DA 4J5OA 3C46A 3NL0A 3RAMA 3AJDA 3MCOA 4B3TJ 2K7KA 5HROB 4TY9A 1RWNB 3V2UC 2V9KA 5F8GA 3PKYA 1XNRF 5GAGI 1S79A 3V4IA 5F3TA 3R97A 4V19J 1IKWA 4P9SA 4DL0C 1S59A 1DARA 2Z2ZA 1KQSR 1RT5B 4B3OA 3HT3A 3BR9A 2DRDA 1YJWS 4FYDA 4ES1A 4LF8J 1U0SA 2AJ2A 4K4TA 4ED6A 2VJVA 1YJTA 3WBZA 4ZK7M 3LGNA 5BYQA 2U1AA 1HKAA 2QL7B 2J9CA 2RIJA 3ZXWA 3IR5B 1NKCA 3MAAA 2WVEA 1HBUB 3S1TA 2ZD1A 4HR2A 1VC5A 3QGGA 1I3OB 2AZ1A 3MOZA 1SPBP 3KLIA 4FDFA 2XGPA 4IR1A 4PXBA 3G6VA 1RU1A 5HMZA 2HFSA 4GVBA 4ZHRB 2HURA 4BBYA 5KFIA 2J9DE 5LXRA 1LW0A 1FX2A 2YQ1A 2Y1JA 2HFZA 1OY6A 2FLOA 3MM6B 3EDRB 1SC1B 2C2MB 3U1MA 4OZ3A 4O3PA 4DR2F 5H1SV 1N6QA 4IFYA 2HNDA 3SV3A 1KRPA 2DNRA 1QVFR 3TA1A 3M32A 2C2KB 2GHVC 5GAEI 5KFAA 2W4PA 4FXVA 1VRUB 3PR4A 3DOMA 3IWLA 1X9WA 1DLOA 2Z0GA 4M5LA 1KLMA 1GMVA 3IWNC 1JNRB 5J2QA 1CJUA 3I4HX 2CXEA 2K06A 3AH6A 2E7WA 4ZPVR 1U1NA 4OYOA 2Q6BA 3F44A 2ZZNA 1NZAA 3H5YA 5HVFA 1YJNS 4ED5A 4CLYA 1FTCA 1NHUA 5E3PA 1WJ9A 2KRBA 3KHLA 3VF0B 2AGPA 4GVLA 4EK2A 4WP3A 2IIHA 1HPZA 2DNZA 2DEJA 2PT0A 1RP5A 1LW2A 2XLIA 3PXGa 4NZ6A 1ROFA 5KOXA 4ZVGA 5T41A 2XB2D 1ZZNA 1WDDA 1RAIB 1ZA1B 1MG7A 3DOKB 4KH1B 4ZVPB 2CZ9A 2BE2A 2WBMA 2HK2A 3DRRB 1U1PA 1U02A 4IOCQ 3FRYA 4Z37A 2R2RA 1RGVA 5IM0A 1HLWA 2HVIA 3AOAA 3KXDA 2RRBA 4HDHA 1HQEA 5T14A 2PSZA 1RWKB 1WI8A 1YTYA 1ZM3A 3HMJG 4X4RA 2GVZB 4DUYF 1WHYA 2VQFF 1FDBA 2VA3A 1WKKA 3M9MB 2JLGA 1VQPS 2DPIA 3HHNB 2Z57B 1UETA 1X4AA 2DNGA 4ZVEA 1XTZA 2VC0A 2GMLA 3GFHA 3MM9A 3KHGA 1XMBA 2W24A 1TL4A 5F8LA 1YZ7A 2YH1A 3AXKA 4RNFA 2BJ9A 2YQ3A 1HD1A 4Y3CA 1NO8A 1NEEA 1QVGR 3TJ9A 4QPTA 4AQYJ 3PRVA 3EZ5A 5B0CA 5CQGA 1SC3B 2QJ3A 2J8AA 4DCPB 3MMJA 4B3MJ 1HR0J 2RQKA 4NLOA 1YVFA 1S1VB 2JLEA 3E01B 4FZVA 4Y2IA 4XPEA 1S9GB 1H3DA 1TKZA 1N36J 2CNNB 3QJPA 4IYQA 4TYAA 5LSRA 3HVWA 3OW2R 3VHQA 4DR1J 3K17A 4ED3A 3IC1A 3KKFA 4NL5A 2AJ0A 3S7RA 2W9CA 2LA6A 1NZ8A 1LWCA 2B4VA 1ITPA 2GIRA 4CI0B 3V6JA 4DPYA 3TP2A 3BKTA 2ZZTA 4GC7A 2RE1A 2Q79A 1D9DA 4ZCMA 2VDIA 2WOMB 5G0RA 3DNCA 1SJ3P 1XMOJ 4YB1P 3SSSA 1SJFA 1R0CB 5E7OB 1EQMA 4I7FB 5B0GA 1JIHA 5A0YB 5M2UA 3HPOA 2QN6B 3GR0A 3CDUA 5KFWA 3J7YU 1PC5A 1MSWD 4B3RJ 2M9KA 2KT2A 3DRPB 4YMEA 3QT5A 2RAQA 3BDPA 1OO0B 3LPYA 2FC8A 3UWTA 3NAIA 4AL7A 2VASA 5EUHA 3P49B 4OI3A 2JDJA 2HZCA 2R8HA 4CRJA 2ZBPA 1TAQA 2MQQA 4USVA 5HO4A 3D6MB 3CULA 4X4SA 4OI6A 4B9NA 3HCXA 1S6UA 3W2WB 2UUAF 1L3TA 1HI1A 1SI9A 2MMYA 1KD1T 1FRJA 2VBYA 2Q43A 4L75A 4OZNA 4RW7A 3U7JA 1VYAA 2HGNA 1HMVA 3MMBB 2LXFA 1DTTA 3AB2B 4NLVA 3QIPB 2XSFA 2LXIA 5IC4B 1Q0NA 2OI2A 1HQUB 1MN7A 3AJ2A 4CH7A 1NJIT 4C0BA 2HMIB 1HNXF 4GRSA 1UVLA 1YDLA 1ULRA 5K8NA 1HW8A 3CCTA 3CJSA 2B7CB 4DR5J 3HHLA 4FKYA 3KJNB 4YR3A 3L9ZA 2C42A 4ZOSA 4DHVA 1KC8T 1T0TV 1U1OA 5GVQA 1RKJA 1A0OB 4WBFA 1UFKA 5LMNJ 2C2ZB 3TZYA 2WW4A 3KLEA 4KKOA 2VONA 3JTOA 3W5XA 3RB6A 1EARA 2CPJA 1DQ9A 1VQ6S 2LDYA 4QOTA 5FDLA 4CH1A 2H5JB 3LP1A 4CIOA 3HFZB 3IBWA 3BQ1A 2HWHA 3ZNUA 1C1CB 3V6DB 1JLGA 1KNZA 1T8EA 3J81Y 2M70A 3VZHA 1FWLA 3Q8SB 1Q82T 3TAMA 4R25A 3TJ8A 4FBUA 3W64A 2CQHA 2H4YB 2H65B 5KG2A 4K0KF 1S0VA 1BC6A 3V4IB 2WAQD 2R8GA 1IKWB 3MD3A 2YPZA 1FFWB 3DLLQ 4B3OB 1LXNA 1T05B 3GJTB 4ER8A 2ZE2B 3EGVA 3JQJA 4HKQA 1VBZA 4EFAC 2LKZA 5AXKA 2R7OA 3UO0A 2OPRA 2GZOA 2GQQA 2CADA 1S57A 3W5ZA 3PO5A 4JI7J 3DGPA 1IKVB 1IKXA 3LANA 3MAAB 2AHOB 2ZD1B 3CVKA 2ROGA 4YDDB 2VODA 1TKXA 2VL1A 2QA4G 3LWMA 4X4VA 4OX6A 2CYYA 4ZPBA 2VG7A 5DG7A 4B3SJ 3KLIB 2VJUA 3NCQA 1J5OA 4GVBB 4XO0A 5FJ4A 4WPAA 1MROA 3M8YA 3CJ3A 3Q8UA 1LW0B 3N5BA 5DLGA 5HL7Q 1T9XA 2J0QD 4KBIA 2L9NA 1X9MA 1VQMS 2IDLA 3BN4A 4PWDA 2IM2A 3DI6A 1YHQS 2N3OA 2I9SA 1KOOA 2DYAA 1N6QB 4WFZA 4IFYB 2ZNZA 1LWEA 4F50A 2KFNA 1DZ5A 2DNNA 2OTLS 2HQCA 3M32B 3THPA 2IM0A 4DL5A 1F2GA 3T6BA 1DLOB 3MR3A 4CM0A 1KLMB 3CMES 1VHFA 1Q53A 2NZCA 4F4YA 1CJUB 3VV2B 4QYZK 2HQDA 2FUG9 3G2XA 1P1LA 4B9SA 2CAJA 4NWBA 4DSEA 3ZTQA 3MM5B 1Q86T 1IBMF 1Y10A 3T3FA 3CT9A 5KFJA 1DURA 2IPOB 1H74A 4MFBB 4ZCLA 3IG1A 3DLBA 3RB4A 2E5IA 4Q2LA 1F5BA 5DDQC 3K5MA 1JLAA 1V5VA 1TVRA 1FRIA 4HDGA 1HPZB 2DEIA 1UFWA 5K8OA 4OI4A 1LW2B 1UJ4A 3UVJA 1RTDB 1S9EA 5ETNA 1IR1A 4U9RA 1S4FA 5K8PA 2JEJA 2M88A 4H4MB 4QCLA 3Q89A 4LF7F 2NYHA 2MGZA 3BJYA 4O0IA 2E5HA 1WC4A 4RNOA 5CYJA 4DV7F 3OQ2A 4QU6A 4I1TA 2XS2A 3V81B 3QFHA 3LGMA 2HGLA 2J7WA 4H4OB 5CH7B 2JNJA 2XWXA 4DR7J 1FXRA 3GG0A 3O5TB 1IJFB 3ZTOA 3HZGA 4OZLA 5DQIA 3SZ2A 3Q2SC 3MM9B 1C0TB 4URSA 3Q8VA 3GTYX 2NREA 3E51A 1NPPA 2C28A 2PO4A 5THWA 3J81j 2E1MC 3NGDA 4DV6F 5EDWA 1PYOB 2AYBA 4JI2F 3D3BJ 3W9IA 2G2ZA 5I42A 1K73T 4USHA 5D4NA 1R43A 2FHMA 2XBPA 1PILA 1MU2A 2XO6A 4KGKA 5D3GB 4GKKJ 1X5TA 1ICEB 2CZVC 3G6YA 4RJVA 2LEPA 1S49A 2ATLA 4DPWA 1TKZB 4DMZA 1Y3JA 3T5KA 3D7SB 1RBOB 1JLCA 3HVTA 4FF3A 2HVHA 3EZUA 3U1NA 1Y5NB 2W9CB 1B4SA 4CLKA 1T94A 3HF5A 3ZTPA 1LWCB 3D67A 1B7YB 1NM2A 4LIRA 4XTTA 4DR6F 2J9DA 2E5GA 3BO4A 1S48A 2XGQA 2AZ3A 4NA1A 3DLHA 3S8SA 3NKYA 1FEHA 4C48A 2O66A 5D77A 4OYBA 3ILLA 2FIUA 1IVZA 4KHMA 4J37A 3EYZA 3D5MA 2ALYB 4LRCA 4ECWA 1WHWA 3RGIA 3EICA 3IA0A 1HNZF 1JXLA 4DPUA 4QWBA 1FRLA 1NK8A 3KMSA 3ZTSA 4DX6A 4DR3J 2CZ4A 2L41A 3LW5C 1Y5IB 4ANCA 3CB4A 2OEKA 2ZBCA 3OV7A 2BOAA 3NNCA 3ZO7A 3P8BB 4HH1A 2OPPA 4UZBA 2HSEB 3A8JA 4ERDA 2R2UA 1BLUA 3BM7A 5KG7A 1HBNA 2OMOA 1S5ZA 4OX9J 3PV8A 3MTKA 1SL0A 2AQ4A 4DBQA 3ENVA 4DV2J 4Q0BA 3FUYA 4NXMJ 3FVYA 4RW7B 4YN3B 2J6UA 2AWZA 5KFHA 3FQKA 1X31C 3KK2B 1HW9A 5HLFA 1N5TA 4ZN1A 2WK4A 3UI3A 2DHAA 2XSJB 1OIAA 2QL9B 1S6QA 3W2VB 5D4OA 1PGZA 1GAOA 4DSIA 2BE7D 1RHJB 2R7XA 5F9LA 3QSIA 2LEBA 2C3YA 3FKBA 3IRXA 3VGUA 4RKUC 1JNZB 1XNRJ 3HHLB 3W8GA 1F5AA 4KE5A 2X1GA 4NLQA 3W7BA 6AT1B 5D4LA 4F2SA 1RWMB 3KLEB 1U6ZA 3BBFA 2G1HA 2V94A 1N5VA 4D3HA 3ET6B 3MR7A 4DX7A 4ECTA 1VMBA 3ZZPA 1JLGB 3K5NA 2HHWA 2WVCA 4GO7X 3R2CJ 4Q8EA 1H73A 4LF6J 3BYRA 5C2GA 2MSSA 3TAMB 1L5UA 5CHCB 4P7TA 2RMLA 4DF8A 1HYSA 3TZXA 1IWAA 4UOGA 1RT6A 2AGQA 1GXTA 1WF0A 1EETB 2IRXA 5IXUA 1CJTA 1R6YA 3V6KA 3D66A 4P2FA 4YDXA 1PKUA 3IRWP 3D4JA 4OL8A 3VGVA 2OPRB 2XC9A 2VG5A 3DGPB 5IV4A 3J80U 2ZBRA 4CYUA 1IKXB 4AUKA 1NDCA 2BMBA 5AE1A 4JI4F 1K1SA 3PZPA 1F0XA 1TK8A 1FEEA 3RYLA 1TKXB 4C98A 2HFNA 4ZLNA 2H54B 4C8YA 5DO2A 4J9LA 3FZBA 1R3NA 1UVIA 4KRWA 4OZ5A 1J5OB 4WKYA 4B17A 1RTJA 2JLFA 4OQJA 2CUYA 4DR4F 3SCIE 3MEGA 2ALZA 2NPIA 5IT9Y 2XWYA 1VIOA 3SEOA 3H2UB 2LQ9A 2YXLA 1RWVB 2V8GA 2IDEA 2WVFA 3E2EA 3RU0A 2E29A 1P1TA 1VI7A 1TV6A 4N47A 1UEVA 4PPZA 3UR3C 1HFEL 3TZZA 4M5KA 3TEHB 3OR1B 3MCNA 2DXFA 1Y3KA 3BGLA 2BR0A 4NYPA 4CP5A 3A1YG 1OQ6A 2CJXB 4DEZA 1KHWA 3DOLA 5L9XA 4C6AA 1UW4A 3QLHA 2OELA 2OIHA 2FVSA 3VAJA 4KT0C 3MECA 1AROP 4X66F 2DY1A 2MQNA 1QAIA 4NCBA 2V4QA 3DDKA 2ZVSA 1RT2B 1RTIA 5HJYA 4MYTA 2ZHAA 2YWHA 2IA0A 1TTHB 3ZZ0A 3KLVA 2X1FA 5HQLA 2KB2A 2VDHA 3B78A 2BKNA 3NRBA 2ZJRQ 4CLUA 1URNA 1RB0A 2D3ZA 2RHQB 1JLAB 3P5TL 1UPPA 3OHAA 1XNQF 4USKA 2B7BB 2X1AA 3DHWC 2ZM6F 1NRKA 5HBMA 3UVJB 1Z2LA 3IXQA 4DUTA 1WELA 1XMQF 2JWNA 2MGZB 1WKLA 2XMKA 5F8JA 3RB0A 4NZ0A 2AYMA 2GV1A 2DD8S 1HHTP 4RZRA 2V6AA 3DM2A 3JAMY 3BBCA 2ASJA 2B8PA 2AJ1A 2WHOA 4JV5F 1WOOA 5D15A 2UUCF 1MLAA 2M3DA 2N4CA 4PG4A 4DFPA 1SKSA 3DYAA 4O3RA 1FX4A 1PBUA 4TN2A 2H3EB 2VBZA 1F3FA 1F2HA 1RLDA 2EVZA 2WZ1A 4ETZA 4Y00A 4RW4A 4BS2A 2PI4A 3VCDA 3JSMA 5B0DA 2I1RA 5JXSA 1VQNS 3UE2A 1RT7A 4PXEA 2XS7A 3AODA 3DLGA 2F9DA 2FLPA 3KUGA 3MMCA 2G2YA 2CQ1A 5I42B 4EUVA 2M52A 1VQ5S 2VU5A 3PRBA 3LUYA 2WVBA 1VS3A 2XI3A 2R7RA 4K4ZA 4J91A 4KAIA 3I4PA 3CJTA 4LFCJ 5HVGA 1LNQA 2B6AA 2FJAB 4ECYA 1X8DA 1NXIA 5HATA 1D8ZA 1FRMA 1VQ7S 1JMTA 1JLBB 1QSLA 4CQ1A 3IN5A 3RBEA 3PW2A 4RNHA 5KFBA 1ACMB 3I0RB 2FHKA 1RKIA 2HQFA 3PIPQ 3K59A 4JI3F 3C3LA 1N54B 3FEYB 5CZXA 3M8SA 1TKDA 1CC7A 4CLWA 1WORA 2VQEF 4K4SA 2XMMA 2AYEA 4F04B 2JHEA 2J6SA 4NYZA 1RTHA 1FK9A 1RXOB 1KVJA 4WE1A 4K5SA 3LAMA 4USWA 4WZQA 4OJGA 1O51A 2VA2A 2ADBA 5LM7E 5HI7A 3QGHA 3R5DA 4M5IA 4ZVUB 1HNXJ 2L48A 4PCQA 1LQ9A 3R27A 3BKUA 4LF8F 2KH9A 3FJ2A 3D2WA 1H2TZ 4UW2A 4P71A 4ELVA 3EM1A 2C22A 1FVSA 4J9MA 3EMTA 1GX6A 2KXNB 3MI7X 1KR4A 1HBNB 2FY8A 2VIHA 4HHUA 2IMWP 4CH0S 4J9QA 4Q0BB 5BXIA 3C66A 1J27A 1D0EA 1S6OA 3GMGA 2FJWA 3OXLA 3BGRA 2GJIA 5HLFB 3R6LB 5J2NA 2LLZA 2MHNA 2ZC4A 4LVOP 1S6QB 1WC6A 2KG0A 1NKBA 3EXCX 3LP0A 5A8KB 1A7GE 1RHKB 3IRXB 3H5XA 4K0KJ 2VFUA 2NSCA 4RL1A 4CLSA 3RRGA 2RUSA 1U8WA 4ZPWR 1R6VA 3CJ4A 2W7PA 5HMWA 3DLEB 1RAHB 4K5RA 3GP9A 3NCRA 3M2RA 1B0VA 1D3WA 1YRUA 2DH8A 2HHHF 4E0DA 1JLQA 4F67A 3IAM9 4RU2A 2VBWA 1YI2S 2IYGA 2YVSA 3KK3B 1M5VC 1ZM2A 2P9EA 1YJRA 2W2QP 3HXMA 1UZDA 1TL7A 4OJ3A 1UKUA 3EGZA 2PA3A 4N76A 2LP4A 2ADCA 1RT6B 5F9NA 3H90A 1EIYB 3B4MA 1T3NA 1R7IA 3BGUA 4WK1A 1CJTB 3PKMA 4QWCA 4KGVB 1TELA 4EZ6A 3ZZTA 4H4KA 4RW6A 2XYGB 1DRZA 3FNNA 2VG5B 3E3XA 3DRXA 4PEOA 4QYRA 2W8KA 2CVEA 4CYUB 3QSYB 1RWWB 1NK6A 3OFFA 4E98A 3MF5A 2ZH3A 3AJ1A 2G2OA 1SQFA 2B4PA 1VQOS 1HWLA 2KRRA 3M1VA 3ADAC 2YWFA 3K89A 4I68A 3OBIA 2EFVA 3IWXA 4FS1A 4LVNP 4RLEA 1S77D 2XMWA 2ZOFA 4PUOA 2AF6A 3MR2A 3VAMA 3QO9A 1FE4A 2XZWA 1RWPB 3BN7A 3DDIA 4RW8A 1IBMJ 2VPWB 3IGNA 3R5AA 5A6WA 3ITHB 1DAXA 4M95A 4DCOB 4LBHA 5B08A 3EGWB 1QAJA 2VG6A 1RWXB 2HHXA 1CS4B 2LU2A 9ATCB 1TV6B 3H98A 4A48A 4DF4A 4IRKA 1BQXA 4B9MA 4Z2XA 3HVAA 2KFZA 4X2BA 4MMOA 4X64J 3MD1A 4B3MF 4LSNA 4MTPA 5LL6d 1QM9A 3P45B 2YKMA 4MK9A 1YJ7A 3DOLB 4ZVRB 1KEKA 2BA9A 3QLHB 2DHHA 3FBBA 4LF7J 2G1DA 3CCRS 2F3JA 4OLPA 5IT4A 3D6TB 3MECB 4RUAA 2F8EX 4M63A 1N36F 4DV7J 2UUWA 1I6JA 1RTIB 4HACA 3A8KA 2G4BA 3L95X 2YQ0A 4CWBA 2MLZA 3DXBA 3RR7A 4DR1F 2ZOMA 4DL6A 5AT1B 1BWEA 3SBMA 5C42A 2AIRB 3N01A 2QV6A 2ASLA 1SL1A 1X7VA 3LQVA 2AEJA 2YPYA 5KFSA 4NZ7A 3J81U 3JS9A 5J1PA 4ZPAA 2DNQA 4IQXA 5HBMB 1Y5LB 5C7PA 5DQGA 3OFEA 4YFUA 2ZH9A 2EFGA 5K20B 1GFWB 2HVEA 4GC6A 4DV6J 1CBKA 2A0FB 4JI2J 4IO9Q 4UY85 4K59A 1FD2A 2L9WA 4QWDA 1FFSB 3DM2B 3VAIA 4B3RF 4OI0A 2BANA 5CD4A 2JSXA 2MKSA 3DCAA 4IKAA 1UWBA 2H48B 4OHWA 4LRDA 1T3OA 5B0FA 5C24A 1OMSA 3M6UA 2DO4A 4R5PA 3HKZD 1FXDA 3BSNA 2RILA 2DXDA 4I0WA 1SKWA 1JKHA 5LXYA 3R6GB 3PTWA 1QTMA 4RW4B 1AZSA 3D1QA 2ZDOA 1U1MA 3I32A 5DDOC 4N8OA 1NB7A 1RT7B 2BX6A 2Z58B 2EBGA 3DLGB 5JVGQ 4DR6J 3O2IA 4LSLB 3MMCB 3PYDA 2OMLA 5C25A 1FDNA 1P8GA 1WKJA 4MKBA 2CJBA 3A3OB 2GHPA 3F56A 1U47A 1Q95G 5KG6A 4RUCA 2C2DA 4ES2A 5HP1A 5KT4A 2MB0B 1MWZA 2NS1B 1V3SA 2B6AB 3I9ZA 1HNZJ 1KBRA 3TVKA 4N8NA 2DNKA 1SH3A 3NBPA 1OSDA 4U8YA 5K14A 4LF5J 2XMVA 5DG9A 3D1HA 3HLUA 2DR6A 1UVKA 1M5OC 2EPIA 5ETOA 2P6TA 2FZGB 1RCXB 4FVMA 5ETMA 4UOFA 5KFLA 3WC2A 1T02A 2RS2A 4LREA 1XR7A 1A6LA 4ECVA 2YNHA 1O5JA 2UVRA 3ZFVA 2ZH5A 4IG0A 3WC0A 3HFVA 1HA1A 4K2XA 3T1AA 2AD9A 4DWIA 2J76E 1KFDA 3J7Z5 2DIUA 1NSQA 3D9BA 5J2MA 1N88A 3T6JA 1PJ5A 2OEMA 1IBCB 4YOEA 4WE1B 2HIQA 3N28A 4KR0B 1NHVA 3KFWX 4ZHRA 2QIFA 3QJLA 2E1AA 3UR0A 4OX8A 4OYMA 3GFYA 4RWWA 3LPEA 2DBBA 3M9NB 5GMEA 4A8MP 2EK1A 1RCOB 2HK3A 4ILLA 3MM6A 3KDOA 4ZLJA 2LXUA 3I56S 1NSPA 2HHVA 1YWXA 4JV1A 2KDOA 4JI7F 3OUYB 2GX8A 1LWFB 1S1XA 4ZIVA 1IKYA 2KZZA 3ISNC 2DGWA 3SIPB 1FD8A 3UD4P 2ROPA 4ANEA
chains in the Genus database with same CATH topology
3QFHA 3BPSP 3AFGA 2E1PA 1V5IB 3GCWP 4K8RA 2W2PP 4NMXA 2QTWA 2XTJP 4OV6A 4YN3B 3H42A 4JP8A 2Z30B 2W2MP 3A3OB 3P5BP 3CNQP 3VV2B 1SCJB 3WIVA 3WHIA 2ZWOA 3BGOP 4NE9C 1ITPA 2ZWPA 3T41A 3A3PB 2W2NP 3CO0P 2Z58B 3VHQA 3WIUA 2Z57B 3SQOP 2Z2ZA 2PMWA 1SPBP 2W2QP 2Z56B 3A3NB 3GCXP 2W2OP 2Z2YB 1R6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFH A;  3BPS P;  3AFG A;  2E1P A;  1V5I B;  3GCW P;  4K8R A;  2W2P P;  4NMX A;  2QTW A;  2XTJ P;  4OV6 A;  4YN3 B;  3H42 A;  4JP8 A;  2Z30 B;  2W2M P;  3A3O B;  3P5B P;  3CNQ P;  3VV2 B;  1SCJ B;  3WIV A;  3WHI A;  2ZWO A;  3BGO P;  4NE9 C;  1ITP A;  2ZWP A;  3T41 A;  3A3P B;  2W2N P;  3CO0 P;  2Z58 B;  3VHQ A;  3WIU A;  2Z57 B;  3SQO P;  2Z2Z A;  2PMW A;  1SPB P;  2W2Q P;  2Z56 B;  3A3N B;  3GCX P;  2W2O P;  2Z2Y B;  1R6V A; 
#chains in the Genus database with same CATH topology
 2MEW A;  2W2P P;  3BGR B;  1FKP B;  4A8O A;  1PBA A;  2KZM A;  4NEY A;  1MN9 A;  2W2M P;  5J2N B;  4U7C A;  4B3S F;  2RUG A;  2F8M A;  3RTV A;  3GIJ A;  2CFX A;  3QWP A;  1ZYQ A;  4F3Q A;  2ABY A;  5IQ6 A;  3MFI A;  4FF1 A;  3M2U A;  3Q8Q B;  2KFY A;  2PGC A;  2WTF A;  3Q86 A;  3QPI A;  1APS A;  4WZM A;  1PIE A;  3NWG A;  4C8Z A;  2HLT A;  5KFX A;  3PVX A;  2MZJ A;  3IGV A;  4OHX A;  3GV8 B;  2D9O A;  4JV0 A;  2FHJ D;  1FI4 A;  2AW0 A;  2P6S A;  3M2R B;  3M30 A;  3FFI B;  3RAX A;  1JLQ B;  3DOK A;  2OSQ A;  3TA2 A;  1LXJ A;  4JI4 J;  3MCM A;  3DRR A;  1FO1 A;  1ZAV A;  4ECR A;  3EVM A;  2GMH A;  3T5L A;  4AND A;  2MZQ A;  1N5Q A;  2XMU A;  3LAL A;  2WON B;  3VR1 A;  2VPY B;  4XIU A;  1UAW A;  1GXU A;  4DN0 A;  5KFZ A;  2GVZ A;  3QWU A;  4OI2 A;  4OHZ A;  5KFG A;  1WD6 A;  3OL6 A;  3PCO B;  1WEZ A;  4ZPD A;  5HN0 A;  4DR4 J;  2XY6 A;  4F3M A;  5BYR A;  1JLE B;  1YQH A;  1S9F A;  2J7K A;  3TUZ C;  1TK0 A;  5CXT A;  2JZ5 A;  4A8K A;  1V6H A;  4RBT A;  1VQY A;  1SJ1 A;  4CLZ A;  2XTJ P;  1WG4 A;  2DK2 A;  3OXF A;  3RBX A;  3QQC D;  2CQ3 A;  2CJY B;  3WDO A;  2DPJ A;  1U8S A;  3WIU A;  3OJU A;  1U4B A;  2CPF A;  3HJV A;  2BKP A;  2BJD A;  1S1V A;  3M1V B;  1WOS A;  1EB0 A;  3T1H F;  3R7N B;  5IV3 A;  1TL3 A;  1S9G A;  4A8S A;  4OYX A;  3EX7 B;  1C1B A;  1M0S A;  3NNH A;  1EP4 A;  2RF2 B;  1FE0 A;  4U7U D;  2MKJ A;  1FCA A;  5L9N A;  2PC6 A;  4OHV A;  3NMR A;  4C0O C;  4CO4 A;  4JP8 A;  3D0G E;  4XK8 C;  2K3I A;  4YR2 A;  3JSR A;  5EX0 A;  1XK8 A;  4I69 A;  1LK7 A;  1X4F A;  3C15 A;  2VG6 B;  1YBA A;  1MNE A;  4C8N A;  4K8R A;  2QTW A;  1S72 S;  1SV5 A;  2NXN A;  4QW9 A;  3CDE A;  3GWC A;  2ZM6 J;  3GPA A;  5C2C A;  1Q78 A;  4CLP A;  1N8R T;  3WZ0 A;  2YKM B;  2ZIT A;  3MGJ A;  1XMQ J;  2RKI A;  4I7F A;  3TR5 A;  1RTZ A;  3THT A;  1IWG A;  4PQA A;  2MQM A;  1RWO B;  3AQO A;  4K4Y A;  3A12 A;  1HD0 A;  1RWU A;  3Q8P B;  5GAH I;  5AXL A;  4JV5 J;  3CNQ P;  2QT7 A;  1B7F A;  2ZH4 A;  4C7Q A;  1DTQ A;  1X5O A;  2AYG A;  2EFN A;  3US5 A;  4CTA A;  1WHX A;  4F02 A;  2DRA A;  2QSF A;  1WF1 A;  4O3Q A;  2UVU A;  3IM8 A;  2VKZ G;  1MMN A;  2OEJ A;  1JQG A;  4IO1 A;  3ZNJ 1;  3HD1 A;  2C2O B;  3FBE A;  2C2E A;  3RUB L;  3MEK A;  2MXY A;  4DQQ A;  3C14 B;  3NGU A;  4NLG A;  1TKT A;  1NH8 A;  2DHX A;  1QAY A;  1RBA A;  1VIS A;  3MHY A;  3HVR A;  4G6V B;  3ILO A;  2XCA A;  3HHD A;  4C3M A;  3C8Y A;  2HYI B;  2N4D A;  2BXJ A;  4WII A;  2EG1 A;  2FJB B;  1C4C A;  3H5U A;  1NJW A;  2KXH A;  2BAN B;  4O4G A;  3GON A;  3JTN A;  3PYF A;  2RHS B;  5HMX A;  1UEK A;  3VVT A;  1S1U A;  4ZVF A;  3JYT A;  1MML A;  3HJF A;  4K4W A;  1UJ5 A;  3BSA A;  2O3D A;  3L3C A;  1TFW A;  2CG8 A;  4EYH B;  4DQI A;  1LKZ A;  4R5P B;  2V63 A;  2GQ2 A;  4R0J A;  2W8L A;  2ILZ A;  2OD6 A;  5KFR A;  2UXC F;  2MKY A;  5HSP A;  5KT7 A;  1U49 A;  1T7P A;  2R7S A;  1X5P A;  1YIT S;  3VZI A;  4A8X A;  1BD6 A;  1YK9 A;  1H7W A;  4PAA A;  2F63 A;  5D0H A;  3POT A;  2HQG A;  4IH7 A;  3M6W A;  1H2V Z;  1Y00 A;  2DVI A;  4ILM A;  1X0F A;  3UCU P;  3O3L A;  1L3U A;  1TK5 A;  4OX9 F;  2QLW A;  2BYC A;  2KJV A;  4X84 A;  4JI3 J;  1IQZ A;  4NXM F;  5C25 B;  1PSD A;  3QRP A;  2ZWO A;  3CCL S;  2BQ3 A;  5IC6 B;  1U26 A;  5IT9 U;  3IS9 A;  5L1L A;  3FC9 A;  3HHK A;  3AB4 B;  1DQ8 A;  1RBL A;  2VQE J;  3PEJ A;  1ZM4 A;  4HL9 A;  3FBC A;  3PJW A;  4ENO A;  1FJ7 A;  3OVA A;  4K4V A;  2QO3 A;  4X65 J;  2BEF A;  3NBP B;  4NPO A;  3M8P B;  3CCQ S;  4WK3 A;  5K14 B;  1NUE A;  3KNA A;  2GQC A;  8AT1 B;  4WTO B;  1RHM B;  4KGX B;  3MCS A;  2M8D B;  4FF4 A;  1T05 A;  4KHP F;  4QR1 A;  2HS0 A;  2ZE2 A;  1DBD A;  3NS6 A;  4D3G A;  5F8H A;  1TL1 B;  2DH7 A;  3MFH A;  4ZPC A;  2YY3 A;  2D7S A;  2FC9 A;  5A8R B;  3AD9 C;  1VC6 A;  3BGO P;  3MUR P;  1X4G A;  1SC6 A;  1IKV A;  1MW7 A;  4G1I A;  1F3V A;  2YNH B;  1WG5 A;  3O8W A;  1VDH A;  3FRZ A;  2HWI A;  4IG0 B;  1V3Z A;  3QGP A;  4LF6 F;  3OL9 A;  3K5P A;  1EHW A;  4BC7 A;  1SIW B;  5J2M B;  2R4F A;  3ULH A;  4M5J A;  4DQP A;  1U1K A;  2V50 A;  3QID A;  2XG8 A;  3TWZ A;  4OJ1 A;  2QC3 A;  3ILJ A;  1KHV A;  2CWK A;  3AQP A;  3Q0A A;  1HNW F;  1SKR A;  4ICL B;  2CQ2 A;  5D0G A;  3KYL A;  1M5S A;  2D9P A;  3JAM U;  1Q1K A;  2NXU A;  4DPX A;  3HO1 A;  2OPS A;  1SUQ A;  3H20 A;  3NMA A;  2PDA A;  1S1X B;  3L7O A;  1IKY B;  3HFK A;  4Y2C A;  2R2S A;  3Q22 A;  2D1C A;  4YQW A;  1N5Y A;  3OXG A;  3BS9 A;  3CIM A;  2HHH J;  3T41 A;  3TVY A;  2E7X A;  5I4M A;  3PO4 A;  1U0H A;  2ZEJ A;  2HS3 A;  3CTR A;  2QA2 A;  1VJW A;  4DV1 F;  3OTC A;  3MM5 A;  5L1I A;  2YX1 A;  1GEH A;  2LA4 A;  5KT3 A;  3M2U B;  4DPT A;  3OSN A;  2IVM A;  4MFB A;  3R1H A;  4TVA B;  5CYQ A;  4M5N A;  1NPR A;  3M2V A;  1HIY A;  4M5D A;  5IT0 A;  2YH0 A;  4UF4 A;  3WX4 A;  3OSP A;  4CT9 A;  2HHT A;  3I82 A;  4U67 Q;  2KL8 A;  1RAC B;  1RAA B;  2DGV A;  2D3U A;  3JSB A;  2XQC A;  1RTD A;  1S1W A;  1I5O B;  3GE9 A;  1U45 A;  3M30 B;  2IMO A;  3DDN A;  2B5J A;  3OR2 A;  1TU0 B;  4H4M A;  1RA6 A;  2QMX A;  4J9V A;  3BF4 A;  2JEG A;  2HAF A;  4A4J A;  3D68 A;  4P74 A;  3PW0 A;  2UXB F;  1S99 A;  5E0O A;  1G6B A;  3FDS A;  1XER A;  1WSR A;  1GX5 A;  1H72 C;  3B6B A;  5KT5 A;  2PFD A;  3V81 A;  3OVB A;  1NK4 A;  3G8Q A;  3BR8 A;  1EKS A;  4LFB F;  4H4O A;  1FFG B;  1YBU A;  3G8T A;  5DJB A;  4ZP6 A;  3NLC A;  2GA7 A;  4YB5 A;  2UVW A;  4OYZ A;  2JJ4 D;  3B54 A;  1LOU A;  5DG8 A;  4U7U K;  4RW9 A;  4JUZ A;  6FD1 A;  1C0T A;  2YKP A;  1RK8 A;  3ISN D;  2XUL A;  2KO1 A;  2EW9 A;  4NLT A;  2D3O 1;  2E7V A;  2GMJ A;  1QUV A;  2CPY A;  4LSZ B;  2NPF A;  2B9X A;  2HHU A;  2B0G A;  4WXO A;  1NJZ A;  1O6X A;  3GU0 A;  2ZH1 A;  1DJ0 A;  5DDP C;  5B7W A;  3MOJ B;  3RW6 A;  4DLG A;  1PAU B;  3DMJ A;  3UCG A;  3FMB A;  2JL9 A;  3AT1 B;  4CZC A;  5D3G A;  2ZHB A;  4YB7 A;  1I94 F;  1G7C B;  1TL3 B;  1UA0 A;  2YKN A;  1C1B B;  2W4C A;  1U1Q A;  2G0C A;  4DSF A;  1EP4 B;  3B82 A;  2N7Y A;  2IFX A;  3EUN A;  2J9E A;  3UNG C;  1T03 B;  4X4N A;  1H7X A;  3SSQ A;  2X3G A;  1P9Y A;  3VWS A;  2KHD A;  3SQG B;  2XMA A;  3C15 B;  4MT1 A;  2HNY A;  3IBF B;  2BJ3 A;  2IYI A;  2VIC A;  3HM9 A;  4Q45 A;  1MMD A;  2BV3 A;  1JXE A;  1SV5 B;  4S0M A;  1T9T A;  1VR6 A;  3MPV A;  4F0M A;  2CJQ A;  2P5V A;  5BYS A;  3AAW B;  4JI8 F;  2RKI B;  2OAU A;  3K2Y A;  2W1B A;  1RI7 A;  3QJJ A;  3PJX A;  3I0S A;  3CC2 S;  4LFC F;  2VD3 A;  2Z2M A;  4PZV A;  1D8Y A;  2VBX A;  2A18 A;  1TFY A;  2H4W B;  4MIB A;  3SCK E;  5KT2 A;  3MR6 A;  2V2K A;  2Y1L B;  4CLF A;  1B70 B;  1JLF B;  4DV5 J;  1DTQ B;  1Q8I A;  3DU6 A;  4CTA B;  3UNY A;  2DCL A;  2QZ8 A;  4X4U A;  4WIQ A;  3BGF A;  4QW8 A;  2KKH A;  5T7L B;  3FEX B;  1IBK J;  4YUD A;  6FDR A;  1SJ4 P;  2V34 A;  1UTA A;  1TKT B;  3M8R A;  2RT3 A;  1KN6 A;  3R7B B;  3CCW A;  1KVI A;  3R3T A;  2IVY A;  2G9O A;  2KM8 C;  4I2Q A;  3KK2 A;  2JFK A;  2X7I A;  4KGZ B;  1Y4Z B;  4O4G B;  2XSJ A;  1GQE A;  3RW7 A;  4KY3 A;  2BE9 B;  3HSJ A;  1S1U B;  1M5P C;  3JYT B;  3W2V A;  1ZET A;  1NH7 A;  1TP7 A;  3D54 A;  2ZBI A;  1Y9O A;  2VC1 A;  2O67 A;  1XIQ A;  3I5A A;  3TO8 A;  3TI0 A;  4WP9 A;  1TZ0 A;  4ZA1 A;  4WCE Q;  4YHH F;  2E9T A;  1S10 A;  4PXC A;  1XJW B;  2DT9 A;  2GCF A;  2J7U A;  4ZLL A;  4JBC A;  1WF2 A;  2DGT A;  3HD2 A;  3POT B;  3ENW A;  2BRL A;  1RYS A;  4CNY A;  1KTV A;  5IQQ A;  4NCG A;  1JWW A;  3CED A;  3HK2 A;  2V67 A;  3L4B C;  2AMC B;  3UQS A;  2LQ8 A;  3QZ7 A;  4ECQ A;  5ETK A;  3ET6 A;  2XNR A;  3IS9 B;  3D28 A;  3OTO J;  2JRS A;  1ZS6 A;  3P4U B;  2WSE C;  4FXW A;  2V8D A;  4NLX A;  1IM6 A;  2ZWP A;  1KOH A;  2QMW A;  2XMT A;  3SCJ E;  4DZD A;  2ZH7 A;  1B99 A;  1HWK A;  3G9C A;  1E6V A;  3QGI A;  4IH6 A;  2ZFH A;  5K5M A;  1Q7L B;  3DFE A;  4P73 A;  2CG4 A;  1VC0 A;  2DR5 A;  2OD4 A;  1EET A;  5KFU A;  1FF2 A;  3MM8 B;  3V6H A;  2FPH X;  2YKQ A;  2D3O R;  1BGX T;  3G87 A;  4ID5 B;  2DCU B;  5B09 A;  2HRY A;  2ACY A;  3S01 A;  2WB1 D;  4P52 A;  2GAG C;  5U47 A;  5ITH A;  1HQ2 A;  2EI5 A;  1VRQ C;  3Q2T C;  1AUS L;  2HG4 A;  4NLR A;  4M5M A;  5DGA A;  4DSJ A;  2MTL A;  5HJX A;  3FSY A;  5A2Q Y;  2E66 A;  2B56 A;  4R0E A;  1T11 A;  4PKD B;  4CLL A;  1YRX A;  3D0H E;  1T95 A;  3NS7 B;  2B4O A;  5I3U B;  4K50 A;  1NND A;  2B8Q A;  1X4E A;  1OSC A;  1KDN A;  1HAR A;  1QUP A;  1YJV A;  4OJH A;  4TYB A;  4QJV A;  3C16 B;  1K44 A;  2IJR A;  1UVN A;  2MY8 A;  1E6Y A;  4A8W A;  3SSR A;  2OPS B;  4NI2 A;  1SUQ B;  1M5K C;  4TXS A;  2BUN A;  3AD7 C;  1RUS A;  3OR1 A;  2DTJ A;  1NAQ A;  1HBM A;  4DL3 A;  1N5Y B;  4DQS A;  1VJQ A;  2J0X A;  2K1R A;  1MWY A;  1PG5 B;  1F9H A;  4TY8 A;  2RNE A;  2KXF A;  1VBX A;  2LEA A;  5KFP A;  3EPG A;  4URQ U;  4TQR A;  8ATC B;  3PAC A;  1U0H B;  3PDN A;  4OHY A;  4PQU A;  1D9F A;  3K8W A;  1RT2 A;  3W63 A;  2H5E A;  3CCM S;  4DG1 A;  2BKO A;  2OJ3 A;  4CNZ A;  4PWU A;  5KG1 A;  5D0R A;  3G96 A;  3GIK A;  3BDE A;  2QLJ B;  5CYQ B;  2QRR A;  1L3S A;  1X5S A;  3EPI A;  4UOC A;  3M2V B;  4M5D B;  1O0P A;  2BJ1 A;  1SQE A;  5DGB A;  3V5R A;  2YX4 A;  2I2Y A;  1M1K T;  5KFC A;  1FT8 A;  4JI6 F;  4G1Q A;  1QLN A;  4EI2 A;  4X64 F;  1S1W B;  3GG1 A;  3D6F B;  2B5J B;  4KB7 A;  3ZC4 A;  2UV8 G;  3OR2 B;  4ECX A;  2HHP A;  4UQT A;  4CLT A;  1JJC B;  1HWI A;  3LP2 A;  3OL7 A;  1CG2 A;  1VQK S;  4NAS A;  2AKW B;  3KUE A;  2ZH6 A;  1YX2 A;  3TOQ A;  4F2R A;  2ZUG A;  4I6W A;  2RDJ A;  3TAR A;  4KIA A;  3CW2 C;  2HVZ A;  1W2B R;  5K8M A;  3BPS P;  2NXC A;  4H4K C;  3BPD A;  1R0A A;  3T1H J;  3I5B A;  3HSD A;  4O44 B;  5HK4 A;  3JQM A;  1H38 A;  4HYK A;  4AYB D;  2AP6 A;  4QZV B;  2YWK A;  3PNI A;  3NS5 A;  3AD8 C;  1B0T A;  1Y0H A;  2V68 A;  1SXL A;  3MUV P;  1ZH5 A;  4RW9 B;  3T1Y J;  1P9Q C;  2B51 A;  2HFU A;  3CJ8 A;  2UZA A;  2EG2 A;  4F26 A;  4URG A;  4NLW A;  5F8M A;  1FJE B;  3RBD A;  1UVJ A;  3BH7 B;  3M8Q A;  2YNG B;  3BYP A;  3JXO A;  4Q5V A;  1TMJ A;  1GMW D;  2FHJ A;  4K2J A;  3H4B A;  3OPK A;  4K4X A;  1RAD B;  1UW9 A;  4EYI B;  2QSW A;  1BY9 A;  4WFA Q;  4MJK A;  2QA1 A;  3DMJ B;  3CIZ A;  2MQP A;  2QGF B;  1N34 F;  2C3O A;  2JC0 A;  1YG0 A;  3ICL A;  4OYP A;  4TU9 A;  3H59 A;  2YKN B;  3ENQ A;  2E5J A;  4EZ9 A;  4IUF A;  2CRL A;  1VRT B;  4QQB A;  2CPX A;  1VFJ A;  4CM2 A;  2P9G A;  2XYP B;  2DR8 A;  1JLB A;  1KP6 A;  3QRQ A;  4HH0 A;  3CD7 A;  1HBO B;  2HNY B;  2QA4 S;  3I0R A;  1K1Q A;  2W9A A;  2DJW A;  4KFB A;  1YZ6 A;  3QT8 A;  2E1P A;  1X9S A;  4BDP A;  1KS2 A;  1WC3 A;  4I6Y A;  3FEZ A;  4ZVO B;  3DRY A;  1RAE B;  3BRE A;  4NLP A;  2IAJ B;  2BAB A;  5KG4 A;  4EBE A;  5F0W A;  4FYX B;  2BQR A;  4BWJ A;  4ZIT A;  1OS5 A;  3I0S B;  5E33 A;  4KGM A;  5J2P A;  1LV5 A;  1WDT A;  2DR7 A;  1NME B;  4U96 A;  1X0P A;  1RAB B;  2UXD F;  3KJV B;  3PX4 A;  2XHW A;  5KT6 A;  1N33 F;  1U2F A;  4JB8 B;  5ETQ A;  4EU0 A;  1FES A;  3L7P A;  1SL2 A;  4LF5 F;  5DLF A;  2OP5 A;  1RIS A;  3PG9 A;  4XDC A;  1OQ3 A;  3BB5 A;  2UXC J;  1QD1 A;  3PW7 A;  1FKO B;  4DS4 A;  1NK0 A;  4NMX A;  4DDF A;  1JK9 B;  3NOC A;  4FXD A;  2FD2 A;  4N77 A;  3CWJ A;  5KFT A;  2MJU A;  2MQL A;  3CDA A;  4JOU A;  2BBE A;  3G82 A;  2OSR A;  2R7U A;  1F9E B;  1Q4R A;  1AXQ A;  4KJI A;  4ZPT R;  2K2P A;  2J8S A;  3HSG A;  2E44 A;  4TQS A;  2KYZ A;  4OZ2 A;  2DB1 A;  4I2Q B;  2OFH X;  2G13 A;  3R7S B;  1YIJ S;  4I2P B;  3PX0 A;  5FLX Y;  4CO1 A;  2P2C B;  4N56 A;  1K47 A;  4KHR A;  3TRG A;  2ACM A;  3L09 A;  1ZAX A;  2Z2L A;  5EHH A;  2OHD A;  2BDP A;  2O01 C;  7FDR A;  3CJK B;  5A8K A;  3T9N A;  3NAH A;  4JI1 F;  2R7T A;  4C11 A;  4NA2 A;  4Y6I A;  1JB0 C;  2V2V A;  5H9E J;  1NDK A;  2LU1 A;  1WI6 A;  4NML A;  3AA8 A;  4KHP J;  5CAA A;  4UY8 T;  4NCG B;  2MKI A;  1CUL B;  2HZA A;  3ETO A;  3DLE A;  2JX2 A;  3HDS A;  4LF9 F;  1OPI A;  1HNI A;  5A8W B;  1FHT A;  3VTI A;  3TEG A;  2C3U A;  2DH9 A;  2NUU G;  5LT5 A;  3KK3 A;  2V4R A;  3PHT A;  3LA0 A;  3OTD A;  2LCW A;  4YY3 F;  2RD5 C;  3M9O B;  1DY3 A;  2OTJ S;  1V3R A;  4P2X A;  2QYG A;  5IS2 A;  1E6V B;  3GIL A;  2IY5 B;  1QY7 A;  3THV A;  4EEY A;  4DV4 F;  5DQH A;  3MMA A;  2RU3 A;  4RX6 A;  3C6U B;  1NDP A;  3Q23 A;  3U27 A;  1HNW J;  5DDR C;  3TX8 A;  3CE8 A;  4HT7 A;  4QWE A;  2WVD A;  1RLC L;  5KFD A;  5L46 A;  4PAB A;  2DGQ A;  2DIV A;  1Q7Y T;  4OZ1 A;  3SDE B;  4BC9 A;  3MDF A;  1ZTW A;  2M8H A;  5D8H B;  2JC1 A;  2FJE B;  1U1R A;  3P6Y C;  2PN6 A;  3KG1 A;  2FVP A;  1KQF B;  4UZC A;  4W92 B;  1RHQ B;  1NDL A;  5ETS A;  4DV1 J;  1UVM A;  3LO3 A;  2B9E A;  5D4P A;  2VFS A;  3HUL A;  1PYS B;  3ITH A;  4L6V 3;  1Z4U A;  2A2C A;  4P6Q A;  1NJX A;  4ZLP A;  5F8I A;  1E6Y B;  5LSO A;  2J5A A;  1X4B A;  4TU8 A;  1K0V A;  3FSX A;  1CS4 A;  4NI2 B;  2BJ7 A;  3MTJ A;  3G71 S;  5MAO A;  4AT1 B;  3A13 A;  1J5E F;  1URR A;  1EJ7 L;  4NLU A;  3CUN A;  2DO0 A;  1N52 B;  2CA9 A;  1HBM B;  2CPI A;  2AEF A;  3A3N B;  1R8A A;  3J7Z T;  4OYA A;  3TJA A;  2K1R B;  1VLO A;  3RBZ A;  1R0B G;  4TY8 B;  4QBU A;  3MM7 B;  3Q8R B;  2QLB B;  3W1Y C;  1IQT A;  4LUB A;  1Q8B A;  2YTC A;  1IJE B;  2Y9H A;  1NSK L;  4PQU B;  2V2Q A;  2UXB J;  3K7R A;  2Q6C A;  1VQL S;  3BQ2 A;  4WFY A;  2DGS A;  4J7C A;  1GH8 A;  4DG1 B;  4RPF A;  3TQ1 A;  1S6P A;  4OMF G;  2HFO A;  4LFB J;  3I9V 9;  2AGO A;  5G4D A;  4QR0 A;  2CIM A;  4HHH A;  1DFD A;  1U1L A;  3I96 A;  4AD6 A;  3J7A N;  3NGK A;  4LBI A;  3F73 A;  2VFT A;  4M5H A;  2GIQ A;  3KG4 A;  2OH2 A;  3CCV S;  2NXE A;  4G1Q B;  3KK1 A;  2MJN A;  2VPZ B;  2EWH A;  1VLY A;  3MZI A;  1FRK A;  2H9Z A;  2EFO A;  5L8R C;  2BZ2 A;  2CNK B;  2I5J A;  2WSC C;  1GT8 A;  2COL A;  2Y1R I;  3NWR A;  3LP2 B;  4F36 A;  4DUZ J;  1F5C A;  4O0N A;  2A3J A;  1RT3 A;  3MAH A;  1NK5 A;  1IBL F;  2CJA A;  2GFF A;  5KAK A;  1XEZ A;  2OFG X;  1OY8 A;  1R0A B;  4QIF A;  4NXN F;  2BW7 A;  3KLF A;  4RR5 A;  3SQO P;  4C9D A;  1I94 J;  2PEB A;  3IR6 B;  3BSO A;  3BKF A;  1LK5 A;  2MPU A;  3AFG A;  1NHK L;  3LWL A;  4MAK A;  3QZ8 A;  1P6T A;  1FRX A;  4FS2 A;  2CPD A;  2DHS A;  1GTH A;  1NB2 A;  4QIE A;  4PG5 A;  3IBC B;  5LOQ A;  2VF3 A;  4KQZ A;  3CPW R;  3UD3 P;  3NOG A;  2F5G A;  4LSL A;  3M8Q B;  3O1L A;  4LR9 A;  5LSL A;  3L7U A;  4Q8F A;  2VUG A;  1VQ4 S;  2B43 A;  3MEE B;  1HL6 A;  3VGT A;  5E3C A;  4JI8 J;  1RQ0 A;  4F4K A;  3IFE A;  4LRA A;  4DV0 F;  3BO3 A;  1HHS A;  3V4M A;  2HKE A;  3N9U C;  1U25 A;  4OIX A;  2ILY A;  4AL6 A;  2JVR A;  1Q81 T;  4DSL A;  2KT5 A;  3OJS A;  5AXM A;  4ED8 A;  2X1B A;  3T5H A;  1D9A A;  2WSF C;  3JQK A;  5IFM A;  2GNK A;  1NU4 A;  5EX3 A;  3HT0 A;  4HVZ A;  1SVD A;  4X4Q A;  2YKO A;  1M5H A;  2HWT A;  3GIM A;  2MKC A;  4KFB B;  3HZE A;  4I64 A;  3BO2 A;  2CQI A;  4B9U A;  3MXH P;  4EBD A;  2IC3 B;  1R8P A;  2OUG A;  5KG5 A;  4PRF A;  1P27 B;  5SUH A;  1VIX A;  3TAN A;  2V8V A;  2E1C A;  4QIV A;  2HRT A;  4PXD A;  4I6A A;  2CNO B;  2BJE A;  3JB9 k;  5J2P B;  3DLK A;  3RJM B;  4RU9 A;  3C6T A;  4AXJ A;  4ATN A;  1X4H A;  5KFM A;  4ZJO A;  2FDN A;  2POK A;  3I87 A;  2MHE A;  4R8U A;  2VV5 A;  2XY5 A;  3K58 A;  2DY9 A;  5CYM A;  4B08 A;  1AFI A;  4KV8 A;  2HIY A;  3SXL A;  1S76 D;  4X65 F;  4KPY A;  1U09 A;  5L39 A;  4FKX A;  3GSI A;  3BSC A;  3ISZ A;  3ILI A;  4B9T A;  3I31 A;  5KFN A;  4YHH J;  1RU2 A;  3RB3 A;  1UEU A;  1BE4 A;  2FVQ A;  2C2R A;  3J7Y I;  2EC0 A;  1T9U A;  3MPY A;  3OUY A;  2DXE A;  1LWF A;  1K8A T;  3TVZ A;  2C1E B;  4EGL A;  3G8S A;  4PWW A;  2IVF B;  1CPZ A;  3G82 B;  1XR5 A;  2KI2 A;  3GYG A;  2WB4 A;  3W61 A;  5F0U A;  1RJJ A;  3IMQ J;  4L3N A;  2E1R A;  1FKP A;  3CGI A;  4ZN3 A;  1WEY A;  1W2I A;  2P8I A;  2RJZ A;  1PJ6 A;  3WX8 A;  2W25 A;  4CDI A;  3TQE A;  1AT1 B;  1BQN A;  2KVI A;  4RNN A;  5L1K A;  2LVW A;  1H2U X;  2J6T A;  4CCH A;  2L08 A;  4A8Q A;  1U2R A;  1Q5V A;  4MIW A;  2D69 A;  4JI0 J;  1RAG B;  2AV5 A;  5CD4 H;  1XQI A;  3IAS 9;  2XZD B;  2GS8 A;  4E8U A;  4C11 B;  3CCE S;  2MZR A;  2QX0 A;  2J0S D;  1SH2 A;  4DLE A;  3R1L A;  5E3R A;  3A4T A;  2DRB A;  2IHR 1;  3AXM A;  3GV5 B;  4M94 A;  4HI2 A;  2XO7 A;  1GK8 A;  4PYA A;  3W8P A;  4KO0 A;  2UV8 A;  3NGS A;  2V5H G;  4ZP9 A;  3NCP A;  1OPZ A;  2BRK A;  2ZHO A;  1RSC A;  3R5J B;  2XS5 A;  2M7S A;  1Y11 A;  1XC9 A;  3A3P B;  3FFI A;  4ED4 A;  2LEC A;  1HNI B;  1X60 A;  4CT8 A;  1KON A;  3D6H B;  5JMN A;  2W01 A;  3FZ2 A;  3QAU A;  3PW4 A;  4OX7 A;  4ID8 A;  1LEO A;  1XN9 A;  3PY8 A;  1H6K X;  1U7L A;  2FY1 A;  2VH7 A;  1HWJ A;  2BAC A;  4IDK A;  3GSD A;  4FBT A;  2KN4 A;  2CDR B;  2IM3 A;  3HX9 A;  4PG7 A;  3UD5 A;  2A10 A;  4AL5 A;  2WON A;  2VOO A;  2AJF E;  2HND B;  4JV2 A;  1FJG F;  3W65 A;  3MMA B;  4F4Z A;  1R8B A;  2CQG A;  2WCX A;  2YNF A;  1KVK A;  4G65 A;  1N32 F;  1GTE A;  1H0H B;  4DFK A;  5BR8 F;  3DLJ A;  3DOM B;  5KTQ A;  1JLE A;  3EWG A;  4WYL A;  2B9Y A;  5J2Q B;  4MIA A;  5KOW A;  4ZKA A;  3CO0 P;  3RZA A;  3Q24 A;  5CA5 A;  1RA7 A;  5EWF A;  5CCM A;  2DNP A;  5ETR A;  1WSV A;  5ETL A;  2A6M A;  4NLY A;  3T5J A;  4F3O A;  3OLB A;  3KDN A;  1I1G A;  4WU3 A;  2R9L A;  3FCV A;  1S4E A;  3N5F A;  5C5J A;  2HW3 A;  3KUH A;  4A8F A;  4ZJL A;  3KWM A;  1NPK A;  2FQQ B;  2RQ4 A;  3GJQ B;  2KU7 A;  5D0E A;  1PC4 A;  2DNM A;  2AU0 A;  2QFI A;  5GMD A;  2N7C A;  4OYW A;  2Z8Q A;  3KLG A;  2RF2 A;  4DCJ B;  2F40 A;  3T9Z A;  5D6G A;  4XAK A;  3BV8 A;  4DL4 A;  2JEF A;  2YKA A;  1UFL A;  1IUJ A;  2BE2 B;  5IM0 B;  4JI6 J;  5JJB A;  1IR0 A;  4L73 A;  2AJ4 A;  1ELO A;  3IO1 A;  1HQE B;  4X62 F;  1FWP A;  4GO5 X;  1FER A;  4TNO A;  1QJH A;  4F4W A;  2M5Y A;  2LQ5 A;  4NE9 C;  1FJC A;  2B4U A;  4M1K A;  2A1B A;  4LF2 A;  2BVZ A;  2FZK B;  4DL2 A;  3UCZ P;  1Q16 B;  1VQ8 S;  1VBY A;  2HS4 A;  1S6P B;  1UA1 A;  3LAK A;  1KWM A;  5E5N A;  1YGY A;  2EKY A;  2AX0 A;  4HTI A;  1CSJ A;  4B9V A;  2DIS A;  1CJK A;  4DX8 H;  4RWX A;  1NCL A;  4FNI A;  4YS2 A;  4W90 B;  1M1H A;  3KK1 B;  3GQC A;  3ZZY A;  3H5S A;  2EBE A;  3TYT A;  2HFV A;  5B0E A;  3C14 A;  2I5J B;  5IZH A;  3KLH A;  3EJM A;  1TMM A;  4LFA J;  3NY0 A;  1RT3 B;  4ZCK A;  3P5B P;  1S0N A;  4MYU A;  2HBY B;  2V2Z A;  2I8E A;  2VFR A;  2GIF A;  3EGN A;  1OJ4 A;  4F7V A;  3OTB A;  3KLF B;  1N34 J;  3CDW A;  4DV5 F;  3N4W A;  2YX7 A;  3CDB A;  4MK8 A;  3H2V E;  3KMQ A;  3OD2 A;  4JI5 J;  2FGC A;  2HGM A;  4ZP8 A;  5K9F A;  3KJQ B;  2AJQ A;  3VAF A;  4DS5 A;  5G0R B;  2CVI A;  1O8B A;  5A2Q U;  2XLK A;  2MZT A;  2QE5 A;  1IBK F;  5JUM A;  2CQ0 A;  1T9V A;  2Y8Y A;  2NZ4 A;  2CDQ A;  2Y0B B;  2CQ4 A;  1PCA A;  5D78 A;  5KG0 A;  1NBE B;  2IBK A;  3QAT A;  1Q8K A;  3CCU S;  5IWA J;  2CPE A;  1CEZ A;  4K4U A;  4RNM A;  5H9E K;  2ASY A;  2O5D A;  2YNI A;  2EEY A;  4Z7Y A;  4GKJ F;  2UXD J;  4W4M A;  3N6N A;  1N33 J;  1C2P A;  3VQT A;  3A8I A;  1NLK L;  4FYV B;  2FVR A;  5E3A A;  4TLQ A;  4FP9 A;  1AUD A;  2EK6 A;  3CJ5 A;  3M8P A;  2GO9 A;  3DKD A;  2JFD A;  1WC5 A;  3PYE A;  4H54 A;  3KNG A;  1HMV B;  1BXN A;  2E9Z A;  2GGP A;  3CD0 A;  3NGT A;  3CD6 S;  1DTT B;  1TL1 A;  4L72 B;  2RQC A;  5A8R A;  1B0P A;  3M6X A;  3UN3 A;  1ZOT A;  2KHC A;  3OTO F;  3FBF A;  3CXC R;  1S0M A;  4UQG A;  1YBT A;  1ZM9 A;  2IM1 A;  1VGY A;  4AFF A;  4QIG A;  3DLK B;  3BQ0 A;  3C6T B;  4OV1 A;  1AA1 B;  5M2R A;  5KFO A;  4DXL A;  2HHQ A;  1GMW A;  4DFJ A;  2B9W A;  2F8H A;  4LF4 F;  2IA6 A;  5GMK a;  1CC8 A;  4R8U B;  2K8G A;  2HLU A;  5CYM B;  2CQC A;  2MLX A;  4KV8 B;  1TAU A;  2R7W A;  3AHP A;  3QFW A;  1N56 A;  3ETM A;  4KKO B;  2BJ8 A;  1D1U A;  3M8W A;  1Y7P A;  3D3C J;  5DS7 A;  4B9L A;  2LQB A;  4ICL A;  5FDL B;  4DU7 A;  2RDI A;  4JI1 J;  3LP1 B;  2V4J A;  2GJF A;  1L3K A;  5B0B A;  1WG1 A;  3R5G A;  1KFS A;  2CQD A;  3LH2 S;  2ZKT A;  1WC1 A;  2FVC A;  4UT4 A;  1V5I B;  3W62 A;  4LF9 J;  1RZM A;  4FPI A;  3HHL C;  2BOP A;  1RT1 A;  2Y0S D;  4DJB A;  1BQN B;  2QMU B;  2DNL A;  2PE8 A;  4TU7 A;  1XBW A;  1KKH A;  1VK8 A;  1SKU B;  3M8Z A;  4YY3 J;  2LDI A;  4KPC A;  5CZV A;  3NG8 A;  4X4T A;  1VOM A;  4LRF A;  2PFF B;  4DR2 J;  4P72 A;  3GJR B;  4WTY A;  1OYE A;  4DV4 J;  4P2M A;  4Y34 A;  4LQ9 A;  5AJ3 F;  3N79 A;  3BBB A;  4IH5 A;  2HRU A;  1QDU B;  2AX1 A;  4FVC A;  4Y2M A;  4F0H A;  4KO0 B;  1MWQ A;  1R89 A;  2LMI A;  3SMZ A;  2C3P A;  2VG7 B;  4EMD A;  3RG6 A;  5HQ8 A;  5M2P A;  2CJ9 A;  2H51 B;  4DFM A;  2W9B A;  3QBC A;  3GFZ A;  1UPM B;  1WTF A;  1R31 A;  4Q7A A;  1MRO B;  1BHN A;  3F41 A;  4RUB A;  3TAP A;  3VVU A;  2ERR A;  3EVW A;  4ZVH A;  4C4W A;  3W9J A;  4PWD B;  1G4C A;  3DI6 B;  4IDK B;  1TL5 A;  4ELU A;  3OL8 A;  3P96 A;  3CCS S;  3BEG B;  2R8J A;  4A46 A;  1XWL A;  4KSE B;  1LWE B;  2R8K A;  5GAH U;  4USM A;  4AE5 A;  1DQA A;  2ZUA A;  2I0X A;  3QAE A;  2YNF B;  3NP5 A;  3TUI C;  3GCW P;  3MWB A;  4J9O A;  4CO5 A;  1M90 T;  1SQG A;  2EC2 A;  4B02 A;  3UDE A;  1R8C A;  4M5G A;  1VQ9 S;  4F8R A;  2DIT A;  4ZMM A;  3TZW A;  5H9F J;  4XPC A;  3ZZZ A;  3R2D J;  4LR7 A;  1J5E J;  3LGH A;  3GV7 B;  2XI2 A;  2D41 A;  1U24 A;  3IG1 B;  2UUB F;  2GJ2 A;  3NXZ A;  4DUY J;  2GC8 A;  4RBV A;  3VQS A;  2WRM A;  3GIR A;  2F4V F;  2M4M A;  2VQF J;  1QE1 A;  1SBR A;  1QTN B;  1TVR B;  2PEH A;  2CQB A;  1WEX A;  2OO4 A;  3X3U A;  4LIW A;  1JJH A;  4FNH A;  4MKY A;  5HMY A;  2NSB A;  3AOC A;  2Z4P A;  1UZH A;  3KLG B;  1S9E B;  3EXY A;  4NRT A;  2UVV A;  1R27 B;  1T03 A;  3R9L A;  3M4X A;  3PM9 A;  1C4A A;  3DN9 A;  1S1T A;  2RDD A;  3T1Y F;  3HSZ A;  3SQG A;  2HBZ B;  3MPW A;  5FLX U;  2E5L F;  1PAE X;  2OPQ A;  2U2F A;  3CSK A;  5JVH Q;  4MK7 A;  1N4L A;  4ED0 A;  4JYA F;  5KFY A;  4IRD A;  1UWA A;  2D74 B;  2XNQ A;  2HBR B;  1V9O A;  2APO A;  4ZVQ B;  1RT4 A;  3M7V A;  3ZTR A;  4CO2 A;  3HKW A;  3NGR A;  2PMZ D;  3GJS B;  4UTG A;  5AE3 A;  1IBL J;  4HLB A;  3SFG A;  2FZC B;  4BWM A;  2VPX B;  2ZOG A;  1S12 A;  1VHI A;  2O1P A;  1WOP A;  1JXV A;  5ETT A;  2L9D A;  1FKA F;  3GYX B;  4NXN J;  1JLF A;  1RHU B;  3AOB A;  3I55 S;  4N41 A;  2NXJ A;  3MPU B;  2QLF B;  1HI0 P;  5LMU F;  2JH3 A;  3PYG A;  2LYV A;  4CO3 A;  1CJK B;  3GYN A;  3TUP A;  5LJ5 Y;  3M05 A;  4FN5 A;  4NRU A;  2ZZM A;  3QT7 A;  5T7L A;  2UU9 F;  1MU2 B;  3BZQ A;  3Q83 A;  1ZAW A;  4ELT A;  3LF0 A;  2N82 B;  1EQ0 A;  2ZKU A;  4LJM A;  3KLH B;  5FII A;  4IG3 A;  2Y8W A;  4V19 X;  4WXW A;  3GB0 A;  5SZT A;  4F4A A;  2ASD A;  4C2M A;  4ECU A;  4FF2 A;  1N5S A;  2QYC A;  1JLC B;  3HVT B;  2YBV A;  3X1L B;  5F3Z A;  2Y1I A;  5IOL A;  2Z2Y B;  1QAX A;  1HNV A;  4XDD A;  2MZS A;  3DRS A;  4HHJ A;  2FTR A;  2KYX A;  4DV0 J;  1OYD A;  4OZJ A;  4OI1 A;  1L3V A;  2I38 A;  4ZDN A;  2UUA J;  4DV3 F;  4Q43 A;  3CO9 A;  1CJV A;  2MST A;  4ES3 A;  3H0P A;  4ECS A;  3EE3 A;  4B3T F;  4ED7 A;  1QSS A;  2R3V A;  2HEK A;  4O4R A;  1OY9 A;  3R5B A;  4DX5 A;  4WFN Q;  4OV6 A;  3OT9 A;  1NKE A;  3OFG A;  2NCK L;  1WNE A;  3MED A;  1IR2 A;  4Z7C A;  3I5C A;  4FYW B;  2PMH A;  1N0U A;  3CD5 A;  4UUW A;  4NX9 A;  1OWX A;  2YNI B;  2ZC3 A;  1S97 A;  3W66 A;  2W7O A;  5B0A A;  5RUB A;  3CMQ A;  2GHW A;  5EWG A;  1VCT A;  3F0N A;  2CJK A;  2OPP B;  3ZZO A;  2CPH A;  2GVD A;  1HI8 A;  3TUJ C;  2VB6 A;  4NLD A;  2VHG A;  2Z30 B;  2R2T A;  1HWU A;  3J7A 1;  3DHX A;  4Q44 A;  2Q3P A;  4MH8 A;  3MM8 A;  4NCA A;  1EKR A;  3K0J A;  2GGP B;  3G6E S;  3G86 A;  2NR0 A;  3K5L A;  4ID5 A;  3CCJ S;  2A2D A;  3ONQ A;  1GXL A;  1WAC A;  2NLW A;  3WQP A;  3C19 A;  2C3M A;  2Q1L A;  1F1B B;  1C0U A;  1AW0 A;  1U48 A;  3BH6 B;  4EO8 A;  2NUH A;  5I3Q A;  4DZ6 A;  3GFX A;  4F0K A;  2GW8 A;  1RAO A;  1CLF A;  4WF9 Q;  4C8L A;  2ATC B;  4KH0 B;  2KVQ E;  2X3D A;  4IFV A;  4DQR A;  4YR0 A;  3UPF A;  3ZZR A;  2RQM A;  2E9R X;  1JX4 A;  1CVJ A;  2G0I A;  3W3S A;  2F9J A;  1REV A;  4UST A;  4YEA A;  5I3U A;  3K8V A;  4W98 A;  4MKV A;  5KFF A;  5HAO A;  3KHR A;  4F4X A;  3C16 A;  4WKR A;  2V4J B;  3FCW A;  3U02 A;  4G1P A;  4QPX A;  1BQM A;  1Q79 A;  4LR8 A;  1U2C A;  4USI A;  2QEX S;  1WTB A;  2EFP A;  4LT6 A;  1HYS B;  1BMQ B;  5A6P A;  2CQP A;  4DOZ A;  5GAD U;  2Y3Y A;  2HQI A;  1IN0 A;  2AT1 B;  1AFJ A;  1R8H A;  1RT1 B;  4DU8 A;  1YSJ A;  2ZH2 A;  3KHH A;  3IR7 B;  2UP1 A;  2V69 A;  1B3T A;  2ZDP A;  2ZJQ Q;  3RRK A;  2XZT B;  1LFW A;  3KG0 A;  1EZZ B;  3CC4 S;  3B4D A;  3GCX P;  2IRY A;  2F7V A;  1FJG J;  2DNY A;  1G1X A;  8RUC A;  4NLS A;  2PI5 A;  3PR5 B;  5EN1 A;  1SIZ A;  3O44 A;  1N32 J;  5EGY A;  5BR8 J;  3CC7 S;  1NK7 A;  3N6L A;  2FHO B;  4QU7 A;  4P75 A;  1G2E A;  1D09 B;  2W9B B;  2BQU A;  1KSP A;  4GMK A;  4ZJQ A;  3HI9 A;  3UW1 A;  4WU2 A;  1RTJ B;  2NYI A;  4CO0 A;  3MEG B;  1X4C A;  2EXU A;  4N7T A;  3P3D A;  2FGO A;  4J9N A;  3FQL A;  4C8M A;  4ZCI A;  2V0N A;  2HZV A;  4U8V A;  3PHE A;  1SJQ A;  1M1G A;  4Y65 A;  3K5O A;  4AQY F;  2K7J A;  4IOA Q;  5J1E A;  1SJR A;  3PEH A;  4O44 A;  3CMA S;  2R8I A;  1JJ2 R;  2HNZ A;  4Q2M A;  4QWA A;  1HR0 F;  2DGX A;  2VOP A;  4P2S A;  3EVO A;  5DM6 Q;  1FDA A;  4HTJ A;  4P10 A;  3IM9 A;  1U6F A;  3DU5 A;  3UDC A;  2A6O A;  4C0H A;  4A47 A;  2MY7 A;  4DUZ F;  3H4D A;  1S7H A;  3HHL D;  2YNG A;  5GAD I;  4EO6 A;  4X62 J;  1FA0 A;  1ZBT A;  4Y28 C;  2XMJ A;  4L3K A;  4BLG A;  5ETP A;  3H25 A;  1QE1 B;  4WFX A;  1TUG B;  3OFH A;  1UCN A;  2XYH B;  3DC2 A;  2DKO B;  5KG3 A;  4NEZ A;  2RRN A;  1EX8 A;  2V8P A;  1VRT A;  3SI8 A;  1XMO F;  2JEI A;  1S1T B;  5MLC V;  2MKH A;  3W5Y A;  4PG8 A;  1YKW A;  1YRT A;  2OKQ A;  4L76 A;  1HBO A;  3QNW B;  3N6M A;  3R8Y A;  2OPQ B;  4C8K A;  1FNX H;  1JJ4 A;  2DGU A;  3ELH A;  4J9P A;  4Y2A A;  2HPU A;  2IBO A;  5CCL A;  2EKN A;  4U6P A;  2M2B A;  2IAJ A;  3DYA B;  4OFZ A;  1RT4 B;  1Q5Y A;  3JTP A;  3UN5 A;  2KM8 B;  4ECZ A;  1IM4 A;  3SCL E;  3OTE A;  5FD1 A;  3A8E A;  4NOH A;  4DI6 A;  4PR6 A;  3TNV A;  4UOH A;  2QL5 B;  4EBC A;  3FMW A;  2PII A;  2MKK A;  3KJV A;  4K7Q A;  3JSM B;  1FTR A;  3C2P A;  1Q8L A;  3M6V A;  2HQ3 A;  1TUV A;  4YP3 A;  2V8H A;  2MQO A;  4PPD A;  3MUT P;  1F9F A;  3PFO A;  5HQM A;  3H42 A;  7FD1 A;  5EWE A;  1FKO A;  1KQK A;  4ITS A;  1N0V C;  1RAJ A;  1Z1Z A;  2DHG A;  1CQN A;  1N48 A;  2CPZ A;  1BWV A;  4L74 A;  5HRO A;  4Y2K A;  4IG3 B;  3VAG A;  2RVJ A;  2EFQ A;  4TLR A;  3CJR A;  3PRD A;  4ILR A;  4X4P A;  4DR5 F;  1ZPW X;  2QG9 B;  2RH3 A;  3MR5 A;  1ZA2 B;  4I2P A;  3SFU A;  1HNV B;  2MYF A;  5ADZ A;  1RT5 A;  3W60 A;  2FJV A;  3VAH A;  3DRS B;  1QSY A;  3MPD A;  5LMN F;  4PYD A;  3UN2 A;  2KTQ A;  4GKJ J;  4IRC A;  2ZJP Q;  4USU A;  1W25 A;  3CJK A;  3TX0 A;  4J9R A;  1CJV B;  1FDD A;  4ETX A;  3PX6 A;  1HBU A;  3LTO A;  5A76 A;  1BUX A;  1UL3 A;  3QYY A;  2RS8 A;  5AXN A;  2CNL B;  2MDA A;  1RTH B;  3GR1 A;  1CUL A;  3NEK A;  1VBK A;  1FK9 B;  3CJ0 A;  2QFJ A;  3GLJ A;  4O3O A;  2Z56 B;  4IOB A;  1XR6 A;  5DRK A;  1S7I A;  3MED B;  1ZZF A;  5A8W A;  3JSY A;  3QRR A;  2M0G B;  4N5S A;  2W4D A;  4X4O A;  4OLO A;  5E3Q A;  3KOA A;  4WFB Q;  2I6W A;  3N0V A;  5LJ3 Y;  2XCP A;  2WW8 A;  3GZ7 A;  2JVO A;  2BW2 A;  1LWX A;  2XY7 A;  2IJF A;  5L38 A;  4BCA A;  2OGU A;  1AYE A;  3ENA A;  4KTQ A;  2RRA A;  1U6B A;  4JI0 F;  4LF4 J;  1FNM A;  2GVD B;  3PJ9 A;  1X4D A;  2DNH A;  1RDR A;  4C97 A;  1YJU A;  2XHC A;  2CKW A;  3TAQ A;  4DN9 A;  3C6U A;  1K9M T;  2FJD B;  1VRU A;  3CCZ A;  1W26 A;  4I4B A;  4ZP7 A;  2HAI A;  3R5C A;  1NK9 A;  3VGS A;  3VAL A;  5BJR A;  1DHM A;  3TA0 A;  4WJB A;  1S0O A;  2ZH8 A;  5DZ6 A;  4LBP A;  5L1J A;  5I3P A;  1C0U B;  2VKR A;  5E41 A;  3LP0 B;  3SV4 A;  2MZ1 A;  3SDE A;  3G6X A;  1KQG B;  4OYI A;  4WYW A;  1EAY C;  4Y0F A;  3NNA A;  3QMQ A;  4J9U E;  2K3K A;  5H9F K;  4IFV B;  1KTQ A;  2C2N A;  2RSQ A;  1GMU A;  1Z2Z A;  2MQ8 A;  2F65 A;  4IR9 A;  2GO8 A;  1UP1 A;  1VQS A;  1REV B;  3E8O A;  1NSA A;  5DM7 Q;  5F8N A;  1YJ9 S;  4C3L A;  4MKA A;  2W2N P;  5AJ3 J;  3AA9 A;  1BQM B;  5E2Q A;  3Q8Y A;  2AEM A;  2IJN A;  4NA3 A;  2NQP A;  2J0W A;  1UJ6 A;  1TL7 B;  3OVS A;  3WHI A;  3KJF B;  2LQJ A;  5HVH A;  3MUM P;  1ZPV A;  3MM7 A;  2RU9 A;  5CAB A;  5AE2 A;  4E2F B;  2XEX A;  2PD1 A;  5KFE A;  5KFV A;  2LFV A;  4RW6 B;  2GAH C;  2KJW A;  3HHE A;  2YWG A;  3TW0 A;  2FYX A;  4J9S A;  3CJ2 A;  2DGO A;  5KFK A;  4J9K A;  3AY0 A;  2G0J A;  2SXL A;  3IP0 A;  4DPO A;  1RAF B;  4NYO A;  3QT6 A;  2DR9 A;  4LMZ A;  1W7W A;  2FJX A;  3E01 A;  4ED2 A;  2W7A A;  4WWS A;  4RO0 A;  1FXL A;  3U1L A;  1GNK A;  4IQM A;  4ZS6 A;  4KYZ A;  1TR0 A;  4QR2 A;  2HVD A;  1FWK A;  1HHQ A;  4X66 J;  7AT1 B;  3ZZU A;  1T9W A;  3FCH A;  4PUO B;  1SB6 A;  4DR7 F;  1AB8 A;  3QO9 B;  2QLX A;  4RW8 B;  4UUX A;  4RUH A;  2Q66 A;  4OZ0 A;  3UFC X;  4C8O A;  2UUB J;  1H98 A;  4DSK A;  1FNO A;  3MAQ A;  1RYR A;  2F4V J;  3O6Q A;  1XNQ J;  4G3I A;  3UDL A;  2F4F A;  1K0T A;  3D0I E;  4F25 A;  2VFV A;  3LOU A;  3UDV A;  4QYZ J;  5J1E B;  1PJ7 A;  1YLX A;  1PYT A;  4FPR A;  1FRH A;  4U95 A;  2CWX A;  2HNZ B;  4LSN B;  2BM0 A;  2BM1 A;  3H2L A;  2W2O P;  4BHQ A;  5DZ7 A;  3I6P A;  2WOM A;  1KLN A;  4DL7 A;  1PO6 A;  1FVQ A;  2MLY A;  3B8H A;  3K57 A;  2RB7 A;  2V9W A;  1F6T A;  4GKK F;  2XLJ A;  4C3K A;  1SCJ B;  3G4S S;  5A0Y A;  1B64 A;  3H7H B;  4ZVT B;  3RR8 A;  3H40 A;  4O3S A;  2R7Q A;  4V1A k;  2FB0 A;  2E5L J;  3EZO A;  4J90 A;  4HAC B;  4LFA F;  3RAQ A;  3FGV A;  4M8L A;  2HBQ B;  3DRP A;  4RBU A;  3J80 Y;  2PA8 D;  4JYA J;  5C42 B;  1LFP A;  5ETV A;  2UUC J;  2FLL A;  3KTQ A;  3MEE A;  2FLN A;  9RUB A;  5GAG U;  2B3T B;  1J2V A;  4I67 A;  5DET A;  3SYZ A;  2F1F A;  2JOQ A;  1WUU A;  2XM3 A;  4LF1 A;  4JI5 F;  2KT3 A;  2VZ9 A;  1VK3 A;  3DXS X;  4LQ3 A;  2R7V A;  4KC5 A;  3VAK A;  1UMJ A;  2ZNY A;  4ZIW A;  2HHS A;  4ALZ A;  2H5I B;  3OHB A;  3W2W A;  1NJY A;  3OLA A;  1SC4 B;  1CQM A;  1WHV A;  3HP6 A;  1WWH A;  1REG X;  1RE1 B;  4I56 A;  5LMU J;  4HI1 A;  2YWW A;  3PW5 A;  3H8Y A;  3GII A;  4FYY B;  1F60 B;  3MMB A;  3QIP A;  5KFQ A;  2L3M A;  2UU9 J;  1UWB B;  4O23 A;  2IC3 A;  4WP8 A;  1ZTT A;  2KG1 A;  3W9H A;  3WIV A;  3RRH A;  5C24 B;  1HQU A;  2R42 A;  5IWA F;  2P9C A;  2HMI A;  4AXI A;  5HAN A;  3FK4 A;  4USJ C;  1TUW A;  3D1O A;  2WBR A;  4ED1 A;  4DR3 F;  1T9Y A;  2YWE A;  3PFE A;  4PG6 A;  1G3O A;  1JKH B;  3EDQ B;  2IRU A;  4HEA 9;  2OLW A;  1TQL A;  4QIW D;  1AZS B;  2ROE A;  4YB6 A;  3S6E A;  4HT5 A;  2DNO A;  1RHR B;  1A9N B;  3CJQ A;  1I51 B;  1WC0 A;  2ZVI A;  2ZBQ A;  1IXK A;  4ZVS B;  4TKT A;  4O3N A;  4DV2 F;  3T19 A;  1SH0 A;  5J1N A;  4LRB A;  4P7V A;  5GAE U;  4A8Y A;  2PMW A;  2H1Y A;  3FSI A;  4DV3 J;  3DGV A;  5F41 A;  2N3L A;  2UUT A;  5HP1 B;  2X51 A;  3PIO Q;  3CF5 Q;  1C1C A;  4EWT A;  3V6D A;  4J5O A;  3C46 A;  3NL0 A;  3RAM A;  3AJD A;  3MCO A;  4B3T J;  2K7K A;  5HRO B;  4TY9 A;  1RWN B;  3V2U C;  2V9K A;  5F8G A;  3PKY A;  1XNR F;  5GAG I;  1S79 A;  3V4I A;  5F3T A;  3R97 A;  4V19 J;  1IKW A;  4P9S A;  4DL0 C;  1S59 A;  1DAR A;  2Z2Z A;  1KQS R;  1RT5 B;  4B3O A;  3HT3 A;  3BR9 A;  2DRD A;  1YJW S;  4FYD A;  4ES1 A;  4LF8 J;  1U0S A;  2AJ2 A;  4K4T A;  4ED6 A;  2VJV A;  1YJT A;  3WBZ A;  4ZK7 M;  3LGN A;  5BYQ A;  2U1A A;  1HKA A;  2QL7 B;  2J9C A;  2RIJ A;  3ZXW A;  3IR5 B;  1NKC A;  3MAA A;  2WVE A;  1HBU B;  3S1T A;  2ZD1 A;  4HR2 A;  1VC5 A;  3QGG A;  1I3O B;  2AZ1 A;  3MOZ A;  1SPB P;  3KLI A;  4FDF A;  2XGP A;  4IR1 A;  4PXB A;  3G6V A;  1RU1 A;  5HMZ A;  2HFS A;  4GVB A;  4ZHR B;  2HUR A;  4BBY A;  5KFI A;  2J9D E;  5LXR A;  1LW0 A;  1FX2 A;  2YQ1 A;  2Y1J A;  2HFZ A;  1OY6 A;  2FLO A;  3MM6 B;  3EDR B;  1SC1 B;  2C2M B;  3U1M A;  4OZ3 A;  4O3P A;  4DR2 F;  5H1S V;  1N6Q A;  4IFY A;  2HND A;  3SV3 A;  1KRP A;  2DNR A;  1QVF R;  3TA1 A;  3M32 A;  2C2K B;  2GHV C;  5GAE I;  5KFA A;  2W4P A;  4FXV A;  1VRU B;  3PR4 A;  3DOM A;  3IWL A;  1X9W A;  1DLO A;  2Z0G A;  4M5L A;  1KLM A;  1GMV A;  3IWN C;  1JNR B;  5J2Q A;  1CJU A;  3I4H X;  2CXE A;  2K06 A;  3AH6 A;  2E7W A;  4ZPV R;  1U1N A;  4OYO A;  2Q6B A;  3F44 A;  2ZZN A;  1NZA A;  3H5Y A;  5HVF A;  1YJN S;  4ED5 A;  4CLY A;  1FTC A;  1NHU A;  5E3P A;  1WJ9 A;  2KRB A;  3KHL A;  3VF0 B;  2AGP A;  4GVL A;  4EK2 A;  4WP3 A;  2IIH A;  1HPZ A;  2DNZ A;  2DEJ A;  2PT0 A;  1RP5 A;  1LW2 A;  2XLI A;  3PXG a;  4NZ6 A;  1ROF A;  5KOX A;  4ZVG A;  5T41 A;  2XB2 D;  1ZZN A;  1WDD A;  1RAI B;  1ZA1 B;  1MG7 A;  3DOK B;  4KH1 B;  4ZVP B;  2CZ9 A;  2BE2 A;  2WBM A;  2HK2 A;  3DRR B;  1U1P A;  1U02 A;  4IOC Q;  3FRY A;  4Z37 A;  2R2R A;  1RGV A;  5IM0 A;  1HLW A;  2HVI A;  3AOA A;  3KXD A;  2RRB A;  4HDH A;  1HQE A;  5T14 A;  2PSZ A;  1RWK B;  1WI8 A;  1YTY A;  1ZM3 A;  3HMJ G;  4X4R A;  2GVZ B;  4DUY F;  1WHY A;  2VQF F;  1FDB A;  2VA3 A;  1WKK A;  3M9M B;  2JLG A;  1VQP S;  2DPI A;  3HHN B;  2Z57 B;  1UET A;  1X4A A;  2DNG A;  4ZVE A;  1XTZ A;  2VC0 A;  2GML A;  3GFH A;  3MM9 A;  3KHG A;  1XMB A;  2W24 A;  1TL4 A;  5F8L A;  1YZ7 A;  2YH1 A;  3AXK A;  4RNF A;  2BJ9 A;  2YQ3 A;  1HD1 A;  4Y3C A;  1NO8 A;  1NEE A;  1QVG R;  3TJ9 A;  4QPT A;  4AQY J;  3PRV A;  3EZ5 A;  5B0C A;  5CQG A;  1SC3 B;  2QJ3 A;  2J8A A;  4DCP B;  3MMJ A;  4B3M J;  1HR0 J;  2RQK A;  4NLO A;  1YVF A;  1S1V B;  2JLE A;  3E01 B;  4FZV A;  4Y2I A;  4XPE A;  1S9G B;  1H3D A;  1TKZ A;  1N36 J;  2CNN B;  3QJP A;  4IYQ A;  4TYA A;  5LSR A;  3HVW A;  3OW2 R;  3VHQ A;  4DR1 J;  3K17 A;  4ED3 A;  3IC1 A;  3KKF A;  4NL5 A;  2AJ0 A;  3S7R A;  2W9C A;  2LA6 A;  1NZ8 A;  1LWC A;  2B4V A;  1ITP A;  2GIR A;  4CI0 B;  3V6J A;  4DPY A;  3TP2 A;  3BKT A;  2ZZT A;  4GC7 A;  2RE1 A;  2Q79 A;  1D9D A;  4ZCM A;  2VDI A;  2WOM B;  5G0R A;  3DNC A;  1SJ3 P;  1XMO J;  4YB1 P;  3SSS A;  1SJF A;  1R0C B;  5E7O B;  1EQM A;  4I7F B;  5B0G A;  1JIH A;  5A0Y B;  5M2U A;  3HPO A;  2QN6 B;  3GR0 A;  3CDU A;  5KFW A;  3J7Y U;  1PC5 A;  1MSW D;  4B3R J;  2M9K A;  2KT2 A;  3DRP B;  4YME A;  3QT5 A;  2RAQ A;  3BDP A;  1OO0 B;  3LPY A;  2FC8 A;  3UWT A;  3NAI A;  4AL7 A;  2VAS A;  5EUH A;  3P49 B;  4OI3 A;  2JDJ A;  2HZC A;  2R8H A;  4CRJ A;  2ZBP A;  1TAQ A;  2MQQ A;  4USV A;  5HO4 A;  3D6M B;  3CUL A;  4X4S A;  4OI6 A;  4B9N A;  3HCX A;  1S6U A;  3W2W B;  2UUA F;  1L3T A;  1HI1 A;  1SI9 A;  2MMY A;  1KD1 T;  1FRJ A;  2VBY A;  2Q43 A;  4L75 A;  4OZN A;  4RW7 A;  3U7J A;  1VYA A;  2HGN A;  1HMV A;  3MMB B;  2LXF A;  1DTT A;  3AB2 B;  4NLV A;  3QIP B;  2XSF A;  2LXI A;  5IC4 B;  1Q0N A;  2OI2 A;  1HQU B;  1MN7 A;  3AJ2 A;  4CH7 A;  1NJI T;  4C0B A;  2HMI B;  1HNX F;  4GRS A;  1UVL A;  1YDL A;  1ULR A;  5K8N A;  1HW8 A;  3CCT A;  3CJS A;  2B7C B;  4DR5 J;  3HHL A;  4FKY A;  3KJN B;  4YR3 A;  3L9Z A;  2C42 A;  4ZOS A;  4DHV A;  1KC8 T;  1T0T V;  1U1O A;  5GVQ A;  1RKJ A;  1A0O B;  4WBF A;  1UFK A;  5LMN J;  2C2Z B;  3TZY A;  2WW4 A;  3KLE A;  4KKO A;  2VON A;  3JTO A;  3W5X A;  3RB6 A;  1EAR A;  2CPJ A;  1DQ9 A;  1VQ6 S;  2LDY A;  4QOT A;  5FDL A;  4CH1 A;  2H5J B;  3LP1 A;  4CIO A;  3HFZ B;  3IBW A;  3BQ1 A;  2HWH A;  3ZNU A;  1C1C B;  3V6D B;  1JLG A;  1KNZ A;  1T8E A;  3J81 Y;  2M70 A;  3VZH A;  1FWL A;  3Q8S B;  1Q82 T;  3TAM A;  4R25 A;  3TJ8 A;  4FBU A;  3W64 A;  2CQH A;  2H4Y B;  2H65 B;  5KG2 A;  4K0K F;  1S0V A;  1BC6 A;  3V4I B;  2WAQ D;  2R8G A;  1IKW B;  3MD3 A;  2YPZ A;  1FFW B;  3DLL Q;  4B3O B;  1LXN A;  1T05 B;  3GJT B;  4ER8 A;  2ZE2 B;  3EGV A;  3JQJ A;  4HKQ A;  1VBZ A;  4EFA C;  2LKZ A;  5AXK A;  2R7O A;  3UO0 A;  2OPR A;  2GZO A;  2GQQ A;  2CAD A;  1S57 A;  3W5Z A;  3PO5 A;  4JI7 J;  3DGP A;  1IKV B;  1IKX A;  3LAN A;  3MAA B;  2AHO B;  2ZD1 B;  3CVK A;  2ROG A;  4YDD B;  2VOD A;  1TKX A;  2VL1 A;  2QA4 G;  3LWM A;  4X4V A;  4OX6 A;  2CYY A;  4ZPB A;  2VG7 A;  5DG7 A;  4B3S J;  3KLI B;  2VJU A;  3NCQ A;  1J5O A;  4GVB B;  4XO0 A;  5FJ4 A;  4WPA A;  1MRO A;  3M8Y A;  3CJ3 A;  3Q8U A;  1LW0 B;  3N5B A;  5DLG A;  5HL7 Q;  1T9X A;  2J0Q D;  4KBI A;  2L9N A;  1X9M A;  1VQM S;  2IDL A;  3BN4 A;  4PWD A;  2IM2 A;  3DI6 A;  1YHQ S;  2N3O A;  2I9S A;  1KOO A;  2DYA A;  1N6Q B;  4WFZ A;  4IFY B;  2ZNZ A;  1LWE A;  4F50 A;  2KFN A;  1DZ5 A;  2DNN A;  2OTL S;  2HQC A;  3M32 B;  3THP A;  2IM0 A;  4DL5 A;  1F2G A;  3T6B A;  1DLO B;  3MR3 A;  4CM0 A;  1KLM B;  3CME S;  1VHF A;  1Q53 A;  2NZC A;  4F4Y A;  1CJU B;  3VV2 B;  4QYZ K;  2HQD A;  2FUG 9;  3G2X A;  1P1L A;  4B9S A;  2CAJ A;  4NWB A;  4DSE A;  3ZTQ A;  3MM5 B;  1Q86 T;  1IBM F;  1Y10 A;  3T3F A;  3CT9 A;  5KFJ A;  1DUR A;  2IPO B;  1H74 A;  4MFB B;  4ZCL A;  3IG1 A;  3DLB A;  3RB4 A;  2E5I A;  4Q2L A;  1F5B A;  5DDQ C;  3K5M A;  1JLA A;  1V5V A;  1TVR A;  1FRI A;  4HDG A;  1HPZ B;  2DEI A;  1UFW A;  5K8O A;  4OI4 A;  1LW2 B;  1UJ4 A;  3UVJ A;  1RTD B;  1S9E A;  5ETN A;  1IR1 A;  4U9R A;  1S4F A;  5K8P A;  2JEJ A;  2M88 A;  4H4M B;  4QCL A;  3Q89 A;  4LF7 F;  2NYH A;  2MGZ A;  3BJY A;  4O0I A;  2E5H A;  1WC4 A;  4RNO A;  5CYJ A;  4DV7 F;  3OQ2 A;  4QU6 A;  4I1T A;  2XS2 A;  3V81 B;  3QFH A;  3LGM A;  2HGL A;  2J7W A;  4H4O B;  5CH7 B;  2JNJ A;  2XWX A;  4DR7 J;  1FXR A;  3GG0 A;  3O5T B;  1IJF B;  3ZTO A;  3HZG A;  4OZL A;  5DQI A;  3SZ2 A;  3Q2S C;  3MM9 B;  1C0T B;  4URS A;  3Q8V A;  3GTY X;  2NRE A;  3E51 A;  1NPP A;  2C28 A;  2PO4 A;  5THW A;  3J81 j;  2E1M C;  3NGD A;  4DV6 F;  5EDW A;  1PYO B;  2AYB A;  4JI2 F;  3D3B J;  3W9I A;  2G2Z A;  5I42 A;  1K73 T;  4USH A;  5D4N A;  1R43 A;  2FHM A;  2XBP A;  1PIL A;  1MU2 A;  2XO6 A;  4KGK A;  5D3G B;  4GKK J;  1X5T A;  1ICE B;  2CZV C;  3G6Y A;  4RJV A;  2LEP A;  1S49 A;  2ATL A;  4DPW A;  1TKZ B;  4DMZ A;  1Y3J A;  3T5K A;  3D7S B;  1RBO B;  1JLC A;  3HVT A;  4FF3 A;  2HVH A;  3EZU A;  3U1N A;  1Y5N B;  2W9C B;  1B4S A;  4CLK A;  1T94 A;  3HF5 A;  3ZTP A;  1LWC B;  3D67 A;  1B7Y B;  1NM2 A;  4LIR A;  4XTT A;  4DR6 F;  2J9D A;  2E5G A;  3BO4 A;  1S48 A;  2XGQ A;  2AZ3 A;  4NA1 A;  3DLH A;  3S8S A;  3NKY A;  1FEH A;  4C48 A;  2O66 A;  5D77 A;  4OYB A;  3ILL A;  2FIU A;  1IVZ A;  4KHM A;  4J37 A;  3EYZ A;  3D5M A;  2ALY B;  4LRC A;  4ECW A;  1WHW A;  3RGI A;  3EIC A;  3IA0 A;  1HNZ F;  1JXL A;  4DPU A;  4QWB A;  1FRL A;  1NK8 A;  3KMS A;  3ZTS A;  4DX6 A;  4DR3 J;  2CZ4 A;  2L41 A;  3LW5 C;  1Y5I B;  4ANC A;  3CB4 A;  2OEK A;  2ZBC A;  3OV7 A;  2BOA A;  3NNC A;  3ZO7 A;  3P8B B;  4HH1 A;  2OPP A;  4UZB A;  2HSE B;  3A8J A;  4ERD A;  2R2U A;  1BLU A;  3BM7 A;  5KG7 A;  1HBN A;  2OMO A;  1S5Z A;  4OX9 J;  3PV8 A;  3MTK A;  1SL0 A;  2AQ4 A;  4DBQ A;  3ENV A;  4DV2 J;  4Q0B A;  3FUY A;  4NXM J;  3FVY A;  4RW7 B;  4YN3 B;  2J6U A;  2AWZ A;  5KFH A;  3FQK A;  1X31 C;  3KK2 B;  1HW9 A;  5HLF A;  1N5T A;  4ZN1 A;  2WK4 A;  3UI3 A;  2DHA A;  2XSJ B;  1OIA A;  2QL9 B;  1S6Q A;  3W2V B;  5D4O A;  1PGZ A;  1GAO A;  4DSI A;  2BE7 D;  1RHJ B;  2R7X A;  5F9L A;  3QSI A;  2LEB A;  2C3Y A;  3FKB A;  3IRX A;  3VGU A;  4RKU C;  1JNZ B;  1XNR J;  3HHL B;  3W8G A;  1F5A A;  4KE5 A;  2X1G A;  4NLQ A;  3W7B A;  6AT1 B;  5D4L A;  4F2S A;  1RWM B;  3KLE B;  1U6Z A;  3BBF A;  2G1H A;  2V94 A;  1N5V A;  4D3H A;  3ET6 B;  3MR7 A;  4DX7 A;  4ECT A;  1VMB A;  3ZZP A;  1JLG B;  3K5N A;  2HHW A;  2WVC A;  4GO7 X;  3R2C J;  4Q8E A;  1H73 A;  4LF6 J;  3BYR A;  5C2G A;  2MSS A;  3TAM B;  1L5U A;  5CHC B;  4P7T A;  2RML A;  4DF8 A;  1HYS A;  3TZX A;  1IWA A;  4UOG A;  1RT6 A;  2AGQ A;  1GXT A;  1WF0 A;  1EET B;  2IRX A;  5IXU A;  1CJT A;  1R6Y A;  3V6K A;  3D66 A;  4P2F A;  4YDX A;  1PKU A;  3IRW P;  3D4J A;  4OL8 A;  3VGV A;  2OPR B;  2XC9 A;  2VG5 A;  3DGP B;  5IV4 A;  3J80 U;  2ZBR A;  4CYU A;  1IKX B;  4AUK A;  1NDC A;  2BMB A;  5AE1 A;  4JI4 F;  1K1S A;  3PZP A;  1F0X A;  1TK8 A;  1FEE A;  3RYL A;  1TKX B;  4C98 A;  2HFN A;  4ZLN A;  2H54 B;  4C8Y A;  5DO2 A;  4J9L A;  3FZB A;  1R3N A;  1UVI A;  4KRW A;  4OZ5 A;  1J5O B;  4WKY A;  4B17 A;  1RTJ A;  2JLF A;  4OQJ A;  2CUY A;  4DR4 F;  3SCI E;  3MEG A;  2ALZ A;  2NPI A;  5IT9 Y;  2XWY A;  1VIO A;  3SEO A;  3H2U B;  2LQ9 A;  2YXL A;  1RWV B;  2V8G A;  2IDE A;  2WVF A;  3E2E A;  3RU0 A;  2E29 A;  1P1T A;  1VI7 A;  1TV6 A;  4N47 A;  1UEV A;  4PPZ A;  3UR3 C;  1HFE L;  3TZZ A;  4M5K A;  3TEH B;  3OR1 B;  3MCN A;  2DXF A;  1Y3K A;  3BGL A;  2BR0 A;  4NYP A;  4CP5 A;  3A1Y G;  1OQ6 A;  2CJX B;  4DEZ A;  1KHW A;  3DOL A;  5L9X A;  4C6A A;  1UW4 A;  3QLH A;  2OEL A;  2OIH A;  2FVS A;  3VAJ A;  4KT0 C;  3MEC A;  1ARO P;  4X66 F;  2DY1 A;  2MQN A;  1QAI A;  4NCB A;  2V4Q A;  3DDK A;  2ZVS A;  1RT2 B;  1RTI A;  5HJY A;  4MYT A;  2ZHA A;  2YWH A;  2IA0 A;  1TTH B;  3ZZ0 A;  3KLV A;  2X1F A;  5HQL A;  2KB2 A;  2VDH A;  3B78 A;  2BKN A;  3NRB A;  2ZJR Q;  4CLU A;  1URN A;  1RB0 A;  2D3Z A;  2RHQ B;  1JLA B;  3P5T L;  1UPP A;  3OHA A;  1XNQ F;  4USK A;  2B7B B;  2X1A A;  3DHW C;  2ZM6 F;  1NRK A;  5HBM A;  3UVJ B;  1Z2L A;  3IXQ A;  4DUT A;  1WEL A;  1XMQ F;  2JWN A;  2MGZ B;  1WKL A;  2XMK A;  5F8J A;  3RB0 A;  4NZ0 A;  2AYM A;  2GV1 A;  2DD8 S;  1HHT P;  4RZR A;  2V6A A;  3DM2 A;  3JAM Y;  3BBC A;  2ASJ A;  2B8P A;  2AJ1 A;  2WHO A;  4JV5 F;  1WOO A;  5D15 A;  2UUC F;  1MLA A;  2M3D A;  2N4C A;  4PG4 A;  4DFP A;  1SKS A;  3DYA A;  4O3R A;  1FX4 A;  1PBU A;  4TN2 A;  2H3E B;  2VBZ A;  1F3F A;  1F2H A;  1RLD A;  2EVZ A;  2WZ1 A;  4ETZ A;  4Y00 A;  4RW4 A;  4BS2 A;  2PI4 A;  3VCD A;  3JSM A;  5B0D A;  2I1R A;  5JXS A;  1VQN S;  3UE2 A;  1RT7 A;  4PXE A;  2XS7 A;  3AOD A;  3DLG A;  2F9D A;  2FLP A;  3KUG A;  3MMC A;  2G2Y A;  2CQ1 A;  5I42 B;  4EUV A;  2M52 A;  1VQ5 S;  2VU5 A;  3PRB A;  3LUY A;  2WVB A;  1VS3 A;  2XI3 A;  2R7R A;  4K4Z A;  4J91 A;  4KAI A;  3I4P A;  3CJT A;  4LFC J;  5HVG A;  1LNQ A;  2B6A A;  2FJA B;  4ECY A;  1X8D A;  1NXI A;  5HAT A;  1D8Z A;  1FRM A;  1VQ7 S;  1JMT A;  1JLB B;  1QSL A;  4CQ1 A;  3IN5 A;  3RBE A;  3PW2 A;  4RNH A;  5KFB A;  1ACM B;  3I0R B;  2FHK A;  1RKI A;  2HQF A;  3PIP Q;  3K59 A;  4JI3 F;  3C3L A;  1N54 B;  3FEY B;  5CZX A;  3M8S A;  1TKD A;  1CC7 A;  4CLW A;  1WOR A;  2VQE F;  4K4S A;  2XMM A;  2AYE A;  4F04 B;  2JHE A;  2J6S A;  4NYZ A;  1RTH A;  1FK9 A;  1RXO B;  1KVJ A;  4WE1 A;  4K5S A;  3LAM A;  4USW A;  4WZQ A;  4OJG A;  1O51 A;  2VA2 A;  2ADB A;  5LM7 E;  5HI7 A;  3QGH A;  3R5D A;  4M5I A;  4ZVU B;  1HNX J;  2L48 A;  4PCQ A;  1LQ9 A;  3R27 A;  3BKU A;  4LF8 F;  2KH9 A;  3FJ2 A;  3D2W A;  1H2T Z;  4UW2 A;  4P71 A;  4ELV A;  3EM1 A;  2C22 A;  1FVS A;  4J9M A;  3EMT A;  1GX6 A;  2KXN B;  3MI7 X;  1KR4 A;  1HBN B;  2FY8 A;  2VIH A;  4HHU A;  2IMW P;  4CH0 S;  4J9Q A;  4Q0B B;  5BXI A;  3C66 A;  1J27 A;  1D0E A;  1S6O A;  3GMG A;  2FJW A;  3OXL A;  3BGR A;  2GJI A;  5HLF B;  3R6L B;  5J2N A;  2LLZ A;  2MHN A;  2ZC4 A;  4LVO P;  1S6Q B;  1WC6 A;  2KG0 A;  1NKB A;  3EXC X;  3LP0 A;  5A8K B;  1A7G E;  1RHK B;  3IRX B;  3H5X A;  4K0K J;  2VFU A;  2NSC A;  4RL1 A;  4CLS A;  3RRG A;  2RUS A;  1U8W A;  4ZPW R;  1R6V A;  3CJ4 A;  2W7P A;  5HMW A;  3DLE B;  1RAH B;  4K5R A;  3GP9 A;  3NCR A;  3M2R A;  1B0V A;  1D3W A;  1YRU A;  2DH8 A;  2HHH F;  4E0D A;  1JLQ A;  4F67 A;  3IAM 9;  4RU2 A;  2VBW A;  1YI2 S;  2IYG A;  2YVS A;  3KK3 B;  1M5V C;  1ZM2 A;  2P9E A;  1YJR A;  2W2Q P;  3HXM A;  1UZD A;  1TL7 A;  4OJ3 A;  1UKU A;  3EGZ A;  2PA3 A;  4N76 A;  2LP4 A;  2ADC A;  1RT6 B;  5F9N A;  3H90 A;  1EIY B;  3B4M A;  1T3N A;  1R7I A;  3BGU A;  4WK1 A;  1CJT B;  3PKM A;  4QWC A;  4KGV B;  1TEL A;  4EZ6 A;  3ZZT A;  4H4K A;  4RW6 A;  2XYG B;  1DRZ A;  3FNN A;  2VG5 B;  3E3X A;  3DRX A;  4PEO A;  4QYR A;  2W8K A;  2CVE A;  4CYU B;  3QSY B;  1RWW B;  1NK6 A;  3OFF A;  4E98 A;  3MF5 A;  2ZH3 A;  3AJ1 A;  2G2O A;  1SQF A;  2B4P A;  1VQO S;  1HWL A;  2KRR A;  3M1V A;  3ADA C;  2YWF A;  3K89 A;  4I68 A;  3OBI A;  2EFV A;  3IWX A;  4FS1 A;  4LVN P;  4RLE A;  1S77 D;  2XMW A;  2ZOF A;  4PUO A;  2AF6 A;  3MR2 A;  3VAM A;  3QO9 A;  1FE4 A;  2XZW A;  1RWP B;  3BN7 A;  3DDI A;  4RW8 A;  1IBM J;  2VPW B;  3IGN A;  3R5A A;  5A6W A;  3ITH B;  1DAX A;  4M95 A;  4DCO B;  4LBH A;  5B08 A;  3EGW B;  1QAJ A;  2VG6 A;  1RWX B;  2HHX A;  1CS4 B;  2LU2 A;  9ATC B;  1TV6 B;  3H98 A;  4A48 A;  4DF4 A;  4IRK A;  1BQX A;  4B9M A;  4Z2X A;  3HVA A;  2KFZ A;  4X2B A;  4MMO A;  4X64 J;  3MD1 A;  4B3M F;  4LSN A;  4MTP A;  5LL6 d;  1QM9 A;  3P45 B;  2YKM A;  4MK9 A;  1YJ7 A;  3DOL B;  4ZVR B;  1KEK A;  2BA9 A;  3QLH B;  2DHH A;  3FBB A;  4LF7 J;  2G1D A;  3CCR S;  2F3J A;  4OLP A;  5IT4 A;  3D6T B;  3MEC B;  4RUA A;  2F8E X;  4M63 A;  1N36 F;  4DV7 J;  2UUW A;  1I6J A;  1RTI B;  4HAC A;  3A8K A;  2G4B A;  3L95 X;  2YQ0 A;  4CWB A;  2MLZ A;  3DXB A;  3RR7 A;  4DR1 F;  2ZOM A;  4DL6 A;  5AT1 B;  1BWE A;  3SBM A;  5C42 A;  2AIR B;  3N01 A;  2QV6 A;  2ASL A;  1SL1 A;  1X7V A;  3LQV A;  2AEJ A;  2YPY A;  5KFS A;  4NZ7 A;  3J81 U;  3JS9 A;  5J1P A;  4ZPA A;  2DNQ A;  4IQX A;  5HBM B;  1Y5L B;  5C7P A;  5DQG A;  3OFE A;  4YFU A;  2ZH9 A;  2EFG A;  5K20 B;  1GFW B;  2HVE A;  4GC6 A;  4DV6 J;  1CBK A;  2A0F B;  4JI2 J;  4IO9 Q;  4UY8 5;  4K59 A;  1FD2 A;  2L9W A;  4QWD A;  1FFS B;  3DM2 B;  3VAI A;  4B3R F;  4OI0 A;  2BAN A;  5CD4 A;  2JSX A;  2MKS A;  3DCA A;  4IKA A;  1UWB A;  2H48 B;  4OHW A;  4LRD A;  1T3O A;  5B0F A;  5C24 A;  1OMS A;  3M6U A;  2DO4 A;  4R5P A;  3HKZ D;  1FXD A;  3BSN A;  2RIL A;  2DXD A;  4I0W A;  1SKW A;  1JKH A;  5LXY A;  3R6G B;  3PTW A;  1QTM A;  4RW4 B;  1AZS A;  3D1Q A;  2ZDO A;  1U1M A;  3I32 A;  5DDO C;  4N8O A;  1NB7 A;  1RT7 B;  2BX6 A;  2Z58 B;  2EBG A;  3DLG B;  5JVG Q;  4DR6 J;  3O2I A;  4LSL B;  3MMC B;  3PYD A;  2OML A;  5C25 A;  1FDN A;  1P8G A;  1WKJ A;  4MKB A;  2CJB A;  3A3O B;  2GHP A;  3F56 A;  1U47 A;  1Q95 G;  5KG6 A;  4RUC A;  2C2D A;  4ES2 A;  5HP1 A;  5KT4 A;  2MB0 B;  1MWZ A;  2NS1 B;  1V3S A;  2B6A B;  3I9Z A;  1HNZ J;  1KBR A;  3TVK A;  4N8N A;  2DNK A;  1SH3 A;  3NBP A;  1OSD A;  4U8Y A;  5K14 A;  4LF5 J;  2XMV A;  5DG9 A;  3D1H A;  3HLU A;  2DR6 A;  1UVK A;  1M5O C;  2EPI A;  5ETO A;  2P6T A;  2FZG B;  1RCX B;  4FVM A;  5ETM A;  4UOF A;  5KFL A;  3WC2 A;  1T02 A;  2RS2 A;  4LRE A;  1XR7 A;  1A6L A;  4ECV A;  2YNH A;  1O5J A;  2UVR A;  3ZFV A;  2ZH5 A;  4IG0 A;  3WC0 A;  3HFV A;  1HA1 A;  4K2X A;  3T1A A;  2AD9 A;  4DWI A;  2J76 E;  1KFD A;  3J7Z 5;  2DIU A;  1NSQ A;  3D9B A;  5J2M A;  1N88 A;  3T6J A;  1PJ5 A;  2OEM A;  1IBC B;  4YOE A;  4WE1 B;  2HIQ A;  3N28 A;  4KR0 B;  1NHV A;  3KFW X;  4ZHR A;  2QIF A;  3QJL A;  2E1A A;  3UR0 A;  4OX8 A;  4OYM A;  3GFY A;  4RWW A;  3LPE A;  2DBB A;  3M9N B;  5GME A;  4A8M P;  2EK1 A;  1RCO B;  2HK3 A;  4ILL A;  3MM6 A;  3KDO A;  4ZLJ A;  2LXU A;  3I56 S;  1NSP A;  2HHV A;  1YWX A;  4JV1 A;  2KDO A;  4JI7 F;  3OUY B;  2GX8 A;  1LWF B;  1S1X A;  4ZIV A;  1IKY A;  2KZZ A;  3ISN C;  2DGW A;  3SIP B;  1FD8 A;  3UD4 P;  2ROP A;  4ANE A; 
#chains in the Genus database with same CATH homology
 3QFH A;  3BPS P;  3AFG A;  2E1P A;  1V5I B;  3GCW P;  4K8R A;  2W2P P;  4NMX A;  2QTW A;  2XTJ P;  4OV6 A;  4YN3 B;  3H42 A;  4JP8 A;  2Z30 B;  2W2M P;  3A3O B;  3P5B P;  3CNQ P;  3VV2 B;  1SCJ B;  3WIV A;  3WHI A;  2ZWO A;  3BGO P;  4NE9 C;  1ITP A;  2ZWP A;  3T41 A;  3A3P B;  2W2N P;  3CO0 P;  2Z58 B;  3VHQ A;  3WIU A;  2Z57 B;  3SQO P;  2Z2Z A;  2PMW A;  1SPB P;  2W2Q P;  2Z56 B;  3A3N B;  3GCX P;  2W2O P;  2Z2Y B;  1R6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...