4OV6A

Crystal structure of pcsk9(53-451) with adnectin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pharmacologic Profile of the Adnectin BMS-962476, a Small Protein Biologic Alternative to PCSK9 Antibodies for Low-Density Lipoprotein Lowering.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
molecule keywords Proprotein convertase subtilisin/kexin type 9
total genus 22
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4ov6A01
2W2OP 1V5IB 3AFGA 3QFHA 2Z2ZA 3GCWP 4NMXA 3A3PB 3GCXP 4OV6A 3WIUA 2Z2YB 3BGOP 3VV2B 2Z58B 3VHQA 2QTWA 2Z56B 1SCJB 1R6VA 3SQOP 2E1PA 3CO0P 2ZWOA 2W2MP 3H42A 3A3NB 3P5BP 4K8RA 3BPSP 3WIVA 2W2QP 2W2PP 2Z57B 3T41A 1SPBP 2W2NP 2PMWA 2Z30B 2ZWPA 4NE9C 4YN3B 3A3OB 2XTJP 4JP8A 1ITPA 3WHIA 3CNQP
chains in the Genus database with same CATH superfamily
4J90A 1IR2A 3JSMB 4DR2J 2VPWB 2B3TB 2GQCA 3HHDA 4ALZA 5DLGA 2J0WA 4LR7A 1S1UB 2BJEA 2J8AA 2NUHA 3C15B 2WHOA 4O44A 1U45A 3CC7S 2VFUA 3AOAA 4FPRA 4O0NA 2CG4A 1LXNA 1NDKA 4NEZA 2G13A 1CULB 5KT3A 3H42A 4J9UE 4YHHF 4YQWA 4DX7A 2L41A 1WELA 2QX0A 1ZPWX 3D1QA 4PR6A 5DJBA 3T3FA 4UW2A 1U1PA 1N5YA 2J6SA 4K4ZA 2GQ2A 2G1DA 1GQEA 1FFGB 2D41A 2JZ5A 3CCZA 5CYQB 1HBUB 1Q8IA 5E0OA 2DNGA 3LW5C 4PG8A 3GV5B 3BO2A 5IV4A 2KFNA 3FRYA 2E1RA 1DTQA 1FNOA 3MMAA 3QLHB 2GJ2A 3WZ0A 4UT4A 1FJGF 4MH8A 2HQGA 4IFYA 1GMWA 8RUCA 3CB4A 1LWCB 2X51A 1SL2A 2J0SD 5HO4A 1FXLA 3M05A 3GB0A 2BOPA 3BYRA 1RAJA 3QT6A 1Q95G 4DBQA 1VRUB 2A1BA 3R7BB 4CM2A 1QSYA 3OL7A 3ZO7A 3FEZA 2FHMA 2UUTA 3PDNA 3EX7B 2OPRB 5I3UA 5H9FK 1APSA 1WC3A 5IOLA 1H6KX 2GAHC 4Y3CA 4CYUB 2BRKA 2EFOA 4IG0A 1S10A 3TAMB 3D0IE 2J7KA 3HI9A 1ULRA 2DGUA 2GQQA 2FQQB 1U0HA 2XZDB 1F5CA 3KKFA 3UN2A 2O66A 3IS9B 4X65F 1IBMF 1JMTA 4DQSA 2UVUA 4OI6A 2YNFA 4C3KA 4JI4J 3KWMA 1VK3A 2BXJA 1VC6A 3LOUA 1RJJA 3MI7X 3UDEA 3PO5A 3W7BA 4YHHJ 1A7GE 1X4HA 2G2OA 5DM6Q 3T1YF 2R7TA 1RB0A 2E7XA 2K3IA 3ENQA 3NWGA 3M8QB 3BQ0A 3M30B 2C3OA 2HRTA 2R8KA 5J2MA 2CJ9A 2HAIA 2R2UA 3HSGA 4QQBA 3BSOA 2OPPA 1NHUA 8ATCB 3G6XA 2ZDPA 5KFNA 3HHLD 1U1LA 3NGTA 2XS2A 1JLEA 4LBIA 4JI4F 4OZ3A 3T9ZA 3K2YA 4ED5A 2KTQA 3KHHA 3E2EA 1K0VA 1OY8A 1IKXA 2E29A 2I0XA 2MKJA 3HT0A 4ECTA 2D9OA 3DRYA 1XBWA 3CF5Q 4GMKA 4XAKA 4J91A 3DDKA 2WOMB 2WSFC 4NYPA 4CT9A 4K2JA 4ES1A 2VZ9A 4ANEA 5KFJA 2CQGA 3C66A 2YX4A 3CJSA 3FC9A 1PCAA 2H5EA 2F3JA 1RWOB 3GMGA 5A8RA 3J80Y 1SB6A 2FVQA 4F2RA 5HL7Q 4LQ3A 1P9QC 3KNGA 1C0UB 1IBLJ 1T03A 2PI5A 2L3MA 3D28A 3OSNA 1FKPA 2PEHA 2M52A 1VISA 4LVOP 4NRTA 2YBVA 4NASA 4Y2AA 5L8RC 4WTYA 4F26A 5CA5A 1NK8A 1ZAXA 2ATCB 3MCSA 3I5BA 2OEJA 4FXVA 2AZ1A 2V94A 2CQHA 2U1AA 3V6HA 4NXMF 3WIVA 4DUZF 2Z2LA 3V2UC 2HEKA 5KG4A 5IM0B 3R6LB 3M9OB 5CYJA 3ZZOA 4FBUA 1NZAA 3ZZZA 2FHKA 4BBYA 3JAMY 3M2RB 1TKDA 3QAEA 2YNHA 3RAQA 1VJWA 3LGNA 4IR1A 1QUPA 3BYPA 5F8HA 3NRBA 1U1OA 2YWKA 1RWNB 1D9FA 1VC0A 1H7WA 2AW0A 2V2QA 3JB9k 3MCOA 4KQZA 2DYAA 3DU5A 4ED3A 4IRDA 3MM9A 3MCMA 2EPIA 2F5GA 1YJ9S 1HBMB 2VHGA 4FVMA 3CO0P 2A0FB 4PXDA 2GIRA 5ETPA 3ZZPA 5BYSA 1HR0F 3D2WA 4ER8A 1HWKA 2EG1A 1TMMA 3GONA 2XO6A 3PX0A 5J1EA 2HHXA 3O6QA 1I1GA 1RCXB 2KL8A 3KLHA 1UWBB 4NL5A 5L1LA 3G6VA 3LP1B 4USVA 1L3TA 5T7LB 3T5LA 2YVSA 3DI6B 4PWWA 2ZNYA 4O3QA 4OLPA 3ITHB 4ITSA 1ZM9A 2LCWA 2BV3A 3M6VA 4KFBB 3GFYA 3M32A 4B3TF 4CLLA 1N34J 3ZXWA 2X1BA 2XMMA 1KEKA 1M5KC 5EUHA 1FE0A 1FRMA 2A2CA 2DIVA 4PXCA 4BHQA 2D3OR 2MSSA 4X4VA 2QE5A 3CEDA 3IBWA 4HT7A 3CJKA 2ZBCA 3VGTA 2HHUA 1HNVB 2YNFB 1Y9OA 2E1PA 3CJ2A 4RUCA 5HP1A 5KFHA 2FJWA 2FUG9 4KV8A 4NYOA 1NSAA 5K14B 2FVRA 2VA3A 1T3OA 3DM2B 2LDYA 2BMBA 5L1IA 3W66A 1NKEA 2ZD1A 3IM8A 2R3VA 4A8QA 3KLEA 1N6QA 2HK3A 3QT7A 3DDIA 1RLDA 4MK7A 4P75A 3MM7B 4PEOA 3FRZA 2OSQA 4EEYA 2C3YA 4I7FA 4NLSA 5C7PA 1KD1T 2AX0A 3PIOQ 2CQPA 2GVDB 2ZE2A 4KGVB 4MT1A 2IHR1 2WCXA 2F4FA 4OZ0A 3OD2A 5HLFA 4EZ9A 4NLDA 1UVNA 2DGXA 4M1KA 1S5ZA 1T9UA 1XN9A 3LQVA 1RUSA 3ILOA 4AD6A 3LP2B 2ZOFA 3DOKB 3DLEA 3I9ZA 4DSKA 1CQMA 1GMWD 3VQTA 1P27B 2BVZA 3OFGA 4OHXA 4N76A 1VQ8S 4LRAA 4CM0A 5A0YA 4K8RA 3Q8SB 1QSLA 3I56S 3DLGA 3OVAA 2XYGB 2Z8QA 3LP1A 4Q2MA 1XEZA 3I0RB 4DU7A 2JEJA 4EZ6A 4AL5A 2HGNA 2R8JA 1S6UA 1UZHA 5EX3A 4F04B 2DH8A 2CKWA 1K44A 2L48A 2M5YA 3EICA 1O6XA 2C2KB 3MEEA 1VHIA 3DRSA 3FZ2A 3VR1A 1AFIA 4ELVA 2DK2A 5ETLA 2V8DA 3LWMA 1C1CA 2RNEA 3D1HA 1U1KA 1NB7A 3QJJA 5D4LA 4P2SA 1IXKA 1GXLA 2HNZA 3UNGC 3BO3A 1RT4A 1RLCL 2E7WA 2FTRA 2N4CA 3M1VB 3M9NB 2YNHB 4UUWA 1YBTA 1XJWB 1HNWF 1LEOA 3HVRA 5I42B 3TJ8A 2N3LA 3LPEA 1FEHA 3OFEA 4A4JA 1GX6A 5E3QA 1KHVA 2BBEA 4ED6A 1QE1A 2SXLA 1JKHA 2QC3A 2HWIA 3CJ8A 1IM6A 1TL3A 3CO9A 3O1LA 3WDOA 5DDPC 1R0CB 1TMJA 5AJ3J 2ZITA 2C22A 2HHVA 3CD0A 1NEEA 3A1YG 4OX8A 2HURA 2RU9A 3GIIA 3B6BA 1B7YB 2R2RA 4G1QA 2MGZB 2ZZMA 1D1UA 1Y5NB 2K3KA 4DPOA 2JEIA 2NSBA 4ECYA 4NLGA 5F0UA 1KQGB 2HVEA 2H65B 3PO4A 2UU9J 2ZHAA 4IFYB 3NGUA 2D3ZA 4GC6A 3SDEA 5HVGA 1OSDA 5KOWA 4UZBA 5A6WA 2ABYA 2BJ3A 4DPXA 1U4BA 3H4DA 1SC6A 3CJ0A 2DNPA 2GHVC 1HBUA 3D3CJ 4J9QA 3CIMA 2NYIA 3FFIB 5D78A 3SI8A 3G8SA 5KG3A 3HHNB 1TAUA 2DH7A 1PJ6A 3QATA 4JI6F 4WCEQ 2HK2A 3S6EA 3GYXB 1J5OB 4PUOA 1WG5A 4NZ6A 3MM8B 3DRSB 1NXIA 3SFUA 1W25A 4YFUA 3P8BB 4AL7A 2QT7A 2LQJA 1CC8A 2W25A 4Y6IA 1RT5A 1VQ7S 4Z7YA 2DEIA 3WX4A 2UXDJ 2HZCA 3GPAA 2ZKUA 5H9FJ 1WNEA 3N79A 2MYFA 4NLTA 2BANA 4O3PA 5IT4A 2OMOA 4H4OA 2R8IA 1FI4A 1JXEA 2QO3A 1VBKA 1MNEA 2JC1A 3B8HA 4X84A 5KFLA 5C42B 3QJLA 2QFJA 3EGVA 1VGYA 4A8XA 2W9CA 4YR0A 1YITS 1DRZA 5G0RB 4LREA 2ILYA 3KLFA 2UXDF 4ANDA 3MURP 2YKMA 4DN0A 1FRXA 4QYRA 3CUNA 1X31C 2MSTA 1IKXB 3KOAA 2RRNA 3CMQA 2J7UA 2VUGA 3MMCA 4FDFA 5G4DA 4DR5F 4DV3J 3R2CJ 4KGZB 1HW8A 2Z30B 4KSEB 3W8GA 2NREA 4DQQA 2ZOGA 5L46A 2KJWA 3LALA 4FKXA 1ZM2A 2IJFA 2AEFA 1M1KT 4NA1A 2EC0A 3EGWB 3NY0A 1NNDA 2V50A 4RW9B 1V5IB 4QWCA 1KONA 3ONQA 4NMXA 4AYBD 4ZHRB 2YKNA 2H5IB 2N82B 1ELOA 2VIHA 4CLWA 3CXCR 3W8PA 2FHJA 2MQNA 2WVCA 4B17A 1UVLA 2CPXA 3KLGB 2B6AB 2IVMA 2XWYA 4F7VA 3I0SA 4W92B 2KG0A 3E8OA 1TUVA 3TVYA 1SV5A 1OYDA 1RT1A 1X0PA 1UJ4A 4IOCQ 2R7VA 4AQYF 3CCSS 2M2BA 1FK9B 2XI3A 1XNRF 3OR2A 5DQGA 3PKYA 1B64A 3I9V9 2HW3A 2WVBA 1REGX 4W98A 2NPFA 3SMZA 3TZYA 3DGPA 4ZVGA 1XNRJ 4Y65A 2PT0A 5EX0A 4M63A 1AUSL 1FKPB 4K4UA 3NP5A 1U6ZA 1UEKA 2P8IA 2KU7A 4LT6A 4GVBB 3GWCA 1NUEA 4HDGA 1R8CA 2CQ3A 3ZFVA 4U95A 4URGA 4NZ0A 5JVGQ 2FLNA 4B9NA 4I67A 2ZNZA 1OJ4A 1IBCB 3IXQA 1WEYA 4E0DA 1DURA 2QA4G 3GJTB 5F9LA 4U6PA 5DDOC 1U1MA 3OT9A 1SH3A 3DOLB 4J37A 2YKQA 2LXFA 4DR4J 3M6WA 4ZCKA 2IBOA 2RH3A 3KFWX 4L76A 3CDBA 3HULA 4IYQA 4UQTA 3OUYA 4K59A 1S1TB 2YKMB 2J9CA 4JBCA 2ZH7A 4WBFA 3AOCA 4M5NA 2X1FA 1RTIB 4QWAA 2MZ1A 4ID5B 2MHNA 3D6TB 1GXTA 4ECXA 4CO3A 5DO2A 5LXYA 4ENOA 5DGAA 5LJ5Y 3PW4A 4C8OA 1RWKB 3IFEA 3CCWA 1RE1B 1M5OC 2UUBF 2MLZA 2ACYA 2PDAA 4LIWA 2CUYA 2B51A 2ZUGA 3UD3P 2BJDA 1EKSA 1WHXA 4JI2J 2NXJA 1RKJA 3PRBA 3N01A 1UFLA 2YNGB 2YQ0A 4RW8B 3Q8VA 1F3VA 3TX8A 4MK8A 4TQRA 5D4PA 2LQ9A 2DPIA 1RT6A 4DV1J 5F8IA 2OD6A 2IIHA 3AD7C 3EVOA 5M2RA 3ZTRA 3TI0A 2FLLA 2CNNB 1QY7A 1CJVA 2CJBA 3VALA 3PW0A 3DN9A 1NJYA 1X4FA 1TK8A 1N0VC 1S9GA 3A3NB 2KFZA 1N5SA 4F0MA 1RT2B 2JFDA 3ZZRA 1CJUB 3W61A 1X4EA 3KLEB 5CXTA 5ETSA 4CP5A 1ZH5A 3NCQA 1HD0A 4KKOB 2HLUA 3CDUA 5DQHA 3C6TB 3CJRA 2MZQA 5C25A 2UXBJ 4YB5A 2VBWA 1PKUA 2CQIA 2AYGA 3TEGA 4H4MB 2IDEA 1YJRA 5L9XA 5ADZA 1WTFA 2D3O1 4V19X 2IDLA 2CJQA 3G86A 3CDEA 1NHKL 3JQJA 4JYAJ 1GT8A 3EJMA 4RBTA 2BA9A 3A3PB 1UWBA 2X3GA 4L73A 4OV6A 4JI6J 4LF4F 1A0OB 3QQCD 1NK4A 4TLRA 2VG5A 2K2PA 4DV2J 4DQIA 4HEA9 1N5YB 3ITHA 4CLFA 1NMEB 3R1HA 4RWWA 1L3VA 3K5PA 2IRXA 3AQOA 3MXHP 1C2PA 1T9XA 1KTQA 2A18A 1VRUA 3FMWA 3U1LA 1YQHA 1NSPA 2B6AA 1DTQB 3L9ZA 3GFXA 1NLKL 4ED8A 1ACMB 3ZTPA 4OJHA 4TY9A 3MUMP 3V4IA 4OFZA 1TAQA 2CFXA 2E5LJ 5U47A 3ZNUA 4IO1A 3BGFA 4LFBF 4C0BA 2BQRA 4Q5VA 1PO6A 1F9HA 2DNQA 5EN1A 4LF9J 3O44A 4IKAA 5CYMB 4P9SA 3UO0A 3JSBA 3HVAA 2HQFA 2VFRA 4NCGB 4E2FB 4B9LA 3FSYA 1JK9B 1WC0A 2QLXA 1N6QB 4L6V3 1CS4B 3RTVA 1X4BA 2BJ7A 1RT7A 2Z2YB 2QG9B 1QDUB 3MM7A 2HFZA 4IDKB 4Z7CA 5DG7A 4XPEA 3GTYX 4DHVA 3A8KA 1FDAA 2HWTA 3EDRB 5HK4A 2E1CA 3HLUA 1CJTA 3NCRA 1RHQB 2NS1B 1F9EB 4PAAA 5KFOA 3MOJB 2GHPA 2OO4A 1T9TA 2AZ3A 4DS4A 4DZDA 1HMVB 2MEWA 2Y0BB 2XMAA 4D3HA 3F41A 4RKUC 2BUNA 5JVHQ 3PW7A 4YB1P 2PSZA 2X7IA 2Q6CA 4B9SA 4CLYA 3X3UA 1R0AB 4NE9C 3LAMA 2CQ1A 2JLFA 4OI2A 3WBZA 4P2XA 3GIJA 1BQMB 2V67A 4KB7A 4B3MF 2QSWA 4C8YA 3GSDA 1RYRA 5IC4B 4MIBA 1SVDA 1DQ8A 1N48A 4K7QA 1QTMA 1NKBA 2Z0GA 3PACA 4IOAQ 4A8MP 4OX9F 2AYMA 2GGPB 1HQEB 1VR6A 2WW8A 3OXGA 2JX2A 4DCJB 2F7VA 1IKWB 4RW8A 5B0FA 4DN9A 3VAGA 1TV6B 4DL3A 1HBMA 4B9VA 4CT8A 2GJFA 4QIEA 2PI4A 5HQLA 2V63A 3EZ5A 4KHMA 1HNZF 3RRHA 5CHCB 4BLGA 1IQTA 2BW7A 2KRBA 2IJNA 1MN7A 4OJ3A 4DCOB 1EQMA 2KJVA 1R3NA 3ENWA 1I5OB 4HLBA 3PG9A 2GNKA 1I6JA 1L3UA 5GAHI 3TA2A 1S1VB 1HQ2A 1S99A 5HBMA 3SBMA 3SCKE 3P45B 4CNYA 2ROEA 2VQFJ 1A9NB 2FGCA 4ZLNA 1RWXB 2RU3A 1DTTA 1T9VA 5RUBA 2H48B 5F8NA 2DD8S 3GCWP 3A4TA 1RBOB 3SQGA 1VBXA 2DO0A 3QO9B 3VGSA 2JEGA 3CCJS 1TL1B 3G87A 3MM8A 2OEKA 1NB2A 2IM3A 4N7TA 3M8ZA 4I0WA 5FJ4A 2M8HA 1IJEB 3OHBA 1NPRA 2DBBA 4ZVRB 1N36J 2WW4A 4LBHA 2OLWA 2ADCA 3TWZA 1YJUA 2GMHA 1VC5A 2UVVA 1KVIA 4PPDA 2HIYA 4LVNP 4QIVA 2ROPA 3PZPA 2B43A 4DLGA 2BOAA 2IA0A 4OV1A 1U1NA 4RNHA 4MJKA 4PYAA 1CULA 3V6KA 4LR8A 4O3SA 4FF1A 2V34A 4LF8J 2NCKL 1HBOB 5HN0A 3TX0A 1JIHA 2AJFE 1RAHB 2B8QA 2I9SA 3BS9A 3F0NA 3ZTQA 2XY7A 4RW9A 1X4CA 1ZM3A 3D6MB 1Y11A 4NPOA 1KLNA 3R3TA 1NK7A 5LMUF 1Q1KA 1QD1A 3ZZ0A 3PR4A 3AD9C 2P9CA 2WRMA 2DNRA 1JWWA 1VIXA 4NEYA 1YRUA 5FLXU 1HR0J 1HD1A 3FCVA 4ECUA 4NCGA 3BF4A 3GIMA 1MW7A 1JXLA 2UZAA 1YDLA 1MROB 3J81j 2VD3A 3MEKA 1X4AA 2VKZG 3QJPA 2ALYB 2XMWA 2V8HA 2HAFA 3V6DA 3M9MB 2XM3A 4LF7F 2KT3A 2PGCA 3BSNA 1Y10A 3GJRB 3CJ4A 5B0BA 1M5VC 2UUAJ 2ZWPA 4B3OB 2EKNA 3U1NA 1YG0A 1WF1A 1XMBA 2ASDA 4CLPA 1OSCA 3LTOA 2VODA 1AYEA 1R7IA 2HBQB 2M70A 3H90A 2HBRB 1EHWA 2V8VA 3ISND 2EFNA 4ZPBA 4R5PB 3CD5A 2NR0A 5HLFB 4OHVA 1HQUA 1TL7A 2FHJD 2H5JB 1E6YA 3CJTA 3MZIA 3W9IA 3UE2A 1HWLA 3AJ1A 4MKVA 1U26A 3PCOB 4YMEA 3RBZA 2AX1A 3VQSA 5C5JA 5DDRC 3OJSA 1VQNS 3CCTA 1XR5A 4Q2LA 2JH3A 2IVFB 1OY9A 4RNNA 1IBLF 3Q23A 4XPCA 5HMZA 3GIRA 3SCJE 2KYXA 5KFIA 2W1BA 3ETMA 2HBZB 1UFKA 3QGPA 2XHCA 4N8OA 3EE3A 1H38A 3HZEA 2G2ZA 4LFAF 1V5VA 1JJCB 3MUTP 4WZQA 4X4QA 1X60A 1S1TA 3M8SA 2AJQA 3LPYA 1FESA 1U8SA 4HR2A 1S72S 4ED4A 3G96A 1RWMB 1JXVA 4EO8A 4WIQA 1K0TA 4WFYA 2XLIA 7FDRA 1Q16B 2KZMA 2HNYA 2HFSA 3MPWA 3W2VB 3C2PA 2ZJQQ 4YY3J 4X62J 3IBFB 3IR6B 4WZMA 4JI7J 2Y1LB 2EK6A 3V6DB 2WVEA 2RKIA 4OZJA 1OY6A 1Q5YA 3HHEA 1UEUA 4A46A 3N5BA 3VZHA 4DSJA 2B0GA 4LF4J 4B3OA 2NZ4A 1U1QA 2QJ3A 2DHGA 2PE8A 3BPDA 1MMLA 1VK8A 3C6TA 3L7UA 5J2NB 2PN6A 3MM6B 3CDWA 1VLOA 5E2QA 1FRJA 1UPMB 2CYYA 3CE8A 4MYTA 1J5OA 4PUOB 1NDPA 3IA0A 4B3RF 2F1FA 2OUGA 2RUSA 4YP3A 3HF5A 4GVLA 3P49B 3CNQP 1S7IA 2VBZA 2XGQA 5B0DA 2W2OP 1U49A 4C9DA 3T1HF 1FO1A 1E6YB 2NXEA 1N5QA 1UEVA 1SJ3P 4C8LA 1QM9A 4WP9A 3ZNJ1 3MR6A 2YKPA 2YX1A 2FVSA 1RT3B 2YH1A 4NXMJ 2CA9A 2POKA 3CJQA 2HZAA 1PSDA 3I87A 2I8EA 4ZVEA 3KMSA 3Q8YA 4H4OB 3KHGA 1RWUA 4PQUA 2EG2A 1LOUA 4Y28C 3HCXA 2RS2A 2KVIA 5HQMA 5KFEA 3AT1B 4DV7F 1WI6A 1I3OB 2Y1JA 2HVIA 4J9NA 4DSLA 1Y3KA 1SKRA 3OPKA 2B5JA 5HMWA 2FC9A 2XMUA 2CNKB 1OYEA 2GS8A 1HIYA 4IUFA 2VC1A 1MU2B 1VQ6S 3RYLA 4YN3B 4CDIA 2R9LA 2EK1A 4DV0J 2DVIA 2BR0A 1QUVA 1LWXA 2GJIA 4G65A 4RLEA 1XIQA 1R8AA 3A8EA 3D7SB 4TQSA 2C1EB 2CPDA 5J2PB 3K59A 3BGRB 1OIAA 4NLRA 4Q44A 3V81B 4GKKF 3GCXP 3NNAA 4JUZA 2DRAA 2OP5A 1WC5A 5SZTA 2F8EX 1EB0A 5C25B 3K5LA 2GW8A 1CQNA 2DHAA 2FY8A 3QZ8A 1Q81T 3HKWA 1U2CA 4G3IA 5L9NA 3G82A 4O23A 4I64A 1IN0A 2XG8A 2V68A 3HFVA 1WDDA 4DL0C 1LFPA 1WC6A 4Y00A 2BJ1A 3R5JB 2B9WA 4NLWA 4A8FA 1JB0C 4GKKJ 2KG1A 4FYDA 3L09A 4KPYA 2JLEA 5GAGI 4FXWA 2P9GA 3I5CA 3IN5A 5IWAJ 4HI1A 4CLTA 3D4JA 4OZ5A 2VG6A 4LFCJ 2MZRA 4JV1A 1YX2A 1UPPA 2QLBB 2IPOB 3MPYA 3HD1A 3TEHB 3OJUA 1Y5IB 4USWA 2AEMA 3ENAA 2P6TA 3I55S 5DDQC 1IWGA 1U24A 4GVBA 3T19A 5KFBA 5AJ3F 5J2QA 4U8VA 4M95A 4PXEA 2MZSA 4DV7J 1CVJA 1JNZB 1N8RT 2YH0A 3QYYA 1XR7A 1X0FA 4PWDB 4ZCLA 1F60B 3TR5A 4YEAA 4IH5A 4FYVB 4OMFG 3VAJA 4F4KA 2AU0A 2CPFA 5DLFA 2XB2D 5IT9Y 2B7BB 4EO6A 1FVSA 1LW0B 3SSSA 3KNAA 1YBAA 5SUHA 5ETMA 5AT1B 2V8GA 1IKVB 3BKTA 2HQ3A 1P6TA 3HKZD 2AT1B 3DI6A 4F4YA 4LRFA 1PYTA 3D9BA 3BR8A 1HWJA 1Q0NA 5LMNJ 2IA6A 2PFDA 2YKNB 5HJXA 5KFAA 3HD2A 3TJAA 1VIOA 2O3DA 4K5RA 3N5FA 3IG1A 3NBPA 3E3XA 1CG2A 4OYMA 3I0RA 4F4ZA 2DNYA 4WXOA 4C3LA 3AFGA 3EPIA 2V2ZA 2L9WA 2VPZB 4KT0C 4OYIA 1WKKA 1S9EB 4FF4A 2Q66A 1X5PA 3CD7A 3K5OA 2DGWA 3THVA 4O4GB 1RAFB 3NOCA 2RQMA 4JI8F 3HHKA 3SQOP 1ICEB 1GH8A 1AB8A 4QIFA 3R97A 4RW4A 1PC4A 1GX5A 3KLVA 3Q8PB 4WP3A 1J27A 5GAGU 3UWTA 4I2PA 1S6QB 3QFWA 5IT9U 2HSEB 1TUWA 4KR0B 3NOGA 1EX8A 2EFPA 2HMIB 2H4WB 2B9XA 1A6LA 4ZVHA 4RNMA 5LJ3Y 1RT2A 3VF0B 4EU0A 1JLBB 1H2TZ 4RO0A 3JQKA 2B56A 1AFJA 1QE1B 1LKZA 2KHCA 4N47A 2QL9B 6FD1A 2YPYA 5D0EA 4EBDA 4LSNB 3T5HA 1DY3A 1IR1A 3NCPA 3PR5B 1KFSA 1SJRA 3DRRA 3KLIA 3R9LA 2XMTA 1JLQA 3Q22A 2HHHJ 1MU2A 1UAWA 4TYBA 2AGPA 4IRKA 3M2VA 4NX9A 4TY8A 2W4PA 4UY8T 4J9MA 2L9NA 1OWXA 1C0TB 2JVRA 2ZH1A 3T5KA 1S49A 1NO8A 2KFYA 4F50A 3ILIA 5D0HA 5KT4A 3M6UA 1OQ3A 3GE9A 4PYDA 4DCPB 5DQIA 1GTHA 1NSKL 2HFVA 2HS3A 2PA8D 1KP6A 1UMJA 3P4UB 1EIYB 2PO4A 4BWJA 1Y3JA 4JB8B 1UFWA 2VDHA 3TQ1A 2PMWA 5B0AA 3NL0A 1MN9A 4CI0B 2Y8WA 2MY7A 3GSIA 1C1CB 3V4IB 3EWGA 5A8WA 2L08A 3J7AN 4DL5A 5DGBA 1HARA 3HK2A 1S9EA 3BM7A 4DZ6A 1PJ7A 3BQ2A 2AMCB 3J7A1 1SQFA 2P9EA 4K4TA 3PVXA 1NDCA 3GP9A 3ZC4A 4O4GA 4OHWA 2M9KA 4MIAA 5ETVA 2MB0B 5L39A 5KFGA 2JJ4D 2HWHA 5D6GA 3PHEA 4WU2A 1YIJS 5H9EK 3JSRA 4UY85 1CJUA 1U6FA 2D69A 3H25A 3HVTB 3CDAA 2ASYA 3KK1A 1F3FA 4NCAA 2RDJA 4I2QB 1B70B 4PG5A 4OJGA 3C16B 1Z1ZA 4ZVOB 2ZM6F 1MSWD 4XK8C 4WK1A 3Q8UA 4ZA1A 1BC6A 3T6JA 1FHTA 3G6YA 4HH1A 2CQDA 1FERA 3UD4P 2BJ9A 3RUBL 2JNJA 1YWXA 5KFVA 2BKOA 2HRYA 4OIXA 3KDOA 4F3OA 2F4VF 2E1MC 4LBPA 1SC1B 3I32A 2QA4S 2AD9A 3SDEB 2Y3YA 1RTDB 1VRTA 3V5RA 3KYLA 3I31A 2COLA 2KN4A 4TVAB 2QLWA 4ANCA 1K9MT 1ZA2B 2DIUA 5IT0A 5KFQA 4DV6F 3CC4S 5L1KA 1BQMA 2HNYB 3W2VA 2XS7A 2XWXA 2HGMA 2AHOB 3IG1B 3NBPB 4RU2A 1QAJA 3NWRA 5AE3A 2OPSA 2YX7A 3N28A 4CLKA 2YXLA 2DNKA 3I6PA 3GR0A 4BC9A 2G9OA 1N88A 4F67A 1VQMS 2D1CA 2EBEA 3J7ZT 2C2MB 3KJQB 1B7FA 1HHSA 2MQOA 4KJIA 2HFNA 2FIUA 1H2UX 4YDDB 1RBLA 1ZA1B 5EWFA 4QOTA 3HJFA 2KXHA 4X2BA 1YJVA 4OX7A 2GAGC 4RJVA 3HVWA 3RU0A 4B9TA 3NGSA 1S1UA 4J9VA 2FJVA 1EETB 2BEFA 5ETTA 4X4RA 4FVCA 1FWPA 3DRXA 3KJNB 4DLEA 1TR0A 2QYGA 2CVIA 3EDQB 2F65A 1XWLA 1VCTA 1J5EJ 4WKYA 3VAHA 1TFYA 1S59A 4R8UA 1U0SA 3HVTA 2HIQA 1KBRA 1XK8A 1ZOTA 2Z58B 3FSXA 4KY3A 1WC1A 1LNQA 3CTRA 1R6VA 2M4MA 3CVKA 3H2UB 1UA0A 2RT3A 2PIIA 1PYOB 2MKIA 1QAIA 3SZ2A 4Z37A 2DXFA 1RQ0A 2W8LA 1TL5A 4FN5A 4ETZA 2ACMA 4DR7J 1C0TA 1OPIA 1ZZFA 5BYQA 4B9MA 1YBUA 2R7OA 3OQ2A 3DLEB 4ES2A 2YPZA 3BZQA 4MFBA 4DV4J 2OMLA 3O2IA 1T0TV 3M4XA 2FVCA 4N77A 1I94F 2QV6A 1D0EA 3G9CA 1H0HB 1XTZA 2FC8A 2NZCA 2XNQA 3M32B 2XI2A 5A0YB 2C2ZB 4NLOA 2N4DA 4HHJA 5A8KB 4WKRA 2GZOA 4RUAA 3MMBA 4EGLA 5KFTA 3WIUA 2G0JA 7FD1A 5MLCV 4J9LA 1FT8A 1WUUA 4NLPA 4OZNA 4O44B 3RAXA 2H1YA 4WFAQ 3OR2B 2MQLA 3WC0A 2YNGA 4M5DB 4J9RA 5GAEI 5ETNA 3OW2R 1XNQJ 1O51A 3HHLC 4K0KF 5D0RA 3BV8A 1S0MA 2QA1A 4CLUA 2CADA 3KK3B 2R42A 1S9FA 3J7YU 3RRKA 1HNXF 4ZN3A 1J5EF 1RHRB 1RU1A 1ZETA 4I4BA 5DM7Q 3SQGB 3TW0A 2NLWA 4C8KA 1ITPA 3POTA 1BMQB 4OHZA 2QGFB 3JTPA 4TU7A 3TVKA 4OI0A 1L3SA 2E5JA 3M2UA 3BQ1A 3TNVA 3BO4A 3B78A 4ZVSB 1RAIB 4FNHA 1PJ5A 2YQ3A 3TJ9A 2C2DA 1DHMA 3FBEA 1UW9A 4DR7F 3MAAA 4DX6A 1WI8A 1RACB 2CNLB 3CCUS 4DQRA 1HI1A 1HQUB 3UDCA 2UXCF 1EAYC 5IV3A 4HACA 1UL3A 2DHSA 4DR3J 1MROA 2OTJS 3EVMA 3M8QA 1REVA 1X5SA 4JV0A 1KDNA 4MFBB 4Z2XA 1R27B 4C4WA 5LM7E 2XMKA 2KZZA 3JAMU 4JYAF 1FRIA 4I6AA 4KC5A 2HYIB 3TVZA 3OL6A 3GYGA 2ERRA 4DG1A 1TELA 5ETQA 3AHPA 1LQ9A 3OLAA 2PMHA 9RUBA 4RR5A 5AXKA 5E33A 3PRVA 6FDRA 5F8LA 2IY5B 4LF2A 1JLGA 1WF0A 5L1JA 3MWBA 1HNZJ 4Q8EA 5I3QA 5ETOA 7AT1B 5IS2A 2J0XA 2ZM6J 1VQLS 2DY9A 3A8IA 2UVWA 1UZDA 3JSYA 4OX9J 4FS1A 2R4FA 5KFWA 3J80U 3DGVA 3S8SA 1NK9A 2OKQA 3PX4A 2RILA 3LGHA 4CLZA 3C6UA 1YGYA 1SJFA 1S1WB 3PNIA 4PWDA 1AA1B 1QSSA 1SJQA 3TQEA 4DPUA 1WSRA 1KOHA 4ED1A 2DRBA 5IM0A 9ATCB 2HNDA 2XLKA 2HFOA 4RUBA 5BJRA 1TKXA 3MFHA 1YJNS 4NA3A 3P5TL 1EP4A 4P6QA 3V4MA 4F25A 2VQFF 1KTVA 4AXIA 1WF2A 5KT5A 2DGTA 1AXQA 2ZBIA 4L75A 4P72A 4F3MA 1DARA 4DR3F 1KOOA 2DPJA 2GVZB 2NXUA 3CC2S 2ASJA 3NG8A 4F8RA 3PW5A 1U6BA 1F2GA 2Q43A 1R8PA 2A10A 4C3MA 4ED2A 1PIEA 5ITHA 4RW7A 5LXRA 3MMBB 3Q24A 2Y8YA 2UUWA 5AE1A 3MPVA 4KYZA 1ZM4A 1MMNA 2FZGB 3SYZA 2CPHA 2ZFHA 2W2NP 3R7NB 1DLOB 2PA3A 2NXNA 5M2UA 3W9HA 1HLWA 1I94J 5BYRA 3QNWB 2Y1RI 3SSRA 1N5VA 5KFZA 3F56A 4LF9F 1QVFR 3HFKA 2KM8B 2HQDA 3DLKB 5LT5A 1VQPS 1NJXA 1S0VA 2EWHA 5CH7B 3SIPB 4QU7A 3FZBA 2VH7A 4L3KA 4TU8A 3C19A 2F8HA 2L9DA 2YQ1A 4ZLLA 4PZVA 3X1LB 3KG4A 3HDSA 3TZWA 2VASA 4QWDA 4JI0J 3TUJC 4JI5J 4L72B 1Y4ZB 3NAIA 3CWJA 4PKDB 3MR2A 5FIIA 4FYXB 3GJSB 1JLAB 2W2MP 4M5MA 4P52A 5JMNA 2K7KA 1FWLA 5B0GA 3CCMS 2I38A 1HNVA 3F73A 3H5SA 4LSLB 2P5VA 2ZBPA 3ET6A 1NBEB 4OI4A 3QT8A 3AD8C 3DOLA 3QLHA 4GRSA 2ZVIA 4USTA 2JSXA 4UZCA 3EVWA 1V3SA 5GAEU 2J9EA 4RWXA 1RXOB 5KFCA 4WFZA 4X66F 2ZD1B 2AJ2A 3QRQA 4M5LA 1UVKA 3PKMA 3MECB 5JJBA 4DDFA 3W60A 3TP2A 4I7FB 3E01B 1D3WA 3LA0A 1CSJA 2DNOA 2UUCJ 4CTAB 3HSDA 3GFHA 4X4SA 3BJYA 2ZH3A 4C8NA 2UUBJ 3K89A 4IQMA 2A2DA 3K17A 1X9WA 5ETKA 3MCNA 3VAIA 4LRCA 8AT1B 1HNIB 3ZTOA 4K50A 4FBTA 3SXLA 2MQPA 4ECSA 1M0SA 3QIDA 1K8AT 1RTJA 3BPSP 2F40A 2C42A 2CZVC 1VQOS 1T05B 2UUCF 3T41A 4DWIA 3DGPB 4LIRA 3IS9A 3AB2B 2KT2A 3D54A 2WBMA 1FTCA 3RJMB 5GAHU 3PIPQ 5LMUJ 1IKVA 2EFQA 2RVJA 1AZSA 3B4DA 4JOUA 3ZZTA 5J1PA 2ZJRQ 2DR7A 2RB7A 4M5JA 2JOQA 3A3OB 1R8BA 2CAJA 3C14A 4LFBJ 1RABB 5EHHA 3TARA 2KDOA 2LQ8A 4Q7AA 1WEZA 1FE4A 1VRQC 3VVUA 2GVDA 1TL1A 2ZE2B 3FMBA 1YJ7A 1M5SA 4TN2A 4Y2MA 3KJVB 3TAPA 2FJAB 2AKWB 2D7SA 2V8PA 2RD5C 3IGNA 2OELA 3CJ3A 3IWLA 4RBUA 3Q0AA 3RRGA 2QL5B 1NM2A 2XCPA 1X4DA 3Q89A 2XO7A 4ZP9A 1D8ZA 4A8KA 3CIZA 1EETA 3UCGA 1Q86T 4R5PA 4FF3A 1FKAF 1N0UA 2WAQD 4USMA 1HHTP 2E9ZA 1E6VA 1PAEX 2ZH2A 1G2EA 2GCFA 1O8BA 2GO9A 2LMIA 4K4SA 1NCLA 4Q43A 3UN5A 2W4CA 4RX6A 2K8GA 5HMXA 4ECZA 4FXDA 2VG5B 1JKHB 1UETA 1TKTB 2AIRB 3W2WB 3BH6B 1SJ4P 2I5JB 3GQCA 1EKRA 4ERDA 4TXSA 2AJ1A 2CG8A 2DH9A 1T9YA 1FRLA 4DV3F 1LWEB 5CD4A 2EFVA 1WSVA 4AE5A 1FX4A 1JNRB 1RYSA 1FKOB 1RA7A 3GG1A 3TRGA 1RGVA 2MJNA 5HANA 2HNZB 2YWFA 3S01A 4N5SA 3IRWP 3DLKA 2LKZA 1RHJB 1SBRA 1KR4A 3VV2B 2LEBA 1XNQF 4W90B 4WYLA 3QIPA 5E7OB 4ZJLA 3CCQS 4PWUA 3FBCA 4TLQA 1H98A 1X7VA 4DU8A 1VHFA 5HSPA 4UQGA 3VGUA 1U2FA 4QPTA 4ZPTR 3VWSA 3BN7A 3FUYA 3K58A 2D3UA 3DKDA 1NJWA 4X66J 1NSQA 4DS5A 1FRHA 4PPZA 2B9YA 4KHPF 1RWWB 4OJ1A 4ES3A 3T1AA 3IAM9 4K5SA 3GV7B 3EXYA 1NZ8A 2X1AA 1H2VZ 3DU6A 4OZLA 3WHIA 4P71A 4KGXB 4EBEA 3OL8A 2ZBQA 1TKZB 1B0VA 1KLMB 1SJ1A 4YR3A 3MAAB 4MKYA 2EVZA 2LEPA 3DCAA 3E51A 1DFDA 4LRDA 5DZ7A 2HHWA 2V9KA 2ZKTA 2CZ9A 4ZPVR 3TUIC 4ZPCA 3M8RA 1ZBTA 2RRAA 2IM1A 2VPYB 4ICLB 1VDHA 3PYDA 3BGUA 2CPYA 4DV1F 3GFZA 4ECVA 4DR4F 3KUGA 2QL7B 4JI3J 1YLXA 1NH8A 2J8SA 5HI7A 3W5YA 5DZ6A 5D15A 1Q7YT 2FY1A 2AF6A 5CYQA 2UV8A 3M8PA 2CWXA 3A12A 4DG1B 2LYVA 1NPKA 4G1IA 3HMJG 2O01C 3MFIA 4V19J 5KT2A 3BSAA 3W1YC 4H4KA 1UKUA 4A47A 5IWAF 2VQEF 3VTIA 1S97A 3MMAB 4RBVA 5GADI 2AYBA 4LF8F 4USUA 5HVHA 4O4RA 1W2IA 4HACB 4HH0A 3VVTA 3KK3A 4G1PA 1KKHA 2MQ8A 1PYSB 1RT7B 1V9OA 3R6GB 4IDKA 3U02A 1VQSA 4A48A 4DFPA 1YJWS 1M5PC 2R7XA 3FSIA 1B3TA 2EW9A 3HSZA 4A8OA 2B8PA 4KFBA 4C7QA 1LK5A 3DYAA 4JI7F 1UP1A 3BGRA 4IH6A 2K1RA 3LH2S 4AUKA 1NAQA 3KK2A 2O67A 1YZ7A 3FDSA 4JI5F 5HQ8A 2ZHOA 5B7WA 1T9WA 4DV6J 4A8SA 2AGOA 2QEXS 1TK5A 3OTCA 3RGIA 2VA2A 1IJFB 1BE4A 1RI7A 4ZIWA 1WOOA 1YVFA 2ASLA 2XBPA 2ZH9A 1QJHA 3D6HB 4HI2A 3GIKA 3T5JA 3FQKA 3I5AA 2UUAF 4Y34A 2OHDA 5F9NA 3M8WA 3KK1B 2VJUA 3C46A 4MMOA 4RNOA 2FGOA 1JQGA 5F8MA 3PM9A 1WC4A 2GVZA 3O5TB 4J9SA 3RB0A 3RR8A 4C98A 1Q82T 4C11B 4HTIA 4IRCA 2RDDA 4NCBA 3AY0A 4HTJA 1HI0P 4CZCA 3N6LA 4DFMA 3B82A 1HNWJ 3ZTSA 1V3RA 4EYIB 3R2DJ 4WU3A 4RU9A 1T8EA 4DQPA 1FX2A 1FDDA 1KWMA 2G1HA 3UDLA 2AQ4A 1DLOA 1GFWB 4ZCMA 2D9PA 1SXLA 5HROA 3G8QA 4TKTA 2CJAA 3ETOA 4ID5A 2QRRA 3BDPA 4KAIA 4MAKA 2E9RX 1S57A 2RE1A 2KYZA 1RTHA 4N8NA 3R7SB 3W5ZA 1X8DA 4WTOB 1OS5A 2HG4A 4AFFA 2XMVA 4LF7J 3AJ2A 3B54A 2Z2ZA 2FLPA 1XERA 1W26A 3H5UA 4KHPJ 4P74A 5BR8J 1F5AA 5K8MA 2EXUA 4M94A 1ZAWA 3FCWA 5J1NA 2BE2A 4NA2A 3ZZUA 2FB0A 3UW1A 2WB1D 1Q4RA 1RTZA 4QPXA 1Q8BA 4IFVB 1C4CA 1MMDA 1LV5A 1TKXB 4DSEA 2FDNA 4K4VA 1IWAA 3R5BA 2VOOA 3AXKA 5AXLA 2WBRA 2HHHF 3Q8QB 3DDNA 2ADBA 1SPBP 5I42A 1TL7B 1B0PA 2B4VA 2J5AA 2YWGA 2DNMA 2NUUG 2VG6B 4KRWA 2MQMA 1BD6A 1XR6A 3THPA 2ZDOA 3UI3A 4A8WA 1FJGJ 2JWNA 4ZJOA 4RPFA 4KTQA 2HVHA 3PX6A 4OYPA 1RK8A 2MJUA 4I2PB 2UVRA 3D0HE 2KT5A 3HJVA 3TA0A 1TL3B 2RIJA 2V6AA 4CRJA 1QTNB 5THWA 2MKSA 2MMYA 5KG2A 2RJZA 2HLTA 1JLBA 4YS2A 4FPIA 3U7JA 2QN6B 3EUNA 1N33J 4G6VB 2ZBRA 5LOQA 2CPEA 3L7PA 4PQAA 4O3NA 4DPYA 1SKSA 2CRLA 5GMEA 1NJIT 4DSIA 2H54B 2XYPB 3VHQA 4AXJA 1WWHA 5KFPA 1CJKA 4K4XA 1GEHA 2ZH8A 4NLQA 3UFCX 1S6OA 2C2NA 4ECWA 1XQIA 2NSCA 1URNA 3HX9A 4MKAA 2XQCA 5IXUA 3KTQA 1N33F 1YKWA 2W9BA 3IWXA 2FJXA 1UJ5A 1HFEL 1UVJA 2ATLA 1WDTA 3BKUA 3BREA 4B3SJ 1ZS6A 1TZ0A 4OYWA 4FZVA 3NLCA 3W9JA 1LFWA 4C6AA 4O0IA 1GK8A 1G3OA 2RQKA 2OIHA 4ATNA 2J6TA 2APOA 2VG7A 3ET6B 5K8OA 2KH9A 1MLAA 1U09A 1Y0HA 1OMSA 3AAWB 2BYCA 1RHKB 4JI3F 3DOMA 3LO3A 1RAAB 3R5GA 3MDFA 3U1MA 4K0KJ 1SCJB 2XLJA 5CABA 2GIQA 2IC3A 3ADAC 3RBDA 2XZTB 1UW4A 2BDPA 5J1EB 2JFKA 1Z2LA 2YKAA 1R43A 4NMLA 3WC2A 3DM2A 2J0QD 1P1LA 2J9DE 5EWGA 2VB6A 2P6SA 3POTB 3MEGA 4I56A 3FCHA 3M8YA 1S1XA 3Q2SC 2VV5A 4QU6A 4AL6A 1EARA 2LU1A 4WFNQ 1T02A 4X4PA 3BB5A 1NH7A 1HHQA 1X5TA 1MWZA 2ZVSA 3H2VE 1GNKA 5CQGA 1XC9A 1WEXA 2OI2A 5B0CA 1DZ5A 4HHUA 2AGQA 4ELUA 3EMTA 3MPUB 5DRKA 3IC1A 3D66A 2F9DA 1R8HA 4WE1B 1SV5B 1N52B 3S1TA 3HP6A 3G4SS 2I1RA 2WTFA 3CCVS 3QPIA 2WSEC 2HQIA 4K4YA 2R8GA 1V3ZA 4UOFA 4ZK7M 4J7CA 1NJZA 4F2SA 4YY3F 5K9FA 4RZRA 4PG7A 4QYZK 4DPWA 1HPZB 4L74A 4XO0A 4HL9A 1CJTB 3QRRA 2BM0A 3WX8A 3OR1A 2M8DB 5K5MA 1FEEA 1UCNA 1TTHB 1T95A 5L38A 4O3RA 2F8MA 3CJKB 2E66A 3OL9A 5KG1A 4ZVTB 1N32F 1KFDA 3GZ7A 4RW6A 1KQKA 4NYZA 2JHEA 4FYWB 1SC3B 2MKCA 2J76E 1PBUA 5D4NA 2WZ1A 2JVOA 1FD8A 1Q78A 3M1VA 1YHQS 2FYXA 3NGRA 4QIGA 4WFXA 3BKFA 3D68A 3K0JA 2QMWA 3BDEA 2MDAA 2E5GA 2HVDA 3AQPA 2ZH4A 4DUTA 2R8HA 1WACA 3PV8A 2V0NA 1M1GA 5F41A 2ALZA 4HT5A 3OBIA 4PRFA 2E1AA 1IKWA 5J2QB 1I51B 2W2QP 4CH0S 3JS9A 3OLBA 3M8PB 3OV7A 1YK9A 4E8UA 4M5IA 1G6BA 1WKLA 2QSFA 1TQLA 2V2VA 1LWCA 4LSLA 4B3TJ 3RW6A 3CCLS 2F63A 2ZOMA 3FEYB 3CGIA 3DHXA 2CQ0A 3KG1A 4F0HA 1JLCA 4DMZA 3BN4A 4B02A 4U67Q 2W01A 4Q45A 3PHTA 3QWUA 4USHA 5B08A 1Z2ZA 4HDHA 2YNIB 3HT3A 5A76A 4UUXA 2VF3A 2YTCA 2E5IA 3LAKA 2A6MA 3Q2TC 3R5DA 3VCDA 2K06A 4U7UD 3MAQA 3PEHA 4Q0BA 2IMWP 3KK2B 1RISA 5KFFA 2DT9A 2B9EA 2WSCC 1JLAA 2QYCA 2HPUA 4ECQA 4CO2A 4DX8H 1SI9A 5AXNA 1FCAA 3R5CA 4G1QB 2MPUA 4D3GA 2MGZA 5B09A 5KFKA 4DL4A 4M5DA 2H9ZA 1K1QA 4TYAA 2G0CA 1D09B 4PCQA 1RHMB 2DCLA 3RB4A 3LGMA 2DGQA 1B4SA 2J9DA 2KRRA 4MIWA 3W64A 1FJ7A 2BM1A 2BJ8A 3N4WA 1NDLA 4NI2A 2D74B 3IBCB 3MECA 4WYWA 4ILLA 5IC6B 5F8JA 1KVKA 2GV1A 3NS7B 4LF6F 4I6YA 3MHYA 1U25A 2J7WA 3FFIA 4NLYA 2VONA 3VAMA 4QWBA 1ZZNA 1VLYA 1HYSB 1DJ0A 3M2UB 4IQXA 3TUPA 3R5AA 2NYHA 2DB1A 4LSNA 4CO5A 2DNHA 5KFXA 1HBNA 1Y7PA 2QA2A 3EGZA 2OAUA 4EWTA 3FGVA 3ISZA 2WVDA 4TY8B 3H98A 3DRPA 5JXSA 1J2VA 5CCMA 6AT1B 4A8YA 3VAKA 2MHEA 1SKWA 4CTAA 4X65J 1IBMJ 1REVB 4I68A 1JJ4A 4U8YA 2HHPA 1SUQA 3H40A 3GG0A 4B08A 2DHHA 3CSKA 5I3PA 3NAHA 2CQ4A 2RKIB 1IBKF 1U7LA 2R2SA 1XMOF 1LWEA 2N7YA 3MTKA 5KG0A 3ENVA 4UOCA 1QVGR 3PYGA 5H1SV 5KFYA 1GXUA 1ROFA 2Z4PA 2RQCA 1Q53A 5J2NA 1BWEA 4F02A 2VFSA 1NK0A 1L5UA 1DQ9A 2MKHA 4EYHB 2H51B 3M2RA 2LQBA 2B4OA 1FFSB 2FVPA 2R7QA 3ILLA 4KPCA 4KV8B 2E7VA 5K14A 2ZHBA 2ZJPQ 1IBKJ 1KNZA 4GKJF 1FXDA 4DX5A 3TYTA 4F3QA 4KIAA 2XULA 1ZPVA 2BE9B 4LRBA 2BE2B 4LUBA 4C2MA 3UR0A 2W9CB 4ZHRA 2IVYA 3RG6A 4EFAC 3D1OA 1YI2S 2AJ4A 3QMQA 3OTDA 1S77D 2MZTA 3EXCX 4RL1A 4U7UK 2HNDB 1RHUB 4QWEA 3SV3A 2WB4A 5KOXA 3N6NA 3UQSA 1KLMA 3I96A 3QZ7A 2XC9A 3LP2A 1FK9A 3K8VA 3ULHA 1RDRA 3EZUA 3IRXA 5CAAA 3UN3A 4TU9A 1H72C 2YY3A 2Y1IA 2Q3PA 2R7UA 3D67A 4WJBA 2WONB 3ISNC 2I5JA 2LLZA 3BSCA 3I4HX 3NS5A 5T41A 1S1VA 4EUVA 4WFBQ 3K57A 2PEBA 2W9BB 4X64F 4ZN1A 3IWNC 5E3AA 4P10A 4DL7A 1K47A 3PY8A 4X4NA 4IG3A 4R0EA 3MM6A 1HL6A 1FDBA 2AV5A 5E3CA 3NS6A 1WJ9A 5I4MA 2C3UA 3DMJB 1WTBA 2AYEA 3HXMA 2VG7B 4CIOA 3WQPA 3H2LA 3Q86A 2F9JA 2R7SA 4OZ2A 3ILJA 1N5TA 2KXNB 5IQQA 1RAOA 3TZXA 3NMRA 1S12A 4X64J 2RRBA 3SV4A 3BR9A 4ZOSA 5JUMA 4HYKA 1ZAVA 1N4LA 2G4BA 3N9UC 5FLXY 1U2RA 2CZ4A 2GIFA 1BQNB 4ED0A 3LANA 4IR9A 2LVWA 4HVZA 1CEZA 4KGMA 2H4YB 3GYNA 2C3PA 2XEXA 2I6WA 1YRXA 4CH7A 3NNCA 1WD6A 2OD4A 5J2MB 1HYSA 2Z57B 4LF6J 1PC5A 3LUYA 4OYAA 3CW2C 5F3ZA 4C8MA 1BXNA 4YDXA 3AB4B 5KG6A 1WG1A 4NZ7A 4B3RJ 5CZVA 4ZVQB 5D8HB 4QJVA 1FTRA 2CPZA 1TL4A 1S79A 2V2KA 2HQCA 3DXSX 4QZVB 2BRLA 4ZDNA 1VOMA 4OI3A 5E3PA 3MOZA 2DISA 4ZPDA 4PABA 3K5MA 5FDLA 4DFKA 2ZEJA 3GR1A 3V81A 2DCUB 1Q8LA 1YJTA 5A6PA 2FZCB 3MD3A 4JV5J 2M7SA 2RDIA 3NGDA 2OPRA 3VGVA 4QR2A 4HKQA 1B99A 3FVYA 3JXOA 1SIWB 1AW0A 5IZHA 3GV8B 2FJEB 2P2CB 3G82B 5C2CA 1HWUA 2EKYA 2OPQB 3MR7A 1Q5VA 3OFFA 3OXLA 2DEJA 2OEMA 2DGOA 2W2PP 3RBEA 1PGZA 4IOBA 3VZIA 4ZPAA 5BXIA 4QCLA 4I6WA 2ZZTA 4ZPWR 2FJBB 3QGHA 2KI2A 3KUHA 4F36A 4WXWA 1CPZA 1AT1B 1RTJB 2BACA 2BQ3A 4NOHA 3U27A 1DBDA 2FLOA 1OPZA 2E44A 1NHVA 1P8GA 3T9NA 4MK9A 4F4AA 3J81Y 1AZSB 5LSOA 3FEXB 2MLXA 1M5HA 3BEGB 4LF5J 4Y2CA 4V1Ak 2UP1A 1LWFA 4N41A 2DKOB 5DG9A 4EBCA 2QTWA 2JRSA 2DGSA 4OYXA 1JJ2R 3KJVA 1FJEB 4Y2IA 4X62F 1KQFB 3IR7B 2LA6A 2MQQA 4IFVA 4M8LA 1WOPA 4ILRA 5KFRA 4YR2A 2VOPA 2FJDB 3US5A 5GMKa 3G6ES 2EEYA 3IRXB 4ID8A 2MXYA 2CJXB 5CD4H 1Q7LB 4BCAA 1S6QA 2IM2A 3MAHA 3RW7A 5HROB 4WPAA 2W8KA 1R0AA 2IAJB 3MGJA 4DV0F 1VQ9S 1VI7A 3KLHB 4FNIA 5D4OA 4ED7A 2E5LF 3EZOA 1RTHB 2X3DA 3P3DA 3NMAA 2B4UA 3MEDB 3OR1B 4H54A 5T7LA 4MTPA 3PFEA 1G7CB 5LL6d 3GILA 1Q79A 2VFVA 2M0GB 2C2RA 2DXEA 1S0OA 2VFTA 4UTGA 1HKAA 2C3MA 2CWKA 3QGIA 3OTOF 3O8WA 1KQSR 1GMVA 3PXGa 1B0TA 2XSFA 5E3RA 1JLQB 2OFGX 4C0HA 4ZP6A 3KLGA 5F0WA 2LFVA 2VL1A 2XMJA 4KO0A 1T3NA 1T05A 5A8WB 3J7Z5 1JLCB 5LSRA 4Y2KA 1M90T 1RT5B 3MR5A 1QAXA 1KN6A 5HP1B 3I82A 2CDRB 1WKJA 2GA7A 3AJDA 2XYHB 1W7WA 3FNNA 3PJWA 4M5GA 1JLFB 2HZVA 1V6HA 2FD2A 2IFXA 4R0JA 2RHSB 2YWWA 1D9AA 4JI2F 3QT5A 4OI1A 4WP8A 1RA6A 1X5OA 5C42A 1RT3A 1KC8T 3NNHA 1FDNA 4LR9A 3FBFA 1TVRB 3MM5B 3PTWA 4XDCA 3ZZYA 4DJBA 3K5NA 4HHHA 4I2QA 4FP9A 2RF2A 2HHSA 5G0RA 4OQJA 3KLFB 3LF0A 1SL0A 1NKCA 1G1XA 4DUZJ 3Q83A 1FVQA 3TZZA 1FFWB 1HQEA 1EZZB 3AXMA 3KDNA 3MMCB 4PG6A 1L3KA 3SCLE 1BWVA 4ZITA 3MUVP 4USJC 3DOMB 5CZXA 4JI0F 2OSRA 4ZLJA 4MKBA 4AT1B 1HBNB 2VPXB 1FD2A 1VRTB 1WOSA 1XMOJ 2ZC3A 1YTYA 3FK4A 3HHLB 5KFSA 3H20A 2XHWA 2PMZD 4CO4A 5KFUA 4PQUB 4X4TA 2O5DA 3AA8A 5ETRA 2C2EA 1F0XA 3BBBA 4ZS6A 2FHOB 4CQ1A 2W7OA 3FBBA 3JSMA 4K4WA 3DLHA 1TUGB 3H8YA 4KGKA 4W4MA 2B5JB 3CJ5A 5DETA 1WHWA 1RT1B 5KAKA 1PBAA 4UF4A 1O0PA 2V4JB 3TANA 4AQYJ 2ZC4A 5GADU 1U0HB 3CCRS 1R89A 3QWPA 4ZVFA 2VJVA 4CCHA 4WF9Q 4DV5F 5EWEA 4KH1B 1RT6B 1U02A 2VKRA 2QLJB 2RUGA 3F44A 4LF1A 4IO9Q 1JJHA 2DY1A 4LMZA 3T1YJ 5T14A 1JLFA 1UJ6A 2LU2A 3H0PA 2MZJA 2LDIA 4DUYJ 2U2FA 3IR5B 2IRYA 5GMDA 4DEZA 4DPTA 4ZCIA 5I3UB 3C16A 4NXNJ 2MTLA 2BKNA 1HBOA 3QO9A 5HAOA 1RCOB 5A2QY 1IKYA 3IO1A 3OTBA 1URRA 3JYTA 1S1XB 3NXZA 3KG0A 3FQLA 1P1TA 1RBAA 3DLBA 3BH7B 1IUJA 4PG4A 3T6BA 4EK2A 4XDDA 4GC7A 2LQ5A 5LMNF 5C24B 4LFAJ 2G0IA 2MLYA 1EP4B 1VYAA 3NEKA 5F8GA 4XIUA 3OSPA 1T94A 1HNXJ 2RSQA 3QBCA 4C97A 4JV2A 2IC3B 4RW6B 1RTIA 5K8NA 3H5XA 1VFJA 2CPJA 4JI1F 1SQEA 2GC8A 1JX4A 1D9DA 4J9PA 1FRKA 2KB2A 2W9AA 2HHTA 1VQ4S 3GU0A 1LW2A 3TAQA 3OFHA 1NRKA 1VMBA 5A8RB 2KKHA 1RTDA 4JI8J 3AA9A 4EMDA 3OVSA 1MWYA 2YWEA 3HHLA 1EJ7L 2OTLS 5D3GA 3E01A 3P5BP 2ZH5A 2HS0A 3TAMA 4DF4A 5BR8F 2GX8A 2R2TA 3R1LA 4M5KA 5K8PA 1K73T 4KO0B 1VQYA 4CO0A 3MF5A 3EPGA 2HBYB 3OXFA 2W4DA 5AXMA 4B3MJ 2Q79A 2W24A 4QW9A 1D8YA 4P73A 4BWMA 1CC7A 4K2XA 1HNIA 3LP0B 2CVEA 2RS8A 3K7RA 4J9KA 2Y9HA 3AOBA 1S4FA 4PXBA 2N7CA 4WK3A 2LA4A 2XGPA 1S9GB 1BHNA 1VQ5S 3C3LA 2QMUB 3DYAB 3W3SA 2DO4A 4LJMA 4R8UB 3O3LA 3L7OA 4Y0FA 1TVRA 1CS4A 1RADB 1NPPA 3MM5A 3G8TA 4XTTA 3ELHA 5A8KA 2XS5A 3BBFA 4NWBA 2B7CB 4ZP7A 2EI5A 2RF2B 2NPIA 1O5JA 3OHAA 1N56A 1FJCA 3W65A 4H4MA 2Q6BA 1SKUB 2HGLA 3PJXA 4B9UA 2MY8A 2CNOB 2O1PA 1OQ6A 4OYZA 1FF2A 1PILA 5D77A 3CCES 2M3DA 3DHWC 1RWVB 3A8JA 4RW4B 4F4WA 3CD6S 2BKPA 2DR5A 4OL8A 3RR7A 4DSFA 3FKBA 3M2VB 3NKYA 4ZVUB 4ZJQA 2PFFB 2WONA 2DR6A 1BY9A 1M1HA 1U1RA 1E6VB 3L95X 4QIWD 4E98A 2OH2A 3MD1A 2KHDA 1PG5B 2LXUA 4C11A 2K7JA 5IQ6A 1X9SA 1MWQA 2HS4A 3R27A 3DFEA 1H74A 1IR0A 3W2WA 2XNRA 2RQ4A 3OVBA 2ZH6A 1TP7A 1YZ6A 2EFGA 3PYFA 4DI6A 1S6PA 1DQAA 2LP4A 3NGKA 3VAFA 3D6FB 3RB6A 2Y0SD 1FA0A 1FXRA 3EGNA 4L3NA 5KFDA 2VBYA 3UNYA 3BBCA 4LF5F 3D3BJ 1U8WA 1TV6A 1XMQJ 3QAUA 2GHWA 3L4BC 3R8YA 2HHQA 1HA1A 1CJKB 1T11A 1H3DA 1LK7A 5C2GA 1SL1A 5KT7A 3LP0A 3D5MA 2VBXA 2CXEA 3QIPB 4CH1A 1RKIA 2EC2A 3RZAA 3UVJA 1RWPB 2GMJA 4IH7A 4KE5A 5LSLA 5EDWA 1UA1A 3IP0A 2BANB 4UOHA 1FWKA 4LQ9A 4MYUA 4FKYA 1Z4UA 3H59A 2R7RA 4F0KA 5H9EJ 2HMIA 5HJYA 2BX6A 2WVFA 4DR1J 4DR5J 4Q0BB 4C8ZA 4YB6A 1DTTB 1R0BG 1JLGB 2KXFA 2RAQA 2DNZA 1Q8KA 3JTNA 4CWBA 2V4RA 5C24A 2LXIA 3BGOP 3ICLA 4CYUA 1CLFA 2OFHX 2FPHX 3J7YI 5AE2A 2CPIA 4FF2A 1OO0B 2BABA 3PRDA 2V9WA 2RHQB 2DTJA 1TKZA 2QZ8A 4JI1J 2A3JA 4C48A 5EGYA 2GO8A 2DR9A 1VQKS 1N32J 2CQBA 2BE7D 3KJFB 3DRPB 3DLLQ 3CULA 4NRUA 4JV5F 3D0GE 3UD5A 1X4GA 1UWAA 2FZKB 3IGVA 2XY5A 1BGXT 2EBGA 1WHVA 3BGLA 3DLGB 3DC2A 3MEGB 1AROP 2LEAA 3MEDA 2AJ0A 4I1TA 3I0SB 4OZ1A 4RW7B 3TO8A 2OPPB 1FKOA 2MKKA 5E41A 3CPWR 2QFIA 2N3OA 4X4OA 4U9RA 4DF8A 2XSJB 1FNXH 2JL9A 4ZP8A 4DUYF 5KFMA 3AH6A 4NXNF 2CDQA 3EM1A 3DOKA 3FJ2A 1XMQF 2R7WA 4TNOA 5E5NA 3H5YA 4QR1A 2CQ2A 5D0GA 5HATA 2ILZA 2DNLA 3JTOA 5HVFA 1KVJA 3UR3C 5HBMB 1CBKA 2M88A 4DV5J 5J2PA 3DXBA 2JC0A 5CCLA 2MKYA 1SUQB 3UVJB 1SIZA 2OPSB 3C8YA 3M7VA 4S0MA 3IAS9 4ZVPB 4J9OA 4ELTA 1QLNA 1BLUA 1C0UA 1S76D 1S1WA 1K1SA 1YRTA 4GO5X 4IG0B 3M30A 4CNZA 2OJ3A 2UU9F 4URQU 2H3EB 4R25A 3AODA 3HFZB 4JP8A 2UXBF 5M2PA 4RNFA 5DS7A 3QRPA 1R6YA 1JLEB 1TU0B 3IMQJ 1P9YA 4OLOA 3L3CA 2X1GA 4DOZA 1S0NA 3HSJA 4ZIVA 4FS2A 1ZYQA 4P2MA 2DR8A 4U7CA 2GFFA 2VDIA 2V4QA 2CQCA 4OX6A 3P96A 2PC6A 1HWIA 1MG7A 2Z56B 5IFMA 3KHRA 1U47A 2DXDA 2UXCJ 1R31A 2YKOA 1T7PA 4QYZJ 4ICLA 1IQZA 4YOEA 3GLJA 4ZKAA 2IM0A 4M5HA 2XCAA 4DR6F 2IRUA 3THTA 3H4BA 3Q8RB 3KHLA 2DHXA 3MEEB 3HZGA 1RSCA 2AWZA 2KM8C 3KUEA 1N34F 1DAXA 4F4XA 1VBZA 3G2XA 4OHYA 2AEJA 3W5XA 3UCUP 1F6TA 2CJKA 2F4VJ 1LW0A 3J81U 1HW9A 2IMOA 2PD1A 3LWLA 2XSJA 4ZLPA 2VQEJ 3DMJA 3MPDA 4C0OC 2I2YA 3A13A 3IM9A 4ZMMA 1C4AA 1CJVB 2BZ2A 5CYMA 1GMUA 3M6XA 1C1BB 4ECRA 2QIFA 3RAMA 1BQXA 2KVQE 4KHRA 2DNNA 4FYYB 1WHYA 5B0EA 3TOQA 3UDVA 1ZTTA 1T03B 2B4PA 5FDLB 1S48A 1UVMA 1RU2A 4QW8A 2DRDA 2YNIA 3I4PA 4KKOA 2IBKA 3OTOJ 2DGVA 2CJYB 4IG3B 5F3TA 1FNMA 1H73A 2C28A 2ROGA 3SEOA 2IYIA 3JYTB 4DR2F 3SFGA 1W2BR 1F1BB 2HKEA 3MM9B 1X9MA 2V4JA 1YSJA 1RP5A 3N0VA 4EI2A 5KT6A 1HMVA 2V5HG 2J6UA 1RZMA 3GJQB 3H7HB 5GVQA 1SC4B 5FD1A 3PYEA 3C15A 2IJRA 2WK4A 2AP6A 4B3SF 4DL6A 4J5OA 3KMQA 4P7TA 2KO1A 4QR0A 4ETXA 1BQNA 2VU5A 2XZWA 5KG7A 3PEJA 1F5BA 3PFOA 4N56A 1TFWA 1NU4A 2ZUAA 4BS2A 4QBUA 3HO1A 3TA1A 4URSA 2JLGA 2LECA 4DR6J 1EQ0A 1IKYB 1VJQA 3S7RA 3P6YC 5HMYA 1IM4A 2RMLA 2UV8G 3SCIE 1N36F 1KSPA 3K8WA 2HVZA 3DRRB 3KLIB 3UCZP 3QGGA 2GGPA 1HI8A 2JDJA 3OUYB 2OPQA 4U96A 4DFJA 3EYZA 2JEFA 4GO7X 4NLVA 2DJWA 1UTAA 3RBXA 3MTJA 1S7HA 2BW2A 4KBIA 5K20B 4Q8FA 3MR3A 1RAGB 5KG5A 4BC7A 3C14B 3PJ9A 4NLUA 5D3GB 2VICA 3TUZC 2CIMA 3KXDA 2G2YA 4P2FA 2C2OB 3N6MA 4P7VA 2A6OA 2NXCA 3CMES 3UPFA 1G4CA 1IVZA 3CT9A 1QAYA 5A2QU 1RAEB 1SH2A 2ZZNA 3V6JA 1AUDA 2E9TA 3MMJA 1NK6A 2ZWOA 2QMXA 1F9FA 1VS3A 3SSQA 2HRUA 1KS2A 2Z2MA 1ZTWA 3DLJA 2YWHA 5MAOA 4DR1F 4WWSA 3OTEA 4DL2A 1LW2B 2E5HA 1RT4B 3DNCA 4O3OA 5DG8A 4NLXA 3QSIA 3T1HJ 2XY6A 1KRPA 1F2HA 2OGUA 1LXJA 2W7AA 3RB3A 4LFCF 1TKTA 4NI2B 4H4KC 2Q1LA 2XTJP 4DV4F 1LWFB 2HFUA 1GTEA 3B4MA 1VBYA 2VC0A 3C6UB 4OYBA 4UOGA 4X4UA 2QLFB 1UVIA 1PAUB 4WIIA 1KHWA 2DITA 3QFHA 1SH0A 1GAOA 3PW2A 1TK0A 4DV2F 4CO1A 4GKJJ 4ILMA 2NQPA 4OYOA 1NK5A 1U48A 1BUXA 1H7XA 1S4EA 1S6PB 4CLSA 2V69A 3HPOA 3HM9A 2GMLA 1Y00A 1C1BA 4BDPA 1WG4A 2BQUA 2IAJA 3G71S 4WE1A 1WORA 2WOMA 2W7PA 4USIA 4YB7A 3QSYB 2IYGA 3CMAS 3JQMA 4YUDA 4USKA 3W63A 4RUHA 1HPZA 4KH0B 1N54B 1SQGA 4LSZB 4DXLA 3W62A 5KTQA 2K1RB 1Y5LB 4I69A
chains in the Genus database with same CATH topology
2W2OP 1V5IB 3AFGA 3QFHA 2Z2ZA 3GCWP 4NMXA 3A3PB 3GCXP 4OV6A 3WIUA 2Z2YB 3BGOP 3VV2B 2Z58B 3VHQA 2QTWA 2Z56B 1SCJB 1R6VA 3SQOP 2E1PA 3CO0P 2ZWOA 2W2MP 3H42A 3A3NB 3P5BP 4K8RA 3BPSP 3WIVA 2W2QP 2W2PP 2Z57B 3T41A 1SPBP 2W2NP 2PMWA 2Z30B 2ZWPA 4NE9C 4YN3B 3A3OB 2XTJP 4JP8A 1ITPA 3WHIA 3CNQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2O P;  1V5I B;  3AFG A;  3QFH A;  2Z2Z A;  3GCW P;  4NMX A;  3A3P B;  3GCX P;  4OV6 A;  3WIU A;  2Z2Y B;  3BGO P;  3VV2 B;  2Z58 B;  3VHQ A;  2QTW A;  2Z56 B;  1SCJ B;  1R6V A;  3SQO P;  2E1P A;  3CO0 P;  2ZWO A;  2W2M P;  3H42 A;  3A3N B;  3P5B P;  4K8R A;  3BPS P;  3WIV A;  2W2Q P;  2W2P P;  2Z57 B;  3T41 A;  1SPB P;  2W2N P;  2PMW A;  2Z30 B;  2ZWP A;  4NE9 C;  4YN3 B;  3A3O B;  2XTJ P;  4JP8 A;  1ITP A;  3WHI A;  3CNQ P; 
#chains in the Genus database with same CATH topology
 4J90 A;  1IR2 A;  3JSM B;  4DR2 J;  2VPW B;  2B3T B;  2GQC A;  3HHD A;  4ALZ A;  5DLG A;  2J0W A;  4LR7 A;  1S1U B;  2BJE A;  2J8A A;  2NUH A;  3C15 B;  2WHO A;  4O44 A;  1U45 A;  3CC7 S;  2VFU A;  3AOA A;  4FPR A;  4O0N A;  2CG4 A;  1LXN A;  1NDK A;  4NEZ A;  2G13 A;  1CUL B;  5KT3 A;  3H42 A;  4J9U E;  4YHH F;  4YQW A;  4DX7 A;  2L41 A;  1WEL A;  2QX0 A;  1ZPW X;  3D1Q A;  4PR6 A;  5DJB A;  3T3F A;  4UW2 A;  1U1P A;  1N5Y A;  2J6S A;  4K4Z A;  2GQ2 A;  2G1D A;  1GQE A;  1FFG B;  2D41 A;  2JZ5 A;  3CCZ A;  5CYQ B;  1HBU B;  1Q8I A;  5E0O A;  2DNG A;  3LW5 C;  4PG8 A;  3GV5 B;  3BO2 A;  5IV4 A;  2KFN A;  3FRY A;  2E1R A;  1DTQ A;  1FNO A;  3MMA A;  3QLH B;  2GJ2 A;  3WZ0 A;  4UT4 A;  1FJG F;  4MH8 A;  2HQG A;  4IFY A;  1GMW A;  8RUC A;  3CB4 A;  1LWC B;  2X51 A;  1SL2 A;  2J0S D;  5HO4 A;  1FXL A;  3M05 A;  3GB0 A;  2BOP A;  3BYR A;  1RAJ A;  3QT6 A;  1Q95 G;  4DBQ A;  1VRU B;  2A1B A;  3R7B B;  4CM2 A;  1QSY A;  3OL7 A;  3ZO7 A;  3FEZ A;  2FHM A;  2UUT A;  3PDN A;  3EX7 B;  2OPR B;  5I3U A;  5H9F K;  1APS A;  1WC3 A;  5IOL A;  1H6K X;  2GAH C;  4Y3C A;  4CYU B;  2BRK A;  2EFO A;  4IG0 A;  1S10 A;  3TAM B;  3D0I E;  2J7K A;  3HI9 A;  1ULR A;  2DGU A;  2GQQ A;  2FQQ B;  1U0H A;  2XZD B;  1F5C A;  3KKF A;  3UN2 A;  2O66 A;  3IS9 B;  4X65 F;  1IBM F;  1JMT A;  4DQS A;  2UVU A;  4OI6 A;  2YNF A;  4C3K A;  4JI4 J;  3KWM A;  1VK3 A;  2BXJ A;  1VC6 A;  3LOU A;  1RJJ A;  3MI7 X;  3UDE A;  3PO5 A;  3W7B A;  4YHH J;  1A7G E;  1X4H A;  2G2O A;  5DM6 Q;  3T1Y F;  2R7T A;  1RB0 A;  2E7X A;  2K3I A;  3ENQ A;  3NWG A;  3M8Q B;  3BQ0 A;  3M30 B;  2C3O A;  2HRT A;  2R8K A;  5J2M A;  2CJ9 A;  2HAI A;  2R2U A;  3HSG A;  4QQB A;  3BSO A;  2OPP A;  1NHU A;  8ATC B;  3G6X A;  2ZDP A;  5KFN A;  3HHL D;  1U1L A;  3NGT A;  2XS2 A;  1JLE A;  4LBI A;  4JI4 F;  4OZ3 A;  3T9Z A;  3K2Y A;  4ED5 A;  2KTQ A;  3KHH A;  3E2E A;  1K0V A;  1OY8 A;  1IKX A;  2E29 A;  2I0X A;  2MKJ A;  3HT0 A;  4ECT A;  2D9O A;  3DRY A;  1XBW A;  3CF5 Q;  4GMK A;  4XAK A;  4J91 A;  3DDK A;  2WOM B;  2WSF C;  4NYP A;  4CT9 A;  4K2J A;  4ES1 A;  2VZ9 A;  4ANE A;  5KFJ A;  2CQG A;  3C66 A;  2YX4 A;  3CJS A;  3FC9 A;  1PCA A;  2H5E A;  2F3J A;  1RWO B;  3GMG A;  5A8R A;  3J80 Y;  1SB6 A;  2FVQ A;  4F2R A;  5HL7 Q;  4LQ3 A;  1P9Q C;  3KNG A;  1C0U B;  1IBL J;  1T03 A;  2PI5 A;  2L3M A;  3D28 A;  3OSN A;  1FKP A;  2PEH A;  2M52 A;  1VIS A;  4LVO P;  4NRT A;  2YBV A;  4NAS A;  4Y2A A;  5L8R C;  4WTY A;  4F26 A;  5CA5 A;  1NK8 A;  1ZAX A;  2ATC B;  3MCS A;  3I5B A;  2OEJ A;  4FXV A;  2AZ1 A;  2V94 A;  2CQH A;  2U1A A;  3V6H A;  4NXM F;  3WIV A;  4DUZ F;  2Z2L A;  3V2U C;  2HEK A;  5KG4 A;  5IM0 B;  3R6L B;  3M9O B;  5CYJ A;  3ZZO A;  4FBU A;  1NZA A;  3ZZZ A;  2FHK A;  4BBY A;  3JAM Y;  3M2R B;  1TKD A;  3QAE A;  2YNH A;  3RAQ A;  1VJW A;  3LGN A;  4IR1 A;  1QUP A;  3BYP A;  5F8H A;  3NRB A;  1U1O A;  2YWK A;  1RWN B;  1D9F A;  1VC0 A;  1H7W A;  2AW0 A;  2V2Q A;  3JB9 k;  3MCO A;  4KQZ A;  2DYA A;  3DU5 A;  4ED3 A;  4IRD A;  3MM9 A;  3MCM A;  2EPI A;  2F5G A;  1YJ9 S;  1HBM B;  2VHG A;  4FVM A;  3CO0 P;  2A0F B;  4PXD A;  2GIR A;  5ETP A;  3ZZP A;  5BYS A;  1HR0 F;  3D2W A;  4ER8 A;  1HWK A;  2EG1 A;  1TMM A;  3GON A;  2XO6 A;  3PX0 A;  5J1E A;  2HHX A;  3O6Q A;  1I1G A;  1RCX B;  2KL8 A;  3KLH A;  1UWB B;  4NL5 A;  5L1L A;  3G6V A;  3LP1 B;  4USV A;  1L3T A;  5T7L B;  3T5L A;  2YVS A;  3DI6 B;  4PWW A;  2ZNY A;  4O3Q A;  4OLP A;  3ITH B;  4ITS A;  1ZM9 A;  2LCW A;  2BV3 A;  3M6V A;  4KFB B;  3GFY A;  3M32 A;  4B3T F;  4CLL A;  1N34 J;  3ZXW A;  2X1B A;  2XMM A;  1KEK A;  1M5K C;  5EUH A;  1FE0 A;  1FRM A;  2A2C A;  2DIV A;  4PXC A;  4BHQ A;  2D3O R;  2MSS A;  4X4V A;  2QE5 A;  3CED A;  3IBW A;  4HT7 A;  3CJK A;  2ZBC A;  3VGT A;  2HHU A;  1HNV B;  2YNF B;  1Y9O A;  2E1P A;  3CJ2 A;  4RUC A;  5HP1 A;  5KFH A;  2FJW A;  2FUG 9;  4KV8 A;  4NYO A;  1NSA A;  5K14 B;  2FVR A;  2VA3 A;  1T3O A;  3DM2 B;  2LDY A;  2BMB A;  5L1I A;  3W66 A;  1NKE A;  2ZD1 A;  3IM8 A;  2R3V A;  4A8Q A;  3KLE A;  1N6Q A;  2HK3 A;  3QT7 A;  3DDI A;  1RLD A;  4MK7 A;  4P75 A;  3MM7 B;  4PEO A;  3FRZ A;  2OSQ A;  4EEY A;  2C3Y A;  4I7F A;  4NLS A;  5C7P A;  1KD1 T;  2AX0 A;  3PIO Q;  2CQP A;  2GVD B;  2ZE2 A;  4KGV B;  4MT1 A;  2IHR 1;  2WCX A;  2F4F A;  4OZ0 A;  3OD2 A;  5HLF A;  4EZ9 A;  4NLD A;  1UVN A;  2DGX A;  4M1K A;  1S5Z A;  1T9U A;  1XN9 A;  3LQV A;  1RUS A;  3ILO A;  4AD6 A;  3LP2 B;  2ZOF A;  3DOK B;  3DLE A;  3I9Z A;  4DSK A;  1CQM A;  1GMW D;  3VQT A;  1P27 B;  2BVZ A;  3OFG A;  4OHX A;  4N76 A;  1VQ8 S;  4LRA A;  4CM0 A;  5A0Y A;  4K8R A;  3Q8S B;  1QSL A;  3I56 S;  3DLG A;  3OVA A;  2XYG B;  2Z8Q A;  3LP1 A;  4Q2M A;  1XEZ A;  3I0R B;  4DU7 A;  2JEJ A;  4EZ6 A;  4AL5 A;  2HGN A;  2R8J A;  1S6U A;  1UZH A;  5EX3 A;  4F04 B;  2DH8 A;  2CKW A;  1K44 A;  2L48 A;  2M5Y A;  3EIC A;  1O6X A;  2C2K B;  3MEE A;  1VHI A;  3DRS A;  3FZ2 A;  3VR1 A;  1AFI A;  4ELV A;  2DK2 A;  5ETL A;  2V8D A;  3LWM A;  1C1C A;  2RNE A;  3D1H A;  1U1K A;  1NB7 A;  3QJJ A;  5D4L A;  4P2S A;  1IXK A;  1GXL A;  2HNZ A;  3UNG C;  3BO3 A;  1RT4 A;  1RLC L;  2E7W A;  2FTR A;  2N4C A;  3M1V B;  3M9N B;  2YNH B;  4UUW A;  1YBT A;  1XJW B;  1HNW F;  1LEO A;  3HVR A;  5I42 B;  3TJ8 A;  2N3L A;  3LPE A;  1FEH A;  3OFE A;  4A4J A;  1GX6 A;  5E3Q A;  1KHV A;  2BBE A;  4ED6 A;  1QE1 A;  2SXL A;  1JKH A;  2QC3 A;  2HWI A;  3CJ8 A;  1IM6 A;  1TL3 A;  3CO9 A;  3O1L A;  3WDO A;  5DDP C;  1R0C B;  1TMJ A;  5AJ3 J;  2ZIT A;  2C22 A;  2HHV A;  3CD0 A;  1NEE A;  3A1Y G;  4OX8 A;  2HUR A;  2RU9 A;  3GII A;  3B6B A;  1B7Y B;  2R2R A;  4G1Q A;  2MGZ B;  2ZZM A;  1D1U A;  1Y5N B;  2K3K A;  4DPO A;  2JEI A;  2NSB A;  4ECY A;  4NLG A;  5F0U A;  1KQG B;  2HVE A;  2H65 B;  3PO4 A;  2UU9 J;  2ZHA A;  4IFY B;  3NGU A;  2D3Z A;  4GC6 A;  3SDE A;  5HVG A;  1OSD A;  5KOW A;  4UZB A;  5A6W A;  2ABY A;  2BJ3 A;  4DPX A;  1U4B A;  3H4D A;  1SC6 A;  3CJ0 A;  2DNP A;  2GHV C;  1HBU A;  3D3C J;  4J9Q A;  3CIM A;  2NYI A;  3FFI B;  5D78 A;  3SI8 A;  3G8S A;  5KG3 A;  3HHN B;  1TAU A;  2DH7 A;  1PJ6 A;  3QAT A;  4JI6 F;  4WCE Q;  2HK2 A;  3S6E A;  3GYX B;  1J5O B;  4PUO A;  1WG5 A;  4NZ6 A;  3MM8 B;  3DRS B;  1NXI A;  3SFU A;  1W25 A;  4YFU A;  3P8B B;  4AL7 A;  2QT7 A;  2LQJ A;  1CC8 A;  2W25 A;  4Y6I A;  1RT5 A;  1VQ7 S;  4Z7Y A;  2DEI A;  3WX4 A;  2UXD J;  2HZC A;  3GPA A;  2ZKU A;  5H9F J;  1WNE A;  3N79 A;  2MYF A;  4NLT A;  2BAN A;  4O3P A;  5IT4 A;  2OMO A;  4H4O A;  2R8I A;  1FI4 A;  1JXE A;  2QO3 A;  1VBK A;  1MNE A;  2JC1 A;  3B8H A;  4X84 A;  5KFL A;  5C42 B;  3QJL A;  2QFJ A;  3EGV A;  1VGY A;  4A8X A;  2W9C A;  4YR0 A;  1YIT S;  1DRZ A;  5G0R B;  4LRE A;  2ILY A;  3KLF A;  2UXD F;  4AND A;  3MUR P;  2YKM A;  4DN0 A;  1FRX A;  4QYR A;  3CUN A;  1X31 C;  2MST A;  1IKX B;  3KOA A;  2RRN A;  3CMQ A;  2J7U A;  2VUG A;  3MMC A;  4FDF A;  5G4D A;  4DR5 F;  4DV3 J;  3R2C J;  4KGZ B;  1HW8 A;  2Z30 B;  4KSE B;  3W8G A;  2NRE A;  4DQQ A;  2ZOG A;  5L46 A;  2KJW A;  3LAL A;  4FKX A;  1ZM2 A;  2IJF A;  2AEF A;  1M1K T;  4NA1 A;  2EC0 A;  3EGW B;  3NY0 A;  1NND A;  2V50 A;  4RW9 B;  1V5I B;  4QWC A;  1KON A;  3ONQ A;  4NMX A;  4AYB D;  4ZHR B;  2YKN A;  2H5I B;  2N82 B;  1ELO A;  2VIH A;  4CLW A;  3CXC R;  3W8P A;  2FHJ A;  2MQN A;  2WVC A;  4B17 A;  1UVL A;  2CPX A;  3KLG B;  2B6A B;  2IVM A;  2XWY A;  4F7V A;  3I0S A;  4W92 B;  2KG0 A;  3E8O A;  1TUV A;  3TVY A;  1SV5 A;  1OYD A;  1RT1 A;  1X0P A;  1UJ4 A;  4IOC Q;  2R7V A;  4AQY F;  3CCS S;  2M2B A;  1FK9 B;  2XI3 A;  1XNR F;  3OR2 A;  5DQG A;  3PKY A;  1B64 A;  3I9V 9;  2HW3 A;  2WVB A;  1REG X;  4W98 A;  2NPF A;  3SMZ A;  3TZY A;  3DGP A;  4ZVG A;  1XNR J;  4Y65 A;  2PT0 A;  5EX0 A;  4M63 A;  1AUS L;  1FKP B;  4K4U A;  3NP5 A;  1U6Z A;  1UEK A;  2P8I A;  2KU7 A;  4LT6 A;  4GVB B;  3GWC A;  1NUE A;  4HDG A;  1R8C A;  2CQ3 A;  3ZFV A;  4U95 A;  4URG A;  4NZ0 A;  5JVG Q;  2FLN A;  4B9N A;  4I67 A;  2ZNZ A;  1OJ4 A;  1IBC B;  3IXQ A;  1WEY A;  4E0D A;  1DUR A;  2QA4 G;  3GJT B;  5F9L A;  4U6P A;  5DDO C;  1U1M A;  3OT9 A;  1SH3 A;  3DOL B;  4J37 A;  2YKQ A;  2LXF A;  4DR4 J;  3M6W A;  4ZCK A;  2IBO A;  2RH3 A;  3KFW X;  4L76 A;  3CDB A;  3HUL A;  4IYQ A;  4UQT A;  3OUY A;  4K59 A;  1S1T B;  2YKM B;  2J9C A;  4JBC A;  2ZH7 A;  4WBF A;  3AOC A;  4M5N A;  2X1F A;  1RTI B;  4QWA A;  2MZ1 A;  4ID5 B;  2MHN A;  3D6T B;  1GXT A;  4ECX A;  4CO3 A;  5DO2 A;  5LXY A;  4ENO A;  5DGA A;  5LJ5 Y;  3PW4 A;  4C8O A;  1RWK B;  3IFE A;  3CCW A;  1RE1 B;  1M5O C;  2UUB F;  2MLZ A;  2ACY A;  2PDA A;  4LIW A;  2CUY A;  2B51 A;  2ZUG A;  3UD3 P;  2BJD A;  1EKS A;  1WHX A;  4JI2 J;  2NXJ A;  1RKJ A;  3PRB A;  3N01 A;  1UFL A;  2YNG B;  2YQ0 A;  4RW8 B;  3Q8V A;  1F3V A;  3TX8 A;  4MK8 A;  4TQR A;  5D4P A;  2LQ9 A;  2DPI A;  1RT6 A;  4DV1 J;  5F8I A;  2OD6 A;  2IIH A;  3AD7 C;  3EVO A;  5M2R A;  3ZTR A;  3TI0 A;  2FLL A;  2CNN B;  1QY7 A;  1CJV A;  2CJB A;  3VAL A;  3PW0 A;  3DN9 A;  1NJY A;  1X4F A;  1TK8 A;  1N0V C;  1S9G A;  3A3N B;  2KFZ A;  1N5S A;  4F0M A;  1RT2 B;  2JFD A;  3ZZR A;  1CJU B;  3W61 A;  1X4E A;  3KLE B;  5CXT A;  5ETS A;  4CP5 A;  1ZH5 A;  3NCQ A;  1HD0 A;  4KKO B;  2HLU A;  3CDU A;  5DQH A;  3C6T B;  3CJR A;  2MZQ A;  5C25 A;  2UXB J;  4YB5 A;  2VBW A;  1PKU A;  2CQI A;  2AYG A;  3TEG A;  4H4M B;  2IDE A;  1YJR A;  5L9X A;  5ADZ A;  1WTF A;  2D3O 1;  4V19 X;  2IDL A;  2CJQ A;  3G86 A;  3CDE A;  1NHK L;  3JQJ A;  4JYA J;  1GT8 A;  3EJM A;  4RBT A;  2BA9 A;  3A3P B;  1UWB A;  2X3G A;  4L73 A;  4OV6 A;  4JI6 J;  4LF4 F;  1A0O B;  3QQC D;  1NK4 A;  4TLR A;  2VG5 A;  2K2P A;  4DV2 J;  4DQI A;  4HEA 9;  1N5Y B;  3ITH A;  4CLF A;  1NME B;  3R1H A;  4RWW A;  1L3V A;  3K5P A;  2IRX A;  3AQO A;  3MXH P;  1C2P A;  1T9X A;  1KTQ A;  2A18 A;  1VRU A;  3FMW A;  3U1L A;  1YQH A;  1NSP A;  2B6A A;  1DTQ B;  3L9Z A;  3GFX A;  1NLK L;  4ED8 A;  1ACM B;  3ZTP A;  4OJH A;  4TY9 A;  3MUM P;  3V4I A;  4OFZ A;  1TAQ A;  2CFX A;  2E5L J;  5U47 A;  3ZNU A;  4IO1 A;  3BGF A;  4LFB F;  4C0B A;  2BQR A;  4Q5V A;  1PO6 A;  1F9H A;  2DNQ A;  5EN1 A;  4LF9 J;  3O44 A;  4IKA A;  5CYM B;  4P9S A;  3UO0 A;  3JSB A;  3HVA A;  2HQF A;  2VFR A;  4NCG B;  4E2F B;  4B9L A;  3FSY A;  1JK9 B;  1WC0 A;  2QLX A;  1N6Q B;  4L6V 3;  1CS4 B;  3RTV A;  1X4B A;  2BJ7 A;  1RT7 A;  2Z2Y B;  2QG9 B;  1QDU B;  3MM7 A;  2HFZ A;  4IDK B;  4Z7C A;  5DG7 A;  4XPE A;  3GTY X;  4DHV A;  3A8K A;  1FDA A;  2HWT A;  3EDR B;  5HK4 A;  2E1C A;  3HLU A;  1CJT A;  3NCR A;  1RHQ B;  2NS1 B;  1F9E B;  4PAA A;  5KFO A;  3MOJ B;  2GHP A;  2OO4 A;  1T9T A;  2AZ3 A;  4DS4 A;  4DZD A;  1HMV B;  2MEW A;  2Y0B B;  2XMA A;  4D3H A;  3F41 A;  4RKU C;  2BUN A;  5JVH Q;  3PW7 A;  4YB1 P;  2PSZ A;  2X7I A;  2Q6C A;  4B9S A;  4CLY A;  3X3U A;  1R0A B;  4NE9 C;  3LAM A;  2CQ1 A;  2JLF A;  4OI2 A;  3WBZ A;  4P2X A;  3GIJ A;  1BQM B;  2V67 A;  4KB7 A;  4B3M F;  2QSW A;  4C8Y A;  3GSD A;  1RYR A;  5IC4 B;  4MIB A;  1SVD A;  1DQ8 A;  1N48 A;  4K7Q A;  1QTM A;  1NKB A;  2Z0G A;  3PAC A;  4IOA Q;  4A8M P;  4OX9 F;  2AYM A;  2GGP B;  1HQE B;  1VR6 A;  2WW8 A;  3OXG A;  2JX2 A;  4DCJ B;  2F7V A;  1IKW B;  4RW8 A;  5B0F A;  4DN9 A;  3VAG A;  1TV6 B;  4DL3 A;  1HBM A;  4B9V A;  4CT8 A;  2GJF A;  4QIE A;  2PI4 A;  5HQL A;  2V63 A;  3EZ5 A;  4KHM A;  1HNZ F;  3RRH A;  5CHC B;  4BLG A;  1IQT A;  2BW7 A;  2KRB A;  2IJN A;  1MN7 A;  4OJ3 A;  4DCO B;  1EQM A;  2KJV A;  1R3N A;  3ENW A;  1I5O B;  4HLB A;  3PG9 A;  2GNK A;  1I6J A;  1L3U A;  5GAH I;  3TA2 A;  1S1V B;  1HQ2 A;  1S99 A;  5HBM A;  3SBM A;  3SCK E;  3P45 B;  4CNY A;  2ROE A;  2VQF J;  1A9N B;  2FGC A;  4ZLN A;  1RWX B;  2RU3 A;  1DTT A;  1T9V A;  5RUB A;  2H48 B;  5F8N A;  2DD8 S;  3GCW P;  3A4T A;  1RBO B;  3SQG A;  1VBX A;  2DO0 A;  3QO9 B;  3VGS A;  2JEG A;  3CCJ S;  1TL1 B;  3G87 A;  3MM8 A;  2OEK A;  1NB2 A;  2IM3 A;  4N7T A;  3M8Z A;  4I0W A;  5FJ4 A;  2M8H A;  1IJE B;  3OHB A;  1NPR A;  2DBB A;  4ZVR B;  1N36 J;  2WW4 A;  4LBH A;  2OLW A;  2ADC A;  3TWZ A;  1YJU A;  2GMH A;  1VC5 A;  2UVV A;  1KVI A;  4PPD A;  2HIY A;  4LVN P;  4QIV A;  2ROP A;  3PZP A;  2B43 A;  4DLG A;  2BOA A;  2IA0 A;  4OV1 A;  1U1N A;  4RNH A;  4MJK A;  4PYA A;  1CUL A;  3V6K A;  4LR8 A;  4O3S A;  4FF1 A;  2V34 A;  4LF8 J;  2NCK L;  1HBO B;  5HN0 A;  3TX0 A;  1JIH A;  2AJF E;  1RAH B;  2B8Q A;  2I9S A;  3BS9 A;  3F0N A;  3ZTQ A;  2XY7 A;  4RW9 A;  1X4C A;  1ZM3 A;  3D6M B;  1Y11 A;  4NPO A;  1KLN A;  3R3T A;  1NK7 A;  5LMU F;  1Q1K A;  1QD1 A;  3ZZ0 A;  3PR4 A;  3AD9 C;  2P9C A;  2WRM A;  2DNR A;  1JWW A;  1VIX A;  4NEY A;  1YRU A;  5FLX U;  1HR0 J;  1HD1 A;  3FCV A;  4ECU A;  4NCG A;  3BF4 A;  3GIM A;  1MW7 A;  1JXL A;  2UZA A;  1YDL A;  1MRO B;  3J81 j;  2VD3 A;  3MEK A;  1X4A A;  2VKZ G;  3QJP A;  2ALY B;  2XMW A;  2V8H A;  2HAF A;  3V6D A;  3M9M B;  2XM3 A;  4LF7 F;  2KT3 A;  2PGC A;  3BSN A;  1Y10 A;  3GJR B;  3CJ4 A;  5B0B A;  1M5V C;  2UUA J;  2ZWP A;  4B3O B;  2EKN A;  3U1N A;  1YG0 A;  1WF1 A;  1XMB A;  2ASD A;  4CLP A;  1OSC A;  3LTO A;  2VOD A;  1AYE A;  1R7I A;  2HBQ B;  2M70 A;  3H90 A;  2HBR B;  1EHW A;  2V8V A;  3ISN D;  2EFN A;  4ZPB A;  4R5P B;  3CD5 A;  2NR0 A;  5HLF B;  4OHV A;  1HQU A;  1TL7 A;  2FHJ D;  2H5J B;  1E6Y A;  3CJT A;  3MZI A;  3W9I A;  3UE2 A;  1HWL A;  3AJ1 A;  4MKV A;  1U26 A;  3PCO B;  4YME A;  3RBZ A;  2AX1 A;  3VQS A;  5C5J A;  5DDR C;  3OJS A;  1VQN S;  3CCT A;  1XR5 A;  4Q2L A;  2JH3 A;  2IVF B;  1OY9 A;  4RNN A;  1IBL F;  3Q23 A;  4XPC A;  5HMZ A;  3GIR A;  3SCJ E;  2KYX A;  5KFI A;  2W1B A;  3ETM A;  2HBZ B;  1UFK A;  3QGP A;  2XHC A;  4N8O A;  3EE3 A;  1H38 A;  3HZE A;  2G2Z A;  4LFA F;  1V5V A;  1JJC B;  3MUT P;  4WZQ A;  4X4Q A;  1X60 A;  1S1T A;  3M8S A;  2AJQ A;  3LPY A;  1FES A;  1U8S A;  4HR2 A;  1S72 S;  4ED4 A;  3G96 A;  1RWM B;  1JXV A;  4EO8 A;  4WIQ A;  1K0T A;  4WFY A;  2XLI A;  7FDR A;  1Q16 B;  2KZM A;  2HNY A;  2HFS A;  3MPW A;  3W2V B;  3C2P A;  2ZJQ Q;  4YY3 J;  4X62 J;  3IBF B;  3IR6 B;  4WZM A;  4JI7 J;  2Y1L B;  2EK6 A;  3V6D B;  2WVE A;  2RKI A;  4OZJ A;  1OY6 A;  1Q5Y A;  3HHE A;  1UEU A;  4A46 A;  3N5B A;  3VZH A;  4DSJ A;  2B0G A;  4LF4 J;  4B3O A;  2NZ4 A;  1U1Q A;  2QJ3 A;  2DHG A;  2PE8 A;  3BPD A;  1MML A;  1VK8 A;  3C6T A;  3L7U A;  5J2N B;  2PN6 A;  3MM6 B;  3CDW A;  1VLO A;  5E2Q A;  1FRJ A;  1UPM B;  2CYY A;  3CE8 A;  4MYT A;  1J5O A;  4PUO B;  1NDP A;  3IA0 A;  4B3R F;  2F1F A;  2OUG A;  2RUS A;  4YP3 A;  3HF5 A;  4GVL A;  3P49 B;  3CNQ P;  1S7I A;  2VBZ A;  2XGQ A;  5B0D A;  2W2O P;  1U49 A;  4C9D A;  3T1H F;  1FO1 A;  1E6Y B;  2NXE A;  1N5Q A;  1UEV A;  1SJ3 P;  4C8L A;  1QM9 A;  4WP9 A;  3ZNJ 1;  3MR6 A;  2YKP A;  2YX1 A;  2FVS A;  1RT3 B;  2YH1 A;  4NXM J;  2CA9 A;  2POK A;  3CJQ A;  2HZA A;  1PSD A;  3I87 A;  2I8E A;  4ZVE A;  3KMS A;  3Q8Y A;  4H4O B;  3KHG A;  1RWU A;  4PQU A;  2EG2 A;  1LOU A;  4Y28 C;  3HCX A;  2RS2 A;  2KVI A;  5HQM A;  5KFE A;  3AT1 B;  4DV7 F;  1WI6 A;  1I3O B;  2Y1J A;  2HVI A;  4J9N A;  4DSL A;  1Y3K A;  1SKR A;  3OPK A;  2B5J A;  5HMW A;  2FC9 A;  2XMU A;  2CNK B;  1OYE A;  2GS8 A;  1HIY A;  4IUF A;  2VC1 A;  1MU2 B;  1VQ6 S;  3RYL A;  4YN3 B;  4CDI A;  2R9L A;  2EK1 A;  4DV0 J;  2DVI A;  2BR0 A;  1QUV A;  1LWX A;  2GJI A;  4G65 A;  4RLE A;  1XIQ A;  1R8A A;  3A8E A;  3D7S B;  4TQS A;  2C1E B;  2CPD A;  5J2P B;  3K59 A;  3BGR B;  1OIA A;  4NLR A;  4Q44 A;  3V81 B;  4GKK F;  3GCX P;  3NNA A;  4JUZ A;  2DRA A;  2OP5 A;  1WC5 A;  5SZT A;  2F8E X;  1EB0 A;  5C25 B;  3K5L A;  2GW8 A;  1CQN A;  2DHA A;  2FY8 A;  3QZ8 A;  1Q81 T;  3HKW A;  1U2C A;  4G3I A;  5L9N A;  3G82 A;  4O23 A;  4I64 A;  1IN0 A;  2XG8 A;  2V68 A;  3HFV A;  1WDD A;  4DL0 C;  1LFP A;  1WC6 A;  4Y00 A;  2BJ1 A;  3R5J B;  2B9W A;  4NLW A;  4A8F A;  1JB0 C;  4GKK J;  2KG1 A;  4FYD A;  3L09 A;  4KPY A;  2JLE A;  5GAG I;  4FXW A;  2P9G A;  3I5C A;  3IN5 A;  5IWA J;  4HI1 A;  4CLT A;  3D4J A;  4OZ5 A;  2VG6 A;  4LFC J;  2MZR A;  4JV1 A;  1YX2 A;  1UPP A;  2QLB B;  2IPO B;  3MPY A;  3HD1 A;  3TEH B;  3OJU A;  1Y5I B;  4USW A;  2AEM A;  3ENA A;  2P6T A;  3I55 S;  5DDQ C;  1IWG A;  1U24 A;  4GVB A;  3T19 A;  5KFB A;  5AJ3 F;  5J2Q A;  4U8V A;  4M95 A;  4PXE A;  2MZS A;  4DV7 J;  1CVJ A;  1JNZ B;  1N8R T;  2YH0 A;  3QYY A;  1XR7 A;  1X0F A;  4PWD B;  4ZCL A;  1F60 B;  3TR5 A;  4YEA A;  4IH5 A;  4FYV B;  4OMF G;  3VAJ A;  4F4K A;  2AU0 A;  2CPF A;  5DLF A;  2XB2 D;  5IT9 Y;  2B7B B;  4EO6 A;  1FVS A;  1LW0 B;  3SSS A;  3KNA A;  1YBA A;  5SUH A;  5ETM A;  5AT1 B;  2V8G A;  1IKV B;  3BKT A;  2HQ3 A;  1P6T A;  3HKZ D;  2AT1 B;  3DI6 A;  4F4Y A;  4LRF A;  1PYT A;  3D9B A;  3BR8 A;  1HWJ A;  1Q0N A;  5LMN J;  2IA6 A;  2PFD A;  2YKN B;  5HJX A;  5KFA A;  3HD2 A;  3TJA A;  1VIO A;  2O3D A;  4K5R A;  3N5F A;  3IG1 A;  3NBP A;  3E3X A;  1CG2 A;  4OYM A;  3I0R A;  4F4Z A;  2DNY A;  4WXO A;  4C3L A;  3AFG A;  3EPI A;  2V2Z A;  2L9W A;  2VPZ B;  4KT0 C;  4OYI A;  1WKK A;  1S9E B;  4FF4 A;  2Q66 A;  1X5P A;  3CD7 A;  3K5O A;  2DGW A;  3THV A;  4O4G B;  1RAF B;  3NOC A;  2RQM A;  4JI8 F;  3HHK A;  3SQO P;  1ICE B;  1GH8 A;  1AB8 A;  4QIF A;  3R97 A;  4RW4 A;  1PC4 A;  1GX5 A;  3KLV A;  3Q8P B;  4WP3 A;  1J27 A;  5GAG U;  3UWT A;  4I2P A;  1S6Q B;  3QFW A;  5IT9 U;  2HSE B;  1TUW A;  4KR0 B;  3NOG A;  1EX8 A;  2EFP A;  2HMI B;  2H4W B;  2B9X A;  1A6L A;  4ZVH A;  4RNM A;  5LJ3 Y;  1RT2 A;  3VF0 B;  4EU0 A;  1JLB B;  1H2T Z;  4RO0 A;  3JQK A;  2B56 A;  1AFJ A;  1QE1 B;  1LKZ A;  2KHC A;  4N47 A;  2QL9 B;  6FD1 A;  2YPY A;  5D0E A;  4EBD A;  4LSN B;  3T5H A;  1DY3 A;  1IR1 A;  3NCP A;  3PR5 B;  1KFS A;  1SJR A;  3DRR A;  3KLI A;  3R9L A;  2XMT A;  1JLQ A;  3Q22 A;  2HHH J;  1MU2 A;  1UAW A;  4TYB A;  2AGP A;  4IRK A;  3M2V A;  4NX9 A;  4TY8 A;  2W4P A;  4UY8 T;  4J9M A;  2L9N A;  1OWX A;  1C0T B;  2JVR A;  2ZH1 A;  3T5K A;  1S49 A;  1NO8 A;  2KFY A;  4F50 A;  3ILI A;  5D0H A;  5KT4 A;  3M6U A;  1OQ3 A;  3GE9 A;  4PYD A;  4DCP B;  5DQI A;  1GTH A;  1NSK L;  2HFV A;  2HS3 A;  2PA8 D;  1KP6 A;  1UMJ A;  3P4U B;  1EIY B;  2PO4 A;  4BWJ A;  1Y3J A;  4JB8 B;  1UFW A;  2VDH A;  3TQ1 A;  2PMW A;  5B0A A;  3NL0 A;  1MN9 A;  4CI0 B;  2Y8W A;  2MY7 A;  3GSI A;  1C1C B;  3V4I B;  3EWG A;  5A8W A;  2L08 A;  3J7A N;  4DL5 A;  5DGB A;  1HAR A;  3HK2 A;  1S9E A;  3BM7 A;  4DZ6 A;  1PJ7 A;  3BQ2 A;  2AMC B;  3J7A 1;  1SQF A;  2P9E A;  4K4T A;  3PVX A;  1NDC A;  3GP9 A;  3ZC4 A;  4O4G A;  4OHW A;  2M9K A;  4MIA A;  5ETV A;  2MB0 B;  5L39 A;  5KFG A;  2JJ4 D;  2HWH A;  5D6G A;  3PHE A;  4WU2 A;  1YIJ S;  5H9E K;  3JSR A;  4UY8 5;  1CJU A;  1U6F A;  2D69 A;  3H25 A;  3HVT B;  3CDA A;  2ASY A;  3KK1 A;  1F3F A;  4NCA A;  2RDJ A;  4I2Q B;  1B70 B;  4PG5 A;  4OJG A;  3C16 B;  1Z1Z A;  4ZVO B;  2ZM6 F;  1MSW D;  4XK8 C;  4WK1 A;  3Q8U A;  4ZA1 A;  1BC6 A;  3T6J A;  1FHT A;  3G6Y A;  4HH1 A;  2CQD A;  1FER A;  3UD4 P;  2BJ9 A;  3RUB L;  2JNJ A;  1YWX A;  5KFV A;  2BKO A;  2HRY A;  4OIX A;  3KDO A;  4F3O A;  2F4V F;  2E1M C;  4LBP A;  1SC1 B;  3I32 A;  2QA4 S;  2AD9 A;  3SDE B;  2Y3Y A;  1RTD B;  1VRT A;  3V5R A;  3KYL A;  3I31 A;  2COL A;  2KN4 A;  4TVA B;  2QLW A;  4ANC A;  1K9M T;  1ZA2 B;  2DIU A;  5IT0 A;  5KFQ A;  4DV6 F;  3CC4 S;  5L1K A;  1BQM A;  2HNY B;  3W2V A;  2XS7 A;  2XWX A;  2HGM A;  2AHO B;  3IG1 B;  3NBP B;  4RU2 A;  1QAJ A;  3NWR A;  5AE3 A;  2OPS A;  2YX7 A;  3N28 A;  4CLK A;  2YXL A;  2DNK A;  3I6P A;  3GR0 A;  4BC9 A;  2G9O A;  1N88 A;  4F67 A;  1VQM S;  2D1C A;  2EBE A;  3J7Z T;  2C2M B;  3KJQ B;  1B7F A;  1HHS A;  2MQO A;  4KJI A;  2HFN A;  2FIU A;  1H2U X;  4YDD B;  1RBL A;  1ZA1 B;  5EWF A;  4QOT A;  3HJF A;  2KXH A;  4X2B A;  1YJV A;  4OX7 A;  2GAG C;  4RJV A;  3HVW A;  3RU0 A;  4B9T A;  3NGS A;  1S1U A;  4J9V A;  2FJV A;  1EET B;  2BEF A;  5ETT A;  4X4R A;  4FVC A;  1FWP A;  3DRX A;  3KJN B;  4DLE A;  1TR0 A;  2QYG A;  2CVI A;  3EDQ B;  2F65 A;  1XWL A;  1VCT A;  1J5E J;  4WKY A;  3VAH A;  1TFY A;  1S59 A;  4R8U A;  1U0S A;  3HVT A;  2HIQ A;  1KBR A;  1XK8 A;  1ZOT A;  2Z58 B;  3FSX A;  4KY3 A;  1WC1 A;  1LNQ A;  3CTR A;  1R6V A;  2M4M A;  3CVK A;  3H2U B;  1UA0 A;  2RT3 A;  2PII A;  1PYO B;  2MKI A;  1QAI A;  3SZ2 A;  4Z37 A;  2DXF A;  1RQ0 A;  2W8L A;  1TL5 A;  4FN5 A;  4ETZ A;  2ACM A;  4DR7 J;  1C0T A;  1OPI A;  1ZZF A;  5BYQ A;  4B9M A;  1YBU A;  2R7O A;  3OQ2 A;  3DLE B;  4ES2 A;  2YPZ A;  3BZQ A;  4MFB A;  4DV4 J;  2OML A;  3O2I A;  1T0T V;  3M4X A;  2FVC A;  4N77 A;  1I94 F;  2QV6 A;  1D0E A;  3G9C A;  1H0H B;  1XTZ A;  2FC8 A;  2NZC A;  2XNQ A;  3M32 B;  2XI2 A;  5A0Y B;  2C2Z B;  4NLO A;  2N4D A;  4HHJ A;  5A8K B;  4WKR A;  2GZO A;  4RUA A;  3MMB A;  4EGL A;  5KFT A;  3WIU A;  2G0J A;  7FD1 A;  5MLC V;  4J9L A;  1FT8 A;  1WUU A;  4NLP A;  4OZN A;  4O44 B;  3RAX A;  2H1Y A;  4WFA Q;  3OR2 B;  2MQL A;  3WC0 A;  2YNG A;  4M5D B;  4J9R A;  5GAE I;  5ETN A;  3OW2 R;  1XNQ J;  1O51 A;  3HHL C;  4K0K F;  5D0R A;  3BV8 A;  1S0M A;  2QA1 A;  4CLU A;  2CAD A;  3KK3 B;  2R42 A;  1S9F A;  3J7Y U;  3RRK A;  1HNX F;  4ZN3 A;  1J5E F;  1RHR B;  1RU1 A;  1ZET A;  4I4B A;  5DM7 Q;  3SQG B;  3TW0 A;  2NLW A;  4C8K A;  1ITP A;  3POT A;  1BMQ B;  4OHZ A;  2QGF B;  3JTP A;  4TU7 A;  3TVK A;  4OI0 A;  1L3S A;  2E5J A;  3M2U A;  3BQ1 A;  3TNV A;  3BO4 A;  3B78 A;  4ZVS B;  1RAI B;  4FNH A;  1PJ5 A;  2YQ3 A;  3TJ9 A;  2C2D A;  1DHM A;  3FBE A;  1UW9 A;  4DR7 F;  3MAA A;  4DX6 A;  1WI8 A;  1RAC B;  2CNL B;  3CCU S;  4DQR A;  1HI1 A;  1HQU B;  3UDC A;  2UXC F;  1EAY C;  5IV3 A;  4HAC A;  1UL3 A;  2DHS A;  4DR3 J;  1MRO A;  2OTJ S;  3EVM A;  3M8Q A;  1REV A;  1X5S A;  4JV0 A;  1KDN A;  4MFB B;  4Z2X A;  1R27 B;  4C4W A;  5LM7 E;  2XMK A;  2KZZ A;  3JAM U;  4JYA F;  1FRI A;  4I6A A;  4KC5 A;  2HYI B;  3TVZ A;  3OL6 A;  3GYG A;  2ERR A;  4DG1 A;  1TEL A;  5ETQ A;  3AHP A;  1LQ9 A;  3OLA A;  2PMH A;  9RUB A;  4RR5 A;  5AXK A;  5E33 A;  3PRV A;  6FDR A;  5F8L A;  2IY5 B;  4LF2 A;  1JLG A;  1WF0 A;  5L1J A;  3MWB A;  1HNZ J;  4Q8E A;  5I3Q A;  5ETO A;  7AT1 B;  5IS2 A;  2J0X A;  2ZM6 J;  1VQL S;  2DY9 A;  3A8I A;  2UVW A;  1UZD A;  3JSY A;  4OX9 J;  4FS1 A;  2R4F A;  5KFW A;  3J80 U;  3DGV A;  3S8S A;  1NK9 A;  2OKQ A;  3PX4 A;  2RIL A;  3LGH A;  4CLZ A;  3C6U A;  1YGY A;  1SJF A;  1S1W B;  3PNI A;  4PWD A;  1AA1 B;  1QSS A;  1SJQ A;  3TQE A;  4DPU A;  1WSR A;  1KOH A;  4ED1 A;  2DRB A;  5IM0 A;  9ATC B;  2HND A;  2XLK A;  2HFO A;  4RUB A;  5BJR A;  1TKX A;  3MFH A;  1YJN S;  4NA3 A;  3P5T L;  1EP4 A;  4P6Q A;  3V4M A;  4F25 A;  2VQF F;  1KTV A;  4AXI A;  1WF2 A;  5KT5 A;  2DGT A;  1AXQ A;  2ZBI A;  4L75 A;  4P72 A;  4F3M A;  1DAR A;  4DR3 F;  1KOO A;  2DPJ A;  2GVZ B;  2NXU A;  3CC2 S;  2ASJ A;  3NG8 A;  4F8R A;  3PW5 A;  1U6B A;  1F2G A;  2Q43 A;  1R8P A;  2A10 A;  4C3M A;  4ED2 A;  1PIE A;  5ITH A;  4RW7 A;  5LXR A;  3MMB B;  3Q24 A;  2Y8Y A;  2UUW A;  5AE1 A;  3MPV A;  4KYZ A;  1ZM4 A;  1MMN A;  2FZG B;  3SYZ A;  2CPH A;  2ZFH A;  2W2N P;  3R7N B;  1DLO B;  2PA3 A;  2NXN A;  5M2U A;  3W9H A;  1HLW A;  1I94 J;  5BYR A;  3QNW B;  2Y1R I;  3SSR A;  1N5V A;  5KFZ A;  3F56 A;  4LF9 F;  1QVF R;  3HFK A;  2KM8 B;  2HQD A;  3DLK B;  5LT5 A;  1VQP S;  1NJX A;  1S0V A;  2EWH A;  5CH7 B;  3SIP B;  4QU7 A;  3FZB A;  2VH7 A;  4L3K A;  4TU8 A;  3C19 A;  2F8H A;  2L9D A;  2YQ1 A;  4ZLL A;  4PZV A;  3X1L B;  3KG4 A;  3HDS A;  3TZW A;  2VAS A;  4QWD A;  4JI0 J;  3TUJ C;  4JI5 J;  4L72 B;  1Y4Z B;  3NAI A;  3CWJ A;  4PKD B;  3MR2 A;  5FII A;  4FYX B;  3GJS B;  1JLA B;  2W2M P;  4M5M A;  4P52 A;  5JMN A;  2K7K A;  1FWL A;  5B0G A;  3CCM S;  2I38 A;  1HNV A;  3F73 A;  3H5S A;  4LSL B;  2P5V A;  2ZBP A;  3ET6 A;  1NBE B;  4OI4 A;  3QT8 A;  3AD8 C;  3DOL A;  3QLH A;  4GRS A;  2ZVI A;  4UST A;  2JSX A;  4UZC A;  3EVW A;  1V3S A;  5GAE U;  2J9E A;  4RWX A;  1RXO B;  5KFC A;  4WFZ A;  4X66 F;  2ZD1 B;  2AJ2 A;  3QRQ A;  4M5L A;  1UVK A;  3PKM A;  3MEC B;  5JJB A;  4DDF A;  3W60 A;  3TP2 A;  4I7F B;  3E01 B;  1D3W A;  3LA0 A;  1CSJ A;  2DNO A;  2UUC J;  4CTA B;  3HSD A;  3GFH A;  4X4S A;  3BJY A;  2ZH3 A;  4C8N A;  2UUB J;  3K89 A;  4IQM A;  2A2D A;  3K17 A;  1X9W A;  5ETK A;  3MCN A;  3VAI A;  4LRC A;  8AT1 B;  1HNI B;  3ZTO A;  4K50 A;  4FBT A;  3SXL A;  2MQP A;  4ECS A;  1M0S A;  3QID A;  1K8A T;  1RTJ A;  3BPS P;  2F40 A;  2C42 A;  2CZV C;  1VQO S;  1T05 B;  2UUC F;  3T41 A;  4DWI A;  3DGP B;  4LIR A;  3IS9 A;  3AB2 B;  2KT2 A;  3D54 A;  2WBM A;  1FTC A;  3RJM B;  5GAH U;  3PIP Q;  5LMU J;  1IKV A;  2EFQ A;  2RVJ A;  1AZS A;  3B4D A;  4JOU A;  3ZZT A;  5J1P A;  2ZJR Q;  2DR7 A;  2RB7 A;  4M5J A;  2JOQ A;  3A3O B;  1R8B A;  2CAJ A;  3C14 A;  4LFB J;  1RAB B;  5EHH A;  3TAR A;  2KDO A;  2LQ8 A;  4Q7A A;  1WEZ A;  1FE4 A;  1VRQ C;  3VVU A;  2GVD A;  1TL1 A;  2ZE2 B;  3FMB A;  1YJ7 A;  1M5S A;  4TN2 A;  4Y2M A;  3KJV B;  3TAP A;  2FJA B;  2AKW B;  2D7S A;  2V8P A;  2RD5 C;  3IGN A;  2OEL A;  3CJ3 A;  3IWL A;  4RBU A;  3Q0A A;  3RRG A;  2QL5 B;  1NM2 A;  2XCP A;  1X4D A;  3Q89 A;  2XO7 A;  4ZP9 A;  1D8Z A;  4A8K A;  3CIZ A;  1EET A;  3UCG A;  1Q86 T;  4R5P A;  4FF3 A;  1FKA F;  1N0U A;  2WAQ D;  4USM A;  1HHT P;  2E9Z A;  1E6V A;  1PAE X;  2ZH2 A;  1G2E A;  2GCF A;  1O8B A;  2GO9 A;  2LMI A;  4K4S A;  1NCL A;  4Q43 A;  3UN5 A;  2W4C A;  4RX6 A;  2K8G A;  5HMX A;  4ECZ A;  4FXD A;  2VG5 B;  1JKH B;  1UET A;  1TKT B;  2AIR B;  3W2W B;  3BH6 B;  1SJ4 P;  2I5J B;  3GQC A;  1EKR A;  4ERD A;  4TXS A;  2AJ1 A;  2CG8 A;  2DH9 A;  1T9Y A;  1FRL A;  4DV3 F;  1LWE B;  5CD4 A;  2EFV A;  1WSV A;  4AE5 A;  1FX4 A;  1JNR B;  1RYS A;  1FKO B;  1RA7 A;  3GG1 A;  3TRG A;  1RGV A;  2MJN A;  5HAN A;  2HNZ B;  2YWF A;  3S01 A;  4N5S A;  3IRW P;  3DLK A;  2LKZ A;  1RHJ B;  1SBR A;  1KR4 A;  3VV2 B;  2LEB A;  1XNQ F;  4W90 B;  4WYL A;  3QIP A;  5E7O B;  4ZJL A;  3CCQ S;  4PWU A;  3FBC A;  4TLQ A;  1H98 A;  1X7V A;  4DU8 A;  1VHF A;  5HSP A;  4UQG A;  3VGU A;  1U2F A;  4QPT A;  4ZPT R;  3VWS A;  3BN7 A;  3FUY A;  3K58 A;  2D3U A;  3DKD A;  1NJW A;  4X66 J;  1NSQ A;  4DS5 A;  1FRH A;  4PPZ A;  2B9Y A;  4KHP F;  1RWW B;  4OJ1 A;  4ES3 A;  3T1A A;  3IAM 9;  4K5S A;  3GV7 B;  3EXY A;  1NZ8 A;  2X1A A;  1H2V Z;  3DU6 A;  4OZL A;  3WHI A;  4P71 A;  4KGX B;  4EBE A;  3OL8 A;  2ZBQ A;  1TKZ B;  1B0V A;  1KLM B;  1SJ1 A;  4YR3 A;  3MAA B;  4MKY A;  2EVZ A;  2LEP A;  3DCA A;  3E51 A;  1DFD A;  4LRD A;  5DZ7 A;  2HHW A;  2V9K A;  2ZKT A;  2CZ9 A;  4ZPV R;  3TUI C;  4ZPC A;  3M8R A;  1ZBT A;  2RRA A;  2IM1 A;  2VPY B;  4ICL B;  1VDH A;  3PYD A;  3BGU A;  2CPY A;  4DV1 F;  3GFZ A;  4ECV A;  4DR4 F;  3KUG A;  2QL7 B;  4JI3 J;  1YLX A;  1NH8 A;  2J8S A;  5HI7 A;  3W5Y A;  5DZ6 A;  5D15 A;  1Q7Y T;  2FY1 A;  2AF6 A;  5CYQ A;  2UV8 A;  3M8P A;  2CWX A;  3A12 A;  4DG1 B;  2LYV A;  1NPK A;  4G1I A;  3HMJ G;  2O01 C;  3MFI A;  4V19 J;  5KT2 A;  3BSA A;  3W1Y C;  4H4K A;  1UKU A;  4A47 A;  5IWA F;  2VQE F;  3VTI A;  1S97 A;  3MMA B;  4RBV A;  5GAD I;  2AYB A;  4LF8 F;  4USU A;  5HVH A;  4O4R A;  1W2I A;  4HAC B;  4HH0 A;  3VVT A;  3KK3 A;  4G1P A;  1KKH A;  2MQ8 A;  1PYS B;  1RT7 B;  1V9O A;  3R6G B;  4IDK A;  3U02 A;  1VQS A;  4A48 A;  4DFP A;  1YJW S;  1M5P C;  2R7X A;  3FSI A;  1B3T A;  2EW9 A;  3HSZ A;  4A8O A;  2B8P A;  4KFB A;  4C7Q A;  1LK5 A;  3DYA A;  4JI7 F;  1UP1 A;  3BGR A;  4IH6 A;  2K1R A;  3LH2 S;  4AUK A;  1NAQ A;  3KK2 A;  2O67 A;  1YZ7 A;  3FDS A;  4JI5 F;  5HQ8 A;  2ZHO A;  5B7W A;  1T9W A;  4DV6 J;  4A8S A;  2AGO A;  2QEX S;  1TK5 A;  3OTC A;  3RGI A;  2VA2 A;  1IJF B;  1BE4 A;  1RI7 A;  4ZIW A;  1WOO A;  1YVF A;  2ASL A;  2XBP A;  2ZH9 A;  1QJH A;  3D6H B;  4HI2 A;  3GIK A;  3T5J A;  3FQK A;  3I5A A;  2UUA F;  4Y34 A;  2OHD A;  5F9N A;  3M8W A;  3KK1 B;  2VJU A;  3C46 A;  4MMO A;  4RNO A;  2FGO A;  1JQG A;  5F8M A;  3PM9 A;  1WC4 A;  2GVZ A;  3O5T B;  4J9S A;  3RB0 A;  3RR8 A;  4C98 A;  1Q82 T;  4C11 B;  4HTI A;  4IRC A;  2RDD A;  4NCB A;  3AY0 A;  4HTJ A;  1HI0 P;  4CZC A;  3N6L A;  4DFM A;  3B82 A;  1HNW J;  3ZTS A;  1V3R A;  4EYI B;  3R2D J;  4WU3 A;  4RU9 A;  1T8E A;  4DQP A;  1FX2 A;  1FDD A;  1KWM A;  2G1H A;  3UDL A;  2AQ4 A;  1DLO A;  1GFW B;  4ZCM A;  2D9P A;  1SXL A;  5HRO A;  3G8Q A;  4TKT A;  2CJA A;  3ETO A;  4ID5 A;  2QRR A;  3BDP A;  4KAI A;  4MAK A;  2E9R X;  1S57 A;  2RE1 A;  2KYZ A;  1RTH A;  4N8N A;  3R7S B;  3W5Z A;  1X8D A;  4WTO B;  1OS5 A;  2HG4 A;  4AFF A;  2XMV A;  4LF7 J;  3AJ2 A;  3B54 A;  2Z2Z A;  2FLP A;  1XER A;  1W26 A;  3H5U A;  4KHP J;  4P74 A;  5BR8 J;  1F5A A;  5K8M A;  2EXU A;  4M94 A;  1ZAW A;  3FCW A;  5J1N A;  2BE2 A;  4NA2 A;  3ZZU A;  2FB0 A;  3UW1 A;  2WB1 D;  1Q4R A;  1RTZ A;  4QPX A;  1Q8B A;  4IFV B;  1C4C A;  1MMD A;  1LV5 A;  1TKX B;  4DSE A;  2FDN A;  4K4V A;  1IWA A;  3R5B A;  2VOO A;  3AXK A;  5AXL A;  2WBR A;  2HHH F;  3Q8Q B;  3DDN A;  2ADB A;  1SPB P;  5I42 A;  1TL7 B;  1B0P A;  2B4V A;  2J5A A;  2YWG A;  2DNM A;  2NUU G;  2VG6 B;  4KRW A;  2MQM A;  1BD6 A;  1XR6 A;  3THP A;  2ZDO A;  3UI3 A;  4A8W A;  1FJG J;  2JWN A;  4ZJO A;  4RPF A;  4KTQ A;  2HVH A;  3PX6 A;  4OYP A;  1RK8 A;  2MJU A;  4I2P B;  2UVR A;  3D0H E;  2KT5 A;  3HJV A;  3TA0 A;  1TL3 B;  2RIJ A;  2V6A A;  4CRJ A;  1QTN B;  5THW A;  2MKS A;  2MMY A;  5KG2 A;  2RJZ A;  2HLT A;  1JLB A;  4YS2 A;  4FPI A;  3U7J A;  2QN6 B;  3EUN A;  1N33 J;  4G6V B;  2ZBR A;  5LOQ A;  2CPE A;  3L7P A;  4PQA A;  4O3N A;  4DPY A;  1SKS A;  2CRL A;  5GME A;  1NJI T;  4DSI A;  2H54 B;  2XYP B;  3VHQ A;  4AXJ A;  1WWH A;  5KFP A;  1CJK A;  4K4X A;  1GEH A;  2ZH8 A;  4NLQ A;  3UFC X;  1S6O A;  2C2N A;  4ECW A;  1XQI A;  2NSC A;  1URN A;  3HX9 A;  4MKA A;  2XQC A;  5IXU A;  3KTQ A;  1N33 F;  1YKW A;  2W9B A;  3IWX A;  2FJX A;  1UJ5 A;  1HFE L;  1UVJ A;  2ATL A;  1WDT A;  3BKU A;  3BRE A;  4B3S J;  1ZS6 A;  1TZ0 A;  4OYW A;  4FZV A;  3NLC A;  3W9J A;  1LFW A;  4C6A A;  4O0I A;  1GK8 A;  1G3O A;  2RQK A;  2OIH A;  4ATN A;  2J6T A;  2APO A;  2VG7 A;  3ET6 B;  5K8O A;  2KH9 A;  1MLA A;  1U09 A;  1Y0H A;  1OMS A;  3AAW B;  2BYC A;  1RHK B;  4JI3 F;  3DOM A;  3LO3 A;  1RAA B;  3R5G A;  3MDF A;  3U1M A;  4K0K J;  1SCJ B;  2XLJ A;  5CAB A;  2GIQ A;  2IC3 A;  3ADA C;  3RBD A;  2XZT B;  1UW4 A;  2BDP A;  5J1E B;  2JFK A;  1Z2L A;  2YKA A;  1R43 A;  4NML A;  3WC2 A;  3DM2 A;  2J0Q D;  1P1L A;  2J9D E;  5EWG A;  2VB6 A;  2P6S A;  3POT B;  3MEG A;  4I56 A;  3FCH A;  3M8Y A;  1S1X A;  3Q2S C;  2VV5 A;  4QU6 A;  4AL6 A;  1EAR A;  2LU1 A;  4WFN Q;  1T02 A;  4X4P A;  3BB5 A;  1NH7 A;  1HHQ A;  1X5T A;  1MWZ A;  2ZVS A;  3H2V E;  1GNK A;  5CQG A;  1XC9 A;  1WEX A;  2OI2 A;  5B0C A;  1DZ5 A;  4HHU A;  2AGQ A;  4ELU A;  3EMT A;  3MPU B;  5DRK A;  3IC1 A;  3D66 A;  2F9D A;  1R8H A;  4WE1 B;  1SV5 B;  1N52 B;  3S1T A;  3HP6 A;  3G4S S;  2I1R A;  2WTF A;  3CCV S;  3QPI A;  2WSE C;  2HQI A;  4K4Y A;  2R8G A;  1V3Z A;  4UOF A;  4ZK7 M;  4J7C A;  1NJZ A;  4F2S A;  4YY3 F;  5K9F A;  4RZR A;  4PG7 A;  4QYZ K;  4DPW A;  1HPZ B;  4L74 A;  4XO0 A;  4HL9 A;  1CJT B;  3QRR A;  2BM0 A;  3WX8 A;  3OR1 A;  2M8D B;  5K5M A;  1FEE A;  1UCN A;  1TTH B;  1T95 A;  5L38 A;  4O3R A;  2F8M A;  3CJK B;  2E66 A;  3OL9 A;  5KG1 A;  4ZVT B;  1N32 F;  1KFD A;  3GZ7 A;  4RW6 A;  1KQK A;  4NYZ A;  2JHE A;  4FYW B;  1SC3 B;  2MKC A;  2J76 E;  1PBU A;  5D4N A;  2WZ1 A;  2JVO A;  1FD8 A;  1Q78 A;  3M1V A;  1YHQ S;  2FYX A;  3NGR A;  4QIG A;  4WFX A;  3BKF A;  3D68 A;  3K0J A;  2QMW A;  3BDE A;  2MDA A;  2E5G A;  2HVD A;  3AQP A;  2ZH4 A;  4DUT A;  2R8H A;  1WAC A;  3PV8 A;  2V0N A;  1M1G A;  5F41 A;  2ALZ A;  4HT5 A;  3OBI A;  4PRF A;  2E1A A;  1IKW A;  5J2Q B;  1I51 B;  2W2Q P;  4CH0 S;  3JS9 A;  3OLB A;  3M8P B;  3OV7 A;  1YK9 A;  4E8U A;  4M5I A;  1G6B A;  1WKL A;  2QSF A;  1TQL A;  2V2V A;  1LWC A;  4LSL A;  4B3T J;  3RW6 A;  3CCL S;  2F63 A;  2ZOM A;  3FEY B;  3CGI A;  3DHX A;  2CQ0 A;  3KG1 A;  4F0H A;  1JLC A;  4DMZ A;  3BN4 A;  4B02 A;  4U67 Q;  2W01 A;  4Q45 A;  3PHT A;  3QWU A;  4USH A;  5B08 A;  1Z2Z A;  4HDH A;  2YNI B;  3HT3 A;  5A76 A;  4UUX A;  2VF3 A;  2YTC A;  2E5I A;  3LAK A;  2A6M A;  3Q2T C;  3R5D A;  3VCD A;  2K06 A;  4U7U D;  3MAQ A;  3PEH A;  4Q0B A;  2IMW P;  3KK2 B;  1RIS A;  5KFF A;  2DT9 A;  2B9E A;  2WSC C;  1JLA A;  2QYC A;  2HPU A;  4ECQ A;  4CO2 A;  4DX8 H;  1SI9 A;  5AXN A;  1FCA A;  3R5C A;  4G1Q B;  2MPU A;  4D3G A;  2MGZ A;  5B09 A;  5KFK A;  4DL4 A;  4M5D A;  2H9Z A;  1K1Q A;  4TYA A;  2G0C A;  1D09 B;  4PCQ A;  1RHM B;  2DCL A;  3RB4 A;  3LGM A;  2DGQ A;  1B4S A;  2J9D A;  2KRR A;  4MIW A;  3W64 A;  1FJ7 A;  2BM1 A;  2BJ8 A;  3N4W A;  1NDL A;  4NI2 A;  2D74 B;  3IBC B;  3MEC A;  4WYW A;  4ILL A;  5IC6 B;  5F8J A;  1KVK A;  2GV1 A;  3NS7 B;  4LF6 F;  4I6Y A;  3MHY A;  1U25 A;  2J7W A;  3FFI A;  4NLY A;  2VON A;  3VAM A;  4QWB A;  1ZZN A;  1VLY A;  1HYS B;  1DJ0 A;  3M2U B;  4IQX A;  3TUP A;  3R5A A;  2NYH A;  2DB1 A;  4LSN A;  4CO5 A;  2DNH A;  5KFX A;  1HBN A;  1Y7P A;  2QA2 A;  3EGZ A;  2OAU A;  4EWT A;  3FGV A;  3ISZ A;  2WVD A;  4TY8 B;  3H98 A;  3DRP A;  5JXS A;  1J2V A;  5CCM A;  6AT1 B;  4A8Y A;  3VAK A;  2MHE A;  1SKW A;  4CTA A;  4X65 J;  1IBM J;  1REV B;  4I68 A;  1JJ4 A;  4U8Y A;  2HHP A;  1SUQ A;  3H40 A;  3GG0 A;  4B08 A;  2DHH A;  3CSK A;  5I3P A;  3NAH A;  2CQ4 A;  2RKI B;  1IBK F;  1U7L A;  2R2S A;  1XMO F;  1LWE A;  2N7Y A;  3MTK A;  5KG0 A;  3ENV A;  4UOC A;  1QVG R;  3PYG A;  5H1S V;  5KFY A;  1GXU A;  1ROF A;  2Z4P A;  2RQC A;  1Q53 A;  5J2N A;  1BWE A;  4F02 A;  2VFS A;  1NK0 A;  1L5U A;  1DQ9 A;  2MKH A;  4EYH B;  2H51 B;  3M2R A;  2LQB A;  2B4O A;  1FFS B;  2FVP A;  2R7Q A;  3ILL A;  4KPC A;  4KV8 B;  2E7V A;  5K14 A;  2ZHB A;  2ZJP Q;  1IBK J;  1KNZ A;  4GKJ F;  1FXD A;  4DX5 A;  3TYT A;  4F3Q A;  4KIA A;  2XUL A;  1ZPV A;  2BE9 B;  4LRB A;  2BE2 B;  4LUB A;  4C2M A;  3UR0 A;  2W9C B;  4ZHR A;  2IVY A;  3RG6 A;  4EFA C;  3D1O A;  1YI2 S;  2AJ4 A;  3QMQ A;  3OTD A;  1S77 D;  2MZT A;  3EXC X;  4RL1 A;  4U7U K;  2HND B;  1RHU B;  4QWE A;  3SV3 A;  2WB4 A;  5KOX A;  3N6N A;  3UQS A;  1KLM A;  3I96 A;  3QZ7 A;  2XC9 A;  3LP2 A;  1FK9 A;  3K8V A;  3ULH A;  1RDR A;  3EZU A;  3IRX A;  5CAA A;  3UN3 A;  4TU9 A;  1H72 C;  2YY3 A;  2Y1I A;  2Q3P A;  2R7U A;  3D67 A;  4WJB A;  2WON B;  3ISN C;  2I5J A;  2LLZ A;  3BSC A;  3I4H X;  3NS5 A;  5T41 A;  1S1V A;  4EUV A;  4WFB Q;  3K57 A;  2PEB A;  2W9B B;  4X64 F;  4ZN1 A;  3IWN C;  5E3A A;  4P10 A;  4DL7 A;  1K47 A;  3PY8 A;  4X4N A;  4IG3 A;  4R0E A;  3MM6 A;  1HL6 A;  1FDB A;  2AV5 A;  5E3C A;  3NS6 A;  1WJ9 A;  5I4M A;  2C3U A;  3DMJ B;  1WTB A;  2AYE A;  3HXM A;  2VG7 B;  4CIO A;  3WQP A;  3H2L A;  3Q86 A;  2F9J A;  2R7S A;  4OZ2 A;  3ILJ A;  1N5T A;  2KXN B;  5IQQ A;  1RAO A;  3TZX A;  3NMR A;  1S12 A;  4X64 J;  2RRB A;  3SV4 A;  3BR9 A;  4ZOS A;  5JUM A;  4HYK A;  1ZAV A;  1N4L A;  2G4B A;  3N9U C;  5FLX Y;  1U2R A;  2CZ4 A;  2GIF A;  1BQN B;  4ED0 A;  3LAN A;  4IR9 A;  2LVW A;  4HVZ A;  1CEZ A;  4KGM A;  2H4Y B;  3GYN A;  2C3P A;  2XEX A;  2I6W A;  1YRX A;  4CH7 A;  3NNC A;  1WD6 A;  2OD4 A;  5J2M B;  1HYS A;  2Z57 B;  4LF6 J;  1PC5 A;  3LUY A;  4OYA A;  3CW2 C;  5F3Z A;  4C8M A;  1BXN A;  4YDX A;  3AB4 B;  5KG6 A;  1WG1 A;  4NZ7 A;  4B3R J;  5CZV A;  4ZVQ B;  5D8H B;  4QJV A;  1FTR A;  2CPZ A;  1TL4 A;  1S79 A;  2V2K A;  2HQC A;  3DXS X;  4QZV B;  2BRL A;  4ZDN A;  1VOM A;  4OI3 A;  5E3P A;  3MOZ A;  2DIS A;  4ZPD A;  4PAB A;  3K5M A;  5FDL A;  4DFK A;  2ZEJ A;  3GR1 A;  3V81 A;  2DCU B;  1Q8L A;  1YJT A;  5A6P A;  2FZC B;  3MD3 A;  4JV5 J;  2M7S A;  2RDI A;  3NGD A;  2OPR A;  3VGV A;  4QR2 A;  4HKQ A;  1B99 A;  3FVY A;  3JXO A;  1SIW B;  1AW0 A;  5IZH A;  3GV8 B;  2FJE B;  2P2C B;  3G82 B;  5C2C A;  1HWU A;  2EKY A;  2OPQ B;  3MR7 A;  1Q5V A;  3OFF A;  3OXL A;  2DEJ A;  2OEM A;  2DGO A;  2W2P P;  3RBE A;  1PGZ A;  4IOB A;  3VZI A;  4ZPA A;  5BXI A;  4QCL A;  4I6W A;  2ZZT A;  4ZPW R;  2FJB B;  3QGH A;  2KI2 A;  3KUH A;  4F36 A;  4WXW A;  1CPZ A;  1AT1 B;  1RTJ B;  2BAC A;  2BQ3 A;  4NOH A;  3U27 A;  1DBD A;  2FLO A;  1OPZ A;  2E44 A;  1NHV A;  1P8G A;  3T9N A;  4MK9 A;  4F4A A;  3J81 Y;  1AZS B;  5LSO A;  3FEX B;  2MLX A;  1M5H A;  3BEG B;  4LF5 J;  4Y2C A;  4V1A k;  2UP1 A;  1LWF A;  4N41 A;  2DKO B;  5DG9 A;  4EBC A;  2QTW A;  2JRS A;  2DGS A;  4OYX A;  1JJ2 R;  3KJV A;  1FJE B;  4Y2I A;  4X62 F;  1KQF B;  3IR7 B;  2LA6 A;  2MQQ A;  4IFV A;  4M8L A;  1WOP A;  4ILR A;  5KFR A;  4YR2 A;  2VOP A;  2FJD B;  3US5 A;  5GMK a;  3G6E S;  2EEY A;  3IRX B;  4ID8 A;  2MXY A;  2CJX B;  5CD4 H;  1Q7L B;  4BCA A;  1S6Q A;  2IM2 A;  3MAH A;  3RW7 A;  5HRO B;  4WPA A;  2W8K A;  1R0A A;  2IAJ B;  3MGJ A;  4DV0 F;  1VQ9 S;  1VI7 A;  3KLH B;  4FNI A;  5D4O A;  4ED7 A;  2E5L F;  3EZO A;  1RTH B;  2X3D A;  3P3D A;  3NMA A;  2B4U A;  3MED B;  3OR1 B;  4H54 A;  5T7L A;  4MTP A;  3PFE A;  1G7C B;  5LL6 d;  3GIL A;  1Q79 A;  2VFV A;  2M0G B;  2C2R A;  2DXE A;  1S0O A;  2VFT A;  4UTG A;  1HKA A;  2C3M A;  2CWK A;  3QGI A;  3OTO F;  3O8W A;  1KQS R;  1GMV A;  3PXG a;  1B0T A;  2XSF A;  5E3R A;  1JLQ B;  2OFG X;  4C0H A;  4ZP6 A;  3KLG A;  5F0W A;  2LFV A;  2VL1 A;  2XMJ A;  4KO0 A;  1T3N A;  1T05 A;  5A8W B;  3J7Z 5;  1JLC B;  5LSR A;  4Y2K A;  1M90 T;  1RT5 B;  3MR5 A;  1QAX A;  1KN6 A;  5HP1 B;  3I82 A;  2CDR B;  1WKJ A;  2GA7 A;  3AJD A;  2XYH B;  1W7W A;  3FNN A;  3PJW A;  4M5G A;  1JLF B;  2HZV A;  1V6H A;  2FD2 A;  2IFX A;  4R0J A;  2RHS B;  2YWW A;  1D9A A;  4JI2 F;  3QT5 A;  4OI1 A;  4WP8 A;  1RA6 A;  1X5O A;  5C42 A;  1RT3 A;  1KC8 T;  3NNH A;  1FDN A;  4LR9 A;  3FBF A;  1TVR B;  3MM5 B;  3PTW A;  4XDC A;  3ZZY A;  4DJB A;  3K5N A;  4HHH A;  4I2Q A;  4FP9 A;  2RF2 A;  2HHS A;  5G0R A;  4OQJ A;  3KLF B;  3LF0 A;  1SL0 A;  1NKC A;  1G1X A;  4DUZ J;  3Q83 A;  1FVQ A;  3TZZ A;  1FFW B;  1HQE A;  1EZZ B;  3AXM A;  3KDN A;  3MMC B;  4PG6 A;  1L3K A;  3SCL E;  1BWV A;  4ZIT A;  3MUV P;  4USJ C;  3DOM B;  5CZX A;  4JI0 F;  2OSR A;  4ZLJ A;  4MKB A;  4AT1 B;  1HBN B;  2VPX B;  1FD2 A;  1VRT B;  1WOS A;  1XMO J;  2ZC3 A;  1YTY A;  3FK4 A;  3HHL B;  5KFS A;  3H20 A;  2XHW A;  2PMZ D;  4CO4 A;  5KFU A;  4PQU B;  4X4T A;  2O5D A;  3AA8 A;  5ETR A;  2C2E A;  1F0X A;  3BBB A;  4ZS6 A;  2FHO B;  4CQ1 A;  2W7O A;  3FBB A;  3JSM A;  4K4W A;  3DLH A;  1TUG B;  3H8Y A;  4KGK A;  4W4M A;  2B5J B;  3CJ5 A;  5DET A;  1WHW A;  1RT1 B;  5KAK A;  1PBA A;  4UF4 A;  1O0P A;  2V4J B;  3TAN A;  4AQY J;  2ZC4 A;  5GAD U;  1U0H B;  3CCR S;  1R89 A;  3QWP A;  4ZVF A;  2VJV A;  4CCH A;  4WF9 Q;  4DV5 F;  5EWE A;  4KH1 B;  1RT6 B;  1U02 A;  2VKR A;  2QLJ B;  2RUG A;  3F44 A;  4LF1 A;  4IO9 Q;  1JJH A;  2DY1 A;  4LMZ A;  3T1Y J;  5T14 A;  1JLF A;  1UJ6 A;  2LU2 A;  3H0P A;  2MZJ A;  2LDI A;  4DUY J;  2U2F A;  3IR5 B;  2IRY A;  5GMD A;  4DEZ A;  4DPT A;  4ZCI A;  5I3U B;  3C16 A;  4NXN J;  2MTL A;  2BKN A;  1HBO A;  3QO9 A;  5HAO A;  1RCO B;  5A2Q Y;  1IKY A;  3IO1 A;  3OTB A;  1URR A;  3JYT A;  1S1X B;  3NXZ A;  3KG0 A;  3FQL A;  1P1T A;  1RBA A;  3DLB A;  3BH7 B;  1IUJ A;  4PG4 A;  3T6B A;  4EK2 A;  4XDD A;  4GC7 A;  2LQ5 A;  5LMN F;  5C24 B;  4LFA J;  2G0I A;  2MLY A;  1EP4 B;  1VYA A;  3NEK A;  5F8G A;  4XIU A;  3OSP A;  1T94 A;  1HNX J;  2RSQ A;  3QBC A;  4C97 A;  4JV2 A;  2IC3 B;  4RW6 B;  1RTI A;  5K8N A;  3H5X A;  1VFJ A;  2CPJ A;  4JI1 F;  1SQE A;  2GC8 A;  1JX4 A;  1D9D A;  4J9P A;  1FRK A;  2KB2 A;  2W9A A;  2HHT A;  1VQ4 S;  3GU0 A;  1LW2 A;  3TAQ A;  3OFH A;  1NRK A;  1VMB A;  5A8R B;  2KKH A;  1RTD A;  4JI8 J;  3AA9 A;  4EMD A;  3OVS A;  1MWY A;  2YWE A;  3HHL A;  1EJ7 L;  2OTL S;  5D3G A;  3E01 A;  3P5B P;  2ZH5 A;  2HS0 A;  3TAM A;  4DF4 A;  5BR8 F;  2GX8 A;  2R2T A;  3R1L A;  4M5K A;  5K8P A;  1K73 T;  4KO0 B;  1VQY A;  4CO0 A;  3MF5 A;  3EPG A;  2HBY B;  3OXF A;  2W4D A;  5AXM A;  4B3M J;  2Q79 A;  2W24 A;  4QW9 A;  1D8Y A;  4P73 A;  4BWM A;  1CC7 A;  4K2X A;  1HNI A;  3LP0 B;  2CVE A;  2RS8 A;  3K7R A;  4J9K A;  2Y9H A;  3AOB A;  1S4F A;  4PXB A;  2N7C A;  4WK3 A;  2LA4 A;  2XGP A;  1S9G B;  1BHN A;  1VQ5 S;  3C3L A;  2QMU B;  3DYA B;  3W3S A;  2DO4 A;  4LJM A;  4R8U B;  3O3L A;  3L7O A;  4Y0F A;  1TVR A;  1CS4 A;  1RAD B;  1NPP A;  3MM5 A;  3G8T A;  4XTT A;  3ELH A;  5A8K A;  2XS5 A;  3BBF A;  4NWB A;  2B7C B;  4ZP7 A;  2EI5 A;  2RF2 B;  2NPI A;  1O5J A;  3OHA A;  1N56 A;  1FJC A;  3W65 A;  4H4M A;  2Q6B A;  1SKU B;  2HGL A;  3PJX A;  4B9U A;  2MY8 A;  2CNO B;  2O1P A;  1OQ6 A;  4OYZ A;  1FF2 A;  1PIL A;  5D77 A;  3CCE S;  2M3D A;  3DHW C;  1RWV B;  3A8J A;  4RW4 B;  4F4W A;  3CD6 S;  2BKP A;  2DR5 A;  4OL8 A;  3RR7 A;  4DSF A;  3FKB A;  3M2V B;  3NKY A;  4ZVU B;  4ZJQ A;  2PFF B;  2WON A;  2DR6 A;  1BY9 A;  1M1H A;  1U1R A;  1E6V B;  3L95 X;  4QIW D;  4E98 A;  2OH2 A;  3MD1 A;  2KHD A;  1PG5 B;  2LXU A;  4C11 A;  2K7J A;  5IQ6 A;  1X9S A;  1MWQ A;  2HS4 A;  3R27 A;  3DFE A;  1H74 A;  1IR0 A;  3W2W A;  2XNR A;  2RQ4 A;  3OVB A;  2ZH6 A;  1TP7 A;  1YZ6 A;  2EFG A;  3PYF A;  4DI6 A;  1S6P A;  1DQA A;  2LP4 A;  3NGK A;  3VAF A;  3D6F B;  3RB6 A;  2Y0S D;  1FA0 A;  1FXR A;  3EGN A;  4L3N A;  5KFD A;  2VBY A;  3UNY A;  3BBC A;  4LF5 F;  3D3B J;  1U8W A;  1TV6 A;  1XMQ J;  3QAU A;  2GHW A;  3L4B C;  3R8Y A;  2HHQ A;  1HA1 A;  1CJK B;  1T11 A;  1H3D A;  1LK7 A;  5C2G A;  1SL1 A;  5KT7 A;  3LP0 A;  3D5M A;  2VBX A;  2CXE A;  3QIP B;  4CH1 A;  1RKI A;  2EC2 A;  3RZA A;  3UVJ A;  1RWP B;  2GMJ A;  4IH7 A;  4KE5 A;  5LSL A;  5EDW A;  1UA1 A;  3IP0 A;  2BAN B;  4UOH A;  1FWK A;  4LQ9 A;  4MYU A;  4FKY A;  1Z4U A;  3H59 A;  2R7R A;  4F0K A;  5H9E J;  2HMI A;  5HJY A;  2BX6 A;  2WVF A;  4DR1 J;  4DR5 J;  4Q0B B;  4C8Z A;  4YB6 A;  1DTT B;  1R0B G;  1JLG B;  2KXF A;  2RAQ A;  2DNZ A;  1Q8K A;  3JTN A;  4CWB A;  2V4R A;  5C24 A;  2LXI A;  3BGO P;  3ICL A;  4CYU A;  1CLF A;  2OFH X;  2FPH X;  3J7Y I;  5AE2 A;  2CPI A;  4FF2 A;  1OO0 B;  2BAB A;  3PRD A;  2V9W A;  2RHQ B;  2DTJ A;  1TKZ A;  2QZ8 A;  4JI1 J;  2A3J A;  4C48 A;  5EGY A;  2GO8 A;  2DR9 A;  1VQK S;  1N32 J;  2CQB A;  2BE7 D;  3KJF B;  3DRP B;  3DLL Q;  3CUL A;  4NRU A;  4JV5 F;  3D0G E;  3UD5 A;  1X4G A;  1UWA A;  2FZK B;  3IGV A;  2XY5 A;  1BGX T;  2EBG A;  1WHV A;  3BGL A;  3DLG B;  3DC2 A;  3MEG B;  1ARO P;  2LEA A;  3MED A;  2AJ0 A;  4I1T A;  3I0S B;  4OZ1 A;  4RW7 B;  3TO8 A;  2OPP B;  1FKO A;  2MKK A;  5E41 A;  3CPW R;  2QFI A;  2N3O A;  4X4O A;  4U9R A;  4DF8 A;  2XSJ B;  1FNX H;  2JL9 A;  4ZP8 A;  4DUY F;  5KFM A;  3AH6 A;  4NXN F;  2CDQ A;  3EM1 A;  3DOK A;  3FJ2 A;  1XMQ F;  2R7W A;  4TNO A;  5E5N A;  3H5Y A;  4QR1 A;  2CQ2 A;  5D0G A;  5HAT A;  2ILZ A;  2DNL A;  3JTO A;  5HVF A;  1KVJ A;  3UR3 C;  5HBM B;  1CBK A;  2M88 A;  4DV5 J;  5J2P A;  3DXB A;  2JC0 A;  5CCL A;  2MKY A;  1SUQ B;  3UVJ B;  1SIZ A;  2OPS B;  3C8Y A;  3M7V A;  4S0M A;  3IAS 9;  4ZVP B;  4J9O A;  4ELT A;  1QLN A;  1BLU A;  1C0U A;  1S76 D;  1S1W A;  1K1S A;  1YRT A;  4GO5 X;  4IG0 B;  3M30 A;  4CNZ A;  2OJ3 A;  2UU9 F;  4URQ U;  2H3E B;  4R25 A;  3AOD A;  3HFZ B;  4JP8 A;  2UXB F;  5M2P A;  4RNF A;  5DS7 A;  3QRP A;  1R6Y A;  1JLE B;  1TU0 B;  3IMQ J;  1P9Y A;  4OLO A;  3L3C A;  2X1G A;  4DOZ A;  1S0N A;  3HSJ A;  4ZIV A;  4FS2 A;  1ZYQ A;  4P2M A;  2DR8 A;  4U7C A;  2GFF A;  2VDI A;  2V4Q A;  2CQC A;  4OX6 A;  3P96 A;  2PC6 A;  1HWI A;  1MG7 A;  2Z56 B;  5IFM A;  3KHR A;  1U47 A;  2DXD A;  2UXC J;  1R31 A;  2YKO A;  1T7P A;  4QYZ J;  4ICL A;  1IQZ A;  4YOE A;  3GLJ A;  4ZKA A;  2IM0 A;  4M5H A;  2XCA A;  4DR6 F;  2IRU A;  3THT A;  3H4B A;  3Q8R B;  3KHL A;  2DHX A;  3MEE B;  3HZG A;  1RSC A;  2AWZ A;  2KM8 C;  3KUE A;  1N34 F;  1DAX A;  4F4X A;  1VBZ A;  3G2X A;  4OHY A;  2AEJ A;  3W5X A;  3UCU P;  1F6T A;  2CJK A;  2F4V J;  1LW0 A;  3J81 U;  1HW9 A;  2IMO A;  2PD1 A;  3LWL A;  2XSJ A;  4ZLP A;  2VQE J;  3DMJ A;  3MPD A;  4C0O C;  2I2Y A;  3A13 A;  3IM9 A;  4ZMM A;  1C4A A;  1CJV B;  2BZ2 A;  5CYM A;  1GMU A;  3M6X A;  1C1B B;  4ECR A;  2QIF A;  3RAM A;  1BQX A;  2KVQ E;  4KHR A;  2DNN A;  4FYY B;  1WHY A;  5B0E A;  3TOQ A;  3UDV A;  1ZTT A;  1T03 B;  2B4P A;  5FDL B;  1S48 A;  1UVM A;  1RU2 A;  4QW8 A;  2DRD A;  2YNI A;  3I4P A;  4KKO A;  2IBK A;  3OTO J;  2DGV A;  2CJY B;  4IG3 B;  5F3T A;  1FNM A;  1H73 A;  2C28 A;  2ROG A;  3SEO A;  2IYI A;  3JYT B;  4DR2 F;  3SFG A;  1W2B R;  1F1B B;  2HKE A;  3MM9 B;  1X9M A;  2V4J A;  1YSJ A;  1RP5 A;  3N0V A;  4EI2 A;  5KT6 A;  1HMV A;  2V5H G;  2J6U A;  1RZM A;  3GJQ B;  3H7H B;  5GVQ A;  1SC4 B;  5FD1 A;  3PYE A;  3C15 A;  2IJR A;  2WK4 A;  2AP6 A;  4B3S F;  4DL6 A;  4J5O A;  3KMQ A;  4P7T A;  2KO1 A;  4QR0 A;  4ETX A;  1BQN A;  2VU5 A;  2XZW A;  5KG7 A;  3PEJ A;  1F5B A;  3PFO A;  4N56 A;  1TFW A;  1NU4 A;  2ZUA A;  4BS2 A;  4QBU A;  3HO1 A;  3TA1 A;  4URS A;  2JLG A;  2LEC A;  4DR6 J;  1EQ0 A;  1IKY B;  1VJQ A;  3S7R A;  3P6Y C;  5HMY A;  1IM4 A;  2RML A;  2UV8 G;  3SCI E;  1N36 F;  1KSP A;  3K8W A;  2HVZ A;  3DRR B;  3KLI B;  3UCZ P;  3QGG A;  2GGP A;  1HI8 A;  2JDJ A;  3OUY B;  2OPQ A;  4U96 A;  4DFJ A;  3EYZ A;  2JEF A;  4GO7 X;  4NLV A;  2DJW A;  1UTA A;  3RBX A;  3MTJ A;  1S7H A;  2BW2 A;  4KBI A;  5K20 B;  4Q8F A;  3MR3 A;  1RAG B;  5KG5 A;  4BC7 A;  3C14 B;  3PJ9 A;  4NLU A;  5D3G B;  2VIC A;  3TUZ C;  2CIM A;  3KXD A;  2G2Y A;  4P2F A;  2C2O B;  3N6M A;  4P7V A;  2A6O A;  2NXC A;  3CME S;  3UPF A;  1G4C A;  1IVZ A;  3CT9 A;  1QAY A;  5A2Q U;  1RAE B;  1SH2 A;  2ZZN A;  3V6J A;  1AUD A;  2E9T A;  3MMJ A;  1NK6 A;  2ZWO A;  2QMX A;  1F9F A;  1VS3 A;  3SSQ A;  2HRU A;  1KS2 A;  2Z2M A;  1ZTW A;  3DLJ A;  2YWH A;  5MAO A;  4DR1 F;  4WWS A;  3OTE A;  4DL2 A;  1LW2 B;  2E5H A;  1RT4 B;  3DNC A;  4O3O A;  5DG8 A;  4NLX A;  3QSI A;  3T1H J;  2XY6 A;  1KRP A;  1F2H A;  2OGU A;  1LXJ A;  2W7A A;  3RB3 A;  4LFC F;  1TKT A;  4NI2 B;  4H4K C;  2Q1L A;  2XTJ P;  4DV4 F;  1LWF B;  2HFU A;  1GTE A;  3B4M A;  1VBY A;  2VC0 A;  3C6U B;  4OYB A;  4UOG A;  4X4U A;  2QLF B;  1UVI A;  1PAU B;  4WII A;  1KHW A;  2DIT A;  3QFH A;  1SH0 A;  1GAO A;  3PW2 A;  1TK0 A;  4DV2 F;  4CO1 A;  4GKJ J;  4ILM A;  2NQP A;  4OYO A;  1NK5 A;  1U48 A;  1BUX A;  1H7X A;  1S4E A;  1S6P B;  4CLS A;  2V69 A;  3HPO A;  3HM9 A;  2GML A;  1Y00 A;  1C1B A;  4BDP A;  1WG4 A;  2BQU A;  2IAJ A;  3G71 S;  4WE1 A;  1WOR A;  2WOM A;  2W7P A;  4USI A;  4YB7 A;  3QSY B;  2IYG A;  3CMA S;  3JQM A;  4YUD A;  4USK A;  3W63 A;  4RUH A;  1HPZ A;  4KH0 B;  1N54 B;  1SQG A;  4LSZ B;  4DXL A;  3W62 A;  5KTQ A;  2K1R B;  1Y5L B;  4I69 A; 
#chains in the Genus database with same CATH homology
 2W2O P;  1V5I B;  3AFG A;  3QFH A;  2Z2Z A;  3GCW P;  4NMX A;  3A3P B;  3GCX P;  4OV6 A;  3WIU A;  2Z2Y B;  3BGO P;  3VV2 B;  2Z58 B;  3VHQ A;  2QTW A;  2Z56 B;  1SCJ B;  1R6V A;  3SQO P;  2E1P A;  3CO0 P;  2ZWO A;  2W2M P;  3H42 A;  3A3N B;  3P5B P;  4K8R A;  3BPS P;  3WIV A;  2W2Q P;  2W2P P;  2Z57 B;  3T41 A;  1SPB P;  2W2N P;  2PMW A;  2Z30 B;  2ZWP A;  4NE9 C;  4YN3 B;  3A3O B;  2XTJ P;  4JP8 A;  1ITP A;  3WHI A;  3CNQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...