3W62A

Mamm-ctd e289a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
78
Chain Sequence
HMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADMIIGVDPENTVEQAHEICEAVQAAVGKIRRIESLHVSAAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Magnetosome protein MamM
publication title Cation diffusion facilitators transport initiation and regulation is mediated by cation induced conformational changes of the cytoplasmic domain
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal transport
total genus 23
structure length 78
sequence length 79
ec nomenclature
pdb deposition date 2013-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein, cytoplasmic domain 3w62A00
3W61A 3BYPA 3W63A 2QFIA 3W5YA 3W8PA 3W60A 3W5XA 3W62A 3BYRA 3W8GA 5HSPA 2ZZTA 3W65A 3W5ZA 3W64A 3W66A 3H90A
chains in the Genus database with same CATH superfamily
5HBMB 2VU5A 5KOWA 1AZSA 3PZPA 1XNQF 1BHNA 3I0SA 4NXMJ 4JV5J 4ZA1A 2DB1A 3QZ7A 4PWUA 2JLEA 1SQGA 1R0AB 4EZ6A 2WBMA 1RAFB 2YWKA 3NOGA 1G7CB 5F8MA 3MTKA 3E2EA 3C66A 1XMOJ 4CLTA 2YVSA 4FF2A 2D3UA 2C2ZB 4HTJA 3HULA 1UWBB 1T05B 2XLIA 2IPOB 4LFAF 2MZSA 4LRDA 4QIVA 2J76E 4KAIA 3PXGa 3AODA 2Y1JA 3ZZPA 1OPZA 4FP9A 3K5NA 2DO4A 3J81Y 1HFEL 3TUPA 5KFMA 3I96A 4DDFA 5F8HA 4K4XA 1N6QB 5HP1B 1NBEB 1M5OC 4ZP6A 3CUNA 2KJVA 4LF8J 4K4TA 1DQ8A 4FZVA 5J1EA 1IM4A 3P4UB 4UOHA 3DNCA 3CCLS 5KFZA 1ZPWX 1BWEA 2IYIA 1CJKA 3ZO7A 1YHQS 5BJRA 4H4OA 5A8RB 4AD6A 3CCQS 2DNOA 3K8WA 4JI2F 4ERDA 1WHYA 3LH2S 2GMJA 2FY1A 4G65A 2WW8A 3TVZA 2BKPA 2HFUA 2XO6A 4IUFA 1PC4A 1RLDA 1VQYA 4C0BA 3HT3A 2CPZA 1HLWA 4EO6A 2JEFA 4WTYA 5H9FJ 3UFCX 5HANA 3IXQA 2DGOA 1XNRJ 3MEEB 3MEDB 5HO4A 3T5HA 2HVIA 1JLGB 2FIUA 4YB6A 4O3SA 2CADA 4X84A 2IM1A 2WVDA 2B9WA 3RAMA 3CMQA 3TO8A 3A8KA 4USIA 2MQMA 3PKYA 2VFTA 1NDKA 3H42A 2K3IA 5KT2A 1TQLA 1A7GE 2QA1A 4M5MA 1S1XB 3CJ0A 2W01A 1VRQC 1SKRA 5KFEA 1ZM2A 3H90A 2ZM6F 1QY7A 4CTAA 3LUYA 2CFXA 4CLZA 4P72A 3QSYB 2GZOA 3H0PA 1XEZA 4EBDA 1S76D 5KFYA 3GCWP 3TJAA 1S59A 2BEFA 3H4BA 4LIWA 4JI6J 1N33F 2VG6A 4ZN3A 4C3LA 2FYXA 3E8OA 4FS1A 4LQ9A 4MYTA 3L95X 2I8EA 4GVBA 2RHSB 1AA1B 4NYPA 4QYRA 4U7CA 2GA7A 2XMTA 4WP3A 5D15A 5C42A 3PM9A 4NLPA 5HQLA 2F8HA 2FGCA 5F8LA 1CLFA 2C2EA 2V0NA 3IWNC 3H59A 1UVMA 2DNHA 3HFKA 1UW9A 4X4OA 3MR2A 2ZDOA 3V6JA 4X4VA 4M8LA 3JSRA 3EPIA 5I42B 1F5BA 2XWYA 4KYZA 1HBMA 3SV3A 3N9UC 2LXFA 3VGUA 3I9ZA 1FA0A 4DPOA 2B6AA 5CYQA 3LAKA 5A0YA 2R7WA 1FTCA 2ZKUA 3D1OA 1IR2A 4DU7A 3AQOA 4ZLPA 2FVSA 2LA6A 4ATNA 1LOUA 1S0VA 4CLLA 1VRTA 2NYHA 5D0HA 4FBTA 5ETRA 1RT4A 4P52A 3D54A 4C97A 4RW9B 4F2RA 3MZIA 5LOQA 2OKQA 1S9GA 2BM1A 2CNLB 2OPRB 4LMZA 3BGLA 3TR5A 4WBFA 1OY6A 3UW1A 2DR5A 3CT9A 2ZBCA 1TMMA 4CNYA 1U1OA 4DS5A 2PFFB 4YUDA 1FRHA 3N4WA 4OX9J 1KR4A 2R8HA 1H72C 2LECA 1RT2B 2V94A 2F5GA 1FO1A 4DHVA 4QIWD 2J6TA 2YKNB 3SQGA 4ES3A 1Y5IB 2NS1B 4WTOB 3CTRA 2MXYA 3RB4A 5HATA 2AGPA 4RW7A 2B4PA 2CQGA 1HMVB 4K5SA 1AUDA 3I5CA 1W2BR 2IDLA 1KSPA 3PEJA 2DR8A 1IJFB 4IFVA 4DV7F 2EK1A 3OFFA 3BQ0A 4K5RA 1VLOA 1UMJA 1R7IA 4WXOA 4FNIA 3KUHA 3NL0A 2XCPA 1FKOA 2XYPB 1DTTA 1EP4B 2J9EA 3E3XA 3WZ0A 4ZPCA 1FXDA 1UPPA 4ZVGA 2XQCA 2D1CA 5C7PA 4WZQA 1S57A 2MYFA 3QFWA 3WX4A 2HQDA 3ADAC 4WYLA 2UUWA 2R7OA 3W7BA 2W25A 2HHTA 2GQ2A 3M8QB 4QWAA 1X4HA 5KT5A 3KK3B 4DV3J 3LW5C 1FNMA 3Q83A 2VBZA 1WACA 1WC3A 4QWDA 3FGVA 2HS0A 2QLBB 3BGRB 3VTIA 3LQVA 3D0IE 3HFVA 1TL4A 4FXDA 3UD4P 4JI5F 2BR0A 2C2NA 2VA3A 3FQKA 3JQJA 3P96A 3BSCA 4CLSA 2UV8G 3FBCA 2CNKB 2HWHA 3NS6A 2VBYA 1VBZA 2P9CA 3QT5A 3R1HA 3GSIA 2W8KA 4XO0A 1FESA 3PRBA 4AUKA 4DPTA 2DYAA 2HRUA 2LU1A 4DCOB 1YJWS 1YJVA 2RQ4A 4FF4A 3GYNA 3CCZA 5MAOA 2E1AA 2PA8D 4QWEA 4L3KA 5ETMA 2UVWA 3GONA 3D7SB 3K58A 3HP6A 3OVBA 2LVWA 2R4FA 1N5VA 3HK2A 3LP1B 3JXOA 4ELVA 1RADB 1FVSA 1Q7YT 4WE1A 1TVRB 3CCRS 3BO3A 3AXMA 2YNFB 1TUGB 4IG0B 4OHYA 3A13A 4ZS6A 3QT7A 4V19J 2PEHA 2HHVA 4ECUA 1LEOA 4U7UD 1ZA1B 3AOBA 2VOPA 3PW7A 2IBOA 3K5LA 1OQ6A 2CQBA 4FYYB 2ZZNA 3QT8A 1RHQB 3CIMA 3UCGA 4KT0C 4N8OA 3DLEB 3EGNA 4J9PA 1KQGB 2F1FA 1RTJA 3EM1A 2HHXA 2RB7A 4DR2F 2WVCA 3NNCA 2DGTA 1BUXA 3SSQA 2LMIA 4F4AA 2BMBA 3ZZZA 2BUNA 2XZTB 1UFWA 3HO1A 1I5OB 1JXVA 2DGQA 2VQFJ 2H54B 1HYSA 1AZSB 2YNIA 3VVTA 1MMNA 3I0SB 2XSJA 2W4DA 1T3NA 4WF9Q 3K89A 2YY3A 1KHWA 2Z57B 2C2OB 3JAMU 2P8IA 3OD2A 2ZHBA 4B9SA 1NPRA 3FMWA 3VHQA 4DV1J 2Z2MA 2F8MA 1IBCB 4X64J 1W2IA 2FVQA 1YZ6A 2P6SA 3C15A 1MWZA 1UETA 1CPZA 2ATLA 3TX0A 4EI2A 4GC7A 3FEXB 4ZLJA 4AL5A 3R5DA 3T1HJ 1X60A 2W7AA 2L48A 2EWHA 3J7ZT 2VV5A 1BLUA 1XN9A 2P6TA 1MMLA 3H98A 1Q16B 1M5KC 2ZUAA 4Y65A 3B82A 4J9UE 4DEZA 5CYMB 4K0KF 2VQEJ 4OI1A 1JJ4A 2WCXA 1HKAA 3FFIA 1I94J 3FEZA 2B4VA 1L3SA 4ZPVR 2RS8A 4USWA 4NLVA 3NWRA 3AAWB 3K5OA 3EZOA 2EG1A 2Z56B 3IM9A 3UN5A 3JS9A 4ZJQA 4IFYB 3OL8A 3M05A 4EFAC 3NS5A 1PBUA 2B4OA 4NA2A 3ETMA 5DZ6A 4R8UB 3OFGA 3DLKB 3OUYA 4F0HA 2QSWA 3OXGA 1NDPA 1ZAWA 2E7VA 2PEBA 3C14A 3L3CA 1RWUA 3PY8A 3CD0A 1LW2B 2QG9B 3JSYA 3BM7A 5CD4A 3OL7A 4EYIB 3T5LA 3GR1A 2ASJA 1TELA 1AFJA 2PA3A 1F9FA 3MCMA 1SVDA 2AKWB 2VONA 4B3RJ 4X66F 3GIRA 1GEHA 3MOZA 4NLDA 3IBFB 4IDKA 3CJ8A 3IR6B 1OSDA 1XR7A 2XI3A 1PG5B 3O6QA 3LOUA 4OJ1A 3GFZA 1VC5A 4NZ6A 2NYIA 3PYFA 3D0HE 3UR3C 4NCGB 1UP1A 1VJWA 4FXWA 2E29A 4X65J 1OPIA 1RGVA 4LQ3A 3MHYA 4WFZA 1PAEX 2UUAJ 2B9YA 4CTAB 2IVFB 3U1LA 4TQSA 1BQMA 1ZYQA 2DY9A 6FDRA 5A2QU 2YWEA 2OAUA 5F3ZA 5GVQA 2CQCA 5A8WA 2VG6B 4XK8C 2QX0A 1SIZA 4M5JA 3ENWA 2QFIA 2FVRA 3ZNJ1 5C42B 1CC8A 3TVYA 2FPHX 3QLHA 4ID5B 5LT5A 3R7BB 2IRXA 2CPDA 3T1YJ 3OR1A 2DVIA 3W3SA 3ILOA 1SC1B 2HBZB 1U8WA 1LFPA 1U1LA 2IVYA 3NLCA 1EETA 4BC7A 2GFFA 2BOPA 2HNDA 4LF1A 5K20B 3HHLA 2XYGB 3M6VA 4PXDA 4NE9C 1FEHA 1O0PA 4TYBA 3JTOA 2CG4A 5CYQB 2RE1A 3NCRA 4WIQA 4PWDA 1RQ0A 4E0DA 4RZRA 2HQIA 3K57A 3WIVA 2HHHF 4RUHA 2UUBJ 2P9GA 4OYAA 3W8PA 2PT0A 2NCKL 4QZVB 5DG9A 3E01A 2BDPA 1U1NA 3FDSA 4CO0A 5HMZA 3FK4A 3OL6A 3W8GA 1S9GB 2KL8A 1NNDA 3RBZA 3DLJA 3KWMA 2KH9A 1G6BA 3I32A 3KK2A 1Q86T 2LXIA 3ZNUA 1Q81T 2N3OA 4NCBA 3LGMA 2JFDA 2UUCJ 3TJ8A 2VOOA 3D67A 2YWGA 4ZHRA 4M5KA 3IMQJ 3D4JA 1UCNA 4N8NA 4MFBB 4CM0A 1QTMA 4WKYA 3CC4S 3SQGB 2OD4A 2ZJPQ 4QQBA 3HVWA 4O23A 1VDHA 2JWNA 3G6XA 5IT9Y 4KO0A 1QSSA 1KQKA 3LPEA 5J2PA 4CH0S 4RW7B 3RB0A 2MQOA 1FNOA 3PACA 5IV4A 5KFSA 3SI8A 2ZZTA 4JP8A 3L4BC 4R25A 3H40A 4ELUA 2RQCA 1IN0A 3R5BA 2XS5A 1FD8A 4V19X 4DV5F 2KI2A 2CJBA 2VDHA 3J80U 3R5CA 2RUSA 3VAKA 1FKOB 4DJBA 1DTTB 2NPFA 3G6VA 4S0MA 4UUWA 3W5XA 3JYTB 4N56A 2AEFA 2ZC3A 4WFXA 5F0WA 1OQ3A 4DR7F 1J5EJ 3HHKA 3VAHA 5KG6A 2J7WA 3BSAA 3IA0A 5J1PA 1S6OA 3P5BP 2HS4A 1HWIA 2XMVA 1YQHA 3BDEA 3LPYA 3NS7B 4USVA 2AMCB 1WC4A 3NCPA 4TU7A 2MHNA 1FVQA 3WQPA 1VQ9S 1AT1B 3GV7B 4DF8A 1RT3B 2N7CA 4P7TA 3TUZC 3VAJA 4HL9A 4UT4A 2KRBA 5IM0A 1CQMA 3D1HA 4KHRA 1R8AA 4KTQA 3D2WA 2J0XA 2V9WA 3KHLA 1FEEA 5IWAF 3C8YA 1VK8A 4AL6A 4DX8H 1NDCA 3CC2S 4A8FA 5K9FA 2ATCB 2DR7A 3UVJA 4J90A 2Z2YB 1U0HB 1W7WA 2ZVSA 3R8YA 1OS5A 2IDEA 3GJSB 5KFXA 3A3OB 1XBWA 2DEJA 2CYYA 3ZZUA 4KH1B 3LWMA 3TA1A 2W9AA 1NPPA 2HZAA 5AXLA 4DFKA 2ILYA 4PYAA 2VFVA 5KFFA 3J7A1 5GMDA 3I55S 4NZ7A 1TL1B 3PJ9A 1SIWB 1WKLA 3TAPA 1FJCA 2VIHA 1SI9A 4WU2A 2H51B 1FJ7A 1T0TV 4ECQA 2MY8A 2RUGA 1AROP 2UXDF 4JI3J 3IP0A 1NK7A 2DH9A 5ETNA 4Y28C 3ITHB 2G0JA 1PYOB 5F41A 5L1KA 4DL7A 2CQ2A 2W2OP 2KT3A 4NPOA 3RUBL 3HXMA 1MNEA 3BKFA 1FERA 2CAJA 3ULHA 1Z1ZA 1KN6A 4C11A 3MMBA 3O1LA 4A8KA 3J81j 3TI0A 3W9JA 4CLYA 4KKOB 2WSEC 2KG1A 1ZS6A 2VDIA 2YH1A 3QIPA 5BXIA 3KJVA 5L1JA 4USTA 1HNZF 1JIHA 2JJ4D 2PN6A 4F4KA 2AJ1A 5RUBA 3PIOQ 1NK8A 1HI0P 5D4LA 4WWSA 3V4IA 1RSCA 3W65A 9RUBA 5H9EK 2EI5A 8ATCB 3RR8A 4PUOA 2YNIB 4P74A 1CULA 2A18A 3Q8YA 4YY3J 1H7XA 2XSJB 2V8HA 2YWHA 1SQEA 5CZVA 3JSBA 4HLBA 5E3CA 2QT7A 1EIYB 2ZE2A 4ZVOB 2AYGA 1KNZA 2W2PP 4CLFA 1F6TA 1PAUB 3FBEA 3TA2A 3C15B 3MXHP 3PRDA 2KT2A 2BJ7A 2Z2ZA 2ALYB 5E33A 2Z0GA 3MAAB 2PSZA 5KG2A 2Y1LB 1QTNB 1K44A 2CPXA 2QMWA 5DLGA 4HDHA 3OW2R 4F26A 4RWWA 2R7TA 4TU8A 5DGBA 2EFGA 3BS9A 4OI6A 2V2ZA 1RT1B 1VQOS 5HROB 2MLXA 1R43A 3AB2B 4X62F 2POKA 1HNXJ 2CQIA 1U7LA 4Y6IA 2XY6A 3NKYA 2M5YA 4W90B 3TAMA 2XM3A 1P9QC 4LSLB 3TX8A 2OPSB 2QRRA 2CNNB 3NMAA 2IA0A 2HWTA 1P27B 4J9VA 5KT3A 3M30A 1SV5A 4LF6F 4KHPF 1Q8LA 5C25B 4KHMA 4ICLA 2MQLA 4ZVHA 4MYUA 1ZBTA 1VR6A 3C14B 1NLKL 1XMQJ 4P10A 4K2JA 4DZDA 4I56A 2D41A 1VQKS 3BF4A 1N5SA 2BW7A 4DR1F 3Q8QB 1VLYA 1FFSB 5DDQC 1S4EA 4DL6A 3BQ1A 4DV6F 2HLUA 2BRLA 4IDKB 2CJYB 4LJMA 3R9LA 5IZHA 3H5UA 1XK8A 4RJVA 3HDSA 4DV4F 5KFWA 3W9IA 3SMZA 5LMNJ 1EJ7L 4LREA 2J5AA 3NEKA 3I87A 1DJ0A 3Q89A 3HSJA 5LMUF 4TNOA 1WF0A 3FKBA 4NRTA 2YXLA 1KVKA 1V3SA 1RWOB 4P2FA 4C3MA 4I64A 2GNKA 1Q82T 4NYOA 4YEAA 3J81U 2X51A 4EUVA 1YJ9S 4YR3A 1VQ7S 1RWNB 2Z30B 4PWWA 5LXYA 1X9SA 4DV0J 2HHWA 5KFOA 4ZVEA 1S9EB 3M6WA 4OHZA 4IH6A 1NCLA 2ZUGA 3QLHB 4C98A 2W2MP 3THTA 3TEGA 2DHHA 2N4DA 3RRHA 4MMOA 1YWXA 3V2UC 2VHGA 2ROEA 4M63A 5AJ3F 1C1CB 3T5JA 1QAYA 2VFRA 1K1SA 3DRXA 4KRWA 2OP5A 5B0CA 4MTPA 2G2YA 1NB7A 2FJDB 3R5GA 4WFNQ 2DCUB 5U47A 3DGPA 1OO0B 2A6OA 2D9PA 4H4KA 1VHFA 3HI9A 1GMWD 5DGAA 2A6MA 4Z7YA 3MM9A 4Q0BA 1ZTWA 3SCKE 2XULA 2OUGA 3HD1A 2N4CA 5E5NA 1LWXA 4R0JA 4JI8J 2DISA 4ES1A 4ZCIA 3E01B 1CS4A 2E5LJ 1N36F 4KPYA 3AT1B 4DMZA 3L7OA 2RD5C 1VK3A 4L72B 2OSQA 2YX1A 2QV6A 3HSZA 1O51A 4F2SA 4CLUA 3DOMA 1VQ6S 1HARA 3GFXA 1KOHA 4RBVA 2CPHA 2WOMA 2EFVA 1W25A 2XB2D 3K7RA 3P8BB 3HVAA 2QYCA 5L9XA 4PQUB 2QA2A 1HNIB 5KFJA 2B56A 3B78A 2BVZA 3SV4A 5A8KA 7AT1B 3IGVA 2GGPA 4Y2KA 3W5YA 4PPDA 4NXMF 1YBUA 3U1NA 2A1BA 2YQ0A 1RABB 2B3TB 4LF9J 4HH1A 3M9OB 3TJ9A 4NL5A 1RDRA 2RHQB 3OLAA 4FN5A 1IKYA 1HNWJ 2XO7A 2BJDA 4OHVA 4DV2F 2MHEA 1R89A 3M7VA 4PPZA 4RKUC 2NXNA 4DBQA 4O44B 1UW4A 4K4ZA 1U6ZA 1DLOB 2JEGA 4O4GA 2CJAA 1JKHB 2J7UA 2AYBA 3HZEA 1Q0NA 2M4MA 1WTBA 2A10A 3DOKA 2XYHB 4Q43A 1NJIT 3VZIA 2MLYA 3A4TA 1OYEA 2JHEA 1TKZA 2KVQE 4DL0C 5D0EA 5FJ4A 1HL6A 3N6NA 2HAIA 3J7YI 4ZCMA 5A76A 4B9LA 5HQ8A 1F9EB 3F0NA 2FDNA 3KDOA 5B0BA 2PMZD 1F2HA 3M8PA 1RHJB 3POTA 1FD2A 1QUVA 2JLGA 2R3VA 3K5MA 4YHHJ 2EPIA 2BE2A 2CJXB 3SSSA 4USHA 4KJIA 2ZOMA 2RDJA 4DF4A 2NSBA 1QD1A 2FZGB 3AXKA 4HHUA 2GIRA 4BDPA 2ZH5A 1N8RT 1DZ5A 4HH0A 2ZBQA 2Y8YA 5EWEA 1NKEA 3GTYX 4ER8A 4C8KA 4W98A 5K8OA 1UFLA 2X3GA 1KQFB 3C6TA 4QIGA 1YGYA 1XNRF 3AHPA 1BY9A 3MCNA 3T41A 2VC0A 1IVZA 3JAMY 2JL9A 4ED5A 3RW6A 1TL7A 2ZHOA 2OIHA 1T95A 3I0RA 4JYAJ 3MGJA 4FYVB 2GS8A 1NHVA 1PJ6A 3D3CJ 1WHVA 2AYMA 1X5TA 5KT6A 2C3OA 3GFYA 4DQIA 4Y2MA 2LQJA 2Q1LA 2V8PA 4C11B 3MMBB 4OYOA 3HM9A 1S1VB 5THWA 3ILJA 4R0EA 4PQAA 3QZ8A 2NXEA 2R7RA 3WDOA 1EB0A 2DNNA 4DX5A 1X5SA 1QLNA 3RZAA 1YBTA 3QIPB 2FC8A 2YKAA 4C8ZA 4HHJA 2Y1RI 1G4CA 3I4PA 2FHKA 1T9VA 4ED6A 2AGOA 2KDOA 4JI6F 4LFBF 2BQUA 2V2KA 3V4IB 2IRYA 3QBCA 5DQIA 2EFNA 2C3MA 4GC6A 4AT1B 2DGVA 1RWKB 4PUOB 1SC4B 2H5EA 3D6TB 1KBRA 1TKTA 4QBUA 4GKJF 1HD0A 3I5BA 4G1QB 1V5VA 5J1NA 1HBNB 1GFWB 5ETVA 2KN4A 2ZE2B 4RX6A 3EDRB 4LBPA 2GHWA 1U2RA 1P8GA 2B7CB 1NAQA 1EARA 2MKCA 3BH7B 2C2KB 3SCLE 4CNZA 1L5UA 1M5SA 2H3EB 3BBCA 4FBUA 1U0SA 2E1RA 1K47A 4AQYJ 1SJFA 3O3LA 4OI2A 2QMXA 3VAGA 4FF3A 2QLWA 1SCJB 2QYGA 5AE3A 1ZA2B 4IG3A 1TU0B 5EHHA 4C8LA 5LSRA 5AXKA 5M2RA 3R2CJ 4UW2A 3N5FA 1BE4A 1U26A 1HQ2A 4LSNA 3VWSA 4CO4A 4B3MJ 3DYAA 2RH3A 5I3PA 4O3RA 4YP3A 4L3NA 4CO3A 2X1GA 4QIFA 4I2QA 3JSMA 1WOPA 1JXEA 3BJYA 3C16A 2UU9F 4WFBQ 2V2VA 4LBIA 1RYRA 5GAHU 3TAMB 2ADCA 3M8ZA 1BD6A 4PYDA 2OLWA 3U7JA 1MW7A 1K8AT 1HQEB 5HN0A 4K4SA 2IM0A 2W9CB 2CPEA 4OX9F 3MEGB 1GTEA 1FX2A 2KFYA 2FJVA 4N7TA 3TWZA 3GLJA 3C2PA 3GJQB 4J9QA 1SV5B 4XDCA 3HHDA 3CO9A 2B8QA 2DY1A 4XDDA 1S97A 3AD7C 4ICLB 4DLGA 3W5ZA 2IJNA 3LGNA 2DNMA 4ED7A 2A0FB 5B09A 5HQMA 1KDNA 1QAXA 4I7FB 4I67A 4XPCA 2QN6B 4IH5A 4I6AA 1RBLA 3ZTQA 3R5JB 3KJNB 2BANA 2Q6BA 4NA1A 1CSJA 4IO9Q 4WK3A 1U1PA 4M1KA 4NX9A 1CJUA 1IKXA 4MK8A 1DFDA 3CDUA 3TUJC 3QJLA 5IC6B 1RACB 4IYQA 1XMBA 4PG8A 1RT5A 5D0GA 2ZD1B 4DWIA 3EZ5A 1N54B 1MWYA 4NASA 3UD5A 2MGZB 1FCAA 4DV3F 3KUEA 2KO1A 4Y2IA 4RW4A 3W62A 2UXBF 2V4RA 5DDRC 4UY85 4ILLA 1ROFA 4PEOA 4ECSA 2PMWA 1HW9A 2R7VA 3LANA 1Y9OA 3EDQB 2OI2A 2GV1A 5L9NA 3CULA 1UEKA 2J7KA 1GTHA 4MK9A 3TZWA 3F41A 2VFUA 3DFEA 1EAYC 4WXWA 2JX2A 4Y00A 1F0XA 1TKXA 2VL1A 2AX1A 3DGVA 3DRPA 4U9RA 3W2VA 3CSKA 2DNRA 2ZKTA 4ZVUB 3CJ5A 2CQDA 2HFSA 4RNFA 3F73A 2V4JB 2HRYA 4JBCA 5EGYA 2XGQA 1KS2A 3D9BA 3BB5A 2OTLS 2DD8S 1IWGA 2FJBB 1WC5A 3GCXP 2ZWPA 2V8GA 1KRPA 4AFFA 2C3UA 5D8HB 1D3WA 4KIAA 2ZM6J 2LQBA 2BE9B 3EGZA 4A47A 3MM9B 4F4YA 3RBDA 2YNHA 4DFJA 2IY5B 3VR1A 1ZM4A 2IMWP 4D3HA 3SBMA 4OX8A 2XHCA 3J80Y 4CCHA 4QU6A 1LQ9A 1T9YA 2HFOA 1PKUA 2K1RB 1N33J 2XHWA 4EWTA 1TTHB 1DY3A 1N32J 2VG5A 2WOMB 3LALA 3R6GB 3KLGA 1U1RA 4M95A 4NYZA 1H73A 2DO0A 3BREA 1YIJS 2VQFF 2HRTA 3MOJB 2BW2A 4JI1J 4RNMA 4DV1F 4KB7A 3NXZA 5J2MB 5D4NA 4DN9A 2BRKA 2H9ZA 2C2MB 1IKYB 2I1RA 1I51B 3DI6B 1WHWA 3EVMA 1N34J 3LP2B 2K7KA 4ZDNA 1S72S 3O44A 1S7HA 5KFCA 3L7UA 4K4VA 3OXFA 3KDNA 3ZZRA 4F4XA 3T1HF 3V6KA 4O4GB 3QGIA 1X0FA 4LT6A 2OPPA 2GMHA 3DRRB 3ET6A 3MR6A 3GG1A 3OR2A 3ETOA 5B7WA 5C24A 1TK8A 2W4PA 2VQEF 2N82B 5KOXA 2AWZA 1E6VA 2BKOA 1I94F 3NCQA 5D4PA 1MN9A 3QFHA 5GAHI 3EICA 3A8JA 4N76A 3K2YA 1NZ8A 3UCZP 2X3DA 4P2XA 4EMDA 5ETTA 5ETQA 5L1IA 1CJTB 3OVAA 3OFHA 1IKVA 1FWPA 2BE2B 5F8GA 1TK5A 2L3MA 1HHSA 4OZNA 5FD1A 3G4SS 2O1PA 2ZH9A 2B43A 3GV5B 4MJKA 2MKKA 3AH6A 3RGIA 2RU9A 1RCXB 4B9UA 1S6QA 2E1MC 1T11A 2CJQA 1GT8A 3QO9A 2RKIA 3ZTSA 1SL1A 1FHTA 5CH7B 3H4DA 5HL7Q 1RTIB 3OTCA 4B3RF 4B3TF 2MZQA 2ZH8A 3VGVA 1FXRA 4PG4A 1D9FA 2XNRA 2R7SA 5IT9U 1NKBA 3V81A 1Z2ZA 2I0XA 4CQ1A 3H5XA 4HDGA 1RKJA 3ZZ0A 1CVJA 2ZNYA 4X65F 2RRBA 3KG0A 4HT7A 1VHIA 3MM7A 2UUAF 3AA8A 1OY9A 5K14A 4Z37A 2PFDA 4NOHA 1LW0B 3FMBA 2WSCC 4OYIA 2EEYA 5KFKA 3KYLA 4MKBA 2JVRA 2HGMA 2WBRA 1H2UX 2VKRA 1QE1B 3KLIA 3W63A 2MB0B 1GK8A 4K59A 2OJ3A 5I4MA 1S10A 2IBKA 3NOCA 2QFJA 1ITPA 1PGZA 1H98A 2ZH7A 4B9NA 3RBXA 2IYGA 3M8RA 1UJ4A 2DGWA 1RT6B 1SBRA 3N28A 3AFGA 4WPAA 1O5JA 1RTHA 3PNIA 2EFQA 3QT6A 1OY8A 4N77A 4ZP7A 3MM5B 4M5DB 4OQJA 3UI3A 1KLMA 2GX8A 2YH0A 3T6BA 3TVKA 4TVAB 3KJFB 2HBRB 3R6LB 1S12A 4QPXA 2ILZA 1Q53A 5DJBA 3ZZYA 1JLQA 2IC3A 1RTDB 3IG1A 2AQ4A 2EC0A 3BH6B 4IG3B 4NA3A 2ZH2A 4WZMA 2KG0A 1NEEA 4CT9A 3G9CA 2UUBF 4EEYA 2P2CB 3FCVA 1SH2A 2YKQA 3MR3A 4DQPA 3MM6A 3QNWB 4F4ZA 2CG8A 2D7SA 5E7OB 2WONA 4ECVA 2PIIA 3KLVA 3TP2A 2YQ3A 1IKWA 3FRYA 4I2QB 1UTAA 5D4OA 3OLBA 3IN5A 3B6BA 2EFPA 3BO4A 2HVHA 1I1GA 1CJVA 3KXDA 4Q2MA 1N4LA 1NK0A 3FEYB 4BHQA 3RAQA 2V68A 4NXNJ 4Q8EA 4DG1B 3BBFA 3KK1B 1MROA 1RKIA 1VQMS 2FZCB 5J2QA 3PVXA 3CEDA 2K06A 4NLSA 2LCWA 5FLXY 5ITHA 6FD1A 5JMNA 1WD6A 3DCAA 2I2YA 3IWLA 2FGOA 1XIQA 4K50A 1KKHA 2BANB 3FQLA 3MMAA 1X5PA 2C22A 1S1UA 3VV2B 4K0KJ 2N3LA 2WB4A 2KXFA 3FBFA 1GMVA 5LL6d 4DOZA 1C0TA 3U1MA 3LP0B 3CCTA 1SJRA 1RT5B 2JC0A 2EKNA 4KFBB 2ACYA 5L39A 3TZZA 2CKWA 4X4TA 1FF2A 2IIHA 3VALA 2Y3YA 1RCOB 1U2CA 5CYJA 2HHQA 3IAM9 1KFDA 4RW6A 4ZLNA 3FSYA 3CGIA 2VKZG 4ETZA 2D74B 5B08A 2LQ9A 4OZ5A 3RW7A 2HW3A 1NUEA 5GAGU 3M8YA 5KG3A 3CIZA 1NK5A 4AXIA 3LTOA 2DH8A 2JEIA 2L9WA 1X4AA 3O8WA 2NPIA 2J0WA 1M0SA 2X7IA 2J9DE 5HVGA 3CJTA 4QCLA 2BQ3A 4K4UA 4IRCA 2GJIA 3EZUA 4A8QA 4PAAA 1FTRA 1RHUB 1T02A 2JZ5A 4ED1A 1BMQB 1RHKB 2DPJA 5C2GA 3WIUA 2HBQB 4P2SA 3BYRA 4ES2A 1H2VZ 1D1UA 1YJTA 3CDAA 4X4RA 2OHDA 5KT7A 4K4WA 4DI6A 2FTRA 4LSZB 1B64A 1W26A 3KMSA 1KP6A 2O66A 4ELTA 2FLPA 3RAXA 4OJGA 3HPOA 2GHVC 1WG1A 4YDDB 3DM2A 4N41A 1RHRB 4RUBA 1YI2S 4RU2A 1JXLA 1FDBA 4G6VB 1ZAXA 3FCHA 2HHSA 1NK4A 5JVGQ 4G3IA 2KHDA 4DUYF 4ZJLA 1YDLA 1QVGR 3MECA 4ZPAA 3CJKB 4JI7J 4F0KA 1E6YA 2VG5B 1QSYA 2G9OA 5MLCV 3OXLA 4NLTA 1S1WA 3PW2A 3KLHA 3A3NB 1YG0A 2RRNA 3GIJA 1TAUA 2BZ2A 1R6VA 1NM2A 4LRBA 3SDEB 3HVTA 3G6YA 2HHUA 2JRSA 3ZTPA 2XCAA 4YY3F 3OT9A 2QMUB 3ICLA 2HSEB 1MU2A 2HPUA 2BA9A 2RF2B 2OMOA 4BWMA 3KNAA 2B7BB 1R3NA 1R8PA 4JOUA 4CH7A 2HHHJ 3PHEA 4IOAQ 2B9EA 1A6LA 3QYYA 1BQNA 2M3DA 4U95A 4RBTA 2HNYA 1RJJA 3K0JA 4DLEA 4RO0A 1H6KX 2W1BA 1SJ4P 3DDNA 1P1LA 3Q22A 1JQGA 2V63A 5M2PA 4FYXB 1GH8A 2JVOA 2AV5A 3QAEA 1IM6A 4L75A 1VRUA 2RNEA 5HAOA 2MJNA 2QZ8A 4YMEA 5LJ5Y 5G0RA 2QL9B 4FYWB 2FHJA 2BXJA 3OR2B 2V2QA 1RA6A 1Q78A 2RAQA 3OPKA 3E51A 1XERA 1JJCB 3W2WA 1HNXF 1WEXA 1R8HA 5HBMA 2DRDA 3PX4A 2OEKA 2K2PA 3FZBA 1D9DA 3GB0A 1J2VA 4QR0A 1X9WA 3H2VE 4A46A 1R0AA 2DXEA 1RYSA 4F3MA 1TFWA 1Q8IA 3HD2A 1YK9A 4DSIA 2XMKA 1FX4A 1WEYA 2RJZA 1WF1A 3T9NA 2I9SA 2YBVA 4WU3A 4JV2A 3GPAA 1J27A 3TNVA 4DV5J 2YX4A 1T05A 2KB2A 4LUBA 1HWJA 1DTQA 3U27A 2E5GA 3RBEA 4K2XA 1RU2A 1UJ5A 3QO9B 4N47A 1LWFB 3IFEA 1RWXB 2H48B 2IRUA 4WJBA 2AZ1A 3W61A 1F9HA 4U8VA 1VS3A 5DLFA 5HP1A 3JQKA 3GG0A 2KZZA 3IR5B 3U02A 3UDCA 3V81B 2CVEA 1AW0A 4PKDB 3UPFA 3KMQA 1REVA 4DL5A 2F4VF 1F5AA 5A8RA 3MAHA 2V5HG 2R2TA 2IFXA 2PC6A 4RNOA 1JJHA 4CI0B 2NXCA 3NAIA 2FJAB 3MM7B 5GAGI 2D3ZA 3KG4A 4G1IA 3ZC4A 3SCJE 4PCQA 2FLNA 3VAIA 2OELA 4OI0A 1TV6B 1FT8A 4I4BA 1VQ4S 4DR5F 3Q24A 3AJ2A 2IHR1 1KD1T 3GZ7A 3MEEA 3MEDA 1FKPA 4I2PB 2GVZA 1JLGA 5AXNA 1AFIA 1RB0A 5A6WA 2HG4A 4RUCA 1D9AA 2IA6A 4F02A 1JX4A 4MAKA 5GADU 2VH7A 4OYXA 1RTHB 3KTQA 2UXDJ 3SFUA 1KLMB 2Z4PA 1S1XA 3ENQA 1AYEA 3GFHA 3IG1B 3M1VA 2R42A 1Q79A 4OX6A 3MR5A 2BABA 1D8ZA 3GSDA 1S49A 3ZFVA 4DR6F 4DPWA 1YSJA 2QA4G 4JI8F 4B3OB 1KVJA 4FVCA 2E5LF 2D3OR 2C2DA 1N52B 2OTJS 1HR0J 3IR7B 1ELOA 2NSCA 2AZ3A 5C2CA 2WONB 3IAS9 5KFTA 2LA4A 4RBUA 4MKAA 3BSNA 1ZPVA 4GO7X 3I6PA 1Q4RA 1CJVB 2HK3A 4OYPA 5ETPA 3QRPA 1RBAA 4OL8A 3CXCR 3AJ1A 5J2QB 2AT1B 2HS3A 2HHPA 4OYZA 4LIRA 4J9SA 1IUJA 2R7UA 1WKJA 2YKOA 3BR8A 7FDRA 4P6QA 2LXUA 3MI7X 4JI4F 2UXCF 2RMLA 3NNAA 3RRKA 2V50A 4PR6A 1LK5A 4RW9A 2UVVA 2DEIA 5J1EB 1YX2A 4CWBA 1CJKB 2OPRA 2VG7A 3MPVA 1Y10A 1C0TB 5IV3A 4EU0A 4CLPA 4H4OB 3KLFA 2M8DB 4JV1A 5GAEU 4Y3CA 2XZDB 4RL1A 4DL2A 4ZMMA 4M94A 4GVLA 2F4FA 4CO5A 1SPBP 1UVJA 1FRKA 2MKIA 4ENOA 3V5RA 3PJXA 4ALZA 3ENAA 1RT2A 5LM7E 3RG6A 4X4SA 3DLBA 3KUGA 3CD5A 2ALZA 2YKNA 5ETSA 2HMIA 2KYZA 4LF6J 3FJ2A 4KHPJ 2R2RA 5HVFA 3IS9A 1HI8A 1TL3A 5E41A 3P6YC 1HI1A 2QJ3A 3PIPQ 2R2SA 1X5OA 1HMVA 3L7PA 3CCJS 4DR1J 3QQCD 2AEJA 3DHXA 3Q8VA 3Q86A 1RAAB 3KHHA 4P9SA 4QU7A 3M9NB 4P75A 3V6HA 3CCSS 1M90T 2XBPA 3H8YA 6AT1B 2CRLA 3B4MA 4BS2A 2ROGA 4DV4J 4HTIA 4LF7F 2EW9A 4LF5F 1VQNS 2KYXA 3B4DA 1VGYA 3CCUS 4M5LA 1KHVA 3KK3A 1WG5A 3ZZTA 4NMLA 2X1AA 2MQ8A 1AB8A 3HSGA 2ZJRQ 2DT9A 1FJEB 2XI2A 4Q2LA 3DN9A 4C0OC 2VPZB 4KGZB 2CUYA 4JYAF 4E2FB 2JEJA 1S77D 4KGXB 3LWLA 4LF4F 1FRMA 4M5IA 4NCAA 2F40A 2DR6A 3M32A 4GVBB 4OJ3A 5DDPC 4TQRA 2WSFC 3CDEA 4HYKA 2WK4A 2RRAA 2WVEA 4A8XA 3C6UA 5JUMA 4QR2A 3NY0A 3VAFA 2HQ3A 3MECB 2BJ8A 1Q7LB 1E6YB 2CPIA 4IKAA 2EK6A 4YS2A 2C3YA 5KFQA 2M9KA 2OFGX 1YKWA 4ILMA 4FPRA 2W8LA 1HBMB 1Y0HA 1S99A 4ANEA 3NGRA 1KLNA 1PSDA 1ZZFA 2B6AB 4WP8A 5AJ3J 5DM7Q 2E9RX 5A0YB 3HHLD 3HVTB 2XMMA 1A0OB 1R31A 3OSPA 1TVRA 4F36A 4PG7A 3V4MA 3OHAA 2YNFA 5KFBA 3ZZOA 1VRTB 1BXNA 3PCOB 2VPWB 2W4CA 5K8NA 1RT4B 5F9LA 2KT5A 1OJ4A 2ASYA 2XSFA 4QPTA 3EPGA 1DRZA 2DHAA 4OZ3A 2HNYB 3N0VA 4KBIA 3WC0A 3BGOP 4V1Ak 1GX5A 4FYDA 2R2UA 2QTWA 3PG9A 1U49A 4I68A 1U02A 3BV8A 4QW8A 4L73A 3CJ3A 1IBKF 1VRUB 1DHMA 5EX3A 1LWEA 4HACA 3OFEA 2CQ3A 3G2XA 3BGFA 1RT7A 4MKYA 4F0MA 3A8EA 4YQWA 1O6XA 4WCEQ 2V67A 5CQGA 1RWWB 3S7RA 4C2MA 5EX0A 3BO2A 3OBIA 3PYDA 3H2LA 3MWBA 1X7VA 2NQPA 3T19A 2DNZA 3T9ZA 2COLA 4ANCA 1HBOA 4CRJA 1JB0C 1NK9A 5ETLA 4FXVA 2CJ9A 1ACMB 1PO6A 4ZPWR 2XNQA 5CA5A 4IFVB 2IJFA 2HLTA 5J2NA 2LEPA 4DQSA 1NMEB 4DV2J 3NP5A 3HZGA 2XLKA 5L1LA 4U7UK 1RE1B 4PZVA 5T41A 3CD7A 1Y7PA 3QRQA 1RWMB 4RWXA 1S7IA 2BQRA 4HVZA 1UVKA 2SXLA 1KC8T 1DTQB 1YLXA 1KTVA 2EC2A 4C4WA 1VISA 2AU0A 3OSNA 3QGPA 3N5BA 4YOEA 2CIMA 3HX9A 4I6WA 3ISND 3P3DA 1VQPS 1IBMJ 4DL4A 5CYMA 4JI0J 2J8AA 2H1YA 2M8HA 4ED3A 1L3KA 3PO4A 4C9DA 1UZHA 4A8MP 3KG1A 3EVWA 3UR0A 2DNLA 2OGUA 1WJ9A 1JWWA 2KFNA 2D9OA 3R7NB 4DPXA 1GMUA 5GAEI 5KFHA 1A9NB 4TU9A 1U1MA 1QAIA 2AGQA 3EJMA 1REVB 1GXTA 1IBLF 5F3TA 3HF5A 4Z7CA 4IFYA 3JTNA 4X4QA 3IRXA 3G8TA 1KOOA 2O5DA 3SCIE 1ZZNA 4U8YA 1D8YA 5BR8F 2CQPA 3DHWC 4EK2A 2B5JA 2BJ1A 2M88A 4R8UA 1C4CA 2ZWOA 3DLKA 2HYIB 2I5JA 2OEMA 1K0TA 2HAFA 4ITSA 5AE1A 2ZH1A 1LW2A 4ZN1A 2VODA 5B0AA 2F8EX 2G1DA 4X4PA 1PC5A 4WE1B 4LR8A 3FCWA 4DL3A 2LYVA 1PIEA 3D6FB 4PG6A 1FKPB 1WC1A 2GVZB 1T3OA 3UDEA 3HHEA 3AOCA 2F9DA 2L9NA 3OTOJ 2BJ9A 1VFJA 3EVOA 2WVFA 2JNJA 1RLCL 1YRXA 4N5SA 4NCGA 5CCLA 2QEXS 4O3PA 4KPCA 2LEAA 3PRVA 3R5AA 1Q8BA 3NMRA 2DNQA 4KGMA 4TXSA 5BYRA 3A8IA 1RTJB 4OYBA 1TKDA 4ZPBA 2GQCA 3DLGA 3M1VB 5HI7A 5ADZA 2CDRB 4QJVA 3BQ2A 3NNHA 1OYDA 3NAHA 1S4FA 2AJFE 1SUQA 1GX6A 5EUHA 4ZVQB 3M6UA 4D3GA 4OLOA 1YBAA 1HYSB 4M5NA 3R1LA 4LFBJ 3QWUA 4U96A 5DQHA 4OZ0A 2VC1A 1N32F 3AQPA 3EXCX 2MQPA 3IGNA 2FJXA 4GKJJ 1SL0A 4B02A 2GMLA 4NEZA 4ID5A 2CZ9A 3TZYA 3QJPA 5SZTA 1ZOTA 2DGXA 2H5JB 3TZXA 3UNYA 2DGUA 5KFAA 3J7Z5 1M5HA 4CT8A 3QGGA 4NI2A 2W9BA 4ZJOA 3GJRB 1Q1KA 1YJ7A 3CE8A 4JI1F 4AYBD 4W92B 3UDLA 1T7PA 1RUSA 3G87A 2Q66A 2XLJA 2VD3A 4BLGA 1TUWA 2AJ2A 3H5SA 4F3QA 4JUZA 2W2NP 2C28A 1UAWA 2IM3A 1FDDA 2GIQA 1N34F 3FFIB 3HLUA 4OYMA 4J91A 2GQQA 3T6JA 2DCLA 2M52A 2ABYA 3RR7A 2B9XA 1U25A 2B51A 4LBHA 3P5TL 4YDXA 2ZH4A 2VG7B 2JDJA 2UU9J 2RDDA 2NZ4A 4OHWA 3KLFB 1K1QA 4DSJA 1TUVA 2PMHA 2RS2A 4OLPA 4UQTA 4DXLA 1EZZB 3SQOP 3VGSA 2MTLA 3OUYB 3BSOA 1LV5A 5D6GA 4MFBA 4B3SF 1N56A 2BJ3A 2GIFA 5EN1A 1HHQA 4OMFG 1UVNA 1PILA 1FJGF 3M6XA 2HMIB 2E66A 3HMJG 5AXMA 2F65A 2LKZA 1F2GA 3FC9A 4DSLA 3IS9B 1TL3B 1BWVA 1T9UA 3GR0A 1SH3A 2XEXA 2F63A 2K3KA 1SJ1A 3VF0B 2QL7B 4QYZK 4CLWA 3QMQA 4ZIVA 2KKHA 1YJNS 3UD3P 1WDDA 2HGNA 4MT1A 3M8WA 4U6PA 4OX7A 3BGUA 2CWXA 1L3UA 3CCVS 4KH0B 3EGVA 2FLOA 2B4UA 3SXLA 1FK9A 1R8CA 1VQ5S 3MR7A 2MJUA 3QRRA 1U2FA 2J0SD 3JYTA 2B8PA 1VCTA 4AE5A 1B3TA 4IOBA 2JOQA 1K73T 4YN3B 2G13A 3LO3A 1QUPA 3PEHA 1UA1A 3OTDA 1VIOA 1WSVA 2YX7A 2UXBJ 1OSCA 3WX8A 2DHSA 5FLXU 3DLHA 2XGPA 3EX7B 1BQMB 2HNZA 2AP6A 3MPDA 2HQFA 1RT3A 4DR4F 1FWKA 2R8JA 5K8MA 2WVBA 3A1YG 2VUGA 5A8WB 3AJDA 3M32B 2QC3A 2L41A 2Q79A 2WZ1A 1LFWA 4KV8A 2RU3A 1NJYA 2KJWA 1DBDA 1U0HA 4O3NA 3C6UB 1MLAA 1T8EA 2RIJA 5E2QA 5F8NA 3OTEA 3OR1B 3W1YC 3HKWA 4WFAQ 3W66A 2KTQA 2WTFA 1EETB 4OIXA 3P49B 1WOSA 2HNDB 1RTZA 4J7CA 1WF2A 1G2EA 4O0NA 4UZBA 3HHLB 4C0HA 4RU9A 4DR3J 1TL1A 1HNVA 5G4DA 4URSA 5HJYA 2HVDA 1UVIA 4PWDB 3RJMB 4UOCA 1SC3B 4O3QA 5KG4A 1H2TZ 4CO2A 4Q45A 3D6HB 4EO8A 2DTJA 4RR5A 3G6ES 4TN2A 3MFHA 2HFZA 3GU0A 4BBYA 1N0VC 2ZOFA 5T7LA 1WELA 3ITHA 1JLFA 1PYSB 4NLXA 5C5JA 1SL2A 4ZPTR 2O3DA 3BN7A 1WI8A 1M5VC 3ONQA 4J9KA 3CDBA 4DQRA 1OIAA 2N7YA 2WAQD 2VFSA 1ICEB 4J9LA 1YJUA 4C8NA 4ANDA 3KK2B 2Y0SD 4KKOA 2DKOB 2FHOB 1FXLA 1HWUA 1L3TA 2PDAA 1J5OA 3DU6A 2HWIA 1LWEB 4ZHRB 4HACB 1RT7B 2W2QP 1S0OA 4JV5F 1V3ZA 4A8YA 3QPIA 3I56S 2VPXB 4ECRA 4KO0B 1GQEA 1B99A 3O5TB 5J2PB 2E1CA 2IJRA 2DNGA 5IXUA 3BPSP 5HVHA 1HBOB 2Y1IA 1QVFR 1RAEB 4QW9A 1XMOF 1F3VA 3HJVA 2HKEA 2HZCA 3W64A 3RU0A 4NXNF 5J2NB 3NGKA 1SXLA 1UWAA 5M2UA 1WHXA 1T03A 1JNZB 4Q7AA 2ZNZA 2XMAA 3CVKA 2ACMA 2VZ9A 3MAAA 1XJWB 3MAQA 4DFMA 2CQHA 3FNNA 4DPYA 4YR2A 1C2PA 2V8DA 4LF8F 1YTYA 1RT1A 5HROA 4URGA 3NGSA 3G8SA 1VQLS 5IM0B 3M2RA 1R0CB 2C42A 4UOFA 3UWTA 2DXFA 2A3JA 4DUZJ 3K5PA 2CDQA 4LSLA 4ZVTB 3UVJB 2CPYA 4FF1A 3LGHA 2Q43A 1JLAA 2LP4A 5FDLA 1FI4A 4A48A 2OPSA 3IRXB 2P9EA 1SB6A 2QLXA 2B5JB 2QA4S 2YQ1A 4F25A 1HQUA 2I5JB 5C25A 3BDPA 3GIIA 1Z4UA 4A4JA 1ZAVA 3GYXB 2MQNA 4ECXA 1NJXA 3EWGA 3MUTP 4RNNA 2G0CA 2OD6A 3GWCA 1Q95G 2MKSA 3Q8SB 2V9KA 4B3TJ 4K7QA 4KQZA 1UVLA 4IRDA 1X4DA 2YKPA 3G82A 2R7XA 4J9NA 3OL9A 4C7QA 1AXQA 1DQAA 2XS2A 3DXBA 1AUSL 5D0RA 2QSFA 3PW0A 2YKMA 3OJUA 2CNOB 4IQXA 1RAJA 3GV8B 3C46A 1ZETA 2BYCA 1SQFA 2QLJB 2DNKA 2GO9A 3AD9C 3DDKA 1BQXA 2GAHC 3VCDA 2FB0A 2UVUA 4A8SA 2YPYA 2DHXA 3L09A 4J37A 3KJVB 4KE5A 3DLGB 1C1BA 4B9MA 2MZRA 2ASDA 5D3GA 3TANA 3R3TA 2OH2A 2AJ0A 1G3OA 3HJFA 1SUQB 3SEOA 4QIEA 1U6FA 2OPQA 3DKDA 2U1AA 4NRUA 4X2BA 4CDIA 2M70A 4DSKA 1CULB 4LFCJ 3CD6S 2DPIA 1EKSA 4PXEA 1PBAA 5KFVA 4DQQA 3PJWA 4JI7F 1GXUA 3TYTA 1KTQA 3DMJA 1ZM3A 1S9EA 3NRBA 2LDYA 2O67A 1T94A 2DGSA 2WHOA 2RILA 3JB9k 5AE2A 1C1CA 4LR9A 2DNYA 3PYGA 1Q5YA 2CZVC 1NU4A 2FJEB 2G2OA 2GCFA 2LDIA 4NI2B 2DJWA 2W9BB 1ZH5A 4TLQA 2RQKA 5JVHQ 3NG8A 4GKKJ 3BBBA 1RAHB 2E7XA 3VQSA 2R9LA 2E9ZA 4CYUA 5BYQA 2YTCA 5F0UA 3M2VA 4P2MA 3CW2C 4DX6A 1YITS 3HKZD 4YB5A 4WK1A 1HHTP 2DIUA 1XNQJ 2J9CA 3PR4A 1HA1A 1UEVA 1B7YB 3H5YA 4ZP9A 4KY3A 2KHCA 4FDFA 2IMOA 3D66A 1VYAA 2Y0BB 1X8DA 1ZTTA 3PHTA 1WOOA 4WP9A 4PQUA 1HNIA 3RYLA 3GYGA 3WBZA 3GP9A 4Q44A 3M30B 1I6JA 5KAKA 1M1GA 1APSA 1NPKA 4TLRA 5HMYA 3MEKA 1RZMA 4NWBA 1B0PA 1TZ0A 1VOMA 4LFAJ 5L38A 1URNA 4XTTA 3UO0A 5KFGA 1S0NA 2CXEA 2V69A 4Y0FA 5EWFA 2PD1A 2FLLA 1VQ8S 3EE3A 1MMDA 4DZ6A 4A8WA 4O44A 1S79A 4EGLA 4UOGA 3ZXWA 1DLOA 2IM2A 1FK9B 4Y34A 4B9TA 3DXSX 1ZM9A 3SFGA 4TKTA 4ZPDA 1TMJA 2NLWA 4C6AA 3KHRA 1NO8A 1JKHA 2ZBRA 4Y2AA 2PI4A 2MEWA 2V8VA 4JI2J 3AA9A 3PKMA 1T9WA 3S6EA 4URQU 3G71S 4W4MA 3SYZA 3CJRA 3NGTA 1UEUA 4HKQA 4ID8A 3NGUA 3VQTA 2HNZB 1DARA 1WSRA 2Q6CA 4P73A 1RP5A 2IAJA 3J7AN 4DFPA 4RUAA 2DXDA 1X0PA 5H1SV 3C3LA 2V4QA 4KV8B 3IRWP 1H38A 4HT5A 2KRRA 2KXNB 3GIMA 3CWJA 4OZ1A 3D0GE 1FRLA 2EFOA 3N6LA 5I3UA 4HHHA 2OEJA 4WYWA 5KFLA 2GJFA 2C3PA 3US5A 1KWMA 1HNVB 3DGPB 3CCWA 4CIOA 2YWWA 2Z58B 4LVOP 1FRJA 4YB7A 1U24A 4DSEA 5CABA 5DO2A 1GNKA 1VI7A 2CA9A 1XR6A 2QO3A 4Q0BB 3BKTA 4USMA 4GO5X 3BN4A 1JLEA 4OYWA 3TQ1A 1XC9A 4JV0A 4ZK7M 2FY8A 3UCUP 1CS4B 1RISA 1URRA 3BKUA 5HMWA 1UZDA 5T7LB 3M2UA 4XAKA 1JLFB 2FVPA 2JSXA 3S8SA 2JLFA 4YR0A 2DK2A 3KOAA 2MDAA 4YB1P 3OV7A 3DOMB 1FE4A 2HEKA 1S1VA 1QAJA 5GMKa 4HR2A 4UQGA 4DUYJ 3M4XA 2E5IA 4EBCA 1YVFA 2VBXA 1J5OB 3WHIA 1RU1A 5A8KB 4F04B 2GGPB 1HR0F 2ZZMA 5KG1A 4J9MA 1UPMB 2ZFHA 3FSIA 1S6PA 4USUA 2XS7A 3HVRA 2QGFB 2XY5A 4WKRA 3KLEA 1TR0A 3T5KA 4X64F 3IBCB 4G1QA 3MPYA 1RI7A 3QATA 2GHPA 2HIQA 4CLKA 1HBNA 4ED0A 2AD9A 2UZAA 3QWPA 4NLUA 3IWXA 1DURA 2FVCA 5B0EA 5IT0A 1M1HA 4ECWA 3S01A 3H20A 5A6PA 4OJHA 4R5PA 4DU8A 1T03B 3MUVP 3BEGB 4NLOA 4FNHA 3THVA 3KFWX 3NBPA 4YFUA 2MPUA 2VF3A 4DCJB 3B8HA 4K8RA 3DOKB 3X1LB 2HFVA 5KG0A 5H9EJ 2UUTA 2MKJA 4KC5A 1TKZB 2KU7A 2XZWA 3I9V9 1M5PC 3IO1A 4FVMA 1VBYA 2ZVIA 5DS7A 2YWFA 2QE5A 2ERRA 3O2IA 3JQMA 3M2RB 1JLBA 3R7SB 3M8PB 3POTB 3ZTOA 4Y2CA 3J7YU 2J6UA 4TY8A 3TARA 4IH7A 3D3BJ 2CPFA 3UN3A 1HQEA 1HW8A 1S9FA 1PJ7A 1QDUB 2W9CA 4DV7J 4OFZA 1JLAB 3PYEA 4RW8A 5FDLB 4J9RA 3MEGA 5ETOA 4QR1A 3MMCA 1NK6A 3TA0A 2KXHA 1MWQA 1MN7A 1HQUB 2RSQA 1XWLA 1FFWB 2MLZA 5E3QA 3C6TB 1M1KT 1NH7A 1LWCA 2DIVA 2LQ8A 4OZLA 3Q2SC 4I7FA 5HJXA 2BJEA 2PI5A 1EQ0A 1K9MT 3EGWB 3QAUA 3TRGA 1F60B 2WW4A 2BV3A 1TL7B 1JK9B 1Y3KA 2HQCA 1WUUA 3I0RB 3G82B 4JI5J 3AOAA 1TAQA 1IWAA 2LFVA 2ZD1A 1U4BA 3F44A 2YKMB 1B7FA 1G1XA 1S6UA 2MGZA 4A8OA 3FSXA 2ZBPA 3ENVA 2F4VJ 1CEZA 4NLYA 2W7PA 2X1FA 1VBXA 2ZH6A 2VBWA 3I5AA 1SJQA 4NLRA 3CO0P 3EXYA 1IQTA 1WC6A 2JFKA 3G8QA 1C1BB 4UY8T 5IS2A 2KM8B 4ECYA 2MZTA 5D3GB 2AEMA 5JJBA 2X1BA 3MFIA 1S0MA 2OPQB 4QYZJ 1RAGB 1EQMA 3Q8PB 2H4WB 4Z2XA 4DR5J 3V6DA 2CJKA 3MD3A 1HIYA 1TKTB 3HHNB 5K5MA 2FD2A 4C8MA 1FDAA 2NZCA 3T1YF 1TP7A 2BX6A 3BR9A 4GMKA 3DMJB 4M5GA 3ILLA 1UA0A 2LLZA 3IC1A 2V4JA 4HEA9 2D3O1 3DLLQ 3HHLC 4LVNP 4LF2A 4ED8A 3D1QA 5LXRA 3QIDA 3B54A 3MD1A 4F67A 4JB8B 2AJQA 2HZVA 5KFNA 2DITA 2XWXA 1JJ2R 7FD1A 1NJWA 2WB1D 1GMWA 1Y4ZB 4BCAA 1MSWD 2DNPA 3CB4A 5CCMA 2GC8A 4LSNB 4NMXA 2E5HA 1S48A 1N0UA 4DR2J 4PG5A 4CYUB 3DYAB 4DR6J 4I0WA 4C3KA 1V6HA 3M2VB 2WRMA 3F56A 1KONA 2AHOB 5I3QA 3JSMB 3C16B 3CJ4A 4UF4A 4XIUA 2K1RA 3K17A 4HI2A 3MMJA 2PGCA 2BOAA 1VJQA 4Q5VA 3W9HA 1Y5NB 1FRXA 3IBWA 2UUCF 1JNRB 3VZHA 1I3OB 4OZJA 4PXBA 1HPZA 1HWLA 5HMXA 5D78A 4KGKA 2ZDPA 1WKKA 1N5YA 5DG7A 2EG2A 3MPUB 2MKHA 4Q8FA 4ZVFA 1C0UA 3GMGA 2XMJA 1B0VA 1P1TA 5H9FK 5HK4A 4WFYA 4L76A 5J2MA 1R6YA 3GQCA 1Y11A 3MUMP 3DI6A 3LF0A 4UZCA 4JI4J 1CJUB 2UXCJ 2FUG9 1IKXB 1EHWA 2AF6A 1VMBA 2ZC4A 3LP2A 2IVMA 1S5ZA 4F50A 3DRYA 3FUYA 2VJUA 3DRSA 1J5EF 4WIIA 1TL5A 2KVIA 3KNGA 3LAMA 1CQNA 4E8UA 3ISNC 1SH0A 4ED2A 3AD8C 2U2FA 4TY9A 4RW4B 5F9NA 1RAOA 4FPIA 3DRRA 1N5TA 2AIRB 1IBMF 5IQ6A 5HLFA 4L6V3 2HBYB 4JI0F 5DRKA 3S1TA 1RXOB 1P9YA 1XQIA 1REGX 1JLCA 3NGDA 3K8VA 5FIIA 5DQGA 5E0OA 1TK0A 2BE7D 2K7JA 2MSTA 1R27B 5EWGA 1S1TA 3A12A 1PJ5A 4E98A 3Q8RB 3PDNA 5KFIA 5L8RC 2IAJB 3DC2A 1SKWA 1FNXH 4QWCA 3CF5Q 1TKXB 1CJTA 1U8SA 3MM8A 3DRPB 1NKCA 3W2VB 5F8IA 1NHUA 1YRTA 2UVRA 3PW4A 4M5HA 2Z2LA 1FRIA 4X66J 1U45A 2F9JA 2XC9A 3MDFA 1NSQA 4IO1A 2W24A 4H4MA 3N6MA 2K8GA 2RQMA 5I3UB 2NUUG 2R8KA 4BWJA 3RB6A 4LF7J 3OJSA 4LF5J 2ROPA 2MZ1A 4ZVSB 4KR0B 1X4FA 4DUTA 5ETKA 1RTIA 4JI3F 1V9OA 3Q23A 4J9OA 3MURP 4XPEA 2A2CA 1RBOB 4DS4A 3CJSA 3X3UA 3EMTA 2YNHB 1QSLA 1JLEB 1UJ6A 3OTOF 2G4BA 1Q8KA 3OTBA 3MCOA 5BYSA 4FKYA 8RUCA 3ILIA 2M7SA 1IJEB 1UKUA 1WC0A 4ZP8A 3M2UB 4LF4J 3MPWA 1D09B 2DRAA 1EKRA 3DOLA 4DX7A 4EYHB 2HIYA 4RNHA 4G1PA 2J9DA 1FDNA 4LRFA 2JH3A 1NH8A 3CC7S 3FRZA 2KFZA 1LNQA 3KLGB 4F8RA 1K0VA 1LW0A 2ZH3A 4H54A 2HK2A 5D77A 1SC6A 5LJ3Y 4MIBA 2ZEJA 5HSPA 1VBKA 1QE1A 4OI4A 2P5VA 3QSIA 4TYAA 3UNGC 2E5JA 4ZIWA 2Y8WA 5DM6Q 1S6PB 5AT1B 1H74A 3PX0A 5KFUA 2OO4A 4NEYA 3KLEB 1N48A 3CMAS 2J8SA 2FHMA 1RT6A 2AX0A 3OVSA 2NREA 3QJJA 2YNGA 2R8IA 1VQSA 2EVZA 2HURA 3MM5A 4M5DA 2GVDA 2RT3A 1CG2A 1DQ9A 3BYPA 4R5PB 4HI1A 1WG4A 5LSLA 1Z2LA 2ZJQQ 1HBUA 3GE9A 3GIKA 1RTDA 2CPJA 1VC0A 1KVIA 1X4GA 4RLEA 1LKZA 2HGLA 3UDVA 3DDIA 2OPPB 3NBPB 4IRKA 3ET6B 2NXUA 3PW5A 5C24B 3PX6A 1IBKJ 2FHJD 4MKVA 2L08A 3ISZA 1FFGB 1E6VB 1C4AA 3MCSA 3PFOA 2FQQB 2OMLA 2MY7A 2BKNA 5L46A 2I38A 4ZKAA 4AXJA 1NSPA 3DU5A 2L9DA 2JC1A 1JLBB 1YJRA 2C2RA 5K8PA 1H0HB 4TY8B 1IKVB 1D0EA 1VC6A 1QJHA 3QGHA 4MH8A 3HT0A 4J5OA 3PFEA 5KFRA 1B70B 4DG1A 4RW8B 3KK1A 2XY7A 1UWBA 4C8YA 4KGVB 3MMCB 2GW8A 3AY0A 5IFMA 2LEBA 1V5IB 3T1AA 1XMQF 3OQ2A 1S6QB 4L74A 1F3FA 4QWBA 1WI6A 5KT4A 4FS2A 4DR7J 1EX8A 2RKIB 1LWCB 5DZ7A 4ILRA 5KG5A 5A2QY 3UN2A 1V3RA 1CC7A 4ECTA 3A3PB 3SIPB 3L9ZA 4P7VA 1HD1A 1N6QA 1BGXT 4PABA 2R7QA 4CZCA 2E44A 2E9TA 2DBBA 1N5QA 4FKXA 5B0DA 1HWKA 3VVUA 3LP0A 1LXNA 2R8GA 5LMNF 1T9XA 1BC6A 2NR0A 4KFBA 3UE2A 5IWAJ 5IQQA 1SJ3P 2G0IA 5F8JA 2QIFA 2FZKB 2M2BA 1TFYA 2MMYA 5B0FA 1R8BA 1Y5LB 2BBEA 4P71A 1IBLJ 4X4NA 4PRFA 5K14B 5IT4A 9ATCB 3G86A 3FZ2A 4X4UA 5BR8J 3PR5B 3CCES 2LQ5A 2C1EB 4ETXA 1WORA 3D68A 3KLIB 3CDWA 2M0GB 2H5IB 3RTVA 1P6TA 2CVIA 2ADBA 1RWPB 3M9MB 1GXLA 1U1QA 3V6DB 3CPWR 4DV0F 3R97A 4ED4A 3HCXA 2V6AA 2CZ4A 1SKSA 3CJQA 1WWHA 1NRKA 2CWKA 3CCMS 5DDOC 5CZXA 4NLGA 3TEHB 1NSKL 2HQGA 2RDIA 4OHXA 1NSAA 1NZAA 4UTGA 2RVJA 5IOLA 2EKYA 3CNQP 3I31A 4OV6A 1RWVB 4ECZA 1JLQB 2IC3B 4DR3F 3CJ2A 2GO8A 2W7OA 3TW0A 2G2ZA 4H4KC 4IR1A 3HSDA 1RK8A 4C8OA 1MG7A 2D69A 1HNZJ 4B9VA 3MM6B 1RA7A 4K4YA 3VGTA 1CBKA 4C48A 2DRBA 1L3VA 3SZ2A 3HFZB 3H2UB 2FC9A 4QOTA 1IKWB 2DH7A 8AT1B 3GJTB 3D28A 3M8SA 1NHKL 1KQSR 2Y9HA 3ELHA 2EBEA 2DR9A 4F7VA 5DETA 3CJKA 4ZOSA 5DG8A 5KTQA 5B0GA 1X4EA 1X4CA 5I42A 4NLWA 4O4RA 2ASLA 3RRGA 2UV8A 1MROB 3THPA 1HPZB 2VPYB 3IM8A 5JXSA 1N88A 3EUNA 2NUHA 4LF9F 3SDEA 4OV1A 4ZLLA 4MIWA 4MIAA 2VASA 1N5YB 1OWXA 3N79A 1Y3JA 2UP1A 2VICA 3R2DJ 3FBBA 1X4BA 2BM0A 1HNWF 2RF2A 1C0UB 2EBGA 4USJC 4ZVRB 3Q0AA 1X31C 2HFNA 4USKA 1F5CA 3MMAB 2H4YB 4ZCLA 1S1UB 4KSEB 5SUHA 4B17A 4MK7A 3TQEA 3GILA 4X62J 1Q5VA 2V34A 2MZJA 2VA2A 4OZ2A 3AB4B 4DCPB 4I6YA 3OHBA 3RB3A 3DRSB 2CQ1A 1FE0A 1Y00A 2ZHAA 1UFKA 4CP5A 5EDWA 1H3DA 1DAXA 4RW6B 2XMWA 2EXUA 1H7WA 3TAQA 1U48A 5HLFB 2G1HA 3BZQA 3VAMA 4CO1A 1JLCB 3I4HX 1SKUB 1X9MA 2J6SA 1U6BA 1OMSA 4B3SJ 4DSFA 1S1TB 1KEKA 4YHHF 1FJGJ 2VB6A 4DUZF 2B0GA 2GAGC 3D5MA 3PTWA 1U09A 5E3RA 4GRSA 3MM8B 3MTJA 4I1TA 2F3JA 4O3OA 4F4WA 1ULRA 5CXTA 4RPFA 1IR0A 2I6WA 2E7WA 4DV6J 2CQ0A 1EP4A 3K59A 1NB2A 3PO5A 2QLFB 2O01C 3KHGA 4F3OA 4AL7A 4H4MB 3P45B 2H65B 2PO4A 2ZOGA 1LXJA 5IC4B 1IQZA 1VIXA 3M8QA 3R27A 2CQ4A 3I82A 3UQSA 5GMEA 1LWFA 1B4SA 2VJVA 5LSOA 1NXIA 1GAOA 1U1KA 3BGRA 2Q3PA 3LA0A 5KFDA 2QL5B 3TUIC 5T14A 5LMUJ 4IQMA 2ZBIA 4LRAA 4IR9A 4EBEA 3ZTRA 4BC9A 3Q8UA 3Q2TC 1NJZA 3DM2B 1KFSA 4DR4J 2MQQA 1QM9A 3W60A 2HVZA 1PCAA 2XMUA 1XTZA 2KZMA 2BACA 5CAAA 2YPZA 2OFHX 1XR5A 3G96A 4OI3A 1R0BG 3TOQA 3DOLB 4ZVPB 2F7VA 1IXKA 1PYTA 1T9TA 2NXJA 1S1WB 2PE8A 1B0TA 2KM8C 3KLHB 4NZ0A 2A2DA 5E3AA 3NWGA 4PXCA 3T3FA 1JMTA 2AJ4A 1TV6A 2LU2A 3EYZA 2XG8A 3SSRA 1FKAF 3LP1A 5E3PA 3H25A 3WC2A 1WTFA 4LFCF 1UL3A 4ZCKA 4DN0A 2Z8QA 4I69A 5GADI 4I2PA 1MU2B 2AYEA 4IG0A 4LR7A 4EZ9A 2GJ2A 4LRCA 1WEZA 4CH1A 3CMES 5KFPA 3C19A 4U67Q 4IOCQ 2APOA 2MKYA 1BQNB 2YNGB 3D6MB 5CHCB 4AQYF 2AW0A 1N36J 1F1BB 3KKFA 3PV8A 1O8BA 3JTPA 2GVDB 2OSRA 4B08A 2XTJP 2MSSA 2J0QD 1WNEA 3DLEA 1NDLA 1YRUA 1LK7A 2HVEA 1YZ7A 2DHGA 1RAIB 3N01A 1FWLA 1HBUB 4O0IA 3FVYA 4DPUA 5KG7A 4GKKF 4NLQA 2ZITA 4ZITA 3KJQB 2FJWA 5G0RB 4B3MF 2E1PA 3H7HB 1WDTA 3BPDA 1IR1A 1RHMB 4B3OA 4CM2A 3W2WB 3MF5A 4UUXA 1U47A 5CD4H
chains in the Genus database with same CATH topology
3W61A 3BYPA 3W63A 2QFIA 3W5YA 3W8PA 3W60A 3W5XA 3W62A 3BYRA 3W8GA 5HSPA 2ZZTA 3W65A 3W5ZA 3W64A 3W66A 3H90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W61 A;  3BYP A;  3W63 A;  2QFI A;  3W5Y A;  3W8P A;  3W60 A;  3W5X A;  3W62 A;  3BYR A;  3W8G A;  5HSP A;  2ZZT A;  3W65 A;  3W5Z A;  3W64 A;  3W66 A;  3H90 A; 
#chains in the Genus database with same CATH topology
 5HBM B;  2VU5 A;  5KOW A;  1AZS A;  3PZP A;  1XNQ F;  1BHN A;  3I0S A;  4NXM J;  4JV5 J;  4ZA1 A;  2DB1 A;  3QZ7 A;  4PWU A;  2JLE A;  1SQG A;  1R0A B;  4EZ6 A;  2WBM A;  1RAF B;  2YWK A;  3NOG A;  1G7C B;  5F8M A;  3MTK A;  3E2E A;  3C66 A;  1XMO J;  4CLT A;  2YVS A;  4FF2 A;  2D3U A;  2C2Z B;  4HTJ A;  3HUL A;  1UWB B;  1T05 B;  2XLI A;  2IPO B;  4LFA F;  2MZS A;  4LRD A;  4QIV A;  2J76 E;  4KAI A;  3PXG a;  3AOD A;  2Y1J A;  3ZZP A;  1OPZ A;  4FP9 A;  3K5N A;  2DO4 A;  3J81 Y;  1HFE L;  3TUP A;  5KFM A;  3I96 A;  4DDF A;  5F8H A;  4K4X A;  1N6Q B;  5HP1 B;  1NBE B;  1M5O C;  4ZP6 A;  3CUN A;  2KJV A;  4LF8 J;  4K4T A;  1DQ8 A;  4FZV A;  5J1E A;  1IM4 A;  3P4U B;  4UOH A;  3DNC A;  3CCL S;  5KFZ A;  1ZPW X;  1BWE A;  2IYI A;  1CJK A;  3ZO7 A;  1YHQ S;  5BJR A;  4H4O A;  5A8R B;  4AD6 A;  3CCQ S;  2DNO A;  3K8W A;  4JI2 F;  4ERD A;  1WHY A;  3LH2 S;  2GMJ A;  2FY1 A;  4G65 A;  2WW8 A;  3TVZ A;  2BKP A;  2HFU A;  2XO6 A;  4IUF A;  1PC4 A;  1RLD A;  1VQY A;  4C0B A;  3HT3 A;  2CPZ A;  1HLW A;  4EO6 A;  2JEF A;  4WTY A;  5H9F J;  3UFC X;  5HAN A;  3IXQ A;  2DGO A;  1XNR J;  3MEE B;  3MED B;  5HO4 A;  3T5H A;  2HVI A;  1JLG B;  2FIU A;  4YB6 A;  4O3S A;  2CAD A;  4X84 A;  2IM1 A;  2WVD A;  2B9W A;  3RAM A;  3CMQ A;  3TO8 A;  3A8K A;  4USI A;  2MQM A;  3PKY A;  2VFT A;  1NDK A;  3H42 A;  2K3I A;  5KT2 A;  1TQL A;  1A7G E;  2QA1 A;  4M5M A;  1S1X B;  3CJ0 A;  2W01 A;  1VRQ C;  1SKR A;  5KFE A;  1ZM2 A;  3H90 A;  2ZM6 F;  1QY7 A;  4CTA A;  3LUY A;  2CFX A;  4CLZ A;  4P72 A;  3QSY B;  2GZO A;  3H0P A;  1XEZ A;  4EBD A;  1S76 D;  5KFY A;  3GCW P;  3TJA A;  1S59 A;  2BEF A;  3H4B A;  4LIW A;  4JI6 J;  1N33 F;  2VG6 A;  4ZN3 A;  4C3L A;  2FYX A;  3E8O A;  4FS1 A;  4LQ9 A;  4MYT A;  3L95 X;  2I8E A;  4GVB A;  2RHS B;  1AA1 B;  4NYP A;  4QYR A;  4U7C A;  2GA7 A;  2XMT A;  4WP3 A;  5D15 A;  5C42 A;  3PM9 A;  4NLP A;  5HQL A;  2F8H A;  2FGC A;  5F8L A;  1CLF A;  2C2E A;  2V0N A;  3IWN C;  3H59 A;  1UVM A;  2DNH A;  3HFK A;  1UW9 A;  4X4O A;  3MR2 A;  2ZDO A;  3V6J A;  4X4V A;  4M8L A;  3JSR A;  3EPI A;  5I42 B;  1F5B A;  2XWY A;  4KYZ A;  1HBM A;  3SV3 A;  3N9U C;  2LXF A;  3VGU A;  3I9Z A;  1FA0 A;  4DPO A;  2B6A A;  5CYQ A;  3LAK A;  5A0Y A;  2R7W A;  1FTC A;  2ZKU A;  3D1O A;  1IR2 A;  4DU7 A;  3AQO A;  4ZLP A;  2FVS A;  2LA6 A;  4ATN A;  1LOU A;  1S0V A;  4CLL A;  1VRT A;  2NYH A;  5D0H A;  4FBT A;  5ETR A;  1RT4 A;  4P52 A;  3D54 A;  4C97 A;  4RW9 B;  4F2R A;  3MZI A;  5LOQ A;  2OKQ A;  1S9G A;  2BM1 A;  2CNL B;  2OPR B;  4LMZ A;  3BGL A;  3TR5 A;  4WBF A;  1OY6 A;  3UW1 A;  2DR5 A;  3CT9 A;  2ZBC A;  1TMM A;  4CNY A;  1U1O A;  4DS5 A;  2PFF B;  4YUD A;  1FRH A;  3N4W A;  4OX9 J;  1KR4 A;  2R8H A;  1H72 C;  2LEC A;  1RT2 B;  2V94 A;  2F5G A;  1FO1 A;  4DHV A;  4QIW D;  2J6T A;  2YKN B;  3SQG A;  4ES3 A;  1Y5I B;  2NS1 B;  4WTO B;  3CTR A;  2MXY A;  3RB4 A;  5HAT A;  2AGP A;  4RW7 A;  2B4P A;  2CQG A;  1HMV B;  4K5S A;  1AUD A;  3I5C A;  1W2B R;  2IDL A;  1KSP A;  3PEJ A;  2DR8 A;  1IJF B;  4IFV A;  4DV7 F;  2EK1 A;  3OFF A;  3BQ0 A;  4K5R A;  1VLO A;  1UMJ A;  1R7I A;  4WXO A;  4FNI A;  3KUH A;  3NL0 A;  2XCP A;  1FKO A;  2XYP B;  1DTT A;  1EP4 B;  2J9E A;  3E3X A;  3WZ0 A;  4ZPC A;  1FXD A;  1UPP A;  4ZVG A;  2XQC A;  2D1C A;  5C7P A;  4WZQ A;  1S57 A;  2MYF A;  3QFW A;  3WX4 A;  2HQD A;  3ADA C;  4WYL A;  2UUW A;  2R7O A;  3W7B A;  2W25 A;  2HHT A;  2GQ2 A;  3M8Q B;  4QWA A;  1X4H A;  5KT5 A;  3KK3 B;  4DV3 J;  3LW5 C;  1FNM A;  3Q83 A;  2VBZ A;  1WAC A;  1WC3 A;  4QWD A;  3FGV A;  2HS0 A;  2QLB B;  3BGR B;  3VTI A;  3LQV A;  3D0I E;  3HFV A;  1TL4 A;  4FXD A;  3UD4 P;  4JI5 F;  2BR0 A;  2C2N A;  2VA3 A;  3FQK A;  3JQJ A;  3P96 A;  3BSC A;  4CLS A;  2UV8 G;  3FBC A;  2CNK B;  2HWH A;  3NS6 A;  2VBY A;  1VBZ A;  2P9C A;  3QT5 A;  3R1H A;  3GSI A;  2W8K A;  4XO0 A;  1FES A;  3PRB A;  4AUK A;  4DPT A;  2DYA A;  2HRU A;  2LU1 A;  4DCO B;  1YJW S;  1YJV A;  2RQ4 A;  4FF4 A;  3GYN A;  3CCZ A;  5MAO A;  2E1A A;  2PA8 D;  4QWE A;  4L3K A;  5ETM A;  2UVW A;  3GON A;  3D7S B;  3K58 A;  3HP6 A;  3OVB A;  2LVW A;  2R4F A;  1N5V A;  3HK2 A;  3LP1 B;  3JXO A;  4ELV A;  1RAD B;  1FVS A;  1Q7Y T;  4WE1 A;  1TVR B;  3CCR S;  3BO3 A;  3AXM A;  2YNF B;  1TUG B;  4IG0 B;  4OHY A;  3A13 A;  4ZS6 A;  3QT7 A;  4V19 J;  2PEH A;  2HHV A;  4ECU A;  1LEO A;  4U7U D;  1ZA1 B;  3AOB A;  2VOP A;  3PW7 A;  2IBO A;  3K5L A;  1OQ6 A;  2CQB A;  4FYY B;  2ZZN A;  3QT8 A;  1RHQ B;  3CIM A;  3UCG A;  4KT0 C;  4N8O A;  3DLE B;  3EGN A;  4J9P A;  1KQG B;  2F1F A;  1RTJ A;  3EM1 A;  2HHX A;  2RB7 A;  4DR2 F;  2WVC A;  3NNC A;  2DGT A;  1BUX A;  3SSQ A;  2LMI A;  4F4A A;  2BMB A;  3ZZZ A;  2BUN A;  2XZT B;  1UFW A;  3HO1 A;  1I5O B;  1JXV A;  2DGQ A;  2VQF J;  2H54 B;  1HYS A;  1AZS B;  2YNI A;  3VVT A;  1MMN A;  3I0S B;  2XSJ A;  2W4D A;  1T3N A;  4WF9 Q;  3K89 A;  2YY3 A;  1KHW A;  2Z57 B;  2C2O B;  3JAM U;  2P8I A;  3OD2 A;  2ZHB A;  4B9S A;  1NPR A;  3FMW A;  3VHQ A;  4DV1 J;  2Z2M A;  2F8M A;  1IBC B;  4X64 J;  1W2I A;  2FVQ A;  1YZ6 A;  2P6S A;  3C15 A;  1MWZ A;  1UET A;  1CPZ A;  2ATL A;  3TX0 A;  4EI2 A;  4GC7 A;  3FEX B;  4ZLJ A;  4AL5 A;  3R5D A;  3T1H J;  1X60 A;  2W7A A;  2L48 A;  2EWH A;  3J7Z T;  2VV5 A;  1BLU A;  1XN9 A;  2P6T A;  1MML A;  3H98 A;  1Q16 B;  1M5K C;  2ZUA A;  4Y65 A;  3B82 A;  4J9U E;  4DEZ A;  5CYM B;  4K0K F;  2VQE J;  4OI1 A;  1JJ4 A;  2WCX A;  1HKA A;  3FFI A;  1I94 J;  3FEZ A;  2B4V A;  1L3S A;  4ZPV R;  2RS8 A;  4USW A;  4NLV A;  3NWR A;  3AAW B;  3K5O A;  3EZO A;  2EG1 A;  2Z56 B;  3IM9 A;  3UN5 A;  3JS9 A;  4ZJQ A;  4IFY B;  3OL8 A;  3M05 A;  4EFA C;  3NS5 A;  1PBU A;  2B4O A;  4NA2 A;  3ETM A;  5DZ6 A;  4R8U B;  3OFG A;  3DLK B;  3OUY A;  4F0H A;  2QSW A;  3OXG A;  1NDP A;  1ZAW A;  2E7V A;  2PEB A;  3C14 A;  3L3C A;  1RWU A;  3PY8 A;  3CD0 A;  1LW2 B;  2QG9 B;  3JSY A;  3BM7 A;  5CD4 A;  3OL7 A;  4EYI B;  3T5L A;  3GR1 A;  2ASJ A;  1TEL A;  1AFJ A;  2PA3 A;  1F9F A;  3MCM A;  1SVD A;  2AKW B;  2VON A;  4B3R J;  4X66 F;  3GIR A;  1GEH A;  3MOZ A;  4NLD A;  3IBF B;  4IDK A;  3CJ8 A;  3IR6 B;  1OSD A;  1XR7 A;  2XI3 A;  1PG5 B;  3O6Q A;  3LOU A;  4OJ1 A;  3GFZ A;  1VC5 A;  4NZ6 A;  2NYI A;  3PYF A;  3D0H E;  3UR3 C;  4NCG B;  1UP1 A;  1VJW A;  4FXW A;  2E29 A;  4X65 J;  1OPI A;  1RGV A;  4LQ3 A;  3MHY A;  4WFZ A;  1PAE X;  2UUA J;  2B9Y A;  4CTA B;  2IVF B;  3U1L A;  4TQS A;  1BQM A;  1ZYQ A;  2DY9 A;  6FDR A;  5A2Q U;  2YWE A;  2OAU A;  5F3Z A;  5GVQ A;  2CQC A;  5A8W A;  2VG6 B;  4XK8 C;  2QX0 A;  1SIZ A;  4M5J A;  3ENW A;  2QFI A;  2FVR A;  3ZNJ 1;  5C42 B;  1CC8 A;  3TVY A;  2FPH X;  3QLH A;  4ID5 B;  5LT5 A;  3R7B B;  2IRX A;  2CPD A;  3T1Y J;  3OR1 A;  2DVI A;  3W3S A;  3ILO A;  1SC1 B;  2HBZ B;  1U8W A;  1LFP A;  1U1L A;  2IVY A;  3NLC A;  1EET A;  4BC7 A;  2GFF A;  2BOP A;  2HND A;  4LF1 A;  5K20 B;  3HHL A;  2XYG B;  3M6V A;  4PXD A;  4NE9 C;  1FEH A;  1O0P A;  4TYB A;  3JTO A;  2CG4 A;  5CYQ B;  2RE1 A;  3NCR A;  4WIQ A;  4PWD A;  1RQ0 A;  4E0D A;  4RZR A;  2HQI A;  3K57 A;  3WIV A;  2HHH F;  4RUH A;  2UUB J;  2P9G A;  4OYA A;  3W8P A;  2PT0 A;  2NCK L;  4QZV B;  5DG9 A;  3E01 A;  2BDP A;  1U1N A;  3FDS A;  4CO0 A;  5HMZ A;  3FK4 A;  3OL6 A;  3W8G A;  1S9G B;  2KL8 A;  1NND A;  3RBZ A;  3DLJ A;  3KWM A;  2KH9 A;  1G6B A;  3I32 A;  3KK2 A;  1Q86 T;  2LXI A;  3ZNU A;  1Q81 T;  2N3O A;  4NCB A;  3LGM A;  2JFD A;  2UUC J;  3TJ8 A;  2VOO A;  3D67 A;  2YWG A;  4ZHR A;  4M5K A;  3IMQ J;  3D4J A;  1UCN A;  4N8N A;  4MFB B;  4CM0 A;  1QTM A;  4WKY A;  3CC4 S;  3SQG B;  2OD4 A;  2ZJP Q;  4QQB A;  3HVW A;  4O23 A;  1VDH A;  2JWN A;  3G6X A;  5IT9 Y;  4KO0 A;  1QSS A;  1KQK A;  3LPE A;  5J2P A;  4CH0 S;  4RW7 B;  3RB0 A;  2MQO A;  1FNO A;  3PAC A;  5IV4 A;  5KFS A;  3SI8 A;  2ZZT A;  4JP8 A;  3L4B C;  4R25 A;  3H40 A;  4ELU A;  2RQC A;  1IN0 A;  3R5B A;  2XS5 A;  1FD8 A;  4V19 X;  4DV5 F;  2KI2 A;  2CJB A;  2VDH A;  3J80 U;  3R5C A;  2RUS A;  3VAK A;  1FKO B;  4DJB A;  1DTT B;  2NPF A;  3G6V A;  4S0M A;  4UUW A;  3W5X A;  3JYT B;  4N56 A;  2AEF A;  2ZC3 A;  4WFX A;  5F0W A;  1OQ3 A;  4DR7 F;  1J5E J;  3HHK A;  3VAH A;  5KG6 A;  2J7W A;  3BSA A;  3IA0 A;  5J1P A;  1S6O A;  3P5B P;  2HS4 A;  1HWI A;  2XMV A;  1YQH A;  3BDE A;  3LPY A;  3NS7 B;  4USV A;  2AMC B;  1WC4 A;  3NCP A;  4TU7 A;  2MHN A;  1FVQ A;  3WQP A;  1VQ9 S;  1AT1 B;  3GV7 B;  4DF8 A;  1RT3 B;  2N7C A;  4P7T A;  3TUZ C;  3VAJ A;  4HL9 A;  4UT4 A;  2KRB A;  5IM0 A;  1CQM A;  3D1H A;  4KHR A;  1R8A A;  4KTQ A;  3D2W A;  2J0X A;  2V9W A;  3KHL A;  1FEE A;  5IWA F;  3C8Y A;  1VK8 A;  4AL6 A;  4DX8 H;  1NDC A;  3CC2 S;  4A8F A;  5K9F A;  2ATC B;  2DR7 A;  3UVJ A;  4J90 A;  2Z2Y B;  1U0H B;  1W7W A;  2ZVS A;  3R8Y A;  1OS5 A;  2IDE A;  3GJS B;  5KFX A;  3A3O B;  1XBW A;  2DEJ A;  2CYY A;  3ZZU A;  4KH1 B;  3LWM A;  3TA1 A;  2W9A A;  1NPP A;  2HZA A;  5AXL A;  4DFK A;  2ILY A;  4PYA A;  2VFV A;  5KFF A;  3J7A 1;  5GMD A;  3I55 S;  4NZ7 A;  1TL1 B;  3PJ9 A;  1SIW B;  1WKL A;  3TAP A;  1FJC A;  2VIH A;  1SI9 A;  4WU2 A;  2H51 B;  1FJ7 A;  1T0T V;  4ECQ A;  2MY8 A;  2RUG A;  1ARO P;  2UXD F;  4JI3 J;  3IP0 A;  1NK7 A;  2DH9 A;  5ETN A;  4Y28 C;  3ITH B;  2G0J A;  1PYO B;  5F41 A;  5L1K A;  4DL7 A;  2CQ2 A;  2W2O P;  2KT3 A;  4NPO A;  3RUB L;  3HXM A;  1MNE A;  3BKF A;  1FER A;  2CAJ A;  3ULH A;  1Z1Z A;  1KN6 A;  4C11 A;  3MMB A;  3O1L A;  4A8K A;  3J81 j;  3TI0 A;  3W9J A;  4CLY A;  4KKO B;  2WSE C;  2KG1 A;  1ZS6 A;  2VDI A;  2YH1 A;  3QIP A;  5BXI A;  3KJV A;  5L1J A;  4UST A;  1HNZ F;  1JIH A;  2JJ4 D;  2PN6 A;  4F4K A;  2AJ1 A;  5RUB A;  3PIO Q;  1NK8 A;  1HI0 P;  5D4L A;  4WWS A;  3V4I A;  1RSC A;  3W65 A;  9RUB A;  5H9E K;  2EI5 A;  8ATC B;  3RR8 A;  4PUO A;  2YNI B;  4P74 A;  1CUL A;  2A18 A;  3Q8Y A;  4YY3 J;  1H7X A;  2XSJ B;  2V8H A;  2YWH A;  1SQE A;  5CZV A;  3JSB A;  4HLB A;  5E3C A;  2QT7 A;  1EIY B;  2ZE2 A;  4ZVO B;  2AYG A;  1KNZ A;  2W2P P;  4CLF A;  1F6T A;  1PAU B;  3FBE A;  3TA2 A;  3C15 B;  3MXH P;  3PRD A;  2KT2 A;  2BJ7 A;  2Z2Z A;  2ALY B;  5E33 A;  2Z0G A;  3MAA B;  2PSZ A;  5KG2 A;  2Y1L B;  1QTN B;  1K44 A;  2CPX A;  2QMW A;  5DLG A;  4HDH A;  3OW2 R;  4F26 A;  4RWW A;  2R7T A;  4TU8 A;  5DGB A;  2EFG A;  3BS9 A;  4OI6 A;  2V2Z A;  1RT1 B;  1VQO S;  5HRO B;  2MLX A;  1R43 A;  3AB2 B;  4X62 F;  2POK A;  1HNX J;  2CQI A;  1U7L A;  4Y6I A;  2XY6 A;  3NKY A;  2M5Y A;  4W90 B;  3TAM A;  2XM3 A;  1P9Q C;  4LSL B;  3TX8 A;  2OPS B;  2QRR A;  2CNN B;  3NMA A;  2IA0 A;  2HWT A;  1P27 B;  4J9V A;  5KT3 A;  3M30 A;  1SV5 A;  4LF6 F;  4KHP F;  1Q8L A;  5C25 B;  4KHM A;  4ICL A;  2MQL A;  4ZVH A;  4MYU A;  1ZBT A;  1VR6 A;  3C14 B;  1NLK L;  1XMQ J;  4P10 A;  4K2J A;  4DZD A;  4I56 A;  2D41 A;  1VQK S;  3BF4 A;  1N5S A;  2BW7 A;  4DR1 F;  3Q8Q B;  1VLY A;  1FFS B;  5DDQ C;  1S4E A;  4DL6 A;  3BQ1 A;  4DV6 F;  2HLU A;  2BRL A;  4IDK B;  2CJY B;  4LJM A;  3R9L A;  5IZH A;  3H5U A;  1XK8 A;  4RJV A;  3HDS A;  4DV4 F;  5KFW A;  3W9I A;  3SMZ A;  5LMN J;  1EJ7 L;  4LRE A;  2J5A A;  3NEK A;  3I87 A;  1DJ0 A;  3Q89 A;  3HSJ A;  5LMU F;  4TNO A;  1WF0 A;  3FKB A;  4NRT A;  2YXL A;  1KVK A;  1V3S A;  1RWO B;  4P2F A;  4C3M A;  4I64 A;  2GNK A;  1Q82 T;  4NYO A;  4YEA A;  3J81 U;  2X51 A;  4EUV A;  1YJ9 S;  4YR3 A;  1VQ7 S;  1RWN B;  2Z30 B;  4PWW A;  5LXY A;  1X9S A;  4DV0 J;  2HHW A;  5KFO A;  4ZVE A;  1S9E B;  3M6W A;  4OHZ A;  4IH6 A;  1NCL A;  2ZUG A;  3QLH B;  4C98 A;  2W2M P;  3THT A;  3TEG A;  2DHH A;  2N4D A;  3RRH A;  4MMO A;  1YWX A;  3V2U C;  2VHG A;  2ROE A;  4M63 A;  5AJ3 F;  1C1C B;  3T5J A;  1QAY A;  2VFR A;  1K1S A;  3DRX A;  4KRW A;  2OP5 A;  5B0C A;  4MTP A;  2G2Y A;  1NB7 A;  2FJD B;  3R5G A;  4WFN Q;  2DCU B;  5U47 A;  3DGP A;  1OO0 B;  2A6O A;  2D9P A;  4H4K A;  1VHF A;  3HI9 A;  1GMW D;  5DGA A;  2A6M A;  4Z7Y A;  3MM9 A;  4Q0B A;  1ZTW A;  3SCK E;  2XUL A;  2OUG A;  3HD1 A;  2N4C A;  5E5N A;  1LWX A;  4R0J A;  4JI8 J;  2DIS A;  4ES1 A;  4ZCI A;  3E01 B;  1CS4 A;  2E5L J;  1N36 F;  4KPY A;  3AT1 B;  4DMZ A;  3L7O A;  2RD5 C;  1VK3 A;  4L72 B;  2OSQ A;  2YX1 A;  2QV6 A;  3HSZ A;  1O51 A;  4F2S A;  4CLU A;  3DOM A;  1VQ6 S;  1HAR A;  3GFX A;  1KOH A;  4RBV A;  2CPH A;  2WOM A;  2EFV A;  1W25 A;  2XB2 D;  3K7R A;  3P8B B;  3HVA A;  2QYC A;  5L9X A;  4PQU B;  2QA2 A;  1HNI B;  5KFJ A;  2B56 A;  3B78 A;  2BVZ A;  3SV4 A;  5A8K A;  7AT1 B;  3IGV A;  2GGP A;  4Y2K A;  3W5Y A;  4PPD A;  4NXM F;  1YBU A;  3U1N A;  2A1B A;  2YQ0 A;  1RAB B;  2B3T B;  4LF9 J;  4HH1 A;  3M9O B;  3TJ9 A;  4NL5 A;  1RDR A;  2RHQ B;  3OLA A;  4FN5 A;  1IKY A;  1HNW J;  2XO7 A;  2BJD A;  4OHV A;  4DV2 F;  2MHE A;  1R89 A;  3M7V A;  4PPZ A;  4RKU C;  2NXN A;  4DBQ A;  4O44 B;  1UW4 A;  4K4Z A;  1U6Z A;  1DLO B;  2JEG A;  4O4G A;  2CJA A;  1JKH B;  2J7U A;  2AYB A;  3HZE A;  1Q0N A;  2M4M A;  1WTB A;  2A10 A;  3DOK A;  2XYH B;  4Q43 A;  1NJI T;  3VZI A;  2MLY A;  3A4T A;  1OYE A;  2JHE A;  1TKZ A;  2KVQ E;  4DL0 C;  5D0E A;  5FJ4 A;  1HL6 A;  3N6N A;  2HAI A;  3J7Y I;  4ZCM A;  5A76 A;  4B9L A;  5HQ8 A;  1F9E B;  3F0N A;  2FDN A;  3KDO A;  5B0B A;  2PMZ D;  1F2H A;  3M8P A;  1RHJ B;  3POT A;  1FD2 A;  1QUV A;  2JLG A;  2R3V A;  3K5M A;  4YHH J;  2EPI A;  2BE2 A;  2CJX B;  3SSS A;  4USH A;  4KJI A;  2ZOM A;  2RDJ A;  4DF4 A;  2NSB A;  1QD1 A;  2FZG B;  3AXK A;  4HHU A;  2GIR A;  4BDP A;  2ZH5 A;  1N8R T;  1DZ5 A;  4HH0 A;  2ZBQ A;  2Y8Y A;  5EWE A;  1NKE A;  3GTY X;  4ER8 A;  4C8K A;  4W98 A;  5K8O A;  1UFL A;  2X3G A;  1KQF B;  3C6T A;  4QIG A;  1YGY A;  1XNR F;  3AHP A;  1BY9 A;  3MCN A;  3T41 A;  2VC0 A;  1IVZ A;  3JAM Y;  2JL9 A;  4ED5 A;  3RW6 A;  1TL7 A;  2ZHO A;  2OIH A;  1T95 A;  3I0R A;  4JYA J;  3MGJ A;  4FYV B;  2GS8 A;  1NHV A;  1PJ6 A;  3D3C J;  1WHV A;  2AYM A;  1X5T A;  5KT6 A;  2C3O A;  3GFY A;  4DQI A;  4Y2M A;  2LQJ A;  2Q1L A;  2V8P A;  4C11 B;  3MMB B;  4OYO A;  3HM9 A;  1S1V B;  5THW A;  3ILJ A;  4R0E A;  4PQA A;  3QZ8 A;  2NXE A;  2R7R A;  3WDO A;  1EB0 A;  2DNN A;  4DX5 A;  1X5S A;  1QLN A;  3RZA A;  1YBT A;  3QIP B;  2FC8 A;  2YKA A;  4C8Z A;  4HHJ A;  2Y1R I;  1G4C A;  3I4P A;  2FHK A;  1T9V A;  4ED6 A;  2AGO A;  2KDO A;  4JI6 F;  4LFB F;  2BQU A;  2V2K A;  3V4I B;  2IRY A;  3QBC A;  5DQI A;  2EFN A;  2C3M A;  4GC6 A;  4AT1 B;  2DGV A;  1RWK B;  4PUO B;  1SC4 B;  2H5E A;  3D6T B;  1KBR A;  1TKT A;  4QBU A;  4GKJ F;  1HD0 A;  3I5B A;  4G1Q B;  1V5V A;  5J1N A;  1HBN B;  1GFW B;  5ETV A;  2KN4 A;  2ZE2 B;  4RX6 A;  3EDR B;  4LBP A;  2GHW A;  1U2R A;  1P8G A;  2B7C B;  1NAQ A;  1EAR A;  2MKC A;  3BH7 B;  2C2K B;  3SCL E;  4CNZ A;  1L5U A;  1M5S A;  2H3E B;  3BBC A;  4FBU A;  1U0S A;  2E1R A;  1K47 A;  4AQY J;  1SJF A;  3O3L A;  4OI2 A;  2QMX A;  3VAG A;  4FF3 A;  2QLW A;  1SCJ B;  2QYG A;  5AE3 A;  1ZA2 B;  4IG3 A;  1TU0 B;  5EHH A;  4C8L A;  5LSR A;  5AXK A;  5M2R A;  3R2C J;  4UW2 A;  3N5F A;  1BE4 A;  1U26 A;  1HQ2 A;  4LSN A;  3VWS A;  4CO4 A;  4B3M J;  3DYA A;  2RH3 A;  5I3P A;  4O3R A;  4YP3 A;  4L3N A;  4CO3 A;  2X1G A;  4QIF A;  4I2Q A;  3JSM A;  1WOP A;  1JXE A;  3BJY A;  3C16 A;  2UU9 F;  4WFB Q;  2V2V A;  4LBI A;  1RYR A;  5GAH U;  3TAM B;  2ADC A;  3M8Z A;  1BD6 A;  4PYD A;  2OLW A;  3U7J A;  1MW7 A;  1K8A T;  1HQE B;  5HN0 A;  4K4S A;  2IM0 A;  2W9C B;  2CPE A;  4OX9 F;  3MEG B;  1GTE A;  1FX2 A;  2KFY A;  2FJV A;  4N7T A;  3TWZ A;  3GLJ A;  3C2P A;  3GJQ B;  4J9Q A;  1SV5 B;  4XDC A;  3HHD A;  3CO9 A;  2B8Q A;  2DY1 A;  4XDD A;  1S97 A;  3AD7 C;  4ICL B;  4DLG A;  3W5Z A;  2IJN A;  3LGN A;  2DNM A;  4ED7 A;  2A0F B;  5B09 A;  5HQM A;  1KDN A;  1QAX A;  4I7F B;  4I67 A;  4XPC A;  2QN6 B;  4IH5 A;  4I6A A;  1RBL A;  3ZTQ A;  3R5J B;  3KJN B;  2BAN A;  2Q6B A;  4NA1 A;  1CSJ A;  4IO9 Q;  4WK3 A;  1U1P A;  4M1K A;  4NX9 A;  1CJU A;  1IKX A;  4MK8 A;  1DFD A;  3CDU A;  3TUJ C;  3QJL A;  5IC6 B;  1RAC B;  4IYQ A;  1XMB A;  4PG8 A;  1RT5 A;  5D0G A;  2ZD1 B;  4DWI A;  3EZ5 A;  1N54 B;  1MWY A;  4NAS A;  3UD5 A;  2MGZ B;  1FCA A;  4DV3 F;  3KUE A;  2KO1 A;  4Y2I A;  4RW4 A;  3W62 A;  2UXB F;  2V4R A;  5DDR C;  4UY8 5;  4ILL A;  1ROF A;  4PEO A;  4ECS A;  2PMW A;  1HW9 A;  2R7V A;  3LAN A;  1Y9O A;  3EDQ B;  2OI2 A;  2GV1 A;  5L9N A;  3CUL A;  1UEK A;  2J7K A;  1GTH A;  4MK9 A;  3TZW A;  3F41 A;  2VFU A;  3DFE A;  1EAY C;  4WXW A;  2JX2 A;  4Y00 A;  1F0X A;  1TKX A;  2VL1 A;  2AX1 A;  3DGV A;  3DRP A;  4U9R A;  3W2V A;  3CSK A;  2DNR A;  2ZKT A;  4ZVU B;  3CJ5 A;  2CQD A;  2HFS A;  4RNF A;  3F73 A;  2V4J B;  2HRY A;  4JBC A;  5EGY A;  2XGQ A;  1KS2 A;  3D9B A;  3BB5 A;  2OTL S;  2DD8 S;  1IWG A;  2FJB B;  1WC5 A;  3GCX P;  2ZWP A;  2V8G A;  1KRP A;  4AFF A;  2C3U A;  5D8H B;  1D3W A;  4KIA A;  2ZM6 J;  2LQB A;  2BE9 B;  3EGZ A;  4A47 A;  3MM9 B;  4F4Y A;  3RBD A;  2YNH A;  4DFJ A;  2IY5 B;  3VR1 A;  1ZM4 A;  2IMW P;  4D3H A;  3SBM A;  4OX8 A;  2XHC A;  3J80 Y;  4CCH A;  4QU6 A;  1LQ9 A;  1T9Y A;  2HFO A;  1PKU A;  2K1R B;  1N33 J;  2XHW A;  4EWT A;  1TTH B;  1DY3 A;  1N32 J;  2VG5 A;  2WOM B;  3LAL A;  3R6G B;  3KLG A;  1U1R A;  4M95 A;  4NYZ A;  1H73 A;  2DO0 A;  3BRE A;  1YIJ S;  2VQF F;  2HRT A;  3MOJ B;  2BW2 A;  4JI1 J;  4RNM A;  4DV1 F;  4KB7 A;  3NXZ A;  5J2M B;  5D4N A;  4DN9 A;  2BRK A;  2H9Z A;  2C2M B;  1IKY B;  2I1R A;  1I51 B;  3DI6 B;  1WHW A;  3EVM A;  1N34 J;  3LP2 B;  2K7K A;  4ZDN A;  1S72 S;  3O44 A;  1S7H A;  5KFC A;  3L7U A;  4K4V A;  3OXF A;  3KDN A;  3ZZR A;  4F4X A;  3T1H F;  3V6K A;  4O4G B;  3QGI A;  1X0F A;  4LT6 A;  2OPP A;  2GMH A;  3DRR B;  3ET6 A;  3MR6 A;  3GG1 A;  3OR2 A;  3ETO A;  5B7W A;  5C24 A;  1TK8 A;  2W4P A;  2VQE F;  2N82 B;  5KOX A;  2AWZ A;  1E6V A;  2BKO A;  1I94 F;  3NCQ A;  5D4P A;  1MN9 A;  3QFH A;  5GAH I;  3EIC A;  3A8J A;  4N76 A;  3K2Y A;  1NZ8 A;  3UCZ P;  2X3D A;  4P2X A;  4EMD A;  5ETT A;  5ETQ A;  5L1I A;  1CJT B;  3OVA A;  3OFH A;  1IKV A;  1FWP A;  2BE2 B;  5F8G A;  1TK5 A;  2L3M A;  1HHS A;  4OZN A;  5FD1 A;  3G4S S;  2O1P A;  2ZH9 A;  2B43 A;  3GV5 B;  4MJK A;  2MKK A;  3AH6 A;  3RGI A;  2RU9 A;  1RCX B;  4B9U A;  1S6Q A;  2E1M C;  1T11 A;  2CJQ A;  1GT8 A;  3QO9 A;  2RKI A;  3ZTS A;  1SL1 A;  1FHT A;  5CH7 B;  3H4D A;  5HL7 Q;  1RTI B;  3OTC A;  4B3R F;  4B3T F;  2MZQ A;  2ZH8 A;  3VGV A;  1FXR A;  4PG4 A;  1D9F A;  2XNR A;  2R7S A;  5IT9 U;  1NKB A;  3V81 A;  1Z2Z A;  2I0X A;  4CQ1 A;  3H5X A;  4HDG A;  1RKJ A;  3ZZ0 A;  1CVJ A;  2ZNY A;  4X65 F;  2RRB A;  3KG0 A;  4HT7 A;  1VHI A;  3MM7 A;  2UUA F;  3AA8 A;  1OY9 A;  5K14 A;  4Z37 A;  2PFD A;  4NOH A;  1LW0 B;  3FMB A;  2WSC C;  4OYI A;  2EEY A;  5KFK A;  3KYL A;  4MKB A;  2JVR A;  2HGM A;  2WBR A;  1H2U X;  2VKR A;  1QE1 B;  3KLI A;  3W63 A;  2MB0 B;  1GK8 A;  4K59 A;  2OJ3 A;  5I4M A;  1S10 A;  2IBK A;  3NOC A;  2QFJ A;  1ITP A;  1PGZ A;  1H98 A;  2ZH7 A;  4B9N A;  3RBX A;  2IYG A;  3M8R A;  1UJ4 A;  2DGW A;  1RT6 B;  1SBR A;  3N28 A;  3AFG A;  4WPA A;  1O5J A;  1RTH A;  3PNI A;  2EFQ A;  3QT6 A;  1OY8 A;  4N77 A;  4ZP7 A;  3MM5 B;  4M5D B;  4OQJ A;  3UI3 A;  1KLM A;  2GX8 A;  2YH0 A;  3T6B A;  3TVK A;  4TVA B;  3KJF B;  2HBR B;  3R6L B;  1S12 A;  4QPX A;  2ILZ A;  1Q53 A;  5DJB A;  3ZZY A;  1JLQ A;  2IC3 A;  1RTD B;  3IG1 A;  2AQ4 A;  2EC0 A;  3BH6 B;  4IG3 B;  4NA3 A;  2ZH2 A;  4WZM A;  2KG0 A;  1NEE A;  4CT9 A;  3G9C A;  2UUB F;  4EEY A;  2P2C B;  3FCV A;  1SH2 A;  2YKQ A;  3MR3 A;  4DQP A;  3MM6 A;  3QNW B;  4F4Z A;  2CG8 A;  2D7S A;  5E7O B;  2WON A;  4ECV A;  2PII A;  3KLV A;  3TP2 A;  2YQ3 A;  1IKW A;  3FRY A;  4I2Q B;  1UTA A;  5D4O A;  3OLB A;  3IN5 A;  3B6B A;  2EFP A;  3BO4 A;  2HVH A;  1I1G A;  1CJV A;  3KXD A;  4Q2M A;  1N4L A;  1NK0 A;  3FEY B;  4BHQ A;  3RAQ A;  2V68 A;  4NXN J;  4Q8E A;  4DG1 B;  3BBF A;  3KK1 B;  1MRO A;  1RKI A;  1VQM S;  2FZC B;  5J2Q A;  3PVX A;  3CED A;  2K06 A;  4NLS A;  2LCW A;  5FLX Y;  5ITH A;  6FD1 A;  5JMN A;  1WD6 A;  3DCA A;  2I2Y A;  3IWL A;  2FGO A;  1XIQ A;  4K50 A;  1KKH A;  2BAN B;  3FQL A;  3MMA A;  1X5P A;  2C22 A;  1S1U A;  3VV2 B;  4K0K J;  2N3L A;  2WB4 A;  2KXF A;  3FBF A;  1GMV A;  5LL6 d;  4DOZ A;  1C0T A;  3U1M A;  3LP0 B;  3CCT A;  1SJR A;  1RT5 B;  2JC0 A;  2EKN A;  4KFB B;  2ACY A;  5L39 A;  3TZZ A;  2CKW A;  4X4T A;  1FF2 A;  2IIH A;  3VAL A;  2Y3Y A;  1RCO B;  1U2C A;  5CYJ A;  2HHQ A;  3IAM 9;  1KFD A;  4RW6 A;  4ZLN A;  3FSY A;  3CGI A;  2VKZ G;  4ETZ A;  2D74 B;  5B08 A;  2LQ9 A;  4OZ5 A;  3RW7 A;  2HW3 A;  1NUE A;  5GAG U;  3M8Y A;  5KG3 A;  3CIZ A;  1NK5 A;  4AXI A;  3LTO A;  2DH8 A;  2JEI A;  2L9W A;  1X4A A;  3O8W A;  2NPI A;  2J0W A;  1M0S A;  2X7I A;  2J9D E;  5HVG A;  3CJT A;  4QCL A;  2BQ3 A;  4K4U A;  4IRC A;  2GJI A;  3EZU A;  4A8Q A;  4PAA A;  1FTR A;  1RHU B;  1T02 A;  2JZ5 A;  4ED1 A;  1BMQ B;  1RHK B;  2DPJ A;  5C2G A;  3WIU A;  2HBQ B;  4P2S A;  3BYR A;  4ES2 A;  1H2V Z;  1D1U A;  1YJT A;  3CDA A;  4X4R A;  2OHD A;  5KT7 A;  4K4W A;  4DI6 A;  2FTR A;  4LSZ B;  1B64 A;  1W26 A;  3KMS A;  1KP6 A;  2O66 A;  4ELT A;  2FLP A;  3RAX A;  4OJG A;  3HPO A;  2GHV C;  1WG1 A;  4YDD B;  3DM2 A;  4N41 A;  1RHR B;  4RUB A;  1YI2 S;  4RU2 A;  1JXL A;  1FDB A;  4G6V B;  1ZAX A;  3FCH A;  2HHS A;  1NK4 A;  5JVG Q;  4G3I A;  2KHD A;  4DUY F;  4ZJL A;  1YDL A;  1QVG R;  3MEC A;  4ZPA A;  3CJK B;  4JI7 J;  4F0K A;  1E6Y A;  2VG5 B;  1QSY A;  2G9O A;  5MLC V;  3OXL A;  4NLT A;  1S1W A;  3PW2 A;  3KLH A;  3A3N B;  1YG0 A;  2RRN A;  3GIJ A;  1TAU A;  2BZ2 A;  1R6V A;  1NM2 A;  4LRB A;  3SDE B;  3HVT A;  3G6Y A;  2HHU A;  2JRS A;  3ZTP A;  2XCA A;  4YY3 F;  3OT9 A;  2QMU B;  3ICL A;  2HSE B;  1MU2 A;  2HPU A;  2BA9 A;  2RF2 B;  2OMO A;  4BWM A;  3KNA A;  2B7B B;  1R3N A;  1R8P A;  4JOU A;  4CH7 A;  2HHH J;  3PHE A;  4IOA Q;  2B9E A;  1A6L A;  3QYY A;  1BQN A;  2M3D A;  4U95 A;  4RBT A;  2HNY A;  1RJJ A;  3K0J A;  4DLE A;  4RO0 A;  1H6K X;  2W1B A;  1SJ4 P;  3DDN A;  1P1L A;  3Q22 A;  1JQG A;  2V63 A;  5M2P A;  4FYX B;  1GH8 A;  2JVO A;  2AV5 A;  3QAE A;  1IM6 A;  4L75 A;  1VRU A;  2RNE A;  5HAO A;  2MJN A;  2QZ8 A;  4YME A;  5LJ5 Y;  5G0R A;  2QL9 B;  4FYW B;  2FHJ A;  2BXJ A;  3OR2 B;  2V2Q A;  1RA6 A;  1Q78 A;  2RAQ A;  3OPK A;  3E51 A;  1XER A;  1JJC B;  3W2W A;  1HNX F;  1WEX A;  1R8H A;  5HBM A;  2DRD A;  3PX4 A;  2OEK A;  2K2P A;  3FZB A;  1D9D A;  3GB0 A;  1J2V A;  4QR0 A;  1X9W A;  3H2V E;  4A46 A;  1R0A A;  2DXE A;  1RYS A;  4F3M A;  1TFW A;  1Q8I A;  3HD2 A;  1YK9 A;  4DSI A;  2XMK A;  1FX4 A;  1WEY A;  2RJZ A;  1WF1 A;  3T9N A;  2I9S A;  2YBV A;  4WU3 A;  4JV2 A;  3GPA A;  1J27 A;  3TNV A;  4DV5 J;  2YX4 A;  1T05 A;  2KB2 A;  4LUB A;  1HWJ A;  1DTQ A;  3U27 A;  2E5G A;  3RBE A;  4K2X A;  1RU2 A;  1UJ5 A;  3QO9 B;  4N47 A;  1LWF B;  3IFE A;  1RWX B;  2H48 B;  2IRU A;  4WJB A;  2AZ1 A;  3W61 A;  1F9H A;  4U8V A;  1VS3 A;  5DLF A;  5HP1 A;  3JQK A;  3GG0 A;  2KZZ A;  3IR5 B;  3U02 A;  3UDC A;  3V81 B;  2CVE A;  1AW0 A;  4PKD B;  3UPF A;  3KMQ A;  1REV A;  4DL5 A;  2F4V F;  1F5A A;  5A8R A;  3MAH A;  2V5H G;  2R2T A;  2IFX A;  2PC6 A;  4RNO A;  1JJH A;  4CI0 B;  2NXC A;  3NAI A;  2FJA B;  3MM7 B;  5GAG I;  2D3Z A;  3KG4 A;  4G1I A;  3ZC4 A;  3SCJ E;  4PCQ A;  2FLN A;  3VAI A;  2OEL A;  4OI0 A;  1TV6 B;  1FT8 A;  4I4B A;  1VQ4 S;  4DR5 F;  3Q24 A;  3AJ2 A;  2IHR 1;  1KD1 T;  3GZ7 A;  3MEE A;  3MED A;  1FKP A;  4I2P B;  2GVZ A;  1JLG A;  5AXN A;  1AFI A;  1RB0 A;  5A6W A;  2HG4 A;  4RUC A;  1D9A A;  2IA6 A;  4F02 A;  1JX4 A;  4MAK A;  5GAD U;  2VH7 A;  4OYX A;  1RTH B;  3KTQ A;  2UXD J;  3SFU A;  1KLM B;  2Z4P A;  1S1X A;  3ENQ A;  1AYE A;  3GFH A;  3IG1 B;  3M1V A;  2R42 A;  1Q79 A;  4OX6 A;  3MR5 A;  2BAB A;  1D8Z A;  3GSD A;  1S49 A;  3ZFV A;  4DR6 F;  4DPW A;  1YSJ A;  2QA4 G;  4JI8 F;  4B3O B;  1KVJ A;  4FVC A;  2E5L F;  2D3O R;  2C2D A;  1N52 B;  2OTJ S;  1HR0 J;  3IR7 B;  1ELO A;  2NSC A;  2AZ3 A;  5C2C A;  2WON B;  3IAS 9;  5KFT A;  2LA4 A;  4RBU A;  4MKA A;  3BSN A;  1ZPV A;  4GO7 X;  3I6P A;  1Q4R A;  1CJV B;  2HK3 A;  4OYP A;  5ETP A;  3QRP A;  1RBA A;  4OL8 A;  3CXC R;  3AJ1 A;  5J2Q B;  2AT1 B;  2HS3 A;  2HHP A;  4OYZ A;  4LIR A;  4J9S A;  1IUJ A;  2R7U A;  1WKJ A;  2YKO A;  3BR8 A;  7FDR A;  4P6Q A;  2LXU A;  3MI7 X;  4JI4 F;  2UXC F;  2RML A;  3NNA A;  3RRK A;  2V50 A;  4PR6 A;  1LK5 A;  4RW9 A;  2UVV A;  2DEI A;  5J1E B;  1YX2 A;  4CWB A;  1CJK B;  2OPR A;  2VG7 A;  3MPV A;  1Y10 A;  1C0T B;  5IV3 A;  4EU0 A;  4CLP A;  4H4O B;  3KLF A;  2M8D B;  4JV1 A;  5GAE U;  4Y3C A;  2XZD B;  4RL1 A;  4DL2 A;  4ZMM A;  4M94 A;  4GVL A;  2F4F A;  4CO5 A;  1SPB P;  1UVJ A;  1FRK A;  2MKI A;  4ENO A;  3V5R A;  3PJX A;  4ALZ A;  3ENA A;  1RT2 A;  5LM7 E;  3RG6 A;  4X4S A;  3DLB A;  3KUG A;  3CD5 A;  2ALZ A;  2YKN A;  5ETS A;  2HMI A;  2KYZ A;  4LF6 J;  3FJ2 A;  4KHP J;  2R2R A;  5HVF A;  3IS9 A;  1HI8 A;  1TL3 A;  5E41 A;  3P6Y C;  1HI1 A;  2QJ3 A;  3PIP Q;  2R2S A;  1X5O A;  1HMV A;  3L7P A;  3CCJ S;  4DR1 J;  3QQC D;  2AEJ A;  3DHX A;  3Q8V A;  3Q86 A;  1RAA B;  3KHH A;  4P9S A;  4QU7 A;  3M9N B;  4P75 A;  3V6H A;  3CCS S;  1M90 T;  2XBP A;  3H8Y A;  6AT1 B;  2CRL A;  3B4M A;  4BS2 A;  2ROG A;  4DV4 J;  4HTI A;  4LF7 F;  2EW9 A;  4LF5 F;  1VQN S;  2KYX A;  3B4D A;  1VGY A;  3CCU S;  4M5L A;  1KHV A;  3KK3 A;  1WG5 A;  3ZZT A;  4NML A;  2X1A A;  2MQ8 A;  1AB8 A;  3HSG A;  2ZJR Q;  2DT9 A;  1FJE B;  2XI2 A;  4Q2L A;  3DN9 A;  4C0O C;  2VPZ B;  4KGZ B;  2CUY A;  4JYA F;  4E2F B;  2JEJ A;  1S77 D;  4KGX B;  3LWL A;  4LF4 F;  1FRM A;  4M5I A;  4NCA A;  2F40 A;  2DR6 A;  3M32 A;  4GVB B;  4OJ3 A;  5DDP C;  4TQR A;  2WSF C;  3CDE A;  4HYK A;  2WK4 A;  2RRA A;  2WVE A;  4A8X A;  3C6U A;  5JUM A;  4QR2 A;  3NY0 A;  3VAF A;  2HQ3 A;  3MEC B;  2BJ8 A;  1Q7L B;  1E6Y B;  2CPI A;  4IKA A;  2EK6 A;  4YS2 A;  2C3Y A;  5KFQ A;  2M9K A;  2OFG X;  1YKW A;  4ILM A;  4FPR A;  2W8L A;  1HBM B;  1Y0H A;  1S99 A;  4ANE A;  3NGR A;  1KLN A;  1PSD A;  1ZZF A;  2B6A B;  4WP8 A;  5AJ3 J;  5DM7 Q;  2E9R X;  5A0Y B;  3HHL D;  3HVT B;  2XMM A;  1A0O B;  1R31 A;  3OSP A;  1TVR A;  4F36 A;  4PG7 A;  3V4M A;  3OHA A;  2YNF A;  5KFB A;  3ZZO A;  1VRT B;  1BXN A;  3PCO B;  2VPW B;  2W4C A;  5K8N A;  1RT4 B;  5F9L A;  2KT5 A;  1OJ4 A;  2ASY A;  2XSF A;  4QPT A;  3EPG A;  1DRZ A;  2DHA A;  4OZ3 A;  2HNY B;  3N0V A;  4KBI A;  3WC0 A;  3BGO P;  4V1A k;  1GX5 A;  4FYD A;  2R2U A;  2QTW A;  3PG9 A;  1U49 A;  4I68 A;  1U02 A;  3BV8 A;  4QW8 A;  4L73 A;  3CJ3 A;  1IBK F;  1VRU B;  1DHM A;  5EX3 A;  1LWE A;  4HAC A;  3OFE A;  2CQ3 A;  3G2X A;  3BGF A;  1RT7 A;  4MKY A;  4F0M A;  3A8E A;  4YQW A;  1O6X A;  4WCE Q;  2V67 A;  5CQG A;  1RWW B;  3S7R A;  4C2M A;  5EX0 A;  3BO2 A;  3OBI A;  3PYD A;  3H2L A;  3MWB A;  1X7V A;  2NQP A;  3T19 A;  2DNZ A;  3T9Z A;  2COL A;  4ANC A;  1HBO A;  4CRJ A;  1JB0 C;  1NK9 A;  5ETL A;  4FXV A;  2CJ9 A;  1ACM B;  1PO6 A;  4ZPW R;  2XNQ A;  5CA5 A;  4IFV B;  2IJF A;  2HLT A;  5J2N A;  2LEP A;  4DQS A;  1NME B;  4DV2 J;  3NP5 A;  3HZG A;  2XLK A;  5L1L A;  4U7U K;  1RE1 B;  4PZV A;  5T41 A;  3CD7 A;  1Y7P A;  3QRQ A;  1RWM B;  4RWX A;  1S7I A;  2BQR A;  4HVZ A;  1UVK A;  2SXL A;  1KC8 T;  1DTQ B;  1YLX A;  1KTV A;  2EC2 A;  4C4W A;  1VIS A;  2AU0 A;  3OSN A;  3QGP A;  3N5B A;  4YOE A;  2CIM A;  3HX9 A;  4I6W A;  3ISN D;  3P3D A;  1VQP S;  1IBM J;  4DL4 A;  5CYM A;  4JI0 J;  2J8A A;  2H1Y A;  2M8H A;  4ED3 A;  1L3K A;  3PO4 A;  4C9D A;  1UZH A;  4A8M P;  3KG1 A;  3EVW A;  3UR0 A;  2DNL A;  2OGU A;  1WJ9 A;  1JWW A;  2KFN A;  2D9O A;  3R7N B;  4DPX A;  1GMU A;  5GAE I;  5KFH A;  1A9N B;  4TU9 A;  1U1M A;  1QAI A;  2AGQ A;  3EJM A;  1REV B;  1GXT A;  1IBL F;  5F3T A;  3HF5 A;  4Z7C A;  4IFY A;  3JTN A;  4X4Q A;  3IRX A;  3G8T A;  1KOO A;  2O5D A;  3SCI E;  1ZZN A;  4U8Y A;  1D8Y A;  5BR8 F;  2CQP A;  3DHW C;  4EK2 A;  2B5J A;  2BJ1 A;  2M88 A;  4R8U A;  1C4C A;  2ZWO A;  3DLK A;  2HYI B;  2I5J A;  2OEM A;  1K0T A;  2HAF A;  4ITS A;  5AE1 A;  2ZH1 A;  1LW2 A;  4ZN1 A;  2VOD A;  5B0A A;  2F8E X;  2G1D A;  4X4P A;  1PC5 A;  4WE1 B;  4LR8 A;  3FCW A;  4DL3 A;  2LYV A;  1PIE A;  3D6F B;  4PG6 A;  1FKP B;  1WC1 A;  2GVZ B;  1T3O A;  3UDE A;  3HHE A;  3AOC A;  2F9D A;  2L9N A;  3OTO J;  2BJ9 A;  1VFJ A;  3EVO A;  2WVF A;  2JNJ A;  1RLC L;  1YRX A;  4N5S A;  4NCG A;  5CCL A;  2QEX S;  4O3P A;  4KPC A;  2LEA A;  3PRV A;  3R5A A;  1Q8B A;  3NMR A;  2DNQ A;  4KGM A;  4TXS A;  5BYR A;  3A8I A;  1RTJ B;  4OYB A;  1TKD A;  4ZPB A;  2GQC A;  3DLG A;  3M1V B;  5HI7 A;  5ADZ A;  2CDR B;  4QJV A;  3BQ2 A;  3NNH A;  1OYD A;  3NAH A;  1S4F A;  2AJF E;  1SUQ A;  1GX6 A;  5EUH A;  4ZVQ B;  3M6U A;  4D3G A;  4OLO A;  1YBA A;  1HYS B;  4M5N A;  3R1L A;  4LFB J;  3QWU A;  4U96 A;  5DQH A;  4OZ0 A;  2VC1 A;  1N32 F;  3AQP A;  3EXC X;  2MQP A;  3IGN A;  2FJX A;  4GKJ J;  1SL0 A;  4B02 A;  2GML A;  4NEZ A;  4ID5 A;  2CZ9 A;  3TZY A;  3QJP A;  5SZT A;  1ZOT A;  2DGX A;  2H5J B;  3TZX A;  3UNY A;  2DGU A;  5KFA A;  3J7Z 5;  1M5H A;  4CT8 A;  3QGG A;  4NI2 A;  2W9B A;  4ZJO A;  3GJR B;  1Q1K A;  1YJ7 A;  3CE8 A;  4JI1 F;  4AYB D;  4W92 B;  3UDL A;  1T7P A;  1RUS A;  3G87 A;  2Q66 A;  2XLJ A;  2VD3 A;  4BLG A;  1TUW A;  2AJ2 A;  3H5S A;  4F3Q A;  4JUZ A;  2W2N P;  2C28 A;  1UAW A;  2IM3 A;  1FDD A;  2GIQ A;  1N34 F;  3FFI B;  3HLU A;  4OYM A;  4J91 A;  2GQQ A;  3T6J A;  2DCL A;  2M52 A;  2ABY A;  3RR7 A;  2B9X A;  1U25 A;  2B51 A;  4LBH A;  3P5T L;  4YDX A;  2ZH4 A;  2VG7 B;  2JDJ A;  2UU9 J;  2RDD A;  2NZ4 A;  4OHW A;  3KLF B;  1K1Q A;  4DSJ A;  1TUV A;  2PMH A;  2RS2 A;  4OLP A;  4UQT A;  4DXL A;  1EZZ B;  3SQO P;  3VGS A;  2MTL A;  3OUY B;  3BSO A;  1LV5 A;  5D6G A;  4MFB A;  4B3S F;  1N56 A;  2BJ3 A;  2GIF A;  5EN1 A;  1HHQ A;  4OMF G;  1UVN A;  1PIL A;  1FJG F;  3M6X A;  2HMI B;  2E66 A;  3HMJ G;  5AXM A;  2F65 A;  2LKZ A;  1F2G A;  3FC9 A;  4DSL A;  3IS9 B;  1TL3 B;  1BWV A;  1T9U A;  3GR0 A;  1SH3 A;  2XEX A;  2F63 A;  2K3K A;  1SJ1 A;  3VF0 B;  2QL7 B;  4QYZ K;  4CLW A;  3QMQ A;  4ZIV A;  2KKH A;  1YJN S;  3UD3 P;  1WDD A;  2HGN A;  4MT1 A;  3M8W A;  4U6P A;  4OX7 A;  3BGU A;  2CWX A;  1L3U A;  3CCV S;  4KH0 B;  3EGV A;  2FLO A;  2B4U A;  3SXL A;  1FK9 A;  1R8C A;  1VQ5 S;  3MR7 A;  2MJU A;  3QRR A;  1U2F A;  2J0S D;  3JYT A;  2B8P A;  1VCT A;  4AE5 A;  1B3T A;  4IOB A;  2JOQ A;  1K73 T;  4YN3 B;  2G13 A;  3LO3 A;  1QUP A;  3PEH A;  1UA1 A;  3OTD A;  1VIO A;  1WSV A;  2YX7 A;  2UXB J;  1OSC A;  3WX8 A;  2DHS A;  5FLX U;  3DLH A;  2XGP A;  3EX7 B;  1BQM B;  2HNZ A;  2AP6 A;  3MPD A;  2HQF A;  1RT3 A;  4DR4 F;  1FWK A;  2R8J A;  5K8M A;  2WVB A;  3A1Y G;  2VUG A;  5A8W B;  3AJD A;  3M32 B;  2QC3 A;  2L41 A;  2Q79 A;  2WZ1 A;  1LFW A;  4KV8 A;  2RU3 A;  1NJY A;  2KJW A;  1DBD A;  1U0H A;  4O3N A;  3C6U B;  1MLA A;  1T8E A;  2RIJ A;  5E2Q A;  5F8N A;  3OTE A;  3OR1 B;  3W1Y C;  3HKW A;  4WFA Q;  3W66 A;  2KTQ A;  2WTF A;  1EET B;  4OIX A;  3P49 B;  1WOS A;  2HND B;  1RTZ A;  4J7C A;  1WF2 A;  1G2E A;  4O0N A;  4UZB A;  3HHL B;  4C0H A;  4RU9 A;  4DR3 J;  1TL1 A;  1HNV A;  5G4D A;  4URS A;  5HJY A;  2HVD A;  1UVI A;  4PWD B;  3RJM B;  4UOC A;  1SC3 B;  4O3Q A;  5KG4 A;  1H2T Z;  4CO2 A;  4Q45 A;  3D6H B;  4EO8 A;  2DTJ A;  4RR5 A;  3G6E S;  4TN2 A;  3MFH A;  2HFZ A;  3GU0 A;  4BBY A;  1N0V C;  2ZOF A;  5T7L A;  1WEL A;  3ITH A;  1JLF A;  1PYS B;  4NLX A;  5C5J A;  1SL2 A;  4ZPT R;  2O3D A;  3BN7 A;  1WI8 A;  1M5V C;  3ONQ A;  4J9K A;  3CDB A;  4DQR A;  1OIA A;  2N7Y A;  2WAQ D;  2VFS A;  1ICE B;  4J9L A;  1YJU A;  4C8N A;  4AND A;  3KK2 B;  2Y0S D;  4KKO A;  2DKO B;  2FHO B;  1FXL A;  1HWU A;  1L3T A;  2PDA A;  1J5O A;  3DU6 A;  2HWI A;  1LWE B;  4ZHR B;  4HAC B;  1RT7 B;  2W2Q P;  1S0O A;  4JV5 F;  1V3Z A;  4A8Y A;  3QPI A;  3I56 S;  2VPX B;  4ECR A;  4KO0 B;  1GQE A;  1B99 A;  3O5T B;  5J2P B;  2E1C A;  2IJR A;  2DNG A;  5IXU A;  3BPS P;  5HVH A;  1HBO B;  2Y1I A;  1QVF R;  1RAE B;  4QW9 A;  1XMO F;  1F3V A;  3HJV A;  2HKE A;  2HZC A;  3W64 A;  3RU0 A;  4NXN F;  5J2N B;  3NGK A;  1SXL A;  1UWA A;  5M2U A;  1WHX A;  1T03 A;  1JNZ B;  4Q7A A;  2ZNZ A;  2XMA A;  3CVK A;  2ACM A;  2VZ9 A;  3MAA A;  1XJW B;  3MAQ A;  4DFM A;  2CQH A;  3FNN A;  4DPY A;  4YR2 A;  1C2P A;  2V8D A;  4LF8 F;  1YTY A;  1RT1 A;  5HRO A;  4URG A;  3NGS A;  3G8S A;  1VQL S;  5IM0 B;  3M2R A;  1R0C B;  2C42 A;  4UOF A;  3UWT A;  2DXF A;  2A3J A;  4DUZ J;  3K5P A;  2CDQ A;  4LSL A;  4ZVT B;  3UVJ B;  2CPY A;  4FF1 A;  3LGH A;  2Q43 A;  1JLA A;  2LP4 A;  5FDL A;  1FI4 A;  4A48 A;  2OPS A;  3IRX B;  2P9E A;  1SB6 A;  2QLX A;  2B5J B;  2QA4 S;  2YQ1 A;  4F25 A;  1HQU A;  2I5J B;  5C25 A;  3BDP A;  3GII A;  1Z4U A;  4A4J A;  1ZAV A;  3GYX B;  2MQN A;  4ECX A;  1NJX A;  3EWG A;  3MUT P;  4RNN A;  2G0C A;  2OD6 A;  3GWC A;  1Q95 G;  2MKS A;  3Q8S B;  2V9K A;  4B3T J;  4K7Q A;  4KQZ A;  1UVL A;  4IRD A;  1X4D A;  2YKP A;  3G82 A;  2R7X A;  4J9N A;  3OL9 A;  4C7Q A;  1AXQ A;  1DQA A;  2XS2 A;  3DXB A;  1AUS L;  5D0R A;  2QSF A;  3PW0 A;  2YKM A;  3OJU A;  2CNO B;  4IQX A;  1RAJ A;  3GV8 B;  3C46 A;  1ZET A;  2BYC A;  1SQF A;  2QLJ B;  2DNK A;  2GO9 A;  3AD9 C;  3DDK A;  1BQX A;  2GAH C;  3VCD A;  2FB0 A;  2UVU A;  4A8S A;  2YPY A;  2DHX A;  3L09 A;  4J37 A;  3KJV B;  4KE5 A;  3DLG B;  1C1B A;  4B9M A;  2MZR A;  2ASD A;  5D3G A;  3TAN A;  3R3T A;  2OH2 A;  2AJ0 A;  1G3O A;  3HJF A;  1SUQ B;  3SEO A;  4QIE A;  1U6F A;  2OPQ A;  3DKD A;  2U1A A;  4NRU A;  4X2B A;  4CDI A;  2M70 A;  4DSK A;  1CUL B;  4LFC J;  3CD6 S;  2DPI A;  1EKS A;  4PXE A;  1PBA A;  5KFV A;  4DQQ A;  3PJW A;  4JI7 F;  1GXU A;  3TYT A;  1KTQ A;  3DMJ A;  1ZM3 A;  1S9E A;  3NRB A;  2LDY A;  2O67 A;  1T94 A;  2DGS A;  2WHO A;  2RIL A;  3JB9 k;  5AE2 A;  1C1C A;  4LR9 A;  2DNY A;  3PYG A;  1Q5Y A;  2CZV C;  1NU4 A;  2FJE B;  2G2O A;  2GCF A;  2LDI A;  4NI2 B;  2DJW A;  2W9B B;  1ZH5 A;  4TLQ A;  2RQK A;  5JVH Q;  3NG8 A;  4GKK J;  3BBB A;  1RAH B;  2E7X A;  3VQS A;  2R9L A;  2E9Z A;  4CYU A;  5BYQ A;  2YTC A;  5F0U A;  3M2V A;  4P2M A;  3CW2 C;  4DX6 A;  1YIT S;  3HKZ D;  4YB5 A;  4WK1 A;  1HHT P;  2DIU A;  1XNQ J;  2J9C A;  3PR4 A;  1HA1 A;  1UEV A;  1B7Y B;  3H5Y A;  4ZP9 A;  4KY3 A;  2KHC A;  4FDF A;  2IMO A;  3D66 A;  1VYA A;  2Y0B B;  1X8D A;  1ZTT A;  3PHT A;  1WOO A;  4WP9 A;  4PQU A;  1HNI A;  3RYL A;  3GYG A;  3WBZ A;  3GP9 A;  4Q44 A;  3M30 B;  1I6J A;  5KAK A;  1M1G A;  1APS A;  1NPK A;  4TLR A;  5HMY A;  3MEK A;  1RZM A;  4NWB A;  1B0P A;  1TZ0 A;  1VOM A;  4LFA J;  5L38 A;  1URN A;  4XTT A;  3UO0 A;  5KFG A;  1S0N A;  2CXE A;  2V69 A;  4Y0F A;  5EWF A;  2PD1 A;  2FLL A;  1VQ8 S;  3EE3 A;  1MMD A;  4DZ6 A;  4A8W A;  4O44 A;  1S79 A;  4EGL A;  4UOG A;  3ZXW A;  1DLO A;  2IM2 A;  1FK9 B;  4Y34 A;  4B9T A;  3DXS X;  1ZM9 A;  3SFG A;  4TKT A;  4ZPD A;  1TMJ A;  2NLW A;  4C6A A;  3KHR A;  1NO8 A;  1JKH A;  2ZBR A;  4Y2A A;  2PI4 A;  2MEW A;  2V8V A;  4JI2 J;  3AA9 A;  3PKM A;  1T9W A;  3S6E A;  4URQ U;  3G71 S;  4W4M A;  3SYZ A;  3CJR A;  3NGT A;  1UEU A;  4HKQ A;  4ID8 A;  3NGU A;  3VQT A;  2HNZ B;  1DAR A;  1WSR A;  2Q6C A;  4P73 A;  1RP5 A;  2IAJ A;  3J7A N;  4DFP A;  4RUA A;  2DXD A;  1X0P A;  5H1S V;  3C3L A;  2V4Q A;  4KV8 B;  3IRW P;  1H38 A;  4HT5 A;  2KRR A;  2KXN B;  3GIM A;  3CWJ A;  4OZ1 A;  3D0G E;  1FRL A;  2EFO A;  3N6L A;  5I3U A;  4HHH A;  2OEJ A;  4WYW A;  5KFL A;  2GJF A;  2C3P A;  3US5 A;  1KWM A;  1HNV B;  3DGP B;  3CCW A;  4CIO A;  2YWW A;  2Z58 B;  4LVO P;  1FRJ A;  4YB7 A;  1U24 A;  4DSE A;  5CAB A;  5DO2 A;  1GNK A;  1VI7 A;  2CA9 A;  1XR6 A;  2QO3 A;  4Q0B B;  3BKT A;  4USM A;  4GO5 X;  3BN4 A;  1JLE A;  4OYW A;  3TQ1 A;  1XC9 A;  4JV0 A;  4ZK7 M;  2FY8 A;  3UCU P;  1CS4 B;  1RIS A;  1URR A;  3BKU A;  5HMW A;  1UZD A;  5T7L B;  3M2U A;  4XAK A;  1JLF B;  2FVP A;  2JSX A;  3S8S A;  2JLF A;  4YR0 A;  2DK2 A;  3KOA A;  2MDA A;  4YB1 P;  3OV7 A;  3DOM B;  1FE4 A;  2HEK A;  1S1V A;  1QAJ A;  5GMK a;  4HR2 A;  4UQG A;  4DUY J;  3M4X A;  2E5I A;  4EBC A;  1YVF A;  2VBX A;  1J5O B;  3WHI A;  1RU1 A;  5A8K B;  4F04 B;  2GGP B;  1HR0 F;  2ZZM A;  5KG1 A;  4J9M A;  1UPM B;  2ZFH A;  3FSI A;  1S6P A;  4USU A;  2XS7 A;  3HVR A;  2QGF B;  2XY5 A;  4WKR A;  3KLE A;  1TR0 A;  3T5K A;  4X64 F;  3IBC B;  4G1Q A;  3MPY A;  1RI7 A;  3QAT A;  2GHP A;  2HIQ A;  4CLK A;  1HBN A;  4ED0 A;  2AD9 A;  2UZA A;  3QWP A;  4NLU A;  3IWX A;  1DUR A;  2FVC A;  5B0E A;  5IT0 A;  1M1H A;  4ECW A;  3S01 A;  3H20 A;  5A6P A;  4OJH A;  4R5P A;  4DU8 A;  1T03 B;  3MUV P;  3BEG B;  4NLO A;  4FNH A;  3THV A;  3KFW X;  3NBP A;  4YFU A;  2MPU A;  2VF3 A;  4DCJ B;  3B8H A;  4K8R A;  3DOK B;  3X1L B;  2HFV A;  5KG0 A;  5H9E J;  2UUT A;  2MKJ A;  4KC5 A;  1TKZ B;  2KU7 A;  2XZW A;  3I9V 9;  1M5P C;  3IO1 A;  4FVM A;  1VBY A;  2ZVI A;  5DS7 A;  2YWF A;  2QE5 A;  2ERR A;  3O2I A;  3JQM A;  3M2R B;  1JLB A;  3R7S B;  3M8P B;  3POT B;  3ZTO A;  4Y2C A;  3J7Y U;  2J6U A;  4TY8 A;  3TAR A;  4IH7 A;  3D3B J;  2CPF A;  3UN3 A;  1HQE A;  1HW8 A;  1S9F A;  1PJ7 A;  1QDU B;  2W9C A;  4DV7 J;  4OFZ A;  1JLA B;  3PYE A;  4RW8 A;  5FDL B;  4J9R A;  3MEG A;  5ETO A;  4QR1 A;  3MMC A;  1NK6 A;  3TA0 A;  2KXH A;  1MWQ A;  1MN7 A;  1HQU B;  2RSQ A;  1XWL A;  1FFW B;  2MLZ A;  5E3Q A;  3C6T B;  1M1K T;  1NH7 A;  1LWC A;  2DIV A;  2LQ8 A;  4OZL A;  3Q2S C;  4I7F A;  5HJX A;  2BJE A;  2PI5 A;  1EQ0 A;  1K9M T;  3EGW B;  3QAU A;  3TRG A;  1F60 B;  2WW4 A;  2BV3 A;  1TL7 B;  1JK9 B;  1Y3K A;  2HQC A;  1WUU A;  3I0R B;  3G82 B;  4JI5 J;  3AOA A;  1TAQ A;  1IWA A;  2LFV A;  2ZD1 A;  1U4B A;  3F44 A;  2YKM B;  1B7F A;  1G1X A;  1S6U A;  2MGZ A;  4A8O A;  3FSX A;  2ZBP A;  3ENV A;  2F4V J;  1CEZ A;  4NLY A;  2W7P A;  2X1F A;  1VBX A;  2ZH6 A;  2VBW A;  3I5A A;  1SJQ A;  4NLR A;  3CO0 P;  3EXY A;  1IQT A;  1WC6 A;  2JFK A;  3G8Q A;  1C1B B;  4UY8 T;  5IS2 A;  2KM8 B;  4ECY A;  2MZT A;  5D3G B;  2AEM A;  5JJB A;  2X1B A;  3MFI A;  1S0M A;  2OPQ B;  4QYZ J;  1RAG B;  1EQM A;  3Q8P B;  2H4W B;  4Z2X A;  4DR5 J;  3V6D A;  2CJK A;  3MD3 A;  1HIY A;  1TKT B;  3HHN B;  5K5M A;  2FD2 A;  4C8M A;  1FDA A;  2NZC A;  3T1Y F;  1TP7 A;  2BX6 A;  3BR9 A;  4GMK A;  3DMJ B;  4M5G A;  3ILL A;  1UA0 A;  2LLZ A;  3IC1 A;  2V4J A;  4HEA 9;  2D3O 1;  3DLL Q;  3HHL C;  4LVN P;  4LF2 A;  4ED8 A;  3D1Q A;  5LXR A;  3QID A;  3B54 A;  3MD1 A;  4F67 A;  4JB8 B;  2AJQ A;  2HZV A;  5KFN A;  2DIT A;  2XWX A;  1JJ2 R;  7FD1 A;  1NJW A;  2WB1 D;  1GMW A;  1Y4Z B;  4BCA A;  1MSW D;  2DNP A;  3CB4 A;  5CCM A;  2GC8 A;  4LSN B;  4NMX A;  2E5H A;  1S48 A;  1N0U A;  4DR2 J;  4PG5 A;  4CYU B;  3DYA B;  4DR6 J;  4I0W A;  4C3K A;  1V6H A;  3M2V B;  2WRM A;  3F56 A;  1KON A;  2AHO B;  5I3Q A;  3JSM B;  3C16 B;  3CJ4 A;  4UF4 A;  4XIU A;  2K1R A;  3K17 A;  4HI2 A;  3MMJ A;  2PGC A;  2BOA A;  1VJQ A;  4Q5V A;  3W9H A;  1Y5N B;  1FRX A;  3IBW A;  2UUC F;  1JNR B;  3VZH A;  1I3O B;  4OZJ A;  4PXB A;  1HPZ A;  1HWL A;  5HMX A;  5D78 A;  4KGK A;  2ZDP A;  1WKK A;  1N5Y A;  5DG7 A;  2EG2 A;  3MPU B;  2MKH A;  4Q8F A;  4ZVF A;  1C0U A;  3GMG A;  2XMJ A;  1B0V A;  1P1T A;  5H9F K;  5HK4 A;  4WFY A;  4L76 A;  5J2M A;  1R6Y A;  3GQC A;  1Y11 A;  3MUM P;  3DI6 A;  3LF0 A;  4UZC A;  4JI4 J;  1CJU B;  2UXC J;  2FUG 9;  1IKX B;  1EHW A;  2AF6 A;  1VMB A;  2ZC4 A;  3LP2 A;  2IVM A;  1S5Z A;  4F50 A;  3DRY A;  3FUY A;  2VJU A;  3DRS A;  1J5E F;  4WII A;  1TL5 A;  2KVI A;  3KNG A;  3LAM A;  1CQN A;  4E8U A;  3ISN C;  1SH0 A;  4ED2 A;  3AD8 C;  2U2F A;  4TY9 A;  4RW4 B;  5F9N A;  1RAO A;  4FPI A;  3DRR A;  1N5T A;  2AIR B;  1IBM F;  5IQ6 A;  5HLF A;  4L6V 3;  2HBY B;  4JI0 F;  5DRK A;  3S1T A;  1RXO B;  1P9Y A;  1XQI A;  1REG X;  1JLC A;  3NGD A;  3K8V A;  5FII A;  5DQG A;  5E0O A;  1TK0 A;  2BE7 D;  2K7J A;  2MST A;  1R27 B;  5EWG A;  1S1T A;  3A12 A;  1PJ5 A;  4E98 A;  3Q8R B;  3PDN A;  5KFI A;  5L8R C;  2IAJ B;  3DC2 A;  1SKW A;  1FNX H;  4QWC A;  3CF5 Q;  1TKX B;  1CJT A;  1U8S A;  3MM8 A;  3DRP B;  1NKC A;  3W2V B;  5F8I A;  1NHU A;  1YRT A;  2UVR A;  3PW4 A;  4M5H A;  2Z2L A;  1FRI A;  4X66 J;  1U45 A;  2F9J A;  2XC9 A;  3MDF A;  1NSQ A;  4IO1 A;  2W24 A;  4H4M A;  3N6M A;  2K8G A;  2RQM A;  5I3U B;  2NUU G;  2R8K A;  4BWJ A;  3RB6 A;  4LF7 J;  3OJS A;  4LF5 J;  2ROP A;  2MZ1 A;  4ZVS B;  4KR0 B;  1X4F A;  4DUT A;  5ETK A;  1RTI A;  4JI3 F;  1V9O A;  3Q23 A;  4J9O A;  3MUR P;  4XPE A;  2A2C A;  1RBO B;  4DS4 A;  3CJS A;  3X3U A;  3EMT A;  2YNH B;  1QSL A;  1JLE B;  1UJ6 A;  3OTO F;  2G4B A;  1Q8K A;  3OTB A;  3MCO A;  5BYS A;  4FKY A;  8RUC A;  3ILI A;  2M7S A;  1IJE B;  1UKU A;  1WC0 A;  4ZP8 A;  3M2U B;  4LF4 J;  3MPW A;  1D09 B;  2DRA A;  1EKR A;  3DOL A;  4DX7 A;  4EYH B;  2HIY A;  4RNH A;  4G1P A;  2J9D A;  1FDN A;  4LRF A;  2JH3 A;  1NH8 A;  3CC7 S;  3FRZ A;  2KFZ A;  1LNQ A;  3KLG B;  4F8R A;  1K0V A;  1LW0 A;  2ZH3 A;  4H54 A;  2HK2 A;  5D77 A;  1SC6 A;  5LJ3 Y;  4MIB A;  2ZEJ A;  5HSP A;  1VBK A;  1QE1 A;  4OI4 A;  2P5V A;  3QSI A;  4TYA A;  3UNG C;  2E5J A;  4ZIW A;  2Y8W A;  5DM6 Q;  1S6P B;  5AT1 B;  1H74 A;  3PX0 A;  5KFU A;  2OO4 A;  4NEY A;  3KLE B;  1N48 A;  3CMA S;  2J8S A;  2FHM A;  1RT6 A;  2AX0 A;  3OVS A;  2NRE A;  3QJJ A;  2YNG A;  2R8I A;  1VQS A;  2EVZ A;  2HUR A;  3MM5 A;  4M5D A;  2GVD A;  2RT3 A;  1CG2 A;  1DQ9 A;  3BYP A;  4R5P B;  4HI1 A;  1WG4 A;  5LSL A;  1Z2L A;  2ZJQ Q;  1HBU A;  3GE9 A;  3GIK A;  1RTD A;  2CPJ A;  1VC0 A;  1KVI A;  1X4G A;  4RLE A;  1LKZ A;  2HGL A;  3UDV A;  3DDI A;  2OPP B;  3NBP B;  4IRK A;  3ET6 B;  2NXU A;  3PW5 A;  5C24 B;  3PX6 A;  1IBK J;  2FHJ D;  4MKV A;  2L08 A;  3ISZ A;  1FFG B;  1E6V B;  1C4A A;  3MCS A;  3PFO A;  2FQQ B;  2OML A;  2MY7 A;  2BKN A;  5L46 A;  2I38 A;  4ZKA A;  4AXJ A;  1NSP A;  3DU5 A;  2L9D A;  2JC1 A;  1JLB B;  1YJR A;  2C2R A;  5K8P A;  1H0H B;  4TY8 B;  1IKV B;  1D0E A;  1VC6 A;  1QJH A;  3QGH A;  4MH8 A;  3HT0 A;  4J5O A;  3PFE A;  5KFR A;  1B70 B;  4DG1 A;  4RW8 B;  3KK1 A;  2XY7 A;  1UWB A;  4C8Y A;  4KGV B;  3MMC B;  2GW8 A;  3AY0 A;  5IFM A;  2LEB A;  1V5I B;  3T1A A;  1XMQ F;  3OQ2 A;  1S6Q B;  4L74 A;  1F3F A;  4QWB A;  1WI6 A;  5KT4 A;  4FS2 A;  4DR7 J;  1EX8 A;  2RKI B;  1LWC B;  5DZ7 A;  4ILR A;  5KG5 A;  5A2Q Y;  3UN2 A;  1V3R A;  1CC7 A;  4ECT A;  3A3P B;  3SIP B;  3L9Z A;  4P7V A;  1HD1 A;  1N6Q A;  1BGX T;  4PAB A;  2R7Q A;  4CZC A;  2E44 A;  2E9T A;  2DBB A;  1N5Q A;  4FKX A;  5B0D A;  1HWK A;  3VVU A;  3LP0 A;  1LXN A;  2R8G A;  5LMN F;  1T9X A;  1BC6 A;  2NR0 A;  4KFB A;  3UE2 A;  5IWA J;  5IQQ A;  1SJ3 P;  2G0I A;  5F8J A;  2QIF A;  2FZK B;  2M2B A;  1TFY A;  2MMY A;  5B0F A;  1R8B A;  1Y5L B;  2BBE A;  4P71 A;  1IBL J;  4X4N A;  4PRF A;  5K14 B;  5IT4 A;  9ATC B;  3G86 A;  3FZ2 A;  4X4U A;  5BR8 J;  3PR5 B;  3CCE S;  2LQ5 A;  2C1E B;  4ETX A;  1WOR A;  3D68 A;  3KLI B;  3CDW A;  2M0G B;  2H5I B;  3RTV A;  1P6T A;  2CVI A;  2ADB A;  1RWP B;  3M9M B;  1GXL A;  1U1Q A;  3V6D B;  3CPW R;  4DV0 F;  3R97 A;  4ED4 A;  3HCX A;  2V6A A;  2CZ4 A;  1SKS A;  3CJQ A;  1WWH A;  1NRK A;  2CWK A;  3CCM S;  5DDO C;  5CZX A;  4NLG A;  3TEH B;  1NSK L;  2HQG A;  2RDI A;  4OHX A;  1NSA A;  1NZA A;  4UTG A;  2RVJ A;  5IOL A;  2EKY A;  3CNQ P;  3I31 A;  4OV6 A;  1RWV B;  4ECZ A;  1JLQ B;  2IC3 B;  4DR3 F;  3CJ2 A;  2GO8 A;  2W7O A;  3TW0 A;  2G2Z A;  4H4K C;  4IR1 A;  3HSD A;  1RK8 A;  4C8O A;  1MG7 A;  2D69 A;  1HNZ J;  4B9V A;  3MM6 B;  1RA7 A;  4K4Y A;  3VGT A;  1CBK A;  4C48 A;  2DRB A;  1L3V A;  3SZ2 A;  3HFZ B;  3H2U B;  2FC9 A;  4QOT A;  1IKW B;  2DH7 A;  8AT1 B;  3GJT B;  3D28 A;  3M8S A;  1NHK L;  1KQS R;  2Y9H A;  3ELH A;  2EBE A;  2DR9 A;  4F7V A;  5DET A;  3CJK A;  4ZOS A;  5DG8 A;  5KTQ A;  5B0G A;  1X4E A;  1X4C A;  5I42 A;  4NLW A;  4O4R A;  2ASL A;  3RRG A;  2UV8 A;  1MRO B;  3THP A;  1HPZ B;  2VPY B;  3IM8 A;  5JXS A;  1N88 A;  3EUN A;  2NUH A;  4LF9 F;  3SDE A;  4OV1 A;  4ZLL A;  4MIW A;  4MIA A;  2VAS A;  1N5Y B;  1OWX A;  3N79 A;  1Y3J A;  2UP1 A;  2VIC A;  3R2D J;  3FBB A;  1X4B A;  2BM0 A;  1HNW F;  2RF2 A;  1C0U B;  2EBG A;  4USJ C;  4ZVR B;  3Q0A A;  1X31 C;  2HFN A;  4USK A;  1F5C A;  3MMA B;  2H4Y B;  4ZCL A;  1S1U B;  4KSE B;  5SUH A;  4B17 A;  4MK7 A;  3TQE A;  3GIL A;  4X62 J;  1Q5V A;  2V34 A;  2MZJ A;  2VA2 A;  4OZ2 A;  3AB4 B;  4DCP B;  4I6Y A;  3OHB A;  3RB3 A;  3DRS B;  2CQ1 A;  1FE0 A;  1Y00 A;  2ZHA A;  1UFK A;  4CP5 A;  5EDW A;  1H3D A;  1DAX A;  4RW6 B;  2XMW A;  2EXU A;  1H7W A;  3TAQ A;  1U48 A;  5HLF B;  2G1H A;  3BZQ A;  3VAM A;  4CO1 A;  1JLC B;  3I4H X;  1SKU B;  1X9M A;  2J6S A;  1U6B A;  1OMS A;  4B3S J;  4DSF A;  1S1T B;  1KEK A;  4YHH F;  1FJG J;  2VB6 A;  4DUZ F;  2B0G A;  2GAG C;  3D5M A;  3PTW A;  1U09 A;  5E3R A;  4GRS A;  3MM8 B;  3MTJ A;  4I1T A;  2F3J A;  4O3O A;  4F4W A;  1ULR A;  5CXT A;  4RPF A;  1IR0 A;  2I6W A;  2E7W A;  4DV6 J;  2CQ0 A;  1EP4 A;  3K59 A;  1NB2 A;  3PO5 A;  2QLF B;  2O01 C;  3KHG A;  4F3O A;  4AL7 A;  4H4M B;  3P45 B;  2H65 B;  2PO4 A;  2ZOG A;  1LXJ A;  5IC4 B;  1IQZ A;  1VIX A;  3M8Q A;  3R27 A;  2CQ4 A;  3I82 A;  3UQS A;  5GME A;  1LWF A;  1B4S A;  2VJV A;  5LSO A;  1NXI A;  1GAO A;  1U1K A;  3BGR A;  2Q3P A;  3LA0 A;  5KFD A;  2QL5 B;  3TUI C;  5T14 A;  5LMU J;  4IQM A;  2ZBI A;  4LRA A;  4IR9 A;  4EBE A;  3ZTR A;  4BC9 A;  3Q8U A;  3Q2T C;  1NJZ A;  3DM2 B;  1KFS A;  4DR4 J;  2MQQ A;  1QM9 A;  3W60 A;  2HVZ A;  1PCA A;  2XMU A;  1XTZ A;  2KZM A;  2BAC A;  5CAA A;  2YPZ A;  2OFH X;  1XR5 A;  3G96 A;  4OI3 A;  1R0B G;  3TOQ A;  3DOL B;  4ZVP B;  2F7V A;  1IXK A;  1PYT A;  1T9T A;  2NXJ A;  1S1W B;  2PE8 A;  1B0T A;  2KM8 C;  3KLH B;  4NZ0 A;  2A2D A;  5E3A A;  3NWG A;  4PXC A;  3T3F A;  1JMT A;  2AJ4 A;  1TV6 A;  2LU2 A;  3EYZ A;  2XG8 A;  3SSR A;  1FKA F;  3LP1 A;  5E3P A;  3H25 A;  3WC2 A;  1WTF A;  4LFC F;  1UL3 A;  4ZCK A;  4DN0 A;  2Z8Q A;  4I69 A;  5GAD I;  4I2P A;  1MU2 B;  2AYE A;  4IG0 A;  4LR7 A;  4EZ9 A;  2GJ2 A;  4LRC A;  1WEZ A;  4CH1 A;  3CME S;  5KFP A;  3C19 A;  4U67 Q;  4IOC Q;  2APO A;  2MKY A;  1BQN B;  2YNG B;  3D6M B;  5CHC B;  4AQY F;  2AW0 A;  1N36 J;  1F1B B;  3KKF A;  3PV8 A;  1O8B A;  3JTP A;  2GVD B;  2OSR A;  4B08 A;  2XTJ P;  2MSS A;  2J0Q D;  1WNE A;  3DLE A;  1NDL A;  1YRU A;  1LK7 A;  2HVE A;  1YZ7 A;  2DHG A;  1RAI B;  3N01 A;  1FWL A;  1HBU B;  4O0I A;  3FVY A;  4DPU A;  5KG7 A;  4GKK F;  4NLQ A;  2ZIT A;  4ZIT A;  3KJQ B;  2FJW A;  5G0R B;  4B3M F;  2E1P A;  3H7H B;  1WDT A;  3BPD A;  1IR1 A;  1RHM B;  4B3O A;  4CM2 A;  3W2W B;  3MF5 A;  4UUX A;  1U47 A;  5CD4 H; 
#chains in the Genus database with same CATH homology
 3W61 A;  3BYP A;  3W63 A;  2QFI A;  3W5Y A;  3W8P A;  3W60 A;  3W5X A;  3W62 A;  3BYR A;  3W8G A;  5HSP A;  2ZZT A;  3W65 A;  3W5Z A;  3W64 A;  3W66 A;  3H90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...