3W62A

Mamm-ctd e289a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
78
Chain Sequence
HMEAVQNRIVEAAERVPGVRGVIHLRARYVGQDIWADMIIGVDPENTVEQAHEICEAVQAAVGKIRRIESLHVSAAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Magnetosome protein MamM
publication title Cation diffusion facilitators transport initiation and regulation is mediated by cation induced conformational changes of the cytoplasmic domain
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
total genus 23
structure length 78
sequence length 79
ec nomenclature
pdb deposition date 2013-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein, cytoplasmic domain 3w62A00
5HSPA 3H90A 3BYRA 3W62A 3W66A 3W65A 3W61A 2ZZTA 3W8PA 3W8GA 3W5XA 3W5ZA 3W64A 3W60A 3BYPA 3W5YA 3W63A 2QFIA
chains in the Genus database with same CATH superfamily
4I6WA 1I5OB 1FVQA 2MY8A 4WFBQ 2XGQA 3DRPB 5DJBA 4ZJOA 4ECRA 2NUUG 3JTNA 4ITSA 3K5PA 2YWGA 4E2FB 3PHEA 2DH8A 4PUOA 1R7IA 4DV5F 1N54B 2KXNB 3F0NA 5LSLA 1FJCA 4F4KA 4F4AA 4IKAA 4DFPA 2JOQA 2DEIA 4DDFA 2KM8C 4QWAA 3BO3A 1VQSA 3LAMA 4DCOB 4P52A 4QU7A 1PGZA 1HNIB 2GC8A 1TK8A 2HURA 2XLKA 2HNDA 1YBAA 4P2MA 2DCUB 4NLGA 5ETTA 3NAHA 2R7QA 2HVEA 3VAIA 2H1YA 1S48A 2XBPA 5F8NA 1RB0A 1UCNA 2X3DA 2BKNA 4C3MA 4U8VA 2HQDA 1JLGA 3OT9A 3VR1A 3H7HB 2J9DA 1OPZA 4DR4J 2Y0BB 3NAIA 3H5SA 1NSQA 5HATA 1ZS6A 3AJ2A 3BSCA 2J5AA 2L48A 1SC4B 4NMXA 4FYXB 2C3OA 1IBLJ 4K2XA 1RHQB 3NMRA 3M4XA 1RAGB 1X60A 5KFNA 3KLHB 4Q8EA 2WHOA 1FE4A 3Q8VA 2W7OA 2Q6BA 2ZOMA 3DLEB 5KFFA 3MAHA 3K7RA 2VBXA 3P96A 3T1YF 5CYQA 1PJ6A 3QWPA 4X4SA 3R1HA 1TUVA 1AYEA 3H90A 2DR5A 1U6FA 4DR7J 3A8IA 2CQ1A 5GAEU 1S5ZA 2BMBA 3AOAA 1TUWA 3EVOA 4K4VA 2CG8A 3S8SA 2VH7A 2XB2D 5L39A 2VKZG 5D15A 2XHCA 1SC6A 3P6YC 2KFYA 2CQIA 5HMWA 4H4OB 2F1FA 1A6LA 1U0HA 5B0GA 3PTWA 1QUVA 3PHTA 1UEVA 3MHYA 1HQUA 4NCAA 2NS1B 2J6TA 3DDIA 1RT2A 3DRXA 1RBAA 5D4OA 5BJRA 2E1RA 4ED1A 1JLEA 3AA9A 4H54A 3BF4A 4KJIA 3SQOP 1WC4A 3AOCA 5A8WB 1GXLA 4E0DA 4EO8A 2G2OA 2LLZA 4N8OA 1FNXH 3MGJA 3BBCA 2JWNA 3FC9A 4ZCIA 1TL7B 4RW4B 3TUZC 2V6AA 3D54A 4XO0A 2OAUA 4WU2A 5AE1A 2E29A 1IKXB 1W7WA 3QO9B 1R8CA 2GX8A 1T03A 4LFBF 3H4DA 2R8JA 1DQ9A 3MR7A 3WZ0A 5DG9A 4QIVA 4AL5A 4BDPA 1KQKA 4RUBA 4EBEA 2V9KA 3OXFA 1BWVA 3LPEA 3C15B 3ZZ0A 2VG5A 4RU9A 4OX9J 4DV2J 2G1HA 1YHQS 1IKWA 3GR0A 4QYZK 1S6OA 4FXVA 2DITA 4YB5A 1K0TA 1Y10A 1YQHA 2E9ZA 2UXBF 4DR2F 4PXBA 4K8RA 5J2NB 2NPFA 4DPOA 1R8BA 1QTNB 3QRQA 3HULA 1V3RA 3HKZD 1Q86T 3T5HA 4DL0C 2VQEF 2Z58B 5CYMA 1IKVB 4QWCA 3TW0A 4JI3F 3EPGA 4AL6A 3KDNA 3PW0A 4NL5A 5GAHI 4NLSA 2NREA 1RTHA 3I0RA 3M2UB 3BH6B 2IC3A 2UXDJ 1TKZA 3DLKB 3F73A 3IFEA 4JI8J 2C2MB 2BEFA 1B0VA 1CJVB 4F04B 3BZQA 1YRTA 2DY9A 4OX7A 2W2OP 4MFBA 5DZ6A 2XS2A 2EKYA 4I1TA 2DNKA 4C8OA 5F0WA 3GU0A 2GV1A 1VRUA 1Z2ZA 3EX7B 3R5BA 1N5YB 3DKDA 2J0WA 4LSLA 3HHLD 2F3JA 1JWWA 3M32A 4O3RA 1CSJA 3IWXA 3PJ9A 1REVB 2HAIA 1UJ6A 2IDLA 3OV7A 3PX4A 2QYCA 4I68A 1Y7PA 2YNFA 1L3KA 2HMIA 1VJWA 3ONQA 2ZKTA 4WP8A 4Y2CA 3KK1A 2BR0A 1PJ5A 5HMXA 4P73A 3DRYA 5IV3A 5EDWA 5DZ7A 2O01C 4IFYA 2JVOA 3PVXA 2EFVA 3ILLA 3K5MA 3HJFA 2R7WA 2V9WA 5DLFA 1M90T 2Q66A 4ECQA 2LQ5A 2RSQA 2UUTA 5LL6d 2DPIA 4IG3B 5KFJA 3R5JB 2NXJA 1SV5B 5HVHA 3DLHA 4NZ6A 5KFLA 3A4TA 2X3GA 3DRRA 4U8YA 4J9RA 2AGOA 1HBUA 3HKWA 2M52A 4KHPF 2QG9B 5L1IA 4ZPDA 3CGIA 1S6UA 1RT7B 2UUAF 2CNOB 2C2KB 1I3OB 3M30B 3R6GB 4PPDA 1HNVA 1P9QC 2MQNA 4V19X 2CQHA 3CJRA 3RUBL 2VG6A 2MQMA 2CQBA 3T9NA 4WJBA 3MCNA 1TK0A 3HHNB 4OHZA 4J90A 1FO1A 1QAJA 3ZTOA 3GG1A 1TK5A 1U47A 4OV6A 3O44A 3W1YC 1DJ0A 3GZ7A 3R3TA 1D0EA 2B4UA 3VWSA 2WW4A 1XR6A 4I69A 4CLLA 1F5AA 2RS8A 1EETA 3NNCA 1PCAA 1KDNA 3HHKA 3LP2B 3NXZA 5HAOA 4TVAB 4O0IA 3NMAA 1CJKB 1SJRA 2G2YA 3H59A 4P74A 4A46A 3AQPA 4USMA 2G2ZA 2F9JA 1IM6A 2MKHA 3N9UC 1MNEA 3D67A 2F40A 2MHEA 5LSRA 3EYZA 3KDOA 4XPCA 2R8KA 4L73A 2UVVA 3KLGB 2MSTA 1IM4A 2UVRA 2JEIA 4ZPWR 4LQ3A 2EEYA 4N77A 2WVEA 3D4JA 2ZJPQ 1YIJS 2IA6A 1CS4B 4J9UE 3UVJA 1BQMB 4F0KA 2MPUA 4WFYA 2OPPB 4PQAA 1VQNS 1SJ4P 1I1GA 4PZVA 3VCDA 1X4HA 1LFPA 4URSA 2EW9A 2HFVA 4RPFA 3CCLS 1VQLS 2JVRA 4OI6A 3J81j 1WC6A 4PG6A 3M1VB 5E0OA 4QJVA 2IBOA 3D66A 1YJNS 1T94A 4YHHJ 2ZH9A 3GIRA 5LSOA 2P8IA 3D6FB 2RU3A 4KH0B 4LJMA 2YPZA 2ROEA 2CPZA 5KFRA 3BS9A 2HHPA 1WSVA 2GQ2A 3R27A 1GNKA 4K4UA 3H42A 3R8YA 1D9AA 1WDTA 3G8TA 3EGZA 4RW7B 4DOZA 2VASA 3CJ3A 3EXCX 1H3DA 2UUWA 1FDNA 2KT5A 4YY3F 4QBUA 4Q0BB 5KFYA 2ABYA 3FBFA 3HVAA 1ZAVA 5ETSA 3KLEA 4NXNJ 3KG0A 2EG2A 2QSWA 3MEKA 1GMUA 2J7UA 2NZCA 6FD1A 1MU2A 1VISA 2KXFA 2LQ9A 1JIHA 5JJBA 4Y2AA 4DN0A 1N33F 4IR1A 3B78A 1LWCB 2E5JA 3TJ9A 1NUEA 2HSEB 2V8HA 1DARA 3QT7A 1VQ7S 3FSIA 1C0TB 5BXIA 8AT1B 4DZDA 3THPA 2WBMA 3S01A 3OVSA 2BRLA 3MI7X 3L7UA 2LXUA 2PA8D 3C19A 2QLJB 1VOMA 1NB2A 1MSWD 2A10A 1S9FA 3N79A 3ZZRA 5DLGA 1ELOA 2LQJA 3CCRS 1DTTA 1VQYA 2NSCA 3IBCB 3GIJA 4ZHRA 2ZJQQ 1S76D 1PSDA 3C8YA 1HBNB 4KGMA 4GO7X 3C16A 4O3NA 5CYJA 1S49A 3O8WA 4HL9A 4O44B 2B9EA 2HQIA 1D8YA 3J7YU 3HM9A 1VK3A 2R7RA 4F4YA 3OTBA 3CCJS 1QTMA 2FHJD 1N5QA 1R0AA 2ILZA 3DRSB 2K7JA 4JI6F 4WFZA 4EMDA 3WHIA 3NBPA 2C3UA 4CLPA 4NZ7A 4JI7F 2UUBJ 4K4YA 3WX8A 2PN6A 1S7HA 1S7IA 1UFKA 4I7FB 4BS2A 3TJAA 3ZC4A 1RT1A 1KNZA 4M5MA 3MM6B 3PRBA 4ECVA 1Y5NB 2WSCC 2E7WA 3CMQA 3OTEA 4NLRA 1HQEB 4Y00A 1KP6A 3TVKA 1T95A 4DV1F 1QE1A 4NASA 2VA3A 2MKSA 1APSA 3UNYA 2AKWB 3BO4A 4LFCJ 2CPFA 4EUVA 4LF9J 2Z4PA 2RILA 3Q23A 1WKKA 1RTJA 3E01B 2GJFA 1JKHA 2VA2A 5HP1A 3CIZA 5HO4A 1GXUA 2MQOA 3GB0A 4PPZA 4UOCA 2MQ8A 1GX5A 4ZVOB 4LF5J 4OI2A 3BQ0A 3I4PA 5C42A 2XMAA 4IR9A 4NPOA 4QWEA 2FGOA 2OHDA 3TUPA 3DYAB 1U1PA 2VC0A 4KAIA 3CO0P 2YKNB 4HACB 3CULA 3N6LA 5K8OA 1TV6B 2HGLA 4ERDA 2ERRA 3ZTPA 1UWAA 1ZTWA 4OHVA 1RU1A 2HGNA 4ZA1A 2VPZB 5A0YA 2KRRA 2HNYB 3GIIA 4B3RF 1CJTA 4WFXA 2NQPA 1KC8T 3CVKA 4HHJA 2C2NA 4IFVA 2DNYA 2VBYA 1NSPA 4KHRA 3V6DB 3JB9k 1LK7A 4BWMA 2FZKB 4ICLA 1KFSA 4JP8A 1JLAA 3BGRA 5I3UA 3MD1A 5KFHA 1TL3B 4NOHA 4K2JA 5J2PB 4WE1B 1OPIA 3AY0A 1WC1A 2Y8YA 2H54B 4JOUA 4DG1A 3KLVA 4C11A 2CQ0A 1S1UB 2KVIA 2J7WA 1FKPB 1SIWB 2OEMA 4PXEA 3MMBB 3RJMB 2QT7A 2Z2LA 1XNRJ 1RAEB 2K1RA 5D0GA 4C7QA 2DGTA 1F9EB 1DY3A 3EZ5A 4RW8B 4WCEQ 2DRAA 1PJ7A 1T3NA 2KO1A 4UY8T 5HVGA 3ISNC 2RAQA 3SEOA 2RJZA 3OW2R 4ECUA 1LWEA 2FZCB 4TU9A 1CJUB 5DO2A 2CNLB 2YNHB 3MMCB 2X1FA 5B0FA 1J5OB 3ILOA 4WFNQ 3VAJA 1S0MA 1M1HA 1OYDA 2HQ3A 4A8QA 2HHWA 5GMEA 1SC1B 4J91A 4QIGA 4ECZA 5F0UA 4M1KA 4DWIA 2QO3A 4X4PA 3SSRA 1NSAA 1YGYA 2FVQA 1LWXA 2B9YA 2VOOA 3G96A 1TAQA 3CSKA 1IBMJ 5HJXA 2GHVC 1RT3B 4NYZA 1U6BA 4ZKAA 3QT6A 2ACMA 3TR5A 1OWXA 3MFIA 2CAJA 2EWHA 3Q2TC 3V6KA 2DHHA 2W2PP 4R0JA 1U24A 4FBUA 5A8RA 4ZS6A 1K1SA 2YX4A 2RQCA 4OLPA 4Y2MA 1IR2A 2OI2A 2PT0A 1H72C 3UN3A 2POKA 3GYXB 4L76A 4F26A 1T02A 2B51A 4DL5A 4WP3A 4FF1A 4NCGB 5FDLA 4GKJJ 4KGKA 3NL0A 3NS5A 4UF4A 5J2QA 1VLYA 4DBQA 2B9XA 4R5PA 3RTVA 3NGUA 5KG1A 2AJ1A 4QR1A 2PGCA 1SVDA 3PXGa 4LRBA 1BMQB 3EMTA 5DETA 2DCLA 3B6BA 4QIFA 4L75A 2RKIA 2AU0A 3K5LA 4TQSA 3DFEA 3LP1A 5EX0A 4ZVQB 4CNYA 3OJUA 4DV3F 2JEGA 3NNHA 3CEDA 3G71S 2GAGC 4LF7J 2J9EA 5FLXY 4OYMA 4ANEA 4EZ6A 3GPAA 3TRGA 3SDEB 1YRXA 1FX4A 3JSYA 4UOGA 3GV5B 2XY5A 3THVA 1S57A 4M94A 1XMOF 1FDBA 1B7FA 1GFWB 5HANA 1NK0A 3PY8A 3HDSA 4A8SA 1S6QA 4YR3A 2EXUA 3MEEA 5F9NA 5ADZA 1B0PA 2PEBA 1JLBA 4LIWA 1FRKA 1BHNA 3EXYA 3CDAA 3QAUA 3MR5A 2HKEA 2D3O1 3KOAA 4IYQA 3IG1A 1R31A 3MPVA 1CQNA 3G4SS 3J81Y 2RVJA 2MKCA 4KQZA 1DLOB 3W5YA 1MMDA 2DNQA 1JLGB 1IXKA 4MIBA 5K8MA 1KQGB 1JJ2R 2QFJA 3TAQA 3I0SB 5BYSA 4I0WA 4CH1A 4OI1A 4CO5A 5HQMA 3NOCA 2W2NP 4OJ3A 1HNXF 2ZHAA 1GT8A 4B9TA 2RDJA 1L3TA 2VBZA 1VC5A 3CPWR 2BDPA 4NMLA 3BO2A 2AYEA 2FHMA 5B0DA 3LH2S 2RUGA 2XWXA 1VQKS 5IWAF 3NGSA 3TUJC 4A48A 3Q0AA 2XMUA 1BY9A 3P45B 2FVPA 3CF5Q 4AYBD 3CXCR 3R6LB 3U1LA 3NGRA 3TA1A 1Q5YA 4KE5A 2UUCJ 2WRMA 3T5LA 3FVYA 1Q8BA 4LF1A 4AL7A 3OR1A 4LF4F 1EZZB 2ZZMA 2KZZA 3BYRA 2OELA 3G86A 4FYDA 1HARA 1QLNA 4Q7AA 4RW9B 4KV8A 4LR9A 1NKEA 2LEPA 3L7PA 4DF4A 4LF8J 3CO9A 1RA7A 2Y1JA 4C9DA 2HBQB 4PABA 4DR5J 2XS5A 4AXJA 4D3HA 2GVZA 2XHWA 5K9FA 1QM9A 1HQUB 2HZCA 3IMQJ 5ETRA 1RT2B 1GEHA 1F5BA 3A8JA 1FHTA 1JLEB 4Z7CA 1Q16B 5GAGI 2OO4A 4NRTA 1BQXA 1NLKL 1Q53A 3HFKA 3BPDA 4BLGA 3MOJB 3CCTA 4DLEA 3RRKA 2YWFA 4Q44A 3N5FA 3EVWA 4IOAQ 3GFZA 2AEFA 5DM6Q 1H6KX 3GYNA 1PYSB 3I56S 4WKRA 3VVUA 2XNRA 1IKYA 2B8QA 1S59A 2VFVA 4PXCA 4MK8A 3K89A 2M88A 4Z2XA 2EKNA 2GAHC 3DOMB 5KFQA 3M2RA 3G87A 1Y11A 1PKUA 3DRPA 2R7VA 1B7YB 1IKWB 2E5LJ 4PWDA 1X5TA 3QSIA 1FRMA 5D0HA 3RG6A 1JLQB 4EU0A 1L3VA 3PW5A 1WKLA 4LR7A 3HSDA 3G8SA 4TKTA 1LXJA 2FJAB 4QYZJ 3H5UA 2F8HA 3CDUA 1WOSA 5JVHQ 4HR2A 3I9V9 2CXEA 5K5MA 1PC5A 4GO5X 2RRNA 4WFAQ 3OPKA 1TL5A 2CJBA 1PG5B 3BGOP 3MDFA 3ILIA 4M8LA 5DDRC 5J1NA 5CYMB 4MKBA 2AX1A 5E2QA 3KYLA 4DL3A 1YJRA 1XBWA 2LEBA 1ZZFA 2B9WA 2K7KA 1C0UA 3K8VA 1VRQC 3WDOA 4FP9A 2CQPA 5KT6A 3TZXA 2AJ2A 4ZP7A 4P7TA 2IC3B 2KRBA 1W2BR 2QLWA 3HHEA 4L74A 4IOBA 3I32A 2N3LA 3R2CJ 3M8RA 2GQQA 4GKKF 5KG7A 4MFBB 2BANA 4N8NA 4A8XA 1Q78A 4OZ2A 3K17A 4UQGA 4QZVB 5GMDA 3O1LA 4LSLB 3PKYA 1TKXB 3VAGA 2LMIA 4JV0A 1RHUB 4WPAA 2C42A 5AE3A 2BJ3A 1JMTA 3BEGB 2JFKA 2AEJA 3EVMA 2HLUA 1FTCA 4DR6F 1DHMA 1KKHA 1Q8KA 2YNFB 3QIPA 3OL8A 2HMIB 1B99A 3DHXA 2AJ4A 3KK1B 1V5VA 4QR0A 2AYGA 4F7VA 5F8LA 4OYPA 1YWXA 2AX0A 2CVIA 2J8SA 2VF3A 4IFYB 1VYAA 4NEYA 3DU5A 1HHTP 1R27B 4O3QA 2EPIA 1WNEA 1KTVA 5FIIA 4DMZA 4CNZA 2FJBB 5CCMA 4F4ZA 3VGUA 3V5RA 5IM0A 2KHCA 3DRRB 3FGVA 3MEDA 1NK7A 1HWKA 3QSYB 2VJUA 1KLMB 5KOXA 2B7BB 1HNVB 5A8WA 1OSCA 5FJ4A 3UDEA 3Q2SC 4B9LA 5F8MA 4DQIA 3THTA 2B8PA 1FFGB 3UD5A 1WTBA 4ECYA 4NWBA 2OMOA 1FJEB 2IRUA 1YJWS 3MOZA 2XS7A 1IKXA 4WU3A 3A8KA 4C8YA 4DR3J 4HDGA 3HXMA 1DBDA 3WIUA 1EETB 5U47A 3KMQA 3C15A 3CCVS 2VZ9A 3PEJA 4ED3A 3ZNUA 2XMTA 4LBIA 4OZLA 3SFGA 2F7VA 1RAHB 1T3OA 1WOOA 2VUGA 3BDEA 2PIIA 4X66F 2KVQE 3KHRA 1WI6A 4HKQA 1UKUA 3VAFA 4O4RA 5A8KB 4FYVB 4P2FA 3QRRA 5CAAA 4AUKA 2DTJA 4JV1A 1IJFB 3T9ZA 3W5XA 3C14B 2BM1A 1FWKA 3V6HA 2H5JB 3UVJB 4OFZA 2DHAA 2W4CA 2ALZA 4O3PA 1S0NA 4OJGA 3JQMA 1O6XA 2KH9A 4DR1F 2XSFA 1IKVA 1XEZA 2OSQA 1NSKL 2BQ3A 2ZE2A 1FESA 1C2PA 1HBMA 1V3ZA 3HFZB 4MH8A 3M2UA 4N47A 5KT7A 2LU2A 4BC9A 1U1NA 2YX7A 2CPDA 5DGBA 3SCLE 1SBRA 4QW8A 3FMWA 1JQGA 4KO0B 1CJVA 5KFPA 2KJVA 2V8DA 1RP5A 4K5SA 2HHHJ 4BBYA 4C48A 3ZNJ1 2M2BA 2FUG9 3LA0A 5DDOC 4ED2A 4DV0F 2CJYB 3QLHA 1T0TV 2QV6A 1AW0A 2GS8A 3H2UB 3M8YA 1N5YA 3K58A 3M9OB 2IMOA 4WWSA 4DV7J 3UO0A 1N36J 1U2CA 1H74A 4M5LA 3HHDA 5MLCV 1BUXA 4HI1A 1S0OA 1REVA 3ILJA 3V6JA 2HLTA 3D2WA 2DISA 2CJKA 1WC0A 3NWGA 4KBIA 5ETOA 1E6YB 4KGVB 1NRKA 4I2QA 2C2DA 4KHMA 1IWAA 3KLEB 4CLTA 4M5HA 4X4RA 1HMVA 1MU2B 2J0SD 4OYAA 1SI9A 4X62F 1JLFA 5F8HA 4DU7A 4DFJA 1S79A 2EVZA 1NKBA 5E3RA 4CIOA 3WIVA 4FNIA 2DR7A 4IG3A 4ZPAA 4C8MA 5CH7B 5H9FK 3Q8RB 4I64A 5HI7A 1X0PA 5D8HB 2W9AA 1NK8A 3GV7B 1S4EA 1R6VA 4ZITA 4JV5J 1QUPA 2ZNYA 4DL2A 2UU9J 3PRVA 4ECWA 2Z2ZA 3GJQB 3M30A 3NP5A 3OFGA 3LUYA 4H4KC 3OTDA 1U26A 3NY0A 1FKAF 3AXMA 3LGHA 2NLWA 2P6TA 2R8IA 2GFFA 3KJNB 4I2PA 2H48B 3QWUA 1NMEB 4URQU 1HHQA 3SBMA 1FDAA 3T5KA 5D4LA 3LQVA 5E3AA 5IS2A 3NOGA 3KK3B 4DEZA 1WSRA 1G7CB 2IM0A 4DL6A 3L09A 4DX6A 1RCXB 3M8ZA 1EP4A 2LDYA 3V81B 2DD8S 4Y65A 3LP2A 1HQ2A 4Q43A 5B0AA 2HHUA 1GMVA 4IH6A 2VV5A 2UV8G 4P2XA 1VQOS 3M6XA 3A13A 2GO9A 4OZ1A 2YKAA 3DLJA 2CQ3A 4DV6F 1Y3JA 3DDKA 3D6HB 3O6QA 3KLGA 4XAKA 3RBEA 2LYVA 2DT9A 2F65A 3EUNA 5ETLA 4CO3A 1RTJB 5HP1B 2LQBA 1WHYA 1OS5A 1BQMA 2E9RX 3VHQA 4GVLA 4LQ9A 4PWWA 1Z2LA 3V4IB 2R7TA 4E8UA 3DXSX 3PFOA 1WELA 4CO2A 1SH0A 5C42B 2R9LA 3EDQB 1FK9B 4B3TF 1JJCB 1NHKL 3VVTA 1V5IB 5T7LA 2JNJA 3PR5B 3HMJG 3N28A 1NCLA 2HW3A 3KLFA 4P6QA 4BHQA 4FF4A 3S1TA 2VQFJ 3P49B 3ZZTA 3B4DA 2OUGA 1CJTB 2CADA 1V3SA 3GSDA 4IFVB 1SC3B 2IRXA 4XPEA 5DQHA 3W2VA 4WKYA 2EC2A 3MTJA 1RAOA 5KFUA 2PFDA 4ZLLA 2KM8B 2CG4A 2B4VA 3BREA 4RW7A 4ICLB 4FS1A 4NLPA 5M2RA 1JLAB 3BGRB 3BR8A 3MM9B 2MKYA 4Q0BA 1YJVA 4ANCA 1AXQA 1SJFA 4ES1A 4DG1B 2YKOA 1TZ0A 2QN6B 3TJ8A 1I51B 2K8GA 3FMBA 2W1BA 4FVCA 3LW5C 4OYIA 2XM3A 2K1RB 5EHHA 2IMWP 2HS0A 2GVDA 1NK9A 5C25B 3PFEA 3IP0A 1NJXA 2EFGA 5HK4A 4K5RA 1NPPA 3MM5B 1CULA 3ZTRA 5EGYA 3SMZA 1EIYB 3FRZA 1KQFB 7FDRA 2XO7A 1Q81T 2CWXA 3AXKA 1U45A 2ROPA 4OZJA 1LWEB 1NXIA 5LMUJ 3DGVA 3ZZOA 2HRYA 4XDCA 3TZYA 2UV8A 5AE2A 4KFBB 2HAFA 2U1AA 4G1QA 3O5TB 4ED4A 3B82A 1VHFA 2Z2MA 5HLFA 2H5IB 5HSPA 2B4PA 2PDAA 5C7PA 1F0XA 9ATCB 4O44A 2VONA 2RQMA 1RI7A 4TLQA 4DUTA 4EYHB 4WIIA 1S1WA 3ADAC 3GG0A 1L3UA 4G1PA 5LJ3Y 5CD4A 1AB8A 1NK5A 4WBFA 3DRSA 3T6JA 3HSJA 4RO0A 3L3CA 3MXHP 3GR1A 4I7FA 4L3NA 3NS6A 3CCUS 4RBTA 3IAS9 1XNQJ 4KPYA 2H51B 3G82A 5A8RB 1URNA 5M2PA 3OHAA 1BLUA 1MROA 1SCJB 5ETVA 5E3QA 3Q24A 2CRLA 3TVYA 3DOKA 2BJ8A 1IUJA 4IO1A 3R5AA 3D3CJ 4QQBA 3OFHA 4X4NA 5E5NA 3OUYB 3L7OA 4DV4F 4QU6A 4K4TA 3ET6A 4Z7YA 1CEZA 1X4AA 4JYAJ 2XC9A 4L6V3 3K5NA 2J9CA 3Q22A 5FDLB 1N5TA 2DNRA 3JSBA 4B3SJ 4R5PB 1VIOA 1N34J 2MYFA 2F4VJ 5AJ3J 2HS4A 3QNWB 1T9UA 2DNZA 1GAOA 3ELHA 1NHUA 2JZ5A 1M5KC 2RKIB 2YKPA 4RX6A 5L9NA 5KFIA 4MT1A 4ZPTR 4U67Q 2HHXA 4O3SA 4HACA 4WZMA 1AFJA 1TV6A 4UUWA 4PG5A 3DGPA 2VB6A 3IBFB 3A8EA 4N41A 4ID8A 1FJGJ 2F5GA 2GMLA 1U0SA 4R8UA 3G6XA 2B56A 2MZTA 2ROGA 3KJVA 1X0FA 2HNYA 2EK6A 4DCPB 1Q8IA 2JFDA 1QAIA 1XMBA 2DNGA 2X1AA 1PYOB 1YVFA 4OI0A 3ICLA 5FLXU 2ZC4A 4OV1A 2MMYA 3MEEB 2W25A 4FF3A 1A9NB 1OY9A 1JLBB 4ZLJA 2A6OA 3X3UA 3L9ZA 1R8AA 2APOA 1HYSA 5LT5A 2MJNA 4B3OB 2A18A 1LNQA 1AUDA 4ZPBA 2N4CA 3D7SB 2IBKA 1N48A 1O51A 3IG1B 1REGX 2O67A 3DOLB 1S10A 3NGKA 3AJ1A 4DF8A 1S1UA 2NZ4A 5F3ZA 2G0JA 5HQLA 4J9VA 3MMBA 4DPUA 3OD2A 4N7TA 4UOFA 4F25A 1U8WA 2C28A 3J81U 1VBKA 1B64A 1X4EA 4QYRA 2I0XA 4DN9A 4JI4J 2G1DA 4UOHA 1N52B 2YNHA 1FF2A 1NDKA 4GC6A 4LRDA 1TL4A 4YDDB 4OZNA 2CWKA 1RTZA 3BSNA 5IT0A 4NLVA 3BM7A 3DNCA 3I87A 4F2RA 1KBRA 1OQ6A 1OIAA 3H8YA 6AT1B 3UCUP 2C2OB 3PYGA 2C3MA 4M95A 3AFGA 1NO8A 1YX2A 4ZJQA 1CC8A 1GMWD 5ETKA 2XMJA 3OR1B 3L4BC 5L38A 2BE9B 2P9GA 3CCWA 2JLFA 3VAMA 1Q7YT 3AD8C 1TFYA 4KV8B 1OQ3A 2A1BA 3M8QA 4C97A 1KRPA 4P9SA 1EQMA 4XTTA 1YTYA 2Y1RI 3EM1A 1NKCA 3KK2B 2YNIB 5K20B 1R0CB 2CDRB 2ZBRA 3OL6A 3R2DJ 1VC6A 4ZIWA 2CJAA 2GJIA 2DYAA 1HNZJ 4ZIVA 4JB8B 1ZAXA 1Y5IB 3BKTA 4U9RA 1WWHA 1EAYC 1YBTA 3FCWA 2QA4S 4LFAJ 3CJ8A 1HPZB 2BABA 4OLOA 3K57A 2ZWPA 4EO6A 1HW9A 5EWGA 3FRYA 3K0JA 2E44A 3OTCA 4LVNP 2GHWA 1X5SA 2GZOA 3BQ2A 3Q8YA 4XK8C 4NZ0A 4NCGA 4QR2A 4G1IA 5I4MA 2AEMA 3NEKA 2QSFA 1EQ0A 4CLUA 1U2FA 1FCAA 3CJQA 3D28A 3CMES 3MPDA 9RUBA 4OHWA 1IKYB 4HT7A 2RT3A 1UFLA 3PACA 2VFTA 1RWVB 2PC6A 3M2RB 4X4QA 4DR4F 3QFHA 1UETA 1X4BA 4RL1A 4ELTA 4PWDB 4WK3A 2QLBB 3SDEA 1TTHB 1FRIA 1CLFA 1IBLF 4X64J 2R2RA 1AA1B 1C1BA 2OPQA 1OYEA 2VBWA 1TL1A 3S6EA 3ZZZA 3WC0A 1IWGA 2XO6A 2RNEA 2DNNA 5KFVA 1SUQA 3MMAA 3KG1A 2GHPA 3OL7A 3FSYA 1WF2A 2QA4G 1RE1B 1BXNA 1SKRA 1I94J 4J9KA 3D1OA 2ZH5A 1OY8A 4DR7F 5KT3A 2RU9A 1DLOA 1C0UB 4P7VA 1WEXA 1FA0A 2RD5C 3RZAA 1F3FA 2KYXA 4FVMA 1M5VC 1EHWA 2AJFE 2NXCA 1C4AA 2L9DA 2RHQB 4KYZA 4HVZA 3OXGA 3CTRA 3H98A 4DL4A 5D0RA 2BANB 3I0SA 1RYSA 1ICEB 2WB1D 1HNWJ 1HHSA 3T3FA 5CCLA 2BJ9A 3MEGB 1HIYA 1AUSL 5KG6A 2BM0A 5G4DA 2KT2A 3VV2B 2ZBIA 3QGIA 2ZKUA 1T05A 3K5OA 2NUHA 1LWFA 3HJVA 2DNLA 3MUVP 2K2PA 4PAAA 2BUNA 3CC2S 4EI2A 3QIPB 1Q7LB 2MQQA 2D3UA 1FRXA 3QPIA 3N01A 4K0KJ 4RR5A 3N0VA 5I3QA 1FE0A 4DX5A 1P6TA 3IR5B 4RW9A 3JTOA 1RGVA 4ID5A 4I4BA 4W92B 2LXIA 1TKTA 2FJDB 4OX9F 4DV2F 1TAUA 4NLXA 5IM0B 3PX6A 5IFMA 3BPSP 4I6YA 5F3TA 3MEDB 4RWXA 1SKSA 3HF5A 1U09A 4H4KA 5F9LA 3T1AA 4IRCA 2R3VA 1JJ4A 3US5A 4USJC 3LAKA 1HD1A 5JVGQ 2MZSA 1N0UA 1CQMA 3I9ZA 4B17A 3KNAA 3VF0B 1SKUB 3KJFB 4HHUA 3T41A 3FZBA 2PEHA 3D6TB 1RLDA 4R0EA 3IN5A 1AFIA 5L9XA 5C5JA 4F3OA 1F5CA 2EI5A 4OX6A 3O2IA 1VQPS 5HROA 4HH1A 1SL1A 1R0BG 2WTFA 4PYAA 3FDSA 3VGTA 2V67A 4C8LA 2ASJA 1RAFB 3R7BB 1D09B 1PO6A 4L3KA 1D9FA 5CZVA 2HQCA 4DSEA 3BH7B 3W9JA 4TY8A 3DOMA 3HHLB 2UXDF 4JI8F 1ITPA 3OR2A 3BGLA 1VQ6S 1X9WA 2E1CA 2WK4A 4CQ1A 2FZGB 1JLQA 2HFZA 2BA9A 4ZLNA 5CA5A 2IJRA 5GMKa 1WUUA 3EWGA 4IG0A 4M5GA 3DN9A 1NU4A 3N6NA 2P5VA 1NNDA 2X51A 3KHLA 2JRSA 2FHKA 5LM7E 4V1Ak 4CT8A 4B3MJ 2KG0A 3ETOA 2AZ3A 1OJ4A 3AH6A 4U6PA 2F8MA 1O5JA 2GMHA 4RNFA 3JAMY 4KSEB 3HO1A 4USWA 5GAHU 4Y2KA 2ZE2B 1F1BB 4HDHA 2BXJA 1HBMB 5AT1B 3D1HA 1UAWA 2GA7A 2V2QA 3J7Z5 4RUAA 2KTQA 1PAUB 2DRDA 4F50A 1VFJA 2YKMB 2BQUA 3P3DA 1XR7A 4B02A 5HMYA 3J7AN 4CO4A 4F2SA 3CDBA 5E41A 3V2UC 3OLAA 1S1TA 2KJWA 3QLHB 4NXMJ 3I4HX 2E5GA 1TKXA 3IWLA 4O4GB 4KH1B 1J2VA 4FYYB 1HBOA 2BVZA 1RWWB 2BOPA 2RQ4A 4KGXB 4I2QB 2VIHA 1GH8A 4HI2A 1HMVB 4CDIA 4WIQA 1J27A 2FJVA 1JLFB 4YR0A 1ZOTA 2HWIA 4O23A 1Q0NA 1XQIA 2UXCJ 3NGDA 2ZC3A 1GTEA 2R42A 3CJSA 1UFWA 1YK9A 3IRXA 1R8PA 2EC0A 2ZM6J 1CVJA 2YH1A 1WHXA 4DPTA 2GQCA 5KFCA 3E3XA 2VPWB 3MMJA 2AYBA 5H9FJ 3MPWA 1HLWA 2M3DA 5F8GA 1IN0A 4Q2MA 4DUZJ 1KLMA 2W01A 4L72B 4JI1J 3X1LB 4ANDA 1PILA 5JXSA 1ZA2B 3C46A 3IS9A 4DSKA 2KFZA 2B43A 1ZZNA 3OTOJ 3DM2A 4I2PB 5D3GB 3EGNA 1Q82T 3B54A 3MFHA 4LSZB 4DS4A 3EE3A 5LMNJ 4CO0A 1G4CA 1LEOA 2B5JB 2HRUA 4JI2J 4QOTA 4F8RA 1KN6A 1EP4B 2VFUA 2HG4A 3DLGA 2HHQA 4EZ9A 2QYGA 4ZVRB 2W4PA 2WOMA 2IRYA 2CJXB 2KN4A 1IBKJ 4YHHF 3LO3A 4EEYA 4NYPA 2VG7B 2PMWA 2UVWA 1SJQA 2ZOGA 4EK2A 3U02A 2QMUB 5A8KA 1H0HB 1DQ8A 1PC4A 2YNGA 1DZ5A 2SXLA 3M6UA 1A7GE 3FNNA 5D77A 3C14A 1Q1KA 1R43A 4LF6J 2QZ8A 2BV3A 2YTCA 3BBFA 4PXDA 4QCLA 5SZTA 1NH7A 3PW7A 1RK8A 1E6VA 4Z37A 3JYTA 5A6WA 1FD8A 4W90B 5LXRA 3BGFA 2RS2A 4NXNF 3MM8B 2NSBA 2ZFHA 4ZVHA 4AFFA 5DQGA 3AT1B 2JHEA 1T7PA 1LQ9A 4BCAA 4DQPA 5T7LB 4HYKA 4F3QA 4TN2A 5ETPA 3LOUA 4O0NA 2JSXA 4C8ZA 1TKDA 3M8PA 5DG8A 4DXLA 3KLFB 3H5XA 2XSJA 2F63A 5H9EK 1XR5A 3RAXA 5KFOA 4KO0A 5L46A 5DDPC 2HBZB 2WZ1A 3VGSA 1M0SA 4IRKA 1XC9A 3H5YA 2M70A 4CZCA 3W63A 3W2VB 2V2KA 4OX8A 3KHHA 2BE7D 3NWRA 3J80U 2GGPB 3M2VA 2YBVA 5KFXA 2DXFA 4CLKA 5L1LA 4FPRA 2XWYA 1XERA 2DHSA 3GCWP 1RKIA 4AE5A 4G65A 3DHWC 1E6YA 3SV3A 4PG8A 5K8PA 1JLCA 4MYUA 3TI0A 4YS2A 2R2UA 2LKZA 2E66A 4K4XA 2CQ2A 3EGVA 1BQNB 2J6SA 5D6GA 4HTJA 4H4MA 1RDRA 2EBGA 2GVDB 2UUBF 4DFMA 1DURA 2IYIA 1CULB 2O66A 3GJTB 1JNRB 4RLEA 3RRGA 2HNZA 3TAPA 2V50A 3BGUA 1B3TA 3AA8A 5BR8J 3PV8A 5KTQA 1NH8A 2XI3A 1QSLA 2M8HA 4QPTA 1I6JA 4J9NA 2H9ZA 1WG1A 2MKJA 5M2UA 3TZWA 2HK3A 3QT8A 1X9MA 2QX0A 4G1QB 2Z57B 3KLIB 2I9SA 3G6VA 4LFCF 4J9OA 5HLFB 3HP6A 3GTYX 4LF9F 1M1KT 1N5SA 1S77D 3W64A 2HS3A 2GO8A 3TYTA 3BSAA 1FRLA 1N4LA 1NAQA 4JI5J 2D9PA 3GILA 2XMKA 3JSMB 3PRDA 2CNKB 1NBEB 2V69A 1N32J 3KTQA 1HI0P 4FF2A 1S1WB 3IA0A 1FDDA 4LF5F 2VICA 3KK3A 2BW7A 3CDWA 4TY9A 1ROFA 3V81A 3SCIE 4U7UK 4CM0A 4DSJA 1HA1A 5IT9U 4X65J 1H7WA 2D69A 4NE9C 4IRDA 2FVSA 5EN1A 1KS2A 3G82B 3HI9A 3IM8A 1VC0A 3ZXWA 2AV5A 2K3KA 3UN5A 3HHLC 4DQQA 1MROB 3CCSS 2XEXA 2C2RA 3LP0B 5LJ5Y 4AQYJ 3DOKB 1XMQJ 1GQEA 4K4WA 1K1QA 2QLXA 3F56A 2AF6A 3TQ1A 3ET6B 2DO0A 1TU0B 2MTLA 4OHXA 2CJ9A 3E8OA 4MK9A 4F4XA 3I5BA 1U7LA 3LANA 2HZAA 4DUYJ 1W26A 1RUSA 1P9YA 3MF5A 4ES2A 1ZPWX 3V4IA 5DRKA 3OFEA 3P5BP 3HZGA 1RWXB 4WP9A 2G0CA 1LW2B 1RHRB 1T9YA 1RT5B 1FK9A 3HD1A 2PMZD 3GONA 1RACB 4NLUA 5DDQC 3T1HJ 3NNAA 3IXQA 1HR0F 3DLLQ 2CFXA 3W62A 2ZZTA 1TMMA 1XNRF 4OMFG 4W4MA 3OSNA 3PX0A 3DGPB 5KT5A 2JJ4D 4RBUA 3KWMA 2V34A 1A0OB 4R8UB 3CC4S 3U1MA 5IXUA 1VIXA 1TP7A 3KJVB 4ETZA 2LXFA 4ELUA 4KT0C 1JJHA 3HPOA 4QIWD 2IJNA 1Y4ZB 2AW0A 1J5EJ 3KUGA 4RUCA 2DGVA 1Q95G 4DJBA 1VQ8S 2Z8QA 4K4SA 1F2GA 1XTZA 1NK4A 1HYSB 3MM9A 5BYQA 1FKOA 3T19A 3CE8A 3H0PA 2ZDPA 2LFVA 2EFNA 3P5TL 2CKWA 1OSDA 1HR0J 1TELA 2FJWA 1IBMF 1NJWA 2B4OA 2YKQA 2J0QD 4NLQA 1URRA 5C25A 1H98A 2NR0A 4NEZA 1UTAA 2QJ3A 3MM5A 2Q3PA 2W2QP 4P2SA 1T9WA 2MDAA 4NLWA 1KEKA 2GIFA 4FXDA 1BE4A 3IM9A 3UFCX 2BKOA 3D0GE 4J9QA 1QVFR 1U25A 4WTOB 1SKWA 3EZUA 4KFBA 1NDLA 3TQEA 4ZVGA 4ER8A 2A0FB 2AP6A 3JTPA 4HHHA 4Q8FA 5CD4H 2H4WB 5C24B 2GMJA 2YWWA 1EARA 3N4WA 1D1UA 2OP5A 1YJ9S 2XMMA 4GKJF 2A3JA 1SQEA 2C3YA 1WF0A 4JBCA 5B7WA 3UE2A 3LWLA 1YSJA 3UWTA 3R7NB 3ETMA 1C1CB 2IM2A 3OQ2A 2N7YA 2K06A 1OY6A 3M8QB 2CPYA 3R5CA 5J2MB 4P71A 3RRHA 4RUHA 1G3OA 2XMVA 4JI0J 4LF7F 2WONA 5D4PA 1VBXA 3RW7A 5KG5A 3TAMA 1QY7A 5T14A 4OJHA 2DVIA 3W9HA 2R7UA 3PYDA 3A3NB 5G0RA 1H2TZ 4TNOA 2ZHBA 1ZPVA 1NZAA 4A8YA 1U1QA 1RLCL 2KXHA 3OUYA 1WACA 2MLZA 4USHA 1SPBP 4ZPVR 1NEEA 2FDNA 4ED7A 1U1OA 1FERA 4LSNA 3GJSB 4DV5J 3FFIA 5KT4A 3NCPA 1TMJA 4ATNA 3LWMA 4YFUA 1VCTA 2LU1A 3P4UB 3HSGA 1XWLA 4Q45A 5L1JA 5AXMA 4U95A 4AXIA 3NRBA 2B6AA 2HFOA 4LBPA 2HIYA 1GTHA 3S7RA 3OFFA 2BJ7A 8RUCA 1EKSA 1TR0A 5GAEI 4RW6B 1YKWA 4C98A 4ZVPB 5DS7A 1C1BB 2OPQB 1UVMA 2NYHA 5HVFA 1TL1B 1GMWA 1M1GA 2HFSA 1QSSA 1OMSA 1SUQB 3MMAB 2IVMA 1HI1A 2HFUA 1R6YA 1FX2A 1SJ3P 3KMSA 4B3OA 1XIQA 3K59A 3C6UA 4J9MA 2CZ4A 3RAMA 2ZHOA 2UUCF 2OFHX 2QL5B 3DOLA 1SB6A 1N56A 2WB4A 4NX9A 4ECXA 1X7VA 1IR1A 3T1YJ 4JUZA 5J1PA 1RYRA 3TZZA 2X1BA 3VALA 4MJKA 2W9BB 4ZJLA 2G9OA 5JUMA 4LF8F 2PO4A 4FKXA 4FYWB 4OQJA 3TA2A 4CI0B 2Z30B 2CZVC 4DR5F 1ZETA 3UCGA 4ZP6A 4A47A 3GYGA 1RZMA 2PE8A 2R7XA 1FXLA 4C3KA 1HW8A 3PW2A 4M5DB 2KG1A 2CA9A 1T05B 2DR6A 3VGVA 1QJHA 1LWFB 2CPHA 3CC7S 4OHYA 1SQFA 1NDCA 2ZBCA 3CJ4A 4PR6A 3D3BJ 3RU0A 3NLCA 4JV2A 1RTDA 3M6WA 3D1QA 2L9NA 4MYTA 1FJ7A 1MWYA 3KJQB 1NHVA 3R97A 2CPEA 3CJTA 1FFWB 1R3NA 3BDPA 6FDRA 1X9SA 1S72S 5KFDA 2AJQA 5B08A 4ID5B 4C8KA 1TKTB 2LVWA 2CJQA 2WVCA 2AWZA 5KAKA 2D7SA 1NJYA 3KK2A 2YNIA 2RHSB 1VRTB 2E5LF 4LFBJ 1JXEA 4ZP9A 1ZBTA 4KC5A 2FD2A 3W2WB 1IQZA 3WQPA 2VL1A 1KHWA 2HIQA 1M5SA 2HVZA 3ZFVA 4C3LA 2MKKA 5GAGU 1HPZA 5KFBA 3UI3A 1Q79A 3TVZA 3B4MA 2ZD1A 5J1EA 2BOAA 2Y0SD 1AROP 2AQ4A 4BWJA 2UXBJ 3FEYB 5KOWA 2W8KA 4DR2J 2H5EA 1Q4RA 2M7SA 1HWIA 1MW7A 5ETQA 5HROB 2DNHA 4USUA 4RZRA 3Q89A 2AHOB 2MSSA 4U7UD 2XLIA 4C2MA 3D68A 2FPHX 1HI8A 1S9EB 4PQUA 1EJ7L 2VQEJ 3IAM9 2G13A 4TY8B 3R1LA 4CLWA 1HL6A 1AZSB 2XZWA 3OR2B 3Q86A 4OYXA 4LRAA 4JI3J 2J7KA 2R2TA 4TLRA 2WBRA 4ZN3A 5MAOA 2PMHA 2MGZA 4LBHA 2H65B 3MM7A 4RNHA 3RW6A 3QFWA 2E7VA 3PR4A 2ZZNA 2O5DA 3H2VE 2Q79A 5CQGA 3UPFA 2QC3A 3W60A 3Q83A 3WBZA 3OXLA 1ZM9A 2HRTA 4IG0B 2R4FA 1UPMB 5D0EA 4J9LA 4P72A 2DB1A 4YQWA 3BSOA 1O0PA 3PEHA 2V4RA 2HQGA 4F0MA 5B0CA 1FI4A 2WAQD 2FVRA 1RWUA 2QA2A 2IJFA 1T9VA 5HBMA 2BZ2A 2V68A 2WSEC 3GCXP 3GWCA 4O3OA 1N6QA 2P9CA 2KI2A 3BKUA 3ZZPA 2KB2A 2AMCB 5AXLA 2ZUAA 3LF0A 3PW4A 3OSPA 1YLXA 5HL7Q 5B0BA 4YEAA 5KFZA 1PAEX 3JAMU 2WVBA 4C4WA 4LREA 1JK9B 4DI6A 3IGVA 3LPYA 4GVBB 1S1TB 1YZ7A 2DO4A 4ZLPA 3IO1A 1FEEA 3MEGA 2ASLA 3AOBA 2RQKA 3DLBA 2OPSB 1UVLA 3R5GA 3JQKA 2GW8A 2E7XA 4DQRA 1FD2A 2RB7A 1U49A 2B3TB 2RF2B 4V19J 4ZOSA 2D3ZA 1HBOB 4YP3A 1FVSA 2WW8A 1RAJA 3BJYA 4KHPJ 4J7CA 4USIA 2EBEA 1WORA 1X31C 3F41A 3ISND 4N5SA 3ZO7A 4F4WA 2UUAJ 3J7ZT 2IHR1 5IQ6A 4ENOA 4DR3F 4IDKB 3CD6S 2EFPA 2BYCA 1RTIB 3JSRA 4CRJA 2JX2A 3G9CA 4KY3A 4M5KA 4Y2IA 1H2UX 2I5JA 3IRXB 5AXNA 1S1XA 2OTJS 2OD4A 1LOUA 5LOQA 2IAJA 4ZDNA 1WD6A 2V4JB 3FJ2A 1D3WA 3EZOA 3JS9A 4K4ZA 3SI8A 2VKRA 5EUHA 3CD5A 1FNOA 4DLGA 3HLUA 3ZZUA 1ZYQA 5HN0A 2QE5A 2QIFA 1S12A 5IZHA 1KFDA 2XI2A 3IS9B 3RBXA 3HK2A 2HVDA 1G2EA 4RNOA 4DFKA 2V94A 3NS7B 2F4FA 2RMLA 4YMEA 2DEJA 3DM2B 3POTB 1U6ZA 5ETMA 5KFTA 2PI4A 3QJLA 2L3MA 2D9OA 4LF2A 2OEKA 4FN5A 4B9SA 2ATCB 2D3OR 1X5PA 2FJXA 4KTQA 3DLGB 4OYOA 1SL2A 2AYMA 2NCKL 3SSSA 4EWTA 3RB0A 2W24A 2WOMB 3TWZA 1L5UA 3HHLA 1KD1T 3FQLA 1BGXT 2C2EA 2M5YA 4CWBA 3W8PA 3AODA 2IYGA 4UUXA 3W5ZA 2HHHF 2OGUA 4M5IA 4A8KA 3MECB 1KHVA 2HBYB 1U1MA 1RBLA 1WC3A 2YNGB 1FTRA 5I3PA 3M9NB 4DV7F 3HVTB 2JL9A 1N36F 4MAKA 4I56A 2XZTB 2VHGA 1E6VB 3GSIA 2XYGB 3JYTB 5DGAA 3AB2B 3FQKA 2LDIA 1IJEB 2O1PA 5KFKA 2ZH8A 4DSLA 3I96A 4DCJB 3DI6B 3CCQS 4KB7A 4YY3J 2E1PA 1NB7A 2JH3A 2YKMA 3M8PB 1KWMA 4NA2A 4FBTA 2XSJB 2QL9B 3NGTA 4DZ6A 3M6VA 4S0MA 2JLGA 4I6AA 3J7YI 1N33J 1QDUB 5H9EJ 4M5JA 1KVKA 1DQAA 2DGXA 2M4MA 4JV5F 1UEUA 3GFXA 2UU9F 5E3PA 3M2VB 3BN4A 2PI5A 1FWLA 2XTJP 4N76A 1LFWA 4DPXA 4O4GA 1ZM3A 4NLDA 2P9EA 1P8GA 4C0HA 4RWWA 4YR2A 1NM2A 1JLCB 4RKUC 1UVKA 2V4QA 2MZJA 2G0IA 2B0GA 1FRHA 1RT6A 1UWBA 2DNOA 2KDOA 2EK1A 4Q2LA 2YY3A 1XK8A 4U7CA 2XLJA 3VAKA 2RRBA 3FBEA 2D41A 2EFOA 1LW0B 2HQFA 4H4MB 3N5BA 1FNMA 1VR6A 1WDDA 2PFFB 2FGCA 4G6VB 3H20A 3SXLA 2I1RA 4MKYA 3CCZA 2HNZB 4ZVSB 3I55S 3H40A 1VGYA 3OVBA 2E1AA 3P8BB 4LMZA 4JI6J 4ZP8A 2N82B 2FLNA 2J0XA 2W4DA 3DU6A 4JI7J 2OPRA 2Q1LA 3MCMA 2L9WA 5KG2A 3KUEA 1RHMB 2KKHA 2L08A 3A12A 5KG4A 3AHPA 3UDVA 3QT5A 1VI7A 2IPOB 1F3VA 2MQPA 4DV1J 5D3GA 1NDPA 1V6HA 3FZ2A 5IV4A 3JXOA 4QWDA 4Y34A 2B5JA 3CJKA 1ZM4A 3PYEA 3EGWB 4TXSA 1U2RA 1TVRA 4QIEA 4GC7A 2NXNA 2ZDOA 2CPJA 3EPIA 2MJUA 3HZEA 3BKFA 2IVFB 3OJSA 1RT4B 3DMJB 2ZWOA 1RA6A 5B0EA 1X4GA 3SIPB 2WSFC 3I5CA 1WHWA 2KYZA 1YG0A 3B8HA 2VG7A 2C3PA 3OL9A 2VQFF 4WTYA 5LXYA 2J6UA 2HVHA 2IDEA 2AGPA 4D3GA 4B9UA 2CYYA 4RU2A 4GRSA 2XYHB 4QW9A 1SQGA 2ZUGA 3QZ7A 2PA3A 4PCQA 2FQQB 2Q43A 4NI2B 2F8EX 1UW9A 3FCVA 4XIUA 3BN7A 3FK4A 2RDIA 2RH3A 1C4CA 1DTQA 2ZH2A 2AJ0A 2VDIA 3CB4A 5GADU 2HPUA 1T9TA 2IVYA 4A8OA 2DKOB 4MIAA 1VLOA 5GADI 4B3RJ 4ZCKA 2CDQA 4NLYA 1R8HA 1O8BA 3G6YA 4ILLA 3TX8A 3MM8A 4KGZB 1YBUA 1QSYA 2XG8A 2BBEA 2YXLA 1JB0C 1RJJA 3MTKA 1Q5VA 3CJ2A 3TO8A 3D6MB 3QRPA 2VC1A 1CG2A 4PG7A 2ZOFA 1NZ8A 5IOLA 1D8ZA 3DDNA 1H2VZ 1WI8A 2LA4A 3MAAB 4ZCLA 5LMUF 2KT3A 1RHJB 4DQSA 3CNQP 2C22A 1JX4A 2GGPA 1ZTTA 2ZH3A 4LT6A 4ECTA 1U8SA 3RBZA 5K14A 2FHJA 1RABB 3H25A 2AD9A 3BR9A 2CPXA 1RQ0A 4UQTA 2ZBPA 2D74B 4QWBA 2V2VA 4EGLA 4F3MA 3BB5A 1FKOB 2YWEA 1M5HA 7FD1A 4UW2A 3MR3A 1YDLA 3VTIA 1B4SA 3UQSA 5D4NA 3MPYA 2DY1A 1WTFA 2IY5B 1BQNA 3W65A 2O3DA 3KG4A 3IRWP 1K47A 1S6PA 3TEHB 3ISZA 1VQ9S 3OLBA 4M63A 4UTGA 1VDHA 1S9GB 4YB7A 3CMAS 4HEA9 3SSQA 5THWA 3D5MA 4ES3A 1XNQF 3L95X 2CIMA 1BWEA 4WXOA 5I42B 2VD3A 4CTAA 2MZQA 2HGMA 4IQMA 1YJTA 3MCOA 5A2QY 3HVRA 3KLIA 5E7OB 1FXDA 3PJXA 2DNPA 2I38A 3H2LA 4ILMA 4K59A 1YRUA 4JYAF 2CNNB 5IC4B 4DS5A 3PZPA 3TUIC 2BE2A 3I5AA 4OL8A 2C2ZB 4X4OA 2W9CA 3JSMA 4CYUA 2BRKA 2EFQA 4B3SF 4PUOB 1N34F 7AT1B 2F4VF 5AJ3F 1UP1A 3MZIA 2KFNA 2OTLS 5E3CA 2ZH6A 2WONB 3IWNC 3ENAA 2A2CA 2YWHA 4DHVA 1FJGF 3TAMB 2N3OA 2R8GA 2HNDB 3RAQA 1CC7A 2LCWA 1KQSR 3ZTSA 3E51A 3LP0A 3UR3C 5G0RB 3G2XA 2XCPA 4DV3J 1RBOB 3FCHA 4PYDA 3BQ1A 5A6PA 4CT9A 1H7XA 1JNZB 1KVJA 3FEZA 2FY8A 2DIUA 1TFWA 3ITHA 3VZIA 3KNGA 1QAYA 4KPCA 1NK6A 1XMOJ 3BV8A 4LSNB 4Y28C 5KT2A 3FFIB 1LW2A 3VQTA 2COLA 1RT5A 3AQOA 3O3LA 4DL7A 4ZN1A 5KFWA 5CYQB 5ITHA 2Q6CA 2B6AB 2FLLA 3A1YG 3RB4A 3M8SA 3GIMA 3MR2A 3SQGA 3SFUA 4A8WA 2K3IA 3A3OB 2Y1IA 4KKOA 1RWOB 3TANA 3FBBA 1Z1ZA 4JI4F 4CM2A 1S1VA 4N56A 2GCFA 5CABA 3PO4A 2R8HA 1V9OA 1U0HB 2ACYA 4OI3A 2XGPA 2JLEA 4HLBA 3C6UB 3IBWA 2HHVA 5KFGA 1D9DA 1HNXJ 2YH0A 3CW2C 3R7SB 2HBRB 3DC2A 2UVUA 3VQSA 3TA0A 4FPIA 1U1LA 3GP9A 2KZMA 3HFVA 3T5JA 5IWAJ 4U96A 2BACA 4RJVA 1NPRA 3DCAA 2W2MP 1T9XA 2BKPA 4FXWA 2PD1A 1NJZA 1RADB 4FDFA 4YUDA 3D9BA 3QJJA 1IBCB 3M8WA 1EB0A 2OIHA 3QZ8A 2WCXA 2V63A 4LF4J 1T03B 3G6ES 1HNZF 4OYWA 2XMWA 3C6TA 3W8GA 4LRFA 2IFXA 3QBCA 4WYLA 4LFAF 4RNMA 4B9MA 3CT9A 1M5OC 5KFAA 2VG5B 4F67A 1PIEA 2CPIA 5C24A 1KLNA 3LGNA 1WHVA 4DSIA 1HFEL 4XDDA 3UD4P 1RAIB 1KSPA 1RTDB 3UDLA 2LA6A 1VQMS 2VPXB 5DQIA 1TUGB 1BC6A 2WVFA 2YQ3A 2J76E 3GMGA 4DPWA 1C1CA 2AIRB 4NRUA 1SH2A 2RUSA 4ZVUB 1RU2A 5J2MA 3C2PA 3RR8A 3HD2A 2ZVSA 2CQ4A 1HNIA 3PJWA 1Y00A 1VQ4S 4X84A 1FRJA 2V8VA 1U1RA 2EG1A 2Y1LB 2ADCA 4X64F 1RTHB 2YPYA 3I0RB 3CCMS 1TKZB 1AT1B 3BBBA 5F41A 2RDDA 2ASDA 3UDCA 4QPXA 1M5PC 1QVGR 4FZVA 5B09A 2OFGX 2ZD1B 1P27B 3MCSA 5J1EB 1I94F 3KLHA 3HT3A 1VRUB 3HCXA 1OO0B 3DLEA 4CP5A 2M8DB 4KIAA 4NA1A 2I8EA 2FTRA 2VPYB 2JEFA 3M32B 2XQCA 3MR6A 2XCAA 1PBAA 4PQUB 1Q8LA 2HZVA 2LECA 3Q8UA 3ENQA 3KKFA 2QA1A 2FY1A 2ZEJA 4BC7A 3NKYA 1RWPB 2FLPA 3FKBA 4RW6A 2FVCA 4TYAA 2ZBQA 1MG7A 2MGZB 1HNWF 4ZCMA 3MM7B 1U02A 4G3IA 2OKQA 4OJ1A 3AJDA 2DR8A 3M9MB 4H4OA 2DPJA 3RR7A 4DX8H 3ULHA 4GKKJ 2OH2A 1UJ4A 1YZ6A 3BYPA 3TX0A 3QGHA 1N5VA 3NG8A 1SJ1A 3Q8SB 4AT1B 1UPPA 1CPZA 3TEGA 4IH5A 1HBUB 2DIVA 4USTA 1Y3KA 4TU7A 1WEZA 5HBMB 1B70B 1MN7A 1N6QB 2ZNZA 1ZAWA 4UZBA 4K0KF 1T8EA 3ENVA 3RB3A 2HWHA 4IOCQ 2FC8A 2VG6B 3OBIA 1HD0A 3RB6A 5HQ8A 2DHGA 4DR6J 2W9BA 3I6PA 3MPUB 2I6WA 2FC9A 1TL7A 2JDJA 4RW4A 4NLOA 2N4DA 4C0BA 3QO9A 3A3PB 1Z4UA 4UZCA 4RNNA 5C2GA 2DGSA 1G1XA 2AT1B 3GE9A 3OHBA 2VOPA 2ASYA 4M5DA 2MB0B 1SH3A 3W61A 1IR0A 2IM1A 3IGNA 2XZDB 4J37A 4URGA 1FT8A 1WKJA 4USKA 4J9SA 3GFHA 4E98A 2Y9HA 2VDHA 1YITS 4PWUA 4ALZA 2FYXA 5FD1A 2DGWA 5J2NA 1WEYA 2QEXS 4ELVA 4X4UA 3MURP 2VFRA 4OZ3A 3UCZP 3AB4B 1RWMB 1X4DA 4TQRA 3QMQA 2KU7A 1K9MT 4OZ5A 2I5JB 1S1XB 4B9NA 3CDEA 2IAJB 2ATLA 1VRTA 2MHNA 3Q8QB 4PRFA 1VBYA 3W2WA 5KFMA 4EBDA 4MMOA 2ALYB 2DRBA 2P2CB 2KL8A 5T41A 1WC5A 4WF9Q 2H4YB 4I67A 3DLKA 5GVQA 3CWJA 4ZPCA 1NPKA 3UN2A 4X66J 3ENWA 2R7SA 1S97A 4B3MF 3CIMA 2W8LA 4KRWA 5AXKA 2MZRA 1SXLA 3C3LA 1ZH5A 4OIXA 2R7OA 1HWJA 1Y5LB 4MKVA 2GIRA 1S9EA 3M7VA 3GFYA 1JXVA 3PIPQ 4DSFA 3HT0A 3WX4A 5EWFA 2JEJA 2XYPB 3Q8PB 4DR1J 3MUTP 2QMWA 1AZSA 1UVJA 2HK2A 4ECSA 2UP1A 1JXLA 1S99A 5F8JA 1LXNA 5DG7A 2CQDA 2IA0A 2DJWA 4OYBA 4NXMF 2QTWA 1YJUA 3W66A 1RHKB 1U4BA 1FXRA 5EX3A 4A8FA 4NCBA 1F2HA 5A76A 3W9IA 3RBDA 3EICA 4CLSA 5JMNA 1SV5A 1VJQA 4DV0J 3TOQA 3PCOB 2JC1A 2BQRA 2J8AA 3WC2A 3SYZA 5RUBA 2V5HG 2HVIA 2YWKA 1DTTB 1RT7A 3R9LA 1X4FA 2M9KA 4ZHRB 2QMXA 3FSXA 1UZHA 4OYZA 2UXCF 3C16B 1QD1A 3KXDA 1UVNA 4F02A 1HKAA 1F9FA 4LUBA 3M05A 4K50A 1UJ5A 3SV4A 1WG5A 2ZM6F 1KOOA 1ULRA 4GVBA 2HFNA 3HSZA 4J9PA 4X62J 2E1MC 1QAXA 3C66A 3GJRB 4NLTA 1R0AB 1KVIA 3PYFA 1RISA 3NBPB 3W7BA 4YN3B 2RIJA 3NCRA 1S4FA 4DUZF 1YI2S 3I82A 4JI1F 1EX8A 4FNHA 2OPSA 2WVDA 5KFSA 2KHDA 4HTIA 1CJKA 4NYOA 1RT1B 1KONA 5KG0A 1HWUA 1P1LA 4Y0FA 3PKMA 5K8NA 2RF2A 2HHSA 2DXEA 2OLWA 2V8PA 1UA0A 1YJ7A 2OJ3A 3OTOF 2V8GA 1RAAB 1QE1B 4EBCA 2QL7B 1RT6B 3QAEA 3QIDA 2X1GA 3QGPA 1UWBB 5ETNA 1N88A 2L41A 5LMNF 3VZHA 8ATCB 5BYRA 4IDKA 4JI2F 2H3EB 4ZMMA 4A4JA 1RTIA 1K44A 1JKHB 1CS4A 3IC1A 3E2EA 2XY7A 2OPPA 1DRZA 4YOEA 1IBKF 2VJVA 3V4MA 5D78A 2V4JA 2HWTA 3UR0A 5L8RC 4CCHA 3ZTQA 3M1VA 2A2DA 2OPRB 2DGOA 3CCES 4LR8A 3LALA 1N8RT 2MEWA 5IC6B 3J80Y 2YVSA 4LF6F 1WJ9A 5A0YB 4C6AA 3LTOA 1XN9A 4R25A 4IUFA 2DH9A 3POTA 1TQLA 4DV6J 4CH7A 2W7AA 1BD6A 4MK7A 3QGGA 4USVA 2FHOB 3CJKB 1W25A 2IIHA 3IR7B 2FIUA 4FKYA 2HYIB 1TVRB 2BJEA 1MMLA 3FEXB 2VFSA 3PNIA 5DM7Q 1DAXA 5I3UB 1T11A 3AAWB 1N0VC 3KHGA 5EWEA 4A8MP 1W2IA 4OI4A 5HJYA 4C11B 2Z56B 2MZ1A 4OZ0A 1DFDA 3RYLA 4F36A 4B3TJ 3HVWA 4Y3CA 2Z0GA 3MECA 1LWCA 1P1TA 2P6SA 3PO5A 2OMLA 3KUHA 3GQCA 2PSZA 2DH7A 2YQ0A 2DHXA 4W98A 3HVTA 1MMNA 3QATA 2ZH4A 1C0TA 4YB6A 1PBUA 1HWLA 1DTQB 2A6MA 2RE1A 4HT5A 4WYWA 2QRRA 4X2BA 1U48A 3D0IE 3D0HE 1K8AT 3CUNA 2UZAA 1G6BA 1MWZA 5CZXA 3EDRB 2MY7A 2OD6A 3AD7C 1MLAA 3HX9A 2OEJA 3DI6A 4LVOP 4NA3A 1HBNA 2GNKA 1Y0HA 4TU8A 1VBZA 5IT9Y 3DXBA 1Y9OA 3U7JA 4Q5VA 2XY6A 5BR8F 1RWNB 3TP2A 2W7PA 3QQCD 3CD7A 5E33A 2FB0A 4F0HA 4ED0A 1RCOB 1R89A 5CHCB 2CQCA 5K14B 4CLYA 2NPIA 2ILYA 3RGIA 2MLYA 2D1CA 4YDXA 4ED5A 3MM6A 2DR9A 3FBCA 2GJ2A 4CLFA 2U2FA 2XNQA 3GV8B 1HQEA 3NCQA 3UW1A 2ZH7A 4JI5F 4ZK7M 3FUYA 4P10A 1KR4A 2ZITA 5HMZA 1N32F 1ACMB 2VU5A 1UL3A 2NXUA 2E5HA 3MAQA 1LW0A 1S6PB 1H73A 4C0OC 2CZ9A 3E01A 4IQXA 1LKZA 2OSRA 4X4VA 2ADBA 1UVIA 4X65F 2M0GB 2QFIA 1WF1A 4LRCA 5J2QB 2MXYA 3SZ2A 2N7CA 1LK5A 1U1KA 3PIOQ 2NXEA 4CTAB 1GX6A 2G4BA 4C8NA 4EFAC 3GLJA 3DYAA 3LP1B 4ETXA 2YKNA 4PKDB 3G8QA 2DXDA 1S0VA 4AQYF 5L1KA 4X4TA 1XMQF 3N6MA 1LV5A 1F9HA 1L3SA 2MKIA 1MN9A 2Z2YB 3R5DA 2BE2B 2BX6A 2W9CB 4DUYF 5A2QU 4UY85 4CYUB 3UD3P 2YQ1A 1H38A 3LGMA 1MWQA 4MIWA 4PEOA 5KG3A 3V6DA 1FEHA 4IO9Q 1GXTA 4ED8A 1S6QB 4DPYA 4DV4J 2Y3YA 1VMBA 3T1HF 2YX1A 2ZH1A 1RT4A 2I2YA 2QLFB 3DMJA 1TL3A 3TNVA 4ILRA 1UW4A 2FLOA 5J2PA 2AZ1A 4WE1A 4RBVA 4DU8A 1NJIT 2IM3A 3W3SA 3CJ0A 1X4CA 1UMJA 2MQLA 1F6TA 1WOPA 1FKPA 4CO1A 4Y6IA 2E5IA 4AD6A 5CXTA 2DGQA 3I31A 1VS3A 4P75A 2NYIA 2LP4A 1J5EF 4NI2A 2CVEA 3PDNA 4MKAA 4CLZA 2DGUA 1ZA1B 2RRAA 2QGFB 1X8DA 1UEKA 4RW8A 3KFWX 4IH7A 3J7A1 4UT4A 3ITHB 1XJWB 1GK8A 4PG4A 3ZZYA 1CJUA 3CJ5A 2FJEB 3PM9A 1VK8A 1FFSB 2JC0A 2V2ZA 3AD9C 3MMCA 2LQ8A 1WG4A 4B08A 1J5OA 1IQTA 5C2CA 2CUYA 4J5OA 5SUHA 4HH0A 3CD0A 1RXOB 3SQGB 3VAHA 1FWPA 4ZVTB 2C1EB 2J9DE 4K7QA 2LEAA 1SIZA 3MWBA 4ED6A 5F8IA 3TARA 4KKOB 4KR0B 2AGQA 5IT4A 5H1SV 1S1VB 2DNMA 5KFEA 3MAAA 5IQQA 1RSCA 1IVZA 4DX7A 1RT3A 1EKRA 2MLXA 3MUMP 4GMKA 4ZVEA 2HEKA 1KOHA 4ZVFA 3QYYA 3JQJA 1CBKA 4CH0S 2ZVIA 2R2SA 3K8WA 1PYTA 4M5NA 4WZQA 2GVZB 3OVAA 2HHTA 2DBBA 2X7IA 2BJDA 1VHIA 3SCJE 4LIRA 3F44A 3H4BA 3IR6B 4B9VA 3EJMA 2E9TA 2BJ1A 1ZM2A 1UZDA 1SL0A 2XULA 3GIKA 2ZJRQ 2Y8WA 2V0NA 2CQGA 4EYIB 4TYBA 3PG9A 3U1NA 1KTQA 2B7CB 4MTPA 1F60B 1RKJA 4WK1A 3T6BA 1S9GA 3UNGC 1VQ5S 4JI0F 2GIQA 2F9DA 3QJPA 3U27A 1UA1A 3MD3A 1K0VA 3SCKE 2DK2A 2BW2A 4YB1P 4FS2A 5I42A 1RWKB 1X5OA 1K73T 3C6TB 4WXWA 1B0TA 3K2YA 2VODA
chains in the Genus database with same CATH topology
5HSPA 3H90A 3BYRA 3W62A 3W66A 3W65A 3W61A 2ZZTA 3W8PA 3W8GA 3W5XA 3W5ZA 3W64A 3W60A 3BYPA 3W5YA 3W63A 2QFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HSP A;  3H90 A;  3BYR A;  3W62 A;  3W66 A;  3W65 A;  3W61 A;  2ZZT A;  3W8P A;  3W8G A;  3W5X A;  3W5Z A;  3W64 A;  3W60 A;  3BYP A;  3W5Y A;  3W63 A;  2QFI A; 
#chains in the Genus database with same CATH topology
 4I6W A;  1I5O B;  1FVQ A;  2MY8 A;  4WFB Q;  2XGQ A;  3DRP B;  5DJB A;  4ZJO A;  4ECR A;  2NUU G;  3JTN A;  4ITS A;  3K5P A;  2YWG A;  4E2F B;  3PHE A;  2DH8 A;  4PUO A;  1R7I A;  4DV5 F;  1N54 B;  2KXN B;  3F0N A;  5LSL A;  1FJC A;  4F4K A;  4F4A A;  4IKA A;  4DFP A;  2JOQ A;  2DEI A;  4DDF A;  2KM8 C;  4QWA A;  3BO3 A;  1VQS A;  3LAM A;  4DCO B;  4P52 A;  4QU7 A;  1PGZ A;  1HNI B;  2GC8 A;  1TK8 A;  2HUR A;  2XLK A;  2HND A;  1YBA A;  4P2M A;  2DCU B;  4NLG A;  5ETT A;  3NAH A;  2R7Q A;  2HVE A;  3VAI A;  2H1Y A;  1S48 A;  2XBP A;  5F8N A;  1RB0 A;  1UCN A;  2X3D A;  2BKN A;  4C3M A;  4U8V A;  2HQD A;  1JLG A;  3OT9 A;  3VR1 A;  3H7H B;  2J9D A;  1OPZ A;  4DR4 J;  2Y0B B;  3NAI A;  3H5S A;  1NSQ A;  5HAT A;  1ZS6 A;  3AJ2 A;  3BSC A;  2J5A A;  2L48 A;  1SC4 B;  4NMX A;  4FYX B;  2C3O A;  1IBL J;  4K2X A;  1RHQ B;  3NMR A;  3M4X A;  1RAG B;  1X60 A;  5KFN A;  3KLH B;  4Q8E A;  2WHO A;  1FE4 A;  3Q8V A;  2W7O A;  2Q6B A;  2ZOM A;  3DLE B;  5KFF A;  3MAH A;  3K7R A;  2VBX A;  3P96 A;  3T1Y F;  5CYQ A;  1PJ6 A;  3QWP A;  4X4S A;  3R1H A;  1TUV A;  1AYE A;  3H90 A;  2DR5 A;  1U6F A;  4DR7 J;  3A8I A;  2CQ1 A;  5GAE U;  1S5Z A;  2BMB A;  3AOA A;  1TUW A;  3EVO A;  4K4V A;  2CG8 A;  3S8S A;  2VH7 A;  2XB2 D;  5L39 A;  2VKZ G;  5D15 A;  2XHC A;  1SC6 A;  3P6Y C;  2KFY A;  2CQI A;  5HMW A;  4H4O B;  2F1F A;  1A6L A;  1U0H A;  5B0G A;  3PTW A;  1QUV A;  3PHT A;  1UEV A;  3MHY A;  1HQU A;  4NCA A;  2NS1 B;  2J6T A;  3DDI A;  1RT2 A;  3DRX A;  1RBA A;  5D4O A;  5BJR A;  2E1R A;  4ED1 A;  1JLE A;  3AA9 A;  4H54 A;  3BF4 A;  4KJI A;  3SQO P;  1WC4 A;  3AOC A;  5A8W B;  1GXL A;  4E0D A;  4EO8 A;  2G2O A;  2LLZ A;  4N8O A;  1FNX H;  3MGJ A;  3BBC A;  2JWN A;  3FC9 A;  4ZCI A;  1TL7 B;  4RW4 B;  3TUZ C;  2V6A A;  3D54 A;  4XO0 A;  2OAU A;  4WU2 A;  5AE1 A;  2E29 A;  1IKX B;  1W7W A;  3QO9 B;  1R8C A;  2GX8 A;  1T03 A;  4LFB F;  3H4D A;  2R8J A;  1DQ9 A;  3MR7 A;  3WZ0 A;  5DG9 A;  4QIV A;  4AL5 A;  4BDP A;  1KQK A;  4RUB A;  4EBE A;  2V9K A;  3OXF A;  1BWV A;  3LPE A;  3C15 B;  3ZZ0 A;  2VG5 A;  4RU9 A;  4OX9 J;  4DV2 J;  2G1H A;  1YHQ S;  1IKW A;  3GR0 A;  4QYZ K;  1S6O A;  4FXV A;  2DIT A;  4YB5 A;  1K0T A;  1Y10 A;  1YQH A;  2E9Z A;  2UXB F;  4DR2 F;  4PXB A;  4K8R A;  5J2N B;  2NPF A;  4DPO A;  1R8B A;  1QTN B;  3QRQ A;  3HUL A;  1V3R A;  3HKZ D;  1Q86 T;  3T5H A;  4DL0 C;  2VQE F;  2Z58 B;  5CYM A;  1IKV B;  4QWC A;  3TW0 A;  4JI3 F;  3EPG A;  4AL6 A;  3KDN A;  3PW0 A;  4NL5 A;  5GAH I;  4NLS A;  2NRE A;  1RTH A;  3I0R A;  3M2U B;  3BH6 B;  2IC3 A;  2UXD J;  1TKZ A;  3DLK B;  3F73 A;  3IFE A;  4JI8 J;  2C2M B;  2BEF A;  1B0V A;  1CJV B;  4F04 B;  3BZQ A;  1YRT A;  2DY9 A;  4OX7 A;  2W2O P;  4MFB A;  5DZ6 A;  2XS2 A;  2EKY A;  4I1T A;  2DNK A;  4C8O A;  5F0W A;  3GU0 A;  2GV1 A;  1VRU A;  1Z2Z A;  3EX7 B;  3R5B A;  1N5Y B;  3DKD A;  2J0W A;  4LSL A;  3HHL D;  2F3J A;  1JWW A;  3M32 A;  4O3R A;  1CSJ A;  3IWX A;  3PJ9 A;  1REV B;  2HAI A;  1UJ6 A;  2IDL A;  3OV7 A;  3PX4 A;  2QYC A;  4I68 A;  1Y7P A;  2YNF A;  1L3K A;  2HMI A;  1VJW A;  3ONQ A;  2ZKT A;  4WP8 A;  4Y2C A;  3KK1 A;  2BR0 A;  1PJ5 A;  5HMX A;  4P73 A;  3DRY A;  5IV3 A;  5EDW A;  5DZ7 A;  2O01 C;  4IFY A;  2JVO A;  3PVX A;  2EFV A;  3ILL A;  3K5M A;  3HJF A;  2R7W A;  2V9W A;  5DLF A;  1M90 T;  2Q66 A;  4ECQ A;  2LQ5 A;  2RSQ A;  2UUT A;  5LL6 d;  2DPI A;  4IG3 B;  5KFJ A;  3R5J B;  2NXJ A;  1SV5 B;  5HVH A;  3DLH A;  4NZ6 A;  5KFL A;  3A4T A;  2X3G A;  3DRR A;  4U8Y A;  4J9R A;  2AGO A;  1HBU A;  3HKW A;  2M52 A;  4KHP F;  2QG9 B;  5L1I A;  4ZPD A;  3CGI A;  1S6U A;  1RT7 B;  2UUA F;  2CNO B;  2C2K B;  1I3O B;  3M30 B;  3R6G B;  4PPD A;  1HNV A;  1P9Q C;  2MQN A;  4V19 X;  2CQH A;  3CJR A;  3RUB L;  2VG6 A;  2MQM A;  2CQB A;  3T9N A;  4WJB A;  3MCN A;  1TK0 A;  3HHN B;  4OHZ A;  4J90 A;  1FO1 A;  1QAJ A;  3ZTO A;  3GG1 A;  1TK5 A;  1U47 A;  4OV6 A;  3O44 A;  3W1Y C;  1DJ0 A;  3GZ7 A;  3R3T A;  1D0E A;  2B4U A;  3VWS A;  2WW4 A;  1XR6 A;  4I69 A;  4CLL A;  1F5A A;  2RS8 A;  1EET A;  3NNC A;  1PCA A;  1KDN A;  3HHK A;  3LP2 B;  3NXZ A;  5HAO A;  4TVA B;  4O0I A;  3NMA A;  1CJK B;  1SJR A;  2G2Y A;  3H59 A;  4P74 A;  4A46 A;  3AQP A;  4USM A;  2G2Z A;  2F9J A;  1IM6 A;  2MKH A;  3N9U C;  1MNE A;  3D67 A;  2F40 A;  2MHE A;  5LSR A;  3EYZ A;  3KDO A;  4XPC A;  2R8K A;  4L73 A;  2UVV A;  3KLG B;  2MST A;  1IM4 A;  2UVR A;  2JEI A;  4ZPW R;  4LQ3 A;  2EEY A;  4N77 A;  2WVE A;  3D4J A;  2ZJP Q;  1YIJ S;  2IA6 A;  1CS4 B;  4J9U E;  3UVJ A;  1BQM B;  4F0K A;  2MPU A;  4WFY A;  2OPP B;  4PQA A;  1VQN S;  1SJ4 P;  1I1G A;  4PZV A;  3VCD A;  1X4H A;  1LFP A;  4URS A;  2EW9 A;  2HFV A;  4RPF A;  3CCL S;  1VQL S;  2JVR A;  4OI6 A;  3J81 j;  1WC6 A;  4PG6 A;  3M1V B;  5E0O A;  4QJV A;  2IBO A;  3D66 A;  1YJN S;  1T94 A;  4YHH J;  2ZH9 A;  3GIR A;  5LSO A;  2P8I A;  3D6F B;  2RU3 A;  4KH0 B;  4LJM A;  2YPZ A;  2ROE A;  2CPZ A;  5KFR A;  3BS9 A;  2HHP A;  1WSV A;  2GQ2 A;  3R27 A;  1GNK A;  4K4U A;  3H42 A;  3R8Y A;  1D9A A;  1WDT A;  3G8T A;  3EGZ A;  4RW7 B;  4DOZ A;  2VAS A;  3CJ3 A;  3EXC X;  1H3D A;  2UUW A;  1FDN A;  2KT5 A;  4YY3 F;  4QBU A;  4Q0B B;  5KFY A;  2ABY A;  3FBF A;  3HVA A;  1ZAV A;  5ETS A;  3KLE A;  4NXN J;  3KG0 A;  2EG2 A;  2QSW A;  3MEK A;  1GMU A;  2J7U A;  2NZC A;  6FD1 A;  1MU2 A;  1VIS A;  2KXF A;  2LQ9 A;  1JIH A;  5JJB A;  4Y2A A;  4DN0 A;  1N33 F;  4IR1 A;  3B78 A;  1LWC B;  2E5J A;  3TJ9 A;  1NUE A;  2HSE B;  2V8H A;  1DAR A;  3QT7 A;  1VQ7 S;  3FSI A;  1C0T B;  5BXI A;  8AT1 B;  4DZD A;  3THP A;  2WBM A;  3S01 A;  3OVS A;  2BRL A;  3MI7 X;  3L7U A;  2LXU A;  2PA8 D;  3C19 A;  2QLJ B;  1VOM A;  1NB2 A;  1MSW D;  2A10 A;  1S9F A;  3N79 A;  3ZZR A;  5DLG A;  1ELO A;  2LQJ A;  3CCR S;  1DTT A;  1VQY A;  2NSC A;  3IBC B;  3GIJ A;  4ZHR A;  2ZJQ Q;  1S76 D;  1PSD A;  3C8Y A;  1HBN B;  4KGM A;  4GO7 X;  3C16 A;  4O3N A;  5CYJ A;  1S49 A;  3O8W A;  4HL9 A;  4O44 B;  2B9E A;  2HQI A;  1D8Y A;  3J7Y U;  3HM9 A;  1VK3 A;  2R7R A;  4F4Y A;  3OTB A;  3CCJ S;  1QTM A;  2FHJ D;  1N5Q A;  1R0A A;  2ILZ A;  3DRS B;  2K7J A;  4JI6 F;  4WFZ A;  4EMD A;  3WHI A;  3NBP A;  2C3U A;  4CLP A;  4NZ7 A;  4JI7 F;  2UUB J;  4K4Y A;  3WX8 A;  2PN6 A;  1S7H A;  1S7I A;  1UFK A;  4I7F B;  4BS2 A;  3TJA A;  3ZC4 A;  1RT1 A;  1KNZ A;  4M5M A;  3MM6 B;  3PRB A;  4ECV A;  1Y5N B;  2WSC C;  2E7W A;  3CMQ A;  3OTE A;  4NLR A;  1HQE B;  4Y00 A;  1KP6 A;  3TVK A;  1T95 A;  4DV1 F;  1QE1 A;  4NAS A;  2VA3 A;  2MKS A;  1APS A;  3UNY A;  2AKW B;  3BO4 A;  4LFC J;  2CPF A;  4EUV A;  4LF9 J;  2Z4P A;  2RIL A;  3Q23 A;  1WKK A;  1RTJ A;  3E01 B;  2GJF A;  1JKH A;  2VA2 A;  5HP1 A;  3CIZ A;  5HO4 A;  1GXU A;  2MQO A;  3GB0 A;  4PPZ A;  4UOC A;  2MQ8 A;  1GX5 A;  4ZVO B;  4LF5 J;  4OI2 A;  3BQ0 A;  3I4P A;  5C42 A;  2XMA A;  4IR9 A;  4NPO A;  4QWE A;  2FGO A;  2OHD A;  3TUP A;  3DYA B;  1U1P A;  2VC0 A;  4KAI A;  3CO0 P;  2YKN B;  4HAC B;  3CUL A;  3N6L A;  5K8O A;  1TV6 B;  2HGL A;  4ERD A;  2ERR A;  3ZTP A;  1UWA A;  1ZTW A;  4OHV A;  1RU1 A;  2HGN A;  4ZA1 A;  2VPZ B;  5A0Y A;  2KRR A;  2HNY B;  3GII A;  4B3R F;  1CJT A;  4WFX A;  2NQP A;  1KC8 T;  3CVK A;  4HHJ A;  2C2N A;  4IFV A;  2DNY A;  2VBY A;  1NSP A;  4KHR A;  3V6D B;  3JB9 k;  1LK7 A;  4BWM A;  2FZK B;  4ICL A;  1KFS A;  4JP8 A;  1JLA A;  3BGR A;  5I3U A;  3MD1 A;  5KFH A;  1TL3 B;  4NOH A;  4K2J A;  5J2P B;  4WE1 B;  1OPI A;  3AY0 A;  1WC1 A;  2Y8Y A;  2H54 B;  4JOU A;  4DG1 A;  3KLV A;  4C11 A;  2CQ0 A;  1S1U B;  2KVI A;  2J7W A;  1FKP B;  1SIW B;  2OEM A;  4PXE A;  3MMB B;  3RJM B;  2QT7 A;  2Z2L A;  1XNR J;  1RAE B;  2K1R A;  5D0G A;  4C7Q A;  2DGT A;  1F9E B;  1DY3 A;  3EZ5 A;  4RW8 B;  4WCE Q;  2DRA A;  1PJ7 A;  1T3N A;  2KO1 A;  4UY8 T;  5HVG A;  3ISN C;  2RAQ A;  3SEO A;  2RJZ A;  3OW2 R;  4ECU A;  1LWE A;  2FZC B;  4TU9 A;  1CJU B;  5DO2 A;  2CNL B;  2YNH B;  3MMC B;  2X1F A;  5B0F A;  1J5O B;  3ILO A;  4WFN Q;  3VAJ A;  1S0M A;  1M1H A;  1OYD A;  2HQ3 A;  4A8Q A;  2HHW A;  5GME A;  1SC1 B;  4J91 A;  4QIG A;  4ECZ A;  5F0U A;  4M1K A;  4DWI A;  2QO3 A;  4X4P A;  3SSR A;  1NSA A;  1YGY A;  2FVQ A;  1LWX A;  2B9Y A;  2VOO A;  3G96 A;  1TAQ A;  3CSK A;  1IBM J;  5HJX A;  2GHV C;  1RT3 B;  4NYZ A;  1U6B A;  4ZKA A;  3QT6 A;  2ACM A;  3TR5 A;  1OWX A;  3MFI A;  2CAJ A;  2EWH A;  3Q2T C;  3V6K A;  2DHH A;  2W2P P;  4R0J A;  1U24 A;  4FBU A;  5A8R A;  4ZS6 A;  1K1S A;  2YX4 A;  2RQC A;  4OLP A;  4Y2M A;  1IR2 A;  2OI2 A;  2PT0 A;  1H72 C;  3UN3 A;  2POK A;  3GYX B;  4L76 A;  4F26 A;  1T02 A;  2B51 A;  4DL5 A;  4WP3 A;  4FF1 A;  4NCG B;  5FDL A;  4GKJ J;  4KGK A;  3NL0 A;  3NS5 A;  4UF4 A;  5J2Q A;  1VLY A;  4DBQ A;  2B9X A;  4R5P A;  3RTV A;  3NGU A;  5KG1 A;  2AJ1 A;  4QR1 A;  2PGC A;  1SVD A;  3PXG a;  4LRB A;  1BMQ B;  3EMT A;  5DET A;  2DCL A;  3B6B A;  4QIF A;  4L75 A;  2RKI A;  2AU0 A;  3K5L A;  4TQS A;  3DFE A;  3LP1 A;  5EX0 A;  4ZVQ B;  4CNY A;  3OJU A;  4DV3 F;  2JEG A;  3NNH A;  3CED A;  3G71 S;  2GAG C;  4LF7 J;  2J9E A;  5FLX Y;  4OYM A;  4ANE A;  4EZ6 A;  3GPA A;  3TRG A;  3SDE B;  1YRX A;  1FX4 A;  3JSY A;  4UOG A;  3GV5 B;  2XY5 A;  3THV A;  1S57 A;  4M94 A;  1XMO F;  1FDB A;  1B7F A;  1GFW B;  5HAN A;  1NK0 A;  3PY8 A;  3HDS A;  4A8S A;  1S6Q A;  4YR3 A;  2EXU A;  3MEE A;  5F9N A;  5ADZ A;  1B0P A;  2PEB A;  1JLB A;  4LIW A;  1FRK A;  1BHN A;  3EXY A;  3CDA A;  3QAU A;  3MR5 A;  2HKE A;  2D3O 1;  3KOA A;  4IYQ A;  3IG1 A;  1R31 A;  3MPV A;  1CQN A;  3G4S S;  3J81 Y;  2RVJ A;  2MKC A;  4KQZ A;  1DLO B;  3W5Y A;  1MMD A;  2DNQ A;  1JLG B;  1IXK A;  4MIB A;  5K8M A;  1KQG B;  1JJ2 R;  2QFJ A;  3TAQ A;  3I0S B;  5BYS A;  4I0W A;  4CH1 A;  4OI1 A;  4CO5 A;  5HQM A;  3NOC A;  2W2N P;  4OJ3 A;  1HNX F;  2ZHA A;  1GT8 A;  4B9T A;  2RDJ A;  1L3T A;  2VBZ A;  1VC5 A;  3CPW R;  2BDP A;  4NML A;  3BO2 A;  2AYE A;  2FHM A;  5B0D A;  3LH2 S;  2RUG A;  2XWX A;  1VQK S;  5IWA F;  3NGS A;  3TUJ C;  4A48 A;  3Q0A A;  2XMU A;  1BY9 A;  3P45 B;  2FVP A;  3CF5 Q;  4AYB D;  3CXC R;  3R6L B;  3U1L A;  3NGR A;  3TA1 A;  1Q5Y A;  4KE5 A;  2UUC J;  2WRM A;  3T5L A;  3FVY A;  1Q8B A;  4LF1 A;  4AL7 A;  3OR1 A;  4LF4 F;  1EZZ B;  2ZZM A;  2KZZ A;  3BYR A;  2OEL A;  3G86 A;  4FYD A;  1HAR A;  1QLN A;  4Q7A A;  4RW9 B;  4KV8 A;  4LR9 A;  1NKE A;  2LEP A;  3L7P A;  4DF4 A;  4LF8 J;  3CO9 A;  1RA7 A;  2Y1J A;  4C9D A;  2HBQ B;  4PAB A;  4DR5 J;  2XS5 A;  4AXJ A;  4D3H A;  2GVZ A;  2XHW A;  5K9F A;  1QM9 A;  1HQU B;  2HZC A;  3IMQ J;  5ETR A;  1RT2 B;  1GEH A;  1F5B A;  3A8J A;  1FHT A;  1JLE B;  4Z7C A;  1Q16 B;  5GAG I;  2OO4 A;  4NRT A;  1BQX A;  1NLK L;  1Q53 A;  3HFK A;  3BPD A;  4BLG A;  3MOJ B;  3CCT A;  4DLE A;  3RRK A;  2YWF A;  4Q44 A;  3N5F A;  3EVW A;  4IOA Q;  3GFZ A;  2AEF A;  5DM6 Q;  1H6K X;  3GYN A;  1PYS B;  3I56 S;  4WKR A;  3VVU A;  2XNR A;  1IKY A;  2B8Q A;  1S59 A;  2VFV A;  4PXC A;  4MK8 A;  3K89 A;  2M88 A;  4Z2X A;  2EKN A;  2GAH C;  3DOM B;  5KFQ A;  3M2R A;  3G87 A;  1Y11 A;  1PKU A;  3DRP A;  2R7V A;  1B7Y B;  1IKW B;  2E5L J;  4PWD A;  1X5T A;  3QSI A;  1FRM A;  5D0H A;  3RG6 A;  1JLQ B;  4EU0 A;  1L3V A;  3PW5 A;  1WKL A;  4LR7 A;  3HSD A;  3G8S A;  4TKT A;  1LXJ A;  2FJA B;  4QYZ J;  3H5U A;  2F8H A;  3CDU A;  1WOS A;  5JVH Q;  4HR2 A;  3I9V 9;  2CXE A;  5K5M A;  1PC5 A;  4GO5 X;  2RRN A;  4WFA Q;  3OPK A;  1TL5 A;  2CJB A;  1PG5 B;  3BGO P;  3MDF A;  3ILI A;  4M8L A;  5DDR C;  5J1N A;  5CYM B;  4MKB A;  2AX1 A;  5E2Q A;  3KYL A;  4DL3 A;  1YJR A;  1XBW A;  2LEB A;  1ZZF A;  2B9W A;  2K7K A;  1C0U A;  3K8V A;  1VRQ C;  3WDO A;  4FP9 A;  2CQP A;  5KT6 A;  3TZX A;  2AJ2 A;  4ZP7 A;  4P7T A;  2IC3 B;  2KRB A;  1W2B R;  2QLW A;  3HHE A;  4L74 A;  4IOB A;  3I32 A;  2N3L A;  3R2C J;  3M8R A;  2GQQ A;  4GKK F;  5KG7 A;  4MFB B;  2BAN A;  4N8N A;  4A8X A;  1Q78 A;  4OZ2 A;  3K17 A;  4UQG A;  4QZV B;  5GMD A;  3O1L A;  4LSL B;  3PKY A;  1TKX B;  3VAG A;  2LMI A;  4JV0 A;  1RHU B;  4WPA A;  2C42 A;  5AE3 A;  2BJ3 A;  1JMT A;  3BEG B;  2JFK A;  2AEJ A;  3EVM A;  2HLU A;  1FTC A;  4DR6 F;  1DHM A;  1KKH A;  1Q8K A;  2YNF B;  3QIP A;  3OL8 A;  2HMI B;  1B99 A;  3DHX A;  2AJ4 A;  3KK1 B;  1V5V A;  4QR0 A;  2AYG A;  4F7V A;  5F8L A;  4OYP A;  1YWX A;  2AX0 A;  2CVI A;  2J8S A;  2VF3 A;  4IFY B;  1VYA A;  4NEY A;  3DU5 A;  1HHT P;  1R27 B;  4O3Q A;  2EPI A;  1WNE A;  1KTV A;  5FII A;  4DMZ A;  4CNZ A;  2FJB B;  5CCM A;  4F4Z A;  3VGU A;  3V5R A;  5IM0 A;  2KHC A;  3DRR B;  3FGV A;  3MED A;  1NK7 A;  1HWK A;  3QSY B;  2VJU A;  1KLM B;  5KOX A;  2B7B B;  1HNV B;  5A8W A;  1OSC A;  5FJ4 A;  3UDE A;  3Q2S C;  4B9L A;  5F8M A;  4DQI A;  3THT A;  2B8P A;  1FFG B;  3UD5 A;  1WTB A;  4ECY A;  4NWB A;  2OMO A;  1FJE B;  2IRU A;  1YJW S;  3MOZ A;  2XS7 A;  1IKX A;  4WU3 A;  3A8K A;  4C8Y A;  4DR3 J;  4HDG A;  3HXM A;  1DBD A;  3WIU A;  1EET B;  5U47 A;  3KMQ A;  3C15 A;  3CCV S;  2VZ9 A;  3PEJ A;  4ED3 A;  3ZNU A;  2XMT A;  4LBI A;  4OZL A;  3SFG A;  2F7V A;  1RAH B;  1T3O A;  1WOO A;  2VUG A;  3BDE A;  2PII A;  4X66 F;  2KVQ E;  3KHR A;  1WI6 A;  4HKQ A;  1UKU A;  3VAF A;  4O4R A;  5A8K B;  4FYV B;  4P2F A;  3QRR A;  5CAA A;  4AUK A;  2DTJ A;  4JV1 A;  1IJF B;  3T9Z A;  3W5X A;  3C14 B;  2BM1 A;  1FWK A;  3V6H A;  2H5J B;  3UVJ B;  4OFZ A;  2DHA A;  2W4C A;  2ALZ A;  4O3P A;  1S0N A;  4OJG A;  3JQM A;  1O6X A;  2KH9 A;  4DR1 F;  2XSF A;  1IKV A;  1XEZ A;  2OSQ A;  1NSK L;  2BQ3 A;  2ZE2 A;  1FES A;  1C2P A;  1HBM A;  1V3Z A;  3HFZ B;  4MH8 A;  3M2U A;  4N47 A;  5KT7 A;  2LU2 A;  4BC9 A;  1U1N A;  2YX7 A;  2CPD A;  5DGB A;  3SCL E;  1SBR A;  4QW8 A;  3FMW A;  1JQG A;  4KO0 B;  1CJV A;  5KFP A;  2KJV A;  2V8D A;  1RP5 A;  4K5S A;  2HHH J;  4BBY A;  4C48 A;  3ZNJ 1;  2M2B A;  2FUG 9;  3LA0 A;  5DDO C;  4ED2 A;  4DV0 F;  2CJY B;  3QLH A;  1T0T V;  2QV6 A;  1AW0 A;  2GS8 A;  3H2U B;  3M8Y A;  1N5Y A;  3K58 A;  3M9O B;  2IMO A;  4WWS A;  4DV7 J;  3UO0 A;  1N36 J;  1U2C A;  1H74 A;  4M5L A;  3HHD A;  5MLC V;  1BUX A;  4HI1 A;  1S0O A;  1REV A;  3ILJ A;  3V6J A;  2HLT A;  3D2W A;  2DIS A;  2CJK A;  1WC0 A;  3NWG A;  4KBI A;  5ETO A;  1E6Y B;  4KGV B;  1NRK A;  4I2Q A;  2C2D A;  4KHM A;  1IWA A;  3KLE B;  4CLT A;  4M5H A;  4X4R A;  1HMV A;  1MU2 B;  2J0S D;  4OYA A;  1SI9 A;  4X62 F;  1JLF A;  5F8H A;  4DU7 A;  4DFJ A;  1S79 A;  2EVZ A;  1NKB A;  5E3R A;  4CIO A;  3WIV A;  4FNI A;  2DR7 A;  4IG3 A;  4ZPA A;  4C8M A;  5CH7 B;  5H9F K;  3Q8R B;  4I64 A;  5HI7 A;  1X0P A;  5D8H B;  2W9A A;  1NK8 A;  3GV7 B;  1S4E A;  1R6V A;  4ZIT A;  4JV5 J;  1QUP A;  2ZNY A;  4DL2 A;  2UU9 J;  3PRV A;  4ECW A;  2Z2Z A;  3GJQ B;  3M30 A;  3NP5 A;  3OFG A;  3LUY A;  4H4K C;  3OTD A;  1U26 A;  3NY0 A;  1FKA F;  3AXM A;  3LGH A;  2NLW A;  2P6T A;  2R8I A;  2GFF A;  3KJN B;  4I2P A;  2H48 B;  3QWU A;  1NME B;  4URQ U;  1HHQ A;  3SBM A;  1FDA A;  3T5K A;  5D4L A;  3LQV A;  5E3A A;  5IS2 A;  3NOG A;  3KK3 B;  4DEZ A;  1WSR A;  1G7C B;  2IM0 A;  4DL6 A;  3L09 A;  4DX6 A;  1RCX B;  3M8Z A;  1EP4 A;  2LDY A;  3V81 B;  2DD8 S;  4Y65 A;  3LP2 A;  1HQ2 A;  4Q43 A;  5B0A A;  2HHU A;  1GMV A;  4IH6 A;  2VV5 A;  2UV8 G;  4P2X A;  1VQO S;  3M6X A;  3A13 A;  2GO9 A;  4OZ1 A;  2YKA A;  3DLJ A;  2CQ3 A;  4DV6 F;  1Y3J A;  3DDK A;  3D6H B;  3O6Q A;  3KLG A;  4XAK A;  3RBE A;  2LYV A;  2DT9 A;  2F65 A;  3EUN A;  5ETL A;  4CO3 A;  1RTJ B;  5HP1 B;  2LQB A;  1WHY A;  1OS5 A;  1BQM A;  2E9R X;  3VHQ A;  4GVL A;  4LQ9 A;  4PWW A;  1Z2L A;  3V4I B;  2R7T A;  4E8U A;  3DXS X;  3PFO A;  1WEL A;  4CO2 A;  1SH0 A;  5C42 B;  2R9L A;  3EDQ B;  1FK9 B;  4B3T F;  1JJC B;  1NHK L;  3VVT A;  1V5I B;  5T7L A;  2JNJ A;  3PR5 B;  3HMJ G;  3N28 A;  1NCL A;  2HW3 A;  3KLF A;  4P6Q A;  4BHQ A;  4FF4 A;  3S1T A;  2VQF J;  3P49 B;  3ZZT A;  3B4D A;  2OUG A;  1CJT B;  2CAD A;  1V3S A;  3GSD A;  4IFV B;  1SC3 B;  2IRX A;  4XPE A;  5DQH A;  3W2V A;  4WKY A;  2EC2 A;  3MTJ A;  1RAO A;  5KFU A;  2PFD A;  4ZLL A;  2KM8 B;  2CG4 A;  2B4V A;  3BRE A;  4RW7 A;  4ICL B;  4FS1 A;  4NLP A;  5M2R A;  1JLA B;  3BGR B;  3BR8 A;  3MM9 B;  2MKY A;  4Q0B A;  1YJV A;  4ANC A;  1AXQ A;  1SJF A;  4ES1 A;  4DG1 B;  2YKO A;  1TZ0 A;  2QN6 B;  3TJ8 A;  1I51 B;  2K8G A;  3FMB A;  2W1B A;  4FVC A;  3LW5 C;  4OYI A;  2XM3 A;  2K1R B;  5EHH A;  2IMW P;  2HS0 A;  2GVD A;  1NK9 A;  5C25 B;  3PFE A;  3IP0 A;  1NJX A;  2EFG A;  5HK4 A;  4K5R A;  1NPP A;  3MM5 B;  1CUL A;  3ZTR A;  5EGY A;  3SMZ A;  1EIY B;  3FRZ A;  1KQF B;  7FDR A;  2XO7 A;  1Q81 T;  2CWX A;  3AXK A;  1U45 A;  2ROP A;  4OZJ A;  1LWE B;  1NXI A;  5LMU J;  3DGV A;  3ZZO A;  2HRY A;  4XDC A;  3TZY A;  2UV8 A;  5AE2 A;  4KFB B;  2HAF A;  2U1A A;  4G1Q A;  3O5T B;  4ED4 A;  3B82 A;  1VHF A;  2Z2M A;  5HLF A;  2H5I B;  5HSP A;  2B4P A;  2PDA A;  5C7P A;  1F0X A;  9ATC B;  4O44 A;  2VON A;  2RQM A;  1RI7 A;  4TLQ A;  4DUT A;  4EYH B;  4WII A;  1S1W A;  3ADA C;  3GG0 A;  1L3U A;  4G1P A;  5LJ3 Y;  5CD4 A;  1AB8 A;  1NK5 A;  4WBF A;  3DRS A;  3T6J A;  3HSJ A;  4RO0 A;  3L3C A;  3MXH P;  3GR1 A;  4I7F A;  4L3N A;  3NS6 A;  3CCU S;  4RBT A;  3IAS 9;  1XNQ J;  4KPY A;  2H51 B;  3G82 A;  5A8R B;  1URN A;  5M2P A;  3OHA A;  1BLU A;  1MRO A;  1SCJ B;  5ETV A;  5E3Q A;  3Q24 A;  2CRL A;  3TVY A;  3DOK A;  2BJ8 A;  1IUJ A;  4IO1 A;  3R5A A;  3D3C J;  4QQB A;  3OFH A;  4X4N A;  5E5N A;  3OUY B;  3L7O A;  4DV4 F;  4QU6 A;  4K4T A;  3ET6 A;  4Z7Y A;  1CEZ A;  1X4A A;  4JYA J;  2XC9 A;  4L6V 3;  3K5N A;  2J9C A;  3Q22 A;  5FDL B;  1N5T A;  2DNR A;  3JSB A;  4B3S J;  4R5P B;  1VIO A;  1N34 J;  2MYF A;  2F4V J;  5AJ3 J;  2HS4 A;  3QNW B;  1T9U A;  2DNZ A;  1GAO A;  3ELH A;  1NHU A;  2JZ5 A;  1M5K C;  2RKI B;  2YKP A;  4RX6 A;  5L9N A;  5KFI A;  4MT1 A;  4ZPT R;  4U67 Q;  2HHX A;  4O3S A;  4HAC A;  4WZM A;  1AFJ A;  1TV6 A;  4UUW A;  4PG5 A;  3DGP A;  2VB6 A;  3IBF B;  3A8E A;  4N41 A;  4ID8 A;  1FJG J;  2F5G A;  2GML A;  1U0S A;  4R8U A;  3G6X A;  2B56 A;  2MZT A;  2ROG A;  3KJV A;  1X0F A;  2HNY A;  2EK6 A;  4DCP B;  1Q8I A;  2JFD A;  1QAI A;  1XMB A;  2DNG A;  2X1A A;  1PYO B;  1YVF A;  4OI0 A;  3ICL A;  5FLX U;  2ZC4 A;  4OV1 A;  2MMY A;  3MEE B;  2W25 A;  4FF3 A;  1A9N B;  1OY9 A;  1JLB B;  4ZLJ A;  2A6O A;  3X3U A;  3L9Z A;  1R8A A;  2APO A;  1HYS A;  5LT5 A;  2MJN A;  4B3O B;  2A18 A;  1LNQ A;  1AUD A;  4ZPB A;  2N4C A;  3D7S B;  2IBK A;  1N48 A;  1O51 A;  3IG1 B;  1REG X;  2O67 A;  3DOL B;  1S10 A;  3NGK A;  3AJ1 A;  4DF8 A;  1S1U A;  2NZ4 A;  5F3Z A;  2G0J A;  5HQL A;  4J9V A;  3MMB A;  4DPU A;  3OD2 A;  4N7T A;  4UOF A;  4F25 A;  1U8W A;  2C28 A;  3J81 U;  1VBK A;  1B64 A;  1X4E A;  4QYR A;  2I0X A;  4DN9 A;  4JI4 J;  2G1D A;  4UOH A;  1N52 B;  2YNH A;  1FF2 A;  1NDK A;  4GC6 A;  4LRD A;  1TL4 A;  4YDD B;  4OZN A;  2CWK A;  1RTZ A;  3BSN A;  5IT0 A;  4NLV A;  3BM7 A;  3DNC A;  3I87 A;  4F2R A;  1KBR A;  1OQ6 A;  1OIA A;  3H8Y A;  6AT1 B;  3UCU P;  2C2O B;  3PYG A;  2C3M A;  4M95 A;  3AFG A;  1NO8 A;  1YX2 A;  4ZJQ A;  1CC8 A;  1GMW D;  5ETK A;  2XMJ A;  3OR1 B;  3L4B C;  5L38 A;  2BE9 B;  2P9G A;  3CCW A;  2JLF A;  3VAM A;  1Q7Y T;  3AD8 C;  1TFY A;  4KV8 B;  1OQ3 A;  2A1B A;  3M8Q A;  4C97 A;  1KRP A;  4P9S A;  1EQM A;  4XTT A;  1YTY A;  2Y1R I;  3EM1 A;  1NKC A;  3KK2 B;  2YNI B;  5K20 B;  1R0C B;  2CDR B;  2ZBR A;  3OL6 A;  3R2D J;  1VC6 A;  4ZIW A;  2CJA A;  2GJI A;  2DYA A;  1HNZ J;  4ZIV A;  4JB8 B;  1ZAX A;  1Y5I B;  3BKT A;  4U9R A;  1WWH A;  1EAY C;  1YBT A;  3FCW A;  2QA4 S;  4LFA J;  3CJ8 A;  1HPZ B;  2BAB A;  4OLO A;  3K57 A;  2ZWP A;  4EO6 A;  1HW9 A;  5EWG A;  3FRY A;  3K0J A;  2E44 A;  3OTC A;  4LVN P;  2GHW A;  1X5S A;  2GZO A;  3BQ2 A;  3Q8Y A;  4XK8 C;  4NZ0 A;  4NCG A;  4QR2 A;  4G1I A;  5I4M A;  2AEM A;  3NEK A;  2QSF A;  1EQ0 A;  4CLU A;  1U2F A;  1FCA A;  3CJQ A;  3D28 A;  3CME S;  3MPD A;  9RUB A;  4OHW A;  1IKY B;  4HT7 A;  2RT3 A;  1UFL A;  3PAC A;  2VFT A;  1RWV B;  2PC6 A;  3M2R B;  4X4Q A;  4DR4 F;  3QFH A;  1UET A;  1X4B A;  4RL1 A;  4ELT A;  4PWD B;  4WK3 A;  2QLB B;  3SDE A;  1TTH B;  1FRI A;  1CLF A;  1IBL F;  4X64 J;  2R2R A;  1AA1 B;  1C1B A;  2OPQ A;  1OYE A;  2VBW A;  1TL1 A;  3S6E A;  3ZZZ A;  3WC0 A;  1IWG A;  2XO6 A;  2RNE A;  2DNN A;  5KFV A;  1SUQ A;  3MMA A;  3KG1 A;  2GHP A;  3OL7 A;  3FSY A;  1WF2 A;  2QA4 G;  1RE1 B;  1BXN A;  1SKR A;  1I94 J;  4J9K A;  3D1O A;  2ZH5 A;  1OY8 A;  4DR7 F;  5KT3 A;  2RU9 A;  1DLO A;  1C0U B;  4P7V A;  1WEX A;  1FA0 A;  2RD5 C;  3RZA A;  1F3F A;  2KYX A;  4FVM A;  1M5V C;  1EHW A;  2AJF E;  2NXC A;  1C4A A;  2L9D A;  2RHQ B;  4KYZ A;  4HVZ A;  3OXG A;  3CTR A;  3H98 A;  4DL4 A;  5D0R A;  2BAN B;  3I0S A;  1RYS A;  1ICE B;  2WB1 D;  1HNW J;  1HHS A;  3T3F A;  5CCL A;  2BJ9 A;  3MEG B;  1HIY A;  1AUS L;  5KG6 A;  2BM0 A;  5G4D A;  2KT2 A;  3VV2 B;  2ZBI A;  3QGI A;  2ZKU A;  1T05 A;  3K5O A;  2NUH A;  1LWF A;  3HJV A;  2DNL A;  3MUV P;  2K2P A;  4PAA A;  2BUN A;  3CC2 S;  4EI2 A;  3QIP B;  1Q7L B;  2MQQ A;  2D3U A;  1FRX A;  3QPI A;  3N01 A;  4K0K J;  4RR5 A;  3N0V A;  5I3Q A;  1FE0 A;  4DX5 A;  1P6T A;  3IR5 B;  4RW9 A;  3JTO A;  1RGV A;  4ID5 A;  4I4B A;  4W92 B;  2LXI A;  1TKT A;  2FJD B;  4OX9 F;  4DV2 F;  1TAU A;  4NLX A;  5IM0 B;  3PX6 A;  5IFM A;  3BPS P;  4I6Y A;  5F3T A;  3MED B;  4RWX A;  1SKS A;  3HF5 A;  1U09 A;  4H4K A;  5F9L A;  3T1A A;  4IRC A;  2R3V A;  1JJ4 A;  3US5 A;  4USJ C;  3LAK A;  1HD1 A;  5JVG Q;  2MZS A;  1N0U A;  1CQM A;  3I9Z A;  4B17 A;  3KNA A;  3VF0 B;  1SKU B;  3KJF B;  4HHU A;  3T41 A;  3FZB A;  2PEH A;  3D6T B;  1RLD A;  4R0E A;  3IN5 A;  1AFI A;  5L9X A;  5C5J A;  4F3O A;  1F5C A;  2EI5 A;  4OX6 A;  3O2I A;  1VQP S;  5HRO A;  4HH1 A;  1SL1 A;  1R0B G;  2WTF A;  4PYA A;  3FDS A;  3VGT A;  2V67 A;  4C8L A;  2ASJ A;  1RAF B;  3R7B B;  1D09 B;  1PO6 A;  4L3K A;  1D9F A;  5CZV A;  2HQC A;  4DSE A;  3BH7 B;  3W9J A;  4TY8 A;  3DOM A;  3HHL B;  2UXD F;  4JI8 F;  1ITP A;  3OR2 A;  3BGL A;  1VQ6 S;  1X9W A;  2E1C A;  2WK4 A;  4CQ1 A;  2FZG B;  1JLQ A;  2HFZ A;  2BA9 A;  4ZLN A;  5CA5 A;  2IJR A;  5GMK a;  1WUU A;  3EWG A;  4IG0 A;  4M5G A;  3DN9 A;  1NU4 A;  3N6N A;  2P5V A;  1NND A;  2X51 A;  3KHL A;  2JRS A;  2FHK A;  5LM7 E;  4V1A k;  4CT8 A;  4B3M J;  2KG0 A;  3ETO A;  2AZ3 A;  1OJ4 A;  3AH6 A;  4U6P A;  2F8M A;  1O5J A;  2GMH A;  4RNF A;  3JAM Y;  4KSE B;  3HO1 A;  4USW A;  5GAH U;  4Y2K A;  2ZE2 B;  1F1B B;  4HDH A;  2BXJ A;  1HBM B;  5AT1 B;  3D1H A;  1UAW A;  2GA7 A;  2V2Q A;  3J7Z 5;  4RUA A;  2KTQ A;  1PAU B;  2DRD A;  4F50 A;  1VFJ A;  2YKM B;  2BQU A;  3P3D A;  1XR7 A;  4B02 A;  5HMY A;  3J7A N;  4CO4 A;  4F2S A;  3CDB A;  5E41 A;  3V2U C;  3OLA A;  1S1T A;  2KJW A;  3QLH B;  4NXM J;  3I4H X;  2E5G A;  1TKX A;  3IWL A;  4O4G B;  4KH1 B;  1J2V A;  4FYY B;  1HBO A;  2BVZ A;  1RWW B;  2BOP A;  2RQ4 A;  4KGX B;  4I2Q B;  2VIH A;  1GH8 A;  4HI2 A;  1HMV B;  4CDI A;  4WIQ A;  1J27 A;  2FJV A;  1JLF B;  4YR0 A;  1ZOT A;  2HWI A;  4O23 A;  1Q0N A;  1XQI A;  2UXC J;  3NGD A;  2ZC3 A;  1GTE A;  2R42 A;  3CJS A;  1UFW A;  1YK9 A;  3IRX A;  1R8P A;  2EC0 A;  2ZM6 J;  1CVJ A;  2YH1 A;  1WHX A;  4DPT A;  2GQC A;  5KFC A;  3E3X A;  2VPW B;  3MMJ A;  2AYB A;  5H9F J;  3MPW A;  1HLW A;  2M3D A;  5F8G A;  1IN0 A;  4Q2M A;  4DUZ J;  1KLM A;  2W01 A;  4L72 B;  4JI1 J;  3X1L B;  4AND A;  1PIL A;  5JXS A;  1ZA2 B;  3C46 A;  3IS9 A;  4DSK A;  2KFZ A;  2B43 A;  1ZZN A;  3OTO J;  3DM2 A;  4I2P B;  5D3G B;  3EGN A;  1Q82 T;  3B54 A;  3MFH A;  4LSZ B;  4DS4 A;  3EE3 A;  5LMN J;  4CO0 A;  1G4C A;  1LEO A;  2B5J B;  2HRU A;  4JI2 J;  4QOT A;  4F8R A;  1KN6 A;  1EP4 B;  2VFU A;  2HG4 A;  3DLG A;  2HHQ A;  4EZ9 A;  2QYG A;  4ZVR B;  2W4P A;  2WOM A;  2IRY A;  2CJX B;  2KN4 A;  1IBK J;  4YHH F;  3LO3 A;  4EEY A;  4NYP A;  2VG7 B;  2PMW A;  2UVW A;  1SJQ A;  2ZOG A;  4EK2 A;  3U02 A;  2QMU B;  5A8K A;  1H0H B;  1DQ8 A;  1PC4 A;  2YNG A;  1DZ5 A;  2SXL A;  3M6U A;  1A7G E;  3FNN A;  5D77 A;  3C14 A;  1Q1K A;  1R43 A;  4LF6 J;  2QZ8 A;  2BV3 A;  2YTC A;  3BBF A;  4PXD A;  4QCL A;  5SZT A;  1NH7 A;  3PW7 A;  1RK8 A;  1E6V A;  4Z37 A;  3JYT A;  5A6W A;  1FD8 A;  4W90 B;  5LXR A;  3BGF A;  2RS2 A;  4NXN F;  3MM8 B;  2NSB A;  2ZFH A;  4ZVH A;  4AFF A;  5DQG A;  3AT1 B;  2JHE A;  1T7P A;  1LQ9 A;  4BCA A;  4DQP A;  5T7L B;  4HYK A;  4F3Q A;  4TN2 A;  5ETP A;  3LOU A;  4O0N A;  2JSX A;  4C8Z A;  1TKD A;  3M8P A;  5DG8 A;  4DXL A;  3KLF B;  3H5X A;  2XSJ A;  2F63 A;  5H9E K;  1XR5 A;  3RAX A;  5KFO A;  4KO0 A;  5L46 A;  5DDP C;  2HBZ B;  2WZ1 A;  3VGS A;  1M0S A;  4IRK A;  1XC9 A;  3H5Y A;  2M70 A;  4CZC A;  3W63 A;  3W2V B;  2V2K A;  4OX8 A;  3KHH A;  2BE7 D;  3NWR A;  3J80 U;  2GGP B;  3M2V A;  2YBV A;  5KFX A;  2DXF A;  4CLK A;  5L1L A;  4FPR A;  2XWY A;  1XER A;  2DHS A;  3GCW P;  1RKI A;  4AE5 A;  4G65 A;  3DHW C;  1E6Y A;  3SV3 A;  4PG8 A;  5K8P A;  1JLC A;  4MYU A;  3TI0 A;  4YS2 A;  2R2U A;  2LKZ A;  2E66 A;  4K4X A;  2CQ2 A;  3EGV A;  1BQN B;  2J6S A;  5D6G A;  4HTJ A;  4H4M A;  1RDR A;  2EBG A;  2GVD B;  2UUB F;  4DFM A;  1DUR A;  2IYI A;  1CUL B;  2O66 A;  3GJT B;  1JNR B;  4RLE A;  3RRG A;  2HNZ A;  3TAP A;  2V50 A;  3BGU A;  1B3T A;  3AA8 A;  5BR8 J;  3PV8 A;  5KTQ A;  1NH8 A;  2XI3 A;  1QSL A;  2M8H A;  4QPT A;  1I6J A;  4J9N A;  2H9Z A;  1WG1 A;  2MKJ A;  5M2U A;  3TZW A;  2HK3 A;  3QT8 A;  1X9M A;  2QX0 A;  4G1Q B;  2Z57 B;  3KLI B;  2I9S A;  3G6V A;  4LFC F;  4J9O A;  5HLF B;  3HP6 A;  3GTY X;  4LF9 F;  1M1K T;  1N5S A;  1S77 D;  3W64 A;  2HS3 A;  2GO8 A;  3TYT A;  3BSA A;  1FRL A;  1N4L A;  1NAQ A;  4JI5 J;  2D9P A;  3GIL A;  2XMK A;  3JSM B;  3PRD A;  2CNK B;  1NBE B;  2V69 A;  1N32 J;  3KTQ A;  1HI0 P;  4FF2 A;  1S1W B;  3IA0 A;  1FDD A;  4LF5 F;  2VIC A;  3KK3 A;  2BW7 A;  3CDW A;  4TY9 A;  1ROF A;  3V81 A;  3SCI E;  4U7U K;  4CM0 A;  4DSJ A;  1HA1 A;  5IT9 U;  4X65 J;  1H7W A;  2D69 A;  4NE9 C;  4IRD A;  2FVS A;  5EN1 A;  1KS2 A;  3G82 B;  3HI9 A;  3IM8 A;  1VC0 A;  3ZXW A;  2AV5 A;  2K3K A;  3UN5 A;  3HHL C;  4DQQ A;  1MRO B;  3CCS S;  2XEX A;  2C2R A;  3LP0 B;  5LJ5 Y;  4AQY J;  3DOK B;  1XMQ J;  1GQE A;  4K4W A;  1K1Q A;  2QLX A;  3F56 A;  2AF6 A;  3TQ1 A;  3ET6 B;  2DO0 A;  1TU0 B;  2MTL A;  4OHX A;  2CJ9 A;  3E8O A;  4MK9 A;  4F4X A;  3I5B A;  1U7L A;  3LAN A;  2HZA A;  4DUY J;  1W26 A;  1RUS A;  1P9Y A;  3MF5 A;  4ES2 A;  1ZPW X;  3V4I A;  5DRK A;  3OFE A;  3P5B P;  3HZG A;  1RWX B;  4WP9 A;  2G0C A;  1LW2 B;  1RHR B;  1T9Y A;  1RT5 B;  1FK9 A;  3HD1 A;  2PMZ D;  3GON A;  1RAC B;  4NLU A;  5DDQ C;  3T1H J;  3NNA A;  3IXQ A;  1HR0 F;  3DLL Q;  2CFX A;  3W62 A;  2ZZT A;  1TMM A;  1XNR F;  4OMF G;  4W4M A;  3OSN A;  3PX0 A;  3DGP B;  5KT5 A;  2JJ4 D;  4RBU A;  3KWM A;  2V34 A;  1A0O B;  4R8U B;  3CC4 S;  3U1M A;  5IXU A;  1VIX A;  1TP7 A;  3KJV B;  4ETZ A;  2LXF A;  4ELU A;  4KT0 C;  1JJH A;  3HPO A;  4QIW D;  2IJN A;  1Y4Z B;  2AW0 A;  1J5E J;  3KUG A;  4RUC A;  2DGV A;  1Q95 G;  4DJB A;  1VQ8 S;  2Z8Q A;  4K4S A;  1F2G A;  1XTZ A;  1NK4 A;  1HYS B;  3MM9 A;  5BYQ A;  1FKO A;  3T19 A;  3CE8 A;  3H0P A;  2ZDP A;  2LFV A;  2EFN A;  3P5T L;  2CKW A;  1OSD A;  1HR0 J;  1TEL A;  2FJW A;  1IBM F;  1NJW A;  2B4O A;  2YKQ A;  2J0Q D;  4NLQ A;  1URR A;  5C25 A;  1H98 A;  2NR0 A;  4NEZ A;  1UTA A;  2QJ3 A;  3MM5 A;  2Q3P A;  2W2Q P;  4P2S A;  1T9W A;  2MDA A;  4NLW A;  1KEK A;  2GIF A;  4FXD A;  1BE4 A;  3IM9 A;  3UFC X;  2BKO A;  3D0G E;  4J9Q A;  1QVF R;  1U25 A;  4WTO B;  1SKW A;  3EZU A;  4KFB A;  1NDL A;  3TQE A;  4ZVG A;  4ER8 A;  2A0F B;  2AP6 A;  3JTP A;  4HHH A;  4Q8F A;  5CD4 H;  2H4W B;  5C24 B;  2GMJ A;  2YWW A;  1EAR A;  3N4W A;  1D1U A;  2OP5 A;  1YJ9 S;  2XMM A;  4GKJ F;  2A3J A;  1SQE A;  2C3Y A;  1WF0 A;  4JBC A;  5B7W A;  3UE2 A;  3LWL A;  1YSJ A;  3UWT A;  3R7N B;  3ETM A;  1C1C B;  2IM2 A;  3OQ2 A;  2N7Y A;  2K06 A;  1OY6 A;  3M8Q B;  2CPY A;  3R5C A;  5J2M B;  4P71 A;  3RRH A;  4RUH A;  1G3O A;  2XMV A;  4JI0 J;  4LF7 F;  2WON A;  5D4P A;  1VBX A;  3RW7 A;  5KG5 A;  3TAM A;  1QY7 A;  5T14 A;  4OJH A;  2DVI A;  3W9H A;  2R7U A;  3PYD A;  3A3N B;  5G0R A;  1H2T Z;  4TNO A;  2ZHB A;  1ZPV A;  1NZA A;  4A8Y A;  1U1Q A;  1RLC L;  2KXH A;  3OUY A;  1WAC A;  2MLZ A;  4USH A;  1SPB P;  4ZPV R;  1NEE A;  2FDN A;  4ED7 A;  1U1O A;  1FER A;  4LSN A;  3GJS B;  4DV5 J;  3FFI A;  5KT4 A;  3NCP A;  1TMJ A;  4ATN A;  3LWM A;  4YFU A;  1VCT A;  2LU1 A;  3P4U B;  3HSG A;  1XWL A;  4Q45 A;  5L1J A;  5AXM A;  4U95 A;  4AXI A;  3NRB A;  2B6A A;  2HFO A;  4LBP A;  2HIY A;  1GTH A;  3S7R A;  3OFF A;  2BJ7 A;  8RUC A;  1EKS A;  1TR0 A;  5GAE I;  4RW6 B;  1YKW A;  4C98 A;  4ZVP B;  5DS7 A;  1C1B B;  2OPQ B;  1UVM A;  2NYH A;  5HVF A;  1TL1 B;  1GMW A;  1M1G A;  2HFS A;  1QSS A;  1OMS A;  1SUQ B;  3MMA B;  2IVM A;  1HI1 A;  2HFU A;  1R6Y A;  1FX2 A;  1SJ3 P;  3KMS A;  4B3O A;  1XIQ A;  3K59 A;  3C6U A;  4J9M A;  2CZ4 A;  3RAM A;  2ZHO A;  2UUC F;  2OFH X;  2QL5 B;  3DOL A;  1SB6 A;  1N56 A;  2WB4 A;  4NX9 A;  4ECX A;  1X7V A;  1IR1 A;  3T1Y J;  4JUZ A;  5J1P A;  1RYR A;  3TZZ A;  2X1B A;  3VAL A;  4MJK A;  2W9B B;  4ZJL A;  2G9O A;  5JUM A;  4LF8 F;  2PO4 A;  4FKX A;  4FYW B;  4OQJ A;  3TA2 A;  4CI0 B;  2Z30 B;  2CZV C;  4DR5 F;  1ZET A;  3UCG A;  4ZP6 A;  4A47 A;  3GYG A;  1RZM A;  2PE8 A;  2R7X A;  1FXL A;  4C3K A;  1HW8 A;  3PW2 A;  4M5D B;  2KG1 A;  2CA9 A;  1T05 B;  2DR6 A;  3VGV A;  1QJH A;  1LWF B;  2CPH A;  3CC7 S;  4OHY A;  1SQF A;  1NDC A;  2ZBC A;  3CJ4 A;  4PR6 A;  3D3B J;  3RU0 A;  3NLC A;  4JV2 A;  1RTD A;  3M6W A;  3D1Q A;  2L9N A;  4MYT A;  1FJ7 A;  1MWY A;  3KJQ B;  1NHV A;  3R97 A;  2CPE A;  3CJT A;  1FFW B;  1R3N A;  3BDP A;  6FDR A;  1X9S A;  1S72 S;  5KFD A;  2AJQ A;  5B08 A;  4ID5 B;  4C8K A;  1TKT B;  2LVW A;  2CJQ A;  2WVC A;  2AWZ A;  5KAK A;  2D7S A;  1NJY A;  3KK2 A;  2YNI A;  2RHS B;  1VRT B;  2E5L F;  4LFB J;  1JXE A;  4ZP9 A;  1ZBT A;  4KC5 A;  2FD2 A;  3W2W B;  1IQZ A;  3WQP A;  2VL1 A;  1KHW A;  2HIQ A;  1M5S A;  2HVZ A;  3ZFV A;  4C3L A;  2MKK A;  5GAG U;  1HPZ A;  5KFB A;  3UI3 A;  1Q79 A;  3TVZ A;  3B4M A;  2ZD1 A;  5J1E A;  2BOA A;  2Y0S D;  1ARO P;  2AQ4 A;  4BWJ A;  2UXB J;  3FEY B;  5KOW A;  2W8K A;  4DR2 J;  2H5E A;  1Q4R A;  2M7S A;  1HWI A;  1MW7 A;  5ETQ A;  5HRO B;  2DNH A;  4USU A;  4RZR A;  3Q89 A;  2AHO B;  2MSS A;  4U7U D;  2XLI A;  4C2M A;  3D68 A;  2FPH X;  1HI8 A;  1S9E B;  4PQU A;  1EJ7 L;  2VQE J;  3IAM 9;  2G13 A;  4TY8 B;  3R1L A;  4CLW A;  1HL6 A;  1AZS B;  2XZW A;  3OR2 B;  3Q86 A;  4OYX A;  4LRA A;  4JI3 J;  2J7K A;  2R2T A;  4TLR A;  2WBR A;  4ZN3 A;  5MAO A;  2PMH A;  2MGZ A;  4LBH A;  2H65 B;  3MM7 A;  4RNH A;  3RW6 A;  3QFW A;  2E7V A;  3PR4 A;  2ZZN A;  2O5D A;  3H2V E;  2Q79 A;  5CQG A;  3UPF A;  2QC3 A;  3W60 A;  3Q83 A;  3WBZ A;  3OXL A;  1ZM9 A;  2HRT A;  4IG0 B;  2R4F A;  1UPM B;  5D0E A;  4J9L A;  4P72 A;  2DB1 A;  4YQW A;  3BSO A;  1O0P A;  3PEH A;  2V4R A;  2HQG A;  4F0M A;  5B0C A;  1FI4 A;  2WAQ D;  2FVR A;  1RWU A;  2QA2 A;  2IJF A;  1T9V A;  5HBM A;  2BZ2 A;  2V68 A;  2WSE C;  3GCX P;  3GWC A;  4O3O A;  1N6Q A;  2P9C A;  2KI2 A;  3BKU A;  3ZZP A;  2KB2 A;  2AMC B;  5AXL A;  2ZUA A;  3LF0 A;  3PW4 A;  3OSP A;  1YLX A;  5HL7 Q;  5B0B A;  4YEA A;  5KFZ A;  1PAE X;  3JAM U;  2WVB A;  4C4W A;  4LRE A;  1JK9 B;  4DI6 A;  3IGV A;  3LPY A;  4GVB B;  1S1T B;  1YZ7 A;  2DO4 A;  4ZLP A;  3IO1 A;  1FEE A;  3MEG A;  2ASL A;  3AOB A;  2RQK A;  3DLB A;  2OPS B;  1UVL A;  3R5G A;  3JQK A;  2GW8 A;  2E7X A;  4DQR A;  1FD2 A;  2RB7 A;  1U49 A;  2B3T B;  2RF2 B;  4V19 J;  4ZOS A;  2D3Z A;  1HBO B;  4YP3 A;  1FVS A;  2WW8 A;  1RAJ A;  3BJY A;  4KHP J;  4J7C A;  4USI A;  2EBE A;  1WOR A;  1X31 C;  3F41 A;  3ISN D;  4N5S A;  3ZO7 A;  4F4W A;  2UUA J;  3J7Z T;  2IHR 1;  5IQ6 A;  4ENO A;  4DR3 F;  4IDK B;  3CD6 S;  2EFP A;  2BYC A;  1RTI B;  3JSR A;  4CRJ A;  2JX2 A;  3G9C A;  4KY3 A;  4M5K A;  4Y2I A;  1H2U X;  2I5J A;  3IRX B;  5AXN A;  1S1X A;  2OTJ S;  2OD4 A;  1LOU A;  5LOQ A;  2IAJ A;  4ZDN A;  1WD6 A;  2V4J B;  3FJ2 A;  1D3W A;  3EZO A;  3JS9 A;  4K4Z A;  3SI8 A;  2VKR A;  5EUH A;  3CD5 A;  1FNO A;  4DLG A;  3HLU A;  3ZZU A;  1ZYQ A;  5HN0 A;  2QE5 A;  2QIF A;  1S12 A;  5IZH A;  1KFD A;  2XI2 A;  3IS9 B;  3RBX A;  3HK2 A;  2HVD A;  1G2E A;  4RNO A;  4DFK A;  2V94 A;  3NS7 B;  2F4F A;  2RML A;  4YME A;  2DEJ A;  3DM2 B;  3POT B;  1U6Z A;  5ETM A;  5KFT A;  2PI4 A;  3QJL A;  2L3M A;  2D9O A;  4LF2 A;  2OEK A;  4FN5 A;  4B9S A;  2ATC B;  2D3O R;  1X5P A;  2FJX A;  4KTQ A;  3DLG B;  4OYO A;  1SL2 A;  2AYM A;  2NCK L;  3SSS A;  4EWT A;  3RB0 A;  2W24 A;  2WOM B;  3TWZ A;  1L5U A;  3HHL A;  1KD1 T;  3FQL A;  1BGX T;  2C2E A;  2M5Y A;  4CWB A;  3W8P A;  3AOD A;  2IYG A;  4UUX A;  3W5Z A;  2HHH F;  2OGU A;  4M5I A;  4A8K A;  3MEC B;  1KHV A;  2HBY B;  1U1M A;  1RBL A;  1WC3 A;  2YNG B;  1FTR A;  5I3P A;  3M9N B;  4DV7 F;  3HVT B;  2JL9 A;  1N36 F;  4MAK A;  4I56 A;  2XZT B;  2VHG A;  1E6V B;  3GSI A;  2XYG B;  3JYT B;  5DGA A;  3AB2 B;  3FQK A;  2LDI A;  1IJE B;  2O1P A;  5KFK A;  2ZH8 A;  4DSL A;  3I96 A;  4DCJ B;  3DI6 B;  3CCQ S;  4KB7 A;  4YY3 J;  2E1P A;  1NB7 A;  2JH3 A;  2YKM A;  3M8P B;  1KWM A;  4NA2 A;  4FBT A;  2XSJ B;  2QL9 B;  3NGT A;  4DZ6 A;  3M6V A;  4S0M A;  2JLG A;  4I6A A;  3J7Y I;  1N33 J;  1QDU B;  5H9E J;  4M5J A;  1KVK A;  1DQA A;  2DGX A;  2M4M A;  4JV5 F;  1UEU A;  3GFX A;  2UU9 F;  5E3P A;  3M2V B;  3BN4 A;  2PI5 A;  1FWL A;  2XTJ P;  4N76 A;  1LFW A;  4DPX A;  4O4G A;  1ZM3 A;  4NLD A;  2P9E A;  1P8G A;  4C0H A;  4RWW A;  4YR2 A;  1NM2 A;  1JLC B;  4RKU C;  1UVK A;  2V4Q A;  2MZJ A;  2G0I A;  2B0G A;  1FRH A;  1RT6 A;  1UWB A;  2DNO A;  2KDO A;  2EK1 A;  4Q2L A;  2YY3 A;  1XK8 A;  4U7C A;  2XLJ A;  3VAK A;  2RRB A;  3FBE A;  2D41 A;  2EFO A;  1LW0 B;  2HQF A;  4H4M B;  3N5B A;  1FNM A;  1VR6 A;  1WDD A;  2PFF B;  2FGC A;  4G6V B;  3H20 A;  3SXL A;  2I1R A;  4MKY A;  3CCZ A;  2HNZ B;  4ZVS B;  3I55 S;  3H40 A;  1VGY A;  3OVB A;  2E1A A;  3P8B B;  4LMZ A;  4JI6 J;  4ZP8 A;  2N82 B;  2FLN A;  2J0X A;  2W4D A;  3DU6 A;  4JI7 J;  2OPR A;  2Q1L A;  3MCM A;  2L9W A;  5KG2 A;  3KUE A;  1RHM B;  2KKH A;  2L08 A;  3A12 A;  5KG4 A;  3AHP A;  3UDV A;  3QT5 A;  1VI7 A;  2IPO B;  1F3V A;  2MQP A;  4DV1 J;  5D3G A;  1NDP A;  1V6H A;  3FZ2 A;  5IV4 A;  3JXO A;  4QWD A;  4Y34 A;  2B5J A;  3CJK A;  1ZM4 A;  3PYE A;  3EGW B;  4TXS A;  1U2R A;  1TVR A;  4QIE A;  4GC7 A;  2NXN A;  2ZDO A;  2CPJ A;  3EPI A;  2MJU A;  3HZE A;  3BKF A;  2IVF B;  3OJS A;  1RT4 B;  3DMJ B;  2ZWO A;  1RA6 A;  5B0E A;  1X4G A;  3SIP B;  2WSF C;  3I5C A;  1WHW A;  2KYZ A;  1YG0 A;  3B8H A;  2VG7 A;  2C3P A;  3OL9 A;  2VQF F;  4WTY A;  5LXY A;  2J6U A;  2HVH A;  2IDE A;  2AGP A;  4D3G A;  4B9U A;  2CYY A;  4RU2 A;  4GRS A;  2XYH B;  4QW9 A;  1SQG A;  2ZUG A;  3QZ7 A;  2PA3 A;  4PCQ A;  2FQQ B;  2Q43 A;  4NI2 B;  2F8E X;  1UW9 A;  3FCV A;  4XIU A;  3BN7 A;  3FK4 A;  2RDI A;  2RH3 A;  1C4C A;  1DTQ A;  2ZH2 A;  2AJ0 A;  2VDI A;  3CB4 A;  5GAD U;  2HPU A;  1T9T A;  2IVY A;  4A8O A;  2DKO B;  4MIA A;  1VLO A;  5GAD I;  4B3R J;  4ZCK A;  2CDQ A;  4NLY A;  1R8H A;  1O8B A;  3G6Y A;  4ILL A;  3TX8 A;  3MM8 A;  4KGZ B;  1YBU A;  1QSY A;  2XG8 A;  2BBE A;  2YXL A;  1JB0 C;  1RJJ A;  3MTK A;  1Q5V A;  3CJ2 A;  3TO8 A;  3D6M B;  3QRP A;  2VC1 A;  1CG2 A;  4PG7 A;  2ZOF A;  1NZ8 A;  5IOL A;  1D8Z A;  3DDN A;  1H2V Z;  1WI8 A;  2LA4 A;  3MAA B;  4ZCL A;  5LMU F;  2KT3 A;  1RHJ B;  4DQS A;  3CNQ P;  2C22 A;  1JX4 A;  2GGP A;  1ZTT A;  2ZH3 A;  4LT6 A;  4ECT A;  1U8S A;  3RBZ A;  5K14 A;  2FHJ A;  1RAB B;  3H25 A;  2AD9 A;  3BR9 A;  2CPX A;  1RQ0 A;  4UQT A;  2ZBP A;  2D74 B;  4QWB A;  2V2V A;  4EGL A;  4F3M A;  3BB5 A;  1FKO B;  2YWE A;  1M5H A;  7FD1 A;  4UW2 A;  3MR3 A;  1YDL A;  3VTI A;  1B4S A;  3UQS A;  5D4N A;  3MPY A;  2DY1 A;  1WTF A;  2IY5 B;  1BQN A;  3W65 A;  2O3D A;  3KG4 A;  3IRW P;  1K47 A;  1S6P A;  3TEH B;  3ISZ A;  1VQ9 S;  3OLB A;  4M63 A;  4UTG A;  1VDH A;  1S9G B;  4YB7 A;  3CMA S;  4HEA 9;  3SSQ A;  5THW A;  3D5M A;  4ES3 A;  1XNQ F;  3L95 X;  2CIM A;  1BWE A;  4WXO A;  5I42 B;  2VD3 A;  4CTA A;  2MZQ A;  2HGM A;  4IQM A;  1YJT A;  3MCO A;  5A2Q Y;  3HVR A;  3KLI A;  5E7O B;  1FXD A;  3PJX A;  2DNP A;  2I38 A;  3H2L A;  4ILM A;  4K59 A;  1YRU A;  4JYA F;  2CNN B;  5IC4 B;  4DS5 A;  3PZP A;  3TUI C;  2BE2 A;  3I5A A;  4OL8 A;  2C2Z B;  4X4O A;  2W9C A;  3JSM A;  4CYU A;  2BRK A;  2EFQ A;  4B3S F;  4PUO B;  1N34 F;  7AT1 B;  2F4V F;  5AJ3 F;  1UP1 A;  3MZI A;  2KFN A;  2OTL S;  5E3C A;  2ZH6 A;  2WON B;  3IWN C;  3ENA A;  2A2C A;  2YWH A;  4DHV A;  1FJG F;  3TAM B;  2N3O A;  2R8G A;  2HND B;  3RAQ A;  1CC7 A;  2LCW A;  1KQS R;  3ZTS A;  3E51 A;  3LP0 A;  3UR3 C;  5G0R B;  3G2X A;  2XCP A;  4DV3 J;  1RBO B;  3FCH A;  4PYD A;  3BQ1 A;  5A6P A;  4CT9 A;  1H7X A;  1JNZ B;  1KVJ A;  3FEZ A;  2FY8 A;  2DIU A;  1TFW A;  3ITH A;  3VZI A;  3KNG A;  1QAY A;  4KPC A;  1NK6 A;  1XMO J;  3BV8 A;  4LSN B;  4Y28 C;  5KT2 A;  3FFI B;  1LW2 A;  3VQT A;  2COL A;  1RT5 A;  3AQO A;  3O3L A;  4DL7 A;  4ZN1 A;  5KFW A;  5CYQ B;  5ITH A;  2Q6C A;  2B6A B;  2FLL A;  3A1Y G;  3RB4 A;  3M8S A;  3GIM A;  3MR2 A;  3SQG A;  3SFU A;  4A8W A;  2K3I A;  3A3O B;  2Y1I A;  4KKO A;  1RWO B;  3TAN A;  3FBB A;  1Z1Z A;  4JI4 F;  4CM2 A;  1S1V A;  4N56 A;  2GCF A;  5CAB A;  3PO4 A;  2R8H A;  1V9O A;  1U0H B;  2ACY A;  4OI3 A;  2XGP A;  2JLE A;  4HLB A;  3C6U B;  3IBW A;  2HHV A;  5KFG A;  1D9D A;  1HNX J;  2YH0 A;  3CW2 C;  3R7S B;  2HBR B;  3DC2 A;  2UVU A;  3VQS A;  3TA0 A;  4FPI A;  1U1L A;  3GP9 A;  2KZM A;  3HFV A;  3T5J A;  5IWA J;  4U96 A;  2BAC A;  4RJV A;  1NPR A;  3DCA A;  2W2M P;  1T9X A;  2BKP A;  4FXW A;  2PD1 A;  1NJZ A;  1RAD B;  4FDF A;  4YUD A;  3D9B A;  3QJJ A;  1IBC B;  3M8W A;  1EB0 A;  2OIH A;  3QZ8 A;  2WCX A;  2V63 A;  4LF4 J;  1T03 B;  3G6E S;  1HNZ F;  4OYW A;  2XMW A;  3C6T A;  3W8G A;  4LRF A;  2IFX A;  3QBC A;  4WYL A;  4LFA F;  4RNM A;  4B9M A;  3CT9 A;  1M5O C;  5KFA A;  2VG5 B;  4F67 A;  1PIE A;  2CPI A;  5C24 A;  1KLN A;  3LGN A;  1WHV A;  4DSI A;  1HFE L;  4XDD A;  3UD4 P;  1RAI B;  1KSP A;  1RTD B;  3UDL A;  2LA6 A;  1VQM S;  2VPX B;  5DQI A;  1TUG B;  1BC6 A;  2WVF A;  2YQ3 A;  2J76 E;  3GMG A;  4DPW A;  1C1C A;  2AIR B;  4NRU A;  1SH2 A;  2RUS A;  4ZVU B;  1RU2 A;  5J2M A;  3C2P A;  3RR8 A;  3HD2 A;  2ZVS A;  2CQ4 A;  1HNI A;  3PJW A;  1Y00 A;  1VQ4 S;  4X84 A;  1FRJ A;  2V8V A;  1U1R A;  2EG1 A;  2Y1L B;  2ADC A;  4X64 F;  1RTH B;  2YPY A;  3I0R B;  3CCM S;  1TKZ B;  1AT1 B;  3BBB A;  5F41 A;  2RDD A;  2ASD A;  3UDC A;  4QPX A;  1M5P C;  1QVG R;  4FZV A;  5B09 A;  2OFG X;  2ZD1 B;  1P27 B;  3MCS A;  5J1E B;  1I94 F;  3KLH A;  3HT3 A;  1VRU B;  3HCX A;  1OO0 B;  3DLE A;  4CP5 A;  2M8D B;  4KIA A;  4NA1 A;  2I8E A;  2FTR A;  2VPY B;  2JEF A;  3M32 B;  2XQC A;  3MR6 A;  2XCA A;  1PBA A;  4PQU B;  1Q8L A;  2HZV A;  2LEC A;  3Q8U A;  3ENQ A;  3KKF A;  2QA1 A;  2FY1 A;  2ZEJ A;  4BC7 A;  3NKY A;  1RWP B;  2FLP A;  3FKB A;  4RW6 A;  2FVC A;  4TYA A;  2ZBQ A;  1MG7 A;  2MGZ B;  1HNW F;  4ZCM A;  3MM7 B;  1U02 A;  4G3I A;  2OKQ A;  4OJ1 A;  3AJD A;  2DR8 A;  3M9M B;  4H4O A;  2DPJ A;  3RR7 A;  4DX8 H;  3ULH A;  4GKK J;  2OH2 A;  1UJ4 A;  1YZ6 A;  3BYP A;  3TX0 A;  3QGH A;  1N5V A;  3NG8 A;  1SJ1 A;  3Q8S B;  4AT1 B;  1UPP A;  1CPZ A;  3TEG A;  4IH5 A;  1HBU B;  2DIV A;  4UST A;  1Y3K A;  4TU7 A;  1WEZ A;  5HBM B;  1B70 B;  1MN7 A;  1N6Q B;  2ZNZ A;  1ZAW A;  4UZB A;  4K0K F;  1T8E A;  3ENV A;  3RB3 A;  2HWH A;  4IOC Q;  2FC8 A;  2VG6 B;  3OBI A;  1HD0 A;  3RB6 A;  5HQ8 A;  2DHG A;  4DR6 J;  2W9B A;  3I6P A;  3MPU B;  2I6W A;  2FC9 A;  1TL7 A;  2JDJ A;  4RW4 A;  4NLO A;  2N4D A;  4C0B A;  3QO9 A;  3A3P B;  1Z4U A;  4UZC A;  4RNN A;  5C2G A;  2DGS A;  1G1X A;  2AT1 B;  3GE9 A;  3OHB A;  2VOP A;  2ASY A;  4M5D A;  2MB0 B;  1SH3 A;  3W61 A;  1IR0 A;  2IM1 A;  3IGN A;  2XZD B;  4J37 A;  4URG A;  1FT8 A;  1WKJ A;  4USK A;  4J9S A;  3GFH A;  4E98 A;  2Y9H A;  2VDH A;  1YIT S;  4PWU A;  4ALZ A;  2FYX A;  5FD1 A;  2DGW A;  5J2N A;  1WEY A;  2QEX S;  4ELV A;  4X4U A;  3MUR P;  2VFR A;  4OZ3 A;  3UCZ P;  3AB4 B;  1RWM B;  1X4D A;  4TQR A;  3QMQ A;  2KU7 A;  1K9M T;  4OZ5 A;  2I5J B;  1S1X B;  4B9N A;  3CDE A;  2IAJ B;  2ATL A;  1VRT A;  2MHN A;  3Q8Q B;  4PRF A;  1VBY A;  3W2W A;  5KFM A;  4EBD A;  4MMO A;  2ALY B;  2DRB A;  2P2C B;  2KL8 A;  5T41 A;  1WC5 A;  4WF9 Q;  2H4Y B;  4I67 A;  3DLK A;  5GVQ A;  3CWJ A;  4ZPC A;  1NPK A;  3UN2 A;  4X66 J;  3ENW A;  2R7S A;  1S97 A;  4B3M F;  3CIM A;  2W8L A;  4KRW A;  5AXK A;  2MZR A;  1SXL A;  3C3L A;  1ZH5 A;  4OIX A;  2R7O A;  1HWJ A;  1Y5L B;  4MKV A;  2GIR A;  1S9E A;  3M7V A;  3GFY A;  1JXV A;  3PIP Q;  4DSF A;  3HT0 A;  3WX4 A;  5EWF A;  2JEJ A;  2XYP B;  3Q8P B;  4DR1 J;  3MUT P;  2QMW A;  1AZS A;  1UVJ A;  2HK2 A;  4ECS A;  2UP1 A;  1JXL A;  1S99 A;  5F8J A;  1LXN A;  5DG7 A;  2CQD A;  2IA0 A;  2DJW A;  4OYB A;  4NXM F;  2QTW A;  1YJU A;  3W66 A;  1RHK B;  1U4B A;  1FXR A;  5EX3 A;  4A8F A;  4NCB A;  1F2H A;  5A76 A;  3W9I A;  3RBD A;  3EIC A;  4CLS A;  5JMN A;  1SV5 A;  1VJQ A;  4DV0 J;  3TOQ A;  3PCO B;  2JC1 A;  2BQR A;  2J8A A;  3WC2 A;  3SYZ A;  5RUB A;  2V5H G;  2HVI A;  2YWK A;  1DTT B;  1RT7 A;  3R9L A;  1X4F A;  2M9K A;  4ZHR B;  2QMX A;  3FSX A;  1UZH A;  4OYZ A;  2UXC F;  3C16 B;  1QD1 A;  3KXD A;  1UVN A;  4F02 A;  1HKA A;  1F9F A;  4LUB A;  3M05 A;  4K50 A;  1UJ5 A;  3SV4 A;  1WG5 A;  2ZM6 F;  1KOO A;  1ULR A;  4GVB A;  2HFN A;  3HSZ A;  4J9P A;  4X62 J;  2E1M C;  1QAX A;  3C66 A;  3GJR B;  4NLT A;  1R0A B;  1KVI A;  3PYF A;  1RIS A;  3NBP B;  3W7B A;  4YN3 B;  2RIJ A;  3NCR A;  1S4F A;  4DUZ F;  1YI2 S;  3I82 A;  4JI1 F;  1EX8 A;  4FNH A;  2OPS A;  2WVD A;  5KFS A;  2KHD A;  4HTI A;  1CJK A;  4NYO A;  1RT1 B;  1KON A;  5KG0 A;  1HWU A;  1P1L A;  4Y0F A;  3PKM A;  5K8N A;  2RF2 A;  2HHS A;  2DXE A;  2OLW A;  2V8P A;  1UA0 A;  1YJ7 A;  2OJ3 A;  3OTO F;  2V8G A;  1RAA B;  1QE1 B;  4EBC A;  2QL7 B;  1RT6 B;  3QAE A;  3QID A;  2X1G A;  3QGP A;  1UWB B;  5ETN A;  1N88 A;  2L41 A;  5LMN F;  3VZH A;  8ATC B;  5BYR A;  4IDK A;  4JI2 F;  2H3E B;  4ZMM A;  4A4J A;  1RTI A;  1K44 A;  1JKH B;  1CS4 A;  3IC1 A;  3E2E A;  2XY7 A;  2OPP A;  1DRZ A;  4YOE A;  1IBK F;  2VJV A;  3V4M A;  5D78 A;  2V4J A;  2HWT A;  3UR0 A;  5L8R C;  4CCH A;  3ZTQ A;  3M1V A;  2A2D A;  2OPR B;  2DGO A;  3CCE S;  4LR8 A;  3LAL A;  1N8R T;  2MEW A;  5IC6 B;  3J80 Y;  2YVS A;  4LF6 F;  1WJ9 A;  5A0Y B;  4C6A A;  3LTO A;  1XN9 A;  4R25 A;  4IUF A;  2DH9 A;  3POT A;  1TQL A;  4DV6 J;  4CH7 A;  2W7A A;  1BD6 A;  4MK7 A;  3QGG A;  4USV A;  2FHO B;  3CJK B;  1W25 A;  2IIH A;  3IR7 B;  2FIU A;  4FKY A;  2HYI B;  1TVR B;  2BJE A;  1MML A;  3FEX B;  2VFS A;  3PNI A;  5DM7 Q;  1DAX A;  5I3U B;  1T11 A;  3AAW B;  1N0V C;  3KHG A;  5EWE A;  4A8M P;  1W2I A;  4OI4 A;  5HJY A;  4C11 B;  2Z56 B;  2MZ1 A;  4OZ0 A;  1DFD A;  3RYL A;  4F36 A;  4B3T J;  3HVW A;  4Y3C A;  2Z0G A;  3MEC A;  1LWC A;  1P1T A;  2P6S A;  3PO5 A;  2OML A;  3KUH A;  3GQC A;  2PSZ A;  2DH7 A;  2YQ0 A;  2DHX A;  4W98 A;  3HVT A;  1MMN A;  3QAT A;  2ZH4 A;  1C0T A;  4YB6 A;  1PBU A;  1HWL A;  1DTQ B;  2A6M A;  2RE1 A;  4HT5 A;  4WYW A;  2QRR A;  4X2B A;  1U48 A;  3D0I E;  3D0H E;  1K8A T;  3CUN A;  2UZA A;  1G6B A;  1MWZ A;  5CZX A;  3EDR B;  2MY7 A;  2OD6 A;  3AD7 C;  1MLA A;  3HX9 A;  2OEJ A;  3DI6 A;  4LVO P;  4NA3 A;  1HBN A;  2GNK A;  1Y0H A;  4TU8 A;  1VBZ A;  5IT9 Y;  3DXB A;  1Y9O A;  3U7J A;  4Q5V A;  2XY6 A;  5BR8 F;  1RWN B;  3TP2 A;  2W7P A;  3QQC D;  3CD7 A;  5E33 A;  2FB0 A;  4F0H A;  4ED0 A;  1RCO B;  1R89 A;  5CHC B;  2CQC A;  5K14 B;  4CLY A;  2NPI A;  2ILY A;  3RGI A;  2MLY A;  2D1C A;  4YDX A;  4ED5 A;  3MM6 A;  2DR9 A;  3FBC A;  2GJ2 A;  4CLF A;  2U2F A;  2XNQ A;  3GV8 B;  1HQE A;  3NCQ A;  3UW1 A;  2ZH7 A;  4JI5 F;  4ZK7 M;  3FUY A;  4P10 A;  1KR4 A;  2ZIT A;  5HMZ A;  1N32 F;  1ACM B;  2VU5 A;  1UL3 A;  2NXU A;  2E5H A;  3MAQ A;  1LW0 A;  1S6P B;  1H73 A;  4C0O C;  2CZ9 A;  3E01 A;  4IQX A;  1LKZ A;  2OSR A;  4X4V A;  2ADB A;  1UVI A;  4X65 F;  2M0G B;  2QFI A;  1WF1 A;  4LRC A;  5J2Q B;  2MXY A;  3SZ2 A;  2N7C A;  1LK5 A;  1U1K A;  3PIO Q;  2NXE A;  4CTA B;  1GX6 A;  2G4B A;  4C8N A;  4EFA C;  3GLJ A;  3DYA A;  3LP1 B;  4ETX A;  2YKN A;  4PKD B;  3G8Q A;  2DXD A;  1S0V A;  4AQY F;  5L1K A;  4X4T A;  1XMQ F;  3N6M A;  1LV5 A;  1F9H A;  1L3S A;  2MKI A;  1MN9 A;  2Z2Y B;  3R5D A;  2BE2 B;  2BX6 A;  2W9C B;  4DUY F;  5A2Q U;  4UY8 5;  4CYU B;  3UD3 P;  2YQ1 A;  1H38 A;  3LGM A;  1MWQ A;  4MIW A;  4PEO A;  5KG3 A;  3V6D A;  1FEH A;  4IO9 Q;  1GXT A;  4ED8 A;  1S6Q B;  4DPY A;  4DV4 J;  2Y3Y A;  1VMB A;  3T1H F;  2YX1 A;  2ZH1 A;  1RT4 A;  2I2Y A;  2QLF B;  3DMJ A;  1TL3 A;  3TNV A;  4ILR A;  1UW4 A;  2FLO A;  5J2P A;  2AZ1 A;  4WE1 A;  4RBV A;  4DU8 A;  1NJI T;  2IM3 A;  3W3S A;  3CJ0 A;  1X4C A;  1UMJ A;  2MQL A;  1F6T A;  1WOP A;  1FKP A;  4CO1 A;  4Y6I A;  2E5I A;  4AD6 A;  5CXT A;  2DGQ A;  3I31 A;  1VS3 A;  4P75 A;  2NYI A;  2LP4 A;  1J5E F;  4NI2 A;  2CVE A;  3PDN A;  4MKA A;  4CLZ A;  2DGU A;  1ZA1 B;  2RRA A;  2QGF B;  1X8D A;  1UEK A;  4RW8 A;  3KFW X;  4IH7 A;  3J7A 1;  4UT4 A;  3ITH B;  1XJW B;  1GK8 A;  4PG4 A;  3ZZY A;  1CJU A;  3CJ5 A;  2FJE B;  3PM9 A;  1VK8 A;  1FFS B;  2JC0 A;  2V2Z A;  3AD9 C;  3MMC A;  2LQ8 A;  1WG4 A;  4B08 A;  1J5O A;  1IQT A;  5C2C A;  2CUY A;  4J5O A;  5SUH A;  4HH0 A;  3CD0 A;  1RXO B;  3SQG B;  3VAH A;  1FWP A;  4ZVT B;  2C1E B;  2J9D E;  4K7Q A;  2LEA A;  1SIZ A;  3MWB A;  4ED6 A;  5F8I A;  3TAR A;  4KKO B;  4KR0 B;  2AGQ A;  5IT4 A;  5H1S V;  1S1V B;  2DNM A;  5KFE A;  3MAA A;  5IQQ A;  1RSC A;  1IVZ A;  4DX7 A;  1RT3 A;  1EKR A;  2MLX A;  3MUM P;  4GMK A;  4ZVE A;  2HEK A;  1KOH A;  4ZVF A;  3QYY A;  3JQJ A;  1CBK A;  4CH0 S;  2ZVI A;  2R2S A;  3K8W A;  1PYT A;  4M5N A;  4WZQ A;  2GVZ B;  3OVA A;  2HHT A;  2DBB A;  2X7I A;  2BJD A;  1VHI A;  3SCJ E;  4LIR A;  3F44 A;  3H4B A;  3IR6 B;  4B9V A;  3EJM A;  2E9T A;  2BJ1 A;  1ZM2 A;  1UZD A;  1SL0 A;  2XUL A;  3GIK A;  2ZJR Q;  2Y8W A;  2V0N A;  2CQG A;  4EYI B;  4TYB A;  3PG9 A;  3U1N A;  1KTQ A;  2B7C B;  4MTP A;  1F60 B;  1RKJ A;  4WK1 A;  3T6B A;  1S9G A;  3UNG C;  1VQ5 S;  4JI0 F;  2GIQ A;  2F9D A;  3QJP A;  3U27 A;  1UA1 A;  3MD3 A;  1K0V A;  3SCK E;  2DK2 A;  2BW2 A;  4YB1 P;  4FS2 A;  5I42 A;  1RWK B;  1X5O A;  1K73 T;  3C6T B;  4WXW A;  1B0T A;  3K2Y A;  2VOD A; 
#chains in the Genus database with same CATH homology
 5HSP A;  3H90 A;  3BYR A;  3W62 A;  3W66 A;  3W65 A;  3W61 A;  2ZZT A;  3W8P A;  3W8G A;  3W5X A;  3W5Z A;  3W64 A;  3W60 A;  3BYP A;  3W5Y A;  3W63 A;  2QFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...