2V5HG

Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLGLUTAMATE KINASE
publication title The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 22
structure length 111
sequence length 111
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2007-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v5hG00
4Y6IA 1V9OA 2GNKA 3BZQA 2DCLA 3X3UA 5D4PA 5L9NA 2GX8A 1J2VA 3T9ZA 3AA8A 4CO1A 1P1LA 4CNZA 2NUUG 2ZFHA 4D3GA 4Y65A 2V5HG 4USJC 4AFFA 1PILA 1UFLA 4YB5A 1NZAA 4D3HA 3AHPA 3LF0A 4YB6A 4CO2A 3TA0A 4CNYA 4CO3A 1NAQA 1UL3A 1Q1KA 2ZOMA 3O8WA 2EG1A 2O67A 3TA1A 1XK8A 3TA2A 4ZK7M 1VHFA 2Z0GA 3L7PA 1O51A 3MHYA 4R25A 4C3LA 4WK3A 2GW8A 4RWXA 5D4LA 4RWWA 1OSCA 3AH6A 3NCRA 2O66A 2E66A 2NS1B 1V6HA 2RD5C 1UKUA 4RX6A 3DFEA 3N5BA 4WK1A 2J9CA 1NH7A 1HWUA 2J9DA 2CZ4A 4CO5A 2XZWA 4IYQA 5DS7A 5D4NA 4C3MA 2XBPA 4YB7A 3NCQA 2JJ4D 1VFJA 4USHA 2NUHA 1H3DA 4USIA 2VD3A 1V3SA 4OZJA 1NH8A 2EG2A 3M05A 4OZLA 4CO0A 1QY7A 1UMJA 4C3KA 1O5JA 4CO4A 4RLEA 2J9EA 2XG8A 5DRKA 1GNKA 4NYPA 4OZNA 3NCPA 3O5TB 3OPKA 3CE8A 1V3RA 4E98A 2J9DE 1KR4A 3GSDA 5D4OA 2XULA 3AA9A 3HLUA 4NYOA 2PIIA
chains in the Genus database with same CATH superfamily
1T9XA 1SJQA 1REGX 2DO0A 2OKQA 1JLEA 3WC0A 2CPHA 1SQGA 3M6UA 4JV2A 4PUOB 2ALYB 2E7VA 4WCEQ 4QIWD 3NRBA 1M1KT 1WC6A 2EG1A 1ZYQA 3JSMA 4NRUA 4U96A 3HHKA 2HSEB 2KN4A 5T7LA 4CYUA 2IAJA 3M9MB 4WFXA 4MFBB 4YHHF 3OUYB 1RT3A 4USUA 3TRGA 3UE2A 3W2WA 1S9GB 4EMDA 2LEBA 2OLWA 1OPZA 2QA4S 1S77D 2GO9A 2NYHA 4C98A 2LMIA 3PKYA 4IRCA 2QIFA 2KG0A 2LQ8A 2D69A 2VASA 1UWBB 2DIUA 4B3TF 2KZMA 1YRXA 2ZWOA 4KR0B 2Q79A 4GKJJ 2J8SA 2L41A 2H1YA 4DQRA 2UUTA 3FRYA 2HS0A 1RTIA 1U26A 2KHCA 4CO0A 2YPZA 2R42A 1JQGA 1V5VA 1U45A 1SQEA 3CCJS 3BPSP 1Y11A 3QGGA 4NLPA 5I42A 4ZVTB 3K59A 1DJ0A 2CPJA 3TZZA 4Y6IA 2ROEA 3N01A 2QMXA 3DRPB 3BYPA 2ZDPA 1S4EA 3A4TA 1YGYA 3AA8A 2BVZA 1NJXA 1K47A 4XAKA 1OQ6A 1VBKA 1RWWB 4B9LA 1JXEA 1JMTA 3JTNA 1RQ0A 1WG5A 3D0HE 2ZZNA 2IIHA 2WSEC 1R31A 1DY3A 4A8YA 1R8BA 1G1XA 1X4BA 5D78A 2C2ZB 5CAAA 3M1VB 2IRUA 4PXCA 2HURA 2W25A 4K0KF 1U2RA 3HX9A 2IM1A 3K5PA 4C97A 2WTFA 2V2VA 3NCQA 4B08A 1KOOA 2FVSA 3VAMA 2VG5A 2J5AA 3BH7B 4OZ0A 3KLGB 2VD3A 3NGRA 3EPIA 1BD6A 4N41A 4YFUA 4NWBA 1AROP 3FMBA 2RH3A 4NYPA 1DFDA 2HEKA 1GMVA 3FCWA 2HHUA 4WP3A 3N6MA 4EYIB 4WFZA 3TX0A 3NEKA 2DXEA 1QE1B 2GFFA 1U1RA 5B0BA 1VRTB 4N8NA 5CA5A 5HMWA 2X3DA 2PMZD 3RBDA 2BKPA 1NJYA 4NMXA 2ZHBA 4PWUA 1WF2A 2DNQA 2RF2B 2RS2A 2O5DA 2C3OA 3O2IA 2GA7A 4USTA 4DSIA 3ENAA 1GMUA 4DXLA 3V81B 3MDFA 3PCOB 1JLQB 1ZTTA 2VOOA 1WSRA 2VFVA 2F4FA 3MR7A 2CPDA 5A8KB 3DC2A 3G6ES 3M4XA 1M1HA 3C6UA 4DV4J 3CULA 2EEYA 3FDSA 4H54A 4WWSA 1KQSR 1PAUB 4OJ1A 1HQUB 5AJ3J 2IVFB 1UEVA 4WE1B 5K8PA 3CCZA 3RRKA 2AIRB 1AUDA 3MCNA 3TARA 1NPPA 3NBPA 3VALA 1SC4B 7AT1B 3W5XA 3SV4A 3SZ2A 4OHXA 3IAM9 3R6GB 2LU1A 1S59A 3POTA 1I51B 5DG7A 3CDUA 3EMTA 3KYLA 3NG8A 5K20B 1S1WB 3KUEA 2DPIA 3W9IA 1FKAF 3W61A 3OTOJ 2BOAA 3PHTA 4X66J 2EFQA 1VGYA 3V4IB 3MMBA 4OYMA 2RQMA 2Z2ZA 3OVBA 2LXUA 3KHGA 3M6VA 1N88A 3GV8B 3E51A 1NDKA 5KG3A 1UFKA 2BA9A 2YQ0A 4B02A 1S1VB 1YJVA 1ICEB 4CP5A 2IDLA 2AWZA 4P9SA 4K4SA 3CCWA 1GAOA 3VQTA 3OL9A 2CPEA 3LOUA 2H51B 3NS5A 4DUZJ 5U47A 3FK4A 2YNGA 1H74A 4KRWA 3D4JA 4QU7A 1UW9A 4DR3J 4J9OA 1GXTA 5D4OA 1N4LA 2KZZA 1F3VA 2Z58B 3CVKA 3S6EA 1J27A 5KFCA 4F50A 5KG5A 3ILLA 5F3ZA 1VJQA 2ZFHA 4QW9A 1N34J 3ZNJ1 2HMIA 3CD0A 4TY9A 2K3KA 3IAS9 3R97A 1HNXF 1YJNS 4YY3J 3DLKB 3ADAC 5CCMA 2GHWA 1OSDA 2W9BA 4GVLA 2R7QA 1X9WA 3G8TA 4PCQA 2KH9A 4OHWA 2V6AA 2HHXA 5D0RA 3TZYA 3D28A 4WPAA 5KFVA 3GIRA 2WVEA 4X64J 3ISZA 4F4ZA 4Q0BA 2DR7A 2HLUA 1LV5A 4KPYA 2AJQA 2QLBB 2QLWA 2J0XA 2XYGB 4GO5X 5A76A 2VFSA 3B54A 3TANA 1VC5A 1Q8IA 2PFDA 4OZ5A 2G13A 3R1LA 2D7SA 4DV6F 1CULA 4F02A 1MROA 3CJ5A 2MQNA 3MM9B 4WBFA 5KFZA 4RW8A 8RUCA 3UCGA 4ECTA 3QAEA 4YB5A 1UVKA 2G0CA 2UUCF 3W8PA 3RB3A 3CJ3A 4OI2A 5DGAA 3UCZP 4ECVA 1EARA 4BWJA 1BLUA 3MR2A 4J9MA 4LVOP 1R0AB 2G1HA 4Y3CA 3BDEA 4CH0S 2AEFA 1S0MA 2G2ZA 3PW4A 4ILLA 4Y2KA 5DDPC 3BJYA 1RAIB 4AQYJ 3DHWC 5HMZA 2V8DA 3PYGA 2VG6B 2R8KA 3MAAA 4EYHB 1GX5A 5DG9A 4WZQA 4Q43A 1Q16B 2Y8YA 1TV6A 1UFWA 2R8HA 4NCAA 1PSDA 3PO5A 1F9FA 3CDWA 2L9WA 3G82A 1RYRA 2RVJA 2XCAA 2B4PA 4H4MA 4I2QB 2V8HA 4PG5A 5KFKA 2MZSA 3J81j 2XI3A 2CFXA 4ENOA 2HNYB 2AT1B 4C8MA 4N5SA 1X4EA 4P74A 2W8KA 3GG0A 1JJCB 2E1AA 2VDHA 4TNOA 1M5KC 4O44B 4M5GA 3IM9A 3PW0A 5HL7Q 2BE2B 2RSQA 3VTIA 2KRBA 1F2HA 4JI7F 2AJ2A 2R3VA 1Y3JA 5SZTA 3SYZA 3CCSS 3KLHA 3TNVA 2DGTA 1XR5A 1BY9A 3PX6A 4MTPA 2GMHA 1F1BB 3A13A 3OFGA 2FJXA 3DGPA 1VC6A 2DH9A 2ZOFA 4F67A 3F73A 2B3TB 1LQ9A 3KLFA 2DY9A 3GIMA 1FFSB 2HVIA 2C2RA 2MKCA 2GVZB 3IWXA 1SC1B 1X4HA 1WHWA 4KC5A 2KI2A 3L7UA 3J7YU 4WP9A 2J0QD 4USWA 2O3DA 4NI2B 2FLPA 3SXLA 4F0MA 5E2QA 2JH3A 4JV1A 1Y4ZB 5KOWA 2L9NA 3KUGA 3O5TB 2NPFA 3MPVA 5ETNA 3C6TA 1CG2A 2QZ8A 4A8FA 5L8RC 3LGNA 2ZZMA 3NS6A 4MIWA 2E7XA 2HZCA 5CABA 1JIHA 1NEEA 1J5EF 2I1RA 1U0HB 5KFDA 2XSJA 1HIYA 2XWXA 1ZOTA 2AZ3A 4OZ3A 3EJMA 4K8RA 4PPDA 3O8WA 3RR7A 2MGZA 4LFCJ 2UVWA 1JXVA 3K5LA 2FHJD 1N32F 2JEFA 4JI5F 4NLUA 2ERRA 2UU9F 3P5TL 5K8MA 4B9UA 1S0NA 2PEHA 2QYCA 1CJKB 3B4MA 4ETZA 1FHTA 2H65B 3RB6A 5DM7Q 2QTWA 1E6YA 3IP0A 2IM2A 2ZM6J 4PKDB 3HKWA 5KG1A 3M2RB 2BW2A 4L74A 1RSCA 1WC0A 2NPIA 3HLUA 3LUYA 1V3ZA 4QW8A 3EXYA 4ZHRA 5KFHA 2VF3A 1SI9A 3O6QA 2QO3A 5FDLA 3HVAA 2APOA 3FQKA 4MYTA 1P1LA 4O3RA 2FHMA 1ZM2A 1BUXA 4KB7A 1IBLJ 4RR5A 5IWAJ 2ADCA 2CIMA 2RILA 3T5JA 3LANA 2M9KA 2BR0A 1F9HA 1E6VA 3GG1A 1X4CA 4ZPCA 1H2VZ 3LA0A 1S6QB 3MM8B 3MPYA 4A8SA 1Y00A 2DXFA 1P8GA 4JOUA 5KG7A 2MHNA 4F25A 3M2VB 1CJUA 3E3XA 2AMCB 2FY8A 2GJ2A 4KH0B 4BS2A 1N36F 3OT9A 4ZVUB 5KFIA 3PIOQ 1NB7A 4X4OA 2K2PA 3UVJA 2GAGC 2ZVSA 2UXBJ 1RT6B 5DLGA 5L39A 1NK4A 1GT8A 5AT1B 2IHR1 2ZEJA 3SIPB 1U8WA 3WIUA 3MTJA 4CLKA 2E7WA 4QWBA 3AY0A 4X65J 4ZIWA 3S8SA 2V94A 4LRFA 1V3RA 3H25A 4WXWA 5SUHA 2R2TA 1SJ4P 2AJ4A 3FSIA 2CQCA 3ZZUA 1SB6A 3KXDA 4J37A 3PXGa 1KLMA 1XNRF 1WKLA 2JVOA 4LF8J 3IG1B 4HT5A 4ZPBA 2Q43A 3PRDA 3QLHA 2ZNYA 4F04B 1IQZA 3EDRB 1S1XB 3SFUA 3H2VE 3H98A 1JKHB 2RRBA 1AT1B 2HG4A 4LRDA 1HBUB 2W2NP 2WOMA 3MMAA 4LQ9A 3NCRA 5AJ3F 2QEXS 2FHKA 1HBNA 4GKKF 3D54A 1PBAA 1I3OB 4BBYA 4R8UA 3TAPA 4IDKB 1S1TB 3H5YA 3R6LB 1TR0A 2EFNA 1H2UX 5ADZA 3R27A 3KJQB 3VAIA 3M32B 4UY8T 4RW4B 3D6HB 2HRTA 3IS9A 1PGZA 2CDRB 5KFXA 3J80Y 1RADB 2HK2A 3EZUA 2KDOA 4P10A 4MAKA 3KHRA 4EBEA 3QFHA 2MQPA 1AZSA 4ED7A 2YTCA 1H7WA 3KFWX 4X2BA 3H7HB 3I0SB 5J1EB 2JVRA 2RT3A 4TQRA 2XLKA 5CYMB 4UZCA 2F63A 3IMQJ 1SCJB 3GLJA 1UTAA 3IRXA 4QWDA 3TWZA 2HHWA 3IBCB 3HZEA 1B64A 2VDIA 3DLEA 4ZLPA 3VZHA 1VQSA 2GAHC 3TA2A 2YH1A 2MZJA 1TKXA 2ZC4A 4CLFA 4ZVOB 2VKRA 5HROB 2RD5C 4OLOA 3M30B 3X1LB 2K1RB 1NH7A 2BX6A 1FERA 1R89A 4URGA 4PWDB 1PBUA 4WXOA 1RTJA 2J7WA 2HGLA 1WI6A 2IAJB 1TL3B 2RKIB 2V68A 5IV3A 1RI7A 1Y10A 2HFOA 1AYEA 1Z1ZA 4NOHA 2VG7B 5KAKA 2MLZA 4OZ1A 4DR5F 4XDCA 2BM1A 2MXYA 4ICLA 1WC1A 5K14A 2ASLA 4FZVA 4RPFA 3KNGA 2LEAA 1NK8A 3VVUA 1L3KA 3P6YC 4YQWA 2OIHA 3H5UA 1WEXA 4KV8B 2CJXB 2XLJA 1VQ9S 4NASA 3QO9A 2FD2A 1XMQJ 1FVSA 4N8OA 5E3QA 1U6BA 3TAMA 4OIXA 3KJVB 5CD4H 3SDEB 3OR2A 1N48A 1MN7A 1ULRA 3MHYA 3ELHA 1QSYA 1VQ5S 1UA0A 2DGVA 2AGPA 3CCLS 2OP5A 2RQCA 1YK9A 1YTYA 1EP4A 3OXGA 1S9EA 3MEKA 3HT0A 3CWJA 1R3NA 3IO1A 5L38A 2RRAA 3MCSA 4ID5B 5L1JA 3UDCA 3K89A 4DSFA 5KFNA 2RJZA 4DR1F 4ZKAA 1SC3B 3QWPA 4USIA 5K8NA 5CYQB 1FEHA 3PM9A 4XIUA 1WEZA 4LF7J 2W9AA 1CJVA 2B9EA 4ECRA 2VG5B 1DLOB 4W92B 3NP5A 4DPXA 3VQSA 2ZJQQ 3MECA 2UVRA 3T1YF 5HBMA 1XWLA 1MMLA 3EZ5A 2G4BA 3EGWB 2N7CA 4DFJA 3NNCA 2LCWA 3HHLD 4ZVGA 4CDIA 4D3GA 1OIAA 4URQU 4J9RA 1TK0A 1URNA 3BQ0A 2XS5A 2CVEA 5GAEU 2AKWB 3U1NA 4FF1A 3W64A 3QZ8A 3Q8QB 3CCES 1DRZA 5GAHU 1TL4A 4H4OB 4N7TA 3LP2A 2VJUA 4HHUA 3UNGC 1IBKF 5D4LA 3JSRA 5LSLA 1NM2A 1U2CA 1VQYA 3ZTQA 1VR6A 1XNQF 4FXWA 3KWMA 1HBMB 5KFLA 4CTAB 4LRCA 4WTYA 2CWKA 1Q7LB 2JEIA 1U09A 1HYSB 3ZFVA 3OTDA 2IVMA 4DL4A 2KXHA 5DDQC 4OYZA 5AXNA 4WKRA 1EJ7L 2CKWA 4PG7A 2QL9B 1NJIT 3T5LA 4F36A 4JP8A 3C6UB 3NGDA 3N6NA 4ECUA 1APSA 3E01B 1FK9B 2PO4A 3N9UC 1FKOA 1TUGB 2Y8WA 1RWMB 1SV5B 2JEJA 1YIJS 1LFPA 2B56A 3A3NB 1CLFA 2HHTA 2V4JB 4Y2IA 4B3SF 4DPTA 1GXLA 1QM9A 2ASDA 4DU7A 3NBPB 3KK3B 3TUPA 3GIIA 1AA1B 1UCNA 4EWTA 2WSFC 4TN2A 4ATNA 1Q8BA 1NRKA 1REVA 3M8PA 3HCXA 2MJUA 4DFPA 4MKBA 5D8HB 1W2IA 3DFEA 4KGXB 4DLGA 5FIIA 2R2UA 1XJWB 5KFPA 3DMJA 3TQEA 4EEYA 3HSDA 2W2PP 4QPTA 3W8GA 3D0GE 5I3UB 1HHSA 2OPPA 2QV6A 1V3SA 5F8NA 3SQOP 3DOKB 1FRMA 1WWHA 1S76D 5AXMA 1LWCB 3CIMA 2XS7A 1QSSA 2PIIA 3T3FA 3GB0A 2RQ4A 1HQEB 1EETB 1OWXA 3CJKA 3DXSX 3DM2B 1HFEL 2L3MA 2VBXA 3QJJA 1HNIB 3GIKA 5JVGQ 3M2UA 4DSLA 5LXYA 2R7OA 1W7WA 3Q8VA 1JLAA 1FD2A 2KJVA 2FYXA 3AB4B 3W5ZA 2E29A 2DNYA 4LR9A 2E5GA 1JNRB 1FX4A 1YVFA 1PYTA 2YNFB 3P49B 2OPSA 2VQEF 5DS7A 5GAGU 1X5TA 3L7OA 4ELUA 3S7RA 2W24A 1FO1A 3CCQS 1BE4A 3ZZRA 3JSBA 4DV2J 2XQCA 2LEPA 2OELA 5G0RA 2Y1RI 4I67A 1GNKA 4JI2F 2HLTA 3RTVA 1JLGB 2DHGA 2PT0A 3QATA 2XULA 3EZOA 5J2NA 8ATCB 4HH1A 2GGPB 3BZQA 1FWKA 2HNZA 3SCIE 3K2YA 2DRAA 2IC3B 2W01A 1KOHA 1RWKB 1AFIA 2BANB 4F3OA 4MH8A 3ZTSA 2UXDF 3H42A 2BJ3A 4CNYA 2WZ1A 2FZCB 1IBCB 1XQIA 3MOJB 1W2BR 2B9XA 4M5LA 4LF4J 1JNZB 4P72A 1RT1A 3VAHA 1QVFR 4BC9A 4UQTA 2MEWA 3ENVA 1KC8T 1B70B 2Y1JA 1W26A 3P96A 3C15B 1RABB 4OFZA 4JI1F 4LUBA 4K5SA 4NL5A 1TUWA 1FRXA 3SFGA 4EGLA 2IFXA 2CZ4A 3M8QB 3Q86A 2IRYA 2DD8S 2KXFA 3Q8PB 3DLGB 3EPGA 3UD5A 3QYYA 4WF9Q 4PQUB 4F4AA 2M8HA 1RAOA 4CLSA 1GXUA 2WVFA 3H2UB 4X4VA 2LXIA 3BGRB 2BZ2A 4DR7J 5JJBA 3PJXA 4W4MA 4LRAA 4P6QA 3JS9A 2BE7D 5HLFA 1T95A 2B51A 4PG8A 3BV8A 3OTEA 1S6PB 2UVVA 4KHPF 3ILOA 2R7WA 2PD1A 2QA1A 3M6XA 4MIBA 1IJFB 3FEXB 3U27A 2DPJA 3WHIA 2AJ1A 5LMNJ 2HKEA 2ZBIA 1VIOA 1UVJA 4HHHA 4DWIA 2A1BA 2Z2LA 4XK8C 3OLAA 3IRWP 3TUZC 3M8SA 1UJ6A 1OY6A 4HACB 5KFTA 3DLHA 3LAMA 1FJGJ 1DQAA 5RUBA 3TZWA 2FTRA 3MOZA 4JI3J 1R7IA 3MCMA 3KK2B 3GZ7A 3EGVA 2IM0A 3CDBA 3HHLA 3AQPA 1ACMB 2NQPA 1SXLA 3CD5A 5L1LA 5KG0A 3C16A 4CLUA 3MD3A 1IN0A 3MEDA 2PN6A 2RB7A 1I94J 2QLFB 5K5MA 1Z2ZA 5C25A 2IY5B 1FE0A 4X62J 4C11B 3CC2S 3MZIA 3BYRA 4K4YA 3ITHA 2BKNA 1S57A 2R7VA 5I4MA 4P7TA 1V9OA 1TFWA 4IFYA 2EPIA 4DDFA 1UJ4A 3IR7B 1VBYA 4TLRA 3EXCX 4DSKA 1KKHA 1NK7A 2VFTA 2JEGA 2CQ2A 2AD9A 1B3TA 2JC0A 4DEZA 1D8YA 2KO1A 4G1QB 3PHEA 1RA7A 2VA2A 1FEEA 1X7VA 3QSIA 3GCWP 2QC3A 2GQ2A 4WK1A 1WOPA 5BYQA 3HHDA 3DHXA 1VYAA 2DR8A 2C2OB 5A8RA 2OTLS 3T6JA 3LAKA 2HQ3A 1GX6A 4RL1A 2F5GA 2C3YA 2RQKA 3ZNUA 1DQ9A 4LQ3A 2XSFA 3MPDA 3V2UC 1LEOA 4C0BA 2CNLB 1TP7A 5J2MA 2DH8A 4DZ6A 2W1BA 1XMQF 3QAUA 4WJBA 6FD1A 2YKNA 1U4BA 3UN3A 4NLQA 4TQSA 3GJQB 3Q2TC 1G2EA 4NLSA 3BSOA 3M9NB 4NLGA 2V34A 1S48A 2M2BA 2ZKTA 1XMBA 4DU8A 2O1PA 1UVNA 4FF4A 4YUDA 1YRTA 4CO1A 5E3PA 4J9NA 1NDLA 1ROFA 1VRUA 5A2QU 2XNQA 1N33J 2C28A 4Q5VA 2NREA 1IR1A 5KFSA 1M5PC 2E5HA 3MAHA 3P8BB 3QIPB 4NXMF 2I8EA 4KO0A 3DRRA 3VHQA 2AP6A 3NWRA 2DGOA 2QLXA 3L3CA 3H5SA 3AH6A 4FF2A 1EKSA 4LSNB 3HI9A 2CQGA 3DOLB 2H48B 1FFWB 1OMSA 3DRXA 3LP0A 1R8PA 1IBMJ 4IQMA 1G4CA 2BBEA 2E44A 5HI7A 4ZN1A 5EWFA 4DQIA 3NNAA 2YQ1A 1BQMA 4IG0A 3CJ0A 3RW6A 1NZ8A 3D1HA 2NXEA 4C8ZA 1F2GA 5LT5A 3J81Y 3OL6A 3CD6S 3GSDA 1T02A 5IV4A 1RTDB 4OYOA 2QFJA 2WAQD 2W9CA 2D9PA 2FB0A 4FBTA 4C4WA 3T9ZA 2OPQB 3EYZA 2ZHAA 1KVKA 5ETTA 2DNPA 2HFUA 2YKPA 1KLMB 5C42A 5J1NA 4ZPTR 4YN3B 2AJFE 4W90B 4AD6A 3RG6A 1IUJA 4R25A 5KFUA 1LOUA 2AYMA 1M0SA 2L08A 2Q6BA 2QN6B 1FDDA 2ACYA 5KFMA 3NNHA 3QMQA 2XYHB 5F8JA 2GHVC 3KK1A 3CJSA 1AUSL 3MMAB 3W2VB 1WHXA 3D7SB 3UW1A 3CJRA 1R27B 1B7FA 3TJ9A 3SSSA 2ACMA 4RU2A 4AL7A 4XO0A 2A18A 2RDIA 2VQFJ 3EGZA 2QSWA 2HGNA 1S7HA 1KWMA 2ZOGA 1M90T 4I0WA 3HSJA 4NLXA 4DG1A 2W7OA 1IM6A 2ZH6A 3PW5A 1AB8A 2VC1A 1CC7A 1KVIA 2MB0B 4ZJOA 1T8EA 1HR0F 5LMUF 4M5KA 2CVIA 3RRGA 4ZK7M 1SJFA 3TVZA 2ZD1A 1X60A 3MTKA 3QFWA 5F9LA 4DFKA 3KG4A 5CZVA 3S1TA 2E66A 3FFIB 4C8OA 1RLCL 5DQIA 3KHLA 2B6AA 1PG5B 4WU3A 2ZWPA 4IFVA 3ET6A 4YHHJ 5A8WB 4AXJA 2AYBA 2HVEA 4UUWA 5H9EK 2ROPA 1ZBTA 2JJ4D 4MK8A 1NSKL 4B3TJ 4JI8J 1NUEA 4X4PA 1VHIA 2ZITA 4LF5F 4OJ3A 9RUBA 3CE8A 4OI1A 4ED6A 3HFVA 3UD3P 1N5SA 1J5OB 2H5EA 3DYAB 3MF5A 4I6AA 1F0XA 1FRHA 5KFBA 3GYGA 1YX2A 3CJTA 2BJ1A 4F8RA 1NJZA 2GCFA 3US5A 3SCJE 1U25A 3FJ2A 1T05A 4DL6A 2HBRB 2DNRA 5IS2A 2ROGA 2ZHOA 3M7VA 3I4HX 1ZETA 5ETSA 2W7AA 3EUNA 1HWLA 2OSRA 3FUYA 4ECZA 4QZVB 4ZPWR 3N79A 2Y1LB 3OD2A 1SL1A 1S79A 1UVLA 1DTTA 3OJUA 1Q8KA 3NKYA 4NCGA 2OFGX 2EFGA 1SJRA 1TL1A 2F8HA 4B3RF 2Z2YB 5D77A 3NLCA 1VLOA 3BGLA 4O3SA 4OLPA 4FVCA 4K0KJ 5D15A 2EWHA 2XMAA 2R9LA 4CM2A 4OX6A 3THVA 4Q7AA 4KGMA 1C1BA 3K5NA 1IKXB 5HANA 4RUHA 2RUGA 1WOSA 2KVQE 4R5PB 2UP1A 3T5KA 2FVCA 1Q53A 2AGQA 3N0VA 1NDCA 2YX1A 2I5JA 4QIFA 2GX8A 2HFNA 5F8GA 2Y3YA 1KFSA 4UT4A 4DI6A 4ANCA 2W4DA 1HD0A 4IG3B 4HDHA 3QPIA 3ZZPA 4I69A 3PJ9A 3IGVA 2KM8C 2QYGA 4LIRA 4C48A 2P6SA 1O51A 4DPWA 4I4BA 4NE9C 1JLFA 2F9DA 4TU8A 2GW8A 2Z4PA 1BQNB 4A47A 1UVMA 3FBEA 4DR7F 3C14A 1RHRB 3EWGA 1FWPA 1B0TA 3B4DA 2VBYA 4YB7A 1KQKA 1TK8A 1HI0P 3WX8A 2OPRA 3RB4A 2CQIA 1YJWS 1TKZB 2VUGA 2ZKUA 4RW9A 3I82A 3MWBA 3DRSB 3HVTB 1XR7A 2A10A 4KFBB 1R0CB 2AEJA 3I6PA 3VWSA 2JL9A 4ZLJA 1EAYC 3DLJA 1K0TA 2DJWA 5DO2A 1FJGF 3W62A 1H72C 1RBAA 4DF4A 4JI3F 2XMKA 3TI0A 1N5YB 4ZVPB 1SPBP 1PO6A 4I2PA 5E7OB 4YB6A 4G1IA 5E33A 3DI6B 4HH0A 1VHFA 2Z0GA 2RHSB 4OYWA 1FTCA 4PEOA 1V6HA 5KG2A 3PYEA 1QAJA 2VU5A 3HP6A 1GQEA 2BJ8A 1RA6A 3WBZA 4C9DA 3IWLA 2HHHF 1IKVA 3DLLQ 1LXJA 3NS7B 2DKOB 4OMFG 4KT0C 1S1UA 1QUVA 2HQCA 1VQNS 3ZZOA 5LM7E 2CG8A 4NLTA 1KHWA 3DU6A 3A8EA 1NSQA 2OMLA 3W9JA 4RW6B 1RT2A 3O3LA 1Q95G 3VVTA 4QYRA 2HGMA 5T14A 1RWXB 1SKUB 3KKFA 3BREA 3QGPA 3FMWA 4DL0C 4ES3A 4ZVQB 4DL7A 3PJWA 2FJDB 4DR6F 4FS1A 4O4GA 4B9VA 3JYTA 1NZAA 2VZ9A 4GVBA 4AE5A 1IKWA 1Y5IB 3OHAA 1TL7B 4ERDA 3FBBA 2HNDA 3GFXA 3G96A 5MLCV 5J2QB 3QBCA 2VV5A 1HNXJ 2IJNA 5M2RA 4IR1A 5I3QA 1RTHA 3H90A 5CCLA 3M8RA 4RJVA 4Q8FA 4Q8EA 4ZS6A 4ZVEA 4AL6A 5IM0A 2CPZA 2MKJA 4OI0A 1VFJA 2NXCA 3RU0A 1RWOB 2QMUB 3GR0A 3BS9A 3KTQA 1N33F 4JI4F 1LK7A 3GCXP 2XG8A 5DRKA 5A0YB 2WBRA 5GMDA 4KYZA 5LJ3Y 1EKRA 3NGSA 3AD7C 1KR4A 2FJBB 3K17A 4V19J 1AXQA 1RKJA 2H5JB 1JLBB 2V5HG 1RXOB 1UPPA 1EQ0A 3LF0A 3SV3A 3KLEB 4A48A 1NAQA 2V9WA 4FDFA 1L5UA 3AQOA 1Q5YA 1HMVA 2BM0A 5ITHA 1CS4A 2UUCJ 4EUVA 1Y5LB 3L4BC 3IR6B 5HMYA 1TMMA 1WI8A 1NPKA 2J9CA 3ZC4A 3R5CA 5T41A 1PC5A 4ED3A 2OEMA 2C2DA 2PFFB 4KGZB 3GTYX 1HPZB 3V6DA 1Q82T 2XBPA 2DH7A 5E3RA 3W66A 4RO0A 5DQGA 2CJQA 1TVRB 3MEGA 1RT4A 1F9EB 1CJTA 2JHEA 4O0NA 2IDEA 3KLIA 2ZE2B 5F3TA 5B0AA 3NGTA 1WNEA 4ED2A 1HNVA 2CPFA 3CTRA 1M5OC 1X4AA 1N52B 1JLCB 2EFPA 2YY3A 2V2ZA 2ZUGA 5HLFB 2LKZA 4TYBA 3FQLA 1CQMA 2CJAA 3SCKE 4I7FB 2SXLA 3HF5A 1VIXA 3OTCA 1LW0A 4DZDA 3I4PA 3BO2A 2XO7A 4RKUC 2HS4A 1M5SA 3MM7A 3D5MA 2OFHX 1SIWB 2YNHA 1VK8A 5J2PA 1HI8A 5K9FA 3CJ8A 4KBIA 4F2RA 1N6QB 1NK5A 1MMDA 2DGSA 2AGOA 1SKRA 2C2NA 3QWUA 2ZC3A 2ZBRA 4DX7A 4USHA 1F5AA 1C0TB 5C2GA 1ZAXA 1RP5A 4FVMA 5C24B 1HBOA 4LRBA 3IGNA 1L3VA 1Z4UA 3HHLB 4I6WA 2I6WA 2C42A 1KS2A 4NLVA 1U1MA 4KKOB 1WJ9A 3VR1A 3C16B 4ECQA 1KDNA 4LR7A 1HI1A 1ZA1B 1QAYA 4LR8A 4KTQA 1T03B 1Q78A 4FNIA 2AJ0A 4ZPAA 4NMLA 5IQQA 4X4TA 4PUOA 3JQKA 4DFMA 4HKQA 2ADBA 2ZUAA 5F0WA 1NLKL 2XHCA 4B9TA 4JV0A 1YITS 2ZBCA 4MYUA 1M5HA 3QIDA 1J5EJ 4C8NA 5F8MA 4JI8F 1UETA 3I0RA 1N5VA 4RU9A 1FE4A 4I1TA 1LWFB 4JI0F 3B78A 4MFBA 1HNWF 3OUYA 5LOQA 4TY8B 1N32J 1XR6A 4XPEA 2DEIA 4ZLNA 1S9GA 4JI5J 1FX2A 2UU9J 2IVYA 3PTWA 2XZWA 3I5BA 4IYQA 1UWBA 2OEJA 1PC4A 2YKOA 4HI1A 1MMNA 4P7VA 2HVZA 3UI3A 4J9UE 4DV3F 4ZP7A 3MEEA 4LIWA 1RYSA 1H0HB 1NH8A 3VAGA 5HQMA 1YWXA 1NK0A 2WVDA 1UWAA 4MIAA 3GONA 1CEZA 5EHHA 3WDOA 3G86A 4UOCA 1FD8A 3DRPA 2DXDA 2E1RA 2A2DA 1ZPWX 3AHPA 1C1CB 1RWNB 2XC9A 2GV1A 3KNAA 3IFEA 4J9VA 4TXSA 2R7XA 2VFRA 3JQMA 4RUBA 4QWCA 3ZXWA 4IKAA 2YKMB 1Y5NB 5D0GA 2GO8A 5E0OA 1MU2A 2X1AA 2V69A 2FZKB 1UP1A 1HQ2A 5D3GB 1A0OB 5F0UA 1DZ5A 2X51A 1NCLA 2OUGA 4KO0B 2YWGA 3K8WA 1HWUA 4QYZK 3M1VA 1H38A 2DYAA 3MUTP 3MAQA 1N36J 4ZVRB 4RBVA 4UTGA 3IA0A 1Y3KA 5EUHA 1OO0B 1P6TA 3KLGA 4M8LA 3FSYA 4RLEA 4CM0A 1U1LA 1X4FA 1HNZF 1GTEA 1FT8A 4ZLLA 1NKEA 3PNIA 4ZOSA 1TUVA 1PAEX 4K4VA 1QE1A 2PDAA 4Y2AA 1VRTA 2PE8A 1X4GA 1QTMA 1OYDA 4LF9F 1XNRJ 1S4FA 2OMOA 1HA1A 2RF2A 3CF5Q 3LP1B 3CMQA 4ZCKA 3CDAA 1WKKA 1OSCA 2K7JA 3V81A 1JLQA 2W4PA 2FJEB 3DNCA 1R0BG 2R2RA 3OL7A 3DGVA 3MUMP 1VMBA 4GKKJ 5A8KA 2ZH3A 2VH7A 2CQPA 1URRA 3W60A 3D3BJ 1N56A 3I32A 4K4ZA 2R7TA 2OSQA 4DCPB 1HQUA 4V1Ak 3NY0A 2DT9A 4WE1A 4OI4A 1NSAA 2AEMA 3OQ2A 3Q83A 4K2XA 1CC8A 2DGXA 3U1LA 3G6YA 2IPOB 2C22A 1FNMA 4CCHA 3IM8A 1HHQA 2IBKA 3TUIC 3F0NA 1NB2A 1S1WA 5E3CA 4QIGA 3WIVA 2CZ9A 3CC4S 4BHQA 4DV0F 3TQ1A 4IOCQ 2DEJA 2NS1B 1UZHA 2LU2A 3HD1A 4FPIA 2L9DA 2WONB 1EB0A 2BQ3A 1PYOB 2HHPA 2KFZA 1RHJB 1S1VA 2H9ZA 1RT7B 3LQVA 1SUQB 1IKYB 1SJ1A 4L73A 4RNOA 3FCVA 2R7SA 5DJBA 1MNEA 1GTHA 4CO4A 3AD8C 2GMJA 4OYPA 2AX1A 2J7KA 2MKIA 4DR5J 2BYCA 4A8WA 1EX8A 2DO4A 3ENWA 4NZ0A 3DOMB 2HW3A 2D1CA 2CQDA 4NA1A 2ZBPA 4LSLB 3RAQA 5F41A 1C4CA 4Y65A 3BSCA 1I6JA 2XCPA 3KJFB 4CO2A 1IM4A 4ID8A 1B4SA 4IO1A 3BGUA 3MM5B 4X84A 3EVOA 2KRRA 2R8JA 5BR8F 5HP1B 3E8OA 2D3ZA 2HRYA 3BKTA 2KT3A 1KD1T 3DLKA 2R2SA 3D6FB 4WTOB 2V63A 1VQ7S 2J6TA 2XM3A 4LFAF 2XI2A 3BPDA 2N3LA 2G2YA 1O6XA 4LFBF 2RS8A 3I9V9 2JNJA 3NAIA 3EE3A 1U7LA 3DCAA 2M4MA 4DR1J 3TO8A 3DDKA 4LSZB 2FLLA 2NZCA 4M95A 3I56S 2C2KB 4YB1P 2E1PA 2IJRA 4QQBA 4GRSA 5D4PA 3VCDA 3MM9A 3TW0A 3I55S 2FQQB 5A2QY 1GMWA 1YBUA 2WSCC 4M5HA 1VQKS 1YBTA 2FVPA 3T1YJ 4ZJQA 3B82A 4WU2A 3ZZYA 4ZIVA 2D3OR 2MQ8A 1IXKA 3CCRS 2ALZA 3P3DA 1KTQA 1DBDA 2LLZA 2FLOA 1X8DA 2PSZA 1R0AA 2D3O1 1UKUA 2ZH4A 4P2XA 3WZ0A 1IBKJ 2M7SA 2B7CB 1U1PA 1BMQB 2OGUA 1XNQJ 4WFBQ 4U9RA 5L46A 2R8IA 1TKTB 5C5JA 2VG6A 3U7JA 2B9YA 1CPZA 3MMCB 4RNMA 2HBZB 1YQHA 5FJ4A 1XN9A 2CQ3A 3BEGB 2EBEA 1FKPB 4E98A 2HHSA 3TP2A 4I2QA 3NXZA 2QFIA 4YOEA 3RB0A 2MTLA 3IR5B 3PG9A 1Q4RA 3QT7A 2HNYA 2RDDA 1YZ6A 4C6AA 5CYJA 4ILRA 4IH5A 3Q24A 2VFUA 5B0GA 2N7YA 2XO6A 1NNDA 4B3SJ 1TKDA 4FBUA 2BE2A 2G0IA 2QL7B 4EZ9A 3C3LA 4O3QA 2HAIA 3RW7A 4QR0A 4UOHA 1H73A 1BGXT 4RW7A 4USKA 1C0UA 4JV5F 2MZQA 1EZZB 1S12A 3W1YC 2LQBA 4DMZA 5GAGI 5D4NA 3DLBA 3Q8SB 4JUZA 1OY9A 4KE5A 2GVZA 3HO1A 1NU4A 5KFJA 4RBTA 3KDOA 2JFDA 5DQHA 2EG2A 3PYDA 1UMJA 2C2EA 1O5JA 4NI2A 1LWEB 1NPRA 4KY3A 1WC4A 1ZTWA 2PI4A 2V9KA 3H5XA 3SQGA 4O4RA 4FXVA 4GC6A 2QLJB 2IYGA 4KAIA 2BKOA 2BW7A 4PABA 3AB2B 3FGVA 1UEUA 4H4KA 4FYVB 4TU9A 4B3OA 3KOAA 2N82B 2BOPA 3ZZTA 2OD6A 3AJ2A 2EVZA 1U0HA 4DV7F 4XPCA 2V8PA 2A2CA 2LQ9A 4GC7A 1ZS6A 1LW2B 3H59A 3M9OB 2XMJA 3KDNA 2D3UA 3H8YA 2YNIB 3T5HA 2DHHA 1UZDA 1CJKA 5ETPA 4C3MA 2IRXA 3MXHP 4Z37A 3MI7X 4HHJA 4A8QA 2GQQA 2VQEJ 4K4WA 4Y0FA 2W4CA 1VBZA 4PXBA 1XTZA 4IH6A 4B9MA 4HT7A 2BMBA 3MM6B 3M2RA 1X4DA 1RT5A 1RWPB 2GJFA 1LKZA 2KM8B 3G9CA 2RDJA 4A46A 4AUKA 1Y9OA 1TAQA 3HDSA 4OX7A 3J7ZT 5F8IA 3GIJA 3PDNA 1RU1A 1VOMA 4JI2J 3Q23A 1EHWA 3FEYB 2LA4A 3D6MB 4L72B 3ILJA 3VGTA 4L3NA 3UN5A 3ILIA 1XK8A 3GP9A 3UQSA 2UXDJ 4DLEA 3R5BA 2XGQA 3AJ1A 2E5LF 1O8BA 5KT7A 1S6QA 3MM8A 2E9RX 3NAHA 4MKVA 5HO4A 1XMOF 4ECXA 1N5TA 2GC8A 4IOBA 4UF4A 1T0TV 4JI1J 2B0GA 3QQCD 3PKMA 4NX9A 1HW8A 4NYZA 3BN4A 1P9QC 1RT6A 3R9LA 3R5AA 3UFCX 1JJ4A 3TYTA 1VCTA 1K1SA 3UWTA 3EGNA 4FP9A 2KFNA 2CPXA 2NZ4A 2CADA 1FRJA 2LQJA 4NYOA 1S7IA 5EWGA 4FYXB 2EK6A 1F60B 3QJLA 1IWGA 1YJUA 3IG1A 2PA8D 1UA1A 4KHPJ 2PMWA 3W65A 4C7QA 1DTQA 1X5SA 5CZXA 1S1XA 1RAGB 3AXMA 2B43A 4NLRA 1RZMA 1VQ8S 4GO7X 1JKHA 1NXIA 2HPUA 1U6ZA 4ZMMA 4DL2A 1HBUA 4K4UA 4CLLA 2CQ4A 4U95A 2DNLA 3H4DA 1M1GA 1JXLA 2VIHA 4M5JA 4IDKA 1S1TA 3T9NA 3D2WA 2LA6A 3G2XA 4U7UD 3MM7B 2CQ0A 4G1PA 4YR3A 2YH0A 3K5MA 2MSSA 4HR2A 4Y34A 4RW4A 4EBCA 2QJ3A 2VICA 2GVDB 2HWIA 4CZCA 3GFZA 4YS2A 3AT1B 4IQXA 1JLEB 4O3NA 4Z7YA 4OJHA 7FD1A 5J1EA 3MCOA 4HTJA 3JTPA 4JI6F 5HJXA 3V5RA 3M8WA 2LFVA 4USJC 5CYMA 1YLXA 2ZH2A 2X3GA 1G6BA 1XC9A 4RUCA 4CO3A 1R43A 3JSMB 5B0CA 2GS8A 1BWVA 2Z30B 5T7LB 1XEZA 4CYUB 3QT8A 3SSRA 2KXNB 2IMWP 2E9TA 4UY85 3TEHB 1RT3B 4FN5A 3W2WB 4EU0A 2NSBA 5HROA 4QIEA 2AW0A 3M30A 1RISA 4C8YA 5G4DA 2K1RA 4ETXA 1GH8A 3M6WA 2NXUA 4PWDA 3KUHA 3CO0P 3I0RB 2X1FA 4IRDA 1TL3A 2RKIA 1RTIB 3C19A 4OX9J 2BXJA 1RE1B 2RNEA 2FJAB 2FGOA 4J7CA 2VG7A 8AT1B 5EX3A 2HIQA 4ZITA 2EC0A 3VAFA 1HARA 5I42B 1NK6A 4MMOA 3OV7A 3HHNB 1SIZA 3MEEB 1RB0A 4UZBA 1RAJA 1UEKA 2OTJS 1PJ5A 2MSTA 4KV8A 5AE1A 4DOZA 5B08A 3T6BA 2B8QA 3DKDA 4KPCA 2ABYA 3KJVA 5EDWA 3SDEA 4DX8H 4ELTA 3AXKA 3VGSA 1JWWA 2L48A 4NXMJ 2BRLA 5AXKA 3LGHA 1D8ZA 1S9FA 2POKA 2RU9A 2D74B 3NGUA 4B3MF 1MU2B 4OV6A 4ID5A 1K8AT 3LPYA 2P6TA 4LJMA 2UV8A 3PR4A 5GADI 1V5IB 4OZLA 2KHDA 5CYQA 4NEZA 1K44A 1HWJA 1D9DA 1Q79A 2IYIA 3NWGA 6AT1B 3GE9A 4LBHA 4F0HA 5KOXA 3OVAA 1DLOA 3QRPA 4EFAC 1TZ0A 1KQFB 1G7CB 5C2CA 3GJRB 1UVIA 3GV5B 4HVZA 2N3OA 1MWYA 3AOCA 2WW8A 1KLNA 1YZ7A 4F3MA 3LWMA 1KONA 3D3CJ 3KJNB 1KNZA 1JX4A 1CVJA 4DR4J 2I9SA 4FS2A 4ZN3A 1C2PA 2UUBF 2DNOA 4R0EA 4C3LA 2W2MP 2FHOB 2ZZTA 3K8VA 3V4MA 4HLBA 4H4OA 1WACA 1Q8LA 5DDRC 1QDUB 2J0SD 3PRVA 3LO3A 3ZTRA 4J9QA 1HBMA 4YMEA 4CTAA 3IC1A 1QUPA 4DPOA 2XHWA 3QRRA 1SH0A 1HYSA 3BDPA 2BV3A 2FC8A 5E3AA 1PJ7A 2J6SA 2PMHA 2R4FA 5JVHQ 5H9EJ 3HFKA 3Q8YA 2KVIA 1I1GA 2WK4A 1F5CA 4AYBD 2W7PA 4ED5A 1X9MA 4OZJA 1OYEA 2F4VF 2HWTA 1MLAA 2HBQB 3F56A 1W25A 2KT5A 5KFYA 1VQOS 4IRKA 2UUWA 1U8SA 3DN9A 1RK8A 3E01A 3CPWR 1FJEB 2B8PA 1FK9A 4WFYA 3VF0B 4ECSA 1DQ8A 1SV5A 3HK2A 3BQ2A 3FZBA 3BR9A 3POTB 4QIVA 2EI5A 1H98A 1S49A 4DS4A 3FZ2A 4Y28C 1RCXB 4F0KA 2UXCF 2V4JA 4ANEA 2KTQA 4IOAQ 2PI5A 2NXNA 3KLVA 1FNOA 1T7PA 4EO6A 1Q1KA 4FYDA 1HR0J 5LMUJ 3MMBB 3KK3A 3IBWA 4U7CA 3EX7B 1OS5A 3D0IE 2MYFA 3QT5A 4PWWA 2B4OA 2FPHX 2WVBA 3ISND 2OH2A 1WELA 3MR3A 4A8KA 3RBXA 3M8ZA 3LH2S 5KFGA 5I3UA 2YNGB 2LVWA 1KFDA 2JLEA 5HVHA 2KFYA 1RCOB 2LQ5A 2NXJA 4CLWA 3DOKA 1S10A 4JYAJ 1IQTA 4I68A 2XMTA 2WCXA 3HHLC 1LWCA 4LF5J 2ZH5A 1RACB 3MR6A 2A3JA 3C46A 1VK3A 4PG4A 5IT0A 3V6HA 1J2VA 1HQEA 1Q5VA 1EETA 3DM2A 4UQGA 1MWQA 2HMIB 1HNIA 1VS3A 3THPA 4G3IA 2XNRA 2PGCA 3C2PA 4LMZA 4LVNP 3MFHA 2HHQA 2LECA 1U1KA 2K06A 2EBGA 2CNOB 1QJHA 2VONA 1YRUA 3CCUS 3JB9k 2W9BB 3BBFA 2DIVA 2ZBQA 1D1UA 3HXMA 4E8UA 1VQ4S 4DV5F 3OL8A 2KYZA 4TKTA 4NXNF 2YNFA 3JTOA 1AFJA 3ZTOA 2BQRA 2YVSA 3THTA 3R7SB 4Q0BB 5LJ5Y 1MSWD 2X7IA 2V2KA 4K4TA 4B3RJ 4YP3A 4Q2LA 2DCUB 1HKAA 2N4CA 3IN5A 4OZNA 4M63A 1CULB 3UO0A 2DVIA 1MROB 4LF2A 1JLGA 5DGBA 4RBUA 4WFAQ 1U2FA 2FUG9 4LBPA 3ZZ0A 4ED8A 5IT9U 2DCLA 4RW8B 2GGPA 2MZTA 2YPYA 1HWKA 2CNNB 2IC3A 2BANA 3J81U 5H9FJ 5AE2A 4RUAA 4LF6F 3TA0A 2XMVA 5ETKA 3K57A 3LW5C 1KBRA 3G87A 1RAHB 5DLFA 2HK3A 2O66A 2DNHA 3GILA 2E5IA 2B4UA 4NA2A 4JB8B 3CJQA 2XZTB 3C15A 1L3SA 3UDVA 5HN0A 2M52A 2CUYA 1H6KX 3PEJA 2J9DA 3MAAB 1PKUA 2MKYA 5IC4B 3M8QA 1VLYA 4DR2F 2J8AA 1NO8A 1LK5A 4RNHA 1TV6B 2W2OP 3DLGA 2XGPA 1A7GE 3ISNC 4DN0A 2J6UA 2XS2A 4F4WA 3G82B 3PW2A 4PQUA 2AV5A 4H4MB 4K2JA 1WEYA 4F2SA 2AQ4A 3BGRA 2BJ7A 4OI3A 3RJMB 5DZ6A 1T3OA 2D9OA 4FYWB 1S6PA 2OJ3A 5FLXU 4DF8A 4LBIA 1PILA 2Z57B 4V19X 1M5VC 4AXIA 4J91A 5B0FA 3G8QA 2CWXA 2D41A 3KLHB 2H4YB 3ONQA 2DNNA 3MGJA 3HVRA 1CBKA 1LXNA 4HACA 4CWBA 3DGPB 5IC6B 4X4UA 4Y00A 3KLFB 2AF6A 3KK2A 3PY8A 4HTIA 1FCAA 2V4QA 3W7BA 4CO5A 4TYAA 2DHXA 4MKAA 4O23A 5DG8A 3Q89A 5C7PA 3A3OB 3A8IA 4RW7B 2HHHJ 1ITPA 1C0UB 5JXSA 2BRKA 2UUAF 4P73A 1JB0C 4BWMA 1WUUA 4E2FB 2WB1D 3PR5B 3C6TB 3NMAA 3K58A 4PAAA 3BF4A 4OYXA 2PEBA 4C11A 2IA0A 1FI4A 4KQZA 1WF1A 4K7QA 4B9SA 2GMLA 3GWCA 4ZCLA 4USVA 3OFFA 2KKHA 4Y2MA 3GFHA 1DURA 4DHVA 4MK9A 3MD1A 1Q0NA 2F40A 2NLWA 2XSJB 1WKJA 3SQGB 2DRBA 4LF1A 3TR5A 4DR6J 3L09A 2MGZB 5JUMA 2BJEA 2HS3A 3FKBA 4OX8A 4OX9F 1CSJA 1X0PA 2QE5A 2JZ5A 1VI7A 4G1QA 1WTFA 4B3OB 7FDRA 1KEKA 3FCHA 3D1QA 2XTJP 3R2DJ 3VAKA 1FNXH 4ED0A 4GKJF 2FLNA 4DPYA 1T11A 2R7UA 1ZZFA 4ER8A 1E6YB 3OHBA 2R8GA 3EM1A 3BBCA 3MPUB 3I9ZA 4QBUA 5EWEA 4KSEB 5CD4A 5FD1A 1P1TA 2VPWB 1I5OB 4JI4J 2FGCA 4OHZA 3CW2C 5GMEA 4ZHRB 2XY7A 3CMES 2BJDA 3PW7A 5FDLB 3PIPQ 3VGUA 5L9NA 1RT5B 3BSAA 1SL2A 3FC9A 2VBWA 5KFAA 3PRBA 1ZA2B 1X9SA 4Q2MA 1TU0B 1E6VB 3CEDA 2X1GA 4E0DA 3CUNA 3QIPA 1TAUA 4YDDB 2YX4A 1NJWA 2IMOA 1CJUB 3AOBA 1FXLA 4N76A 4LSNA 4WIQA 1EQMA 4MKYA 3UVJB 2DRDA 2CQ1A 3DOLA 1WDTA 2JC1A 2HZAA 3TAQA 3TZXA 3JAMU 4CLYA 1VQ6S 2FJWA 1WORA 3PX4A 4DR4F 1RTZA 4KGKA 2IM3A 2P2CB 5HJYA 4KJIA 3SSQA 2C3MA 3H20A 3R7NB 1RTDA 4ZVHA 4C8LA 2DR6A 4NRTA 3W9HA 2MKKA 2JSXA 3QLHB 2Q3PA 3CD7A 3P5BP 2OPQA 3AFGA 2MDAA 2P5VA 4CH1A 1RAEB 4PG6A 4DX5A 2WOMB 4PXEA 2DHAA 3ENQA 1XBWA 1RLDA 1T9YA 1A6LA 4ZA1A 3S01A 1HBNB 4RWWA 2HVDA 3UDLA 1DTQB 4R8UB 5M2PA 2A6MA 2ZVIA 2ATCB 2KJWA 2Y9HA 4DV4F 2OHDA 1N5QA 1U02A 3HKZD 4DV1J 4ED4A 2V8GA 3W2VA 2N4DA 2P9CA 1H2TZ 4USMA 1KP6A 1NBEB 3P4UB 5CH7B 2V8VA 4PYDA 1H3DA 5EX0A 2F8EX 1FJ7A 2V67A 3IS9B 3QGHA 2C3UA 4J9PA 1F5BA 1PCAA 3CT9A 4YR0A 1N8RT 1O0PA 4C0OC 3PACA 1XIQA 4HL9A 1AZSB 1D0EA 2XZDB 5ETOA 3CCVS 1NSPA 3O1LA 3I87A 4YDXA 4J9SA 1SQFA 4TLQA 5D6GA 2QRRA 1Q7YT 3IRXB 5CHCB 2NUUG 1NMEB 3SI8A 3BN7A 3CCMS 3OTOF 1ZAVA 3DLEB 4X66F 1BC6A 4RNFA 4OYIA 3QNWB 2XMMA 3TA1A 1TKXB 3H2LA 1RAAB 1SH3A 4W98A 1FESA 3I5AA 4O3OA 2GIFA 4QJVA 3VGVA 2MJNA 1H7XA 1RTJB 3FFIA 2V4RA 2YBVA 1UAWA 2XMUA 4JYAF 4JI0J 4DUYJ 5A8WA 1HNWJ 2VJVA 3KMSA 4QYZJ 4DUZF 2BDPA 2NCKL 4OL8A 4P71A 3UR0A 3RAMA 4P75A 4ICLB 4DR3F 5GVQA 5F8LA 3T1HJ 5K14B 1FDBA 1KTVA 1ZM4A 2FDNA 1VQMS 4DV3J 2Z2MA 4NZ6A 1T9UA 3GMGA 4KGVB 4EZ6A 1KHVA 2GZOA 3W3SA 1L3UA 2DGWA 1J5OA 2Y0BB 3B6BA 3DYAA 1N34F 1TMJA 1QAIA 2V2QA 4NCBA 3QO9B 2Q1LA 1L3TA 3CGIA 1X31C 2M3DA 3PO4A 3TAMB 3FNNA 4F3QA 4YY3F 4PXDA 3OR2B 1S6UA 2OI2A 5HK4A 1VQPS 3VAJA 4HEA9 3BBBA 2NYIA 2JFKA 4DS5A 1Y0HA 5KTQA 2HFVA 2BACA 1KQGB 4RX6A 2WW4A 5KFWA 4X4RA 1EP4B 1TELA 1S9EB 4IO9Q 2FIUA 1GEHA 4X64F 1X0FA 1TQLA 4CRJA 1WHVA 1FA0A 2DNGA 2DNMA 2QL5B 2CNKB 4EK2A 3J7AN 1YJTA 1QY7A 3PEHA 3OXLA 1CJVB 2CAJA 2ASYA 1IKXA 4ZP8A 4N47A 5GMKa 3MECB 3VV2B 4R5PA 5HBMB 1HNZJ 2CDQA 2WHOA 3HSGA 4PZVA 3BB5A 1FRKA 4QCLA 4ZDNA 4ILMA 2FHJA 1EIYB 4S0MA 2AYGA 2BUNA 2J76E 1R8CA 2RRNA 1RBLA 4IG3A 2CA9A 1KRPA 3LALA 4LF9J 4ZPDA 4U8YA 2DNKA 2FC9A 4FYYB 1HD1A 2KB2A 3L95X 3LP2B 4DCJB 3L7PA 2XMWA 4L75A 3BGOP 3KG1A 4AQYF 4IH7A 2A6OA 6FDRA 3GQCA 3N6LA 4DBQA 2I38A 1BQNA 3SEOA 3QSYB 4L3KA 3DU5A 2GQCA 3G71S 1Z2LA 2AU0A 2CJKA 1U1QA 2VPXB 4DJBA 1S99A 1Y7PA 4K59A 1SC6A 2AX0A 4ANDA 3PVXA 3T41A 4PRFA 1TKZA 5B0EA 4M5IA 2G1DA 2UVUA 1FKOB 3DRSA 3HVTA 2IBOA 4KFBA 3CNQP 2YKQA 3OXFA 2QA4G 3R2CJ 2Z8QA 4Z7CA 2VPZB 2MZ1A 1P9YA 2ZH9A 5ETQA 1HLWA 3CDEA 5KT3A 1N5YA 4CLZA 4N56A 4QU6A 2LDIA 1FFGB 3DI6A 3UDEA 1REVB 3M8PB 3WX4A 3OFHA 2Y0SD 2EXUA 4RWXA 9ATCB 1IR0A 5IXUA 2YWKA 5A6WA 5I3PA 2HQFA 2CZVC 2OO4A 4OV1A 2E9ZA 2EKNA 3BQ1A 4DV0J 3DMJB 2P8IA 2FVQA 4WYWA 4GMKA 2HQDA 2QA2A 1VDHA 2F8MA 4L6V3 4WP8A 4NEYA 4CQ1A 2OPPB 2QT7A 2CJ9A 3R3TA 4TVAB 2G2OA 1TL5A 2AHOB 1RGVA 4M1KA 4EI2A 2DNZA 2HYIB 2FJVA 3R1HA 2RMLA 1GK8A 1VQLS 4RW6A 4WIIA 2F3JA 2H5IB 3CJKB 2C2MB 1T9TA 4U7UK 4IUFA 3M2UB 2ZDOA 3C8YA 2FY1A 3HHEA 5H1SV 3TJAA 1NDPA 4LT6A 4LFCF 2CPIA 3DRYA 1S97A 4KIAA 1JLAB 5AE3A 4P2SA 1WG4A 1LWXA 1TL7A 3RUBL 1RDRA 5CXTA 4DX6A 5BR8J 4M5DA 3JQJA 3H0PA 3BO3A 3N5BA 5J2QA 4J90A 1FRLA 1YJRA 2CPYA 2OPSB 3RBZA 3HMJG 4URSA 5KFOA 2ZM6F 3CCTA 2ILZA 3D9BA 3CSKA 1B0PA 1K73T 3A8JA 2DY1A 3NOCA 4LFAJ 4ZPVR 1N0UA 5G0RB 1Q86T 2P9GA 3HD2A 4LFBJ 2J9EA 2ZJPQ 4DQSA 2B5JA 5A0YA 4BCAA 4BDPA 5J2NB 1KVJA 2UZAA 1KSPA 2V50A 1VC0A 5D0EA 2HNZB 1IBLF 2HAFA 4I6YA 5IWAF 4OHYA 1F6TA 4X4NA 1TTHB 4CNZA 1HHTP 2IJFA 2HBYB 4O3PA 3I96A 2CJYB 4J5OA 2JRSA 1JLBA 1N0VC 2AYEA 2DBBA 5DDOC 4KH1B 3KLEA 1RT1B 2I2YA 3Q8UA 2WB4A 2M0GB 5IZHA 3HJFA 3K7RA 3F41A 5DM6Q 2JLGA 1B99A 2HHVA 3UNYA 2YXLA 4F4KA 3J7YI 3QZ7A 5HVFA 2UXBF 3G6VA 5J1PA 3NMRA 3L9ZA 4NA3A 4A4JA 4C0HA 1HPZA 4ELVA 4X65F 3MPWA 1MN9A 3RBEA 3OR1A 3W63A 2DR9A 5CQGA 2EFOA 5EN1A 1TVRA 3TX8A 2MQOA 4FF3A 5EGYA 4LF8F 3GR1A 2ZE2A 1BWEA 1K1QA 1YHQS 3ZTPA 1SKSA 1YJ9S 2H4WB 1WF0A 1JLCA 2C1EB 2JX2A 4D3HA 2VODA 2BABA 4DV1F 1WC3A 5ETRA 1X5PA 5B09A 3T1AA 3R5JB 4I7FA 1WOOA 2ZNZA 2B4VA 5L9XA 3DXBA 3MURP 1S6OA 2C3PA 3O44A 4PYAA 3T19A 3D67A 4C8KA 5HAOA 3LPEA 3ULHA 3U1MA 2VL1A 4DSEA 3AAWB 4TU7A 4JV5J 1N6QA 2VHGA 1U49A 3EICA 4K50A 4CT9A 3GPAA 3MEDB 4Z2XA 1C0TA 3SBMA 4RNNA 1SBRA 5C25B 2DK2A 3B8HA 4J9LA 4OHVA 1WSVA 5C24A 1YI2S 4QWAA 1OY8A 3OPKA 3ITHB 3UCUP 1YJ7A 4KKOA 4IFYB 3N28A 5BJRA 4NLDA 4CI0B 1FXDA 1FVQA 1RHQB 2RAQA 4NLWA 1VISA 3ETOA 4K5RA 4CIOA 2NR0A 1T03A 3N4WA 4X4QA 4DUYF 2ZH1A 4ZP9A 1TFYA 1YKWA 2I0XA 3BKFA 1VRQC 1GMWD 2CRLA 2DISA 1WDDA 4DV7J 4JBCA 1DARA 3T1HF 1P27B 2M8DB 2E5JA 3KMQA 3I31A 1LWFA 1G3OA 2YWFA 5A8RB 4DL5A 2MKHA 4DSJA 5KT2A 4TY8A 4DPUA 1IJEB 4K4XA 1A9NB 2PA3A 4XTTA 4CH7A 2GHPA 5DZ7A 3G8SA 3MFIA 5J2MB 3TVYA 2H3EB 4BC7A 2KYXA 2YKNB 1JJHA 3AJDA 2HFSA 1OQ3A 2QSFA 4ZCIA 3OW2R 3K0JA 5IFMA 3TOQA 1IVZA 4U8VA 5HQLA 1IR2A 2VOPA 1VRUB 2GJIA 2HQIA 4OYBA 1UW4A 1FTRA 3ETMA 2FVRA 1QSLA 3TJ8A 3N5FA 3SCLE 3BKUA 3UD4P 1C1CA 3DRRB 2GIQA 3OLBA 2Q6CA 1B7YB 1WD6A 3GSIA 3CIZA 2CYYA 1QD1A 2YKMA 4M94A 3GYNA 5D3GA 2E5LJ 4BLGA 3LP0B 1D09B 4FNHA 5KFRA 1XMOJ 2YQ3A 2F1FA 1BQMB 4IG0B 4LF7F 1F3FA 5BYSA 4WZMA 4Q44A 3JXOA 4CT8A 3R5DA 4P2FA 2H54B 5ETMA 5KT6A 3LTOA 3A1YG 3A12A 5HSPA 5K8OA 1RWUA 2YWWA 2W9CB 2BE9B 3BO4A 5IT9Y 4B9NA 2LXFA 1NHKL 3D66A 1WC5A 3Q22A 5MAOA 4ED1A 4Q45A 5C42B 3IBFB 3I5CA 3LP1A 1BQXA 4QOTA 2COLA 1R8AA 3GFYA 2VA3A 1MW7A 1CQNA 4G65A 3SMZA 3V6JA 5F9NA 3KK1B 2MLYA 2RU3A 5KFFA 3WQPA 2JWNA 4ZCMA 4B17A 3KHHA 3F44A 2MLXA 5KT5A 2VB6A 5KT4A 1QVGR 2W8LA 1ZM3A 5LSRA 5HQ8A 4OI6A 5BXIA 1NKCA 1K0VA 4OZ2A 3R8YA 1JJ2R 1T9WA 4F7VA 3TEGA 3D6TB 4I56A 1RU2A 5B0DA 2HVHA 2J9DE 4MT1A 4WFNQ 1U1NA 1S5ZA 4DG1B 4MK7A 4ECYA 1U1OA 2Z56B 2DTJA 3GV7B 5GADU 2K7KA 5FLXY 2B9WA 2OAUA 4U6PA 3V4IA 2Q66A 2DGQA 2GIRA 1FF2A 3GYXB 3HT3A 1HW9A 4PQAA 4JI6J 3ICLA 2F65A 1D3WA 3CJ2A 2MY7A 5HATA 4L76A 2ZD1B 2WBMA 5JMNA 5M2UA 2B6AB 4IFVB 1RWVB 4DUTA 3ET6B 3BM7A 2ATLA 2PC6A 1R6YA 4ECWA 2U2FA 2RHQB 3D1OA 2WONA 4NZ7A 1FRIA 2MKSA 4ZJLA 1B0VA 4C2MA 1RT7A 3HZGA 3HM9A 5IQ6A 1SUQA 2CJBA 1IKYA 1ZPVA 2LP4A 4ITSA 1U24A 3OBIA 1NKBA 1LNQA 3BSNA 2F7VA 3PX0A 3DDIA 5GAEI 3DOMA 4XDDA 3D68A 5GAHI 2KG1A 1T05B 1PYSB 4LSLA 1WTBA 3OFEA 3CO9A 3AD9C 2QGFB 2YX7A 4PR6A 4UUXA 1UL3A 1ZAWA 3CXCR 2G9OA 3MM5A 1QTNB 5E41A 3NOGA 4R0JA 5HP1A 5L1IA 4QR2A 3OSPA 1OPIA 3EVMA 2LDYA 4HYKA 3MMJA 2DGUA 1DTTB 3RR8A 1FDNA 5IOLA 4NCGB 4H4KC 3GJSB 4A8MP 1U6FA 1TL1B 2K8GA 3CB4A 2MQMA 4CLPA 3HSZA 2O01C 1T3NA 4DV2F 1WG1A 3Q0AA 4B3MJ 2MQLA 3CMAS 2W2QP 4ES1A 4DQQA 1RKIA 3RYLA 1C1BB 2ILYA 1XERA 2E1MC 2HFZA 4IR9A 4DL3A 2JLFA 2U1AA 3R7BB 1SL0A 2I5JB 3NGKA 3C66A 4WKYA 2QG9B 2YKAA 2X1BA 2JDJA 2M88A 4FXDA 3HFZB 4LF4F 2R7RA 3CC7S 1BHNA 2ZH7A 1SH2A 3NL0A 2YWHA 2ZOMA 3FVYA 1JLFB 3W5YA 1QAXA 3TUJC 4U67Q 1VBXA 5AXLA 2XEXA 4F4YA 2YWEA 3PYFA 2V0NA 3CJ4A 2UUBJ 3EVWA 3C14B 1IWAA 1YDLA 4M5MA 1S0VA 3HULA 2EKYA 2QX0A 1WHYA 2EK1A 5BYRA 4O0IA 4NPOA 5A6PA 1RHMB 2OPRB 3FSXA 1TKTA 2NUHA 4YEAA 3PV8A 2HZVA 4RW9B 2XB2D 4M5NA 3M05A 3JAMY 1NK9A 3MMCA 3J80U 2E1CA 2IA6A 2RE1A 3NCPA 4F4XA 4J9KA 3U02A 5IT4A 2F4VJ 4UW2A 2DR5A 1FKPA 4O44A 3G4SS 1FWLA 1NHVA 5LSOA 5LMNF 2F9JA 4FPRA 2BEFA 4I2PB 5LL6d 3H40A 1UFLA 2HQGA 3J7A1 1VJWA 4DQPA 3H4BA 1ZZNA 2CXEA 3A3PB 3FBFA 1U48A 1N54B 2HRUA 2UXCJ 1S0OA 5H9FK 1FJCA 3BGFA 4YR2A 4ZVFA 3GJTB 5KG4A 1IKVB 3OSNA 4WYLA 2OD4A 2BQUA 3ZZZA 2XLIA 1YBAA 4OQJA 1S1UB 3IWNC 2LYVA 1I94F 3FEZA 5ETLA 4X62F 4MJKA 1RT2B 4QWEA 5F8HA 4C3KA 2M70A 2RUSA 1BXNA 4FKXA 1FXRA 2DITA 1LWEA 4UOGA 1RHUB 2KU7A 2WRMA 2XY6A 2GNKA 3ZO7A 4PPZA 2G0JA 3OJSA 1SVDA 2J0WA 4O4GB 3JYTB 5LXRA 2BJ9A 4N77A 4LREA 3R5GA 4OJGA 4GVBB 1UJ5A 1IKWB 3LGMA 1T94A 3AODA 5D0HA 2HNDB 1Q81T 2CQBA 2KL8A 3G6XA 4P52A 3PZPA 1U0SA 2ZJRQ 3QGIA 4QPXA 5HMXA 1PJ6A 1D9FA 3HPOA 1RTHB 1NHUA 1LW2A 5HVGA 1YSJA 1K9MT 2YNIA 3BH6B 2Y1IA 4EO8A 2EC2A 5IM0B 3HJVA 2M5YA 4DV5J 4M5DB 3QJPA 4NXNJ 3UPFA 1SKWA 1RBOB 4ES2A 1TK5A 1S72S 1R6VA 2JOQA 3HVWA 1T9VA 3MM6A 2MMYA 1X5OA 1DAXA 4HI2A 1MG7A 3PFOA 3UR3C 4AL5A 4F26A 3OVSA 5KFEA 3X3UA 5E5NA 3OTBA 3RAXA 2EW9A 5B7WA 2B5JB 4AFFA 3K5OA 2RIJA 3JSYA 1HMVB 1SJ3P 4ALZA 1CS4B 3UN2A 2MHEA 3QT6A 2OEKA 1U47A 5DETA 3M2VA 2VBZA 4DV6J 2QMWA 4LF6J 1YG0A 4NLYA 4DN9A 2A0FB 3FRZA 4I64A 4OYAA 2XYPB 5KG6A 4KHMA 1R8HA 1IBMF 3WC2A 3BR8A 3J7Z5 4CLTA 3V6DB 4AT1B 3LWLA 3RRHA 4G6VB 3FBCA 2XWYA 4HDGA 2CG4A 1DHMA 2VPYB 2KT2A 1KN6A 2UV8G 3DDNA 1RJJA 2P9EA 3MEGB 3PFEA 1RT4B 4X4SA 4DR2J 1UPMB 2ASJA 1LFWA 1CJTB 2K3IA 2VKZG 2B7BB 2MZRA 3KLIB 2NSCA 1C4AA 1HNVB 3MUVP 4ZVSB 3OR1B 3AA9A 4RZRA 1ZM9A 2CQHA 1RHKB 3V6KA 3VZIA 3GU0A 5L1KA 3E2EA 2MPUA 3MR5A 3IXQA 5THWA 4P2MA 1RUSA 4UOFA 2DHSA 3M8YA 3A8KA 4ZP6A 4KHRA 2DB1A 1MWZA 3RGIA 1HWIA 2O67A 1FDAA 3P45B 2ZH8A 3AOAA 4A8XA 1LW0B 2MY8A 2EFVA 1HL6A 4WK3A 2WVCA 1PIEA 4EBDA 2J7UA 5ETVA 3KG0A 2XY5A 2YNHB 5J2PB 2MQQA 4Y2CA 1AW0A 5KFQA 3M32A 3TVKA 1OJ4A 1ZH5A 3Q8RB 2VC0A 2VQFF 1RAFB 4JI7J 1ELOA 3Q2SC 1QLNA 3EDQB 1GFWB 1D9AA 3RZAA 1HBOB 3I0SA 3QRQA 2HIYA 4QR1A 4FKYA 1JK9B 2UUAJ 4NLOA 2AZ1A 2GVDA 2FZGB 4DCOB 4A8OA 2HWHA
chains in the Genus database with same CATH topology
1SJQA 4QQBA 3OTEA 2DO0A 3DYAA 2OKQA 1S6PB 2UVVA 1JLEA 1N34F 5D4PA 2CPHA 3VCDA 3MM9A 3WC0A 4KHPF 3TW0A 3I55S 2R7WA 1QAIA 3M6UA 2PD1A 4NCBA 2QA1A 3QO9B 5A2QY 4JV2A 3M6XA 2Q1LA 4MIBA 4PUOB 1IJFB 3FEXB 1L3TA 3CGIA 3U27A 2WSCC 2M3DA 2DPJA 1VQKS 3PO4A 4WCEQ 4QIWD 3TAMB 2FVPA 2AJ1A 3NRBA 3FNNA 4F3QA 1M1KT 3B82A 2ZBIA 4YY3F 1VIOA 4WU2A 1UVJA 4PXDA 4DWIA 3OR2B 3ZZYA 1S6UA 2D3OR 2A1BA 2Z2LA 4XK8C 3OLAA 1VQPS 2EG1A 3VAJA 1IXKA 4HEA9 3CCRS 3JSMA 2ALZA 1ZYQA 4NRUA 3IRWP 2NYIA 3P3DA 3TUZC 1KTQA 3M8SA 1DBDA 1UJ6A 3HHKA 2JFKA 2LLZA 2FLOA 2KN4A 4DS5A 5T7LA 5KFTA 1Y0HA 3DLHA 3LAMA 1X8DA 2PSZA 5KTQA 2IAJA 1DQAA 3M9MB 2BACA 4WFXA 4MFBB 2FTRA 4YHHF 1R0AA 3OUYB 3MOZA 1RT3A 1KQGB 1UKUA 1R7IA 4RX6A 3TRGA 2ZH4A 5KFWA 4X4RA 3UE2A 1EP4B 3WZ0A 3KK2B 3GZ7A 3W2WA 1S9GB 2LEBA 2OLWA 1S9EB 2IM0A 1OPZA 2QA4S 2M7SA 2FIUA 2B7CB 4IO9Q 1S77D 2GO9A 4C98A 2LMIA 3PKYA 4IRCA 2QIFA 2KG0A 3CDBA 1U1PA 2VASA 4X64F 1X0FA 1UWBB 1TQLA 2DIUA 1WHVA 4B3TF 2KZMA 4WFBQ 1FA0A 4U9RA 1YRXA 3HHLA 2Q79A 4KR0B 2DNGA 1TKTB 2R8IA 5C5JA 2VG6A 3U7JA 3AQPA 2DNMA 2NQPA 1SXLA 3CD5A 2B9YA 2L41A 4DQRA 5L1LA 1CPZA 2UUTA 3FRYA 5KG0A 2HS0A 1RTIA 3MMCB 3MD3A 4RNMA 1IN0A 1U26A 1YJTA 3MEDA 2PN6A 2KHCA 2RB7A 4CO0A 1QY7A 3PEHA 3OXLA 5K5MA 1YQHA 1Z2ZA 5C25A 5FJ4A 1XN9A 1FE0A 2ASYA 2CQ3A 3BEGB 4C11B 2EBEA 1U45A 3CC2S 1FKPB 1SQEA 1IKXA 3MZIA 4ZP8A 4E98A 3CCJS 4N47A 4K4YA 3QGGA 4NLPA 5I42A 3ITHA 2HHSA 3TP2A 5GMKa 3K59A 4I2QA 3MECB 1DJ0A 2R7VA 2CPJA 5I4MA 4R5PA 4Y6IA 4YOEA 4P7TA 5HBMB 2CDQA 2ROEA 1V9OA 3N01A 1TFWA 3RB0A 2WHOA 3IR5B 4IFYA 2QMXA 2EPIA 3DRPB 2ZDPA 3BB5A 1YGYA 1Q4RA 3AA8A 1FRKA 2HNYA 4DDFA 2BVZA 1NJXA 4QCLA 1UJ4A 3IR7B 4ZDNA 4ILMA 5CYJA 1VBYA 4ILRA 2FHJA 4IH5A 4TLRA 4XAKA 3EXCX 3Q24A 2AYGA 2BUNA 1OQ6A 2VFUA 4DSKA 2J76E 1NK7A 5B0GA 2VFTA 2JEGA 2CQ2A 1R8CA 2N7YA 2RRNA 4IG3A 2AD9A 1JXEA 4B9LA 1JMTA 1NNDA 3JTNA 1KRPA 3LALA 1TKDA 4FBUA 2JC0A 4DEZA 1D8YA 4ZPDA 2KO1A 2DNKA 2BE2A 1RQ0A 2FC9A 1WG5A 1HD1A 4G1QB 2KB2A 3L95X 3D0HE 3LP2B 2ZZNA 2WSEC 3PHEA 3L7PA 4EZ9A 3C3LA 2XMWA 1RA7A 1R31A 4O3QA 2HAIA 3RW7A 2VA2A 3KG1A 4AQYF 4QR0A 4A8YA 1FEEA 1X7VA 1R8BA 4IH7A 1G1XA 6FDRA 3GQCA 4RW7A 1BGXT 3N6LA 2GQ2A 4WK1A 2I38A 4DBQA 1X4BA 1C0UA 5BYQA 3HHDA 1BQNA 3DHXA 2MZQA 5D78A 3SEOA 4JV5F 2DR8A 3M1VB 2LQBA 3DU5A 5A8RA 2OTLS 2IRUA 2GQCA 4PXCA 3T6JA 3LAKA 2HQ3A 3G71S 4DMZA 5GAGI 1GX6A 2W25A 4K0KF 5D4NA 3DLBA 1U2RA 3HX9A 1Z2LA 2IM1A 3K5PA 2AU0A 2CJKA 4C97A 2WTFA 3Q8SB 1U1QA 2VPXB 4JUZA 2C3YA 2RQKA 3NCQA 4B08A 1KOOA 4DJBA 4KE5A 1S99A 3HO1A 1DQ9A 1Y7PA 2FVSA 4LQ3A 2XSFA 3VAMA 2VG5A 4K59A 1SC6A 2J5AA 2AX0A 4OZ0A 3V2UC 3KLGB 2VD3A 1NU4A 4C0BA 1TP7A 5KFJA 5J2MA 3EPIA 4RBTA 1BD6A 2DH8A 3PVXA 4N41A 2JFDA 5DQHA 2EG2A 4YFUA 4PRFA 1XMQF 3QAUA 4NWBA 4WJBA 1UMJA 6FD1A 2C2EA 1O5JA 1AROP 2YKNA 1TKZA 5B0EA 1U4BA 1LWEB 4NLQA 4TQSA 3FMBA 2RH3A 4NYPA 3Q2TC 1ZTWA 2G1DA 1DFDA 2PI4A 1G2EA 2UVUA 4NLSA 1FKOB 3BSOA 3DRSA 3M9NB 4NLGA 3HVTA 2V9KA 2IBOA 2HHUA 3H5XA 4KFBA 3N6MA 1S48A 2M2BA 2YKQA 2ZKTA 3OXFA 2QA4G 4EYIB 4WFZA 1XMBA 3SQGA 4O4RA 1QE1B 2O1PA 1UVNA 2GFFA 2Z8QA 4FF4A 4FXVA 1U1RA 5B0BA 1VRTB 4GC6A 4N8NA 5CA5A 2IYGA 2VPZB 5HMWA 4YUDA 1YRTA 4CO1A 2MZ1A 4KAIA 2PMZD 3RBDA 5E3PA 2ZH9A 4J9NA 1ROFA 1VRUA 1NJYA 3CDEA 3AB2B 2ZHBA 2XNQA 3FGVA 4PWUA 1UEUA 1WF2A 4H4KA 5KT3A 2DNQA 4TU9A 1N5YA 2RF2B 3KOAA 4B3OA 2N82B 2RS2A 2C28A 2O5DA 4Q5VA 2C3OA 2BOPA 3ZZTA 2OD6A 4N56A 2NREA 4QU6A 5KFSA 3O2IA 3AJ2A 2EVZA 2GA7A 1M5PC 2E5HA 4DV7F 2LDIA 4XPCA 3MAHA 4DSIA 3QIPB 4NXMF 2I8EA 4KO0A 3DRRA 3DI6A 2A2CA 1REVB 3M8PB 2LQ9A 2AP6A 3WX4A 2DGOA 2QLXA 2Y0SD 3OFHA 4RWXA 3L3CA 4GC7A 1IR0A 3V81B 3H5SA 3MDFA 3AH6A 5IXUA 2YWKA 5A6WA 1JLQB 5I3PA 4FF2A 1ZTTA 1LW2B 3H59A 3M9OB 2XMJA 4LSNB 2VOOA 2CZVC 2OO4A 4OV1A 2D3UA 2VFVA 2E9ZA 3H8YA 2YNIB 3HI9A 3T5HA 2CQGA 3BQ1A 3DOLB 3DMJB 2FVQA 2CPDA 5A8KB 3DC2A 4WYWA 3G6ES 3M4XA 4GMKA 3DRXA 2QA2A 3LP0A 4C3MA 2F8MA 1R8PA 3C6UA 4L6V3 3CULA 4IQMA 4CQ1A 2IRXA 3FDSA 3MXHP 4Z37A 2OPPB 2BBEA 2QT7A 3MI7X 2CJ9A 3R3TA 4HHJA 4H54A 2GQQA 4A8QA 2E44A 1KQSR 5HI7A 1TL5A 5EWFA 4K4WA 1RGVA 4Y0FA 4DQIA 3NNAA 2W4CA 1VBZA 4M1KA 2DNZA 4PXBA 1BQMA 2HYIB 4IG0A 1XTZA 4IH6A 2FJVA 4B9MA 3CJ0A 1HQUB 4OJ1A 3R1HA 4HT7A 2IVFB 3RW6A 3D1HA 3MM6B 3M2RA 1UEVA 2RMLA 1RT5A 1X4DA 4WE1B 4C8ZA 1VQLS 1F2GA 4RW6A 4WIIA 1LKZA 2KM8B 3G9CA 2RDJA 4A46A 4AUKA 5LT5A 3J81Y 3OL6A 1Y9OA 1TAQA 3CD6S 3GSDA 3HDSA 4OX7A 1T02A 5K8PA 3J7ZT 1RTDB 3CCZA 2F3JA 5F8IA 2QFJA 3RRKA 3GIJA 3PDNA 1VOMA 3CJKB 2WAQD 1AUDA 2W9CA 3TARA 2D9PA 3NBPA 2FB0A 3VALA 3Q23A 4FBTA 4C4WA 3SV4A 3SZ2A 3T9ZA 4U7UK 3FEYB 4OHXA 2OPQB 3IAM9 4IUFA 3EYZA 2LA4A 2ZHAA 2LU1A 3M2UB 3POTA 2ZDOA 5DG7A 3C8YA 2FY1A 3CDUA 3HHEA 5H1SV 2DNPA 4LT6A 4L72B 4LFCF 3KYLA 2CPIA 3DRYA 3NG8A 1S97A 4KIAA 1S1WB 2YKPA 1KLMB 4L3NA 5C42A 5J1NA 4ZPTR 2DPIA 1JLAB 2AJFE 4W90B 1XK8A 3UQSA 1FKAF 5AE3A 1IUJA 1WG4A 4P2SA 4DLEA 3R5BA 4R25A 5KFUA 3AJ1A 2XGQA 1RDRA 1VGYA 2EFQA 3V4IB 5CXTA 2E5LF 3MMBA 1O8BA 1LOUA 2AYMA 1M0SA 2RQMA 2L08A 3OVBA 4M5DA 2LXUA 5KT7A 1S6QA 3KHGA 2Q6BA 3MM8A 2E9RX 3M6VA 3BO3A 1N88A 1FDDA 3N5BA 3E51A 3GV8B 5J2QA 1FRLA 1YJRA 2CPYA 5KG3A 2OPSB 2ACYA 3NAHA 2BA9A 5KFMA 3NNHA 3QMQA 5HO4A 5F8JA 3HMJG 2GHVC 3KK1A 4URSA 4B02A 4ECXA 1S1VB 1XMOF 1N5TA 2GC8A 4IOBA 5KFOA 1YJVA 3MMAB 3W2VB 2ZM6F 3CCTA 1WHXA 2ILZA 2B0GA 1B0PA 3CSKA 3UW1A 1K73T 3PKMA 1R27B 4NX9A 1HW8A 4NYZA 2AWZA 1B7FA 3BN4A 1P9QC 1RT6A 3SSSA 4K4SA 3CCWA 1GAOA 4RU2A 4AL7A 4XO0A 4ZPVR 1N0UA 3R5AA 3VQTA 3OL9A 2CPEA 2A18A 3LOUA 3NS5A 5G0RB 3UFCX 2RDIA 1Q86T 5U47A 1JJ4A 3EGZA 2P9GA 2YNGA 3TYTA 2QSWA 2J9EA 2ZJPQ 4DQSA 2HGNA 2B5JA 1K1SA 3UWTA 4KRWA 4QU7A 5A0YA 1S7HA 3EGNA 4FP9A 4BCAA 4J9OA 1GXTA 2CPXA 5J2NB 4BDPA 2KFNA 2NZ4A 1KVJA 5D4OA 2UZAA 1KSPA 4NYOA 1FRJA 2LQJA 1VC0A 2ZOGA 1M90T 4I0WA 2HNZB 1N4LA 2KZZA 5EWGA 4NLXA 4DG1A 3CVKA 2W7OA 1IBLF 3S6EA 2EK6A 1F60B 2ZH6A 4I6YA 5IWAF 4OHYA 5KFCA 3QJLA 4F50A 5KG5A 3PW5A 4X4NA 5F3ZA 2VC1A 1CC7A 4CNZA 1HHTP 2MB0B 1KVIA 2ZFHA 1YJUA 2IJFA 3IG1A 4QW9A 4O3PA 2PA8D 3I96A 1UA1A 1T8EA 4J5OA 1HR0F 2JRSA 5LMUF 1JLBA 2HMIA 4C7QA 1N0VC 3CD0A 2AYEA 2DBBA 4TY9A 1DTQA 2CVIA 5DDOC 3KLEA 1X5SA 3RRGA 2K3KA 3IAS9 5CZXA 1RT1B 1S1XA 4ZK7M 2B43A 2I2YA 4NLRA 1HNXF 1SJFA 3TVZA 1YJNS 1VQ8S 2WB4A 4GO7X 2M0GB 2ZD1A 1JKHA 5IZHA 3MTKA 2HPUA 1U6ZA 5F9LA 4ZMMA 3HJFA 4DL2A 3DLKB 3K7RA 1HBUA 3F41A 5DM6Q 4DFKA 4K4UA 5CCMA 3KG4A 1OSDA 2GHWA 2CQ4A 5CZVA 2W9BA 2JLGA 2HHVA 3S1TA 2E66A 4F4KA 3FFIB 2R7QA 3J7YI 4C8OA 2DNLA 1X9WA 5DQIA 3KHLA 3H4DA 2B6AA 3G8TA 4WU3A 3QZ7A 1JXLA 4IFVA 4PCQA 2UXBF 2KH9A 3G6VA 5A8WB 4OHWA 4AXJA 5J1PA 4IDKA 3NMRA 1S1TA 4NA3A 4A4JA 2AYBA 3T9NA 4UUWA 3D2WA 2HHXA 2LA6A 3D28A 4C0HA 2ROPA 5KFVA 1ZBTA 3MM7B 2JJ4D 1HPZA 4MK8A 4X65F 2CQ0A 4ELVA 3ISZA 3MPWA 4F4ZA 4Q0BA 4G1PA 3RBEA 4YR3A 2DR7A 2HLUA 3OR1A 2YH0A 1LV5A 4KPYA 2AJQA 2QLWA 2J0XA 4GO5X 3K5MA 2VFSA 2DR9A 5CQGA 2MSSA 3TANA 1VC5A 2EFOA 5EN1A 1Q8IA 4X4PA 4Y34A 4OZ5A 4RW4A 4EBCA 2G13A 1TVRA 2ZITA 3TX8A 4LF5F 3R1LA 2HWIA 4OJ3A 4CZCA 2MQOA 4FF3A 3CE8A 3GFZA 4OI1A 4ED6A 2D7SA 3UD3P 1N5SA 5EGYA 1J5OB 4DV6F 4LF8F 2H5EA 3DYAB 3MF5A 4IQXA 4I6AA 1F0XA 1FRHA 5KFBA 4F02A 1JLEB 1MROA 2ZE2A 3GR1A 1K1QA 4O3NA 1BWEA 1YHQS 3CJ5A 2MQNA 3MM9B 1SKSA 4OJHA 4F8RA 1YJ9S 7FD1A 5J1EA 1NJZA 4HTJA 2GCFA 5KFZA 4RW8A 3US5A 3UCGA 3SCJE 1U25A 3JTPA 4JI6F 1WF0A 3FJ2A 3V5RA 4ECTA 1T05A 3QAEA 4USJC 5CYMA 4DL6A 4YB5A 1JLCA 1UVKA 2JX2A 4D3HA 2ZH2A 2DNRA 2X3GA 1G6BA 5IS2A 2G0CA 1XC9A 2UUCF 2BABA 2VODA 4DV1F 4RUCA 1X5PA 2ROGA 2ZHOA 4CO3A 5B09A 3RB3A 1R43A 3T1AA 3JSMB 3CJ3A 5B0CA 4OI2A 3I4HX 3UCZP 4ECVA 5DGAA 1ZETA 4BWJA 4I7FA 1BLUA 3MR2A 2W7AA 3EUNA 2ZNZA 5T7LB 1XEZA 1HWLA 2B4VA 4J9MA 4LVOP 5L9XA 3DXBA 3SSRA 2OSRA 2KXNB 3MURP 2IMWP 2E9TA 4ECZA 1S6OA 1R0AB 2C3PA 4UY85 4QZVB 1RT3B 4ZPWR 3O44A 4Y3CA 3N79A 3BDEA 4FN5A 4CH0S 1S0MA 3T19A 3W2WB 4EU0A 3PW4A 1SL1A 2NSBA 4ILLA 5HROA 4Y2KA 1S79A 5DDPC 3BJYA 4C8KA 4QIEA 2AW0A 3ULHA 3M30A 1RISA 1DTTA 3U1MA 5G4DA 3OJUA 1UVLA 2K1RA