2V5HG

Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
b'MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLGLUTAMATE KINASE
publication title The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 22
structure length 111
sequence length 111
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2007-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v5hG00
3TA1A 1P1LA 4RWXA 4CO4A 2VD3A 4USJC 3AA8A 4YB7A 4CO3A 2XG8A 3NCQA 3DFEA 1J2VA 5L9NA 5D4NA 3GSDA 4USHA 2RD5C 1O51A 1NZAA 2CZ4A 4CO5A 4NYPA 5D4PA 2J9DE 2NS1B 3NCRA 3MHYA 2ZFHA 4AFFA 1NAQA 3TA0A 4Y65A 1O5JA 5DRKA 4Y6IA 4CO0A 4RWWA 1PILA 3N5BA 4RX6A 4C3LA 3CE8A 4OZJA 3OPKA 1UMJA 2E66A 2ZOMA 3O5TB 5D4OA 4NYOA 1XK8A 2GW8A 1VFJA 2EG2A 2GNKA 2XULA 4YB5A 1Q1KA 4C3KA 3T9ZA 4R25A 1QY7A 1GNKA 1UKUA 2DCLA 2O66A 4CNZA 1VHFA 2J9EA 4USIA 2O67A 3AHPA 1V3RA 4C3MA 4D3GA 3AA9A 3L7PA 2V5HG 4CO1A 1OSCA 4OZLA 3O8WA 4IYQA 5D4LA 1NH8A 3AH6A 4E98A 4CO2A 4WK3A 3LF0A 3BZQA 2XBPA 3M05A 2NUUG 4CNYA 2JJ4D 1V3SA 2NUHA 1UL3A 4RLEA 3NCPA 5DS7A 4OZNA 1H3DA 4D3HA 4WK1A 1HWUA 1KR4A 1V9OA 2J9DA 4ZK7M 2J9CA 1UFLA 3TA2A 2XZWA 1V6HA 2Z0GA 1NH7A 3X3UA 2PIIA 4YB6A 2GX8A 3HLUA 2EG1A
chains in the Genus database with same CATH superfamily
3M2RA 3RBXA 1YIJS 4CO5A 1U8SA 2E7XA 4JI0J 1IM4A 2MZ1A 1N5QA 5C24A 3LALA 1M90T 2RU9A 3Q2SC 2EFGA 2HQGA 4YUDA 3RAMA 2G2ZA 3RJMB 3UQSA 3ETMA 3UDLA 2DK2A 2HQIA 2ZD1B 3NNAA 3NBPA 2DO4A 2UV8G 3EMTA 2VFRA 4MK7A 2C28A 1PJ6A 4N7TA 2LU1A 1SIWB 3Q8YA 3JSBA 5T41A 3WC2A 3IMQJ 2J8AA 2XZTB 2OHDA 5IC4B 3MMAB 3US5A 3TZZA 3OTBA 4ELUA 4OHWA 2LQ5A 3D54A 1X31C 2PMWA 5EHHA 1IKYA 3JSMB 4F0HA 4HI1A 1VQ4S 3CCUS 3OSNA 2DY1A 4DPOA 3IAM9 4DQRA 4C97A 3EGWB 1G6BA 3CJKA 2W24A 3Q89A 3JTPA 3NLCA 1RHUB 3FSYA 2XLJA 1SV5A 2QLXA 1MN9A 2VA3A 4KGKA 2FHKA 1S6PA 3QQCD 1RAOA 1O5JA 2Y1LB 3OTEA 1VCTA 2AF6A 2FLPA 2HRYA 1FERA 3AJDA 2CNOB 1PBAA 2RS2A 5IM0A 3O5TB 3TI0A 3R7BB 5J1PA 3L7OA 3IGVA 1U6BA 1T05A 1YVFA 2RKIA 1N56A 5A0YA 2PE8A 1SL1A 3QSYB 4P72A 4Q8FA 2F8HA 5IT4A 4RBTA 4ZHRA 2IC3B 4QZVB 4PR6A 1NCLA 5KTQA 4I2QB 1EX8A 4I2PB 5EUHA 1Q5YA 5I42B 2B6AB 2R7OA 4DCOB 1S4EA 2AYBA 3D0GE 5KFIA 1SH2A 4TN2A 2XS2A 3NS5A 2ZHBA 1I1GA 2X1GA 2V6AA 1HLWA 5BJRA 2JH3A 1IKVA 4DL4A 2FQQB 1TL7B 5KFYA 1RT4A 4DR6F 2P6SA 4DFKA 3HVTA 2WSCC 3MPUB 1REVA 3NGSA 2K3IA 4OJGA 4EEYA 3UR0A 1Y0HA 3KLFA 4Y6IA 3A13A 3C19A 1FRJA 4UOHA 2YWHA 5M2PA 2VG6B 3EWGA 2MSSA 4ZCKA 1KRPA 1O0PA 4ZPCA 2B4PA 1RE1B 1K44A 4ED7A 3VTIA 2GQQA 2F1FA 1PCAA 2A1BA 2QFIA 1IBKF 1HARA 3P45B 1FFGB 1HQUB 3GFYA 5LJ5Y 4EK2A 4ZVSB 1IKWA 1FDNA 4J9QA 4ZP8A 3NWRA 1TV6A 2IYGA 4WU2A 4GRSA 3V2UC 1TUWA 3ILJA 2CPEA 4YEAA 3TUPA 2LQ9A 1WOSA 4KHMA 4DUYJ 1GMVA 3U1LA 1CSJA 2ZH6A 3DOMB 2GQ2A 2RRAA 4DX7A 2HSEB 4R8UB 4CLZA 1NDLA 3CJ4A 2C3PA 3KUEA 1RTIA 3PW7A 3G8TA 4MKVA 3M2UB 3MMBB 1KONA 5AXKA 1Q5VA 5ETRA 1WC6A 1ZPWX 3HZEA 1M1GA 2CUYA 3AJ1A 4ECTA 4WIIA 4J5OA 2GHVC 1UW9A 4LF7J 1K47A 4P7VA 4FS1A 1S6QA 5KFRA 4ZKAA 1YKWA 4OLPA 4AYBD 3BH6B 3RB6A 3WHIA 2N3OA 5HVGA 4B3OB 2XULA 4R5PB 3KG1A 3D28A 1B4SA 2C2KB 4CLFA 4LF9J 3ZNJ1 5KFQA 3I87A 2DXFA 1VC0A 4KHPJ 5C5JA 2VASA 1RU1A 2WB4A 3W1YC 1AW0A 3DN9A 4ECVA 2ADBA 2QJ3A 4C0OC 3PW2A 2ALYB 4KIAA 4DV2F 1KR4A 1HNWF 5GAGI 4OYAA 3CJ3A 3FC9A 1KEKA 2FY8A 1FKOB 2XC9A 4QWAA 1RHKB 4BCAA 4U67Q 4LF4J 4WYWA 3T1AA 5L9NA 2HMIA 3DOKA 1U1KA 3T19A 2MGZB 1XBWA 1U1LA 1X9SA 1FE0A 3OHBA 5E2QA 2FHMA 4AXIA 2ROGA 1RDRA 1H2TZ 2P6TA 1FXDA 1VFJA 2OPSA 1U1OA 2M88A 5AT1B 5F0UA 4ZVQB 5CYQA 2YWEA 3MM7A 2HS4A 2DNZA 4I1TA 4C3MA 3PYFA 1LXJA 2YWGA 4H4OA 3KLIA 4LF6F 4O3PA 1S0OA 1NK4A 2YNIB 4LF5F 2QRRA 2MSTA 1BQXA 1HQEB 5I3UB 5M2RA 2V4JA 1K0VA 2VQFJ 3Q24A 1HNIB 2ZC3A 3D68A 4P74A 2UVUA 3CNQP 1HNXF 4A8QA 4GC7A 3WC0A 4ZITA 4CM0A 1JXEA 4O44B 4YB1P 5B7WA 5IWAJ 3A8EA 3KLEB 4OYXA 2UUTA 3MF5A 2YQ3A 2AJ1A 2MZJA 1SC3B 2JNJA 4HHJA 3V6DA 2ZHOA 4LFAF 5GMDA 3D1HA 1OIAA 2I38A 5IFMA 3POTA 1HHSA 4NXNJ 3KKFA 2VDHA 1WC5A 4USVA 3NAIA 2E9RX 2DIUA 1QY7A 3QRQA 4ZCMA 4NCAA 2ZWOA 4C9DA 4L76A 2CPIA 2W7AA 1N5VA 3QSIA 4QIGA 2PFFB 3AHPA 1S76D 1Y00A 4Z37A 3MEEA 1WKKA 4C8KA 4MKAA 4F26A 2L08A 3OQ2A 5J2MA 4I4BA 1NDCA 2GCFA 4P2MA 2JJ4D 2CWKA 4RPFA 4M5DB 2YNHB 3SV4A 1V5VA 5F8HA 1YK9A 5BYQA 2QSWA 4OYMA 1DQ9A 1YJWS 2BANA 4NLGA 2I9SA 4RL1A 4AD6A 3CT9A 1L3VA 3OVBA 3M32A 4RWXA 5KFXA 3SDEB 3QFWA 2HRUA 1PJ5A 2RNEA 3MUMP 4DU8A 3MR7A 3BQ0A 2KYZA 4I64A 4WE1B 2IA0A 3I0RB 3LA0A 1X4CA 3ET6A 5LSLA 1YJUA 3DGPB 3IC1A 1CPZA 3MM8A 1VQ9S 2BOAA 3N6LA 3E01A 3T9NA 1CEZA 4LSLB 3LP0B 4CT9A 2ILYA 2B9EA 5LMNF 2MEWA 3V6KA 1WSVA 2O5DA 2KI2A 3K5OA 4XDDA 5A8WA 2OPPA 3Q8UA 5FDLB 2AEFA 2ZUAA 2MPUA 1HNVA 2GVDA 5KT4A 4Q43A 4PWDA 2BE9B 5D3GB 4DV0F 3DLJA 4HACB 4PG4A 3QLHA 3W8GA 3QGPA 4DMZA 4ZP6A 1NPRA 2JC0A 3ILIA 2HNYA 3MAHA 2CPJA 1VBYA 1IR0A 3GU0A 2DNNA 4FXDA 3H59A 4ECZA 3PXGa 2EG1A 2AEMA 3MAAA 1TTHB 1T7PA 2WVBA 3CJRA 1M0SA 2RDIA 3OLBA 2ZH1A 4CDIA 4WTOB 4Y65A 4JYAF 2W2OP 1DTTB 2RQKA 2XWXA 4UOCA 4LIWA 1T11A 2MQMA 3OXGA 3B4DA 4K0KF 3A4TA 2M9KA 2EBGA 1DTQA 3E3XA 3SCIE 2DHAA 4EI2A 2N4DA 4YR2A 4OZ5A 3MPDA 4KO0A 2DTJA 1RT1A 3CDAA 2UP1A 1D9AA 3CJ8A 3AH6A 1U1MA 3S6EA 2R42A 2DHHA 2YX4A 4ETXA 3PIPQ 4ENOA 1S57A 1NJZA 4ICLA 3Q2TC 1V9OA 3SQGA 4JV5J 1S6OA 2LEBA 2QIFA 2N4CA 2KJVA 1EETB 2N82B 2M8DB 4QIVA 1QD1A 4R0JA 3VVTA 2XGQA 4NX9A 4P75A 5EGYA 4PYAA 4ZIVA 3L9ZA 4A8MP 1ACMB 4O4GB 3UCGA 4CZCA 4E8UA 3CULA 2LKZA 2KKHA 2XLIA 3QIDA 4O3QA 5GADI 4PG5A 3T5KA 3BPDA 3M9MB 1WC1A 3N5BA 1XR6A 4Y3CA 3M8QB 2H9ZA 1DLOA 4ED8A 3OJSA 2COLA 1BUXA 1P6TA 3RBDA 2IM2A 4O23A 5EX3A 1DY3A 2FD2A 2ZH3A 3UO0A 2XY6A 4DQSA 3ZZTA 1IKXB 4B17A 3VALA 4J9PA 3LP2A 1VHFA 3H2VE 5HJXA 1U6FA 1RWVB 1L3KA 1PAEX 1R3NA 2WHOA 3UDEA 3I96A 3FUYA 2EXUA 1RLDA 2GGPB 2FVPA 1F3VA 1TL4A 5DM6Q 2ZD1A 4DSEA 1SC4B 3GLJA 2ZBCA 4DU7A 3Q8VA 3T6BA 3T5HA 1D09B 4JI1F 4JI7J 3PTWA 3GIIA 3MMAA 2V69A 1HMVB 1ZS6A 4FS2A 2NXEA 3FEYB 5KFPA 1PAUB 2E66A 2V94A 5HROB 1CS4B 1WF0A 3JSMA 1VIXA 1URNA 1F3FA 4OHXA 8ATCB 2AD9A 3KNAA 1Q16B 2CQCA 1LWXA 5DQIA 3C16B 3GR1A 1UJ4A 3BF4A 4NLOA 1T95A 5CXTA 1NJWA 4ZS6A 1U49A 3PJXA 2QLFB 1R6VA 2QYCA 2DR6A 3MM6A 3VGTA 1RBLA 1NBEB 4XPEA 1SKUB 4DF8A 3DRPB 3N9UC 3PRVA 3CCQS 1HWKA 4F3OA 2CG4A 3FBEA 4I69A 4LR8A 1G1XA 2VIHA 4DF4A 2CDRB 4A8KA 2CPHA 2DGOA 2XY7A 1X60A 3R8YA 3K5MA 5AE3A 2OD4A 3UWTA 1BD6A 3FCHA 5B0FA 2EC0A 2ROEA 3ZO7A 2OO4A 1QVGR 1RT6B 4I2PA 3OW2R 5I42A 2B6AA 2BJ7A 1UMJA 3QRPA 2ZOMA 1I94J 3TAPA 1Y11A 3MR5A 5HO4A 2XHCA 3V81A 4Y2AA 3KDNA 3NG8A 2XYHB 4JV0A 3G9CA 1JLEB 4FPIA 4NLRA 2DBBA 3V6HA 1TL7A 2RUSA 1RHRB 2IIHA 1N34F 2AZ3A 3IBCB 2QG9B 2AJFE 3UR3C 1JX4A 3DRSA 4OI0A 4LT6A 5KFAA 4IH6A 4HH0A 2X1AA 1LFWA 3M6WA 3M8SA 2CPFA 2VG6A 4RZRA 1UWBB 1S0MA 4B3MF 1B0VA 1K8AT 5C25B 2B7CB 1YLXA 2BJ3A 3CF5Q 1TUVA 1PBUA 3KYLA 2G0IA 3JXOA 5CYMB 1PKUA 3H2UB 3Q83A 4K50A 3PEHA 3HI9A 2EFOA 2X3GA 5LM7E 2HLTA 5B0GA 2F4VJ 3MXHP 3IS9B 1VK3A 1PG5B 2AYEA 5AJ3F 4O3NA 2POKA 3DOMA 1GX5A 1ZM3A 1L3UA 4DV6F 1VYAA 3C8YA 3KWMA 4R8UA 4F3QA 2VU5A 4R25A 4DV5J 2XMUA 2PI5A 4D3GA 2V5HG 3NL0A 3MMBA 2IRYA 2ZDPA 2DNGA 4KKOA 3J81U 3LUYA 4DZ6A 3NGUA 3AD9C 1F9EB 4CNYA 4CP5A 4V19J 4EZ9A 2ZJPQ 4F25A 2OFHX 2KG1A 3UI3A 1N48A 4DWIA 1HHTP 2XS7A 4B3OA 2RU3A 3SXLA 4R5PA 1TUGB 4X4PA 3CMAS 1N33J 1FRXA 1SPBP 5CZVA 4CIOA 2XI2A 2NXNA 4M5KA 2BJEA 2KRBA 2NSCA 2O3DA 3NGKA 5U47A 3M30A 2CQHA 5CCMA 5AXLA 1NHVA 2B7BB 2I1RA 1B70B 1LK5A 3W63A 2QA4S 1H38A 2G0CA 2CQDA 1WC3A 4QQBA 2I0XA 4KFBA 1MLAA 5ETLA 4WCEQ 4V1Ak 5J2NB 2BBEA 3GJRB 5LL6d 3FEZA 2B3TB 2J7UA 1D3WA 1FA0A 1FKOA 1S1WB 4YHHF 2RRBA 1EP4B 4MIBA 4PYDA 3KK2B 3ENVA 1UVIA 2BKPA 4DSJA 1X0FA 2K2PA 3G71S 3E51A 4C11B 4ZLJA 6FD1A 4UUXA 4F36A 1KVKA 1UVKA 5K14B 2J5AA 7AT1B 3WZ0A 3TWZA 4IRCA 3J7Z5 4X4SA 3KDOA 1RWOB 2VQEJ 3U02A 2I5JB 3H7HB 2HIQA 2Q1LA 3G2XA 2CG8A 1AT1B 4EMDA 2W4CA 3K57A 3HSDA 3FMBA 3W2VB 1Y5IB 4OZ3A 2VZ9A 1HR0J 2FLNA 3DCAA 1ZBTA 1PIEA 4OZ1A 3TA0A 2ZVIA 2GJIA 2JEIA 2YNIA 1DFDA 3GJTB 1OY6A 2I8EA 1FJ7A 1IBMF 4GKJJ 2V4RA 1HQEA 2XTJP 2EPIA 1HNIA 4P71A 4BDPA 3D9BA 2FJWA 3NS7B 1VRQC 1H2VZ 4I7FB 4ZLLA 3HX9A 4HT5A 4NLVA 2E7VA 2E29A 3F0NA 1NSQA 2QL9B 4O44A 3W64A 1XNQJ 1BLUA 2YPYA 3KLEA 3MFIA 1J5EJ 2HKEA 4PPZA 3KMQA 3MMCB 4DV4J 4KYZA 4CM2A 4AQYF 4WP9A 2AHOB 1RTDA 4UZCA 1S1UB 3SSRA 3OR2B 1PJ7A 3W5ZA 2GHWA 3QT6A 3SFGA 4QIEA 4JV2A 2Y1RI 4DFPA 5I3QA 2CADA 2Z2MA 2BJ1A 3LO3A 4BLGA 1H7WA 3SCLE 5D4NA 5L8RC 1NK8A 4XAKA 2CZ4A 3NGTA 2AWZA 1U7LA 3UNYA 1SIZA 5GVQA 5DG9A 3A8JA 1KLNA 2ZZTA 4J91A 1RTJB 3TX8A 3QT8A 4DR4F 5FLXY 4M5DA 1HD1A 1NXIA 4MIWA 5KG6A 1IBLJ 3IR7B 2XSFA 1HW8A 2VBWA 2M52A 3N5FA 4DV7F 3BGUA 4ID5B 1T9YA 2MMYA 1OWXA 3N79A 1CJUB 2CWXA 1NZ8A 2KFZA 2HAFA 1KTVA 3I4PA 1TP7A 3MURP 4E0DA 1B0TA 3OV7A 4J7CA 2QA4G 4DG1A 2AGPA 2F63A 3CJSA 5KFMA 2GQCA 4OX9F 4WE1A 3I0RA 5F0WA 3DGPA 4KGZB 4G6VB 4B3RJ 5KG3A 1P9QC 4FKYA 1VBXA 1EKSA 3PHEA 5ETTA 2XB2D 3LP0A 5KFOA 3LWMA 2E44A 2PT0A 4Q0BA 2R7TA 3OJUA 4CLLA 1XNRJ 1UVLA 1VQ8S 5FDLA 1JNRB 5DZ7A 1FFSB 2BMBA 4DN9A 1CQMA 1N54B 3IN5A 5E3PA 5D3GA 4IRDA 4HACA 1P1TA 1JLGB 2C2OB 4NA1A 5D6GA 3R5AA 1Q7YT 1X5SA 3DKDA 3L4BC 3D5MA 4C4WA 1VLYA 4OX7A 5JXSA 4B08A 1MSWD 4AUKA 3VGVA 3CCES 2CZ9A 2MLXA 5D0HA 1NEEA 2A0FB 2D69A 4TU9A 3C14B 2B8PA 3THVA 2AYGA 2NUUG 2DEJA 1WEYA 4NRUA 1DTTA 2DHXA 2AT1B 4U9RA 1FWKA 1T02A 5L1KA 3DLEB 3PW5A 3CD5A 5IZHA 2DXEA 2CQIA 4DUZJ 3OHAA 3HK2A 2HK2A 3DDNA 3NCQA 2GJ2A 2WVFA 3MUTP 1GTHA 2EC2A 3SYZA 1PO6A 3B8HA 4J9UE 1LW0B 2J0QD 3HP6A 4PRFA 4ZPWR 2D74B 3LP1A 3G8SA 4C0BA 4FNIA 3MD3A 1EETA 1UKUA 4I67A 2BX6A 4J9SA 3EZ5A 4PUOB 3K5PA 2XQCA 3OTDA 4F4YA 3ZTPA 1N88A 1RZMA 3CMQA 5DGAA 2IBKA 4MK8A 1FTCA 2B51A 5LJ3Y 4O4GA 1PYTA 4ZVGA 1AROP 1R0CB 4USUA 3O44A 3MWBA 2R7RA 3RAXA 4TLRA 2YKAA 1XMOJ 3DYAB 3NCPA 5DS7A 5D0GA 1YBTA 1LOUA 3M8QA 2R8GA 5EWGA 1DZ5A 1FI4A 9ATCB 4ZVTB 5LXYA 4MJKA 1CJVB 3IM8A 3IG1B 5HMXA 1FKPB 4DV3J 1GH8A 4IOBA 4TU8A 1FK9B 2MTLA 2P2CB 1IKXA 2ZWPA 4JV1A 3DM2B 2YX7A 3VQTA 1UEUA 1NB2A 3F41A 4A4JA 4A47A 2VPWB 3BR9A 2OAUA 3IO1A 2YWWA 2UZAA 3BKUA 4PXDA 2AKWB 5GAHI 1RP5A 3GIRA 3KMSA 1UA0A 4RNFA 3IWNC 2GGPA 2IM0A 4DSFA 2UUCF 4ED4A 2PGCA 1RHQB 1NDPA 2C42A 2WOMA 2NYIA 2UXCF 1UPPA 3PDNA 2MY8A 3ULHA 2YKPA 3SQOP 1LFPA 3RBZA 3BO3A 2ASYA 1HYSB 1AYEA 4IYQA 2CPXA 2XNQA 3QT5A 1OS5A 3HSGA 1GMWA 4MKBA 1OQ6A 3NWGA 2VC1A 2UVVA 4DR1F 1PSDA 2FJBB 1NHUA 5HROA 4RW8B 1CS4A 3P96A 3PW0A 3HHLB 2V8PA 4F4XA 1TL5A 2KM8B 4X4QA 4EFAC 1APSA 1BWEA 1F0XA 4USHA 2PEBA 2VPXB 1HQ2A 3AQOA 2GMHA 3C16A 2ZFHA 4DX6A 1RYRA 1B0PA 2CQPA 4DPUA 4NLTA 4ED5A 2W2MP 4F50A 2F4FA 2V8VA 4QYZK 1F1BB 3MM5A 2DJWA 4WFYA 2JOQA 2GW8A 2W4PA 3DRPA 4UOFA 5A6WA 4H54A 2R8JA 1OPIA 4XO0A 2OFGX 3ZTOA 4B9NA 4YDDB 1A0OB 1KD1T 2AQ4A 4QU7A 2BJDA 2VG7B 3W66A 1RWMB 2XMTA 3I5BA 3LGNA 2WSFC 2KRRA 2JVRA 1YRUA 4LBHA 2JLFA 3LF0A 4KGXB 4DSLA 2ZBPA 1RT6A 1FE4A 1SC6A 3M8PB 3HKWA 2Q6CA 4F02A 1S9EA 4DPYA 1G2EA 1UAWA 2JLEA 2VBXA 2HQDA 2B9WA 2DVIA 4KR0B 1RT5B 1N5SA 4X62J 2BA9A 4DR6J 2OPRB 4AL5A 3QZ7A 2R4FA 1NJXA 2J6UA 3MOJB 3QATA 1UJ6A 5LOQA 3GFHA 2HS0A 3O3LA 3M7VA 2GHPA 1TK8A 3SIPB 2UXDJ 1UWBA 4FVCA 1IBKJ 3R5BA 3U7JA 2E7WA 1LWFB 3TVYA 2ZE2A 4CRJA 4KH0B 2UUAJ 1MU2B 5L46A 4F3MA 1T0TV 5KAKA 5IV4A 1N32J 4F7VA 1S1XA 4KPCA 1GMUA 2HURA 5IOLA 3JYTB 2CJAA 5SUHA 1FKAF 3DC2A 4A48A 2K3KA 1VQ7S 2RMLA 3KXDA 5KFFA 2QC3A 2RS8A 5L1LA 3QJPA 4LVOP 1S99A 1PYOB 5ETNA 4YB7A 1RAEB 2XCPA 4KTQA 2DNOA 1YBAA 3HHLC 4WZMA 1XTZA 3MFHA 2V2VA 2KM8C 2RHQB 1X5OA 3KG4A 4DDFA 4YS2A 4ZIWA 5H9EJ 4ZP7A 2ACMA 3C6UB 4HH1A 3PRDA 4EO6A 1GT8A 3IWXA 5D4OA 1S7IA 1IWAA 2AP6A 3T1HJ 1I3OB 2DCLA 3PM9A 1TZ0A 3TJAA 2IFXA 2VA2A 3S7RA 3K2YA 1XR7A 1KOOA 2EEYA 1VQKS 2MZQA 3F56A 5CA5A 1B3TA 3IBWA 5AXMA 4UOGA 1F60B 2WW8A 2BQRA 2HHQA 2YKNB 2BM0A 4NEYA 4Q5VA 5HQMA 1HNWJ 5J2NA 1YJTA 1MROB 2MZRA 1QSLA 3CDEA 3FBBA 5B0DA 3G6VA 4DPWA 2XO6A 1VQOS 1KQGB 1WWHA 4N8OA 3S01A 3G6YA 2MKCA 5BXIA 2LQ8A 1S1WA 2GMJA 2Y8YA 4IR1A 4LR7A 1EP4A 4L72B 3KK2A 4USMA 3LQVA 3IRXB 4YN3B 4NWBA 4C11A 2V67A 1M5KC 2KXFA 1K1SA 2VKZG 2OMLA 1TR0A 4RUCA 3M6XA 3NRBA 3D3CJ 3UVJB 5K14A 3HFVA 4PXBA 1KTQA 3BYPA 4DL2A 4LJMA 4C98A 2CJBA 1PC5A 2EK6A 2I5JA 3HD1A 4IFYB 1FVQA 1RAJA 1C1CB 3W2VA 4RW9B 1TKTB 2LMIA 3C2PA 1Y10A 2BE7D 3DU6A 1NH8A 5L39A 1U48A 2W9CB 1NJYA 2WCXA 5M2UA 4LF5J 3R6GB 3JTNA 2VL1A 1FDDA 1XN9A 2ZEJA 1CQNA 3DHXA 1EJ7L 4J9OA 4CLTA 2CQ4A 4PG8A 2P9EA 3ZZPA 3Q0AA 1YGYA 4I7FA 1MG7A 1TFWA 3K5LA 1SKSA 4Z7YA 2V8GA 2PDAA 4TKTA 1LQ9A 3R3TA 1SC1B 1O51A 4NYPA 2FHJA 1RABB 2R2RA 3KHHA 2XMAA 4LFAJ 3MMCA 2WVEA 4QJVA 3GV5B 2ZHAA 1S1UA 2N3LA 3MZIA 3FVYA 4HHUA 3OR2A 4DV1J 1EQMA 2H1YA 2VFVA 2GIQA 3NKYA 4DL3A 3PV8A 1GXTA 3D2WA 2BABA 3SI8A 4ZVHA 3PHTA 3KJQB 2HFOA 2GAHC 3NGDA 2QL5B 4ZLNA 3N4WA 4OI1A 1HBOB 1QUPA 2DR7A 3DI6B 4X66J 2YXLA 4CLYA 4P73A 2R9LA 2D3UA 1H3DA 4FPRA 1W2BR 1RTJA 5G0RB 4KY3A 2IJRA 1UFKA 2KT3A 3HCXA 4Y2KA 3HO1A 5F8IA 1SL2A 5IQQA 4DUYF 3MTKA 5DM7Q 4ID5A 2OD6A 4IFVB 3HT3A 1CJUA 3GIJA 3EUNA 2Y0BB 1GX6A 3A8KA 2FVQA 1QJHA 4WZQA 1SQFA 4L3KA 1C0TB 3AY0A 1S77D 1S1VB 5KOWA 2FJDB 3M9OB 2BKOA 5T7LB 2XMKA 2R2SA 4LF7F 4ANDA 2XS5A 1U2RA 3CWJA 1GXLA 5KOXA 4ZVUB 4N76A 1SVDA 2J6TA 2Z57B 4FZVA 3B54A 1IXKA 4LF9F 4JI2F 2MQ8A 2ALZA 4KHPF 2HHUA 4DV0J 4C8LA 3DHWC 1B99A 1WF2A 1IJFB 2Y1JA 3TA2A 2KH9A 2CNLB 2CJ9A 4FNHA 3OT9A 4EGLA 1JLGA 3WX8A 2OEMA 5HVHA 2YVSA 1FO1A 2VF3A 2WK4A 2CDQA 1UETA 3N28A 1M5HA 4OJ3A 4BC9A 1QAIA 4N8NA 1SJ1A 1YITS 4TNOA 3G6ES 3GILA 1TL3B 2GO9A 4FYYB 1RGVA 3TAMB 2WB1D 3BO4A 3GP9A 3CTRA 4JYAJ 2LP4A 4TU7A 3C14A 1TKZB 5ETPA 1F9HA 1S0VA 4YY3J 3UFCX 2Q3PA 2BEFA 1OMSA 4QWCA 2HQFA 4DHVA 2B43A 3VAIA 1BWVA 4ECSA 3DLEA 4OMFG 2BW7A 2HQ3A 4KBIA 1DJ0A 2LXUA 4ZA1A 3UW1A 2AJQA 2RQ4A 1R0BG 4K4WA 5DLFA 2ZM6F 4TY8B 2BUNA 4X64F 1CG2A 4ZVFA 2QLWA 5DO2A 1FT8A 2H51B 3KK1B 4K8RA 2YKOA 1TKDA 4GKKF 4PWUA 3BGLA 3HHDA 1LW0A 2ZKUA 4RNNA 2R2TA 4AL6A 1DRZA 2GX8A 3D6TB 1I6JA 1WTBA 3QJLA 4CO3A 4RNMA 5KG0A 4L73A 4PUOA 3PO5A 1Q8IA 4H4KC 2AEJA 3NOCA 1NAQA 3FFIB 3ENQA 5IWAF 4J37A 4RW7B 2DNYA 2UU9F 3LAMA 3ONQA 1WDTA 4PZVA 3DYAA 1FVSA 3FZ2A 3NXZA 2E5IA 3WQPA 2D3O1 4LRFA 3MPVA 2FZGB 2MKHA 1CJVA 4NLUA 3IG1A 1FKPA 4ECWA 1FK9A 3IR6B 3DNCA 2CVIA 3DM2A 2EFNA 2ZNYA 2D7SA 2QA2A 1YI2S 2HIYA 1MMNA 1SJ3P 3BGOP 4RO0A 4I0WA 2MQNA 1XC9A 2FZCB 2M5YA 5F3ZA 2XGPA 1ZM4A 1R7IA 3ICLA 3N0VA 1OYDA 3T5JA 4NLXA 5G4DA 4TVAB 2MQQA 1YTYA 5F8NA 3MUVP 1SKWA 1HI8A 1HYSA 1Q79A 3MCNA 1TAQA 1CJKB 1FJGF 1JKHB 4K4SA 1RB0A 2Q66A 4LFCJ 5KT6A 3R27A 2HK3A 3G86A 4FF2A 2D9PA 4WP3A 4OX8A 4U96A 4ES3A 2V2QA 4B9TA 1AFJA 4USTA 4DL7A 2VODA 3HHLA 3DDIA 4ZLPA 1U1QA 2R7VA 1XWLA 3CCTA 4DR2F 1NPPA 1U09A 4ID8A 3OR1B 2IHR1 5C2GA 4U8VA 1NK0A 1UL3A 1WEZA 4R0EA 1UZDA 3H4BA 4V19X 5I3PA 1TVRB 4IDKB 5J1EB 2Z2LA 2L9WA 4OIXA 5J2PB 2KB2A 1EARA 4F67A 2AX0A 2KO1A 1DHMA 3HHNB 3TUZC 2HW3A 2KFNA 1P1LA 4XTTA 2KG0A 4CYUB 1BQMB 2OMOA 4LQ9A 4O3OA 1N36F 4A8WA 1YZ7A 2VG7A 2AGQA 1FEEA 2LVWA 2QV6A 5KFSA 3GR0A 5HI7A 2WSEC 4Y28C 4OL8A 3QAEA 2BR0A 4WU3A 2MQPA 3OPKA 4LMZA 2A10A 2G1HA 3I31A 3O2IA 2A2CA 2RE1A 3TEGA 4U8YA 1LV5A 2XY5A 4NLWA 4KE5A 3QYYA 4QR0A 1GFWB 2E9TA 2A2DA 2NYHA 4GVBB 3DRXA 4AE5A 3IAS9 1OO0B 2HHHJ 2NZ4A 5FD1A 2VDIA 4HEA9 1RT5A 3R5GA 1JJ4A 1T9UA 4DCJB 1N34J 1FX4A 2FLLA 1FJCA 3Q8QB 3DOLB 1RWPB 3JSYA 3CC7S 4WJBA 5A6PA 2P5VA 2PA3A 2HHPA 2V0NA 4EBDA 2LQBA 2MZTA 3EGZA 4ZN1A 4WBFA 1Q8BA 3R5CA 1JLAB 2P9GA 4A46A 4HTIA 4B3MJ 4K5SA 2WVDA 4ER8A 3I0SB 2M8HA 1N6QA 1S48A 3M8RA 2ZJQQ 3W65A 1LWFA 1Q0NA 3CO9A 3OFHA 3IWLA 1MU2A 2YX1A 4I68A 3PX6A 2DKOB 5HL7Q 2QO3A 1KNZA 5B0CA 2V8DA 3JYTA 4DV6J 3M1VB 4TYAA 4USIA 2DYAA 5H9FJ 5KFZA 3UDVA 3GTYX 3BKFA 2H5JB 2ZKTA 4CLSA 2KT2A 3UN2A 4LRAA 5T14A 3VAHA 1N0VC 5KG2A 4FP9A 3M8ZA 4TQRA 2NCKL 1HWLA 4GMKA 1GEHA 2P8IA 3C6UA 4D3HA 4HHHA 4WIQA 4ANEA 2HZAA 4CI0B 5HATA 1VQNS 2GMLA 3QRRA 1Y5NB 1Z1ZA 2OGUA 1YJRA 3B82A 3GCWP 3W3SA 2C22A 2FC8A 1HL6A 1U26A 5E3QA 1D8YA 3TVKA 2UUBF 5C7PA 3L95X 4UQTA 5KFHA 2MJNA 4MAKA 2O01C 1X4GA 1TFYA 2YKNA 4YFUA 3PR4A 1HD0A 5BR8F 3VZIA 1MROA 2DH9A 4YHHJ 2M70A 1LWEB 4PEOA 3FKBA 2E9ZA 1KHWA 2OJ3A 1KN6A 3CCLS 3DMJA 4PG7A 4N5SA 1NM2A 3CCZA 3CJKB 4NPOA 3FK4A 5HP1B 3IRXA 2ZBIA 4LSNB 2NQPA 5K8NA 3GMGA 1HPZA 3AOAA 3TAQA 1SV5B 3UVJA 3QFHA 3J7YU 3BO2A 2Y9HA 1AZSA 1K73T 1K9MT 3E8OA 4C2MA 4PXEA 3E2EA 4DR7F 1LW2B 4ZPAA 3OLAA 1DQAA 2D3ZA 4HTJA 4Q7AA 4JI5J 2HFSA 2C3UA 4RW4B 4EZ6A 4B02A 4IFYA 2RKIB 4C8MA 4OHZA 1C1CA 4RW9A 1TKTA 4ECYA 1JIHA 1G7CB 4ZHRB 1QVFR 3BV8A 1IBMJ 3MGJA 5C42B 1PGZA 4QIWD 5F8JA 4WFBQ 2J8SA 2WAQD 3VR1A 3HXMA 1YX2A 4JI6F 3IFEA 4M5NA 2G2OA 3OTOF 5IV3A 4NXMJ 3M9NB 1I94F 1F2GA 4LFBF 4UZBA 1S5ZA 1NPKA 3ZZRA 1H73A 2HWHA 1IKVB 2BRLA 1UWAA 3MEGA 3J80U 2J0SD 2OEKA 2NUHA 4AQYJ 3H5SA 4RLEA 2BZ2A 4TQSA 4EYIB 2JSXA 3C15B 4WK1A 1REVB 3GIKA 1DURA 3KLFB 2JEFA 3X3UA 1GMWD 5MLCV 1CC8A 1NO8A 2HBZB 4NI2B 2RQMA 2IA6A 4PABA 5KFKA 6AT1B 1VQYA 2C2NA 1VDHA 3RGIA 3AFGA 5KFGA 3TZYA 2QMXA 1FJEB 3UD3P 1O6XA 4K4YA 3WBZA 2BJ9A 1Y4ZB 1HBOA 2RIJA 1IKWB 4NLYA 3PCOB 4DR4J 2W1BA 2MY7A 2W2NP 4YOEA 2J7KA 4G1IA 1KHVA 4DV7J 2F4VF 3CUNA 1RSCA 1NDKA 4XK8C 2O67A 1WI6A 2QYGA 4MMOA 2W25A 4IFVA 2UXBJ 3L09A 3W60A 2YKQA 4ELVA 1TK5A 2HNZB 4LF2A 3HHKA 4QWBA 1S9FA 5HMWA 3R7NB 1S1VA 5F41A 3TQ1A 4Z7CA 1RT3B 4FXWA 3PNIA 1TK0A 5T7LA 2JVOA 2CQBA 1VQPS 4OHYA 1VHIA 5A2QU 2ADCA 3RB0A 5EWFA 4OYBA 1XEZA 2E5GA 4IG3A 5D78A 4NMXA 1RA7A 1N33F 1TL1B 3PR5B 1N5YB 1XIQA 1IM6A 1H2UX 2DB1A 4UQGA 2VPZB 2AJ2A 3CB4A 4XDCA 1MWZA 2DRAA 5JVGQ 1OY8A 2MJUA 1B7YB 3T9ZA 2BOPA 3W61A 2HS3A 2FVCA 4LF8F 1ICEB 2FZKB 2B0GA 2Y0SD 4E98A 2EK1A 1HI0P 4C8ZA 3TAMA 3MPYA 1S97A 1UP1A 3DLKA 1HIYA 4WKYA 3GWCA 2LU2A 4ES2A 5DLGA 2HMIB 3DOKB 2A6MA 1TKZA 2ATLA 4FXVA 4FYWB 1ZETA 1U24A 1X4BA 1WHXA 3OFEA 3SZ2A 2CPZA 2LDYA 4OZ0A 1FD2A 4UY8T 4Q2MA 1D1UA 2VPYB 3TW0A 4JBCA 5CYQB 1V5IB 2ZOGA 3MCMA 4TY8A 1UPMB 1S9GB 3C6TB 1H7XA 5LXRA 1Y5LB 2E1PA 1KWMA 4WF9Q 2J7WA 3KLHB 2HGMA 4NMLA 2K1RB 2J76E 3H0PA 5KFDA 4A8FA 4QOTA 3FNNA 2V4JB 1PC4A 4B3SF 1A9NB 4GKJF 3ITHA 5ETSA 2WTFA 3R2DJ 2ZNZA 4M95A 1X5TA 1IBCB 3NY0A 3GYNA 1S79A 4AL7A 4LQ3A 1VJQA 2HEKA 3BH7B 3BDEA 3HDSA 2YNGA 5F3TA 2Z2YB 3TYTA 3IXQA 3A3OB 3H8YA 7FDRA 4I6WA 1HWUA 3V6DB 2V2ZA 1MWYA 5HVFA 4KV8A 4EU0A 2DXDA 5C2CA 3NEKA 3NNCA 2SXLA 3HFZB 2WW4A 3PJWA 5KG7A 2VH7A 1XJWB 4CT8A 3BSCA 3UN3A 2IDLA 4P2XA 4WP8A 2CQ3A 3R1HA 3CD0A 2LXFA 1PILA 3QO9B 2V63A 4F2SA 3AD8C 3BN7A 5D15A 2VONA 9RUBA 2EWHA 2HGNA 3OD2A 2JL9A 2CXEA 3CJ5A 2UUCJ 1JJ2R 2UXCJ 3MEDB 2PO4A 5ETOA 1IBLF 4NA2A 2MKYA 3O6QA 4M5GA 2H4WB 3D0IE 3DLLQ 3CD7A 1S6UA 3M32B 3IP0A 1CJKA 1JKHA 3KLGB 4DR1J 4C48A 4MK9A 4G1PA 1UCNA 3ET6B 1FCAA 4ZDNA 2QLBB 2RF2B 3E01B 1OSDA 3VWSA 4OYWA 2OEJA 4ZP9A 4ED0A 1E6YB 2MDAA 1CBKA 3WX4A 1SJ4P 2BRKA 3W5XA 2XI3A 3KUHA 2XMMA 3OR1A 1U6ZA 1AUSL 2JZ5A 5DG8A 2FHJD 3F73A 2V9KA 2XLKA 4IDKA 5J1EA 1T9TA 5J2PA 2E5LF 4EUVA 4NZ7A 1YRTA 4ED6A 3EICA 3D66A 3FQKA 1Q4RA 5F8MA 2OSRA 4OHVA 4I56A 3EZOA 1QAXA 4KJIA 4CYUA 2MYFA 1BQMA 4QYZJ 1XMBA 3SSSA 2ZH8A 2V9WA 3KUGA 2VG5B 2IMWP 3TQEA 4HDHA 3LOUA 3W7BA 3T6JA 5FLXU 4NASA 5L9XA 4DR5J 1RTHB 2MLYA 3D3BJ 2YNFB 5CH7B 3UE2A 4GVBA 3EVMA 2BQUA 1RADB 2HBRB 3T5LA 4RKUC 3BGFA 3TNVA 3OVSA 3EPGA 3HJFA 1MMDA 4TXSA 5LMUJ 4KO0B 4OFZA 4C7QA 5B0BA 1FXLA 3AT1B 1RT1B 5CABA 1TQLA 3PX0A 2AMCB 3CW2C 3IM9A 1S72S 1JLBB 3PW4A 2I6WA 4U95A 1OQ3A 2CFXA 4C8NA 1UEKA 1KLMB 1FEHA 3I5AA 4U7UK 3R7SB 2AGOA 4FYXB 3FCWA 1RWXB 3ZTQA 2BYCA 4OZ2A 2EKYA 3H42A 5AE1A 3HF5A 4IKAA 1VQ6S 3KOAA 3QT7A 2M2BA 3LGMA 2IC3A 4ZVOB 3BBCA 1KVJA 1NJIT 2B5JB 2QZ8A 4BWJA 1EIYB 3HVWA 3THPA 2R7WA 4I2QA 1Q86T 3KNGA 2DR5A 1S7HA 2IJFA 1JXLA 1S1TB 3BB5A 2CYYA 1RTZA 3RW6A 5HANA 2C3OA 5D77A 2ZC4A 4QPXA 3NCRA 2JDJA 4DV3F 3HJVA 1AXQA 3A1YG 4NYOA 2DH8A 3W9JA 3DXBA 2NXCA 2GV1A 5GAEU 2KT5A 4PQAA 2PD1A 4FF4A 3Q23A 8RUCA 2LDIA 5LT5A 1SH3A 2C2EA 2B4OA 3BKTA 4WFXA 1BQNB 1VOMA 2IM1A 3PKYA 3KTQA 2RHSB 3AA9A 1BE4A 4CO1A 2E1MC 1BHNA 4LBPA 2MKJA 4ZVRB 1RAIB 2DR9A 2KTQA 2F65A 3M05A 2QL7B 4QW8A 2G1DA 4M5LA 2Y8WA 3RR8A 1HQUA 2F9JA 3VV2B 2Z0GA 1T9XA 4KSEB 2FJXA 1FTRA 2I2YA 2IPOB 5ITHA 3V5RA 4PG6A 5GMKa 1LWEA 4W4MA 2J9DE 4P7TA 4RBVA 1EHWA 3RTVA 3LW5C 4QPTA 4ZPTR 1NKBA 3PG9A 4USKA 5HP1A 3KK3B 4CTAB 4LSNA 3M2UA 4OLOA 4DEZA 1FWLA 2CRLA 3ISNC 3VAKA 4O3SA 1VGYA 4HI2A 3MM6B 2MHNA 1NU4A 2HHVA 1VK8A 2DD8S 3QPIA 4DQPA 3CGIA 2XMJA 1XMQF 1LW2A 4AT1B 2AX1A 3AJ2A 1Y3JA 1SKRA 4K2XA 4ETZA 1Q8KA 4RW4A 3PFOA 1WC4A 3VVUA 3TJ8A 3BZQA 4OI6A 5EWEA 1WG5A 1XQIA 4IQMA 3CDUA 3KFWX 1BC6A 3ZTSA 1H72C 2JHEA 4GVLA 5C42A 3HMJG 5K8MA 3R5DA 3NMAA 3MR2A 4C0HA 1WHWA 4KH1B 2CNKB 4YB6A 3M6UA 3HSZA 2J0WA 4KHRA 4DR3F 2RT3A 2PSZA 1FF2A 5CD4A 3V81B 1K0TA 1ZTTA 4OV1A 2JX2A 4CQ1A 4B9SA 2OP5A 1FHTA 1RAGB 1QTMA 1ZAVA 4X62F 1JLFB 2XO7A 2DR8A 2FPHX 1L3SA 1F2HA 3BSOA 3C15A 3DRSB 3CD6S 3G6XA 2IVFB 3ZNUA 3S1TA 2BW2A 2AIRB 3L3CA 4UF4A 4NCBA 2MGZA 2NSBA 4ECQA 3R9LA 5ETVA 4NI2A 3NGRA 4Q45A 2GC8A 2UXDF 1ROFA 4KB7A 3P8BB 2H65B 2PMZD 3A3PB 3HHLD 2D41A 5RUBA 2GZOA 3MD1A 2X1BA 4CLKA 2E1CA 3W9HA 4QBUA 4J9LA 1R8BA 2UUAF 1W25A 2A6OA 1UFLA 2HHSA 1Q78A 2J6SA 4X4VA 2R8KA 2NPIA 1N32F 1HI1A 5HK4A 2VV5A 1ZM9A 2V68A 1QAYA 1RA6A 5I3UA 4J9KA 5KFTA 4ZJLA 2G4BA 4JB8B 5H9EK 3I9V9 1WKLA 1O8BA 4KQZA 4K4ZA 1YG0A 2X3DA 2C3YA 1W7WA 2HPUA 4C3LA 2XM3A 4B3TJ 2HNZA 3QNWB 3D1OA 1WHYA 4IG0B 4KKOB 1WHVA 3W2WB 1RT3A 2QN6B 4QWDA 4LUBA 1U8WA 3I4HX 2CJQA 4K4TA 5L38A 3FGVA 2O66A 1FWPA 2QGFB 1ZM2A 4DLEA 3MCSA 2VBYA 3V4MA 3T1HF 2LEPA 4JP8A 3QGGA 4JI2J 1UZHA 2QTWA 3H90A 4K2JA 4A8OA 4P2FA 1NSAA 2ZJRQ 1TL1A 1N5YA 3M30B 1SJQA 4IR9A 3Q8RB 2Z56B 1N52B 1RHMB 2DNQA 2OSQA 3CJ2A 3GJQB 4TLQA 1S49A 4KFBB 4O3RA 4PQUB 3I9ZA 2VOOA 1R8PA 2KYXA 1IJEB 4CH1A 2YNHA 2MQLA 3DRYA 2VJUA 1YJVA 4NZ6A 3T1YJ 3MHYA 1RWUA 3EZUA 2HNDB 4ANCA 3P5BP 4LREA 2V50A 4U7UD 3SV3A 3TUIC 5E3CA 4X4TA 1QE1B 2D9OA 4URQU 2CA9A 3SDEA 1NNDA 3DDKA 3R2CJ 1JJCB 4G1QB 1FXRA 4GC6A 2XMVA 2M3DA 5FIIA 5IS2A 1FD8A 5ETMA 3UD5A 4HVZA 4DL5A 1VQLS 4OZLA 2G9OA 1JLQB 2EW9A 5HAOA 4NCGB 2HLUA 1VBZA 1Q53A 4A8YA 4LSLA 1C4AA 2IM3A 2ZM6J 1M1KT 3KLVA 1FESA 1NHKL 4QR2A 4X64J 3CEDA 3D6FB 3O1LA 2D1CA 4OYIA 1SL0A 1Y9OA 2WONB 1RU2A 1S9GA 3C6TA 1N4LA 3DLHA 4GKKJ 3S8SA 2DRDA 3H40A 1R8CA 3J81j 3OXFA 3KLHA 4DSKA 4X4NA 2K1RA 4HLBA 4JI8F 2IYIA 2PFDA 2KFYA 2OKQA 3BJYA 1R43A 1RT7B 3K8WA 4I6YA 3JQJA 1TU0B 1IWGA 3CC2S 4DXLA 4LSZB 5J2QB 1IUJA 4UT4A 2XNRA 2B9YA 3I5CA 3SCKE 3QJJA 1X4DA 2B4UA 5IQ6A 4PXCA 2UU9J 3RU0A 2GAGC 5A8KB 2FHOB 4DBQA 2FTRA 5JUMA 4NLDA 2C1EB 3HPOA 1U0HB 1RTDB 3VF0B 4ECUA 4MKYA 5DETA 2LYVA 4DV1F 2JEGA 2DGVA 1ZA2B 2QX0A 2DGUA 5CAAA 3LPEA 1EQ0A 2QT7A 2WBRA 1D8ZA 4ES1A 3RBEA 4M8LA 2N7CA 3QO9A 3GIMA 1LNQA 3N01A 3VAFA 4O4RA 1QSSA 5SZTA 2HVIA 4EBCA 3KHGA 1X0PA 4X66F 4KC5A 3G82B 1LK7A 3G8QA 3L7UA 2AYMA 5F9NA 4MH8A 1AA1B 3MEDA 2K8GA 1U4BA 1TMJA 1CJTB 4JI3J 4BC7A 1AFIA 2H5IB 3CDBA 4JI4F 1X4HA 2FGCA 1FJGJ 1DARA 1G3OA 4AXJA 2RQCA 3K0JA 1URRA 1WUUA 4YP3A 3KLGA 4DG1B 4ATNA 2L9NA 4C3KA 4EO8A 4WFAQ 2JWNA 4LIRA 1BY9A 1ZAWA 2J9EA 2RF2A 3HVAA 3BBFA 3NAHA 1JQGA 5B0AA 3C46A 5EN1A 1U02A 1JWWA 3SEOA 1NK9A 5E3RA 1KKHA 2RILA 1T94A 4DR2J 1REGX 1E6YA 2QA1A 2C2DA 3UCUP 4Q0BB 3EX7B 2HFUA 4RBUA 4B9UA 2FVSA 4B9MA 3AODA 3KHLA 2XMWA 4BS2A 3UN5A 3OBIA 2BE2B 1YZ6A 4OYZA 1H0HB 3D6MB 1ZZNA 1N36J 1P27B 3UNGC 2XYPB 3FEXB 4AFFA 4LR9A 2OH2A 1ZAXA 2BM1A 3MTJA 3TR5A 1NK6A 1JJHA 4HT7A 2VG5A 1NUEA 4LRDA 3VHQA 3N6NA 1Q7LB 1H6KX 2IMOA 1WOOA 4ZCLA 2HG4A 2VUGA 3HD2A 1P9YA 1X4AA 1RTHA 3BDPA 1HMVA 5AE2A 4K7QA 4YY3F 3RB3A 2DNPA 3AD7C 5KFNA 2YNFA 3GFXA 1EZZB 4JUZA 4F4WA 2IVMA 4KGVB 2L3MA 1TMMA 3I55S 1Q82T 1HHQA 3DRRB 3OL6A 5E0OA 3BQ2A 2GS8A 2IY5B 4Y34A 3DLGB 3I82A 2YPZA 4Q44A 3X1LB 1DQ8A 4EWTA 4YMEA 2RB7A 4ZN3A 1HNZF 1EAYC 3H25A 3K17A 2OELA 2EVZA 1RUSA 1JLBA 5DZ6A 1KLMA 2GJFA 4ZMMA 5KFLA 4DSIA 1M5OC 3LP1B 2KVIA 4DPXA 1VJWA 2NS1B 2RDJA 3TANA 3CCWA 3F44A 2ZITA 2DNLA 4QW9A 2JFKA 4KPYA 4KAIA 4ED1A 3OVAA 4W92B 1WNEA 5ADZA 1HBUB 2OLWA 5IT9U 2CQ0A 5IXUA 2YWFA 4RU2A 2M7SA 4ZJOA 2B5JA 1RWKB 2QE5A 5I4MA 3VAGA 5DG7A 1HA1A 2CJKA 2HAIA 2MKKA 1CVJA 3NNHA 2OUGA 3JTOA 2RRNA 4P6QA 1R8AA 5IC6B 1DBDA 5D4LA 1S1TA 3GZ7A 1T9VA 1JXVA 2ZH9A 5HQ8A 4N56A 3GV7B 4YR0A 3FQLA 5K20B 1SXLA 2CQGA 3HULA 3OXLA 1N5TA 8AT1B 1JLEA 5JJBA 1SUQB 2A3JA 1RBAA 3G87A 3TOQA 1KOHA 4MYTA 2HBQB 2Q79A 4ELTA 1VR6A 1BQNA 4RU9A 4RR5A 5AXNA 5D4PA 1SI9A 3LANA 2UUBJ 2ZBRA 4K59A 1YJ9S 4MFBB 2WOMB 1JNZB 5C25A 3CCVS 2R7QA 1Z2LA 2CPDA 4QIFA 1KQSR 1U45A 3ZZYA 2ABYA 5CYMA 1VRUB 1W2IA 2DGTA 1HWJA 1VMBA 4HL9A 1VRTB 1GNKA 3J80Y 2V4QA 1VQMS 4YQWA 2Z4PA 4S0MA 2UVRA 2E1AA 2LCWA 5BR8J 4LFCF 2VJVA 3C3LA 2Q43A 2MKIA 3IS9A 2GFFA 5EX0A 2X7IA 3B6BA 2K7KA 3MM9B 1NKEA 5J1NA 1EB0A 3LAKA 2MXYA 4DQQA 1SB6A 1C2PA 2CIMA 2LA4A 5ETQA 3MPWA 1IQTA 1RKIA 2VFTA 4X65F 5KFVA 2V8HA 3GB0A 3I32A 3KK3A 2IRUA 4CTAA 1R6YA 3CVKA 3ZZ0A 4RW6B 3W9IA 1WDDA 4CCHA 1TKXB 3HSJA 1X5PA 3MM5B 1ZOTA 2F40A 3K8VA 4DR7J 4WXOA 2E5JA 2BVZA 3LTOA 4Z2XA 4JI0F 2VBZA 3BN4A 3QIPB 4RX6A 4N77A 2OPQB 4OZJA 1GXUA 2DPIA 4DOZA 5HBMB 3J7YI 1EKRA 2VFSA 4L3NA 2GVZB 2ZH4A 1WOPA 4WPAA 5L1JA 2LQJA 4IH7A 4JI6J 4BBYA 3CC4S 3OTOJ 3TX0A 2KHCA 4K4UA 1OYEA 1IQZA 2C2RA 4DV2J 4LFBJ 1S9EB 4FDFA 4CH0S 1ZYQA 2WVCA 5A2QY 3JAMU 2HHHF 3TARA 2BKNA 1Q8LA 3IBFB 3PKMA 4ZK7M 1NB7A 5HSPA 4F4ZA 1JLFA 3QBCA 4IUFA 1WACA 3EPIA 1KQFB 4ECRA 3A12A 4X2BA 2IBOA 2GA7A 2YKMB 1FRIA 1S0NA 3I56S 4DUTA 1Y7PA 2Q6BA 2FDNA 3CJTA 4P2SA 5BYSA 1KS2A 4ZCIA 3IRWP 4OI2A 2CVEA 1M5SA 1U0SA 3Q22A 2HBYB 2R8HA 2ZE2B 1FRMA 2YTCA 4LF6J 1R0AB 1WJ9A 5H9FK 1H74A 2F8MA 3VCDA 1S1XB 2VOPA 1VC5A 3OUYB 2ZBQA 1ELOA 1OSCA 3TZXA 4CH7A 1HNXJ 2XSJB 4MYUA 2E5HA 3CCMS 3PYDA 4PAAA 3FDSA 2HVEA 4IO1A 4NZ0A 1U25A 3GFZA 4ILLA 1RISA 1JLCB 2HQCA 4DLGA 2OTJS 5A8RB 3AXKA 1S59A 2HHTA 1FNXH 1R31A 4IG0A 3M8YA 3W2WA 2Z30B 3BGRB 3PVXA 4KT0C 1X4FA 4LVNP 1ZZFA 2DY9A 4USJC 2IRXA 1ZTWA 3DFEA 4U7CA 1J5OB 2XYGB 1IR2A 1UA1A 7FD1A 2DH7A 2IAJB 1M5PC 1QUVA 2RSQA 4K4XA 1OPZA 1RXOB 2HWTA 3CO0P 4C8OA 1IVZA 1ZA1B 3SMZA 3NMRA 3HZGA 3CSKA 2H54B 2HVHA 2U2FA 2K06A 3PACA 4DCPB 5KT7A 3D1QA 4LF8J 2R3VA 5HLFB 4PQUA 2EKNA 4G3IA 4C8YA 4LRCA 3H4DA 2FLOA 1WORA 2XBPA 2LLZA 1QLNA 2HNDA 4F04B 1QE1A 2FC9A 1D9DA 2PIIA 1KSPA 3HLUA 4G1QA 4DJBA 2LFVA 2KZMA 2HRTA 1B7FA 2DGXA 2DNKA 4QR1A 3D67A 3KJNB 2XZDB 2R7SA 1JLQA 4NCGA 2L9DA 5LMNJ 1MMLA 1T8EA 3D6HB 3ZZZA 3K7RA 1UVNA 4DS5A 4JI5F 1YRXA 4UY85 1LKZA 3PJ9A 3AQPA 2WONA 1C4CA 3EVOA 3AOBA 5GAGU 2YH0A 5CZXA 2ZOFA 3KJVB 3IR5B 1F9FA 3BBBA 3QAUA 3CCSS 2ZH7A 1NK7A 1OJ4A 2NXUA 4B3SJ 4CLPA 1QDUB 1RT7A 1U1RA 1OY9A 5HN0A 4OJ1A 3EE3A 3FZBA 2PN6A 2LECA 5J2QA 2H48B 4OI4A 3VAJA 3ENAA 4NXMF 4J90A 3H5UA 3ZZUA 1B64A 1WKJA 4ALZA 1KQKA 3RUBL 1FNOA 2J9CA 3BSNA 1W26A 5A8KA 3PEJA 5KG4A 2ATCB 3VGUA 4DL0C 2LEAA 4JOUA 4LF4F 1KVIA 3H98A 1SQEA 1U0HA 3ZC4A 1YBUA 3D7SB 1CC7A 4RNOA 4K0KJ 4WWSA 1HBMB 2RD5C 2R8IA 5HQLA 4BWMA 3T41A 2QMWA 2KU7A 4F8RA 4RJVA 1HFEL 4F0KA 3U1NA 3TUJC 2GIRA 1SJRA 4DI6A 4ITSA 4M5MA 3TP2A 3ISZA 3DGVA 3G82A 3RAQA 2HGLA 2XEXA 4DX8H 1RCXB 3HHEA 4FYVB 4WFZA 4M5JA 1CJTA 2MZSA 4IQXA 1V3SA 2VQFF 1T03B 5LSRA 2NR0A 1RHJB 4Y2IA 2W8KA 1RACB 1VI7A 2IDEA 1AUDA 3RRHA 1GQEA 2KZZA 1QAJA 2UXBF 2QSFA 2AW0A 1YHQS 1QTNB 3CCJS 2HFZA 2XWYA 2RH3A 4QYRA 3CPWR 4YDXA 4H4MB 1KFDA 2XG8A 3SCJE 4Q2LA 4J9NA 1C1BB 3QGHA 2F5GA 1BMQB 3JB9k 2L48A 4ZPVR 4NXNF 1LEOA 5E3AA 3AOCA 1ZPVA 2Z2ZA 2RJZA 3FCVA 3LH2S 3PIOQ 1R27B 1RAHB 1RBOB 3ZFVA 4NLQA 4KRWA 3WDOA 1VQ5S 2VC0A 1WD6A 2E5LJ 4WXWA 1U1PA 5F9LA 3ZTRA 4CWBA 3A3NB 2F7VA 1NKCA 2BE2A 2W9BB 4J9VA 1VQSA 1T3NA 1WTFA 4MT1A 5JVHQ 2DNRA 3FBFA 3UPFA 5CCLA 3M2VB 3NP5A 2DNHA 1X9WA 2J9DA 3BS9A 4M1KA 5DDQC 4JI1J 3RB4A 2JFDA 1LWCB 1G4CA 4UW2A 2VB6A 2V34A 2F3JA 2H5EA 4RUHA 1WC0A 2FVRA 4DS4A 1YWXA 4OQJA 1QM9A 3CIZA 2C2ZB 4CO0A 4RW8A 1VS3A 3KG0A 2FJEB 3DRRA 4M63A 3DLGA 2C2MB 3M8WA 3Q8SB 1R89A 4FF1A 1RT2B 1UEVA 2VFUA 3MECB 3D4JA 2BDPA 2HFNA 3Q8PB 3EM1A 3THTA 3O8WA 2OTLS 1HBNB 1HWIA 2DRBA 3P6YC 4QCLA 3R97A 3GPAA 2F9DA 4IO9Q 4ZVEA 1XR5A 3EGNA 1F5AA 3EJMA 2IJNA 2G2YA 3MCOA 3DXSX 3NOGA 2ASJA 4XPCA 5B0EA 3QZ8A 3FMWA 3H2LA 4FYDA 1UJ5A 3FBCA 5KFCA 2HZVA 3T3FA 3MEKA 2KXHA 1HBUA 2ASDA 2HFVA 1QSYA 3GG1A 4HR2A 4ED3A 3ZXWA 2GO8A 1J2VA 3J7A1 3M8PA 5CD4H 4X84A 3GSDA 3J81Y 1NZAA 3OFGA 4Y00A 5F8GA 1X4EA 4X4UA 4DL6A 1E6VB 1KBRA 2PMHA 1FFWB 4O0NA 4L6V3 2CJYB 2N7YA 4UUWA 1GK8A 4F2RA 1XK8A 4ZOSA 1SUQA 2W2QP 1FDAA 1Q1KA 1S10A 2OPRA 1C0UB 2YY3A 1SH0A 4K5RA 3U27A 5BYRA 2CAJA 1FX2A 3ELHA 1SQGA 3HM9A 5GADU 2PI4A 4WK3A 5KFEA 4EYHB 4MFBA 5FJ4A 4GO7X 2UVWA 4JV5F 3CCRS 4A8SA 3WIVA 2V2KA 1D0EA 3V4IB 1PYSB 2JEJA 5GAEI 3VGSA 1VRUA 5DJBA 1YJ7A 4DFJA 3CJQA 1YJNS 1VRTA 5E41A 4HDGA 5AJ3J 2AJ0A 3RW7A 2ROPA 4Y0FA 5E33A 3VAMA 2Y3YA 1RYSA 3HT0A 1CULB 3GYGA 3MM9A 4P52A 1I51B 1X8DA 3QWUA 4U6PA 3TO8A 2NZCA 4OYPA 3AXMA 3OL9A 3H5XA 1RAAB 2UV8A 1F5BA 5E5NA 3LPYA 2DIVA 2ASLA 1N8RT 4RW6A 4NEZA 3ILOA 1TKXA 4URSA 3M2RB 3L7PA 2KN4A 2J0XA 2DGSA 1XMQJ 2R7XA 1RQ0A 4OYOA 1WG1A 5C24B 1V3ZA 5KFUA 3FJ2A 1RAFB 3UCZP 2HVZA 3MDFA 4CLWA 1NMEB 3PZPA 3QIPA 2DGQA 2DT9A 2OPQA 3NBPB 3B4MA 1FDBA 3HVRA 3ADAC 2G13A 2RUGA 2FJVA 2Y1IA 5HMYA 4X4RA 5HBMA 3LGHA 5B08A 2GVZA 2HZCA 4WFNQ 4UTGA 1YQHA 3SBMA 2UUWA 2OI2A 4JI7F 4DR3J 5DQHA 4ZPDA 4TYBA 4DR5F 2MB0B 3TVZA 5CYJA 1UW4A 1IKYB 2RDDA 5IT0A 2VKRA 2BV3A 2X1FA 3A8IA 4OI3A 3SSQA 4NLSA 1X9MA 1Z2ZA 1IN0A 3R1LA 2NPFA 3CJ0A 4LBIA 1RKJA 1ZH5A 3GG0A 5LMUF 3QGIA 3G96A 2VHGA 5THWA 4USWA 3AB4B 3FSIA 2HVDA 1S6PB 3R6LB 2YKMA 2MLZA 3RR7A 3VZHA 4N41A 1JMTA 4CO2A 1N6QB 2ZH2A 5IM0B 2HHWA 1NSPA 2DISA 4ZJQA 2G0JA 5K8OA 3ENWA 1WF1A 1T05B 1M1HA 1JK9B 2KJWA 5A0YB 2M4MA 3IGNA 2MKSA 1R0AA 3RRGA 2W9CA 2YQ1A 1FRLA 2MHEA 2VD3A 3OUYA 4QWEA 2FUG9 4K4VA 1A6LA 2YBVA 3I6PA 2XSJA 1NRKA 2R7UA 4E2FB 2B56A 2NREA 3KJFB 3BPSP 4P9SA 3R5JB 1JLCA 2GNKA 4WKRA 3BSAA 5JMNA 5A8RA 3DU5A 2W9AA 2CNNB 3EGVA 1L3TA 2ZZMA 2KL8A 1RT4B 5K5MA 3GE9A 3BGRA 1P8GA 3P4UB 3HVTB 1RI7A 4X4OA 3DLBA 1V3RA 2YQ0A 2JLGA 2HHXA 1WEXA 4F0MA 3GV8B 4J9MA 3TZWA 1J5OA 2PEHA 4DPTA 3PX4A 2IAJA 2B4VA 1X7VA 4J9RA 3W5YA 1NSKL 3BREA 1SJFA 2RAQA 1CLFA 2CQ1A 1S12A 3GCXP 4BHQA 1RJJA 3ILLA 3N6MA 3EYZA 3ISND 3JQMA 4FN5A 3DI6A 4HKQA 2WBMA 4OV6A 1TV6B 1FRHA 1MNEA 1J27A 1U2FA 4NOHA 4I6AA 2DCUB 5HLFA 2B9XA 1VISA 4B9VA 5G0RA 4W90B 1ULRA 1MN7A 1K1QA 3DMJB 4H4KA 4FBUA 3C66A 4ZVPB 5L1IA 1Z4UA 2ZZNA 4IH5A 1RTIB 3RG6A 2EBEA 4DV5F 2BACA 2ZDOA 2QEXS 2GIFA 3WIUA 4OX9J 2DGWA 1C0TA 4NE9C 1HPZB 4DZDA 2DNMA 4ERDA 4NYZA 1S6QB 1AZSB 2BXJA 4Y2CA 2IVYA 2NXJA 4DN0A 3EXCX 2EFVA 4LRBA 5H1SV 2A18A 4OZNA 2W4DA 3NS6A 2EFPA 3V6JA 2E1RA 5F8LA 2ZVSA 2FY1A 3BYRA 4JI8J 3KJVA 5EDWA 3TJ9A 1VC6A 3GQCA 4PKDB 3ETOA 1U47A 3TRGA 4B9LA 4Q8EA 2Z8QA 3EDQB 2KVQE 1KFSA 5DRKA 3HFKA 3MR6A 5KFJA 4F4AA 4HYKA 4KGMA 4CLUA 3CE8A 1WG4A 4OX6A 4N47A 3GYXB 4TY9A 3MEGB 1I5OB 4QU6A 4NL5A 1ITPA 5K8PA 1TL3A 3J7AN 4RUAA 1TAUA 5DDOC 2QFJA 1TELA 2CJXB 5DDRC 3J7ZT 4CNZA 3K59A 3JS9A 4WTYA 3BR8A 3GSIA 3AB2B 2NLWA 1HBMA 3OL8A 2B8QA 1RCOB 4DX5A 3RRKA 2W2PP 2XHWA 3OFFA 2OPSB 2FJAB 1MWQA 4ILRA 4L74A 2VQEF 3GJSB 1BXNA 3MM7B 2D3OR 4RUBA 4H4OB 3KLIB 5D0EA 3KK1A 1HR0F 4URGA 4EBEA 3PY8A 1MW7A 2WRMA 4Y2MA 3PRBA 1N0UA 1RK8A 3D0HE 4JI4J 1GAOA 4FF3A 4MTPA 3OTCA 1T03A 5KT3A 2H3EB 1HW9A 4NA3A 4NRTA 3OSPA 1XERA 3FFIA 3KHRA 2EFQA 4B3TF 3CDWA 4O0IA 5DDPC 1XNQF 4DFMA 4RW7A 3G4SS 5E7OB 2DHSA 4H4MA 4G65A 1J5EF 1A7GE 2ERRA 3AAWB 3POTB 5MAOA 4DV4F 3H20A 1C1BA 3BEGB 1VIOA 5CHCB 3CIMA 2OIHA 5LSOA 3IA0A 2EI5A 4IRKA 5A76A 2QMUB 4IG3B 4FBTA 3HKZD 2ZUGA 2C3MA 3RYLA 2W8LA 3MEEB 2FGOA 5B09A 4MIAA 3OL7A 5J2MB 3MAQA 1RWWB 1UVMA 4IOCQ 3EXYA 3M4XA 2O1PA 6FDRA 4YR3A 5IT9Y 2WZ1A 1VLOA 4GO5X 3W62A 2R2UA 4LF1A 2AJ4A 1YSJA 2W9BA 4M94A 5KG5A 1KDNA 3CXCR 2CKWA 3U1MA 2DHGA 5D8HB 3M2VA 3QMQA 2BANB 4FKXA 3T1YF 3EDRB 3DLKB 1LWCA 3CMES 1KC8T 3PO4A 1UFWA 2LA6A 4IOAQ 2CQ2A 3M6VA 4PPDA 2ILZA 2LXIA 4OJHA 1RWNB 5KT5A 2MQOA 3EVWA 2KDOA 1YDLA 3MM8B 1Q81T 2JC1A 2CPYA 2YWKA 2VICA 2DITA 1T9WA 4B3RF 5HMZA 1UVJA 2XZWA 1HNZJ 4M5IA 2W7PA 1D9FA 1NH7A 3K89A 2KXNB 1AB8A 2AZ1A 4FVMA 5A8WB 1DAXA 1RT2A 2OPPB 1GTEA 1R8HA 1M5VC 1NK5A 3MECA 1S4FA 1HNVB 3K58A 5DQGA 1XNRF 2GVDB 3MR3A 3LWLA 2HWIA 4PWDB 1TVRA 5CQGA 3MOZA 2PA8D 1HBNA 2PC6A 3QLHB 2DO0A 3ITHB 4RWWA 5KT2A 3BQ1A 5GMEA 2HNYB 2W7OA 3PYGA 3B78A 2EG2A 4ED2A 4YB5A 3ZZOA 4F4KA 3PYEA 1T3OA 3MAAB 2YNGB 3PFEA 3QWPA 1KP6A 1WI8A 4NLPA 3BM7A 2U1AA 3MMJA 3JSRA 4KV8B 5KFBA 3FSXA 5KG1A 4M5HA 2H4YB 1UTAA 2YH1A 1RLCL 4WYLA 4PWWA 2FIUA 2KHDA 2QLJB 1E6VA 1SBRA 4C6AA 1DTQB 2X51A 2FYXA 3GONA 4ECXA 3W8PA 3H5YA 1V6HA 4ILMA 2W01A 4PCQA 2JRSA 3SFUA 5ETKA 3UDCA 3FRYA 1BGXT 4DUZF 3P3DA 1Y3KA 1C0UA 1U1NA 2L41A 3DOLA 1WSRA 3TA1A 4CO4A 4ZPBA 3AA8A 5K9FA 1FRKA 2BJ8A 3UD4P 2FB0A 1VBKA 3K5NA 3MI7X 2AU0A 1JLAA 1L5UA 3VQSA 2DEIA 1LXNA 4ICLB 1JB0C 1F5CA 2BQ3A 3SQGB 3I0SA 2XCAA 2P9CA 4JI3F 3RZAA 2F8EX 1HKAA 3V4IA 1Q95G 3JAMY 4XIUA 2APOA 2M0GB 4P10A 1H98A 4A8XA 5HJYA 5DGBA 1FNMA 1IR1A 3FRZA 1NLKL 4DQIA 2RVJA 5D0RA 1DLOB 1XMOF 2ZH5A 1F6TA 2AV5A 1CULA 3M1VA 3P49B 3TEHB 2Z58B 5GAHU 3JQKA 4X65J 4RNHA 1U2CA 2CZVC 4L75A 1SCJB 2DPJA 2K7JA 1WELA 4W98A 2ACYA 5KFWA 3LP2B 3Q86A 3P5TL 2HYIB
chains in the Genus database with same CATH topology
1KQFB 4ECRA 4X2BA 3DDNA 3NCQA 2IBOA 3RB0A 2GA7A 2GJ2A 2YKMB 1FRIA 1S0NA 3I56S 3M2RA 5EWFA 1YIJS 1Y7PA 2Q6BA 4CO5A 3MUTP 1U8SA 1XEZA 2E5GA 2FDNA 2E7XA 4P2SA 4IG3A 1GTHA 5BYSA 5D78A 1IM4A 1KS2A 2MZ1A 4ZCIA 3SYZA 1N5QA 5C24A 3IRWP 3LALA 1PO6A 1RA7A 4OI2A 1N33F 3B8HA 2CVEA 2RU9A 1M90T 1M5SA 1TL1B 3Q22A 3PR5B 1N5YB 3Q2SC 2R8HA 2EFGA 1H2UX 4UQGA 2DB1A 4YUDA 2VPZB 3CB4A 3RAMA 1LW0B 2ZE2B 1FRMA 4XDCA 2J0QD 3UQSA 1MWZA 3HP6A 2DRAA 4PRFA 5JVGQ 4ZPWR 3UDLA 2DK2A 2HQIA 2D74B 2YTCA 2MJUA 2ZD1B 3NNAA 1R0AB 3LP1A 3NBPA 3G8SA 2DO4A 3T9ZA 2UV8G 4C0BA 2VFRA 2F8MA 4FNIA 4MK7A 3MD3A 2C28A 3VCDA 2BOPA 1EETA 1S1XB 1UKUA 2LU1A 2HS3A 1SIWB 4I67A 2VOPA 1VC5A 4J9SA 2FVCA 3OUYB 3JSBA 5T41A 3EZ5A 4LF8F 4PUOB 3K5PA 3WC2A 3OTDA 1ELOA 4F4YA 1N88A 1OSCA 2J8AA 4CH7A 2XSJB 4MYUA 2E5HA 5DGAA 3CCMS 2IBKA 4MK8A 1FTCA 2B0GA 2B51A 2Y0SD 5LJ3Y 4O4GA 3MMAB 3US5A 4ZVGA 4E98A 1AROP 2EK1A 3FDSA 3OTBA 1HI0P 3O44A 4ELUA 4IO1A 4OHWA 3MWBA 4C8ZA 2LQ5A 2R7RA 3RAXA 3D54A 3MPYA 4NZ0A 3TAMA 1U25A 4TLRA 1S97A 1UP1A 2YKAA 3DLKA 3GFZA 4ILLA 4WKYA 3DYAB 3GWCA 3NCPA 2LU2A 5DS7A 1RISA 4ES2A 5DLGA 2HMIB 1JLCB 5EHHA 1IKYA 3DOKB 1LOUA 3M8QA 2R8GA 5EWGA 4DLGA 2OTJS 1TKZA 3JSMB 2ATLA 1DZ5A 4HI1A 4FXVA 1VQ4S 5A8RB 3CCUS 1ZETA 1U24A 3OSNA 1FNXH 1R31A 4IG0A 2HHTA 3W2WA 3IAM9 4DPOA 4DQRA 5LXYA 4MJKA 3BGRB 1X4BA 4C97A 3EGWB 1G6BA 3PVXA 1WHXA 3OFEA 3IG1B 3CJKA 5HMXA 1FKPB 4KT0C 2W24A 1X4FA 4LVNP 3SZ2A 2CPZA 1ZZFA 2LDYA 3JTPA 4IOBA 1GH8A 4TU8A 1FK9B 3NLCA 1IKXA 4OZ0A 1FD2A 2IRXA 4USJC 4UY8T 1ZTWA 3DFEA 4Q2MA 3FSYA 2XLJA 1D1UA 3DM2B 4U7CA 4JV1A 1J5OB 2YX7A 3VQTA 2VPYB 1SV5A 2QLXA 4JBCA 3TW0A 5CYQB 1UA1A 1UEUA 7FD1A 3F41A 2DH7A 2ZOGA 4KGKA 2FHKA 4A4JA 2VA3A 1S6PA 2IAJB 2VPWB 4A47A 1M5PC 1QUVA 2RSQA 4K4XA 1O5JA 1OPZA 2HWTA 3BR9A 4TY8A 2OAUA 3OTEA 1S9GB 3C6TB 1H7XA 5LXRA 3IO1A 2AF6A 4C8OA 1Y5LB 2FLPA 2HRYA 1FERA 3SMZA 2UZAA 3NMRA 4PXDA 5GAHI 2RS2A 5IM0A 1RP5A 3HZGA 3O5TB 3CSKA 2J7WA 3TI0A 4WF9Q 2HVHA 3KLHB 2HGMA 2U2FA 4NMLA 2K1RB 5J1PA 3L7OA 2J76E 3IGVA 5KFDA 4A8FA 1U6BA 4QOTA 3KMSA 1T05A 3FNNA 1UA0A 4RNFA 3IWNC 2GGPA 2IM0A 1YVFA 2RKIA 4DSFA 1N56A 2UUCF 5A0YA 2PGCA 2V4JB 3PACA 2PE8A 1PC4A 4B3SF 1SL1A 1A9NB 4GKJF 2C42A 2WOMA 2NYIA 2UXCF 5KT7A 3ITHA 3PDNA 4Q8FA 2MY8A 2WTFA 2F8HA 5IT4A 3ULHA 4RBTA 2YKPA 4ZHRA 2IC3B 3D1QA 1LFPA 3BO3A 2ZNZA 4QZVB 2ASYA 4M95A 1X5TA 4PR6A 5HLFB 5KTQA 1HYSB 4PQUA 3GYNA 1S79A 4IYQA 4G3IA 4I2QB 4C8YA 4I2PB 2CPXA 5EUHA 4AL7A 4LQ3A 2XNQA 5I42B 3H4DA 1OS5A 2FLOA 2B6AB 2R7OA 3BDEA 2XBPA 2AYBA 3HDSA 2YNGA 3D0GE 5F3TA 5KFIA 2LLZA 4MKBA 1QLNA 1OQ6A 2HNDA 3NWGA 2VC1A 1SH2A 4TN2A 3IXQA 3TYTA 2UVVA 3H8YA 4DR1F 3NS5A 2XS2A 2ZHBA 7FDRA 1I1GA 4I6WA 1HWUA 2X1GA 1PSDA 3V6DB 2FJBB 1MWYA 1QE1A 5BJRA 4KV8A 2FC9A 4EU0A 1NHUA 5HROA 1D9DA 4RW8B 3NNCA 2JH3A 2PIIA 2SXLA 1IKVA 4DL4A 1KSPA 3P96A 3HLUA 3PW0A 4G1QA 3HHLB 4DJBA 4F4XA 5KFYA 2KZMA 1TL5A 3PJWA 2KM8B 1RT4A 4DR6F 4X4QA 1B7FA 2P6SA 4DFKA 4EFAC 5KG7A 3HVTA 1APSA 1BWEA 1F0XA 2VH7A 2DGXA 2WSCC 2DNKA 3BSCA 4QR1A 4USHA 4CT8A 2VPXB 1REVA 3AQOA 2R7SA 1JLQA 2K3IA 2GMHA 4OJGA 2ZFHA 1RYRA 4NCGA 4EEYA 3UR0A 2L9DA 1B0PA 1Y0HA 1MMLA 2CQ3A 2CQPA 3KLFA 3R1HA 1T8EA 4Y6IA 3CD0A 2LXFA 1PILA 4NLTA 3ZZZA 4ED5A 3K7RA 3QO9B 1FRJA 5M2PA 2YWHA 4F50A 2VG6B 2V8VA 4F2SA 1UVNA 3BN7A 2MSSA 4ZCKA 4DS5A 4JI5F 3MM5A 2DJWA 1KRPA 1YRXA 1O0PA 4WFYA 4ZPCA 4B3TF 4UY85 2VONA 1LKZA 2B4PA 3AQPA 2WONA 2JOQA 2GW8A 4ED7A 1C4CA 2EWHA 2HGNA 3VTIA 5GAGU 2GQQA 2YH0A 2F1FA 2W4PA 3DRPA 5CZXA 2JL9A 2ZOFA 2A1BA 3KJVB 3IR5B 5A6WA 1F9FA 1IBKF 4H54A 1HARA 3QAUA 2R8JA 1OPIA 3CJ5A 4XO0A 3CCSS 2ZH7A 1NK7A 2NXUA 2OFGX 4B9NA 4YDDB 1JJ2R 1HQUB 3GFYA 1KD1T 1RT7A 3MEDB 5LJ5Y 2AQ4A 1IKWA 4QU7A 2PO4A 2BJDA 2VG7B 1U1RA 1FDNA 4J9QA 1IBLF 4ZP8A 4NA2A 1TV6A 5HN0A 2XMTA 4OJ1A 3I5BA 3O6QA 3LGNA 2IYGA 3FZBA 2PN6A 2WSFC 2KRRA 2LECA 3D0IE 2JVRA 1YRUA 4WU2A 3V2UC 5J2QA 2JLFA 3DLLQ 3CD7A 3LF0A 1S6UA 4OI4A 3VAJA 3M32B 2CPEA 4YEAA 2LQ9A 4KHMA 4NXMF 4DSLA 3U1LA 3H5UA 1RT6A 3ZZUA 1FE4A 1CSJA 1B64A 2ZH6A 1SC6A 3M8PB 1JKHA 2GQ2A 2RRAA 3KLGB 4ALZA 1KQKA 3HKWA 4MK9A 2Q6CA 4G1PA 1FNOA 2J9CA 4R8UB 3BSNA 5A8KA 3PEJA 5KG4A 4F02A 3CJ4A 2C3PA 1S9EA 1G2EA 4DL0C 1UAWA 2LEAA 1FCAA 2JLEA 1RTIA 2VBXA 4ZDNA 3PW7A 3G8TA 2RF2B 4JOUA 2B9WA 4LF4F 1KVIA 3H98A 2DVIA 1SQEA 3M2UB 3ZC4A 3MMBB 1KONA 4KR0B 5AXKA 3E01B 1OSDA 1RT5B 3VWSA 1ZPWX 3HZEA 1N5SA 2BA9A 1CC7A 3AJ1A 4RNOA 4ECTA 4WIIA 4J5OA 2GHVC 4ZP9A 4ED0A 1HBMB 2RD5C 2OPRB 2R8IA 4AL5A 3QZ7A 1E6YB 2MDAA 4FS1A 4P7VA 4BWMA 3WX4A 1SJ4P 1S6QA 5KFRA 2R4FA 2QMWA 1NJXA 2BRKA 2KU7A 4ZKAA 4OLPA 2XI3A 4AYBD 2J6UA 3RB6A 4F8RA 3MOJB 2XMMA 1HFEL 3OR1A 1UJ6A 1U6ZA 3GFHA 2JZ5A 5DG8A 2HS0A 2FHJD 3O3LA 2N3OA 3U1NA 3TUJC 3F73A 2GHPA 1TK8A 4B3OB 2V9KA 2XLKA 2GIRA 2XULA 4IDKA 4R5PB 1SJRA 5J1EA 3KG1A 3D28A 5J2PA 1UWBA 5KFQA 3I87A 2E5LF 4EUVA 4FVCA 4NZ7A 1VC0A 1YRTA 4ED6A 3R5BA 4ITSA 3U7JA 3TP2A 3FQKA 3ISZA 2E7WA 1Q4RA 5C5JA 5F8MA 1LWFB 2VASA 2OSRA 3RAQA 4OHVA 2WB4A 4I56A 2HGLA 2XEXA 3TVYA 4DX8H 1QAXA 4KJIA 2ZE2A 2MYFA 1MU2B 1BQMA 1AW0A 4QYZJ 1XMBA 3SSSA 3HHEA 2ZH8A 2V9WA 3DN9A 4WFZA 4ECVA 2ADBA 2VG5B 4F3MA 5KAKA 2MZSA 4C0OC 4IQXA 3PW2A 1V3SA 2VQFF 2IMWP 1T03B 5LSRA 1S1XA 4HDHA 2NR0A 3LOUA 4Y2IA 4KIAA 2W8KA 4DV2F 1KR4A 1VI7A 3W7BA 3JYTB 3T6JA 1AUDA 3RRHA 2CJAA 1GQEA 2KZZA 5L9XA 1HNWF 5GAGI 1QAJA 5SUHA 1FKAF 3CJ3A 2UXBF 2QSFA 2AW0A 1KEKA 1YHQS 3DC2A 4A48A 1FKOB 2K3KA 2XC9A 1VQ7S 1RTHB 2RMLA 2HFZA 3CCJS 2XWYA 5KFFA 2RS8A 5L1LA 4QWAA 3QJPA 4LVOP 1S99A 2RH3A 4QYRA 3CPWR 4YDXA 4BCAA 4U67Q 2YNFB 4WYWA 5CH7B 3UE2A 2BQUA 4H4MB 3T1AA 4YB7A 1KFDA 2XG8A 3T5LA 3SCJE 5L9NA 2XCPA 4KTQA 2DNOA 4Q2LA 2HMIA 1YBAA 3HHLC 4J9NA 3DOKA 4RKUC 3BGFA 4WZMA 3TNVA 1XTZA 1C1BB 1U1KA 3T19A 3MFHA 3QGHA 3OVSA 2KM8C 3EPGA 3HJFA 1X5OA 2MGZB 3KG4A 1MMDA 4TXSA 4DDFA 3JB9k 4KO0B 1XBWA 1U1LA 4OFZA 2L48A 1X9SA 4C7QA 4ZPVR 1FE0A 5B0BA 5H9EJ 1FXLA 4ZP7A 3C6UB 1RT1B 4HH1A 3OHBA 4NXNF 5E2QA 3PRDA 2FHMA 5E3AA 4AXIA 4EO6A 1TQLA 2ROGA 3PX0A 1ZPVA 2RJZA 1GT8A 3IWXA 1RDRA 5D4OA 1S72S 1H2TZ 2P6TA 1FXDA 1VFJA 1JLBB 2OPSA 3LH2S 3PW4A 1U1OA 2M88A 1OQ3A 2CFXA 3PIOQ 4C8NA 1R27B 3ZFVA 1KLMB 4NLQA 1FEHA 3I5AA 4U7UK 2AP6A 5F0UA 4KRWA 5CYQA 3WDOA 2YWEA 1VQ5S 2DCLA 2VC0A 3MM7A 1WD6A 2AGOA 4WXWA 2HS4A 1U1PA 5F9LA 3PM9A 2DNZA 1TZ0A 2IFXA 4I1TA 4C3MA 2VA2A 3S7RA 1LXJA 2BYCA 2YWGA 3K2YA 1XR7A 4H4OA 3KLIA 4LF6F 1KOOA 2F7VA 1NKCA 4O3PA 1S0OA 2BE2A 1VQKS 2W9BB 1NK4A 2YNIB 4LF5F 2MZQA 1VQSA 2EKYA 3F56A 5CA5A 1T3NA 1WTFA 3IBWA 5AXMA 2QRRA 5JVHQ 2DNRA 5AE1A 2MSTA 1F60B 3UPFA 1BQXA 1HQEB 5CCLA 5I3UB 3HF5A 4IKAA 3M2VB 5M2RA 2V4JA 1VQ6S 1K0VA 3NP5A 3KOAA 3Q24A 1HNIB 2ZC3A 2M2BA 2WW8A 2UVUA 3LGMA 2DNHA 2BQRA 1X9WA 2YKNB 2HHQA 1HNXF 2J9DA 4A8QA 3BS9A 2IC3A 4M1KA 2BM0A 5DDQC 4GC7A 4Q5VA 3WC0A 3RB4A 1KVJA 1NJIT 2JFDA 2B5JB 1LWCB 5J2NA 1YJTA 2QZ8A 4BWJA 3HVWA 3THPA 2R7WA 1MROB 2MZRA 1JXEA 4I2QA 4UW2A 1Q86T 4O44B 3KNGA 4YB1P 2VB6A 5B7WA 1QSLA 3CDEA 2DR5A 2F3JA 2H5EA 5B0DA 3G6VA 3A8EA 3KLEB 1VQOS 4RUHA 1S7HA 2IJFA 1KQGB 1WWHA 4N8OA 3S01A 1JXLA 2UUTA 2MKCA 3G6YA 1S1WA 3MF5A 2GMJA 1S1TB 2YQ3A 3BB5A 4IR1A 2CYYA 2AJ1A 1EP4A 4L72B 2MZJA 3KK2A 3RW6A 2C3OA 5D77A 2ZC4A 4HHJA 4DS4A 2FVRA 1YWXA 3V6DA 4QPXA 2ZHOA 3NCRA 4OQJA 3LQVA 4LFAF 3D1HA 3IRXB 1OIAA 2I38A 1QM9A 4NWBA 3CIZA 4C11A 2JDJA 4CO0A 5IFMA 3POTA 4DV3F 4RW8A 1M5KC 2KXFA 1K1SA 2VKZG 2OMLA 1TR0A 1VS3A 4RUCA 3M6XA 1AXQA 1HHSA 3KG0A 2FJEB 3NRBA 3DRRA 3A1YG 5K14A 4PXBA 4M63A 4NYOA 3KKFA 1KTQA 3DLGA 4DL2A 3Q8SB 2DH8A 3NAIA 1R89A 3DXBA 2E9RX 4FF1A 2DIUA 2GV1A 1RT2B 1UEVA 4LJMA 2VFUA 4C98A 5GAEU 1QY7A 2KT5A 4PQAA 2CJBA 1PC5A 4ZCMA 4NCAA 2EK6A 2PD1A 4FF4A 3Q23A 3MECB 2I5JA 2LDIA 5LT5A 1SH3A 2C2EA 2BDPA 2B4OA 4WFXA 2HFNA 1BQNB 4C9DA 2CPIA 2W7AA 3Q8PB 1N5VA 1VOMA 2IM1A 4QIGA 3THTA 3AHPA 3PKYA 3KTQA 1S76D 2PFFB 3AA9A 1Y00A 4IFYB 4Z37A 1FVQA 3MEEA 4CO1A 1RAJA 2E1MC 1C1CB 4MKAA 3W2VA 4RW9B 4F26A 4C8KA 1TKTB 3O8WA 2MKJA 2LMIA 2OTLS 3C2PA 1HBNB 1HWIA 2DRBA 2L08A 3P6YC 3DU6A