2V5HG

Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLGLUTAMATE KINASE
publication title The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Transcription
total genus 22
structure length 111
sequence length 111
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2007-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v5hG00
5D4NA 1QY7A 3NCRA 2XULA 4USIA 3TA2A 2E66A 3O8WA 1GNKA 4Y65A 4C3MA 5DS7A 1VFJA 1Q1KA 3OPKA 4USHA 3N5BA 2GW8A 4OZNA 4E98A 4CO3A 1NH7A 3CE8A 4RLEA 3MHYA 3T9ZA 4R25A 2XG8A 4CO0A 1VHFA 1XK8A 4CO4A 2RD5C 5L9NA 3DFEA 2PIIA 3AA8A 2EG1A 4CO2A 3AA9A 4CNYA 3GSDA 4D3GA 2GNKA 1V3SA 3TA0A 2O66A 2ZFHA 3NCPA 4CNZA 4YB5A 4RX6A 4OZLA 1OSCA 1O5JA 4RWWA 2J9DE 3NCQA 4Y6IA 2O67A 2J9DA 1NAQA 1NH8A 3AH6A 1O51A 4RWXA 4C3LA 4YB7A 2J9CA 3HLUA 4IYQA 4OZJA 2ZOMA 4NYOA 5D4LA 3TA1A 2XZWA 2CZ4A 1P1LA 3L7PA 2VD3A 4WK1A 4C3KA 3O5TB 2GX8A 1NZAA 4CO1A 1V3RA 4YB6A 5D4PA 4CO5A 1UL3A 1V9OA 4USJC 2JJ4D 2EG2A 3LF0A 3M05A 1HWUA 2NS1B 2J9EA 1UMJA 2Z0GA 4D3HA 1UKUA 2V5HG 4WK3A 4ZK7M 4NYPA 1KR4A 5D4OA 1PILA 1H3DA 1V6HA 2XBPA 2DCLA 2NUHA 1UFLA 2NUUG 3X3UA 5DRKA 4AFFA 1J2VA 3BZQA 3AHPA
chains in the Genus database with same CATH superfamily
1PBAA 3OVSA 3KLFB 4V1Ak 2OMLA 3TZYA 1W2BR 1VFJA 2XMAA 5ETKA 1WSVA 2JLFA 4WP3A 1ZYQA 2QG9B 2VU5A 4ZJLA 1H2VZ 1U02A 4L6V3 3CJ5A 2G1HA 2E7VA 2B56A 4OHVA 4ZVSB 3OV7A 2BR0A 3BN4A 1NSPA 1MN7A 1GFWB 2HK3A 3V6KA 1B0TA 2KHCA 4M5DA 1CG2A 1RCOB 3G8SA 3E01B 4OX7A 3M8WA 1YBTA 3TRGA 1R8AA 3WDOA 2OPRA 1FJGF 4Q7AA 3CJQA 3S1TA 3MM9A 1F2GA 1R0CB 4YHHJ 3G82A 3ZZPA 4DV6J 1S1XA 3P49B 4LBIA 5EX3A 2LDYA 3BGOP 1BC6A 4WFZA 2VJVA 3ZZTA 3NCRA 2AD9A 2RH3A 2HAFA 3TNVA 1FRIA 3DLLQ 1U47A 3PYDA 1U2CA 1RKJA 4IUFA 3H5YA 2GJFA 2XG8A 2C2MB 4G1QA 2J0XA 1S72S 1ELOA 4TY8B 3MEGA 1MW7A 4NCBA 1N34F 1UAWA 2CQIA 2AWZA 4FF3A 2C3UA 3QGHA 2O66A 1FXLA 1H74A 4X4PA 2HHQA 1VBYA 2CQ2A 4DG1A 4EWTA 4KGZB 5IWAJ 1APSA 1U1RA 2CKWA 2NXEA 2QO3A 2YWEA 2EW9A 1X4CA 1MN9A 2AYEA 4KIAA 4JBCA 1NZAA 1JK9B 3P8BB 2JJ4D 4UTGA 1BD6A 1Q81T 5F8MA 4LREA 2R7TA 1X4BA 1EB0A 3X3UA 2IHR1 2N4DA 3GV5B 5F8JA 2CG4A 4NLUA 3OW2R 1IJEB 3I9V9 4JI2J 1H2UX 4B3SF 2BKPA 2BE2A 4PR6A 1FA0A 3DMJB 3D67A 2W4CA 1BQMA 4EI2A 4YP3A 4ZLNA 3O44A 2MGZB 1QAYA 1LFWA 1UZHA 2KH9A 2CYYA 4MKVA 4DSJA 1N36F 3US5A 2QA2A 5HROB 4IH5A 2XGPA 4J9UE 4M5JA 2FJVA 1ZAXA 3T41A 4ZIWA 2EFNA 2ADCA 2AMCB 3FQLA 3J81Y 2MQPA 3SDEA 5J2PA 2OKQA 2AJ2A 2FLOA 2J9CA 1FRJA 4IQXA 2BKNA 2AYMA 4A8XA 2KM8C 3SZ2A 2UUCF 1CJTB 1TKZB 1VQ7S 1JLEB 2GAHC 1U2RA 1FJCA 1UJ4A 1S1TA 4JV2A 3DOKB 5EWEA 2VFVA 3PEJA 4WTYA 1OIAA 4LFBJ 1PCAA 2LMIA 5KFGA 3Q24A 5FLXU 2ASLA 2G2YA 2H4YB 1NMEB 1E6VA 3EPIA 3CIZA 2ACMA 1VQSA 2VPXB 2AW0A 4P2XA 4USKA 2W9CA 1SV5A 4WJBA 2ZH7A 2IM3A 1EIYB 4JI5J 4GKJJ 3QT5A 2HNDB 3FRZA 3KDOA 1KVJA 2XMUA 4H4OA 4JUZA 4Y28C 1Q5YA 4LSNA 4OZ1A 2Q66A 2UXCF 3MMBA 3A8EA 1TL3B 5K8MA 3IGVA 4RW8B 3H2UB 3DOLB 2LU1A 4K4XA 2G1DA 2DR8A 3D9BA 1HNVA 3BQ0A 1B4SA 1SH0A 3IC1A 4M5NA 2P6TA 5MAOA 1R7IA 4FVMA 2W9AA 3MPVA 4OYZA 2W8KA 2JWNA 4JB8B 4N41A 3TAQA 5L1LA 2V2ZA 3QO9B 3IR6B 2HFZA 5KFWA 4EK2A 1CJUB 2KHDA 2W9BA 2HNZB 1LXJA 5BXIA 1T9YA 4RO0A 4FKYA 4DI6A 3K5LA 2YKQA 3HO1A 2Y0BB 1KLMB 5C7PA 3DKDA 1YJUA 5KT2A 4JI4J 3PIPQ 1NH7A 2A1BA 1S0NA 2FB0A 3BO2A 4KGMA 3B78A 5HBMB 2D69A 3E8OA 4FP9A 1NJXA 2OHDA 2C2ZB 2BKOA 2LYVA 2LQJA 1FK9B 2F5GA 3JQJA 2A0FB 2CJKA 3DRYA 3AXKA 2OJ3A 3I32A 4ECWA 1RSCA 2D1CA 2QE5A 5HMYA 1IJFB 1R6YA 3NGKA 4NMLA 2IDLA 3PYEA 1URNA 3ZZRA 2VKZG 5KFMA 2D9OA 5H9FK 2IBKA 4CO1A 3CCTA 4NA1A 4PG4A 3CC7S 3LP2A 2DGUA 1JJCB 4M5MA 2DHSA 5K8PA 4M5DB 4AE5A 2IY5B 1HHTP 1M5OC 3HD2A 2UXBF 5LT5A 3BYPA 4DL2A 4I0WA 4C8KA 3R5AA 5F8GA 3CCWA 3OXFA 2PEBA 3MM9B 1EP4A 3I5AA 4ZVEA 3U1LA 3EYZA 1GTHA 2IYGA 4CZCA 3KWMA 1SH2A 4YR2A 5F8HA 3UFCX 1S1XB 3I0RA 2CJAA 4O0IA 4X4NA 4F4KA 2V2KA 1V3SA 5KTQA 4E0DA 2MZTA 1EQ0A 5AXKA 2CIMA 4UZCA 2QL9B 4P2FA 4JV1A 2HVEA 2H5IB 4C2MA 4ECVA 2CQ0A 3LOUA 3DM2A 2VFUA 2GO8A 3UWTA 1HBMA 4J9PA 3R6GB 2PC6A 1Q8BA 4G1QB 3N01A 1SQFA 5DGBA 3TARA 3KLGA 5MLCV 2GAGC 3MEGB 3I55S 1L3KA 2DHHA 1WKLA 2CJBA 4XTTA 1NK6A 4OZ2A 4DV5F 2CG8A 4ED6A 4DG1B 2ZH9A 4DR4J 2UV8A 1D0EA 2KTQA 4LJMA 2G9OA 3C66A 3U27A 2VV5A 3E2EA 1OY9A 4FYVB 3OL8A 4NA3A 2YX4A 4ZVPB 2V4QA 1YX2A 2JVOA 2ZC3A 4EBCA 2R8GA 2ILZA 3BQ1A 1FRLA 1HMVA 4FBUA 4HI2A 1TL1A 1N5VA 5IFMA 4RX6A 3BQ2A 2BE2B 1ZZNA 3T5KA 3HSJA 4OJHA 4ANEA 1R0AA 1BQMB 4DCOB 4LQ9A 3JYTA 2B7CB 3M7VA 1TMMA 2QLXA 2HHHJ 1WSRA 2OAUA 3QAEA 3R27A 5KFSA 4DFJA 4I7FB 1TFWA 4I6WA 1AYEA 3H59A 1H7WA 3L7OA 1P27B 1RAGB 2OUGA 3MPDA 2A3JA 3VGVA 2KKHA 1CC7A 1VI7A 2XBPA 1DBDA 2K3IA 4LF6F 3L95X 2R3VA 3BZQA 3LP1A 3SDEB 1Q7YT 5J2PB 3PTWA 2OFGX 3OD2A 5GAHI 3PRVA 4HT5A 3PJXA 4CH0S 2J0WA 1KHVA 3CGIA 5DS7A 2V67A 1HWJA 1VQ4S 3CNQP 4TU8A 3MM7A 2HGNA 2DNLA 5CZXA 2ZVSA 1S1TB 5KFKA 2DNKA 3OJUA 3ILIA 4B3MJ 1IUJA 1SB6A 1S49A 2OEJA 4C98A 2DO4A 1NK0A 1DLOB 2ADBA 2HFVA 2N3OA 2PMHA 1P8GA 1E6VB 3R8YA 2JH3A 4NWBA 2J0SD 1T95A 5KG6A 3AJ1A 2H4WB 3IBFB 1EJ7L 3GE9A 4ZN1A 1T0TV 1FDDA 1SV5B 4ZPCA 2HZVA 3PIOQ 4MK8A 2BVZA 3L9ZA 3W62A 1RWNB 1V3RA 3I4HX 2QRRA 5LMNJ 2JEJA 2AGQA 4WP9A 4H4OB 3FJ2A 4LSNB 4LF9J 3T1YJ 1RISA 4MH8A 4C9DA 3MMBB 1U4BA 1Z2ZA 1D09B 3BBCA 3T3FA 3MF5A 5J1EA 1HNVB 4CLFA 5CXTA 4G1PA 1YG0A 4N56A 4GC7A 1SL1A 1FJGJ 2VG6A 5C2GA 1S6QA 3TEGA 4EBEA 5SZTA 2JDJA 2IJNA 3KHHA 2CJYB 1L3VA 2I8EA 2ZE2A 2CRLA 3GQCA 5D0EA 2Q3PA 4F4ZA 4QPXA 4UUWA 3OVAA 4USUA 5BJRA 2CADA 1R8PA 3MOJB 5HLFA 3BPDA 3N0VA 4OZ3A 1BHNA 4Q43A 4ED2A 4DFKA 2GMJA 5I4MA 2W4PA 3SYZA 5EWFA 4ERDA 1RUSA 1NUEA 4C3KA 1Y5NB 4N8OA 3NY0A 3OHBA 2XY5A 3CB4A 3NGTA 1FKPA 1N32F 1N34J 4HH0A 4DCPB 1S6OA 1KSPA 4H54A 2QTWA 1YK9A 3H25A 2CQ3A 3O1LA 3QIPA 4ZLLA 1WC5A 3QBCA 2XS7A 1N6QA 3CW2C 4Q44A 4DV0F 5E33A 1VYAA 3PYFA 3NOGA 4LFCJ 2IBOA 4LT6A 3HM9A 1F5AA 3LP2B 1FKOA 1U1MA 2UUTA 3TZXA 3GSDA 3OTOF 2RJZA 3QT7A 2C3MA 3NRBA 2AP6A 4LF4F 2H3EB 4KC5A 1HHQA 2H65B 3N4WA 4B3SJ 5LSRA 1S0MA 4MKBA 2LP4A 5A8KA 5DG7A 1G7CB 3FFIB 2DHAA 4G1IA 1RGVA 1EAYC 4E8UA 4PKDB 1KOHA 2AHOB 3N28A 1GMWD 2O01C 2GX8A 1SVDA 4DPXA 2K2PA 3I0RB 3OTCA 3MMJA 1TKDA 2I6WA 1S76D 2BM1A 4NL5A 4OYBA 4F67A 2EEYA 2RRBA 4X4UA 1QTMA 4L74A 2JEIA 4ZVHA 3DM2B 4IOAQ 1HBMB 1Y7PA 1HR0F 4MK9A 2ZWPA 2KT3A 1W26A 2IAJB 4NLGA 3FBFA 2KO1A 5IV4A 3KLGB 3HXMA 5G4DA 4PXBA 4PXDA 2E5HA 2XS2A 3ZTPA 2FLPA 1MG7A 3S7RA 2UUWA 1XK8A 4TKTA 1T05A 2ACYA 4C8OA 2Q43A 2R7OA 2QA1A 1BGXT 2V4RA 2N82B 4K5RA 4WKYA 4RWWA 2BACA 2V8HA 1FXDA 4K2XA 2GHPA 2WOMA 2ZOMA 4KGVB 5AE1A 2NXJA 1NJIT 3NNAA 1U1PA 1UW4A 3VAHA 3DLBA 1XNQF 2XWXA 5KOXA 1HMVB 4A4JA 4HEA9 8AT1B 1TL1B 2J76E 1IKXA 3RB4A 1KONA 4M5GA 4ZIVA 4CTAA 2UXCJ 1IKYA 4U8YA 1R0AB 4F4XA 5A76A 1D8YA 1X4EA 3JYTB 4FXWA 2L9WA 1TMJA 2Z8QA 2Z2ZA 1L3SA 4USMA 4Y2AA 3UD4P 4PG7A 3PY8A 3NL0A 3M9MB 3KNGA 2RQKA 4PYDA 1BWEA 1YJRA 4C97A 3K58A 2Y1LB 1NRKA 5KT7A 1YBAA 3P45B 3AOBA 2BOPA 3NAHA 3LP1B 2VPZB 1YRUA 1M5KC 3NCPA 4DPYA 1KD1T 3DCAA 1G6BA 4RZRA 3OFHA 5KFVA 3GYGA 4LF5F 3CCZA 3G6XA 5KFLA 3MM7B 3THTA 2BBEA 3DRSB 2CPDA 5E7OB 3VVUA 1NK9A 4I69A 1S99A 5D0GA 3POTA 4DJBA 3MD1A 2MKJA 2EG2A 1FEHA 4OJGA 4DX8H 2YWWA 5LL6d 1FE4A 2V4JA 2R7QA 3NOCA 5E3AA 2R9LA 5L39A 5C2CA 2M88A 4QYRA 5B0GA 2QA4G 5HN0A 4M1KA 2B0GA 2P9GA 3TAMA 3KUEA 2F3JA 1QSSA 3N5BA 1RHJB 1C4CA 1HNXF 3M8PA 1T9VA 3QQCD 2RSQA 2AF6A 2OIHA 3DU6A 1T9XA 3HT0A 5J1EB 2UXBJ 4OZLA 3IXQA 2QC3A 3QZ8A 2DH7A 2VG6B 2R8JA 1S6QB 2PFFB 4NASA 2DITA 2HQ3A 2RT3A 3D3CJ 2B4UA 1UEVA 1GMWA 4UZBA 2ZE2B 2HRUA 2J6SA 1VS3A 4C0HA 4YB6A 2HSEB 2L41A 1LK5A 1UTAA 3OFFA 1U49A 4CH7A 4XK8C 4D3HA 4I2QA 2NYIA 2XMMA 2D41A 1UA1A 2DIVA 4C8ZA 5HLFB 3X1LB 3J81U 2Z2YB 2G0CA 3OR2A 3IG1A 1EHWA 1EKRA 4OX6A 3UVJA 4ANDA 1ROFA 3CJ3A 3DHWC 4ZP7A 4AL5A 3MPWA 4H4MA 1FKPB 9RUBA 1EX8A 2MLXA 3EZUA 2JFDA 4DV5J 4ELUA 3CD6S 3HVAA 1VRUA 3CJRA 5T7LA 4R5PA 2ZH2A 2NXNA 4ZP9A 1RT5A 3TOQA 4NXMJ 3QIPB 5KFAA 4XDCA 5CHCB 1N6QB 2E1MC 1S6PA 3P96A 3R6LB 4I2PA 1VDHA 4OYWA 5CD4H 4B9SA 4WZMA 2V9KA 3M30B 2WVBA 1VQLS 1NK4A 2E5LJ 2Z57B 1FKOB 1NM2A 1WOPA 4C6AA 1WG1A 3TAPA 1VC5A 2XO6A 2X3DA 2LA6A 2L9NA 1KDNA 2R7VA 4KH0B 2BJDA 2VOOA 1DQAA 4BLGA 5A8KB 1O6XA 4CLUA 4JI6J 4RW6A 3MUVP 1VQYA 3D0GE 3JAMY 2IM2A 4HDGA 3P6YC 2IRUA 4ES1A 4DV7F 1F60B 2J6TA 1YHQS 1RA6A 1VQNS 1H73A 4ZHRA 1LW0A 5KFXA 2ZDOA 3DFEA 4KV8A 3T5LA 2M4MA 4WXWA 1CULA 4ZLJA 4DQQA 3U1NA 3NNHA 3V2UC 2NYHA 3BF4A 5C42A 4EYIB 4DR1J 4RW7A 1HFEL 4TLRA 3KK3A 1H6KX 2VUGA 3NGRA 5I3QA 4IO1A 2MQ8A 1SQEA 2XO7A 2DJWA 4TN2A 3HSZA 1T05B 1RP5A 3TW0A 5C5JA 1QUPA 1HW9A 1Q86T 3LALA 1ZS6A 5ETRA 2ZJPQ 3Q0AA 5KFOA 2QL7B 2J8SA 5G0RA 5IC6B 3FZ2A 3OTEA 4QR1A 1RT2A 3B82A 1BMQB 1MMNA 4ECSA 2WOMB 4UQTA 2PMWA 2RRAA 2NREA 3FCVA 4EUVA 1IR2A 3HVTA 4QIFA 1F5BA 3BBBA 3FK4A 4BHQA 5B0CA 1RACB 2DNMA 4CO0A 1XWLA 4UOHA 1IKXB 2DR7A 1RWVB 5K8OA 4HHHA 4CTAB 2HVZA 2WSFC 4KR0B 1IKYB 2VG7B 5IC4B 1VBKA 3IWNC 2QX0A 4FYWB 2WVCA 3FVYA 1QD1A 3QJLA 2A2DA 3B4DA 1YITS 3GLJA 5LM7E 4Q5VA 4J9RA 2E29A 2Z2LA 3UPFA 2XSFA 2YNGA 4GMKA 4K4WA 3O5TB 3BPSP 1BUXA 4NRTA 1M1GA 4XAKA 2K06A 2VPWB 2YWGA 4MMOA 2AJQA 4CLSA 3M1VA 3E51A 3LA0A 4WK3A 4ZK7M 3DHXA 5EUHA 3R5DA 4DF4A 1RHRB 2XC9A 1UP1A 4HTJA 3ZZZA 4IRDA 3TVZA 3RRGA 2V68A 1U1NA 1WC4A 2B9XA 3POTB 2WVEA 2MLYA 1FRKA 4DL6A 1L3TA 2XLKA 3CJ4A 4JI8F 1ZH5A 2V4JB 3OLBA 7FD1A 3RUBL 1M1HA 3K57A 4KHPJ 1PJ6A 2ZKUA 2WK4A 2XNRA 5I3UA 4DR2J 3TAMB 2RU9A 5H1SV 2MKSA 1M90T 2F9DA 4F7VA 1CJKB 4DV3J 3HLUA 4L3KA 4J9OA 2OD4A 3TWZA 4B9NA 4O3RA 2A6OA 2QLWA 1RABB 3M8PB 4OLPA 1VQMS 2EFQA 1SJ1A 1HD1A 3OTOJ 1Y11A 4IFVA 4NLYA 3QZ7A 1TKTA 3T19A 1SQGA 4X62F 4LF4J 3UR3C 2KB2A 3BB5A 1HBOA 1YIJS 3BO3A 1VQPS 4B3TF 1NSAA 5JVHQ 2YTCA 2ZBQA 3PHEA 1DY3A 3N6NA 1RK8A 2HBRB 4OI2A 2W25A 5ADZA 3FZBA 1NHVA 2MJNA 2ZH6A 1Q5VA 5E5NA 4YS2A 4I2QB 2RD5C 3FGVA 3BGFA 1URRA 3W64A 4BWJA 3HFVA 1F2HA 2ZM6F 1HNZF 3RYLA 3H2LA 3IG1B 2OFHX 1Q8LA 2R7WA 2FJXA 5HQ8A 1CBKA 1IQZA 2KYXA 4U8VA 4H4MB 3T1HJ 2VD3A 2R8HA 3MCSA 4KB7A 1IVZA 2HWTA 3PO4A 1BQXA 1NCLA 2E5IA 3CUNA 1VRUB 5T7LB 4R5PB 2ASYA 5M2UA 2Z0GA 1RT5B 1Y3KA 3EZOA 3EX7B 4TY9A 1H3DA 5KFBA 3MOZA 1SKUB 3SCJE 1PSDA 4DUZF 3K89A 4LVNP 1EETA 3CPWR 4I2PB 1FVQA 2CPHA 3EE3A 1S1UA 2IPOB 4B3OA 3SMZA 5AE2A 1OY6A 1DARA 4PUOA 5K9FA 3RB6A 1XNQJ 2R8IA 1NJZA 1NNDA 1HD0A 4Y3CA 4P75A 3GTYX 1R8BA 2RHSB 4MKYA 2DBBA 3FUYA 5DDQC 2B51A 4I1TA 1YQHA 4J9LA 2AQ4A 4PABA 1ULRA 5KOWA 4B08A 3Q83A 4DWIA 3RRKA 4CLPA 4RW6B 2DXFA 1JIHA 3LPYA 2UVWA 3FEZA 4KKOA 3DYAA 2FGCA 4CM0A 1MWZA 5CYJA 2UVUA 3L7PA 4ZHRB 1LW0B 2V8DA 4KV8B 1SJ3P 3G8TA 4MKAA 1HQ2A 1FEEA 2VQEF 2LDIA 1CULB 1PKUA 2F7VA 4QJVA 3HSDA 1HWUA 3Q86A 1F3FA 3THPA 4A8QA 4RW7B 2V2VA 5J1NA 1PILA 4DZDA 3LAMA 2CDQA 3KK3B 4DV4F 1CVJA 5D4NA 4M63A 2HMIA 4LF5J 1SL0A 1RADB 2ZVIA 3J7ZT 1HA1A 2KDOA 3G8QA 3NGDA 1F6TA 2MYFA 4CRJA 3ILJA 1VCTA 3GFXA 3TJ9A 3GG0A 1SJQA 2ZBRA 4NA2A 5BYSA 3ELHA 1OQ6A 3WIVA 1RT2B 3AT1B 5HATA 1U24A 3EWGA 4RR5A 3NMAA 3GIMA 3IR7B 1X5OA 1NHUA 4KRWA 3V6DA 4KPCA 1HBNA 3HKWA 1RHMB 2R2UA 3CDAA 3VZIA 3OR1A 4AYBD 2WTFA 3HVTB 2ATLA 4OZ5A 2WCXA 2DXDA 3IM9A 2XGQA 2BQRA 4DPWA 2DY1A 1TQLA 1JLGA 1HNXJ 1RT3A 4JYAF 2V9WA 6AT1B 5F0UA 2KM8B 1UPMB 2D3O1 2QT7A 4P72A 3WX4A 3LGNA 4NYPA 3D2WA 5D4OA 3K7RA 1NSKL 3PJWA 3RBDA 5CCLA 3TA2A 2YNGB 2G2OA 5F8LA 4USHA 4DUTA 4DV6F 3J81j 3PW5A 2AJ4A 1WJ9A 4L75A 3QFWA 1WHYA 2HHTA 3M1VB 3VAJA 2A18A 1VQKS 1UVNA 4TLQA 1RAIB 2FVCA 1FTRA 1FJEB 3Q89A 3A3PB 2DEJA 4PXCA 3ENAA 4ELVA 2AJ0A 2UU9J 1I1GA 2KJVA 3MEDA 2MDAA 4U9RA 2DNHA 5I3PA 2YNFB 4DV1F 1YJ7A 4QYZJ 2BJ8A 5T14A 4RNOA 2FC8A 4ZLPA 3C3LA 4A48A 5CYQA 1RU2A 3BKTA 4USTA 2HHXA 2OEMA 3HK2A 3BR8A 5I3UB 2V2QA 2FVRA 3CCVS 3RAQA 1S10A 2W8LA 2ATCB 3VWSA 1X9SA 1PIEA 3NS6A 3N5FA 2C2DA 4C7QA 5KFEA 3PO5A 4NPOA 1CQMA 4R25A 4GVLA 4IFVB 2VF3A 4OI6A 2GC8A 1TKTB 3Q8SB 4GC6A 2HVDA 3ENWA 4ZCMA 3QRQA 1L3UA 3WBZA 5GADU 1RTHA 1HBOB 4X64J 3BS9A 4ZS6A 1G1XA 4PWUA 3UD3P 5C24B 2CJQA 1WWHA 2HS3A 2VOPA 2C3OA 3W63A 2WZ1A 1SJRA 4CLTA 3W5XA 1VJWA 3QPIA 3HHEA 2DISA 4DV7J 2GIQA 4N47A 1IWGA 2CPEA 3CMAS 1JLAA 4XDDA 5D4PA 3GPAA 2HWHA 4Y2MA 3T9NA 2RQ4A 1YDLA 4G3IA 1JNZB 5L1KA 1XMQF 4CYUA 2NXCA 4WIQA 4FF4A 2GV1A 5B0FA 2KG1A 4WTOB 1JMTA 4ZVRB 3MPYA 4ZPDA 1F5CA 2DGTA 3JB9k 3Q2SC 4F3MA 3W5ZA 3M6UA 1MLAA 1H72C 5AXLA 1U45A 2SXLA 3C6TA 3ZTQA 5B0AA 5HVGA 4QW9A 4EU0A 3B8HA 3KLVA 3ZNUA 2DRAA 1RWUA 2MSSA 4C48A 2ZZTA 3OTBA 1EETB 3A12A 4OHYA 2B8QA 3BYRA 1O5JA 2XI3A 2RVJA 3DOMA 1S57A 5HP1A 3NLCA 1S1UB 4B3OB 5F9NA 4JI5F 1HARA 3CJTA 4FPIA 4F0HA 4PUOB 4GKJF 2DNQA 2RRNA 1KBRA 4NEYA 3V4IB 2BABA 4KFBB 5BYRA 2UP1A 2D3ZA 2FZGB 2KVIA 5E3PA 2UUBJ 2AEMA 3J7YU 4UOGA 3L09A 3KHLA 1NPKA 5IV3A 2XSJA 2IJFA 1I51B 1N0UA 1WG5A 1YJWS 2Y3YA 3T6JA 1U6BA 5A8WA 2QMWA 1Y4ZB 2FD2A 3T5JA 4KKOB 2FY8A 5FD1A 2DR6A 3DYAB 4DL7A 2YNHA 1RAOA 2FJEB 1HIYA 1GNKA 4CDIA 3BSOA 1TL5A 2B4VA 1RDRA 3ET6A 4LF2A 4USWA 2IA0A 4F4YA 4UF4A 5SUHA 3PVXA 2MHNA 1S12A 3H7HB 3TA0A 4JI4F 2HMIB 4LUBA 4ZKAA 1WDTA 4LF8J 3L3CA 2W7AA 1Q95G 2L9DA 1YLXA 2BJEA 2YKOA 3KK2A 2C2NA 3M8YA 3NNCA 2YKMA 1VIOA 3KDNA 3W1YC 1CS4A 3C6UA 2HFSA 3W9JA 5ETVA 4ZMMA 3HJVA 2B9YA 5JVGQ 2MQQA 2HVHA 5J2MB 4J7CA 1S0OA 3WX8A 2IVFB 1RHQB 2QYGA 4RU9A 3V6DB 4Y2IA 3AAWB 1VRTB 1SCJB 4ZVGA 1FNOA 3OR1B 4PXEA 1OJ4A 5KFZA 3M8ZA 4ZDNA 4DOZA 3HVRA 2EKNA 1JQGA 4FYYB 4Q0BA 4YY3J 2CNKB 1NJYA 4C3MA 2LEPA 3GJQB 1R8HA 3GSIA 3OQ2A 3H5XA 1RT3B 2K1RA 2PI4A 4S0MA 1WACA 1I94F 4WWSA 4X62J 4P7TA 3IGNA 2FZCB 3HD1A 3CCLS 2EFVA 1ZPVA 3JXOA 2FDNA 4I6YA 4WBFA 2F8MA 3KG1A 4B3TJ 3JAMU 4MIWA 4IQMA 3PCOB 1R31A 3JTPA 1VMBA 3BR9A 5GMEA 1JXEA 2NZCA 2ZNYA 2A10A 1XR5A 3TZWA 2AIRB 4X84A 2FC9A 1TUGB 2DRDA 1ZA1B 1AXQA 4RBTA 4DCJB 4OHWA 2MKCA 2B8PA 2ZM6J 3M9OB 1RXOB 3H5UA 3M6WA 4HT7A 2ZH1A 4NLTA 4A8OA 3MEDB 4ZCLA 5KFQA 1QY7A 4MAKA 4AL6A 1RTZA 1LWXA 2ZH3A 3BKFA 1OSDA 2ROEA 3PR5B 4OZNA 3LWLA 2A6MA 5CYQB 4DR4F 3I9ZA 2ERRA 3GV8B 1SUQB 2GVDA 2WB4A 4O3QA 4ILLA 4YDDB 2MKKA 1KQFB 2QLFB 2QLBB 2ZNZA 3M8QA 4DUZJ 4PPZA 2WAQD 1FESA 2MQMA 2C1EB 2EPIA 2KXFA 5CAAA 1LEOA 4YB7A 4Z2XA 3BH7B 5KT3A 3IA0A 4MFBB 1JJ4A 2OLWA 2KRBA 1RWOB 3G4SS 2DGQA 1RTHB 1S4FA 2BYCA 2LEAA 3SIPB 3QJPA 4KHMA 3ISNC 2H51B 3MCMA 1M5SA 3H20A 3TJ8A 3VVTA 4UUXA 1J2VA 2ZZNA 1DTTA 2LXUA 4ED1A 2HEKA 3O8WA 3GG1A 3ISZA 1R89A 4DU8A 1W7WA 1WF0A 1PC4A 1JLAB 2VQEJ 2JX2A 5KT5A 2CQPA 3AA8A 1A9NB 5KAKA 1RTDB 4CYUB 2GNKA 4DV4J 5D6GA 2VQFJ 4B9UA 2VODA 3D5MA 3K2YA 3TQEA 1WELA 2DTJA 3PV8A 5IM0A 2YQ0A 1K0VA 4B3MF 4AXJA 1U1LA 2KT5A 2HRTA 3KJQB 4ZVQB 4DQSA 3C6TB 3CCJS 2YWKA 2E7XA 1HW8A 4URSA 2Y1IA 2BV3A 1RAFB 4AUKA 1UVIA 1UPPA 2K3KA 2ZZMA 1HPZA 2F1FA 3DOMB 2FY1A 5HP1B 3I82A 1LWEA 4U67Q 2E9RX 4K50A 1UVMA 2L3MA 2DYAA 1VR6A 1D8ZA 5LMNF 2GQCA 4UW2A 4LF9F 3T1YF 3F73A 2CPFA 3QT8A 2HZAA 4JYAJ 2N7CA 3HKZD 3QT6A 2XSJB 3G9CA 5CYMA 1HQUA 3HZGA 5CZVA 1NXIA 2JOQA 4NEZA 3DI6A 4RW9A 1WEXA 5A8WB 4C11A 2RDJA 3PXGa 2H48B 3AD8C 1OPIA 2YNHB 4IFYA 1DQ8A 3ZO7A 1OSCA 1Q4RA 2HKEA 3EVOA 9ATCB 5CH7B 3W61A 4QWAA 2V63A 2LQ8A 4P52A 3HHKA 2C3PA 2RDIA 3CJSA 2EK6A 2F4FA 3ET6B 1YZ7A 3MPUB 2PT0A 2KU7A 5CABA 3W2VA 3D3BJ 1RT1A 3TO8A 3PX0A 3CDBA 1IKWA 2HNYA 2PA3A 3C14A 3MM6A 3CO9A 2XMJA 2B43A 2DD8S 1QE1A 1UZDA 4ELTA 3D54A 5ETQA 3DXBA 1PJ5A 2NUHA 5U47A 1NEEA 3EZ5A 3A8JA 1ZM9A 3VALA 4DL5A 3KK2B 2YKMB 1CS4B 3C6UB 3G6VA 2HK2A 4DV1J 1EARA 2MMYA 1JLCA 2VC1A 1C0TA 1LWFA 4DPOA 2XLIA 1DURA 2P6SA 4F4WA 5HL7Q 2FQQB 5DG9A 2RE1A 1TL7A 1SI9A 4A46A 3FC9A 4LFCF 4Q0BB 4YB1P 3KLIA 1QM9A 4WU2A 2ZBIA 3TVKA 3ULHA 2K1RB 3TA1A 3GP9A 4Y0FA 1I6JA 4EZ9A 3CCUS 4ICLA 2HZCA 2HBZB 2F65A 4PG6A 4EO8A 1XBWA 3VAFA 1U1OA 2YWFA 1QSYA 1UMJA 1NKEA 2HHWA 5IT4A 2OD6A 3JSBA 3MECA 3DRPA 3EVMA 3T1AA 2ZBCA 3H0PA 2E7WA 5F41A 3IS9A 3BJYA 4CWBA 5DZ6A 1UVJA 4JOUA 5L1IA 4DS4A 4JV5J 3H42A 3RBXA 2V94A 2MHEA 4OYXA 2BJ9A 2YPYA 1TR0A 4J5OA 3AQOA 1XMQJ 1LW2A 2R7RA 1FRHA 2VFRA 1R43A 2HWIA 1RKIA 2Y9HA 3OUYA 3AOAA 2MEWA 3HCXA 3FBEA 2BJ7A 4WP8A 3W9HA 1FF2A 2UXDF 3UNGC 2ZH4A 4ECUA 2HBYB 2GVDB 4IKAA 1HQEA 2AJFE 4K2JA 2DHGA 4YEAA 4P9SA 5KT4A 3BGLA 3KLHA 3M8QB 1WHXA 2HQGA 3VGUA 2X7IA 1FKAF 3RB0A 2NPIA 1OYDA 1WF2A 3PACA 4OMFG 4DSIA 3MR7A 1K8AT 3GJSB 2RS8A 2XEXA 1G4CA 3CWJA 4FN5A 3JTNA 4WKRA 1P9QC 2FPHX 1H2TZ 5LOQA 2RKIB 4K4UA 2FUG9 4LF7F 4ETZA 2EG1A 1AB8A 3U02A 4P74A 1QVGR 4DX6A 4WYLA 2VICA 4ZVOB 1DTTB 1EKSA 4DN0A 2AX1A 1T9WA 1PYOB 3NCQA 4KYZA 3IM8A 3MM5A 3TUPA 1X0PA 2BEFA 3DDKA 2HGLA 2V0NA 2BXJA 2FVQA 3MFHA 4ITSA 2OTJS 2MQNA 1S77D 2OSRA 2XNQA 1Q7LB 2HFOA 1XIQA 1RLDA 2V5HG 3OTDA 2EC2A 2IFXA 1FWPA 3AJDA 2J5AA 3MAAA 4ENOA 5IM0B 2YNIA 1KP6A 4QZVB 4OX9J 3FMWA 2V6AA 3DLEA 4DSKA 4DQPA 4U7CA 4QIWD 1YKWA 5LJ5Y 5HJYA 4CH1A 1J5EF 1TVRA 5L9NA 5LJ3Y 1HPZB 4ECTA 4QCLA 5DLFA 5LMUF 1KOOA 2W2PP 2F4VJ 3UQSA 5F3TA 1GXTA 3LW5C 1HHSA 2P5VA 1XERA 3CCQS 3GWCA 2DH9A 1U6FA 3HULA 4A8YA 3HJFA 2DR5A 1DRZA 2W7PA 3H5SA 3PFOA 2GVZA 2OPQA 3NAIA 5CYMB 1HQUB 4WE1A 3AD7C 1I94J 2AYBA 2AU0A 3DI6B 4RW9B 2PO4A 2VH7A 4C11B 2OPRB 2CQBA 3I0SA 2ZC4A 3GB0A 3CSKA 4IFYB 4B9TA 4HTIA 1ZAVA 4AFFA 4GRSA 2G13A 3UCUP 3G82B 2P8IA 2ZHBA 1J5OA 3VHQA 2Y0SD 1VHIA 2DCUB 4HYKA 1ACMB 3IWLA 5DM7Q 3TI0A 2NPFA 5DLGA 1UWBA 3H40A 3W2VB 4DR5J 2XMWA 1RT1B 2CJXB 4DZ6A 1HNWF 5KFCA 1IKWB 2MTLA 3KK1A 3MM6B 1N48A 1QE1B 2VBZA 1S0VA 2B6AA 1SIWB 3G96A 1RYSA 4ATNA 1WTBA 3TX8A 2ZWOA 3K5NA 1Y5LB 5ETSA 4IOBA 5A2QU 1RB0A 5T41A 3GCXP 1Z4UA 4RKUC 4JI3J 3KJFB 1PAEX 1JLCB 2DH8A 4C3LA 1C0TB 1LWFB 3RGIA 4LF1A 2M2BA 1RQ0A 4WK1A 4NXMF 1SC3B 2ZJQQ 1GTEA 3OHAA 5D78A 2YKPA 5F9LA 4J91A 2BM0A 3UCZP 3K0JA 1FDBA 1RBAA 1QTNB 2OEKA 4A8WA 2Y8WA 2ZDPA 3KLIB 1MU2A 1KKHA 2E5LF 2QL5B 1KQSR 1GXLA 4J90A 2XYPB 2P9CA 1WF1A 3LH2S 3SV3A 1LFPA 1N8RT 2CZVC 4ICLB 3FBBA 2DGSA 3AB2B 1K47A 3M8RA 3GV7B 1VK8A 4F04B 3VQSA 1XQIA 2CPYA 2IYIA 4JI6F 5ETPA 3MGJA 4UQGA 3MECB 3DRPB 3TUJC 3PW2A 3R97A 2GIRA 5DO2A 4CLKA 4JI1J 2CQHA 3TX0A 5GAHU 3VAGA 3IS9B 3ONQA 4FNIA 4OZJA 4A8FA 1X5SA 3ZZOA 2ZJRQ 4U7UD 3MMAA 4KGKA 3H4DA 1VBZA 2KFYA 4DR1F 1QAXA 2ABYA 2XHWA 4PPDA 1CEZA 3QNWB 1Y9OA 1QAIA 2WHOA 5KFHA 2X51A 4ID8A 3ZXWA 4ANCA 3WIUA 3JQMA 2C3YA 5KFDA 1H7XA 1LW2B 3D6TB 2HGMA 4ALZA 3IN5A 1FFSB 1N33F 3OUYB 1OYEA 2RUSA 3DNCA 1M0SA 3MEEA 4A47A 4OL8A 3DDIA 2FJDB 3DRRA 1X60A 3E3XA 4YFUA 1RAJA 1H0HB 2KN4A 1HQEB 4QQBA 2JVRA 1PYTA 1U8SA 1QAJA 3NKYA 4N7TA 3KLHB 5BYQA 3HX9A 2JLGA 2HHPA 2FVSA 2FTRA 1U1QA 3DLJA 4KE5A 2W9CB 4ILMA 2RS2A 4D3GA 1ZM3A 5IS2A 1N5SA 4DQIA 4BCAA 1FWKA 4XPEA 4ZA1A 2DPJA 3FMBA 2IMOA 4UT4A 4V19X 2RILA 4O0NA 1B0VA 1U7LA 2MZJA 3RJMB 3MM8A 1S79A 4I56A 3AXMA 2CDRB 3ETMA 4DL0C 4Y2KA 4O3NA 3R1HA 2AYGA 3RRHA 2I1RA 2FHOB 1K9MT 2L08A 4F2RA 2HQIA 7AT1B 4X4VA 3MM5B 3MTKA 1U2FA 3BSAA 2MGZA 1S9GA 2W9BB 3RTVA 3C2PA 1M5VC 2KL8A 4NLVA 2HS4A 1O8BA 5DDPC 5EWGA 2W01A 1AT1B 3ZZUA 2CWKA 2IDEA 2APOA 2UVRA 4FS2A 1TTHB 3IRWP 3SQOP 2NQPA 3WC0A 1KVIA 4OZ0A 2CQ1A 5J2QA 2XMTA 1JLQA 3G87A 1S7HA 2KXNB 1YBUA 4J9QA 4UOCA 3MAAB 1N5QA 2YNIB 2EFOA 3PX4A 4ZITA 3HDSA 2J9DE 4CLZA 5EX0A 1KHWA 3DLEB 1YRTA 5HANA 2W2OP 2AGPA 6FDRA 3B6BA 3ISND 1VK3A 1TKZA 1IWAA 2IJRA 2ALYB 1JLEA 4PG5A 2PA8D 3GR1A 2DNPA 4WFYA 1N0VC 5GAGI 1KN6A 4KHPF 1TVRB 3BSNA 2IMWP 4O4GA 1MMDA 2CA9A 4WF9Q 3MCOA 4F26A 3ZTSA 4DR2F 4FYXB 3GFHA 5B7WA 1IBCB 4NZ7A 1F1BB 2EK1A 4KSEB 4DV3F 4P2MA 1PAUB 1U1KA 3QWPA 2NUUG 3GIKA 3UD5A 3OT9A 2KXHA 2MZSA 5LXRA 1GEHA 3CEDA 2GVZB 1S1VA 4KQZA 2OPQB 1UEUA 4WE1B 3EM1A 2GIFA 3CE8A 4HI1A 2DY9A 3I0SB 1REVA 3D4JA 4BBYA 3ICLA 1X0FA 2KVQE 1EP4B 4MJKA 1ZOTA 3JSYA 4IH6A 4RUCA 1AFJA 2YBVA 4ER8A 2MQOA 3DU5A 3M2VA 1J5OB 3SCIE 2BQUA 1D3WA 1X4FA 3KNAA 3TZZA 3EDRB 4QIGA 1UWBB 1S59A 2CQ4A 4USVA 4RNFA 3WQPA 3KK1B 1S6UA 3W2WA 3FDSA 1V5IB 1S9FA 1MROA 2OP5A 3S01A 4I6AA 4K4YA 2HNZA 2B6AB 2QYCA 1K44A 2ZUAA 1IBMJ 4LR8A 1K73T 1A7GE 4WFNQ 2V34A 2C28A 3SFUA 3MUTP 2ZH8A 4JI7F 4NXNF 3T1HF 1KLMA 4W92B 1FDAA 1WHWA 3R5CA 3Q8QB 1W2IA 7FDRA 3V6HA 3AHPA 4I4BA 2W4DA 2BRKA 1ZETA 2UXDJ 2HS0A 2U1AA 5KFFA 1FFGB 3TUZC 1VQ9S 4DDFA 4DU7A 3N6LA 3MFIA 2N4CA 3CC2S 2KG0A 4X65F 1MU2B 1FD2A 5KG4A 3UCGA 2V69A 4QU7A 2ZD1A 1LWCA 3R9LA 3VR1A 3RU0A 1YJTA 4M94A 1KTVA 1X5TA 3KKFA 4KJIA 3KHGA 3VF0B 2W1BA 2XQCA 5K20B 1PO6A 1UETA 2H1YA 2CPJA 2KFZA 3D1OA 4LF7J 4KBIA 3CDEA 5DQHA 3C8YA 3RW7A 2NR0A 1TAUA 2B9EA 3CVKA 4WPAA 3PKYA 1XMOF 3LPEA 2CZ9A 3A13A 2AJ1A 1C0UA 1VQ5S 2EI5A 2OELA 2HIQA 2JSXA 2I0XA 1CC8A 2EWHA 2KZMA 2QSWA 3MMAB 4DMZA 3OPKA 1JXVA 4A8KA 2DNZA 1LOUA 3CD5A 3D68A 4B3RF 2VDHA 4WXOA 1AW0A 4FXDA 1NK5A 2HLUA 4QPTA 2IA6A 3GILA 1RCXB 2BRLA 4B9MA 5E3CA 1FJ7A 3KG0A 4LFAJ 2ROPA 2JLEA 5KG0A 2Y1RI 3RG6A 2CJ9A 3MEEB 1MWQA 1X8DA 3KMSA 1PJ7A 2I5JA 2M8HA 3M6XA 5B09A 3DRRB 1NAQA 4PEOA 1NH8A 2D3UA 2PMZD 3BEGB 2HHSA 1K1QA 1Q53A 1S4EA 2GCFA 2R2RA 5HMWA 3BH6B 3PRDA 4A8MP 1J5EJ 2VBWA 4EZ6A 2WB1D 3I5BA 3KOAA 1X7VA 1UJ6A 2BW2A 3HVWA 3NMRA 5LMUJ 4K4TA 4ED8A 2R7XA 4RUAA 3G6YA 5DRKA 2WSCC 5DDOC 2YPZA 1B7YB 3BDEA 4USIA 3SXLA 2QV6A 2F40A 3AD9C 4HL9A 4W4MA 1KLNA 3MXHP 1F0XA 4HH1A 1XC9A 3MM8B 1RAAB 2FHKA 1NB2A 3RBEA 2VL1A 3MZIA 1JKHA 2M3DA 3G2XA 5CD4A 2FHJD 4HVZA 2QMUB 4N77A 4DR7J 3BO4A 1SKRA 1HWKA 1S9GB 2RIJA 2IC3A 4DPUA 3NG8A 1TL4A 2WW8A 4I7FA 3PJ9A 3FEXB 5L38A 2N7YA 5DG8A 3EPGA 1HNWJ 3UNYA 2WONA 1U0SA 3CJKA 2RMLA 3Q22A 3M32A 5J2QB 1JLQB 3RZAA 1BQNA 5F8NA 4OI3A 2UU9F 3L7UA 2W2QP 2HQFA 3SSRA 2ZEJA 1R8CA 1HLWA 1KFSA 4HACA 3QIDA 4ZPVR 5DQGA 4CLYA 1FRMA 2XI2A 2C42A 5ETNA 4O4GB 1HI1A 2JL9A 5ETTA 4KHRA 5DDRC 1RWPB 3EXYA 3B4MA 4ZJOA 3OSPA 1DLOA 3K5PA 4CO4A 2DB1A 4FF2A 2ZHOA 3R1LA 4OYAA 3I6PA 4DR6F 4PQAA 4DUYJ 4ZVFA 3ITHA 2CQDA 1FRXA 1UVKA 4TU7A 2E1PA 4OI1A 2Z2MA 2X1AA 4LIRA 5H9EJ 2OO4A 4R0JA 3HF5A 3FSXA 1YJNS 3ZZYA 2L48A 2VHGA 1S1VB 2HVIA 1NLKL 1H38A 5GMDA 1WTFA 4ZCKA 3QRPA 2RNEA 4Q2MA 4C8NA 4X64F 3LUYA 4OYMA 5KFPA 1DJ0A 3CT9A 3OL9A 3CJ2A 3AOCA 1REVB 4PCQA 3VAKA 4IG3A 5RUBA 2R7SA 4CI0B 4NX9A 1B7FA 3KG4A 4ZCIA 1T7PA 3M2VB 1X4DA 1YGYA 1M5HA 3K5MA 4K59A 4QBUA 4YUDA 3LP0A 4A8SA 3BGUA 3UDVA 4U95A 3W2WB 4V19J 1FCAA 1MROB 4YDXA 2K7KA 2GW8A 2P9EA 2GHWA 1OY8A 2D74B 1QLNA 3P3DA 1OO0B 1DZ5A 4TNOA 1UA0A 4IDKA 2GS8A 3AA9A 1A0OB 4HLBA 3F56A 3F41A 1N33J 2E9TA 2E5GA 2LEBA 1N52B 4OYIA 4L3NA 2O67A 2BQ3A 3LQVA 3D0HE 4XO0A 5B0EA 3EICA 2UZAA 2M70A 4RWXA 2LU2A 2GMHA 1NJWA 4ZPWR 4K8RA 2MXYA 3GIRA 3VQTA 1T3NA 1I5OB 3QLHA 1ZAWA 2NLWA 2FHMA 1JLFA 3GIIA 3IMQJ 2XMVA 2ZD1B 1LWCB 3SBMA 2PFDA 5AXMA 3MR5A 4ZP6A 2DNRA 1TV6A 2DNOA 4AXIA 4FVCA 3GMGA 1HKAA 2DGVA 4DR3F 2UUBF 2ROGA 1S9EA 1XNRJ 3NS5A 4J9KA 4X4OA 1BLUA 3LANA 1ZBTA 4ED4A 3NWGA 3PNIA 2F8HA 3R7NB 2FHJA 4URGA 1JB0C 2ZITA 2BANA 4P6QA 3HHNB 4CO2A 3M9NB 1HL6A 1T9TA 5HMZA 1C0UB 3CJ8A 2H54B 5ITHA 3FFIA 3CCSS 4MTPA 3ZZ0A 2VFSA 4URQU 2XHCA 1K0TA 4HHUA 3CDWA 1MMLA 3M2RA 4TQRA 2I2YA 2GGPA 2CPIA 3FQKA 3HPOA 5E41A 3DLKA 4LF8F 4OJ1A 4CCHA 1S5ZA 3PDNA 2R2SA 1IBKF 4Q8FA 4M5KA 3AQPA 4NRUA 4FS1A 1NKBA 4ED5A 5L9XA 4DLGA 1DQ9A 2I5JB 2IAJA 2O1PA 3VGSA 4ZPAA 4X66J 3AODA 3R7SB 2XYHB 2NXUA 2DR9A 1FERA 4NLSA 5CCMA 4X4QA 5A0YA 5HQMA 1ZTWA 2GFFA 1IM4A 4DFPA 2VG5A 3WHIA 3MD3A 4KPYA 4YY3F 1ZM2A 2OPSA 1X4GA 2HG4A 1SC1B 3ZC4A 1E6YA 1HYSA 3EJMA 4PYAA 3RAXA 2COLA 4DN9A 4FNHA 4CQ1A 2EBGA 4ZVTB 5HK4A 2VIHA 1FX2A 3JS9A 4F2SA 1JKHB 4RBVA 2CPZA 3MDFA 2X1BA 4F36A 4QW8A 5K8NA 4QWDA 2DK2A 2LA4A 2V8PA 5KG7A 5GMKa 2GA7A 4RU2A 2IC3B 2C22A 2M8DB 3V5RA 1N5YA 1MNEA 1RTIA 2C2KB 5D77A 3BSCA 3QRRA 2XY7A 5IQ6A 2PEHA 2X1GA 3C46A 4QIVA 2WONB 2VBYA 4UY85 3JSRA 3CJKB 5E2QA 3M32B 4O3PA 2MB0B 2K7JA 3OR2B 1VBXA 3J7AN 1BQNB 3CCRS 1TFYA 1IBLF 3RR8A 3A8KA 5GAEU 3UVJB 1B3TA 4NI2A 1X4AA 1RYRA 3Q8VA 4AD6A 4JI7J 4NXNJ 2WVFA 4HACB 1HI8A 2E1CA 4RUHA 3OBIA 4ZPBA 2CVEA 3DRSA 2QGFB 3I4PA 1RT6A 3RW6A 5D15A 4WFAQ 5HO4A 4OHXA 4NYOA 5HMXA 2DIUA 2CNOB 3SFGA 2ASJA 1EZZB 1VC6A 1S6PB 4L76A 2N3LA 2KT2A 4J37A 2J6UA 1LKZA 4YQWA 3P5BP 4H4KC 4X65J 3ITHB 1FDNA 3MAQA 4KO0A 1FNMA 1NZ8A 4KTQA 1PYSB 3KJNB 2OH2A 2DGWA 2KJWA 4DX5A 4DS5A 2V50A 3ENVA 5D0RA 3GR0A 4EEYA 3GJTB 4F3QA 1OQ3A 2YKNA 3OL6A 2HLTA 3W66A 3W3SA 2G2ZA 4E98A 4IG3B 4OYPA 1U25A 2FGOA 1WNEA 1WUUA 3M6VA 5KG3A 2RHQB 2GQQA 1NHKL 2BOAA 4PAAA 5L46A 1XMOJ 1SKWA 2RF2A 3D7SB 3PW7A 4B17A 2HFUA 2LCWA 2Q6BA 3LP0B 1YRXA 2LQ5A 2M0GB 1AZSA 2J9DA 1HNIA 3LTOA 1QUVA 1FWLA 4X4TA 5C42B 1LK7A 1S1WA 4B3RJ 4GO5X 2G0JA 2YX7A 3D6HB 1TK0A 4K0KF 4IDKB 3CCES 2VQFF 2JEFA 5FIIA 5KFIA 4CO5A 1ZA2B 4N5SA 4DL4A 2R4FA 5I42A 5D0HA 4AQYF 4B02A 3UE2A 2HHVA 2KYZA 3OXGA 5CQGA 2DGOA 2D3OR 1U6ZA 3Q8UA 2FJAB 1KNZA 3W9IA 5G0RB 1AUSL 2R2TA 2E66A 4O3OA 2XY6A 1SPBP 3WZ0A 1Q78A 3V4MA 1RBOB 3QLHB 3UN5A 1JLFB 3UDLA 2OMOA 2DKOB 1BWVA 1LV5A 3D6MB 4O4RA 1RWWB 5H9EK 3PHTA 1NO8A 1TV6B 1KS2A 4DFMA 3HHDA 3G86A 4NZ6A 2MZRA 2AEJA 2VASA 3M30A 2C2EA 2J7UA 3D1QA 4KT0C 1S9EB 1SIZA 1RT4A 1R3NA 3M8SA 1O51A 4ECZA 2IVYA 2FJWA 1WDDA 3K59A 1R6VA 3W8PA 3BBFA 2FJBB 4DSFA 3CIMA 3CDUA 4OI0A 2BANB 4P2SA 1WC6A 3VV2B 4KY3A 3HHLD 4GKKF 5DQIA 1UKUA 3C16A 2QIFA 4M5LA 4Z7CA 3PKMA 2YVSA 3R5JB 4F25A 3R2CJ 3M2RB 1ZZFA 2GGPB 1UW9A 1N36J 2RQMA 3CC4S 2VDIA 2IM0A 2XCPA 2J7WA 4YN3B 3DLKB 1UFKA 1OMSA 5B0BA 1SC4B 1B70B 1NSQA 1DHMA 4BC7A 3PW0A 2W7OA 2UUCJ 4TYBA 2PDAA 3CXCR 3BN7A 4QU6A 3MI7X 2RAQA 1RLCL 2NSCA 5A0YB 3FNNA 3QFHA 4Z37A 2BJ3A 2E9ZA 1P1LA 3LO3A 2VG5B 5JMNA 4M95A 4OFZA 2OPSB 4DR6J 5LSOA 1T94A 4ILRA 1E6YB 3VAMA 1S97A 1HYSB 4HKQA 3I96A 1IR0A 3BM7A 4ZP8A 4F8RA 2JFKA 2LXFA 2YH1A 1KWMA 3LGHA 2GHVC 4OV1A 2LQBA 4Y65A 3EUNA 1V5VA 3S8SA 2DEIA 1WC0A 2MZQA 3CMES 2VG7A 2XMKA 4DL3A 2GZOA 1F9HA 4OLOA 3MUMP 3MAHA 4XIUA 5IT9Y 2Y8YA 1N5YB 3OFEA 2OGUA 1UFWA 3IO1A 3OXLA 1RTIB 1X31C 4C8MA 2Q6CA 4EMDA 4CNZA 6FD1A 3MR3A 4JV5F 3DXSX 2BE7D 2LQ9A 1FI4A 2XWYA 1GMVA 4LSLA 4YR3A 2XZDB 3SI8A 4IH7A 5KFUA 4DSLA 3I5CA 5ETOA 1OWXA 2B7BB 1Q8IA 5E0OA 4DHVA 2X3GA 1BE4A 1VC0A 4RJVA 3TYTA 4ED7A 1RHUB 4NI2B 1WI6A 4FZVA 3K8WA 1PGZA 2WSEC 3J80Y 2X1FA 4L73A 3SSQA 3O3LA 2Z56B 4DSEA 1LNQA 2DHXA 4EYHB 3UR0A 1V3ZA 1RT6B 2GJIA 4C0BA 2XYGB 4CP5A 1F9FA 1GMUA 5BR8F 2ZH5A 3W7BA 1HI0P 1JWWA 2EFGA 2EXUA 3CTRA 1QJHA 4N76A 3KXDA 3NWRA 3RR7A 3RAMA 4NLDA 4ECXA 2VPYB 4KO0B 2AZ1A 2U2FA 2DPIA 5DETA 1WKJA 3DC2A 4TVAB 3TUIC 2KZZA 4P7VA 2LKZA 3K17A 3Q23A 1CJKA 1RAHB 4I68A 2W2NP 3IFEA 1U09A 2YKNB 3L4BC 4DR3J 1GX5A 2HYIB 3U7JA 2XB2D 5AT1B 2DGXA 4LRAA 3VTIA 4YR0A 1PBUA 4KH1B 3J7Z5 1FD8A 4Q2LA 3UDCA 3HHLA 1YVFA 3K5OA 4MIBA 3ZNJ1 3MURP 2PI5A 4USJC 4LBHA 3ZTOA 1AFIA 3MMCA 2CXEA 2J9EA 2RF2B 2OTLS 3ILOA 1AZSB 1D9AA 3LAKA 4DXLA 1IKVA 1HNIB 3NXZA 3QGGA 2H5EA 1DAXA 3BGRA 3W60A 2UUAF 1CSJA 1S1WB 2DT9A 3EVWA 2M9KA 5KG1A 2Y1JA 1YI2S 4RLEA 1P9YA 4ED0A 2ZKTA 4F02A 2EC0A 3DLGA 8ATCB 1UJ5A 4OX9F 5I42B 1Y0HA 2RB7A 5ETLA 2EFPA 4U6PA 3TQ1A 4BC9A 1IBKJ 3ZFVA 4MIAA 4Y34A 4BWMA 2RU3A 3KYLA 2RDDA 3IAS9 3DRXA 3M2UA 1I3OB 4XPCA 1M5PC 5KFTA 1IM6A 3UN2A 1WC1A 2YY3A 1FE0A 1HBNB 1SJFA 2WW4A 5A8RA 3W8GA 4ZJQA 2YX1A 4WZQA 3O6QA 2BJ1A 2F4VF 2YKAA 2G0IA 4UY8T 2O3DA 1X9MA 1JLGB 2ASDA 1KR4A 3DN9A 5KFRA 1RT4B 5HI7A 2GJ2A 3EGZA 1U0HA 3IBCB 2EBEA 1Q79A 1NU4A 2XLJA 4M8LA 4NLRA 5IXUA 1YZ6A 4F3OA 1WEYA 5B08A 4DV2F 1TK5A 2VJUA 1RWKB 3BREA 4PG8A 3R5BA 5DJBA 2QN6B 2BZ2A 2DNNA 2MQLA 3C16B 4WU3A 3J7A1 1C1BA 1RWMB 1TU0B 3CD7A 3P5TL 3QWUA 3H4BA 4DR5F 4GVBA 5JJBA 1DTQA 4BDPA 2CAJA 3AH6A 3TVYA 1NB7A 4F50A 4TXSA 2NCKL 2UV8G 5FDLA 3FSIA 4LF6J 4FPRA 1IBLJ 3KTQA 4JI3F 4IR1A 2YH0A 1G2EA 3A8IA 2XTJP 2R8KA 3ETOA 1Z2LA 4W98A 4ECRA 3KUGA 3VZHA 1B64A 2VC0A 1GT8A 5CA5A 4Z7YA 3V6JA 1VRQC 1SXLA 5K14A 1CJVA 2MSTA 1N4LA 3D1HA 5HAOA 3SSSA 3ZTRA 4DF8A 2HBQB 2CNNB 2BX6A 3CMQA 4ED3A 3D6FB 1RA7A 2Q79A 4O23A 1RE1B 3QJJA 3QMQA 3MR6A 4HDHA 3TANA 2DVIA 5D8HB 1NBEB 1RZMA 4CM2A 4NCGA 1N54B 4QIEA 3RBZA 4EGLA 3H98A 2B4PA 2H9ZA 5C25A 2MY7A 2BW7A 4ZOSA 3KMQA 4LRBA 1ZM4A 2VKRA 2IIHA 3A3NB 2W24A 2JEGA 3TEHB 4JI1F 1ZPWX 5M2PA 2VA2A 1QVFR 3I31A 3C15A 1TAQA 3IP0A 3IRXA 2JHEA 4LSLB 3EXCX 4OYOA 4ECYA 5F0WA 1SKSA 1SBRA 1N5TA 2VFTA 4OIXA 4HHJA 2PSZA 3SEOA 4RNMA 2VZ9A 1R27B 4DX7A 4FXVA 4K0KJ 2BMBA 5IQQA 4X2BA 1NK8A 5DGAA 4LVOP 5D3GA 2NSBA 3DGVA 1QDUB 2A2CA 1AUDA 5ETMA 2D9PA 1NDKA 2XS5A 5IOLA 2K8GA 4AQYJ 4CT8A 3ENQA 4C4WA 3NGSA 4YB5A 4CLLA 3SV4A 2YNFA 2F9JA 3DGPA 4LSZB 1N32J 5KFNA 3KUHA 3AY0A 3TP2A 4JI0F 4P10A 5KFYA 5KT6A 3UW1A 1FFWB 2WBMA 3CF5Q 1GH8A 1NDPA 4R8UA 2F8EX 4DV0J 1SL2A 3B54A 4WFBQ 2M5YA 3HMJG 3R7BB 4WFXA 1V6HA 2ILYA 4LBPA 1WKKA 4QWCA 4FYDA 3JTOA 3MCNA 3GU0A 4NE9C 3M4XA 1CLFA 2QFIA 4DBQA 4LR9A 1Q1KA 1Q0NA 1VISA 3HHLB 1JXLA 5LSLA 4J9MA 4Q45A 3MMCB 1C1CA 1R0BG 4LRCA 4GKKJ 5C24A 5E3RA 3LGMA 4J9NA 1XEZA 1IKVB 1RAEB 2PD1A 1LQ9A 2C2RA 3BGRB 3EGWB 3THVA 4RNNA 4ZPTR 4Y00A 2CUYA 3TJAA 2VA3A 2LVWA 3HFKA 5AJ3F 2YXLA 1TUVA 3R5GA 3OJSA 3DLGB 3SCLE 5J1PA 2IRXA 4I64A 1VQ8S 2B4OA 4K4VA 1Q16B 1HR0J 4J9SA 2I9SA 4K5SA 5EDWA 4RUBA 3R2DJ 3M2UB 4WYWA 3GYNA 4KAIA 1CQNA 1NPRA 4NZ0A 2ZOFA 1L5UA 4C8YA 5GAEI 5A8RB 4GO7X 3RB3A 1KVKA 1XN9A 3PRBA 1MWYA 1TELA 3V81A 4B9VA 4IRCA 2IRYA 1YWXA 1UCNA 3PEHA 1RJJA 4MT1A 3SQGA 3CCMS 4CNYA 5GVQA 4PWDA 4HR2A 2DO0A 1K1SA 3P4UB 4OI4A 1LXNA 1U0HB 1TZ0A 5JUMA 2V8VA 4RPFA 4Y6IA 3V4IA 2YQ1A 2XZTB 5A6WA 2ZOGA 1WD6A 5FJ4A 3NS7B 1WOSA 2HQDA 3GCWP 3FCHA 3GZ7A 4U96A 4KFBA 4IG0A 3CD0A 1X4HA 3HT3A 4FKXA 2QJ3A 4QWBA 1WEZA 1C1BB 1C2PA 3SCKE 4TYAA 2DRBA 3N6MA 4GVBB 3T6BA 1P6TA 1VQOS 1UFLA 1DTQB 4MK7A 3K8VA 3OSNA 1T9UA 3I56S 5HJXA 3F0NA 3H90A 4QR0A 1S48A 3T5HA 1IBMF 1F3VA 1UWAA 1IR1A 3C19A 5FDLB 1X9WA 2CVIA 1QSLA 3EGVA 2J0QD 4NYZA 2JC1A 1DFDA 2AGOA 3MTJA 4ZVUB 4YOEA 3NP5A 3D28A 4LR7A 5KG5A 4PRFA 2QEXS 4DPTA 1U8WA 3EGNA 1TKXA 5K14B 3QSYB 1CJVB 1SH3A 4AL7A 1U48A 5BR8J 3GONA 1G3OA 3H8YA 2B9WA 4ES3A 3VAIA 1KFDA 2WVDA 3PW4A 3JSMA 1IXKA 5J2MA 2CQCA 1HBUA 3FRYA 3PFEA 5FLXY 1YTYA 1D1UA 2FIUA 1O0PA 2OPPA 1VRTA 2QA4S 2KI2A 3GFYA 3AB4B 1UL3A 4NCGB 1NK7A 1N56A 1TP7A 1KQKA 1P1TA 2GQ2A 2QZ8A 5K5MA 4X4SA 5C25B 4NMXA 3VGTA 3QGPA 4MYTA 2MJUA 2BDPA 3BKUA 2JRSA 1Y3JA 2HQCA 1KEKA 1BY9A 3Q8YA 1JLBA 2ZHAA 4W90B 3IR5B 2HHUA 3U1MA 1RTJA 3QATA 1Y5IB 1M1KT 3UO0A 4ID5A 2PIIA 4YHHF 3PM9A 4PZVA 3C15B 3D66A 1CPZA 1XR6A 3IRXB 4H4KA 1T03A 2HRYA 1WOOA 2PGCA 2UUAJ 5JXSA 2LLZA 2J8AA 4OQJA 4G6VB 4O3SA 4J9VA 2POKA 3FKBA 4OX8A 4OJ3A 4LFAF 5HVFA 2B5JA 5D4LA 5D3GB 1IN0A 3HP6A 3GIJA 4NLQA 5EN1A 4PQUA 1WG4A 1AROP 3OFGA 1RT7A 4E2FB 3FCWA 5J2NA 2P2CB 3MR2A 2EKYA 4RW4A 3DGPB 2BUNA 4IRKA 2HPUA 2Z30B 5IWAF 1XJWB 1SUQA 1LWEB 1KRPA 4AT1B 1AA1B 4CO3A 1SJ4P 5M2RA 4R8UB 3QGIA 1VHFA 2BA9A 2AT1B 3Q2TC 2MY8A 3Q8PB 3KHRA 1RI7A 1Q8KA 4X4RA 3AFGA 2JC0A 4L72B 3OL7A 4FF1A 2HURA 1FO1A 2VBXA 1H98A 4JI2F 1WHVA 4MFBA 4DV2J 4YMEA 4NLWA 3HFZB 3A4TA 2H5JB 1RBLA 2DXEA 4DQRA 4RL1A 3MWBA 2KRRA 5AXNA 1C1CB 2MZ1A 4ETXA 4DR7F 1X5PA 5F8IA 4NLPA 4QOTA 5IT9U 4LRDA 3NBPA 3IBWA 2HFNA 2MKHA 4EO6A 5E3QA 3CULA 2DNGA 5GADI 3G71S 4LQ3A 4WIIA 1J27A 2W2MP 2HNYB 1VQ6S 3C14B 1JNRB 2IM1A 3NEKA 4RBUA 2NZ4A 3KLEA 3EMTA 1N88A 2QMXA 1VOMA 5AE3A 1FVSA 3HI9A 2O5DA 1RTDA 1SC6A 3MHYA 3J80U 3UDEA 1Y10A 1T11A 4JP8A 2AEFA 1RU1A 4CT9A 2EVZA 5A2QY 1VIXA 2M7SA 3DDNA 3D0IE 2CFXA 3S6EA 3KJVA 1FNXH 2E1AA 3GJRB 4LIWA 2JZ5A 2JNJA 2AKWB 4O44A 3ADAC 1TL7B 2J7KA 2LFVA 2YWHA 4LFBF 5KG2A 4F4AA 2RUGA 3QSIA 4DUYF 1FT8A 2BE9B 4LRFA 3KLFA 4NCAA 4MYUA 5DM6Q 3GFZA 2HW3A 3PYGA 3V81B 4IO9Q 3SQGB 1RWXB 1V9OA 4F0MA 4PWDB 2WRMA 4FDFA 3LF0A 2R7UA 1XR7A 2QSFA 1VLYA 4B9LA 1HWLA 2DNYA 1OS5A 4EFAC 3CO0P 1YSJA 3DLHA 4IOCQ 1GAOA 1Y00A 5HQLA 3G6ES 2MKIA 4IG0B 3LWMA 2HAIA 1B0PA 2I38A 3UI3A 5HVHA 1Z1ZA 3E01A 2XM3A 1C4AA 1VGYA 5EHHA 3N9UC 4ECQA 2FLLA 1WC3A 2GMLA 2LECA 2VB6A 2KFNA 1WI8A 3QYYA 3J7YI 3MEKA 1OPZA 1TUWA 1TK8A 4QR2A 4OHZA 1UEKA 3H2VE 2E5JA 1MSWD 1JJ2R 3F44A 5KFJA 4IR9A 2VONA 1WORA 5LXYA 2XZWA 2CZ4A 1FX4A 2FZKB 3WC2A 5F3ZA 4G65A 5EGYA 2NS1B 5L1JA 1NDLA 1REGX 1TKXB 1ITPA 2V8GA 3PZPA 4TY8A 4R0EA 4NLOA 2AZ3A 5THWA 4BS2A 2FLNA 4PWWA 4FBTA 2F63A 2MLZA 4JI8J 3JSMB 4CIOA 4DLEA 3PG9A 1HBUB 4CLWA 1VLOA 1W25A 3JQKA 3AJ2A 4JI0J 1XTZA 2CQGA 3KFWX 4TU9A 3NGUA 2OPPB 1UVLA 3TR5A 1VJQA 2M52A 4Q8EA 2Z4PA 4NOHA 5B0DA 3UN3A 1XNRF 3ILLA 2ZFHA 3IWXA 1ZTTA 1D9DA 3PR4A 4F0KA 3A1YG 1HWIA 1S7IA 2CWXA 1FHTA 1JLBB 3OVBA 2C2OB 2R42A 3GYXB 1RTJB 1Q82T 2FVPA 3DMJA 3FEYB 1A6LA 4ID5B 2ALZA 3HZEA 3OLAA 3FBCA 2HIYA 3M05A 4WCEQ 1PG5B 1T03B 2CNLB 4M5HA 3A3OB 3I87A 1ICEB 1T8EA 3CJ0A 2GO9A 1RHKB 5HROA 5A6PA 5AJ3J 2FYXA 2B5JB 1GX6A 3FSYA 4OV6A 5GAGU 3EDQB 1HNZJ 4PQUB 2XCAA 1YJ9S 2Z58B 3T9ZA 1NPPA 1RT7B 4P71A 5J2NB 1CJTA 4M5IA 2Q1LA 4X66F 4EBDA 1F9EB 1NDCA 4RW4B 3QAUA 4JV0A 2E1RA 1U26A 4ZN3A 2ZBPA 4TQSA 5L8RC 2PN6A 1GXUA 3DOKA 2B3TB 1JX4A 2AV5A 1T3OA 1GQEA 4K7QA 1FTCA 2OSQA 5IZHA 2WBRA 1T02A 3PX6A 3Q8RB 4Y2CA 1GK8A 4NLXA 5H9FJ 3R3TA 3BV8A 1XMBA 2LXIA 3W65A 1YJVA 4LMZA 3BDPA 2HNDA 4QWEA 2OI2A 3W5YA 3O2IA 2IVMA 4UOFA 1JJHA 4N8NA 1IQTA 2XULA 4C8LA 3IAM9 1BXNA 2RKIA 2QFJA 1FXRA 1TL3A 1KTQA 2CPXA 2YQ3A 4RW8A 3DOLA 5IT0A 2D7SA 4RNHA 5HSPA 2HHHF 3NBPB 1NKCA 2ZUGA 3N79A 8RUCA 2AX0A 1PC5A 3QO9A 4K4ZA 3HSGA 1CJUA 3KLEB 2E44A 4ES2A 4U7UK 3VCDA 1EQMA 2PE8A 1KC8T 4DEZA 2G4BA 2QLJB 4IYQA 5DZ7A 4I67A 1B99A 1D9FA 2UVVA 4KGXB 3KJVB 3HHLC 1KQGB 5HBMA 4K4SA 2RQCA 4O44B 4C0OC 4P73A 4QYZK 2DCLA 1FK9A 2MKYA 2MPUA
chains in the Genus database with same CATH topology
3ZZZA 4IRDA 2ZHBA 3TVZA 1J5OA 2Y0SD 3OVSA 2GHVC 4OV1A 2LQBA 3KLFB 2DCUB 2OMLA 3RRGA 4Y65A 4HYKA 3EUNA 1W2BR 1VFJA 3IWLA 5DM7Q 3TI0A 3S8SA 2JLFA 2NPFA 5DLGA 1UWBA 3H40A 2MZQA 3W2VB 1U1NA 2XMWA 1RT1B 1ZYQA 3POTB 2B9XA 3CMES 1HNWF 2VG7A 5KFCA 1IKWB 2XMKA 3KK1A 1H2VZ 4DL3A 4L6V3 1FRKA 4OLOA 3CJ5A 3MM6B 4DL6A 3MUMP 1L3TA 1N48A 2XLKA 2B56A 3CJ4A 3MAHA 4OHVA 4JI8F 1ZH5A 3OV7A 2BR0A 2V4JB 4XIUA 3OLBA 1QE1B 2VBZA 1S0VA 5IT9Y 2B6AA 3BN4A 1SIWB 3G96A 1RYSA 4ATNA 7FD1A 1N5YB 1WTBA 3OFEA 3TX8A 1UFWA 3IO1A 3OXLA 3K57A 1RTIB 3K5NA 4C8MA 2Q6CA 1Y5LB 2ZKUA 4CNZA 6FD1A 3MR3A 2WK4A 1B0TA 3V6KA 4IOBA 3DXSX 4JV5F 2XNRA 5T41A 5I3UA 2LQ9A 2XWYA 1Z4UA 4RKUC 3TAMB 2RU9A 2KHCA 4M5DA 4LSLA 4YR3A 5H1SV 3SI8A 2MKSA 1CG2A 2F9DA 1M90T 4IH7A 5KFUA 1JLCB 2DH8A 4DSLA 4C3LA 3G8SA 3E01B 4OX7A 3HLUA 1C0TB 3I5CA 3TRGA 1LWFB 4J9OA 1OWXA 2B7BB 1R8AA 2OD4A 3WDOA 1Q8IA 5E0OA 4DHVA 2OPRA 2X3GA 1FJGF 4B9NA 4O3RA 2M2BA 2QLWA 1RQ0A 3M8PB 4WK1A 1VC0A 4OLPA 4NXMF 4Q7AA 3TYTA 3S1TA 2ZJQQ 4ED7A 3MM9A 1GTEA 3OHAA 5D78A 1F2GA 1WI6A 4FZVA 2YKPA 3K8WA 5F9LA 1PGZA 2WSEC 2BM0A 1VQMS 3J80Y 3UCZP 2EFQA 2X1FA 1SJ1A 1HD1A 3K0JA 3SSQA 1FDBA 4IFVA 4NLYA 3QZ7A 1TKTA 3ZZPA 3T19A 4X62F 4A8WA 3UR3C 2KB2A 2ZDPA 1S1XA 1MU2A 3KLIB 3BB5A 5EX3A 3P49B 2LDYA 3O3LA 4DSEA 1HBOA 1BC6A 4WFZA 2DHXA 4EYHB 2E5LF 3UR0A 1V3ZA 1RT6B 2GJIA 4C0BA 1YIJS 1F9FA 1KQSR 3ZZTA 5BR8F 2ZH5A 3W7BA 3NCRA 3BO3A 2AD9A 1HI0P 1GXLA 1JWWA 2EFGA 2RH3A 3CTRA 3TNVA 1VQPS 1FRIA 2P9CA 3DLLQ 4B3TF 1WF1A 3LH2S 1QJHA 3SV3A 1U47A 1LFPA 5JVHQ 1N8RT 2CZVC 2YTCA 3PHEA 4ICLB 1RKJA 4IUFA 4N76A 3N6NA 2DGSA 3AB2B 1RK8A 3H5YA 4OI2A 2W25A 3M8RA 3GV7B 1VK8A 5ADZA 3FZBA 3RR7A 1NHVA 2XG8A 2MJNA 2ZH6A 3VQSA 5E5NA 4I2QB 4G1QA 3RAMA 2RD5C 4NLDA 4ECXA 2VPYB 4KO0B 3FGVA 3BGFA 2U2FA 1URRA 2DPIA 2J0XA 2CPYA 5DETA 1S72S 3DC2A 1ELOA 2IYIA 4TY8B 3MEGA 4JI6F 4BWJA 3TUIC 1MW7A 2KZZA 4NCBA 4P7VA 1N34F 2LKZA 1UAWA 3Q23A 2CQIA 3MGJA 2AWZA 4UQGA 2C3UA 3MECB 4FF3A 3DRPB 3QGHA 3TUJC 2ZM6F 1HNZF 2O66A 1FXLA 4I68A 3RYLA 3PW2A 4X4PA 2GIRA 3H2LA 5DO2A 3IG1B 1VBYA 2HHQA 3IFEA 2CQ2A 1U09A 2CQHA 2YKNB 5GAHU 4DG1A 4EWTA 2OFHX 3IS9B 3VAGA 1Q8LA 2R7WA 3ONQA 1GX5A 4FNIA 2FJXA 5HQ8A 2HYIB 1APSA 3U7JA 2CKWA 1U1RA 2XB2D 1IQZA 2KYXA 4OZJA 2QO3A 2YWEA 4A8FA 2DGXA 2EW9A 3VTIA 1X4CA 4H4MB 1X5SA 3ZZOA 4YR0A 2ZJRQ 3MMAA 4KGKA 3J7Z5 1FD8A 2VD3A 4Q2LA 3H4DA 1VBZA 3UDCA 2R8HA 2KFYA 2AYEA 3MCSA 4KIAA 1QAXA 4DR1F 2ABYA 3HHLA 1YVFA 3K5OA 2XHWA 4MIBA 4KB7A 4PPDA 1CEZA 4JBCA 1NZAA 1Y9OA 3MURP 1QAIA 2WHOA 2PI5A 5KFHA 4USJC 2X51A 2HWTA 1JK9B 3PO4A 1BQXA 2E5IA 4ID8A 3CUNA 1VRUB 5T7LB 3MMCA 4R5PB 1AFIA 2ASYA 2JJ4D 2J9EA 2RF2B 5M2UA 1BD6A 1RT5B 1Y3KA 2C3YA 2Z0GA 5KFDA 1Q81T 5F8MA 1H7XA 1LW2B 3EX7B 4TY9A 1X4BA 2HGMA 2R7TA 4ALZA 1H3DA 2OTLS 3IN5A 1D9AA 3X3UA 2IHR1 3LAKA 5KFBA 3MOZA 1N33F 2N4DA 3SCJE 3GV5B 5F8JA 3OUYB 1PSDA 2CG4A 4NLUA 4DUZF 1IKVA 1IJEB 1HNIB 3I9V9 3OW2R 3QGGA 4LVNP 1EETA 2H5EA 1DAXA 3DNCA 3CPWR 1H2UX 3BGRA 4I2PB 2UUAF 1CSJA 1FVQA 1S1WB 4B3SF 2DT9A 2BE2A 1M0SA 4PR6A 3MEEA 2CPHA 1FA0A 4A47A 4OL8A 2FJDB 1S1UA 2M9KA 3DRRA 3DMJB 5KG1A 4B3OA 3SMZA 5AE2A 3E3XA 1DARA 1BQMA 1RAJA 1H0HB 2W4CA 4YFUA 4YP3A 2Y1JA 2KN4A 4PUOA 1YI2S 3O44A 1HQEB 5K9FA 4QQBA 2MGZB 1QAYA 4RLEA 1LFWA 2JVRA 1U8SA 4ED0A 3RB6A 1QAJA 2ZKTA 2KH9A 4F02A 2EC0A 3DLGA 2R8IA 3NKYA 1NNDA 1NJZA 1HD0A 3KLHB 4Y3CA 1UJ5A 5BYQA 3HX9A 2CYYA 4OX9F 1R8BA 5I42B 4DSJA 2JLGA 4MKYA 1Y0HA 2DBBA 2HHPA 2RB7A 2EFPA 3US5A 1N36F 4U6PA 5DDQC 3TQ1A 4BC9A 2QA2A 3ZFVA 2FVSA 2FTRA 4MIAA 1U1QA 3DLJA 2B51A 4I1TA 4KE5A 5HROB 2W9CB 4ILMA 2RS2A 4D3GA 1YQHA 4Y34A 4BWMA 2RU3A 4J9LA 1ULRA 3KYLA 5KOWA 2AQ4A 4B08A 3IAS9 1ZM3A 4IH5A 5IS2A 1N5SA 2XGPA 4DQIA 3DRXA 3M2UA 4DWIA 4BCAA 4XPEA 4ZA1A 2FJVA 3RRKA 1ZAXA 2DPJA 4XPCA 4RW6B 3FMBA 2IMOA 1JIHA 2EFNA 3LPYA 2ADCA 2UVWA 3FEZA 3FQLA 2RILA 4KKOA 5KFTA 2MQPA 3J81Y 1M5PC 4V19X 3SDEA 5J2PA 2OKQA 1B0VA 3DYAA 2FLOA 2FGCA 1MWZA 2J9CA 2YY3A 5CYJA 1FE0A 1FRJA 1HBNB 1SJFA 1U7LA 2UVUA 4IQXA 5A8RA 3L7PA 4ZHRB 2AYMA 4A8XA 2KM8C 3SZ2A 1LW0B 2MZJA 2UUCF 2YX1A 2V8DA 4KV8B 4WZQA 3MM8A 3G8TA 1SJ3P 3O6QA 4MKAA 1TKZB 2F4VF 1FEEA 2YKAA 2VQEF 2LDIA 1VQ7S 1JLEB 1S79A 4I56A 2F7VA 4UY8T 4QJVA 1U2RA 2O3DA 1HWUA 4DL0C 1FJCA 4Y2KA 1UJ4A 1X9MA 4O3NA 1S1TA 1JLGB 2ASDA 3R1HA 1KR4A 3THPA 4RW7B 4A8QA 2AYGA 4JV2A 3DN9A 5J1NA 3RRHA 1PILA 2I1RA 3LAMA 5KFRA 2FHOB 1K9MT 2L08A 3DOKB 5EWEA 2CDQA 4F2RA 1RT4B 2VFVA 2HQIA 3PEJA 5HI7A 3KK3B 4X4VA 2GJ2A 3MM5B 4WTYA 1OIAA 3EGZA 4DV4F 3MTKA 1U2FA 2EBEA 2LMIA 3BSAA 4M63A 5D4NA 5KFGA 2HMIA 2MGZA 3Q24A 1S9GA 1Q79A 1SL0A 2W9BB 1NU4A 2XLJA 4M8LA 4NLRA 5IXUA 3RTVA 1M5VC 2ASLA 3C2PA 4F3OA 4NLVA 3J7ZT 1WEYA 2HS4A 5B08A 4DV2F 1TK5A 1E6VA 1HA1A 2KDOA 3G8QA 3NGDA 3EPIA 1O8BA 3CIZA 3BREA 5DDPC 5EWGA 1VQSA 2VPXB 2MYFA 2AW0A 4PG8A 3ZZUA 2W9CA 2APOA 2UVRA 1SV5A 3R5BA 4FS2A 4WJBA 3IRWP 3GFXA 2NQPA 3WC0A 2ZH7A 2IM3A 1KVIA 5DJBA 3GG0A 1SJQA 4NA2A 2BZ2A 5BYSA 1OQ6A 2DNNA 2MQLA 4OZ0A 2CQ1A 5J2QA 2XMTA 4WU3A 1JLQA 1RT2B 1S7HA 1U24A 2HNDB 3FRZA 2KXNB 3NMAA 4J9QA 3J7A1 1C1BA 4UOCA 1KVJA 1N5QA 2XMUA 4H4OA 4JUZA 3IR7B 3GIMA 2YNIB 1X5OA 1NHUA 3CD7A 4Y28C 4KRWA 4LSNA 3V6DA 4OZ1A 3P5TL 3QWUA 3H4BA 2EFOA 4DR5F 2Q66A 3PX4A 1HBNA 3HKWA 2UXCF 3HDSA 2J9DE 3A8EA 3MMBA 5EX0A 5JJBA 1KHWA 3CDAA 1TL3B 3VZIA 2R2UA 3DLEB 5K8MA 3IGVA 1DTQA 3OR1A 1YRTA 4RW8B 3H2UB 4AYBD 2WTFA 3DOLB 2LU1A 4K4XA 4BDPA 2G1DA 2DR8A 2AGPA 3HVTB 3AH6A 6FDRA 2ATLA 3TVYA 3ISND 1VK3A 1TKZA 4OZ5A 1HNVA 2WCXA 2XGQA 3BQ0A 2BQRA 1NB7A 1JLEA 4F50A 1SH0A 3IC1A 4TXSA 4PG5A 2P6TA 2PA8D 5MAOA 2UV8G 1R7IA 4FVMA 3GR1A 2DNPA 4WFYA 1N0VC 5FDLA 5GAGI 2W9AA 4KHPF 1KN6A 1TVRB 1TQLA 3MPVA 3FSIA 3BSNA 1JLGA 4FPRA 2IMWP 4O4GA 1MMDA 2W8KA 3KTQA 2JWNA 1RT3A 4JYAF 4WF9Q 4F26A 4DR2F 2V9WA 4N41A 5F0UA 3TAQA 2KM8B 5L1LA 3GFHA 5B7WA 4JI3F 4IR1A 3QO9B 3IR6B 2HFZA 2QT7A 2YH0A 4NZ7A 5KFWA 2EK1A 4KSEB 1G2EA 3WX4A 3LGNA 4DV3F 4NYPA 2KHDA 3ETOA 3D2WA 2R8KA 1Z2LA 5D4OA 2W9BA 3K7RA 4ECRA 1U1KA 3VZHA 3PJWA 2HNZB 1LXJA 3QWPA 3RBDA 2NUUG 1B64A 3GIKA 2VC0A 1GT8A 5CA5A 3V6JA 1SXLA 2KXHA 2MZSA 5K14A 5LXRA 5CCLA 2MSTA 3K5LA 1N4LA 3TA2A 2YKQA 3CEDA 3D1HA 3HO1A 3SSSA 2YNGB 4DF8A 1S1VA 1KLMB 5F8LA 4KQZA 4USHA 2OPQB 1UEUA 4WE1B 1YJUA 4ED3A 5KT2A 4DV6F 1RA7A 3PIPQ 1NH7A 2A1BA 2Q79A 3CE8A 3PW5A 1S0NA 4O23A 2FB0A 3QJJA 2AJ4A 3BO2A 3QMQA 4KGMA 3B78A 1WHYA 4HI1A 5HBMB 3MR6A 2HHTA 3E8OA 3M1VB 3I0SB 3VAJA 4HDHA 2A18A 3TANA 2DVIA 1REVA 5D8HB 1VQKS 1UVNA 4FP9A 1NJXA 2LYVA 4TLQA 4BBYA 3ICLA 1X0FA 1EP4B 2LQJA 1FK9B 4MJKA 1ZOTA 2FVCA 1FTRA 4NCGA 3JSYA 1N54B 4IH6A 4RUCA 1FJEB 2CJKA 1AFJA 3DRYA 4QIEA 2MQOA 4EGLA 3DU5A 3H98A 2B4PA 3M2VA 1J5OB 3SCIE 2BQUA 2OJ3A 3I32A 1D3WA 2H9ZA 5C25A 4ECWA 4PXCA 1X4FA 2MY7A 3KNAA 4ELVA 2AJ0A 1I1GA 2KJVA 4QIGA 4ZOSA 3KMQA 2D1CA 2QE5A 3MEDA 1UWBB 2MDAA 2CQ4A 4RNFA 1ZM4A 5HMYA 1IJFB 1R6YA 2DNHA 2VKRA 4U9RA 3NGKA 4NMLA 3KK1B 1S6UA 3W2WA 5I3PA 2YNFB 3FDSA 4DV1F 2W24A 3ZZRA 2VKZG 5KFMA 1S9FA 1URNA 1MROA 4QYZJ 5T14A 2D9OA 2FC8A 2OP5A 3S01A 4RNOA 1BWEA 4ZLPA 4I6AA 2JEGA 3C3LA 2IBKA 4A48A 4K4YA 2HNZA 2B6AB 4JI1F 2QYCA 4CO1A 3CCTA 5CYQA 1K73T 1A7GE 4WFNQ 1ZPWX 4NA1A 5M2PA 4PG4A 3CC7S 2C28A 3SFUA 2VA2A 2HHXA 3MUTP 3LP2A 3HK2A 1QVFR 2DGUA 3I31A 3BR8A 5I3UB 1TAQA 2DHSA 5K8PA 2ZH8A 4JI7F 2FVRA 4NXNF 3CCVS 3RAQA 3IRXA 4M5DB 2JHEA 4LSLB 4AE5A 3EXCX 1HHTP 3T1HF 1KLMA 1S10A 1M5OC 4W92B 1FDAA 1WHWA 3R5CA 3Q8QB 1W2IA 7FDRA 3V6HA 3AHPA 4I4BA 2UXBF 4ECYA 5LT5A 2W4DA 2W8LA 4DL2A 5F0WA 1SKSA 1SBRA 4I0WA 1N5TA 4C8KA 2VFTA 4OIXA 4HHJA 3VWSA 1X9SA 2PSZA 3SEOA 2BRKA 4RNMA 3R5AA 1ZETA 5F8GA 2VZ9A 3NS6A 3N5FA 2C2DA 1R27B 2HS0A 2U1AA 4C7QA 5KFEA 3CCWA 4FXVA 3PO5A 5KFFA 3OXFA 3MM9B 1EP4A 3I5AA 5IQQA 4NPOA 4X2BA 4ZVEA 3U1LA 3TUZC 1NK8A 1CQMA 4LVOP 5DGAA 4R25A 5D3GA 2NSBA 4IFVB 1VQ9S 4DDFA 3N6LA 4OI6A 2A2CA 2GC8A 3MFIA 3EYZA 1AUDA 1TKTB 3Q8SB 2D9PA 4GC6A 1GTHA 3ENWA 2IYGA 4ZCMA 4CZCA 2N4CA 3KWMA 3CC2S 1L3UA 1SH2A 4YR2A 2KG0A 2XS5A 4X65F 3WBZA 2K8GA 5F8HA