2V5HG

Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
111
Chain Sequence
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQKGQTERYRGSEYTVEFLQKLKLEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKNADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords ACETYLGLUTAMATE KINASE
publication title The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 22
structure length 111
sequence length 111
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2007-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v5hG00
4NYPA 4USJC 4OZJA 1O51A 1NAQA 4YB6A 3AH6A 1VHFA 2J9EA 2ZOMA 3L7PA 4CO5A 4IYQA 2J9DE 4R25A 4CO0A 2EG1A 4CO1A 4C3LA 4CO2A 3OPKA 3TA2A 2XG8A 1PILA 1O5JA 2NUUG 1KR4A 4WK3A 2O67A 5D4LA 5DRKA 4RWWA 3TA1A 2CZ4A 4Y65A 3HLUA 2J9DA 5D4OA 3GSDA 3NCPA 3AHPA 4C3KA 2XZWA 1V3SA 1V3RA 5D4NA 2ZFHA 4CO3A 3BZQA 3M05A 4CNYA 3AA8A 2GW8A 1UFLA 1GNKA 4RX6A 4E98A 1QY7A 5L9NA 2RD5C 2GX8A 2NUHA 2GNKA 2NS1B 3NCRA 4WK1A 2EG2A 3O8WA 1VFJA 1HWUA 3AA9A 4USIA 4OZNA 2XULA 4CNZA 1Q1KA 2DCLA 5DS7A 4RWXA 1H3DA 4D3GA 3DFEA 2O66A 1V6HA 4C3MA 2JJ4D 1V9OA 2Z0GA 3LF0A 4D3HA 4ZK7M 2PIIA 3O5TB 4YB7A 2XBPA 1NH8A 4NYOA 3X3UA 5D4PA 1OSCA 4CO4A 3NCQA 2E66A 4RLEA 3TA0A 1NH7A 1UL3A 3N5BA 1UMJA 4OZLA 3MHYA 4Y6IA 1XK8A 3CE8A 1NZAA 2VD3A 3T9ZA 2J9CA 2V5HG 4YB5A 1J2VA 4AFFA 1P1LA 4USHA 1UKUA
chains in the Genus database with same CATH superfamily
5IWAJ 5EUHA 2YVSA 3K89A 4GMKA 2VV5A 2GS8A 2E5IA 5H9EJ 1WORA 2PI4A 3CCTA 3K59A 5D4LA 5E3AA 3LP1A 4LR7A 2MQMA 3BGLA 3QT7A 3NLCA 2A18A 3MCNA 2E1RA 4EBCA 3M8PA 1IR1A 4NI2B 5DZ7A 3C46A 3UW1A 4LQ3A 4RW4B 2IM1A 3MM6B 3H98A 5CCMA 4LF4F 1L3UA 4WBFA 1X5TA 2XMVA 4M5GA 4QIGA 4DV6F 2B6AA 3LGHA 2HHTA 3Q86A 1JLAB 1R3NA 2UU9J 3KG0A 3W2VB 1D3WA 3MCSA 1NNDA 3KTQA 1R7IA 1IBKF 3Q23A 1HYSB 3AXKA 4G1QB 5C24A 1S1TB 1N36F 2ACMA 2XQCA 5HJXA 3C6TB 1DY3A 4OYWA 4LSLB 2MKKA 1TKZB 4DUYJ 4CIOA 4FKYA 2HS0A 2L08A 2CJBA 3NBPA 4J90A 3TAPA 2DIVA 3M8YA 3OUYA 1S6QA 2KT2A 2MYFA 4QPTA 3W1YC 4UOGA 3G6ES 4JYAF 2HLUA 4JI1F 2CXEA 4HDHA 4B3OB 4OYBA 2HZVA 2XMMA 1D9FA 3JTNA 1N33F 5LMUJ 3K58A 2DPJA 1A7GE 2QLJB 3D0IE 1FWPA 1D8YA 2RILA 2MMYA 3KK1A 3JXOA 4OLPA 2W25A 1R27B 4FDFA 3IG1A 3DRSB 2N4CA 2GGPB 3MR3A 3BN4A 4ZN3A 2FGCA 2PIIA 1VQMS 3IRWP 4ZP6A 1AUDA 4UZCA 3FCVA 3GWCA 4CLZA 4TQRA 5KFAA 3NCQA 4DHVA 4F04B 3KLGB 4B3RF 3TQ1A 2HVIA 4UT4A 4ICLB 5AXMA 3GJSB 2FLOA 1X4FA 4USTA 2KO1A 4OIXA 5ETRA 4NLDA 2WCXA 4N7TA 1P9YA 3TX8A 3OL6A 2A10A 3OTOF 1ZAXA 2JC0A 2B9EA 3R6GB 1KTVA 2BX6A 4CO0A 1TK5A 2A0FB 1KFSA 4MIBA 1TL7A 2BV3A 5KFCA 3MPDA 4PG8A 4PZVA 3W7BA 3R5CA 1WJ9A 2RS2A 4M95A 2D41A 5MAOA 3MGJA 3IRXA 4A46A 1S1XA 2F8MA 1JLBB 3DLKB 2WK4A 3NGSA 4NA1A 4ZCLA 3LP0A 2E5HA 3QJPA 5HMWA 1RT3A 3T1HF 1ZA2B 2Z0GA 4EUVA 2N7YA 3RB0A 3HVTB 3G4SS 1Q7YT 3CTRA 3J7YI 3EGVA 4ZN1A 4QIWD 2ERRA 1RCXB 2DR9A 4X2BA 2ZKTA 1JIHA 4ED4A 1U1QA 4DFKA 1B0TA 1Y5NB 5MLCV 1SI9A 2HIQA 5J1PA 2I2YA 5CAAA 5T14A 3MM6A 1YJ7A 4TNOA 4ECUA 4DPWA 3CD6S 3OVBA 2QMUB 5E3RA 4DL2A 3VQTA 5ETVA 2YQ0A 4A47A 2VHGA 4DCJB 1IJEB 1U2RA 3M8SA 3W2VA 2M5YA 1IBCB 3UN5A 3PACA 1HYSA 4PEOA 4I69A 1R0CB 3C6UB 4ECVA 4G1QA 3IP0A 4DF8A 2UXCF 4OYXA 2Y1RI 3SFGA 3H20A 4QJVA 4CWBA 1VQLS 1IKVB 4KJIA 5A6PA 1WI8A 5LL6d 1J5OA 3C6TA 3SSQA 1X9MA 2ZH5A 4ZVOB 3EM1A 3WHIA 2AX0A 4LRFA 4LBPA 5KFGA 1S0OA 3NMAA 1VQ8S 2VQFF 4ZIVA 1HD1A 3C14B 1NM2A 3QWUA 3US5A 3CDWA 4PXEA 4WTOB 2MPUA 1WEYA 2RIJA 2YWKA 2ZBIA 1TZ0A 4DV5J 3UR0A 2NCKL 3QLHB 4B3OA 1S6UA 3D68A 5CA5A 1A9NB 5DQGA 3ZZZA 2EK6A 4RW9B 1WHYA 2XLKA 3ZTOA 4X4SA 3RBZA 3QRPA 2HQGA 2J7KA 3OT9A 1UWAA 4Y65A 1OQ6A 2ZC4A 4DR3J 3DRSA 4HT5A 1F6TA 3J80Y 2GGPA 2ZZTA 3A8IA 2ZE2B 4ZLLA 2R7TA 3G9CA 4RUCA 3DM2B 4YOEA 3O8WA 2RMLA 1X9WA 4IRDA 2JFDA 3KLGA 2QMXA 2EFVA 4ICLA 1CC8A 2Y9HA 5CXTA 2SXLA 4U67Q 1KOHA 1KKHA 3R9LA 2D69A 5E5NA 5GAEI 1TUWA 1QD1A 4TY8B 2I1RA 1I1GA 5D0HA 2HAIA 3W8GA 3WIVA 1PJ7A 4I7FB 2RHSB 2QC3A 1F3VA 2CNOB 4NCBA 1WWHA 1CBKA 1T8EA 3SCIE 1RZMA 2V6AA 3DI6B 3HD2A 1U1RA 2QLBB 3GILA 5F9LA 2ZM6J 1Y5LB 2ADBA 8RUCA 1FDAA 2BR0A 4JI4F 1JLBA 4ELVA 2HWHA 5LJ5Y 1GEHA 3PHEA 4K4YA 4N8OA 2ALZA 2C2ZB 4IR9A 1NU4A 5D4NA 2CPXA 4M5KA 4OHXA 5GVQA 5H9FK 1A0OB 3IGNA 3R5DA 3Q22A 3PO4A 5EN1A 5KFBA 3W5ZA 3AD9C 1TUGB 3QFWA 1FEEA 4A8XA 4JI0F 2RHQB 1V6HA 4P2MA 1NB7A 2UP1A 3OXLA 4B9SA 3KDOA 1LXNA 1OY8A 5D15A 4B17A 4DV4J 3NNAA 1R8AA 4ZMMA 4IOBA 1GMWD 1YRUA 2FVSA 3PW0A 5IOLA 3K7RA 4YY3F 4MKAA 4Y6IA 3PTWA 1XK8A 4N41A 2QN6B 2Y0BB 4M5DB 4QQBA 4MAKA 2CA9A 2RAQA 2E44A 5M2PA 3QGIA 2W9CB 4IR1A 4WE1B 1IVZA 4A8QA 3M2UB 4K4TA 3A4TA 3MAAB 3LALA 1WOSA 1IKVA 3B78A 1UA0A 2JFKA 3D4JA 2CWXA 3AA8A 3MM9A 1UFLA 3VF0B 2JWNA 1RHJB 4I6YA 4PPDA 1P1TA 2UXDJ 4F3QA 5E3CA 1BQXA 3C14A 1V3ZA 3MPWA 5DGBA 3GB0A 3GR1A 4CNZA 2GQCA 3PR4A 3NEKA 2LCWA 3QLHA 4OLOA 1WI6A 3AQPA 2YKMA 5BR8F 5KFWA 4JP8A 1M1KT 3N5BA 4RW9A 4X62J 2B8QA 4M5MA 1C4CA 2G4BA 1D1UA 4EEYA 3KMQA 4KYZA 4ZPDA 2QYGA 2MQLA 3L4BC 2K8GA 4DXLA 1RJJA 2ZE2A 3G6XA 1NKCA 2ZDOA 4KKOB 2W4CA 1TFYA 1GQEA 2BBEA 4CO1A 3DM2A 3D2WA 2ASDA 3BO3A 2IVMA 3IFEA 2C22A 3H0PA 2AYBA 3I96A 3RBXA 1AYEA 3B6BA 5KT3A 4WU3A 2V4QA 2DXEA 4O3SA 4H54A 3SCLE 2YPZA 1Q86T 2N4DA 4LFCF 4X4OA 2BDPA 5K8OA 3MCOA 4I7FA 3DKDA 2XCPA 1MMNA 5KFHA 4RWXA 4I6AA 2JX2A 4X4QA 2GVDB 3GFHA 4JV1A 1WHXA 1QUVA 2B51A 3R5BA 3SCJE 3DI6A 3BV8A 1RT1B 1OSDA 4EU0A 2HVEA 1TAQA 1QAIA 2PT0A 2YNIB 4P7VA 5D8HB 1S10A 1XR6A 4TLRA 4DSIA 2CQ3A 3D1HA 2VQEF 1UKUA 3DDKA 4J9VA 3CJQA 4KGMA 2VFTA 3LO3A 1F5CA 4L73A 2OO4A 4KAIA 1KHVA 1FA0A 4MKBA 2YWWA 2AGOA 4JI6J 2UU9F 3PO5A 2VDIA 4K5SA 2X7IA 4NLOA 2GW8A 1FXLA 3TZWA 4PYAA 1UFKA 3SIPB 4ZPWR 3T5JA 4USIA 2F65A 3TUZC 5DZ6A 4X84A 4WIIA 3CJTA 4M5DA 4WXOA 1OYEA 1AW0A 4DLGA 4DUYF 5CQGA 2UVWA 1DURA 3SBMA 1D9AA 1N56A 3TEGA 5GAHU 2W9CA 1QUPA 4WE1A 2FHMA 2C3PA 2IHR1 4K8RA 3MAAA 3EYZA 3H2LA 1U1MA 1HBUA 4Z7YA 3G8QA 4JI7J 2UUCJ 5LMUF 9ATCB 1QLNA 2MKJA 2V9WA 2JLEA 2XG8A 6FDRA 2JC1A 3OFFA 1RKJA 1FK9B 3FBFA 2WVEA 4NASA 3EJMA 4RX6A 4FF2A 1WELA 2AW0A 1I94J 1F0XA 2OMLA 2RU9A 4GO5X 1U1NA 4JOUA 4ITSA 1N0VC 3L95X 3RB4A 1N5VA 3CCES 1Q1KA 2B8PA 2DCLA 4O3OA 3UNYA 4OYIA 2BW2A 4LSZB 1WF2A 3QNWB 4ZPVR 4KO0B 4KKOA 3SZ2A 2RQMA 1GFWB 2C1EB 1S48A 2Q66A 5IC4B 2V4JA 2B5JB 4WFBQ 2JLGA 3BPSP 3W5XA 3UD4P 3OTBA 2YX1A 1R8PA 3ZZYA 2MJNA 4ZP8A 4CLKA 2WBMA 4UZBA 1Y11A 1DRZA 3UI3A 1BMQB 3TQEA 2CNNB 1X9SA 3I0SB 1TKDA 2MTLA 5LT5A 3CDEA 2GVDA 2KXFA 1V3SA 3G8SA 4WJBA 2ATCB 3T1YJ 3BM7A 2ZH9A 1MWYA 4WFYA 2V2QA 5DQHA 5DQIA 2HRUA 1BC6A 3N6NA 2YNIA 2CQDA 3I5CA 2KB2A 1YBUA 4FVCA 3EDRB 4DF4A 2H51B 5J2MA 2XBPA 3D6MB 3NOCA 3HSJA 4JI8J 3OVAA 4C2MA 2E66A 3BREA 5HJYA 1YJUA 2EFNA 1FRMA 2H1YA 1C1CB 3D3CJ 4PRFA 1PAEX 3S7RA 1Y3JA 4ENOA 3KUEA 2DT9A 5KFJA 4PG4A 1KS2A 2HLTA 2XO6A 1HFEL 3SQGB 4KQZA 1TU0B 1U8WA 1Y3KA 2WONB 4X4RA 3CCMS 3PZPA 3V6KA 3MEGB 2ZC3A 4M8LA 4DX7A 4DFPA 1KLMB 1AT1B 4Y2IA 4Q5VA 3IC1A 4DPOA 3VHQA 4WPAA 1RAAB 1QSLA 2HFZA 1X5SA 5KFQA 4OMFG 2YX4A 1DJ0A 1QY7A 4URQU 1PBAA 2Y8YA 2VG5B 4QWCA 2GVZB 3RU0A 3VVTA 2ZH2A 1HNWJ 1U6BA 3ZNUA 1U26A 4ZJOA 4RZRA 1EARA 1WOPA 5IQQA 1YRTA 2C3UA 3BYPA 4ER8A 4DV5F 2FY1A 3OJSA 1RTJB 5IC6B 3HZEA 3BSAA 2OELA 2NXEA 2I9SA 2M2BA 2VASA 4X65J 2G0CA 2DGQA 2WSCC 4DR3F 2YKNB 1DQ8A 4ED8A 1S97A 3E2EA 4IO1A 3PYGA 1JQGA 1FNOA 4DPTA 1UEKA 1Z1ZA 3ZTRA 4DV2J 5IS2A 3LAMA 3K0JA 3QJJA 5ETLA 3BH6B 4C4WA 2P8IA 3NGUA 3C16A 2JOQA 3DXBA 4LFBJ 1HNXJ 3D0GE 3FZBA 4TU8A 3SI8A 4DN0A 4KO0A 3AD8C 1S0MA 1B99A 4M63A 4QYZJ 2HQIA 1S6PA 3QSYB 3W62A 2DYAA 4DLEA 2GA7A 1E6VB 2BA9A 2B5JA 2XZTB 4DUZJ 2AP6A 2B4OA 3PCOB 2JDJA 4Y28C 2HAFA 1N5SA 2ZM6F 1S5ZA 3BDPA 4ZHRA 1R6YA 4HACB 3OFGA 5JJBA 3MUTP 3ZFVA 1YJNS 1AUSL 4F3OA 3I0SA 4QR0A 4PPZA 4QR1A 1URNA 2BMBA 1FCAA 2PGCA 2DNRA 3L7OA 3NY0A 4GVBB 3BPDA 4PAAA 2LQ5A 4CP5A 3NWGA 1T9WA 4NLYA 2GO9A 4V19X 3HFVA 1G6BA 4TYBA 2HBQB 5KG2A 4UY85 4HTIA 5D4OA 3IN5A 2BQ3A 4J9KA 1SQGA 4DV4F 1S77D 3G71S 1GNKA 2VPZB 5KFXA 5HATA 3TYTA 4IUFA 3H59A 1FNXH 2MY8A 4I2PA 2VC0A 2B4UA 3ENQA 2DR8A 3PY8A 1C1CA 4CLFA 4QW8A 3VZIA 2IDLA 3KXDA 3SQGA 2WW4A 4UW2A 2WONA 1UEVA 3MEGA 1NH8A 1S12A 4OFZA 5BJRA 4Q8FA 1KLMA 3H5XA 1PCAA 4ZJLA 1Q78A 3FNNA 4ZP7A 4WCEQ 4EO6A 1NK6A 3LANA 2FY8A 2JZ5A 4YEAA 1Q16B 2BOPA 2O01C 2P2CB 5CYMB 4W98A 2UXDF 1CULB 3QO9B 2GVZA 1EHWA 1KFDA 1SKUB 2FGOA 4J37A 1B7FA 2Q43A 1TV6B 4HLBA 4F2RA 2CNKB 1NJWA 1NHKL 2UUTA 1RISA 3GIMA 1LW2B 4LR9A 1RTJA 3BF4A 1HD0A 2NPFA 1G3OA 4ZITA 2DITA 3AOBA 4UF4A 1NHVA 1N4LA 1T02A 4X62F 3QGGA 1TK8A 1SJQA 3QMQA 5A2QY 1T03B 2IM0A 2XO7A 1SH2A 2O5DA 1XN9A 3TO8A 3L7UA 1RWWB 1PG5B 4BWMA 1R0BG 1N32F 4RKUC 3BGRB 2AEFA 2FJBB 2ZHOA 2YKNA 4CLWA 1ZBTA 2ROGA 3DN9A 2Z2MA 2KJWA 1X5PA 2E9RX 1RHRB 2RUSA 4QW9A 3T9NA 4J9NA 3MHYA 2K2PA 1H0HB 4UOFA 1VK3A 3HVWA 1QAJA 3JAMU 2CZVC 2EBEA 4ECWA 2G2OA 2N3LA 2W01A 2N82B 1RGVA 4NYPA 1O51A 5B09A 2DH8A 3SEOA 1VC6A 4C0BA 5EDWA 4ZDNA 4J5OA 4C3LA 4AT1B 1XQIA 4DPUA 2B3TB 4ETXA 2ZH7A 1YJ9S 1E6VA 2P6SA 1H7WA 4HH0A 2HBYB 3GSDA 1S4EA 5A8KA 5FLXU 2RDIA 4CO3A 2BJ9A 2OSQA 3ZZOA 3UN3A 3CD5A 1WSRA 1K44A 3FBCA 4CLUA 3KLVA 1S76D 4P6QA 5CD4A 1KNZA 1GTEA 1SKRA 1T9YA 3H40A 2EKYA 2WVDA 4LRCA 3ZZTA 3P3DA 4CT8A 2GHVC 4C3MA 2HVDA 1AFJA 3CMAS 4DL6A 3KWMA 4YB7A 5JVHQ 3ZZUA 1FXDA 4MKYA 4GVBA 2LA6A 1YLXA 2BM1A 4YB1P 3FBEA 2CPEA 2I8EA 2XHWA 2DNMA 4JI6F 3E01B 5J2NB 8ATCB 1TL3B 4NLPA 1MMLA 1NJXA 2YPYA 1JB0C 3GG1A 1G1XA 4CH7A 1FO1A 2L41A 1XR5A 4UOHA 3I4PA 5DLFA 3KHRA 4Q2LA 5KT6A 2UUAJ 3RR8A 4O3NA 3CIMA 1RWNB 3MTJA 3EXCX 1XMOJ 2XMTA 1NK4A 3GIJA 5K5MA 3DMJB 5DRKA 2OEJA 1M5OC 4KHPJ 3UN2A 4KBIA 4DX5A 3P8BB 4O4GB 2YNFB 4I2QB 4U9RA 3VGVA 4Y2MA 1VC0A 1S4FA 5CCLA 3HT3A 2YQ3A 2J7UA 1RU1A 1HHTP 2O3DA 2BJ1A 3VTIA 3ULHA 3KUHA 4JI7F 2UUCF 4B3MJ 3Q8PB 2AIRB 1OPIA 4ZPAA 1ZAWA 1HL6A 3CJKB 3KMSA 1YRXA 1Q82T 2HHSA 5CYMA 2QGFB 2W4PA 5KG6A 4NXMJ 3QO9A 3KHHA 3HVAA 2ASJA 1RTDA 3VAIA 1DQAA 4PQAA 3UCGA 1LWCB 3Q8UA 5AE3A 1JNZB 2XMWA 5KFVA 4P74A 1YBTA 1I94F 1RHUB 1VHFA 2ZNYA 4R25A 3MEEB 3ZO7A 1VBKA 1NPPA 1T03A 2DBBA 3MD1A 1TQLA 1B70B 3BGRA 1HQ2A 3A3NB 5FD1A 4LIRA 4FF1A 1NSKL 4EGLA 1M0SA 4DR6J 2F5GA 1U0SA 1Y00A 2U1AA 2OP5A 3QIDA 3E3XA 1R0AB 4RNHA 3MURP 2VFUA 3VGUA 2DNYA 1RT2B 1VQNS 1IQZA 3K57A 2DGXA 3K5PA 4Q7AA 1FESA 1H2TZ 4FXVA 3RB3A 2ATLA 1PYTA 3M8ZA 3CJSA 3T5KA 4OJ3A 1PKUA 2E7WA 4LF7J 4NZ6A 4MYUA 3M30B 3CW2C 3HX9A 2FUG9 3HK2A 3SQOP 2W9BB 1PC4A 1WDDA 3T1YF 2FDNA 2XMUA 2J9EA 2ZOMA 1KQFB 4CO5A 2GIQA 1FT8A 1SJ1A 3TA2A 2AKWB 5BYQA 3ETOA 3AB4B 2E7VA 4OX7A 2BRKA 3RJMB 2AU0A 3GONA 5JMNA 5KT5A 1GXUA 4QZVB 5HVHA 2XM3A 4RUHA 1M1GA 4JI8F 4HTJA 5KG5A 2JEGA 2XMAA 2WBRA 5L9NA 2HURA 4LVOP 2DGWA 1YZ7A 3J7Z5 3OL8A 1JJCB 2VBXA 1ZAVA 2C2KB 3E01A 5J2NA 2YTCA 1TL3A 3KKFA 4ES2A 1WC0A 1F9HA 4YR0A 2FVQA 2MXYA 4LSNA 2YNGA 2V63A 3DNCA 3FQKA 3M8WA 1VK8A 2ASLA 2ZOGA 4RLEA 3H4DA 3JSMB 3SV4A 2EPIA 3U1LA 2P6TA 3DMJA 4F0MA 2IPOB 3CCUS 3AJ1A 1RKIA 1W2IA 5LMNJ 1XJWB 2IFXA 4O4GA 2ZWOA 2DGTA 1Q8LA 2YNFA 4I2QA 5T41A 2NXJA 1HNWF 1U1KA 2FJVA 1O0PA 3THPA 2YKPA 4ELTA 2R8GA 4DU8A 3EPIA 3O6QA 3GZ7A 5H9EK 4LVNP 2HK2A 5B0EA 2ZFHA 1JXLA 3JTPA 1T9UA 1WC5A 2KL8A 3DOMB 1TK0A 1LK5A 5E0OA 4P2FA 4X65F 4C7QA 2GHWA 1RB0A 4X4PA 2Z57B 4NMXA 5FDLB 4P52A 4F3MA 1LWCA 2MKCA 2KJVA 4IH5A 3BO2A 4CM2A 2XGQA 3EVOA 1B0PA 2AQ4A 4DV2F 5DDPC 2FYXA 4UQTA 3RGIA 2E5GA 1JLFB 1SJRA 2LFVA 3MEEA 3KLEB 4IQXA 1C0TB 1CJTB 3H2VE 3TAMB 4YMEA 3KLFA 3D28A 3KFWX 2AEMA 2HBZB 1AA1B 4MJKA 2GV1A 3GFZA 4LFBF 1HNXF 2CQ4A 4RNMA 4F4XA 4A8SA 4CDIA 2O1PA 1N36J 1GMWA 4X66J 4I0WA 4KGKA 3QJLA 3MPUB 2J6UA 1UVLA 2HNDB 1QSYA 3TUIC 1VRQC 2NYIA 1RT5A 3M32B 3D6TB 1N48A 2KG0A 5IQ6A 4O44B 3LP2B 1S9GA 1R0AA 1QAXA 2M8HA 1SQFA 4ANDA 2V94A 1HW8A 4B02A 2PSZA 4GC7A 3MCMA 3IBWA 2M7SA 1RT2A 5HVGA 3R6LB 3MD3A 3Q24A 5HI7A 1RBLA 2QL7B 4Q8EA 4ZP9A 1HPZB 2DHXA 3M30A 2IRXA 2QA4S 3MF5A 2PD1A 3MAHA 3PM9A 1TVRB 4ZJQA 2LQ8A 3CJRA 1FWKA 2BKNA 2ROPA 4OYZA 4Y34A 4B3RJ 1RU2A 4NLGA 3CDUA 5DM6Q 3CGIA 5L46A 1UJ6A 2BJEA 4NXNJ 4LF9J 2BJ3A 3J81j 4ES1A 2AJ4A 5JXSA 1KHWA 1OJ4A 1HLWA 3CEDA 1NB2A 4C0OC 4B9NA 4K4XA 2K3KA 2FHJD 4PG6A 3G96A 2X1GA 4CTAB 1GMVA 3G8TA 1RUSA 2OFGX 1QTNB 3WC0A 4TY9A 2GCFA 3MM5A 3ENVA 3J7AN 2AX1A 4ALZA 4F4ZA 1M1HA 3I5BA 2DGOA 4J9OA 1FKAF 3HKZD 4ILLA 3JSMA 1XMBA 1Q81T 2LMIA 1WKJA 5KFZA 3K8VA 4C8NA 2XY7A 1YHQS 2G13A 4DZDA 2XY5A 4XDDA 4XDCA 3BB5A 4ZVFA 2OHDA 2CZ9A 1L3KA 5JVGQ 3HD1A 1SKWA 3R5JB 3X1LB 2V8VA 1JLEA 4F02A 3W2WB 4HH1A 3CC2S 5ETQA 2DRBA 1ROFA 4BHQA 5E3PA 4H4MA 4KGZB 2H9ZA 2QEXS 4ATNA 2M88A 3ICLA 2QO3A 5JUMA 2DEJA 4R0JA 5FDLA 2I6WA 1UJ5A 2VKZG 4W90B 3OTEA 2VFSA 2LXIA 4USKA 2C3OA 2QSFA 5BYSA 4MMOA 1U45A 2UV8A 1CC7A 1UWBB 3R97A 3SSSA 2EG2A 3KLEA 1C0TA 1L3SA 1CJTA 3TAMA 2RDJA 1DTTA 1QAYA 3RR7A 2RQ4A 2Q6BA 1U4BA 2K7JA 4H4OB 3PX4A 4OV1A 4ZVGA 3TP2A 3AD7C 1CSJA 4CCHA 3ENAA 1XR7A 2FLLA 3EUNA 2RF2B 2HNDA 3M32A 5B0AA 3LP2A 3MECB 3HM9A 1RE1B 2PFDA 1RWMB 3NS5A 3HFZB 3KDNA 2VJVA 2ZBPA 3M1VB 4AD6A 3CWJA 5GADU 4NWBA 1PGZA 3ISNC 1HPZA 3C19A 2LA4A 3C3LA 3I4HX 4NZ7A 3LWMA 3OTDA 1K1SA 3QWPA 1HMVB 3R3TA 2CPFA 3HO1A 3GPAA 2P9CA 2EFOA 2QRRA 3BS9A 2IMWP 3HXMA 1TVRA 2AJ1A 1PO6A 4P71A 1RA6A 5FIIA 4FYWB 5AT1B 1MWQA 2M0GB 2OD4A 5H9FJ 3DLGB 3BQ0A 1RP5A 3JYTB 2ALYB 4N8NA 1LXJA 2UUAF 1HBOB 5KFOA 1MNEA 4P2XA 1IUJA 2ADCA 1FKOA 4K4SA 1PYOB 2VB6A 1XMOF 2VC1A 2CIMA 2IYGA 1UW4A 1HWJA 2V68A 1KQSR 4C97A 4KHPF 1IBLJ 3CCRS 4LRAA 4E0DA 2MZRA 3CSKA 3FUYA 3ONQA 4CTAA 3N79A 2WZ1A 2MZSA 2V9KA 1TTHB 3J81Y 3DYAB 3L7PA 2FC9A 3MMBB 4YFUA 2RRBA 1K0VA 1TFWA 2PMZD 3UPFA 3OXFA 1MN7A 2W2PP 4AUKA 3EVWA 2MJUA 4B3MF 3EZ5A 1KRPA 1C4AA 3HDSA 2FQQB 1X0FA 3NRBA 1U2CA 5EX0A 2LU1A 2F8EX 2LDYA 2HHHJ 1RT7A 4NXMF 2GNKA 4IG0A 5B0CA 4ECSA 2CDRB 1SC4B 4ZVTB 4EWTA 1IKWB 1VRUB 1T3NA 1DAXA 1FRIA 1G7CB 1GK8A 4PWDA 1V9OA 3VAKA 3AJDA 1NK5A 3O5TB 2R2TA 2R7OA 2WB1D 4YQWA 3GJQB 4G1IA 4A8WA 5AJ3J 4NPOA 2XI2A 4MH8A 4J9UE 2ZZNA 3RRKA 5K20B 3THVA 3MR6A 2HSEB 2YNHB 3LTOA 1CS4B 4DL3A 2KTQA 2H4WB 3IR6B 4A8FA 2ZJQQ 4OJGA 1YGYA 1K47A 1WHVA 2EFGA 5D77A 1VQSA 3M7VA 4DR6F 3LH2S 4QWBA 1WACA 4FF3A 5J2PB 1UWBA 2BJ7A 3BR9A 3WBZA 4IFYA 3W9JA 4HDGA 4KT0C 5HMYA 1OWXA 1NBEB 3HLUA 5F8NA 4H4OA 1TKTB 4MK9A 3VCDA 4U6PA 4HYKA 4LBHA 1MU2A 1H38A 1WTFA 5KFDA 4F50A 4LF7F 2RF2A 3G6YA 4F4AA 1VJQA 1H7XA 4DFJA 2CVEA 3MMAB 2K1RB 4IKAA 3PV8A 1GH8A 2WVBA 3MECA 3T6JA 3HCXA 3DRYA 3V4MA 3EMTA 2ZBQA 3LUYA 4IDKB 1FFSB 3S01A 1FERA 1VIXA 3AB2B 1VBXA 2HQDA 1WG1A 4FYDA 1T95A 4DQRA 2JL9A 3RUBL 2LEBA 5U47A 3F44A 4GKJJ 3CCSS 2QIFA 3PDNA 2VG7B 4YUDA 1U49A 1W25A 3Q8VA 2DR7A 3K5OA 1PAUB 4O23A 3EPGA 1NAQA 1XWLA 2G2ZA 1UZHA 2DK2A 4DX8H 1RSCA 4IOAQ 3UD3P 2ROEA 3U02A 4L74A 4J9MA 5J1NA 1FJEB 3DLGA 1C0UB 1KD1T 2J9DA 4FVMA 3MMJA 4Z7CA 4C0HA 3RAQA 1WC6A 1HBOA 2XTJP 4IOCQ 1TL1B 3OL9A 1EETA 2OPRB 2IBOA 3GJTB 2GZOA 3NMRA 3FKBA 3D7SB 1UVIA 3PYFA 3QQCD 1QDUB 2BANA 1XBWA 3BYRA 3P6YC 2ZZMA 3B8HA 5F0UA 5LMNF 1UVKA 1WG4A 3V4IB 1W7WA 5ETSA 2A3JA 4AL5A 3OV7A 3KLIB 1Q79A 3DYAA 3QFHA 5ETPA 3MMBA 4ETZA 1YJRA 4I1TA 4NEZA 1O8BA 1DFDA 3KUGA 5L8RC 5HQLA 3E8OA 4RW7B 4PQUA 3W64A 4DL0C 5B08A 4W4MA 4QWEA 1C1BA 2VQEJ 2J9DE 3MOJB 5F8IA 4M5NA 4KIAA 3IWLA 2RQCA 1IKWA 1K9MT 3DLEB 2FIUA 1VRUA 2GIRA 2YKAA 5C42A 7AT1B 4C3KA 3PG9A 1H72C 1R8HA 3NGKA 2DIUA 2QSWA 3R8YA 2JEIA 5HANA 2R3VA 1LWFA 5G4DA 2Z58B 4J9PA 2LXFA 5ETTA 5EHHA 2B9XA 2YNHA 4JI3J 1CS4A 3QT5A 2IAJB 4YS2A 3M2RB 4ID5B 1RWOB 3QAUA 3CCZA 3BJYA 3L09A 4X66F 5DDOC 4RU2A 2LDIA 3PXGa 1MLAA 1NLKL 3R1LA 3K5MA 3HHLA 1VGYA 5J2PA 4CRJA 4QU6A 1UMJA 3QZ8A 3J7YU 4OZ2A 2VF3A 4OI0A 4KRWA 2BE7D 3DXSX 2EFPA 1M5VC 1X4EA 3PNIA 1MN9A 2CRLA 4WFNQ 2G0JA 3N5FA 2RB7A 3FVYA 3UFCX 3CMES 3VAFA 1CJVA 1FDDA 5LOQA 4M5JA 2DO4A 3MMAA 3UE2A 5J1EB 2K1RA 3OQ2A 1FD2A 1D9DA 1S6OA 2KFNA 3CF5Q 5IZHA 3TX0A 1RTZA 2PI5A 4IDKA 4NCGB 1F2GA 3CCWA 2OI2A 1WG5A 3ENWA 2AHOB 4XPCA 1NK9A 1VQ6S 2PFFB 4C48A 4FNHA 2E9TA 4OZ3A 2DHHA 3DLHA 2VG7A 4RL1A 4LF9F 4NXNF 1KEKA 4FS2A 4Y0FA 5HP1A 1HW9A 1WC1A 2R42A 4C8OA 1LWEB 3AY0A 3FEXB 4KPCA 2I5JB 4IFVB 4U8YA 2B0GA 2VD3A 3G82B 3ILOA 3A8KA 2XZDB 2XGPA 2EK1A 3HHEA 5KFFA 2CJ9A 1TL1A 2D7SA 3RYLA 5I4MA 4DR2J 5KFMA 2MZJA 4EBEA 1W2BR 4DSLA 5E41A 2XLIA 2K3IA 2DJWA 1RWPB 3IGVA 2CG4A 2M70A 4QWAA 2JSXA 3MUMP 3HFKA 1QE1B 3UR3C 5KT4A 2QL9B 3FSIA 1YG0A 3JSRA 4WZQA 3KLIA 3DGPB 1XEZA 3BN7A 2VBZA 4FP9A 1H74A 1U02A 3TUJC 4WU2A 3G2XA 1S9FA 1ULRA 5D3GB 4FYYB 3AFGA 1B64A 3H8YA 2M9KA 2WVFA 4KH0B 4RW7A 1NDPA 4DBQA 1SIWB 2FJDB 1T11A 1TMJA 2UVRA 3SV3A 5GAEU 1PIEA 4NI2A 3PIPQ 5T7LB 4RW4A 1KQGB 1T7PA 1Z4UA 3TNVA 3O1LA 3DLEA 2GIFA 3V6DB 2VFRA 2Z2YB 3H7HB 4RNFA 2BW7A 4NA3A 1PBUA 3QIPB 1JLAA 2JVRA 1SQEA 3OXGA 2DRDA 4L3KA 1RDRA 5J2QB 1Q7LB 4ES3A 1UVMA 2Z2LA 2W2OP 2F8HA 5B0DA 3JQJA 1S1TA 1FJCA 3U1NA 4X64J 4CNYA 4CLTA 5I42B 1X7VA 2OTLS 3MZIA 4LSLA 3OSNA 2ZJRQ 4DQPA 2R8HA 1TKZA 1URRA 3AA9A 3CC4S 1N88A 1N8RT 3TI0A 5HO4A 3VAJA 2OUGA 2EW9A 2U2FA 2RUGA 3GIIA 5L38A 5I3UB 2AV5A 4U7CA 2GMJA 2J0WA 3A3OB 3W3SA 1RTHB 2D3UA 1BHNA 5IV4A 5L1KA 3CCJS 1UFWA 3W65A 3HZGA 5LM7E 3FGVA 3HT0A 4NOHA 1U6ZA 3W66A 2WSFC 1DBDA 2X51A 3CC7S 3GIRA 2C2EA 1IXKA 2MDAA 2EXUA 3GE9A 4NCGA 4C9DA 3EVMA 3MFIA 5GMKa 2VG6B 3RAXA 3D0HE 1CJKB 5A6WA 3M6UA 3VGTA 2CJYB 2F63A 2OGUA 4KC5A 4C8MA 4JI2J 3GTYX 4GKKJ 3N4WA 1DARA 2JNJA 4PUOB 4TYAA 1Q0NA 4C8KA 1IBLF 4YR3A 1LWEA 4RPFA 4NEYA 2YWEA 4J9SA 3PW7A 4QYZK 2KFYA 2I5JA 4IFVA 3DHWC 3TEHB 3RAMA 3G82A 2QMWA 1TP7A 5HMXA 2O66A 2IA6A 4ECQA 3CULA 4K50A 4LF1A 4B9UA 5SUHA 2FJXA 2V50A 2POKA 3BO4A 2FD2A 2IA0A 3H2UB 1JWWA 3BH7B 3DLKA 2GAGC 2HHHF 1KLNA 3CJ0A 1MG7A 4DFMA 3R7BB 3DGPA 4NE9C 3HVTA 4KH1B 1EB0A 3TZZA 2IIHA 3GG0A 3JTOA 3PJ9A 2Y8WA 2L3MA 4DV1J 3JAMY 4DS5A 5D3GA 4EK2A 2ZH4A 2A1BA 1X31C 4GO7X 3KYLA 5D6GA 1OO0B 2H5IB 2MHNA 5AJ3F 5KFKA 2R2UA 1SL0A 5T7LA 4IO9Q 2CNLB 5K8PA 5L39A 5FLXY 3V6DA 3GYXB 2VA2A 5I3QA 3JSYA 3CNQP 1UETA 1Q5VA 5B0BA 4F4KA 4FBUA 5E33A 2OD6A 4K4VA 3QIPA 1IKXB 1FXRA 1P9QC 5J2QA 2FLPA 2CUYA 1ELOA 3C6UA 1RAOA 2DNOA 3P5TL 3KK3B 4ZVEA 4UOCA 4ED3A 3ISND 1XIQA 3OBIA 1KONA 1NZ8A 3RTVA 2CQ0A 2DHAA 2HHWA 2NPIA 1T94A 4TU9A 1O5JA 1T0TV 4J9RA 2MLYA 3NWRA 1VMBA 1JNRB 2XNQA 3W5YA 3NOGA 4KHRA 1YJWS 3JQKA 1JLCB 5B7WA 3M9NB 1LFWA 2RKIB 3J81U 1LWXA 3I0RB 1RTHA 1YJTA 2DXDA 2KN4A 4GKJF 3N0VA 4KY3A 3AT1B 3HJVA 4JV5J 2Y1IA 1KQKA 1YI2S 5D78A 1N32J 1AFIA 5AXKA 3A13A 5IT0A 1HIYA 5A8RB 2CQGA 2W2MP 4U7UK 1EKRA 1GT8A 2VG6A 4NL5A 1HI0P 3F41A 5KG3A 1QSSA 4Z37A 1NZAA 2HIYA 1CJKA 4ZVPB 3VAGA 5I3PA 4ED7A 1JXVA 3PYDA 1FKPB 2DCUB 1OYDA 1RABB 4USJC 3OD2A 3GV7B 3AQOA 3SDEB 4TY8A 2V4RA 3Q8QB 3KHGA 4OX6A 3BGOP 1EKSA 2X1AA 4ZVUB 1IBMJ 4KHMA 3M2VB 2WOMB 4PXBA 1Y5IB 3MWBA 2MKIA 3K5LA 4K2XA 5KOWA 4EYHB 2RD5C 1KDNA 1PJ5A 2CQPA 3H90A 2J8SA 2VBYA 2IVFB 1DZ5A 2DD8S 2H65B 2A6OA 2IMOA 1YQHA 1IR0A 4ED1A 3Q2SC 3D66A 2B7CB 4DL7A 2ACYA 4W92B 2DH9A 3W9HA 2XYGB 3VGSA 2DNQA 3B4DA 4O0IA 3RBDA 4K4ZA 1VQ7S 3UDVA 3CJ5A 2AEJA 2MQOA 3CUNA 2CDQA 2OPSB 3CDBA 3IAS9 4B9MA 5ETMA 2VH7A 3O2IA 2PEBA 4JI3F 2P5VA 1U1OA 1ACMB 4LT6A 5LSLA 4RNOA 2DY1A 1MWZA 3AOCA 5AXLA 5C2GA 1BQMB 3DHXA 5KFLA 2HQFA 3L3CA 2OAUA 1IKXA 3Q2TC 2FHJA 2NXUA 3N01A 4PXDA 4KSEB 4RJVA 3C66A 4ZVHA 3CXCR 3KHLA 1UTAA 3M2UA 3KOAA 1MROB 2WSEC 5HMZA 1FRJA 1SKSA 4OJHA 2H5JB 2HWIA 1R89A 3RRHA 1UL3A 3VZHA 1KC8T 3PW2A 3A1YG 3M8QB 1S1UB 4E8UA 3I31A 3CJ3A 1JK9B 2XMKA 2I38A 1X4CA 1JLCA 1BUXA 2E7XA 4ECZA 3KJQB 4NRUA 4LMZA 1PYSB 3I0RA 3O44A 3IG1B 2ZD1B 2CPHA 2R7WA 2OTJS 2LQBA 3FJ2A 3TWZA 3LW5C 4K0KJ 2ILYA 4YDXA 1F3FA 3CB4A 1U2FA 4EI2A 5ETNA 4N56A 2V67A 2IC3B 1AROP 2KM8B 2OPPB 2BE2B 3NKYA 3PRVA 2MGZB 3QAEA 2OFHX 5C25B 3FZ2A 1NMEB 1RBOB 1FFGB 4JB8B 4B3TJ 3MM8B 1FKPA 2BUNA 4DR2F 3NGRA 4MK8A 3DLBA 1N6QB 4RUBA 1TL7B 2VIHA 1Q8IA 4OJ1A 3AOAA 3CE8A 3T9ZA 4CLLA 2V5HG 2MEWA 3VV2B 2AMCB 3M2VA 2D3ZA 3CIZA 2WOMA 1S1XB 4ILRA 2YQ1A 1SCJB 3H5YA 2MKHA 1T9VA 1RT1A 3AJ2A 4IH6A 1CPZA 2RS8A 2G9OA 4ZLNA 2GJFA 1RT3B 1UPPA 1ZETA 2R7VA 2KT3A 1SIZA 2KG1A 4R0EA 4WP9A 4XAKA 3NP5A 1EIYB 3BZQA 2AJ0A 3PW5A 2CQ2A 3QATA 5G0RB 2K7KA 2OIHA 2A2CA 2LKZA 2YXLA 3FK4A 1X4DA 5K14B 1UVNA 2KHDA 4NLSA 1SC1B 2RH3A 4KGVB 2J0XA 5F3TA 4NRTA 4PABA 2E5JA 2HFUA 2R8KA 3GJRB 5LSRA 1Q8KA 2OPSA 1M5SA 2J7WA 4MT1A 3R5AA 3LQVA 1DQ9A 2MZ1A 2COLA 4A8OA 4DR5J 3OR2B 3LGMA 4X64F 2X1BA 1BQMA 1AZSB 3QYYA 1H2VZ 4RBVA 1SXLA 2GJ2A 2DNPA 4AL6A 1SL2A 2YKOA 3P4UB 1K0TA 1BLUA 2UVVA 1HNZJ 1J5OB 2Z56B 2Y1LB 1GXTA 4ZS6A 4ZVRB 4DI6A 1MROA 3SFUA 4NYZA 3FCWA 5ITHA 2IVYA 3BDEA 2JHEA 5GAGI 3RG6A 2XB2D 3OW2R 2FB0A 2PEHA 4RNNA 1L3VA 3M8QA 3HSDA 1S1UA 4NLTA 7FD1A 2ZBCA 4U96A 5HL7Q 2DVIA 1NDCA 2BABA 1FK9A 3V81B 2HW3A 1OMSA 5A8WB 2HZAA 3GYNA 5C2CA 4P75A 3OHAA 1XNRJ 3M4XA 2KFZA 1FFWB 2ZD1A 3K17A 4DPXA 1Y0HA 2VU5A 5GMDA 3OR1B 3M6VA 2XWYA 1VI7A 3MM7B 4JI2F 2DGUA 1RQ0A 4GKKF 4P9SA 1RA7A 4DL5A 1BQNB 4EBDA 4ZA1A 1ZM4A 1FRKA 1VRTB 1M90T 2IC3A 2YKQA 1LKZA 4WP8A 2OPPA 2BE2A 2MGZA 3BR8A 2W9AA 5KFNA 5C25A 2HFVA 3F0NA 3MM8A 1T9TA 4OHWA 5HN0A 4BCAA 1U8SA 4X4TA 4OL8A 1SC6A 2LVWA 1N6QA 2XI3A 1SJ4P 2EEYA 2XS2A 1MSWD 1VS3A 2KHCA 2J76E 3CJ2A 4FXDA 1NSAA 2EC0A 2QE5A 2YH0A 3MI7X 1S72S 1B7YB 4ZK7M 1G4CA 3VALA 4PR6A 5CZVA 1VQKS 2F1FA 2NXNA 2NSBA 4DV1F 3OFEA 3NL0A 2Q79A 4NLRA 4ERDA 2BKPA 1H73A 2JEJA 3QPIA 2XY6A 4K59A 1X8DA 2UXBF 5DO2A 3C2PA 2JEFA 1GX5A 4DL4A 4NLUA 3IR7B 1SUQB 4J91A 5KFPA 1B0VA 2QJ3A 1RAHB 3RRGA 1KOOA 5G0RA 1EP4B 4TVAB 3CJ4A 4DV0J 3HF5A 3BGFA 3KG1A 4QIVA 3CJ8A 3FCHA 3HKWA 5K14A 5IT4A 1IWGA 4NZ0A 1ZOTA 1L5UA 2DXFA 2DNZA 3CT9A 3NGDA 3AXMA 4DJBA 1GXLA 2DEIA 2GX8A 2FZCB 3R7NB 2IRYA 1T05B 3T41A 3WIUA 2FTRA 4F0KA 3UCUP 2GC8A 4PYDA 2Y1JA 1Z2ZA 2QL5B 3OR2A 3FEYB 1YTYA 1XMQJ 4XTTA 4HT7A 4ILMA 2V34A 5ADZA 1AZSA 2BM0A 2FVPA 2KRBA 4G6VB 4DSEA 3BSCA 2VG5A 3HHLC 4DSFA 2OMOA 3MM9B 4WTYA 3HHKA 1ZM9A 1SVDA 3FMWA 4I64A 3P45B 4O3RA 3I87A 3GFXA 3PKYA 2ZEJA 4P7TA 4USMA 4JV5F 3HPOA 5L1JA 1U09A 4TLQA 4KFBB 1TL4A 3U27A 4XPEA 1VBZA 4KE5A 2YKMB 2B9YA 4L6V3 1VQYA 4I6WA 3V81A 1D8ZA 4ZPBA 1S59A 5M2UA 2CPJA 5A8WA 1B3TA 2L9NA 4HR2A 4F36A 5KT7A 1LQ9A 5AE1A 1H2UX 1S99A 4OX8A 3PEHA 1FRHA 3OR1A 3KJNB 2HQ3A 3MMCB 2FVCA 2B7BB 3ZTQA 3MM7A 2E1CA 2BXJA 2HFNA 1UP1A 3TUPA 1OY9A 2AD9A 1BQNA 1N34J 1MW7A 1IBMF 4ZCMA 1VRTA 1X5OA 2GMHA 2QT7A 4X4NA 4C98A 3MR2A 3J7A1 8AT1B 5KFEA 5EWGA 2Q3PA 5K8MA 3IR5B 2V8GA 1VISA 2LEPA 5CHCB 2ZDPA 4LUBA 1WKKA 4HACA 1UW9A 2CAJA 4O0NA 1S1WB 3RB6A 3JS9A 4RU9A 3Q8SB 4WYLA 3UCZP 2ZH6A 4K4WA 2HHVA 1WD6A 3MFHA 4NCAA 2DHGA 3TVKA 4AE5A 3GMGA 4WWSA 3BKUA 4K5RA 1RACB 2IM3A 2CJQA 1ZA1B 1F5AA 1R43A 2ZUGA 4M94A 2NZ4A 3P5BP 1SUQA 4LJMA 4Q43A 4OX9J 1XNQJ 1EP4A 1LV5A 2R8IA 3HI9A 2WHOA 1HARA 4KR0B 1GAOA 4TQSA 2R7RA 1F9EB 1KP6A 5HQ8A 2UZAA 1KTQA 3BBFA 3UQSA 2MHEA 1VIOA 2OKQA 4IH7A 4MKVA 1T05A 4UUXA 3GIKA 1CEZA 6AT1B 3RW7A 2KT5A 5RUBA 4PWUA 1UAWA 3UDCA 5L9XA 2IBKA 1MMDA 1FX2A 1N0UA 3BGUA 4O4RA 2APOA 1HNIB 2CFXA 1CULA 1KVKA 1HBUB 1X4HA 5DS7A 1RADB 3AAWB 3UNGC 3EXYA 4B9TA 4OHZA 1TV6A 2RU3A 1NUEA 4RUAA 2IYIA 1ZM2A 1LW2A 3CCQS 5E3QA 3H5SA 3D54A 3LAKA 4K0KF 1KBRA 3UWTA 1S7IA 4KFBA 1DLOB 5LJ3Y 3HHNB 2KH9A 1Y4ZB 4DV7J 2K06A 2LEAA 3D67A 1VHIA 5BXIA 2NUUG 1TL5A 3EGWB 2QX0A 4HI1A 3GR0A 1H98A 1M5KC 4QU7A 3IBCB 4B3TF 1KWMA 4QR2A 3MMCA 2DRAA 5E7OB 3NAHA 5CYQB 1UA1A 4UY8T 2IM2A 1RLCL 3NG8A 4DMZA 4A48A 2V4JB 2GAHC 4DR4J 3FRYA 4J9LA 4URGA 1NEEA 4WXWA 4WIQA 2HPUA 4LQ9A 2FZKB 2CJKA 1BY9A 5KOXA 1R8CA 4UTGA 1F1BB 4ELUA 2HMIB 4FZVA 2MSTA 2EKNA 3TA0A 1D0EA 1YZ6A 1UPMB 3CO9A 2V2ZA 1HI8A 1XERA 4HHUA 3FBBA 5IWAF 4L72B 2R7QA 4M5HA 1S1WA 4FXWA 2BYCA 3I55S 4OZJA 4DCPB 4C11B 4CLPA 4WYWA 4EFAC 4J7CA 1L3TA 4OHYA 2R7UA 2H3EB 3CMQA 4WK3A 2F7VA 2LECA 5BYRA 2KVIA 2DO0A 5K9FA 5J2MB 4H4KA 3K5NA 2ZH3A 1CQMA 3HSZA 2A6MA 4WP3A 5A0YB 1RAFB 2W4DA 4LRBA 1K1QA 1WTBA 4DR5F 4LBIA 1VLOA 3VVUA 3TVYA 3PHTA 4GRSA 5F0WA 2QLXA 3OFHA 4Z2XA 1RHQB 1ZZNA 2JH3A 3HMJG 1FEHA 5DLGA 1HNZF 3MPYA 4JV2A 4KTQA 4N76A 3IWNC 2M4MA 3TRGA 4NLQA 2PN6A 4FS1A 3WDOA 2DGVA 4DS4A 2DKOB 5IT9U 2NQPA 4DQQA 1VQ4S 3VR1A 3CJKA 4PCQA 3IM9A 1HNIA 2GMLA 3Q83A 2RJZA 4RWWA 2CPDA 5DGAA 2DTJA 2B4PA 4QCLA 1YVFA 4LF2A 2R9LA 3WX8A 3ZZ0A 1XNRF 5DG8A 2DY9A 1RK8A 1EJ7L 1RHKB 2VPXB 1WEXA 4OYMA 2PDAA 2HS4A 5SZTA 2HBRB 1VC5A 1DLOA 3R27A 3OLAA 4FNIA 3EICA 4G3IA 2HZCA 4CYUB 3PW4A 3ZNJ1 3A3PB 4ZPCA 3SYZA 1VR6A 1NK8A 3CPWR 2ZHBA 3C16B 1CVJA 4E2FB 3GYGA 3CCVS 3JQMA 4USHA 3OSPA 3P49B 1S6PB 5CYQA 3IM8A 3NS6A 1TMMA 3RW6A 5HQMA 2N7CA 3IBFB 4F7VA 4CH1A 3ET6B 1UCNA 1S49A 5KFSA 1WKLA 1N52B 2AJFE 4F4YA 5DJBA 2E1MC 2LQ9A 1OQ3A 5HROB 2V8HA 1ZTWA 4ZHRB 2E1AA 4DV3J 2XNRA 2W9BA 3DRXA 4PXCA 6FD1A 2HMIA 4WKRA 3M6WA 4IG3B 2CQ1A 1H3DA 4ZCIA 4ECXA 2DNKA 4N47A 5GAHI 1U1PA 3X3UA 2I0XA 4C11A 4DV0F 2RRNA 1WUUA 3MR5A 3IA0A 2M3DA 3GFYA 3MR7A 1I5OB 2QZ8A 3I5AA 4M1KA 1S9EB 3MTKA 4DWIA 3HVRA 1IN0A 2EFQA 4I2PB 1LW0B 2DR6A 2D3O1 1ZTTA 3T3FA 4AYBD 1EQMA 2FHKA 2QFIA 4JI5J 4YHHJ 2RT3A 5A0YA 3HJFA 4LRDA 1PILA 4NLVA 4ID8A 5E2QA 3RBEA 2R4FA 1XMQF 3CDAA 2W7PA 1G2EA 3BKTA 3ADAC 2G0IA 1WEZA 2MZQA 3EZOA 2J6TA 1BE4A 2B43A 3EGNA 3EZUA 2CPIA 2QG9B 2EVZA 2RSQA 1PC5A 2LU2A 3BQ1A 2MKYA 1VFJA 4Y3CA 3FC9A 1SJFA 5KFIA 1YK9A 2BVZA 3B4MA 2XULA 1FVQA 2CPYA 4NX9A 2LQJA 2J0SD 4LR8A 2HRTA 4D3HA 1NPKA 1CJUB 2C42A 4P2SA 1FE0A 4PG7A 2VBWA 2X3GA 2VKRA 2E9ZA 2OJ3A 1FD8A 2ASYA 5GMEA 1D09B 3DOMA 5F8MA 4TN2A 4ECTA 4AL7A 2UVUA 4IQMA 3NAIA 3IMQJ 5ETKA 4DCOB 1P1LA 3I9ZA 4DZ6A 4HEA9 1JXEA 1VCTA 3FFIB 1RTIB 2D1CA 4OYAA 1NDLA 2IJRA 2KXNB 4L76A 4DR1J 1J5EJ 2IDEA 1JLFA 2DR5A 2VODA 4ZVQB 2C2DA 1VDHA 1FDNA 2HKEA 4XK8C 2VFVA 2WTFA 2CWKA 3QGPA 2B56A 2BJ8A 1N34F 1FJGJ 4CYUA 2XYHB 3Q89A 1FJ7A 1CLFA 4F67A 1HWUA 2CQHA 4WZMA 3UD5A 3A8JA 2N3OA 4P72A 1UZDA 5HBMB 4WFAQ 4F0HA 3JSBA 1SC3B 4QBUA 4O44A 3J7ZT 3T19A 3ZTSA 2F9DA 2R7XA 4CZCA 1REGX 4ZLJA 2C2MB 1RT4B 3Q8YA 3VWSA 3PFEA 1Y7PA 2WAQD 3ET6A 2OEKA 3OVSA 2NSCA 4USUA 4BWJA 5A8KB 4CLSA 1JX4A 1RAJA 1WHWA 4LF5J 5HROA 2HG4A 3PKMA 4WFXA 4ZOSA 4M5IA 1K73T 1RBAA 2Q6CA 3AH6A 4DR7J 2BZ2A 1TUVA 2BJDA 3JB9k 3ILIA 2QA1A 2CQIA 3IS9B 2OLWA 4IG3A 2QV6A 3ZC4A 1WF0A 5DDRC 1M5PC 2MQ8A 1S1VB 4J9QA 1PSDA 4CQ1A 2HGLA 1U47A 5EWFA 2Q1LA 2BE9B 4K4UA 3C8YA 2IJNA 4C6AA 4OX9F 1XNQF 1X4GA 3PR5B 1APSA 3GCWP 5CZXA 5H1SV 3CCLS 1S9EA 4PG5A 3S6EA 4FPIA 2MQPA 1V5IB 2W2NP 1LW0A 3WC2A 2WRMA 5LXYA 3MXHP 1T3OA 1FVSA 3HHLD 1JKHB 1FDBA 1I3OB 2BKOA 5FJ4A 1HNVB 1NK7A 4JV0A 3DDNA 4DG1B 3TJ8A 4DSJA 3CD7A 5KFRA 3HULA 3R7SB 4A8MP 3J80U 3MOZA 5D0EA 2VDHA 4Y00A 5KFYA 5IXUA 3SMZA 4ZKAA 4IYQA 1NSQA 2EG1A 4LREA 1FWLA 1VQPS 2XMJA 1RHMB 3MAQA 1YJVA 2AT1B 2CADA 3UDEA 3N28A 3W2WA 3QT6A 4A4JA 3TOQA 1CJUA 1VYAA 2NR0A 1JMTA 1KSPA 4BLGA 1RTDB 1NDKA 4ECYA 2MY7A 4QYRA 1NKBA 1SH3A 1TELA 2LXUA 2XSFA 2E29A 1WSVA 2H5EA 2UUBJ 1YDLA 2FC8A 2MKSA 4G65A 2JJ4D 2F4FA 4DV7F 2W7AA 1RXOB 4YP3A 3NGTA 1YITS 1IM4A 3FFIA 2HHQA 2D9OA 1RTIA 3PIOQ 1KN6A 2GFFA 5HVFA 1NJYA 2HK3A 4R8UB 3D5MA 4M5LA 5KTQA 1U48A 2HRYA 4DR4F 3WX4A 4WKYA 4OI2A 3PX6A 2FZGB 5KAKA 3DLLQ 4LF6J 4AQYJ 3WZ0A 4P73A 5HBMA 3KJFB 1BWVA 1Q95G 3GQCA 1F60B 5L1LA 4U8VA 4FKXA 2VONA 2DH7A 2KM8C 1M5HA 1TR0A 3VQSA 2QLFB 4K7QA 2NXCA 4ANEA 2ZOFA 1RT4A 3GU0A 3T5LA 1RYSA 5CYJA 3M1VA 4HHJA 3CO0P 2B4VA 2CQCA 3ZZRA 4NLXA 1Y9OA 3B82A 4DUTA 1YBAA 2L9WA 2J5AA 2KXHA 3GV8B 1U1LA 4O3PA 2CQBA 4DX6A 1NXIA 4C8ZA 2W1BA 3EWGA 1HMVA 1DTQB 4OZLA 4QOTA 5KG0A 2M52A 3IS9A 4WF9Q 3D6HB 1HHQA 1SV5B 1SB6A 1V5VA 1S1VA 3W63A 2EBGA 4G1PA 4AFFA 3GV5B 5HAOA 3H42A 3JYTA 3TZYA 4LF8J 3W61A 1RAEB 2C3MA 3KG4A 4B9LA 4MYTA 3N9UC 1HWKA 4LSNB 2YNGB 3W8PA 2A2DA 1U0HB 1NSPA 2WW8A 2XWXA 5F9NA 4OZ0A 3FSYA 3ZXWA 2XSJB 2W24A 3FQLA 4E98A 4TKTA 4RBTA 2G1HA 2DNNA 2KKHA 2NS1B 2J0QD 5F8HA 4A8YA 1JKHA 1HNVA 2EWHA 4FN5A 4DG1A 4B3SJ 3FEZA 4I4BA 2BACA 2FJEB 1WC4A 4YDDB 5AXNA 3PRBA 5IFMA 3GP9A 2PA3A 2BQRA 2GHPA 2FJAB 3OLBA 2NZCA 1N54B 4AXJA 1JLQB 4KV8B 3RZAA 5A76A 3TZXA 1ZPWX 2ZUAA 1H6KX 1NHUA 4FF4A 3V6JA 2HEKA 2HYIB 4DDFA 3M6XA 2KZZA 1J2VA 4DQIA 2VPWB 3LPEA 4U7UD 4QPXA 1JLGB 2HQCA 4S0MA 2PC6A 3QRRA 1O6XA 2MQNA 2MSSA 4LFAJ 4OI6A 2PA8D 3BSNA 1SPBP 4FYVB 1VQ5S 2QTWA 3DU5A 3H25A 2AYEA 2KI2A 2KYXA 4HHHA 4DQSA 2AYGA 3KLFB 5M2RA 1RLDA 2VPYB 2ZH1A 1EQ0A 4L75A 2CPZA 1B4SA 4QWDA 1HR0J 5HLFB 1X4AA 3O3LA 5DG7A 3I32A 3E51A 2JRSA 2WB4A 4KB7A 4R8UA 3SCKE 3IAM9 2RDDA 2YBVA 3UVJB 1OPZA 1TKTA 1HBNB 1RT5B 4NYOA 5DM7Q 4I67A 2ZBRA 1S9GB 3D9BA 1RAGB 2D74B 3ISZA 1LOUA 1HWIA 2GQ2A 1TKXB 3S1TA 4YB5A 3IO1A 3V2UC 2NLWA 4DV3F 2PMWA 3LOUA 1OS5A 2YWHA 3POTB 4NA2A 2XLJA 2F4VJ 2UV8G 2AZ3A 2KYZA 2L9DA 1BXNA 2J6SA 2KZMA 2HGNA 2E5LJ 3F56A 3BKFA 3TA1A 2AF6A 3DOKB 3AHPA 3MEDB 1RWKB 4ZCKA 2ZKUA 2YWFA 1AB8A 1BGXT 3UO0A 4BS2A 3NCRA 1DTQA 1GTHA 2W2QP 3DRPB 4LIWA 3I82A 2CG8A 4OZNA 4ED6A 1S57A 2WVCA 1GMUA 1SV5A 1P8GA 5KFUA 2MQQA 1X4BA 4MK7A 1C0UA 1HKAA 4K2JA 4JI5F 4YHHF 2R2RA 4ED5A 1OSCA 3EGZA 3NNCA 3D1OA 2OPRA 2NYHA 4R5PB 3M9OB 3ZZPA 1IWAA 1U0HA 2P9EA 1NK0A 3MM5B 1E6YB 1WOOA 3K8WA 4YN3B 4Q0BB 2HVZA 3G87A 2XSJA 3V4IA 5C7PA 2XC9A 3KJVB 1RAIB 1WC3A 2ZVSA 1CQNA 7FDRA 4CH0S 1IJFB 1EX8A 4PKDB 2O67A 3PVXA 2HHUA 4U95A 3G6VA 3FRZA 5F8LA 1RWUA 2DGSA 1U6FA 3VAHA 3PFOA 5CH7B 5KFTA 1QTMA 2OEMA 1RT6B 4F8RA 1JLEB 2NUHA 1UEUA 2V0NA 5EX3A 5DDQC 3H5UA 1JLQA 4MTPA 4KV8A 2E1PA 2VICA 3T5HA 3SSRA 1T9XA 1HA1A 3BEGB 2AYMA 1HHSA 1J27A 2OPQB 4H4MB 5KG4A 4RBUA 2HNZB 4DR1F 1J5EF 3PJWA 3EDQB 3OTCA 1S79A 3S8SA 1JLGA 2HFOA 2ABYA 2MLZA 4RW8B 1DHMA 5D0RA 4DU7A 3QZ7A 4LF4J 4QIFA 4N5SA 3QBCA 2ZWPA 1HI1A 3DOLB 4DV6J 1HQEB 4IRCA 1N5YB 2QA2A 2IAJA 2P9GA 4FYXB 3M2RA 4ID5A 1Y10A 2R8JA 1FJGF 5KT2A 3QRQA 1DTTB 1ICEB 1S7HA 1IBKJ 2BQUA 3HP6A 1IKYB 5HLFA 2H4YB 3TJAA 3NXZA 2ZNZA 1R31A 2HHPA 4RW6B 2VL1A 3UVJA 4XIUA 1HBNA 4TU7A 1U7LA 1NJZA 2QYCA 1REVB 3I56S 4DUZF 2C3YA 2BOAA 2FLNA 2FPHX 4LF5F 3TJ9A 1UJ4A 4X4UA 1TKXA 1HBMB 5KG1A 3DFEA 5J1EA 2GO8A 1F5BA 5KG7A 2AZ1A 2MZTA 4JYAJ 4DR7F 4JI1J 4FPRA 2HGMA 2PO4A 3POTA 3MPVA 2HHXA 4B9VA 4Y2AA 1N33J 2DB1A 1A6LA 1I51B 2VZ9A 1X0PA 2RNEA 4A8KA 1FRLA 3DOKA 1F9FA 2QFJA 3MEDA 4DN9A 2XS7A 3UDLA 1QJHA 3FMBA 4USWA 2C2NA 1QM9A 2HNYB 3IXQA 2JVOA 3DRPA 1NPRA 2Y0SD 4DEZA 2Z8QA 1FX4A 2DNGA 1KVIA 2HS3A 3PEJA 2AGQA 3N6MA 4V1Ak 1FKOB 1UVJA 1V3RA 3Q8RB 2ZITA 2X1FA 3ITHB 4GVLA 1ZPVA 4BC9A 1FF2A 3OTOJ 4WK1A 4H4KC 1JJHA 4OI4A 1OIAA 3THTA 2YH1A 4R5PA 4QIEA 4CI0B 3OL7A 1YX2A 2LYVA 2CYYA 2BEFA 1I6JA 2DISA 4MFBB 4D3GA 4HVZA 1RYRA 4OI3A 3TVZA 1E6YA 2EC2A 1LFPA 1VJWA 3C15B 2W8LA 4O3QA 3DCAA 4Q0BA 4RR5A 1ZZFA 4KPYA 1QE1A 1Q5YA 3T6BA 1S0NA 3PX0A 4CO4A 4F26A 5CD4H 3KJVA 4X4VA 2AJ2A 3DRRB 4HKQA 1F2HA 1P6TA 1U24A 2CVIA 5B0GA 1SL1A 3V6HA 1AXQA 3T1AA 2AJQA 1RT7B 4Q44A 1QVGR 3AODA 3T1HJ 1CG2A 4NLWA 4IG0B 9RUBA 1GX6A 1Z2LA 3BQ2A 2OH2A 3NNHA 1RT6A 5IM0B 1QVFR 2H54B 2UXBJ 2RVJA 4AXIA 1RWXB 1IQTA 2VUGA 3B54A 2PE8A 1S0VA 3KLHB 2BRLA 1VQ9S 4PWDB 3R2DJ 2UUBF 1OY6A 1RI7A 1RWVB 2DPIA 4OV6A 1SJ3P 1ZH5A 1U25A 2RQKA 2IY5B 2OPQA 3M8RA 3TAQA 5LXRA 2HNZA 3A8EA 2QA4G 3KNGA 3MDFA 3KK2B 4RW8A 3L9ZA 2Z2ZA 4USVA 2ZHAA 2V2VA 1JJ2R 3DOLA 1WNEA 1HQEA 5ETOA 1N5YA 5K8NA 3LF0A 2LP4A 1BD6A 4UUWA 4CM0A 4IFYB 3R5GA 1IR2A 4LF6F 5I42A 1NH7A 4URSA 4AQYF 2ZVIA 3M9MB 4YR2A 4OYPA 1NJIT 2HWTA 1IKYA 3BSOA 1MU2B 1LNQA 2FVRA 2UXCJ 3W60A 5THWA 4RW6A 2Z4PA 4EZ9A 2X3DA 4Y2CA 2RE1A 3I9V9 3BBBA 3GCXP 5I3UA 1REVA 1YKWA 2W7OA 1R6VA 2IRUA 3TANA 2VQFJ 1VLYA 5AE2A 4C8YA 3GSIA 3FDSA 3H4BA 1LEOA 3CVKA 3TARA 4OQJA 3D3BJ 1HBMA 5F8JA 2XZWA 3IWXA 4F25A 3M05A 1P27B 3TW0A 2JLFA 4Q45A 3R2CJ 4ZIWA 2YWGA 3NS7B 4CLYA 4KGXB 2G2YA 3W9IA 3PJXA 5DG9A 3TR5A 2OSRA 4PWWA 3DDIA 2KVQE 2ZH8A 3WQPA 3OHBA 2V2KA 1Q53A 4LF8F 3D6FB 5F8GA 3ZTPA 2IJFA 2HNYA 3Q0AA 5EWEA 2NREA 5IV3A 2C28A 2L48A 4OYOA 4PUOA 3I6PA 2W8KA 1N5QA 4EZ6A 2J9CA 1NO8A 3P96A 1EETB 4ZLPA 3DU6A 2PMHA 2Y3YA 3ITHA 3HHDA 2VOPA 1HQUB 4GC6A 2FJWA 2BANB 2VA3A 3N6LA 4B3SF 5A2QU 1KR4A 3FSXA 3PRDA 1NRKA 4IRKA 1VBYA 3KNAA 2YY3A 4B08A 4MFBA 2MLXA 3NCPA 4ZVSB 2KDOA 1W26A 3QT8A 4NMLA 3C15A 4HI2A 2HFSA 3BBCA 1BWEA 1YIJS 4OHVA 1K8AT 2YX7A 4JI4J 3DRRA 4ED2A 3LP1B 1C2PA 4PQUB 4CT9A 2CJXB 3OJUA 3M8PB 1C1BB 1EAYC 3R1HA 2F9JA 5EGYA 4V19J 5IM0A 2FHOB 2RRAA 2AGPA 5LSOA 3KLHA 4LFAF 5C42B 2B6AB 1ZS6A 4L3NA 2D3OR 1ZYQA 4JI0J 1LWFB 3MUVP 3ILLA 4DOZA 3ELHA 4HL9A 4YB6A 1X60A 5GADI 2LLZA 1NCLA 2MB0B 3K2YA 3SXLA 4CO2A 2KRRA 3PYEA 5C24B 1HR0F 2GQQA 3KK2A 4ZPTR 4YY3J 3QSIA 1HWLA 5DETA 2AWZA 2CZ4A 3DC2A 1YSJA 4XO0A 2H48B 4EO8A 4Q2MA 3EX7B 2C2RA 3HHLB 3CD0A 3KK3A 2F40A 4BDPA 4I68A 4DPYA 3ETMA 3U1MA 2XEXA 3NBPB 3ILJA 4ECRA 4WFZA 5F41A 2M8DB 3OUYB 1S6QB 2CJAA 4UQGA 2VOOA 5L1IA 1SBRA 1FTRA 4I56A 2V8PA 2R7SA 1N5TA 1PJ6A 1VQOS 1YWXA 1LK7A 4F4WA 4BBYA 1EZZB 4BC7A 2ZJPQ 2F4VF 2DHSA 4JBCA 4ED0A 1CJVB 5D4PA 5HK4A 1KVJA 2B9WA 2E5LF 4RO0A 2RKIA 3KK1B 3VAMA 4TXSA 5D0GA 2G1DA 4MIAA 2XYPB 4OZ1A 4Y2KA 3V5RA 5F3ZA 1Q8BA 1FE4A 4OI1A 2EI5A 2C2OB 2UUWA 1FHTA 5A8RA 2DNLA 5HSPA 3DLJA 1FNMA 3MEKA 3OPKA 5BR8J 1ZM3A 4JUZA 2V69A 3U7JA 1JJ4A 1RCOB 2CKWA 2Z30B 4ANCA 2ILZA 4DSKA 2QLWA 3QGHA 4OZ5A 3A12A 3LPYA 2HVHA 1ITPA 3LGNA 1WDTA 1NKEA 1IM6A 3F73A 5HP1B 3HSGA 5IT9Y 1FRXA 2V8DA 2GJIA 4MIWA 4F2SA 5C5JA 2R2SA 3GLJA 1WF1A 3SDEA 3D1QA 1Q4RA 3LWLA 5GAGU 2XCAA 2F3JA 2D9PA 5B0FA 1VOMA 3LA0A 3EE3A 1XC9A 4FBTA 3IRXB 2DNHA 2XHCA 3DGVA 1HQUA 1XTZA 1TAUA 2XS5A 4LFCJ 4N77A 4C8LA 1SH0A 1R8BA 4P10A 5CABA 4EYIB 1FTCA 1FI4A 2J8AA 3LP0B 3G86A 2VJUA 2KU7A 4EMDA
chains in the Genus database with same CATH topology
1LW0B 1ZTTA 5EUHA 4DFMA 3RR8A 3T3FA 4O3NA 4AYBD 3DGPA 3HVTA 2FHKA 3CIMA 2YVSA 3JTOA 3GG0A 4GMKA 2RT3A 5A0YA 3HJFA 2VV5A 2E5IA 5H9EJ 1PILA 3MTJA 2PI4A 4NLVA 3EXCX 4ID8A 5E2QA 2L3MA 3CCTA 2XMTA 1NK4A 3GIJA 5D4LA 5E3AA 5K5MA 3DMJB 2R4FA 5DRKA 3JAMY 3K59A 4DS5A 3RBEA 3LP1A 1XMQF 3CDAA 2W7PA 2ZH4A 5D3GA 1G2EA 1M5OC 2A1BA 2MQMA 4GO7X 3BGLA 1WEZA 3NLCA 4KBIA 2A18A 2MZQA 2E1RA 2J6TA 4EBCA 3M8PA 4O4GB 2B43A 3EGNA 3EZUA 2YNFB 4I2QB 3KYLA 3C46A 5D6GA 2CPIA 3UW1A 4LQ3A 1OO0B 2EVZA 2MHNA 2RSQA 4U9RA 4RW4B 5AJ3F 1PC5A 2IM1A 3MM6B 2LU2A 4Y2MA 1VC0A 3H98A 5CCMA 1S4FA 3BQ1A 5CCLA 3HT3A 1VFJA 5KFKA 4Y3CA 4LF4F 1L3UA 2YQ3A 2R2UA 2J7UA 1SL0A 1X5TA 2XMVA 5T7LA 1SJFA 5KFIA 4IO9Q 2BVZA 4QIGA 4DV6F 3B4MA 2XULA 1FVQA 2B6AA 2CPYA 5K8PA 1HHTP 5L39A 2O3DA 4NX9A 2HHTA 3VTIA 2LQJA 2J0SD 3ULHA 5FLXY 3V6DA 3GYXB 2VA2A 1JLAB 4JI7F 2UUCF 5I3QA 1R3NA 3Q8PB 3JSYA 4D3HA 1UETA 1OPIA 2C42A 5B0BA 4F4KA 4P2SA 4FBUA 5E33A 3KG0A 4ZPAA 2OD6A 1FE0A 4PG7A 1ZAWA 4K4VA 1HL6A 3CJKB 3W2VB 1YRXA 3KMSA 1Q82T 1D3WA 2VBWA 3QIPA 2X3GA 2HHSA 3MCSA 1NNDA 3KTQA 5CYMA 1R7IA 2VKRA 2E9ZA 1IKXB 1FXRA 2OJ3A 2W4PA 5KG6A 1P9QC 1IBKF 1FD8A 2ASYA 3Q23A 1HYSB 3QO9A 3KHHA 5J2QA 2FLPA 3DOMA 4G1QB 3HVAA 5F8MA 2ASJA 5C24A 1RTDA 4TN2A 3VAIA 1S1TB 4ECTA 4AL7A 1DQAA 1N36F 2UVUA 4IQMA 3NAIA 1ELOA 4PQAA 3C6UA 3UCGA 1LWCB 2DNOA 5AE3A 1JNZB 3P5TL 3C6TB 1P1LA 3KK3B 2XMWA 3I9ZA 4LSLB 5KFVA 4ZVEA 4UOCA 2MKKA 4HEA9 4ED3A 1JXEA 3ISND 3OBIA 1TKZB 1I94F 4CIOA 1KONA 3FFIB 1VHFA 3RTVA 1RTIB 2CQ0A 2D1CA 2DHAA 2ZNYA 2HS0A 2HHWA 2KXNB 4R25A 3MEEB 2NPIA 1T94A 2L08A 4TU9A 1T03A 2DBBA 2CJBA 3MD1A 1O5JA 3NBPA 3TAPA 4J9RA 2DIVA 1TQLA 1JLFA 3OUYA 2DR5A 3BGRA 1S6QA 2KT2A 2MYFA 2VODA 2C2DA 4QPTA 5FD1A 1VMBA 3G6ES 1JNRB 1FDNA 2XNQA 4JYAF 2HLUA 4XK8C 2VFVA 4LIRA 4JI1F 2WTFA 4KHRA 1YJWS 3QGPA 4HDHA 4FF1A 4B3OB 1JLCB 5B7WA 4EGLA 2B56A 3M9NB 1M0SA 2XMMA 1D9FA 1N34F 1LFWA 3JTNA 1N33F 2RKIB 1Y00A 3K58A 2DPJA 1A7GE 2U1AA 1FJ7A 3I0RB 1RTHA 1CLFA 4F67A 1YJTA 1HWUA 2CQHA 2OP5A 3D0IE 3E3XA 2KN4A 3QIDA 1D8YA 4WZMA 2RILA 1R0AB 4RNHA 2N3OA 3MURP 2MMYA 4GKJF 3N0VA 3KK1A 5HBMB 4WFAQ 4OLPA 3JSBA 2W25A 1KQKA 1R27B 2Y1IA 4QBUA 1YI2S 4O44A 3J7ZT 2VFUA 3T19A 5D78A 3IG1A 3DRSB 2N4CA 2GGPB 2F9DA 1AFIA 5AXKA 5IT0A 3MR3A 3BN4A 2R7XA 2FGCA 2PIIA 2DNYA 5A8RB 4CZCA 1VQMS 3IRWP 1RT2B 2CQGA 4ZP6A 1AUDA 1VQNS 3GWCA 1IQZA 3K57A 2DGXA 3K5PA 4Q7AA 1FESA 1H2TZ 4FXVA 4TQRA 5KFAA 3RB3A 2ATLA 1RT4B 3NCQA 4DHVA 4U7UK 3VWSA 3KLGB 4B3RF 3TQ1A 3PFEA 3T5KA 4OJ3A 1GT8A 1Y7PA 2WAQD 2HVIA 2VG6A 3OVSA 4ICLB 2E7WA 2NSCA 4NL5A 1HI0P 3F41A 4BWJA 5KG3A 1QSSA 5A8KB 5AXMA 4Z37A 2FLOA 1X4FA 1NZAA 1JX4A 2KO1A 4NZ6A 1RAJA 1WHWA 4MYUA 3VAGA 3M30B 4OIXA 5I3PA 4ED7A 4NLDA 5HROA 2WCXA 3HX9A 2FUG9 3HK2A 2HG4A 3PKMA 2W9BB 4WFXA 1FKPB 1PC4A 3TX8A 3OL6A 2DCUB 2A10A 3OTOF 3T1YF 4ZOSA 2FDNA 2XMUA 4USJC 1ZAXA 1K73T 2Q6CA 3GV7B 3AQOA 2JC0A 3SDEB 3AH6A 1KTVA 2J9EA 2ZOMA 1KQFB 2BZ2A 1TUVA 2BJDA 4CO5A 2GIQA 4CO0A 4TY8A 1FT8A 1SJ1A 3JB9k 2V4RA 3TA2A 2QA1A 3Q8QB 2CQIA 3IS9B 5BYQA 3KHGA 4OX6A 2OLWA 3ETOA 3AB4B 1TK5A 2X1AA 4MIBA 4OX7A 2BRKA 4IG3A 1KFSA 4KHMA 2AU0A 2BV3A 2QV6A 3ZC4A 5KFCA 5KT5A 1WF0A 5DDRC 1M5PC 1S1VB 4PG8A 3M2VB 1GXUA 4QZVB 3W7BA 4RUHA 2WOMB 3R5CA 4J9QA 4PXBA 1PSDA 2RS2A 1Y5IB 4CQ1A 4M95A 2D41A 2HGLA 3MWBA 4JI8F 3MGJA 5MAOA 4HTJA 2MKIA 5KG5A 5EWFA 2Q1LA 3K5LA 1U47A 2JEGA 4K4UA 2WBRA 3IRXA 4K2XA 5KOWA 5L9NA 4EYHB 2RD5C 4LVOP 3C8YA 2IJNA 2DGWA 4A46A 4OX9F 1S1XA 1XNQF 3J7Z5 3OL8A 2VBXA 2F8MA 1X4GA 1ZAVA 2CQPA 1JLBB 3PR5B 1APSA 2VBYA 2IVFB 3E01A 5J2NA 2YTCA 1TL3A 3KKFA 3DLKB 2WK4A 4ES2A 1DZ5A 5CZXA 2DD8S 5H1SV 4NA1A 3CCLS 4ZCLA 3LP0A 4YR0A 2FVQA 2E5HA 3QJPA 1S9EA 5HMWA 2IMOA 4LSNA 2MXYA 1RT3A 3T1HF 4PG5A 3S6EA 1YQHA 2YNGA 1IR0A 2Z0GA 4EUVA 4ED1A 2MQPA 2N7YA 3RB0A 3HVTB 3G4SS 3DNCA 3Q2SC 1Q7YT 1LW0A 3FQKA 3WC2A 2B7CB 4DL7A 2WRMA 2ACYA 1VK8A 3CTRA 5LXYA 3MXHP 1T3OA 1FVSA 3J7YI 2ASLA 4W92B 3HHLD 2ZOGA 4RLEA 3H4DA 1JKHB 1FDBA 4QIWD 2DH9A 5FJ4A 1HNVB 2ERRA 3JSMB 2DR9A 4X2BA 1NK7A 4JV0A 2DNQA 3DDNA 4DG1B 2ZKTA 3SV4A 2EPIA 4DSJA 3U1LA 3B4DA 2P6TA 4O0IA 3DMJA 3CD7A 5KFRA 3RBDA 1JIHA 1U1QA 4K4ZA 4DFKA 1VQ7S 1B0TA 1Y5NB 3CCUS 4A8MP 3AJ1A 5MLCV 1SI9A 1RKIA 1W2IA 3CJ5A 3MOZA 2IFXA 2HIQA 4O4GA 2MQOA 2DGTA 4Y00A 1Q8LA 2YNFA 4I2QA 5KFYA 5J1PA 2I2YA 3CUNA 5IXUA 5T41A 1HNWF 2CDQA 1U1KA 2OPSB 5T14A 3SMZA 4ZKAA 2FJVA 3MM6A 3CDBA 3IAS9 4IYQA 4TNOA 4ECUA 4B9MA 1O0PA 3THPA 2EG1A 3CD6S 2YKPA 4ELTA 3OVBA 2VH7A 2R8GA 3O2IA 3EPIA 1VQPS 4JI3F 2P5VA 5E3RA 1U1OA 2XMJA 4DL2A 3VQTA 3MAQA 1YJVA 4LT6A 3O6QA 3GZ7A 3N28A 5LSLA 4RNOA 4LVNP 3W2WA 4A47A 1MWZA 5AXLA 5B0EA 3TOQA 4A4JA 1IJEB 2ZFHA 1BQMB 1JXLA 1U2RA 3DHXA 2NR0A 1JMTA 3JTPA 5KFLA 1KSPA 3M8SA 3W2VA 2M5YA 3L3CA 2OAUA 1TK0A 1RTDB 1IKXA 1LK5A 5E0OA 3Q2TC 4ECYA 2FHJA 2MY7A 3PACA 4X65F 4I69A 4QYRA 4C7QA 1HYSA 2NXUA 2GHWA 3C6UB 1NKBA 4ECVA 4X4PA 3N01A 4G1QA 4KSEB 4PXDA 3C66A 4DF8A 1SH3A 2UXCF 4ZVHA 2Y1RI 3SFGA 2LXUA 2XSFA 5FDLB 2E29A 4F3MA 3CXCR 3KHLA 3H20A 4QJVA 2H5EA 1LWCA 1VQLS 3M2UA 1IKVB 4KJIA 5A6PA 2FC8A 2MKCA 2KJVA 4IH5A 1WI8A 2MKSA 5LL6d 2JJ4D 1J5OA 3BO2A 3C6TA 3SSQA 2XGQA 4DV7F 1X9MA 3KOAA 1MROB 2ZH5A 1B0PA 2W7AA 2WSEC 5HMZA 2AQ4A 1FRJA 1SKSA 4DV2F 4OJHA 4YP3A 2HWIA 5DDPC 1YITS 1IM4A 2AX0A 3FFIA 4UQTA 2HHQA 2E5GA 2D9OA 1RTIA 5KFGA 1S0OA 1R89A 3RRHA 3PIOQ 1JLFB 3NMAA 1SJRA 1UL3A 3MEEA 3KLEB 1VQ8S 3VZHA 2VQFF 4IQXA 1KN6A 1HD1A 1C0TB 1KC8T 3H2VE 3PW2A 3A1YG 3QWUA 3TAMB 3US5A 4YMEA 3KLFA 2GFFA 3D28A 3M8QB 1NJYA 3CDWA 1S1UB 3KFWX 4PXEA 4MJKA 2GV1A 4E8UA 3I31A 3GFZA 4R8UB 4LFBF 2MPUA 1WEYA 1HNXF 2RIJA 2YWKA 3D5MA 2CQ4A 4RNMA 2ZBIA 4F4XA 3CJ3A 4A8SA 1JK9B 2XMKA 2I38A 1TZ0A 5KTQA 2O1PA 1U48A 2HRYA 3UR0A 3QLHB 1X4CA 4I0WA 4KGKA 4B3OA 1JLCA 3QJLA 1S6UA 2J6UA 4DR4F 3WX4A 2E7XA 4WKYA 5CA5A 1UVLA 5DQGA 1A9NB 4ECZA 4OI2A 4NRUA 2HNDB 3PX6A 3ZZZA 2EK6A 1QSYA 4RW9B 3TUIC 1WHYA 2NYIA 5KAKA 1RT5A 3M32B 2XLKA 4LMZA 3I0RA 3DLLQ 1N48A 2KG0A 5IQ6A 4O44B 3LP2B 1S9GA 4X4SA 1QAXA 3O44A 3IG1B 1R0AA 2M8HA 3WZ0A 2ZD1B 2CPHA 2J7KA 5HBMA 2R7WA 2V94A 2LQBA 1HW8A 2OTJS 4Y65A 2PSZA 4B02A 3FJ2A 4GC7A 1OQ6A 3GQCA 1F60B 3LW5C 2ZC4A 3IBWA 2ILYA 4YDXA 2M7SA 5L1LA 3DRSA 4HT5A 3J80Y 2GGPA 2ZE2B 2VONA 2DH7A 2KM8C 2R7TA 1RT2A 1M5HA 1TR0A 3CB4A 3VQSA 3G9CA 3MD3A 1U2FA 2ZOFA 4RUCA 4N56A 1RT4A 3DM2B 3O8WA 3Q24A 2RMLA 1X9WA 4YOEA 4IRDA 2JFDA 3KLGA 5HI7A 3T5LA 1RYSA 2QMXA 5CYJA 2IC3B 2EFVA 1AROP 4Q8EA 4ICLA 3M1VA 4HHJA 4ZP9A 1HPZB 2KM8B 2OPPB 2BE2B 2B4VA 2CQCA 1CC8A 3NKYA 3ZZRA 5CXTA 2MGZB 2SXLA 2DHXA 4NLXA 3M30A 3QAEA 2IRXA 4U67Q 2QA4S 1KOHA 2OFHX 5C25B 1Y9OA 3B82A 1YBAA 3FZ2A 2L9WA 5E5NA 2J5AA 2KXHA 3MM8B 3MF5A 1FKPA 2BUNA 3GV8B 5GAEI 4DR2F 4TY8B 2I1RA 1U1LA 2PD1A 1I1GA 4O3PA 2CQBA 3MAHA 4MK8A 2HAIA 3PM9A 3DLBA 1N6QB 4C8ZA 1TVRB 1HMVA 4I7FB 1DTQB 4OZLA 4QOTA 5KG0A 1Q8IA 2M52A 3IS9A 4WF9Q 4OJ1A 3CE8A 4NCBA 3T9ZA 1SV5B 2ROPA 4Y34A 2V5HG 1SB6A 1WWHA 4NLGA 3CDUA 1S1VA 2EBGA 4G1PA 3M2VA 2D3ZA 3CIZA 4AFFA 1T8EA 3SCIE 3GV5B 2WOMA 5DM6Q 3JYTA 3CGIA 3DI6B 1S1XB 4ILRA 1U1RA 1UJ6A 3GILA 5F9LA 2BJEA 1Y5LB 2ADBA 4ES1A 2AJ4A 5JXSA 3H5YA 1KHWA 2MKHA 3CEDA 1FDAA 2BR0A 4JI4F 2C3MA 1RT1A 3KG4A 4C0OC 4B9NA 3AJ2A 1JLBA 4B9LA 4K4XA 4IH6A 1CPZA 2RS8A 2G9OA 4MYTA 3N9UC 4ELVA 2K3KA 2HWHA 1HWKA 4LSNB 1RT3B 5LJ5Y 2FHJD 2YNGB 3PHEA 2A2DA 4PG6A 4K4YA 3G96A 1ZETA 2X1GA 2WW8A 4CTAB 2XWXA 4N8OA 2R7VA 2ALZA 2KT3A 3G8TA 5F9NA 1SIZA 2KG1A 2OFGX 4R0EA 4IR9A 4OZ0A 3WC0A 4XAKA 3NP5A 1NU4A 5D4NA 3BZQA 3FSYA 4TY9A 2AJ0A 2GCFA 3MM5A 2CPXA 2XSJB 3ENVA 2AX1A 4OHXA 5GVQA 2W24A 3FQLA 4ALZA 4E98A 3IGNA 4F4ZA 4TKTA 3R5DA 3Q22A 4RBTA 3PW5A 2CQ2A 2DGOA 3I5BA 2DNNA 2KKHA 2NS1B 4J9OA 2J0QD 5F8HA 3PO4A 5G0RB 4A8YA 5EN1A 1JKHA 2K7KA 2OIHA 2A2CA 1HNVA 1FKAF 5KFBA 3HKZD 4ILLA 2EWHA 2LKZA 1XMBA 3JSMA 1Q81T 2LMIA 4FN5A 5KFZA 4DG1A 3FEZA 1X4DA 3K8VA 4I4BA 1FEEA 5K14B 1UVNA 2KHDA 4NLSA 4A8XA 2BACA 2RH3A 2FJEB 4C8NA 4JI0F 2J0XA 5F3TA 4YDDB 4NRTA 1V6HA 2XY7A 2E5JA 5AXNA 3PRBA 2G13A </