4JP8A

Crystal structure of pro-f17h/s324a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKHNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Increase in activation rate of Pro-Tk-subtilisin by a single nonpolar-to-polar amino acid substitution at the hydrophobic core of the propeptide domain
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 128
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4jp8A01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4jp8A02
1GTJ1 4K8RA 1T1IA 2W2NA 1R64A 2PWAA 2PKCA 3BX1A 3H42B 1SVNA 3DDZX 1PTKA 2E1PA 5AVKA 1C9JA 3VV3A 3UNXA 2HD4A 1JEAA 4J94A 1YJCA 4KG7A 1WMEA 1S2NA 1WVMA 2V8BA 3P5BP 3I37X 5AQEA 2ID4A 1TM5E 1UBNA 3VHQA 1T1GA 1GTG1 1GNSA 3GT3A 3DYBA 4DWWA 1Y3CE 3BPSA 2W2QP 3DVQX 4K8RB 2TECE 1V6CA 4M1ZA 3LPAA 2XTJA 1YJAA 2SECE 2DUJA 3LPCA 3AFGA 1TO1E 1TECE 5CW1A 4KB5A 1SELA 1Y3FE 1EGQA 2SICE 1S01A 3D43A 3A3OA 1R6VA 3AJ9A 1V5IA 1GA4A 1PFGA 3DE7X 5JMOA 4FONA 1WMFA 2HPZA 3DVRX 1GA6A 3ZXYA 1AU9A 4LVNA 1AH2A 1DUIA 5SICE 2WWTA 3PRKE 2G4VA 1Y4DE 1GTL1 4DZTA 3DE6X 2WUVA 3GCWP 3HJRA 4NMXB 1TMGE 3LPDA 3PTLA 1Y9ZA 1OYOA 5AVJA 3SQOA 3BGOP 4DJ5X 3Q5GA 5JXIA 2W2OA 2W2NP 1NDQA 3DW3X 1C3LA 1KE1A 3A3OB 3I34X 1AVTA 2IXTA 3TI9A 1T1EA 3TECE 1V5IB 4AKTA 3QMPA 2Z30B 1GNVA 1THMA 3A3NA 1PEKE 4GI3A 1LW6E 1VSBA 1IC6A 4B5LA 2PQ2A 1SCBA 2X8JA 2Z58A 1KDVA 2Z2ZA 1NLUA 2Z56A 3GCXA 1ITPA 5JXHA 1GCIA 2IY9A 5FFNA 3T41A 3I2YX 2ZWOA 1CSEE 2Z2YA 1SBNE 4OV6A 1EA7A 5ARBA 3EDYA 1TM3E 3QFHA 5FAXA 1P8JA 3BPSP 2SNIE 2PRKA 5JXJA 2B6NA 2W2PA 1AQNA 2XTJP 2Z57A 3BGOS 3OSZA 1AK9A 4WOBA 1Y48E 1P7VA 3LXUX 2W2QA 3A3NB 4HX2A 3EE6A 1YU6A 3F7OA 4LVOA 1SUCA 2QTWA 3SICE 1BJRE 2Z58B 2X8JB 2Z56B 1SPBP 1SBTA 1TK2A 4KPGA 1SUEA 3DW1X 4I0WB 1Y33E 4H6XA 4C3VA 1SCAA 3VYVA 3Q40A 1SN7A 3F49S 1BE8A 4OV6B 1TM1E 1SUBA 3WQBA 3DE4X 5FBZA 4NE9A 2WV7A 3DE5X 1KE2A 1Y4AE 4H6WA 2P4EA 3CNQP 1Q5PA 2W2MA 4OMCA 1SIUA 3SQOP 2Z57B 4CG0A 2PMWA 1SCDA 1SBHA 4ZARA 1ST2A 1WSDA 1R0RE 4YN3A 3GT4A 3WIVA 1TO2E 3I30X 1ST3A 1TM4E 1Y1KE 3QTLA 2QTWB 1Y3BE 3A3PA 3F7MA 5ARCA 1AF4A 1C9MA 1PJ8A 1ZVJA 1YJBA 3AJ8A 5ARDA 2DP4E 5B1EA 4JP8A 3GCXP 1SPBS 1S02A 3CO0P 1SUPA 3DE3X 1TM7E 3D9QX 1P7WA 1SBIA 4CFZA 1MPTA 5B1DA 1BH6A 2SBTA 2ID8A 2ZRQA 1KDZA 1A2QA 1GT91 1NDUA 2PMWB 1SIBE 1GA1A 4HVLA 3VTAA 4H6VA 1WMDA 3P5BA 4Z2AA 5K7SA 4YN3B 2W2PP 3CNQS 1SCJA 4AKSA 1SIOA 3VV2A 1MEEA 1CNMA 4NE7A 3DVSX 1BE6A 1ZVKA 2PWBA 3A3PB 4NMXA 3VSBA 1SH7A 2ST1A 4CFYA 3DE2X 5I9SA 4BWGA 1C9NA 5JXGA 1AV7A 2ZWPA 1BFKA 3DE1X 1OT5A 3H42A 1SBCA 1Y3DE 4WOCA 4C3UA 2Z2YB 2Z30A 4NE9C 1BFUA 3EIFA 4ZOQI 3WIUA 3CO0S 3L1KA 1SUDA 1OYVA 2PYZA 1HT3A 1XF1A 2DQKA 3WHIA 2WUWE 1IAVA 1Y34E 3DWEX 2W2MP 2GKOA 1KDYA 3TI7A 1SCJB 4OMDA 1DBIA 1SUAA 3VV2B 2Z2XA 1SCNE 4MZDA 3GCWA 3ZXXA 2W2OP 3DE0X 4RYDA 2XRMA 5AMXA
chains in the Genus database with same CATH superfamily
2HNYB 3PSAA 1EUQA 2OD2A 4NLOA 4JI3F 2EVWX 4FKBA 3LXRA 4MW9A 3D0QA 1OGYA 1DAKA 3WGOA 5M29A 3QQCD 4ES2A 1T0UA 2QTVB 1U7PA 2V7WA 3G59A 2TRSB 1WM1A 1NASA 1YIOA 5BW4A 2REBA 3BIXA 3OUZA 1E6VA 2HD4A 4BGEA 1X8DA 5IUNC 4HDSB 4Q9NA 4AYTA 3OLZA 4OHFA 3NGLA 1IM4A 1FUEA 5HFAA 1I7QB 2O06A 1N36F 4USTA 1FU4A 3RYFB 1QUEA 1V8PA 3PPXA 2X7IA 1H8ED 4X66F 1ITZA 3V8PA 3G8AA 2WE7A 4HNTA 2OLKA 3IKMB 3AY3A 4J03A 4N7BA 4E15A 4JKYA 4FVMA 4X94A 5LJ5Y 2JBAB 1RQNA 2WYIA 2PFDA 4WCEQ 1JB1A 2YJ4A 3I8OA 4D42A 1IJFA 4R1UA 3OKPA 3Q8XB 4IS2A 3CEMA 2Q6VA 4HN9A 3RGIA 3SXUB 4EA8A 3STXA 2IM0A 2Y0BB 3BDPA 4WF9Q 5AJZA 1NVBA 3HZRA 5CFRA 2WK4A 4OL9A 3BCUA 2YC2C 4R8VA 2FW9A 1T5IA 4BGDA 4YPVA 3U27A 2H4XA 3OM0A 1JKJB 1FLDA 5HJYA 4URWR 4CDIA 1LH0A 4UM7A 2BFDA 3RARA 1ETUA 2FPXA 3FKQA 4IUYA 4KKXB 2QMWA 3ZHXA 2RC5A 3F9RA 1DTEA 4LF6F 3LUDA 3TB6A 1OB2A 2IX9A 4TMXA 2FWMX 2D3OR 3N6MA 4NIMA 4RUAA 2HCJB 4KO0A 2MZSA 4EFNA 9LDBA 3L4EA 4JA2A 3NHMA 2GPBA 3NWOA 3VO9A 2B82A 5DBEX 1JDBB 3DBLA 2PD4A 2XG8A 1EDDA 3M6AA 5C81A 1FE0A 4N5NA 4KYIB 1CR1A 5JW6A 3BMNB 3HUDA 5CDGA 1LWFA 4B6EA 4KIJA 2GO8A 2AR0A 3C16A 1D09A 1QJHA 3DOKA 3KLFA 1CY4A 4DSLA 1HT2E 1JU3A 3B1WA 3C8UA 1ONPA 4IXWA 3MLEA 3THYA 4L73A 3SJUA 3KJNA 1RRFA 2H4YA 3GIDA 2C57A 2OCGA 3ABIA 3QRQA 2RBGA 4JUZA 2I1QA 3NPAA 2I03A 3L4BC 3A12A 3AYZB 4ZVRB 1SO8A 2CLFB 3E2MA 3IMEA 2F1FA 1M90T 2C58A 3K4PA 4WNAB 1IBRA 4QIWD 2IYYA 1IM5A 3QEJA 2JVOA 1IKVA 3LRXA 1W581 2PUAA 3E70C 2VJCA 4QASA 3E22B 1XPRA 4J4TA 2FVPA 5HO4A 1S6PB 1UIRA 1DL5A 1LPPA 3NOCA 4Y9SA 4WX2B 3F71A 2GN9A 2FVXA 4GWKA 4F0KA 4TXMA 2JGJA 4GKAA 4UBOA 3IE0A 3RV4A 1SXPA 1N4DA 3SAJA 1KDTA 2PSEA 1ZA1B 1VJTA 1QANA 3D8UA 4FQ5A 3ZNNA 3OT1B 4ANEA 1N3LA 3H0KA 2EARA 4X1KA 3GL9A 3K70B 3CLTD 1W2IA 1B74A 3VHXB 1EETA 1E6WA 1FXLA 2DNPA 1D9DA 4CKCA 4DR4J 4DMGA 4WASA 2YBEA 3FWYA 3L09A 1JSRA 3KC2A 1OXUA 1NDUA 2XMZA 4YS2A 1G6KA 2D0OB 4F25A 2Q62A 2DGVA 2BAGA 3VV2A 3P5SA 5CM9C 2VHGA 4UVGA 2CL7X 2H2FA 4K59A 2MQNA 1BWSA 4BGVA 4GRIA 2IDMA 2VNIA 2CMKA 2A8YA 3UUEA 3ULKA 2J59A 4U3JB 4LRBA 5J1NA 4DPUA 4HTFB 4C4RA 2Q2WA 1EXVA 2G0CA 4Y2IA 4YECA 2PSZA 3MJSA 4QXAA 1OGIA 1YS9A 4NX9A 4TWBA 5FV7A 2FSIA 1T35A 6FD1A 5HCUA 3EARA 5AHOA 1CEZA 1QHSA 1DZ5A 5F2NA 1OAAA 5D0EA 3LDUA 3V8BA 4BNNA 3PQ5A 5CH3A 5KPDA 3A6KA 4OYWA 4ZJLA 2XLKA 2VOPA 3RW7A 3WJ7A 3JQFC 4EITA 3L7AA 1G4UR 4DJJA 3IAM1 1K8XB 1QS0B 5JHGB 4GKKB 4R01A 1GEHA 4EPRA 3FZBA 4B71A 4Q3OA 1DBPA 3TYXA 3I92A 2LVWA 3GJ0A 2QTLA 1R0LA 4D5GA 2V2ZA 1LQTA 4QDTA 2QQ5A 4QU0A 1V9OA 1QRSA 2O01C 1W26A 3PJWA 4QNNA 1N2CE 2WK1A 2FZ5A 2VYCA 1JAZA 4HUQB 4NEGA 4NEZA 1ZMXA 5E2QA 5D4PA 1XZNA 4PYIA 1E4YA 4X4OA 4RIIA 4MGIR 4JQYA 1LA2A 4YP5A 2X4IA 1YJAA 3H8JA 4IUDS 1FXSA 2C97A 2VUUA 3RI3A 1DEHA 4AJEA 2VQDA 4FXVA 2V58A 4DOMA 4YFYA 4LMBA 3KZKA 3QPAA 5DGXA 1RYRA 3VPXA 3KEQA 2CC2A 4KPYA 2M88A 3RUCA 4UXIA 1GDTA 4BWJA 3UD4P 3BMOB 1YUMA 3PEJA 4YR2A 4YHHB 4XDCA 4MKIA 3GRKA 1GG9A 4UVIA 1C7ZA 3GONA 2CFCA 4NMXB 3AR4A 2OV6A 1DAOA 4MQBA 5B3LA 4LFBB 4MQFB 2F4FA 1I01A 1CUWA 1XLVA 2PU5A 2AMFA 2FE4A 3E84A 1EX8A 2W2NP 4Q8FA 1IEWA 1T0HB 1PGNA 1JEDA 3S40A 4LY0A 1X7ZB 2XZOA 3UVJA 1NP7A 2X0KA 3DG9A 1LBHA 3MBIA 4C87A 3AOGA 3KLMX 1WHYA 1OS5A 4JJ8A 2APJA 1GNPA 2WT8A 2JDJA 3DB1A 1CEEA 1NQXA 4F4WA 3MCMA 4YRBA 2IVYA 4GPTA 3D3QA 1SXJC 5IT4A 4U2KA 3R09A 2OGWA 4ROTA 3GEBA 4U2DA 3FCAA 5LYJA 3E81A 2QLXA 1IQ0A 4Q3LA 1YACA 2KW5A 5BYRA 1FZTA 1RB0A 1KAGA 3FPAA 4EBBA 2PR2A 3CT4A 3DEZA 4BTLA 1IKYB 3EEQA 1DIAA 1LU9A 2M9KA 1U0GA 1UWBA 2Y92A 3ZTRA 1ZN8A 1H74A 1B14A 1TA4A 3KR2A 1H2EA 4DA9A 2EX0A 1K7CA 7ABPA 2V7TA 4RLEA 2NLOA 4X54A 3WHPA 3D54D 1RWMA 2ODPA 3KPJA 3L82B 3E3LA 1L8LA 1VLYA 5B4TA 1VE5A 1D1QA 2FPSA 4YUWA 3WKBA 5FTMA 2E1AA 3ADAC 4GH5A 4DB2A 1D2AA 4RD3A 1U47A 4N5SA 3M4NA 3TKYA 4QWEA 1GNTA 5CYMA 1UMBA 1Y1KE 4ZN6A 1Y3BE 4M9CA 1G5QA 1JAYA 5DG7A 1AQUA 3MWYW 4GECA 2BYCA 1EB8A 2GM4A 4FCWA 2IPAB 1T9HA 1OTXA 2LU1A 1AQLA 1G21B 3HFVA 5KDLA 3RRMA 2SKEA 2MYNA 3A8JA 3WP0A 2HR1A 4TVSA 1TVCA 4F4YA 2D1CA 3SSAA 1A9XB 2AEFA 1EQAA 2DFTA 2LQ5A 4B6PA 1DAPA 2DXEA 3EK2A 4MRVA 1Y8CA 3AVPA 3WDOA 1Z5VA 2XMBA 3CNQS 3RTDA 3MOJB 3P45B 3C70A 3RBXA 3EODA 3PNYA 5EJFA 1F2UB 3LNCA 2QT9A 5IV3A 1UEXC 3GUZA 5U9CA 3OQNA 4D9FA 3OLBA 4GPBA 4H4KC 5HCIA 1DTQB 4KXQA 4ZVPA 4KGXB 1OT5A 1XDDA 5DTMA 3VAZA 1Y3DE 2QG9A 5JO0A 1GPYA 4FFLA 5GY7A 3BWXA 1K6EA 4KN9S 4K2XA 1RTIA 3JZMA 4TL6A 3NBXX 3FRHA 2V55B 1Z5UA 3WGYA 4GP7A 1KEKA 2QJFA 3BZUA 1SBZA 1KI4A 1AA9A 1NA5A 2R751 4Z49A 2BCGY 5LKAA 4MVWA 4B4WA 3UKOA 2E9SA 1GTZA 1FU8A 3SOZA 4RAOA 1QTNA 3BHNA 1A8IA 2X1HA 2WU8A 4C2BA 4CLRA 4KGZB 1UXGA 1DCFA 1JMYA 3BIFA 4RESA 2JK1A 2FPPB 1XCOA 2Y71A 1R64A 1LTQA 1P4SA 1PDVA 4O4HB 4NXNF 1C9DB 1K6MA 4PYOA 2KG1A 4YJ2B 3EMVA 2REOA 4JAVC 4MWZA 1VBKA 5EWJB 1FRNA 1LWOA 4UOFA 4LWPA 1Y7PA 4Q15A 1HNNA 3D3JA 1IRIA 2J45A 4TQAA 2R7LA 3BEGB 3MIIA 3T5PA 2ZIVB 2RK4A 3L3BA 3OLYA 1QBGA 5A8WB 1XHLA 4KLCA 1C1CB 2IZ5A 1PFQA 1LB1B 1IY0A 3PX6A 4EY5A 3M6MD 4QJ5A 3RW9A 3T9NA 3W34A 4K7QA 3LDAA 3EWAA 2N4DA 1FTNA 3FGZA 1E20A 1XJWA 1KPHA 1I9CA 2ZAIA 4QULA 4GXNA 1HQUB 3E51A 4EMUA 1TF5A 3QGIA 2PGAA 3O2IA 2IIPA 1BC5A 1RXVA 1DZIA 4EJSC 1MU2B 4C5CA 3J7A1 3BQMB 1GQ2A 3CVWA 3G9XA 3G5LA 3LSYA 4WWHA 3N2NA 4QZVB 3OR1B 3G6VA 1CY6A 1NW4A 2X7HA 1RQ0A 3I6ZA 2IPMA 2DRAA 3TX2A 1HNZB 3CONA 1H6BA 5KKAA 2PO5A 1WXEA 3FPCA 5JEDA 5D78A 5HTKA 5JCJA 3KETA 4QYTA 1WU8A 4USMA 4TZKA 5EEGA 3VAYA 3Q10A 3Q5GA 1KC8T 2HFUA 2FK8A 3PHGA 2I2FA 3AU8A 2ONKA 3I34X 3NGXA 2QNRA 1AVTA 4ZV9A 2ORVA 4KQ2A 3CXRA 3NALA 5DB4A 2R4FA 1DRVA 2PUWA 1SL0A 4XAKA 1G3UA 1QVVA 2CK3A 1Z63A 4ADSG 4KVZA 3TA1A 2QMEA 2JGDA 4RJ2A 3GNSA 5JARA 1KLNA 4H3SA 2WAXA 4MUJA 3BXFA 3NC4A 1AKTA 4BE4A 4EEZA 4WZMA 3R23A 1IOLA 3WY9A 1GR0A 3HJTA 1KR2A 1N9GB 3GGPA 2XWQA 1R6DA 4K6CA 3ETJA 5JOQA 5ILGA 4JL6A 5DNAA 1FDAA 1HNIA 5GAGU 4ZYLA 1WHWA 2A9KA 3DPIA 3KZ1E 4BHQA 4HAIA 3FRYA 1EK0A 3WC0A 2PH3A 4YP0A 4ZVLA 2OZKA 4F72A 4CO3A 3QLTA 4I1PA 1BMFD 1VBMA 3CDWA 1B7GO 4Y7CA 2H2DA 3CZ9A 1Z38A 3F8WA 3IVRA 3NEAA 4BZPA 4XQGA 4EL5A 2BFOA 5BSUA 3U4GA 4XQCA 1SUEA 4D1YA 2UUAJ 2VWPA 3FNHA 5I7RA 4HCJA 3HNRA 1T2UA 3ANTA 3NAHA 2CPIA 5JAHA 3DLCA 4LIPD 2Z83A 4EGSA 4Y1GA 3PS9A 3D2CA 3MR3A 2ZTVA 2Y8WA 4HWGA 2IPOB 2I2WA 4NL5A 2B35A 4LHVA 3C3YA 3I58A 2XTNA 4LOAA 2HRTA 3MB8A 1ST2A 2WJJA 3FDJA 2G76A 1HT1E 4LQCA 4NAUA 4KDRA 2QZZA 4CDGA 3IEKA 5HMXA 4UPEA 1JYFA 3DZJA 4LXIA 1OJ4A 1NPKA 3A1VA 2ZTMA 4WVLA 3A4IA 2IRYA 2TMGA 1LY1A 3L7KA 5PNTA 3SZOA 3W9HA 1RWKB 4TV9B 5AFSA 4X1YA 1A9NB 1VGVA 4PQAA 3AEZA 2EI5A 1U7HA 3CC4S 4MAFA 1KH3A 1N32F 4LQ4A 5K8VA 3TZXA 2EHDA 3UR0A 1R8QA 4DLEA 2PM8A 3X1LB 1MVOA 1JG2A 4TVBA 4ILMA 5FBHA 3DLGA 5IFKA 3M2VA 4WMLA 4QWDA 4B3HA 4KXWA 2HQDA 3DMNA 5DSXA 1G5PA 4R1QA 1FTRA 5COAA 4RNCA 2AFVA 5AUOB 2JFDA 4EGJA 5LM7E 1H4SA 3T3HA 2HURA 4BNYA 1WZUA 3BGVA 3N2YA 2A94A 1K4MA 2EK6A 4TTIA 1DC3A 2OCAA 4NBRA 2IT1A 1KOLA 3UQYS 2DISA 1AKWA 3TLYA 3N87A 1PYSB 4QBGB 1V7CA 3KCNA 3VU9B 1CS0A 4RZHA 4OBXA 3ZXXA 4IDFA 4LSZA 3L7BA 5M2RA 2R3SA 1STOA 3LWMA 4L15A 5CR9A 1Y8RA 2WWYA 1GUBA 3SQGA 4B7AA 3P71T 1OH5A 5KYXB 3RS8A 1DBWA 1J0CA 3CJQA 2YWCA 4ICIA 5TMPA 3V9AA 1CW2B 4PIPA 1XF9A 1PTKA 1XZLA 5J2TB 3UHFA 2WNSA 4IVPA 3ZE0B 1NMSA 1IH8A 4ZDWA 4J94A 3OUYB 4AFNA 4UDYX 5DE3A 5ULLA 4Q0BB 4Q21A 1H0SA 1O6XA 1YWXA 5C8XA 3O73A 4DDFA 4K9RA 1U3DA 5KQSA 4F3YA 1ISPA 1NN1A 1GNSA 3QY0A 3IEUA 3ZZRA 4CEHA 4ANFA 2C2BA 3HVHA 3IEXA 3WB9A 2XRYA 1HBOB 2E21A 4NDAA 3ZIAA 2HWKA 4QVKA 5L6LB 3W2HA 3G2OA 3TZHA 5A4KA 2ZRKA 5CPBA 2PR7A 1NOKA 4Q2LA 5KWSA 1U1NA 3IQXA 4I5IA 5GJWC 4G2TA 1URRA 3WOHA 1HE4A 2CW5A 4HQOA 1E3EA 2OD9A 4JI5J 1FX0B 2HMAA 1AZSA 2O5DA 2BKPA 2AZ1A 4NASA 2PEHA 2CJWB 1JLFB 5LA6B 2EG1A 2NSHA 1SVUA 4LRXA 1X9WA 1PUXA 1WCV1 3DLBA 4XJVA 2AT1B 3S5UA 1JBEA 1GKIA 2RHRA 2YNHB 3PC8A 1K44A 2QGFA 2ZJPQ 2V7QA 3EXEB 2QZ8A 4EVRA 1SC1B 4RABA 3W5JA 1E3DA 1JT9A 3QFFA 1X7WB 4QXRA 3SU8A 5CFMA 5FUXA 2DNLA 1CDOA 1UFVA 3NNSA 3OHBA 1NVGA 2Z30B 2XY6A 5M2QA 1SHKA 1RR6A 4LF4F 2F8HA 3MMNA 4X4NA 4DGSA 4YJFB 2OMOA 2XHEA 1HHQA 2KJQA 4D92A 1YT5A 2V8PA 4DV6B 1YB2A 2O1EA 4B5KA 4WLEA 1PD0A 4IZHA 4IDBA 1AA1B 1H22A 3I2YX 1H1LB 2VPWB 2FJPA 2J48A 1ACJA 4F50A 3IJPA 2LXIA 5CDSA 4C2MA 1T9YA 1J9GA 2J5AA 1UBTS 2ZJYA 3K9HA 2R7OA 1DSSG 4B9UA 2PH1A 2IU6A 3RAGA 4V19J 1VBZA 1P91A 2XCPA 3W5VA 1E63A 1KEPA 4J90A 4PZAA 4U2EA 1J20A 4KT0C 3MUFA 1XRQA 5ETMA 3KO8A 5B2EA 4A4JA 1NBME 3QUSA 3IVMA 1XVTA 2JFVA 2UU9F 2ZR7A 3FTNA 2QEXS 1Z0IA 4OB8A 1YFKA 3FPKA 5FUWA 3RYCB 3N2LA 4BAUA 2NXUA 2OV2A 1G16A 1S10A 2ZBPA 4A48A 1SC3A 2GESA 2XOKD 2HVDA 4E6PA 3MZ0A 1XMQJ 3PC4A 3TXXA 5FUVA 3A7DA 1DY3A 5IUKC 3IELA 4UNQA 1P1FA 1JL3A 1VE6A 4Q4AB 3EPKA 4F02A 5CCXA 3OTOF 1L5QA 4FWIB 3NS7B 2YNIB 4QYIB 3ZDFA 2MYTA 5H70A 1ADYA 3TQHA 2YR0A 4L07A 5KBYA 4PYDA 5JJCA 3SJZA 3GRRA 3CPHA 5TC4A 4DSZA 1VIMA 2Y68A 1YRLA 1RI1A 4TPKA 2AR7A 4YS6A 4AI6A 5K0GA 1RXWA 2PJZA 1R8AA 1KJIA 3M1AA 3GJTB 1B7FA 3OSNA 5K8OA 1UKBA 4DR7B 1Q7LB 1CQIA 5CW2A 5I42A 4MPDA 1OC4A 4MI9A 4FWTA 3GX1A 1TGYA 1PJLA 1GRRA 5CA0F 2DHRA 4DILA 1SUIA 2V69A 2LCIA 3OTEA 3KKLA 2B7BA 1DXHA 2BRKA 5IKXA 4I56A 4QIGA 5CVDA 2ZFHA 3AETA 1RHQB 3AFMA 3TOQA 5IQ6A 1KKMA 1CLUA 4ED6A 4G8DA 1XZQA 4M1KA 4DV4J 2IDLA 4HAUA 4II7A 3SF0A 1RLJA 1P0PA 3DE0X 3ZU2A 2AKEA 3EICA 3CJ0A 5AMXA 4Y0NA 1GCUA 2ZDPA 4RVGA 2Y2VA 2G1PA 4Z51A 3RIEA 1UIMA 5AW7A 4N56A 1VQ1A 4H4EA 2QW0X 1O0PA 5B3JA 3AB4B 1A4RA 4EELA 1CNEA 1ZINA 5D5HA 1MAAA 2A1BA 4E2XA 1N92A 5E3RA 4KYVA 4ZOBA 2DGOA 5E41A 4TKVA 4DZRA 3MM7B 1DLOA 2FSSA 1GUFA 4MS4A 2GMJA 3ETNA 2BJVA 2ORIA 1CE8B 3K94A 3OOJA 4WA8A 1S79A 4PXYA 4ZI7B 5AQEA 2Q3JA 2V4ZA 3K16A 4A9AA 3BJZA 2IUFA 1I4WA 8ABPA 1VCTA 1DWPA 2NO9A 4YIKA 5IEJA 4BVHA 2QX8A 3G6YA 3PRDA 3LC0A 3MPUA 1JB9A 4CTNA 2H65A 1D0EA 2Y6UA 3O3OB 5F76A 4I19A 1YDMA 4LE2A 2MKJA 3C4QA 1OH6A 4IQGA 5J40A 3IC5A 5HJXA 1RTDB 1RT7A 1L3UA 3JAMA 1KLMA 3GRFA 3BN3A 1BW9A 4N5LA 5K0NA 4P38A 4FONA 2EQAA 2O48X 4FF1A 3I8SA 4FYVB 1H42A 3Q15C 3L0CA 5FNVA 1HA1A 3ROGA 2VA9A 1IYZA 4LRCA 2RCNA 4A8OA 3JPWA 2NACA 4PX2A 2ADMA 2BKUA 1GTL1 1N5MA 4MB2A 3HA3A 1MZVA 1XMOJ 1HMPA 5FOSA 4X90A 1SQGA 3PM9A 3BCHA 3ZW9A 1Y6QA 4BBZA 2I8LA 2ZIXA 3UOWA 3PNQA 2CADA 4IEEA 3RS5A 3T5TA 2IV2X 1ZVMA 1JKFA 2FLWA 1ZY2A 4GI3A 4DLTA 2HFZA 2OG1A 4G1UC 5CNKA 3MMCA 4RMJA 1K88A 4YUYA 1EGVB 4DCJB 3BGIA 3R5AA 4ED4A 3WGQA 3GJQB 1VI5A 2P3SA 3L7YA 1EP3B 3UAVA 4LDNA 3TBFA 2WVFA 2VDPB 2OV3A 4H35A 5CT8A 3INRA 1VCIA 4JFRA 1P6XA 2C4MA 2NV0A 3I0NA 3NCTA 2FFJA 1U26A 2Q3FA 1Y6JA 2B6NA 3NVMB 2QIPA 3AQIA 3IL2A 4AIIA 3VTFA 1JHYA 5D3KA 4X8OA 2AJQA 2X41A 3BEOA 4F97A 2CFTA 3KPVA 5K9ZA 2WU1A 2C54A 1VE3A 4JSTA 2CLLB 4KRFA 3D3CJ 4F84A 2CQIA 1EARA 1N2CB 4RXTA 1TK2A 1WD5A 4EWTA 4NLRA 1OX6A 1NJZA 1SCAA 5I7SA 1G19A 1QE5A 2Y77A 1JDBC 3QFWA 2WYWA 4NARA 2YVKA 4N5DA 3CISA 3CW2C 1PYOA 4RFLA 4JI0J 2ZAGA 1VL1A 4I4BA 5A5GA 3G8BA 3A4NA 1U1OA 2FD2A 3SSQA 3GXOA 1BAPA 5JVGQ 2I7CA 4ZA1A 5I7AA 1CQXA 4ARBA 3IAS6 4JVLA 2WHOA 2VV5A 1BWEA 4JBLA 2GI4A 2IVFB 1SOMA 1Z6PA 1OPIA 1VHLA 3F4KA 2D8MA 4XLTA 4PHTA 3V34A 4FR0A 3PDHA 2VAXA 2KFYA 1XZDA 1UZNA 3ZVNA 4DS5A 1NQVA 1OBCA 3V00A 1B15A 1M6VB 3K71B 1AXGA 4CIYA 3FWKA 4L5YA 4IQMA 2R7KA 3V4IB 4TLEA 4C2UA 4C0KA 2GEBA 1XMIA 3S8EA 4O4JA 3G2MA 1A98A 2OQIA 1ZM4A 3MD1A 1LDYA 3HV0A 2CLEB 4Q34A 1AIPA 4CTOA 3WV5A 4RVFA 1ZVKA 3JVVA 3X3UA 1CUHA 3KLNA 1Q5VA 3I01A 4MI3A 2BLNA 3DD1A 2DNOA 4ETNA 1BQMA 2VHUA 4ZJPA 4OL8A 1U0SA 3K31A 5AO9A 3WSTA 3ZDYB 1KP9A 4D9CA 4D99A 1A8PA 4L9RA 4WBXC 1OY6A 3NMAA 1ZL0A 5AW1A 1U1EA 3K70C 5A5VA 2VFAA 3PXGa 3Q6NA 4N40A 4OYRA 1GDDA 3R0XA 3S4YA 3S8YA 1YBAA 4PWZA 4IR9A 3W5XA 5IAJA 1KP6A 1VE7A 1JDPA 3ET4A 5TS2A 2YKMA 4YUZA 6LDHA 2IYIA 1TYAE 1OY8A 1Z0AA 4D26A 2ROEA 1OXMA 5ALNA 1SJ9A 3IAS1 2I8AA 3THXB 1W5SA 3O3LA 2AK3A 2LECA 5C8ZA 7AT1A 2JL1A 4FXDA 3YASA 2CVOA 4ID9A 1DTTA 1SV5A 1RZUA 4OJTA 4LRQA 1FRIA 4OP3A 4W98A 5LSOA 5JRZA 4FF3A 3KK0A 3EB9A 2DQZA 1W76A 5I7OA 2E1PA 2XA1A 2EBFX 4M5DB 4IOAQ 4OI3A 3BQNB 3LQVA 3FPSA 3BMCA 3SC2A 1T6ZA 1U7DA 5ALKA 1JWBB 4B44A 2C31A 1U9IC 1QRRA 4LXUA 3AR3A 4WK0B 3CRRA 4TVKA 1Z56C 1R27A 1I7LA 5JTTA 3TN7A 3TD2A 5FOQA 2AL7A 4UUWA 3OH8A 2HF2A 2I22A 1YOBA 4MB6A 2JKYA 3BJMA 2II6A 2I4OA 3FRZA 4WTYA 1B6SA 3D3WA 4C0JA 4WXEA 1CY0A 4HH3C 1R9GA 3QIPA 1LX7A 2Y0EA 2IM1A 4WXMA 2M70A 1WHTA 5DHPA 2PZJA 4LDQA 4C4WA 5K3CA 1QGUA 4Y67A 4MUGA 4EUKA 2GT1A 3KYJB 4NATA 4BO3A 2V6IA 4LF9B 1SKAA 2HSEB 3IP5A 2LVBA 1PD1A 3RBZA 2BM9A 4D46A 3FUUA 1Q1EA 4PPGA 2Q29A 3FCOA 2WUVA 2ZH8A 2Q5JA 5H59A 4D8XA 1Q0HA 3SYNA 2OPQB 2Q9UA 5KSPA 2AQKA 1HXHA 3EFHA 3C74A 121PA 2A9FA 4H3VA 3ZQKA 4F46A 1GPKA 4R2WA 1ZAWA 2NPFA 2G0JA 2JH9A 2ECFA 3CLUD 3JVUA 3TTTA 3AT1B 1MBZA 4O3MA 1CP2A 2AD9A 1ZA2A 2YXNA 4ECUA 2ZRDA 3NOXA 2Q46A 3QMPA 5CIQA 4Y2RA 1KY4A 5DLFA 3FBWA 4MGKR 4ZU1X 1QTQA 1WEXA 1DKPA 5HIJA 3NX4A 5HQ3B 4XGRA 3UMGA 2LDBA 4RW8B 4O3QA 2GZ3A 2XAAA 4J6EA 5LQSA 3AOCA 5G4KA 1N0WA 2QN6A 2PKYX 2ECQA 2YXEA 2XDWA 3IP8A 5EMKA 1PYTA 3Q9UA 2P9ZA 3PNIA 4OQDA 3D6HB 2G9VA 3EJWA 3OWXA 1OX5A 3AR7A 2ZXFA 4DA4A 1HM5A 1LJUA 4E5KA 4LX8A 2QOEA 4NAHA 5LUBA 2CG4A 5I51A 1GMVA 1T9DA 4JLKA 2XR1A 1WHVA 1RT3B 4QOEA 3Q8LA 3NHKA 2K2PA 1TQLA 1Y5IA 3U1TA 2GXSA 4RMIA 1MLAA 5D15A 1X9IA 1BGXT 3H4BA 4K88A 1PKXA 4ENWA 4MDEA 1U8WA 3ZHUA 1VHTA 3RG2A 3RUAA 5HQMA 3IEIA 2XSJB 3MSXA 4C4XA 2XMUA 1JHDA 4OUDA 3A1CA 4OJQA 1ZRHA 3V7UA 5HN0A 3A58B 2J7PA 4KC5A 3K0AB 1NSFA 4A8KA 1C0UB 1HOXA 5DRKA 4RVUA 3M6VA 1BQ4A 1HFWA 2H7YA 3PRYA 5FBRB 4RCZA 3THSA 1C9EA 1I80A 1CJMA 1OGJA 4ZDJA 4ATNA 3CJ2A 4FVTA 2UYQA 3RVKA 3GLUA 3FOFC 3LQ4A 1ACMB 1TAUA 2QORA 3GJ5A 1G5FA 4NA1A 4DSEA 1YWGO 3I1YA 4NLDA 1UH5A 2MB0B 2FW6A 3LCRA 3ZNQA 4LXGA 5JZ9A 1QMPA 4QWAA 3BYZA 4BLQA 3T34A 3LTNC 2W2PP 6NULA 1NUEA 4AJLA 3IALA 5AXLA 2ARKA 5TPWA 2QO3A 4JNCA 4JUDX 2XLJA 3K5HA 4URUR 3Q3VA 3FX2A 1H93A 2YNFA 3UWKA 4E32A 1BS1A 3DFZA 2RAUA 1QBKC 2B4TO 4PCQA 2ZSDA 5AOBA 2WD9A 2IDJA 1WXGA 3M6IA 5AKXA 3DMPA 4TMFA 4QNRA 3T61A 4GX5A 3A10A 4X93A 4CMIA 2FF7A 1XLUA 3TJRA 5KTQA 4KITB 1I6JA 3K6KA 5H3HA 1SCUB 4OAPA 3H2KA 4FFBB 1EX6A 5DBIA 4G37A 1K0VA 3EIWA 3M9XA 5L7TA 3HXMA 1U9CA 1D1SA 1PQUA 3E3AA 1WV0A 1N2ZA 3ABQB 2P0EA 2R1TA 4S24A 1XCLA 4TZ0A 1FKOA 1RFLA 5I7UA 3CHYA 5F3RA 1K6JA 1T0PA 4KQKA 4YJHA 4MDFA 1C1XB 5FPHA 2JKVA 5KFPA 3C3CA 1TL7B 1J7KA 4LA4A 1N2EA 3GGCA 1T05B 3T9FA 5KSWB 1X4FA 4B3MB 2HMSA 3PUJA 5MAOA 4IV0A 2HF9A 2MMYA 2PIIA 2NS1B 2JARA 3NC1C 3P0HA 5A6SA 4ZCPA 4IVNA 5G0RA 2FHPA 2R5WA 1N5YA 3M2UB 1TIPA 1EM8A 2VXBA 3OM9A 1F5SA 1S5PA 2ZQYA 3QQPA 3ENQA 1UPXA 2CLDX 2B83A 1MO4A 1D0IA 4F38A 3S2UA 4LFCF 3LT2A 2YVLA 5I48A 2ZT5A 1WZEA 1XZBA 2V0CA 3TM4A 4UHHA 5JISA 3F56A 4L6CA 4H1UA 3BS4A 3TVTA 1G8GA 4BQQA 4BMOB 3CPSA 3NAZA 3NS6A 4KV8A 2ECKA 1TUGB 3GMSA 3QATA 1LWEB 2WYUA 3Q2SC 1CC1S 3DV0A 3U0BA 4DMUB 1FC0A 2A1IA 2G72A 3L04A 1KVJA 1I4LD 4IH5A 2NZYA 3H0EA 5EMLA 3UG7A 3C4JA 1U1MA 3EXG2 3GUVA 5AXBA 3VAHA 1N6NA 3ODGA 4RVOA 4GO7X 4CLWA 3G1UA 4C8OA 4KW7A 4BIIA 3NAMA 3MQ2A 3KYCA 4F6RA 2CL6X 3UJ6A 4IRXA 1IHOA 3GLIB 3EUAA 1JVBA 2GBFA 5JXIA 1OTHA 4I6EA 1FBNA 5FDFA 1NN3A 3CIMA 2RFLA 1RLUA 4PSDA 2HW3A 4HUTA 2IXTA 5CG1A 4AQYJ 3DCAA 2FEMA 2VJOA 3PD7A 4DHWA 2NYAA 4O4LB 1QO9A 1K5HA 4JNKA 3IRXA 3ZY2A 1D4OA 2ZKUA 3DDHA 4S04A 2AHOB 1IBLF 1XNRJ 4I2QA 3VDQA 4KHMA 1UW4A 1JYEA 2D5AA 4BQIA 1ECCA 3HXTA 5AKHA 4KLZA 5KB3A 3I5BA 5DDRC 4UHDA 2OC9A 2EW2A 4BN0A 1LVHA 4IH6A 5B7QA 4OYHA 2VEDA 3LFUA 3R44A 1MC1A 5IJ9B 3JQDA 2O0LA 3VSCA 2X1AA 5F23A 5G40A 3TGLA 4DCOB 4P84A 2AYEA 3EE6A 4QL3A 5C4MA 3IV7A 3JTEA 4G0WA 1PR0A 1HD1A 3NDIA 4OGLA 3VWSA 1MVLA 3JZDA 4IZOA 5CVEA 5HQ8A 1PNTA 1CUSA 1YQDA 3MS7A 1CJVB 1EJ0A 4K4ZA 1LNQA 2LIVA 3E3NA 3R1IA 3W9YA 1M8PA 3M4JA 4K50A 3KMSA 3UOAB 3HCWA 3K92A 1UZDA 1KOHA 1G60A 3WBZA 1K8YB 2Z1DA 1M6NA 3SE7A 2NAPA 4KJXA 1JLLB 3VR4H 4JWKA 3TCNA 1MX5A 1FA0A 3SLKA 4TWIA 4P0QB 3EA5A 3LUKA 4BWMA 4KLAA 5E3IA 3WNBA 5BQXA 4AG3A 2Q3EA 5CDYA 1JH9A 1ZG3A 1L4BA 2H16A 3R7AA 4G1MB 3GFZA 4DQXA 2FVRA 5C5IA 4Q18A 2J7KA 3FW1A 2OV1A 2BOPA 5HRCA 5T4EA 4YBZA 1C9MA 5J5VA 2X0FA 3TEMA 3JZIA 3UK6A 1X3LA 2QDKA 1DARA 3I4LA 1P5FA 3OA0A 4Y3UA 4INZA 3ZE2B 4OQLA 1KKLA 1KOJA 4OHBA 1UMKA 3Q4GA 1VFNA 1WMBA 4YCSA 4MGEA 2MY8A 1XTUA 2DXIA 1V26A 3A25A 2XPCA 2FG6C 3K05A 4MJKA 1Y0BA 1UJMA 1GOTA 2PV7A 4DRXA 3HD2A 1JLSA 3FFAA 4CLTA 4DIFA 5IM0B 2E18A 4ZP7A 1KR4A 3QYAA 1BMQA 1YJTA 2W8BB 3CIFA 4TRNA 5AK5A 3PEYA 5C42A 4HAWA 3NCRA 4RW7B 4JWTA 1S89A 2D4HA 2WONB 1C9NA 1Z0FA 3R5DA 1O54A 4FSXA 5DX1A 3KZVA 4LY9A 4JD5A 1KAEA 3H4MA 1HYQA 4CL8A 4ZYZA 2I3AA 4OG2A 5C0OE 4HDOB 3FLBA 3KAQA 3CCRS 3OHMA 2N75A 4CHTA 2VKTA 4S3MA 4ITVA 5DCYA 2P3LA 4OOEA 1HW9A 1O95D 1SK9A 2XT9A 1N48A 4J0CA 4DPKA 2GHVC 3EIQA 3OBBA 4DFJA 1PBUA 1M33A 2VJUA 5D87A 3O8LA 2GJ8A 1TQ2A 2YV2A 4OMUA 3KHTA 3IULA 1YMVA 4ND8A 5GJVC 3W6ZA 4PSCA 2V8VA 2H3HA 3ASVA 5BRAA 3KZMA 3BE8A 1V6SA 3ER9A 1ZOPA 4AUEA 4B3OA 3I39X 4GOLD 3I4FA 1YIJS 2RRBA 1JHUA 2CXOA 4G4GA 4PZUA 4I1SA 4C3LA 1P4HA 2Y1IA 3FNFA 4FU0A 2EZ4A 2J41A 2Z4TA 3PFCA 5K2OA 5GQSA 5TF4A 1ZVVA 2LQJA 1AZLA 3WLFA 3AUFA 2IP2A 2WFZA 3O3CA 3QU9A 1YRWA 4R84A 3JS5A 4HDGA 1MO3A 3H0CA 3L7OA 4AMGA 3VR6A 4EF6A 1C1DA 2CDAA 2B1JA 1AMOA 1QH1A 4AY2A 3D4IA 1IB6A 4DUZB 4Z86A 3W5HA 3GO4A 4JEMA 1V8FA 1L4KA 1U11A 1SUSA 1GQEA 4ZREA 1M5OC 3BBFA 1OF1A 1IN1A 3RZAA 1RFGE 3C7DB 2Q1TA 1R0CB 2N3OA 4O4IF 3G2JA 1K68A 4AY4A 1U8SA 3KEGA 4J9OA 1GUAA 5FOUA 2QX7A 3T9ZA 1ZK2A 1AS3A 3I8XA 3SBXA 1JB0C 4RS4A 4G26A 4BNGA 5KFSA 4F7VA 4R0EA 5B0EA 2ZH4A 1KL7A 4H0CA 1OWLA 3WO0A 2P77A 3DM9B 3IDFA 5IKOA 2ZUFA 3WB1A 5I3CA 1L9KA 4HB4A 2O3QA 4QEDA 3NI2A 1C0KA 2RBEA 2WLSA 4C0BA 3LPEA 1KZ9A 1TZBA 3DQZA 4WINA 3UENA 4D82A 2IH4A 1LSUA 1TUVA 2AN9A 5E3JA 3LWLA 1IJEA 4WCFB 5JJLA 2PQ2A 3R3WA 1Q50A 3L7UA 5FI5A 1E7QA 2JLYA 5F4ZA 2CL5A 4QJBA 5EAIA 1OTYA 2HQRA 3AM3A 4LJ5A 4KWCA 4OJGA 3ORRA 5F3ZA 2YS6A 1WETA 2B69A 1Z62A 1ULSA 3HMQA 1JEJA 2QWXA 1XB2A 1BGWA 2WFLB 3NYIA 1AQNA 1RZRD 4IDKB 4NYIQ 2GAOA 1T13A 4FBTA 5G3ZA 1FNXH 2EJVA 1R6XA 5J1SB 4E11A 4K3UA 4F8EA 4MIOA 4HC4A 2K1RA 3SS7X 5TEWA 4BN4A 3ZNOA 2DETA 1G42A 2QTGA 4M49A 4XGNA 1YONA 3LGXA 2DR3A 3LBAA 1IN6A 1REGX 4UE6A 5K1ZA 3WAKA 4I64A 1COWD 3OAAD 3DU6A 2HA0A 2WMNB 2YWEA 2IPLA 5IT9Y 2PEYA 2QVBA 1U9YA 2V6FA 3GYGA 3HUTA 2UAGA 5HJEA 2QL9A 1W44A 4IEIA 5J2UF 1F9EB 3M32A 2VT2A 4ME6A 2N47A 3DRXA 3MTGA 1B6TA 1FNDA 2PCLA 1G8HA 5CPFA 3RPEA 4KH1A 3NHUA 3KPYA 1ST3A 2CNDA 3V2GA 4L8VA 2MPUA 3HFSA 2BI7A 1CSJA 4UMFA 4XM1A 2FIUA 1IATA 2C4NA 3ENZA 3R7NB 4LGVA 3GQVA 5GJBA 3LV8A 2QBYA 4DBLE 4E1VA 4KQXA 4KGDA 3JYPA 1G2QA 4BV9A 4JELA 2BFEB 3QKTA 5HHTA 1H3FA 2B43A 3MFYA 3NFYA 1LEOA 4RKYA 2GO7A 3ADCA 4XVCA 1OD6A 3MS2A 3V7FA 5DT2A 3D5QA 5EZ5A 4K5RA 4IILA 1BX3A 1EHYA 3EY4A 1PKUA 2E82A 2EQBA 5HW0A 3C6YA 3LBHA 1E0DA 1WP4A 3MWJA 2XODA 2J9DE 3AR2A 1XD9A 3DLLQ 3KYDA 5IOLA 1QIDA 4C7OB 3CIZA 1DKUA 2GPAA 3GN1A 4BQEA 3IFEA 1T3NA 3OJLA 5JDCA 2JGIA 1Q0RA 1Y80A 4DV2F 4B9EA 5JAMA 1L1EA 1JQBA 4F3TA 4P36A 3H1FA 2ZQ5A 3QVKA 4E5DA 3TW8B 1KQPA 5BUSA 5E9QA 1YVUA 2H9IA 1M7GA 2PZAA 2P6TA 1APBA 3HKEA 4FGUA 4F11A 3WSVA 3HVWA 3H5UA 3PHJA 2P6MA 4H18A 2QTMA 1SHUX 3AY0A 4POAA 4ALLA 2QF7A 5KNCH 2B98A 2C2HA 2RAPA 5EPOA 1FDWA 3QFRA 2DG2A 4TROA 4EI7A 2R11A 4I6WA 3LPNA 5DM0A 1M2OB 2DR2A 4FINA 3TGWA 3BSOA 1JF8A 1K7EB 3IDSA 3ZLTA 4LRFA 1TAGA 5JS6A 1K9VF 2RH4A 1U48A 2G1JA 4V1CB 4IFVB 3HXKA 1YJCA 5EA2A 3PBKA 2QN9A 4HLDA 2XHZA 3FDFA 3HCNA 1LWCA 4LHZA 1CUGA 5EHGA 3UKDA 1JDVA 2DCUB 3FCEA 4EO8A 4R8MA 3BH6A 4JC4A 2OI2A 2M3DA 1T4CA 1G9SA 2DUJA 2XQVA 2AZXA 8ATCB 3I04M 4HAVA 2J0QD 3OOEA 3E7XA 1YR6A 3O4HA 3OQOA 3LCUA 2XWPA 1GGMA 1VJ1A 3ZHZA 5HZKA 1E2BA 4DCSA 3DRRA 3Q8SB 5CCDA 2ZI5A 1Z6ZA 1KJNA 1LV7A 2V1XA 1TA9A 3U81A 5ALMA 2FB9A 4M4SA 4TYWA 4DOZA 2HHQA 2PT6A 1UJ4A 4JEIA 2C7OA 1Y4DE 1W36D 3CBGA 1Z68A 3KSDO 2IYSA 3HDYA 2BDTA 3IH5A 1WUKS 1U6BA 1T9CA 1UFRA 3AB2B 4KU4A 1UDBA 1GCAA 4URHA 4F60A 2OK7A 5FTKA 1RU1A 4QU8A 3DFEA 5AJHA 4AJIA 1HZZC 4EJ0A 1IUKA 2NO6A 2JCGA 2HDHA 4ND6A 1M1NA 3INGA 1Z0JA 4IO0A 3FLAA 2J9GA 3FEXB 1U65A 3AKYA 1OPXA 5LKRA 1SCBA 1Z34A 4P7GA 1WS6A 5KJEA 4ALMA 1NN0A 1O6CA 5AI4A 5LMZA 5BN1A 1S59A 5CCLA 1S1WA 2W8KA 2OXIA 1R18A 3RFFA 2AJ1A 4YQYA 2PO4A 3ZU3A 4HR7A 1E4EB 3D9BA 2C82A 5CIWA 3DMTC 1S7CA 1FA9A 4K0KJ 1Q15A 1P8JA 2U2FA 2XBLA 3AP1A 2XTJP 1VMAA 4J9RA 4K40A 3ROKA 3MCTA 1CYEA 2JD2A 1WW2A 4CM4B 2I2XB 1VYUA 3LFTA 1YQGA 5AUPB 2V0GA 3HR4A 2P6SA 5IEBA 2O2HA 3RVQA 4CLYA 3ZZNA 3GJRA 5LQRA 4J1TC 4BNZA 3W9IA 2EL7A 3QKSB 1TUBB 4RK6A 3QLEA 3MGAA 4NE9A 2F8SA 4AQ7A 2VUGA 1FDNA 2OPRB 2QUJA 1VQOS 5EP2A 4R1LA 3GNTA 1KBOA 3OT9A 1P4RA 1NK9A 3GJYA 4XSHA 1V4VA 4GUAA 2ATCA 4PFSA 1MXFA 1ZFNA 3BGRB 3M5CA 1KNXA 5SYAA 3FTEA 2P0AA 4QICA 4P58A 1SXIA 5BJRA 4MUHA 4GKJJ 1KYZA 1JKHA 1J25A 1LLDA 2PD3A 3AM4A 1TGVA 2ZPUA 4FEEA 4RVSA 1P1HA 2KTQA 3D0GE 3J81Y 2JAHA 3D9QX 3O8QA 2H54A 1UQRA 4PO8A 1HFJA 3FZEA 1EAYC 2M5YA 3JQ6A 4B73A 3S27A 4NLSA 6ABPA 2FUG6 4HT3B 2D06A 1T15A 4GPEA 2QLJB 1UFWA 9LDTA 2CE7A 1YUBA 2GCEA 1Q22A 1VECA 2UVPB 3MPOA 2D2EA 3H83A 2ZZNA 3HVRA 4J0IA 2PX2A 3MCNA 2Q5LA 2AGVA 4AJPA 4BX3A 1BEEA 3QPCA 1NPRA 1ZBQA 2FXIA 4JGGA 2NU8B 1ZGCA 1ID1A 4IKPA 5EJEA 1MA3A 4DF4A 3ACCA 4OI4A 2WJWA 3K9QO 3O9VA 1FU7A 5CFOA 3KFVA 1E69A 4NZNA 1FYXA 5IASA 1J8YF 1K2WA 1JLGB 3RK1A 3G0OA 1YOVA 5A4DA 2ZR9A 1TCVA 3DGEC 1JHRA 1E3MA 5DTQA 4OQZA 2ZH3A 4TNOA 2C2YA 2A30A 3KXPA 4GRAA 3W5DA 3TB4A 1X87A 1L7RA 3W5IA 4KPUA 2JLQA 3HBJA 1B1AA 4PQRA 2WF5A 2R8HA 3KD3A 2ZPTX 3NBUA 2DQYA 2WBLC 4ZT2A 2ZBIA 2VQFF 1N8TA 2PT9A 3UA3A 2H1SA 1H8HA 4HDHA 1CUVA 2NYHA 2F3PA 4XFDA 1FFHA 3B2QA 1PSWA 3HG7A 5CYQB 1NXOA 4RAQA 5TJHA 1FHTA 5F64A 3UF0A 2X7XA 2FUG1 3KK2A 3WLPA 3QMQA 2Z09A 4RPFA 3BSFA 3NTRA 2CZ9A 5L3QA 1WOPA 1UZMA 2RGNA 2XGMA 3R8XA 2HN9A 3QV1A 3U3KA 1E3JA 4B3TB 1RVDA 3STYA 2LDIA 3HB7A 2SECE 3TX0A 2GEKA 4DI6A 1DE0A 1RWNA 3A6EA 1AUDA 1JLAB 5A5FA 1NCLA 4OB6A 1ZGGA 4S1PA 3WWDA 5JTUA 2P27A 4BFCA 1NTRA 4YCBA 1ENYA 3Q2TC 2WWTA 3PRKE 2B2NA 1OYYA 2JAXA 2Q3HA 5A7HA 4K28A 1OV6A 1JR6A 1ZCAA 1TKZA 5KOHA 3IR7A 4BKQA 2QTHA 1LZLA 2CAJA 1S0MA 1A8SA 4DV3J 2AZMA 5LUAA 2QXTA 2C77A 4QJ4A 1FTQA 2NP6A 4F04A 3ZVKA 5AM2A 1EU1A 4DV7B 2G36A 2PK3A 3RTCA 1SI9A 3DXYA 1WBBA 3MM4A 4FYMA 2YIMA 2W4CA 2GNKA 3PHBE 4DFDA 4JI1B 1KDVA 2H3EB 1EZ1A 1OASA 2WJAA 4BFXA 4HFNA 4OYBA 3WK8A 1K1EA 1IQRA 4JKOA 1N5RA 3IUSA 1GMUA 3LTOA 2W2XA 3WLAA 2Z2YA 4ZKAA 4LWQA 2YQ4A 4OQXA 1Y8ZA 3RS0A 2XMSA 1DQ8A 4LIRA 4O0LA 2ZYTX 4IDCA 1XD8A 1X7YB 2FUNB 2FR1A 2MINB 5IANA 4B80A 4NCNA 3FSEA 1XXLA 2BCEA 3BIWA 1XSEA 3S2EA 1PGPA 4KMRA 4QRIA 3VYWA 3DONA 1ZI8A 5IDVA 1EIYB 1YDFA 3GIKA 2ORYA 4EI2A 1V5GA 3W90A 1YS7A 4NZOA 4OHOA 3MAAB 1QIJA 3GLIE 2GB4A 1QV7A 2D3O1 4OQPA 3GRYA 4U67Q 1EX1A 1NVMB 3D7KA 3Q11A 5FBZA 4XAQA 4QEZA 2MU1A 1DJPA 2Q1XA 1U0FA 3UJ8A 4KGMA 3BM5A 1SCDA 2XMMA 3ZHVA 1G5HA 1EE2A 4UTRA 5CXSA 4BU0A 2VH5R 3DFMA 1JJ4A 4DCPA 3Q8UA 4MIAA 1RKVA 2AMLA 4U6SA 2HM7A 3VDMA 4FCTA 4PQFA 2P2NA 3ZDEA 1QNLA 2HSJA 3AP3A 2RAFA 5EY5B 5K6RA 3IQWA 2QE7A 1FRJA 3SC6A 5HJ2A 3KUEA 3P32A 4X65B 3LL7A 4UBNA 2CNBA 2RHTA 3PQFA 4OOFA 4PLYA 3VQTA 3TE6A 5CJJA 4ARSA 1ZJZA 1YC5A 3OPVA 2QM8A 4Z1MA 3B9PA 3G2NA 4TKLA 1WO8A 3UAXA 2H00A 1L4LA 4UD2A 4BO9A 2PEBA 3GI1A 3LPLA 3T06B 1HQYE 4RIFA 4LKOA 3UEOA 3GU0A 2VI5A 3DVSX 3T5AA 1WNFA 5HUHA 1GJRA 3U7QA 3NCQA 4Q43A 1HFKA 4PGGA 4RD1A 1T4DA 1YFLA 3PTWA 2FDNA 3P19A 5IMBA 1ZQ1A 1PR1A 2XIQA 3OSPA 3JYLA 1VQ9S 4BO4A 3EOAI 3WOVA 1K6XA 3NLCA 1NM5A 2Q7DA 3HB9A 4XCXA 1G1AA 4QUBA 2BMVA 1SHZA 3MWEB 2MDAA 2HK2A 2C9CA 2WSSD 4ZTUB 1H9BA 1CUAA 2VC2B 4EG4A 3EZ6A 2YBDA 1E2MA 1XTRA 2XS5A 1ADBA 1FNBA 2UUCJ 3EPRA 3NMRA 3VJLA 4IJVA 3CR3C 4XIYA 4C07A 6PFKA 2N7CA 1RAFA 5HEKA 5AXMA 1GXSB 4MHOA 2CCKA 1IWOA 2Y9PB 4X92A 1L4MA 3KK3B 3TLCA 4LI0A 4ZAFA 4DG1B 1NVVQ 1QUPA 2F4NA 3V81A 3A6JA 1Q3TA 1LW0A 4ZOAA 2FJVA 3EBLA 4C48A 2NUTB 2FX3A 1Q8LA 3QBTA 4JBGA 4LBWA 1OFTA 4JLVA 4I4NA 4XWGA 2WF7A 5EE9A 1RWVA 1S9GA 1VE9A 5KFJA 1I3LA 3K0HA 3DYBA 3H1EA 1M1ZA 2GEJA 3R7DA 3WZ2A 3GILA 4N39A 4M1ZA 4D5EA 3D5TA 4MWBA 3KZOA 2DHEA 2DRBA 2UXDJ 3VH2A 3MGJA 4TGLA 4JUCA 3BBPA 2B4OA 5IYZB 1TL7C 4U7WA 1JQKA 3E35A 4X64J 4DLWA 3CVOA 4REMA 2CJXB 4CM9D 1EH5A 4JK3A 4LOJA 4YWJA 2O8VA 5C8YA 3TNDA 2R3VA 2R66A 4F9TA 2Q66A 5AVVA 1EFPB 1RJWA 4NX2A 4TQSA 5CJPA 4ZIVA 2QL7A 4BWFB 4X2BA 3G6ES 3V8QA 4QHSA 1AKNA 3AUUA 3LOQA 2A5JA 5CD4H 4U8HA 2YZGA 4NCKA 1V5IB 5L51A 3JQRA 1QG4A 1M0WA 3D0IE 1QDEA 3HCXA 2FEPA 1WOYA 4KAJA 3MA0A 2I4TA 2N1MA 5JQGA 3VHRA 1AHNA 5K01A 3VVTA 5JRDS 2KYRA 3KLEA 3KTQA 5BOSA 3RSCA 3CZMA 3JQCA 3IAM9 2LBPA 2OLEA 5CHEA 2BMBA 5JSZB 1HNWF 5A9SA 1KZHA 5K5EA 1DXOA 3J80Y 2PUTA 4KMOA 3NBPB 4O3OA 4FNHA 4U00A 1JTEA 2HIHA 3BC1A 1DAGA 4W6ZA 3JRWA 4R1NA 4NBLA 3VSDA 4UT4A 4FLMA 3PE4A 2ZQZA 5FIUA 5AVRA 3V7WA 2QZPA 1HR0F 2VC1A 3MTAA 1JNXX 2W22A 3TQEA 5JAQA 1I7NA 4LJ4A 1EFLA 2DR8A 3VR4D 2EBWA 3TK1A 2FWPA 2DGDA 2DCMA 1B0ZA 1WC5A 4I0WB 2PLRA 1HDOA 3PEWA 1T0IA 2VUIB 2HZCA 2C7PA 3PZPA 3HMJG 4MDYA 1PJ6A 3CF4G 3VR3D 1J0EA 1NPDA 2REXB 4C0OC 4CKBA 3S5JA 1GSOA 3ZCUA 2JZNA 4KL8S 2XB2A 1VJDA 2IYOA 1MIOB 2XITA 5IWAJ 2QRVA 3MEEA 1ZOIA 2EEZA 2JRCA 2XQGA 3I6YA 2HNBA 2MKYA 1R0YA 3UK2A 5HANA 3W7BA 3QU5A 4CLFA 1U9JA 1K08A 1R8YA 2QZJA 3ESAA 1F5CA 1Y1RA 2B5JB 4XGKA 4ZC8A 3CMQA 3DN9A 1CJVC 4YMUA 4KWIA 2VQ6A 3UKJA 5MN4A 3MHPA 4QAJA 1YQUA 5BPFA 3U31A 3FLEA 4XRGA 2IPNA 4EY6A 2HQBA 3ROPA 3R9IA 4F0MA 1QG2A 3U4QA 3IR6B 4L74A 1U2EA 3ME5A 4XD2A 4AS1A 1GXTA 4ZD6A 3JR7A 2XZLA 3EQ7A 1RYMA 4JITA 2H06A 5K20A 4GD3Q 2ODWA 3C7KA 3RU9A 3CTPA 2K3IA 1XAJA 2R7UA 1J2UA 2A5GA 4C7MA 1S48A 1R31A 3IBCB 1YASA 5DP2A 1T9AA 3PW4A 2R62A 3OFGA 3L8ZA 2NXWA 4WZBA 3A9SA 3BRWA 2FOXA 5LOVF 1G0NA 5GAEI 3ZK7A 4E13A 5JCPA 3PL1A 3T7AA 2ZSIA 2FCRA 5KOJB 1H05A 4DUYF 5CNJA 2QI9F 2ZD1B 2IM3A 1UR5A 3QEBZ 1R0BA 3QZUA 2RH9B 3PA6A 2OHJA 2CBGA 4GOND 1LQ2A 4U4AA 5HE9A 4N8OA 3UK0A 2VCHA 2WHYA 4X62F 1TL1A 2Q8PA 3VUEA 3M9MB 1KSHA 2YWXA 2J3KA 4EYSA 2KJWA 4OLPA 3PUZA 4FYIA 3VPAA 5FUQA 4XVRA 2Z08A 3J7AC 4JI7J 1QJCA 2HVZA 2WT9A 3ZHOA 4YAWA 3V2UC 2PMFA 1QO7A 2VTEA 3OQPA 5LC1A 3L0YA 2X5JO 4XD7D 2EPIA 1P0MA 4D8WA 2UUBB 1KMQA 2Q2VA 4RTPA 1QGED 3SM3A 1X1TA 2OZPA 2ROQA 1HDGO 2ZYWX 1ZOLA 4H1WA 1VKOA 5FEUA 2HA5A 1AKVA 1CQZA 1NYRA 3N1UA 2XNJA 1RVV1 4UM8B 2GRJA 4M37A 5CBPA 1PC4A 5CA1A 3SHQA 2RAQA 5D3MA 3RTEA 3I6IA 1VRTB 1G38A 3PFOA 4KUGA 4AT1A 2D74B 2AOTA 3FMVA 3KE8A 1UBLS 4J75A 1SIWA 4YMWA 4IWYA 2O2EA 3B3JA 4AUMA 2G4BA 4DEVA 2BXJA 1IWAA 1ND6A 1P61B 4XIFA 1HYEA 2RQKA 2ZJZA 4RSRA 2W2KA 3DWFA 4R5HA 5LQAA 3VVMA 2HX1A 1DJQA 3Q9SA 1BJKA 2WWWA 3T6JA 3KG0A 3GELA 1K4KA 3P26A 2Q9AA 1V9LA 4PFJA 1VMDA 1SXJD 2QV0A 3RJTA 4C3MA 4V39A 3WKCA 3TL3A 3RHSA 2OGTA 5GM1A 3ADPA 1VRUB 1VJCA 1HNXB 4UTOA 4RHUA 1YQHA 3MD9A 2YHUA 2I6TA 1J5EJ 1X42A 1OLSA 1E3IA 4RV9A 2ID7A 3FKSD 2DO4A 1HE3A 3U3XA 3A2KA 1L2TA 1Y1LA 3UT5B 2AZ4A 2MKCA 3KHUA 2ASJA 1NUPA 1FDIA 3UMVA 3L0BA 3OP1A 5DBFA 2ZCVA 3OVAA 7FD1A 5JVDB 3H04A 3A8KA 1N7HA 5ETJA 2PBFA 3OT5A 4RW0A 5JI3E 3QNUA 3BJYA 4TLBA 2Z56B 9ATCA 3ASYA 5GM2A 2C2ZB 4WCFC 3E1SA 4P3KA 1NMEA 1NNLA 4DL7A 4DUGA 3IUQA 3S7TA 2J67A 4WP3A 3T1NA 2VF7A 2OP5A 3AXSA 4KE6A 1F06A 2V65A 4FW8A 3D1OA 1S2MA 4OHMA 1XWFA 1F5NA 5HL7Q 1FS6A 3TTUA 1TFWA 5ICEA 2WMOB 4QTUB 4LZWA 3WL7A 2KYXA 3P9XA 4Y0FA 1XCGB 2IYVA 4RQAA 3K8OE 2YW9A 3S0JA 3HADA 2V9WA 4X63A 4FT4A 5HIAA 1I3OB 2J31A 2Q8NA 4RGYA 2ZHBA 1WC4A 2QTWB 4F0JA 1JXLA 2O8FB 4TLDA 1FX1A 2HT1A 1BQ3A 5LDHA 3T7KA 5C5JA 3PYMA 4ZAVA 4JI6J 4E2YA 3UVEA 1EWRA 3I23A 10MHA 3V97A 2UUWA 5JLJA 3AEUB 2DOKA 3KJVA 4LFAJ 1MPTA 4EFLA 3SEZA 2PMCA 2FRDA 3BT7A 2BKOA 5B1DA 2JATA 1JPUA 5DBGA 4PANA 1KDZA 4OQQA 4ZDIA 3CZQA 1MO5A 4YCJA 2MWMA 2CVHA 1KJYA 1WMDA 4X1IB 4CKXA 1OFUA 4U39A 4HLCA 4CO2A 4CL2A 4R5PB 1PFYA 1DG1G 3RYHB 3RD5A 1DWOA 4MINA 4JYAF 2ST1A 3RYIA 3CUEF 3NTUA 2YN4A 5K5MA 2VAMA 4LDZA 4UHCA 2VDLB 5KNCD 1P7ZA 5HS6A 3ZBTA 3E3MA 1QK3A 1HEIA 3G8SA 3WMWA 4UTPA 3DWIA 4QNMA 1Q1GA 4TKMA 2HMTA 2K7FA 2JGMA 4BLTA 1ZJJA 3NEPX 1OYVA 2V7BA 3M8RA 2Z2XA 1X6VA 4YT5A 5KMGB 1RYSA 1T2AA 3K2IA 4PQGA 4HTJA 4A91A 1BXKA 2C3UA 3CE8A 3OJSA 1AMNA 3D4BA 4BNDB 3TPFA 4JZYA 1EFRA 3IGVA 3JQAB 3O5TB 4EK9A 5IJWA 4CCYA 3BBCA 2OCPA 4MHSA 2C9DA 4MROA 3N2GB 4GS5A 4Z4IA 1W9HA 3G2LA 2WM8A 3QELA 1V1MA 4C6TA 2JEFA 2GKGA 3A13A 4FDTA 1T8TA 4BNWA 1I36A 3PJFA 3QHQA 1TP7A 4WY2A 2V8OA 3STUA 3UT6A 4LG1A 3MJDA 1K1QA 5F41A 3PI7A 3OX2A 3TIFA 3O21A 1ZS9A 5E4YA 4EKIA 1BQXA 1O51A 1R4AA 2HMWA 4RUBA 5LIPA 3ROZA 4PYNA 1S6UA 3WRYA 4G6ZA 1M1HA 3D4PA 1UT5A 4WKYA 2ZJ5A 2NU7B 3U61B 3OZAA 4M9ZA 2ZRNA 4MEAA 4TV8F 3I0RA 1PR4A 3AWIA 5HGJA 2V6GA 2FSGA 1RRGA 1IU9A 3AJ9A 3PIPQ 5KFUA 1H65A 1GT8A 4AJ1A 2OK8A 1TA0A 4O2AA 5KNBA 4FYWA 3GJ6A 5LB4A 1MV8A 1PZXA 5F3WB 4QOTA 1BVHA 4DG5A 4YB5A 4BBYA 3FJYA 1OJ7A 2HSDA 3UC5A 3I83A 4TYMA 4I6GA 3T1YJ 4MUNA 5ELXA 4U2FA 2NO7A 4LR7A 1S1UB 5D85A 3RBVA 3T38A 3PGXA 2XM3A 3TNFA 4BRZA 2IVMA 3H6HA 1GZ5A 2QX4A 5JMWA 3H59A 2HHVA 1LS1A 5LZ7A 2VSOA 4US0R 4LRDA 2VQEJ 2JFOA 4EZ9A 2YQ5A 1PI3A 4R71A 4DNPA 3ZHRA 1L4NA 4V19X 3B6KA 2WG0A 2D1RA 2XA9A 4X24A 1QP8A 4USIA 1SKUB 3RFTA 5J2MA 3I4CA 1JZSA 1VMBA 3Q9LA 5A7FA 4DV0B 1OLUA 3NETA 1J5OA 2EW9A 4XB2A 2WFAA 4IIEA 3DTVA 5CEEA 3OZGA 4EY7A 2ZANA 2JHAA 4PAWA 2J5XA 3OXGA 1IAQA 3CLRC 2D3UA 4FYDA 1E1LA 4GRDA 1P6QA 3KT8A 4FMDF 5LWHA 1AJEA 3CA8A 1IPFA 1HPLA 2VPZA 2BGNA 4H16A 4Z1OA 2KLHA 1S1XB 4ZCLA 1DMRA 5AXNA 2XMVA 4D81A 3W5BA 3K2YA 1Z7BA 2IJRA 1P2BA 3PTZA 1EYZA 1D4AA 3KTAA 4E09A 1IN8A 3GP8A 1XP5A 4DR3F 1X4GA 4LE0A 3JCZA 4YAUA 4I55B 4R2KA 2V7XA 2OB2A 3OFSA 3DW1X 5GONA 2I0FA 4QQKA 1XTBA 2CXNA 2EFJA 3LS2A 1RT1A 4WPGA 5TMBA 4I6AA 3JASB 1H3DA 3ZWBA 1IOZA 1E2LA 1WUJS 1TJ4A 1IN0A 3LP8A 1U1PA 4P1ZA 3WL3A 5L3SB 4I4IA 2ASYA 1RLCL 4DV1B 4PC7A 3E4CA 4Q7EA 3USES 3ZLJA 3HHDA 4OIFA 1L5HA 3HXQA 2GGPA 4RK5A 5F5LA 3Q89A 4XK8C 3AQOA 3AMVA 1PVOA 3N9IA 1AKYA 3UJ9A 4JU9A 2GFHA 3KTFA 2Y2UA 4INJA 1V41E 3CVKA 1L8AA 1C1BA 2WUEA 3MRTA 4KNVA 3AOEA 4O02B 5B2FA 3C8MA 1BDJA 2G1UA 4GW3A 3RGGA 2I62A 4HVLA 5THKA 4R0MA 4IKOA 3FUWA 1LLCA 3A28A 1X1RA 1N5DA 4AKSA 1T6BY 5B58T 3OX4A 1M1YA 5C80A 1CP3A 3QM1A 3DRPB 1HBUB 2ZIWB 2KI5A 1K5PA 4DR5F 5C5DA 3VZSA 2BGWA 2GZRA 4BMZA 3WYGA 3K17A 5IJ0A 4RM2A 1ADCA 4AC9A 2AX4A 2PZLA 3LCCA 5IH3A 3ZU5A 3L3CA 4XM0A 3C19A 3VAAA 3HBMA 1E9VA 3HKDB 5FO1A 5DM70 5THWA 2H9ZA 4QA9A 4DV5J 2EWHA 1FJGJ 4EG3A 1OYEA 1E99A 2ZRLA 5HR5A 1OY9A 3EPIA 1DKQA 1NSPA 3QA9A 1E1QA 2VDVE 4UKDA 2GHQA 4V0SA 1RYDA 3BHIA 2VA2A 4IJUA 1CJTB 1XRPA 3ZZ0A 3OCVA 4H1VA 2Z4SA 5A3JA 1IJKA 4PLFA 4MW0A 1RAJA 4Z7OB 4Q4JB 1DRZA 1JMVA 2XULA 1R8XA 4ZVTA 4I68A 4ZYUA 4PLTA 5LJ3Y 1GPLA 2ZREA 3D6TB 4GBED 3AXKA 4FNOA 4NYJQ 1K5GA 3NJ8A 2G1AA 3FFIA 2PQ0A 1QUFA 2WJGA 4LV8B 4HAOA 2PMEA 2EWMA 2IHUA 4MW2A 4F93B 4RA6A 2QXUA 4DMHA 1N77A 2RDJA 2PANA 5CH7B 4QPNA 1MOSA 5A3QA 2XGQA 4GOXA 3PCOB 3RC3A 4ZVHA 3R7WB 3GGOA 4ELTA 3LPMA 1LUAA 1OZFA 4RUHA 5C1BA 4M22A 3KE9A 2VPXA 2P9TA 2Z8YM 1PC5A 2EFNA 2AG8A 1ULAA 1A9PA 2Y99A 3ITHB 4X3CA 3I9MA 4JI8B 4HOYA 2MKHA 1S7HA 1JQAA 1MAVA 5MN5A 5GVSA 4KYUA 4U2CA 3FFWA 3IOMA 1FSFA 2RHCA 4A27A 3H65A 2PA3A 1KGDA 3D5MA 3LP2A 1TCCA 1P60A 5IRCD 1KOFA 3KOXA 4EENA 1BU5A 2PI4A 1E0AA 3E1KA 4DG9A 3TAQA 5JALA 1VC2A 3PT9A 9GPBA 5K45A 3JSAA 4C11A 3USCS 4OPMA 5KYYA 1E2PA 2DX7A 5L8VA 3IILA 3UHOA 4E6EA 1RWXA 2WJZB 4MMXB 4BEJA 2BFFB 4DJ5X 3WLRA 1UDRA 2JFPA 3AF3A 3SDBA 1REVB 3UFXB 2OCDA 4UBIA 3LOUA 2AD1A 3GRZA 3V6DB 1ND5A 1WUHS 1T1EA 2VYFA 1ZZNA 1PS8A 1SRQA 2X5XA 4Y2PA 4DLSA 1I5OB 3HYSA 2PQ6A 2XBUA 2B8JA 3WBJA 3KWJA 1QZXA 1WVIA 4ARVA 2Q1SA 1ZGHA 3UM9A 4QGHA 2ZU6A 5HVFA 1U80A 2YOHA 4RIGA 3PGLA 3QFHA 3I0SA 4FOOA 4G0UA 3W77A 4YCAA 5KYUA 3QW4B 2JFZA 1AK1A 2A92A 3KIPA 1TUEA 3Q1KA 5D3ZA 3I53A 2A18A 2CQ2A 1GPMA 1VFPA 3IBWA 2YZKA 1K7FB 1UP7A 5HKAA 1TL3B 1S9EB 2O0JA 2XAUA 1RQLA 4L0DA 1E6YA 2OYSA 3DDUA 1U6ZA 1ZYUA 4F3MA 2WAAA 3FM9A 2WIAA 3EF3A 2ZZMA 3OE7A 5CDFE 1U2DA 3CEJA 2NXJA 3A9VA 3SSOA 2NQ8A 3RHZA 1G3IA 1PL8A 2REQA 5AM1A 4XGQA 4XARA 4PYLA 1T9TA 2XMDA 3T3DA 1ZOTA 1RBOB 2IF0A 3NORA 4LC0A 3CJ4A 2BQ3A 4PC3A 4OLOA 3KBOA 3CUYA 4P54A 2OUGA 4LF1A 2Y3IA 5T41A 1HEUA 4QTZA 5D1NA 3IUEA 2J4CA 5CVUA 4DJTA 2GASA 4JOSA 4NZZA 1B6RA 3ACBA 5ILOA 3C43A 1TO2E 3AU9A 2HGMA 3F2VA 3A14A 4ETWA 1AF4A 4JV5B 3K9NA 5FBVB 4F4ZA 5F1KA 3MAAC 3KJIA 3R6WA 2G25A 5IVIA 3AEQA 4D74A 4YR3A 4J6FA 4B7CA 3TO5A 3AR6A 2A7QA 3D31A 3BD6A 3C39A 3P9KA 4I81A 3IP9A 2XY4A 3ZDAA 4WD3A 3MEGA 2O4UX 1KQGA 3OXFA 3PIOQ 2F3JA 3LP0A 2IC3B 2KSQA 3EOBI 5ADHA 2CHQA 4ARCA 1YRAA 3WQRA 1T5TA 4LF8J 3UO8B 1E2QA 1EZZB 2WAMA 1DGQA 2B21A 2VDJA 4KRGA 4PX9A 1L4GA 1CNFA 2A57A 5AW3A 5EJ6A 2AZTA 2F17A 4INAA 2Y1RI 4R9UC 2XMWA 2RUSA 1VQ5S 1N5KA 1RC1A 5CZVA 1QYIA 4LSNA 1NG1A 2IYXA 1QX3A 2ZATA 4K4XA 1KTIA 4BB0A 3OTDA 3U4DA 2UXCB 4I67A 2Q07A 3ELHA 3KLGB 3BYRA 3LUCA 3A27A 2P2CB 3N2EA 1RYYA 1UPMB 4JI4F 3FOZA 1N33J 4NLXA 2YWHA 3DRYA 1KI8A 3E58A 2E7XA 2H1RA 4WDQA 2OZLB 1XR3A 1S1MA 1XKQA 4H4MB 2VLIA 4DMCA 3O82A 3QYJA 4M9QA 3ADOA 2E6KA 2F00A 2ZDHA 5CXUA 4ZYTA 3D4OA 3C5HA 1RKIA 1MR3F 4JYBA 1K0FA 8GPBA 3M1VA 2DMRA 4GMDA 5H9EJ 2JJQA 2AJ2A 3O8OA 1R5JA 4K2HA 3S6JA 2BABA 3Q5DA 1HY3A 2QFIA 5I3UB 3NBQA 2OMLA 2GTPA 2VFSA 4LF7F 4P4TA 3U6KA 2Q4TA 1PWXA 1ZSYA 4K8RB 2J5RA 2NUHA 3M81A 1GAXA 3DT6A 1XTTA 4DKXA 2WTUA 3FCVA 4KXLA 3EHEA 1GPDG 3ZJ4A 1R6VA 2E5LF 2BBEA 1ZAXA 2XB9A 4A6DA 1GIAA 3JWPA 3J7ZT 3IGNA 2OXTA 3IOBA 3RO7A 2QTCA 1UCNA 3DVRX 3UAOA 4JXXA 2PCJA 4DABA 1DBVO 2I99A 4F12A 1L5LA 3PQDA 4PCVA 3A0RB 5TARA 3J7YI 3IUYA 3TLXA 4Z7JA 4MRMB 4Q4DA 3KJEA 1NNI1 4YAEA 2Q0HA 3CJKA 2BRUA 2ICAA 2BH9A 5DGAA 1X15A 1UVMA 3TXAA 1VQ7S 4B83A 1ZJYA 4Z7NB 3R6TA 1JFSA 2IJNA 2FPMA 3WMFA 4IGEA 4PG5A 4OJ1A 2C5SA 4ND4A 2OSVA 1EIWA 1Z7GA 2IMWP 1KYVA 2ZB3A 2FZGB 1Y10A 2FQYA 4UEWA 4W92B 1NVTA 1DX4A 4HZGA 1FDBA 1PCAA 2R4TA 3IAS9 4KV9A 3SEQA 4LBIA 2H1IA 2K2WA 3DV2A 1YB1A 2O0HA 3I9ZA 2HGSA 5J2NA 5EZYF 2JVIA 1XWLA 5SY6A 3FR8A 1M2JA 2AX3A 4ZC1A 3JD4A 3M6WA 3QPWA 4M0PA 3RVMA 1LWXA 4LDAA 5D0HA 1CPZA 4CLKA 4E7OA 2O05A 5HAOA 4N65A 1IVSA 1R4MB 1N5JA 3IJ5A 2QM0A 3JQBA 4OYXA 4LKRA 1E6VB 4M8SA 2HEKA 1OXBB 1UVJA 5AOVA 4BO0A 4WJZA 1USIA 4ROSA 4MEBA 1BJRE 2Q1WA 2P6UA 2QG4A 1L5VA 4U7JA 1UTAA 2OXCA 3HEMA 1T8SA 3DE4X 5HQTA 3P94A 1LRKA 1IKWA 1O8BA 1XLTC 3ITKA 3PDJA 3LT5A 1L3CA 2YHAA 5FWXB 1GVNB 2CZCA 1JA9A 1J56A 1H85A 4Y2QA 3C1AA 3TIXB 5ERGB 1KI2A 2CWKA 1W5AA 5TT0A 4Y2XA 1NHUA 2VRNA 3IHKA 4QM7A 1LTHR 2QGNA 3R40A 1RIIA 1XYGA 4CF7A 4YNBA 2YV1A 5J2PB 1LWNA 4GL2A 2O50A 4X4TA 4KGKA 1R10A 4MAAA 3QSYA 2HDOA 3E5RA 2XC9A 4PLPA 2X9NA 3C6BA 5E9WA 3S68A 4PS1A 1WDMA 3G2QA 4LNAA 3ORQA 3CEPB 3IPAA 4BP1A 2GFFA 4MIYA 3WWCA 1Z25A 4NOLA 2CQHA 3SFVA 4KEAA 3VSAA 1A2QA 1WXDA 3ZG6A 5FF9A 3G9CA 3N0VA 5CLJA 2ZE8A 3LF2A 2BX6A 2XI3A 2RHOA 2CMGA 3MHTA 3N74A 4C0SA 1Z6TA 4OHUA 5KNDH 3K9BA 2RHHA 1M1XB 1ESEA 1S2DA 4YAKA 1Z28A 3L7DA 1M66A 5HFNA 2BOAA 1BY9A 2XUFA 4D9BA 1E3TA 2YV5A 3PWSA 1IHPA 4CMJA 5MFZA 2VRCA 3W3AH 4YV0A 1L5UA 4HGOA 2X7JA 1MTOA 4PRYA 2HI0A 4GYKA 3DBLB 1I4DD 3OZTA 1IWGA 4UREA 2BVZA 2E7ZA 1Q79A 3SWWA 4BNKA 5BN3A 1B16A 2HS0A 3BGDA 5IMSA 4NLQA 4M7PA 1LWFB 2EG2A 4QPZA 3PYLA 3V1UA 1EB0A 2M98A 2HQGA 3C16B 2AOXA 4Z4HA 4BVGA 1W52X 4KAIA 1RNLA 1Z2PX 1WEKA 1P7PA 3RLFA 2FPHX 3F0NA 1IR1A 1AQYA 2EEYA 3LM8A 3L5OA 2O6HA 1Z75A 4J5OA 3W61A 3R3JA 5D51S 1ZGAA 4EYKA 4RKRA 3SM9A 3EJ6A 1GUZA 4URZR 5FI3A 4PICA 1BHQ1 2QJTA 2DTJA 2OE2A 2OGZA 2O1SA 1ZPWX 4DLXA 1ULTA 3BK7A 1FFDA 2WT4A 3IUJA 2QTFA 1U2CA 4HJXA 1EWYA 4U7DA 1CVJA 4DIMA 1IKVB 4NMWA 4U9HS 1IUOA 5FLYA 1YR8A 3MXHP 1APSA 4NK4A 3VNSA 3HE3A 4KFCA 5LBUA 1C3OB 1ZUNA 1FRXA 1QAYA 2OD7A 4RHCA 3CN7A 3JRNA 2P41A 3ONNA 4LVCA 3RHFA 1ENPA 5JBIA 4CLHA 4P5EA 2HFSA 1IN7A 3COVA 3G2XA 3Q0TA 1F4VA 3F78A 2Z0GA 4YT2A 3DBHA 3Q3HA 4B17A 1EETB 4NCIA 2O1PA 3M8QB 1CEQA 2XDQA 4JUAA 4HWKA 2OHIA 5DYGA 2XZTA 2MQLA 1NFQA 3JQ8A 4BO6A 4GLOA 3EBPA 5KVQA 4N0EA 3FPHA 2WLTA 1DAIA 1Z8DA 4FD2A 4B4DA 5LSAA 1URPA 1PK8A 1QH9A 3DM5A 3WYAA 3C3LA 5D77A 2IVZA 4AZ0A 2PBRA 4DJEC 1RQ7A 5K8LA 2ZJ0A 2YWGA 4DN6A 2ACEA 4I7FB 3MLAA 4JLJA 3OE5A 2ZC3A 3DZ8A 1RP5A 1OSCA 4DBLC 4POOA 4U02A 4Q4HB 4F9GA 4CMKA 1E1RD 1YHZA 2OCXA 4U2BA 5JI2E 3G1TA 2I7TA 1W7AA 1KN6A 3LT1A 3DO8A 4Y6IA 1RI4A 3ZX4A 1JQ5A 3LE8A 1VJQA 5L45A 3SYMA 4Y2YA 1BX0A 4EOGA 4DXDA 1QZTA 5FTNA 1VJ5A 1B41A 1U2PA 5F9LA 5FLXA 4O2BB 1WF0A 1NW3A 2XWXA 5DHRA 4WBNA 4MQMA 3KUXA 2IS1A 2W37A 5ARBA 3VBEA 1QORA 1AXQA 2LNDA 2FW7A 3LX5A 5K4GA 4GUDA 1E79A 2X1VA 2I6UA 1M1UA 4PZPA 1H7WA 3CLSD 3SMQA 5EPEA 4Y30A 3B3AA 4I36A 1CS4B 3CRZA 4KFBA 2PGDA 4LYFA 1VPLA 4MPTA 4F3NA 4JLOA 3DAFA 2D0IA 1HQKA 2PRIA 4GO1A 1Y5RA 2G9QA 4JLDA 4G23A 4ER5A 2KJVA 1Q53A 1N0IA 2JAPA 3L0OA 2ETVA 4N8NA 1BXRB 4L7QA 3H9BA 1EVZA 3N2KA 4RM3A 3NIDB 2PZFA 4WLUA 2H11A 3RBAA 5H4GA 4RLFA 2QTNA 4LSLA 1P80A 2XMRA 5ICCA 3T5KA 1MC4A 3CWZA 3IE2A 1AKMA 4PW0A 4BO7A 3A70A 2VF8A 1IIRA 3FUYA 3EA4A 4CIXA 3RQSA 1I30A 2J76E 5DTIA 3ZWKA 1U7LA 4YJ3A 1N34F 1GGVA 4DUPA 2DWUA 1CETA 5E4JA 5BY2A 4UJ5A 3U9TA 3IIMA 4BXOB 3SEOA 4KRYA 1J06A 3BMQA 4XTRA 4RTMA 4JR1A 3UWOA 5EIEA 2K7KA 5GGYA 4UMVA 3RRGA 4Q01A 4RXUA 1VYHA 2DH8A 3PNKA 1R4ZA 2FZKA 2EAUA 3AY7A 1BYIA 1ZK4A 3TTYA 5A71A 1Z15A 3F6YA 4L3VA 2QVCA 4B02A 3ONVA 4C0AC 4AVYA 3NTOA 3AZQA 4MVJA 2ZUDA 4H3KB 5BV8A 3ND6A 1MJNA 2CG8A 3AHIA 4AJOA 5AICA 3IT2A 4DLPA 2F8EX 3TMAA 1KDOA 4DJBA 2IHKA 2HXYA 5LXYA 4LQ9A 4TUYF 4E07A 2QPTA 2E87A 4XX0A 1TVRB 1RE1A 5CVCA 4DLRA 1UKCA 3R0QA 3R5GA 3B9BA 4EZ6A 3UYKA 3WIDA 4F96A 4G1BA 3IMGA 3SZGA 4PTLA 4EABA 1G3OA 3QIDA 4O25A 1PJCA 4XOIA 1VDMA 3JU3A 3LLUA 5B0AA 2K8GA 5KFRA 4K81B 1N5VA 3MEQA 5LYJB 1SCJB 5BMOA 1JR3A 1Z4KA 4UQLA 3DDOA 4Z3OA 1XZIA 1PT7A 4TMVA 2BV3A 3P9NA 4RKEA 4M1MA 2DJ5A 2XXAA 3TJ9A 2PUDA 2GZSA 4HNRA 1NE7A 1AHIA 3IXLA 4RTQA 2BE7D 2I2YA 4EI8A 1A97A 3T3OA 5KT3A 4YQEA 1SQEA 4E2FB 2UXBB 3S6EA 4N54A 3NV9A 4CH7A 3EFOA 4YY3F 1O94C 1YC2A 1OHHD 5DOVA 3GLTA 3EQ8A 4BY9E 4YRJA 3I9LA 1PO6A 4MKHA 4JB8B 1UBJS 3HU1A 4RK0A 1QIIA 2HBZA 3GJSB 5IS2A 1H2ZA 3KJFB 3G0GA 4O1MA 4QPDA 2VG7A 2ZS9A 4AL7A 5EIFA 3M0EA 1UA1A 4DR6F 4R7GA 1UMBB 4CJXA 3K59A 4BCDA 2O57A 3SBEA 3IX7A 1A1SA 1NK5A 1ODSA 4ES3A 3F6SA 1SH3A 4B7XA 3E9DA 2A88A 1NONA 2VB6A 4H7KA 1NP3A 1YS6A 4TMKA 1DIGA 3W8NA 1YVDA 2AQ8A 3H2GA 2CDCA 1N6OA 3B85A 3CT9A 2HWUA 1IVZA 3L5KA 5JMOA 4RF4A 5LP6A 5EP4A 1CG6A 2OYCA 4UAUA 4DR2B 1HARA 1UZAA 4B3SB 1GVHA 1FMFA 2ANBA 2J32A 4W7SA 3VI4B 1PVDA 4FMCF 1UL3A 5J4VA 4DDVA 4CO0A 3KOUA 3UN5A 4UY85 2FP4A 5LXTA 2ERYA 4L57A 3UB3A 3D6JA 2RG1A 1SKSA