4JP8A

Crystal structure of pro-f17h/s324a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKHNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Increase in activation rate of Pro-Tk-subtilisin by a single nonpolar-to-polar amino acid substitution at the hydrophobic core of the propeptide domain
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 128
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4jp8A01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4jp8A02
2PQ2A 1ST3A 3DVRX 3F49S 4OMDA 2DQKA 2W2NA 1YU6A 3P5BP 1A2QA 1SBCA 3CNQP 3A3PB 4OV6A 1KDZA 1ITPA 1SIBE 2W2OA 2W2MP 1DBIA 1Y48E 3TI9A 3DE5X 1TECE 4MZDA 3DYBA 2Z57B 4C3VA 5I9SA 1AVTA 3PTLA 2XTJP 3BPSA 4NMXB 3A3NA 5AVKA 1AK9A 4OV6B 1CNMA 1OYOA 5SICE 1SUPA 1WMDA 1SUBA 3BX1A 4AKSA 1YJAA 3EDYA 4KPGA 1YJCA 2PMWB 4NE9C 1Q5PA 4HVLA 3F7OA 3DWEX 2WV7A 2Z58B 1Y4AE 1CSEE 1TM5E 3DVSX 1P8JA 1C9JA 1BFKA 1TM7E 3LXUX 3QFHA 2IXTA 1KE1A 3I34X 1S2NA 2W2MA 1GTL1 2PKCA 4K8RA 5B1EA 3EE6A 1PJ8A 3DE0X 2Z58A 1DUIA 2TECE 1BE6A 1SVNA 2E1PA 2Z30A 1R6VA 3EIFA 1PFGA 2PYZA 5ARDA 5CW1A 4GI3A 5ARCA 2X8JA 1GA1A 5AMXA 1JEAA 1SCJB 2DUJA 3Q5GA 3BGOP 3DE4X 1AV7A 1OT5A 3BPSP 1EA7A 1Y3FE 3VV3A 3VYVA 3BGOS 1VSBA 3I2YX 3TI7A 2PMWA 2SICE 3A3OA 3GCWA 3VV2B 1AQNA 4DWWA 4M1ZA 2B6NA 3P5BA 3GT3A 4FONA 1Y34E 1SCDA 4YN3A 3SQOA 4H6VA 2HD4A 3A3OB 5K7SA 3UNXA 1AU9A 1R0RE 3D43A 1WSDA 1OYVA 4Z2AA 3H42A 4KG7A 5FFNA 1C9NA 3QMPA 1BH6A 4RYDA 1SUEA 4B5LA 3OSZA 2QTWB 1SN7A 3AJ8A 3AJ9A 5JMOA 1R64A 3PRKE 1BE8A 1GNSA 1PTKA 2G4VA 3SICE 1TO1E 2DP4E 3AFGA 5FBZA 1S02A 1UBNA 2WWTA 5B1DA 1Y3DE 5JXJA 1LW6E 3SQOP 1GTJ1 3CNQS 1SUDA 5JXIA 3GCXA 4LVOA 1TO2E 1KDVA 1GT91 3DW1X 1WVMA 2HPZA 3A3NB 1Y1KE 1TM3E 2SECE 2GKOA 1SH7A 2V8BA 1SCBA 4DZTA 3H42B 2P4EA 3DE3X 1YJBA 3VSBA 3WHIA 2IY9A 3L1KA 1T1IA 2W2QA 1BJRE 1NDUA 1XF1A 2ST1A 1SBHA 3DE6X 3GCWP 3ZXXA 2PWBA 4WOCA 3LPCA 1C3LA 1HT3A 1AH2A 3WIUA 3I30X 2W2QP 1TM4E 1V5IB 1ZVJA 1SCAA 1SUCA 5JXHA 1ZVKA 5FAXA 2XRMA 1Y9ZA 1WMEA 1SPBS 1TK2A 2ID4A 3QTLA 3I37X 1S01A 1GCIA 2SBTA 2W2PP 4J94A 4YN3B 5ARBA 4CFZA 1GNVA 2W2OP 1PEKE 1Y3CE 3LPDA 1V5IA 2SNIE 3A3PA 2ZRQA 4ZARA 1WMFA 1NLUA 2W2NP 1V6CA 3DW3X 3F7MA 1Y33E 3HJRA 1SBTA 2Z2ZA 4I0WB 4NE7A 1KE2A 2W2PA 1Y3BE 3VTAA 4CG0A 4ZOQI 3TECE 4KB5A 1Y4DE 3VHQA 4WOBA 3DDZX 2ID8A 1SBNE 3DE7X 1KDYA 4C3UA 1T1GA 2WUWE 3ZXYA 3DVQX 2Z56B 1GA6A 2PWAA 3LPAA 2X8JB 4NE9A 3DE1X 4AKTA 1C9MA 2PRKA 2Z2YA 1IC6A 3DE2X 2Z2XA 3Q40A 2WUVA 3T41A 5AVJA 1P7VA 3GCXP 1ST2A 4H6XA 1AF4A 4H6WA 4DJ5X 4HX2A 4K8RB 1SBIA 4JP8A 1SUAA 3VV2A 1SIUA 2Z30B 1SCNE 1SIOA 3WQBA 2Z2YB 2Z57A 1IAVA 3D9QX 1GTG1 1THMA 1T1EA 1TMGE 1BFUA 2ZWOA 4NMXA 4BWGA 1SPBP 3GT4A 1SCJA 5JXGA 3CO0P 1EGQA 5AQEA 3CO0S 1SELA 4LVNA 1NDQA 2ZWPA 1MEEA 1TM1E 1MPTA 1P7WA 2Z56A 4CFYA 2XTJA 3WIVA 2QTWA 4OMCA 1GA4A
chains in the Genus database with same CATH superfamily
2ZRJA 3RTGA 2VKRA 2O2CA 3VHRA 1KOHA 3DPUA 3PC6A 4GI5A 5ILOA 1Q20A 1O96A 4F25A 1TKRA 3F78A 4NRDA 3PDIB 4JKIA 2WW4A 2JEYA 4CH0S 5FLYA 3HLYA 3NG8A 5L39A 5KWSA 3AOGA 2CQ1A 1ZJ5A 3VYSB 3TOXA 2V6AA 1JV2B 2Z0MA 5I42B 4E33A 1IPHA 5DQGA 4XTTA 3UAYA 4JI5F 4G1BA 2I5JA 1G2OA 1LB1B 5U1PA 2JANA 4B84A 4GI2A 1UFQA 1G3QA 1UKZA 2Y1XA 4M5GA 2KB0A 4Z9YA 2ZB3A 3CGGA 1FJXA 3EGWB 3H20A 3H7AA 1BXGA 2IOYA 4JL6A 4ACBA 4W7SA 3SMQA 4INPA 4YV2A 4QJ4A 2J5RA 2YC2C 2QRMA 3OZRA 4IHQA 3AMVA 4OBBA 4Y7DA 3BE8A 4TQGA 2QJWA 3I1JA 2FCRA 2FZ4A 3ET4A 1FFYA 4OGWA 3G8TA 1YIAA 5ETRA 4D9NA 1BE0A 1QHXA 3KDNA 2AX0A 3WL5A 2X8JA 1XD9A 2H5LA 3MNFA 5GV7A 4D3YA 1VLZA 1VHDA 4LC9A 2KHDA 4DI6A 5IKEA 1NBMD 2NYUA 2WB4A 1COZA 1XEXB 3QPVA 3IA7A 3COJA 4FDFA 2P6SA 1UBUS 3MPYA 5HJEA 2KZZA 1XK6A 4F3YA 3G7UA 1JR6A 1N1EA 1VQLS 5F12A 3MXTA 4YY3F 1UT6A 2ZJZA 3K71B 1YS7A 4UMVA 3TCKA 3D6UA 1RRKA 3FLBA 1BCSB 5ETVA 3I9V1 1DQNA 2ZS7A 4DADA 4ZMSA 2W83A 1KZ4A 1E77A 4CBVA 2FAXA 3A4MA 3C5HA 4P74A 1O6BA 2PMFA 4E14A 2EBHX 5BUSA 3NEYA 4MVCA 4OFZA 3UGJA 3D1HA 1BDMA 4KPCA 2QE6A 2HBQB 2BFPA 4BFSA 2REQA 3DGPA 4B3XA 2F62A 1RWUA 1O08A 2JA1A 3CMMA 3GSDA 4RX1A 4KHRA 1RQGA 2ZLBA 2GRAA 4AX4A 1H5NA 4R8UA 2H54B 2MY8A 2W70A 1U1IA 1RI2A 3M8ZA 1K7CA 2JHGA 2OV8A 2SXLA 4NBRA 4U7GA 5CH3A 2AX1A 3HBJA 5AO9A 1LLFA 2NO5A 2XYRA 1C4KA 2QA4S 2H51B 4GP9A 3ITEA 2WBMA 3TGLA 1G3MA 1B8PA 5FUXA 1Y1KE 4UM5A 1NB2A 3OL6A 2B1GA 1Y8ZA 4OG2A 4C89A 1NLZA 4RJVA 4KYVA 2VG7A 2HQRA 1AKTA 2IPNA 1ZD3A 1JLKA 4IDKA 1N2CB 2IV2X 3OJSA 1QIEA 4TRRA 3F6YA 1SBHA 4F93B 3ZZOA 3DE6X 1U0EA 3DU5A 3ILOA 2OHGA 2WJ4A 1SEPA 3UNGC 1RC0A 1ECPA 4X4TA 3PFNA 1WEYA 4LF8F 4COOA 1OZGA 3NY0A 2VYCA 5IH7A 4RW4B 1E9BA 3II6X 1KDRA 2GYWA 3EZGA 4DR5F 3IOCA 3AVWA 4Q48A 4MUMA 1JG1A 1RS0A 1XZKA 1DAXA 3KKFA 4DSFA 1K4MA 4TPKA 5DGDA 4E70A 2RGBA 4NCBA 4E5VA 4PR0A 1GAXA 2P2SA 1NK8A 5L3SB 3G2KA 1HMVA 4KQGA 3NGDA 5I8ZA 1JEDA 2ZTUA 1XJQA 2FQWA 5E7OB 4PSAA 1ZW6A 3CG0A 1RTIB 1CY8A 3Q8VA 4CKBA 2I8EA 3IBFA 2Z3VA 2XGPA 4TT3D 1YZ6A 5LMUF 5IT9Y 2Y1LB 3Q8PB 2L2QA 4NIMA 3IPCA 2Z2XA 5FH9A 1CUYA 2BZGA 4ZRNA 3AD9C 5H82A 3O74A 3U60B 2RD5C 4BLOA 1HR0J 3AR3A 3LS2A 3N2YA 3L4EA 4UVIA 3ORSA 3FMPB 1RBLA 3CJTA 3HF5A 4EY4A 3A8EA 4OUDA 1Z25A 4K3VA 1KSPA 4B3CA 3TEHB 1RKIA 1ORDA 1HNVB 2F40A 3BH7B 5D3GB 4HNVA 1YOVB 4WU3A 5JYEA 1T29A 3NALA 1GZUA 4XCQA 4ZQFA 3ETMA 2G0JA 1TZBA 2B98A 4F2SA 3L7OA 2HJSA 2YY3A 4FGZA 2QTWA 1N33F 5KWEA 3BWBA 1P8AA 2VJAA 5LQRA 2OIHA 2V7QD 4H2DA 4IJ6A 3K5IA 4B80A 2GGPA 4CLZA 3WADA 4F8YA 1U81A 3BGRB 3CF4A 3WB9A 2M32A 5C5DA 5AKGA 2IAJB 1B0UA 1EUQA 3GFSA 3IX7A 1B93A 1GPAA 4JYAF 5CCMA 3QX7A 2FVXA 1YQUA 1WABA 3K3PA 5F3TA 2GPNA 4UOFA 2LGJA 1CHNA 4FGSA 2ZOFA 2BKVA 2NSDA 1ENYA 3EA4A 3N8IA 1B8UA 1QXSA 4DV1J 3L6DA 2V5UA 4M0EA 3NAIA 3QF7A 5BQ3A 2IODA 1NW7A 3T7KA 2Q5QA 1OLXA 1S6PA 3EA0A 3QV1A 2LLZA 3EVOA 4FFBA 3ZZPA 3EH2A 3UVJA 3DLPX 5C7IO 5AM1A 3KBOA 4WFNQ 4GZLA 4O23A 1U02A 2VFAA 2YJGA 3LQ1A 1KMIY 3QKTA 1KJYA 2YZ7A 4A8HA 3MAAC 1OI3A 1XZGA 1EHCA 3FKBA 2VDUE 2BCGY 2NREA 2J0QD 3I12A 4Q19A 1N57A 2YJTD 1UBMS 1DPGA 2Z5FA 4KGXA 3R44A 4DLWA 4I9FA 3L7BA 4NF2A 4IZHA 5KQSA 2C4WA 3FKSA 1HD1A 3DT9A 1TCBA 3LA8A 1L6IA 1ARZA 4ITSA 4G2NA 1AQNA 2Q28A 4M8IA 3G8QA 1BMDA 2ZETA 2ZZKA 1FSSA 4ZMRA 4B45A 2DR7A 2EP5A 5DNCA 3AVYA 3L1IA 3OTDA 2BMWA 5AI8A 2PGIA 4L5IA 3HM2A 2XMUA 4BNYA 2MZQA 1TT5B 1F3VA 4FYMA 1JJHA 2ZJ2A 3RRYA 2P0YA 4C5AA 3R8CA 4KRYA 1SH2A 4ZOSA 4YLYA 2J9EA 4HUJA 2NN3C 2MYUA 2QLXA 2DP4E 5LXRA 4CMAA 1WHVA 1W35A 5IM4A 4PZAA 5DYTA 1ZA1A 3KUDA 4TXMA 4TYBA 1DWUA 1D09B 2ZS8A 1XWWA 4RDXA 1HK7A 5JFOA 1VGYA 1HBNB 4LBWA 1IZYA 4HB3A 1SUSA 2BV3A 1XQYA 3D4IA 3F74A 3GMSA 3KR9A 2F64A 3M8WA 1S97A 1L7VC 3TYTA 3BK1A 1WSWA 1TFYA 3F5MA 3EGCA 2UZ1A 2PYDA 2J8ZA 3CD0A 2AJCA 3LO8A 4A46A 1S1TB 2WSEC 3LYLA 1JW9B 4N5IX 5FUWA 2QP9X 3RW9A 1ZGGA 4JLUA 2XDWA 2F4VB 2ZSJA 1JHPA 2C9ZA 4K46A 1UFWA 3H3JA 4YTEA 5BV7A 2X22A 4DJTA 4N5LA 5TMEA 1R0AB 4FB5A 1Z15A 3LQKA 2E6UX 1U9IC 1D9AA 2YOHA 5IJ0A 2HNBA 2SNIE 3QBDA 4PSDA 2E85A 1H4TA 3MM9A 1RADA 1TUEA 1UAGA 4IDEA 1RBYA 2RU9A 1V3ZA 4A3SA 1NUTA 5KTQA 1Z83A 4QXAA 4O4RA 3GUUA 4QECA 3IB6A 3LWBA 1OD6A 3IULA 2MJLA 3DB1A 3EYZA 1JEQB 4DMGA 2CHVA 2R8OA 2JBWA 4NLUA 1MO4A 1C1DA 1UC9A 1IL0A 3MOGA 1UR5A 1U3CA 1FFBA 2O0HA 1A2OA 1M1YB 1P2SA 4RD3A 1H2XA 2KG1A 3PZRA 3P20A 2RHTA 4LVOP 4I1YA 3QT8A 4AUMA 4ZYUA 4TYQA 3M8QB 1S72S 4U8YA 1ABFA 1AZWA 5HVNA 2IPMA 3GMGA 2IIBA 4D9JA 4LBPA 1MUUA 5HROA 3R1LA 2Q0QA 2BRUC 1K68A 3ID6C 1TR0A 1P39A 2IFTA 3T9AA 2RNEA 4FIZA 2IW3A 2QXTA 3NFYA 3ZWMA 3H4MA 4F0KA 1EP9A 2I3AA 1CJSA 5B08A 3IG1A 2R42A 1QLNA 3C3KA 5IH3A 1XVAA 4EJ2A 1JH8A 5I3ZA 2CE2X 1P5FA 2EX4A 3C14C 3F49S 3HZZA 1PUJA 3FOZA 1TL7A 2DECA 5H0IA 4JSTA 2Q50A 6Q21A 2ZT8A 5KWVA 3UV3A 3K0FB 4FJ0A 3GV5B 2EJUA 4HYEA 3ED1A 1UP6A 3DE5X 2AWOA 3IQXA 3UMFA 1HW9A 3HI6A 1GG9A 4TKMA 1X1AA 1XDUA 4YXFA 1YC2A 2LXFA 4B46A 3E2PA 1JJBA 3V8QA 3IH5A 2K7JA 4MW6A 4OK6A 3MD3A 2VBYA 3W79A 2QPTA 4ENOA 1NVKA 4OHOA 5JZBA 1G21E 3ZWCA 3TZHA 2VJDA 4JBYA 2ROEA 5RUBA 5HLFB 5IFLA 2VQFF 3AESB 3B20A 3BRCA 4XIUA 2Y4OA 5AOCA 3K8ZA 3N79A 4OJQA 1BQNB 5IVKA 1X9WA 4ZVGA 2O9JA 3QWAA 1GTL1 3KUXA 1J0XO 3FGVA 2AC7A 1X4EA 1MQSA 3DAGA 1E0KA 3M6AA 4TV8F 3OETA 2PSHA 5BXIA 2E21A 4JSYA 5D1HA 4LQ3A 3KBBA 3OMWA 4Q43A 4LBHA 1XIQA 4FF4A 2ZBIA 3W60A 4ZP9A 3QT5A 2B35A 4ARVA 2HOQA 1RD4A 1B0AA 5L3SA 4JQSA 2DTJA 2GWRA 3PJDA 3GF4A 3VJLA 3KG2A 1ISFA 2HO5A 5MHTA 1PFVA 1JALA 1YWGO 3MINA 4IUBS 4LPKA 1J22A 2VDRB 2NADA 1PZGA 3MG9A 1O89A 1OB2A 3A3OB 1OPXA 1D1UA 2PAAA 1QGUA 3HN7A 2FFAA 3HACA 2CHUA 7REQA 3EGVA 3ZWPA 3V9PA 2AD1A 4HAIA 4I3GA 1OFUA 1HBMA 1SB8A 3PYMA 4AY3A 3HHDA 3C0KA 2JK0A 5K5EA 2GH1A 3WJ1A 2YNMA 4B9EA 1Z0SA 4DR4F 2IXDA 1SXQA 1I14A 1WSVA 1E6VA 3HWRA 4RL6A 4BEBA 2JI4A 3CUKA 3SE0A 1U2SA 2WZBA 3MF5A 2RJZA 1B7GO 1SXHA 2JIRA 5KTTA 5P21A 4BB5A 3CR7A 3SV4A 1APBA 2HHQA 2POKA 2BEJA 3V8VA 5D3GA 4UUQA 1KRPA 3TX2A 5B0EA 1OXVA 4RXTA 2JZCA 2EFEB 3FCAA 1RHRB 1GXTA 4Y2UA 3H17A 4OKNA 1EX9A 2VT3A 5KT7A 1K89A 4YVFA 2QR2A 4DZTA 1PC4A 4NICA 2HHWA 1C8BA 2VYVD 3G0CA 3PGJA 1TZ2A 4RCYA 2QQEA 5HIMA 3PUVA 1N8TA 1I5OB 5ADWA 3TDMA 1N3YA 4NK4A 1JSCA 3S1AB 4AWAA 4KDRA 2JBAA 4PCUA 3VPXA 1Z5ZA 4MKIA 3TNVA 3OLZA 3N0RA 1I6MA 3I30X 2W2QP 1E4VA 4LIRA 2TS1A 3TX6A 1Z0JA 5DG9A 2QA2A 4Y9SA 1SPXA 1CS0A 4M6WA 3FWYA 1P5RA 1UEIA 3LPDA 1VRTA 1Q7EA 4IOBA 4BGEA 2BH9A 4C7OA 4IGKA 1P62B 1U3DA 2BHNA 3R41A 4DA8A 2CNOA 2P75A 2J6UA 1QG2A 4Y2SA 1F5NA 2YQ5A 3JATA 1F60A 4CCWA 3SEOA 5F5NA 2NYHA 4WNCA 2J4DA 1NBWB 2XNDA 2ZSHA 4AD6A 1Z06A 1LW0B 2QQGA 3GRUA 2NUAB 2YNFB 1CETA 3FAZA 2MQPA 5DTEA 1H1LB 3ZDCA 3N2GA 2V0GA 1QCZA 2CJXA 4AICA 2BT4A 3LO3A 2OI2A 4RVSA 1S2OA 4EECA 4HNUA 1I7NA 3G2IA 4C2MA 2X3DA 5KU1A 2NSLA 3FUCA 3R7BA 2FTRA 3UK2A 5IARA 3GVPA 1QV7A 1MNQA 5G40A 3NAHA 3HULA 3V1NA 3OKAA 4ZODA 4AP9A 4NJEA 2RSLA 4KL8S 3AYXB 3PC7A 2P11A 4YASA 2CD7A 3M9OB 1AXEA 4P3XA 5LP6B 1IQUA 4MS4B 2XYPA 5CHYA 4BZWA 5ADVA 4LJ8A 2WHQA 4RFSB 5JD4A 1QRAA 1HIYA 3MECB 1S7CA 1XKQA 1QCDA 4Q6BA 5DYWA 3M5WA 1VBYA 5ISMA 1SELA 1RB0A 4RKEA 4ZKEA 1QO0D 4TMKA 1R18A 3B7GA 4N3AA 4AJOA 2SCUA 3LD9A 4R3WA 1HOTA 4WLUA 2GPSA 5F8IA 1SK9A 2VJYA 1UF9A 3O0DA 2A1TR 3HVUA 5I3PA 1JDNA 2GBPA 3QSYA 4EEZA 2WM3A 2ZIVB 5IV3A 1UT5A 2ODWA 1QNFA 2ZR9A 4JENA 4JYAB 1GCOA 1H7WA 4N7MA 3KVVA 4ENSA 4O4LA 2Q5OA 5LMZA 1XMPA 4AYWA 1MOQA 1NUPA 5IKMA 3H1BA 1LNZA 2LKZA 2D1CA 3D0RA 3S2ZA 4XPCA 2Q5IA 3NB0A 2AA3A 1TM5E 3H86A 4Z1MD 2C5FA 1O5IA 2MSEB 1JXAA 5EI5A 5EAIA 4OP3A 2GNKA 4L50A 4Q0MA 4UDNA 1FFWB 4WACA 3VAMA 1BWQA 4OHVA 2EC2A 3H13A 5B1YA 2PZJA 2C2KB 2GHIA 1ZZFA 4DR3F 4Q39A 2PU5A 5E7MA 3MAAB 1LI7A 4XQEA 5DYNA 1E2IA 3MFQA 3DE4X 1QZUA 4X61A 4D82A 4B7UA 3T5TA 1J49A 1AKUA 1Y6RA 1R0XA 2AC2A 1ZI9A 3TA0A 5CFNA 3BK2A 4IX1A 1FTSA 1DVRA 4KOAA 4H1WA 3EG5A 1WB6A 3MPUA 1CQZA 4OM7A 4PY2A 3EFOB 2IM0A 3FTFA 1LRJA 2WIDA 2OPPB 1R0CB 1N77A 1T4DA 2WSSD 2WLSA 1TL7C 1QKIA 4MQ6A 1YRAA 2DNHA 4WY5A 1G60A 4DSEA 1M72A 3U61B 4I0WA 3N8NA 3TKAA 2F9LA 1GV0A 5FHQA 4LF7J 5F21A 1X5PA 5D78A 2IY5B 3RVOA 2RT3A 1XLTC 5K8PA 4UU7A 2C9YA 3OW2R 4XWYA 3ZLUA 1JDZA 5GM1A 2UUWA 5A9RA 1XNHA 5EEGA 2XB2D 3MHTA 5J5CA 4KMRA 4HWKA 5GAGU 4RUBA 4DS5A 3UC9A 5GZ3A 4R25A 1X7GA 4RSMA 1H94A 4K0KB 2CLMB 3LV8A 1VI6A 1W52X 5KJEA 1GAOA 2OAGA 3K17A 4OHYA 4R8VA 4KQHA 5CABA 4D42A 4KO4S 3ULKA 1YXMA 1UAYA 4JGBA 1ESMA 2VQFB 4TROA 1AM4D 3K0FA 1BJRE 4I55B 1OFGA 5IOLA 3IERA 1SKUA 3IS3A 2MT9A 3EPJA 4C8OA 2VG7B 3W4KA 2V45A 5AW3A 5FIUA 3MD0A 3KLFB 4HPJB 1PO7A 2J0EA 3AVUA 4B3SF 3ZHQA 3HSSA 1K88A 2LCFA 2EW9A 1A0OA 1KBZA 1WPGA 1S7HA 2ID4A 1TL5A 1NFFA 1BY9A 5K8VA 3WK8A 2Q43A 2GJFA 4C6HA 4GS5A 1DT3A 5BW5A 5CYMA 4K2HA 4MLZA 1FIUA 4QIGA 3GZNA 1E64A 4BNUA 3HSZA 2A10A 2ZRFA 3NCHA 4KDEA 1KOJA 3WWYA 2HG4A 2FZ5A 4CM8A 1T36A 3G71S 3MM5A 1L8AA 4KGZB 1G5HA 3TH5A 4UEJA 3RAFC 3IWNC 1DAOA 3D2AA 1X0FA 4DLYA 5DNVA 1NZDA 1FNOA 1V2GA 5BN4B 4RWXA 3LTEA 1AMOA 1PYGA 4PXAA 4XWGA 3VGVA 1SRRA 2I67A 1WP4A 2FJUA 4EJMA 4LOIA 4ZTZB 5HQTA 3S7RA 5HR5A 4I9NA 2VJMA 1RWOA 1ZRMA 1G1XA 4JWTA 1YBAA 4KQWA 5JQGB 4DV6F 4M5JA 3WQBA 4RF3A 5CD9A 3IUSA 2WSFC 2ALYB 3SOZA 1V7ZA 1U7OA 5F3DA 3I01A 1RTDA 5TR9A 1RJ9A 1ZYUA 4RZHA 4DMUB 3N5FA 5E0OA 1ZN7A 4M5IA 2AN9A 4QYZJ 2FB9A 2HWKA 3OZSA 1G16A 3JS9A 1FDOA 3HDYA 4EZ9A 4H60A 2QUHA 3RRBA 2HHCA 3C85A 2QRHA 3A9CA 4C4WA 3U3MA 1J8DA 2OMKA 5DBGA 5LWQA 1Z0AA 3FNGA 4RK0A 3HQ4O 3HY4A 3Q8YA 3ZJVA 3QFWA 4DJFC 2G63A 1K86A 1H66A 1JYFA 5HANA 3ZDRA 4FKYA 4E4RA 1YZUA 4XWKA 1ZCFA 1GDTA 1SVDA 1X4AA 1SBRA 2ZIXA 1X1RA 2VAWA 3LA6A 3DRRA 3BZUA 4WN9A 1RCXB 2GQ2A 3A4YA 2Y0DA 3FCWA 4W5WA 3P0EA 7AT1A 2A3JA 3F2VA 2OXFA 1EDBA 4DV7J 2G07A 1M1NA 5EEHA 4JBNA 3WHLA 2B7BA 5AK0A 1OKKD 4HFMA 4YFYA 4MUNA 4JI7F 2VP4A 3JYOA 1B6GA 2P9JA 2PGJA 5ADZA 4Z7YA 1TZCA 3RTVA 4UM7A 1L8OA 1M7GA 5A5EA 2ZYVX 4E46A 4RU2A 3TD6A 4FYHA 4QDOA 3C6QA 4KHZA 2ONJA 4DS3A 1KFKB 4UEWA 2WHYA 5AW4A 1R6VA 3E48A 5J4YA 4Q3CA 1X3SA 4KN6A 1Y8QB 2J4CA 4M55A 3TO5A 2B51A 4R5HA 4V19X 1P9YA 4JV0A 1QY7A 4ER0A 2P9QA 2GVZA 4H4KC 4N7BA 1LRLA 1YZYA 2HHJA 3NKVA 5E1DA 5A6SA 2RBGA 3VKGA 4B4UA 3V4RA 4F6LA 5H9WA 3BJZA 2DULA 4RZ3A 3ZZNA 5K1ZA 4AJ1A 3ER9A 4I3HA 4WMLA 3X44A 3MMCA 2ZSDA 1DQYA 3Q8UA 3IO5A 5LOVF 1Z8HA 4MYHA 4NXMJ 4OLPA 3I09A 3OTHA 2CJXB 3UNXA 2Q6BA 1FDAA 3RV4A 1JT2A 2VJPA 5KSZA 4ZKAA 3D8BA 3OM0A 3ZCTA 2FU5C 2PY6A 5PNTA 3PYGA 1F6BA 5J2NA 3CKYA 1QE5A 2RSQA 1OB5A 3BGFA 5A4DA 3PVXA 4V1CI 4NL5A 3CH6A 3ILYA 2MSNA 5KC9A 3T7IA 3B6JA 3EQ7A 2CLOB 2ZE8A 2PL5A 5BV0A 4MW2A 5DGAA 4MS4A 1CEEA 4BDSA 2QN1A 3GJ8A 2H5IB 3N2NA 4NI2A 3E8MA 1ML3A 2IYLD 4UBNA 1XPOA 3TZXA 4CLOA 2QM7A 1LLCA 3J7TA 4MEAA 5JXIA 2BACA 4TLLB 1ZD5A 3V6JA 4CF5A 3RRKA 2WZCA 4F2PA 1PWHA 5HX7A 1CUFA 2PZMA 3MM8A 2C57A 3QJLA 1S4MA 3ZCPA 1YE8A 3MPDA 1ONSA 5H16A 5IFKA 3QITA 1THGA 1WMSA 2WUFA 1IH8A 1OVMA 2O8DB 4DANA 5F8JA 2CLDX 1RPAA 3SBXA 4XK8C 1LPPA 1ODCA 1Z5VA 3PY8A 2WC1A 2B21A 2YYZA 4FPIA 1XB2A 5KTYA 1YQQA 1AMUA 2WU3A 1NZJA 3AI2A 4YDRA 5CLFA 3IBGA 2L9NA 5A8RA 3MEDB 1KJ9A 1IXRC 5K3FA 2A1UB 2GZ1A 4DR6B 1DJ0A 4CO3A 1G4CA 5THXA 2WVCA 3LUBA 3F46A 2RARA 2D74B 1S4QA 1PZHA 4ZVSA 2WE8A 3TBKA 3GIWA 4NI5A 1J0BA 3Q0EA 2IYIA 3H5TA 4J9KA 4I1OA 4F21A 4BLWA 3HJAA 2M88A 3NNDA 3B1JA 4ABTA 1GK8A 5ALXA 4J1QA 1RADB 5DZSA 4KB5A 3KYIB 4GPBA 3CGWA 3NVAA 3KJZA 4Y34A 1N75A 3AONB 5JCOC 2HVZA 3DBHA 3PSAA 2EL7A 2JLVA 2CZ9A 1ISRA 1OWMA 2YZNA 3ZBPA 3GR0A 2XYGA 1S79A 1S6QA 1VGRA 2BM1A 2H1SA 1HNXF 2QAJA 4HPXB 1T5HX 3QLVC 2C99A 4IDGA 5FLXA 3MPOA 2BKEA 3T95A 2J9XB 3CUNA 3RUIA 1JEYA 1PR1A 2F59A 2J7UA 5HVHA 1CR1A 4AJ4A 2K5UA 2CUYA 2N7YA 3M8QA 1DI0A 3UBMA 1Y5NA 2DPLA 4PF1A 2HFUA 2HNZB 1AK2A 4YJDA 1IOVA 5HROB 2UUAF 3HZEA 3ZO7A 3GXBA 4ERNA 2KQUA 3HKDB 3GFVA 1NUHA 2VP6A 2JI7A 3OPXA 1WHTA 1QU3A 5A02A 2PQ2A 1Q16A 2WU8A 1R31A 2C8KA 2HSDA 2DCLA 2EHJA 4CO4A 3NANA 3AJ2A 4IWYA 1JJ4A 1SXJA 1M0WA 4YAUA 3MR3A 2VPYB 5ENZA 1T0PA 4DR7F 3S40A 1MJ5A 1QPZA 4WERA 1KWGA 2I03A 3V7FA 2P62A 5ESRA 1P1HA 4P2SA 3L2OB 5G1PA 2UUTA 4QWEA 3VC1A 1OYOA 1JDTA 4RSHA 4LW8A 3DHYA 1GYPA 1D8AA 1QB7A 2M0GB 4Q34A 4J6FA 5E3IA 3CJ4A 2OENG 4C04A 1WF6A 3L8FA 3P9KA 1FL9A 4A8YA 3LGXA 4BASA 4Z0NA 3E5MA 1EJBA 2OCIA 4BQQA 4U2KA 1FQWA 1TM7E 2VH5R 1DFDA 1E9DA 3D6MA 1GGVA 3PQ3A 4ZEXA 3UY4A 4Q3AA 1E5LA 3EE6A 5KFYA 1KAGA 5K4HA 5JTUA 3QWBA 4CYMA 3RUFA 1JB0C 2I6WA 5DHPA 4Z4IA 4IKAA 1R6XA 2Y1IA 2QQ0A 2G9UA 3VTZA 3QVGA 5HQJA 3FYSA 1G6BA 2DRIA 2CWWA 1G5FA 1LQTA 4EU0A 4CUZA 5KOHB 2CNNA 5LJ3Y 5IASA 1AKWA 5IC6B 3T4UA 4L4YA 1O6GA 5AKIA 3UUGA 4L74A 2EZ4A 5HP1A 2OP1A 3DRXA 3VQTA 3U48A 3EDRA 3TEGA 1EH5A 1DBSA 2VDVE 2WTEA 3UHFA 3KQVA 1THZA 3HO1A 3GAFA 4LY6A 1OGJA 5EDWA 1VMDA 1SULA 3TPCA 1YTYA 5FLXU 1C4WA 1DAEA 2R65A 3QJGA 3GLGE 5JUMA 2BC9A 3KSBC 4FJ1A 2C31A 1JAZA 4D9MA 5T57A 4UZFA 3GWZA 3ZY3A 3AEUB 5DM1A 3HCEA 1T4CA 5HEKA 3W1EA 3RLIA 1ILWA 1KVKA 1KQNA 3QMPA 4TXNA 2BEUA 1O4WA 1SJ3P 4N7RA 3IAM6 3QGMA 3LKVA 1PYOA 1UA1A 4QUDA 3ZZZA 3Q5DA 4ECEA 2OSBA 2PMCA 1EIWA 3GJRB 1VJTA 2Q6LA 1IKWB 3RQIA 3I4HX 3L49A 4U00A 4C8NA 2ZJ7A 4QVKA 4ZN1A 1UWKA 4C0HA 5L1JA 5A62A 2CJWA 1PVOA 1BN7A 2WHOA 1RZ3A 3I82A 3TGWA 1NQAO 2P41A 1XD8A 5DT2A 2HPZA 2YZMA 2AZ1A 1BHNA 4HOYA 5EPEA 2X0IA 3WLMA 3U1LA 2I3ZA 4FYVA 1RVV1 4LF2A 4X9XA 5D00A 2EIHA 4N3BA 2JI6A 3VHXB 3HCOA 3A06A 4J4BA 3C15A 1P29A 5HN0A 4DT1B 2DXEA 1JKHB 3NI2A 3WL6A 3MWFA 4CIDA 4YRSA 3V7NA 2HHPA 4F4HA 4YR0A 1AV6A 4F84A 2WPDD 4ZQCB 1MQ8B 2WD7A 4BJ1A 5JAUA 1V43A 4DNPA 5DG7A 4LFBF 2Z4PA 5JYBA 5L6MB 3Q22A 4NECA 1MLDA 1GTEA 2FP4A 3N28A 1OS5A 3HYNA 4CFZA 5IN5A 5IM0A 4DDWA 1C50A 3CPJB 1A71A 2MZJA 2YHAA 1II0A 5AJVB 2IYGA 4G0WA 4EO6A 4QM6A 1MG5A 4W99A 4HQ6A 2A0YA 3IPLA 2Q1SA 2XGQA 2HMAA 1U1PA 1QC5A 1L5OA 2RHWA 2QM8A 3L8DA 3LLUA 2U1AA 1VCHA 5JSYA 2XBLA 3LP8A 2WSLA 2CMFA 4A6DA 3UQYS 3WYNA 4QPPA 4QDUA 2Z95A 4L07A 3CX4A 4KFCA 2PLRA 4ZP8A 2P5UA 5CYOA 2X3UA 5LJLA 4KNYA 4YO8A 1TYAE 2WUVA 1JLAB 1EESA 3OHSX 4U7UK 1E2UA 2QRVB 4Z0TA 1ZFNA 4PNEA 1VQ8S 1XHFA 3SBMA 3I9KA 5G3YA 3L79A 5DBHX 1UZLA 3V42A 2ARKA 3KLEA 3TTUA 2GYUA 4DZ6A 1W29A 2JFOA 3VYUB 1SFRA 3IJ5A 3ZDZB 3P0JA 3LQVA 3JSMA 2ZDGA 1VHWA 1SPBP 3CJ0A 4F3RA 1NZAA 4TTJA 4MUXA 1I7QB 2OLEA 5CFZA 1LJ8A 5KOJB 1UBSB 5FV7A 4Z4CA 2E55A 4I2PB 1A9RA 1RACB 4UHDA 4WNAA 4YJKA 1A8QA 2IHBA 1YCFA 3TLBA 1Z6ZA 3KK3A 2K2QB 3KQWA 3L02A 1VYHA 4GE0A 1XX6A 2LKDA 4Y1RB 5HUQA 1MH9A 3NVDA 4EYIB 4ZZIA 1QSSA 2O7QA 4Q4DA 4DF8A 1TW3A 1Y48E 3QHPA 3HJVA 2BANB 4QAJA 5E9AA 3BKUA 4ECXA 4R9RA 1KP6A 3H5RA 2WF5A 4UTXA 4OV6B 3R9XA 2IBOA 2J87A 3RR2A 4AKSA 4Q8EA 4OAPA 4MITA 4XIIA 3C39A 5FDFA 1N3LA 1SL1A 3HCBA 3IMFA 3LPLA 2V50A 5BURA 1YE5A 2WT4A 5DX0A 4B32A 4EVSA 4H3VA 4Q9JA 4EG7A 1QIMA 3NJ4A 1RQPA 1I3OA 2KJWA 4KQCA 3OE4A 1UPBA 4C7BA 4WASA 3M2PA 1BU8A 3WB1A 2GO8A 3JTEA 1E1DA 1Y7PA 4EMDA 4QYXA 1V39A 1DIGA 3SZMA 5CDYA 5DLYA 4KWTA 1R7RA 5F2KA 3TAUA 2I6XA 4LFBB 2P30A 3PDIA 5I7AA 2FK7A 3G85A 4YMSA 1BUXA 1BS1A 4GBGA 5FUQA 1XMVA 3IPYA 1K8XB 3WNQA 2C5LA 5JWHA 4X6LA 1YG0A 2MQQA 3JQAB 1JJAA 1G3UA 4KODA 1OAOA 3PNOA 3HY6A 5TPWB 1UMCB 2HK9A 1YQ9A 2ENUA 2Y1JA 1TJPB 1X1QA 5ALEA 5BUCA 3FPHA 1GSIA 5J2MA 5AR1A 5AE1A 4BU0A 4NEHB 2UXBB 1QOPB 2W58A 5HK8A 4M46A 2YWEA 1HDGO 5DGHA 5IT5A 2P3OA 4GFDA 5E6RA 2HXGA 4R6XA 2PIAA 121PA 3G6VA 4HEHA 9ATCA 1L4MA 2DFDA 4N49A 2ZRCA 4OKIA 4HYKA 2MU1A 2BJ1A 1X4DA 5D0EA 1JLCA 3ZW9A 3DMPA 5CXUA 4B3BA 1GKKA 4L5AA 2CK3D 1G3OA 2ZKTA 3ZDYB 3MJFA 3M6WA 3RU7A 1TKTB 1XROA 1NSFA 3BIWA 3IVMA 1CBUA 1NNDA 1CR2A 1W8DA 2V7XA 1CJUA 5TPZA 1VL1A 4LYDA 2YCLA 4YS2A 4R1PA 3PU6A 5AKJA 3QY9A 2DFLA 4RDHA 3FPLA 4DPWA 2DFTA 4DSZA 4TLDA 4P10A 1T9DA 2YWRA 1HRDA 3DI6B 2I6QA 4YUVA 5EQJB 3FCEA 5HM8A 4WIAA 3HHPA 2ECFA 4K6KA 3WLIA 1YJXA 2JJQA 1TAHA 3I6BA 4CQMB 4NV3A 1IBCA 2VDHA 4YRJA 5HAOA 3GLKA 4DUZJ 3OPMA 4F3MA 4QEKA 1DQ8A 2VPYA 2CPDA 2LD4A 4RBUA 5ICFA 2DEUA 3G9UA 5LFAA 2D8MA 4XDYA 1W25A 3VPSA 1YDFA 4P4LA 2P40A 2O66A 3K4HA 4JVSB 4EZIA 3MJRA 1ZICA 3CD7A 4USIA 4BFVA 2XDQA 4EB3A 3RAXA 3OURA 1E4EA 1AGNA 2Q21A 4HNHA 2FMXA 1Y33E 3BQ2A 1UFVA 1JQAA 1V5WA 3E5NA 5KFPA 4U6PA 2Q45A 3P26A 4MYSA 2XI4A 1GYRA 5FBVB 2F90A 5G53C 2PZKA 5I7HA 5LQNA 5EZYB 2YWWA 4AW9A 2K06A 3CH4B 4BOYA 1NP7A 1SGWA 4FD2A 3Q2KA 3FRHA 3GDGA 3AT1B 4LRAA 3KXPA 3NNCA 2B9VA 3G0GA 1X7HA 2AQ4A 5F76A 4FGUA 3PR1A 1ONBA 3VAIA 1FB5A 5KCMA 3IILA 1G5TA 2QSYA 5D0GA 1TVMA 5D0HA 1J97A 1RISA 1LV8A 2CNKA 3NOOA 3C6TB 3LKZA 4JUBA 4JV2A 3LHKA 3QV2A 4NSNA 1T6NA 5CB4A 2W6JD 2M3DA 5JY6A 4QOGA 5JZMA 1FXUA 4PGAA 1BFUA 2JW5A 3AC0A 1OLSB 3RSCA 5GMOA 2J0SA 2Q9AA 2XR1A 1NKSA 3ISTA 5E6UB 2GCEA 5FPYA 3E9ZA 3RH0A 1VKZA 1BGWA 1EP2B 1TJNA 3TW6A 3OR1B 4ZOLA 3N70A 3VI3B 4BMVA 4BNJA 3T38A 3HCNA 3B5EA 4X66B 1K7YA 2G82A 2R1ZA 3SFZA 2ZIUB 3L8EA 4DL5A 1XLUA 2XJ9A 1RTDB 3VVTA 4TL9A 3IEVA 2A14A 5FL3A 4YECA 2P1RA 3MS2A 1EWKA 1N5OX 1YQXA 2W2MP 4S0MA 5K51A 3CRNA 2IDJA 2C2OA 5B1IA 4I4TA 2ONYA 5J1NA 2AYXA 1UC4B 3GJ3A 4TY8A 1II8B 3BHJA 5INTA 1Z47A 1Q0SA 4HDNB 1N9KA 2O57A 3BDVA 3X3HA 2ZB4A 5EHNA 4DV1F 3WLAA 2P91A 3D02A 4OCZA 3F4KA 1DJLA 5SUHA 1E3TA 2VZLA 2QG4A 4A82A 4DT1A 1N6NA 3EXHA 3VAKA 4US0R 3IBCA 3PDNA 4NCNA 2CCKA 3KHGA 5C34B 3QH4A 2AJLI 1U31A 3BGSA 2FE1A 3JRXA 2NYRA 4UM9B 4H54A 1OSNA 1GMWA 1RABA 1RUSA 4F9FA 3UH0A 16PKA 1HWKA 1CJKB 1UDCA 4PNZA 4TGLA 3S29A 1R88A 1ENOA 4X20B 2B8JA 1MIOB 3MRVA 2K1RB 3T8YA 5AMXA 4DDKA 2AXEA 3MB8A 3F1KA 5CA1F 3RKSA 2HQOA 3EVAA 4B48A 1H5UA 5AJ3J 1JHMA 3GBVA 3C5CA 3SFTA 2HGNA 2I87A 4FS2A 2PS1A 2QMWA 3CEMA 1KERA 2WAOA 3CF0A 1QHFA 5D1NA 1P1LA 1IN5A 5HF5A 2DUMA 2M2IA 4K9RA 1GLGA 3ROQA 4QDTA 4ND8B 4NA2A 3EUFA 2IZ1A 3S7TA 2G9VA 2QPLA 3DXXA 3FI9A 3AJ8A 3AR2A 2GO7A 2O0LA 1RZMA 4DARA 2ZTMA 1H05A 4L76A 3USES 2XZLA 4L3KA 1U0HA 2A94A 2D5BA 3TBHA 1J5XA 2GJ2A 1T3SA 2R60A 2I6UA 3A2KA 4I2QA 3LLMA 3G9XA 1FTYA 4I99A 1N25A 2VBCA 3OP4A 2IYZA 4IMJB 2RD2A 4R2WA 2V8GA 1WNTA 2ZRLA 3W2IA 4DL6A 4IDHA 2VOJA 2LQBA 3CMCO 1VHIA 1SUFA 1REVB 1DXHA 2CMKA 5TQ2B 2JK1A 1X42A 4N40A 3TJAA 3HZGA 4C7QA 3K5WA 4WBXC 1RTJA 2W22A 2OD7A 1NVDA 4XLLA 3L5OA 2VNHA 4XGQA 2AOUB 4Q3KA 1P6UA 1KEEA 4TVKA 5LCXA 3VU9A 4GPTA 3QTLA 1WCV1 3FOWA 1S9EB 2G36A 4ZYWA 4I4NA 4EEKA 4OU4A 3GVCA 3RFTA 1VMBA 4J9UE 4NOJA 2VG5A 1TK3A 2XXAB 4GBJA 1QK3A 3VH4A 5C5JA 5HHTA 3RB0A 3IT0A 1MP0A 3LCMA 2BEKA 4ZVOA 1E9VA 4I14A 2J09A 3NGTA 3SOPA 4FMBB 4RU9A 2DNOA 4PWDB 2O1XA 2FOIA 3GC6A 1X1EA 4ZVSB 4XRGA 1I3MA 2AXNA 5EE5B 1KTVA 4O4IF 1PR9A 1K7SN 2D5LA 3KTDA 1HT0A 2UXCB 4ECTA 4FNHA 4YBRA 5JVGQ 4G4SP 4ECAA 2NZ8A 3ZXYA 4JBIA 3AA9A 3CPWR 5H9EK 5LJIA 4G0VA 4AMBA 3KXDA 1ORWA 3S81A 2BFMA 1TTQB 4HAZA 2WIFA 1LW7A 1ZK4A 2YC4C 1U5CA 2HZCA 3EAGA 2RMLA 3OJ0A 3FMVA 5F77A 2BP7A 1DC3A 1E99A 2YWCA 2ZE2B 3OE5A 3GN2A 5AP9A 1E3QA 3HA5A 5KKCA 3IWLA 5E2AA 3W2TA 3OQ6A 1MN7A 1PS0A 1HRKA 3T3MB 1Q77A 4MKAA 5DO2A 1PW7A 3GONA 2AOTA 3UKDA 5K9ZA 6CHYA 5JXGA 1B41A 1UJNA 1RVDA 2WP0A 5FWNA 4W5RA 4EZEA 2HWXA 1XHLA 3OO0A 5K8TA 5FADA 2ASLA 1M1YA 4ONEA 1WC1A 3L0ZA 3LHSA 1IKXB 4JI0F 3PEUA 3IRWP 2B78A 4UHHA 3GUZA 4RADA 1I3KA 3VU8A 1YU6A 1H2AS 1KZ7B 3BSFA 2PFGA 1LS1A 1YB1A 4DSLA 2FGOA 3VPFA 2HWTA 4QFMA 4LTDA 3FC9A 4FNMA 3IEXA 1RCUA 5AUOB 1CQIA 1E3SA 1LNQA 3G9QA 1QU2A 3L7PA 2FN3A 4GI7A 2V1XA 2IUTA 3AUUA 2ZC4A 2IV7A 2OC9A 1WMDA 4CMEA 1A5ZA 2WA2A 5FT9A 4RJKA 4CQMA 3P7MA 4TYMA 2Q3BA 2SKCA 1M2GA 3DHWC 2ADBA 2CJPA 3BXPA 1V48A 2C8JA 1OV6A 1GIAA 1HNZB 4G4JA 2IXTA 2OK8A 3AR7A 4LHWA 2XYHA 4PZUA 2J76E 5B1EA 3UJHA 3GJYA 4Q4CA 4JEUA 3T1YJ 5DYGA 2IHZA 1XTQA 2YXLA 3WB2A 4I69A 3B4MA 1SM4A 3BSCA 1YZVA 3GFGA 4R1UA 4HJXA 1TVRA 1OGIA 1N2CA 3CCVS 2IH5A 1S0MA 3R20A 5KNDA 4C5CA 3FZ2A 3ZIUA 2ZUVA 3JXOA 3PL5A 3FZYA 3AW9A 4RFLA 4OHPA 4CH1A 3JYTB 3CRVA 1HDCA 4EARA 2V9CA 1IBLB 3O7WA 3QMWA 4DQPA 5AXDA 4EF4A 2XY5A 3E03A 3M1LA 3GP9A 1C0PA 2P5YA 1UWVA 5IUJC 4M89A 1AQLA 2YDYA 2KYZA 4OVKA 1S5PA 1XZCA 1WD6A 2ZUUA 3FFAA 3M1IA 1HNWB 2WB2A 4DJEC 5J2TF 1FX0B 1ZOIA 1W7AA 1CUZA 5CEEA 2I22A 3EZNA 3PP8A 1W30A 3UA3A 1FUIA 1XALA 4K7JA 2A4KA 5CFPA 4MRMB 3GYXB 3ZG6A 3RRGA 4W4MA 4NPCA 2G4VA 3OZAA 5LSRA 1IZZA 2GN1A 4UUOA 4ND5A 4Y3CA 1XEWY 1OCEA 2GOYA 4M1SA 3HKZD 3R7DA 3GJRA 4B1FA 1ZKMA 1DTWA 4DLPA 1F0PA 4TYPA 4PFKA 2DJ5A 3KK1A 3IDZA 3BS9A 4QUGA 1JIVA 2V7QA 1SCBA 2VNIA 1AX9A 5I7SA 3NWBA 3DXBA 3BSSA 2YKNA 4DG9A 3THYA 3VNRA 3I8XA 3IJPA 1YQTA 4KGKA 1VI2A 4IIJF 4RQAA 4DDHA 4AL5A 5DN6D 3B36A 3EDMA 4IKPA 2B5OA 4RTJA 2ST1A 3QJYA 2YNHA 3ESAA 1QM9A 1XEXA 1E5QA 2A6MA 3J80A 2QROA 2VPWA 2R4UA 1YS2X 1ISIA 4INOA 3W5HA 5KI6A 2HSGA 5EJ4A 2ZRDA 1ZQ1A 5DLFA 2B4OA 2FZLA 3DMDA 1FJHA 1H0HB 4ZAFA 1Z34A 4MKRA 2ERRA 2XQJA 1Q21A 1XMOB 5TGTA 2JLEA 3RJ5A 4H1TA 4UBIA 3A0UA 1JPVA 4GWGA 3F7MA 5GIOE 2Z2MA 2QTRA 4BMPB 2PSZA 1PR2A 2FHOB 1OHHA 2QSWA 4U6NA 4IMRA 1SCUB 3V6LA 3VC2A 2ANCA 5E4TA 2XT9A 1C7QA 3HUDA 1QHEA 1RHUB 3L8CA 4C7XA 1SVOA 4W6ZA 2JEGA 1KP3A 2XITA 3QFCA 2ECKA 4YI3A 3LLCA 4URHA 2XMQA 1N33J 6REQA 2Z8XA 4HNAB 5KYNA 1RM3A 3I5BA 5DEIA 1GL9B 1PGOA 1YB2A 1G59A 4H9GA 1FCJA 2WM9B 3EIOA 4EYQA 3STUA 1FRHA 2G04A 2DETA 1TQ6A 2CNOB 5KFKA 3JSXA 1UDAA 2WJJA 4BZQA 5ALQA 2ZAOA 1B16A 2VFVA 2G40A 3WMXA 1SU8A 3GJQA 1V1RB 1CDOA 4HZUA 4JB8B 4PG7A 2E48A 3LALA 1EETA 2V3VA 3GA5A 3U9LA 5KFMA 1LPMA 3VDXA 4IFBA 3V5NA 2WTBA 4YR3A 4JQZA 1BX3A 3GLHB 5B36A 2FEXA 1FY2A 3QFFA 3DTYA 2GVDC 2IHYA 3A1DA 1TJ4A 4E30A 1JWBB 5JAZA 3EXEA 1GL7A 4QOFA 2BQRA 4JB3A 1UMJA 1ADCA 1FRKA 2CNWD 5KOJA 1YC5A 1H73A 1GKYA 3QFTA 1VBFA 1XPUA 1U0HB 1IM2A 4O29A 1A9PA 1GCUA 4GLFA 2J6TA 1XQXA 1MAUA 2O8FA 1P2GA 3CN9A 3N5CA 4XQCA 3SVLA 1N8SA 3R5CA 1KKMA 2PH5A 3PHJA 1NVEA 1HLDA 3ACBA 3K9CA 2DNLA 5KVVA 3DQPA 3RS3A 1QZ3A 1U6KA 1LSOA 1K7FB 2VQ3A 1Z4NA 4CWAA 2BMFA 1WI8A 4D46A 1IUPA 1ZXLA 4RD4A 1DCMA 1BH2A 1L7PA 1I94J 3NIBA 2EFHB 1UDWA 5K0TA 2MLZA 3SIRA 4BU1A 3PR2B 3GEHA 2GJ4A 3NBQA 4Y9UA 5DNEA 3N5BA 4WKPA 2YWXA 221PA 3I55S 1BIFA 4KV8A 1DO2A 1WG1A 3OQPA 1T3TA 3J7AC 5CVJA 3DFKA 2UXCF 4GM4A 3KUUA 4AZ3A 3MMXA 1K0TA 3CURA 5E3PA 4TTRA 1D5CA 3D0HE 4GZMA 5H4GA 2Q4OA 3E7FA 4M60A 4FW9A 4XD7A 5FFFA 2VHTA 3MVEA 2H1WA 2D2FA 3BGOS 4X62F 2C00A 2JGRA 4HC4A 4PWDA 3FD8A 5LYJF 4MT1A 2C7VA 3ANYB 1BDJA 4XJXA 1WXFA 2GQQA 3SYLA 2C0QA 4Y0AA 1X7VA 3R6GB 4WECA 2ASEA 1MB2A 3CQ9A 3UT5B 2VFUA 1OJ4A 2VZ9A 4CV0A 1KI9A 1DPFA 2MZSA 5J1SB 3W9UA 2DGQA 2FSIA 3I2IA 2EF0A 3T94A 4LZPA 3MM9B 4U2EA 1LPSA 2XS2A 3NEAA 3G5TA 3CX6A 2LVBA 1VJRA 4MR7B 5D5QA 5E6RB 3C8UA 1RC8A 2OO5A 5IT0A 4IR1A 1OH6A 3OWXA 1J5PA 4OXIA 1YI2S 2XY7A 1IQTA 4YV1A 1JEQA 4MCIA 2JBAB 3Q2IA 1I10A 5K0BA 1JLCB 3K0CC 3Q7PA 1W88A 2ZJ1A 4KVGA 3ZU6A 1XZQA 5HMMA 3I0NA 5I8WA 1R8YA 3RBEA 1FKPA 2RF2B 2W8KA 3I9V6 2Q9CA 1JDUA 5SYNA 2OV2A 2R1TA 2IZOA 1UPAA 1VG8A 3UXEA 2BSAA 4PYMA 3KLPX 2Z2LA 2VODA 3KR1A 3SZGA 4QBTA 3JQCA 2QTZA 1JIXA 4DIOA 3V8NA 3KKMA 5JSZA 1G3IA 4YLGA 2A1BA 4DXHA 1G8GA 2O7RA 4K1XA 1L4NA 5CJ2A 5CT9A 1J2JA 2Z8YM 3K5PA 1G2PA 1TMMA 4JL5A 1CFZA 2VP5A 5CYQB 2HMYB 3F8WA 3C1OA 1UEJA 2FQYA 4RH0A 3R75A 1MC1A 4JLJA 1SPBS 2RGRA 5CA0B 2VTVA 3ZTQA 1HETA 1JT9A 4J9RA 5AHXA 1LLDA 4HDMB 4Z8XA 4DLLA 3GEBA 4GOJA 1Y89A 3NNSA 2QTAA 4IGAA 1D8YA 3ORQA 4RXUA 4GVPA 3UMSA 3ZK8A 4BMNA 4ZQIA 4BECA 2IH4A 3CW2A 4D5GA 1VB5A 3K58A 4G8JA 3OC0A 4MK8A 2LTAA 1SKSA 2BMDA 1C8KA 2VSNA 1PV4A 1Q84A 5CFQA 3HI9A 3FBTA 3DVQX 1X5SA 2GEFA 3EPIA 4FCTA 3ZOZA 1Y5LB 3D6NB 4J76A 2XNQA 2SCUB 1OMOA 3A9VA 3UGTA 3DHNA 1H6CA 2ZH9A 1UBRS 4B3TJ 4WHMA 2DBVO 3KUKA 4IY1A 4WIIA 5E3RA 2G5GX 1G17A 4H4MB 1RI1A 3G6WA 2ZJ6A 4DV6J 1P9QC 2ZOMA 3RC1A 2PQMA 5FUVA 4RNDB 3LY9A 1SJ1A 2WTFA 3NOQA 4G89A 4R2IA 2AVDA 4JI8B 4J4HA 4KTVE 3ZGNA 1UK6A 3FSRA 2VJLA 4N3GA 1YZGA 3O7MA 3FHJA 1JVBA 2O1SA 1FA0A 3BMCB 3MWLA 2G5TA 3CCCA 3RVBA 2O2IA 3HXPA 3W8PA 3AEXA 1I0ZA 3CF5Q 1XVUA 3FSGD 3GHYA 1TF2A 1R0AA 1M7HA 4J7CA 3DVRX 4ZOLB 1VI5A 2WYUA 3TLCA 4QYSA 2HQCA 1Z1ZA 1OI2A 1JI0A 3QU5A 4H7HA 7REQB 4GAEA 3HHLB 3GVIA 2R3VA 3K0KA 3SSAA 4DL9A 4UAGA 1UBTS 1POXA 4HDRB 1D2GA 1HF3A 2QDKA 1G8KA 5LN1A 4F5EA 4GXTA 2PDAA 3BM5A 2ZBCA 4NCXA 3DHVA 3Q8SB 2ZTLA 4MV3A 2R00A 2GX6A 4DLRA 3U5TA 5ALDA 4I4TB 4PPQA 3ZVLA 3PRDA 3TOQA 1CDDA 3IAM9 4B3MB 3PC2A 2VDWB 1KDPA 4DCJA 4HR2A 4AJPA 1QAIA 4ZVPA 3LYHA 2MJUA 3O3MB 2MYFA 2ZSEA 3KHKA 1GTHA 4P83A 2DY0A 3LQRA 4BNKA 4LRUA 2IF0A 2CXUA 1S2NA 2W2MA 1JG4A 4D9KA 3B38A 3LOPA 1T0JB 4DAEA 3R24A 3UCXA 4N77A 4FDMA 4EELA 2FSVC 1Z4UA 5AI0A 3OCWA 1NGSA 2QVBA 1BD3A 4DR4J 3TE6A 2HRUA 5H4HA 3E3AA 2I4IA 2J48A 3KLNA 4PICA 2NUBA 4NKRA 1Q22A 2JKVA 3FYUC 4PBTA 2GKSA 5E8JA 3HDVA 1LX7A 3VAAA 5JATA 1MN9A 5CT6A 3TJZA 3BDAA 1N34J 3GYNA 4IH7A 5GMDA 1QFMA 3WI7A 2X3GA 5K8UA 4N5DA 4N5HX 1OJ7A 3JYHA 3TANA 3BJYA 1R0RE 3KNAA 4DG8A 3H1TA 4QPTA 1J0EA 6REQB 3RUDA 2YJNA 1M1HA 1TK5A 2UUCJ 3FUVA 5CGQB 1Y8QA 1V1JA 4ASUA 2H3EA 1G41A 3NFRA 1E2GA 4DLKA 3SZUA 2P65A 621PA 2P8JA 2O3QA 3EBPA 5J3JA 5F5LA 4YQWA 3HXTA 4QDJA 1WD5A 2ASJA 2XB8A 1CX9B 3J80U 3H4BA 1GUFA 3IUEA 2OAEA 2OBNA 3DOFA 2BUBA 1V9LA 3RHTA 3JV7A 4NESA 3OFND 3BTUA 2IIQA 2XCQA 1TO2E 3HJUA 13PKA 1QWSA 1EQ0A 4N0QA 3C5VA 3H9UA 4BAZA 2O2GA 1GHTA 1FLDA 3NLCA 2YWJA 3GFTA 3NGKA 1LBTA 2PXXA 1T36B 3UR3C 1AGPA 1SEVA 1FK8A 2OV1A 1O87A 3U3OA 3B3FA 1DU4A 4AWXA 1NXPA 2VHXA 5BR1A 1SC3A 5F8HA 2LDXA 3JVVA 5TQ2A 3HGMA 5CAEB 3L8GA 2C9OA 3R7NB 2OGWA 4QVIA 1JLBA 3EPHA 2X77A 2M7SA 4BPBA 3IKMB 3MWYW 5GAGI 1LU9A 1W87A 3GV0A 4KR9A 2A57A 2GYVA 2W2PP 1ZMRA 4C03A 4ADSG 2A5FA 2ASVA 3FTCA 3DT6A 1V4BA 4DR6F 4DHVA 2QU7A 3IAFA 1DJOA 2OAQ1 1OWNA 2MHNA 1SU6A 3HA2A 2KFZA 3LO5A 1X15A 2FEKA 3O2QB 2H7XA 3IODA 5LIRA 4NNOA 1RP5A 4MV1A 2WA1A 4RDCA 2H63A 1GSHA 3CZQA 1O5TA 3KTQA 1PQPA 1HE4A 1U4SA 4WOBA 2VHEA 3MCUA 1IRIA 3BSNA 2IYFA 4B9AA 2XKKA 3C6BA 4EUKA 3TX8A 4JI2J 4TZKA 4PCLA 4X93A 4AT1A 4M54A 3PCRB 3UK1A 1C80A 5T5QA 2O8NA 3ZZTA 2YQZA 5FWYB 1M67A 3JQQA 4V0LA 2PT0A 3O73A 2Z30B 4R3NA 2R84A 1AUOA 3AHPA 2G83A 2R11A 3SC4A 3U31A 3Q7IA 2ZUSA 2EKZA 4ARZB 2BKXA 1N5QA 1CZOA 5F3RA 3U7EB 3NWRA 1XXHE 2VQ6A 3S1AA 5A71A 2XTNA 2ZIXB 4YFUA 4K2AA 5AKYA 4HWRA 2D00A 2OXEA 2JA2A 5HP4A 1Y82A 2WJAA 3CUSA 1UZAA 4IH1A 1EFRA 2Q0XA 5D87A 2VKQA 4G0PA 4MPTA 5K8NA 3M8SA 2GASA 2ZD1B 5EHZA 3T3OA 2RJNA 4LXIA 2A9PA 1XR7A 4BO8A 2J8AA 5A1TA 1NUAA 3CZ9A 1U0LA 2HQ3A 2NTNA 4I7EA 1B3BA 2P3LA 3O47A 4D8VA 1ICIA 3BWDD 4E12A 2PUBA 3FF4A 3OE7D 2K2WA 4F3QA 3JX9A 2VNAA 1P27B 4HH4A 1ND5A 4P4UA 5P8WA 3RBDA 1F6TA 1JKXA 2P6OA 3Q7SA 4J9LA 3DWFA 1P3JA 1QS0A 2X9QA 2YNFA 2PAFA 1E7YA 2AJ1A 4FF3A 3WIBA 4EW6A 2GO9A 3WK4A 3G7SA 5KFSA 5GMEA 1V2HE 4YROA 5FXMA 4DV3F 3O94A 5M2UA 3FBFA 2B92A 1QTIA 1ZM9A 5DK6A 1YIOA 2RS2A 1C1YA 3JCZA 3N3AC 1AUPA 1W93A 3PUWA 1ZAYA 5CB4F 4XIJA 1NIJA 1VIDA 4MYDA 3CJ3A 3BF4A 1USKA 1W2BR 1JQJC 4F0HA 3TMYA 2X4LA 3BMQB 4HS4A 4UZSA 3U7FB 4DIBA 3PFGA 1HOXA 2APJA 3PTZA 2WONB 4GYYA 3PGKA 5ARDA 4O25A 5LP6A 4I4BA 3RI3A 5J47A 4LZJA 1M8GA 1A5AB 1RMYA 1YB5A 4YJ3F 4WAUA 2FLKA 4QPDA 4LEIA 4E22A 3UV7A 2N3LA 3VZSA 4RULA 2IPOB 1UTAA 3FVYA 5GZ1A 1MMNA 5DM2A 2H5IA 3E51A 1A0OB 1WF2A 2F8HA 3VAFA 2DSNA 2AOVA 1EP3B 1A04A 3PWKA 3OCVA 3SEQA 1U9JA 4E5PA 2ZVSA 2JDJA 4TVAB 5KKNB 2XZDA 4REQB 2Q5FA 2HVHA 3RJZA 4G65A 1C9NA 1FP6A 3UMGA 4WV3A 4Y00A 3TZQA 2ZSUA 1YRXA 1N6KA 1Q0RA 5F9FA 1HQEA 2HKEA 1WEKA 3MD1A 2ONCA 3A14A 1ZVMA 1EB0A 3N2IA 2X8BA 3ZH9B 3OCYA 2M1XA 5AE3A 1FRMA 3FVQA 1BG6A 2PI4A 2W9AA 4CMEC 1I6JA 4NBKA 1UQRA 2AJ8A 3HGQA 1L3CA 1ZOLA 1U2GA 1NBOA 4ECUA 1U1MA 3KR0A 3RYIA 2NW6A 2YJ6A 9RUBA 5A7GA 2D9PA 1WPRA 3JYQA 4HQKA 3Q9SA 3WGQA 3AY6A 2A18A 3HGTA 1Q0HA 5GONA 3X2FA 4OLJA 4EWTA 1MORA 4I4TF 4QDXA 1KC3A 4HBZA 5J40A 3HB5X 2BEUB 3PLRA 4D0GA 5LKAA 2CVIA 3CF4G 1GSOA 3FOCA 4WXMA 4OSOA 3OQJA 4BCCA 2ORED 1ZD1A 4DLXA 2AUMA 4HH1A 3E9EA 1G8MA 4IP0A 3ZVNA 4LR7A 3GP3A 1HARA 4TKZA 4P32A 5FAXA 1FUKA 4L02A 3OT4A 3D54D 4MQEB 1ODLA 3W6OA 1DHTA 1F48A 5E2QA 2QUIA 3B7WA 7ADHA 1FTGA 2QG6A 4RKUC 3A3PA 4D57A 4NULA 2DXDA 1L5KA 4CCSA 2HBRA 4ZVVA 5K8MA 2FH5B 1H0HA 1K3FA 4EKIA 6PFKA 4WP9A 2VUIB 5H9VA 4I6YA 3NV9A 2ZWAA 3P4XA 4E07A 1HI0P 1GARA 2GVNA 3ZJTA 5K8OA 3UK6A 1MABB 3QPWA 2QTVA 4WADA 4O02B 4LK2A 3LY7A 4IICA 1IC6A 1NHUA 4KLNA 4XUEA 4DC0A 2J9GA 3GX1A 3AHJA 3I56S 4DIEA 2RKIB 3G2QA 1KMMA 3HL4A 3QX3A 3C3DA 1RFGE 2ZQYA 1DZ5A 5E9QA 3DMTC 1AKRA 2ICAA 3ECAA 1ATIA 1YMVA 4DR3B 2QRGA 3IHWA 4S2EA 4TMYA 3T1VA 1JSLA 1R3DA 2PX4A 5AXCA 3PNVA 2JGMA 4A6PA 2PD3A 1SO8A 2HLUA 2LZ0A 4BNFA 1GPNA 4DC1A 3GRZA 3PW5A 1R37A 1F9EB 2V67A 1GCAA 1JX6A 3CUVA 1JBEA 3UOGA 2MMYA 3ETNA 1KA9H 4FP9A 1DBPA 3WRXC 4EL0A 2HLNA 2GEVA 3PE3A 2BCJQ 3FYUB 3IL2A 2IDLA 3F6RA 1YJWS 4JB8A 2G3YA 1E58A 4QPXA 4DV7F 2AMYA 4NBTA 3ZV3A 3ZGXA 1U2FA 1V8FA 5FPSA 2PTHA 3Q12A 2YMMA 4LF7B 3ZBTA 1FJGJ 2NCKL 3PUYA 1VJGA 1O6CA 4WA8A 4YP5A 5KFFA 5D3MA 4KIGA 3G86A 4LYEA 5NLLA 2D2XA 1G5PA 3X3UA 1FESA 2EJTA 1M1ZA 2IUSA 3PACA 4U5XA 2WEKA 3GCZA 4Q4JA 3IR6B 3TVDA 2E5HA 2X9NA 3W4IA 4D41A 4YMEA 4A5SA 4YDDB 4UASA 4OX8A 3P9SA 1NK5A 2XD9A 1YKFA 5TY0A 5CK4A 1T3NA 2CNWA 3GZ7A 2IYNA 3HKCB 1RACA 5AXKA 3LPNA 4KQIA 1AZLA 3AU8A 2PC6A 4RHFA 2J3JA 2FEMA 2X51A 2MINB 4H3SA 1J2TA 1SG0A 4ZS6A 3R3XA 5TC4A 3I34X 2AN4A 2O2XA 4HN4B 4HRXA 5JQGA 2IPXA 2W2KB 4TTIA 3UI3A 4CIVA 1NTOA 1UC5B 4S04A 3JWGA 4M1OA 2YJ5A 2PYZA 4OHXA 1CIVA 3IBFB 2FEPA 4R8KA 4EY7A 5A5DA 2VXCA 1RK8A 1VBXA 1B23P 4YP9A 1MENA 3GLRA 2P3QA 1PR3A 4FHFA 4FPXA 4TXSA 3KSZO 3SZLA 2A0XA 2HKIA 1EA7A 2HS4A 4PLFA 1RWNB 3EXFA 1SJFA 3RADC 4P33A 1QFXA 4U95A 3PQ5A 3H87A 1NDPA 4BDPA 2E4AA 2E5LF 3RSSA 2YV1A 3F4BA 2QN7A 4ED4A 2PVCA 3P5BA 4AURA 1SZDA 4L72A 2GNOA 2XSZA 1NW5A 1K4KA 1C3OA 2G0AA 2QA1A 2FMTA 1VLLA 1KSFX 5JBIA 3VCDA 4AO6A 3EWSA 3LP5A 2IXGA 5BR8F 2WJGA 2VA8A 2PO4A 4OX9F 5KAPA 4C7JA 1Y6GA 3WGIA 1JKHA 3BEGB 1QO0A 3DLAA 1Q6YA 5DCLA 2Z9CA 2AR9A 2OCBA 3BL5A 1JNRB 5CHCB 1NK0A 1FNMA 2R6FA 4KK4A 4D3GA 1CEXA 3C8ZA 2NVOA 1XTBA 2Z0GA 2KFYA 4U63A 3WWPA 1E60A 3SR3A 2WF9A 3MBKA 2ZJQQ 4PNHA 5J1TB 3DLGB 2D0DA 3G5MA 3BRQA 4UD6A 2YHUA 2HU7A 4MI1A 5H7XA 3ZK7A 4KU4A 2MSDB 3WKAA 4ID5A 1J5EB 1ZH0A 2F4NA 2GNPA 3D3BJ 3MQ2A 1DKRA 1YB6A 3LX6A 5HE9A 5CT8A 2ZUGA 3DZIA 3B9PA 1Y5NB 3FKSD 3FF1A 2XJ4A 4HGNA 3PW7A 3H0CA 3E70C 2POQX 1V3UA 4WX2B 2C88A 2YKQA 3OQNA 2BA9A 5ALKA 4JP5A 4A27A 1E3LA 1ZNWA 3HFGA 2PT9A 3QO9A 2I62A 3UD5A 3EAQA 1XNRB 5J5VA 2UXDF 5K5MA 5FI3A 1OILA 5GOZA 3CLVA 1F8YA 1O94D 5HVFA 1HKAA 5BN3A 1EJ6A 4RV5A 1UOOA 1T0BA 4HDMA 1SWVA 5LWHA 4OZ2A 1IHOA 2KB2A 2FPIB 4GICA 3A7DA 4REMA 4B4DA 5CITA 4Z0HO 3LBHA 3ZFVA 3REFA 2VCHA 3TQEA 3TB4A 1S2MA 2J67A 1RPNA 4OXYA 4W5QA 3TVZA 4KJZA 1J7JA 4BNHA 5DH9A 4Z53A 1C7EA 2JEIA 5KYTA 5KVQA 3AFMA 1P2DA 2JD0A 1TKCA 4ZC1A 2AZ3A 2YHBA 2IPOA 2IXAA 4Y0NA 2FFHA 4G67A 1QMPA 2J32A 4R31A 3PHTA 4DR7J 5CX1A 4WE1A 4NS1A 4MVXA 1Q0UA 1PL7A 1WBBA 2V6JA 1FJEB 3TLGB 2QBYA 3J7ZT 2REXB 3PD1A 3LKDA 4DLAA 1ZITA 1OTXA 3LHFA 1QIIA 3WHPA 1UW9A 4IO9Q 3TIXB 4AO8A 5CK5A 1AUQA 3IT3A 4QE3A 5BR8B 2P27A 3N05A 1SNYA 4EFMA 3H8SA 1F12A 5JDCA 1EFTA 1RAEA 2DJWA 3AR6A 4CF6A 4L3WA 5M2RA 2FVPA 1M5PC 4RD1A 3AF4A 1A2QA 4KLCA 1B14A 1YJRA 3I8OA 4ITVA 3AEUA 4IVNA 3JQ8B 5I42A 1PG5A 4MIWA 1L6RA 2H9AA 2Z57B 1U49A 1FMJA 1JAIA 4HQ0A 1Z74A 4AJIA 5DDIP 1N5MA 3O8RA 4XIFA 3HBFA 4RBNA 4XSHA 4IL5A 1Q44A 1DAGA 2IRXA 3OTQA 5HF9A 3WRYC 1XLVA 4RLFA 3TAMA 1RQLA 2VTBB 2F3JA 2WPDA 3ZWAA 5HKKD 1R8SA 2RIJA 1EK0A 4WK1A 2XADA 2XB4A 5FOVA 3OH8A 2F17A 2C92A 2XF2A 1VQ6S 3U3JA 1SI9A 4X95A 4O0MA 5DDPC 1KJWA 2VF8A 3DE0X 2NVWA 3MR7A 1TKDA 5CYPA 3QHAA 4IFYB 4GPZA 1SR8A 4FYVB 4DQKA 1X38A 4PBRA 4GI3A 5BSHA 2CV2A 1ZSYA 2HQDA 3C15B 4QEDA 3L4KA 4BNIA 1FCAA 2VL7A 5LMUJ 4C0AC 2G88A 3E0QA 3PX6A 4S0ZA 2NZ4A 4OOEA 3P96A 4ZLJA 3K16A 1M5VC 1UJCA 1E79A 2LCQA 1W47A 4D0SA 3V4OA 5B3KA 1Y5IB 2EU8A 4YMWA 2ZBDA 4MULA 2QD5A 2RK4A 4NS4A 2O2HA 2NIPA 1C4CA 2J6HA 3T4XA 1RYHA 2ECOA 4OXRA 1JVNA 2D2VA 3EGNA 4Z7QB 2W7PA 2IS1A 4KQ6A 4R8UB 5B09A 1WJGA 3ASUA 3R5JB 3R5SA 1NSQA 1E3DA 3K35A 1RRGA 2XS7A 2RKIA 2C2GA 3AILA 1W6UA 3H5NA 4HLDA 1MW8X 4FE4A 4MXDA 4ZTUB 5D4PA 2ISQA 1C7JA 2DUNA 1QC5B 3NVMB 4O6VA 1G19A 3AZQA 4C78A 2HWHA 3LT0A 5EPOA 2GJIA 4RHEA 3ZQJA 2JHEA 3VNQA 2QJFA 3LUCA 1YDLA 2H3EB 2CLLB 1UBNA 1D2CA 4O3NA 1WUKS 4KQ9A 5GPBA 1IU9A 4WUTA 2HHAA 2AV6A 3T1HJ 5C8YA 3IAAA 3DEJA 2DTEA 4C21A 3M3HA 1MWQA 5C42B 2B8NA 2MQLA 3PEJA 1KTQA 3PFOA 1VQ9S 4CTAA 5L9XA 2VOOA 1N6LA 2D5AA 2AH5A 1QF6A 4U2GA 2R8KA 1RT6B 3R5XA 2RHQB 4R1SA 1JBKA 5BYJA 3D3CJ 1L5MA 2DTDA 2XWYA 2J0SD 3WKBA 2ACYA 1ZJJA 1MC8A 1HE5A 3AESA 3KG4A 1TU3A 3SC3A 2QIPA 4G84A 2HFJA 5DRYA 1P60A 3MLEA 5KG4A 1P2FA 2C61A 3IV6A 1RYEA 1TUBB 4M1MA 4KO3S 3UNYA 5KNCA 4USKA 3R5TA 2I1LA 4J4TA 3LRTA 1VJ0A 4ENWA 2EFQA 4QW9A 4FKZA 4ABYA 1CUIA 3H05A 1V5IA 2KXNB 4J1NA 3MS7A 4JC4A 3F9RA 2YNMD 2VTDA 1OQAA 4DRXA 3F5QA 3PKIA 1WEZA 1Z37A 2Y76A 3IHTA 5C25B 4C0JA 2W2KA 1LDGA 3R9XB 3SD7A 2FC8A 2ES4A 3CRQA 2WF8A 2YOFA 2JIQA 3R3UA 2CVZA 3BZBA 2HY7A 4MUKA 4DTIA 2A0FB 3F8SA 3UGKA 2R7TA 5AOAA 5JC1A 1VJQA 3VU9B 3PX3A 4R5PB 2D4AA 2QE5A 5DM0A 1XAJA 4ON9A 4UVEA 2HSEB 3KWMA 3M2RB 5DNYB 4ZPXA 5IANA 5ALVA 1RI4A 4D26A 4ZDKA 1YVEI 2XYQA 1R4MA 3R4VA 2XM3A 3OIDA 2XS5A 2PX2A 4MKYA 1T5IA 1RYFA 1KWKA 2ZTHA 2WIBA 4FMPA 3KJNA 3SDSA 1CT9A 4EUHA 3AB8A 2CL5A 1JDBB 1Q4RA 3GFHA 3KE9A 4DABA 3DC2A 4CIOA 2QIFA 1CRZA 2WD7B 1UC8A 3AETB 1T2NA 1VA5A 2MKYA 1NZ8A 4NR0A 1P72A 1YV9A 1YSJA 4Q0BB 5J2MB 3U4QB 5DEOA 2M98A 5KSPA 1VC5A 1X8DA 3RVJA 1EWVA 1DG1G 3EZ6A 8AT1A 2VHQA 1AQIA 4FBMA 4DXAA 3NTVA 1CF2O 5I9LA 3VR4H 5AVRA 1TFWA 4GQBA 2GZOA 4B44A 2VRCA 4GECA 1U3VA 4E15A 1NAIA 4M1QA 1PZEA 3ETJA 2CQIA 2MEWA 4IO1A 2E2WA 4HL6A 4B17A 2ZYRA 4OI6A 1EVLA 2XHEA 5JHGB 3LF2A 1F5CA 3I3OA 1S1XA 3RC3A 5DI9A 4CLDA 3R6LA 2AFHA 1CDZA 2DX7A 2Y77A 1S8FA 2IKSA 4X8MA 3UATA 5HK4A 1RJDA 5DXFA 3EWIA 3VGJA 4XVCA 3HT3A 3IAUA 2MSCB 1ZOOA 3CNLA 2QY9A 4YAWA 4HKQA 1GTVA 3TNLA 2BZ2A 1HWLA 3ZGOA 2R7WA 2YR0A 2C2WA 2VQEJ 2AI3A 3FTDA 4MPDA 3KZVA 5C2GA 1RAHB 1V1MB 3UO0A 3HNRA 2XRZA 2OHVA 4ND1A 2CN1A 4DRZA 5JROA 1E1LA 1EVJA 5EXDA 4IQGA 1GVNB 4CMJA 3HU1A 4DA9A 4L4SA 3VZRA 2IOFA 4A92A 3TTXA 3DNPA 1TP7A 1VSBA 3HDGA 3LXMA 4RW9A 4JU8A 3IUMA 5DZ7A 1HBUA 3G3EA 4Q66C 4RPJA 4LJLA 1ICEB 2GLUA 3SZ3A 3UT0A 2JH3A 1AOXA 4UXIA 5AVSA 4DR2J 4QJIA 4JODA 4WTOB 1I8TA 3WZMA 1ZIPA 2HD4A 2XDQB 4DIDA 2C95A 1WOOA 2WSCC 3UCGA 1TOAA 4HADA 1RWWA 1DDOA 3OFVA 1BAPA 1KD1T 3PVZA 5CEFA 3W8RA 1OWOA 2QUZA 3COPA 4YBZA 5FI1B 4DUZF 3LCVB 1VA4A 2HHSA 1NI4B 3U3ZA 5F1OA 3KXIA 2B30A 4ZAZA 1K27A 3GLGB 1M6WA 3DL0A 1W59A 1SK8A 3SJBA 4B3DA 4XO0A 3FFXA 3I04A 1TO1E 1LCIA 1VL2A 2QBYB 5JSQA 2ZRGA 2AJBA 3DDWA 4MWCA 4EKDA 3G1TA 3ZNNA 3LX4A 3R5FA 1DXQA 1HNZF 3ET6B 4XTRA 3NUZA 1W96A 4B87A 2CNKB 1YAJA 1S0VA 3BC1A 2ROGA 2CXOA 4XX0A 2UZ3A 4UMDA 1MC5A 2GZRA 4KB7A 2QVGA 1YJ9S 4PFSA 5K2MA 1ZK3A 2JFKA 4FLMA 3KB2A 1JG7A 3EEBA 3GYGA 4GKVA 1R15A 4TTSA 4BX3A 3OEHD 4BTEA 5E6UA 2HQGA 4FWIB 4D4MA 5ELLA 2FFJA 1KEWA 1Q7RA 3RSGA 1T1JA 821PA 1WZCA 1FHTA 5L7WA 4AL7A 2G09A 5HMWA 4Y1FA 4HT7A 3JVEA 1GLNA 2XBPA 3R5HA 4XDZA 1O6XA 4L73A 2R3SA 2B8WA 3I9OA 4JC8A 1M5UA 2OHFA 3LNTA 3TRIA 2JFQA 4Q2LA 4DUGD 2Q5LA 5BPHA 4MQEA 1ZAVA 2AP6A 1D9XA 4E8UA 1R9NA 2VJKA 4WZAA 2Q2QA 1UCNA 4TVOA 2FP3A 4MUHA 3GD7A 2Z2ZA 2CRLA 2OCGA 1AURA 4HDNA 1I01A 1SCKA 4HEJA 3TQ1A 3F98A 4S1VA 3K9QO 4FDLA 1H0SA 1FFXA 4RHYA 1KDYA 2FPLA 2VG6A 2WT8A 4Y28C 3DE1X 1RKJA 1TU0A 1IDN1 3W3AA 3A1VA 3NRBA 4V0MA 1WVGA 1KZ1A 4NCAA 3LC0A 2AJDA 4DQSA 2BY4A 1FSGA 3HCCA 3OG9A 3PC8A 4NX9A 1AQUA 4MR8A 3D54A 1MD9A 2GA9A 2LECA 2EZTA 3EY4A 3VXKA 1TTTA 4C8LA 1XQVA 2QPAA 2K7ZA 4YYZA 4KLRA 3KHLA 3W6UA 5T8KC 1K7EB 1C4AA 1OBCA 2GTPA 1HGXA 5D8HB 2I6TA 2K3IA 3A6JA 3PXGa 5T3YA 3HVWA 5L3QA 1NA5A 2CSUA 5LM3A 3NDPA 3BGIA 3UB4A 4O4LF 1E8DA 1SXPA 1RA6A 3KLMX 3JAMU 3GRVA 3O2JA 1JDPA 4B3HA 1V9OA 4ZCKA 2ZT7A 3VGPA 1X1TA 1UMDB 3IIJA 3LVRE 4FWBA 3ZDDA 4RD2A 4OMDA 5JCZA 3O1LA 3LCUA 2UVQA 4ITUA 2CLKB 1VHFA 3Q87B 1BWPA 5B7GA 1KOFA 2W2OA 1HR0B 2MZ1A 3DMTA 4C6TA 4GXQA 1KZGB 2VD3A 2XRFA 1JFVA 4CZ2A 1BGXT 2C22A 3MEGB 1ZGAA 3BEDA 1VE9A 2QXYA 3RBVA 3FBGA 4U7FA 3GB9A 3NIDB 1Q91A 1VC2A 4F4DA 5EPUA 4DNOA 4WXOA 4M5DA 1V16A 4YWJA 5L51A 2AZMA 3D7SB 1BVRA 4Z7OB 5IK2D 3BQ9A 5BOSA 1K73T 4XPIB 4JDUA 5LD2B 3ZKWB 2D3OR 4F2WA 2Z2JA 4YR9A 4TS4A 2HRDA 1HEIA 1UOPA 1U6IA 5EJMA 2W2TA 3ZLBA 3HKCA 2UZIR 4CYUB 1CZRA 4YJ3A 2JB9A 5I7VA 2BCEA 3ST7A 3YASA 2Y71A 2I4NA 3PPVA 2REOA 1M5HA 4KQXA 1DXYA 1WTAA 1REVA 2DFKB 3BN3A 4B7XA 2ODTX 2B4KA 4RPCA 1K9VF 3C3AA 3KC2A 3UENA 1XGKA 4TXLA 4BATA 2VEOA 4W1RA 2PRZA 1SCJB 4DFMA 2LXNA 2PKWA 4G0XA 4PCAA 3IPRA 1EB8A 4FYXA 4EAAA 2FUCA 4B6EA 4B2YA 4EZ6A 1F38A 3QW4B 1KEKA 2YV5A 3A3OA 1GRVA 3FKJA 3D0KA 2HAIA 5CIWA 3S27A 1PDWA 1XJ5A 3W06A 3M4ZA 1IQRA 3T3DA 3GT3A 4P7GA 3D6JA 2IWRA 4ZQEA 1JEOA 1QFSA 1ZWLA 3GJ6A 3C48A 2U2FA 4IWXA 1XTUA 4O44A 1QH1B 3E35A 2H18A 2JLYA 2CCJA 1JG3A 2YKNB 3AHFA 4DMRA 3PVSA 1ZK1A 3C19A 2WWWA 2NV2B 1FWKA 1U25A 1JKJB 3SHWA 1XG5A 1AA1B 1G6HA 3DSRA 3SK0A 2DUWA 3TD2A 2A78A 5IVPA 2RGXA 2BYCA 1KVQA 5AWFC 3TL6A 1HNXJ 1AGYA 3AJDA 4KFUA 5JIBA 1T0IA 3RC7A 3U02A 1VKRA 2BMAA 4NMHA 1DJNA 2WJ6A 3EULA 4Q5VA 2XWPA 5AW8A 2F1KA 1SUDA 3V2IA 3JQFC 1V3SA 2TMKA 4OHUA 2RHDA 2CXQA 3VH1A 4HN9A 1OZAA 4AKGA 1T4BA 1KU6A 1PT6A 3SX2A 1XNRF 3TVYA 4JZKA 3GP8A 1NE7A 4N6NA 2OCAA 2NYIA 2WYHA 2O6HA 3BMNB 3ILVA 4K4XA 1E3EA 4I19A 1IONA 1JXQA 3NXSA 5EQFA 5CDSA 2CQBA 4B3OB 1U28A 1U0JA 4KN9S 4N0MA 3SAJA 1YS4A 4DCGA 3BTOA 3N0VA 3VAYA 5EJIA 2X1MA 1JHZA 2V54A 1KYVA 4W8HA 2ZRAA 1L5FA 2Y9MB 1QZZA 3HZRA 3REGA 2IZ7A 2PMKA 3LUDA 5EZ5A 1UK8A 2VA3A 2DY1A 3A2NA 2WVAA 1O57A 4NCKA 4BFWA 1NMEB 1XDSA 1UXGA 3OFFA 3O9MA 1NMYA 2IS4A 1U0SY 1A98A 5CLLA 4ND8A 1SWWA 1E7MA 1WMFA 1TPYA 1GP2A 2NUAA 4UFNA 2CL7X 4FEAA 2C0PA 4TVBA 2XZPA 1GNQA 2VC0A 1K5DA 4IRMA 1VP9A 1IYZA 1Z8FA 4CEJA 3I9JA 5H70A 1XR3A 1C30A 4TSFA 2ODAA 3N86A 3KU4A 1Z82A 2DR5A 1KZYC 4B81A 3F7NA 2I66A 1S89A 1ZLYA 2AB0A 3ERCA 1CQWA 2FPIA 5JSUA 1PD0A 4AWBA 5DCWA 4JI0J 2H2HA 5FP0A 4X60A 3PJFA 4GOLD 3RB8A 4QFDA 3ECCA 3K53A 1Y11A 1R5BA 3P9CA 4TXJA 4KNVA 4OQ4A 2FX5A 1IAVA 5EYPB 1U3TA 5IC4A 1D7AA 1ZP6A 2A3NA 4PTZA 3RBXA 2C9CA 4WYWA 4QBGB 1TVRB 3OZEA 3JTMA 4AAYA 1VG0B 4IUCS 4CQJA 3IBTA 2XHWA 5HPYB 2FW8A 3PO4A 2RQMA 1UPUA 1W5EA 4F4WA 3AV0B 1OIAA 3GUYA 3REQA 1T03A 5G4LA 4G0UA 1Y5LA 4LF5J 1B76A 4QVGA 4YRPA 1S1UA 4B71A 4WCEQ 4NEZA 2NP6A 1P2TA 3RR7A 4KV8B 1FVXA 2CUKA 2F1RA 5T4HA 1R50A 1K47A 2WP8J 1ABBA 2DHSA 3T1YF 2DVMA 2OV6A 4BX0A 2C4MA 1KS2A 4I6EA 4RF4A 4NLGA 1E6EA 2HMIA 2RC5A 4UCFA 3E58A 1CNMA 5K3FB 5A2QA 2N46A 3O2SB 4PRZA 1B6RA 4IG9A 3CVUA 1TKBA 3CLKA 4V19J 1XLTA 2FSVA 3QWPA 1RPZA 2J5KA 4D99A 1NJZA 4QGHA 3Q2TC 1AF7A 5EJ5A 3V1MA 2MDAA