4JP8A

Crystal structure of pro-f17h/s324a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKHNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Increase in activation rate of Pro-Tk-subtilisin by a single nonpolar-to-polar amino acid substitution at the hydrophobic core of the propeptide domain
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 128
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4jp8A01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4jp8A02
1SUPA 4OV6A 3HJRA 5FAXA 1SELA 3TI9A 5FBZA 4KB5A 1Y4DE 1GCIA 3WIUA 3GCXP 2PMWB 4YN3B 3A3NA 1WVMA 2PKCA 1CNMA 4H6XA 3SQOP 1JEAA 1GA6A 3F49S 1SBCA 5JXHA 1TK2A 2ZWPA 2W2OP 2W2MA 1UBNA 4AKTA 1AH2A 4B5LA 1KDVA 2ZRQA 3LPDA 2QTWB 4J94A 4K8RB 2DQKA 3GCWA 2Z56B 3H42A 1Y9ZA 2B6NA 1T1EA 1SN7A 4NE9A 3VTAA 4WOCA 4CFYA 4WOBA 1SIBE 4KPGA 3DE4X 4NE7A 3Q5GA 5JXJA 2XTJP 3ZXYA 1PFGA 2IXTA 1SCJA 5JXIA 3VV2A 3I37X 2DP4E 2WWTA 1SUBA 1WMFA 1YU6A 2W2NA 1TM7E 1TO1E 3DVQX 2GKOA 1CSEE 1XF1A 4NE9C 3DE6X 4ZOQI 2Z2YB 3F7OA 1GTG1 3CNQP 1DUIA 3F7MA 4RYDA 1SBTA 1KDZA 3DW1X 1TM1E 3DE7X 1SVNA 2Z58B 1AU9A 1BFUA 3BGOP 3A3PA 1TMGE 1TO2E 4Z2AA 4OMDA 5ARDA 2ZWOA 3PRKE 1SUDA 5B1EA 5K7SA 2Z30B 1S02A 4NMXB 4KG7A 5ARCA 1EGQA 3GCWP 2SECE 3I30X 1SBIA 2W2PA 3GT3A 3VHQA 2E1PA 2W2QP 2HD4A 2XRMA 1IAVA 1MEEA 2TECE 1ST2A 3DE3X 3PTLA 1YJCA 1OYVA 4LVOA 1Y3FE 4NMXA 3DVRX 2ID4A 1AK9A 1TM5E 3DVSX 1NDUA 1SCBA 1Q5PA 1PJ8A 3BPSA 5SICE 4OMCA 3I2YX 2Z57B 1SUEA 1V6CA 2PYZA 3UNXA 1HT3A 3WQBA 3DDZX 2WUWE 2X8JA 1AF4A 2Z56A 3H42B 3EDYA 3GCXA 1Y4AE 1C9JA 3QFHA 3DE0X 3DE2X 3DE5X 5FFNA 1AV7A 2G4VA 2Z2YA 3CO0P 1R6VA 5CW1A 1ZVKA 4MZDA 1A2QA 2V8BA 1C3LA 5AVKA 3BGOS 3LPCA 4GI3A 2WV7A 1SCJB 1SCDA 4C3VA 1S01A 1GTL1 5AVJA 1YJBA 2ST1A 4DJ5X 5B1DA 3DWEX 4CFZA 1V5IB 4YN3A 1SUAA 1Y3CE 3DE1X 5JMOA 1R0RE 3BX1A 2P4EA 1OYOA 2SNIE 1BJRE 2PQ2A 3WHIA 3CO0S 1SPBS 2PWAA 4K8RA 1MPTA 3WIVA 1YJAA 1GA4A 1P8JA 1Y3BE 3TECE 1SBHA 4JP8A 1P7WA 4HX2A 1NLUA 1EA7A 3EIFA 1GT91 3SICE 1GTJ1 3A3NB 1TM3E 1SIOA 1GA1A 1LW6E 1BH6A 3GT4A 4DWWA 3SQOA 3TI7A 5ARBA 1SCAA 2W2OA 4CG0A 3VV3A 1TM4E 1C9MA 2Z57A 3AJ9A 3T41A 1Y33E 2X8JB 2Z2XA 1SPBP 5I9SA 2PRKA 4ZARA 1KE1A 1SIUA 4LVNA 1BE8A 1Y3DE 1GNVA 1TECE 2ID8A 3CNQS 3ZXXA 2WUVA 5AMXA 3I34X 3EE6A 4I0WB 1S2NA 2W2QA 1THMA 3OSZA 3VSBA 3A3PB 3DW3X 5JXGA 1Y1KE 3BPSP 4FONA 1GNSA 1ST3A 3VYVA 2XTJA 4C3UA 1SCNE 1P7VA 3A3OA 4HVLA 2Z58A 2W2MP 4OV6B 4BWGA 1SUCA 3Q40A 1WMDA 2W2NP 2SBTA 1AQNA 1KDYA 1VSBA 1KE2A 1C9NA 4M1ZA 1AVTA 1T1IA 2SICE 1WSDA 1ZVJA 3QMPA 3D9QX 1IC6A 2Z30A 2IY9A 1BFKA 3D43A 3LXUX 3LPAA 1PEKE 1R64A 2W2PP 3P5BP 1NDQA 3A3OB 3AJ8A 3AFGA 4H6WA 2DUJA 3P5BA 1T1GA 2QTWA 4H6VA 2PWBA 3DYBA 1BE6A 3VV2B 1ITPA 1WMEA 3QTLA 4DZTA 1SBNE 1DBIA 1OT5A 1Y48E 2HPZA 4AKSA 3L1KA 1Y34E 1PTKA 2PMWA 5AQEA 1SH7A 1V5IA 2Z2ZA
chains in the Genus database with same CATH superfamily
4FJ1A 1FDSA 1GR1A 3I9V6 3OTCA 4DT1B 4CCAA 1DFDA 4NEGA 1J0BA 1Z4NA 2B8WA 1E8DA 1P19A 1PL8A 5BSWA 3SZ2A 3WRWA 3RR7A 4K50A 5H80A 4ZEOA 3EHEA 4QNNA 2V2VA 1EZZA 3FROA 3JXEA 2O2SA 4F8YA 1VCHA 4LDPA 1PGZA 2OJ3A 3VNRA 2AD5A 5BSHA 5FR1A 1QVGR 2AI2A 3QX9A 4B74A 4W63A 3ZY3A 1C0KA 4K4XA 2PD1A 1P1LA 3CWJA 1SCQA 1E7SA 3OTIA 1GPKA 5BR4A 3WOHA 3K09A 2ZE2A 3ZLTA 3C66A 2QN7A 2PD3A 2Y1LB 1X7VA 3PSAA 3R7WB 3J7AC 1JHAA 5BMOA 3O2IA 1PG5B 3RC2A 1J7KA 2VHYA 4KXWA 1Q1QA 1JPNA 4ALJA 3VOAA 4GBGA 1U8FO 1IEWA 3BERA 1ZA2B 1TTHB 4H1WA 1BEZA 3TP2A 3PFIA 4JV1A 2CK3D 4U7PB 4XB6B 3PDIA 3RJMA 1RE0A 1SVOA 3PQ2A 1QHNA 4PGMA 1O5OA 4NZMA 5K8CA 1NPDA 3UJ6A 1CDDA 5KFWA 1PVDA 2PIAA 4PR6A 3SF0A 3M6UA 2ZM5A 3SR4A 4LIWA 5BXYA 1VYAA 3URMA 1KZHA 4TWJA 1Q81T 3D2WA 4EY3A 4YAJA 5BW4A 1RP7A 1WXFA 3IRVA 3DLLQ 4HGYA 3RYTC 4BWVA 4WZBE 4A8MP 4RNHA 3SF8B 2RKIB 2ZE6A 5JY1A 4L8GA 3MWKA 3ZZYA 3UMFA 4JOQA 4PINA 1M34B 3CJKB 5J2QA 3C98A 3BD7A 4A8SA 3MLBA 3PI7A 5KFFA 1LVUA 4DV0B 4BNIA 3TSZA 1NJ1A 5JECA 3QYJA 1T36A 4TMWA 4GKAA 3N2NA 1VFPA 4MZDA 3QLHB 3OQHA 4EMBA 2IWHA 4C30A 1FFSB 3IR6A 3QT5A 3CA8A 3PQ6A 4NULA 4UPEA 4D26A 4PXAA 3M7IA 5GOTA 3PFGA 5HLFB 3TIGA 2WKRA 1KSGA 4Q19A 3ZCXA 4OVKA 2FNAA 3ONFA 1S48A 2YNHA 4A10A 2B34A 4KZKA 1C0IA 3GJSB 4HWPA 5DGXA 2YX1A 4JP8A 1YT5A 3NFYA 3V81A 3DMGA 2P5UA 3QPUA 2AI3A 621PA 3E8MA 4P5EA 3QPDA 3NCQA 2FD2A 4QYIB 3OTHA 1J2EA 2CJXB 3AB4B 3IKLA 1YRUA 1XVLA 4FGSA 5IZ4A 4GWLA 1BKDR 2X40A 1YIAA 1QWSA 1CJBA 4KGVB 1N6KA 2C28A 1R2QA 2JFYA 2OHXA 4I5DA 5LC1A 1Z2EA 1MN9A 4QASA 5CFNA 4GOLD 4CLKA 1WBJB 1UQTA 3A6PC 1WEKA 2RI1A 3TO8A 3GLRA 1W4RA 1GTHA 1ULZA 2WUVA 2AGVA 4G0YA 3GQBB 4PWYA 4E31A 3C7TA 4YB8A 3GJQA 3UCZP 1XDSA 1CLUA 4DCVA 1ZGJA 1EUCA 2C2ZB 3FCEA 2CWXA 3NOVA 1QU2A 4AN4A 3HDHA 2GILA 1MXHA 3O4JA 1XMJA 5ALHA 1RLMA 3F44A 2PMDA 1T25A 1R4MB 3HFZB 5KO2A 3OVAA 4U67Q 3AKYA 2DMRA 4ES1A 2JZNA 3HRKA 4G84A 3OT1A 2LXFA 1XCLA 2DTEA 2V6GA 5A0TA 2QL5B 1NRXA 3L1JA 3VR4A 4C4TA 1KK2A 10MHA 5AVUA 2Y66A 2W90A 3C3DA 4MJLA 1CRWG 5AK3A 4DLZA 4X8HA 4KVAA 4QVGA 1Z33A 5JSZA 3BYZA 4QTUB 3NEKA 4L73A 1FVHA 3W1YC 3BQ9A 3HBJA 3R40A 1XR3A 5B0GA 1TCAA 4BLWA 1HFJA 4HLUC 3VAYA 1A9NB 2PPVA 5GAGI 3WZMA 3ETLA 3FSRA 3L4BC 3PE6A 5TGDA 2C3PA 3HB9A 4C11B 2HQ1A 1L3VA 1ZESA 2F1JA 1O94C 4M55A 1T0BA 4LRXA 2WPDD 2FZCA 4UM7A 3TLXA 2ZIZA 3VALA 1N2SA 3DQPA 4ZOBA 1SK9A 2WWFA 1FTGA 3CINA 5CNIA 2VASA 4QA9A 3LFTA 4CTKA 2FUG6 2HYDA 2VHCA 2GJ2A 4KPCA 2XUFA 1T9DA 1R1DA 2QAGA 4OBWA 1VLOA 5EIBC 4F93B 1FX2A 2H08A 3QQ5A 4NDAA 2WAQD 4DJDC 3VKUA 3IUEA 3AVQA 3A3NA 2P9HA 1NC1A 2J1LA 3DEAA 2B56A 4MRNA 2H2GA 3N6VA 2IPOB 3MUEA 1L5SA 2JIDA 5IW8A 3DRSB 3FCVA 1K86A 3I53A 3DOCA 1XTBA 1AT1B 1LY1A 1FEZA 2PMBA 5C8YB 1EDDA 2JJ8A 3DXYA 3Q8QB 5I7AA 3EXEA 4AG5A 3ZW9A 1SIBE 2ZUUA 5CX1B 3PX3A 4ZP6A 1YZYA 3F4LA 1JJ4A 1TA9A 4KR2A 5ELLA 3EZLA 1Z4JA 3L0CA 3RNLA 2FUG1 1Y3KA 2GLXA 4H7JA 4BB0A 2ZB8A 1XO1A 3F6YA 4DNXA 2CXSA 1PC4A 4BJ6A 4GC6A 2BJ3A 3D4LA 2FLNA 4DLKA 4P5DA 4Q43A 2RBKA 3SPXA 4D45A 1Z6XA 3R0IA 1XJWA 2GA9A 1RLUA 4U5XA 4HMOA 2KT2A 4ARZA 3IERA 1U47A 1SVSA 3ZO7A 2PZ8A 3EWSA 2JL9A 2WPNA 1I10A 3IVCA 3PW4A 2OL4A 4KWEA 4NWIA 2AQHA 3BDPA 1G55A 2Q5LA 5K8TA 4E7PA 3CMCO 1CQNA 4CO1A 3LJKA 5B0CA 1JHPA 2HH9A 1CY7A 1R8JA 1YZ3A 4ZVNA 4XX0A 4ARUA 1V8FA 2SCUB 4EG0A 3E22A 1FDBA 3TKAA 1DX6A 5DGAA 1XWIA 1I7PA 3V4VB 3I56S 5DZSA 5B0EA 1GUYA 1X0XA 4KR7A 4RBTA 4URHA 5K09A 3MWDB 1IXSB 4OZ1A 2BJ9A 3LYUA 1VQ4S 3NHZA 3Q7TA 1MB0A 1GGFA 1M8JA 1WC0A 3LC1O 4JOCA 2QUAA 3AEYA 4DX6A 1VM6A 1MC5A 3AEUA 3VZBA 3WKEA 1V3QE 3DTVD 4OFZA 2IF2A 1P77A 5KT3A 4I4TA 5C52B 1ZXLA 4P31A 1HLWA 3THPA 4EFAC 2DH6A 1EMDA 5AVKA 4LF4F 4NZPA 4KHPF 3SC3A 1N6RA 1SCDA 3IODA 2RK4A 5TMPA 1PNOA 1CULB 2QMHA 1N78A 1IMJA 1JJVA 3M81A 1N3LA 4OBBA 4C4AA 1QSGA 4TTAA 3T1HJ 1H6AA 2JFBA 5BSEA 2J07A 4IR1A 1FE0A 2DIVA 4P9NA 1VIYA 2JLWA 2VKTA 3FY4A 2XKBA 4PFKA 4F60A 1XEXA 4ARIA 4R2IA 4AN1A 3G86A 1AXRA 3QVSA 3AUUA 3Q3EA 4FYPA 3M32A 3QTBA 4WECA 3FMVA 4DIOA 3A6JA 1UMDA 4PC2A 2VJKA 1GT6A 1ZKDA 1GKLA 4ECVA 3O9VA 4YRMA 1Z8DA 3J81Y 4N5DA 2YC4C 4LJMA 1Y33E 2IVZA 3FTDA 1RCUA 4A4JA 4FS1A 5JG7A 4F3KA 1MAUA 1X14A 1XTKA 5D87A 1RPAA 2AC4A 5LMNJ 2CFSA 3TUIC 3IR5B 1L7RA 1A8IA 2OXRA 4EW1A 4BU1A 4QOTA 3ICEA 2VBWA 4K9MA 3ANNA 1AOXA 3GYXB 1TT7A 3HXPA 1K63A 2WIBA 3A1SA 1UAYA 5IUJC 2CVQA 3B1JA 1RXWA 1MJFA 3UMYA 3UT5A 5ICMA 1Y42X 3EDCA 5K4AA 2YIVX 4QUEA 1YZUA 2RHQB 4W4MA 3CJ0A 3QGMA 2VSFA 2SICE 3D3WB 3L5OA 4X3OA 2BCGY 3D64A 2Y6UA 4KAAA 2RHOA 3GAFA 4HUJA 1D04A 3MTJA 3U37A 1WD5A 1LLQA 3SFUA 4BZXA 1FBTA 2MQ8A 4DSKA 3EF3A 2UXBB 4X3CA 4BO1A 3H7HB 1GLVA 3BWVA 3T1YJ 1P5FA 3VU3A 3WHPA 2NYHA 5JSFA 2C5BA 3KAPA 2NXNA 3F4BA 3I9V9 1ONPA 2EBWA 1SBNE 3GDHA 4XIGS 1NUPA 1XNQJ 2AE1A 1ZI6A 4O2AA 1OYYA 1MROB 1E2JA 2W01A 1PTKA 4X84A 4OHFA 4R1LA 3H8WA 3KOZA 3FMBA 1T9HA 1RGVA 3G2MA 4CGYA 5AWFC 2RJOA 2W83A 4XD7A 3IBCB 2IRXA 1ZTTA 3IEIA 1K8AT 5SYNA 2DEUA 3OOWA 3PDWA 3R09A 3KRTA 1H1TA 4RUHA 1FFWB 1S2LA 2VVTA 4QUHA 1ZAXA 3IPLA 5CRIA 1ODCA 2GA8A 4DGSA 1U24A 1PILA 1CUAA 4BNJA 2RHTA 2HHUA 5L8RC 4NE7A 5EJIA 3C97A 3FZ2A 3WXBA 4DFMA 3FLEA 5IH3A 1NL3A 4FJ0A 5JZOA 4IJ6A 1SUBA 8OHMA 3WKCA 3BKTA 4N9WA 3CJRA 3L7OA 1YQ9A 4JNCA 4NARA 1E9FA 1P44A 1HH4A 2BM8A 1N36B 1EYZA 2ALJA 1ZR4A 5JYDA 4AJOA 3M3PA 4XQEA 3LUKA 3GARA 1W0JD 3V6MA 3DJYA 5EMJA 1SBTA 4DXDA 1L3BA 3DV0A 3ZTQA 1UANA 4IGAA 5J47A 4L9WA 5K3OA 1XNQF 2REXB 1T9VA 3DHWC 5I4IA 4G5FA 2FJWA 1ZW1A 3H04A 5AW9A 4MPTA 1T9GS 1PFUA 5DNCA 2FUG9 4B3RJ 4I2PA 1LWEA 1HXHA 2C84A 3RS5A 1QIJA 4XB2A 1LLCA 3Q41A 1G2PA 4NCNA 2FSSA 1CHDA 3NDRA 3VI3B 2IBKA 1YVDA 1YDHA 5CTAA 3MUOA 4TMXA 3HHKA 1JXLA 4B3FX 4R9SA 4ZGWA 3KKLA 4JB8B 1WXDA 4C0WA 4B3HA 2VG5A 2B7BA 3LP2A 4OMCA 1NVBA 2NR0A 4AW9A 5EEGA 5KOWA 1V2HE 4Z6KA 2AGQA 1HE8B 1KYXA 3G87A 5E38A 1S5PA 5ILGA 4KXNA 1LEHA 3H6GA 4A6XA 3NBUA 2H9ZA 1QQAA 1T1SA 3AEQB 3GPAA 2BM9A 2ZJ2A 4MVJE 3K7EA 1AV6A 1OX4A 1DDOA 5G4LA 2FXIA 1J49A 1E92A 1N2XA 4QBUA 5E3RA 2Y93A 1W8IA 2RH4A 5E3JA 2ZH9A 2R60A 1XEXB 2IOFA 3CZAA 1AA1B 1CW2B 5DM70 3Q0AA 5TEWA 2DPMA 1CY2A 4RZQA 1H2AS 1PTJA 4FW8A 1QSYA 2O4CA 3K9WA 2JBHA 4OYZA 2KU7A 1T9TA 2XRFA 4G25A 1CUVA 4GE3A 2DOKA 4ETWA 1UOQA 2HADA 1E66A 2C5GA 2J7KA 3AL0C 1VE9A 3OW2R 3RK4A 2VWQA 3ZBPA 1NF8A 1P8JA 1QCYA 2JGIA 4KGXB 1GKYA 1T4GA 4MARA 2A1UB 3BR9A 3OIYA 1AQJA 3O83A 1IG0A 5H9FK 1TKBA 4CT5A 6FDRA 2G0IA 3ZHZA 4OQFA 2QRRA 1RAFB 1P33A 2HJVA 1DFGA 1EETB 4FKXA 3P0IA 3E9YA 3DNMA 1A9QA 2NCKL 3H9QA 5GAJA 4JXKA 4N0MA 2HMWA 5A2QA 1GPLA 1GK8A 5CVUA 3JATA 3HY4A 4FKYA 5BQFA 1YJ8A 2P5TB 3AB3A 3R3JA 4OJGA 3PJFA 1C1DB 1NNI1 1DOAA 3B3GA 5KQRA 2WONB 2WVBA 1GPNA 3KKPA 2O5CA 1EK0A 3CZ4A 1K8YB 3TMYA 2I8LA 3IXQA 2YBDA 5C42A 2GJFA 1VSQA 2A1IA 2QMUA 1YBAA 4UVGA 1E9AA 2HA3A 4KITB 2CIMA 2H4ZA 2ZBEA 1ZETA 1C0PA 3DLIA 1HARA 3OFEA 1IE3A 5BQ5A 3I5UA 4RM2A 3BJZA 3R4CA 2CDQA 2L42A 4EJFA 3I61A 3EAFA 5AXBA 1XNQB 3ZD9A 3L7KA 4HL6A 2HRDA 3W5UA 3I9MA 4PYOA 4B9AA 3EJMA 1VQ9S 4OJYA 3CX7A 2B9WA 5KNCA 5A6WA 5BW5A 3EWAA 4RUAA 3DOUA 2R7NA 2WICA 3UWDA 3Q86A 3ZV4A 2WKPA 3GEEA 2BI4A 4ZQBA 2VRNA 3RUDA 2J46A 7AT1A 3HO1A 2VTBB 3RRYA 3E0XA 2ZRHA 1LNZA 4MYCA 3FJ2A 2ZJ7A 4D02A 1PEDA 1PNTA 2QTVA 721PA 4ECWA 1VBZA 2BE2A 4HGZA 1J0DA 1P5RA 5KX5A 3I8OA 2WSBA 3E51A 3K59A 2HNBA 3LP5A 1LK5A 2NPIA 1RXEA 4YWHA 5B7GA 3OV7A 2P4SA 1JQ5A 2QLXA 3K15A 1I14A 5H1YA 4IYJA 3DMFA 4AKTA 3UWKA 3FVYA 4WWHA 1DB3A 1VI7A 4R25A 3ZWNA 2ZSDA 1MVOA 4KDCA 3COZA 5IG2A 2YS6A 4Q1DA 2YXEA 2Q7XA 1YWXA 4NE9A 2R66A 4EK2A 4LVUA 1VJ5A 5ENDA 1HWLA 3HC7A 4N5NA 1W44A 1K97A 5FUWA 3C16B 1EJ2A 1K5GA 3WB0A 2R8PA 1LPBB 2JFUA 2QTHA 4CF3A 3VU9B 1ECPA 1G4UR 3ZWXA 4WLOA 1NK7A 2QGFB 4BVHA 5KKNB 1QNFA 2PXAA 3IESA 1KI4A 2RQKA 2ZT6A 2WD7A 2BFCB 5GTDA 1OTHA 3TGPA 2JDJA 2P27A 4MP8A 3OZTA 4LRSB 4P54A 2QZSA 4QFBA 3L4SO 2P30A 5F78A 5HZMA 4K8OA 1TZJA 3EIHA 3E35A 1Z8HA 5EY5B 3WLKX 4CHTA 3FFTA 4DHWA 1KO8A 2Y6VA 4HRYA 2EG5A 4FNHA 1CCWA 3I30X 2QTBA 1IZYA 4NLSA 1PHPA 3C6TA 3A06A 3VGUA 4O5AA 1OLOA 3TZKA 1YUMA 3X1WA 1Z4KA 4CF6A 5F3DA 4UBLA 4J0FA 3LLMA 2BL4A 5IF3A 1WF2A 1C5KA 3GLGA 3HFKA 1PV2A 2Z3ZA 2LLZA 4A8FA 2D3ZA 2M8DB 4QU8A 1AHNA 4XLZA 2YJGA 4BNGA 5E1BA 1FJGJ 2X1FA 4BBAA 2V1UA 2Z56A 3I5BA 3QXXA 2GBLA 2JAUA 4YP6A 4IMIB 1LQTA 4H4MB 4PYQA 3FDZB 3IUNA 1MNQA 4AZ0A 4EA6A 3C1UA 1D4OA 2AFIB 1LF0A 3DMJB 4F3QA 4IY1A 4R6WA 4D6PA 4ZI3A 3UWTA 4TRNA 2EXXA 3LUHA 4LF5J 3GMIA 4I2VA 2K7JA 1R88A 3L8MA 1MIOA 1FTSA 2AMVA 1NKSA 3E70C 2HIGA 3A6HA 1BQNB 5EKUA 1QXSA 2R8EA 4P86A 3FQKA 3C6MA 4TWRA 3MCVA 3AVXA 5K8NA 4D98A 1Z7YA 1IVYA 2MEWA 4GPAA 3U6KA 5DTMA 4OGFA 1ZVMA 1RHUA 5DASA 2B8EA 2QRJA 3Q23A 1JLKA 1F60A 2XX3A 3VCDA 4RD6A 1D1PA 4MW4A 5E9QA 2OPSB 1Y0BA 4AVYA 3FLMA 1NU6A 1JSZA 4RJTA 2X2PA 3VC3A 3NVAA 1MC1A 3KD2A 4NBKA 3LDAA 4B9EA 2Z04A 3ZGOA 1ZD2P 3PFCA 5FI1B 2PCLA 3D1QA 1FOEB 3HK2A 2A1BA 2QPOA 1KEKA 3ET6A 3U1BA 2VJOA 4M7PA 3L18A 4QCLA 4DL9A 4DUYJ 1LQUA 3F5QA 1SBRA 3O95A 2FVCA 3UJ7A 3VFDA 2CD7A 2FR8C 3EXHB 4WY2A 1ZD9A 4M5LA 3NOOA 1BFDA 3M4NA 3B38A 3M8KA 3AAWB 4A0HA 3H90A 2QV7A 3VSBA 4OI0A 2H1WA 3NXKA 4I46A 4MGZR 1M6HA 2A4MA 4IDPA 2Q0XA 3IGFA 3P9YA 3GX1A 4JT9A 3EODA 4BX8A 2BBEA 3KJZA 3TE7A 3F98A 3K16A 3MXTA 1KZ9A 1RAGB 4BMYA 1HPLA 3BB3A 4AUEA 1DADA 1EFVA 5A7HA 4F2GA 5J2TF 4YT5A 4LT6A 4R3NA 1QAIA 2B3TA 3QNWA 4GSYA 1S7IA 3O90A 3ZVLA 3KFXA 3WY9A 4K03A 3QIAA 2YKMA 4OP2A 3IP6A 4ARAA 4GOMD 4NRUA 3MFQA 1Z0AA 1TDJA 2XCPA 1RQXA 5IZHA 5JAMA 2JCXA 3IVMA 1O6FA 2ZD1B 5AJUA 5IKPA 4GX2A 4TN5A 2QAGC 3RBDA 5B5SA 4BHQA 4URZR 5IJ9A 1Q0NA 2CNLB 1H0KA 1CEQA 3ESCA 1ATZA 1M3SA 5KFQA 2N9UA 2QMEA 3L1KA 4UBOA 1DRJA 3SJBA 5EIAA 4FZJA 4J0DA 3K5HA 4NPAA 1F5NA 4YCSA 1KFJB 2AJ2A 3V46A 4EB3A 3HJRA 3U81A 5F9NA 3PEWA 4C7JA 3C87A 1Y3IA 3GR1A 1JYFA 1ZL0A 2FG5A 2CJWA 2XB8A 3AKEA 4A0GA 4N0EA 1WTAA 5B64A 5CLHA 4R81A 1N1MA 1WX1A 4FT4A 4IG3A 1JHVA 3C3EA 1JU4A 4MS1B 3T0IA 3GHHA 1IDN1 4W1RA 3VTIA 1EI9A 3O8CA 4PICA 4WOCA 3CJKA 3T0FA 3X1MA 3IRXA 2R4UA 3K9BA 1U7WA 4TV9A 2BGUA 4X66J 5KEIA 2QM7A 3RI3A 1XLTA 1YSJA 2JC1A 4DSTA 2YKMB 2G9UA 4NE9C 2NREA 3RUCA 3FGPA 4QIEA 5CDHA 3EF1A 3TOVA 2CUTA 2B94A 3FNGA 3HJTA 1QIMA 3MWGA 1VL1A 3GLJA 1SD2A 2FOXA 1TJ4A 2HPUA 3H5AA 2R7TA 1C7EA 5EMLA 4D44A 1VJTA 4CF5A 2IE0A 5CT6A 1I7LA 4BFXA 1O87A 1NURA 1AF7A 3O1JC 2YXPX 1MFZA 3RC3A 4Z7NB 3WC4A 3OY2A 2XOEA 1W36B 3P0HA 3L06A 9RUBA 3TSAA 4NWBA 1E9VA 1UIMA 1NV8A 4OGGA 2VJLA 1QQ7A 2ZHBA 3LZDA 5GVSA 5HPYB 3EMDA 4M1QA 4EHJA 4J3JA 2ERYA 4Z4CA 1KMNA 1E6VA 3PNIA 1OJLA 1N2IA 4DUYF 2XA2A 3D1JA 4OIXA 1J4AA 5D15A 1MAHA 5F5LA 5L1IA 1UT6A 4LR7A 1ZG3A 1WOMA 1JWLA 3MTDA 2M2BA 2ROQA 1DT5A 3Q8PB 1H74A 5CX4A 1WSWA 4UVDA 2G7MC 2VC1A 4R1NA 1BW9A 2M0GB 1IB0A 4JUZA 2GCGA 3ISND 4QWCA 2R48A 1EVZA 2FDNA 2NU9B 1V95A 1N3BA 1AG9A 4AZVA 3TVKA 3DMHA 3DN9A 3BM5A 1X5TA 4M21A 5KFCA 4EP1A 1LFWA 3TQSA 2ATXA 4CRWB 4RCVA 1OJ4A 4NNOA 4F3NA 4G41A 3IBFB 4EIWA 3RU0A 4FCWA 3I1YA 1EKSA 2ZJAA 1WL8A 2V7QA 4DFJA 4N03A 5KSOA 5HEKA 1F8GA 2D8MA 4TNOA 4D8YA 2MKYA 1FMJA 2AMCB 4QODA 1OFVA 1H94A 4LXGA 3J7AN 5D3MB 2V8DA 4YCAA 2IBSA 3ZDQA 1T4CB 2RILA 1U0HC 4M0KA 4TXLA 3LK7A 4HD8A 4DLRA 2RMLA 5ICGA 4GXTA 4Z9AA 2ZS8A 4P34A 5F4ZA 2WSLA 5FXMA 4DUPA 2BF4A 4US0R 4BWFB 4L15A 3EYZA 5JD3A 4R2HA 3HI6A 1U1MA 4RKQA 1R8QA 2X7XA 3IEUA 1B93A 4PTZA 4P1ZA 1C81A 2V94A 4KR3A 1V39A 3GG0A 3BWDD 4KGZB 1NVDA 4PS1A 5EGNA 3TTVA 4J0GA 1B4DA 2IYSA 3WK7A 1ZK3A 3BH7A 5EGSA 1U02A 4UU1A 4W8HA 1EQ0A 3BDIA 4Q3KA 2Z2LA 2EJCA 1B6SA 4P3KA 4PWWA 2IPAB 3EGXA 1RZ3A 5KHLB 3CC8A 1RT4A 4BE9A 5CU7A 1UJ6A 3UB2A 2E4WA 5IUKC 1IKYB 3QRPA 5ICEA 4OXYA 3H11B 4OX6A 1OOEA 3MMAB 2O8CB 2GEFA 4ZQIA 4CTMA 4O25A 1FP6A 5LYYA 4NEYA 4BNHA 4DY6A 3JQRA 1S2OA 5KYUB 1O9HA 3LCMA 4IEEA 4P7TA 1HE1C 2CYCA 4N76A 4KFCA 1SUCA 4H0FA 2H9AA 2WCXA 1G9XA 4NH0A 4MWEA 4H4OB 4DDMA 3WK5A 5EXSA 9LDTA 1XNHA 3EJWA 4YMLA 3D7MA 1V9OA 3ITHA 4ZC1A 3QAEA 2J41A 2VQDA 2Q6OA 2DNYA 2PLFA 4JL5A 4TLLB 3P5BP 3PNQA 3WYCA 2W9CA 4H6WA 2OZEA 3DLEB 3VO9A 1GITA 2EFPA 1T1GA 4M76B 3MIZA 3TZWA 1GXUA 1YI1A 4JITA 2X3UA 4D43A 1FXUA 4DZTA 2Y1FA 4MICA 3BK7A 3ED1A 3PC2A 2HPZA 3EFHA 1GKIA 1LWNA 3BM7A 3QVGB 2XSJA 5AM0A 2M52A 2X5OA 1HDZA 4KPUA 1X7GA 4M99A 2B4YA 3CSUA 4HC4A 4K9OA 3OQIB 1FNNA 5FA5A 4WT7A 5TRTA 2XZWA 4INZA 3D4IA 4KB5A 2OA0A 2YNGB 3RFXA 4D81A 1R6XA 1P9OA 4OX8A 1KQ3A 3F8WA 2AJDA 1VE7A 5C4GB 2GIRA 1OJ7A 3QTTA 4G0NA 3DCAA 1LH0A 2OFFA 4F3CA 1FYFA 1S9DA 1DKNA 5ECGC 3NG1A 2DQKA 2QA2A 3OUUA 1S2DA 2E5LJ 3C3YA 3GCWA 4L3OA 1OIWA 1P27B 6LDHA 1BMQB 3QX7A 1NHWA 3ANYB 1XMPA 1YRAA 3L05A 1JKJB 3EGCA 2AUNA 2CXXA 4GR5A 5FPTA 4DSIA 1LBTA 3F96A 3FI9A 2V5VA 3SFVA 4KQGA 2WTFA 4POAA 2ZAGA 2AEMA 1RYDA 3TR0A 3U48A 3ZH2A 4H1UA 1O7JA 3TIXB 2P9BA 3G85A 4AECA 3Q8RB 2HX1A 3AIOA 3P9IA 3T61A 4QXOA 3PXGa 1ONBA 4K9QA 1QZXA 1WKKA 4IM7A 2MQLA 3H9JA 4CIBA 2A1TR 3GJ8A 3FRZA 3VSDA 4PABA 3VHLB 3ZZRA 1AS3A 1VRUA 3TNDA 2UVWA 3VDNB 4JV5B 3MOGA 4M89A 2YWKA 3GAAA 2B0GA 4MYTA 3AEZA 2HA4A 4HDOB 3AR5A 3SSRA 1NKVA 2R7UA 1KQNA 3KFVA 5EIFA 4MQ5A 3FTEA 3P4XA 4M0FA 5FBQB 4D6XA 3TXAA 2GMWA 4G1VA 3IVGA 1SIZA 1U7XA 4Q2LA 4GGOA 1NUEA 1PJQA 3UVJA 1ZIDA 5IM4F 3R5AA 1XVUA 1TL4A 4FYJA 3WMRA 1R9JA 1Q5PA 4F3OA 2LR0A 4Q7QA 1FNCA 2J0XA 4HHUA 3ILVA 4URGA 1IWOA 1UC9A 2ONJA 2V45A 2QY6A 2FPGA 2F3TA 2QTTA 3WRVA 4JLVA 3WLEA 1RTIA 4NLVA 3QXJA 4P4LA 1MOPA 4KYVA 4CPDA 3PQCA 5T7BA 4KP7A 4Z8YA 2A1UA 1PQWA 2X0KA 3WYEA 1Q7TA 3AOBA 2Q9CA 2GXUA 1YZHA 2JL1A 1CB0A 3R7LA 1LFDB 2V96A 1N7HA 4L9SA 4JLOA 2Q8QA 1F20A 5FWXA 3PHEA 1Q6ZA 2VDUE 4L16A 1TMYA 5IQQA 5B0DA 1EVJA 4IUBS 3FNHA 4KE5A 4ALNA 2OMEA 4DR6B 1LD3A 3ET5A 5T8KA 3VZIA 2ODBA 2G8LA 2P4HX 4IRMA 2WJPA 4CMGA 4MKZA 1H98A 5JJCA 1UDXA 4OREX 3IUQA 1SU8A 4G9GA 2BTOA 2ROGA 3WKDA 3JVUA 2QD3A 4BQPA 1N5RA 3OM8A 2C9YA 1NAHA 4ABYA 1O94D 4QPCA 3T5JA 3ICVA 3HV0A 5KAPA 3B5IA 4ZI7B 3WMXA 4FWBA 4N7BA 4C8ZA 1KERA 2CL0X 1ZUWA 4NCBA 4N8NA 2CWWA 4M95A 2LEBA 3AESB 1ACLA 2VHTA 2GAGC 1GVHA 1WP4A 3IFEA 3IPXA 4N18A 4ZTUB 1A69A 4C88A 1ORHA 2HW8A 4NHOA 4KLAA 2RJ3A 3X2SA 4JJFA 3ISVA 2QJOA 3OKAA 3VYVA 1WF1A 2GZ2A 2PUDA 4CE6A 5CYMA 2B92A 1MP0A 3THWB 8AT1B 2ZH8A 3EGZA 3K0HA 2RC5A 1E2BA 2GO7A 4XUCA 3IPRA 1FYVA 1OI7A 1YA4A 1O77A 4WZZA 1Z18A 3GELA 4RNMA 4LV6A 3NYQA 1AB5A 2HO5A 3KLEA 3VVCA 4G65A 1TUGA 1BTOA 4NX2A 3T5BA 3W8PA 2HZBA 5BJRA 3KSUA 1YR9A 5LWHA 5B12A 2O3JA 1EP3B 1YK0A 4Y2XA 1IQZA 3M33A 1K7XB 5KYUA 1G4HA 4RVNA 2F8SA 3CLUC 3I0SA 4RY8A 2UP1A 3WGNA 2X5NA 4ZYZA 2DECA 3PL5A 4KRWA 4M54A 3OQ6A 2ZYDA 1BN6A 1MFPA 4GRIA 2G13A 2FPIB 2QA4S 2GDJA 1Y34E 2VFSA 3LDGA 3CPSA 2HXSA 2XQCA 1UPTA 4J0IA 3W8EA 4FNGA 3BXGA 5FBZA 3UZUA 4PHGA 4RNOA 4N1AA 4TSKA 1GPH1 3IIEA 4B4OA 1FW8A 3HVKA 3OZVA 3I42A 3JD0A 2BGTA 5ETSA 3IRUA 3WMWA 3JQKA 3GV8B 4O0IA 4KGZA 3QJGA 1N6IA 5FTMA 1LSJA 3BB1A 3C1AA 3KSRA 1EZZB 5J1PA 3PQFA 1KZ6A 4A8KA 4MS1A 4MW6A 1YIOA 4I8DA 3HHLA 1VCIA 1X8LA 5ETNA 4BO8A 4RVFA 4OYHA 5FV7A 1PGNA 5KG0A 3EQ6A 2D9OA 1TUEA 3W66A 2B8NA 5THXA 2C5FA 2WM9B 3LUYA 1X3LA 3WHKA 3IURA 4B9TA 2WHEA 1E6YB 4A91A 3OSNA 2QT9A 3JSRA 4L4YA 4BN4A 1DC6A 5K4HA 3RSFA 2XNSA 4P4SA 3V6DA 1TC2A 1Q5YA 2QLFB 1V1RB 1F2UB 1CIPA 3WBKA 1JNRB 2H18A 4NABA 3FYCA 4I55B 2R7RA 2OPHA 3X1KA 1NFRA 2DZDA 5FF9A 4PWDB 4G0OA 1XL0A 4AC9A 1E1NA 5FPQA 1Y8QA 4XCQA 1TRHA 4WFKA 4A8HA 4HR2A 2DBYA 4KIWA 3BTOA 5CA1B 3WZ0A 1KRXA 5BSTA 4R5PA 1QHYA 3DO6A 4FFRA 4FVCA 1C7JA 1WB9A 3W60A 1MROA 1U8YA 5AVRA 3T6KA 1JFRA 1E0AA 1FNSA 1VC6A 2OCPA 1A77A 3GMSA 4URWR 3JW8A 5LMNF 5E95A 1L7DA 4CUJA 4J4TA 4LOKA 1FKAF 4ITRC 3GVHA 2DG2A 2SKCA 2IMWP 1KQKA 3C14B 2DTDA 3LHFA 5FAKA 1WETA 2D8AA 4HQ6A 5DMXA 5K01A 1H4QA 2UXCF 1HR0F 5TIIA 2KH9A 1X77A 1M5KC 3DBVO 2NLOA 2OHJA 4Z7OB 2H0AA 3B2QA 4HH3C 5KFZA 3ZHOA 3G3EA 3ZVKA 3D3JA 3PX2A 4XH9B 3TW6A 1QH8B 1C9EA 4QGHA 2Q3PA 4HFMA 3GJYA 4BRWA 3B70A 4NZOA 2ZWIA 2DGOA 3VA7A 2XA9A 3MHYA 2EFDB 4KUEA 2VIIA 4PAOA 4XIJA 4B34A 1P2UA 3LYAA 3EK2A 3IL2A 3PRHA 4MRRA 2ZT7A 5CYPA 2PPLA 4HPWA 1I6JA 3UG6A 4C4OA 1ZAWA 1U8XX 2C8JA 1U3GA 4ZZ3A 3GDOA 3O4RA 3MGKA 3K0JA 4BEVA 3QO9A 3V7WA 1P1RA 2ZIAA 2ORED 1U9IA 1ZK1A 4OX7A 1D9FA 2HRYA 3RBXA 4KHPB 1VHLA 1HPZA 1X5OA 1JLBA 4QX6A 1I5OA 3Q8UA 1OZHA 3I01A 1GSAA 3E7WA 3AHFA 3M2UA 2C5HA 1ZS6A 3HL4A 5EQTA 3NGSA 2ZQ5A 4KYIB 5KQSA 2V50A 4ZV4A 1GNPA 4KW7A 4IJWA 3M1AA 4CM9D 4JOBA 2E4YA 4OYWA 4X66B 2XXBA 2X8JB 3VUFA 3OURA 2GGSA 4MWZA 3LVFO 1MBZA 2AFHB 3UJCA 4H60A 1HURA 2HF9A 1AGXA 5JMNA 5D85A 2W2QA 2DVIA 1F0YA 1SUSA 2NQ8A 5JTTA 3BBPA 1N34B 2R2AA 2VA8A 2VH5R 4K05A 4EK9A 1P9YA 3G96A 5K51A 3B5JA 4FF3A 4TZKA 5A6VA 3K0EA 1WJ9A 1BHSA 2BP7A 3NUZA 4CLEA 5E3HA 2E1MC 1JXQA 4XFJA 1OTYA 3HA3A 2E89A 3VX3A 1PC5A 2A5YB 5JCXA 3L6EA 2FGJA 3EAQA 1CXZA 5F2KA 2EI5A 4DQPA 3TTWA 5K0ZA 2BBOA 3FKQA 4FBUA 1OV6A 1R0SA 2IS2A 3OZ7A 1YZFA 4M98A 1XELA 3NEYA 4G5OA 4MMYB 4B6QA 1CUIA 3SEAA 1XZHA 3NCTA 3QRQA 2RNEA 4NFHA 2MU1A 1BD6A 4EYOA 3FF4A 1RP5A 3NAGA 4GE0A 2ASDA 3MEGB 4IZ6A 4LYYA 1X60A 2QLFA 1RM4A 3P0JA 2B30A 4L0CA 5DNWA 2W98A 2JBAA 5HANA 1HDEA 2FEMA 3X2EA 5K1ZA 3BYRA 4K7JA 3SDBA 1U26A 1UXJA 1LNQA 3Q6NA 4KV9A 1BE4A 1GTRA 1AN0A 2QY9A 3GWGA 1CEZA 1QHGA 2ILZA 2FVYA 3RB4A 1GQOA 4AD6A 2O0JA 1YE8A 3QIPA 2VDKB 5C8ZA 1Z12A 3GRYA 3TZHA 3QVMA 1DUSA 5E2AA 1FKOB 1J8QA 3OJ0A 2DBBA 4HDHA 2X2OA 4OHOA 4RNFA 4ZN3A 1PW7A 5C8DA 3K2QA 2PI5A 1WZ2A 3UN5A 4LJ7A 1DAPA 1CLFA 3O73A 1WI8A 3KALA 2V4MA 2JVRA 3U3MA 1JBKA 1FFEA 2V74B 3ZHUA 4B33A 3I37X 2ATVA 2OORC 4RFSA 3DRSA 1KVKA 4MZXA 2Y4OA 1KIAA 4LSGA 1NKCA 5G4KB 1I2ZA 3LCUA 4D92A 1HI9A 5F7ZA 4NMMA 4JYPA 4Q4JA 3FPJA 2BY4A 2IPNA 2M1ZA 2A9OA 2IOQA 1NVGA 4HAWA 3JU3A 1ZRHA 1NK6A 5HQ3A 1QLHA 4FQ8A 1OWPA 3FDZA 4ETNA 3FZBA 4WKYA 4KQ1A 4D3YA 3ETOA 3PRVA 1T2EA 1YUBA 4AG3A 1KHHA 4GPD1 3U4GA 1GGEA 2Z30B 3K35A 2GPYA 2VUHB 2QE7A 1DQNA 2JX2A 4EQZA 2D7JA 1LJLA 1M8PA 4F5DA 3VU9A 3QUQA 3U4CA 2GLUA 4GRAA 5A9SB 1EDOA 1IN4A 5HMWA 2AHRA 4J9UE 1V96A 2IIPA 9ATCA 4P8RA 2K4MA 1T94A 2YZNA 2Z57B 5CEJA 4IG4A 2VYVA 2ZPTX 3G7NA 2M6LA 3BQ2A 3LTEA 2QPLA 4RKUC 3Q8XB 3S1AB 4HLNA 4EQ6A 3N8NA 2QN6A 4UNPA 1C9JA 4M0CA 4WBNA 5CLJA 3IM9A 1HNXJ 4UZBA 1MXFA 2W2TA 2HPAA 1RZUA 4L76A 4RFSB 4LF6F 4USUA 1W5EA 4P3PA 1OFUA 1U04A 4PX2A 2WSFC 1EXMA 4TT3A 3RUBL 3NI2A 2AN4A 4X61A 1MUUA 1ZHFA 3A2MA 3ERCA 2IYEA 3OZIA 5EIHA 4FFPA 1J8VA 3O5AA 1I3CA 3HZEA 3RUAA 2D2FA 2ZRDA 4XYEA 1NQOA 5BV1A 4GDMA 4ZT6A 4IJQA 1SKUB 4L2IA 4WKCA 4X1KB 3NHWA 1JKHB 4XWGA 1PSWA 4D6YA 2CCKA 4J6FA 4RD4A 2C0QA 4NS4A 4OHUA 5KINB 2QN1A 3H2YA 2EIHA 1H69A 3IS3A 1V8OA 1QAQA 3OCZA 3TNLA 4PLFA 1YBHA 2B8QA 1Z0ZA 3M6XA 3EFEA 4XQ9A 1SPBP 4UTNA 1M1NA 2HT6A 3NAMA 1QGYA 4ZVVA 4BB5A 4KLZA 3WDLA 5MN6A 5I5EA 1T24A 3E3MA 2R2GA 2VBXA 2CXHA 2RAUA 1T3ZA 2XOKA 1SC4A 4I4CA 2A18A 2ZJ1A 2VS1A 4AS2A 4OH7A 1L2TA 1PS0A 1WDMA 5H3HA 4LNUA 5TQ2B 1LRJA 3NTVA 4COKA 1Z25A 3SC6A 1C9KA 1CZRA 1XN1A 2OCYC 5DP2A 1TKXA 3JQPA 2R42A 3NDBB 2PV0A 2QX7A 5ENZA 2O3RA 4D0LB 4TKVB 1JPUA 3PEUA 1G8HA 2PGIA 2F64A 4GWGA 5KOHA 3ER9A 4Y3CA 4H59A 1AIPA 2EW8A 5LL6P 1YRYE 2OTJS 4QBIA 5ALRA 5F41A 2Q1XA 1R64A 4EL5A 4ZYLA 5B4VA 3GE9A 1MJ5A 5B0BA 4Y6OA 4BDSA 3ZNUA 3HKCA 4IFYB 3A37A 2J67A 1TL7A 1X4BA 3HVTA 2FKNA 1H85A 5H9FJ 1E4OA 1P29A 1KNZA 4F4FA 4I1PA 1ITPA 3P8BB 2EX1A 3STXA 2E9TA 2COEA 2Y0CA 1OKKD 1V26A 3NGMA 1JQAA 5HS6A 3IAUA 4Q24A 4DCNA 4RMIA 1NPPA 4FBTA 3AG6A 4HAUA 3EZOA 3JX9A 4KEAA 4WWSA 2EJTA 4IZOA 3OZRA 1JEAA 2J4DA 4PX5A 2ZS9A 3FF1A 2XMJA 5BT8A 4TL6A 3ZWDA 2PUVA 1SK8A 1YZQA 5C34B 2O4UX 2JI9A 4NYIR 3RFCA 2CLLB 3I39X 3OPYB 4RTPA 1T3NA 2VRCA 3GY0A 3OC6A 3OHSX 4OHWA 2FZGA 3WTBA 2LCQA 4ARBA 3K7RA 1E2MA 4S0XA 2H7YA 4YY3F 1D4ZA 2QD1A 1LI7A 3GOQA 2LQ5A 2DU8A 1U4NA 5AFSA 3CUKA 4CEJB 1ZOLA 3M5DA 4LPSA 1MR3F 3VPSA 2XE6A 3Q87B 1ZGZA 3AETA 3IE0A 4DAEA 5GZ6A 1DOZA 4KE9A 4YDXA 4XTCS 2CMHA 3QEBZ 1XTJA 4NASA 2J87A 4F04A 1O2DA 5AM4A 5KVVA 4CM5A 1R0CB 4X1IB 3L0IB 1U31A 2FUNB 5IBRA 5C1DA 2I7CA 2VXBA 4L6IA 2BGKA 1GGJA 1WUTA 3DOLA 3RTGA 1QC5A 1SUWA 3V7YA 4GX0A 2SECE 1OAOA 3D3WA 2DNLA 4D9EA 3PW0A 1SRRA 1SJ4P 1F4VA 1QR2A 4CI0B 4B6FA 4J5OA 4HAYA 1IPHA 1E1MA 2QTCA 2DX7A 1Q3KA 1QORA 1PJRA 2HHSA 3KZCA 1PJSA 1WKCA 4CLOB 1HBUB 4MYDA 5HJ5A 1WHYA 4X4RA 1NVKA 3IT1A 3WGQA 4B76A 1RJ9A 1D09B 3ZK8A 1CJKA 2G63A 3ZKWA 1Y6ZA 3GMGA 3QJPA 1QANA 4YUAA 2P5VA 1B0AA 3S7TA 5CW1A 3T4UA 3BILA 1Z8NA 2Q21A 1PR2A 1OSCA 1HDRA 1IH8A 2CQ2A 1VHTA 1Q14A 1T3SA 5ELMA 5AP9A 1DO0A 2AK2A 1XQ6A 3WX0A 1L5OA 5JD6A 1TAHA 3FUCA 3QVUA 3BSFA 3PGA1 3RWOA 3UUFA 3G1TA 3VPCA 4OF4A 3SEQA 4AUKA 1I4LD 2D00A 2VTKA 2DK2A 1I0LA 4W5NA 1H93A 5JV5A 2JKVA 2XDAA 3MT0A 2WJJA 3OPNA 2CGEA 2EWWA 4AN0A 2HU7A 1G1XA 4R8MA 3FVVA 4KLRA 3H2KA 1VLYA 3AFHA 1V0JA 2FX2A 2X0EA 4CIAA 1V9LA 1IZ9A 3LW8A 3A4IA 4YACA 1EIYB 4B48A 4J1TC 3BQ0A 1ZSVA 2X2EA 1FTNA 4RKEA 3L7DA 2DFLA 3UNGC 5F9HA 4BFTA 4HQRA 5CPFA 4UTVA 4UASA 3O7WA 5JLAA 1BDHA 4RVUA 3CD7A 1SIUA 5HJXA 2QP4A 3UG7A 4JT4A 3AH6A 3ROFA 3DDUA 1L4HA 5AMXA 4DX7A 2ENWA 5LNK6 3I34X 4HQLA 4PS0A 3UOWA 4GMFA 5KFOA 4UNIA 4MRAA 2X1GA 5CD1A 1NJXA 1FYEA 1RJGA 3CR3C 4JC8A 3I5MA 4EI2A 1VPLA 3NNDA 4DCUA 5A9SA 3UDEA 1NJZA 5FWYA 3RHFA 2F7VA 3BJRA 1E3TA 1T11A 4GFDA 3CCVS 3RTBA 4M86A 1RXUA 3CX4A 1UAGA 1TZ2A 1FNDA 3PHIA 5D4LA 1JNYA 1T10A 2GYYA 2I6UA 4GL4A 4OOEA 1FS4A 4MV6A 1W6RA 2V9CA 2XJ4A 1UOPA 3K0FA 3BZQA 2Z8QA 2ES4A 4B9UA 2VODA 1JZQA 4LOIA 3IE2A 3D1HA 1VLMA 3OFFA 2CQDA 4MINA 3IH5A 2O5EA 2Z5LA 3SHWA 2GJKA 1TIPA 1DBSA 2XHEA 3BG5A 1R5JA 2ZKUA 3L3BA 1TCCA 1XU4A 3ZOZA 3BB5A 1FK9B 2HCRA 2I2FA 2EFVA 4DV7F 3CCFA 1R4NB 2VZEA 4NKRA 3UHOA 5DGIA 4IRCA 2PKXA 1D6SA 3IDZA 4X5OA 3ML1A 3SQGA 1MIOB 1UEVA 3RS3A 3BMOA 1VC0A 2YKQA 3EPRA 4G36A 2QT0A 2BPOA 1JEQB 4L8WB 4XPIB 2GJIA 2ZT5A 1RAIB 2WOMB 4EZ9A 1KN6A 2ZB4A 1OVMA 3LTOA 4IBOA 4JI3F 1SVMA 5LYJA 3MRVA 1ZMOA 3GFFA 2XUIA 3NR2A 3Q3IA 1KJIA 2H7VA 3FJOA 3UT6A 1PK8A 2PA8D 4FN4A 2C5SA 3UAXA 1M9NA 2HF7A 4ZPCA 5F8HA 4DV2B 3HKBA 3KEFA 4MK7A 3ZDDA 1RKXA 2MZTA 1QIIA 5LBTA 4C0KA 4ZRDA 1NIPA 2UYHA 1U65A 1E8NA 3OUZA 2VA9A 1QUFA 2ZUDA 4V38A 3RYCA 1W85B 2RSLA 5EWJB 3F67A 1U4SA 1GWNA 2WMDA 5IFLA 1X7YA 2UZ3A 5SZIA 2OO3A 3DLPX 2VLIA 1YCFA 3MS7A 2Y1DA 1Z6AA 2IDMA 4CT4B 1S4MA 4BKRA 1U3DA 1VQNS 4YR0A 1H05A 2C2HA 1WPGA 4X0EA 1ZH0A 2FI1A 4XW2A 3BMXA 4KXXA 2Q3FA 3TG8A 4HN2A 1ISFA 3GD7A 1S49A 1QB7A 4OJHA 5HK4A 5FLXU 5HOEA 5KFKA 4RTRA 3SKYA 3W9BA 4A92A 3FFIA 1TYAE 3GW8A 4EQ6B 5JBNA 1DG9A 1S8OA 5AUOB 3OOHA 1TKDA 1ISRA 2TECE 5SYAA 2I5JB 4KQZA 3N0XA 4WOPA 3R0QA 3II6X 2IUEA 3B9QA 3O8OA 3VPHA 3ZHSA 5HP1B 4ZRMA 4IDDA 4F2PA 4S1OA 1RXSA 4ZVSB 2PEYA 4NCXA 1FRHA 3F5DA 4CHGA 1CK4A 3CG4A 4EY4A 3PIDA 1Y6QA 3SBOA 2YCBA 3B89A 5DO2A 5C35A 3B20A 4PTLA 3Q24A 4UF4A 4N8SA 2VG6B 3K0AA 1RB0A 4CG3A 2ZHAA 3A1EA 3PXDA 2V8BA 1C3LA 4MQ4A 4BX9A 3WGYA 4Q00A 1Q1NA 3LPCA 5DZ7A 3E82A 2WV7A 2YMLA 2ILVA 3CLSD 3A1WA 5DRYA 2BW7A 1ESCA 1O6XA 3AV3A 2PK3A 2UUBF 2EZ4A 1BVRA 8ATCB 1X8JA 4C5CA 3J81j 2NVUB 1XEZA 4RANA 5DGTA 2FZ4A 3UPDA 2G08A 1WM1A 5LUAA 3UOGA 2QE7D 3EE3A 2M6RA 4LBVA 2AHOB 2P2SA 2B4VA 3AUSA 4F92B 4QDUA 4BPRA 4FP9A 3GFGA 2QEQA 2N75A 3MW8A 1WW3A 5CH5A 4MIOA 3SHFA 2Y71A 1W76A 1VL5A 1DIRA 4X60A 2FLPA 1L5FA 4TSFD 4DWJA 4OJTA 1DWOA 5LP1A 3A9WA 1JFTA 1DWPA 1PFQA 2M9KA 4PY2A 1NP7A 3ESDA 1AZWA 1VP9A 2XIQA 3BMCB 3SYRA 3NP7A 5KFRA 3Q3JB 7REQA 3PBKA 2HA5A 2AMLA 2LYVA 1LOUA 3DEHA 4EJSB 1JEEA 2AOVA 2W7OA 4JKYA 2QU8A 4PLYA 3KJHA 5C5IA 3JQ7B 1GL6A 1WXHA 1FDVA 3HU2A 1OXTA 3PUJA 4QYSA 2J3MA 3NKVA 1SGWA 1T2AA 2X22A 3LMKA 1MC8A 1OIVA 4ZFNA 2QQGA 1SVWA 3ZBUA 3EIUA 3T9DA 1BYIA 5LPNA 4TT3D 4UEJA 3K0AB 4XUEA 4FONA 1A4RA 2PE5A 3JB9k 2R84A 3BMQB 4OHMA 3ANSA 2VYVD 2GBIA 2XYPA 5HP1A 3I0RB 4LF7F 1ZD4A 3GQCA 4ENQA 5E6RA 3ND5A 2FOIA 3FC9A 3Q3GE 4S12A 2GX8A 4DLLA 1EDBA 3VKFA 2AX0A 2A0KA 5IVPA 1X8DA 3IT2A 4D3ZA 3TX6A 4PFQA 1S7GA 5K2MA 1V5VA 2YWEA 3SX0A 5B55A 1K9SA 3H7IA 2KJVA 1SUQA 3IMQJ 4WZQA 1X1SA 2DTJA 1KK1A 1E1KA 3DMPA 4GC5A 4A8WA 4ZVQA 3Q2KA 2UUPA 4Q9HA 3UV3A 3MPWA 3LPMA 4DEZA 1ZH6A 2A0WA 3EPGA 2PXCA 3JVVA 1R18A 4ECXA 3D7NA 4QUIA 2PT6A 6CHYA 3KTAB 4RWWA 5CJJA 1EK2A 2YY5A 1IVNA 3I9KA 4ZVOB 3FBEA 3G0GA 3SYZA 4EHFA 1FXSA 5AXCA 1PR5A 1RZRA 3EJ6A 4QARA 3C8HA 4KN9S 1A98A 1OMOA 1WDKA 3RBVA 1W85A 1K7YA 4HYEA 1SEPA 1FMTA 5I4CA 2O9JA 2NXCA 3FAKA 3D81A 2C22A 5HBMA 4D57A 4M22A 4DR7B 4JLMA 5IT4A 4XEHA 2EJBA 2QRVB 1B8NA 1LA2A 5EX3A 5JISA 4M1TA 4C0LA 3D2CA 3IA0A 1GCOA 4W5OA 2XKAA 4O08A 4JJ6A 1T0UA 3NRBA 3SYTA 2ALYB 1F5BA 1SKYB 3AEXA 2RIRA 2GEUA 4HI0E 1KBZA 4D82A 1YHYA 1JR6A 1I4OA 1T6YA 3ORYA 3H5UA 1ZBDA 3PDJA 1RFGE 3U7IA 1LZLA 3KJNB 3P2EA 3L7UA 5IEJA 2Q5EA 1K68A 1JQEA 1SUDA 2VP3A 3ND9A 3QVJA 1IKWA 3HVHA 3EEOA 2BOVA 3GCWP 3Q8WA 3DOLB 2G9OA 3ZJTA 4FFMA 1J7JA 5FLXY 1WULS 4EG1A 3R74A 3G79A 4BCAA 1NZDA 1ST2A 2XQIA 3BGVA 2FPKA 1M2FA 4QDJA 3SIWA 5JJ5A 3GLGE 2CJYA 2PSSA 3PTAA 1KMHA 5TQJA 3R24A 1T8UA 2P75A 1ZZNA 4YCJA 4V1Ak 1HT3A 2GNOA 5HIAA 2VAPA 2JZCA 3EMKA 2PGDA 5BSGA 2X8JA 3IGNA 2XB2D 1HKUA 1H6KX 1RHMB 3NCPA 2BRUA 1NVUQ 4C22A 3E9MA 1FLVA 2O8DA 1W2BR 4B43A 4CLUA 3QFHA 3HT0A 2G4VA 1DEKA 4B40A 3DLJA 1KD1T 2VDOB 3DXSX 2M32A 2VHZA 2LEAA 3OR2A 1ZY2A 2BMFA 1IJKA 5K4GA 2BFNA 4PGHA 1T4MA 5FEMA 3H4IA 1AKYA 3CVYA 3RRKA 2YHSA 1PCAA 4J2HA 3HEAA 2VPWA 3TA0A 1T4DA 1JE1A 1TPZA 1G8PA 1JDPA 5DM0A 2KI2A 5CFRA 4RKWA 4I08A 1CJTB 1W9MA 4IILA 4NBSA 4WEQA 5HKAA 4HQKA 2AEEA 3AA8A 1XVVA 3SLGA 2Z6QA 1UWLA 2O7VA 3MD0A 3LGAA 1JBQA 4W8OA 1RQRA 3SQOA 2UYQA 3WLAA 4Q7KA 3C6KA 3G2KA 3NIWA 3D7SB 1ZDMA 1W29A 2JRSA 1O8CA 1BD3A 2P0AA 2L19A 3GV0A 3F7NA 2VNKA 1WUYA 2IYTA 3G0IA 3DZCA 4GLLA 3KB1A 4F6CA 3O8NA 1DWQA 1OXUA 2O8FB 2HNZB 1OBFO 4OQ4A 2OORA 4YIHA 1O0SA 2B9VA 4DNOA 1L1RA 3AERB 1KIFA 4WNAA 3PYDA 4E6EA 1NHKL 2LBPA 1XK8A 1V71A 4ZPXA 1TL1B 1A88A 4X8OA 3L6DA 3ORRA 1KRPA 4F06A 3R0JA 4JLDA 4ROSA 3W04A 2FW9A 2ZUFA 5A4FS 1L4MA 4NI5A 1GSHA 2B8TA 4MS4A 1KVSA 1QIHA 1LDBA 3JQCA 3LAMA 2VNAA 1MPXA 4C0OC 1M1HA 1KE2A 1AZSA 4GKJJ 3PFBA 4QUAA 4MIEA 3RGIA 1JVSA 5K9ZA 3QOWA 3KR1A 4YRCA 3U1TA 1QVRA 5EJFA 3H16A 1E2DA 1CZUA 1KPIA 1B6GA 5EP4A 4LYDA 3EIWA 4QJBA 3P9QA 3AO0B 4KBFA 3DV0B 3Q8MA 3GEIA 4QBFA 1TO6A 3I0RA 3L7BA 5ENVA 3KX2A 2RGBA 5D5PA 3DZJA 4YC7A 2P77A 2YN0A 4BNDB 2RGUA 5D0HA 3KUKA 1GPMA 1R8XA 2BTQA 1JR4A 5JZSA 1R0WA 2RS8A 4RV5A 1H5UA 1FKPB 4I6EA 1JDNA 1E5XA 5KNDH 3U3JA 4WK4B 3NJRA 2VYND 3KR2A 3U4QB 2ZULA 1Q44A 2G0TA 2WSSA 3CYFA 2BEUB 1K8QA 1Z0DA 1M8FA 3GFYA 3MFYA 4F5YA 4CMKA 5LXYA 1GZ3A 3IUJA 4KWCA 3BF7A 3SCKE 3PUYA 3C15A 2YV4A 2PRJA 2V67A 1ONOA 4A4DA 4KFTA 4OQMA 1OD6A 2HYIB 4B3GA 4A03A 3V4LA 2Y1RI 1HMPA 1KH3A 2FW6A 3NBFA 3ZV5A 5M29A 5CDTA 5KX5F 3SVTA 4KR0A 2ZYTX 1HLPA 3HYLA 2XY5A 5C25A 1EE1A 4UMFA 3CWCA 3LQ4A 1M0SA 3QRWA 3A8JA 4UMVA 2IXTA 5B7QA 1Z2PX 4Q3BA 1SCJA 4IIEA 5JI3E 2GIFA 4DJBA 2RHCA 2WG2A 4QFDA 2RONA 3U3OA 3VU0A 4MOWA 4A23A 2NX2A 5CVEA 2DB1A 3E81A 1WV1A 3FUVA 3O2SB 1S8NA 4Q15A 4JQCA 4UDYX 2D7CA 4OLBA 1GTG1 2ZJ6A 4J9MA 1E1RA 2O2JA 2CUYA 1YE3A 3BBLA 1JVBA 3U4HA 2CQ0A 4MWBA 4QYMA 2C2ZA 3JQ9A 1Y6GA 3R5JA 3PFFA 3NTOA 5C81A 4DMKA 3NMAA 2B4PA 4IOKA 2XYPB 1A5AB 2FQ1A 5H7XA 3FJ1A 1U7OA 2X6TA 2I9PA 4Q4AB 4JUBA 3ZHCA 4LTDA 4P10A 3ITKA 4ETZA 3K9GA 4BN0A 4MAAA 2QJ3A 4HZIA 4C3KA 3OLYA 2DXIA 2I1QA 4M4SA 2UYGA 2VBYA 2OWEA 2P9EA 3AP1A 2C42A 1ECBA 4MCJA 3J7ZT 1EVYA 2XIJA 5D3GA 1HSOA 2BFEB 3CJ8A 3TJZA 1SH0A 3ENNA 2JEGA 1OAOC 3WIOA 4IGFA 4D3SA 4QSHA 2HQBA 4YJFB 3FOAA 2DKNA 3RTCA 2WWRA 2QN2A 4DGQA 4ZDKA 2WA1A 4C3LA 4YASA 3R44A 2P9TA 2O0KA 1W7WA 3RHZA 3SY8A 4WH0A 3MAJA 3BYPA 4ZYTA 4YRAA 1XMQJ 2P67A 3CUSA 3WS7A 1A2KC 2FSIA 3D67A 2HL6A 4YJGA 3UDLA 1RRPA 4W5HA 2R5FA 4OX9Y 3EFOA 4TTPA 1VQSA 5FBLB 5CYMB 1EFCA 4QUBA 3KT3A 4EDFA 2Y3IA 1Q74A 5EXPA 1GRQA 3U09A 1EHYA 4EYHB 1O0BA 5D7BA 1GR0A 4FBMA 3OLCX 3KSZO 4F4AA 3PFOA 3INRA 1Y9JA 3P32A 2NUAA 1P7CA 3MJSA 4QYIA 4ES6A 2LGJA 2IM0A 3H9UA 4QIVA 4EYQA 1NB7A 4U9HS 3RDPA 1ZFNA 1DMRA 3D0RA 1F6TA 1GL7A 3L07A 4KAJA 5CFLA 3S8SA 4RUBA 3ICLA 4O4HF 1YD7A 2CWDA 3LCJA 1IR0A 2HQCA 4XLLA 2MZSA 2QOEA 2FPRA 1TTQB 1NH7A 4Y3UA 4WZMA 1GPBA 4KJIA 1OILA 1SULA 4NBWA 4OZ0A 3Q3VA 5JNUA 1ZO8A 3MUMP 2E4XA 1NDLA 3LWLA 5IDQA 1FUUA 3NS6A 3WSVA 2VTBA 4QNRA 1ODTC 5HO4A 5I42B 1B6TA 1M1YA 1EAMA 5C32A 3CKMA 3CC2S 4Q0BA 5K5EA 4DTIA 3BC1A 1SR8A 4Q12A 4QUJA 3BL8A 2D2EA 3MM4A 2PBFA 4DA9A 2C88A 3Q40A 3QPIA 1GQYA 3CLTC 5GONA 4QU0A 1U2QA 2XF2A 3LT4A 4ZVLA 1OTXA 2I6QA 3OX4A 2CQ3A 3ECSA 5KWEA 4W4TA 3FCYA 3N5BA 2MSCB 3V4FA 2HFUA 1SXLA 4IWYA 2BMBA 2QZ9A 3G5TA 5KT4A 4I1RA 1CQJA 1G2QA 1BWPA 3DC7A 3HE3A 1A8PA 2YIDA 3KJQB 4PYRA 4W9RA 3QSYB 4YXFA 5JD5A 1TVCA 5DI9A 4RXMA 1JFLA 3EHDA 4OI1A 5HVHA 3UDCA 1KP6A 3WB1A 4XIYA 1DTTA 1KZ4A 1V8ZA 3MMCB 2V2QA 2UYCA 4X90A 4ECEA 2GPJA 3W5YA 4KO0B 3FA2A 2I0FA 1ZZFA 4CJXA 5JH7F 5IJ0A 1TNDA 2VKRA 3DAYA 5DX8A 2C04A 4S2UA 4F4YA 2HZCA 1ILWA 3AV0B 3G6WA 3JQ8A 4TM8A 4UUNA 3D5EA 1S97A 4EPRA 2J76E 1EZ1A 3UK0A 2QX6A 3KQPA 1RCFA 2VQEF 2VJPA 1Z4OA 2J6UA 5TF4A 5CLFA 5RUBA 5TQ0B 1KO7A 2UXDB 3R5JB 1DG1G 4J9VA 2GK3A 2I4MA 2W2OP 4P83A 4MVCA 4QPZA 1XJQA 2N3OA 2E6UX 3EOAI 4LYJA 4OD0A 1I33A 3QI7A 1P5ZB 1ZGBA 2CHVA 1M1UA 3HHLD 1FA0A 4XWWA 1H8HD 3OTOB 4JKOA 4TMZA 1XTRA 3A1DA 2C5LA 3KVRA 4RXUA 2UZ1B 1U8CB 4QAJA 3R6WA 4WCFC 4FS8A 1RRKA 2PZAA 3QU4A 3OFGA 4TXMA 1RSCA 3DMNA 2C2XA 1XLWA 2L3MA 5AVOA 3EVDA 2IAJA 3UK2A 4II3A 2VWGA 1UOOA 2PXXA 1F4LA 4O2BA 5J5CA 1TFUA 1V9SA 2NT3A 2XQVA 2ZBFA 1KI3A 1TM7E 2JOQA 3DWIA 4OQLA 3CX6A 2H07A 1Z7GA 1J8DA 5K8OA 2RK3A 3LWMA 2IX3A 3TF5A 3F6BX 3E6AA 3VHXB 5DLFA 3PSHA 1FSSA 8ADHA 3GEGA 1P8AA 3O1IC 2BEVB 3VPXA 3P2IA 1NJYA 2CNBA 4IAOA 2XMBA 5E1MA 5B58C 5I8WA 3ZGVA 2EBFX 4FYHA 1X1CA 3FSIA 3EN0A 3WGGA 4UW9A 2C92A 4QJVA 1U0GA 1SU7A 1H65A 4RF3A 5DYYA 4FDMA 1YK9A 1U8WA 3ZXIA 1ULHA 4Q7MB 1XRSB 1C0EA 1LPPA 2JRLA 1WMSA 3NIBA 1FMLA 1ZD3A 5I48A 4K4VA 1U49A 3IJPA 2Z3WA 3EVBA 3QHQA 5JNVA 3JPWA 4E6PA 2X0NA 3RBZA 3SCZA 1DRWA 2GC8A 1QDLB 1I3NA 1L5GB 4M1OA 2VBFA 1KTIA 5JCPA 4LF5F 4JD5A 3TGWA 1Z68A 1WSRA 5TPWA 1BQMB 2WSSD 3E9CA 3SMVA 3A4TA 3TZ6A 3GIIA 5AKYA 4URVR 3BGRA 4LMAA 3GLHE 1YQUA 4DV5J 3NG8A 1YJQA 3MMJA 1WC4A 2B9XA 4BNYA 2DIUA 1TE2A 2K7ZA 3MMZA 2OCLA 4HNSA 5CB4B 1POXA 1AZSB 2E5WA 1NK0A 1BXRB 5BVGB 1WKBA 2R1VB 4MDYA 1O97D 1Z4MA 4GI3A 1U3FA 2A9QA 2C0CA 3QBJA 4BB9A 1M73E 2QR2A 4NEQA 4PLPA 5FOXA 3RU7A 1OA1A 2GEBA 3DVAB 2PY6A 3R7SA 3G8AA 2QR3A 4LFAF 4NE2A 3R3YA 4DMLA 2PH3A 4LC9A 1JLCB 2VPWB 3PEJA 5J2NB 3DUFB 3QU7A 4KO3S 2IVFA 3ZWCA 4IFVA 3S8YA 4PWDA 3WFJA 1B64A 2ZPUA 1HQDA 3AIMA 4Q39A 3KJVB 5I47A 1FLAA 4DUZJ 3HO6A 4IJ5A 2QYSA 2AJ0A 4FWTA 4KOAA 3H0KA 5E33A 1DQPA 1BCRB 3H1PA 1KSPA 3KOXA 4KREA 4RSMA 1ILEA 2R7XA 3KLIB 4J0HA 4ZHRB 4LXTA 1XQYA 3ESRA 1UAWA 3UFBA 3TJ9A 5JASA 2WYOA 1DXYA 1QWOA 1BW9B 4QDTA 3RUFA 4FHZA 2KB0A 2QI9F 4WE1B 3H3FA 4Q6WA 5DGBA 2IPMA 2Y0BB 3D8TA 4GPZA 1TADA 3UWOA 4R1SA 1GNSA 4YMTA 2I6XA 1N54B 3QBTA 2VHJA 3MG9A 2FPPB 1PSZA 2J7PA 5D6NA 1IBKF 2DE0X 4TMTA 5JPDA 3SF8A 2DPIA 4ZO6A 1SI9A 1P6QA 2P2CB 2VP6A 1DRZA 3HCEA 1VE5A 3ULHA 2Q4EA 4S1WA 4LFCB 1DLOA 4TQAA 4ERXA 5CLLA 1TFWA 1CQPA 2GS8A 5EJ9A 2PVSA 2PGAA 2H4YA 3OH8A 1YBVA 3COWA 3F97A 4NYJQ 3DT9A 3V9AA 1DV1A 3GQVA 3AXTA 4LOHA 3MM7A 4CU2A 4ED1A 1M66A 4FNOA 4UZFA 5M2QA 1FVOA 1EQMA 2ZSBA 1RLOA 3I9JA 3DNFA 4XKJA 1WHTB 4QD3A 3I4FA 4I1VA 4DV1J 3PZBA 4ETIA 1N5DA 2QJRA 1YXMA 1JA1A 4OJMX 3KQLA 3HD2A 2LW7A 3ONEA 1OASA 2HDWA 3QVVA 2BYCA 3E9QA 3QTLA 1P75A 2B83A 4E3ZA 3QT8A 3WDOA 3TRKA 5CCMA 2ZFUA 4KQ2A 1QIGA 3N2YA 4ZHQA 4WF9Q 4JIMA 4C6RA 1UPPA 5HFJA 2IXBA 4AS1A 2C5AA 1DC3A 4Q0BB 3H9BA 2WK4A 3GYNA 1OW3B 3V2HA 5HBMB 4WFJA 3PEHA 3F90A 1NMYA 2Q1UA 3GROA 3M32B 3RSGA 4UU7A 3SZ3A 1KVTA 5EJEA 1X31C 4RTOA 1TKTA 3DL7A 1A7UA 5DOZA 1UMCA 2D5IA 4GMHA 4QJ5A 1U1FA 4S0ZA 2HW3A 3AM5A 5F4BA 3M2VB 2PE8A 4TUYA 5E3QA 3W7BA 3VAJA 3C46A 3BSNA 2XTJP 4K4TA 1HWIA 2IUYA 2P7IA 1G8AA 3TAXA 3D2LA 2OIHA 1CBKA 1RTJA 1H2TZ 3VR0A 1NAIA 4X65F 1WMFA 3PJXA 2R7OA 4UFOA 1S77D 2ZTUA 2WEKA 4AL7A 4B73A 3AUTA 4ZVQB 2H54A 1ZJYA 4PQEA 1BWQA 1ORIA 1K4KA 4RGQA 3QNWB 1U0TA 4RTSA 2NWQA 5LB4A 1FDIA 1U99A 9ATCB 1VPDA 3EYWA 3K58A 3BCSA 5AUPB 2MKKA 3D59A 4CCYB 4C14A 3QU5A 2RG7A 3WBBA 1V3SA 3EAGA 4NXNJ 5AJWA 4DEVA 1APSA 4RXTA 1I4DD 3AD9C 3BWEA 3CJSA 5IXYA 4LRDA 1A27A 4CF4A 4IQGA 2X42A 1NG1A 3ZZNA 2V8VA 3DEZA 4NENA 1AKWA 4PIMA 1PJ6A 1UKUA 5KT7A 1XZCA 3ZE2B 3ORSA 4ILLA 1SL1A 3R7BB 2ON6A 1YB7A 3KCNA 5HFNA 3WZLA 1GH8A 1FRZA 2LKDA 3LWBA 3WAGA 4FF1A 1HQEA 1QRAA 5KFXA 5EZ6B 3T7SA 4O3PA 2W9BA 4XVUA 3HUEA 1OU4A 5LL6d 4CQMA 3C6QA 1SL0A 1AXQA 5CABA 3TRFA 1DLJA 4QPDA 2QVZX 4JMPA 2RDDA 4NCGB 4LF9B 3VJLA 2QJTA 4OQJA 2AOXA 2HN9A 1QF7A 1XCOA 3I09A 1GT8A 1HMVA 3HG7A 2OCBA 3P9ZA 2Q3MA 3EFOB 1N7GA 4KXMA 4WKBA 3RK0A 4UZSA 4R5MA 2JA2A 2LQBA 3P2KA 4L22A 3KB8A 1FZTA 4M9RA 2VT3A 4EBBA 2W6OA 1PKEA 3CDUA 1H0HB 3MUVP 2QRGA 2JFDA 3PZRA 4IHJA 4GD3Q 2X15A 2WF7A 5J40A 1TLFA 3N70A 1GA4A 4C0BA 1VHQA 4PSDA 4BO2A 3NWJA 1AMUA 1TA4A 1N2CB 4Y9DA 3TQRA 5HVNA 1MRNA 3E1KA 2MKCA 4PPQA 1QQ6A 3KE8A 5M5BA 1NZJA 1HDYA 4YV0A 3E1GA 1UDAA 1WRBA 2C20A 2X2FA 2HREA 2R5NA 5LD2C 3K9QO 2M3DA 2BMAA 3WYAA 1WUUA 4MMOA 5BN4A 8LDHA 4QU9A 3MM6B 3BRWD 1BJKA 1MT3A 4UEWA 3WWDA 1NKBA 2XXJA 4RORA 2YVAA 1WHSB 5J2PA 1DLOB 2CK3A 3MCAA 4OP3A 2ZLBA 1RHUB 2WP8J 4WZAE 3G0DA 5LZ5A 5CHCB 1XOIA 3EUNA 4LMPA 3Q11A 1K92A 1PUIA 1E99A 2JLYA 2YVSA 2ZM6B 4K4WA 2W0SA 4ER0A 1VIMA 4GZ3A 3HS3A 3P0RA 1SIWA 1M6EX 3C1OA 5PGMA 4X62B 4JUFA 2FZKB 4IUFA 3AF0A 1OBHA 2NUPB 4Q21A 5A8WB 4DE5A 1I13A 4JDUA 3TZEA 2FN8A 2QBYA 3REGA 3MVEA 4CQNA 1Z3CA 1FKPA 3TB6A 4CQMB 3A1UA 1I2CA 3OM1A 4WW0A 2F8EX 3W7AA 4D1YA 1V41E 1E7QA 1LWEB 1V48A 4YMEA 1FUEA 4KQFA 3HQ4O 4RQAA 5A1TA 1PO7A 4NG4A 1ZLYA 1CEYA 4QSMA 3EZUA 2Q2NA 1UINA 2NIPA 1PJBA 1RCOB 2C1ZA 5FA6A 2J45A 3HVJA 1MX1A 5F8GA 4WFNQ 3EGWB 3A26A 1IOWA 1WMEA 3FBBA 1KC1A 4ZLLA 2QX0A 3EX7C 1NBAA 1N56A 5I8PA 1OKKA 4Y2KA 3FVQA 4FFBB 2ISQA 4MSUA 5GAHU 1ML3A 4L9RA 2P65A 1IIRA 1FY2A 1JLSA 1RBQA 1HYBA 1DCKA 2EKDA 4I81A 1VP3A 3W06A 2QRKA 4QOHA 3VR5H 4WYLA 1U0FA 2MB0B 1LNSA 2WONA 1KQGB 4BECA 1Y4UA 4MR7B 3JALB 2ZAIA 4TU7A 1NSPA 2W1BA 1KH1A 3EZ7A 2PX4A 4C7XA 2V7PA 4QDZA 3R5SA 2HMVA 5P21A 3E2IA 2WMNB 1OFTA 2D74A 4YYEA 4IHAA 3P45B 1UZDA 2B6NA 1BS2A 1H1LB 4B3SB 1NQUA 4N0PA 1NTRA 4B81A 3UO0A 1FEEA 4XYGA 2IYLD 5BWMA 4EUNA 3QHPA 3W5BA 1DT3A 4X94A 2XUKA 3QELA 1ETUA 2HGMA 5FOSA 2YYSA 4S2EA 4DA0A 2C3MA 1KAMA 4G1EB 1XRNA 3MPUA 3IWNC 2GCNA 2F3UA 4DBZA 5LA6F 4ZVRB 2XB6A 1JVNA 2I8AA 1PG0A 1WIWA 2PH1A 2DPXA 3BE6A 4H3KB 5JU6A 5TS2A 3EXAA 1U7UA 3GCGA 5K8PA 3M3HA 1ANKA 1DAEA 1G42A 2QGNA 4I3FA 5DM6Q 1AUSL 3QVKA 1ZH4A 2FF7A 3CPWR 3CH6A 4H17A 1B3BA 1JAXA 2J9RA 3R0XA 2UXBJ 1XXHA 1N6HA 3MK31 4JASB 5ED4A 3DKKA 3V2UA 3MA0A 2XZTA 3UW1A 1NZ8A 1O51A 3LAKA 3WGVA 2J6BA 4Q3DA 1ESDA 2KHDA 2VCEA 3UD3P 4ER6A 3A70A 4NFSA 3E9EA 4C2BA 2PQ0A 1D1UA 2ECFA 2XADA 2VR1A 5DHSA 1YB2A 4RK4A 3S2IA 4F7WA 4WA8A 1BEUB 1KOJA 1N1EA 4LF4J 4F7DA 2PX0A 2PKRA 3AHJA 3CRW1 2A14A 2GH1A 2JFKA 1QTRA 1MNAA 3BEDA 4CKBA 1ES9A 2R86A 2JHCA 1J5OB 5DHPA 3UXMA 2HWIA 1PYOA 2IYNA 1RM5A 5BMVF 1T9ZA 1GPDG 3RVPA 3V1TC 5J58A 4DR7J 4DR7F 1TFYA 1W59A 1XGKA 1GGVA 5FHQA 4ACBA 4NLQA 4D25A 2A7XA 1J2UA 3VR4D 2QG9A 3B6KA 3NTRA 3NC1C 2X4LA 3OHBA 4RH0A 1G6HA 4AROA 1IRIA 4I55A 2EFGA 4NXMF 3D6TB 3PACA 1WXIA 3JWIA 3KYCB 1D2AA 3IB3A 1FLDA 1VDMA 4NBVA 1VPTA 4D80A 4NQZA 3UC9A 4WXEA 2YR0A 3VYUB 2H8KA 2CNWA 1J1UA 1XMIA 3I0SB 5CB0A 4QAQA 1E2NA 1POWA 2RGCA 4L85A 3CNOA 2XF8A 1ODSA 2K5UA 4P5PA 3OIFA 3ITEA 1QQBA 1GCGA 3LC2O 3O4FA 2ZROA 3UHPA 1O0PA 2HQRA 2XMQA 3HDSA 5BSRA 3K92A 3IAXA 3HCAA 3GL9A 1DFIA 1L5YA 3D02A 4FD2A 3JWEA 2MQPA 3N0WA 4RF2A 3VDQA 1JHYA 5FOTA 1QYDA 1TL7C 1TEXA 4FNMA 1DFHA 4P7GA 4YHHJ 3A27A 4WP3A 4XQ0A 3V48A 3LDHA 3OZUA 2BC9A 4ZMBA 3B6EA 3DBHA 1Z62A 1V43A 2IZ7A 2XNDA 4XGIA 1OXMA 1SOMA 3UD5A 1VG8A 1S2NA 1U1GA 1Q12A 5KU7A 5G0RA 2Q9BA 1IVSA 5TQ2A 1Y6JA 4M60A 2RGWA 1S6QA 2EFEB 1ZRMA 2EBGA 1G6Q1 3HR4A 4TKZA 3RTEA 4YP3A 1U0HB 4FI3C 1MAWA 3BL5A 4K4SA 1JSRA 4GOJA 1AGPA 3HP4A 3A13A 4RSGA 4GG1A 4DPUA 3K0SA 4NV1A 4JZYA 4A82A 1KIMA 3UENA 3JYLA 1GARA 5AOVA 5DHQA 1UBCA 3KYJB 1ETHA 4EFNA 1EB9A 1QYWA 3KNAA 4YA6A 4OHYA 3E3NA 3H1BA 1RWWB 4OO3A 5CYJA 1BFKA 5CVVA 3KK2A 1YRHA 4LTNA 2FJEB 2UYOA 4DMGA 3B8HA 2CQBA 1NF2A 3J7YU 4QYXA 1YBTA 3FEYB 3N2KB 3C3WA 1LWOA 1XD9A 1U25A 5MAOA 3B51X 1K7EB 4ZHSA 5KS2A 4M1KA 1FDTA 4JBHA 4Z49A 1DBQA 3WLFA 3DH0A 2M6SA 1VKOA 1NSFA 2AN3A 2IDKA 4Z9BA 3QKRA 2NXWA 2MJLA 1TQHA 1Z45A 5EWMA 3N6LA 3VOSA 3WX4A 3BBFA 1ZGCA 3P2MA 1YDGA 3FRHA 5L40A 4Z8XA 3E4CA 4G97A 3C5EA 2Z1NA 5I5GA 1KY2A 3U56A 1E5QA 2FW7A 4K0KJ 1X42A 4MXDA 4IDCA 4XJTA 4P82A 4LV8B 2HNYB 3ABZA 1KDVA 5CBPB 4MV4A 5AM5A 3ROEA 5DM7Q 1W581 1F2UA 1O9BA 5IT9Y 3GLHB 4S35A 1Y7LA 5H1SV 4X3PA 5IDWA 1J99A 2F4VB 2GRUA 5GMOA 2HEKA 1CYDA 1CUXA 3ZHYA 1E2FA 4O2AB 3BGFA 3VTKA 4AL6A 4IG3B 4Y28C 4MIBA 2YNIA 3WBFA 1TKRA 2OO5C 2FHMA 3AB8A 2GQCA 2HHHJ 1AN9A 2R9LA 1T0JB 3FTPA 4P80A 5K99A 4EEZA 4IJKA 1WW8A 3EGWA 4LXXA 1ZWKA 2DNKA 2VG6A 1GPAA 2DCUA 4B6EA 4S24A 3Q9NA 2IHBA 4LDJA 4BNZA 1MW8X 4Q01A 3MGCA 4JR0A 3O4HA 2RJZA 3LQKA 4F8RA 2XNKA 1KZ7B 4JDPA 4XCXA 1SXGA 3GPBA 4REOA 5FPSA 1AO0A 4WRRA 2PT0A 3ESXA 1M34E 5DBEX 5FOQA 2JIMA 3B54A 1CUWA 4GMXA 3ZGZA 1TJ5A 4EOGA 3K3PA 5CAAA 4X64B 4CM4A 3K70D 2F8TA 3RRMA 2G88A 4BVKA 2DO4A 4KUGA 4XUGB 1U1EA 1UEXC 4WXWA 4MFBA 4CV0A 4DFDA 1FSZA 3PR3A 1K3TA 1PDOA 2DGXA 1FTRA 4YREA 3M8ZA 4LEIA 4KXFB 3LLUA 4QPXA 2BBWA 2IE8A 3RVRA 1QAJA 5EFOA 2K06A 2C2GA 2ZI5A 4CMJA 3CD6S 4GZ5A 1BA2A 4WK6A 2QRZA 5AE1A 3R1HA 3LBFA 1SXHA 1YRLA 3RT7A 2FMIA 3BV8A 4HYQA 2VDJA 1KFDA 1PQUA 2E5JA 2Y9MB 4RKFA 1YAHA 2WJZB 3JWGA 1JDBC 2FUEA 5CM9C 5E8JA 2KFYA 1DPGA 1QS0B 4IMRA 3PHGA 1TW3A 4L57A 2P4EA 3CZQA 1U6BA 4EKDA 2GXAA 2PUFA 1B8OA 1OI3A 2ONYA 4YT8A 3VVUA 5A2GA 1D0EA 1Y0HA 2FHOB 3TCNA 1H0HA 2Q5OA 1WNTA 1VA5A 3R3SA 1XHLA 4I7FB 3HBNA 2H17A 2IPLA 2OB2A 2DNMA 2AX3A 5A2QU 1U48A 1HHQA 4RHEA 4IXWA 4BEJA 3ZD6A 1GNKA 1CRPA 3D68A 3O8RA 5D1HA 1W8DA 2B4RO 4FFDA 5HMXA 3NLLA 2HQIA 5A5DA 4X4SA 4PQUB 3TR6A 2Q4RA 3JAWB 4KE8A 4UBMA 3T7IA 4URFA 3OG9A 2GD2A 4MUYA 2W6MA 1YR2A 5KC9A 3O4GA 2W8BA 2GK4A 3AQPA 1FX0A 2GS9A 1OXXK 1GY8A 3M1LA 4OZJA 4ZN6A 3KVOA 1YA8A 3WADA 2CMDA 5J2MA 2IEAA 3AKZA 3RJ9A 3TKLA 4AX4A 4Q16A 2P2CA 5IHXA 4USVA 3LIIA 1KVRA 3P71T 3GLGB 1RT4B 1PR1A 3B4MA 3GYBA 1FRLA 2BUAA 4BWGA 2IOFK 1UVLA 3GFOA 2AXEA 3AQOA 5CNKA 3HPOA 2ZBIA 1FP7A 3EXCX 2FZEA 2V68A 1PUJA 2PZLA 4U2BA 3KK0A 4ENRA 3K0BA 1CY8A 1ZPVA 3CMAS 1Y4SA 2YWJA 2MSTA 5LOVF 1Q16A 1ACMB 4MV5A 2X3GA 5EZYB 3RTAA 4LFBF 3FKBA 4LQCA 2YWFA 2V8PA 4XAKA 4RZRA 1A04A 1RE1B 4XO0A