4JP8A

Crystal structure of pro-f17h/s324a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
395
structure length
395
Chain Sequence
NTIRVIVSVDKAKHNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tk-subtilisin
publication title Increase in activation rate of Pro-Tk-subtilisin by a single nonpolar-to-polar amino acid substitution at the hydrophobic core of the propeptide domain
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 128
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4jp8A01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4jp8A02
4NE9A 1EGQA 1S2NA 3DE6X 3A3PB 2DUJA 2ID8A 3SICE 2WV7A 1SUAA 4ZARA 2PYZA 1AF4A 1SBHA 3L1KA 5JXHA 2Z56A 2Z58A 1Y9ZA 1HT3A 1CSEE 3VV2B 1GTG1 1TO1E 2W2PA 1SCBA 2XTJP 2ZWPA 2WUWE 4NMXB 1YJCA 3CO0P 1LW6E 5AMXA 2IY9A 1Y1KE 4GI3A 1S02A 5CW1A 1C3LA 1UBNA 4HX2A 3VTAA 1C9NA 3H42B 4HVLA 1SUDA 4JP8A 1SVNA 1YJAA 4CG0A 1TM1E 1SELA 2HPZA 3A3NB 3DDZX 4OV6A 3BPSP 2PWBA 1PJ8A 4AKTA 1DUIA 1P7WA 2ID4A 4YN3B 5JMOA 3F7MA 2SBTA 2Z2YB 3Q40A 5SICE 3CNQS 3WIUA 2QTWA 5K7SA 3BGOS 3DE0X 1YU6A 2ZWOA 3A3OB 3VYVA 1SUEA 2W2OA 3DVQX 3P5BP 1AVTA 2Z30A 1SCJB 1SN7A 1SCNE 1Y34E 1PTKA 2Z2ZA 2W2MA 4K8RA 5AVJA 3AFGA 2PWAA 4CFYA 2XRMA 1KDVA 1SBIA 3CO0S 1TECE 4H6WA 3DW1X 3BX1A 4BWGA 1SBTA 3DWEX 3DE7X 3CNQP 1V6CA 3BGOP 3ZXXA 1KDZA 3VSBA 1BJRE 3UNXA 4C3UA 5JXGA 2HD4A 1Y4AE 2X8JB 5JXJA 1BE8A 4KPGA 4OMCA 2DP4E 2PQ2A 1GNVA 4DZTA 2SICE 2ST1A 3DYBA 1SBCA 2XTJA 1Y3FE 2PMWA 2TECE 1WMFA 1NDQA 1BFUA 3T41A 3I37X 4MZDA 1Q5PA 1ZVKA 5AQEA 1TM4E 2Z57A 4LVNA 1CNMA 1SUBA 1SCDA 3LPAA 2Z2XA 1WMEA 1TO2E 4KB5A 1V5IA 3F49S 1R64A 2B6NA 4WOBA 3DVSX 2Z56B 3OSZA 1S01A 4NE7A 3ZXYA 3I30X 1GT91 3GCXP 3BPSA 2GKOA 3EIFA 3DE4X 3TI7A 3TI9A 5JXIA 1GA1A 1WSDA 3F7OA 1P8JA 1SCJA 1SPBS 1GA6A 1Y48E 2E1PA 1TM7E 3DE5X 1SH7A 2G4VA 3EE6A 1T1GA 1MEEA 4I0WB 4LVOA 3WQBA 3P5BA 4CFZA 1AU9A 4H6VA 2ZRQA 1TM5E 5B1DA 1T1EA 5ARDA 3EDYA 1DBIA 3A3PA 2WWTA 1SIUA 1AV7A 5ARBA 1BH6A 5ARCA 3QFHA 2P4EA 1T1IA 1Y4DE 3GCWP 3DW3X 3WIVA 1SCAA 1SIBE 1C9JA 1AK9A 3VHQA 2W2NP 4M1ZA 1TM3E 1SPBP 4H6XA 1IC6A 1ST2A 3VV2A 3QTLA 5FFNA 3SQOP 5I9SA 2QTWB 4NMXA 2SECE 2W2QP 1KE2A 1AQNA 3D43A 1SBNE 4FONA 3D9QX 2V8BA 2Z30B 3PRKE 1ZVJA 3H42A 1OYOA 4K8RB 1C9MA 1R0RE 3AJ9A 3HJRA 1WMDA 3DE2X 2SNIE 1NLUA 1P7VA 1GTJ1 1YJBA 1VSBA 1SUPA 4DWWA 3AJ8A 3A3NA 1SIOA 1OT5A 1ST3A 2W2PP 4WOCA 4J94A 1R6VA 1PEKE 3GT3A 4YN3A 2Z2YA 1PFGA 3LXUX 2Z58B 3TECE 1EA7A 2PKCA 3WHIA 3GCXA 3A3OA 1GNSA 1NDUA 1Y3DE 3VV3A 1WVMA 2PMWB 3LPDA 4RYDA 3GT4A 3LPCA 4B5LA 1A2QA 4Z2AA 4ZOQI 2Z57B 1AH2A 1IAVA 3Q5GA 1BE6A 5FBZA 1TMGE 1SUCA 2PRKA 3DE1X 1V5IB 1GCIA 1MPTA 1ITPA 1THMA 2IXTA 2WUVA 3DVRX 1XF1A 3QMPA 4OMDA 1BFKA 1Y3BE 4OV6B 4NE9C 5FAXA 1GTL1 2X8JA 5AVKA 3GCWA 2W2OP 1Y3CE 4KG7A 1KDYA 2W2NA 1TK2A 3I34X 1OYVA 4AKSA 3DE3X 3SQOA 3I2YX 5B1EA 2W2MP 1Y33E 2W2QA 4C3VA 2DQKA 1JEAA 1GA4A 3PTLA 1KE1A 4DJ5X
chains in the Genus database with same CATH superfamily
3EXHB 4I1RA 4Q4JA 5IUNC 3IUEA 4AP5A 3BZUA 5LCXA 3TO8A 2LNDA 4UATA 1ZNQO 1FFDA 2PEBA 5EHIA 4XYBA 4GOMD 3NBUA 4OYYA 4L4ZA 3UGTA 4BFSA 4A6DA 1SA0B 3SBEA 5K0JA 3U3OA 1FDRA 4OFXA 4FXOA 1TZ2A 1ZL0A 4C7XA 3J80Y 4BGIA 3DRYA 4P34A 3T9FA 2L69A 4PCQA 5EFZA 2E5LF 4NSNA 3MXTA 3DOIA 5FTLA 3KTFA 4JB2A 1NATA 4HAWA 1X87A 2FJ0A 1YL6A 3H99A 5ETJA 3GIRA 1Q86T 4US1R 5TSDA 4GM4A 4W8GA 3VNSA 1LOUA 1RMTA 3GUUA 3HBLA 1AS3A 1KQKA 4JT8A 4KE6A 2JZOA 2CHGA 4XTRA 4DIDA 4HB4A 1KP9A 4R9VA 4FW8A 3ZCUA 1X0PA 3VYVA 1LWCA 4J07A 4Y2JA 3DFFA 4FGSA 3C39A 4O1MA 3ITKA 4KXXA 3ZZMA 2AOWA 1CQIB 2QVZX 1YITS 4WP3A 4EEXA 1B8OA 1MPXA 4CFYA 1TFYA 5D3ZA 2Q62A 4BGVA 2GBLC 4PN3A 3BQMB 4N5SA 3ZDXB 3D8BA 3OECA 2Y8WA 3GW8A 5AI8A 1G1MA 4OXIA 1IK6A 3UUEA 4C3UA 2C2WA 4NDZA 4OHMA 2XY7A 2FQQA 1I0ZA 3ZWDA 1R6UA 3K0FB 5FNVB 1YR3A 2OUIA 1BDBA 2GQQA 4DZTA 3KLHB 3RAFC 1VM6A 5P21A 4ZAFA 4OZJA 1N34F 2XXAB 1DURA 2ZD1B 1SUBA 5DNUA 3TARA 5LDGA 2PVCA 2E1RA 3RFTA 3GRCA 5CA1F 4JB3A 3DMRA 3VAZA 3OJEA 5KFUA 1OROA 2Z5FA 1LS1A 3OM0A 3QJ5A 4BQSA 1Y0HA 4ZMMA 1K47A 4IF4A 1N36B 3GELA 2CHVA 3H87A 2MMYA 3CLSD 4I2NA 2IY5B 1F1BB 3UE2A 1AMNA 3J7YU 2FLVA 2GMWA 4XK8C 1H5NA 1JFFB 4N3BA 7GPBA 3U7HB 3GRUA 4GWGA 2GHPA 2AMYA 4D99A 3LKZA 1T9GR 3PXUA 2XQJA 4KN8A 5EIOA 1SVUA 4M1WA 3N2LA 5LOVA 1M2KA 1VBKA 2V8HA 3LDAA 4LJKA 5AI0A 2FPPB 3G5AA 4US0R 5GM1A 1UMDA 4JFRA 3DXSX 2DEJA 5ETQA 4UHBA 3GFYA 5CDUA 1UZLA 4I50F 5SV2A 1VLHA 3MJ4A 3ISVA 3AEUA 3G7SA 5I7VA 4B9EA 4NJMA 2W83A 5C8DA 2VG7B 4AKHA 4MOWA 1OZGA 2X5XA 4JEUA 3ILXA 4C87A 3CVXA 2X7XA 3HSSA 4FYPA 3PYMA 2BL4A 3CBGA 3B6JA 3K94A 2HBQB 1W0KA 1NRJB 4GP9A 2W6OA 2WJAA 5CHCB 5JECA 2XMSA 3UTDA 5KDOA 3P32A 5LQNA 3GFGA 3KZXA 2P9QA 3ZU5A 2WD7B 2XBUA 3RRYA 4E14A 2VO1A 2ZIVB 5FBLB 2RAFA 4Z9XA 5FIIA 3OD2A 5BQ3A 4CLXA 3SYMA 4XWWA 3CW2A 3GIKA 3KOZA 4AXJA 1SQ6A 2AW5A 2YTZA 4YMTA 1LWFA 2OESA 1J1IA 1WV0A 2WCXA 2ZUAA 3N6MA 2AG6A 4JYCA 2FZ4A 4HMQA 1PK8A 3MB5A 1OBVA 1I2ZA 5A7HA 3BO2A 3EGWB 3GLGE 1U4BA 2G77B 4ZCKA 4P9NA 4OFBA 3QU4A 4J2HA 5LP6F 1P1RA 2AV5A 2XRZA 4Y6LA 4JJEA 2A0XA 3BWXA 3CD6S 1T3OA 1U1NA 3C97A 4N8EA 4YP7A 1C1CB 3QA3E 3A31A 2Y0EA 2R66A 4E1AA 1M6VA 1N2OA 5TIIA 3SDEA 5HIAA 4O5OA 1CFJA 3QEJA 1UT6A 2W2OP 5KKAA 3OCUA 2CPJA 3L8HA 2XBLA 2QMUA 2BANB 1ONNA 1WUYA 3LPLA 1NVVR 3EQ9A 3CEHA 4IV5A 1ZITA 5DHQA 3K5MA 2XWXA 1RPTA 4LS3A 4K2JA 4UDYX 5BSMA 3WG9A 3WGOA 1Y1SA 5F0UA 4DUTA 5K0FA 3EASA 2IIHA 3WO1A 2EWVA 4NCNA 4N18A 1W4CA 2V5HG 3I0NA 3NXSA 4RZIA 2JWNA 1D2CA 2MXYA 2BKEA 1D0EA 3J7AN 3B60A 5FUVA 5KOJB 5IQ6A 5E8RA 4JBXA 3EVDA 1WHTA 4LYEA 4NPOA 1X9SA 1A50B 1UDRA 4DL9A 2E66A 4BKUA 3JD3A 1HYEA 3VR6H 3QGPA 1W0JD 3H8SA 3LYUA 2W2KB 5CURA 3QV1A 2ZNYA 1SBZA 1Q11A 4HX2A 4MNTA 3WXBA 1N8SA 2EU8A 2Q5FA 5I7SA 3RG6A 4AY2A 4U3JA 1XTTA 4K9DA 1K1EA 5AOAA 5HKKA 2P5VA 3BXPA 1N4AA 1PG0A 4MUGA 3FPKA 5IJ0B 3RK4A 1E1DA 1RABB 2NU9A 3ELUA 1MVLA 4Q3AA 3J7ZT 1B7GO 5D8DA 4BFUA 3D54D 2QL9B 4C0HA 3K0CC 3PX6A 1VRTA 4FMDB 4UHCA 3UWOA 2QX8A 1ORHA 3T8YA 4JLMA 1E63A 2GBPA 5EE3A 3L0OA 4DYVA 4BYMA 3EGXB 1E1NA 3KEGA 1QAJA 3F8WA 3ONNA 2YXEA 3HFRA 4NNJA 2Y3YA 3VR5D 2AFHB 2BI7A 4Y9DA 1XKTA 4YQFA 1O77A 4IZ6A 2FUNB 5HAOA 1UZUA 4F36A 4ARCA 4Y0VA 2IJNA 3FOEC 3R3UA 5C80A 3QJYA 2WTEA 3LKVA 1HEYA 1O9BA 3U26A 3UOGA 2RMLA 4HRAA 1AFIA 4DGQA 3HN7A 5TMEA 5EJFA 2AJ4A 4A0RA 1RAHB 3DD5A 4NA3A 3T38A 1SCDA 2IM1A 5J5AA 4L50A 3FKSD 3CCZA 2OWEA 2FW1A 1FT8A 1E61A 4C0LA 1OY6A 1B6RA 2Z56B 2CQ3A 5A3SA 1PDOA 3V4SA 3GZ7A 1ZVQA 3B6KA 4ZRNA 1SC1A 5E3QA 4O4LF 4OXKA 2YY5A 3GJRB 3BSWA 1P0QA 3F5DA 1MR3F 3RLIA 5SY4A 5A8WA 3KLOA 1P2FA 3BG5A 2QPOA 4A7PA 5AW7A 3WB9A 4F4IA 3AJ1A 1M9NA 5PNTA 3RU0A 1BROA 1E5XA 4E2WA 4ARZA 3NMUF 1RRFA 1JAHA 4KBYA 3QQCD 4N9QA 1YCDA 4DNOA 5LA6F 5BT8A 1EEXB 3H83A 3V5NA 3CO5A 3CSKA 3EZXA 2HTEA 2FZKA 4OK3A 2ZH3A 5IDXA 4CO5A 5F8NA 2DGSA 3WYCA 5DHRA 1AE1A 4KYVA 4GO7X 1E77A 4P7GA 2X40A 3SQOP 2EKNA 5C8XA 3VKGA 4F56A 4NWBA 3QVMA 1E9BA 2O52A 5BVHA 4JLPA 1Z15A 4KBGA 1ZUD1 4Z4GA 5KOYA 3PKYA 3C3CA 3ZU6A 3K9LA 4ARIA 3RB4A 2PD4A 3STXA 4WE3A 1QMPA 4BBPA 1A96A 4FGWA 2JJQA 5L4LA 4HTJA 4JBGA 3TK1A 3D28A 1I7PA 3L4KA 5A4MS 1JIIA 3FJOA 3FNFA 4JH0A 4ND8B 2ASYA 4FMCF 1ZH2A 1FTQA 4G4SP 1YVFA 3JPYA 1WC0A 1PG5A 1X5OA 4NAHA 4GWKA 2R8BA 2C2ZB 1I4EB 4D1YA 1Q12A 3IPLA 3GRYA 3PCOB 2IEIA 3JATA 4PIMA 4UE6A 2ZG6A 1WVMA 2AG0A 3T0FA 4CM8B 3G2HA 2X4DA 3MBKA 3B54A 3UV6A 1YL7A 4NNPA 4AQYF 3R4VA 5D4LA 4P6QA 2IT1A 4MTLA 4QXOA 1F5CA 1YAJA 5AWFC 3RIXA 3EZ6A 3UWSA 4TWIA 5DNYB 1GUFA 4H3HB 4D98A 3NP9A 1DRJA 2CDBA 5FPHA 3D6VA 4EO7A 2AUTA 4LOIA 3RVRA 4KBIA 2BXJA 1G3QA 3R76A 5JSZA 4BNIA 4LNUB 1QQ6A 1UPPA 4TV8F 1KWGA 3B9RA 1U0GA 4FB4A 1F6TA 3GB0A 1FXRA 5L3QA 4RPIA 4QFMA 2ZKUA 1X4FA 4C5CA 3IAUA 3NYWA 2VG6A 3KK1A 4WEOA 1VK8A 4FYYA 1YQQA 1IYZA 2UUAB 1FFWB 3FFTA 4W8OA 1VDZA 3ODPA 1T1SA 2CNKB 2P9HA 1GDHA 3TRJA 5KNLA 3P6YC 2NXCA 1RBMA 2CN1A 1XOIA 4WNCA 2DJ5A 2QVCA 3M9MB 2X0KA 1TUVA 2GZ3A 3FNNA 4FT2A 1N2JA 3PXXA 4WGFA 3HULA 1DO8A 4R3WA 2D6FA 1BOOA 4AURA 3DV0A 3IA7A 2OE2A 4L2IB 1Z4LA 2BEWB 1I2CA 4JI1J 3Q5DA 3BGFA 5JR3A 4Y1RA 4G0MA 1EWQA 2FHSA 4DR1J 3NUGA 4BP8A 4D79A 2HFUA 3WLHA 3K53A 1DJQA 1XIQA 4TUYF 2ADCA 1CUXA 5T7BA 3R5FA 5DLPA 4O0MA 1WOSA 2MLYA 4DV3B 5DM1A 4PCAA 5DEOA 3A9TA 1MRSA 1JB0C 1ZS9A 1UZAA 2ZBGA 3GXBA 3S0JA 4HHEA 2X15A 1AQLA 1O57A 1NVFA 1RC8A 1UMBB 2V4JA 2R65A 4WCEQ 2FTKE 3X1JA 1Z4JA 3QXJA 1L8QA 4IV0A 2GD6A 4WU3A 2ACVA 1LQTA 2DE0X 1CUWA 4KI7A 1IDOA 3D8RA 4CM7A 4A92A 1F6BA 4JL5A 1KXZA 3X1MA 1VJQA 4OOFA 4QRDA 2R4FA 1U1RA 4DV0F 3V7FA 2CPHA 4RU1A 3RVQA 3VFDA 2IHJA 4F5WA 3G9XA 1R0LA 5JIBA 1OYWA 3GJYA 2WP0A 1TJYA 4DS5A 4KXQA 4Q19A 4ETXA 3ZY6A 4WD3A 2UVWA 1TMMA 5ALPA 2C7PA 3CY6A 1MBZA 2EG5A 5H3HA 5FHQA 1Q0SA 3SQDA 2IDLA 5E0OA 4QREA 4C0KA 1CSJA 4YCLA 2XX3A 3OL9A 1ONPA 4Q9LA 4K9LA 5J2MB 5FRDA 2DD8S 1DQ9A 1X7HA 2J0VA 1F1JA 2PX6A 3OLBA 3OBBA 2I9PA 7AT1B 3S2IA 3IODA 1EHCA 3KMSA 3CUNA 5IM0A 2Q4BA 1IXRC 4ZHQF 3HU3A 2G7ZA 2U2FA 1VQMS 3ILJA 3KK2B 5CCMA 2Z3WA 3UG6A 4WK0B 3AM3A 1TVRB 4F0KA 3X1LB 3MUOA 3NZEA 5TGZA 2BFBA 3NBAA 3L6BA 4CL2A 1IONA 3KETA 3GLFB 1ACMA 3K0BA 3NWPA 3ABIA 4A3SA 4XDHA 3WGMA 1PAUA 4MKXA 1XFAA 2QZSA 1ZUIA 1KR4A 3DBRB 2UZ3A 4RHYA 2ZFUA 3T6JA 5LYJA 5AESA 4RQAA 4BBJA 1II8B 3AINA 3R8CA 4UQTA 4FHFA 4KX3A 5HMXA 3MWDB 4NOKA 4C1BA 3RU7A 4EL0A 3PNLA 2R7UA 2R87A 4CM0A 3PRKE 1NR5A 5FBWB 4CM9A 1VJDA 3JWHA 3TKYA 4NE2A 5EIAA 1G1XA 2ZATA 4PIPA 1UW9A 5KVSA 1KY5A 2H1OA 3KWMA 1LBEA 2WMYA 3QYPA 2REBA 2XOKD 3CCJS 4RBUA 2G1AA 3T1NA 1NRXA 4EZ6A 3I56S 3GMIA 3A4LA 4I56A 5H0IA 4P3PA 3WKBA 1HDEA 2V7VA 2AG5A 4NQRA 2O2EA 4ZN3A 4M38A 1C1XA 1GZDA 3TTUA 4DQRA 4JCOA 4QEDA 1L4BA 1TU4A 4LMRA 1E6YA 2HMIB 2P4HX 2CPYA 5F7ZA 2JGIA 2R8ZA 3ANMA 2QN8A 4MCAA 5FDLB 4AXIA 1FLAA 2G71A 1K4YA 1S9FA 4CV3A 3QLUC 2H48A 4B3OA 2R2SA 3WKEA 1EFRA 3WY9A 1Z06A 1OWMA 5TQ0A 3OVAA 4PPDA 1D1PA 1M2WA 2P1DA 2Y1FA 3RSHA 3ET6B 1JHMA 3TZWA 2CSXA 3TJ9A 3KC2A 2XMVA 5ERGB 1JQ5A 3ACBA 3AH8A 2LYVA 2VTDA 2NVUB 2BCGY 2OMEA 3LL4A 3NVMB 2OPBA 3G2KA 4MH8A 2YNHA 1V9SA 2W2LA 3EAFA 2WKPA 2G1HA 4XUGB 3RYHA 1QZZA 1EQAA 5K8LA 1NXOA 4NLXA 1T8RA 2VHUA 1U1CA 3FYDA 1EHIA 2W2PA 3ELHA 3RS0A 1HI0P 4YDDB 1F2TB 3MRTA 4DV6J 1WXDA 5DT9A 3SPXA 1HHQA 3Q23A 3M3PA 4CLLA 4NYMQ 1XZDA 4IICA 4RHXA 4X8LA 4C0XA 1VLVA 2YXDA 1SKSA 4TZ0A 4JKIA 2IYEA 5CBKA 2PR2A 2IH4A 1E92A 4O4IA 3DB1A 1YJAA 3QWFA 1TM1E 3ZWWA 3FIUA 4DS4A 4R6XA 3V9AA 4YT5A 3U27A 1NQXA 3OFJA 2DTEA 5TX7A 3NPMA 2I7DA 2JVJA 3T4PA 4HPXB 3M9NB 5JMOA 2R7RA 2O5CA 1XMQF 3GG9A 3QFFA 2BMJA 3HQ4O 2OGWA 2HMYB 1OX4B 3DBLB 3JTMA 3WADA 4QYZJ 1ODKA 3FMBA 4PRYA 9GPBA 3UY4A 3QG1A 3B36A 3HJBA 3AEQB 4I4LA 2B30A 1C29B 1K97A 1SCJB 4BO6A 3A3YA 4J9QA 1SCNE 5LL6d 2V8VA 2IAJA 2W7PA 4CG3A 4TROA 2G08A 3TLCA 1QFYA 4JD5A 3U4MA 2K2WA 4GQAA 2ICAA 5DBOA 1YJRA 4X1YA 4EWTA 1VCTA 4QJ4A 2WIKA 2XUDA 3JXOA 1C7EA 1LC0A 1L2TA 4C0WA 3S5UA 4DLGA 2ISCA 1EBUA 1E5TA 2CDCA 3K4QA 3ROFA 4CL0A 4YRIA 1W73A 2ZE8A 4WK4B 3G8CA 1D4AA 2RBKA 2GBLA 2IVFB 2MDTA 4JT9A 3M8YA 1FMTA 4FR0A 4W5TA 4HPWA 4HEQA 1GRVA 4IZIA 3KQYA 1RD4A 2R1ZA 4ZYXA 3SYZA 4CMIA 2XGSA 3TDMA 1TT5B 3SKYA 5AE1A 1C1HA 1B3BA 1U8TA 1FX2A 2C5EA 2PFGA 1UVKA 3M0EA 2FDRA 3CIMA 3W6ZA 1A1SA 5BPFA 1T9HA 2EZUA 4DC0A 4N0QA 2FG7C 3DV2A 1JHPA 2ZT5A 2R1VA 1WPXA 5KX5F 1TUGB 1Z5PA 1GTZA 2CCGA 3DF7A 3VDNB 2FWMX 1E62A 2YHUA 3H2IA 3KK0A 5L46A 4KAXA 3NIFB 5FULA 2BYCA 1VKJA 4Q45A 2QROA 4FOPA 1H4QA 5EXXA 1RT9A 2AYYA 1E2HA 1U0OC 2XE8A 4GMXA 3OPXA 4PPGA 1QKKA 4M1SA 3U1BA 2C9MA 5BSRA 3BF8A 1GGVA 2HO4A 5C5JA 5FL7D 1AV6A 1XQYA 1RJWA 4YOEA 2V6MA 1W85B 1FNNA 3PFBA 1MH9A 3WX0A 5F5NA 3PNMA 3M5WA 2I2WA 2LIVA 5F51A 1KA9H 2XDQA 4AKIA 2B61A 1KNXA 2VQ3A 5DBFA 5CLJA 1D0SA 5IAEA 3GFXA 4ZC1A 1QONA 4OYRA 3QVWA 1MXHA 2Z4SA 3HNPA 3QT7A 4Y9RA 1T5SA 5AKLA 3C6BA 2BUNA 3PJGA 3COSA 2XULA 2LP4A 3NWEA 1FCAA 4D4HA 4FDUA 2I6SA 1QH8B 2ODPA 3DTTA 3CZ9A 2AHOA 2C7QA 2VSFA 4LF6F 2H4HA 4GRSA 1WHYA 2GTPA 2BGKA 2X77A 4CLPA 1POXA 1NUTA 2CXSA 5EN1A 3KOOA 4JJFA 3I96A 3E61A 3CCVS 1VC5A 2WTNA 2NZUG 2X0DA 1I1OA 3BEOA 2RDDA 4C14A 3GGPA 2JEJA 1D0VA 2FJBB 4ABYA 1XMPA 3OVSA 1V8BA 1N2CE 1DRZA 1O8CA 3HO8A 4EJ6A 3EYWA 1QTIA 3W8FA 2DXDA 3FDIA 1AKTA 5KC8A 4IR9A 2YVLA 2HQ1A 3BYRA 4KHZA 3LLUA 4BNFA 2M3DA 2IYAA 4R0MA 4D9BA 2PFFB 3C8MA 3ZBQA 2XB9A 3TQHA 4BNGA 2Q5CA 2OGZA 2YQ5A 1WDMA 1ZJ6A 2DUJA 1FEHA 1YB2A 4N6GA 4YACA 3CD0A 3FCYA 1VRVA 3DSRA 2VDKB 5EZYA 3G7NA 4W4MA 1Y7IA 1FPQA 1M7BA 3ZXWA 3AZQA 1ZMRA 1HL6A 4X4SA 4B2YA 4NJEA 1P1FA 1NF2A 2V2QA 5BRNA 3M6WA 3V1TC 1KSPA 4NYJQ 4U1RA 3H42B 3NGLA 2A0WA 1SUDA 3DOHA 3GLHA 4DWJA 3BTUA 2XUZA 1H1TA 5A2QY 1D8YA 3E7DA 1FDIA 1LZLA 3DB2A 4EJSC 4NH4A 3EDQA 1O4VA 1QDUA 4BC1A 4IJ5A 2I2XB 1NK8A 1WULS 4ZQIA 2HBZB 2GXAA 3WLAA 2AT1B 5FTJA 3WA6A 1TMKA 1FU7A 2BOVA 3U81A 3NMRA 2WYWA 1UKCA 2ZIZA 1U7ZA 2HH9A 3ZH9B 1T8TA 2BHSA 1P8AA 2OGSA 1C0KA 4RK5A 3R77A 2W2MA 4RPFA 3JRWA 4XCVA 1I80A 3CO0S 4IGFA 3KJXA 3D1JA 3RROA 2PKQO 3CLVA 5JBNA 4A8OA 3K0CA 4GAEA 3PW0A 1WC6A 3AB8A 2DKFA 2PMEA 2E7XA 3UDCA 1XMOF 2C2MA 1T9XA 3GV8B 2VYND 2X4IA 5BN4B 4QBUA 1P9RA 1GCOA 1QVZA 1J24A 1UBKS 3MURP 2VHTA 2P7IA 1EZ4A 2QD2A 4GM1A 1M5PC 3EVAA 4DPMA 3ANLA 4RD3A 1FK9A 4KODA 3NATA 5JI3E 4YUDA 1P2TA 1BMQB 2ZYUX 4MXDA 3OEHD 2ABYA 2P4QA 4DLLA 2W6JA 4YXFA 3CUEF 3DL7A 1ZTTA 4ZKEA 3E3AA 1YVRA 2EQBA 1W5EA 3K8QA 4YB8A 4Q9NA 4OI2A 4PFQA 1E5QA 2VJAA 3S1SA 1BW9B 4RXMA 1I5OB 3GAMA 1WCV1 3QVGA 1NK5A 3CGGA 1AO3A 1R8HA 2R7VA 3CLTC 3UCUP 3IS3A 1B0PA 2VBZA 3K59A 3STTA 3EXG2 5JISA 2XQKA 3OPYB 4MWZA 4WDQA 2AHRA 5J2NA 3NDRA 2F3JA 3NBPB 3W3SA 2Q0SA 3AFNA 4W6ZA 3ROZA 2KBEA 2XSFA 2GMLA 3U4GA 1EM8A 5T7LB 3PQFA 3THRA 1Q1QA 3T19A 4ZHRA 5AM2A 5FOSA 1VBNA 4K4XA 2XMDA 1CS4C 4TU9A 2QA4G 1TM3E 2DEIA 2QNBA 3WLNA 3VV2A 1JG7A 1P6XA 4ZOEA 4ZVUA 5T41A 4V02A 5KT6A 5KPJA 4CDIA 4BL5A 3KZNA 4OQFA 4PNZA 2AR9A 5G53C 3LKDA 3DOMA 2VNIA 5H3LA 2R1TB 1VIMA 1RLUA 2P2CA 2FMKA 4LBYA 4XIYA 1XMIA 3P0RA 3I0ZA 4OSOA 1J56A 3G1TA 3R41A 3U9TA 4DLZA 3P2EA 1SOUA 4NICA 2KG1A 1K8RA 2DHCA 3MR5A 4R0EA 2A5GA 5I7EA 5CAEB 2QI9C 3MWBA 4GPBA 1ZXBA 5GAJA 2B4OA 4GO5X 2HN9A 4DR4B 1TU0A 2JG3A 3VTIA 3CEPB 3DUFB 1S5ZA 3TCKA 1TV6A 3HL0A 4XUEA 1AW0A 5H8WA 5DM60 2VRCD 5KAPA 2JB9A 3RUPA 5DJBA 2V4UA 3V81A 1WXXA 4HFNA 3WYFA 1HYHA 2I2AA 3ZTRA 1WHSB 1LKZA 2WHXA 1KZ6A 1NUAA 1KXJA 2RG1A 3FB4A 3PEHA 3DEKA 2UVVA 3MT0A 1HQ2A 4CETA 1OV6A 1S7HA 3OOYA 1NHKL 3TRDA 4LDNA 3ROKA 3M2UB 2GFHA 1XUOA 1ZAXA 3INYA 3MJDA 5CB4F 2V6BA 4KHPB 5L45A 4MI1A 2I3BA 3L6OO 3A3PB 1YB7A 2WVEA 4ZVOB 4OLJA 3A28A 4F5DA 5KQPA 3D2CA 1QYRA 4CTMA 4C7OA 3F6RA 3MECB 1BWRA 4D3YA 4B3JA 3ZPXA 1G6Q1 1JLBA 4EPTA 2P6MA 1RKXA 1NBMD 4H7EA 4AJHA 4D4GA 2CJQA 3CO0P 3UCGA 4W5OA 1Q6YA 4PBRA 4CTOA 4BEVA 3JALA 7YASA 3LY5A 1VI7A 5BUZA 1P1TA 3KLGB 1XC9A 4G0OA 5JO9A 4BVLA 1U47A 3QM1A 2HY7A 4P5DA 3QO9A 3EMVA 3HUDA 1EHWA 2LWIA 1UJCA 4ZOAA 1TZMA 3HRHA 2OVBA 4UMDA 4I64A 3E7WA 4K4SA 3GWCA 3LCCA 5C8VA 2J0WA 1UFVA 2Y1LB 2MQQA 1V39A 3OTWA 3M32B 5BYSA 4TWAA 4C9DA 3M89A 2B92A 2F62A 1QVWA 5KIAA 3C16C 4KO1S 2BFAA 4Z3KA 1X31C 4NJOA 2G5CA 3P4XA 4YMGA 4JODA 4M1MA 3ANTA 5AVSA 3RC7A 1N2ZA 1N7IA 3LP8A 3WMWA 1PBTA 2HAIA 1WY7A 2V0NA 4CIBA 5C25A 3T3PB 4HXYA 3A9WA 3DEIA 1U8EA 2C4HA 1XJ0A 3JQFC 5MF6A 4S0MA 1HBOA 1T0TV 4EO8A 1XVLA 4DR7F 1JA1A 2WTXA 1G38A 2DHRA 1J00A 2C99A 3NS7A 4FGZA 2JLAA 4Q02A 4XAKA 4WOKA 4MR7A 4G1CA 2RHTA 3TOQA 5CFOA 3VKWA 4CM3A 4MJXA 3QGMA 2VDRB 3OU6A 3TLJA 5DISB 1AKRA 5CFMA 2RE8A 2GVZC 1RK8A 4CM2A 5JRDS 1GY8A 1M8JA 3LF2A 4W7IA 2A9OA 2P9JA 1RXSA 2D1CA 4DJBA 3ZW9A 3NGKA 2HLTA 3S4YA 3WICA 1PE0A 4OXYA 4CLZA 2J33A 3GJSB 3VU9B 2QA4S 3AHPA 3LQRA 4CCSA 1SK9A 3BPSA 3NV7A 1B14A 1BNCA 1CY8A 3TS1A 3UB4A 3UD4P 4QNRA 4C4TA 4EHHA 4B35A 3W5XA 3TWOA 1U65A 4AMYA 1G8AA 1I4TD 2B5JB 2QTVA 4XJXA 4X66B 4B75A 3UXYA 1GQOA 4P83A 4OKIA 3DAGA 3FFXA 1YDLA 4QNMA 1DQYA 3JAKA 1DY3A 1V16B 1AN0A 5GADU 5D1NA 3WWZA 2OPSB 5CVTA 1PKEA 1JA0A 2WHPB 2Z2LA 1U0SY 4UBMA 4DCSA 2X6RA 3W9UA 4MKFA 3ILSA 1WBJB 5DWDA 2V7PA 5JFOA 2CJXA 1G7SA 3S99A 5IJ9A 4W9NC 2W6CX 3PFCA 3DOOA 5EX0A 4HFMA 2YFYA 3R6GA 2LCQA 2RH3A 4NXNB 4F84A 3T1HF 4F93B 2CWDA 1XVIA 1UEXC 3ZHRA 2XNKA 4MROA 4YJ3F 1XYGA 2JFZA 1UK9A 4KQJA 1DQAA 4QUHA 3IEXA 1D2AA 2EK6A 4DPWA 1R31A 1DC8A 4PZYA 1T2CA 5G1PA 3G1WA 1L7BA 1S1XA 4BNKA 4LNHA 1I1NA 2QSYA 1KVUA 5HGJA 2AN4A 2ZSIA 2VL1A 1ZW6A 2ZTMA 3R0ZA 4NZPA 3KELA 4J1TA 2CVZA 4DLNA 3K8WA 1MOZA 3M82A 4ZK2A 3DO6A 3IO3A 1D09B 4KSBA 1WF3A 3PYDA 3NKFA 3Q5GA 2AFIE 3R9LA 3RJMB 4P2BA 5M3BA 3GCZA 1G3RA 2C8VA 2UVDA 3CC2S 2QTBA 2WF8A 4UTXA 2VHEA 1F4PA 4OOEA 3R3HA 1SKYB 1HNXF 5TARA 2AF3C 3OFEA 1FO1A 4GP7A 4TTPA 5I3UB 3O3OB 4X24A 2P6TA 1HBMB 4BJ6A 3E1KA 3R4CA 3ZKAA 4DFJA 2HM7A 2PO4A 1ZGJA 4LZJA 4X62B 4ITUA 3QLUA 3DYAA 2M7SA 2VYCA 3TSOA 3WYGA 3HZHA 1KI6B 1S0OA 1S7GA 4MK9A 1TF7A 1F2UB 4E7PA 4O3PA 2HEGA 5DU2A 4ENQA 3HSGA 2DNLA 3I32A 2QYCA 2GJKA 4KN9S 2HHAA 2C97A 1W36B 1WOYA 1EG7A 3DF9A 3AVPA 3RFFA 3FZQA 3B6MA 2CDRA 3Q15C 2DUUA 5FP0A 3LSYA 3DMTA 2V4QA 1N6KA 3WE7A 3UENA 1RWPB 3DFEA 1RT6B 3QKTA 4XM2A 2Y4NA 3PUWA 3KKFA 3TX0A 5AKZA 3Q7SA 3KNGA 4NMHA 5IFMA 1TO6A 3A2NA 3BB3A 4E07A 1XJQA 3R7BB 1UXIA 1S02A 3KWFA 2XZOA 4TKVB 4DSFA 2GZAA 5TY0A 3F0TA 3LP6A 4KTQA 4DZ6A 1LS6A 3GV0A 4FDVA 4LG1A 3OUYA 1FNCA 2IBSA 4DUGD 1VSVA 1E9EA 2NNLD 3UT0A 4F04A 3ENZA 3DDZX 3LX5A 3ZI4A 1C30A 1IN8A 2HF7A 4JLUA 3GDHA 4MDYA 5K99A 2R0QC 3O4GA 3R0JA 5K7SA 1T5OA 4E0DA 2NAFA 4MQ6A 2AX4A 3TKAA 1SIWB 3AW9A 5AJYA 4ME6A 3VJRA 4C97A 3S8SA 2VA8A 4D92A 4BKOA 3CGWA 1DXHA 3NCPA 2R47A 1VHLA 3NNCA 3ZBTA 1RKVA 4FYMA 5EIXA 4QGSA 3QIDA 2HV8A 1X15A 4DR2F 1IKWA 1HR0F 1C1DB 4CV2A 2W0MA 1VL0A 3KCNA 4JOQA 3ZY4A 3LYLA 6ADHA 4UTOA 1K4MA 2QZ9A 2VICA 1QVGR 1Z56C 2YL2A 3PFOA 4AMZA 4JT2A 4JI0F 1THGA 2OUKA 3BOSA 2FWRA 1KSJA 2IUTA 4KZPA 4RVSA 1VBYA 3D7LA 4KO4S 1NK6A 4NS1A 3OWHA 4CLFA 3ICCA 3PNPA 1CNFA 3JQAD 2EXUA 2NUTB 1IPEA 2PKYX 2PT5A 3DYIA 4FYIA 3PDCA 1O6XA 2RUSA 1NK9A 4BO2A 1XBTA 3H2YA 4M86A 5IXSA 5FOWA 4QQBA 3WL4A 3MILA 2HNDA 4OGGA 1WA5A 2A9FA 2JL1A 2HA7A 5IC4B 1O6CA 4W82A 2HIQA 1PJQA 1A4UA 4AS3A 4GE0A 2GI4A 3VJKA 4LV8B 4DPKA 1GT91 5D6NA 1L5KA 3U3ZA 1JQJC 2KFZA 1GN8A 1PLJA 4QAJA 4CKEA 1SCUA 1GIAA 4ECAA 3GO4A 1ZJ5A 3O3MB 4N12A 1HNIB 2DETA 3L4SO 2VQFB 3WQBA 4UTNA 1Y11A 4Y2KA 1EG2A 2D0DA 4ER6A 3C7DB 3DNFA 4KB7A 1DBIA 3VR4D 5A9SB 5HKBA 2JI8A 1XRRA 3TUPA 1WB6A 3URKA 2CFSA 3RU9A 2IYFA 3GCWP 3K9WA 1A7KA 3KSUA 2DY9A 4DJTA 5TVGA 2HGLA 4DQIA 1R0XA 4GXTA 1BEUB 4XD7A 2OCKA 1J6UA 1PQPA 1H3FA 4B3SF 2OEKA 2Q8QA 3PNYA 5KYUA 3I83A 1KN6A 2BGRA 1C4XA 1YZNA 4WJZA 3U4DA 3IDSA 5DI3B 4F3KA 1JSXA 2Z2IA 4NLYA 2ZZMA 5HROB 1U3WA 2VPYA 2PU7A 4E33A 4ITSA 1NW7A 1NPPA 3S81A 1PV2A 5KBYA 2VJQA 3FJYA 1IOLA 1MTOA 1J39A 1ICEB 4I1TA 3MYYA 1WMAA 4IWNA 2HDWA 4UEQA 4NV3A 4JOUA 4WXYB 1RWUA 3BMCA 4NOMA 2C1EA 2IM2A 1V5WA 1FF9A 2H2AA 3ANSA 2WFAA 2NV0A 1MD9A 4C2TA 2CMKA 4F4JA 1BHSA 1NRIA 1OQAA 2QL5B 4FF3A 2B56A 1PWYE 2WAMA 5F4ZA 1VIAA 2ZUGA 4F4HA 4OYMA 1ZPWX 1GG5A 2QE6A 5A6PA 1SUCA 2WEKA 4R8LA 4UW2A 1ZBTA 2KLBA 3HBMA 2OKCA 3WQSB 3KV3O 4D80A 1UAWA 3QEBZ 1GQSA 3WSVA 3LY7A 1AM4D 3GFRA 1DJOA 2JLZA 2J48A 5B0GA 1FTWA 3IG1B 4S1PA 3KZVA 1REQB 4JI2F 5AUQA 3P9NA 2EFCB 4QWEA 2C31A 1C7FA 1K3FA 4ZP7A 4MVJH 3SG0A 4MB0A 4GPTA 2CSUA 3F90A 3CB2A 4ZOCA 4ZFNA 3AJ2A 3DP9A 3B20A 3RARA 3VOTA 4J7XA 4TQGA 1UBMS 3F56A 2PYZA 4X6XA 4EA8A 2AS0A 3ELYA 2FR0A 4WZBA 3U3JA 2FMUA 2JI9A 3UUGA 3Q83A 1Q0UA 3H3JA 5CA0A 3ZCXA 4QGBA 1PO6A 1AC5A 4USWA 3F3SA 2HA5A 4YAJA 3J7YI 3CA8A 5I9MA 3B9PA 1RHUB 1U7WA 4A27A 5DW3A 1U2PA 1WD7A 4RCYA 5AXKA 4NLGA 1NP6A 1FZTA 1L1FA 5IUKC 3RREA 5CVCA 3WGYA 1HQEA 1EK0A 4RUBA 2YJGA 2BP7A 3ZGXA 2GQ0A 2IYWA 1JDZA 4KFTA 5JVDB 3M4YA 3C3XA 1KOJA 5HQ3B 4KR9A 2F3PA 3FWYA 4YR2A 1Y00A 2I91A 3KQVA 4NAVA 3U3RA 1W8IA 3O8DA 1PTJC 2A1BA 3CQ9A 4B5KA 3L77A 1QHFA 2QD5A 5D01A 2ON6A 4EJSA 1KYVA 2RSQA 2R62A 4Z4EA 2IKQA 3U4CA 1HNWB 5J59A 5AVOA 5HL7Q 3OLAA 3H97A 4ND4A 4NFSA 1PZMA 1KDVA 1FE8A 3KK3A 4E2FA 5EMHA 5DX1A 3H9JA 3DLIA 1YASA 2ECQA 2YZMA 2AYZA 2ENWA 4HKQA 3ZZRA 1EETA 4KK4A 821PA 3D1HA 3PFGA 1T6BY 4M0MA 2HUNA 5EWEA 4F3YA 3HCPA 2CZGA 4L6V3 5AYVA 3H4BA 4K6OA 3HD1A 5BNTA 1T8EA 3L7JA 2JLWA 2KM8B 4QQKA 2J59A 3T3IA 2EFDB 1CZHA 3H0PA 4KAAA 1FKOA 4EBEA 2BBEA 1PWXA 2O0KA 1HQCA 3G0OA 1G5HA 5DNDA 2NPOA 3I37X 3DVAA 1NQ5A 3J80U 2J9RA 2QVXX 3GH1A 3CJ3A 4YMSA 4ANCA 3NWJA 3CKLA 5M34A 1CXZA 5GV7A 3VNRA 4ZN6A 5A4FS 2JA1A 5HA5A 1IPHA 2DNMA 3W7BA 3VR1A 4QBKA 5A1TA 1DFHA 1NASA 1PDWA 5FD8A 2XB2A 4G37A 3VH2A 4D5GA 2QGFA 5LQUA 4RWWA 5BR7A 1GA1A 3OHPA 2TMYA 1DBWA 4EBCA 1KOHA 5G0VA 1NK7A 4GX5A 1R2QA 4NBRA 4FNOA 2PZJA 4EMBA 4NCKA 4MFBA 4ER3A 4MVJA 4GQIA 2Y4OA 4EDHA 4TSKA 4Z3DA 3GVPA 1V7CA 1RQPA 1VECA 2HDNB 2MSKA 3DONA 3HSDA 1BHJA 2OXFA 2CPZA 2C57A 1YB5A 4BBZA 2NYAA 4HDQB 2AGOA 3BE5A 2XE7A 4ZVLA 2HFOA 3ZJ5A 5CNKA 1MC1A 4U63A 4HH0A 2CAJA 4HL6A 1MFZA 1YJQA 3AI3A 4L9WA 3PWSA 1S1VA 1NMXA 5CYGA 3KRTA 1S48A 3CO9A 4YMHA 2ZPUA 3BHJA 4OX9Y 3Q3HA 4X1IB 4RW4A 1CS4A 3R0IA 3AUSA 1CNEA 4UUQA 4G1VA 1TTHA 4LE0A 2EX1A 2GNPA 1R5OA 2Q6OA 4L78A 1N5SA 9LDBA 3W9IA 5I7FA 2ZUEA 1HDIA 1C5KA 5IK2A 2ZOFA 3ECAA 4H4MA 2CQDA 2C84A 3OZDA 4UDNA 4Y2CA 4J16C 5ETSA 2PI5A 2CZQA 2Y99A 5KWSA 1U8XX 1GNSA 4BCBA 1I5RA 2HZ7A 5LOVF 2ZKLA 2WWXA 5TJHA 2I76A 1XKQA 621PA 2GO9A 5FR2A 1EINA 5CHEA 2FGJA 2XO6A 2HMWA 2KFYA 3URMA 2WMNB 4L15A 3OX4A 2A6MA 4H7KA 4K3VA 2O7QA 3RASA 3C3PA 1OOEA 2V3WA 3I9LA 5AXBA 4ESVA 4NYZA 1OC4A 1TKTA 3OZCA 4AY4A 1Y3BE 1IKVA 4CH0S 4G84A 2CYCA 5AVQA 3D3BJ 3H0CA 2JLEA 3WFIA 1RYZA 5AE2A 2B69A 2G72A 5TPWA 3C3YA 1Z4IA 2W6MA 4M54A 3LBAA 3Q24A 1PNOA 5AKIA 5JQGA 1H73A 5KAKA 1U3UA 2QAJA 5LDDC 5FF9A 2VC0A 1B73A 4B45A 4ETIA 2OYRA 3B82A 1COWA 3NGDA 2Y66A 1VFPA 2II6A 4TN5A 5BR8B 2OZVA 1EP1B 4DR3B 4LHYA 1ZAWA 3COVA 5TF0A 3IRWP 1I4LD 4R3NA 1W96A 5JI2E 2C29D 1J0CA 1F4LA 1G9SA 1VPVA 2A1TR 4ENTA 4CQMD 2VDWB 2V97A 4Y2YA 4RIIA 1JVSA 4RXTA 5HK4A 3UR3C 4FYKA 4LHEA 2VFUA 3QTBA 5ESWA 4IG0A 3HCRA 1Z0DA 2MY7A 4KYZA 4FHDA 4PBTA 5JS2A 3CJSA 3KLNA 1ADBA 2O1XA 4IHJA 4B4OA 3PT5A 3CJQA 1U49A 4CNBA 2J9FB 1Y89A 3EFEA 5EQTA 1G5RA 4YB1P 1Q81T 4D8WA 4JBHA 2UZIR 3NOOA 2BBWA 4EGAA 4QAQA 1O95D 3EG5A 3E48A 4FI3F 4E1VA 4MITA 1MZVA 1YKWA 2GS9A 4V1CI 1W2IA 4I3GA 4RMIA 1YU6A 2WJ4A 1A6LA 2CHEA 2QQGA 4BRZA 2N4CA 1A9QA 1G8JA 1U7DA 3DUWA 4DV4B 1KH3A 1UP7A 3SZOA 3HO6A 5K0TA 3O1LA 3TQQA 3C16A 1TL5A 1PQ4A 3HKBA 3EXYA 1CJUC 3AKDA 4C08A 1OU0A 4EB8A 3PSAA 1R8XA 3IEIA 3PGVA 3FOFC 3Q7RA 3T5LA 2EFPA 4DBZA 2W37A 1YZ6A 4BPRA 4Q39A 5JNSA 4Y7DA 3C2QA 2OI2A 1MB4A 4HQFA 4TMZA 3SC4A 4M1TA 2BGWA 3RRBA 1QQ5A 5A7GA 3ZO7A 1CRWG 3RVOA 4K03A 5LUAA 1E7YA 3JQFA 2EP5A 5GAGI 1XK8A 2JZNA 3MUTP 3MWEA 3BJEA 2BJ1A 4HSEA 1KJ8A 1M1XB 3M8ZA 3INGA 3PXAA 3DXYA 2OVFA 2CMFA 3EQ7A 3GT0A 4C48A 1YBFA 2DGVA 1Y37A 1S99A 3RZAA 1FJGJ 1R64A 5KS2A 5GAGU 3S8EA 1OIWA 3L0ZA 1W4LA 2GVZA 5AVXA 1N6IA 1T2NA 5K0ZA 4MV8A 4HB3A 5JH7A 2J5KA 3E1SA 2AYGA 2NV6A 1T1GA 2NVBA 5KFEA 4BVBA 3TXYA 1YTLA 5EJ6A 1LNZA 1NQOA 1PJ5A 1NYTA 3NALA 3M2RB 4CMAA 4Z3OA 3BQNB 2VYVA 1DQNA 1Y4DE 2YNMC 3DW3X 2BGGA 2WIFA 1XZEA 1QAMA 4TTIA 5HR5A 4I36A 4DOMA 3O9ZA 4LSNA 4YS2A 2J0EA 3UCEA 2MQNA 4X60A 1VHTA 3LT4A 2DK2A 4JXXA 3RT9A 3G49A 1NYQA 2Q1UA 4RTQA 3JQ7B 4V03A 1JKFA 3US5A 4CO0A 2QLTA 3I5CA 2WVGA 1QV9A 3AHDA 4UTGA 4ZAYA 2FLLA 3ND6A 1FE0A 4WP9A 1HOTA 4FBGA 3BM5A 2GEUA 2IHKA 1GG8A 2R6ZA 1FJCA 1LRLA 1SWWA 3BR9A 2XDYA 1KU0A 1GO2A 2I1QA 1OLSB 3FSGD 3IPCA 2QGNA 5HRAA 4EHLA 4MQLA 5EJGA 4OI6A 4W9NA 3BGRB 3CRNA 4RLQA 4KW7A 3GOQA 3LXUX 3GN2A 3E2PA 4TPKA 1Z5GA 1TUWA 1K9VF 4KJIA 5LZ9A 4WLNA 4A8JB 1EFPB 4RYDA 1VDMA 3JQ9A 1BCSB 1VRWA 1XZGA 3EMDA 2ZJ6A 1NAQA 4N5DA 1YK1A 5KOWA 3FDZA 2PR7A 3HXQA 1VB5A 3W3AD 1IZ8A 1QZXA 3E4DA 5AFSA 2FD2A 4RH0A 2X1LA 2HFJA 1DX4A 2MTLA 1OREA 4ED0A 5IS2A 2X3YA 2GEKA 1VQ4S 5AW6A 2Z8QA 2WKRA 2V65A 3AUUA 3U40A 1KP2A 4OXXA 1YGYA 4C8MA 4U67Q 4WFZA 5JADA 3RG2A 5IDWA 1OYDA 3H98A 4ELTA 3RTBA 4K4YA 3CHYA 1L4LA 1ZEMA 4FX2A 3MPUB 2P62A 5LDHA 1QSSA 3QZUA 4J7CA 4DA6A 1YB1A 4NDAA 2QRLA 5COBA 4K6MA 4KKVA 3SICE 3O74A 1U7UA 1FRMA 4FF1A 2BJDA 1KJJA 4JYAF 1VI2A 1RXVA 2EW1A 3S55A 5DYGA 4P31A 3IWXA 1RYFA 5L4SA 1LEHA 4DZZA 1Y7HA 3MM5A 1GILA 3GI1A 2UZ1A 4BECA 5BT9A 2ZJYA 3PXGa 5KTOA 2IYLD 2QZJA 2RGAA 5F41A 4IDEA 2C22A 1QLWA 4ALMA 2CXTA 4QPDA 2OYCA 3KLPX 2X86A 1UXOA 3CRVA 1NMEB 2WVBA 1XHLA 2WF7A 2CJKA 1ULRA 1MGOA 2BQUA 3NDJA 2HRDA 3DFUA 1ECLA 4PAGA 3RUBL 3FZEA 4J0KA 3CEMA 4C01A 1PGNA 4G1UC 1XU9A 1HNZJ 1IEWA 3USZA 2WTUA 3ZU2A 1V5FA 5G40A 3H4VA 1IJFB 3D4IA 3SE0A 2RBGA 2KYZA 5ALRA 4PPQA 5D4NA 2EX0A 3GNQA 1T94A 3IWLA 4KFUA 1W46A 1K8XB 4ID9A 3ZV7A 1G3OA 4FQ8A 2XB4A 1RE0A 1P77A 2FP4B 2PXXA 3WI7A 2XB6A 1X0XA 4LFAB 5LQKA 3HI6A 1SKMA 3H18A 2EEPA 4QWBA 5K3CA 1GPUA 3MMNA 1OBCA 1NY6A 4F4ZA 2X22A 4BP9A 1YFJA 4DQQA 3F5MA 4UEJA 1RACA 5E33A 4JA0A 2LCWA 4H3KB 1E1YA 1LVGA 5ILOA 4WPGA 3TVZA 1WU8A 4PHTA 4N0DA 5K8CA 1X38A 3BC1A 4NEQA 3AXMA 2LA4A 1TMJA 1U94A 2H07A 2V7QA 4NLQA 3OW2R 3JRXA 2GD1O 4X85A 3L06A 1WXQA 4C21A 4NBKA 1YDGA 5ESXA 1KI7A 1YRQA 1HYSB 1KQ3A 4J1TC 4CR8A 4WK2B 4ZJOA 1KYQA 2GEDA 4UREA 4DR6B 3T6KA 2ANBA 3OSZA 4V0SA 5K8OA 4BJHB 1S01A 4RTSA 3L6CA 1XZJA 1Q19A 3GCXP 3TLBA 1NE7A 3C3EA 2WVAA 5CTJA 1LBTA 4DSTA 3NC4A 2HQ3A 4MWOA 1NVBA 3PPIA 3SXUA 1H22A 1WEHA 3LLSA 4GVPA 1XNHA 3IQDB 3JWGA 3THOA 3PW2A 4KV7A 4Q05A 4CODB 5BVGB 4YY3B 2MY8A 3L40A 7FDRA 2GPTA 3N5CA 1N5RA 1IBKF 4DSIA 5DO2A 3NBYC 4EO6A 2OJ3A 4QUDA 3L92A 1DEXA 1G21B 2X8WA 2VA2A 3VGVA 3JYTA 2RC5A 3KLFB 3IP1A 2ETVA 1QC5B 3DMTC 3WS7A 1T6XA 2C5FA 1FFGB 1TKBA 4OJ1A 3N2GA 1PJZA 5J47A 4O6VA 2FRDC 3R3WA 3LYAA 1ND5A 1JMVA 4OK6A 1KO1A 4PW0A 1FKAF 1J2YA 4MV7A 4E5YA 2O3TA 2B82A 5L39A 3RUIA 3TA0A 2GYVA 2AZ3A 3W6PA 2BM0A 2O0LA 2XF8A 4G0NA 2BKVA 8ATCA 2HSDA 2A7XA 3MGAA 4D7AA 1IZ9A 2QJOA 2VQSA 4KQWA 2F9LA 1PL8A 3DOJA 2LKZA 3MPWA 4C89A 2IEDA 1ZD3A 1O94C 4I4BA 3VJLA 3R5KA 1E4EB 4DG5A 1CW2B 1ID1A 4HVCA 3C66A 1P9OA 3TRHA 4B33A 3JQRA 3KP1A 3A13A 1ZM2A 1S6UA 4WGGA 4AP6A 2C7OA 1CRZA 1SRRA 5L3RA 1S6QB 1OZ0A 2RHDA 3NHRA 2DSNA 4K4VA 3MHYA 1MC8A 2ZJ3A 3LQ2A 1ZIDA 3IMEA 3A8JA 4JR0A 4NLOA 1M2JA 4A26A 1U7PA 1F9EB 1JSLA 3N86A 4KKOA 1AT1A 5C1OA 4TSFD 2Z5GA 1T8PA 2BVNA 1DIGA 4WE1A 3R7FA 1JVNA 4R40A 3OV7A 2WUVA 5LYJF 5BO5A 4DL3A 2H85A 3GB9A 1E2QA 3ED1A 1B6TA 2YOGA 2IEGA 3ZIUA 2I1RA 4J0HA 3F2IA 2QEXS 1L7VC 4MX8A 3KTQA 5B1EA 3FOAA 3IOEA 4ENPA 3GEDA 3V4MA 5A0YB 2C54A 1P45A 3TX8A 3DEJA 1MORA 3LHIA 4CEHA 3U3KA 3CF4A 3FOBA 3MMCA 2FUCA 4G1EB 3FPLA 1FSGA 2ASEA 2XYGB 2EZ9A 1B6GA 4ZPCA 1NRWA 4QPJC 5F1YA 1ZGHA 2GUGA 3MEQA 4O2BA 1XCGB 4M87A 2H2WA 1QB7A 1BU5A 1Y81A 3BA1A 1RWWB 3K09C 1SQFA 4KQEA 2BMAA 4RVNA 1EIYB 2HKEA 1FTNA 1JJBA 3LAKA 4RWXA 4RWZA 1MMDA 2WB4A 1DC5A 2OXEA 2UYOA 3FF4A 1RHMA 1BWVA 5HM6A 3MMAB 5JYEA 1RT7B 1L4UA 1LSUA 1OS5A 1UDXA 3UB2A 5BQPA 3C45A 1G5IA 5F7OA 2AI2A 5IG2A 2ZC4A 4J3JA 1ULSA 4BMOB 3ZNQA 1K27A 4I9FA 3M5CA 2R6R1 1U7LA 1MABA 4ONEA 5CT8A 4LNAA 4URZR 1PHRA 1F48A 4I7FB 5LD2B 5K20B 5KFLA 1EVIA 1I3MA 1PJ8A 3T12A 1NR1A 1ZH0A 3ZU3A 2ZSUA 4LJ9A 2FP3A 3U7RA 2F3UA 2H9AA 3IPRA 1SV5A 5ADHA 2QSZA 1PAEX 4XFJA 1EQ0A 4ZO8A 4CQMB 1LRKA 1N1GA 4AJ9A 2HSWA 1GPWB 4C4YA 2GJ8A 3RG8A 4DX6A 4K6CA 1GWNA 2OB1A 4IVRA 3MWJA 4AL6A 1WCIB 4U7JA 1S97A 2X76A 4U95A 3ZHQA 3T3GA 3R3XA 1XU7A 4JI5J 3EICA 5EHHA 3ZY5A 2PLFA 5TS2A 3OF2A 1PTJA 1AUPA 2XZPA 4AWBA 1A7AA 4KHMA 5TRTA 1QG4A 3F9CA 3ZH2A 1N0VC 1CPZA 4Y30A 5DBIA 4RPGA 1EUDB 2BFDA 3NBXX 3HCCA 2V7UA 1YA6A 5TT0A 4DB4A 5ALQA 2L42A 1GNVA 2IS6A 2C0PA 4DV7B 2JBHA 1H0SA 2A0FA 2DTJA 3HB0A 4N03A 4YT8A 1E6KA 2IIBA 4O4IF 3K0HA 3WGHA 2YC2C 3NHLA 2X5NA 1RT5A 4IR1A 1UMJA 2ZTLA 3RYIA 1NJSA 4I68A 2QZ4A 3EG9A 5D84A 2O67A 2WHQA 2QVGA 2QE7A 3MJHA 3BWEA 2IWHA 1S10A 1L7EA 1WHWA 3LPNA 2WJPA 3RU2A 2FUEA 4EAQA 1E2LA 4U8VA 4K59A 4MKYA 3RS4A 4CCWA 3E8XA 3KQTA 4KAJA 3WGJA 1A9OA 1AZLA 2O59A 4OB7A 3BPDA 3EXHC 3G13A 2P2DA 2ZXEA 2X7HA 2GKOA 2BE2B 1URNA 1E6MA 1NQVA 1X7WB 3IUBA 4ZVPB 1T9TA 1H2XA 4PWDB 1KYTA 1M2OB 4MW1A 4WXWA 2UYQA 3LQFA 4UARA 5LN1A 1NHUA 5G0UA 1LB1B 4NZ6A 2NQPA 1U09A 2PMHA 2BUBA 2P40A 4JJAA 2F5GA 4D4JA 1AD2A 2CZCA 4RDHA 1Q20A 1ZJJA 1B1AA 1TJ4A 4WZAE 3KG0A 3GV5B 3IAM6 4D5EA 4MS1B 1OGJA 4YB5A 1RM4A 4FC7A 1C0IA 4URSA 2I7XA 4C5AA 2QBYB 2XI2A 1QHYA 4CLRB 4QBFA 5L38A 4PC1A 4RDXA 1LWEB 3REGA 1N5DA 3VSEA 2O2CA 1GQYA 2IW3A 2GO8A 1S1CA 1WAMA 1WW8A 1E0KA 1JWAB 3OZRA 2GJFA 3L0CA 2WVJA 2XNQA 3GQBB 1YJVA 1G41A 2R8EA 4ZEXA 4DT1B 5L51A 1K44A 2ZHAA 1DTQB 1T13A 5HJ2A 4PHFA 5BNZA 2VDOB 2OSQA 5H02A 2JNWA 3Q11A 3MM7B 1IEVA 1XMVA 3RSFA 2OAP1 3N9UC 4WKYA 2CXUA 4R1QA 3DZGA 4BLVA 4Q4CA 1N56A 4RA6A 4ZDJA 1D4ZA 1WB9A 3IT3A 4MUBA 4HDOB 1CBUA 1IQ0A 2GVNA 1N9KA 2CBGA 4LSLB 3EY4A 1USUA 4AL7A 3CS3A 4UZBA 3QW4B 4EKNB 2I9KA 1YUBA 1CUYA 3UOAB 1R4ZA 4LJ4A 4EG0A 5AHOA 5IXUA 1GT8A 2F48A 3LUAA 4Q4AB 2O8EB 1GCIA 4J16A 4W9MC 3M3DA 3P0HA 4EIWA 5JEEA 2VQEJ 2VIHA 2VPTA 1Z0AA 2JFGA 4ZGBA 4HNGA 3W0LB 4PAQA 3S6EA 2O5EA 3KSRA 2JEOA 3P19A 2CV0A 4JMPA 4BKMA 3EPKA 3C41J 4K0KJ 3DLGA 1YZFA 4MHSA 2K2PA 1I1GA 1TAGA 4AFNA 1ZCAA 2A0YA 1N8KA 2D69A 4DMHA 2DPIA 2BEKA 3QUSA 1NCLA 4MMZB 1HQDA 4GVBB 2ZBCA 4MYCA 2Q1TA 2YIMA 1S2NA 1ZAKA 2B20A 5I4CA 3X2FA 3UD5A 3LP5A 4E12A 3VZRA 1MV5A 4KFBA 1IHDA 3NGXA 4K2HA 1UAGA 5CXXA 4CT0A 1EXDA 4CEJB 2R11A 4A8SA 4H18A 1DIHA 1DC7A 2NXNA 2N3LA 1BXGA 3MYRA 4WAUA 1CLUA 5A03A 2HWWA 2X9LA 2WUWE 4HQNA 2EBEA 2B1GA 1T0IA 2Z2MA 3BBLA 1UBCA 4NCXA 2DNOA 2DKOB 4AO7A 3WDLA 3OM1A 1EU1A 3PHBE 4BX9A 1ZG3A 2WKSA 1RZRD 3FMFA 4M9RA 2HLDA 4X65B 3HP7A 1XRSB 3EAQA 3OZGA 2GZRA 1TL4A 2OIHA 1X8DA 4ENVA 5KFPA 4HQKA 1PKUA 4MRSA 4ZHSA 5JMNA 4Q21A 1OB5A 4TGLA 1JG4A 1ZUNB 3L9WA 1OSCA 4QOSA 3IJRA 2Q29A 4JV5J 2V2ZA 3ZCTA 3HJVA 1VLZA 2XGMA 2RB5A 1NKEA 2Q3JA 4DSNA 1GDTA 3AYXB 2P8SA 4TT3D 4GSKA 2X0NA 2LIPA 1NUHA 1UPUA 4P2GA 3IJPA 1PC4A 3P45B 3W2WB 3HCDA 4OGLA 4N01A 3G82B 1EP3B 3ZDBA 3MJTA 1B00A 1RTTA 3V4LA 1S0MA 4V0RA 4ZXPA 2AJ0A 5EZYF 2D4AA 2NGRA 4L85A 3KDAA 2D8MA 4JBNA 4NLRA 3PW5A 4ZT5A 1G6OA 4QX6A 2CLIB 1GAJA 4WX2B 4C11A 4P4TA 5I48A 3FK4A 5ABPA 2R8RA 1SJ4P 4KO0A 4A8FA 4OHPA 1CJUA 2B21A 4BNMA 1TVKB 1RJGA 1E32A 4PWUA 1RHQA 2G1PA 3CH4B 3L7BA 1PR4A 4L9SA 1YCFA 2V69A 4GPD1 1WSVA 3GP3A 1ISHA 1RQ7A 2ZS7A 3FWHA 2FOXA 2EBFX 1PL0A 4IY1A 4ER8A 1LQUA 3EISA 3OTEA 3WZ0A 1AG9A 5A2QU 3LSTA 2EFVA 3JVVA 1FDDA 4O4RA 2X3FA 2YKAA 3QZ8A 4HS4A 1W26A 2JIMA 1G59A 2YVAA 1QKIA 4RC9A 3RVPA 5DM0A 2YYSA 2BOPA 3P0JA 2N82B 3WJAA 1LTHR 4RSMA 4UD2A 3EX7B 2V9WA 2QR3A 4ZT2A 4RHFA 2OXCA 4MQEB 3L41A 3MM9B 1CFZA 5F8IA 1Y3AA 2O5RA 5JDIC 2H1FA 2FR1A 3OZSA 1N8TA 3I3OA 2QDXA 3GJ4A 2DUNA 4FMPA 1POWA 2POKA 4AIRA 2JRCA 4O4GB 4V0MA 2QENA 3VCDA 1T4CA 3M8WA 4OP2A 3QLVC 1F2HA 2GS8A 1U31A 3WGTA 4J9NA 4JR1A 4QO8A 4WFQA 1P1KA 1JDVA 3TNJA 3AKZA 2NZXA 4N5LA 4NK5A 2H1IA 2GAIA 2WICA 2YNMA 3VAFA 1K68A 3I31A 4RIFA 1LDEA 5J2TA 1ZYQA 4Z9AA 3AW8A 3OQOA 3JAWA 1WBBA 3HT0A 2F1OA 4FYVA 5JNLA 3I6IA 4Q2LA 2FSVC 2YY3A 3IE1A 1ISMA 1MROB 3L7OA 3LGMA 1H6CA 5IX8A 3TVDA 4ZVSB 2QRHA 4KIJA 3KXPA 3SMQA 4XKJA 1EI9A 4TVBA 3AM5A 1X1DA 1U5BA 1KI4A 3SC2A 1ZQ1A 2C61A 4C4RA 3VV3A 1A5ZA 2FZ5A 3ZCSA 4Y8VA 5IW8A 2AJTA 3OE5A 5EEGA 1BS1A 1PR2A 3HU1A 1YRXA 1WCXA 1SKBA 3OMXA 3GLIE 4RNNA 1O4WA 3VGSA 5CVDA 3MOGA 2P35A 2CQ0A 1QHHB 3BMNB 4FLFA 4NZYA 3S7ZA 5G0WA 4ZQHA 1E3TA 1LPPA 1LPNA 3H1PA 4DCJB 2LRHA 1IG0A 2BGJA 2PPVA 4KPEC 3R9WA 3N39C 5F3TA 1N32F 5KFYA 2HW3A 3GH3A 2VFAA 3KR1A 2O2XA 1P39A 1ZIYA 5B5SA 1IBMJ 3UA3A 1PFYA 3LDUA 3LV8A 4P3YA 2CXOA 5LLSA 4LRXA 3PFEA 1KEEB 1KFBB 1IN0A 4L0MA 3VGTA 3T1YF 4DVGA 4F3NA 2RIJA 3Q0TA 3K31A 1V96A 4DDKA 4FXWA 2NSHA 1MO5A 1SCBA 2V4ZA 4J9OA 3DMFA 2PUTA 2IBKA 3OEWA 1SD5A 3H5IA 4X93A 3P2MA 3DHXA 3OOJA 1AY0A 3QFSA 3D64A 3I9KA 1NM5C 3JD4A 5F77A 3KTAA 1L4GA 4RFSB 3IKMB 1UL3A 4G5YA 4D9MA 1SVNA 2WJJA 4HGQA 3DOLB 2N3OA 2CJYB 3AONB 4MIYA 1JHVA 3DBHA 4K50A 3ORRA 1BA2A 1Z0ZA 4OHKA 3DNCA 4R2XA 5K8JB 2YJTD 3PV0A 1C4WA 3U0VA 2OC4A 1HA1A 1C7ZA 3EB9A 1DE0A 3N59A 1US8A 1VL8A 5A4IS 3JS5A 1FEZA 3DU5A 3KYBA 5GADI 2OFOA 1GV0A 2XQVA 2VJMB 5DGDA 3P4UB 3S70A 4BCDA 4WNAA 3R8YA 1HDXA 1Y34E 2P9CA 1ISSA 1IMOA 3GPIA 3QPUA 3CJKB 1T3NA 2IW1A 3V2UC 4EGLA 1NN0A 3FTDA 1Z8HA 2AUNA 1X9GA 1U99A 4EYSA 3JYQA 2L19A 4B4DA 1TI7A 5JJCA 2I6TA 4IQ8A 5JEDA 4WBFA 4CWBA 1RAAA 5IM5A 4TRMA 3ENAA 4RSGA 1YZ3A 1JQLB 2DQZA 2BR5A 3OFGA 3VNUA 1MJHA 5DMXA 1RHJB 3NC0C 4B9AA 3LP1B 1S2OA 3PFIA 5EZ5A 3BR8A 4LJRA 1HQYE 4YP9A 2IL1A 4L4XA 3QU7A 1F0XA 4RM3A 3H86A 2FPGB 3TPFA 5JPDA 2GDJA 5C2GA 3JQ9C 2ZT7A 4XUDA 3NBKA 4ILKA 2VF3A 1JR3A 3F49S 5ALGA 4F6RA 1EP4A 4QR2A 1QRSA 3M6UA 4O29A 2NG1A 1WJGA 3O03A 3HCFA 3A11A 5DLGA 3TI9A 1W87A 2XIQA 3BK1A 1Y9OA 2Y76A 1RA6A 1P62B 3F7OA 4NZNA 2IPOB 5AE3A 3LY9A 5JT1A 2G4VA 4ZCTA 3K7RA 3W9JA 4LF4F 1PJLA 2V96A 1VA4A 3IIKA 3O3CA 1IY0A 3OF3A 4O1IA 5L1KA 4RA9A 4Y6GB 3HZGA 5C8YF 1FRZA 4R0JA 2RHWA 3EDYA 2HZCA 1YRLA 4I08A 1R8SA 2Q4EA 3QGIA 4AWAA 1NUEA 1CERA 3H0EA 2DTXA 3LXXA 4RGBA 3KKEA 1CUBA 4FYDA 2A10A 3R5JA 3FTCA 2TMKA 1T26A 3W61A 4ELUA 2YZKA 1FRFS 2HU5A 4Z5XA 1RW4A 5T67A 3RB8A 3I2JA 3VVUA 5LM3A 3L2OB 2GJ2A 3KJFB 3AJ9A 2J4DA 1I8TA 4H1TA 4WLVA 1RE1B 4O44A 3FTQA 2B6AB 3P49B 4O3QA 3W6NA 5F9MA 2FRDA 2BBOA 1ZOTA 4P4GA 1ZIOA 1M6WA 2WIGA 5G4KA 2VF4X 1BHO1 4MYDA 1G3UA 4J94A 2JCXA 4JQYA 1SWVA 5D00A 1FXDA 1Y8RA 4FHEA 5HS4A 3H1FA 1KTQA 2ZUVA 2VZ8A 1JQEA 2P9EA 5G02A 5BUSA 4FM9A 1JIQA 3HMKA 3DC7A 2COEA 5JWRA 1O94A 5CLIA 5B09A 2OAQ1 3RBAA 4EF6A 2IUEA 1G7CB 4HXFB 1N25A 2W11A 2WSIA 2MHCA 3VH4A 2IDJA 4GNKA 4OSEA 4BTLA 4PAAA 4QQFA 4RY9A 4YGXB 3CKYA 4EB3A 3QU9A 5L3ZA 1CLEA 5LJLA 1DKOA 4GS5A 1Y6QA 2ROQA 1HE3A 4ZVNA 4IUBS 4II3A 4YUZA 4HKTA 4YALA 3PXBA 4Z4QA 4KE9A 3RFUA 3SJ7A 2IU0A 3QPCA 2B98A 1P7YA 5M2QA 1RAGA 4KR3A 1NA5A 4HO1X 1RJFA 1BQNA 1MHPA 2PWYA 5E6SB 1W2HA 5DI9A 5JAOA 2JFYA 4RAOA 2IV7A 1KJNA 3B1XA 4DPTA 2IPXA 1J0EA 1T35A 2ZB3A 2AX1A 4R6WA 3UB3A 3FUYA 3SXPA 2DR9A 2ZJFA 2ATXA 5F33A 1I3OB 3LC2O 2ABWA 1R9NA 5IBCA 3PUKA 4R83A 1IKXA 2BELA 1OBOA 2JJ4D 5KFTA 3H7IA 2ZYGA 3BWVA 3BIXA 1GPDG 1AS0A 3VDRA 2ZOSA 5CXTA 4IJMA 3R5GA 1K8QA 1G6BA 3C3AA 2OP5A 3S6JA 3CLSC 3K09A 4DLTA 3VU1A 1KC8T 1JU9A 4L0DA 1W59A 3A3KA 3U5ZB 1FXUA 3JR7A 3SIPA 4MTCA 5J43A 3QT6A 2F17A 4II2A 1U81A 2Q5LA 4DIKA 1D1TA 1UWVA 1AQ6A 2GCGA 1YL5A 3IM8A 2Z2JA 2JHCA 1X94A 1YDHA 3R6TA 1DBRA 4ZIRB 2ZH5A 3O4FA 3QUAA 5IT5A 3NUQA 4XYGA 4JUIA 3MSXA 4I4TB 3P9KA 3AJEA 2HA0A 4X9XA 1TTTA 2UZ4A 1WTCA 1ZH5A 1YJXA 1IOZA 3N2NA 4LTDA 5IJXA 4JEMA 1QFZA 4IWXA 2H29A 3QWIA 2DEUA 4JUDX 5GTDA 1R0CA 4E31A 4MP6A 1E1RA 2O8DB 3LCUA 2IM0A 1GXTA 2QMQA 4G1QA 3VSBA 3N76A 5ELXA 3HLTA 3LFUA 1H5UA 2JIQA 1PO7A 4C2AA 3MEDA 5D78A 3RWOA 1CU1A 2QRRA 5TNXA 2TRSB 3QA9A 3SK0A 1D6SA 1Y3FE 3MJRA 1Y6RA 1CBKA 1FFSA 2ZR0A 3V7NA 3TOVA 3E9CA 1BFUA 2BFFB 2BI4A 2AW3A 3HHPA 4MUIA 1X2EA 5JMPA 4V0QA 4YRJA 3AF3A 2YKOA 4PXBA 3GEIA 1FBTA 4GC6A 1EFTA 2XUIA 3ZDCA 4CBVA 2Y0DA 4OZNA 1NT2A 1VYVA 4EUNA 4HFJA 5DCYA 1Q8IA 2JFUA 3PPYA 3LTEA 1DAGA 1JYFA 5EJ7A 4C0JA 1RT3B 3H84A 4YI3A 3G6YA 5ICCA 3GUCA 1TELA 3G5MA 4IDNA 3R2JA 2HVHA 4MV3A 3MTBA 3MUFA 4JC8A 5KG7A 1FRIA 2GDZA 2ZH6A 4LDAA 4XDCA 5CVUA 1V6AA 4B3RJ 1NF9A 2PBRA 4FFLA 3V1NA 1BEEA 1P7CA 3EXHA 5DYNA 3E70C 1CE8B 1XNRF 3KOMA 3LRPA 2WSEC 5DHTA 2BJVA 4IOAQ 1PYSB 2CT8A 1E8NA 4BWJA 4F25A 2ZI9A 5A04A 3BS9A 1Q1KA 2EJUA 1VYAA 2QOEA 5BQOA 3ZZYA 5HVFA 5DLFA 3HLKA 4O02B 4A8MP 3IR6B 3P9SA 2HFVA 2F00A 4MKAA 4YHHJ 1M83A 2XMPA 4G86A 1GYQA 1FDWA 4L5AA 3QXHA 2ROEA 5CDYA 5BN3A 2MYTA 3ZS9A 2JGJA 4EWLA 1HG0A 3AOEC 1G9TA 4C3ZA 4MVWA 4ZVKA 3A9VA 2IGBA 1NLUA 3NJ4A 4Z53A 3ETNA 3T5BA 9ABPA 4ZCLA 1SU7A 2CLFB 4PQEA 1BGXT 4OD0A 4QYWA 4TKMA 1BRTA 1TL7B 1NL3A 2HMAA 4DYHA 4FE3A 4TQSA 3HNRA 1USGA 4KRXA 1TZJA 1K7YA 5EUMA 5B1SA 1SHZA 4AG3A 4ZPTR 5E3CA 2H51B 2R96A 3LPCA 4QIGA 1UPXA 3QWPA 4Z7YA 3CEJA 1CQIA 4BPBA 2BJEA 3D7RA 4I55B 3GAZA 2C9ZA 1SKUB 3PQ4A 1BE6A 3UO0A 1VQ5S 2CY0A 1VQLS 3D6AA 2UXBJ 2DCUB 1E1QA 3IIMA 3H7HB 1UKEA 3O47A 1XTKA 4XSGA 5KG5A 1ESMA 4P4UA 4WKOA 3IP9A 2C4VA 2A58A 3FJ1A 4GWLA 2PZEA 4PLTA 5FNVA 1L4NA 3JSAA 3PLAE 4KRWA 2ZS8A 3ICOA 1B16A 3K9HA 3KLHA 1LPMA 1NHWA 1WQ4A 3ZTPA 4DHEA 4F12A 3BK2A 2FNAA 4N1AA 4NLLA 5HQ8A 3W6UA 2XXAA 3WBFA 2O7VA 1VC2A 3IAS9 5A8RB 2ZD1A 4DKJA 4E5VA 2PK3A 3A70A 3GEMA 3T9BA 1KO8A 5B0EA 2CXNA 1CUHA 4PPFA 5FLXA 1XZHA 4ZAZA 3M4XA 1G8PA 5KFJA 3CJ0A 1W9HA 2JF0A 3RVSA 1FI4A 3EFOA 4YWHA 3B6EA 2JGNA 1F1BA 4PZVA 1LDNA 4QUEA 1JFFA 4JJ4A 2ODQA 4IWYA 4MHOA 2AN1A 4PFSA 2NO0A 5SY9A 4P98A 3FHJA 1X9IA 1R89A 4RENA 1L4EA 4DG9A 2HKIA 2YX4A 2M9KA 2A2ZA 3EGDB 2MTBA 4H16A 1E1KA 2QG9B 4IP0A 3U2QA 4X4VA 5LU9A 3HWRA 4N5HX 3QPIA 5L1LA 2FLOA 3RVLA 2B7BB 2VG7A 1Z6GA 1LVUA 3Q1KA 1JAYA 2CBXA 3JQDA 3PNOA 4D4KA 4PONA 4RDCA 2HBQA 1HMPA 4I5DA 4RKYA 2BHTA 4FFMA 5J4VA 4YLGA 1QZ3A 2XUJA 2OV8A 1I10A 2PRSA 3R7WB 4GZLA 4YAEA 3SOPA 4GU5A 3UW3A 1LBIA 3FGZA 1R0BA 3ZWOA 2IZ0A 4NABA 2I8CA 1TOAA 4JUBA 1N4DA 4F3QA 1L5HB 4EGCB 3WQRA 4L4SA 2UV8A 4C0AC 3D6MB 1T5IA 3EXAA 1SC4B 4IFIA 4BN0A 2PS9A 5CA0F 5D7BA 5EJ5A 3VXKA 3ETHA 3EGWA 3T7EA 1ECFA 5IZCC 2WA2A 5JUWA 3IMKA 5BSTA 3BIWA 1QFMA 4I4IA 4MW2A 3OOHA 1E0SA 3ZBUA 4JI1B 1VGVA 3E8MA 3QFWA 2HYDA 4IDOA 3AK4A 1C1CA 2SKEA 3LT2A 4FWTA 4F3OA 4DR1B 2HNBA 3MR7A 4XCQA 3QEAZ 2F64A 3W2FA 3I30X 4NDNE 4B71A 1Q8LA 3CVOA 4RNCA 1YU9A 4EMSA 2BANA 3FW1A 2A78A 1ZNZA 1T1JA 2IX9A 1IUKA 4UQPA 1HLFA 1M5HA 1G7RA 3AGPA 4F5ZA 3IE2A 3KJGA 2JDJA 4Q7MB 5AICA 3JX9A 4O8ZA 4UOGA 4GL2A 1VHWA 4DV2F 4HT3B 1YBMA 2IYNA 3J81Y 2QIFA 4L51A 3EGIA 4M1EA 5CEJA 2OTLS 1XTJA 3BFPA 1C2TA 1O9HA 2X9GA 4Y98A 5ALHA 4S1OA 1LC3A 1VKHA 3MC1A 4MYHA 3T7SA 2LW7A 5KOJA 3VR2D 4MDHA 4BNDB 1EUZA 4Y0AA 5IH7A 2XVYA 4LI0A 4MUFA 1MENA 2Z4RA 3ZU4A 2PN6A 4HGRA 1KVSA 1FFAA 2WD9A 5JDIA 1SBNE 4MQFB 2DXEA 4PCUA 3V4OA 3KYLA 3VHXB 4HLUC 3UMGA 4TYWA 2W2KA 8AT1B 5EMLA 4D9FA 3M6MD 5H4HA 3FCVA 1PLKA 1BY9A 3GWGA 2AZ1A 1Y9DA 3IN5A 1XK6A 1IUJA 5J2PB 4F2PA 5TB5A 1AB8A 3QLVA 4LOLA 4KXMA 5IAJA 2GAOA 9ATCB 1JPJA 2YIJA 5D85A 1YE8A 2VJBA 2BONA 4YRZA 5IXYA 5IJ0A 4MB6A 3D8HA 1RABA 2ZRLA 3N8HA 3H17A 4YB7A 1HLGA 3RRHA 2PEYA 4EA6A 4ZYZA 3HCXA 2QL9A 4RF3A 1JSCA 4TLBA 1KY3A 4MVJF 2YQ0A 3RANA 4ZEVA 4MS3B 4MSUA 3K2YA 3MWGA 2XADA 3GRZA 3T34A 4Z8XA 3PIPQ 1JQKA 4EZIA 2FSVA 4QM7A 5BOVA 3JAMA 3AA8A 3H20A 4RSHA 2V5VA 5F8MA 2PX8A 3OURA 3K2EA 3EGXA 1XKLA 4ZODA 4J5OA 4K88A 5ENDA 4QU5A 1F12A 5E7OB 1OFGA 2ZM6J 2AFHA 2HL6A 1GARA 5D5HA 3KR0A 1PVDA 5AXLA 1HKUA 4Q3NA 5HATA 4DFPA 2NSJA 5CCXA 1IJEB 3UMSA 2CBZA 4PO8A 1T03B 1ZL2A 2LDXA 3KKOA 3KNZA 4Z86A 3ER9A 1B1CA 5YASA 1P33A 2IHUA 1GX6A 2VRNA 4KWCA 3BO3A 4EUKA 1NF3A 5DZSA 4AJNA 1T2VA 3SQMA 4LBPA 3TRKA 3RJ5A 4DNQA 1RAHA 4BGDA 4HNHA 2ZUSA 5FUQA 2NUBA 1MN6A 4FDFA 4K40A 4WBSA 5KYVA 1EIZA 3UGKA 4LBHA 1E6EA 3KX2A 4IOKA 2WNIA 2Z56A 5DIFA 1A5BB 1NU6A 3QOXA 1H6KX 4EO4A 1K5HA 3AHGA 4ZCQA 4DUZF 2EJWA 3OTGA 2CK3D 3K9CA 2R7WA 3AR8A 4MARA 3ILOA 2NUHA 5HUHA 4OZ1A 3QY0A 4EMUA 1Q1EA 1TNDA 1F3FA 5IULC 3QYFA 3EE3A 1HIYA 4WY8A 5F35A 1EDBA 3W2GA 4ILRA 1F14A 2QGZA 4HWOA 4E2XA 3MFQA 4ZEMA 2DGQA 3ZWAA 2QI9F 3LOUA 1F0KA 3ZV4A 3VQSA 2PSEA 1Q1ZA 3GY0A 2MYPA 4G8JA 3I9FA 3ZWQA 2UVPA 4RGYA 2ANCA 4XVQA 5B3JC 2HFZA 4ELVA 4JI7F 2ERXA 1J0XO 5EYPB 4ZVTB 2NACA 2BFNA 3BZQA 1NM5A 1QK4A 2OL4A 1F3OA 1PR6A 5AM3A 1RCFA 3J81k 1I3CA 4R1PA 3JQAB 4ZJYA 4MWCA 3VVLA 1HZZC 1C3VA 2DOKA 3DZDA 4MV4A 5KVVA 3TDNA 4MUHA 5JQGF 4JFAA 3EZ5A 2C9OA 4YP0A 2KL8A 2CPIA 4NYOA 1SN7A 3VR3A 5B0DA 5DCWA 5JZMA 4AL4A 2W6NA 2XD9A 1Z4KA 4ZREA 3IH5A 1YR6A 1JQGA 2YDXA 5I8ZA 5JCPA 3QENA 1KWKA 1W5SA 2O2YA 2Q50A 2VHJA 4ND8A 3KL2A 1MZPA 4J1QA 3TP2A 5CG1A 2GLTA 1HFEL 3OQ1A 4YV0A 2I54A 5G1OA 2L17A 2M8HA 1U6BA 3OMLA 5IN5A 4DV6B 5EE1A 3V8MA 2J0SD 2C2ZA 1J5EF 4Q2MA 2JCYA 3V2UA 1OTHA 2E44A 4P22A 1XSEA 1QGYA 4NLSA 3VTZA 2WTBA 3G88A 1T3GA 4X97A 4IHJF 1EWKA 2PLAA 3OXGA 1CVLA 1B0UA 3G5LA 4M6WB 3FUWA 1OGIA 4NA2A 5HZHA 4F2DA 4ZPXA 2RAPA 4QUAA 2BR0A 1ZCFA 2OHJA 2OHIA 2ZYRA 2QLWA 3D3CJ 4IIJB 4RLHA 2HQIA 4ENOA 1E1MA 3N58A 3JQ6A 1PT7A 3V2GA 5JSYA 2Q43A 2OMOA 3FLAA 3DDOA 3ZXIA 1U1MA 3CUUA 1L3CA 3EE6A 3DWFA 3VX3A 2QZZA 1QHNA 1ZC3A 1AKNA 5GJBA 2HCBA 2REQB 5LBTA 2JLQA 3N70A 2VWHA 1E5VA 2N1MA 1RPNA 2BUAA 1TP7A 3AA9A 1Z6AA 2C77A 4URXR 1YB6A 3HKDB 1RPZA 1FFWA 2CQPA 3NGSA 4KE7A 4MA4A 2DHSA 4GLLA 4LPSA 4Q9IA 2CNKA 1RHKB 2BFCA 5L3VA 3DOCA 4ZO4A 1P19A 4RORA 3IQGX 2LU2A 5EERA 5KT4A 3HC7A 2QQ0A 1WUJS 3LE8A 5H9WA 3GIIA 3H6GA 4DU7A 1G55A 2AWOA 3SNHA 4DUYJ 1YWGO 3WGNA 3JYHA 4QLAA 4L2IA 2BEWA 3CVUA 1Q5VA 3AJRA 1D2EA 1OKKA 4LFCF 1Y7LA 4Z0TA 2OD2A 1DUVG 2BV3A 3BXEA 2EFOA 1YJBA 2F59A 3UC9A 4DB2A 1CB0A 4LCJA 1YGPA 4RL6A 3PE3A 1A9PA 3RW6A 1T8UA 4ESHA 2JAPA 5IWAJ 4BFXA 4ZDIA 2CYBA 2GHRA 5JH7F 3TZLA 3BGSA 1OX5A 3MB8A 1E8DA 2PKCA 2SCUB 2XMTA 2WVCA 3LWNA 2I2DA 3U62A 2FG6C 4LF9J 4Y67A 4G97A 4WP8A 3HGTA 4RGQA 5AW3A 2AZXA 3W9YA 3PUYA 2IZOA 1YJTA 2B4KA 1UMBA 3FLEA 3M8PB 5CK5A 3QVLA 4LQ3A 1TYBE 5KQGA 2V9KA 3MPYA 3UNGC 3I62A 5C4GB 4JNKA 2X2OA 3AYZB 1UWBB 3V33A 2MCFA 2Q99A 2OTCA 1L6IA 2RHGB 1XPRA 2CHUA 4IXDA 3ETLA 4HCJA 5CFLA 2RC6A 4L08A 3KMQA 1H8EA 1KK0A 3MHTA 3NOVA 3ZTOA 1SAYA 1HARA 1GSAA 2D1YA 3UAVA 2EKZA 1NU4A 2WF9A 3UDVA 3HHNB 2VPQA 5JDCC 5BV2P 4I69A 4KY3A 2DG2A 3EFHA 3GDFA 4GKJJ 2KTQA 4HQOA 3GHHA 3UHJA 1H8HA 4PSUA 2WIDA 4B4UA 2YWFA 5J2MA 1B7FA 5AIAA 2PA0A 4GI7A 3N7AA 2J0QD 1YHYA 1RYHA 1Q50A 5DN6A 7AT1A 2JLSA 3HVIA 4EMDA 4D0GA 1XCPA 3F1KA 3DCIA 3JZAA 3OQ2A 3MELA 4HNVA 3KK2A 2P30A 4OTZA 3GGGA 1TVRA 1NUSA 3IO5A 1YBAA 2QRUA 2XA2A 1AKUA