4JP8A

Crystal structure of pro-f17h/s324a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
395
structure length
395
Chain Sequence
b'NTIRVIVSVDKAKHNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tk-subtilisin
publication title Increase in activation rate of Pro-Tk-subtilisin by a single nonpolar-to-polar amino acid substitution at the hydrophobic core of the propeptide domain
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 128
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4jp8A01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4jp8A02
4B5LA 1S2NA 2W2NA 4WOBA 4CFYA 5I9SA 2W2MP 4H6WA 1Q5PA 1DUIA 1ZVKA 3DE5X 2PKCA 3TI7A 3P5BA 3LXUX 1R0RE 1WMEA 2XTJP 1ITPA 1P7WA 3CO0P 3DE4X 1V5IA 2ID4A 3PTLA 2PYZA 3WIVA 1T1EA 2W2NP 3DVQX 1Y4AE 3VTAA 2ST1A 3CO0S 2WUVA 1V6CA 2Z58B 1P7VA 3HJRA 3P5BP 2Z2XA 1EA7A 4ZARA 1SIOA 3WIUA 1MPTA 2WWTA 1YU6A 1Y3CE 3ZXYA 2Z2ZA 4J94A 1HT3A 1AV7A 2DP4E 2W2QP 2Z30B 1BH6A 1PFGA 3SQOA 4ZOQI 3DE7X 4KPGA 2PWAA 1BE8A 4AKTA 1AVTA 4LVNA 3VHQA 1NDQA 1C9MA 3VV3A 1A2QA 3LPAA 2DUJA 2QTWB 4HVLA 2TECE 1Y3FE 3T41A 2WUWE 4JP8A 2W2PA 3UNXA 1GTG1 1CNMA 1SUCA 1TM4E 2PQ2A 1AF4A 5AVJA 3PRKE 4CG0A 3SQOP 2QTWA 1YJAA 3BPSP 3VSBA 5FAXA 5JXHA 3DW1X 3F7OA 1ZVJA 1YJCA 2Z57B 1SUPA 1C9JA 1XF1A 3GCXA 1PTKA 3VYVA 1SBCA 1TMGE 5AMXA 5JXGA 3BX1A 1SCNE 1P8JA 2W2PP 4OV6A 3WQBA 5FBZA 1BJRE 1KE2A 1Y34E 3DE3X 3QFHA 2E1PA 1V5IB 2Z57A 1GA1A 1VSBA 3BGOP 5ARDA 2W2OP 2WV7A 1WMFA 2HPZA 1R64A 5FFNA 2P4EA 1Y3DE 3GCXP 1AU9A 1SELA 4M1ZA 3SICE 3WHIA 1TM7E 4BWGA 3DVSX 4NE7A 1SUAA 4RYDA 4C3VA 5B1DA 1GA6A 1DBIA 3LPCA 1AQNA 4GI3A 1SCAA 5JXJA 1OYVA 2PRKA 5AVKA 2Z56B 3EIFA 1SIUA 1SBNE 2SICE 3DE6X 3D43A 2IXTA 2ZRQA 5CW1A 3L1KA 1SBHA 1Y33E 1TO2E 3H42B 2Z56A 1OT5A 3AFGA 3A3PA 2Z2YB 1EGQA 1PJ8A 1T1GA 1SPBP 3ZXXA 1C9NA 3H42A 2ZWOA 4WOCA 4CFZA 1TECE 2SBTA 2Z2YA 3D9QX 4I0WB 4H6VA 3EDYA 1GA4A 4OV6B 1SUBA 1YJBA 1Y9ZA 2ZWPA 1GTJ1 1S02A 4HX2A 1KDVA 1SCBA 3CNQP 1SIBE 3I37X 2G4VA 3Q40A 3BPSA 3DVRX 3OSZA 3TI9A 1BE6A 3GCWA 1NLUA 1KE1A 1BFKA 1AK9A 2HD4A 1WMDA 2XTJA 1THMA 4NMXB 1SBTA 2DQKA 3DE0X 1PEKE 1SCDA 1SUEA 2X8JB 1CSEE 1GTL1 1T1IA 3DE1X 2GKOA 1WSDA 3DYBA 1BFUA 1IAVA 3GT3A 1WVMA 4Z2AA 1GNSA 5SICE 3GCWP 3AJ9A 1SH7A 4NMXA 1GCIA 3BGOS 3VV2B 3DW3X 2PWBA 2X8JA 3EE6A 1UBNA 4K8RB 1AH2A 1S01A 1Y3BE 2B6NA 1C3LA 3A3PB 4FONA 1GT91 1TO1E 1KDZA 4LVOA 2W2QA 1MEEA 4OMCA 3QMPA 3VV2A 2PMWB 5ARCA 1SVNA 4OMDA 2IY9A 4K8RA 4NE9C 5AQEA 1ST3A 4DJ5X 5K7SA 5B1EA 4KB5A 2ID8A 3I34X 2PMWA 3AJ8A 3Q5GA 4DWWA 2Z58A 4DZTA 4C3UA 3F49S 1SBIA 1SN7A 1TM3E 1TM5E 3GT4A 3A3OB 4KG7A 1SUDA 1TK2A 1JEAA 3A3NB 1GNVA 1OYOA 1LW6E 1IC6A 1Y1KE 1SPBS 2V8BA 1SCJB 3I30X 2Z30A 1Y4DE 3DDZX 4AKSA 2SNIE 3F7MA 4NE9A 1NDUA 3A3OA 1TM1E 1R6VA 4YN3B 3QTLA 5JXIA 3A3NA 1KDYA 4H6XA 2W2MA 1ST2A 2W2OA 2SECE 2XRMA 1SCJA 4MZDA 1Y48E 5ARBA 3CNQS 3I2YX 3DWEX 4YN3A 3TECE 3LPDA 5JMOA 3DE2X
chains in the Genus database with same CATH superfamily
3MCNA 3EGIA 5EGNA 5E3IA 4JMLA 3QWFA 2ZUEA 3L02A 5JDIC 1ZVKA 5GADl 2M6LA 5L38A 3LS2A 1XMOF 4KGXB 3T3PB 2VRBA 1PJBA 4BU0A 4PZLA 1W19A 3HCBA 1QH9A 3C24A 4XQCA 1GTZA 1BX3A 3EULA 3VSCA 4AN0A 3K5OA 2BELA 3KNGA 1NB2A 2IC5A 3MGAA 4QPTA 3EG9B 2RBKA 1HT3A 3EAQA 3E9YA 2NUAA 2PUJA 4IG9A 2EX1A 1CUWA 1MC4A 4JKYA 3I9V9 4CH1A 3NHRA 3I4LA 3MWYW 4LYFA 3ZI0A 3CF6R 4MW9A 1ZAXA 4R9SA 3K9FC 4KEAA 4LJAA 1QOPB 1XXHA 4FS1A 1NOIA 1CNMA 1YRXA 4U96A 1NI4A 1EFPA 5TXGA 4KO8A 1UOPA 4PLPA 3ZX4A 3Q72A 3H9JA 1UVMA 3I87A 1ICIA 2AVDA 5M5BA 1F0PA 1PD1A 4N65A 2AQIA 4UC0A 2HMVA 2QIPA 1N9GB 4IMIB 2QYCA 4OLBA 4BDSA 2X5XA 4EY4A 3OXFA 1QG4A 3V5NA 1ZIYA 4KYVA 3QVLA 1C1DB 4OHRA 1E98A 1LH0A 1ZCZA 2GDZA 4BP8A 4YS6A 5IG2A 1KK0A 1Y8RB 2H5JA 3U1VA 4CM0A 2JFPA 3JVEA 1E6MA 3B36A 2HPZA 5I01A 3IDQA 1SH3A 1YKWA 4JJEA 2IUEA 4EZ6A 3ZZRA 1SGWA 3UJ6A 2WTBA 4PEOA 4QO8A 1UINA 1J2TA 3C14C 2JDIA 2ZRIA 4DSAA 2EZ8A 2ZSUA 4MVXA 3QUCA 1DMRA 4P86A 3GD5A 4UU1A 2L42A 4DX8H 2W00A 2P68A 5JNRA 4CMKA 1OIWA 3QSGA 1J2RA 3KJVB 1L7QA 2J3QA 3ZGOA 3ZFVA 4P2SA 2RARA 4ESEA 3DBVO 5JAPA 5T6MA 2JKVA 3P5TL 3AF4A 2Y8YA 1DIGA 1Z36A 3AEQB 4EYIB 3BF8A 4MSUA 4C22A 2IY8A 4YROA 1VDMA 5KFPA 3L1UA 3QJPA 5T4EA 2K7ZA 2QP9X 4AL5A 1WC4A 1SOAA 3G9UA 3RG8A 4PQUB 3HE3A 2Y8WA 3IOEA 3W77A 4YRKA 3A4MA 2EBGA 3GG0A 2C5FA 2P0AA 4BWVA 4HT7A 4DPTA 4IR1A 4Q4HB 2KYZA 2CDQA 1ZAYA 1RKUA 5D0RA 3LIIA 1ETUA 4KR3A 3ZXSA 3VOAA 1SVIA 2J4DA 3D0RA 3CX7A 2X1AA 3KAJA 1BCSA 4J7UA 5JD6A 3R7WA 1NK0A 4NMXB 2SKEA 1EYZA 1GXTA 3KXPA 2VOOA 2R42A 3KLOA 3I5YA 1TVMA 5HDBB 5EQDA 3IE0A 3KSBC 4DJDC 3HCAA 4AO8A 2RGEA 2ZKIA 1VQPS 3UMBA 2GXSA 3TJ8A 4GOKA 2VATA 5IZCA 1L3IA 3G79A 4DBZA 2HM7A 4AJ4A 1CY0A 1QFSA 4W7SA 3T7AA 4NLOA 3ZTWA 4R5MA 4H7PA 5CM8B 2AZTA 4DV0F 3CJ8A 1YCGA 1GD1O 5C1DA 2DGTA 3RK1A 3LW7A 2MSNA 4JLNA 2UUPA 4LYGA 3LCVB 1HI1A 3P2MA 1D5WA 1TYCA 4EPXA 3PYDA 4JJKA 1E3WB 2FPIA 3D6JA 1XPRA 1K6XA 2XMSA 4NP6A 8GPBA 5LJIA 1PYGA 1L7EA 1IE3A 2AHOB 1Z26A 3BB4A 4FBTA 5FI0B 3KUUA 3M7VA 3IXQA 4PWUA 1UKZA 3QRQA 4OV1A 2OHXA 5E9QA 1VIXA 2PO7A 5FOQA 5JOQA 1C4WA 2ZE8A 1ZI8A 4WFIA 2I78A 2C58A 2BE9A 4O63O 5AXMA 4GLLA 1B7GO 3QSYB 1KO8A 4XGQA 3L7AA 4D9BA 1FMFA 4BFSA 2CL6X 4CL0A 1XEXB 4HATA 1QMPA 2QLJB 4O4RA 4IGFA 1IB6A 1LRKA 2C98A 1HNVA 2QTAA 3IUNA 4HDHA 3E9QA 721PA 3EEQA 1LPPA 3DWEX 4WLNA 1A88A 2UKDA 2BEJA 1QZ3A 3J7TA 4RD0A 1FDVA 3H13A 1MDFA 1D6MA 3GYNA 1TF5A 2BKVA 5HFAA 2M4MA 3AEUA 4I50F 1GPKA 2ARKA 3GYXB 1GGNA 1VE5A 2PI4A 2BMWA 4UDXX 2CQ2A 1TPZA 3IKJA 3CLTD 1ZM2A 3KETA 4Z99A 4BWJA 2EYUA 4LF7J 3GFQA 4WRRA 1L8AA 4IWXA 3NBPB 4I8IA 4O4IB 4H4MB 4FSHA 4AJLA 1Q7EA 3D1OA 2J0UB 5G1NA 2B1RA 3ZU3A 1AMOA 5A4AA 3IBWA 2MSKA 3IUMA 2COUA 4PLFA 4P35A 1C8VB 2P5SA 6ADHA 2UXCJ 2Z08A 5KINB 3WY9A 3ICPA 3H5RA 2GYWA 4YRBA 4H16A 4EELA 2AFHA 1Z4QA 5CDUA 2R25B 2XUOA 2KXNB 3IAS9 4W9RA 3TX0A 2QGZA 3AW8A 3OZVA 2P1ZA 4M9XA 3RAQA 4Q24A 4YJ2F 2IYGA 4LY3A 4D8WA 1QHGA 4NABA 3T6KA 2ISCA 4EF6A 3NOQA 1JKJB 4PCUA 5TVGA 1R27B 2EFOA 3EHDA 3FZBA 4ZOAA 5SZKB 3CVVA 1S59A 5EJGA 4AY6A 4IGAA 2FKAA 3ETDA 2V4RA 3A6GA 5JRDS 4Q4AB 4WIQA 3DNCA 2PZLA 3GQVA 4ISCA 3MUOA 1FP4A 1U80A 1YOVA 4DCVA 3IAHA 4DV2F 4Q7JB 2Q2QA 3VUEA 5A4DA 1E9AA 1K2VN 4BATA 3GMDA 4BJ6A 2Q6BA 3QX8A 3PR1A 5KTTA 2Z8QA 5AKGA 1NVXQ 1KC1A 3KOYA 1UT5A 1KN6A 5ALPA 2GYUA 1AIPA 1FKPA 4YP3A 4M5LA 2FVCA 2CFCA 1WKCA 4MMXB 1HPZA 13PKA 4BNXA 2Q9AA 3BCRA 4J03A 3IYLW 2FG6C 4KRYA 3DF7A 3MCTA 2RB5A 1EGHA 2D59A 3BH6B 5D85A 2Y1JA 3BIJA 4D82A 2IL1A 1PR2A 5EWGA 4NCHA 1VI2A 3OLXA 4RHUA 3Q8QB 1A4UA 4O4JB 1NXPA 3E1GA 1FF2A 5C4IA 2LV8A 1M1XB 5EXXA 2NPIA 1Z6QA 3FE2A 5AOAA 4EKGA 4H77A 2C4MA 3ZN2A 4KZKA 2XYQA 4WGFA 2JH8A 1IKVB 2PT6A 4YJ3F 3VO9A 4G1MB 4JSYA 4WUTA 3GR6A 3SPXA 5LXTA 4L51A 2PKQO 3VU1A 1VMAA 1T8SA 2RKIA 1WB6A 2NO1A 2H2WA 4H0CA 2Q4EA 4HKQA 2KTQA 5DMXA 2GGPB 5DQIA 2B69A 1M2HA 5AKHA 3X2EA 1REVB 4DFKA 4MKBA 4BO5A 1AZSC 5ER6A 3LW5C 3LWDA 1NM2A 1P91A 3SBXA 4NKRA 3D0HE 3UB2A 2V58A 2BH2A 2NQ2C 3TR0A 3T3HA 4A8YA 3UJ9A 4BMZA 4B3SJ 1NHGA 4JI8B 3P9QA 1UBNA 4F3QA 2OHGA 2E7VA 2JI4A 4FW8A 2OO3A 3T7IA 3NXSA 4OX9B 3O8LA 4I8XA 1E66A 3OLCX 3AY3A 2OD7A 2WVGA 2R7NA 2XMDA 3F3KA 5FX2A 2WJZB 1N5IA 1SI9A 1XX6A 1QYCA 4AKIA 1FJXA 4FQ7A 3SZ3A 1XTJA 2BANA 2JH3A 5BR7A 1ZGCA 4X64J 2DIVA 2VRNA 1QBKC 1JEYB 4CF5A 3MHTA 4DV1B 3N7TA 2YKAA 2RGDA 4GAEA 1C7JA 4KO3S 5ETTA 4YO8A 1WU8A 3F78A 5EWEA 1V3SA 4R41A 4GDMA 4XQ0A 1BQNA 1E4YA 1K8XB 3PF9A 3SX0A 4NXNB 1FXLA 1QLNA 3TX6A 1W87A 3QYYA 3RRFA 4LE2A 3SYNA 1D07A 3RTGA 4B3RF 2VHXA 2ZBFA 4JV2A 2H2HA 3CH6A 4RWXA 2ZC3A 3GPIA 4XQGA 5KYVA 4LXYA 4IFYB 4DDMA 4P8RA 3KOXA 2PUTA 1O94C 3TTYA 5DZ7A 2VHEA 4W5OA 4CWAA 2W8ZA 3PDIA 3K17A 4AJ2A 5IP5A 1G9SA 1TKZA 3CX4A 3C70A 3CNNA 3QU4A 5EJ4A 1YNSA 1NKEA 2B82A 5KG3A 5J23A 2UUCF 3SSSA 2FB9A 4K6FA 3I9JA 5HCUA 5BN1A 3E22B 3RC3A 4YJGA 2O52A 1YA6A 1KU6A 2HJVA 2C2GA 1ZW1A 3P5BP 1UK8A 2CE2X 3MJTA 3JQFA 2X0NA 2I4TA 1CIJA 3KCNA 3ASUA 3S5UA 5A71A 1G6KA 5SYAA 4OI6A 4K3UA 5B7NA 4B4WA 4FFMA 4KBGA 4CM4A 5ETMA 4R8SA 1TCAA 2FRDC 1JXVA 5J47A 3VHQA 1SUWA 3FDFA 3KLPX 1ZLYA 2NU9A 3WJ7A 1S1MA 2ZITA 4HVLA 1NXOA 1JVBA 2LLZA 5K3EA 1RT7B 1PR1A 4FN4A 5ED0A 1O89A 5TPWB 3GMSA 2A18A 4HH0A 2PQ2A 3AY7A 3QX3A 2C42A 1ZN7A 4BZQA 2QMWA 2EWVA 2QRVA 4OQZA 2V8OA 3UHAA 4C87A 3FD8A 3ZDXB 5B6IA 3C7TA 3OUTA 1W4ZA 3OEEA 3Q8LA 3N6XA 3GZ7A 1J25A 1TZCA 4QHYA 4EF5A 2ZS9A 4GT1A 4LFBB 2WM2A 2O66A 3FB1A 4KO0B 1RAFB 5GADU 2W2XA 1DDGA 4W8HA 2E1PA 4XOUA 1J5EF 5A6SA 3HFJA 1XLVA 2CLLB 1HYSB 5D4PA 3KHRA 4LSMA 2VK1A 5CLGA 1FJGF 5AVVA 3LZCA 2IV2X 4BWGA 2YKNB 1JF8A 1AN0A 4A0HA 2RAFA 4MWBA 3WK7A 1R6UA 2W9BA 3T9DA 5L51A 4WN9B 4YMHA 1YVFA 4ZEVA 3UWDA 1UPTA 3U7QA 3NKFA 2RRNA 4P08A 5DHAA 4ALNA 3AKEA 5SZHB 4UM9B 1MKYA 1GAOA 1IONA 1KD1T 4EG4A 3JQPA 3GEHA 5DM70 4P0PB 4XCVA 2PQMA 4DV5F 1S0VA 3O90A 2PL9A 4KE8A 2VK4A 1FFDA 2WYHA 3C7KA 1C29B 3ZWMA 1QGDA 1QDUB 3PW4A 2GZDA 3X2SA 1JAHA 2XQGA 1P0QA 1RHJB 1RRFA 3DDWA 1ZRSA 1WD7A 3TO5A 4ZAWA 1CS0A 3A4VA 2IPMA 1RI5A 1TVKA 3QXHA 3CVWA 1OWXA 1QZXA 2F3SA 4CUJA 2PX6A 1BDJA 4P10A 1V47A 4JJ7A 2BFNA 1UWAA 1VHDA 3F8TA 3ESQA 3M82A 3Q41A 2ZRCA 2OY0A 1MHTA 2F3RA 3VI4B 1A5BB 4NARA 1C2YA 5B3JA 1A0OA 2B4KA 4OO3A 5JUMA 1HBNB 3H17A 3MT8A 1AW0A 4DCOB 5E0KB 4WDRA 3N7AA 2KYXA 2IZ6A 3CR3C 4DF4A 1KI6A 3C45A 4KHPJ 2HEKA 4F5ZA 3BD9A 3ZWPA 5FL7D 4K5SA 3HHNB 2IXDA 3R0XA 3WLPA 4L78A 1ULSA 2R7KA 1P9OA 4YYZA 3L7NA 4LF6B 1B15A 2YWEA 5DOVA 4LJMA 4M63A 2HLPA 1YZLA 5A06A 4YPOA 3OX3A 5B6PA 1DAGA 4I1VA 3QFFA 4QOIA 4ZCIA 3FLBA 5J2PA 1T9TA 1OJLA 2VPWB 2GAFA 4AE5A 1XAJA 2HUNA 1Z22A 3PEYA 4V0QA 3WGUA 5LSLA 2IMWP 3RVKA 3OFKA 4Z9FA 3BG5A 3CRW1 4UNNA 2H85A 4P5EA 4PYOA 3W4IA 2AP6A 5A8KA 1W1WA 3M4NA 4N7RA 2LRHA 1ZXBA 3BMCA 3TL2A 1XMSA 5T67A 3FHJA 2O2DA 3D0OA 4QXMA 5C8YB 3LOUA 5IC6B 2YHIB 4FWBA 4HLUC 1CERA 4QODA 2N75A 1SUIA 5EZQA 2LQBA 1Q22A 4EY8A 4ZI3A 1XAIA 1BE1A 4DFMA 4C08A 4EEXA 4JD5A 5ALLA 1G5HA 4PXSA 4P82A 1WJGA 3BK7A 4D9GA 3H04A 4ZIRB 4J4TA 2BFFB 3ZJ5A 1ND5A 5BYAA 4O8CA 3EFOB 1EP3B 4C43A 1RR6A 1CLEA 4PZUA 1WHSA 5DSXA 1ZM7A 4B3MB 3O44A 4NI2A 4DL2A 1H5NA 1R0XA 3QE0A 3SJ7A 5JNWA 2W2NA 1HLPA 2EOAA 2YV4A 1QV9A 5IDWA 1XERA 3PI6A 3I8OA 4URHA 3DBIA 4HY3A 4KLCA 4RH1A 3P0JA 1Q0LA 1P7WA 2ZP1A 2B2XA 4IDKA 2DPJA 5ITVA 1E2BA 4RV9A 1URRA 2Q1LA 4ZP9A 1MX3A 5KNCA 2I3DA 1G8FA 2QD3A 3AL2A 3IXLA 3K72B 4KOAA 1UWBA 5D78A 1OLSB 1WF6A 2BBSA 1VMKA 3LP8A 2CJAA 1CLFA 3KZKA 2AOXA 3B38A 4OXRA 5BNZA 1PVDA 2AX4A 2YZ7A 1S6PB 4IRMA 3RREA 5T7LB 2C07A 4WKNA 3ZQ6A 4F96A 1QE3A 1HMPA 1ZRNA 4EUNA 3G1UA 3OQHA 3EYWA 1NSPA 3LPEA 5T7BA 2E6KA 3ZIAA 1XEWX 1O77A 3IBFB 2CCGA 3LY9A 4TMFA 2HQ1A 2JNJA 3NJ8A 2AJ1A 1UW4A 1WACA 4FDLA 4NMMA 3RVSA 3ENQA 3W8GA 3EODA 1NAHA 1MN7A 2VYQA 1VKOA 4CLZA 1U94A 3TZ6A 5FUQA 2WWYA 1MMFB 5DDIP 1E79A 4KSEB 3CQ9A 1JLGA 1MC8A 4WK3A 3ROKA 5DBHX 3LX5A 1NHKL 3TRKA 4K6OA 1VKJA 1Y1RA 3J81Y 2ZJ5A 2LNDA 3GR1A 1L5NA 2O5RA 3UK7A 3AI3A 1OV6A 2QTFA 3R2CJ 4XDGA 4TMZA 3I39X 5TJ9A 1VTKA 3DFFA 4K1XA 1QU3A 2ZBCA 1M67A 4YR3A 2A88A 3BFJA 3STHA 2YDXA 1E5TA 1CEQA 4Y2KA 3HI9A 3RRJA 3ZI4A 3L8MA 3DVLA 4QIVA 4I6WA 4C4PA 2IDLA 3IO5A 1F60A 4C98A 3AKYA 1DNPA 3IRXB 3QYFA 1N5QA 4LF4J 3V6MA 3HVTA 4KGMA 3GNQA 2KM1A 4UQTA 2FWBA 4ZO9A 3ND9A 1PSDA 2OEMA 2O4UX 1X9GA 3GGJA 4FXWA 2OXFA 4KUEA 2GC8A 3BWVA 3UTDA 2W25A 4F4XA 2VCEA 4L50A 2DNHA 3KU1A 1P19A 3GL9A 5HRCA 4I1SA 4ECSA 1L7AA 4C6HA 1DXHA 1C3OA 2QN8A 4JLKA 3M83A 4ERDA 1TTHA 4DVGA 2C95A 2REBA 1ZEJA 4M9UA 1QPGA 2E55A 2V5AA 5CB8A 2LCQA 4EQZA 3PHTA 2IDJA 1JSRA 2HA4A 5I4IA 1QTNB 1IUOA 1DLIA 3L0SA 2CHGA 1YBVA 3OWXA 4YXWA 4CNQA 2W7PA 5DHQA 4UTPA 1F1BA 3UMJA 2CJWB 4BPRA 1E62A 1QVZA 3ABZA 4P4TA 4TLMB 2XH8A 4P4NA 4XLTA 2D3ZA 2OZKA 2PJRA 3RUEA 1E7SA 2YZMA 4LRCA 4GPZA 1QORA 1Q3TA 1Q5YA 4DV6B 3FSGD 1S5ZA 3AHHA 4Z2AA 1ODSA 2AC2A 2W43A 4EG6A 2DT8A 3D8UA 1MB2A 2IXEA 1RUSA 1JFFA 3DRYA 4F2WA 1UWKA 2J0XA 1Y6JA 2W01A 3IJPA 1AH2A 3VPAA 2ERCA 2QLNA 5JC1A 5E1DA 1F12A 5G1OA 4TM7A 1S79A 1GAJA 2LKZA 4LR9A 4OK3A 2W6MA 2RHQB 2ZOFA 3CCRS 1BYUA 2FGCA 2WABA 3JS9A 3QJYA 2IHTA 5JQGA 2ASLA 4QU0A 2ZC4A 1TZMA 6FDRA 1QQ7A 1P45A 3SN6A 4KPEC 3L18A 3AD9C 3PE4A 4ZYUA 4E21A 1DAFA 3CUYA 4Z4FA 1QAOA 4RENA 2EJBA 1USIA 4M1EA 2AX1A 2PMCA 3GF4A 3AHJA 3DLCA 2O3JA 4IRCA 4M6WB 3DMYA 4HVZA 4L9SA 3CXUA 3R5SA 4AKSA 1Z07A 3G9XA 3WLFA 4DIFA 4DA4A 3UJ3X 4Z0PA 4WESA 3AC0A 1F9EA 4DV7F 3R5BA 3V6JA 1XFAA 3CLSD 3ADAC 2ZTMA 2GO1A 3O3CA 4CGYA 4HC4A 2E1CA 1ZOOA 2RG1A 3TARA 4P72A 4C03A 2QJ3A 2DNLA 2AZMA 1EAYC 2XKBA 1WPQA 3OKFA 4ZVNA 2O5VA 3PSHA 3FMWA 4EZIA 3KLNA 1J9GA 3LSTA 4IG0B 4LJKA 1NLYA 2J4FA 5JECA 1LK5A 3CO0P 3OFHA 4XFJA 1M1UA 2RF2A 3PQFA 2VXYA 3CZPA 5E6SB 2J59A 1VL8A 1DXOA 1JFRA 5KFAA 1SOWA 2RGAA 2MKHA 1EE2A 2JBAB 2E4ZA 2TMGA 3QPVA 2CHVA 4C1NA 5FL3A 2YCBA 2A9OA 3GJXC 2FETA 1AKMA 3GLKA 2JGRA 1C1XA 5LC1A 4OZNA 3OPYI 1YZUA 5G0TA 3EBOA 3HR4A 4DI6A 5LA6A 1DMSA 1PT9A 4XPIB 1D7AA 5JIBA 4EJ6A 3SQWA 2I8AA 1BNCA 1E2IA 1XZFA 3VPGA 1T9GS 2YNFA 1EXVA 3GJQB 3R6GB 5K0FA 4YUAA 1Q1NA 4F3OA 4FGKA 4LQ9A 2HHVA 5CP8A 4TYWA 2ZT6A 3A7EA 4DL5A 5LLTA 4KPCA 2X1LA 5E6RB 1NGSA 5JSZB 2VUHB 3OL7A 4MV8A 3TSOA 2Z8YM 4EENA 4LVNP 2ZXFA 4M95A 2P9ZA 1FRQA 3S2UA 3NBKA 3SP1A 2DITA 3GCXA 4H27A 4A8FA 4LNUA 3KWLA 1SKUB 4B45A 2UVDA 3INTA 3TLMA 3PQ4A 1ZJYA 4F4ZA 4HZUA 3QNWA 1ICEB 3V4SA 2GFIA 3QZUA 1SXJC 2XNSA 2UU9F 3SBMA 3K92A 3AFIA 3J7YI 2VU5A 4LYDA 2JK0A 3R5JB 1SCIA 1XE3A 3BDIA 1EZ1A 4RHFA 5HHTA 1KJZA 3E27A 4M88A 1SVOA 3WNDA 3WGOA 1FFAA 2P4UA 3ZVNA 3AFOA 1JSXA 5AM4A 3WQQA 2RHOA 1J23A 4I4TF 2I4LA 3NRCA 4U00A 4CU2A 4CV3A 4ZHRA 1A9OA 1USGA 2QV7A 2FFRA 3I5BA 5KFJA 1FW6A 2UYHA 2SXLA 2NUTB 1JKIA 3Q7EA 1G8PA 1TC1A 3FMIA 1FFWA 4OGWA 3K1ZA 1I30A 3BIXA 4MWZA 3CDBA 5FPSA 2CHUA 4GW3A 5BSFA 1OBFO 3EEOA 3LX8A 5CYJA 4MCIA 3EY9A 2QTCA 5AIBA 3WK5A 1KKMA 4DUPA 1HQEA 1Y7LA 1JTVA 2O6HA 3EDOA 3UDVA 1MT3A 2MDTA 2NP7A 1WP9A 4UVDA 1JFVA 1HQYE 2CNWA 3PDNA 4DJEC 1I1NA 3JATB 4ARAA 5IUJC 2FGOA 4IHJB 2GHWA 1FP2A 1KDTA 3FGZA 4YUVA 3S8EA 3P0EA 4UE3S 3ETEA 1SURA 2Y2VA 4GDFA 1S2IA 3FPBA 3TVZA 2I33A 1UXIA 2XI2A 4C07A 2PE8A 1E9SA 2JFBA 2Z5GA 2JLGA 3U37A 2WHYA 1H4VB 1P7ZA 3CURA 2R8GA 1IHPA 1S7CA 3CX3A 1HNZB 3OE7D 1S4EA 1OBCA 1EG7A 2SKDA 2QV0A 4V1CI 4M9SA 1BA3A 3L06A 4COOA 3SX2A 1VJWA 2PNJA 3DBLA 3N2LA 5JISA 3DLKB 5LXRA 3GSDA 3VGPA 1F06A 1QAYA 1OX5A 3AA9A 4DAOA 1IBKJ 1FKOA 4Q3LA 2RU9A 4PFKA 4KUGA 2BQUA 2WY2D 4HYTA 2C8VA 2ZIEA 4FP9A 4ZVOB 3F6PA 1MW7A 1DPFA 2XZOA 1B2RA 1HMYA 2ID8A 1XLWA 2CVFA 2H11A 4EB3A 1P31A 1A8UA 4OYMA 2O57A 3SBEA 3LECA 1SWWA 3NTRA 3DC7A 4P38A 2DR7A 4L6AA 2QQ5A 2A0UA 5JFTA 1SUDA 5HN0A 1BKYA 1BQXA 4TWAA 5SUHA 1T9WA 3AA8A 2OXEA 2V8BA 4ND7A 1E3DA 4V3CA 4K4SA 4PWYA 1TKXB 2GHRA 3ZBQA 1J06A 3F7MA 2QUBA 1PVVA 3PXCX 2WICA 5A5VA 4I46A 5B0EA 2GEUA 5LSRA 1PJTA 1PO7A 2GYYA 3IPYA 3VJKA 1N5MA 4OZ2A 3O1JC 2ABYA 4URWR 1I0ZA 3NHUA 5IJ0B 2I38A 4BMOB 1IUPA 1YB1A 2B9XA 2AJTA 5JMOA 4OA5A 4Q9LA 4ZP6A 5EJEA 3D54D 5J9FA 4WBNA 1QIIA 4PGMA 4Q02A 4IMJB 3TIIA 4C8KA 2XD4A 3VVLA 1WEZA 4NFSA 3YASA 4CEJB 1Z7WA 1YZKA 4MW0A 1E9BA 3FUWA 4IYRA 4W9NA 3OPNA 5CJJA 3UG7A 3WIVA 2PJUA 3E1SA 5G3YA 3GIIA 3TG2A 2MLXA 4RESA 1I36A 3I72A 1WSWA 5IJAA 3JSYA 4RNCA 1NDCA 2FHOB 1JN0A 2OD9A 2FLOA 1FE0A 1ZOPA 4LZZA 2WLTA 1EFCA 2R1ZA 5ALJA 4FDVA 5E7QA 4C97A 1U2EA 1ZKMA 3MSCA 2OORA 2NU7B 1BHSA 3ZCPA 2F7SA 4B85A 3KJGA 2QMEA 1M2JA 4DADA 4ASUA 4DSJA 2Q49A 3EQ8A 4JI7F 4WBXC 5CA1F 1N32J 5DYTA 1NH8A 2HFSA 4CE6A 1NUTA 2QTHA 4ZKEA 2ATEA 1HC7A 3TIFA 2AQHA 2VODA 1V1RA 3N0RA 4JI2B 1USUA 5THXA 4FWTA 3AUYA 4LRUA 4RTRA 4WN3A 3WMEA 1QB8A 3JZAA 1FRMA 2EFYA 3RT7A 5K6AA 2AF6A 2F8MA 2VBWA 1SXPA 4QAJA 2LDBA 3L9ZA 3F46A 1SU4A 3S1AB 1SBCA 3U5TA 3ZKAA 4CHGA 1IBMF 4QDJA 2XB6A 5EJ9A 1L5KA 3NU1A 2ZFHA 4DIBA 2VNKA 3FM9A 3E4DA 5DNVA 1A7JA 3BDPA 2GT1A 1Z9BA 2FPPA 3VSAA 2RI1A 4YJHA 4H9GA 1E89A 3OZAA 4HDNB 2PEHA 1RTTA 1V45E 3NXZA 1SEVA 2JVJA 1KONA 1QB7A 4DDKA 1RWKB 1TA9A 5K6RA 3DMTC 3MFQA 3TLEA 1D9FA 1U0FA 4Y2RA 1QX4A 1WKKA 1SXJD 2IDZA 4JLJA 3HULA 3BSAA 3GEEA 5FOTA 5F64A 1AGNA 1YRUA 1YZHA 1D6JA 4P4SB 5FNVB 1XA0A 4NU0A 2ADBA 5FLKA 3DMHA 4TYNA 1Q0QA 1I5OB 1GSAA 2VLBA 3GROA 4QPCA 1XIQA 3G17A 4KVZA 4JVLA 1YKSA 4DUYB 1B4SA 3UGTA 4ALMA 1Y3JA 1SK9A 2ZT5A 1S6QA 1GTSA 1W1UA 5JSUA 2Q3CA 3ER9A 2W9XA 3V1TC 3HNPA 3R7BA 1Y9EA 4RL6A 1RYBA 2Z04A 2F65A 1U8EA 4FEAA 1XCJA 4OGLA 1RQGA 3NMAA 2E1RA 3HO1A 3V4VB 5CBPA 3K3PA 4K2HA 5AVOA 1H9CA 1AK9A 1C7IA 5KYYB 2A9KA 5EKXA 4XX1A 1XTUA 4TS4A 1XU4A 3DKPA 1OZGA 4Y2TA 2WJ3A 3T4XA 1EJBA 1ZAVA 1DE0A 4ICLB 4PLVA 1CB0A 4P34A 1MNQA 1NQ5A 3JSAA 4CIDA 3Q3HA 4DGSA 2O8DA 1OO0B 2CNKB 4C14A 4Z1MD 1TZKA 1JLLA 2GWHA 3IQHX 4GX2A 3INYA 4HRYA 4EU0A 1G21A 1ZNWA 1PYTA 3C6QA 3RYFA 1FCJA 1UBKS 2B8JA 1UKUA 3OTBA 3IMGA 3PYLA 1OZFA 1XNRJ 5H1YA 4P71A 3O5TB 1QHIA 5CITA 1NA5A 1K7XB 5A4IS 4G8BA 2DT9A 1BW9B 4FMDB 3QPBA 4D44A 4BJHB 3STYA 3R9LA 2PD3A 1Z3CA 1KP2A 2ZRBA 4UKDA 1EETA 3RKRA 4CMIB 4H7KA 2JRLA 3OCWA 2Z58A 3QE9Y 1R4MB 1M75A 2QLTA 2C03A 5EHQA 3B3FA 3HWSA 4JYPA 5LQCA 4K5QA 2GN0A 3GLGE 1Q84A 5HTOA 2XYPB 1S0OA 3C3MA 4LVCA 4HDKB 2ZBQA 1VGRA 3RAJA 1VCHA 2DE0X 1OW3B 1GSOA 3U0BA 3HMQA 4N5SA 3WA6A 4NLVA 2DHQA 3W62A 3G5LA 2J08A 5FJ4A 1ML4A 5LD2C 1FJHA 2OGTA 3AY6A 2BEKA 4C48A 2OHJA 1A04A 3UT6A 1SXHA 2NAPA 1YJNS 1Q3KA 1R10A 2W6NA 5KG2A 1Q5PA 4I14A 4OQQA 1T3NA 2XZTA 1KDNA 1MB9A 1XROA 1NF3A 1M0SA 2DVIA 3EVCA 3UVEA 3R77A 3B9PA 3QZ8A 4PX2A 3DOJA 5FLXY 1XTIA 1B6SA 1UL1X 4GF5A 1K3FA 3AR4A 3TQHA 5K3BA 2A3RA 1FZQA 4CVNA 3HXPA 1T3OA 1H7WA 5KG0A 3L8YA 3E01B 3F6SA 3NC1C 1F4PA 4O4HF 4Z7JA 2W8BA 4KO4S 3Q83A 5BW5A 3TSYA 4KE6A 1Q44A 2QNIA 2BDTA 4GOMD 4PAWA 3P9ZA 1EB0A 4IZOA 1FNBA 2XODA 2PGJA 4QUHA 2H9ZA 4PQYA 3NBMA 4Y8VA 4BUZA 5I7AA 4FC7A 3VO1A 1KY4A 1WOPA 5TQ2A 2QYOA 2V45A 5J1EB 4E88A 6NULA 5G3ZA 4G1EB 1EFHA 1U5BB 4B9LA 2OEPA 1AF4A 3ILHA 4K88A 4LSLB 2FLWA 4QUKA 1PEAA 4YMEA 1TJ5A 4KMSA 4BPBA 5DM2A 5BV1A 3ORRA 1X7DA 2P77A 3FSEA 2MKSA 3JU3A 5F8NA 3K0AA 1KH2A 1R43A 2I76A 1H42A 3PC6A 2R7LA 4F06A 2H5IB 3NEAA 1KKHA 4NEZA 3BQ1A 5KTNA 1XTBA 4WEOA 3CCJS 3IEKA 4CLSA 2CMFA 2VHUA 3PEUA 3KTAA 5FTJA 3UGJA 1FD2A 1NXIA 1RLOA 2G9ZA 3E51A 5KOJA 3L5KA 4RIHA 5C0OE 5IJ9B 2NAFA 2FNAA 3AVPA 4EKIA 3E9ZA 1E1QA 3A6LA 3MJHA 2YNIB 4EKEA 5JDCC 2Z56B 1O6CA 4RQAA 4YDDB 1NAIA 5CRIA 5FULA 4BNWA 3V4OA 1FNDA 2H4ZA 3CR7A 1NUPA 3L41A 1IQ0A 5BVHB 3HGTA 1AKVA 3WLJA 1E2KA 1QUPA 1P2SA 1QYRA 5K0TA 3AHCA 1QH1A 3TW4A 3AK4A 3ZVKA 3P0RA 3O9MA 4LF5F 4H2DA 4C3OB 4INPA 3WLEA 3QKTA 5EIAA 1LBQA 1G59A 5LYJF 4F4FA 1VBMA 1DC3A 1RTJB 4GU5A 4MARA 3KEGA 2OUIA 3JASB 3R3YA 5K0JA 5EVCA 2Z2YA 4N6GA 2EVWX 4YMVA 4M5MA 2IWHA 1WTBA 3DM2B 3IFEA 2FWMX 2A78A 4KZPA 3Q3VA 2AMYA 3SE7A 2GM4A 3CONA 2LVWA 4KQEA 1Z2ZA 4MQEB 4P2XA 2OI2A 1R15A 3JWHA 3RR2A 2EXUA 2YZ2A 3DRPA 2ZCJA 1JYSA 4FVTA 4DUZB 4DX6A 3SQDA 5AJ3J 3CLTC 3HM2A 3RC1A 4JB8B 2CCJA 5ER9A 6YASA 3JTMA 3WFJA 1BXRB 4UM5A 1YVDA 2WU3A 3R7LA 2ZYSA 3KJQB 1VYAA 3TNVA 4OX8A 1AA9A 2PIIA 3FEYB 2VCHA 1CP3A 3FRJA 4IUYA 3UJNA 4MKGA 3MRXA 2JGAA 2IDKA 4LMAA 1JZQA 1K9MT 1JWLA 2Z5VA 4HQ0A 1K6EA 1NKSA 1V96A 1N7JA 3LVRE 3FCHA 1R0CB 2J9ZB 1GL7A 4X66F 4LBWA 2PKQP 2FZKA 5DDOC 3SVTA 1KP9A 1P3Y1 1ISPA 5EINA 3EGOA 1R5NA 3T5PA 4A8TA 2QY9A 2BEUA 1DRJA 3JQRA 3GU0A 2XNRA 5EXDA 3A4IA 4FMCF 4MJLA 3THYB 3MZ0A 4QEDA 4TTAA 4MR8B 3D1VA 1DQNA 2G63A 4MFBA 4ZQIA 3B53X 3I4FA 2FEAA 4NCAA 4PRYA 1OD6A 1SKWA 4EZEA 4I1OA 3REGA 5JFGA 4ROSA 4OHXA 3TMAA 1KGSA 2IYEA 3DM5A 1X7ZB 5CT6A 3HJHA 5LZ8A 4IXNA 5CG1A 1LW0B 1U2SA 2QVXX 1QGZA 2R8XA 1EX9A 3OHPA 2BKUA 1BQEA 3DDNA 4KHMA 2WUDA 3KUEA 1FA0A 4P2GA 2AYEA 3BULA 1DBDA 2GEBA 4NA2A 5EKUA 2XNHA 2BBEA 4EVRA 2IPLA 2JGLA 5KOWA 2RC6A 2C1ZA 5TIIA 3HFZB 3FYCA 2ZCUA 1W9HA 4CH7A 4IMPA 4YY3J 2JF0A 4HEA9 3DAYA 3UAWA 1PJAA 1JLMA 2QYTA 5CW2A 5JBIA 4FYJA 3N86A 3KLVA 2FQQB 4F0MA 2RDIA 5CYQB 1AZSA 1DTTA 1KP6A 3TQOA 3AVTA 1Z6PA 2VNSA 4RA9A 2ZZNA 3I42A 3CLKA 4JI1B 2FYTA 2XO7A 1WOMA 4ZARA 3UTCA 1RJEA 4O3FA 3R97A 2CXUA 1J56A 2C3MA 4ED8A 2M6SA 4RE5A 3PHJA 4IUCS 1KQNA 3IODA 4HL6A 8AT1B 4PRLA 1IQZA 1G4AE 1F2TB 3R9IA 3EPRA 2O8CA 4EABA 4ZT6A 3GEBA 2CD9A 1TMYA 4JK3A 2A9VA 2C4UA 3KPWA 1BE0A 1QYIA 1UXHA 5JLJA 1E8DA 3OUUA 3LKZA 4Y2SA 2V65A 2ZYAA 1OH6A 1C7RA 1SBZA 3PJFA 4QQNA 4Z86A 4JYMA 3DTTA 3WLHA 4WE1A 4O3QA 1WEXA 3NWBA 5LU9A 3PJGA 1PRYA 4QUGA 2RGGA 1YFJA 4KUHA 5DYGA 1L1RA 2Z57B 4HAVA 2EFGA 4RFLA 2W6JA 3OTOF 4U7DA 4EKDA 2C0QA 1OFUA 1ETHA 4TTPA 4BWYA 4R9NA 5K0SA 2XZPA 1B0TA 1XCLA 2YTZA 2GHQA 4C05A 4GBMA 4PGAA 4RGVA 5BQ3A 3CCES 4DS4A 4JV5B 2GPTA 1B26A 1UBGA 5FHQA 3IA2A 1J2YA 4HAXA 2PBRA 1YGPA 1E7QA 4WECA 1QHNA 4J9KA 1GA6A 3WO0A 3LYUA 3FFXA 2AI2A 3GI1A 4ZQCB 1KEWA 1QVFR 2M70A 5E1BA 2B21A 2QUKA 3ASYA 3BXOA 4RM3A 3LT4A 4A2CA 1EEHA 3T1HF 4YP1A 1Y5LB 2J7PD 1K1QA 1FSGA 3V2UC 3KSAC 1CVRA 5TV2A 2J32A 2PZKA 1RRCA 3PJ9A 4BJ3A 3AO0B 3V1MA 3DB1A 1O94A 3QG1A 3W2GA 3BJYA 2GHVC 5C42B 2H4YB 1RYHA 2GVZA 1X1CA 2FR1A 4FDMA 1VLVA 1D8TA 1G6BA 4QHSA 4DAEA 1H2UX 5LL6P 1NRJB 3PIDA 5J59A 3AWIA 3U44B 4OGGA 3CG0A 2GSDA 4QWEA 3EAGA 3RSZA 3T1YJ 1Q8LA 2C4KA 4S2UA 4DCMA 3U4QB 1QE1B 1AGRA 4RTJA 4I50A 1IR2A 3CNBA 5EJFA 3NKLA 3CNQP 2A6OA 5HE8A 1Z4LA 3GMGA 2Y1KA 3HXKA 5KYWB 4PAGA 4RMGA 5E8JA 2ZVPX 1XR5A 4ZA2A 1N3BA 2HA2A 2IYAA 3W0LB 4CLEA 4LXQA 3MB5A 4QRHA 3ZS9A 2GDJA 3I62A 5HCNA 5BMVF 3OLWA 5DM4A 3BIWA 4RD3A 1ZXLA 1U65A 3ZZTA 2P2ZA 2BACA 1KQGB 3J7YU 5LMUB 5DM6Q 2EWWA 3RB4A 4CO3A 1EFVB 3LHDA 5EHHA 2C2BA 3TM4A 1T6ZA 2WG0A 3OFFA 4CLRA 3FPGA 4EGJA 3SR0A 3MR2A 3EEBA 1ZCFA 4D0SA 4LC9A 1HD0A 1KS9A 3W66A 3SF8B 4ZCMA 3N0VA 3ZHUA 5KFCA 1Z56C 4Z7QB 1RAGA 3UA4A 1SEPA 3IULA 1TT5A 1FRHA 1RQLA 5K0EA 2KS6A 3R3XA 3AKZA 2HSEB 5DFAA 5JPIA 4GOND 1YQTA 2YS7A 5EMNA 2M32A 1SKSA 4FDAA 3JQGB 4YUDA 1GNVA 3HWRA 4PG7A 5JTUA 4JYZA 3DCYA 1UH5A 4EO8A 4DIOA 3PC8C 4KPFC 3W8EA 2PL5A 1U6JA 4HN2A 1UP7A 4A8KA 4XE5A 1BWEA 1K44A 1XMQF 3M6IA 2GS9A 4IH9A 2AN9A 1OTYA 4X8OA 5AHKA 4YP6A 1RA6A 3EVOA 2ZJ1A 2OCLA 2XQJA 3BD6A 2Q1YA 4G0YA 1N9ZA 1UANA 4Q82A 3CO5A 3QBTA 3WE7A 5CD4A 1QAMA 4DF8A 1KOGA 2ZI3A 5GIOE 3W5YA 1OIXA 3BPSP 4DSKA 3PFCA 4D3SA 2PUCA 4L1KA 3ZWNA 1OROA 5I9SA 1RHRA 3R9KA 3GP3A 4ZVHA 4WK0B 1JG1A 1H4SA 4Z9XA 4PLWA 5D51S 4B79A 1HYEA 4L22A 1I14A 2W4PA 4YAKA 3C3XA 2NXNA 2OCGA 2D7SA 3PRHA 1ZVVA 4OM7A 2R0QC 4RANA 4UQGA 2FMFA 1ZSVA 1Z7EA 1DUVG 1IBLB 2ZKTA 4YJ3A 1U1OA 4KPUB 2R4TA 4LYEA 4Y2CA 3C19A 2QL9A 4QICA 4EB8A 2HJRA 1TVRB 2FR8C 5L1LA 3U7HB 4G24A 2VQEJ 4NPCA 3G1WA 1X4BA 1KAGA 2PFKA 3BMNA 1TU0B 3ABOB 5L8RC 5EWMB 2H1FA 4WXRA 3HFVA 3AGQA 5B6JA 1TMMA 1TQHA 5KTYA 3VAZA 2RVJA 1TZJA 3VRHA 4EO4A 5HIJA 4D4JA 2WC1A 4WCFB 2R6DA 2CV1A 4FILA 3CRNA 4I8DA 4IIUA 4P3XA 2MSTA 3H5UA 2QEXS 4ESVA 1D0EA 4A0FA 2IS1A 1L4HA 1U5CA 1W29A 1E1RA 1YJAA 1YR9A 2VPQA 1W5BA 1E77A 4ER5A 1QP8A 4C0BA 5B08A 1UJ5A 1Z4JA 3VVBA 4G6VB 2HKIA 2R5WA 5DHRA 4HGZA 5AE2A 3D3EA 2AWNA 3HHEA 4JBGA 4IFBA 4JI6B 5BORA 3N2GB 3GJSA 4WXEA 4FF2A 4GVBB 4JLVA 5GP1A 1CF9A 1VSBA 5CFNA 4DR7J 4Y34A 3A9VA 5CX1A 3T7RA 2PU5A 3ULHA 4EJSB 4TUYF 5AYVA 2DBQA 4ND8B 4Q37A 2HXYA 1W36C 3AG6A 4IIHA 4PYRA 4BV9A 3OA0A 4XWKA 5JXJA 5HMYA 3X1WA 1YE5A 5FPPA 3M32A 5AKEA 3DZFA 3DGPA 2ZVJA 2VZEA 1ZGGA 2GILA 4HBGA 3OCCA 3STUA 3W5ZA 2C1EA 2YNMA 2YRXA 4QSHA 2JJMA 3WYEA 2IYFA 1VHFA 2WWVD 1F6BA 3HABA 4BFCA 5DN6D 4PUOA 2BFCA 3RJZA 1LDGA 1VHJA 1R9GA 2OAGA 2BDEA 3EC1A 3O8BA 4YAEA 4WOCA 5K0GA 4NLSA 3RYHB 1UDBA 5JD4A 2HNZB 3ANLA 3TOZA 1YJBA 2CJFA 1JLEA 3PACA 4BECA 4MJ3A 4GZ5A 4PU0A 1M5KC 1YE8A 3OZXA 1XTPA 3UCGA 4NXMJ 4YP0A 3ZS8A 4UE6A 4ZQBA 4L4ZA 2GPJA 3MNFA 4C6TA 3JD4A 4FYVA 1MJFA 4YDQA 3HKZD 4UHHA 5BSHA 1TK8A 3TTUA 4UEQA 5FR1A 3KLEB 1I0LA 2WKWA 5EFZA 1UA0A 2I2WA 4R3WA 4PX3A 1KNXA 1FX0B 4HEHA 1CULB 3Q12A 5FTWA 2GXAA 3UWKA 4E15A 2Z8ZA 3FNNA 1J0XO 2XR1A 3DXFA 3RVPA 1N7HA 2Y67A 1N9KA 4MO2A 1PKEA 4Z37A 2BZ2A 2C3OA 3B7PA 5HDQA 3KS9A 2JL1A 1MOZA 4RD1A 3NTVA 1U2GC 4LVOA 4A15A 3GPCA 1LC0A 1IDN1 4ENPA 3PIPQ 2B1GA 4E08A 2QN3A 1U5AA 1Q1KA 1WKBA 4KBYA 2D4HA 2HEIA 2WFAA 3C6KA 4YAWA 4LQ4A 3DKIA 1YTUA 1ZZGA 3NIBA 4C3ZA 1KAEA 4GWGA 2PKWA 4V19X 2CK3A 3W7BA 4W5HA 4IHKA 4X0EA 1UEIA 4YJDA 3F9CA 5U1PA 4QTTB 3M4JA 3O0TA 3SCLE 2DO4A 2GF0A 1JNRB 3RS5A 3D3WB 4XCQA 2HWTA 1NDLA 4G41A 5EJAA 4EL5A 3C4JA 4I9UA 4FVMA 1YOBA 4EEZA 4X24A 2DLDA 1MAUA 2XQKA 3KHLA 3W34A 1TC2A 5I7UA 2HIGA 3O47A 1Q1AA 3B6KA 1VMDA 2W4CA 4YH1A 2UYGA 3CJKA 4WGGA 5EWJA 5BWBA 2I1VB 4Y65A 1V37A 4KN5A 5EYPA 4F6RA 5KVCA 4RXTA 4HAZA 4QJ4A 1K7EB 1JJAA 3QPAA 5IFMA 1ITPA 2C5SA 4ZVMA 1E60A 2ID4A 3ABSB 1VISA 2EQAA 4E5KA 4A8JC 1SC4A 1AFJA 3OE7A 3CCQS 4GRDA 4DLKA 2OOSA 4JVMA 2P8JA 2W58A 1CUAA 2MGZA 2XMPA 3X1KA 3N5BA 3BSOA 4BVEA 5D4NA 1G2QA 4MUYA 1YS9A 2AFRA 4KGZB 1PJZA 1RIIA 2U2FA 1JDNA 1FRVA 1GGKA 2Y3IA 2P0EA 4OJNA 4NEGA 5ALDA 4F26A 1JTEA 1WRBA 3TLGA 3MI7X 1CVIA 4D5EA 4PIMA 1LBIA 1H8HA 4DXDA 4OJYA 1E9RA 5CZVA 2AT1B 1N34B 1EUQA 1XF9A 3GX1A 1JR6A 4HT3B 2QPTA 2QT7A 1PGQA 1T0IA 3HEAA 2QUJA 2Y9MB 3VSBA 1MWYA 2ROEA 5LP6F 1O2DA 5EJ2A 4AWXA 3DHXA 4II2A 2VJOA 1LJ8A 1TFRA 4A8PA 1F7VA 2KG0A 2A5JA 3L9XA 2AB0A 2OELA 4UD2A 1LEHA 3NGXA 5FUVA 3S1LA 4YUWA 1UKYA 3BGSA 2VXCA 1RQNA 4FR5A 4RY9A 2BTQB 4LXHA 2XMZA 4PWDA 4B76A 3ACBA 2IHKA 3KFVA 4H7DA 4BVAA 1UAGA 2KPOA 2YJ3A 1ZH6A 3OZIA 4LG1A 3T5BA 1RD4A 4LSZB 2K7JA 1W581 2EKBA 4YCNA 1R6XA 1BS9A 3PWTA 1JLFB 5BPHA 1U0SY 3DV9A 4EZBA 3BRQA 3ZJTA 4JCOA 3EGXB 1EAYA 4EYQA 2Q3BA 1N2CE 4GKKJ 3BB3A 3PEWA 2JATA 1W36D 4C9BA 3R4VA 2HWIA 4I4LA 4USWA 3IP0A 2VL7A 3AJ2A 3E7XA 1YIJS 1GZDA 1EWVA 3SMZA 3B6IA 5JJCA 2OECA 1Y3HA 4LFAB 3GEIA 1RAEA 3N07A 1TL7C 3L84A 1EGAA 3UZUA 2AFIA 3MXHP 3R09A 4I08A 3TZZA 2VDNB 4F04B 2LU1A 2RRBA 5FDLB 1P1JA 3CLSC 5ANRB 3DNPA 2YQ5A 2XOEA 4DJTA 1WTCA 2GYVA 5GTDA 4NEYA 3C3JA 1I1HA 1T4MA 3PL1A 5GWXA 4GLFA 2JHAA 3KFWX 5CEFA 1PCAA 3KYBA 5BR8B 1V5EA 1OE0A 3OTIA 3E2EA 3B3QA 1NQOA 1HZZC 5JJLA 2EFPA 1CSEE 4MUNA 1XPUA 3PI7A 3N70A 2V8VA 3KBBA 3ZTQA 2R97A 1EM8B 1OAOC 5AK4A 1MABA 4NX2A 2FFJA 4RF2A 2Y05A 2E49A 4Q8FA 3P49B 2OPHA 3T3FA 2ZPUA 4JH0A 3T5AA 1F0YA 4DNFA 3K31A 4EGQA 4Z7YA 1KFDA 4L8VA 4EKNB 3ESRA 2A2ZA 3HO8A 2G1HA 4TRJA 1RPTA 2YYZA 2H2GA 3I12A 1NJ8A 1ZUWA 1OLUB 1X94A 3CINA 1XZAA 3GUZA 3D4LA 4KB5A 4IGKA 1O08A 3CH5A 5EE5B 3ZUGA 5IWAB 3GP9A 5LQJA 2PDAA 4BQRA 3NUGA 1RTDB 2ZUWA 3HCFA 4J0EA 1QOQB 4JZKA 3F49S 3UD5A 2X2EA 3ETGA 4TYMA 4WDQA 1CQMA 1FUIA 1JRLA 1NMEA 1RZ3A 2AJBA 2QLBA 3F97A 3U60B 2IA6A 1EFKA 3GLGB 1KMCA 4Z1OA 2R66A 3DOLA 4O0MA 1J39A 5JO9A 3NS7A 5DTRA 1J9EA 1Z13A 4W6QA 1R0AA 2CIMA 3DV0A 2WNIA 2AGPA 3MRVA 3BTUA 1TAUA 1L2TA 4F2DA 4Y98A 2BZ1A 4L74A 4Z9AA 3PGMA 1ZI6A 4PFQA 1N6KA 1KHTA 1ARZA 3HVRA 5I3PA 4J43A 4XDZA 2VZ9A 4XB2A 2I0XA 1V95A 5J40A 2FWAA 1CD5A 5EPEA 2WBLC 3PNSA 4DFPA 2RCNA 3P5SA 5G0RA 1N1MA 3WBBA 1CYEA 1ZA1B 2EBUA 1VB3A 4I3GA 1QGUA 4MI9A 3RUDA 3ZQ4A 2ZW9A 4I2QB 5BYRA 3F41A 1CF4A 1P27B 1FS5A 1FVXA 4HUTA 3VH4A 1A5TA 3NT5A 5KHAA 2DY9A 4JFRA 2R7UA 3T12A 2LXIA 1UPCA 4Q4JB 4ZVSA 3KM0A 3OWHA 2XMQA 1V6CA 5G40A 5C2GA 1HG0A 1EVYA 3JAMA 3M2RB 3EEFA 1WF0A 1UP6A 2FJUA 1RRGA 4X4RA 2AZXA 4DJBA 4RX1A 4A16A 3NM6B 3Q3EA 1TRHA 1P0MA 3Q1KA 1KR5A 3C3CA 2GXUA 4ZP1A 1EZ4A 4A46A 4DR6F 1SG6A 3T5LA 3HR8A 2R5FA 1WXWA 1E8MA 5K8LA 4JR2A 5FA5A 2F3PA 1HWLA 2H4WA 3JZIA 5BN3B 3ISTA 3RQSA 3LO5A 5GV8A 4OFXA 5BQFA 4FFLA 1RYMA 3ZGNA 4DIUA 4BNIA 1WHWA 2WA1A 2A57A 2QD5A 2ETXA 1ZH2A 3FPCA 5CNIA 2E5LJ 4TKVA 4RFSB 3L77A 2QTMA 2AJLI 2D2VA 4BX0A 1TMGE 1KRWA 4G0OA 2VJCA 4KXYA 2P9GA 3RIMA 5A2QA 4OYHA 3KUHA 3DLGA 1T4BA 4D80A 1KKUA 2AGQA 4NYJR 3OOEA 1MN9A 3MM7A 1NG9A 1JJBA 2JIPA 4J9UE 4E5NA 2HFJA 5IQQA 1K4MA 1XRJA 1GEGA 2V7QD 5BUCA 3CN9A 3T9AA 5TSDA 5LP6C 1BRTA 2F9MA 2OB1A 3HWWA 3GUCA 3V7FA 4K2JA 2DFKB 4EO9A 5A2GA 2NWQA 5K9FA 4KV7A 3M2UB 3ZK9A 3I04A 1CUFA 2VRCD 3ISVA 4NF2A 4DQPA 3W2WA 5I5GA 4PRKA 3SLGA 2OFHX 3MWLA 3C6TB 3WLIA 3G86A 2E1MC 2RFLA 4BOYA 1S8NA 1ZVMA 5L9NA 3IBCB 1NP3A 3G2JA 1BQMA 2HHAA 1E4EB 3EWNA 4FFOA 1JPUA 2VDHA 4X7RA 2O1SA 2QL6A 3VKUA 2BGIA 5AKXA 4PSDA 3VU8A 2YIJA 2QUAA 3R3JA 3MCWA 2JZNA 1W85A 3AZOA 3GN2A 1JXQA 1CQJB 3NTXA 2CD7A 3GIKA 4RC9A 4POAA 4WE3A 3TX2A 3WVNA 4BO2A 2DGOA 1SOMA 3C15C 4IVQA 1YL6A 3M8RA 4Z3DA 3HC7A 3LOPA 1V8DA 4B9SA 2FSHA 3AUAA 2IS2A 5E3QA 4DNQA 3AF1A 2X7HA 1AT1A 1XZJA 5FPQA 5E8RA 2FW9A 3Q8MA 1RE0A 2XBLA 5FBVB 1G3QA 3HRKA 2RG7A 4RUAA 1A2KC 4QR2A 2VFSA 3MEGB 3H99A 4IDOA 1RHQB 2C7OA 1LSJA 1Z2PX 3Q11A 2XQCA 1IJEB 4LJ4A 4WWSA 2O0KA 2WOMA 4D9IA 2ZD1B 4UUQA 2MMCA 2IU3A 5IKXA 3LE8A 4TV9F 4ZRMA 2HDWA 3R3VA 3QAEA 2N4DA 2GA8A 2BC9A 3MTAA 1FHTA 1RWWB 1FU8A 4X4PA 3PWSA 2WRZA 4W8OA 1S2DA 1RKIA 1QYDA 2X9VA 4F25A 1GV1A 2L9NA 1E5DA 2DGVA 4X61A 5LMNF 1E6YA 3MMCA 2OFXA 1GH8A 1GAQA 4MS4A 5KJ1A 1C1BB 4TYQA 3SEQA 2ZROA 1NPKA 4DJ5X 1IBCA 3BOSA 5IU6A 4CCHA 4R8KA 1U3WA 5KPDA 5BV2P 4ZJPA 5J2MB 3EH1A 2XBMA 2QE7A 1H6BA 5FXMA 4NWBA 1KQFB 3CMMA 4L57A 3RAMA 2CJPA 4CCYA 4O08A 4B3CA 2Y0BB 3DOKB 3PXDA 4WZQA 3AHGA 4KN9S 4TNOA 3LLMA 1NX6A 4BMPB 3X44A 2R2TA 4IZIA 4C2TA 4DG1A 1OXXK 2YRWA 3K9LA 5DTJA 3PYEA 3GJ6A 3ABRB 3R27A 2B20A 5KQRA 1PQYA 3OJUA 2H3HA 1E3TA 3NIGB 3JTPA 4M1OA 1PGNA 3V2HA 2FPLA 1TYDE 1KDRA 1FYEA 3ZJVA 3GH3A 3FZ2A 3DMPA 4ABYA 3OJSA 3QGGA 5KT7A 4UOZA 3QEAZ 4M4SA 4WTOB 2QJWA 5FDFA 2RGUA 3A3KA 4I4TA 1KMNA 1PSZA 2Y0PA 3LV8A 4EHKA 3R20A 4A6XA 3EPIA 1S10A 1BU8A 4ZI5A 5FUBA 3GGDA 3WGMA 1UEXC 4XTRA 2FJXA 3R5FA 3RVDA 3K5IA 1S49A 621PA 2VOEA 4JBWA 4TZTA 1V5IA 4RXMA 1DBWA 4Q3BA 1N3YA 4NYIR 2CJYB 1V4NA 5I9BA 3L0CA 3U4GA 2HMWA 5DLFA 4C0WA 4GP7A 1U8SA 3HGMA 4D6XA 1JG7A 4K9SA 4I5GA 4KQMA 4F0HA 3SKYA 5M7EA 4EPRA 4ZZ1A 1SL2A 1Z5GA 3WV4A 3DOFA 2XAAA 2B5VA 2NO9A 1H1LA 1HL3A 1U6BA 4H0NA 2DUUA 2I7XA 4ZVPA 3VFDA 4D3HA 3IP8A 3DCAA 1KKLA 2AGOA 2NNWB 5F41A 5EMJA 4UTGA 3LC0A 4YPVA 1K5GA 1WG5A 4IHAA 2UYOA 2E4YA 3T41A 4JP8A 2J41A 5AR1A 3KZNA 1V1MA 2LIVA 4BX9A 3PM9A 5BRNA 4RA6A 4D25A 4MQ4A 4QG3A 4MTLA 3DAFA 2AD9A 2I2AA 3ILIA 2G1KA 1E7WA 1QJCA 5EVJA 1FSSA 5GJVC 2IRYA 3SX4A 4AIIA 2LUOA 4HAIA 3ST7A 1S1TB 5CB0A 2BRUC 3HV2A 1B00A 2DPIA 1J33A 3G96A 4RJTA 1RLTA 1TL4A 1OT3A 5IKMA 4A6EA 1JEJA 2OPQA 4ZCLA 4LBIA 4E4YA 3FDZB 2QAGB 5JVGQ 3F67A 1YJXA 3PNOA 4J29A 1WETA 4LDNA 3SXPA 3WISA 3ITHA 4WFBQ 3QEJA 1DFHA 5ALNA 1EK2A 1AHNA 2KW5A 3O92A 2H1IA 1UM8A 3AZQA 2UXBF 4JYAF 3PHLA 2CNLB 2YY3A 5T4FA 1CG2A 2GBLC 3OFSA 3K7RA 1U28C 4R2KA 1YVEI 3NHMA 3C74A 1E0KA 4QPJC 2SICE 2YVUA 1XZNA 4UVHA 1JH9A 2V67A 2C57A 3VDMA 2QG9B 3RW7A 1DQSA 1WUJS 3PS9A 1SQ5A 4ID8A 2XBPA 4HGQA 2HRTA 2CPJA 3IUPA 1VL2A 4DSNA 1BSVA 2RGWA 1RT2A 4XIYA 2IAJB 4KO1S 1B64A 1QJ4A 2B4YA 1VQ4S 1VYUA 3V33A 1UW9A 4KREA 2ZWVA 3FHTA 1RQPA 3TA1A 2XVYA 1ZK4A 1C41A 1Z0SA 1PGOA 3KT3A 1OVMA 1XFDA 3ESBA 4E32A 4EO6A 4BEWA 4IDCA 2EQ5A 4MKIA 4BO1A 1VECA 3VNRA 3RVOA 3VYUB 4OH1A 2WIKA 2F1RA 2PA8D 5D8HB 1HEUA 1Y7HA 1YA4A 4X65J 3UNYA 3STWA 1LV8A 1J1UA 5HR5A 1L3BA 2D69A 3WHKA 2IH2A 1Q2XA 2VZ8A 3BIFA 3F2IA 1YDGA 2IP4A 3JQQA 3SR3A 1FQJA 2QJOA 4M5NA 4NAUA 2YWGA 4AAYA 3TLJA 1F3OA 4IG3B 1R0YA 4BMCA 3QVUA 3PLRA 3V1YA 4YRQA 3TMKA 4MYDA 4Q7AA 4GWKA 4QYIB 5KQMA 5H59A 2KHCA 3A1CA 1COWD 4RKUC 2R8YA 4GL2A 1OI2A 1Y0HA 3EVZA 4X4VA 5J2NA 2O1EA 3CR8A 2VS1A 4ZCKA 5CA1A 3SJUA 2BE2A 4QPPA 1N56A 3KQWA 1CJUB 3MM5B 3GT7A 3MMBA 2YIDA 3GHYA 3JAWA 1D0VA 2CPHA 2ZTHA 2UVWA 1IXZA 2FI1A 3H3JA 1WHTB 4LA4A 4YBZA 3SQMA 4K8RA 3COSA 1JIKA 2YH2A 4L8WB 5G4KA 1RI3A 3VU3A 2X3FA 1JA1A 4C20A 3RWMB 1RU3A 4C3MA 4R8UA 1C0IA 5C3MA 4RMHA 1NR7A 1VBKA 2D00A 3MAAC 3IR5B 2HIQA 4BMYA 3ILSA 2AH5A 3TQFA 3VU9A 5KFHA 2ZI5A 3H2VE 2YS6A 3I3SR 3H75A 3OX4A 2Z2KA 2E7ZA 3ZQKA 3D5MA 4BBAA 2R85A 2ZJYA 2NGRA 1JDPA 3NP9A 2JFGA 4LGMA 1R9JA 3A3OA 5E3AA 2DSNA 2JIOA 5BNIA 3IEXA 3QTLA 2YY7A 4D0NA 3UXEA 2JJ1D 1P72A 4OJGA 1W34A 4QDKA 2H1SA 2QTGA 1ILEA 4O2AF 4QUAA 2ZRFA 3CULA 4GKJF 5FPYA 1TM2A 3MTQA 1N4LA 4MJ7A 4AY5A 1NSYA 2AW3A 1T02A 3MM9B 2YVQA 3WNQA 4FNOA 1STOA 3THWB 3Q2OA 1HT0A 2XI4A 2VQFF 3ERCA 5JAIA 5CXTA 1RBZA 4DMRA 1LPNA 5DNCA 2C28A 2DGUA 2UVQA 1RJDA 3G2NA 5CJ2A 3WL6A 3KLFB 2F3UA 4N18A 2PKEA 5FEMA 2LA6A 4NJOA 1E1CA 4IIJF 3QMQA 4EYGA 1RPAA 1XLTC 4B3XA 1UMDA 5CNMA 3AUUA 1VOMA 5JDIA 4CF4A 1I0IA 5CIYA 1WSRA 5CK5A 4OREX 3FYTA 4BU1A 2AEFA 4QXAA 1IBSA 3KKKA 2O8FB 4BVGA 3PUIA 1ZM3A 2JGMA 2R2AA 2Q1UA 3PD7A 4R84A 5I42A 4MVJP 2VTKA 4XIGS 3MUMP 4F4DA 5L40A 5BRAA 4OA8A 4UBLA 1MC5A 4M60A 3BJEA 4DREA 1NEEA 1NY5A 5COAA 1BHNA 5J43A 1ESZA 1WF2A 3N39C 1BA2A 3EBPA 4Q66C 4A48A 2PKYX 1NSQA 3Q6MA 3ANTA 3GFTA 1OI3A 1EVZA 5D3MA 3MR5A 1Y42X 1YK9A 1ISHA 1QM9A 5GVSA 3ZHYA 4JOSA 2ZVDA 3AR3A 3I9FA 4RQUA 2P65A 3DVAB 3GEMA 4O1MA 4FOTA 3PB3A 4F6LA 3KSZO 4ECUA 4AQYB 4ATNA 3A2KA 3RB3A 2WV7A 1B7FA 2VDOB 4O4LF 3CRVA 2DXEA 3THPA 3EGNA 2IIVA 1J4AA 4BE9A 5L3SB 1G16A 2CLFB 1J0EA 3GFRA 3QAUA 4V1Ak 1NVUQ 1QXSA 2LW7A 1X8XA 3EXIA 3NLCA 4NZNA 2B1JA 5ENDA 1X77A 1RRMA 4IWYA 4JC8A 5FOVA 2GESA 5LDGA 3WLOA 1NLKL 3PIIA 2ADCA 5C2JB 1EDZA 4CMGA 2R4FA 4AMYA 4QGBA 2LU2A 1C8BA 2FRVA 1KNQA 2ILVA 1E2FA 3I6QA 4MVCA 1SK8A 1YI2S 1C7QA 3AFGA 2VBGA 3QPIA 3E05A 4U6SA 4QKQA 3GW8A 3HZHA 6REQA 4GS5A 4HWOA 4EA6A 4GECA 3GFZA 1C0PA 2HWKA 5ES4B 3C14A 3WL3A 3QVKA 3SE0A 4DS5A 5HO4A 4NY1A 1DRVA 3MIIA 5CLHA 2O05A 1NV8A 2NUBA 3KBOA 2Y0SD 3UFXB 2ADOA 3I01M 2MHCA 4U2BA 3IVMA 4ZVTB 5C46F 5KVQA 5IHPA 4XO0A 4DA0A 3OX2A 3V9AA 2HS0A 2PMKA 2RMLA 4Z4GA 3Q8UA 4OVKA 1R37A 2PSEA 4QU7A 3LUCA 1N4DA 4US2R 5ILGA 2YYAA 4D8TA 3WP1B 2OTLS 4O2BF 3JS5A 4C8OA 2XTAA 521PA 4PVDA 1NUSA 3A1VA 5I48A 3MECB 1AGYA 4LFCF 1HRKA 1DTWA 3QXSA 3AT1B 4O4HA 3TQIA 1DT3A 2X7JA 3QBVA 2IBMA 1JIJA 1U1KA 1SH7A 1LPMA 2GVDB 4R1TA 3EIEA 4QAQA 2F9FA 5FNZA 1IDOA 1S9HA 1KC3A 3REQB 3OT5A 3R3UA 2QNBA 5E9AA 2FFBA 4P3OA 3EUAA 1FTYA 2PZ8A 1VLZA 3KJZA 1GFWA 3MWEA 4CLOA 2QXUA 3A13A 2JHPA 3PQ8A 2O14A 3MXOA 4HMPA 4RZUA 1NRIA 2ZJQQ 2HCTA 4E5PA 4AJ1A 4ZPVR 3WAKA 1SBYA 4OLFA 3KOOA 1G9TA 2C2KB 1MX1A 3I1JA 3V81A 2XUIA 2PSDA 2F8LA 2GN8A 1QPZA 3H8VA 5IH7A 4GX5A 1QLWA 1TZ2A 1OX4B 2B4PA 5GAEI 4RTNA 2XO6A 4A0GA 3OU7A 4AFFA 1XCMA 2LDIA 1FNMA 4ZYTA 2ZOMA 1NW4A 5ALUA 2R00C 3U16A 2QLFA 2LFVA 4GQIA 1EFRD 2GHIA 1YHYA 4J5OA 2XT9A 1FRLA 4OHYA 5JYBA 3CLVA 1WCV1 4ZMMA 3MFIA 4RLQA 3WB1A 1CEEA 5BR1A 3BEGB 3PXEA 2PAAA 1X38A 4IGIA 1NRWA 1GKLA 4J9SA 5EXPA 2W9CB 4FDTA 3K70B 3F44A 1R8SA 1KJYA 4ND4A 5JAOA 1W59A 3Q3GE 2ZBPA 3EZNA 4O3NA 2ZH8A 3EWAA 3KZVA 4IXWA 1X7YA 4BB5A 5A0FA 1C5KA 2XSFA 3A8TA 4WY5A 2WRMA 3O2QB 4M8KA 1MQ8B 5M2QA 2XE4A 4JI3B 3SXJA 3AJEA 1FVOA 1TDJA 4X7BA 2GBIA 4NQZA 3OT1B 1LSUA 1JDBC 3MGGA 5B3KA 4UDNA 2WOOA 3HFGA 1ZGBA 4TZ6A 1VLJA 2AKWB 3OPMA 2BH9A 4IQGA 2FJDB 1KFEB 1L7PA 1GKYA 3SHQA 4MRPA 2B56A 2HGMA 5MGBA 2RHTA 2L9WA 1E1KA 1C9EA 2XDQB 3H65A 1R4NB 1ZIPA 3E2MA 1U1PA 4HWGA 1GKKA 3RAEC 4R2HA 2MJNA 2JFQA 4UXIA 4FLEA 5IXYA 4WSOA 2BR4A 4FGJA 3QTBA 3C1UA 4F9EA 4O23A 2P3OA 4JB3A 2FOIA 4IH4A 2FPRA 4KNYA 4QTZA 2ZM6B 3CISA 4N47A 4FF4A 4LBVA 1Y9JA 1THTA 4TM8A 4IIBA 1HL6A 2XLKA 1E59A 3ZE1B 2RB4A 3VZCA 1QG2A 2XUFA 2C00A 1NN0A 4HNAB 2YKMB 2YXPX 2V4JA 4CIAA 5KQGA 1XG5A 2FFHA 2GBFA 3FNHA 4RPLA 1UP4A 3CSUA 4JV0A 2XA2A 2OHDA 3WIOA 2D5LA 2HIAA 821PA 5AHOA 1Q0PA 1CJSA 3D6MA 1RC0A 2VJDA 3FRHA 3LLVA 1JU9A 1AHIA 1NOKA 2HF9A 1DINA 2H59A 2RHDA 3Q8WA 1J0BA 1I1QB 2I2BA 2IM3A 2C8KA 4AXJA 1P6XA 3IERA 2LQ9A 4LQLA 1N2CB 4IOKA 1RHUA 2PFGA 2EW9A 3G7UA 4RZIA 1YR6A 3IUBA 3SQLA 3HCWA 1JXEA 1FNSA 5JJKA 4Y9UA 4P36A 3BSYA 4G5QA 5HVGA 4F50A 4JBXA 3ENVA 2ZB8A 3T1AA 2GTHA 3PX4A 3LA8A 4BZXA 4DR5J 4MKXA 1ORTA 2CXRA 3BMQB 1FYXA 5DXAA 4TVSA 1L8XA 3QU9A 2A9PA 1KAQA 1WMBA 3TDNA 3NOXA 4Q39A 2VFVA 1GPUA 3BAZA 4PRZA 3MM8B 1DEKA 1K98A 2GH1A 4DDFA 5FHRA 4Q1BA 2H5JB 5BSKA 3SIXA 1CXZA 4R3NA 2F9DA 2ZAMA 3ZK8A 1ZMBA 3UXHA 5IDQA 1PUIA 4MIEA 2WIBA 3JVVA 2JWNA 1IZZA 4RH0A 3EVBA 1WC0A 2HD4A 1XJCA 2W4MA 4WACA 4EWTA 2AZ3A 5LXYA 2QDKA 1HA3A 3SSNA 4DTCA 3I9KA 2CQHA 4U0KA 5F9HA 3JQAB 1VE1A 3QVTA 4PCVA 3DOIA 1IKYB 3JPYA 5JCOC 3KKQA 1X9IA 4NRDA 2L69A 3F96A 3KXIA 3LQ1A 5K0NA 1JPNA 2JFZA 1IZ9A 3OFGA 2RHWA 1C3LA 3ZCUA 2OSRA 2WT9A 4KFCA 2XUAA 1TLTA 4CR6A 4UQLA 5AJXA 5FL7A 3S7TA 4EGFA 1NVWQ 1RLIA 1XTVA 2ZYIA 4OYPA 3N1UA 2P79A 4MULA 1KSPA 4NYPA 4UUXA 2ZBEA 4JJ6A 5H68A 2GJ2A 3WTCA 5T57A 4KQ2A 2FRXA 4C89A 2W2LD 1YB7A 2A5GA 3A2MA 3MPDA 2V7WA 3BRCA 3TRJA 1SBIA 1UT8A 3HA3A 2CXPA 1T43A 5HP1B 1TK2A 4BC0A 1OYOA 4RVNA 3RRZA 1XBTA 2XZLA 1NN5A 1SCJB 5GMEA 4ED5A 1EQ0A 1LW2A 1IPFA 3R7WB 1XK8A 4XVUA 4IUDS 4BJ1A 3LP1B 2VHVA 4B9EA 3ELHA 4YN3B 5KOXA 3I6IA 1XTSA 4H6XA 4YO7A 5HSPA 3OL6A 5I9MA 1CQZA 5F7XA 1C0UB 1KH1A 3UENA 2QZ9A 1SV5A 4BP1A 4ALKA 4QDZA 4KLZA 3AQIA 3I2FA 3DNFA 1KIMA 2YHSA 1R0BA 4YMGA 1XGKA 3HJFA 1VQ5S 4CIVA 2CQ0A 3I09A 2W9AA 4MYHA 3UA3A 1OFGA 1GYRA 2ID9A 4FC6A 2ZBDA 3GUHA 5IMSA 1D09A 1EBUA 4AUKA 2FPIB 4G1IA 4NAVA 4O25A 2X76A 4KU4A 1RPZA 4GEGA 1N6OA 2FWRA 2WUFA 1AGPA 4D4LA 3AL3A 2Q1XA 2PPLA 5CAEB 3H5AA 1XDWA 1XDGA 4R5PB 1FDDA 4OLAA 3HNRA 1EA7A 4DR3B 4DZDA 2BFOA 3E5MA 3IMFA 1Y3CE 1I2MA 3PD0A 3ZXYA 3CJRA 3RK0A 3C2QA 4I6JA 3MC1A 4WMLA 5TEVA 1FMLA 4DANA 2NZVG 1IWGA 3M34A 4F4AA 3HN6A 5DLQC 1U2GA 4FJ0A 1TUGB 4B31A 2B78A 4ER8A 3GIRA 1DKMA 3ORYA 5BMVA 1LJLA 3OPVA 1HQCA 2GJ4A 4DU8A 1KVTA 3SYKA 3IOBA 4IFIA 2YYYA 2OSBA 4Y2HA 1I5EA 4GC7A 1P77A 1XC7A 2WG2A 3NGUA 3UV6A 4AMVA 1PQUA 3S81A 1PFKA 3EVDA 2FRDA 3W3SA 1RAHA 3PTWA 2E18A 1S9EA 2RAPA 4E12A 3EVNA 1X1EA 3S2EA 3GGOA 1VE7A 4DQ0A 1FE8A 4H3SA 1XZDA 1TUWA 2QV6A 1J00A 1HHQA 2FJWA 4DY6A 3PT9A 3FKSD 2CLMB 4RDXA 3QJJA 5FWXA 3LQYA 4EATA 4I6YA 3CZAA 1SG9A 2PRYA 4YJ2A 2X0IA 1FYFA 2RMKA 1UOQA 3QZ7A 2O3RA 1XB2A 1ZCBA 4FSXA 1DHMA 4A03A 4FMBB 3RIEA 2IXTA 2I5JA 3ZTSA 4FKBA 2BHLA 5HZMA 4S0MA 2R7XA 3MM6B 2FW7A 3BL6A 2CL0X 2GJFA 1S9GA 4CNZA 1OYDA 4D79A 2R1VB 4TXNA 3W2VA 2CEKA 1KEZA 1XAHA 1L5SA 4A8JA 4KQ6A 4PRFA 2HW3A 4D3FA 4ITVA 1XZQA 2H48A 1C30A 1H2XA 4YB8A 5BVGA 3ZW9A 3AFMA 2VN8A 3RARA 2YWRA 5JU6A 2X1HA 3PV0A 5KMGA 1HKHA 4G1QB 1F8YA 3RR8A 1CC1S 4KQHA 5I4MA 2WFLA 4I6GA 3WLSA 3V6DA 1OBOA 4I69A 1I80A 1CEXA 3NJ4A 3HLKA 3SJZA 5KJCA 2I0FA 2J8SA 5AVRA 2QVYX 3EXG2 1FKPB 4ES1A 2E4XA 5DO9A 4EB6A 1BCRB 2FSVC 3CWJA 2WIGA 5E4TA 4ETWA 3DU6A 1K47A 1RKQA 1Y4ZB 2XS7A 1X0PA 1MMDA 3X1ZA 1EWQA 2J09A 2JG3A 1S76D 2JA2A 4QPXA 3B1YA 3DDHA 3VV2B 1G42A 4URGA 2L2QA 2Q50A 3VKFA 1KOLA 1FDIA 5JCJD 3MRTA 3RZAA 3OT9A 3FSGA 4TU9A 2OV2A 3K0JA 2G0CA 4Q15A 3NV7A 5LP1A 1PZNA 4KR0B 1WOYA 1K68A 5BXYA 4FGZA 3H5WA 3JWGA 1JJIA 1P2DA 4KLAA 4PSUA 4E31A 1NQWA 4NL4H 3G8CA 2Z0MA 4NLWA 3ZHOA 4USMA 4BNDB 1U7TA 1VKRA 3Q8KA 4WLEA 1SCUA 3D0QA 3AP3A 4UHFA 1VHQA 1FRJA 2BQRA 5IN5A 1GUZA 4TKUB 4NOKA 3PJRA 4R0JA 1HNXF 2MQLA 4BP9A 2PN6A 1ADYA 4BKMA 4R8LA 2B6AA 4MIYA 5JAHA 4B4KA 2J3LA 3EVAA 2EZ4A 2KFYA 2WKSA 4CQMB 2QZJA 1PGJA 3L1JA 2PKRA 1M5HA 4HUQA 1SPBS 7ABPA 2OFPA 2ZU0C 3V7YA 4X85A 5HILA 2XS2A 4BLTA 4XQ9A 3TJZA 3KQHA 2Y4NA 2XGGA 2JLCA 3GRRA 4JUBA 1Z88A 1I3CA 2R8JA 1QFYA 3DM9B 1S9FA 3LTOA 2Z2IA 1LKZA 2H7VA 5E2AA 4Z4QA 2K2PA 1JIXA 2PRZA 3MWDA 3KOMA 3LDUA 4E07A 3KK1B 3LHSA 1XL1A 4Q12A 4PBSA 3E5HA 4UFNA 1T9YA 2NSLA 4ZVFA 2H07A 3RTBA 4DMZA 4HLUA 3RF7A 4AX8A 3HI4A 3CY6A 3KQOA 1P5HA 3SXUA 4X4TA 3P5BA 2C82A 2WJJA 3LXUX 4FYXA 4J0FA 1AUQA 4OP1A 1L5HA 1HFKA 3CLRC 2CXSA 3QVOA 2P8SA 1NMQA 5I7OA 3SF0A 3CCLS 2BANB 5CZXA 2ZATA 1IEVA 4RWZA 5B09A 2DQ4A 1NP6A 3P9XA 5IDVA 4JUCA 1BGVA 2R6CA 1HZZA 3DGFC 2ZIFA 4M94A 3HFKA 1EJ2A 2DH7A 3OJLA 4MVJG 1CQNA 1V7CA 4N54A 2QDXA 3BILA 1B0UA 1XTKA 1CR1A 1E94E 3BO2A 4JI8J 1Y1QA 1PFGA 3FJ2A 4MXDA 2CZGA 3N75A 1NDQA 2J87A 2RHHA 2G04A 3LA0A 1QIFA 3D67A 4OX9J 1PV4A 4B80A 1PUJA 1ZHFA 3CXCR 1XNQJ 1KXZA 1Z4PX 4X92A 4URUR 2Q0QA 1R89A 2HG4A 5K5MA 3OZGA 1UFVA 1IY1A 3JW8A 5B7GA 3P4UB 2GD2A 4DDWA 3KFLA 2JCXA 4DV1J 1Q0RA 2HSZA 3T54A 2Q2NA 2GPNA 5FO0A 4OXNA 2YJ5A 2HH9A 4ACBA 1H85A 1KI1A 4X3PA 4DYHA 3A8EA 2OGZA 4XB6B 1RT4B 1GA1A 2EQBA 3I76A 2R7VA 2MINA 3O7MA 5LQUA 2NSJA 1ZN9A 4AFNA 4ITUA 4F3NA 1J0AA 1W2GA 4YJGB 4URVR 5ITHA 2WYOA 1SJ4P 3HCOA 1GFIA 1IVYA 2VDUE 4C4RA 3CX8A 3RKUA 4NZZA 2JLAA 4BFXA 3OE5A 1E61A 4Q9NA 1R5BA 3M8PA 5IYZB 1H2TZ 2DNYA 4K86A 2E44A 1ODKA 2MOKA 5B4UA 2NU9B 3O21A 4Q44A 3PQ7A 2I8LA 4QUEA 5G0UA 4YS2A 3MTEA 5J58A 3U3MA 5GZ3A 1RADA 2YXDA 3FJ1A 1T6BY 2Y3YA 3MCVA 4ONEA 3R8XA 4K9RA 3TBHA 2POCA 4WJZA 4IIEA 3KHHA 2F90A 1O5OA 4JNKA 3EZ7A 3RB0A 1HMVA 4F2SA 4XJXA 4YHHB 4L27A 3QRPA 1CVLA 3RD5A 1OI4A 4RZ3A 5IMBA 4ESOA 4I0WB 4DN0A 5LMCA 3BXGA 2WD7A 4HNVA 4WV3A 1GTJ1 3STVA 4I5FA 2ZNZA 3MXTA 4HHHA 3JTNA 5A6SB 3ZH9B 2EI5A 5HWSA 3QXXA 2QN2A 3SZGA 1Z5OA 4LWOA 3AODA 1H1TA 1LVUA 1DKRA 3KOUA 3EMDA 5HATA 1M73E 4LSNA 1PZEA 1UADA 4D8VA 4CGZA 3V32A 3A6ZA 4UHEA 3CKYA 1XZKA 3O1LA 2QRUA 4LBZA 5CFPA 2B8QA 2OMLA 2HRDA 3TSCA 2Y8EA 3N59A 4NBRA 1X9SA 2ZQZA 3MURP 1ISGA 1IM5A 4FKMA 4OHZA 2ZUUA 1GQOA 2HPVA 1XMBA 1IHYA 2CUKA 5JH7B 4Y6RA 2OV4A 2YUTA 1RT5B 4TLQA 1QBGA 1JR3D 1N1GA 1ZM4A 2PO5A 4KSBA 1X80A 4I2NA 1SVNA 4PR0A 3CZMA 2QTTA 2HHPA 4PXAA 1JKHB 1MVNA 1RBYA 3FJOA 3MLAA 3DDUA 1B74A 1O4WA 3UR0A 1J1IA 2HC9A 2GEKA 5LP6A 3FRZA 3IAM6 1WU7A 3K1AB 3KG1A 1Z17A 4JS0A 1USKA 2WB2A 3C7CB 2XYRA 1PFQA 3ADKA 1Z8FA 2HHCA 1ULUA 5FI3A 1JILA 5I4KA 3UK6A 2R8IA 3PGA1 4WINA 3P1JA 3PNVA 2ZTVA 3GLIE 4OAPA 1OH8A 2PXCA 4JI5F 2FTKE 3QGHA 2OCBA 5B58T 4QGGA 2VDRB 3TEMA 1Y7TA 3FB4A 5E3PA 3OCZA 2ZI7A 3M6FA 4Q1AA 3VF0B 4PTZA 1BRMA 1PN3A 4XGNA 3KEQA 3DMJB 2UAGA 3PW7A 5LKAA 2OBYA 3JRXA 4QX6A 4B2IA 2E37A 4HSEA 3KIPA 5EUQB 4B33A 3HRIA 2R65A 4WTYA 5EERA 4KHRA 1PL6A 1FF9A 3EDQA 5HQ8A 1ABEA 4G5FA 3JR3A 5F3ZA 2BJEA 4RWWA 3C15A 2I1RA 3UBTA 1I32A 2HV9A 4M8IA 3FVRA 1QVGR 3KNAA 5E3CA 3H18A 3D54A 3KDNA