4JP8A

Crystal structure of pro-f17h/s324a
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
395
structure length
395
Chain Sequence
b'NTIRVIVSVDKAKHNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWLGGGSTQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tk-subtilisin
molecule tags Hydrolase
source organism Thermococcus kodakarensis
publication title Increase in activation rate of Pro-Tk-subtilisin by a single nonpolar-to-polar amino acid substitution at the hydrophobic core of the propeptide domain
pubmed doi rcsb
total genus 128
structure length 395
sequence length 395
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 4jp8A01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4jp8A02
1BE8A 1THMA 1V5IA 1SUPA 1KDVA 3DDZX 5AQEA 3A3NB 1C9JA 4HX2A 4JP8A 1KE1A 4WOBA 1BJRE 3EIFA 3DE1X 2HPZA 4ZARA 1JEAA 1PEKE 1AV7A 1CNMA 3DVRX 3BPSP 1TM7E 3VV3A 1R6VA 5AMXA 2ZRQA 3DW3X 1BE6A 2QTWB 2G4VA 4NE9A 2W2OA 3TECE 2PWAA 2XRMA 2SICE 1Y33E 3ZXYA 2Z30B 1T1GA 1AU9A 2B6NA 4CFYA 1IAVA 3VHQA 1SUCA 1SBNE 1SUAA 3DE7X 1TM4E 3BGOS 2Z58B 2GKOA 1YJAA 1Y9ZA 1UBNA 2WV7A 1EGQA 3I34X 3VTAA 1Y4DE 1C9NA 3H42B 3H42A 4YN3B 2X8JA 2Z57A 5I9SA 2Z2YA 1SBTA 2Z56A 1KDZA 2XTJA 4H6XA 1OYOA 1ZVJA 4NMXA 4C3VA 5AVKA 4C3UA 1NLUA 1OYVA 3P5BA 2WWTA 1MPTA 1AQNA 2W2QA 3GT4A 1SELA 4OMCA 3SQOP 1BH6A 1PTKA 4KB5A 4Z2AA 4NE7A 1Y4AE 3LPDA 3I2YX 2QTWA 5B1DA 4H6VA 1KDYA 3GCXP 5JMOA 4AKSA 4OMDA 1GTL1 3T41A 2W2MP 2IXTA 1C3LA 3GCWP 3BX1A 1WMDA 2W2NA 2SECE 2PMWB 1GCIA 2PRKA 2P4EA 1TO1E 1SCAA 4OV6A 2Z58A 3UNXA 1S02A 1Y48E 2PWBA 3F7OA 1TK2A 1IC6A 1GT91 3AJ8A 1TM5E 3L1KA 2Z57B 1SIUA 1KE2A 3QMPA 4B5LA 1T1EA 3DE4X 1PJ8A 1S2NA 3TI9A 1DBIA 1Y34E 1Y3FE 3DE0X 1PFGA 1AH2A 1WVMA 1WMFA 1NDUA 1SH7A 3DVSX 1Y3CE 1LW6E 1YJCA 1CSEE 4KG7A 2E1PA 2ID4A 1ZVKA 5FFNA 5ARBA 4J94A 2Z2YB 1WMEA 3CNQS 5ARCA 1SCJB 5JXHA 2V8BA 2W2PP 4OV6B 3VV2B 1GA1A 4I0WB 1R64A 1ST3A 1DUIA 3F49S 3QFHA 2XTJP 1YU6A 1SN7A 3EE6A 4AKTA 5JXGA 1SUEA 1SVNA 2TECE 1TECE 2PYZA 3D9QX 3EDYA 4H6WA 3P5BP 1AF4A 1T1IA 2DUJA 5JXJA 1XF1A 3PRKE 5B1EA 3SQOA 1SCDA 2Z2XA 2Z30A 1C9MA 3F7MA 1SCNE 3A3PB 3WQBA 1NDQA 2HD4A 4BWGA 1SBCA 5FBZA 2DQKA 3CO0S 1GNVA 3VYVA 3DE5X 1YJBA 1GTG1 4DZTA 3GCWA 1AVTA 1VSBA 2W2NP 2WUVA 3I37X 2Z2ZA 1P8JA 4CFZA 3WIUA 1A2QA 1V5IB 3BGOP 1WSDA 2W2PA 2WUWE 4FONA 3CNQP 1Y3BE 1Y1KE 3OSZA 4NMXB 3LXUX 4ZOQI 2SNIE 3BPSA 5K7SA 1SIBE 2W2MA 3DWEX 4WOCA 1GTJ1 1AK9A 1TMGE 4DJ5X 4MZDA 3DE2X 4NE9C 3D43A 3TI7A 2ID8A 4K8RA 4M1ZA 3Q40A 1TO2E 4K8RB 3LPAA 3ZXXA 3AFGA 4LVOA 3AJ9A 1Y3DE 1TM3E 1SIOA 3I30X 3VSBA 3GT3A 1GA4A 2W2QP 4LVNA 1R0RE 1BFKA 3QTLA 2PKCA 3DYBA 4KPGA 5FAXA 1Q5PA 2ZWPA 3SICE 5AVJA 3WIVA 1ITPA 1P7WA 3VV2A 2ZWOA 2IY9A 3Q5GA 2PQ2A 1SBHA 4RYDA 1SUBA 1HT3A 3PTLA 1MEEA 1V6CA 4CG0A 2X8JB 4YN3A 3A3NA 2Z56B 3DW1X 5ARDA 3GCXA 1SCJA 2ST1A 1GNSA 3WHIA 1TM1E 3DVQX 2W2OP 1GA6A 5SICE 4DWWA 4HVLA 1OT5A 1SUDA 3A3PA 1BFUA 3HJRA 1SPBS 2PMWA 2DP4E 3CO0P 5JXIA 1SPBP 3DE3X 4GI3A 1ST2A 1P7VA 3LPCA 3A3OB 2SBTA 1EA7A 1S01A 3A3OA 3DE6X 1SCBA 1SBIA 5CW1A
chains in the Genus database with same CATH superfamily
2BELA 2J8SA 4LAFA 2NUPB 3OZAA 3GMSA 1OJ7A 4MW4A 4L8WB 1F2UB 3TW0A 4DR2F 5JZ9A 1U1OA 1JJAA 2GD6A 2FR1A 4YRTA 2WHQA 4D3GA 2IODA 3IBSA 1SC3B 4NESA 2LWIA 3IUSA 3AU8A 4QRIA 4YRFA 1YL5A 3AHFA 3PEYA 3TGWA 1CTQA 1JLEA 2CW5A 1V0JA 4YUDA 1M2EA 3ZVKA 1F60B 1C3XA 1PZGA 3FVVA 3VOBA 2XY6A 1WUKS 2XRMA 3KG2A 1X7WA 4BGVA 3DPIA 1T1GA 1KHWA 2JD1A 1HX7A 3VR4A 4RFLA 1S4FA 2DO0A 4FNGA 4RWXA 3P49B 2ADMA 3B1VA 3STWA 2JLUA 4QOEA 2Y8WA 1UQRA 4LSNA 3BRCA 5EYPB 5EIEA 1QOQB 1PYOA 1R3UA 4COKA 2BACA 4DA7A 4FS2A 3DDIA 2GBFA 1GXUA 1Z4IA 1VKNA 3DOKB 3B13B 4FHFA 4NCXA 1DOAA 4TN1A 2E5IA 3OPXA 5E6SB 2OILA 1RQGA 5KIAA 2IOFA 2ZT6A 3EXIB 4BO3A 4GQAA 4DSEA 3RAQA 5KFFA 3UUWA 3RTBA 3UPDA 4EFLA 2CHEA 5TMBA 5ERXA 2LW7A 1UP1A 4OG2A 5HF5A 3G8CA 3BXPA 1TU0A 4HLDA 2RHRA 1NBIA 1P73A 3D67A 1KC3A 4ZVLA 3KB6A 1CF4A 2C5HA 3KDOA 4MQEA 3CIOA 2CZ9A 1A9TA 1GPJA 5K3DA 3PD7A 4LDJA 2C2BA 2XQJA 1CS4C 2HSEA 2JRSA 1JG2A 1L7VC 4RVGA 2IIHA 1RPZA 2R4FA 4LA4A 4HTAA 2PZEA 4KMOA 2CB9A 1BRMA 4JLNA 1K08A 2VTBA 2GVNA 5E6SA 4FC6A 1JMYA 4GI1A 2BUNA 1SOVA 4XUGB 4C4WA 1ZA2B 1DBIA 1FRMA 3TEHB 4OREX 2JCXA 4IH7A 4LUBA 3H3XA 1JLFA 3ZCRA 1YKSA 4I2PB 2Z4PA 3ZCSA 4G1EB 1KYWA 4HAWA 1BN7A 4B85A 3MWJA 3PUKA 4I5FA 4RLQA 2ZE2A 5FIIA 3MM9B 3KRTA 4XPIA 4MV3A 5E3PA 2H8GA 3TJAA 3T5DA 2BEJA 4ZIWA 3H5IA 5A05A 3M70A 4BJ3A 4KLNA 1ZM4A 4ZQBA 2WK1A 3OQOA 3CRVA 3M3DA 2J9ZB 4PGHA 4G36A 3UO0A 5HVHA 4W5QA 1XF9A 2XKAA 4Z8XA 4FWTA 5CCXA 1DARA 2VEDA 3IQIX 3QEAZ 4DSUA 2V9WA 4QATA 2Z5LA 2K6GA 1JLFB 4F1WA 3G5TA 2GEDA 4RIGA 2R7TA 1NB7A 2FKAA 3DCIA 4IDCA 2Q3HA 3OIYA 4YMUA 4IQ8A 2W4QA 1EKSA 3V4VB 1IM5A 4M9SA 2ZWIA 1U7XA 3JTEA 4GPD1 1FTGA 2JH8A 3BGOP 5H8WA 4EWTA 3MGBA 1V8OA 2FGOA 1MAWA 1X4DA 4WOCA 3UOGA 3LP0B 5K51A 1H22A 2DULA 4CUKA 4WTOA 2YQ3A 3COJA 1SXLA 3ZYZA 4PRKA 2BZ0A 3MURP 5A6SB 3FBEA 4ZMRA 4O4LB 2I8LA 3V8RA 3ADBA 1X60A 1M75A 3EEFA 2UDPA 4JJ7A 4K5QA 3HKCB 2Q2OA 4JT4A 2AJ4A 1YI2S 4B32A 3GPAA 5AW8A 3OEYA 4LDAA 4MXDA 1AV6A 3EGVA 1BCRB 5AK0A 1XFAA 3CU5A 3ASYA 5D0EA 1O5OA 2E7ZA 4IIJF 2WJJA 3I5AA 2ALJA 2WT8A 3TVKA 4ZYZA 1X70A 3E3OA 4E08A 1DB3A 2X3YA 3TB6A 3CUEF 4RBVA 1XBWA 1FTRA 2COLA 3VWSA 3I28A 4YK7A 4XUDA 2NU7B 1FJXA 2AL7A 1ZNZA 3LWZA 1P8GA 3TQ1A 2NZXA 4EJSC 2Q07A 3WZ0A 2LE0A 4HQFA 3INGA 5IJXA 1Q1NA 3WWZA 1IXRC 3I01A 2I4OA 5AUNB 2PMHA 2ZVQX 2PMWA 2DRIA 1T5OA 2VAXA 4F5DA 2YBVA 3N4WA 4G5QA 2GCNA 2DNMA 2HHWA 1XZFA 4ZXPA 1ZOLA 4DY4A 4X24A 2KWIA 1H3EA 4EY6A 2JBAB 2C2KB 2YN2A 3UENA 5BT8A 2A18A 2OFHX 2AOUA 1ZUNB 2HSGA 3R6GA 1M0WA 1JYEA 4OL0A 2YBDA 4F8JA 3JSAA 4DLPA 5DEOA 2JCVA 4NYIQ 1GLVA 3NYQA 1E5XA 3LS2A 3MAGA 2CFSA 1EYZA 2RJNA 2G1JA 3OD5A 3H4MA 2QAIA 2Q1SA 3D1LA 3BHJA 3PFKA 3GFHA 1B2LA 2R42A 2TMKA 4JI1F 5LP6B 4UU1A 4Y6QA 2VIIA 1HBNA 2DJIA 5BSTA 2YWCA 2D1TA 3IHTA 2IS1A 4M1QA 5IYZA 1EX1A 1N75A 1FW8A 4JV5B 1N7GA 5AI4A 1WF0A 1YB4A 4EUSA 2G28A 3ZI0A 3D7MA 4PX9A 3H40A 4X4UA 1XZPA 1ROFA 2ZUWA 1QAMA 4KKXB 4Y9DA 4KQWA 3A1CA 1NOJA 2BWJA 4ZVQA 4N54A 4GI7A 4Q0MA 4JCCA 2PL3A 4MMZB 1N6QA 1BGVA 2Z08A 4KWIA 4J9QA 4LVNP 4P7BA 4RCYA 5FBKA 3BKWA 3PX7A 2ZD1B 4HMPA 2AUMA 1NLKL 1Z36A 5CXSA 4NIMA 1T2DA 1PWZA 3N5FA 4B71A 1A9PA 4OZNA 2FJAB 3BSCA 1Q3KA 1LW2B 4DBLC 4EUKA 1C3OA 4YDXA 3TANA 1LVUA 1LBSA 2BOPA 3PHLA 4RO0A 5CTAA 1KEUA 4ZOSA 2K87A 1E69A 2W8BB 2O67A 3BO4A 4V24A 3JASB 1NQVA 1FDNA 1AHHA 4DR4J 4YRBA 4EG6A 4MYSA 4TS3A 3L0CA 1GR0A 1S02A 1TPZA 3W7VA 1P1FA 1DV1A 3LO3A 1FZTA 2AR9A 2E4XA 1MOPA 3WX4A 5T3YA 3NO4A 1L5HA 1YB2A 3IQFA 3AL0C 1IG3A 3UGKA 1PE0A 3TLAA 3Q5EA 5ALHA 4WLVA 3ZWDA 2CXXA 1A8UA 2QTHA 3L4EA 2KT5A 1WVMA 1GN9A 3BCHA 3S3TA 5JJIA 5IXUA 1WZUA 2UAGA 2JGKA 1EFTA 3T5AA 4OMUA 4GUAA 1IJBA 5LMUF 1EQ2A 4CLOA 3G4SS 4B87A 1JT2A 3OZRA 4MQFA 3KVNA 3CNQS 3CXRA 2IUUA 1NW5A 1PFWA 2VJBA 1KQGA 3UJNA 5FUWA 2HV8A 4XDDA 3G2JA 1F3FA 3C85A 2NZ8A 4AUKA 1NAHA 1X1CA 2EDAA 3CJSA 4Z49A 4CIYA 1C0IA 4IFIA 2C88A 3HKDA 1FNMA 2VF7A 4GP9A 4C2UA 2AW0A 4MAFA 3T5TA 1Y8QA 3HLKA 3JR3A 4HFRA 2B35A 4RFSB 2B8QA 3GMDA 1MA0A 3RARA 2NZYA 2LDXA 5LBIA 4QU8A 1E0JA 3FWYA 1SVMA 3UQZA 2W93A 3AF5A 3HZZA 3DZFA 1T3SA 1Y5NB 4K88A 4BP9A 2R8JA 3I37X 4R81A 5CJJA 2FUCA 2LVWA 3AH8A 1E9CA 1NR1A 1WPRA 2XUHA 1KQ3A 4JI2F 3NAHA 1NY5A 5LOVF 1NXWA 2RHCA 3RS4A 1OKKA 5EESA 4ENVA 3PQFA 4P58A 4ZKDA 5K14A 5C25A 5KG0A 2WPDA 3QWFA 3DBLB 2YZNA 2OORC 2V6IA 4U8HA 4LR8A 3KMQA 4XPEA 5KG4A 4NCAA 1VJDA 2P41A 2W2LD 1KRWA 4MWOA 2CL5A 5JRJA 5EP3A 2Q46A 4ZKAA 1ZCAA 4ISCA 3VDNB 5KU7A 2HK6A 2BUAA 1FU7A 2A3NA 4LVOA 3N0TA 1SXJA 4IIBA 3REGA 1DAFA 4KWEA 3MK31 2GJFA 1FNDA 3ZJUA 5I7FA 5G41A 2B9WA 1R8JA 1UH5A 3RB8A 4ILKA 2QRGA 3ZXUB 2VH2A 4HDCA 2CCKA 1DRVA 2J4DA 4RGYA 4RTKA 4PEVA 2JGDA 2UUBJ 4ENSA 3TK1A 3ZOZA 2X8JB 4QYSA 3URMA 5AYVA 4RHYA 3I87A 3WK6A 1YIDA 2P40A 4F4KA 1C3VA 1ZWKA 4ZTUB 1SB8A 5EZQA 4F2GA 3GUYA 3QEOA 4ES1A 2Z2JA 3KHKA 1GG2A 4TWAA 5AR1A 1C2PA 1UXJA 3P2KA 3C3AA 4HCJA 1TL1B 3HXQA 2H4HA 3R0VA 3VU0A 4UZFA 4KGVA 1Z08A 2ZH4A 2B4KA 5D3MB 1JEQA 3A3OB 3TB4A 2R8PA 4B6SA 5JS8A 2OGZA 3ETJA 2MINB 1HNXF 2UUCB 3UW3A 2Q0HA 4R0MA 1Z4JA 1YJ8A 1WS6A 5IBQA 3TH5A 4BC0A 3CJ3A 1PHRA 1CZHA 4AW9A 2L9WA 4ED8A 4N5MA 5CYJA 1TTTA 3UI3A 3HCRA 2I38A 4L51A 3ISNC 4RV4A 2GVZC 4MRVA 2FE4A 5ALDA 4IO1A 1OLOA 4UAGA 1TMMA 2VP4A 3IDZA 3O4JA 3SF8B 4B3CA 4DCVA 5J4KA 1KQFA 3MLEA 4N5HX 2AJLI 3QVWA 5DQIA 1Q12A 3LAWA 4HFJA 5IULC 3MBIA 2WV7A 4ZGGA 5L7YA 1U2GA 4EELA 1U2ZA 5MN6A 2BX6A 5I4MA 5MGNA 4PW0A 4GPEA 3KV1A 1EVIA 2RHOA 4C4ZA 3HUFA 5LKAA 1QPZA 4X44A 1O0CA 1ZDMA 2PXHA 5IK2A 2VT7A 5GINE 1TIBA 3K5OA 2DPHA 4HAYA 4QKQA 4MUEA 2XNQA 2OV2A 4YRNA 3QUTA 2DNPA 2BBTA 3CW2A 3DMPA 1PTKA 4RACA 1EZ1A 2DYKA 4XXHA 5I4CA 1J2YA 2DR3A 3EX7C 4S3MA 2SKEA 3SYLA 1PR0A 2LV8A 1UZAA 4J4TA 3P32A 4PSAA 5LZ4A 3FPAA 2GZ2A 2WV9A 3KZVA 4Q05A 3G1TA 1D5CA 4PTLA 3VH4A 1YT5A 1J5EJ 1NK6A 4MYTA 2G9RA 1WCWA 2ZS7A 2HT6A 4A8JA 1VGVA 1P62B 2XBMA 2HSZA 1YTUA 3H90A 3D64A 3EIOA 3N8NA 5CLLA 2AZMA 4IOMA 3R5DA 1FUUA 4I9UA 4E51A 2ZB7A 2QX4A 1FFEA 6REQB 4RE5A 1HD0A 2DTEA 3D8HA 2FQQA 3RSCA 1BD6A 2AZ1A 4IJ5A 3N28A 1X2BA 2HPAA 1FJGF 5ICGA 1KIAA 1LH0A 1CVIA 1U8ZA 2QWXA 4YS2A 3HNPA 3RHZA 1RC0A 1C80A 3VX3A 3KELA 1R0BG 3P0HA 3Q3EA 5AESA 5DG7A 3I1YA 1U8CB 2AC2A 3MNFA 1ZH4A 1XHLA 2C5LA 3ZV7A 3ONWA 1YR1A 2OTCA 1K75A 3PRYA 3FCOA 4G9GA 2XB2A 2HWXA 3NWJA 1H72C 2P27A 2CA9A 4XFKA 4UTNA 4TRNA 1FXUA 3WNQA 3HGQA 3QZUA 1PZMA 3W8FA 3NFRA 1QUVA 3GJQA 4MR9B 2LDIA 3VZPA 3KK3B 3ITNA 3I9ZA 3TGLA 4W1RA 2I2FA 1UT8A 3T4EA 1GTMA 3EIXA 2E4WA 3S5UA 4YRQA 2UVDA 2CQHA 2MSCB 3HYTA 1H1LA 5TEWA 1IXSB 2DIVA 3BGLA 2KT2A 2CLLB 3D8UA 5REQA 1D0EA 4FGKA 2VDRB 1CJMA 3PC2A 3DE5X 1AGXA 4JFRA 3GJSA 2Y0CA 4HAOA 5G3ZA 5K8OA 4ENRA 1T6YA 1X38A 1KBQA 5CD1A 4QGGA 4D0LB 4OQDA 5ED0A 3WE7A 3S81A 3RROA 5AKKA 1IBMJ 4FYMA 1XLVA 1TEZA 4DJ5X 4H3VA 4HTIA 2NPOA 1K5HA 2LP4Y 1UAWA 3LZ6A 4OHCA 4AICA 5IVKA 1U0EA 3UPTA 5A02A 2WU3A 3WA6A 2QZSA 1NVEA 3V4IB 4I1PA 4YAGA 4UZBA 2OZVA 5KG2A 1W5EA 3U7EB 3KK3A 3BGUA 1YK9A 1QGZA 4NG4A 3RVOA 4BVHA 2WJ4A 2ZRNA 1UP7A 3OR1A 4I50A 4YB7A 1HI8A 2NO5A 4BV3A 1TFWA 1VS3A 5JO9A 5DHTA 1EHIA 3LWLA 1UA1A 3N2NA 3VAKA 3A6PC 1WD5A 2R5NA 3SOZA 3BHNA 3CC4S 1O95C 2AQHA 2DLCX 2Z4RA 5KAPA 3L4JA 4ELTA 2RHBA 5AHXA 2DH8A 1TFRA 4F86A 2JLXA 4KITB 3SM3A 4EHBA 4DPTA 2PKQO 1RJGA 2O1PA 3BB4A 1OX6A 2QMUA 4MRMA 1UANA 3RFVA 5K0EA 4UY8T 2VLIA 4KJXA 3N5CA 3IODA 3DHXA 2XD9A 1V6HA 1SH3A 1O54A 5DT9A 4I8IA 4PUOA 5CJPA 1UVJA 3SCIE 4PLPA 1U5BB 5F2OA 3HWRA 2ZIZA 4JJIA 2RGDA 3HMKA 2IA6A 4D4LA 4FOSA 3F71A 1AY0A 1V25A 2BV3A 4L2IB 3RVSA 3EOAI 2BMBA 2Y0DA 2AW5A 4FYYA 2P2LA 3PPVA 2CC2A 4M89A 3ZZPA 5DDRC 5IWAF 3NAMA 4LC1A 1L3IA 4PPGA 3K15A 5CEEA 3ROKA 3Q8MA 3TPCA 1FJGJ 4IH4A 4NY1A 3E03A 4FD3A 2AZTA 4OXRA 3EVFA 3USES 4PYMA 3BQ2A 1RI7A 1IKXA 3PBKA 3CCBA 3DXSX 1X86B 4WE1A 5KNBA 3BWXA 4GBMA 1K4KA 4I3GA 4F9FA 1AOXA 2QTFA 2ZJ5A 3T7EA 4S04A 4EA7A 2QG9B 4JC8A 2CV1A 5C52B 3PD0A 1JTVA 4GPAA 3V34A 4DR2B 3LW7A 2ZOGA 3K70D 5LA6F 1A9XB 3M4JA 1BHNA 4BZZA 4HLQB 5EDWA 1UL3A 1T2FA 3IPLA 5JZBA 3RGIA 1VHDA 5BOVA 4P73A 3LA6A 5DNYB 1IY2A 2EKYA 1TC2A 2CJFA 3L82B 5JQWA 1YFKA 2CEKA 5H70A 2V4RA 1JSRA 4ONEA 1D9DA 5L3SB 5CD4A 4DFMA 2FB0A 4MYRA 3FVQA 3AVOA 2V03A 1NK4A 4G9EA 4CKWB 5DJBA 2I6TA 4DA6A 2J9YB 4UAVA 5HANA 3AI3A 2ONJA 5HKKD 2VKTA 2FFBA 2FY8A 1J22A 4PHCA 2HNBA 3BX1A 2QEQA 3GRVA 3BILA 2HJGA 4O1HA 1YU9A 1M5SA 2DQYA 2V5UA 1Y81A 2FD2A 1MN7A 1ZAVA 2QRJA 3N7AA 3N2GA 3UWSA 3QJYA 3A7EA 1PEYA 3BF7A 3NRJA 2GO9A 5LR6A 1VI6A 3VPDA 2JZCA 1NJXA 3OJFA 5LN1A 4FTWA 1Y9DA 4UQGA 1QHHA 2UYGA 1PTJC 2WJPA 4EQZA 3VGUA 4B76A 1B8NA 1ZW1A 4OFBA 4L85A 1HURA 2EIHA 4C1NA 4TM7A 4F46A 3GVHA 4PX3A 2RHGB 3E8SA 2KBEA 1R4ZA 3KOUA 8ADHA 3ZZOA 3R97A 2YOFA 2VG6A 4UZSA 4E12A 5FFNA 4V38A 2PBLA 3NGMA 4X62J 1IUOA 4QJ5A 4EKEA 1RRFA 5IMBA 1Q7LB 3DXFA 3UC5A 3U3KA 2ISSD 1J8DA 2VV5A 4GC7A 1WC4A 2M4MA 1I6LA 1VQSA 1M6VA 2HQRA 2X3DA 4BLRA 2J6HA 3ZNJ1 1QM9A 1J0EA 4CIDA 5TRTA 3ET6A 3E3NA 5J2QA 3PC4A 4F8RA 4RF2A 5JQGB 5DNVA 3PX6A 4YCDA 1PVVA 3HKZD 1CXZA 2O0MA 3MPUB 1U8XX 5AJHA 1ZH8A 4Y6IA 3WQBA 4DL4A 4M5LA 3F6PA 2QVLA 3DHEA 4EPWA 2R1UA 3RFXA 4JI8J 3LBHA 1L3VA 3WG9A 1LBHA 4KXXA 4EF5A 2COKA 1HNVB 2QD2A 4XKJA 5LM7E 3B1KA 3ES9A 1GUDA 2J0QD 2W2MA 2IC5A 3G6VA 2LCIA 1U7WA 4RA6B 1EFUA 4C4OA 4WN9B 4J9RA 1S7CA 4AJOA 2FJXA 5C8ZA 4FOPA 3J7YU 4KNWA 2G1AA 4TROA 3PPIA 1NLZA 3QATA 2XOEA 1VQ8S 1CY7A 2QYSA 4K8OA 3SM9A 2OCYC 4KK3A 5HEKA 4OXKA 4QU6A 4RK0A 4PWDA 5P8WA 2F4VF 1J23A 4UTRA 3LP2A 2E6KA 3BBPA 4YUYA 1FRZA 4F4DA 4NLGA 1HQKA 3AWIA 4RAOA 3A4IA 4XOIA 2A2DA 1O9BA 1QV9A 4DFKA 3FPLA 2R8KA 1L5FA 3ROQA 4JY7A 1G0OA 4B46A 3UT0A 2R8BA 2OO7A 3S40A 4M2LA 1JQAA 2Q5CA 2QQGA 3RJMB 1SL2A 2QRZA 3IJEB 2JIQA 3FZYA 3B1XA 2AZDA 1NWHA 2DKFA 3HCPA 1NE7A 3HPOA 1RRPA 2JCYA 4FNIA 2PX8A 1R8SA 3VR3D 1XL1A 1DJNA 4DLRA 1SUPA 4L8GA 2YNIB 1ECPA 4M0LA 4PYKA 1AGRA 3EEQA 1DFDA 1EHWA 5E9AA 1ISIA 2WEKA 3E7DA 5DLPA 4LYEA 1Q6YA 2RBEA 2W4DA 4YFYA 5LMNB 2QBYA 1F5CA 3MJVA 1Z07A 4QYIB 3WB9A 3UT5B 3GGJA 1IBKF 1VSUA 4A8QA 4NVRA 1JQDA 1DUSA 4CEJB 2WB1D 2L17A 5CB0A 1WJGA 3WL8A 5INTA 1PWXA 2A0FA 4W6ZA 2F64A 3Q12A 4Q0BA 5ETOA 4DLBA 3C8YA 1FY2A 1SC4B 4OI6A 2FX5A 4UFNA 2YVKA 1SUAA 3VJLA 3WIOA 5LU8A 4OQJA 2A5YB 3W1WA 3JQEA 1UXHA 5L4NA 1YZ3A 7REQB 1QE0A 1MOZA 3VNAA 3I3SR 3OOEA 1M7GA 5I9SA 1SBTA 1DBDA 3GJYA 4RGQA 1A98A 1B76A 5CVCA 5J47A 3HVHA 2GPJA 2QXTA 1EXVA 2DFTA 5SZKB 2FWMX 3DV9A 2ZSIA 3H87A 3P5SA 4C76A 1QE3A 3BAZA 2XA1A 1NYLA 2Q21A 4J9PA 4L5BA 2YQ4A 1OI3A 3FIJA 4H4OB 3WLIA 4KB5A 2I8AA 1E1QA 1DPFA 3FZGA 3DZIA 3DPSA 1G5RA 2RT3A 2M3DA 3NCRA 4FNOA 3RRYA 1DRKA 4L4UA 2OEPA 3ER8A 1S8OA 5EN4A 3NXZA 1T2UA 4B79A 4CF6A 4RX6A 4ECZA 2GHWA 4LOAA 3MTBA 1CZUA 3HABA 1OY9A 1NK0A 5B1HA 5KFEA 3S4YA 3G8SA 2WM2A 2WWIA 5A8RB 3G6WA 4YP1A 1S3IA 4HYEA 4QREA 1N5KA 4FBTA 5DI3A 4B5LA 2YJ3A 1CQJB 1FMCA 2BFCA 5GIPE 1YK1A 3EGCA 4UOCA 1T9BA 3NUZA 2YZ2A 3FSRA 1IBLB 2WKWA 1G8SA 1G66A 4O2RA 4R8UB 5DTRA 4OSOA 1UAYA 1B0UA 2VA8A 4BQNA 4TY8A 4TV9F 3G3EA 4O5OA 5BURA 1P2BA 3OPVA 4NPOA 4MJKA 1M2JA 3VVBA 4CCAA 3RKUA 3KO8A 1R8XA 4DR5B 2JFDA 2I6GA 1FDBA 4HN9A 1M66A 1JLGB 2DJ5A 3F6SA 5HE9A 4TVAB 4C6TB 2H5IB 3MGJA 4OKIA 4EBDA 5EE5B 3AR3A 1YX2A 4FT4A 3EPKA 1ESEA 2HJVA 3GB9A 3SIXA 4CMBA 2RC6A 2A2ZA 1FBTA 1YQXA 3S55A 1FRNA 2OZKA 1Q78A 3SCKE 2VZLA 2XO6A 2XE6A 3OBIA 4I7EA 4QQ8A 5DMXA 2HR1A 3VR1A 2GYUA 2DBRA 4E6EA 2W7OA 1HQYE 5FBZA 1RTJB 3RU0A 1YJBA 4P7FA 3VHXA 4CN9A 3C3MA 4D74A 3TZWA 1VMEA 1IWGA 2NTYC 1S0OA 2RGYA 2WUWE 3MGAA 3VTKA 4JI6J 1DX6A 2NZVG 3P52A 3ESCA 2GFIA 1XMOJ 3QVGB 1T02A 4EI9A 4KQGA 1X0FA 4DS5A 1KONA 1FYVA 3FI0A 1HNWB 3MXTA 1O3YA 1Z4LA 1ULTA 2E6UX 3UYLA 2I0FA 3IDQA 1YGYA 3Q5DA 5FUYA 3MWBA 3WNDA 2HIHA 1PK8A 2GN0A 3W6ZA 4GXNA 1U2CA 1FIUA 3G8DA 3QPVA 3T15A 4JK3A 3MWGA 2BEWB 1HNWF 1RR6A 5D5HA 2VG7A 1LWEA 3FMOB 4J9OA 4DV0B 1IR2A 4DSKA 1ONOA 4TKZA 2Q5EA 2HFUA 3PFFA 4JC0A 1AHNA 3H0CA 4DMHA 1PT7A 4DV7J 4LF2A 3A4YA 4YP7A 1EUCB 3G0IA 5IQQA 1YL7A 1RWVB 2VJMA 5DFAA 1RYEA 4FYPA 3LLUA 1UW9A 2VQ6A 3TOQA 1VQ7S 4UNQA 1XZDA 2WDPA 3GJXC 3F56A 2TMDA 3LOUA 3PC7A 5ARDA 1YZFA 3L18A 1U3FA 3HLTA 2GHQA 1RT6B 3UK2A 1V5EA 4DBQA 1WEZA 4K6OA 1XALA 2U1AA 3ICOA 3CIMA 4UJ5A 4G85A 1E1NA 2F6RA 1NZFA 1A9ZA 1II9A 4HEA6 1SU4A 1TA9A 1N1DA 1BE8A 1N2OA 2EGGA 1EFPB 2RD2A 4ZDNA 3D7SB 4HNRA 2X58A 4CM9A 5C0OE 1Y5RA 3DAGA 3IAM6 1VRTB 3URKA 5DQGA 4IXNA 3FTFA 5KFUA 4C8MA 3W9SA 2J0QA 3GRZA 4CM9D 3H5YA 1UEUA 1T05B 4MPRA 4ECTA 1ZIDA 4NV1A 2YJ5A 3W78A 4M49A 3DUFA 3Q89A 5D3KA 4OLPA 4TMTA 1KWMA 2GW8A 2ZYAA 1WWHA 4P5PA 4I50F 4B31A 3H1FA 4UE3S 2JVKA 2YWWA 2PPLA 4LX0A 2Z3ZA 1MNAA 3KLHB 4GM1A 2H4ZA 2C2EA 2B25A 5BV1A 1Y80A 5HPYB 2V74B 1M1GA 2XYGA 1AZSA 1MDFA 3E7WA 5D01A 2CFTA 2R47A 1U5CA 4HFNA 1U0OC 1JXOA 3EWAA 1VHIA 4F0KA 1UJ6A 1Y6GA 2ASDA 3GIMA 2KBFA 5M2RA 2EVZA 5FNZA 1VLLA 2JFGA 3W5YA 1WABA 4BNTA 1V43A 4CF3A 1XCBA 3S0JA 4YRDA 5FTWA 1JG3A 4JVSB 3IIIA 2RCNA 3FDZA 3GJQB 4PFJA 4ZOEA 3THSA 3MAAC 1CYEA 5KJFA 3NNHA 4M9UA 4Z2YA 2NT4A 3MN1A 2ZTUA 4G4SP 2Z1NA 2BBWA 1OBCA 2Z5VA 5HO4A 4MR7B 4BC7A 5KFDA 4Q45A 2O2ZA 4FXVA 3A6HA 4JUFA 1U1PA 4I4TF 4NHOA 3OJ0A 4EITA 5K3SA 2Y6VA 1Z37A 4B47A 1IJEA 2HDWA 3TCNA 1JXVA 1IE3A 4IIDA 3T1YF 2R84A 2AP6A 1ISHA 4LBYA 1RK8A 5GOZA 3HFGA 1HZZA 2WIJA 2ZNYA 3HY6A 1SZCA 5JSQA 5KKAA 2YICA 3I9MA 3IR6B 3RG6A 1YIAA 1FJEB 1NHUA 2Q79A 4G0WA 1NFRA 3OE7A 5ALUA 3OIFA 3NGDA 2YNHB 3MUFA 1M5UA 2ATEA 4LFAF 4ZPJA 2P7IA 2HBZB 2QMOA 3D6FA 1RBOB 2VDUE 1U90A 4KE9A 2CQ2A 2V0CA 4FQ8A 4REOA 2RI1A 3F5SA 3O4RA 2O06A 1RKUA 3MM7A 1RAEB 1SQ6A 5JXHA 4DXAA 4EHFA 4WEQA 3W7AA 4JOUA 3DTVA 3HBNA 1JJ2R 1REGX 2UUAF 4Z0PA 4ETNA 1TQ2A 5IAGA 4Q03A 4QDKA 1PCXA 4WW0A 3R8FA 3EZLA 4CLEA 2H1VA 2YJ4A 3KUCA 3LUBA 4D9EA 2HPVA 3J7A1 2DUJA 2QQFA 2FC9A 1T9WA 4X71A 1V37A 3GHHA 4ND7A 2UXDJ 4B2IA 3WY9A 4EA8A 1OWLA 5FWYA 2CF6A 1RE1B 3SXUA 2V3WA 4GD3Q 4YRAA 1VOTA 2NTJA 4OATA 2EVWX 1NKEA 4DG1A 4BNDA 3M8PB 4Y2XA 1OZFA 2VT6A 5EXXA 4FDLA 1CUSA 2C07A 5CIYA 2DGQA 3PY8A 3PDCA 2HH9A 1QF6A 2I0XA 4M53A 3SJCA 4FF1A 1BWSA 4HYKA 4MTPA 3FSGA 2FZVA 1G7TA 2M8DB 2G5TA 3JQQA 1GTJ1 2O0KA 3QFTA 4FCTA 5A3QA 3BEGB 3T5JA 4Y7DA 1I94J 4XJVA 5LJIA 3L6OO 5EZYB 3CF5Q 4IM7A 1BHQ1 1C9YA 4Q7LA 3QLTA 1UKYA 4IEFB 4LCEA 4NNPA 3QVJA 4CTOA 1DLIA 5ER9A 1SG0A 3P96A 4P08A 1TA4A 5A03A 3Q8SB 4FFNA 4LYDA 4YC7A 4Z99A 1E2LA 4FX2A 3CF0A 3JD3A 4HQKA 4BAZA 3HRIA 1T1SA 2ZH2A 4Q9HA 5B0CA 1Q14A 2QLFA 1I1HA 1CE8B 1J90A 3ULKA 3ANSA 5DM6Q 1GRQA 3M30B 3EA4A 5HP4A 1QIHA 4DVJA 4PGFA 1LDNA 3IG1B 2DKNA 2C4WA 2E7XA 2BI4A 3FTPA 3NCQA 4LHVA 3K09C 2VUUA 4B3OA 2W2OP 2GBGA 2NXEA 1H6AA 1I2BA 1T5SA 4X6UA 4RBUA 2WRMA 2BOAA 2W83A 3KKKA 1NI4B 3HJRA 2G5CA 1YQEA 4BN0A 1YZGA 4TTSA 2IRUA 1DWUA 2A2CA 4UU0A 3MS7A 1HLGA 3I76A 3UDVA 4E13A 3ETOA 2QX0A 3OSUA 2FDXA 2GJSA 1HBNB 4JT8A 1BDIA 4A8SA 2H5EA 4XYMA 4R83A 5JI3E 2QN1A 1GOTA 2JD2A 3OCXA 4B33A 4K3UA 4EQ6B 3KKMA 3M1VB 4Y00A 3UE2A 4JYBA 4I2QA 4AZ3A 3EFOA 3D6UA 3MMBA 3QKTA 3PA6A 2KYXA 3Q85A 2OAEA 2PGDA 1O97C 3NHUA 2ZK7A 5EE9A 3VISA 1QP4A 2V7UA 4GLLA 5EWLB 1NQAO 1JR2A 2VYFA 5TQ2B 1IOVA 4DRZA 1NBOA 3NMRA 3C1TA 3MPUA 4C8NA 3AUTA 2I9PA 4X20A 1R10A 2VYCA 1N6NA 2WB2A 4HXYA 1E3SA 1R3NA 1IQUA 3I34X 3AA9A 3OA0A 4PYLA 4B3JA 4WZ6A 2HXGA 2TMYA 2HAFA 5JAMA 3NGXA 2CD9A 1ETHA 5DM4A 3VU9B 4ER6A 4C3UA 2OQRA 4ZOCA 5EJIA 1QS0B 3OIVA 2CF5A 4ZVGA 5JNRA 4UEKA 2B5OA 5CX1B 4KQEA 3EMVA 2FYXA 3OE5A 1PBAA 2ZYHA 3DKKA 4FKYA 1EP9A 3LP5A 1E8DA 1QFYA 3T9BA 3CT4A 4LF7F 1LDBA 1MG5A 3DLGB 3HO6A 1XZGA 2AZ4A 2DBVO 1E2KA 2C42A 2FZKB 1KPHA 4EHIA 1HARA 3P9CA 1S77D 1YJQA 1CDDA 3GPCA 4NBWA 5FPPA 3I2JA 1OIVA 1Y48E 3W06A 2Q8NA 3HWWA 3HSGA 2QTGA 2B78A 2JHFA 3GJ7A 3MCAA 4OXIA 2P9TA 3TLXA 3AXKA 1RAIB 2YV3A 1BVRA 3GRRA 2DHDA 4KR7A 2O8CB 1LC0A 1N9KA 5HMWA 3ACDA 3GK3A 3LO8A 1N36F 3ANNA 4TV8F 2O9JA 2E21A 1EFRA 2Q2QA 1CUHA 1UC9A 5CHCB 3QHAA 1TYEB 3OJLA 3NEAA 3G89A 3MYYA 2RKIB 2GPNA 4U7UD 5M04A 2W8LA 2R6FA 2M98A 2FZEA 9MHTA 3OZXA 3IVMA 2AUTA 1OXMA 4CLDA 1FHTA 1TZ0A 1DC5A 1LQTA 1CS0A 1X14A 4AJKA 4M7PA 4H31A 1UZNA 2KB2A 2KM8C 4BBJA 2EJVA 3PGKA 1M5TA 1T1JA 2VG5A 3WYAA 1B23P 3ILHA 3ECSA 3PRJA 2FPPA 1PG5B 2Z09A 3MF4A 2GA8A 5E7JA 4B6FA 3U4QB 4IFEA 2KS6A 1KO5A 2INGX 3I6IA 1N0IA 4HX5A 2GMWA 4CT5A 4EPRA 5IV4A 2LP4A 1PX2A 3D3QA 3QNMA 1RLJA 2PT5A 4ZMSA 2D9OA 5KTSA 2JGLA 3FUWA 5EJ9A 3NWOA 2OXEA 4GX2A 3O3LA 1SGWA 3LVRE 1D6SA 4IX9A 1LKZA 1EK0A 1JDBC 3ZWXA 4Y1FA 1WG1A 4NJEA 4UDNA 2OK8A 2YZ7A 2QVZX 4JI5J 3G96A 4IYRA 1Z5VA 2WK4A 2JIPA 3WGZA 2NUHA 4ZQIA 3BQ9A 1BA2A 4I9FA 2V3VA 5KHOC 2Q5OA 3TZLA 2QU8A 3IT1A 1G3QA 4NLWA 3U7FB 3JATB 4DV6B 1W36B 4E6PA 3KZMA 2GFHA 4ENOA 3CPHA 1QG0A 4IV5A 3SEAA 4B4WA 1N7HA 5F8IA 1WPQA 2YWBA 2Z8XA 1L3TA 1A5TA 1GKYA 3VNVA 3Q72A 3BR9A 4I3HA 4WK1A 2D3TA 5CD9A 1S1XA 4ZLJA 4IKEA 3PEWA 5BR4A 3QHQA 3VPAA 2CJWB 4EL0A 3HNRA 1QFJA 1KFDA 3JD0A 3GFPA 5HVGA 1P29A 3QGMA 4PXAA 1FTQA 5DNWA 2CDNA 2KPOA 1SC4A 4K6MA 3CNHA 1IN5A 5BOSB 3F1LA 5EIHA 3MQ2A 3A4TA 5ALOA 2W4CA 1YZNA 4IEEA 3L3CA 2V65A 3ICEA 1CJSA 3KHRA 2OTJS 2XKJE 1YUNA 3HXMA 5CH7B 2VQEB 1NDCA 1AF7A 4OHPA 3BB3A 4P3NA 2XS2A 3NWRA 1QG4A 3RWMB 3QGPA 3LF0A 2QA4G 2C8VA 3KK0A 3RV3A 1PILA 2D3ZA 3DV2A 1I4OA 4GI3A 4RD0A 3E9NA 1K92A 1SVLA 3THYA 1EA7A 1E6UA 2GX6A 3FTCA 3OD1A 1KQFB 3VVCA 4WCFB 5T3UA 4JBHA 1BMQB 1X4BA 2YW2A 4Z2XA 1KD1T 5E5NA 4RSGA 1Z2PX 1VHJA 3BPSP 1TM7E 2JHCA 3K6RA 5GOTA 2G4VA 4AJHA 4BJ6A 1EK5A 2MHEA 3J80U 1THTA 2W6OA 2FTRA 4WFNQ 1F0PA 2WKQA 3EXYA 4X8HA 3B7GA 4ZAVA 4O2BA 1GTHA 5DWDA 1QANA 2XMZA 5LQDA 1E64A 3F3MA 3EOBI 3LW8A 1OPIA 4GM4A 3LQRA 4L9WA 4PC3A 2ENWA 4RUHA 1RDFA 1PR3A 4EPTA 2A1UA 4ZODA 1PG2A 4WAUA 4UVGA 5D1HA 5F5LA 2ZJ7A 1NJ6A 3QEMB 5EKUA 5JSYA 2C00A 3R74A 1WC0A 2GIQA 4UQOA 2WD9A 2D3OR 2PE8A 2HSWA 5C2JB 4DWOA 2QUHA 2WVFA 2PH5A 3VDMA 1UA0A 2BRKA 1M6HA 3X1WA 3U44A 2VHXA 1HT0A 1XKLA 1EK2A 1MVNA 3S70A 3IO1A 3KKPA 5KT5A 4RUCA 2BEWA 3IWLA 2QRRA 4LJ8A 4XEHA 2GA7A 1YFLA 3PHIA 1JTFA 2QA4S 5KYUB 1MJFA 3BWCA 1D2EA 5ETSA 1NF8A 4BO0A 3O74A 4CZ2A 3QQCD 5DK6A 2ZYVX 4UAJA 1DFIA 5C4IA 6AT1B 3HM2A 4IMRA 1PL7A 2UVVA 4DDWA 2ZI3A 4LV5B 4DAEA 1L9KA 4NFYA 1Y34E 1ZU5A 5CQGA 2FSIA 1SXJC 2HNAA 3FKSD 5DCYA 2FLVA 2ONCA 1YJVA 3WL7A 4OZ5A 3KHSA 1RBQA 4OLOA 4LOHA 3C5CA 2RD5C 4C2AA 5JYCA 4RUBA 3BH6B 1BOFA 4ZU3A 1Z4NA 3DD5A 3AOGA 4YJGB 2VP3A 1NNLA 5BJRA 3M2VA 4QECA 1IXKA 4Y65A 2A7QA 4MQEB 1Q1KA 3UGQA 5KQGA 4IHJA 3TL6A 5AE3A 1BEEA 1XTTA 3H8JA 5EYPA 1CB7A 1RXOB 4RENA 2JFVA 2CYBA 5GZ1A 1T05A 3G5MA 5TMEA 3JWIA 1XN4A 1ORHA 2IDZA 1SCDA 2W25A 2Y3YA 1BX0A 4A16A 1RADB 1C1DA 5FEUA 1JLRA 1CD5A 2YKAA 5LSOA 2BVZA 3JQAD 4DV2J 3SBDA 1M73E 1XP8A 4ED4A 2QVYX 2BCEA 4ARCA 2DPGA 2YPZA 4UQTA 1CB0A 3DKIA 4KLAA 4RW4B 2XUAA 4ZO9A 5AI6A 3AR7A 2V9CA 4N7TA 3DMTA 5KFTA 2QM8A 4QLAA 1NK5A 2OO4A 1LI7A 3ETDA 3C15B 3LE8A 1TEHA 1MN6A 1H23A 3K2EA 5MN4A 4DV2F 3NTXA 2O1XA 1E3TA 3DYVA 1XTVA 4X1IA 2HVHA 1TYZA 3OL9A 3KLIB 3IC5A 3MI7X 3TGPA 4OLJA 2QSJA 2H00A 4EVIA 3WFZA 4RL1A 2W2TA 5CFZA 3MT0A 5KC9A 5L3VA 2MCFA 2X22A 4DZRA 2N7CA 4R1SA 4DMKA 2ERYA 2QO3A 2PZFA 4F0HA 3UN1A 1MXHA 1L3BA 4KGXA 3KPJA 3UAWA 4X66B 2PT7A 5EX3A 4CMIA 4HGPA 1JT9A 1G5HA 1RP5A 4KGKA 4QICA 4D8UA 1EARA 2DNKA 4YACA 5F2EA 4Y0FA 1E62A 2ODQA 2XE7A 4RVSA 1Z38A 3GCZA 3H3JA 3HUEA 1K0TA 4OQQA 1GFZA 4NI2B 2HQCA 2JFNA 1VLQA 2O2SA 1A8SA 1Z16A 2JARA 2ROPA 5YASA 4DMGA 4BKQA 4F91B 5HKKA 2HW3A 4EHLA 2QG9A 4Q4AA 3AD7C 2C0PA 4D9GA 3RT7A 2B1IA 2RHDA 3NHFA 2QUAA 5CR9A 4V0OA 1GQQA 4L22A 1U0SA 3K0BA 2JIZA 3RB4A 4HAXA 1CUDA 4Z9BA 1U0LA 3L49A 1X1SA 4KFSA 4K0KF 3RVKA 4BNXA 1UWVA 3IUNA 4MR7A 1P2FA 1GFWA 1WC5A 4BQQA 1UFWA 2DHGA 1FFWB 5EHIA 1I0IA 2BFEB 3IVAA 1MGPA 1Y0HA 4BWVA 1D0VA 4HWRA 4RE6A 3AXSA 2FPLA 3HRKA 3GCGA 2ECOA 3RS3A 1ESMA 3OUTA 5BYQA 3A6ZA 4CKWA 4NE9A 4ED6A 1GUZA 3K1AA 1AQ6A 3UJCA 1HYGA 4LJ5A 5NULA 1XTKA 3IO5A 5LNK1 1UKBA 3T6BA 1U6KA 4DM7A 1JQ5A 3I9V9 1IAVA 2WYHA 4ETIA 2WM9B 2YNMA 1VG0B 3QVSA 2EHDA 2AOVA 4DL5A 4C0KA 1P4RA 4AUNA 4MT1A 1KF0A 1UBNA 3KLGA 4RV9A 4IG0A 1H05A 3CC8A 2VYNA 3LKZA 5AVRA 5IJ9B 5JPCA 1FUEA 1YVPA 5DDPC 4Q37A 1WUTA 1WE2A 4ABTA 3JRWA 4EG7A 2I34A 1B4SA 1G5QA 1OH8A 3BDPA 4DR1F 3GFTA 4TN2A 2WSBA 5LP6A 1XCGB 1MG0A 4HPXB 3O9MA 2CYCA 2I6QA 1JH9A 1R0BA 1ECLA 3K9LA 3ND6A 1FRHA 2DD8S 3RYCA 3NHMA 2WWXA 3GZNB 3CJ2A 1U2SA 4HBZA 5C3MA 2LYVA 1PJZA 1ZUNA 4FSHA 4UDOA 4X85A 3I04M 4CLRB 3HCXA 5AP9A 2DQZA 4H4DA 1PFQA 1Y11A 4J0KA 1L5RA 3TVYA 3WBZA 3V2UA 3A8JA 2G4BA 4KDFA 4BTEA 2UYCA 3EEOA 3TEFA 1JEYB 1GM5A 3MM6B 2I1LA 3H5UA 3RAXA 1N5OX 3TOSA 4LXYA 4GX0A 5B30A 4D9CA 3NZEA 5JNUA 1A76A 1VC2A 3ZGVA 1S49A 4XD7D 2W8BA 4YPFA 5DTIA 4WSOA 1XPUA 3ESYA 4ARVA 3JZAA 3IR7B 2N7YA 3PZPA 1GR1A 3EZ9A 3BAFA 1COWD 4DV6F 4CM8B 2JZOA 1L5YA 2UVPB 5DBEX 4NR0A 3B1FA 1CDZA 3FBFA 3NHYA 4DB4A 3ICVA 3DKVA 2ILYA 5HVFA 3HZOA 2C9ZA 5KYWB 3WAJA 4Y2VA 2BH2A 2FW8A 2BGUA 4WDRA 3F5FA 3EMBA 3RQIA 1V4NA 2LEPA 2AQIA 2CUKA 4RF4A 4DJFC 4DI6A 3U16A 4AZ3B 4XB1A 4QIWD 1XQ9A 2GEKA 3JQCA 2QGZA 5ILGA 2Z6QA 1RBZA 3J81j 4MLDA 3REQB 2FJUA 3UH1A 3HHEA 5KI6A 4KRGA 1MC1A 1OFUA 4BIMA 5FBQB 1AUOA 3BWMA 4I5DA 3VGJA 4H16A 2EDCA 4BGDA 5IX8A 2ETVA 4PXEA 3IR7A 1TB4A 2GX8A 3LT0A 1KAQA 2I6WA 2XMKA 3K31A 1XCMA 2ECFA 1AUQA 3T1TA 1RQ0A 2GV1A 4FDTA 4OK6A 1IHDA 4NPAA 3NU1A 4IIHA 4ZI7B 2QE6A 3SN6A 1E2BA 4X63A 4NE9C 3RJMA 4S12A 4IO0A 4K8RB 3G6KA 4ELUA 1R0KA 4DF8A 5EKTA 4EM6A 1RS0A 3HJHA 3CE9A 1OASA 4WX2B 3KZCA 4L78A 1ZK1A 2VQEJ 3AJ2A 3RVDA 1R18A 3AUXA 1LQUA 2CSXA 2GERA 3U81A 4YRKA 1N9GA 4HJRA 2PKCA 4RD3A 2ILVA 1TJ5A 3VUEA 2K7FA 1U9IC 4DQUA 1VB5A 5HUJA 1DBSA 3T7CA 2GTIA 3CMMA 4NABA 1P7WA 2BJHA 2I7XA 3ENZA 4M0CA 2CRLA 3PWSA 1E96A 4FFDA 3W2VB 1Q7RA 4A73A 2IYXA 3AONB 4J29A 5T5QA 2VBZA 3MCNA 5ULLA 1Y7IA 4NBUA 2HQBA 3AVQA 3M5CA 3TOCA 5IUKC 1HFWA 3L05A 3WL6A 3QU2A 2W2LA 4B8YA 3LCJA 4KFUA 1U2DC 1GL6A 4R3WA 4AIIA 3OXLA 4E4TA 3NJ4A 2NZCA 3M6VA 3U3ZA 1LTHR 4X3CA 3QTBA 2ATLA 1U80A 2AS0A 4ECRA 2FZKA 4MJLA 3G9TA 5JRZA 3D1QA 3MFYA 1B2RA 5F1YA 5HIJA 3EPPA 5IZCC 3OTOB 4C29A 2GEUA 1BEUB 4RZXA 1NURA 1PTJA 1ZAKA 3BSSA 2R8HA 2CXUA 4HEQA 4Z4QA 1KR2A 1UF9A 4CI9A 2O7NA 1S2OA 3IUYA 1Q16A 3LHSA 4ZYXA 2MINA 4ROSA 1VLMA 5IT5A 2PZAA 1P9RA 1RT2B 3DOMA 2BEUB 1M1NA 3ZQUA 1RMQA 3BSNA 4NQZA 2ORWA 4P35A 4Z7QB 2OR3A 4A82A 3DFFA 4CT4B 4MKFA 2I67A 1ADCA 3MM5A 4J3FA 5KAMA 4F72A 2PSFA 2M6RA 1QFSA 5EWMB 1O6XA 3ABRB 4G8CA 3PPXA 1AMOA 2EZ8A 4KQHA 5D51S 3H2LA 2QX6A 4Q3AA 2H85A 1FWKA 1M2NA 4F4XA 2CZQA 4H1HA 2AMCB 4JL8A 1PNVA 1TZCA 4RY0A 1KJQA 5LYJB 4X61A 3D59A 4JJAA 4ER0A 4HQOA 2JIDA 1VSQA 3G8TA 5IM5A 1IULA 2C9DA 2PMDA 5IT4A 1AG9A 4HJXA 4URUR 3PXAA 1IQPA 3CPSA 3ESAA 4LXQA 1N6HA 3KB1A 3EN0A 4XIYA 4OQXA 4NV3A 4I4NA 2VQFB 4AG5A 2RGGA 2EGUA 4BMNA 1ORDA 4W7HA 2KHCA 4OZ2A 3L0IB 1CUCA 2PRKA 4IDOA 3PIDA 3M6XA 1DI0A 1XEZA 1H2HA 4RKRA 1WLYA 4LJAA 5E2AA 4QFCA 5EJFA 1IK6A 1EWKA 2VP0A 4LISA 5AM3A 4EZBA 2OM6A 4PAGA 2LUOA 1TM5E 2HW8A 5JY1A 5E3CA 3ASUA 2A9KA 3R5CA 1QTRA 5K0SA 4FB4A 2HNKA 3PDIA 2ZAMA 3L46A 3U09A 5KSOA 5TY0A 1KRPA 1MHTA 4C4RA 3V8QA 2KXNB 1S97A 4TYMA 3C5HA 4BNVA 4MROA 1WMFA 5ETVA 3NT5A 1LPBB 3LY5A 2QN6A 2KM8B 1U48A 1G5PA 1NEEA 4CT8A 3OG9A 1XZEA 3VAFA 1EI9A 5IG2A 4DZ6A 5AJ3F 2PZBA 4LF6J 4AXBA 5BRJA 3I4HX 1IU9A 3RFUA 4E7OA 1YXMA 5TX7A 2XGSA 2AMJA 2Y9MB 5GPBA 1TQHA 4F96A 4DV2B 1CF9A 1XRJA 4J9LA 3I0SB 1TI7A 4LXUA 2CXSA 1G7CA 3BG5A 3OQHA 1E1DA 2AJTA 1K1EA 2FGJA 2M6SA 3JYHA 2XRFA 1KSPA 4LK3A 4D5EA 3F0NA 4A2CA 4CUJA 2N47A 3PKZA 1WG5A 4JL6A 1PFUA 2OZLA 2ID9A 3GX1A 4DUZF 2RIJA 5IKMA 3RR8A 2GFFA 3WMWA 1V9LA 1GTG1 4F7VA 5LUAA 4YECA 1E4OA 4LSNB 1E2PA 3DKRA 4WNCA 1J99A 4DL7A 5FOVA 3V7FA 4DG8A 3EYAA 1K3FA 1JVNA 1WSDA 1JEDA 1TMOA 1YS6A 1C9DB 2CN1A 2WU4A 3VAIA 2EBFX 4UOZA 1ECBA 1X1DA 3ITDA 4X66J 2QRVB 1ES9A 4PG7A 3QG1A 3QKWA 4G89A 4DSOA 1Z4KA 4V1Ak 3WISA 2PZLA 2KE5A 1L7OA 2WFAA 2QMQA 1ADYA 4KVZA 2HA2A 4N4AA 1ACJA 1NHKL 4UEOA 3OUYA 1E1CA 2JC3A 1RIFA 1KRXA 4CQJA 3UHPA 4LRYA 4HADA 1SD5A 4BFTA 1J21A 3DDUA 1N2ZA 2D06A 4C05A 1A72A 1G2PA 1DEOA 2BLNA 1EXDA 1UZDA 2QUJA 2P68A 1OJ4A 3GFYA 1V5FA 5HUHA 2ROEA 2R7SA 1ZBDA 1E6CA 3CLTD 4BLVA 4GECA 3BV8A 1MO4A 2RKOA 1V6CA 2ODEA 3GILA 1NX9A 3AM3A 4C04A 3EPLA 3ZHYA 2H2DA 4X4SA 5T8KA 3SOPA 1TLLA 1DP4A 3KR9A 2EX1A 3OM0A 5H81A 3TIXB 3NHPA 1N6IA 2Y9HA 4F67A 3UD5A 1T9CA 3E5MA 4XR9A 3V4IA 2UP1A 3INNA 5DKFA 1JL3A 4GP6A 1O0SA 5B0FA 3VR4H 1JIHA 2BANB 3RC2A 2AN5A 3CMES 3DMYA 3I9OA 4B83A 1OH6A 2QN2A 2XUDA 1QGUB 5BN1A 1XBTA 3L0DA 3UR0A 3W2GA 4HX9A 1AGYA 3ZQKA 2OQ2A 6FD1A 4Z4GA 2ZPAA 4DWJA 3EGXB 2QKYA 4QDTA 2P7HA 4EF4A 4O3PA 3D3BJ 1I1GA 3A25A 4PIVA 1U1DA 1QB8A 5MAOA 1J0DA 5TJ9A 2GO7A 4FJ1A 5CNKA 2CCJA 4LHXA 1LWFB 3BZUA 1E32A 3DH0A 3ZY2A 1JIUA 2JJ8A 1QX4A 3NIFB 3H4DA 3KPWA 4MTLA 4RKQA 3RAGA 3QE2A 4G1MB 4CU2A 4U0KA 4TVSA 4JIMA 1NVVR 2WSSA 3IOBA 4UDXX 3BGOS 2G07A 2Z58B 3ROGA 3PQ2A 4Z9FA 3PXBA 1OJLA 1JJIA 4YO7A 2Q1TA 2F3UA 1NA5A 5G4KB 2LNDA 3SDZA 1UT5A 1GTZA 4PU0A 2EWVA 4KHZA 1UTAA 2Z56A 5HMLA 1AMNA 1NXPA 5IC6A 5JCXA 2WD8A 1MPTA 2XRZA 1HWJA 2J9RA 4D9NA 1SXGA 4B9LA 4ZCKA 2KI2A 5JSUA 4KYVA 3M3HA 2I54A 3E9DA 3AD9C 4D6PA 1YUBA 2QPTA 3DL2A 1MDBA 1AZWA 2PLFA 1XU9A 2Q6TA 2XA2A 4KQJA 2D1SA 1LJLA 2W2NA 4LZPA 5BW5A 1UPMB 4U7FA 3EAFA 1VQYA 2HQ1A 4P2MA 3X1DA 4MW7A 3K70B 4I69A 4JXJA 1GPUA 3SR0A 1BIFA 3K8QA 3L6EA 1RAFB 5HQ3A 2EQ5A 2VQ3A 2IUTA 3BGFA 2P1DA 4GMDA 1RWXB 1RT9A 3NHRA 1E9AA 4X62F 1MJGA 1EH5A 5BY2A 3ZBQA 4E14A 2XE8A 4DANA 3RYTC 1YIJS 3L7UA 2DGSA 1XMQJ 1B6TA 2R2SA 3U0VA 4A2WA 3WLHA 1P0PA 3S2GA 1VIXA 5HMXA 5B3AA 4HDAA 2YXLA 1EPUA 1NMEB 4KG7A 2BBSA 4QUBA 5FD8A 1V1RB 5FJIA 1I80A 2H1LA 3FROA 5DO2A 4J94A 4QODA 2GN6A 1CQMA 2ZOMA 2C1EB 4XJTA 3NS7A 3CA8A 4J76A 4XIUA 3HR7A 2PH3A 3K5PA 8ABPA 1QHHB 2XNSA 2VDVE 1YMVA 4X7MA 1M2OA 3WIEA 2QYCA 4DNOA 2IA0A 4II3A 3ZDYB 5DE3A 2GIRA 2OV3A 4BYGA 3QFHA 3KYJB 1ZXXA 3G8YA 3OQJA 1WULS 5HKBA 4I9NA 4LBHA 3CW9A 1S99A 4ZU6X 3FUCA 3JD2A 2GTHA 1IEXA 1JPJA 4HRVA 3RU2A 3RJTA 1JDUA 4FMBB 1YUMA 2L08A 1VQ5S 1FFSA 5HQ8A 3AEQA 1KRHA 4ZVRB 1NTRA 4NZ6A 2VRNA 1I36A 4B3DA 1Z5UA 3CZ5A 2CAJA 4FNAA 5LZ8A 1DL5A 1JG4A 4EFNA 4C7XA 2EPIA 4P0TA 1MW8X 1W4RA 2XQKA 1TUIA 3IG1A 2A9PA 4HB2A 3HVWA 3D31A 3M8RA 5M29A 1VJRA 1HDCA 3E7XA 1C7JA 3EICA 3B20A 1VOMA 3QU5A 5JS1A 5E6RB 3CLTC 4Y98A 3W5BA 5J2PA 4Q9IA 2EKDA 4P32A 1T8RA 2MKKA 1A7GE 3L8MA 1X9IA 3ZR4B 1Z28A 2PMZD 1KQSR 2XY5A 4UOEA 4KODA 2JNWA 1GJRA 4RNDB 2H1SA 3GT3A 3Q3GE 4DFJA 2R8GA 2Z5FA 5IYZB 4IFVB 3A9WA 4RXUA 2QLTA 5KYXA 4FZJA 4ZVRA 2ARKA 2VZEA 1REQB 2W2KB 5JNSA 4U7GA 5KDOA 3ACCA 3QMVA 2BKAA 2VK8A 2HAEA 4JYPA 4IR9A 1KJJA 1Y9EA 2WOMB 5BQXA 4ZMMA 4BNUA 4RJJA 4Y2AA 2QPOA 4BPRA 5C9ZA 2V7GA 1H2VZ 4DR3B 3LPEA 4FFVA 2QT7A 4F4UA 5AVQA 3IH5A 5A1TA 1QVRA 2JLSA 3C2QA 1GGVA 4W4MA 1KSFX 3M82A 4EKYA 1FRQA 3HDSA 1ZONA 2RH8A 4YHBA 1I2ZA 2IBSA 1C3OB 2UVPA 1E8NA 1O03A 3GV8B 2WYWA 5M5BA 1SG9A 2ZJ0A 4KX5A 1VK8A 4LVCA 4QOIA 4EO6A 3LT5A 4KY3A 2DHAA 1I8TA 3D02A 1EGHA 4IH6A 5KFNA 4ESEA 1DXQA 5A8KA 3IIMA 3G17A 3DLPX 4EQ6A 3OOSA 1MMDA 4JBIA 3VAHA 5HK8A 3PXDA 2DR2A 1M2FA 4NZPA 4F4IA 1YR9A 1EBUA 3R5GA 1IBMB 3GTYX 3HKDB 2I33A 2E66A 3UK0A 2H2WA 5LQSA 4M37A 1IXYA 3TTTA 3FHJA 1EWQA 5JAOA 3KVRA 1Y4ZA 5E4YA 2DXIA 2B6NA 3GYNA 2MYFA 4ZV7A 5BWBA 5G1OA 4TYNA 4A10A 4L6V3 4Q48A 3ND5A 1GNPA 3OZWA 3RCBA 4ZXFA 1H6BA 4QVKA 4LFAB 1ZC3A 3RYIB 1I4DD 1Z22A 3EW7A 4B3GA 2QORA 4Q1BA 2E89A 3GGSA 2CL0X 3UR3C 3K5NA 2GO8A 1QCCA 4EUEA 1BXZA 3FGOA 3U9SA 1U0GA 3PF8A 3EPIA 1XHEA 3HYRA 3B6EA 3ZBTA 1KQGB 2Q29A 3G0BA 1KI8A 3QIVA 5BN4A 4C87A 3ABOB 3ABZA 3VR6D 2XV1A 2OEJA 2V7PA 2IH5A 1TEXA 1MX9A 5K20A 2FF7A 1EXWA 3KTFA 1AUSL 4J6EA 4YJ3A 1QZXA 3DDWA 1P0CA 1VLHA 3GUUA 2HXYA 4TUYF 1CRLA 5KT2A 2FCAA 3DEIA 4NE7A 1KYXA 3VR5H 2ZH3A 5IH3A 3ASVA 2IFXA 2HU5A 4E88A 4LBZA 1YZTA 4X7RA 3ZEAA 1SUWA 1S3GA 4AXIA 1TKXB 3Q8UA 4GR4A 1KYZA 4ID8A 4IGKA 1E92A 1IIRA 4D9IA 1BC6A 4L1KA 3RBDA 4IRDA 1SD2A 3HLYA 4DR7J 3OZTA 2F43A 2MDTA 1WOMA 3VKGA 3L01A 3N2IA 2BYCA 1G5FA 4R3NA 3IEPA 4TLQA 2Y0BA 1B43A 4DSZA 1PSDA 4LVOP 4CKCB 1BXRA 3FOAA 3LIPA 5U1PA 4FCWA 4G0UA 2YVAA 1W5AA 4E5KA 4PBSA 4B3RB 1Q3TA 2NYHA 3DRYA 3P6YC 1UPPA 2PAFA 4YAOA 2QPLA 1OS5A 5T7LA 2NVBA 3JS9A 2ZSJA 1G18A 3PFNA 2EWMA 3LAKA 1RA7A 5EA2A 3CT9A 3WK4A 1T5DX 3K0FA 1T3TA 3FCHA 3FEZA 2Y0EA 4HBGA 3X0DA 1B70B 2NXWA 2HSJA 2RVJA 2L18A 2IWRA 2D3UA 4NYMQ 2Z3WA 3CKMA 2FVPA 3O8CA 4ND8A 1SO8A 4N03A 2CJXA 3E9QA 5G4DA 3HI6A 3IULA 2ES4A 1SVNA 1VFNA 1XZ8A 4DPLA 3F5DA 4II7A 1SOWA 2C3OA 3DOJA 5L9XA 3FIUA 2RK3A 4CYUB 1JXAA 1BH2A 3HCNA 5BUZA 3PJGA 2P69A 1H98A 3BXOA 1JHUA 4DJJA 3KS9A 5F8GA 4C5BA 1N6KA 1SBCA 3AFIA 3HM9A 3BH0A 4J03A 5HFAA 2X3UA 2J9CA 3G6YA 3MPYA 1JIQA 1E94E 3DAPA 5AUQA 5AFSA 4KIGA 3E5NA 1I3KA 3CH4B 1VRQC 2HMTA 4O2AA 5KG7A 1ZUIA 4FR0A 1HMYA 1MB0A 4W1SA 2Y99A 3B2EA 4QC2A 1RCOB 1MU2A 2AF6A 5BR8J 2ID8A 4PYIA 5BRNA 4BNYA 1NB2A 1CX9B 2CPEA 3KMSA 4ZIRB 4O8CA 3ZVLA 3KJFB 1QSSA 1FMTA 2ZUEA 4G5RA 4Y2CA 2EKPA 4KJZA 3MCVA 3SHFA 5CG1A 3FM9A 5A5FA 2PFKA 2PX2A 4WCFA 3EQ2A 4CYUA 1CIVA 5DLDA 2I2AA 5TGTA 4P33A 5E8RA 5AKIA 3ME5A 3ZFVA 4FS1A 3K1YA 1IKYA 5ADHA 4HLUC 3RS8A 4NYJQ 2OO5C 1ULAA 4EW2A 1BTOA 1L9XA 2UUWA 5G0RA 1TL4A 2J5KA 2VJAA 3MGCA 3QENA 3ZDXB 4I4IA 5DGBA 3R3ZA 3T9EA 4C6SA 1UIRA 1C0LA 4BN5A 3MQ4A 3HGMA 2NP7A 4EO8A 3WGMA 5DN9A 1B8UA 3OO1A 3O1IC 1JBKA 3E22B 4NCGA 3SR4A 4DIMA 4TUYA 4UCQA 4A23A 1JLAA 2ZWMA 2YNFA 3FBCA 4PZCA 3R5XA 4J16C 1JHVA 1XVAA 3R7AA 2C54A 4N8SA 1VYVA 1JP7A 2C94A 3KVYA 4URXR 5I01A 3UN5A 3WAGA 2EEZA 3VU8A 2NXJA 1M6EX 1IKVA 1KDVA 4N5LA 4MHSA 4QAQA 5JS7A 3OZBA 1S59A 3JAWA 1X7XB 2B9YA 3OR2B 2UUBF 5KVQA 1EP2B 4B2YA 2JFUA 2LFVA 4H7IA 3WBJA 4EAQA 5BSGA 5HUQA 3QV1A 4YUZA 2PV0A 4UMEA 4YB5A 2ADFA 3EAGA 3RKRA 1U9JA 1R6VA 5CT6A 4ND6A 1FYEA 1F60A 4CLYA 1NNEA 5KKCA 2C7GA 2JFZA 4IH9A 2OECA 5IXJA 4ZT4A 4BZXA 1V2HE 3OCJA 3UW1A 2O23A 2CXRA 1J2TA 3ZU4A 2M2BA 2OVBA 3C24A 1DJPA 5CFRA 1R9JA 5KOWA 3ISVA 3OUZA 1UWBB 3QWBA 4NBLA 4UVHA 3X1XA 2DBBA 2V6FA 4P7VA 1G20E 3M1YA 4U9RA 1U9YA 4G1QA 1XTQA 5AW9A 3EDRA 3ELUA 1O94D 3TEMA 1UUFA 4F5WA 5IKPA 1M5HA 3L40A 3PSHA 1OFGA 1N8TA 2V4UA 4L8FA 4WFQA 3BMNB 1EEXB 1ODTC 4L8VA 3VKWA 4I1IA 4DUZB 4DREA 2R6HA 3OJSA 3GWZA 1C3JA 3JQ9C 1WZCA 1LSJA 4AP9A 3VVUA 3FDFA 5EJ8A 1PU2A 2J09A 4YX9A 3GCXP 2HNYA 2ZE8A 2W2MP 2WFLB 1CV2A 2PD4A 1O51A 4FYXB 3U02A 5GJBA 2SECE 4D8WA 4X94A 3AY6A 5DLEA 3PXEA 4D0RA 3EF0A 1HBUB 1W29A 3IL2A 1X3SA 3SSQA 2HREA 3CLRD 1NQOA 4MA4A 2HSEB 3AHHA 1GT91 4R1LA 1E63A 5CA5A 4S35A 1F3VA 1QO9A 3G0GA 4ZQFA 3F4LA 5LZ2A 3KTDA 3WGOA 3AG5A 4RNOA 1G4HA 3IP7A 1BQ3A 2HS3A 4JOSA 3O31A 4I1SA 3KSBC 3PGMA 3AHJA 2BI7A 4BO4A 3ILJA 2DTXA 3E2MA 2HLUA 1JDSA 3UGTA 4YY3J 4IV0A 1BLUA 3DC7A 5BV0A 1GZHB 1QO0A 2B3TB 2BHNA 3BEDA 1R5OA 4TU9A 3UKOA 1ADFA 3PUJA 2E1PA 2HA6A 3LUJA 5AM0A 3PRHA 3RB0A 1N4DA 4JOBA 3G68A 5IZ4A 1KLMA 3P20A 2PEYA 4WH0A 3Q9SA 4MKIA 4BIIA 1GPMA 3T7IA 4L0CA 3DEJA 2CNOB 1BQNB 2KZMA 4AF7A 1KEVA 2A0XA 3S6JA 2C4UA 3ZS8A 1KJ9A 2YKMB 3F49S 1NJ2A 3GA5A 3OLZA 3NLLA 3RANA 2F3PA 4LF8J 3K0AB 1P5RA 3UB4A 1C7ZA 3MAQA 3W3ZB 4CIWA 4RHFA 1MORA 3GWGA 3HDQA 2FHPA 3LP6A 4RIFA 4F1KA 2DFPA 4AF6A 3GEIA 3FDZB 2XMSA 4WACA 2F8LA 3PNQA 3SE7A 4GWLA 2FY1A 1YULA 2WSSD 4W5OA 3T1HF 1S2MA 1J27A 4JQOA 2W43A 1RAHA 2QTMA 1K9SA 1X9MA 2ASYA 2GZHA 2TMGA 1SY7A 1FS4A 4CL3A 4EGFA 3DTVB 3Q8WA 2AX4A 1E9FA 3ZE0B 1FF2A 4UUMA 3PIIA 3IR6A 4AO6A 1CY0A 3QPWA 3AO0B 2FDNA 1V16B 1S10A 4S1OA 3UMFA 4CCWA 2FJ0A 4MO9A 2QAGA 1Y5IA 3U37A 5A1JA 5LXTB 5KOJB 2F3JA 5BSEA 1FX0B 4RPHA 3OH8A 2QV0A 4KO4S 4WASA 2VYVD 1Z7WA 2M1XA 3BGDA 5LQNA 1LBQA 1XRRA 5FL7D 2FUKA 4KUHA 4WDQA 3BO2A 3W79A 1AO3A 1QF7A 5LDGA 4KTTE 4UXJA 1FRKA 5ENDA 2FSHA 5A4IS 1N5LA 5CCDA 2CBXA 4OH1A 1GTEA 3CUWA 3PQDA 1ZNXA 1UJBA 2OXFA 2EI5A 4K7QA 2BE7A 3QOWA 2X5NA 1B42A 2OOKA 5AKXA 1OLUA 1NSFA 3FKBA 4ZZ0A 1P1JA 2WHXA 2CJBA 4EA6A 4GYKA 1SUQA 2ZI4A 1GZUA 3N8IA 1R1DA 5T4HA 1N8SA 1SUIA 5D1NA 1GL7A 4HATA 4DPYA 4JLSA 2KXFA 2G1DA 2XM3A 2OP1A 3WXBA 4L3VA 4RU9A 3HB0A 2P2NA 4RGBA 5D6OA 3PHTA 2FNAA 3FYUB 4OJMX 5CYFA 1V3SA 2P9GA 5KVSA 2GHRA 4PS0A 1ABFA 2LQ9A 4RHTA 4XEUA 2GYVA 4PTZA 4FS8A 1LV7A 4CTKA 2LQJA 1WU7A 4BWYA 3G82B 1U1FA 4QPDA 4OAOA 2E7VA 4DLEA 4OJGA 3JRNA 3FNEA 1WSBA 4MCIA 1IVNA 5ECWA 3WZ2A 1DXHA 3ZX4A 4QO7A 4AG3A 2J41A 4O6VA 4GO1A 1VA4A 4KMRA 4OP2A 3R44A 4IG4A 1KYTA 3R8XA 1NLFA 4AL6A 4NF2A 4DOZA 2HCRA 5DHPA 4H35A 3CNOA 2I4LA 4J1NA 3RYCB 2DT8A 3RSOA 2B4YA 2G71A 5KVCA 5L40A 2O3SA 4QZVA 1PQ4A 1B0ZA 3QY9A 3UJ8A 4C9BA 4C0LA 3L7IA 1LK7A 5KFCA 2YKPA 3LHKA 4FOLA 4PHHA 5MF6A 1W5BA 3OICA 1PYGA 3D4PA 4U7CA 5IHXA 4WESA 1XPRA 1PGZA 3C48A 4QPZA 3GLFA 2A14A 3BE8A 4WL0A 3AA8A 3ML1A 3K8WA 5I4IA 1U6ZA 1FX1A 3ZZUA 3RRNA 3P4UB 1SVIA 2PS9A 8ATCB 1LS1A 4N3CA 3TQEA 2DE0X 3CXUA 3OP1A 1UFLA 1I5OA 2Q9BA 4CKBB 2V2ZA 4UCWA 4WBFA 1N2HA 4A15A 3I92A 1DKPA 5F3RA 3W8NA 3R40A 1A7JA 1NNI1 3EFOB 1UPCA 1Y0BA 1PZNA 2I2DA 4UNNA 3AZPA 1C0PA 3L7NA 1G98A 5JAHA 1JWWA 3I31A 2BN4A 3OAAD 1AW0A 1HDEA 4EB3A 3NIDB 2U2FA 3W62A 2CZVC 3HEMA 4MW1A 3W04A 4BFVA 5ICEA 1VHFA 1ZQ1A 3JQAA 2QN8A 4IH5A 2Q4RA 5HRCA 1GMVA 3LUPA 1KY3A 1LFAA 4QSMA 4NOMA 2L19A 2Y66A 3VU1A 4WWSA 4TYPA 3TRIA 1PJ7A 2F9DA 4WNAA 4OM7A 3DEFA 3SV4A 4CM5A 1VTKA 3TLMA 3BWBA 4PAMA 2HXSA 3GNQA 2FX3A 2WMYA 4BTVA 1PG0A 4W9NA 1UOPA 3KT3A 2OY0A 1S76D 1PGPA 5A2QU 2WONB 3DHYA 4L5CA 1XJCA 3ESQA 1QRTA 2GESA 4YJ3F 1UEIA 3FCVA 2B2CA 1TT7A 3J7AN 2RGNA 4J75A 5LMCA 3WB0A 2E7WA 4QT4A 5ABPA 3N8HA 3EYZA 4L9SA 3HD2A 3OKFA 2VC0A 2A33A 1VE3A 2DQ4A 4CL2A 1Z35A 3L7OA 1QTQA 1NK9A 4TSFA 4XTCS 2PG3A 3A6DA 1CLUA 4FMDF 1EGMB 4Q93A 3DRSA 1BN6A 1TX4B 3IWXA 3K2BA 4Q4CA 4ILMA 1EX7A 4LW8A 4XD2A 3SIWA 3JAMU 4R84A 4I1VA 3DEZA 4GSKA 4AY5A 4WKCA 3T7DA 5T57A 3Q41A 3V42A 4M5NA 2Q3EA 4LPSA 3AXMA 1CFJA 4AYBD 1CY4A 5DIZA 5AUOB 5BW8A 4DR3F 2GK7A 1QMPA 3DTNA 1RTHA 1HNZJ 5IM0A 2B7CB 2ATXA 4R1PA 1XJ0A 1QLHA 5JYEA 1FTCA 3G82C 5ETKA 2RKIA 1MF7A 4CMHA 3IKVA 4M8NE 2D41A 1WNEA 3O4FA 4HACA 2PTHA 3VVLA 2C3PA 4UFPA 3OMLA 4O3RA 1PD1A 4K9NA 2Q3FA 1P4HA 4DC9A 4C0AC 1VJ1A 4K26A 2PUEA 1UZLA 5K0NA 4R9RA 5KT7A 4U7JA 2XB6A 1XZCA 5CFQA 1QU3A 2O2GA 5JCJA 3THXB 1XQ1A 3E1KA 2JJQA 5KOHB 3DE3X 1ADBA 5BVGA 4Q3EA 4DB2A 3M6LA 3SZGA 3PEEA 2JKYA 3AQPA 1J8MF 3GFSA 3DE6X 4GEKA 1QM5A 1WXGA 1ZGAA 2QMWA 4BNHA 4BLWA 4B3SJ 1XRQA 4KTVE 1HWLA 4R5PA 3ETEA 4F97A 4NCBA 4XDHA 1NYQA 2QRNA 4YJKA 4OQYA 3KKLA 4B3MB 1PEKE 3R9XB 4RZHA 2QOEA 3JYTA 5AHWA 5DG8A 1C2YA 1J9ZA 4JP3A 2R85A 1JB1A 2A57A 1S6PA 5DX8A 4QOTA 1D3WA 1K8XB 2B6HA 1DC8A 2VNAA 4B4OA 2ODTX 1CULA 4ED1A 3QKRB 1H69A 5ALKA 1R8HA 3J80A 2JFOA 4L57A 3DAHA 1KKHA 1XI2A 1QDLB 3DNFA 4KW7A 1UAAA 4UCXA 4UASA 1JA1A 1BJTA 2Z95A 5EHQA 4A8XA 4HK4A 3DP9A 2PFDA 3TA2A 3NEPX 4K9RA 4X8MA 4FDUA 3S6EA 3WGHA 2JOQA 2R8OA 3SDBA 1N4LA 1LK0A 2G6BA 4I6JA 2I9KA 3GJ3A 5GM1A 1N7IA 3V7YA 1G3UA 1NW4A 1AQNA 4AO8A 5H9EK 2F8SA 1PSWA 4M0FA 3ERCA 3SZ3A 4DWIA 3BD7A 4EBCA 5EJ7A 4Y2SA 3MZIA 1K8YB 4AFFA 1RQPA 1SKUB 2JI7A 3W2HA 2EBGA 3ETNA 2IPXA 4WP3A 5JH7F 1DELA 4WFBQ 1RYSA 1SC1A 2O5DA 1ZY2A 4E2XA 2CE2X 3AD8C 4NU6A 3H13A 1JR4A 3AF0A 3N3BC 2A5FA 2QVGA 3UVJB 1YRQA 2OHGA 3GBVA 2MYUA 3N6RA 3N8KA 3OD2A 2A5GA 2EP5A 1WSWA 3LP1A 4AMYA 3JVUA 3ZLJA 3WK7A 5H59A 4H7KA 3ICWA 1XK6A 3MJHA 3BS9A 3QSIA 4OI3A 1K7XB 3L77A 1WHSA 1NUAA 4MIYA 5ALWA 1ZD9A 1W59A 3IDFA 1MABB 1UPFA 2IPOA 3GFFA 3O2NA 1NRWA 3TLGA 4FKZA 2G9UA 4ZIRA 1CUVA 4ATNA 1JHQA 4WLFA 1CUIA 4MPTA 3F9IA 3KE9A 4MK4A 4GT1A 5FTKA 3L7MA 3TAMA 3QVMA 3RK0A 3P8ZA 3TUJC 1RJ9B 3M2PA 2YVQA 1H2YA 4AJIA 1MCZA 3ZHVA 1MH1A 4I67A 1L2TA 2C20A 4PFQA 4RTQA 5IKEA 4NH4A 3QPAA 1RT7A 4O44A 3NHJA 3M6UA 4EYHB 3DEAA 1T4CA 2KVQE 3AUAA 2VFTA 1Y6FA 2QJTA 1B3TA 2IOQA 1ZLYA 1FYDA 2BONA 2B8PA 3NTRA 2X23A 2DX7A 3B38A 4P3YA 4RK7A 3E35A 4D4KA 1P39A 4IICA 3PW2A 2NVOA 4A4DA 3WQPA 2GR9A 1D3AA 1KAHA 4KRXA 4DV5F 4M9CA 3V6JA 1PVDA 1WMAA 2P78A 1OMSA 1PZFA 4GXTA 3MMJA 2AYXA 3EFEA 1BQXA 2B4VA 1JHOA 2ZDGA 4R1TA 1SAYA 1OB5A 3A8KA 3GJSB 2E3JA 2IEYA 1DU4A 1XAJA 5LVAA 3M2VB 4RKWA 4WBSA 2X5KO 2W0SA 1I6JA 3C6MA 1N2JA 2ASEA 2FPRA 4UEJA 5K7SA 3W1VA 1YKWA 3INYA 1NN5A 5L4LA 3WWYA 4P84A 1EE1A 5CB4A 2QL5B 1NUTA 3TBFA 4H3SA 4QUKA 1PWYE 3LRXA 4BE7B 3TBHA 4ND2A 2BGWA 2Q1WA 2YV1A 1E8MA 2PWYA 2AHOB 2WY2D 2XYGB 2XVXA 3FKSA 2SKDA 2HNYB 1VYUA 2N1MA 2HWIA 4U7DA 4G67A 3AR5A 4IOBA 3ABSB 1JLBB 4JU8A 2X0FA 2ZI7A 1WKCA 1NW9B 2HYDA 1E2HA 2MKYA 4E1AA 3C15A 4PYNA 3ITKA 3TQHA 3MGGA 4PLYA 1RWOA 3QEJA 4HAZA 1POWA 4AJ2A 5CYMB 3LBNA 2ZS8A 3CE6A 3PO4A 3O7MA 2PWZA 3V9PA 5JARA 4MJXA 1U0HB 4UARA 4UC0A 4MRMB 1O8CA 2PGNA 4P9SA 2IH4A 4HVLA 2E1CA 3W77A 1QYIA 3ZXSA 3GQCA 3FOZA 4Z4IA 1HXHA 1PT6A 4MUHA 1JAHA 3LX8A 3CULA 2D5AA 3C3LA 3F4BA 2I71A 1EB8A 1H8EA 1UM9B 4LFBB 3DLEB 2D2IA 3OTOF 1N32F 1GPDG 3PJ9A 3LQ4A 5J23A 1YNSA 1GRRA 3OE1A 1KMNA 2OBLA 1F8XA 1P72A 3S8YA 3S1AA 4LC0A 3H5XA 3IAM9 3CH7A 4RPIA 821PA 3PQ3A 2GWRA 4ZJUA 4M5DA 5AM1A 2ZBRA 1XJQA 3WRYC 2ZE5A 2LECA 3WQSB 3A3KA 3JSRA 3GLJA 1RJDA 5L3SA 4GOKA 2JGMA 2DB1A 1QIEA 3UMMA 5KFLA 4A8TA 4RETA 4QBIA 5KQPA 2PLRA 3ZDCA 3MOIA 3HKBA 4DV3J 2H3EB 3N5KA 3OFNA 3RUDA 4PZUA 4QHYA 4Z8YA 4LX8A 3QIAA 1JLQB 3IS9A 1RJJA 3H0KA 2HBZA 4V03A 4Y2IA 4ARAA 4CM6A 4EY7A 3H9QA 2GBLC 3C14B 2ZM6J 5CPBA 2C0CA 2M6KA 4DQVA 2IFTA 4PLZA 3LP8A 1WC6A 2Z6VA 1GGMA 2P90A 4KPFC 1TAUA 4D9MA 4ARSA 5K8JB 3R5BA 3N75A 1KJIA 1J8FA 2H1HA 1VRUB 2L0XA 1R6DA 2FWNA 2C98A 1DQNA 4DF3A 1LWCB 1ENOA 4KI7A 3JRXA 3RT1A 1BDMA 2BE9A 1ISPA 3NNCA 2Y93A 5BMVB 1A8IA 1RWNB 3U19A 2XHCA 5ILQA 1XMBA 1AQYA 3DKPA 2CKDA 3H0EA 3LTEA 3IJ5A 2F8MA 3KL4A 4PC2A 2ACWA 2G7MC 3VH2A 4IWXA 3SDEB 2AC4A 2IDMA 2BH9A 5DH9A 2MJUA 1NG1A 7ABPA 5CBKA 4KV8A 4Y2HA 4GWGA 3IOYA 4WCVA 5AXBA 1P4JA 2BFEA 1EG2A 4Y3UA 5AJZA 3VOAA 2WSFC 4V0NA 3KJNB 1JJFA 4F3OA 4HVTA 1JK9B 3O8NA 1ZR2A 3RVLA 5THQA 4KQXA 2DG2A 2JLEA 4GR9A 4S1TA 1JDZA 4U6PA 3O6VA 2PUTA 1OY6A 1V11A 5A6VA 3K6JA 3NXKA 4D7AA 4OYLA 1B8VA 2DT9A 4I55F 4MNTA 3KJGA 2FUEA 2HF7A 2LCFA 4E31A 4YIHA 1TVRB 5EWJA 1XQVA 3I82A 2QB5A 3RRXA 2L48A 4J0EA 1SWWA 2Y3IA 4G41A 1KEPA 5F64A 5ARBA 1QP8A 1V7PC 5B7PA 1LW0A 1OSNA 3K30A 3FPKA 3K0CA 3U6BA 5JJKA 1NI4A 1UM8A 1SKYB 4I4LA 4XX0A 4V1CI 4S0XA 1DLJA 3NAZA 4S1PA 2COEA 4C3ZA 5L8VA 2CADA 2ZRHA 3MFQA 1UDRA 1ZUD1 3A04A 5HCUA 4EAAA 1P9YA 2Z30A 5FX2A 1E6WA 2FPIA 3FI9A 2AI3A 2UKDA 2ZH6A 2A78A 5FJ4A 2RK6A 1YBTA 3QIPB 1FFSB 4C2MA 4L7VA 2AOTA 5I9NA 3LP2B 1QHEA 5LOQA 2COUA 2V9ZA 2PY6A 4ECAA 3HCBA 2B4QA 1NRKA 5CX4A 1P8JA 1EESA 3C45A 3LZDA 1HPLA 4WN3A 4YI3A 5SYAA 3C16C 3PGXA 3RS5A 2BR5A 3MTAA 1U2GC 4F25A 3ROPA 5KTMA 4TL6A 1VIVA 4LQDA 1EJ7L 2RS8A 3GG9A 4HLBA 1TVKB 4NZ7A 1XN1A 3TRKA