1VBXA

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in edta solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vbxA00
4IOCQ 1VC6A 1YTYA 1X4CA 4IOAQ 5GAGU 3P3DA 1P27B 2KG1A 2KRRA 2HVZA 2ZJPQ 1U1RA 2X1FA 2DGSA 2E5HA 1A9NB 4WKRA 2E44A 1VQ4S 3V4MA 1N54B 2CPIA 2GO9A 2DB1A 4J5OA 1UP1A 4IUFA 2MSSA 2MQOA 2AYBA 2KXHA 2A3JA 5GVQA 3J7ZT 1YJWS 3CD6S 1G2EA 1W2BR 5FJ4A 3P5TL 5JVHQ 2MZ1A 2XS5A 1WELA 1FHTA 1DZ5A 3MD1A 2MY7A 3BO4A 3SMZA 1PGZA 4C0OC 2BZ2A 5LSOA 3JB9k 3VAIA 2JVRA 3G8SA 1WF0A 3VAFA 1X0FA 2MB0B 2MKJA 3CCQS 1VQPS 4C7QA 1YJ9S 3MDFA 2KXFA 2G4BA 3TYTA 3NNAA 3DLLQ 1U6FA 5EN1A 3R1LA 1SJFA 1SJQA 4YUDA 3EGZA 4WFAQ 3L3CA 2XNRA 1U1LA 1QVFR 2E5GA 1L3KA 1U6BA 3VAHA 1FNXH 2EK1A 2K3KA 1VQOS 3N9UC 2DIVA 2MHNA 2OIHA 1SXLA 1ZH5A 2DITA 3U1MA 2CQDA 2RS2A 1R8HA 2M8HA 1U2FA 1WF1A 2K8GA 2I38A 1RK8A 2MKCA 1D9AA 2ERRA 5IM0A 3MOJB 5ITHA 3DXBA 3VALA 1M5OC 3I56S 3CCUS 2OJ3A 5DDPC 1VQLS 3FEXB 2J0SD 4BS2A 2M52A 2KM8B 1U1MA 2MSTA 2RUGA 2HYIB 5CXTA 2MZRA 3SXLA 3BO3A 3UWTA 2WBRA 1AUDA 1YWXA 3MXHP 1N52B 2KN4A 3CCSS 3HHNB 5GADU 2M7SA 1HD0A 2DHGA 2RS8A 2MZSA 2QA4S 4ERDA 2X1BA 2YH0A 1FO1A 1O0PA 2N3LA 2X1AA 2UP1A 1A7GE 2MQLA 4OZ1A 4WCEQ 2CPFA 2KI2A 1U1PA 5IQQA 2MY8A 2MKIA 1M5KC 2CPYA 3NMRA 1D8ZA 1YJNS 2ZJQQ 2X1GA 1WEZA 4ZKAA 2JWNA 1X4HA 3G4SS 2DNPA 1F9FA 3S01A 3G96A 2AYGA 2RNEA 2DO4A 2Q79A 2DH8A 1Q86T 3CCES 5GMKa 3IWNC 2PE8A 4TU9A 3G71S 3VAJA 5DDOC 1JJ4A 3TO8A 4F26A 1FJEB 2DNKA 2EK6A 2YH1A 3R1HA 2D9PA 3S7RA 3CF5Q 2DGUA 5LJ3Y 2MJNA 1WHVA 3UCUP 1CVJA 3EX7B 3R27A 2MQQA 5DDRC 4WFBQ 4QU7A 2VOPA 1X5SA 1XN9A 3CCLS 2M2BA 1N8RT 1JJHA 3J7YU 1H2UX 1H6KX 1OWXA 3H2UB 3IRWP 1HA1A 5MLCV 5D77A 1KOOA 3ZZYA 2FC8A 3H2VE 1YI2S 2MGZB 1NO8A 1OIAA 1U1QA 1M1KT 5DM6Q 2HGMA 2L9WA 2MKHA 3CXCR 2OSQA 2MYFA 2F9JA 1K8AT 3VAMA 4CQ1A 2DHXA 1VQ6S 2CQ0A 1ZZFA 3THTA 2OTLS 1X5TA 2DNYA 2XB2D 2LQ5A 2LA6A 3ULHA 2LA4A 2F9DA 2VOOA 1KD1T 3PIPQ 2DISA 1Q7YT 5BJRA 2DO0A 1VQNS 2DNHA 5IFMA 2KG0A 1U1KA 3CMES 1WWHA 2DHAA 3FEYB 2MMYA 3CCJS 1KQSR 2ZJRQ 2LXUA 2CPXA 2XS7A 2JRSA 1WF2A 3LQVA 2O3DA 1VQ7S 1R8PA 1WI8A 4A8XA 2CQHA 2KT5A 2DIUA 2DGWA 4F25A 2M9KA 4CH1A 3BEGB 3UE2A 3EGNA 3MD3A 2VONA 2CPJA 2OSRA 2DHSA 2FC9A 2HGLA 3SDEB 3I55S 2CJKA 1WEXA 1X5PA 2CPZA 4LIRA 4YOEA 2YKAA 2E5JA 1K73T 2MJUA 4TU7A 1H2VZ 4QU6A 2CQBA 2DGVA 5DM7Q 2LKZA 3CCMS 4LJMA 1M5VC 3CCRS 4CH0S 2RQ4A 3OW2R 3CC2S 4CIOA 1B7FA 1OO0B 3UD3P 2MKKA 1U1OA 4ED5A 3CC7S 1Q81T 3VAGA 2RU3A 2KM8C 2DNRA 2OTJS 3VF0B 2QFJA 5LXRA 3G9CA 3UD4P 1WEYA 3MURP 2RRAA 4PKDB 2DNNA 2MZJA 1FT8A 2RQCA 4UY8T 1KOHA 1WHYA 3G8TA 1WHWA 5GAEU 3CCVS 2HGNA 5HO4A 1VBXA 1NU4A 3Q2TC 3LPYA 3PIOQ 2ADBA 2NLWA 1HD1A 4FXWA 1URNA 2B0GA 2LMIA 4WIIA 2KXNB 1S72S 2DNGA 1YITS 4EGLA 3MI7X 2VODA 2FY1A 1VQKS 2L08A 2D9OA 2JVOA 3U1LA 2CQ3A 2LECA 1VC0A 2M70A 2MZTA 3CTRA 4C4WA 1JJ2R 2ADCA 3CC4S 1VBZA 3Q2SC 1YIJS 3MUTP 1X4BA 2MGZA 1VBYA 1Q82T 2M8DB 1WHXA 4U67Q 2I2YA 2DK2A 4FXVA 4UQTA 1QVGR 5LXYA 2CQ2A 1P1TA 2U2FA 2DNZA 2CQGA 5DETA 2CPDA 1U1NA 2MKSA 2M88A 1X5OA 3P6YC 4TU8A 3THPA 1WG1A 1M90T 2N3OA 3S6EA 3UCGA 2RRBA 4OZ0A 2CQ4A 1BY9A 1YHQS 2CQIA 3P49B 1UFWA 3MUMP 1M5PC 3UCZP 2QEXS 5HL7Q 3VAKA 2MZQA 4LMZA 2MQNA 5H1SV 1K9MT 3NNCA 3US5A 2XS2A 1WG4A 2MQPA 1DRZA 1IQTA 4V19X 4WF9Q 2CPEA 1VQ8S 3NS6A 1X4DA 1H2TZ 3K0JA 5CYJA 1DBDA 2HZCA 2LCWA 2KYXA 3TP2A 2YWKA 2J8AA 3SDEA 3CULA 2DNQA 2GHPA 1UAWA 2DH7A 1X4EA 1QM9A 2M4MA 5LJ5Y 4QPTA 2G0CA 5JVGQ 1PO6A 1FJCA 1VQ5S 3CMAS 2DGXA 4QQBA 2RT3A 4W92B 3S8SA 3ZZZA 2LEBA 5D78A 3B4DA 2FHOB 2G1DA 2PEHA 3G6ES 2DNLA 4TLQA 3RW6A 1X4FA 2LXIA 4W90B 3B4MA 2XNQA 4P6QA 2DGQA 2U1AA 3RW7A 1OPIA 1WG5A 2XSFA 4YB1P 2N7CA 1FJ7A 2AD9A 1NJIT 2KRBA 2D3OR 2L41A 2J76E 1JMTA 2AYMA 4F02A 2CQ1A 5LSLA 2F3JA 4RU2A 1FXLA 2CPHA 3NNHA 2DH9A 2CQCA 1UW4A 1VQ9S 5DDQC 2JX2A 1VC5A 3BS9A 2AYEA 1SJRA 2MPUA 5IM0B 2N82B 3D2WA 2YTCA 2FPHX 5CA5A 4PRFA 2NZ4A 2BOPA 2DGTA 1KC8T 2SXLA 2DGOA 1HL6A 4M5DB 2MQMA 4Y00A 2KHCA 3NS5A 1DHMA 2DNMA 3HI9A 2V94A 2LYVA 4Z2XA 4Y0FA 1SJ4P 2RVJA 1X4AA 3BO2A 2KFYA 2J0QD 1ZZNA 1S79A 1WTBA 4PR6A 2KU7A 1RKJA 3MUVP 2CQPA 4IO9Q 1VQMS 3CUNA 1N88A 1WI6A 2M0GB 1X4GA 2E5IA 2MXYA 5GAHU 2LEAA 2KVIA 2KH9A 1SJ3P 4WFNQ 2DNOA 2EVZA 3CPWR
chains in the Genus database with same CATH superfamily
1VC6A 2I9SA 4DV6F 3BPDA 3HD2A 3RAMA 1WSVA 2MSSA 1Q95G 4I0WA 2WB4A 1AA1B 1IKXA 1HWUA 3CJ8A 4DZDA 3RU0A 3PX6A 1YJ9S 5B0AA 4PG8A 1N36F 2HAFA 3TA0A 2OKQA 3TJAA 1R8CA 2V8VA 1IUJA 3HFKA 1XR7A 3DOKA 1DQ9A 3I6PA 3O5TB 3SI8A 2CDRB 4MK9A 1DQ8A 3FQLA 2Y3YA 3KK3A 4DR4J 1N33F 1S1VB 4ANDA 2M8HA 4X66J 3IS9B 1HNXF 3IMQJ 2ERRA 4O4RA 5A76A 5KFZA 4ZN1A 2UVVA 3TJ9A 2VC1A 4QWDA 2MSTA 4QW9A 2GCFA 2H51B 4OYXA 4RW4B 4FBUA 2JEFA 2ZE2A 3IO1A 2M7SA 1N34F 1PYSB 1BWVA 3M4XA 4WFXA 3BREA 2CZ9A 2G1HA 4F4ZA 3C15B 1Y5LB 3DI6A 1RAGB 1RYSA 2EI5A 4DPUA 2HVEA 2MKIA 1M5KC 1LNQA 3HHLC 1UMJA 1IKWB 5BXIA 4QIEA 3WIVA 4NI2A 5KG0A 4EBEA 4G1QA 4YY3J 1FWKA 1GK8A 1X8DA 1EX8A 3FZBA 3M6XA 4KPCA 3WX4A 2IA6A 1Z2LA 3HP6A 3D1QA 1GXTA 3RTVA 3DRRA 2VKRA 2EFQA 5KT3A 5DDRC 4WFBQ 1X5SA 3A3PB 1MMNA 1TUWA 1B3TA 4BWJA 1HWLA 1SB6A 2EEYA 5EGYA 2MLZA 4DJBA 1XC9A 1XWLA 2WRMA 3M8PB 4NZ7A 3T1AA 3N0VA 3IBFB 4B17A 4BC9A 2OTLS 2PIIA 3I5BA 2LQ5A 1NK4A 2F7VA 2KTQA 5L1LA 2NR0A 5KG2A 3LQVA 1R8PA 4R0EA 5A8RA 3I96A 2V2KA 3OTEA 2DY1A 1FK9A 3NS7B 3SDEB 2C28A 2W24A 5DQIA 3HPOA 3OPKA 4QR2A 3AOCA 5AXNA 2H5EA 4NLXA 2R42A 2AWZA 4WP3A 5L1KA 5E3AA 2W9AA 2RU3A 4P2MA 4OX9F 2W9BB 3K5PA 4F04B 1C0TA 5J1EB 1RT3A 3Q8PB 1TMJA 4PKDB 2MZJA 1YGYA 4DXLA 4MFBA 4FP9A 2HIYA 1U0SA 2CG8A 3DRXA 6FD1A 1RI7A 1WACA 2DEIA 3LPYA 3QZ7A 2B0GA 4JI2J 1GMWA 2QLBB 2BBEA 1T9TA 4WE1A 5AT1B 5KFCA 2UVUA 4C8YA 3GJSB 4U7UD 5CYMA 4A4JA 3HDSA 4ED1A 4FXVA 2ROPA 2ZZMA 1TVRA 3PYGA 5DETA 4RBVA 2B4PA 2MKSA 3D6TB 2XG8A 3VR1A 1YSJA 3UCGA 3I5AA 1TV6A 3MUMP 3E51A 4K4ZA 4NXMJ 1DRZA 5HQMA 5H9FJ 4J9LA 2YX4A 1WDTA 2FGOA 2YPYA 4GRSA 3TUZC 4F50A 2MLXA 4LBIA 3KJFB 1IKXB 4NLOA 3GG1A 1VJWA 1RZMA 4TQSA 2BE7D 5HROB 2R8HA 3OUYA 3CO9A 3BSNA 3DOKB 3CD5A 4F0HA 3UD5A 2XSFA 3ITHB 3A3OB 1YVFA 4Q43A 2VD3A 5KFTA 1RCOB 1DLOA 1N32J 1IBMJ 3W3SA 5CA5A 4RNNA 2F8MA 4AXIA 3D1OA 1QE1B 5C25A 5A2QY 3X1LB 2BACA 3ZZOA 1AT1B 2OPPA 2ZE2B 2KFYA 3NBPB 4V19J 3KLVA 4O3RA 4OJ3A 1I51B 3MPWA 1N88A 4TLRA 5EDWA 3OTDA 4ZVGA 2LLZA 5LMNJ 4K5SA 1RB0A 5HN0A 2YWWA 1RHRB 3UI3A 5DZ7A 1X4CA 1XR6A 4IOAQ 3D6FB 3P3DA 4X66F 5A0YA 1F2HA 4CLTA 4G1QB 2HQIA 3C8YA 1X9WA 2E44A 1B0PA 2RB7A 3J7YI 1WJ9A 2AYBA 2A3JA 2K3IA 2OAUA 4PXBA 2NXCA 3MTJA 1XNRF 3PX0A 1FXRA 3RZAA 4Q8EA 3CSKA 1VQYA 1FVQA 1NJWA 1H7XA 4BCAA 2KXFA 2K06A 5C42A 2ZC4A 3TEGA 2GJIA 3EMTA 1SJFA 4AL7A 1ZAVA 2BANA 4ZJQA 3GCWP 2YNFA 2VDHA 1L3KA 4C6AA 4YY3F 3H8YA 1ZYQA 3N9UC 1M1HA 3W2VB 3OFGA 4FPRA 1SBRA 1P6TA 3I4HX 5ITHA 4ZPAA 2Q1LA 4DI6A 1ZA2B 5ETVA 3TWZA 2GGPA 3UWTA 4RX6A 1N52B 4DSLA 1T03A 2KVQE 3NOGA 4U7CA 1L3SA 4Y28C 4WCEQ 2YNGB 4KHMA 1U1PA 1WC6A 2HHUA 4MKAA 3PHTA 2VV5A 4CO3A 3G87A 1Y7PA 4WZMA 1U47A 3F56A 3PFEA 1C0TB 1TMMA 4M5KA 5CYQA 1CQNA 2IDLA 2YWGA 1EKRA 3FCHA 1RAOA 3PW5A 2CJBA 5IT0A 2E9TA 2IJFA 2LQ9A 1JLAA 4USVA 1CC7A 1RISA 1VGYA 1ZETA 2OPRB 1RDRA 1XN9A 1VQSA 3MGJA 3JQKA 5L8RC 3LANA 5D77A 3E2EA 4JI7J 2YKPA 1NO8A 2NXUA 4ECTA 1TL3A 2QLXA 4YR2A 5CCLA 3JXOA 1S1WA 3LUYA 2OMLA 4UQGA 4KPYA 5DGBA 2VF3A 3M2RA 1TV6B 3CCJS 4USUA 3K7RA 3QFWA 3BGLA 3W2WA 4JI2F 3PO4A 5DQGA 3KOAA 5HMWA 2QO3A 4PWUA 3NGSA 3UE2A 2VONA 4DUYJ 2FC9A 3JS9A 3M2VB 2ZWOA 4NMXA 4UW2A 3QZ8A 2W2PP 4P75A 5B09A 4OX6A 5CABA 4WTOB 1GMWD 3OUYB 4ED3A 4DCJB 1LOUA 2RMLA 4X4NA 1NPKA 1UFLA 2A1BA 4IQXA 3KLHA 2FZKB 3DMJA 2EC2A 4QYZK 2VJVA 3RBZA 1DLOB 1BQMB 5K8OA 3MEDA 4UY8T 4ZVRB 5ETNA 1J5OA 2X51A 4R8UA 2NLWA 1SUQA 1NKEA 4USWA 2OPPB 1RWMB 3F0NA 3HK2A 5GAGI 1WHXA 5LXYA 2CQGA 2CPDA 3DLGB 3RBXA 3ZZ0A 2DR5A 2GMJA 3RR8A 5A0YB 1N32F 1M90T 4G1IA 2VDIA 1IBMF 3PNIA 5THWA 3MEEA 1PC5A 4M5LA 2MQNA 5E7OB 4Z37A 5DO2A 4WF9Q 4CTAA 3RRGA 1D3WA 4FDFA 5I4MA 3NP5A 1RAIB 1T02A 4YQWA 4N76A 1QM9A 3E8OA 1B7YB 3ADAC 5LMNF 5C42B 2J8SA 4C11A 5AJ3J 3HSGA 2BANB 4ILRA 3CDAA 2PA8D 3FRZA 3BYPA 1RJJA 2V8PA 2VHGA 4F02A 1GEHA 4OI0A 2CPHA 3SSRA 1IN0A 1A0OB 1TK8A 5CAAA 1V3RA 2G0JA 3J81Y 4MYUA 4TQRA 4WK3A 2D7SA 1UL3A 1Q8BA 4BBYA 3GIKA 1L3TA 3SV4A 2RVJA 4LVOP 3NG8A 4ZHRB 1TAQA 4LSZB 2ZH9A 3J7A1 3MHYA 8RUCA 1WI6A 1T8EA 3CW2C 2DVIA 3C2PA 2EVZA 4WU3A 5KFUA 1NKBA 2ZBIA 4FKYA 2X1FA 1BUXA 4USMA 2XY5A 1N54B 2B51A 2P8IA 2Z30B 4KB7A 3W8PA 3TANA 5FJ4A 2N4DA 3AXKA 4JBCA 3Q8VA 2MY7A 3SMZA 4C0OC 2IM2A 2NXEA 4I68A 2BYCA 4Y2MA 3TYTA 5IC6B 2VPWB 1TL3B 4ELVA 1UTAA 1S1WB 3L3CA 4ZK7M 3Q0AA 3GZ7A 2MHNA 5E3RA 1ZH5A 1HLWA 2C2OB 5IZHA 3DRSA 4DR3J 4DFKA 2I38A 1W7WA 3TZXA 3MOJB 3Q23A 3HULA 3CCUS 1LQ9A 2XLIA 3JQJA 2BJ8A 4RUHA 4EBCA 5CXTA 3AXMA 4J7CA 1NB7A 3AA9A 3QBCA 4O4GA 5K8NA 1ZM4A 3HHNB 2BUNA 3NAIA 4DR6F 3BGFA 1Z1ZA 2ZM6J 1KEKA 1S0OA 3OL7A 1E6VA 3DLBA 5EWGA 2VKZG 1D8ZA 1YJNS 4AXJA 3KLHB 1R3NA 3DMJB 3G4SS 1UWBA 3LOUA 3PRBA 7FD1A 1CQMA 2Q79A 1L5UA 3IWNC 2QSWA 3MEDB 3RRKA 1ZPWX 1TL1A 4FYVB 2C42A 2HQGA 1SUQB 2QL9B 2ZUAA 2H5IB 2X3GA 4QCLA 4DV7J 3T5HA 1CLFA 3KFWX 5MLCV 4IYQA 1NK6A 2A6MA 4ILMA 1M1KT 4J9QA 4K0KF 1IM4A 1C1BA 1Q8IA 2CQ0A 2UVWA 2YWEA 3SEOA 3MMAA 2PMHA 1WDDA 1KD1T 2QV6A 1S6PB 4X4OA 3OFHA 5HP1B 3GQCA 3MEEB 3FEYB 2IRYA 2AW0A 1GNKA 2HHSA 3N6MA 1H74A 5K14B 3RB0A 1IM6A 4CTAB 2GW8A 2E66A 1JNRB 2IRUA 4FZVA 3A12A 1WC5A 4H4MA 3MMJA 1X5PA 2CPZA 4WXWA 4NLPA 5DRKA 4G1PA 5EX3A 3OVSA 1OPZA 3M6UA 1B7FA 3JQMA 2NS1B 3WHIA 4CM0A 4L3NA 2QZ8A 1RE1B 4F4WA 3RBDA 3FNNA 1JB0C 2RQCA 4DN9A 3UO0A 5KFHA 4ZPDA 4B3OA 1QTMA 2V2VA 3BN7A 1HD1A 3QYYA 1URNA 2B5JA 3BH7B 3IBCB 2KXNB 1YITS 4OZLA 3KHHA 2DCUB 4IG3A 3ZZPA 2R2RA 1VC0A 1IKYA 5IT4A 3V6DB 3HD1A 2OEKA 4Q0BA 2PD1A 1SKUB 2FJVA 2CIMA 1QVGR 2HBQB 3BBCA 4LR7A 3IR6B 4RNMA 2L48A 4DUTA 1Q0NA 5F8GA 3A13A 4MK7A 1B64A 2CQIA 2V4QA 2DRBA 2K7KA 3H59A 1WG4A 1SPBP 4XDDA 2GHVC 1H2TZ 2WW4A 3FCVA 5E41A 1R8BA 2HZCA 5L9NA 4ES1A 4LF5J 2GHPA 2A18A 1RTIA 5HJXA 3EZ5A 1VQ5S 3OXFA 4L6V3 2DGXA 1RADB 4LRBA 7FDRA 2PN6A 2GO8A 4P6QA 4YHHF 4LT6A 1TTHB 1SL0A 1NJIT 2HQDA 2L41A 3H2LA 3BSAA 2DXEA 1UW4A 1KQKA 3M6VA 1RTJB 4PG6A 1ZPVA 2FPHX 2ZH5A 1V5IB 1HL6A 3EGVA 1S0MA 3FBBA 1DHMA 1YZ6A 4OYIA 1CSJA 4JV5J 1D9FA 3VZIA 3MUVP 2ASJA 1FE4A 1E6VB 1PCAA 2DNOA 2J7WA 1G3OA 5KT4A 2RILA 4NLSA 3KUHA 2D41A 1SVDA 2OPQA 3BQ1A 2Z2LA 2BV3A 3EZOA 4HEA9 4IKAA 3FBFA 3LGHA 3Q8UA 4PQAA 3HVTA 1TL1B 3IR5B 2D3ZA 1FJGJ 1XJWB 2LDIA 3TQ1A 2HNDA 2F40A 1PGZA 4JI0J 2ZM6F 4ECVA 2AJFE 3VAFA 4LF8J 5ETSA 3EDRB 2WAQD 4DL5A 2HFNA 3AD9C 3UPFA 2XYHB 3MECB 3RAQA 2ATCB 3MMAB 3DOLB 1ACMB 1ZOTA 2AGOA 4B9SA 4IG0A 3Q22A 1D1UA 3M1VB 3QQCD 2HHHF 2R7TA 3TAQA 4DMZA 2APOA 3QWPA 3MMCA 4H4MB 4QR1A 2W2NP 2CUYA 5IC4B 1G7CB 3VGTA 3V4IB 2GQQA 4OZ1A 4DEZA 4M5IA 3SSQA 1N5YA 5D3GA 1PC4A 5B0FA 4UOCA 2KZMA 2X3DA 2V4RA 3GLJA 4I4BA 2E1AA 1X4HA 2HKEA 4DUZJ 4HI1A 1ZM2A 1S5ZA 2DH8A 4OJHA 3MM8A 2QTWA 1M5SA 4A46A 4B3OB 2D9PA 4I6WA 5LJ3Y 2D74B 2OHDA 2M2BA 4ED6A 4IG3B 4AFFA 2RAQA 1L3UA 1IKYB 1RWOB 1I1GA 1Y9OA 2MKHA 1H73A 5BYQA 2IC3A 2XYGB 1LK7A 2C3OA 3CEDA 3W60A 1VLOA 3JAMY 3D0IE 1SC1B 1HWJA 3J80Y 3OLBA 3RJMB 4DSFA 1IR0A 1Z2ZA 2ZOGA 2QX0A 2ZJRQ 2LXUA 4R0JA 3PYEA 4OHVA 2OD4A 4DL7A 4CLWA 3A8EA 1KKHA 4FF2A 4QWBA 3MD3A 3QPIA 3G6YA 2AEFA 4RW8A 3I55S 4ENOA 1KFSA 1RTIB 4OZ3A 4TU7A 3SCIE 1Y4ZB 4NA3A 4U7UK 2CQBA 3R6GB 3CCMS 5KFKA 3RAXA 4CH0S 3OW2R 2HHQA 5ETKA 2ZDOA 4CDIA 2LVWA 2BDPA 4CLLA 3K59A 2W4CA 3ENWA 2WTFA 1X60A 1RLCL 2O5DA 2DY9A 4F3OA 2QA2A 1F2GA 2KHDA 3QATA 4KHPJ 1SC3B 1KOHA 3GIJA 3DGPA 4LF5F 3QSIA 2HGNA 2Z58B 4YDXA 4DX5A 2DNGA 5KFMA 4ECWA 5GMEA 4C0BA 2W01A 1S1TA 1JJ2R 1VBZA 1VBYA 4QWAA 2M8DB 2R7SA 4PABA 3TEHB 2B3TB 4ZPWR 1UVMA 4P52A 4UQTA 2ZOFA 3O8WA 3EYZA 2DPJA 2H65B 2QIFA 4ZJOA 4HTIA 5C2CA 3KMQA 3AQOA 1CBKA 3GSDA 5H9EK 2AGQA 4MMOA 3PY8A 3HVTB 2E7WA 2DR6A 2DHHA 1BHNA 4JV5F 2ZH4A 4I64A 2HNDB 2C2RA 2IYIA 2PC6A 4OYZA 2V69A 1RT7A 2Y1RI 5LJ5Y 2B8QA 4QPTA 3GYNA 3CMAS 2RT3A 4DV3J 3HHDA 2LEBA 1FF2A 2CVEA 4KIAA 3B8HA 1X4FA 1FX4A 4PAAA 3U27A 2DGQA 4IO1A 5KG4A 3PX4A 3M8QA 3MCNA 2RUSA 4NXNJ 4IG0B 1FXLA 4DQQA 2CQCA 1VQ9S 2HFVA 3TVKA 2DYAA 1XK8A 3K5NA 3D2WA 4CLZA 1J5EJ 1NMEB 2NZ4A 4JI0F 3QT7A 3M9NB 5T41A 3NS5A 1HQUA 1SL2A 4LF8F 1BGXT 2QMXA 2PSZA 2LYVA 2LU2A 5J2QA 2J6UA 1Q5VA 4CLKA 2J0QD 3KDNA 3MAHA 2OO4A 4PR6A 2MEWA 3H4DA 3R5AA 2CQPA 5DQHA 1AYEA 3OHBA 2MXYA 3AJ2A 2YY3A 5F0UA 4Q2MA 5IOLA 1Y11A 4RKUC 1YZ7A 1E6YA 5HQLA 1SH0A 1YRXA 1VQ4S 1UPPA 2CPIA 4ZP7A 3T5JA 1WKKA 1MMLA 1Q8LA 1YJWS 1UZDA 3MPDA 3FMWA 3UW1A 2NUUG 2HHVA 1M1GA 5KT6A 4BHQA 2K2PA 4QIGA 4B3RJ 3GV7B 4A8SA 3CT9A 2EFNA 3ENAA 1JLGA 2VIHA 4X2BA 1MMDA 1HBNA 1TZ0A 1SKWA 3QT5A 2OGUA 1RKIA 2H48B 4KGZB 2ZVSA 1MN9A 3ETOA 4DUZF 4B02A 3UR3C 1S77D 5F9LA 4JV2A 1U2RA 4XPCA 4ZP6A 1FFSB 1LWCA 3I56S 2JLFA 4JB8B 3WC2A 3KLFA 1I94F 2LP4A 4M5DA 2XTJP 2BQUA 2RUGA 2J7KA 3Q8YA 2KN4A 2K1RA 5GADU 5HVGA 5HMZA 2R2UA 3PM9A 2X1BA 1RWWB 1O0PA 2NZCA 2MQLA 2CPFA 3S1TA 2KI2A 5LM7E 2FLLA 4OYMA 4FF1A 5DS7A 5C2GA 2XMAA 3LPEA 2WSFC 1CJVB 4K8RA 5GAEI 1GTEA 4B9LA 1TL5A 3W1YC 1IBCB 5KFPA 4Z7CA 4HT7A 2QFIA 2RDJA 2XQCA 3DGPB 2JLEA 1MSWD 3PKYA 5CZXA 2MQQA 4QU7A 4M63A 5D4NA 4EU0A 1VI7A 4NCAA 1Y0HA 5C5JA 3HZGA 4YEAA 4RUCA 3IRWP 1HA1A 2H1YA 1S1TB 4DX7A 3V81B 4XK8C 2YNHA 3MF5A 4QOTA 1S76D 3T1YJ 3W62A 4DSJA 1LW2A 4CO1A 3KK1A 3CCWA 2OLWA 1Q53A 4FVMA 4PQUA 4YR0A 3LAKA 2WW8A 4KHPF 2Y0BB 1VLYA 1TUVA 3M9MB 3HT0A 4URGA 1KBRA 2R7WA 2KT5A 4KGMA 2FD2A 5J2NA 2WVCA 2M3DA 2V8GA 2XMWA 5KFFA 2RF2A 2KFNA 4LRAA 1RT7B 2FJAB 5AE3A 2ACYA 5BYSA 3K5OA 4LR8A 2W7OA 2FZGB 5DM7Q 4EWTA 2WONA 3SIPB 1NDPA 4A8YA 5IT9U 2ZNZA 4CO5A 3SQGB 3M8SA 3HVRA 4FS1A 2VG5A 1NHVA 1RYRA 4HHUA 2CA9A 5K5MA 4EO8A 1RCXB 4O23A 2QLWA 4ZS6A 3FSIA 4B9MA 3DOMA 2HVHA 1VBXA 4BLGA 3AA8A 1HQUB 2LMIA 4DL4A 1HIYA 1IBLJ 2FY1A 3VCDA 4GKJJ 2MZTA 1RT2A 1YIJS 5HLFA 1Q82T 3UQSA 3GFXA 3D0HE 5KFYA 2CQ2A 4DR2J 2CDQA 2KDOA 2V4JA 2O67A 3JSRA 4JI5J 1J5EF 1TKZA 1CJKB 1K0VA 1FD8A 3K57A 3UNGC 4M5NA 1NSPA 2KYZA 5F8NA 3NGKA 4WBFA 1M0SA 1KQGB 3MPVA 2LFVA 2FVSA 1FJCA 3CDUA 3N4WA 4V1Ak 1JLGB 3SV3A 4LQ3A 5L1IA 2Z4PA 1S57A 3MMBB 4K59A 1G6BA 2J9EA 3K8WA 2YKOA 4LFAF 2JEJA 3H7HB 3FMBA 5KFDA 1SQGA 1RTDA 4LFCJ 3BQ2A 4LSNA 1B70B 4TNOA 1VC5A 4GO5X 1UKUA 1LWCB 2XWXA 2Q6BA 3NRBA 3C16B 2ZDPA 2AJ2A 4M5DB 2KHCA 4DFMA 4O44A 4YDDB 2H54B 1RT5A 2KKHA 2BVZA 3P45B 1KONA 5KT5A 1JIHA 3HFVA 1S6QA 2E5IA 2R8KA 2LEAA 2OUGA 3PZPA 2A10A 4AL5A 3AJ1A 4PYAA 4FS2A 1WOPA 4CLYA 1KTVA 3V4MA 4DG1A 4OZJA 4FN5A 2VQEJ 2KXHA 3FBCA 2NREA 3CD6S 3L4BC 2MZ1A 2XS5A 1FNOA 5LSOA 4M1KA 1T7PA 3RYLA 4J9KA 2MB0B 4RPFA 4X64F 3PKMA 3N6LA 1WC1A 5K20B 2YNHB 3FZ2A 1PJ6A 1T05A 4CNYA 3IR7B 3A8KA 5F8MA 4PQUB 1FNXH 5F8JA 4PCQA 2UZAA 3U1MA 2G9OA 2B56A 2OFHX 4Y2KA 1C4AA 3DFEA 4C3LA 4P7VA 4AUKA 1WC3A 5L9XA 4ED8A 2HYIB 1TELA 4DL2A 3CD0A 3CCSS 2N7YA 2RF2B 1YBAA 4DS4A 1LWFA 3I0SA 4KFBB 5J2PA 3BYRA 3HKZD 3FFIA 4P2XA 4CYUA 3OR1B 2VG5B 4MTPA 4QYRA 4K4WA 4WIQA 1VIXA 2CADA 1BQNA 1VK3A 3MM5A 4DQPA 2AGPA 3G71S 1KR4A 1MWYA 5KT7A 1FJEB 3MM6B 2VBZA 2IYGA 2OPSB 4LF2A 3OL8A 4KR0B 2YQ1A 4K4TA 3R5JB 4C8NA 4DCOB 3CCLS 4GC7A 3H5YA 2FJXA 3J7YU 1NDCA 2YPZA 1U6ZA 2CYYA 4IFYA 1KOOA 3LP2A 1RU1A 2Z56B 3H2VE 4Q7AA 2MDAA 5HLFB 4KHRA 3R8YA 3BGRA 3H20A 2OI2A 1VQ6S 1WUUA 2ROEA 1HBOA 3A8IA 1X5TA 3R5GA 3TNVA 2W25A 4ITSA 3VWSA 2V4JB 5BJRA 4ZLNA 2AEJA 2XWYA 3K5LA 3AOBA 1PBUA 3QSYB 4F0KA 1FCAA 5HANA 1HNIA 4R5PA 2W9CB 3TUPA 2F4VJ 4GKJF 3J7Z5 2CJKA 1WEXA 2ZHOA 3D4JA 1WC4A 2LQJA 3OL6A 4DR2F 2MKYA 3FSYA 5CZVA 1NHKL 1NJYA 1MU2A 1KLMA 4JI5F 2CKWA 3H5SA 1RTDB 5HVFA 4LSNB 1HQEA 4YMEA 4U8YA 5JMNA 1TFWA 3OJSA 4FXWA 4XTTA 1TUGB 4WIIA 4O44B 1AXQA 3MI7X 1RWPB 1RT5B 3EUNA 4X4PA 5HI7A 4PZVA 1UEUA 3T5KA 4WYLA 3ZTSA 1T3NA 1HI0P 1SCJB 2MGZA 1RP5A 1TKTA 1S6QB 1VRTA 3W8GA 4LFCF 3IG1A 4ZVOB 1N5QA 1XMQJ 3H25A 3QJPA 4TU8A 3THPA 3IWLA 3CJ5A 4OZ0A 1AZSB 5C7PA 1RACB 2B43A 4N56A 4DG1B 3CB4A 1F60B 4V19X 2O66A 4ZOSA 3VVUA 3GYGA 2PMZD 3LP0B 3PO5A 4OHWA 2J8AA 2AJ1A 3ZTRA 3A8JA 1IWAA 4DLGA 2BEFA 2OMOA 3NGUA 2J9CA 3OTCA 1NUEA 2HRYA 4W92B 3M30A 4LSLA 1S9GA 2BQ3A 4I2PB 5D78A 2MHEA 4L76A 3EWGA 1WOSA 1UWAA 2R7RA 1YG0A 5HJYA 4AE5A 2J76E 1WC0A 3T5LA 2VQEF 5ADZA 2JDJA 4I7FA 1JLCA 4ED2A 3VQTA 1PSDA 2N82B 3I0RA 2BOPA 1KC8T 1H0HB 3HHLB 3KK2A 2FQQB 1O8BA 4P9SA 3R7SB 4Z2XA 5KAKA 3EVOA 1VMBA 3AD7C 2ZFHA 1LWFB 5ETLA 4CO4A 4RW6B 4ETXA 3H90A 5J2PB 4WU2A 1FEHA 2FHJA 4CYUB 5D0HA 5LOQA 3ET6A 5GAGU 1NK8A 3C3LA 1U1RA 4MJKA 2Q3PA 1HNXJ 5HK4A 3MM5B 3AOAA 2DB1A 4ZLJA 3HFZB 2DEJA 1ZTTA 3DKDA 1BMQB 3WC0A 4RLEA 1ULRA 4F67A 3JB9k 1N34J 3H0PA 2XZWA 1PKUA 2MKJA 3HHLD 1OY9A 3T9ZA 3G86A 1RLDA 4U95A 4X4RA 3BGRB 1JXVA 4UT4A 4NWBA 1HBOB 1U6BA 4Y3CA 2DCLA 3DN9A 3LF0A 2XULA 2DT9A 2BW7A 1NH8A 4NA2A 4C8MA 2V0NA 1WF1A 2K8GA 1OY8A 2B9XA 2HFSA 2QMUB 2PGCA 3MOZA 4ED4A 1UETA 3JYTA 5DDPC 1CJTB 1ICEB 3CJQA 2JOQA 2J0SD 4CLPA 2XEXA 3MPUB 1S12A 4P74A 3PEJA 3TUJC 2Y1LB 4CO2A 2ALYB 2MY8A 5FDLB 1KLMB 4GVLA 1NPRA 2ZJQQ 1S10A 3G82B 3GJQB 2VC0A 4P71A 1HQEB 1NDLA 1PJ5A 4LFBF 4TY9A 4ZVUB 1K0TA 4JI6F 1JJ4A 1HBMA 2YH1A 3U7JA 3OR2A 4LBHA 3R1HA 3CF5Q 2ZH3A 5K9FA 3LP1A 1CVJA 4DR1J 1JJHA 1FWPA 3AD8C 4ANEA 2QA1A 3P4UB 4I1TA 2QLJB 1O6XA 2MGZB 2BJ1A 1TKTB 4LUBA 1VRTB 1VBKA 3KMSA 1Y10A 3LO3A 3VZHA 3IG1B 4NZ0A 4L73A 4ZLPA 4F0MA 5KFAA 1VQNS 3GV8B 1U1KA 1KQSR 5D0GA 2R8JA 2CPXA 4ZCIA 4JOUA 4Y65A 1C0UA 3TX0A 4M94A 4F8RA 2CQHA 4UOHA 5CQGA 2DIUA 2DGWA 3TZZA 2I0XA 5H9EJ 3CCTA 4CH1A 5LSRA 1FKPA 4ZITA 4E98A 3R5DA 3T6JA 3PHEA 3DRYA 1U8SA 3JTPA 4DQIA 5ETOA 1R31A 3GFYA 2HVDA 4LF1A 3M30B 3NGRA 4LSLB 1S9GB 3ICLA 2LKZA 1C1CA 1XMQF 2XLJA 2JHEA 3DLKA 1U26A 2DXDA 4Y2IA 2OD6A 2MKKA 2HQ3A 2F8EX 4WFZA 3I4PA 4DU7A 4MAKA 5HMYA 3Q8SB 2ZBCA 1RWVB 1AFJA 4I7FB 4DL3A 1PAUB 2YKQA 2XY6A 3I0RB 3EE3A 3CJKB 1MN7A 1NKCA 3M32B 1YX2A 4JI1J 1EQMA 3PDNA 4EMDA 1NSAA 2BKOA 4FNHA 2JVOA 5JXSA 2HQCA 2RRNA 1J27A 5L38A 2WSEC 3R5BA 1BC6A 2I8EA 3Q8QB 3CC4S 1K44A 3UR0A 2W7PA 3DLJA 2RJZA 5C24A 2W2MP 2I5JA 3GFHA 3UN5A 1EHWA 2GIRA 2XYPB 4P72A 4KE5A 3TAMA 1X0PA 4DSEA 3D67A 2AKWB 4DF4A 3ISZA 1LKZA 1WSRA 1VK8A 1PYTA 4N8OA 2MQPA 4OYWA 3NS6A 1X4DA 2BMBA 3K0JA 2AZ1A 2LCWA 2QSFA 5E2QA 3LA0A 4N7TA 3PW0A 3BB5A 3K5MA 1NLKL 1XR5A 3QGHA 2RSQA 2KJVA 2LXIA 2B6AA 4RR5A 2GFFA 4LIWA 4F36A 2CQ1A 3NNHA 2CXEA 1D0EA 1EQ0A 2I6WA 2FHJD 3MR2A 1I3OB 4ALZA 4IFVA 3JYTB 1FKOA 4CLFA 3MEGA 2R4FA 1XNRJ 2HNZA 3FVYA 4C0HA 4Y0FA 1JNZB 5DLFA 1X4AA 2XZTB 2ZUGA 3DYAA 3ISND 4KAIA 4MIBA 4NLRA 1N5VA 1RTZA 4IDKA 1VOMA 1W2IA 2IAJA 2D3O1 2BR0A 4U9RA 5AXMA 1SJ3P 5DZ6A 2OH2A 3MM9A 1HR0J 1X7VA 3QIDA 4J90A 1S97A 4ZVPB 2VUGA 4WKRA 1T9UA 1S49A 1R89A 1XTZA 1HBMB 1JLEB 3WBZA 3P5TL 4CRJA 3GFZA 2BABA 3MD1A 3LP1B 4KBIA 1OSCA 3OHAA 2ZD1B 2Q66A 4J9UE 4F3MA 4LR9A 3CCQS 4C7QA 4U8VA 2JEGA 2HG4A 3V6JA 4ZDNA 1EKSA 4N77A 4H54A 4PUOB 4EZ9A 1Y3KA 3D68A 1FFGB 4HL9A 1U1LA 2RHSB 1LW0A 3VAHA 2AJQA 1DY3A 3KJQB 2QL7B 1R43A 3ONQA 4OI2A 2HBRB 2ROGA 3IN5A 2HURA 4GVBB 2GX8A 3P96A 1TKXA 2DRAA 4TY8A 1U25A 4DR1F 3OXGA 4X65J 2W4DA 2OFGX 4NCBA 5KFVA 3PW2A 1ZAXA 1FO1A 3KLIA 1A7GE 1C1CB 3DLKB 4ZLLA 1S9FA 1LXNA 1V6HA 2MQ8A 3UN3A 2CNKB 2CPYA 4NLGA 3NMRA 4OI4A 2ZHBA 5IWAF 1N6QA 3LWMA 2V5HG 4NX9A 3GPAA 1T3OA 3CCES 1R27B 2V9WA 3BBFA 1EP4A 3S7RA 4B9NA 1UPMB 1KVIA 5H9FK 1YJUA 4ED0A 1PILA 4DU8A 4I69A 3ZZRA 2C2KB 2FC8A 4CP5A 5CHCB 1HNWF 2L9WA 4X4TA 3VAMA 4HLBA 4YFUA 1RAHB 2LDYA 4HKQA 4NYZA 2LA6A 4CLUA 1NDKA 3TAMB 2Y0SD 5SUHA 2FVPA 2KG0A 2MMYA 1OYDA 2FDNA 3PVXA 3TUIC 4JI1F 1VQ7S 1WI8A 4F25A 2H4WB 4K50A 3BKTA 2J6TA 1R0BG 4ECXA 2D1CA 1KN6A 1SV5A 4HR2A 3KK3B 4NEZA 3OL9A 4CIOA 3GTYX 2RKIA 2BE2A 2B6AB 2RE1A 5I42A 1S1UA 3Q8RB 2OTJS 4TYBA 1FE0A 3CMQA 3TOQA 4B08A 2R3VA 4IRCA 2HS4A 3PJ9A 4QIFA 4IFVB 1MWQA 3MCOA 2IIHA 2P9GA 1FX2A 3G8QA 1RABB 1VQKS 3DI6B 1RHUB 2AEMA 1HHTP 5RUBA 3DYAB 5B0CA 2I1RA 2EBEA 1V5VA 3POTA 4RUAA 2NCKL 5D8HB 3W66A 1F5AA 4NI2B 4B9VA 1QY7A 3I9V9 3NMAA 3MM9B 2B4VA 3H5UA 2VBXA 1H72C 5HQ8A 1WG1A 2JLGA 3I87A 3S6EA 1U49A 2GJ2A 3OD2A 5KFIA 3DRRB 4DV4J 1CS4A 4B3MF 4CH7A 2CPEA 3EPGA 4KJIA 4KYZA 3TP2A 2PO4A 3M9OB 3QO9A 2BJ7A 1RHMB 2XZDB 3WX8A 5JVGQ 3ISNC 3M8ZA 1U4BA 3ZZZA 4K4UA 2FHOB 1KVJA 3UN2A 2PEHA 3CWJA 1HR0F 2HWHA 2R7UA 3KUEA 4GC6A 2DPIA 1NM2A 4YB1P 2KRBA 4OIXA 2ZKTA 5A8RB 3ILOA 2DH9A 4KRWA 1QSLA 3KJNB 4OLPA 3LALA 4H4KC 1FK9B 4TY8B 3HF5A 4KGKA 4Y00A 2B7CB 2ASDA 3KYLA 3KLEA 2HLTA 2VA2A 4A47A 4N5SA 5ETPA 3NGDA 4YB7A 3RR7A 3M2UA 3KLIB 4NCGA 5D4LA 1NPPA 1VQMS 3KLGA 2M0GB 4UOGA 3OTOF 1Q4RA 1S6OA 5G4DA 4FVCA 2C2EA 1RT3B 4ZA1A 1NCLA 4A8WA 3E01A 4KTQA 4Z7YA 4ZPBA 4MFBB 4P2SA 3ZNUA 4C2MA 2HVZA 5E0OA 5F8IA 3PRDA 2AMCB 2DGSA 3QJLA 4Y2AA 2FUG9 5FIIA 1VHIA 1KTQA 4LF6J 3OVBA 2GO9A 2VPZB 3I9ZA 5KG7A 2MQOA 2EFOA 2H4YB 3GILA 4X65F 2BXJA 4WE1B 1CULA 1EP4B 1WELA 3ENQA 1LFWA 5CYMB 4HHJA 2JVRA 4DR6J 2R7QA 4OYBA 9ATCB 2ZC3A 1HHQA 3DHWC 1FRHA 3V2UC 1TVRB 3KG0A 1N4LA 5BYRA 1T95A 3N28A 4NLVA 1ZM9A 4OQJA 4UUWA 4K5RA 3CDWA 4QJVA 5EWEA 2BJDA 1VHFA 3J81j 3PXGa 1NEEA 2PFDA 4TN2A 3H5XA 4FXDA 1T94A 2JC0A 2ZH7A 2BRLA 1APSA 2YKNA 3RGIA 1T9VA 4QBUA 3OTBA 2CWKA 2DHGA 1AW0A 4K2XA 3BQ0A 2ASYA 4K0KJ 3GU0A 2RKIB 2IJNA 2BE2B 2HS3A 3M7VA 3T6BA 1IVZA 1S1UB 4BWMA 2QRRA 4FF4A 4ZKAA 2JWNA 3R3TA 2DNPA 3PV8A 2AYGA 1JXEA 2DO4A 5C25B 1Q86T 3V5RA 1I5OB 3JAMU 2FVQA 2E7VA 1I6JA 2NYIA 4URQU 2MJNA 1TFYA 1TAUA 3IM9A 4RW9A 1XQIA 4JI4F 1H2UX 2XHCA 3H2UB 3CD7A 2ZKUA 2HGMA 4DFPA 3L7PA 3P8BB 2HIQA 4ZVFA 2RDDA 1B4SA 2LA4A 2F9DA 1OS5A 2QYCA 1FESA 2F8HA 1WWHA 2DHAA 4ZVEA 1NB2A 4RNOA 5KFNA 3Q86A 4A8XA 1WKLA 3HJVA 1KHVA 2CPJA 4XIUA 5IQ6A 1KVKA 2W1BA 5ETTA 2OSRA 2DHSA 5L39A 4DPOA 4E0DA 3M8YA 3QO9B 1OJ4A 4YOEA 4K4XA 4LF9F 2YNFB 4ZP8A 2HQFA 3DCAA 4KT0C 4QU6A 1WKJA 4FYDA 4DWIA 4LJMA 5F8HA 4IRKA 3CC2S 2FY8A 2L9NA 1FRJA 4B9UA 4WPAA 5D15A 5T7LA 2Y9HA 3IA0A 3QLHA 2QFJA 4DV4F 4GO7X 3G9CA 2VFUA 3UD4P 5LT5A 3I31A 3OFFA 1F6TA 1FTRA 1KRPA 2KZZA 1XMOJ 5KG3A 2GGPB 5A8KA 3PACA 5GAEU 1T03B 4ES3A 3W64A 4I2QA 3PIOQ 3WZ0A 3BF4A 3SYZA 2XY7A 3KLEB 3DDIA 1P1LA 4KY3A 1OQ3A 3IGNA 2HWIA 2ADCA 4O3SA 1H98A 2PT0A 4NCGB 3HX9A 1HKAA 3KLGB 2I2YA 2DK2A 4QW8A 2PMWA 4YHHJ 3D54A 5L1JA 3DM2A 5CYQB 3SFGA 1HNZJ 3BR9A 4EI2A 1PYOB 2FJWA 1JLAB 1YHQS 3UCZP 2XSJA 3GONA 2K7JA 5F0WA 1FERA 2QJ3A 3NNCA 3US5A 1S6UA 2UUWA 1VQ8S 3BGOP 4EEYA 1O5JA 2IFXA 3GP9A 1JLQA 2EW9A 4OFZA 4WTYA 1F3VA 3CULA 5G0RA 2DH7A 5HAOA 2M4MA 4NE9C 1LWXA 5E3QA 2OEJA 2HZVA 1NZ8A 2KT2A 3KUGA 2YQ3A 3ILIA 4G6VB 3M2RB 3B4MA 4RZRA 3C15A 3RW7A 2CJQA 2DR9A 4LF6F 3QNWB 3W2WB 5LSLA 3Q83A 1GTHA 1HMVA 3BS9A 3PEHA 1HBUA 3GV5B 4F3QA 4HDHA 4B9TA 1JK9B 3R97A 2YKNB 3HHEA 2J6SA 2E1PA 4OMFG 1LV5A 3MFHA 3K8VA 4N47A 1R7IA 1RWKB 5IT9Y 2KH9A 2UUBF 1IKVA 4AQYF 3CPWR 4IOCQ 1RA7A 1YTYA 3M8PA 1P27B 4ZVHA 1J5OB 2XMKA 3H40A 2IVFB 4R8UB 1UJ6A 1EARA 4ECSA 4J5OA 4I6YA 3HKWA 3QT6A 2W7AA 2HHHJ 3J7ZT 1AB8A 3ILLA 5GVQA 1G2EA 1J2VA 1YJRA 2GZOA 3VAIA 1N48A 1U09A 3HSZA 2XGPA 4ILLA 1FFWB 2AT1B 3ZO7A 1Q1KA 2XO7A 1NAQA 2EXUA 3R2DJ 4YUDA 3EGZA 4LF4J 1IR1A 4WYWA 1BQXA 1P9YA 1NNDA 3SCKE 2K3KA 4PG5A 1RBAA 2AX0A 3A4TA 3N79A 1NH7A 1R8HA 1RK8A 2KJWA 1QTNB 4KGVB 2R7VA 1FI4A 5DJBA 4G3IA 1OYEA 4HYKA 5J1EA 1MW7A 3MCSA 4QZVB 2IHR1 4XDCA 1U1MA 4EZ6A 2QYGA 1SJ1A 3OFEA 4CI0B 4C11B 2C3MA 2PI4A 3W5XA 3QGPA 3QAEA 1HI1A 1U45A 4ELTA 2GMHA 4ED7A 2QG9B 5IQQA 4E8UA 1QUPA 5J2MA 3ELHA 5T7LB 2BOAA 5KG5A 3O3LA 1GH8A 3ZFVA 3QLHB 3KNAA 1X31C 4ICLA 2P9EA 2PE8A 2AJ4A 3CDBA 5A8KB 2BQRA 1URRA 1BXNA 4I2QB 2FYXA 2DGUA 4HHHA 4KGXB 3R27A 4PPZA 2VOPA 4JV0A 4KH0B 3AJDA 3BDPA 1OIAA 1S7IA 4J9PA 4DV5J 2CRLA 1C2PA 2UXBJ 2ZH6A 2E1MC 3HZEA 5HROA 3DM2B 2Y1IA 3DGVA 5F3ZA 1S59A 1HW9A 1PAEX 1XMOF 2XMUA 2DKOB 2JRSA 2XSJB 3ITHA 3EJMA 2VBYA 3TJ8A 1QLNA 1Y5IB 1JLQB 2VFVA 4ZPCA 2CJYB 4F4YA 5G0RB 1QE1A 2E5JA 2IBKA 4IH7A 4DL6A 3NBPA 1JKHA 2F5GA 4A8QA 2J9DE 5AE1A 4ED5A 2ABYA 1HNZF 3T3FA 3DRSB 2C2DA 2V2QA 2KM8C 2CNLB 2B9EA 1WEYA 2DJWA 2RRAA 1KS2A 4RWXA 1HMVB 1FT8A 1HBUB 1K1SA 2FB0A 1U2CA 2HZAA 4O4GB 3FEZA 3BKUA 3C6UA 3R7NB 3MR3A 4Q8FA 2VODA 2HLUA 2YQ0A 2EFGA 5B08A 2M70A 2VG7A 4C4WA 4OYAA 2G2OA 3UVJA 2WZ1A 2P6TA 2ACMA 1X4BA 3QWUA 5JJBA 4DV2J 2EFPA 4NLYA 1IKVB 1UWBB 1P1TA 2C2MB 2VB6A 1FRIA 2YBVA 1TK5A 4YB5A 1RWUA 5AXKA 2HFOA 4NZ6A 3RG6A 5CD4H 1UCNA 1BY9A 3P49B 1B99A 2QEXS 1FDBA 3EICA 3W2VA 5F41A 1IQTA 1QAYA 3PFOA 2L3MA 4A8OA 3EVWA 5CYJA 2HEKA 5D0EA 4ZIWA 1S1XA 1V3ZA 1X4EA 3E3XA 1C1BB 1GX5A 4XO0A 2QE5A 2UUCF 2CVIA 5K8MA 4C97A 3S8SA 4O3NA 3HCXA 3TA1A 3TR5A 4W90B 3PRVA 3WIUA 4DHVA 2LEPA 2YNGA 3F41A 4Y2CA 1NHUA 1ZS6A 4O3QA 3KG1A 4AT1B 1B0TA 3MWBA 4R25A 1NJZA 1GMUA 2OEMA 3CVKA 5F8LA 4JI8J 2EPIA 4FYWB 4WKYA 4NEYA 2UXCJ 4JI3J 5BR8J 4DQSA 1UA0A 4WP8A 3BO2A 1QJHA 3AAWB 3A3NB 4OZNA 4USTA 2OPRA 5KTQA 4LF4F 5KFGA 4X84A 2YWFA 3R5CA 2BM1A 2E1RA 9RUBA 2KVIA 4LVNP 5J2MB 4DDFA 3CDEA 3OQ2A 3BBBA 4ICLB 1DTQA 3UFCX 3L7OA 1CJUA 2E5HA 5ETQA 1TP7A 2B5JB 1UP1A 2ATLA 5KFRA 1I94J 2QC3A 2WHOA 3GJTB 3MAAA 4OHZA 2AF6A 3BO4A 2BZ2A 3GIMA 4Q0BB 2AIRB 2FTRA 3G8SA 4EO6A 1WF0A 3UDLA 1IJFB 2VICA 1D9DA 1YDLA 2GJFA 3M2VA 3DLLQ 3QMQA 3GR1A 3BH6B 4PG7A 5EN1A 3EXCX 2OP5A 4WK1A 3QAUA 1VQOS 2DIVA 1ZM3A 3CJ0A 4EYIB 1G1XA 4FYXB 4ES2A 3VALA 2ZOMA 3JSYA 1BQMA 2J0XA 5I3QA 1U48A 1AUDA 3MXHP 3GR0A 2NXJA 2AQ4A 4DV5F 3QT8A 2YH0A 2UXBF 1XNQJ 3GE9A 2WVFA 4EK2A 1M5HA 3D3CJ 2AJ0A 1JKHB 4FF3A 2W8KA 4ETZA 2ZZTA 1SC6A 3PG9A 1JLBA 1PJ7A 2ZBQA 2HFUA 4J91A 4DR4F 3DLGA 3CO0P 4TU9A 1BD6A 3VAJA 1T9XA 4ZP9A 4BDPA 3K2YA 2HHXA 3C6UB 2ZBPA 2DD8S 2P2CB 3FKBA 1HWKA 1NJXA 2VG7B 4OV1A 5SZTA 3UVJB 2DR8A 4ELUA 2XCAA 2WBMA 1FA0A 1U1QA 4NRTA 3CXCR 4L74A 1UJ5A 2OPQB 2DHXA 3ZZTA 2KL8A 2GS8A 1FWLA 2DNYA 3C19A 4MYTA 3BM7A 2DO0A 1UEKA 5IFMA 5KOXA 3WDOA 3KG4A 4LF7J 4HTJA 3W9IA 3UNYA 3TZWA 3BEGB 3EGNA 2XLKA 3G6XA 2HGLA 5F3TA 2XMJA 1S1XB 1QAXA 4LIRA 2HHWA 2BM0A 4USIA 2YKAA 4DV2F 4OX8A 3DHXA 4RJVA 2WVDA 1FXDA 2RQ4A 4ZHRA 3EPIA 2VJUA 1U1OA 3F73A 1BLUA 1RSCA 3NWRA 4HACA 2B9WA 4YP3A 1IQZA 1NK7A 1AROP 4M5JA 2LU1A 3CGIA 1FTCA 1WHWA 3MMCB 2J0WA 1NU4A 2WOMA 3WQPA 3TVZA 4H4OA 3L09A 5GAHI 1XBWA 2F63A 5D3GB 1N5YB 3KDOA 3T9NA 1RWNB 4LFAJ 3VQSA 4M5GA 3D6MB 1YBTA 1EETA 4KSEB 4DSKA 1X5OA 4N8NA 3MM8B 2N3OA 4L3KA 1DTQB 3HSDA 3AB4B 1CJUB 2CQ4A 4PXEA 4C3MA 3QGIA 4JI8F 2UXCF 4JI3F 4CT9A 5BR8F 1U0HA 4DX6A 5L46A 4BC7A 4URSA 3MAAB 1DBDA 2V50A 2PA3A 3Q89A 2PEBA 4UOFA 2FJEB 3CJ4A 2IC3B 4HVZA 5MAOA 3LWLA 4PYDA 3D6HB 1LEOA 2Z57B 2YX7A 1UVIA 2C2NA 2BW2A 4RUBA 1MLAA 2AYMA 2IA0A 2R8GA 2WK4A 2BKNA 2GA7A 4M95A 4NXMF 4RW8B 3J7AN 4PRFA 2COLA 2E1CA 3PYFA 4X64J 1WTBA 2KU7A 4WFYA 5E33A 2WVEA 4JP8A 4QIVA 5KFBA 4NPOA 1RUSA 1X9SA 5FD1A 4QYZJ 1JLBB 4DPXA 5K8PA 2XI2A 4M5HA 4WP9A 1A9NB 3DRPA 4ZVSB 2P9CA 3HVAA 4IUFA 2GC8A 1S6PA 5HP1A 4PPDA 2IVYA 1W2BR 1H38A 1UVNA 3W9JA 1DZ5A 2C1EB 4OL8A 2AV5A 2IM0A 4U6PA 5DG9A 5K14A 1QAIA 4DSIA 1XNQF 1S48A 5FLXU 1VQPS 3UDVA 2G4BA 2ZVIA 2YXLA 3R1LA 1RAEB 2XNRA 1QVFR 2E5GA 1NK5A 4IH6A 2HFZA 2DITA 4NLQA 2RS2A 3NLCA 3IC1A 1U2FA 1N0UA 2OJ3A 1F3FA 4BS2A 1WOOA 2RQMA 3HMJG 2HVIA 3SXLA 4RWWA 2EKYA 5DG7A 2QA4S 1GXLA 5IXUA 2VA3A 3LH2S 5HATA 3M8QB 2RD5C 3MEKA 4KV8A 3V6DA 4OJGA 3DU5A 4D3HA 4RNHA 2JH3A 4HACB 1CG2A 2HPUA 5HSPA 2Z2YB 1WEZA 1RHQB 1OMSA 1F9FA 4LF7F 3TI0A 2MLYA 4EFAC 4ID5A 4OX7A 2Z0GA 2CJ9A 2DNKA 5J2QB 2WOMB 1LK5A 4H4OB 4ZCLA 3BPSP 4PXDA 4DPYA 1H6KX 3AODA 3TRGA 2OELA 4OLOA 4CLSA 4RBTA 1KHWA 2IRXA 3D3BJ 1E6YB 2WB1D 3KKFA 4RBUA 4L72B 1U02A 2G0IA 1EETB 3C6TA 2Y1JA 3TVYA 2E29A 3PIPQ 2DNHA 2C3YA 2UUTA 2YKMA 4DF8A 2XS7A 1WF2A 4HH0A 1RHJB 2O3DA 1U0HB 2UXDJ 1FEEA 2M9KA 2XGQA 8AT1B 1RTJA 2H5JB 2DBBA 2VZ9A 3TQEA 1HBNB 4F7VA 4JI7F 5E3PA 3NCRA 2UV8G 3CCRS 1OO0B 2CJXB 2VL1A 1TL4A 3PR5B 1BWEA 3OSPA 3KLFB 2E5LJ 4IQMA 3R2CJ 4G65A 2DNNA 5HVHA 3FC9A 4RW7A 4YB6A 2D3UA 4KKOA 2K1RB 5HO4A 2CNOB 2FLPA 4P10A 3Q2TC 3IRXA 3EGWB 2ASLA 4DUYF 3UDEA 4DLEA 2VQFJ 3CTRA 1S7HA 1R8AA 5AXLA 1T9YA 3Q2SC 1P9QC 5KFEA 1MWZA 1CC8A 2WSCC 2DNZA 1FRXA 1KWMA 4Y6IA 4HI2A 2G13A 2RRBA 1UW9A 3MECA 3BR8A 1VYAA 2HBYB 3DRPB 3DOLA 2W2OP 2R2SA 1K9MT 5KFXA 5HBMA 2FVCA 1HHSA 3M1VA 1LW2B 4ZPVR 1GX6A 1O51A 4RU9A 3KK1B 4F4KA 2IPOB 4IRDA 1XMBA 1X9MA 3T41A 3V4IA 4MIWA 2QGFB 4JV1A 2AD9A 3U02A 2VPXB 4NYOA 2UVRA 1Q79A 1Q5YA 5J2NB 4LQ9A 5CCMA 4NLWA 4DFJA 4K4VA 2AYEA 3BSOA 1SJRA 2YTCA 2DGTA 1GQEA 3GMGA 3PW4A 1RGVA 1SJ4P 4J37A 5KG6A 2WONB 3W65A 1Y00A 3ENVA 2V9KA 3D0GE 2GIFA 2O01C 3CJRA 1W26A 5AJ3F 2RHQB 4KV8B 3MTKA 3HJFA 1N56A 2BE9B 2KG1A 2V8HA 2B7BB 2ZEJA 3DOMB 3O1LA 1JWWA 2Y8YA 2N4CA 4ID5B 3B6BA 5CD4A 2PFFB 4O0NA 5JVHQ 4C8ZA 2KB2A 3CCZA 1RT2B 2B8PA 4UZCA 3AHPA 1R0AA 2XMMA 3MDFA 3W5ZA 3R7BB 4YR3A 3NWGA 1F0XA 2CFXA 1SJQA 1UZHA 2ILZA 2UU9J 1TQLA 6FDRA 1TKZB 3C6TB 1DJ0A 2ILYA 4OHYA 4LFBJ 1R6VA 1YKWA 2GMLA 1F1BB 2EC0A 2YKMB 4IR1A 4JI6J 3IM8A 3QJJA 1FDAA 1KSPA 3RUBL 1DAXA 1FRKA 2GQ2A 2YVSA 3QFHA 1HD0A 2HAIA 1QUVA 4ERDA 2JEIA 2IBOA 4O0IA 1R0CB 2IVMA 1ZA1B 1V3SA 3N01A 4NLDA 2XHWA 4ID8A 3H4BA 3CE8A 2BA9A 2X1GA 4Q45A 1QD1A 2FHKA 2W8LA 3G96A 4UF4A 5A8WA 3IP0A 2UXDF 1A6LA 2CZVC 4DR3F 1G4CA 1VDHA 4RW7B 1DTTA 3TO8A 4F26A 2J9DA 4KKOB 1VR6A 3C66A 3IRXB 3N6NA 3GIRA 3VGVA 3HT3A 3D7SB 3RB4A 1YRUA 4TVAB 1OWXA 3C46A 2CJAA 2Q6CA 3ZZYA 3W9HA 1YI2S 3OJUA 3W5YA 4C8KA 2OSQA 3SCJE 3VV2B 2FZCB 2HRUA 2E5LF 2XB2D 2EBGA 1UFKA 3BV8A 2BRKA 2RU9A 4A48A 1HQ2A 3RRHA 4MT1A 5HBMB 1N5SA 3AY0A 2VQFF 5A2QU 1YRTA 3UDCA 2XMTA 3BGUA 4DPWA 4X4SA 4DV7F 4A8KA 3RB3A 1T05B 1M5VC 1TK0A 5D6GA 4WWSA 1VISA 3L9ZA 4NMLA 1Y3JA 5DGAA 1WTFA 1HNVA 2EWHA 1MG7A 4PWWA 3MURP 3C14A 1MROA 2AP6A 3ILJA 1UJ4A 1WHYA 4C8LA 1N0VC 1IR2A 2BJEA 2X7IA 2V8DA 2KFZA 3I0SB 4FNIA 3Q24A 3KXDA 1S72S 3EXYA 3DXSX 4I56A 3IXQA 1HW8A 3MFIA 1FDDA 2LXFA 1RT6A 1GFWB 3GJRB 3CJ3A 3FFIB 2FHMA 2C22A 1RBOB 3NL0A 1T0TV 1H3DA 4ECRA 4NLUA 1WNEA 3AQPA 2FGCA 1BQNB 2XM3A 2AU0A 5KG1A 1U1NA 5E5NA 2M88A 3THVA 3HSJA 3P6YC 1IJEB 1YJTA 1LWEA 2QLFB 1YQHA 5IS2A 8ATCB 1IXKA 4AYBD 3A1YG 1OQ6A 2GAGC 2V2ZA 4OI1A 3CIMA 2IM1A 2MZQA 1SIWB 4I67A 1S99A 2FJDB 1VJQA 1ZAWA 3HM9A 4IR9A 1OY6A 4IFYB 3LP2B 1VS3A 4QWCA 2YWKA 3KJVA 1UAWA 1R0AB 1XEZA 2HNYA 5KFSA 2DRDA 4QQBA 3NAHA 4H4KA 2P5VA 3RW6A 2DNLA 4LRDA 4DV1J 3LAMA 5A6WA 5A6PA 2QMWA 1RT4A 2HSEB 2XC9A 2ZHAA 4RU2A 3OXLA 2L9DA 1HNIB 5U47A 4R5PB 1CJVA 4LRCA 4DCPB 4ER8A 5B0GA 1DFDA 2GIQA 1FVSA 4U96A 2MQMA 4J9MA 3HXMA 2DNMA 3HI9A 1NSKL 1MU2B 5B0EA 2POKA 4A8FA 2UU9F 4IO9Q 1Z4UA 1SI9A 4IOBA 3F44A 3AFGA 1XERA 3V81A 3FDSA 4ZVQB 2NPFA 3D5MA 1ZBTA 1QSYA 2ZJPQ 3H98A 5A8WB 1U7LA 7AT1B 4MK8A 1DTTB 2AZ3A 5LMUJ 2B9YA 4J9SA 2BX6A 3GWCA 1EAYC 4USHA 1SIZA 1RTHA 3AH6A 2CZ4A 1X0FA 3R9LA 1K47A 2CNNB 3NNAA 4PXCA 2XCPA 2E9ZA 2GV1A 4CNZA 1U6FA 2PI5A 4CM2A 4WFAQ 2UV8A 4HDGA 5IWAJ 1U8WA 1YK9A 2C2ZB 5HMXA 4S0MA 3TA2A 1SXLA 3SQGA 2A2CA 2CQDA 1DURA 1SQFA 3TZYA 2MKCA 4DS5A 5J1PA 2CWXA 3I5CA 3G6VA 3IGVA 3FEXB 2M52A 4TKTA 2W4PA 1FJGF 1RAJA 1OSDA 4FKXA 4E2FB 2RS8A 2MZSA 4OZ2A 3GSIA 1UVKA 3HHKA 1HNWJ 4YS2A 3JSMA 4K4YA 3EZUA 1PBAA 3X3UA 4KO0A 2CG4A 3HLUA 2AX1A 3DLEA 3LGNA 1RT1A 1REGX 5DG8A 4I6AA 2JL9A 1JLCB 1LXJA 2DR7A 1HNVB 5KFJA 2RNEA 3KK2B 2IMOA 3C14B 1HFEL 1MROB 2JFKA 4N41A 2HS0A 4XAKA 4ZPTR 1CJKA 2YX1A 1EJ7L 5KOWA 1C4CA 3UCUP 5CH7B 1N8RT 4QR0A 2NYHA 1RT6B 4ZIVA 3CJTA 4NRUA 2R7OA 1REVA 2NQPA 3IAM9 3ET6B 2F9JA 4CQ1A 3GG0A 3NCPA 4FYYB 3OLAA 3K89A 3MMBA 2QA4G 1LWEB 1XIQA 3CMES 1ROFA 3KWMA 1TKDA 2QT7A 1CPZA 3FRYA 2KT3A 3J81U 2B4OA 1UVLA 2VFTA 3KJVB 3C16A 3CJ2A 2NSBA 2GHWA 4OI3A 3TW0A 3MZIA 2XO6A 2Q43A 2HNYB 4ZCKA 4HH1A 3P5BP 5E3CA 2NUHA 2DGVA 4ECZA 3MM7A 3CC7S 4M8LA 2DXFA 2A2DA 4PWDA 1RHKB 3O44A 3G2XA 2DNRA 4C98A 1D09B 1RT4B 3VF0B 4J9VA 3PJXA 4F2SA 2DTJA 4B3MJ 3LGMA 3G8TA 3NXZA 1NK0A 3PR4A 3QRRA 4KC5A 4LBPA 2Z8QA 2L08A 2D9OA 2HHTA 2C3PA 4DR5J 3U1LA 3FQKA 3JTOA 2CQ3A 2ZBRA 3HO1A 3QIPA 1SKSA 1KP6A 4DV1F 2RDIA 4U67Q 1RAFB 3ZC4A 3KHGA 3OR2B 1UFWA 1M5PC 4MKVA 6AT1B 3U1NA 4WJBA 2JJ4D 1L3VA 1F5BA 4WZQA 3QRPA 4CO0A 2KYXA 4F4XA 1RTHB 3H42A 4FBTA 2G0CA 2ZH1A 4J9OA 3I82A 3OTOJ 1ZTWA 2M5YA 3EM1A 4MH8A 4KFBA 2FLOA 2JFDA 1FJ7A 1C0UB 4USJC 1Y5NB 2Z2ZA 1IWGA 5LMUF 4O3OA 4QWEA 3IWXA 3OR1A 1IBKJ 1EIYB 1AFIA 2JX2A 2NSCA 1FKPB 4Q2LA 1RBLA 2VBWA 3VGSA 2V68A 4W98A 1FRLA 4C8OA 3MM6A 5KT2A 1NXIA 1T9WA 4Y34A 1F5CA 2OPSA 3KHLA 1Q78A 3PTWA 3BDEA 1S79A 4OHXA 1FKAF 4ZJLA 2H3EB 3JSMB 2VPYB 4CT8A 1X4GA 4KO0B 4DV3F 3DLEB 1SC4B 4O3PA 1RT1B 4EYHB 3NGTA 1Q7LB 2KRRA 3V6HA 1VRUA 4NXNF 3B54A 3OSNA 3NKYA 1BE4A 2QL5B 2LQ8A 2EFVA 3ETMA 5KFLA 4JYAJ 3T19A 4UY85 1NZAA 3K58A 4X4VA 3OT9A 2HK3A 2F1FA 1HYSA 4LRFA 5C24B 4DV0J 1KQFB 2W9CA 2I5JB 4RL1A 2IJRA 1REVB 4LREA 1MNEA 1GXUA 1JX4A 4DR7J 3GCXP 1AUSL 1DARA 1SL1A 2J7UA 2EK1A 3NEKA 4EUVA 3PCOB 1NK9A 3D9BA 1D9AA 1JQGA 5IM0A 4OI6A 4XPEA 4CZCA 2IMWP 3N5BA 3FJ2A 1VQLS 5KFOA 2B4UA 2BKPA 1SKRA 4F4AA 5F9NA 4OJ1A 4JI4J 1ELOA 2QN6B 1CEZA 3DNCA 4P73A 4B3RF 3L95X 1S0VA 5LL6d 2X1AA 2YNIA 1TR0A 2HW3A 1DQAA 1YJ7A 5KFQA 2R7XA 3MM7B 4B3TJ 4PWDB 2G2ZA 3FUYA 1Q16B 3QGGA 1PIEA 3CIZA 3EDQB 1FKOB 2JSXA 3RB6A 3S01A 2D69A 3RBEA 3MEGB 2HNZB 4DBQA 1KFDA 2A0FB 5B0DA 3OV7A 2EK6A 1AZSA 3MR5A 3KTQA 4IDKB 2IAJB 1P8GA 1S4EA 4LF9J 3LP0A 1U24A 3QIPB 2MYFA 1JXLA 2EG1A 2HRTA 2R9LA 2H9ZA 4I2PA 2VOOA 1Q7YT 1RXOB 3M8RA 4X62J 2G2YA 4MKYA 1N5TA 3DLHA 2F4FA 3VTIA 3FK4A 4DR5F 2O1PA 3PYDA 3GIIA 1JLFA 5IV4A 3D1HA 2CAJA 3T1HJ 3HHLA 4F2RA 1SH2A 4OYPA 4USKA 4MKBA 5EWFA 1RAAB 1LW0B 3NY0A 3B82A 3KHRA 3T1YF 3UD3P 3OBIA 4RW6A 4WXOA 1Q81T 3VAGA 3BSCA 4K7QA 1TKXB 3W7BA 1HI8A 4X4UA 4D3GA 1Q8KA 4K2JA 2BJ3A 1UEVA 1GAOA 2E9RX 3CCVS 1B0VA 4DX8H 4HT5A 2GVDA 5IV3A 1WD6A 5EX0A 1D8YA 2WVBA 2LECA 2HBZB 2UUAJ 1SQEA 4NA1A 3FCWA 1N6QB 3SZ2A 2XI3A 2U2FA 2HK2A 4KQZA 1IBKF 4OYOA 1QSSA 1S9EA 1VRUB 3N5FA 3GYXB 1FDNA 5HL7Q 5H1SV 4GMKA 4C48A 3BN4A 1UA1A 5I3UA 2W2QP 4MIAA 1IBLF 2YWHA 2RQKA 4ECQA 1CJTA 1YLXA 1HYSB 1NSQA 4NASA 3O2IA 4NLTA 2V67A 4TXSA 1S4FA 2XMVA 3VVTA 3ZZUA 3O6QA 2UUBJ 1GMVA 2G1DA 3IBWA 4AQYJ 4CWBA 3GB0A 3TARA 2U1AA 3KNGA 1OPIA 2D3OR 1TL7A 1JMTA 5D0RA 4OV6A 2F3JA 5FDLA 4K4SA 4QPXA 2KO1A 1ITPA 4CCHA 1QDUB 2VU5A 3EVMA 4JYAF 5IM0B 3G82A 2HMIA 4ECUA 3HVWA 2SXLA 2DGOA 4J9RA 2V34A 2F65A 4DV0F 1T11A 2P6SA 1V9OA 5DLGA 4M5MA 1SV5B 3JTNA 1ZZNA 4L75A 4DR7F 2FVRA 2YNIB 5I42B 2V6AA 4GKKJ 4Q5VA 5GAHU 4WFNQ 4KH1B 3PJWA 3ZTOA 4P2FA 1HWIA 2EKNA 2HHPA 4FPIA 4JUZA 4ATNA 3J80U 2MTLA 4AD6A 3M6WA 3LW5C 3CNQP 3D28A 3I32A 1TU0B 2HWTA 3B78A 3TAPA 3ZTPA 1FHTA 1JJCB 2IM3A 2GVZA 2IDEA 3POTB 3QRQA 4B3SJ 5B0BA 3MCMA 2V63A 4B3TF 3IFEA 1K1QA 2IY5B 2XBPA 5JUMA 4ZMMA 4RNFA 5AE2A 5T14A 1NBEB 4QIWD 1CS4B 3LTOA 2OIHA 2VG6A 2EG2A 4DZ6A 4ZN3A 3CJSA 4DV6J 3DXBA 1M5OC 2RIJA 3L7UA 2FJBB 5EHHA 2KM8B 2FIUA 1JLFB 2MZRA 3BO3A 3SSSA 2WBRA 3CJKA 1YWXA 4ZCMA 1RA6A 3D66A 3DDKA 3AT1B 3M32A 2JZ5A 2N3LA 2UP1A 1S0NA 1HPZA 1SH3A 1N36J 4DL0C 4X62F 5D4OA 2Y8WA 5B7WA 1UVJA 5GMKa 3SQOP 4IH5A 5DDOC 2GNKA 3M05A 5I3PA 1N33J 2E7XA 3T1HF 1KLNA 4ZVTB 2GVDB 2NXNA 4DN0A 2ZH2A 1WHVA 3EX7B 3M2UB 3SFUA 3M8WA 2ZITA 2R8IA 2C3UA 3E01B 3AB2B 5DM6Q 1KDNA 1K8AT 3K17A 4TYAA 3R6LB 2FLNA 1ZZFA 2GQCA 3THTA 2ZWPA 1NRKA 3ULHA 4DPTA 5J1NA 2DISA 2VH7A 1S9EB 1S1VA 1YBUA 1VRQC 1CULB 2AHOB 3IS9A 1FD2A 4PG4A 1VCTA 1HARA 3DDNA 3MAQA 4PEOA 4Q44A 3SCLE 1RQ0A 3ZTQA 2VFRA 5I3UB 4AL6A 1F9EB 2UUAF 4RW4A 1PG5B 5FLXY 3FBEA 2ZZNA 1W25A 1K73T 2MJUA 1YJVA 5ETRA 1H2VZ 2NPIA 2JC1A 3OVAA 4ECYA 3JSBA 1VFJA 3MR7A 3MPYA 1IKWA 1TL7B 3NOCA 1KNZA 5LXRA 5KFWA 3DC2A 2RH3A 4NL5A 3W61A 2HMIB 4X4QA 2ADBA 5EUHA 3PW7A 4OZ5A 4EGLA 2VASA 3ZNJ1 2F4VF 1JLEA 2JNJA 3IAS9 4DOZA 1FNMA 3V6KA 2UUCJ 4C9DA 2ZD1A 5D4PA 3MUTP 1RU2A 1FRMA 3MR6A 1EB0A 4UUXA 4UTGA 4P7TA 1R6YA 4C3KA 4PUOA 2ZH8A 4DQRA 4OX9J 3BJYA 1F9HA 2LQBA 1RWXB 2BJ9A 3VAKA 5GMDA 4LMZA 4EBDA 5M2RA 2XS2A 4RW9B 5M2PA 4GVBA 2GVZB 3BZQA 2Z2MA 1H7WA 3FSXA 5M2UA 3SDEA 2DNQA 1VIOA 2R2TA 4A8MP 2WCXA 4GKKF 1PO6A 1WORA 3VHQA 4UZBA 2PDAA 3B4DA 3G6ES 4TLQA 4J9NA 3VGUA 2XNQA 1GT8A 3DU6A 3NCQA 4ANCA 4NYPA 2A6OA 1WG5A 2N7CA 5ETMA 2W9BA 4NOHA 1QAJA 2VG6B 1LFPA 3BKFA 5DDQC 3ZXWA 2J5AA 2MPUA 5GADI 4YN3B 3W63A 3TX8A 2VFSA 4RO0A 4B3SF 3FGVA 2ALZA 2V94A 3SBMA 4W4MA 1RKJA 1EZZB 1HPZB 3CUNA 2ZNYA 2GAHC
chains in the Genus database with same CATH topology
1N56A 3E01A 1VC6A 4KTQA 4ZPBA 4MFBB 2I9SA 4P2SA 1E6YA 4C2MA 2KG1A 2HVZA 4DV6F 5E0OA 5F8IA 2V8HA 3PRDA 2B7BB 2DGSA 3O1LA 1SH0A 4Y2AA 3QJLA 2FUG9 1JWWA 1YRXA 5FIIA 1VQ4S 1KTQA 3OVBA 3RAMA 2CPIA 2GO9A 2VPZB 3I9ZA 2MSSA 2N4CA 2EFOA 4ID5B 5KG7A 2MQOA 4ZP7A 3T5JA 3GILA 2PFFB 4X65F 1MMLA 1Q8LA 1YJWS 2BXJA 4WE1B 5JVHQ 4C8ZA 1EP4B 1WELA 3FMWA 3UW1A 2NUUG 4I0WA 2KB2A 3ENQA 2HHVA 2WB4A 5KT6A 1LFWA 4BHQA 1IKXA 1HWUA 1RT2B 2K2PA 3CCZA 4QIGA 5CYMB 4HHJA 2JVRA 3GV7B 2R7QA 3AHPA 4A8SA 1R0AA 3RU0A 2ZC3A 3PX6A 1YJ9S 5B0AA 2XMMA 3MDFA 4PG8A 3CT9A 3DHWC 1FRHA 2EFNA 1N36F 3V2UC 1TVRB 3KG0A 1N4LA 1JLGA 5BYRA 4YR3A 4X2BA 3TA0A 1T95A 2OKQA 1MMDA 3NWGA 3N28A 1R8CA 1HBNA 1IUJA 2V8VA 1F0XA 3HFKA 4NLVA 1TZ0A 1XR7A 1SKWA 3DOKA 1ZM9A 2CFXA 1SJQA 1DQ9A 1RKIA 2ZVSA 3I6PA 4OQJA 4UUWA 4K5RA 2ILZA 1TQLA 6FDRA 3O5TB 3SI8A 3ETOA 4DUZF 1TKZB 4B02A 3C6TB 3UR3C 4MK9A 1DQ8A 3CDWA 3FQLA 4QJVA 1S77D 1DJ0A 5F9LA 2ILYA 4JV2A 4OHYA 5EWEA 2BJDA 3KK3A 1U2RA 2GMLA 2EC0A 1VHFA 2YKMB 4XPCA 1N33F 4ZP6A 1S1VB 2M8HA 4IR1A 3PXGa 3IS9B 1HNXF 3QJJA 2ERRA 4O4RA 1NEEA 4TN2A 1LWCA 3H5XA 4FXDA 3I56S 1FDAA 2JLFA 1KSPA 1T94A 5KFZA 3KLFA 3WC2A 2JC0A 2UVVA 2ZH7A 2VC1A 2BRLA 1I94F 2BQUA 4M5DA 1APSA 2YKNA 4QWDA 2MSTA 2RUGA 1DAXA 2J7KA 4QW9A 2GCFA 1FRKA 4QBUA 4RW4B 2GQ2A 2YVSA 4FBUA 2JEFA 2KN4A 2ZE2A 2K1RA 3OTBA 3IO1A 2M7SA 5GADU 5HMZA 1HD0A 2HAIA 1N34F 2DHGA 1AW0A 2R2UA 3PM9A 1QUVA 4K2XA 3BQ0A 3M4XA 4ERDA 2X1BA 4WFXA 3BREA 2JEIA 1O0PA 4F4ZA 2ASYA 2MQLA 1Y5LB 2CPFA 3DI6A 3S1TA 1RYSA 2KI2A 2EI5A 2IBOA 2FLLA 4O0IA 4FF1A 1M5KC 2RKIB 2MKIA 2IJNA 2BE2B 2IVMA 1V3SA 2HS3A 3HHLC 3N01A 5DS7A 4NLDA 3T6BA 2XHWA 4ID8A 3H4BA 1S1UB 2WSFC 3CE8A 4BWMA 1UMJA 5GAEI 1GTEA 2BA9A 1TL5A 4B9LA 1IKWB 2QRRA 2X1GA 4FF4A 4QIEA 4ZKAA 2JWNA 4Q45A 2FHKA 5KG0A 3R3TA 5KFPA 2W8LA 2DNPA 3PV8A 4EBEA 3G96A 5A8WA 4G1QA 2AYGA 2UXDF 1A6LA 1JXEA 2CZVC 2DO4A 4HT7A 4DR3F 1X8DA 5C25B 2RDJA 1Q86T 3V5RA 4RW7B 2FVQA 1DTTA 3TO8A 4F26A 3FZBA 2J9DA 3M6XA 4KKOB 3WX4A 1I6JA 2IA6A 1Z2LA 3C66A 3HP6A 2NYIA 4URQU 3D1QA 2JLEA 1GXTA 3IRXB 3DRRA 3RTVA 3N6NA 2MJNA 1TFYA 2VKRA 2EFQA 5KT3A 3HT3A 1MSWD 3PKYA 5CZXA 2MQQA 5DDRC 4WFBQ 4QU7A 4M63A 1X5SA 1YRUA 3RB4A 1TAUA 5D4NA 4RW9A 4EU0A 1VI7A 1MMNA 4NCAA 4JI4F 1H2UX 1Y0HA 1OWXA 5C5JA 3HZGA 4YEAA 4RUCA 3H2UB 3IRWP 2CJAA 1HA1A 3CD7A 3C46A 4BWJA 1S1TB 2Q6CA 3V81B 2ZKUA 1HWLA 1SB6A 3ZZYA 1YI2S 4XK8C 2YNHA 3MF5A 5EGYA 4QOTA 3OJUA 1S76D 4DJBA 1XC9A 1XWLA 2HGMA 2WRMA 4C8KA 3M8PB 4DSJA 1LW2A 4DFPA 2OSQA 3SCJE 4CO1A 4NZ7A 3L7PA 3T1AA 3N0VA 3KK1A 3CCWA 2OLWA 4B17A 1Q53A 2HIQA 4BC9A 4ZVFA 2OTLS 2HRUA 2PIIA 3I5BA 4FVMA 2E5LF 4PQUA 2XB2D 2LQ5A 2LA4A 2F9DA 4YR0A 2EBGA 3LAKA 2WW8A 1NK4A 2F7VA 2KTQA 4KHPF 1OS5A 2QYCA 1FESA 5L1LA 2F8HA 2NR0A 1VLYA 1WWHA 2DHAA 4ZVEA 1TUVA 5KG2A 3M9MB 4URGA 2BRKA 4RNOA 2RU9A 5KFNA 3LQVA 4A48A 2R7WA 1R8PA 4R0EA 4A8XA 3RRHA 2KT5A 5A8RA 3I96A 4KGMA 2FD2A 2V2KA 5J2NA 3OTEA 1KHVA 5HBMB 1N5SA 3AY0A 2M3DA 2CPJA 4XIUA 5IQ6A 2VQFF 2OSRA 2DHSA 2V8GA 1YRTA 2XMWA 3UDCA 1FK9A 5KFFA 3SDEB 2C28A 2W24A 2XMTA 2RF2A 5L39A 3BGUA 5DQIA 4DPOA 3HPOA 4E0DA 2KFNA 3OPKA 3QO9B 4YOEA 1RT7B 4QR2A 4X4SA 4DV7F 4A8KA 4K4XA 3RB3A 1T05B 4LF9F 2FJAB 5AE3A 2ACYA 2YNFB 5BYSA 5AXNA 4ZP8A 3K5OA 3DCAA 2H5EA 4KT0C 2W7OA 4NLXA 4QU6A 4FYDA 5DM7Q 4DWIA 4LJMA 4EWTA 2WONA 1M5VC 2AWZA 5F8HA 4IRKA 3CC2S 5L1KA 1TK0A 4A8YA 2L9NA 1FRJA 2ZNZA 3SQGB 4CO5A 4B9UA 5D6GA 3M8SA 3HVRA 3BO3A 5E3AA 5T7LA 2W9AA 4FS1A 2VG5A 4OX9F 3IA0A 2RU3A 4NMLA 1NHVA 1Y3JA 2W9BB 1RYRA 3K5PA 3QLHA 5DGAA 1WTFA 2QFJA 4DV4F 4GO7X 3G9CA 1HNVA 2VFUA 3UD4P 2EWHA 3I31A 5LT5A 1C0TA 3OFFA 5J1EB 1RT3A 3MURP 3Q8PB 5K5MA 4PKDB 2MZJA 1YGYA 4EO8A 1FTRA 1MROA 2AP6A 4MFBA 4FP9A 1KRPA 4O23A 2KZZA 1UJ4A 1WHYA 2QLWA 4ZS6A 4C8LA 5KG3A 3DRXA 2GGPB 5A8KA 6FD1A 3PACA 3FSIA 5GAEU 1N0VC 4B9MA 1T03B 1RI7A 4ES3A 1WACA 3DOMA 2HVHA 1VBXA 2BJEA 3LPYA 4I2QA 3PIOQ 3AA8A 3QZ7A 1HQUB 2B0GA 2LMIA 2V8DA 3I0SB 4FNIA 3WZ0A 3Q24A 4DL4A 2KFZA 1S72S 3BF4A 3EXYA 3DXSX 3SYZA 4I56A 3KLEB 2XY7A 2FY1A 2BBEA 3VCDA 3IXQA 1HW8A 3MFIA 4WE1A 1FDDA 1P1LA 1RT6A 2LXFA 1OQ3A 5KFCA 2UVUA 4C8YA 2MZTA 3CJ3A 3FFIB 2FHMA 3IGNA 2C22A 2HWIA 2ADCA 1RT2A 4O3SA 3NL0A 1H98A 2PT0A 4NCGB 5CYMA 4A4JA 3HX9A 1YIJS 1H3DA 5HLFA 4ECRA 3HDSA 1Q82T 4NLUA 3UQSA 3GFXA 3KLGB 2I2YA 4ED1A 1WNEA 2DK2A 4FXVA 3D0HE 4QW8A 3AQPA 5KFYA 2FGCA 3D54A 2CQ2A 1BQNB 2ROPA 2ZZMA 1TVRA 3DM2A 5L1JA 5DETA 5CYQB 5KG1A 2CDQA 2KDOA 3SFGA 2AU0A 1U1NA 2V4JA 4RBVA 5E5NA 2B4PA 2M88A 2MKSA 3THVA 3P6YC 2O67A 2XG8A 1IJEB 3VR1A 3JSRA 1YJTA 1YSJA 1LWEA 3UCGA 3BR9A 1TV6A 3I5AA 1YQHA 5IS2A 2FJWA 1IXKA 1J5EF 4AYBD 1JLAB 3A1YG 1TKZA 1YHQS 1OQ6A 3MUMP 3UCZP 3E51A 4OI1A 1K0VA 1FD8A 3CIMA 3K57A 4K4ZA 2IM1A 2XSJA 2MZQA 1SIWB