1VBXA

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in edta solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatitis Delta virus ribozyme
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vbxA00
2J76E 3CCJS 2DNHA 2CPFA 2EK1A 3UD4P 2AYBA 1X4FA 3CC7S 2DNPA 1VC5A 2QA4S 2JRSA 5LXYA 4M5DB 2HGLA 2HVZA 5CYJA 3OW2R 4W90B 2G0CA 3TP2A 4J5OA 1IQTA 3S01A 3CCQS 1BY9A 1WWHA 1G2EA 4IO9Q 3H2VE 2DNQA 1VBZA 3MI7X 2I2YA 2MQMA 2AYMA 3DLLQ 2XSFA 4C7QA 3TYTA 4YUDA 3CMAS 3UCUP 2DH8A 3DXBA 2KI2A 2OIHA 2CQ4A 2KXHA 5IM0B 4F26A 4CH1A 2JWNA 3US5A 2LKZA 1X5PA 1DRZA 2RNEA 3CCVS 1OWXA 2KRRA 2V94A 2L41A 2CQ2A 2ZJQQ 1WG5A 5D77A 1SJRA 1FJCA 4W92B 2G1DA 2LMIA 1N88A 2MKKA 1X4CA 5JVHQ 2BZ2A 2X1BA 3BO3A 1JJ2R 1WHVA 2MKHA 2B0GA 4C0OC 2MKCA 1U1LA 3G6ES 2YTCA 2MHNA 2CPXA 3MURP 1Q81T 2CQIA 1WELA 1VQ6S 2MQOA 2MZJA 2KG1A 2N3LA 3I55S 2CPHA 1D9AA 2U1AA 4WIIA 4WFAQ 3B4MA 2KHCA 2DITA 1H2VZ 1WEZA 1WEYA 2E5GA 3BS9A 4QU6A 1A9NB 1KD1T 1KOHA 1U6FA 1PGZA 1WG1A 3G8SA 2DGWA 2VODA 2DIUA 5DM7Q 2G4BA 2KXFA 4CIOA 1FO1A 3PIOQ 5DDRC 1R8PA 3NS5A 1YJ9S 1HD1A 1H2TZ 1X4AA 3R1HA 1QVFR 2RRBA 2PEHA 1OO0B 5GAGU 1ZH5A 3NNHA 3S6EA 3S8SA 4QU7A 3TO8A 4LIRA 4V19X 2F9JA 1X0FA 3ZZZA 2CPYA 2DGUA 2CPZA 4PKDB 2SXLA 3MXHP 2HGNA 2LYVA 2YH0A 2MYFA 1SJ3P 1NO8A 2L9WA 4C4WA 2MPUA 2A3JA 2DNZA 4TU8A 2K8GA 2DGOA 2XS7A 3VAKA 1A7GE 2DNYA 3HI9A 3G71S 3UWTA 4RU2A 2KT5A 1WI6A 1WEXA 2FY1A 3CCUS 5HL7Q 3BO2A 2DNMA 1ZZFA 2I38A 5CXTA 2E44A 2YKAA 1S79A 4WFNQ 3NNAA 3CC2S 2MY7A 2MKIA 3BEGB 4WFBQ 5MLCV 2MZTA 3EGZA 2CQGA 2RQCA 2DHXA 3CCLS 1YTYA 3CCES 2OSQA 1QM9A 2ZJPQ 2LXIA 1FHTA 2CPEA 4LJMA 2M8DB 2LEAA 4OZ1A 1YWXA 2DH7A 2E5JA 3SDEA 1RKJA 3IWNC 3G4SS 1SJ4P 3U1MA 1FJEB 2DNKA 1UAWA 3VALA 2MQLA 2N3OA 1UW4A 2KG0A 3LQVA 4IOAQ 1X4HA 5LJ3Y 4CH0S 3VAMA 2BOPA 1WHWA 3S7RA 3G9CA 3B4DA 3ULHA 1U1RA 2DNOA 3V4MA 2KN4A 2DK2A 2MZRA 1P27B 1SJQA 5HO4A 1DBDA 3LPYA 2DNLA 2X1AA 1K9MT 2N7CA 1URNA 1U1KA 1S72S 3VAJA 4EGLA 2YH1A 3VAHA 1M90T 1U6BA 3I56S 2DHAA 4QPTA 5LJ5Y 2D9PA 3CC4S 2ERRA 5IQQA 2M70A 3EGNA 4FXWA 1VQNS 1L3KA 3CMES 1HL6A 2JVOA 1Q7YT 1U1QA 5LSOA 2MJNA 1VQ4S 2MJUA 3CTRA 1NU4A 3UE2A 2CQPA 3H2UB 1U1NA 5GAEU 2DGXA 3NMRA 2HYIB 2KXNB 2XB2D 2MMYA 4OZ0A 2MKJA 3CCRS 2LCWA 3RW7A 2OJ3A 2EK6A 1H2UX 1Q82T 1OIAA 4Z2XA 1U1OA 3RW6A 3U1LA 3P6YC 2MXYA 1UP1A 4UQTA 1R8HA 1FT8A 5D78A 1WHXA 2LEBA 2N82B 2MY8A 1VQPS 2AYGA 3MDFA 5BJRA 2DNNA 2KRBA 1W2BR 2Q79A 1JJ4A 1WF0A 1JMTA 2ZJRQ 2HGMA 3VF0B 1RK8A 1JJHA 2KYXA 2M88A 1X4EA 2M0GB 2MZ1A 1VQKS 2J0QD 3NS6A 2MKSA 2OSRA 1VQMS 5GADU 2MQPA 4WKRA 1WG4A 2KM8B 1K73T 4F02A 2LXUA 1X5TA 2DISA 5GAHU 4TU9A 2MGZA 1N52B 3CPWR 2F9DA 5DM6Q 2RS2A 2MQNA 3P5TL 3CXCR 2KH9A 1M5PC 2VOOA 3SDEB 2KVIA 1WI8A 3MUTP 1U1MA 2CPDA 3MD3A 1X5SA 2CQ0A 1N8RT 3FEYB 3CD6S 1YI2S 2RT3A 2JVRA 2CQDA 2D3OR 2VONA 3Q2TC 1XN9A 2CPJA 2U2FA 1FNXH 2MB0B 1HD0A 2DO0A 5DDPC 2DGVA 2O3DA 1VC0A 4YOEA 3L3CA 2OTJS 2FC8A 2DGQA 4PR6A 5IFMA 2KFYA 3CUNA 3VAIA 3R1LA 2KM8C 2NLWA 3D2WA 3CCMS 1Q86T 4BS2A 5EN1A 1CVJA 2XNRA 1VBXA 3UCGA 3HHNB 2XNQA 4UY8T 3BO4A 4F25A 1WF1A 2FHOB 1N54B 2WBRA 2M4MA 2XS5A 3IRWP 2X1GA 1U2FA 1KOOA 2DIVA 2GO9A 1DHMA 2M52A 1HA1A 1U1PA 4TU7A 3K0JA 3JB9k 2HZCA 1YJWS 3NNCA 3J7YU 1PO6A 1VQLS 4ZKAA 5GMKa 2DGTA 3N9UC 2LA6A 3UD3P 1M5KC 5DETA 3J7ZT 5ITHA 1D8ZA 1WTBA 3VAGA 2M8HA 2DHSA 1M5VC 2X1FA 2LQ5A 5GVQA 5H1SV 3CULA 1OPIA 2RUGA 2F3JA 2NZ4A 1X5OA 2MZQA 2CJKA 3R27A 5DDOC 1UFWA 3P49B 5IM0A 4IOCQ 4LMZA 2M9KA 2DGSA 3MD1A 1FXLA 4P6QA 3ZZYA 1AUDA 2MSTA 3CF5Q 2EVZA 2DH9A 3FEXB 5DDQC 2ADBA 2RVJA 5LSLA 2LA4A 2LECA 1FJ7A 3PIPQ 4U67Q 2DB1A 2FPHX 5JVGQ 2J0SD 1YITS 2DNRA 2JX2A 2OTLS 1VQ8S 2CQHA 1M1KT 5FJ4A 4A8XA 2ADCA 2MZSA 4ED5A 1H6KX 2XS2A 2MSSA 1SJFA 1YHQS 2RRAA 3SMZA 2MQQA 2QEXS 2J8AA 4Y0FA 3VAFA 1K8AT 2DNGA 1WHYA 4FXVA 4WCEQ 4WF9Q 1WF2A 3SXLA 3THPA 3Q2SC 1ZZNA 4IUFA 2D9OA 2L08A 2DO4A 1QVGR 2VOPA 1YIJS 1VQ5S 4Y00A 1X4DA 1O0PA 2KU7A 2M7SA 1NJIT 2YWKA 4PRFA 1SXLA 2MGZB 2CQ1A 4TLQA 1M5OC 4YB1P 1B7FA 2CPIA 4QQBA 5LXRA 2RQ4A 2QFJA 2RU3A 2AYEA 3G96A 3UCZP 1VBYA 1VC6A 2PE8A 1KQSR 2K3KA 2FC9A 1VQOS 2DHGA 2CQCA 4CQ1A 1KC8T 4ERDA 2AD9A 1X4BA 1VQ7S 2UP1A 2RS8A 3CCSS 2E5HA 1DZ5A 1P1TA 3EX7B 2GHPA 3MUMP 3G8TA 1VQ9S 2CQ3A 3MUVP 3MOJB 1F9FA 2CQBA 5CA5A 1X4GA 2M2BA 2E5IA 1YJNS 3THTA 3P3DA
chains in the Genus database with same CATH superfamily
4U7UD 4WIQA 3KTQA 4M95A 5E41A 3MM5B 5LMUF 1CJVB 1BUXA 3GV5B 3SIPB 4M8LA 1BY9A 4ZHRA 2V2KA 1T02A 4LF9F 5J2NB 2NPFA 5I3UB 1KVJA 3DLLQ 2OKQA 5DJBA 1FK9B 1MW7A 1T9XA 1TK5A 5C2GA 4YHHF 5D8HB 4LF7J 1ZAXA 3ZTOA 3M30A 4ECRA 3BO3A 2P5VA 2UUAJ 2MKCA 2J7KA 4JI8J 4DBQA 4J9UE 3AA8A 1JLGA 3KK3A 1HI1A 2OO4A 4ALZA 1T95A 3HSGA 1VOMA 2PT0A 4AQYJ 3R5AA 4QU6A 5E2QA 1NJWA 1N6QB 1KDNA 3DLJA 2HW3A 1YX2A 2VODA 4U6PA 2IRYA 2F40A 2PMHA 2KJVA 5CZVA 4Q8EA 4G65A 4LVNP 4DR2F 2F4VJ 5F8LA 4J9LA 1I94J 1FESA 3HVAA 2YH0A 3DGPB 4RZRA 4LF9J 4R5PB 2A3JA 4CWBA 4YB7A 1M1HA 1WEXA 2C42A 3TEHB 3ADAC 4R8UA 3EGVA 3LGNA 3GCWP 4OV1A 5IC4B 1NHKL 1RCXB 2QLBB 2OSQA 1IKXA 2ZJPQ 3UO0A 3TARA 4ZMMA 3LWMA 3FUYA 3PO4A 5KFIA 2VFSA 5A2QU 1Y4ZB 3W5YA 1CC8A 3KK2B 2RMLA 1N5YA 3CIMA 2RILA 3WDOA 3IR5B 1URNA 1S10A 1JIHA 2QMUB 4DLEA 5D15A 3WIVA 4N41A 2DHAA 2W9BA 5ETTA 3CC4S 1IM4A 2VFVA 3G6VA 3N28A 4DR7F 4C97A 5BYQA 1WKJA 3OVBA 3MPUB 3RB4A 2RF2B 1RXOB 2DRAA 3K58A 3IM8A 3M7VA 4F4XA 3R5CA 2D69A 2ALYB 3O2IA 2KFZA 4NZ0A 4F50A 2WVBA 2FVRA 2IVMA 1UL3A 1HBMB 3MDFA 4NXMJ 5BJRA 2EFNA 4K2XA 1WF0A 2NYIA 4JI3F 1RK8A 1IKWA 1S1UB 5GAEI 3TVKA 4NEZA 4DJBA 5A8RB 5KFWA 1CJKB 1IBLF 1UEUA 4FN5A 4ICLB 1X5TA 5DLGA 5H9EJ 3CXCR 1NUEA 2UV8A 5A2QY 2WSFC 3ZZOA 3T1YJ 2WOMA 2BW2A 4QZVB 2R4FA 3QT5A 2DR6A 5KG5A 2FDNA 1WDDA 5D6GA 2DGQA 2IC3A 1JLFA 3MCSA 3D0IE 4MKBA 1TVRB 2PFDA 1WKKA 3OHBA 4DCPB 1WF1A 4QIGA 2NR0A 3EE3A 1N54B 3D6HB 3DLEA 4I2PB 2YNIA 4QYZJ 4Y2CA 3W65A 2QSWA 3A3NB 4RJVA 4Y2MA 3FSIA 3LWLA 2B4VA 1CLFA 1XJWB 3UD3P 1D8ZA 2OD4A 3LW5C 2X1FA 2LQ5A 2KHDA 4PQUA 5IM0A 2DGSA 5CYMB 5K8PA 4MJKA 3G6XA 4M63A 5BR8F 5KFDA 2I9SA 4NA3A 4OYOA 2QN6B 4A8XA 1IBLJ 4KJIA 5FIIA 3M2UA 3LGMA 3KDOA 4JI6F 3AAWB 1NH7A 4ZVPB 3G6YA 2IIHA 3CIZA 3NGDA 4AL7A 2ASJA 1G3OA 1U2RA 2HHPA 2VOPA 4LSLB 4J9PA 1UA1A 2VHGA 1NJIT 1Z4UA 1SXLA 4CT9A 5ADZA 2GAGC 4XAKA 2I8EA 1QE1A 3W5XA 3LTOA 1X4BA 3MECA 5HLFA 1P1TA 3GV7B 2GQQA 1RTDA 3MCOA 3SSSA 4M5LA 3LOUA 3AJ2A 1U02A 2AYBA 3Q8RB 2EBEA 2OGUA 4M5DB 2DVIA 3DMJB 4O3QA 4IO9Q 1VS3A 3FJ2A 1MMNA 4M5NA 3UCUP 3N5FA 2G2YA 2KRRA 3W5ZA 4JI5J 5A8WB 2FGCA 3DLKA 1NSQA 5EGYA 1EARA 4N8OA 2BZ2A 1DJ0A 2FHJA 3JS9A 3MPWA 1U1LA 2ZOMA 3PJWA 4V1Ak 4F3MA 2BYCA 1VQ6S 3DLBA 2MZJA 3U1NA 4C8YA 3EVWA 4RWWA 4PXBA 4JV0A 2K1RB 3SCJE 5D4LA 5DDRC 3SQGA 2P6SA 2UUBJ 3KK1B 3RBZA 3I0SA 4Q5VA 1WSRA 1RU1A 3H7HB 1UPMB 4GC6A 1MWYA 1LWFA 4FZVA 4NA1A 2W4PA 1VRTA 1TK0A 1NO8A 4OYBA 3D28A 3PJ9A 4E0DA 3HI9A 3V6HA 2IDEA 3UWTA 4I2QB 2YPYA 3W2VB 3PVXA 3KYLA 2H51B 3N6MA 2RQCA 1W26A 2DHXA 2WZ1A 1FERA 3J7Z5 1FX2A 2LEAA 1H98A 3ENAA 3OR2B 2Y0SD 5EWGA 2E9TA 2Q1LA 4KKOA 2GVZA 4F0HA 3GFYA 1PC5A 3M2RA 5HVHA 2DK2A 1YRUA 4QR1A 2RU9A 1S72S 1JX4A 1NB7A 1RZMA 2XSJB 3LAKA 2GJIA 1LW0A 2ABYA 3ISNC 4NI2A 1RHKB 2QJ3A 2AJ0A 1V5VA 4ED2A 3T3FA 2EG2A 3KLHA 2XMUA 5B0FA 4ES3A 1VHIA 3VCDA 4IG3A 2ZC4A 2V5HG 5DQGA 3KHRA 2Q6BA 2MKJA 4MIAA 4YB6A 2JFDA 2VDHA 1RT6B 5KFAA 1TKXA 2AT1B 4DUTA 4ILLA 1R8HA 2LEBA 2N82B 4PG7A 1LK7A 1YLXA 2C2EA 2AYGA 2HVHA 2WCXA 2XG8A 2VBZA 2E7WA 4I6AA 2R8IA 2KYXA 4Y65A 4DUZF 1HQEB 1I3OB 2OD6A 1CJUA 2QIFA 2CZVC 1RT3B 1FFGB 3V2UC 3RGIA 3EMTA 4IR1A 2VC0A 2H48B 2VBWA 1N52B 2YY3A 4JI2J 2V50A 3HVRA 4IH6A 1EKRA 1S1XB 4ZP7A 3D7SB 3KUGA 2BJ1A 3HPOA 4LF4J 1UVKA 3FCHA 2MB0B 4Q2MA 1RWKB 4B02A 2YWWA 4NLDA 2UUWA 2KM8C 2V69A 3D2WA 2GQCA 4LRFA 3BZQA 1N5QA 3CJ8A 2M5YA 1LKZA 2OPPA 4KR0B 1LNQA 4XIUA 3HM9A 4CNYA 1WSVA 2FGOA 1S9GB 3K0JA 2ROGA 4J9RA 1HIYA 2ZOFA 1M5KC 1YZ6A 2LA6A 5D3GB 2JEFA 3L7PA 3CMQA 5H1SV 5ETPA 1JLEB 5HMWA 1ZPWX 2E66A 1AUDA 2ADBA 4OHZA 2FPHX 1HKAA 1UVLA 3GYXB 4P10A 3CJ4A 2QEXS 1F5AA 3KG1A 1S6PA 4RUHA 3WZ0A 2DNGA 2YNFA 4KFBA 1ULRA 3O6QA 4OJ3A 4LBPA 2KU7A 4DR1J 2Y3YA 4E2FB 1M5OC 5B0EA 4OLOA 5KFKA 5K9FA 1HMVA 1TAQA 3D3BJ 2AD9A 1PJ7A 3SFUA 3OSNA 2NYHA 1Z2LA 4HDGA 3U7JA 1XR7A 2XLIA 3TAPA 4J9MA 1XC9A 5G0RA 2N4CA 2RQMA 3UNGC 4Y2KA 4P7TA 4LBIA 1UJ6A 2RRNA 3LO3A 1V3RA 4GVBA 4KC5A 4PWUA 3CVKA 3VZHA 1C1CB 4UOHA 1J5EF 2OUGA 3MOZA 3DOLB 2KO1A 5EWEA 1T03B 2YKPA 2VICA 1DRZA 4IFYB 3DRPA 2KZZA 1AW0A 4MFBA 3CJ5A 3RR7A 1SJRA 1L3VA 2CDQA 3ZZUA 2JH3A 3RRHA 2GVDB 5L9NA 2XO6A 5E0OA 3CCTA 1BE4A 4DDFA 2CPXA 4USJC 4C3MA 4A46A 2W24A 1XMOJ 5J2PA 2AQ4A 1NKBA 1B0VA 3J80U 4C11A 2U1AA 1XQIA 3R3TA 2ZE2A 4OYZA 1WEYA 3AB2B 2I6WA 2LQ8A 2OPRA 1KD1T 5IV3A 4JI7J 1HBOB 2JFKA 2AGOA 2JSXA 3NS5A 2W9CA 2HHWA 3KLIB 3E3XA 3DGVA 4NXNJ 4D3HA 1OO0B 1OQ3A 3MPVA 4B9LA 4V19X 1YBTA 3MMBA 2GMLA 4EK2A 4ED7A 4PPDA 2W9AA 2XCPA 3TZZA 3EICA 4Q43A 1WNEA 2HKEA 1WC4A 2GCFA 1QTNB 3M8PB 4OI6A 3OTEA 1GMWD 3CCUS 1YG0A 1CJTB 3ITHB 2I38A 1ZZFA 2KKHA 3W8GA 2CRLA 4R0JA 2XLKA 2RDJA 2LU2A 4PPZA 3MR3A 2CAJA 3IBWA 4P2XA 1OSDA 4RBVA 2QE5A 4PG8A 1E6YA 1KSPA 4KHPF 3IM9A 3ONQA 1M0SA 3IWNC 3D1HA 1BMQB 1RWNB 5E3QA 4ILRA 1NHVA 2XWYA 4QWDA 3MM7A 3E01A 4JV2A 2WAQD 2HHSA 2KB2A 4K4SA 1FDAA 4OHXA 2UUCF 4DX8H 2VBXA 4CZCA 3DU5A 2DHHA 2IM0A 4O4GB 4JI0F 2HAFA 1N0UA 3PR5B 2UVVA 3DOMB 2E9ZA 1L3KA 2VF3A 3DLHA 2XCAA 3KHHA 5LOQA 3VQTA 3EVOA 4KIAA 1L5UA 3FZ2A 3NMRA 1FKPA 2CJ9A 1EETB 2EFPA 2KT2A 3RW7A 1R43A 1B4SA 3KLFB 4KV8B 5HK4A 3C3LA 1S99A 2ASDA 2ZZTA 2R2TA 4ED6A 1VQPS 3BPDA 2ACMA 3L4BC 4IQMA 1IBKF 1URRA 1IN0A 1VHFA 1VK3A 3TVZA 2LXFA 1NRKA 1R31A 4KB7A 3MR6A 1S6QB 3TX8A 1AZSA 4NCAA 3MZIA 1R0CB 3TAMA 2YKMA 4EMDA 2D3UA 1X5SA 2CQ0A 4PCQA 3OQ2A 2WVFA 3PJXA 1R6YA 1HD0A 2MTLA 2VFTA 3GJQB 2XHWA 2QV6A 1LXNA 2FHOB 2W7AA 4ID5A 4HHUA 3JB9k 4YN3B 5K8MA 4FYXB 2I5JA 3HLUA 3PX4A 3N9UC 4JV5F 3UNYA 2NZ4A 1D9FA 1FXDA 2BJ3A 2VPWB 2ZC3A 2VC1A 2B4UA 3DM2A 1F5CA 4XTTA 2RVJA 2YQ0A 2LECA 4S0MA 1GFWB 3WQPA 3DFEA 2HMIB 3VZIA 3OL8A 1RWOB 2EW9A 2C3PA 2O67A 3CNQP 4NRTA 1X0PA 3DDIA 1TP7A 3R9LA 1YJVA 2FZKB 1X4DA 4FYYB 3F44A 3L9ZA 2YWKA 5LMNF 4NA2A 1XERA 4P52A 4IH5A 5HP1A 1H73A 5ETLA 2FJAB 2DHGA 1T05B 4B3MJ 3AA9A 2E1PA 2UP1A 5KOWA 2XEXA 4I56A 4XDDA 2CQBA 2KL8A 3PNIA 5CA5A 2M2BA 2EFVA 3KLEB 2VL1A 4LFAJ 3AXMA 1S6OA 3MCMA 2Z57B 4KGXB 4A8WA 3OTDA 1BWEA 3B6BA 1IQTA 2B8PA 1F9EB 1FEEA 1NJZA 1U8SA 2GHWA 2CKWA 3HKWA 5C5JA 4C7QA 2GW8A 3MMJA 2KI2A 4RU9A 3QFHA 2C22A 2AGPA 1K0TA 2CNNB 3US5A 3FSYA 2L41A 2V94A 4C8MA 4TY8A 2YNGB 2WVEA 3R7BB 4DSIA 4E98A 1RBLA 4B3SF 2YNHA 4LF5F 1UWBA 2XYPB 2GX8A 2ATCB 3MURP 2W01A 1HHQA 1TTHB 4M5JA 2MDAA 2N3LA 4O3NA 4YEAA 4IRCA 1SKWA 3BR9A 1ZS6A 4F3OA 4X66J 2KHCA 4LT6A 4BBYA 3GJRB 4FKYA 1RU2A 1PJ5A 3L7UA 4NYPA 2W25A 1SBRA 1SH0A 2NZCA 3HZGA 1IJFB 3C16A 3HHKA 2BJEA 3CD7A 2CWXA 3M8WA 3NXZA 1FDNA 3V81B 1R8BA 2XMVA 4H4OA 3ZZRA 4NOHA 4MIWA 1VQSA 2XS7A 1JLAB 3IS9B 3OV7A 1OS5A 1AUSL 3AODA 3W64A 1YSJA 1NKEA 3AB4B 4DCOB 4U95A 1UKUA 1RHQB 1RLCL 2BQRA 4DL6A 2JL9A 2NXEA 1SH2A 4Y6IA 5E3CA 1DTQA 2CPEA 2IDLA 3SDEA 1FD2A 5GADI 3OFGA 4Q45A 3W1YC 1RKIA 3NP5A 3U1MA 3MM6A 4DV4F 1N32F 2IYIA 4FPIA 1VK8A 2NUUG 4WTYA 2KN4A 3PW7A 3CDWA 1ICEB 3H5XA 2IM2A 4CLPA 4QR0A 3TUIC 2N7CA 4FF3A 1HYSB 1HQ2A 3VAJA 5SUHA 3UR3C 1KR4A 1M90T 3DI6A 2V4RA 3K8VA 2J0XA 3DLGB 5IQQA 3RJMB 3BBFA 3JTNA 3CMES 3FNNA 3EVMA 2Y1LB 4CRJA 4B9SA 2QL5B 3M4XA 1ZTWA 5IZHA 2HHTA 4HI2A 1YQHA 3M8QB 1U1OA 1UWAA 1KQGB 4DHVA 1TV6A 2HBRB 1JMTA 2RKIB 3KLVA 3OFEA 1Q5VA 3VF0B 4ECQA 3Q0AA 1UJ4A 4I68A 4BC7A 4B3OA 3AQOA 4KE5A 5C25B 2J0QD 6AT1B 4QW8A 4RR5A 2MQPA 1DTTA 3GG0A 2FJDB 5KOXA 1N32J 2MQNA 4DV6J 1WI8A 4YMEA 1RYSA 1RT5A 4IQXA 5J2MA 3C8YA 5IQ6A 5EUHA 3M30B 1BC6A 4WYWA 2W2PP 2OPQB 2R7XA 4X4SA 1RAEB 3U27A 1H74A 2CWKA 1F3FA 3MAAA 3QQCD 3DYAA 4GMKA 2NCKL 5H9FJ 1R0BG 4N8NA 4Z37A 3JYTA 2DHSA 2I0XA 2RHSB 5KFJA 2ZUAA 1UFWA 4DQIA 3GYGA 3MD1A 4DUYJ 5CD4A 2DD8S 3BSAA 1ZM9A 2DH9A 2V6AA 1C4CA 3OUYA 1B99A 1GTHA 2OTLS 2DY1A 3GONA 3RZAA 5FJ4A 3MPYA 3I0RA 4MK7A 3VAFA 1V6HA 2R7TA 3SCLE 3AJ1A 4OZ3A 1FCAA 4LF2A 4WF9Q 3Q2SC 3F73A 5E33A 2XQCA 2E5LJ 2D9OA 4MAKA 5KFCA 1NPKA 4PRFA 1KP6A 4DSJA 4AXIA 2HPUA 2AZ3A 5L1JA 1JLBA 4WZMA 2PDAA 3BBCA 3AD8C 5I42A 3UCZP 3KOAA 1HNXF 3B8HA 1VQ7S 1JLCB 2JZ5A 2IHR1 3SYZA 1RE1B 1AXQA 2GHPA 3MMCA 4FPRA 1F9FA 4ANEA 2E5IA 2DCLA 1T9UA 5D0RA 3PG9A 2JRSA 4C2MA 1HR0J 2BANB 3QBCA 2ZH8A 4HVZA 3G86A 5KG1A 2BA9A 1NMEB 3PFOA 2IJRA 4ZPTR 3Q22A 4Q0BB 2NQPA 1S12A 1RUSA 2DH8A 5AJ3F 2CQ4A 2FZCB 1CPZA 5E3PA 2RNEA 1OWXA 3T1HF 3CD0A 3VGTA 1P9YA 4GKKJ 2CQ2A 3QRPA 2VG6B 3BN4A 3ZZTA 1FJCA 1XNQF 2MKKA 4H54A 3SCIE 1HPZA 1WHVA 2OEMA 1B7YB 4Y3CA 3I9ZA 1RADB 5K20B 1HBNA 4U7CA 2BJDA 2HNYB 3AOCA 4WIIA 1TKTA 1IKWB 2AJFE 4F8RA 1AB8A 4YR2A 4LFBF 2W2QP 2HBQB 2ROPA 4NLPA 4YR0A 2DYAA 1R3NA 1TL4A 2HG4A 2BE2B 1UVNA 1S0MA 3ET6A 3K7RA 5K14A 2PGCA 2HGNA 2MQ8A 5DG9A 2F65A 3OVAA 1F2HA 3BSCA 4DWIA 1WC5A 2W7PA 2UXBF 2AW0A 2VPZB 1HI8A 3ZTQA 2K8GA 2IC3B 2J7UA 2A6MA 3W62A 3P8BB 3OT9A 1MROA 1F0XA 1HNWF 2PFFB 2FY1A 3VQSA 4CCHA 1ZA1B 1S79A 3M6UA 2MKIA 3BEGB 3T5HA 2CNLB 5MLCV 3T6JA 1DLOA 4P2SA 3SSQA 3ZZPA 5KFTA 3SV3A 3VTIA 3LAMA 4RW6A 3IXQA 2QYGA 2YWEA 5LM7E 1X4HA 1NK9A 4KY3A 1YJUA 4DV2F 3G9CA 2E7XA 2P9CA 4O3SA 1NH8A 4I6WA 4DLGA 1S0VA 1SJQA 3IR7B 3M2UB 4DV7F 1CULA 1SKRA 5J1PA 4DPWA 3VR1A 5A0YA 3NWRA 4J9QA 1JLQB 1B3TA 3HHLB 3K2YA 1UFLA 1HNVA 3MEDA 1RA7A 2I1RA 4DV3J 1WC6A 1WKLA 2R42A 3C19A 1HL6A 5B08A 1MNEA 4OZNA 3WX4A 1XMQF 4AL6A 1RTHA 2OJ3A 3LP1A 5EHHA 1Q78A 3MECB 5HLFB 1GQEA 5D78A 1YJRA 1PYTA 1YJTA 4UOFA 2CJQA 3M6WA 2HGMA 4ED4A 4OI4A 4V19J 2DEJA 2ZBCA 3N4WA 3T41A 2C3UA 3C66A 4ZPWR 1EHWA 2R7VA 3V6DB 3HT3A 2LXUA 3F0NA 4A8YA 3BGFA 2FLNA 2MGZA 4C9DA 3CPWR 2KH9A 3KHLA 3MR5A 1NSPA 2BACA 3FMBA 2XMMA 3BGRB 4DR6F 3HVTB 2OAUA 1GNKA 1XEZA 1KFSA 2LQBA 2BDPA 1TL5A 1FTRA 2O3DA 1FRMA 2V8GA 3IBFB 2BABA 4ZN1A 3PW5A 4PR6A 2ILYA 3CSKA 1JXEA 4P72A 1VIXA 4CLUA 4PZVA 2WBRA 2M4MA 2AF6A 2IRXA 1DHMA 5I3PA 1V3ZA 2KZMA 4N47A 4ZCLA 1J5OA 3J7ZT 1L3SA 4Z7CA 2Z30B 3JTPA 3GQCA 1I51B 3IRXB 4NLGA 1N34F 2C2ZB 4OYPA 4Y28C 3BGOP 3ZZYA 3VGUA 2GMHA 2CQHA 4A47A 1Q4RA 3J7YI 5M2PA 2LVWA 1TL3A 4BDPA 4X4RA 1LWFB 2F8MA 4FXVA 4OI2A 4HEA9 1PJ6A 4IUFA 5HI7A 1N5VA 4DN9A 2M7SA 3W2WA 3BREA 2RDIA 1TL7A 2FLPA 1D9DA 1HARA 1F1BB 3PHEA 4HH1A 1S6UA 5J1NA 2DXFA 1RDRA 4DV5F 1X4GA 3MEGB 4QWBA 4DS4A 2BR0A 2O5DA 2J9DA 4JI4F 5HMYA 2G9OA 3HK2A 5LXYA 1C4AA 1ACMB 4D3GA 4K5RA 1CEZA 3S01A 1RT1B 2HFSA 1VBZA 2FVQA 3BDEA 2AYMA 2HNZA 4RW9B 3JXOA 1T94A 1F6TA 2OIHA 5CCMA 3A12A 3I5BA 4MYUA 4RWXA 1FRXA 3JAMU 2X51A 2BQUA 4HACB 3D54A 1SIZA 4GKJJ 3W8PA 2OH2A 1MMLA 3EUNA 1GMWA 5KFNA 1FNOA 2HIYA 4J9VA 2JC1A 2GAHC 2KFNA 1IQZA 1RT2A 2G2ZA 4ZP9A 4RW7A 1SL2A 3NKYA 4ZA1A 4WP9A 1N0VC 4CLFA 1CJUB 1NDLA 2G4BA 4OI0A 1YJ9S 2WSEC 2D3O1 1NPRA 4B08A 1ZAWA 1TUGB 4P73A 2XMAA 2HVDA 1CSJA 1NSAA 2VA2A 4O0IA 5L39A 3H4BA 1XR6A 1JNRB 2XTJP 2H1YA 2B4PA 4DFPA 1FKOB 5L46A 3ENVA 3A8KA 2IRUA 4RU2A 4TY9A 4FYWB 2OPPB 4O3OA 3BBBA 3DRRB 2IAJB 1T3OA 3BH6B 3DN9A 2J9EA 3DRSB 3JAMY 4XPEA 4M5MA 1SC1B 2B3TB 2YX4A 2DNKA 3QGGA 1S9EA 2MQLA 3W66A 1G4CA 2ILZA 4IFVA 4IOAQ 2H5IB 5KG4A 3VAMA 5KFHA 2OPSA 2B7CB 4X65J 4H4MB 2MZRA 1S1TA 4WP3A 1P27B 2IA0A 4K0KJ 3L09A 3DCAA 5HATA 2BV3A 3VVUA 1S6PB 3QFWA 2NREA 4CO0A 2YNFB 2ZZMA 3OFFA 2D1CA 2D9PA 3NGTA 2K3IA 2VFUA 3NOGA 4EI2A 3EGNA 5C42B 1HNZJ 1VQNS 3C6TA 4QWCA 1U1QA 2MJUA 1WUUA 2DGXA 4LUBA 2HQDA 1HMVB 4Z2XA 2FVCA 4NLWA 2P9EA 4XO0A 3GIRA 2ATLA 2IYGA 1UVMA 3JSRA 2QYCA 1AROP 2MZ1A 2AX0A 1REVB 4UT4A 1BLUA 3LH2S 2AEFA 1WG4A 3BM7A 4PWDB 1SKSA 4X62F 1YRTA 3DU6A 2HFOA 5AXNA 2HQIA 3QGHA 3CD6S 1CS4A 3BJYA 5EWFA 3DRPB 2DCUB 3QSYB 4DV0F 4ZPBA 2PMZD 5IFMA 4OX9F 4MK8A 1SUQA 5EN1A 1VBXA 3UCGA 2HHHF 1RLDA 1NDPA 4LF8J 2AJ2A 4A8OA 5B7WA 4TN2A 3BQ1A 1GK8A 3MM5A 2EFOA 3O8WA 4F2SA 2PC6A 3M32A 4OX8A 4L76A 1P8GA 4BWMA 1PCAA 2ZE2B 5J2NA 2R2UA 5I3UA 3OXFA 3CULA 1UVJA 2CJKA 4NLSA 2XI3A 1MU2B 2EXUA 1XTZA 1RTIB 1FE0A 2XMJA 4CO1A 1GEHA 3FEZA 3M6XA 2B8QA 1VQ8S 2FUG9 5KFSA 5KFPA 1MN7A 5F9LA 4F67A 2Z2LA 5IS2A 4QIFA 3R7SB 3QT7A 2DKOB 1C0TB 1M5HA 4WFZA 5L38A 4OL8A 1UW9A 4M5KA 3TA2A 4UUWA 4Q8FA 3I5CA 3DHXA 1EAYC 1WDTA 2IBOA 5KT5A 1T0TV 3WC2A 3J81Y 2A6OA 2J8SA 1OPZA 1RAHB 1HQUB 4LF6F 4RNMA 3GR1A 2PE8A 1KQSR 1QAYA 1VQOS 2MLZA 1FVSA 3RYLA 1FF2A 4K4XA 4DX7A 2ROEA 3AD9C 4PG5A 1TR0A 2J76E 2HBYB 2VFRA 3CCJS 1JNZB 3OR1B 2CVEA 3DGPA 3MM7B 4R5PA 3E01B 3QNWB 3OW2R 2G0CA 1Y0HA 4FKXA 2V34A 4B3TF 1PILA 2I2YA 5HBMB 5D0GA 5KG3A 2P2CB 3QWUA 1PAUB 4F26A 2BVZA 2EKYA 2RUSA 5KFBA 3PFEA 4MKAA 1HHTP 1ZM2A 2HIQA 3GFXA 1WG5A 4DMZA 3V6KA 4OYMA 1D3WA 3M8RA 1PG5B 4X4TA 3I32A 3KK2A 5U47A 3TI0A 4HDHA 4HH0A 3UDEA 6FDRA 4ZITA 3I55S 3H25A 4UZBA 2MLYA 1D9AA 4WFAQ 4X4QA 2DITA 4A8SA 1WEZA 1KLNA 3LP2B 4O3RA 1IWGA 2V8DA 1AZSB 4WXWA 1QVFR 3TUPA 3TAMB 5L1IA 3H0PA 2YKMB 2UXDF 3IN5A 3EZ5A 3LUYA 5HVFA 2RF2A 3D6MB 4NCGA 4PKDB 2YPZA 4I69A 2MYFA 1SJ3P 2L9WA 1JB0C 2MPUA 5IWAJ 1GMVA 1FJGF 3LA0A 3TZYA 2VIHA 2QL9B 4DI6A 2E44A 5A8RA 1CJKA 3CC2S 4MKYA 4ID5B 4DR3J 4PXDA 3EGZA 3PACA 4ICLA 2I5JB 4KT0C 1QUVA 2AJQA 3UR0A 2PEBA 1JXLA 2YKOA 1EIYB 3RAMA 2JLEA 4CH0S 4NE9C 4OZLA 4IO1A 3HX9A 5RUBA 4AYBD 1TVRA 2PA3A 4NLYA 1WC3A 2GHVC 4Y34A 2UU9J 4I2PA 2UXDJ 5LJ5Y 4HKQA 1FEHA 1C1BB 2R7WA 3M2VA 3HSDA 2GNKA 5HN0A 4CYUB 4L3KA 1NXIA 4N76A 3CTRA 5HP1B 4USIA 2MMYA 2X3DA 3CEDA 4KBIA 1IKVA 4IYQA 4F3QA 4AL5A 3P6YC 4LF7F 1QLNA 2V4JA 2ACYA 4HYKA 1RTJB 2UUAF 4QCLA 4DL7A 3KKFA 1IBMJ 1S4FA 1HBUB 1NK0A 3HHEA 4JI8F 4N77A 2R7SA 5F8NA 3UN5A 4QWAA 3EGWB 2J5AA 4LSLA 1MSWD 1K0VA 3CE8A 4FF1A 4AT1B 3R2CJ 1BQMB 4AQYF 2YKNB 4ZVHA 2QRRA 1DQAA 3AJDA 5H9FK 1VQYA 4F4ZA 1OMSA 1QSLA 2RDDA 1FX4A 3SQOP 4EO8A 4YOEA 2DBBA 1N4LA 2F4VF 4M5IA 3CCMS 3OTOJ 1I94F 1QSSA 4P9SA 1RBOB 4F25A 3N6NA 2QGFB 1SL0A 3R97A 4M5DA 4DEZA 1U4BA 3W63A 4I7FB 2DIVA 1YJWS 4OYAA 1U2CA 2GGPB 2DR5A 3BN7A 3H8YA 4IOCQ 3NWGA 3MEKA 4ECZA 1W2IA 3CF5Q 3C16B 2YQ1A 5A8WA 1N36J 5D0HA 2NSCA 1YVFA 5F8GA 2J0SD 1YITS 2JX2A 4LR9A 3J81j 4RKUC 2MQQA 3GSDA 4ZVFA 1XMBA 2CXEA 2OHDA 4K5SA 1NK4A 1UJ5A 2GS8A 1HWIA 5T7LB 2L08A 2DO4A 2C3YA 3KJQB 4UQGA 1YIJS 4UW2A 4G1IA 1VJWA 2K1RA 2H65B 3FFIB 2YXLA 3KK1A 1DTQB 1D09B 2CYYA 4X64F 2PI5A 4B9TA 3MM6B 1FWLA 1UEKA 4USUA 2DNHA 2GJ2A 5BYSA 2DY9A 2HZAA 2R8GA 4NXMF 4X4PA 3KLGA 3BB5A 2QLFB 1WWHA 3W2VA 4QIEA 3PTWA 4YUDA 3KJNB 2HWTA 2W1BA 2LKZA 4C3KA 3K5MA 3Q83A 2BKOA 2IJFA 1XR5A 2FVSA 4DR5F 1S4EA 3OR2A 3PRVA 2P8IA 3HMJG 3ZXWA 3T1YF 4E8UA 5LT5A 1TK8A 1JKHB 2J6UA 2P9GA 3ZTPA 2MQOA 3TQ1A 1UTAA 2AJ1A 4PEOA 4QIWD 1TV6B 4O44B 5GMDA 5C7PA 4B9NA 3MEEA 1A9NB 4X64J 1OYDA 2ZVIA 4ZLPA 1DTTB 2W7OA 2KYZA 2VG5B 1H2TZ 3T1AA 2VG7B 2RRBA 1S7HA 2YKQA 4NLXA 2H5JB 3Q89A 4ZVSB 2UXCJ 1LV5A 4BWJA 1RT6A 1K44A 4MTPA 2DGOA 2W8KA 4M1KA 4YY3F 4C98A 3IFEA 2E7VA 3BO2A 4ENOA 1NJXA 2ZH6A 1HQEA 1Y9OA 4DR5J 2KVQE 1V9OA 4OIXA 1SH3A 3DYAB 1RT3A 4ZIVA 3AHPA 1SL1A 2JEJA 3T5KA 2BKPA 2V8VA 1RSCA 2ZH1A 2YWGA 4G1QB 1FWKA 3JQKA 3HHLD 3JYTB 3MF5A 1KTVA 2WBMA 2ZM6J 1SJ4P 1S1XA 4C48A 4IRKA 3OUYB 2VH7A 2QA4G 2VA3A 1DBDA 2CG8A 1K9MT 2X1AA 2Y9HA 1S48A 1I6JA 8ATCB 5IT4A 3WC0A 3NEKA 4CLSA 2HRTA 1O5JA 1S9GA 5IOLA 3H59A 1BHNA 2ZHBA 5J2QB 3UI3A 2WONB 5I42B 4OZ0A 3NGSA 5KAKA 2ZDPA 4QIVA 1QAJA 4JI5F 4YY3J 2B43A 3CJKA 1RT7A 4ZS6A 1O6XA 3MMCB 4OFZA 1H0HB 3RAXA 2Q79A 4JYAJ 4JI1F 2XY6A 2YWFA 8AT1B 2HRUA 1GTEA 4Y2IA 5GADU 4WKRA 2B6AB 5KG6A 4WJBA 5D4NA 4FYVB 3NAIA 3OXGA 2DISA 1P1LA 5AE3A 3P5TL 4FBUA 2C2OB 1C0UA 4JBCA 5LSRA 2VZ9A 1N8RT 2FJEB 2XHCA 1YI2S 2RT3A 4OI1A 2UUBF 5KG0A 2BXJA 1NCLA 4P74A 3GPAA 2DXDA 5KFXA 1S1VB 5M2RA 1Q86T 2L3MA 4BS2A 1HPZB 1UFKA 2CDRB 4ETZA 2X1GA 4FYDA 1HBNB 4JB8B 3JQJA 3BKUA 4KYZA 1TKTB 2C2NA 5KG7A 4JV1A 1S1WB 1GT8A 2E9RX 3V6JA 1S77D 3FC9A 4PYDA 1BXNA 4CLWA 2G13A 2VJVA 1TL1B 2CJBA 3PKMA 4JI1J 4U67Q 2DB1A 1EQMA 4I64A 4QBUA 3ET6B 1M1KT 2ADCA 5K14B 2GVDA 1OYEA 4J90A 2HEKA 3QMQA 2W2OP 2GA7A 2H4YB 3OTCA 2O01C 1K8AT 1F2GA 1IWAA 2LQJA 2UVRA 2FD2A 1RB0A 2C1EB 1MROB 1FKAF 4GRSA 3I31A 2CJYB 3FQLA 2HWHA 2H4WB 4P71A 4QQBA 3N6LA 1AYEA 1HBOA 2K3KA 3LALA 2NXUA 3KLIA 2RS8A 1DZ5A 4USKA 4RBUA 4LVOP 3P4UB 2XGQA 1RWPB 3BR8A 4IG0B 3D9BA 3P3DA 2RIJA 1U0HB 3T9NA 1N5TA 2HGLA 2HVZA 1NJYA 4W90B 4B9VA 2LLZA 4ECUA 2HFVA 1Q8KA 1CJTA 3ITHA 5THWA 1MN9A 2QLJB 2G0IA 4JUZA 2POKA 2IY5B 4AXJA 1TZ0A 2NPIA 3QLHB 4CH1A 2F4FA 4NRUA 1JXVA 3NBPA 2BM0A 2IBKA 3QGIA 4JI2F 1J27A 2MKYA 2AZ1A 2ZBIA 3V4IA 4WE1B 4URSA 4LF4F 5T14A 4C0OC 1RCOB 3TVYA 1XIQA 3C14B 3I4PA 1U24A 1YKWA 5IT9U 3HD2A 2EEYA 4I1TA 2JNJA 2CADA 3G8SA 5E3AA 4EBCA 4NLUA 3DOMA 3QWPA 2ZVSA 3PIOQ 3HULA 2QTWA 1ZH5A 1VLOA 1UVIA 4KPYA 1Z1ZA 3GYNA 1EETA 3QZ7A 3KLFA 2BRKA 4GO7X 3DNCA 1M5SA 4KV8A 4CNZA 1RWXB 4KO0A 4TU8A 1WJ9A 3OSPA 3VAKA 1Y3JA 3RBXA 3DOKA 4AD6A 3A3OB 3H20A 3ETOA 1VRQC 3Q8QB 1AFIA 1S6QA 2DPIA 3FBFA 2UVWA 2LXIA 4DR1F 1UA0A 2YWHA 3DRXA 4RNNA 1FHTA 3JSMB 4KH1B 4YB5A 3G82B 4OHVA 3T19A 3SEOA 5L1KA 4IKAA 1FJEB 1WORA 3RB3A 4CTAB 1LWCA 4UUXA 1RI7A 3CJQA 1F60B 4F4AA 9RUBA 1R0AB 2RAQA 1TL3B 5J1EB 5IT9Y 4K59A 1S76D 3BQ0A 2HK2A 2EPIA 1T9WA 4OX7A 5AE2A 3JSBA 1H7XA 4F2RA 3QJJA 3FCWA 4Q2LA 2NUHA 4FXWA 2QZ8A 3CT9A 5ETMA 2OEKA 1HWLA 2PSZA 4WPAA 1XNRJ 1TL7B 3UE2A 5CZXA 2WSCC 1N33J 2XULA 2XYHB 2AV5A 1D0EA 1X60A 3CD5A 3U1LA 1UP1A 4J91A 4ILMA 4NASA 2OELA 2HMIA 1W2BR 3NLCA 5B09A 4DQRA 1RWWB 4LSNA 3M9OB 1J2VA 4RW4A 1XMOF 3GTYX 4ZVGA 3DDKA 4NX9A 3KG0A 4HHHA 2KM8B 1K73T 5KFEA 1T9VA 3BQ2A 4JI7F 3KFWX 2CPDA 2DR9A 2GIQA 4LFCF 1QD1A 3HJVA 3PW4A 2BBEA 2VONA 4NXNF 4DV1J 1KQFB 2DO0A 1IJEB 2CJAA 3KLEA 4DG1B 1TELA 5C2CA 3TWZA 2RD5C 1VIOA 1KS2A 2R2RA 2QA2A 3SFGA 1KOOA 3A8JA 4C8NA 2AEJA 4OZJA 3QIPB 1VQLS 5HQLA 4L73A 5ITHA 4ED1A 3VAGA 1I5OB 5GVQA 3FDSA 2EG1A 4OLPA 4LR7A 2C3MA 3CJ2A 2CJXB 3ILOA 4P6QA 3HT0A 2MSTA 1KRPA 3A13A 2Z4PA 2ZH4A 4Y2AA 2DNRA 3HHDA 2QA1A 4I6YA 2MZSA 2V2VA 4ZCMA 3OD2A 2J8AA 2ZNZA 4QW9A 3J7AN 1NK6A 4TNOA 2E1MC 3LP0B 9ATCB 1SI9A 2ZBQA 4UOGA 2R7UA 4QPXA 1Y5LB 5L8RC 4LFCJ 2JLFA 5JXSA 1CQMA 2L9DA 2BOAA 2WVCA 2HS0A 2ZH7A 2HWIA 3JQMA 2R3VA 3RG6A 4JOUA 3PM9A 1AFJA 1RAAB 1RTZA 3OLBA 2XZTB 1RAOA 3MUMP 1PSDA 3FSXA 1GMUA 4YFUA 1S9EB 1UZHA 3THTA 5EX3A 3V81A 3GB0A 1KVKA 2GMJA 3R6GB 2OPSB 3OL7A 4LRAA 5CYJA 3IS9A 3BDPA 5MAOA 2VQFJ 1CG2A 4GO5X 5K8OA 3IG1B 2IMWP 2HNDB 4DR4J 5E5NA 4J37A 1EP4B 1RAJA 2RQKA 4ZPDA 3FKBA 4F0KA 3R6LB 4GC7A 4XPCA 3WHIA 4L3NA 3NS7B 3AFGA 3K5OA 1SC3B 4BLGA 3FGVA 3CDBA 3POTB 6FD1A 3M8YA 2MHNA 4Z7YA 3K89A 4HTJA 2B56A 4PYAA 5KT3A 3QATA 2LDYA 1S59A 2JJ4D 2G1HA 3NAHA 4OQJA 1U6FA 3QJPA 1Q8BA 1WG1A 5B0GA 2P6TA 2KJWA 1VYAA 5KFZA 3U02A 3UVJA 4CIOA 4IDKA 3NGRA 4ZCKA 2GQ2A 4RUCA 1KQKA 4DU7A 3TANA 3OHAA 4DXLA 3ZZZA 2DGUA 1ZM3A 3QRRA 5F8HA 4MMOA 3F41A 1TFYA 1NM2A 4EZ9A 5AT1B 1G7CB 4GVLA 3Q8SB 2HZVA 3ENWA 2QFIA 5IT0A 4DPUA 4RBTA 2RKIA 3D0HE 1A6LA 3TW0A 5JUMA 4BHQA 5CXTA 5C25A 5FD1A 2V8PA 3O5TB 5KFYA 2CZ9A 3M32B 3MTJA 4ELVA 2DH7A 1RISA 4QR2A 3TZWA 4OJGA 2JLGA 3OXLA 3ZC4A 3H5YA 1Y00A 4RUAA 1IKYB 1XK8A 1YK9A 2IA6A 5GAHI 4B3MF 5F0UA 1U7LA 2COLA 3BYPA 1E6VB 1NK7A 3PX6A 3CJ0A 3O1LA 4DQSA 3Q24A 1U1RA 4CI0B 2F63A 2LDIA 4LFAF 4AUKA 2OPQA 1ZTTA 1LFWA 3VAHA 2XWXA 2V0NA 4PQAA 2ASLA 5HMZA 1SC6A 3I6PA 3CJSA 1HLWA 4N5SA 4YQWA 4WTOB 5LSOA 1G1XA 3H2UB 3KNGA 3TJ9A 3N5BA 3RRKA 5CD4H 2EKNA 2B51A 3VHQA 1OIAA 2CNKB 3QO9B 5IXUA 1RT4B 4PG6A 4F4YA 5LMUJ 1SQGA 1Y3KA 1HI0P 4ITSA 1NBEB 4EUVA 1VQKS 3ZZ0A 4I67A 3CJRA 1X7VA 1DY3A 4X66F 2F8EX 5L1LA 4TU9A 3CCZA 2RS2A 1X9WA 2VOOA 2KDOA 1T8EA 3Q8YA 4YHHJ 3AH6A 1F5BA 2HLTA 4ED0A 1M1GA 3D6FB 2V68A 1LXJA 2D3OR 1JLCA 1MLAA 3PYGA 3W60A 5M2UA 2OTJS 1JWWA 5DS7A 1S97A 1UPPA 2HK3A 2XNQA 4RUBA 2G2OA 3IO1A 1WD6A 2BANA 1U2FA 1WC1A 5KFRA 5CYQB 1U1PA 2PI4A 4F0MA 4TU7A 1SQFA 3IC1A 1TU0B 3M1VA 5GMKa 4Q0BA 1WTBA 2H5EA 1OPIA 2F3JA 1X5OA 3GZ7A 4EYHB 4HL9A 2XM3A 2A1BA 5BXIA 5HQMA 4DR2J 3ELHA 4UF4A 1GXLA 2FHKA 5K5MA 2Y1IA 1WACA 3RUBL 3R5BA 5JVGQ 3KHGA 3UQSA 2X7IA 2BM1A 4B9UA 3KG4A 2VG6A 4NCGB 4MYTA 5A8KA 2PD1A 4ED5A 3B78A 1SJFA 3NCRA 1H7WA 1VRUA 2OFHX 2LFVA 1KLMB 3W7BA 2DEIA 3WIUA 1IR0A 5ETKA 2HNYA 2C28A 1O0PA 4O4RA 1OY8A 2ZDOA 2NXJA 3HFZB 5LXRA 1VBYA 4ERDA 2E1RA 2EBGA 3QAEA 3MR2A 1IUJA 2E5HA 4ZK7M 3GFHA 1BQXA 2BE2A 1VQ9S 2CQ3A 4KGVB 3MUVP 3MOJB 4DOZA 1SV5A 2ZEJA 2QC3A 2DR7A 1GXTA 4DL2A 2BX6A 5GAGI 2YX1A 2APOA 3LANA 2W4DA 3QSIA 3DXSX 5DRKA 2BE9B 3UFCX 3TZXA 1LWEB 3GCXP 3HKZD 4K4TA 4DR7J 1T7PA 3QJLA 5AXMA 5KFOA 1SJ1A 4RW8B 2R8HA 3M2VB 2UZAA 4ATNA 1X31C 4ZJQA 2JHEA 2LU1A 4DV6F 4X2BA 2OMLA 5KT4A 4W92B 2LMIA 4NZ7A 1JJ2R 2WW8A 4ES2A 4KSEB 1IKVB 5B0BA 2ZWOA 4JI3J 3G6ES 3W3SA 2YTCA 1NK5A 2N7YA 5ETVA 2V4JB 1P9QC 1FTCA 3CJTA 2HSEB 3MM8A 1OY9A 4CT8A 3AOAA 2O66A 4KAIA 1WOSA 2B5JB 1JLQA 3HHLA 1QUPA 4TVAB 3A1YG 1F9HA 1HNIB 1PGZA 1U26A 2OEJA 3Q8VA 1IM6A 3C6UB 3KJVA 4P75A 3IGNA 2BQ3A 1Q16B 3SV4A 3KUEA 3K5NA 5HROB 5AE1A 1DQ9A 4DUYF 3D1OA 1RP5A 1DAXA 3Q8PB 2FJBB 1VJQA 4URGA 2XLJA 1BQNA 2DNYA 4ZHRB 5DO2A 2CIMA 3W9HA 2AWZA 5HL7Q 5B0CA 1YDLA 1RQ0A 3NNAA 3GILA 2E5LF 2AIRB 4ECWA 3L7OA 2FY8A 4QYRA 4ECTA 1KKHA 3MR7A 3CCES 3V6DA 2HURA 4DZDA 4A48A 4OZ1A 2R8JA 5BR8J 2HVEA 3ICLA 1RKJA 1D1UA 2HRYA 3EXYA 5JJBA 3VALA 3BGRA 3HVTA 4WBFA 4JI6J 2XYGB 4DCJB 2WK4A 3P5BP 3W9JA 4ANDA 4ES1A 4ZOSA 5I4MA 5A76A 1YJ7A 4ZPCA 1JLGB 3KK3B 1Q8LA 1APSA 2YH1A 4NL5A 1HR0F 3AXKA 1D8YA 3GJTB 3GWCA 4H4KA 4HR2A 3FK4A 4EEYA 2JVOA 1Q7YT 4W98A 1DQ8A 3IRXA 4QWEA 1H72C 4GKKF 3RW6A 1FT8A 2VU5A 4KGKA 4K4WA 3AD7C 2JEGA 1GAOA 4ZPAA 1JJHA 2M88A 5D0EA 3UPFA 1DARA 2AKWB 2EC0A 3X1LB 4R8UB 3FQKA 3NS6A 4DSKA 3AY0A 1R6VA 3WBZA 4PAAA 4CO3A 4K2JA 3KLGB 1RAGB 2B9EA 1IKXB 2Z8QA 3IWXA 2DXEA 1ZOTA 4NPOA 4NZ6A 4ZVUB 3NCPA 1RYRA 1N5YB 4J9OA 2IM1A 3CUNA 3MEGA 3HCXA 4NMXA 3DKDA 4UY8T 1YRXA 2R7QA 2W9BB 4C8OA 3QT8A 2HZCA 3EDRB 4XK8C 3BV8A 1RT1A 2RH3A 4RW9A 1TMJA 3MEEB 4FDFA 2RUGA 1NHUA 4UTGA 2ZNYA 4LMZA 5E7OB 4J9SA 5FLXU 2UVUA 4K4ZA 4CH7A 3UDLA 1FFWB 5DDQC 5LSLA 2AHOB 4EBDA 1K1SA 4HACA 4OJ1A 2XC9A 2OLWA 2XS2A 3VGVA 3ILJA 3SMZA 1KNZA 1LW2A 2J7WA 1BWVA 3A3PB 1WHYA 1WF2A 2E1CA 5F9NA 2GV1A 2IVYA 2A10A 4TKTA 2JDJA 3UN2A 1VQ5S 4J7CA 3PX0A 4O3PA 3ZO7A 5SZTA 4OZ2A 2KTQA 1UETA 2K7KA 3R2DJ 1HHSA 4DV3F 3GSIA 5FDLA 2WOMB 1FRHA 2JOQA 4YP3A 4YR3A 3ILIA 2NXNA 3MFHA 2ZWPA 1JLFB 3CO0P 1YJNS 2C2KB 3PY8A 3RB6A 3CJ3A 2DNPA 3PRBA 2QA4S 3DLEB 4LQ9A 3FBBA 3P45B 2QMWA 2YNIB 4EWTA 2EFQA 1ROFA 4J5OA 1FKOA 2K7JA 2ZITA 4IRDA 4ZN3A 1RHRB 1I1GA 3MI7X 4CO2A 3DRRA 3MGJA 2IAJA 1S0OA 3Q86A 4PQUB 2R9LA 5IM0B 3VVTA 5FLXY 2VB6A 1B64A 1B0PA 3DRSA 4DFKA 2EFGA 4L72B 3DC2A 2ASYA 2Y1RI 4ELTA 2IFXA 1A0OB 1N88A 3BPSP 3PYEA 2MKHA 2B0GA 2FHMA 2HS4A 3CJKB 1RT7B 3PW0A 4A8MP 4WWSA 1ELOA 2CQIA 4DUZJ 5DLFA 1OJ4A 1R8CA 4H4MA 2HFUA 3HFKA 4G6VB 4OYIA 3PW2A 3ZNJ1 3PYDA 3QAUA 1QAXA 1H2VZ 3I82A 2GC8A 2DGWA 4X4VA 1QE1B 3PEHA 5C42A 1R8PA 1RTDB 5IV4A 4R0EA 3I96A 1C0UB 2VQEF 2FB0A 3MMAA 2F1FA 1YGYA 3H4DA 2BKNA 1FE4A 3C15A 1T3NA 4KPCA 3EXCX 1A7GE 3ISND 3NGUA 2BRLA 3FVYA 4C8LA 2KT5A 1QAIA 4YDDB 3JSYA 3MAHA 4HLBA 4WU3A 4NWBA 1REVA 2MY7A 1HW8A 1P6TA 4B3RF 2VD3A 3H2LA 4PWDA 3FRZA 1FDDA 4LJMA 1YWXA 2V8HA 3DLKB 3EPIA 1TKZA 4LF1A 3T6BA 2O1PA 4F36A 4A8QA 4KH0B 3VV2B 2FJVA 1MWQA 1WHWA 3B4DA 1NLKL 2Z0GA 3OJSA 3HXMA 1N56A 3AT1B 2DNLA 4HTIA 1OY6A 4PG4A 1GXUA 1NK8A 4DQPA 3PXGa 4TQSA 4X4UA 1NB2A 2PA8D 4KQZA 2VQEJ 1Q95G 4MK9A 3SQGB 5HANA 1EX8A 3HDSA 1NZAA 2MJNA 3OTBA 3I0SB 2FJXA 1VDHA 2XO7A 1FXRA 5GAEU 4NLRA 5AXLA 2KXNB 1MU2A 5K8NA 3PYFA 1RTIA 2BW7A 2WB4A 4W4MA 2BJ8A 1H2UX 1KBRA 3SI8A 1VRTB 4QOTA 1WHXA 4GKJF 1OSCA 1NDCA 4QJVA 1JJ4A 4B3RJ 1NZ8A 4CP5A 4ECYA 1C0TA 3HZEA 1X4EA 4ZVTB 4PABA 2DRDA 4EFAC 1X9SA 1J5EJ 5C24A 1FVQA 3IP0A 2ZH9A 4F02A 2F9DA 2QL7B 4OI3A 2XMTA 1HQUA 3MD3A 3W61A 3TNVA 4PWWA 2H54B 1O8BA 4USHA 4KKOB 2GVZB 3NBPB 3ISZA 3Q2TC 4CO5A 5DDPC 5HAOA 3BH7B 3RTVA 1VC0A 3M2RB 4LREA 3V4IB 3GU0A 2UV8G 5F3TA 2Q43A 2QT7A 4FNIA 4K8RA 3BO4A 3OR1A 1LQ9A 1ZM4A 3HP6A 1LW0B 4NI2B 3J80Y 2V4QA 1NSKL 4U8VA 1KWMA 3NNCA 3BSNA 3KLHB 1PBUA 1PBAA 3MTKA 5HBMA 4AE5A 3ZNUA 4ETXA 1S5ZA 3OL9A 2MZQA 4OHWA 4IG3B 4A8KA 4K4UA 5HMXA 1TKXB 3MM9A 1LEOA 1S49A 3HF5A 2ZD1A 3R5JB 1H6KX 4ECSA 1OQ6A 4EO6A 5HQ8A 4X65F 4KO0B 3K5PA 4K0KF 1PKUA 1NPPA 3H40A 3DOKB 4KTQA 4RNOA 4R25A 1U25A 4YB1P 5CAAA 1Q5YA 2B7BB 4KHPJ 2J6TA 2WTFA 5CQGA 3LP2A 1HNZF 2CQCA 3MPDA 2CUYA 3M8SA 4C0BA 3VGSA 2HHUA 3WX8A 4FF2A 2IMOA 2IVFB 4ER8A 1LWCB 2EI5A 1L3TA 1EJ7L 3Q23A 2CPFA 2UUCJ 4PUOA 2G0JA 1VC5A 1VI7A 4JI0J 4FP9A 2HQFA 1ZBTA 4A4JA 1JQGA 4DZ6A 4OZ5A 4CDIA 4F4KA 3DRYA 4P2FA 3BSOA 3PHTA 2HFZA 3CMAS 5DG8A 2OFGX 2KXHA 1WOOA 2DT9A 3BGLA 1LWXA 3CCVS 2RJZA 8RUCA 3SSRA 1ZETA 1U09A 2W2NP 4KGZB 2X3GA 2YBVA 1X4CA 5JVHQ 2X1BA 1SKUB 3TRGA 1IBKJ 1DURA 4B9MA 2NS1B 3BGUA 3N0VA 2C2MB 2AMCB 3X3UA 1Q81T 1Y11A 3TJ8A 4KFBB 1G6BA 2CPHA 3SCKE 3I87A 4UZCA 1JK9B 4LF8F 4LSNB 5F8JA 1SVDA 4DFMA 2QX0A 4I0WA 4RW4B 3HSZA 3NL0A 1C1BA 2DIUA 5DM7Q 2KXFA 4G3IA 2R2SA 3FBCA 4CYUA 2R7RA 4LRCA 2MLXA 4ANCA 1Y5IB 2CPYA 1ZPVA 2SXLA 2D3ZA 3KWMA 1B70B 4C4WA 5G0RB 2DNZA 3CW2C 3EZOA 4CLLA 1RAIB 1RTJA 4GVBB 1HBUA 4X4NA 3J81U 2DNMA 3OBIA 4JV5J 4IR9A 5DGAA 2GIFA 3HVWA 1Q8IA 4B17A 4K50A 2QLXA 1KVIA 1BQMA 2E1AA 5G4DA 3A4TA 2YKNA 4MFBB 4NYOA 3G4SS 4L74A 4ZVQB 2KG0A 2D41A 1V3SA 3V4MA 3GJSB 5J2PB 1ITPA 3QPIA 1CJVA 1NDKA 4C11B 1FRJA 5LMNJ 1U6BA 3I56S 4QPTA 2OPRB 1FK9A 4I7FA 3O3LA 3KNAA 5DQIA 3N79A 4WYLA 1X9MA 2GJFA 2W9CB 2GGPA 3ILLA 1VLYA 1NU4A 1U47A 3GIKA 2XB2D 3MMBB 2Z2ZA 2HHXA 3FBEA 1ZA2B 1BGXT 1BD6A 4IH7A 3GG1A 3PR4A 2ZOGA 2KRBA 4RO0A 2F7VA 4P7VA 3N01A 2AP6A 1GH8A 3I5AA 5T7LA 1N6QA 5CHCB 1E6YB 3K57A 4J9NA 3MCNA 3FEYB 4B3SJ 2CQDA 3FFIA 4LF5J 3EZUA 1HWJA 4TXSA 4HT7A 5KFLA 2DGVA 1HWUA 2J9DE 4K7QA 2FC8A 5L9XA 3R1LA 2DTJA 3HHNB 3MFIA 2AEMA 3GP9A 2V2ZA 1B0TA 5KG2A 3AQPA 5IWAF 3IRWP 4ZVEA 1L3UA 2ZHAA 4CO4A 3RR8A 4ELUA 1TFWA 2HBZB 1IR1A 4EYIB 2OMOA 2BEFA 3R7NB 4DX6A 1RHMB 4DR3F 1FKPB 3UVJB 2VPXB 2DR8A 3M8ZA 3I4HX 4WFXA 4IDKB 3FEXB 2GZOA 3BYRA 2LA4A 1FJ7A 4L6V3 3Q8UA 4DL3A 1Q7LB 3PO5A 3JTOA 2CVIA 2AGQA 2Z2MA 4NLQA 4O23A 1JKHA 5H9EK 4NMLA 4ECXA 3THPA 4O44A 2VJUA 3M05A 2XI2A 4IOBA 1RAFB 3QGPA 4KHMA 5D4OA 2UU9F 2FTRA 2FZGB 4OYWA 2RU3A 4DPYA 3O44A 2VG5A 4DV4J 4ZP6A 3GIIA 5ETSA 2VDIA 2VG7A 3EX7B 4QYZK 2V9KA 1T9TA 4PXCA 3L95X 1HBMA 3I9V9 4JP8A 2F8HA 5HJYA 3A8EA 3CC7S 2OI2A 4ZLJA 1S1UA 4EZ6A 3NMAA 3UDCA 4WK3A 4G1PA 3EM1A 3CGIA 3TR5A 4K4YA 1IBMF 3UDVA 3E51A 1LOUA 2VPYB 2XSFA 4WXOA 2L9NA 1Y10A 5A6PA 1X5PA 3DM2B 4G1QA 5CABA 4DSEA 2ZJQQ 2XZWA 4RX6A 2PN6A 3CDUA 2D7SA 2G1DA 4M94A 2B4OA 5T41A 4DS5A 3EDQB 3D3CJ 4MT1A 5A6WA 3EJMA 2KG1A 3R8YA 3NG8A 3OJUA 2FLOA 3OTOF 2VKRA 3K17A 1C2PA 4TYBA 3MAQA 3B4MA 3B54A 3BF4A 4OYXA 1FD8A 4BC9A 3FMWA 2A2DA 1GX6A 5CYMA 2C2DA 1GX5A 1X4AA 3R1HA 5J2QA 1X8DA 3LGHA 4FBTA 1KHVA 2E29A 3NNHA 4F7VA 2WONA 3TO8A 4LIRA 2F9JA 1RBAA 4FVMA 4OX6A 1N36F 1FI4A 2CNOB 1RGVA 1KONA 4CLYA 1N48A 2ZH2A 3MHYA 5F8IA 2YKAA 4Q44A 4ZVRB 2B6AA 3VWSA 1QM9A 5AXKA 4ECVA 3M1VB 4TY8B 1KTQA 2ZBPA 3RBEA 1UAWA 1H38A 4WZQA 2YNHB 5KFGA 2N3OA 2XY7A 4FS2A 5ETQA 1UW4A 1UWBB 4LBHA 2FQQB 4DPTA 5LJ3Y 2QG9B 3R5GA 4ZP8A 4MH8A 5A8KB 1S1VA 1FA0A 4WFYA 4RPFA 3NOCA 3DMJA 1TUVA 5GMEA 1VRUB 5F0WA 4ID8A 2HQ3A 2WW4A 4I4BA 1FWPA 5KFVA 2ZH5A 4CLKA 1RJJA 1WTFA 3GLJA 1HNXJ 1S1WA 1VQ4S 5KT2A 1IBCB 1MG7A 2D74B 2Q6CA 2HYIB 3V5RA 1PYOB 1TL1A 1W25A 4ZLNA 3HHLC 2CZ4A 1Q82T 1LFPA 3K59A 4H4OB 4RNHA 4LSZB 2HAIA 2W8LA 2ZBRA 1SV5B 2HFNA 3R5DA 4OJHA 4TYAA 7AT1B 4LQ3A 3H98A 2BMBA 2MKSA 2HVIA 4C0HA 1K47A 5AJ3J 1KFDA 3HFVA 4ZDNA 4X84A 3IWLA 1QTMA 1NKCA 1Q53A 5GAHU 2AX1A 2YQ3A 3T1HJ 3A8IA 1W7WA 3SDEB 3PEJA 1U1MA 3D1QA 2GIRA 3KJFB 4DPXA 1XNQJ 3ZTRA 3FRYA 4WU2A 2U2FA 1HW9A 3L3CA 2QMXA 1TUWA 4IG0A 3GFZA 1CVJA 1U0HA 4C8ZA 4I2QA 2HLUA 2UXCF 5EX0A 2FVPA 2BJ9A 1MMDA 1R8AA 3DI6B 4LFBJ 2GFFA 2M52A 4NYZA 3MM8B 7FDRA 2J6SA 2FYXA 3TUZC 2DGTA 3GIJA 4URQU 3PZPA 4C8KA 3UN3A 1FRLA 3QLHA 3EWGA 3D68A 4WP8A 2HQGA 1FXLA 2EVZA 3KJVB 3RRGA 1UMJA 2UXBJ 1VBKA 4H4KC 2ZM6F 2M3DA 4WE1A 3EYZA 2WB1D 2RRAA 3D67A 1HNWJ 2ZKTA 3OLAA 5KTQA 4B3OB 2XSJA 4WCEQ 4LRBA 3D6TB 3C14A 1BQNB 4Y00A 3PRDA 3IR6B 2Z58B 2DJWA 2XZDB 1IR2A 2CQ1A 2IM3A 3D4JA 4YS2A 2R8KA 1B7FA 2CPIA 5ETRA 2NSBA 2AYEA 1VC6A 2YVSA 2IJNA 5ETOA 1RT5B 4KRWA 4CQ1A 3D0GE 1KC8T 4DF4A 5J2MB 1NNDA 1Z2ZA 2WHOA 4DV2J 2CA9A 2Z2YB 1VCTA 3G8TA 4FF4A 3GR0A 4DQQA 1ZAVA 4DV7J 3UD4P 4UY85 1X4FA 5F41A 2Y8YA 3B82A 3KDNA 4TLRA 3MAAB 3TP2A 1PIEA 5B0AA 3CCQS 4JYAF 1Q79A 1G2EA 1VISA 3H2VE 3GE9A 2DNQA 3J7A1 4KGMA 2MQMA 1XMQJ 3TYTA 3KXDA 4AFFA 3IAM9 5LL6d 2GO8A 4DN0A 3JSMA 3G82A 3TAQA 4CTAA 1HFEL 4LIWA 3I0RB 4RLEA 4USTA 1R0AA 4ZIWA 1WELA 4DSLA 5J1EA 1R89A 1U49A 2A18A 5E3RA 1NAQA 5D3GA 2Q66A 1JLBB 3M6VA 4CLTA 3BS9A 2AJ4A 1JLEA 1WOPA 1FO1A 1HD1A 3PKYA 4DR6J 2RB7A 5KFUA 1FRKA 2F5GA 4OHYA 5DG7A 3CWJA 3RB0A 2VKZG 2PEHA 5GAGU 2XMWA 3S6EA 3S8SA 4HT5A 2HQCA 2H9ZA 1X0FA 2Y0BB 3GMGA 5HSPA 2CPZA 4MKVA 2V2QA 3MXHP 2LYVA 4K4VA 3ZFVA 2VV5A 3G71S 2FHJD 1RWUA 3D66A 1FNMA 4WFBQ 1KHWA 2CQGA 1REGX 1N34J 2M8DB 1XWLA 2E5JA 1PYSB 4J9KA 4X4OA 1EZZB 3TOQA 3NGKA 3LQVA 1FFSB 4ZPVR 3S7RA 4FNHA 1WC0A 2VBYA 4U8YA 5HO4A 4CM2A 4DG1A 3LPYA 1LW2B 1U1KA 3H42A 4EGLA 4OMFG 2CG4A 4FS1A 1C1CA 3FCVA 2Y8WA 5DZ7A 3DOLA 2ERRA 2Q3PA 1QSYA 3QIPA 1T03A 4IFYA 1N5SA 5D4PA 1T9YA 2QSFA 4NCBA 2CQPA 1AA1B 3IA0A 4NLVA 5FDLB 4DV5J 3CCRS 2LCWA 4ZLLA 1PC4A 1EB0A 3ZTSA 4DX5A 5BYRA 3TJAA 4JI4J 1FDBA 2WVDA 3H5SA 5KFQA 2DNNA 3E2EA 1AT1B 4HHJA 2FJWA 2M0GB 3LP0A 1U0SA 2C3OA 2OSRA 1VQMS 1SIWB 1DLOB 3CDAA 1IXKA 5DM6Q 1UZDA 4WK1A 1M5PC 4Q7AA 3MUTP 4ZVOB 1TQLA 4RW6B 1XBWA 3E8OA 2JVRA 3FZBA 3CCWA 2ZHOA 2CPJA 1FNXH 5B0DA 1RA6A 7FD1A 3VAIA 2KFYA 1EQ0A 2NLWA 3DDNA 3G87A 1CULB 1VGYA 3M8PA 3KUHA 5A0YB 3PV8A 4DSFA 1RABB 1CC7A 3M9NB 2XS5A 3CDEA 3HSJA 1HNVB 3NY0A 2GO9A 2K06A 3MEDB 1HA1A 2XY5A 4A8FA 5KT6A 4ZKAA 4NEYA 5DETA 4USVA 1H3DA 1QJHA 4USMA 2M8HA 3IG1A 2HNDA 4M5GA 5HJXA 3R27A 4XDCA 5DDOC 3BKTA 2W4CA 1EP4A 1HWKA 3DHWC 2M9KA 1RTHB 4UOCA 3RBDA 3LP1B 2LP4A 3PIPQ 2VUGA 1S9FA 3OFHA 1QY7A 2MHEA 2YX7A 4ED8A 3MMAB 2MSSA 1YHQS 1S7IA 5JMNA 3POTA 4Y0FA 4DL0C 2B9YA 3C15B 2QLWA 2IPOB 3OL6A 4N56A 4O4GA 2QO3A 4F04B 2FLLA 1ZZNA 1RHJB 2DRBA 1QVGR 1RWMB 2KT3A 3ETMA 3HJFA 4DU8A 3C46A 3HO1A 3CB4A 1YBAA 5KFMA 2MGZB 3G8QA 3F56A 1U45A 5KT7A 2QFJA 4DFJA 3IAS9 3G96A 4DF8A 1NEEA 2FC9A 2XGPA 1FRIA 1XNRF 1TKZB 1N33F 2V67A 2V63A 3SZ2A 5I3QA 2EK1A 3P96A 3ENQA 2ZKUA 4N7TA 1KN6A 5KFFA 1U48A 3OPKA 2L48A 1TMMA 4CLZA 3UD5A 3QRQA 2AU0A 1J5OB 3RAQA 1CBKA 1EKSA 3DXBA 3PCOB 4ZJOA 1QDUB 2BE7D 2LEPA 3IGVA 2JWNA 1UCNA 1VMBA 3TA1A 4USWA 3W9IA 5D77A 1PAEX 2A2CA 2R7OA 1IKYA 4DV1F 5CCLA 3THVA 1E6VA 2PMWA 3HD1A 2DPJA 2ZZNA 1KEKA 2EC2A 2MEWA 2JEIA 1CQNA 2BJ7A 2CFXA 3W2WB 3T9ZA 3TA0A 2E5GA 4X62J 3T5LA 4U7UK 1KOHA 5C24B 3PDNA 4EU0A 4C3LA 2B9XA 4RNFA 3S1TA 2XBPA 3QIDA 4DV0J 1TAUA 3SBMA 4QU7A 1YZ7A 2RSQA 4OX9J 2HHHJ 3QO9A 1RT4A 4RL1A 1WI6A 1R27B 4P2MA 1R7IA 2HNZB 4PXEA 2HHVA 4WFNQ 4EBEA 1Y5NB 2MZTA 1ZYQA 3CCLS 1YTYA 1YBUA 3NCQA 1T05A 3G2XA 5HVGA 1RWVB 5F8MA 3D5MA 1Y7PA 2N4DA 4O0NA 2BOPA 3MM9B 3ULHA 2DNOA 3IMQJ 2V9WA 2ZD1B 2PIIA 5DGBA 2K2PA 1UEVA 3TUJC 1RT2B 1V5IB 3LPEA 4RW7B 4LF6J 5CYQA 3UW1A 3TQEA 2ALZA 2M70A 3RU0A 3QYYA 3MWBA 2VQFF 2NXCA 2YNGA 1U1NA 4OV6A 4DR4F 3H5UA 2JC0A 4C6AA 2BUNA 3QT6A 2B9WA 2EK6A 4M5HA 4FXDA 2W2MP 3GIMA 2H3EB 1S0NA 2MXYA 4UQTA 2MY8A 4F4WA 2VASA 4DL4A 2XMKA 4BCAA 4B3TJ 2ZJRQ 4PUOB 3EPGA 1SPBP 1KLMA 2Y1JA 1U6ZA 2FIUA 1LK5A 3AOBA 1Q1KA 3GV8B 4YDXA 1S57A 3M9MB 2KVIA 1SQEA 1IVZA 3BKFA 3CO9A 2WRMA 1U8WA 4IFVB 1XN9A 4DPOA 3LF0A 1O51A 1Q0NA 1S1TB 1JLAA 4ZJLA 5DQHA 2XNRA 3K8WA 3OVSA 2UUTA 2ZUGA 5IC6B 1K1QA 2EWHA 2A0FB 4MIBA 1LWEA 4CM0A 4U96A 3J7YU 2RE1A 3TX0A 1PO6A 1DFDA 3K5LA 3C6TB 1F3VA 2LQ9A 1JJCB 1M5VC 4RW8A 4U9RA 3KMQA 3P49B 1SCJB 4DL5A 1RACB 3NRBA 4KHRA 1RHUB 1VFJA 5ETNA 1VR6A 1FJGJ 5F3ZA 5DZ6A 1MWZA 2HS3A 1HYSA 3QZ8A 4ED3A 2J9CA 4FVCA 4ZCIA 4TQRA 3SXLA 4LRDA 3DLGA 2OP5A 3C2PA 4NLTA 3T5JA 2ZFHA 2B5JA 4L75A 5EDWA 3KMSA 2J0WA 4NLOA 1SC4B 4TLQA 1HNIA 2RQ4A 5CH7B 3H90A 4LR8A 1TKDA 2Z56B 3IBCB 2ZH3A 1CS4B 1T11A 2HHQA 2RHQB 3C6UA 3CCSS 3M8QA 1SB6A 4HI1A 4WKYA 2PO4A 2C2RA 3TEGA 5HROA 1SUQB
chains in the Genus database with same CATH topology
1L3TA 3Q23A 2CPFA 3KTQA 4M95A 3T9NA 4PUOA 1VC5A 1VI7A 4C2MA 2JRSA 5E41A 1N5TA 2BANB 3MM5B 2HGLA 2HVZA 4HVZA 2ZH8A 1NJYA 4W90B 5LMUF 4B9VA 3G86A 3GV5B 5KG1A 2LLZA 2BA9A 4FP9A 4M8LA 1ZBTA 1BY9A 4A4JA 4ECUA 4ZHRA 4OZ5A 2V2KA 3PFOA 1T02A 3ITHA 4ZPTR 3Q22A 5J2NB 2NPFA 4LF9F 5I3UB 5THWA 4Q0BB 2NQPA 4F4KA 1KVJA 3DRYA 3DLLQ 3BSOA 2OKQA 4JUZA 5DJBA 1FK9B 2HFZA 3CMAS 2DH8A 2POKA 5DG8A 2OFGX 4AXJA 1TZ0A 2NPIA 5AJ3F 3QLHB 2CQ4A 2KXHA 4CH1A 1CPZA 4NRUA 2DT9A 3NBPA 2BM0A 1MW7A 2IBKA 5E3PA 3BGLA 2RNEA 3CCVS 1OWXA 3T1HF 3CD0A 3QGIA 2RJZA 1TK5A 4JI2F 2CQ2A 3SSRA 4YHHF 1ZETA 5D8HB 1U09A 2VG6B 3BN4A 3ZZTA 1FJCA 1ZAXA 2X3GA 1XNQF 2MKKA 1X4CA 2ZBIA 3M30A 3V4IA 5JVHQ 4H54A 4ECRA 2X1BA 4WE1B 3SCIE 3BO3A 2P5VA 4URSA 1HPZA 1WHVA 4LF4F 5T14A 3TRGA 1DURA 4C0OC 2MKCA 4B9MA 2NS1B 3BGUA 3TVYA 2J7KA 3N0VA 3X3UA 4Y3CA 1Q81T 4KFBB 3I9ZA 3I4PA 4DBQA 1HBNA 1U24A 3AA8A 4U7CA 2BJDA 1JLGA 1G6BA 3KK3A 2CPHA 3SCKE 2HNYB 1HI1A 2OO4A 3I87A 4WIIA 4ALZA 1JK9B 4I1TA 4LF8F 4LSNB 1T95A 1TKTA 1IKWB 5F8JA 2AJFE 4F8RA 4DFMA 1VOMA 2PT0A 4I0WA 4YR2A 4LFBF 4RW4B 3R5AA 4QU6A 5E2QA 1NJWA 3G8SA 1N6QB 2ROPA 5E3AA 3NL0A 3DLJA 4NLUA 4EBCA 2HW3A 1C1BA 4NLPA 2VODA 2DIUA 4U6PA 4YR0A 5DM7Q 4PRFA 2KXFA 3DOMA 3QWPA 4G3IA 2ZVSA 3PIOQ 2R2SA 2IRYA 1R3NA 1TL4A 2F40A 2PMHA 2HG4A 2KJVA 2R7RA 2BE2B 1ZH5A 1UVIA 5CZVA 4KPYA 1UVNA 1S0MA 1Z1ZA 3GYNA 4Q8EA 3K7RA 4LVNP 1EETA 1Y5IB 3QZ7A 4DR2F 5K14A 2CPYA 5F8LA 1ZPVA 4J9LA 2PGCA 2SXLA 2HGNA 3KLFA 5DG9A 2D3ZA 1FESA 2BRKA 4GO7X 3HVAA 2YH0A 3DNCA 1M5SA 3BSCA 3KWMA 4KV8A 3OVAA 4DWIA 4CNZA 4RZRA 2W7PA 4C4WA 2UXBF 4R5PB 2AW0A 2VPZB 5G0RB 2A3JA 2DNZA 1HI8A 4KO0A 4TU8A 2K8GA 3OSPA 3VAKA 2IC3B 2J7UA 1Y3JA 4YB7A 1RTJA 1MROA 1F0XA 1HNWF 2PFFB 1WEXA 2C42A 2FY1A 1HBUA 4X4NA 3VQSA 3DOKA 2DNMA 3OBIA 4CCHA 4B3MF 4IR9A 4R8UA 1S79A 3LGNA 5DGAA 3M6UA 3HVWA 2MKIA 3BEGB 3T5HA 3H20A 1Q8IA 3ETOA 4B17A 5MLCV 4OV1A 3Q8QB 1AFIA 1S6QA 3T6JA 2DPIA 1DLOA 4K50A 2UVWA 2OSQA 1IKXA 2ZJPQ 2LXIA 4DR1F 2QLXA 4P2SA 3SSQA 2YWHA 3DRXA 4RNNA 4ZMMA 3LWMA 3TARA 1UA0A 1FHTA 1KVIA 3JSMB 1BQMA 2E1AA 3PO4A 5KFIA 5G4DA 2YKNA 4MFBB 4YB5A 5KFTA 3ZZPA 2VFSA 4OHVA 3SV3A 4NYOA 3VTIA 3T19A 3SEOA 3LAMA 4IKAA 3G4SS 4RW6A 5L1KA 1FJEB 1Y4ZB 3IXQA 3RB3A 4CTAB 1LWCA 1CC8A 2YWEA 3KK2B 2KG0A 1X4HA 4UUXA 1NK9A 1RI7A 1F60B 2D41A 2RMLA 1YJUA 1V3SA 4DV2F 3G9CA 1R0AB 2E7XA 1N5YA 2P9CA 3V4MA 4O3SA 1NH8A 3CIMA 4I6WA 4DLGA 5J2PB 1TL3B 3QPIA 1S0VA 5J1EB 5IT9Y 4K59A 1SJQA 2RILA 1S76D 3IR7B 3M2UB 4DV7F 3WDOA 3IR5B 1SKRA 3BQ0A 1URNA 5J1PA 4C11B 1S10A 1JIHA 3VR1A 5A0YA 4DLEA 1FRJA 4J9QA 1JLQB 2EPIA 3HHLB 4OX7A 5AE2A 4N41A 3JSBA 1U6BA 3I56S 3K2YA 2DHAA 1UFLA 1H7XA 2W9BA 4QPTA 4F2RA 2OPRB 1HNVA 1FK9A 4I7FA 3QJJA 3O3LA 3MEDA 3CC4S 1RA7A 2I1RA 3KNAA 4Q2LA 1IM4A 5DQIA 2NUHA 2VFVA 3G6VA 3N28A 3N79A 4FXWA 4WYLA 2QZ8A 1X9MA 2W9CB 4DR7F 1HL6A 3CT9A 1HWLA 5B08A 2PSZA 1MNEA 4OZNA 3WX4A 2GGPA 4C97A 1XMQF 5BYQA 1VLYA 3OVBA 1NU4A 1U47A 3UE2A 5CZXA 2WSCC 2XULA 3RB4A 2RF2B 3GIKA 2XB2D 4AL6A 2AV5A 2DRAA 1D0EA 3MMBB 1RTHA 3K58A 4F4XA 3R5CA 2OJ3A 3LP1A 3CD5A 5EHHA 3O2IA 2HHXA 1Q78A 2KFZA 3MECB 4NZ0A 4F50A 5HLFB 2FVRA 1GQEA 3U1LA 1BGXT 1UP1A 2IVMA 4ILMA 1UL3A 5D78A 1BD6A 4IH7A 1YJRA 4C8ZA 1YJTA 2HMIA 3GG1A 3PR4A 2CJQA 1HBMB 2ZOGA 3MDFA 5BJRA 2KRBA 1W2BR 3M6WA 2EFNA 4K2XA 1WF0A 3NLCA 5B09A 2NYIA 2F7VA 2HGMA 4P7VA 4JI3F 4DQRA 4LSNA 3M9OB 1RK8A 1IKWA 3N01A 4OI4A 4V19J 1S1UB 1J2VA 5GAEI 3TVKA 4DJBA 2ZBCA 3N4WA 2C3UA 4RW4A 5A8RB 5KFWA 3C66A 1XMOF 2AP6A 1IBLF 4ZPWR 3I5AA 5T7LA 1N6QA 4ZVGA 3DDKA 1GH8A 1UEUA 2R7VA 5CHCB 4FN5A 4ICLB 4NX9A 3KG0A 3V6DB 2KM8B 1K73T 3HT3A 5KFEA 2LXUA 1X5TA 4A8YA 3BGFA 5DLGA 2FLNA 2MGZA 1E6YB 4C9DA 3BQ2A 3CPWR 5H9EJ 3CXCR 2KH9A 3KHLA 3MR5A 2UV8A 3K57A 4J9NA 2BACA 4JI7F 3KFWX 2CPDA 3FMBA 5A2QY 2DR9A 2GIQA 2XMMA 4LFCF 2WSFC 3FEYB 3ZZOA 3BGRB 4DR6F 3HVTB 2CQDA 3FFIA 3PW4A 2BBEA 2OAUA 2WOMA 2VONA 1GNKA 1XEZA 2BW2A 3EZUA 1HWJA 4QZVB 2LQBA 1KFSA 4NXNF 2R4FA 1KQFB 2DO0A 4TXSA 4HT7A 2BDPA 1TL5A 5KFLA 1FTRA 2DGVA 5KG5A 2O3DA 1HWUA 1FRMA 1IJEB 2CJAA 2J9DE 2V8GA 2BABA 2FDNA 3PW5A 5D6GA 2FC8A 2DGQA 4PR6A 5L9XA 3R1LA 2IC3A 2ILYA 3CSKA 1JLFA 1JXEA 2DTJA 3D0IE 3MCSA 3KLEA 4DG1B 4MKBA 1TVRB 1VIXA 3HHNB 3MFIA 3OHBA 1WF1A 1VIOA 2RD5C 4QIGA 2NR0A 1N54B 1B0TA 1KS2A 5KG2A 2R2RA 2WBRA 2M4MA 3AQPA 3DLEA 5IWAF 4I2PB 2QA2A 2YNIA 3IRWP 2AF6A 4ZVEA 4QYZJ 3SFGA 1L3UA 2IRXA 4Y2CA 1KOOA 1DHMA 5I3PA 2ZHAA 4CO4A 2QSWA 4C8NA 3RR8A 1V3ZA 2KZMA 4OZJA 4N47A 3QIPB 4ELUA 4ZCLA 1VQLS 4Y2MA 3FSIA 3LWLA 2B4VA 1TFWA 1CLFA 1J5OA 3UD3P 3J7ZT 5ITHA 1D8ZA 4EYIB 4ED1A 2OD4A 2OMOA 3VAGA 3LW5C 1L3SA 2X1FA 2LQ5A 5GVQA 2KHDA 3FDSA 2EG1A 4PQUA 4OLPA 3JTPA 3GQCA 4DR3F 2C3MA 1FKPB 3CJ2A 3IRXB 5IM0A 1N34F 4NLGA 2VPXB 2DGSA