1VBXA

Crystal structure of the hepatitis delta virus gemonic ribozyme precursor, with c75u mutaion, in edta solution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
95
structure length
95
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conformational Switch controls hepatitis delta virus ribozyme catalysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/rna
molecule keywords Hepatitis Delta virus ribozyme
total genus 23
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vbxA00
5LXRA 1SJRA 2CPDA 3NS6A 4WFNQ 2B0GA 2CPIA 5CA5A 2HVZA 2DGXA 1S79A 5MLCV 2KFYA 3MURP 1FJCA 2DISA 1F9FA 1U2FA 2DH9A 5IQQA 1VQ7S 3L3CA 1G2EA 3UCGA 1YITS 3SXLA 1VQ9S 1DHMA 2EK6A 2RS8A 1FJ7A 3EGZA 2X1AA 3UD4P 3IRWP 3CCSS 2MGZB 2DH7A 2E5GA 2LEAA 4PRFA 3CTRA 2MZQA 2G0CA 3SMZA 3I56S 1WHWA 2CQCA 3B4MA 5CYJA 3J7YU 2DNLA 2MXYA 3VAHA 2CJKA 5LSLA 1X4FA 3CXCR 2MQLA 3MD3A 4UY8T 1VQ8S 2LECA 2JWNA 1VC5A 4YUDA 1PO6A 2DNRA 2V94A 1YWXA 1D8ZA 1OPIA 4C4WA 5DDQC 2CPEA 1X0FA 3ULHA 1M5KC 5GADU 2L08A 3BO2A 3MXHP 2DGVA 5H1SV 1A9NB 2PEHA 1VC6A 1O0PA 2VONA 4A8XA 2MKSA 3S01A 3P6YC 2HZCA 5GAGU 2OSQA 1P27B 2KRBA 3G8TA 1X4EA 2OTLS 1WI8A 3CULA 1UP1A 2CPJA 3VAKA 3G8SA 2LCWA 2BZ2A 2KRRA 1H2UX 3U1LA 2MYFA 2QFJA 4LMZA 3JB9k 1VBZA 3CF5Q 5IM0B 2JVRA 2CPZA 2DGOA 4F26A 2JVOA 5ITHA 4WIIA 3G4SS 1KD1T 1PGZA 2RT3A 4Y0FA 1IQTA 2FPHX 2F9DA 2LXIA 2DGUA 2DNMA 5D78A 1X4HA 1X5SA 2LMIA 2XS7A 3UCZP 3RW6A 1YJNS 1URNA 2CQDA 2J8AA 2DNZA 3EX7B 2MKIA 1A7GE 3VF0B 2J0SD 3NNHA 2MQQA 3SDEB 3CC2S 3B4DA 2MKJA 1H2TZ 4PKDB 4TLQA 2DHSA 2FY1A 3THTA 2F3JA 2D3OR 4C0OC 2QEXS 3BS9A 2KYXA 2UP1A 1HD0A 2LYVA 2KT5A 4RU2A 1U1PA 4CIOA 4BS2A 2MHNA 5D77A 4C7QA 2LA6A 3TO8A 3FEXB 1FJEB 1KC8T 1KQSR 3R1LA 1SJQA 2CQ4A 2VODA 4IOCQ 2OTJS 2GO9A 2LA4A 2CQBA 1X4GA 4LIRA 2E5HA 3CCJS 3Q2SC 5DM6Q 3CMAS 3P49B 3CPWR 1WHVA 1Q82T 2DNQA 2HGMA 1R8PA 3CUNA 5JVHQ 4CH1A 2MQOA 5GMKa 2DNPA 1U1LA 1M5PC 3THPA 3RW7A 1VQ4S 3PIOQ 4ERDA 4M5DB 2OSRA 3CCLS 2BOPA 2O3DA 3S7RA 1N52B 3MD1A 3VAMA 2G1DA 3MUVP 2M8DB 2ZJRQ 1DZ5A 2KXFA 2LKZA 2OJ3A 1Q81T 4WKRA 4FXWA 2CQHA 1JJ4A 4U67Q 1ZZFA 1N88A 2X1GA 5DETA 1VBYA 2MKCA 2F9JA 3S8SA 5JVGQ 2KXNB 1U1RA 1QVFR 1M5VC 2M2BA 2DIVA 1YHQS 2EVZA 2XS5A 2X1FA 2K8GA 2MZTA 3MUMP 2CQ1A 2MKHA 2CPXA 2AYMA 2KH9A 2KVIA 3CCES 2FHOB 1L3KA 1YTYA 2DHGA 3OW2R 1VQKS 1FO1A 1XN9A 2CQIA 5GVQA 3IWNC 3UCUP 1VQOS 2X1BA 2AYEA 2KXHA 2MJUA 2N3OA 2KG0A 4QU7A 2DHXA 2DIUA 2GHPA 3P5TL 1DRZA 1D9AA 2MPUA 1P1TA 3G71S 1AUDA 2K3KA 2FC9A 2RNEA 2MZRA 5DDRC 2ZJQQ 1UFWA 4LJMA 3R1HA 2M52A 3ZZZA 4YB1P 3US5A 2RU3A 2JX2A 2U2FA 2D9PA 2DNNA 3FEYB 4OZ0A 3CCVS 2DGSA 3CC7S 1U6BA 4ED5A 3UWTA 2MZSA 1RKJA 2DK2A 1VQ5S 2XS2A 4YOEA 1U1OA 4IUFA 3CCUS 1WHYA 1WF1A 2N7CA 1KOHA 2MQNA 3J7ZT 2OIHA 1NU4A 2DGWA 3MOJB 4IO9Q 2LQ5A 2MGZA 3DLLQ 2ERRA 2QA4S 2XNRA 1WELA 2KN4A 2YH0A 5IFMA 4IOAQ 2KM8B 1B7FA 2RRBA 4QPTA 1FHTA 2DGQA 1WG5A 3P3DA 2CQ0A 2EK1A 1S72S 2RVJA 3PIPQ 1UW4A 4CQ1A 1WHXA 3CCRS 3MI7X 1X5OA 5CXTA 1X5TA 1YJ9S 3BO4A 1X4BA 2XB2D 1U1QA 3UE2A 2ADCA 3H2VE 3NMRA 2XSFA 1U6FA 1VQMS 1JMTA 2DO0A 4QQBA 2E44A 2N82B 1K9MT 2RQCA 4WFAQ 3R27A 1W2BR 2D9OA 1RK8A 2RUGA 2KG1A 2M0GB 1WEZA 3H2UB 2DNYA 2M4MA 2CQGA 2KU7A 4WFBQ 2N3LA 5LSOA 1HD1A 2CQPA 1YI2S 2HYIB 4PR6A 2M9KA 3HI9A 2E5JA 2HGNA 2M7SA 2DGTA 2ADBA 1U1KA 2KI2A 1VBXA 2MSTA 2G4BA 2XNQA 1WG4A 3CCMS 4F25A 2YWKA 3BEGB 5DDPC 4J5OA 1R8HA 4FXVA 4W90B 4Z2XA 2U1AA 2ZJPQ 1SJ4P 3LPYA 2MZ1A 2DITA 1VQLS 3CD6S 2DNKA 2MB0B 3BO3A 3LQVA 1ZH5A 2DH8A 1KOOA 2L41A 2E5IA 2MY8A 2A3JA 2DB1A 2MQPA 1OIAA 2PE8A 2CPYA 1M1KT 1X4AA 2DNOA 3TYTA 2FC8A 2WBRA 1NO8A 5LJ5Y 2LEBA 2NLWA 2AYGA 3VAIA 2MZJA 4ZKAA 2CQ3A 1BY9A 1SJ3P 3VAFA 5DDOC 5LJ3Y 3SDEA 2RS2A 4TU9A 1U1NA 1VQPS 2RQ4A 1X5PA 1M90T 3G9CA 1QVGR 3G96A 1U1MA 1OWXA 3UD3P 4UQTA 1H2VZ 1FT8A 5HO4A 3MUTP 1WWHA 3N9UC 1X4CA 2YTCA 4TU8A 3CC4S 2M70A 3VALA 2VOOA 2I38A 2M88A 5HL7Q 1N8RT 1ZZNA 2MQMA 3NNAA 3TP2A 1YIJS 4TU7A 1JJ2R 2CPHA 3CCQS 2DNHA 1FNXH 1YJWS 4WCEQ 2MKKA 3MDFA 3S6EA 1DBDA 2DNGA 1VC0A 3VAGA 2DHAA 2MMYA 2DO4A 4P6QA 1Q86T 4F02A 5DM7Q 3I55S 3VAJA 1WTBA 1UAWA 1VQNS 3DXBA 3EGNA 2KM8C 3HHNB 5EN1A 3K0JA 3CMES 3NNCA 4W92B 1HA1A 3D2WA 1K73T 1CVJA 2AD9A 4CH0S 2SXLA 2M8HA 1OO0B 2MSSA 1X4DA 4WF9Q 3U1MA 3G6ES 2RRAA 2Q79A 4Y00A 4EGLA 5LXYA 2NZ4A 2MY7A 3ZZYA 4V19X 1WEXA 2J76E 2YH1A 1NJIT 1H6KX 1VQ6S 2AYBA 1SJFA 1M5OC 1QM9A 3Q2TC 2L9WA 5FJ4A 1N54B 1WI6A 2JRSA 1WF0A 2YKAA 3V4MA 2HGLA 1FXLA 1K8AT 1WEYA 2CQ2A 2J0QD 1JJHA 1WF2A 5IM0A 2VOPA 1WG1A 2CPFA 1SXLA 4QU6A 3NS5A 2LXUA 5BJRA 1Q7YT 2I2YA 5GAEU 1HL6A 2MJNA 4OZ1A 5GAHU 2KHCA
chains in the Genus database with same CATH superfamily
2Q1LA 3HSJA 3AOBA 2ZE2A 3BBFA 1N36F 1APSA 3D1HA 2JL9A 2QMUB 2IIHA 2QMXA 5KG5A 2EXUA 3A8EA 2UUCJ 1HI8A 1FF2A 3D6HB 1YJVA 4FPIA 4JB8B 3CGIA 3H0PA 3M8QB 5EHHA 2RE1A 1UETA 1VQ7S 1U2FA 2DH9A 3E01B 4HI1A 2FJVA 4K4UA 4DSIA 4PUOA 4JV2A 3KHGA 1EQMA 2XMAA 3I0RA 4KHRA 2JEJA 2ZNZA 2J9CA 3MFHA 1BE4A 2X1AA 4DR1F 4C11A 3GILA 1NXIA 2OPRB 2VG7A 5KFKA 3NS7B 1A0OB 3OTEA 4G1PA 1S49A 1D09B 4WK1A 2C1EB 1XR7A 4LF4J 4WE1B 4DPTA 1W25A 2R7QA 1IKYA 1RWNB 2QRRA 2OD6A 2W9BA 1OYEA 4LVOP 4YQWA 3TOQA 5F3ZA 2V4JA 1N48A 3WIVA 1REGX 3RU0A 3LAKA 4BLGA 2F8MA 3N79A 1LQ9A 5JJBA 2DNLA 3G8QA 3IXQA 2E5LJ 2VF3A 1D9DA 4O3RA 3MD3A 2DTJA 4OYOA 4W4MA 4DV6J 3KHLA 1PYOB 2R2SA 2XLJA 2HHHJ 3FFIA 3T5HA 2WSCC 4ZVFA 2UVVA 2HLUA 4LF7F 1ZAVA 1HW8A 3EXCX 3GP9A 1D8ZA 1OPIA 3TVZA 1XMOJ 3IM9A 5DDQC 1MLAA 4OL8A 4WZMA 4Y6IA 5AXNA 4AD6A 1S6QA 4Y2IA 4O3SA 4IQMA 2JH3A 4HT5A 2R2UA 1F5BA 2MDAA 3IS9A 3R5AA 2DGVA 2GMHA 4HR2A 4DPOA 1VBKA 2PEHA 4IR9A 1O0PA 4UOCA 3WBZA 3W60A 3PW4A 3T1YJ 1S7HA 3THVA 2VBZA 3HFZB 2G1HA 2G2ZA 3FC9A 2AEFA 5B0EA 4ZHRB 1U7LA 2HS3A 5IOLA 2VQEF 2ZHBA 4EBEA 4DS4A 4PWDB 3CJ4A 1P27B 2V2QA 5ADZA 3LTOA 1QSLA 2VFUA 4ID8A 1LFWA 3C16B 2IJRA 4OFZA 5J2QA 2QX0A 4YFUA 3L7UA 1KTVA 4B9MA 3MM8B 3M2VA 3QJLA 2AF6A 5C24A 4EK2A 3TI0A 3KG1A 3VAKA 2POKA 2FVPA 2HLTA 2R7WA 2KKHA 2NUHA 3G8SA 2KRRA 2LXFA 4JI4F 1QAYA 1FRJA 3FGVA 3M8PA 1M5SA 3MWBA 5ETLA 3KK2A 2QFJA 3CD7A 2QYGA 4LMZA 3RGIA 4UUXA 3V6DB 3VQSA 2CKWA 3EGWB 3HP6A 1R6VA 4NLRA 1L3TA 2RHSB 3MR7A 4Q44A 2AJ2A 3MTKA 3RYLA 1G3OA 1QJHA 1PC4A 4DX5A 3AB4B 4K8RA 4CNYA 1JXEA 3D0GE 5A8KB 3D0HE 5L39A 2JFKA 1FNMA 4CO1A 2ACYA 1EB0A 3OQ2A 1LNQA 2V5HG 2PI4A 4NLUA 4PABA 3DGVA 4WPAA 1NK9A 1RACB 1S48A 1RTZA 3HDSA 2COLA 2F9DA 2O67A 2VPYB 5HROA 1G4CA 3BH7B 2ZZNA 2RIJA 1Y9OA 3BBCA 4EBDA 3BGOP 1X4HA 3C14A 2CG8A 1Q8BA 5D4OA 4R5PB 1TL7B 3UCZP 2C28A 3TARA 4DN9A 1NJYA 2P9EA 2J8AA 2BKNA 2MEWA 4L3KA 3OHBA 4M63A 4KKOB 3H5XA 4XDCA 2Y0BB 4DR3J 1NKCA 2XGPA 3RBEA 1XMBA 2ZHOA 3BZQA 1I6JA 2YNGA 1B3TA 4KT0C 2YVSA 3B4DA 2OPQB 2G13A 3JSBA 5CYQA 4YMEA 1H2TZ 4B3TJ 5BYSA 2NSBA 3DOKA 3WZ0A 1LWEA 3QT5A 5DQIA 3Q8SB 2FY1A 3B8HA 3IS9B 1UWAA 4HDGA 4JP8A 3I0SB 3THTA 5IT4A 3JQJA 5F0WA 4CP5A 3F73A 2IFXA 2UUBJ 3OL6A 2QLBB 5J1NA 3HXMA 4E8UA 4BHQA 2VU5A 3BS9A 4DQPA 3Q23A 2F4VJ 1IWAA 3LALA 3CT9A 1U1PA 4CIOA 3JQMA 4HH1A 1UVKA 3T1HF 4KPCA 1RQ0A 2MHNA 4CT8A 3MEGB 5LT5A 4KH0B 2PMZD 1KLMA 3IAM9 4M5NA 5DLGA 5J2QB 2F4VF 1FE4A 3CMQA 1KWMA 3FEXB 3M2VB 4LF9J 2Z4PA 4C8NA 2G2OA 3GIMA 2MKYA 1FX4A 1TKXA 1SJQA 1AXQA 4IOCQ 1T11A 2GVDA 2GO9A 4G1IA 3ZZUA 4EO8A 4KB7A 2RKIA 4LIRA 4ANCA 2E5HA 2AKWB 4NL5A 5E7OB 3LP0B 2FIUA 5DM6Q 4DQIA 1UJ5A 4H4OB 5M2UA 3CMAS 2UU9J 3CPWR 1HPZB 2VZ9A 4ILRA 4A4JA 1Q82T 1SC3B 1R89A 1CC7A 3PCOB 3NXZA 4DSFA 1U45A 3LOUA 1T9TA 4ZP6A 3CD5A 3FSYA 4NOHA 2MQOA 1I94F 2DNPA 2XI2A 1CS4B 1NZ8A 3V4IA 1VQ4S 2Y8WA 3HJFA 3MPVA 3PIOQ 3W61A 4M5DB 2ZH6A 3V81A 4JV5F 5J1EB 2OSRA 3H2LA 4QWEA 1NK8A 4B08A 3MD1A 3OBIA 5C2GA 4C8OA 2B5JB 3MUVP 5G4DA 5HROB 2W24A 1CJTA 5IS2A 2ZJRQ 2W01A 3GCXP 3MR6A 3EMTA 1VLOA 2ATCB 4MIWA 2B8PA 3HHLB 2OJ3A 4IRCA 3C14B 8RUCA 1ICEB 4FXWA 2CQHA 5D0RA 2ZOMA 2RD5C 1ZZFA 4YEAA 5IV4A 1TK5A 2EEYA 4UOHA 5KOWA 4OX7A 4NLGA 3G82B 2CAJA 3NG8A 4FS1A 4A8KA 4LFCF 4C8LA 1HIYA 1QY7A 1RTHB 1VJQA 1KFDA 5DLFA 3FCWA 1M5VC 1PBUA 1YJTA 2EVZA 5BYRA 3MEDB 2DXFA 2H1YA 1E6YB 2CQ1A 2R7VA 2ZZTA 4DSJA 1JKHB 1VCTA 3CCES 1C1CB 1JLCB 3IG1B 4KV8A 2AGQA 3OW2R 3IAS9 1FDAA 2H4WB 4OYBA 3D9BA 4RW6A 2FZCB 4J90A 4ZP8A 1KQFB 5GADI 1VQOS 2XI3A 2XM3A 3T5KA 4USHA 2HS0A 1URRA 1PAUB 3PEJA 2FJBB 4M1KA 1NPKA 4QYZK 2HPUA 2AYEA 3C66A 1EKRA 1HWUA 4ES1A 4P2SA 4RO0A 2ZH5A 1FXDA 2VB6A 4D3GA 2N3OA 3T1YF 5H9EJ 3UPFA 1DZ5A 4F4KA 4RL1A 2DHXA 4ZVEA 4F2RA 2GMLA 2DIUA 3ENQA 3TUJC 2DXDA 3H4BA 4UUWA 3T19A 4TYAA 3FSXA 5KG3A 4QOTA 3NMAA 1P1TA 5F0UA 2NS1B 3KDNA 3H7HB 1TAQA 1NHVA 5ETVA 3BKFA 5E41A 2GVZB 2V4RA 2DR9A 1WSVA 2QV6A 3OTOF 3DN9A 3AAWB 2RUSA 3DLKA 2R8KA 1YZ6A 1FVQA 1F9EB 1U6ZA 2BJ9A 4CWBA 1RHJB 2JX2A 2GQQA 2FTRA 2HNDA 3L4BC 3PM9A 1SBRA 3UO0A 1SC4B 2JLFA 4CLKA 2VBWA 1PYSB 3UWTA 1RKJA 4ZLJA 3UI3A 5LSRA 1N6QA 1QE1A 3ZO7A 2AJFE 4DCJB 3CJRA 1VQ5S 3H25A 2R7SA 2QE5A 4GC7A 3FNNA 5CYMB 4IUFA 5A8WB 4YP3A 3CCUS 1Q16B 1WF1A 2QTWA 1KOHA 1BC6A 1UKUA 2MQNA 1REVB 2A0FB 4ES3A 4X4TA 2GC8A 5DGBA 1ZETA 3OUYB 1BUXA 3ITHB 1LWFA 1LK7A 3HVTA 1NNDA 4IO9Q 4NXNF 1RI7A 5DJBA 4QWBA 3UDCA 2BXJA 4FZVA 3TAQA 5E3CA 1NPPA 4YB6A 5IT9Y 3WC0A 1ROFA 2Z2MA 4U95A 1S1UA 4LR9A 4IOAQ 2D69A 3M7VA 5KG6A 4OI6A 4EWTA 1SH3A 4QPTA 2UVRA 1RHUB 3KLHB 1FHTA 4WP9A 1E6YA 2IPOB 2N4DA 4ZVTB 2A18A 2G2YA 3GLJA 1B70B 1UW4A 4EMDA 1WHXA 2V8GA 3KLGA 1S4FA 2ZM6J 1H38A 2BDPA 1DFDA 1RTJB 1X5OA 1LEOA 2PO4A 3F44A 5CXTA 3KOAA 4O23A 1RABB 3I9V9 2V2VA 3H5UA 4IRKA 3Q8YA 3AA8A 3R97A 2H5EA 4NLTA 4O4GB 1T02A 4DL5A 2DO0A 3S1TA 4Q0BB 4YY3F 2JDJA 2E44A 1PAEX 4ED2A 3JTNA 4B3OA 3OV7A 2BYCA 4OIXA 2RQCA 4WFAQ 1W2BR 3QWPA 1KLNA 4HACA 4M95A 1AZSA 3C6UA 3MM6B 3RB3A 4DR6J 2XYHB 4H4MA 2M4MA 3T9NA 2CQGA 4IH5A 5E3PA 2XSJA 2N3LA 4ZIVA 1EX8A 1HD1A 2CQPA 2B51A 4CO3A 5EGYA 5F9NA 2BM0A 1YI2S 4LSNB 1XC9A 5KFWA 1RU1A 2GV1A 2OPPA 3GWCA 3QGIA 3N4WA 4MMOA 4NLWA 3H90A 4QR1A 4CNZA 1KHWA 5A2QU 1CPZA 3FUYA 3OL8A 3BDEA 3T5JA 2KTQA 3FZ2A 1Z4UA 4WXWA 1U1KA 1WUUA 1VBXA 2A6MA 2VBXA 4DPXA 3K58A 2ZDOA 4QW9A 2XNQA 2ILYA 4FYXB 3QO9A 3T1AA 4ERDA 2PEBA 1FDDA 1N6QB 3OL9A 5DDPC 2ZNYA 3HX9A 4J5OA 2I6WA 2WOMA 3GU0A 3UQSA 2BKOA 2Y1LB 3CO9A 2U1AA 3O5TB 4OJGA 3OFGA 3LPYA 3UD5A 2MZ1A 3CD6S 3DI6A 2DNKA 2KFNA 3HVTB 2MB0B 2W4PA 1CC8A 1V3ZA 2AV5A 3LQVA 1ULRA 4KQZA 3W2VB 2X3DA 3V6HA 2DR7A 1ZH5A 4Y65A 4LBHA 3GV7B 5KFMA 1BWEA 2JJ4D 3WDOA 4B9TA 2DB1A 3QAEA 1OIAA 3BN7A 2PE8A 3C15B 3PRDA 1FRIA 1X4AA 1HKAA 1TZ0A 4CYUA 4DL0C 3NL0A 4L75A 2LQ8A 5KFIA 4I4BA 3GE9A 1XNRJ 3BGRA 2IJNA 1C2PA 1ZPWX 2B9WA 3JTOA 3OXGA 4R25A 3O8WA 4ELUA 3NMRA 3D6TB 3CJ2A 2Q3PA 4K2JA 1UZDA 2IAJA 2ZE2B 4C98A 3U27A 2PFDA 3MCNA 3KLGB 5SUHA 3D6FB 2W7AA 1UVNA 1RHQB 5LJ3Y 5D6GA 1FD8A 3GB0A 4USTA 1HNVA 2O5DA 2RDDA 4KAIA 5B09A 1RTIB 5HANA 3QNWB 2R9LA 4JI0J 4PUOB 3ZTPA 2CDQA 3CIMA 3KXDA 4O44B 1HWKA 3I0RB 4ZVHA 1X5PA 3CJ3A 2EFVA 4JI8J 2J7KA 4KH1B 4C11B 4CLPA 3QIDA 3G96A 1HYSB 1Z1ZA 5B0FA 2G9OA 3M9NB 3JS9A 3UD3P 1H74A 4UQTA 3VGSA 3MM7B 2QJ3A 4LFAJ 1SV5A 3MMBB 4LF7J 2WVDA 1IKYB 1WWHA 1AYEA 3CJQA 1X4CA 1J2VA 2OFGX 3CIZA 3N9UC 4DG1A 4QWAA 3VALA 2ASLA 2V4JB 3WX4A 3H4DA 3CWJA 1S1TB 2HWHA 4N47A 3LO3A 4NLSA 1N4LA 4OHXA 2XLIA 4LFBF 4FN5A 4ZJLA 1VR6A 4RUHA 2CPHA 2EKYA 3GYXB 4WFZA 1JJ2R 2B4UA 3JXOA 1FNXH 3MDFA 1EIYB 4DCPB 1KBRA 1WNEA 1RHKB 2XBPA 1EP4B 1YK9A 2DHAA 3VHQA 3MOZA 5CABA 5HVFA 5HVHA 4NA2A 4KGVB 5GAHI 4ECWA 3LH2S 2J6SA 4ELVA 3KLFB 4F02A 2IDLA 1FNOA 1JJCB 2GNKA 2H48B 1N36J 5F8JA 1FK9A 1NSKL 1RWVB 3CW2C 3VAJA 3DLBA 1BQNA 3AD9C 4FNHA 3RRHA 3C2PA 1IBMF 5AXKA 3JAMY 3GCWP 3W62A 2FZGB 2CNOB 1KDNA 2MLZA 3HJVA 4RW7A 2YNFA 3CMES 2IDEA 3MGJA 3NNCA 1VYAA 4ECSA 1HA1A 1LXJA 4W92B 3HKWA 4ZHRA 2Q43A 2W8LA 4Y2CA 4MKAA 4CYUB 4B3RJ 1KVIA 2HIYA 4ZPAA 2YKNA 2IYIA 4OYWA 1ZA2B 7FD1A 3D0IE 2W9AA 1OO0B 2MSSA 3BGRB 4MTPA 3HMJG 2E9ZA 5HMXA 2ZVIA 1WSRA 3E01A 5I3UA 5KG7A 3U1MA 5BYQA 3QWUA 2C2EA 3QJJA 1T9YA 4WIQA 4OLPA 3HKZD 4F3OA 1DARA 1EJ7L 1Y5NB 4OX6A 2V8HA 5A6WA 3ZZYA 2CWKA 3VZIA 3GR0A 1VQ6S 1HWIA 3RUBL 4DHVA 2AYBA 4GMKA 3KK2B 2W2MP 4X4QA 2GMJA 3EXYA 5L1JA 4NYZA 5FJ4A 5F41A 2VC1A 3SZ2A 4WP3A 1FKOA 1ZM3A 1WF0A 4DPYA 2EC0A 3QAUA 2CQ2A 4ANDA 5D0EA 5K8PA 1MU2A 1SQEA 4P2XA 4RNNA 1XNQJ 3LGMA 3GQCA 5C42A 4C8KA 4USWA 5KFFA 2I2YA 5B0BA 1HL6A 2X7IA 3TVYA 4ED7A 1XMOF 4OZ1A 1SV5B 3MMBA 1VRQC 3ZZRA 5GAHU 1TMMA 1SJRA 2I9SA 3UVJB 4KGMA 4HEA9 4KBIA 3UFCX 3RB4A 1NK6A 1HHSA 4B9UA 5H9FK 3R5GA 2CPIA 5KFCA 2J7UA 2DGXA 3HHEA 1S79A 3O44A 2HWTA 3MCOA 2K3IA 2I0XA 4CLWA 4DV1F 2FQQB 3ZTQA 4NRTA 5EDWA 1TL3B 2AW0A 3U1NA 4QW8A 2DISA 1IKXB 1F9FA 5I42B 5IQQA 4X64F 1FJCA 3L3CA 1G2EA 3UCGA 2CZVC 4NEYA 3MR2A 3W9HA 4R5PA 5KG1A 2QSFA 2VQEJ 2D3O1 1A6LA 1XIQA 2LQ9A 2QZ8A 2VFRA 3EGZA 1SIWB 3AD7C 1V5IB 3G87A 5C2CA 4I67A 2IVFB 2R7UA 2QLJB 1D3WA 3TQ1A 2BQ3A 1I51B 3CCSS 5FLXU 4KFBB 3ZTRA 2MGZB 2YNGB 1B99A 1W2IA 1X7VA 4JI3J 1DQ9A 1OS5A 1YSJA 2LEAA 4DI6A 1RAJA 2VH7A 2ZVSA 3SFGA 5KOXA 4ECUA 3DOKB 2MZQA 2B56A 1JK9B 1GK8A 2QL9B 1WHWA 2YPZA 4MYTA 4QIWD 2CQCA 4XAKA 1IBCB 3W3SA 1UL3A 2V8VA 3DMJB 7AT1B 5SZTA 2IA6A 3VAHA 3M8WA 4IFYB 4M5HA 3R2DJ 5LSLA 3CXCR 1D8YA 3EDQB 5EWGA 4RU9A 4DR5F 1TU0B 2R7TA 5LM7E 1H7WA 1TUWA 4DUTA 2JWNA 3MAHA 4NCGA 3DM2B 4DZDA 1UEVA 2RSQA 2DNRA 3H20A 4KIAA 2HFZA 3MEGA 4I69A 2F65A 3T6JA 5C7PA 5L1IA 4DV5J 2NREA 4JV1A 3AOAA 1PSDA 1JLQB 2CPEA 2X51A 4DV4J 1X0FA 3EM1A 1TQLA 3O2IA 1BQMB 3I5AA 3GSDA 3ZFVA 2IVYA 5GADU 3RBZA 3I9ZA 3EZUA 3AJDA 3BO2A 2V8PA 4HHJA 1Q8LA 1NJZA 1IBKJ 4N76A 1U25A 1GFWB 5E2QA 5ETOA 4F3MA 3TAMA 2DR8A 2MKSA 1SUQA 3BKUA 3CJ5A 4N41A 4QBUA 1GXLA 2VFVA 2N4CA 5BR8J 2XHCA 3FVYA 1Y5LB 3W5ZA 3Q8VA 1NSQA 3PJXA 5C42B 2IJFA 1X4EA 1RLCL 1VQYA 2OTLS 1JLGB 1ZM4A 1IJEB 2I1RA 1UW9A 1CJKA 3E51A 1B64A 2RF2A 1NHUA 2XMMA 3M6VA 2XWYA 3MMJA 2JEFA 2GO8A 4N7TA 1FFWB 2C22A 2LCWA 3OFFA 4P10A 1RADB 3ENWA 4HL9A 4WTYA 1KNZA 3B78A 3RRGA 1IKXA 1KONA 4JI1J 3IP0A 3JB9k 2EFQA 3CF5Q 3OSPA 4ETXA 4C0HA 5MAOA 1H7XA 3RRKA 4J7CA 2E7WA 3Q24A 2UV8G 5HMWA 3KHRA 3BPDA 5IZHA 4F26A 4YR2A 1LXNA 5ITHA 1SC1B 3EYZA 4DS5A 3LP2B 3HHDA 2QMWA 4HI2A 4URQU 4E98A 4GO7X 4WIIA 4F04B 3K5LA 4JI5F 3TUPA 3G4SS 1HI0P 4BBYA 2P2CB 3FMWA 2RT3A 4C3KA 2CJQA 7FDRA 2VA3A 2HMIB 2NXCA 4I2QA 1Y3KA 2NYIA 3UDEA 1Q78A 1KN6A 3VGUA 1KLMB 1N0VC 4F0KA 2XMJA 4KO0B 1YGYA 2CWXA 2DGUA 1LKZA 1XR5A 5D4LA 1X5SA 4CLUA 4CTAA 4YHHF 4LVNP 3RW6A 3POTB 3DC2A 2CQDA 4NA3A 4ZA1A 2OMLA 2W4DA 2MKIA 2VUGA 3OHAA 1UA0A 2RKIB 2CJYB 4CLFA 4RPFA 3OTOJ 2VPWB 2F8HA 2IMOA 2WK4A 4DUYJ 3W1YC 3NNHA 1IKWA 2MQQA 4RNHA 4YHHJ 3KHHA 2GQ2A 3EUNA 4H4OA 4USIA 3AB2B 1IWGA 4JV5J 2EBEA 1EARA 2BR0A 3FDSA 1HBMA 2MKJA 4Q43A 3VR1A 1TK0A 1NSPA 3A8IA 2HURA 2DRDA 3QRPA 2L3MA 4TLQA 1O51A 2VPZB 4PXEA 3H98A 3M2RB 3AY0A 2F3JA 2VV5A 3CJSA 4RW8B 1RBAA 3OXFA 5D4PA 1FRLA 4ZVRB 2FLNA 3KMQA 2GCFA 3MOJB 3TZYA 2J9DE 1F60B 1FDBA 4UZCA 1OPZA 5DS7A 1RXOB 4J9KA 3LWMA 2KT5A 1TMJA 2XO7A 4DFPA 2AX1A 4RU2A 2OD4A 3BM7A 2E29A 1KTQA 4DSKA 2WW4A 3I5CA 2UUTA 3DYAB 1DQAA 3TZXA 3GG0A 1N5VA 1C1BA 1Y3JA 1RUSA 1YDLA 3EVMA 5DZ6A 1WC0A 1B0VA 2K1RA 3DU6A 1KC8T 1FJEB 1QE1B 1KQSR 4E0DA 2VL1A 2W7OA 2V69A 1Z2LA 2CQ4A 1GMUA 2CRLA 4F4YA 3IM8A 4RKUC 4FVMA 4XTTA 4R8UB 2LA4A 2CQBA 4LT6A 4P52A 2HQGA 4NLDA 2ZEJA 2XYPB 3ITHA 3VGVA 1FWKA 1MROA 4B9NA 4EYIB 3TRGA 2GHVC 2HHHF 3PVXA 1OY8A 1TL5A 4GVLA 3KJVA 2G0IA 3HFVA 2RB7A 4OYMA 2DNQA 1RT5B 1JKHA 1NH7A 2YWHA 3BJYA 5GMKa 3RR7A 3AJ1A 3IG1A 2H54B 4ZP7A 2R7OA 1IBKF 1RISA 3THPA 2C42A 5J2NB 4X64J 2B6AB 1DURA 4U7UK 3BH6B 4OQJA 3NWGA 2FLPA 1JLBB 1GAOA 5EX3A 4JI2F 4ZS6A 2P9GA 3KLHA 1JX4A 3CCLS 1CG2A 4F4XA 5KFZA 2O3DA 2IMWP 1N52B 1U48A 5HBMB 1RGVA 2M8DB 3HPOA 2XZWA 4DL3A 3NEKA 3I5BA 2KXFA 4G1QB 3C6TA 1HNXF 1TFYA 5A6PA 1EAYC 2UUBF 1BGXT 3W7BA 4JI3F 1EHWA 1Q81T 2DPJA 1JJ4A 3CD0A 1TL1A 2IVMA 4IR1A 3CDEA 1BWVA 2X1GA 4OV6A 5DETA 3K5NA 2WSEC 2VJVA 4ANEA 4FKYA 3K17A 3NGTA 3KLEB 3IBWA 4XO0A 2Y1RI 4AL6A 5KFLA 2ABYA 2ZH4A 2GGPB 3DXSX 3PYEA 4DPWA 3SFUA 2R3VA 2KXNB 2AEJA 2YX1A 1QVFR 2F5GA 4Y28C 4O3QA 1YHQS 2E7XA 3I6PA 2XS5A 1FESA 4NMLA 4K0KF 2MZTA 3MUMP 2C2NA 1ZS6A 2HAFA 1RT1A 4TY8A 3L7OA 3M30B 5DG9A 2AYMA 2XSJB 4M5MA 4DSEA 4CCHA 2BE7D 3BYPA 1L3KA 3PG9A 1N0UA 2HQCA 3EVOA 3N5BA 1FO1A 4N8OA 4NRUA 3R9LA 4DFMA 5KFHA 4NXNJ 4F67A 3QLHB 2IHR1 2O01C 3PKYA 2AJ0A 3J81U 2HZVA 3IWNC 3R6GB 1QUVA 1S6PB 1VK8A 1VK3A 2BW7A 3RBXA 2XY5A 1REVA 1I94J 1WACA 4PPZA 3OUYA 2B4VA 4B9LA 3JSMA 3LW5C 3M8ZA 4WBFA 4C8ZA 1DTTB 2BJEA 1U47A 3TUIC 3DU5A 1N32F 2GHPA 3KDOA 2GIFA 3P5TL 2Y0SD 3FQKA 2MPUA 5EWFA 2ZM6F 1RAIB 1RT6B 2K3KA 2VDHA 4YN3B 3DNCA 2WTFA 4DV7F 2BJ3A 1MSWD 2C3OA 3C3LA 2HNZB 1PKUA 2FD2A 2HFOA 3GJSB 2IA0A 2ZJQQ 3D6MB 4EZ6A 1RT5A 3P8BB 2A2DA 1WC4A 2J5AA 3DDNA 5JXSA 3CDWA 3QZ8A 5IT9U 3FCVA 2M52A 3IGVA 1Q7LB 1BXNA 2V68A 3OL7A 2E9RX 3ZZZA 3US5A 3G6YA 2QO3A 4LRBA 2YBVA 3MEEB 3FEYB 2C3UA 1TKTB 2DNNA 2H4YB 2HK3A 2P8IA 2GJFA 4UF4A 3ZZOA 4DN0A 4NPOA 1X9WA 4LF8F 2OPSA 1F2HA 4PXCA 2MZSA 2HHUA 1AA1B 4YOEA 2XS2A 4LSLA 2Q66A 2BRKA 2QLWA 2WB4A 2AU0A 3QMQA 1RBOB 4ZLLA 3I82A 3JQKA 3TQEA 2N7CA 1JWWA 1S1VA 3OSNA 4QIVA 3PX6A 1JNRB 1NKEA 2PC6A 2VG7B 1LWXA 1XERA 1X8DA 2V9KA 4KGKA 2ZBRA 4HACB 4TXSA 4WU2A 4WYLA 4DX8H 1RAAB 2E1RA 3GJTB 1RTIA 2LLZA 3DLLQ 2KFZA 1UEKA 4CO5A 4ZPTR 5B0AA 4WE1A 1TL1B 2JHEA 1V3RA 2LDIA 4JYAJ 5T14A 4IQXA 2DRBA 1HW9A 1VRUB 5F8IA 1WOPA 4FBUA 3BQ1A 4F2SA 2DGQA 1NEEA 3KJNB 1AFIA 3QSIA 1UCNA 2EK1A 5HQ8A 2AMCB 3M30A 2RVJA 3QGHA 1F5AA 3FFIB 3PIPQ 5KT4A 3LUYA 2UU9F 1VISA 3IN5A 2RH3A 1L3VA 2C2OB 2B43A 4LRFA 4PWUA 5IQ6A 4FYWB 4OZLA 3TJ8A 3GIKA 2W2PP 1X4BA 4ED8A 5CAAA 3H2VE 4OLOA 2OH2A 4QCLA 3MM5B 2W9CB 2WOMB 1U6FA 3UR3C 1JMTA 3LGNA 1VQMS 1T9WA 4QQBA 1JNZB 3W2WB 4P72A 2XULA 2HAIA 3UDVA 3J7YI 2HK2A 4C0BA 1Q0NA 2ROGA 3R27A 3CDUA 2D9OA 4KY3A 1RT7B 1FI4A 1RT2A 3HCXA 1B7YB 1PYTA 3GR1A 2M0GB 3J7Z5 4KHMA 4JYAF 1H0HB 4RW4B 5E33A 4X2BA 2DNYA 1B4SA 5AE3A 3OTBA 2ZBCA 1HBOB 1C0UA 2ZBPA 4M5GA 1NHKL 4EEYA 1RT6A 2K7KA 1N5TA 2AZ3A 2XO6A 4PXBA 4J9SA 1RYSA 1EZZB 1N5SA 1GX5A 2M9KA 3HI9A 3IA0A 3M2UA 2HYIB 1X9SA 1DLOB 4P75A 1TVRB 2DBBA 3FQLA 2E5JA 4P71A 4M5KA 1VGYA 2M7SA 3IBCB 4CLSA 4MIAA 1RA6A 2GJIA 2VFSA 3MEEA 3M8PB 4K2XA 3TWZA 2F4FA 2IBKA 2B7BB 2G4BA 1OY6A 1MWZA 4F25A 3BEGB 3HHLD 5E0OA 4Y2KA 4CLTA 1HQ2A 4FXVA 4LF4F 1RWOB 1YZ7A 5CH7B 4IO1A 4N77A 4Z2XA 5IWAF 1N33F 1GTHA 1AFJA 1U8WA 1SJ4P 1YX2A 2DITA 4LF2A 1CJUA 4NA1A 4OMFG 5KFYA 1SCJB 3BO3A 4J9LA 1U0HA 2LQBA 5IWAJ 4JI7J 1BMQB 3R3TA 3K89A 3HLUA 2MQPA 1ZAXA 2KYZA 5A2QY 4DG1B 1MU2B 2BE9B 5DQHA 5D15A 4DU7A 2QC3A 2HFSA 1RBLA 1NO8A 2RDIA 2Z30B 3GYGA 2GJ2A 3IR5B 5HJXA 4MYUA 2OLWA 4LIWA 1NDCA 2BACA 1Q4RA 5AT1B 1WD6A 5FD1A 3VAIA 2YWGA 4FF4A 1D0EA 1KSPA 2GQCA 2ZKTA 1MNEA 1RE1B 3SCJE 1S10A 3VAFA 1R27B 1SJ3P 2LEPA 5HQMA 2FUG9 3FBFA 3NGRA 2GS8A 3DGPB 3PDNA 1AROP 2K7JA 3G2XA 3HSZA 1XMQF 4OI0A 2NQPA 4TU9A 1U1NA 4HHUA 3MM5A 2YKOA 2JNJA 3UW1A 1LWEB 4UOGA 1QAIA 4ID5B 1QVGR 1MMDA 3M6WA 1FWPA 2Y3YA 4GVBB 5KFEA 4DBQA 3M8RA 1KVJA 3MEKA 2YNFB 3OT9A 4HT7A 4DDFA 1YKWA 1DJ0A 5LMUJ 2ROPA 4L3NA 2DEIA 4RJVA 4ZVQB 5HO4A 4X62J 4A8YA 3KLIA 3P45B 1C0UB 2O66A 4TU8A 4U96A 2CJXB 2FJAB 2M70A 1P9QC 2YKNB 3OFHA 3W63A 3QT6A 4ZCMA 5F3TA 2VIHA 1K47A 2I38A 1MMLA 3DMJA 4KE5A 1UTAA 1WOOA 4FNIA 1TFWA 5KG2A 5I3UB 1ZZNA 3TP2A 1DLOA 3FMBA 2NXJA 3MPYA 1NPRA 1HQEB 3OR2A 3PACA 5G0RB 3W5YA 5K14A 1V6HA 2V4QA 2ZD1B 3JYTB 2FY8A 4WCEQ 5K8MA 3RBDA 2UUWA 1M1HA 2C2KB 3DM2A 4K5SA 2NPFA 3TZWA 5BR8F 4NLXA 1XNQF 4RNMA 3DLEA 4URSA 4CO0A 5KT6A 3J81Y 4A8SA 2GFFA 2MMYA 2DO4A 3GZ7A 3TUZC 3NAHA 4V19J 2C3MA 2WZ1A 1HPZA 1VOMA 5KFDA 2DCUB 1NK5A 1TAUA 4XK8C 5DM7Q 1OJ4A 2CADA 1HBUA 3I55S 2M3DA 2J9DA 1WTBA 4B3SF 4ED3A 3EGNA 3DLGA 3SCLE 5J2MB 4IG3A 4FVCA 5LMNF 2VHGA 3NGKA 1IJFB 5T41A 4JUZA 4QPXA 5JUMA 4B9VA 2WRMA 1SVDA 3UVJA 3PJWA 2WW8A 2CJBA 5FDLB 1R0BG 1SQFA 1F6TA 2KJWA 2UV8A 3IO1A 3ZZ0A 3SV3A 2XY6A 2UXCF 4BWJA 1I3OB 4U7UD 1CJTB 4RR5A 1PJ6A 3OVBA 2YKMA 5AJ3J 4DV3J 3W9IA 1S1WB 1TL3A 2PA3A 3HD2A 3V6JA 1KQGB 1JXLA 1CSJA 4K4XA 1CJKB 3G6ES 5EUHA 4OI2A 4K4YA 2D3UA 4L73A 1UJ6A 3ET6B 3A3OB 3I32A 2MY7A 2W2OP 4OYZA 4KC5A 5KTQA 4V19X 2KZMA 1H6KX 3T1HJ 3PTWA 1T3OA 3PXGa 4ZN3A 3MM9B 1QM9A 4I0WA 1SJFA 1M5OC 4Q7AA 4C8YA 3A1YG 3EE3A 3NOCA 2EFNA 1HWJA 3PR4A 2JRSA 4A8OA 3D7SB 4DWIA 2KL8A 4J9OA 3W5XA 1FXLA 2J0QD 1JJHA 1WF2A 2V8DA 4ID5A 1KEKA 2VOPA 2Z2LA 1WG1A 1QTNB 1NSAA 1Z2ZA 2B9EA 3OR1A 4ED6A 3MHYA 4DV5F 2YWEA 1Q7YT 3UNYA 3N6MA 2MJNA 5KT2A 4U8VA 2H51B 3I31A 3BSNA 3O6QA 2ZUAA 2BQRA 3VGTA 3R5JB 2C3PA 2IM0A 4ES2A 1SC6A 4NCGB 4B9SA 4I2QB 3DKDA 4K4TA 2HVZA 3CJKB 4IKAA 3MMCB 4OX8A 1RTDB 2MQ8A 5GMDA 2J8SA 4DR1J 1RT4B 1JLQA 4C97A 2YKPA 2FYXA 1YITS 3OR2B 5G0RA 3CE8A 4WTOB 4CTAB 1HBNB 2EK6A 3DHXA 3NAIA 4Q45A 3E2EA 1FJ7A 2MLYA 4RX6A 3B54A 3M9MB 4CRJA 3EPGA 3UD4P 4GKJF 3I96A 3IRWP 1CQMA 2DCLA 2QL7B 4UT4A 5L38A 1NB7A 3SBMA 3HHNB 2LFVA 4X4VA 4PQUB 2FHJD 2DH7A 1KHVA 1B0PA 1R0CB 5K20B 2VASA 4RZRA 3R5BA 1LW2A 2GX8A 3MR3A 1GQEA 3DRXA 4XDDA 1K0TA 2G0CA 3L7PA 3SMZA 3KLVA 4LQ3A 5A76A 1SKSA 2NXUA 5CYJA 4PEOA 3J7YU 4DR7J 1R31A 4IG3B 3IRXB 1FFSB 5IC6B 2CJKA 4JI8F 2YY3A 1X4FA 2MQLA 4U8YA 2FHMA 3DRRB 4ZCKA 3GFZA 4UY8T 4N5SA 1VQ8S 5FDLA 2LECA 4J37A 4TYBA 3NCQA 3K8VA 1FRXA 1VC5A 2DKOB 2M5YA 4YUDA 1PO6A 1UVJA 3DOMB 2V0NA 1LWFB 2EFPA 4R0EA 2UUAF 1AB8A 4C4WA 2BX6A 3GJQB 1X0PA 1S59A 2H9ZA 3DOLB 4DEZA 1ZTTA 5CCMA 1KVKA 1R8BA 3T9ZA 3LAMA 2L08A 3OXLA 3BF4A 2B9YA 3JAMU 3E3XA 4R8UA 1KP6A 2HRUA 2L9NA 4N8NA 4DV2J 2F8EX 5H1SV 2HHTA 3LP2A 1S1XA 1OY9A 2VA2A 2VONA 4ALZA 4A8XA 3EDRB 2XHWA 2BJ7A 4ZJOA 2A6OA 2OEMA 3KJVB 2HZCA 4USMA 3P6YC 2E66A 2AJ1A 1SKRA 5GAGU 3OPKA 2OSQA 2HMIA 3H5YA 3TVKA 4DV0J 2HHVA 4WWSA 4OYAA 2KRBA 2ZC4A 1U2RA 2RHQB 3BGUA 4M5JA 3OJSA 3G8TA 4PG8A 3IWLA 4X66J 4GKJJ 2B6AA 4A8FA 3QRQA 1JLBA 4QWDA 3CULA 2V2ZA 2DY9A 4AQYF 2IRYA 1Q53A 3BBBA 4O4GA 2XMUA 3VCDA 3CJ0A 2HBYB 4DCOB 3U1LA 4F3QA 3C6TB 1OQ3A 2IC3B 4X4PA 2JC0A 3K59A 2AZ1A 2PI5A 1TR0A 4NZ7A 2UXDJ 1VBZA 4DLEA 2AJQA 3C6UB 3NOGA 2HS4A 2OI2A 4GO5X 5E3QA 3AFGA 5IM0B 2JVRA 2UXDF 2Q6CA 2VFTA 2CPZA 2KZZA 2JVOA 3BR8A 5I4MA 1R0AA 2Z2ZA 1IKVB 1LW2B 1HQUA 4DOZA 4IOBA 2APOA 3DRSA 5CCLA 3PYGA 5HK4A 3R7SB 4QYZJ 1IQTA 4A8QA 1VRTA 2BKPA 2FPHX 3DYAA 4J9RA 2V9WA 4OX9F 1M5HA 2BA9A 3MECB 1CJVB 3IRXA 3ETOA 2DR5A 1C1BB 2DNMA 3QO9B 4BCAA 2V6AA 1U09A 1VIXA 3OLBA 3QLHA 1HHTP 2XS7A 5D8HB 3V2UC 3FSIA 3BDPA 1UVLA 4OZ3A 2XGQA 1URNA 4DL2A 1S6PA 3EX7B 2DNZA 1S4EA 1RWPB 1FRMA 4AE5A 2R7XA 3T5LA 1S5ZA 2R42A 1C4CA 1WKLA 3SDEB 3W2VA 4NLOA 4TQSA 3DOLA 1FFGB 3UDLA 4RNOA 2OMOA 2VDIA 1TK8A 4PKDB 4BC7A 1LK5A 4DR3F 4J91A 3C15A 4ZPWR 4I7FB 4OI3A 4YY3J 1DTQB 4NLPA 5KFNA 3ENAA 5J2NA 4C0OC 1HNWJ 6AT1B 4ICLB 1RHRB 3VZHA 4RWWA 2PSZA 4RBTA 1UFKA 4ZVPB 8ATCB 1YRTA 1BHNA 1HD0A 5BXIA 3KUGA 2LYVA 2Z56B 3M6UA 4O0NA 5HBMA 1FERA 2H5JB 4BS2A 2I5JB 3VVTA 2YQ3A 1GXUA 1BQXA 2YX7A 4EYHB 2GZOA 2OGUA 4C7QA 1RCOB 1HNVB 1RYRA 2IRUA 3GTYX 1SL0A 1UVMA 4DQQA 3CVKA 3R1LA 2BJDA 1FVSA 4JV0A 4K5RA 2VODA 2OTJS 2X3GA 2CG4A 3GFXA 4CM2A 3KK3B 2QLFB 1X4GA 2GGPA 3ZC4A 4QWCA 1HYSA 3CCJS 4LF6F 3Q2SC 4ECZA 3T6BA 1SH0A 3PW0A 3HM9A 1IBLF 1WHVA 2XMVA 1R8PA 3CUNA 2GIQA 3TW0A 2VQFJ 1M5PC 2FJEB 1T0TV 2HFNA 3KFWX 3T41A 1U26A 4Y2MA 3F0NA 5KFJA 3BYRA 5E3RA 1NKBA 2FLOA 1R0AB 2Z57B 4I2PA 1VDHA 4LRDA 3OD2A 1N56A 3QFWA 2BE2B 2P9CA 4FS2A 1T8EA 2BOPA 4AL7A 1ZOTA 4P73A 2E7VA 1N32J 1VRTB 2BVZA 3DDIA 4I6YA 2VG5A 5C5JA 2OIHA 3I4PA 1N34J 2LKZA 2VC0A 3MECA 2AJ4A 3C8YA 3SQGB 3JSMB 4X84A 1S76D 3DDKA 3RAXA 3BSOA 2DPIA 1DTTA 4WKRA 4TY9A 1M1GA 2D41A 4ECVA 3MPUB 3QIPB 2W9CA 1N34F 2C2DA 3KLFA 2NR0A 3AXKA 2QG9B 4Q8EA 4HTIA 2MKCA 5KAKA 2ZFHA 3VV2B 1BQNB 4ZVSB 1O5JA 1U24A 2YX4A 4DR7F 2HBQB 5JVGQ 1U1RA 1LWCB 2FB0A 1RDRA 2DIVA 4RW7B 4ZIWA 2A1BA 3KMSA 1HNZJ 1Y11A 2X1FA 4N56A 4OYIA 4RW4A 1NK7A 2AEMA 1RU2A 2EKNA 1S57A 1HBOA 4I7FA 1NK0A 1TKTA 3N5FA 4DJBA 3PYDA 1YTYA 1HNZF 1G7CB 3HT0A 4ZCLA 2MLXA 1F5CA 4G3IA 4AUKA 3A12A 2LVWA 2DY1A 1XN9A 3ILIA 1W7WA 4K7QA 3ISND 5GVQA 3W8PA 4F4AA 1TUVA 4O3NA 2Z8QA 4MH8A 4I6AA 5ETNA 3OLAA 1NRKA 3PZPA 1QDUB 3WQPA 3CCWA 3N0VA 4DPUA 3MMAB 4M5IA 2FHKA 4A47A 2KXHA 2QYCA 1R43A 3SYZA 1J5OA 5LL6d 1FEEA 3CDBA 3FEZA 4QU7A 2RU9A 2EFGA 1X60A 1QUPA 4DL4A 4DU8A 3Q22A 3CDAA 4KHPJ 1DRZA 3A4TA 1TTHB 1YVFA 1D9AA 2HQDA 3CSKA 4QIEA 2OPRA 3G71S 3ZNUA 3CNQP 3CCTA 3A8JA 3ISZA 4ZP9A 2B4OA 4HKQA 1LW0A 3DRPB 4OX9J 4K4ZA 5L8RC 4YDXA 1NDKA 1U0HB 3RAMA 5DDRC 4F4ZA 1KQKA 4GRSA 4L72B 3R1HA 3TEHB 2R8JA 5J2PB 3GIJA 2CJ9A 2CDRB 2K2PA 3PHEA 2WVBA 1S9EB 1IR1A 3AJ2A 4YB1P 5ETSA 1XQIA 2D9PA 3JSRA 4NLQA 2DGSA 2ZC3A 1JLFB 3M32A 4J9NA 4K0KJ 1LV5A 3W65A 2HKEA 4DQRA 1JQGA 3D3CJ 5D3GB 3KNGA 4QIFA 5GAGI 1WHYA 2HQ3A 2BABA 2Z2YB 2OO4A 4K59A 1QSYA 1NU4A 1RWMB 2DGWA 3D67A 2G0JA 3DGPA 5FLXY 4F8RA 5HN0A 1SI9A 3GMGA 1RT2B 1RT7A 2BM1A 3MF5A 2MGZA 3G6VA 2J9EA 2ZH1A 2ERRA 1S6QB 2XNRA 1OSDA 2XTJP 5HSPA 2IM3A 5KFGA 4MJKA 4ED4A 1Q8IA 1KS2A 4BC9A 1YBTA 4NMXA 3VTIA 3CEDA 2H5IB 2YH0A 2QGFB 4OJ1A 2ZKUA 2DEJA 3UN5A 1RAGB 1S6OA 5IFMA 2KM8B 1S6UA 3KG0A 2HRYA 2D1CA 1LWCA 2OUGA 2RRBA 3GONA 1RZMA 1UMJA 1ZTWA 1ITPA 4ITSA 4RWXA 3SEOA 3VWSA 3WX8A 5C25A 1TUGB 2AGOA 2FVRA 3RJMB 3PY8A 3B82A 2RDJA 2CQ0A 1CBKA 1UPPA 3KLIB 2GW8A 3NBPA 4A48A 2AIRB 3K5MA 4Q8FA 4ECYA 3MI7X 5KFBA 3J7A1 2PGCA 1X5TA 3D5MA 4WYWA 1T3NA 1YJ9S 2EG2A 3GFYA 4LF1A 3BO4A 2O1PA 1YG0A 5I3QA 4X4UA 2ZWOA 4EUVA 2C2RA 2XB2D 1S0MA 4CLZA 1FCAA 2K06A 1HQEA 3BSAA 3HD1A 3KK1B 1FKAF 5K14B 2L9DA 5LMNJ 2PMHA 2WAQD 1S77D 2N82B 2HEKA 3KKFA 4RNFA 2BJ8A 5KFOA 4RBVA 4F7VA 4OZJA 3MAAB 2E9TA 4RW9A 1HLWA 1RK8A 1SUQB 1SPBP 2RUGA 3FRZA 3M1VB 4IFVA 3HZGA 4KGXB 4OJHA 4ZPCA 2KG1A 4A8WA 2BQUA 1WEZA 2RQKA 2F7VA 2BW2A 3K2YA 1KRPA 1SH2A 4TKTA 1HBUB 2KU7A 1JIHA 4Y34A 4WFBQ 4X65F 2AHOB 4DX7A 3QRRA 1HMVA 2RILA 3DLGB 3G86A 2F1FA 4QJVA 5A8KA 2AGPA 4FF2A 3QSYB 1XK8A 1WOSA 3KUEA 1JLGA 1E6VB 1G1XA 5L46A 5IC4B 2RF2B 1NJWA 4WU3A 3PW5A 2WCXA 1GTEA 1U8SA 1AUSL 1MW7A 1S9EA 2LDYA 4OZNA 2GA7A 3MZIA 4YB7A 2VBYA 3HULA 3ENVA 2KI2A 4P2FA 4DUZJ 4C9DA 1RAHB 2YKMB 4G65A 4O0IA 4DR4F 1S1WA 3BSCA 3HVAA 1LFPA 2JOQA 2R2RA 3KYLA 5D0GA 2ZOFA 5ETTA 2WVEA 5B7WA 2AQ4A 1TL7A 4U7CA 3GJRB 3WHIA 1FKPB 2ZJPQ 2CZ9A 4GVBA 1VQLS 4KTQA 4P2MA 4RLEA 2OKQA 4CM0A 1SKUB 2YPYA 3MM9A 4DL6A 3H5SA 4USJC 4EU0A 2DH8A 3HSDA 1TP7A 3BPSP 3R6LB 2L41A 2E5IA 2MY8A 2A3JA 2JFDA 2ZH7A 1WDDA 5D0HA 4DLGA 4KPYA 1UWBA 2DNOA 2HHPA 2KB2A 3SCKE 4LQ9A 2EG1A 5KFVA 2FC8A 2L48A 2WBRA 5KT3A 2HWIA 2C3YA 4KJIA 1EQ0A 2QIFA 1ZYQA 5LJ5Y 3GV8B 4AXJA 2LEBA 4DR2J 3PX0A 5K8OA 1K0VA 2NYHA 1U02A 4DFKA 4LF5F 2ZD1A 3JYTA 1H98A 4W98A 4FPRA 2VICA 4UQGA 2MZJA 4ZKAA 1V5VA 2BJ1A 4MKYA 1HFEL 1BY9A 1OSCA 3HFKA 2LQJA 3ZTSA 5A8RA 4NCBA 4QR2A 3WIUA 4UY85 2RS2A 2HFVA 4LSZB 2E1AA 2HHXA 1TELA 3KWMA 1VQPS 2NXEA 1HBMB 2RQ4A 1TKXB 4ETZA 3IR6B 5DRKA 1M90T 2GVDB 1NM2A 2V2KA 4LF8J 1IVZA 1G6BA 2XZTB 2R7RA 3E8OA 4XPCA 4DV0F 1RAOA 3LP0A 5AJ3F 2RQMA 1OWXA 4WKYA 1RWWB 2YKQA 4NEZA 4AT1B 1X9MA 2DJWA 2AX0A 1H2VZ 3V5RA 3Q8RB 5KG4A 2HQIA 4CT9A 3MUTP 4O3OA 3TJAA 3CC4S 2HQFA 3IR7B 5IT0A 2FJWA 4LREA 3J7AN 4LFAF 4LFBJ 4L76A 3NCRA 1ACMB 4LBIA 4MIBA 1FTCA 4K4WA 1CS4A 2M88A 4HTJA 2PIIA 5HL7Q 3I56S 3BN4A 3LPEA 1N8RT 2OHDA 2BANA 4JI7F 1E6VA 2EC2A 2MQMA 4MK7A 3NNAA 1YIJS 2JEIA 5J1EA 1EKSA 1RWUA 2GAHC 2Z0GA 2YXLA 3CO0P 2ASDA 2V67A 2DNHA 4JOUA 4LRCA 4FKXA 2XC9A 2B5JA 1JLEA 5KFAA 1YJ7A 3OTCA 1Y4ZB 3NP5A 2DNGA 2HBZB 1OQ6A 1T94A 2WONA 3X1LB 2YNIA 1YLXA 1U49A 3AODA 3HHLA 2UXBF 1NLKL 3A8KA 2RRNA 1FRKA 2CUYA 4NE9C 2HNYB 4P6QA 4X66F 3DRYA 1VJWA 1Q86T 2HVHA 4IH6A 1UAWA 3KG4A 1SL2A 2VKRA 1MWQA 1VQNS 3OR1B 4ZPVR 4DUYF 2PD1A 4USKA 2KM8C 1XMQJ 5IXUA 5EN1A 1I1GA 1PJ7A 3L95X 5T7LB 3G6XA 1TV6A 2BRLA 2ZH3A 4G6VB 1YBUA 1K1QA 2YWFA 3MEDA 3MFIA 2YNHB 3D2WA 1VBYA 3GFHA 1K73T 1IBMJ 1CVJA 2E1MC 5L1LA 1T7PA 4D3HA 4WZQA 2SXLA 2YQ1A 1C1CA 1JLCA 4URGA 4PG5A 4NWBA 1EETA 2W2QP 1YJRA 3HF5A 4FP9A 1P9YA 4J9UE 4JBCA 1IN0A 2JC1A 1MN7A 3EVWA 4CI0B 4WF9Q 2ZH9A 4FYYB 4RW6B 3RR8A 4X62F 1DQ8A 3BB5A 2VPXB 3ISNC 3P4UB 2Q79A 5LXYA 3HVRA 5HP1B 2NZ4A 3D3BJ 3R5DA 3TAPA 2ACMA 1U0SA 3KLEA 2J76E 2HVDA 3TJ9A 4DZ6A 3LGHA 2ROEA 4PQUA 3Q2TC 2Y9HA 3HSGA 4L6V3 5M2PA 3PX4A 4CZCA 1S9FA 2VG6B 1WI6A 4ENOA 3MAQA 4MKBA 3DLHA 2EFOA 1WEYA 4TVAB 1K8AT 4TY8B 5HAOA 5IM0A 5KFPA 3QFHA 3QBCA 5KFRA 2CPFA 2UZAA 3U7JA 4P7TA 2LXUA 2JLGA 3IGNA 5BJRA 5J1PA 5GAEU 2UUAJ 2GVZA 2R8GA 1T9UA 4MKVA 1RT3B 2RAQA 5K9FA 1XWLA 1NCLA 2KHCA 1IKVA 5LXRA 1R8AA 2CPDA 3DRSB 3NS6A 3TZZA 1HNIA 4U6PA 4A8MP 4V1Ak 4WFNQ 2B0GA 2IM1A 2IM2A 4LUBA 3QGGA 3PHTA 5CA5A 4PG6A 2HNDB 1RP5A 2AP6A 4PYAA 1Q95G 1H73A 5MLCV 2KFYA 3MURP 2QLXA 4J9PA 3M8YA 3H8YA 2ZITA 4RUCA 1RWKB 1MWYA 1L3UA 1R8CA 3R5CA 3SXLA 1VQ9S 1DHMA 2RS8A 3IC1A 4ZCIA 4DV1J 1GX6A 1MG7A 3AXMA 5A8WA 4IG0B 5RUBA 1YBAA 3X3UA 3JSYA 1RA7A 4DV3F 1S1XB 1YRXA 2YNIB 2DXEA 2MHEA 2QSWA 4OHWA 4HLBA 1K1SA 1N5YB 1D1UA 1OYDA 2E5GA 1M0SA 4PRFA 3QT8A 3CTRA 4NXMJ 3CJTA 3KTQA 1ELOA 1HHQA 4Q2MA 4DFJA 3BGLA 1Q79A 2QL5B 2W4CA 3B4MA 5HJYA 4DR4J 2J6TA 2PMWA 5LOQA 4ATNA 2CXEA 2MXYA 4DF4A 2OPSB 2R8HA 1S9GA 2P5VA 4LF6J 4LSLB 2KDOA 2NPIA 1SJ1A 3IMQJ 5F8GA 2KVQE 4QIGA 2XEXA 4ER8A 1S1VB 1BD6A 5E5NA 5LMUF 5D3GA 3ETMA 2IC3A 2V94A 1Y5IB 1YWXA 3M8QA 4YR0A 2HHSA 4F50A 3GIRA 2XWXA 4ECQA 4DXLA 9ATCB 4FYDA 1R7IA 4I64A 1O6XA 3ULHA 5IV3A 5HP1A 1M5KC 2NZCA 4NLVA 1FWLA 3NY0A 4HVZA 3ILOA 1GMWD 1VMBA 5KG0A 3MXHP 1VFJA 4B3OB 1XNRF 1S12A 1A9NB 2IY5B 4F0MA 4O3PA 1VC6A 4O4RA 1VRUA 3S01A 1XTZA 3D68A 5DG7A 1QLNA 3FRYA 3MTJA 1C0TA 1HQUB 4YS2A 1NB2A 1T9XA 3PO5A 1ZAWA 3LP1A 3SSQA 1NK4A 1FA0A 4IRDA 3D66A 2KHDA 3ONQA 3DCAA 1FD2A 3OVSA 3K5PA 2FVQA 3RTVA 1WI8A 3H59A 2V50A 2DRAA 4L74A 1UP1A 4PQAA 2CPJA 4Z37A 4B3TF 1FJGF 4I68A 2R4FA 4B3MJ 4BWMA 4ZOSA 4RUAA 2BZ2A 3SCIE 4OI1A 3PRVA 1H2UX 1K44A 2FGOA 3DLJA 3TA2A 3W2WA 3PW2A 2E5LF 2MYFA 4KR0B 2ZZMA 3QATA 3TEGA 1FJGJ 4C8MA 1IUJA 5ETPA 5B0GA 4JI6F 2XQCA 1T03B 2HHQA 2EW9A 4OV1A 4DV6F 3QIPA 4MFBB 4U9RA 4MAKA 1AW0A 3PV8A 1WKKA 4IG0A 1GH8A 1DTQA 1IM4A 1TL4A 1VHIA 2DGOA 3RB6A 1UVIA 3DHWC 3TANA 1JLAB 1B0TA 3OTDA 4ICLA 1TKZB 3SI8A 4NYOA 2DD8S 1T05A 3M2UB 2ZBIA 1S97A 1N5YA 3QYYA 4LF9F 1KD1T 2DVIA 2Z58B 1PGZA 1TVRA 1PCAA 4Y0FA 2XYGB 1VI7A 3NGDA 2E1CA 1LOUA 1RCXB 4DSLA 3FJ2A 4PWDA 2I5JA 1IXKA 2BUNA 5CZVA 3LA0A 5HVGA 4DV2F 2N7YA 4KSEB 3NGUA 3W9JA 2LXIA 4M8LA 4F4WA 4KHPF 2CVEA 4X4NA 2UXBJ 3ZTOA 1GEHA 5D78A 1S9GB 1NZAA 2LMIA 1FXRA 2GAGC 4AYBD 3HT3A 3TA0A 1YJNS 5JMNA 3MPWA 3UR0A 4XPEA 1A7GE 3VF0B 2Y1JA 2VQFF 3F56A 3EWGA 5DQGA 3L9ZA 2J0SD 1F2GA 2HG4A 4CDIA 1GMWA 3HO1A 1CJUB 2XMTA 3C19A 4PG7A 1QAJA 2A2CA 3CC2S 1L3SA 3D1OA 3MPDA 2QA4S 3V6DA 5H9EK 1J5OB 2UUCF 3C46A 3EJMA 1U6BA 3A3NB 3QT7A 5KT7A 1S0VA 3LF0A 3M05A 4H4KA 5M2RA 4B3RF 3PR5B 2W25A 2DHSA 4OHVA 1PIEA 2ALYB 2W9BB 4AXIA 3BQ0A 2OP5A 1J27A 4NASA 2GHWA 2IRXA 2D3OR 1Q8KA 3H42A 3O1LA 3SSSA 3MM7A 2CNNB 2J7WA 1DY3A 1UPMB 1SL1A 2BE2A 2QEXS 2A10A 2KYXA 2OELA 3PNIA 2UP1A 5ETQA 4OHYA 2DYAA 3LP1B 4MK8A 2NSCA 4R0JA 5J2PA 3A3PB 4FDFA 4ELTA 1PG5B 2R8IA 1HARA 4ILMA 4HHHA 3SQGA 1S1TA 1UEUA 3TX8A 1XBWA 5D77A 2LA6A 3TO8A 5F9LA 2BV3A 1JXVA 5A0YA 5CD4A 3M9OB 2ZH8A 1UA1A 3NKYA 3OFEA 2JSXA 2HSEB 1S0NA 3IBFB 1PC5A 3FBEA 4USUA 4OJ3A 5K5MA 4HDHA 1S7IA 4WK3A 1EP4A 1Y0HA 3M6XA 2BBEA 1WC3A 2YQ0A 5DZ7A 3P49B 4J9MA 2FHJA 4NZ0A 4USVA 4ILLA 3PKMA 2HGMA 2V63A 3U02A 2W1BA 5JVHQ 4CH1A 1RHMB 4ZVGA 4B17A 1FK9B 4LBPA 4J9QA 4JI2J 1RKIA 2HVEA 5L9NA 3V6KA 3I0SA 1U1LA 1JLAA 5CHCB 5L1KA 1F3FA 1N5QA 3RW7A 1Q5YA 2HW3A 1NDLA 1NBEB 2DT9A 2XMWA 4TLRA 4DX6A 2B7CB 5C24B 4OYXA 3NRBA 4C3MA 5EX0A 3S7RA 3GV5B 3R7BB 2D7SA 2R2TA 3SV4A 3VAMA 2ASJA 3NBPB 8AT1B 2G1DA 2ILZA 3P96A 3MCMA 1YQHA 2RJZA 3MMAA 1F9HA 3KJFB 3EGVA 3ILJA 1U2CA 3DLEB 3ZXWA 4EFAC 6FDRA 3Q8QB 1H72C 1FEHA 3L09A 2RMLA 2EPIA 3N01A 4QYRA 4EO6A 3J81j 3Q86A 4NXMF 3KNAA 4I1TA 4U67Q 3KK1A 3K8WA 4P74A 3SSRA 1N88A 4OI4A 3NGSA 5F8MA 1CQNA 3TX0A 3AHPA 2F9JA 4CLYA 3S8SA 1LW0B 3DRPA 2KJVA 2AWZA 2H3EB 3MAAA 5J2MA 2NCKL 3PW7A 1RLDA 1ZM2A 2DR6A 2M2BA 3M1VA 2ASYA 2WBMA 5I3PA 1SB6A 1FKOB 4IYQA 2K8GA 4JI4J 2QT7A 1VIOA 1UJ4A 2MKHA 1C4AA 4OYPA 2CPXA 1S99A 3PEHA 4PG4A 3W66A 3J80Y 4PWWA 2KH9A 4FXDA 3JTPA 3OVAA 2KT2A 2KVIA 2FHOB 4BDPA 1XR6A 2BOAA 2DHGA 3V4IB 1VQKS 1JLFA 1WORA 3FBBA 3M32B 4EZ9A 4LR8A 1IBLJ 2CQIA 1Q5VA 2B9XA 2VKZG 3VVUA 1PJ5A 3BKTA 2ZWPA 4HH0A 4GC6A 2WVCA 4YDDB 3UCUP 3ET6A 4X4RA 2X1BA 3PRBA 3Q8PB 1RAFB 3D1QA 5HI7A 4NLYA 4KKOA 4NZ6A 1I5OB 2D74B 2YWWA 4RUBA 2MJUA 3R8YA 5I42A 3N6NA 4ZLNA 2FZKB 4NI2B 5A0YB 2KG0A 2ZUGA 2XCAA 3F41A 2OPQA 2JEGA 3QPIA 5CYQB 1V3SA 1GT8A 5GAEI 1FKPA 3FCHA 4P7VA 5K8NA 2XCPA 4DR2F 2ZHAA 2XG8A 3G82A 4K4VA 1FDNA 1AUDA 2IBOA 5AE2A 2FC9A 2EBGA 1OMSA 2RNEA 1XEZA 1F0XA 1RTHA 4KFBA 3FZBA 4ZMMA 2V34A 4UW2A 5U47A 5C25B 2MZRA 1UFWA 3ADAC 4LJMA 4CH7A 4EI2A 3PJ9A 3H40A 3FKBA 3LANA 2NUUG 4LRAA 4PAAA 4CO2A 1UWBB 1QD1A 2RU3A 4LFCJ 4FF3A 4P9SA 2PT0A 3CJKA 1S0OA 2U2FA 1P8GA 3MMCA 2QN6B 3AOCA 4OZ0A 3W64A 1RTDA 3CC7S 2Y1IA 4JI1F 5DO2A 1RT4A 4IFYA 4JI6J 2DK2A 3KJQB 3I87A 1NDPA 4ZLPA 2EWHA 1HBNA 3HHLC 1Y7PA 5CD4H 2XLKA 1U1OA 4OHZA 1NAQA 1NMEB 1HNWF 1SQGA 3BR9A 3J7ZT 4Q2LA 4TQRA 4DQSA 4PZVA 1RAEB 4X65J 3GG1A 5A8RB 1ZBTA 4RW9B 5AXLA 2LQ5A 4IFVB 4XIUA 3QJPA 4MT1A 1FTRA 1R6YA 1BQMA 2JZ5A 1V9OA 1WELA 5KFSA 3UN3A 1UFLA 4ZITA 3EZ5A 4DF8A 3NCPA 2Y8YA 2KN4A 4H54A 1YRUA 1XJWB 2HRTA 2HFUA 2HIQA 1HMVB 3TAMB 1B7FA 3VQTA 4ED0A 4AFFA 1RSCA 4F36A 3GPAA 5KFUA 2UVWA 4M5DA 3V81B 1WG5A 3DRRA 4HYKA 2CIMA 3P3DA 1HI1A 3IFEA 1S72S 2VD3A 4OZ2A 4CQ1A 3CCRS 1VS3A 6FD1A 2WVFA 5HLFA 4ZVUB 5F8LA 3DOMA 3AD8C 2HVIA 2OEKA 5THWA 2FGCA 5F8HA 1ZPVA 1HR0J 1QSSA 4EBCA 3AQPA 2J6UA 1U1QA 3UE2A 2PA8D 5KT5A 2ADCA 5F8NA 2XSFA 3PFOA 4ED5A 2CFXA 2P6SA 4NCAA 3BGFA 1HR0F 2LU2A 1Y00A 1BLUA 5KFTA 2FJXA 1SKWA 1K9MT 5ETKA 4QR0A 2CNLB 4NI2A 3ICLA 1F3VA 5B0DA 4ZK7M 1MN9A 2PN6A 4Y3CA 2HNYA 2B8QA 3H2UB 4TN2A 4LF5J 1CULA 1TKDA 5EWEA 3QGPA 5LSOA 1HWLA 1QTMA 4KV8B 1WTFA 3HK2A 4B02A 2CNKB 2B3TB 3M4XA 3BREA 3HVWA 2JLEA 3KUHA 5T7LA 2XZDB 4PR6A 3PFEA 3K7RA 4M5LA 4QZVB 4UZBA 2YNHA 3AQOA 1Y10A 2HGNA 3AH6A 4NYPA 4ZPBA 2DGTA 1SIZA 2XMKA 4DMZA 2ADBA 2UVUA 4KYZA 1RTJA 2MSTA 1GNKA 4KRWA 1VLYA 3ZNJ1 1EETB 3I4HX 2KT3A 3AA9A 3Q83A 3N6LA 4KO0A 4C6AA 1WG4A 4ED1A 3PYFA 3WC2A 3R2CJ 3IWXA 1KR4A 3CCMS 4MK9A 2YWKA 1FE0A 4IDKB 1R8HA 2I8EA 3POTA 4Q0BA 1J5EJ 2FVCA 4RBUA 1RJJA 4W90B 4NX9A 3K57A 1IKWB 2BMBA 4E2FB 1RWXB 2F40A 3CB4A 1U4BA 1J5EF 4OZ5A 3MR5A 1KOOA 2VG6A 2MTLA 5B0CA 3DLKB 5D4NA 4H4MB 2CPYA 9RUBA 3B6BA 5HMZA 1M1KT 2J0WA 3M2RA 1WJ9A 3UNGC 3FBCA 4RW8A 2ZOGA 3NLCA 3TYTA 1HNXJ 3CCVS 1FX2A 1CJVA 2WHOA 5KFQA 4DL7A 2BANB 2NLWA 4DR6F 1GMVA 1WKJA 4ZVOB 4ZJQA 1T95A 3LWLA 5HMYA 2F63A 4KGZB 3N28A 5CYMA 1HNIB 2AYGA 1JLEB 3A13A 3MCSA 1WC5A 2CQ3A 4UTGA 4Z7CA 3EZOA 3GIIA 4C2MA 3EPIA 5HLFB 3GYNA 5DDOC 2WONB 1YJUA 2FVSA 3PO4A 3SDEA 3RB0A 3AT1B 4YB5A 3D28A 1F1BB 2K1RB 3UN2A 1WDTA 1IR2A 2C2MB 1D9FA 2QA2A 4AQYJ 1N33J 1QAXA 5GMEA 3TNVA 4K4SA 3G9CA 4DUZF 2PFFB 1S1UB 3DFEA 4K50A 1X31C 4Y2AA 4ZPDA 1MROB 3DI6B 5KFXA 4ECXA 1U1MA 3TR5A 2CVIA 4GKKJ 1TV6B 3NWRA 3EICA 4FBTA 1FT8A 1ZA1B 4C3LA 4WFYA 3P5BP 1RB0A 1NJXA 1CULB 3HHKA 3R7NB 2H65B 2NXNA 2YTCA 2P6TA 5ETRA 3D54A 4WFXA 3BQ2A 4DV4F 4GKKF 4H4KC 2AT1B 3K5OA 2VOOA 3RAQA 4ECRA 2CZ4A 4F0HA 1W26A 2ZDPA 1FRHA 3QZ7A 1PILA 5E3AA 5AE1A 4TU7A 2QA1A 1P6TA 3SQOP 1VHFA 2FJDB 5HQLA 4WP8A 1IM6A 2IAJB 2LP4A 3CCQS 2XY7A 1YJWS 2HBRB 2MKKA 3S6EA 1P1LA 2LU1A 2CJAA 4PCQA 1DBDA 3W8GA 1H3DA 1ZM9A 3KK3A 4G1QA 2W7PA 4DV7J 1VC0A 2OFHX 3VAGA 2ALZA 4PXDA 3QQCD 4B3SJ 4C48A 2KO1A 5FIIA 1AZSB 2DHHA 2CYYA 3MM6A 4LR7A 4IDKA 4WXOA 4M94A 2B4PA 4O44A 5DG8A 3OJUA 2OAUA 4PPDA 1T9VA 3J80U 3Q0AA 2QA4G 1R3NA 1WC1A 3DXBA 3ZZPA 3HZEA 4X4SA 4YR3A 1GXTA 5CZXA 2FLLA 3D4JA 4FF1A 4B3MF 3CJ8A 4LSNA 1VQSA 2PDAA 4I56A 2OPPB 1RT3A 4I2PB 4S0MA 5HATA 4JI0F 5CQGA 3K0JA 1C0TB 2EI5A 5AXMA 2QFIA 4FYVB 1RT1B 1IQZA 4ZDNA 3RZAA 4PYDA 2AD9A 4CH0S 2VG5B 1IR0A 3BV8A 4TNOA 3Q89A 4Z7YA 3M8SA 2M8HA 1AT1B 2OEJA 4ECTA 2WSFC 1WC6A 2IYGA 2ZBQA 2Q6BA 3T3FA 4A46A 2GIRA 5DGAA 2CA9A 3SIPB 2UXCJ 3FK4A 1X4DA 5B08A 2FDNA 2HHWA 1UZHA 1NH8A 3O3LA 2W8KA 2J0XA 2E1PA 3ILLA 5H9FJ 2RRAA 4Y00A 4EGLA 1CEZA 4JI5J 1DAXA 1WEXA 1Q1KA 3ZZTA 2YH1A 4I6WA 2VJUA 2BEFA 1NUEA 4CO4A 1NJIT 5L9XA 1KFSA 2ZH2A 1JB0C 3TA1A 2L9WA 4Q5VA 1N54B 4WJBA 1T03A 4CLLA 2YKAA 1PBAA 2HGLA 3V4MA 2C2ZB 4DR5J 4MFBA 3Q8UA 2D3ZA 4X4OA 4IH7A 2WB1D 5ETMA 2ATLA 4AL5A 1MMNA 1KKHA 1SXLA 4QU6A 3NS5A 1CLFA 1L5UA 3C16A 3CCZA 4J9VA 2HNZA 3GSIA 1TKZA 2W2NP 4UOFA 3ELHA 1T05B 1O8BA 2HZAA 3RG6A 3MM8A 4ZN1A
chains in the Genus database with same CATH topology
2Q1LA 2ZE2A 1N36F 1APSA 3D1HA 2JL9A 2QMXA 5KG5A 3A8EA 1HI8A 1FF2A 5EHHA 1YJVA 5D3GB 3CGIA 3M8QB 2RE1A 1UETA 1VQ7S 1U2FA 2DH9A 3E01B 4HI1A 2FJVA 4K4UA 4DSIA 4PUOA 4JV2A 3KHGA 3I0RA 4KHRA 2JEJA 2ZNZA 2J9CA 3MFHA 2X1AA 4DR1F 4C11A 3GILA 2OPRB 2VG7A 5KFKA 3OTEA 4G1PA 1S49A 4WK1A 1XR7A 4WE1B 1W25A 2R7QA 1IKYA 2QRRA 2OD6A 2W9BA 4LVOP 4YQWA 3TOQA 5F3ZA 2V4JA 1N48A 3RU0A 3LAKA 5JJBA 2F8MA 3N79A 1LQ9A 2DNLA 3G8QA 3IXQA 1D9DA 4O3RA 3MD3A 2DTJA 3KHLA 2R2SA 2XLJA 3FFIA 3T5HA 2WSCC 4ZVFA 2UVVA 2HLUA 4LF7F 1ZAVA 1HW8A 3EXCX 3TVZA 1D8ZA 1OPIA 5DDQC 4WZMA 4OL8A 4Y6IA 5AXNA 1S6QA 4Y2IA 4O3SA 4IQMA 2JH3A 4HT5A 2R2UA 1F5BA 2MDAA 3IS9A 3R5AA 2DGVA 2GMHA 4DPOA 2PEHA 4IR9A 1O0PA 4UOCA 3WBZA 3PW4A 1S7HA 3THVA 2VBZA 4DSJA 5B0EA 4EBEA 4ZHRB 2VQEF 1U7LA 2HS3A 4DS4A 2ZHBA 4PWDB 3CJ4A 1P27B 5ADZA 1QSLA 2VFUA 4ID8A 1LFWA 4OFZA 5J2QA 4YFUA 1KTVA 4B9MA 3MM8B 3M2VA 3QJLA 2AF6A 5C24A 3TI0A 3KG1A 3VAKA 2POKA 2HLTA 2R7WA 2KKHA 2NUHA 3G8SA 2KRRA 2LXFA 4JI4F 1QAYA 1FRJA 3FGVA 3M8PA 1M5SA 3MWBA 3KK2A 2QFJA 3CD7A 4LMZA 4UUXA 3V6DB 3VQSA 2CKWA 3EGWB 3HP6A 4NLRA 1L3TA 4Q44A 3MTKA 3RYLA 1G3OA 1QJHA 1PC4A 3AB4B 4CNYA 1JXEA 3D0GE 5A8KB 3D0HE 5L39A 2JFKA 1FNMA 4CO1A 2ACYA 3OQ2A 2V5HG 2PI4A 4NLUA 1NK9A 1S48A 3HDSA 2COLA 2F9DA 2O67A 2VPYB 5HROA 2ZZNA 2RIJA 1Y9OA 4EBDA 1X4HA 5D4OA 1Q8BA 4R5PB 3UCZP 2C28A 3TARA 4DN9A 1NJYA 2P9EA 2J8AA 3OHBA 4M63A 4KKOB 3H5XA 4XDCA 1NKCA 2XGPA 3RBEA 1XMBA 2ZHOA 3BZQA 1I6JA 2YNGA 4KT0C 2YVSA 3B4DA 2OPQB 2G13A 3JSBA 5CYQA 4YMEA 1H2TZ 5BYSA 2NSBA 3DOKA 3WZ0A 1LWEA 5DQIA 3Q8SB 2FY1A 3B8HA 3IS9B 4HDGA 5IT4A 3THTA 3I0SB 5F0WA 3F73A 2IFXA 3OL6A 5J1NA 3HXMA 4E8UA 4BHQA 4DQPA 3BS9A 3Q23A 3LALA 3CT9A 1U1PA 4CIOA 4HH1A 3T1HF 1UVKA 5LT5A 1RQ0A 2MHNA 4CT8A 3MEGB 3K57A 2PMZD 1KLMA 3IAM9 5DLGA 5J2QB 2F4VF 1FE4A 3FEXB 3M2VB 2Z4PA 4C8NA 3GIMA 1TKXA 1SJQA 1AXQA 4IOCQ 4G1IA 3ZZUA 2GO9A 4EO8A 4KB7A 2RKIA 4LIRA 2E5HA 4NL5A 4DQIA 3LP0B 2FIUA 5DM6Q 1UJ5A 4H4OB 5M2UA 3CMAS 3CPWR 1HPZB 2VZ9A 4ILRA 4A4JA 1Q82T 1R89A 1CC7A 4DSFA 1U45A 3LOUA 4ZP6A 3CD5A 3FSYA 4NOHA 2MQOA 1I94F 2DNPA 2XI2A 3V4IA 1VQ4S 3HJFA 3MPVA 3PIOQ 4JV5F 4M5DB 2ZH6A 3V81A 5J1EB 2OSRA 3H2LA 4QWEA 1NK8A 4B08A 3MD1A 3OBIA 4C8OA 2B5JB 3MUVP 5G4DA 5HROB 2W24A 5IS2A 2ZJRQ 3MR6A 4MIWA 3HHLB 2OJ3A 4IRCA 4FXWA 2CQHA 2ZOMA 2RD5C 1ZZFA 4YEAA 1TK5A 5KOWA 4OX7A 4NLGA 3NG8A 4FS1A 4A8KA 4LFCF 4C8LA 1QY7A 1RTHB 1KFDA 5DLFA 1M5VC 2EVZA 1YJTA 5BYRA 3MEDB 2R7VA 1E6YB 2CQ1A 1JKHB 3CCES 1C1CB 1JLCB 3IG1B 4KV8A 2AGQA 3OW2R 3IAS9 1FDAA 4RW6A 4ZP8A 1KQFB 5GADI 1VQOS 2XI3A 3T5KA 4USHA 2HS0A 1URRA 3PEJA 2FJBB 4M1KA 2HPUA 2AYEA 3C66A 1HWUA 4ES1A 4P2SA 2ZH5A 1FXDA 2VB6A 4D3GA 2N3OA 3T1YF 3UPFA 4ZVEA 2DHXA 4F2RA 2GMLA 2DIUA 3ENQA 3TUJC 3H4BA 4UUWA 3T19A 4TYAA 3FSXA 5KG3A 4QOTA 3NMAA 1P1TA 5F0UA 2NS1B 1TAQA 1NHVA 5E41A 2V4RA 2DR9A 2QV6A 3OTOF 3DN9A 3AAWB 3DLKA 2R8KA 1FVQA 1U6ZA 2JX2A 2GQQA 2FTRA 2HNDA 3PM9A 1SBRA 2JLFA 2VBWA 3UWTA 1RKJA 3UI3A 5LSRA 1N6QA 1QE1A 1VQ5S 2AJFE 2R7SA 1B64A 3H25A 2QE5A 4GC7A 3FNNA 5CYMB 4IUFA 5A8WB 4YP3A 3CCUS 1Q16B 1WF1A 1BC6A 1KOHA 1UKUA 2MQNA 1REVB 4ES3A 4X4TA 1ZETA 2GC8A 5DGBA 3OUYB 3ITHB 1LK7A 1LWFA 3HVTA 1NNDA 4IO9Q 4NXNF 1RI7A 5DJBA 4QWBA 3UDCA 2BXJA 4FZVA 3TAQA 5E3CA 5IT9Y 4YB6A 3WC0A 1ROFA 2Z2MA 1S1UA 4IOAQ 5KG6A 4OI6A 4EWTA 1SH3A 4QPTA 2UVRA 1FHTA 3KLHB 1E6YA 2N4DA 2A18A 1UW4A 1WHXA 2V8GA 3KLGA 1S4FA 1H38A 2BDPA 1DFDA 1RTJB 1X5OA 3F44A 2PO4A 3KOAA 5CXTA 4O23A 3I9V9 3H5UA 4IRKA 3AA8A 2H5EA 4NLTA 4O4GB 1T02A 4DL5A 2DO0A 3S1TA 4Q0BB 4YY3F 2JDJA 2E44A 4ED2A 3JTNA 4B3OA 3OV7A 2BYCA 4OIXA 2RQCA 4WFAQ 1W2BR 3QWPA 1KLNA 4M95A 3MM6B 3C6UA 3RB3A 4H4MA 2M4MA 3T9NA 2CQGA 4IH5A 5E3PA 2XSJA 2N3LA 1HD1A 2CQPA 2B51A 4CO3A 5EGYA 5F9NA 2BM0A 1YI2S 4LSNB 1XC9A 5KFWA 2OPPA 2GV1A 3GWCA 3QGIA 3N4WA 4MMOA 4NLWA 4QR1A 4CNZA 1CPZA 1KHWA 3OL8A 3BDEA 3T5JA 2KTQA 3FZ2A 1Z4UA 4WXWA 1U1KA 1VBXA 2VBXA 3K58A 2ZDOA 4QW9A 2XNQA 2ILYA 3T1AA 3QO9A 4ERDA 1FDDA 1N6QB 3OL9A 5DDPC 2ZNYA 3HX9A 4J5OA 3UQSA 2WOMA 3CO9A 2U1AA 3O5TB 4OJGA 3OFGA 3LPYA 2MZ1A 3CD6S 2KFNA 3DI6A 2DNKA 3HVTB 2MB0B 2W4PA 1CC8A 1V3ZA 2AV5A 3LQVA 1ULRA 4KQZA 3W2VB 3V6HA 2DR7A 1ZH5A 4Y65A 3GV7B 5KFMA 1BWEA 2JJ4D 3WDOA 4B9TA 2DB1A 3QAEA 1OIAA 3BN7A 2PE8A 3PRDA 1FRIA 1X4AA 3NL0A 1TZ0A 4DL0C 5KFIA 4I4BA 3GE9A 3BGRA 2IJNA 1C2PA 1ZPWX 2B9WA 3JTOA 3OXGA 4R25A 3O8WA 3CJ2A 2Q3PA 2IAJA 2ZE2B 4C98A 3U27A 3KLGB 5SUHA 2W7AA 1UVNA 5LJ3Y 5D6GA 1FD8A 3GB0A 1HNVA 2O5DA 4KAIA 5B09A 2R9LA 1RTIB 4PUOB 2CDQA 3CIMA 4O44B 1HWKA 3I0RB 4ZVHA 1X5PA 3CJ3A 2EFVA 2J7KA 4C11B 3QIDA 3G96A 1HYSB 1Z1ZA 5B0FA 2G9OA 3M9NB 3UD3P 4UQTA 3MM7B 1SV5A 3MMBB 1IKYB 1WWHA 3CIZA 3N9UC 1X4CA 1J2VA 2OFGX 4DG1A 2ASLA 4QWAA 4ILLA 3VALA 2V4JB 3WX4A 3H4DA