3BPSP

Pcsk9:egf-a complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/lipid transport
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3bpsP01
2Z58B 3AFGA 2QTWA 3BGOP 2Z2YB 2XTJP 1SPBP 2W2MP 3VHQA 3T41A 3WHIA 3A3OB 3GCWP 3WIUA 1R6VA 2Z30B 3A3NB 3QFHA 3VV2B 3CNQP 2E1PA 2W2QP 2Z57B 3A3PB 1SCJB 2W2PP 3GCXP 3CO0P 2ZWOA 3SQOP 3H42A 2W2OP 2Z56B 2W2NP 4OV6A 3P5BP 2PMWA 4YN3B 4K8RA 4JP8A 1ITPA 3BPSP 3WIVA 2Z2ZA 1V5IB 4NE9C 4NMXA 2ZWPA
chains in the Genus database with same CATH superfamily
2F4VJ 1TKDA 4DCOB 5AXNA 4O4GB 5KFMA 4QR2A 2PE8A 3OTEA 3SSSA 2GZOA 2Z2LA 2HAIA 3D54A 4X62J 3W2VA 4HDGA 4AT1B 3NEKA 5K8NA 2KXFA 5IZHA 2J6TA 4JYAF 4B3OB 1WG4A 2GJ2A 2WSFC 3IRXB 2I0XA 3DI6B 3MUMP 4RW9A 1BGXT 2J0SD 4C2MA 3V5RA 4ER8A 1OYEA 1Q7LB 5A6PA 3VGSA 4USHA 3PX6A 2ATCB 5KFIA 2QL5B 3BKUA 2P5VA 2PMHA 4FBUA 1J5EJ 2Y1JA 2AYBA 3UE2A 4LF5J 1HNIB 2PA8D 4ECYA 3UCUP 2MLYA 3M2VA 1K9MT 2IM0A 2RF2B 3GCWP 2H5IB 2YNHA 1NRKA 2JVRA 1TL1B 1WF1A 3IBFB 3HF5A 3JSMA 5KFTA 4R8UA 3UQSA 3CCVS 1WSRA 2KDOA 1D9DA 2ZEJA 4RLEA 4TU8A 3UW1A 3PVXA 1Q78A 2O1PA 1IBKJ 1NSQA 3UR0A 4MIWA 1QE1A 3EM1A 1IBMF 3AXKA 1L3SA 5D78A 1ZETA 2UUTA 5I3PA 1X4DA 3RB6A 4Y3CA 2GMHA 1XMQF 2RQ4A 1E6VB 2Y1RI 1UMJA 3KJQB 5K9FA 1RA7A 2W9BB 1K44A 3CCMS 5D77A 4H54A 4J9QA 2BJ7A 4LFCF 1VLYA 1PBAA 3W66A 2VOOA 1K0TA 3A8JA 3EZOA 2XM3A 1QTMA 4PG5A 4O0IA 3EZUA 2XLJA 1TVRB 2ACYA 2BZ2A 2IDEA 4DUZF 1FKOA 3CJQA 4UY8T 1QM9A 4W92B 2WVEA 2FHKA 4GMKA 3JSBA 2LKZA 2YTCA 2AZ3A 4ATNA 4P72A 5CZXA 3ENQA 1WNEA 4J9SA 2ZJRQ 3Q2SC 2CA9A 1KLMB 3D6HB 4ELVA 1RDRA 3U02A 3NGDA 5DJBA 1XBWA 1XQIA 4J9LA 2FIUA 5HLFB 4AD6A 2NCKL 3O8WA 2YKMA 1CJUB 3RBEA 1GTHA 1WHYA 2RRAA 4OI0A 3OPKA 3DNCA 5HBMA 3MCMA 1KNZA 3EMTA 3KJFB 4R0EA 2CQ0A 2GJIA 3M32A 1HBMA 2VICA 3R1HA 2KXHA 1DRZA 2J7WA 3W5YA 1H72C 1L3UA 2OPSB 3FBEA 2ZH2A 5DM6Q 3HHDA 3GLJA 2GS8A 2CJYB 3SCLE 2C3OA 2V9KA 4P2FA 3UD5A 4PG4A 2A2DA 3W62A 4ZJOA 2W9CA 2R2UA 2I5JA 3BDEA 1BQMB 5CQGA 2VPZB 2OELA 2W4DA 2ZUAA 2CQHA 4ZPAA 4KO0B 3DRSB 4ES1A 1EP4B 2V34A 3JAMU 4UZCA 3DOKB 2YVSA 5EX3A 1T11A 2ZBQA 5H9FK 4PABA 2VPWB 3AODA 3ENWA 2MQOA 2RKIB 3V6HA 2BVZA 5DO2A 3C6TA 2CPHA 2M0GB 1NLKL 2HZAA 5DDPC 4M94A 5KAKA 3G82A 2EFOA 2C3PA 4JP8A 2HMIB 2AZ1A 2RUGA 2ZJQQ 1KOHA 1P8GA 5DS7A 3UI3A 1KVIA 5M2RA 4CZCA 1X5PA 1VOMA 1S7IA 3QT5A 1GAOA 2HW3A 4GKJF 4M5DB 1P27B 4MKVA 4ERDA 4ZN1A 3BB5A 1GNKA 1FO1A 2OUGA 4C7QA 1JXVA 4DPUA 4NA2A 2BDPA 3M6XA 5D3GA 3U7JA 3DXSX 1LWEA 2K3KA 4WU3A 5KT6A 3BQ2A 4QIGA 3GIIA 4G1PA 1JJ2R 5HVGA 5H9EJ 1R3NA 4I2QB 2EPIA 3D9BA 4WXWA 1UJ4A 3QWUA 4X66F 4HACA 1RTIA 4ALZA 2RDDA 3GR1A 2C3MA 2R42A 3FSIA 3ZZTA 1FFWB 1NJXA 3NWRA 2YWWA 3HD2A 1S9EB 2MZTA 5M2UA 2F8HA 1R89A 4DPOA 1PSDA 4MYTA 4Y2MA 1KVJA 5U47A 2ZZNA 2MKHA 2ZJPQ 4ZVGA 4XTTA 4IDKA 2XSFA 2DGVA 3KKFA 1DARA 4P73A 2CIMA 3QIDA 5KFUA 4F4KA 1KP6A 3TEHB 3HFZB 2F65A 1HWJA 3WBZA 2ATLA 4C8ZA 4K0KJ 4O3RA 2GHVC 3BS9A 4DL7A 1FWKA 4DS4A 2AP6A 4A8QA 2V63A 2VU5A 3W2VB 2VV5A 1VRUA 3A8KA 4ECQA 2EEYA 2XSJA 3Q0AA 1WKJA 3TEGA 4ECVA 2HRYA 2QE5A 2NXNA 1WOSA 2K8GA 4RW9B 3R7BB 3J7Z5 2VHGA 3CC2S 5L39A 4ITSA 4ZVQB 1HWIA 1H73A 3FEZA 3TJAA 5EX0A 3D2WA 1YJNS 4I2PA 4CM2A 2VFVA 3MR5A 4USKA 4LIRA 1AUDA 2IAJA 3SIPB 2KU7A 4WFAQ 3GFYA 1IQZA 4ZIWA 2J0QD 3J81Y 3M2VB 5DLGA 4Y2KA 2IVFB 2BKOA 3FRZA 1ROFA 1S12A 1M5PC 2YNHB 4LBPA 2UXBJ 2KFZA 4WP3A 2HHTA 2OH2A 3JSMB 1R8AA 2H5EA 4R8UB 1T7PA 5IQQA 1FDAA 3OVSA 4LRCA 4DFPA 4USWA 3UPFA 2XS7A 3MM7A 2QJ3A 2C2MB 3LPEA 5B09A 5F0UA 2V6AA 1QE1B 2WBMA 4LREA 2B4OA 3BYPA 2OLWA 4G1QA 4DV4J 4O44A 4OZNA 4FNHA 5A2QU 4W98A 1ZPVA 2PD1A 1CVJA 1T95A 2JFDA 4QU6A 3QT7A 3FSXA 3H2VE 4DPTA 4CO2A 3Q89A 4NCAA 4DX8H 2LMIA 1RT5B 1SUQA 4M5NA 4FS2A 1G3OA 3K8VA 3HT0A 4DR5J 2R2TA 2AGPA 1C4AA 3R3TA 2G2ZA 1FKOB 3CXCR 2R7SA 3QJPA 2ADCA 3MWBA 3GG1A 4G1IA 4DR4J 1RP5A 1RXOB 5E3RA 2HNYA 3H2UB 1B99A 3M6VA 3UO0A 2GO8A 4P75A 2D3UA 1A6LA 2XWYA 2QSFA 3BPDA 3AY0A 5GMKa 1N0VC 4F50A 1AB8A 3D0HE 3TQ1A 3NCRA 3B82A 1CJKA 5FD1A 5IS2A 1D3WA 1N36F 2N3OA 5GAGI 3PYGA 3OLBA 2BW2A 4FS1A 2YKMB 2XI2A 4Q0BB 1GFWB 2ZZMA 5HBMB 2C2ZB 1U2CA 2PA3A 3DGVA 3MF5A 5IT9Y 3KYLA 4IG0A 2VFTA 1HBMB 3TW0A 3FBFA 4OZ2A 3GP9A 2R8JA 2WOMA 4DSFA 5DG9A 3CUNA 5A8KA 2U2FA 2NYHA 2W9CB 2DR6A 4K4ZA 1SL2A 2I5JB 2F5GA 4N77A 2PO4A 2F4VF 3RR7A 4PKDB 3D6FB 3QQCD 4ZVHA 2COLA 1S59A 2FB0A 4IH5A 1HKAA 2KFYA 4RPFA 3NLCA 3MTKA 1F9FA 4X62F 1VIXA 2VJUA 5JJBA 2BJ1A 1HLWA 1NXIA 2HURA 1X4AA 2IDLA 3C6TB 4KGKA 4GVBA 3G82B 3LAKA 1CC7A 4IQXA 1JK9B 5CD4A 3SV3A 3WIVA 1ZYQA 1WEZA 5HMWA 1JX4A 4QBUA 2U1AA 1SJFA 5HAOA 2XMAA 3EYZA 4JI2J 2W01A 3CT9A 2DY1A 4EZ6A 2MZRA 3PW0A 1PC5A 3F41A 2QC3A 3DDKA 4C8OA 2GQ2A 3NOCA 1LWEB 3UDLA 3PIOQ 1VQ6S 1RWWB 3TNVA 1SCJB 5B0GA 4U7CA 2W1BA 4ZVUB 5IT0A 1FT8A 1F3FA 2QTWA 1YGYA 4K4SA 2K3IA 1TUWA 2MSTA 2MY8A 5HMZA 4HACB 1RTIB 4B9VA 3NWGA 4ANDA 8ATCB 1YJ9S 1Q86T 4C9DA 1IBKF 3CDBA 3Q22A 2CPXA 4KE5A 1RHUB 1XJWB 4X65J 3W60A 2FGOA 2Q1LA 4KPYA 1UPPA 3LAMA 2NLWA 2H51B 3B8HA 3LO3A 1NZAA 4J9MA 4IDKB 4CCHA 2CVIA 3D7SB 1F5AA 1U0SA 1EZZB 1OPZA 3M05A 4ETZA 4IH7A 2C2DA 2Q6CA 1SKSA 3LPYA 4LRDA 4UUWA 4OZ1A 1F9HA 1BQNA 2X1FA 4DV7J 2EI5A 4WWSA 1VRUB 4QIVA 2ZZTA 2GVDA 2XSJB 2JX2A 3J80Y 1TFYA 4OX6A 3Q2TC 2CZVC 4PXCA 2XO6A 1VQYA 2UUBF 1X8DA 1VQ8S 1WF2A 4FYYB 1XIQA 2R8GA 2H4WB 2BUNA 5ETOA 5C24A 2UXCJ 2HHHJ 4I2PB 4MT1A 2IAJB 3W8PA 1O0PA 2BE9B 1FEHA 4J7CA 1K1SA 2B4VA 1I5OB 2KG1A 2HZVA 4NE9C 2V2KA 5D0RA 3F56A 4KSEB 4IFYA 1S1UA 5D4PA 4CLUA 1RAAB 3A3PB 3FVYA 3L9ZA 4IKAA 3MOJB 3ZC4A 3HKZD 1XMBA 1NK7A 2DNRA 1YG0A 1N34J 2RMLA 2JLGA 2X3DA 4Z7CA 1N8RT 3EGZA 1M90T 1XNRJ 4RNNA 1IJFB 1RCXB 2JL9A 1QD1A 3TA2A 2WVFA 1U47A 5DGBA 2OTLS 5C5JA 3FRYA 3OTOJ 3M4XA 4G1QB 3LP1A 4N56A 1FE4A 3GJQB 4O44B 1KSPA 5D0HA 3D5MA 2HFZA 5F8GA 2C2RA 3PW7A 4MKBA 3TVZA 3TZWA 1UFLA 5LT5A 2GCFA 1U49A 4ZS6A 4B3MJ 3VZIA 2R8KA 3M8SA 3UCZP 4B02A 1SUQB 3AB2B 4M5GA 3EPIA 4KFBB 4TY8A 3U27A 1A7GE 2QL7B 4HYKA 4ZLLA 4KAIA 2CPZA 3B54A 1RU2A 3M8RA 1BQXA 4AXIA 3VAIA 5KFKA 1RHRB 3NNCA 3TZYA 4DMZA 2HNYB 4K4VA 1S6QA 2UU9J 2Q3PA 4FVMA 2HWHA 4ZOSA 5T41A 1SBRA 5CA5A 3EZ5A 2GFFA 4RBVA 1RABB 1VYAA 1CJKB 3B4DA 4N8NA 5KT5A 1KOOA 3V2UC 1OYDA 2NUUG 5GVQA 1IR0A 1HNWJ 2DD8S 1WSVA 2HFNA 2RRNA 5L9XA 3QAEA 2MEWA 4ZPVR 2ASLA 1AW0A 4QWCA 2VODA 1RHQB 1G6BA 2WONA 4IG0B 4ZPWR 3HPOA 2BJ8A 5AE1A 3DDIA 5GADU 2RAQA 1TL4A 2ABYA 4ZJQA 2EKYA 3CW2C 2N82B 2CJQA 4ZITA 2WOMB 4JI5J 4YB7A 1VQ4S 1YZ7A 4DL2A 4F3OA 1Q5VA 5A8KB 2VPYB 2ASJA 2LFVA 1EARA 4YR2A 4X4RA 1CQNA 4Y2CA 3IM8A 2F8EX 1CSJA 3C46A 5CH7B 3L09A 2KKHA 3BQ0A 1B4SA 2DITA 2WRMA 2VZ9A 1SC4B 4K0KF 1N5QA 4QIEA 2KL8A 3PIPQ 1UW9A 3ZZ0A 3DLEA 4IUFA 3CB4A 4RU2A 3BGUA 1X7VA 2FZCB 4KGXB 2CQPA 4F4YA 1ZTTA 2HFSA 3MPUB 1Q53A 2L9DA 3DMJA 1EETA 4PQAA 2XNQA 3C66A 2PT0A 4OI3A 4GVBB 4NA1A 2XULA 3CTRA 5C2CA 2GGPA 3PHEA 3TA0A 2W8KA 3SZ2A 4NCGA 1Q8KA 4ZCMA 5KG6A 3C14A 3NMRA 2UV8G 4HHJA 2DHXA 3W9JA 4WIIA 4I69A 2BJ3A 2JOQA 2CPFA 2DGWA 4L74A 4NLSA 1BE4A 3J7A1 3IFEA 3JTNA 5HVFA 2XZTB 1YHQS 3CNQP 1QAXA 4RBUA 2XY5A 2XLKA 2MJUA 5HQMA 2VOPA 5CYQA 2UXBF 2BQ3A 2YQ0A 2DIUA 1SL0A 5H9EK 1DBDA 4EEYA 3DRYA 2OSQA 5EWEA 1XK8A 3M8PA 1WTBA 2ZH1A 4G65A 5CYMA 2D3ZA 4DPYA 4NOHA 3BEGB 3LA0A 3RZAA 3LF0A 1VQOS 4DV4F 2EW9A 4P9SA 3KLIA 1YRTA 3CC7S 4I1TA 1UWAA 1S48A 1RT7A 4KIAA 5C25A 2ZD1A 4OJ1A 3QZ8A 3H7HB 3L4BC 3MTJA 2IBKA 2HHPA 1B3TA 1P9YA 4C3MA 4QCLA 1Y10A 1NJZA 4NLRA 2NQPA 3AOAA 4B9TA 3KUEA 3RTVA 4DR5F 4HTJA 3RW7A 4GC6A 2E5IA 3EGNA 1SC1B 1HI8A 2BE2A 1BQNB 1W2BR 1PAEX 1VQ9S 2RDIA 2IM1A 4ED2A 3M6WA 4DR4F 2GVDB 2D3OR 4Y6IA 2DNQA 1JJCB 3TUJC 3W8GA 2MSSA 2YNIA 9RUBA 5KOXA 4LIWA 2CJBA 3VVUA 1R27B 4X64F 3SXLA 3R1LA 1JXLA 1LV5A 2AJ4A 5E3QA 3PRBA 1S76D 2WW4A 5KFOA 4RWWA 2WB4A 4CI0B 3MURP 2E1CA 5C24B 3I6PA 4URSA 4DSEA 1YK9A 2NXCA 3DCAA 3ZZUA 2E7XA 1MNEA 2YPZA 1CLFA 2CJAA 2UUAJ 2EKNA 1TK5A 3OW2R 1S9GA 2F1FA 4AL6A 2HHSA 3HVWA 4UQTA 2LQ8A 3CC4S 1R0BG 1PBUA 4ZIVA 1U02A 2AQ4A 4IFYB 1S1UB 2VKRA 1YKWA 2C3UA 4AFFA 1UA1A 3NL0A 4AXJA 2VQEJ 3JSRA 3IRWP 2RDJA 1RQ0A 5E3CA 3AT1B 2F9DA 1X31C 4BCAA 4HEA9 1AA1B 3I5AA 1KKHA 1FKAF 4I6YA 1VBYA 1L3VA 2IRYA 3G6VA 5KFBA 2QLJB 2IA0A 4L72B 3IWNC 4OHYA 1QSYA 4BWMA 3RG6A 1Q4RA 4CO1A 1C2PA 4ED8A 3ILLA 3LP1B 3L3CA 4EBEA 3PRVA 1FXDA 4PXEA 1QY7A 1RYRA 2QZ8A 1AUSL 1R6VA 1IM6A 3PM9A 4LF8J 1IUJA 4UOCA 4ECWA 4YQWA 5HJXA 1TU0B 2LQ9A 4DLGA 1KQGB 3QZ7A 2E1PA 2DNMA 5ADZA 3M8WA 1IBLJ 4JI2F 2HEKA 4K4UA 2PEHA 3BBBA 3GYXB 3CDEA 3WC0A 2F63A 1S6QB 4K4WA 4OYAA 4CIOA 4CWBA 4GVLA 3NRBA 1HI1A 2GA7A 3PV8A 5JVHQ 1RHMB 3CCSS 5KT2A 5DG7A 5KFEA 4IFVA 3VAKA 2RQMA 1ZAXA 1DQ9A 5BYRA 4BS2A 4RUAA 3JQJA 5KFCA 3OLAA 1QJHA 5L38A 1N5VA 3ZTQA 1NK9A 4Q2LA 4Q44A 3I87A 3GIKA 2J9EA 1S72S 3BJYA 4AQYJ 3KXDA 4OX8A 2J7UA 2I2YA 2WONB 4CYUA 1SKUB 1LK5A 3RRKA 4K50A 4PPDA 4ZP8A 1U48A 3ZZZA 2YKQA 4HT7A 3G6YA 3IR6B 2R7RA 4X65F 1BUXA 2C2EA 4Y2IA 2J8SA 3T9NA 4ECRA 2DNKA 2DO0A 3ISZA 1X4FA 2XMVA 4CO0A 1NKBA 3C6UA 3RR8A 4IOBA 3GV5B 2VG5A 4LSLB 3I56S 4WTOB 1MN9A 1VMBA 4BC7A 2GVZA 2UV8A 1VQPS 5KFVA 2YKAA 1F5BA 3DLEB 1Y5NB 4CLTA 5AXKA 4QU7A 2FLOA 3VGTA 2IA6A 1CG2A 3S1TA 2BOPA 1NPKA 4MK9A 3JTPA 3OR1A 3DMJB 1R0AA 1EETB 2FZKB 3CIZA 3DLJA 2FQQB 1VHIA 2OIHA 2XO7A 5LJ3Y 1UZDA 5HATA 2DHAA 3BSAA 2J6SA 4C48A 3MFHA 4D3HA 4RNFA 3FC9A 2XCPA 3N9UC 1MSWD 3MEEA 1TL3A 3CCRS 3U1NA 4NCGB 1FNXH 2UXCF 2HHHF 5LMUJ 2YXLA 2D9OA 4B9SA 2CNNB 3T1AA 1NSPA 1ZS6A 2B7CB 3OUYA 1DZ5A 2W2QP 1N32J 4NYZA 1PJ6A 2E1AA 5HROA 3BO2A 2BBEA 1RACB 5J1PA 3JTOA 2GHWA 5AE2A 4FXVA 2AEJA 2QLFB 3D0GE 4QPTA 2XS2A 5KFHA 4ANCA 3GV8B 1TKXB 4PG8A 2B9EA 1ZPWX 4USTA 4DCPB 1WWHA 1XNRF 2DCLA 1ZTWA 4B3TF 3M8PB 4H4KA 4Q43A 4NWBA 4JV0A 2JDJA 5CYMB 4DR3J 4NLUA 2HHWA 4P74A 4WYLA 1YVFA 3MPDA 2O01C 3K5NA 3DLGA 3OTOF 3IG1A 4DX5A 1SIZA 1R31A 3HVTA 1DJ0A 3KLIB 1KHVA 1RT7B 2MZ1A 5C25B 4J9OA 1B0TA 2ZD1B 2XC9A 3R97A 1UCNA 1WORA 4DPXA 2ZNZA 4B3MF 2MDAA 3ILJA 1JQGA 2ACMA 3TUIC 3AJDA 4DN0A 3FMWA 1CS4A 1LWCA 4DQRA 2BE2B 4ZP6A 3V81A 1JLEA 4NMLA 2MKJA 1GMWD 2AHOB 3R9LA 1B0VA 2YNIB 3E51A 2FHJD 4AYBD 2LU1A 1OY6A 3DLLQ 3DOLA 4PR6A 2DRAA 1ZM2A 1RISA 1HNWF 2X3GA 2FYXA 2LDYA 3Q8QB 2B4PA 4NA3A 1S9GB 2BJEA 1FESA 1X0PA 1FWLA 2IMWP 2O66A 2PFFB 2OSRA 4TU7A 5JMNA 2QIFA 1RWUA 2NPIA 1V3ZA 4K2XA 3M8QA 4LR8A 4I64A 2W2NP 3ONQA 2IBOA 2OKQA 1JMTA 1Y0HA 4JI5F 4HKQA 4K7QA 2BXJA 2ZH4A 3GIJA 2MHNA 1JLQA 4F36A 3E3XA 2MQMA 3M9MB 1DHMA 1DTQA 4PYDA 2ZHBA 1RWPB 5E5NA 3CCWA 1FDDA 3R2CJ 2VBXA 2VC1A 1ACMB 1NUEA 2DR5A 4CNYA 2B56A 2BACA 3T1YF 3SQOP 2BKNA 3MECA 2DNLA 2OD6A 3CIMA 4DQSA 1FRHA 1SPBP 4DL3A 5EWGA 4H4OA 2G0IA 4WFBQ 4XDCA 2B43A 2IVMA 1KC8T 2V2QA 3GSIA 3MHYA 4LQ9A 3G71S 4DOZA 2FVRA 2VUGA 2OJ3A 2YNFA 5H1SV 5THWA 4LT6A 3R7SB 1JNRB 4WCEQ 1U1NA 4LFCJ 6FDRA 3H0PA 4U7UK 1QSSA 2V2VA 3PFEA 3D3BJ 4I67A 4P6QA 3IN5A 2Q43A 2RNEA 1X4GA 3UWTA 3QJLA 4DUZJ 2RS2A 4IFVB 1URNA 2QSWA 3RYLA 1XNQJ 1IKXA 2DK2A 4A8FA 3FZBA 3TJ9A 3IBCB 1KBRA 5ETQA 1UJ6A 2ALYB 4JI8J 4QWAA 3OSPA 3O44A 2CFXA 1GX6A 1RK8A 1TL7B 3PKYA 3RAXA 4CYUB 3IS9B 3EXCX 9ATCB 3P49B 3P5TL 1RBOB 2DYAA 2E1MC 2GJFA 4TYBA 3CJ0A 3EGVA 3JB9k 3CSKA 3Q86A 4IG3A 1NZ8A 1U1KA 2CQ3A 2P8IA 3C6UB 3DU5A 2IY5B 2VG5B 2OFGX 2NPFA 1T0TV 3J7YU 4FXDA 4X4SA 3FUYA 4PQUA 2GVZB 4DV1J 3HHLA 1KS2A 5HMYA 4ZPDA 3W9HA 5F0WA 4Z7YA 3WHIA 3NGSA 4ED3A 2MLXA 5F8JA 4LBIA 3DXBA 3OSNA 5KG2A 2DR8A 4M5KA 1T03A 2RILA 4K5SA 3J81U 4F4WA 2GV1A 3TZXA 3OR1B 1R0AB 2KN4A 2XMTA 1U6BA 3NP5A 2ILZA 4CRJA 4DXLA 4YHHF 4QR1A 3A8IA 2CG8A 1HARA 3MEEB 2C2KB 3QRPA 1TL3B 4IQMA 4TU9A 1T9XA 2IM2A 3QSIA 2YKNB 4IRCA 5L1KA 1DY3A 2UUAF 3BKTA 1G7CB 3OUYB 4FVCA 3VHQA 4JUZA 4PG7A 5HROB 1HR0J 1RT4A 4OMFG 3SCJE 1PO6A 2VQEF 1ZZNA 1VQ5S 1GEHA 1FF2A 2XGQA 4EK2A 1T05A 1WELA 4YFUA 3HSDA 4DR7J 1OY8A 3TX0A 2YNGA 2C42A 3G6XA 4JI3J 4L6V3 4RUCA 5KG0A 1U2FA 1S6UA 5DQIA 4DSJA 2L9WA 3O5TB 3KUHA 3DLGB 4Y28C 1WDDA 3IG1B 3R5CA 3HVTB 2NR0A 2G0CA 1Q8IA 5LXRA 5J1NA 3C8YA 1FHTA 4WE1A 1UVMA 2JWNA 2YX1A 2ZBIA 1H38A 1V9OA 3AOBA 4DU8A 3DN9A 1VIOA 2AYEA 4OX7A 4ZMMA 4QW9A 2L08A 2H9ZA 1CS4B 1LWCB 5KFXA 2CDQA 3T41A 5IT9U 2CQCA 3V81B 1F2HA 5CD4H 2HBYB 1SC3B 1IBLF 1JLEB 2QN6B 4KRWA 1XC9A 1NKCA 2ZBRA 2RE1A 4IO9Q 3H40A 1SB6A 2QMXA 4FNIA 4X4OA 1QVFR 2XMUA 3GPAA 1IKWA 5KFZA 3NGRA 3LGMA 2JHEA 4FPRA 3DOLB 2P6SA 5DRKA 4QW8A 3NCPA 2EBGA 4ZCKA 4O3NA 2JZ5A 3THVA 2OGUA 3LW5C 1N5SA 4JBCA 1F3VA 1G4CA 4DQIA 3NGKA 2JFKA 2R7VA 2DBBA 5ITHA 3V4MA 4A8YA 4AQYF 1NK8A 4FP9A 1KFDA 3M2UA 4NZ6A 3QIPA 1MU2A 2EWHA 3MMCA 2HBRB 3HHLC 3A1YG 3DU6A 3MEDA 2W7PA 3M8QB 2Z8QA 1MN7A 4C97A 5KFYA 4RUBA 4OLPA 1V3RA 4DJBA 1HNXJ 3IMQJ 3X1LB 2DNNA 3C2PA 1ITPA 3T3FA 1NKEA 1DTQB 2NXJA 1FX4A 3KHGA 1JKHA 2W2PP 1A9NB 1RUSA 2RSQA 2GO9A 3VQTA 3B6BA 4K2JA 4CO3A 3TJ8A 4U6PA 1UVLA 3MECB 2QYCA 3TYTA 1VQMS 2MZQA 4ED6A 3IWLA 1TK0A 4AE5A 3FCVA 4H4OB 4LF1A 4ZVSB 1VBXA 3PY8A 3PFOA 1HNZJ 2HNDA 3KLVA 4OHVA 3WQPA 4J9UE 2R4FA 3I9ZA 4E98A 4DN9A 1UL3A 3D3CJ 2YNFB 3TANA 5LMUF 2BE7D 2IYIA 1C4CA 2AWZA 4ICLA 2JSXA 2FJEB 1F9EB 1N32F 1Y5IB 1UFWA 3W61A 2DR9A 2ZBCA 4URQU 3ET6A 3D6MB 3PXGa 3K59A 1IKXB 1W26A 1U8SA 5KG4A 5DDOC 1WKLA 1ICEB 2UZAA 3ADAC 3RBZA 4D3GA 3K57A 1T8EA 3GB0A 3M1VA 2Z4PA 4V19J 1N36J 4M95A 2DY9A 4ECXA 2YWKA 3J80U 5GAEU 1FKPA 3R7NB 4J9NA 1YSJA 4NEYA 3L95X 4I7FB 4IG3B 4ID5A 4MFBB 2M70A 5HO4A 1D9AA 3EJMA 2D41A 3PW5A 1SIWB 1R43A 1NPPA 1RE1B 3BV8A 4LR7A 5FDLA 1GMVA 4JV5J 4EBCA 3MM9A 4ZCLA 2D69A 1R6YA 4CO5A 2MQQA 1H3DA 4UOFA 1LEOA 1J5OA 3VV2B 2HLUA 1T9WA 4DV5F 5IC6B 1JLCA 4J9KA 2DNOA 3H4BA 2FLLA 4C0HA 2E5JA 4J9PA 4ID8A 2PMWA 4YS2A 5GAHI 3THPA 4KR0B 5F9NA 4X84A 4C4WA 1B70B 4LVOP 2UP1A 5AXMA 4OZ5A 2P9GA 1PIEA 4U9RA 1VC5A 1CJTA 4LF7J 2F8MA 4F3MA 2Q79A 3KUGA 3R5BA 1MG7A 3GG0A 4F4ZA 2CKWA 3O6QA 1B0PA 2BYCA 3H98A 5A2QY 1M1KT 3ZZRA 2HGMA 3SQGA 4DBQA 1EAYC 4NCBA 5HANA 5D4NA 5JVGQ 2OFHX 5ETSA 1RT4B 4CLPA 3BH7B 3K5LA 1XR6A 3RU0A 3FSYA 5I42A 4DU7A 3I0SA 2M52A 4CLFA 1T05B 5L8RC 1WOOA 2WVBA 1UVIA 5DZ7A 2HIYA 2BABA 1U45A 1OQ3A 1X9WA 1MMNA 1XR7A 2YNGB 2JNJA 4A8WA 3OJSA 4X4TA 3OFEA 2HG4A 3GONA 2MGZA 4OI2A 3RB3A 2E66A 2DGOA 5GMEA 3BGFA 2Z57B 3BZQA 4WE1B 4ZVRB 3QBCA 3MPVA 4UOHA 4NLXA 3DOMA 5LSRA 3MCOA 3PJXA 4HL9A 4MH8A 1RAEB 2GIFA 7FD1A 1JLFA 2KVIA 3K7RA 1YLXA 1I94J 3HJFA 3PJ9A 2XCAA 2ZHOA 1HBUA 2ZDOA 3G2XA 1H6KX 2XEXA 1VCTA 4CT8A 1LWFA 3W7BA 5AJ3F 1HBOA 2W4PA 1RT5A 3R5AA 2K2PA 1IKWB 1UZHA 4MMOA 4Q7AA 1FRMA 2QMUB 4ED0A 4B3RJ 2DHHA 1NCLA 2G9OA 2F7VA 4NLOA 1SXLA 2YQ3A 2YH0A 3K0JA 4FPIA 4Y00A 1XNQF 3GMGA 2DNZA 2V8VA 2IM3A 2QV6A 2Y1IA 2YPYA 1V5IB 4F02A 2CQBA 3V4IA 4JI8F 3WX8A 1FJEB 3M2UB 2V0NA 3BBCA 3QIPB 4NX9A 1MU2B 4DG1A 3MMCB 2XHCA 1GK8A 2BA9A 1L3TA 2UUBJ 2XMMA 2BQUA 3OXFA 2VDIA 2BEFA 4DZ6A 3QWPA 2FJDB 3G6ES 3MEDB 2AGOA 3KJNB 1FJGJ 3IBWA 2AJ0A 1FRJA 4USIA 4JV1A 1UW4A 3CCQS 2XS5A 2KRRA 3CJ2A 1VGYA 2MKKA 3QNWB 1ELOA 3BN4A 4ZVOB 1H2VZ 5SUHA 4NLTA 5HJYA 4ETXA 4Q0BA 3OXGA 2X51A 1SQFA 1HWKA 2AJ2A 2WB1D 1RWVB 4KY3A 1JKHB 2JH3A 2ZVIA 3BBFA 4DV1F 4O3QA 1I3OB 1UJ5A 4B3SF 4K4TA 4ECSA 3T1HJ 3MEKA 3UDCA 2AJQA 1VR6A 1RGVA 3N6NA 3NXZA 2ZHAA 3AQPA 3MAAA 3FBBA 4RKUC 3H5YA 2P9CA 5F41A 2QLWA 4M5LA 2DH9A 5L46A 4OHXA 3DHXA 2G13A 4FDFA 3MAQA 4O3OA 2LQ5A 4DZDA 5LMNF 2N7CA 4CTAA 2HNDB 5EGYA 3MUVP 4CQ1A 1LXJA 1M0SA 2FY1A 4XIUA 2FHJA 1ULRA 1NB2A 2AJ1A 2LDIA 3BPSP 4EUVA 2HWTA 2ZE2A 3FQLA 1HHQA 4C6AA 3DRPA 4J9VA 4XAKA 4WFYA 4ICLB 1IKYA 2W4CA 1S1VA 3ITHB 5T14A 4DF4A 4LF9J 3A8EA 1TMMA 3RUBL 1HR0F 4YY3F 3BO4A 5KT3A 2G1HA 3ET6B 3EWGA 5A6WA 1OS5A 1B7YB 3CJ8A 1NDKA 2M88A 2E5HA 4ECZA 1L3KA 4F0MA 4LFAF 4ILRA 3MM8A 4O3SA 4DR7F 5D8HB 1W7WA 2NZ4A 2J9DA 1I6JA 4LRFA 5KG7A 2LA4A 4KC5A 4CP5A 3M1VB 4JI3F 1KRPA 1F2GA 1H7WA 2WBRA 4Y2AA 4KHPJ 1OSDA 1KTVA 2Q6BA 3NAIA 5J2PA 2MKIA 1REVA 1FKPB 5D0EA 2W2MP 2V8GA 4ID5B 5F8MA 1V5VA 4DL6A 3CDAA 3S7RA 2A6OA 4OX9F 2FLPA 3GR0A 2KJVA 2MJNA 3DFEA 1QUPA 3CPWR 5FDLB 4Q8FA 4WYWA 2DGQA 2PMZD 3MM9B 5BXIA 1N0UA 5C2GA 2NXUA 2KT2A 2JJ4D 2JVOA 1S0NA 1VRTA 3HHEA 1J5OB 3SSQA 1RLCL 1JLCB 2OMLA 2Y0BB 4J90A 1HMVA 4J5OA 3D66A 1U1MA 2ALZA 4RW8A 1ZAWA 3SFUA 4DV3F 3IM9A 2DJWA 5JUMA 4TNOA 2ZVSA 1U7LA 1WUUA 2F4FA 4CDIA 4F2RA 2ZDPA 2HS0A 3UDVA 2DB1A 1CJTB 1RLDA 2DR7A 2DTJA 2VA3A 4I56A 4LRBA 4CT9A 2AIRB 3IXQA 3LGHA 3IP0A 4DV0J 2VFRA 1S0OA 3EPGA 2AJFE 3TAPA 1VQ7S 1IJEB 5LSLA 3SQGB 1HBNA 1UEKA 1EB0A 1LFPA 2BANA 1TL5A 3RGIA 2G4BA 2UUCJ 5E33A 2V69A 5I42B 5IV3A 3MPWA 3I0SB 2I38A 2XY6A 1HIYA 1HNXF 3KMSA 4UW2A 3BGRA 2C22A 2NUHA 3D4JA 1YJRA 3PR4A 3EDRB 1WACA 1PILA 3DHWC 3OL9A 1JLBA 2OPPA 3IC1A 4E2FB 3OT9A 2QLXA 3VAHA 2MGZB 1RT2B 3VGVA 1C0TA 4P2MA 4N41A 2FVCA 1PAUB 5CHCB 1X5TA 4TYAA 1NJIT 2DPIA 3GIMA 2R8IA 1SI9A 3QLHA 1H2UX 1S49A 2HFUA 3DOMB 3FMBA 2OAUA 4M8LA 5I3UA 1P6TA 2GHPA 2X7IA 1HNZF 3CCES 3PYFA 3BGOP 3D67A 1JLFB 1DFDA 2B4UA 2V4RA 1HL6A 4YR3A 3MUTP 3KK3A 2ZH5A 1HBUB 2AMCB 3CMQA 3EICA 2PSZA 2E5LJ 2EBEA 1LWFB 2KFNA 3BGLA 2HQDA 1HBOB 1XMOJ 2R7UA 4JI4F 3FGVA 3CD6S 1F5CA 4FZVA 4KFBA 3E2EA 2B9YA 3W63A 1XERA 1RTDA 2P6TA 1JIHA 1FRIA 4NZ0A 2X1AA 1S1XA 2AV5A 1U09A 3CD5A 3GFHA 5GAGU 3V4IB 1DLOA 2OEMA 2VQFF 4W90B 1NSKL 4ZHRB 4DG1B 2OPQA 3PO4A 3N4WA 3K2YA 4K5RA 5EWFA 4X64J 1W2IA 1TUVA 2AX0A 1GQEA 3MI7X 1HYSA 4CH1A 2JC0A 2AEFA 3QJJA 1NEEA 4UY85 1UWBA 3RRHA 3KJVA 3QGIA 1M5VC 1FTCA 4ENOA 1REGX 1Y5LB 3R5DA 4N76A 4EWTA 4JV5F 1X4CA 5G4DA 4DI6A 4B9NA 5CYJA 4P7VA 3KLEA 4A8OA 5F8IA 4YMEA 1RAOA 5A76A 2FGCA 1YJ7A 3MAAB 2FHMA 1RKJA 3L7PA 4MJKA 3US5A 1Q7YT 5ETPA 1WEXA 4CTAB 4FF1A 2HK2A 4PCQA 4KQZA 4NYOA 4LF7F 4F0HA 1QTNB 4J91A 4KB7A 2P2CB 2E9ZA 3ZTRA 2ZE2B 3QGHA 3DRPB 3G87A 2V8PA 3TAMA 2MXYA 2PFDA 3D68A 1IKYB 1PG5B 2DIVA 4BWJA 1S1VB 1HD0A 1RB0A 2M5YA 3ZZOA 4O23A 1OO0B 2VG7A 4QPXA 3G8TA 2F3JA 3CO9A 2Y3YA 3I0RA 3W3SA 1CBKA 1HW9A 3F44A 3LP2B 2CJKA 5BYQA 3VQSA 5KT4A 3QRQA 3HT3A 4LJMA 3MM8B 3FKBA 3H4DA 2CWKA 3OD2A 1HQ2A 3CJRA 1FXLA 1C0UA 2F40A 5KFLA 4LF6J 1APSA 3HVAA 2I1RA 4WZMA 2RU9A 1REVB 5J2PB 1VBKA 4RW4A 3NNHA 1ZA1B 2E7WA 1TQLA 2RUSA 1NJWA 1WC1A 3MM5A 3MCNA 3KHRA 4PXDA 1NDLA 4EFAC 2L48A 3DRXA 2EFPA 2NSCA 2FVSA 4JI1J 2OD4A 4WKYA 3R2DJ 4ZKAA 1N5YA 3N01A 3MM6A 5ETRA 1I94F 3WZ0A 1VRTB 4OYWA 2QX0A 3CCLS 2CJXB 3GFZA 3H5UA 3W9IA 1HMVB 2CNKB 3IGVA 4RW8B 3KTQA 4WFNQ 2PDAA 4CO4A 1P1LA 3BREA 4UZBA 1NHKL 1KQKA 1EJ7L 4ES2A 1HW8A 4B3RF 3FQKA 3U1LA 1NMEB 2B0GA 3MD1A 3R6GB 1QAJA 2HGLA 1WC0A 2XI3A 4FYXB 4QIFA 4GO7X 3POTA 1HWLA 2OMOA 3LWMA 5J2MA 4BBYA 3NBPA 1HBNB 4A8KA 1RT3A 1RI7A 3UFCX 2LEAA 3D28A 2Z0GA 1KFSA 2BANB 3TAQA 2N3LA 1FJGF 4WFZA 4LFBJ 1XTZA 1YI2S 2ERRA 4AUKA 2Q66A 1OSCA 1ZZFA 3UNGC 1FVSA 3OTBA 5A8RA 4L76A 3BGRB 3GQCA 3TQEA 3MFIA 2OEKA 1VHFA 1TAUA 2RD5C 3R8YA 1JLBB 4M5MA 2OPPB 1EIYB 3H5SA 2XMJA 3TA1A 4LF2A 3CD0A 2ZH3A 1C0TB 1TKZA 3T1HF 1TK8A 2VBWA 1Y3JA 5L1IA 1WC6A 1FNOA 3ILIA 2DVIA 1Y4ZB 1FNMA 4HVZA 2R3VA 3G8SA 3QLHB 3MR2A 3UDEA 3J7ZT 4LRAA 2H65B 2KB2A 3WIUA 3Q23A 1FX2A 1S57A 5I3UB 3H5XA 4B3TJ 3VALA 1RT6A 3CO0P 5CCLA 2XHWA 3P4UB 4IR1A 1RBLA 3EGWB 2RJZA 2CVEA 3I4HX 2MZSA 2R7QA 3KK3B 2DGTA 3MR3A 2VIHA 1R8BA 2YQ1A 3HDSA 2DNGA 4OV6A 1PKUA 2V68A 2AW0A 2B8PA 2BV3A 1IR2A 3EVMA 4LF9F 2VG6A 1F0XA 4WXOA 1RWMB 1UVJA 4V19X 4F0KA 4NLYA 1N54B 1Q8BA 1RTDB 1WOPA 5K20B 4YP3A 5D6GA 1S1XB 4BHQA 2CADA 3PRDA 4F04B 1NBEB 1DLOB 2GMLA 3Q8VA 2XYPB 2KG0A 3KHLA 2DXEA 2OPQB 2MKCA 1LKZA 3Q8UA 2FJWA 3DLKA 4L75A 2OPRA 4KHPF 3CJSA 1S1TA 1HYSB 1UEVA 2CPYA 4NYPA 2QEXS 5RUBA 2QA1A 2HFVA 1UWBB 4I68A 3MCSA 4LSNA 3LP0A 1UA0A 1RWOB 3BH6B 3KJVB 3KLHA 3ZTSA 3AA8A 2FLNA 2M9KA 1WC4A 4I6AA 4ZPTR 4WZQA 2J9CA 2RHQB 3UN3A 1LXNA 3MD3A 5E41A 3BM7A 4ECUA 2HQGA 4N8OA 4IRKA 1CJVA 4P52A 3KLEB 4C8KA 4OYBA 3VCDA 4DV2J 2GAGC 4F8RA 2C2OB 3TO8A 2BX6A 1TZ0A 2DRDA 3TZZA 4IRDA 3R5GA 1KD1T 3ILOA 5MAOA 4KGMA 4R25A 5IM0A 5CABA 4LSLA 2V9WA 2HQIA 2YWGA 1C1CA 1VQKS 2D9PA 3S8SA 3GWCA 5SZTA 1KQSR 3LUYA 3PYEA 4H4MB 3T1YJ 3AOCA 1VISA 4YUDA 1RWXB 1PYTA 2CUYA 4DV0F 2GQCA 2CQ2A 4JOUA 2AX1A 3TAMB 4EO6A 2AYMA 5KT7A 3NOGA 1Y3KA 4EYIB 2LXIA 3CJTA 1WJ9A 1OY9A 3AA9A 3RAQA 2GAHC 2VG7B 1WG1A 4OHWA 4OYZA 2E9TA 1V3SA 1BXNA 1K1QA 1RHJB 2B9WA 5IWAJ 3C19A 3M8ZA 3I0RB 2UUCF 1F1BB 1X4EA 1AXQA 4Q45A 5FLXU 3BSCA 3M6UA 2YX4A 1D09B 3OL7A 1EQ0A 1C0UB 3JQMA 4ZK7M 4NXMF 3IA0A 1NH7A 1DAXA 3NS6A 7FDRA 3N79A 2QFJA 4RW4B 1YBAA 3TP2A 2O67A 5BR8J 4JI6J 3MM5B 2VFSA 2J7KA 1TKXA 3W65A 2OEJA 2LA6A 4DUYF 1CC8A 4DLEA 1VS3A 4U67Q 1EQMA 4FYVB 1TUGB 1LFWA 4B08A 6AT1B 1N5YB 3MM6B 3T5JA 3GJRB 5IT4A 3SFGA 2M3DA 1UTAA 4GRSA 2AEMA 2V4QA 1LK7A 2HRUA 1S10A 2E5LF 4KPCA 3MEGA 1XMOF 4PUOB 3DRRA 1H7XA 2BRLA 2CXEA 2Z2ZA 4MKAA 4C0OC 1D8YA 3LOUA 3CGIA 2J0WA 2D74B 1ZOTA 2ROGA 1NK4A 2KT3A 4HDHA 4ZLNA 1YJWS 3SDEA 2WTFA 5DZ6A 1FDNA 2EK6A 2XLIA 3DM2A 1LW0A 3POTB 2QMWA 2YWEA 5J2MB 3DYAA 3NBPB 1HHTP 1PJ7A 1RT3B 1I1GA 1WC5A 3D1HA 3ZTOA 2LQJA 5D4LA 4YHHJ 2IPOB 4FF2A 3GZ7A 4O0NA 4Q8EA 4TVAB 3SMZA 2QG9B 2J9DE 4M5JA 4P2XA 2FC8A 2HVIA 3Q24A 5A8RB 3RW6A 5DGAA 4X2BA 3RJMB 4TN2A 1JNZB 3VGUA 2VJVA 3MPYA 1NO8A 4O4RA 4N7TA 4N47A 2MTLA 5L1LA 2AF6A 1TKZB 3VTIA 1YJTA 4CLZA 2ASDA 3SBMA 1BY9A 3HM9A 2Z30B 2XB2D 4NLGA 1SQGA 2R8HA 1S5ZA 2L9NA 5B0BA 4KKOA 2MYFA 4HHHA 4U8YA 4NZ7A 3BSNA 2W25A 1RT6B 4UF4A 3OVAA 1CQMA 2W7AA 3AJ2A 2DXDA 2JRSA 5D15A 2DGSA 2MKSA 1NB7A 3PACA 2BQRA 3V6DA 2UVRA 2FPHX 1U6ZA 4DV6F 1JLGA 1JXEA 2V5HG 5LSOA 1U1LA 3FEXB 5KFGA 3OFGA 5CCMA 4C98A 4EYHB 2JEIA 4DQQA 1VK8A 3UN2A 4JI0J 5F8LA 2VG6B 2HNZA 3Q8PB 3N5BA 2BRKA 1IQTA 2X1GA 3FNNA 1RU1A 1M5OC 3CMAS 5J1EA 1MLAA 2ZC3A 3UN5A 1VQLS 2CQDA 2RVJA 2L41A 1OPIA 3CCJS 1E6YA 2ROEA 2ZITA 3DLKB 3CD7A 3Q8SB 2HQCA 4LF6F 1GX5A 2OPRB 2IYGA 4E8UA 1TV6A 1S1TB 3CCUS 4F2SA 1A0OB 4XPEA 3T5HA 3JQKA 3LALA 1UP1A 4LSNB 3LP0B 3GSDA 4YDXA 3KLHB 2WSCC 2GMJA 3AD9C 3P5BP 1S0MA 1WKKA 2Y9HA 1FD8A 1IXKA 4JI7J 1TL7A 4A8MP 3GFXA 4QR0A 2FDNA 3IS9A 3KK1A 4JI1F 3C16A 1CJVB 4CH7A 1M1GA 2C3YA 2K1RA 2HVZA 3A3OB 3UCGA 2UXDJ 1UVKA 4NRTA 2ZH6A 3UNYA 3VF0B 3SEOA 3NY0A 3HX9A 5D0GA 1X60A 5IM0B 4K8RA 2APOA 2IJRA 3HXMA 2HQ3A 4KYZA 2LXFA 5F3ZA 3P6YC 4B17A 3T5LA 1C1CB 3DGPA 2B5JA 2HVEA 4ZA1A 4DR6J 4I6WA 2HGNA 1GXTA 2A18A 3D1QA 1DTTA 2BJDA 1T3NA 1U24A 3HD1A 1FJCA 5D4OA 2LEPA 2YBVA 4OJHA 3ZO7A 2C1EB 2E7VA 3AD8C 4Q2MA 2W8LA 3J81j 1GH8A 8RUCA 4NLVA 1SQEA 2KZMA 2FJAB 4RW6A 2ZNYA 4USJC 3R5JB 3M7VA 4MK7A 5B0FA 1NHUA 4LFBF 2MQ8A 2IC3A 4TKTA 4RZRA 1GXLA 4MTPA 2YKNA 3NKYA 1VC0A 2HSEB 2J5AA 1S1WA 2CRLA 1O5JA 3PJWA 3QATA 5LOQA 3GJSB 2PN6A 1Q5YA 1WC3A 4YDDB 3M32B 1FE0A 2KRBA 1KN6A 1S6OA 4QOTA 2V67A 4J9RA 5KFWA 3KWMA 2LQBA 1NPRA 2JEFA 1J2VA 1YTYA 4DUTA 2VBYA 4WPAA 4F67A 2GW8A 3I9V9 2GQQA 5DM7Q 5IOLA 2WSEC 2W7OA 2FD2A 3EDQB 4EU0A 4U8VA 3CJKA 3KK2A 3E01A 2AU0A 2DNHA 2QLBB 5ETNA 3VAMA 1WF0A 2QA4S 1U25A 2MY7A 4FBTA 3CF5Q 1RSCA 1FJ7A 3W2WA 2EG1A 2N4CA 4N5SA 4FYDA 4AL5A 1T94A 3K5PA 2RQCA 4EGLA 4C0BA 2DEJA 5ETLA 2YWFA 1Y9OA 4ZJLA 2MB0B 2EFVA 3MEGB 4K59A 3LANA 1RTZA 4ELTA 3DRRB 2B51A 2MZJA 1R8HA 4CLYA 2ZH7A 4L3NA 4X4VA 4O3PA 2G2OA 4B9UA 4OIXA 4IH6A 1VK3A 4WBFA 4QYRA 4DV5J 5HN0A 1X4BA 1J5EF 4R5PA 3OFHA 5DG8A 1N88A 3SDEB 3M9OB 5HQ8A 3NMAA 4CLLA 4GC7A 4LF5F 5D3GB 3DM2B 1GXUA 1LW0B 3I5BA 2FZGB 3DYAB 1FD2A 3EX7B 3KG1A 1N33J 3RB4A 4WP8A 1BMQB 2IIHA 3D6TB 5CXTA 1K0VA 3VR1A 4KH0B 2M7SA 5IC4B 2ADBA 1JLAA 1WI8A 1VQSA 2BW7A 1NHVA 3RBDA 3S6EA 1JB0C 5KG3A 2QT7A 2B7BB 1Q16B 2QA2A 4Y34A 2E1RA 3HK2A 1FFGB 1WD6A 2C2NA 2DGUA 4DX7A 1FRLA 2CZ4A 3G4SS 2ZH8A 3ISND 3MGJA 2XBPA 2XMWA 4EO8A 2H54B 1M5KC 2R7TA 5L1JA 2KM8C 4TXSA 2NYIA 1JJHA 3JS9A 4JB8B 2GIRA 2FUG9 3FZ2A 1IM4A 3KFWX 4DV2F 1R0CB 3IR5B 3MMBA 1URRA 3CJ3A 2K7KA 2VPXB 5E0OA 3QFHA 1XEZA 2DO4A 3HO1A 4KKOB 3Q83A 3MZIA 3GJTB 2B9XA 3M30A 3GCXP 2E44A 3L7OA 3V6JA 2IRUA 1ZM4A 2A3JA 1T9VA 2CNLB 4DF8A 1SVDA 3V6DB 2PI4A 5F9LA 1QVGR 2HZCA 4QWEA 3P3DA 2XWXA 1JLGB 3IR7B 4M5HA 3BQ1A 3VAGA 2B3TB 3TUZC 3FDSA 4A48A 1U1RA 1EKRA 2JLEA 3C15A 2MKYA 2HNZB 4XO0A 4FF3A 2HLTA 3N5FA 4UTGA 2JEGA 5IWAF 2FHOB 2HWIA 3TARA 5DETA 1SJ1A 2ZBPA 3A4TA 4A4JA 5KFAA 2NSBA 3DLHA 5J1EB 2QYGA 2ZC4A 1Z2ZA 5AJ3J 2M8DB 2D3O1 3K8WA 2XMKA 4G6VB 4YB6A 3TVKA 4LF4J 4F25A 1E6YB 1LQ9A 2DEIA 2HBQB 1YWXA 4H4KC 3KDOA 3QGPA 3ETOA 1TFWA 3CJ4A 1NK0A 1H2TZ 3H8YA 3K5MA 1TV6B 4F26A 4ZCIA 2KJWA 3K5OA 1UAWA 2A1BA 1D8ZA 2EFNA 1T02A 5KFDA 2LLZA 1U26A 4WTYA 5BR8F 4JI6F 3MM7B 2LCWA 3FK4A 3EE3A 1VC6A 3HFVA 1AROP 4HI2A 3MMAA 4USVA 4LBHA 1YJUA 4DHVA 3KK1B 1R8PA 5KFRA 3WX4A 3EXYA 3C16B 2J6UA 3VWSA 5IV4A 2K1RB 4Y65A 4C3KA 4NLPA 1MMLA 4OHZA 3HHLD 4TY9A 2WZ1A 4XDDA 1K8AT 3ETMA 3CWJA 4F4XA 4I7FA 2NZCA 4MFBA 5I4MA 4NMXA 2AGQA 5A8WA 3MAHA 3HSZA 2KT5A 3C3LA 1P9QC 4E0DA 2NREA 1TKTA 2HHQA 4WIQA 3MDFA 3OXLA 1X9SA 2WHOA 1U2RA 4RWXA 5EDWA 3DGPB 4B3SJ 4QWBA 2B5JB 4TLRA 2KM8B 5B0EA 2YY3A 1RT1A 1DTTB 4XK8C 1X9MA 3QRRA 2CPDA 3QT6A 2IVYA 2B6AA 1YBUA 2A0FB 1J27A 1HHSA 2IHR1 4B9LA 5AE3A 2ASYA 3BYRA 4M1KA 3T5KA 3W5ZA 3AAWB 2XG8A 5LMNJ 4WFXA 4RW6B 4A47A 1WDTA 1KTQA 2EFGA 4RW7A 5I3QA 1HQUA 4HTIA 1Y11A 1U6FA 4KBIA 1FWPA 2IC3B 3MOZA 1N48A 1Q95G 1S97A 1S99A 1VJWA 2R2RA 3OQ2A 2HBZB 4FYWB 3CMES 4L3KA 1N6QA 1S1WB 2CQ4A 4QWDA 1QAIA 1JJ4A 1AFIA 3NS5A 8AT1B 3TRGA 4BC9A 3PZPA 2ZH9A 3AFGA 4NLQA 1FCAA 3QGGA 4TLQA 1AT1B 4Y0FA 2HHVA 4MIBA 4YY3J 2EFQA 5AXLA 3OFFA 4DR1J 4QYZJ 1ZAVA 4A46A 1RBAA 4A8XA 2DCUB 4DSIA 3IWXA 4PWWA 2HRTA 2ZWPA 3NS7B 5GADI 1Q0NA 4WK1A 3CCZA 4LFAJ 2ZOMA 1RHKB 3BO3A 4DL4A 3CJKB 3KK2B 3E01B 2HPUA 3OVBA 3PX4A 2DISA 3HMJG 4QQBA 2R7XA 1U1PA 2V2ZA 2MQNA 1NNDA 3QMQA 3W2WB 3OL8A 3OL6A 1YRUA 2IJNA 3I4PA 2DXFA 3DKDA 4WP9A 3LWLA 3ENVA 3I5CA 2IFXA 2XY7A 3R6LB 1C1BA 3UD4P 4IYQA 4OX9J 1BWVA 4CLWA 3A3NB 4CLSA 2GNKA 2MQLA 4JI0F 3F73A 3FCWA 4C11A 3ELHA 5B0AA 5J2NA 2DGXA 4PXBA 1S9FA 4OJ3A 3IAS9 3BDPA 1U0HA 2MLZA 2RB7A 4UQGA 1W25A 4P10A 3HLUA 4KHMA 3U1MA 4R5PB 5B08A 3GV7B 5KFFA 3GYNA 1IKVA 2ZOGA 2QRRA 2VD3A 4DV3J 3HFKA 1KWMA 2Y0SD 1NAQA 4ZVEA 1OIAA 4OYXA 1GT8A 3HVRA 1RAIB 3H20A 2AD9A 4ANEA 1SC6A 1JLAB 3FJ2A 3GILA 4NI2A 3G86A 3HP6A 5B7WA 2LP4A 1K73T 6FD1A 1RKIA 2CPJA 3PO5A 2ILYA 5IXUA 3JAMY 1MWQA 1IVZA 4JI7F 1QUVA 4YN3B 3J7AN 2VKZG 4EBDA 1MWZA 1IN0A 4RNMA 1UKUA 3IO1A 4QJVA 2WVDA 3I82A 3THTA 1NSAA 2YX7A 4RJVA 2AKWB 2E9RX 5KFNA 4LR9A 5B0DA 2BM0A 3MMBB 2MQPA 4LVNP 1HA1A 2UXDF 4DFKA 3CULA 4KGZB 1TP7A 1YBTA 1UETA 4KJIA 4IR9A 4BLGA 3PKMA 4NPOA 3OV7A 4RU9A 2BR0A 1KVKA 3PG9A 2FJBB 3M30B 4KH1B 4DR6F 2H3EB 4P7TA 1RWNB 1FFSB 1NJYA 4YOEA 5K8OA 5KG5A 3PDNA 4W4MA 4PPZA 5K8PA 5IFMA 4G3IA 3EVWA 5ETMA 1HWUA 2HYIB 4UUXA 2MHEA 5DDRC 2LECA 1D0EA 2QL9B 4ZP7A 4ZP9A 4OI1A 3C15B 1R8CA 3OR2A 1Y00A 4XPCA 1DQAA 2HVDA 2HS4A 3ZFVA 3ZNJ1 3RB0A 3NCQA 3MXHP 3OTCA 3PNIA 2FC9A 3HULA 2B8QA 4USMA 2WVCA 3OHBA 1AFJA 1FERA 5CZVA 2KZZA 4JI4J 2RRBA 3ITHA 1SH3A 1YIJS 2FJXA 3H59A 4C8LA 2KHCA 4MKYA 3OTDA 1N5TA 2BKPA 3NNAA 3AQOA 2RIJA 1D1UA 1FTRA 1Q82T 3CEDA 3H42A 1PYSB 1RAGB 2CNOB 3SV4A 5KOWA 1CULA 2EK1A 2LEBA 5F8HA 1WHVA 1UEUA 2HQFA 5LXYA 3FEYB 4ZN3A 2VQFJ 3ZZPA 2CQGA 1PJ5A 3FBCA 3I55S 3MMAB 3KG0A 4RNHA 1N4LA 5EN1A 4KHRA 1EHWA 3HCXA 5K8MA 2XZWA 3I96A 4FF4A 3OBIA 4DPWA 3PR5B 1SH0A 4F7VA 4X4NA 1AZSA 2ZFHA 2ZM6J 5A8WB 4EMDA 3BR8A 3PEJA 3I31A 2PI5A 2XYGB 5A0YA 2LVWA 1VDHA 4YR0A 4RO0A 4FKXA 1SV5A 4YB1P 1IR1A 1RJJA 4TY8B 1TKTB 3UD3P 1HI0P 1S6PA 1QSLA 1S0VA 2AYGA 4KGVB 3G9CA 3TOQA 2JC1A 3PHTA 3P45B 3BKFA 1H74A 5GAHU 3ENAA 3RAMA 1RT1B 3VVTA 3BF4A 3CDUA 3VAFA 4ZVTB 4ZVFA 3TR5A 1TR0A 3F0NA 4ILMA 5DLFA 3JYTA 2E5GA 3ZZYA 2B6AB 3NGTA 3FFIA 5LL6d 1N33F 2IRXA 1KLNA 3ZTPA 2H48B 3QFWA 3TX8A 4RW7B 3BN7A 3T19A 4ZLPA 1HQUB 3HJVA 5K5MA 4ES3A 1OWXA 1UFKA 4JV2A 1N6QB 3NAHA 1LW2A 1TAQA 1KEKA 1XR5A 4OZ0A 2FVQA 4PWDA 1TELA 1DQ8A 1D9FA 1X5SA 2PGCA 2KH9A 2XTJP 3W1YC 4NXNJ 2NS1B 3SYZA 3H90A 1SJQA 1Q81T 1RA6A 4TQRA 2DPJA 1XN9A 4L73A 4U95A 4OYMA 3CDWA 1NK6A 1R7IA 1RT2A 1YQHA 2DNYA 4DV7F 2XQCA 2VA2A 4DFMA 2CZ9A 4PYAA 1EKSA 5ETTA 1SH2A 2CPIA 2DRBA 2HHUA 4HH1A 1C1BB 4PWUA 2EC0A 3BR9A 2G0JA 5HMXA 3PYDA 1ZH5A 3G8QA 2KHDA 1P1TA 2HVHA 2GGPB 2FJVA 2PC6A 2GIQA 2UUWA 1RCOB 4C11B 2UVVA 2J76E 5J2NB 1NM2A 2K06A 5MLCV 3AB4B 1U0HB 3C14B 4U96A 1FVQA 2KTQA 3O2IA 5BYSA 3G96A 3TUPA 1LWXA 4DEZA 2VB6A 4OZ3A 3UR3C 3UVJA 1RADB 1WG5A 5J2QA 1YJVA 1IKVB 4FN5A 1XWLA 4LF4F 2HHXA 5E3AA 3HI9A 4C3LA 3ICLA 4YEAA 4DR2J 2RHSB 3OJUA 4OFZA 1HQEA 2QGFB 5CYQB 4NI2B 3W5XA 3B78A 3HZEA 1S4FA 4S0MA 1N34F 5AT1B 3R27A 1Q8LA 2A6MA 1O51A 4GKKJ 4OZJA 3GU0A 5HK4A 1ZM9A 2YKOA 4ED1A 3CVKA 4ZHRA 4OI6A 4RBTA 1DURA 2L3MA 3DLBA 3MMJA 5FJ4A 2HFOA 4NLDA 2KXNB 4ECTA 1WHXA 3KDNA 3WDOA 4DSLA 1T9UA 5T7LA 3AHPA 2HAFA 1VBZA 3MR7A 2J8AA 1RTHA 1RWKB 3LGNA 2ZKUA 2M8HA 1FRXA 3RRGA 2W24A 2BOAA 4F3QA 1FK9A 2RS8A 2V94A 1M5HA 3K17A 2I9SA 1HPZA 1N56A 2DH8A 2RH3A 2BJ9A 4HH0A 5ETVA 5CAAA 2UU9F 1G2EA 1Z4UA 1I51B 3IGNA 4F4AA 3PEHA 1TTHB 1Q1KA 2N4DA 1JWWA 3N6MA 3OR2B 2VASA 4NRUA 1YITS 3QPIA 1QAYA 5K14A 1QLNA 4GO5X 1GMWA 4CH0S 4OZLA 4JYAJ 1U1QA 4V1Ak 3AXMA 5M2PA 2Z2MA 4ED4A 3M2RA 1CPZA 1IBCB 3H25A 3K58A 2GC8A 4M63A 2JEJA 5E7OB 4OJGA 1VI7A 5E2QA 2VDHA 3T6BA 1KDNA 1NDPA 1PGZA 4DR1F 1O8BA 1BD6A 1CULB 5HSPA 1CEZA 3LP2A 1BC6A 1SKRA 4LUBA 4URGA 5JXSA 4ZDNA 1WHWA 2VBZA 1HNVA 3X3UA 1ZM3A 4NL5A 1U8WA 1QDUB 4ZPBA 4AL7A 1YZ6A 4FKYA 3WC2A 1K47A 4UT4A 3Q8YA 5KTQA 4ZVPB 4K4XA 1UVNA 2Y8WA 4OYIA 4DL5A 1U1OA 1AZSB 4CM0A 4HI1A 4KTQA 5G0RA 3JXOA 4ED5A 5A0YB 1SL1A 1FRKA 1SV5B 2GX8A 3GYGA 1IBMJ 1S6PB 4DDFA 1M5SA 5H9FJ 1FA0A 2DH7A 1VQNS 1MROA 4WF9Q 4KT0C 4DS5A 1S7HA 3HHNB 1XMQJ 1VRQC 3PW2A 3KLFA 3HHKA 4C8NA 3HKWA 4HR2A 3ZXWA 3V6KA 2ROPA 4HLBA 3JYTB 2M4MA 3FCHA 5C42A 1WI6A 1BLUA 3ZNUA 3FFIB 1RTJA 4EZ9A 2EVZA 5DQGA 3KMQA 1BWEA 3QO9A 5KFPA 2WW8A 2R7WA 2PEBA 1SKWA 2V4JA 3RBXA 2WAQD 4MIAA 5HP1A 3L7UA 2D7SA 3DC2A 2K7JA 1LW2B 2CJ9A 2ZUGA 1IWAA 1OJ4A 2WK4A 3QSYB 2RT3A 4PWDB 3HSJA 2HS3A 2KYXA 4NLWA 3NG8A 4X4QA 4P2SA 4U7UD 2LU2A 3QYYA 2FVPA 1NK5A 1N52B 2ZKTA 3KLGA 2UVWA 4YB5A 2YH1A 1FXRA 4ZLJA 3KNGA 4QYZK 4A8SA 2V50A 5KFJA 2Y8YA 4QZVB 5ETKA 1NH8A 4Z37A 4B9MA 5E3PA 4ELUA 4X4PA 2E29A 2J0XA 2VF3A 1UPMB 5L9NA 4R0JA 4NXMJ 2HKEA 2DHSA 2EG2A 3S01A 3E8OA 3J7YI 7AT1B 2IMOA 4IO1A 4C8MA 4KV8A 2DT9A 4ILLA 1H0HB 5DDQC 4X4UA 1HFEL 2DKOB 2RU3A 3O1LA 3QAUA 4O4GA 4DUYJ 1X5OA 5HVHA 1PC4A 5B0CA 2R2SA 1FEEA 4TQSA 4MK8A 2KYZA 1B64A 1F6TA 2SXLA 2CPEA 3M8YA 3ISNC 5EHHA 4B3OA 1KHWA 2LYVA 3UVJB 3IRXA 1S79A 1NU4A 5J2QB 3DI6A 3CJ5A 3HSGA 4Z2XA 3ULHA 2OI2A 2QFIA 2G1DA 4OI4A 3TVYA 2O3DA 3LQVA 3SCIE 3N0VA 1HQEB 4OYPA 4GKJJ 2V8DA 1SJRA 2I8EA 2CYYA 1EX8A 2RQKA 4OL8A 3LTOA 2WCXA 4DL0C 1ZBTA 1BHNA 2W9AA 4ED7A 2N7YA 2V8HA 2R7OA 3O3LA 5EUHA 1RZMA 3CE8A 2NXEA 1HNIA 2F9JA 1TMJA 5GMDA 2KVQE 4WKRA 1O6XA 2MMYA 2CQ1A 1T9TA 1KQFB 1L5UA 2RF2A 5F8NA 5KFSA 3SSRA 4USUA 2EC2A 1TL1A 2EXUA 4OQJA 2A10A 2XNRA 4LF8F 3QT8A 4X66J 1RYSA 5T7LB 2ZM6F 3CCTA 2XYHB 2ZOFA 3IAM9 1RTHB 2Y1LB 4RX6A 5FLXY 3TI0A 1SJ4P 2DHGA 1FK9B 3T6JA 3AJ1A 4J37A 2VC0A 1YDLA 5HQLA 3I32A 2OP5A 4IOAQ 1HPZB 1E6VA 3D0IE 4WJBA 1WTFA 1IWGA 2KI2A 2W9BA 3GTYX 3PX0A 4NASA 2AT1B 1U4BA 2DNPA 2FY8A 4HT5A 4LMZA 1PCAA 3MR6A 5LJ5Y 3TWZA 1TVRA 4IOCQ 1VFJA 4CLKA 5K14B 2Z58B 2HIQA 2MPUA 2CDRB 4MAKA 3JSYA 4DFJA 4H4MA 1RAHB 2YWHA 1AYEA 4PG6A 3K89A 4LQ3A 4RL1A 4DV6J 3M2RB 2QA4G 4OLOA 4RR5A 3AD7C 1KLMA 1LNQA 3N28A 2QO3A 5IQ6A 3NGUA 3AH6A 4BDPA 2CWXA 5HLFA 2OO4A 3KHHA 3GE9A 4NXNF 2OHDA 2Z2YB 1CJUA 1JLQB 1HD1A 3D1OA 3PTWA 2FTRA 4C8YA 1MWYA 4PRFA 1VJQA 3OHAA 5KG1A 1HNVB 2X1BA 3PW4A 3A12A 2D1CA 3W64A 3EUNA 1Z2LA 4CNZA 1T9YA 4LSZB 1Q79A 2KO1A 2OPSA 1S4EA 2Z56B 2YKPA 2M2BA 2BM1A 3P8BB 1YX2A 1BQMA 5G0RB 4P71A 2VH7A 3VAJA 4ZPCA 5HI7A 1LOUA 1MW7A 4KO0A 4DQPA 3DRSA 4HHUA 1EP4A 1MROB 3VZHA 1KR4A 3DOKA 2HK3A 2LXUA 1FDBA 1B7FA 1VLOA 3KNAA 3KLFB 2RKIA 1H98A 2IJFA 1S77D 5HL7Q 1ZA2B 2O5DA 1KONA 3HZGA 3DDNA 1FI4A 3EVOA 4M5IA 5C42B 4PUOA 3P96A 3N6LA 2VONA 1RTJB 3GIRA 2HMIA 2C28A 2BMBA 2POKA 3Q8RB 3QO9B 4I0WA 5DQHA 4PAAA 4MYUA 4DR2F 3SCKE 2A2CA 4UOGA 1WEYA 2CAJA 2VL1A 2H5JB 2V4JB 4M5DA 1X4HA 4OYOA 1GTEA 5HP1B 3KG4A 4DX6A 1X0FA 3BSOA 2H1YA 2UVUA 2XGPA 5LM7E 3SI8A 4GKKF 2PIIA 2W2OP 3LH2S 2H4YB 1G1XA 5C7PA 1SJ3P 4NEZA 2G2YA 4RUHA 4DR3F 4Q5VA 2JLFA 2R9LA 4PZVA 1MMDA 2CQIA 4RNOA 3B4MA 4WK3A 2I6WA 1F60B 2VFUA 4EI2A 3M9NB 4DWIA 4DSKA 1T3OA 2CG4A 5F3TA 3KLGB 5KFQA 1M1HA 4I2QA 3A13A 3PCOB 3KOAA 1PYOB 5FIIA 5BJRA 4WU2A 1Y7PA 5GAEI 1Z1ZA 4OV1A 1RAJA 1YRXA 4PQUB 4QIWD 3HHLB 1RAFB 3H2LA 2P9EA 2XZDB 1S9EA 4PEOA 4FXWA 1T03B 1OQ6A 2OTJS 4K4YA 3T9ZA 1NDCA 1OMSA 1V6HA 1GMUA 2ZWOA 4KV8B 4DCJB 4I4BA
chains in the Genus database with same CATH topology
2Z58B 3AFGA 2QTWA 3BGOP 2Z2YB 2XTJP 1SPBP 2W2MP 3VHQA 3T41A 3WHIA 3A3OB 3GCWP 3WIUA 1R6VA 2Z30B 3A3NB 3QFHA 3VV2B 3CNQP 2E1PA 2W2QP 2Z57B 3A3PB 1SCJB 2W2PP 3GCXP 3CO0P 2ZWOA 3SQOP 3H42A 2W2OP 2Z56B 2W2NP 4OV6A 3P5BP 2PMWA 4YN3B 4K8RA 4JP8A 1ITPA 3BPSP 3WIVA 2Z2ZA 1V5IB 4NE9C 4NMXA 2ZWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z58 B;  3AFG A;  2QTW A;  3BGO P;  2Z2Y B;  2XTJ P;  1SPB P;  2W2M P;  3VHQ A;  3T41 A;  3WHI A;  3A3O B;  3GCW P;  3WIU A;  1R6V A;  2Z30 B;  3A3N B;  3QFH A;  3VV2 B;  3CNQ P;  2E1P A;  2W2Q P;  2Z57 B;  3A3P B;  1SCJ B;  2W2P P;  3GCX P;  3CO0 P;  2ZWO A;  3SQO P;  3H42 A;  2W2O P;  2Z56 B;  2W2N P;  4OV6 A;  3P5B P;  2PMW A;  4YN3 B;  4K8R A;  4JP8 A;  1ITP A;  3BPS P;  3WIV A;  2Z2Z A;  1V5I B;  4NE9 C;  4NMX A;  2ZWP A; 
#chains in the Genus database with same CATH topology
 2F4V J;  1TKD A;  4DCO B;  5AXN A;  4O4G B;  5KFM A;  4QR2 A;  2PE8 A;  3OTE A;  3SSS A;  2GZO A;  2Z2L A;  2HAI A;  3D54 A;  4X62 J;  3W2V A;  4HDG A;  4AT1 B;  3NEK A;  5K8N A;  2KXF A;  5IZH A;  2J6T A;  4JYA F;  4B3O B;  1WG4 A;  2GJ2 A;  2WSF C;  3IRX B;  2I0X A;  3DI6 B;  3MUM P;  4RW9 A;  1BGX T;  2J0S D;  4C2M A;  3V5R A;  4ER8 A;  1OYE A;  1Q7L B;  5A6P A;  3VGS A;  4USH A;  3PX6 A;  2ATC B;  5KFI A;  2QL5 B;  3BKU A;  2P5V A;  2PMH A;  4FBU A;  1J5E J;  2Y1J A;  2AYB A;  3UE2 A;  4LF5 J;  1HNI B;  2PA8 D;  4ECY A;  3UCU P;  2MLY A;  3M2V A;  1K9M T;  2IM0 A;  2RF2 B;  3GCW P;  2H5I B;  2YNH A;  1NRK A;  2JVR A;  1TL1 B;  1WF1 A;  3IBF B;  3HF5 A;  3JSM A;  5KFT A;  4R8U A;  3UQS A;  3CCV S;  1WSR A;  2KDO A;  1D9D A;  2ZEJ A;  4RLE A;  4TU8 A;  3UW1 A;  3PVX A;  1Q78 A;  2O1P A;  1IBK J;  1NSQ A;  3UR0 A;  4MIW A;  1QE1 A;  3EM1 A;  1IBM F;  3AXK A;  1L3S A;  5D78 A;  1ZET A;  2UUT A;  5I3P A;  1X4D A;  3RB6 A;  4Y3C A;  2GMH A;  1XMQ F;  2RQ4 A;  1E6V B;  2Y1R I;  1UMJ A;  3KJQ B;  5K9F A;  1RA7 A;  2W9B B;  1K44 A;  3CCM S;  5D77 A;  4H54 A;  4J9Q A;  2BJ7 A;  4LFC F;  1VLY A;  1PBA A;  3W66 A;  2VOO A;  1K0T A;  3A8J A;  3EZO A;  2XM3 A;  1QTM A;  4PG5 A;  4O0I A;  3EZU A;  2XLJ A;  1TVR B;  2ACY A;  2BZ2 A;  2IDE A;  4DUZ F;  1FKO A;  3CJQ A;  4UY8 T;  1QM9 A;  4W92 B;  2WVE A;  2FHK A;  4GMK A;  3JSB A;  2LKZ A;  2YTC A;  2AZ3 A;  4ATN A;  4P72 A;  5CZX A;  3ENQ A;  1WNE A;  4J9S A;  2ZJR Q;  3Q2S C;  2CA9 A;  1KLM B;  3D6H B;  4ELV A;  1RDR A;  3U02 A;  3NGD A;  5DJB A;  1XBW A;  1XQI A;  4J9L A;  2FIU A;  5HLF B;  4AD6 A;  2NCK L;  3O8W A;  2YKM A;  1CJU B;  3RBE A;  1GTH A;  1WHY A;  2RRA A;  4OI0 A;  3OPK A;  3DNC A;  5HBM A;  3MCM A;  1KNZ A;  3EMT A;  3KJF B;  4R0E A;  2CQ0 A;  2GJI A;  3M32 A;  1HBM A;  2VIC A;  3R1H A;  2KXH A;  1DRZ A;  2J7W A;  3W5Y A;  1H72 C;  1L3U A;  2OPS B;  3FBE A;  2ZH2 A;  5DM6 Q;  3HHD A;  3GLJ A;  2GS8 A;  2CJY B;  3SCL E;  2C3O A;  2V9K A;  4P2F A;  3UD5 A;  4PG4 A;  2A2D A;  3W62 A;  4ZJO A;  2W9C A;  2R2U A;  2I5J A;  3BDE A;  1BQM B;  5CQG A;  2VPZ B;  2OEL A;  2W4D A;  2ZUA A;  2CQH A;  4ZPA A;  4KO0 B;  3DRS B;  4ES1 A;  1EP4 B;  2V34 A;  3JAM U;  4UZC A;  3DOK B;  2YVS A;  5EX3 A;  1T11 A;  2ZBQ A;  5H9F K;  4PAB A;  2VPW B;  3AOD A;  3ENW A;  2MQO A;  2RKI B;  3V6H A;  2BVZ A;  5DO2 A;  3C6T A;  2CPH A;  2M0G B;  1NLK L;  2HZA A;  5DDP C;  4M94 A;  5KAK A;  3G82 A;  2EFO A;  2C3P A;  4JP8 A;  2HMI B;  2AZ1 A;  2RUG A;  2ZJQ Q;  1KOH A;  1P8G A;  5DS7 A;  3UI3 A;  1KVI A;  5M2R A;  4CZC A;  1X5P A;  1VOM A;  1S7I A;  3QT5 A;  1GAO A;  2HW3 A;  4GKJ F;  4M5D B;  1P27 B;  4MKV A;  4ERD A;  4ZN1 A;  3BB5 A;  1GNK A;  1FO1 A;  2OUG A;  4C7Q A;  1JXV A;  4DPU A;  4NA2 A;  2BDP A;  3M6X A;  5D3G A;  3U7J A;  3DXS X;  1LWE A;  2K3K A;  4WU3 A;  5KT6 A;  3BQ2 A;  4QIG A;  3GII A;  4G1P A;  1JJ2 R;  5HVG A;  5H9E J;  1R3N A;  4I2Q B;  2EPI A;  3D9B A;  4WXW A;  1UJ4 A;  3QWU A;  4X66 F;  4HAC A;  1RTI A;  4ALZ A;  2RDD A;  3GR1 A;  2C3M A;  2R42 A;  3FSI A;  3ZZT A;  1FFW B;  1NJX A;  3NWR A;  2YWW A;  3HD2 A;  1S9E B;  2MZT A;  5M2U A;  2F8H A;  1R89 A;  4DPO A;  1PSD A;  4MYT A;  4Y2M A;  1KVJ A;  5U47 A;  2ZZN A;  2MKH A;  2ZJP Q;  4ZVG A;  4XTT A;  4IDK A;  2XSF A;  2DGV A;  3KKF A;  1DAR A;  4P73 A;  2CIM A;  3QID A;  5KFU A;  4F4K A;  1KP6 A;  3TEH B;  3HFZ B;  2F65 A;  1HWJ A;  3WBZ A;  2ATL A;  4C8Z A;  4K0K J;  4O3R A;  2GHV C;  3BS9 A;  4DL7 A;  1FWK A;  4DS4 A;  2AP6 A;  4A8Q A;  2V63 A;  2VU5 A;  3W2V B;  2VV5 A;  1VRU A;  3A8K A;  4ECQ A;  2EEY A;  2XSJ A;  3Q0A A;  1WKJ A;  3TEG A;  4ECV A;  2HRY A;  2QE5 A;  2NXN A;  1WOS A;  2K8G A;  4RW9 B;  3R7B B;  3J7Z 5;  2VHG A;  3CC2 S;  5L39 A;  4ITS A;  4ZVQ B;  1HWI A;  1H73 A;  3FEZ A;  3TJA A;  5EX0 A;  3D2W A;  1YJN S;  4I2P A;  4CM2 A;  2VFV A;  3MR5 A;  4USK A;  4LIR A;  1AUD A;  2IAJ A;  3SIP B;  2KU7 A;  4WFA Q;  3GFY A;  1IQZ A;  4ZIW A;  2J0Q D;  3J81 Y;  3M2V B;  5DLG A;  4Y2K A;  2IVF B;  2BKO A;  3FRZ A;  1ROF A;  1S12 A;  1M5P C;  2YNH B;  4LBP A;  2UXB J;  2KFZ A;  4WP3 A;  2HHT A;  2OH2 A;  3JSM B;  1R8A A;  2H5E A;  4R8U B;  1T7P A;  5IQQ A;  1FDA A;  3OVS A;  4LRC A;  4DFP A;  4USW A;  3UPF A;  2XS7 A;  3MM7 A;  2QJ3 A;  2C2M B;  3LPE A;  5B09 A;  5F0U A;  2V6A A;  1QE1 B;  2WBM A;  4LRE A;  2B4O A;  3BYP A;  2OLW A;  4G1Q A;  4DV4 J;  4O44 A;  4OZN A;  4FNH A;  5A2Q U;  4W98 A;  1ZPV A;  2PD1 A;  1CVJ A;  1T95 A;  2JFD A;  4QU6 A;  3QT7 A;  3FSX A;  3H2V E;  4DPT A;  4CO2 A;  3Q89 A;  4NCA A;  4DX8 H;  2LMI A;  1RT5 B;  1SUQ A;  4M5N A;  4FS2 A;  1G3O A;  3K8V A;  3HT0 A;  4DR5 J;  2R2T A;  2AGP A;  1C4A A;  3R3T A;  2G2Z A;  1FKO B;  3CXC R;  2R7S A;  3QJP A;  2ADC A;  3MWB A;  3GG1 A;  4G1I A;  4DR4 J;  1RP5 A;  1RXO B;  5E3R A;  2HNY A;  3H2U B;  1B99 A;  3M6V A;  3UO0 A;  2GO8 A;  4P75 A;  2D3U A;  1A6L A;  2XWY A;  2QSF A;  3BPD A;  3AY0 A;  5GMK a;  1N0V C;  4F50 A;  1AB8 A;  3D0H E;  3TQ1 A;  3NCR A;  3B82 A;  1CJK A;  5FD1 A;  5IS2 A;  1D3W A;  1N36 F;  2N3O A;  5GAG I;  3PYG A;  3OLB A;  2BW2 A;  4FS1 A;  2YKM B;  2XI2 A;  4Q0B B;  1GFW B;  2ZZM A;  5HBM B;  2C2Z B;  1U2C A;  2PA3 A;  3DGV A;  3MF5 A;  5IT9 Y;  3KYL A;  4IG0 A;  2VFT A;  1HBM B;  3TW0 A;  3FBF A;  4OZ2 A;  3GP9 A;  2R8J A;  2WOM A;  4DSF A;  5DG9 A;  3CUN A;  5A8K A;  2U2F A;  2NYH A;  2W9C B;  2DR6 A;  4K4Z A;  1SL2 A;  2I5J B;  2F5G A;  4N77 A;  2PO4 A;  2F4V F;  3RR7 A;  4PKD B;  3D6F B;  3QQC D;  4ZVH A;  2COL A;  1S59 A;  2FB0 A;  4IH5 A;  1HKA A;  2KFY A;  4RPF A;  3NLC A;  3MTK A;  1F9F A;  4X62 F;  1VIX A;  2VJU A;  5JJB A;  2BJ1 A;  1HLW A;  1NXI A;  2HUR A;  1X4A A;  2IDL A;  3C6T B;  4KGK A;  4GVB A;  3G82 B;  3LAK A;  1CC7 A;  4IQX A;  1JK9 B;  5CD4 A;  3SV3 A;  3WIV A;  1ZYQ A;  1WEZ A;  5HMW A;  1JX4 A;  4QBU A;  2U1A A;  1SJF A;  5HAO A;  2XMA A;  3EYZ A;  4JI2 J;  2W01 A;  3CT9 A;  2DY1 A;  4EZ6 A;  2MZR A;  3PW0 A;  1PC5 A;  3F41 A;  2QC3 A;  3DDK A;  4C8O A;  2GQ2 A;  3NOC A;  1LWE B;  3UDL A;  3PIO Q;  1VQ6 S;  1RWW B;  3TNV A;  1SCJ B;  5B0G A;  4U7C A;  2W1B A;  4ZVU B;  5IT0 A;  1FT8 A;  1F3F A;  2QTW A;  1YGY A;  4K4S A;  2K3I A;  1TUW A;  2MST A;  2MY8 A;  5HMZ A;  4HAC B;  1RTI B;  4B9V A;  3NWG A;  4AND A;  8ATC B;  1YJ9 S;  1Q86 T;  4C9D A;  1IBK F;  3CDB A;  3Q22 A;  2CPX A;  4KE5 A;  1RHU B;  1XJW B;  4X65 J;  3W60 A;  2FGO A;  2Q1L A;  4KPY A;  1UPP A;  3LAM A;  2NLW A;  2H51 B;  3B8H A;  3LO3 A;  1NZA A;  4J9M A;  4IDK B;  4CCH A;  2CVI A;  3D7S B;  1F5A A;  1U0S A;  1EZZ B;  1OPZ A;  3M05 A;  4ETZ A;  4IH7 A;  2C2D A;  2Q6C A;  1SKS A;  3LPY A;  4LRD A;  4UUW A;  4OZ1 A;  1F9H A;  1BQN A;  2X1F A;  4DV7 J;  2EI5 A;  4WWS A;  1VRU B;  4QIV A;  2ZZT A;  2GVD A;  2XSJ B;  2JX2 A;  3J80 Y;  1TFY A;  4OX6 A;  3Q2T C;  2CZV C;  4PXC A;  2XO6 A;  1VQY A;  2UUB F;  1X8D A;  1VQ8 S;  1WF2 A;  4FYY B;  1XIQ A;  2R8G A;  2H4W B;  2BUN A;  5ETO A;  5C24 A;  2UXC J;  2HHH J;  4I2P B;  4MT1 A;  2IAJ B;  3W8P A;  1O0P A;  2BE9 B;  1FEH A;  4J7C A;  1K1S A;  2B4V A;  1I5O B;  2KG1 A;  2HZV A;  4NE9 C;  2V2K A;  5D0R A;  3F56 A;  4KSE B;  4IFY A;  1S1U A;  5D4P A;  4CLU A;  1RAA B;  3A3P B;  3FVY A;  3L9Z A;  4IKA A;  3MOJ B;  3ZC4 A;  3HKZ D;  1XMB A;  1NK7 A;  2DNR A;  1YG0 A;  1N34 J;  2RML A;  2JLG A;  2X3D A;  4Z7C A;  1N8R T;  3EGZ A;  1M90 T;  1XNR J;  4RNN A;  1IJF B;  1RCX B;  2JL9 A;  1QD1 A;  3TA2 A;  2WVF A;  1U47 A;  5DGB A;  2OTL S;  5C5J A;  3FRY A;  3OTO J;  3M4X A;  4G1Q B;  3LP1 A;  4N56 A;  1FE4 A;  3GJQ B;  4O44 B;  1KSP A;  5D0H A;  3D5M A;  2HFZ A;  5F8G A;  2C2R A;  3PW7 A;  4MKB A;  3TVZ A;  3TZW A;  1UFL A;  5LT5 A;  2GCF A;  1U49 A;  4ZS6 A;  4B3M J;  3VZI A;  2R8K A;  3M8S A;  3UCZ P;  4B02 A;  1SUQ B;  3AB2 B;  4M5G A;  3EPI A;  4KFB B;  4TY8 A;  3U27 A;  1A7G E;  2QL7 B;  4HYK A;  4ZLL A;  4KAI A;  2CPZ A;  3B54 A;  1RU2 A;  3M8R A;  1BQX A;  4AXI A;  3VAI A;  5KFK A;  1RHR B;  3NNC A;  3TZY A;  4DMZ A;  2HNY B;  4K4V A;  1S6Q A;  2UU9 J;  2Q3P A;  4FVM A;  2HWH A;  4ZOS A;  5T41 A;  1SBR A;  5CA5 A;  3EZ5 A;  2GFF A;  4RBV A;  1RAB B;  1VYA A;  1CJK B;  3B4D A;  4N8N A;  5KT5 A;  1KOO A;  3V2U C;  1OYD A;  2NUU G;  5GVQ A;  1IR0 A;  1HNW J;  2DD8 S;  1WSV A;  2HFN A;  2RRN A;  5L9X A;  3QAE A;  2MEW A;  4ZPV R;  2ASL A;  1AW0 A;  4QWC A;  2VOD A;  1RHQ B;  1G6B A;  2WON A;  4IG0 B;  4ZPW R;  3HPO A;  2BJ8 A;  5AE1 A;  3DDI A;  5GAD U;  2RAQ A;  1TL4 A;  2ABY A;  4ZJQ A;  2EKY A;  3CW2 C;  2N82 B;  2CJQ A;  4ZIT A;  2WOM B;  4JI5 J;  4YB7 A;  1VQ4 S;  1YZ7 A;  4DL2 A;  4F3O A;  1Q5V A;  5A8K B;  2VPY B;  2ASJ A;  2LFV A;  1EAR A;  4YR2 A;  4X4R A;  1CQN A;  4Y2C A;  3IM8 A;  2F8E X;  1CSJ A;  3C46 A;  5CH7 B;  3L09 A;  2KKH A;  3BQ0 A;  1B4S A;  2DIT A;  2WRM A;  2VZ9 A;  1SC4 B;  4K0K F;  1N5Q A;  4QIE A;  2KL8 A;  3PIP Q;  1UW9 A;  3ZZ0 A;  3DLE A;  4IUF A;  3CB4 A;  4RU2 A;  3BGU A;  1X7V A;  2FZC B;  4KGX B;  2CQP A;  4F4Y A;  1ZTT A;  2HFS A;  3MPU B;  1Q53 A;  2L9D A;  3DMJ A;  1EET A;  4PQA A;  2XNQ A;  3C66 A;  2PT0 A;  4OI3 A;  4GVB B;  4NA1 A;  2XUL A;  3CTR A;  5C2C A;  2GGP A;  3PHE A;  3TA0 A;  2W8K A;  3SZ2 A;  4NCG A;  1Q8K A;  4ZCM A;  5KG6 A;  3C14 A;  3NMR A;  2UV8 G;  4HHJ A;  2DHX A;  3W9J A;  4WII A;  4I69 A;  2BJ3 A;  2JOQ A;  2CPF A;  2DGW A;  4L74 A;  4NLS A;  1BE4 A;  3J7A 1;  3IFE A;  3JTN A;  5HVF A;  2XZT B;  1YHQ S;  3CNQ P;  1QAX A;  4RBU A;  2XY5 A;  2XLK A;  2MJU A;  5HQM A;  2VOP A;  5CYQ A;  2UXB F;  2BQ3 A;  2YQ0 A;  2DIU A;  1SL0 A;  5H9E K;  1DBD A;  4EEY A;  3DRY A;  2OSQ A;  5EWE A;  1XK8 A;  3M8P A;  1WTB A;  2ZH1 A;  4G65 A;  5CYM A;  2D3Z A;  4DPY A;  4NOH A;  3BEG B;  3LA0 A;  3RZA A;  3LF0 A;  1VQO S;  4DV4 F;  2EW9 A;  4P9S A;  3KLI A;  1YRT A;  3CC7 S;  4I1T A;  1UWA A;  1S48 A;  1RT7 A;  4KIA A;  5C25 A;  2ZD1 A;  4OJ1 A;  3QZ8 A;  3H7H B;  3L4B C;  3MTJ A;  2IBK A;  2HHP A;  1B3T A;  1P9Y A;  4C3M A;  4QCL A;  1Y10 A;  1NJZ A;  4NLR A;  2NQP A;  3AOA A;  4B9T A;  3KUE A;  3RTV A;  4DR5 F;  4HTJ A;  3RW7 A;  4GC6 A;  2E5I A;  3EGN A;  1SC1 B;  1HI8 A;  2BE2 A;  1BQN B;  1W2B R;  1PAE X;  1VQ9 S;  2RDI A;  2IM1 A;  4ED2 A;  3M6W A;  4DR4 F;  2GVD B;  2D3O R;  4Y6I A;  2DNQ A;  1JJC B;  3TUJ C;  3W8G A;  2MSS A;  2YNI A;  9RUB A;  5KOX A;  4LIW A;  2CJB A;  3VVU A;  1R27 B;  4X64 F;  3SXL A;  3R1L A;  1JXL A;  1LV5 A;  2AJ4 A;  5E3Q A;  3PRB A;  1S76 D;  2WW4 A;  5KFO A;  4RWW A;  2WB4 A;  4CI0 B;  3MUR P;  2E1C A;  5C24 B;  3I6P A;  4URS A;  4DSE A;  1YK9 A;  2NXC A;  3DCA A;  3ZZU A;  2E7X A;  1MNE A;  2YPZ A;  1CLF A;  2CJA A;  2UUA J;  2EKN A;  1TK5 A;  3OW2 R;  1S9G A;  2F1F A;  4AL6 A;  2HHS A;  3HVW A;  4UQT A;  2LQ8 A;  3CC4 S;  1R0B G;  1PBU A;  4ZIV A;  1U02 A;  2AQ4 A;  4IFY B;  1S1U B;  2VKR A;  1YKW A;  2C3U A;  4AFF A;  1UA1 A;  3NL0 A;  4AXJ A;  2VQE J;  3JSR A;  3IRW P;  2RDJ A;  1RQ0 A;  5E3C A;  3AT1 B;  2F9D A;  1X31 C;  4BCA A;  4HEA 9;  1AA1 B;  3I5A A;  1KKH A;  1FKA F;  4I6Y A;  1VBY A;  1L3V A;  2IRY A;  3G6V A;  5KFB A;  2QLJ B;  2IA0 A;  4L72 B;  3IWN C;  4OHY A;  1QSY A;  4BWM A;  3RG6 A;  1Q4R A;  4CO1 A;  1C2P A;  4ED8 A;  3ILL A;  3LP1 B;  3L3C A;  4EBE A;  3PRV A;  1FXD A;  4PXE A;  1QY7 A;  1RYR A;  2QZ8 A;  1AUS L;  1R6V A;  1IM6 A;  3PM9 A;  4LF8 J;  1IUJ A;  4UOC A;  4ECW A;  4YQW A;  5HJX A;  1TU0 B;  2LQ9 A;  4DLG A;  1KQG B;  3QZ7 A;  2E1P A;  2DNM A;  5ADZ A;  3M8W A;  1IBL J;  4JI2 F;  2HEK A;  4K4U A;  2PEH A;  3BBB A;  3GYX B;  3CDE A;  3WC0 A;  2F63 A;  1S6Q B;  4K4W A;  4OYA A;  4CIO A;  4CWB A;  4GVL A;  3NRB A;  1HI1 A;  2GA7 A;  3PV8 A;  5JVH Q;  1RHM B;  3CCS S;  5KT2 A;  5DG7 A;  5KFE A;  4IFV A;  3VAK A;  2RQM A;  1ZAX A;  1DQ9 A;  5BYR A;  4BS2 A;  4RUA A;  3JQJ A;  5KFC A;  3OLA A;  1QJH A;  5L38 A;  1N5V A;  3ZTQ A;  1NK9 A;  4Q2L A;  4Q44 A;  3I87 A;  3GIK A;  2J9E A;  1S72 S;  3BJY A;  4AQY J;  3KXD A;  4OX8 A;  2J7U A;  2I2Y A;  2WON B;  4CYU A;  1SKU B;  1LK5 A;  3RRK A;  4K50 A;  4PPD A;  4ZP8 A;  1U48 A;  3ZZZ A;  2YKQ A;  4HT7 A;  3G6Y A;  3IR6 B;  2R7R A;  4X65 F;  1BUX A;  2C2E A;  4Y2I A;  2J8S A;  3T9N A;  4ECR A;  2DNK A;  2DO0 A;  3ISZ A;  1X4F A;  2XMV A;  4CO0 A;  1NKB A;  3C6U A;  3RR8 A;  4IOB A;  3GV5 B;  2VG5 A;  4LSL B;  3I56 S;  4WTO B;  1MN9 A;  1VMB A;  4BC7 A;  2GVZ A;  2UV8 A;  1VQP S;  5KFV A;  2YKA A;  1F5B A;  3DLE B;  1Y5N B;  4CLT A;  5AXK A;  4QU7 A;  2FLO A;  3VGT A;  2IA6 A;  1CG2 A;  3S1T A;  2BOP A;  1NPK A;  4MK9 A;  3JTP A;  3OR1 A;  3DMJ B;  1R0A A;  1EET B;  2FZK B;  3CIZ A;  3DLJ A;  2FQQ B;  1VHI A;  2OIH A;  2XO7 A;  5LJ3 Y;  1UZD A;  5HAT A;  2DHA A;  3BSA A;  2J6S A;  4C48 A;  3MFH A;  4D3H A;  4RNF A;  3FC9 A;  2XCP A;  3N9U C;  1MSW D;  3MEE A;  1TL3 A;  3CCR S;  3U1N A;  4NCG B;  1FNX H;  2UXC F;  2HHH F;  5LMU J;  2YXL A;  2D9O A;  4B9S A;  2CNN B;  3T1A A;  1NSP A;  1ZS6 A;  2B7C B;  3OUY A;  1DZ5 A;  2W2Q P;  1N32 J;  4NYZ A;  1PJ6 A;  2E1A A;  5HRO A;  3BO2 A;  2BBE A;  1RAC B;  5J1P A;  3JTO A;  2GHW A;  5AE2 A;  4FXV A;  2AEJ A;  2QLF B;  3D0G E;  4QPT A;  2XS2 A;  5KFH A;  4ANC A;  3GV8 B;  1TKX B;  4PG8 A;  2B9E A;  1ZPW X;  4UST A;  4DCP B;  1WWH A;  1XNR F;  2DCL A;  1ZTW A;  4B3T F;  3M8P B;  4H4K A;  4Q43 A;  4NWB A;  4JV0 A;  2JDJ A;  5CYM B;  4DR3 J;  4NLU A;  2HHW A;  4P74 A;  4WYL A;  1YVF A;  3MPD A;  2O01 C;  3K5N A;  3DLG A;  3OTO F;  3IG1 A;  4DX5 A;  1SIZ A;  1R31 A;  3HVT A;  1DJ0 A;  3KLI B;  1KHV A;  1RT7 B;  2MZ1 A;  5C25 B;  4J9O A;  1B0T A;  2ZD1 B;  2XC9 A;  3R97 A;  1UCN A;  1WOR A;  4DPX A;  2ZNZ A;  4B3M F;  2MDA A;  3ILJ A;  1JQG A;  2ACM A;  3TUI C;  3AJD A;  4DN0 A;  3FMW A;  1CS4 A;  1LWC A;  4DQR A;  2BE2 B;  4ZP6 A;  3V81 A;  1JLE A;  4NML A;  2MKJ A;  1GMW D;  2AHO B;  3R9L A;  1B0V A;  2YNI B;  3E51 A;  2FHJ D;  4AYB D;  2LU1 A;  1OY6 A;  3DLL Q;  3DOL A;  4PR6 A;  2DRA A;  1ZM2 A;  1RIS A;  1HNW F;  2X3G A;  2FYX A;  2LDY A;  3Q8Q B;  2B4P A;  4NA3 A;  1S9G B;  2BJE A;  1FES A;  1X0P A;  1FWL A;  2IMW P;  2O66 A;  2PFF B;  2OSR A;  4TU7 A;  5JMN A;  2QIF A;  1RWU A;  2NPI A;  1V3Z A;  4K2X A;  3M8Q A;  4LR8 A;  4I64 A;  2W2N P;  3ONQ A;  2IBO A;  2OKQ A;  1JMT A;  1Y0H A;  4JI5 F;  4HKQ A;  4K7Q A;  2BXJ A;  2ZH4 A;  3GIJ A;  2MHN A;  1JLQ A;  4F36 A;  3E3X A;  2MQM A;  3M9M B;  1DHM A;  1DTQ A;  4PYD A;  2ZHB A;  1RWP B;  5E5N A;  3CCW A;  1FDD A;  3R2C J;  2VBX A;  2VC1 A;  1ACM B;  1NUE A;  2DR5 A;  4CNY A;  2B56 A;  2BAC A;  3T1Y F;  3SQO P;  2BKN A;  3MEC A;  2DNL A;  2OD6 A;  3CIM A;  4DQS A;  1FRH A;  1SPB P;  4DL3 A;  5EWG A;  4H4O A;  2G0I A;  4WFB Q;  4XDC A;  2B43 A;  2IVM A;  1KC8 T;  2V2Q A;  3GSI A;  3MHY A;  4LQ9 A;  3G71 S;  4DOZ A;  2FVR A;  2VUG A;  2OJ3 A;  2YNF A;  5H1S V;  5THW A;  4LT6 A;  3R7S B;  1JNR B;  4WCE Q;  1U1N A;  4LFC J;  6FDR A;  3H0P A;  4U7U K;  1QSS A;  2V2V A;  3PFE A;  3D3B J;  4I67 A;  4P6Q A;  3IN5 A;  2Q43 A;  2RNE A;  1X4G A;  3UWT A;  3QJL A;  4DUZ J;  2RS2 A;  4IFV B;  1URN A;  2QSW A;  3RYL A;  1XNQ J;  1IKX A;  2DK2 A;  4A8F A;  3FZB A;  3TJ9 A;  3IBC B;  1KBR A;  5ETQ A;  1UJ6 A;  2ALY B;  4JI8 J;  4QWA A;  3OSP A;  3O44 A;  2CFX A;  1GX6 A;  1RK8 A;  1TL7 B;  3PKY A;  3RAX A;  4CYU B;  3IS9 B;  3EXC X;  9ATC B;  3P49 B;  3P5T L;  1RBO B;  2DYA A;  2E1M C;  2GJF A;  4TYB A;  3CJ0 A;  3EGV A;  3JB9 k;  3CSK A;  3Q86 A;  4IG3 A;  1NZ8 A;  1U1K A;  2CQ3 A;  2P8I A;  3C6U B;  3DU5 A;  2IY5 B;  2VG5 B;  2OFG X;  2NPF A;  1T0T V;  3J7Y U;  4FXD A;  4X4S A;  3FUY A;  4PQU A;  2GVZ B;  4DV1 J;  3HHL A;  1KS2 A;  5HMY A;  4ZPD A;  3W9H A;  5F0W A;  4Z7Y A;  3WHI A;  3NGS A;  4ED3 A;  2MLX A;  5F8J A;  4LBI A;  3DXB A;  3OSN A;  5KG2 A;  2DR8 A;  4M5K A;  1T03 A;  2RIL A;  4K5S A;  3J81 U;  4F4W A;  2GV1 A;  3TZX A;  3OR1 B;  1R0A B;  2KN4 A;  2XMT A;  1U6B A;  3NP5 A;  2ILZ A;  4CRJ A;  4DXL A;  4YHH F;  4QR1 A;  3A8I A;  2CG8 A;  1HAR A;  3MEE B;  2C2K B;  3QRP A;  1TL3 B;  4IQM A;  4TU9 A;  1T9X A;  2IM2 A;  3QSI A;  2YKN B;  4IRC A;  5L1K A;  1DY3 A;  2UUA F;  3BKT A;  1G7C B;  3OUY B;  4FVC A;  3VHQ A;  4JUZ A;  4PG7 A;  5HRO B;  1HR0 J;  1RT4 A;  4OMF G;  3SCJ E;  1PO6 A;  2VQE F;  1ZZN A;  1VQ5 S;  1GEH A;  1FF2 A;  2XGQ A;  4EK2 A;  1T05 A;  1WEL A;  4YFU A;  3HSD A;  4DR7 J;  1OY8 A;  3TX0 A;  2YNG A;  2C42 A;  3G6X A;  4JI3 J;  4L6V 3;  4RUC A;  5KG0 A;  1U2F A;  1S6U A;  5DQI A;  4DSJ A;  2L9W A;  3O5T B;  3KUH A;  3DLG B;  4Y28 C;  1WDD A;  3IG1 B;  3R5C A;  3HVT B;  2NR0 A;  2G0C A;  1Q8I A;  5LXR A;  5J1N A;  3C8Y A;  1FHT A;  4WE1 A;  1UVM A;  2JWN A;  2YX1 A;  2ZBI A;  1H38 A;  1V9O A;  3AOB A;  4DU8 A;  3DN9 A;  1VIO A;  2AYE A;  4OX7 A;  4ZMM A;  4QW9 A;  2L08 A;  2H9Z A;  1CS4 B;  1LWC B;  5KFX A;  2CDQ A;  3T41 A;  5IT9 U;  2CQC A;  3V81 B;  1F2H A;  5CD4 H;  2HBY B;  1SC3 B;  1IBL F;  1JLE B;  2QN6 B;  4KRW A;  1XC9 A;  1NKC A;  2ZBR A;  2RE1 A;  4IO9 Q;  3H40 A;  1SB6 A;  2QMX A;  4FNI A;  4X4O A;  1QVF R;  2XMU A;  3GPA A;  1IKW A;  5KFZ A;  3NGR A;  3LGM A;  2JHE A;  4FPR A;  3DOL B;  2P6S A;  5DRK A;  4QW8 A;  3NCP A;  2EBG A;  4ZCK A;  4O3N A;  2JZ5 A;  3THV A;  2OGU A;  3LW5 C;  1N5S A;  4JBC A;  1F3V A;  1G4C A;  4DQI A;  3NGK A;  2JFK A;  2R7V A;  2DBB A;  5ITH A;  3V4M A;  4A8Y A;  4AQY F;  1NK8 A;  4FP9 A;  1KFD A;  3M2U A;  4NZ6 A;  3QIP A;  1MU2 A;  2EWH A;  3MMC A;  2HBR B;  3HHL C;  3A1Y G;  3DU6 A;  3MED A;  2W7P A;  3M8Q B;  2Z8Q A;  1MN7 A;  4C97 A;  5KFY A;  4RUB A;  4OLP A;  1V3R A;  4DJB A;  1HNX J;  3IMQ J;  3X1L B;  2DNN A;  3C2P A;  1ITP A;  3T3F A;  1NKE A;  1DTQ B;  2NXJ A;  1FX4 A;  3KHG A;  1JKH A;  2W2P P;  1A9N B;  1RUS A;  2RSQ A;  2GO9 A;  3VQT A;  3B6B A;  4K2J A;  4CO3 A;  3TJ8 A;  4U6P A;  1UVL A;  3MEC B;  2QYC A;  3TYT A;  1VQM S;  2MZQ A;  4ED6 A;  3IWL A;  1TK0 A;  4AE5 A;  3FCV A;  4H4O B;  4LF1 A;  4ZVS B;  1VBX A;  3PY8 A;  3PFO A;  1HNZ J;  2HND A;  3KLV A;  4OHV A;  3WQP A;  4J9U E;  2R4F A;  3I9Z A;  4E98 A;  4DN9 A;  1UL3 A;  3D3C J;  2YNF B;  3TAN A;  5LMU F;  2BE7 D;  2IYI A;  1C4C A;  2AWZ A;  4ICL A;  2JSX A;  2FJE B;  1F9E B;  1N32 F;  1Y5I B;  1UFW A;  3W61 A;  2DR9 A;  2ZBC A;  4URQ U;  3ET6 A;  3D6M B;  3PXG a;  3K59 A;  1IKX B;  1W26 A;  1U8S A;  5KG4 A;  5DDO C;  1WKL A;  1ICE B;  2UZA A;  3ADA C;  3RBZ A;  4D3G A;  3K57 A;  1T8E A;  3GB0 A;  3M1V A;  2Z4P A;  4V19 J;  1N36 J;  4M95 A;  2DY9 A;  4ECX A;  2YWK A;  3J80 U;  5GAE U;  1FKP A;  3R7N B;  4J9N A;  1YSJ A;  4NEY A;  3L95 X;  4I7F B;  4IG3 B;  4ID5 A;  4MFB B;  2M70 A;  5HO4 A;  1D9A A;  3EJM A;  2D41 A;  3PW5 A;  1SIW B;  1R43 A;  1NPP A;  1RE1 B;  3BV8 A;  4LR7 A;  5FDL A;  1GMV A;  4JV5 J;  4EBC A;  3MM9 A;  4ZCL A;  2D69 A;  1R6Y A;  4CO5 A;  2MQQ A;  1H3D A;  4UOF A;  1LEO A;  1J5O A;  3VV2 B;  2HLU A;  1T9W A;  4DV5 F;  5IC6 B;  1JLC A;  4J9K A;  2DNO A;  3H4B A;  2FLL A;  4C0H A;  2E5J A;  4J9P A;  4ID8 A;  2PMW A;  4YS2 A;  5GAH I;  3THP A;  4KR0 B;  5F9N A;  4X84 A;  4C4W A;  1B70 B;  4LVO P;  2UP1 A;  5AXM A;  4OZ5 A;  2P9G A;  1PIE A;  4U9R A;  1VC5 A;  1CJT A;  4LF7 J;  2F8M A;  4F3M A;  2Q79 A;  3KUG A;  3R5B A;  1MG7 A;  3GG0 A;  4F4Z A;  2CKW A;  3O6Q A;  1B0P A;  2BYC A;  3H98 A;  5A2Q Y;  1M1K T;  3ZZR A;  2HGM A;  3SQG A;  4DBQ A;  1EAY C;  4NCB A;  5HAN A;  5D4N A;  5JVG Q;  2OFH X;  5ETS A;  1RT4 B;  4CLP A;  3BH7 B;  3K5L A;  1XR6 A;  3RU0 A;  3FSY A;  5I42 A;  4DU7 A;  3I0S A;  2M52 A;  4CLF A;  1T05 B;  5L8R C;  1WOO A;  2WVB A;  1UVI A;  5DZ7 A;  2HIY A;  2BAB A;  1U45 A;  1OQ3 A;  1X9W A;  1MMN A;  1XR7 A;  2YNG B;  2JNJ A;  4A8W A;  3OJS A;  4X4T A;  3OFE A;  2HG4 A;  3GON A;  2MGZ A;  4OI2 A;  3RB3 A;  2E66 A;  2DGO A;  5GME A;  3BGF A;  2Z57 B;  3BZQ A;  4WE1 B;  4ZVR B;  3QBC A;  3MPV A;  4UOH A;  4NLX A;  3DOM A;  5LSR A;  3MCO A;  3PJX A;  4HL9 A;  4MH8 A;  1RAE B;  2GIF A;  7FD1 A;  1JLF A;  2KVI A;  3K7R A;  1YLX A;  1I94 J;  3HJF A;  3PJ9 A;  2XCA A;  2ZHO A;  1HBU A;  2ZDO A;  3G2X A;  1H6K X;  2XEX A;  1VCT A;  4CT8 A;  1LWF A;  3W7B A;  5AJ3 F;  1HBO A;  2W4P A;  1RT5 A;  3R5A A;  2K2P A;  1IKW B;  1UZH A;  4MMO A;  4Q7A A;  1FRM A;  2QMU B;  4ED0 A;  4B3R J;  2DHH A;  1NCL A;  2G9O A;  2F7V A;  4NLO A;  1SXL A;  2YQ3 A;  2YH0 A;  3K0J A;  4FPI A;  4Y00 A;  1XNQ F;  3GMG A;  2DNZ A;  2V8V A;  2IM3 A;  2QV6 A;  2Y1I A;  2YPY A;  1V5I B;  4F02 A;  2CQB A;  3V4I A;  4JI8 F;  3WX8 A;  1FJE B;  3M2U B;  2V0N A;  3BBC A;  3QIP B;  4NX9 A;  1MU2 B;  4DG1 A;  3MMC B;  2XHC A;  1GK8 A;  2BA9 A;  1L3T A;  2UUB J;  2XMM A;  2BQU A;  3OXF A;  2VDI A;  2BEF A;  4DZ6 A;  3QWP A;  2FJD B;  3G6E S;  3MED B;  2AGO A;  3KJN B;  1FJG J;  3IBW A;  2AJ0 A;  1FRJ A;  4USI A;  4JV1 A;  1UW4 A;  3CCQ S;  2XS5 A;  2KRR A;  3CJ2 A;  1VGY A;  2MKK A;  3QNW B;  1ELO A;  3BN4 A;  4ZVO B;  1H2V Z;  5SUH A;  4NLT A;  5HJY A;  4ETX A;  4Q0B A;  3OXG A;  2X51 A;  1SQF A;  1HWK A;  2AJ2 A;  2WB1 D;  1RWV B;  4KY3 A;  1JKH B;  2JH3 A;  2ZVI A;  3BBF A;  4DV1 F;  4O3Q A;  1I3O B;  1UJ5 A;  4B3S F;  4K4T A;  4ECS A;  3T1H J;  3MEK A;  3UDC A;  2AJQ A;  1VR6 A;  1RGV A;  3N6N A;  3NXZ A;  2ZHA A;  3AQP A;  3MAA A;  3FBB A;  4RKU C;  3H5Y A;  2P9C A;  5F41 A;  2QLW A;  4M5L A;  2DH9 A;  5L46 A;  4OHX A;  3DHX A;  2G13 A;  4FDF A;  3MAQ A;  4O3O A;  2LQ5 A;  4DZD A;  5LMN F;  2N7C A;  4CTA A;  2HND B;  5EGY A;  3MUV P;  4CQ1 A;  1LXJ A;  1M0S A;  2FY1 A;  4XIU A;  2FHJ A;  1ULR A;  1NB2 A;  2AJ1 A;  2LDI A;  3BPS P;  4EUV A;  2HWT A;  2ZE2 A;  3FQL A;  1HHQ A;  4C6A A;  3DRP A;  4J9V A;  4XAK A;  4WFY A;  4ICL B;  1IKY A;  2W4C A;  1S1V A;  3ITH B;  5T14 A;  4DF4 A;  4LF9 J;  3A8E A;  1TMM A;  3RUB L;  1HR0 F;  4YY3 F;  3BO4 A;  5KT3 A;  2G1H A;  3ET6 B;  3EWG A;  5A6W A;  1OS5 A;  1B7Y B;  3CJ8 A;  1NDK A;  2M88 A;  2E5H A;  4ECZ A;  1L3K A;  4F0M A;  4LFA F;  4ILR A;  3MM8 A;  4O3S A;  4DR7 F;  5D8H B;  1W7W A;  2NZ4 A;  2J9D A;  1I6J A;  4LRF A;  5KG7 A;  2LA4 A;  4KC5 A;  4CP5 A;  3M1V B;  4JI3 F;  1KRP A;  1F2G A;  1H7W A;  2WBR A;  4Y2A A;  4KHP J;  1OSD A;  1KTV A;  2Q6B A;  3NAI A;  5J2P A;  2MKI A;  1REV A;  1FKP B;  5D0E A;  2W2M P;  2V8G A;  4ID5 B;  5F8M A;  1V5V A;  4DL6 A;  3CDA A;  3S7R A;  2A6O A;  4OX9 F;  2FLP A;  3GR0 A;  2KJV A;  2MJN A;  3DFE A;  1QUP A;  3CPW R;  5FDL B;  4Q8F A;  4WYW A;  2DGQ A;  2PMZ D;  3MM9 B;  5BXI A;  1N0U A;  5C2G A;  2NXU A;  2KT2 A;  2JJ4 D;  2JVO A;  1S0N A;  1VRT A;  3HHE A;  1J5O B;  3SSQ A;  1RLC L;  1JLC B;  2OML A;  2Y0B B;  4J90 A;  1HMV A;  4J5O A;  3D66 A;  1U1M A;  2ALZ A;  4RW8 A;  1ZAW A;  3SFU A;  4DV3 F;  3IM9 A;  2DJW A;  5JUM A;  4TNO A;  2ZVS A;  1U7L A;  1WUU A;  2F4F A;  4CDI A;  4F2R A;  2ZDP A;  2HS0 A;  3UDV A;  2DB1 A;  1CJT B;  1RLD A;  2DR7 A;  2DTJ A;  2VA3 A;  4I56 A;  4LRB A;  4CT9 A;  2AIR B;  3IXQ A;  3LGH A;  3IP0 A;  4DV0 J;  2VFR A;  1S0O A;  3EPG A;  2AJF E;  3TAP A;  1VQ7 S;  1IJE B;  5LSL A;  3SQG B;  1HBN A;  1UEK A;  1EB0 A;  1LFP A;  2BAN A;  1TL5 A;  3RGI A;  2G4B A;  2UUC J;  5E33 A;  2V69 A;  5I42 B;  5IV3 A;  3MPW A;  3I0S B;  2I38 A;  2XY6 A;  1HIY A;  1HNX F;  3KMS A;  4UW2 A;  3BGR A;  2C22 A;  2NUH A;  3D4J A;  1YJR A;  3PR4 A;  3EDR B;  1WAC A;  1PIL A;  3DHW C;  3OL9 A;  1JLB A;  2OPP A;  3IC1 A;  4E2F B;  3OT9 A;  2QLX A;  3VAH A;  2MGZ B;  1RT2 B;  3VGV A;  1C0T A;  4P2M A;  4N41 A;  2FVC A;  1PAU B;  5CHC B;  1X5T A;  4TYA A;  1NJI T;  2DPI A;  3GIM A;  2R8I A;  1SI9 A;  3QLH A;  1H2U X;  1S49 A;  2HFU A;  3DOM B;  3FMB A;  2OAU A;  4M8L A;  5I3U A;  1P6T A;  2GHP A;  2X7I A;  1HNZ F;  3CCE S;  3PYF A;  3BGO P;  3D67 A;  1JLF B;  1DFD A;  2B4U A;  2V4R A;  1HL6 A;  4YR3 A;  3MUT P;  3KK3 A;  2ZH5 A;  1HBU B;  2AMC B;  3CMQ A;  3EIC A;  2PSZ A;  2E5L J;  2EBE A;  1LWF B;  2KFN A;  3BGL A;  2HQD A;  1HBO B;  1XMO J;  2R7U A;  4JI4 F;  3FGV A;  3CD6 S;  1F5C A;  4FZV A;  4KFB A;  3E2E A;  2B9Y A;  3W63 A;  1XER A;  1RTD A;  2P6T A;  1JIH A;  1FRI A;  4NZ0 A;  2X1A A;  1S1X A;  2AV5 A;  1U09 A;  3CD5 A;  3GFH A;  5GAG U;  3V4I B;  1DLO A;  2OEM A;  2VQF F;  4W90 B;  1NSK L;  4ZHR B;  4DG1 B;  2OPQ A;  3PO4 A;  3N4W A;  3K2Y A;  4K5R A;  5EWF A;  4X64 J;  1W2I A;  1TUV A;  2AX0 A;  1GQE A;  3MI7 X;  1HYS A;  4CH1 A;  2JC0 A;  2AEF A;  3QJJ A;  1NEE A;  4UY8 5;  1UWB A;  3RRH A;  3KJV A;  3QGI A;  1M5V C;  1FTC A;  4ENO A;  1REG X;  1Y5L B;  3R5D A;  4N76 A;  4EWT A;  4JV5 F;  1X4C A;  5G4D A;  4DI6 A;  4B9N A;  5CYJ A;  4P7V A;  3KLE A;  4A8O A;  5F8I A;  4YME A;  1RAO A;  5A76 A;  2FGC A;  1YJ7 A;  3MAA B;  2FHM A;  1RKJ A;  3L7P A;  4MJK A;  3US5 A;  1Q7Y T;  5ETP A;  1WEX A;  4CTA B;  4FF1 A;  2HK2 A;  4PCQ A;  4KQZ A;  4NYO A;  4LF7 F;  4F0H A;  1QTN B;  4J91 A;  4KB7 A;  2P2C B;  2E9Z A;  3ZTR A;  2ZE2 B;  3QGH A;  3DRP B;  3G87 A;  2V8P A;  3TAM A;  2MXY A;  2PFD A;  3D68 A;  1IKY B;  1PG5 B;  2DIV A;  4BWJ A;  1S1V B;  1HD0 A;  1RB0 A;  2M5Y A;  3ZZO A;  4O23 A;  1OO0 B;  2VG7 A;  4QPX A;  3G8T A;  2F3J A;  3CO9 A;  2Y3Y A;  3I0R A;  3W3S A;  1CBK A;  1HW9 A;  3F44 A;  3LP2 B;  2CJK A;  5BYQ A;  3VQS A;  5KT4 A;  3QRQ A;  3HT3 A;  4LJM A;  3MM8 B;  3FKB A;  3H4D A;  2CWK A;  3OD2 A;  1HQ2 A;  3CJR A;  1FXL A;  1C0U A;  2F40 A;  5KFL A;  4LF6 J;  1APS A;  3HVA A;  2I1R A;  4WZM A;  2RU9 A;  1REV B;  5J2P B;  1VBK A;  4RW4 A;  3NNH A;  1ZA1 B;  2E7W A;  1TQL A;  2RUS A;  1NJW A;  1WC1 A;  3MM5 A;  3MCN A;  3KHR A;  4PXD A;  1NDL A;  4EFA C;  2L48 A;  3DRX A;  2EFP A;  2NSC A;  2FVS A;  4JI1 J;  2OD4 A;  4WKY A;  3R2D J;  4ZKA A;  1N5Y A;  3N01 A;  3MM6 A;  5ETR A;  1I94 F;  3WZ0 A;  1VRT B;  4OYW A;  2QX0 A;  3CCL S;  2CJX B;  3GFZ A;  3H5U A;  3W9I A;  1HMV B;  2CNK B;  3IGV A;  4RW8 B;  3KTQ A;  4WFN Q;  2PDA A;  4CO4 A;  1P1L A;  3BRE A;  4UZB A;  1NHK L;  1KQK A;  1EJ7 L;  4ES2 A;  1HW8 A;  4B3R F;  3FQK A;  3U1L A;  1NME B;  2B0G A;  3MD1 A;  3R6G B;  1QAJ A;  2HGL A;  1WC0 A;  2XI3 A;  4FYX B;  4QIF A;  4GO7 X;  3POT A;  1HWL A;  2OMO A;  3LWM A;  5J2M A;  4BBY A;  3NBP A;  1HBN B;  4A8K A;  1RT3 A;  1RI7 A;  3UFC X;  2LEA A;  3D28 A;  2Z0G A;  1KFS A;  2BAN B;  3TAQ A;  2N3L A;  1FJG F;  4WFZ A;  4LFB J;  1XTZ A;  1YI2 S;  2ERR A;  4AUK A;  2Q66 A;  1OSC A;  1ZZF A;  3UNG C;  1FVS A;  3OTB A;  5A8R A;  4L76 A;  3BGR B;  3GQC A;  3TQE A;  3MFI A;  2OEK A;  1VHF A;  1TAU A;  2RD5 C;  3R8Y A;  1JLB B;  4M5M A;  2OPP B;  1EIY B;  3H5S A;  2XMJ A;  3TA1 A;  4LF2 A;  3CD0 A;  2ZH3 A;  1C0T B;  1TKZ A;  3T1H F;  1TK8 A;  2VBW A;  1Y3J A;  5L1I A;  1WC6 A;  1FNO A;  3ILI A;  2DVI A;  1Y4Z B;  1FNM A;  4HVZ A;  2R3V A;  3G8S A;  3QLH B;  3MR2 A;  3UDE A;  3J7Z T;  4LRA A;  2H65 B;  2KB2 A;  3WIU A;  3Q23 A;  1FX2 A;  1S57 A;  5I3U B;  3H5X A;  4B3T J;  3VAL A;  1RT6 A;  3CO0 P;  5CCL A;  2XHW A;  3P4U B;  4IR1 A;  1RBL A;  3EGW B;  2RJZ A;  2CVE A;  3I4H X;  2MZS A;  2R7Q A;  3KK3 B;  2DGT A;  3MR3 A;  2VIH A;  1R8B A;  2YQ1 A;  3HDS A;  2DNG A;  4OV6 A;  1PKU A;  2V68 A;  2AW0 A;  2B8P A;  2BV3 A;  1IR2 A;  3EVM A;  4LF9 F;  2VG6 A;  1F0X A;  4WXO A;  1RWM B;  1UVJ A;  4V19 X;  4F0K A;  4NLY A;  1N54 B;  1Q8B A;  1RTD B;  1WOP A;  5K20 B;  4YP3 A;  5D6G A;  1S1X B;  4BHQ A;  2CAD A;  3PRD A;  4F04 B;  1NBE B;  1DLO B;  2GML A;  3Q8V A;  2XYP B;  2KG0 A;  3KHL A;  2DXE A;  2OPQ B;  2MKC A;  1LKZ A;  3Q8U A;  2FJW A;  3DLK A;  4L75 A;  2OPR A;  4KHP F;  3CJS A;  1S1T A;  1HYS B;  1UEV A;  2CPY A;  4NYP A;  2QEX S;  5RUB A;  2QA1 A;  2HFV A;  1UWB B;  4I68 A;  3MCS A;  4LSN A;  3LP0 A;  1UA0 A;  1RWO B;  3BH6 B;  3KJV B;  3KLH A;  3ZTS A;  3AA8 A;  2FLN A;  2M9K A;  1WC4 A;  4I6A A;  4ZPT R;  4WZQ A;  2J9C A;  2RHQ B;  3UN3 A;  1LXN A;  3MD3 A;  5E41 A;  3BM7 A;  4ECU A;  2HQG A;  4N8O A;  4IRK A;  1CJV A;  4P52 A;  3KLE B;  4C8K A;  4OYB A;  3VCD A;  4DV2 J;  2GAG C;  4F8R A;  2C2O B;  3TO8 A;  2BX6 A;  1TZ0 A;  2DRD A;  3TZZ A;  4IRD A;  3R5G A;  1KD1 T;  3ILO A;  5MAO A;  4KGM A;  4R25 A;  5IM0 A;  5CAB A;  4LSL A;  2V9W A;  2HQI A;  2YWG A;  1C1C A;  1VQK S;  2D9P A;  3S8S A;  3GWC A;  5SZT A;  1KQS R;  3LUY A;  3PYE A;  4H4M B;  3T1Y J;  3AOC A;  1VIS A;  4YUD A;  1RWX B;  1PYT A;  2CUY A;  4DV0 F;  2GQC A;  2CQ2 A;  4JOU A;  2AX1 A;  3TAM B;  4EO6 A;  2AYM A;  5KT7 A;  3NOG A;  1Y3K A;  4EYI B;  2LXI A;  3CJT A;  1WJ9 A;  1OY9 A;  3AA9 A;  3RAQ A;  2GAH C;  2VG7 B;  1WG1 A;  4OHW A;  4OYZ A;  2E9T A;  1V3S A;  1BXN A;  1K1Q A;  1RHJ B;  2B9W A;  5IWA J;  3C19 A;  3M8Z A;  3I0R B;  2UUC F;  1F1B B;  1X4E A;  1AXQ A;  4Q45 A;  5FLX U;  3BSC A;  3M6U A;  2YX4 A;  1D09 B;  3OL7 A;  1EQ0 A;  1C0U B;  3JQM A;  4ZK7 M;  4NXM F;  3IA0 A;  1NH7 A;  1DAX A;  3NS6 A;  7FDR A;  3N79 A;  2QFJ A;  4RW4 B;  1YBA A;  3TP2 A;  2O67 A;  5BR8 J;  4JI6 J;  3MM5 B;  2VFS A;  2J7K A;  1TKX A;  3W65 A;  2OEJ A;  2LA6 A;  4DUY F;  1CC8 A;  4DLE A;  1VS3 A;  4U67 Q;  1EQM A;  4FYV B;  1TUG B;  1LFW A;  4B08 A;  6AT1 B;  1N5Y B;  3MM6 B;  3T5J A;  3GJR B;  5IT4 A;  3SFG A;  2M3D A;  1UTA A;  4GRS A;  2AEM A;  2V4Q A;  1LK7 A;  2HRU A;  1S10 A;  2E5L F;  4KPC A;  3MEG A;  1XMO F;  4PUO B;  3DRR A;  1H7X A;  2BRL A;  2CXE A;  2Z2Z A;  4MKA A;  4C0O C;  1D8Y A;  3LOU A;  3CGI A;  2J0W A;  2D74 B;  1ZOT A;  2ROG A;  1NK4 A;  2KT3 A;  4HDH A;  4ZLN A;  1YJW S;  3SDE A;  2WTF A;  5DZ6 A;  1FDN A;  2EK6 A;  2XLI A;  3DM2 A;  1LW0 A;  3POT B;  2QMW A;  2YWE A;  5J2M B;  3DYA A;  3NBP B;  1HHT P;  1PJ7 A;  1RT3 B;  1I1G A;  1WC5 A;  3D1H A;  3ZTO A;  2LQJ A;  5D4L A;  4YHH J;  2IPO B;  4FF2 A;  3GZ7 A;  4O0N A;  4Q8E A;  4TVA B;  3SMZ A;  2QG9 B;  2J9D E;  4M5J A;  4P2X A;  2FC8 A;  2HVI A;  3Q24 A;  5A8R B;  3RW6 A;  5DGA A;  4X2B A;  3RJM B;  4TN2 A;  1JNZ B;  3VGU A;  2VJV A;  3MPY A;  1NO8 A;  4O4R A;  4N7T A;  4N47 A;  2MTL A;  5L1L A;  2AF6 A;  1TKZ B;  3VTI A;  1YJT A;  4CLZ A;  2ASD A;  3SBM A;  1BY9 A;  3HM9 A;  2Z30 B;  2XB2 D;  4NLG A;  1SQG A;  2R8H A;  1S5Z A;  2L9N A;  5B0B A;  4KKO A;  2MYF A;  4HHH A;  4U8Y A;  4NZ7 A;  3BSN A;  2W25 A;  1RT6 B;  4UF4 A;  3OVA A;  1CQM A;  2W7A A;  3AJ2 A;  2DXD A;  2JRS A;  5D15 A;  2DGS A;  2MKS A;  1NB7 A;  3PAC A;  2BQR A;  3V6D A;  2UVR A;  2FPH X;  1U6Z A;  4DV6 F;  1JLG A;  1JXE A;  2V5H G;  5LSO A;  1U1L A;  3FEX B;  5KFG A;  3OFG A;  5CCM A;  4C98 A;  4EYH B;  2JEI A;  4DQQ A;  1VK8 A;  3UN2 A;  4JI0 J;  5F8L A;  2VG6 B;  2HNZ A;  3Q8P B;  3N5B A;  2BRK A;  1IQT A;  2X1G A;  3FNN A;  1RU1 A;  1M5O C;  3CMA S;  5J1E A;  1MLA A;  2ZC3 A;  3UN5 A;  1VQL S;  2CQD A;  2RVJ A;  2L41 A;  1OPI A;  3CCJ S;  1E6Y A;  2ROE A;  2ZIT A;  3DLK B;  3CD7 A;  3Q8S B;  2HQC A;  4LF6 F;  1GX5 A;  2OPR B;  2IYG A;  4E8U A;  1TV6 A;  1S1T B;  3CCU S;  4F2S A;  1A0O B;  4XPE A;  3T5H A;  3JQK A;  3LAL A;  1UP1 A;  4LSN B;  3LP0 B;  3GSD A;  4YDX A;  3KLH B;  2WSC C;  2GMJ A;  3AD9 C;  3P5B P;  1S0M A;  1WKK A;  2Y9H A;  1FD8 A;  1IXK A;  4JI7 J;  1TL7 A;  4A8M P;  3GFX A;  4QR0 A;  2FDN A;  3IS9 A;  3KK1 A;  4JI1 F;  3C16 A;  1CJV B;  4CH7 A;  1M1G A;  2C3Y A;  2K1R A;  2HVZ A;  3A3O B;  3UCG A;  2UXD J;  1UVK A;  4NRT A;  2ZH6 A;  3UNY A;  3VF0 B;  3SEO A;  3NY0 A;  3HX9 A;  5D0G A;  1X60 A;  5IM0 B;  4K8R A;  2APO A;  2IJR A;  3HXM A;  2HQ3 A;  4KYZ A;  2LXF A;  5F3Z A;  3P6Y C;  4B17 A;  3T5L A;  1C1C B;  3DGP A;  2B5J A;  2HVE A;  4ZA1 A;  4DR6 J;  4I6W A;  2HGN A;  1GXT A;  2A18 A;  3D1Q A;  1DTT A;  2BJD A;  1T3N A;  1U24 A;  3HD1 A;  1FJC A;  5D4O A;  2LEP A;  2YBV A;  4OJH A;  3ZO7 A;  2C1E B;  2E7V A;  3AD8 C;  4Q2M A;  2W8L A;  3J81 j;  1GH8 A;  8RUC A;  4NLV A;  1SQE A;  2KZM A;  2FJA B;  4RW6 A;  2ZNY A;  4USJ C;  3R5J B;  3M7V A;  4MK7 A;  5B0F A;  1NHU A;  4LFB F;  2MQ8 A;  2IC3 A;  4TKT A;  4RZR A;  1GXL A;  4MTP A;  2YKN A;  3NKY A;  1VC0 A;  2HSE B;  2J5A A;  1S1W A;  2CRL A;  1O5J A;  3PJW A;  3QAT A;  5LOQ A;  3GJS B;  2PN6 A;  1Q5Y A;  1WC3 A;  4YDD B;  3M32 B;  1FE0 A;  2KRB A;  1KN6 A;  1S6O A;  4QOT A;  2V67 A;  4J9R A;  5KFW A;  3KWM A;  2LQB A;  1NPR A;  2JEF A;  1J2V A;  1YTY A;  4DUT A;  2VBY A;  4WPA A;  4F67 A;  2GW8 A;  3I9V 9;  2GQQ A;  5DM7 Q;  5IOL A;  2WSE C;  2W7O A;  2FD2 A;  3EDQ B;  4EU0 A;  4U8V A;  3CJK A;  3KK2 A;  3E01 A;  2AU0 A;  2DNH A;  2QLB B;  5ETN A;  3VAM A;  1WF0 A;  2QA4 S;  1U25 A;  2MY7 A;  4FBT A;  3CF5 Q;  1RSC A;  1FJ7 A;  3W2W A;  2EG1 A;  2N4C A;  4N5S A;  4FYD A;  4AL5 A;  1T94 A;  3K5P A;  2RQC A;  4EGL A;  4C0B A;  2DEJ A;  5ETL A;  2YWF A;  1Y9O A;  4ZJL A;  2MB0 B;  2EFV A;  3MEG B;  4K59 A;  3LAN A;  1RTZ A;  4ELT A;  3DRR B;  2B51 A;  2MZJ A;  1R8H A;  4CLY A;  2ZH7 A;  4L3N A;  4X4V A;  4O3P A;  2G2O A;  4B9U A;  4OIX A;  4IH6 A;  1VK3 A;  4WBF A;  4QYR A;  4DV5 J;  5HN0 A;  1X4B A;  1J5E F;  4R5P A;  3OFH A;  5DG8 A;  1N88 A;  3SDE B;  3M9O B;  5HQ8 A;  3NMA A;  4CLL A;  4GC7 A;  4LF5 F;  5D3G B;  3DM2 B;  1GXU A;  1LW0 B;  3I5B A;  2FZG B;  3DYA B;  1FD2 A;  3EX7 B;  3KG1 A;  1N33 J;  3RB4 A;  4WP8 A;  1BMQ B;  2IIH A;  3D6T B;  5CXT A;  1K0V A;  3VR1 A;  4KH0 B;  2M7S A;  5IC4 B;  2ADB A;  1JLA A;  1WI8 A;  1VQS A;  2BW7 A;  1NHV A;  3RBD A;  3S6E A;  1JB0 C;  5KG3 A;  2QT7 A;  2B7B B;  1Q16 B;  2QA2 A;  4Y34 A;  2E1R A;  3HK2 A;  1FFG B;  1WD6 A;  2C2N A;  2DGU A;  4DX7 A;  1FRL A;  2CZ4 A;  3G4S S;  2ZH8 A;  3ISN D;  3MGJ A;  2XBP A;  2XMW A;  4EO8 A;  2H54 B;  1M5K C;  2R7T A;  5L1J A;  2KM8 C;  4TXS A;  2NYI A;  1JJH A;  3JS9 A;  4JB8 B;  2GIR A;  2FUG 9;  3FZ2 A;  1IM4 A;  3KFW X;  4DV2 F;  1R0C B;  3IR5 B;  3MMB A;  1URR A;  3CJ3 A;  2K7K A;  2VPX B;  5E0O A;  3QFH A;  1XEZ A;  2DO4 A;  3HO1 A;  4KKO B;  3Q83 A;  3MZI A;  3GJT B;  2B9X A;  3M30 A;  3GCX P;  2E44 A;  3L7O A;  3V6J A;  2IRU A;  1ZM4 A;  2A3J A;  1T9V A;  2CNL B;  4DF8 A;  1SVD A;  3V6D B;  2PI4 A;  5F9L A;  1QVG R;  2HZC A;  4QWE A;  3P3D A;  2XWX A;  1JLG B;  3IR7 B;  4M5H A;  3BQ1 A;  3VAG A;  2B3T B;  3TUZ C;  3FDS A;  4A48 A;  1U1R A;  1EKR A;  2JLE A;  3C15 A;  2MKY A;  2HNZ B;  4XO0 A;  4FF3 A;  2HLT A;  3N5F A;  4UTG A;  2JEG A;  5IWA F;  2FHO B;  2HWI A;  3TAR A;  5DET A;  1SJ1 A;  2ZBP A;  3A4T A;  4A4J A;  5KFA A;  2NSB A;  3DLH A;  5J1E B;  2QYG A;  2ZC4 A;  1Z2Z A;  5AJ3 J;  2M8D B;  2D3O 1;  3K8W A;  2XMK A;  4G6V B;  4YB6 A;  3TVK A;  4LF4 J;  4F25 A;  1E6Y B;  1LQ9 A;  2DEI A;  2HBQ B;  1YWX A;  4H4K C;  3KDO A;  3QGP A;  3ETO A;  1TFW A;  3CJ4 A;  1NK0 A;  1H2T Z;  3H8Y A;  3K5M A;  1TV6 B;  4F26 A;  4ZCI A;  2KJW A;  3K5O A;  1UAW A;  2A1B A;  1D8Z A;  2EFN A;  1T02 A;  5KFD A;  2LLZ A;  1U26 A;  4WTY A;  5BR8 F;  4JI6 F;  3MM7 B;  2LCW A;  3FK4 A;  3EE3 A;  1VC6 A;  3HFV A;  1ARO P;  4HI2 A;  3MMA A;  4USV A;  4LBH A;  1YJU A;  4DHV A;  3KK1 B;  1R8P A;  5KFR A;  3WX4 A;  3EXY A;  3C16 B;  2J6U A;  3VWS A;  5IV4 A;  2K1R B;  4Y65 A;  4C3K A;  4NLP A;  1MML A;  4OHZ A;  3HHL D;  4TY9 A;  2WZ1 A;  4XDD A;  1K8A T;  3ETM A;  3CWJ A;  4F4X A;  4I7F A;  2NZC A;  4MFB A;  5I4M A;  4NMX A;  2AGQ A;  5A8W A;  3MAH A;  3HSZ A;  2KT5 A;  3C3L A;  1P9Q C;  4E0D A;  2NRE A;  1TKT A;  2HHQ A;  4WIQ A;  3MDF A;  3OXL A;  1X9S A;  2WHO A;  1U2R A;  4RWX A;  5EDW A;  3DGP B;  4B3S J;  4QWB A;  2B5J B;  4TLR A;  2KM8 B;  5B0E A;  2YY3 A;  1RT1 A;  1DTT B;  4XK8 C;  1X9M A;  3QRR A;  2CPD A;  3QT6 A;  2IVY A;  2B6A A;  1YBU A;  2A0F B;  1J27 A;  1HHS A;  2IHR 1;  4B9L A;  5AE3 A;  2ASY A;  3BYR A;  4M1K A;  3T5K A;  3W5Z A;  3AAW B;  2XG8 A;  5LMN J;  4WFX A;  4RW6 B;  4A47 A;  1WDT A;  1KTQ A;  2EFG A;  4RW7 A;  5I3Q A;  1HQU A;  4HTI A;  1Y11 A;  1U6F A;  4KBI A;  1FWP A;  2IC3 B;  3MOZ A;  1N48 A;  1Q95 G;  1S97 A;  1S99 A;  1VJW A;  2R2R A;  3OQ2 A;  2HBZ B;  4FYW B;  3CME S;  4L3K A;  1N6Q A;  1S1W B;  2CQ4 A;  4QWD A;  1QAI A;  1JJ4 A;  1AFI A;  3NS5 A;  8AT1 B;  3TRG A;  4BC9 A;  3PZP A;  2ZH9 A;  3AFG A;  4NLQ A;  1FCA A;  3QGG A;  4TLQ A;  1AT1 B;  4Y0F A;  2HHV A;  4MIB A;  4YY3 J;  2EFQ A;  5AXL A;  3OFF A;  4DR1 J;  4QYZ J;  1ZAV A;  4A46 A;  1RBA A;  4A8X A;  2DCU B;  4DSI A;  3IWX A;  4PWW A;  2HRT A;  2ZWP A;  3NS7 B;  5GAD I;  1Q0N A;  4WK1 A;  3CCZ A;  4LFA J;  2ZOM A;  1RHK B;  3BO3 A;  4DL4 A;  3CJK B;  3KK2 B;  3E01 B;  2HPU A;  3OVB A;  3PX4 A;  2DIS A;  3HMJ G;  4QQB A;  2R7X A;  1U1P A;  2V2Z A;  2MQN A;  1NND A;  3QMQ A;  3W2W B;  3OL8 A;  3OL6 A;  1YRU A;  2IJN A;  3I4P A;  2DXF A;  3DKD A;  4WP9 A;  3LWL A;  3ENV A;  3I5C A;  2IFX A;  2XY7 A;  3R6L B;  1C1B A;  3UD4 P;  4IYQ A;  4OX9 J;  1BWV A;  4CLW A;  3A3N B;  4CLS A;  2GNK A;  2MQL A;  4JI0 F;  3F73 A;  3FCW A;  4C11 A;  3ELH A;  5B0A A;  5J2N A;  2DGX A;  4PXB A;  1S9F A;  4OJ3 A;  3IAS 9;  3BDP A;  1U0H A;  2MLZ A;  2RB7 A;  4UQG A;  1W25 A;  4P10 A;  3HLU A;  4KHM A;  3U1M A;  4R5P B;  5B08 A;  3GV7 B;  5KFF A;  3GYN A;  1IKV A;  2ZOG A;  2QRR A;  2VD3 A;  4DV3 J;  3HFK A;  1KWM A;  2Y0S D;  1NAQ A;  4ZVE A;  1OIA A;  4OYX A;  1GT8 A;  3HVR A;  1RAI B;  3H20 A;  2AD9 A;  4ANE A;  1SC6 A;  1JLA B;  3FJ2 A;  3GIL A;  4NI2 A;  3G86 A;  3HP6 A;  5B7W A;  2LP4 A;  1K73 T;  6FD1 A;  1RKI A;  2CPJ A;  3PO5 A;  2ILY A;  5IXU A;  3JAM Y;  1MWQ A;  1IVZ A;  4JI7 F;  1QUV A;  4YN3 B;  3J7A N;  2VKZ G;  4EBD A;  1MWZ A;  1IN0 A;  4RNM A;  1UKU A;  3IO1 A;  4QJV A;  2WVD A;  3I82 A;  3THT A;  1NSA A;  2YX7 A;  4RJV A;  2AKW B;  2E9R X;  5KFN A;  4LR9 A;  5B0D A;  2BM0 A;  3MMB B;  2MQP A;  4LVN P;  1HA1 A;  2UXD F;  4DFK A;  3CUL A;  4KGZ B;  1TP7 A;  1YBT A;  1UET A;  4KJI A;  4IR9 A;  4BLG A;  3PKM A;  4NPO A;  3OV7 A;  4RU9 A;  2BR0 A;  1KVK A;  3PG9 A;  2FJB B;  3M30 B;  4KH1 B;  4DR6 F;  2H3E B;  4P7T A;  1RWN B;  1FFS B;  1NJY A;  4YOE A;  5K8O A;  5KG5 A;  3PDN A;  4W4M A;  4PPZ A;  5K8P A;  5IFM A;  4G3I A;  3EVW A;  5ETM A;  1HWU A;  2HYI B;  4UUX A;  2MHE A;  5DDR C;  2LEC A;  1D0E A;  2QL9 B;  4ZP7 A;  4ZP9 A;  4OI1 A;  3C15 B;  1R8C A;  3OR2 A;  1Y00 A;  4XPC A;  1DQA A;  2HVD A;  2HS4 A;  3ZFV A;  3ZNJ 1;  3RB0 A;  3NCQ A;  3MXH P;  3OTC A;  3PNI A;  2FC9 A;  3HUL A;  2B8Q A;  4USM A;  2WVC A;  3OHB A;  1AFJ A;  1FER A;  5CZV A;  2KZZ A;  4JI4 J;  2RRB A;  3ITH A;  1SH3 A;  1YIJ S;  2FJX A;  3H59 A;  4C8L A;  2KHC A;  4MKY A;  3OTD A;  1N5T A;  2BKP A;  3NNA A;  3AQO A;  2RIJ A;  1D1U A;  1FTR A;  1Q82 T;  3CED A;  3H42 A;  1PYS B;  1RAG B;  2CNO B;  3SV4 A;  5KOW A;  1CUL A;  2EK1 A;  2LEB A;  5F8H A;  1WHV A;  1UEU A;  2HQF A;  5LXY A;  3FEY B;  4ZN3 A;  2VQF J;  3ZZP A;  2CQG A;  1PJ5 A;  3FBC A;  3I55 S;  3MMA B;  3KG0 A;  4RNH A;  1N4L A;  5EN1 A;  4KHR A;  1EHW A;  3HCX A;  5K8M A;  2XZW A;  3I96 A;  4FF4 A;  3OBI A;  4DPW A;  3PR5 B;  1SH0 A;  4F7V A;  4X4N A;  1AZS A;  2ZFH A;  2ZM6 J;  5A8W B;  4EMD A;  3BR8 A;  3PEJ A;  3I31 A;  2PI5 A;  2XYG B;  5A0Y A;  2LVW A;  1VDH A;  4YR0 A;  4RO0 A;  4FKX A;  1SV5 A;  4YB1 P;  1IR1 A;  1RJJ A;  4TY8 B;  1TKT B;  3UD3 P;  1HI0 P;  1S6P A;  1QSL A;  1S0V A;  2AYG A;  4KGV B;  3G9C A;  3TOQ A;  2JC1 A;  3PHT A;  3P45 B;  3BKF A;  1H74 A;  5GAH U;  3ENA A;  3RAM A;  1RT1 B;  3VVT A;  3BF4 A;  3CDU A;  3VAF A;  4ZVT B;  4ZVF A;  3TR5 A;  1TR0 A;  3F0N A;  4ILM A;  5DLF A;  3JYT A;  2E5G A;  3ZZY A;  2B6A B;  3NGT A;  3FFI A;  5LL6 d;  1N33 F;  2IRX A;  1KLN A;  3ZTP A;  2H48 B;  3QFW A;  3TX8 A;  4RW7 B;  3BN7 A;  3T19 A;  4ZLP A;  1HQU B;  3HJV A;  5K5M A;  4ES3 A;  1OWX A;  1UFK A;  4JV2 A;  1N6Q B;  3NAH A;  1LW2 A;  1TAQ A;  1KEK A;  1XR5 A;  4OZ0 A;  2FVQ A;  4PWD A;  1TEL A;  1DQ8 A;  1D9F A;  1X5S A;  2PGC A;  2KH9 A;  2XTJ P;  3W1Y C;  4NXN J;  2NS1 B;  3SYZ A;  3H90 A;  1SJQ A;  1Q81 T;  1RA6 A;  4TQR A;  2DPJ A;  1XN9 A;  4L73 A;  4U95 A;  4OYM A;  3CDW A;  1NK6 A;  1R7I A;  1RT2 A;  1YQH A;  2DNY A;  4DV7 F;  2XQC A;  2VA2 A;  4DFM A;  2CZ9 A;  4PYA A;  1EKS A;  5ETT A;  1SH2 A;  2CPI A;  2DRB A;  2HHU A;  4HH1 A;  1C1B B;  4PWU A;  2EC0 A;  3BR9 A;  2G0J A;  5HMX A;  3PYD A;  1ZH5 A;  3G8Q A;  2KHD A;  1P1T A;  2HVH A;  2GGP B;  2FJV A;  2PC6 A;  2GIQ A;  2UUW A;  1RCO B;  4C11 B;  2UVV A;  2J76 E;  5J2N B;  1NM2 A;  2K06 A;  5MLC V;  3AB4 B;  1U0H B;  3C14 B;  4U96 A;  1FVQ A;  2KTQ A;  3O2I A;  5BYS A;  3G96 A;  3TUP A;  1LWX A;  4DEZ A;  2VB6 A;  4OZ3 A;  3UR3 C;  3UVJ A;  1RAD B;  1WG5 A;  5J2Q A;  1YJV A;  1IKV B;  4FN5 A;  1XWL A;  4LF4 F;  2HHX A;  5E3A A;  3HI9 A;  4C3L A;  3ICL A;  4YEA A;  4DR2 J;  2RHS B;  3OJU A;  4OFZ A;  1HQE A;  2QGF B;  5CYQ B;  4NI2 B;  3W5X A;  3B78 A;  3HZE A;  1S4F A;  4S0M A;  1N34 F;  5AT1 B;  3R27 A;  1Q8L A;  2A6M A;  1O51 A;  4GKK J;  4OZJ A;  3GU0 A;  5HK4 A;  1ZM9 A;  2YKO A;  4ED1 A;  3CVK A;  4ZHR A;  4OI6 A;  4RBT A;  1DUR A;  2L3M A;  3DLB A;  3MMJ A;  5FJ4 A;  2HFO A;  4NLD A;  2KXN B;  4ECT A;  1WHX A;  3KDN A;  3WDO A;  4DSL A;  1T9U A;  5T7L A;  3AHP A;  2HAF A;  1VBZ A;  3MR7 A;  2J8A A;  1RTH A;  1RWK B;  3LGN A;  2ZKU A;  2M8H A;  1FRX A;  3RRG A;  2W24 A;  2BOA A;  4F3Q A;  1FK9 A;  2RS8 A;  2V94 A;  1M5H A;  3K17 A;  2I9S A;  1HPZ A;  1N56 A;  2DH8 A;  2RH3 A;  2BJ9 A;  4HH0 A;  5ETV A;  5CAA A;  2UU9 F;  1G2E A;  1Z4U A;  1I51 B;  3IGN A;  4F4A A;  3PEH A;  1TTH B;  1Q1K A;  2N4D A;  1JWW A;  3N6M A;  3OR2 B;  2VAS A;  4NRU A;  1YIT S;  3QPI A;  1QAY A;  5K14 A;  1QLN A;  4GO5 X;  1GMW A;  4CH0 S;  4OZL A;  4JYA J;  1U1Q A;  4V1A k;  3AXM A;  5M2P A;  2Z2M A;  4ED4 A;  3M2R A;  1CPZ A;  1IBC B;  3H25 A;  3K58 A;  2GC8 A;  4M63 A;  2JEJ A;  5E7O B;  4OJG A;  1VI7 A;  5E2Q A;  2VDH A;  3T6B A;  1KDN A;  1NDP A;  1PGZ A;  4DR1 F;  1O8B A;  1BD6 A;  1CUL B;  5HSP A;  1CEZ A;  3LP2 A;  1BC6 A;  1SKR A;  4LUB A;  4URG A;  5JXS A;  4ZDN A;  1WHW A;  2VBZ A;  1HNV A;  3X3U A;  1ZM3 A;  4NL5 A;  1U8W A;  1QDU B;  4ZPB A;  4AL7 A;  1YZ6 A;  4FKY A;  3WC2 A;  1K47 A;  4UT4 A;  3Q8Y A;  5KTQ A;  4ZVP B;  4K4X A;  1UVN A;  2Y8W A;  4OYI A;  4DL5 A;  1U1O A;  1AZS B;  4CM0 A;  4HI1 A;  4KTQ A;  5G0R A;  3JXO A;  4ED5 A;  5A0Y B;  1SL1 A;  1FRK A;  1SV5 B;  2GX8 A;  3GYG A;  1IBM J;  1S6P B;  4DDF A;  1M5S A;  5H9F J;  1FA0 A;  2DH7 A;  1VQN S;  1MRO A;  4WF9 Q;  4KT0 C;  4DS5 A;  1S7H A;  3HHN B;  1XMQ J;  1VRQ C;  3PW2 A;  3KLF A;  3HHK A;  4C8N A;  3HKW A;  4HR2 A;  3ZXW A;  3V6K A;  2ROP A;  4HLB A;  3JYT B;  2M4M A;  3FCH A;  5C42 A;  1WI6 A;  1BLU A;  3ZNU A;  3FFI B;  1RTJ A;  4EZ9 A;  2EVZ A;  5DQG A;  3KMQ A;  1BWE A;  3QO9 A;  5KFP A;  2WW8 A;  2R7W A;  2PEB A;  1SKW A;  2V4J A;  3RBX A;  2WAQ D;  4MIA A;  5HP1 A;  3L7U A;  2D7S A;  3DC2 A;  2K7J A;  1LW2 B;  2CJ9 A;  2ZUG A;  1IWA A;  1OJ4 A;  2WK4 A;  3QSY B;  2RT3 A;  4PWD B;  3HSJ A;  2HS3 A;  2KYX A;  4NLW A;  3NG8 A;  4X4Q A;  4P2S A;  4U7U D;  2LU2 A;  3QYY A;  2FVP A;  1NK5 A;  1N52 B;  2ZKT A;  3KLG A;  2UVW A;  4YB5 A;  2YH1 A;  1FXR A;  4ZLJ A;  3KNG A;  4QYZ K;  4A8S A;  2V50 A;  5KFJ A;  2Y8Y A;  4QZV B;  5ETK A;  1NH8 A;  4Z37 A;  4B9M A;  5E3P A;  4ELU A;  4X4P A;  2E29 A;  2J0X A;  2VF3 A;  1UPM B;  5L9N A;  4R0J A;  4NXM J;  2HKE A;  2DHS A;  2EG2 A;  3S01 A;  3E8O A;  3J7Y I;  7AT1 B;  2IMO A;  4IO1 A;  4C8M A;  4KV8 A;  2DT9 A;  4ILL A;  1H0H B;  5DDQ C;  4X4U A;  1HFE L;  2DKO B;  2RU3 A;  3O1L A;  3QAU A;  4O4G A;  4DUY J;  1X5O A;  5HVH A;  1PC4 A;  5B0C A;  2R2S A;  1FEE A;  4TQS A;  4MK8 A;  2KYZ A;  1B64 A;  1F6T A;  2SXL A;  2CPE A;  3M8Y A;  3ISN C;  5EHH A;  4B3O A;  1KHW A;  2LYV A;  3UVJ B;  3IRX A;  1S79 A;  1NU4 A;  5J2Q B;  3DI6 A;  3CJ5 A;  3HSG A;  4Z2X A;  3ULH A;  2OI2 A;  2QFI A;  2G1D A;  4OI4 A;  3TVY A;  2O3D A;  3LQV A;  3SCI E;  3N0V A;  1HQE B;  4OYP A;  4GKJ J;  2V8D A;  1SJR A;  2I8E A;  2CYY A;  1EX8 A;  2RQK A;  4OL8 A;  3LTO A;  2WCX A;  4DL0 C;  1ZBT A;  1BHN A;  2W9A A;  4ED7 A;  2N7Y A;  2V8H A;  2R7O A;  3O3L A;  5EUH A;  1RZM A;  3CE8 A;  2NXE A;  1HNI A;  2F9J A;  1TMJ A;  5GMD A;  2KVQ E;  4WKR A;  1O6X A;  2MMY A;  2CQ1 A;  1T9T A;  1KQF B;  1L5U A;  2RF2 A;  5F8N A;  5KFS A;  3SSR A;  4USU A;  2EC2 A;  1TL1 A;  2EXU A;  4OQJ A;  2A10 A;  2XNR A;  4LF8 F;  3QT8 A;  4X66 J;  1RYS A;  5T7L B;  2ZM6 F;  3CCT A;  2XYH B;  2ZOF A;  3IAM 9;  1RTH B;  2Y1L B;  4RX6 A;  5FLX Y;  3TI0 A;  1SJ4 P;  2DHG A;  1FK9 B;  3T6J A;  3AJ1 A;  4J37 A;  2VC0 A;  1YDL A;  5HQL A;  3I32 A;  2OP5 A;  4IOA Q;  1HPZ B;  1E6V A;  3D0I E;  4WJB A;  1WTF A;  1IWG A;  2KI2 A;  2W9B A;  3GTY X;  3PX0 A;  4NAS A;  2AT1 B;  1U4B A;  2DNP A;  2FY8 A;  4HT5 A;  4LMZ A;  1PCA A;  3MR6 A;  5LJ5 Y;  3TWZ A;  1TVR A;  4IOC Q;  1VFJ A;  4CLK A;  5K14 B;  2Z58 B;  2HIQ A;  2MPU A;  2CDR B;  4MAK A;  3JSY A;  4DFJ A;  4H4M A;  1RAH B;  2YWH A;  1AYE A;  4PG6 A;  3K89 A;  4LQ3 A;  4RL1 A;  4DV6 J;  3M2R B;  2QA4 G;  4OLO A;  4RR5 A;  3AD7 C;  1KLM A;  1LNQ A;  3N28 A;  2QO3 A;  5IQ6 A;  3NGU A;  3AH6 A;  4BDP A;  2CWX A;  5HLF A;  2OO4 A;  3KHH A;  3GE9 A;  4NXN F;  2OHD A;  2Z2Y B;  1CJU A;  1JLQ B;  1HD1 A;  3D1O A;  3PTW A;  2FTR A;  4C8Y A;  1MWY A;  4PRF A;  1VJQ A;  3OHA A;  5KG1 A;  1HNV B;  2X1B A;  3PW4 A;  3A12 A;  2D1C A;  3W64 A;  3EUN A;  1Z2L A;  4CNZ A;  1T9Y A;  4LSZ B;  1Q79 A;  2KO1 A;  2OPS A;  1S4E A;  2Z56 B;  2YKP A;  2M2B A;  2BM1 A;  3P8B B;  1YX2 A;  1BQM A;  5G0R B;  4P71 A;  2VH7 A;  3VAJ A;  4ZPC A;  5HI7 A;  1LOU A;  1MW7 A;  4KO0 A;  4DQP A;  3DRS A;  4HHU A;  1EP4 A;  1MRO B;  3VZH A;  1KR4 A;  3DOK A;  2HK3 A;  2LXU A;  1FDB A;  1B7F A;  1VLO A;  3KNA A;  3KLF B;  2RKI A;  1H98 A;  2IJF A;  1S77 D;  5HL7 Q;  1ZA2 B;  2O5D A;  1KON A;  3HZG A;  3DDN A;  1FI4 A;  3EVO A;  4M5I A;  5C42 B;  4PUO A;  3P96 A;  3N6L A;  2VON A;  1RTJ B;  3GIR A;  2HMI A;  2C28 A;  2BMB A;  2POK A;  3Q8R B;  3QO9 B;  4I0W A;  5DQH A;  4PAA A;  4MYU A;  4DR2 F;  3SCK E;  2A2C A;  4UOG A;  1WEY A;  2CAJ A;  2VL1 A;  2H5J B;  2V4J B;  4M5D A;  1X4H A;  4OYO A;  1GTE A;  5HP1 B;  3KG4 A;  4DX6 A;  1X0F A;  3BSO A;  2H1Y A;  2UVU A;  2XGP A;  5LM7 E;  3SI8 A;  4GKK F;  2PII A;  2W2O P;  3LH2 S;  2H4Y B;  1G1X A;  5C7P A;  1SJ3 P;  4NEZ A;  2G2Y A;  4RUH A;  4DR3 F;  4Q5V A;  2JLF A;  2R9L A;  4PZV A;  1MMD A;  2CQI A;  4RNO A;  3B4M A;  4WK3 A;  2I6W A;  1F60 B;  2VFU A;  4EI2 A;  3M9N B;  4DWI A;  4DSK A;  1T3O A;  2CG4 A;  5F3T A;  3KLG B;  5KFQ A;  1M1H A;  4I2Q A;  3A13 A;  3PCO B;  3KOA A;  1PYO B;  5FII A;  5BJR A;  4WU2 A;  1Y7P A;  5GAE I;  1Z1Z A;  4OV1 A;  1RAJ A;  1YRX A;  4PQU B;  4QIW D;  3HHL B;  1RAF B;  3H2L A;  2P9E A;  2XZD B;  1S9E A;  4PEO A;  4FXW A;  1T03 B;  1OQ6 A;  2OTJ S;  4K4Y A;  3T9Z A;  1NDC A;  1OMS A;  1V6H A;  1GMU A;  2ZWO A;  4KV8 B;  4DCJ B;  4I4B A; 
#chains in the Genus database with same CATH homology
 2Z58 B;  3AFG A;  2QTW A;  3BGO P;  2Z2Y B;  2XTJ P;  1SPB P;  2W2M P;  3VHQ A;  3T41 A;  3WHI A;  3A3O B;  3GCW P;  3WIU A;  1R6V A;  2Z30 B;  3A3N B;  3QFH A;  3VV2 B;  3CNQ P;  2E1P A;  2W2Q P;  2Z57 B;  3A3P B;  1SCJ B;  2W2P P;  3GCX P;  3CO0 P;  2ZWO A;  3SQO P;  3H42 A;  2W2O P;  2Z56 B;  2W2N P;  4OV6 A;  3P5B P;  2PMW A;  4YN3 B;  4K8R A;  4JP8 A;  1ITP A;  3BPS P;  3WIV A;  2Z2Z A;  1V5I B;  4NE9 C;  4NMX A;  2ZWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...