3BPSP

Pcsk9:egf-a complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/lipid transport
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Molecular basis for LDL receptor recognition by PCSK9.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2007-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3bpsP01
2W2NP 2Z2YB 3AFGA 2W2OP 3A3NB 4JP8A 3BGOP 4OV6A 2W2QP 2Z58B 3H42A 3A3PB 4NE9C 3T41A 4YN3B 3BPSP 2Z57B 3QFHA 2XTJP 2QTWA 2Z2ZA 2ZWOA 3P5BP 3WHIA 3GCWP 3WIUA 2PMWA 3GCXP 4K8RA 3A3OB 3CO0P 2W2PP 1ITPA 3VV2B 1R6VA 2E1PA 3VHQA 1SCJB 1V5IB 2Z56B 3SQOP 3WIVA 3CNQP 2ZWPA 4NMXA 1SPBP 2Z30B 2W2MP
chains in the Genus database with same CATH superfamily
2A2CA 4J9RA 4TVAB 2OO4A 5I3UA 1OIAA 1IQZA 2EPIA 1FCAA 1B4SA 3WQPA 3QRRA 2JVOA 1RTHA 5LSOA 4DZDA 3GIRA 4XDCA 5HP1B 3I5AA 2XHWA 2KG0A 2B7CB 2IVYA 2J8SA 4ZIWA 2W2PP 1U02A 1KQFB 5IWAJ 2F8EX 1FX2A 2YKMA 3IP0A 1NB2A 1RTJB 2K7KA 1EP4A 1L3SA 1MMNA 4M5LA 2AT1B 1UW4A 4HEA9 2YX4A 1YJ7A 5DQHA 1JB0C 2XSFA 4ZIVA 3GJRB 1VCTA 5EDWA 1T03A 2GA7A 5K8PA 4X66J 2YH1A 3LWMA 2VF3A 1D9AA 4FPRA 4N76A 1A6LA 3EMTA 1Y4ZB 2GHWA 3QGGA 4H4KC 4OYIA 3HVTA 3AOBA 2Z57B 3BQ0A 3ZZUA 4A8WA 2DNKA 5KFSA 2VU5A 2H1YA 4DFMA 2CA9A 4TQRA 4QYRA 3P5TL 2HYIB 3SFUA 2R8GA 4DUZF 2PC6A 4W4MA 4M1KA 2PSZA 4A4JA 4LFBJ 1TKXB 3LA0A 3TVYA 5B0EA 2QFIA 3BPDA 3OL7A 3PW0A 4LSNB 1GX5A 3N4WA 4KQZA 1RAOA 1G3OA 4EZ9A 4ZP6A 2JH3A 2V4QA 2PEHA 1V5VA 2E5LF 4NEZA 4PUOB 2HBYB 3H4DA 3OTEA 2IAJB 4L72B 2AZ1A 5I3UB 3MEKA 1S0OA 3HD2A 4JYAJ 5L1KA 4HI2A 2IMOA 1R0CB 1Z1ZA 2DGQA 1IXKA 3VQTA 3LAMA 4HH0A 1REGX 4O3PA 1RAIB 4OYWA 5E3RA 2AGPA 4WCEQ 3M6VA 1ZBTA 4R0EA 4CLZA 1HNIA 4DL7A 2YKMB 1RT3A 3FMBA 1SJFA 4IFYA 4IRDA 1WHVA 5LSRA 3CJ8A 3JS9A 4J5OA 3PV8A 4Y00A 2ZM6F 3KUHA 2RUSA 2VH7A 3CJ5A 5E5NA 5CCMA 3NAIA 4KJIA 4S0MA 2P6SA 2OD4A 1T03B 4K59A 1JLQA 5G0RA 2AJ2A 2CVEA 2RQ4A 2ADBA 2GJFA 2OTLS 1MNEA 3JB9k 1PSDA 5D3GB 2N7CA 1VBZA 4IH7A 1FTCA 4B3OB 2L3MA 4RUAA 1TMMA 2PO4A 3K89A 4MYUA 2H48B 1TUWA 4P2SA 3I9ZA 4PWUA 1JXLA 4JI1J 3D0IE 2XMMA 2W9BA 2UVUA 2DNLA 4QWBA 2L9DA 1DBDA 1I94F 1U24A 3TA2A 5KOWA 4LT6A 3PYFA 3ULHA 3GIMA 2E1PA 3HD1A 2L08A 1V3RA 2VG6A 4KGKA 1NK6A 3P4UB 4YP3A 5D15A 2GMLA 4JI2J 2BE2A 4CLKA 2G1DA 3QJLA 4ED2A 1D8ZA 3DNCA 4ID5A 4U67Q 1N48A 1YJTA 2XMWA 1H74A 1CJVA 4NA3A 3CCSS 1XNQJ 3GV8B 2LA6A 1FK9A 3KJVB 3MR7A 4YOEA 1U1OA 1R8AA 1WDTA 3QLHA 1OSDA 4LR9A 1X4AA 1U6ZA 2KM8C 1RBAA 2KL8A 3BBBA 4NLTA 2HQFA 2GCFA 1O51A 2CNOB 2WAQD 4C8NA 4FNHA 4QW9A 1DTTB 1LWEA 4ECWA 3RB6A 4QIGA 4UOGA 2CQIA 1KDNA 3UW1A 5KFNA 2DJWA 2QMXA 1M5PC 4URGA 1PCAA 1HNIB 1RT3B 2PMHA 3UD3P 4ZVPB 4OZLA 3I4HX 4ECYA 3OPKA 2E9RX 1S72S 2KN4A 1N5TA 4DU7A 2R7XA 1FX4A 2IJFA 4ZVGA 4JV5J 5T41A 1SJ4P 2OMOA 1T9YA 1JKHB 2HFNA 1YJ9S 3VGVA 5G0RB 1EKRA 4HT7A 3DMJB 2YWFA 1S1UA 5KG1A 3CWJA 2EFGA 4PRFA 3U7JA 3OXGA 4PG6A 3W60A 1FJ7A 1Y9OA 4DR2J 1U49A 5J1EB 3J7AN 2YKQA 1X4BA 2DHHA 2E66A 4Q45A 3VAFA 3U1LA 1XNRF 4ILLA 5KFGA 3NCPA 1NBEB 4OV6A 2W9BB 1XMQF 4Y2CA 1UTAA 3BKFA 1Q0NA 3OL6A 4Y28C 2HZCA 2J6SA 1TUGB 2WTFA 4WYLA 1U1PA 4Q44A 1DURA 2MJNA 3NGTA 2VG6B 2HFSA 3PW7A 2EFPA 3MCOA 1L5UA 2Z4PA 1IKWA 4UOFA 4ZPTR 3IXQA 4X64J 4B9SA 4KB7A 1NRKA 4NLPA 4ID5B 3HSJA 5B08A 1FHTA 1CJVB 1RT2A 4C48A 3IWXA 1FK9B 2BJEA 1LV5A 1EB0A 3OW2R 4JI3J 2HG4A 1WHWA 3P49B 2JZ5A 5K8OA 3T19A 3QZ7A 1PYTA 3RUBL 2JFKA 1FJGJ 3QLHB 2G0CA 4BWJA 1K0VA 4O3OA 3CSKA 3TR5A 2FHJD 2VFVA 4ICLA 2ZUAA 3ZC4A 3I31A 4O23A 2ILZA 5DZ7A 1RA6A 3DLJA 1VQ9S 3M9MB 1LWEB 1Y10A 4DV5J 4NCAA 5B09A 5LL6d 1JXVA 2V4JA 2MXYA 4F26A 4DR1J 3PJXA 3BGLA 3A8IA 1GQEA 2A1BA 3GIJA 3KK3A 1FF2A 2N4DA 4NA1A 4FVMA 5HL7Q 3QT7A 2BUNA 2YPYA 2RDJA 2YX7A 2B5JA 3H90A 5HO4A 2D1CA 2QGFB 4DR6F 2LFVA 1RBLA 1RHRB 4DV4F 3AD7C 3O6QA 1X9WA 4ZA1A 1RUSA 3IA0A 2MTLA 4ZVFA 4UQTA 4K8RA 1QAXA 2XS2A 4EEYA 1XK8A 3W64A 4K5RA 1CEZA 2BOAA 2QSFA 2ZH9A 4B3MJ 1URRA 3ZZ0A 2IC3A 3POTA 2APOA 5HN0A 2YWHA 3BH7B 3IGVA 1TMJA 2JNJA 2XMTA 3IFEA 3FQLA 1VIXA 2F4VF 1NB7A 3A4TA 3BQ2A 3PACA 2DEJA 4OI4A 2C3UA 2RRBA 2W9CA 5HQ8A 3EGNA 3GTYX 2XM3A 2AIRB 1T3OA 5KFKA 1LWCA 3D4JA 2R8KA 1RT2B 2HVIA 1QM9A 3C46A 4QU6A 2DRDA 3MUTP 3TUIC 1TAUA 3T1HF 2DISA 1RTIA 2M9KA 3ZNJ1 2OPSA 1F5CA 4OQJA 2QMWA 1UA0A 4ICLB 2G2OA 1KTQA 2FJAB 4J9SA 1U8WA 3IN5A 4HHJA 4DR5J 4BS2A 3GJTB 2AJ1A 3HHDA 2DR7A 2QLFB 4C7QA 2FZGB 1UPPA 4NI2B 2V4JB 2XYGB 5D4PA 2ZH8A 3M8QA 1XN9A 2M3DA 4I56A 1RWNB 4JI8J 1S77D 3EGWB 4ED8A 3KK3B 3R1HA 5KT2A 3RTVA 3T1YJ 3W65A 2HHWA 4LBHA 4IQMA 3IM8A 1RLCL 4OJHA 4OZ2A 1HWUA 2VFRA 2VDHA 2DNZA 1Q7YT 4WP9A 3U27A 1IM6A 2AQ4A 4PPDA 4GVLA 3SEOA 4M5GA 3R7SB 3HDSA 4CP5A 4USIA 4ZDNA 2VG7B 2AZ3A 2W25A 2KXHA 2OEKA 2G0JA 3FQKA 3V4MA 4OHZA 3MAAB 3F44A 4CO2A 4RO0A 2HBQB 1FESA 4NLVA 2PIIA 1RHMB 4OYBA 3HCXA 2FD2A 1L3VA 1SQGA 1YG0A 1K73T 1HL6A 2YWGA 3QJPA 1WTFA 2FPHX 1YZ6A 4LF5F 2IC3B 4NRUA 1FRXA 4NZ6A 5KT5A 3POTB 2WOMA 4LF9J 3D6TB 3AB2B 1J27A 1PG5B 4H54A 2F1FA 3PNIA 3UDEA 4JI5J 1B7YB 1RCOB 3TEGA 4O3QA 1R6VA 4C8MA 3EDQB 2W9CB 3UN3A 3UQSA 4ECRA 4HDHA 4QWDA 3TJAA 3HHLC 4CT8A 2BQ3A 2ASYA 5L9NA 4OLPA 4ECTA 5IV4A 3I0RA 3WX8A 2FLLA 3AA9A 2AW0A 2XYPB 2LQJA 1RTIB 5F8IA 1RDRA 4M5HA 4DL2A 3TJ9A 2F9JA 3TZYA 2OFHX 2UUBJ 4KHPF 3NS6A 3UDVA 2E44A 1FE4A 3CIZA 1OYEA 4MK7A 3DOKA 4KPCA 3QRPA 3H2UB 2KZMA 2E1MC 4DSIA 2N82B 3JTPA 2KB2A 1N36J 4C8ZA 5H9FJ 3H2LA 4F0MA 4LBIA 2GW8A 3HFVA 3NBPA 4CLLA 1U1MA 2FUG9 2CUYA 1R8HA 3EZUA 2V2KA 2XWXA 4ELTA 3SXLA 2LMIA 1RXOB 4U8VA 4OX9F 5F8HA 3N5BA 1S0VA 3LUYA 4CO1A 2BJ8A 1WSRA 2NZCA 3FFIB 3CJ2A 3G71S 1J5EF 1WG5A 1TL4A 3QWUA 1GFWB 4Q0BB 4CLTA 4FPIA 2GZOA 2CJ9A 1PBUA 1ROFA 4LRCA 3OL8A 1ICEB 4RKUC 3KK2A 2GS8A 1JK9B 4NOHA 3K5NA 3OHBA 2IYIA 2I8EA 2CQGA 2GX8A 4LJMA 5GAHI 3AXMA 2FYXA 2R3VA 4TKTA 3SSQA 2K06A 4A8SA 1VQ4S 2GAHC 1TV6A 3CE8A 3Q83A 3LQVA 3ZNUA 4F50A 4G1PA 4WYWA 1UVIA 2E29A 5B0DA 1WC0A 1MG7A 2HWHA 4N8NA 2MZ1A 3C6UA 1HHQA 3KJQB 5DETA 7AT1B 5LXRA 3I0RB 1NDKA 4TYBA 1VLYA 2W4PA 2G9OA 4QIVA 3DDKA 3GILA 5FJ4A 4DV2F 8ATCB 2H5JB 5BR8J 2DXFA 2CIMA 4PXEA 4KFBA 4X4TA 1F9EB 1QAIA 5ETSA 2PI4A 3BSNA 1SKRA 4DL5A 4RUCA 3OVAA 3NGRA 1PIEA 3DOKB 2C3MA 3CXCR 2GGPA 3KMQA 2UUCF 2ZVSA 2QO3A 2MQPA 4NXNJ 1J5OB 1GT8A 2F8HA 2VD3A 3C15A 3NBPB 4IG3A 5E2QA 4W92B 3KUEA 3OVSA 2Q43A 3QIDA 1S48A 3L7PA 3RRGA 5BJRA 3MF5A 3S01A 2CVIA 1CBKA 1WELA 1U47A 3VV2B 4K4XA 4USTA 2ZZTA 1WDDA 2HSEB 3N6NA 1SB6A 1N32J 2ZBRA 1G7CB 2ZC3A 1ZM3A 1TUVA 4B3SF 3GFYA 3BSOA 3QWPA 4LIRA 4ZPBA 3FBFA 2EKYA 4IFVA 3IWNC 2DR5A 1HI8A 3TZWA 2LXUA 2VIHA 3C16A 3PG9A 4IO1A 2HLTA 2J9EA 1AB8A 3R8YA 3LWLA 2KVIA 3LPYA 4GVBB 3G9CA 3UCGA 3VVTA 2VICA 3QT6A 3AJDA 3MR5A 1F3VA 3MPWA 1R7IA 3EJMA 4BLGA 1N5QA 1S1WA 2EC2A 2CG4A 4F4KA 2F40A 3OBIA 1RTDB 1HR0F 4LRBA 4ZITA 2HQCA 3OJUA 3W61A 5J2MA 1NDPA 3CVKA 1LWXA 5LMNJ 1RADB 1HA1A 4KO0A 5DG8A 2MHEA 4LSLB 5KFHA 4DV0J 3Q8PB 4G3IA 3LALA 1Q86T 3GG1A 1UWAA 3CCTA 1KKHA 3NS7B 1SC4B 3IBWA 3HVWA 1ZA2B 3VVUA 1Y0HA 3E3XA 2HFOA 3OLAA 5DLFA 2GC8A 2GGPB 1R27B 4I6WA 3EX7B 1P1LA 2KXFA 1UAWA 4RWXA 3LO3A 1KC8T 2V8GA 4A8FA 4K0KF 4JI0J 1BE4A 3M8WA 3K5OA 4L6V3 5ETMA 4CLWA 3C15B 4F02A 1P6TA 3VHQA 1RT7A 2PN6A 3G8SA 4FXWA 4NLYA 4IG3B 3RBXA 1T94A 1RT5A 2I1RA 5KFDA 3ICLA 4RX6A 1Q8IA 2MZTA 1T9VA 2IVFB 4IR1A 4OZNA 2MB0B 1KOHA 3W66A 1RT4A 3HSZA 4RLEA 4W90B 2RMLA 3SSRA 2HGLA 2MQNA 4IFVB 1WOOA 5KG0A 2Q1LA 4WFNQ 3TZXA 3W9JA 3PR5B 2EKNA 2V8VA 4WK3A 4BWMA 5DDQC 5BYQA 2FJWA 3KLGA 3MWBA 3ETOA 1K1QA 3OR2A 4K5SA 4P74A 1LWFA 4C8KA 4DEZA 4ILRA 4J91A 3MZIA 1S1WB 3VGTA 4X62J 2HGNA 2YNIA 3NWRA 3PFEA 2EG2A 1I6JA 3AOCA 1PC4A 5CYMA 1U4BA 1TTHB 2OJ3A 4YDDB 2VPZB 3MCNA 5J2MB 1TR0A 1SL1A 5ETOA 1QAJA 1TK8A 4KO0B 3QGIA 3D66A 4W98A 1Q82T 5KFIA 4NYOA 2QV6A 3MPYA 2BXJA 2BKPA 3DHWC 3E01B 1VQ7S 5EX0A 3JXOA 4I6YA 4OZ3A 5JUMA 2KRBA 3TARA 4IYQA 3WC2A 1SKUB 2W8LA 4ZVUB 1LW2A 4ZPAA 3WBZA 5GAEU 1UEUA 3GFHA 1S9GA 5E3PA 2I5JA 5KFBA 4AL5A 2NYIA 1F3FA 3AQPA 4EBEA 2O3DA 5I3QA 1UL3A 2R2TA 4LF4J 2GMHA 3C3LA 3CCZA 4KH0B 4TU9A 4R25A 2LDYA 2F63A 3B4MA 4IDKA 3HK2A 4LMZA 4P7VA 1CQNA 2D3O1 3DOMB 1BQXA 1XWLA 2F5GA 1VFJA 4KSEB 2L9WA 2P9CA 3PYDA 1K0TA 3B8HA 1BQNA 4M5MA 3DLLQ 3D6FB 4MH8A 2NPIA 3MEDA 1MWQA 1RT4B 1PJ7A 3D6HB 1FFWB 4K7QA 2QLBB 1LNQA 1H2VZ 1NXIA 2DGOA 3LANA 2VKZG 3WX4A 2W2MP 4CLSA 3D1HA 3NKYA 2KRRA 4GO7X 4F4XA 4F4ZA 2WHOA 2QL9B 3HJVA 1SQEA 1NM2A 1HPZA 4K4SA 3G96A 2O01C 5AJ3J 3KLGB 5DQGA 2DO4A 4PWDA 1M5SA 3CDAA 3OUYB 3CNQP 3UDLA 3OFEA 4JI7J 3OV7A 2KDOA 3TA0A 3H5XA 2XTJP 2XMAA 1PILA 4IOCQ 2BV3A 1YVFA 3GFZA 1BMQB 2YNIB 1OWXA 4CO3A 1FJGF 2OH2A 4EGLA 3CCVS 4DX5A 5CYMB 3PRDA 4ZN3A 4J37A 1KQKA 2MY7A 1ULRA 5H9EK 2XULA 3JYTA 1ZTTA 1KQGB 2EW9A 2U2FA 4KHRA 3H42A 5GADI 4WP3A 4FBTA 4CZCA 3LW5C 3PIPQ 5KFXA 1LKZA 3OTOF 3MGJA 4USHA 3TW0A 4WTOB 4EYHB 2AYGA 3BS9A 2J9DE 2O5DA 1IQTA 3H4BA 1S9GB 2I5JB 1TL3A 5HROA 1B99A 1RAGB 2IM0A 3FKBA 4RL1A 1HYSA 4LF2A 3VAMA 3CJKA 3I6PA 3FZ2A 2R7QA 3G8QA 3R2CJ 1REVA 4PG4A 1DLOB 4K50A 2N3LA 5J2QB 3B78A 4OZ0A 3FRYA 5F9LA 1GMUA 1BQNB 4DN9A 3M30A 2BR0A 2Z2LA 1T02A 1S7IA 5CYQA 1S9FA 3MEDB 4UTGA 4B3MF 2I9SA 2DK2A 1SBRA 2QC3A 3H25A 3DGVA 2RB7A 3M05A 1S0MA 2AF6A 2GIRA 2M0GB 3EDRB 2NYHA 1VC6A 2EK6A 3UNGC 3LGHA 3NAHA 2KZZA 3HJFA 2CNNB 1HPZB 4EO8A 5D4LA 1FRJA 3ETMA 2OMLA 1RHJB 2MKIA 4DQRA 1N5YB 4PWDB 4DUZJ 4Q2LA 2FVCA 1UVLA 2PT0A 1MN9A 2VZ9A 2PFFB 3H5SA 1WTBA 4PXBA 3QAEA 3THPA 1FWPA 3BEGB 3M8PA 4URSA 5GMKa 2D74B 1VHFA 1TELA 2KKHA 1M1HA 2W24A 5A8KA 3IAS9 2E5LJ 4A48A 2F4FA 6AT1B 4YQWA 5DDPC 1N34F 1RAFB 1CLFA 1HWJA 3DLKA 3J81U 3MMBB 3CUNA 5IQ6A 3JYTB 3P6YC 3MR2A 3DCAA 1ZAWA 1FKAF 3CJQA 2XWYA 4B3RF 1JX4A 4N8OA 1U7LA 4N47A 3T9NA 1MLAA 3P3DA 2ZJRQ 4B9NA 1YBAA 5IT9Y 2R7WA 1VJQA 2FZKB 2W9AA 3NRBA 5HROB 3AD9C 4HH1A 4MKAA 3ZTQA 1ITPA 1UA1A 1KBRA 3I87A 3CPWR 4TLQA 2RS2A 4QWEA 4USVA 2JWNA 1REVB 2ZM6J 2H4WB 2YY3A 3H59A 1KP6A 4TXSA 1K9MT 4NLWA 2KXNB 3FGVA 1HNZF 2NUUG 3M30B 4J9LA 3QQCD 5KAKA 5CYQB 1NHKL 3CCWA 3R6GB 3G6VA 1AFJA 2DKOB 1OY6A 2B9EA 4OHWA 3C2PA 4IOAQ 1D9FA 1VMBA 4C0BA 2XCAA 2GVDA 3GV7B 4GKKF 4FBUA 4OV1A 1YK9A 4WBFA 3CDBA 2MQQA 4A8OA 3HHKA 4ED1A 2R2RA 4RPFA 1I94J 3I5CA 4FYVB 4DJBA 1NJZA 3G6ES 2WW4A 3OTDA 2RILA 4NLQA 3P8BB 3OFHA 2XS7A 5D0RA 1CULA 3CO0P 2NXCA 2HFZA 1S99A 2DNPA 3AODA 1S4EA 2QLXA 1JXEA 2HMIA 3GJQB 4YS2A 5B0FA 1SC1B 5A8KB 5CZVA 2NXEA 1GTHA 2FJXA 1U25A 3M6UA 1GX6A 3CCES 1BUXA 2J7KA 3KLVA 5CCLA 1S4FA 1TU0B 1BWEA 1YJRA 3KHHA 4DF4A 3VAIA 1PGZA 2IHR1 5JVHQ 5KT7A 5A8RA 3NLCA 4WE1A 3D3BJ 2NZ4A 1NKBA 2C2ZB 1GH8A 4JI4F 1WG1A 1CJTA 1S7HA 2NCKL 4X2BA 2YPZA 3RW6A 1RWUA 1F5BA 4IRCA 2A6MA 1FDDA 1TZ0A 3J81j 1W7WA 2CKWA 2UXBF 1J2VA 3KHRA 1APSA 2YNGB 2HZVA 2E1CA 2DGTA 1QY7A 1SJRA 1UZDA 2HQIA 3ISND 3L95X 4RW9A 1ZZFA 2F65A 2HFVA 3QMQA 2M4MA 4XO0A 2ZWPA 2MEWA 3KUGA 3CMES 3FBEA 4L73A 4PQAA 3PW4A 2MLYA 3KOAA 3THVA 1FRLA 3ELHA 1FA0A 4QBUA 4C3LA 5JVGQ 3MMAB 4Y2KA 3HZEA 2DY9A 5F8JA 4MAKA 2GJIA 3PTWA 1LFWA 3BPSP 4WIQA 3DHXA 2GVDB 4PG7A 4ES1A 5DM6Q 5G4DA 4BC7A 2JFDA 2XLKA 1XNRJ 1M5KC 3K17A 4JBCA 1KVJA 2HIYA 4M5DA 1XMQJ 1VISA 4QIEA 4LSZB 4WFAQ 4Z2XA 4M5IA 2CPHA 1YZ7A 5IV3A 2RDIA 1UP1A 3GYGA 5AXMA 1CULB 3JTOA 2RRAA 1X5PA 1Y00A 2W2NP 4DMZA 2XNQA 3BGOP 4OHVA 5HK4A 2HMIB 2CJAA 4YB1P 5THWA 2VPWB 2H5IB 2IA0A 1JLGA 1ZPWX 1JWWA 2EFOA 1ACMB 1MU2B 3M8RA 5BR8F 1UPMB 2B9YA 1QLNA 4MYTA 3W9IA 3JSRA 4O4GA 4USUA 4R8UA 4ED3A 4CT9A 2ZVIA 2HZAA 1X31C 4WE1B 2RQKA 3DXSX 4QIWD 4C9DA 1CJTB 3KXDA 4OYAA 4MJKA 4DR3F 2XHCA 1SH0A 1VYAA 3CIMA 1VJWA 2XI2A 1KFSA 1IJFB 4AXIA 3M2UA 4ELUA 5U47A 4ILMA 1E6YA 2OFGX 1JIHA 2ZWOA 3MTJA 3HMJG 2ROEA 4ZPVR 1HW9A 3DRYA 4RW9B 2BJ9A 3OSNA 3SDEA 3FNNA 2ZD1A 3SIPB 2JC0A 3DDIA 1KLMA 2OEMA 4AL7A 5FLXY 5E7OB 3JSMA 1S1TA 4DR6J 2BX6A 3M9OB 4CLPA 2NXNA 4DV4J 2GVZA 4KKOA 4O4RA 2YX1A 4J9UE 3Q8RB 4OZJA 2MQ8A 4H4OA 1UEVA 2AGQA 2YQ3A 5ETNA 2WZ1A 2CRLA 1DHMA 4OYMA 3I55S 4QZVB 3I4PA 3M8ZA 4ECSA 4M5DB 3E8OA 2KH9A 2R2SA 5HVGA 3GR0A 2YNFB 2QFJA 3IS9A 3H7HB 3CC2S 1CG2A 3N01A 1FT8A 2BMBA 1H6KX 2W2OP 2YKPA 3DI6B 2ZHAA 4DSLA 4ZJOA 4UUWA 3UN2A 2F4VJ 4A8MP 3Q2SC 4DPUA 1NCLA 2FHKA 2N7YA 4FXDA 3AJ1A 5LMUJ 3HKWA 4JUZA 1JLGB 2BRLA 3C6TA 4PYAA 3Q0AA 2IRXA 3UPFA 7FD1A 2EFNA 4CI0B 3IRWP 2DH9A 3PXGa 4O4GB 4R8UB 3K0JA 4QYZJ 3T1HJ 4FP9A 3WIVA 1HQEA 3RAXA 3D67A 3LAKA 3K5MA 4RNFA 1F1BB 4L3NA 2LP4A 2FJVA 2P9EA 1NZ8A 2AYBA 1RK8A 2J6UA 2X1BA 4RW4A 2JL9A 2E9ZA 1NK0A 2NR0A 3M2UB 3GSIA 4J9NA 4DL6A 2DXDA 2LYVA 3GIIA 3ITHA 5E3CA 2B4UA 2J7WA 3FRZA 4MTPA 2BYCA 2ADCA 2HVEA 3HFKA 3VALA 3SDEB 4FF3A 3V6JA 3QNWB 2CDRB 2B51A 1LXJA 3H20A 1KLMB 1CSJA 3JSMB 5M2PA 4KH1B 1SH3A 1SH2A 1RWMB 1R6YA 1IBMF 2D3UA 2ZH5A 2HHHF 2GVZB 4KKOB 2K7JA 3EVWA 1KN6A 3CO9A 3ZZTA 2A18A 3GCWP 1RWKB 2J9CA 2OHDA 2VKRA 5LSLA 2JLFA 1UW9A 2NSBA 3K5PA 4ZVRB 2E5JA 4TNOA 1KS2A 1IBLF 1NPPA 2AHOB 4UY8T 4X62F 4LF5J 4AD6A 1S9EA 1MROB 5C2GA 1RI7A 3HF5A 2RF2A 2UVRA 3W5XA 3HP6A 5M2RA 3GSDA 1SL0A 4NYPA 2P9GA 2EFVA 4J7CA 1Q8BA 1RYSA 1W2BR 4IOBA 2E5HA 3LPEA 1BGXT 2DHXA 1UETA 1X5SA 4ZP9A 1D0EA 4JP8A 2Y8WA 1TL1A 1B70B 2OAUA 5F0UA 4ZVTB 5KTQA 2ASJA 4P6QA 1FKPB 4HTIA 2VQFF 4UQGA 3VAJA 4IH5A 2XY5A 1HQEB 4DSKA 4I2QA 5GAHU 4ED0A 4BBYA 2VBYA 1H98A 1GMWD 5AXLA 4X4OA 4KHPJ 5KFMA 4DX6A 2MZRA 2HS3A 1NHVA 4RW4B 2BACA 2C2EA 1RAEB 2MJUA 3PIOQ 4Y2IA 4KPYA 4HL9A 1WUUA 3RRHA 4O44A 1VC0A 4ZPWR 1UZHA 2ZITA 3ADAC 3GIKA 2D9OA 3ILIA 3M32B 1VQLS 4MKVA 1WC3A 2HBZB 4WIIA 3S8SA 5ETQA 4YR0A 3PRVA 3QYYA 3QGHA 2XSJB 1G4CA 1YTYA 4P9SA 2Y8YA 2HHSA 3ONQA 2J0WA 1T8EA 1N33J 3D6MB 3T6JA 2ZH2A 4EK2A 3HKZD 1EETA 1IKXA 1VBKA 2BE9B 2RT3A 1B3TA 3UE2A 3TNVA 3TUJC 1NK7A 5EGYA 2LQ5A 3X1LB 3QGPA 4OX9J 2QTWA 4C3KA 1O8BA 1GXTA 2CG8A 3NY0A 3G2XA 1J5EJ 4U96A 5T7LA 4DWIA 4JI7F 4A8KA 1KR4A 3KK1B 4G65A 3W3SA 3V6DA 2ZH7A 2ZDPA 5FD1A 5E41A 1WSVA 4RBTA 2HPUA 1OO0B 2WBMA 4RUBA 3Q8SB 4MK9A 1RKJA 2B4OA 4I2PA 2RF2B 4URQU 1D8YA 2FJDB 5J2NA 1TAQA 3PVXA 2RUGA 5LXYA 2KT5A 2ACYA 1EX8A 2LA4A 4KE5A 2M70A 2FB0A 1TL1B 3VAHA 2X1FA 3LTOA 1FRKA 4DL3A 1SI9A 3SCLE 4HACB 1RABB 1ZAXA 3AB4B 1P9QC 4CIOA 4C8OA 2F7VA 1VDHA 3RAMA 4K4TA 4OX6A 2SXLA 4NLUA 3CMAS 4HT5A 3I9V9 3QPIA 2XLIA 8RUCA 4LR7A 5D0EA 2CQ4A 4I2QB 2DBBA 2ACMA 3RGIA 4DV2J 1X4CA 3WDOA 2COLA 3NNAA 1X4EA 1W26A 3KDOA 3PY8A 4LF1A 4NXMF 3I56S 4DN0A 4NCGA 1N0VC 4EZ6A 3SSSA 1R8PA 2QJ3A 4DL0C 5H9FK 4U9RA 4O44B 2VG5A 2HVHA 3MEGA 2PA8D 4DCPB 2UUCJ 2V8DA 2QA1A 2FGOA 4DQIA 4YB7A 2ATCB 3PW5A 2G0IA 3PX0A 3DFEA 4I69A 2CADA 1VRUA 4WFBQ 3GYNA 1MSWD 2IIHA 3KLFA 1M1KT 4DQPA 1NAQA 3TVZA 2RNEA 1X5TA 3D7SB 5IT9U 1WEXA 3Q24A 2OSRA 3VWSA 1C0UA 5LT5A 2R7RA 1NLKL 3RBDA 4ED5A 2HNZA 4F2SA 4A46A 4B3SJ 4YR2A 3MOZA 1UVJA 3IBFB 3MM6A 5CXTA 2CJYB 1X4DA 3V6DB 3DKDA 5IC6B 5HVHA 4DPWA 2RSQA 4EMDA 2ZEJA 3DGPB 4FYWB 2ZOMA 4I2PB 1NEEA 2YKAA 4OHXA 5A2QY 2KO1A 3CD5A 4A8YA 2IA6A 3JQMA 5J2NB 4LFCF 3PFOA 2ZH6A 4F3OA 5K9FA 2BW7A 2HHXA 1I1GA 2H4YB 4CWBA 4NWBA 1HR0J 3GU0A 2CQDA 2OPRA 1YJVA 1FRMA 3MFHA 2YTCA 1O5JA 1RTHB 4P7TA 4DV6F 1ZS6A 4ED6A 1WC5A 3UCZP 4AYBD 1U09A 3K2YA 3B82A 2HHTA 2OKQA 3BZQA 3ET6A 3QZ8A 4PCQA 3M6XA 3C14A 3DXBA 1EP4B 3KFWX 1S97A 1V3SA 4RNNA 2VG5B 4QJVA 3MEGB 3BQ1A 1U0SA 5KOXA 4WTYA 3O44A 3MR6A 3CJSA 2XY7A 2VV5A 2DVIA 1U2FA 4K0KJ 1FERA 1FRHA 3JSBA 1G6BA 5KFCA 4UT4A 4LVNP 5K8NA 2BKOA 3KTQA 2JX2A 4XDDA 1YJNS 4DFKA 1HBNA 2I6WA 1Z2LA 4H4MA 2OGUA 3HVTB 4UOHA 1C0UB 4F25A 5IFMA 4X4SA 3QSIA 4NASA 1S49A 4G1QA 3MM9A 5HMXA 3R6LB 3MPDA 4L74A 2QZ8A 3L7OA 2ZJQQ 5EWGA 3KJNB 2QMUB 3LP2A 1I51B 3X3UA 1S6UA 1VRTA 4NLSA 3GE9A 1T11A 2GIQA 4C98A 3MHYA 3DOLA 2ZDOA 1XJWB 1DAXA 5L38A 2KHCA 4OLOA 2XQCA 5D6GA 3RYLA 5KG4A 2UVWA 5C5JA 2LQ8A 1NDLA 1KVKA 3UR0A 3DDNA 1SJQA 3UR3C 3GWCA 5HMZA 4V19X 4ERDA 2CAJA 3K8WA 1WORA 2HAFA 3HFZB 5GVQA 5SUHA 2QA4S 3AQOA 2OPRB 2FDNA 4CO5A 1X60A 3PCOB 2RQMA 3MTKA 3IG1A 2OTJS 2HLUA 1ZM2A 3DRSA 2QT7A 1CQMA 3N79A 2BVZA 1WHYA 3SCJE 2V8HA 3ET6B 3R5DA 2HAIA 4ZVSB 1VGYA 1DJ0A 4IFYB 1LW0A 4NYZA 5B0AA 4F36A 2ZE2A 4WFYA 4Y34A 2KJWA 2B56A 2H54B 2V50A 4GC6A 4AXJA 4PQUA 1UVKA 4Y2MA 2G13A 4KC5A 2HRTA 4NEYA 3FBBA 4HR2A 5L1LA 1JLQB 3MFIA 3H40A 2DNQA 3IM9A 2PA3A 1KD1T 2IM1A 5EHHA 1WF2A 2CQ0A 3NCRA 4FKXA 3TUPA 1HBNB 2C2DA 4H4MB 1F9FA 4LF8J 4KTQA 5GADU 1TFWA 2XO6A 4J9VA 4TYAA 4MKBA 3M6WA 3FUYA 1QAYA 4F67A 2W4DA 3NMAA 1FFGB 2QG9B 1SVDA 4G1QB 3MM9B 1UEKA 4WXWA 1RJJA 5E3QA 1NSAA 3IR6B 2DR9A 5EUHA 4C11A 3NEKA 1Q16B 1HI0P 4Y2AA 1XMBA 2EK1A 4U7UK 3H5YA 1FO1A 2DIUA 3LP2B 3NOGA 4JI6J 1M1GA 1VRTB 5FLXU 1OPZA 2LVWA 4FS2A 2XMKA 1XR6A 5ITHA 1TVRA 1HBUA 3R7NB 2BE2B 5DG7A 3RRKA 5IC4B 4FNIA 1FVSA 1F6TA 4OI1A 2D7SA 4EBDA 1IWAA 1SQFA 3UVJA 5CD4A 1DARA 5AE3A 4IQXA 2HHVA 2BJ7A 2M8HA 2DGWA 4QR1A 3QO9A 1H0HB 5KFEA 4Q8EA 2FHMA 2DNRA 3IG1B 3K57A 2QEXS 4NLRA 2MYFA 1YBTA 2ZNZA 5JMNA 2PI5A 4QOTA 1F0XA 3J7ZT 4OI3A 4BDPA 2V2VA 5D8HB 4ZPCA 1FEHA 1WOPA 4HTJA 4DXLA 3L3CA 1FI4A 2HURA 3OTOJ 3D0GE 1UJ6A 2ZE2B 4B3TF 1Q53A 3KG0A 5GAGI 4ZCKA 2MKCA 4F2RA 4R5PA 4ZLNA 4PQUB 3OFGA 3PO5A 1GXLA 4CCHA 5HLFA 2YKOA 5J1PA 1S1UB 1Y7PA 2X51A 3SFGA 2VBWA 3BREA 4ATNA 3K59A 4K4VA 3FMWA 1FKOA 4CTAA 2B0GA 2DRBA 4PWWA 2AJQA 2W2QP 4LFAF 1Q8LA 4MT1A 4V1Ak 1RWWB 2HVZA 4C0OC 4PG8A 4OFZA 2WONA 4C11B 4NA2A 3KLEA 2CQCA 2MPUA 1R43A 1V5IB 2NUHA 2XBPA 4OZ5A 2BEFA 4K2XA 1FNOA 1JLAA 1NK9A 4FF2A 1A9NB 1KONA 1IKWB 1HBUB 1R8CA 1YRTA 1C2PA 5LMUF 3BM7A 3W2WA 3IO1A 5L1JA 1TKZA 1AZSA 2UV8A 2Y1LB 2FY8A 3SZ2A 4MFBA 1UFKA 5KT6A 2Q66A 3AH6A 4B9TA 5ETLA 3UVJB 4V19J 3QO9B 1XERA 4OJGA 4KHMA 2R7UA 1RYRA 3K7RA 5KFUA 2E5GA 2XS5A 1WI6A 2H5EA 1N34J 1N0UA 4ZVOB 5KFPA 5MLCV 1U1NA 1YKWA 2DCUB 3BN4A 1NHUA 1IBKF 4DPOA 2UP1A 2ZHBA 3MAHA 5B0GA 3D0HE 4OL8A 4FYDA 1VQYA 4B3RJ 4F0KA 1XTZA 2MKKA 3T5HA 3W8GA 4BC9A 1A0OB 3TQEA 2C28A 1AUDA 5HBMA 1XR7A 1IR0A 4U8YA 4RW8A 4R5PB 1Y11A 3A8KA 5EX3A 2GAGC 2DXEA 5F0WA 2WB4A 4OMFG 1KWMA 2B5JB 1AUSL 3FEZA 2BJDA 3AY0A 4DV1F 3SMZA 4ALZA 3ZZPA 1FNXH 2ZZMA 1NMEB 2C2OB 1IKYA 4PKDB 2WCXA 1NH7A 2RD5C 3BR9A 3RBZA 3RZAA 1ZYQA 4P72A 2OELA 4DLGA 4DZ6A 4CTAB 3OFFA 1HNZJ 5LM7E 2WRMA 2B9XA 3KNGA 4N7TA 3BV8A 2CPDA 1Q79A 1VQ6S 3V2UC 3T5LA 2QYCA 3L9ZA 2ZJPQ 1SUQA 3PDNA 5DO2A 3KLEB 5KFYA 3QIPA 3MM8A 4F8RA 4GKKJ 4DV7F 1WJ9A 5M2UA 1Y5IB 1S79A 4PABA 2DNGA 1S6QA 5F3TA 1EARA 1E6VA 1NO8A 4F3MA 1S6OA 3W2WB 1TKZB 1AZSB 2OLWA 1LWCB 1NUEA 1RGVA 3MUMP 4QPTA 9RUBA 4ZP7A 2RJZA 3DM2A 3H98A 3CCJS 3B4DA 2A0FB 1V6HA 4OI0A 3UN5A 2MKHA 4IO9Q 3DYAA 2AWZA 2V68A 1WWHA 2OPSB 5IT4A 3GYXB 3TOQA 5ETPA 2Y9HA 1PYSB 4JV0A 1LFPA 3CJ3A 1SC6A 4AUKA 3P96A 1AROP 4DR4F 1YBUA 4LREA 1N5SA 4R0JA 3M8QB 2MQMA 4GC7A 4ECVA 2E5IA 4C97A 4JI4J 4UF4A 1ZOTA 3HO1A 4DBQA 3AAWB 3EXCX 4OI2A 5HBMB 1SJ1A 4RW8B 1YGYA 5EWFA 2M8DB 4NLXA 1YRUA 3N5FA 2VA3A 4USJC 4ZN1A 3HHLD 3KJFB 2MQLA 1N33F 2DIVA 1T9WA 1WEZA 3U02A 3TI0A 5D4OA 1U1RA 1KQSR 2UXBJ 2VBXA 2Y3YA 2BQUA 3KHLA 3HZGA 4Q2MA 4L76A 1OQ3A 2AJ0A 3G87A 1HD0A 2E1AA 1BQMA 1VQ5S 1R8BA 2GFFA 5A76A 1RSCA 3MPUB 1NK5A 3ZO7A 3ZTSA 3PYGA 3CTRA 2RS8A 1GXUA 1HBMA 1JLEA 1X5OA 5HQMA 1T9TA 2LKZA 2ZBIA 3O3LA 2JDJA 5K20B 2M5YA 1XEZA 2Q3PA 5DDOC 1ZM9A 4LSNA 3MCMA 3ILOA 5GAEI 3MM5A 3E2EA 2FJBB 3QIPB 3P45B 2WOMB 2CPYA 3GMGA 2W8KA 3A12A 3MD1A 3FSYA 3VF0B 2HGMA 2RHQB 3RJMB 4EUVA 5C24A 1GAOA 4M5NA 3GFXA 2ZHOA 3ZZRA 3NL0A 3I32A 4CLFA 3KWMA 3NP5A 4UZBA 4P10A 2MY8A 4F04B 2VONA 1WHXA 5HMYA 3DM2B 1RAJA 2CPJA 3R7BB 2ZH3A 5AE2A 2QE5A 2V67A 4PR6A 3W2VA 3VR1A 2R7SA 3DYAB 4OI6A 1K47A 2Y0BB 4BHQA 1KNZA 2HNDA 2MZJA 4RJVA 4ITSA 2DR6A 1NK4A 1RACB 5A2QU 2WK4A 2CJKA 2HBRB 4OYPA 2EVZA 2VB6A 4G1IA 1RP5A 5KG3A 1KSPA 1QUVA 1EKSA 3CD7A 3OVBA 2WBRA 5IM0A 3W9HA 4DR3J 3OLBA 3S7RA 4ETZA 2EXUA 1H2TZ 1A7GE 5D3GA 1VK8A 3BO2A 5SZTA 2XZDB 3L4BC 4B3OA 5D0GA 2V0NA 2KYZA 2FQQB 4KAIA 3CJ0A 1OY9A 5L8RC 3J7YI 1BQMB 2QL5B 2CWKA 3A13A 3AHPA 1H2UX 3DRRA 2F8MA 1R0AA 3K58A 3MPVA 4LF7F 1RTZA 2FC8A 1HBMB 1JLEB 3J7A1 1HIYA 2DH7A 2JEGA 4FKYA 4PYDA 3QBCA 3MAQA 3KK2B 3KHGA 4B08A 1U2CA 3MM5B 1RE1B 5F9NA 1VOMA 2MSSA 4B17A 1D09B 2LQ9A 1CPZA 5KG5A 4XK8C 5HAOA 4E2FB 4M8LA 2KT3A 1D9DA 1TV6B 5C24B 3KJVA 4F4WA 2W4CA 5EWEA 3R1LA 3PYEA 3C6UB 2ZBQA 2KG1A 4IRKA 4WFXA 4ZK7M 1JLFA 4MIWA 1ELOA 3W2VB 9ATCB 2YWEA 1FXLA 2YVSA 3A8JA 2I2YA 3LGMA 4WK1A 2XYHB 2DYAA 2UZAA 4F4YA 3OD2A 1DTTA 2DGSA 1N88A 5F8LA 6FD1A 4KFBB 1EZZB 2HNDB 2ILYA 2L9NA 2AX1A 3Q2TC 4NE9C 1Q1KA 2WVFA 3C19A 2CPEA 2LU1A 1JNRB 3JTNA 4RW6A 5AXNA 1C0TA 2PMWA 3A3OB 3TO8A 3HT0A 1EJ7L 2P5VA 1JKHA 3D54A 3JAMY 2XY6A 3TVKA 2VC0A 5IM0B 4LF6F 2MKSA 3PZPA 3DMJA 4IKAA 2CZ4A 3PJWA 4MK8A 2MMYA 4PPZA 4FF4A 5A0YA 2H9ZA 4X4QA 2DHGA 4RZRA 1RHQB 1T9UA 1GNKA 3H2VE 1KEKA 5J1EA 2GHVC 3O5TB 3DLGA 3M2VA 3DRRB 2KJVA 2ASDA 1R0AB 6FDRA 4M94A 1SC3B 3BB5A 3RG6A 2DGVA 4DHVA 4YY3F 3EPIA 4B9MA 1KOOA 1RBOB 4NZ0A 3IC1A 4NMLA 5HMWA 3OT9A 2A3JA 3SYZA 1UVNA 1FEEA 1IBMJ 2HHHJ 5J1NA 2Z30B 4Q43A 4HI1A 2DHAA 1U48A 2CQHA 3C16B 2IBKA 1EIYB 2Y1JA 1QDUB 1NKCA 3GZ7A 4DPTA 4CNYA 1C1CA 2Z56B 4AT1B 3HSDA 3GONA 3A3NB 2FY1A 3UO0A 4JOUA 1IBLJ 3U1NA 2EBEA 4Q8FA 1U6BA 1K8AT 5CQGA 1AT1B 4ZVEA 3UI3A 5DDRC 4QQBA 3R5CA 5ETKA 3BKTA 2BOPA 3JSYA 4KYZA 4WKYA 1JLFB 2DHSA 3B6BA 2D3ZA 4AL6A 1B0TA 1M5VC 3F73A 5I3PA 2LDIA 4QYZK 5C42A 4EI2A 4ZVQB 4ED4A 2DT9A 4DOZA 2ZFHA 2BKNA 4RW6B 2VQFJ 1C0TB 3NGKA 2R7VA 2LEPA 4TY9A 4X4UA 1NPRA 1YHQS 3G86A 3CULA 1NJIT 3O8WA 1W2IA 1IBCB 1N52B 4UZCA 1NU4A 2UUAF 4HDGA 2IRYA 1VR6A 1OJ4A 2J6TA 1MWYA 2UUWA 2NQPA 1UFWA 1RT7B 4EO6A 5A0YB 1WKJA 2C1EB 5C25A 1SIWB 2UU9F 4LF8F 2NREA 3PX4A 1RT5B 5KT3A 3CCUS 2J0QD 1P8GA 1Q5YA 4CO0A 3WC0A 3KLHA 3DLGB 3R9LA 3M2VB 1PJ6A 2CXEA 2V69A 1BWVA 5L46A 4M5JA 3A3PB 1TP7A 5KG2A 4HKQA 1L3KA 3RBEA 2BBEA 2Y1IA 3CGIA 2AU0A 3N6LA 3SCIE 4JI6F 2HQ3A 2MKYA 1IVZA 5DGBA 3LOUA 2KYXA 2OSQA 3IR7B 3I0SA 5I42A 3OR2B 1C1CB 4QR2A 4Y6IA 1CS4A 2AEMA 1LWFB 5GMEA 1Y3KA 1VQ8S 2ZKUA 4RNOA 4UOCA 3IGNA 1U1QA 4CNZA 2FC9A 3T6BA 5E33A 2IMWP 2M7SA 2V9KA 2GHPA 5ADZA 4X84A 2DGUA 2CDQA 4XTTA 2NSCA 4U7CA 4I64A 2DITA 5C42B 4WZQA 1OPIA 1GTEA 2C3YA 3NGDA 4NI2A 1EQMA 4NLOA 1NSKL 4NCBA 1WG4A 2VBZA 2ZH4A 2VQEF 1LOUA 1TK0A 1SCJB 2BANA 2UXDF 4DCJB 1LW2B 1UWBA 5KG6A 3G4SS 2PEBA 4DFJA 3ZTRA 3D2WA 2CQPA 1S6PA 2HW3A 2E7XA 4NXMJ 2JSXA 2VG7A 2DO0A 1NDCA 4WPAA 3SI8A 3T5JA 4NPOA 4IDKB 2MKJA 1B0PA 3CCMS 5C25B 4WJBA 1AW0A 3OTCA 2Z2ZA 3T5KA 2QL7B 3MDFA 3MAAA 2V2QA 2YKNA 2ZOGA 1FWLA 4E0DA 1RHKB 2ZC4A 2CNLB 3KLHB 2C2KB 4WXOA 3TAMA 3VQSA 1NSQA 4YHHJ 1UFLA 1WF1A 4FYYB 2HHQA 2Q6CA 2NLWA 2K3IA 3GV5B 4JV2A 1X4HA 1HNVA 2V5HG 3N28A 1QJHA 1YI2S 3BSCA 4AQYJ 2GQCA 3QATA 4QWCA 2VOOA 3ISZA 4YEAA 1N4LA 1U0HA 5HI7A 2XC9A 4ZCMA 3I0SB 5I42B 3I5BA 4KBIA 3M9NB 3BR8A 2A6OA 3QFHA 1CS4B 2UV8G 1WC6A 1HARA 2AYEA 4ECXA 1SL2A 1HQ2A 3FCVA 4B9LA 2HHPA 2J0XA 4ZLLA 3R5GA 2NPFA 4J9PA 4DSJA 2CJBA 1NJWA 1YJWS 3FCWA 3NG8A 2JEIA 1RQ0A 1Q78A 3GP9A 3KYLA 4LFCJ 1VK3A 1DY3A 3GB0A 1BC6A 1FTRA 3D3CJ 4OJ1A 3TEHB 2OD6A 3CCQS 3CCRS 1TKDA 4J90A 4TU7A 2BW2A 3UFCX 3LH2S 1WC1A 4USKA 1SV5A 1BY9A 4RNMA 5KFFA 4AE5A 1FE0A 2OPQA 4KIAA 2K3KA 1EQ0A 2BANB 2LQBA 2VFTA 4DV6J 1M5HA 3A1YG 1HFEL 5DM7Q 1DFDA 1UWBB 1OYDA 1RWVB 3G6YA 1TL3B 4K2JA 5L39A 4DUTA 2UXCF 3BN7A 1S6PB 4YDXA 4F4AA 2KU7A 4J9OA 1HNXF 1HYSB 3ZZOA 3CJKB 4GKJF 1HNWF 1RZMA 3NNCA 4N5SA 4ZHRA 4X4RA 3EXYA 1ZH5A 5KFLA 4DF8A 2YKNB 2R7TA 1KVIA 4QWAA 1JLBA 3FFIA 4OJ3A 3TANA 1EAYC 3TAMB 5IXUA 4Q0BA 1GMWA 2ZNYA 5FDLA 2BDPA 1T7PA 2DNOA 5AT1B 2GQ2A 2IPOB 2LECA 3VGSA 1HNVB 2CQBA 2ALZA 4DLEA 3J81Y 1WKLA 8AT1B 2QYGA 2HK2A 3J80Y 1MWZA 2J7UA 2WW8A 2HQGA 1S76D 4K4YA 4B9UA 4QIFA 3AT1B 2RU9A 1U0HB 2NXJA 3PRBA 2V34A 1G2EA 4FYXB 4LUBA 3JQJA 4NLGA 1FJCA 4O3SA 1KTVA 4JB8B 1YRXA 4C2MA 3CDEA 3HHNB 3TRGA 3M8PB 3D1QA 4DSFA 5F41A 2JVRA 1L3TA 2JJ4D 4ENOA 4LR8A 1G1XA 4P75A 1NH8A 1IR1A 3RB0A 1RCXB 1NNDA 3BBFA 2X3GA 2AGOA 4P71A 1CJUA 4YUDA 1UJ4A 3DLKB 1Q4RA 2MLZA 3OXLA 3NNHA 2FZCB 2W1BA 3PHTA 3NWGA 3SCKE 3UNYA 2HRUA 2QRRA 1WNEA 3DLEA 5CYJA 2Z0GA 4USMA 3NCQA 4N77A 1SV5B 2OP5A 4DS4A 1K1SA 2OPQB 2XZWA 1VBXA 1UCNA 1J5OA 4TQSA 4CM0A 4DV3F 2N3OA 2MZSA 4DR7F 3HHEA 3AA8A 2CQ1A 4CYUA 3V4IA 3KDNA 2Z2MA 2YXLA 1X4GA 4DQSA 2C2NA 2AEFA 3M8SA 1MMDA 4CH7A 3D5MA 3BJYA 1IJEB 4E98A 4ZHRB 2RU3A 4FZVA 3O1LA 5C7PA 3FCHA 2GV1A 1JJHA 1MN7A 1IUJA 3UCUP 1OS5A 1WACA 1JLBB 1Z4UA 2N4CA 4DUYJ 1B7FA 4ZLPA 4N56A 4GO5X 2BA9A 2XMUA 4DCOB 2HNYA 5FDLB 4X65F 1PAUB 2VUGA 1XMOF 3AD8C 3C66A 3VZIA 1NKEA 2JOQA 2B8QA 1Y3JA 2WB1D 1PKUA 3DC2A 2VODA 4GVBA 2A10A 4WF9Q 2CJXB 2DR8A 2E9TA 3Q8UA 2XI3A 1F2HA 1Z2ZA 1U6FA 1S0NA 2EC0A 1RWPB 5GAGU 2E7VA 4OYOA 4ZCLA 2JEJA 3I96A 2KT2A 2QN6B 2ZOFA 4QU7A 1IKVA 3UDCA 5AXKA 1RTDA 2DNNA 4KGVB 1IN0A 1BLUA 4D3HA 3W8PA 4PZVA 5CZXA 1ZZNA 2PMZD 5J2PA 4P52A 3OHAA 3EVMA 3BO3A 3FJ2A 1PO6A 4LSLA 2IRUA 2DPIA 3DU6A 2MDAA 1CJUB 5IWAF 1VC5A 4OIXA 3PEJA 3QJJA 1TK5A 2GJ2A 3R5JB 3ENQA 3OTBA 5A8RB 3DLEB 2FGCA 4LQ9A 1XBWA 4WWSA 4I67A 5A6PA 1TL5A 4X66F 1U1KA 4NX9A 3EWGA 2P2CB 1UMJA 4H4KA 5D77A 1ZA1B 3IMQJ 4CYUB 3V4IB 1B64A 3EYZA 2DPJA 1S10A 4Z7YA 3NGUA 4M5KA 3CC7S 4B3TJ 3MURP 2AJ4A 3OSPA 2GIFA 3V6KA 4K4ZA 3ENVA 2G2ZA 1DQ9A 3F41A 4RR5A 1AA1B 3Q86A 3T3FA 1QSSA 3W63A 1Q81T 3TUZC 4I6AA 3RR8A 2W01A 2WSFC 4LFBF 4L75A 1U1LA 2X1AA 2HNYB 5JXSA 4CO4A 1VI7A 3SQOP 4FVCA 3MI7X 3TX0A 1NSPA 4HHHA 4FXVA 5BXIA 4ZP8A 3JAMU 3CB4A 4DS5A 4K4UA 2BE7D 4NZ7A 5CABA 3DRPA 1QVGR 7FDRA 1M90T 2AX0A 3HM9A 4LFAJ 4ETXA 3ZZYA 3ZFVA 3CD6S 1FDAA 1KFDA 4EU0A 2GO8A 1IKVB 2YNHA 2B6AA 1GMVA 2LEBA 4JYAF 2WVCA 4CRJA 1U45A 2VL1A 2ZH1A 1SPBP 3HULA 2X3DA 1YJUA 5KFOA 1ZAVA 3KKFA 4WP8A 3SV4A 2FHOB 2DNHA 2LEAA 5J2PB 1X0FA 2DD8S 1QE1A 1IWGA 5KT4A 3QT5A 1F2GA 2LCWA 3Q8YA 3ZXWA 3E01A 3LP0A 1YWXA 1X9MA 2QA4G 1O6XA 2VHGA 4TU8A 1N5VA 3MCSA 4ZOSA 1JLCA 3R27A 3TAQA 4ZCIA 1ZTWA 4DQQA 4ZS6A 3PKMA 2WVDA 2AJFE 3TP2A 2CPFA 1WKKA 1IBKJ 5RUBA 1OQ6A 3L7UA 3FBCA 4ZJLA 1UKUA 1X8DA 1Y5NB 2CNKB 5E3AA 1E6YB 3DOMA 1PJ5A 1CVJA 4ZVHA 3LP1A 3M4XA 4U7UD 4JI1F 4CH1A 2ZD1B 1H72C 2RKIA 5D4NA 1RWOB 3MMJA 3OQ2A 3IRXA 3OJSA 3U1MA 5CAAA 3BGRA 3ILJA 2CWXA 1S1TB 2HS0A 1LXNA 4KGZB 4DV1J 2XGPA 2EI5A 1H38A 2PE8A 3S6EA 3PX6A 2DY1A 4CLYA 1N56A 1I5OB 1ZPVA 2B4VA 4H4OB 4JI2F 4AFFA 1RAHB 2WSCC 4EYIB 1IR2A 2XZTB 4RW7A 1EHWA 1U2RA 4RNHA 3OUYA 3DRPB 4A8QA 1QVFR 1T3NA 1XNQF 2YQ1A 1D1UA 3BYPA 4RU9A 4I4BA 3BH6B 1VIOA 3V5RA 4DFPA 4ES2A 2YNHB 2B6AB 4Y65A 3N6MA 3IS9B 2OIHA 2HWIA 5CD4H 3H0PA 4KGMA 1RAAB 2K1RA 3W5ZA 4U95A 4DV7J 4M95A 3EUNA 3TZZA 5T14A 1B0VA 2XNRA 3TJ8A 1QE1B 3JQKA 2EWHA 3C6TB 2R4FA 4DPXA 4DI6A 1R0BG 4YN3B 1HMVA 3ZZZA 3H5UA 3LP0B 4DX8H 2XGQA 3Q23A 4UY85 3R3TA 1YX2A 5F3ZA 1QUPA 2KFYA 4KR0B 2F9DA 3K8VA 2KVQE 4OX8A 2M2BA 1JLCB 5B0CA 2ABYA 1Q5VA 4JV5F 2R42A 2BJ3A 2D69A 4DG1A 3Q22A 2BABA 3EPGA 2KI2A 2CYYA 2DNYA 4O0IA 2DCLA 1HKAA 1LK5A 3CW2C 4I7FA 2CFXA 1Y5LB 2EFQA 4DR4J 3NMRA 4I68A 3ITHB 5K14A 2MHNA 3LF0A 1SXLA 1GEHA 1DLOA 4DR2F 3WZ0A 2VA2A 5J2QA 3BF4A 2XLJA 3LP1B 3ZTPA 2B4PA 4IR9A 2MLXA 2B43A 2RKIB 5K5MA 5LOQA 4RBVA 5BYRA 1AXQA 3IRXB 5F8MA 3C8YA 3EE3A 3BGRB 1DQAA 3GPAA 4L3KA 4CDIA 1Q95G 4HHUA 4F7VA 3HI9A 3N0VA 3GQCA 3VGUA 4WU2A 1VQSA 1AYEA 2L41A 2YQ0A 3RAQA 5DRKA 1RISA 2LXFA 1N5YA 4X64F 4RW7B 4DDFA 3QT8A 4KRWA 1QD1A 2R7OA 3S1TA 2CJQA 3QSYB 2BJ1A 2YH0A 4LRAA 3DN9A 3IAM9 2O66A 1VHIA 2GNKA 4JI3F 4USWA 4O3RA 1S9EB 4DL4A 3CDUA 2KM8B 3TQ1A 1HD1A 3QAUA 1BHNA 4Y0FA 1LK7A 3T1AA 2FTRA 3BGUA 1SJ3P 2K1RB 4EFAC 2RVJA 2C22A 5E0OA 4ECQA 3NOCA 1FWKA 1HQUA 3J7YU 4E8UA 4QR0A 5HSPA 1QTMA 3M8YA 3EVOA 2RDDA 3MMBA 2IDLA 2CPXA 1JQGA 3ILLA 4DV5F 3EZOA 1X7VA 1MMLA 2B3TB 2EBGA 3VCDA 5KFQA 1HMVB 4DR1F 3UD5A 2V6AA 4WKRA 1H3DA 2C42A 3CJ4A 4ANCA 2V4RA 3I82A 5ETRA 1FXRA 4ZJQA 4OX7A 5KFJA 2EG1A 2V2ZA 4FF1A 1FFSB 4P2MA 4DG1B 2HFUA 2RAQA 2DH8A 3MM7A 1QSLA 1UJ5A 4Z37A 3EGVA 2PFDA 2R2UA 4ES3A 1DTQA 4I7FB 1L3UA 2QLWA 1VQKS 3FSXA 2IM3A 2DEIA 3HX9A 2R8IA 1M0SA 2ROPA 5K14B 1SIZA 3DLHA 3L09A 2BM1A 1YIJS 5H1SV 2KTQA 3PR4A 3NS5A 5BYSA 5CHCB 5ETVA 3CDWA 4UUXA 4YHHF 5KFZA 3US5A 3BSAA 4C6AA 3BBCA 4X4VA 4TY8A 2A2DA 1EETB 3ENWA 3VAGA 1IKXB 4YMEA 2RE1A 1P1TA 1X4FA 4AQYF 3ZTOA 4O0NA 2OPPA 1HWIA 1V3ZA 4TLRA 2AYMA 4LF7J 3CCLS 1HHTP 5T7LB 4M63A 4HLBA 4IG0A 2FLNA 1XC9A 3E51A 2WSEC 5KG7A 1QSYA 1TL7A 5DG9A 4J9QA 2AMCB 4NMXA 1X9SA 1RB0A 1SKSA 3TYTA 1NJYA 3R2DJ 4IUFA 4LQ3A 2FVQA 1GK8A 2NXUA 2ZBPA 1HQUB 1YDLA 1FDNA 3CD0A 3GJSB 4DR5F 4IH6A 2FVRA 5HVFA 2FIUA 3R97A 2FVSA 1RT1A 2WVEA 2GQQA 3J80U 2V8PA 2Y1RI 1Q7LB 2FLPA 1NZAA 4NL5A 2E7WA 4PAAA 4JI8F 2AP6A 2GO9A 4C4WA 2UVVA 3T1YF 1KRPA 4LVOP 2KHDA 1LEOA 1HWLA 5MAOA 1VLOA 2K8GA 4EWTA 2JC1A 3FC9A 3MM7B 4F0HA 1C1BA 4ID8A 5GMDA 1VQOS 1LQ9A 1DTQB 2Z2YB 2YNGA 2LXIA 4RU2A 4NCGB 1BD6A 2E1RA 2HVDA 3DLBA 1PC5A 1T9XA 3MD3A 1NPKA 3MECA 2HHUA 3VTIA 3RU0A 2IDEA 2VOPA 4D3GA 5D78A 2C2MB 5IZHA 1WF0A 2XEXA 4LF6J 1HWKA 1VRUB 2JRSA 3PO4A 4TY8B 3CJTA 1VBYA 3MMAA 3KLFB 4OZ1A 5AE1A 2FLOA 3SV3A 3HPOA 4PXCA 3AXKA 4CH0S 2P6TA 1H73A 2IVMA 4LF9F 3F0NA 1DZ5A 3IBCB 1VQNS 3M1VA 1Q8KA 2OPPB 4JI5F 3EICA 4XIUA 4J9KA 2HNZB 1JNZB 2ZBCA 1PBAA 1XR5A 5A8WA 4YY3J 5DS7A 3UD4P 3FEYB 2F3JA 1S5ZA 3HHLA 1V9OA 4IG0B 3SBMA 3MM6B 4RBUA 4PEOA 3CT9A 3W5YA 1TL7B 4GRSA 4C0HA 3HVRA 3EZ5A 1FD2A 2Z8QA 1ZETA 4ZLJA 1ZM4A 2G4BA 2OUGA 4C8YA 1MW7A 3ISNC 1VQMS 1RU1A 2AV5A 4OYXA 2UUBF 1MU2A 3HSGA 3MMCA 3N9UC 4NRTA 2AEJA 3PKYA 1BXNA 4HYKA 4FN5A 4FDFA 1RT1B 2ALYB 2X7IA 1FVQA 3HT3A 1N6QA 2J9DA 2YWKA 2V63A 3G82A 2M88A 1JJ2R 3R5AA 1S1VA 4O3NA 1WEYA 3VAKA 3RB3A 1N36F 1U26A 4YB6A 2XO7A 1CC8A 2KFNA 2CQ3A 2JEFA 3TWZA 2VFSA 3MUVP 3T9ZA 3AJ2A 3IWLA 1TKTA 2XB2D 1C1BB 1YSJA 3QRQA 3C14B 1KLNA 1HI1A 4WZMA 2W7OA 2ZZNA 2XMVA 2YBVA 4QW8A 5L1IA 1RHUB 3MECB 3OR1A 4PG5A 2R8JA 5LJ3Y 4LRFA 3KLIA 3TA1A 4YB5A 1N54B 4DUYF 5HQLA 4OYZA 2IJRA 2D9PA 2UUAJ 1WOSA 1PYOB 1FDBA 2V94A 1URNA 3WHIA 1F5AA 3A8EA 4KY3A 2FJEB 4RWWA 2UU9J 4P2FA 5EN1A 3P5BP 2RIJA 3M1VB 5KFTA 1S57A 2ASLA 1FRIA 1VQPS 3BYRA 2XG8A 4CM2A 2OEJA 5A8WB 4ZMMA 2VPYB 2DTJA 3EGZA 5IT0A 3HHLB 2YNFA 2HWTA 1DRZA 2IY5B 4P73A 4MIAA 3DI6A 1N8RT 2J76E 4XPEA 2LLZA 2B7BB 3DOLB 2X1GA 1M5OC 1H7WA 1FJEB 3OXFA 3AOAA 2D3OR 3W1YC 3MMCB 3D68A 4LBPA 3W62A 1JMTA 1S12A 2VJVA 2H65B 4KV8A 4X4PA 2RQCA 3PEHA 1N6QB 2IJNA 3G82B 4ECUA 3V81A 1S1VB 3RB4A 3CEDA 2IM2A 1X0PA 2H3EB 4NXNF 3CC4S 3MEEA 4G6VB 3G8TA 1K44A 4BCAA 2DNMA 2RH3A 4ANDA 1VS3A 2W7AA 3OL9A 3DRSB 1T0TV 2EEYA 3CF5Q 3KG1A 4KT0C 1CC7A 5CA5A 1OY8A 1TKTB 2IFXA 1CJKA 5DLGA 4X4NA 2LU2A 1LW0B 4RUHA 4B02A 2VQEJ 4JV1A 2JLEA 5HATA 1R3NA 2UXDJ 2UUTA 3OR1B 2J8AA 4B9VA 3KLIB 1DQ8A 1N32F 4DU8A 4N41A 4NLDA 2R8HA 5JJBA 3J7Z5 1KHVA 2BRKA 2BQRA 3GG0A 3K5LA 3KG4A 5IQQA 3BGFA 1P27B 5KFWA 3WIUA 3GCXP 2R9LA 3PM9A 3ENAA 4ECZA 3MXHP 3H8YA 2AKWB 2DGXA 3O2IA 1JJ4A 2HKEA 3W7BA 1FXDA 2CPIA 2POKA 2QIFA 2AD9A 1NJXA 1F60B 3RR7A 1MROA 1RA7A 4A47A 3Q89A 2PDAA 5DGAA 2DB1A 1HLWA 5DQIA 4KGXB 5F8NA 4YR3A 3GLJA 2V9WA 1TVRB 5LMNF 2GMJA 3DRXA 5HJYA 1WC4A 3Q8QB 4MKYA 3HLUA 2OI2A 1QTNB 4DV0F 2XMJA 3M2RA 5KFVA 4QCLA 3THTA 4KV8B 1RT6A 1FD8A 3PHEA 2QSWA 2CZ9A 1FKPA 1XIQA 5KFRA 3V81B 1HBOA 2U1AA 4ANEA 3PW2A 3BDPA 2I38A 2CZVC 4A8XA 4P2XA 3MEEB 3FDSA 5I4MA 4OHYA 2M52A 2RRNA 4JI0F 2QX0A 2ZUGA 4C3MA 2MGZA 4PXDA 2FVPA 4DX7A 3HVAA 1S1XA 1H7XA 1XQIA 1CJKB 4Q5VA 4LIWA 5C2CA 1FNMA 4ZPDA 4Z7CA 3SQGA 4FS1A 1RLDA 1OSCA 4MIBA 3M32A 3QFWA 4ZKAA 2HRYA 3Q8VA 4LRDA 1RU2A 2XSJA 1T95A 1IM4A 1RWXB 2VJUA 3FZBA 1HHSA 5HLFB 2UXCJ 2D41A 3HXMA 2K2PA 2VFUA 2O67A 1HNXJ 4DSEA 2QA2A 3FEXB 1T05A 4GKJJ 1HNWJ 3LGNA 3MOJB 3D28A 1SKWA 1YQHA 1D3WA 3TAPA 1FKOB 2ATLA 1AFIA 1TQLA 3IR5B 2PGCA 2VASA 3D1OA 5LJ5Y 2ROGA 2VC1A 3KK1A 3V6HA 4ELVA 2QLJB 2VPXB 2Q79A 5IS2A 4CQ1A 3G6XA 2RHSB 2WONB 4J9MA 3DU5A 1NK8A 2WVBA 2G2YA 2JHEA 5A6WA 1S59A 1I3OB 2BZ2A 1UVMA 3MR3A 4WU3A 3FSIA 4WFZA 1WD6A 1JLAB 4ED7A 1PAEX 3BO4A 3NGSA 3BKUA 5B0BA 4YFUA 3NXZA 2ZKTA 1VRQC 1JJCB 2VDIA 1YLXA 3UWTA 4MFBB 3M2RB 2YWWA 4I0WA 4HACA 1RT6B 4UW2A 5H9EJ 5CH7B 3F56A 2MZQA 2JLGA 4TN2A 3KNAA 2BM0A 5HJXA 2Q6BA 1HBOB 4F3QA 2L48A 1U8SA 1R89A 1W25A 5HP1A 1OMSA 5IOLA 2MGZB 2HS4A 1WI8A 1RTJA 1S1XB 1KHWA 3GR1A 4Y3CA 2J5AA 4LF4F 2B8PA 2NS1B 5D0HA 3VZHA 5F8GA 1F9HA 3FK4A 1YITS 3SQGB 5DJBA 3M7VA 2C3PA 4XPCA 4Q7AA 2HEKA 2HQDA 2PD1A 4ER8A 2C2RA 2FHJA 4DV3J 2CQ2A 5DZ6A 2B9WA 4CLUA 4K4WA 1TFYA 2P8IA 4DR7J 1O0PA 1C4AA 3CJRA 4DPYA 2ERRA 2G1HA 3B54A 1P9YA 5L9XA 3AFGA 1T05B 3KMSA 2Z58B 5KFAA 4MMOA 1IKYB 3TX8A 2IYGA 2MSTA 5AJ3F 2HK3A 3R5BA 4HVZA 5ETTA 4EBCA 3BDEA 3T41A 4U6PA 1TKXA 5B7WA 4X65J 4GMKA 1XMOJ 5K8MA 3CMQA 4C8LA 2J0SD 4XAKA 1SUQB 3PJ9A 2CPZA 3DGPA 2HIQA 3RW7A 1RKIA 2O1PA 2DRAA 2W7PA 1C4CA 2Y0SD 3MM8B 2C3OA 2MQOA 4QPXA 5FIIA 4PUOA 3FVYA 3EM1A 4I1TA 1R31A 2XCPA 2KFZA 2IAJA 1S6QB 3D9BA 5HANA 1HW8A 1E6VB 2H51B 2IBOA 2I0XA
chains in the Genus database with same CATH topology
2W2NP 2Z2YB 3AFGA 2W2OP 3A3NB 4JP8A 3BGOP 4OV6A 2W2QP 2Z58B 3H42A 3A3PB 4NE9C 3T41A 4YN3B 3BPSP 2Z57B 3QFHA 2XTJP 2QTWA 2Z2ZA 2ZWOA 3P5BP 3WHIA 3GCWP 3WIUA 2PMWA 3GCXP 4K8RA 3A3OB 3CO0P 2W2PP 1ITPA 3VV2B 1R6VA 2E1PA 3VHQA 1SCJB 1V5IB 2Z56B 3SQOP 3WIVA 3CNQP 2ZWPA 4NMXA 1SPBP 2Z30B 2W2MP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2N P;  2Z2Y B;  3AFG A;  2W2O P;  3A3N B;  4JP8 A;  3BGO P;  4OV6 A;  2W2Q P;  2Z58 B;  3H42 A;  3A3P B;  4NE9 C;  3T41 A;  4YN3 B;  3BPS P;  2Z57 B;  3QFH A;  2XTJ P;  2QTW A;  2Z2Z A;  2ZWO A;  3P5B P;  3WHI A;  3GCW P;  3WIU A;  2PMW A;  3GCX P;  4K8R A;  3A3O B;  3CO0 P;  2W2P P;  1ITP A;  3VV2 B;  1R6V A;  2E1P A;  3VHQ A;  1SCJ B;  1V5I B;  2Z56 B;  3SQO P;  3WIV A;  3CNQ P;  2ZWP A;  4NMX A;  1SPB P;  2Z30 B;  2W2M P; 
#chains in the Genus database with same CATH topology
 2A2C A;  4J9R A;  4TVA B;  2OO4 A;  5I3U A;  1OIA A;  1IQZ A;  2EPI A;  1FCA A;  1B4S A;  3WQP A;  3QRR A;  2JVO A;  1RTH A;  5LSO A;  4DZD A;  3GIR A;  4XDC A;  5HP1 B;  3I5A A;  2XHW A;  2KG0 A;  2B7C B;  2IVY A;  2J8S A;  4ZIW A;  2W2P P;  1U02 A;  1KQF B;  5IWA J;  2F8E X;  1FX2 A;  2YKM A;  3IP0 A;  1NB2 A;  1RTJ B;  2K7K A;  1EP4 A;  1L3S A;  1MMN A;  4M5L A;  2AT1 B;  1UW4 A;  4HEA 9;  2YX4 A;  1YJ7 A;  5DQH A;  1JB0 C;  2XSF A;  4ZIV A;  3GJR B;  1VCT A;  5EDW A;  1T03 A;  2GA7 A;  5K8P A;  4X66 J;  2YH1 A;  3LWM A;  2VF3 A;  1D9A A;  4FPR A;  4N76 A;  1A6L A;  3EMT A;  1Y4Z B;  2GHW A;  3QGG A;  4H4K C;  4OYI A;  3HVT A;  3AOB A;  2Z57 B;  3BQ0 A;  3ZZU A;  4A8W A;  2DNK A;  5KFS A;  2VU5 A;  2H1Y A;  4DFM A;  2CA9 A;  4TQR A;  4QYR A;  3P5T L;  2HYI B;  3SFU A;  2R8G A;  4DUZ F;  2PC6 A;  4W4M A;  4M1K A;  2PSZ A;  4A4J A;  4LFB J;  1TKX B;  3LA0 A;  3TVY A;  5B0E A;  2QFI A;  3BPD A;  3OL7 A;  3PW0 A;  4LSN B;  1GX5 A;  3N4W A;  4KQZ A;  1RAO A;  1G3O A;  4EZ9 A;  4ZP6 A;  2JH3 A;  2V4Q A;  2PEH A;  1V5V A;  2E5L F;  4NEZ A;  4PUO B;  2HBY B;  3H4D A;  3OTE A;  2IAJ B;  4L72 B;  2AZ1 A;  5I3U B;  3MEK A;  1S0O A;  3HD2 A;  4JYA J;  5L1K A;  4HI2 A;  2IMO A;  1R0C B;  1Z1Z A;  2DGQ A;  1IXK A;  3VQT A;  3LAM A;  4HH0 A;  1REG X;  4O3P A;  1RAI B;  4OYW A;  5E3R A;  2AGP A;  4WCE Q;  3M6V A;  1ZBT A;  4R0E A;  4CLZ A;  1HNI A;  4DL7 A;  2YKM B;  1RT3 A;  3FMB A;  1SJF A;  4IFY A;  4IRD A;  1WHV A;  5LSR A;  3CJ8 A;  3JS9 A;  4J5O A;  3PV8 A;  4Y00 A;  2ZM6 F;  3KUH A;  2RUS A;  2VH7 A;  3CJ5 A;  5E5N A;  5CCM A;  3NAI A;  4KJI A;  4S0M A;  2P6S A;  2OD4 A;  1T03 B;  4K59 A;  1JLQ A;  5G0R A;  2AJ2 A;  2CVE A;  2RQ4 A;  2ADB A;  2GJF A;  2OTL S;  1MNE A;  3JB9 k;  1PSD A;  5D3G B;  2N7C A;  1VBZ A;  4IH7 A;  1FTC A;  4B3O B;  2L3M A;  4RUA A;  1TMM A;  2PO4 A;  3K89 A;  4MYU A;  2H48 B;  1TUW A;  4P2S A;  3I9Z A;  4PWU A;  1JXL A;  4JI1 J;  3D0I E;  2XMM A;  2W9B A;  2UVU A;  2DNL A;  4QWB A;  2L9D A;  1DBD A;  1I94 F;  1U24 A;  3TA2 A;  5KOW A;  4LT6 A;  3PYF A;  3ULH A;  3GIM A;  2E1P A;  3HD1 A;  2L08 A;  1V3R A;  2VG6 A;  4KGK A;  1NK6 A;  3P4U B;  4YP3 A;  5D15 A;  2GML A;  4JI2 J;  2BE2 A;  4CLK A;  2G1D A;  3QJL A;  4ED2 A;  1D8Z A;  3DNC A;  4ID5 A;  4U67 Q;  1N48 A;  1YJT A;  2XMW A;  1H74 A;  1CJV A;  4NA3 A;  3CCS S;  1XNQ J;  3GV8 B;  2LA6 A;  1FK9 A;  3KJV B;  3MR7 A;  4YOE A;  1U1O A;  1R8A A;  1WDT A;  3QLH A;  1OSD A;  4LR9 A;  1X4A A;  1U6Z A;  2KM8 C;  1RBA A;  2KL8 A;  3BBB A;  4NLT A;  2HQF A;  2GCF A;  1O51 A;  2CNO B;  2WAQ D;  4C8N A;  4FNH A;  4QW9 A;  1DTT B;  1LWE A;  4ECW A;  3RB6 A;  4QIG A;  4UOG A;  2CQI A;  1KDN A;  3UW1 A;  5KFN A;  2DJW A;  2QMX A;  1M5P C;  4URG A;  1PCA A;  1HNI B;  1RT3 B;  2PMH A;  3UD3 P;  4ZVP B;  4OZL A;  3I4H X;  4ECY A;  3OPK A;  2E9R X;  1S72 S;  2KN4 A;  1N5T A;  4DU7 A;  2R7X A;  1FX4 A;  2IJF A;  4ZVG A;  4JV5 J;  5T41 A;  1SJ4 P;  2OMO A;  1T9Y A;  1JKH B;  2HFN A;  1YJ9 S;  3VGV A;  5G0R B;  1EKR A;  4HT7 A;  3DMJ B;  2YWF A;  1S1U A;  5KG1 A;  3CWJ A;  2EFG A;  4PRF A;  3U7J A;  3OXG A;  4PG6 A;  3W60 A;  1FJ7 A;  1Y9O A;  4DR2 J;  1U49 A;  5J1E B;  3J7A N;  2YKQ A;  1X4B A;  2DHH A;  2E66 A;  4Q45 A;  3VAF A;  3U1L A;  1XNR F;  4ILL A;  5KFG A;  3NCP A;  1NBE B;  4OV6 A;  2W9B B;  1XMQ F;  4Y2C A;  1UTA A;  3BKF A;  1Q0N A;  3OL6 A;  4Y28 C;  2HZC A;  2J6S A;  1TUG B;  2WTF A;  4WYL A;  1U1P A;  4Q44 A;  1DUR A;  2MJN A;  3NGT A;  2VG6 B;  2HFS A;  3PW7 A;  2EFP A;  3MCO A;  1L5U A;  2Z4P A;  1IKW A;  4UOF A;  4ZPT R;  3IXQ A;  4X64 J;  4B9S A;  4KB7 A;  1NRK A;  4NLP A;  4ID5 B;  3HSJ A;  5B08 A;  1FHT A;  1CJV B;  1RT2 A;  4C48 A;  3IWX A;  1FK9 B;  2BJE A;  1LV5 A;  1EB0 A;  3OW2 R;  4JI3 J;  2HG4 A;  1WHW A;  3P49 B;  2JZ5 A;  5K8O A;  3T19 A;  3QZ7 A;  1PYT A;  3RUB L;  2JFK A;  1FJG J;  3QLH B;  2G0C A;  4BWJ A;  1K0V A;  4O3O A;  3CSK A;  3TR5 A;  2FHJ D;  2VFV A;  4ICL A;  2ZUA A;  3ZC4 A;  3I31 A;  4O23 A;  2ILZ A;  5DZ7 A;  1RA6 A;  3DLJ A;  1VQ9 S;  3M9M B;  1LWE B;  1Y10 A;  4DV5 J;  4NCA A;  5B09 A;  5LL6 d;  1JXV A;  2V4J A;  2MXY A;  4F26 A;  4DR1 J;  3PJX A;  3BGL A;  3A8I A;  1GQE A;  2A1B A;  3GIJ A;  3KK3 A;  1FF2 A;  2N4D A;  4NA1 A;  4FVM A;  5HL7 Q;  3QT7 A;  2BUN A;  2YPY A;  2RDJ A;  2YX7 A;  2B5J A;  3H90 A;  5HO4 A;  2D1C A;  2QGF B;  4DR6 F;  2LFV A;  1RBL A;  1RHR B;  4DV4 F;  3AD7 C;  3O6Q A;  1X9W A;  4ZA1 A;  1RUS A;  3IA0 A;  2MTL A;  4ZVF A;  4UQT A;  4K8R A;  1QAX A;  2XS2 A;  4EEY A;  1XK8 A;  3W64 A;  4K5R A;  1CEZ A;  2BOA A;  2QSF A;  2ZH9 A;  4B3M J;  1URR A;  3ZZ0 A;  2IC3 A;  3POT A;  2APO A;  5HN0 A;  2YWH A;  3BH7 B;  3IGV A;  1TMJ A;  2JNJ A;  2XMT A;  3IFE A;  3FQL A;  1VIX A;  2F4V F;  1NB7 A;  3A4T A;  3BQ2 A;  3PAC A;  2DEJ A;  4OI4 A;  2C3U A;  2RRB A;  2W9C A;  5HQ8 A;  3EGN A;  3GTY X;  2XM3 A;  2AIR B;  1T3O A;  5KFK A;  1LWC A;  3D4J A;  2R8K A;  1RT2 B;  2HVI A;  1QM9 A;  3C46 A;  4QU6 A;  2DRD A;  3MUT P;  3TUI C;  1TAU A;  3T1H F;  2DIS A;  1RTI A;  2M9K A;  3ZNJ 1;  2OPS A;  1F5C A;  4OQJ A;  2QMW A;  1UA0 A;  4ICL B;  2G2O A;  1KTQ A;  2FJA B;  4J9S A;  1U8W A;  3IN5 A;  4HHJ A;  4DR5 J;  4BS2 A;  3GJT B;  2AJ1 A;  3HHD A;  2DR7 A;  2QLF B;  4C7Q A;  2FZG B;  1UPP A;  4NI2 B;  2V4J B;  2XYG B;  5D4P A;  2ZH8 A;  3M8Q A;  1XN9 A;  2M3D A;  4I56 A;  1RWN B;  4JI8 J;  1S77 D;  3EGW B;  4ED8 A;  3KK3 B;  3R1H A;  5KT2 A;  3RTV A;  3T1Y J;  3W65 A;  2HHW A;  4LBH A;  4IQM A;  3IM8 A;  1RLC L;  4OJH A;  4OZ2 A;  1HWU A;  2VFR A;  2VDH A;  2DNZ A;  1Q7Y T;  4WP9 A;  3U27 A;  1IM6 A;  2AQ4 A;  4PPD A;  4GVL A;  3SEO A;  4M5G A;  3R7S B;  3HDS A;  4CP5 A;  4USI A;  4ZDN A;  2VG7 B;  2AZ3 A;  2W25 A;  2KXH A;  2OEK A;  2G0J A;  3FQK A;  3V4M A;  4OHZ A;  3MAA B;  3F44 A;  4CO2 A;  4RO0 A;  2HBQ B;  1FES A;  4NLV A;  2PII A;  1RHM B;  4OYB A;  3HCX A;  2FD2 A;  1L3V A;  1SQG A;  1YG0 A;  1K73 T;  1HL6 A;  2YWG A;  3QJP A;  1WTF A;  2FPH X;  1YZ6 A;  4LF5 F;  2IC3 B;  4NRU A;  1FRX A;  4NZ6 A;  5KT5 A;  3POT B;  2WOM A;  4LF9 J;  3D6T B;  3AB2 B;  1J27 A;  1PG5 B;  4H54 A;  2F1F A;  3PNI A;  3UDE A;  4JI5 J;  1B7Y B;  1RCO B;  3TEG A;  4O3Q A;  1R6V A;  4C8M A;  3EDQ B;  2W9C B;  3UN3 A;  3UQS A;  4ECR A;  4HDH A;  4QWD A;  3TJA A;  3HHL C;  4CT8 A;  2BQ3 A;  2ASY A;  5L9N A;  4OLP A;  4ECT A;  5IV4 A;  3I0R A;  3WX8 A;  2FLL A;  3AA9 A;  2AW0 A;  2XYP B;  2LQJ A;  1RTI B;  5F8I A;  1RDR A;  4M5H A;  4DL2 A;  3TJ9 A;  2F9J A;  3TZY A;  2OFH X;  2UUB J;  4KHP F;  3NS6 A;  3UDV A;  2E44 A;  1FE4 A;  3CIZ A;  1OYE A;  4MK7 A;  3DOK A;  4KPC A;  3QRP A;  3H2U B;  2KZM A;  2E1M C;  4DSI A;  2N82 B;  3JTP A;  2KB2 A;  1N36 J;  4C8Z A;  5H9F J;  3H2L A;  4F0M A;  4LBI A;  2GW8 A;  3HFV A;  3NBP A;  4CLL A;  1U1M A;  2FUG 9;  2CUY A;  1R8H A;  3EZU A;  2V2K A;  2XWX A;  4ELT A;  3SXL A;  2LMI A;  1RXO B;  4U8V A;  4OX9 F;  5F8H A;  3N5B A;  1S0V A;  3LUY A;  4CO1 A;  2BJ8 A;  1WSR A;  2NZC A;  3FFI B;  3CJ2 A;  3G71 S;  1J5E F;  1WG5 A;  1TL4 A;  3QWU A;  1GFW B;  4Q0B B;  4CLT A;  4FPI A;  2GZO A;  2CJ9 A;  1PBU A;  1ROF A;  4LRC A;  3OL8 A;  1ICE B;  4RKU C;  3KK2 A;  2GS8 A;  1JK9 B;  4NOH A;  3K5N A;  3OHB A;  2IYI A;  2I8E A;  2CQG A;  2GX8 A;  4LJM A;  5GAH I;  3AXM A;  2FYX A;  2R3V A;  4TKT A;  3SSQ A;  2K06 A;  4A8S A;  1VQ4 S;  2GAH C;  1TV6 A;  3CE8 A;  3Q83 A;  3LQV A;  3ZNU A;  4F50 A;  4G1P A;  4WYW A;  1UVI A;  2E29 A;  5B0D A;  1WC0 A;  1MG7 A;  2HWH A;  4N8N A;  2MZ1 A;  3C6U A;  1HHQ A;  3KJQ B;  5DET A;  7AT1 B;  5LXR A;  3I0R B;  1NDK A;  4TYB A;  1VLY A;  2W4P A;  2G9O A;  4QIV A;  3DDK A;  3GIL A;  5FJ4 A;  4DV2 F;  8ATC B;  2H5J B;  5BR8 J;  2DXF A;  2CIM A;  4PXE A;  4KFB A;  4X4T A;  1F9E B;  1QAI A;  5ETS A;  2PI4 A;  3BSN A;  1SKR A;  4DL5 A;  4RUC A;  3OVA A;  3NGR A;  1PIE A;  3DOK B;  2C3M A;  3CXC R;  2GGP A;  3KMQ A;  2UUC F;  2ZVS A;  2QO3 A;  2MQP A;  4NXN J;  1J5O B;  1GT8 A;  2F8H A;  2VD3 A;  3C15 A;  3NBP B;  4IG3 A;  5E2Q A;  4W92 B;  3KUE A;  3OVS A;  2Q43 A;  3QID A;  1S48 A;  3L7P A;  3RRG A;  5BJR A;  3MF5 A;  3S01 A;  2CVI A;  1CBK A;  1WEL A;  1U47 A;  3VV2 B;  4K4X A;  4UST A;  2ZZT A;  1WDD A;  2HSE B;  3N6N A;  1SB6 A;  1N32 J;  2ZBR A;  1G7C B;  2ZC3 A;  1ZM3 A;  1TUV A;  4B3S F;  3GFY A;  3BSO A;  3QWP A;  4LIR A;  4ZPB A;  3FBF A;  2EKY A;  4IFV A;  3IWN C;  2DR5 A;  1HI8 A;  3TZW A;  2LXU A;  2VIH A;  3C16 A;  3PG9 A;  4IO1 A;  2HLT A;  2J9E A;  1AB8 A;  3R8Y A;  3LWL A;  2KVI A;  3LPY A;  4GVB B;  3G9C A;  3UCG A;  3VVT A;  2VIC A;  3QT6 A;  3AJD A;  3MR5 A;  1F3V A;  3MPW A;  1R7I A;  3EJM A;  4BLG A;  1N5Q A;  1S1W A;  2EC2 A;  2CG4 A;  4F4K A;  2F40 A;  3OBI A;  1RTD B;  1HR0 F;  4LRB A;  4ZIT A;  2HQC A;  3OJU A;  3W61 A;  5J2M A;  1NDP A;  3CVK A;  1LWX A;  5LMN J;  1RAD B;  1HA1 A;  4KO0 A;  5DG8 A;  2MHE A;  4LSL B;  5KFH A;  4DV0 J;  3Q8P B;  4G3I A;  3LAL A;  1Q86 T;  3GG1 A;  1UWA A;  3CCT A;  1KKH A;  3NS7 B;  1SC4 B;  3IBW A;  3HVW A;  1ZA2 B;  3VVU A;  1Y0H A;  3E3X A;  2HFO A;  3OLA A;  5DLF A;  2GC8 A;  2GGP B;  1R27 B;  4I6W A;  3EX7 B;  1P1L A;  2KXF A;  1UAW A;  4RWX A;  3LO3 A;  1KC8 T;  2V8G A;  4A8F A;  4K0K F;  4JI0 J;  1BE4 A;  3M8W A;  3K5O A;  4L6V 3;  5ETM A;  4CLW A;  3C15 B;  4F02 A;  1P6T A;  3VHQ A;  1RT7 A;  2PN6 A;  3G8S A;  4FXW A;  4NLY A;  4IG3 B;  3RBX A;  1T94 A;  1RT5 A;  2I1R A;  5KFD A;  3ICL A;  4RX6 A;  1Q8I A;  2MZT A;  1T9V A;  2IVF B;  4IR1 A;  4OZN A;  2MB0 B;  1KOH A;  3W66 A;  1RT4 A;  3HSZ A;  4RLE A;  4W90 B;  2RML A;  3SSR A;  2HGL A;  2MQN A;  4IFV B;  1WOO A;  5KG0 A;  2Q1L A;  4WFN Q;  3TZX A;  3W9J A;  3PR5 B;  2EKN A;  2V8V A;  4WK3 A;  4BWM A;  5DDQ C;  5BYQ A;  2FJW A;  3KLG A;  3MWB A;  3ETO A;  1K1Q A;  3OR2 A;  4K5S A;  4P74 A;  1LWF A;  4C8K A;  4DEZ A;  4ILR A;  4J91 A;  3MZI A;  1S1W B;  3VGT A;  4X62 J;  2HGN A;  2YNI A;  3NWR A;  3PFE A;  2EG2 A;  1I6J A;  3AOC A;  1PC4 A;  5CYM A;  1U4B A;  1TTH B;  2OJ3 A;  4YDD B;  2VPZ B;  3MCN A;  5J2M B;  1TR0 A;  1SL1 A;  5ETO A;  1QAJ A;  1TK8 A;  4KO0 B;  3QGI A;  3D66 A;  4W98 A;  1Q82 T;  5KFI A;  4NYO A;  2QV6 A;  3MPY A;  2BXJ A;  2BKP A;  3DHW C;  3E01 B;  1VQ7 S;  5EX0 A;  3JXO A;  4I6Y A;  4OZ3 A;  5JUM A;  2KRB A;  3TAR A;  4IYQ A;  3WC2 A;  1SKU B;  2W8L A;  4ZVU B;  1LW2 A;  4ZPA A;  3WBZ A;  5GAE U;  1UEU A;  3GFH A;  1S9G A;  5E3P A;  2I5J A;  5KFB A;  4AL5 A;  2NYI A;  1F3F A;  3AQP A;  4EBE A;  2O3D A;  5I3Q A;  1UL3 A;  2R2T A;  4LF4 J;  2GMH A;  3C3L A;  3CCZ A;  4KH0 B;  4TU9 A;  4R25 A;  2LDY A;  2F63 A;  3B4M A;  4IDK A;  3HK2 A;  4LMZ A;  4P7V A;  1CQN A;  2D3O 1;  3DOM B;  1BQX A;  1XWL A;  2F5G A;  1VFJ A;  4KSE B;  2L9W A;  2P9C A;  3PYD A;  1K0T A;  3B8H A;  1BQN A;  4M5M A;  3DLL Q;  3D6F B;  4MH8 A;  2NPI A;  3MED A;  1MWQ A;  1RT4 B;  1PJ7 A;  3D6H B;  1FFW B;  4K7Q A;  2QLB B;  1LNQ A;  1H2V Z;  1NXI A;  2DGO A;  3LAN A;  2VKZ G;  3WX4 A;  2W2M P;  4CLS A;  3D1H A;  3NKY A;  2KRR A;  4GO7 X;  4F4X A;  4F4Z A;  2WHO A;  2QL9 B;  3HJV A;  1SQE A;  1NM2 A;  1HPZ A;  4K4S A;  3G96 A;  2O01 C;  5AJ3 J;  3KLG B;  5DQG A;  2DO4 A;  4PWD A;  1M5S A;  3CDA A;  3OUY B;  3CNQ P;  3UDL A;  3OFE A;  4JI7 J;  3OV7 A;  2KDO A;  3TA0 A;  3H5X A;  2XTJ P;  2XMA A;  1PIL A;  4IOC Q;  2BV3 A;  1YVF A;  3GFZ A;  1BMQ B;  2YNI B;  1OWX A;  4CO3 A;  1FJG F;  2OH2 A;  4EGL A;  3CCV S;  4DX5 A;  5CYM B;  3PRD A;  4ZN3 A;  4J37 A;  1KQK A;  2MY7 A;  1ULR A;  5H9E K;  2XUL A;  3JYT A;  1ZTT A;  1KQG B;  2EW9 A;  2U2F A;  4KHR A;  3H42 A;  5GAD I;  4WP3 A;  4FBT A;  4CZC A;  3LW5 C;  3PIP Q;  5KFX A;  1LKZ A;  3OTO F;  3MGJ A;  4USH A;  3TW0 A;  4WTO B;  4EYH B;  2AYG A;  3BS9 A;  2J9D E;  2O5D A;  1IQT A;  3H4B A;  1S9G B;  2I5J B;  1TL3 A;  5HRO A;  1B99 A;  1RAG B;  2IM0 A;  3FKB A;  4RL1 A;  1HYS A;  4LF2 A;  3VAM A;  3CJK A;  3I6P A;  3FZ2 A;  2R7Q A;  3G8Q A;  3R2C J;  1REV A;  4PG4 A;  1DLO B;  4K50 A;  2N3L A;  5J2Q B;  3B78 A;  4OZ0 A;  3FRY A;  5F9L A;  1GMU A;  1BQN B;  4DN9 A;  3M30 A;  2BR0 A;  2Z2L A;  1T02 A;  1S7I A;  5CYQ A;  1S9F A;  3MED B;  4UTG A;  4B3M F;  2I9S A;  2DK2 A;  1SBR A;  2QC3 A;  3H25 A;  3DGV A;  2RB7 A;  3M05 A;  1S0M A;  2AF6 A;  2GIR A;  2M0G B;  3EDR B;  2NYH A;  1VC6 A;  2EK6 A;  3UNG C;  3LGH A;  3NAH A;  2KZZ A;  3HJF A;  2CNN B;  1HPZ B;  4EO8 A;  5D4L A;  1FRJ A;  3ETM A;  2OML A;  1RHJ B;  2MKI A;  4DQR A;  1N5Y B;  4PWD B;  4DUZ J;  4Q2L A;  2FVC A;  1UVL A;  2PT0 A;  1MN9 A;  2VZ9 A;  2PFF B;  3H5S A;  1WTB A;  4PXB A;  3QAE A;  3THP A;  1FWP A;  3BEG B;  3M8P A;  4URS A;  5GMK a;  2D74 B;  1VHF A;  1TEL A;  2KKH A;  1M1H A;  2W24 A;  5A8K A;  3IAS 9;  2E5L J;  4A48 A;  2F4F A;  6AT1 B;  4YQW A;  5DDP C;  1N34 F;  1RAF B;  1CLF A;  1HWJ A;  3DLK A;  3J81 U;  3MMB B;  3CUN A;  5IQ6 A;  3JYT B;  3P6Y C;  3MR2 A;  3DCA A;  1ZAW A;  1FKA F;  3CJQ A;  2XWY A;  4B3R F;  1JX4 A;  4N8O A;  1U7L A;  4N47 A;  3T9N A;  1MLA A;  3P3D A;  2ZJR Q;  4B9N A;  1YBA A;  5IT9 Y;  2R7W A;  1VJQ A;  2FZK B;  2W9A A;  3NRB A;  5HRO B;  3AD9 C;  4HH1 A;  4MKA A;  3ZTQ A;  1ITP A;  1UA1 A;  1KBR A;  3I87 A;  3CPW R;  4TLQ A;  2RS2 A;  4QWE A;  4USV A;  2JWN A;  1REV B;  2ZM6 J;  2H4W B;  2YY3 A;  3H59 A;  1KP6 A;  4TXS A;  1K9M T;  4NLW A;  2KXN B;  3FGV A;  1HNZ F;  2NUU G;  3M30 B;  4J9L A;  3QQC D;  5KAK A;  5CYQ B;  1NHK L;  3CCW A;  3R6G B;  3G6V A;  1AFJ A;  2DKO B;  1OY6 A;  2B9E A;  4OHW A;  3C2P A;  4IOA Q;  1D9F A;  1VMB A;  4C0B A;  2XCA A;  2GVD A;  3GV7 B;  4GKK F;  4FBU A;  4OV1 A;  1YK9 A;  4WBF A;  3CDB A;  2MQQ A;  4A8O A;  3HHK A;  4ED1 A;  2R2R A;  4RPF A;  1I94 J;  3I5C A;  4FYV B;  4DJB A;  1NJZ A;  3G6E S;  2WW4 A;  3OTD A;  2RIL A;  4NLQ A;  3P8B B;  3OFH A;  2XS7 A;  5D0R A;  1CUL A;  3CO0 P;  2NXC A;  2HFZ A;  1S99 A;  2DNP A;  3AOD A;  1S4E A;  2QLX A;  1JXE A;  2HMI A;  3GJQ B;  4YS2 A;  5B0F A;  1SC1 B;  5A8K B;  5CZV A;  2NXE A;  1GTH A;  2FJX A;  1U25 A;  3M6U A;  1GX6 A;  3CCE S;  1BUX A;  2J7K A;  3KLV A;  5CCL A;  1S4F A;  1TU0 B;  1BWE A;  1YJR A;  3KHH A;  4DF4 A;  3VAI A;  1PGZ A;  2IHR 1;  5JVH Q;  5KT7 A;  5A8R A;  3NLC A;  4WE1 A;  3D3B J;  2NZ4 A;  1NKB A;  2C2Z B;  1GH8 A;  4JI4 F;  1WG1 A;  1CJT A;  1S7H A;  2NCK L;  4X2B A;  2YPZ A;  3RW6 A;  1RWU A;  1F5B A;  4IRC A;  2A6M A;  1FDD A;  1TZ0 A;  3J81 j;  1W7W A;  2CKW A;  2UXB F;  1J2V A;  3KHR A;  1APS A;  2YNG B;  2HZV A;  2E1C A;  2DGT A;  1QY7 A;  1SJR A;  1UZD A;  2HQI A;  3ISN D;  3L95 X;  4RW9 A;  1ZZF A;  2F65 A;  2HFV A;  3QMQ A;  2M4M A;  4XO0 A;  2ZWP A;  2MEW A;  3KUG A;  3CME S;  3FBE A;  4L73 A;  4PQA A;  3PW4 A;  2MLY A;  3KOA A;  3THV A;  1FRL A;  3ELH A;  1FA0 A;  4QBU A;  4C3L A;  5JVG Q;  3MMA B;  4Y2K A;  3HZE A;  2DY9 A;  5F8J A;  4MAK A;  2GJI A;  3PTW A;  1LFW A;  3BPS P;  4WIQ A;  3DHX A;  2GVD B;  4PG7 A;  4ES1 A;  5DM6 Q;  5G4D A;  4BC7 A;  2JFD A;  2XLK A;  1XNR J;  1M5K C;  3K17 A;  4JBC A;  1KVJ A;  2HIY A;  4M5D A;  1XMQ J;  1VIS A;  4QIE A;  4LSZ B;  4WFA Q;  4Z2X A;  4M5I A;  2CPH A;  1YZ7 A;  5IV3 A;  2RDI A;  1UP1 A;  3GYG A;  5AXM A;  1CUL B;  3JTO A;  2RRA A;  1X5P A;  1Y00 A;  2W2N P;  4DMZ A;  2XNQ A;  3BGO P;  4OHV A;  5HK4 A;  2HMI B;  2CJA A;  4YB1 P;  5THW A;  2VPW B;  2H5I B;  2IA0 A;  1JLG A;  1ZPW X;  1JWW A;  2EFO A;  1ACM B;  1MU2 B;  3M8R A;  5BR8 F;  1UPM B;  2B9Y A;  1QLN A;  4MYT A;  3W9I A;  3JSR A;  4O4G A;  4USU A;  4R8U A;  4ED3 A;  4CT9 A;  2ZVI A;  2HZA A;  1X31 C;  4WE1 B;  2RQK A;  3DXS X;  4QIW D;  4C9D A;  1CJT B;  3KXD A;  4OYA A;  4MJK A;  4DR3 F;  2XHC A;  1SH0 A;  1VYA A;  3CIM A;  1VJW A;  2XI2 A;  1KFS A;  1IJF B;  4AXI A;  3M2U A;  4ELU A;  5U47 A;  4ILM A;  1E6Y A;  2OFG X;  1JIH A;  2ZWO A;  3MTJ A;  3HMJ G;  2ROE A;  4ZPV R;  1HW9 A;  3DRY A;  4RW9 B;  2BJ9 A;  3OSN A;  3SDE A;  3FNN A;  2ZD1 A;  3SIP B;  2JC0 A;  3DDI A;  1KLM A;  2OEM A;  4AL7 A;  5FLX Y;  5E7O B;  3JSM A;  1S1T A;  4DR6 J;  2BX6 A;  3M9O B;  4CLP A;  2NXN A;  4DV4 J;  2GVZ A;  4KKO A;  4O4R A;  2YX1 A;  4J9U E;  3Q8R B;  4OZJ A;  2MQ8 A;  4H4O A;  1UEV A;  2AGQ A;  2YQ3 A;  5ETN A;  2WZ1 A;  2CRL A;  1DHM A;  4OYM A;  3I55 S;  4QZV B;  3I4P A;  3M8Z A;  4ECS A;  4M5D B;  3E8O A;  2KH9 A;  2R2S A;  5HVG A;  3GR0 A;  2YNF B;  2QFJ A;  3IS9 A;  3H7H B;  3CC2 S;  1CG2 A;  3N01 A;  1FT8 A;  2BMB A;  1H6K X;  2W2O P;  2YKP A;  3DI6 B;  2ZHA A;  4DSL A;  4ZJO A;  4UUW A;  3UN2 A;  2F4V J;  4A8M P;  3Q2S C;  4DPU A;  1NCL A;  2FHK A;  2N7Y A;  4FXD A;  3AJ1 A;  5LMU J;  3HKW A;  4JUZ A;  1JLG B;  2BRL A;  3C6T A;  4PYA A;  3Q0A A;  2IRX A;  3UPF A;  7FD1 A;  2EFN A;  4CI0 B;  3IRW P;  2DH9 A;  3PXG a;  4O4G B;  4R8U B;  3K0J A;  4QYZ J;  3T1H J;  4FP9 A;  3WIV A;  1HQE A;  3RAX A;  3D67 A;  3LAK A;  3K5M A;  4RNF A;  1F1B B;  4L3N A;  2LP4 A;  2FJV A;  2P9E A;  1NZ8 A;  2AYB A;  1RK8 A;  2J6U A;  2X1B A;  4RW4 A;  2JL9 A;  2E9Z A;  1NK0 A;  2NR0 A;  3M2U B;  3GSI A;  4J9N A;  4DL6 A;  2DXD A;  2LYV A;  3GII A;  3ITH A;  5E3C A;  2B4U A;  2J7W A;  3FRZ A;  4MTP A;  2BYC A;  2ADC A;  2HVE A;  3HFK A;  3VAL A;  3SDE B;  4FF3 A;  3V6J A;  3QNW B;  2CDR B;  2B51 A;  1LXJ A;  3H20 A;  1KLM B;  1CSJ A;  3JSM B;  5M2P A;  4KH1 B;  1SH3 A;  1SH2 A;  1RWM B;  1R6Y A;  1IBM F;  2D3U A;  2ZH5 A;  2HHH F;  2GVZ B;  4KKO B;  2K7J A;  3EVW A;  1KN6 A;  3CO9 A;  3ZZT A;  2A18 A;  3GCW P;  1RWK B;  2J9C A;  2OHD A;  2VKR A;  5LSL A;  2JLF A;  1UW9 A;  2NSB A;  3K5P A;  4ZVR B;  2E5J A;  4TNO A;  1KS2 A;  1IBL F;  1NPP A;  2AHO B;  4UY8 T;  4X62 F;  4LF5 J;  4AD6 A;  1S9E A;  1MRO B;  5C2G A;  1RI7 A;  3HF5 A;  2RF2 A;  2UVR A;  3W5X A;  3HP6 A;  5M2R A;  3GSD A;  1SL0 A;  4NYP A;  2P9G A;  2EFV A;  4J7C A;  1Q8B A;  1RYS A;  1W2B R;  4IOB A;  2E5H A;  3LPE A;  1BGX T;  2DHX A;  1UET A;  1X5S A;  4ZP9 A;  1D0E A;  4JP8 A;  2Y8W A;  1TL1 A;  1B70 B;  2OAU A;  5F0U A;  4ZVT B;  5KTQ A;  2ASJ A;  4P6Q A;  1FKP B;  4HTI A;  2VQF F;  4UQG A;  3VAJ A;  4IH5 A;  2XY5 A;  1HQE B;  4DSK A;  4I2Q A;  5GAH U;  4ED0 A;  4BBY A;  2VBY A;  1H98 A;  1GMW D;  5AXL A;  4X4O A;  4KHP J;  5KFM A;  4DX6 A;  2MZR A;  2HS3 A;  1NHV A;  4RW4 B;  2BAC A;  2C2E A;  1RAE B;  2MJU A;  3PIO Q;  4Y2I A;  4KPY A;  4HL9 A;  1WUU A;  3RRH A;  4O44 A;  1VC0 A;  4ZPW R;  1UZH A;  2ZIT A;  3ADA C;  3GIK A;  2D9O A;  3ILI A;  3M32 B;  1VQL S;  4MKV A;  1WC3 A;  2HBZ B;  4WII A;  3S8S A;  5ETQ A;  4YR0 A;  3PRV A;  3QYY A;  3QGH A;  2XSJ B;  1G4C A;  1YTY A;  4P9S A;  2Y8Y A;  2HHS A;  3ONQ A;  2J0W A;  1T8E A;  1N33 J;  3D6M B;  3T6J A;  2ZH2 A;  4EK2 A;  3HKZ D;  1EET A;  1IKX A;  1VBK A;  2BE9 B;  2RT3 A;  1B3T A;  3UE2 A;  3TNV A;  3TUJ C;  1NK7 A;  5EGY A;  2LQ5 A;  3X1L B;  3QGP A;  4OX9 J;  2QTW A;  4C3K A;  1O8B A;  1GXT A;  2CG8 A;  3NY0 A;  3G2X A;  1J5E J;  4U96 A;  5T7L A;  4DWI A;  4JI7 F;  4A8K A;  1KR4 A;  3KK1 B;  4G65 A;  3W3S A;  3V6D A;  2ZH7 A;  2ZDP A;  5FD1 A;  5E41 A;  1WSV A;  4RBT A;  2HPU A;  1OO0 B;  2WBM A;  4RUB A;  3Q8S B;  4MK9 A;  1RKJ A;  2B4O A;  4I2P A;  2RF2 B;  4URQ U;  1D8Y A;  2FJD B;  5J2N A;  1TAQ A;  3PVX A;  2RUG A;  5LXY A;  2KT5 A;  2ACY A;  1EX8 A;  2LA4 A;  4KE5 A;  2M70 A;  2FB0 A;  1TL1 B;  3VAH A;  2X1F A;  3LTO A;  1FRK A;  4DL3 A;  1SI9 A;  3SCL E;  4HAC B;  1RAB B;  1ZAX A;  3AB4 B;  1P9Q C;  4CIO A;  4C8O A;  2F7V A;  1VDH A;  3RAM A;  4K4T A;  4OX6 A;  2SXL A;  4NLU A;  3CMA S;  4HT5 A;  3I9V 9;  3QPI A;  2XLI A;  8RUC A;  4LR7 A;  5D0E A;  2CQ4 A;  4I2Q B;  2DBB A;  2ACM A;  3RGI A;  4DV2 J;  1X4C A;  3WDO A;  2COL A;  3NNA A;  1X4E A;  1W26 A;  3KDO A;  3PY8 A;  4LF1 A;  4NXM F;  3I56 S;  4DN0 A;  4NCG A;  1N0V C;  4EZ6 A;  3SSS A;  1R8P A;  2QJ3 A;  4DL0 C;  5H9F K;  4U9R A;  4O44 B;  2VG5 A;  2HVH A;  3MEG A;  2PA8 D;  4DCP B;  2UUC J;  2V8D A;  2QA1 A;  2FGO A;  4DQI A;  4YB7 A;  2ATC B;  3PW5 A;  2G0I A;  3PX0 A;  3DFE A;  4I69 A;  2CAD A;  1VRU A;  4WFB Q;  3GYN A;  1MSW D;  2IIH A;  3KLF A;  1M1K T;  4DQP A;  1NAQ A;  3TVZ A;  2RNE A;  1X5T A;  3D7S B;  5IT9 U;  1WEX A;  3Q24 A;  2OSR A;  3VWS A;  1C0U A;  5LT5 A;  2R7R A;  1NLK L;  3RBD A;  4ED5 A;  2HNZ A;  4F2S A;  4A46 A;  4B3S J;  4YR2 A;  3MOZ A;  1UVJ A;  3IBF B;  3MM6 A;  5CXT A;  2CJY B;  1X4D A;  3V6D B;  3DKD A;  5IC6 B;  5HVH A;  4DPW A;  2RSQ A;  4EMD A;  2ZEJ A;  3DGP B;  4FYW B;  2ZOM A;  4I2P B;  1NEE A;  2YKA A;  4OHX A;  5A2Q Y;  2KO1 A;  3CD5 A;  4A8Y A;  2IA6 A;  3JQM A;  5J2N B;  4LFC F;  3PFO A;  2ZH6 A;  4F3O A;  5K9F A;  2BW7 A;  2HHX A;  1I1G A;  2H4Y B;  4CWB A;  4NWB A;  1HR0 J;  3GU0 A;  2CQD A;  2OPR A;  1YJV A;  1FRM A;  3MFH A;  2YTC A;  1O5J A;  1RTH B;  4P7T A;  4DV6 F;  1ZS6 A;  4ED6 A;  1WC5 A;  3UCZ P;  4AYB D;  1U09 A;  3K2Y A;  3B82 A;  2HHT A;  2OKQ A;  3BZQ A;  3ET6 A;  3QZ8 A;  4PCQ A;  3M6X A;  3C14 A;  3DXB A;  1EP4 B;  3KFW X;  1S97 A;  1V3S A;  4RNN A;  2VG5 B;  4QJV A;  3MEG B;  3BQ1 A;  1U0S A;  5KOX A;  4WTY A;  3O44 A;  3MR6 A;  3CJS A;  2XY7 A;  2VV5 A;  2DVI A;  1U2F A;  4K0K J;  1FER A;  1FRH A;  3JSB A;  1G6B A;  5KFC A;  4UT4 A;  4LVN P;  5K8N A;  2BKO A;  3KTQ A;  2JX2 A;  4XDD A;  1YJN S;  4DFK A;  1HBN A;  2I6W A;  1Z2L A;  4H4M A;  2OGU A;  3HVT B;  4UOH A;  1C0U B;  4F25 A;  5IFM A;  4X4S A;  3QSI A;  4NAS A;  1S49 A;  4G1Q A;  3MM9 A;  5HMX A;  3R6L B;  3MPD A;  4L74 A;  2QZ8 A;  3L7O A;  2ZJQ Q;  5EWG A;  3KJN B;  2QMU B;  3LP2 A;  1I51 B;  3X3U A;  1S6U A;  1VRT A;  4NLS A;  3GE9 A;  1T11 A;  2GIQ A;  4C98 A;  3MHY A;  3DOL A;  2ZDO A;  1XJW B;  1DAX A;  5L38 A;  2KHC A;  4OLO A;  2XQC A;  5D6G A;  3RYL A;  5KG4 A;  2UVW A;  5C5J A;  2LQ8 A;  1NDL A;  1KVK A;  3UR0 A;  3DDN A;  1SJQ A;  3UR3 C;  3GWC A;  5HMZ A;  4V19 X;  4ERD A;  2CAJ A;  3K8W A;  1WOR A;  2HAF A;  3HFZ B;  5GVQ A;  5SUH A;  2QA4 S;  3AQO A;  2OPR B;  2FDN A;  4CO5 A;  1X60 A;  3PCO B;  2RQM A;  3MTK A;  3IG1 A;  2OTJ S;  2HLU A;  1ZM2 A;  3DRS A;  2QT7 A;  1CQM A;  3N79 A;  2BVZ A;  1WHY A;  3SCJ E;  2V8H A;  3ET6 B;  3R5D A;  2HAI A;  4ZVS B;  1VGY A;  1DJ0 A;  4IFY B;  1LW0 A;  4NYZ A;  5B0A A;  4F36 A;  2ZE2 A;  4WFY A;  4Y34 A;  2KJW A;  2B56 A;  2H54 B;  2V50 A;  4GC6 A;  4AXJ A;  4PQU A;  1UVK A;  4Y2M A;  2G13 A;  4KC5 A;  2HRT A;  4NEY A;  3FBB A;  4HR2 A;  5L1L A;  1JLQ B;  3MFI A;  3H40 A;  2DNQ A;  3IM9 A;  2PA3 A;  1KD1 T;  2IM1 A;  5EHH A;  1WF2 A;  2CQ0 A;  3NCR A;  4FKX A;  3TUP A;  1HBN B;  2C2D A;  4H4M B;  1F9F A;  4LF8 J;  4KTQ A;  5GAD U;  1TFW A;  2XO6 A;  4J9V A;  4TYA A;  4MKB A;  3M6W A;  3FUY A;  1QAY A;  4F67 A;  2W4D A;  3NMA A;  1FFG B;  2QG9 B;  1SVD A;  4G1Q B;  3MM9 B;  1UEK A;  4WXW A;  1RJJ A;  5E3Q A;  1NSA A;  3IR6 B;  2DR9 A;  5EUH A;  4C11 A;  3NEK A;  1Q16 B;  1HI0 P;  4Y2A A;  1XMB A;  2EK1 A;  4U7U K;  3H5Y A;  1FO1 A;  2DIU A;  3LP2 B;  3NOG A;  4JI6 J;  1M1G A;  1VRT B;  5FLX U;  1OPZ A;  2LVW A;  4FS2 A;  2XMK A;  1XR6 A;  5ITH A;  1TVR A;  1HBU A;  3R7N B;  2BE2 B;  5DG7 A;  3RRK A;  5IC4 B;  4FNI A;  1FVS A;  1F6T A;  4OI1 A;  2D7S A;  4EBD A;  1IWA A;  1SQF A;  3UVJ A;  5CD4 A;  1DAR A;  5AE3 A;  4IQX A;  2HHV A;  2BJ7 A;  2M8H A;  2DGW A;  4QR1 A;  3QO9 A;  1H0H B;  5KFE A;  4Q8E A;  2FHM A;  2DNR A;  3IG1 B;  3K57 A;  2QEX S;  4NLR A;  2MYF A;  1YBT A;  2ZNZ A;  5JMN A;  2PI5 A;  4QOT A;  1F0X A;  3J7Z T;  4OI3 A;  4BDP A;  2V2V A;  5D8H B;  4ZPC A;  1FEH A;  1WOP A;  4HTJ A;  4DXL A;  3L3C A;  1FI4 A;  2HUR A;  3OTO J;  3D0G E;  1UJ6 A;  2ZE2 B;  4B3T F;  1Q53 A;  3KG0 A;  5GAG I;  4ZCK A;  2MKC A;  4F2R A;  4R5P A;  4ZLN A;  4PQU B;  3OFG A;  3PO5 A;  1GXL A;  4CCH A;  5HLF A;  2YKO A;  5J1P A;  1S1U B;  1Y7P A;  2X51 A;  3SFG A;  2VBW A;  3BRE A;  4ATN A;  3K59 A;  4K4V A;  3FMW A;  1FKO A;  4CTA A;  2B0G A;  2DRB A;  4PWW A;  2AJQ A;  2W2Q P;  4LFA F;  1Q8L A;  4MT1 A;  4V1A k;  1RWW B;  2HVZ A;  4C0O C;  4PG8 A;  4OFZ A;  2WON A;  4C11 B;  4NA2 A;  3KLE A;  2CQC A;  2MPU A;  1R43 A;  1V5I B;  2NUH A;  2XBP A;  4OZ5 A;  2BEF A;  4K2X A;  1FNO A;  1JLA A;  1NK9 A;  4FF2 A;  1A9N B;  1KON A;  1IKW B;  1HBU B;  1R8C A;  1YRT A;  1C2P A;  5LMU F;  3BM7 A;  3W2W A;  3IO1 A;  5L1J A;  1TKZ A;  1AZS A;  2UV8 A;  2Y1L B;  2FY8 A;  3SZ2 A;  4MFB A;  1UFK A;  5KT6 A;  2Q66 A;  3AH6 A;  4B9T A;  5ETL A;  3UVJ B;  4V19 J;  3QO9 B;  1XER A;  4OJG A;  4KHM A;  2R7U A;  1RYR A;  3K7R A;  5KFU A;  2E5G A;  2XS5 A;  1WI6 A;  2H5E A;  1N34 J;  1N0U A;  4ZVO B;  5KFP A;  5MLC V;  1U1N A;  1YKW A;  2DCU B;  3BN4 A;  1NHU A;  1IBK F;  4DPO A;  2UP1 A;  2ZHB A;  3MAH A;  5B0G A;  3D0H E;  4OL8 A;  4FYD A;  1VQY A;  4B3R J;  4F0K A;  1XTZ A;  2MKK A;  3T5H A;  3W8G A;  4BC9 A;  1A0O B;  3TQE A;  2C28 A;  1AUD A;  5HBM A;  1XR7 A;  1IR0 A;  4U8Y A;  4RW8 A;  4R5P B;  1Y11 A;  3A8K A;  5EX3 A;  2GAG C;  2DXE A;  5F0W A;  2WB4 A;  4OMF G;  1KWM A;  2B5J B;  1AUS L;  3FEZ A;  2BJD A;  3AY0 A;  4DV1 F;  3SMZ A;  4ALZ A;  3ZZP A;  1FNX H;  2ZZM A;  1NME B;  2C2O B;  1IKY A;  4PKD B;  2WCX A;  1NH7 A;  2RD5 C;  3BR9 A;  3RBZ A;  3RZA A;  1ZYQ A;  4P72 A;  2OEL A;  4DLG A;  4DZ6 A;  4CTA B;  3OFF A;  1HNZ J;  5LM7 E;  2WRM A;  2B9X A;  3KNG A;  4N7T A;  3BV8 A;  2CPD A;  1Q79 A;  1VQ6 S;  3V2U C;  3T5L A;  2QYC A;  3L9Z A;  2ZJP Q;  1SUQ A;  3PDN A;  5DO2 A;  3KLE B;  5KFY A;  3QIP A;  3MM8 A;  4F8R A;  4GKK J;  4DV7 F;  1WJ9 A;  5M2U A;  1Y5I B;  1S79 A;  4PAB A;  2DNG A;  1S6Q A;  5F3T A;  1EAR A;  1E6V A;  1NO8 A;  4F3M A;  1S6O A;  3W2W B;  1TKZ B;  1AZS B;  2OLW A;  1LWC B;  1NUE A;  1RGV A;  3MUM P;  4QPT A;  9RUB A;  4ZP7 A;  2RJZ A;  3DM2 A;  3H98 A;  3CCJ S;  3B4D A;  2A0F B;  1V6H A;  4OI0 A;  3UN5 A;  2MKH A;  4IO9 Q;  3DYA A;  2AWZ A;  2V68 A;  1WWH A;  2OPS B;  5IT4 A;  3GYX B;  3TOQ A;  5ETP A;  2Y9H A;  1PYS B;  4JV0 A;  1LFP A;  3CJ3 A;  1SC6 A;  4AUK A;  3P96 A;  1ARO P;  4DR4 F;  1YBU A;  4LRE A;  1N5S A;  4R0J A;  3M8Q B;  2MQM A;  4GC7 A;  4ECV A;  2E5I A;  4C97 A;  4JI4 J;  4UF4 A;  1ZOT A;  3HO1 A;  4DBQ A;  3AAW B;  3EXC X;  4OI2 A;  5HBM B;  1SJ1 A;  4RW8 B;  1YGY A;  5EWF A;  2M8D B;  4NLX A;  1YRU A;  3N5F A;  2VA3 A;  4USJ C;  4ZN1 A;  3HHL D;  3KJF B;  2MQL A;  1N33 F;  2DIV A;  1T9W A;  1WEZ A;  3U02 A;  3TI0 A;  5D4O A;  1U1R A;  1KQS R;  2UXB J;  2VBX A;  2Y3Y A;  2BQU A;  3KHL A;  3HZG A;  4Q2M A;  4L76 A;  1OQ3 A;  2AJ0 A;  3G87 A;  1HD0 A;  2E1A A;  1BQM A;  1VQ5 S;  1R8B A;  2GFF A;  5A76 A;  1RSC A;  3MPU B;  1NK5 A;  3ZO7 A;  3ZTS A;  3PYG A;  3CTR A;  2RS8 A;  1GXU A;  1HBM A;  1JLE A;  1X5O A;  5HQM A;  1T9T A;  2LKZ A;  2ZBI A;  3O3L A;  2JDJ A;  5K20 B;  2M5Y A;  1XEZ A;  2Q3P A;  5DDO C;  1ZM9 A;  4LSN A;  3MCM A;  3ILO A;  5GAE I;  3MM5 A;  3E2E A;  2FJB B;  3QIP B;  3P45 B;  2WOM B;  2CPY A;  3GMG A;  2W8K A;  3A12 A;  3MD1 A;  3FSY A;  3VF0 B;  2HGM A;  2RHQ B;  3RJM B;  4EUV A;  5C24 A;  1GAO A;  4M5N A;  3GFX A;  2ZHO A;  3ZZR A;  3NL0 A;  3I32 A;  4CLF A;  3KWM A;  3NP5 A;  4UZB A;  4P10 A;  2MY8 A;  4F04 B;  2VON A;  1WHX A;  5HMY A;  3DM2 B;  1RAJ A;  2CPJ A;  3R7B B;  2ZH3 A;  5AE2 A;  2QE5 A;  2V67 A;  4PR6 A;  3W2V A;  3VR1 A;  2R7S A;  3DYA B;  4OI6 A;  1K47 A;  2Y0B B;  4BHQ A;  1KNZ A;  2HND A;  2MZJ A;  4RJV A;  4ITS A;  2DR6 A;  1NK4 A;  1RAC B;  5A2Q U;  2WK4 A;  2CJK A;  2HBR B;  4OYP A;  2EVZ A;  2VB6 A;  4G1I A;  1RP5 A;  5KG3 A;  1KSP A;  1QUV A;  1EKS A;  3CD7 A;  3OVB A;  2WBR A;  5IM0 A;  3W9H A;  4DR3 J;  3OLB A;  3S7R A;  4ETZ A;  2EXU A;  1H2T Z;  1A7G E;  5D3G A;  1VK8 A;  3BO2 A;  5SZT A;  2XZD B;  3L4B C;  4B3O A;  5D0G A;  2V0N A;  2KYZ A;  2FQQ B;  4KAI A;  3CJ0 A;  1OY9 A;  5L8R C;  3J7Y I;  1BQM B;  2QL5 B;  2CWK A;  3A13 A;  3AHP A;  1H2U X;  3DRR A;  2F8M A;  1R0A A;  3K58 A;  3MPV A;  4LF7 F;  1RTZ A;  2FC8 A;  1HBM B;  1JLE B;  3J7A 1;  1HIY A;  2DH7 A;  2JEG A;  4FKY A;  4PYD A;  3QBC A;  3MAQ A;  3KK2 B;  3KHG A;  4B08 A;  1U2C A;  3MM5 B;  1RE1 B;  5F9N A;  1VOM A;  2MSS A;  4B17 A;  1D09 B;  2LQ9 A;  1CPZ A;  5KG5 A;  4XK8 C;  5HAO A;  4E2F B;  4M8L A;  2KT3 A;  1D9D A;  1TV6 B;  5C24 B;  3KJV A;  4F4W A;  2W4C A;  5EWE A;  3R1L A;  3PYE A;  3C6U B;  2ZBQ A;  2KG1 A;  4IRK A;  4WFX A;  4ZK7 M;  1JLF A;  4MIW A;  1ELO A;  3W2V B;  9ATC B;  2YWE A;  1FXL A;  2YVS A;  3A8J A;  2I2Y A;  3LGM A;  4WK1 A;  2XYH B;  2DYA A;  2UZA A;  4F4Y A;  3OD2 A;  1DTT A;  2DGS A;  1N88 A;  5F8L A;  6FD1 A;  4KFB B;  1EZZ B;  2HND B;  2ILY A;  2L9N A;  2AX1 A;  3Q2T C;  4NE9 C;  1Q1K A;  2WVF A;  3C19 A;  2CPE A;  2LU1 A;  1JNR B;  3JTN A;  4RW6 A;  5AXN A;  1C0T A;  2PMW A;  3A3O B;  3TO8 A;  3HT0 A;  1EJ7 L;  2P5V A;  1JKH A;  3D54 A;  3JAM Y;  2XY6 A;  3TVK A;  2VC0 A;  5IM0 B;  4LF6 F;  2MKS A;  3PZP A;  3DMJ A;  4IKA A;  2CZ4 A;  3PJW A;  4MK8 A;  2MMY A;  4PPZ A;  4FF4 A;  5A0Y A;  2H9Z A;  4X4Q A;  2DHG A;  4RZR A;  1RHQ B;  1T9U A;  1GNK A;  3H2V E;  1KEK A;  5J1E A;  2GHV C;  3O5T B;  3DLG A;  3M2V A;  3DRR B;  2KJV A;  2ASD A;  1R0A B;  6FDR A;  4M94 A;  1SC3 B;  3BB5 A;  3RG6 A;  2DGV A;  4DHV A;  4YY3 F;  3EPI A;  4B9M A;  1KOO A;  1RBO B;  4NZ0 A;  3IC1 A;  4NML A;  5HMW A;  3OT9 A;  2A3J A;  3SYZ A;  1UVN A;  1FEE A;  1IBM J;  2HHH J;  5J1N A;  2Z30 B;  4Q43 A;  4HI1 A;  2DHA A;  1U48 A;  2CQH A;  3C16 B;  2IBK A;  1EIY B;  2Y1J A;  1QDU B;  1NKC A;  3GZ7 A;  4DPT A;  4CNY A;  1C1C A;  2Z56 B;  4AT1 B;  3HSD A;  3GON A;  3A3N B;  2FY1 A;  3UO0 A;  4JOU A;  1IBL J;  3U1N A;  2EBE A;  4Q8F A;  1U6B A;  1K8A T;  5CQG A;  1AT1 B;  4ZVE A;  3UI3 A;  5DDR C;  4QQB A;  3R5C A;  5ETK A;  3BKT A;  2BOP A;  3JSY A;  4KYZ A;  4WKY A;  1JLF B;  2DHS A;  3B6B A;  2D3Z A;  4AL6 A;  1B0T A;  1M5V C;  3F73 A;  5I3P A;  2LDI A;  4QYZ K;  5C42 A;  4EI2 A;  4ZVQ B;  4ED4 A;  2DT9 A;  4DOZ A;  2ZFH A;  2BKN A;  4RW6 B;  2VQF J;  1C0T B;  3NGK A;  2R7V A;  2LEP A;  4TY9 A;  4X4U A;  1NPR A;  1YHQ S;  3G86 A;  3CUL A;  1NJI T;  3O8W A;  1W2I A;  1IBC B;  1N52 B;  4UZC A;  1NU4 A;  2UUA F;  4HDG A;  2IRY A;  1VR6 A;  1OJ4 A;  2J6T A;  1MWY A;  2UUW A;  2NQP A;  1UFW A;  1RT7 B;  4EO6 A;  5A0Y B;  1WKJ A;  2C1E B;  5C25 A;  1SIW B;  2UU9 F;  4LF8 F;  2NRE A;  3PX4 A;  1RT5 B;  5KT3 A;  3CCU S;  2J0Q D;  1P8G A;  1Q5Y A;  4CO0 A;  3WC0 A;  3KLH A;  3DLG B;  3R9L A;  3M2V B;  1PJ6 A;  2CXE A;  2V69 A;  1BWV A;  5L46 A;  4M5J A;  3A3P B;  1TP7 A;  5KG2 A;  4HKQ A;  1L3K A;  3RBE A;  2BBE A;  2Y1I A;  3CGI A;  2AU0 A;  3N6L A;  3SCI E;  4JI6 F;  2HQ3 A;  2MKY A;  1IVZ A;  5DGB A;  3LOU A;  2KYX A;  2OSQ A;  3IR7 B;  3I0S A;  5I42 A;  3OR2 B;  1C1C B;  4QR2 A;  4Y6I A;  1CS4 A;  2AEM A;  1LWF B;  5GME A;  1Y3K A;  1VQ8 S;  2ZKU A;  4RNO A;  4UOC A;  3IGN A;  1U1Q A;  4CNZ A;  2FC9 A;  3T6B A;  5E33 A;  2IMW P;  2M7S A;  2V9K A;  2GHP A;  5ADZ A;  4X84 A;  2DGU A;  2CDQ A;  4XTT A;  2NSC A;  4U7C A;  4I64 A;  2DIT A;  5C42 B;  4WZQ A;  1OPI A;  1GTE A;  2C3Y A;  3NGD A;  4NI2 A;  1EQM A;  4NLO A;  1NSK L;  4NCB A;  1WG4 A;  2VBZ A;  2ZH4 A;  2VQE F;  1LOU A;  1TK0 A;  1SCJ B;  2BAN A;  2UXD F;  4DCJ B;  1LW2 B;  1UWB A;  5KG6 A;  3G4S S;  2PEB A;  4DFJ A;  3ZTR A;  3D2W A;  2CQP A;  1S6P A;  2HW3 A;  2E7X A;  4NXM J;  2JSX A;  2VG7 A;  2DO0 A;  1NDC A;  4WPA A;  3SI8 A;  3T5J A;  4NPO A;  4IDK B;  2MKJ A;  1B0P A;  3CCM S;  5C25 B;  4WJB A;  1AW0 A;  3OTC A;  2Z2Z A;  3T5K A;  2QL7 B;  3MDF A;  3MAA A;  2V2Q A;  2YKN A;  2ZOG A;  1FWL A;  4E0D A;  1RHK B;  2ZC4 A;  2CNL B;  3KLH B;  2C2K B;  4WXO A;  3TAM A;  3VQS A;  1NSQ A;  4YHH J;  1UFL A;  1WF1 A;  4FYY B;  2HHQ A;  2Q6C A;  2NLW A;  2K3I A;  3GV5 B;  4JV2 A;  1X4H A;  1HNV A;  2V5H G;  3N28 A;  1QJH A;  1YI2 S;  3BSC A;  4AQY J;  2GQC A;  3QAT A;  4QWC A;  2VOO A;  3ISZ A;  4YEA A;  1N4L A;  1U0H A;  5HI7 A;  2XC9 A;  4ZCM A;  3I0S B;  5I42 B;  3I5B A;  4KBI A;  3M9N B;  3BR8 A;  2A6O A;  3QFH A;  1CS4 B;  2UV8 G;  1WC6 A;  1HAR A;  2AYE A;  4ECX A;  1SL2 A;  1HQ2 A;  3FCV A;  4B9L A;  2HHP A;  2J0X A;  4ZLL A;  3R5G A;  2NPF A;  4J9P A;  4DSJ A;  2CJB A;  1NJW A;  1YJW S;  3FCW A;  3NG8 A;  2JEI A;  1RQ0 A;  1Q78 A;  3GP9 A;  3KYL A;  4LFC J;  1VK3 A;  1DY3 A;  3GB0 A;  1BC6 A;  1FTR A;  3D3C J;  4OJ1 A;  3TEH B;  2OD6 A;  3CCQ S;  3CCR S;  1TKD A;  4J90 A;  4TU7 A;  2BW2 A;  3UFC X;  3LH2 S;  1WC1 A;  4USK A;  1SV5 A;  1BY9 A;  4RNM A;  5KFF A;  4AE5 A;  1FE0 A;  2OPQ A;  4KIA A;  2K3K A;  1EQ0 A;  2BAN B;  2LQB A;  2VFT A;  4DV6 J;  1M5H A;  3A1Y G;  1HFE L;  5DM7 Q;  1DFD A;  1UWB B;  1OYD A;  1RWV B;  3G6Y A;  1TL3 B;  4K2J A;  5L39 A;  4DUT A;  2UXC F;  3BN7 A;  1S6P B;  4YDX A;  4F4A A;  2KU7 A;  4J9O A;  1HNX F;  1HYS B;  3ZZO A;  3CJK B;  4GKJ F;  1HNW F;  1RZM A;  3NNC A;  4N5S A;  4ZHR A;  4X4R A;  3EXY A;  1ZH5 A;  5KFL A;  4DF8 A;  2YKN B;  2R7T A;  1KVI A;  4QWA A;  1JLB A;  3FFI A;  4OJ3 A;  3TAN A;  1EAY C;  3TAM B;  5IXU A;  4Q0B A;  1GMW A;  2ZNY A;  5FDL A;  2BDP A;  1T7P A;  2DNO A;  5AT1 B;  2GQ2 A;  2IPO B;  2LEC A;  3VGS A;  1HNV B;  2CQB A;  2ALZ A;  4DLE A;  3J81 Y;  1WKL A;  8AT1 B;  2QYG A;  2HK2 A;  3J80 Y;  1MWZ A;  2J7U A;  2WW8 A;  2HQG A;  1S76 D;  4K4Y A;  4B9U A;  4QIF A;  3AT1 B;  2RU9 A;  1U0H B;  2NXJ A;  3PRB A;  2V34 A;  1G2E A;  4FYX B;  4LUB A;  3JQJ A;  4NLG A;  1FJC A;  4O3S A;  1KTV A;  4JB8 B;  1YRX A;  4C2M A;  3CDE A;  3HHN B;  3TRG A;  3M8P B;  3D1Q A;  4DSF A;  5F41 A;  2JVR A;  1L3T A;  2JJ4 D;  4ENO A;  4LR8 A;  1G1X A;  4P75 A;  1NH8 A;  1IR1 A;  3RB0 A;  1RCX B;  1NND A;  3BBF A;  2X3G A;  2AGO A;  4P71 A;  1CJU A;  4YUD A;  1UJ4 A;  3DLK B;  1Q4R A;  2MLZ A;  3OXL A;  3NNH A;  2FZC B;  2W1B A;  3PHT A;  3NWG A;  3SCK E;  3UNY A;  2HRU A;  2QRR A;  1WNE A;  3DLE A;  5CYJ A;  2Z0G A;  4USM A;  3NCQ A;  4N77 A;  1SV5 B;  2OP5 A;  4DS4 A;  1K1S A;  2OPQ B;  2XZW A;  1VBX A;  1UCN A;  1J5O A;  4TQS A;  4CM0 A;  4DV3 F;  2N3O A;  2MZS A;  4DR7 F;  3HHE A;  3AA8 A;  2CQ1 A;  4CYU A;  3V4I A;  3KDN A;  2Z2M A;  2YXL A;  1X4G A;  4DQS A;  2C2N A;  2AEF A;  3M8S A;  1MMD A;  4CH7 A;  3D5M A;  3BJY A;  1IJE B;  4E98 A;  4ZHR B;  2RU3 A;  4FZV A;  3O1L A;  5C7P A;  3FCH A;  2GV1 A;  1JJH A;  1MN7 A;  1IUJ A;  3UCU P;  1OS5 A;  1WAC A;  1JLB B;  1Z4U A;  2N4C A;  4DUY J;  1B7F A;  4ZLP A;  4N56 A;  4GO5 X;  2BA9 A;  2XMU A;  4DCO B;  2HNY A;  5FDL B;  4X65 F;  1PAU B;  2VUG A;  1XMO F;  3AD8 C;  3C66 A;  3VZI A;  1NKE A;  2JOQ A;  2B8Q A;  1Y3J A;  2WB1 D;  1PKU A;  3DC2 A;  2VOD A;  4GVB A;  2A10 A;  4WF9 Q;  2CJX B;  2DR8 A;  2E9T A;  3Q8U A;  2XI3 A;  1F2H A;  1Z2Z A;  1U6F A;  1S0N A;  2EC0 A;  1RWP B;  5GAG U;  2E7V A;  4OYO A;  4ZCL A;  2JEJ A;  3I96 A;  2KT2 A;  2QN6 B;  2ZOF A;  4QU7 A;  1IKV A;  3UDC A;  5AXK A;  1RTD A;  2DNN A;  4KGV B;  1IN0 A;  1BLU A;  4D3H A;  3W8P A;  4PZV A;  5CZX A;  1ZZN A;  2PMZ D;  5J2P A;  4P52 A;  3OHA A;  3EVM A;  3BO3 A;  3FJ2 A;  1PO6 A;  4LSL A;  2IRU A;  2DPI A;  3DU6 A;  2MDA A;  1CJU B;  5IWA F;  1VC5 A;  4OIX A;  3PEJ A;  3QJJ A;  1TK5 A;  2GJ2 A;  3R5J B;  3ENQ A;  3OTB A;  5A8R B;  3DLE B;  2FGC A;  4LQ9 A;  1XBW A;  4WWS A;  4I67 A;  5A6P A;  1TL5 A;  4X66 F;  1U1K A;  4NX9 A;  3EWG A;  2P2C B;  1UMJ A;  4H4K A;  5D77 A;  1ZA1 B;  3IMQ J;  4CYU B;  3V4I B;  1B64 A;  3EYZ A;  2DPJ A;  1S10 A;  4Z7Y A;  3NGU A;  4M5K A;  3CC7 S;  4B3T J;  3MUR P;  2AJ4 A;  3OSP A;  2GIF A;  3V6K A;  4K4Z A;  3ENV A;  2G2Z A;  1DQ9 A;  3F41 A;  4RR5 A;  1AA1 B;  3Q86 A;  3T3F A;  1QSS A;  3W63 A;  1Q81 T;  3TUZ C;  4I6A A;  3RR8 A;  2W01 A;  2WSF C;  4LFB F;  4L75 A;  1U1L A;  2X1A A;  2HNY B;  5JXS A;  4CO4 A;  1VI7 A;  3SQO P;  4FVC A;  3MI7 X;  3TX0 A;  1NSP A;  4HHH A;  4FXV A;  5BXI A;  4ZP8 A;  3JAM U;  3CB4 A;  4DS5 A;  4K4U A;  2BE7 D;  4NZ7 A;  5CAB A;  3DRP A;  1QVG R;  7FDR A;  1M90 T;  2AX0 A;  3HM9 A;  4LFA J;  4ETX A;  3ZZY A;  3ZFV A;  3CD6 S;  1FDA A;  1KFD A;  4EU0 A;  2GO8 A;  1IKV B;  2YNH A;  2B6A A;  1GMV A;  2LEB A;  4JYA F;  2WVC A;  4CRJ A;  1U45 A;  2VL1 A;  2ZH1 A;  1SPB P;  3HUL A;  2X3D A;  1YJU A;  5KFO A;  1ZAV A;  3KKF A;  4WP8 A;  3SV4 A;  2FHO B;  2DNH A;  2LEA A;  5J2P B;  1X0F A;  2DD8 S;  1QE1 A;  1IWG A;  5KT4 A;  3QT5 A;  1F2G A;  2LCW A;  3Q8Y A;  3ZXW A;  3E01 A;  3LP0 A;  1YWX A;  1X9M A;  2QA4 G;  1O6X A;  2VHG A;  4TU8 A;  1N5V A;  3MCS A;  4ZOS A;  1JLC A;  3R27 A;  3TAQ A;  4ZCI A;  1ZTW A;  4DQQ A;  4ZS6 A;  3PKM A;  2WVD A;  2AJF E;  3TP2 A;  2CPF A;  1WKK A;  1IBK J;  5RUB A;  1OQ6 A;  3L7U A;  3FBC A;  4ZJL A;  1UKU A;  1X8D A;  1Y5N B;  2CNK B;  5E3A A;  1E6Y B;  3DOM A;  1PJ5 A;  1CVJ A;  4ZVH A;  3LP1 A;  3M4X A;  4U7U D;  4JI1 F;  4CH1 A;  2ZD1 B;  1H72 C;  2RKI A;  5D4N A;  1RWO B;  3MMJ A;  3OQ2 A;  3IRX A;  3OJS A;  3U1M A;  5CAA A;  3BGR A;  3ILJ A;  2CWX A;  1S1T B;  2HS0 A;  1LXN A;  4KGZ B;  4DV1 J;  2XGP A;  2EI5 A;  1H38 A;  2PE8 A;  3S6E A;  3PX6 A;  2DY1 A;  4CLY A;  1N56 A;  1I5O B;  1ZPV A;  2B4V A;  4H4O B;  4JI2 F;  4AFF A;  1RAH B;  2WSC C;  4EYI B;  1IR2 A;  2XZT B;  4RW7 A;  1EHW A;  1U2R A;  4RNH A;  3OUY A;  3DRP B;  4A8Q A;  1QVF R;  1T3N A;  1XNQ F;  2YQ1 A;  1D1U A;  3BYP A;  4RU9 A;  4I4B A;  3BH6 B;  1VIO A;  3V5R A;  4DFP A;  4ES2 A;  2YNH B;  2B6A B;  4Y65 A;  3N6M A;  3IS9 B;  2OIH A;  2HWI A;  5CD4 H;  3H0P A;  4KGM A;  1RAA B;  2K1R A;  3W5Z A;  4U95 A;  4DV7 J;  4M95 A;  3EUN A;  3TZZ A;  5T14 A;  1B0V A;  2XNR A;  3TJ8 A;  1QE1 B;  3JQK A;  2EWH A;  3C6T B;  2R4F A;  4DPX A;  4DI6 A;  1R0B G;  4YN3 B;  1HMV A;  3ZZZ A;  3H5U A;  3LP0 B;  4DX8 H;  2XGQ A;  3Q23 A;  4UY8 5;  3R3T A;  1YX2 A;  5F3Z A;  1QUP A;  2KFY A;  4KR0 B;  2F9D A;  3K8V A;  2KVQ E;  4OX8 A;  2M2B A;  1JLC B;  5B0C A;  2ABY A;  1Q5V A;  4JV5 F;  2R42 A;  2BJ3 A;  2D69 A;  4DG1 A;  3Q22 A;  2BAB A;  3EPG A;  2KI2 A;  2CYY A;  2DNY A;  4O0I A;  2DCL A;  1HKA A;  1LK5 A;  3CW2 C;  4I7F A;  2CFX A;  1Y5L B;  2EFQ A;  4DR4 J;  3NMR A;  4I68 A;  3ITH B;  5K14 A;  2MHN A;  3LF0 A;  1SXL A;  1GEH A;  1DLO A;  4DR2 F;  3WZ0 A;  2VA2 A;  5J2Q A;  3BF4 A;  2XLJ A;  3LP1 B;  3ZTP A;  2B4P A;  4IR9 A;  2MLX A;  2B43 A;  2RKI B;  5K5M A;  5LOQ A;  4RBV A;  5BYR A;  1AXQ A;  3IRX B;  5F8M A;  3C8Y A;  3EE3 A;  3BGR B;  1DQA A;  3GPA A;  4L3K A;  4CDI A;  1Q95 G;  4HHU A;  4F7V A;  3HI9 A;  3N0V A;  3GQC A;  3VGU A;  4WU2 A;  1VQS A;  1AYE A;  2L41 A;  2YQ0 A;  3RAQ A;  5DRK A;  1RIS A;  2LXF A;  1N5Y A;  4X64 F;  4RW7 B;  4DDF A;  3QT8 A;  4KRW A;  1QD1 A;  2R7O A;  3S1T A;  2CJQ A;  3QSY B;  2BJ1 A;  2YH0 A;  4LRA A;  3DN9 A;  3IAM 9;  2O66 A;  1VHI A;  2GNK A;  4JI3 F;  4USW A;  4O3R A;  1S9E B;  4DL4 A;  3CDU A;  2KM8 B;  3TQ1 A;  1HD1 A;  3QAU A;  1BHN A;  4Y0F A;  1LK7 A;  3T1A A;  2FTR A;  3BGU A;  1SJ3 P;  2K1R B;  4EFA C;  2RVJ A;  2C22 A;  5E0O A;  4ECQ A;  3NOC A;  1FWK A;  1HQU A;  3J7Y U;  4E8U A;  4QR0 A;  5HSP A;  1QTM A;  3M8Y A;  3EVO A;  2RDD A;  3MMB A;  2IDL A;  2CPX A;  1JQG A;  3ILL A;  4DV5 F;  3EZO A;  1X7V A;  1MML A;  2B3T B;  2EBG A;  3VCD A;  5KFQ A;  1HMV B;  4DR1 F;  3UD5 A;  2V6A A;  4WKR A;  1H3D A;  2C42 A;  3CJ4 A;  4ANC A;  2V4R A;  3I82 A;  5ETR A;  1FXR A;  4ZJQ A;  4OX7 A;  5KFJ A;  2EG1 A;  2V2Z A;  4FF1 A;  1FFS B;  4P2M A;  4DG1 B;  2HFU A;  2RAQ A;  2DH8 A;  3MM7 A;  1QSL A;  1UJ5 A;  4Z37 A;  3EGV A;  2PFD A;  2R2U A;  4ES3 A;  1DTQ A;  4I7F B;  1L3U A;  2QLW A;  1VQK S;  3FSX A;  2IM3 A;  2DEI A;  3HX9 A;  2R8I A;  1M0S A;  2ROP A;  5K14 B;  1SIZ A;  3DLH A;  3L09 A;  2BM1 A;  1YIJ S;  5H1S V;  2KTQ A;  3PR4 A;  3NS5 A;  5BYS A;  5CHC B;  5ETV A;  3CDW A;  4UUX A;  4YHH F;  5KFZ A;  3US5 A;  3BSA A;  4C6A A;  3BBC A;  4X4V A;  4TY8 A;  2A2D A;  1EET B;  3ENW A;  3VAG A;  1IKX B;  4YME A;  2RE1 A;  1P1T A;  1X4F A;  4AQY F;  3ZTO A;  4O0N A;  2OPP A;  1HWI A;  1V3Z A;  4TLR A;  2AYM A;  4LF7 J;  3CCL S;  1HHT P;  5T7L B;  4M63 A;  4HLB A;  4IG0 A;  2FLN A;  1XC9 A;  3E51 A;  2WSE C;  5KG7 A;  1QSY A;  1TL7 A;  5DG9 A;  4J9Q A;  2AMC B;  4NMX A;  1X9S A;  1RB0 A;  1SKS A;  3TYT A;  1NJY A;  3R2D J;  4IUF A;  4LQ3 A;  2FVQ A;  1GK8 A;  2NXU A;  2ZBP A;  1HQU B;  1YDL A;  1FDN A;  3CD0 A;  3GJS B;  4DR5 F;  4IH6 A;  2FVR A;  5HVF A;  2FIU A;  3R97 A;  2FVS A;  1RT1 A;  2WVE A;  2GQQ A;  3J80 U;  2V8P A;  2Y1R I;  1Q7L B;  2FLP A;  1NZA A;  4NL5 A;  2E7W A;  4PAA A;  4JI8 F;  2AP6 A;  2GO9 A;  4C4W A;  2UVV A;  3T1Y F;  1KRP A;  4LVO P;  2KHD A;  1LEO A;  1HWL A;  5MAO A;  1VLO A;  2K8G A;  4EWT A;  2JC1 A;  3FC9 A;  3MM7 B;  4F0H A;  1C1B A;  4ID8 A;  5GMD A;  1VQO S;  1LQ9 A;  1DTQ B;  2Z2Y B;  2YNG A;  2LXI A;  4RU2 A;  4NCG B;  1BD6 A;  2E1R A;  2HVD A;  3DLB A;  1PC5 A;  1T9X A;  3MD3 A;  1NPK A;  3MEC A;  2HHU A;  3VTI A;  3RU0 A;  2IDE A;  2VOP A;  4D3G A;  5D78 A;  2C2M B;  5IZH A;  1WF0 A;  2XEX A;  4LF6 J;  1HWK A;  1VRU B;  2JRS A;  3PO4 A;  4TY8 B;  3CJT A;  1VBY A;  3MMA A;  3KLF B;  4OZ1 A;  5AE1 A;  2FLO A;  3SV3 A;  3HPO A;  4PXC A;  3AXK A;  4CH0 S;  2P6T A;  1H73 A;  2IVM A;  4LF9 F;  3F0N A;  1DZ5 A;  3IBC B;  1VQN S;  3M1V A;  1Q8K A;  2OPP B;  4JI5 F;  3EIC A;  4XIU A;  4J9K A;  2HNZ B;  1JNZ B;  2ZBC A;  1PBA A;  1XR5 A;  5A8W A;  4YY3 J;  5DS7 A;  3UD4 P;  3FEY B;  2F3J A;  1S5Z A;  3HHL A;  1V9O A;  4IG0 B;  3SBM A;  3MM6 B;  4RBU A;  4PEO A;  3CT9 A;  3W5Y A;  1TL7 B;  4GRS A;  4C0H A;  3HVR A;  3EZ5 A;  1FD2 A;  2Z8Q A;  1ZET A;  4ZLJ A;  1ZM4 A;  2G4B A;  2OUG A;  4C8Y A;  1MW7 A;  3ISN C;  1VQM S;  1RU1 A;  2AV5 A;  4OYX A;  2UUB F;  1MU2 A;  3HSG A;  3MMC A;  3N9U C;  4NRT A;  2AEJ A;  3PKY A;  1BXN A;  4HYK A;  4FN5 A;  4FDF A;  1RT1 B;  2ALY B;  2X7I A;  1FVQ A;  3HT3 A;  1N6Q A;  2J9D A;  2YWK A;  2V63 A;  3G82 A;  2M88 A;  1JJ2 R;  3R5A A;  1S1V A;  4O3N A;  1WEY A;  3VAK A;  3RB3 A;  1N36 F;  1U26 A;  4YB6 A;  2XO7 A;  1CC8 A;  2KFN A;  2CQ3 A;  2JEF A;  3TWZ A;  2VFS A;  3MUV P;  3T9Z A;  3AJ2 A;  3IWL A;  1TKT A;  2XB2 D;  1C1B B;  1YSJ A;  3QRQ A;  3C14 B;  1KLN A;  1HI1 A;  4WZM A;  2W7O A;  2ZZN A;  2XMV A;  2YBV A;  4QW8 A;  5L1I A;  1RHU B;  3MEC B;  3OR1 A;  4PG5 A;  2R8J A;  5LJ3 Y;  4LRF A;  3KLI A;  3TA1 A;  4YB5 A;  1N54 B;  4DUY F;  5HQL A;  4OYZ A;  2IJR A;  2D9P A;  2UUA J;  1WOS A;  1PYO B;  1FDB A;  2V94 A;  1URN A;  3WHI A;  1F5A A;  3A8E A;  4KY3 A;  2FJE B;  4RWW A;  2UU9 J;  4P2F A;  5EN1 A;  3P5B P;  2RIJ A;  3M1V B;  5KFT A;  1S57 A;  2ASL A;  1FRI A;  1VQP S;  3BYR A;  2XG8 A;  4CM2 A;  2OEJ A;  5A8W B;  4ZMM A;  2VPY B;  2DTJ A;  3EGZ A;  5IT0 A;  3HHL B;  2YNF A;  2HWT A;  1DRZ A;  2IY5 B;  4P73 A;  4MIA A;  3DI6 A;  1N8R T;  2J76 E;  4XPE A;  2LLZ A;  2B7B B;  3DOL B;  2X1G A;  1M5O C;  1H7W A;  1FJE B;  3OXF A;  3AOA A;  2D3O R;  3W1Y C;  3MMC B;  3D68 A;  4LBP A;  3W62 A;  1JMT A;  1S12 A;  2VJV A;  2H65 B;  4KV8 A;  4X4P A;  2RQC A;  3PEH A;  1N6Q B;  2IJN A;  3G82 B;  4ECU A;  3V81 A;  1S1V B;  3RB4 A;  3CED A;  2IM2 A;  1X0P A;  2H3E B;  4NXN F;  3CC4 S;  3MEE A;  4G6V B;  3G8T A;  1K44 A;  4BCA A;  2DNM A;  2RH3 A;  4AND A;  1VS3 A;  2W7A A;  3OL9 A;  3DRS B;  1T0T V;  2EEY A;  3CF5 Q;  3KG1 A;  4KT0 C;  1CC7 A;  5CA5 A;  1OY8 A;  1TKT B;  2IFX A;  1CJK A;  5DLG A;  4X4N A;  2LU2 A;  1LW0 B;  4RUH A;  4B02 A;  2VQE J;  4JV1 A;  2JLE A;  5HAT A;  1R3N A;  2UXD J;  2UUT A;  3OR1 B;  2J8A A;  4B9V A;  3KLI B;  1DQ8 A;  1N32 F;  4DU8 A;  4N41 A;  4NLD A;  2R8H A;  5JJB A;  3J7Z 5;  1KHV A;  2BRK A;  2BQR A;  3GG0 A;  3K5L A;  3KG4 A;  5IQQ A;  3BGF A;  1P27 B;  5KFW A;  3WIU A;  3GCX P;  2R9L A;  3PM9 A;  3ENA A;  4ECZ A;  3MXH P;  3H8Y A;  2AKW B;  2DGX A;  3O2I A;  1JJ4 A;  2HKE A;  3W7B A;  1FXD A;  2CPI A;  2POK A;  2QIF A;  2AD9 A;  1NJX A;  1F60 B;  3RR7 A;  1MRO A;  1RA7 A;  4A47 A;  3Q89 A;  2PDA A;  5DGA A;  2DB1 A;  1HLW A;  5DQI A;  4KGX B;  5F8N A;  4YR3 A;  3GLJ A;  2V9W A;  1TVR B;  5LMN F;  2GMJ A;  3DRX A;  5HJY A;  1WC4 A;  3Q8Q B;  4MKY A;  3HLU A;  2OI2 A;  1QTN B;  4DV0 F;  2XMJ A;  3M2R A;  5KFV A;  4QCL A;  3THT A;  4KV8 B;  1RT6 A;  1FD8 A;  3PHE A;  2QSW A;  2CZ9 A;  1FKP A;  1XIQ A;  5KFR A;  3V81 B;  1HBO A;  2U1A A;  4ANE A;  3PW2 A;  3BDP A;  2I38 A;  2CZV C;  4A8X A;  4P2X A;  3MEE B;  3FDS A;  5I4M A;  4OHY A;  2M52 A;  2RRN A;  4JI0 F;  2QX0 A;  2ZUG A;  4C3M A;  2MGZ A;  4PXD A;  2FVP A;  4DX7 A;  3HVA A;  1S1X A;  1H7X A;  1XQI A;  1CJK B;  4Q5V A;  4LIW A;  5C2C A;  1FNM A;  4ZPD A;  4Z7C A;  3SQG A;  4FS1 A;  1RLD A;  1OSC A;  4MIB A;  3M32 A;  3QFW A;  4ZKA A;  2HRY A;  3Q8V A;  4LRD A;  1RU2 A;  2XSJ A;  1T95 A;  1IM4 A;  1RWX B;  2VJU A;  3FZB A;  1HHS A;  5HLF B;  2UXC J;  2D41 A;  3HXM A;  2K2P A;  2VFU A;  2O67 A;  1HNX J;  4DSE A;  2QA2 A;  3FEX B;  1T05 A;  4GKJ J;  1HNW J;  3LGN A;  3MOJ B;  3D28 A;  1SKW A;  1YQH A;  1D3W A;  3TAP A;  1FKO B;  2ATL A;  1AFI A;  1TQL A;  3IR5 B;  2PGC A;  2VAS A;  3D1O A;  5LJ5 Y;  2ROG A;  2VC1 A;  3KK1 A;  3V6H A;  4ELV A;  2QLJ B;  2VPX B;  2Q79 A;  5IS2 A;  4CQ1 A;  3G6X A;  2RHS B;  2WON B;  4J9M A;  3DU5 A;  1NK8 A;  2WVB A;  2G2Y A;  2JHE A;  5A6W A;  1S59 A;  1I3O B;  2BZ2 A;  1UVM A;  3MR3 A;  4WU3 A;  3FSI A;  4WFZ A;  1WD6 A;  1JLA B;  4ED7 A;  1PAE X;  3BO4 A;  3NGS A;  3BKU A;  5B0B A;  4YFU A;  3NXZ A;  2ZKT A;  1VRQ C;  1JJC B;  2VDI A;  1YLX A;  3UWT A;  4MFB B;  3M2R B;  2YWW A;  4I0W A;  4HAC A;  1RT6 B;  4UW2 A;  5H9E J;  5CH7 B;  3F56 A;  2MZQ A;  2JLG A;  4TN2 A;  3KNA A;  2BM0 A;  5HJX A;  2Q6B A;  1HBO B;  4F3Q A;  2L48 A;  1U8S A;  1R89 A;  1W25 A;  5HP1 A;  1OMS A;  5IOL A;  2MGZ B;  2HS4 A;  1WI8 A;  1RTJ A;  1S1X B;  1KHW A;  3GR1 A;  4Y3C A;  2J5A A;  4LF4 F;  2B8P A;  2NS1 B;  5D0H A;  3VZH A;  5F8G A;  1F9H A;  3FK4 A;  1YIT S;  3SQG B;  5DJB A;  3M7V A;  2C3P A;  4XPC A;  4Q7A A;  2HEK A;  2HQD A;  2PD1 A;  4ER8 A;  2C2R A;  2FHJ A;  4DV3 J;  2CQ2 A;  5DZ6 A;  2B9W A;  4CLU A;  4K4W A;  1TFY A;  2P8I A;  4DR7 J;  1O0P A;  1C4A A;  3CJR A;  4DPY A;  2ERR A;  2G1H A;  3B54 A;  1P9Y A;  5L9X A;  3AFG A;  1T05 B;  3KMS A;  2Z58 B;  5KFA A;  4MMO A;  1IKY B;  3TX8 A;  2IYG A;  2MST A;  5AJ3 F;  2HK3 A;  3R5B A;  4HVZ A;  5ETT A;  4EBC A;  3BDE A;  3T41 A;  4U6P A;  1TKX A;  5B7W A;  4X65 J;  4GMK A;  1XMO J;  5K8M A;  3CMQ A;  4C8L A;  2J0S D;  4XAK A;  1SUQ B;  3PJ9 A;  2CPZ A;  3DGP A;  2HIQ A;  3RW7 A;  1RKI A;  2O1P A;  2DRA A;  2W7P A;  1C4C A;  2Y0S D;  3MM8 B;  2C3O A;  2MQO A;  4QPX A;  5FII A;  4PUO A;  3FVY A;  3EM1 A;  4I1T A;  1R31 A;  2XCP A;  2KFZ A;  2IAJ A;  1S6Q B;  3D9B A;  5HAN A;  1HW8 A;  1E6V B;  2H51 B;  2IBO A;  2I0X A; 
#chains in the Genus database with same CATH homology
 2W2N P;  2Z2Y B;  3AFG A;  2W2O P;  3A3N B;  4JP8 A;  3BGO P;  4OV6 A;  2W2Q P;  2Z58 B;  3H42 A;  3A3P B;  4NE9 C;  3T41 A;  4YN3 B;  3BPS P;  2Z57 B;  3QFH A;  2XTJ P;  2QTW A;  2Z2Z A;  2ZWO A;  3P5B P;  3WHI A;  3GCW P;  3WIU A;  2PMW A;  3GCX P;  4K8R A;  3A3O B;  3CO0 P;  2W2P P;  1ITP A;  3VV2 B;  1R6V A;  2E1P A;  3VHQ A;  1SCJ B;  1V5I B;  2Z56 B;  3SQO P;  3WIV A;  3CNQ P;  2ZWP A;  4NMX A;  1SPB P;  2Z30 B;  2W2M P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...