5B08A

Polyketide cyclase oac from cannabis sativa
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
b'AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 28
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b08A00
2HLUA 1U7LA 4QOTA 1SI9A 2RILA 1MWZA 1TZ0A 2ZDPA 2KT2A 2CRLA 3BDEA 3CJKB 3VTIA 5KAKA 2XMVA 3HFKA 3FMBA 2ROPA 1Y3KA 2K1RA 3BGUA 2BJEA 3LO3A 2XMMA 4NPOA 1FEEA 5F0WA 2GV1A 2OP5A 1R6YA 1OPZA 2VV5A 1TL4A 4NL5A 2W4CA 2XMWA 4DN9A 3HHLC 2FIUA 1OSDA 2K2PA 1JK9B 4DL0C 1X7VA 2KYZA 5A6WA 1FD8A 2GA7A 2EW9A 1FESA 1ULRA 2OD6A 1Y3JA 4FNIA 3TNVA 3HHLB 1P8GA 3HX9A 2OFGX 1SB6A 2FHMA 4OJ3A 1S6UA 2G9OA 1YJUA 2AJ1A 3DCAA 2IFXA 3QMQA 4HH1A 2LXFA 1CC7A 3CJKA 1W2IA 2IYIA 2LQBA 3E8OA 3HF5A 2FTRA 2BYCA 2OAUA 1VQYA 4A46A 3BN7A 3MCSA 3T9NA 2AW0A 2BUNA 2JDJA 3LGMA 2LDIA 2N7YA 1LQ9A 3I9ZA 1GXTA 2GCFA 3TOQA 2OMOA 2ACYA 2LQ9A 2QLXA 1WD6A 2KKHA 2W4DA 2QYCA 5B09A 5B0BA 1GXUA 1K0VA 4A4JA 5B0AA 3HHLA 2AJ0A 4Y2IA 2RSQA 4HL9A 3KG1A 3UDCA 4HI1A 5T7LA 1X8DA 2L3MA 2FB0A 2K7JA 3BB5A 1X0PA 2HLTA 2N4CA 5B0FA 1N5SA 1KQKA 3BM7A 3GZ7A 5T7LB 5A6PA 2PD1A 3MZIA 1OQ3A 2W4PA 2AP6A 3FRYA 1FE4A 2BBEA 1V3ZA 4ZOSA 2HFOA 4Y2KA 3WDOA 2K7KA 1FVQA 2XMUA 3F44A 4Q2LA 5B0DA 1TL5A 2XMKA 1OQ6A 1YJTA 3KG0A 2GGPA 1KVIA 2KT3A 3KKFA 2GO8A 4YEAA 1QUPA 1AFIA 2ROEA 1Q8BA 3K7RA 2QIFA 2RU9A 4OJHA 2BJDA 2GFFA 5B08A 4F67A 2GGPB 1FE0A 2VH7A 1YJVA 1AFJA 1Q53A 4OJ1A 5B0GA 1MWYA 4A48A 2PGCA 5F0UA 3QGPA 1KVJA 1Y0HA 3KNGA 2ROGA 4Y2MA 2OFHX 2RMLA 3BR8A 4FNHA 2ZDOA 4EFAC 1Y9OA 4ZA1A 1TUVA 2XMTA 1CC8A 2ASYA 2QLWA 4HH0A 4YDXA 5B0CA 1APSA 3HDSA 1IUJA 1URRA 5K9FA 1SQEA 1JWWA 4OJGA 3IWXA 4U9RA 1CPZA 2HIQA 1YJRA 1VQSA 2K1RB 5IXUA 1Q4RA 3FGVA 3DXSX 1XBWA 1RJJA 4Q2MA 1N5VA 4DPOA 2OD4A 3BF4A 1Q8LA 2IYGA 2XMJA 1TR0A 2HFNA 4HI2A 1N5TA 3LGNA 3HHLD 1FVSA 2Q3PA 2N4DA 1N5QA 1P6TA 3IWLA 4A47A 1AW0A 2OKQA 1YG0A 1YRXA 1S6OA 2HQIA 4OIXA 3TRGA 5B0EA
chains in the Genus database with same CATH superfamily
2HLUA 4DMZA 3HI9A 4RW8A 5D77A 4N47A 5G0RA 1RTZA 3RU0A 3I4HX 4GC6A 3DLGB 3C6TB 4C8KA 2CDQA 1F2GA 5IWAJ 1HW8A 3CUNA 1NZAA 4EUVA 4X65J 1YGYA 3FBEA 2R7WA 1WC1A 3J80Y 2Y0SD 4BCAA 2RSQA 3VQSA 4DV5F 1Q7YT 2DITA 1TFWA 3ZTQA 5MAOA 2HWHA 1J27A 2HFOA 3D1OA 5DGBA 1AYEA 3DLKA 3CC2S 2C28A 4X62J 3KDOA 3GIJA 4X64J 4J9PA 3UCZP 1RU1A 2ZE2A 3UNGC 5IM0B 4IG0B 4DV1F 2IJNA 3IR7B 3V6JA 1MMLA 3QT7A 1SJ4P 4PXEA 1NDKA 1BLUA 2E29A 3KNGA 4AE5A 1JNRB 2RRBA 4YDXA 2FLPA 4DUYF 3OL6A 3QPIA 2DNYA 3DYAA 1BGXT 3K59A 4WK1A 1P1LA 2YWGA 2DR9A 3CJQA 3PHEA 2BA9A 3LGNA 3TO8A 4A47A 3I96A 4LF8F 3UN5A 3OTOF 4LFCJ 4X4RA 2EC2A 2HHHF 2WVBA 1SQFA 1YJ9S 4NOHA 3KUEA 3GFHA 5K14A 1RT6A 4NYPA 5F9NA 1M5KC 3T6BA 3HHLA 4F3OA 1EP4B 3VZHA 5HO4A 1ZH5A 2ZVSA 2JEFA 4W90B 2HPUA 3CD6S 1IBMJ 3VGTA 4MJKA 1UVIA 3ILIA 2FVQA 3BH6B 3BO2A 1IN0A 4OYOA 3EE3A 3NNHA 5L1LA 2HHVA 2YBVA 3MOZA 3K89A 2CQ0A 4TNOA 3NKYA 2WVEA 4M5NA 3UD3P 2AU0A 1IWAA 3QRPA 3MECA 5KT6A 3H2LA 2R2SA 4J37A 4RL1A 4KHRA 1KQFB 1TR0A 2E5JA 2ZH6A 1SKWA 2AJ4A 2PEBA 4R8UB 2XSJA 2R7OA 1FDAA 2CQ1A 3LP0A 1HNIB 3LO3A 4I2PB 4NPOA 5A8RA 4F04B 1RWVB 2RT3A 5F8HA 3R6GB 3TZYA 2QJ3A 2OFGX 2JZ5A 3AXKA 3UN3A 5KOXA 4YUDA 1FJGJ 2P6SA 2D3UA 3NWGA 2YY3A 3K8WA 3MM9B 2KJWA 4KJIA 3VVTA 1LWFA 1HQ2A 5KFSA 3M2UA 1R0AB 4V19J 2LMIA 3CDAA 4YQWA 4DL6A 3DMJA 3LPEA 5D8HB 2GFFA 1PSDA 4LIRA 4KKOB 2CWXA 2CG8A 3QIPB 4EI2A 2E66A 5C2CA 1F9EB 3ENWA 3PCOB 4QYRA 4RBUA 1RT1A 1RP5A 2MHEA 4O3PA 1BHNA 2FVRA 3TQEA 4ECVA 4F8RA 3FK4A 5HAOA 4X4OA 4Q7AA 3W2WB 2J0QD 2FDNA 2XMWA 4RX6A 1RKJA 1S49A 1R6VA 3P5TL 1MROA 1NSPA 3TWZA 4DV7F 4M5HA 4YHHJ 2ZD1A 1YK9A 3EGWB 2J76E 4UY85 4NLGA 3MM8B 5CAAA 3JTOA 4CP5A 1ZS6A 3QT5A 4LFBJ 3B82A 3M9NB 4RW9B 5BR8F 2FJVA 1GTHA 2D41A 2QMXA 1AFIA 1VC6A 3EDRB 3LUYA 2JHEA 3UNYA 2YH0A 1YJ7A 2GO9A 1H98A 2KVQE 4OYMA 1U6FA 3TAMB 1HBMA 2DYAA 4UF4A 2DHHA 4C48A 1RYRA 2ZHOA 2NPIA 2ILYA 5KFZA 1Q7LB 3GIKA 3DRRB 1RHUB 2R4FA 2GHPA 2VG7B 1EKRA 4IQXA 1T0TV 2XMVA 2L08A 4DR4J 3DHXA 4B3SF 2C22A 3K57A 2CQIA 2M52A 2UXBF 1NB2A 1VK3A 5D4NA 4JI7J 4DX5A 1O6XA 1N88A 4MK8A 3R5JB 3J7A1 2ERRA 4C8YA 3EWGA 1VR6A 2OSRA 1RLCL 2DNMA 4IRCA 1A7GE 2GCFA 5B7WA 2OMOA 5IT9Y 4K4ZA 1JLAA 3HXMA 1R8BA 1FKOB 4HLBA 4NX9A 4MTPA 4HHHA 3AOBA 4H4OB 4M5GA 1VFJA 4JI4F 4L76A 3TARA 4KV8B 2FPHX 2XNQA 1IM4A 2MQ8A 2XC9A 3WX8A 4AFFA 3OT9A 2MZRA 4LF4J 4ZLNA 4CH1A 2DHXA 1IKWB 2FLLA 3MMBA 4KRWA 3AFGA 5EWEA 1I51B 4USUA 2YKAA 2EEYA 4ANCA 3SV3A 1CQMA 5J2QA 1F3FA 3FZ2A 2DISA 1RHRB 2HNDB 3I0SB 5DS7A 1YJNS 1ZAVA 4AQYF 1MN9A 3B4DA 5IQ6A 2GV1A 1JLEB 3QYYA 3ZFVA 1LXNA 2FHOB 3D68A 3T3FA 5ETOA 1NSAA 3VAKA 4O4GA 2WSFC 4B9SA 3AA9A 2GJFA 2AQ4A 4ZVPB 3WBZA 2LQ5A 2R7TA 3M8PB 2XWYA 3DLBA 1J5EF 4CTAA 3I31A 5D4OA 4HKQA 1H3DA 1HWUA 3DLJA 1NDLA 1OQ3A 1UJ5A 1KOHA 2ADBA 2KHCA 1LEOA 2ATCB 3MI7X 2UU9J 4WPAA 3H20A 4N77A 5IWAF 2GIRA 3TUPA 3NGSA 4X65F 4IO9Q 3MCMA 4N41A 2HWIA 2MMYA 2QLWA 1HWIA 2PMHA 2YKNA 4ECXA 3GMGA 2VONA 4K0KJ 5KG5A 4K50A 3KHGA 4ZJLA 4AD6A 4X62F 1ZM9A 2XMMA 3IR6B 5D4PA 1P1TA 2HNYB 4F25A 3J81j 4M94A 3R7NB 1VI7A 4YR0A 3LP1B 2R42A 1JXVA 3E01A 3HT0A 3GCWP 3BGOP 2OPQB 2FGCA 5BYSA 1TMJA 1UMJA 5B0BA 2A0FB 2YNGA 2IRXA 1XMQJ 1SC6A 1S1WB 3R1LA 3QIDA 1RACB 5HVFA 3Q22A 1R27B 3MGJA 1G6BA 1PO6A 4NWBA 2E5IA 4LFCF 2CZVC 9RUBA 2XY5A 2GC8A 2OEJA 1N48A 2RE1A 2QIFA 4ZHRA 4ECUA 1F1BB 2CJYB 3ULHA 1Q95G 2VPYB 1U1NA 4ED3A 2YH1A 1UJ6A 3EXCX 3KJFB 2ZH4A 2DNQA 2DBBA 2EI5A 1TK5A 3OXGA 1T9TA 4K4XA 2NZCA 2HHXA 4FKXA 1RJJA 2MDAA 1RBLA 1CJKA 5G4DA 2UUCJ 1I5OB 4DV2F 2RKIA 3RB4A 2G2OA 1VBKA 4PUOB 2KU7A 5J2MB 5F8GA 1FCAA 2R8GA 4IFYB 3FFIB 1IKXB 3TUZC 4UT4A 3KNAA 5GMEA 1VQ7S 3WC0A 4DG1B 1T05A 3C6UA 3DRPB 4C11A 2RQ4A 4LSZB 4KH1B 3GSDA 5A8WA 4Q8EA 3B8HA 4LF5F 4HI1A 4OV6A 5LMNJ 3GB0A 4X4NA 2JH3A 3R2CJ 2FQQB 1V3ZA 3ZTOA 4FYDA 1MWQA 4PPZA 2CG4A 1OY8A 3ENVA 3P3DA 3W5ZA 1C0TB 4RU9A 4KGXB 3VV2B 1UZHA 4IRDA 1XIQA 1IBKJ 4A8OA 1WSRA 1XJWB 1QVFR 2JVRA 2IC3A 4NLPA 3PM9A 1RLDA 3J80U 2XMTA 3EYZA 1JWWA 4B3OA 4IRKA 2ACMA 4ECSA 3HVRA 5A0YB 3HLUA 4U8VA 3NNCA 2ZH8A 5CYMB 3SMZA 3CDUA 2X51A 3IWNC 1FEEA 3H5YA 3H0PA 4DN9A 2FIUA 1FTRA 3P6YC 3I82A 3H59A 4LSNB 1QE1A 5AXMA 2EVZA 2WTFA 3CC7S 3KWMA 1T9VA 3DOLB 1R8HA 4I6YA 3I9ZA 3N0VA 2HBYB 1G2EA 4NZ6A 1GXUA 2RVJA 3GG0A 5IC4B 3NOCA 4USMA 1QAYA 2PIIA 3EICA 4LRCA 2VOPA 2MEWA 1TV6B 2X7IA 1XMOJ 2M8HA 5KG1A 1MU2B 3AT1B 2AKWB 1TL5A 5FDLA 2AF6A 4DV3F 1RYSA 2KXFA 5AE1A 1S6PB 2MLZA 2VQEJ 3Q24A 1CJTA 2FHJD 2VD3A 1YHQS 4NXMJ 3TA0A 4YHHF 4FKYA 2FJWA 2LQJA 1QVGR 1RE1B 2E9ZA 1G3OA 1LW0A 1WHVA 1VOMA 4W98A 4LIWA 1NAQA 4P72A 2PN6A 3U1NA 3FCVA 3OVAA 3J7Z5 3S1TA 2RILA 1N0UA 1RTIA 7FD1A 3O1LA 4NLRA 1UVLA 5CCLA 2V8DA 4USWA 1X5SA 1OPIA 4UZBA 2OGUA 4S0MA 2UUBJ 3IS9B 1MMDA 2X1GA 2IA0A 4PG7A 3H5SA 3EUNA 4MMOA 4TY8B 3RB0A 4LBHA 4CLLA 2BACA 4HL9A 3UDCA 3JQJA 3H2VE 4F3QA 2V67A 4ZKAA 3DLEA 2MZJA 1CS4B 3MTJA 4ZVGA 4OX9F 3KLEA 4RNHA 2DKOB 3CMES 1FE0A 1VQ5S 2G1HA 2WRMA 2UVWA 3IO1A 1FTCA 5J2PA 2G1DA 4DR5J 2W2OP 4WF9Q 4U9RA 4NXNJ 5DZ6A 4ELUA 4I6AA 4FP9A 1XR5A 4P73A 1P6TA 2MYFA 3H4DA 1K8AT 1XNQF 3DLGA 3EVWA 3M8ZA 2AHOB 2R7VA 3N79A 3HZGA 2FJEB 2ZH5A 1QAJA 3NGTA 3TNVA 4LF4F 5A2QU 1ZPVA 5D0GA 1N32J 5HMYA 2JLFA 4IFVA 3HM9A 4NEYA 4C98A 2W7AA 3V81A 3P45B 2XS5A 3O44A 1YSJA 1WELA 1KQKA 4TKTA 2MQPA 3R7BB 3OR2B 5I3QA 2MZTA 5IM0A 4JI8J 4IG0A 3G96A 2GIQA 1QUPA 1IJEB 3T1HF 3UR0A 1YWXA 3R7SB 4OJ1A 3R3TA 4TN2A 3EPIA 1NDCA 3GPAA 1FDDA 5ETSA 3IWXA 4KYZA 3QJPA 4ZLLA 2ZITA 3TZZA 4M5LA 2R7XA 1RHMB 3X1LB 4IH7A 2QA1A 2DNHA 2QEXS 4ZPDA 3K5PA 4ZN1A 2QSFA 2G0JA 2Y0BB 5A8KB 2R7QA 4NA2A 5KOWA 2JLGA 2XZTB 3CWJA 2R8IA 2LYVA 5LSOA 1MMNA 4LRDA 4XDDA 1WI6A 2W9AA 3KLVA 1IXKA 5FLXY 3QQCD 2RF2A 3AH6A 2O1PA 3QZ7A 2YQ3A 4RBVA 1N56A 1MSWD 2H9ZA 2C2RA 3LP2B 2BE7D 2RNEA 2C42A 2GNKA 4IR9A 2R8HA 3JSYA 1KVKA 3MMJA 3DN9A 3NG8A 2CQ2A 2RB7A 2E9RX 3VVUA 3OR1B 3DFEA 3RBDA 1T9YA 2ZBQA 3V5RA 4RW7B 5J1PA 3A8KA 5IT9U 2CPFA 3CE8A 1XMQF 3GIMA 1EAYC 3HZEA 2ZBCA 4R8UA 2FJXA 4V1Ak 1QTNB 2ADCA 2C2NA 5HMZA 1JLBA 2F8HA 1PCAA 2GQ2A 5HLFB 4AYBD 5ADZA 1WHWA 2CIMA 4KB7A 5KFCA 1S4EA 3QBCA 2NXNA 5JVGQ 2BR0A 2LECA 3MM9A 1JLQB 1CQNA 2DGVA 2ATLA 2OJ3A 1RAHB 3KUGA 4CLTA 3I6PA 4OQJA 4LUBA 3Q89A 4O3NA 4Y65A 4CDIA 2AGQA 4AL6A 3R5AA 2ZJPQ 3FSIA 3P8BB 3PTWA 3IRWP 3LOUA 2O67A 4KKOA 4P52A 1XNRF 2DNGA 5EDWA 3QIPA 2YX7A 1ACMB 3GCXP 4J9RA 2XO6A 5KG7A 3MUMP 4F4AA 1Y00A 4KGMA 4ZVQB 2E5LJ 2M2BA 3DHWC 1HNZF 3A8EA 2HQGA 1JXLA 2DH7A 4OZLA 3M8WA 4MIBA 2F7VA 4Q0BB 2DNNA 4JP8A 4DUTA 3UCUP 2J6SA 3KDNA 4DQPA 1VQ8S 2R7SA 5LSRA 5KFYA 2EKNA 1RT4B 1YRXA 3PO5A 3W2WA 2DNKA 3VTIA 2DNPA 2CPEA 2QLBB 4XK8C 2K1RA 4PWWA 4CCHA 1R6YA 4FYXB 2OI2A 5KT2A 5GVQA 5DM7Q 2GHVC 4KBIA 2QL9B 3R5BA 2WCXA 2EC0A 3UR3C 2HVZA 5KG2A 2YNHA 3MM8A 4NA3A 3W66A 1HNXF 4DX6A 2QLXA 3HFVA 2I9SA 1N36J 1X8DA 4M5KA 1TL7B 3V6HA 5IV4A 4V19X 1HNVA 4OV1A 2Y8WA 1UVMA 4OLPA 3VGVA 3MUVP 1TKDA 4ZVRB 4LBPA 2CQPA 3GV7B 1JJ2R 1S79A 4B3RF 4LF2A 3TAMA 1S97A 1SIZA 5D15A 2A6OA 2ZVIA 1YTYA 1XQIA 3PYGA 1RT3B 2PO4A 4OL8A 1RA7A 3PYDA 3NOGA 1X4AA 1VQSA 4DPXA 1FERA 1KP6A 1S9GB 1RAOA 2BANA 2JRSA 5B0EA 2EKYA 3MM6A 2XQCA 2F4FA 1SKUB 2YNIA 2MSTA 1Q5VA 2VQEF 1KLMA 2I1RA 4JUZA 3W2VB 1B7FA 2XB2D 4GC7A 3ZZTA 5DZ7A 2BABA 1TKZA 4MKBA 5H9EK 2HRYA 4F4XA 2HHUA 2W4DA 3BSCA 4URSA 4ZJOA 4H4OA 2PFFB 2ZBIA 3ILOA 4Y3CA 3US5A 2F3JA 4KV8A 3WDOA 2GVDB 2F4VJ 2E44A 2MY8A 2H4WB 1UL3A 3FSYA 1F3VA 3H7HB 1IBLJ 1R8CA 3HMJG 2F8EX 2QMUB 4FNHA 4KGZB 3VF0B 3GJQB 4RNFA 2BVZA 1YJRA 4J9SA 4CO0A 2VG6B 1N5TA 1NJIT 3D67A 1AW0A 2Z57B 2DY1A 2KI2A 1JLEA 5D3GB 5KFHA 1Y11A 4QIWD 1U48A 3KYLA 2MQOA 4OI4A 4J91A 4LR9A 2E1MC 3W65A 2C3PA 1XC9A 2HHWA 4QWBA 3M8PA 2LXFA 1Q81T 3W8GA 2CAJA 3PKMA 1VRTB 3T9NA 1GXTA 5LMUF 3H98A 2QC3A 4NXNF 5CABA 1DRZA 1S0MA 2M9KA 5CZXA 1X5PA 2PA3A 5T7LB 3DGVA 1U1RA 5GMDA 3D1QA 2XHCA 2I2YA 5KFEA 1OQ6A 2NXEA 3B6BA 1W2BR 2DK2A 5B08A 4LRAA 3EGNA 1SJ1A 5E3RA 1QAIA 1LNQA 1D1UA 3K58A 4Y00A 1N32F 3K17A 3KK2B 1MG7A 1P27B 2ZKUA 3I5CA 3QT6A 3TVYA 4HR2A 3JAMY 2QN6B 3C2PA 1KTQA 1JB0C 1JJCB 1B0VA 1RTHB 4O0IA 1SL0A 1N5QA 3NBPA 1WF2A 1UW4A 3BR9A 4ZS6A 2MQLA 3LP1A 3CCZA 2RIJA 4DL0C 2GA7A 2IM0A 4JI3F 2BRLA 2M0GB 2J7UA 5I3UB 2OPQA 4TY9A 1VQMS 1VGYA 5KFBA 3FJ2A 2UUAF 3I87A 2BM0A 1S1WA 5GADI 5FD1A 4DSKA 2ZOFA 4I7FB 2OPPB 1FT8A 1WC6A 2QT7A 1PYSB 5KFVA 1VQNS 2RU9A 3MHYA 4TQSA 4I68A 2RMLA 2C2OB 4F02A 2VQFF 1XERA 2GX8A 1FO1A 2HIQA 2UV8A 1SKRA 3FEXB 2P9GA 4CNYA 3FGVA 5C24B 3ZZRA 2B4UA 1DURA 4Z7CA 4Y34A 4I6WA 4RW4B 4DV0J 4WYWA 4BWMA 4K4UA 4HTJA 1HBUB 5HANA 1IKXA 1IVZA 4DUZF 2V6AA 1FRIA 3QWPA 1HYSB 4YS2A 4DG1A 3LALA 2KYZA 4FS2A 4XAKA 5GMKa 2VA3A 5E2QA 1H73A 2C2ZB 1E6VB 1PG5B 4G1QA 3V4MA 2M4MA 2W2PP 4UQGA 4LF7F 1LQ9A 4IH5A 4P2SA 1WD6A 3D54A 3QFHA 4LFAJ 3E3XA 2PE8A 3O2IA 2HURA 3W7BA 2NUUG 4ELTA 4DL5A 4XO0A 4ILMA 4FVCA 4FZVA 3DYAB 3HHKA 1U4BA 2HMIA 2LKZA 2Y8YA 3GYGA 2BDPA 3OXLA 2BQUA 3IP0A 3VAJA 4DXLA 5B0CA 3BJYA 3SFUA 2ILZA 2MJUA 1XBWA 1FJEB 2F40A 5CYMA 2XY7A 2V68A 4HYKA 2U2FA 3JTNA 4USVA 1Y3KA 5K14B 3MEGA 1RT6B 1NHUA 5KFAA 4LSNA 3M05A 1VQPS 2YWFA 1WKLA 3OFEA 3OFFA 1RQ0A 2H4YB 2J7KA 2CNLB 3HHLB 3D0GE 2EBEA 3VCDA 1S59A 3DOLA 3ELHA 4WFAQ 2E5LF 3VGUA 4Z2XA 2MZ1A 3ZZ0A 4DQSA 2L9DA 1WG4A 1X5OA 2VPXB 2LDIA 1X9WA 3IC1A 5IC6B 3I9V9 1RU2A 5DETA 2NZ4A 1TV6A 2WB4A 1NHKL 3MWBA 2L3MA 3GONA 4RLEA 1KRPA 3G86A 5KFQA 1VQKS 5T41A 4YFUA 4ZCMA 3TA1A 1PC5A 1YJTA 2KG1A 5IT0A 1OY9A 1QJHA 4FYWB 3G87A 3MECB 3PRDA 4JI6J 4M8LA 4OZ5A 3CJ8A 4CIOA 2HVHA 3OL8A 1T8EA 3HO1A 3U27A 3A8JA 3DLHA 2XSJB 4HT5A 1UWAA 4B9UA 1URRA 4WP3A 3P4UB 1K44A 1N36F 4K2JA 5A8RB 1C1BA 4C3LA 4M5MA 3ENQA 3MOJB 4EO6A 3FMBA 3TEGA 4CH0S 2OLWA 4OX8A 1R0CB 3HHLC 2OPSA 2WHOA 1JX4A 4W92B 2V2ZA 3THPA 1LWFB 3HT3A 2HQFA 1X60A 3M2UB 4XPCA 2LA4A 1CSJA 2BUNA 1FA0A 4ZVSB 1NJXA 4MAKA 7AT1B 1UEKA 3F56A 3ETMA 2VDHA 2FJBB 3VAGA 2RU3A 3CGIA 4OX6A 5GAGI 3F0NA 4C7QA 1CS4A 4Y28C 2RAQA 1FK9A 1YBUA 1RT1B 5LL6d 4UOHA 2GGPB 3HD1A 1UFWA 3N6NA 2JEIA 1F6TA 4K59A 4ECQA 2WONB 4NLTA 3KMQA 2B56A 3CSKA 4YDDB 2BXJA 3KLFB 1Q8LA 3OJUA 1WUUA 1UJ4A 4KSEB 4TYBA 5C25A 3NLCA 2F4VF 1NHVA 1RABB 1K1SA 2G2YA 2ZD1B 3HJFA 3QLHB 2KO1A 1RADB 2O01C 4K4YA 2XCAA 5BJRA 5CCMA 1FESA 1UETA 5D6GA 5KFMA 3RR7A 2XZDB 4RW6B 4CQ1A 3MCSA 2J9CA 2EPIA 4LVNP 2DJWA 1LXJA 1U2FA 5DLFA 3BGRA 1WF0A 4IR1A 4ILRA 5HL7Q 1QY7A 4AUKA 5DQHA 3ZC4A 4MYTA 1T9WA 4Q2LA 1VBXA 5DO2A 3KG0A 3TR5A 2G13A 2BJDA 4PWDA 1NNDA 3ISZA 3DOMB 3RAQA 1Q79A 1LWEA 4NZ7A 2B8QA 4EYHB 4N56A 1U1LA 1NMEB 2NS1B 3OL9A 5C42A 4G3IA 1WC0A 3FBBA 4DFKA 4EO8A 3EGZA 3PG9A 2A18A 5FIIA 2XGQA 1YG0A 4K5RA 3GSIA 2Z0GA 3VZIA 1C4CA 1HL6A 1G4CA 2IRYA 3GILA 2MQMA 3T1YF 5JMNA 3PDNA 1S6QB 3M6XA 3CJSA 4A8MP 5LXYA 2IHR1 1JLAB 1TKXB 2B0GA 3D0IE 2YQ0A 2BYCA 2YWHA 2ZOGA 1TELA 5HROA 2XCPA 2AT1B 2DHAA 2XM3A 4QPTA 2KHDA 3IMQJ 1KR4A 2VPWB 3KTQA 3JB9k 4O44B 3BM7A 3LP2A 4U7UK 4DS4A 4Y2KA 1GH8A 1PILA 1U47A 1UA0A 1T9XA 2CQCA 3HHEA 2CQGA 4WFXA 4YOEA 1SVDA 3MMBB 2W7OA 1H7WA 1S0VA 4LQ9A 2Q1LA 2E9TA 1I94F 2B4PA 2VBZA 5J2QB 1NZ8A 2U1AA 1SH3A 4Z37A 1DBDA 5KT3A 3MFIA 2HS0A 2O66A 1B3TA 1A9NB 3M8RA 8AT1B 2QX0A 3TW0A 4O4GB 2RQKA 2HZAA 4MH8A 3S6EA 2GJ2A 4ZIVA 1YLXA 5HLFA 4C4WA 4DUYJ 4LBIA 1VCTA 4RZRA 3QGGA 3CJRA 1FD8A 4DL7A 1ULRA 2AIRB 4LF8J 4C0OC 1S77D 2ASDA 1FXDA 3OTOJ 2NXCA 2HW3A 4B02A 3P5BP 4K5SA 4E8UA 4WP8A 4C3MA 3OHBA 3PJ9A 2OSQA 1DQ9A 1IBCB 3MZIA 1X4HA 4EZ9A 1RWXB 2DHSA 1T9UA 4USTA 1U0HA 2XO7A 2F65A 5KFWA 1WNEA 3GJTB 4IDKA 4CNZA 3ZZUA 4TU8A 2JL9A 4DOZA 1FX2A 3LAKA 2V8HA 4YB6A 1DLOB 2DNRA 4TLQA 4DV6J 3GTYX 1AZSB 4JI5J 4XDCA 2W8LA 3IWLA 2OKQA 2H54B 3K5LA 1AFJA 4CO5A 3MR2A 4O3SA 1HI1A 2Z56B 3SEOA 4ZVOB 3RTVA 2LFVA 4OI3A 1OPZA 5HSPA 3TA2A 3CTRA 2RJZA 1WSVA 4DL4A 2M5YA 2M70A 3L4BC 4TU7A 2JVOA 2P9EA 4FYYB 5D0EA 3F73A 2H5JB 5M2UA 3EZOA 2LQ9A 1TL7A 4Y2IA 1HNWJ 3BPDA 2CPHA 2ZM6F 3OQ2A 2QTWA 4ZHRB 3AOAA 4KAIA 3C16A 1SV5A 2DRBA 3BDPA 3RBEA 1FVQA 3W1YC 2J8AA 3R5DA 1VHIA 1HQEA 3PEHA 4EU0A 2K06A 2IVFB 4I2QB 3N4WA 1E6YA 1CJKB 1NU4A 3OUYB 1JJHA 2CWKA 3NCRA 1RZMA 2RKIB 3DLLQ 1IUJA 2MGZB 4P9SA 2ZUAA 1S9GA 4F4WA 2G4BA 2I6WA 3MEDA 2UP1A 3G6VA 3M8YA 4A8YA 2D3OR 3BDEA 1LK7A 2F5GA 5GAHI 2LEPA 4C11B 2WVCA 3THTA 4AXJA 4P2XA 2OP5A 4X66F 1NBEB 4FXWA 4JI6F 3WZ0A 1S57A 5A8WB 3TX0A 3AD7C 1FD2A 1P8GA 4CM2A 1QAXA 1KS2A 3QMQA 3MMAB 3SCJE 4NI2B 3L9ZA 5LXRA 3LGMA 2J5AA 4KHPF 2BE2B 2MZQA 1DTTA 2RDJA 1X4BA 2ZEJA 1IQZA 5F8LA 1AROP 2GVDA 4OHWA 3KK3A 3ZZZA 5AE2A 4MFBA 1NSQA 2KJVA 3TI0A 1XMBA 2HQDA 1R8PA 2GO8A 5F8NA 4WFYA 2H5EA 4B3OB 4FXVA 2WZ1A 2NSCA 2BJ1A 4WBFA 1QM9A 1C4AA 3QGPA 1V9OA 2Q43A 5KFGA 1NKCA 5ETNA 5DDRC 5JJBA 2XYPB 2D69A 4GVBB 1N5YA 3H42A 1GMUA 4DN0A 4C8OA 2PEHA 2DVIA 1N54B 4P71A 2KL8A 3KK1A 3G2XA 4D3GA 4ITSA 3QSYB 4EBEA 1FWPA 1EETB 4BS2A 5LJ3Y 2PC6A 3A4TA 3UI3A 1VRTA 4FXDA 4B3SJ 1NKBA 2UXCJ 2UXBJ 2Z2MA 4ECTA 1SPBP 4L73A 2AGOA 5T7LA 4A8FA 3CCMS 1U1KA 1S76D 4P2MA 4P75A 1IQTA 2H5IB 2KZMA 4A8WA 3D6TB 4K4TA 3KXDA 3CNQP 3PX6A 4BHQA 4DFPA 1LW0B 2V9WA 1HBNB 4ZN3A 2HSEB 3P49B 1V5VA 4JI4J 1WORA 1X5TA 1FFWB 5AXNA 1RTIB 1RTHA 3ZZPA 5DDQC 3IAM9 2NXUA 4URGA 2LXUA 2AEFA 5F8IA 1H74A 1S6OA 2PA8D 3AOCA 3CJ4A 4WYLA 1NEEA 3HFKA 1YZ7A 2X3GA 2VASA 1S0OA 2CQDA 3SQGA 1VJQA 3IRXB 3QAEA 5J1EA 2IYIA 4ECRA 1YX2A 3KJVB 1SH0A 3DLEB 2OPPA 4J90A 4IYQA 2VZ9A 2V8PA 2XS7A 3M8QA 3KLEB 4ANEA 2C3OA 3R9LA 2XI3A 3PRVA 3DC2A 4CLUA 3EPGA 3MAAA 5J2PB 3K8VA 2HFVA 2E1AA 4J9NA 1J5EJ 3EDQB 4XTTA 3KLIA 4F4YA 5HMWA 3BQ0A 2RRNA 5K8PA 4NLDA 2Y1LB 1NB7A 1FFSB 4I69A 5C24A 1X4CA 3R1HA 2F9DA 4YN3B 1T02A 3OLBA 1R89A 2JFKA 4RW4A 2PT0A 2CVIA 1HBUA 4KY3A 3D0HE 4A8QA 3GE9A 1HYSA 4K4WA 3BGUA 3DU5A 4IFVB 1XR7A 2CZ4A 1T3OA 1NK6A 3KOAA 3V81B 2CVEA 2YKPA 4CO1A 2VHGA 2GJIA 1E6VA 1FRHA 3DRYA 1LK5A 2Z2ZA 3NWRA 4LR8A 4UY8T 4NRUA 1UWBA 3TVKA 5IQQA 2FJAB 5E7OB 4WK3A 3HVTB 2HK3A 4J5OA 1K0TA 3F44A 4ZVFA 3SZ2A 2BJ7A 4LJMA 1WEYA 1U09A 4CT9A 3W5XA 3H25A 3O5TB 1PGZA 3QZ8A 5ETPA 1MLAA 3IG1A 4FYVB 3HVAA 1U26A 1JXEA 4EGLA 4USHA 1SC4B 3U02A 4WIQA 1NLKL 2IVYA 2QA4G 3DI6A 3W9JA 3I5BA 3JSRA 3ZTRA 4K4VA 1UTAA 2EFOA 3K2YA 1QUVA 2DGQA 2PSZA 5HP1A 4DV2J 1S6UA 3AD9C 2RF2B 2LQBA 1CLFA 4ETXA 1VQYA 2HGMA 1FNXH 5L9XA 1B0TA 4NLQA 4DV6F 6FD1A 1EJ7L 3CCRS 2HS3A 4TVAB 1WF1A 1TKTA 4DPTA 4JI5F 3T5LA 3OLAA 5GADU 4PAAA 4GRSA 1T03A 4CLWA 2DNOA 1KONA 4QBUA 4CLKA 3LPYA 3AODA 5SZTA 5D0RA 1G7CB 4UUXA 4AXIA 4CO4A 4LF5J 1M90T 3Q2TC 4OI2A 2V4QA 1WC4A 4F26A 1L3SA 3BKFA 2MKIA 4ERDA 3L7OA 3FC9A 2B9YA 4DR1F 1JLBB 3LTOA 1XK8A 4OYBA 1EB0A 1HNWF 4DPOA 2XNRA 2QLFB 2ASLA 5E3QA 2HHSA 1S1XA 1S1TA 3OVSA 1Z4UA 1H72C 2VFTA 2BOAA 1OWXA 2BEFA 4ECWA 2W7PA 2F8MA 3I32A 3JS9A 4A8KA 3LF0A 4O0NA 2XTJP 5I42A 2FYXA 4A46A 3Q8QB 1HBOB 4LRFA 1RWKB 1U1MA 4N5SA 5KFKA 1VJWA 3ZXWA 4QYZK 4ZVTB 2OUGA 5A2QY 4PQUB 3KHHA 1Q0NA 4J9OA 4LSLB 4GO5X 3CCJS 4O23A 4ZCLA 3TYTA 2QRRA 2XWXA 2R7UA 4FF2A 2GGPA 1QDUB 2FZKB 1DQ8A 4NLWA 2FC8A 3MD1A 2BJ9A 3TUIC 2UVVA 2WONA 3BSNA 2QFJA 3PW0A 4YB1P 3G6XA 3KLFA 4DV3J 1HQUB 1SQEA 2HGNA 4DR7J 1WHYA 3ZTPA 2K1RB 4Q2MA 2QLJB 4U96A 3Q83A 1VK8A 4U7UD 4PXCA 4QIVA 3FZBA 1NPPA 1SI9A 3QLHA 3BYRA 3R5CA 2KT2A 2G0IA 3GR1A 1RUSA 1Q82T 1XWLA 2YNHB 1NH7A 3TVZA 5H9FJ 4Q8FA 2UV8G 4LQ3A 4WU2A 4RW6A 3CJTA 2AJ1A 4HH1A 3O3LA 4FBUA 1HNVB 1V3SA 3MEEA 2EFVA 5IOLA 4WKYA 1SXLA 3M2VA 3V2UC 2MSSA 3OHAA 3GQCA 2IIHA 4CO3A 4C3KA 4CO2A 2OEKA 3C15B 1FXLA 3C19A 1ROFA 2N4CA 1S99A 5BYRA 3M32B 4CH7A 5I4MA 5DJBA 3ADAC 3DOMA 3T1AA 5KFOA 3DDIA 1YBAA 3MPYA 2KRRA 4FS1A 1ZZFA 1OMSA 3W62A 4Y2MA 2BANB 2UXCF 2UZAA 4ED5A 4HH0A 3Q2SC 4OX9J 2E1PA 2OELA 3MM6B 2JX2A 2FUG9 1S1UA 2YNIB 3KLHB 1VC5A 2YKMB 4F4KA 4QJVA 4Y2CA 3BGLA 4HHUA 1KLMB 3OL7A 2QGFB 1S6QA 1TKZB 3NGUA 5ITHA 2V5HG 1TKXA 1EX8A 2MY7A 1S4FA 3HF5A 1XNQJ 2CJXB 4I64A 4E2FB 2XYGB 1UKUA 3SXLA 3M8SA 4O44A 3V6DB 3OSNA 2K7JA 4FF3A 3J81Y 3ET6B 1X9SA 1WWHA 4PWUA 1EQMA 4IUFA 2BBEA 2K7KA 1Z1ZA 5GAGU 3HSDA 4EBDA 4ZPVR 2HK2A 3ZZYA 3QO9B 4F67A 4P2FA 1M0SA 2A10A 4H4KA 2HBZB 4QWDA 3CD5A 4U8YA 5HJXA 2GS8A 4ZA1A 5DQGA 5K9FA 3FQLA 4MYUA 3T1HJ 2NR0A 1Q8IA 2VFRA 2DHGA 4L75A 4PG4A 5L1KA 5AE3A 3HHDA 3HHLD 4G65A 4GO7X 3CCVS 3PW2A 3AJDA 4NLXA 3SCLE 4CLFA 5K8MA 3CJ3A 3NCQA 1REVA 5ETLA 2B9EA 1WC5A 5HVGA 3SV4A 2C3YA 3TANA 2DNZA 4DQIA 2CQ3A 3OW2R 3NY0A 2I5JA 3DCAA 4LF6F 4F7VA 3OJSA 4I56A 2MPUA 4IOAQ 3C66A 2LEAA 2N3LA 3IGVA 3CO9A 3CXCR 1PIEA 3QAUA 4AL7A 3LH2S 3CO0P 3HVWA 3UW1A 1FRMA 2E1CA 5J2NB 2J0WA 3Q8UA 4DSLA 2MLYA 3TEHB 2HBRB 3FQKA 2E7XA 1DLOA 1GNKA 3QRRA 3O8WA 1HI0P 1KD1T 1GX6A 3NBPB 1S7HA 4RPFA 1AZSA 3SI8A 4HTIA 3D3CJ 1RAEB 3JSBA 1VQ6S 2ASJA 2JLEA 3J7ZT 3NS7B 2DH8A 1O0PA 3M4XA 2AWZA 2KFYA 4R5PB 1CULA 2K3KA 4ED0A 1N0VC 2GQCA 2HFSA 4LF9F 5CH7B 4WKRA 4QZVB 1TQLA 5KFDA 2N7YA 5EX0A 3R97A 2CJAA 2JOQA 1LW2A 2Z4PA 3BB5A 3M6UA 3G9CA 3OFHA 3G6YA 5HMXA 1S9FA 4IKAA 2XS2A 1RAJA 1U6ZA 1ZYQA 1TK8A 1JKHB 4I2QA 3BSOA 1TU0B 2VC0A 3PYEA 3OUYA 2DCUB 3C46A 3BBBA 1WI8A 2MGZA 5CHCB 3RAXA 3R6LB 2DR6A 1WHXA 4NLYA 2AZ1A 3DOKA 5IXUA 1XNRJ 4ZP8A 8RUCA 2KT5A 5AJ3J 1FNMA 3NCPA 1IKVA 2DEIA 1HNZJ 3GLJA 1TMMA 3MR5A 4M63A 2CUYA 4G1QB 2OHDA 4IH6A 4NL5A 1OSDA 4HEA9 3MMAA 1SC1B 4NI2A 5F41A 3D28A 2OAUA 3C14B 4JI1J 2WSEC 2BE2A 1M1KT 2KKHA 1NK7A 1IR1A 2CPZA 2GMJA 2QFIA 3M6VA 4YMEA 3MM7B 2EFNA 3POTA 5B0FA 1S9EA 2QYGA 4P6QA 2W4PA 1JMTA 5KT4A 5SUHA 2HMIB 5IZHA 1RK8A 4LF1A 1HNXJ 1FDBA 2WOMA 2MKKA 1HW9A 2IMWP 3DNCA 1GAOA 4GVBA 3D3BJ 2VFSA 5IV3A 3IBFB 2P8IA 3BQ2A 3CJ2A 4DZDA 3MEGB 4B3RJ 1O51A 2E1RA 1D09B 3SFGA 3TRGA 3FRZA 3BKUA 3QWUA 2WVFA 4QR2A 4DI6A 4ZLJA 1EETA 3A1YG 5MLCV 2ROPA 1IKYB 2QA2A 1CJVB 2P9CA 1F5BA 2VA2A 2NPFA 1M5HA 4WXOA 4IG3B 1HARA 1U0SA 3CJKA 1RSCA 4J9LA 2OIHA 1NK0A 5HJYA 4WFBQ 2UUTA 1KBRA 5HQMA 4DR7F 1VQLS 1C1CB 1Q8KA 1UW9A 4Q43A 1WDDA 4TU9A 3EZ5A 2HEKA 4DFMA 3D5MA 3BS9A 3EVMA 2MKJA 1HBNA 4OLOA 5JVHQ 4JYAF 4ZLPA 1BD6A 2PMZD 3HHNB 3MURP 4ZCKA 1C1BB 2A2DA 4ED2A 2KB2A 5EWGA 1B64A 2D9PA 4C8LA 3R8YA 2P5VA 1M5SA 3PW4A 4DWIA 4WZMA 2EFQA 3M6WA 3V4IA 1KFSA 2ZH9A 3F41A 2OPSB 1FRLA 4JI0F 1ZM3A 1SBRA 3K5MA 1VLYA 2BMBA 3N9UC 4QOTA 4M5DB 1RT5B 3GYXB 3GFXA 4NLVA 4RKUC 4DV4J 4M5IA 1ZM4A 2CPJA 5GAHU 2GIFA 3IRXA 2BKNA 2WBRA 1WC3A 3KJVA 1SH2A 3T5JA 2XLIA 4MKAA 3UWTA 2J9DA 2VFUA 2QL5B 3GR0A 1FK9B 4DF4A 1RGVA 3PHTA 3FBCA 4OYZA 4Y2AA 2W8KA 1MW7A 2VJUA 4NA1A 5KG4A 5LMUJ 1VYAA 4X4VA 2VBYA 2KN4A 4OJHA 1QD1A 2FJDB 3CMQA 4QWAA 3DGPB 2IAJA 5CQGA 1ZTTA 2DPIA 2ZDOA 4B9LA 5C25B 5K8OA 2FY8A 4NLOA 1VRQC 1QTMA 2OD4A 4ED6A 1XTZA 2DXFA 1ZOTA 3B54A 4I1TA 3PXGa 2O5DA 3QFWA 2YPYA 4X4TA 1WOPA 4F36A 1MWZA 1TZ0A 2ZJRQ 3D6HB 3VAFA 4WXWA 1FXRA 4I0WA 4DFJA 3MMCA 2WW4A 3T9ZA 5CXTA 3BGRB 4DCJB 2X1FA 6AT1B 2IVMA 3HX9A 4UTGA 1U2RA 2V2VA 2LU1A 2IFXA 5CD4A 4MKVA 2C2KB 4MIWA 1OIAA 3DU6A 2YKQA 3HVTA 4LVOP 2CPDA 5C5JA 1HFEL 2ZH1A 4JI3J 3H90A 1Q78A 4PWDB 1D8ZA 3U1LA 2CJ9A 2DB1A 4PG5A 1LWEB 5F9LA 4FPIA 2UUAJ 1UAWA 4OZ3A 1TFYA 3N6LA 5C42B 5L8RC 1GT8A 2VG5B 2KTQA 4DLGA 3IM8A 3LW5C 1Q53A 1G1XA 3T19A 2BJ3A 5F8MA 2QSWA 2H48B 2J7WA 1ZPWX 1BWVA 5KFNA 2C2DA 1B4SA 4P74A 3M30B 5DRKA 1KHWA 4UOGA 2RQCA 5DDOC 1JLCA 2VQFJ 3UD5A 1ZA2B 1SC3B 2ZC3A 4QCLA 2BV3A 5HROB 2IRUA 2Y1RI 3G82B 1NO8A 1R3NA 4QIGA 2I38A 1RCXB 4FVMA 4EYIB 3ISNC 3J7YI 4DUZJ 2IA6A 5KT7A 2ACYA 4PYAA 2Q6CA 5EUHA 3UFCX 3ZO7A 3QATA 3D9BA 1HWLA 3SDEA 1JIHA 1ZTWA 2RHSB 4DQRA 4LF7J 3B78A 2KT3A 1EARA 4AL5A 1U24A 2NUHA 2DR8A 1VIXA 5L9NA 4HVZA 4ATNA 5KTQA 4PABA 2HFUA 3B4MA 4QQBA 4OYIA 3UVJB 3DXSX 2A3JA 4ZPAA 3J81U 3OVBA 2MTLA 5CYQA 4YB7A 4OYWA 4NE9C 5KG0A 2HVEA 4ZPTR 1YZ6A 3CCES 4WU3A 2R9LA 1QLNA 4ZVHA 2IJRA 2UXDF 2YWWA 5HVHA 1VRUA 1C0UB 1URNA 1ELOA 3HSZA 2MKYA 3VQTA 1HBOA 1CEZA 2DGUA 4OI1A 5L1IA 3L09A 1S72S 3D66A 1M5PC 4A4JA 1U0HB 3FEZA 4PQUA 1FRXA 3I4PA 5AJ3F 1A6LA 4LSLA 3BGFA 1O8BA 5ETMA 1T11A 2ZWOA 4RNMA 4IDKB 3RW7A 3VHQA 2UVRA 3MEKA 2BW7A 2PMWA 2MJNA 5KFTA 5KG6A 1RHQB 1SIWB 4RUCA 1LWCB 1HHQA 3FUYA 2QZ8A 3IN5A 4IOBA 4JI1F 2KYXA 1HQUA 2ALYB 2BRKA 3BO3A 1NPRA 4F3MA 4Q44A 2KRBA 5KFRA 1U02A 1K9MT 5HN0A 3KLGA 2VOOA 4JV5F 4WWSA 1ICEB 3D7SB 4WZQA 5E41A 4Y6IA 1SUQA 1Y5LB 3MDFA 2ZNYA 2M7SA 2COLA 4OYAA 1RT2B 2RS2A 2XSFA 4ECZA 3C16B 4L3NA 4B9MA 1RWOB 4NLUA 3BEGB 3DRSB 1SV5B 3X3UA 4UOCA 2Y3YA 1BUXA 3C15A 2M8DB 3M2RA 1F9HA 5B0AA 1N4LA 1BMQB 3M32A 1HHSA 2V0NA 5DG8A 3WC2A 1Y5NB 1HQEB 2L9WA 4CM0A 1KKHA 3ZTSA 1E6YB 2VDIA 2AX0A 2HG4A 1T95A 2XMUA 3SCKE 2AEJA 3QGIA 3AQPA 4B08A 2HHPA 2ZH7A 2BX6A 2WK4A 1UZDA 2R8JA 2Q79A 3CB4A 4GVLA 1ZAWA 4YY3J 4GKKF 3GIIA 3MEDB 3M1VA 1RBAA 1HR0F 3TZXA 3VWSA 4JV1A 3WIVA 3G71S 4WCEQ 3BH7B 3KLHA 2YKMA 3GYNA 1KFDA 2IYGA 1WTFA 1DTQA 2DGSA 4G6VB 1U45A 3BYPA 1VQ9S 2OPRB 2LLZA 1FKPB 1YRUA 4NZ0A 1DTTB 3PR4A 4ID5A 4PQAA 2B6AB 1YKWA 4CWBA 2X1AA 2HS4A 4F0HA 5ETTA 3KK3B 1Y10A 2QV6A 4MFBB 3V6DA 2K3IA 4J9KA 2FC9A 3ET6A 1GMVA 1TL3B 2FB0A 1SKSA 5A6PA 4ZOSA 3AA8A 1U8WA 1OS5A 2LVWA 4WP9A 4NEZA 4DV4F 2V8VA 2FVSA 3QO9A 3PW5A 4EWTA 4K7QA 1N5YB 2ALZA 1H2TZ 2Q66A 3CC4S 1A0OB 1D9DA 1H6KX 3KK1B 2YVSA 2WSCC 4FPRA 1VISA 1RA6A 3OTBA 3BO4A 3JYTB 4FDFA 2P2CB 2Y1IA 1T3NA 3L7PA 2Z2YB 4ETZA 2X1BA 3PZPA 1SJRA 1RAAB 1UPMB 4DR3J 4KHMA 3D4JA 2G2ZA 2RHQB 2Z30B 3NAIA 2FHJA 2VBWA 1V6HA 4PXBA 4NLSA 1N33J 4QW9A 4ZP7A 2CJBA 4OMFG 3HPOA 3UPFA 1NJYA 3PNIA 1NRKA 1IR0A 1AXQA 3T1YJ 1HD0A 5F3ZA 1WJ9A 2YKOA 2GQQA 1YRTA 5J2NA 2QG9B 5B0DA 1YJWS 3PRBA 4DR2F 2E5GA 4L74A 4FF1A 2XEXA 5K5MA 3Q86A 1I6JA 1M1GA 1VHFA 3IA0A 1KVJA 4KO0B 1SCJB 1RHKB 2DO4A 3IGNA 1HPZA 5KT5A 1I94J 1LV5A 1WDTA 4G1PA 2EG2A 1AB8A 5KFXA 4ZITA 1FWLA 2RH3A 4CYUB 4LMZA 5DDPC 4D3HA 2NLWA 2IM3A 5E3CA 4R5PA 3SQGB 2NYIA 1H2UX 4C0HA 5J1EB 3A3PB 4JI2J 3BKTA 4OFZA 3WX4A 5EWFA 3Q8YA 3CCSS 2CJQA 3A12A 2BZ2A 1PJ5A 1CG2A 4KC5A 1RWNB 3M8QB 4OJ3A 5I3PA 2LU2A 4KTQA 2L41A 2J8SA 4CLYA 3KMSA 3MAAB 1VBZA 3PX4A 2LP4A 4X64F 4DF8A 3BREA 5K8NA 1H2VZ 3PW7A 2AJ0A 2B9WA 2GW8A 1OJ4A 3KLIB 2YWKA 4CLSA 1VC0A 2I0XA 2KFZA 2BQRA 3UE2A 4UZCA 1Y5IB 1JKHA 1PYOB 3W8PA 3P96A 5ETRA 2VJVA 2X3DA 1PKUA 1FX4A 5FJ4A 1RAIB 4O3RA 3VAHA 2PGCA 1ZETA 1UVJA 2CYYA 1PBUA 2ZZMA 4YB5A 2V50A 1B70B 5IFMA 1FI4A 3MPVA 3QGHA 3GP9A 4ZPCA 2DNLA 3HP6A 1H7XA 2B4OA 1DQAA 2V2KA 1UWBB 4NCGA 3TJAA 2DRDA 3CCQS 1P9QC 2BQ3A 3C14A 3BPSP 4DQQA 3MD3A 1OYEA 5IS2A 2AW0A 3KJNB 2HZCA 1IBMF 2HZVA 3MM7A 1R43A 4ZIWA 5JUMA 3IBCB 1F5AA 2WBMA 2EFGA 2DTJA 2KH9A 4DCOB 1L3TA 3BZQA 1TL1B 3A3NB 4H4MA 4X4SA 2JC0A 3IG1B 2ZM6J 2NSBA 2HBQB 1VIOA 2W1BA 4DPUA 4C8NA 5HBMA 3D1HA 1NK9A 5L46A 1APSA 2BE9B 5CZVA 1WACA 3DI6B 3H4BA 2BOPA 1Q4RA 1NCLA 3MPWA 3MFHA 2QO3A 5H9EJ 1UFLA 4DSFA 5D4LA 2J6TA 3VAMA 4USJC 2V8GA 3CDEA 5HP1B 1PJ7A 2DT9A 2L48A 1IKYA 2XGPA 4O4RA 2HNZB 3LANA 3Q8VA 1FJGF 1CJVA 3PACA 1VLOA 2KG0A 5RUBA 4PXDA 3FCWA 4IG3A 1H38A 3BV8A 3OTCA 4EEYA 2R3VA 1TKTB 3NMAA 4X4PA 4M5JA 3FKBA 1DHMA 4BC9A 1C1CA 1T03B 2MKHA 4X66J 3G8QA 3KG4A 2J9EA 1U8SA 1T7PA 2KZZA 1U1PA 1XN9A 2CNOB 2EBGA 5J1NA 4B3TJ 4PZVA 4ANDA 4KHPJ 1WKKA 1NM2A 2A6MA 1EHWA 1Q8BA 1WG5A 1S7IA 3DM2B 1WEZA 2V4JA 3MR6A 3IM9A 3S01A 3UQSA 5F0UA 5H1SV 1MN7A 2B8PA 3A8IA 3BR8A 1S1XB 1U25A 4B3MJ 1S1TB 1HMVA 2A1BA 3CW2C 4OHZA 4RO0A 2B3TB 1TK0A 2YQ1A 2Q6BA 2LXIA 5E5NA 3S7RA 2HQ3A 3HK2A 3PIPQ 4C2MA 4M5DA 1RT5A 3NL0A 2AEMA 1EIYB 2BJ8A 5I42B 2CNKB 2VV5A 1DARA 2EW9A 3I0RA 4F0KA 4LFBF 1Y3JA 5DGAA 4YY3F 4H54A 4TLRA 1NK4A 7FDRA 2JDJA 4B9TA 3UDLA 5JXSA 3KG1A 1BQMB 5E3AA 3ZNJ1 3JSMB 2PI4A 2FLNA 3FMWA 1FE4A 4DJBA 4LREA 4PG8A 2RUSA 3DGPA 2KM8B 1XR6A 2NXJA 1HWKA 1FJ7A 2VODA 4AT1B 4DBQA 3FDSA 5CA5A 1NUEA 4DR4F 2IDEA 4RUHA 4IO1A 3THVA 4ZPWR 1RWWB 4JI7F 4PEOA 2HHTA 1D8YA 2DCLA 1L5UA 4F2SA 1X4GA 5DG9A 5HK4A 3MEEB 2MHNA 1BQNB 2AD9A 3M2VB 1WOOA 3W5YA 1X7VA 4WTYA 3N5BA 1RXOB 4RBTA 2R8KA 3E8OA 2VPZB 1RTJB 2W24A 1NK5A 4R0JA 3C6TA 4PR6A 3U7JA 4NCBA 3Q8RB 3BQ1A 2ZKTA 4G1IA 3RBXA 4QWCA 4BWJA 2AYMA 2VKRA 3DDNA 3IR5B 4ALZA 1GFWB 3A3OB 4DR3F 1SJFA 1GX5A 4LT6A 1C2PA 4QR1A 2KM8C 2VG5A 2EXUA 1EZZB 3K7RA 1RT7B 4WTOB 3LGHA 2AJQA 1N33F 5E33A 3RRGA 2HYIB 1S1UB 2DGTA 3I56S 5AXKA 5KFUA 4ES3A 2QL7B 3M30A 4N76A 2GAHC 3PIOQ 1HIYA 4L72B 3M9MB 1UPPA 2DIUA 5KFIA 4EK2A 2N7CA 3CIZA 5AXLA 4DEZA 1QSLA 3D2WA 2KFNA 2DR5A 2FLOA 2OMLA 1OYDA 1H0HB 3G82A 3NXZA 5C7PA 5T14A 3UD4P 3L95X 4ZMMA 2B5JB 4FNIA 4OHXA 2YPZA 1GK8A 4OZ2A 4ZP6A 4DU8A 3ENAA 2UU9F 1FJCA 2VU5A 3UDVA 3RR8A 4P10A 4C97A 3G8TA 2Z8QA 2J0XA 2XYHB 3GZ7A 1YI2S 1UEVA 1FFGB 3EGVA 1VQ4S 3T6JA 1Y7PA 4JI2F 2Y1JA 5E3PA 1EP4A 2R2UA 1DFDA 1YJVA 4K0KF 1J5OB 3KFWX 3R27A 2IBOA 2C2MB 1F2HA 3UVJA 3K5OA 3KJQB 3PKYA 3KHRA 4B17A 1REVB 3CCUS 1J2VA 1BWEA 1GXLA 2HFNA 1CBKA 2I5JB 3MPDA 4DR6J 2CRLA 1C0UA 4ED7A 3EMTA 3IFEA 4HACB 1TVRB 2W4CA 1CVJA 2W2NP 4LRBA 1LKZA 2VL1A 4QIFA 4QR0A 3MM5B 2R7RA 2RS8A 3CDWA 1HNIA 4I2PA 4TXSA 4CI0B 1W7WA 4QW8A 4FF4A 3RBZA 3TOQA 1MNEA 1F60B 4ZVUB 2DY9A 2JSXA 2DEJA 3R5GA 1Q16B 4H4KC 2DXEA 3TUJC 1JNZB 2LA6A 3AHPA 2W25A 3QJJA 4ZCIA 4L3KA 2HAFA 3W64A 4XPEA 1V3RA 3UCGA 1R0AA 1LWCA 4OHVA 4EMDA 2UUCF 2XI2A 5GAEI 1NSKL 2VFVA 3RJMB 4EFAC 1KN6A 4WIIA 2WVDA 3OD2A 4OI0A 3GWCA 5EHHA 4RNNA 3ZNUA 4NMLA 1CULB 4HI2A 2OEMA 1RHJB 3DXBA 1RBOB 2GMHA 2JFDA 2P6TA 4DR1J 2ZH2A 4DX8H 1ZZNA 3W9IA 1RT2A 1NJWA 1LW2B 5LMNF 1KC8T 3DRSA 4WJBA 3EXYA 3AQOA 1RAFB 1R8AA 3CT9A 4DPWA 3JXOA 3J7YU 1NJZA 2L9NA 2HVDA 2V4RA 2VICA 4KPYA 4P7TA 1IBKF 4DX7A 3I5AA 4R0EA 2CDRB 2AGPA 3BBCA 1ZA1B 5HI7A 2V94A 2B43A 3LWLA 1AUDA 4RW9A 4GKJJ 3DOKB 2APOA 4B9VA 1TUGB 4RUBA 1IJFB 5K20B 5DG7A 5D0HA 1IKVB 3IXQA 4J9MA 3PV8A 2IM1A 2B7CB 2XMJA 1RISA 2K8GA 2W9BB 2B4VA 3QSIA 2D3O1 4B3TF 2OPRA 1W26A 1FKPA 1JQGA 5LT5A 2BM1A 3RAMA 3DRRA 1FKAF 2BKOA 2RD5C 3ISND 5IT4A 5D78A 2VG7A 2B6AA 4ER8A 4N8NA 3GFZA 1XMOF 3TAPA 3POTB 2FTRA 1S9EB 3W60A 2YXLA 3AB2B 4CLZA 4B3MF 4OI6A 1FDNA 2BW2A 4RWWA 1TL3A 1KNZA 5CYJA 2EG1A 1O5JA 4RU2A 1JLGB 1X0PA 2WOMB 4KGVB 4J9UE 4NXMF 3CPWR 2NCKL 1FKOA 2VH7A 3SSQA 1X0FA 4DS5A 1SQGA 3CD7A 1N6QB 3JYTA 4URQU 1PAUB 4KGKA 1AA1B 4ED4A 3Q23A 5EN1A 4CLPA 3GJSB 2ZBRA 1L3KA 3MR7A 2UUBF 1IKWA 2Q3PA 2CXEA 3OXFA 3CJKB 1S1VB 4NMXA 4CRJA 2JEJA 3FSXA 2YNFB 1HLWA 3WIUA 1JLFB 4KH0B 1HA1A 4E98A 1SB6A 2HNDA 3I0SA 1YJUA 1D3WA 2DPJA 3TAQA 2PFDA 2VB6A 1F9FA 3J7AN 3HSGA 1UP1A 3W9HA 1P9YA 5KFLA 4I4BA 2A2CA 3T41A 3SIPB 1RCOB 4JB8B 1N5SA 5EGYA 3AD8C 2GVZB 4DR5F 3PFEA 3Q8SB 1HWJA 1KVIA 1X4DA 2QMWA 3TZWA 4KO0A 1K47A 3V4IB 4KR0B 1RI7A 2D7SA 3RB3A 2FVPA 3TJ9A 1QSYA 1K73T 2IDLA 1KQSR 4BDPA 2CQHA 4ICLB 2NYHA 4CYUA 3BF4A 3TQ1A 1RWPB 1XEZA 5DLGA 2XLJA 4C9DA 2O3DA 3ITHB 2HQIA 1U7LA 4WFNQ 4KFBB 1L3VA 3JQKA 3OV7A 4J9QA 1KEKA 1YIJS 2NREA 2MKCA 3ONQA 2W9CB 2ZZTA 2H51B 2HWTA 3NAHA 1CC7A 4QU7A 1DZ5A 2AYBA 3MXHP 4RR5A 5LJ5Y 2MQQA 2HNYA 1CJUB 4JI8F 4DZ6A 3T5KA 2POKA 1DY3A 2VC1A 4ELVA 4U95A 4LF6J 4WE1B 2IAJB 3U1MA 1GMWA 1M1HA 1N34J 1LFPA 1AUSL 2J0SD 1R0BG 2ZH3A 2W01A 1FF2A 4YEAA 4PG6A 4BLGA 4QPXA 1RTDB 2IMOA 2FGOA 3G8SA 4HT7A 3C8YA 3RW6A 1WOSA 3NRBA 1U2CA 4KQZA 1WG1A 4U67Q 2KXNB 2DGXA 1UEUA 3MMCB 2VF3A 1EKSA 5KG3A 3VGSA 2UVUA 1I3OB 2V69A 3O6QA 3T5HA 4OYPA 3H5XA 4RW8B 5KFPA 1B0PA 2ZHBA 5G0RB 2M3DA 2OD6A 1WEXA 3GV8B 4F2RA 2CADA 5LM7E 4ZVEA 4PUOA 3HKZD 5J2MA 3BN4A 4IFYA 4DSEA 3FFIA 5B09A 3NGKA 2PDAA 4LF9J 1GQEA 3DRPA 1TL1A 2LQ8A 3R2DJ 4DR6F 2MQNA 2C3UA 2AZ3A 1QSSA 3DLKB 4MT1A 1YBTA 1NPKA 2ZE2B 4X84A 2CA9A 4YR3A 4QWEA 1VDHA 1YVFA 2JWNA 2MZSA 1TUVA 1KLNA 2ZC4A 1C0TA 4EZ6A 3BBFA 1JLCB 1CPZA 2EFPA 2E5HA 3N5FA 4XIUA 3NMRA 2B9XA 2HNZA 2FZCB 2J9DE 4OIXA 2DIVA 1NDPA 2D1CA 3IAS9 4LR7A 4PKDB 4DLEA 2KVIA 3AXMA 5F0WA 5A0YA 2IY5B 1FEHA 3PX0A 5BYQA 4X2BA 4ID8A 5L1JA 1FHTA 3S8SA 2G9OA 4Q45A 5LSLA 4X4QA 3SDEB 1ZBTA 3UN2A 3NEKA 1ITPA 4PRFA 2Y9HA 1BC6A 3DRXA 2WB1D 3QJLA 1PC4A 3FBFA 3E51A 1M5VC 2F9JA 2DR7A 4C6AA 3DM2A 1DAXA 3MAQA 4TQRA 4UW2A 1EQ0A 1MU2A 3SYZA 5CYQB 4M1KA 2ROGA 3LAMA 3CCWA 1CC8A 4RUAA 2W2MP 1S6PA 4QIEA 2AYGA 1VRUB 4DU7A 2QE5A 4A8SA 3NGRA 1K1QA 1X31C 2GHWA 2DD8S 2IBKA 5A76A 3AJ1A 3PO4A 1Z2LA 4JBCA 1TL4A 5FLXU 3LP0B 4UUWA 1UFKA 4GKJF 3WQPA 3QT8A 3K5NA 4JV0A 1PAEX 3RRKA 3DDKA 4C8ZA 4FBTA 4USIA 1X4EA 1HD1A 5KFJA 1UVKA 4TYAA 1BQMA 2OO4A 1NXIA 3JSMA 4Y0FA 2XULA 3IS9A 2AJFE 3L7UA 4KE5A 1YITS 5U47A 1WTBA 2EK1A 3Q8PB 5AT1B 3ETOA 4TY8A 1UCNA 4P7VA 2G0CA 1NK8A 2R2TA 3HKWA 1FNOA 1N52B 2R2RA 5THWA 3DMJB 1VS3A 4KIAA 4X4UA 1N8RT 5B0GA 4U7CA 3KLGB 1L3UA 1KHVA 4UOFA 3ILJA 3RGIA 1U1QA 4A8XA 3RB6A 1U1OA 3G6ES 2ZFHA 2IM2A 2YX1A 1OO0B 4RWXA 4OJGA 1SUQB 4JYAJ 4L6V3 4E0DA 1RWUA 1SJQA 2HRUA 4ED1A 1OY6A 1FRJA 2MLXA 1SJ3P 2N4DA 2VIHA 1BQNA 2HFZA 3CCTA 1B7YB 2QA4S 1SL2A 3MCOA 1R31A 5A6WA 2AV5A 3M2RB 4JI0J 3GV5B 1RTJA 1W2IA 4ZPBA 1MROB 2WW8A 1Z2ZA 4J7CA 8ATCB 4OZJA 3E2EA 1GMWD 2LEBA 2HGLA 4F50A 1IBLF 2ZUGA 1Q86T 3GU0A 4ENOA 1D0EA 4U6PA 3HJVA 2WAQD 3EX7B 2OH2A 3FRYA 2W2QP 3M1VB 1RT7A 4ECYA 2DRAA 2H65B 1PJ6A 2FZGB 5HQ8A 3PY8A 3L3CA 3OR2A 3KHLA 2H3EB 1TAQA 5L38A 3OSPA 1DTQB 3CD0A 1HBMB 4MK9A 3QNWB 3MF5A 6FDRA 4ZP9A 1I1GA 4HDGA 4ID5B 1Q1KA 1D9FA 5KAKA 4KT0C 9ATCB 1KOOA 2B5JA 2F63A 5C2GA 1NKEA 3AAWB 2EWHA 3K0JA 1RKIA 3AB4B 5A8KA 4GMKA 3LWMA 4OZ1A 2HVIA 3CIMA 3PEJA 2AJ2A 1VMBA 1V5IB 2H1YA 1S12A 3PVXA 4NYZA 2PD1A 3PYFA 3OBIA 2B7BB 4O3OA 4PYDA 1J5OA 1VQOS 1R7IA 3N28A 4PCQA 2IJFA 1D9AA 2HIYA 2FY1A 2RUGA 2FD2A 2N82B 3PR5B 2SXLA 4K8RA 5L39A 3N01A 4NASA 5LOQA 1GTEA 3CEDA 3VR1A 4ES2A 1HKAA 3CF5Q 4DV5J 3OR1A 3H5UA 3D6FB 3A13A 3JTPA 4RW7A 4F0MA 4HACA 1TVRA 4ZJQA 1N34F 3VAIA 3FNNA 3MR3A 2ZBPA 1S10A 4QU6A 3TP2A 3MPUB 3MM5A 4DV1J 2AX1A 3QRQA 4NCAA 2V34A 2V2QA 4UQTA 2XMAA 2JJ4D 5E0OA 3N6MA 4CTAB 2CKWA 3I55S 3BSAA 3NGDA 4MIAA 5HATA 2AP6A 1JLQA 1HI8A 4ES1A 1PYTA 3FCHA 1UA1A 2GZOA 3ZZOA 4M95A 2HHHJ 3V6KA 3WHIA 4DSIA 2YTCA 1HPZB 3SBMA 2YWEA 5M2PA 2JEGA 4J9VA 4DV0F 2CQ4A 3M7VA 3OTEA 3PJXA 2BKPA 2HKEA 1ZAXA 2UUWA 3EM1A 4B9NA 1FWKA 2YKNB 2M88A 5F8JA 2DGWA 1GEHA 4C0BA 4NYOA 4QYZJ 4ZK7M 2MB0B 1RDRA 4Q0BA 1KTVA 4I67A 5ETQA 2I8EA 5KFFA 5M2RA 2OTLS 5DQIA 1NH8A 1JK9B 3MCNA 4F4ZA 2VUGA 1RT4A 1LFWA 4LFAF 1SL1A 2E7VA 3BN7A 1M5OC 3E01B 4PPDA 2UXDJ 3NNAA 2PI5A 4DPYA 1X9MA 1KQGB 3NS6A 1F0XA 4JOUA 2ZNZA 2YNGB 2HAIA 1T94A 1BQXA 3KUHA 2C1EB 2XBPA 2ABYA 2DGOA 3JAMU 1U6BA 2Z2LA 1KWMA 1IR2A 4HHJA 3UDEA 4K2XA 4K4SA 1REGX 1IM6A 1X4FA 3ICLA 3GG1A 2ASYA 1S5ZA 2IPOB 2CJKA 2C3MA 2EK6A 2ZOMA 1W25A 3UO0A 2FHKA 4OHYA 2W9BA 2V9KA 2KXHA 1RB0A 4Q5VA 3Q0AA 4NCGB 4KPCA 3H40A 2RQMA 2VBXA 5ETVA 2NQPA 1RT3A 2XHWA 2ZDPA 3RUBL 2MKSA 3CMAS 2DH9A 2AMCB 5DM6Q 4C8MA 4MK7A 2LDYA 4OZ0A 2K2PA 4DSJA 4JV5J 3SQOP 3HULA 5EX3A 2CPYA 3GJRB 3VALA 3PFOA 4DDFA 1T05B 3C6UB 4ED8A 2CPXA 4EBCA 2XY6A 2D74B 2KDOA 1JLGA 3GIRA 4HDHA 3CVKA 2JNJA 4H4MB 2HLTA 2DXDA 3W2VA 4ILLA 3M9OB 2N3OA 2HHQA 2AYEA 3CJ0A 5HBMB 1IWGA 3TJ8A 3KKFA 3W61A 2CFXA 2VKZG 3LA0A 2E7WA 1N6QA 3CDBA 3RYLA 4Z7YA 3MUTP 3G4SS 1MWYA 4A48A 4DV7J 1TTHB 4YR2A 4ZDNA 1BXNA 5CD4H 3SCIE 5GAEU 2IC3B 2XZWA 1OSCA 3NS5A 4DCPB 4FN5A 3W63A 1N5VA 4GKKJ 1KSPA 5BR8J 1HR0J 1S1VA 1WKJA 4NRTA 1TAUA 4WFZA 2YNFA 3DKDA 2BJEA 3EJMA 3CULA 3HSJA 1JLFA 4BBYA 2VG6A 4DHVA 1RWMB 2CNNB 2MXYA 3HFZB 5D3GA 1QE1B 4O3QA 1UVNA 2DO0A 3OFGA 2ZZNA 3RRHA 1PBAA 2OTJS 2QYCA 4W4MA 2GVZA 2HQCA 2B51A 3RG6A 2RDDA 1TP7A 2V4JB 2XMKA 4DL3A 1HMVB 3FVYA 2ROEA 3MTKA 2D9OA 5FDLB 3CJ5A 2YX4A 4RNOA 1LWXA 3HD2A 1YDLA 1YQHA 1ZM2A 3D6MB 3H2UB 2OFHX 1CJTB 4ICLA 3SSSA 4IQMA 4OZNA 1U49A 3ILLA 3HCXA 4OX7A 4YP3A 2XLKA 3ITHA 1B99A 1S0NA 2Z58B 3I0RB 3KK2A 4KFBA 1AT1B 5HQLA 2ZWPA 3EVOA 2CQBA 1LOUA 3PJWA 2F1FA 2W9CA 3H8YA 2ZJQQ 1BE4A 1Y4ZB 4R25A 2FHMA 2HRTA 1CJUA 3OTDA 4RJVA 2J6UA 2RRAA 4BC7A 1BY9A 3LQVA 1S48A 2XG8A 3MAHA 2C2EA 4N8OA 3NP5A 1K0VA 5BXIA 1FRKA 5I3UA 4WE1A 4N7TA 1F5CA 2RDIA 3OPKA 2ZHAA 2LCWA 4DL2A 2GAGC 4CT8A 5ETKA 1VBYA 3FEYB 5F3TA 1JJ4A 4I7FA 1DJ0A 4USKA 5H9FK 4AQYJ 4CZCA 2GMLA 3AJ2A 1RTDA 4MKYA 1Q5YA 3AY0A 2CPIA 3JQMA 3TX8A 2JC1A 1RAGB 3SSRA 1TUWA 2FVCA 1Y0HA 2CZ9A 4IOCQ 2V63A 3C3LA 1Y9OA 2D3ZA 4DR2J 3HDSA 3EZUA 3RZAA 4JV2A 4OYXA 3IBWA 3GFYA 3W3SA 1KDNA 1FVSA 3CCLS 1HHTP
chains in the Genus database with same CATH topology
3SCLE 1WF2A 5AXLA 1UW4A 2HLUA 3HI9A 4DMZA 3BR9A 4DEZA 5K8MA 4RW8A 5D77A 3CJ3A 1QSLA 3NCQA 1REVA 3D2WA 4ZS6A 4N47A 2KFNA 5G0RA 2DR5A 3RU0A 2MQLA 3LP1A 3I4HX 2FLOA 2OMLA 4GC6A 3DLGB 3C6TB 4C8KA 2CDQA 1H0HB 3SV4A 2C3YA 3CCZA 2RIJA 4DL0C 3TANA 5T14A 2DNZA 3UD4P 2GA7A 3L95X 4DQIA 2CQ3A 2IM0A 4ZMMA 2B5JB 4FNIA 4JI3F 2BRLA 1F2GA 4OHXA 2M0GB 3OW2R 2I5JA 2J7UA 3DCAA 2OPQA 5I3UB 1HW8A 3CUNA 4TY9A 4LF6F 1NZAA 1VQMS 4EUVA 1VGYA 5KFBA 4ZP6A 3OJSA 1YGYA 3FJ2A 4I56A 2R7WA 2UUAF 3I87A 3J80Y 2UU9F 2BM0A 2MPUA 1S1WA 5GADI 5FD1A 4DSKA 4IOAQ 2ZOFA 2Y0SD 4I7FB 4BCAA 3C66A 1FJCA 2LEAA 2OPPB 2RSQA 3RR8A 3VQSA 4DV5F 1Q7YT 4C97A 2DITA 1TFWA 2N3LA 3IGVA 3G8TA 3CO9A 2Z8QA 2J0XA 3GZ7A 5MAOA 3CXCR 1YI2S 2HWHA 3QAUA 4AL7A 1UEVA 2HFOA 3LH2S 3D1OA 5DGBA 1FT8A 3DLKA 3CC2S 3HVWA 3UW1A 2C28A 2QT7A 1VQ4S 1FRMA 2E1CA 3T6JA 5J2NB 1Y7PA 4JI2F 3GIJA 2Y1JA 4J9PA 5E3PA 5KFVA 2J0WA 3UCZP 1EP4A 2ZE2A 5IM0B 3UNGC 1VQNS 2R2UA 2RU9A 4IG0B 3MHYA 4DSLA 1DFDA 4TQSA 4DV1F 1YJVA 4K0KF 2IJNA 3IR7B 3V6JA 1J5OB 1MMLA 3FQKA 2E7XA 1SJ4P 4I68A 3KFWX 4PXEA 3R27A 1DLOA 1BLUA 1GNKA 2IBOA 2E29A 3O8WA 1HI0P 3KNGA 2VA2A 2RMLA 1KD1T 1GX6A 4AE5A 3NBPB 1JNRB 1S7HA 2RRBA 4YDXA 4F02A 3K5OA 2VQFF 1XERA 3SI8A 3PKYA 4HTIA 3KHRA 4B17A 2FLPA 2GX8A 1REVB 1FO1A 3CCUS 2HIQA 2UV8A 4DUYF 1SKRA 3FEXB 2P9GA 3QPIA 2DNYA 3FGVA 4CNYA 5C24B 3JSBA 3OL6A 1J2VA 3DYAA 1VQ6S 1BWEA 1BGXT 2ASJA 3K59A 4WK1A 1GXLA 1P1LA 2YWGA 3ZZRA 2DR9A 2HFNA 2B4UA 2JLEA 3PHEA 3J7ZT 1DURA 2BA9A 3LGNA 3TO8A 4NLXA 4A47A 2DH8A 4Y34A 3I96A 4I6WA 4LF8F 1O0PA 4RW4B 4WYWA 4BWMA 2I5JB 3M4XA 3OTOF 4K4UA 2CRLA 2AWZA 2KFYA 4HTJA 1C0UA 1HBUB 4X4RA 4ED7A 1IKXA 4R5PB 3IFEA 4DUZF 1TVRB 1FRIA 3QWPA 2K3KA 2W4CA 4ED0A 1CVJA 1HYSB 1N0VC 2GQCA 2HHHF 4DG1A 3LALA 2KYZA 4LF9F 1LKZA 4FS2A 2VL1A 4QIFA 5CH7B 4XAKA 5GMKa 1YJ9S 4QR0A 4NOHA 3MM5B 2R7RA 2VA3A 5E2QA 4WKRA 2RS8A 3CDWA 1HNIA 1E6VB 3GFHA 4G1QA 4QZVB 3V4MA 2M4MA 4I2PA 4TXSA 5K14A 4CI0B 1TQLA 1RT6A 4QW8A 5KFDA 4UQGA 4FF4A 4NYPA 2N7YA 1LQ9A 4IH5A 4P2SA 5F9NA 5EX0A 4LF7F 1M5KC 3TOQA 2CJAA 3T6BA 1MNEA 1WD6A 1LW2A 2JOQA 3D54A 2Z4PA 1F60B 3HHLA 2JSXA 4F3OA 1EP4B 3BB5A 3M6UA 3VZHA 3G9CA 1Q16B 4H4KC 3TUJC 3OFHA 3G6YA 5HO4A 1ZH5A 1JNZB 3E3XA 2LA6A 2ZVSA 3AHPA 2PE8A 5HMXA 2JEFA 4W90B 2HPUA 2W25A 1S9FA 3QJJA 4IKAA 2XS2A 3O2IA 4ZCIA 4XPEA 1RAJA 1U6ZA 3CD6S 1V3RA 3W7BA 1ZYQA 1TK8A 1JKHB 2NUUG 4MJKA 4ELTA 1UVIA 4I2QA 3BSOA 4DL5A 3UCGA 2FVQA 2VC0A 3BO2A 1IN0A 4XO0A 4ILMA 3OUYA 1LWCA 4FVCA 4OHVA 1R0AA 2DCUB 4FZVA 3C46A 2UUCF 3DYAB 3HHKA 3NNHA 2XI2A 1U4BA 5L1LA 5GAEI 2LKZA 2HMIA 2BDPA 2HHVA 3OXLA 1WI8A 3MOZA 2VFVA 2CQ0A 2MGZA 5CHCB 2BQUA 3RAXA 4EFAC 1KN6A 4TNOA 3NKYA 4WIIA 3VAJA 3UD3P 4OI0A 5B0CA 3BJYA 2AU0A 1WHXA 3GWCA 5EHHA 4NLYA 3SFUA 3MECA 5KT6A 2ILZA 3H2LA 2MJUA 3DOKA 5IXUA 2R2SA 4RNNA 4ZP8A 1XBWA 4J37A 4NMLA 2KT5A 4KHRA 1KQFB 1TR0A 2E5JA 4HI2A 1FJEB 2ZH6A 1FNMA 3NCPA 1SKWA 1IKVA 2F40A 5CYMA 2AJ4A 2XY7A 4R8UB 2XSJA 2R7OA 4HYKA 3DXBA 1FDAA 2U2FA 3JTNA 2CQ1A 3MR5A 2GMHA 2JFDA 3LP0A 4M63A 1HNIB 2P6TA 1Y3KA 4G1QB 3LO3A 4I2PB 4NPOA 5K14B 4IH6A 3MEGA 1RT6B 1NHUA 5A8RA 5KFAA 4NL5A 4LSNA 3M05A 2ZH2A 1VQPS 2YWFA 4DX8H 2RT3A 3OFEA 1OSDA 1ZZNA 3OFFA 1RQ0A 1RT2A 4HEA9 1NJWA 1LW2B 2J7KA 5F8HA 3MMAA 3HHLB 3D0GE 2EBEA 3VCDA 2OFGX 5LMNF 2JZ5A 3DOLA 1KC8T 5F41A 4WFAQ 2E5LF 3DRSA 3D28A 4WJBA 4Z2XA 2MZ1A 5KOXA 3EXYA 3ZZ0A 2OAUA 4DQSA 4YUDA 2WSEC 3AQOA 2L9DA 2BE2A 1WG4A 1X5OA 2P6SA 2VPXB 2LDIA 1M1KT 2D3UA 3NWGA 1X9WA 3IC1A 1R8AA 3CT9A 2KKHA 3I9V9 5DETA 2NZ4A 1NK7A 1TV6A 2WB4A 2YY3A 3K8WA 3MM9B 2CPZA 3MWBA 3J7YU 2GMJA 1NJZA 2L9NA 2KJWA 2L3MA 4KJIA 3M6VA 4RLEA 4YMEA 1LWFA 2EFNA 3MM7B 3POTA 3G86A 5B0FA 5KFQA 5KFSA 1S9EA 3M2UA 1VQKS 1R0AB 5T41A 2V4RA 4V19J 4KPYA 4P7TA 2LMIA 3CDAA 4YFUA 4P6QA 1IBKF 2W4PA 1JMTA 5KT4A 5SUHA 3I5AA 4R0EA 2HMIB 5IZHA 4ZCMA 3TA1A 2AGPA 4YQWA 4DL6A 1RK8A 1PC5A 5HI7A 1YJTA 3DMJA 2V94A 1FDBA 2KG1A 2B43A 3LWLA 1AUDA 5IT0A 5D8HB 2WOMA 1QJHA 2GFFA 3PRDA 1PSDA 3MECB 4LIRA 4KKOB 4RW9A 2MKKA 4M8LA 1HW9A 3DOKB 4OZ5A 4CIOA 2APOA 2HVHA 4B9VA 3QIPB 2E66A 2IMWP 3DNCA 1IJFB 1GAOA 3OL8A 5DG7A 1T8EA 3HO1A 3U27A 1IKVB 3IXQA 3ENWA 2VFSA 4J9MA 4QYRA 3DLHA 2XSJB 3PV8A 4HT5A 4RBUA 4B9UA 1URRA 2IM1A 1RT1A 1RP5A 3BQ2A 2MHEA 4O3PA 3CJ2A 2B7CB 3MEGB 1N36F 1O51A 5A8RB 2E1RA 2XMJA 1RISA 2K8GA 2FVRA 2W9BB 4ECVA 1C1BA 4F8RA 3SFGA 2B4VA 4C3LA 3ENQA 3TRGA 3FRZA 3QWUA 4B3TF 4QR2A 4X4OA 3MOJB 4Q7AA 2OPRA 4EO6A 1FKPA 5LT5A 1EETA 3A1YG 5MLCV 3FMBA 3W2WB 2ROPA 2J0QD 2BM1A 4CH0S 3RAMA 1IKYB 3DRRA 2OLWA 1FKAF 4OX8A 2QA2A 2RD5C 2FDNA 2XMWA 2P9CA 1F5BA 3HHLC 1S49A 2VG7A 2OPSA 2WHOA 3ISND 4RX6A 5D78A 2NPFA 5IT4A 2B6AA 3P5TL 1M5HA 1JX4A 4WXOA 4W92B 3THPA 1MROA 4N8NA 3GFZA 4IG3B 1HARA 3TAPA 1XMOF 3CJKA 1LWFB 3POTB 2FTRA 3HT3A 4DV7F 1S9EB 3M2UB 2ZD1A 4XPCA 4J9LA 2OIHA 1NK0A 4WFBQ 2LA4A 2UUTA 3AB2B 4B3MF 1CSJA 2BUNA 1FA0A 4OI6A 1FDNA 2BW2A 4RWWA 3EGWB 2J76E 4UY85 1TL3A 1KNZA 4NLGA 1NJXA 4DR7F 1VQLS 5CYJA 2EG1A 4MAKA 1C1CB 1O5JA 3F56A 3MM8B 4RU2A 3JTOA 2FJBB 1JLGB 3VAGA 2RU3A 1X0PA 3B82A 2WOMB 3CGIA 3M9NB 4RW9B 4OX6A 4Q43A 5BR8F 5GAGI 4C7QA 4TU9A 3EZ5A 4NXMF 4Y28C 2FJVA 3CPWR 4DFMA 1GTHA 3D5MA 3BS9A 2MKJA 1HBNA 2D41A 4OLOA 1FK9A 2QMXA 1AFIA 5JVHQ 4JYAF 1VC6A 1RT1B 5LL6d 4ZLPA 3LUYA 2GGPB 1FKOA 2VH7A 2JHEA 3SSQA 1UFWA 2YH0A 3N6NA 1BD6A 2JEIA 2GO9A 1H98A 2PMZD 1X0FA 3HHNB 4DS5A 3CD7A 1N6QB 1U6FA 3MURP 3TAMB 4ZCKA 1HBMA 4K59A 4ECQA 1C1BB 2A2DA 4URQU 3JYTA 4ED2A 2KB2A 5EWGA 2WONB 4NLTA 1B64A 2D9PA 3KMQA 1RYRA 4C8LA 4KGKA 2P5VA 1M5SA 3PW4A 2B56A 2ZHOA 2NPIA 3CSKA 4DWIA 2ILYA 4WZMA 2EFQA 5KFZA 4YDDB 1Q7LB 3M6WA 3GIKA 3Q23A 3DRRB 3V4IA 1KFSA 5EN1A 2BXJA 3KLFB 2R4FA 1Q8LA 2GHPA 2ZH9A 3F41A 2VG7B 2OPSB 1FRLA 3OJUA 1L3KA 4JI0F 2UUBF 4IQXA 1IKWA 2Q3PA 1UJ4A 1ZM3A 1SBRA 4KSEB 3K5MA 1VLYA 4TYBA 5C25A 2XMVA 2L08A 3NLCA 3N9UC 4QOTA 3OXFA 3DHXA 4B3SF 2F4VF 2C22A 1NHVA 4M5DB 3CJKB 1RT5B 3K57A 1S1VB 1K1SA 3GYXB 2CQIA 3GFXA 2M52A 4NLVA 4RKUC 2ZD1B 2UXBF 3HJFA 3QLHB 1VK3A 2KO1A 2O01C 5D4NA 2JEJA 4K4YA 1ZM4A 3FSXA 1N88A 2YNFB 4MK8A 2XCAA 3J7A1 5BJRA 2ERRA 2CPJA 5GAHU 4C8YA 5CCMA 1FESA 3IRXA 1JLFB 1HA1A 1UETA 2WBRA 4E98A 5D6GA 5KFMA 1SB6A 2HNDA 3I0SA 3KJVA 2OSRA 1YJUA 3RR7A 1D3WA 1SH2A 3T5JA 2DPJA 4RW6B 4CQ1A 2DNMA 3TAQA 3MCSA 2XLIA 2J9CA 4MKAA 2EPIA 4IRCA 3UWTA 1A7GE 4LVNP 2DJWA 1LXJA 1U2FA 2VB6A 1F9FA 2GCFA 5DLFA 3BGRA 2OMOA 1WF0A 5B7WA 1UP1A 2J9DA 2VFUA 4IR1A 3GR0A 5IT9Y 5KFLA 4ILRA 4K4ZA 5HL7Q 1FK9B 4I4BA 2A2CA 1JLAA 3HXMA 4DF4A 1R8BA 1RGVA 1QY7A 1FKOB 1N5SA 4Y2AA 4HLBA 4NX9A 4MTPA 4AUKA 5EGYA 5DQHA 3ZC4A 2W8KA 1MW7A 4H4OB 4MYTA 1VFJA 4JI4F 4DR5F 3PFEA 4NA1A 3Q8SB 4Q2LA 3TARA 1HWJA 5KG4A 4KV8B 1VBXA 5DO2A 2FPHX 2XNQA 3KG0A 3TR5A 1IM4A 1KVIA 4X4VA 2G13A 2VBYA 1X4DA 2KN4A 2XC9A 4OJHA 2BJDA 4PWDA 2QMWA 1NNDA 2FJDB 4QWAA 4KO0A 3ISZA 4AFFA 3V4IB 2MZRA 4KR0B 2IAJA 1RI7A 2D7SA 3RAQA 1Q79A 3RB3A 2FVPA 1QSYA 1LWEA 1K73T 4CH1A 4NZ7A 5CQGA 4EYHB 2DHXA 1ZTTA 1IKWB 1KQSR 2DPIA 2FLLA 2ZDOA 4N56A 1U1LA 4B9LA 5C25B 5K8OA 3MMBA 4KRWA 4BDPA 2CQHA 4NLOA 2NS1B 5EWEA 3OL9A 2YKAA 5C42A 4G3IA 1QTMA 4ICLB