5B08A

Polyketide cyclase oac from cannabis sativa
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
molecule tags Lyase
total genus 28
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b08A00
1ULRA 1TR0A 5B0AA 4ZA1A 1AFJA 2GCFA 4A4JA 4Y2MA 3BF4A 2QLWA 4Y2IA 2BJDA 3HHLC 2G9OA 3HDSA 3HFKA 3BDEA 1Q4RA 2HFOA 2OD4A 1FE4A 1TL4A 3WDOA 1CPZA 1P6TA 2KYZA 2JDJA 1OQ3A 2K1RB 2N7YA 2OKQA 3CJKA 3MZIA 1GXUA 1Q8LA 1XBWA 1KVJA 2XMVA 1SB6A 1Y0HA 2AP6A 1FESA 1X8DA 3UDCA 2VV5A 3BB5A 2RILA 2EW9A 2QYCA 3BGUA 3IWXA 4Y2KA 4NL5A 5F0UA 1FVSA 3VTIA 2HQIA 4OJ1A 2L3MA 2RSQA 3HHLA 4FNIA 4YDXA 4HL9A 2K7JA 1SQEA 2GO8A 2ZDOA 2FHMA 1X0PA 4OIXA 3KNGA 1WD6A 3FRYA 4OJHA 5B09A 1Y9OA 1CC7A 3E8OA 1MWYA 5B0CA 2OMOA 4Q2MA 4Q2LA 5IXUA 5T7LB 3HHLB 1OSDA 3LGNA 1KQKA 2LQBA 1TL5A 1TZ0A 4A47A 2BYCA 5B0BA 3KG1A 3HX9A 1JWWA 3BM7A 2HFNA 2XMKA 2XMMA 4NPOA 2VH7A 5K9FA 4DPOA 2QIFA 2ROGA 3IWLA 2ROPA 1LQ9A 1N5TA 2LQ9A 2OFGX 1IUJA 1AFIA 1TUVA 3CJKB 4DN9A 1N5VA 3DCAA 3LO3A 1APSA 2GV1A 2KT3A 3HHLD 2ASYA 3TRGA 2OD6A 4QOTA 2GFFA 1S6OA 2FB0A 2K2PA 2RU9A 1OQ6A 1K0VA 1YJTA 1VQSA 1P8GA 3KKFA 4EFAC 1FEEA 4A48A 3BR8A 1Q53A 3K7RA 1Q8BA 2PGCA 2IYGA 2IYIA 2OP5A 4U9RA 5T7LA 1W2IA 1S6UA 2OFHX 2XMUA 3LGMA 2KKHA 5KAKA 2GGPA 2CRLA 4OJ3A 2HLUA 2OAUA 1OPZA 3KG0A 1GXTA 3F44A 1N5QA 3HF5A 1YG0A 3QMQA 2W4CA 1QUPA 1N5SA 2IFXA 2FIUA 2QLXA 1V3ZA 2RMLA 3DXSX 1X7VA 1Y3KA 2BJEA 1JK9B 2N4DA 1CC8A 1FE0A 2BUNA 5A6WA 2AJ0A 1URRA 2PD1A 1AW0A 1YJRA 1MWZA 2GGPB 4A46A 2GA7A 2FTRA 3T9NA 2K1RA 1FD8A 3MCSA 1U7LA 4FNHA 1KVIA 2LXFA 5B08A 1R6YA 1Y3JA 4DL0C 5A6PA 1YJVA 2AJ1A 4HI2A 2N4CA 2XMWA 3GZ7A 3I9ZA 2Q3PA 5B0EA 3QGPA 4HH1A 4OJGA 5F0WA 2KT2A 2ZDPA 1FVQA 4HH0A 4F67A 2HIQA 2ROEA 3TOQA 2XMTA 5B0DA 2BBEA 5B0FA 5B0GA 1SI9A 3BN7A 1YJUA 2W4PA 4YEAA 4HI1A 1RJJA 2K7KA 3FGVA 2LDIA 2AW0A 2XMJA 3FMBA 4ZOSA 1VQYA 2ACYA 3TNVA 2W4DA 2HLTA 1YRXA
chains in the Genus database with same CATH superfamily
1ZM9A 3FEYB 2J0XA 2VFRA 4Q44A 2VKZG 2R7WA 2AYBA 1SC3B 2V5HG 1RTJB 4JYAJ 2XG8A 3LGHA 5J2NB 4ZMMA 2DRDA 5F0UA 2KM8B 2DT9A 1YJNS 4ED2A 3POTA 1X0PA 1WD6A 4DSIA 1U2RA 3CCUS 4JI8F 4B9VA 1XTZA 4NLSA 4KH0B 3BH7B 2XMMA 4F4KA 2ZVIA 5ADZA 1NK6A 2KH9A 4OYMA 2OIHA 5I4MA 2MZTA 4DCOB 1IQTA 2WW8A 5IM0B 5DLFA 2C42A 5HLFA 2YKAA 3A4TA 2L48A 5AXMA 4X4TA 4WP8A 2VFTA 3NXZA 1W7WA 4QJVA 4DL0C 1HA1A 5DJBA 4WYWA 1PYTA 4NCGA 1VRUA 4NWBA 4B3MJ 1U1LA 4DZ6A 3M32B 2GC8A 2NXUA 3RW6A 1AFJA 3RB6A 2U1AA 3HHLC 5JXSA 3RB3A 4LIRA 2ZWOA 1IVZA 2JX2A 4CO4A 3KLFA 1VQ5S 1LW0B 1MMNA 1SV5A 5IV3A 4DN0A 3IAM9 3HVRA 4OJHA 4I2QA 2AMCB 1TKZB 4K4UA 4JOUA 1F2HA 5A8WA 2BJ1A 1S0MA 2DNLA 3DOKA 1Z1ZA 3K0JA 3MEDB 1NRKA 4C8OA 3J81U 3R3TA 2ZH4A 1ZZFA 2HHQA 3V4MA 3OD2A 1PG5B 4JI0F 4JV2A 4YUDA 4DN9A 2AJ0A 1URRA 4B9SA 1EQ0A 2G0JA 2HQDA 2K3IA 4XDDA 1F0XA 2LQ5A 3IG1B 3LW5C 4F0MA 4E98A 2W24A 2OUGA 5F8MA 3LP2A 5J1EB 4B02A 1IBCB 4QW9A 1NK5A 1ZA2B 1XR5A 3ZTOA 3GONA 1SJ3P 2XEXA 3CDUA 2LA6A 2P8IA 2RHQB 1LFWA 2YXLA 1I5OB 4CLWA 2OPRA 2WSFC 4F02A 4N5SA 1BQMA 2FHMA 1F60B 3DLEA 1Y4ZB 4ZPBA 1TTHB 1TFYA 2ASDA 4RWWA 3GSIA 1MROA 1S0NA 2FLLA 9RUBA 3QIPA 2ERRA 1NB2A 4DX6A 2R7XA 4NEYA 3BSAA 5L1LA 4FVCA 1L3VA 4QCLA 1O8BA 4NXMF 2HBYB 1V9OA 2XSJA 1OJ4A 2Z30B 3W9JA 3PW7A 2ZH2A 2HLUA 3D2WA 4OI1A 2AEFA 3PX0A 1Y3KA 4WE1B 3PFOA 1UWBA 5IT9Y 3JSMA 4C6AA 3CDAA 3SIPB 3CMQA 1HI8A 3LP0B 2E66A 2XM3A 2AW0A 3ISND 4RW7A 2WOMB 4J9LA 4O3RA 5J1PA 4OHXA 2M5YA 1FTCA 2GVZB 1RHMB 1BHNA 3SDEA 3HULA 4YMEA 1YVFA 2FPHX 2VV5A 2WVBA 2FLOA 1VHIA 2ZNZA 3THPA 2PC6A 5BR8F 3KK2A 5HP1A 2CZ9A 3C6UB 4QIEA 4KV8B 4FKYA 4CM0A 3KJVA 2GMHA 3DRSA 4K4VA 3G6VA 4DLEA 4DX5A 2AGPA 2BX6A 1NDPA 1XQIA 2QL7B 4PAAA 4DPOA 4NMLA 4ETZA 1VRQC 4JV5F 3EPIA 4IG3A 1CJKB 3RZAA 1N36J 4KHMA 2BJ7A 4YDDB 1Q8BA 2B4VA 1IBKF 3OR2B 2WTFA 2F3JA 1NXIA 3L95X 2B4UA 4I67A 2DH9A 3HVAA 5C7PA 3FNNA 2WONA 2BRLA 1YJ9S 1X5OA 4WJBA 4PUOB 2EVZA 1JKHA 4O4GB 2C22A 4X65J 4K4YA 5KFOA 1WOSA 1Q16B 3MHYA 5I42A 2YKQA 5K8OA 2E1PA 4K5RA 2M9KA 2MZRA 5HL7Q 9ATCB 2RIJA 2OD4A 3CCZA 2MQMA 2KJVA 1HHQA 3A3NB 2F4VJ 1REGX 1WTFA 3KLEA 2XWXA 2XI3A 4DR4J 3F56A 3PM9A 4LREA 1NMEB 3PVXA 1EX8A 1QJHA 1JLBA 1OSDA 1QLNA 3UDEA 1GMVA 5KFNA 2VOOA 1D8YA 4M8LA 2VIHA 4TNOA 1LW2A 3OBIA 2DNZA 5KFCA 5CD4A 4WK1A 2Y0SD 5A76A 2CADA 2C3UA 1ZH5A 5L39A 3H5UA 3B8HA 4IDKA 3A12A 4CLFA 4DG1A 1HNWF 4GVBB 4Y00A 3WQPA 4OYOA 2I8EA 1Y3JA 2VG5A 5KTQA 1P1LA 5KFSA 1CULA 4J9PA 3OSNA 2C3MA 2PO4A 1Q8KA 2VPXB 4C98A 2UVUA 1VRTB 1XWLA 1S1TB 3A8JA 1Y0HA 4PXDA 5F8HA 2UXBJ 1AB8A 2AJFE 2ZH9A 3EZOA 3NGUA 3C46A 4ZPCA 1SKWA 2HS4A 3R27A 2BRKA 4OZ3A 4OMFG 3THTA 2BE2B 1JX4A 4TY9A 2RJZA 4WYLA 2GV1A 2CPJA 3HKZD 3I31A 3VQTA 2R2SA 1RK8A 2CPIA 4M5MA 3J7A1 2M8HA 1KONA 2XYGB 1H2VZ 4GRSA 4EO6A 5E3QA 3UCGA 1SKRA 2BM0A 2K1RA 2POKA 3K57A 3GLJA 1N6QB 3SMZA 4J90A 1FRHA 3MM9A 2HHUA 4DR6F 4C2MA 1Q5YA 1X9SA 1ZAXA 4X4OA 3NCQA 2BBEA 4UF4A 5BYQA 2R4FA 3GPAA 5AJ3J 3FMBA 2VC1A 5ITHA 4NCAA 1NSAA 5KFDA 3R5BA 2A2DA 4RNOA 1WTBA 2DY9A 4R0EA 4BS2A 4OZ0A 2OGUA 1KRPA 1RT6B 2KT5A 2B43A 3MFIA 4KY3A 1YZ6A 1MG7A 4Q2LA 3MAQA 3RW7A 4OZNA 1H7XA 4G3IA 3O3LA 3KLIB 3MM6B 4UOGA 6AT1B 4FXDA 4PXBA 1KLNA 2F8HA 1JJ4A 1DTQB 1A7GE 2DNPA 1V3RA 2KXNB 2D9OA 3AA9A 1VIOA 1M90T 3D1QA 5DGAA 4YB1P 3MURP 1IKXB 1B70B 1RACB 3Q83A 4WBFA 4ELUA 1FWKA 2ALYB 4RUCA 2FHJD 1KR4A 3T1AA 1B99A 2CPZA 2IRXA 2A3JA 3L3CA 8AT1B 1YK9A 4OL8A 2MLYA 1T9VA 4OI3A 3CJ3A 2XY7A 2PEHA 2NPIA 4FYDA 3LOUA 3L9ZA 2F40A 1N36F 2A2CA 2MHNA 5D0RA 4RNFA 3CCVS 3EJMA 3V81B 3DLGB 2YX4A 3SCIE 2C2MB 1WEZA 3QWUA 1T3NA 4CO0A 5B0CA 4P6QA 3OTEA 3TA1A 2NXNA 4JI2J 1S12A 4X65F 3PW5A 5G0RA 1KQGB 4QBUA 3HI9A 1FRLA 3M8WA 5K9FA 4RX6A 3ETMA 1JJHA 2X51A 2YPZA 2CIMA 1ZOTA 4F25A 1SVDA 3J80Y 1JLGB 3CCWA 2JHEA 2DR6A 2MQOA 4D3GA 2Q1LA 3HF5A 4QQBA 3PR5B 2VBXA 2W2QP 1BQNA 4ECZA 2M7SA 1FKOB 4S0MA 4DR4F 2BKPA 3NS6A 3S6EA 5KG5A 4HACB 2BXJA 1AYEA 3PY8A 5DG7A 2V2ZA 4OJGA 1MN7A 4KGKA 3ENQA 4YS2A 1HI0P 4L75A 3E51A 3I4HX 1PIEA 1W26A 1CSJA 1KWMA 5DZ6A 2W25A 4OV1A 1VQ8S 4U7CA 3D7SB 2VF3A 7FDRA 3TUIC 2AP6A 5B7WA 2DEJA 1M5KC 3KLHA 1M5PC 1JLFA 2E5HA 2W2OP 4DPWA 1FT8A 1P9YA 1HHSA 2IAJB 2BJ3A 5E3PA 5IC4B 1T8EA 2V4JA 3H2VE 4FBTA 4JI5F 1WHXA 2Z0GA 3DRRA 3CTRA 3LGMA 2HMIB 1O51A 4NLTA 3KG0A 5MLCV 1YG0A 5CCMA 3VF0B 1M5VC 3B78A 1XN9A 1RU2A 3KLVA 4N76A 1CJUA 3DM2A 1VQNS 2I0XA 4ZVFA 2RRAA 1XR6A 2W4DA 3BO2A 5IQQA 3TAPA 1K1SA 2HNZB 2VKRA 1S79A 3MD3A 3HDSA 1P9QC 3PYFA 2FUG9 5EDWA 1NKEA 3E01B 4URGA 2CKWA 2E7WA 1FDBA 3M1VA 1F5BA 2IM2A 1YTYA 3FRYA 1M1GA 4KKOB 1Q5VA 4EMDA 2ZITA 1DLOA 1HYSA 2EFQA 3MM8A 4CIOA 2KG1A 1XNQJ 2HK2A 3G2XA 1SJ4P 2VZ9A 1VBYA 4QOTA 4FF4A 3BR8A 3JB9k 1H3DA 3KDNA 2IC3A 3WBZA 2D3OR 5DS7A 5KT4A 5J2MB 2IJRA 1RHRB 1HWIA 4DV6J 3MCSA 1U7LA 4A8FA 3HT0A 3LANA 4WP3A 1H38A 2DKOB 1HBUB 2IVYA 1LOUA 2QLJB 1VC5A 2DXEA 2U2FA 2CAJA 3I0SA 3SSQA 2KHDA 3ITHB 2CQ1A 3OXFA 2ZJRQ 4NLDA 3I82A 3TQ1A 1S0VA 3LQVA 2WB4A 1Y00A 3PFEA 4YDXA 3UVJA 5U47A 2Z2LA 1PBAA 2F65A 4KJIA 3BGLA 4CO2A 3OT9A 1CJTB 3J81j 4DQSA 4ED0A 4K4ZA 4DUTA 3UQSA 2OFGX 1M1KT 3ISNC 2GFFA 3OUYA 1Q7YT 1JXVA 4C3MA 4YB7A 4B9MA 1N5QA 3IAS9 2G4BA 2BJEA 2HHPA 1TMJA 1F5CA 5KG7A 1MWZA 2UUWA 5FLXU 3IGVA 5D4OA 2AZ1A 2W2MP 3QGIA 3IMQJ 4ALZA 1N0UA 2UUBF 3CJTA 4UOHA 4J91A 2QV6A 3AOAA 1YJVA 3P6YC 5K5MA 4JI2F 1FCAA 4USWA 4WIQA 5D4PA 4NRUA 1TL3A 4U96A 4C97A 4CLLA 3GJSB 4Y65A 1TKDA 3TJ8A 5ETOA 4DFPA 5J2QB 3BN4A 2W2PP 3DOLB 3MMBA 2A1BA 2JDJA 4DPUA 4IQMA 3GILA 3BYPA 3QGHA 4M1KA 3RB4A 3JQMA 4RLEA 1T11A 3NGDA 2XWYA 4YB5A 2OTLS 2QN6B 1JWWA 2I6WA 4DFKA 2CPDA 4CYUB 4ZVOB 3CJ2A 2JEGA 1KSPA 1OSCA 3N6NA 3VAHA 4DR5J 3W64A 5FDLA 2R7SA 1W2IA 1UTAA 1VLYA 2E1AA 2DGWA 4DWIA 3H98A 3MR3A 1U6ZA 1N34J 1E6YB 2XHCA 2VICA 3CSKA 1UFWA 1J5OA 4ZLLA 3ICLA 4F04B 3CCQS 1H2TZ 5DG9A 4USIA 1RHUB 1RJJA 3QATA 4F4XA 3K5LA 1KKHA 3VGTA 3VZHA 5KG6A 1LWFA 2FHJA 5E5NA 4U6PA 1RT1A 3SQGB 3MUTP 1EAYC 3VALA 1WHYA 2V0NA 2MGZB 1SL2A 2Z8QA 2YNGB 2IMOA 1WC3A 1RT3A 3CDEA 4LFAF 1RDRA 1VC0A 5CYMB 3M2RA 4QZVB 1JMTA 3D6MB 4AXIA 1RWNB 4MKVA 4K0KJ 3EDQB 4ETXA 2ABYA 4P2XA 3NWRA 3SCJE 2ZOGA 3ENAA 3U02A 2Q6BA 2CJBA 1B7YB 3BGOP 1K8AT 3DXSX 1N5SA 1HQEB 1TK8A 2RUSA 3MR7A 5J2NA 2J7WA 4ZHRB 5KT5A 1CEZA 4RBUA 4DL7A 3ZO7A 2R7RA 2ZH6A 5D3GB 4JI7J 1XNQF 1EIYB 1UVIA 3KWMA 2SXLA 1WC5A 2LA4A 2M3DA 2VA2A 3RRGA 1SIWB 1LWCA 1T9WA 1WJ9A 2VPYB 1YLXA 3HPOA 5IM0A 2KVIA 1KTQA 1VQPS 4F7VA 5J1NA 4DV6F 3MPDA 4GC6A 2EFPA 2OELA 2LP4A 4IO1A 4MYUA 1FRIA 3FCHA 2V8DA 3MPWA 2WHOA 1M0SA 1G7CB 3QT8A 2OTJS 1GMUA 2HIYA 1ZM4A 3NS7B 4ANEA 1EETB 1QUPA 2HZVA 2XZDB 3L7PA 2N4DA 1FE0A 3GIIA 3IRWP 4A46A 3MMCA 1SJQA 4QYRA 4M94A 3MMAB 1CBKA 3OLBA 4M63A 1BMQB 5B08A 2AV5A 5CZXA 3VGSA 4F4WA 1S7HA 2DCLA 2XS2A 4TQSA 4RR5A 1ROFA 2DR8A 4M95A 1NHKL 3LWMA 3QBCA 4QU6A 1KN6A 4A8SA 3K5NA 2VU5A 1VBXA 1S1WA 2RUGA 2MZ1A 1W25A 1J5EJ 4PWDB 2L3MA 2ZM6J 4DSLA 1BC6A 1KHWA 3TEHB 4KGVB 4ECWA 4OYZA 3RAMA 1N0VC 2ZBIA 4ZVRB 5HK4A 2VQEJ 1G6BA 1BQXA 2FZCB 2DHGA 2NQPA 5IOLA 3IG1A 3OVSA 2NR0A 1RI7A 3DHWC 5JUMA 5DGBA 3D5MA 4ZVTB 1BWVA 5J1EA 2MJNA 3QT6A 1NHVA 3D28A 1R43A 4EI2A 2IFXA 4G1QB 2BUNA 2PD1A 3OFFA 4AL5A 5HLFB 1R8BA 4HDHA 3R5DA 2AJ1A 2CPYA 3AHPA 5KG1A 2JEJA 2D3ZA 2KM8C 2OPSA 4YR2A 2NCKL 3CIMA 2QLWA 4NA2A 1X4DA 4DR5F 3G6XA 1IBLJ 4RO0A 1Y5IB 4ZIVA 1UEVA 1O6XA 3AA8A 1BE4A 4TU7A 1N34F 2Y1JA 3BO4A 1SCJB 3KLFB 3KG4A 2AWZA 1K1QA 2V9KA 3DDNA 5E33A 4N56A 5IT0A 1T05B 4I2QB 4LSLB 4DR1F 3OPKA 3LP1A 3TP2A 3L7OA 2XS5A 4ANCA 4A8XA 5A8WB 3CJKB 3THVA 2QGFB 3TRGA 4PQUA 2F9JA 3I6PA 1VK8A 3BQ1A 1VQSA 2PGCA 1UJ5A 2WOMA 2DPJA 2R2TA 1R8PA 3OTOF 1OYDA 3KJFB 2DNGA 2GVZA 5ETMA 2IY5B 1X5SA 4X62J 4DL3A 3PW0A 2CVIA 4N41A 2XLKA 5A6PA 1FFWB 3C3LA 7FD1A 2AU0A 1P27B 4KV8A 2XS7A 3NRBA 2RQKA 1WI8A 5JJBA 4K0KF 3CJQA 3FBEA 2I5JA 1OWXA 4LSNA 4UUXA 2MDAA 3KK1B 2LU2A 2P9CA 4RU9A 3CO0P 2XZWA 1CJKA 4G6VB 4HEA9 2GW8A 5A2QY 2W7OA 1HFEL 4C8KA 1NB7A 3OR2A 4UY8T 2VONA 1S6PA 1WUUA 2G1HA 5B09A 2B9YA 1NK9A 2OMOA 3SSSA 1VK3A 1GT8A 4L76A 4U8VA 3SQOP 5E3CA 5AT1B 5L1JA 3DLEB 4PUOA 2HHVA 1FI4A 4ZP8A 3MM5A 3FK4A 4O4GA 2YPYA 2EPIA 3BO3A 4ZCMA 4UT4A 3QIPB 1O5JA 4MK9A 5H9FJ 3LUYA 1LK7A 3PEJA 2QA1A 2PI5A 1HL6A 5KFHA 1TKTA 2QLXA 4WFNQ 4YB6A 1FXRA 3US5A 4OHZA 3UN5A 5HQLA 4O0NA 3PJ9A 5A8KA 1FXLA 1REVB 2UUCJ 3D67A 2BABA 2EBEA 1HWJA 2X1BA 3T19A 3Q2TC 3CMAS 1A6LA 3RU0A 3BF4A 3VAJA 2AJQA 2GJFA 1F6TA 5ETQA 1N4LA 5T14A 2XCPA 3MR5A 2ZVSA 5AXLA 3SDEB 1NSQA 5H9EK 1U2FA 1LV5A 2V69A 1TVRB 5KFEA 3SZ2A 3MTKA 3NGSA 2FVSA 1YKWA 4IFVB 3KK2B 5AXNA 1U6FA 3KJVB 2DISA 3HXMA 4FPRA 3DRSB 2V4RA 2H51B 1UFKA 3DC2A 5HBMA 2OD6A 3NMRA 1OPIA 3G87A 3MTJA 3T3FA 4IOBA 4FZVA 3K59A 4DL6A 1HNXJ 4IG3B 2VQFJ 4PYAA 1AA1B 5DQGA 1MU2B 2KRBA 2W4CA 2RDJA 2AJ4A 2PMHA 1J5EF 1VRTA 4KGZB 3N6MA 1S1TA 3J7AN 4P73A 3GG0A 2GMJA 4DV0J 3FZ2A 4KGMA 4KHPJ 4ZCIA 4K2JA 1XEZA 2WONB 2D74B 1BGXT 2HQ3A 4DQIA 2IA0A 3B82A 2QX0A 3VAFA 3TVZA 4QR1A 2Y8WA 2E29A 3DDIA 2K7KA 1SQGA 5I42B 4HLBA 5K14B 2WZ1A 4NRTA 4C0OC 2BE2A 3OHBA 1R89A 3FC9A 1VR6A 2BV3A 2G13A 2FVCA 2Z4PA 3FEZA 4ZP7A 1KC8T 4QWCA 3UWTA 2GIRA 4HR2A 3MWBA 2O5DA 3R7BB 3CD5A 1RWWB 1S10A 1LEOA 2LLZA 1LWXA 2G2YA 1RADB 4LFCF 1JLBB 3KHLA 1RABB 4TXSA 4RW6A 3DXBA 3PCOB 3N6LA 4PKDB 3CJ4A 5KFFA 4QIFA 1LW2B 4ZLNA 4EGLA 5A8RA 2V94A 4FKXA 1UP1A 5F8IA 5GAGU 4O44B 1N8RT 2QMUB 4DV1J 4IDKB 4GVLA 2OEMA 1A9NB 4TN2A 4DG1B 3SEOA 4PG8A 2EC2A 2YBVA 4ES1A 4QPXA 2LXIA 8RUCA 3U27A 2B6AB 3BKTA 5C5JA 3KLIA 3MM6A 4QWEA 3EMTA 4K5SA 1DTQA 1OQ3A 3ETOA 4H4MA 2BQ3A 1FESA 2GJIA 3NEKA 5GAHU 1IKXA 4R5PB 1JXLA 2K7JA 1SQEA 2ZBRA 4O4RA 1V6HA 1D0EA 1BWEA 2JH3A 2HHHJ 1YHQS 5HMWA 3W3SA 4LRBA 2X1AA 4RWXA 3RBZA 4UY85 2MZSA 4NOHA 2QA2A 3UN3A 3K8WA 3TJ9A 1GMWD 1U1NA 3TAMB 4ECUA 3KMSA 1IQZA 2E9RX 3T9ZA 3EVOA 1UJ6A 2YY3A 5E3RA 1KDNA 4F2SA 4ELVA 4DV4F 5IT9U 4IH6A 2VG6B 2HPUA 1FNOA 1N5YB 1SQFA 3AB4B 3QGPA 4LF6J 1B0VA 3FKBA 1YRXA 1VQOS 1XMQF 2ZD1A 3FSYA 4Y2AA 4BC7A 3H0PA 4FYVB 3RAXA 3IBWA 4ANDA 3CCSS 1LXJA 2ZFHA 5DM7Q 5CCLA 2RILA 1JLGA 3I0RA 1HBMB 1SJFA 4DL5A 2L41A 2NUHA 2BKOA 3EGZA 2DXDA 2E7XA 1FKOA 3FBBA 4YQWA 1L3UA 3PR4A 4HACA 2HFNA 2UUCF 2PEBA 4PXCA 2YTCA 2ZBPA 4RZRA 1S48A 3SCKE 4OI0A 1FFGB 3OVAA 1S6UA 3QRQA 1Z2LA 4LVOP 1S9GA 2UUAJ 2YNIB 1PJ6A 2KTQA 1PAUB 3A13A 1UKUA 2K06A 1KOHA 5LMUJ 2Q79A 3I5AA 4LRAA 1Y5LB 2HIQA 1WKJA 2AKWB 3MGJA 1SI9A 3BN7A 3OW2R 3NGTA 4Q7AA 5LXRA 3GJRB 3W63A 2IAJA 3ULHA 2BA9A 1RWXB 1X4HA 1D9FA 2VQFF 2FHOB 2VJVA 1ITPA 3KMQA 1J2VA 2HMIA 1NK0A 4DV0F 3CCLS 4KHPF 2MKHA 4LFBF 1SPBP 5FD1A 3LALA 3DLJA 2NZCA 3EVMA 4ZK7M 3PRDA 1MNEA 3CC2S 4KBIA 1EKSA 4CLYA 2VHGA 2OP5A 1WDDA 2EK6A 2WSEC 1UA1A 4AYBD 1JLQA 2HNZA 2IBOA 2HHTA 3W2VA 4C8MA 2ASLA 1IR0A 4TY8A 5C25B 1QM9A 4DUZJ 2MPUA 1BQNB 3M4XA 1Q0NA 3GTYX 4DX8H 4UQTA 2BOPA 1RWMB 2L08A 3ILOA 2ROEA 4KKOA 2X3DA 1YBTA 2MB0B 2HHXA 3OVBA 2LFVA 4Q45A 4Z7CA 4IRKA 2OEJA 3CWJA 1Q86T 1HD1A 2GHPA 4EK2A 4EYIB 3Q24A 3QZ8A 2DNKA 3CDWA 2F8MA 4TQRA 4IQXA 3EICA 4PXEA 4DV1F 1MWYA 2BOAA 4CM2A 5EX3A 1TAQA 1O0PA 1D1UA 3RBEA 3W5ZA 1JLFB 3IWLA 1K44A 2MKSA 3ONQA 3DHXA 2QYGA 1RU1A 2CG4A 1HBUA 2IPOB 2V4JB 1FRKA 2OAUA 1OPZA 1T9TA 3DRPA 3H59A 5IFMA 2DY1A 4GKKJ 2JVOA 2LMIA 1T0TV 5D77A 1RAHB 3RR7A 4A8WA 5LSOA 3FMWA 1K73T 2DO4A 2CQCA 1K47A 3AJDA 4PCQA 2NUUG 3R2DJ 2FLNA 1CJUB 3TNVA 2KN4A 2EFOA 3ZFVA 1Y5NB 3ZNJ1 1DHMA 2R7VA 4Y2IA 4PPDA 1DY3A 1R0BG 3MF5A 2BACA 2GMLA 5HJXA 2MSSA 2BJ8A 2CYYA 3DLLQ 1RYRA 2G0IA 3M1VB 2VG7B 3T6BA 3CJRA 4X4RA 1S1VB 3JQKA 3BBFA 4QWAA 3EX7B 2ASJA 4NPOA 2H4WB 5KFLA 2ATCB 4HT5A 1RT7A 3MM8B 1MLAA 4ZVQB 2RE1A 2IYGA 1X4EA 5A0YA 2AEMA 2V67A 3DOLA 3N5BA 4DFMA 3DU6A 3IS9A 2MZJA 4RNMA 4ZPWR 2DEIA 2NS1B 2MJUA 2QLFB 2WW4A 4DEZA 2YX1A 3G71S 1XJWB 1WC4A 3B4DA 3PACA 2MTLA 4DPTA 3RYLA 2IHR1 1NK4A 4CYUA 2GX8A 2RRNA 3I0SB 2ALZA 5G4DA 5F3ZA 4QIWD 1BD6A 3B54A 1X4AA 3W8PA 4CP5A 2XMAA 4BDPA 1SJRA 2DH7A 1NBEB 2X7IA 3Q89A 3H40A 5DDOC 1FDAA 1OO0B 4ED7A 1NZAA 3UVJB 1U4BA 2R9LA 2M8DB 1RWOB 3GIKA 4YY3J 1QSSA 4NEZA 3R9LA 2AYGA 1EP4A 1Q8IA 2HAIA 1F9EB 1WSVA 1XK8A 1P8GA 3F0NA 1XERA 3J80U 4FF1A 3G6YA 1TL1B 3OUYB 1GXTA 1Q1KA 3MCNA 3TW0A 3NNCA 1KQFB 3OTDA 1H74A 4CT9A 3C6TB 3GCWP 1S49A 1IKYA 2UP1A 2MQQA 4MJKA 4J9MA 1S1UB 4OYAA 2CPEA 4XO0A 2YNGA 4ECQA 2MY8A 1PGZA 3FGVA 1BY9A 4I7FB 1ULRA 1YRUA 2V4QA 4E2FB 1H6KX 2QG9B 1TL3B 2XHWA 1RQ0A 5CAAA 1N48A 2KYZA 4LRDA 1ZA1B 1LK5A 3HD2A 1GX5A 4ZJQA 4A8QA 5IC6B 3MMBB 2HHSA 3QAEA 1IWAA 2NXJA 1U2CA 4A8MP 4NZ0A 4C3LA 1NPPA 5GAGI 1PSDA 3ZTRA 3OTBA 4FF2A 1DQ8A 1M5OC 3ZC4A 1ZS6A 1S59A 5HMZA 5D3GA 1VDHA 5LJ3Y 2B8QA 2MQLA 2CDQA 2QRRA 3VGVA 1RBLA 3GJTB 4KYZA 1V3ZA 4F4AA 4ED8A 2CZ4A 3CCRS 2C2DA 2ZJQQ 2XCAA 4P2MA 4Y3CA 4C9DA 4MKAA 4UW2A 4IFYB 5GAHI 3ZXWA 5DDPC 3AXMA 5LT5A 4CLTA 2I9SA 5EUHA 3BPSP 4USKA 4PRFA 1J5OB 3R2CJ 4P10A 3BZQA 2DYAA 2HLTA 1TR0A 3SV4A 5GADI 1VFJA 3TANA 5ETRA 4WFYA 2XTJP 2Y1RI 4IO9Q 3IR7B 3QFHA 2X1GA 1X5TA 2IRUA 1HPZA 4NYZA 2EW9A 3BGUA 2BKNA 1U48A 4ID5A 1NJIT 3DKDA 2XZTB 1U45A 4HL9A 1RT1B 3H5SA 3NKYA 3CCMS 2VOPA 3M8YA 2H48B 1RAGB 4A8OA 1EETA 1JLCB 2LXUA 1UVLA 3SFUA 4K4TA 1FXDA 2PA3A 1XNRJ 5KG2A 3BQ0A 1RT3B 2VBWA 4FF3A 2BE7D 2QT7A 4BC9A 3FUYA 4Q43A 3MDFA 1VQ6S 3M2RB 5C42A 4LBIA 3PNIA 3SFGA 2JLGA 1MW7A 4L3KA 4B9UA 3AB2B 2RMLA 2ZOMA 3IR5B 4ED6A 4JV5J 1U49A 4F3MA 3QJLA 1RTZA 1U1QA 1IBKJ 4PWDA 3HK2A 4NLOA 3F41A 2FZGB 1DQ9A 4DSJA 2RVJA 3WZ0A 1BLUA 3KXDA 1R0AB 4Y2MA 4J9VA 3BSOA 2AIRB 1M1HA 2RT3A 3KNAA 3V5RA 2ZE2B 2QMXA 4KO0B 2XMVA 4WKRA 2IBKA 1X4BA 1LWCB 2QJ3A 3U1NA 2AJ2A 3NOCA 5F8NA 1RT4A 4DHVA 4OIXA 1NO8A 3T1HJ 1EHWA 6FD1A 4G1QA 3Q2SC 3N01A 4MKBA 5K8MA 1VISA 3HZGA 3D4JA 3W65A 4C4WA 4DV2F 3E2EA 2K2PA 1H98A 3DFEA 2PI4A 3MCOA 3MD1A 3LPYA 2LCWA 2KG0A 4J9RA 4TYAA 1SC6A 4RUBA 4OYBA 1F9FA 1VBZA 1R6YA 3MMCB 5HQMA 3I9ZA 4CTAB 3TWZA 2E5JA 4NASA 1N33F 1NJWA 4YY3F 1HNWJ 2R8JA 1OIAA 2BANB 1T05A 1QAIA 7AT1B 2M52A 1WI6A 1RGVA 4LSLA 3N4WA 3GSDA 2KYXA 1H72C 2CDRB 3S7RA 3CJKA 4X4NA 4JV1A 1HBNB 2Y1IA 1NDCA 3WIUA 3L7UA 1U1OA 2B4PA 3SXLA 1S1WB 2G1DA 1R8AA 3E8OA 4TLRA 1GQEA 2XNQA 4RNNA 1NM2A 2L9NA 1B0PA 4ECSA 3R6GB 3VV2B 5I3QA 1LQ9A 2DGQA 2W8KA 4NZ6A 2VFVA 2ASYA 4U67Q 4PZVA 5SUHA 5KFUA 1Q82T 3UO0A 2UZAA 1SC4B 5LSRA 3WHIA 3UN2A 2CQPA 2DHXA 1C0UA 3GR0A 3KK1A 2CQBA 3EGWB 5CYQB 1FD8A 3DU5A 2N4CA 3BGFA 5T41A 2PSZA 5F0WA 2QFJA 2KZZA 3D3BJ 3WIVA 1NKCA 1WWHA 3QPIA 2OPSB 4N7TA 4DR6J 2ZC3A 4K2XA 4IR1A 3TUJC 4WP9A 3QIDA 2B7BB 1HR0J 4ZVPB 4CLKA 3QAUA 3KJQB 4CWBA 2VL1A 1S4EA 4W98A 2ZZNA 1E6VB 3DGPB 4DJBA 4KTQA 4IRCA 4WF9Q 2H4YB 2UVWA 3Q22A 3T5KA 3G8TA 1APSA 2Y3YA 4O3PA 1EARA 2LYVA 3LP1B 3PEHA 1UW9A 1REVA 4WTOB 1S99A 2XO6A 2HRTA 4ITSA 1RA7A 1JQGA 4PQUB 1UEKA 4IYQA 3UD3P 4B9NA 5IS2A 1QSYA 4NA3A 4LF1A 1OS5A 1RB0A 4URQU 1NZ8A 4ZVSB 4WCEQ 2WVFA 1HKAA 1RCXB 1TVRA 3SYZA 1XNRF 1EJ7L 3ELHA 4JBCA 5KFTA 4B3TJ 4IFVA 3BKFA 3RBXA 5B0AA 4HT7A 1RT5B 1GH8A 2JEIA 4C3KA 1CPZA 4O3QA 5KG3A 3SBMA 2DR9A 2W9BA 2I5JB 4ZPDA 4LSNB 5GAEU 2EFVA 1D8ZA 4M5IA 2GO8A 4XTTA 2O01C 4OLOA 1JJCB 1MU2A 1T3OA 4ILMA 4YOEA 2IMWP 1NNDA 1T95A 3M8QA 2O66A 2H9ZA 2RNEA 1S6PB 3A3PB 1QD1A 1M5HA 5FJ4A 4YP3A 1WKLA 3OSPA 2H5EA 3VAMA 4O3SA 5IWAJ 4C11B 2VASA 3PYEA 3MM5B 4PG7A 3UPFA 5DETA 4N47A 5EGYA 4NE9C 2E9ZA 4NX9A 2A10A 3C14A 5K14A 2R2RA 5A6WA 1HQ2A 4HHHA 4ED1A 1TKTB 2RQ4A 3T1HF 5K8PA 2HBQB 1YIJS 5KFQA 3H90A 3KOAA 1WELA 2VBYA 1MN9A 1N32F 3V6KA 4J9QA 2OI2A 2DGSA 2CWKA 4GKJJ 5EWEA 1WNEA 1NKBA 4K4WA 5A8KB 1S6QB 2BJ9A 2V8GA 1FRXA 3EZUA 5KFMA 2HFUA 3H4BA 2DGVA 3IWXA 1JB0C 4OJ1A 2RSQA 1XC9A 2E5IA 2BW2A 4ZIWA 4J9UE 2UV8G 5KFWA 5MAOA 4O44A 3G8SA 4CI0B 4LF5F 2J6UA 1H73A 2B7CB 2ACMA 3CVKA 3TX8A 1UA0A 5E7OB 5HBMB 4DFJA 2B6AA 1NSKL 4ER8A 1TAUA 4RUHA 2QTWA 2WCXA 4PEOA 4ZVGA 3AJ2A 3OL6A 1KVKA 1HNZJ 4GC7A 4JI5J 1ZPWX 2J7UA 3SCLE 4FN5A 2MY7A 2AT1B 3N9UC 4HI2A 3TUZC 4OZ2A 2HGNA 4R5PA 1TUGB 5B0DA 4QR0A 3HM9A 1UL3A 3CMES 1YWXA 4FS2A 4LT6A 4MAKA 4F0HA 4L3NA 4OX8A 2N3OA 1KFSA 4DX7A 1PKUA 3C16B 2QSWA 3HMJG 4LF7F 4LUBA 3BSCA 3TAMA 5F8GA 2FJXA 2V2KA 1VCTA 3IP0A 3PRBA 4ZP6A 4LF2A 1TL7B 3I9V9 3DYAA 4CO3A 3VAIA 2YKPA 2V6AA 2E7VA 2W7PA 2ZZMA 2WAQD 3GE9A 4R8UB 2VG6A 4C7QA 3IRXA 1YDLA 1N5YA 2CQIA 4FS1A 3VR1A 1HWUA 2B9EA 4RW6B 3QNWB 4CT8A 2H1YA 3S1TA 4M5NA 3GIRA 2B9XA 1HR0F 5A8RB 1IR2A 5CQGA 2UV8A 3D66A 3CDBA 3GFXA 3M9OB 5B0EA 1TFWA 4QR2A 3R7SB 1HBMA 2V2VA 2RU3A 4I68A 2XLIA 4OV6A 1KTVA 3GV5B 4B3OA 2CQDA 2J0QD 4C8LA 1CJVA 4H4MB 2HGMA 3FZBA 5A2QU 4OZ5A 3B6BA 2YNIA 4IUFA 1WDTA 1B64A 2HNDB 2YWKA 4X66F 3UDLA 3JAMY 5RUBA 3C19A 2W2NP 3D68A 2HURA 3KG1A 3CEDA 4K50A 4UZCA 1ZTWA 2NREA 3MEEA 2HQCA 3NS5A 4B3TF 2GZOA 3DI6B 4EWTA 1ZM2A 4PWUA 4Q0BB 1PCAA 2VB6A 3HSDA 2W01A 3BV8A 1WG5A 2HFZA 4XDCA 4V19X 3EXCX 4GMKA 3JSBA 4P2FA 3GWCA 2IJNA 2RDIA 4WTYA 4Y0FA 1SKSA 2ZUAA 5EWFA 2PFDA 3MOZA 3A1YG 2AYEA 5B0FA 3MR2A 2P2CB 2FJBB 4YR0A 1RT2B 2UUBJ 5IWAF 4KIAA 3PHEA 3HFKA 2FY1A 1XR7A 1TL4A 4WFZA 4NLRA 3M6WA 2RKIB 2ZD1B 1KVJA 4KGXB 3NY0A 4Y6IA 1S0OA 2UU9F 3CJ8A 4RW4B 3W61A 4I6YA 2DGTA 1AUDA 2FD2A 3R6LB 1QAYA 4O3OA 3I0RB 2IDEA 4DZDA 1XMOJ 1RWVB 1H7WA 3ZZZA 2MSTA 2OJ3A 5C25A 5E3AA 2ROPA 2GVDA 4GKJF 4X4VA 5KT2A 4KFBB 2FGCA 2PE8A 4C8NA 2MZQA 5AE1A 1WHVA 2PIIA 5DG8A 1SL0A 3U1MA 2CRLA 3AFGA 3AAWB 2DIUA 2MEWA 2YKMA 2E5LF 2IVMA 3PX4A 3Q0AA 1S9GB 3A8KA 4I2PB 3QO9B 2NXCA 4U95A 3KLGA 2NSCA 2RAQA 4HH0A 5KFBA 1FJGJ 3IBFB 3M30B 2CUYA 3PYDA 1PJ7A 4G1PA 3IFEA 2O3DA 2OSQA 4OQJA 3FVYA 1GTEA 4PG4A 3PO5A 1MMDA 1Q8LA 2KO1A 1NH7A 2LKZA 4XK8C 1TU0B 3LA0A 3BGRA 3UD4P 1FVSA 1ICEB 3D0IE 1EZZB 3BYRA 4ZITA 2FDNA 2R7TA 1HNZF 3FSXA 3FCWA 1RZMA 5LMNJ 2DGXA 2Z57B 3Q8QB 2GS8A 1RAOA 2BM1A 5M2PA 5D4NA 3PW4A 4FXVA 2RQCA 1U0SA 4MIWA 4JI4J 2EG2A 4LF8J 1S77D 2BMBA 2QZ8A 3FCVA 4JB8B 1RBOB 1FEEA 1WEYA 4LFAJ 5KFGA 2GHWA 5K8NA 4EZ9A 1DZ5A 4OLPA 1RLCL 1TUWA 2JZ5A 4DV3F 1JLQB 3W9IA 4TYBA 4XAKA 3PO4A 3W2VB 2QO3A 3T5HA 4TY8B 4BWMA 1YX2A 3HJVA 2VG7A 2HS0A 3GJQB 3W9HA 4HI1A 4MT1A 1S1VA 2CVEA 1X5PA 4YHHJ 1NDLA 1D9DA 2HNYB 3O5TB 2LEPA 2XQCA 1GXUA 3QSYB 2DR7A 2L9WA 2YWHA 4U7UK 1YQHA 3K5OA 2OMLA 1HWKA 1Q95G 3HHLA 2AEJA 3W2WA 2RS2A 2WVCA 2R7UA 4MK7A 1KFDA 3M6UA 4I1TA 4GO5X 3P96A 4ZPVR 3M8SA 1VBKA 5KFVA 2YQ3A 2V68A 1KNZA 5C24B 2RDDA 2R8GA 2DXFA 1N54B 3HP6A 3ZZOA 5DDRC 2WK4A 4HHUA 1RTIA 1H0HB 3JYTB 3K89A 3KUGA 3MAHA 1U25A 1V5IB 3DRPB 3NAIA 2VC0A 5GAEI 2AQ4A 2EKNA 2CPHA 2Q3PA 1ZZNA 1AROP 4NA1A 3A8EA 1Y10A 3VVUA 1YJUA 4JI3J 1SUQB 4WFBQ 4PR6A 1X0FA 4FXWA 3UW1A 2J9CA 2AHOB 2IJFA 3V2UC 1U1KA 2DVIA 1TL1A 2V8HA 2W1BA 3BQ2A 3EVWA 3M8RA 1U6BA 3C6TA 5LOQA 4ZJOA 2ZKUA 3WX4A 1S1UA 3ZZYA 2ZZTA 2R8IA 2HFVA 2FJVA 5E2QA 3V6HA 4ECXA 1RT7B 4I7FA 2JEFA 4I6AA 4FVMA 4RW8B 1X7VA 1VQ9S 5A0YB 3AQOA 3TYTA 3OJUA 2R8KA 3MCMA 2KI2A 2CJYB 3KDOA 3IS9B 2ZH8A 5EWGA 5M2RA 1XMOF 4AL7A 4C48A 3MAAA 2KFZA 2FJEB 2AYMA 4NXNF 2Q66A 1NPRA 4TLQA 3QRPA 4LMZA 1QTNB 2FJDB 3PIOQ 5E0OA 1B7FA 3T5LA 2UVVA 2HVIA 4EYHB 3L4BC 1FDNA 3HJFA 1T9UA 3IM9A 4DCJB 4BHQA 1RTDA 5IZHA 3FEXB 2FHKA 4IKAA 1I3OB 3M9NB 2B9WA 5DDQC 5J2PB 1JLAB 3ZZ0A 4IFYA 1FJGF 4USTA 3PV8A 3LO3A 2D3UA 3QRRA 3DRXA 3MMJA 2PA8D 5I3PA 4ERDA 1KLMA 2DPIA 4U9RA 4K7QA 3HCXA 1EP4B 3JTOA 3RGIA 4DR1J 4Q5VA 2VDHA 1ZBTA 5BXIA 5BJRA 4LVNP 2FTRA 3NNHA 4L73A 2ZH1A 2BQRA 3GMGA 5LMNF 1Q7LB 2XYPB 4B3SJ 1IKYB 2GNKA 3I32A 3OTOJ 4DF4A 2DNRA 1JLCA 4JI4F 4PPZA 2HWTA 1S5ZA 4ZOSA 4LF8F 4ZS6A 3MECB 5D4LA 2CQ3A 1ELOA 1R8HA 4AXJA 3ZZRA 4DF8A 3CC4S 4I0WA 3M2UA 4OHVA 3CIZA 2F1FA 2AD9A 2HW3A 2B0GA 1FDDA 4F4YA 1VS3A 1WOPA 3T5JA 1N5VA 4GO7X 2J6SA 4YHHF 4J9SA 5GVQA 2QMWA 2IM1A 1DARA 2C1EB 4X4QA 1R0AA 4A8YA 3KUHA 1HLWA 4ZVEA 3TQEA 1R6VA 2EFNA 5F9LA 2ZE2A 4P52A 4KO0A 3PW2A 3G86A 3UE2A 4WWSA 1IJEB 2VPWB 4ZPTR 4KR0B 3ZTQA 1C4CA 1FK9A 1RCOB 2W4PA 1GTHA 2C3YA 4ZA1A 1U8WA 4X84A 2MYFA 3O2IA 4LIWA 5L46A 3PG9A 2GQ2A 3RJMB 3R7NB 2YKNA 1RWPB 3MXHP 1ZYQA 1HPZB 1Y9OA 4ID5B 4OYXA 1SBRA 5GMKa 1TZ0A 1I94J 3HVWA 4Q8FA 5SZTA 2HWIA 3BKUA 1HMVB 2BZ2A 4JI3F 4CTAA 1TK0A 3JXOA 4ZN1A 5GMDA 5LL6d 2HQGA 1DBDA 2BANA 5C42B 3QT7A 1R0CB 4EEYA 1RBAA 4CLZA 4LF9F 1H2UX 2DO0A 1UAWA 3D6TB 3W1YC 2KZMA 4H4KA 2YNFB 1TV6A 2M88A 1JLEA 1HBNA 1RXOB 1U24A 1C4AA 4DLGA 4JYAF 3LPEA 1FVQA 3GYGA 1R3NA 1CQMA 3CNQP 2ZHBA 4CH7A 2XO7A 3Q23A 3JS9A 3NAHA 2J7KA 2DHSA 2N7CA 1VQ7S 2CQGA 2KFNA 1GK8A 2YNHB 3W60A 2FYXA 4RPFA 3PJXA 4OYIA 3NOGA 2VUGA 3NCPA 2GAGC 1HHTP 1RT4B 3LGNA 1TMMA 1UZHA 3O8WA 5CYQA 5B0BA 4LQ3A 1C1BB 1WEXA 1DJ0A 2YWGA 3Q86A 1UVMA 3TZYA 2G2ZA 4A48A 1V5VA 2AX0A 4AFFA 4LRCA 4QU7A 4LFCJ 4M5DA 3OHAA 2V9WA 4UUWA 1T03A 2FIUA 4B3MF 5KOXA 3GV7B 2DNNA 2UXDJ 1N88A 1T02A 2F8EX 3UNGC 2BVZA 3LWLA 2VA3A 1E6VA 3DGPA 2J0SD 3LF0A 3D1OA 4KAIA 3CXCR 1HW8A 4X64J 2OEKA 2XNRA 3JTPA 2WBRA 1WHWA 3GB0A 3DMJA 5L9NA 3GV8B 4RKUC 5HI7A 3CCES 2B5JB 1I51B 4AD6A 3MZIA 4ZCKA 2XY6A 1U1MA 3MEGA 2V8VA 3BH6B 4EZ6A 1IKVB 3CGIA 1SXLA 4DQPA 4X2BA 2W9CB 3MEKA 3AJ1A 4XIUA 1F1BB 3VAKA 2V63A 3OXGA 3W66A 2MXYA 2HVZA 3HLUA 4B3SF 2PFFB 5HVFA 4DU7A 1PC5A 2DK2A 3IC1A 2ILYA 4EFAC 2CZVC 3DLKA 3MPVA 1ZAVA 3H5XA 1RT5A 3DDKA 3KYLA 2GA7A 1V3SA 1Z4UA 4ZN3A 2LXFA 5AXKA 1C0UB 5L38A 4B17A 1SH3A 4H4KC 2CNLB 4TU9A 3RG6A 3IR6B 4EBDA 5KT7A 2DHHA 3M8PB 3QGGA 4HTJA 4DV4J 3OFGA 1Q4RA 2HFOA 3EGNA 3J7YU 2KXHA 1X31C 4ES3A 4C11A 3PHTA 3HSGA 1ZAWA 1XMQJ 4I6WA 2RD5C 4WK3A 1S97A 1VYAA 2R7OA 3MM7A 2XBPA 1RAJA 3OR1B 5CXTA 5L1KA 1C0TB 2RF2A 3BPDA 1DTTB 5IT4A 4EBCA 2C3OA 3QQCD 1VC6A 2IYIA 1FERA 1GEHA 4LRFA 3D0GE 1YBAA 4C8ZA 1S6QA 2K3KA 2Q6CA 2JSXA 2HSEB 4MFBA 2P5VA 3LH2S 4FBUA 3S01A 2MLZA 3HHDA 5EX0A 3TEGA 3QWPA 1S72S 2CJKA 3G82B 1FKAF 5E41A 3OL8A 3Q8UA 3H8YA 2DIVA 1CLFA 4G65A 1I94F 1Q78A 2JJ4D 4LSZB 3U7JA 4F0KA 5HATA 2GQCA 4QPTA 3QSIA 5KG4A 1HNIA 4OX7A 3RR8A 1FE4A 4OFZA 1S57A 3AY0A 1F9HA 1WF0A 4ED3A 2W9BB 2R7QA 2K8GA 2JOQA 3VQSA 1FNXH 3QT5A 3ZNUA 4KRWA 3W5XA 2DHAA 3W7BA 4G1IA 2VD3A 2LQJA 3PDNA 4O3NA 2E1RA 3M8QB 4WPAA 5HN0A 4KC5A 4RW9A 4BLGA 3ZZPA 4USMA 4LFBJ 1I6JA 1MWQA 3PTWA 4H4OB 4OYPA 3C15A 3N79A 2NLWA 2ZBQA 1C1CB 4ES2A 1YZ7A 5H9FK 3C16A 4J37A 3C14B 2QLBB 3IN5A 4DU8A 3H42A 1LFPA 1OYEA 3EE3A 4P74A 2XULA 4DCPB 1VGYA 2CJXB 3CPWR 2CQ0A 1WACA 1TL7A 2F4VF 3QYYA 2H65B 4OZ1A 1FEHA 1L5UA 1FO1A 3UI3A 1F3FA 1IR1A 4R8UA 1S7IA 2L9DA 1PJ5A 2J76E 3I5BA 1M5SA 4KT0C 4FNIA 3GP9A 2MKIA 4USJC 1VI7A 1PC4A 3C2PA 2UXDF 2EKYA 2CWXA 2J6TA 5HROB 4CLSA 2CPFA 2DB1A 2QSFA 3SSRA 2V34A 2XSFA 4IG0B 2E44A 3HX9A 2GJ2A 2R8HA 3AXKA 4X64F 3UCZP 4HKQA 2HVEA 3MUMP 4HDGA 4OI6A 4X4UA 5T7LA 4OX9J 2GGPA 4QW8A 5D78A 1RISA 5KFXA 2J0WA 3ADAC 3NMAA 2NYHA 1HWLA 1FKPB 1U26A 1YRTA 2C2RA 1YBUA 4DSKA 4LBHA 1G3OA 2XLJA 4C0HA 2D41A 4EU0A 2HNDA 4QWBA 3CUNA 3ET6B 2UXBF 2YH1A 4UTGA 2CNNB 4WFXA 1X4FA 3V6DB 1AZSB 3DI6A 4HVZA 3IA0A 4RBVA 1UETA 4ED4A 2KXFA 4XPCA 3HHNB 3ZZTA 1F5AA 3ZTPA 1XMBA 4Q0BA 1W2BR 4QYZJ 3M2VA 1B0TA 3EUNA 3BM7A 3DYAB 1HQUB 5KFKA 4PABA 2OPPA 2ZC4A 3DCAA 1S6OA 1L3KA 3IRXB 1IM4A 4NI2B 1IXKA 2UXCJ 1RT2A 5KG0A 4O0IA 5KFPA 2HBRB 4DXLA 1UZDA 4OZJA 5AJ3F 2RKIA 1SIZA 4URSA 2J9EA 4RW4A 3TVYA 1HW9A 2QC3A 5CYJA 4NLGA 3DOMB 3FDSA 4ZJLA 1NK8A 4R0JA 2CG8A 1VQYA 4CH1A 4DI6A 5KFIA 2EBGA 4Z7YA 4DL4A 3IM8A 3ZTSA 3GQCA 4DS4A 1U8SA 4B3OB 4KFBA 3NP5A 5HAOA 3VTIA 4RNHA 1WOOA 4F8RA 2ADCA 5HMYA 4BWJA 3IWNC 1CJVB 1NPKA 4W90B 2A6MA 4PG5A 3TZZA 3K17A 5KFYA 4I2PA 4MIAA 3UR3C 3QO9A 1U47A 2ZH7A 4P75A 1S1XA 1TQLA 3BR9A 5JMNA 1OQ6A 3MEEB 3M30A 1RTHB 2B56A 1JJ2R 2D3O1 5F8JA 4ZCLA 4KE5A 4L74A 4TVAB 2DITA 5I3UB 5D15A 4AL6A 1X4GA 3HT3A 4ZDNA 2OPQA 2HKEA 4QYZK 2V50A 4USUA 4MTPA 1WC6A 4F26A 3AD9C 2CA9A 4F67A 1I1GA 3TX0A 5CZVA 4ECTA 2LEBA 2RB7A 5HJYA 4WZQA 4ZLJA 1DQAA 1TELA 2V2QA 4Y2CA 1K9MT 1VLOA 3TA0A 1UVJA 1CQNA 4OZLA 3AD7C 1NEEA 1FX2A 3UDCA 4J5OA 4NL5A 3K58A 3HKWA 1QE1B 2ADBA 5HVHA 4NZ7A 4F3QA 3HVTB 2YH0A 1TL5A 3KFWX 3UDVA 3HFVA 2KJWA 5D0EA 3OFEA 3TARA 1OY8A 2WRMA 1S9FA 1U0HA 3J81Y 4DR7J 1U02A 4KPCA 2GVDB 3PKYA 2W7AA 4YN3B 3K5MA 3V4IA 3KUEA 1HBOA 2HNYA 1HNVB 2OO4A 1WF2A 3HHEA 4LF4J 2YKMB 1UMJA 2A18A 1U1RA 2ZEJA 3BREA 3MR6A 3OTCA 2XMWA 4KB7A 1VQLS 3RAQA 4IOAQ 2HVDA 1YJ7A 2V8PA 3RB0A 3KLGB 1ZM3A 1RWUA 3EXYA 5DQIA 2M4MA 4PG6A 2RQMA 4ATNA 3R5AA 2QA4G 2LVWA 4JP8A 3D3CJ 3BDEA 1JNRB 5CHCB 3P45B 1LNQA 2IIHA 4WIIA 4OX9F 3JSYA 1SB6A 5C24A 5KFAA 1MMLA 3FFIB 2B8PA 4J9OA 3CCTA 3VAGA 3KJNB 5K20B 1IKWA 2O1PA 2OHDA 3BGRB 4C8YA 1FNMA 2YWEA 3BBCA 3JYTA 4ICLA 4K4XA 4CLUA 2ATLA 4TU8A 2ZHAA 1UJ4A 3H5YA 2HHWA 3CCJS 2X1FA 3D1HA 1S9EA 2Z2YB 2FB0A 2JC0A 1YJTA 2H5JB 3CC7S 2F4FA 5ETKA 2HRUA 4AUKA 4MIBA 3NBPB 1SUQA 1IN0A 3KHHA 1TKXB 2F63A 1RP5A 3J7YI 2DNHA 4DDFA 2LEAA 1N56A 2JL9A 4K59A 2A6OA 4UOCA 4BCAA 2UUTA 5B0GA 3O1LA 2IDLA 2JWNA 4YEAA 3NLCA 3CF5Q 3KTQA 1RTJA 4FDFA 1KEKA 2Y8YA 3RRHA 1MSWD 1EB0A 2R2UA 2I2YA 4UZBA 3GFHA 3QZ7A 5AE3A 2UXCF 2GIFA 1T9YA 1CS4B 3NGKA 4W92B 4M5KA 4CRJA 5C2GA 2B4OA 3FRZA 3H4DA 2MKCA 1VQKS 4RW8A 4ECRA 3HHLB 3DNCA 2CQ2A 3MPUB 5D0GA 3W2WB 3RTVA 2ZOFA 3JAMU 2QIFA 2HRYA 3Q8PB 4I4BA 3ZZUA 1LKZA 2Z2ZA 2KHCA 2DGOA 4P72A 1ZTTA 4ENOA 1FF2A 2FZKB 3ENWA 1FA0A 4QIVA 1OY6A 1QDUB 3P8BB 1PO6A 1UEUA 1S4FA 3KK3B 4MYTA 4DV2J 3FSIA 4DL2A 3T6JA 3DN9A 3O44A 3ILJA 1KVIA 1TK5A 1RTIB 3OLAA 3GR1A 5F3TA 2VBZA 2HZCA 3L09A 2E1CA 3M32A 1R27B 2Z56B 4WXOA 1VOMA 1N52B 4M5LA 2PDAA 3T1YJ 1RHKB 4PQAA 4A4JA 5J2PA 2XYHB 1JLAA 1LW0A 1Y7PA 2G9OA 4NCBA 1P6TA 4OI4A 5KFJA 1N33J 2DNOA 2LQ8A 5ETTA 1LWEB 1QAJA 2JC1A 4L72B 1TKZA 3M8ZA 2W9AA 1FJEB 3D6HB 3EPGA 3QLHB 3ENVA 2Y0BB 3MEDA 2ZUGA 1HARA 3PYGA 4CCHA 2KB2A 2RRBA 4USHA 1LXNA 5HO4A 3TAQA 2J9DA 1WG4A 4DPXA 3MI7X 3OQ2A 3P5TL 5DM6Q 3NCRA 2CNKB 4HHJA 3POTB 3M9MB 1DAXA 2XGQA 1RE1B 3H2LA 5BYSA 4U7UD 3TR5A 3MECA 2R3VA 2BR0A 1CC8A 4P9SA 1JIHA 4ZP9A 2FC8A 4CLPA 3IO1A 3R8YA 2YWFA 1VJWA 1SJ1A 1U1PA 2C2EA 2GO9A 5M2UA 4IRDA 2EK1A 1ZPVA 5KOWA 2HEKA 1VMBA 4DR7F 4LQ9A 4RU2A 2IA6A 1RKIA 3MAAB 2WSCC 3HHKA 4Y28C 4MH8A 3FBCA 2P6SA 2I38A 3EGVA 1WC1A 3I5CA 2GAHC 2YQ0A 1L3TA 4O23A 2QEXS 4J9NA 2DGUA 4NCGB 2DR5A 4LF4F 3KNGA 1VRUB 1FWPA 2PT0A 2FC9A 5ETLA 2HBZB 1RTDB 1RHQB 1AFIA 3A3OB 1SL1A 2ZHOA 1K0TA 1K0VA 4ECVA 2C2KB 1FD2A 1SV5B 5CABA 4DR2J 1UPPA 4WE1A 2D69A 4OJ3A 2DD8S 1KLMB 3W62A 4RL1A 4P7VA 2ILZA 3DOKB 2VFSA 3GU0A 1FJCA 1RAEB 1OY9A 2Y1LB 2EXUA 3LP0A 2Y9HA 2Z58B 2IVFB 4KPYA 2CJ9A 1C2PA 3EDRB 2ACYA 4NYOA 3D0HE 4NLUA 3Q8YA 1FTRA 5H9EJ 2FLPA 3K8VA 5LXYA 1VQMS 3UNYA 1HMVA 4E0DA 1KQSR 1S76D 1Q79A 5AE2A 3C6UA 1R7IA 3GYXB 3HZEA 1DURA 1RKJA 1QY7A 1KOOA 3VHQA 3K2YA 4Z37A 5FIIA 3LP2B 2JNJA 3I55S 3OJSA 2LQBA 3IXQA 3M2UB 1URNA 2YNFA 4ELTA 2CFXA 2GQQA 2LQ9A 4NLVA 5HANA 2RU9A 1WF1A 2YQ1A 2OPRB 2RS8A 1BQMB 1YJWS 5H1SV 5KFZA 3F44A 4ZLPA 3Q8SB 4NLXA 1JK9B 4M5JA 1OMSA 4JI7F 4P2SA 2OSRA 3T9NA 2DJWA 1MROB 3ILIA 3VGUA 2YNHA 2YKOA 1QTMA 1IM6A 3AD8C 2M70A 2ZDPA 2E1MC 2XSJB 3PIPQ 2CJQA 1D9AA 1WC0A 2OFHX 3PKMA 1B4SA 4NLPA 2GCFA 3UFCX 2XI2A 1FK9B 3WX8A 1C1BA 3G9CA 2KRRA 2MMYA 2ZH5A 1UWBB 3TZXA 2QE5A 3JSMB 1P1TA 4DSFA 3P3DA 1N32J 2KL8A 3LTOA 2VODA 2QYCA 5L1IA 2E5GA 3I96A 4EBEA 3CD7A 4KH1B 5JVGQ 1EKRA 1RSCA 3VWSA 2YKNB 1DRZA 4RW7B 5KT3A 1IBMJ 3MUVP 1SKUB 1TUVA 3T1YF 2HZAA 2DBBA 1QVGR 3J7ZT 3GIJA 5HP1B 4AE5A 3SV3A 3TA2A 2E9TA 4LF5J 4GVBA 4DPYA 2B5JA 4RJVA 2FVRA 3AH6A 5F8LA 1PYSB 2EC0A 5DRKA 1GNKA 1IKVA 1TV6B 2CQHA 1JLEB 5EHHA 1AT1B 2W9CA 1GXLA 2C2OB 4AQYJ 4D3HA 2LDIA 2ZM6F 5IV4A 1HD0A 2AF6A 4FYXB 2FVPA 2BJDA 3N5FA 2GHVC 1WORA 1G1XA 1JKHB 2VQEF 4B3RJ 3JQJA 2MQNA 3HSJA 1CC7A 4KHRA 2OLWA 2UVRA 2J9DE 1NAQA 2QL5B 4FYYB 6FDRA 5DQHA 2EWHA 3NL0A 4I56A 4LF7J 1UCNA 3BS9A 4DMZA 3CT9A 4EUVA 3AODA 3H2UB 2KT3A 3NNAA 3F73A 3KLEB 1TP7A 2BEFA 3RUBL 1X9WA 2AZ3A 2XMUA 3BBBA 3M8PA 4F3OA 2H3EB 1YSJA 1N6QA 4M5DB 2W8LA 5KFRA 1T03B 2B3TB 3C8YA 4DUYJ 3CD0A 1IBLF 4WU3A 2KT2A 1FHTA 2XMTA 3QJJA 4JI6J 2NYIA 4DS5A 1UVKA 3OFHA 3U1LA 3JSRA 3H20A 3M6XA 3OR1A 1C0TA 3DMJB 4DR2F 2MKKA 1RT6A 1XBWA 2WB1D 1DTTA 8ATCB 2HGLA 4CZCA 2KU7A 3PZPA 3GCXP 2VG5B 1PILA 1WSRA 1QSLA 4ID8A 2ZH3A 3MEGB 2R42A 4N8OA 1CULB 4ZVUB 2ZKTA 2PMZD 4DV5J 2I1RA 2FVQA 4F2RA 4F4ZA 3G82A 4LR7A 1UWAA 3Q8VA 4X62F 1PYOB 3PXGa 2C3PA 2NXEA 1Q53A 1A0OB 4X66J 2CQ4A 2B51A 2PN6A 4Q8EA 1X9MA 4DSEA 4NYPA 3D9BA 5GADU 1J27A 3DLKB 2JLFA 2YWWA 4IH5A 1ACMB 5HQ8A 1KS2A 4DBQA 3EYZA 2ZWPA 3OV7A 4P7TA 1F3VA 4H54A 3RBDA 4TKTA 4N8NA 1B3TA 4CO5A 2F5GA 2Q43A 5D8HB 1U09A 2F7VA 2CPXA 3IBCB 3KHGA 1RWKB 4NMXA 2K1RB 4F36A 3V81A 3DLGA 3CD6S 1AXQA 2AX1A 4MK8A 2J5AA 3MM9B 4WKYA 4FYWB 3M05A 1R8CA 4H4OA 5ETPA 3BSNA 4J9KA 1C1CA 5ETSA 3DRYA 2FJWA 2D9PA 1VQ4S 3VVTA 4A47A 2UU9J 1YITS 1YGYA 2XMKA 4RUAA 3G6ES 3S8SA 2C28A 3MM7B 1IUJA 4Z2XA 3CO9A 2HWHA 3HHLD 4UOFA 1KP6A 1EQMA 4DOZA 2BE9B 2RF2B 3E3XA 2HS3A 1IJFB 2XC9A 1T94A 2ZBCA 5EN1A 2FJAB 5FLXY 4KQZA 4NLWA 5D6GA 1RLDA 2LU1A 4E8UA 3MFHA 1PAEX 3UCUP 4MFBB 3GIMA 4DR3J 3J7Z5 2VDIA 2VJUA 5KT6A 2FY8A 4ZPAA 1IBMF 2E5LJ 4CH0S 1CVJA 3O6QA 5HROA 4CO1A 1Z2ZA 2H54B 4IG0A 1AUSL 5IQ6A 3TO8A 2N3LA 2IM0A 4ZKAA 5D0HA 2JVRA 1UPMB 2HK3A 2NPFA 3DLHA 1HNIB 5F41A 3QFWA 1PBUA 1JXEA 1X8DA 4J7CA 4USVA 2DRBA 3BB5A 4CNYA 3NG8A 3GFZA 2BQUA 4F50A 2ZDOA 3WC2A 3CJ0A 3AOBA 3GG1A 3B4MA 5L9XA 5CA5A 3CJSA 4LJMA 1KHVA 2BYCA 3ILLA 1HNXF 2EI5A 2RH3A 4B08A 4JUZA 2H5IB 2QL9B 2CJAA 2ROGA 1FKPA 3OXLA 4AQYF 4JV0A 4W4MA 5LJ5Y 4ZVHA 2KFYA 3NGRA 4A8KA 4V19J 1XIQA 4KSEB 1FWLA 1DFDA 1JNZB 5KAKA 4RW9B 2O67A 3ET6A 4L6V3 4I64A 5DO2A 3FQLA 4BBYA 4B3RF 4DQRA 2KDOA 4ED5A 5G0RB 3FQKA 3V6DA 3C15B 1AZSA 4FNHA 5HSPA 4P71A 1FFSB 4QWDA 3P49B 2WBMA 5C2CA 3GYNA 3N28A 5GMEA 4DV3J 3E01A 3HFZB 2RHSB 3AT1B 4PYDA 1HQUA 2LDYA 2C2ZB 1NJZA 2YX7A 2NZ4A 3PX6A 1X60A 3D54A 4NI2A 4C0BA 4K4SA 1VJQA 1FX4A 1T7PA 2D7SA 1KD1T 4DUYF 4I69A 3JTNA 3KHRA 2X3GA 3PRVA 1RAFB 2ZJPQ 4JI1J 2G0CA 3R5CA 4JI6F 2MHEA 2XY5A 3I4PA 5LSLA 3R97A 3MOJB 3DOMA 5J2MA 2WVDA 5JVHQ 2CNOB 3KLHB 2JFKA 4ILLA 5T7LB 1KBRA 1GX6A 2HVHA 4DQQA 2GGPB 3W5YA 2COLA 3BDPA 5CH7B 2DNMA 4IH7A 1CG2A 1RUSA 4DV5F 3FBFA 3DRRB 3CB4A 3ITHA 2XMJA 3X1LB 1NHUA 3PJWA 4UQGA 1RYSA 4MMOA 3OL7A 1WG1A 1SH2A 3TUPA 3WDOA 2HHHF 1F2GA 2CXEA 1FRMA 2MKJA 5CD4H 3DGVA 4YR3A 1RTHA 3DM2B 1IWGA 3HSZA 3AQPA 3WC0A 1CJTA 2NSBA 5I3UA 2YVSA 1Q81T 2HQFA 4DV7J 3P4UB 1N5TA 3M2VB 4V1Ak 3R5GA 5DZ7A 5L8RC 4NLQA 3EWGA 3ISZA 3BJYA 4HTIA 3H7HB 2DH8A 3K7RA 2OPPB 4LF6F 1T9XA 3G8QA 4NLYA 4FPIA 3D6FB 5THWA 1NK7A 3K5PA 1YJRA 1DLOB 4EO8A 4PWWA 5ETVA 1HYSB 3HO1A 4JI8J 3T41A 5LM7E 3IGNA 2JLEA 4OX6A 5HMXA 1QE1A 4HYKA 5J2QA 2JRSA 3QJPA 2IC3B 2DRAA 3HVTA 4OI2A 4QIGA 3LAKA 3TI0A 4XPEA 1RAAB 3CJ5A 3Q8RB 3R1HA 1VIXA 1GAOA 2IM3A 2DTJA 3CE8A 3FJ2A 3G96A 2XB2D 2EEYA 4NXNJ 3GFYA 4WZMA 1UVNA 3DLBA 4U8YA 2JFDA 3UD5A 3I87A 3LAMA 4DR3F 2EG1A 1HNVA 2KVQE 4WU2A 2C2NA 3N0VA 4R25A 1QVFR 5HVGA 2VH7A 2M0GB 2UUAF 4X4SA 3CW2C 1R31A 4WXWA 4OHWA 2AGQA 5LMUF 3C66A 3VCDA 1ZETA 3SI8A 1NU4A 1S1XB 1E6YA 2IRYA 1QAXA 2APOA 2QFIA 2BW7A 3QMQA 3TJAA 1YI2S 2A0FB 2EFGA 3HD1A 1AW0A 4LR8A 2DNQA 5ETNA 2DCUB 4M5HA 1D09B 1HIYA 2M2BA 4LBPA 3R1LA 3FFIA 1X4CA 3GZ7A 2OPQB 3BEGB 4CQ1A 4B9TA 3TOQA 1SH0A 5DLGA 2P9EA 4MKYA 4B9LA 3RRKA 3SQGA 2ZNYA 4M5GA 2N7YA 2MGZA 2OKQA 4JI0J 1NUEA 4WFAQ 3P5BP 1RA6A 1WKKA 4CNZA 2MKYA 4N77A 3R5JB 4Y2KA 1L3SA 2HQIA 2G2OA 3VZIA 4K8RA 3NBPA 3M6VA 5CYMA 1GMWA 1TKXA 2MQ8A 4Q2MA 5IXUA 2FQQB 5BYRA 1GFWB 1KQKA 2HAFA 2P6TA 2D1CA 3X3UA 1U0HB 3KKFA 2HFSA 4AT1B 4DUZF 2GIQA 1UW4A 1FRJA 1HQEA 1BUXA 1G4CA 1HI1A 2J8SA 3G4SS 4ZHRA 1RAIB 3V4IB 1HBOB 2VPZB 1CS4A 2XGPA 1NDKA 2N82B 3CULA 4Y34A 2WVEA 4ILRA 4RBTA 4IOCQ 5FDLB 4JI1F 3UR0A 4ECYA 5F9NA 3W8GA 2J8AA 1NH8A 4OYWA 4NXMJ 4X4PA 4CDIA 1D3WA 2PMWA 3I56S 4LR9A 3TZWA 4YFUA 3A8IA 3M7VA 2MLXA 3EM1A 1NCLA 2VFUA 1UFLA 1NJYA 3KK3A 2Z2MA 1IKWB 2HG4A 2DNYA 3EZ5A 1SC1B 2MQPA 4GKKF 4ICLB 2BDPA 1Y11A 1LWFB 3H25A 1NJXA 1FJ7A 4FP9A 2P9GA 4IR9A 1BXNA 1RHJB 1VHFA 2F9DA 1S9EB 2OH2A 2HYIB 2KKHA 2AGOA 1NLKL 3MPYA 3MMAA 1NSPA 1G2EA 5BR8J 3NWGA 3AOCA 3TVKA 4OHYA 2LECA 1LWEA 1QUVA 3OL9A 3V6JA 4HH1A 2FGOA 3QLHA 4LF9J 4DV7F 2QA4S
chains in the Genus database with same CATH topology
1ZM9A 5JJBA 3FEYB 2RB7A 4LT6A 4MAKA 4K0KF 2J0XA 2VFRA 4Q44A 2I5JA 2VKZG 4L3NA 4WZQA 2R7WA 1OWXA 2AYBA 2V5HG 4OX8A 1DQAA 4LSNA 2N3OA 1RTJB 4UUXA 2MDAA 1KFSA 4Y2CA 3KK1B 1K9MT 2LU2A 2P9CA 2XG8A 3TA0A 4RU9A 1UVJA 1CQNA 4OZLA 5J2NB 2QSWA 4ZMMA 3HMJG 2XZWA 1NEEA 3UDCA 4LF7F 4LUBA 4J5OA 5F0UA 4G6VB 4HEA9 4NL5A 2GW8A 3K58A 5A2QY 2KM8B 2DT9A 3BSCA 3HKWA 3TAMA 5F8GA 2FJXA 2W7OA 2V2KA 1HFEL 1QE1B 2ADBA 1YJNS 4ED2A 1NB7A 3POTA 3OR2A 1X0PA 4C8KA 4UY8T 2VONA 1WD6A 4DSIA 1S6PA 1U2RA 3PRBA 4ZP6A 5B09A 2B9YA 4NZ7A 3CCUS 1NK9A 4JI8F 2OMOA 4B9VA 3I9V9 4F3QA 3SSSA 3DYAA 1VK3A 4CO3A 1GT8A 1XTZA 3VAIA 3HVTB 2YKPA 2YH0A 1TL5A 4NLSA 3KFWX 5E3CA 2W7PA 2KJWA 5L1JA 3DLEB 3OFEA 3TARA 4PUOA 2ZZMA 2HHVA 2XMMA 4ZP8A 4F4KA 2WAQD 2WRMA 1S9FA 3MM5A 3J81Y 3GE9A 4R8UB 2VG6A 4C7QA 4O4GA 3IRXA 5ADZA 1NK6A 2KH9A 1N5YA 2CQIA 2EPIA 4FS1A 3BO3A 5I4MA 4ZCMA 2OIHA 2MZTA 3VR1A 3QIPB 1HWUA 1IQTA 1O5JA 4RW6B 4MK9A 5H9FJ 3LUYA 4CT8A 2WW8A 5IM0B 1LK7A 3S1TA 5DLFA 2C42A 3PKYA 2W7AA 3PEJA 2QA1A 2PI5A 1HL6A 2B9XA 3K5MA 1HR0F 3V4IA 5KFHA 5HLFA 1TKTA 1HBOA 2QLXA 2HNYA 1HNVB 2YKAA 2OO4A 4WFNQ 2L48A 4YB6A 1WF2A 5AXMA 5A8RB 4X4TA 3HHEA 1FXRA 2YKMB 2VFTA 1UMJA 5CQGA 2UV8A 3US5A 3CDBA 2A18A 3GFXA 1U1RA 4QJVA 4OHZA 4DL0C 3M9OB 3BREA 3MR6A 3OTCA 2XMWA 5B0EA 1TFWA 1HA1A 4KB7A 4QR2A 5DJBA 1VQLS 3RAQA 4IOAQ 4WYWA 1HBMA 4NCGA 5A8KA 1FXLA 1REVB 1VRUA 3RB0A 4NWBA 2RU3A 4I68A 1U1LA 2BABA 2EBEA 3KLGB 1ZM3A 1HWJA 2X1BA 1RWUA 3EXYA 3M32B 2XLIA 3T19A 5DQIA 1KTVA 2GC8A 2M4MA 2NXUA 4PG6A 3GV5B 3Q2TC 3RW6A 1AFJA 3RB6A 3CMAS 2RQMA 1A6LA 3RU0A 4ATNA 3BF4A 3R5AA 2U1AA 3VAJA 4B3OA 3HHLC 5JXSA 2QA4G 2LVWA 3RB3A 4LIRA 3BDEA 2AJQA 1JNRB 2CQDA 2JX2A 5CHCB 2J0QD 4CO4A 4WIIA 4OX9F 3JSYA 3KLFA 1N4LA 1SB6A 1VQ5S 4C8LA 5T14A 2XCPA 1LW0B 5C24A 5KFAA 3MR5A 1MMLA 3FFIB 2ZVSA 5AXLA 1MMNA 3SDEB 4H4MB 1SV5A 1U2FA 4J9OA 3CCTA 3VAGA 1IKWA 1LV5A 1TVRB 5KFEA 2HGMA 4DN0A 3FZBA 3SZ2A 2O1PA 3IAM9 3MTKA 3HVRA 4OJHA 4I2QA 4OZ5A 3BGRB 1TKZB 2YNIA 2FVSA 4C8YA 4IUFA 1FNMA 2YWEA 3JYTA 1B64A 4IFVB 2HNDB 4ICLA 3KK2B 5AXNA 2YWKA 4JOUA 4K4UA 4K4XA 4X66F 3UDLA 2ATLA 3JAMY 5A8WA 1U6FA 1S0MA 2DNLA 3DOKA 4TU8A 1Z1ZA 2ZHAA 3KG1A 3CEDA 3KJVB 4K50A 1UJ4A 2DISA 3H5YA 3HXMA 2HHWA 4FPRA 3DRSB 3K0JA 3CCJS 2X1FA 2V4RA 1ZTWA 2NREA 3MEDB 3MEEA 3NS5A 4B3TF 1NRKA 4C8OA 3D1HA 1S9EA 3DC2A 5HBMA 3R3TA 2ZH4A 1ZZFA 2OD6A 3DI6B 3NMRA 1OPIA 2FB0A 4EWTA 2JC0A 2HHQA 1YJTA 3CC7S 1ZM2A 3V4MA 2HRUA 3MTJA 3T3FA 4PWUA 4IOBA 4FZVA 3K59A 4AUKA 4DL6A 4MIBA 4Q0BB 3NBPB 4IG3B 4JI0F 5DQGA 2VB6A 1SUQA 1IN0A 4YUDA 4JV2A 1MU2B 3KHHA 1TKXB 2KRBA 1RP5A 2W4CA 2RDJA 4DN9A 2AJ4A 2PMHA 3J7YI 1WG5A 1J5EF 2HFZA 2AJ0A 1VRTA 1URRA 4B9SA 3N6MA 2DNHA 4XDCA 4V19X 4DDFA 1S1TA 2K3IA 3EXCX 4GMKA 3GG0A 2GMJA 2LEAA 4XDDA 3FZ2A 1F0XA 3JSBA 4KGMA 2LQ5A 4ZCIA 3IG1B 1N56A 2JL9A 4K59A 1XEZA 3GWCA 3LW5C 2IJNA 2RDIA 2WONB 4WTYA 4E98A 4Y0FA 2D74B 1SKSA 1BGXT 2HQ3A 5EWFA 2W24A 3MOZA 4DQIA 2IA0A 3A1YG 3B82A 4UOCA 4BCAA 2AYEA 3VAFA 3TVZA 4QR1A 2UUTA 5F8MA 5B0FA 5B0GA 3LP2A 2E29A 3O1LA 3MR2A 2JWNA 4YEAA 3NLCA 2K7KA 3CF5Q 3KTQA 2FJBB 5J1EB 4YR0A 1RTJA 1KEKA 1RT2B 4B02A 5I42B 4QW9A 3RRHA 5IWAF 4KIAA 4HLBA 5K14B 3PHEA 1MSWD 1NK5A 2R2UA 2I2YA 1XR5A 3HFKA 3GFHA 2FY1A 1XR7A 1TL4A 1SJ3P 4WFZA 4NRTA 4C0OC 2BE2A 2XEXA 4NLRA 3CDUA 3M6WA 3QZ7A 2LA6A 2RKIB 5AE3A 2ZD1B 3OHBA 2UXCF 1LFWA 1R89A 1KVJA 2G13A 2BV3A 2FVCA 2Z4PA 3FEZA 4Y6IA 4ZP7A 3NGKA 1S0OA 4RW4B 1KC8T 2UU9F 2OPRA 4QWCA 2WSFC 4W92B 3UWTA 4F02A 4I6YA 2GIRA 4N5SA 1BQMA 2DGTA 1AUDA 2FD2A 3MWBA 2O5DA 2FHMA 1F60B 2B4OA 3CD5A 3FRZA 1QAYA 3H4DA 2MKCA 3DLEA 1VQKS 1S10A 1Y4ZB 2LLZA 4O3OA 3I0RB 4RW8A 4ECRA 3HHLB 3DNCA 2CQ2A 4ZPBA 1TFYA 2ASDA 1H7WA 3ZZZA 4RWWA 2MSTA 3W2WB 3RTVA 2OJ3A 5C25A 1MROA 1S0NA 4LFCF 1JLBB 2ZOFA 3KHLA 2FLLA 3QIPA 2ERRA 4TXSA 2QIFA 2HRYA 3Q8PB 4RW6A 5E3AA 2ROPA 3DXBA 4I4BA 2R7XA 3ZZUA 4GKJF 3N6LA 1LKZA 3BSAA 4PKDB 5L1LA 4FVCA 3CJ4A 1L3VA 4X4VA 5KT2A 5KFFA 4QCLA 1O8BA 4KFBB 2FGCA 2KHCA 2PE8A 2DGOA 4QIFA 1LW2B 4NXMF 4C8NA 2XSJA 1V9OA 2MZQA 5AE1A 1ZTTA 1WHVA 2PIIA 1FF2A 3ENWA 5DG8A 1FA0A 4QIVA 1SL0A 4EGLA 5A8RA 3PW7A 3U1MA 2V94A 2CRLA 2ZH2A 2HLUA 3AAWB 1PO6A 1UEUA 1S4FA 3KK3B 2DIUA 2YKMA 3D2WA 2E5LF 4OI1A 1UP1A 2IVMA 3PX0A 3PX4A 4MYTA 5F8IA 1Y3KA 5GAGU 4O44B 4WE1B 3PFOA 1UWBA 3FSIA 5IT9Y 4DL2A 3T6JA 3Q0AA 1S9GB 3DN9A 3JSMA 3O44A 1N8RT 1KVIA 1TK5A 1RTIB 4IDKB 3OLAA 4I2PB 1A9NB 3GR1A 5F3TA 4TN2A 4DG1B 3QO9B 3SEOA 4PG8A 2VBZA 3KLGA 2HZCA 2NSCA 3L09A 2E1CA 3M32A 1R27B 3CDAA 4HH0A 5KFBA 4ES1A 3M30B 4WXOA 4QPXA 1HI8A 2LXIA 1VOMA 1N52B 3LP0B 2E66A 2AW0A 3U27A 2B6AB 2PDAA 3ISND 4RW7A 2WOMB 4J9LA 4PQAA 4G1PA 5C5JA 4O3RA 3IFEA 3KLIA 2O3DA 4A4JA 5J2PA 3MM6A 5J1PA 4QWEA 2OSQA 4OHXA 1JLAA 2M5YA 1LW0A 1Y7PA 2G9OA 4NCBA 1FTCA 4K5SA 4OQJA 3FVYA 1GTEA 4PG4A 1P6TA 4OI4A 3SDEA 5KFJA 1DTQA 1OQ3A 3ETOA 4H4MA 3PO5A 1MMDA 1Q8LA 2DNOA 2KO1A 1NH7A 2LKZA 4XK8C 4YMEA 2BQ3A 1YVFA 1FESA 1LWEB 2FPHX 2VV5A 2GJIA 1QAJA 3BGRA 3UD4P 1FVSA 2FLOA 2JC1A 1TKZA 4L72B 2W9AA 5GAHU 2ZNZA 1IKXA 3D0IE 3THPA 4R5PB 1FJEB 2PC6A 5BR8F 1JXLA 2FDNA 2R7TA 3KK2A 5HP1A 2K7JA 3EPGA 1SQEA 1HNZF 3C6UB 4QIEA 4KV8B 3QLHB 3FSXA 4O4RA 3ENVA 1V6HA 1D0EA 1BWEA 2JH3A 3KJVA 2GMHA 2DGXA 1YHQS 3DRSA 3MEDA 2ZUGA 5HMWA 3Q8QB 3W3SA 1HARA 4K4VA 3G6VA 4DLEA 5M2PA 2BM1A 2AGPA 5D4NA 3PW4A 4FXVA 2RQCA 4CCHA 2KB2A 2RRBA 4MIWA 2X1AA 4RWXA 2EG2A 4USHA 4NMLA 4DPOA 4ETZA 1LXNA 4UY85 2MZSA 5HO4A 3TAQA 1S77D 4NOHA 2J9DA 1WG4A 4JV5F 3EPIA 3MI7X 2QZ8A 3OQ2A 4IG3A 2QA2A 3P5TL 3RZAA 5DM6Q 4KHMA 3K8WA 1FEEA 1WEYA 4YDDB 1Q8BA 1U1NA 5KFGA 3TAMB 2GHWA 3NCRA 2B4VA 1IBKF 4ECUA 4HHJA 3KMSA 3POTB 3OR2B 3M9MB 1DAXA 1IQZA 2XGQA 2WTFA 2F3JA 5K8NA 4EZ9A 3H2LA 5BYSA 3L95X 2B4UA 3TR5A 1DZ5A 2E9RX 4OLPA 3T9ZA 3MECA 4I67A 2BR0A 2JZ5A 2DH9A 1CC8A 3HVAA 4DV3F 1UJ6A 1JIHA 2YY3A 2FC8A 4ZP9A 5E3RA 3FNNA 1JLQB 3IO1A 2WONA 2BRLA 4F2SA 1YJ9S 4ELVA 1X5OA 2YWFA 4TYBA 4WJBA 4XAKA 4PUOB 2EVZA 1VJWA 3PO4A 4DV4F 1SJ1A 3W2VB 1JKHA 2QO3A 1U1PA 4IH6A 2VG6B 3T5HA 2HPUA 4O4GB 4TY8B 2C2EA 1FNOA 4BWMA 2C22A 1N5YB 2GO9A 4K4YA 3AB4B 5M2UA 4IRDA 3QGPA 2EK1A 5KFOA 5I42A 1Q16B 3MHYA 2YKQA 1B0VA 1ZPVA 5KOWA 2VG7A 5K8OA 2HS0A 4HI1A 1VMBA 4K5RA 4DR7F 2M9KA 1S1VA 4LQ9A 2CVEA 1YRXA 1X5PA 2MZRA 1VQOS 5HL7Q 1D9DA 4RU2A 1XMQF 2IA6A 2ZD1A 1RKIA 3FSYA 2WSCC 4Y2AA 2RIJA 3HHKA 2HNYB 4BC7A 2OD4A 3O5TB 3RAXA 4Y28C 4MH8A 3CCZA 2LEPA 2MQMA 3IBWA 1GXUA 3CCSS 2DR7A 1LXJA 2ZFHA 5DM7Q 5CCLA 2KJVA 2P6SA 2I38A 2L9WA 2RILA 1JLGA 3I5CA 1WTFA 2YWHA 4U7UK 3KLEA 1YQHA 3K5OA 2XWXA 2OMLA 3I0RA 2XI3A 1L3TA 1HWKA 3HHLA 4O23A 2QEXS 4J9NA 2DGUA 3F56A 1HBMB 4NCGB 2DR5A 4LF4F 3KNGA 1VRUB 3PM9A 3W2WA 2PT0A 2FC9A 2RS2A 3PVXA 1QJHA 2R7UA 1SJFA 1JLBA 4DL5A 2L41A 2NUHA 3EGZA 1OSDA 1RTDB 2E7XA 1QLNA 1FKOA 5KFNA 2VOOA 4YQWA 4MK7A 1L3UA 1KFDA 3PR4A 3M6UA 4I1TA 1D8YA 4GO5X 2HFNA 4M8LA 2UUCF 3P96A 4ZPVR 4TNOA 1LW2A 3M8SA 3OBIA 5KFVA 2DNZA 1AFIA 5KFCA 4PXCA 1SL1A 2YTCA 2ZHOA 2YQ3A 4RZRA 1S48A 1KNZA 5C24B 4WK1A 3SCKE 1K0TA 4OI0A 2R8GA 2Y0SD 1K0VA 4ECVA 3OVAA 1FD2A 1SV5B 2C3UA 1ZH5A 1N54B 3HP6A 1S6UA 4WE1A 3ZZOA 1Z2LA 5L39A