5B08A

Polyketide cyclase oac from cannabis sativa
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
100
structure length
100
Chain Sequence
AVKHLIVLKFKDEITEAQKEEFFKTYVNLVNIIPAMKDVYWGKDVTQKNKEEGYTHIVEVTFESVETIQDYIIHPAHVGFGDVYRSFWEKLLIFDYTPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Olivetolic acid cyclase
publication title Structural basis for olivetolic acid formation by a polyketide cyclase from Cannabis sativa
pubmed doi rcsb
source organism Cannabis sativa
total genus 28
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 4.4.1.26: Olivetolic acid cyclase.
pdb deposition date 2015-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5b08A00
1U7LA 5F0WA 3CJKA 4A46A 2HLUA 2HLTA 2W4DA 3QMQA 4OJ3A 2LDIA 1FVQA 1URRA 2KT3A 5F0UA 1YJVA 1GXTA 1N5QA 2OFHX 2GGPB 2OMOA 2OP5A 2QYCA 2RMLA 4HH1A 1S6OA 3BGUA 2K2PA 2GO8A 5T7LA 4A47A 1LQ9A 2K7KA 2HIQA 2OD6A 2FIUA 4HI2A 5K9FA 1N5SA 2BJEA 4NL5A 5B09A 2HFNA 1FEEA 2XMVA 3KG1A 2BBEA 1Y3JA 4DN9A 3FGVA 5B08A 1AFIA 2GA7A 3I9ZA 1OQ3A 3BB5A 2ASYA 3GZ7A 4U9RA 4QOTA 2N7YA 1Y0HA 5B0FA 3TOQA 2OKQA 2Q3PA 3DXSX 3UDCA 1TR0A 5B0CA 2QLXA 2W4PA 1AW0A 3MCSA 1R6YA 4DPOA 3LGMA 3TNVA 4OJGA 3HX9A 1XBWA 1FESA 1Q4RA 3BDEA 2BJDA 2KYZA 2ZDOA 3LGNA 5A6WA 4EFAC 3KNGA 2AW0A 3IWLA 2QIFA 5B0AA 1X0PA 4Y2KA 1SI9A 2K1RA 4OIXA 2FB0A 2N4CA 2PGCA 4FNHA 2ROGA 4Q2LA 1N5TA 1JK9B 1QUPA 1KVIA 1FD8A 2G9OA 1YJRA 2IYIA 1KVJA 3HHLC 5KAKA 2KKHA 2ROPA 2ROEA 1IUJA 2HQIA 3K7RA 1Q53A 3TRGA 4Y2MA 1MWZA 2KT2A 2RU9A 2VH7A 1GXUA 2K7JA 3BN7A 3FRYA 3F44A 4YDXA 4OJHA 1OPZA 2AJ1A 1YG0A 1APSA 2AP6A 3HHLD 1Y9OA 3KKFA 2BYCA 2ZDPA 2RSQA 2LQ9A 2XMWA 4OJ1A 5T7LB 1ULRA 3HFKA 1CC8A 2N4DA 5IXUA 4YEAA 4Y2IA 2ACYA 1W2IA 1SQEA 3T9NA 2FTRA 3BR8A 2L3MA 1FE4A 1OQ6A 1X7VA 3BF4A 1FE0A 2GGPA 4HL9A 3E8OA 4HH0A 3HHLB 4A48A 2GV1A 3WDOA 2GFFA 4FNIA 3KG0A 1CC7A 2XMUA 4ZOSA 1WD6A 3VTIA 2OD4A 3DCAA 4ZA1A 1KQKA 1TL5A 4F67A 2FHMA 1VQSA 2PD1A 2LXFA 3CJKB 1X8DA 2EW9A 2OFGX 2XMKA 1FVSA 4HI1A 1Q8BA 1TUVA 1YJTA 3MZIA 4Q2MA 1YRXA 2CRLA 1V3ZA 4DL0C 1Q8LA 1TL4A 2BUNA 2K1RB 1MWYA 1YJUA 2XMMA 2LQBA 4A4JA 2IYGA 1RJJA 2HFOA 2IFXA 1CPZA 2JDJA 1N5VA 1VQYA 1P8GA 2OAUA 2XMTA 2XMJA 3HF5A 1Y3KA 3QGPA 4NPOA 2QLWA 1JWWA 1K0VA 1TZ0A 2RILA 1SB6A 1OSDA 3HHLA 5B0EA 2GCFA 5B0DA 1S6UA 2W4CA 3LO3A 5A6PA 1P6TA 3BM7A 3FMBA 3IWXA 1AFJA 3HDSA 5B0GA 2AJ0A 2VV5A 5B0BA
chains in the Genus database with same CATH superfamily
4DQSA 5AE3A 1MMDA 4ED6A 4AD6A 1TTHB 2QL5B 3HI9A 2CVIA 2QMXA 4AXIA 4KBIA 1SJQA 5DO2A 2GA7A 2HS4A 1T3OA 2NLWA 2YWWA 1RT4A 5LXYA 1D9FA 2DH8A 3MM7A 1HQUA 1BMQB 3VGSA 3MDFA 1RHUB 2D1CA 2HS3A 1BY9A 3HVRA 1LFPA 3GV8B 1JK9B 3G96A 2XY5A 4JYAF 3EVMA 2XBPA 4GO5X 1SL1A 4LVOP 2KT2A 5F8GA 1N54B 2AJ1A 3HJFA 3MM6A 4DUYF 1WWHA 1O51A 2ZH2A 1RQ0A 2DNGA 2I2YA 1PJ7A 2VPZB 3F0NA 3OUYB 5KFCA 4FPRA 4DEZA 4C8YA 2OFGX 2IVFB 1WSVA 4EYHB 5ETMA 4ID5B 1N33J 4CO0A 4WXOA 5IFMA 5C42B 2Z57B 5IM0A 2NYHA 2M5YA 2M2BA 2VPXB 3O1LA 4YHHF 2HQ3A 1UAWA 1R0AA 4RBUA 1FWKA 4KE5A 4HDHA 4KFBB 4H4OA 2LLZA 4NI2B 3PKMA 1HBNB 3E01A 4O4GB 5DM6Q 2N82B 3KOAA 3NGDA 3KK3A 5K9FA 2W9CB 4DV2F 4JI0J 3IN5A 3Q89A 1D0EA 4IO1A 1FRLA 2WAQD 5HVFA 1S1UA 3Q24A 4ZIWA 2UUAJ 3OTDA 2AHOB 5L1KA 3IWLA 5HMYA 2IBKA 1C1BA 3Q23A 3D54A 2VICA 5EUHA 2J0XA 2R2SA 1QAIA 5D6GA 2ZNZA 2HBYB 2KFNA 1TV6B 3IS9B 2ZD1B 1KQSR 2AP6A 5E33A 1D8YA 2BRKA 3FC9A 1EJ7L 4YS2A 1WKKA 4MKYA 1YLXA 3UN3A 3HHLB 1VC6A 4J9UE 2BANA 1Y11A 1FRJA 3T1YF 4HTJA 3FEZA 2ZH9A 1VIXA 2NR0A 1LW0A 3OL8A 2IJRA 2HMIA 1Q7YT 3MR6A 4OI0A 5DLGA 4B17A 4OZNA 3BM7A 1UJ5A 4M95A 4F36A 2E5GA 2HWTA 2G0IA 5BYQA 1KS2A 1Y4ZB 2BMBA 2YH0A 1UW4A 4W4MA 3K59A 2BOAA 4ES1A 4CYUB 1NBEB 2Y8WA 2W9BA 4QBUA 3O5TB 4QOTA 3IC1A 2DCLA 3A8JA 3SQOP 3KYLA 2EKNA 3NY0A 3U1LA 4PWWA 4P73A 2R8IA 2RUSA 3G6VA 1YZ6A 4QCLA 4LF2A 3DLJA 2X3DA 4TQRA 1NSKL 4JV5F 4X84A 2KN4A 4WKRA 1JJ4A 4ECSA 3NGKA 2VASA 2MKCA 4G1QA 3FZBA 2IM0A 1K9MT 3E8OA 3MOZA 2JH3A 2WVDA 1L3VA 1NK9A 2XMUA 4ZMMA 2MMYA 4DN0A 3TUJC 3U02A 3CDWA 4YN3B 2VPWB 3CB4A 3S6EA 3GFXA 2R9LA 4A8KA 3AT1B 2UXCF 3K8VA 1P8GA 2ZVIA 1FRKA 4QR0A 1RT5B 2YWFA 3TEGA 2I8EA 4DV4J 3IR7B 4J9NA 2MDAA 2UUCF 1SH2A 1SBRA 2LA6A 3ZTSA 4C6AA 3OTOJ 2WHOA 3C19A 2D41A 1GXTA 3CJTA 2AJQA 3WIVA 3DYAA 1S9EA 1FTCA 3B82A 3BYPA 3CCUS 4K7QA 4KSEB 2OIHA 2GQQA 3TP2A 2EG1A 1IQZA 4DPOA 5KG0A 1XNRJ 3M6UA 2RQ4A 3TJ8A 2IA6A 3SSRA 2OPPB 2RD5C 4DQPA 1HWLA 3GFYA 2MKYA 2HQIA 3CNQP 1HNIA 3B6BA 1CQMA 4IFYB 1HWIA 2UXDJ 1CC8A 5BR8J 3MEDB 3JS9A 1S59A 1NO8A 2GGPA 1WHVA 2XM3A 4ZOSA 1O5JA 3ZNJ1 1DTTA 3HVAA 5G0RA 2XLJA 3ICLA 4ER8A 4MKBA 4CWBA 3R5BA 4IO9Q 3EGWB 3VR1A 3J7YU 2QL9B 3IBWA 1CPZA 4O44B 3J81j 5F8IA 3U1NA 4OX8A 1U0SA 3C8YA 3QWUA 1NUEA 4DV6F 1UPMB 2ZBRA 1RAEB 2HW3A 4X4OA 1JLGA 5IZHA 2F8EX 2QYCA 2RUGA 3SCKE 3NOCA 4DUZF 2XCAA 2FVRA 3LQVA 5HP1B 3PJ9A 3W63A 5KOXA 3KLHB 3KWMA 5LXRA 1S1VA 3LP0B 3ZZZA 4DFJA 1Q4RA 4OIXA 2QGFB 3FBCA 3OVAA 4DLEA 2BW2A 3FFIB 2AMCB 2IJFA 5HANA 1LV5A 2ERRA 4YOEA 2J9EA 2ZBIA 1WHYA 2Y0SD 3OL9A 2GJIA 1HNVB 1M5PC 3BPSP 2YVSA 4F8RA 2X7IA 4CLPA 4KKOB 3PX6A 2ZH3A 3CT9A 3D3CJ 5I3UA 4ECRA 1WSRA 4B3TF 2PFDA 4N8NA 5A76A 3CCTA 2KO1A 3D66A 2AKWB 1I3OB 2KM8C 1YVFA 2VFRA 1TKXA 4RW6A 1JJCB 2WVFA 2OMOA 2EFNA 3D2WA 1BLUA 3KG1A 1AZSB 3JYTB 2E44A 1UVJA 1UETA 2HHSA 2J8AA 3Q8YA 2R8HA 2CXEA 4O0IA 4DFMA 1FJCA 2W2MP 4R8UB 2EBGA 4I0WA 2HBQB 1KP6A 2WOMB 2XTJP 2CZ9A 4UOCA 1YKWA 1S97A 2MZRA 4MTPA 5IC6B 3ENAA 2BYCA 1WACA 3DFEA 5LT5A 1WG4A 1GXLA 4WK3A 3SCJE 2FY8A 3KMQA 1RWXB 3M30A 4AFFA 2HFUA 5SZTA 1DQAA 4ZVPB 2MQPA 2MGZA 3MECB 4RW7A 1HLWA 4JYAJ 2Q79A 2HNDB 4DWIA 4F4ZA 3W65A 2KVQE 4CM0A 4P74A 2QLWA 1F5AA 3BREA 3CJ0A 4Q8FA 4DUYJ 4MIWA 2XSJA 3HHNB 5M2UA 1KR4A 5HVGA 2NZCA 4UQTA 1JLFA 3B78A 5GAHI 3EWGA 2GIQA 3CO9A 2BVZA 4KJIA 4F4WA 3SIPB 3LGHA 1J5EF 1T05B 5LSRA 3QLHB 1SL0A 1S1WB 2L9DA 1PBUA 1FRIA 4RLEA 4YHHJ 2QG9B 1S57A 4EUVA 2DXFA 5E3PA 1LW2A 3C16A 2AIRB 4LFBJ 2KH9A 2PDAA 4CLZA 4BCAA 1GMWA 3OTBA 3P5BP 1KHVA 1IBMF 5D4NA 4BC9A 5HROB 2ZC3A 1NDKA 1SJ1A 4ZPAA 2YWEA 3EGNA 5AE1A 2F65A 1B0VA 2H5EA 3BGRA 3NGTA 1KFSA 3R5CA 3DKDA 2ZBQA 3E51A 4Q44A 2DB1A 5DG8A 2WTFA 4P2XA 3HF5A 3JQJA 1WNEA 2QLFB 3BEGB 4TY9A 1X9MA 5A8KB 4J9VA 4A46A 2HLTA 2CQ3A 1KKHA 3ZTPA 5BYSA 3AOAA 4R0JA 3T1YJ 3RB6A 2LU1A 2R2RA 1BQMB 3TZWA 4I6AA 5J1PA 1U45A 4H4KA 3NS7B 3UQSA 2RQKA 4NZ6A 3WQPA 3QFHA 1C0TB 5HMWA 3JSMB 3EUNA 5KFKA 2MZSA 2R8KA 1HHQA 5C24B 5C25A 2YQ1A 1TL3A 3HZGA 2ZFHA 2HRYA 4DZ6A 4WWSA 2ADBA 4IOAQ 1MU2B 4F2SA 2H3EB 4ED2A 1Q7LB 4A48A 3DNCA 2CNKB 1MNEA 4DUTA 3FJ2A 1VQSA 2FGCA 4A8WA 2F9JA 5D15A 1Q8BA 2HK2A 4CRJA 1Q82T 4DBQA 5E0OA 4V19J 3KNAA 1R6VA 3FEXB 2L9WA 3EE3A 1HARA 3H0PA 2E1PA 4JI6F 1H73A 5F0WA 2GVDB 3S8SA 1RAGB 5A8WB 2E9RX 1CJUA 5A0YA 3UCGA 2YNGB 4DL6A 1EP4A 2GHPA 2R2UA 1RHMB 2UXCJ 1S49A 5CHCB 1VJQA 2ZHBA 2A18A 2OEMA 3A1YG 4LVNP 2AWZA 2UUCJ 4F02A 2MEWA 5M2RA 5HVHA 4L72B 3OL6A 5E3AA 5KAKA 2B4PA 2CPEA 4LRDA 3UDEA 3MUTP 1PJ5A 5T7LB 2AEJA 4QW8A 5IXUA 3SZ2A 3DHWC 5J2QB 3KHRA 4Y6IA 2KJWA 3CF5Q 2IIHA 2ZJPQ 3NCPA 3VCDA 3G82B 5GVQA 1UWBB 1D3WA 4HACA 2CDRB 1G2EA 3J7AN 1HPZA 1KOHA 2CQIA 2EFVA 3HULA 3T5HA 3T41A 1GFWB 3OXLA 4ECTA 3TX0A 2EPIA 3T3FA 4URSA 4KT0C 1KTVA 2RKIA 4F0KA 1S76D 3OJUA 3GSIA 1WF1A 1N5YA 4RWWA 1FJGF 1X4DA 4QWAA 1VQ4S 3I5BA 3RW6A 4NX9A 4RW4B 3D67A 2CFXA 5E3QA 3C6UA 2ZKUA 3LP1A 2OO4A 2E5JA 4OJGA 1NPRA 1RTDB 4I2QB 1RAFB 1PCAA 4DV6J 4ZCIA 2CNLB 2MKKA 5I42B 4EO6A 2BJ8A 4USMA 4BLGA 1N36F 4NLWA 3D0GE 3MD1A 3D9BA 4DHVA 4G6VB 2MJNA 5F3TA 4OYWA 4JV2A 5KFGA 4ZA1A 1N34F 3SSSA 4CLSA 4OHWA 1S7IA 1H6KX 1VHIA 4TU7A 2BX6A 3OV7A 5HI7A 1SQFA 4E0DA 5IC4B 2YKPA 2B8QA 1S6PB 4FS2A 5DETA 5B0EA 2EK6A 5A6PA 4LSNA 2AYBA 5L1IA 1WF2A 1LWEB 5DM7Q 1S9GB 3M9MB 3DI6B 3J7YI 3ITHB 3BV8A 5L38A 1S12A 1AXQA 2KYXA 2A2DA 3GYXB 3MR5A 4LIWA 4LF4J 4QYZK 5KFVA 3BYRA 4B3TJ 2ZH8A 2R4FA 5D3GB 4ZPCA 1SKUB 2VG6B 1N88A 4WCEQ 2ZM6F 4Q2LA 5E3RA 3D5MA 4EGLA 4H4KC 1NJZA 2B7CB 3KLGB 2YNIB 2LEBA 1L5UA 1X5TA 1GQEA 4R5PA 3H4DA 5D0EA 1RCOB 1WHXA 2FZGB 2QJ3A 2DTJA 4RO0A 4B9VA 2HGMA 3SFUA 1IWAA 2IVYA 3P6YC 2PN6A 3PVXA 4YR0A 1TL7A 1SB6A 3V81A 4XO0A 5L46A 2E29A 4DR3F 4YR2A 1YBAA 2ZH6A 3PYGA 1VK8A 3KG4A 2GMLA 3BGFA 1HKAA 3GCWP 1CJVB 4ZLPA 2VC1A 2FHOB 3P45B 5F3ZA 1VQ6S 2XWYA 1KVJA 1IBLF 3GIIA 1MG7A 5K20B 3BN4A 3R7NB 5AXKA 3KLEA 2CQBA 4B9LA 3OXGA 2H51B 1GNKA 1J5EJ 4WXWA 5IT0A 3LF0A 4K59A 3BQ2A 1MN9A 2AJ4A 3MMCA 4PPDA 3LP2B 4ED0A 1F2GA 5ETRA 2CWXA 2ATLA 1TUGB 2H5JB 3QGPA 2XQCA 3AXMA 1FHTA 2XB2D 3UDVA 3NGRA 3QMQA 2ILZA 2AQ4A 3DDKA 4HT5A 3WC2A 4DF8A 2FJAB 4QQBA 3MFIA 2B56A 3DRSA 3PYFA 3P49B 2JVRA 2BE2B 5KT3A 2BE9B 5CYMB 5T14A 1TK0A 1NB2A 3PR4A 2R7UA 1RTIA 4RJVA 1R0CB 4LFCF 2Y9HA 3W2VB 4GO7X 2KTQA 5LM7E 3UNGC 3L7PA 1Y5IB 1XC9A 3BN7A 3A3OB 2F5GA 4RW9B 2UVUA 2VF3A 4Z7CA 3H8YA 1HBOA 1SQEA 3NKYA 3SCIE 1X5SA 1XTZA 3AJ1A 2CQPA 1T95A 4MFBA 1CEZA 5KG4A 1A9NB 2JX2A 4ZP7A 3FMWA 1NCLA 2QO3A 2W7AA 1U8WA 4RR5A 4CO4A 4DXLA 4TNOA 2RRNA 3OBIA 1V6HA 1S4FA 4CLFA 4URQU 1RZMA 1TAUA 1IM4A 5LSOA 1JLQB 3DMJB 2DPIA 3SDEB 2VONA 4NLGA 4Y3CA 3CCVS 2NXJA 1L3KA 2KHDA 4A47A 2Q66A 1LQ9A 4OLOA 2PT0A 3UVJA 3ZTRA 4N41A 2Z8QA 4AQYF 4DV0F 4Y2CA 3US5A 3B4DA 3O8WA 1KVKA 3DRRB 1NK7A 5CABA 3QPIA 2H4WB 3MPUB 1F5BA 4YY3F 5DGAA 2LECA 1RHRB 2MSSA 2V2QA 2EFGA 4NLDA 1SV5B 3R6GB 1NKEA 5DDQC 4HH0A 4EZ9A 3DDNA 1CSJA 1HQ2A 2ALZA 1FO1A 1HNWF 2VD3A 4DV7F 4B02A 2G2ZA 5J1EB 3MPYA 1REGX 5J2NB 4OHYA 5RUBA 2FPHX 3W61A 1RWWB 4URGA 4DCJB 4RZRA 2J5AA 4XPEA 2VQEF 1P27B 2Q6BA 5I3QA 1BWVA 2DO4A 4JI2J 3EX7B 1DZ5A 2ZH1A 5JUMA 1GMVA 3JQMA 3M2RB 1F2HA 2DO0A 2AGPA 1KOOA 4EMDA 4LR9A 3N0VA 1U2CA 1JXEA 2IHR1 1U25A 2FHKA 4OYAA 2W1BA 1YDLA 3HMJG 1WI6A 4ZVSB 3OUYA 1GTHA 1AW0A 3IP0A 4ID5A 3QSIA 4WF9Q 2OSQA 5KFXA 4KGVB 5C42A 5E3CA 2IM3A 1EQ0A 1N6QB 3OLBA 5D78A 4ZN1A 4HHHA 1H2VZ 4YDXA 4HKQA 3LTOA 4KFBA 2C2KB 4NI2A 3K2YA 4P71A 5ETNA 3R2DJ 1HBNA 3QO9A 2VU5A 2HNYB 1IWGA 1MROB 4WJBA 3MUVP 3AB4B 1BHNA 4C0BA 3FSXA 4NLQA 1N36J 3AHPA 1NHVA 2YWKA 4C3KA 2X51A 3ZZRA 2PI4A 3BH7B 3I5AA 4QPTA 1VS3A 1TV6A 3IS9A 2C3MA 2ZD1A 1R7IA 1N34J 2GO8A 3K5OA 1JX4A 3GYGA 2WSCC 1NM2A 3MTKA 4MK8A 5KFYA 2HVHA 1LKZA 2FLNA 1YSJA 2HG4A 4J91A 4UF4A 1F9FA 3PDNA 4OV6A 1S9FA 4ELVA 5C2GA 1KHWA 1F1BB 2RDJA 4NEZA 1ZZNA 3FRYA 3TAMB 4USWA 3PACA 2C2EA 2H65B 2VA3A 1JJHA 5IS2A 3CCJS 3BSAA 3QT6A 2M8HA 4GKJF 4CYUA 1TAQA 3CJRA 1RWNB 3J80Y 4OYZA 3PR5B 2ZM6J 4ANEA 4OYMA 4DCPB 3KLIB 1ICEB 2YX7A 2XULA 2I1RA 3A3PB 5CZXA 1VQ5S 3CPWR 4X66F 4USHA 2AJ0A 1B7FA 4PXDA 2B5JB 5L9NA 1KN6A 1FVQA 4DR1F 4QW9A 1AFJA 4BS2A 2KZMA 4LREA 4KHPF 3IFEA 1FT8A 2MQOA 2XO7A 2HSEB 3MCOA 2Z2YB 4HEA9 4M5IA 4C8OA 2F4VF 2MPUA 2WBMA 1B0PA 2QLBB 1VQKS 4DR3J 2DNYA 1JLCB 4X4QA 1RT5A 4RNHA 3VHQA 2J6UA 3JQKA 4I64A 3QGGA 4CLUA 2C3UA 4UOHA 4N56A 2IMOA 1FK9A 2ZOMA 4A8SA 3D28A 1UZHA 2RU3A 4MYUA 2KU7A 3TUZC 1LWXA 1V5VA 4J9SA 5HQMA 4X4NA 1IBLJ 2GHVC 3JTNA 4GKKF 4ZJLA 2OPPA 1TL1B 1N0VC 3CW2C 3ENQA 2W8KA 2J7WA 3CCWA 4IFYA 5AJ3F 3KHGA 1IQTA 1Y3JA 4ZVOB 3G8TA 3P5TL 2RNEA 2C1EB 1YI2S 3I96A 3AODA 4RU9A 3UI3A 2YWHA 2R7TA 2HWIA 3JSRA 2NPFA 2R7WA 4EEYA 4FYVB 3BSCA 2GW8A 2M7SA 2M9KA 2JEFA 4O44A 1FNXH 4ITSA 5MLCV 2DR9A 2KXHA 1G1XA 1VFJA 3H7HB 2CPHA 2WONB 4AL6A 3AQOA 3IAS9 3KK2B 3PFEA 5A2QU 2W25A 3BGLA 2NSBA 5HP1A 3NOGA 2R7OA 2J9DA 3BSOA 2HBRB 2MQNA 4LFCJ 2OEKA 3KLHA 3D7SB 1FRXA 3LP0A 1YBTA 2ALYB 5KFAA 2CG8A 1FKOB 2FVQA 2ACMA 4G3IA 4CO3A 4YDDB 3O44A 3FFIA 1UP1A 4E8UA 4ECVA 2V9WA 1U7LA 3L3CA 1LNQA 4TVAB 4UZCA 1XMQF 1UVNA 2FD2A 5B09A 1HNVA 3AOBA 3IBCB 4TKTA 5GMDA 2AEFA 4KKOA 1HMVB 3DXSX 4ZDNA 5B0CA 1HWKA 2GNKA 1ZAXA 1AUDA 2QE5A 3U7JA 3T1HF 2DNHA 2B4OA 1FRMA 1BC6A 1H7XA 2IAJB 1HBUB 3MR3A 4D3HA 4HHJA 3K57A 4NLUA 3HHLC 1UEUA 5FLXU 4KY3A 1KLMB 2DR7A 2ZOGA 2CNOB 3VAMA 3QGIA 5HJXA 4WYLA 1RHJB 3Q83A 3PXGa 3PW5A 1XNQF 1O8BA 4OZ3A 1SH3A 1Y10A 4AQYJ 2R7VA 4DV0J 3KDOA 1AZSA 3JYTA 3GYNA 3K5NA 4LF1A 4PQAA 3Q0AA 4JB8B 4ECZA 1YRXA 3KJFB 3M8ZA 3CCMS 1TL4A 2WB1D 1LEOA 1EIYB 2QFJA 3W2WB 1RAHB 3TUIC 4NLSA 3H42A 2IC3B 4YY3J 2WOMA 5KFFA 3HM9A 2QRRA 1HD1A 5F8MA 2CAJA 3OTCA 2P6SA 3IAM9 2MKIA 3KLVA 2XGQA 3ELHA 1O0PA 5B0GA 2K2PA 4DV7J 3QSYB 1K1QA 1OJ4A 1A7GE 1KONA 3G6ES 3EXCX 3HHKA 2ZHAA 1Q79A 3L7UA 1JJ2R 2VQEJ 1UA1A 2HK3A 4P72A 3GJQB 5I4MA 2FHJD 3MECA 3W3SA 1UVIA 1CJTB 2KI2A 3CD5A 2OGUA 2HNDA 3CUNA 2DGOA 4XDCA 5K5MA 1U6BA 3BQ0A 5HQ8A 5D0GA 2MZ1A 2DPJA 2VBWA 2MY7A 3D6HB 1RAIB 1XMBA 3LA0A 1I1GA 3T9NA 5KT7A 4X4PA 2MLZA 1AT1B 1NK8A 4ZLNA 3MAAB 2FHMA 1NU4A 3TAPA 3HLUA 3F41A 3QRRA 1T05A 4FXVA 4K0KF 4M8LA 3QLHA 2K1RB 1S1WA 3FRZA 3H40A 4PWDB 2WW4A 3M05A 5K8MA 1DAXA 1HWJA 2JHEA 4TYBA 1T02A 3I4HX 1X4CA 5HROA 3RAXA 1R8HA 1PG5B 1S6OA 2ZUAA 5BXIA 2M8DB 2HYIB 2XEXA 2DXEA 3KUHA 5IT9U 4J37A 2LCWA 2CPFA 3VZIA 3I56S 4KPCA 4NOHA 3PHTA 3G8QA 1SIWB 2MQQA 2B6AB 2IRXA 3V4MA 3KNGA 4PCQA 2AW0A 3PX0A 4I67A 2W01A 3GFHA 4OFZA 4A8MP 2G9OA 2OPRB 4QIFA 5AT1B 2VFUA 3RYLA 4USTA 3HSGA 5A8KA 4KPYA 1GX5A 2EXUA 4FVCA 2Z56B 1U26A 4UUXA 1ZBTA 4Z2XA 2QC3A 4DR4F 2XS5A 4DR2F 3I9V9 3KUGA 1BQMA 1JNRB 3DU5A 3RB4A 3J7ZT 3POTB 3IGNA 3LPYA 1C0TA 4WIQA 1NDCA 2G1HA 3SBMA 1HHTP 3R5DA 3OFGA 3JSMA 2HNZB 2ZH7A 3TQ1A 2CVEA 2FJBB 5C24A 4C97A 3TJAA 1S0NA 2P5VA 5J2PB 4GKJJ 3V4IB 1DARA 2RDDA 1MU2A 1SUQB 3MR7A 3PW4A 2EFPA 3CE8A 3R1LA 2DNPA 3UNYA 2Z30B 3PRDA 2OEJA 2AX1A 5U47A 5L8RC 2JVOA 4C9DA 3O2IA 2RJZA 4A8QA 1RLDA 4X66J 4FNHA 3BBCA 2UU9F 1OIAA 3AOCA 3EZOA 4DR1J 2QA4S 1OPZA 5CH7B 3K58A 4K4ZA 2GVDA 4KHPJ 4YEAA 2B51A 5A8WA 1RADB 4B9UA 3EGVA 3MM9B 3HVTB 1JIHA 3OTEA 2MY8A 3LAMA 3LH2S 4ED1A 2YNGA 1KQKA 2QLJB 2B9EA 1ZPWX 2F4VJ 4HI1A 4LSZB 2AGQA 3DC2A 1X31C 1W7WA 3JSBA 2IYGA 5KG3A 1X4AA 4EK2A 3GU0A 1IR0A 1RHKB 3TJ9A 5KG7A 5L1LA 3P96A 4DCOB 1AROP 5D0RA 1A6LA 2AYEA 1WTBA 1QTMA 1VMBA 5T7LA 5H9FJ 1NJIT 4U6PA 3D4JA 5J2QA 2V8HA 2VJUA 2ZE2B 3G82A 3MURP 1UWBA 1R6YA 1S0MA 1WOPA 2ZBCA 1AA1B 1LWFA 4LR7A 3W62A 2XG8A 1KFDA 2W2PP 2D3OR 1WUUA 3UO0A 6FDRA 5AJ3J 4ECUA 1QSSA 2RSQA 4ED3A 3QATA 3BO3A 1UW9A 4LR8A 1JLAB 3TVYA 2V69A 1PILA 1IJFB 4RW4A 1FRHA 4K4XA 5B7WA 9RUBA 3PG9A 3CDUA 3WC0A 4WFNQ 2C3YA 3GJTB 4WE1A 1RTDA 1V3SA 3P4UB 2HFVA 4IH7A 3M8RA 4MAKA 3UCUP 1UL3A 3BBFA 5I42A 2ZBPA 5DZ6A 2NYIA 4B3OA 1U1QA 2GMHA 4P6QA 2QSWA 4QIEA 2R7SA 4Y28C 2YPZA 1EAYC 2HBZB 1UFKA 2ASDA 2PMZD 4TLQA 4CLLA 3A8IA 1H7WA 5AE2A 3SMZA 1S77D 4RBVA 1OY6A 4Y2KA 2CUYA 3HSDA 4ZHRB 5IT9Y 2EKYA 1XMQJ 3AD8C 1LWEA 2RDIA 4OX6A 1Y9OA 1U1MA 1S9GA 3DI6A 1HI1A 2W2NP 4IQXA 2ZWPA 3IR5B 1EZZB 4N5SA 2JLEA 3DM2B 4DR6J 3I55S 2D74B 4LRAA 1XR7A 2Q1LA 2YX1A 4DQRA 4J7CA 4B3RF 4DFPA 3QT8A 3NG8A 5D3GA 5THWA 2XLKA 4LT6A 1NRKA 1SCJB 2VG6A 2DH9A 1JWWA 3G6YA 1TZ0A 1MSWD 2JC0A 2H54B 3AJ2A 4DX5A 3S7RA 4OI4A 1UA0A 1XNQJ 2IPOB 3PKYA 1M1HA 3KLGA 5JJBA 2YNIA 2XGPA 1G4CA 3UDLA 3D68A 2ZITA 3DOMB 1N5SA 4Y00A 2OSRA 1HHSA 2HAFA 3I82A 3TO8A 4K4VA 1YX2A 3ILOA 3MM6B 2Z0GA 4JI4F 1N32J 5DG7A 1NB7A 3M6WA 2A6OA 2B3TB 4ZPTR 2QTWA 1HBMB 4IUFA 1CS4B 4FF2A 2DY1A 2QSFA 2W7OA 4GC6A 2XC9A 1ZA1B 1RABB 4KGKA 2PEHA 2W2QP 4LRCA 3G9CA 3GR0A 1NZAA 3N01A 4FYWB 4K4UA 1Q16B 5HAOA 3WX8A 1CJVA 4KRWA 5HO4A 1A0OB 1IM6A 4LBHA 1FNMA 1GX6A 3HSZA 4PG4A 3LO3A 2UVVA 2V6AA 1VOMA 2CQCA 3KFWX 5CCMA 2OP5A 1SXLA 2K7KA 1FDAA 3NXZA 4ZJOA 5EWGA 2YNFB 4K0KJ 2MB0B 5CA5A 2IM2A 3UR3C 4Q8EA 5JVGQ 3LP2A 2ZZNA 3G8SA 3SQGB 2ROGA 1KVIA 3R7BB 2DR8A 4OJHA 3HHDA 2RHQB 4XTTA 4OX7A 3IG1B 1LW0B 2XSFA 3KMSA 4LBPA 3WZ0A 4U96A 1QLNA 1GH8A 1T8EA 3BGOP 2LXUA 3IM8A 2BE2A 2DCUB 5CYMA 3EICA 4FZVA 1HW8A 2HFOA 3UD3P 3TZXA 1U24A 3D6FB 3W2VA 3M8PB 2YY3A 3DLLQ 3V5RA 4NLVA 4BC7A 3NNHA 4DR4J 4NCGB 3MMBB 2NCKL 2A10A 4RW9A 4DR2J 3DHXA 3GWCA 4NYOA 2JL9A 1ELOA 2A3JA 4KAIA 1FWPA 1YQHA 5F9NA 4XK8C 1Q8KA 3TEHB 4KGXB 1WC4A 3AY0A 1SKSA 3MMAB 1VHFA 3D0HE 5KFHA 4F26A 2F8HA 1QD1A 5KFUA 3HX9A 3TW0A 4PEOA 4PG5A 1IKVB 4L3NA 3C2PA 2KG0A 2KKHA 3CCES 2KZZA 5CYQB 1S99A 1JLQA 3SDEA 2OPSB 5DDRC 2CQ4A 5AXLA 5L39A 2CZ4A 3D3BJ 1UJ4A 2DGTA 2B4VA 1WEYA 3W9IA 4B08A 1R27B 4F4KA 2XNRA 4DL0C 2UU9J 1U49A 1PKUA 4NPOA 3DRRA 2RRAA 4H4MB 2E1MC 4QR1A 1URNA 2KJVA 4JV1A 1HNXF 3VVTA 1SV5A 1HR0F 2DHHA 2D3O1 2WSEC 3Q8PB 2FJDB 4RX6A 2N7YA 4H54A 2G2OA 4QU6A 4X65F 2B0GA 4AUKA 5J1EA 5KT6A 4HTIA 3G2XA 2LYVA 1X4FA 2ZJQQ 3BKFA 4KH0B 3RR7A 4YB6A 3OR2B 4TXSA 2JLFA 4CH7A 3GV5B 4NLTA 2UVRA 2V0NA 2V2VA 3JSYA 3M2RA 3QJPA 3FCHA 2P9EA 2V94A 2QZ8A 2YKNB 1HIYA 1J27A 1ZS6A 2ZKTA 3EGZA 2GFFA 4IDKA 2MSTA 3NS5A 4LFBF 3X3UA 4CT9A 3BBBA 3JAMU 2I5JB 3IR6B 2BKOA 2R8GA 1LK7A 5A8RB 4Z37A 4WBFA 1TKZA 2Y8YA 5J2MB 3IXQA 1N6QA 4U7UD 4F4XA 5EDWA 3CJSA 2HVZA 5F0UA 3NGSA 4ECYA 3PW2A 1CULB 3DLEB 2HNYA 1ZOTA 1MROA 4ZJQA 3C46A 2KFYA 1QTNB 1H2TZ 1RYRA 5A6WA 3ZTOA 4DV1F 3D6TB 5G4DA 3IRWP 3ZZOA 3IO1A 4ZK7M 2EVZA 4EO8A 5CD4H 1UVLA 1FEHA 3MM8B 2RAQA 2ZVSA 3IA0A 3M6XA 4Y2MA 4WFBQ 3GIMA 1HA1A 1P1TA 3OJSA 5F8LA 4LRBA 2WVBA 3T6JA 2CYYA 5DLFA 4PAAA 3R5JB 2QMUB 4CLKA 4DR5F 4CCHA 1SJRA 1FDBA 3K5MA 3H5UA 4G1PA 2NXNA 1PGZA 4IQMA 1IVZA 4AT1B 1RTJB 5KFDA 1T03B 1JLEB 3TAMA 2GVZB 4AL7A 1NPPA 4WK1A 1ZTWA 3MPWA 5E2QA 3CDEA 2A2CA 4KGZB 4C48A 1OQ3A 4YP3A 4B3RJ 4JI3F 4TQSA 3MEGB 2QA2A 4FS1A 1YHQS 3CCLS 3LGNA 4PXCA 3NWGA 4QJVA 4WPAA 2J9DE 5KFQA 3M30B 2R3VA 1NKBA 1K73T 1DTQB 3KLIA 1FXRA 3ZNUA 1R8BA 4ZP6A 4FF1A 4P75A 3PW0A 1Z2LA 1Q8IA 2B5JA 3TVZA 1RGVA 4Y2AA 3W5YA 3SCLE 2F7VA 3P3DA 5DG9A 1V5IB 1Q5YA 4JI4J 7FDRA 2OHDA 1RDRA 1YJ7A 2HURA 4U95A 2HHVA 5KOWA 3U1MA 3ISZA 2OAUA 3N79A 4KV8A 5F41A 1JLCA 3CJ4A 3PTWA 4CTAB 2V8VA 3H5XA 2VOOA 4ZVQB 1CQNA 2AYMA 3BGUA 4C3MA 1VBXA 3GPAA 4ED5A 3M32A 2CKWA 1W26A 2BBEA 2JSXA 1D1UA 5KT4A 1HW9A 1B70B 1B3TA 2W24A 2XYGB 4KO0B 3R1HA 2Q3PA 1Z2ZA 2W4PA 5C7PA 4RPFA 4NZ7A 2BJDA 4OYIA 1GT8A 1X4GA 4C3LA 1HD0A 1RHQB 3BGRB 2HHPA 1S72S 2A6MA 2O3DA 3KJVB 1BE4A 2C2OB 2RU9A 1TL1A 3KLFB 3NNCA 2AU0A 2FTRA 2E7XA 1FE4A 2CJAA 3Q8SB 4OYBA 1KDNA 3C3LA 3WDOA 4LFAF 4OX9F 3L09A 1NSPA 3RBXA 2NUUG 1K0TA 1MWYA 1SQGA 3FK4A 3SYZA 2LQBA 2F3JA 2GHWA 3KXDA 1BGXT 2KG1A 1UMJA 4X64F 5KFOA 1XMOF 1FX4A 4J9RA 2WONA 5IWAF 2XZDB 3HZEA 1U6FA 1GEHA 3KK2A 1RT3A 2WZ1A 2HIQA 1VIOA 4F7VA 1RT6A 5CCLA 2MQLA 1EB0A 3TOQA 4NRUA 1FJEB 2CJXB 2DD8S 2LKZA 2P8IA 4ILRA 1FKOA 4KR0B 5LSLA 3QBCA 5BJRA 1G7CB 3PFOA 1NJYA 4CLYA 4DL3A 1YG0A 4LF4F 4ELUA 1REVB 5D4OA 2VFVA 2HFSA 1NAQA 3UD5A 3PRBA 2BRLA 2CQGA 4ZIVA 3HXMA 4MKAA 3QJJA 2I0XA 4PYAA 1T7PA 3UWTA 3V6JA 4FDFA 2LEPA 3NS6A 3GTYX 3LAKA 4JUZA 2FLPA 2UV8G 1HMVA 2GQCA 3I0SA 1GMWD 4DS4A 3D1OA 2DITA 4IG0B 2DNZA 1HWUA 2HQCA 2AZ3A 5KFEA 2HHTA 2IAJA 1HBUA 1R31A 2XS7A 5B0BA 2KRBA 2HQGA 2HQDA 1SC6A 2IMWP 2H48B 1KLMA 4RUAA 2K8GA 2ATCB 1M0SA 2OFHX 4KB7A 3TANA 2VUGA 2DNLA 1C4AA 2AT1B 1SPBP 4C8MA 4NXNF 4M5HA 1RWVB 2GAHC 5EX0A 1M5OC 3ET6A 3HO1A 2D3UA 2AZ1A 2UUBF 1XR6A 2IY5B 4DF4A 4DPUA 1Q78A 5B0AA 1U1OA 3W2WA 2X1FA 4K4TA 2J0QD 3BS9A 3ENVA 4DV3F 1HNXJ 2VBYA 2CG4A 2QFIA 3RBZA 1HR0J 1NEEA 4DJBA 2Z4PA 4O0NA 2AV5A 8ATCB 3HK2A 4C8ZA 5I3PA 4X65J 2HQFA 2ZH4A 2LFVA 1NXIA 1HYSB 2MLYA 1J5OA 2CJKA 4PRFA 2ZC4A 5FIIA 1T9TA 3FNNA 4ETXA 1IR1A 3PEJA 1N5VA 4KHRA 5KFNA 1FFWB 3T6BA 2W4CA 1F60B 1MW7A 1VRUB 3DLGB 1OY8A 1C0UB 3PM9A 1BQNB 1DQ8A 2JZ5A 4HHUA 5AXNA 1YITS 1URRA 2D9PA 1F9HA 1CLFA 4MIBA 4I56A 2F63A 1KNZA 3DGPB 3K8WA 4MT1A 2FUG9 1FKPB 3MAAA 2JC1A 3W8GA 2WBRA 4J9QA 1YIJS 2K1RA 4ES3A 2DGXA 2BDPA 4J9OA 4PWDA 1BQXA 4RW8B 5FDLB 4WU3A 3KHLA 2EC0A 2JWNA 1SC3B 3FBFA 4OZ5A 2ZOFA 3MEEA 1RU1A 1M1GA 4UTGA 1F5CA 5ETPA 3TR5A 4DOZA 1OMSA 3MPVA 2DNRA 4DV1J 2HS0A 3I31A 3UW1A 1S1XB 3PIOQ 3AJDA 4USKA 5DRKA 2B6AA 2HZAA 1IKXB 3R6LB 1KWMA 2G1DA 4K5SA 4K50A 2C2MB 4NEYA 2X3GA 2RQCA 3FMBA 2OPRA 3OD2A 3QFWA 2QEXS 3CJKA 2HLUA 2VG5B 4K2JA 5IV4A 4OZ0A 3RG6A 1YJVA 2BM1A 2HZVA 1DQ9A 4YB1P 2M88A 1SVDA 4DR5J 3HT0A 1UVKA 3OR1B 3POTA 4FN5A 3ULHA 4RUBA 2V2KA 1IJEB 5ETQA 4LF9F 3ENWA 4IRCA 4ES2A 1WELA 2HNZA 1Q53A 2VA2A 2R2TA 1QVGR 5J2PA 2CIMA 4JI3J 3V4IA 4CH1A 3IGVA 1NLKL 3RAMA 4J9PA 1FCAA 4OMFG 1S1TB 1S0OA 4A8FA 2G4BA 4RNOA 4ALZA 2I9SA 4TY8B 4M63A 5ETTA 3MMJA 2KXFA 3CMQA 2C42A 1R8PA 3L95X 2OD6A 2VODA 4PQUB 5DDOC 1ZA2B 1UTAA 3W5XA 3MM9A 3HVTA 3I9ZA 3NMAA 5D8HB 1WKLA 4KYZA 4WIIA 3C14B 4JI2F 3WX4A 5L9XA 2YKMB 5LMNF 2E66A 1QSLA 1WKJA 3I0RB 5H9FK 1QUVA 4ZLJA 3I87A 1D09B 3SI8A 4NA1A 3SSQA 3OLAA 3QJLA 1D8ZA 2G0CA 2HFZA 3NCQA 4OYXA 1VISA 5KT2A 3QT5A 4CO1A 4CNZA 3ILLA 4P10A 2ZE2A 2YTCA 1NSAA 3NWRA 2B9YA 1VQPS 4FXDA 2MHNA 2J6TA 1KTQA 1ROFA 1X0FA 3FBEA 2Y1LB 4DG1B 1N4LA 1VBZA 3TYTA 4IR9A 4U7CA 2NPIA 1UJ6A 1C1CB 4LFAJ 4OX9J 4F3OA 3V6DA 2OLWA 4K2XA 3TQEA 2L08A 1W25A 2D69A 4ERDA 5DQHA 2UUWA 1NNDA 2NXCA 5DDPC 3NLCA 3J7Z5 3C15A 2QIFA 4X64J 3FKBA 2RS8A 1XMOJ 1N5TA 5IWAJ 1K44A 3MI7X 5H1SV 4O3QA 2BKNA 2DHXA 4IH5A 4WP8A 3IWNC 2FLLA 2VOPA 4LQ3A 2WCXA 2GV1A 3Q2SC 4OZJA 4X4RA 1SJ3P 1LWCB 1H2UX 3LALA 3BPDA 1TMJA 4LF5F 3AD9C 3L9ZA 3TWZA 7AT1B 4FKYA 5DQIA 5KG2A 4MMOA 2BZ2A 2LQ8A 2VFTA 3LW5C 2XMJA 3HVWA 2LQ5A 4C98A 3FVYA 4ZHRA 3CD6S 4PXBA 2Y1IA 1BWEA 3QIPB 3ZTQA 2KRRA 3X1LB 2EI5A 2F1FA 5DZ7A 3DM2A 4OZ1A 4NXMF 1Y0HA 2VL1A 4QIWD 2PI5A 1NK4A 2JEIA 1Q81T 3OQ2A 3TARA 4JP8A 4B9SA 3CULA 1Q95G 1H38A 4PWUA 3W9HA 2AJFE 2QMWA 2VBZA 1YJRA 2E9TA 3K0JA 4PUOB 4NA2A 4NRTA 3TX8A 5HN0A 1RTZA 4YUDA 4M5LA 2LU2A 4NXNJ 5KTQA 2RS2A 4QIVA 2HAIA 1RISA 1VGYA 4C0OC 3DOMA 2GZOA 4UZBA 2OMLA 2UUBJ 2C2RA 4KC5A 1EKRA 1RA7A 1E6YB 4FF3A 1Q8LA 1U8SA 4C4WA 1R8AA 4DV3J 3G71S 1F9EB 4M5DB 5D0HA 4HYKA 1XIQA 1HBMA 2KFZA 2BJ7A 1CS4A 1JXLA 1HNZF 3FDSA 1N5QA 1QE1A 2FYXA 4MYTA 4J9LA 2DR5A 2V4JB 3CJQA 3BJYA 3BB5A 2DISA 2COLA 4NLOA 1H0HB 2M52A 1S10A 4I68A 2KYZA 3GCXP 1UFWA 1YJNS 2HHUA 3QO9B 3MEKA 4L3KA 4JBCA 1CJKB 2CJQA 3QAUA 1NJWA 4QU7A 4NYZA 1GMUA 4Q0BB 3VV2B 4P9SA 2YNFA 4X2BA 2PFFB 2YXLA 2UV8A 2PA8D 3KUEA 6AT1B 1Q5VA 4YB7A 3C6TB 4A4JA 3DOLB 2ASLA 2BKPA 3SQGA 4YFUA 3EDQB 2VKZG 3H2UB 3AXKA 3MF5A 3FSIA 5KG5A 5JVHQ 4FKXA 2V4RA 4ECXA 4QPXA 1JB0C 2XHCA 4I6WA 3IG1A 3TAQA 2MLXA 3UFCX 4CM2A 3H4BA 2DHSA 3ONQA 1S48A 1ZH5A 1JMTA 4RUCA 2FVPA 2W9AA 1QAJA 1B7YB 5HL7Q 2IDEA 1SI9A 2R7QA 1CG2A 3OSPA 1ZM3A 3QAEA 2DXDA 3HKWA 1FI4A 3CIMA 3EPIA 3K7RA 3M8PA 2VH7A 1E6VA 4FYDA 4UY8T 1S4EA 3BDPA 4NCGA 3MMBA 4RNFA 3G86A 4QYRA 4AYBD 1TFYA 1RU2A 3DLKB 4OI2A 3GG0A 4LF9J 3N6NA 3NBPB 3NCRA 3MMAA 1U48A 2QT7A 4ANDA 3GP9A 5T41A 3UR0A 1IKVA 3ZZ0A 4OHZA 2E1RA 3EXYA 4IOCQ 1XN9A 1X5PA 5CYQA 3DGVA 4OJ3A 2SXLA 2VC0A 2LDIA 3MHYA 4Y34A 2OPSA 2DNMA 4DZDA 2P2CB 3QGHA 1ZPVA 2PE8A 3BH6B 1RT2B 2C2DA 4KQZA 2PA3A 3KK1B 2LXIA 1KD1T 4OI1A 1CVJA 3R7SB 1TMMA 1KEKA 2BOPA 1UCNA 5GADU 4N8OA 1IBKF 1IN0A 1WDTA 1EETB 1DJ0A 1FK9B 3PHEA 4CQ1A 3H25A 2CWKA 2C3OA 3MM5B 3ISND 4I7FB 5HMZA 4MK9A 4HLBA 4H4MA 3HHLD 2Q43A 3T9ZA 1RLCL 5DJBA 3OFHA 3R97A 1R8CA 2HIYA 4RBTA 2JEGA 4PG7A 4JI1F 4USJC 3DCAA 2DRBA 3TUPA 4IH6A 5LMNJ 4ZKAA 2Z2ZA 3OR2A 3OSNA 4OHVA 1RAAB 4EYIB 1ZM9A 2FJVA 4J9MA 1TFWA 2ZJRQ 2F4FA 3AQPA 3WBZA 2XCPA 1V3RA 4FYXB 2E5LF 2IRUA 4WZMA 2YKNA 1M5SA 4DX7A 3M2UB 3LUYA 2R7XA 3QIDA 2CPIA 1R3NA 1S6QB 3OHBA 2W7PA 3HJVA 4O4GA 2QA1A 1OS5A 1UWAA 2I5JA 3NNAA 1WG5A 2W9CA 3H59A 2QX0A 4N77A 5A8RA 2EFQA 2XYPB 4ZPDA 5J2MA 4PABA 5MAOA 2O1PA 5D4LA 4M94A 3V6KA 1FFGB 5KG1A 1RUSA 2GAGC 3BF4A 3LOUA 3I5CA 1CULA 3DLEA 2G0JA 4DPYA 4GMKA 5HQLA 4GVLA 4C11B 4IG3B 1V3ZA 3LPEA 3U27A 4OYOA 3DRPB 1OWXA 2J7UA 1H74A 2XMMA 3A8EA 1ZTTA 4F4YA 4ZVEA 2YNHB 5GAEU 3K5PA 3HHLA 4I6YA 2C2NA 2AYGA 3MM8A 4CDIA 4DL4A 2XMAA 2OTLS 2ZUGA 1U1NA 4LF5J 1PBAA 1YTYA 1FEEA 3QZ7A 3W64A 2O66A 4CLWA 4DMZA 2KHCA 5E5NA 2GS8A 4IFVB 5B0FA 4GRSA 1VJWA 4AE5A 3PYEA 2Y1RI 1VCTA 2Q6CA 3TNVA 4C7QA 1HI0P 4CH0S 4ECWA 4K4SA 1GAOA 4U7UK 1FD8A 2HRUA 1B99A 4KH1B 3TRGA 1FXDA 1UPPA 3KKFA 1RTJA 4WFAQ 2CPYA 4LBIA 4ZVUB 1T03A 1JLEA 2MQMA 4QWCA 2GVZA 3BR9A 3PJXA 4NXMJ 4NCAA 1Y00A 4DQQA 5EGYA 2DR6A 3H5YA 1PJ6A 4G65A 5CD4A 2BR0A 3MCNA 4DL5A 2OH2A 1LFWA 1TUVA 4NA3A 3MEGA 4Q2MA 3UE2A 1K8AT 1RE1B 5KFTA 4IYQA 3VGUA 4M5GA 4B9NA 3FEYB 1DTQA 2MXYA 1RT1B 4O3RA 1FJ7A 4USUA 4FPIA 1PIEA 1DLOB 1RTHB 2RF2B 2L41A 1WC0A 3MCSA 5ETLA 3GIJA 2HGLA 1KRPA 2FQQB 4KGMA 1G6BA 1VRTB 3DDIA 3M8SA 1NKCA 1Z1ZA 3M1VB 2R7RA 4LSLB 5KFZA 2H1YA 3BKUA 1F3FA 5D77A 1HNZJ 1RAOA 1HL6A 2J9CA 2ZDPA 3QNWB 4CTAA 1RT7B 3H2VE 3RU0A 3O3LA 2D7SA 1I6JA 3CXCR 2BM0A 1U1KA 2V34A 1N52B 2E7VA 4C8KA 2UUTA 1EKSA 1H72C 4KO0A 3L7OA 1U1PA 4DX8H 3MEDA 4DV2J 1F3VA 4F3QA 1VDHA 2N3LA 2FJWA 3CTRA 2CJBA 2GMJA 2V8GA 4ILLA 3GIRA 3KJVA 5IOLA 2E5HA 2YWGA 2JFKA 3THVA 2RMLA 3KLFA 1S79A 2CQ1A 2NZ4A 3R27A 2BABA 4O3SA 4DQIA 4Q7AA 1WF0A 3V6HA 4RNMA 4ICLB 2LQJA 3H90A 4X4TA 1BXNA 1KC8T 1KQGB 4DSIA 1I5OB 2GJ2A 2V63A 4OV1A 2NQPA 4I1TA 1DBDA 2DT9A 3CWJA 3MTJA 2BA9A 2CQDA 1TVRB 1ULRA 1EHWA 4ED4A 2YH1A 5F9LA 5HSPA 1UVMA 2C22A 1GK8A 2MZJA 3HD2A 3NGUA 4NYPA 4TN2A 2IRYA 5GAGU 2FLOA 3MZIA 4WU2A 4CO2A 1WC5A 3RBDA 2V2ZA 1AB8A 5H9EJ 3L4BC 1OSDA 3N4WA 3PX4A 3MGJA 4DR6F 3H5SA 2UXBF 2H4YB 5CZVA 4F3MA 3ZO7A 4L75A 5EHHA 1REVA 4JV5J 4ILMA 3ISNC 4EZ6A 1EX8A 4NMLA 3QT7A 1N56A 1M5VC 2WRMA 2GJFA 5EWEA 2O01C 2HZCA 4WYWA 2XNQA 3VAKA 5EN1A 6FD1A 2ZH5A 4IG0A 2V5HG 3NEKA 1HQEB 3CCQS 2XS2A 2MYFA 1IR2A 3PO5A 5DQGA 3EM1A 1RI7A 4R8UA 4QWBA 1N32F 1FFSB 4UT4A 1QDUB 2DGVA 1IBKJ 1FVSA 3F73A 3CD7A 4USVA 3Q8VA 4G1IA 1H98A 2EBEA 3JTPA 5F8JA 3VWSA 2DGSA 5BYRA 3CMAS 3CCSS 1JLBB 2HGNA 2X1GA 3GR1A 4BBYA 1RK8A 2DNKA 5B0DA 1S6UA 1NH7A 1IKWB 1YGYA 4PG8A 1RKIA 2XI2A 3CJ5A 4JI1J 3DN9A 1LWFB 1RBAA 2HEKA 3PW7A 4NL5A 2V9KA 2XMVA 4I2PB 3CC4S 1AFIA 1YRTA 3TA2A 4DU7A 2Y1JA 2MKHA 3ADAC 1LOUA 4ZN3A 1HYSA 1T94A 4X4SA 2HVDA 2GC8A 2JOQA 3V2UC 2OJ3A 3VGVA 1WOOA 2OPQB 3DRXA 1D9AA 1L3UA 7FD1A 3K17A 2Y3YA 1TKTB 3GMGA 2R8JA 1VRUA 5GADI 2VBXA 2CQ0A 3DLGA 2E5LJ 1C0UA 1Z4UA 4DI6A 1BQNA 4WE1B 3FBBA 2V4QA 3D0IE 1N8RT 2EK1A 4K4YA 2MTLA 2VDIA 5CQGA 1XJWB 3IM9A 1B0TA 1X4HA 3IMQJ 4B3OB 3BZQA 3DGPA 4OI3A 2EW9A 2P9CA 5HLFB 2NXEA 1FKPA 4JI8F 4DUZJ 3QRPA 2DGQA 5HJYA 1VRQC 1PC4A 3HD1A 8RUCA 1OY9A 4RW8A 4RU2A 4X4VA 3R2CJ 5FDLA 2FY1A 3NMRA 3AD7C 1HFEL 3AH6A 4B9MA 3DOKB 2XZTB 4C8LA 4W90B 3AB2B 5CAAA 2DEIA 3VGTA 1IKYB 3QWPA 3GG1A 3LGMA 3GILA 1S1XA 2ZDOA 5CYJA 1RAJA 4HVZA 3VAFA 2UP1A 1IKXA 3B4MA 1U0HB 4C2MA 2PO4A 5LOQA 4MKVA 4AL5A 3ILJA 3M8WA 3RB3A 2VG5A 2MKJA 3GONA 1NK5A 5A2QY 5K14B 1M5KC 3GJSB 2L3MA 3IRXB 1NMEB 2IVMA 4N7TA 1YJ9S 4M5JA 2OD4A 1CBKA 1TL5A 3GE9A 5F8NA 3M8QB 1B64A 4DPWA 3OR1A 2YPYA 3EZ5A 1K0VA 1M90T 3M2VB 1EARA 5ETKA 1W2BR 1T3NA 2M70A 2WVCA 1SJFA 1QJHA 2BE7D 4EBCA 4OZ2A 3R9LA 4WP3A 1FERA 1G3OA 4MH8A 5GAEI 2VKRA 3FGVA 5B08A 2DIVA 2C28A 4GVBB 3DXBA 3UN2A 4LRFA 2OKQA 1T0TV 1S1TA 3W9JA 2VFSA 2BJ3A 1SIZA 1JQGA 1ZM4A 2KL8A 1WC1A 5FLXY 4TY8A 1FKAF 2CPZA 3JB9k 4CLTA 1BD6A 3Q8UA 5E41A 1ZAWA 2CPDA 2QN6B 3FSYA 4F25A 2L9NA 1SC4B 4PQUA 1PC5A 2Z58B 3BO4A 2HVIA 2DNQA 3NP5A 4WTOB 3GB0A 3C14A 2NXUA 3T5KA 2YKMA 2FVSA 2RILA 1DY3A 1NDLA 3I0RA 3GLJA 2NREA 2V67A 2W4DA 4XPCA 1X9WA 4PR6A 2QYGA 4R0EA 4K5RA 3AA8A 4D3GA 3GV7B 2DRAA 5KFMA 1IBMJ 3CCRS 4EU0A 2RT3A 4USIA 4B3MF 4B9TA 3M4XA 4PZVA 1JKHB 1VQOS 1VLOA 4DG1A 4ZITA 2K7JA 2E1AA 1ZETA 1W2IA 1C1CA 1OO0B 2NS1B 4I2QA 2UVWA 1QAYA 5GMEA 3T19A 1RXOB 4L76A 1XK8A 3N9UC 1XEZA 5HBMB 2DHGA 3J80U 4E2FB 1VQMS 2DBBA 2E5IA 4WFXA 2IFXA 4LF6F 4OLPA 4Q5VA 1PO6A 2JJ4D 1K47A 2VPYB 3RRHA 2QA4G 2BACA 3HDSA 2XY7A 4JI7F 4UOFA 2BEFA 4L73A 2NUHA 1WHWA 3TZZA 4ELTA 4EBDA 4FYYB 2IBOA 3M9NB 3HSJA 4CZCA 1S6PA 1RKJA 4FXWA 3NL0A 2CNNB 1LWCA 1UEKA 1WDDA 3VAIA 3TI0A 2VG7B 4N76A 3AAWB 5ETSA 3ITHA 1U6ZA 3BSNA 1RCXB 4ATNA 1MMLA 4M5KA 1ZAVA 2UXBJ 2L48A 5HMXA 5L1JA 3RTVA 2B9XA 3CCZA 3AFGA 1P1LA 2HHWA 2ACYA 3G4SS 2IA0A 4JI6J 3BKTA 3QIPA 2J6SA 1RT4B 2RE1A 3MM7B 1HQUB 4OYPA 3PZPA 4W98A 3R5AA 3E3XA 4YB5A 2YKQA 1RBOB 4TLRA 4UQGA 2CJYB 1K1SA 3H2LA 4QWEA 3MUMP 3IWXA 3ZXWA 3FCVA 3T1AA 5GAGI 1WC3A 4PUOA 1U2RA 4DSEA 3K89A 5K8PA 2JLGA 1TKDA 3MR2A 4HH1A 2GIRA 4DN9A 3CO0P 1B4SA 4Q45A 1NJXA 4C0HA 2FGOA 3UDCA 3TA0A 1RWMB 5IM0B 1E6YA 2I6WA 1X0PA 4OHXA 1R0AB 1UKUA 4IDKB 1QUPA 4M5DA 4NLXA 3JXOA 2BQ3A 4H4OB 2RQMA 5CXTA 3E01B 4DSLA 4RKUC 2LQ9A 2B8PA 3KK3B 3BR8A 3RZAA 5LMUF 1OQ6A 3UN5A 3D1HA 1VK3A 1UZDA 1TKZB 2BJ9A 3OW2R 3HPOA 2O67A 1C2PA 2J0WA 2V4JA 5ADZA 1S1UB 2VHGA 4DR7F 1FJGJ 2LEAA 1GTEA 1C1BB 1NHUA 4E98A 2J8SA 3OT9A 1O6XA 1C4CA 3KTQA 2M4MA 2MQ8A 4DFKA 1PYSB 2AGOA 1CJKA 2HHHF 3RBEA 5J1NA 1I94F 1QVFR 4Q0BA 2BANB 4HT7A 2KM8B 4JI8J 1Y5LB 4IR1A 2PSZA 2VB6A 1F0XA 1YJWS 1VQNS 2LMIA 3RRGA 4F2RA 1YRUA 1RBLA 2HMIB 3LANA 2XHWA 3C6TA 3DOLA 2YX4A 2V50A 3PO4A 2ROPA 2HPUA 3PY8A 4ZVHA 2H5IB 1XR5A 4ZP9A 3HKZD 2ADCA 5EWFA 2DNNA 4LIRA 1R43A 2BW7A 4RL1A 4ZPVR 2W9BB 5C2CA 2XO6A 4FNIA 2D9OA 4F04B 1KBRA 9ATCB 2Z2LA 3J7A1 1N0UA 1VI7A 5KFPA 4PXEA 2MKSA 1YJUA 5KFWA 4WP9A 4CT8A 2YQ0A 2R42A 2DK2A 1RP5A 4P2MA 3MAHA 4JI5F 2FZCB 2AEMA 5AXMA 1YBUA 3D6MB 2RVJA 4G1QB 4AXJA 4FBTA 4TYAA 3EYZA 1X5OA 2AX0A 2FZKB 4F0HA 4HDGA 4CIOA 2OUGA 3DRYA 2JEJA 3CVKA 5C5JA 4U9RA 4ZCLA 1TK5A 2YKAA 2UZAA 3DMJA 1TR0A 3CDBA 4YMEA 3DLKA 2RH3A 4O4RA 5KFJA 3NBPA 3ZFVA 3H20A 2PGCA 4I4BA 2BV3A 1PYTA 2J7KA 1V9OA 2FDNA 3W8PA 2WW8A 1MWZA 4ANCA 5KFSA 4M1KA 1Q0NA 2XMWA 5HATA 4O23A 3MXHP 3DYAB 2A1BA 3P8BB 1S9EB 4IRDA 1T9WA 1FDNA 4KV8B 2YQ3A 4CI0B 1RT2A 1BUXA 1QM9A 3KK1A 3PNIA 1FWLA 1VBKA 3LWMA 4DLGA 2CQ2A 3W1YC 3M32B 3IBFB 1EETA 3EZUA 1H3DA 1R89A 1YZ7A 1WEXA 1DHMA 1HNIB 4UUWA 3GQCA 1QY7A 3SV3A 3DLHA 4FVMA 5KFBA 4K4WA 1IBCB 2IM1A 2QL7B 3MM5A 4I7FA 4F4AA 2HWHA 5J2NA 1Q1KA 2GGPB 2PEBA 2CPXA 2GX8A 2FIUA 4HI2A 2E7WA 3RGIA 1DTTB 4PPZA 5G0RB 3J81U 3CC2S 4UW2A 3ETOA 2X1AA 4NLYA 1KSPA 2RIJA 3N28A 4F0MA 1U1LA 2XZWA 4ED8A 3GJRB 3Q22A 4CO5A 1TELA 2WSFC 2DRDA 1QAXA 1IUJA 3VF0B 1FX2A 3H98A 4M5NA 1JLGB 2YKOA 4RWXA 3CDAA 1AYEA 3Q8RB 5JXSA 3I4PA 2PIIA 4Z7YA 4ZVGA 3ZZTA 3VQSA 2PD1A 4ETZA 3CJ3A 3F56A 4B3MJ 3M2UA 1YJTA 1S1VB 1MWQA 4O3OA 4X62F 1RT3B 3QYYA 3ZZYA 1S6QA 2KT5A 3KJQB 3DLBA 1RT6B 3RR8A 4F50A 3ZZPA 1WOSA 3EJMA 5M2PA 5SUHA 4DV5F 3N6MA 4UY85 4RNNA 1SJ4P 2AJ2A 1WJ9A 4V1Ak 1ITPA 4NZ0A 4WFYA 2BJEA 1P9YA 2HFNA 3S01A 1X60A 2GO9A 4K8RA 2RRBA 1VC0A 4LF6J 5I3UB 4HR2A 4C11A 4IG3A 3DRPA 3PJWA 4V19X 3Q2TC 2CADA 3RW7A 4JI7J 5KFLA 2YNHA 3OVBA 1WI8A 1TKXB 4RW6B 1L3SA 1GXUA 3F44A 3PRVA 3I0SB 1ACMB 1QSYA 2DJWA 4FBUA 4NCBA 3HFKA 2N4DA 1LK5A 4W92B 1JNZB 2HVEA 4XAKA 2BQUA 1DFDA 1N48A 1UFLA 2B9WA 3M7VA 4IFVA 4P7TA 2OELA 1XWLA 4XIUA 1U4BA 4EWTA 3THPA 3RAQA 2RB7A 1VC5A 4DS5A 4P52A 3ET6B 2MJUA 4ZS6A 2NSCA 3G87A 2KT3A 4P7VA 2FC9A 4ZPWR 5GMKa 2J76E 2POKA 2CA9A 2KDOA 3CJ8A 3HHEA 2K06A 2MGZB 3W7BA 4RW7B 1RWOB 1WC6A 2CPJA 1XQIA 2LDYA 1HNWJ 1VBYA 2B7BB 1F6TA 3R3TA 3TZYA 2XSJB 1LXJA 4O3NA 2W2OP 3MD3A 3W66A 1X9SA 3DU6A 4M5MA 2Y0BB 4J9KA 1J5OB 1JLFB 1VQ8S 4WFZA 1JXVA 1FXLA 4Y2IA 1OSCA 1RT1A 4LF8F 4PYDA 4WZQA 4BWJA 1CC7A 1PAEX 4P2SA 3VTIA 2N7CA 3OFEA 5ETVA 1X8DA 3ZZUA 4LF7F 1DLOA 1RTHA 2RF2A 4NMXA 3GIKA 2MZTA 3BQ1A 1LW2B 3C16B 4ENOA 1VQYA 3VALA 2XMTA 1XERA 5ITHA 1VRTA 4DL7A 4IKAA 2VQFF 1P6TA 3M1VA 4LSLA 5LMUJ 3FCWA 4EI2A 3KHHA 2EWHA 1Y7PA 2DNOA 1L3TA 1RT7A 3FUYA 4DR7J 4DSFA 4CNYA 2ASYA 1HI8A 3Q8QB 1VYAA 1OPIA 3MEEB 1Y5NB 1XBWA 3BDEA 3PV8A 3HFVA 3GFZA 5IQ6A 1RSCA 2N4CA 2ZEJA 1FA0A 1PSDA 2HHHJ 3MPDA 1KQFB 1T9VA 3J81Y 1I94J 2W8LA 3WHIA 2DIUA 2AF6A 2BQRA 4L74A 3HCXA 1RWPB 2V68A 1WTFA 3CSKA 3ILIA 5EX3A 4KHMA 5LJ3Y 2JRSA 2K3IA 1S0VA 3M8YA 2FVCA 3NRBA 3CJKB 3EVWA 5D4PA 3VAGA 1RYSA 3JAMY 1FF2A 4ICLA 1RJJA 4LMZA 2JDJA 2LP4A 4ED7A 4Q43A 5C25B 1TL3B 3ZC4A 1SC1B 3A12A 2FHJA 3A8KA 4Y0FA 1RA6A 2FJXA 4DPXA 4OL8A 3MAQA 3VAJA 1TVRA 2VZ9A 1RWKB 2EG2A 1ZZFA 3QRQA 2XLIA 2G2YA 1NK6A 3HP6A 2C3PA 5JMNA 2M0GB 2IJNA 3GZ7A 1U1RA 5H9EK 2DHAA 3M9OB 3T5JA 2WK4A 1VQ7S 3KJNB 3E2EA 4JI5J 5K8NA 1TQLA 2M3DA 3A3NB 4B3SF 3WIUA 1NSQA 1SKRA 4ZVFA 2JFDA 2LVWA 2ROEA 1U47A 2YBVA 4IRKA 5E7OB 2F9DA 5KFIA 3W60A 1CJUB 1T9YA 5A0YB 1NHKL 2GQ2A 2V8PA 4JOUA 2ABYA 1X7VA 1EP4B 1FE0A 3VAHA 3CC7S 5KG6A 3CIZA 2CZVC 2X1BA 2N3OA 4KTQA 3RRKA 4ID8A 4QIGA 4U8YA 3AA9A 4ZVRB 4O3PA 2BUNA 4ZCMA 2WB4A 2IDLA 4XDDA 2D3ZA 1MN7A 1HQEA 2OTJS 2WVEA 3NAIA 3SEOA 3SFGA 2DH7A 3CEDA 3I32A 4MJKA 3EPGA 4DPTA 1EQMA 3A4TA 5LJ5Y 2IC3A 2F40A 3QZ8A 2C2ZB 2MHEA 4HACB 1HPZB 4WKYA 1DURA 4YR3A 1T9UA 1N33F 2B4UA 2DY9A 1JLBA 2XYHB 2IYIA 1Q86T 2H9ZA 2RKIB 8AT1B 3CJ2A 2BXJA 4P2FA 2KXNB 5KT5A 1N5YB 1IKWA 2DKOB 3M6VA 2XWXA 2P6TA 4GKKJ 3CD0A 2GIFA 2RHSB 4HL9A 4A8XA 1CJTA 3C6UB 5HK4A 2ZWOA 2PMHA 1S5ZA 4I2PA 3LP1B 4WTYA 3HT3A 1U02A 5FJ4A 2G13A 4JI0F 3OVSA 3NAHA 3V6DB 2DEJA 1KLNA 2UUAF 3ETMA 2ZHOA 2EFOA 2OPQA 2VV5A 1VQLS 2JNJA 4C8NA 3C15B 5DGBA 4LJMA 1TKTA 4ECQA 3W5ZA 2F8MA 1AUSL 4LQ9A 4X62J 1NPKA 2CDQA 5KFRA 4ZPBA 4ZCKA 5ETOA 3OHAA 1OYEA 3A13A 5HLFA 1R0BG 4PKDB 4NLPA 4QR2A 2FB0A 3GSDA 1M1KT 4LSNB 4DV5J 3CGIA 4L6V3 4BWMA 2MZQA 2EC2A 1ZYQA 1X4EA 2K3KA 1APSA 2J0SD 3MFHA 2HRTA 4A8YA 2EEYA 3C66A 2XI3A 2DVIA 4GC7A 3DOKA 3TA1A 3KG0A 5IT4A 2VDHA 4F67A 1WEZA 3VQTA 4EBEA 3R8YA 1VLYA 3THTA 1IKYA 4NASA 1FDDA 4RUHA 2Z2MA 4NLRA 5FD1A 1SH0A 4DSJA 3FQKA 4QYZJ 2LA4A 4U8VA 4OQJA 3RB0A 2I38A 2V8DA 1U0HA 3I6PA 3T1HJ 1I51B 3UD4P 2P9GA 3OPKA 1NK0A 4I69A 4R5PB 5K14A 4NE9C 3PYDA 4J5OA 3IRXA 3CMES 3QQCD 4ZP8A 4OI6A 5DS7A 5LL6d 2QLXA 3VVUA 1YWXA 1FESA 4QZVB 3M8QA 1TL7B 1SUQA 3V81B 1TP7A 2CJ9A 4S0MA 3M2VA 1M5HA 3PEHA 3B54A 3EDRB 2PC6A 2XY6A 1IXKA 4R25A 4DV4F 1WORA 1SKWA 1NZ8A 3N6LA 3D1QA 4IOBA 2KVIA 5K8OA 3OTOF 3T5LA 2BJ1A 2AD9A 1S7HA 4Y65A 2U1AA 2LXFA 2XMKA 4GVBA 3JTOA 3OXFA 3Q86A 2OI2A 1QE1B 3FQLA 4JV0A 3OFFA 1FTRA 2VJVA 1OYDA 3PCOB 1NH8A 2PMWA 5IQQA 2GCFA 1XNRF 1MMNA 3O6QA 2U2FA 3KLEB 4LF8J 4CP5A 1U2FA 4MK7A 3RJMB 2DGUA 4A8OA 4NWBA 4TU8A 2UXDF 4N47A 5BR8F 4LF7J 4YQWA 2A0FB 4KIAA 3MMCB 3K5LA 2APOA 2DGWA 4X4UA 1TU0B 3SV4A 2VQFJ 1TK8A 1DRZA 3N5BA 3EVOA 4U67Q 1WG1A 4J90A 1VQ9S 1VR6A 2VIHA 3SXLA 2KB2A 3BO2A 4TU9A 4QWDA 4FP9A 2FC8A 2E9ZA 2B43A 3MCMA 3PIPQ 3DRSB 1WD6A 4OZLA 1PAUB 1P9QC 2HKEA 2ZNYA 3RUBL 2HHXA 1RTIB 1SL2A 4DDFA 4UOGA 1JLAA 3EMTA 4BHQA 3R5GA 2HHQA 1NDPA 1JKHA 1YK9A 4ZLLA 3G6XA 3KDNA 1FD2A 3MWBA 1TUWA 2FJEB 3VZHA 4DSKA 1HBOB 3MOJB 4DU8A 2QV6A 3UPFA 3HFZB 1RACB 4MFBB 3OL7A 1PYOB 1E6VB 1J2VA 5HBMA 4EFAC 4DL2A 1X4BA 4BDPA 1FNOA 5F8HA 1UEVA 4LUBA 4DX6A 1RWUA 2ZZTA 1D9DA 3TVKA 1MLAA 3S1TA 4PG6A 4FF4A 4OJ1A 3UVJB 2ZZMA 1RB0A 3N5FA 2O5DA 2ILYA 2E1CA 2CRLA 2DYAA 1ZM2A 1LXNA 4B3SJ 3LWLA 5GAHU 2CQHA 2VG7A 1T11A 2ASJA 1T9XA 1U09A 3B8HA 4ZVTB 1Y3KA 5IV3A 3UCZP 4MIAA 3FZ2A
chains in the Genus database with same CATH topology
4DQSA 1SJFA 1B7FA 5AE3A 1MMDA 4PXDA 4ED6A 1SC6A 2IMWP 1QJHA 1KLMA 4EBCA 4RUAA 2B5JB 2K8GA 5L9NA 1KN6A 1FVQA 1M0SA 2OFHX 4KB7A 3TANA 4DR1F 4QW9A 1AFJA 3HI9A 2CVIA 2VUGA 2DNLA 1C4AA 4BS2A 2KZMA 1FERA 4C8MA 1G3OA 2QMXA 4MH8A 4AXIA 4NXNF 5GAEI 4KHPF 4KBIA 2VKRA 1SJQA 3FGVA 5B08A 5DO2A 2DIVA 3IFEA 2GA7A 2HS4A 1T3OA 2NLWA 1FT8A 2C28A 1RT4A 3DXBA 5EX0A 5LXYA 1D9FA 2DH8A 2MQOA 2XO7A 3MM7A 1HQUA 2OKQA 1M5OC 4HEA9 3HO1A 2D3UA 1S1TA 3MDFA 4C8OA 2UUBF 1XR6A 2D1CA 2F4VF 2HS3A 2MPUA 2WBMA 4DF4A 1Q78A 5B0AA 1B0PA 1BY9A 3HVRA 2VFSA 1U1OA 1LFPA 3W2WA 3GV8B 2X1FA 1JK9B 3G96A 4K4TA 1SIZA 1VQKS 2J0QD 2XY5A 4JYAF 2DNYA 1ZM4A 1JLCB 3BS9A 2XBPA 3ENVA 4DV3F 5FLXY 4GO5X 4TY8A 4X4QA 1FKAF 1RT5A 4RNHA 2J6UA 1SL1A 4LVOP 2CPZA 2KT2A 3JB9k 4I64A 2VBYA 5F8GA 1N54B 2AJ1A 2CG4A 3QGGA 3HJFA 1BD6A 3MM6A 4DUYF 1WWHA 1NEEA 4DJBA 2Z4PA 1O51A 2ZH2A 2C3UA 5E41A 4N56A 2AV5A 1RQ0A 1ZAWA 2IMOA 1FK9A 2CPDA 2ZOMA 4A8SA 3FSYA 4F25A 3HK2A 4C8ZA 2DNGA 2L9NA 5I3PA 2I2YA 4PQUA 2ZH4A 2VPZB 3OUYB 1PC5A 3D28A 5KFCA 4FPRA 4DEZA 4C8YA 2OFGX 2IVFB 3BO4A 4EYHB 1HYSB 2HVIA 2RU3A 4ID5B 2DNQA 3NP5A 1J5OA 2CJKA 4MYUA 4CO0A 2ZC4A 4PRFA 2KU7A 3FNNA 5FIIA 4ETXA 3TUZC 4WXOA 5IFMA 3GB0A 5C42B 5IM0A 4J9SA 2NXUA 3PEJA 2M5YA 1N5VA 2M2BA 2VPXB 4KHRA 5KFNA 3T5KA 4X4NA 3O1LA 2YKMA 2FVSA 2GHVC 4YHHF 2HQ3A 1UAWA 2RILA 3JTNA 1R0AA 3T6BA 4GKKF 4RBUA 3I0RA 2W4CA 1F60B 2OPPA 1MW7A 2NREA 1VRUB 4KE5A 4HDHA 1TL1B 4KFBB 1N0VC 3DLGB 4H4OA 2LLZA 1C0UB 3ENQA 2W8KA 3PKMA 2J7WA 3PM9A 2W4DA 1BQNB 1DQ8A 2JZ5A 5AXNA 4XPCA 1X9WA 1HBNB 3CCWA 3E01A 4IFYA 4O4GB 1URRA 5AJ3F 5DM6Q 1YITS 2D9PA 2N82B 4PR6A 3KOAA 3NGDA 3KK3A 4R0EA 1CLFA 4K5RA 3KHGA 5K9FA 1IQTA 3AA8A 4D3GA 4MIBA 2W9CB 3GV7B 4I56A 2DRAA 1Y3JA 5KFMA 1KNZA 3K8WA 4DV2F 3CCRS 4EU0A 3G8TA 3IN5A 2RT3A 3P5TL 2FUG9 2RNEA 1FKPB 1YI2S 1D0EA 4IO1A 4USIA 3I96A 1FRLA 2WAQD 4RU9A 3UI3A 1S1UA 2YWHA 3Q24A 2JC1A 2R7TA 2HWIA 3JSRA 3OTDA 2NPFA 2WBRA 2R7WA 4J9QA 1YIJS 4EEYA 5L1KA 3IWLA 4B3MF 4B9TA 3M4XA 3BSCA 2GW8A 2K1RA 4ES3A 5HMYA 2M7SA 2IBKA 1C1BA 2DGXA 2M9KA 3Q23A 3D54A 2JEFA 2BDPA 4O44A 4J9OA 1JKHB 4PWDA 5EUHA 2J0XA 1VQOS 1BQXA 2R2SA 4RW8B 1FNXH 1QAIA 4ITSA 5D6GA 5MLCV 2DR9A 2KXHA 1G1XA 1VFJA 2ZNZA 4DG1A 2KFNA 2CPHA 5FDLB 2WONB 1TV6B 3IS9B 2K7JA 4WU3A 3KHLA 2EC0A 2ZD1B 1KQSR 2E1AA 2JWNA 4AL6A 3AQOA 2AP6A 4OZ5A 5E33A 3IAS9 3KK2B 1ZETA 2ZOFA 3MEEA 1D8YA 3PFEA 2BRKA 1W2IA 2W25A 1C1CA 1OO0B 2NS1B 4MKYA 1F5CA 4I2QA 2UVWA 1QAYA 3HHLB 1VC6A 3BGLA 3T19A 3TR5A 2BANA 2NSBA 4DOZA 1FRJA 1XK8A 3N9UC 3MPVA 1XEZA 2DNRA 2HS0A 3T1YF 4HTJA 3FEZA 5HBMB 2DHGA 5HP1A 2R7OA 2J9DA 3I31A 3UW1A 3BSOA 1S1XB 2ZH9A 2MQNA 3PIOQ 1VQMS 1VIXA 3KLHA 2DBBA 5DRKA 2NR0A 1FRXA 1LW0A 3OL8A 2B6AA 2E5IA 3LP0A 4WFXA 1IKXB 2IFXA 4LF6F 4OLPA 5KFAA 4Q5VA 1FKOB 2FVQA 1PO6A 4G3IA 2G1DA 4CO3A 4YDDB 1Q7YT 2HMIA 4K5SA 3MR6A 4K50A 4OI0A 3O44A 3FFIA 1UP1A 5DLGA 2JJ4D 2X3GA 4B17A 2VPYB 4E8UA 4OZNA 2RQCA 2QA4G 3BM7A 4ECVA 1UJ5A 3FMBA 2OPRA 3RRHA 2BACA 2V9WA 3HDSA 4M95A 2XY7A 4JI7F 2QEXS 1U7LA 2E5GA 2HWTA 3CJKA 3L3CA 2HLUA 2NUHA 2VG5B 1WHWA 5BYQA 1KS2A 4ELTA 4OZ0A 4EBDA 1XMQF 1Y4ZB 1UVNA 1YJVA 2YH0A 1UW4A 2BM1A 2IBOA 3M9NB 2FD2A 4CZCA 3K59A 1DQ9A 5B09A 4ES1A 1HNVA 1S6PA 2W9BA 1RKJA 4YB1P 4FXWA 4QBUA 3NL0A 2M88A 3O5TB 4QOTA 4TKTA 3IC1A 2DCLA 1LWCA 4KKOA 3KYLA 1HMVB 3DXSX 1UVKA 4ZDNA 3U1LA 3VAIA 5B0CA 3TI0A 1HWKA 2GNKA 1ZAXA 2VG7B 3OR1B 1AUDA 4N76A 2QE5A 3AAWB 2R8IA 3U7JA 3POTA 4FN5A 3G6VA 3ITHA 3ULHA 3T1HF 2DNHA 1U6ZA 2B4OA 1FRMA 2V2KA 3BSNA 1IJEB 4QCLA 4LF9F 4ATNA 1MMLA 1BC6A 3ENWA 1H7XA 2IAJB 4IRCA 1HBUB 3MR3A 3DLJA 1ZAVA 4ES2A 4D3HA 4TQRA 4HHJA 3K57A 2L48A 4JV5F 4NLUA 1WELA 5HMXA 5L1JA 3HHLC 3RTVA 1UEUA 4X84A 2HNZA 2B9XA 1Q53A 2KN4A 3CCZA 2VA2A 1KLMB 2DR7A 4WKRA 2ZOGA 1JJ4A 4ECSA 3NGKA 2VASA 2R2TA 1P1LA 2MKCA 3QGIA 3VAMA 2HHWA 2ACYA 4G1QA 4WYLA 1QVGR 3G4SS 3FZBA 2CIMA 2IM0A 5J2PA 1K9MT 2IA0A 3V4IA 4CH1A 3IGVA 3PXGa 3PW5A 3E8OA 3MOZA 1XNQF 2JH3A 3QIPA 1L3VA 1NK9A 2J6SA 1O8BA 1RT4B 1SH3A 2XMUA 4ZMMA 2R7VA 2MMYA 2RE1A 4DN0A 3JYTA 3RAMA 4J9PA 3GYNA 3MM7B 1HQUB 1FCAA 4OMFG 3PZPA 3TUJC 3K5NA 3U02A 4PQAA 3Q0AA 3CDWA 1S1TB 3E3XA 3R5AA 4ECZA 1YRXA 4YB5A 2VPWB 3CB4A 3CCMS 2YKQA 1S0OA 4A8FA 1TL4A 3S6EA 3GFXA 2R9LA 2WB1D 4TLRA 2G4BA 4A8KA 4UQGA 4RNOA 2QFJA 1K1SA 2UXCF 3W2WB 3K8VA 4ALZA 1P8GA 3TUIC 1FRKA 2I9SA 4QR0A 4NLSA 3H2LA 2IC3B 2WOMA 4TY8B 5KFFA 3HM9A 1RT5B 4QWEA 2YWFA 3MUMP 2I8EA 2QRRA 3IWXA 3IR7B 1HD1A 5F8MA 4J9NA 4M63A 2MDAA 3T1AA 1SH2A 5GAGI 2UUCF 4PUOA 3OTCA 2P6SA 3IAM9 2MKIA 1U2RA 3KLVA 3MMJA 4DSEA 1SBRA 2KXFA 2LA6A 5K8PA 2XGQA 2WHOA 1O0PA 2D41A 2C42A 2JLGA 5B0GA 3MR2A 1TKDA 1GXTA 4HH1A 1R8PA 3L95X 2K2PA 2OD6A 2AJQA 2GIRA 2VODA 3DYAA 4PQUB 5DDOC 1K1QA 4DN9A 3MM9A 3HVTA 1S9EA 1A7GE 1FTCA 1KONA 3I9ZA 3B82A 3G6ES 3CCUS 3EXCX 4KSEB 3HHKA 4Q45A 3NMAA 2ZHAA 1Q79A 5D8HB 2OIHA 1NJXA 2GQQA 4C0HA 2FGOA 3UDCA 3TP2A 2EG1A 3TA0A 4WIIA 1JJ2R 1IQZA 4JI2F 1UA1A 4DPOA 5IM0B 5I4MA 5KG0A 2FHJD 1E6YA 5L9XA 3WX4A 2YKMB 3MECA 1X0PA 4OHXA 3W3SA 3M6UA 1UVIA 2RQ4A 2IA6A 2KI2A 2E66A 3CD5A 2HNDA 5LMNF 1R0AB 1QSLA 3CUNA 2DGOA 1UKUA 4XDCA 3I0RB 4IDKB 5K5MA 3SSRA 2OPPB 1QUPA 2RD5C 4M5DA 1U6BA 4NLXA 1QUVA 4DQPA 1HWLA 3BQ0A 5HQ8A 2BQ3A 3GFYA 3I87A 2RQMA 4H4OB 2MZ1A 2DPJA 2HQIA 2VBWA 2MY7A 1HNIA 3SI8A 1XMBA 5CXTA 1CQMA 3E01B 4IFYB 4NA1A 1HWIA 4DSLA 4RKUC 2LQ9A 3SSQA 1I1GA 1CC8A 3OLAA 3KK3B 3QJLA 3MEDB 3T9NA 3BR8A 3RZAA 5KT7A 5LMUF 4X4PA 1OQ6A 1NO8A 2GGPA 1D8ZA 2G0CA 3D1HA 1VK3A 1WHVA 2HFZA 3NCQA 1TKZB 3OW2R 3HPOA 4ZOSA 5KT2A 1O5JA 2O67A 4CO1A 4CNZA 1NK8A 1C2PA 1DTTA 2J0WA 2V4JA 3HVAA 5ADZA 2FHMA 1NU4A 1S1UB 5G0RA 2XLJA 3ICLA 4MKBA 3TAPA 3HLUA 2ZE2A 2YTCA 4DR7F 3F41A 1T05A 3R5BA 4FXVA 4K0KF 4IO9Q 4M8LA 2B9YA 3EGWB 2LEAA 3QLHA 1VQPS 4FXDA 3VR1A 2MHNA 3J7YU 1KTQA 1ROFA 1X0FA 2J6TA 2K1RB 1S1WA 1GTEA 1C1BB 3IBWA 1NHUA 3FRZA 1CPZA 4E98A 4O44B 3H40A 5F8IA 4PWDB 1C4CA 3U1NA 3M05A 4DG1B 5K8MA 3KTQA 4OX8A 1DAXA 2M4MA 1VBZA 3TYTA 1N4LA 1HWJA 4DFKA 4U7CA 4IR9A 2NPIA 2JHEA 3C8YA 3QWUA 4TYBA 2AGOA 4DV6F 1UJ6A 1T02A 2HHHF 3I4HX 3RBEA 2HW3A 4X4OA 1X4CA 5HROA 3RAXA 1R8HA 1JLGA 1C1CB 5J1NA 5IZHA 2F8EX 2QYCA 2RUGA 1S6OA 4F3OA 1I94F 3SCKE 2M8DB 1QVFR 4Q0BA 2BANB 4HT7A 2HYIB 2XEXA 3V6DA 2OLWA 4K2XA 2KM8B 1Y5LB 4DUZF 4J37A 2XCAA 2LCWA 2FVRA 4IR1A 2L08A 3LQVA 2CPFA 2PSZA 2VB6A 5HP1B 1F0XA 1W25A 3VZIA 3I56S 5DQHA 4ERDA 1YJWS 2UUWA 1VQNS 1NNDA 2LMIA 4NOHA 5KOXA 3KLHB 3G8QA 5DDPC 3RRGA 1SIWB 2MQQA 3NLCA 3KWMA 4F2RA 5LXRA 1S1VA 2B6AB 3LP0B 3ZZZA 3J7Z5 1Q4RA 1YRUA 2IRXA 4DFJA 3V4MA 3KNGA 4PCQA 2AW0A 2QIFA 4OIXA 2HMIB 3LANA 3PX0A 2XHWA 4I67A 3C6TA 2RS8A 3OVAA 4DLEA 3DOLA 2BW2A 3FFIB 3GFHA 1N5TA 4OFZA 2IJFA 4A8MP 2G9OA 2OPRB 2YX4A 4QIFA 3MI7X 2VFUA 3PO4A 5H1SV 3RYLA 2ROPA 2HPUA 4O3QA 3PY8A 1LV5A 2ERRA 4ZVHA 2DHXA 5A8KA 4YOEA 4KPYA 2J9EA 1GX5A 4FVCA 1XR5A 4IH5A 4ZP9A 3HKZD 2ZBIA 1U26A 2ADCA 5EWFA 2DNNA 4UUXA 1ZBTA 3IWNC 1WHYA 2Y0SD 4Z2XA 3OL9A 4LIRA 1R43A 2GJIA 2FLLA 1HNVB 2VOPA 4ZPVR 1M5PC 4DR4F 2W9BB 4LQ3A 2WCXA 2XS5A 4DR2F 2YVSA 2GV1A 3Q2SC 4F8RA 4FNIA 2D9OA 4OZJA 4X4RA 1SJ3P 1LWCB 4KKOB 1H2UX