1PC4A

Crystal structure of the p50a mutant of ferredoxin i at 1.65 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECAAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin I
publication title Mechanisms of redox-coupled proton transfer in proteins: role of the proximal proline in reactions of the [3Fe-4S] cluster in Azotobacter vinelandii ferredoxin I
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pc4A00
2C3OA 2PA8D 1FD2A 2C42A 3OR1B 1FF2A 3MMCB 4ID8A 2WSCC 4YDDB 6FDRA 1JB0C 1SIWB 1F2GA 1B0VA 1H7WA 1GT8A 1KQGB 2ZVSA 3MM6B 4AYBD 2O01C 4XDDA 2C3YA 2C3UA 1SIZA 2VPXB 1XERA 6FD1A 1FXDA 3MMAB 3IR5B 2GMJA 2C3MA 1KEKA 1DFDA 3MM8B 1FXRA 1BLUA 4DHVA 2FJAB 1FDNA 2WB1D 1Y5LB 4OMFG 2XSJA 1R27B 1Y5IB 1FRKA 1A6LA 2Y0SD 1FERA 1FRHA 5FD1A 1JNRB 3EUNA 1FDDA 3LW5C 3OR1A 2FJEB 4XDCA 3MMCA 4Y28C 1ROFA 2PDAA 2VKRA 1BD6A 1HFEL 3EGWB 1D3WA 3HKZD 1JNZB 1SJ1A 3MM6A 1B0PA 5CHCB 3MM5B 1FDBA 3IR6B 1BQXA 1IQZA 1F5CA 1GTHA 1GTEA 3MMAA 4OV1A 1CLFA 3MM8A 1RGVA 3MM9A 2FDNA 3GYXB 1FRJA 2Z8QA 2WSEC 4L6V3 3EXYA 1IR0A 2FD2A 2V4JB 5E7OB 3MM7B 1F5BA 1WTFA 3PNIA 1FEHA 2FJBB 2FJDB 1DAXA 1G3OA 1Q16B 1H0HB 1FTCA 1FRMA 3OR2B 2GMHA 5L8RC 1GAOA 3MMBB 2WSFC 2IVFB 1H7XA 2VPYB 2UZAA 1PC5A 1B0TA 1G6BA 1H98A 4KT0C 1KQFB 1BWEA 1VJWA 1FRXA 1Y4ZB 1AXQA 5CH7B 2WAQD 2PMZD 2V4JA 1DURA 2V2KA 2VPZB 3MM7A 1K0TA 1C4AA 7FD1A 1PC4A 1FCAA 5BYSA 1BC6A 3C8YA 5BYQA 1C4CA 1FRIA 3MM9B 1Y5NB 4RKUC 3MM5A 3OR2A 2C3PA 1FDAA 1FRLA 2XSJB 4XK8C 2FGOA 3MMBA 5BYRA 3IR7B 2VPWB 7FDRA 4CI0B
chains in the Genus database with same CATH superfamily
4ER8A 1KLMA 2J76E 3NS6A 3IWLA 3B54A 2M4MA 2A2CA 3D0HE 2H4WB 2X3GA 3IM8A 3P45B 3BGLA 4MH8A 3JSMB 3FSIA 2J9EA 1C1CA 1Y3KA 5KFWA 4F4AA 4CLUA 1H72C 2E9TA 3FFIB 2UUCJ 3I87A 3HD2A 3GYNA 2BBEA 3R5AA 1NU4A 4K4TA 3ZO7A 3BJYA 4LIRA 3IAM9 4LFAJ 3HULA 1D9AA 3UO0A 1MWQA 5HAOA 1IBKF 1LNQA 4LRBA 1S4EA 2AJ2A 1FWKA 4NEYA 4DL7A 5A8WB 3P49B 2VPYB 1NH8A 3TUPA 1BWEA 4CT8A 3CD5A 2W2MP 4DLGA 2LA6A 4X4RA 1CULB 3CJ2A 3SDEA 4I2PB 1PKUA 4LSZB 1JLFB 1BGXT 4B9LA 3AH6A 5FDLB 2ZUGA 2DXFA 1IQTA 3BBCA 3T41A 2DY9A 2LEBA 1GT8A 2HNDA 3CW2C 4MYTA 4DX7A 4BS2A 2E1AA 4DUZJ 2AJ0A 2C2NA 2AX1A 3H7HB 1S72S 4I68A 2UUWA 2R42A 4UOGA 1RK8A 2F9DA 3PR5B 3W63A 4M5KA 5B0CA 4J9VA 4NRUA 4KRWA 1RT2A 1HWIA 1FDBA 3HJVA 1IBMF 3WX8A 2LEAA 4X4SA 2K3IA 2V4QA 4CO2A 2LP4A 4M5DB 3MAAA 2HHWA 4MJKA 3HP6A 3G86A 3N01A 3VAFA 1ZETA 1YRTA 2YH1A 1QE1A 2CPHA 3QIDA 4ELUA 3K5PA 3JYTB 3C6TB 5CCLA 3UN3A 1PYTA 3RBXA 4QYZJ 2JJ4D 4RBVA 4UOCA 2BKOA 2IJFA 2YTCA 2KYXA 2ZDPA 1WI6A 3CPWR 4C11B 4PG8A 3CGIA 1KQKA 2DH7A 2CQPA 4A8KA 3L7PA 5D0HA 5J2PB 3RB4A 1YBUA 3J7YI 1U1MA 2UXCF 4MAKA 3CCMS 2DT9A 4KYZA 1T03A 4GKJF 2PO4A 1EKSA 4WBFA 3M2UA 1HBNB 3IA0A 3Q83A 2XS2A 4QU6A 1S49A 1BQMB 4DV1F 1H73A 2V2VA 1P9QC 2X7IA 3S8SA 1RT4A 1N32J 5A8KB 4WIIA 3HSZA 5CYMB 3RBDA 2HRTA 2DCLA 2OPSA 3A3NB 3TQEA 4C8KA 1JXLA 4NLXA 2YPYA 4DR2J 4KQZA 5GMDA 4EGLA 4DSLA 4HI2A 2XO6A 1CBKA 2AMCB 1S1VA 3UD5A 3MM9B 4WFAQ 4DR6F 4LT6A 4USVA 4LF8F 1F0XA 2C22A 4L3KA 3W66A 2NCKL 2RNEA 1EP4B 4F4XA 1SIZA 2IRUA 1DARA 4X4TA 3QFHA 1ZAWA 3KJFB 2XSJA 3K0JA 1BUXA 2CJ9A 1UW4A 3C15B 1R8HA 4OV6A 3W2WA 1C1BA 2VKRA 2CZ4A 4URSA 2F9JA 4J37A 2Z2MA 5K9FA 4JI3J 5KFIA 1UEKA 3B82A 5T41A 4OZ0A 2FDNA 2WVFA 1U2CA 3PNIA 1FEHA 1F2HA 3FNNA 3FSXA 1TFWA 4X4PA 2BJ9A 1ZAVA 1FTCA 3K8VA 5IM0B 2F4VJ 3W1YC 1WEYA 2MKSA 4C8YA 4FYVB 2EVZA 4O44A 4RW6B 1N6QB 2KZZA 2QN6B 5BYSA 4TU8A 1NJYA 3M8RA 2N3LA 3I5BA 5KFKA 1YVFA 2QL9B 2HVHA 3IR7B 2G2YA 1PG5B 2DR8A 1MN9A 2AQ4A 4PKDB 2D3OR 3MEDB 4KGKA 4RW7B 1XR6A 4RW8B 3LP0A 4H4KC 2YX1A 3M4XA 4ZJOA 4ALZA 3CMES 1RWPB 3QRPA 1BWVA 1GMVA 4CLYA 3UPFA 1CPZA 3QWUA 1SL0A 2PE8A 4NI2B 3NBPB 3Q8SB 2QMXA 2OFHX 3D1QA 1KHVA 1NPRA 1XMOF 1N5VA 4NEZA 2ILZA 5I42B 3Q2TC 1G3OA 5HBMB 1RTDB 1S6QB 4CH7A 2RMLA 3JSBA 2WVBA 3TAQA 1C0UA 2DISA 2IMOA 4KT0C 2YNFA 1CS4A 5L46A 3OHBA 4X66F 3OXFA 4CO4A 4K0KJ 2FQQB 4LF5F 4IG0B 2FLOA 5D4OA 2G9OA 1JX4A 4WZMA 3FQLA 3CCTA 4P10A 1F3FA 3ET6A 1T3NA 5F8JA 2BEFA 1TL1B 4CYUA 4LR7A 3KHGA 2RS2A 4DV6F 1JJ2R 3OXGA 3C14A 2PSZA 3DU6A 4ZVEA 1FKPB 1QLNA 4QWBA 3EPIA 1AYEA 3I0SA 1HWUA 2RUGA 3SI8A 1IBMJ 2D3ZA 4QIFA 1NM2A 4HHUA 2MJUA 3PRBA 3TJ9A 2LXUA 5K8OA 1UETA 3HO1A 4P52A 5DDOC 4NA1A 1K44A 4FF4A 2HSEB 3PEHA 2MKKA 2MZJA 1HYSB 3IP0A 2DVIA 3NNHA 1RHUB 2ZVIA 4LF6F 4IG3A 2N7YA 2P6SA 3ZZ0A 2V0NA 3KNAA 1UWBB 4ZP8A 2UXDF 4DOZA 2J9DE 4MFBB 2QLJB 1LKZA 1FRIA 4NASA 4JI8F 4F3MA 3CO0P 1FE0A 2JEJA 6FDRA 1V5VA 1RI7A 2HBZB 3MM6B 1CJUA 4KBIA 2K7KA 2BANB 3GPAA 2VG7B 1UA0A 4PWWA 2UUBF 1VQOS 1RTIA 1R27B 1VCTA 2DHGA 2XMMA 2HHQA 1WTBA 1PCAA 3GFZA 1VHIA 3FCWA 3TW0A 3HKZD 2J8AA 4CLZA 2JNJA 1Y00A 4I1TA 3BM7A 3C16B 1L5UA 2R7QA 1DTQB 1LWEB 4KIAA 3HM9A 1T95A 4JP8A 4LSLB 3RBEA 5HVFA 1U02A 2HHUA 3UD4P 5GMEA 4W98A 2HHTA 1G1XA 1YSJA 1GAOA 4AE5A 2CJAA 4X65J 3OD2A 5E5NA 2KB2A 3LOUA 1WI8A 2NXNA 4HACB 5BR8F 2O67A 3R5DA 4DDFA 1LWCA 2RIJA 1UMJA 3IBWA 1SPBP 1RLCL 4B3SJ 3O44A 4UUWA 4ZVUB 3IRXA 3FJ2A 3IGNA 3CJKA 1VQ6S 4BWMA 2L48A 1V6HA 3BKFA 3GIMA 1SI9A 2FGOA 1YJWS 1P27B 1SH0A 2RRBA 5KFDA 1X5TA 3PW7A 4DSKA 1PIEA 1SH2A 5KFAA 2Y3YA 5IC6B 2YWHA 1S48A 3CF5Q 2MKIA 5D3GB 2NXEA 2MJNA 4QW8A 1RCXB 1JQGA 3ILLA 4HVZA 3DLKA 5J1NA 4QR2A 1R43A 4N47A 4RZRA 3PRDA 3GIIA 2ZOFA 3GJQB 1FE4A 2RSQA 3OSPA 2BZ2A 1QJHA 1KWMA 5E7OB 1V3SA 2UVVA 1TL4A 2CPEA 5K8NA 4DQIA 4DS4A 2F65A 3M2RA 3RRGA 1RT7A 2V63A 2EFPA 3M8WA 4PQUA 3CUNA 3ONQA 1VRQC 3HHEA 1RTJA 4E0DA 1K0TA 2JEFA 4RPFA 1N8RT 4AL6A 3D6TB 4URQU 2R7WA 2A1BA 3ZC4A 1FFGB 1GX6A 4AL5A 5KT6A 4RNNA 2H51B 5GVQA 1RWOB 2E9ZA 4O4GB 3Q8PB 1Y7PA 2E5LF 4HH1A 2DO4A 4QIGA 3BN4A 3PIPQ 2YY3A 1X4HA 4PG7A 3LP1B 1RAJA 2KHCA 5HO4A 5CQGA 4RX6A 2FJXA 2FY8A 4MYUA 2DYAA 1SUQA 4LRCA 1RWVB 1S1UA 4XDCA 1U0HB 3IG1A 4NLOA 1HHQA 2HVZA 4JV2A 3SFUA 3G6YA 5KFQA 4RNHA 4K5SA 3TA1A 1M1GA 1U1KA 3ETOA 4JI6J 1D9FA 3G87A 5B08A 2ZZNA 2DR9A 4ELTA 4WFXA 2G4BA 5F0UA 2HS3A 3HD1A 1WOPA 3MFIA 1WHVA 4K7QA 4X66J 1NK5A 4QBUA 2VODA 4MIBA 1Z4UA 1XNRF 2V2ZA 4LF5J 1YJVA 3UN2A 3CJ8A 1XMQJ 1QUPA 5FJ4A 3H2LA 2MDAA 2ZKTA 3KLVA 4ATNA 3MEKA 4IH7A 3CJRA 2ZE2A 4FXDA 4ZVHA 4PAAA 2B9EA 3M2VB 3OTDA 5IC4B 1CJVB 4OYWA 2FVSA 3VGSA 1VK3A 3WC2A 2PEBA 3Q23A 3SSRA 5HMXA 4U7UD 1A6LA 5K5MA 1HQEB 3D7SB 4PPDA 3UDEA 1HQUA 4ZDNA 3GIJA 5F8HA 2QA4G 2XSFA 5AJ3F 4UOHA 4HL9A 1S97A 4P73A 1J5EF 2NR0A 3MEEA 3OW2R 2JX2A 2HHSA 1DHMA 4CTAA 3BKTA 3VAJA 4DG1A 1VQPS 4LSNA 1Z2LA 4NLSA 2MZQA 3SSQA 2ALYB 1TKXB 3BDEA 1OYEA 4E98A 2OGUA 5IFMA 2P2CB 2WVDA 2J0XA 3NAHA 4F4YA 3QSIA 1WJ9A 2DRBA 3VQSA 2PD1A 2V34A 5KFJA 3LANA 3IM9A 2X1GA 4EU0A 1FF2A 2HAFA 3TAMB 1I6JA 3DM2A 3D66A 4JUZA 4Z37A 4HDHA 3EXCX 2J0QD 2HHVA 3UDCA 2BQRA 5LMUJ 4M95A 1ZH5A 4MKAA 3UCZP 3EDRB 3LALA 4DX6A 4UOFA 1VQ9S 4C0HA 4FBUA 4DV0F 4DR5F 4DX8H 1M0SA 2CNLB 3C2PA 3DI6A 4RBUA 1YI2S 2XMKA 4PQAA 1HPZB 2CQ1A 4OI6A 2RDIA 3MM7B 2QFJA 1EX8A 4DQRA 3TNVA 3QZ8A 2ZFHA 4FPIA 2CVIA 5HATA 3CSKA 5IQQA 5LMNF 1V3ZA 3KLHA 4ZPCA 3HVAA 2ZC3A 3FKBA 2C2EA 4IYQA 1U24A 4FNIA 2MSSA 1PAEX 1FRLA 1UL3A 2YQ1A 3M9OB 2R8JA 4JI4J 3M8PB 1F2GA 1WACA 2MLYA 2NZ4A 1OY8A 2VBWA 2XZWA 2C3MA 2UXBJ 1T9TA 4M5HA 4ECZA 1X7VA 1H6KX 5HVHA 2YNIB 2NYIA 4ECUA 3DRYA 1HKAA 1JNZB 3N0VA 4ZJQA 4DWIA 5JJBA 4RBTA 3CC7S 4IDKA 2BV3A 4DV4F 4Q45A 1REGX 2VFUA 4ZN3A 1VRTB 1CG2A 2B56A 2J6TA 2AJ1A 3H5UA 2KU7A 2W9CB 1CQMA 4YP3A 4USIA 3VVUA 3OR2B 4RU9A 3W61A 2G1HA 2EXUA 3EX7B 3GLJA 2I8EA 4NLGA 4DQQA 1B99A 3R5JB 1I5OB 3D4JA 2HHPA 3PDNA 3TZZA 3A1YG 2M88A 4XPEA 5M2UA 1F60B 3PM9A 1FVQA 4WE1A 3W62A 4ZA1A 4ANCA 3MMCB 2E5LJ 1VRUA 2QA2A 3MTJA 4NCBA 1N5YA 1RTHB 1M5OC 2BOPA 4OJ3A 3NGRA 1FDNA 4N5SA 3T1YF 1KLNA 3GCXP 2DRDA 4P7VA 4TLRA 2H5IB 3KK2B 4DN0A 1MG7A 1NSPA 3WHIA 4I6AA 1WD6A 2UVUA 4WWSA 1SJ4P 1SC3B 3AT1B 1RQ0A 4A48A 2R2RA 4HLBA 3Q22A 2H3EB 2GGPB 3X1LB 2IM2A 2HQDA 2CKWA 2Q3PA 1KQSR 4HYKA 2VJVA 2M52A 2EFQA 2ACMA 3DCAA 2ZKUA 2YWKA 2HGNA 3WQPA 2IVFB 3MECA 4OYBA 2BJ8A 1L3TA 3Q8YA 1UVLA 3NOCA 3L3CA 1XNRJ 2MZ1A 1Q7YT 1RA6A 5HROB 2JVRA 3NG8A 4KFBB 4OI3A 3F0NA 1TFYA 1Q7LB 2LDIA 3C8YA 2W24A 3LGHA 3M30A 2C3PA 4B02A 4PYDA 5D0RA 4Q8FA 2D1CA 1FT8A 1S7HA 2GIQA 2ZHBA 3FEZA 1IKWB 2JWNA 4EZ6A 2VQFF 1H7WA 4OYZA 2B7CB 1SKWA 1HD0A 3BPSP 6FD1A 4LFCF 1CSJA 3HX9A 2KO1A 2AJ4A 2GFFA 3GSDA 3SCLE 4ZHRA 3EUNA 4Q0BB 2E1MC 4A8YA 5KFYA 2Q6BA 5KOWA 5AJ3J 1Q86T 5I3QA 1Q8LA 3QBCA 1ZZFA 1OQ3A 1FTRA 4DPOA 1YWXA 2XBPA 1HNVA 1S1XA 1QTNB 4KPYA 1R6VA 4YFUA 1WTFA 1AUDA 3RYLA 3PJXA 3ZNUA 1FJ7A 5DQGA 2B8PA 4BC9A 1JJHA 3PX0A 4C8MA 5C2GA 2I5JB 3EMTA 1RADB 1WNEA 2RHQB 3M05A 4EBEA 3VQTA 4DN9A 3KHHA 3W5ZA 1DBDA 3SBMA 4IQMA 5JVGQ 2X51A 4C8LA 1J5OB 4NLUA 2HYIB 1VQ7S 1SIWB 1VC5A 4U96A 1FK9B 3ZZOA 1L3UA 2DNMA 1B3TA 2YQ3A 2ZZTA 4ZN1A 1ZYQA 3NY0A 1C0TA 5L1JA 2HWTA 4G65A 1HBMB 3OR1A 4PCQA 2KT3A 4HT5A 4HDGA 4DV0J 4WJBA 3UR3C 1BQXA 1JK9B 2M5YA 3DLLQ 2QYCA 2K7JA 1TL3B 1JLBB 5AE3A 3M1VB 2DXDA 1TKDA 2VDHA 4USTA 5C42A 3R7BB 3P4UB 4C8OA 1NJXA 2Q6CA 1X4GA 3UDLA 1T05B 3LP2B 4N77A 2KVQE 1DLOA 1GX5A 1UVJA 3E01A 1D9DA 1G4CA 1HMVA 5DG9A 3PKMA 2EPIA 4DUTA 1VS3A 2BW2A 2OD4A 3VGTA 4LQ3A 4K8RA 2I2YA 3DLJA 3S1TA 4OYMA 3L7UA 3O6QA 3K5NA 4YQWA 2AZ3A 4F25A 4CLTA 4XDDA 4ICLB 3JB9k 3VVTA 1BLUA 5HL7Q 2JLGA 4ELVA 5D4LA 5KG3A 3SQGA 2CQ3A 1F1BB 4FYWB 3H4BA 3SFGA 3NCPA 5L9XA 2XCPA 2AX0A 2MEWA 4DEZA 4ZVRB 4DX5A 1KVJA 5B0FA 1IWGA 4Y65A 5E41A 4IH5A 1IKXA 1FX2A 4FDFA 3NEKA 1HNXF 2IYIA 4JI2J 1ITPA 1UEUA 3OFHA 2E66A 3TEGA 4PXEA 5C24A 2HWHA 4FYDA 5ETVA 4ANEA 4QR1A 1N0VC 3UCUP 2OPQA 3JXOA 2QZ8A 2XY5A 5K8PA 3M8QB 2PI4A 5CZVA 3MHYA 2IDLA 4NLQA 1X60A 3MPVA 2VA3A 3PCOB 3CDBA 2R8KA 2JFDA 2AYMA 3T1YJ 3AB2B 3BSCA 4ZIWA 1LW0B 2RD5C 1N36J 2W8KA 4QYZK 1L3SA 2DIUA 3ILJA 3TYTA 4I2QB 3KLGA 3G2XA 3Q8VA 1EHWA 1VLYA 3IFEA 1UW9A 1NKCA 1FI4A 3PO4A 4F50A 1WC1A 3NOGA 3MR3A 2WK4A 2GA7A 1M5SA 3DOKA 3VZHA 5IQ6A 4R5PB 3UWTA 2B5JB 3DLEA 2BR0A 4WU3A 1NPPA 1CJTA 3LQVA 5KFFA 2XC9A 2CDQA 1NKEA 1WHXA 2C2MB 1FJGJ 1B64A 2XY6A 3OTCA 1KOOA 3D3BJ 3J7YU 3DRSA 1HNWJ 1U1LA 4ERDA 3MPUB 4K4WA 3W2VA 3BB5A 2VQFJ 1Z1ZA 3X3UA 2ZH5A 1HW8A 3D5MA 3UNYA 4DPTA 4LFCJ 1H3DA 1KEKA 1FHTA 2OELA 1V3RA 4NXNJ 3KLFA 1NHUA 1TAQA 4PG6A 2E7WA 4LQ9A 4EMDA 5HQLA 2CPFA 2QIFA 3R9LA 2OMOA 1S1TB 1VC6A 1UJ5A 3GJRB 2HFUA 2IIHA 2KN4A 4HEA9 1LXJA 1XBWA 3VCDA 4AXJA 5KFTA 4PPZA 2ZD1A 2HS0A 4HT7A 2HFZA 3CWJA 2IRYA 4HI1A 3DGPA 4KGZB 2VC1A 1ACMB 1AZSA 1S6OA 4GVBA 3UW1A 1HBUB 4X4NA 4ZP7A 2OEKA 1MMDA 2R2SA 3IWXA 4Q43A 1XJWB 2DNOA 5GAHI 1KDNA 2V4JA 5T7LB 3T3FA 2RKIB 3CDAA 3JQJA 3OT9A 4O3RA 1NAQA 2Z2ZA 3KK3A 1JLQA 1XIQA 3CDWA 2DNYA 4ZPBA 4KKOB 1IKVA 4BC7A 3MDFA 4KHMA 3OVBA 2MGZA 4EZ9A 3OL8A 4ZCLA 3DRPA 1RKJA 5SZTA 2Y9HA 4KJIA 2IAJB 2I0XA 2HFVA 3DOMA 3BBBA 1LWFA 2QC3A 4X62J 5HQ8A 3DYAA 4ZVFA 3MPDA 3ICLA 4KGXB 2D3O1 2FLPA 4YHHF 1S4FA 3AJ2A 1F3VA 2UP1A 4O0IA 4DL3A 4A8QA 3PXGa 4USJC 2YKMB 2HRYA 4ZVPB 2V94A 2QSFA 1KLMB 2CPZA 5J1PA 5HVGA 2KFYA 2YWFA 1T9WA 4Y6IA 1ELOA 2E44A 2NLWA 3GG1A 2HPUA 2Z58B 5AE1A 3P3DA 2NUUG 1VQ4S 1SXLA 2GVDA 1ULRA 3BO3A 1S57A 2FTRA 5L9NA 1B70B 1FXLA 4M1KA 4LREA 3MXHP 4NWBA 2O01C 2DGVA 4OX9F 3H25A 3W64A 3ENWA 3RAXA 1NBEB 2V8PA 2D7SA 1UFWA 4MKBA 3CJ5A 3KJNB 1YITS 3K57A 3VGVA 3H90A 5I3UA 3RB0A 1AB8A 2GIRA 1I51B 4I2PA 3T5LA 1SJ3P 4OHZA 1FKAF 2O1PA 2N4DA 1HBOA 4C7QA 2MQNA 1HI0P 3SDEB 2EG2A 1NK0A 2FC8A 2W4CA 2CPXA 2XMUA 3VGUA 3RW6A 1S1WA 4OL8A 1WDDA 2OEJA 3WBZA 4CO0A 1Q81T 2JHEA 4FS1A 3GFYA 2W2OP 3AA8A 5L38A 2HNDB 2NSCA 1TU0B 3NNCA 1DURA 4PXBA 3BEGB 2OLWA 2W2QP 3GFXA 4L73A 3THVA 2L3MA 4U7CA 2EFNA 3RUBL 2EKNA 2BJEA 3R5CA 4F0HA 3I9V9 1WOSA 1P6TA 3DRXA 3MFHA 3PO5A 1RT2B 3W8GA 4DSJA 3EM1A 5B0EA 1PBUA 4K5RA 4AXIA 2VA2A 2G1DA 1X0PA 3MAAB 3GR0A 1KTQA 1ROFA 4EUVA 4LFBJ 2OKQA 1R6YA 3NMAA 2EBGA 1QE1B 3M8ZA 1U1OA 2QMUB 4FN5A 4V19J 1REVB 1B7FA 4DPYA 4K59A 1TP7A 3EXYA 2DR6A 3GZ7A 1CQNA 4KSEB 2ASDA 3QMQA 1JXEA 4YY3J 1ZM3A 4CLSA 3TAPA 3WIUA 2XMTA 1T11A 3GB0A 2ASLA 4DR1F 4Y2AA 4ECWA 2P9EA 1NLKL 5IS2A 2LXFA 5GADU 3K5LA 2XM3A 2PI5A 2DNHA 3GMGA 3HVRA 2B4VA 1T03B 3I55S 4ED1A 2HHXA 1VHFA 2FHKA 1IN0A 3M2UB 5E3RA 1M5PC 5A8KA 1RSCA 4ZVQB 2B9XA 2E5JA 3FEYB 4CH1A 1KD1T 1HR0F 3O2IA 3CDUA 1TK0A 2ADCA 4RUHA 4C3KA 4B3TF 1RT4B 1JLAA 3NCRA 2OIHA 3CC4S 4UY85 3M6WA 4MIAA 2N7CA 2OPSB 2RH3A 3MR7A 2DGQA 3CCRS 3MMAA 2GS8A 4EEYA 3PYGA 2W01A 3MM9A 2R7UA 2HKEA 2XMAA 2O5DA 2HRUA 1RP5A 3JSRA 4AUKA 1T9UA 2MQMA 4GO7X 1S1VB 3V4MA 2RRNA 2XS7A 3DRRB 4FYXB 5H1SV 2QG9B 4Q2LA 4TY8A 4IFVB 3G8QA 2WBRA 1FNMA 4NYPA 2VG6A 3PZPA 9RUBA 2L9WA 4JYAJ 1KNZA 3U27A 1OPIA 4IH6A 2XSJB 4H4MA 1YJTA 3VZIA 5IZHA 1GXTA 1K0VA 3V4IA 3SV4A 3W2WB 1W25A 3VWSA 3NLCA 1C1BB 3AHPA 3I4HX 4OLPA 3DXBA 1XERA 3T1HJ 4IRCA 1S99A 3VAGA 4ENOA 1GMUA 2ATLA 1B4SA 4X64J 1MMNA 3A8JA 4JV0A 2AKWB 1Q82T 4B17A 1RAHB 3CTRA 5EUHA 4X4VA 2M8DB 3AJ1A 3HKWA 2R7SA 3NS5A 1IBLJ 4F4KA 1GH8A 5A2QU 4FVMA 4O44B 1M5KC 1T9VA 2NS1B 2KG1A 3V81A 2DIVA 3FCHA 2I9SA 4F0KA 3IO1A 3M6VA 4P71A 1UAWA 1ICEB 3PKYA 1Q8KA 2IMWP 2CJKA 4KHPF 3LP0B 3BGUA 2OSRA 4WFNQ 5KG2A 2H48B 4N7TA 4DF4A 3D2WA 3NBPA 2KM8C 2F3JA 2VF3A 5KFXA 1U25A 5H9FJ 4YR3A 3DGVA 3WIVA 2J7WA 1HW9A 4JV1A 2RRAA 4ECXA 3N6MA 1S76D 2CQGA 4RR5A 2KT5A 4P72A 1R8CA 4LIWA 1RBOB 3ZFVA 4NLWA 1ZTTA 1U7LA 1RHRB 2KH9A 3W3SA 4LF4F 1R8BA 3C46A 4QYRA 3PJ9A 3DLGA 1C0UB 2V67A 1T94A 2EI5A 4N76A 5KT5A 1CS4B 2IYGA 2QLXA 3AY0A 2OO4A 4P75A 4DV2J 3C3LA 3H5YA 1SQFA 2VH7A 1JXVA 1DAXA 2R8GA 2ALZA 1CEZA 3A13A 3IN5A 1VC0A 4QWCA 1S9GA 4FP9A 3CCUS 3ET6B 3HMJG 2F7VA 2OH2A 4P6QA 1XNQJ 3H40A 1TKTA 4CYUB 3ZZTA 3H59A 4AFFA 2RJZA 3O1LA 3DXSX 4FZVA 3CXCR 1Y5NB 4WK1A 5LSOA 3C14B 4BHQA 1F9FA 2PA8D 1NJWA 4O4RA 3CIZA 3SZ2A 3CT9A 2EKYA 3I0SB 3LTOA 3KJVA 4GMKA 4OZNA 3N6NA 3R2CJ 4I6YA 2UVWA 2E7VA 2XZDB 4AT1B 3HVWA 2DHSA 2YPZA 1OO0B 2DHHA 2QFIA 2R9LA 4KY3A 1DQAA 3AQOA 1N34F 1ZA1B 5L1LA 1VJQA 2AEJA 4CLLA 4USUA 1UWAA 4F3OA 2AJQA 3TZYA 4JI7F 4KPCA 1SJRA 3CE8A 3IAS9 2RQMA 4IG3B 3FZ2A 3CCZA 1MU2A 4C2MA 2KHDA 3ITHB 2XYGB 4WYLA 2FVQA 4NCGA 4I6WA 4DR1J 2BVZA 4YB1P 2FGCA 3DHXA 5E3QA 4NLYA 3WC0A 3WX4A 3R27A 1CJUB 2GCFA 2OEMA 2ZM6J 4IRKA 1WC3A 3QO9A 1E6YA 4F8RA 1XQIA 1RTIB 4TQSA 1TKZA 1TUGB 5F8MA 2M3DA 2ILYA 4OFZA 1NDCA 4DL2A 1U4BA 3OTEA 4CM0A 4X2BA 5G4DA 1EB0A 3TA2A 2ZITA 2HIYA 3KNGA 3I4PA 2HVIA 3HVTA 1M1HA 1S9FA 1XMBA 1BD6A 3K8WA 1TL5A 1Y11A 2C2OB 2FHOB 1S9EB 4ECVA 1MWYA 3CB4A 1LWCB 4XO0A 1PYSB 4JI1F 1E6VA 2QYGA 4DR7J 1QAIA 1IM4A 2L08A 3KJQB 2VASA 2F40A 2C2ZB 3IRXB 4UTGA 3CJKB 1KBRA 4UZBA 2BMBA 3N28A 3PYDA 2IC3A 3OHAA 4ZIVA 3FEXB 1N33F 9ATCB 1VJWA 4NA2A 5MLCV 4DV7J 1O5JA 1RDRA 2HURA 1C4CA 1H2TZ 1YJRA 3KHLA 4HTJA 4J9OA 3W5XA 5F9NA 5IWAF 1JJ4A 2JDJA 3T9ZA 2IA0A 3RRHA 3HFVA 2FLLA 4DR4F 3DLKB 3LA0A 4YEAA 3BGFA 3ZXWA 1U6FA 5B0GA 5KFEA 2KYZA 3EVWA 3OPKA 3OVSA 2AD9A 4B3MF 1RT7B 4B3OA 4PQUB 2UUAF 2MY7A 1RWNB 3HXMA 2EK1A 4GO5X 3P6YC 3OFFA 1RTJB 1NK9A 4O0NA 3KMQA 1UFKA 2BJ7A 3AOCA 1W2IA 3ZZPA 2MZTA 3RAQA 1O51A 4DFKA 2VKZG 3GJTB 4QW9A 4GKKF 4KHPJ 2PFDA 1Y0HA 1Q79A 3UN5A 4K4SA 4ITSA 2Y8YA 1ZM2A 1GEHA 1U47A 1FNXH 4OYIA 2ZWOA 3J80Y 2BQUA 1I94F 4DV3F 3SYZA 2VPWB 4EYIB 3TQ1A 5EN1A 4Y3CA 2XZTB 1VR6A 3U1MA 2BA9A 1SUQB 4ED3A 4I69A 4F4WA 1S1UB 2F1FA 2EC0A 2PGCA 2CZ9A 3IG1B 2IVMA 2KVIA 2IBKA 2XO7A 3F44A 3D28A 4O3QA 3ZTQA 4WXWA 3D9BA 2DJWA 2MSTA 4PZVA 3MUTP 2BE2A 1SJFA 4J9SA 3IR6B 1IQZA 2ZJQQ 1TVRB 4EWTA 2KRBA 2F8MA 5IT4A 4HHJA 2HHHF 5DDQC 5KG5A 2NSBA 3W9HA 4I7FA 2BDPA 3H0PA 2GHWA 3M9MB 4HR2A 3HHLB 1JLEA 1B7YB 2HFSA 4MT1A 3OVAA 1TELA 3I0RA 5F8LA 4DF8A 2ZE2B 1IVZA 1RT6A 2C1EB 4J90A 2Z2LA 4DUYF 1JMTA 1VQ8S 4WP3A 3KK1A 4HTIA 3PW0A 1VISA 1HQUB 1FFSB 4OX6A 2GJ2A 4BLGA 3R5BA 4QIVA 5HP1A 2J0SD 5E33A 2BJ1A 3BDPA 3MEEB 2RDJA 2OUGA 5F3TA 3I96A 3VR1A 1N34J 4CTAB 4OJGA 4DG1B 4LSNB 1R0AB 4YUDA 4ES1A 4AD6A 4K4XA 2CWKA 4KH0B 3FC9A 2JC0A 1GTEA 4BWJA 4BBYA 2MYFA 4AQYJ 2R7TA 3FQKA 2ZOMA 3MWBA 1NK4A 2RU9A 1EQMA 2J7UA 1S79A 3QJJA 3QATA 3EE3A 3ETMA 2AZ1A 3POTB 4LVOP 1PJ6A 1EQ0A 1D0EA 2UV8G 3RZAA 5D6GA 1RWMB 3GONA 3DM2B 1QM9A 1YLXA 5ITHA 1I1GA 3B78A 3J80U 2YBVA 2MKCA 4M5IA 4JI0J 2VDIA 1YX2A 4C3LA 3DLHA 1MN7A 3TR5A 5HANA 4M5MA 5GAEU 4HKQA 3QJPA 2P9GA 4KV8A 3H2VE 4OYOA 1HNZF 1RYRA 5A6PA 4TN2A 1RISA 3FK4A 3DI6B 3BF4A 3ILOA 3NGUA 2EFGA 2GJFA 1GMWA 3SCJE 2YNGA 4P74A 2VJUA 1HFEL 4DSFA 3DOLA 4W90B 4GRSA 3TJAA 2DR5A 3KHRA 3DLBA 1A9NB 3KLHB 1IR0A 3GTYX 3U1NA 3D6HB 4LR8A 2AGQA 1N48A 3SXLA 4NZ6A 2JSXA 1N33J 2K1RA 1UZHA 5F8IA 1WC0A 1VQKS 3C6UA 2GAGC 4YOEA 2CQDA 3BO4A 3RB6A 5BJRA 2CPDA 3KWMA 1LWXA 4DZDA 4B08A 4JV5J 2NXCA 1OIAA 2BJ3A 5J2QA 3ELHA 5E3CA 1U6BA 2Z0GA 1T9YA 4ECYA 2Y1IA 4NXMJ 3M32A 2C3UA 3K17A 3M6UA 4IDKB 3HZEA 4O3SA 2GQCA 1XC9A 1DQ9A 1IR1A 4F02A 3H20A 4C6AA 2YXLA 3MR5A 3BH6B 3AD7C 5FIIA 5KG0A 3QGPA 2H9ZA 1IJEB 1GQEA 2HZVA 2QX0A 4DFJA 3AXMA 4F2SA 4ILLA 2J5AA 2MQ8A 1QSSA 1S12A 2RE1A 5H9EK 2P8IA 1N0UA 4WE1B 3R1HA 3JQKA 1NMEB 5KT7A 2OMLA 2DXEA 3TUIC 4W4MA 2UU9F 5CYQA 2JL9A 2ZWPA 3G4SS 3FSYA 4Y2IA 3PV8A 1N5YB 2KJWA 4ZVTB 2GVZA 4IOBA 1I94J 4DV3J 2WONA 4QCLA 2GGPA 2HG4A 3F41A 3J7AN 5KFUA 1K8AT 4RW4A 2GO9A 1NZAA 2HFOA 2PC6A 1Z2ZA 3GYGA 4N56A 2GZOA 1HLWA 2GJIA 1ZOTA 1NJZA 1F5AA 3HCXA 3DC2A 4UY8T 1FD8A 1RE1B 1JNRB 2HK2A 4RWXA 1IBKJ 2C2KB 2FUG9 2CQ4A 1JIHA 3I56S 3MECB 1NUEA 1HNIA 2Y1LB 2NUHA 2WB4A 3QZ7A 1V5IB 3OBIA 3ADAC 1WWHA 1RAIB 4ES2A 3M30B 5ETRA 1D8ZA 4WCEQ 3TANA 3HT3A 3MURP 3CIMA 4MTPA 5DM6Q 3LPEA 2FHJD 2ZNZA 3GP9A 3DDIA 2VB6A 2ZBCA 1T02A 1PJ7A 1W7WA 2VG5A 3N4WA 4ZP9A 3I32A 2PT0A 3BQ0A 4IFYA 2XHCA 3VAKA 1ZM9A 2HZAA 4ZHRB 3MEGB 3DKDA 2WW4A 3DDKA 2XS5A 4J9MA 3NGTA 3H5XA 1VMBA 1UVKA 1K47A 4RW9A 4B9MA 3MTKA 1FXDA 1X4DA 1RAEB 2HBRB 5ETSA 1HNVB 4X4QA 2HIQA 1S1XB 3BYRA 2FJEB 2VHGA 2VIHA 2DPJA 4FKYA 3CJQA 4OJHA 1YHQS 2KFZA 2NYHA 4L72B 2DY1A 2BKPA 2CJQA 2SXLA 2Z4PA 4KC5A 4DPWA 4LBIA 3NWRA 3W8PA 4NMLA 4A4JA 4W92B 2FZCB 2Q66A 4OI4A 1FK9A 2OTJS 1AUSL 5KFLA 3CVKA 2UXCJ 2B4OA 1FESA 4YR0A 2DNQA 4GKJJ 4NYOA 2OFGX 5ETPA 2IA6A 4B3RF 3EGNA 4ID5A 2JEIA 2LQ9A 1U8WA 1X9MA 1X9SA 2V8DA 1S7IA 2W9AA 3KOAA 2YWEA 3OR1B 4TYBA 4DV1J 3TA0A 4NLPA 1YKWA 4F67A 3VAIA 4IUFA 3BO2A 4WP9A 2CRLA 1PAUB 4CZCA 2GMLA 1RYSA 1QAXA 4MIWA 5C42B 4HH0A 4YB5A 3KLEA 5DS7A 1URRA 1Q0NA 4WFZA 3E01B 2R7XA 1L3VA 4UQTA 3BQ1A 1HMVB 3SMZA 2KXHA 4QU7A 3V6JA 2KXFA 2ZJRQ 1TV6A 4CH0S 1OPZA 2M70A 3IRWP 5JMNA 3TP2A 2LMIA 1RZMA 2UUCF 1NB7A 4DR6J 1BQNA 4J7CA 1HARA 3B4DA 4LF8J 1EIYB 2BACA 3K59A 2IJRA 3NCQA 1VQSA 3Q86A 2CG8A 2QA1A 5AT1B 2CPYA 5LOQA 5MAOA 5D0EA 2G2OA 3N9UC 4WTOB 5KT4A 1RBAA 1VLOA 3CO9A 2VPZB 2IHR1 4LFAF 2WVEA 3QIPA 4NYZA 5LJ3Y 3HSDA 5HI7A 3MUVP 3N6LA 5KG4A 1OJ4A 1X8DA 4IO1A 5LT5A 3SQGB 1ZS6A 1RKIA 1UTAA 2V8GA 2AHOB 2FJVA 2O66A 3QGHA 2FJAB 4Q44A 4BCAA 3M7VA 3TZWA 5GAGU 2LKZA 3KUHA 5FD1A 2BJDA 4M8LA 2J0WA 1IKXB 3GV5B 2KI2A 4C97A 1LFPA 3RB3A 5KFPA 2NPFA 4DUZF 2J9DA 1WHYA 3K58A 4ES3A 4PRFA 5AXMA 2LU2A 1TK8A 3H42A 3KKFA 2OPQB 3AFGA 2A6MA 4V19X 3PHEA 5ETNA 2IFXA 3H98A 2RU3A 3OXLA 2XHWA 3O3LA 1APSA 2UU9J 5C2CA 1YZ6A 2RF2A 1WF0A 2B4UA 3MR6A 1GK8A 2CNNB 1XWLA 4JOUA 3SQOP 1UZDA 2XYPB 3UDVA 2KZMA 4CI0B 1IJFB 4WK3A 2CG4A 2E5HA 3KLGB 2EFVA 2CDRB 3HLUA 2X1BA 4N41A 1XR7A 5C5JA 4LRAA 2LDYA 2GV1A 3P8BB 2VL1A 1HWKA 5HN0A 4K4ZA 1RWXB 1XMOJ 3DOKB 3A3OB 1SVDA 2HK3A 2RT3A 3GSIA 2ACYA 3AJDA 1CJTB 3HSGA 4KGMA 3W7BA 1PSDA 4Y00A 1F5CA 2I1RA 3SV3A 3R2DJ 4ILRA 4DLEA 3E51A 3GWCA 1TK5A 5ETTA 3GE9A 4DFPA 4ETZA 2DNLA 1N4LA 5G0RA 4FNHA 3GCWP 3DRSB 2YKNA 5IV3A 5K14A 2NZCA 2YQ0A 1AT1B 2AYBA 1P8GA 4OZ1A 1VBKA 1N32F 1SKUB 2R8IA 1T0TV 1QSLA 4DV6J 4RJVA 4ANDA 3KLFB 4P2FA 1EETA 4DR2F 4DCOB 3FMWA 3OJUA 3Q2SC 1JB0C 1RT3A 1S6PA 4FPRA 2LQ8A 4OJ1A 5DDRC 5I4MA 2R7OA 2ZVSA 1ZM4A 2V5HG 1CC8A 1NCLA 3CD6S 1UJ4A 3AD9C 2ZD1B 3QT5A 1U45A 1VQYA 2JFKA 2HMIA 4YDXA 3I5CA 2OPPA 5B09A 3DGPB 3PYEA 5DRKA 1AZSB 2OSQA 3NP5A 2BYCA 4GVBB 2DRAA 4LF6J 3TX0A 2A10A 5B0AA 2KFNA 2UXDJ 2H1YA 2V4JB 2F63A 2AJFE 1RACB 4EO6A 4DMZA 2KKHA 1RABB 4JI8J 2GQQA 2IDEA 4M94A 3KK3B 1PC5A 4JI3F 2V8HA 3BYPA 1JLQB 3UD3P 4RNMA 3LH2S 1NKBA 2I6WA 2ABYA 4K50A 1IKVB 2Y8WA 3QQCD 2UUBJ 1U1PA 2MGZB 4XK8C 3BKUA 4R8UA 3QNWB 4L76A 5CA5A 2WCXA 4CT9A 2F4VF 3DRPB 3BZQA 2MPUA 3DOMB 2OHDA 1LWFB 5SUHA 3DYAB 4RNOA 5DLGA 2XLIA 1HD1A 4FBTA 4F0MA 2X1FA 1DTTA 1RU1A 4LJMA 1JLCB 4A47A 2ZH6A 4XTTA 1Q53A 3EGWB 3W5YA 2LU1A 4G6VB 1VBXA 5H9FK 2DITA 1CLFA 1DZ5A 1TAUA 2FJWA 5BR8J 2E9RX 1RT5A 5ADZA 1JLGB 4X4UA 2CQCA 2XULA 3F73A 3DHWC 4ZCKA 4G1QA 3OUYA 5J1EA 5EWEA 2GVDB 4NZ7A 4CNYA 1VOMA 2VZ9A 2HNYA 4PUOA 1H2VZ 1NDPA 4PABA 4D3HA 4IOAQ 2YNHA 4RWWA 4I4BA 4MK9A 2HVDA 3KXDA 4LBPA 4Q7AA 2CQIA 1N88A 1WSRA 2BX6A 2CQ2A 1HA1A 5I3UB 4K0KF 3A3PB 3M8SA 1MROA 1XK8A 3AOBA 3VF0B 5DGAA 1RWWB 3JTPA 2EK6A 3BGRA 4P2XA 3MCNA 3HI9A 1FRHA 3PRVA 1HBOB 1M90T 1FJEB 1UPMB 1U2FA 2PDAA 4N8NA 1G7CB 2D69A 3KLIA 2VU5A 3B8HA 1S1WB 2RS8A 1P1TA 3FBFA 4J9PA 3PW5A 2GHVC 4EI2A 4XAKA 1Q1KA 5DG7A 2EFOA 4J9KA 4LF7F 2EWHA 3THPA 3D0IE 2OAUA 4OHXA 3PACA 4R25A 1LW2B 1RHMB 1N54B 5U47A 4J9LA 2V6AA 1UCNA 1BMQB 2WAQD 5A8RA 1PJ5A 4TXSA 4DS5A 5ETOA 3CCSS 4JBCA 1X0FA 3FBEA 2FPHX 5CYJA 2ZBRA 3ZZYA 3PX4A 4FXWA 2W4PA 4YB7A 1FFWB 5BYRA 2B0GA 2QL5B 3QGIA 1REVA 1KR4A 1WELA 2HBQB 3GU0A 1FJCA 2Q79A 5AE2A 2VFTA 4NPOA 1KVIA 4QQBA 2MTLA 5KG6A 2ADBA 5D15A 3A8KA 2BOAA 4J9RA 2FZKB 3HFZB 1SKSA 2FIUA 2B3TB 5EHHA 4C9DA 4U6PA 1YJ9S 5L1IA 2XNRA 2HQFA 4I0WA 2CNOB 2XY7A 1YDLA 3MM8A 4DI6A 1ZPWX 1WHWA 1JJCB 2WSEC 4M5JA 2FD2A 2AEMA 3NKYA 4ZS6A 3UI3A 1HWLA 2JOQA 4KAIA 2HNZA 3RRKA 2QO3A 1MW7A 5KG7A 2EG1A 1Q5VA 4DFMA 3EYZA 1WDTA 2L9DA 1CJKA 3CCQS 3QT8A 2ZH9A 1IKYA 5HMYA 2IY5B 4ZP6A 4KO0A 2W9BA 1JLAB 1X4AA 1GMWD 3SEOA 4U95A 2IVYA 3C66A 2KJVA 4X65F 3CCJS 2QLWA 4G1IA 4MK8A 3EVMA 1NJIT 2JRSA 5A0YA 1J5EJ 2HBYB 1OSDA 3MMAB 1KONA 4B3SF 3DRRA 3L95X 1ZA2B 4IFVA 2EW9A 5T14A 2VBXA 1S0VA 4UQGA 3JTOA 2QJ3A 1SJ1A 3MM5B 3HF5A 3PW4A 4ED8A 4TY8B 4O23A 2RQKA 4H4OB 4ZKAA 1VYAA 8AT1B 4A8XA 2VG6B 3QLHA 1TUWA 2VFSA 5C25A 1XTZA 2DGTA 2E29A 1WUUA 2CPJA 1PBAA 4H4MB 1QUVA 1X4FA 3ENQA 3U7JA 2LYVA 2UZAA 3V4IB 3HHNB 4DPUA 1PILA 1S6UA 4J9QA 3HT0A 1RHJB 3BR9A 2WVCA 1S77D 3T6JA 4K4YA 1QD1A 1QSYA 2B6AA 3QWPA 2H5JB 5D4NA 3EGZA 2VBYA 3JS9A 4OZ5A 4Q2MA 5B0BA 5KOXA 1SV5A 4FF1A 4QWAA 1NHVA 4DR5J 2A18A 3P5TL 3T5HA 1XEZA 2GIFA 2FHMA 4IKAA 4WZQA 4A8SA 4C98A 3Q0AA 2AT1B 3V81B 2G0IA 5KTQA 2IPOB 2DTJA 2LQ5A 1TTHB 4CRJA 3G71S 5HLFA 2XYHB 5LSLA 5A76A 5LMNJ 3EJMA 2RQ4A 2LCWA 3AODA 2YKQA 4U8YA 4B9VA 4MK7A 4CIOA 3CMAS 2GX8A 1S59A 5L8RC 3EWGA 1RUSA 1OSCA 2ZNYA 4KTQA 1H98A 4K4UA 2FZGB 4OZJA 4JI6F 5LL6d 3L9ZA 4J5OA 4NLTA 4DL6A 2N82B 2W4DA 4CO1A 1SJQA 4CLFA 3D54A 2V50A 1UEVA 5K8MA 4ECSA 4OX7A 4LR9A 2DNGA 3NAIA 4YN3B 3DFEA 5E2QA 4ZOSA 2R8HA 4CDIA 4HHHA 3J7A1 3DLGB 4ZLJA 4DV4J 1XMQF 2CQBA 3PYFA 2DGWA 1EARA 4KR0B 3EPGA 4DQSA 4U8VA 2A0FB 4IR9A 2WOMA 3DMJA 4USWA 1TL7A 3CJ0A 3Q8QB 2KRRA 3E3XA 4ECRA 1WSVA 4OHWA 5E0OA 1S9GB 1OY9A 1RGVA 1LXNA 1YBAA 1QAJA 5KT3A 2PFFB 1TKTB 2YKOA 2ZH2A 5JVHQ 4LF7J 3ZZRA 4UUXA 3K5OA 3FMBA 4PWDA 4PYAA 3PG9A 2XWYA 2WSFC 1O6XA 3H5SA 1SL2A 1H7XA 2DGSA 4TYAA 5M2PA 4TLQA 5L1KA 2JH3A 3KJVB 3OLAA 4WKRA 4OZ3A 2F8HA 2XB2D 4YR2A 3MF5A 2ZHAA 4J9UE 4E2FB 3KTQA 3KUGA 2NXUA 1NDKA 2J6UA 4C4WA 5H9EJ 1NNDA 1Y10A 4TKTA 1U49A 2P5VA 5J2MA 4RLEA 3ITHA 8RUCA 5CCMA 2DB1A 5GADI 1SC6A 3TUZC 1MU2B 1KOHA 4NLDA 1AROP 3W65A 4LBHA 4CO5A 3L09A 1SCJB 4NCGB 3CJ3A 1Q4RA 1SQEA 2BM0A 4OLOA 2LEPA 5LMUF 2YX4A 1KC8T 1LV5A 7AT1B 2PIIA 1KFSA 2XLKA 3JTNA 3QO9B 1A7GE 1E6YB 3Q89A 1K9MT 2EBEA 2U1AA 1WG4A 4F36A 1RBLA 4E8UA 1TKZB 4RUBA 3V6DA 5IOLA 4C3MA 2CADA 2XCAA 5J2NA 3HJFA 3RW7A 4DQPA 1PC4A 2L9NA 1BC6A 2CFXA 3FDSA 1KHWA 1DJ0A 1U1NA 1PO6A 1MSWD 5IT9Y 5KFNA 1S9EA 1R3NA 3CEDA 1NDLA 3HVTB 4DCJB 2OPRA 2PMWA 3ILIA 3GR1A 3NRBA 1RT1A 3IS9B 2PMHA 3TJ8A 2MHEA 3G82A 2K8GA 1E6VB 4QPTA 1P1LA 2GAHC 3DU5A 4JI4F 2F5GA 3RGIA 2MLZA 4WYWA 2IC3B 3BSAA 4OI2A 2MLXA 2UXBF 5GMKa 3RBZA 3JAMY 1IUJA 3BBFA 3TUJC 4O3NA 3IBCB 4ED7A 1FKOA 1X4EA 5CH7B 4DBQA 5IT0A 1D09B 1AW0A 1UJ6A 3GIKA 3NNAA 3UNGC 4RL1A 2GC8A 3NGSA 3MMBA 1JKHA 1WC4A 4Y2KA 3US5A 1RWKB 2XI2A 3DNCA 2R2UA 4MKVA 1KQGB 3QFWA 4KGVB 4B3OB 5D8HB 2HVEA 3UVJA 1AA1B 1LK7A 2V68A 4D3GA 4C0BA 2CVEA 2ZH3A 1W26A 3CDEA 1U1RA 1NXIA 2FY1A 1U0SA 2W7AA 2N4CA 3TX8A 3VAHA 3JSMA 1YK9A 3QSYB 1FRJA 5KFCA 1RAFB 4Y34A 2DPIA 3TVZA 3FFIA 2RQCA 2CZVC 2E5IA 4UW2A 5F3ZA 2RUSA 3KG4A 1C1CB 1M1KT 1BY9A 3MR2A 4GVLA 2PEHA 1NB2A 3S7RA 4EK2A 5IT9U 2YX7A 3PR4A 1FDAA 4OHYA 5A8WA 1TVRA 1T3OA 3GFHA 2ZEJA 2HW3A 4C8ZA 4PEOA 2BE2B 4LRDA 1CULA 1PYOB 3F56A 1JLFA 2X3DA 3HHLA 1RXOB 2WB1D 4DU8A 5FDLA 2AW0A 4UT4A 4I7FB 2ZH1A 4Y28C 1H38A 2XTJP 1JLEB 1HNXJ 4C8NA 3KG0A 3JAMU 3I0RB 2QLFB 2DEIA 4L3NA 1RT6B 3BS9A 2XI3A 1RHQB 2Z8QA 2AV5A 3FRYA 1EAYC 1N5TA 2KTQA 2KDOA 5KFVA 1YIJS 3KK1B 3V6HA 5LXYA 3NGKA 3HPOA 1YQHA 1KQFB 3MAHA 4A8MP 2QA4S 1SKRA 5HP1B 2FC9A 1R0BG 4PG5A 3U1LA 4M5DA 4YS2A 4RNFA 1R0AA 1MNEA 4NMXA 4QJVA 3ZTOA 3TOQA 4ZPVR 3QPIA 1NRKA 3JYTA 3THTA 4IO9Q 3C6TA 2DKOB 1QVFR 1KKHA 2NPIA 3ZTSA 1O8BA 3BH7B 4TU9A 3S01A 2JZ5A 3ISNC 3POTA 4C11A 2QL7B 2UV8A 4ETXA 5IV4A 2P9CA 4K2XA 2QV6A 5J2PA 5A2QY 3AAWB 4GC6A 2JLEA 2C2RA 3CJ4A 1G2EA 1DQ8A 3BSOA 1QTMA 5BXIA 1VQLS 1K1SA 3J81Y 4ZVOB 1OQ6A 1I3OB 4FF2A 2WBMA 4EBCA 2XGQA 3FVYA 1HBNA 4EO8A 1A0OB 4ZJLA 4YMEA 1BQMA 1U09A 3LWMA 3TVYA 1FRMA 1WEZA 4V1Ak 5B7WA 1UVIA 1G6BA 4KV8B 2DR7A 3BREA 3AD8C 3HHDA 2FHJA 5CYMA 4ZPTR 2V2QA 2A2DA 3MOJB 3JSYA 1VIOA 1U8SA 4RKUC 1Q8BA 2I38A 2CQ0A 4M5LA 3Q8UA 3PIOQ 1L3KA 4FS2A 3IMQJ 4L75A 2YNGB 2E1RA 1RLDA 3DOLB 4DU7A 3OL9A 2C3YA 8ATCB 4FXVA 3IR5B 3BR8A 2PA3A 1Y5LB 2VFVA 2Z56B 4ZPAA 1CVJA 4F04B 3QAEA 4LUBA 2W2PP 2JC1A 4QZVB 3RU0A 1F9EB 3ZNJ1 4DR3F 2B8QA 1EP4A 2K1RB 2CJXB 2MB0B 3NXZA 3C6UB 2G0JA 3UCGA 3FBCA 1X5SA 1YG0A 1U2RA 1ZBTA 2AIRB 5KFHA 1HI1A 3C15A 3PEJA 1UVMA 1VDHA 3NMRA 5J2QB 4WP8A 1KS2A 4OZ2A 2D41A 4GC7A 3V5RA 3M32B 3OFGA 4XPCA 1JWWA 2CWXA 4DV5F 5DM7Q 2W1BA 2M7SA 1KN6A 1PGZA 1EZZB 5IM0A 1FD2A 4JI2F 1U48A 2UUTA 1BE4A 3ISND 4CM2A 4IQXA 4RW6A 1N6QA 1KP6A 2M8HA 2WHOA 3T1AA 2UVRA 2LVWA 4YHHJ 1X5PA 2JLFA 2ZH8A 4OMFG 3EDQB 3PFOA 1D8YA 4B9UA 1LQ9A 3HFKA 1GNKA 2KXNB 3MEDA 4RW7A 4X84A 1B0PA 5KFOA 3J81U 4RW8A 2H65B 3FCVA 1NK8A 1VGYA 3J7Z5 5A6WA 2LFVA 1Q78A 1IM6A 3AOAA 1QDUB 1N36F 5CYQB 4ED4A 1KRPA 2BABA 2D9PA 2XWXA 3H2UB 1WC6A 3PX6A 4NL5A 2V8VA 4NE9C 1KVKA 2GVZB 4NI2A 2CIMA 2W25A 5C7PA 2WONB 2XMJA 1YBTA 2CJBA 3B4MA 2XEXA 2MMYA 1FWPA 4RW4B 2YKPA 1R8AA 4DL5A 4OX9J 2MQQA 3OTOF 1FCAA 2ZZMA 3RJMB 5I42A 3V6KA 4WTYA 4WIQA 5HBMA 1RTDA 1S6QA 3CNQP 4QOTA 2RAQA 2RB7A 2QTWA 1FJGF 5AXNA 3S6EA 1URNA 3E8OA 2MY8A 3DDNA 2HQCA 1HNIB 1IBCB 4IG0A 3I5AA 2YNFB 2ROPA 1VQ5S 2HLTA 1HNWF 2D74B 3TI0A 3W60A 2QE5A 1R89A 3EVOA 4A8WA 5CHCB 1TL1A 1QVGR 3ZTRA 4DL0C 2VG5B 3CC2S 4NXNF 3OV7A 3BGOP 3MEGA 1N56A 3HZGA 1FKPA 2FJDB 1HHTP 4IFYB 5F8NA 3LWLA 1NSKL 3A12A 1NHKL 3P5BP 2F4FA 1UA1A 4XIUA 3EICA 1NK6A 4FF3A 3OL6A 4RW9B 2GW8A 2V2KA 3P96A 4MKYA 3RR8A 1TMMA 4A8FA 3I9ZA 1T7PA 1HYSA 2R3VA 2AYGA 1LOUA 5EGYA 1YJUA 3UQSA 3TZXA 2Y1RI 1UWBA 2AEFA 1VFJA 4URGA 4MFBA 1K1QA 2XQCA 1ZPVA 2HLUA 2OTLS 4M5NA 2P6TA 3OLBA 3M6XA 3VHQA 5EX0A 3MM6A 3PJWA 4KE5A 1KFDA 3PTWA 4TQRA 5GAEI 4O3PA 2BANA 3QYYA 4G3IA 1RU2A 1Y3JA 2VG7A 1GXUA 2VQEF 4K4VA 4ZITA 2F8EX 5K20B 2XMWA 4ID5B 2JEGA 3PHTA 1XR5A 1X4BA 4X62F 1BXNA 4TY9A 3FBBA 4ZPWR 4UZCA 3C16A 1HR0J 1DTQA 1LWEA 2V9KA 4TNOA 1N5QA 2W8LA 3KDNA 4YB6A 3O8WA 2E5GA 2GHPA 3N5FA 1OS5A 4B3TJ 4LSLA 3VAMA 1D1UA 4DL4A 1VQNS 3D1OA 1TUVA 3BPDA 3CD7A 2BQ3A 2CPIA 4YDDB 1RCOB 3LGMA 4CO3A 4HACA 3KLEB 5HJXA 3UR0A 2VFRA 4OZLA 5DG8A 3SSSA 3K7RA 4DXLA 1QAYA 4TU7A 1X31C 3G8SA 4P2MA 1DY3A 2MZSA 1TV6B 4DR3J 2ZJPQ 1ZAXA 2QGFB 3PVXA 2G0CA 1BQNB 2E1PA 1DRZA 4I56A 3A8IA 2DNPA 2G13A 2ASYA 3IBFB 4ECTA 2M0GB 1N52B 2Q1LA 4PXCA 2MHNA 4B9TA 5D3GA 4B9NA 2IM0A 4F3QA 1KSPA 3QIPB 1YTYA 3G6VA 2IM3A 1SL1A 2VOOA 2NQPA 4QWDA 2DNZA 4F4ZA 2O3DA 4ED0A 3QRRA 1EJ7L 4DV5J 4LF2A 1BHNA 4MMOA 1M5HA 4Z7YA 1S0NA 2AU0A 2DGUA 2R7RA 4C0OC 1T9XA 4JB8B 5KFMA 3CCWA 3M2RB 2KL8A 2POKA 2OD6A 2VPXB 3CD0A 1MMLA 4JI5F 3N79A 2U2FA 4I64A 4L74A 2ZBIA 3LUYA 3H4DA 4F2RA 1HL6A 3EZ5A 4QIWD 3TRGA 3LW5C 3BN7A 3QT7A 4O4GA 2YKAA 1VIXA 1TQLA 5F41A 2HWIA 3O5TB 3LP1A 2YVSA 2H5EA 3UFCX 2RF2B 1WG1A 2AF6A 4F26A 1U0HA 2Y0BB 1T8EA 1UPPA 4LFBF 5DDPC 3HK2A 2IBOA 5EDWA 1S10A 1Y4ZB 4X4OA 2CQHA 2MQLA 3OTOJ 3QJLA 1LK5A 2X1AA 1YRXA 1WC5A 3SIPB 3UE2A 4IRDA 1R31A 4YY3F 2DBBA 1X4CA 2PN6A 1HI8A 3AB4B 3VV2B 1RAOA 3E2EA 3TARA 1NK7A 4DCPB 2DNRA 4P9SA 5ETQA 5D0GA 2XLJA 4LF4J 3MD1A 2FLNA 2K2PA 2DH8A 4CLWA 4ED2A 4UF4A 3D1HA 4CLKA 2BM1A 2ZBPA 2Y0SD 1RHKB 2OJ3A 2VBZA 4OYAA 5G0RB 2CUYA 2YKNB 3CJTA 4C48A 1GXLA 3M2VA 3Q8RB 5K14B 2VD3A 3ULHA 1CJVA 3T5JA 3KYLA 3G8TA 4ILMA 3MCOA 1YJ7A 1K73T 2MZRA 2LA4A 2E1CA 1HQEA 3BSNA 4WKYA 4U7UK 4OIXA 3MMJA 1H0HB 2MXYA 2ZOGA 2N3OA 3R8YA 1EETB 3JQMA 1RT3B 1S6PB 3I6PA 4U9RA 2DGXA 1WEXA 2CNKB 3K5MA 2AGPA 3A8EA 3R6LB 2HMIB 3T19A 3IC1A 3HHLC 1TKXA 5F9LA 1HWJA 1CC7A 2OPPB 2WW8A 1GFWB 3N5BA 2WRMA 3MPYA 1NSAA 4K2JA 4JI7J 3MCMA 4PXDA 4JYAF 2QEXS 2ERRA 4PR6A 2FVRA 2D9OA 4Z7CA 2W7PA 2ROGA 2Z57B 2DHXA 4Y2CA 3TAMA 3NS7B 4ZLNA 2BRLA 3T1HF 4EBDA 5HJYA 3MOZA 2VQEJ 1Y9OA 4X64F 2IJNA 2COLA 1WORA 3CCES 2L41A 5DQIA 3IGVA 3VALA 1RJJA 4R8UB 1RA7A 3FGVA 4USKA 3GV8B 1FEEA 4ZLLA 1W2BR 3IXQA 3ISZA 3QGGA 1IBLF 4WF9Q 2RDDA 3MGJA 1HPZA 2M2BA 3MM7A 1JLCA 3QAUA 2VV5A 2FB0A 1VBYA 1SC1B 2HZCA 1OY6A 1H74A 3V2UC 1RAGB 2LLZA 3RAMA 1DTTB 2G2ZA 3OL7A 1WF2A 1Q8IA 1JLGA 1X5OA 2ATCB 4RUAA 2J7KA 2R2TA 1NO8A 4ZPDA 1RWUA 2ZC4A 4DHVA 4ECQA 1RT5B 1J27A 1P9YA 4JI1J 2ZH7A 4NX9A 4WFBQ 4F7VA 5E3PA 4G1QB 3OUYB 5J1EB 3PW2A 3M8PA 2A6OA 3CCLS 2KG0A 1F6TA 5M2RA 1ZTWA 4OV1A 2HNYB 4RU2A 4PUOB 5DQHA 3VTIA 2J8SA 2YNIA 5EWFA 2XGPA 2C28A 2EC2A 4M5GA 3L4BC 2YNHB 4FYYB 2CA9A 5HK4A 3AA9A 5GAGI 5IWAJ 2ZHOA 4QWEA 3R3TA 4DR4J 1AXQA 4DV2F 2PMZD 1VRTA 3HHLD 1MROB 2B43A 2MQPA 5BYQA 2W9CA 1WKKA 2V9WA 3NWGA 5ETMA 3BGRB 3OR2A 4H54A 5E3AA 2RHSB 3EZOA 1EKRA 2YH0A 5HMWA 4B3MJ 3CCVS 2AGOA 3KLIB 3Q24A 2H4YB 4JI5J 1XNQF 1XN9A 2UUAJ 3DN9A 1DFDA 4OX8A 4KB7A 1Q95G 2HGMA 2C2DA 1LW2A 3K89A 4LVNP 3H8YA 2RILA 2V69A 3D67A 1FDDA 2BE9B 2BXJA 3MMCA 5LJ5Y 5JUMA 2ZBQA 3EGVA 1D3WA 5KFRA 3LAMA 3KMSA 3R5GA 1RTHA 4GKKJ 1VBZA 5KFZA 1LEOA 5A8RB 1VRUB 3KK2A 1F5BA 5D77A 2FYXA 3MCSA 1WF1A 2B4PA 4NCAA 3R7SB 1VQMS 1MLAA 3MD3A 5D4PA 3OQ2A 3QT6A 5LM7E 2V4RA 3M8YA 4OI0A 4U67Q 2D3UA 5THWA 4ED6A 2E7XA 5LSRA 4DSEA 2C42A 1RB0A 2NREA 2WSCC 3GV7B 5HROA 4KFBA 3D0GE 3LPYA 4NOHA 3R97A 3B6BA 4FKXA 2ZM6F 5KFSA 2EEYA 1HIYA 3R7NB 3MM8B 1FXRA 4AL7A 3RTVA 3BV8A 1S0MA 2A3JA 3T6BA 1R0CB 4NLVA 2HHHJ 2K06A 3WDOA 1FERA 2W2NP 2IRXA 2VUGA 2QSWA 4R0EA 4EFAC 2JVOA 2HFNA 2HNZB 1IKWA 1YJNS 5CZXA 3R6GB 2AWZA 1GTHA 1UFLA 1CJKB 2GQ2A 4Q5VA 2B9YA 4LRFA 2ZUAA 2LECA 1IKYB 4DUYJ 1WKLA 4Q0BA 4KO0B 3G96A 5JXSA 1S0OA 2AP6A 2W9BB 1OYDA 3MZIA 5DJBA 2HQGA 2QT7A 4LF9F 3KG1A 3CULA 3GIRA 1B0TA 2AYEA 4P2SA 2QLBB 2H54B 1UP1A 5A0YB 4DSIA 2WZ1A 4DR7F 3OFEA 1X9WA 2LQBA 2HAIA 3MM5A 3GJSB 3D6MB 2BKNA 4H4OA 1NZ8A 4QR0A 2I5JA 2OP5A 2RVJA 2CXEA 2HGLA 3K2YA 4DV7F 1FNOA 1F9HA 4NA3A 4ED5A 2XNQA 1NSQA 3QLHB 1FRKA 2ZH4A 1J5OA 2LQJA 5C25B 4H4KA 4QPXA 5GAHU 4DZ6A 3J7ZT 5KFGA 1FO1A 4WFYA 5I3PA 2XMVA 3CJSA 2QRRA 1YGYA 2DO0A 2Z2YB 3NGDA 4NZ0A 2DEJA 1HBMA 5FLXY 4O3OA 3BQ2A 2B6AB 5CD4A 2KM8B 1C0TB 2GMHA 2NXJA 4EYHB 2DGOA 3ENVA 3EZUA 1TL3A 4NRTA 1JLBA 3M1VA 4LF1A 1HNZJ 5ETLA 1FX4A 1SV5B 4Z2XA 4USHA 7FD1A 3WZ0A 3KDOA 2CJYB 2APOA 1T05A 3LP2A 4ZCIA 1LFWA 2J6SA 1SQGA 2FVCA 3ZZUA 1B0VA 1HHSA 3ZZZA 1WOOA 1AFIA 5AXLA 1DLOB 5HLFB 4ZLPA 2DK2A 1U26A 4PWUA 5HQMA 2VOPA 3FZBA 4FVCA 3TWZA 3TEHB 2DH9A 1RAAB 4ICLA 1U1QA 4ZVSB 2GNKA 5KT2A 3KFWX 4DPXA 3SCKE 2XG8A 1IXKA 2DD8S 2KT2A 1R7IA 2ASJA 3AQPA 4CWBA 1SH3A 1IR2A 2J9CA 3MPWA 5B0DA 2VICA 5CXTA 3ZTPA 4P7TA 1O0PA 4WXOA 4PG4A 2CAJA 1FVSA 1SC4B 2GO8A 4NLRA 5CD4H 4QIEA 2WOMB 3DMJB 3TVKA 5EX3A 1TL7B 4A8OA 3J81j 3PFEA 5CABA 2ZDOA 3SCIE 3LF0A 1H2UX 4AYBD 3T9NA 5HMZA 5DLFA 2HS4A 3M8QA 3OSNA 3OTBA 5DZ6A 3QRQA 5C24B 4CQ1A 4OYPA 3CMQA 4PWDB 2HQIA 4RUCA 3M9NB 3I82A 3TO8A 1OMSA 4OQJA 4J91A 5KFBA 5FLXU 1LW0A 2Q43A 4J9NA 2BUNA 1R8PA 1QY7A 2LXIA 4I2QA 2R4FA 3LO3A 1AFJA 4BDPA 1NEEA 4CP5A 6AT1B 4KH1B 4RO0A 2BRKA 1YRUA 1FRXA 2BW7A 4N8OA 3G9CA 4IOCQ 5J2MB 3IWNC 4AQYF 3T5KA 1MWZA 3RG6A 5D78A 4R5PA 2B5JA 2M9KA 2DNNA 2W7OA 5HSPA 2VC0A 7FDRA 4Y2MA 4Y0FA 2C3OA 4TVAB 1YZ7A 3AXKA 3DLEB 1U6ZA 3W9JA 1UKUA 2MKYA 3GG0A 1ZZNA 2GMJA 2CYYA 1SBRA 4JI0F 1Q5YA 4B9SA 3MAQA 1NPKA 1TMJA 2Z30B 1Y5IB 3GILA 2OI2A 4ZMMA 3D68A 1TZ0A 5L39A 3G6XA 4OI1A 2QMWA 3R1LA 2IM1A 5EWGA 1SB6A 3V6DB 2DHAA 2B51A 3W2VB 4ZCMA 1VK8A 3PY8A 5J2NB 2ROEA 4LMZA 3LGNA 3D3CJ 3HSJA 3W9IA 4I67A 3NL0A 4R0JA 2HEKA 3IS9A 1M5VC 1S1TA 4LF9J 1KTVA 3ENAA 3D6FB 4M63A 2OPRB 1TR0A 1RT1B 4DJBA 5AXKA 4IR1A 4S0MA 2HQ3A 1C4AA 2YWWA 3KUEA 2DCUB 3C19A 3HHKA 4WU2A 2BE7D 2Y1JA 5DO2A 3G82B 3U02A 4KHRA 3G6ES 1HBUA 1WKJA 4ID8A 5ETKA 5LXRA 2B7BB 2WTFA 4ZK7M 2YWGA 4WPAA 5T7LA 1N5SA 2RKIA 5KG1A 4JV5F 5CAAA 1WG5A 3A4TA 4CCHA 2VONA 4CNZA 1S5ZA 2MQOA 1IWAA 1FWLA 5IXUA 5DZ7A 4KKOA 5DGBA 4OHVA 2MKJA 1NH7A 4NXMF 2DNKA 4ZVGA 4A46A 3RR7A 1FKOB 5F0WA 3LAKA 1HQ2A 3GYXB 2B9WA 3HDSA 4L6V3 1FA0A 3I31A 4CLPA 3FRZA 5F8GA 4B3RJ 2R7VA 4USMA 2FJBB 1V9OA 2IAJA 1J2VA 1Q16B 5DETA 5RUBA 1C2PA 3MMBB 1JKHB 1UVNA 3L7OA 4Q8EA 2K3KA 2FVPA 3OJSA 1RTZA 3MI7X 3GQCA 4G1PA 2MKHA 5KAKA 3UVJB 2YKMA 3FUYA 3MUMP 1VI7A 1OWXA 4OYXA
chains in the Genus database with same CATH topology
3MEGB 1KLMA 3PIOQ 1L3KA 3DDKA 3MHYA 5CZVA 4FS2A 4NLQA 2J76E 2XS5A 4J9MA 3MPVA 3NS6A 2VA3A 2YNGB 2E1RA 3IWLA 3H5XA 1VMBA 2M4MA 2A2CA 3DOLB 3OL9A 3D0HE 1UVKA 4RW9A 2C3YA 4B9MA 4FXVA 2X3GA 3MTKA 1FXDA 3BGLA 3CDBA 3IR5B 4MH8A 1X4DA 2R8KA 2JFDA 3BR8A 3JSMB 2AYMA 3FSIA 2PA3A 3AB2B 3BSCA 1Y5LB 1LW0B 2RD5C 2VFVA 1HNVB 4X4QA 2W8KA 2HIQA 2J9EA 1S1XB 4ZPAA 1L3SA 1CVJA 2DIUA 1C1CA 3QAEA 1Y3KA 4LUBA 2JC1A 3TYTA 5KFWA 2FJEB 4I2QB 4QZVB 3KLGA 2E9TA 3RU0A 3FFIB 3I87A 4DR3F 2DPJA 1EP4A 2K1RB 3GYNA 4OJHA 2MB0B 2BBEA 1YHQS 2KFZA 3R5AA 1VLYA 4L72B 3IFEA 1NU4A 1NKCA 2CJQA 4F50A 3PO4A 3C6UB 4K4TA 2SXLA 2Z4PA 3MR3A 3BJYA 2WK4A 4LIRA 3UCGA 2GA7A 1M5SA 3DOKA 3VZHA 4KC5A 5IQ6A 3IAM9 1X5SA 1YG0A 1U2RA 1ZBTA 1D9AA 2B5JB 4NMLA 1HI1A 3DLEA 3UWTA 4R5PB 4A4JA 5KFHA 4W92B 2BR0A 4WU3A 3PEJA 1UVMA 1IBKF 2Q66A 4OI4A 3NMRA 3LQVA 1FK9A 2OTJS 5KFFA 5J2QB 2XC9A 2CDQA 4DL7A 1KS2A 5A8WB 1NKEA 5KFLA 3P49B 2VPYB 1NH8A 1WHXA 3CVKA 2B4OA 1BWEA 4CT8A 1B64A 3CD5A 1FESA 4YR0A 2D41A 2XY6A 2DNQA 3OTCA 4GC7A 3V5RA 1KOOA 3M32B 4NYOA 3OFGA 4XPCA 3J7YU 2OFGX 4DLGA 2IA6A 2LA6A 4B3RF 1JWWA 4X4RA 3CJ2A 3EGNA 3SDEA 4I2PB 4DV5F 1JLFB 4ID5A 5DM7Q 2JEIA 1BGXT 2LQ9A 4B9LA 1X9MA 2M7SA 3DRSA 1X9SA 1KN6A 2V8DA 3AH6A 1PGZA 5FDLB 2ZUGA 2W9AA 1U1LA 3KOAA 4ERDA 4K4WA 5IM0A 1IQTA 1FD2A 2YWEA 3OR1B 4JI2F 3W2VA 3BB5A 4TYBA 1Z1ZA 3X3UA 1U48A 2ZH5A 1HW8A 2UUTA 2LEBA 3D5MA 1GT8A 3ISND 2HNDA 4MYTA 3TA0A 1H3DA 4NLPA 4RW6A 4BS2A 4IQXA 2E1AA 1N6QA 4F67A 2M8HA 3VAIA 2WHOA 4IUFA 3T1AA 1KEKA 3BO2A 2UVRA 2LVWA 1FHTA 1X5PA 2JLFA 2AJ0A 2CRLA 2ZH8A 2AX1A 1V3RA 4OMFG 4CZCA 3KLFA 2GMLA 3PFOA 1S72S 1D8YA 4B9UA 1NHUA 1RYSA 1QAXA 1TAQA 4MIWA 4I68A 2E7WA 4PG6A 5C42B 1LQ9A 2UUWA 4LQ9A 3HFKA 4HH0A 2CPFA 1GNKA 2KXNB 2QIFA 2OMOA 4YB5A 1RK8A 2F9DA 3PR5B 3MEDA 1S1TB 4RW7A 5B0CA 1VC6A 4X84A 3KLEA 1UJ5A 1B0PA 5KFOA 2KN4A 4HEA9 1LXJA 1XBWA 4NRUA 4RW8A 5DS7A 3VCDA 4KRWA 1RT2A 4AXJA 1HWIA 1URRA 1FDBA 5KFTA 1IBMF 4PPZA 1NK8A 2ZD1A 1VGYA 2HS0A 3J7Z5 4WFZA 3E01B 2R7XA 5A6WA 1L3VA 4UQTA 1Q78A 4HT7A 3BQ1A 2LEAA 2HFZA 1HMVB 4X4SA 2K3IA 2V4QA 1N36F 3CWJA 2IRYA 5CYQB 3SMZA 4CO2A 1KRPA 2BABA 2D9PA 2XWXA 3H2UB 4HI1A 2KXHA 4QU7A 3V6JA 3DGPA 3PX6A 2KXFA 4M5DB 4NL5A 2V8VA 2HHWA 2VC1A 4MJKA 3HP6A 2ZJRQ 1TV6A 4CH0S 1OPZA 2CIMA 2M70A 3IRWP 3G86A 3TP2A 2W25A 3N01A 2LMIA 3VAFA 2UUCF 1S6OA 1ZETA 1NB7A 1BQNA 1YRTA 1HARA 2WONB 3B4DA 2XMJA 3UW1A 2YH1A 1HBUB 2CJBA 3B4MA 1QE1A 2BACA 2CPHA 3QIDA 3NCQA 3K59A 1VQSA 4X4NA 4ZP7A 2XEXA 2MMYA 2QA1A 4ELUA 2CPYA 4RW4B 3K5PA 3JYTB 1MMDA 5MAOA 2R2SA 3IWXA 3C6TB 2YKPA 1R8AA 5CCLA 3N9UC 5KT4A 5GAHI 2DNOA 4Q43A 4DL5A 3CO9A 2V4JA 2VPZB 2MQQA 2IHR1 3OTOF 5T7LB 4LFAF 1FCAA 2ZZMA 4QYZJ 2JJ4D 4RBVA 5I42A 3V6KA 3QIPA 4NYZA 4UOCA 3T3FA 2IJFA 2RKIB 2YTCA 2KYXA 2ZDPA 3CDAA 4WTYA 5LJ3Y 5HI7A 1WI6A 3CPWR 5HBMA 4C11B 1S6QA 4PG8A 3CGIA 3MUVP 1KQKA 1RTDA 2DH7A 3N6LA 5KG4A 4QOTA 2CQPA 4A8KA 3L7PA 4O3RA 1NAQA 1X8DA 5J2PB 3KK3A 3RB4A 3J7YI 1JLQA 1U1MA 2RB7A 2UXCF 4MAKA 4IO1A 5LT5A 3CDWA 3CCMS 2DT9A 1FJGF 3SQGB 5AXNA 2DNYA 3S6EA 1RKIA 4ZPBA 1URNA 2V8GA 4KKOB 3E8OA 1IKVA 1T03A 2MY8A 3DDNA 4GKJF 1HNIB 4BC7A 3MDFA 4IG0A 4KHMA 2FJVA 2PO4A 2O66A 3I5AA 3QGHA 2YNFB 2FJAB 4Q44A 3OVBA 4BCAA 2MGZA 2ROPA 4EZ9A 5GAGU 3OL8A 2LKZA 1VQ5S 2HLTA 1HNWF 2D74B 3M2UA 1HBNB 5FD1A 3TI0A 3IA0A 2BJDA 4ZCLA 2XS2A 4M8LA 4QU6A 1S49A 3DRPA 1RKJA 5SZTA 4KJIA 2QE5A 1BQMB 1IKXB 1R89A 2I0XA 2IAJB 2J0WA 4DV1F 4A8WA 3GV5B 3DOMA 1LWFA 2KI2A 4C97A 5CHCB 1LFPA 1P9QC 5HQ8A 3DYAA 1TL1A 3RB3A 1QVGR 5KFPA 2NPFA 4ZVFA 3ICLA 3S8SA 4DUZF 4DL0C 1RT4A 2J9DA 2FLPA 4YHHF 1WHYA 1S4FA 3AJ2A 2VG5B 4ES3A 3K58A 3CC2S 5A8KB 4WIIA 4NXNF 2UP1A 5AXMA 4PRFA 3OV7A 3MEGA 2LU2A 5CYMB 3RBDA 1N56A 1TK8A 3KKFA 4O0IA 3HZGA 4DL3A 4A8QA 2DCLA 1FKPA 3PXGa 2FJDB 2OPQB 2YKMB 4USJC 1HHTP 4V19X 4IFYB 2HRYA 2OPSA 3PHEA 5F8NA 4C8KA 2IFXA 3LWLA 3H98A 1JXLA 4NLXA 2RU3A 2V94A 4KQZA 2QSFA 1KLMB 3OXLA 1UA1A 2CPZA 2XHWA 3O3LA 4XIUA 5J1PA 1APSA 1NK6A 4FF3A 2RF2A 3OL6A 1WF0A 2B4UA 2YWFA 4EGLA 2KFYA 3MR6A 4DSLA 4HI2A 4RW9B 1XWLA 2GW8A 2V2KA 3P96A 4Y6IA 4MKYA 3RR8A 4JOUA 1ELOA 2E44A 2NLWA 3GG1A 4A8FA 4JI3F 2HPUA 5AE1A 3P3DA 2NUUG 3I9ZA 1S1VA 2KZMA 1VQ4S 3MM9B 4WFAQ 1SXLA 1T7PA 4DR6F 1ULRA 4LT6A 1HYSA 2AYGA 4CI0B 4LF8F 1LOUA 1IJFB 5EGYA 1YJUA 4WK3A 1F0XA 3UQSA 3BO3A 2CG4A 2FTRA 5L9NA 2C22A 2E5HA 3KLGB 2EFVA 1FXLA 2Y1RI 1UWBA 3HLUA 2X1BA 4M1KA 1VFJA 4URGA 2RNEA 3MXHP 1EP4B 4NWBA 4N41A 4F4XA 2O01C 1SIZA 1XR7A 2DGVA 4OX9F 4MFBA 5C5JA 2IRUA 1K1QA 1DARA 2GV1A 2LDYA 4X4TA 3H25A 1ZPVA 3ENWA 2VL1A 3RAXA 1ZAWA 1HWKA 5HN0A 4K4ZA 2D7SA 1UFWA 2HLUA 2XSJA 3DOKB 4MKBA 2OTLS 3K0JA 3CJ5A 2RT3A 2CJ9A 2P6TA 1YITS 1UW4A 2ACYA 1R8HA 3OLBA 3W2WA 3K57A 3M6XA 1C1BA 2VKRA 5EX0A 3MM6A 4KGMA 5I3UA 2CZ4A 4URSA 3RB0A 2F9JA 3PJWA 4J37A 4KE5A 2Z2MA 1KFDA 3W7BA 1PSDA 5K9FA 2GIRA 1F5CA 2I1RA 4Y00A 4TQRA 5GAEI 3SV3A 5KFIA 4O3PA 4I2PA 2BANA 3T5LA 3B82A 1SJ3P 3QYYA 5T41A 4OZ0A 4ILRA 4DLEA 4OHZA 4G3IA 1Y3JA 2VG7A 1FKAF 3E51A 3GWCA 2FDNA 2O1PA 1TK5A 1GXUA 2VQEF 2N4DA 3GE9A 1HBOA 4K4VA 3PNIA 4C7QA 1FEHA 4DFPA 2MQNA 4ETZA 1HI0P 2DNLA 3SDEB 2F8EX 1N4LA 2XMWA 2EG2A 4ID5B 2JEGA 5G0RA 3FNNA 3FSXA 1TFWA 4FNHA 4X4PA 1ZAVA 1FTCA 2FC8A 1XR5A 3DRSB 1X4BA 2YKNA 1NK0A 2W4CA 4X62F 2CPXA 2XMUA 5K14A 3RW6A 1S1WA 4OL8A 4TY9A 3K8VA 5IM0B 3WBZA 4CO0A 1Q81T 2JHEA 2AYBA 4ZPWR 1P8GA 4OZ1A 4FS1A 3GFYA 1N32F 3AA8A 5L38A 1WEYA 2HNDB 2V9KA 1DTQA 1LWEA 2MKSA 2NSCA 1N5QA 4TNOA 4YB6A 2W8LA 1DURA 3NNCA 4C8YA 2EVZA 3O8WA 2E5GA 4O44A 4RW6B 4PXBA 2GHPA 3N5FA 1N6QB 2KZZA 5BYSA 1OS5A 3BEGB 2OLWA 4LSLA 3GFXA 4TU8A 1QSLA 1NJYA 3VAMA 3M8RA 1D1UA 3THVA 2N3LA 4DL4A 2L3MA 3I5BA 5KFKA 1YVFA 4U7CA 3KLFB 2EFNA 1VQNS 3D1OA 1TUVA 2HVHA 1EETA 3IR7B 3CD7A 2BJEA 4DR2F 2BQ3A 3R5CA 2DR8A 2CPIA 2AQ4A 3FMWA 4YDDB 3Q2SC 4PKDB 3OJUA 1JB0C 1RT3A 3I9V9 1S6PA 3LGMA 4FPRA 4CO3A 2D3OR 3MEDB 4KGKA 4OJ1A 4RW7B 5DDRC 5I4MA 1XR6A 1P6TA 2R7OA 3KLEB 2ZVSA 1ZM4A 3DRXA 4RW8B 3UR0A 3LP0A 4H4KC 2VFRA 1RT2B 2YX1A 3MFHA 4OZLA 3PO5A 2V5HG 1CC8A 3M4XA 5DG8A 3CD6S 1UJ4A 4ALZA 2ZD1B 4DSJA 3SSSA 3CMES 1U45A 1VQYA 2JFKA 2HMIA 4YDXA 3I5CA 3K7RA 5B0EA 2R8IA 1QAYA 4K5RA 4TU7A 4AXIA 2OPPA 2VA2A 3UPFA 5B09A 3G8SA 2G1DA 1X0PA 1CPZA 2MZSA 3QWUA 3GR0A 1SL0A 5DRKA 1KTQA 1ROFA 1TV6B 2PE8A 2ZJPQ 4EUVA 2OSQA 1ZAXA 3NP5A 2OKQA 2BYCA 3PVXA 2G0CA 1BQNB 1DRZA 1R6YA 3NBPB 4I56A 2DRAA 2DNPA 2G13A 3NMAA 3Q8SB 2QMXA 2ASYA 2EBGA 1QE1B 2OFHX 4ECTA 2A10A 5B0AA 1U1OA 3D1QA 2M0GB 2KFNA 1N52B 1KHVA 2Q1LA 4FN5A 1REVB 4PXCA 4V19J 1B7FA 4K59A 1XMOF 2MHNA 1TP7A 3EXYA 4B9TA 5D3GA 3GZ7A 2IM0A 4B9NA 2V4JB 1N5VA 1CQNA 4KSEB 2ASDA 2AJFE 3QMQA 2ILZA 1JXEA 4F3QA 5I42B 1KSPA 3Q2TC 3QIPB 1YTYA 3G6VA 2IM3A 1ZM3A 3TAPA 1G3OA 1SL1A 2VOOA 2XMTA 4DMZA 2KKHA 4EO6A 5HBMB 1RTDB 1S6QB 3GB0A 4CH7A 2NQPA 2RMLA 3JSBA 2GQQA 2ASLA 4DR1F 3TAQA 4M94A 4Y2AA 4ECWA 2P9EA 4QWDA 2DNZA 5IS2A 2LXFA 1C0UA 2DISA 1PC5A 2V8HA 3KK3B 5GADU 2IMOA 3K5LA 1JLQB 4KT0C 2YNFA 3UD3P 4RNMA 3LH2S 4F4ZA 1NKBA 2PI5A 2O3DA 3OHBA 4X66F 2DNHA 3OXFA 3GMGA 4CO4A 4ED0A 3HVRA 2ABYA 2B4VA 1IKVB 1T03B 4K50A 4LF5F 3I55S 4IG0B 2FLOA 4MMOA 5D4OA 4ED1A 2G9OA 2HHXA 1M5HA 1U1PA 1JX4A 2MGZB 1S0NA 1VHFA 4XK8C 2FHKA 2AU0A 4R8UA 2DGUA 1IN0A 3M2UB 5E3RA 5CA5A 4WZMA 1M5PC 2WCXA 4CT9A 3FQLA 4C0OC 2R7RA 3CCTA 2F4VF 3DRPB 3BZQA 1T3NA 5A8KA 2B9XA 2E5JA 2MPUA 3FEYB 4CH1A 5KFMA 1LWFB 3CCWA 3M2RB 1KD1T 1HR0F 5F8JA 5SUHA 3DYAB 1TL1B 2POKA 4RNOA 2OD6A 5DLGA 2VPXB 3CDUA 3O2IA 3CD0A 2XLIA 2ADCA 1TK0A 1HD1A 1MMLA 4RUHA 4JI5F 3N79A 2U2FA 4I64A 4C3KA 4FBTA 4B3TF 1RT4B 1JLAA 3KHGA 2ZBIA 2RS2A 3LUYA 4DV6F 3H4DA 4F2RA 3NCRA 1JJ2R 3OXGA 2PSZA 3DU6A 2X1FA 1HL6A 1DTTA 4ZVEA 3EZ5A 4LJMA 2OIHA 1JLCB 4QIWD