1PC4A

Crystal structure of the p50a mutant of ferredoxin i at 1.65 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECAAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin I
publication title Mechanisms of redox-coupled proton transfer in proteins: role of the proximal proline in reactions of the [3Fe-4S] cluster in Azotobacter vinelandii ferredoxin I
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pc4A00
1KQFB 1B0TA 2C3MA 1PC5A 3EUNA 1G3OA 2GMJA 4DHVA 4YDDB 2FD2A 1SIWB 3MMBA 1GTEA 3MM5B 2XSJA 3OR1A 1JB0C 1FF2A 2WAQD 3MMAA 1FXDA 1FDBA 4ID8A 2C3YA 2FJAB 2GMHA 3EXYA 2Y0SD 1B0VA 1FDDA 3IR5B 1RGVA 3MM7A 3MM8A 1Y5NB 4L6V3 3MM9B 1R27B 3OR2B 4XK8C 3MM6B 2VPWB 2VPYB 1VJWA 2Z8QA 1FRXA 3MMCB 1DURA 1FRJA 2WSFC 4AYBD 1F2GA 3PNIA 3MMBB 1A6LA 2C3OA 1Y5LB 2O01C 2FDNA 2XSJB 1FXRA 3OR1B 4RKUC 1H98A 3MMAB 5BYSA 2WB1D 1BQXA 3C8YA 1FRLA 2C3UA 1IQZA 1AXQA 2FJDB 3GYXB 3IR7B 3EGWB 2V2KA 2PDAA 5CHCB 1JNRB 5BYQA 5BYRA 1DAXA 1SJ1A 1ROFA 1FD2A 2VPXB 2FJBB 7FDRA 2IVFB 1KEKA 3MM7B 3LW5C 1FDAA 4Y28C 1C4AA 1BD6A 2VKRA 6FD1A 1JNZB 1GAOA 1C4CA 2C42A 1FDNA 2C3PA 2UZAA 2WSCC 7FD1A 2FGOA 1FEHA 5E7OB 1F5BA 1XERA 2V4JA 5L8RC 1HFEL 1H7XA 4OV1A 1KQGB 1BWEA 3HKZD 1BLUA 1GT8A 3IR6B 1H7WA 1Y5IB 2PA8D 2PMZD 5FD1A 1K0TA 3MM8B 1GTHA 3MM5A 2ZVSA 2WSEC 1FRMA 1FRHA 1FRKA 1F5CA 5CH7B 1WTFA 4KT0C 4OMFG 4XDCA 1B0PA 6FDRA 1IR0A 4CI0B 1BC6A 1FCAA 1FERA 1FTCA 4XDDA 1PC4A 1CLFA 1Y4ZB 1G6BA 2V4JB 1D3WA 1FRIA 1H0HB 3MM9A 3OR2A 1SIZA 2FJEB 3MM6A 1DFDA 1Q16B 2VPZB 3MMCA
chains in the Genus database with same CATH superfamily
1PKUA 1SJ4P 3HSDA 2R8IA 1WELA 1N32F 4ZLLA 2FD2A 1CS4A 1VRUB 1U48A 5EUHA 3W7BA 3MOZA 1KLMB 2DGTA 3BF4A 4DDFA 1LXJA 3ZNUA 1B4SA 1HLWA 4QPXA 5ETNA 1C1BA 2ROEA 4TQSA 3NMRA 3M6VA 4CLWA 2WB4A 3TJ8A 5F8NA 1RI7A 4M5NA 2B7CB 1RT1B 4K2JA 1J5OA 1NU4A 3TA2A 1J5EJ 5HVFA 1T03A 1DRZA 5LXRA 1HNXF 1N52B 2UZAA 1N5SA 4I0WA 1XR6A 5ETTA 2VQFF 3M8WA 4WCEQ 3W64A 1PAEX 5D0EA 1P8GA 1K0TA 5D4LA 2CPYA 5BR8J 4M5JA 2KG1A 1S0VA 4BWMA 4QYZJ 5E33A 1D8ZA 4DQRA 2B9YA 5G0RB 1V3RA 1U4BA 1YJTA 3DU5A 2R7VA 2W9BB 1NDKA 3C14A 2NYIA 2CQ1A 4OYIA 1T11A 3GIKA 4LFAJ 1URNA 4J9NA 4RNHA 1NB7A 2ROPA 1ZTTA 4JI2F 2BEFA 2RQCA 3MTKA 4X66F 1RWWB 3FEYB 1TK5A 1ZM9A 5KFYA 4B9TA 2C2KB 4OIXA 2C2DA 1FTRA 2RAQA 5A0YA 3VAKA 2FDNA 3AOCA 2MHNA 4WTOB 4NRTA 1VQYA 1WHXA 2WW4A 3AT1B 5L39A 3IC1A 5AXKA 2ZM6F 3A3OB 2ERRA 1RWPB 1WI8A 4G65A 2DHSA 2R8HA 3M9OB 1JLGA 2LEBA 3R2DJ 3V6JA 1QY7A 2AEFA 3CCMS 3BO3A 4CM2A 2HWHA 4YR2A 2RU3A 3EX7B 3NCRA 4X64J 5D3GB 2EK6A 1I94F 2PMWA 4J9RA 2D7SA 2I9SA 2LLZA 3B54A 2QC3A 3N79A 2XMWA 4WU3A 1DFDA 1Q16B 3BZQA 1SC3B 4R5PB 2OELA 4DZ6A 1LW2B 1WF1A 4OFZA 2DXEA 2Q6BA 3IA0A 1I1GA 3GFHA 4KY3A 1M5SA 4RNFA 4LF2A 3TX0A 3GV7B 5GVQA 4ECWA 4ECTA 2YNGB 2MZRA 2YPZA 3CIZA 2VDIA 1PYSB 3QT6A 5CABA 2DRAA 4KGMA 4UT4A 3DRRB 3D2WA 3W66A 1IKVA 4X62F 5E3PA 1JLAA 2J76E 2CWKA 4EO8A 5B0CA 3BGOP 3DLLQ 2A10A 2ZITA 2JFDA 3NG8A 2RDIA 3CJ4A 1EQ0A 1EIYB 2MQNA 2XLIA 4XDCA 2DY1A 2QYGA 4EZ6A 1SJRA 4JI5F 1F3VA 3TRGA 2YX4A 1MSWD 1XQIA 4A48A 2CKWA 1U2RA 1UW9A 3DRSA 3PYDA 4IRKA 4WKRA 2O5DA 3SQOP 2WAQD 4H4MB 3OXLA 5IQ6A 3MR7A 2BR0A 4QBUA 3J7ZT 4HYKA 3KXDA 1M5KC 5J2QB 2KG0A 3V81A 2R2TA 3ZZRA 2A18A 3HSGA 5JJBA 4M8LA 3TZYA 4LBIA 1YJVA 2Z8QA 5HMWA 1WKJA 3UQSA 3TZWA 4W98A 3QAEA 1RUSA 1JJ4A 1HHQA 1FD2A 3D4JA 3CPWR 3BSNA 2HVZA 3U1MA 4URGA 2PD1A 2FJXA 1UKUA 4RW6A 2XNRA 1E6YA 3ET6A 4X4QA 3MEEB 2IMWP 4WFYA 2ZBPA 4M5DB 3UCGA 5KFDA 3KHLA 5GAGU 2BABA 2JEFA 2MKIA 2CZ9A 4YEAA 5CCMA 5SUHA 2YNIB 3H2UB 2W7AA 4P72A 1FKOB 2E5JA 3AFGA 1AUDA 2KTQA 1EHWA 2ZHOA 3BQ1A 3V5RA 3DCAA 4J9SA 3UN2A 2YKOA 1RU1A 1FF2A 3G6YA 4OI6A 1UWBA 1GXTA 4ELTA 2OUGA 1KWMA 4C8KA 2D3OR 1QTMA 3ZZTA 1HBMB 4ZK7M 1O51A 5JVGQ 2CXEA 3W5ZA 1AZSB 1H3DA 2NS1B 1FRLA 4KGZB 1PG5B 3DFEA 2QMUB 5T7LA 4PYAA 1ROFA 4WYWA 2YNFA 3QWPA 1HBUA 1SPBP 1X60A 4ZVEA 4ZP7A 3GIJA 4MKBA 1WC3A 1PILA 4NLYA 1UETA 4C8YA 2JVOA 2BANA 4UF4A 5KFRA 2QL7B 5LMUF 1S5ZA 1EKRA 1RTIA 1UVIA 4LJMA 2QLFB 4CO1A 4DR2J 4HVZA 2BBEA 3QQCD 1HHTP 1VIOA 4WKYA 4C8MA 2AU0A 3G2XA 1UFKA 2MLZA 2AQ4A 4OL8A 2UUCF 1H72C 2Y0SD 1RBOB 4MT1A 2NCKL 1WUUA 5AE2A 3E01A 4Y2MA 4YY3J 2IPOB 3LALA 3KLIB 3PRBA 3POTA 1TKZB 3KLFA 1Q8KA 1NKCA 2X3GA 4CYUA 4YHHF 1VQ9S 5FJ4A 2R7QA 2HNDB 3OL6A 3KK3B 2QT7A 4PQUA 4BC7A 4OYZA 2CQIA 4USWA 4RW4A 4LIRA 3IMQJ 3DMJB 2CJ9A 4RUBA 2CPJA 4S0MA 4DR1F 2FJWA 5BXIA 2PI5A 1GFWB 4IO1A 4X2BA 2PGCA 1H38A 3HVRA 3FFIA 5GAEI 1RZMA 1IBKF 3I5CA 3TVZA 3EGZA 1TKDA 3HLUA 2KT2A 1R31A 4EGLA 4RW9A 3X1LB 4K2XA 1AW0A 3GR1A 2CPXA 4ZCLA 1HBNB 2XMMA 2EFVA 3NMAA 3UN3A 1K1QA 3Q8YA 2DITA 2AHOB 1S76D 1TL5A 3QMQA 3MECB 3LAKA 3J7Z5 3T1YJ 2BM0A 4K0KJ 1JLFB 1VBYA 1RTHA 2RVJA 4ILRA 1WC1A 2Z4PA 1H98A 5GMDA 3KMSA 4C3KA 3OXGA 1VBKA 3VGTA 1FVSA 3KNAA 3PW7A 5LJ5Y 3C3LA 5A6WA 3THVA 1VDHA 3PKMA 5A8KA 3EVOA 3IS9B 2B4PA 4WFBQ 2AWZA 2ASLA 3NLCA 1B70B 1VLOA 2MEWA 2DISA 3ETMA 2W24A 3HULA 5EWGA 1NUEA 1I3OB 4U7UK 3IR6B 4LF4J 1RAEB 2VOPA 2DNOA 3OXFA 3GG0A 4BHQA 4ECRA 3WC0A 3PVXA 1WOSA 2Z2ZA 3L9ZA 4I2PB 1A0OB 4CLKA 4J9KA 3GJTB 1P1TA 3B78A 1NSPA 4P2MA 1D8YA 1U49A 2HS4A 4OYAA 3T6BA 2V34A 4IH5A 2HQ3A 1SH0A 4CNZA 3PYFA 1XMOJ 3G71S 2BJ7A 2IYGA 1S10A 1S99A 5HBMB 1HD1A 4K4UA 2HSEB 3FBEA 2J6SA 4LVOP 2O01C 2UUBJ 1VJQA 3A8KA 1FI4A 2GHWA 2IRXA 2MQ8A 1DTQA 2OMLA 4TYAA 2DCUB 1RWVB 1TL7B 3BEGB 4FN5A 2L48A 1KVKA 4WK3A 2GNKA 4F4XA 4CDIA 1VIXA 3CD7A 1JMTA 4NRUA 1T05B 4LBHA 2XS5A 1EB0A 2VUGA 4U6PA 3TQ1A 4O3NA 2HRTA 1RAIB 1Y4ZB 3KJQB 2OJ3A 2HLTA 2BE7D 1JK9B 1UWAA 3M2VB 4FNIA 4QU7A 3EXYA 4WJBA 2W01A 3CCES 3T5JA 4PG4A 1N34J 4DV2J 3I5BA 2KXNB 2CG4A 5BJRA 3GMGA 3R1LA 1WC0A 2GC8A 1NHUA 4DR3J 4M5LA 3DLEA 1KLNA 2Q3PA 2P9GA 5FDLA 2DR9A 4LF9F 4DQIA 3O5TB 1IKXB 5J2PA 4ZVRB 5ETSA 2GQCA 2FZCB 2OTJS 3C15B 3TR5A 2VASA 5DQHA 3NNAA 1FESA 4FDFA 2CNLB 1YJUA 4YP3A 2KZMA 5KFOA 3MEGB 1ELOA 3MPVA 4M5IA 1FE0A 1F5CA 3MCMA 2JHEA 2FGCA 3H40A 2FHJD 1S1VA 4K59A 4IQXA 3MM9A 4ZVFA 2MKCA 1S6QA 4UUXA 3E3XA 3NP5A 1RT7A 3A8EA 1JKHA 1KD1T 4HHJA 4Z7YA 4K4ZA 2AEJA 4GKKF 4B08A 3MM8A 1MG7A 4WFNQ 2H5EA 4QIGA 3WIVA 5KG3A 4O3SA 1DJ0A 2C2MB 2AJ4A 5CCLA 2EBEA 3OR1B 2JEGA 2MYFA 3OPKA 3PO4A 3LP0A 1SUQA 4OQJA 5CYQA 4KGVB 1NK8A 2FVSA 1T0TV 3N4WA 3WZ0A 2H48B 1W7WA 2H9ZA 2LDIA 3D67A 3RBEA 1Q8BA 3D1OA 2ZWOA 1HFEL 1H7XA 1WSVA 2KFYA 1RISA 4ECYA 2FZKB 3FBFA 5K8OA 4UOHA 2R8JA 2HGNA 4QZVB 4MYTA 3CCQS 4MKAA 1QTNB 2O1PA 2DNLA 4F7VA 1X5SA 1YIJS 1JJHA 1WEZA 1CJVA 4U95A 2XY6A 1FKPB 4Q0BB 1GTEA 3G8SA 4NXNF 2CQCA 3UDEA 5LMNF 4TU9A 1QSYA 2HHWA 2ZVIA 3PACA 3V6KA 3LA0A 4JI3J 1WDDA 5DGBA 4ZVTB 2W4PA 2YNHA 3KJVB 3N6LA 4ATNA 2MGZB 3UNYA 4O4GA 3BGLA 3SXLA 1VQ7S 2ZE2B 4QIVA 1HWIA 4CO3A 3OL9A 4F25A 2JOQA 2W25A 2ZOMA 2ACMA 3N0VA 3M6WA 2OPSB 3QGPA 3I9V9 2IYIA 3IXQA 2G2OA 3S6EA 1VQ4S 4JI1J 2C2EA 3RBXA 5H9EJ 1RT3A 3C6UB 3JTOA 3HKZD 3T41A 2IC3B 3FMBA 1IBMJ 3AQOA 2YX1A 1CBKA 1X4HA 4KT0C 2EFQA 2K7KA 4LSNB 5F3ZA 2MZJA 1X4AA 2FY8A 4H54A 2GZOA 1HYSA 2HGMA 3O3LA 1EQMA 4B3MJ 1T9XA 3M1VA 4N7TA 4O3QA 2GMJA 1U8SA 5K14A 1X0PA 2GQQA 5T14A 3CF5Q 5B0DA 3HXMA 1AUSL 1WJ9A 4JOUA 2JSXA 3ISZA 2ZWPA 4K5RA 2FHJA 1DURA 1F1BB 4BCAA 5E5NA 3IM9A 1WI6A 1KOHA 2JWNA 2DR6A 4P71A 4NLTA 1BQXA 4Y3CA 4ZP6A 2ZEJA 3UN5A 3IAS9 1LFWA 4DV6J 3W9IA 2R2RA 3CVKA 1JXLA 4OX9J 5K20B 1JNZB 1S1XA 2KJWA 3ZTRA 2F7VA 4PCQA 1N5YB 3NL0A 3UD3P 3MAAA 3TYTA 1CULA 4J9UE 1BE4A 5FLXU 3T3FA 3DGPB 3O2IA 4NLWA 4O44B 1RT4B 2QLJB 4GKJF 3QO9A 2B6AB 2UU9J 2GGPA 1U45A 5C25A 4C7QA 4OJHA 2JFKA 2YQ0A 5F8JA 3LGMA 3MM6A 4AXJA 1X9WA 2ZKUA 2IM3A 2B8QA 2EKNA 3QJLA 3GE9A 1QSLA 2GS8A 3SQGB 2Y1LB 2MMYA 4DX6A 4PXDA 3EE3A 5CYMA 2WONA 1DY3A 3Q2TC 4WU2A 2MSSA 1WTBA 2KN4A 4QWBA 3SIPB 4P52A 2XCAA 3M2RB 2E5HA 3SI8A 3CJ5A 1Q8LA 4ALZA 4NLGA 1XMQJ 3L4BC 2LCWA 4DLEA 2GW8A 4LFCF 4IDKA 3GIIA 2VG7B 1FDAA 1K8AT 5L1IA 3R1HA 1NNDA 4ECSA 4Q7AA 2WRMA 1BHNA 4FBTA 3AJ2A 1VS3A 1TZ0A 3JYTA 4ZP8A 5ETKA 1M5OC 3VVTA 2KI2A 2EW9A 1S9FA 6AT1B 3FGVA 3GCWP 3AB4B 1FRHA 4M5GA 2ZH8A 3R5GA 1SL0A 1Y00A 4ICLB 2VA2A 1ACMB 4XDDA 3CCUS 4USUA 2FTRA 2FVPA 3PX6A 1X7VA 1IWGA 1TKXA 1Q81T 3TARA 2HRUA 4KHPF 3MM5B 3FVYA 4NCGA 2E5LF 4I4BA 4DPXA 4F3QA 1N54B 4P2FA 3BBCA 4GO7X 2HFSA 1TL1B 3I0SB 3KDOA 3NGUA 5AT1B 3CEDA 4L75A 4USJC 3W60A 1ZAXA 3LGHA 1N5QA 1RWMB 2NUHA 4OZ3A 4W4MA 2WSFC 4TLRA 3W61A 4OYWA 4NXMJ 5F8MA 2EFPA 1TKTB 3T5KA 4ANDA 3M8QB 3N6NA 4NA2A 2HPUA 8RUCA 3AODA 1L3KA 4HDHA 3EVWA 3R7BB 4HEA9 1E6VB 1W25A 4OZ5A 1REVA 1R0AA 5HATA 2RHQB 4EI2A 5L8RC 4NLUA 2W7OA 1QE1A 3O6QA 1BWEA 4KH1B 2DR8A 1SQEA 4I6AA 1R6VA 5D4NA 3QIDA 2FLOA 1KQSR 5D77A 3V6DB 1RYRA 2BXJA 2OFGX 2VC1A 1OYDA 3U1LA 3DXSX 2R7SA 1QVFR 3FNNA 4Y65A 1WF2A 3VR1A 5LJ3Y 3OHAA 2RILA 4DV3F 2M8DB 2K1RA 1AT1B 5E3QA 2D3O1 4OJ3A 2FJVA 2CPFA 2GMHA 2K2PA 2HBQB 2BQ3A 1L3VA 2VBXA 2U1AA 4JV5F 1JLEA 2XSFA 4Q2LA 3W1YC 5AJ3J 5IXUA 3ZTQA 2ZHBA 1ZM3A 3D68A 3O44A 2XSJB 1BMQB 5DETA 3FUYA 3QAUA 4UQTA 5FLXY 4DUYJ 1XNRJ 3CC7S 2YQ1A 3L95X 3S8SA 4V1Ak 4RNMA 4M5HA 1C4AA 1VR6A 3RB4A 4Y0FA 2M3DA 3CCWA 3SFGA 2CJAA 3NGDA 1VQ6S 5DZ7A 2L9NA 2CJQA 2UUAJ 2LFVA 3AOAA 1FJEB 4IG0A 3MEKA 4GC7A 1H2TZ 5C2CA 4B9SA 2H1YA 2DNZA 4LSLB 3HVTA 1KFSA 1TQLA 2RNEA 2DHXA 4CZCA 4AXIA 3VQSA 4I7FA 4HACA 1JLGB 4FXDA 3CD0A 4I6YA 3BREA 4ECQA 4ZN3A 4B9NA 2HQCA 4LMZA 4ZN1A 1VLYA 1NDCA 2WK4A 3M30B 4A8MP 2W9CB 1Z1ZA 5K8NA 3CO0P 4DF8A 1OSCA 2OLWA 4J5OA 1GMWD 4HT7A 4WWSA 1NLKL 2AJ0A 3TVYA 3AD7C 2PSZA 2OPRA 4B3OA 5B0BA 4JBCA 6FD1A 4DUZF 2WSCC 3QWUA 5GMKa 1WF0A 5CD4H 1GX6A 1KDNA 2DY9A 2BOPA 4ETXA 2XB2D 1Y0HA 2MQPA 1LQ9A 1FNXH 2GHPA 5KG7A 3D6FB 1T9TA 1WHWA 3VAGA 4ED5A 1LWFB 5J2NB 2DH9A 1F3FA 3D66A 2IM2A 3M8YA 2MQMA 5E41A 1FT8A 2DNRA 1WD6A 2VBZA 1NJWA 5EX0A 4QYRA 3TW0A 4IRCA 4ZCMA 3C66A 4C11A 1HQUA 1FRJA 4DWIA 4O4RA 4MMOA 3HHEA 2LKZA 5D6GA 3OV7A 3MR5A 4ES1A 3LPYA 2DNQA 4FS2A 1VQKS 1NCLA 2RF2B 3PW2A 4UOGA 3JSBA 4PEOA 2DRBA 2J6UA 2HMIB 3R5JB 2BJ9A 4IO9Q 2CQ3A 3MUTP 1SH2A 3AHPA 4J37A 3PJWA 4D3HA 3OTEA 1DBDA 3I0RA 5HQ8A 4NLOA 1MROB 2GVDB 4LR8A 3M32B 1BC6A 2HS3A 1YHQS 4WZMA 1HWUA 4ETZA 2KDOA 4DX8H 3MDFA 1SJFA 4IFYA 2ASJA 3UPFA 5KFNA 2A6OA 4DV5F 1JB0C 4WPAA 2MLXA 1S7IA 4IFVB 4JUZA 5HLFB 2QL9B 1RWKB 2DNMA 4MAKA 1JWWA 1CJUA 1C1CA 2LU1A 2GVZB 3M2UB 3TAMB 2C22A 3CDUA 2VC0A 2FPHX 2ZD1B 2BVZA 1N48A 4JYAJ 3EM1A 1M1GA 3TO8A 4Z37A 2KU7A 2PDAA 3KK1B 5KFIA 4C0BA 4ZMMA 3FZBA 1UAWA 4U8VA 1EJ7L 4DR5J 4DG1A 1DZ5A 2KHCA 3K5NA 2MZQA 2QO3A 4EO6A 3BSCA 3DC2A 3PIOQ 3W2VA 3RW6A 3U02A 1GQEA 2IVYA 1GMWA 4QWDA 4FYYB 4P73A 3CCLS 1N5VA 1OJ4A 4UOFA 3E8OA 1HR0J 3RGIA 1FCAA 3QLHA 1CQNA 4Q2MA 1S72S 2Z56B 4G1QA 1FX4A 2YNFB 1TL4A 4ZITA 4TY8B 2ASDA 2SXLA 2V0NA 2Z58B 3DNCA 4PWWA 5CXTA 2FUG9 5G4DA 4EBCA 3EZUA 1O6XA 2XG8A 3RR7A 3K5PA 2AZ1A 3OW2R 2CFXA 3CMES 4MH8A 4HI2A 3PFEA 4USMA 3JAMU 1WEYA 3IBCB 4F4AA 1U09A 5IWAJ 2LQJA 4PRFA 4E0DA 5HVGA 2OEKA 2HHSA 1VK8A 2J9DA 2YWFA 5LM7E 2CQ0A 1BQMA 3ZTPA 2H4WB 5A8RB 2ZH9A 2C2ZB 2IJFA 3HK2A 4KTQA 2CQHA 2Y9HA 3MR6A 1CEZA 1M1KT 3P8BB 3IWNC 4C6AA 5KG5A 4LR7A 4F04B 1S49A 2NQPA 4UUWA 4NA1A 1YKWA 2FJEB 3T9ZA 1ZZNA 1RBAA 2PA3A 2RRBA 3KHRA 2VDHA 3T5HA 3VAJA 4I56A 1R27B 4NI2A 3NGTA 2WOMA 1JLCA 2R3VA 3NNCA 1NM2A 4RL1A 4HTIA 3BS9A 3H5UA 1Q7YT 1F2GA 1V9OA 4X4OA 2N3LA 3CCRS 3QZ7A 2W7PA 1RHMB 1RAJA 1KC8T 4ID5A 3T9NA 3HJFA 1S1WB 4XPCA 3J81j 1AFJA 1V3ZA 1CVJA 2NXJA 5LT5A 5J1EB 2B43A 4JI4J 3DI6A 2AGOA 5LSOA 4MFBB 3N6MA 3S7RA 4OX8A 1R7IA 4ECVA 1UPMB 1PJ6A 1LW0A 2MJUA 2GV1A 4Q44A 1SBRA 4NEZA 1KP6A 4OYMA 2F8EX 2RS2A 2LXFA 2UXDF 4JI7F 3PCOB 1Z4UA 4C8OA 3UDLA 2MKJA 2GA7A 1N6QA 3MCSA 2KT5A 5L9XA 2YWEA 3BGRA 3OVBA 1BGXT 5F41A 1FJGJ 1G1XA 5LSRA 4CCHA 1JLQA 2VL1A 4DJBA 5F8HA 2M8HA 1HPZA 2EXUA 4ZVPB 3D1QA 3IG1A 3BO4A 3H59A 4IR9A 1FO1A 2K3IA 1JNRB 3N5BA 2J7KA 2MKKA 3KG1A 2IM0A 3PJ9A 4CTAA 3F41A 1RLCL 4Z2XA 1YG0A 4KYZA 1X4GA 4UY85 3D1HA 2QLBB 1AB8A 1VQSA 3WDOA 5IS2A 1VQ8S 1GTHA 3CCVS 1HNVA 2JC0A 5B08A 3U7JA 2GAHC 4LFBJ 1VQ5S 1ZA2B 5HL7Q 2U2FA 2Y8WA 1U1RA 2GMLA 3T1HF 4RW8B 2MKYA 4K4SA 1NO8A 2NYHA 4PXEA 1LK7A 5RUBA 4HTJA 1TMMA 4LQ9A 1ZM4A 1HNWJ 3ILLA 5J1PA 4HL9A 1NJIT 1QUPA 2DJWA 3OFHA 3SYZA 1ZBTA 3CC2S 2Z57B 4JI0F 1Y7PA 3RYLA 4USTA 1VJWA 4CNYA 1FRXA 4ILMA 4M94A 1RTDA 2ZH4A 4K50A 4DV4F 1R8BA 5F8IA 3K5OA 5KT2A 2FJBB 3SV3A 1SC1B 2GIFA 4RR5A 5EN1A 4CLLA 2P6SA 2V50A 4M1KA 4LF6J 4YB5A 4QR2A 5GAHU 2LQ5A 4GVLA 1ITPA 2CPHA 2ZH7A 2NSBA 4Y34A 2VKZG 3CJ0A 3TA1A 5KG0A 2JZ5A 2WZ1A 5A8WB 4RW7A 4I1TA 3VZIA 1RAGB 2KVQE 1R8AA 4RPFA 2G1HA 1WTFA 4CLFA 1HW9A 3NGKA 3MD3A 4LT6A 1FERA 4F4WA 3H4BA 4I69A 3AJDA 2E9ZA 1LWCA 3G82B 2IJRA 3PXGa 2HFNA 4C0HA 1FK9A 4MK9A 3AH6A 1UTAA 3CXCR 4WF9Q 5KAKA 3ZTOA 1RWNB 4R25A 2CAJA 3CB4A 3BO2A 1F0XA 1MNEA 3KOAA 4ELUA 1S6PB 3VWSA 4NOHA 3CJTA 4ZLPA 4O0IA 4X4SA 2BM1A 5MLCV 5I3PA 2X51A 4DN0A 2DYAA 3UVJA 2Z2YB 2GJFA 3H2LA 4AQYJ 3CD6S 3QGIA 1WC4A 5C24B 3MM8B 2HLUA 2B9EA 3QBCA 4O3RA 2CNNB 3BYPA 1ZAWA 3JSMB 1VRTB 2OPPB 1TVRB 2PN6A 3FCWA 3KLGB 2F3JA 3CDWA 6FDRA 1FTCA 4L3NA 4U7UD 4PKDB 2N4DA 2XMUA 3R5DA 5IT0A 2R7TA 2P6TA 2P9CA 4MIBA 1NAQA 3PZPA 5KFQA 1HQEA 3VQTA 4DCPB 1RGVA 5L1KA 3PEJA 3W5YA 3Q24A 2PI4A 1R3NA 4OHWA 1A6LA 1RDRA 3IBWA 4O3OA 2VQEF 3QGHA 1YQHA 1IQZA 3C6TB 3LO3A 3MM7B 5B0GA 4WP3A 1BD6A 2DD8S 1D0EA 1U2FA 1HMVA 2C42A 3NBPA 1UZDA 1IBCB 4F0MA 4KHRA 4EYHB 2E66A 5HJYA 2F4VF 3VZHA 2DO4A 1VQMS 3MEDA 3R5BA 1VRUA 2ASYA 1M90T 4C8LA 3UW1A 1KLMA 1S4FA 3OVAA 3DRYA 4F0KA 2EG2A 2YNHB 1IKYB 4C9DA 3IP0A 4N56A 2I6WA 4K4XA 2KYXA 1NBEB 4N8OA 2IBOA 5HROB 2MLYA 2FLLA 1RT5B 4WZQA 5ADZA 1JLBB 2HWTA 1RT1A 2ZBQA 2DNNA 4CWBA 2BQUA 4L3KA 3M6XA 3MAHA 3I4HX 3W3SA 3TAQA 4F4ZA 2UXCJ 2XQCA 2WB1D 1N32J 2AKWB 3EGWB 2OTLS 2MPUA 5BYQA 3FKBA 2O67A 4DSJA 3QFHA 3HVAA 2UVUA 1RT2A 3M1VB 5G0RA 3A8JA 2OAUA 2YKNB 1S6UA 2W9BA 3DHWC 5DLFA 3I5AA 1RAOA 4DX7A 4LRDA 1LWEB 2XNQA 1HARA 2E1MC 5HMYA 1DQ9A 3OTDA 4UQGA 3P4UB 4DU7A 1ZPWX 3HF5A 2VJVA 3HHDA 2JLGA 3K8VA 1IWAA 5KFFA 1IKWB 3P5TL 3W5XA 4HH0A 3SCKE 2I5JB 1HNXJ 1K1SA 4AL6A 1S1UB 4FF1A 2CZ4A 2VQFJ 5IFMA 3ONQA 1S1XB 2LQ9A 4OI3A 5B0EA 5E2QA 4L6V3 5A2QU 4DEZA 4IH6A 3J7A1 1Y5LB 1TAUA 4HKQA 2XYHB 2GGPB 4B3RF 5DQGA 3MR2A 5BYRA 4BDPA 2HNYB 2OD4A 3HT3A 2CRLA 1MU2B 5D3GA 3R2CJ 4DR4F 3ENQA 4DPUA 4JI2J 3I87A 2VA3A 3B4DA 3L7OA 3NOCA 4X66J 3EXCX 2DRDA 1WOPA 3OLBA 2BRLA 5H9EK 2DH7A 2QFJA 1H7WA 4R5PA 5ITHA 4ES3A 1VYAA 4DOZA 3HHNB 4KGKA 5IC6B 1YRUA 2ZM6J 1LW2A 1OY9A 3PEHA 2AW0A 3GONA 1LEOA 1QDUB 2H54B 2HK3A 1VQPS 4DSEA 2AD9A 2JX2A 1F2HA 1VRQC 4RUAA 1RAAB 4HT5A 1HA1A 4ZJQA 2YNGA 1IR1A 1MLAA 4TN2A 3DLHA 4CLUA 4QOTA 2CPZA 2MKSA 3K2YA 3DRRA 5KFBA 2XBPA 5DS7A 3TZZA 2RQKA 4DV1F 3PR5B 4UTGA 2C3OA 4KKOB 3SMZA 2XO6A 1EKSA 4G6VB 3Q23A 3QNWB 5MAOA 2VICA 3M4XA 3LW5C 1XEZA 1UW4A 2ALYB 4DCOB 1U02A 3H90A 3I6PA 1S0OA 4DS5A 2OSQA 3BKTA 4ZIWA 5IV4A 3QRQA 3M7VA 4JI6F 4H4MA 5KFGA 3MMJA 1S6OA 1RK8A 4XAKA 4X62J 1WG4A 3KUEA 3KLEB 3OTBA 4ZP9A 2H4YB 2W2NP 3PHTA 1V5VA 2HS0A 1NJZA 1X5OA 1R0AB 1AYEA 2ZDPA 3TEGA 2K8GA 3IGVA 2DR7A 2GJIA 4CLSA 3NCPA 4A8XA 4JI5J 5D8HB 1X9MA 5IOLA 2I1RA 4F4YA 3UCZP 1A7GE 4J9MA 4KSEB 3MEEA 2MQQA 4M5DA 1L3UA 4ZPVR 5DDOC 2YNIA 1OQ6A 4IR1A 2CG8A 2LA6A 4J7CA 2HAIA 1FKOA 2VBWA 1VQNS 1YGYA 2AX1A 4ZVHA 1ZA1B 3SSSA 4E2FB 3TANA 1JLEB 2YH0A 4KAIA 1EAYC 4N8NA 2CZVC 1D1UA 4N47A 1DTTA 4WP8A 5A2QY 4DL4A 5KT3A 3J7YI 2RD5C 2OFHX 2XY7A 5HMZA 2HRYA 2BKOA 1REGX 4OI2A 1AZSA 3LWMA 2DGSA 5F3TA 3HKWA 2B4OA 4I2QB 4CH1A 4UW2A 4QIFA 4R0EA 1N36F 2QL5B 4XK8C 4HHUA 4WXOA 2CA9A 4NYPA 1WG5A 3MMAB 3MTJA 2XZDB 2C3UA 2CJXB 3HSJA 4EMDA 3THTA 3ZTSA 4Q5VA 3LP1B 4ELVA 1SXLA 4ED4A 2IRYA 4DX5A 4U7CA 1PIEA 4QWCA 4NLVA 2W4CA 1CJKB 3D0GE 4ITSA 3NNHA 3OTCA 4MYUA 3BV8A 5GAGI 5EWEA 4RO0A 3M8RA 2CQBA 1B0PA 3KDNA 2V6AA 3G4SS 3BYRA 3FSYA 4CQ1A 3Q86A 3HZGA 3Q8UA 3KLIA 1SJ3P 2ZOFA 5F8GA 4F67A 5LMUJ 4ZHRA 4P74A 1AA1B 1RT6B 4KR0B 1QLNA 3LPEA 2KM8B 3CC4S 4H4OB 3KK3A 3RTVA 3CJKB 1OS5A 4FP9A 5FIIA 2N7CA 2XC9A 2NR0A 1HNZF 1S9EB 2HHPA 1ZH5A 3HX9A 3ENWA 3HSZA 2RQMA 3W2WB 3DMJA 3CCSS 3IR7B 4FYVB 1OSDA 2QFIA 3IN5A 1C0TB 3JSRA 2UUCJ 3HJVA 2ZC4A 3R97A 4IG3B 4JP8A 3V4IA 3TAPA 5EDWA 2J0XA 3J7YU 1XERA 3HFVA 3MUVP 2YWKA 1XNQF 1N0UA 2OPQB 4KBIA 1VGYA 1U6FA 1HBNA 3BPSP 1UEKA 3KHGA 4TY9A 2ABYA 4WE1B 4YHHJ 3FCVA 2BQRA 4KFBB 4NLSA 2E1PA 3BH7B 2NXCA 3IRXB 1SB6A 2EC2A 3MECA 1K73T 1YVFA 2FC8A 2QZ8A 1GK8A 5IZHA 1WKLA 2IDEA 3DN9A 4LIWA 1X9SA 4ZIVA 1JLFA 2CNKB 3A13A 4ED7A 1T8EA 4NLDA 4DR1J 2XGPA 1NZ8A 5I42B 2HK2A 3K0JA 1RE1B 1IBKJ 4ZA1A 3IS9A 4NCAA 1U0SA 2O66A 2E7VA 1VISA 4OHZA 5L9NA 5IT9U 1X5PA 4F2RA 1RJJA 4LRCA 1HBOB 3ILJA 4H4KA 2LP4A 1NZAA 4IFYB 4I2PA 1B64A 1XTZA 4YUDA 4FF4A 4KO0B 1IBLF 4DV7F 3GYGA 3MPUB 4DSFA 2AMCB 4QR0A 4LF7F 1ZTWA 3HFZB 2X1FA 2W2MP 4WFXA 2KXFA 1XMBA 4X65F 3PG9A 1T7PA 2IFXA 1OWXA 3RW7A 3WHIA 1BUXA 4LF8F 5U47A 1XK8A 4DLGA 1UJ4A 5HBMA 1JQGA 1XN9A 4NMLA 3UO0A 2FHMA 1PO6A 3VAHA 4RU9A 2FLPA 1VCTA 2W1BA 4OI1A 2Y0BB 2DGXA 2LU2A 3CDAA 3AA9A 4K4VA 2B8PA 4ZVOB 3LP2B 2FLNA 4DR7F 1XR5A 3OTOF 2VPWB 3PV8A 3MMCB 3KLHB 3BSAA 1TL7A 4CT9A 1R0BG 3R9LA 3PHEA 2G2ZA 5D78A 3CT9A 3MPWA 4A8YA 2BYCA 4USIA 1VHFA 3RBZA 4WFZA 4X4PA 2RKIB 1GEHA 1KOOA 1VHIA 5D15A 4I67A 2NPFA 2XYGB 4IOAQ 1U1QA 1BLUA 4OI0A 4DPOA 1UPPA 1KTVA 2RUGA 1FD8A 2BKPA 3M2VA 5CYJA 4YR3A 2IAJB 3SEOA 3P6YC 1I6JA 2DGQA 2QE5A 3A8IA 2HFUA 5EWFA 4GC6A 4XIUA 4NA3A 2JEIA 3RJMB 4DHVA 1KTQA 1SIWB 3IAM9 4PUOA 1Q82T 2AIRB 2Z30B 2UUWA 2YBVA 3TVKA 1EETB 4LF5F 3JS9A 3QSYB 3DLGB 3BB5A 1Y5NB 4B9LA 2HBZB 1IKXA 3OR2B 2E9RX 3ETOA 1XJWB 2VOOA 2B9WA 3JTNA 3I82A 2CQ2A 4TU7A 3C15A 1WEXA 1XC9A 1BXNA 3F0NA 4RKUC 3W63A 3OHBA 2C1EB 1SJQA 4OZ0A 2KT3A 3PY8A 2W2PP 2KXHA 3ZZUA 2IVFB 3DU6A 2DNPA 1IQTA 1PYTA 2AP6A 3DOLB 4L76A 1UVJA 2ZBCA 2ZH3A 2R4FA 5ETLA 3BQ2A 5DQIA 4ES2A 4DI6A 4DPYA 4ZPBA 4FPIA 5KFEA 4LF9J 1IJFB 1KR4A 2DXDA 2JH3A 4OMFG 4ILLA 5E3CA 1NK7A 2E29A 2XO7A 2AYBA 4Q8FA 2AZ3A 4U9RA 3KTQA 5IT9Y 4WP9A 3DYAB 2PO4A 4RWXA 2XWYA 3OR1A 3LH2S 2ROGA 3EMTA 4FVMA 2P8IA 3D6HB 3A1YG 4OYOA 1B99A 3VV2B 4V19J 3PJXA 4FXWA 4PWUA 4M5KA 4KB7A 2HHUA 1T9WA 5DG9A 3BSOA 2M5YA 4B3TF 3VF0B 3Q83A 3RB3A 2YY3A 4PYDA 3CJ3A 1T3OA 3L09A 1NMEB 5KFKA 4GKKJ 3IRWP 1U8WA 2V8VA 2R7WA 1N6QB 2NREA 2KHDA 3DRXA 2BW7A 3DM2B 3GYNA 4MKVA 2RMLA 3BGRB 4A8SA 4H4KC 1DQAA 1R0CB 2HNZB 1PJ5A 1GT8A 4RNOA 3LGNA 3QJJA 1FKPA 4Q0BA 2QEXS 4OZJA 3AD8C 3D0IE 1Q8IA 1HPZB 4J91A 1HIYA 1URRA 1RBLA 1SKSA 3PIPQ 5C7PA 2ZZNA 1UFLA 3DKDA 3KJVA 3G9CA 2MGZA 1S9GB 2EFOA 2VFVA 2ZE2A 2KH9A 5H1SV 2C3YA 2EC0A 2W2OP 4I6WA 1N8RT 2OPSA 2VPYB 3SSRA 4DXLA 2PEHA 4ZLJA 1VQOS 2MDAA 2OSRA 2FJDB 2R7XA 3C6UA 3P5BP 2GO8A 2EI5A 2AT1B 2IC3A 4NXNJ 2ZHAA 2D69A 5LMNJ 3PKYA 3G6XA 4X84A 4LSNA 5DDRC 1Y9OA 2PEBA 4MJKA 2YWGA 3KWMA 2DH8A 1Y5IB 2X3DA 1F9HA 1RB0A 2MKHA 1N33F 5IT4A 2NXEA 1IR0A 4C48A 2DEIA 1JJ2R 2V4JB 2GCFA 2VF3A 3H98A 2H51B 2L41A 2KVIA 2HQIA 2A2DA 2DTJA 1QM9A 2V9WA 5DLGA 4B3SF 2V8PA 3K5MA 1JXVA 1KS2A 1DLOB 3OVSA 1N5YA 4OZLA 1QAJA 2LQ8A 2UP1A 4A8FA 4N76A 3C8YA 2XULA 2ATCB 2UXBF 4PG7A 2AF6A 2V2QA 4NLQA 3LWLA 2AJ2A 1SV5B 3M8SA 4OHYA 3FC9A 4C8NA 5C42B 3CCZA 5KFCA 3DGPA 4O44A 1RT4A 1LWCB 2B6AA 2HBYB 1FDNA 3Q8QB 3AQPA 4DL5A 2CDQA 1U1NA 3CUNA 1NK5A 4P75A 3S01A 4IRDA 4NPOA 2HHHF 1CQMA 2I8EA 1YZ6A 4OZ1A 3EGVA 3SQGA 3UWTA 2RDJA 1FFGB 4ED6A 3RB0A 2M0GB 4WYLA 3K5LA 1Y11A 2B51A 3M2RA 4B17A 1NK6A 1OO0B 2RHSB 2J5AA 2I2YA 2HZCA 2JNJA 3RAMA 3WX4A 4QW9A 4U67Q 4GO5X 1VFJA 3MPYA 2MQOA 1NJYA 1V3SA 3LTOA 4C8ZA 1DARA 4QIEA 4GKJJ 3DHXA 2VG7A 4WIIA 1YZ7A 2XI2A 5HK4A 1S0MA 2N3OA 1TK8A 5M2UA 3PX0A 5ETMA 1L5UA 4C97A 4A47A 3D0HE 1G7CB 1ZETA 2V2VA 3HHLB 1U1LA 2LEAA 4YQWA 3QZ8A 2QX0A 1Q4RA 3MCNA 4ICLA 1QUVA 4J90A 1ZZFA 2YKMA 4F26A 2LDYA 3Q22A 4LREA 3BN7A 3US5A 2VONA 5HANA 3UNGC 3BR8A 3MM5A 1TUGB 1U0HB 1U25A 1OYEA 2J0SD 1IN0A 3FMWA 2XMKA 4LFCJ 1NK9A 3I0SA 1TL1A 3GIMA 1EX8A 2WHOA 2VH7A 2A0FB 5B0AA 1T95A 4OI4A 1VC6A 3HHKA 3TZXA 4USKA 2ZOGA 2J6TA 2C3MA 2RH3A 1P6TA 1SH3A 1M0SA 1TL3A 1TKTA 2DGVA 3K58A 2V2ZA 1HW8A 2L9WA 4KPCA 2KFZA 2W4DA 4QPTA 2Z2LA 2OMOA 5JVHQ 5L1JA 1E6VA 2HZAA 1X0FA 4PWDB 3MMBB 1EP4B 3VALA 1RSCA 3CNQP 2H65B 1UVMA 3SV4A 3EDRB 4KHPJ 2FVQA 2E5LJ 4X4RA 1W26A 3JSYA 1GX5A 2LYVA 1KRPA 3KK2B 4DR6F 1OY8A 2D41A 3MI7X 1U2CA 3V6DA 1WC6A 1TFWA 2ZUGA 4YB6A 5HVHA 5A6PA 3SDEA 1QD1A 1YDLA 4Y00A 2DPJA 2ZH1A 4DMZA 2CIMA 2PMZD 3H42A 4RBVA 4D3GA 2VG6B 1UVKA 3R5AA 4KPYA 4A4JA 5KG4A 1W2BR 4OJGA 3UD4P 1NXIA 1FFWB 2RQ4A 3VGUA 2XSJA 4A46A 3LOUA 2KZZA 1RT2B 3UR3C 3CCTA 5D0GA 4C98A 3GFZA 2VG5B 3QSIA 5F0WA 5I3UB 2WBRA 3TP2A 1UVLA 1ULRA 4XPEA 1RLDA 3UI3A 5A76A 2PFDA 4NL5A 4OLOA 9RUBA 4J9QA 4DV3J 1M1HA 2QA4S 5CHCB 1U24A 3CIMA 1FA0A 1PYOB 1SL2A 4JV5J 3OFGA 4NCBA 4OZ2A 3W62A 2BE2B 2HZVA 3OFFA 3D54A 1YBAA 4CIOA 4LSLA 1S97A 4JI8J 4IOBA 3F44A 4A8OA 3DOMA 1S59A 5GADU 5J2MA 3AD9C 3QRRA 3V4MA 3M30A 4RZRA 3J7AN 2W9CA 3BGFA 4DV0F 1NSAA 2ILZA 2KJVA 3VCDA 1U7LA 4IH7A 1FDDA 2POKA 4EU0A 1BY9A 1KHWA 1RTZA 2YKPA 5KFTA 3OUYB 3IGNA 3FDSA 1YI2S 4F8RA 4K4TA 5KFVA 1YTYA 5C2GA 1AXQA 4WTYA 3QIPB 2HHVA 1NPRA 1HNIB 1SC4B 2WTFA 3Q8RB 3WBZA 2QG9B 5KG6A 4CO2A 4KV8A 4R8UB 3EYZA 5KT6A 2XMAA 1U6ZA 4LQ3A 1C4CA 3WQPA 4NMXA 1NHKL 1RTJB 1LWFA 3AXMA 5J2NA 3DXBA 1N5TA 4CLTA 2W8LA 3GV5B 2VB6A 3NGRA 2XHCA 2ZVSA 4PABA 4FF2A 1R8PA 2G0JA 3MXHP 5DZ6A 1P9QC 3DLKB 4C4WA 4DUZJ 2BA9A 3R7NB 1J2VA 4WFAQ 3C16B 1CJTB 3B82A 2P2CB 2HQFA 1J5EF 3RG6A 5K9FA 2GAGC 4GVBB 3I55S 1U1MA 3IR5B 2D9OA 2HHXA 4FYXB 2RF2A 2HMIA 5EX3A 4NZ7A 1CS4B 1UEVA 5LL6d 1X4DA 3J80U 5BR8F 1H73A 3BH6B 4CP5A 1FE4A 2B3TB 1MROA 3EDQB 4RU2A 2GVDA 1P1LA 3W8GA 1C1BB 3M32A 2XCPA 2Q43A 2J9EA 3QATA 1YJWS 4ZVSB 1VI7A 5DO2A 3T19A 4LFAF 2LVWA 5CZVA 1J5OB 5FD1A 1A9NB 2F9DA 2O3DA 3T1AA 1WHYA 3SCJE 1T03B 5H9FJ 3Q2SC 4HHHA 3PTWA 2E1AA 3CW2C 3RRGA 3PFOA 3FZ2A 2XTJP 2FVRA 3OSPA 4IFVA 5HLFA 3CJRA 1UFWA 5E3AA 1U1KA 2HAFA 3GG1A 3OLAA 1UA1A 1SIZA 2RSQA 3M2UA 2GVZA 3TAMA 3UE2A 2QA2A 2ZD1A 3VHQA 1RHKB 3O1LA 1Z2ZA 3KK1A 3FCHA 4PPZA 2WVEA 3C14B 1TFYA 3DGVA 4X64F 2BMBA 1DTTB 1S1TA 4TKTA 4DV5J 4CLPA 1HL6A 4Y6IA 4EYIB 4EUVA 1TUWA 3ELHA 2GO9A 1Q0NA 2ZDOA 4DN9A 5A0YB 1EARA 2KL8A 5EHHA 4AD6A 1IJEB 3VGVA 5M2PA 4RBUA 1WC5A 2RB7A 5KFAA 4A8WA 4QR1A 3P45B 3TUPA 1TK0A 2MZ1A 4TY8A 4V19X 3VTIA 1YJ7A 2HBRB 1HQ2A 5F9LA 4LF1A 1MN7A 2GQ2A 1R6YA 1YBTA 4Y2KA 1W2IA 2HVHA 5D4PA 2MZTA 1B0TA 3Q0AA 1FVQA 8AT1B 4LSZB 2CPEA 3X3UA 3Q8SB 2QTWA 4IKAA 2KFNA 2HVDA 2VFRA 1H2VZ 2KKHA 5HMXA 2V63A 3BJYA 1YWXA 3GPAA 3PRVA 4G1IA 3SZ2A 1NPPA 2A2CA 2MY7A 3HD2A 1KBRA 4JV1A 5A8RA 3JQMA 3CJQA 2A1BA 2GIQA 1RP5A 3TJ9A 4J9PA 2EVZA 2BACA 2ZH6A 3GSIA 2GX8A 8ATCB 2E5GA 4ZHRB 4AE5A 4DFKA 3CSKA 4JV2A 1KSPA 2M9KA 1CC8A 1MN9A 1SCJB 2VZ9A 5B0FA 3P49B 4G1PA 1KKHA 4KE5A 1IKVB 2ZZTA 4ZDNA 4A8QA 1JLAB 2ZH5A 2H5IB 4RNNA 3UDVA 3FK4A 2AGQA 2MZSA 2B5JA 2D74B 5F0UA 2DNGA 4YDDB 3J80Y 5HP1A 3V4IB 3EPGA 4C3LA 1S1WA 1YJNS 4P7TA 2YPYA 4EEYA 1Q7LB 1Q53A 4P2SA 2CWXA 2DHGA 3DRSB 5J1EA 1F9FA 4O0NA 4DQSA 2Z2MA 4FKXA 4N41A 4MFBA 1KFDA 3W8PA 3R5CA 3NCQA 1SJ1A 3V81B 3JB9k 3ZZ0A 2MHEA 2UUTA 3BBFA 1VK3A 3BM7A 4P10A 3GSDA 2CVEA 2APOA 3GZ7A 4W92B 5JMNA 5THWA 1RA7A 4LRAA 2OI2A 3QPIA 4OZNA 2EFNA 4RJVA 2J0WA 2PA8D 3MZIA 3LQVA 1YRTA 2PIIA 2DB1A 2WSEC 1OPIA 2XI3A 4ZVQB 4KHMA 2DHAA 1R89A 2X1GA 3PW0A 3M6UA 4RBTA 1D9AA 3HCXA 4RW6B 3TWZA 1E6YB 3ET6B 1D3WA 4NLPA 2J8SA 1P27B 2HFVA 4IOCQ 4B9MA 4FS1A 1I51B 1FXDA 1F60B 3CD5A 4O3PA 2UXDJ 4JI7J 2DVIA 3KFWX 4UY8T 2DIVA 4EZ9A 4EK2A 4BS2A 4M5MA 1QVGR 2BW2A 4OHXA 1UWBB 1WOOA 4K4WA 2NPIA 4YS2A 1F6TA 2G13A 1B7YB 2BE9B 2AJFE 1WG1A 1GAOA 1YJRA 3FSIA 3QT5A 3ZFVA 4DR2F 3I31A 5E7OB 5IM0A 3H5SA 1IM6A 3RB6A 4OV1A 4YR0A 1QAIA 5T7LB 4RW8A 4DFPA 3JTPA 3K89A 5GAEU 1S7HA 1HBUB 2DNKA 4YY3F 1OIAA 4EBEA 5F8LA 2BANB 5HN0A 2CYYA 1MMNA 3UD5A 2MSTA 4OYPA 3H5YA 4ECZA 1S79A 2PE8A 3NY0A 3ICLA 3ULHA 1LFPA 4L74A 1RTIB 4YFUA 2EFGA 4LBPA 1KQKA 3NOGA 2FZGB 3D9BA 2NSCA 4AYBD 3CGIA 3NWGA 3TUJC 2EBGA 3T1HJ 1SL1A 5A8WA 2C2NA 3ZZPA 2I0XA 3Q8VA 2ATLA 3E01B 4ENOA 1PBUA 4FVCA 2H3EB 2BX6A 2RRAA 4JI0J 4DSKA 4PUOB 5KFMA 3POTB 2K3KA 3KLFB 4J9OA 3CJ2A 3G82A 4JV0A 4ZVUB 4CYUB 4F4KA 3ZZZA 4NZ6A 1SQGA 4DV4J 4J9LA 1CPZA 5AXMA 4PQUB 1MW7A 2LXIA 1KN6A 3DOKA 2N82B 1T9UA 1RABB 1UEUA 3T1YF 4UOCA 1RWXB 4RW4B 4CO5A 4R0JA 4K0KF 2V68A 3F56A 3PDNA 1UL3A 3OFEA 5B7WA 2YH1A 4URSA 1LKZA 1S6PA 3FFIB 2YVSA 3ISND 1X5TA 2YQ3A 3M9NB 1WKKA 4RW9B 1HI8A 5KFXA 1TR0A 2C2OB 1RHRB 5D0RA 2G4BA 3U27A 1NRKA 4LF4F 2CQPA 4K8RA 2OGUA 3TJAA 2UV8G 3ITHA 3GP9A 5ETVA 5C24A 2CQGA 2NZCA 2F9JA 3GFYA 3A4TA 2MB0B 3JSMA 1VRTA 2OPPA 1TVRA 3BPDA 5DDQC 5GAHI 4CLYA 2WCXA 2WW8A 3KLGA 1NHVA 1RTHB 3HVWA 1XIQA 2GFFA 2QMXA 4QQBA 5CAAA 2DBBA 4PXCA 4QJVA 4TVAB 3H20A 2HFZA 5A8KB 2VHGA 2WVFA 1XMOF 5E3RA 4ZCIA 3AJ1A 3M8PA 2ZH2A 3B8HA 1FRIA 1H6KX 2UUBF 2HGLA 3MUMP 4YMEA 4XTTA 5HQLA 2HQGA 4NX9A 2D9PA 2DO0A 3C6TA 1N88A 2KB2A 1QAXA 3VAFA 4LUBA 3MM7A 1VQLS 4OHVA 3O8WA 3CMAS 2R42A 5KFSA 2R7UA 1GXUA 2E7XA 2EPIA 2FY1A 3E2EA 4DL7A 4CH0S 5DGAA 4F3OA 4ED1A 3CJSA 3G86A 3MPDA 2VIHA 3PR4A 3IO1A 1N56A 3TX8A 1CSJA 3DRPA 3NGSA 2ZZMA 1SKUB 1D09B 1R8CA 5ETPA 1IKYA 2B0GA 2XS2A 2NXUA 3NAIA 4PPDA 4MK8A 2V8GA 2Q6CA 2QMWA 1NDPA 2JLFA 5HROA 4OX7A 2W9AA 2VQEJ 1AFIA 1MWZA 1DTQB 2HHQA 4A8KA 2WBMA 3KMQA 1RT5A 2ALZA 1TAQA 4X4VA 4WXWA 1N34F 2V67A 1JLBA 2XHWA 4DV2F 3SSQA 3KHHA 3RAQA 2J7UA 3R6GB 1ZAVA 2DNHA 1K47A 4DR3F 3EWGA 1DHMA 3DDNA 2DKOB 5CQGA 2F4VJ 1X4CA 4DBQA 1NKEA 2I38A 4AT1B 3OBIA 1FDBA 1RHQB 1O0PA 3D6MB 3N28A 1HI1A 3A12A 1RYSA 4CO4A 4EWTA 1VC0A 1MWYA 2YXLA 1VBZA 4TLQA 2YKNA 4C3MA 4DSLA 1YJ9S 1RADB 2V5HG 1FWPA 4ZJOA 2V69A 1LWEA 1GNKA 4L72B 1HWJA 2EKYA 4KQZA 1UJ5A 4P2XA 3D6TB 4F02A 1UJ6A 2HW3A 3RAXA 4MTPA 3MF5A 1R8HA 4Y2AA 5DM7Q 2Y1RI 4GRSA 4F3MA 1IKWA 3NRBA 2OKQA 4ZS6A 2I5JA 3DLEB 1M5PC 5FDLB 1S1UA 2AEMA 1RCXB 4USHA 4BBYA 3CWJA 3MFHA 4PQAA 2OEMA 3J81U 1WORA 4I64A 3R3TA 5CA5A 5J2PB 3CCJS 3TA0A 1ZS6A 1SKRA 1BQNA 5E0OA 1HWLA 1CLFA 5KOXA 1G6BA 1B3TA 1SVDA 4QWEA 3L7UA 1ICEB 1V6HA 2HVEA 3FQLA 1H2UX 3H4DA 2IVMA 4WK1A 3CJ8A 3GTYX 2VJUA 2FJAB 5KG1A 2QYCA 4FF3A 1Q86T 2RUSA 2HNYA 2JJ4D 4NE9C 2AJQA 1MU2A 2BJ1A 2P9EA 1S1VB 2JLEA 3MM9B 2Q79A 1C0UA 1S6QB 2MQLA 1I5OB 2IJNA 4FBUA 3R27A 1RT7B 2HG4A 1JKHB 1T9YA 4DFJA 4ECXA 2DXFA 2QLXA 3KJFB 3NKYA 4L73A 3EPIA 3PW5A 2ZBRA 3LAMA 1O5JA 1UMJA 1YK9A 2ADCA 2DPIA 2G9OA 1UA0A 5KFZA 3FEXB 1FEHA 1FNMA 2NZ4A 1X4EA 3OSNA 1ZYQA 3LP0B 1SUQB 3GJQB 4X4UA 4KGXB 5CYQB 1NJXA 4B3RJ 2MY8A 3Q89A 4ZPCA 1L3TA 2F63A 4OYXA 2XLJA 3I96A 4JI3F 4DR4J 1LK5A 1O8BA 1OMSA 2XMVA 1RA6A 2JRSA 4K5SA 4ZPDA 3NWRA 3IWXA 3ENVA 4KKOA 2K7JA 3EICA 1RHJB 2M52A 2E1RA 5JUMA 2YKMB 2G2YA 1MWQA 2AYGA 1RWOB 1CJVB 4TNOA 4JI1F 2Y8YA 3CDEA 3PNIA 3K17A 1TV6A 2BUNA 1IBMF 2LQBA 5ETRA 2KRRA 3RZAA 3P3DA 3AY0A 2OH2A 3DDKA 1OQ3A 1MMDA 3VAMA 4P9SA 3TUIC 2IA0A 3VVUA 3P96A 4B3MF 4MK7A 1N4LA 1RAHB 2EEYA 4O4GB 2IBKA 4TU8A 2XZTB 4MIWA 1TL3B 4NEYA 3B6BA 1FEEA 4DV1J 1G4CA 3KLEA 3W9HA 2ZJQQ 1PBAA 1TUVA 4ANEA 4KC5A 3G87A 1XR7A 4DUTA 3ZXWA 4DZDA 2Y1JA 2PC6A 3TOQA 1S48A 4W90B 4RWWA 2E9TA 1RT3B 3K57A 2CQ4A 4LRFA 4ZKAA 2RRNA 2FIUA 3WX8A 2ZNZA 2FHOB 4ZPWR 1S12A 1K0VA 1YITS 2ZNYA 4DV6F 3G8QA 3SDEB 2GIRA 4OX9F 4JI6J 4ED0A 4BLGA 4DQQA 2F4FA 1U26A 5L38A 1Q78A 4PZVA 1HYSB 3KKFA 1ZPVA 4KIAA 1TP7A 2RIJA 4FKYA 3L3CA 4BC9A 4Y2IA 5K14B 1FXRA 3FQKA 1WACA 2J8AA 2MXYA 2D1CA 2WVCA 3GIRA 1RXOB 3J81Y 4UZCA 2E7WA 5T41A 7FDRA 2UU9F 3CULA 3QRPA 2GJ2A 3MFIA 2K06A 4NLRA 4PG6A 2A3JA 5B09A 3GCXP 1NEEA 1Q5VA 4HI1A 1NK0A 4F2SA 4YOEA 4FXVA 3ISNC 4JI8F 2RS8A 2C28A 1KQGB 5DDPC 4XO0A 1X31C 3GU0A 3OJUA 1NB2A 2YX7A 1NKBA 1XWLA 1BWVA 1EZZB 5AE1A 4I2QA 5KTQA 2VD3A 5IQQA 4CO0A 4ZJLA 3BQ0A 3BGUA 3MAAB 2NUUG 3GWCA 3KNGA 2YWHA 1CULB 4N77A 3EUNA 3QT8A 1XMQF 1YLXA 3MMAA 3QO9B 4X4TA 3K8WA 5KFPA 2L3MA 1UVNA 5C25B 1AROP 3LP1A 3AAWB 1Q79A 2V4RA 5K8PA 4IYQA 3MM6B 1T3NA 3N01A 1U6BA 4AUKA 4MIAA 2ZKTA 1CJKA 3DOMB 3SCLE 4DL3A 1FXLA 5CYMB 4QCLA 2WONB 5J2MB 1HWKA 2LEPA 3RRHA 2OEJA 1SI9A 3BKUA 3ENAA 1N36J 7FD1A 1APSA 3SBMA 2OP5A 1Q95G 3KJNB 3H8YA 4IDKB 2R7RA 1T02A 2UVRA 4DPWA 5DRKA 4F0HA 1F9EB 1LNQA 4DQPA 2D3ZA 4F36A 2J9DE 3JYTB 1RT6A 1I94J 2DK2A 4H4OA 2J9CA 4NXMF 3CJKA 2GHVC 2AJ1A 1IR2A 1S9EA 1DQ8A 4KV8B 4QYZK 3W2WA 3AB2B 1FFSB 2M88A 1QAYA 1C0TA 3ZNJ1 2NLWA 1PSDA 4ED8A 4IG3A 4Q43A 1TKXB 4U96A 1WSRA 2COLA 4NCGB 2C2RA 1TTHB 2OPQA 2DR5A 4G3IA 3TNVA 5KFUA 3G8TA 4WE1A 1X4FA 5SZTA 4KFBA 3UCUP 3D28A 2BOAA 3IRXA 3MWBA 5J2QA 3PX4A 1HNZJ 2HEKA 4FZVA 1VBXA 2N4CA 3G96A 2V94A 1XBWA 2QN6B 4ZVGA 2Q1LA 5DJBA 4USVA 3DLJA 1X4BA 2IHR1 1REVB 2G0IA 1K9MT 4ANCA 1KHVA 5I42A 5AJ3F 1Q1KA 4CI0B 1NH8A 5EGYA 5D4OA 4CH7A 1T9VA 5DG8A 1QE1B 1PC5A 1XNRF 4DUYF 1S0NA 3CTRA 1XNQJ 3UR0A 5K8MA 4ZPTR 2HFOA 2R2UA 1HBOA 1GMUA 2ILYA 1J27A 5HJXA 4KO0A 2K1RB 4DU8A 1TMJA 3N5FA 2ZJPQ 2Z0GA 2UUAF 3H25A 3S1TA 4Y2CA 3RR8A 5KFWA 4PG8A 2LMIA 1Z2LA 1LOUA 4Z7CA 3GQCA 1YRXA 4AL5A 1WDTA 2Y3YA 3BN4A 1HBMA 5KFHA 4AL7A 3A3PB 4WBFA 2F40A 3LP2A 1S1TB 1IBLJ 3D7SB 3MMCA 2BKNA 3KLHA 4DV7J 2XY5A 2F5GA 2XWXA 4LF7J 3THPA 4E98A 3FBCA 4IG0B 4X65J 4Q45A 1HKAA 2XYPB 2AX0A 2RKIA 2FHKA 3HVTB 3CDBA 1ZOTA 4LF8J 4RUHA 1RKJA 4I7FB 5BYSA 4HACB 1CC7A 2E5IA 2AGPA 2FYXA 4I68A 2IAJA 4DR7J 1X8DA 1GMVA 3EVMA 3OTOJ 5J1NA 5AXNA 4FPRA 3H7HB 4CLZA 3B4MA 2XMTA 1SQFA 5HO4A 2HKEA 2VBYA 2YKAA 1IXKA 1YX2A 3NAHA 2HWIA 3E51A 5C5JA 2QSFA 1PCAA 3I32A 3RRKA 3EGNA 2OPRB 4B3OB 1ZM2A 5H9FK 5KT5A 2XS7A 4CM0A 2W8KA 1TKZA 1EETA 2LXUA 2DCLA 3DLGA 3GR0A 3IBFB 2HNDA 3EZ5A 3D3BJ 2RE1A 3OR2A 2V8DA 2VPZB 3C2PA 2G0CA 5F9NA 1PJ7A 2R7OA 2KM8C 1RU2A 3FSXA 1U1OA 1GH8A 2YTCA 1TELA 2VFSA 4K7QA 4HR2A 1FKAF 2LECA 5KFLA 3EZOA 3DOLA 3PRDA 2P5VA 2QIFA 2M7SA 4P6QA 4U8YA 3WIUA 3OL8A 3KUGA 3GYXB 3DLBA 2VFTA 1K44A 5KT4A 3N9UC 2EG1A 4LRBA 2QRRA 2ZFHA 1DAXA 4C11B 4ED2A 4LF5J 1HQUB 2QGFB 2RJZA 3FRYA 3EJMA 2B5JB 2KRBA 4QIWD 5HP1B 1PAUB 2M4MA 3D5MA 1V5IB 2L9DA 3M8ZA 3RUBL 2ADBA 2BJDA 2AYMA 3DYAA 2JVRA 1B7FA 5CH7B 1FJCA 1NH7A 3IWLA 2ZBIA 4NLXA 1PGZA 3HM9A 3PYEA 1JIHA 3K7RA 3TUZC 1F5AA 1CG2A 4JYAF 7AT1B 3I0RB 2VU5A 4P7VA 4Q8EA 2QV6A 4DR5F 3W65A 2HURA 1RAFB 1VMBA 3ZZOA 4DSIA 4ZLNA 2J0QD 4CT8A 2CQDA 3DM2A 3RU0A 5M2RA 2QJ3A 1P9YA 2HNZA 3QYYA 4RLEA 4F50A 4X4NA 1Y3KA 2F8HA 2ACYA 2B4UA 3PYGA 1HR0F 4FYDA 5AE3A 4DL2A 1CJUB 1C1CB 5AXLA 2IA6A 2XM3A 2XGQA 2BRKA 3GFXA 1LXNA 3H2VE 2YWWA 3W9JA 3VGSA 4M95A 4B3TJ 3DDIA 4ZCKA 2FC9A 1S9GA 1UP1A 4DG1B 3V2UC 2R2SA 2R8KA 3NS7B 3HHLD 3KG0A 3C19A 3KG4A 3GJSB 2VV5A 1KVIA 5CD4A 3W2VB 5DM6Q 3I56S 1FX2A 1WWHA 4PG5A 4YB1P 4KJIA 2MJNA 5LOQA 3PM9A 3Q8PB 5IWAF 1WNEA 2FQQB 5CZXA 3QLHB 5IM0B 1T05A 4G1QB 1M5HA 2Y1IA 4C2MA 3JAMY 3GJRB 5IC4B 2VFUA 4OV6A 3TQEA 2IIHA 3MAQA 1QSSA 3H0PA 2BJEA 3QT7A 2VPXB 1IVZA 2IMOA 2L08A 4Y28C 2E44A 1RHUB 3M05A 2JL9A 2AV5A 5LSLA 4JB8B 2UVWA 4J9VA 2FGOA 2F1FA 2V4JA 2HQDA 3LUYA 3FRZA 4B9VA 3T6JA 1FHTA 3OQ2A 4TYBA 2HYIB 1FRKA 1MMLA 2IM1A 1IM4A 2WVBA 5D0HA 5I4MA 2H5JB 1YSJA 4C0OC 4CRJA 1BQMB 2BDPA 1DLOA 3PW4A 4OYBA 1RACB 1G2EA 4ECUA 4OX6A 2N7YA 3BDEA 2F65A 1B0VA 4RX6A 1SV5A 3IM8A 3FBBA 5C42A 1N33J 2DHHA 3MEGA 4JI4F 2BJ8A 3V6HA 4AFFA 1SKWA 4DPTA 3AXKA 3VAIA 2RU9A 4B9UA 2PT0A 3DOKB 3G6ES 3M9MB 2IY5B 2QSWA 4NASA 2F8MA 3WC2A 3FJ2A 4B3SJ 4LR9A 2G1DA 4NI2B 2V8HA 2WOMB 3LF0A 1JLCB 5L46A 2IRUA 4UZBA 2C3PA 3ZC4A 4HDGA 3QFWA 3ILOA 2MTLA 1F5BA 2RDDA 4DCJB 3JQJA 4ID5B 5IV3A 2XLKA 4PXBA 2UXBJ 3FEZA 4OJ1A 1FJGF 3HMJG 1WHVA 3HFKA 2M70A 1FNOA 3DI6B 2CUYA 1RCOB 2CNOB 4HH1A 4NYOA 3ITHB 3MEDB 1H0HB 4QU6A 1RQ0A 3A3NB 3KUHA 1LW0B 2DGOA 3HPOA 1HHSA 9ATCB 3GLJA 2HHHJ 1Q5YA 2DEJA 3HDSA 3KLVA 3JQKA 3L7PA 4QW8A 3HD1A 2QA4G 3ZO7A 3HHLA 2LA4A 4K4YA 3BBBA 1M5VC 3LANA 3SFUA 2CVIA 3MGJA 4B02A 3NEKA 3R7SB 4LFBF 3M8PB 1GXLA 1T94A 3TEHB 1U0HA 2VKRA 4EBDA 1NSKL 2ZUAA 1D9DA 1JLQB 2CDRB 3CE8A 1HI0P 5HI7A 2IDLA 3CO9A 1U47A 2PFFB 2OD6A 3IG1B 3MD1A 3HZEA 4OLPA 2CPDA 1HNWF 1LWXA 1S57A 1OY6A 3D3CJ 4CTAB 3F73A 4O23A 2Q66A 4WIQA 2B9XA 3HI9A 2KYZA 3MCOA 3K59A 1JJCB 3JXOA 3OL7A 2B56A 1YBUA 4M63A 4PWDA 3OD2A 1LV5A 2OHDA 3DRPB 3MMBA 4DFMA 1EP4A 1HNVB 2OIHA 3OJSA 4URQU 1L3SA 4ID8A 3QGGA 2VODA 3I9ZA 5L1LA 4LF6F 3GV8B 4QWAA 1JX4A 3KK2A 1NSQA 2CJKA 3UFCX 2ZC3A 3ADAC 3IFEA 1NDLA 4DL6A 1C2PA 4KRWA 3BR9A 2HHTA 1RKIA 1KEKA 2DIUA 3C46A 1UZHA 5KG2A 2VG6A 3T5LA 2BZ2A 3MURP 1NK4A 1TU0B 2X1BA 4E8UA 1KONA 1VOMA 4YN3B 1RTDB 4DF4A 3CMQA 3I4PA 5K5MA 2CJBA 2UV8A 3BKFA 4LVNP 5HAOA 1VC5A 2M2BA 4TQRA 3PO5A 1UCNA 3TI0A 5HSPA 2VG5A 4DR6J 5I3UA 1PC4A 2J7WA 3GB0A 4NYZA 2HIYA 4DS4A 1FWKA 2QLWA 3NS5A 3U1NA 3NXZA 4RW7B 2OO4A 4IUFA 2XMJA 4NWBA 2AYEA 2X1AA 1S4EA 3AA8A 2ZJRQ 5KOWA 4KH0B 1HD0A 2V4QA 4FYWB 3QJPA 3MHYA 3HT0A 4AQYF 2UVVA 3KYLA 1FK9B 1Y3JA 5KT7A 2BE2A 3BDPA 1JXEA 2W2QP 3R6LB 2RT3A 1S77D 5HQMA 2V2KA 1BQNB 2DGUA 5ETOA 3MOJB 5LXYA 2XZWA 5I3QA 1Y10A 4EFAC 4MKYA 2D3UA 5ETQA 2WVDA 3R8YA 1OPZA 2V9KA 4DL0C 5JXSA 2R8GA 2JDJA 3OT9A 4TXSA 2DGWA 3ZZYA 2R9LA 3UVJB 1C0UB 1QJHA 3MR3A 2CJYB 4IQMA 4FNHA 3SCIE 4ZOSA 2A6MA 2HIQA 2X7IA 2XEXA 3NS6A 1KQFB 4ZPAA 1G3OA 3OUYA 2JC1A 4ED3A 3UDCA 4PR6A 2KO1A 1KVJA 1H74A 4GMKA 3QIPA 2EWHA 1HNIA 2EK1A 2CADA 4R8UA 2DNYA 3HO1A 5DG7A 4ERDA 2CPIA 1RTJA 4NZ0A 1SC6A 2E1CA 4RUCA 3HHLC 2DT9A 4DV0J 1HQEB 3AOBA 1R43A 4PAAA 2BJ3A 1FWLA 1N0VC 1KNZA 1IUJA 1FJ7A 2HVIA 2NXNA 3G6VA 2FVCA 3DLKA 1U1PA 1D9FA 4YB7A 5KFJA 3C16A 1CJTA 5GMEA 4N5SA 3RBDA 1FRMA 2B4VA 2QA1A 2JEJA 1HMVB 3NBPB 2B7BB 2PMHA 5GADI 4GVBA 3M8QA 4BWJA 3ILIA 1TV6B 3H5XA 1RWUA 2BV3A 2YKQA 4YDXA 4HLBA 1NPKA 2UXCF 2FB0A 4ER8A 3GILA 3HP6A
chains in the Genus database with same CATH topology
1DHMA 1SJ4P 2R8IA 1WELA 4DHVA 3DDNA 5CQGA 2IM2A 1KTQA 2FD2A 1N32F 1SIWB 1VRUB 2MQMA 1X4CA 4DBQA 5EUHA 3W7BA 5E41A 1U48A 1FT8A 1NKEA 3MOZA 1KLMB 2DNRA 2I38A 3IAM9 1WD6A 2VBZA 2DGTA 3OBIA 3BF4A 4DDFA 1Q82T 4PUOA 1LXJA 1FDBA 2UUWA 1O0PA 1NJWA 3TVKA 5EX0A 4QYRA 1EETB 3TW0A 4LF5F 3N28A 4IRCA 4ZCMA 3C66A 3DLGB 1HI1A 3BB5A 4C11A 1RYSA 1Y5NB 4CO4A 4EWTA 4B9LA 1HQUA 4QPXA 1VC0A 1IKXA 3OR2B 1MWYA 2E9RX 3ETOA 1VBZA 2B9WA 2VOOA 1FRJA 3JTNA 3I82A 1C1BA 2CQ2A 4TLQA 4DWIA 2ROEA 4O4RA 2YKNA 4TQSA 4TU7A 4MMOA 3HHEA 4C3MA 1WEXA 4DSLA 2LKZA 1XC9A 4RKUC 3M6VA 3NMRA 1YJ9S 2WB4A 5F8NA 3OHBA 1RI7A 1SJQA 2V5HG 4OZ0A 5D6GA 3OV7A 2KT3A 3PY8A 3MR5A 4ES1A 2B7CB 1RT1B 3LPYA 2KXHA 1LWEA 1GNKA 2DNQA 4L72B 1J5OA 4FS2A 1NU4A 1HWJA 2EKYA 4KQZA 1UJ5A 3ZZUA 2C2DA 2IVFB 3DU6A 3TA2A 1VQKS 2DNPA 2RF2B 3PW2A 3JSBA 4F02A 1T03A 1IQTA 2DRBA 1UJ6A 1DRZA 2J6UA 2HMIB 5LXRA 2HW3A 3RAXA 1HNXF 4MTPA 1N52B 2AP6A 3DOLB 3MF5A 2UZAA 1N5SA 1R8HA 4Y2AA 4IO9Q 2CQ3A 2Y1RI 4F3MA 5DM7Q 4I0WA 1IKWA 1UVJA 3MUTP 3NRBA 1SH2A 2OKQA 1XR6A 3AHPA 4ZS6A 2ZBCA 2I5JA 3DLEB 2ZH3A 2VQFF 2R4FA 1M5PC 4J37A 5FDLB 3BQ2A 5DQIA 3PJWA 4D3HA 1S1UA 3OTEA 4WCEQ 1P8GA 4ES2A 1DBDA 4USHA 1K0TA 3I0RA 5D4LA 4BBYA 2CPYA 3CWJA 4NLOA 5HQ8A 4ZPBA 2KG1A 3MFHA 1S0VA 4PQAA 4BWMA 4QYZJ 5E33A 5KFEA 1MROB 1D8ZA 4I64A 1IJFB 1KR4A 4DQRA 2B9YA 5G0RB 3R3TA 2JH3A 5CA5A 4OMFG 1V3RA 3TA0A 5J2PB 3CCJS 1U4BA 1SKRA 4ILLA 3M32B 1YJTA 3DU5A 2R7VA 1BQNA 1BC6A 5E3CA 5E0OA 1HWLA 2W9BB 1CLFA 5KOXA 2HS3A 1G6BA 1YHQS 1NK7A 4WZMA 1HWUA 4ETZA 2KDOA 2E29A 4DX8H 3MDFA 2XO7A 1SJFA 4IFYA 2AYBA 4Q8FA 2NYIA 2ASJA 4U9RA 4QWEA 3KTQA 5IT9Y 4RW6B 2CQ1A 3DYAB 1V6HA 2PO4A 3UPFA 3GIKA 5KFNA 4RWXA 3FQLA 4DV5F 2XWYA 1H2UX 3OR1A 3H4DA 1JB0C 2IVMA 3LH2S 4WK1A 2ROGA 1URNA 4FVMA 4J9NA 4RNHA 1NB7A 2FJAB 5KG1A 2QYCA 2ROPA 3A1YG 4FF3A 1ZTTA 1Q86T 4JI2F 2RQCA 4V19J 2HNYA 3MTKA 4IFVB 2JJ4D 4JUZA 5HLFB 2AJQA 1MU2A 4X66F 2P9EA 3FEYB 1S1VB 1TK5A 1ZM9A 5KFYA 2JLEA 3MM9B 3PJXA 4FXWA 4B9TA 2DNMA 4PWUA 4MAKA 4OIXA 1JWWA 2Q79A 1C0UA 1C1CA 2LU1A 1FTRA 3M2UB 5A0YA 3TAMB 3CDUA 4KB7A 2C22A 1S6QB 2VC0A 2HHUA 2MQLA 2FPHX 2ZD1B 2BVZA 2IJNA 5DG9A 3VAKA 1N48A 4FBUA 2FDNA 2MHNA 3R27A 1RT7B 3BSOA 2M5YA 2HG4A 4B3TF 1JKHB 4NRTA 3VF0B 4DFJA 4ECXA 1VQYA 3RB3A 3TO8A 1WHXA 4Z37A 2KU7A 2PDAA 2YY3A 5L39A 3IC1A 2QLXA 3KK1B 5AXKA 5KFIA 2ZM6F 3CJ3A 3NKYA 4C0BA 4ZMMA 3EPIA 1T3OA 3FZBA 3L09A 3PW5A 1UAWA 1O5JA 1UMJA 1WI8A 3LAMA 2ERRA 2DHSA 4DG1A 1DZ5A 5KFKA 3IRWP 3M9OB 2R8HA 2ADCA 1JLGA 2V8VA 2R7WA 2DPIA 2LEBA 2KHCA 1N6QB 3V6JA 2NREA 2KHDA 1QY7A 2G9OA 1UA0A 3CCMS 3K5NA 5KFZA 3DRXA 3FEXB 3DM2B 2MZQA 2QO3A 1FEHA 1FNMA 3GYNA 4EO6A 1X4EA 3OSNA 3BO3A 2NZ4A 2RMLA 3BSCA 3DC2A 3BGRB 3PIOQ 2HWHA 1DQAA 4H4KC 3LP0B 4A8SA 1SUQB 3W2VA 3RW6A 2HNZB 3U02A 1GT8A 4YR2A 4X4UA 1GQEA 4RNOA 2IVYA 3LGNA 3QJJA 2RU3A 5CYQB 1FKPA 3EX7B 3NCRA 4Q0BA 4QWDA 5D3GB 1NJXA 2EK6A 2MY8A 3CCLS 1I94F 2QEXS 4ZPCA 1N5VA 4OZJA 1L3TA 3D0IE 4J9RA 2D7SA 2I9SA 2LLZA 2XLJA 3I96A 1Q8IA 4JI3F 1HPZB 1LK5A 1O8BA 2XMVA 3E8OA 1URRA 1FCAA 3QLHA 1CQNA 3N79A 4Q2MA 1SKSA 1S72S 3PIPQ 2XMWA 1RA6A 4WU3A 2JRSA 4K5SA 4G1QA 1DFDA 1Q16B 4ZPDA 3BZQA 1UFLA 2ZZNA 4R5PB 3IWXA 2YNFB 1TL4A 3KJVA 3G9CA 3ENVA 4KKOA 2MGZA 1S9GB 4TY8B 2K7JA 2EFOA 2VFVA 2ZE2A 2KH9A 2ASDA 1LW2B 1WF1A 2M52A 5H1SV 2E1RA 2C3YA 4OFZA 2Q6BA 2SXLA 2V0NA 5JUMA 3IA0A 1I1GA 3DNCA 2YKMB 5CXTA 2FUG9 3GFHA 2EC0A 5G4DA 4EBCA 3EZUA 1M5SA 2AYGA 2XG8A 4I6WA 4RNFA 3RR7A 1N8RT 2OPSA 2VPYB 4TNOA 3SSRA 4JI1F 3GV7B 3K5PA 3CDEA 2PEHA 3OW2R 2CFXA 3PNIA 1VQOS 3CMES 5GVQA 4MH8A 4HI2A 2MDAA 4ECWA 4ECTA 1TV6A 2BUNA 1IBMF 2LQBA 2OSRA 3PFEA 2KRRA 1WEYA 2FJDB 2YNGB 2MZRA 2R7XA 3RZAA 3C6UA 3P3DA 3AY0A 2GO8A 2EI5A 3CIZA 2IC3A 2ZHAA 2OH2A 3DDKA 1U09A 1OQ3A 1MMDA 2DRAA 3VAMA 3PKYA 2LQJA 3G6XA 4KGMA 4PRFA 4E0DA 3TUIC 3DRRB 2IA0A 3D2WA 2HHSA 1IKVA 1VK8A 4X84A 4X62F 4LSNA 3P96A 2J9DA 5DDRC 2YWFA 1JLAA 5E3PA 2J76E 1Y9OA 4MK7A 4B3MF 1N4LA 4MJKA 4O4GB 2IBKA 4TU8A 2YWGA 4MIWA 1TL3B 2CQ0A 1BQMA 1FEEA 4EO8A 3KLEA 3KWMA 5A8RB 2ZJQQ 2DH8A 2ZH9A 1Y5IB 5B0CA 3DLLQ 2A10A 2IJFA 1TUVA 2ZITA 2JFDA 3NG8A 2RDIA 3HK2A 2MKHA 3CJ4A 4KTQA 4KC5A 2CQHA 3MR6A 1CEZA 1XR7A 1M1KT 3IWNC 1N33F 2MQNA 2XLIA 4XDCA 5KG5A 5IT4A 4EZ6A 1SJRA 2Y1JA 2PC6A 1IR0A 1S49A 3TOQA 4JI5F 2NQPA 1JJ2R 4UUWA 2V4JB 2GCFA 1S48A 4W90B 4RWWA 2E9TA 3TRGA 2YX4A 4NA1A 2FJEB 3T9ZA 1RT3B 3H98A 4A48A 1ZZNA 2CKWA 1MSWD 2L41A 3K57A 1U2RA 2CQ4A 2KVIA 2PA3A 4ZKAA 2HQIA 2RRNA 3DRSA 2FIUA 2A2DA 4IRKA 4WKRA 2RRBA 2O5DA 2DTJA 2ZNZA 2WAQD 4H4MB 1QM9A 3OXLA 5IQ6A 2BR0A 2V9WA 2FHOB 3KHRA 4ZPWR 5DLGA 1K0VA 4QBUA 1YITS 2ZNYA 4DV6F 4B3SF 3J7ZT 3G8QA 3SDEB 4HYKA 2GIRA 3T5HA 1M5KC 4OX9F 4ED0A 5J2QB 2KG0A 4DQQA 3VAJA 2R2TA 3V81A 3K5MA 1U26A 3ZZRA 5L38A 1Q78A 4I56A 1HYSB 2A18A 5JJBA 1R27B 1KS2A 3KKFA 2WOMA 1ZPVA 4M8LA 1JLCA 1YJVA 1DLOB 3OVSA 2Z8QA 3NNCA 4KIAA 5HMWA 1TP7A 4HTIA 2RIJA 3BS9A 3H5UA 3L3CA 1Q7YT 4OZLA 3UQSA 1V9OA 1N5YA 1F2GA 4X4OA 4BC9A 1QAJA 2N3LA 3CCRS 2UP1A 4A8FA 4Y2IA 5K14B 1FXRA 3QZ7A 2W7PA 3FQKA 3QAEA 4N76A 1WACA 2J8AA 2MXYA 3C8YA 2D1CA 2XULA 1RAJA 2UXBF 4PG7A 2AF6A 1JJ4A 4NLQA 3J81Y 1KC8T 4ID5A 1FD2A 2E7WA 3LWLA 1SV5B 5T41A 3T9NA 7FDRA 3M8SA 2UU9F 3CULA 4OHYA 4C8NA 1S1WB 3HJFA 5C42B 3CCZA 5KFCA 4XPCA 3CPWR 3DGPA 2GJ2A 1AFJA 3MFIA 4O44A 1RT4A 1LWCB 4NLRA 4PG6A 2B6AA 3BSNA 2HVZA 3U1MA 1FDNA 1V3ZA 1CVJA 4URGA 3Q8QB 3AQPA 5LT5A 4DL5A 2A3JA 5J1EB 5B09A 2B43A 2CDQA 1NEEA 2PD1A 3DI6A 2FJXA 1UKUA 1U1NA 3CUNA 2AGOA 4HI1A 1NK0A 4F2SA 5LSOA 1NK5A 4FXVA 3N6MA 4MFBB 4RW6A 3S7RA 1E6YA 3ISNC 2XNRA 4YOEA 4OX8A 4JI8F 2RS8A 1R7IA 2C28A 3S01A 4X4QA 4ECVA 4IRDA 3MEEB 1KQGB 2IMWP 4NPOA 5DDPC 1CQMA 4XO0A 2HHHF 4WFYA 3OJUA 1LW0A 2I8EA 2MJUA 4M5DB 4OZ1A 3UCGA 5KFDA 3KHLA 2YX7A 2GV1A 5GAGU 2BABA 4Q44A 2JEFA 3DLBA 2MKIA 3SQGA 1SBRA 4YEAA 1NKBA 3UWTA 5CCMA 5SUHA 2RDJA 2F8EX 2RS2A 1XWLA 4ED6A 2YNIB 3H2UB 5AE1A 3RB0A 4I2QA 2W7AA 2LXFA 5KTQA 2UXDF 4JI7F 2VD3A 5IQQA 4CO0A 3BQ0A 2M0GB 1FKOB 2E5JA 3BGUA 4WYLA 2NUUG 3GWCA 3K5LA 2B51A 1AUDA 3M2RA 4B17A 1NK6A 3KNGA 1OO0B 2YWHA 2J5AA 2KTQA 1Z4UA 4C8OA 2I2YA 2ZHOA 3UDLA 3BQ1A 2HZCA 3V5RA 2MKJA 3EUNA 2GA7A 4N77A 3RAMA 3DCAA 4J9SA 1N6QA 3WX4A 4QW9A 4U67Q 4GO5X 2YKOA 1XMQF 3MCSA 1FF2A 1VFJA 2KT5A 3MMAA 3QO9B 3MPYA 2MQOA 5L9XA 1NJYA 3G6YA 4X4TA 1V3SA 3K8WA 4OI6A 2YWEA 3BGRA 5KFPA 4C8ZA 1DARA 2L3MA 4QIEA 3OVBA 1UVNA 1UWBA 5C25B 1GXTA 1AROP 3LP1A 3AAWB 1BGXT 4ELTA 1Q79A 5F41A 3DHXA 2VG7A 4WIIA 1G1XA 2V4RA 5K8PA 5LSRA 4C8KA 4CCHA 2XI2A 1S0MA 4IYQA 3MM6B 1T3NA 2D3OR 1QTMA 3N01A 1JLQA 2VL1A 3ZZTA 4DJBA 1U6BA 1HBMB 4AUKA 2N3OA 5F8HA 1TK8A 2M8HA 4ZK7M 4MIAA 1HPZA 2ZKTA 1O51A 5M2UA 5JVGQ 3PX0A 1H3DA 3SCLE 2NS1B 3D1QA 4DL3A 1FRLA 1FXLA 3IG1A 5CYMB 3BO4A 4QCLA 2WONB 3H59A 3DFEA 1L5UA 4IR9A 4C97A 1FO1A 2K3IA 4A47A 3D0HE 1G7CB 1JNRB 1HWKA 5T7LA 5J2MB 2LEPA 1ROFA 3N5BA 1ZETA 4WYWA 3RRHA 2J7KA 2YNFA 1SI9A 3HHLB 2MKKA 1U1LA 2LEAA 3KG1A 2IM0A 4YQWA 4CTAA 3QZ8A 3QWPA 1HBUA 3F41A 4ZVEA 4Z2XA 1YG0A 4ZP7A 1Q4RA 3GIJA 4MKBA 7FD1A 4ICLA 1APSA 1QUVA 1X4GA 1ZZFA 1PILA 2YKMA 4NLYA 4UY85 1UETA 2OP5A 3D1HA 4C8YA 4F26A 2LDYA 2JVOA 2BANA 3Q22A 1VQSA 3US5A 3BN7A 2VONA 5KFRA 3H8YA 3WDOA 5IS2A 5LMUF 3UNGC 4IDKB 1VQ8S 1GTHA 3BR8A 3MM5A 2R7RA 1T02A 3CCVS 2UVRA 1HNVA 2JC0A 2J0SD 1U25A 5B08A 3U7JA 1IN0A 3FMWA 5DRKA 2XMKA 4DQPA 1NK9A 2D3ZA 1VQ5S 3I0SA 1TL1A 2J9DE 3GIMA 3JYTB 1RT6A 2WHOA 1RTIA 5HL7Q 2VH7A 2DK2A 1UVIA 2U2FA 4H4OA 4LJMA 5B0AA 1T95A 4OI4A 2J9CA 4NXMF 4CO1A 1VC6A 3CJKA 3HHKA 1U1RA 4HVZA 2BBEA 2GHVC 2GMLA 2AJ1A 3T1HF 1HHTP 4RW8B 2ZOGA 1VIOA 2C3MA 2RH3A 2J6TA 1P6TA 1S9EA 4WKYA 1DQ8A 4K4SA 4KV8B 4C8MA 2AU0A 1NO8A 1SH3A 4PXEA 1LK7A 1M0SA 4HTJA 2AQ4A 3W2WA