1PC4A

Crystal structure of the p50a mutant of ferredoxin i at 1.65 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECAAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin I
publication title Mechanisms of redox-coupled proton transfer in proteins: role of the proximal proline in reactions of the [3Fe-4S] cluster in Azotobacter vinelandii ferredoxin I
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pc4A00
3MM8A 3MMCB 1BC6A 2VPXB 2Y0SD 1FXRA 2V2KA 1BD6A 1ROFA 3OR2A 1FRXA 1FD2A 3IR6B 2VKRA 2O01C 1BQXA 2XSJA 1WTFA 2WSFC 4Y28C 1DFDA 1FRIA 1FDBA 1CLFA 2ZVSA 1FDNA 1HFEL 1PC5A 1H98A 3EGWB 1Q16B 1DAXA 1RGVA 1C4AA 1JNRB 2C3OA 1GAOA 1FRLA 5L8RC 3GYXB 1FRJA 2VPWB 3MM6B 4KT0C 4YDDB 3EUNA 2C3PA 1KQFB 4DHVA 2C3UA 1AXQA 2FD2A 2FJBB 1R27B 4AYBD 1H7XA 2WSCC 3MM7B 1BLUA 2FGOA 1FEHA 3MM5B 2C42A 7FD1A 1C4CA 1B0PA 2V4JB 5CHCB 1SIZA 1JNZB 2FJDB 1SIWB 3MMCA 1Y5NB 1BWEA 1IQZA 1GTHA 3MMAB 2PDAA 1FCAA 4XDDA 3MM7A 4L6V3 1FERA 1F5BA 1B0TA 2Z8QA 1FRMA 1FF2A 1FTCA 1PC4A 3MMAA 3MMBB 1A6LA 5FD1A 4OMFG 1FRHA 1G6BA 1SJ1A 3MM9B 5BYSA 3IR5B 1GT8A 1Y4ZB 3OR1B 2PA8D 1JB0C 5CH7B 2WAQD 3IR7B 2C3MA 1B0VA 5E7OB 3MM8B 2IVFB 3HKZD 3MM6A 1FRKA 1K0TA 4XDCA 5BYQA 3MMBA 4ID8A 2XSJB 1KQGB 1FDDA 1G3OA 3EXYA 3MM5A 1Y5LB 2PMZD 2V4JA 6FD1A 2WB1D 1Y5IB 2GMJA 1F2GA 4CI0B 7FDRA 2VPYB 1XERA 1FXDA 4XK8C 2FDNA 5BYRA 1VJWA 1KEKA 2VPZB 3C8YA 2FJAB 3LW5C 4OV1A 4RKUC 1GTEA 1H7WA 2WSEC 1FDAA 2C3YA 3OR2B 1D3WA 2UZAA 3MM9A 3OR1A 2FJEB 1F5CA 3PNIA 6FDRA 1IR0A 1DURA 2GMHA 1H0HB
chains in the Genus database with same CATH superfamily
2ASJA 2UXBJ 1HR0F 1TVRA 1T05A 3LH2S 4UZBA 5T14A 4JI4J 5KOWA 4FNIA 2W4DA 2I9SA 1ACMB 4RJVA 1R89A 2BJ1A 2RKIB 1RWMB 3TUZC 2QL7B 3MEDB 3W8PA 1WF2A 4NLUA 4CT9A 2YWFA 1M90T 3PHTA 2IJRA 3DYAA 2ZM6F 1PJ6A 2JHEA 5D3GA 3G96A 3L09A 3ILOA 1YJUA 1RT4A 3LGHA 5C24A 4P2FA 1WKJA 4I6WA 4ECWA 1AFJA 3K2YA 3MCMA 4C2MA 4IO1A 2AGPA 5D4LA 1RACB 3PJXA 1YX2A 1NHUA 5G0RB 4CP5A 4UQGA 1UPPA 1SB6A 3UWTA 5E3AA 2DGOA 4LVOP 4ZIWA 1TL7B 2F4VF 1U09A 4Q8FA 1T9WA 1VQSA 2IVYA 4Y65A 3SMZA 1CG2A 1IKXA 1DLOB 3QYYA 3VAFA 2JFDA 1HNXJ 2X1FA 3FSXA 1N8RT 1XMBA 1UW9A 3NEKA 2GVZA 2VG6B 2R42A 4M5IA 4LSLB 2HVDA 2JWNA 2OPPB 4XPEA 5HMYA 2V69A 2A6OA 1N6QB 2WW4A 2V9KA 3JSMB 2H5IB 2DH8A 1U47A 3UNGC 2YKNA 2N3OA 1FJGF 4ES2A 1EARA 2OTJS 4BBYA 1U7LA 2GC8A 3W7BA 1RHKB 4DV0F 2J9DA 4A47A 2Z58B 5EX3A 4OI4A 1LWFB 3H2LA 4ATNA 5DS7A 4HACA 2HQIA 2QT7A 2AV5A 2X3GA 3CCZA 3MM9B 3CJKA 5CH7B 5DGAA 1MNEA 2PGCA 2DRAA 1T8EA 2LDIA 2LDYA 4PG6A 1T05B 3VZHA 4X62F 2RNEA 2R7RA 1WEZA 4ZLPA 1VQLS 3C15A 2QZ8A 2FDNA 3OTCA 1KSPA 2VZ9A 3LP0A 5KFYA 3PM9A 1DHMA 1RYRA 3T1HJ 2DISA 4CDIA 2IM3A 1Q1KA 4J9LA 5D3GB 1OS5A 1UEVA 3Q8RB 4PWDB 4K4WA 1IN0A 1VQ9S 3BSNA 5C24B 2VL1A 3I9ZA 5DJBA 4QPXA 5A0YA 3T41A 1TUWA 4WYLA 5GADI 4YS2A 3P49B 2HBQB 2DKOB 3D6HB 4B9UA 4RWXA 2H1YA 3D5MA 2VJUA 3OL9A 3M9OB 4FS1A 3DGPA 3FEZA 2VICA 4ED6A 4AXIA 4B9LA 1EETA 1IKXB 1U48A 4M5GA 3QFWA 3GE9A 2ALZA 2KJWA 5F9LA 5DDRC 1E6VA 4LR9A 3BO4A 5KFBA 3CVKA 2FHOB 1CJUA 2GVZB 3ITHA 3DOLA 3MPVA 1KFSA 4NXMF 2V6AA 4ZP9A 3OFEA 4ERDA 3SSRA 3LGNA 2RQCA 4F7VA 4ELVA 2BOAA 3OSNA 3G82B 1YSJA 2DPJA 2FHJA 5B0GA 5IXUA 3V2UC 2YKNB 4ANCA 1VLYA 4LBPA 1A7GE 1VS3A 3MEGA 1H0HB 4DQPA 4X66F 2DJWA 2NUUG 2BRLA 2OUGA 1NJZA 4W92B 2DGQA 2QLBB 4JUZA 3MUMP 3SCLE 1YJTA 3K8VA 1EZZB 2QV6A 2GFFA 4LF1A 1N5QA 1YBTA 4MKVA 3C15B 4YMEA 3B4DA 2VUGA 5B0BA 1X4CA 1XBWA 1LKZA 1UZDA 5IQQA 3LTOA 2ATCB 4NA1A 5CA5A 4DXLA 2CPZA 3UN2A 5BYQA 2VB6A 3CCWA 3DI6A 1FJEB 4GRSA 1Q0NA 2WOMB 3JYTA 2ZZNA 5A0YB 4IG3A 3Q2TC 2M0GB 3PRBA 1KEKA 4DJBA 4N56A 1B7YB 2ZH6A 4ECZA 3SI8A 1HWJA 3CC4S 4DSEA 1NH8A 3DGPB 4KR0B 4X4RA 1VQKS 5BJRA 4Z2XA 1LXNA 2FVRA 3IWNC 4A8SA 4DR2F 2VFTA 1E6VB 2KI2A 3C66A 3F0NA 3TEGA 3M7VA 1AFIA 1QTNB 5F8LA 1CJUB 1FRLA 1DJ0A 2DNRA 2ZDPA 3DOLB 4QZVB 4DV3F 3L7UA 1PBUA 4X65F 4J9PA 4DFJA 4CO2A 3Q89A 2ZWOA 1TP7A 1UVJA 1FT8A 2XYGB 4O3OA 3W2VA 2RUSA 3TZZA 4CLKA 1LWCA 4C97A 2RS8A 3MEGB 2LQJA 2ZH1A 5THWA 3EPIA 3MDFA 1VQNS 3KLGA 5BR8J 1OWXA 2HVEA 3J7YI 3I56S 2A10A 3QRPA 4CLTA 2BV3A 4EMDA 3TAMB 2HIYA 4BDPA 1NKEA 1GXUA 3KHHA 1FDAA 2AJFE 2FHKA 1RTJB 4JYAF 3MD1A 3HDSA 1IM4A 3IM9A 2UXDJ 1URRA 4FYWB 3A8JA 3W9HA 3VVUA 3KJQB 1DFDA 3GONA 3ISZA 3VALA 2BOPA 3QSYB 3MCOA 4OZ5A 5K8OA 2DR6A 3C19A 2OEJA 2D9OA 2WSCC 3DI6B 3JYTB 1ZAWA 4IG3B 5L1IA 3A3OB 4ECSA 3R6GB 3AXKA 4EUVA 5H9FK 2BX6A 3V5RA 3GSDA 3T6BA 3IG1A 3ZTQA 1BGXT 4MJKA 4K59A 2MGZA 4RBUA 2EKNA 3B82A 5KFRA 4DR6F 3B4MA 1HW8A 2MTLA 2ZOFA 1U1RA 2E1RA 4L3NA 2BKNA 2EFVA 2NPFA 3FUYA 4NMLA 2QLJB 2F8HA 4NCAA 2R8KA 1LNQA 1YJWS 4B3RF 3GMGA 3MR3A 1VHIA 1RTIA 3PXGa 3TAQA 3IAS9 2RE1A 3UR0A 3HSJA 4DV0J 2AJ1A 2BABA 1LWCB 2YPYA 3T1YJ 3DLLQ 2R8GA 2CWKA 3Q86A 3Q2SC 1IM6A 5J1PA 3TO8A 4DPWA 4ES1A 1XTZA 3RBZA 3ZC4A 1FEHA 1VQYA 3H2UB 3N6MA 3KLGB 3BM7A 1HNIA 1R8BA 2EFQA 4LFBJ 3GYNA 3M6WA 1NHVA 5K8MA 1PG5B 1RTHA 1N32F 1UJ6A 4DSIA 4X62J 2CRLA 2POKA 4C48A 3MMAA 3MMBB 4O3NA 1HHSA 3D28A 2PEHA 1HIYA 3I5CA 2GHVC 2XLJA 1NPPA 3VQTA 2G2YA 1TKXA 5F0WA 4KTQA 3L7OA 3RB3A 1LFWA 5EHHA 3TZYA 4DR5F 2V68A 1RWOB 3MWBA 5LMNF 2W2QP 2PC6A 1NDLA 1FWPA 5T7LA 4EEYA 2LEPA 1V3SA 2I6WA 5D4OA 1KRPA 3QNWB 3C2PA 2VIHA 3CMES 2D3O1 1EAYC 4IO9Q 3IG1B 1YWXA 2JC1A 5KFHA 1O51A 3FQLA 1JNRB 4B08A 1Y3JA 3NMRA 3V6KA 2FD2A 1BLUA 2FGOA 2H48B 4M1KA 1FNXH 2J6UA 1HYSA 1WHXA 1FCAA 3SBMA 3Q83A 2HWIA 2ZBQA 5C7PA 1U45A 3Q8QB 3UCGA 3A3NB 4HTJA 5DZ6A 1UJ5A 3DLEA 2NUHA 2CNOB 3ET6B 4PQUA 1URNA 2NR0A 4X66J 1AUSL 2HAFA 2M3DA 2DPIA 1RLCL 1RTDB 4MKYA 4CI0B 3MECA 2IAJA 3R7BB 1R31A 3HK2A 1U0HA 2J9DE 2MMYA 8ATCB 4F3OA 1P9QC 2ZJQQ 5KFKA 3KHGA 5B0FA 2KFYA 2R8JA 2BE9B 1HNIB 1CULA 1L3VA 2VKRA 1RTHB 4EZ6A 4NMXA 2HNYB 1MG7A 1TELA 3CWJA 4TKTA 4PG4A 4LRCA 1Q16B 2ACYA 4ZN1A 2YX1A 1YJNS 4F26A 2FHMA 3AT1B 1CSJA 4G65A 2AZ1A 1PYOB 4BWJA 1VMBA 2EC0A 4NEZA 3G6VA 2E9ZA 1TKXB 4UOHA 4ZITA 1BWEA 3CJ0A 1TZ0A 3B54A 5KFEA 2D7SA 5CZXA 2U1AA 4OYMA 4QU7A 4QW9A 1TFWA 5B0EA 2JEFA 2W1BA 1S59A 5BYSA 2J6TA 4H4OA 1P8GA 1T7PA 2W7OA 5EUHA 3KLVA 4KH0B 6FD1A 5KFOA 5U47A 3LP1A 3H59A 3EX7B 2VG5A 3GCWP 4DLGA 1Z2LA 2MQOA 4NLXA 3IP0A 4DV3J 4R5PA 3AB4B 5B0AA 1HYSB 4CWBA 3BJYA 3Q8PB 3FGVA 3IR6B 4NLTA 1FEEA 3ETMA 3RGIA 3MAAB 3ETOA 2Z56B 4J9UE 2LECA 4LUBA 2VHGA 5FDLA 4ZMMA 4NL5A 4RLEA 3KJFB 2M7SA 3DLEB 4MMOA 4P7VA 2DHHA 1NDCA 4ANDA 1WSRA 3OUYA 2Y3YA 1FA0A 4ED1A 2DTJA 2P9CA 1H6KX 2K7KA 3HM9A 2B56A 2X3DA 3IXQA 2M88A 1VC6A 2BJ3A 2IAJB 4J9VA 3F44A 2QO3A 2YX7A 5ETVA 4RW8A 1U0HB 1UL3A 4AL6A 1D9DA 5K8NA 3DLGA 4M5KA 2DY1A 1GT8A 1ZA2B 3TI0A 3B78A 1M1HA 2A2CA 3OFHA 1CULB 3T9NA 4LF8J 4RBTA 3W62A 1ZAVA 3MXHP 5F3ZA 3FEYB 5C25A 3CDUA 2QA4S 5E3CA 2YNHA 2OH2A 4ZDNA 2DXEA 4KH1B 3GU0A 2WB1D 3D3BJ 4NLRA 1SKSA 4WPAA 3EGZA 1GMWA 4Z7CA 2UUBF 1N56A 2FC9A 2MZJA 4ZVUB 4GVLA 4FDFA 5D4PA 1HBMA 4WJBA 4J9SA 3OL6A 3G8QA 4BCAA 2PD1A 5F0UA 3J7AN 3C6TA 3GV5B 2H4WB 5ETQA 4IFYA 3QPIA 4IYQA 3O44A 3BKFA 2VFVA 2ERRA 4H4OB 1DARA 2O67A 2CPJA 3NOGA 4LVNP 2Q1LA 1T9TA 2C2RA 3EZ5A 3HHDA 3EMTA 3FCHA 2KZMA 3LP1B 4UZCA 2WZ1A 2CDQA 2ZH8A 1U2RA 2H54B 4ZLNA 3FBFA 1ZM4A 4IOBA 2OIHA 1S1WA 3W61A 4FN5A 4B9NA 4R5PB 1S57A 5L9XA 2RDJA 2V8VA 4AL5A 3A4TA 2ZH3A 4ZVFA 1A9NB 5FDLB 3FKBA 2KT3A 4ILRA 3CGIA 2QJ3A 2XNRA 1RU2A 3OUYB 3M8SA 3CCRS 3V4IB 1Y0HA 2N4DA 3BSOA 4Q5VA 3D1QA 1A0OB 2VU5A 3PX0A 4RW8B 4USIA 2ZOGA 1KLMA 4UY8T 2G13A 1RWWB 2X1GA 2A2DA 1L3TA 4MTPA 3BBCA 3MFIA 2C3OA 3TARA 4B3OA 2AX1A 3EUNA 3FRYA 4USHA 2R7SA 4MFBA 5C25B 3KG4A 1V5VA 5EWGA 3VAMA 5HBMA 2YNHB 4F4ZA 1RXOB 3TNVA 1UMJA 4GC7A 5DQIA 1MWYA 4IQXA 3FK4A 2E9RX 3CJ5A 2MY8A 5LSOA 2R7TA 5EDWA 2J8SA 2KZZA 1RHRB 4WP3A 1HBMB 3QGHA 3BN7A 3R27A 1U1PA 2E5GA 3I5BA 3IN5A 3OBIA 4OHVA 1TL5A 2Q6CA 3WIVA 4QYZK 4IFYB 5A2QY 2DNYA 1VISA 4OZNA 3BR9A 1CJVA 2BW2A 2CPEA 4DL3A 3NWRA 1XMQJ 3TUJC 1TK5A 5EGYA 3PW2A 4HR2A 3NS6A 1VQ8S 3RZAA 3NGUA 3O6QA 1KWMA 4DX8H 1LEOA 4A8QA 1Z4UA 3KLEB 2W2MP 2YXLA 5D78A 2L9DA 2R7WA 1UVNA 1D0EA 4YOEA 1RCOB 5KFVA 3R1HA 2DGTA 1EX8A 2AKWB 2JVRA 1JJ4A 2RIJA 3SV4A 1IKYA 2XLKA 2K3KA 5F8HA 4ELUA 2YBVA 1TMMA 3R5BA 1S4FA 1VRQC 2CQGA 2V50A 3PTWA 4QW8A 4EFAC 4ZHRA 3FSYA 1KLMB 2FQQB 4DX5A 1JLEA 4LSZB 3K59A 1UFLA 5AXMA 4N41A 1Z1ZA 3R8YA 2Q66A 4USKA 1K47A 3FJ2A 2LQ5A 2JEJA 4MFBB 2VBZA 4USMA 5HBMB 4HEA9 2CPYA 3I0RA 1PYTA 1X5TA 3QZ7A 2ZZTA 1IBKF 3VAGA 4ZVSB 4ALZA 2V9WA 1CC8A 1K44A 4C8KA 2CNLB 4USJC 2J0QD 5DLFA 3US5A 1KHWA 3KK2B 2BE7D 4ZCLA 3UCUP 4O3PA 1NUEA 1NM2A 2DY9A 4G6VB 4M5DA 3C14B 4DV4J 3H5YA 4QJVA 1CJVB 2VH7A 2F8EX 1T95A 2NYIA 2V4QA 2DNHA 5IQ6A 3BH6B 1KVJA 3BGLA 5T41A 2J9CA 3QAEA 3NNCA 3FBCA 5HQ8A 4DFMA 2MLZA 4XDCA 3OXGA 1G3OA 4WWSA 2R2SA 1FD8A 1AZSB 3D66A 3DLBA 4F4YA 3DMJA 2C22A 1JJ2R 3DGVA 1W2BR 2GHWA 5HVGA 1U1LA 2WSEC 3GIMA 2YTCA 3AAWB 2GMHA 2MLYA 2HHWA 2Z30B 2NQPA 2QMXA 4K4VA 4GO5X 2JC0A 2ZHOA 1GX6A 1WC0A 4PXEA 1IKYB 1FDNA 4I2PA 1S0VA 4JBCA 5M2UA 4I7FA 4YDXA 1UW4A 2ZH7A 1WG4A 2XY5A 4ZHRB 1R6YA 2I38A 2KHDA 1JLEB 4K4TA 1FWKA 4RR5A 2MXYA 4RUAA 2BACA 4JI6J 2O3DA 3BKTA 2EBEA 3MUVP 1YJ7A 4GMKA 4TVAB 4LF6F 4I68A 3I0RB 2HYIB 1HBUA 3MF5A 2LU1A 4RU2A 4JV5F 3BGUA 3EJMA 1NHKL 3K0JA 4CLZA 1HWUA 4WU3A 2ZNZA 3HCXA 2OFHX 5KFJA 2BQ3A 4FYYB 2AHOB 1M5SA 2IM2A 4P6QA 4YP3A 2QX0A 2CPIA 4C0HA 3EZUA 4M5DB 1RBAA 1T9XA 1KR4A 3DRXA 3CD0A 4I1TA 2E1PA 3R5CA 4WIQA 5KT2A 1RWXB 1QY7A 4IUFA 3AJ1A 2MSTA 3DRYA 3K5PA 4M94A 2XMMA 3DLKA 1T11A 3BN4A 3ENVA 1RT7B 2R8HA 4ETZA 1AB8A 2V8GA 3FCVA 2NSCA 2BEFA 1HMVB 4ZLLA 4EO8A 2FB0A 3EICA 4U8VA 3PYGA 3I55S 4NE9C 2HHXA 4HH0A 3CUNA 5LMUF 3OTOF 1FRHA 2GMLA 1I94F 2IIHA 2O1PA 5ITHA 3EXYA 3CB4A 1V3RA 2J7KA 4I2PB 4J9MA 4DEZA 5E3QA 1N54B 3U1LA 3G86A 3RBEA 4I7FB 1OSCA 3LALA 3NBPA 3CCUS 1N88A 2LU2A 3J7ZT 2DNGA 4USTA 3NGSA 3K5MA 2RMLA 4BC7A 4OX9F 3AA9A 4J9RA 1F9EB 2CQHA 4UOCA 4DSLA 2CJQA 2ASLA 4ECRA 1Q81T 2QGFB 3J80Y 2RD5C 2FVPA 2C28A 3JTPA 2YNFA 1KNZA 3PX6A 1DQAA 4ZPVR 2DHXA 3NS7B 4P10A 2DR8A 1T03A 3KHRA 4O23A 1U1OA 3THVA 2XQCA 1UEUA 2CIMA 4J9KA 4OL8A 2AYEA 2XZWA 2OGUA 2J7UA 2UVRA 3ISNC 4OHZA 2MKHA 1IBMF 4ZP7A 1LQ9A 1HW9A 4Q0BB 3D4JA 1F5AA 3TZWA 5HP1A 1Q8BA 3VZIA 4DL2A 1S9GA 2R7UA 3RAMA 2J5AA 1YJ9S 1YTYA 4DV7F 3EXCX 2HHHJ 4EK2A 1VK3A 2G0JA 4PG8A 2E44A 2ADBA 5H9FJ 1QUVA 1VCTA 4DPTA 2CUYA 3DC2A 2HQCA 3KUHA 1Q78A 4FF3A 4C9DA 3A13A 5I4MA 3L95X 1HQUA 3OL7A 4EBEA 5CYMA 1I6JA 1CBKA 4WKYA 2JLEA 3M30A 4CRJA 4K8RA 2B6AB 1WHYA 5K9FA 2Y1IA 2C2DA 2GCFA 3VAKA 8AT1B 1V6HA 3TRGA 4KT0C 1HPZA 3N01A 4YB5A 5EX0A 5M2PA 4YR3A 1N33J 3FMBA 1UWBA 1N36J 3TA2A 1EQMA 1Q8KA 2ZZMA 2HS4A 2HQGA 2BR0A 4ITSA 5GVQA 3GYGA 5SZTA 4CNYA 4WYWA 2LFVA 4A48A 2KYXA 4I67A 3LGMA 3GFZA 2QTWA 2XSFA 1U1NA 2L41A 4DPUA 4KHPJ 1LWEB 2MEWA 3Q0AA 5AXKA 3HZGA 4I6YA 2OPSA 1UVMA 1MWQA 1J5OA 3RBXA 1TV6A 2I0XA 3DHXA 1F9FA 4E98A 4IOCQ 4USVA 1R3NA 2DGWA 2YNFB 4AQYJ 4LSNA 5LM7E 5C42A 2OELA 3M8QA 5DQHA 1WWHA 4DV1F 1IBCB 1NK8A 1DZ5A 4O0IA 1X4BA 1T03B 5C2GA 1MMNA 2LXFA 3ENQA 3RAXA 3UE2A 1RAOA 2LEBA 3GG1A 3M4XA 2JLFA 1QLNA 1D09B 3S6EA 5KFCA 2YKQA 4Y3CA 4F4WA 2HHPA 3JTNA 4DS4A 5J2MA 3X1LB 3BDEA 1YHQS 3N0VA 4F3MA 3C16A 2YKMA 1S9GB 2ATLA 1B99A 1OPIA 2XGPA 1SQFA 2UV8G 2PDAA 2ZE2A 3H8YA 4E8UA 3HSZA 2HS0A 4DPYA 3HVAA 4NLYA 3GV7B 3UDCA 2M52A 5KG7A 1HQUB 1ZAXA 5CYMB 1YZ6A 2NXEA 2N7CA 2XULA 4KFBA 1RLDA 4C98A 2AWZA 5KG1A 5EWFA 4HYKA 1DTQA 2EG1A 3BGFA 4WP9A 5KAKA 1HPZB 3JB9k 3NGDA 4WU2A 4QIEA 5KG5A 2HG4A 1UWBB 1REVA 4NLVA 2M4MA 3CCES 1NRKA 3N5FA 3ISND 4HHJA 4HDGA 1WKKA 3M8PB 3G87A 3IO1A 3BQ1A 2BJDA 2ZKTA 1MU2A 1J5OB 1TV6B 2DNOA 3W63A 3CXCR 2MB0B 2M5YA 1GXLA 4LSNB 4CLWA 3H25A 4M5NA 1NH7A 4YR0A 4P74A 2VASA 1NNDA 4FPRA 5I3QA 3HVWA 4QQBA 2J8AA 2YQ0A 3C3LA 3PIOQ 2B9WA 4OYXA 5KG3A 1F2HA 3U02A 3GQCA 4N5SA 2MQPA 1CJTA 3EWGA 2BYCA 3DXSX 1SL1A 4W4MA 4OLPA 3C16B 1S1TA 2VC0A 1K0VA 2YKMB 5KFLA 6FDRA 4LBHA 1QSSA 3AD9C 4MT1A 4A8XA 2ZE2B 3QRRA 4NCGA 1V9OA 1UFKA 4F25A 2D3UA 2MHNA 3H90A 1PKUA 4Y0FA 1SC4B 1RQ0A 1J5EJ 3SDEB 4DHVA 3CDWA 1QVFR 4O4GB 4DL7A 4KFBB 3AA8A 5IZHA 1F0XA 1XWLA 2B51A 4V19X 5CHCB 2YWKA 4DCOB 4OX6A 5E41A 5MLCV 2RRBA 1DTQB 1RISA 4KGZB 4OLOA 4TU8A 4JP8A 3QO9A 1EHWA 5CCLA 1BWVA 3QMQA 2CA9A 1NZAA 4ZKAA 3RBDA 3ZTPA 3QT8A 3TVKA 5A8RA 2G1HA 8RUCA 5IT4A 1REVB 4ZP8A 2RRAA 3J81U 2VA3A 2BA9A 1APSA 2H51B 1FKOA 4X4TA 2WRMA 2RU3A 4BS2A 4DUTA 2P9EA 3HD1A 1X7VA 3GJQB 2HQFA 2V2KA 1FTRA 4Y2KA 1FD2A 2XWYA 5F41A 2YNIA 4DV5F 2ZVSA 2APOA 5A8WB 2ZBCA 5AJ3F 1RT6A 4CH7A 1T0TV 3EVWA 5F8NA 4F8RA 2ZUAA 2Q6BA 2JFKA 1JIHA 3OV7A 3GFHA 1RAFB 2QYCA 2CQ2A 3CCQS 3BDPA 3OL8A 1CJTB 4I69A 1F5BA 2UUTA 2P6TA 5K20B 1S6PA 4WCEQ 2QLXA 3MEEB 4YY3J 2ZFHA 1S1TB 1RB0A 5D4NA 1OY8A 4LF7F 2HK3A 3QWPA 3D1OA 4NCGB 3BF4A 2B4VA 5JUMA 2JX2A 4B9VA 2DD8S 4MK7A 2LLZA 2RHSB 2XI2A 4OYIA 2AX0A 4RW9A 4F0HA 3GG0A 2ZWPA 2VG7A 1SQEA 2VKZG 2FC8A 3KKFA 2HFSA 4HH1A 1IQTA 1ULRA 3CJ2A 1S10A 2J0SD 3CW2C 3DKDA 2UXBF 3KLFA 1RK8A 4QCLA 3QO9B 4Y00A 2CQ4A 4JI4F 1JLGB 5HO4A 2E5LJ 3A1YG 4NLDA 4PPDA 4ZCIA 1NXIA 2R2UA 4OZ3A 2CJAA 2RS2A 4PWUA 2E9TA 2JOQA 5A8RB 3H2VE 3SQOP 4KY3A 5CYQB 2LCWA 2AJ4A 4IH5A 1JNZB 1U49A 3BZQA 1FKOB 1EJ7L 1X5OA 2CPFA 3HZEA 1ZA1B 1KVIA 1IKWA 2E5JA 2K7JA 2BJEA 2XS2A 5C2CA 3K5OA 4DV1J 2QA1A 2V8HA 4M95A 2YNIB 3MGJA 1SL2A 2V4JA 3QBCA 4J91A 4WE1A 2UUCJ 2K3IA 3VGTA 1RT6B 3D0IE 3CCMS 3I31A 4N8NA 1RKJA 2QG9B 5JMNA 2CVEA 4J9NA 1HNXF 3I4PA 2AEFA 3W5YA 2DT9A 1U6BA 1SC1B 4FPIA 3DXBA 2E1CA 2X51A 4NXNJ 2W24A 3IAM9 2DCUB 3OVAA 3L7PA 3CULA 1S9EA 4Q45A 4B9SA 2F1FA 5DLGA 4WIIA 4N76A 3JXOA 1S6PB 2D9PA 1PC5A 2YH1A 3WBZA 5JVHQ 3D2WA 4QYZJ 3HFZB 4PZVA 4JI0J 2ZC4A 3MPDA 5DQGA 2R7XA 4Z7YA 3B8HA 4RNOA 4YB7A 3R5DA 2RJZA 1HI1A 4WFZA 3ZZ0A 1HHTP 5KFQA 1X9SA 1S6OA 1VDHA 2U2FA 1U1QA 2NXCA 3QWUA 2NLWA 2OPQA 2R7QA 1MLAA 1KN6A 3BQ0A 1H72C 4DV6J 1VBKA 3KLFB 4RW4A 1XMOJ 1TL1B 2GQQA 2XGQA 3I82A 5IT0A 2PEBA 4XK8C 2V4RA 3NOCA 3N4WA 1VRTA 2QSFA 4WTOB 2Y1RI 1CJKA 1QSYA 3LQVA 4ZA1A 3T1HF 3ILJA 4RUCA 3OR2A 2FJWA 1U2CA 1X60A 1VI7A 1YZ7A 2NYHA 4L74A 4X4NA 2D41A 3I96A 1YI2S 4ZPBA 2R2RA 4CO4A 2V8DA 1UEKA 1KQFB 1F3VA 2C3UA 2LQ9A 3UVJA 3E2EA 1HBOB 5KG0A 4ID5A 2DXFA 4A8OA 3LPEA 2V4JB 3DFEA 1NB2A 4WE1B 2BBEA 1M1KT 1VLOA 3RB6A 1Y11A 1KOHA 1UZHA 3KUGA 1KP6A 1B0TA 3HLUA 1TL3A 1S1VB 1FNOA 4DR1J 2W2NP 2W9BA 4IRCA 4PAAA 1U6FA 3AD8C 1M0SA 1S9EB 5L38A 2B9XA 1N52B 3HJVA 5KFUA 4KQZA 1FKPB 2XC9A 4ED2A 2BM1A 1XNRJ 3HF5A 2DH7A 1DQ9A 1RHQB 4RKUC 2HFVA 2FIUA 1N34J 5DM6Q 2ZUGA 4WK3A 4C7QA 2FYXA 1BD6A 1B3TA 1WTFA 3CCLS 1XC9A 3BO3A 5L1KA 2H9ZA 5GMKa 2BKOA 2VOOA 1UKUA 4DR4J 3CO0P 2VQEJ 2RDDA 3Q8YA 2PFDA 5GAHU 3PACA 1AXQA 4LF2A 2OKQA 3PW7A 3QIPA 1W7WA 2Q3PA 3G4SS 5ETPA 4NI2B 1QD1A 1RT5B 2KL8A 5JXSA 3MMJA 2FLNA 4MAKA 3R3TA 4I2QA 3KJVA 3KNAA 3FZBA 1VRTB 3A8KA 2HKEA 3HHLC 1S5ZA 1Y7PA 2K8GA 2QL5B 2E7VA 1K73T 3NG8A 4ZPTR 1RU1A 1RSCA 2JZ5A 5JJBA 2DBBA 2BJ9A 1FDDA 3QGPA 3KDNA 1FKAF 1YBUA 1NEEA 5L9NA 3HHNB 1TL7A 3M6VA 3MAQA 4LREA 4CO3A 3UVJB 3CC7S 2HVHA 1T3NA 2HHVA 3PW5A 1BXNA 6AT1B 4C8NA 4WK1A 2DEJA 4F0KA 2CZVC 3IA0A 2WSFC 2VG6A 1WHWA 1TKTA 2OPPA 2V2VA 1JK9B 2W9BB 5J1EA 1FFWB 4IDKA 4IG0A 4LIRA 2UXCJ 1EKSA 4KBIA 4ED5A 3RG6A 3HP6A 3JSMA 3ICLA 2C42A 2FVCA 2FJDB 4TQSA 3DOMA 3GLJA 3ZZPA 2ZNYA 4GC6A 4OX7A 2OD6A 3VAJA 1LWFA 5F8JA 1F9HA 4H4KA 3K5NA 2F5GA 1PJ7A 4NZ0A 1QTMA 2PMZD 3CMQA 5BR8F 2GHPA 2WHOA 4OHWA 3MHYA 2W8LA 2WVDA 2MQLA 1C1BA 5K8PA 3DDIA 4WZQA 2IDEA 3TA0A 1FVQA 2E1AA 4FXVA 2B0GA 2FJXA 3CSKA 3QIPB 1WNEA 2UXDF 1BC6A 2GAHC 2Y0SD 4I2QB 3KJVB 2N82B 3F41A 2ZH9A 2IJFA 3LWMA 3GZ7A 1RDRA 5J2NA 1VQ4S 4N7TA 3VGVA 4OZ0A 4PWDA 1SC3B 4B02A 1C0TA 4OYZA 1TR0A 1M5OC 3ZTRA 2V5HG 2HHSA 3SV3A 3ZZRA 1LK5A 2XCPA 2RQ4A 1WUUA 4B17A 3D68A 2IC3A 2GNKA 1GTHA 1TQLA 3NY0A 2KG0A 1HI8A 1YVFA 3PR4A 4KKOA 2JEIA 4QIFA 2YKPA 2RQMA 2DHAA 3VAHA 2MKKA 4TXSA 1I3OB 3ZZYA 4FVMA 1Q95G 2M8DB 2XG8A 3D0HE 3H4BA 1WDTA 4M5JA 4ZP6A 3I32A 1YJVA 2OHDA 1TKTB 3GPAA 5BYRA 5J1EB 3DHWC 2L48A 4IDKB 4IG0B 1FHTA 4OHYA 3T5JA 4PG5A 1WTBA 2AJ2A 2PMHA 2CQDA 2Z0GA 3G82A 1IR0A 2B3TB 4W90B 2EKYA 1BHNA 3DOMB 3OVSA 3HHLD 3QT5A 1FDBA 9RUBA 2Y0BB 2ZEJA 4FNHA 2IA0A 1REGX 4NYZA 3LP2A 4K5SA 1ZYQA 3T1YF 2A18A 3UR3C 2ZITA 1WACA 3IC1A 1VQ6S 1MN7A 1M5PC 1ELOA 3MM7B 1VBXA 4YQWA 4TYBA 4LFBF 3ZZOA 4K4ZA 2G9OA 3UN3A 1KD1T 1YRTA 1C1BB 2RVJA 4J9OA 2IM1A 4IKAA 4LRDA 2UUAJ 1PIEA 1S1UA 2W2OP 1HD0A 3D7SB 2GX8A 1NB7A 2KJVA 2C2EA 3T19A 1N4LA 3TANA 2A6MA 3HHKA 3VV2B 4U7CA 5J2NB 1S48A 2ZJPQ 7FDRA 4DSKA 1C0TB 3OFFA 5L1JA 2WOMA 1VJWA 4DU7A 2KXFA 2OPRB 1S0OA 4QWEA 4GKJJ 1U4BA 2NXUA 3VHQA 2P9GA 3R97A 2UU9F 3ZTSA 2XLIA 1XR5A 4WTYA 2B9YA 3CJRA 1O6XA 1DRZA 2IC3B 4KB7A 3BBBA 4KKOB 5H9EK 2QC3A 3TQEA 1WI6A 2XYPB 2I5JA 4J7CA 4WFAQ 2ABYA 1VQPS 1AT1B 5AXLA 4WF9Q 1H2VZ 4DLEA 4OJ3A 1IR2A 5KT6A 4Q44A 3NMAA 1L3KA 2OD4A 1P1TA 3MOZA 4LFCF 5G4DA 1MN9A 2IMOA 5KFXA 3MM6A 4FKXA 2LEAA 4IR9A 2DGVA 4URQU 4MYTA 5ETNA 3GV8B 5JVGQ 2OJ3A 4KYZA 2XZDB 4ICLA 4XO0A 3LP2B 5HMXA 1M1GA 3GIIA 3ZZTA 3TA1A 4KV8B 1TUGB 4P2XA 1H2TZ 2XI3A 3BYPA 2RH3A 3TAMA 4UTGA 1M5HA 1RTJA 2MZQA 2HBZB 3W65A 3M8YA 3QGIA 1S1UB 2YKOA 4WKRA 4FYXB 4NLPA 2KM8C 1MMDA 4ZCMA 5CABA 2DNZA 1Q5VA 4DQSA 4KGMA 2CXEA 3HI9A 3AQOA 1RT2B 4C8YA 2DRDA 3ILLA 2EK1A 4I4BA 2MYFA 1A6LA 5HANA 2MZ1A 1NDKA 2E5HA 1RZMA 3ELHA 1HNVA 3ZNJ1 3DU5A 1U1KA 4P71A 5ETMA 1JLBA 2YWHA 4FF4A 3OHAA 1WC6A 4OHXA 2I5JB 1X4EA 2A3JA 2F9JA 4DQQA 4A8KA 3NWGA 2CQ3A 2PMWA 4C8LA 1RWUA 3WIUA 5F8IA 3TVZA 4HVZA 4B3TJ 3BBFA 2X7IA 3BGOP 3JQKA 3GSIA 4L73A 2K2PA 3K8WA 1SJFA 1RAIB 2BQUA 5AE1A 4PUOB 2MPUA 3KK3A 4J90A 3GYXB 1R6VA 2HK2A 4ENOA 1JLQA 4ZVTB 4C11A 3POTB 3MM6B 1IVZA 1H7XA 1JLFA 3CDBA 1C0UA 1FX2A 2YKAA 4CH1A 5AT1B 4PRFA 1IXKA 2XMWA 1RUSA 4ICLB 3W5XA 2HFUA 4L6V3 1NPKA 4H54A 3V81B 4LQ9A 1FF2A 2AU0A 2EBGA 2O66A 5L46A 2AJQA 4M5HA 2E7WA 3NKYA 3HKZD 4C4WA 4LF8F 1Q79A 3MMBA 2KTQA 4I6AA 2R7VA 4U95A 2VFRA 4PG7A 2GMJA 1NSKL 2N3LA 4P72A 3WHIA 1PJ5A 1Y00A 5LOQA 4CO5A 3CF5Q 4DL0C 3VR1A 1F60B 2DB1A 2OSRA 4U67Q 1QDUB 2NZCA 2XO6A 4LRFA 1KQKA 3I5AA 5HK4A 1IR1A 4PABA 4KSEB 5DGBA 5CCMA 5HJXA 4JI3J 3OW2R 2ZC3A 1LV5A 1VBZA 3PW0A 1HNVB 2IA6A 3FC9A 4FYDA 3CJ8A 1H73A 1JLBB 4Q7AA 5K5MA 4CLPA 1WF1A 4K50A 3OTBA 2G0IA 4O3RA 3N6NA 2F7VA 2AT1B 3PJWA 1WHVA 3B6BA 3H4DA 1KTQA 2PA8D 5J1NA 4EGLA 1RWKB 4OYAA 3DRPA 2NS1B 4TNOA 1YKWA 3J7YU 2E1MC 1JKHA 3E01A 1CC7A 2K1RA 2QL9B 1Q5YA 3ET6A 3JS9A 3KK3B 4ZVOB 1JLQB 2DITA 4C11B 1ZM2A 1QE1A 1RTDA 2ACMA 1JLFB 4DPOA 1C0UB 2LP4A 4PXBA 3VGUA 4FVCA 1EP4A 1R8PA 1WOPA 4ECXA 1LW0A 3PVXA 2B5JA 2HFNA 2CQBA 4XPCA 3HHEA 4NLQA 4AT1B 5RUBA 4OQJA 3MUTP 2DIUA 4KE5A 2HNYA 2PT0A 4F4KA 2D1CA 2IBOA 3I4HX 2RF2B 3TOQA 3RUBL 4KHMA 1LOUA 2V94A 1B4SA 3AOBA 4U7UD 4GKKJ 5IC4B 5HJYA 2H5EA 5CD4H 5F3TA 3SCJE 1X31C 3UDEA 4A8YA 3EVMA 2XMVA 4Q43A 4DFKA 1B0VA 2FVQA 5D0EA 2NSBA 2UU9J 2AIRB 1XNQF 4J9QA 2HW3A 2FHJD 1QAYA 1ZTTA 1HWIA 1BUXA 3M8ZA 2GJIA 1YLXA 4TU9A 3IWLA 1SV5A 1JWWA 4CTAA 4NPOA 1XMQF 4TN2A 3H20A 5SUHA 3R7SB 3MM8A 2VOPA 2Z2ZA 1VGYA 2FZKB 2MKYA 5F8MA 3MAAA 3OLBA 5HVHA 3DRPB 4RUHA 2NZ4A 3WDOA 3G6XA 4LFAJ 4LFCJ 3IRXA 1FESA 7FD1A 9ATCB 1JKHB 3E01B 2JNJA 2K1RB 2GO9A 2ZHBA 2X1AA 1B7FA 1WC3A 2B7CB 1QE1B 1AUDA 4G1PA 5E3RA 1XIQA 4DZDA 4ZPWR 2IM0A 4NCBA 2AJ0A 5F8GA 2H3EB 1EP4B 2ASDA 1LW0B 4OIXA 4OYPA 4CQ1A 2B5JB 3V6HA 2YH0A 4J37A 4DV2F 3EGNA 3GJRB 1EIYB 3NAIA 1X9MA 4DN9A 3T5HA 4IH6A 1QJHA 1R0AA 2Z57B 2H65B 1TK0A 1VYAA 4NLGA 2HRTA 4NASA 1AROP 1GK8A 3UPFA 1FVSA 1ZM9A 2L3MA 3I6PA 3HXMA 4MK9A 2XWXA 3BV8A 4YB1P 4F2RA 4EBDA 5KOXA 1U26A 4DUZF 3PKMA 2XHCA 2FVSA 3CDAA 2B4PA 4C3MA 4P2MA 5HMWA 3Q22A 4DV4F 1RWVB 3W2WB 1SKUB 1S99A 4R8UB 5GAEI 3QT6A 3PO4A 1SV5B 2IHR1 5GAGI 4CTAB 2CFXA 4RW6A 2XY7A 1L3UA 2XM3A 3MM8B 1S12A 3SQGB 3I0SB 2E5IA 2MKJA 3X3UA 3MPWA 4C3LA 3ULHA 3PKYA 1JLCB 4Y6IA 4X4SA 1Q53A 1WOOA 2EFNA 3EVOA 3TWZA 3RW6A 3ZNUA 4KAIA 1WI8A 1WKLA 2MZSA 3IRXB 2XY6A 2FJEB 1GXTA 4QIVA 2ZDOA 1LW2A 2L08A 3V4IA 2DO0A 4X84A 3OVBA 2DRBA 1UWAA 2Z2LA 2MQ8A 1NK9A 4JI8J 3RR8A 4F50A 4ZPCA 4A46A 2VV5A 2OSQA 5KFZA 4AYBD 4YR2A 3NCRA 2CQCA 5FLXU 2ZH5A 3G71S 2KO1A 3MURP 2ZBIA 4V19J 4PPZA 3ILIA 3HSGA 4FBUA 4JI6F 3EYZA 1R0AB 1TAUA 5DG7A 2LQ8A 4UY85 2WTFA 4Y2CA 5L1LA 2UVUA 1WEXA 2JVOA 5I3UA 3SXLA 2W8KA 3VF0B 1TKZA 3CJ3A 3VVTA 1DBDA 2RILA 4B3MJ 1Y3KA 1X0FA 2HHUA 3SEOA 4OI3A 2D69A 3N5BA 2W4PA 3KYLA 4URGA 2B43A 1NK6A 4FBTA 4KRWA 3MCSA 2Z2MA 3PYEA 1KFDA 4DBQA 1IBLJ 3GILA 1X9WA 2Q43A 3P6YC 2XZTB 1VR6A 1PILA 2IBKA 2R3VA 2QFJA 4RW6B 1FNMA 1Q8IA 4JI5J 2FGCA 3KLEA 3PRDA 1Y10A 1FE4A 1OYDA 1YK9A 4MKAA 4OI1A 3RAQA 1YDLA 5HMZA 1R8CA 2HHQA 4YHHF 4DQIA 2PFFB 4P75A 4QOTA 3C6UA 4ZCKA 1T02A 4KGKA 1LW2B 1SUQA 3TZXA 2K06A 3VWSA 2WB4A 1QUPA 2XMUA 2XS7A 3JSRA 1N5YA 3CT9A 3NAHA 2KHCA 1N0VC 1PSDA 4NA2A 2DNPA 1TKDA 1RT3B 3M2VB 1VBYA 2P5VA 4CLYA 1GQEA 2W2PP 5HATA 3LA0A 1CLFA 1IUJA 2YWEA 4O4RA 4X4VA 2C3PA 1EKRA 5I3UB 2JEGA 2DEIA 1TKZB 4QWCA 4DL5A 2RAQA 2GVDA 3M2RA 3KK2A 4C0OC 2LYVA 1XNQJ 1QAIA 4IH7A 4CZCA 3JTOA 4KC5A 3C14A 4R0EA 3H42A 2OTLS 2YVSA 2IFXA 3UO0A 4YFUA 1JB0C 3V6DA 3AOCA 4YUDA 1HQEB 2BXJA 3AB2B 2L9NA 1S72S 3R2DJ 2ROGA 5E0OA 4U9RA 1S7HA 1GH8A 4XIUA 1D1UA 1H3DA 1UAWA 2HHHF 1AZSA 4OI6A 3IBWA 1P27B 1VHFA 4UQTA 3AJ2A 1TVRB 3DRRA 3OTDA 2C2NA 1FXLA 1S4EA 3HMJG 1HNZJ 4TU7A 1F3FA 3RTVA 3KG1A 3D9BA 1X0PA 2ILZA 1S49A 2KVQE 5LJ5Y 5D6GA 1VC0A 2FZCB 4AE5A 3C6UB 3R7NB 4TQRA 1D9AA 1XQIA 2AYBA 2BJ8A 1SUQB 3DYAB 4LBIA 4TY8A 2ZKUA 1RT4B 4DN0A 2ZBRA 2CNNB 3GB0A 4DV2J 1N33F 2F3JA 4PKDB 1G1XA 2BZ2A 4IRKA 1N36F 4CLFA 1S97A 4BHQA 1N5YB 4L76A 5IC6B 3K89A 4PYAA 2HBYB 4UT4A 3PFOA 5IS2A 1KQGB 1HLWA 2PO4A 4KHPF 2IRXA 4U6PA 2BKPA 5DO2A 1JXVA 3TEHB 1F2GA 2DCLA 2VPYB 3S8SA 1G7CB 4HL9A 1OYEA 4AQYF 2QRRA 3P8BB 4DUZJ 1I1GA 2G4BA 3WX8A 1J27A 3EZOA 1U6ZA 1F5CA 1NBEB 2GVDB 4WFNQ 3M2RB 4FS2A 1FWLA 4LMZA 5LL6d 2XSJA 4Y28C 2XMTA 3KHLA 4FXDA 1Q7LB 2EEYA 1SVDA 1U0SA 2VBYA 3V6DB 2WCXA 1Y9OA 3S01A 1NJIT 3T5LA 2A1BA 5CQGA 4XDDA 4HACB 3K5LA 1RT7A 3CJKB 2COLA 2DYAA 1HMVA 4F36A 1CS4A 4JV0A 1PYSB 3KUEA 1DQ8A 4DDFA 2CVIA 1P6TA 3N28A 5HROA 4JI1J 2WAQD 3DRRB 5H9EJ 4K0KJ 1S9FA 3UFCX 4U8YA 4OZLA 2AP6A 3UQSA 1GMWD 4JI7J 1SJ3P 4X4PA 2KM8B 4IR1A 2YWGA 3LP0B 4A8FA 1LWXA 4DPXA 4TY8B 4AFFA 2FY8A 3BREA 4B3SF 5ETTA 4RO0A 2MHEA 5E3PA 2YPZA 3OT9A 1NMEB 1RA7A 3CD5A 2BANA 4ED3A 3FZ2A 2HVIA 1EQ0A 2WBRA 3SFUA 3WZ0A 1TUVA 3CPWR 1QM9A 2KKHA 4DUYJ 4EYHB 1EETB 3J7Z5 4ECTA 1WD6A 1S0NA 5HQMA 1P1LA 3R5GA 3BEGB 2MLXA 1RT1A 4X4UA 1Y5NB 3O2IA 4KO0A 4CYUA 1K8AT 3ITHB 1R0BG 1FTCA 2D74B 3P3DA 3QQCD 4FKYA 2FLOA 3IGNA 2QA2A 5E7OB 3PG9A 4LF5J 4Q0BA 2XSJB 3AD7C 3E51A 4ELTA 2I1RA 1PAEX 3RR7A 2RRNA 4QWBA 1HKAA 2MDAA 1XJWB 2WVCA 1WC5A 5KT5A 2GZOA 1HR0J 2PE8A 3UDVA 3M32A 3MEKA 1CS4B 3CTRA 1DAXA 3P5TL 5HROB 4YB6A 2IRUA 2BJ7A 2Y8WA 1J5EF 2B6AA 4OV6A 4K2XA 4YHHJ 3U27A 2F4FA 1XEZA 1SH3A 2DHSA 3VCDA 2M8HA 1C4CA 2ZM6J 2VDHA 1R0CB 1RTZA 1W2IA 1T9YA 2V67A 1MMLA 3GIRA 4G1QA 4ZVPB 2N7YA 3H40A 2I2YA 1K0TA 1X8DA 2BANB 3RB0A 4MYUA 2F4VJ 1R8HA 3BGRA 5LT5A 1OY6A 4HHUA 4N8OA 1LWEA 2PA3A 1T9VA 1MROA 3N9UC 4LQ3A 2B7BB 4I64A 2Q79A 3IGVA 1RT1B 4OZJA 3RJMB 3IBCB 1RAHB 4WFYA 2HRUA 4KO0B 1GFWB 4CYUB 3DNCA 5A6PA 2LVWA 4HDHA 2JDJA 4CCHA 4P73A 3HO1A 4AXJA 1VFJA 4PCQA 3VQSA 3PEJA 3WQPA 2FJBB 1FJGJ 2DGXA 2VFSA 2RSQA 2HWTA 2KRRA 3BR8A 5AXNA 1QAJA 5B09A 1N5SA 2FPHX 3W2VB 1KTVA 1WORA 3KDOA 4PR6A 5DDQC 3A8IA 1ZBTA 1Q7YT 4LR8A 4MIWA 2GQ2A 2OLWA 4YY3F 3R6LB 4ILMA 1NU4A 4PWWA 4HI2A 4A8MP 3MOJB 2C3MA 3PY8A 2EWHA 3TX8A 2G1DA 2FUG9 4AD6A 1NK7A 1NK0A 4PEOA 1U24A 2QFIA 3W1YC 3M32B 5ADZA 3M05A 3QATA 3LAMA 2EC2A 4DL4A 2C2ZB 3KFWX 1U02A 1UVIA 3TW0A 3ZTOA 1JXEA 2N4CA 4NA3A 2QE5A 1VOMA 1SXLA 3SZ2A 2V2QA 3DLJA 1ZS6A 3DRSA 4X64F 4G1QB 3MPUB 3IM8A 4O0NA 2DGSA 2E5LF 1IKVA 2EK6A 2XS5A 3G6YA 1WEYA 2CZ4A 1BQNA 2AD9A 1XN9A 3BGRB 2DNLA 3GFXA 4DX7A 3PYDA 3M8PA 1FERA 3QJJA 2QYGA 2MGZB 4N77A 4NYPA 2AZ3A 4A8WA 2WVFA 1I51B 2W7PA 1MROB 2AQ4A 4F4XA 2VF3A 3RRKA 3DU6A 4WXOA 2HURA 3E8OA 3T6JA 2RHQB 4CLSA 4J5OA 4NXMJ 2HEKA 3PZPA 2C2OB 4C8MA 2UUCF 1KDNA 3CCTA 2W9AA 1C2PA 5KFMA 2DNMA 2OMOA 2HHTA 3G2XA 4QR1A 3OXFA 2J6SA 1SH0A 4Q2LA 1RTIB 2B4OA 1SJRA 1PGZA 2F65A 3GIKA 3GCXP 3QJPA 4DCPB 3DDKA 3FDSA 4NXNF 2WK4A 1BE4A 5A6WA 4R0JA 2WONA 3MI7X 5ETRA 2KVIA 2EG2A 3DDNA 4ECYA 1C4AA 2F40A 4RU9A 1OIAA 2KU7A 2ILYA 3J7A1 2VC1A 4ZJLA 4OZ2A 1R27B 2CDRB 4JI0F 3NNHA 4ECVA 3SDEA 4EI2A 2QLWA 3MMAB 3J81Y 2O5DA 4D3GA 4O4GA 2A0FB 4RZRA 2Z8QA 3TJAA 1IJEB 3W64A 4HT5A 4URSA 3CJ4A 5IV3A 1ZETA 4B3SJ 3DRSB 3HVTA 3SIPB 3MM5A 3KTQA 2DVIA 4DV6F 4DX6A 2NPIA 2HGLA 1XMOF 4F67A 1IKVB 2UVVA 1K1QA 3MPYA 3I9V9 5T7LB 3UCZP 1HBNA 4ZS6A 3PJ9A 3A3PB 2V2ZA 1BQNB 3JQJA 5KFWA 4ZLJA 2PN6A 1OJ4A 1SKWA 5CAAA 3U1NA 4Q8EA 3HX9A 4DR2J 3BQ2A 1FRIA 1S1XA 2OI2A 4ILLA 1Q8LA 3QT7A 2DR9A 3R1LA 3GWCA 5A8WA 4F2SA 1Q4RA 4X65J 4CLLA 2HRYA 3FCWA 1NJXA 3UDLA 3RYLA 4JI2F 4M5MA 1T3OA 3MMCA 4YN3B 3TP2A 1NLKL 3JQMA 3SSSA 4WZMA 4EU0A 3G8SA 3H5XA 3S1TA 2RUGA 4PQUB 2ZOMA 4DR1F 1H38A 1QSLA 1RAAB 3MEEA 3D6FB 4K5RA 5IV4A 5A8KA 3MECB 4ED4A 2WONB 2IY5B 2G2ZA 1RYSA 1PCAA 1XNRF 3FNNA 2B8PA 2BMBA 3VAIA 4JYAJ 1N34F 4S0MA 3RB4A 3HFVA 1UP1A 1OY9A 3MZIA 3H5UA 5L39A 4ECUA 4QPTA 2HZVA 1U1MA 2GQCA 4ZVHA 4DCJB 5DETA 5IT9Y 4KIAA 2DNNA 4DR4F 5I3PA 2VQEF 3RRGA 4K4YA 1JLGA 3CNQP 4NLOA 2NCKL 4NOHA 4ZVQB 3CCJS 3HVTB 3N79A 3MM5B 3BYRA 4ER8A 4CM2A 2CQIA 1YJRA 5D0HA 5CYQA 3DN9A 1HBNB 4K4XA 4CO0A 3JSYA 3AY0A 1X4HA 2DNQA 5I42A 2KXHA 1WF0A 2PIIA 4DR6J 1IWGA 1S1XB 4F3QA 2VG5B 5IOLA 3BPDA 3RW7A 4DOZA 3OD2A 2VPZB 4OYWA 3LUYA 2P8IA 4B3RJ 3KG0A 2AMCB 1U25A 2BE2A 3MMCB 2X1BA 2J7WA 1OSDA 1RHUB 1TL4A 2KH9A 1D8YA 2BQRA 2KYZA 1ICEB 3D6MB 1RHJB 4Y2MA 1GAOA 5L8RC 1WELA 2AF6A 3OLAA 1E6YA 2VBWA 3BS9A 5IWAF 1NJYA 3DLHA 5A8KB 1TFYA 3GP9A 2JSXA 2UXCF 4I56A 1OMSA 1KONA 1UVLA 2VQFF 3DCAA 4ETXA 5CXTA 1J2VA 2R2TA 3TUPA 1IQZA 2CJXB 1N32J 3DLGB 3CE8A 1KLNA 2KT5A 4ED0A 2YNGA 3NGRA 1RABB 5IFMA 4JV2A 3EDRB 4HLBA 4EWTA 2LXUA 4FF1A 2IVFB 3H5SA 4G3IA 2OMLA 1WJ9A 1ZTWA 4X64J 3L3CA 1HHQA 4DR5J 4K2JA 1TL1A 2DNKA 1GTEA 1ZOTA 4CNZA 5LMNJ 3C6TB 3TR5A 2VBXA 3K17A 4WBFA 4OJ1A 4USWA 1VIXA 3P96A 1BQXA 1YQHA 3T1AA 1JMTA 4OYBA 4NX9A 4L75A 4MIAA 4A4JA 2Y9HA 2DO4A 2C2MB 5CYJA 5I42B 1L5UA 1U8WA 5IT9U 2AYMA 1TTHB 4XTTA 4WXWA 2HNDA 2AGOA 2QA4G 3AFGA 4WP8A 3TUIC 1S1WB 3F56A 1HBOA 3KOAA 4HT7A 2F63A 3OPKA 2ZD1A 2W9CA 1RP5A 4DU8A 2BE2B 1S1VA 4ECQA 2P6SA 3L4BC 2AYGA 1I5OB 1Y5LB 3DOKA 5HAOA 4DSFA 3VTIA 5KT4A 1E6YB 4K7QA 1UVKA 1H7WA 1FKPA 3CDEA 3GIJA 2XYHB 1OO0B 2MSSA 1DURA 1RWNB 2HLUA 2XBPA 2JL9A 2O01C 1V3ZA 2GIFA 4C6AA 3GJSB 4CIOA 4QWAA 2YNGB 4B3OB 1HI0P 3NCQA 4RWWA 5EWEA 3M1VA 3AH6A 3OQ2A 3QZ8A 4BWMA 3TVYA 1B64A 1SH2A 2QLFB 1S6QA 4FF2A 4U96A 2KDOA 4X2BA 2WVBA 3Q8SB 3Q23A 4AL7A 4HTIA 2GV1A 2I8EA 4LRAA 4QWDA 4OJGA 2HZCA 1RAEB 4NI2A 2BUNA 1RT5A 2UUAF 4DF4A 4O44A 1BMQB 2QN6B 1Y4ZB 4QBUA 1YG0A 5KTQA 4DQRA 1BY9A 5KG2A 3OTEA 4BLGA 3K7RA 2QSWA 1AA1B 2GJFA 1VQ5S 1UETA 5AE2A 4GVBA 3P45B 2DIVA 2MQMA 3HJFA 2FJAB 4ANEA 1NKBA 1HWKA 4GKJF 2HNDB 4OYOA 1U8SA 1NK5A 1SJQA 1RADB 3CJQA 1LK7A 3PYFA 5AE3A 4DI6A 3NXZA 1FRXA 3G9CA 5A2QU 4JI2J 3HD2A 1RCXB 3IWXA 2ZD1B 2W9CB 4EBCA 2QIFA 4CM0A 1L3SA 2GJ2A 3V4MA 3QAUA 5HL7Q 3KMQA 3DM2A 3TJ8A 2VJVA 2RU9A 3DOKB 3R9LA 1S0MA 2CJYB 3ZZUA 2HIQA 4IOAQ 2Y1LB 2YQ3A 4ZPDA 3RRHA 4RNHA 3UD3P 3WC0A 2HBRB 3NGTA 5B08A 4KGVB 2PI5A 1LXJA 1FRKA 1IWAA 4IFVA 2HMIA 1RA6A 4E0DA 3IMQJ 1NCLA 3D3CJ 3THPA 4BC9A 1YIJS 2UUBJ 2XMKA 3M1VB 2AGQA 4MH8A 1S6UA 3HT0A 4NYOA 2VD3A 2E29A 2QMUB 3VGSA 1S6QB 1X4DA 4MIBA 3PFEA 3EPGA 5C5JA 4H4MA 2LMIA 2VPXB 1N0UA 5D15A 4QR0A 3P4UB 2IJNA 5DG9A 4DMZA 1F1BB 2PSZA 3SFGA 4O44B 5KFAA 4QU6A 1UPMB 1TU0B 2LA6A 4RNNA 3R5AA 2NREA 1SIWB 3T3FA 1O5JA 5LJ3Y 3KK1A 4KPYA 4GVBB 4LR7A 4KGXB 5M2RA 3LF0A 2KB2A 1FRMA 3T5KA 3PX4A 2PI4A 1PAUB 3MCNA 5DRKA 3HKWA 1UFWA 3DMJB 2F8MA 1TK8A 4UOGA 5KFPA 1WOSA 2JH3A 2D3ZA 3AQPA 3UD4P 1WSVA 1FXDA 3IBFB 4NLWA 1ITPA 4OFZA 3W9JA 2XTJP 3BKUA 2XB2D 4NRUA 2G2OA 3C46A 1CPZA 2VFUA 5J2QA 2EFPA 1HL6A 2MQQA 3DM2B 5IWAJ 1FFSB 4B3TF 2GIQA 3RU0A 5D0RA 3H98A 5DG8A 2ALYB 2EFOA 2VQFJ 5ETKA 1TAQA 2GAGC 4DSJA 2VONA 3LANA 3E3XA 1X4FA 4IFVB 1YGYA 3A8EA 1ZH5A 1Z2ZA 2HMIB 1MW7A 2ZH4A 2V8PA 4M63A 1SJ4P 5D8HB 2E7XA 3MM7A 3O8WA 2P2CB 1HBUB 2J0XA 2CADA 2MZRA 1G6BA 4ZK7M 1ZM3A 3MAHA 1V5IB 4H4MB 3EM1A 3F73A 2F9DA 2UP1A 1X5PA 1KHVA 3OSPA 4OV1A 4G1IA 2H4YB 2MJUA 3M2UA 2FLLA 1JJHA 3OJSA 2OPRA 4Y34A 4AUKA 3KK1B 2V63A 2CKWA 4D3HA 1JJCB 3DLKB 4JI3F 4NZ7A 3CCVS 3MFHA 1JLAA 1FRJA 3EDQB 2IVMA 2DR7A 1OQ6A 3QSIA 4ZPAA 1R43A 3QJLA 4EYIB 3WC2A 4DR3F 4M8LA 2WBMA 1T9UA 3UI3A 2OEKA 3W8GA 1S76D 5E2QA 1OPZA 4TY9A 3TX0A 2FJVA 5J2QB 1SJ1A 3KWMA 4LF9F 5BXIA 3TAPA 2DXDA 4ID8A 2CJ9A 1XR7A 1FE0A 1NK4A 3NP5A 1VRUA 4LRBA 1NSPA 2AEMA 3NBPB 4K4UA 2IRYA 4EZ9A 4LT6A 1KVKA 2ZVIA 3D0GE 2HGMA 3W66A 3LO3A 4H4KC 4RUBA 1SL0A 1IBKJ 4KV8A 4E2FB 3BO2A 4DF8A 1X4AA 1FJ7A 1TMJA 1HFEL 4KJIA 1QVGR 2XCAA 5LXYA 1QAXA 5FIIA 4WFXA 1U2FA 3BSAA 4LJMA 2W4CA 1HD1A 1SIZA 2ZJRQ 4Z37A 2J76E 2Z2YB 3FVYA 3J80U 4GKKF 4R25A 3FQKA 2MKIA 1RT2A 4LF4F 4KPCA 1O0PA 5J2PA 3M2UB 5HP1B 3HPOA 3MR2A 2UVWA 1PBAA 4PXDA 3HVRA 3AXMA 5D77A 3FRZA 3HT3A 2Y1JA 3FMWA 2HFZA 1Y5IB 5LSLA 2EPIA 3Q8UA 4ES3A 1JLAB 3PRVA 2QMWA 3IRWP 5FJ4A 1X4GA 4F02A 2DR5A 2YY3A 1RBOB 1DTTA 3M30B 3OR1A 3QFHA 4NLSA 2B4UA 1Q82T 2EI5A 1JXLA 3BPSP 2XHWA 4DFPA 2BRKA 2KT2A 4QIGA 1RGVA 2LQBA 4FYVB 4PQAA 4PUOA 1VIOA 2XMJA 4LFAF 1VRUB 1YRXA 2DGUA 2VA2A 3POTA 2CNKB 4KHRA 1H2UX 2WW8A 5KG6A 2C2KB 2CZ9A 5KG4A 3NGKA 1G4CA 1PC4A 4LF6J 2HAIA 3BB5A 4NRTA 3IR5B 3V81A 3PW4A 5ETSA 2OPSB 4JV5J 2W25A 1M5KC 3CJTA 3KLHA 3QRQA 4ZVEA 3GTYX 4LIWA 4TLRA 2R4FA 4NEYA 5C42B 1VK8A 4DWIA 3M8QB 3MTJA 2J9EA 2JLGA 4YEAA 3ZFVA 4FZVA 4ZJQA 3OHBA 3GJTB 3JSBA 4B9TA 2R8IA 5GADU 1KOOA 4C8ZA 3PNIA 1RBLA 1FXRA 2RDIA 4M5LA 3PO5A 2GO8A 4IQMA 2EVZA 5J2MB 3PDNA 3PV8A 2GS8A 3EGWB 5KT7A 1WG1A 5J2PB 4DS5A 2BDPA 3O3LA 2IYIA 1BQMA 4YDDB 1K9MT 1AYEA 3MR6A 1SKRA 2MQNA 1W26A 2BW7A 4MK8A 2ZHAA 1RKIA 2LXIA 1NJWA 1FI4A 1K1SA 1XR6A 2CJKA 1CEZA 4W98A 3O5TB 5LMUJ 3OTOJ 3ONQA 1DTTB 5ETOA 2W7AA 3OR1B 1I94J 4HKQA 1IJFB 4XAKA 2KG1A 1PO6A 2RT3A 4JV1A 3HFKA 2RB7A 4F0MA 3HSDA 1RAGB 3LWLA 4RX6A 1CQNA 1S77D 2AEJA 1MSWD 3CJSA 4QIWD 4ZN3A 1ZPWX 1NKCA 1O8BA 1HNWF 3D54A 3MR7A 1N5VA 2C3YA 1SC6A 3GR1A 1AW0A 1R7IA 2VODA 2J0WA 4OX9J 3CC2S 5A76A 3Q24A 3SSQA 4Y2IA 3KMSA 3IFEA 4JI8F 3IS9A 2CPXA 5D0GA 2IYGA 3M6UA 3OXLA 4HI1A 3QIDA 1MU2B 2HQ3A 3SCIE 3KLHB 1G2EA 2M9KA 1RAJA 5H1SV 2ASYA 1KS2A 2DHGA 3D67A 2RQKA 1ZZFA 1GEHA 2RF2A 4P7TA 3A12A 3ADAC 2C1EB 2FLPA 3I87A 2IMWP 4DR7F 4DL6A 3JAMY 1IBMJ 4CO1A 2LKZA 4O3QA 3H0PA 3QLHA 1RJJA 3KXDA 3W9IA 4Y2AA 1HQ2A 3NLCA 3UD5A 4ZOSA 4HHHA 2BVZA 4B3MF 5E5NA 1FFGB 3ZZZA 5MAOA 4DV7J 2L9WA 5HQLA 2Y8YA 1BQMB 4V1Ak 1WC4A 2V34A 4ZJOA 2E66A 1M5VC 2JJ4D 3SCKE 2EW9A 1Q86T 4RW7A 2CQ1A 4TYAA 3FSIA 1IBLF 4DR3J 5KFDA 1SPBP 1XK8A 3UW1A 4UF4A 1UJ4A 5IM0A 2R9LA 4UUWA 1ZZNA 4JI5F 4OJHA 1KQSR 2CG4A 5DM7Q 1T94A 4LF9J 2OP5A 1D8ZA 1B0PA 3UN5A 1YRUA 3KNGA 2JRSA 1GMVA 5DDOC 1KC8T 3CO9A 4JB8B 4PYDA 3ENAA 5LSRA 1JX4A 3PHEA 3G8TA 5B7WA 2HLTA 4NZ6A 2FY1A 4JOUA 3IR7B 3O1LA 2M70A 3U1MA 1UA1A 3AJDA 4CH0S 3J81j 2H5JB 2AW0A 3IS9B 4FP9A 3CD6S 3ENWA 5CZVA 2HGNA 4C8OA 1HA1A 2NXJA 2MKCA 2KFNA 2UV8A 4TLQA 4F4AA 3UNYA 3D6TB 3CIZA 1SCJB 1ROFA 4O3SA 3CCSS 3LPYA 3NRBA 3D1HA 3LAKA 1R8AA 5K14A 2ZH2A 1WG5A 2CPHA 5B0DA 4LF4J 2M2BA 3QLHB 2EFGA 1WDDA 4RL1A 1HARA 3AOAA 2GW8A 2OAUA 2D3OR 3WX4A 4UW2A 3P5BP 5DDPC 3M6XA 1RE1B 2W01A 4OX8A 2HNZA 2B9EA 3FFIA 1FO1A 1GMUA 3W2WA 3JAMU 4R8UA 3CIMA 4ED7A 4USUA 4RW7B 4RW9B 2CG8A 5KFIA 2GGPA 2VG7B 3NNAA 1FK9A 4NWBA 4ZIVA 1LFPA 5EN1A 3SQGA 3KJNB 5KFNA 2DK2A 5F9NA 1WC1A 2FZGB 5IM0B 2XNQA 1GX5A 3I0SA 2CWXA 3C8YA 4N47A 3PEHA 3R2CJ 1YITS 1H74A 1JLCA 2UZAA 4B9MA 1KBRA 2VDIA 4OI0A 5FLXY 2HFOA 3M8WA 3FBBA 1HNZF 5HN0A 4CT8A 2YQ1A 1H98A 2GIRA 3LOUA 1RI7A 5B0CA 1P9YA 3HHLA 5HVFA 2GA7A 2VPWB 3HULA 3N6LA 1DY3A 5GAHI 3CEDA 2KFZA 5HSPA 2HSEB 2KN4A 4U7UK 3S7RA 2CQPA 2XO7A 3KLIA 2CQ0A 4UOFA 3GFYA 4PXCA 3H7HB 1KKHA 4GO7X 2SXLA 3PCOB 1IKWB 2HS3A 2UUWA 4P9SA 2OFGX 4QYRA 1FJCA 1UA0A 4MKBA 3CD7A 2ADCA 4OMFG 4CLUA 4X4QA 1VQOS 2WVEA 4L72B 3PIPQ 1N48A 4L3KA 1ZPVA 2ROPA 3QGGA 1SI9A 1C1CA 1VC5A 5K14B 5ETLA 1VQ7S 5KFGA 3L9ZA 2MKSA 5HI7A 1JQGA 3W3SA 4DZ6A 1GNKA 4FXWA 3LW5C 3MR5A 1NAQA 2EXUA 3BH7B 4K4SA 1MWZA 1W25A 7AT1B 1D3WA 4P52A 1VJQA 4ZVRB 4F04B 4DG1A 5KT3A 3W60A 3AHPA 3W5ZA 2HNZB 4UUXA 2CAJA 3CMAS 3FFIB 3OFGA 1NSQA 1CVJA 1X5SA 2OEMA 5HLFA 2HZAA 1B70B 4RBVA 2GGPB 3K58A 1FK9B 2HWHA 3TYTA 1VQMS 3EGVA 1F6TA 3BSCA 5GMEA 2KRBA 3SYZA 5DZ7A 3ZXWA 2OPQB 2DH9A 5FD1A 1SQGA 2CPDA 4JI1F 1HNWJ 4WFBQ 2RKIA 2Z4PA 1NZ8A 1N5TA 4RW4B 2CJBA 4K0KF 3MEDA 2QEXS 2LA4A 2HVZA 1NDPA 2ZBPA 2KXNB 4C0BA 4RNFA 1EB0A 4JI7F 3U7JA 3HHLB 1CJKB 3NL0A 3K57A 3GR0A 2XMAA 4OI2A 3OR2B 3ZO7A 3KLIB 1SBRA 1NPRA 3G6ES 1D9FA 2B8QA 1CQMA 4I0WA 4C3KA 5G0RA 3V6JA 3TJ9A 2OO4A 2HPUA 1RT3A 2R7OA 4RNMA 4DV5J 4QR2A 3M2VA 2IPOB 2HQDA 2MJNA 2YX4A 5AJ3J 1RWPB 1DLOA 3M9MB 2MY7A 4ID5B 4DR7J 4RPFA 2V0NA 4X4OA 2NXNA 2G0CA 4DUYF 5CD4A 2MZTA 4Q2MA 2ROEA 3EE3A 1S7IA 3FEXB 3FBEA 1C1CB 3R5JB 1TL3B 3NCPA 4LSLA 2BM0A 5KFTA 5GAEU 3THTA 3Q8VA 5KFFA 1N6QA 1YBAA 5E33A 5GAGU 1S79A 2XEXA 3NS5A 4IRDA 3PR5B 4DG1B 4LF7J 1FX4A 2CYYA 4LF5F 1OQ3A 3TQ1A 5LXRA 3M8RA 1NSAA 3AODA 4ZVGA 4ED8A 3MD3A 5KFSA 1HQEA 1XERA 5GMDA 2YWWA 1UTAA 4EO6A 1HWLA 4OZ1A 3OJUA 3M9NB 2FTRA 2IDLA 1UCNA 4P2SA 5HLFB 3MM9A 3T9ZA 1RHMB 1NO8A 3MTKA
chains in the Genus database with same CATH topology
3MMCB 2X1BA 3K5MA 2J7WA 1KQKA 2ASJA 3I5AA 1OSDA 2RMLA 4BC7A 4KSEB 1TL4A 5DGBA 4OX9F 5CCMA 1HR0F 3AA9A 2KH9A 4J9RA 1TVRA 1D8YA 1T05A 3LH2S 2BQRA 5T14A 2CQHA 4UOCA 4DSLA 2CJQA 2ASLA 2KYZA 5KOWA 3OW2R 4ECRA 1Q81T 2ZC3A 3J80Y 1LV5A 2RD5C 4FNIA 2FVPA 1VBZA 2C28A 2W4DA 3JTPA 3PW0A 4Y2MA 2I9SA 1GAOA 5L8RC 1R89A 1WELA 2YNFA 1KNZA 2RKIB 2AF6A 1HNVB 3PX6A 2IA6A 1DQAA 3OLAA 4ZPVR 1E6YA 2VBWA 3BS9A 3TUZC 3MEDB 5IWAF 2DHXA 1WF2A 1NJYA 3DLHA 5A8KB 1TFYA 4NLUA 4FYDA 2JSXA 2UXCF 4I56A 1JLBB 4CT9A 1KONA 4Q7AA 2DR8A 1T03A 2YWFA 1UVLA 1M90T 2VQFF 3DCAA 4ETXA 3KHRA 5CXTA 3DYAA 4O23A 1J2VA 2ZM6F 2JHEA 2R2TA 1U1OA 5D3GA 5K5MA 3G96A 3THVA 1IQZA 3L09A 1UEUA 1YJUA 1RT4A 2CIMA 3DLGB 3CE8A 4J9KA 1KLNA 1WF1A 5C24A 2KT5A 4ED0A 3OTBA 4K50A 4OL8A 2YNGA 2AYEA 2XZWA 4I6WA 4ECWA 1AFJA 5IFMA 4O3RA 3N6NA 2F7VA 3K2YA 4JV2A 2J7UA 3PJWA 2UVRA 1WHVA 3ISNC 4OHZA 2MKHA 1IBMF 4ZP7A 1LQ9A 1HW9A 4Q0BB 4HLBA 4EWTA 4C2MA 3H4DA 1KTQA 4IO1A 2PA8D 2AGPA 5J1NA 2LXUA 5D4LA 4EGLA 4FF1A 3PJXA 1F5AA 3H5SA 2IVFB 1NHUA 3DRPA 5G0RB 4UQGA 1SB6A 2NS1B 4G3IA 3UWTA 5E3AA 2DGOA 4LVOP 4TNOA 2F4VF 1U09A 5HP1A 1Q8BA 4Q8FA 3VZIA 4DL2A 2OMLA 1S9GA 1VQSA 2R7UA 3J7YU 2E1MC 1JKHA 2IVYA 3E01A 4Y65A 3SMZA 1CC7A 2K1RA 1CG2A 3RAMA 2J5AA 1ZTWA 1IKXA 1YJ9S 3L3CA 1DLOB 1YTYA 3QYYA 3KK3B 3VAFA 2JFDA 4DV7F 3EXCX 1JLQB 2DITA 4C11B 1ZM2A 1QE1A 1TL1A 2DNKA 1GTEA 1ZOTA 4CNZA 1VK3A 4PG8A 1RTDA 2X1FA 2E44A 2ADBA 5H9FJ 1JLFB 1QUVA 4DPOA 3C6TB 1C0UB 3FSXA 3TR5A 1N8RT 3DC2A 4PXBA 1XMBA 1Q78A 2VBXA 1EP4A 1R8PA 2VG6B 4FVCA 4FF3A 4C9DA 4ECXA 5I4MA 1LW0A 3PVXA 3L95X 1HQUA 2B5JA 3OL7A 4LSLB 4OJ1A 2HFNA 4EBEA 2CQBA 2JWNA 1VIXA 2OPPB 3HHEA 3P96A 4NLQA 5CYMA 4XPCA 1BQXA 1YQHA 1I6JA 4WKYA 2JLEA 3M30A 3T1AA 5HMYA 1JMTA 4XPEA 1N6QB 4NX9A 4OQJA 4MIAA 4A4JA 3MUTP 2B6AB 2DIUA 2DO4A 4KE5A 1WHYA 2V9KA 5K9FA 2Y1IA 3JSMB 2HNYA 5CYJA 2C2DA 2GCFA 3VAKA 2PT0A 1V6HA 4F4KA 3TRGA 5I42B 4KT0C 1L5UA 2D1CA 2IBOA 2AYMA 2DH8A 1U47A 4WXWA 2HNDA 3I4HX 3UNGC 2RF2B 2YKNA 1HPZA 2N3OA 3TOQA 2AGOA 1FJGF 2QA4G 3N01A 4YB5A 5EX0A 5M2PA 4YR3A 4ES2A 4KHMA 1LOUA 3TUIC 2V94A 2OTJS 4BBYA 1U7LA 1UWBA 1S1WB 2GC8A 1HBOA 3F56A 3FMBA 3W7BA 3KOAA 3TA2A 4DV0F 2J9DA 4A47A 2HS4A 2ZZMA 4HT7A 5EX3A 4OI4A 1LWFB 3H2LA 3OPKA 2H5EA 5CD4H 4ATNA 5F3TA 3SCJE 2BR0A 2ZD1A 4ITSA 5GVQA 5DS7A 5SZTA 2W9CA 4CNYA 4WYWA 4A8YA 2HQIA 2QT7A 2AV5A 2X3GA 3CCZA 3MM9B 3CJKA 4A48A 5CH7B 2KYXA 2XMVA 1RP5A 4Q43A 5DGAA 1MNEA 4DFKA 1B0VA 2PGCA 3LGMA 3GFZA 2BE2B 4I67A 2FVQA 2DRAA 2XSFA 1T8EA 2LDIA 1S1VA 4ECQA 2P6SA 2NSBA 1U1NA 2L41A 2AYGA 2LDYA 1LWEB 1XNQF 4PG6A 3Q0AA 1Y5LB 4J9QA 1T05B 5AXKA 3VZHA 3HZGA 4I6YA 2OPSA 2HW3A 1UVMA 4X62F 3DOKA 2RNEA 1J5OA 2R7RA 2FHJD 1TV6A 1QAYA 1WEZA 2I0XA 3DHXA 4ZLPA 1VQLS 1ZTTA 1F9FA 4E98A 1HWIA 4IOCQ 2QZ8A 4DSFA 3VTIA 1R3NA 2FDNA 2DGWA 2GJIA 2YNFB 5KT4A 4TU9A 1E6YB 4LSNA 3OTCA 1UVKA 3IWLA 1SV5A 5C42A 1H7WA 1FKPA 3M8QA 1KSPA 2VZ9A 5DQHA 1WWHA 3LP0A 3CDEA 4DV1F 1NK8A 1JWWA 4CTAA 1DZ5A 4O0IA 3GIJA 5KFYA 1X4BA 1OO0B 1DHMA 3PM9A 4NPOA 1RYRA 2MSSA 1XMQF 1T03B 4TN2A 3H20A 5SUHA 1DURA 1MMNA 2DISA 2IM3A 2LXFA 3ENQA 3MM8A 1Q1KA 4J9LA 3RAXA 1OS5A 5D3GB 2HLUA 2XBPA 1UEVA 2JL9A 3Q8RB 2VOPA 3UE2A 4PWDB 4K4WA 1IN0A 2LEBA 3GG1A 3M4XA 3BSNA 2O01C 1V3ZA 1VQ9S 5C24B 2VL1A 4CIOA 4QWAA 2YNGB 4B3OB 2JLFA 1VGYA 3I9ZA 1QLNA 5DJBA 4QPXA 1HI0P 3NCQA 5A0YA 4RWWA 5EWEA 3S6EA 5F8MA 3M1VA 3AH6A 4WYLA 5KFCA 2YKQA 5GADI 3OLBA 3P49B 4Y3CA 3OQ2A 2HHPA 3JTNA 3QZ8A 4BWMA 3TVYA 4F4WA 3DRPB 4DS4A 5J2MA 3X1LB 3BDEA 1B64A 4RUHA 2NZ4A 3WDOA 3G6XA 1YHQS 3N0VA 1SH2A 4B9UA 4F3MA 4RWXA 3D5MA 1S6QA 3IRXA 3OL9A 4FF2A 1FESA 2YKMA 7FD1A 1S9GB 3M9OB 2ATLA 1OPIA 2XGPA 1JKHB 3DGPA 3E01B 2KDOA 4FS1A 3FEZA 4X2BA 4ED6A 2UV8G 3Q8SB 2K1RB 4AXIA 3Q23A 4B9LA 2GO9A 2ZHBA 1EETA 1IKXB 2PDAA 2ZE2A 2X1AA 4AL7A 4HTIA 1U48A 1B7FA 2GV1A 2B7CB 2I8EA 3GE9A 3H8YA 1QE1B 4QWDA 4E8UA 2ALZA 2KJWA 5F9LA 4OJGA 1AUDA 4G1PA 5E3RA 5DDRC 1E6VA 2HZCA 3BO4A 2BUNA 1RT5A 2UUAF 2HS0A 4DF4A 4O44A 3HVAA 4NLYA 2IM0A 4ZPWR 5KFBA 3GV7B 4NCBA 3UDCA 3CVKA 2FHOB 2AJ0A 1Y4ZB 2M52A 5F8GA 1EP4B 4QBUA 2ASDA 3ITHA 1YG0A 5KTQA 3DOLA 4DQRA 5KG7A 1LW0B 1BY9A 4OIXA 5KG2A 1HQUB 1ZAXA 2B5JB 3MPVA 3OTEA 4CQ1A 3V6HA 2YH0A 1KFSA 4J37A 4DV2F 3EGNA 5CYMB 4NXMF 3K7RA 2QSWA 2N7CA 2XULA 4ZP9A 3OFEA 4KFBA 1VQ5S 4ERDA 4C98A 1UETA 3NAIA 3SSRA 1X9MA 2AWZA 5KG1A 5EWFA 4DN9A 3LGNA 4HYKA 3T5HA 2RQCA 4IH6A 5AE2A 1QJHA 4ELVA 1DTQA 3OSNA 2DIVA 2MQMA 1R0AA 3HJFA 1YSJA 2DPJA 2FJAB 2EG1A 2FHJA 5B0GA 1HWKA 5IXUA 1NKBA 4GKJF 3BGFA 2HNDB 3V2UC 2YKNB 5KAKA 1HPZB 1U8SA 1VLYA 1TK0A 4NLGA 1NK5A 1SJQA 3UPFA 1AROP 3JB9k 1FVSA 1ZM9A 2L3MA 3I6PA 3NGDA 1A7GE 1VS3A 4WU2A 3HXMA 3MEGA 4QIEA 1H0HB 5KG5A 4MK9A 2XWXA 1LK7A 2HG4A 5AE3A 4DQPA 1UWBB 4X66F 1FRXA 2DJWA 3G9CA 1REVA 4YB1P 4F2RA 4NLVA 2M4MA 2NUUG 3CCES 4EBDA 1NRKA 3IWXA 5KOXA 2ZD1B 3N5FA 2BRLA 3ISND 1NJZA 2W9CB 4EBCA 4HHJA 2QIFA 1U26A 4W92B 4DUZF 2DGQA 1L3SA 3PKMA 2GJ2A 4HDGA 3V4MA 4JUZA 3MUMP 3M8PB 3QAUA 3SCLE 2FVSA 3CDAA 3IO1A 1YJTA 5HL7Q 3K8VA 3BQ1A 2BJDA 2B4PA 2ZKTA 3DM2A 3KMQA 4C3MA 1MU2A 2RU9A 2QV6A 2GFFA 3DOKB 1N5QA 1J5OB 1S0MA 5HMWA 1TV6B 2DNOA 4YMEA 3ZZUA 3Q22A 4DV4F 3B4DA 2HIQA 3CXCR 4IOAQ 2VUGA 3W2WB 2MB0B 5B0BA 2YQ3A 1S99A 4ZPDA 4R8UB 1X4CA 5GAEI 3RRHA 4RNHA 2M5YA 1XBWA 1GXLA 3UD3P 4LSNB 3PO4A 3WC0A 1SV5B 1LKZA 5IQQA 3H25A 2IHR1 5GAGI 5B08A 1NH7A 4NA1A 4CTAB 2CFXA 5CA5A 4RW6A 4YR0A 2XY7A 2PI5A 1L3UA 2VASA 1LXJA 1NNDA 4FPRA 5I3QA 3MM8B 3HVWA 2CPZA 1FRKA 4QQBA 2J8AA 5BYQA 4IFVA 2VB6A 3C3LA 3SQGB 3CCWA 3DI6A 1RA6A 2HMIA 3PIOQ 4E0DA 1FJEB 2B9WA 2WOMB 3I0SB 2E5IA 5KG3A 3JYTA 3U02A 2ZZNA 3THPA 4BC9A 5A0YB 3GQCA 4IG3A 2MKJA 1YIJS 3Q2TC 3X3UA 3MPWA 2XMKA 3M1VB 4N5SA 2MQPA 2AGQA 4C3LA 2M0GB 3ULHA 3PKYA 1JLCB 3PRBA 4MH8A 4Y6IA 1S6UA 4NYOA 1KEKA 2BYCA 4X4SA 1Q53A 3DXSX 2EFNA 4DJBA 1SL1A 4N56A 2VD3A 2E29A 4OLPA 3RW6A 2ZH6A 4ECZA 4KAIA 3SI8A 1S1TA 1S6QB 1WI8A 1X4DA 2MZSA 1HWJA 2VC0A 3IRXB 4MIBA 1K0VA 3PFEA 2YKMB 2XY6A 3CC4S 4DSEA 1GXTA 1NH8A 2FJEB 5KFLA 6FDRA 1QSSA 4KR0B 4QIVA 4X4RA 3EPGA 2ZDOA 5C5JA 4A8XA 1LW2A 1VQKS 2L08A 5BJRA 4H4MA 2LMIA 2VPXB 4Z2XA 2ZE2B 1LXNA 3V4IA 1N0UA 2DO0A 2FVRA 4NCGA 3IWNC 4QR0A 4X84A 1V9OA 2IJNA 4A8SA 5DG9A 3OVBA 4DMZA 4DR2F 4F25A 2D3UA 2DRBA 2MHNA 2VFTA 2Z2LA 2PSZA 1E6VB 2KI2A 3C66A 1NK9A 3RR8A 4F50A 3SFGA 1AFIA 4O44B 4Y0FA 5F8LA 4ZPCA 5KFAA 4QU6A 1FRLA 1DJ0A 2DNRA 1RQ0A 2ZDPA 4A46A 3DOLB 2VV5A 4QZVB 4DV3F 2OSQA 2LA6A 3SDEB 4DHVA 5KFZA 4AYBD 4YR2A 3NCRA 4X65F 3CDWA 2CQCA 4J9PA 2ZH5A 4RNNA 3G71S 1QVFR 4O4GB 4DL7A 2KO1A 4KFBB 3MURP 4DFJA 3AA8A 5IZHA 3R5AA 1F0XA 1XWLA 2B51A 5CHCB 4CO2A 2ZBIA 2NREA 4V19X 1TP7A 2YWKA 4OX6A 1SIWB 3T3FA 5E41A 4V19J 1O5JA 5MLCV 4PPZA 1UVJA 2RRBA 1FT8A 5LJ3Y 3KK1A 4FBUA 1DTQB 1RISA 4JI6F 3EYZA 1R0AB 4KPYA 5DG7A 1TAUA 4UY85 4OLOA 5M2RA 3LF0A 4TU8A 2KB2A 2WTFA 1FRMA 4O3OA 3W2VA 3QO9A 4Y2CA 5L1LA 3T5KA 3PX4A 2PI4A 5CCLA 1LWCA 2UVUA 4C97A 3QMQA 2RS8A 3MEGB 1WEXA 1NZAA 4ZKAA 5DRKA 2LQJA 3RBDA 2ZH1A 2JVOA 3HKWA 5THWA 3TVKA 3EPIA 1UFWA 5A8RA 5I3UA 5IT4A 3MDFA 3SXLA 3DMJB 2F8MA 1REVB 4ZP8A 1TK8A 2W8KA 3VF0B 1VQNS 1TKZA 5KFPA 2RRAA 3CJ3A 3KLGA 2JH3A 2VA3A 1OWXA 2BA9A 2D3ZA 3AQPA 3J7YI 3UD4P 1DBDA 2RILA 1Y3KA 1APSA 3I56S 1X0FA 2HHUA 2A10A 1FXDA 3SEOA 2BV3A 4NLWA 4OI3A 1FKOA 4OFZA 4X4TA 3TAMB 2WRMA 4BDPA 2XB2D 4NRUA 1NKEA 2RU3A 3N5BA 2W4PA 3C46A 1CPZA 2VFUA 1GXUA 3KYLA 1FDAA 3KHHA 4BS2A 4URGA 5J2QA 2AJFE 2FHKA 1RTJB 2EFPA 4JYAF 1HL6A 2B43A 2P9EA 3DM2B 3MD1A 2MQQA 1NK6A 4FBTA 1X7VA 3HDSA 4KRWA 1IM4A 3MCSA 4B3TF 2Z2MA 2GIQA 3RU0A 1KFDA 2V2KA 4DBQA 1FTRA 1URRA 4Y2KA 3H98A 1FD2A 2XWYA 5F41A 5DG8A 2EFOA 3GILA 1X9WA 2Q43A 3P6YC 1DFDA 2YNIA 1TAQA 1PILA 4DV5F 2IBKA