1PC4A

Crystal structure of the p50a mutant of ferredoxin i at 1.65 a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECAAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms of redox-coupled proton transfer in proteins: role of the proximal proline in reactions of the [3Fe-4S] cluster in Azotobacter vinelandii ferredoxin I
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
molecule keywords Ferredoxin I
total genus 32
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2003-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pc4A00
1BQXA 1JNZB 3IR6B 1B0TA 3MM9A 2FDNA 2C42A 1F5CA 1WTFA 1D3WA 1B0VA 3MM7B 3EXYA 2Z8QA 1DAXA 2VPWB 3EUNA 1HFEL 2FD2A 3MM5A 3MM8B 2WSFC 1VJWA 4YDDB 1FTCA 3MM8A 3EGWB 6FD1A 4OV1A 2GMJA 3HKZD 1KEKA 2ZVSA 2C3UA 2V2KA 1H7WA 3OR2B 1FRJA 1FRHA 1BC6A 3LW5C 3MM6A 2WAQD 2PMZD 1FRKA 1JNRB 2XSJB 1XERA 1FDAA 4XK8C 1C4CA 1RGVA 3C8YA 1FDNA 3MMAA 2O01C 3MMBA 1FRXA 4KT0C 1FCAA 1SJ1A 1DURA 1ROFA 1FRMA 2WSCC 2FJBB 2FJDB 1SIZA 1H7XA 2FJEB 1BD6A 1BLUA 1IR0A 1IQZA 3IR5B 1GTHA 4OMFG 2WB1D 1FXRA 3MM5B 1FF2A 2WSEC 3PNIA 5CH7B 3MMCB 5CHCB 1H0HB 2FGOA 3GYXB 2FJAB 2C3MA 2XSJA 5L8RC 2VPXB 7FDRA 4ID8A 1Y5IB 4Y28C 4CI0B 5BYSA 1GAOA 3MMBB 5FD1A 4AYBD 1F2GA 4L6V3 1FDDA 1FEHA 4DHVA 1DFDA 1K0TA 2UZAA 1Q16B 1PC4A 2VPYB 6FDRA 5E7OB 5BYRA 2V4JA 4XDDA 2IVFB 3OR1A 1F5BA 1Y4ZB 2VPZB 7FD1A 1GT8A 1FERA 1G6BA 1R27B 1PC5A 2V4JB 1FRLA 1GTEA 1B0PA 1Y5NB 3MMAB 1C4AA 1FRIA 1BWEA 2C3OA 1FDBA 2GMHA 2PA8D 3IR7B 4XDCA 3MM9B 2Y0SD 1FXDA 2C3YA 1KQGB 1FD2A 3OR2A 1Y5LB 1AXQA 5BYQA 2PDAA 4RKUC 1JB0C 2C3PA 3OR1B 1CLFA 3MMCA 1H98A 1G3OA 3MM7A 1KQFB 1A6LA 1SIWB 2VKRA 3MM6B
chains in the Genus database with same CATH superfamily
1CJUB 1SV5B 3FK4A 3JSMA 3IA0A 4RW7B 4NEYA 3NNCA 2Z2ZA 1MROA 3RR8A 2G1DA 3V5RA 4LFBF 4YB7A 4ZDNA 2HWIA 5HVGA 4JI6F 3QAUA 2CVIA 4IO1A 1V3RA 1NM2A 1N0UA 1B64A 1UP1A 4RNHA 5FLXY 1U49A 4M5LA 1DLOA 3T19A 4F26A 4EEYA 5KG6A 5DS7A 3GJSB 3R7BB 2WCXA 5A8KB 5IM0A 3V6KA 1RAEB 3K89A 2KT5A 2B51A 3IWXA 2RNEA 2B5JB 3SEOA 5ITHA 3VCDA 1NPPA 3PZPA 2H54B 2J6TA 4DV5J 4OLPA 1KTQA 3KG4A 1MWZA 1ZM3A 5KFGA 5HQ8A 3A3NB 1L3KA 4L75A 5C25B 1RT3B 2RE1A 5GMEA 2MXYA 2PO4A 1U1PA 3ETOA 3D6TB 3SFGA 4MFBB 1O6XA 1M0SA 3LA0A 2QMWA 4DEZA 2ZM6J 1GMWD 1F9FA 2DNYA 4Q7AA 4F50A 1HI0P 2AJQA 2YX7A 4ZMMA 4JI3F 4DR1F 1Q7LB 1N5YA 5D4OA 3AFGA 3V4IA 4JI0J 4LIWA 2W9CB 5I3UB 5CYQB 4C3KA 2R2RA 4CT8A 5EX0A 5KFMA 5DM7Q 2AJ4A 2FZCB 1RWWB 4KHMA 3TVZA 2V4QA 3G86A 2NYIA 3D6HB 3CMQA 2ZD1B 2MSTA 3NNHA 4EU0A 3DYAB 3M8QA 1R31A 4OMFG 3RRHA 3CCUS 2RF2B 2XGQA 2AZ1A 3JQJA 1FO1A 2VG7A 1HBMA 3AHPA 1ZPWX 3KHLA 4G65A 2ASJA 4CLUA 2H4WB 3CWJA 3JS9A 1TR0A 3OFEA 3W9IA 2ZBPA 4RUBA 3OD2A 5BYSA 3FFIA 2H5IB 5M2UA 3C6UB 1X5OA 1N6QA 2PMHA 1N0VC 4DUYJ 5J1EA 4LVOP 3ENVA 4RU9A 3LWLA 3BYRA 4I64A 4AUKA 3K59A 4P10A 4DPUA 1OQ3A 2BE2B 2CJAA 5KFVA 4JI4F 4CZCA 3FEXB 3EVMA 4DR1J 3HDSA 3J80Y 3D0HE 3PYGA 3TRGA 4ZP7A 1F0XA 2B43A 2ZUGA 3QQCD 2E1CA 5D0HA 2Z2YB 4QU7A 4ZP6A 4OZ2A 3UCUP 5JVHQ 4FN5A 3QZ8A 1NDCA 1SKUB 2XY5A 1QAIA 2OPRB 1GMWA 2OD4A 3HSZA 5IQ6A 3C14A 4GKJJ 3MMJA 4Y2AA 2KG1A 1ZAWA 2PN6A 1S99A 2R7OA 3IRXB 4RZRA 2E7VA 3ISZA 1MMDA 2ZWOA 4HACB 2R8GA 4OYMA 2K7JA 4K0KF 3TA0A 2VH7A 3M6VA 3W2VB 2E9TA 2BZ2A 3MPDA 3DHXA 2CNNB 4KAIA 4RW9A 5IS2A 1RWUA 4HHHA 3SQGB 3R9LA 1SVDA 3C16B 2XY7A 3PVXA 1TL5A 1VQNS 5IT9U 2OH2A 4DZ6A 2MKJA 2C3PA 1NZ8A 2PFDA 3HVWA 1N48A 3HD1A 1VGYA 4USHA 5K5MA 1TFYA 2BM1A 3HM9A 4ZJQA 3FQKA 4KV8B 1G7CB 1RT5A 3UPFA 3OL8A 5B0CA 2R7RA 4QCLA 2GJFA 3W64A 1LXJA 5B0EA 2GIFA 3MWBA 3OVAA 4EK2A 2EXUA 2HYIB 2FJWA 1HNVB 3CW2C 2ERRA 2B9WA 2G2YA 1RWVB 3DLJA 3I5AA 4NRTA 2VKRA 4ECYA 1HW8A 3S6EA 2OKQA 3PEJA 1H73A 2YX1A 3MR7A 4DPTA 4CO2A 4X64F 2DPJA 2MZRA 2VJUA 2NS1B 2DRDA 5GAHU 1AB8A 4TY9A 3TJ8A 2VONA 2YVSA 4B9UA 2HVZA 3OHAA 3NP5A 1SQGA 4OZ3A 2GJ2A 5HBMB 4OX9F 1YITS 1ULRA 2QLXA 2DGWA 1VQ7S 1RAIB 4QPXA 4OI1A 1C0TA 4I6AA 1P27B 4XAKA 1DTQA 5K8MA 3R1LA 2R7QA 5KFQA 2RAQA 3CF5Q 2XMVA 1ICEB 2HFVA 5SUHA 1F3FA 4IR1A 1KEKA 2XS5A 2KZZA 4MJKA 3UNYA 5CYMB 3OJUA 1S1TA 4ECVA 1KLMB 1YRXA 4PPDA 3NMRA 2XYHB 1OSDA 3M8WA 2CKWA 1RCOB 4P75A 3AODA 3Q8VA 4E2FB 4LF9F 1RYRA 3BQ0A 4I2QB 1RWPB 2QA2A 2W9AA 1U1RA 2GHWA 2WBRA 5F8NA 3OXLA 4UT4A 2QC3A 3FCVA 3TAMA 3C8YA 5EWGA 1U0HB 4BWMA 5GAGI 3O44A 4JI2J 1IM6A 3NCPA 2HNDA 4ECSA 1DQ8A 2LEBA 5KFBA 3A3PB 3H0PA 5HMZA 2WVEA 4HL9A 4PRFA 2XMAA 1SJ1A 4IG0B 1PAEX 1WHWA 4QIFA 1XBWA 2BANB 2QA4G 1D09B 3WDOA 3V81B 2CRLA 2Z4PA 2V6AA 5DZ7A 4YUDA 3OL7A 3IR5B 3MEDA 4CRJA 1WF2A 1VQYA 3DRPB 3VVTA 1T05B 1XMBA 5AXMA 2IJRA 1JLFA 2CQ3A 4ES2A 2AEMA 1HNIB 2CQIA 2HRUA 4HVZA 3T1HF 1Z2ZA 3ZC4A 2M9KA 4R5PB 4TXSA 5IC4B 3OL6A 2A18A 3HSJA 1Y5IB 3M8PA 1XWLA 3EJMA 3FCWA 3P4UB 4RBUA 2DR7A 2QG9B 3R2DJ 4UOCA 1KC8T 1WEXA 3DXBA 3RBXA 2I9SA 4NMXA 4TN2A 5BR8F 2RRBA 3V4IB 1DJ0A 1QE1A 1F2GA 1CS4B 2PT0A 3HHEA 3BO4A 5DRKA 1T0TV 1SKSA 4B3SF 4W92B 2J9DE 2XO6A 3I0SA 3R5JB 4DUYF 2C2ZB 5F0UA 3VAHA 1Q78A 2ZD1A 4OYIA 4PWWA 1PYSB 3D66A 5JJBA 4YY3J 1V3ZA 2GGPA 2BRLA 2ZVIA 4ZVQB 1SH3A 2LYVA 2J8SA 1NEEA 4Q2MA 3ZZ0A 1GXUA 2OTLS 1XNQJ 2MHEA 3QO9A 4H54A 3MOZA 4W4MA 3DRYA 1PILA 1R27B 5HP1B 1CJKB 1LWXA 2A6MA 2H9ZA 3LUYA 1TFWA 1IKXA 3DXSX 3OSPA 4HDHA 4M5DB 4OJGA 2HHPA 1XEZA 3PYEA 4B3RJ 2XWYA 2DNPA 4EZ6A 1FRIA 3PRDA 5FIIA 3M4XA 3A8EA 4N56A 1NPRA 4OYPA 1DLOB 2JLGA 7AT1B 4OIXA 3ET6A 1S9EB 2BJDA 1KWMA 2C1EB 4UOFA 4WIQA 3AOBA 1UL3A 2D3ZA 4LSZB 3J81j 3OL9A 3M9OB 4FNHA 4Z7CA 2FB0A 2KHDA 1X9MA 4OYXA 4A46A 4KE5A 3H40A 1R8CA 2N82B 3V6HA 5CXTA 1LKZA 3VHQA 1JLFB 4H4MA 5DGAA 2BOAA 2RMLA 4DX7A 4K4VA 1FJGF 2V5HG 2IYGA 2BJ7A 3NAHA 5LOQA 1S59A 2CPXA 2ILZA 3A8IA 2GJIA 3KFWX 4USUA 3TUJC 4B02A 3W9JA 4ZCMA 3JAMU 2FZGB 2OEJA 1Y10A 4P7TA 4Q45A 4YB1P 3NGTA 1Y0HA 3DRSB 1WOOA 4F0HA 3K0JA 1RU1A 3CDAA 2HW3A 3PYDA 1K44A 2D69A 3FC9A 2MQLA 5KFLA 4C0OC 1VBZA 2WBMA 3UDLA 3MHYA 1JLBA 2PE8A 1CJTA 3K17A 5F8LA 1DRZA 2B4OA 1SJRA 3SQGA 2ZJPQ 2HHTA 2P5VA 5D15A 5D3GA 1S57A 2HNYB 4A4JA 2XHCA 1S12A 2OPSA 3DLKB 5E5NA 5KOXA 2QFJA 4LRAA 1NJZA 1PO6A 5KG0A 2K7KA 2H3EB 2VZ9A 3BPSP 3JSYA 3W60A 3I31A 2L9NA 4DX8H 3VAJA 2V2KA 3QGIA 2KDOA 1T02A 4ZPDA 1KR4A 2GVDA 4EYHB 2DCLA 1M5PC 2OUGA 3D6MB 3KLIB 1FTRA 2ZBQA 2I8EA 3UR3C 3M2UB 2JNJA 3D1QA 3UFCX 3DRXA 1FRKA 3CDUA 4L73A 5ETOA 1VQ5S 3ITHB 4UUWA 1JJ2R 3VQSA 4IFYA 1Z1ZA 4LF4J 2QX0A 4BHQA 2HEKA 3ILLA 3Q86A 4M63A 3HKWA 2FHMA 4KKOA 3MMBA 1R0AB 3BM7A 2Z57B 4ED8A 2F8HA 5JXSA 2YTCA 2C2EA 1AUDA 4X66J 3BBBA 1D8ZA 4IH7A 4EFAC 1NJXA 4WF9Q 2VQFJ 3UO0A 3KYLA 1FRMA 1OJ4A 2IFXA 2NUHA 2OSQA 1TMMA 2V94A 4LRCA 4N7TA 4U7UK 3CO0P 2CADA 2KT2A 5GMDA 3MFHA 2VFSA 1BLUA 3M1VA 1J27A 1WHYA 3D1HA 1EP4B 5C5JA 4F0KA 3D5MA 3RBZA 2F9JA 2AHOB 3WIVA 1E6VA 3LP0A 4G1IA 2F63A 3NY0A 3D67A 5L8RC 2IM1A 4FKXA 3AAWB 3K5MA 1YTYA 4O4GA 3KTQA 5HLFB 1TZ0A 4OQJA 4ID8A 4B9VA 2Y8YA 1VQSA 5G0RB 3CNQP 4RW6A 1VRQC 1N5VA 2EFPA 4EI2A 2UUAJ 4B3OA 3HT0A 3ZZZA 8ATCB 3GV5B 4KO0B 4CYUB 1RT4B 2EK1A 1VK8A 4M5NA 3CE8A 5GAEU 4ED7A 2G9OA 1YJUA 5K8OA 1TKZB 5D4PA 1WJ9A 2QLJB 1R8BA 2GVZB 1C1BB 4DR3F 5KOWA 3MEDB 3DM2A 1R8PA 4JI2F 2UXBF 4E98A 4TQRA 3KK1A 1NH7A 1QY7A 1GT8A 2YKQA 7FD1A 1YIJS 3GV7B 1YBAA 2B9XA 1VBYA 1S1VB 5C25A 4IH5A 2KHCA 4QWDA 2UVUA 3M8SA 4URQU 1WHVA 5HQMA 1S1XA 2BACA 4CLKA 2DTJA 4O23A 1Y5NB 5I42A 5F9LA 5CAAA 1FNMA 3MMAB 4KGVB 1OMSA 1TUGB 2BE9B 4F7VA 2R9LA 2VICA 1VBXA 2AGQA 3THTA 1YZ7A 2VFUA 3HO1A 1ZM2A 3UN5A 2JFDA 4LFAJ 1IN0A 1QSLA 1EETB 1S6QA 1TL1A 2E5GA 1IR2A 3UCZP 5LSLA 3I9V9 2CUYA 4KGZB 4DLGA 4EYIB 1MNEA 1WC5A 2M5YA 2XC9A 1DQ9A 2VOOA 3N0VA 3E01B 4A8YA 1U8SA 5HAOA 2LA6A 4P6QA 3FMBA 3JQMA 4U8VA 2C2MB 2DCUB 4ECWA 4KGMA 1UVNA 2OELA 2YWEA 3DFEA 3IM8A 1CLFA 2DR5A 1JQGA 2LEAA 3AD8C 4ZP9A 1LW0B 4OZNA 4LREA 5ETQA 3WC2A 2HS0A 2M3DA 2RILA 3ADAC 5K8PA 4LF5J 4QU6A 1REVB 2AIRB 2UUCF 1QAYA 1NUEA 1UEKA 1KVIA 4K4UA 1VC5A 5KFZA 4HTIA 2UUBF 1K73T 4YOEA 4RW8A 2I2YA 1N54B 5ADZA 3BEGB 4ZPCA 3UDEA 1CC7A 1CJVA 4NLTA 2GHPA 4M5GA 3MR3A 4F4ZA 3DOKB 3P5BP 3PIOQ 3BPDA 2BJ9A 3D6FB 4NLWA 3HD2A 1QM9A 4RO0A 2DGSA 5D77A 4JUZA 4ANDA 1OY8A 2CPFA 4YHHJ 2LP4A 4NZ6A 3MM5A 3MM8B 3QGHA 5J2PB 3UD3P 1IJEB 1S77D 4F0MA 5G4DA 2ZZMA 4H4MB 3EGWB 3MECB 1FE0A 4OZJA 4F4YA 3HKZD 2J5AA 1R3NA 1TKXB 1WKJA 3NBPA 1S1TB 3LP2B 1FVQA 2VASA 3FBFA 4ELVA 4F4WA 1Q95G 2YX4A 4NLOA 4ALZA 5JVGQ 2ADBA 4P2FA 4RBVA 3FZ2A 5A8KA 3VQTA 4OL8A 2WAQD 2JEIA 3RZAA 4QYZJ 1X4GA 3AH6A 3IRXA 3OTDA 3R3TA 1YVFA 4RL1A 2NXUA 2CPZA 2VL1A 1HARA 4O3PA 3BV8A 1NHVA 3HXMA 2ZE2A 4DV4J 1VC0A 1WG1A 4PQUA 1TK0A 2ZH4A 1IKVB 5LSRA 1IR1A 3PEHA 1AROP 3LGMA 3K5LA 3R5AA 1S1WA 5JMNA 4P7VA 3GQCA 1UA0A 4OZLA 3UN2A 1APSA 2NSCA 2MGZB 1VYAA 5L1KA 1SIZA 2KFYA 1XR7A 2BX6A 2KXFA 4Y2CA 4NLYA 3J7Z5 4DS5A 3IO1A 1CQNA 2DHXA 2JHEA 1JLGB 4V1Ak 2DISA 1NK7A 3FFIB 3OXGA 3GJRB 1UFWA 5CHCB 3AB2B 4FXWA 4X62F 3VTIA 1WDDA 4Y34A 3UE2A 2R8KA 1U47A 1RYSA 2AEFA 2J0QD 2LCWA 3T5JA 1CJVB 4CIOA 3EDQB 4DQRA 4M5MA 3M8PB 3IN5A 2ZOFA 4OJHA 3TVKA 3Q83A 1WEZA 3MEGB 3FEZA 4NCBA 2ASLA 5J2QA 2UV8G 2LA4A 2A1BA 2E9RX 4IG3B 3TQ1A 2IA6A 2MSSA 2VB6A 2COLA 3DLGB 1U02A 2JDJA 4DR7F 1XN9A 3TAQA 1UTAA 1F1BB 3Q8SB 3DYAA 5FLXU 4L74A 2MKIA 4NYZA 4C8LA 2HBQB 1PBAA 1IBLF 3B4MA 3D2WA 4P9SA 2N3OA 1FERA 4DR5J 1JLQB 3V2UC 2LXUA 1S9GB 2HKEA 1U0HA 1HWUA 2E5IA 3TAMB 2GMLA 1KS2A 1FNOA 1LWCB 1YQHA 3NOGA 1FFWB 4K5RA 5F8HA 4UQGA 3KK2A 4ZS6A 4ZVOB 3TUZC 1J5EJ 2FLPA 1BWEA 1IWAA 3HF5A 1U2CA 2GMHA 2H48B 2PA8D 3DLKA 4KC5A 3MM9B 8AT1B 5AJ3F 4QR2A 1FXDA 2GNKA 3KMSA 5IM0B 3EPIA 4PG7A 2DY9A 1XMOF 2JLFA 3BKUA 3L7PA 5FDLA 2HBRB 1SI9A 2B4VA 4NYPA 2G0CA 4QIWD 4WP9A 3CD7A 3KK1B 2W1BA 1Q0NA 2RRNA 3MMCA 1HBNA 1VLYA 4YEAA 1H98A 4PG5A 4ZJOA 2MZJA 3T1AA 4ETXA 5HO4A 4AQYF 3CSKA 4FF4A 1M1GA 4QJVA 4WKYA 1M5HA 3VR1A 1KLNA 3PG9A 4AQYJ 3B78A 1UWAA 1LW2B 4ILLA 4RWXA 4MTPA 4MK7A 5I3UA 1SPBP 5IT4A 3A8JA 1B0TA 2Z2MA 2LQ9A 3LAMA 3MEEB 1V5IB 1TTHB 1RZMA 2YPZA 1UJ5A 1ZPVA 3I0SB 2UUWA 4RU2A 4XTTA 2XULA 2LKZA 1JXVA 2ZBCA 4U96A 3SZ2A 1AA1B 3HLUA 4C8ZA 3ZXWA 2HQFA 2IDLA 1IBCB 4YDDB 5ETRA 4J37A 2KRBA 4YHHF 3OTCA 2QN6B 3FBCA 3VV2B 1U48A 4B9TA 3D28A 3UD4P 2ALZA 3BZQA 4ZLJA 4AE5A 4ELTA 2DIVA 4PEOA 3KJQB 1NDLA 3CD0A 4DQPA 3GWCA 3PW7A 4WE1A 2D3OR 1IKXB 1OS5A 1CULB 1REVA 2KXNB 5H9EK 3H2LA 1W2BR 1SL1A 3BDPA 2F7VA 3IBFB 4CWBA 2KO1A 3SCIE 3BR8A 1I1GA 4FYVB 1FDNA 5CD4A 1GMUA 4ZN3A 1HWIA 3RG6A 3JSMB 2CWXA 1NHUA 3P3DA 2R7SA 1TAUA 2DGVA 3OW2R 2UUAF 1DARA 2MTLA 4J9PA 4MKVA 1TQLA 3J7AN 4FVMA 1SBRA 4G3IA 1S1UA 3R5DA 5HATA 5DLGA 3DOMA 3PW0A 3HK2A 1J5OA 4BDPA 1H7XA 1JXEA 2FJEB 4DUZJ 2HFOA 1KQSR 3KJNB 1IQZA 1QTMA 5HMXA 3QNWB 3DOLB 2NPIA 3Q8PB 2HVIA 1AW0A 2UXCJ 1FF2A 2YH0A 4M5KA 3NGKA 4U67Q 1U45A 3G2XA 1N8RT 2C3MA 3PW2A 2GO8A 4XO0A 1RTIA 2UVWA 2KG0A 4I7FB 4KPYA 2IRXA 3PX6A 1WD6A 4HI1A 4QWEA 3OJSA 3TWZA 1WTBA 1BE4A 2E5LF 1R7IA 2QL9B 5CA5A 3QGGA 1I94F 3BBCA 2M8DB 2HAIA 1MG7A 3MPVA 5EHHA 1LNQA 1X4HA 4DV2F 4EZ9A 2AKWB 2RQMA 1K0TA 5LMNJ 1OYDA 2CNOB 3IG1B 3NS5A 3MR5A 4NLPA 4U9RA 2PFFB 3CC7S 1PC4A 1T9WA 2HVDA 4GRSA 2YWFA 4OX6A 4TY8A 2RDIA 1HWKA 4WYWA 2OSRA 1H2VZ 5AE2A 4LFBJ 4ZCIA 1KVKA 3AB4B 2LDYA 3QAEA 2KKHA 2W9BB 1RDRA 2NXNA 4TYBA 2NQPA 1ITPA 2KVIA 2C2OB 5M2RA 2HZCA 2EBEA 5EDWA 4NCGA 3U1LA 2VBXA 1Q53A 3FZBA 3W9HA 2ZH2A 3H2VE 1H74A 1PC5A 3E8OA 1FRLA 1JXLA 5KFDA 1XC9A 1SL2A 2IC3B 1RHJB 3EZOA 1RT2B 4DWIA 2H65B 4RUHA 4JI1F 1VRUA 1YRTA 3QGPA 4UOHA 1S97A 2HFZA 1X5TA 2B4PA 3BGUA 4UY8T 3PX0A 2I6WA 5F3TA 3HHNB 3QIPA 4XDCA 5SZTA 3Q23A 1R6YA 3FUYA 1W26A 5B0GA 4FBUA 5BR8J 2J9DA 1T9XA 3CJRA 1YJVA 3K8WA 2E1MC 3I0RB 2QL5B 1RAAB 4JI0F 2PDAA 5A8WA 3GU0A 5CABA 1S9FA 4DV2J 1VQ8S 2X1BA 3C6TB 1KKHA 3RBEA 3C46A 2V69A 2QEXS 5LMNF 3CC4S 1NSKL 1TKZA 1RKJA 1N33F 5ETSA 4DFPA 4PUOA 4MAKA 1N5QA 1YLXA 3DGVA 1BQMB 1UJ6A 2WVCA 3KLVA 2V9KA 3CCMS 3DLBA 2N4CA 3M2RB 1LWCA 2BA9A 2H5EA 2E5HA 3MD1A 4BC9A 3B4DA 4PYAA 1LWEA 3OLBA 1Q81T 2VA3A 2ASDA 1SIWB 4RW6B 3TA2A 2PMWA 1TVRB 1X8DA 2WVBA 3KDOA 2W25A 4I4BA 1U1KA 2FDNA 2AYMA 2WB4A 4ZVHA 3O6QA 5KFXA 5DDRC 1I6JA 4JBCA 5F9NA 4OJ3A 2LXIA 3ZZPA 1T05A 1Z2LA 1CEZA 1FJEB 1HNXF 4HHJA 1KSPA 3T1YJ 2R42A 1HBNB 1HD0A 3Q8YA 3VVUA 3UW1A 3AQOA 1PJ6A 4TVAB 3CCTA 1GXLA 1EQ0A 3CIMA 3QT5A 3C16A 4Q5VA 5KT4A 2ADCA 1MU2A 4CLLA 3SBMA 2HHQA 4NLUA 4LFCF 2GIQA 4ED6A 3W2WA 2RJZA 3KLGB 1SJFA 1FJGJ 4RLEA 5B0AA 1RWXB 3CJ8A 3L09A 4O44A 1WDTA 4C11B 1ZAXA 2IHR1 5B7WA 2XSJB 3RBDA 2EBGA 1HNWJ 2DK2A 1D9FA 1T03A 3DMJB 1ZS6A 1RADB 2HBZB 2QYCA 1JLCA 2YWWA 3DMJA 2FZKB 2IIHA 3AJ1A 4X62J 3BYPA 3SV4A 1PJ5A 1WOSA 4KTQA 4UZBA 1RT3A 4DJBA 2MKKA 3GB0A 3BS9A 1JJCB 4X65F 2A6OA 2QTWA 2IJFA 1QVFR 4K2JA 4OI2A 2HHVA 4Z2XA 4URGA 2MLZA 2FVQA 1NXIA 1NMEB 1PJ7A 2WSCC 4OI4A 1RTHB 2FJBB 3PACA 2EC0A 2XSFA 3OV7A 4LQ9A 4DUTA 1AZSB 2F65A 3NRBA 1F60B 2BE2A 2W2OP 5CQGA 1IR0A 3HP6A 4V19J 4MIBA 1TKDA 1DTQB 2GFFA 5B0BA 4I6YA 5EWFA 1Y00A 1B7YB 4WXOA 5D8HB 1ZA2B 2HLUA 2RSQA 3IAS9 4FKYA 5G0RA 2W4DA 3RB6A 1C0UB 3KK2B 1HI8A 3NCRA 2KRRA 4UOGA 4X2BA 3NBPB 3RW7A 4U95A 4JOUA 4KBIA 4DCPB 3PR5B 4DR2J 1N32J 3P45B 2UUTA 5E3RA 2VG6B 3UVJB 3CXCR 2AU0A 1IBKJ 2NSBA 3TEHB 2J76E 2CQBA 2DNKA 2K3KA 2OPPA 3BB5A 3K5PA 4OYBA 3UNGC 2OEKA 2C2RA 3M2VB 3FRYA 1X9WA 3D3BJ 4QBUA 1PYOB 2KJWA 2I1RA 1S6OA 4USTA 5D6GA 1L5UA 4JI8J 3IGVA 2FY1A 5F8GA 4RW9B 5BYRA 3R7NB 2XLJA 1R0BG 2YNGA 5KFTA 4TU9A 2AEJA 1IJFB 1Y4ZB 1YX2A 2DEJA 2V68A 1SXLA 2ZUAA 1LW2A 2DEIA 2J6SA 4F36A 2BQ3A 3G9CA 4FP9A 1RISA 3D4JA 4L76A 3G8QA 4DXLA 5A8RA 1N5TA 2G2OA 2M52A 3AT1B 3CJ5A 2FHKA 3AQPA 3IGNA 1WF1A 1PIEA 3WX4A 5GADI 3W63A 3PV8A 2P9GA 1FDBA 3BJYA 1Q7YT 4OYAA 3QATA 3MD3A 4NOHA 1KQKA 4DX5A 4ER8A 1S49A 1U2RA 1ZM4A 4RX6A 1ZTTA 3QMQA 3N79A 1WKLA 2M7SA 3UN3A 1Y7PA 3E2EA 3G96A 2J7UA 5KFHA 4OHVA 4DV7F 3UQSA 1HKAA 3OR1B 4DQIA 3H25A 2UU9J 3NNAA 4KSEB 4K4ZA 2JVRA 5EGYA 4G6VB 1FJCA 4I67A 1NSPA 3DU5A 5B08A 2XG8A 3JTPA 4HR2A 4WBFA 1OO0B 1WOPA 5DQIA 4ECUA 1Z4UA 2RD5C 3F44A 3MCOA 1KLMA 3NXZA 1QAXA 4YFUA 5EWEA 1UVMA 1G4CA 4ZLPA 1IKWB 4KHRA 1H6KX 3BSNA 2CDRB 4C2MA 1CJUA 1XR6A 4WP3A 8RUCA 4IRKA 2J0XA 4KJIA 4B3TJ 2ZBIA 2SXLA 1ZOTA 3CJ3A 4YB5A 3C15B 1O5JA 2IVYA 3ISNC 3CDWA 1B0VA 3MM7B 3RUBL 3T9NA 2HGMA 5IV4A 5DG8A 1SJ4P 2HHHJ 3Q2TC 1OQ6A 2NXCA 1N52B 2MKSA 3CC2S 4JP8A 1BXNA 2AF6A 2HHHF 4UTGA 1S4FA 4PQUB 5C2CA 4A48A 4CO0A 3PJ9A 4IDKB 2BM0A 4PWDA 3M2RA 1P1TA 2LXFA 5B09A 1QLNA 3GSIA 4KYZA 3H2UB 3J7A1 4TU7A 1RT6A 5K20B 2MHNA 4NA2A 4J9QA 2K8GA 1Q86T 2DKOB 4A8OA 4O0NA 3MAAB 4C8OA 4MFBA 2NPFA 2JVOA 4DV6J 3N01A 1WSRA 3EZUA 3L95X 4YY3F 2UUBJ 2BV3A 2O3DA 4LT6A 2P6SA 2RT3A 1K9MT 4X4VA 1S5ZA 2JC1A 2P8IA 3BGOP 4HTJA 4KT0C 2R7WA 2YKMB 4IO9Q 3RTVA 4KRWA 3GCWP 2NZ4A 2V9WA 1REGX 3KLFA 3BGFA 4HACA 4OZ0A 4F04B 1ACMB 3BKFA 4TKTA 3VGVA 2ZNZA 2AZ3A 1SUQA 2IRUA 1T7PA 2MQMA 2FJDB 2HHXA 2G2ZA 2C22A 1T95A 1RTJB 4F4XA 3DOLA 1NRKA 3SIPB 1TU0B 1U7LA 3AOAA 4ANCA 4I2PA 1FXRA 3PHEA 3MR6A 1NK4A 2FGOA 4Y0FA 3EX7B 1FEEA 2BRKA 3AOCA 5DGBA 3K5NA 3TAPA 2XSJA 1RBOB 1T03B 4C3MA 2IDEA 2ROPA 3CMAS 2KL8A 3I4HX 2DXFA 3PYFA 2VBWA 5J1NA 3P5TL 1D1UA 4LF8F 4DSJA 4AYBD 1WKKA 4WU2A 1HI1A 1X9SA 4OYZA 2YNFA 4OI3A 3GFZA 2W2PP 1Q16B 2DO0A 2CQ2A 1HD1A 2D7SA 3QJJA 3VGUA 1W7WA 2MLYA 4LVNP 4NASA 4B9NA 4KY3A 2V4JA 5AXNA 4LRBA 2F40A 4IFVA 1CULA 3R5CA 4FS2A 3KUEA 4X65J 3G87A 1FKPB 1T8EA 4MYUA 5KFFA 1F2HA 1G6BA 2PC6A 2R7TA 4OZ5A 5E3CA 4F4AA 2HRTA 2V8DA 3DHWC 3NWRA 4BWJA 2QO3A 1S0NA 1KD1T 3M6WA 2EPIA 4KR0B 2J0SD 3CULA 1N33J 4Y2KA 1IXKA 5CZXA 5KFYA 4DPWA 3PW5A 3R1HA 1WSVA 1MW7A 4UZCA 1L3UA 2DNLA 3DLEA 2C3OA 4FPRA 4NYOA 3QLHA 3MAQA 1ZBTA 3OXFA 3P8BB 3US5A 1SKWA 1J5OB 2D3UA 3CJ4A 2CFXA 1OYEA 1GMVA 4DV4F 3I0RA 1Y5LB 5KT2A 9ATCB 2XTJP 3G6VA 2VHGA 2V8GA 5E33A 3GMGA 1NJYA 1KRPA 4DSIA 3HHLD 3MZIA 1C1BA 1OWXA 1WF0A 5E3PA 2AYBA 1N34F 2DJWA 3EM1A 1B99A 2AJ2A 2GS8A 3G8TA 2EFGA 3JYTB 4K8RA 1NPKA 4PZVA 2DNHA 2XYPB 4NI2B 3OTOF 2I5JA 4DCOB 2G13A 3DRRA 3ETMA 4BBYA 2XMJA 3MCSA 1U1OA 2VQFF 3DLHA 4GO7X 4IKAA 5CYJA 2CZVC 4F3OA 5LL6d 3NGUA 1S0OA 4NLGA 3UDVA 1U2FA 2XZWA 2YKNA 4G1PA 4EGLA 1RT2A 3JSRA 4PKDB 2VPWB 1QE1B 2ZFHA 3D0IE 4G1QB 4RUAA 2KTQA 3KWMA 1N36J 4Y3CA 5IOLA 3UI3A 3GV8B 2JX2A 2O67A 4DG1A 4NCGB 2F1FA 3HI9A 3AA8A 4R5PA 3OFHA 3OHBA 3QSIA 1UFLA 3H5XA 2FHJA 4TYAA 3FBBA 3B8HA 3ZTSA 3VAIA 5J2MA 3IBCB 2HRYA 2QA1A 3LW5C 4R0EA 1L3TA 1NLKL 1KDNA 2NCKL 3HULA 1YJNS 2DVIA 4A8MP 3LOUA 4LR8A 5FJ4A 5J1PA 1N5SA 2WRMA 1YBTA 4XK8C 4DBQA 4UUXA 3C15A 1VR6A 2WVFA 4M5DA 4DV0F 5KFKA 5E2QA 2DGTA 3GILA 4DL4A 2NYHA 4TLRA 2WTFA 4N41A 2XMUA 4JV1A 5F0WA 4PYDA 3QO9B 1Y3KA 2IMWP 5IZHA 4IG0A 5KFIA 2AYGA 4OI0A 5IFMA 5CD4H 4M94A 2FYXA 4FYXB 3DNCA 2BW2A 4O3RA 4BS2A 2VDHA 4NZ7A 3N6LA 2GC8A 2WB1D 4EWTA 1HBOB 1R8HA 2X7IA 2WSEC 3FBEA 3PNIA 1HBUA 4FYYB 3S01A 3W8PA 1S1UB 1RUSA 2L3MA 3PRVA 5HROB 3BBFA 3H5YA 4J9MA 4AL5A 3FRZA 5CYMA 4JYAJ 1AFIA 5L9XA 1TP7A 1WHXA 4FXDA 2K1RB 2W4CA 1C1CB 2E1AA 2A2CA 2B9EA 1EB0A 2EI5A 2PEBA 2V8VA 1FWKA 1NDKA 3D9BA 3G8SA 5K9FA 1U4BA 1WI8A 3QT6A 5K8NA 2PEHA 1S7HA 1ZYQA 1EKSA 2O1PA 3NCQA 3ZO7A 1JLBB 3QSYB 3CCQS 5KG4A 3IS9A 3LPYA 5IQQA 1RHQB 4M1KA 4MK9A 3I55S 3SV3A 3V6DB 2YNIA 2BABA 2OMLA 1D8YA 1HR0F 5IWAJ 4WFXA 1GFWB 2POKA 2VPZB 5E0OA 5C2GA 1SQFA 2OIHA 2CJQA 2HFSA 4N76A 3HFKA 3JAMY 2FC8A 2MPUA 2MZTA 5L1IA 4B3RF 1OY9A 5AXKA 5L38A 5F8JA 3MEKA 4C8MA 1TL1B 3KMQA 3D68A 2DR8A 1U24A 4NMLA 1HNVA 2MQ8A 4XIUA 4ED5A 2CVEA 3I96A 3SSSA 2MQNA 3LH2S 3MUTP 2KJVA 4PXBA 1MLAA 5U47A 2MLXA 2D1CA 3VWSA 3FNNA 1NB2A 1S1WB 2EVZA 3CCZA 1S1XB 4Z7YA 1FWPA 1RXOB 4CCHA 3AJ2A 2C3YA 3ET6B 3IWLA 3H98A 4WK1A 4OYWA 2KU7A 1JKHB 3G6YA 1XR5A 1VFJA 1RK8A 1XK8A 3CDEA 4RKUC 3J80U 4YDXA 3AY0A 2DNQA 2YH1A 2JSXA 5I3PA 3DI6A 5CCLA 1D0EA 2UXDF 2E5JA 3DI6B 1X4DA 1W2IA 4YQWA 3EPGA 5ETVA 3MUMP 1RA6A 1V5VA 2D9OA 1HMVB 2RVJA 2CJYB 3ZZUA 1M5OC 2UXDJ 2F5GA 4R8UA 1HR0J 3CJKA 2VBZA 1T9VA 1AYEA 2VG5B 4H4OB 2RQ4A 4WWSA 4DV5F 5H9FJ 1SL0A 1SV5A 2I38A 3MPWA 4O4GB 4OHYA 5IXUA 3QLHB 4U7CA 2OFGX 1OSCA 2AYEA 4UW2A 3EXYA 2WOMA 1TKXA 4LSNB 3FEYB 1TL7B 1M90T 3V6DA 1EP4A 3V4MA 1RHMB 3KLHA 1I3OB 3R6LB 4ZLNA 2XGPA 3ENAA 2BBEA 2F8EX 3Q24A 3WQPA 2GMJA 3TP2A 3OTEA 4HT7A 3ZNUA 4I7FA 2GV1A 5CZVA 3ZTOA 4K50A 3OR2B 3TW0A 3TYTA 2BOPA 1BQNA 1FRHA 1KFSA 3T6BA 2FPHX 4ZHRB 4RW4B 2QMUB 3U1NA 3OVBA 4D3HA 4Q0BA 3ULHA 3CCWA 3FMWA 2YNFB 4DR3J 1LQ9A 4RPFA 4R25A 1TK8A 3QRPA 4PG6A 3G4SS 4LF6F 2W2MP 3LQVA 4CNYA 1JX4A 3AXMA 4IYQA 3R7SB 2W9CA 2L9DA 4DR4F 3HHLC 4WYLA 2DIUA 1GK8A 3LANA 4OX7A 2LU1A 2XLIA 4J9SA 2EG2A 2V34A 5D0GA 3EVWA 4ZVRB 3IM9A 1WUUA 2Y3YA 4I68A 5EUHA 3UWTA 1DTTA 3GPAA 4NLRA 5DG7A 1YJWS 4DR6F 3S7RA 4A47A 3HHKA 4LJMA 1TUWA 1BD6A 2ZNYA 3EGNA 5T7LA 2OPSB 1GTHA 3PFEA 3RB0A 5HL7Q 5KAKA 3J81U 2WHOA 4OJ1A 3ONQA 4MKYA 2MGZA 4IQXA 3GP9A 4ICLB 2JEGA 3IP0A 1FI4A 2JRSA 4QZVB 4QYRA 1HHSA 4OLOA 2YWGA 1X5PA 1U1QA 3JTNA 3QJPA 1NHKL 4Y28C 2RHQB 4IUFA 3KHGA 3QFHA 1YI2S 4WJBA 4O3QA 4A8KA 2HQ3A 3MI7X 4KPCA 4DV1F 1DZ5A 4NLSA 1U6BA 1TELA 2DNRA 2OGUA 3A4TA 5HVFA 4I69A 3W7BA 4LSLA 4UF4A 1FKOB 1PSDA 1RAFB 2EEYA 3EWGA 4CO5A 5T14A 4K4WA 4ZOSA 5LM7E 4DV0J 1S9GA 3U1MA 5DO2A 3BSAA 3TEGA 2AD9A 1XQIA 1FKPA 4PXDA 3I87A 4FZVA 1C0UA 1RHKB 3SCLE 3ZTRA 1WI6A 2Y1IA 2CIMA 2DB1A 3CGIA 3JB9k 2B7BB 2QE5A 4ZPWR 4JI5F 4XPCA 1RTDA 1NB7A 4RR5A 1UETA 2V67A 4P2SA 5AE3A 2MDAA 1C4AA 2YKAA 2ZJRQ 3RR7A 4WK3A 2YKNB 1E6YA 2GIRA 1S79A 3ILOA 3FVYA 3EYZA 1SJQA 4S0MA 4YS2A 1Q8IA 3PKMA 1LXNA 4JI4J 2HNZA 5K14A 2GZOA 3JQKA 3H20A 1L3VA 2HQDA 3UDCA 4H4KC 4DOZA 2FHJD 2ATLA 3TUPA 3EGVA 1TMJA 2AJ1A 1HLWA 1H72C 2HAFA 4ID5B 1IWGA 1JB0C 5KT6A 4WPAA 1RWMB 2VIHA 2ZC3A 5B0DA 4DQQA 2MZ1A 1VHFA 2GA7A 1LW0A 3M05A 4C11A 4CM2A 2E66A 4O3SA 1SQEA 1YBUA 3MURP 4X4QA 3W5XA 1JLCB 3RAQA 3N28A 4ZCKA 3C2PA 4C0BA 3HMJG 2LECA 5IWAF 4O4RA 1KQFB 1HYSB 5C24B 1DHMA 2UXCF 3KLIA 3L3CA 4FNIA 4TNOA 1VC6A 2GO9A 4ENOA 2YQ1A 4P52A 1NDPA 3C3LA 4X4RA 3BGLA 1KBRA 2KZMA 1MN9A 1D3WA 3TZYA 1RE1B 2RS8A 1YDLA 4DL6A 2B3TB 4J91A 1EIYB 2F8MA 5GAEI 3GG0A 1DAXA 3EUNA 4ZA1A 2J0WA 2KH9A 3MOJB 2J9EA 3HHLA 2WSFC 2VOPA 2ACYA 1C0TB 1FTCA 2CG8A 2VDIA 3D3CJ 2HMIB 2G0IA 4L3NA 4JV0A 3EDRB 4CH7A 4ZVUB 1AUSL 2RKIA 2ZVSA 1RTZA 1IVZA 2ZKUA 4F3QA 5D0EA 1EZZB 2IPOB 3GJQB 3BF4A 4K2XA 3LP2A 2HZAA 3P96A 4X84A 3VGTA 5RUBA 3KLEB 3MCMA 4ED4A 3OTBA 4GVBA 2OP5A 2RF2A 5F8IA 2W8KA 3MAHA 2M88A 3CJ0A 4UQTA 3M6UA 3KHHA 4C9DA 2FQQB 3NS6A 5DQGA 2LDIA 1R6VA 1MMLA 1ZZFA 3E51A 3THPA 2FVPA 2FLNA 3HVAA 5C7PA 1VQLS 3H5SA 2V4RA 4JYAF 4A8SA 4C8KA 4B3OB 2WZ1A 4A8XA 3RGIA 4C3LA 5KG2A 1TL7A 2YNIB 1XMQJ 1F3VA 3IXQA 2X1GA 2XHWA 3THVA 5ETKA 2DR9A 4DN0A 4MYTA 1AFJA 3IC1A 1ROFA 4RNMA 4BCAA 4JI6J 3HSDA 3OLAA 1SJ3P 4F3MA 3LALA 3S8SA 1RT1A 2RU3A 1RWNB 4JI1J 5ETPA 4Q43A 3DRPA 2PIIA 4HYKA 2Y0BB 4EBEA 4ZVGA 1X31C 1SUQB 1U0SA 3GYXB 4KIAA 5C24A 1LFPA 4OV6A 2XMTA 2KM8C 2VPXB 3GJTB 3VF0B 4FVCA 2AWZA 4Q8FA 3FCHA 1XMOJ 1HWJA 2V2ZA 3WBZA 2E7XA 1VQMS 2ACMA 2KXHA 1RAHB 1WWHA 3MMBB 5FD1A 4AT1B 3PW4A 2CJ9A 5J2NB 5A2QU 1R0AA 4N77A 1R89A 4ZLLA 2MEWA 4GKKF 4DHVA 3GIRA 2CQDA 3BSCA 4YP3A 4CLZA 3I9ZA 2BQRA 5HJXA 2GAGC 3MPYA 2CPHA 2QLFB 1X0FA 2OFHX 2OPQA 2LMIA 1HQ2A 3R2CJ 3W2WB 2MJNA 4I0WA 3KLGA 1F5BA 3KLEA 4B9SA 3T1HJ 4Y2MA 4NCAA 3CUNA 1XMQF 1MSWD 2EFNA 2ZHOA 2EFOA 1HBMB 2DNGA 2RUSA 3IFEA 2DGOA 5THWA 4DV3J 2UV8A 3PTWA 1JLQA 2R3VA 2V4JB 5LMUF 1XNRJ 3DU6A 2WW4A 2BYCA 1QUVA 4Y00A 3OUYA 3PXGa 2VQEJ 2XEXA 4I6WA 4QWCA 2DNMA 4ECTA 5D0RA 1HNXJ 3SDEB 3BGRA 2K06A 3UR0A 2CPIA 1NK0A 2Z30B 2JL9A 4W98A 1NSAA 1HNWF 3M32B 4PQAA 2C2NA 1V9OA 3VAGA 3F0NA 1KN6A 5E41A 4MH8A 1NH8A 2D9PA 3FKBA 5KT5A 2HGLA 5J2QB 2X1AA 4ZJLA 3CEDA 4OHWA 3EE3A 3M2VA 1RCXB 2V2QA 4MKBA 3IWNC 4OZ1A 4NRUA 2FGCA 4KHPF 1JLAB 1V6HA 2JJ4D 2VC0A 4DCJB 3M6XA 3WIUA 5A8WB 2XZDB 1I94J 1UPMB 1M5SA 3HVRA 5A0YA 1VQPS 3CJ2A 1AT1B 4ZVPB 4KFBB 1BY9A 1EJ7L 1S72S 1RB0A 2YKMA 3OT9A 4USIA 2HQIA 3K5OA 1DQAA 3K8VA 5KFCA 2BEFA 3W2VA 4AXJA 2EG1A 4MT1A 5KG5A 4QWAA 1WTFA 1T3OA 4LR9A 2LQ5A 1DTTB 2Z8QA 4B08A 4I56A 4ZP8A 5A2QY 2RDDA 1FFSB 3POTB 4USVA 5E3QA 2ZH3A 5T41A 5IV3A 1X4FA 3EZ5A 4LF8J 4DR4J 3GG1A 5HI7A 2FVRA 1S6UA 3K7RA 3M30B 1YWXA 4NE9C 4ECQA 1RP5A 2OMOA 1CC8A 1VK3A 3QFWA 3CD6S 1BC6A 2W9BA 5KFOA 1FWLA 4OFZA 1VHIA 4A8WA 2CZ9A 4DL0C 2PMZD 3MCNA 4DX6A 2DO4A 2H1YA 1KONA 1P1LA 4FF1A 2JOQA 1UEVA 1FDAA 2QV6A 3L4BC 4RNOA 4EMDA 1GX5A 2DH8A 2ZOMA 1C4CA 4I1TA 4JI8F 2IBKA 1YG0A 1VCTA 3DOKA 1FHTA 4U8YA 3J7ZT 4JI5J 1XIQA 1RBAA 3MEGA 3ZZOA 2J6UA 4DSKA 5LXRA 1XJWB 5F3ZA 1IQTA 4IOCQ 3ZTQA 1NKCA 5DJBA 5MLCV 2PGCA 4QR1A 4WTYA 4Y2IA 4BLGA 3M9MB 1WG4A 2R2SA 4AXIA 2YKOA 3RB4A 2B8PA 4EBDA 1YJ9S 4ZIWA 1M1KT 3Q8RB 2NREA 2MQQA 1OY6A 1YJTA 4NWBA 3TQEA 3T3FA 1NJIT 4WFNQ 3X1LB 5A0YB 5F8MA 4WKRA 1RQ0A 1LK7A 3C6TA 1RTHA 2CXEA 3HJVA 5HMWA 2E5LJ 2J8AA 4V19X 1MROB 1R0CB 3I6PA 3D0GE 3NEKA 3NG8A 1URRA 3TJAA 1BQMA 4ECRA 1KFDA 4N8NA 5A6WA 4ATNA 3FSXA 1BUXA 2K3IA 2HNDB 2VF3A 3H42A 4NLXA 2CDQA 4ZPTR 2B6AB 3CCES 2DITA 2P6TA 3SDEA 3V81A 1VIOA 3D1OA 5LJ5Y 3QJLA 2ILYA 2XS2A 1WC0A 2RUGA 4A8QA 3PM9A 3QPIA 3GZ7A 4J5OA 3T9ZA 4Q0BB 1L3SA 1RKIA 3G82B 4PPZA 2LQBA 4LFAF 2L48A 3GLJA 3LP1B 2ZM6F 2ZZNA 1EQMA 2HBYB 3QZ7A 1RT1B 1BQNB 3PX4A 4JI3J 2DYAA 2HQCA 1UW4A 4OHZA 2AX0A 1VRTA 5DETA 4DL5A 3G71S 2W4PA 3U27A 1X0PA 3Q8QB 4ZHRA 4QOTA 2LQJA 3AA9A 6AT1B 4ECXA 2KFZA 4WFAQ 2NZCA 1Y3JA 3N5BA 3O1LA 3HT3A 1FJ7A 1U6FA 1P9YA 4CLPA 2E44A 1RI7A 2N7YA 2HWHA 4G1QA 3W61A 4CTAB 4NZ0A 2W8LA 3T1YF 2KFNA 2UUCJ 3C66A 1YGYA 4WZMA 2P9EA 1RAJA 2C2KB 3D54A 2Y1LB 5A6PA 1CPZA 2DY1A 4QIGA 1EX8A 2DRBA 3PY8A 1WNEA 3P49B 3QRRA 3MEEA 1RT7B 2JFKA 3ENWA 1FD2A 4PCQA 4K0KJ 2CQHA 4ZK7M 3PIPQ 2B56A 3SYZA 3IG1A 1X4BA 3DDIA 4OX9J 1PAUB 3OFFA 4P2MA 1HQUA 1X60A 1RT5B 4J7CA 4DPOA 4N8OA 1ELOA 2CYYA 2RB7A 2IJNA 2XLKA 3A13A 2ZH1A 1MMNA 3BDEA 4MIWA 1NU4A 1SKRA 4IOBA 2CQCA 4BC7A 2Q6CA 2XZTB 3MM7A 4M5HA 2YQ3A 1Q5YA 4PXEA 1X4CA 2HGNA 4PXCA 2VFTA 1HBUB 2EFVA 1RSCA 2VUGA 4CM0A 2UP1A 5DZ6A 2IA0A 2KYZA 3OFGA 3KJVB 4DV3F 1EKRA 1XNRF 1A9NB 4U7UD 1FX4A 1JKHA 2OAUA 2QYGA 5GVQA 5IT0A 1VRUB 3VAMA 2HLTA 2KVQE 2FIUA 2RU9A 2FD2A 4H4KA 3K58A 3W3SA 4QQBA 1GEHA 3WX8A 4CLSA 4GKJF 2DGXA 3KUGA 3IAM9 1MWQA 3DLEB 3MM8A 4ZKAA 2C28A 3ZTPA 2G1HA 3HVTA 2Y1JA 5K14B 3R5GA 5KG1A 2DPIA 1UVLA 1EARA 3KNAA 4W90B 4DR2F 2XNQA 4WP8A 4ELUA 1TL4A 1FRJA 3MTKA 2PI5A 4K4TA 2B7CB 3O3LA 5H1SV 1GH8A 1TV6B 2LEPA 5IT9Y 1ZH5A 5L39A 2DXDA 3T41A 3TZZA 2H51B 4NXMJ 2RIJA 4EO8A 2V8HA 2MKYA 1JNRB 5KFUA 1RA7A 2CA9A 2OLWA 4CLWA 3W1YC 4GC7A 4LR7A 1Q4RA 5BJRA 2WOMB 3QT8A 1CJTB 3GIMA 4NXMF 3NGDA 2O01C 2A0FB 1TVRA 2Z2LA 2V63A 3I4PA 2P9CA 5M2PA 1YK9A 2W7OA 1DURA 2I0XA 1GNKA 2BANA 2VG7B 3SQOP 4GKKJ 1RBLA 3M30A 4CP5A 1LEOA 4CDIA 1ZA1B 4GVLA 1F6TA 4DR7J 1URNA 2BKPA 1UVJA 2VODA 1JLGA 4ILRA 3LPEA 3R8YA 4RNFA 4JV5J 4CH1A 2AJFE 3N9UC 2IM0A 3DLLQ 1WC6A 2BW7A 4J9OA 4ILMA 5KTQA 3GONA 4U6PA 5KG3A 4NEZA 4K7QA 4QW9A 2HG4A 2A10A 1RTJA 3B82A 1HL6A 1YJ7A 2NXJA 2ZKTA 3LGNA 5MAOA 3KJVA 1S9EA 1UVIA 3H7HB 2OJ3A 3GR0A 3ZNJ1 2BDPA 1SH2A 2YPYA 2UU9F 1YJRA 4L6V3 1FDDA 3TZXA 2QA4S 3R6GB 4WFZA 2CJBA 4PWUA 4X64J 2VPYB 3OQ2A 4C6AA 6FDRA 4NX9A 2X3DA 2CPEA 5T7LB 3MDFA 3IRWP 3F73A 2ZH9A 3TOQA 1UW9A 2Z0GA 2FHOB 3MXHP 1KNZA 2X51A 2Y9HA 4N5SA 1J2VA 1WC3A 3G6ES 4UY85 3H90A 1E6VB 1X4AA 3LP0B 3DKDA 2P2CB 3I5CA 1GTEA 2BJ3A 5BXIA 3W62A 2CJXB 1HWLA 4NXNJ 1Q1KA 3OBIA 2GX8A 4RW4A 4FF2A 2HURA 4HHUA 5L46A 2QGFB 3WC0A 5F41A 2AQ4A 3D7SB 3PJXA 3KK3A 3UCGA 2K1RA 4EUVA 2IYIA 3BSOA 1DY3A 4X4OA 2IBOA 1RLDA 4PWDB 1TUVA 3OR2A 1G1XA 3WZ0A 2CPJA 4MK8A 2QMXA 3GIJA 3TARA 3KG1A 4DL3A 2XB2D 1F5AA 1TL3B 4P71A 3TA1A 5HROA 4LF2A 1A7GE 1H2TZ 5D4NA 4DPYA 1SCJB 2R8HA 4WZQA 2WONA 4HT5A 4L3KA 3DCAA 4AL6A 1RWKB 2OPRA 2QFIA 3DGPA 5HK4A 1FESA 5ETMA 3VAKA 3HJFA 3DGPB 5GAHI 1A6LA 5J2NA 4GO5X 1YZ6A 2HVEA 3QIDA 2HFUA 2JWNA 3LF0A 3SFUA 3IR6B 2KM8B 3MR2A 1XNQF 2HVHA 2HSEB 2R7UA 2DHHA 1IUJA 4JV2A 4ZCLA 1EETA 2LVWA 3EXCX 3Q2SC 3M8RA 3NMAA 4K5SA 4GC6A 3O8WA 3Q8UA 2DNZA 3E01A 5LSOA 4K4XA 2EWHA 1N36F 1HFEL 2D3O1 4I2PB 3SSQA 2YKPA 2R8JA 4FS1A 1VBKA 2Q43A 3BGRB 2V8PA 3EVOA 3QBCA 4DV1J 2MKHA 4B3SJ 2GAHC 2W7PA 3TUIC 3CTRA 1TK5A 2F4VJ 2C3UA 4PABA 1H7WA 2R2TA 4LRFA 5HSPA 4DU7A 2CQ1A 3C6UA 1U1MA 4DMZA 4RNNA 2JLEA 3B6BA 3LGHA 4RJVA 1N32F 2CQ4A 1O8BA 4IQMA 4B9LA 4HH0A 1UCNA 5KFJA 2DNNA 4YR3A 4C8YA 3MAAA 3M9NB 1SC1B 2W01A 4DFKA 5JUMA 1QVGR 2GVZA 2G0JA 2FVCA 1FX2A 4HLBA 4IOAQ 1WC4A 5KFAA 3M8ZA 2AGPA 3ZFVA 4LF7J 4RW7A 2BJ1A 4H4OA 1Q82T 1R43A 3HX9A 1PYTA 1TKTA 1FFGB 2Q6BA 1B70B 2CPYA 3ISND 4ED1A 1D9AA 1QDUB 3HVTB 4F4KA 1QUPA 2Q1LA 1U6ZA 3JTOA 4HEA9 2MB0B 5DDQC 1FA0A 4CT9A 2IY5B 2Z56B 2ZH8A 3X3UA 3BKTA 3POTA 2E1PA 1C1CA 2IAJA 5KFRA 4J9RA 1H0HB 4B3TF 4LRDA 2FJAB 4J9NA 2XI3A 2LU2A 2ABYA 4FYWB 2B5JA 4PUOB 3PKYA 1RTIB 2A2DA 5KT3A 4DL2A 4RWWA 1K8AT 2F4VF 3J7YU 1VQKS 1HBOA 4WXWA 1IKVA 5HMYA 3CCSS 1U09A 2D74B 3T5HA 3GFYA 1PG5B 2BMBA 2DT9A 2V0NA 2F3JA 3JYTA 1U26A 3BO2A 1JJ4A 2FVSA 4ITSA 1IKYB 1UZDA 5LXYA 1N88A 3Q0AA 3R5BA 1FD8A 2MKCA 2WK4A 3A8KA 3ITHA 2AJ0A 3PJWA 3TI0A 4DSLA 2JZ5A 4FYDA 1UJ4A 3NLCA 2O5DA 3VGSA 4ES3A 1S10A 3HZGA 2GQ2A 2EKNA 2QSWA 3OR1A 5DQHA 3RAXA 4XPEA 2RHSB 1SH0A 1RHUB 2DGQA 2QT7A 5DDPC 4NLVA 1FNXH 2QJ3A 1IBMJ 1C2PA 1SC3B 3SI8A 4WIIA 4AD6A 3ZZTA 1VJQA 4J9VA 4M5JA 4DDFA 1WG5A 3W5ZA 2RS2A 2W7AA 1KOHA 2IMOA 1LWFA 4CTAA 4DQSA 2VFVA 2G4BA 2XM3A 4IG3A 4IRDA 1RU2A 2WVDA 3FSYA 2HMIA 1I51B 1FT8A 3IR7B 4NLQA 2Y0SD 3CMES 5AE1A 1P9QC 1SC6A 2XI2A 3GFHA 3IBWA 1ZTWA 3IMQJ 1CG2A 3CJQA 4YMEA 3KG0A 3GYNA 1HHTP 1OIAA 3OVSA 2FY8A 4X66F 2BQUA 2ZHAA 1SB6A 3G82A 3O5TB 3TO8A 2FC9A 2HZVA 2MQPA 3WHIA 1JK9B 2O66A 3HHDA 3KOAA 4CO1A 3TX8A 3Q22A 1OPIA 5HLFA 4OI6A 2B6AA 1FCAA 4K59A 1EHWA 1P6TA 5ETLA 3MM6B 2MQOA 3CPWR 3OSNA 2OEMA 2BE7D 2YQ0A 3N6NA 1WC1A 1NZAA 3DRRB 1FK9A 3ILJA 4LUBA 1IBMF 4LSLB 1PGZA 1FVSA 3RB3A 3H4BA 4ERDA 2HS4A 4DN9A 1U1NA 2AGOA 1B4SA 1JMTA 2CPDA 3HCXA 3TVYA 5FDLB 3GIIA 2NUUG 2HHUA 4FDFA 5L1JA 3CCJS 2E9ZA 2R7VA 1Q8BA 1ZAVA 1K1QA 2V50A 4J9UE 1TL3A 3GFXA 3KNGA 3DN9A 1CVJA 2H4YB 2ZDOA 4E0DA 2MZSA 3PCOB 5DG9A 2M2BA 4P2XA 4C0HA 1UA1A 1RTDB 2B4UA 5KFWA 2GQQA 2IVMA 3ICLA 2GGPB 1Y9OA 2CZ4A 3FQLA 4J9KA 4KHPJ 2ZH5A 3I5BA 1KHVA 2XBPA 4KV8A 5GAGU 4TQSA 2Y8WA 4Y65A 1LK5A 2CJKA 1SC4B 5EX3A 4JV5F 1PBUA 1H38A 4LF5F 2GVDB 2AT1B 2B0GA 1RGVA 4QPTA 3GIKA 2A3JA 4O3NA 5LMUJ 3QRQA 2QZ8A 5I3QA 1F9EB 3FSIA 2BVZA 1NAQA 1VQ4S 1T11A 5D78A 4ZVSB 2ALYB 4Z37A 5IC6B 4RW8B 4CLTA 3J7YI 1I5OB 1S7IA 3GTYX 2DHAA 2VFRA 3NGRA 2V2VA 3GYGA 4KGKA 3KHRA 4F2SA 3CCRS 1WEYA 2ZWPA 3L7UA 2DXEA 4PR6A 3W66A 4DSEA 2ZDPA 3M32A 2Q3PA 1GX6A 3RJMB 2CG4A 1B3TA 4IRCA 4C8NA 3VZHA 2XQCA 3HHLB 3OTOJ 3SSRA 1ZZNA 3RRGA 3M8YA 4F67A 2EC2A 2R7XA 3JXOA 1Q8LA 2HK2A 4PG8A 5HVHA 5L1LA 1NK6A 2OHDA 1JLEA 3HFVA 3ZZYA 1N4LA 1GQEA 1FK9B 3JSBA 7FDRA 4X4NA 2VJVA 4CI0B 4DFMA 4USWA 1JIHA 2XCAA 4ECZA 3CJSA 1IKWA 1K47A 1X4EA 3A3OB 4OYOA 4KFBA 3R97A 2N7CA 1D9DA 1NSQA 4ICLA 1QAJA 2YWHA 1BGXT 3AD7C 4NA3A 4JI7J 4FF3A 4M5IA 2ROEA 2XS7A 5E7OB 3W5YA 5L9NA 4NLDA 3P6YC 2BUNA 4X4SA 1BMQB 5I4MA 2IVFB 4Q44A 1Q8KA 2CNKB 3KDNA 4ID5A 3PO4A 1YKWA 4KQZA 1KP6A 5LT5A 2E7WA 2F4FA 4I2QA 1FXLA 4O44B 1E6YB 2N4DA 4LF4F 1TAQA 1QD1A 3DM2B 1CSJA 2MJUA 3G6XA 2QRRA 2CNLB 4ZPBA 2HNZB 1B7FA 2K2PA 1WELA 2ZEJA 5A8RB 4MKAA 2ZBRA 2XWXA 3KLFB 1JWWA 4DR5F 2ZE2B 3CDBA 2VKZG 4L72B 4M8LA 2CAJA 4DL7A 5D3GB 4NA1A 3PO5A 2XO7A 4KO0A 3GSDA 4CYUA 1RT4A 3BQ1A 1LV5A 4B3MJ 4O3OA 1MN7A 1M5VC 3K57A 3PRBA 3BO3A 1PKUA 3I82A 1UVKA 5GMKa 4USKA 1NKEA 3DDKA 3TJ9A 2VD3A 3BN4A 4TY8B 3TNVA 3GCXP 1UAWA 4YR2A 1AXQA 3ZZRA 4DF8A 3OPKA 2DH7A 1HA1A 1CS4A 1VISA 4DG1B 1RT7A 3QWPA 1S6PB 1VI7A 2OPQB 4Y6IA 2RRAA 2AP6A 1S6PA 4B9MA 2ZJQQ 3MF5A 1BHNA 2CQ0A 2X1FA 4J9LA 4LBIA 3CD5A 4LF6J 3KJFB 1H3DA 1HMVA 3SCJE 1G3OA 1RABB 3VALA 4DUZF 4FXVA 1NJWA 2GCFA 3Q89A 4ZVEA 5D4LA 1M1HA 4ES1A 1JNZB 1S0VA 5HP1A 2VG5A 4P73A 1PCAA 1IBLJ 2UVVA 2ZZTA 2C42A 1QSSA 3TX0A 3RW6A 1ZM9A 2IM2A 2QL7B 2YBVA 4DV7J 4ANEA 4ZPAA 4DI6A 3DOMB 5C42A 2FJXA 1UWBB 1WORA 2UXBJ 4GMKA 2H5JB 2YY3A 3S1TA 3J81Y 4WFBQ 2JEJA 2ZC4A 1UMJA 1W25A 4OHXA 6FD1A 2DGUA 4OV1A 4LF1A 1S48A 4DSFA 2CWKA 5DLFA 4LF7F 2AMCB 1QTNB 2MZQA 1A0OB 4IDKA 2VU5A 1XTZA 1U8WA 3KUHA 2GQCA 2DBBA 4URSA 4IR9A 5EN1A 3MECA 1NKBA 2XNRA 3MM6A 2QLBB 4F8RA 2XCPA 4KH1B 3KKFA 1HNIA 4QW8A 2R8IA 1FE4A 1HQEA 5KFPA 4YR0A 4O0IA 2WONB 2L08A 1RHRB 3CB4A 4C7QA 3MMAA 2AX1A 2YNHA 2NR0A 1K1SA 2M0GB 1FRXA 3C19A 3W65A 4X4PA 5LJ3Y 3T5LA 2VC1A 3BH7B 1S1VA 1HW9A 1KTVA 2BJEA 4FBTA 2KB2A 1Q5VA 2LLZA 3CT9A 3E3XA 3PFOA 2BKOA 4ZN1A 3GE9A 5AJ3J 4LSNA 3CVKA 1S4EA 4DZDA 2YNGB 1NK5A 1Q79A 1S0MA 1K0VA 1NNDA 2L9WA 1X7VA 3ELHA 3KLHB 2ASYA 2M70A 2OPPB 3M8QB 2KT3A 3DRSA 1HNZJ 1NCLA 3NKYA 4DPXA 2PA3A 3LWMA 4DF4A 1FKAF 1HPZA 2U2FA 4LIRA 4Q8EA 3NAIA 2DNOA 1DBDA 4CLFA 1T9TA 3BREA 4NL5A 2FTRA 1VOMA 1GAOA 3QWUA 3UD5A 1HIYA 2FLLA 1HYSA 1VIXA 4NI2A 3NS7B 4QYZK 3H4DA 3K2YA 2QIFA 4B17A 2R2UA 4DFJA 2EW9A 1O51A 3EICA 4CO4A 1FEHA 2J7WA 3PDNA 1DFDA 4DS4A 2DHSA 4ZVTB 3TZWA 1VDHA 5KG7A 4JI7F 2FLOA 3DC2A 1CJKA 1IM4A 3AD9C 1AZSA 1CQMA 5HN0A 1UKUA 4CO3A 1QSYA 3H59A 3BQ2A 4IH6A 4KGXB 4LBHA 4D3GA 2PSZA 3QT7A 4IFYB 2RQCA 5J2MB 2L41A 2DHGA 3LTOA 2XYGB 3ENQA 3R27A 4KKOB 3PR4A 4M95A 2E29A 3LAKA 3CCLS 5HBMA 1N34J 4GVBB 1T3NA 5ETTA 3B54A 3H5UA 2IAJB 4RUCA 4ZPVR 2AV5A 5HJYA 1TKTB 2QSFA 3T6JA 4C98A 4ED0A 1P8GA 3CO9A 5J2PA 4DR6J 2RKIB 2W2NP 4EBCA 1RACB 4RBTA 2GW8A 2DH9A 2Y1RI 4MMOA 1KQGB 1LFWA 1RLCL 2EK6A 4HDGA 4PG4A 4KH0B 4B3MF 3AXKA 4OX8A 2ATCB 2B8QA 3AJDA 2HNYA 2NLWA 4NPOA 1UEUA 1H2UX 2RH3A 3BH6B 3SXLA 5J1EB 2Z58B 1NK8A 4LQ3A 4WTOB 4ED2A 2XY6A 1FKOA 2LQ8A 3LP1A 4E8UA 5AXLA 2GHVC 3NGSA 4CNZA 3U02A 2OD6A 4A8FA 3L7OA 1HHQA 4X4UA 1RAOA 2E1RA 4ETZA 1T9UA 1O0PA 1NO8A 1VRTB 2ZOGA 3CIZA 3FJ2A 2KI2A 3CJTA 4FPIA 3N5FA 1BQXA 1KHWA 2EFQA 2I5JB 4F02A 3HPOA 2CQGA 3MM9A 2Q66A 1RWOB 2HFNA 2YXLA 4P74A 3L9ZA 3V6JA 2MY7A 1F5CA 5B0FA 1EAYC 1VQ9S 5DM6Q 3F56A 3C14B 1YSJA 1X5SA 9RUBA 2J9CA 4ZITA 5KT7A 1IBKF 2FUG9 1S6QB 1VJWA 5CYQA 2HHWA 2BKNA 2HQGA 2J7KA 1BWVA 1QJHA 4X4TA 3CCVS 3EGZA 2PD1A 2ROGA 1VS3A 3GR1A 3RRKA 4MIAA 1MU2B 2HPUA 4LBPA 4Q2LA 1N56A 4LMZA 2KYXA 5H9FK 3H8YA 1KOOA 5E3AA 1J5EF 1G2EA 2EKYA 2N3LA 3CJKB 1VLOA 2F9DA 5DDOC 3QIPB 1HQUB 2PI4A 4LFCJ 2BR0A 1XERA 1R8AA 2VV5A 3N6MA 2HK3A 4QWBA 2ZH6A 1U25A 4HH1A 4N47A 3TR5A 1V3SA 3OUYB 1RJJA 3FGVA 4QIEA 5KFSA 1ZETA 3NL0A 1N6QB 2UVRA 4ED3A 4DLEA 1RAGB 1UWBA 3SMZA 2VA2A 2X3GA 4NXNF 3VAFA 1T9YA 2MYFA 3BR9A 4YB6A 3MPUB 2XMWA 3NOCA 4F25A 3KK3B 1MWYA 2DRAA 2M8HA 2HIYA 4LF9J 1LWEB 5A76A 1VQOS 2C2DA 3MM5B 5KFNA 3FDSA 4QIVA 1RT6B 2B9YA 4KB7A 3MMCB 5CH7B 2QLWA 3NWGA 1UFKA 2U1AA 2IRYA 3I32A 3RYLA 3HZEA 3EMTA 4QR0A 2W2QP 3I56S 2ZHBA 5H9EJ 2MMYA 3M1VB 1S76D 2VBYA 3UVJA 2HIQA 2AW0A 2VG6A 2FJVA 3MGJA 4AFFA 4ZIVA 1N5YB 2YNHB 4F2RA 1T94A 3A12A 3KXDA 2OTJS 2UZAA 2DD8S 1GXTA 1JLAA 3IS9B 4AL7A 3T5KA 3RAMA 2WW8A 4XDDA 2BJ8A 1TV6A 4C48A 3HFZB 2CQPA 3RU0A 1HNZF 4WU3A 3PHTA 2RDJA 1M5KC 2IC3A 4CQ1A 4P72A 4USMA 4K4YA 4USJC 2RQKA 3M7VA 1WACA 1HPZB 3BN7A 4CH0S 3VZIA 1VQ6S 4WFYA 4ZVFA 2VQEF 4HI2A 2W24A 3SCKE 1B0PA 2JH3A 4TLQA 3U7JA 1OPZA 4DU8A 1YHQS 2JC0A 5GADU 2HHSA 2OO4A 1LOUA 1YRUA 2NXEA 5C42B 1F9HA 1UZHA 1IKYA 1CBKA 3MFIA 2R4FA 2YWKA 3M2UA 4EO6A 1UPPA 2JEFA 1U1LA 5I42B 1Y11A 2OI2A 3MTJA 4TU8A 2D41A 2MY8A 1KVJA 4WE1B 4DV6F 2IM3A 3ILIA 5BYQA 4IFVB 1NK9A 3DLGA 5ETNA 2HWTA 4HKQA 2LFVA 3A1YG 5AT1B 4K4SA 4C4WA 4CLYA 1JJHA 4JB8B 2XMMA 1JLEB 3W8GA 2ZITA 5CCMA 2BXJA 3DDNA 5HANA 3O2IA 4PAAA 3QYYA 2ZH7A 5HQLA 1HQEB 2KN4A 4J90A 4R0JA 2Q79A 2M4MA 1LWFB 1NBEB 2XMKA 3F41A 3HSGA 2HS3A 4R8UB 4WCEQ 3MUVP 1VMBA 2DR6A 3LO3A 4C97A 3TANA 4YN3B 5KFEA 2APOA 3N4WA
chains in the Genus database with same CATH topology
1SV5B 3JSMA 3IA0A 4RW7B 3NNCA 1MROA 3RR8A 2G1DA 3V5RA 4LFBF 4YB7A 4ZDNA 2HWIA 4JI6F 3QAUA 2CVIA 4IO1A 1V3RA 1N0UA 1B64A 1UP1A 4RNHA 5FLXY 1U49A 3T19A 1DLOA 4F26A 4EEYA 5KG6A 5DS7A 5A8KB 2WCXA 5IM0A 3V6KA 2KT5A 2B51A 3IWXA 2RNEA 2B5JB 3SEOA 5ITHA 3VCDA 3PZPA 2J6TA 4OLPA 1KTQA 3KG4A 1MWZA 1ZM3A 5KFGA 5HQ8A 1L3KA 5C25B 1RT3B 2RE1A 2MXYA 2PO4A 1U1PA 3ETOA 3SFGA 4MFBB 1M0SA 4DEZA 2QMWA 4F50A 1HI0P 4Q7AA 1F9FA 2DNYA 2AJQA 2YX7A 4ZMMA 4JI3F 4DR1F 1Q7LB 1N5YA 5D4OA 3V4IA 4LIWA 2W9CB 5I3UB 5CYQB 4C3KA 2R2RA 4CT8A 5EX0A 5KFMA 5DM7Q 2AJ4A 4KHMA 3TVZA 2V4QA 3G86A 2NYIA 2ZD1B 2MSTA 3NNHA 4EU0A 3DYAB 3M8QA 1R31A 4OMFG 3RRHA 3CCUS 2RF2B 2XGQA 1FO1A 2VG7A 1HBMA 3AHPA 1ZPWX 3KHLA 2ASJA 3CWJA 3OFEA 1TR0A 5BYSA 3FFIA 5M2UA 3C6UB 1X5OA 1N6QA 2PMHA 1N0VC 5J1EA 4LVOP 3ENVA 4RU9A 3LWLA 4I64A 4AUKA 3K59A 1OQ3A 2BE2B 2CJAA 5KFVA 4JI4F 4CZCA 3FEXB 3HDSA 3J80Y 3D0HE 3TRGA 4ZP7A 1F0XA 2B43A 2ZUGA 2E1CA 4QU7A 4ZP6A 3UCUP 5JVHQ 4FN5A 3QZ8A 2XY5A 1QAIA 2OPRB 2OD4A 5IQ6A 3MMJA 4Y2AA 2KG1A 1ZAWA 2PN6A 1S99A 2R7OA 3IRXB 4RZRA 3ISZA 2R8GA 1MMDA 2K7JA 4K0KF 3TA0A 2VH7A 3M6VA 3W2VB 2E9TA 2BZ2A 4KAIA 3DHXA 4RW9A 5IS2A 1RWUA 3SQGB 3PVXA 2XY7A 1TL5A 1VQNS 2OH2A 2MKJA 2C3PA 1TFYA 3HVWA 1N48A 1VGYA 4USHA 5K5MA 2BM1A 3HM9A 3FQKA 4KV8B 1G7CB 1RT5A 3UPFA 3OL8A 5B0CA 2R7RA 4QCLA 1LXJA 5B0EA 3MWBA 3OVAA 2HYIB 2FJWA 1HNVB 2ERRA 2B9WA 3I5AA 3DLJA 4NRTA 4ECYA 2VKRA 1HW8A 3S6EA 2OKQA 3PEJA 2YX1A 4X64F 4CO2A 2DPJA 2MZRA 2VONA 2NS1B 5GAHU 4TY9A 2YVSA 4B9UA 2HVZA 3OHAA 3NP5A 2GJ2A 5HBMB 4OX9F 1YITS 1ULRA 2QLXA 2DGWA 1VQ7S 4QPXA 4OI1A 1C0TA 4I6AA 1P27B 4XAKA 1DTQA 5K8MA 3R1LA 2R7QA 5KFQA 3CF5Q 2XMVA 5SUHA 4IR1A 2XS5A 1KEKA 2KZZA 4MJKA 5CYMB 3OJUA 1S1TA 4ECVA 1KLMB 1YRXA 4PPDA 3NMRA 1OSDA 2CKWA 4LF9F 1RYRA 3BQ0A 4I2QB 2QA2A 2W9AA 1U1RA 2GHWA 2WBRA 5F8NA 3OXLA 3TAMA 3C8YA 5EWGA 5GAGI 4BWMA 3O44A 3NCPA 2HNDA 4ECSA 1DQ8A 2LEBA 5KFBA 5HMZA 4PRFA 4HL9A 1SJ1A 4IG0B 1WHWA 4QIFA 1XBWA 2BANB 2QA4G 3WDOA 2CRLA 2Z4PA 3OL7A 3IR5B 3MEDA 1WF2A 1VQYA 3DRPB 1T05B 1XMBA 5AXMA 1JLFA 2CQ3A 4ES2A 1HNIB 2CQIA 2HRUA 4HVZA 3T1HF 1Z2ZA 3ZC4A 2M9KA 4R5PB 4TXSA 3OL6A 2A18A 1Y5IB 3M8PA 1XWLA 4RBUA 2DR7A 4UOCA 1KC8T 1WEXA 3DXBA 3V4IB 2I9SA 4TN2A 5BR8F 2RRBA 1DJ0A 1QE1A 1F2GA 2PT0A 3HHEA 3BO4A 5DRKA 1SKSA 4B3SF 4W92B 2J9DE 3I0SA 4DUYF 5F0UA 3VAHA 1Q78A 2ZD1A 1V3ZA 2GGPA 2BRLA 3ZZ0A 1SH3A 2LYVA 1NEEA 4Q2MA 1GXUA 2OTLS 2MHEA 3QO9A 4H54A 3MOZA 3DRYA 1PILA 1R27B 5HP1B 1TFWA 2H9ZA 3LUYA 1IKXA 3DXSX 3OSPA 4HDHA 4M5DB 4OJGA 2HHPA 1XEZA 2XWYA 2DNPA 4EZ6A 1FRIA 3PRDA 5FIIA 3M4XA 3A8EA 4N56A 1DLOB 2JLGA 4OIXA 1S9EB 2BJDA 3OL9A 1UL3A 2D3ZA 3M9OB 4FNHA 2FB0A 2KHDA 1X9MA 4A46A 3V6HA 4KE5A 3H40A 1R8CA 2N82B 5CXTA 1LKZA 1JLFB 4H4MA 5DGAA 1FJGF 2RMLA 4K4VA 2V5HG 2IYGA 3NAHA 4FF1A 2CPXA 2ILZA 4B02A 4ZCMA 2GJIA 3KFWX 3TUJC 4NXMF 1HNWF 4Q45A 4P7TA 4YB1P 1Y0HA 3DRSB 3K0JA 3CDAA 2HW3A 2MQLA 5KFLA 4C0OC 1VBZA 2WBMA 3UDLA 3MHYA 1JLBA 2PE8A 5F8LA 1DRZA 2B4OA 1SJRA 3SQGA 2ZJPQ 2HHTA 2P5VA 5D3GA 2HNYB 4A4JA 2OPSA 3DLKB 5E5NA 5KOXA 2QFJA 1NJZA 1PO6A 5KG0A 2K7KA 2VZ9A 3JSYA 4DX8H 3I31A 2L9NA 3VAJA 2V2KA 3QGIA 2KDOA 1T02A 4ZPDA 1KR4A 4EYHB 2DCLA 1M5PC 3KLIB 1FTRA 2I8EA 3UR3C 3M2UB 3UFCX 3D1QA 3DRXA 1FRKA 3CDUA 3ITHB 4UUWA 1JJ2R 3VQSA 4IFYA 1Z1ZA 4BHQA 4M63A 3HKWA 2FHMA 4KKOA 3MMBA 1R0AB 3BM7A 4ED8A 2F8HA 5JXSA 2YTCA 2C2EA 1AUDA 4EFAC 1D8ZA 4IH7A 1NJXA 4WF9Q 3KYLA 1FRMA 2IFXA 2NUHA 2OSQA 2V94A 4U7UK 4HYKA 3MFHA 5D8HB 2KT2A 2VFSA 1BLUA 3M1VA 1WHYA 3D1HA 1EP4B 5C5JA 3D5MA 2F9JA 1E6VA 3LP0A 4G1IA 5L8RC 2IM1A 3KTQA 3AAWB 3K5MA 1YTYA 4O4GA 4B9VA 5HLFB 1TZ0A 4OQJA 4ID8A 1VQSA 5G0RB 4RW6A 1N5VA 2EFPA 4B3OA 3ZZZA 3GV5B 4KO0B 1RT4B 2EK1A 1VK8A 5GAEU 3CE8A 4ED7A 2G9OA 1YJUA 5K8OA 1TKZB 5D4PA 1R8BA 1C1BB 4DR3F 5KOWA 3MEDB 3DM2A 1R8PA 4JI2F 2UXBF 4E98A 4TQRA 3KK1A 1QY7A 1NH7A 1GT8A 2YKQA 7FD1A 1YIJS 3GV7B 1YBAA 2B9XA 1VBYA 1S1VB 5C25A 4IH5A 2KHCA 4QWDA 2UVUA 3M8SA 4URQU 1WHVA 1S1XA 2BACA 2DTJA 4O23A 1Y5NB 5I42A 5F9LA 1FNMA 3MMAB 2R9LA 1VBXA 2AGQA 3THTA 2VFUA 3HO1A 1ZM2A 2JFDA 1IN0A 1QSLA 1EETB 1S6QA 1TL1A 2E5GA 3UCZP 5LSLA 3I9V9 4DLGA 4EYIB 1MNEA 2M5YA 2XC9A 1DQ9A 2VOOA 3N0VA 3E01B 4A8YA 1U8SA 2LA6A 4P6QA 3FMBA 4ECWA 2DCUB 4KGMA 2YWEA 3DFEA 1CLFA 2DR5A 2LEAA 3WC2A 4ZP9A 1LW0B 4OZNA 2RILA 2HS0A 2M3DA 5K8PA 4QU6A 1REVB 2UUCF 1QAYA 1KVIA 4K4UA 1VC5A 5KFZA 4HTIA 2UUBF 1K73T 4YOEA 4RW8A 2I2YA 1N54B 5ADZA 3BEGB 4ZPCA 1CC7A 4NLTA 2GHPA 4F4ZA 3MR3A 3DOKB 3PIOQ 4NLWA 5D77A 3OVSA 1QM9A 4JUZA 2DGSA 2CPFA 4NZ6A 3MM5A 3MM8B 3QGHA 5J2PB 3UD3P 1IJEB 1S77D 2ZZMA 5G4DA 4H4MB 3EGWB 3MECB 1FE0A 4OZJA 4F4YA 3HKZD 2J5AA 1R3NA 1TKXB 3NBPA 1S1TB 3LP2B 1FVQA 2VASA 4ELVA 4F4WA 2YX4A 4NLOA 4ALZA 5JVGQ 2ADBA 4RBVA 3FZ2A 5A8KA 3VQTA 4OL8A 2WAQD 2JEIA 3RZAA 4QYZJ 1X4GA 3AH6A 3IRXA 3OTDA 3R3TA 1YVFA 2NXUA 2CPZA 2VL1A 1HARA 4O3PA 3HXMA 1NHVA 1VC0A 2ZE2A 1WG1A 1TK0A 2ZH4A 1IKVB 5LSRA 3PEHA 1AROP 3LGMA 3K5LA 3R5AA 1S1WA 3GQCA 4P7VA 1UA0A 4OZLA 1APSA 2NSCA 2MGZB 5L1KA 1SIZA 2KFYA 1XR7A 2KXFA 3J7Z5 4Y2CA 4NLYA 4DS5A 3IO1A 1CQNA 2DHXA 2JHEA 1JLGB 2DISA 1NK7A 3FFIB 3OXGA 1UFWA 5CHCB 3AB2B 4FXWA 4X62F 3VTIA 4Y34A 3UE2A 1U47A 1RYSA 2J0QD 2LCWA 3T5JA 4CIOA 4DQRA 3IN5A 3M8PB 2ZOFA 4OJHA 3TVKA 1WEZA 3MEGB 3FEZA 4NCBA 2ASLA 5J2QA 2UV8G 2LA4A 2A1BA 2E9RX 4IG3B 3TQ1A 2IA6A 2MSSA 2VB6A 2COLA 3DLGB 2JDJA 4DR7F 1XN9A 3TAQA 3Q8SB 3DYAA 2MKIA 4NYZA 4C8LA 1IBLF 3B4MA 3D2WA 2N3OA 1FERA 1JLQB 3V2UC 2LXUA 1S9GB 1HWUA 2E5IA 3TAMB 2GMLA 1KS2A 1FNOA 1LWCB 1YQHA 5F8HA 4UQGA 4K5RA 3KK2A 4ZS6A 3TUZC 2FLPA 1BWEA 3HF5A 2GMHA 2PA8D 3DLKA 4KC5A 5AJ3F 3MM9B 4QR2A 1FXDA 2GNKA 3KMSA 5IM0B 3EPIA 4PG7A 1XMOF 2JLFA 3L7PA 5FDLA 3KK1B 1SI9A 2B4VA 4NYPA 2G0CA 4QIWD 3CD7A 3MMCA 2RRNA 1HBNA 1VLYA 4YEAA 1H98A 4PG5A 4ETXA 2MZJA 3T1AA 5HO4A 4AQYF 3CSKA 4FF4A 4QJVA 4WKYA 1KLNA 1M5HA 3VR1A 3B78A 1LW2B 4ILLA 4RWXA 4MTPA 4MK7A 5I3UA 5IT4A 1B0TA 2Z2MA 2LQ9A 3LAMA 3MEEB 4RU2A 1UJ5A 1ZPVA 3I0SB 2UUWA 3SZ2A 2XULA 2LKZA 2ZBCA 3HLUA 4C8ZA 4YDDB 4YHHF 4J37A 2KRBA 3OTCA 1U48A 4B9TA 3D28A 3UD4P 2ALZA 3BZQA 4ELTA 4AE5A 2DIVA 3CD0A 4DQPA 3GWCA 3PW7A 4WE1A 2D3OR 1IKXB 1OS5A 2KXNB 1REVA 1SL1A 3BDPA 3H2LA 1W2BR 2F7VA 2KO1A 3SCIE 3BR8A 1I1GA 1FDNA 3JSMB 1HWIA 3P3DA 1NHUA 2R7SA 1TAUA 2DGVA 3OW2R 2UUAF 1DARA 4J9PA 1TQLA 4FVMA 1SBRA 4G3IA 1S1UA 3R5DA 5DLGA 3PW0A 3DOMA 3HK2A 1J5OA 4BDPA 1H7XA 1JXEA 2FJEB 1KQSR 2HFOA 1IQZA 1QTMA 5HMXA 2HVIA 3DOLB 2NPIA 3Q8PB 1AW0A 1FF2A 2YH0A 3NGKA 4U67Q 1U45A 1N8RT 2C3MA 3PW2A 2GO8A 4XO0A 1RTIA 2UVWA 2KG0A 4I7FB 4KPYA 2IRXA 3PX6A 1WD6A 4HI1A 4QWEA 3OJSA 1WTBA 2E5LF 1R7IA 5CA5A 1I94F 3QGGA 2M8DB 2HAIA 3MPVA 5EHHA 4DV2F 4EZ9A 1X4HA 2RQMA 1K0TA 3IG1B 3NS5A 3MR5A 4NLPA 4U9RA 2PFFB 3CC7S 1PC4A 4OX6A 5JJBA 2YWFA 4TY8A 4WYWA 2RDIA 1HWKA 5AE2A 2OSRA 1H2VZ 4ZCIA 3AB4B 2LDYA 3QAEA 2KKHA 2W9BB 1RDRA 2NQPA 4TYBA 2KVIA 5M2RA 2HZCA 2EBEA 5EDWA 4NCGA 3U1LA 2VBXA 1Q53A 3FZBA 2ZH2A 3H2VE 1PC5A 3E8OA 1FRLA 1JXLA 5KFDA 1XC9A 1SL2A 2IC3B 1RT2B 4DWIA 4RUHA 4JI1F 1VRUA 1YRTA 3QGPA 1S97A 2HFZA 1X5TA 2B4PA 3BGUA 4UY8T 3PX0A 5F3TA 3HHNB 3QIPA 4XDCA 5SZTA 3Q23A 1R6YA 5B0GA 4FBUA 2J9DA 1YJVA 3K8WA 2E1MC 3I0RB 4JI0F 1S9FA 2PDAA 5A8WA 1VQ8S 2X1BA 3C6TB 3RBEA 3C46A 2QEXS 3CC4S 5LMNF 1TKZA 1RKJA 1N33F 4DFPA 4PUOA 4MAKA 1N5QA 1BQMB 1UJ6A 3KLVA 2V9KA 3CCMS 3DLBA 2N4CA 3M2RB 1LWCA 2BA9A 2H5EA 2E5HA 3MD1A 4BC9A 3B4DA 3OLBA 1LWEA 3KK2B 1Q81T 2VA3A 2ASDA 1SIWB 4RW6B 3TA2A 1TVRB 1X8DA 4I4BA 1U1KA 2W25A 2FDNA 2AYMA 2WB4A 4ZVHA 3O6QA 5KFXA 5DDRC 1I6JA 4JBCA 5F9NA 4OJ3A 2LXIA 3ZZPA 1T05A 1Z2LA 1CEZA 1HNXF 4HHJA 1KSPA 1HBNB 1HD0A 3UW1A 3AQOA 3CCTA 1GXLA 3CIMA 4Q5VA 5KT4A 2ADCA 1MU2A 2HHQA 4NLUA 4LFCF 2GIQA 4ED6A