3DOKB

Crystal structure of k103n mutant hiv-1 reverse transcriptase in complex with gw678248.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
425
structure length
402
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 106
structure length 402
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dokB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dokB03
2HNYB 2OPSA 4DL3A 1HARA 5KG5A 1RT7A 4KO0B 1NNDA 3I0SA 1JLAB 3KK2B 5CYQB 4IG3A 1HQEA 3C6UB 5F8GA 1TKTA 3PJXA 4EYIB 1RT5A 3KLEA 1KHWA 1JLBA 1LWEB 2JLEA 4TQSA 1T3NA 2WOMA 5C25A 3QLHB 3DRSB 4RW6B 3H4BA 5KFGA 4KSEB 2JEGA 3LP0A 3MR6A 3DMJB 4MIAA 2YNHA 2QV6A 5JUMA 2E9ZA 3PVXA 4Q0BA 4WYLA 2HNYA 2WTFA 4JV1A 4K4VA 2C2RA 4KO0A 5CYMB 2EC0A 2GC8A 1JLAA 3BGRB 3QO9B 5CYQA 3KK2A 3GV8B 3KLHB 2GIRA 2R8IA 4F50A 4KBIA 3C6UA 4WYWA 2GIQA 3SFGA 2BQRA 2ALZA 2IBKA 4GC7A 4K4ZA 4NLOA 4O3SA 3BSOA 1LWEA 5K14B 2IJNA 2YNFB 4ID5B 2VG5B 3QLHA 3DRSA 4RW6A 4DEZA 3CDUA 4IFVB 3V4IB 3DMJA 1S48A 4Q45A 3JSMB 2IMWP 3DOLB 4J9QA 5L1IA 3DLEB 4GC6A 3MEDB 4MKAA 5CYMA 4ED7A 3DDKA 3V6HA 3BGRA 3QO9A 1SV5B 1RT6B 3KLHA 3HKWA 1VRTB 5KFHA 3PW0A 4RW8B 4K4WA 4URGA 1S4FA 4LSNB 1SH2A 5K14A 4O3QA 2YNFA 4ID5A 5EWEA 2VG5A 3ISNC 2AGOA 4H54A 1FK9B 3MEGB 4IFVA 3RB6A 2BE2B 3V4IA 1EP4B 1JLGB 3FDSA 3JSMA 3EZUA 3DOLA 3OLAA 4KV8B 3I5AA 3QIPB 3DLEA 4R5PB 1TL3B 3MEDA 1S1WB 5KFZA 3Q8RB 3QZ8A 2OPRB 4ED3A 3ITHB 1SV5A 3NL0A 4RW9B 1VRTA 5JXSA 3RB4A 2AU0A 3H5XA 5KFMA 2C2DA 4RW8A 3UQSA 5KFKA 1HNVB 3CJ4A 4K50A 2I1RA 4LSNA 3KJVB 2DPJA 4IH7A 1JXLA 1ZTWA 5KFNA 5DLGA 4FS1A 3NGDA 4PQUB 4KFBB 2B5JB 1FK9A 3MEGA 4J9SA 3FRZA 5KFOA 2BE2A 1EP4A 3I0RB 3KHRA 4PWDB 1JLGA 4IH5A 4YMEA 3MFIA 3DRRB 4KV8A 3G6VA 4R8UB 3QIPA 4R5PA 3EPGA 1S1UB 1TL3A 1S1WA 1C0UB 3E01B 1DLOB 2OPRA 5J2QB 3GIKA 2JEFA 3ITHA 4NRTA 4IQXA 4QPXA 4RW9A 2HNZB 4WFZA 3HVTB 4MFBB 4TLRA 3QGHA 4KHRA 4F4WA 1HNVA 2V4QA 3KJVA 5DQHA 4I2PB 3GV5B 4R0EA 4KHMA 3LAMA 3V6DB 4PQUA 4KFBA 2B5JA 3CJ5A 4IH6A 5KFTA 3PZPA 3CWJA 3RAQA 4TYAA 3I0RA 4PWDA 3H5SA 4RU9A 4IR9A 3DRRA 2IM1A 1SH3A 2BRLA 4R8UA 1KLMB 4Q43A 1S1UA 1UWBB 3E01A 4YR3A 3MR5A 1DLOA 4LSLB 5J2QA 2W9BB 3M8PB 1S9EB 3H40A 4FBUA 3D28A 4MK7A 1TKZB 3RAXA 3OL9A 4Q8EA 2HNZA 3HVTA 3Q8SB 3BQ2A 4MFBA 4TN2A 1RTHB 3OL7A 4U7CA 1TV6B 1IKWB 1QAIA 4Y2CA 2DPIA 3G86A 4I2PA 4I2QB 5KT2A 3V6DA 4QWCA 1N4LA 1MMLA 1D1UA 2IM0A 3H2LA 1RT1B 4IKAA 3CIZA 4ZVEA 5KG1A 3T5JA 4WZQA 4IOBA 3GV7B 1HYSB 2IJFA 2YNGB 1KLMA 4O3NA 2FVCA 1UWBA 2W9BA 4NZ0A 4LSLA 1S9EA 3M8PA 3IGNA 2VG7B 3IS9B 1TKZA 2IAJB 4DL2A 1CSJA 2FLNA 4NLQA 1HPZB 1W25A 1RTHA 4ECYA 1TV6A 4RW7B 1IKWA 1JLCB 2FVSA 2CJQA 2V9WA 4RUCA 4ZPCA 3BJYA 2F8EX 4I2QA 2B6AB 2BQ3A 4NLGA 1ZETA 4WXOA 5KT4A 1HMVB 1RT1A 3QIDA 5D3GB 4ECVA 3TAMA 1HYSA 4ED0A 4O4GB 3CDWA 2YNGA 4LQ9A 3FFIB 1RT4B 2VA2A 2D41A 3IRXB 5KFJA 2VG7A 3IS9A 2FVRA 4O4RA 2IAJA 1LWFB 1IKXB 3T1AA 1HPZA 3FQKA 3RBDA 3Q8PB 2FLPA 1OS5A 5DGAA 1N48A 5KFVA 4RW7A 1JLCA 3BSCA 4YP3A 2HMIB 2W8KA 2B6AA 5L9XA 5KFEA 3QGGA 2W9CB 1S0OA 4J9MA 1HMVA 5F9LA 5D3GA 3PW5A 3G6XA 3PW7A 5F8JA 4K4TA 4O4GA 1GX6A 3M9MB 3T5LA 3LALA 3MECB 4ECWA 3FFIA 1RT4A 3N6MA 4QWBA 3IRXA 5L1JA 1LWFA 4RNOA 1IKXA 4J9NA 2YKMB 3DRPB 5KFQA 1S10A 3CDEA 1QAJA 4NLWA 1RYRA 3M8QB 3OSPA 3MF5A 4K4XA 2AWZA 2J6UA 4NYZA 4EBDA 4Q44A 3GIMA 4YR0A 2HMIA 2CKWA 4U6PA 4NLXA 2D7SA 1RA7A 4EO6A 4ECQA 2W9CA 4YQWA 2R8KA 2OPPB 2BRKA 5DG7A 4G1QB 1LW2B 1T03B 2ILZA 3FQLA 3MECA 4ZP8A 4FBTA 1RYSA 4ECZA 3GYNA 2FVPA 1U09A 4NLVA 4WXWA 2YKMA 3DRPA 4IG0B 4WFYA 5DGBA 4ICLB 3I5BA 1GX5A 3M8QA 4RNFA 1JLQB 3DOKB 4MKBA 4RW4B 4B3OB 3HVWA 2OPQB 4NLUA 4ZPDA 4KB7A 1C1BB 4KKOB 2QE5A 2BQUA 2HWIA 4ECUA 3MFHA 2XI3A 4EBCA 4JV2A 4EO8A 3KK1B 5KT6A 3KNAA 2OPPA 4X2BA 3QZ7A 3GIIA 3Q8QB 1RTJB 4ZP7A 5KFAA 3LANA 4G1QA 5EWFA 1LW2A 1T03A 3OL8A 4YR2A 4RNHA 3UPFA 4RUAA 1RT3B 1RTDB 5L1LA 2UVWA 5KG0A 4IG0A 4ICLA 4HYKA 4QW8A 2C2EA 1JX4A 2HNDB 1J5OB 1K1SA 1NHUA 2ZD1B 3NBPB 1JLQA 3DOKA 3GQCA 4NLSA 2AGQA 2VG6B 4RW4A 3BQ1A 4B3OA 1S97A 1LWCB 2OPQA 3NMAA 4KE5A 1C1BA 4KKOA 2FJVA 3H5UA 3MR3A 3KK1A 4ED8A 2E9RX 2UVVA 1XR6A 1S1TB 3H5YA 1RTJA 5T14A 2IM2A 4JV0A 1EETB 1TL1B 4J9LA 2R8GA 2O5DA 4J9OA 2R2RA 4ZP9A 1C2PA 5KFLA 3IN5A 1REVB 4PUOB 2ASDA 3CO9A 2XC9A 1RT3A 1RTDA 3I5CA 1WNEA 5DG8A 4NLDA 2UUTA 4ED6A 4NLYA 2WONB 3DLGB 3BR9A 1BQMB 2HNDA 1J5OA 4F4ZA 5J1EB 4F4YA 2ZD1A 3NBPA 2R2SA 5KFRA 3UR0A 5KFPA 3GILA 2VG6A 1LWCA 1S6QB 1RAJA 4IDKB 5J2PB 4NLTA 2UUWA 4QWDA 2ATLA 1S1TA 2WCXA 4EEYA 5J2MB 2R2TA 2FLLA 1EETA 2XWYA 3QYYA 1TL1A 2R8JA 4FS2A 1REVA 4PUOA 4IRCA 1YVFA 2XGPA 2HAIA 5KFXA 2WONA 1S1XB 3DLGA 3TAMB 2RDJA 1BQMA 5HBMB 5J1EA 5KG4A 1C1CB 4MK9A 5DQIA 5F8HA 3KHHA 5KFSA 3ISND 4K4YA 2OH2A 1S6QA 3H98A 4XPEA 3IG1B 4IDKA 3FSIA 5J2PA 1RA6A 4I7FB 1RDRA 1TQLA 4ZMMA 4WZMA 2IC3B 1C0TB 3RB0A 2RKIB 5J2MA 3D5MA 4K4UA 3TVKA 3BREA 2C28A 1S0NA 4ZPAA 4ZP6A 1XR7A 2AX0A 1JLEB 2YNIB 4H4MB 4MH8A 2D3UA 3M9NB 4ZVFA 1S1XA 3QGIA 4MIBA 4ZVGA 5HBMA 5KG7A 1TKXB 1C1CA 2AQ4A 1T94A 2HWHA 2J6TA 2AX1A 4IFYB 1TVRB 3IG1A 2C22A 5F8IA 4I7FA 3TQ1A 1IKYB 2IC3A 1C0TA 5KFYA 5KFCA 4J9KA 2RKIA 4TY8B 1SUQB 5J2NB 1S9GB 3DYAB 5HLFB 2WHOA 1D0EA 4TYBA 1HNIB 1MU2B 3OHBA 4Y3CA 2UVUA 1BQNB 1JLEA 2YNIA 4H4MA 2JEJA 1S0MA 2WRMA 3JYTB 5KFFA 1FKPB 2XCAA 1S49A 1TKXA 2FVQA 5KFDA 5F8NA 4TY9A 3PW4A 4M95A 5KT3A 3T5HA 3UDLA 3KHLA 4IFYA 2R2UA 4M94A 1TVRA 4NLPA 4JUZA 5DG9A 2J6SA 3T19A 3BSAA 1K1QA 1IKYA 5L1KA 3MEEB 4ZPBA 4TY8A 4J9RA 1S9FA 1SUQA 5J2NA 1S9GA 3DYAA 4DL7A 3HVAA 5EWGA 1SH0A 5HLFA 4QWAA 3PW2A 3T5KA 1HNIA 1XR5A 4Y2AA 4TQRA 2V0NA 1MU2A 3SFUA 4ED1A 2RF2B 4DL6A 1BQNA 3DM2B 2IA6A 4F4XA 3OL6A 2W8LA 5C42B 3JYTA 2IM3A 1FKPA 2D3ZA 3VQSA 1N6QB 4ZHRB 3OHAA 3G6YA 5KG6A 5KT5A 4NLRA 4WE1B 2FJWA 2B43A 4QW9A 5FDLB 5EDWA 1JIHA 1QE1B 3N6LA 3NAIA 3MEEA 4HKQA 3IGVA 3NKYA 1RT2B 5KFBA 1JKHB 3HHKA 3CVKA 5KFUA 3H59A 2YKNB 2RF2A 4H4OB 3DM2A 3KK3B 1N5YB 5F8MA 3GIJA 5C42A 4DL4A 5HROB 4RNNA 1N6QA 3BQ0A 4ZHRA 1LW0B 4XPCA 1KHVA 4ECRA 5KG3A 4WE1A 2W9AA 5DQGA 5C5JA 5FDLA 1JLFB 1QE1A 1S6PB 2I5JB 4KAIA 3KHGA 2XI2A 4ECSA 4ED2A 2JC1A 4NCGB 1RTIB 2ILYA 4MK8A 1RT2A 2ZE2B 3LP2B 1JKHA 1T05B 3LAKA 5I42B 1Z4UA 2WK4A 1ZTTA 1IM4A 5HP1B 3V6JA 2YKNA 4H4OA 4WFXA 2ASLA 2E9TA 3KLFB 3KK3A 5KFWA 1N5YA 1RT6A 2ASJA 1QUVA 3KLIB 2W7OA 4J9PA 4IR1A 5HROA 4IRDA 1NHVA 3PHEA 3DLKB 2BR0A 1LW0A 4K4SA 3MR2A 4QWEA 3KMSA 3PR4A 3LP1B 1DTTB 2V4RA 3EPIA 1JLFA 4DL5A 1S6PA 2I5JA 2UVRA 5C24B 4NCGA 2XCPA 1RTIA 4XO0A 1FKOB 2ZE2A 3LP2A 1T05A 5I42A 3C6TB 4URSA 3N6NA 5HP1A 3MTKA 4Y34A 3KLFA 3CJ2A 4EBEA 3PR5B 3KLIA 2WB4A 2R8HA 4O3RA 4Q8FA 3V81B 4DG1B 3DLKA 4LQ3A 4O3PA 3OSNA 1VRUB 1I6JA 3LP1A 1DTTA 4G3IA 5KFIA 3V6KA 5EUHA 4O44B 5I3UB 4RNMA 5C24A 3OLBA 4O3OA 3KMQA 3KOAA 1FKOA 3ICLA 3KLGB 3KLVA 3C6TA 3NAHA 3CJ3A 1C0UA 3H4DA 2BANB 4EYHB 2AGPA 5DLFA 3DI6B 4IRKA 4ECTA 1HQUB 5F8LA 1DTQB 3SI8A 3V81A 3PJWA 1IKVB 4DG1A 1R0AB 4ZVHA 1S1VB 3RBEA 1N56A 3BSNA 2OPSB 1VRUA 5F9NA 1RT7B 2FJXA 2JC0A 3I0SB 2W7PA 4O44A 5I3UA 4IG3B 1HQEB 3RB3A 1TKTB 5KT7A 1RT5B 3M9OB 3KLGA 3KLEB 4RZRA 2VA3A 3E51A 4URQU 5KG2A 1JLBB 2BANA 2WOMB 5C25B 4NRUA 4ECXA 4OL8A 4TXSA 3DI6A 3CJ0A 2JEIA 1HQUA 1DTQA 3LP0B 1TP7A 1IKVA 1R0AA 2YNHB 1S1VA 2RDIA 2ZKUA 4Q0BB 2XGQA
chains in the Genus database with same CATH superfamily
1H0HB 4KO0B 1WG1A 4YB1P 2RUSA 3C6UB 2HAFA 3DDNA 5D0RA 3ILLA 3BH6B 3OD2A 4NL5A 2RE1A 2PSZA 4I69A 4CDIA 1JLAA 3SFGA 3NS5A 2V2VA 4ZLJA 2NUUG 3SV3A 4ZJOA 2P8IA 3QRRA 1SQEA 4ED7A 4HTJA 1RHKB 3S1TA 2YNFA 2AGOA 2BYCA 5H9EJ 1WOOA 1FDNA 2M0GB 3IFEA 4C8NA 4DR5J 2MLZA 2EG2A 5JXSA 4DV0J 5AXKA 2ZBRA 1VS3A 1N33F 3KJVB 3MUMP 3LGMA 5E3QA 3C15B 4AL5A 2WVFA 2HHHF 4OX7A 3D6TB 6FD1A 3MMBA 4MFBB 1S79A 4DQPA 1M1HA 2DBBA 1FI4A 1NH7A 3BDPA 4R8UA 4YR3A 3VWSA 3PW2A 4BCAA 2HNZA 5BJRA 3OL7A 4OYOA 1KN6A 1QAIA 3AT1B 4HACB 2IBOA 3NNHA 1MMLA 5ETSA 1ZM3A 4ZVEA 2UU9J 2BM1A 4PAAA 1S9EA 1ZM9A 4NLQA 2A6OA 2VZ9A 1WEZA 2V9WA 5B0DA 2HYIB 3UDVA 1NDLA 3BH7B 4WXOA 3TAMA 1PG5B 2XSJB 5H1SV 2VA2A 2D41A 5KFJA 3HHEA 2A0FB 4UY8T 1F5AA 4DUYF 4DS4A 2LKZA 1HMVA 3PW7A 3LGHA 2A10A 1IKXA 3DRPB 5KFQA 1X5OA 4NYZA 4Y2IA 4CLKA 3GMGA 4DPUA 2KZMA 4B9NA 4ECZA 1FX4A 1U09A 2V67A 3A4TA 2E1CA 3P6YC 3CCQS 2BBEA 1I5OB 3VAFA 2QIFA 1T03A 1HNZF 4ED4A 5IZHA 4P75A 3FEYB 1FRLA 2L9NA 5CCLA 3DOKA 2FUG9 1N36J 4B3OA 4KKOA 1NJZA 2AZ3A 1U2FA 1OPIA 3PIOQ 2OIHA 4XDDA 3D9BA 1RAHB 3IN5A 3KG1A 3WIUA 2C1EB 3W66A 5C7PA 4DFJA 2VG6A 3R2CJ 1NB2A 2FLLA 2IDLA 3U1NA 4ZJLA 2V2KA 2HFUA 4OI4A 1R0BG 5HBMB 3JQJA 2PEBA 4OYXA 4ZPVR 2VOOA 3UDCA 2RHSB 4I64A 2C28A 4RLEA 2JOQA 4OZJA 2M4MA 1UJ4A 3SV4A 3IG1A 3FVYA 3PG9A 4DSEA 1NK7A 4J9KA 4LF1A 2IIHA 2WRMA 2LU1A 5HATA 4J91A 2CA9A 2R2UA 2Z0GA 2YQ0A 4GVLA 4NZ6A 4ZPBA 2H5EA 1SH0A 1HNIA 1XR5A 4Y2AA 2BACA 3PYDA 1U6BA 1VLOA 2W24A 2E66A 4KH1B 1M5KC 3NAIA 1VQYA 3ZTSA 4RL1A 5IXUA 1FNMA 4DV6F 3Q89A 4LF9F 3KDOA 5FDLA 4IOAQ 5G4DA 2AEMA 4G6VB 1UA0A 2YWHA 3V6JA 2B4PA 2ASJA 3OVBA 3AODA 3TJ8A 2DR6A 3EDQB 1U25A 5I42A 1WHVA 3TAPA 2AKWB 3D6HB 2JHEA 1K0VA 4EBEA 4NE9C 3V81B 4E2FB 2CNKB 4OYIA 3LP1A 4RKUC 1U47A 4WCEQ 4B9SA 5AJ3J 2K1RB 3TARA 5DLFA 5A2QY 4A8FA 3MZIA 2VBXA 2OPSB 3MWBA 2VBWA 2E7XA 4FKYA 1FNOA 3KLGA 2LYVA 5K9FA 4OJ1A 1E6VA 3UD3P 2HFVA 3ZZPA 1S97A 3D2WA 3BQ1A 2C2ZB 4V19X 2HVDA 1Q82T 4CZCA 2BDPA 4YFUA 1M5OC 1CULB 2B7BB 5F8GA 5FLXY 4TQSA 3QQCD 4ENOA 2B9WA 3S01A 4L74A 2YNHA 4KH0B 2AF6A 1M1GA 2GC8A 3BGRB 1RWUA 4WYWA 1DZ5A 4OI3A 2UXCJ 3ZXWA 3CDUA 2DCUB 2GVDB 2M7SA 1PGZA 1HWUA 3MEDB 1PBAA 3T41A 1VQ9S 4LREA 2R7RA 4A8SA 5CABA 5B0GA 3QIPB 4R5PB 4PXCA 3AA9A 2QA1A 1VRTA 4QYRA 5GAEU 2ZHOA 3CJ4A 3UWTA 2ZDPA 1W2BR 5KFNA 2EI5A 4KYZA 1DQ8A 4JV5J 1U49A 1B0TA 3N9UC 1GMUA 3LAMA 3VGUA 2FHKA 4ETZA 4DPOA 1XEZA 2I9SA 5IOLA 3DOMA 4PZVA 3T1HF 4Q8EA 2FTRA 1URRA 2VPXB 2RILA 3RW7A 3T5JA 1HYSB 1YJ7A 2IJFA 4USVA 2VG7B 3IS9B 4JI0J 2KFYA 1O0PA 1Q16B 4OYPA 4ZPCA 4F2SA 2OMLA 4X66F 2QFJA 2EK1A 3JTPA 5KT4A 1ZYQA 3QIDA 1J2VA 2B4OA 4DU7A 4C4WA 1HHQA 2ZM6F 5B08A 2ACYA 1ZOTA 2EKYA 4RPFA 3FCVA 1YK9A 4QJVA 2W9CB 1G1XA 2GHVC 5M2UA 3IM8A 2WBRA 4QWBA 5L1JA 3M1VA 2QSWA 1VQOS 2QL7B 2MKJA 1RYSA 3I5BA 1T7PA 2BE9B 1L3KA 2BQUA 2VBZA 3KUEA 4EBCA 5EN1A 1FEEA 1WI6A 3K2YA 4G1QA 2G0JA 1SJFA 3QAUA 2VFSA 2C2EA 1SJRA 4Y65A 1LWCB 2GGPA 4MAKA 3N01A 2CNLB 3T6JA 2HHQA 1SC1B 1FJ7A 2K3IA 2UV8A 1VQKS 2J7UA 4PUOA 5IQQA 3CJKA 3CCSS 4L73A 1UEVA 1U2RA 3OJUA 2WW4A 2JX2A 4ZVPB 4K4YA 2MEWA 2IC3B 3RB0A 3BREA 3UD4P 4CNYA 2RU9A 2EVZA 2QLBB 3M8SA 2CDRB 2GMLA 1FE0A 1F2GA 2L48A 3W64A 4ZVGA 2VU5A 5AXLA 1R8PA 2CYYA 2ZHBA 3UNYA 5KFCA 2VC1A 2LA6A 5K8MA 4H4KC 1FDBA 2LA4A 3ILJA 4OV1A 3ZZTA 3MR7A 3PW4A 5KT3A 1J5EF 3PACA 2HZAA 5BYRA 4J9RA 5J2NA 4NA1A 2HRUA 4F0MA 1RQ0A 3HT3A 3R6LB 2KN4A 4W92B 1S5ZA 1HWLA 3POTB 3J7AN 3M6VA 3SSSA 2VFRA 2YKNB 3OPKA 2ZITA 1EJ7L 2OP5A 1S6PB 4YOEA 2ZZTA 2XI2A 1UEUA 2EFGA 4MK8A 2P6TA 1TK0A 2DJWA 4H4OA 3KK3A 2XZTB 2A6MA 4RBUA 3H20A 1X0PA 4EZ6A 5HROA 2PT0A 3R5GA 2BR0A 2V4RA 2DHSA 2UVRA 2YTCA 4HR2A 1T05A 2PA3A 2FPHX 3MTKA 2PE8A 4J5OA 3D0IE 3PR5B 3BPSP 2IDEA 3OSNA 4WFNQ 2IRYA 2EFVA 5SUHA 3RRGA 2WVBA 2AGPA 2YWGA 2Z2YB 1B7YB 3IAS9 3CMES 4KGVB 2MGZA 5CCMA 4DG1A 5GADU 3I82A 5FD1A 2FJXA 1RAEB 1X0FA 1QUPA 2BV3A 2OLWA 2P9CA 4OL8A 1TAUA 3LP0B 1IKVA 3ZO7A 3KJNB 3Q23A 3RBZA 2RDDA 1G2EA 3OTBA 3MOZA 1UFWA 4Q0BA 2HNYA 1BY9A 2FY1A 2E5LF 1K47A 3NP5A 3CJ8A 3MM7A 1G7CB 4NLOA 3LF0A 4WP9A 4ZVRB 3DRSA 2HVEA 4IFVB 3U27A 3LH2S 2HHSA 5ETOA 4QZVB 5L1IA 3UFCX 5CYMA 3D3CJ 2MQNA 1D9FA 4ZLPA 3ISNC 2ZBQA 4ZKAA 1EP4B 1SC6A 1UVNA 1WACA 1X9MA 2YVSA 4RW9B 4KT0C 2VICA 4AQYJ 5DDOC 1H2VZ 4OX9F 1QAXA 2NYHA 4YMEA 4DX8H 2AZ1A 2OPRA 1REGX 2Y0SD 1FT8A 4C7QA 1U45A 3CPWR 1NO8A 2C42A 3DRRA 1VQ4S 1XNQF 2NLWA 3CCZA 2BOAA 5CAAA 4OLOA 1D1UA 4CLLA 3MHYA 3M32B 4Y00A 4USHA 3R7NB 1Q1KA 2MQOA 3J81Y 2MKKA 3QT8A 1Q8KA 4KHPF 4M5MA 2XZDB 3CDWA 1RUSA 1YHQS 4BDPA 1DFDA 5LOQA 3HCXA 1Y11A 2XYGB 2HZVA 5DJBA 4CTAA 4O4GA 3ENQA 3IWXA 1IBMF 1CC8A 3M9MB 2MDAA 2X51A 2CQBA 1LWFA 2Y3YA 1CVJA 1WUUA 1QAJA 2ZDOA 2GVZB 2PMZD 2D1CA 4EO6A 4ECQA 3VAIA 3FQLA 3O6QA 1TL4A 1CQMA 5DGBA 1U1NA 2CADA 1TUGB 4RNFA 2HWIA 2A18A 4NCBA 3FK4A 3GIIA 4FYDA 2KG0A 1RTDB 4EFAC 2E29A 1U8SA 1CC7A 1OY8A 4Y2KA 1SC4B 3H5YA 4EGLA 5A0YA 2YQ1A 3W9HA 3HFVA 1REVB 1UJ6A 1UCNA 4AT1B 2DXEA 4NLYA 2J9DE 2R2SA 3IBCB 3CCMS 4OQJA 1U1LA 3QYYA 2HIYA 1VCTA 2FC8A 2V34A 2VV5A 5HVFA 3I4HX 3DCAA 3UQSA 1R8HA 5D15A 3AQPA 2M88A 4HTIA 4OHYA 1N32F 3R1LA 1C1CA 1XMQF 2HHXA 4PYAA 1VC0A 1VI7A 2C22A 1YI2S 2QJ3A 2DNYA 4TYBA 2W1BA 4ITSA 3HHLD 5KOXA 1FE4A 2QYCA 3M7VA 1RAFB 1X5TA 1FX2A 5L1KA 4TY8A 3DYAA 1JMTA 4ED1A 3OJSA 1SIWB 2IA6A 2W8LA 2V69A 3EDRB 3OHAA 1HWJA 3P49B 2LFVA 3ISZA 3JQMA 4UOGA 3C14A 3N6LA 1RBLA 1RISA 3NWRA 2GMJA 4DR1J 4NCAA 2DO0A 1WC1A 3DM2A 1EHWA 3H2VE 3QSIA 4XAKA 1Q5VA 1FRKA 1Y00A 4WE1A 3EZ5A 2N82B 1TK5A 1JLFB 2V68A 3W2VA 1KFSA 1M5VC 2PIIA 4ES1A 2X1BA 1NAQA 4NCGB 1Z4UA 2ZE2B 3GR0A 1U2CA 4WFXA 4F4KA 1B7FA 4P7VA 3DXBA 3GWCA 4X62F 1UFKA 3PR4A 1X4HA 4GKKJ 2UUAJ 2ROEA 1RJJA 1FKOB 1NH8A 3Q8VA 4CT8A 5K5MA 4ZVOB 5B7WA 2R7SA 5E0OA 4K0KF 2KL8A 3JAMY 3EE3A 2UXDJ 1RAAB 2V5HG 2BANB 5F3ZA 3NGTA 2E7VA 3PJWA 3AY0A 1X31C 3CF5Q 3W2WB 1V3ZA 4BS2A 3QJJA 1RWKB 4YY3J 3I6PA 1RT5B 1RKJA 1HBOB 4IQMA 3N28A 1O8BA 1S1VA 1HW8A 2XLJA 3KLEA 3F56A 1K44A 3H4BA 5KFGA 4KSEB 1LOUA 1OYDA 3GFYA 2E9ZA 3VGVA 2CQ4A 4DV2J 5IM0A 4A8MP 3QLHA 4RW6A 5JMNA 3DMJA 1NPRA 2VBYA 1NPPA 2FYXA 4MTPA 1B99A 1DQAA 4CH0S 4LSNB 1LQ9A 5EWEA 2VG5A 3QPIA 1FK9B 4MYUA 3RB6A 2FIUA 3JSMA 1QTNB 1FTCA 1TL3B 3EICA 3D1QA 4WWSA 7AT1B 5IV4A 2DHGA 3BGUA 4X84A 1TK8A 1T9UA 3HM9A 3NGDA 3MEGA 2XHCA 5KFOA 2W4CA 2UUBF 4PWDB 3CD5A 1C0UB 1DLOB 4QPXA 1VQ8S 2ZH3A 1H38A 2FGOA 4JYAJ 3K5NA 1YIJS 4IR9A 1HQ2A 3VAMA 2BRLA 5J2QA 3M8PB 3H40A 2RJZA 2LVWA 3HJFA 2ATCB 4ZPTR 4I2QB 4KC5A 1S72S 1XK8A 3AD8C 4ZVSB 1UVKA 3M30B 3AD9C 2L41A 4DI6A 1KQGB 1IKWA 2R42A 3OR2B 3MDFA 2B6AB 2N7YA 2Y8YA 5CD4A 4PPDA 4ANCA 2NPIA 3J80U 4ED0A 4G65A 4Q2MA 4NZ7A 2LQ9A 2F8HA 1FJEB 4O4RA 4RJVA 1HPZA 4RBVA 3Q8PB 3K0JA 5KFEA 2HK3A 5LSOA 5D3GA 4BWMA 3EX7B 2QT7A 2NPFA 2XY6A 2GCFA 3S6EA 1RYRA 3THPA 2AWZA 1XERA 2PDAA 1XC9A 3MMAA 2HMIA 4L3NA 2F4FA 3DGPA 2R7QA 2AHOB 2OD6A 2KHCA 4DXLA 1WF0A 1LWXA 1SKUB 3A3NB 2YKMA 3P5BP 1HBMB 4IG0B 4ICLB 1QM9A 1VBXA 2F65A 1CBKA 3I9V9 1WC4A 1C4AA 2GQCA 4MT1A 3LANA 1SXLA 2KTQA 1S6OA 2DNMA 2OGUA 1JX4A 2PI5A 3NBPB 1JLQA 3NMAA 2E9RX 2J8SA 1RTJA 5CA5A 4JV0A 1UZHA 5IWAJ 1FTRA 1RT3A 1JJ4A 1FRMA 4ED6A 2GW8A 1U6ZA 5J1EB 3R7BB 2GQ2A 1S6QB 4NYPA 1T9WA 5HMWA 2MZRA 2AJ1A 2ASYA 4DOZA 2UUWA 1IBLF 4U7UD 2PFFB 4DCPB 4QU6A 4JB8B 2HVIA 3A12A 2FJBB 2MQQA 2BMBA 3ZZUA 3IWLA 3VZHA 3OTOJ 1HD1A 2IJRA 2X1AA 1PJ7A 3MAAA 4DPWA 2H48B 2M70A 4U67Q 1S9GB 2KM8B 3PXGa 2JEJA 4ZN1A 3PEHA 4DX7A 5GAHU 2UV8G 1TVRA 2AV5A 4OJ3A 3WIVA 1BLUA 3TA1A 4DV3F 2G0CA 4TQRA 5IV3A 3QGPA 1N6QB 1KS2A 4C48A 2XMJA 4HKQA 4UT4A 5GADI 2KZZA 3R5CA 3QWUA 1RWMB 1HBUA 4F02A 3A3PB 5KG3A 1VOMA 2W9AA 5ETMA 3OT9A 1AA1B 4IYQA 2QEXS 3LAKA 4DQQA 2DR8A 1NDKA 4IR1A 2WAQD 4PG8A 2XMAA 3J7A1 1U1PA 4M8LA 2XULA 2I5JA 2CPZA 1YG0A 2Y0BB 1RAGB 4IO9Q 3C66A 2DYAA 2X3DA 2FLOA 3ET6A 3I4PA 3G82A 1NJYA 3LTOA 1RHRB 4B3RF 2HPUA 3VAGA 3ICLA 3Q8UA 3Q0AA 4JI7J 1X4AA 3K8VA 4DSIA 3BEGB 2R7OA 1IUJA 1VRUA 4YDDB 3I0SB 1NSPA 3VF0B 1HQEB 2KRRA 4ES2A 2E1RA 1FRXA 4R0JA 4WU2A 4ATNA 4FF2A 2KU7A 2ZBCA 5HQLA 4LF7J 3DHWC 4OI1A 3K17A 4K59A 2WOMA 3HJVA 4M5IA 5JUMA 1WORA 2IMOA 4DUZJ 3GYXB 5CH7B 4JI8J 4KGKA 4HL9A 1B0VA 1EQMA 1RAOA 2EFPA 2IJNA 3T9NA 1OIAA 1FD2A 4Q45A 4UTGA 2EG1A 3DOLB 4J9QA 3DLEB 1KOOA 3FNNA 3QO9A 5KFHA 4UF4A 2YWKA 4XK8C 4LJMA 1Q7LB 4I6YA 1QVFR 4FZVA 4C98A 4CO3A 3HK2A 1F6TA 1T11A 4UOHA 1F3VA 2C2NA 2HFOA 3H5XA 1U26A 4KFBB 2BXJA 4J9SA 4DF8A 2VHGA 1VQ7S 3FRZA 2EFQA 2KFNA 1XMBA 1UZDA 3HO1A 3H0PA 2NSCA 3BF4A 4DCOB 3RAQA 4TYAA 2NXEA 5GAGU 3X3UA 2OO4A 3RAXA 4CH7A 4QIFA 1UVJA 3Q8SB 2VASA 1N0VC 5KT2A 4QWCA 3TWZA 2XS7A 2A1BA 5CZXA 4LSLA 2FHMA 3ETMA 4NI2B 1P9YA 4M5DA 1JLCB 5HANA 2F8EX 5D0HA 2EXUA 3BKTA 5A2QU 2CJ9A 3P96A 2IRUA 5KFVA 1NBEB 3AOCA 3HKZD 5L9XA 1LFWA 3FZ2A 2MLYA 5F8JA 1FESA 3FFIA 1RT4A 3VHQA 2BEFA 2KI2A 3ENAA 2HHVA 4NLWA 4I0WA 3MF5A 2MSTA 4Q44A 1B4SA 2R8KA 2VIHA 2GFFA 2VPWB 4PG7A 3ZZRA 1TL7A 5A8KB 2HFZA 4HH0A 4ZP8A 4JI6F 2XNQA 4FBTA 3D1OA 1I51B 3JXOA 3F44A 4WXWA 2VPZB 4DV0F 2CXEA 4FKXA 4GMKA 3R1HA 3TNVA 3MFHA 3MM8B 4F4AA 1LW2A 3G9CA 1N5VA 1OQ6A 3M6XA 4B17A 3J7Z5 1OWXA 1MMNA 1RWNB 1AFJA 3J7YU 1EETB 2OMOA 3JTNA 4WIQA 1WNEA 3I5CA 2UUTA 1Y3JA 3DLGB 4F4YA 2HIQA 3HHLA 1P9QC 4PXEA 4LF8F 4C11B 3SDEA 3PRBA 4QWDA 1BQXA 1JJ2R 4DZ6A 4P6QA 2CPEA 3GB0A 4C97A 2LU2A 4IDKA 4ELUA 4I7FB 2KT3A 3MM5A 5J2MA 4KTQA 2QZ8A 5HO4A 4O0IA 5CZVA 3QT7A 2UP1A 4NEZA 2DNRA 4ANEA 1WKJA 1U7LA 1T9XA 2J6TA 4YN3B 1VQLS 1NK5A 1CJUA 1IKYB 1WSRA 1WOSA 4LRBA 9RUBA 3ZFVA 4LBIA 2JNJA 2XCAA 3PYGA 2FVQA 4X4OA 1XNRF 4IFYA 2D69A 2ZH4A 2VF3A 1SQGA 2RRAA 1S9FA 5J1PA 1SJ3P 2YX1A 2RAQA 5L46A 2MY7A 4TKTA 3T1YJ 2V4JA 1NSAA 1GEHA 1WF1A 4N77A 3AXKA 3NRBA 2WVDA 2QX0A 5C42A 1TELA 1BE4A 2BUNA 2QC3A 5I3PA 4F3MA 4DR3J 1N36F 1QE1A 1EB0A 1Q78A 2RU3A 4G1PA 4CWBA 4YDXA 3WBZA 1ZTTA 2E9TA 5D4OA 2W7OA 3D6FB 4X4SA 1XBWA 5A8WB 5AE3A 1SJ1A 1LKZA 4DL5A 3HFKA 3OR1A 2VDHA 2GAGC 3C6TB 5HP1A 2O1PA 4YEAA 2R8HA 2WVCA 3AJ2A 1FDAA 5EUHA 5C24A 3EGVA 1NXIA 1D09B 4EK2A 2CFXA 4AUKA 2VFTA 1Z2ZA 2Q79A 1C0UA 4CO1A 4ID8A 4ECTA 3BSNA 1YJ9S 1RCOB 2FQQB 1GMWA 2YH0A 1QLNA 4URQU 1B70B 3DLBA 2XTJP 1HQUA 1HI1A 2HS0A 3ZTQA 1Y5IB 4LF6J 3QZ8A 3MUVP 1AUSL 5ETTA 1JLAB 4FDFA 4C8ZA 2OKQA 5A8RA 3PJXA 2XLIA 4QR1A 2G1HA 5IT0A 4CO5A 4OHWA 3M2UA 1Q5YA 2JEGA 4USIA 2DT9A 3G87A 3U1MA 1OMSA 4LRAA 4P9SA 2M8HA 2YNFB 4ZCLA 1EKRA 1S48A 4MKAA 2MQPA 3GZ7A 3HSJA 2OELA 1RT6B 3UI3A 1CJVA 3CNQP 1P1TA 3BB5A 3Q8RB 3MMBB 1FXRA 3RB4A 4CLWA 4OX6A 2NXUA 2APOA 3L9ZA 3LW5C 2MTLA 4B3SJ 4R8UB 1S1WA 1FERA 3CCUS 2JEFA 4CO0A 4NRTA 4IQXA 1SI9A 2HNZB 3ENWA 1YTYA 3NOCA 4PQUA 4F2RA 2B5JA 3SSQA 3QSYB 3E01A 3CMAS 1S9EB 4CP5A 1DHMA 4TN2A 1KEKA 1KWMA 4N41A 3V6DA 3CO0P 3TZZA 2F4VF 4BLGA 5F41A 3S8SA 2FVCA 1NJIT 5F0WA 2CJAA 1Y5NB 3B4DA 4F0HA 4FNIA 1U02A 2H5JB 3A1YG 1AZSA 2I38A 1HMVB 1WF2A 4DV7J 3AH6A 1IKXB 3T1AA 4YP3A 3WC0A 2GJ2A 2RS2A 4CRJA 3FBEA 4CO4A 2RSQA 1EAYC 1T3OA 1RLDA 2HBRB 2DEJA 3TO8A 4NLXA 5GMEA 1T03B 3MM9A 4PG4A 2WVEA 4FF4A 3DOKB 1VHFA 4B3OB 4ZPDA 4KKOB 3FCWA 1A0OB 3KNAA 2HSEB 4ZVQB 3BPDA 3T3FA 2O3DA 1NK0A 1VFJA 1KD1T 2Y9HA 1NHUA 2OSRA 2ZNZA 4NLSA 2VG6B 2OPQA 3H5UA 4GVBA 5U47A 2HHUA 5GAHI 1FRHA 4J9LA 4MMOA 4GKJF 4HI2A 2XB2D 2ZZMA 1J5OA 3DRYA 3RRKA 1FXLA 3D4JA 3ULHA 2J0SD 2OTJS 2PFDA 3GCWP 1SVDA 4OZ5A 2CJBA 4DPTA 4AXIA 4DSFA 2DGVA 3UD5A 2VUGA 5K20B 1D3WA 2R7XA 1RA6A 3IG1B 1R31A 2J0XA 3SCKE 4B3TJ 1XR7A 1S1XA 1VIOA 4NYOA 4WBFA 3S7RA 3TUJC 2RKIA 1AW0A 2BABA 1HNIB 5M2RA 1A9NB 3NOGA 4KPYA 3IO1A 3LGNA 3KKFA 1HNXJ 2LLZA 3UDEA 2MHNA 4K5SA 3KHLA 3R8YA 1XN9A 1TKDA 2EFNA 1SUQA 1BQNA 1VMBA 4F4XA 2DGQA 4M5GA 2FJWA 4DQIA 3K7RA 5FDLB 3EGNA 1JK9B 3GLJA 2JZ5A 1YJNS 2VL1A 3GIJA 5EHHA 1VHIA 4DL4A 4KGZB 3WHIA 5DZ7A 1U0HA 2LDYA 5DQGA 1WELA 4KAIA 1IR2A 2KXFA 1HI8A 4DV6J 5GMKa 1RT2A 4KRWA 5I42B 2WK4A 1Q7YT 4DR4F 3OFFA 2J8AA 2QFIA 3HHNB 2F3JA 4IRDA 2YWWA 4K4SA 4PRFA 1QD1A 1KTVA 3LP1B 3EPIA 7FD1A 2KVQE 5EX0A 3CJ2A 2W2QP 1CEZA 1DTTA 1VBZA 2CZ4A 3KLGB 3KLVA 1JJHA 3NAHA 4EYHB 4DJBA 1E6VB 1Q79A 1HHTP 4FNHA 3DLJA 4ZIVA 1UETA 3R5AA 5I3UA 2DISA 1ZH5A 3EXCX 5M2PA 5L39A 2XY5A 2RNEA 3ETOA 3L95X 2AIRB 2YNHB 4QCLA 1QDUB 5T7LA 2B4VA 3Q22A 3NEKA 3MR6A 2CQHA 1L5UA 2W2OP 4G1IA 4ETXA 2GIRA 3QRPA 5GAGI 4PXDA 1LWEA 4DLGA 4I4BA 3IR6B 1ULRA 4GC6A 3SCLE 2AJFE 3V6HA 3HKWA 1VRTB 1VIXA 1MSWD 1UVLA 4URGA 2J7KA 2I0XA 3EGWB 1EX8A 3JS9A 4DSKA 1SV5A 4PWWA 3K59A 2D9OA 4K50A 2CVIA 2RB7A 4KPCA 3NS6A 4CO2A 2BE2A 2XHWA 3O44A 3DOMB 2I8EA 5ETPA 4OYWA 1HNVA 4PCQA 1H7XA 4WKRA 4I68A 1YJUA 4OI0A 4V19J 4K2XA 3I0RA 3H5SA 3TZWA 4L76A 1EKSA 2IM1A 2WW8A 4EMDA 4FBUA 2XSFA 3HVTA 2ZNYA 4ER8A 5HI7A 3PM9A 2N3LA 2AW0A 1Q81T 4OYZA 3R97A 1SL1A 1UWBA 2W9BA 4NZ0A 1HBNA 1W2IA 1TTHB 4ECYA 4OHVA 2B9XA 4HEA9 1SQFA 3LOUA 2MZTA 2YNGA 4LQ9A 2DIUA 2ALYB 2IAJA 2EEYA 3M1VB 2F40A 4RW7A 2Y1LB 1Z1ZA 1OPZA 3BSCA 1N34J 2G0IA 3K58A 1Q8LA 4J9MA 1WJ9A 3G6XA 3IM9A 4W90B 2RD5C 3IRXA 4AFFA 2R7TA 2C2MB 1KQSR 1S10A 1APSA 2NXCA 2QA4S 1LEOA 2BRKA 3G2XA 1F9HA 4F7VA 4G1QB 2XM3A 1UWAA 2FVPA 3CMQA 4NLVA 3THTA 2MB0B 4DWIA 2W7AA 4LR7A 4PKDB 2GGPB 4AQYF 2XI3A 3QZ7A 4ZA1A 1HWKA 3PIPQ 2ADBA 3OL8A 4RUAA 5DRKA 3SXLA 2P2CB 2XLKA 3CCJS 3AFGA 4DSJA 4RW4A 2BZ2A 3TEGA 1V6HA 1YJRA 2MKYA 2IM2A 3BBFA 2R8GA 1M5SA 1RP5A 3CJKB 4PUOB 3C19A 3P5TL 4HT7A 1RAJA 2C3MA 3U02A 5LXYA 1RGVA 4ILLA 2M2BA 4UZBA 2MHEA 2HAIA 2WONA 4C3MA 1K0TA 2XQCA 4YUDA 2WZ1A 3O8WA 3H98A 1TQLA 4XPEA 4ZMMA 4UY85 5KTQA 4ZPAA 3GJQB 2KYXA 4USMA 4MH8A 3R27A 4BHQA 2KG1A 2HWHA 2XMKA 4TU9A 3VAHA 2AX1A 4J37A 5ETVA 1DRZA 3TQ1A 5KFYA 1C0TA 3CD0A 5J2NB 3AB4B 4NWBA 4B9VA 4Y3CA 1JLEA 2YNIA 4H4MA 4JI5F 2GHWA 3THVA 1XIQA 1S49A 5F8NA 1U4BA 1T9TA 2ZZNA 2QLJB 2J6SA 5B0AA 5J1NA 2MKCA 3ILIA 3OFGA 2CPDA 1VBKA 1RHUB 2Q66A 2KT2A 4QPTA 2MKHA 3KJFB 3MEEA 3WZ0A 4P71A 4O0NA 3A8KA 4LT6A 2L9DA 3Q24A 4H4OB 4IO1A 2HGNA 3KK3B 2CPHA 2CQGA 3IA0A 2MKIA 5HROB 4X64J 1LK7A 3GONA 2ILYA 3Q2SC 1T05B 4TU7A 1KNZA 1FWKA 1RT6A 3PRVA 4OX8A 4J9PA 3PHEA 2AT1B 3M2VA 3LPYA 2XCPA 2H65B 4URSA 3N6NA 2RH3A 3KLIA 2MGZB 4DG1B 1N0UA 3HSDA 4A46A 2UZAA 3V6KA 4OMFG 3Q83A 1S59A 3I55S 3F73A 2IPOB 4MIWA 1WEYA 4DN0A 1IKVB 4BBYA 3DGVA 4HLBA 1ZA2B 5BXIA 3RB3A 2ADCA 2B4UA 2F1FA 4FYVB 3UVJA 1PC4A 4ERDA 3ZZYA 1AYEA 4Q0BB 2HNYB 4OV6A 1G6BA 1I1GA 3C16A 4IG3A 4P2XA 3D67A 4DU8A 3MM7B 3QJLA 4RR5A 4U7UK 2JLEA 4C0OC 3NNCA 3DRSB 4CYUA 2QL9B 4JV1A 3HSZA 5CYMB 1TR0A 3ZTRA 4RWXA 5HVGA 4P2FA 3WC2A 1B0PA 4WFAQ 3CDAA 2B56A 4DR1F 2C3PA 5A6WA 5BYSA 1BGXT 3OQ2A 3PW0A 6AT1B 1SH2A 4ID5A 3V4IA 2OD4A 3VQTA 2NREA 2CPXA 2OPRB 2MY8A 4U8VA 3NL0A 2UUAF 1ITPA 4P74A 5D0EA 5DLGA 2HFSA 4LF5J 5EGYA 3KHRA 1JLGA 3DRRB 1EQ0A 4OX9J 2Y1RI 1SPBP 2W2NP 3PEJA 1WWHA 3CCTA 1U0SA 3RYLA 2FC9A 4M5NA 2ZH9A 3OV7A 1B3TA 4M63A 2UXDF 3UN2A 3DC2A 2XO6A 4C2MA 4OJHA 2DHAA 3MR5A 4C8OA 4MK7A 4BWJA 4I2PA 4LR9A 3CIZA 3I87A 2KHDA 2ZH2A 1KLMA 1UW4A 1D8YA 4B9UA 3Q8YA 2V8HA 4OZ3A 1I3OB 3JQKA 1TV6A 2XY7A 4OZ0A 3A8EA 2BQ3A 1G4CA 3HZEA 2JFDA 4CTAB 2CG4A 4O4GB 3GP9A 3FC9A 2HRYA 1LWFB 1RBAA 2CJXB 4PEOA 2AYMA 3FMWA 4DV2F 1XMOF 2KO1A 3HD2A 2L08A 2EBGA 3LALA 1UMJA 4N47A 5T41A 1QSLA 3TJAA 2J6UA 5G0RA 2JH3A 3NS7B 3FBBA 2CQDA 2F8MA 2YKPA 4MYTA 3HVWA 4K2JA 3BO4A 3EWGA 4EO8A 4X2BA 3IMQJ 5A0YB 3LQVA 4USJC 4YR2A 2MPUA 5L1LA 2OUGA 1NCLA 2YKOA 2AGQA 1YX2A 2FJVA 1VDHA 4JYAF 2V2ZA 2GA7A 1MWYA 4CM2A 4QR2A 4DQRA 2ZD1A 5KFRA 2MQ8A 2Q43A 1WC0A 1RSCA 1PYTA 3CCRS 1ZBTA 1R43A 1BQMA 1C1CB 2GHPA 3KHHA 5KFSA 5J2PA 1RLCL 2H51B 2IA0A 3TOQA 1CS4A 1DAXA 4ZDNA 1X4BA 2AQ4A 3O2IA 5F8IA 2DRBA 4TY8B 3DYAB 2K7JA 2DO4A 4X4UA 3RUBL 2RT3A 3T5HA 4NLPA 1WG4A 2DNLA 2AD9A 3C14B 4RBTA 3HVAA 5EWGA 3CCLS 1MU2A 3SFUA 3DM2B 4CLSA 2J7WA 5HQ8A 2BJ9A 4RWWA 5KG6A 5KT5A 4WE1B 3W2VB 2BJ8A 1NU4A 2DNPA 5B0CA 2V63A 2U2FA 4A8KA 2X3GA 5KFWA 1IBKJ 1NHVA 1LW0A 2RRNA 3KMSA 2DCLA 4X62J 5ETNA 4XO0A 1Y10A 3P45B 3FSYA 4M5LA 3DKDA 2CAJA 2IRXA 4G3IA 3GPAA 2V8DA 4K0KJ 3VCDA 2BJEA 3OTOF 4K7QA 4OLPA 5JVHQ 2DY1A 2A3JA 3SI8A 4O23A 4ZVHA 1L3VA 1S1VB 2YKAA 5FIIA 1H74A 1AXQA 5GMDA 2KKHA 3A8IA 3M9OB 3KLEB 1PJ6A 3DI6A 2ZH5A 4JI1J 2DRAA 4F36A 2DGTA 1GT8A 1R0CB 4JI2J 4WPAA 5IM0B 3M8RA 1JLBA 1UL3A 2N7CA 2ZOGA 3QLHB 4RW6B 1PAEX 3DMJB 3DN9A 5C2GA 2NZ4A 2I2YA 3CEDA 4LIRA 3KK2A 2V6AA 4KBIA 2JDJA 2KM8C 3BO3A 5H9FK 2VG5B 2HKEA 4AE5A 3JSMB 3L3CA 2Z4PA 4NASA 3PTWA 3H8YA 1WG5A 3L09A 1S4FA 1F60B 3MEGB 3C3LA 2ZH7A 1NSQA 2E5JA 2B51A 4ZJQA 2LP4A 3L4BC 1SC3B 1HLWA 3UN5A 1PCAA 5KFKA 4WKYA 1MN7A 2QYGA 4FS1A 4KV8A 3G6VA 3EPGA 2KYZA 5J2QB 4OZ2A 2YBVA 5HJYA 4TLRA 4ZOSA 1VC6A 2F63A 3IXQA 1SH3A 4FVCA 2GV1A 3VR1A 1S1UA 1VK3A 4C3KA 4U7CA 1FKAF 1YITS 1IKWB 5DO2A 1RB0A 2J0WA 3A8JA 4E98A 5HK4A 2DY9A 3B82A 1ROFA 3TW0A 2MSSA 1HPZB 4LF7F 2BKNA 5HAOA 1RTHA 1YJWS 3CGIA 3C8YA 1TL5A 1TMMA 3N5FA 4CT9A 4ECVA 3TAQA 5D3GB 3JSBA 4H4KA 3QAEA 1VR6A 3C46A 1OJ4A 2FVRA 1VQ5S 4DUZF 1T0TV 4PQAA 3TI0A 3R6GB 2H1YA 4QYZK 3LUYA 1TFWA 3MMAB 2HMIB 2W8KA 2DH9A 3DGPB 4PG5A 3G71S 2PA8D 2JLGA 2G2YA 1FJGF 3N6MA 2YKMB 5DM7Q 2J5AA 3CDEA 1FRJA 4HI1A 1WHWA 3GIMA 2YQ3A 2CKWA 5F0UA 3MECA 1BWVA 2PO4A 5LM7E 4OYBA 2EKNA 1JLQB 2OJ3A 2BVZA 1HR0J 2OPPA 2M3DA 1RTJB 2ABYA 2XBPA 5KFAA 1RT3B 3DHXA 2GO9A 2FHJD 2LECA 1HD0A 2NXJA 2MYFA 2L3MA 3DDIA 4ED8A 2UVVA 4ZCKA 1T9YA 3W63A 2VQEJ 2R2RA 2P9GA 1E6YA 2HNDA 2HBYB 3R9LA 2W2MP 2LEBA 4EEYA 2XWYA 1TL1A 1IBLJ 1S57A 5CXTA 2C3OA 3MAAB 4DX6A 5DQIA 2E44A 3HZGA 4C8MA 3OFHA 3FSIA 5GVQA 4WZMA 3FGVA 1OY9A 4JOUA 3ZC4A 8RUCA 3TVKA 1S0NA 2K2PA 4ZVFA 2IVFB 4P10A 4CLFA 1T94A 5E2QA 2B8PA 1TVRB 2Y1JA 4WK1A 3W5XA 2Q6CA 3E8OA 3PX0A 1GQEA 1VJQA 2H4WB 3I56S 4TY9A 1HI0P 4FYWB 5DDQC 2J9EA 5K8OA 3UCUP 1HIYA 1HBUB 4P2SA 1FKPA 3BYPA 4DV3J 2DTJA 2EW9A 3G6YA 1XJWB 3EVMA 1MWZA 1X4DA 3H59A 4ZLLA 2LQ8A 4ZHRA 1UW9A 1KHVA 3RBXA 4C9DA 2KDOA 4OHZA 2MMYA 2J0QD 2I5JB 2Z30B 3CJRA 1N52B 2N3OA 4PPZA 3ET6B 3AOAA 3G82B 4QWEA 1EIYB 2E1PA 2KRBA 1RTIA 3TVYA 3M6UA 1NDCA 3KLFA 1YKWA 4ZIWA 4O3PA 3NLCA 1VRUB 4NXNJ 3GJTB 4U96A 1M0SA 4O3OA 3KOAA 2RRBA 4C0HA 1P8GA 4B3RJ 1HNWF 1P6TA 4CM0A 1Y7PA 3W9IA 4NA2A 1DJ0A 3WX8A 1O51A 4O44A 5KT7A 4A4JA 2IYIA 2WOMB 3CJ0A 1HL6A 1IQTA 3G96A 3MOJB 1TP7A 2OFHX 1RBOB 4QQBA 1YQHA 4LFCJ 1TKTA 3RU0A 1ZAVA 4ALZA 5C25A 1IVZA 4MIAA 5E33A 3PVXA 1PSDA 1T8EA 2WTFA 1QJHA 3T1YF 4DSLA 3QO9B 5CYQA 2BQRA 1SJ4P 3CCWA 3SEOA 4O3SA 1VRQC 4C6AA 4USUA 2DIVA 3NWGA 2V94A 3W62A 2IMWP 3BYRA 3QWPA 3DDKA 3M8ZA 3KLHA 1C4CA 2GX8A 4K4WA 4B08A 3KG0A 3TYTA 4H54A 3H25A 3FDSA 4EZ9A 2J9CA 3QJPA 3EGZA 2C2DA 3P4UB 5BR8J 3OTCA 2UUCJ 5D78A 4DR7F 1M1KT 3ITHA 5LMUF 1EZZB 3T6BA 1N5SA 2QLFB 2V4QA 3NCQA 2VPYB 3NCPA 4IH6A 3CWJA 4Q43A 2ZWOA 4LSLB 3BGOP 2QN6B 4M5DB 5E5NA 4WZQA 2YWEA 3MI7X 5D4LA 3OTDA 2OFGX 1X5PA 3SQGA 4N5SA 2H54B 2CJQA 4RUCA 2BKPA 1ICEB 4A8XA 2AP6A 4HDHA 1RT1A 1KQFB 2G2OA 4LRCA 1FCAA 4Q5VA 3FFIB 1RT4B 3K89A 3OVAA 4DFKA 1N48A 4NXMJ 4DUTA 1WDDA 2HLTA 4NMXA 5F9LA 3PW5A 5DDPC 1TL7B 1GX6A 4ECWA 4GRSA 4RNOA 3RR8A 1TUVA 4K4XA 3PRDA 2VONA 4I6AA 3KDNA 3CDBA 4LF4J 4U6PA 2DR7A 3H42A 1BMQB 2DNZA 3BBBA 1LW2B 4UUXA 2VH7A 3RRHA 4JI6J 4FPRA 1KBRA 4KY3A 4ECUA 4LFAJ 2VODA 2BX6A 4B3SF 2HK2A 4QOTA 3UCGA 4TLQA 3HHLB 1MW7A 4QR0A 5E3PA 1K73T 1C1BA 2HBQB 3SDEB 1XR6A 3N4WA 3MTJA 2XC9A 5DETA 4CLYA 1L3TA 5F3TA 3GILA 4DV1F 4IDKB 2E7WA 3O1LA 3MM5B 2IY5B 4LMZA 1S1TA 5J2MB 4LF8J 3RJMB 3KUHA 1CQNA 5KFXA 2KFZA 1F5CA 5DS7A 3VZIA 3FMBA 1RDRA 4YB5A 1CJUB 1U1MA 2PMWA 4DV7F 4UOFA 3BKFA 1O6XA 1GNKA 3M9NB 2D3O1 3Q2TC 4IFYB 3JB9k 4UZCA 4BC9A 3KXDA 1DBDA 3ZZ0A 1JJCB 4Z37A 1TKXA 2Z2LA 2V4JB 1KOHA 1IWAA 4Q7AA 3BSAA 3MPWA 1WTFA 4PXBA 3US5A 1XNRJ 1VQPS 4QWAA 4LFBJ 5C42B 4DDFA 2WSCC 4HVZA 2VQFJ 1FJCA 3DLLQ 5HJXA 2JFKA 1QE1B 2GZOA 1I94F 4U9RA 4AXJA 2HQ3A 1R8AA 4KJIA 4I6WA 3CVKA 2RF2A 2HVZA 1T9VA 1GMWD 3U1LA 1XWLA 4E8UA 2LCWA 4FVMA 2QG9B 1RI7A 3OR1B 4ED2A 3NGRA 4Y0FA 5IFMA 4ES3A 1IM4A 5HP1B 2ASLA 4KR0B 1N5YA 1R7IA 2ZH6A 2AMCB 5C24B 5D77A 3LP2A 3SBMA 3HMJG 1BD6A 5L8RC 2DR9A 3KYLA 3DLKA 1X4FA 3MMCA 5KFIA 1WC5A 2A2DA 1WI8A 3WQPA 2H3EB 3H90A 2AJ2A 1KQKA 1NK6A 1HQUB 4AD6A 4B3TF 3TX0A 5LSLA 5F9NA 1NRKA 3EYZA 5A8RB 4N8NA 3G4SS 4RZRA 2VA3A 4Q2LA 4ECXA 5E3RA 3M2UB 2FDNA 1DTQA 4ELVA 4HH1A 1OSDA 3KFWX 4UOCA 1HNXF 2X1GA 1RT7A 1VQMS 3AOBA 1N88A 3BV8A 3PDNA 4EYIB 1RHMB 2WSEC 1HWIA 4X4NA 2QV6A 5A76A 4WYLA 3EXYA 4M1KA 1LNQA 4NMLA 1NLKL 3GV8B 3HF5A 3ADAC 2IBKA 3DNCA 1CJVB 2R3VA 2NUHA 2ZKTA 3OBIA 5K14A 1PBUA 4WFBQ 1R8BA 3X1LB 1A6LA 3I5AA 5KFZA 2KJVA 1S1WB 1CPZA 4I67A 4RW8A 2B9EA 4WK3A 1JXLA 3PYEA 4PQUB 2B5JB 1MROA 1IQZA 3E01B 2XMWA 1CJTA 1HHSA 2RVJA 3CD7A 2CRLA 4KHRA 1CJKA 2DNQA 3VVUA 3V6DB 3CJ5A 4A47A 1J27A 3OL9A 2MLXA 1RWXB 1KVJA 1RADB 2XMVA 1DQ9A 1Y4ZB 3PYFA 1AZSB 2LEPA 5ETLA 3DU5A 3HPOA 4IOBA 5B0BA 3OUYA 2ZJRQ 4UQTA 4O3NA 3IGNA 2F4VJ 1TKZA 1CSJA 3C2PA 3VALA 2DRDA 2DGXA 3GR1A 2XNRA 4DR6J 3D66A 2DNOA 4MJKA 1JQGA 4FXVA 5HL7Q 2MQMA 3FQKA 4PABA 2FHJA 2VD3A 2VJUA 2GIFA 3QGGA 1S0OA 3SYZA 3FEZA 4K4TA 3MM9B 2G9OA 3TP2A 2ZOFA 3OSPA 3KWMA 4EBDA 2BJ1A 4YHHF 3ONQA 4PR6A 2HS3A 3GYNA 5E3CA 3M8QA 1VLYA 4MKBA 4F67A 3SIPB 2OPQB 4XDCA 3N0VA 3MPYA 4JV2A 4GVBB 5KT6A 2KH9A 4B3MF 4FXWA 3BKUA 3PHTA 4RNHA 3M05A 4HYKA 4OYMA 3D3BJ 2UXBJ 1J5OB 4OZ1A 3QATA 4HDGA 1URNA 3KK1A 1C2PA 1PJ5A 3BR9A 4X65J 2KB2A 4GKJJ 5KFPA 3AB2B 3OXGA 5HMYA 1X9WA 1GXTA 2D3OR 4RUHA 2FZCB 2QA4G 2Z58B 1S1XB 1AB8A 4ZLNA 3AD7C 2N4DA 2RKIB 2E5IA 5H9FJ 2XYHB 2DGSA 4JI3F 1U1RA 4L3KA 3LWMA 3K5PA 2W01A 4YB6A 1WEXA 1N34F 3HI9A 2X1FA 1SUQB 3TQEA 2WHOA 2UVUA 1BQNB 2QO3A 2DH7A 2CIMA 2R7UA 3UDLA 2LQJA 2VKRA 3RTVA 5HLFA 4YS2A 2DNGA 3JYTA 1ZZNA 3ZZOA 4ZCIA 1DARA 1U0HB 1HW9A 3M2RA 1RT2B 5KFUA 4NEYA 1KVKA 4RNNA 3HLUA 3FEXB 3MM6B 1JKHA 1D8ZA 1KFDA 4DV4F 1IJFB 4L72B 4WJBA 2B9YA 2QLXA 4DR4J 3UN3A 2H5IB 1DTTB 5JJBA 2OEMA 4A8YA 1H7WA 4F25A 2WBMA 1Y0HA 1KC8T 1KP6A 2PGCA 4Y34A 4JI4J 2MZQA 2DNKA 4Q8FA 1Q86T 1OQ3A 3R2DJ 2H9ZA 2CZ9A 4QYZJ 5I3UB 4TU8A 5IT9U 3L7OA 1X5SA 5LT5A 2XEXA 5D4PA 1Y3KA 3NXZA 2DNNA 5F8LA 2DXFA 1H73A 1FXDA 1RK8A 1N56A 5D0GA 5T7LB 1Y5LB 2JVRA 4S0MA 1AUDA 2ZOMA 1S6UA 2HGMA 4LRFA 3E51A 1FNXH 3BS9A 2ZC3A 2RQMA 3ZTPA 3EM1A 1VQ6S 3VAJA 1R0AA 2IFXA 5KG5A 3KG4A 1NNDA 1WKLA 2HURA 2ZJPQ 1T3NA 1LWEB 4QU7A 1NHKL 3K5MA 4A8QA 2V9KA 3CJQA 1S77D 4K4VA 3U7JA 2C2RA 4KO0A 4WU3A 3C6UA 4GC7A 3GYGA 4DEZA 1H6KX 5L9NA 1UEKA 1MLAA 1SV5B 4X64F 2ZUGA 3OFEA 1GXLA 1ZS6A 4DR5F 2RS8A 2BE2B 3WDOA 3OLAA 1RABB 2PEHA 4I1TA 2AU0A 2XMMA 1VQNS 1HNVB 2CQIA 3HHDA 2ZJQQ 3I0RB 3MFIA 2QMXA 1ZAWA 2FD2A 3FKBA 4YB7A 3HVTB 3K5OA 3CD6S 3KJVA 5LMNJ 3QFWA 1FD8A 3R7SB 4KHMA 4CLUA 3C15A 3NMRA 4CLZA 4RU9A 2DGOA 1UWBB 2W9BB 1HBNB 3D1HA 2HEKA 2BKOA 4RO0A 4MFBA 4LBPA 2UU9F 2M5YA 4Y2CA 2HRTA 1UVIA 4C3LA 4N8OA 2YNGB 3PJ9A 3QRQA 4AL6A 1GTEA 4GO7X 2MXYA 2IAJB 4R25A 4DL2A 2FLNA 3I9ZA 4RW7B 4HACA 1NZAA 3UO0A 2QL5B 3G6ES 3IRXB 2DVIA 2FLPA 3IP0A 2PD1A 1RWPB 1KTQA 1WD6A 4DR2J 3E2EA 3EUNA 2XSJA 3TZXA 2LXUA 4DV5J 5SZTA 4X4PA 4DFMA 2G1DA 2MJUA 1SL2A 2D7SA 8AT1B 4QIEA 4KQZA 4QIVA 1MG7A 1Q95G 3HULA 3DRPA 4WFYA 4ILMA 2RMLA 1V5IB 4J7CA 4RW4B 4DBQA 3EJMA 2M8DB 4LF5F 4KIAA 3MCSA 1YJTA 3QBCA 5KOWA 5CQGA 1GTHA 3CO9A 3CXCR 2WONB 3W65A 1PO6A 3OTEA 2ATLA 3M8YA 3PFOA 2QMUB 4P73A 4Y28C 3FJ2A 5DZ6A 1MWQA 1R6YA 1O5JA 4RU2A 2JSXA 1HKAA 1JXVA 1C0TB 4XIUA 1QY7A 1QTMA 2EK6A 3UR3C 4DPYA 5HMXA 1JLEB 2YNIB 4H4MB 2XS5A 5CD4H 4ZK7M 1D9AA 5HBMA 5FJ4A 3TVZA 5D8HB 4UUWA 1YJVA 4Y2MA 4LR8A 4M95A 4JI5J 1K1QA 2X7IA 2Z2ZA 3MEEB 1X60A 2V0NA 1YBTA 1FO1A 3I32A 3BGFA 2P5VA 1L3UA 4F26A 2FGCA 1GAOA 5F8MA 1SKRA 4XPCA 2FB0A 1S7HA 4ECRA 4V1Ak 1QSSA 3M2VB 1VISA 3KLIB 2VFUA 5IC4B 4FF1A 1UTAA 2JVOA 4LSZB 3SSRA 3G8SA 3VVTA 2DEIA 1N33J 3CCVS 3MPVA 4F04B 5ETRA 3HD1A 3K57A 2DGUA 1HFEL 9ATCB 2HHHJ 3DLHA 2QRRA 1S76D 2JJ4D 1JWWA 4RNMA 5AJ3F 2P6SA 3RGIA 3TA2A 3H2UB 1RACB 3UVJB 3V81A 3RW6A 1YBAA 3MAQA 3NGSA 3FBCA 3C16B 1VJWA 4IG3B 1R27B 3TJ9A 1QSYA 2K1RA 2Z56B 2G13A 2JEIA 4CYUB 3R5JB 3OXFA 2F9DA 5AE2A 2F7VA 4C8KA 5HMZA 2OPSA 1UP1A 3VTIA 3O3LA 2ZC4A 2RQCA 2R4FA 2CQ2A 3PO5A 1KHWA 2E5HA 1TUWA 1DURA 2HGLA 2C2OB 3TUZC 5HVHA 2UXCF 1CULA 4DUYJ 4K4ZA 2J9DA 1YZ6A 4ID5B 2DB1A 1K9MT 2CQ0A 2GMHA 3V4IB 1SCJB 2RUGA 3BGRA 5LXRA 4JBCA 4DQSA 3V4MA 4OYAA 4O3QA 2GVDA 2DHXA 1IBKF 1JLGB 2M52A 3EZUA 3MEDA 5A6PA 4DLEA 3E3XA 3CTRA 3TUIC 4JV5F 4IH7A 1ZTWA 1HNZJ 3WX4A 4IH5A 1UPPA 1AT1B 3QIPA 4R5PA 3GIKA 3L7PA 3CT9A 3SCJE 2BE7D 5DM6Q 4PYDA 3QGHA 3D54A 1ZPVA 4I2PB 3PZPA 2AJ4A 3ZNUA 1CLFA 1KLMB 1RWWB 1KDNA 3D28A 1YLXA 1JNRB 3MXHP 1TV6B 3IAM9 2DPIA 2ZH1A 1LK5A 4JI0F 3GV7B 1PIEA 4JI1F 3GFHA 1BUXA 3LA0A 1PYSB 5GAEI 4JI2F 2C3YA 1HYSA 2VG7A 3IS9A 1X7VA 4DN9A 3BGLA 1XQIA 5DGAA 3FUYA 1RTZA 5G0RB 2E1MC 4RX6A 2LXFA 4K8RA 4F3OA 3PY8A 1XMOJ 2VKZG 4P7TA 2FZGB 3D0HE 2YH1A 2FJEB 3MPDA 1RU2A 2W9CA 1OYEA 4YQWA 1T95A 4GO5X 1FWLA 4CLTA 2U1AA 3CC7S 2RIJA 1IJEB 3KNGA 2QE5A 2F9JA 2HQDA 4ZP7A 3B8HA 3UCZP 5KG0A 2XMTA 4QW8A 4UQGA 4B9TA 2ZD1B 4LF9J 1RWOB 2WB1D 2N4CA 1V5VA 1TFYA 3GSDA 2AEJA 5HQMA 1ZM2A 1JNZB 1H3DA 3OXLA 3W1YC 4NLDA 2NR0A 2H4YB 4LRDA 1BQMB 3MM6A 1LWCA 3JSRA 5J2PB 4D3GA 3DFEA 4DZDA 3AAWB 2ZHAA 2ZVIA 2COLA 1CS4B 4FS2A 2FJAB 2ROGA 2RDJA 2AJ0A 2OEKA 4OFZA 3MMJA 3B78A 1W7WA 4FYXB 1VC5A 4ZP6A 1ZZFA 1U1KA 2D3UA 4DS5A 4MIBA 2K06A 2J76E 2QSFA 3UW1A 6FDRA 1RAIB 2IC3A 1D0EA 3D6MB 1MU2B 3OHBA 2YXLA 3MURP 4DPXA 5E3AA 1V3SA 3O5TB 2CPIA 3T19A 2JWNA 4C8YA 4DL7A 1LXJA 1RCXB 4UW2A 1T02A 3OL6A 1DY3A 1F1BB 3ZTOA 3BBCA 4NLRA 2B43A 3H7HB 1HR0F 2LXIA 3J81j 2NQPA 5KFBA 2YWFA 2PN6A 1U24A 3MAHA 2PC6A 1LW0B 3V2UC 4FXDA 5C5JA 1QVGR 3POTA 3M4XA 2PI4A 2MZ1A 2YKNA 2VQEF 3NCRA 5LSRA 2XYPB 3MR2A 3W61A 1FFGB 1NKBA 1S6PA 3HVRA 1P27B 4CNZA 2DHHA 4ZS6A 2G2ZA 2XS2A 2BOPA 4N56A 3DI6B 2HQIA 2NS1B 3OVSA 1V3RA 4LBHA 1X4EA 2OI2A 3T1HJ 2JC0A 1FF2A 4OJGA 1FFWB 1JLBB 2JLFA 4NRUA 4L6V3 3M6WA 4A8OA 2ZKUA 2XGQA 4DL3A 3BR8A 4I56A 3KK2B 2BM0A 2R9LA 4X4VA 3QMQA 4X66J 4M5KA 3LP0A 4HHJA 4RUBA 4WTOB 1IR0A 2ZM6J 2ERRA 2MQLA 2R8IA 4OHXA 4F50A 1KKHA 2HLUA 3W5YA 2CQCA 3MCNA 1GFWB 3T9ZA 1UAWA 2DXDA 2E1AA 2QA2A 1N5TA 3P8BB 3HX9A 3FZBA 4IFVA 3JTOA 1TMJA 4KV8B 2HQFA 3TZYA 4OIXA 5KFMA 2V8PA 1GK8A 1PYOB 2DPJA 3TR5A 4HHUA 3I96A 5E41A 1EP4A 1S1UB 4DFPA 5B0FA 4NXNF 2NYIA 4RW9A 1F0XA 4EWTA 3BZQA 5DQHA 3GTYX 3IR7B 4EU0A 3RZAA 2EPIA 1RTHB 3MD1A 3HP6A 4P2MA 3EVWA 4IKAA 5I4MA 1WOPA 1PKUA 3IC1A 3CCES 4FN5A 1W25A 1K8AT 2W4PA 4LFCF 1IXKA 1NZ8A 4NLGA 3M32A 1UKUA 2JL9A 2Z2MA 4CI0B 4AYBD 1KVIA 1OS5A 3K8WA 1F3FA 1R8CA 1NUEA 1CG2A 2CPFA 2D9PA 1A7GE 1VK8A 2OTLS 5LJ5Y 1U1OA 3MECB 2CWKA 4W4MA 1FJGJ 1J5EJ 2E5GA 3CSKA 1X9SA 1N8RT 1OY6A 3R3TA 1NKEA 2OPPB 1RXOB 2XO7A 2WSFC 4ZVUB 2HFNA 4U8YA 1S0VA 2GVZA 4Y6IA 2XWXA 4FYYB 3F41A 2NXNA 3PFEA 5BR8F 2UUCF 2HVHA 3DRXA 5JVGQ 1RWVB 3UE2A 3UPFA 2XG8A 2UVWA 1E6YB 1S7IA 2HNDB 1K1SA 2BJ3A 2ZH8A 2CQ3A 3MR3A 4N7TA 3HFZB 3AA8A 1U8WA 1VGYA 5AXMA 2HS4A 1YGYA 2CUYA 1TL1B 3PKMA 4J9OA 3ELHA 3RG6A 1RTDA 4ZITA 5DG8A 3ENVA 3W7BA 1BHNA 1AFIA 3AXMA 1PAUB 2GAHC 5H9EK 3KJQB 4P72A 2R2TA 4WF9Q 1REVA 2OEJA 4IRCA 2C3UA 4B02A 2XGPA 4WP8A 3GE9A 4MK9A 4CQ1A 2YPYA 3ISND 3MPUB 3FCHA 3GFXA 4K4UA 3P3DA 4DF4A 3EMTA 1RHJB 1NSKL 2HQGA 5I3QA 3CC2S 5KG7A 3GU0A 4NXMF 2DKOB 5D4NA 4PWUA 1SKWA 3B54A 4PG6A 2C2KB 3IWNC 2ZFHA 5KFFA 1FKPB 1TU0B 5KFDA 3BN7A 2B3TB 3QNWB 4M94A 2W25A 4LF4F 4LVNP 1FHTA 2AEFA 1WDTA 2EC2A 3ZZZA 2VDIA 1PC5A 5KAKA 2IVMA 5THWA 5HSPA 5FLXU 2D3ZA 1EARA 2OAUA 4ZHRB 3V5RA 2E5LJ 2Z8QA 8ATCB 3GJSB 4TVAB 1SB6A 2ZVSA 4LFAF 4IOCQ 1BXNA 3IR5B 1S12A 4FF3A 3VGSA 1WC6A 1IR1A 1YBUA 1W26A 1U48A 1M5PC 2BA9A 3KHGA 3IRWP 4ECSA 3JSYA 1RTIB 2GO8A 4M5JA 3KLFB 2ZBPA 1UVMA 5K8NA 4ZPWR 4GKKF 2GJFA 1FA0A 1JXEA 1JLFA 2RQKA 3AJ1A 4LUBA 4NCGA 2ZE2A 3VAKA 1SKSA 3G8TA 2DGWA 2EWHA 4HHHA 3SQOP 3HHLC 2VC0A 3GCXP 4O44B 2HW3A 3OLBA 3QT6A 1FKOA 3KUGA 1OSCA 3BN4A 3H4DA 4J9UE 4YY3F 1XNQJ 3RBEA 1HNWJ 1FDDA 1GH8A 3W8GA 4QIGA 1H2TZ 4C0BA 1ZM4A 5AXNA 3QFHA 2ZWPA 1TKTB 3UNGC 2BJ7A 2BANA 5C25B 4B9LA 1G3OA 3W60A 3MD3A 3N5BA 4JP8A 3W2WA 1HARA 2AYBA 3GIRA 5CYQB 2DNHA 1RT5A 2HG4A 2DR5A 4KHPJ 4LFBF 1HBOA 3BO2A 2W4DA 3FBFA 2VQFF 4DHVA 3N79A 3KLHB 2Y8WA 2ALZA 3BM7A 3BSOA 1NPKA 2Q6BA 1H98A 1NEEA 2HQCA 1Q8IA 2AYGA 1IBMJ 1Y9OA 1NB7A 2LQ5A 1X4CA 2NSBA 2JRSA 3A13A 4B9MA 1RZMA 5EX3A 1UPMB 2BJDA 3M8WA 3ITHB 2HHWA 4X4RA 4LSNA 3ZNJ1 1MNEA 1FK9A 2CNOB 3NNAA 1R6VA 3W3SA 1TL3A 5ETKA 1KLNA 2LEAA 5IT9Y 4DR7J 4F4WA 5LMUJ 4CIOA 4OI6A 4R0EA 3J7ZT 3GJRB 5AT1B 4PWDA 4ELTA 3MEKA 1DLOA 3R5BA 3BQ2A 3SQGB 1JB0C 2ZUAA 3G86A 1UJ5A 1U1QA 1LV5A 1LXNA 5ITHA 2IM0A 3H2LA 1RT1B 5KG1A 4USKA 1YRXA 3M8PA 4KGXB 1L3SA 1SJQA 1NK4A 3CJTA 4I2QA 2B7CB 1HA1A 1ZETA 1SL0A 5RUBA 2YX7A 3M30A 4CLPA 2KXNB 1N32J 1XMQJ 1XTZA 5CHCB 1X4GA 3OR2A 2B6AA 2CJKA 2CG8A 2LDIA 3LPEA 4QBUA 2VFVA 2MJNA 3TX8A 3EVOA 4Z7CA 1ZPWX 2QMWA 3I31A 4YR0A 1RA7A 5DG7A 5B09A 2ILZA 2CVEA 1FFSB 1GX5A 1NMEB 2GS8A 5B0EA 4KB7A 1C1BB 1PILA 1KRPA 3DU6A 4U95A 1BWEA 4OZNA 3Q8QB 5EWFA 4C8LA 1HBMA 2HHTA 4IG0A 4ICLA 2GNKA 5IWAF 1WC3A 4ILRA 2K8GA 3CULA 1S1TB 1YRUA 2O5DA 4WIIA 3CB4A 4ZP9A 4FP9A 4F4ZA 2KJWA 3NBPA 4K5RA 4NLTA 1B64A 2FHOB 2WCXA 1KSPA 4DV1J 3D0GE 1YVFA 2O01C 1VBYA 2KT5A 3TAMB 5J1EA 2DITA 3GG1A 2LQBA 4E0DA 5F8HA 2QGFB 1S6QA 4DR6F 3D5MA 2OHDA 3PX6A 2AX0A 4D3HA 1TKXB 4QIWD 1NJXA 1WKKA 1F2HA 1IM6A 2W2PP 1MN9A 4X4TA 5DG9A 4JUZA 1S9GA 1GXUA 3T5KA 4DL6A 2Q1LA 1U6FA 2RF2B 3F0NA 4QW9A 5EDWA 1JIHA 2V8GA 3NKYA 3Q86A 3LO3A 1I94J 3CIMA 1TAQA 1N5YB 4P52A 1Q8BA 3MUTP 5IC6B 1N6QA 1RE1B 2UXBF 3TRGA 2ACMA 3PX4A 4F3QA 1S99A 4J90A 3LP2B 3FRYA 3W8PA 2CPJA 3RAMA 1QUVA 3DLKB 4EI2A 3MMCB 4X65F 7FDRA 3TANA 3AJDA 3CW2C 5DDRC 1N5QA 2UUBJ 1FEHA 2WB4A 1I6JA 2V2QA 2YX4A 4JI7F 3KMQA 2VJVA 1ACMB 1DTQB 3MCMA 2MZJA 3HT0A 3DXSX 1RT7B 3CE8A 5IT4A 2BW2A 5KG2A 1H2UX 4TXSA 4MKVA 2W7PA 4AL7A 2R7WA 1MMDA 3I0SA 1HQEA 2O66A 3J81U 2DD8S 2VOPA 4CH1A 4JI8F 2XMUA 1X8DA 5C2CA 2GIQA 2AYEA 5K14B 1NJWA 2LMIA 2EBEA 3MGJA 2HHPA 1KR4A 3CUNA 4RW8B 1NKCA 4EUVA 2BW7A 2B0GA 4DCJB 5HN0A 2Y1IA 4OZLA 1MROB 2VB6A 3DOLA 3DLEA 4NA3A 4ED3A 3SZ2A 1M90T 1CJTB 3AQOA 4NX9A 3R5DA 3EZOA 3W9JA 2I1RA 1CJKB 4CCHA 4F0KA 1FWPA 4USWA 3BDEA 4JI4F 2V50A 2CWXA 4WFZA 1NDPA 2CJYB 5MLCV 3GV5B 3TEHB 4ZVTB 4KFBA 5KFTA 4ANDA 4IUFA 3NG8A 2YKQA 3OUYB 2FZKB 1TKZB 1R89A 3CJSA 5K8PA 5IQ6A 4A48A 3LWLA 1N4LA 4LIWA 1ZAXA 1Q4RA 2HZCA 1ZA1B 4DX5A 3KTQA 4BC7A 1ELOA 1SIZA 2G4BA 1YWXA 1F5BA 2GJIA 2FVSA 3MCOA 3D7SB 3BJYA 1V9OA 1FRIA 4MKYA 4OI2A 1F9FA 2IHR1 2FJDB 4NI2A 2PMHA 3RBDA 2F5GA 4TNOA 1JLCA 3PO4A 3B4MA 3QT5A 3CC4S 2IVYA 5LL6d 3T5LA 3TA0A 3GG0A 1RKIA 3G8QA 4J9NA 1RHQB 3W5ZA 3M8QB 2CZVC 2NCKL 5L38A 3NGKA 2IYGA 2HBZB 3HDSA 2YPZA 3HXMA 2Q3PA 5ETQA 4YHHJ 2RHQB 2AJQA 1NM2A 4NLUA 2SXLA 4L75A 3KK1B 4J9VA 2KVIA 2ROPA 3SCIE 5A8KA 4NOHA 1AROP 5CYJA 2NZCA 2GQQA 4B3MJ 4USTA 5MAOA 2P9EA 4N76A 3NY0A 3GQCA 4KE5A 2L9WA 5LMNF 4WTYA 2Z57B 4FPIA 3MM8A 2I6WA 1VYAA 1RU1A 5T14A 3IBFB 3B6BA 5KFLA 2K7KA 3PV8A 2ASDA 4WP3A 2DH8A 2DK2A 2CNNB 1WSVA 2QTWA 2XZWA 2YY3A 1YDLA 3NGUA 4XTTA 3UR0A 1S4EA 2M9KA 1WHXA 1EETA 2R8JA 1YRTA 2ZBIA 3D68A 1M5HA 1WHYA 1OO0B 4NPOA 2D74B 3DLGA 5KG4A 1H72C 2OH2A 4C11A 3JAMU 1GMVA 1SBRA 2V8VA 1R3NA 3QGIA 2ZEJA 5E7OB 4JI3J 5AE1A 2EFOA 4I7FA 3OW2R 4A8WA 3J7YI 1F9EB 4DR2F 5HLFB 3SMZA 4ZN3A 2B8QA 1S0MA 4DV5F 3JYTB 4LF2A 2QLWA 1Q0NA 2EC0A 3M2RB 3K5LA 5LJ3Y 1NK8A 1IKYA 2O67A 2CQPA 2MKSA 2MZSA 2CPYA 1IWGA 1Q53A 4DL0C 2IM3A 4KGMA 3VQSA 4ED5A 4ZCMA 2RQ4A 1YZ7A 4LVOP 4X4QA 1D9DA 3FSXA 3IGVA 1YSJA 1JKHB 3HHKA 5BYQA 3GFZA 3ILOA 3VGTA 1P1LA 4DR3F 3TUPA 3BQ0A 2A2CA 3GSIA 4F8RA 3L7UA 1NK9A 1BC6A 2JC1A 2CQ1A 3PNIA 1VQSA 1TZ0A 1WTBA 4Z2XA 1FVSA 3VV2B 4Z7YA 1IN0A 4DV4J 1UFLA 3A3OB 2POKA 3PCOB 3RR7A 1KONA 4O3RA 3PKYA 4LQ3A 5A8WA 4DMZA 2KXHA 2R7VA 1UA1A 3C6TA 1FVQA 3CJ3A 2HWTA 3J80Y 4IRKA 1QAYA 1R0AB 5IS2A 4HT5A 2CDQA 2FY8A 4M5HA 1N54B 4W98A 2OSQA 3HSGA 3IBWA 4LF6F 1LFPA 1Z2LA 5ADZA 2K3KA 3AHPA 5D6GA 2RDIA 1IBCB
chains in the Genus database with same CATH topology
2OPSA 2DGTA 1H0HB 3VTIA 4KO0B 1WG1A 4YB1P 3DHWC 4OI1A 4K59A 1GT8A 3C6UB 3O3LA 2ZC4A 2RQCA 2R4FA 2CQ2A 5IM0B 3M8RA 3DDNA 3PO5A 1KHWA 1JLBA 1UL3A 2WOMA 2E5HA 2N7CA 2ZOGA 3QLHB 4RW6B 1DURA 4NL5A 3DMJB 2RE1A 2HGLA 3DN9A 5JUMA 2PSZA 2IMOA 3TUZC 2NZ4A 4I69A 2I2YA 3GYXB 2UXCF 3CEDA 4LIRA 1JLAA 3KK2A 5CH7B 4KBIA 3SFGA 3NS5A 4KGKA 2JDJA 4HL9A 1B0VA 2NUUG 2KM8C 4K4ZA 3BO3A 3SV3A 2J9DA 2EFPA 2IJNA 3T9NA 4ID5B 2DB1A 2VG5B 1K9MT 2CQ0A 1OIAA 2GMHA 1FD2A 3V4IB 4Q45A 4AE5A 2EG1A 3JSMB 3L3CA 3DOLB 2Z4PA 4J9QA 3DLEB 1SQEA 4ED7A 2RUGA 1KOOA 3FNNA 3BGRA 5LXRA 3QO9A 4HTJA 3S1TA 3H8YA 1WG5A 5KFHA 4JBCA 4DQSA 3V4MA 2YWKA 3L09A 4XK8C 1S4FA 4O3QA 4LJMA 2YNFA 2AGOA 1F60B 2BYCA 5H9EJ 3MEGB 1Q7LB 4I6YA 1QVFR 4FZVA 3C3LA 2ZH7A 2DHXA 1FDNA 4C98A 2M0GB 4CO3A 3IFEA 1IBKF 1JLGB 2M52A 3HK2A 3EZUA 4C8NA 2E5JA 3MEDA 2B51A 5A6PA 4DLEA 2EG2A 2HFOA 5JXSA 3E3XA 3CTRA 3H5XA 1U26A 5KFKA 5AXKA 4WKYA 1VS3A 3TUIC 1N33F 4JV5F 3KJVB 4IH7A 1ZTWA 4FS1A 3MUMP 4KFBB 2BXJA 3LGMA 5E3QA 4J9SA 4DF8A 1VQ7S 3FRZA 4AL5A 3WX4A 4IH5A 2EFQA 2HHHF 4KV8A 4OX7A 3G6VA 3QIPA 4R5PA 2KYZA 6FD1A 3EPGA 2KFNA 5J2QB 3GIKA 1XMBA 3MMBA 3L7PA 3CT9A 3SCJE 4MFBB 5DM6Q 4TLRA 3QGHA 1S79A 3D54A 4ZOSA 3HO1A 2NSCA 1VC6A 4DQPA 1ZPVA 4I2PB 2DBBA 3BF4A 1NH7A 3IXQA 2AJ4A 3PZPA 3RAQA 1CLFA 4TYAA 3BDPA 5GAGU 1SH3A 4R8UA 4FVCA 1KLMB 2GV1A 1S1UA 3VR1A 3VWSA 4YR3A 3PW2A 1VK3A 3D28A 2OO4A 3X3UA 4CH7A 4QIFA 4BCAA 3RAXA 1UVJA 2HNZA 1JNRB 3Q8SB 2VASA 4C3KA 5BJRA 3OL7A 3MXHP 4U7CA 1TV6B 1FKAF 1KN6A 1YITS 1IKWB 1QAIA 3IAM9 2DPIA 1N0VC 5DO2A 5KT2A 2ZH1A 2IBOA 4QWCA 2ZJRQ 1LK5A 3NNHA 1MMLA 1ZM3A 4ZVEA 2J0WA 4E98A 4JI0F 3GV7B 2BM1A 2XS7A 4JI1F 2A1BA 5CZXA 4LSLA 1S9EA 3GFHA 2FHMA 1ZM9A 3B82A 1ROFA 3TW0A 2MSSA 4NLQA 4M5DA 1HPZB 4LF7F 1RTHA 2VZ9A 5GAEI 1YJWS 4JI2F 1JLCB 1WEZA 2V9WA 5B0DA 3CGIA 2F8EX 3C8YA 1TL5A 2HYIB 2C3YA 3N5FA 4WXOA 4CT9A 4ECVA