2KG0A

Structure of the second qrrm domain of hnrnp f in complex with a agggau g-tract rna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
NSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Heterogeneous nuclear ribonucleoprotein F
publication title Structural basis of G-tract recognition and encaging by hnRNP F quasi-RRMs.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2kg0A01
1U2FA 3CCMS 2MQMA 3MXHP 3NS6A 2X1BA 2PEHA 1X4EA 2DITA 2CQDA 2MPUA 3UCUP 2LKZA 2RT3A 2NZ4A 2KVIA 2J0QD 1VC0A 1H2VZ 4FXVA 3J7YU 3CMES 5ITHA 2DISA 1DHMA 1A7GE 1SJRA 3P6YC 1X4DA 1VBZA 2KHCA 3U1LA 4P6QA 3EX7B 1VC5A 2CQ2A 2DGTA 1X4FA 3CULA 4EGLA 2XS2A 4C4WA 1U1PA 3HI9A 3VAGA 1X5SA 2LECA 2M9KA 4CH0S 1FXLA 2KRRA 2DNPA 2MKHA 4QQBA 2M52A 2M7SA 1QM9A 2PE8A 2MZ1A 4UQTA 3CCVS 3R1LA 4WFAQ 2N3OA 2DHSA 1JJ4A 2HVZA 1YJWS 2DIVA 3CD6S 1KOHA 5LJ5Y 3LQVA 2DH7A 4IOAQ 2DB1A 2E5GA 2RU3A 3MOJB 4C7QA 2FC8A 1Q7YT 1A9NB 2KI2A 5LXRA 2RNEA 2MGZA 2RS2A 1SXLA 1R8HA 3MUVP 2LEAA 5DM6Q 2CQBA 3ZZZA 3VAIA 3I55S 3FEXB 1M5VC 2YH0A 1FJEB 3VF0B 1VQ5S 2CQHA 2ZJQQ 2CPZA 2VOOA 2KG0A 2DGUA 2CQ4A 3SXLA 3ZZYA 2CQPA 2DGSA 2MQOA 1BY9A 4RU2A 3VAFA 1Q81T 2KT5A 2RRAA 2M0GB 1VQ7S 4F25A 2XSFA 1S72S 2EVZA 3IWNC 4CIOA 2N82B 5CA5A 2MQQA 4WFBQ 1X0FA 4F26A 3H2VE 4WIIA 4TU8A 2MGZB 1ZZNA 3BS9A 2X1GA 4YB1P 5LXYA 4OZ0A 1VQ9S 1QVFR 1NJIT 1VQMS 2CQ1A 1S79A 4C0OC 4M5DB 2NLWA 2CPYA 2F9DA 2QFJA 5DDRC 1SJ4P 3EGZA 3NNCA 3I56S 1H2TZ 2DHAA 4WKRA 4Y0FA 3CC4S 2K8GA 3VAHA 1PGZA 2CPJA 2M88A 2DNKA 1O0PA 2XB2D 3SDEA 2MJNA 4A8XA 4TU9A 1JJHA 4CQ1A 1VQLS 2DO0A 2F3JA 2DH8A 3DLLQ 1FNXH 5CXTA 1M90T 1ZH5A 4IO9Q 2G0CA 1HD1A 3G71S 2E5IA 2JVOA 5GAHU 4PRFA 2LA6A 2KFYA 1KC8T 3RW6A 2I2YA 1KQSR 1WF0A 4QU6A 3CCSS 3PIPQ 2LMIA 4TLQA 2CPDA 2KRBA 2EK1A 2DNRA 4ZKAA 3BO4A 1HL6A 2AYGA 2HGNA 3SDEB 2B0GA 3MDFA 1N52B 3NMRA 4FXWA 2HGMA 3N9UC 2MZSA 3R1HA 1X5TA 3VAMA 3VAKA 3NNAA 2J8AA 2WBRA 4W90B 2YKAA 3CUNA 2CJKA 5GAEU 1VBXA 5GADU 1F9FA 1VQ8S 1YITS 1N8RT 4PKDB 5JVHQ 2DNMA 5DDOC 2RS8A 1QVGR 1U6FA 1DRZA 3SMZA 3CCQS 1FJCA 1WEXA 1K9MT 2DGXA 1XN9A 3IRWP 2KN4A 3BO2A 2GO9A 1AUDA 1VQ4S 2RRBA 1D8ZA 2VONA 2QEXS 1NU4A 2RQ4A 1Q82T 1M1KT 2UP1A 1YJ9S 5GMKa 3D2WA 2KM8B 3PIOQ 4UY8T 2XNRA 2KM8C 2DNYA 1YI2S 2CPEA 2AD9A 2D3OR 1YIJS 3UCGA 5D77A 1OWXA 4ED5A 2M8HA 4LIRA 2N7CA 3J7ZT 2FPHX 4YUDA 2DNOA 1U1QA 2E5JA 1X5OA 2BZ2A 3R27A 2JWNA 2MKCA 2Q79A 1U1RA 3P5TL 5FJ4A 2CQGA 2DGVA 1WTBA 3MI7X 1X4AA 3TP2A 2OSRA 3JB9k 1PO6A 2LYVA 3G8TA 2LCWA 4TU7A 2AYBA 1VQKS 1WHXA 5CYJA 4BS2A 3THPA 2X1AA 3Q2TC 1L3KA 5DETA 3G4SS 5MLCV 4V19X 1WEYA 2N3LA 4WCEQ 1UFWA 3THTA 3CTRA 2YWKA 2MHNA 3NS5A 2HGLA 2RVJA 3MURP 2JRSA 2MY8A 1WG5A 2I38A 1DZ5A 1H2UX 3U1MA 3G6ES 2MZJA 4F02A 1WWHA 1YWXA 2MSTA 1M5PC 1WHWA 2HYIB 2MXYA 2MQLA 3BO3A 2ZJRQ 2JX2A 2K3KA 4CH1A 4U67Q 3VALA 2XS5A 3L3CA 2D9OA 2KXFA 5IQQA 1OPIA 5DDPC 2MKIA 2YTCA 4J5OA 2DNLA 2KXHA 3B4DA 2AYMA 3Q2SC 1U1KA 1URNA 1U1MA 2MZQA 1YJNS 2L41A 1UAWA 2OSQA 2DNQA 2OIHA 2AYEA 2M8DB 2O3DA 3EGNA 1WF2A 4IOCQ 2DGWA 1B7FA 1HA1A 2FY1A 2VODA 1VQ6S 2MB0B 2DGOA 2MKSA 5JVGQ 3B4MA 4OZ1A 5LJ3Y 3G96A 1FT8A 1HD0A 2E5HA 1RKJA 2U1AA 3G9CA 2D9PA 1SJFA 2LA4A 1FO1A 2MY7A 1SJQA 3H2UB 3UD3P 3CF5Q 1X4BA 2YH1A 1U1LA 2MSSA 3S7RA 2EK6A 4QPTA 3MUMP 3P49B 2FC9A 5EN1A 3LPYA 1X4HA 2RUGA 2MZRA 3V4MA 2CQIA 3US5A 2DO4A 2G1DA 5GVQA 1X4GA 5IM0A 3UE2A 2BOPA 1WI8A 1VQPS 3CCRS 2ADBA 2U2FA 4ERDA 2ZJPQ 1N54B 2DNHA 2DNGA 2MQNA 1VQNS 2CQCA 2MKJA 4WFNQ 2DIUA 2KG1A 2HZCA 3CC7S 1U6BA 4LMZA 1FHTA 1RK8A 2CQ3A 1SJ3P 4YOEA 2QA4S 1UW4A 1X5PA 1WEZA 4Z2XA 2XNQA 2MQPA 5DM7Q 1NO8A 1M5OC 4PR6A 2CPFA 1WELA 3S6EA 1X4CA 3K0JA 5LSLA 1G2EA 3NNHA 5DDQC 5IM0B 1JMTA 2M2BA 3CPWR 3DXBA 3CMAS 3S01A 1K73T 3VAJA 2L9WA 5LSOA 3UD4P 4W92B 4WF9Q 2KH9A 4LJMA 3P3DA 1CVJA 2MJUA 1JJ2R 2GHPA 2RQCA 5IFMA 1R8PA 1Q86T 2KYXA 2V94A 3CCLS 4Y00A 2DNNA 2J76E 2JVRA 1W2BR 1IQTA 2DGQA 3MD1A 2G4BA 1WG1A 2OJ3A 3CCES 2F9JA 2CPXA 1DBDA 2ERRA 1P1TA 2DHXA 2VOPA 3UCZP 3ULHA 3CCUS 1YTYA 3MD3A 3OW2R 5D78A 2M4MA 2XS7A 2LEBA 5HL7Q 2OTJS 2SXLA 1FJ7A 1VC6A 1P27B 3RW7A 2MYFA 3CCJS 3TO8A 1KD1T 2DH9A 2DK2A 1OIAA 2FHOB 1D9AA 1WHVA 2LQ5A 1WG4A 1M5KC 2OTLS 3HHNB 5HO4A 1OO0B 1K8AT 1WHYA 3UWTA 2DNZA 2LXUA 2X1FA 3MUTP 1H6KX 1WI6A 5H1SV 2CPIA 2A3JA 4IUFA 1U1NA 1N88A 2E44A 3CXCR 2L08A 1WF1A 1VBYA 2MMYA 2J0SD 2LXIA 4QU7A 5GAGU 3BEGB 1VQOS 1U1OA 2KXNB 3CC2S 2CQ0A 2M70A 2DHGA 3TYTA 5BJRA 1UP1A 3G8SA 2MKKA 2CPHA 1KOOA 3S8SA 2KU7A 1YHQS 2MZTA 2ADCA 1ZZFA 3FEYB
chains in the Genus database with same CATH superfamily
2GNKA 4NPOA 3NWGA 2MPUA 4C8NA 4DCJB 4IG0B 4L3NA 2ZH4A 2R7QA 2XMTA 1GTEA 1X4DA 1N34F 5KT2A 4KT0C 3W63A 2CQ2A 2DGTA 3HSJA 2UUWA 1U1PA 3HI9A 4Y28C 4CH0S 2JSXA 4MIWA 1EKSA 1LK5A 2M52A 1FX4A 1NK9A 3MMBB 4ZPBA 1G7CB 1HBNB 3CD6S 4A4JA 3ILLA 3EPGA 2GQQA 2PGCA 1I5OB 1YBAA 3LPEA 4JI5F 1RHKB 2XTJP 2YKNA 2ZC3A 4R25A 4EYIB 4M5DA 1NKCA 2Z2YB 1XJWB 1ZOTA 5KFBA 1S77D 4Q43A 3MR5A 4I56A 1Q81T 3QGPA 2R8IA 1LWFB 4KJIA 1CBKA 1S72S 3OTOF 2EVZA 4JI4F 5GAHI 3HMJG 4FBUA 3BH7B 4PQUA 3FZBA 1ZA1B 3EWGA 1VQ9S 1WJ9A 4IH6A 1JLCB 2VKRA 4F4ZA 2BR0A 1VR6A 1S0MA 4F50A 1U45A 8ATCB 2XG8A 2IJFA 4NLGA 1NZ8A 5AE2A 4CZCA 2XO7A 5ETSA 2FJVA 3VCDA 3HHKA 1RQ0A 5JXSA 5H9FK 1LWEB 3TEGA 2BJEA 3OD2A 3GR1A 3KK3B 1WC5A 2NSBA 2XMUA 1J2VA 4WP3A 4LFBF 4CLTA 2DRDA 2BJ1A 4QIEA 3C8YA 4KPCA 3R9LA 1C4AA 1N32J 2B56A 3E01B 1X9WA 3CT9A 1N52B 2XYPB 3K5PA 3MDFA 2NS1B 1JKHA 4B9TA 3IBWA 3QWUA 2YKAA 4FF2A 4NCBA 2CJKA 2W24A 3FQKA 3MFIA 4X65J 1FKPB 3CCQS 2HQIA 4DLEA 3KJFB 1PJ5A 3SCIE 3D54A 4MMOA 4DPUA 2XNRA 3D1HA 2ZNZA 4A8WA 1OWXA 2JFKA 3M2UA 2ZH3A 1S1VA 4DQPA 3GE9A 4J9NA 3I0RA 3ET6B 2PSZA 1Y5IB 4J37A 1XMQJ 2AX1A 3CCTA 4M1KA 4EO6A 5K14A 1RTDB 5T7LB 3THTA 1TUGB 2MY8A 4H4OB 1DZ5A 5FDLB 3G6ES 4TQRA 2B9XA 2HYIB 2YWWA 1K1QA 2J5AA 2JX2A 2K3KA 2UXCF 1VHIA 1Q8BA 1RBAA 3BPSP 2DYAA 4J5OA 5C42A 3DN9A 5J1PA 4EI2A 2OIHA 2AYEA 4DX8H 1S1TB 4LBIA 4C6AA 4IOBA 4CCHA 3ETOA 1FT8A 1HD0A 3N6MA 5ETMA 1SV5A 5K5MA 2BJ8A 3UD3P 4EWTA 3B8HA 5HMYA 1N5YA 4PWUA 1RTJB 1SH2A 1N36F 4RBTA 1ICEB 4QPTA 3ZTSA 2VG6A 4QIVA 5KFTA 1S4EA 3D1QA 4ANCA 2FJWA 2EKNA 4DV2J 1GQEA 3H5XA 3VVTA 1S6OA 1VQPS 4V19J 3KLHA 3SEOA 1NK4A 3M8WA 3M8PB 2NYHA 4KPYA 4ZLPA 2B4UA 3GV8B 5A8KB 3K57A 1LV5A 1HMVA 1WEZA 3AOCA 1MU2B 1B0TA 5HLFB 3ZTQA 3NNHA 4I6WA 1L3UA 4G6VB 4CLFA 4NX9A 5DZ7A 4A8YA 2HHTA 4BC9A 1R8PA 4G3IA 4HYKA 1PKUA 3RUBL 3CW2C 5KFOA 2DPIA 1P1TA 3UNYA 1FI4A 4HKQA 2XEXA 2IYIA 3HX9A 3HT0A 1NB2A 4CDIA 1FJ7A 3BKUA 4ZVPB 4J9OA 1U8WA 1GMUA 2J6UA 2ZVIA 3RRHA 3MUTP 1X7VA 3GYNA 2E44A 1XMBA 3PVXA 4QU7A 1B99A 1S7HA 1HNWJ 1I3OB 4YR2A 1LWCA 5ETRA 2D3O1 1BD6A 1U24A 2KU7A 4NI2A 2B8QA 3B6BA 4JV2A 3BBCA 4AL5A 2OO4A 2YKQA 1D1UA 4ZITA 2IBKA 3TVKA 5J2QB 2D74B 2XBPA 1BQMB 1CJTA 4RX6A 3CMES 2VJVA 3OTBA 2HMIB 2V8GA 3IM9A 3ISNC 2VG5A 1LFPA 2XY6A 2VIHA 2FVRA 3G6XA 3TQEA 1TKZB 3GP9A 3CCVS 1CJUA 2AX0A 2EC2A 3BREA 3TX8A 3T5LA 3KJNB 5LJ5Y 2WVBA 4IG3A 1GXUA 3ZZRA 1VOMA 1YSJA 4NZ0A 1Q7YT 2RS2A 1SXLA 2PFFB 4C3KA 3NEKA 2YH0A 3D9BA 5BYQA 2UUCJ 1YX2A 2B9YA 3G87A 1FD8A 4RU2A 4HH0A 4AXIA 4NLPA 2V2KA 2CNKB 4F25A 2FZGB 3M8RA 2LQ8A 4OHWA 2YKMA 1S9GB 2UUBJ 2HBYB 4TU8A 2X1GA 1QVFR 4PPZA 3SIPB 2C22A 4ZVUB 2F9DA 2QC3A 5KG6A 2QMUB 3HVTB 3HHLA 2DHAA 4XIUA 1N0UA 2K7JA 4HDHA 4OYMA 2HHHF 3MM9A 5B0AA 1FVQA 4LF6F 3W5YA 4TU9A 3OSNA 2NR0A 2W8LA 3TUZC 1FNXH 2E9ZA 1D0EA 1NEEA 2BABA 4F7VA 3OT9A 3SCLE 1ZM9A 2NXEA 1SC6A 4QU6A 1EP4B 1VLOA 1H73A 3TW0A 3VGTA 1NJXA 5J2MA 4GRSA 4LF2A 3KUGA 4DR5F 4Q2LA 3KHGA 4N77A 1ROFA 5AT1B 4J9LA 1JLQB 2MKYA 3LGHA 1RWOB 4DR2F 2V8PA 2GQCA 3MEDB 3OFHA 2UVVA 1N34J 3T5JA 5EGYA 4B3MF 3QAUA 5HMZA 1XTZA 4E98A 4GVBA 4UY8T 3H42A 5I3PA 4NCGA 4DSKA 4KH1B 3AA9A 4YUDA 2ZWOA 5D3GA 2VFUA 2R9LA 2W7AA 2JEFA 4M5JA 2V68A 3GG0A 2K1RB 2AYBA 4JI5J 1RACB 2VC1A 3TAPA 3W9IA 2MHEA 3W2VA 3PO5A 3BF4A 3BR9A 3SQOP 4CO4A 3GB0A 2ILZA 3K17A 4YN3B 4A8KA 3CDEA 2FJAB 1SUQB 3B82A 1TVRB 4FNIA 4RNOA 2H4YB 2YNIB 4JI4J 2DNLA 2KXHA 1RLDA 3H40A 2L41A 4DL0C 1RWXB 4ZPAA 3QGIA 3FJ2A 5D15A 3K58A 1HIYA 4DSJA 2Q43A 3G96A 3D68A 5IXUA 1XERA 5L38A 2H9ZA 4KE5A 2OPPB 2K2PA 2B4VA 3C2PA 3RBEA 4X2BA 3TUJC 2NCKL 4MJKA 3OL6A 3US5A 3THVA 2HFVA 2ACYA 1IVZA 4WXWA 2BANB 2PEBA 4LFBJ 1GFWB 3R7SB 4USMA 3KDOA 4AFFA 2QA4S 1ZA2B 1MLAA 1YRXA 3J7A1 4ZIVA 2GIRA 3KUEA 4LF5F 1RTHB 3NXZA 3T6JA 1PBAA 2M2BA 3OR1A 4Y2AA 4Y6IA 5A8WB 3UD4P 3T5KA 2Q1LA 3CVKA 4ECWA 2VPXB 2GHPA 2MQ8A 2YPZA 1Q86T 2B6AA 3LP0A 1IR0A 1F1BB 1F2GA 2HQFA 4DV1F 2R4FA 1YTYA 2KL8A 3CSKA 3GCWP 1KKHA 3VHQA 3A3OB 1KD1T 5BR8F 3TAMB 2J0XA 1IJEB 1IKVA 4UOCA 1KEKA 4WE1A 2QA2A 4NLTA 2CPIA 2XHCA 4IUFA 4LSNB 3UVJB 1R0AA 4O3PA 1SIZA 5GAGU 1U1OA 2OAUA 3TYTA 2GA7A 4DJBA 5IWAF 1YBUA 4HHUA 2EFQA 3CD5A 2YQ0A 2HKEA 4Q45A 4HHHA 5LMNJ 4ZJQA 4Q44A 3WZ0A 3A8IA 3ILJA 4MKYA 5HJYA 4OYAA 4C8LA 3UR0A 2IAJA 1RJJA 4TNOA 4UOFA 3I5CA 2WSEC 1N36J 1F3FA 4F4YA 3R2CJ 1DTTB 5D0EA 4A46A 1YJWS 5ETKA 1KOHA 4A8QA 1FXRA 1ZAVA 4NXMF 3E8OA 2VZ9A 2OMOA 3KKFA 3MUVP 2LEAA 5E0OA 4OJGA 1X60A 4P7TA 4X62J 4P2XA 3SXLA 2OH2A 4IFVA 1XR7A 3GIRA 3VAFA 1E6YA 2OLWA 2E1MC 3N5FA 1T3OA 2AW0A 1TP7A 4WFBQ 4P72A 1JWWA 4O3NA 4JV1A 2YKNB 1TQLA 4M5DB 2R2TA 3A3NB 1S0VA 2UVWA 1Y11A 3SSRA 3HZEA 3VGUA 4CTAB 5E3QA 1TK8A 1PCAA 2HVHA 2RE1A 3AXMA 2VF3A 5EWEA 1M1GA 3JYTA 2DO0A 2DH8A 3LAKA 2UZAA 4ECTA 2JHEA 1VRUA 3RR7A 1RAJA 4HACA 1JIHA 2KKHA 4CI0B 3GU0A 4F0KA 4QR0A 1UVKA 2HQ3A 3H90A 4OZ3A 1IKXA 4F3MA 4B9SA 3NKYA 2CPDA 5B0BA 5CYMB 3CJ3A 4Q8FA 2HRUA 3L7PA 1K0VA 2IM2A 3EXYA 2WVCA 1RT2A 4OYBA 1N5VA 3LF0A 4Y2IA 2QLJB 4U9RA 2RHQB 5F8HA 1NAQA 1SC1B 1D8ZA 1W7WA 4K4UA 3HXMA 5GMKa 2J9CA 2VBYA 3RRGA 3Q8VA 4HH1A 5HMXA 3UCGA 1S1XA 1JKHB 1TMMA 4K0KF 3QZ8A 1U1QA 3FQLA 2C2ZB 4GKKF 4BLGA 1HBMA 2Y0SD 3JB9k 3OXFA 3AQPA 3O2IA 5M2PA 2IYGA 4Y3CA 2QG9B 4FYDA 3PYFA 2HGLA 2VA2A 1WSRA 4F3QA 3M2UB 4OJHA 2B3TB 2Z30B 5FLXY 3H4DA 4TLRA 1CJVA 5IZHA 1MNEA 1RAEB 3I0RB 4LQ3A 4OZ2A 4OI1A 1R6YA 2D9OA 2UV8G 3ENAA 1VK8A 4DCPB 2HRYA 2P5VA 5T41A 4KFBB 1WF2A 1B7FA 2G0IA 2MB0B 4U7UD 4ICLA 5DQHA 4P74A 1RKJA 3G9CA 3GV7B 1RB0A 2XI3A 1NJZA 5IV3A 5C42B 1HQEA 4O3QA 3N6LA 4LF6J 3SCJE 1SC3B 1Y10A 4QR2A 4V1Ak 2UUAF 1HWLA 4BCAA 3HVWA 3ZNUA 1SV5B 2KG1A 4Z7YA 1N5YB 4FP9A 1H7WA 2DEJA 3FRZA 3KK2A 1WELA 2VG6B 4LREA 5KFSA 2W4DA 3N0VA 3AA8A 4HR2A 1G2EA 5EWFA 4NA2A 4DR2J 1KDNA 5K8NA 5LOQA 3KLHB 4OLOA 3FZ2A 4B3MJ 3HVRA 3CCLS 3TJ9A 4DG1A 4ILRA 3DMJA 2G4BA 3M30A 1HMVB 4H54A 1KFSA 4NL5A 1QTNB 3GFXA 5AE3A 3MD3A 3TVYA 2L9DA 2OTJS 3DRRA 1NH8A 5I4MA 3J81j 2E1AA 1WG4A 3KK1A 4FDFA 2G1HA 5CZXA 2ZM6F 1JLBA 1R0CB 1ZM4A 2UV8A 3UWTA 2HHPA 2X1FA 3FCVA 4OX9F 3GIIA 4DI6A 3GG1A 4DDFA 3UNGC 2X7IA 3CXCR 2KB2A 2W4CA 3I9ZA 1NHKL 4DQIA 1NBEB 3G6VA 2DHGA 4O3OA 1LOUA 1KN6A 3N4WA 2ZOMA 1FRLA 1PJ6A 4GMKA 2LKZA 3IA0A 3O8WA 4K4XA 3J80Y 4FXVA 4JYAJ 5KOWA 1F9EB 1PC5A 1LWCB 1T11A 1LKZA 1RAAB 5JJBA 4LF7J 2QA1A 3OLAA 4N5SA 2M7SA 2NPIA 2N3OA 2B4OA 1CJTB 2OPQA 2IVMA 2RDDA 2BQUA 2W9BA 4HDGA 3W1YC 2VG5B 1ZYQA 2AHOB 2EFGA 4TQSA 2FJXA 2OEJA 1M5VC 2VUGA 4ZK7M 3OR2A 2QL9B 2VASA 2ZJQQ 1TK0A 4LF5J 1AFJA 2CQ4A 4J91A 4LQ9A 3F44A 1CJUB 1YLXA 4ECUA 1VQ7S 1U8SA 2RQKA 2AQ4A 4IG3B 1JLFB 1RU1A 2HIQA 3MR3A 1ITPA 2HHVA 1RE1B 3KJQB 1R7IA 5IC4B 4DL7A 3I0SA 4DV1J 3WDOA 4RKUC 2Z8QA 3PKYA 2WVFA 2PT0A 1F3VA 4DSFA 4Y0FA 2YPYA 2K8GA 3ZTPA 1AXQA 2E5LF 3Q89A 2FYXA 2X3DA 1NB7A 2YKMB 3QSYB 1V5VA 4D3GA 1QUPA 4DR4J 2N7YA 4ID8A 3TARA 2FLNA 1RI7A 1ZH5A 3MMJA 3DLHA 4ZLJA 2LA6A 4FF3A 4NLOA 3MM8B 4YB6A 3HHLB 2XQCA 4DL2A 5IWAJ 1FWKA 2XYHB 3KNAA 2R8HA 1IKYA 3MM9B 2AKWB 1TAQA 1Y3KA 1HBOA 4J9MA 1L5UA 1TAUA 3R7NB 3UDLA 2DNMA 1U26A 5KTQA 2E7XA 1S5ZA 1XN9A 2KN4A 2IC3A 3KG1A 1TUWA 2QEXS 1Q82T 5J2MB 3QWPA 1HWUA 2CPEA 1Q8KA 1TL1A 4L76A 4IDKA 3FKBA 3FBBA 4MKAA 1RT1A 1U1RA 1YBTA 3TP2A 4I2PA 2LCWA 3A1YG 2HHQA 1OY9A 3G4SS 4NXNF 4GVBB 4KGXB 3A8KA 4DX6A 3D3BJ 4NCGB 1UWBA 1VIOA 4HVZA 3R2DJ 1TL4A 3K59A 2DHHA 5KFQA 2KFNA 3VV2B 5D3GB 2W2NP 1UMJA 2EG2A 2KXFA 4O3SA 2QX0A 1U0HA 3G8QA 1U1KA 3MHYA 1ZTWA 3W2VB 2BVZA 4R0JA 5E3CA 1IJFB 3Q8SB 2OI2A 1IBCB 4JUZA 5KFAA 4NA1A 4OV6A 1FO1A 2WONA 2ZHOA 1GXTA 2E1PA 2AGOA 3IC1A 3V6JA 5E3RA 5H9EJ 3KLGA 4JI1F 3V2UC 2V9KA 1UWAA 4ERDA 4RNHA 3M8QA 2AJQA 1QE1A 2IHR1 3NCRA 2LU2A 3MECA 2FIUA 4P52A 1KLNA 2CWKA 3K0JA 3L4BC 2FLLA 2VB6A 2ZH6A 3CPWR 4Q2MA 3W8GA 2L9WA 5KG1A 3UN2A 1S76D 1VJQA 4O0IA 1EQMA 1S10A 2PI4A 2DHXA 2AWZA 3UCZP 3ULHA 3TI0A 4LRFA 3DU6A 2LEBA 4GKKJ 3OR1B 4M8LA 1LK7A 3MCNA 1M1HA 2RMLA 2B6AB 3LP0B 4LF9F 5DG8A 3W9HA 1VBYA 5M2RA 2J0SD 3BR8A 3GONA 5H9EK 1YGYA 2OEMA 4JBCA 3OL7A 1D9DA 3W62A 2CPHA 1SKUB 5F3ZA 1YHQS 2J9DA 3I82A 1IKVB 3OV7A 3JTPA 4WE1B 2EXUA 3UCUP 1FEHA 2XZWA 1NH7A 5AE1A 2DXEA 3DOMA 1R0AB 2BW2A 2J0QD 3K2YA 1QSYA 3M9NB 3CD0A 4RW6A 2JEJA 3U1LA 2XS2A 4U96A 4OHZA 1FXLA 3KTQA 4GKJF 5L39A 2J7UA 3QNWB 3KMQA 1RUSA 1MROA 4UQTA 2HFOA 1R43A 4W4MA 2P9EA 4GC7A 2FZCB 2UUAJ 2EFVA 4LF8F 3R3TA 4OJ1A 2PD1A 2JZ5A 2RNEA 4CLWA 1FF2A 1HBUB 3FBCA 3QJJA 2FGOA 2W9AA 3NGTA 4ALZA 2UXBF 5DGBA 2BQ3A 4Q8EA 2DGUA 1VK3A 2FVCA 1PYOB 1NCLA 4DR1F 9ATCB 3CIMA 1GNKA 2XLJA 3AHPA 4YHHJ 3D6MB 2XSFA 4CIOA 4MK9A 1N33J 4Q0BB 3EXCX 3ZC4A 3RGIA 3R5JB 4KRWA 3CDWA 1CLFA 1Q78A 1S79A 1W2IA 2CQ1A 6AT1B 2AGQA 3PHEA 1BC6A 4IFVB 2C2MB 3JSRA 1RKIA 3PHTA 1S97A 4X4TA 1DQ8A 1E6YB 1YJRA 3VAHA 5I3UA 1Q16B 4DV6F 3TJ8A 1R8BA 5KFZA 2CUYA 4OX9J 2F3JA 3QRRA 2CA9A 3PO4A 4U7UK 1TL7A 3UW1A 3IR7B 3HDSA 1HD1A 2FD2A 5L1LA 2DCUB 2VD3A 2C3UA 1P8GA 4KGKA 4YS2A 4F0MA 3MWBA 3AOAA 3CCSS 2F8HA 1NK8A 2CNOB 2YKOA 1YZ7A 5HAOA 4IH7A 4K2XA 4XPEA 3J7Z5 3NMRA 2AV5A 2WBRA 3H7HB 3JYTB 3Q8RB 4I2QA 4KBIA 1VRUB 4NRUA 2VG7A 5DZ6A 5KFJA 4HACB 2B51A 3BO2A 4W98A 1IKXB 2ACMA 3TUIC 4PG6A 1EX8A 2HBRB 3PRBA 1WC1A 2N7CA 3MGJA 3RBXA 2Z4PA 4KQZA 1RT2B 5HROA 1BQXA 2CQGA 2LYVA 1FEEA 3QSIA 2N3LA 1Q8IA 1NSAA 4QIWD 4DHVA 1B70B 3NS5A 4QW8A 1S1XB 5D4LA 1HNZF 2ZHAA 5AXLA 4K59A 2LEPA 2WW8A 1HBMB 2EFNA 2JL9A 2RAQA 3CJ4A 3BH6B 3UFCX 3QATA 1EARA 4M5IA 2F1FA 1RISA 4IFYA 3VTIA 4OZ1A 4NASA 2E5HA 4CRJA 3CNQP 1CJVB 1Z1ZA 1SJFA 2HVIA 3OHAA 2E5LJ 2KTQA 1LWXA 1EETA 1KQKA 4JI3F 1HR0F 1U1LA 1O5JA 3CDBA 3BQ1A 2BBEA 4UW2A 4NA3A 2F8EX 4OQJA 1VQYA 2RQMA 4C3LA 4IKAA 2IRUA 1VBKA 2G2YA 3SCKE 3Q8UA 1B7YB 4QYZJ 1HQEB 2XNQA 3HSDA 2BKOA 1TL5A 1K1SA 4KV8A 2QGFB 2W2PP 3I9V9 2R7WA 4MIBA 4CLUA 1NDKA 4ZHRA 1K73T 5F8MA 1FESA 2AJ4A 4DUYF 4LUBA 2MJUA 3C3LA 2ROGA 2HEKA 2ZHBA 2JVRA 3KDNA 3NY0A 3MD1A 4ZJLA 4URGA 2X3GA 2ALYB 1QAJA 1QUVA 3KK2B 3M6XA 2AP6A 1RWMB 2R7OA 1T7PA 3DDIA 3MZIA 3TO8A 2R7RA 1OIAA 1QAXA 2FHOB 4MIAA 2VQFF 1SJ1A 1OO0B 4ES1A 3DOKA 4CLPA 4OI3A 4DG1B 3DMJB 1IR2A 3M30B 3AB2B 5FIIA 1C0UA 4EUVA 5RUBA 3T1HF 3DRRB 4DFMA 1T94A 2ALZA 1K0TA 3E01A 3KK1B 1JLBB 1HQUA 4ED1A 3X1LB 3MAHA 3RB3A 3C66A 4QYZK 2Q3PA 1H2VZ 2QA4G 2GGPA 1VMBA 6FD1A 1GX5A 4N76A 4RUAA 1DY3A 4X84A 3HP6A 2W8KA 5FLXU 4K5RA 5DLFA 3SQGA 4MKBA 6FDRA 2HVZA 1UPMB 4JI1J 2NXNA 4F4XA 2E5GA 1HHQA 3MOJB 1RTDA 4ECSA 5ETPA 2UU9F 2HBZB 2B7CB 3I96A 5DM6Q 3KLEA 2V8VA 1X8DA 3VF0B 3RBDA 1HI0P 3GJSB 3QT7A 1G1XA 1XNRF 4KIAA 1OS5A 3AT1B 4L6V3 2OPQB 3LOUA 3SI8A 1U25A 1H7XA 3LGNA 2W9BB 3ZTOA 2MLXA 2WB4A 5J2NB 4B3SF 1KVKA 4MAKA 5KAKA 2QLWA 4WU2A 4CT8A 1SCJB 4H4KC 1YDLA 3OHBA 3AODA 1S6QA 3OR2B 2VFSA 1BLUA 4YY3J 4N8OA 1RXOB 5SUHA 4WFZA 2VFVA 4L72B 3NNCA 2W7OA 2BOAA 2R2UA 2W4PA 4M5LA 1ZAWA 1FA0A 4QR1A 4FS2A 4QYRA 4PEOA 4OI0A 3ZXWA 3PYDA 2XCPA 1KSPA 3I0SB 4LF9J 5JMNA 3EZOA 3ZZUA 2HK2A 2RILA 3OVSA 1TMJA 3HSGA 3B54A 3HHDA 3QJLA 4ZN1A 1HL6A 3KYLA 1KWMA 3M4XA 2ZBIA 2ZH9A 4PG4A 1C1BA 3GSIA 4XDCA 2CVIA 4QOTA 5GADU 1MWYA 5HQMA 4Y34A 1RYSA 3W2WA 1AUDA 4DSIA 3LW5C 3O1LA 1NU4A 3RG6A 1UJ4A 1IKYB 2KM8C 4GKJJ 5AXMA 2GVDA 3GYXB 1HBOB 2LDYA 5KFRA 4X66F 3DM2A 5F8NA 4LIRA 4ZVEA 5CD4A 1F9HA 3PJWA 4BDPA 3GIJA 1DTQA 1RT7B 3RAQA 1IN0A 3MI7X 3F41A 2FJBB 2GC8A 4CWBA 2IC3B 4TU7A 4NLXA 3K5NA 4BS2A 3THPA 4KR0B 3GJRB 3J80U 1TL1B 4UUXA 4C0BA 4DUZF 2MSTA 4IDKB 4DR1J 4ELVA 3AQOA 2AZ3A 4I2PB 1HNVA 4QWDA 2FGCA 1NK6A 1URNA 5J2QA 2FDNA 2GZOA 2XLKA 1TKDA 1KQFB 2GS8A 2FY1A 2CWXA 3NGRA 1UWBB 2DGOA 3LA0A 4ZVGA 2VQEF 1Y4ZB 3QGGA 1FRHA 2HHWA 4C8MA 4PWWA 5BXIA 2QLBB 4DV6J 1U0HB 1BWVA 1Y00A 3FCWA 4KB7A 1F0XA 1U02A 3IAM9 3DRXA 4ZIWA 5A2QU 2D7SA 5GVQA 1WOSA 1X4GA 3OBIA 5B09A 1WI8A 1ZM3A 2GHWA 2ZJPQ 1CEZA 2WONB 1U6BA 3FEZA 3DU5A 2XY7A 4Z37A 2PN6A 1X4CA 2HAIA 2E9RX 2PO4A 1FVSA 3KLGB 4W92B 4AL7A 4OZJA 4FKXA 4B3TF 3M8QB 4PQAA 1IQTA 1QE1B 3BJYA 4ILLA 2Y9HA 1P6TA 1N6QA 2F9JA 3VWSA 2QJ3A 2ERRA 1RCXB 1UA1A 3MECB 4CYUA 3OW2R 4CM0A 3P8BB 2V4JA 2SXLA 1KHVA 4DSEA 1P27B 2MYFA 1RTZA 1DQAA 2UVUA 4NLQA 3HLUA 2XSJA 4XO0A 3M6UA 3ETMA 3BEGB 3QT8A 2W01A 1HNZJ 4F36A 3PACA 4O4GA 1DFDA 2IA0A 2Z0GA 4ZVTB 2H51B 2ROPA 3NCQA 1NKEA 3I5AA 5HMWA 2VICA 1M5HA 2Q6CA 2BX6A 1HWKA 4ZVQB 5F8LA 3D1OA 2YWHA 2KVIA 2H3EB 3H5UA 1DHMA 4Y2CA 2FHJD 3LTOA 3W5ZA 3EX7B 4WYLA 2AT1B 4DBQA 1FJGJ 2W2OP 2E29A 1HR0J 1RT3A 2Y0BB 4JV0A 1FDAA 4IQMA 2PE8A 1NDPA 2H1YA 3T1AA 5J1EB 3LALA 4F4AA 4ZJOA 4QIFA 3JSMA 2DPJA 2DH7A 4IOAQ 2K1RA 1D8YA 3T19A 4RW6B 3TVZA 2ZD1A 3PZPA 3D0HE 3M8ZA 3VAIA 1T02A 3FFIA 4OYIA 2CPZA 1MROB 1HW8A 4CH7A 4DR3F 1BY9A 4X4UA 3IAS9 4WPAA 2BXJA 1LQ9A 4DUYJ 3AD8C 3AJ1A 5K8OA 4OZ0A 1TV6A 4ZPTR 2ZH2A 1VQMS 3CJ0A 3FMWA 3K8VA 4M5GA 3MMAA 3JSBA 1X31C 1XR5A 3DDKA 3OQ2A 2P8IA 4TN2A 1Q4RA 3I32A 2R42A 4ANEA 3SDEA 3TZZA 1RSCA 4WTYA 4H4MA 3ZZTA 4IO9Q 4TXSA 2RH3A 5D4PA 5AJ3J 2KFYA 4KY3A 1WF0A 1VISA 1T05A 1S48A 1UVIA 5I3UB 3R5GA 1AZSA 5F8IA 5DGAA 2L48A 3N9UC 4OYOA 3C19A 1U4BA 4NE9C 5B0CA 3E3XA 5C25A 1WEXA 5C7PA 3IRWP 1R27B 4ZPWR 3MTKA 1T03A 2V63A 3IGNA 5U47A 4DV3F 4PWDA 4C48A 2AD9A 2GJIA 1YIJS 2BW7A 4OV1A 3NGKA 4I2QB 2FPHX 3D5MA 2VG7B 2AIRB 1G6BA 1KVIA 2DCLA 1N4LA 2WCXA 3BYRA 1H72C 1EQ0A 2UU9J 2X1AA 2IPOB 3Q2TC 4PXCA 1SBRA 3AXKA 4E8UA 1NPPA 2YWKA 3AD9C 1NPRA 2IIHA 2HQCA 2Q6BA 1NK5A 1H2UX 2WSCC 3U1MA 5KFKA 4NLUA 4F02A 4DLGA 1V3SA 2YWGA 1S57A 3GSDA 3OLBA 2ZZMA 2ZBPA 2HFSA 3SFUA 4NOHA 5BYRA 3B4DA 2DBBA 5K9FA 3GJQB 1U1MA 3L7UA 2V5HG 4GVLA 2DNQA 2DY1A 4PAAA 2DGWA 4E0DA 3LAMA 4QPXA 1P1LA 1GEHA 1UTAA 2PMWA 4EZ6A 4O44A 4UY85 1X4BA 1SKSA 4DPYA 2R2RA 2EK6A 4ZVFA 2VU5A 3EM1A 5KT5A 3QJPA 4IYQA 2CIMA 1DTTA 1PAEX 4IFYB 2QE5A 3P45B 3GQCA 3J81U 4OYPA 2ABYA 5H9FJ 2IMWP 2VPZB 2DNHA 3MM6A 2JC0A 3GILA 1UVMA 1FHTA 1EETB 3PNIA 1TL3A 2CPFA 3BSOA 2D3UA 5KFGA 4C8KA 3VAJA 1KVJA 3IBFB 1FDBA 4QZVB 5GAGI 4X4RA 2J0WA 2VFTA 3QT6A 3NGDA 2DR5A 2ZITA 3BGOP 1DBDA 3EZ5A 4X66J 2OEKA 8RUCA 3CWJA 1UPPA 2M4MA 4KV8B 4CTAA 3BZQA 1HLWA 2XMKA 2HNYB 2YNHA 4ZHRB 3JAMY 2XMVA 2AJFE 1K47A 5KT3A 4CO0A 2MLYA 5KT7A 3HHNB 3CJSA 2KDOA 2LXUA 1KHWA 4TY9A 4Y2KA 5KFCA 5K8PA 5L46A 4B9LA 1F2HA 1Q79A 1AFIA 2HNDA 1VGYA 4DUZJ 1ZPWX 1KOOA 4OIXA 4LFCJ 5CYMA 4EMDA 4IO1A 4KAIA 2HFZA 3DCAA 2PEHA 3DOKB 3RB4A 4TYAA 5KFVA 1C0UB 3AD7C 3J7YU 1ZBTA 1OQ3A 2XGPA 3D67A 2DISA 3R5DA 1Y5LB 2LXFA 3P6YC 4C3MA 2VQEJ 1S4FA 1XEZA 4M63A 4WTOB 1TR0A 2ZH5A 1OJ4A 1HQUB 4I69A 3D7SB 5I42A 4K4YA 1CG2A 2ATLA 1R6VA 4LT6A 1OQ6A 3ADAC 2GGPB 2KHDA 4EFAC 3MPYA 2KI2A 3GJTB 3QO9A 1TTHB 2C3YA 5C2CA 2Q66A 1CC7A 3SQGB 3MR7A 1LXJA 3K7RA 1JLAA 4N47A 1NSPA 4J9KA 4UUWA 4I64A 2A6OA 1ZTTA 3PX6A 4JI8F 2HWHA 4B3TJ 4KFBA 4ZPVR 1T9TA 3KLEB 2F7VA 3CCWA 3TAQA 4I68A 3GTYX 3TA2A 5T14A 2XLIA 1HWJA 3SYZA 4NEYA 1MWQA 3ITHA 1FX2A 5F0WA 3H4BA 4X4NA 4WIQA 4E2FB 4O4RA 4P2FA 3I87A 4Y2MA 3I4PA 1UKUA 2KZZA 1S6QB 4NZ7A 4KTQA 2BRLA 2W7PA 5DRKA 1KC8T 3A8JA 3PV8A 3HD1A 4RWWA 4EBEA 1BMQB 3LH2S 2KRBA 1S6PA 4K4ZA 1XQIA 1NDLA 1L3SA 3NCPA 1NJWA 2JC1A 1BXNA 2E7WA 3BQ2A 1QVGR 1DRZA 4Y65A 4GO5X 3IN5A 3L9ZA 2PMHA 4G1PA 2QL7B 3P96A 1NRKA 2I0XA 2WVDA 3ENVA 1RWUA 1YI2S 4JI7F 3MAAA 2HS3A 3Q0AA 1C1BB 3TZYA 3W60A 4DL4A 5A6PA 3GFZA 2H65B 3KLVA 3EE3A 4JI2F 3W2WB 4UF4A 5CYJA 1L3KA 1ZAXA 2V69A 1WNEA 2MHNA 2GVDB 2GJFA 5KFNA 3DDNA 1HFEL 4I4BA 3DM2B 2C2NA 2FB0A 3A3PB 1QY7A 4U7CA 4DR3J 1VHFA 1DTQB 2ZDPA 1X9SA 5DDPC 3IWXA 3GYGA 2AYMA 2I5JA 3V81A 2IVFB 3Q8PB 3MF5A 2M8DB 3O3LA 2JEIA 4ECQA 3MPUB 4IOCQ 4X64F 2CJBA 1WC6A 3G2XA 1WOOA 2OPSA 5CHCB 5D8HB 5K20B 1IBMJ 2QMWA 5EDWA 4R0EA 3H25A 2VBZA 2QT7A 3VGSA 2QSFA 3HHLC 1NXIA 1HNVB 3C6UA 4R5PA 3HM9A 3P49B 3CMQA 1U2CA 1X4HA 2OD6A 3JXOA 4DOZA 4PCQA 2G1DA 3NMAA 1RP5A 2CZ9A 1SQFA 1U2RA 1WACA 2DNGA 2MQNA 2HAFA 2HZCA 4NMXA 3ENWA 2VPWB 2MQPA 3EVMA 4PR6A 3CJ8A 5KOXA 1GX6A 1RCOB 4LSZB 3IWLA 1UEUA 4ZCMA 2UUTA 2OP5A 1JLFA 4ZVOB 1UFKA 5KG4A 1HYSA 2QO3A 1RT6A 2YQ1A 4MTPA 1T9XA 4Y00A 2XMAA 2N4CA 3FBEA 4PYAA 3PKMA 4I67A 1WG1A 1N5TA 4KGVB 1O6XA 1NHUA 1MMDA 1RU2A 1WC4A 2MEWA 3BKFA 1FRJA 3RW7A 3RZAA 2DH9A 4YP3A 1M5KC 3HFVA 2CVEA 2YWFA 1WI6A 4RUBA 1KS2A 4K4WA 4OX8A 1N6QB 1M0SA 1U48A 4CYUB 4P7VA 4NLRA 5KG5A 3MM8A 2V4JB 3DRPA 2BUNA 4FPIA 5E3PA 3BGRA 5A0YB 2EWHA 1X4EA 4PZVA 1UZDA 2XSJB 1XC9A 4NLDA 1RWPB 3X3UA 3WC2A 3VZHA 4O4GB 1R31A 4FXDA 1KR4A 3NAIA 4QWEA 3T9NA 2KRRA 3MTJA 1I1GA 4WFAQ 2DHSA 1J27A 2W25A 2JEGA 4UOHA 3ISND 2VL1A 4DX5A 2A18A 4C7QA 2LLZA 4B08A 3CJKA 1SL0A 1C0TB 2H5IB 2RDJA 3HD2A 3IO1A 3RRKA 1T9VA 2FUG9 1FKOA 1S9EA 1RT3B 2LU1A 5DJBA 3UPFA 4DL5A 4F3OA 4B3OB 4RR5A 1N5QA 3TANA 3J7AN 2ZZNA 2IM0A 2RRAA 1JQGA 3PX0A 1FFSB 3JSMB 4L74A 4WZMA 4B02A 4Q5VA 4A8OA 4MKVA 5EHHA 3SV4A 2ZD1B 4WIIA 3MPVA 2ZEJA 4QCLA 5CYQA 4MT1A 2PA3A 4RZRA 3RR8A 3UDEA 2P9CA 2QIFA 4C0OC 3TZWA 3FFIB 1GTHA 1QDUB 1ZS6A 1FDDA 4ES3A 2H5JB 2F65A 3OTOJ 1PGZA 2XB2D 2B9WA 2FHKA 3KWMA 2BV3A 4DPTA 3QLHA 3DLLQ 1TV6B 1JNRB 2C28A 3MMAB 2RD5C 4DWIA 3C14B 3H20A 4IRDA 3KHLA 2V9WA 3MR2A 3SDEB 2B0GA 5F9NA 1S99A 4P71A 3NNAA 2Y3YA 1UVJA 4H4MB 5E3AA 5DDOC 4ATNA 3W66A 1MG7A 3A12A 1VQSA 4NLWA 2V8HA 2GO9A 1BWEA 4LF4F 3Q24A 2RRBA 1T05B 4K50A 4OI4A 3DLEA 4QWAA 1AZSB 2WVEA 2M8HA 3J7ZT 1W26A 1BGXT 3KFWX 2MKCA 2Q79A 3JTOA 3P5TL 2O5DA 5C25B 2KYZA 2OSRA 4K2JA 4TKTA 4WXOA 4DV4F 4RNFA 2IRXA 4CO5A 1FFGB 1WHXA 5ETTA 1OSCA 4DPOA 1T03B 4F4KA 4PWDB 1V9OA 2CADA 2HZVA 3OJUA 4MYTA 2FHJA 1WWHA 2ASYA 4C2MA 4LBPA 1EAYC 1S12A 2FZKB 1V3RA 2J6TA 4CH1A 3VALA 4PUOA 3DNCA 3KLFA 4JI8J 2BE2B 3TX0A 3IGVA 2AEFA 3EDRB 2LFVA 5LMUF 5HP1A 1T9YA 1UL3A 2CDRB 4PXDA 1VQ6S 2EBGA 2Z58B 1AYEA 3ILIA 2UXCJ 3B78A 2AMCB 2D9PA 4YR3A 1FE4A 2LA4A 4RW9A 4KYZA 4NYZA 2NPFA 1IM6A 3JQMA 3IR6B 3FSXA 4F4WA 4IRCA 2KT3A 2Y1JA 4ZCLA 2YWEA 2APOA 1J5OA 1HBUA 2DIUA 4O44B 3BGUA 3N5BA 3NOCA 3H8YA 2BE7D 2C42A 2V34A 3S6EA 5L1KA 1Y3JA 1IWAA 2ASJA 4RWXA 3M6VA 1EB0A 3IG1A 1DQ9A 3EGVA 3M2RA 4OX6A 4Q0BA 3UDVA 4IR1A 3MM6B 2KYXA 2HS4A 3PTWA 4MYUA 1UZHA 4FKYA 4KC5A 3M8SA 3AAWB 3DFEA 4N56A 4JI7J 2KFZA 1TL3B 1V5IB 4AE5A 1Y5NB 2ZUGA 3PJ9A 1HNWF 1L3VA 1WKJA 1U47A 1WHVA 3I4HX 4FYYB 1SIWB 2LVWA 5J2PA 1YJVA 1KBRA 8AT1B 4YB7A 2CJQA 5BJRA 2IDEA 2AJ2A 2YNHB 4HTIA 2MZTA 3IS9A 5IT9U 4WFYA 4JP8A 2C3MA 1O51A 5LL6d 1MSWD 2W2QP 2G9OA 4ECVA 4JI0F 2HHSA 2NZ4A 4ZP8A 4X64J 4DS5A 3R5CA 3TJAA 2HNDB 5KFUA 3KNGA 3RTVA 1VBZA 3U02A 2KHCA 2NZCA 3QBCA 1RA7A 1YQHA 5L9NA 4EGLA 2QLXA 4P2MA 4L73A 4RUHA 3SV3A 1GMWD 3G6YA 1QM9A 1MWZA 1YVFA 4Z7CA 5KG3A 2V4QA 2IBOA 4YDXA 3JSYA 1HHSA 3V4IA 1GAOA 3DOLA 4P10A 2WRMA 3MOZA 4PG8A 5B7WA 3FEXB 4ZS6A 2M3DA 1TKXA 2QLFB 4I6YA 5I42B 4RNNA 2GHVC 2CQHA 4KH0B 4OZLA 3UI3A 2HVEA 7AT1B 1TKTA 2MQQA 2EBEA 3EDQB 1ZZNA 3BS9A 1BHNA 1LNQA 5A76A 2HQGA 3QO9B 2NLWA 2CPYA 3MAQA 4CLKA 1YKWA 1R3NA 3HVAA 2P2CB 2CJYB 1Q95G 5M2UA 1JLAB 1RTIA 4DX7A 1VS3A 2CPJA 1J5EF 4KKOA 2QN6B 2PMZD 2KJVA 4WP9A 3R6LB 3ONQA 3AOBA 4OI6A 4FPRA 4PRFA 5CD4H 1DARA 4F67A 3ITHB 3PIPQ 5D4OA 2HHHJ 1HARA 2DNRA 2HGNA 3GIKA 1I94F 3W65A 3CUNA 5D0RA 3M2VA 2OFGX 4DV5F 1WSVA 3JAMU 1RYRA 1TUVA 3T41A 1N0VC 1Z4UA 3WQPA 2FVPA 1HHTP 1EJ7L 1AT1B 1S6PB 3CGIA 5EUHA 4DR5J 3MR6A 1YJ9S 2D3OR 3NP5A 5HBMB 1HNIA 4ED3A 2E5JA 3PW4A 2W2MP 4AUKA 3K89A 3OFGA 2XMWA 1ZM2A 3VQSA 1TFWA 2DGVA 1X4AA 2EFOA 3PR4A 1ULRA 5DLGA 1QSLA 4PXBA 4ZA1A 1B3TA 4V19X 4RNMA 4WCEQ 5HK4A 3ZFVA 2HNZA 3MAAB 2F63A 2IFXA 3WIUA 1MN7A 9RUBA 4JV5F 1FNOA 4U67Q 4YMEA 4OYWA 5IQQA 1IKWA 2YTCA 2LQBA 5A6WA 4XAKA 3QMQA 1H74A 2OSQA 4USJC 2VC0A 1HA1A 2VODA 1RAOA 3HKWA 2BKNA 3HCXA 3CEDA 3V6KA 3HF5A 2RF2A 4C97A 4A47A 2YH1A 3S7RA 2I5JB 3V81B 2V2QA 2XYGB 3Q8YA 2RUGA 2OPSB 4F2RA 3Q86A 1H38A 2AEMA 4ER8A 2R8KA 3PDNA 3M05A 1VQNS 4DXLA 3BSNA 4MFBA 3RAMA 3IRXA 1S6UA 3C6UB 2R2SA 5IC6B 2EC0A 3PW7A 4R5PB 3F0NA 1C2PA 4HI2A 2A2DA 2PC6A 2XMMA 4OLPA 3PW5A 5J2NA 2ZH7A 3LUYA 3DC2A 4LJMA 1JLEA 2RQCA 4O3RA 4LF4J 1RHUB 3UQSA 5CH7B 2IVYA 2R7TA 2CPXA 2DRBA 3FSYA 1IBKF 2XS7A 4F04B 2OPRA 1VC6A 3MM7A 4CO3A 1HI1A 2CJXB 2C2KB 1HYSB 4DV4J 1RT6B 3LANA 2CZVC 3LWMA 2BJ3A 3FGVA 1SH0A 1OY6A 2POKA 5A8RA 2VDIA 4AT1B 2YX1A 5LMNF 1R8AA 4FN5A 1AUSL 3D0GE 3HK2A 2VHGA 1VYAA 1NK0A 2M5YA 2QL5B 1S59A 4M95A 1RHJB 5BR8J 3H2LA 2Y8YA 3TEHB 2ILYA 5HN0A 2C1EB 3CCMS 2X51A 2X1BA 3GR0A 2CQDA 5LMUJ 1GT8A 3H59A 3PY8A 5LM7E 4UOGA 1WC0A 4O23A 1SJRA 3GZ7A 4ED4A 3DRPB 1CS4B 1VC5A 4WBFA 1PSDA 5KG7A 3BGRB 4ED0A 2KO1A 3VAGA 4JOUA 3NLCA 3HHEA 2VPYB 3IFEA 3OPKA 4X62F 5IQ6A 3R1LA 4J9RA 1RT7A 1T9WA 2RJZA 3L95X 1XMOF 2QZ8A 2DVIA 2RU3A 3A13A 4U6PA 1R8HA 1FRKA 2JJ4D 1VQ5S 4ECXA 5L9XA 5FD1A 4IR9A 1M5SA 1Q0NA 1RT5A 2FQQB 2MQOA 4NXMJ 1JXEA 1FCAA 4F26A 4ENOA 3CJKB 2WZ1A 2C2OB 1FKOB 3JS9A 1S9EB 3TQ1A 2ZE2B 4M5MA 4QWBA 4C8OA 1SC4B 1FXDA 3OUYA 3CC4S 5GADI 4ZVSB 4G65A 2DNKA 3KJVA 3NRBA 4WK3A 2MJNA 1UW9A 1VJWA 2HIYA 2LQJA 3BGFA 4HTJA 4CQ1A 1VQLS 4CO2A 4K4VA 2KJWA 5CYQB 4LFAF 3VZIA 4FF1A 4USUA 2G0CA 2E5IA 2JVOA 2GIQA 3RW6A 2HZAA 4LRAA 5HI7A 2LMIA 4LVNP 4LVOP 4ANDA 1YG0A 3MCOA 2DR9A 3EUNA 4XPCA 3MM5A 3AH6A 3QZ7A 3GV5B 2K3IA 4R8UA 4ED2A 3QLHB 4CLSA 4JI0J 1C1CA 2W9CA 5KFWA 3HULA 1N8RT 2IRYA 2QFIA 1FJCA 4C8ZA 4FYVB 1FD2A 2FLPA 2I9SA 2RQ4A 3HFKA 3R5AA 2KM8B 4DS4A 3ENQA 3JTNA 4L75A 3E2EA 2R7SA 3FCHA 4RUCA 3M32A 2C2RA 4G1QA 1OMSA 1REVA 1SVDA 4DSLA 1Y0HA 3MPDA 1REGX 4WP8A 4OL8A 1NHVA 3DLEB 3PFOA 2P6SA 4LSLA 3KG0A 4S0MA 4K0KJ 3FBFA 2I38A 2IA6A 2CG4A 1IM4A 4EEYA 2EKYA 3TOQA 2H4WB 5B0GA 1VI7A 3BYPA 2K7KA 5ADZA 1Q7LB 3MCMA 3JQKA 1MN9A 4GO7X 4URQU 4LF1A 2GCFA 3DLKA 4CNYA 5MAOA 3CDAA 2E66A 4DMZA 3AY0A 1SKRA 1CJKA 4PUOB 3KLFB 2DR6A 4DU7A 1J5EJ 1FK9B 4P9SA 3K5OA 5CCMA 1RLCL 2XWXA 5HP1B 3OTDA 4WJBA 5J1EA 2DD8S 1WORA 4ES2A 4UQGA 4U8VA 1MMLA 1D3WA 2F4FA 5CAAA 4RW9B 1GK8A 1T0TV 2CQ3A 4KSEB 2J9EA 2R7VA 1M5OC 1S7IA 4OHVA 2JOQA 1I94J 4MK8A 1Z2LA 4DL3A 4DV5J 2XULA 1U49A 2VBXA 5D0GA 1RWKB 5DQIA 4J9VA 2NQPA 1ELOA 2KH9A 3C46A 1J5OB 1X0PA 3NBPA 1CVJA 5KFIA 5G0RA 1CQNA 2DNNA 1W2BR 2J8SA 2DGQA 2ZH1A 1NPKA 4I7FB 3WC0A 4BWMA 2E1RA 2H54B 1QAIA 1D9AA 5F0UA 3IG1B 2LQ5A 3M2RB 2ZVSA 3M1VA 5AXKA 1WHYA 3K5MA 4ED8A 2E7VA 3P5BP 2PA8D 2A3JA 5J1NA 3H5YA 1ZETA 3R6GB 1PG5B 3BGLA 2HRTA 2V8DA 1VQOS 5CQGA 3IR5B 1VFJA 2CQ0A 4FS1A 1UP1A 4JYAF 5KT4A 3MEEA 4JV5J 1EKRA 4URSA 2ZM6J 2ZOGA 3Q22A 3ILOA 3FEYB 4DF8A 3W5XA 1FWLA 2MQMA 4HHJA 4LF7F 5J2PB 4DN0A 1FDNA 5KFPA 3WBZA 5KFLA 4DPWA 4LRBA 4FNHA 4F0HA 2EFPA 4FYWB 1X9MA 3FMBA 2YY3A 4C4WA 2BRKA 4UZBA 4RL1A 1X5SA 3IS9B 4YDDB 2HLTA 2MKHA 1FWPA 2Y1LB 1I6JA 4USWA 2V50A 3DLGA 3U27A 4J9SA 1JJ4A 2NXJA 3TA0A 3IXQA 4OI2A 3FSIA 4X4OA 1HPZB 2OFHX 5ETQA 4K5SA 2CQBA 1NSQA 1LXNA 4ELUA 1JLGA 4OHXA 3PYEA 2CQPA 5CCLA 3ZZOA 2DGSA 5G4DA 3U1NA 1UCNA 1TZ0A 4WYWA 2YNGA 5ETNA 4DPXA 2KT5A 3HO1A 3M6WA 5CA5A 3V4IB 3D3CJ 3DOLB 2BE9B 1FTCA 2CJAA 3D28A 3H2VE 3HJVA 1TKXB 2DR8A 4IQXA 4DR4F 3EPIA 2QFJA 4G1IA 1IBKJ 1AW0A 2BEFA 2HURA 2EW9A 2R7XA 1TKTB 3HSZA 3QIPA 1FRMA 3TWZA 3KG4A 3GCXP 4ZCKA 1SQEA 2DY9A 1YK9A 1Q5VA 1JJHA 4DQQA 3BPDA 4ZN3A 5GAHU 1RTIB 3V6HA 2Z2ZA 3BO4A 1AA1B 4KKOB 5IT4A 4B9VA 4NYPA 3D66A 2ROEA 5KT6A 1VBXA 1VQ8S 1YITS 1VRQC 1LW2A 2C3PA 5LSRA 1K9MT 2H48B 2DXDA 4HT7A 5CABA 3D2WA 3PIOQ 2UVRA 4DEZA 3EMTA 3PCOB 3M2VB 2N4DA 2HNYA 3N01A 2A2CA 1XMOJ 1Y7PA 1WUUA 2A0FB 1WTBA 4CT9A 2A6MA 3IM8A 2IJNA 3PJXA 1XR6A 1B64A 1RT4A 5DETA 3FNNA 2NYIA 4C11A 2WBMA 2F8MA 3Q23A 1HNIB 3DRYA 2CG8A 2BJ7A 1FNMA 2MQLA 1WD6A 1HWIA 4F2SA 3DRSA 3VGVA 4TY8A 2HBQB 3TR5A 4MK7A 1GMWA 4NXNJ 3IP0A 3PXGa 4PQUB 1TK5A 2F40A 4QBUA 4X4VA 2HNZB 4IRKA 2MKSA 5JVGQ 4CLLA 5LJ3Y 2BA9A 1NM2A 1HKAA 2D1CA 2U1AA 5C5JA 3H2UB 2C2EA 1IKWB 3O5TB 2WB1D 4LRCA 4PXEA 4J9PA 2MSSA 1N48A 3PW0A 4AQYF 4LFAJ 5EN1A 2NUUG 3LGMA 2BMBA 1RZMA 4M5KA 3UE2A 5IT0A 3GLJA 3CCRS 4HT5A 2AF6A 1UEKA 2U2FA 2KZMA 2EG1A 1RA6A 3CJTA 3SBMA 2CQCA 2BYCA 2RF2B 1APSA 1SJ3P 4LRDA 3OFFA 2CAJA 1IBLF 3PYGA 1SQGA 4EZ9A 3S1TA 1Y9OA 3I31A 5DDQC 4ZP7A 5HANA 2CNLB 3NGSA 4WFXA 4BWJA 5HQLA 3EVWA 4HI1A 4MFBB 2J76E 1E6VA 3IMQJ 3IRXB 1IUJA 4CO1A 1RWWB 1B4SA 2R7UA 3CCUS 3WHIA 2YQ3A 1DAXA 2A1BA 5DS7A 1S1VB 1B0VA 2DK2A 3R97A 3J7YI 2OTLS 3FC9A 7FD1A 2FVSA 1JLEB 1H3DA 2DNZA 1H6KX 1L3TA 5K14B 1RHMB 1S0OA 2MMYA 4EU0A 5KFEA 3CC2S 4OZNA 2QTWA 2OPRB 3G8SA 1KONA 3MM7B 3ZZPA 1SL1A 2ADCA 1ZZFA 4B17A 3MXHP 3NS6A 2RT3A 4ECZA 5A8RB 2CZ4A 3DYAA 1XNQF 1CPZA 2ZZTA 5ITHA 4PYDA 1XBWA 1T95A 4U8YA 1U0SA 3MFHA 1DURA 2LECA 2DR7A 3KLIA 3TNVA 4QQBA 1OYDA 1R0BG 1YRUA 2MDAA 1RAHB 2DIVA 3RU0A 2HHUA 1PC4A 1KTQA 4YHHF 3T6BA 3D4JA 4DQSA 3DGVA 4AXJA 2FC8A 1W25A 1N33F 2MGZA 3PRDA 5KFHA 4ITSA 1KQGB 2XGQA 5B0DA 1IWGA 3F56A 2BJ9A 2NXUA 4LF8J 2H5EA 2PI5A 2RIJA 3NWRA 3W64A 2KVQE 4YB1P 5LXYA 2ASDA 2UXBJ 4K8RA 5JUMA 1NJIT 5L8RC 3UR3C 3DGPA 1SJ4P 3DI6A 1RT5B 3AFGA 3QAEA 5C2GA 3I56S 3EICA 3OL8A 1XIQA 3OTCA 2HHXA 1PJ7A 4A8XA 3BDPA 2B9EA 3QGHA 4X4SA 5IV4A 4AD6A 4OYZA 4QJVA 1S1WA 4I0WA 3G71S 4NMLA 1UVNA 2DKOB 4A8SA 3OUYB 2JLFA 2F4VF 2EK1A 1NDCA 4NI2B 3KJVB 1DJ0A 4FXWA 4RW8A 2MZSA 2NUHA 5F41A 2J8AA 1PIEA 3FK4A 2WTFA 4NLSA 1JJCB 5L1IA 2RS8A 2YKPA 5CZVA 2NXCA 2DGXA 1VQ4S 3ZTRA 4ZLLA 3RBZA 3PM9A 2JFDA 3CJRA 1U7LA 3MM5B 1IQZA 5D77A 3W3SA 4ED5A 3PEJA 4R8UB 3JQJA 2GMHA 2HFNA 1C1CB 2W9CB 1X5OA 2JWNA 4KHPF 2XWYA 5A2QY 4ED6A 3W61A 5L1JA 1FTRA 2BQRA 1VQKS 4RW7A 1JNZB 4KHMA 3TUPA 4ZPDA 2C2DA 1WG5A 4A8MP 3OXLA 2GIFA 3M32B 2YNFA 4G1QB 1DLOA 1REVB 5A0YA 4YB5A 3SZ2A 1NJYA 2XS5A 4BC7A 4NYOA 3ZZ0A 5GAEI 3BM7A 3PW2A 2I6WA 4NLYA 1UETA 2Z56B 1UAWA 4LSLB 3R7BB 3CD7A 3C6TA 4WKYA 2A10A 1OY8A 3B4MA 3C15A 2ZKUA 3N28A 3M7VA 5F8GA 4DV0F 2MY7A 5E33A 3CF5Q 2CDQA 3MEKA 2G2ZA 1HW9A 2OD4A 5HVFA 3LPYA 3OFEA 2CQIA 1OPZA 3DLKB 2ZBRA 3WX8A 5IM0A 3UDCA 2R8GA 2ADBA 1C0TA 1WKKA 3LWLA 3QQCD 1GMVA 4USTA 4WFNQ 1CJKB 2GJ2A 4JI3J 3TA1A 3EGWB 5DQGA 2IY5B 5EWGA 1FFWB 1UW4A 1C4CA 1ZPVA 2DTJA 1NK7A 3LO3A 4NZ6A 2EI5A 4B3OA 2VH7A 1QTMA 4DR6F 3V6DA 1T9UA 4DFJA 2Z2LA 4TVAB 3PFEA 2GVZA 3G86A 4ZLNA 4D3HA 1JJ2R 2VFRA 3MEGA 4I6AA 5IFMA 1B0PA 3L09A 3Q8QB 3SSQA 4XK8C 2OJ3A 2B5JA 2JH3A 2B7BB 2AGPA 4N41A 2YX4A 4ZOSA 3GFHA 3NBPB 4FBTA 5G0RB 2CJ9A 2V6AA 1S1UA 1LEOA 4PPDA 2VJUA 1U1NA 1V6HA 3L7OA 2GAHC 3U7JA 2IJRA 3C14A 3NOGA 1S0NA 4UT4A 2KXNB 2RKIA 3W7BA 5E2QA 2VQFJ 4RW4A 3QIDA 4EBDA 1UA0A 3M1VB 4USHA 1U2FA 4DV7F 4DZDA 4GC6A 2O1PA 3T1HJ 3PRVA 3C16A 2PIIA 4UTGA 1R89A 1LW0A 3BDEA 1WKLA 1NUEA 2OELA 3MEEB 4P6QA 1X4FA 3CULA 1XK8A 1JK9B 4FYXB 3NS7B 4B3RF 3MMCA 3DLBA 2DNPA 3TRGA 4AQYJ 1YJUA 4ETZA 3BN4A 4HL9A 2DXFA 4NLVA 4WWSA 2GO8A 2RU9A 4KO0A 4ID5A 4YR0A 4M94A 3PR5B 4EBCA 3FRYA 4I1TA 1KRPA 1CQMA 1FJEB 1IBLJ 2ZBQA 1YJ7A 2VOOA 4IH5A 4YY3F 3ZZYA 3DLGB 3RAXA 3NGUA 3OJSA 2LQ9A 5IOLA 2M0GB 1RAFB 2ZWPA 2WSFC 3ISZA 1G4CA 2BE2A 2CKWA 3OTEA 1X0FA 4A8FA 2B43A 2WOMA 1UVLA 2GW8A 3N6NA 2RSQA 1JLGB 4JI6F 2XMJA 5DDRC 1TFYA 4BBYA 2J7KA 1XNRJ 3UO0A 2OHDA 3EGZA 4P2SA 2YNGB 4WKRA 4ZMMA 2J6SA 4B3SJ 5KG0A 3CB4A 2M88A 2ZKTA 5KFMA 2OUGA 3M9MB 2W1BA 1EHWA 3ZO7A 5ETLA 3LP2A 2IM3A 2QSWA 1Q8LA 2V2ZA 3POTA 3PEHA 2J9DE 4HLBA 3QIPB 1QD1A 3IBCB 3KOAA 3R1HA 3VAMA 3VAKA 3F73A 3HKZD 5ETVA 2FJEB 3LP1A 3ZNJ1 2P9GA 3K8WA 1F9FA 1XNQJ 4PKDB 4ECRA 2WW4A 2ZC4A 5D6GA 1KNZA 2IMOA 2G0JA 2XZTB 1YRTA 1FERA 2QV6A 1SKWA 3M8YA 2IAJB 1QLNA 4OZ5A 1BE4A 4WK1A 2BZ2A 2GMLA 3OVAA 3PX4A 1LW2B 3WX4A 2G2OA 4CP5A 3G8TA 4FVCA 3J81Y 3T1YF 2RHSB 5MLCV 4PG5A 4J9QA 4DL6A 3CTRA 2EPIA 1BQNA 3BSCA 5K8MA 5E41A 1XWLA 5DO2A 4RU9A 3EVOA 2ZJRQ 4DQRA 3L3CA 1RADB 1NKBA 3Q2SC 1CSJA 3T9ZA 3OSPA 1RT4B 1R8CA 2O3DA 4YFUA 4C11B 3P4UB 1NZAA 3OXGA 2OKQA 3VR1A 3PG9A 2CXEA 2HVDA 3DRSB 4RBVA 5D0HA 2ZDOA 4TY8B 1CULA 3I6PA 2F5GA 2GFFA 4NRTA 4DR7F 5C24A 3CCZA 3FUYA 2MZRA 2NREA 5KFDA 2DO4A 3D6TB 1FKAF 1WDTA 4Q7AA 1T3NA 3BSAA 1GXLA 1N54B 1KLMA 2B8PA 3CDUA 5THWA 2FY8A 2F4VJ 1NNDA 2QYGA 5GMEA 3VQTA 4YOEA 5DM7Q 3SSSA 1BUXA 3KMSA 1NO8A 4ED7A 2GQ2A 1RAGB 5LSLA 2D3ZA 5LT5A 3CMAS 2O01C 2VV5A 2XCAA 1VRTA 3G82A 4ZVHA 4RJVA 3DKDA 2E1CA 2YVSA 1H0HB 1WOPA 2VOPA 1SH3A 4WZQA 3KUHA 1F5BA 3AB4B 3BB5A 2WK4A 3CCJS 2HLUA 3DXSX 4KHPJ 5HO4A 1E6VB 1JB0C 4IG0A 1HNXF 1Z2ZA 1ACMB 1YJTA 3CIZA 3D6HB 2ZBCA 3CO9A 4O0NA 3S8SA 2XHWA 3K5LA 4YEAA 4B9MA 2AJ1A 1Q53A 3HT3A 1OSDA 1FJGF 3VVUA 5KFFA 2ATCB 2DRAA 2DITA 2G13A 3QFWA 1NSKL 2Y1RI 3MMBA 1HBNA 1A7GE 2HWTA 4LR8A 4ICLB 2GV1A 3W8PA 4DV0J 5HVGA 4RBUA 3FVYA 3OL9A 5HBMA 1RGVA 2EEYA 5BYSA 5IS2A 3DYAB 4BHQA 1LWFA 3LQVA 2ZFHA 1QJHA 1P9QC 2AZ1A 4B9NA 2CFXA 3ZZZA 3I55S 1JLCA 4ECYA 4DFKA 3Q83A 1HQ2A 2HW3A 3KLIB 2GMJA 3WIVA 2HWIA 1VCTA 4DR6J 4UZCA 5F8JA 3BN7A 5E5NA 4OJ3A 4B9UA 2OMLA 1G3OA 2JDJA 2N82B 1VLYA 2KT2A 1LWEA 4HEA9 2MGZB 1RHQB 3KK3A 3KHRA 3H0PA 2UXDF 2HK3A 4K4TA 1AROP 1FE0A 3DHXA 1UJ5A 5HSPA 5AJ3F 4XTTA 3MPWA 1U09A 4N8NA 5HATA 2O66A 2P6TA 2HS0A 2RDIA 5CXTA 4DUTA 3AJ2A 3DGPB 1SB6A 3DI6B 1FKPA 3GFYA 2YX7A 4X4PA 2I2YA 1RBLA 1KQSR 4TLQA 1RBOB 2AYGA 1PAUB 4DV7J 2WHOA 4W90B 4P73A 2AEJA 5GAEU 3QPIA 2I8EA 2CRLA 1Q1KA 1S1WB 1EIYB 5JVHQ 3ET6A 4CNZA 2NSCA 3SMZA 2HFUA 3AJDA 2Z2MA 1MW7A 4FF4A 2COLA 1UJ6A 2VKZG 5T7LA 2UP1A 3A4TA 1JXLA 3UD5A 4B3RJ 4OMFG 5AXNA 3KXDA 4H4OA 4RW8B 2FTRA 5FDLA 5B0FA 3O44A 2J7WA 3R27A 2ZNYA 3BBFA 2I1RA 5FJ4A 5F9LA 3EJMA 4DFPA 2ZH8A 5DG9A 4J90A 1PO6A 2LDIA 2Y8WA 4N7TA 4DV3J 1Q5YA 1QAYA 1WEYA 4NWBA 3DLJA 1S1TA 3MURP 3BKTA 2XZDB 2JRSA 4MH8A 4A48A 2MZJA 1RABB 1VDHA 1M5PC 2E9TA 1H98A 1WHWA 2HQDA 2MXYA 1SI9A 5E7OB 2Z57B 1AB8A 4JB8B 2MKIA 3KHHA 1CC8A 3EZUA 3QFHA 2MZQA 1RTJA 3GPAA 1YJNS 1JXVA 2FJDB 1GH8A 4RW7B 3V5RA 1SPBP 5EX0A 4JI6J 1F5CA 4FZVA 1A0OB 4XDDA 1CS4A 1JX4A 2YNFB 1DLOB 1RAIB 1SJQA 3M8PA 5GMDA 5A8KA 4USIA 4OFZA 2FHMA 1MU2A 3MUMP 3O6QA 5HLFA 2C3OA 3C6TB 4M5NA 2YXLA 5SZTA 2BOPA 5I3QA 3C15B 3R5BA 3HHLD 4DU8A 3BV8A 3QRPA 2MKJA 1NMEB 2V0NA 1NLKL 2GAGC 4Z2XA 4DF4A 2MTLA 1TU0B 3N79A 5IM0B 1JMTA 3DXBA 5ETOA 5LSOA 4WF9Q 2MLZA 2V2VA 2PFDA 4H4KA 2V94A 3EYZA 1V3ZA 2ZE2A 3CCES 4QWCA 3D6FB 2V4RA 4RPFA 3BQ0A 3V6DB 5HL7Q 2D41A 2HG4A 4M5HA 1OYEA 2GVZB 1RT1B 5HQ8A 4LFCF 4OX7A 3MEGB 3T1YJ 1FRXA 2GX8A 2B5JB 2L08A 4LR7A 1BQMA 2LP4A 2V67A 2LXIA 2HMIA 4C0HA 1UEVA 2MKKA 5D4NA 1N32F 2FLOA 1TKZA 4C8YA 4CM2A 1S1UB 1S49A 1KP6A 1VC0A 4X65F 2JLGA 3A8EA 2RKIB 3GWCA 1D09B 1KTVA 2CYYA 2AU0A 3NG8A 4RW4B 2M9KA 1N56A 2FVQA 5B0EA 2WAQD 2IM1A 4DR7J 2MZ1A 1P9YA 3HPOA 3C16B 4ZCIA 1PILA 1LW0B 3QRQA 1XMQF 2DB1A 1HI8A 1S9GA 4PG7A 2DJWA 1A9NB 4NEZA 5LXRA 3E51A 2ZUAA 4ELTA 4LBHA 3MMCB 1K44A 3CJ2A 2KG0A 3HVTA 2L3MA 3CJ5A 1PBUA 3UN3A 3IWNC 4P75A 2RB7A 4RO0A 4DN9A 4KO0B 4ID5B 1F6TA 4U95A 5DG7A 4X4QA 1PYSB 3MCSA 2BM0A 2K06A 3BBBA 2R3VA 4K7QA 3NL0A 4EK2A 1N5SA 1H2TZ 1EP4A 3H5SA 5F3TA 1FK9A 3D0IE 2VDHA 4CLZA 1O0PA 4C9DA 2WOMB 1D9FA 2O67A 4C98A 2RUSA 1JLQA 1HNXJ 4OYXA 1M90T 4DV2F 2RRNA 3MEDA 2BM1A 1WC3A 1SL2A 4ILMA 4KGZB 3QT5A 4ZKAA 1KFDA 3UN5A 4KGMA 3NAHA 2HGMA 2QMXA 1X5TA 5EX3A 3LP2B 2JLEA 3DOMB 1U6FA 1U6ZA 1A6LA 3POTB 4K4SA 3DHWC 4QIGA 3H98A 2VONA 1M1KT 3ELHA 4USKA 3FDSA 4I7FA 2DNYA 3GMGA 3LP1B 2DNOA 2OGUA 1SUQA 1TVRA 2ZOFA 2YNIA 1WTFA 4TYBA 5B08A 4EYHB 2DEIA 4KHRA 1MMNA 3OVBA 1RHRB 1UFWA 2XC9A 2RVJA 3HJFA 2L9NA 4YQWA 1YWXA 4AL6A 4ZVRB 1QSSA 3BO3A 4CLYA 2D69A 1IBMF 5KG2A 5HVHA 2OPPA 1EZZB 3RJMB 3CE8A 4ZP6A 4JI2J 1OPIA 5KFYA 3RB0A 3SFGA 2QYCA 3T3FA 2BACA 3R8YA 2HPUA 1F5AA 1PYTA 2Y1IA 3EGNA 1FRIA 2UXDJ 1BQNB 2YBVA 1IR1A 4LR9A 2BANA 1WDDA 2VBWA 3RB6A 3GIMA 1URRA 1IXKA 4WU3A 4RLEA 3ICLA 3W9JA 2IDLA 2QRRA 1RTHA 2FC9A 3RYLA 3V4MA 4J7CA 2BKPA 2DT9A 4J9UE 2HSEB 1RWVB 2R8JA 1O8BA 1TL7B 3M9OB 2ASLA 1HPZA 5A8WA 4ZP9A 4OHYA 1VIXA 2PDAA 3CC7S 4LMZA 1UFLA 1RK8A 1CULB 3HFZB 4FVMA 1X5PA 4ZDNA 2UUCF 5C24B 1I51B 4USVA 1RDRA 5IT9Y 4AYBD 3T5HA 3S01A 2CNNB 2BJDA 3TAMA 1RWNB 3P3DA 1KLMB 2UUBF 4PABA 4NCAA 3TZXA 4DCOB 2B4PA 2BDPA 4LSNA 1S9FA 3UVJA 3CJQA 3QYYA 5KFXA 2XO6A 5D78A 3CO0P 1LFWA 5HROB 4ZPCA 1VRTB 3G82B 4LIWA 1K8AT 4QW9A 1F60B 1YZ6A 5HJXA 2AJ0A 7FDRA 4F8RA 5H1SV 2XM3A 1N88A 2XY5A 1WF1A 3I5BA 1TELA 3HZGA 4L3KA 2VA3A 2XI2A 2M70A 2JNJA 4ETXA 1T8EA 4DZ6A 4EO8A
chains in the Genus database with same CATH topology
4B17A 2GNKA 4NPOA 3I82A 3MXHP 3NS6A 1IKVB 3OV7A 3JTPA 3NWGA 1X4EA 4WE1B 2MPUA 1FEHA 3UCUP 4C8NA 2XZWA 1NH7A 5AE1A 4IG0B 2RT3A 4ECZA 5A8RB 2CZ4A 3DOMA 3DYAA 1R0AB 1XNQF 2BW2A 2J0QD 2XSJB 1XC9A 4L3NA 4NLDA 2ZH4A 1CPZA 3K2YA 5ITHA 1QSYA 2R7QA 3X3UA 3M9NB 2XMTA 1GTEA 1X4DA 3WC2A 3VZHA 3CD0A 1N34F 4O4GB 4RW6A 1XBWA 5KT2A 1T95A 2JEJA 3U1LA 4KT0C 1R31A 2CQ2A 2DGTA 2XS2A 2UUWA 1U1PA 3HI9A 4Y28C 3MFHA 1DURA 4OHZA 4FXDA 2LECA 1KR4A 2JSXA 4CH0S 3NAIA 2DR7A 4MIWA 3KTQA 4QWEA 4GKJF 1FXLA 5L39A 3KLIA 3T9NA 2KRRA 2J7UA 3MTJA 3TNVA 1LK5A 4QQBA 1I1GA 2M52A 3KMQA 1MROA 4UQTA 1NK9A 2HFOA 4WFAQ 1YRUA 3MMBB 2DHSA 2MDAA 4ZPBA 1R43A 1G7CB 2DIVA 1HBNB 3RU0A 2W25A 3CD6S 2P9EA 4A4JA 2JEGA 4GC7A 2HHUA 1PC4A 3ISND 1KTQA 2VL1A 2EFVA 4YHHF 3EPGA 3T6BA 2GQQA 2A18A 4LF8F 2PGCA 4DQSA 3R3TA 4OJ1A 4AXJA 4C7QA 2FC8A 2LLZA 2PD1A 1W25A 1YBAA 4B08A 4JI5F 3CJKA 1SL0A 1C0TB 2JZ5A 1N33F 2RNEA 2MGZA 3PRDA 2RDJA 1FF2A 3IO1A 1HBUB 3RRKA 5KFHA 3QJJA 2FGOA 2YKNA 2ZC3A 2W9AA 4ALZA 4R25A 2FUG9 2UXBF 4ITSA 4EYIB 1FKOA 1KQGB 1S9EA 1RT3B 4M5DA 5DGBA 2BQ3A 4Q8EA 2LU1A 5DJBA 3UPFA 1NKCA 4DL5A 2DGUA 1VK3A 2XGQA 2FVCA 5B0DA 1ZOTA 4F3OA 5KFBA 4B3OB 1S77D 1N5QA 4DR1F 3TANA 4Q43A 3MR5A 4I56A 2ZZNA 3CIMA 2IM0A 1Q81T 3QGPA 1GNKA 2XLJA 3F56A 1LWFB 3AHPA 2R8IA 2RRAA 4KJIA 2NXUA 3PX0A 2XSFA 3OTOF 3JSMB 1S72S 4WZMA 4B02A 2EVZA 4A8OA 4Q5VA 2H5EA 2PI5A 2RIJA 4CIOA 5EHHA 4MK9A 4JI4F 5GAHI 3HMJG 3SV4A 4FBUA 2ZD1B 4PQUA 4Q0BB 4WIIA 3FZBA 3EXCX 3ZC4A 3MPVA 4YB1P 5LXYA 2ASDA 1VQ9S 4QCLA 5JUMA 1NJIT 4IH6A 1JLCB 2VKRA 5CYQA 5L8RC 4KRWA 2PA3A 3CDWA 4RZRA 3RR8A 1Q78A 1S79A 1W2IA 2CQ1A 2P9CA 2QIFA 3UR3C 3FFIB 4C0OC 4F4ZA 1GTHA 2AGQA 2BR0A 3PHEA 1S0MA 1BC6A 3DGPA 1FDDA 1SJ4P 4ES3A 4F50A 3DI6A 1RT5B 4IFVB 1U45A 3JSRA 1RKIA 2XG8A 1S97A 3QAEA 4X4TA 3I56S 2IJFA 4NLGA 1DQ8A 5AE2A 3OL8A 1E6YB 4CZCA 2XO7A 3OTCA 2FJVA 3VCDA 1YJRA 3VAHA 1PGZA 2HHXA 5I3UA 1Q16B 3HHKA 4DV6F 2XB2D 1RQ0A 1R8BA 2B9WA 5JXSA 2FHKA 1LWEB 5KFZA 3KWMA 4A8XA 3BDPA 2BV3A 3QGHA 2BJEA 4X4SA 3GR1A 2F3JA 3KK3B 3QLHA 3DLLQ 1TV6B 3PO4A 2NSBA 4U7UK 1JNRB 2XMUA 1J2VA 3UW1A 4QJVA 1S1WA 3IR7B 4I0WA 3HDSA 1HD1A 2C28A 3MMAB 3G71S 2FD2A 4NMLA 5L1LA 1UVNA 2DCUB 2VD3A 2C3UA 1P8GA 4KGKA 4A8SA 2RD5C 4DWIA 3OUYB 3MWBA 3H20A 3CCSS 2JLFA 2F8HA 4LFBF 2F4VF 4IRDA 4QIEA 3C8YA 1CLFA 3KHLA 1NK8A 1C4AA 2V9WA 2YKOA 2EK1A 3MR2A 4IH7A 3KJVB 4K2XA 2B56A 3E01B 3SDEB 1X9WA 2B0GA 3CT9A 1N52B 3K5PA 3MDFA 5F9NA 4XPEA 3J7Z5 1S99A 3NMRA 1DJ0A 2NS1B 2AV5A 4FXWA 4RW8A 2MZSA 1JKHA 2NUHA 4B9TA 3NNAA 5F41A 2J8AA 2WBRA 3JYTB 3IBWA 3Q8RB 3QWUA 2YKAA 4FF2A 4I2QA 4KBIA 4NCBA 2CJKA 2WTFA 2W24A 4NLSA 1VRUB 1UVJA 4NRUA 4H4MB 2VG7A 5E3AA 5DDOC 5L1IA 2RS8A 2YKPA 3FQKA 5CZVA 5KFJA 4ATNA 3MFIA 2B51A 1FKPB 3CCQS 1VQSA 2HQIA 2DGXA 4DLEA 4NLWA 2V8HA 3BO2A 2GO9A 1BWEA 1VQ4S 4LF4F 3Q24A 2RRBA 1IKXB 1T05B 3SCIE 3TUIC 4K50A 3D54A 4MMOA 4OI4A 4PG6A 3DLEA 3PM9A 4QWAA 2XNRA 2JFDA 3PRBA 3D1HA 2ZNZA 4A8WA 1U7LA 3MM5B 1IQZA 5D77A 1OWXA 3W3SA 4ED5A 2M8HA 2JFKA 3PEJA 4R8UB 3MGJA 2N7CA 3M2UA 2GMHA 2ZH3A 3J7ZT 2Z4PA 2HFNA 1S1VA 4KQZA 1RT2B 5HROA 1C1CB 2W9CB 1BGXT 1X5OA 3KFWX 2JWNA 2MKCA 2Q79A 3GE9A 4DQPA 4J9NA 3I0RA 1BQXA 3JTOA 3P5TL 2O5DA 2CQGA 5C25B 2KYZA 4KHPF 2PSZA 2XWYA 5A2QY 4ED6A 2OSRA 1Y5IB 4TKTA 4WXOA 4J37A 1FTRA 4RNFA 5L1JA 4DV4F 2LYVA 2BQRA 2AX1A 2IRXA 3CCTA 1FEEA 4M1KA 4CO5A 4EO6A 1WHXA 1VQKS 1OSCA 5K14A 1RTDB 4DPOA 5T7LB 4RW7A 1JNZB 4KHMA 2N3LA 1Q8IA 1T03B 3THTA 4QIWD 4ZPDA 4DHVA 4F4KA 3NS5A 2C2DA 4PWDB 1V9OA 4QW8A 2MY8A 1S1XB 4H4OB 1WG5A 1DZ5A 5D4LA 5FDLB 3OJUA 4MYTA 4A8MP 3G6ES 2FHJA 1HNZF 1WWHA 2ASYA 3OXLA 4C2MA 4TQRA 2B9XA 3M32B 2HYIB 2ZHAA 2YNFA 4G1QB 5AXLA 1K1QA 2J5AA 1DLOA 1V3RA 1REVB 5A0YA 4K59A 2JX2A 2K3KA 2LEPA 4YB5A 4CH1A 3SZ2A 1NJYA 2WW8A 2J6TA 1HBMB 2EFNA 3VALA 1Q8BA 2XS5A 4PUOA 4BC7A 2JL9A 4NYOA 3DNCA 3ZZ0A 5GAEI 3CJ4A 3BM7A 3KLFA 3PW2A 4J5OA 5C42A 4NLYA 2BE2B 1UETA 3DN9A 3UFCX 3IGVA 5J1PA 1UAWA 5LMUF 5HP1A 2OIHA 2AYEA 4DX8H 1S1TB 2F1FA 4LSLB 1RISA 1XMQF 4IFYA 1UL3A 3VTIA 3CD7A 4PXDA 1VQ6S 2EBGA 3C6TA 4WKYA 2A10A 4IOBA 4CCHA 3B4MA 3ETOA 4OZ1A 1FT8A 1HD0A 2E5HA 1Z1ZA 3N6MA 2ZKUA 3B78A 2D9PA 3N28A 4YR3A 5F8GA 1SV5A 1FE4A 1SJFA 3OHAA 2LA4A 2HVIA 4RW9A 2MY7A 4DV0F 5K5MA 3UD3P 5E33A 3CF5Q 4EWTA 2KTQA 3B8HA 1EETA 1KQKA 5HMYA 1N5YA 4PWUA 4JI3F 1HR0F 2CDQA 4NYZA 1U1LA 3MEKA 1O5JA 1RTJB 1SH2A 2NPFA 1N36F 3CDBA 4RBTA 4QPTA 1HW9A 3BQ1A 2OD4A 2VG6A 4QIVA 5KFTA 2BBEA 3LPYA 3IR6B 3OFEA 3D1QA 4UW2A 2CQIA 2F8EX 3FSXA 4NA3A 1OPZA 4OQJA 3DLKB 2FJWA 1VQYA 1GQEA 3H5XA 2RQMA 4F4WA 5IM0A 4C3LA 4IRCA 4IKAA 3UDCA 2KT3A 2Y1JA 4ZCLA 1S6OA 2YWEA 1VQPS 2R8GA 4V19J 2ADBA 3KLHA 3SEOA 2IRUA 2APOA 1J5OA 1C0TA 3LWLA 1HBUA 4WFNQ 2DIUA 1NK4A 4O44B 3BGUA 2GJ2A 3M8PB 3TA1A 3EGWB 3SCKE 4KPYA 5DQGA 3N5BA 2B4UA 4ZLPA 3GV8B 5A8KB 3K57A 5EWGA 1LV5A