4WBFA

Acinetobacter baumannii sdf ndk
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
140
Chain Sequence
EFMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Acinetobacter baumannii Nucleoside Diphosphate Kinase
doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 41
structure length 140
sequence length 140
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4wbfA00
3B54A 1F6TA 2DXDA 3ZTPA 1LEOA 3G2XA 4EK2A 3VGUA 2AZ3A 5C7PA 1NPKA 3EICA 1ZS6A 3FBCA 2DXFA 1HIYA 1S57A 2B8QA 3DKDA 1NUEA 3NGUA 3Q89A 5BXIA 1NLKL 3VVUA 3WX8A 4ANDA 3VGSA 4UOFA 2DY9A 4FKXA 3FBFA 3FCVA 1NB2A 4WBFA 3BBFA 2BX6A 3MPDA 1NCLA 3GP9A 1PAEX 1S59A 4ANCA 1B99A 3ZTSA 4S0MA 3PJ9A 3Q8YA 3NGSA 3VVTA 4CP5A 3EVMA 1WKLA 1NHKL 3BBCA 4FKYA 4UOHA 3L7UA 4F4AA 3Q86A 1WKKA 1MN7A 2VU5A 3EVWA 1UCNA 3EMTA 4DZ6A 1BUXA 1NSKL 1VYAA 4W98A 4HR2A 3ZTOA 1XQIA 2HVEA 1S5ZA 1WKJA 1HHQA 4DUTA 3GPAA 1LWXA 1EHWA 1NDKA 3FCWA 1NSQA 2HURA 2B8PA 1NDPA 3Q8UA 1K44A 3BH6B 2DXEA 4O0NA 1B4SA 3EE3A 3NGTA 2DYAA 4F36A 3PRVA 1U8WA 1BE4A 2NCKL 3EJMA 1HLWA 3DDIA 4ANEA 2CWKA 3BH7B 3R9LA 1JXVA 1MN9A 2HVDA 1W7WA 3EVOA 1PKUA 2ZUAA 3VGVA 5IOLA 3ZTRA 3BBBA 5CAAA 1NSPA 3B6BA 1XIQA 3FKBA 3VGTA 4UOGA 3ETMA 1BHNA 3ZTQA 1F3FA 3NGRA 4ENOA 2BEFA 1NDCA 4KPCA 3ELHA 1NDLA 3JS9A 3Q83A 5CABA 4C6AA 3FBEA 3FBBA 3Q8VA 3FC9A 4DI6A 3EM1A 2AZ1A 1KDNA 3ENAA
chains in the Genus database with same CATH superfamily
1HFEL 2G0JA 3CCZA 3FVYA 3KDNA 2GHWA 2VG7A 1UVLA 1JLFB 1LXJA 2DGTA 2EPIA 3G2XA 4O3NA 4LQ3A 1Q7LB 1W25A 4I7FB 2F7VA 3UDLA 3GR1A 2KH9A 4PG6A 4B3MJ 4PR6A 2WCXA 3BREA 2DXFA 4IQMA 4AFFA 2OFHX 2A18A 3NGUA 3PDNA 1XWLA 1U1RA 1RT3A 4P6QA 1Q79A 3MEEA 4IRCA 4LF4J 2UXCJ 2DNKA 1S1VB 3OTOF 4A8QA 3G8TA 4X65J 1MROA 3PYDA 3BN7A 5GAHU 2F8HA 3CDEA 1KP6A 2HS0A 2ZOGA 1T7PA 3AA9A 2C42A 2UXBF 4JP8A 4FXDA 1T9UA 1F5CA 2WBMA 3W60A 1KQGB 3Q0AA 1K1QA 4E98A 5EWGA 2CQDA 3ILIA 4OQJA 5D0HA 4NLOA 2W24A 1J2VA 2VONA 1RAAB 1NJIT 1B0PA 1M0SA 1RB0A 1NH8A 3GYXB 4IG0A 4DHVA 5J1EB 1KBRA 4LIRA 2HMIA 4Y2CA 3BV8A 1M5OC 2I8EA 2N4CA 3MI7X 4KIAA 4WPAA 1YKWA 4EFAC 2KTQA 4YB7A 4JI1F 1Q95G 4A8SA 3D7SB 3NAIA 3IM9A 2IA6A 4DV7F 1SH2A 3DLEA 2IAJA 2CNKB 1U7LA 3GLJA 4DQSA 1NNDA 2WB1D 5M2RA 3AJDA 3FSYA 2O67A 3C8YA 4GMKA 4WE1B 3W7BA 1YDLA 4X4SA 4AYBD 3O3LA 3HI9A 3NBPB 1NPPA 1C1CA 4K4WA 2RAQA 3CTRA 1DY3A 2KJWA 2RU9A 2V2VA 5GMEA 1TQLA 2YNIB 4J9SA 1D1UA 2MY8A 4OHWA 1NKBA 3BDEA 1EB0A 1MW7A 1RE1B 4ZOSA 2BZ2A 2HWIA 1WOPA 4YN3B 1AA1B 1RUSA 1WDDA 3NS6A 1PJ5A 4MIWA 4WXOA 5L1LA 2QLWA 2W01A 4H4KC 2XSJB 3AD8C 3QAUA 3R6LB 4MJKA 4YB6A 3ZZRA 2FY1A 4GC7A 5ETQA 5D8HB 5D15A 2YH1A 2BBEA 2W2MP 2UVVA 1NEEA 4QYZJ 1R6VA 1D9FA 1F9EB 1VR6A 1I1GA 2XS7A 5IQQA 4U7UK 3TJ9A 5LMNF 4DV7J 1X4FA 5G0RA 2HHSA 3P5TL 2LQJA 5A8WB 1X4DA 2DHAA 2HQIA 3HVTA 2KG1A 3ENVA 3OD2A 4L74A 4XAKA 1HPZB 4QWCA 4P7TA 2NYIA 2AWZA 4ZP7A 2YKNB 4IH6A 5KFZA 4WKYA 2HW3A 2VICA 4LBIA 1VRUA 1IBKJ 4ZPTR 4M94A 4WU3A 3ZTRA 3VQTA 3OL6A 2CFXA 3MM6A 4RUHA 1EJ7L 3ET6B 1AZSA 1NK7A 3TX8A 3M7VA 3H4DA 5DM6Q 3KLFA 4N77A 4LRBA 2XNRA 1PAUB 4OIXA 1JB0C 1U02A 4O4GA 1TL7A 2PC6A 1R8PA 3SSSA 3VGTA 1BQMA 3ISZA 2Y1JA 5KFRA 5JUMA 3MFHA 2OPPA 4ENOA 1WF0A 3W1YC 3GMGA 1KTVA 3DMJB 1R0AB 2JZ5A 3JSRA 2K2PA 1KTQA 4KAIA 4LR9A 4NLTA 2GVDB 1RACB 4UY8T 1A6LA 3JS9A 4DR7J 1IVZA 3OLAA 5AXLA 3FBEA 3AB2B 2N82B 2R8HA 3TJAA 2B51A 1KRPA 2YNGB 4JI4J 3M8PA 3PACA 4OHYA 1Y3JA 3SQGA 5E3CA 2GO9A 3FQKA 3VALA 1R3NA 1RHMB 1ZA1B 2KKHA 2V34A 3DRSB 3IR5B 5AE2A 4C8YA 1CJTB 2ACYA 3W62A 4B3RJ 1UMJA 2GW8A 1CG2A 1RAJA 1SKRA 3GIKA 4IDKA 4RPFA 2AQ4A 1NPKA 1S99A 1VI7A 4QCLA 1SBRA 4O4RA 1VFJA 1EZZB 3GSIA 4H4KA 4USIA 2LCWA 4FF1A 3MEEB 1CJKA 3R5BA 4CH1A 4LFCF 2MZQA 3T5LA 4DR4J 3BS9A 5FDLB 1NLKL 4K5SA 4TY9A 2CIMA 3DLKA 3R3TA 1FCAA 2GQCA 3OL8A 3G8SA 3G6XA 4QJVA 4F4WA 2JEFA 1UPPA 3I6PA 1KNZA 1RGVA 3IXQA 2GX8A 4C9DA 2CQBA 2DY9A 3MPUB 4I7FA 2VC0A 4LR8A 1FWKA 1TP7A 3BDPA 3HD1A 1ZYQA 1WI6A 4DSJA 2X3DA 1RT1B 5ETMA 1KQFB 2E1AA 3KJVB 3ITHA 4NLGA 5E3AA 3KMSA 3GILA 2CZ4A 3M6XA 1IM4A 3IP0A 2DCLA 4I2QB 4KJIA 2IY5B 1F60B 2OSQA 3MMCA 1UZDA 4RL1A 2GFFA 3CDUA 4NLSA 2EWHA 1Y5IB 2DGXA 2UUAJ 2MLZA 2IRXA 2YWKA 3NOCA 4TNOA 1I94J 1YBAA 4H54A 4LREA 2DPIA 1WORA 4CCHA 3Q8YA 1RWVB 3SSRA 5GAEU 2HBZB 1S76D 2XHWA 4C11B 1VQOS 5DLGA 2BUNA 2DTJA 4OYAA 2DNYA 3C6UB 3QZ7A 4OI1A 4DFKA 3BPDA 3IN5A 1MLAA 2QA4G 2Z57B 4CYUA 2RRAA 2MZTA 2X1AA 2IMWP 4X4QA 3AQPA 1UWBB 1VRUB 2VOOA 5BR8J 5AJ3J 2VBXA 1KOOA 1QAYA 1GTEA 1R6YA 4QIWD 2V0NA 2VPWB 2OGUA 5A0YA 3MM9A 4QR0A 4DV6F 4YMEA 2HNYB 3BKFA 2HFUA 1HYSA 2J9CA 1LWXA 3CD5A 3D0HE 3CJKA 2JOQA 4DPYA 2R8IA 1TV6A 4BBYA 1Q78A 2M0GB 4JI4F 1AUSL 2R8KA 1N34J 2VODA 1SXLA 2DNLA 3GR0A 2KFYA 4IOCQ 2LEAA 3PVXA 1J5EJ 3HHLD 4CO3A 2LXIA 2Q79A 4ECUA 1N5YA 2AHOB 2NUHA 4B9TA 3HM9A 2AIRB 2UUBJ 3OTBA 1MMLA 4RWWA 3IGNA 4OHVA 4CO1A 1HWIA 2E5IA 5DDQC 1M90T 5AXNA 3HD2A 2PA3A 1O6XA 1E6YB 3BGFA 4X64F 1QAIA 3UO0A 2W25A 3UWTA 2UXDF 1N0VC 3EJMA 3L9ZA 4HH0A 2JH3A 3CJQA 2XS2A 3PG9A 2P8IA 1WC5A 4XPCA 1JNZB 3BR8A 4Q7AA 4QR2A 5HMZA 1RZMA 2W7AA 2ZBQA 1PKUA 1DBDA 2BYCA 1QDUB 1Y9OA 2F8MA 1R7IA 4LSNA 4LF8J 3D67A 4OYWA 3JAMU 2VIHA 4LF9J 3HJVA 1WHYA 4DR7F 4LIWA 1FERA 4DPTA 1H7XA 2IAJB 2XHCA 1QVFR 4EWTA 1P9QC 4RO0A 2XM3A 5KOXA 3L09A 4CLWA 3IG1A 3AOBA 4LFBJ 1T3NA 4L6V3 3MCOA 4ZHRA 5FDLA 2CPZA 3CT9A 3CC7S 8AT1B 2JLGA 3PFOA 3B78A 2J8AA 3IAM9 1QJHA 2DJWA 1QD1A 4M5KA 3JYTA 2BM1A 4EO8A 5RUBA 4JYAF 3F56A 2W4DA 1EX8A 2LQBA 3H2UB 4B9MA 4JI5F 2DNNA 2ZEJA 1Q8LA 2OEMA 4IDKB 1FWLA 1N5QA 2VFUA 4NXMJ 3K2YA 2FVPA 4V19J 2HG4A 3RU0A 2XY7A 1FRXA 1T02A 2AZ3A 3UNGC 4PXBA 5C7PA 5I42B 3CMAS 3C6TB 3EICA 1T05B 2FLPA 3V81A 3K7RA 3OLBA 2UVRA 3T1AA 2NXJA 3KUHA 2C1EB 1JLGB 2DH8A 2YTCA 2B6AA 2DGUA 4J9UE 1NK9A 3NCPA 1S9GB 5CD4H 3DCAA 3TJ8A 1P1TA 2OKQA 4NX9A 4OYOA 4DL7A 2AYGA 1KN6A 1D8ZA 2WVEA 1U6BA 2XMVA 1U26A 2YKMB 2CYYA 4WZQA 4LRCA 2CVIA 2D74B 4WP8A 3IS9B 1JXLA 3OL9A 2KDOA 3FJ2A 2BJEA 2FHMA 4ERDA 1BWEA 1UFKA 2DD8S 3TUJC 5EWFA 4K59A 4PPZA 1ICEB 3GONA 1WJ9A 1RT4B 2CPEA 3FBFA 4LBPA 4LSLB 1AZSB 4Y2KA 2Z58B 4QPXA 2YX1A 5L46A 2QG9B 5JJBA 2UV8A 1N88A 3MCNA 4KGXB 4O0IA 3K8WA 1HI1A 4LVOP 3TX0A 1EETB 1FTRA 1IBLJ 2XBPA 1WD6A 1S59A 2BJ7A 1WEXA 2CADA 1B0TA 2E1MC 2GNKA 4FXVA 1RAEB 3R7SB 1QUPA 1H72C 4S0MA 4TN2A 4ZCIA 3MEKA 4EGLA 4MH8A 3KK3A 1U1OA 3HVTB 5HANA 3TI0A 3PJ9A 3KMQA 3J81j 1W26A 1TUVA 2CQPA 1D0EA 2IA0A 1WUUA 2ZC3A 2RKIA 1TL3B 3DGVA 5KFXA 2OUGA 5K8MA 5LSRA 3CCSS 3MF5A 5DG8A 3A13A 5K8OA 1NJXA 2BJ3A 1LK7A 2HQFA 2XYHB 4WFXA 4LF9F 1CSJA 4RNNA 2ROGA 2OI2A 1MU2B 4LF8F 3D4JA 3H59A 2XEXA 3W9IA 2P2CB 4DZ6A 4Y0FA 1IKVA 3T5KA 3J7A1 1ZPVA 3GU0A 3GJSB 2ASYA 3AY0A 3MM9B 2RQMA 4OX7A 2R8GA 3D5MA 3LW5C 3J7Z5 2J7KA 1VQ8S 2B7BB 2RMLA 1SPBP 2WZ1A 2YKQA 3CE8A 3C15A 3BO2A 3IBWA 4YR0A 1LW2B 4C3MA 1XMOJ 3MMBB 3DRPB 1TUWA 3K0JA 1TL1B 3GQCA 1AW0A 1Q5VA 3FCWA 3LANA 4RW6B 1V3ZA 1CVJA 3I96A 2G2OA 4Y65A 3CJ4A 1FWPA 4L75A 2E44A 4USWA 3S01A 1YWXA 4A48A 2WTFA 1YIJS 2AJQA 4HT7A 3H5YA 2HWTA 1VHFA 3PY8A 2HKEA 3TZZA 2VBYA 1L3VA 3OTCA 1S6UA 1GXUA 5CH7B 2EKNA 4KH1B 2KM8B 1S6PA 4ID5A 5KG7A 3R27A 2K7JA 3R5GA 4OYPA 2EBEA 5I3PA 2W2OP 1YSJA 2RHSB 4ANEA 2ZZTA 2ACMA 3A3NB 3MM7A 4A46A 5BR8F 5AJ3F 2K06A 2H48B 1R8AA 1UA0A 1HMVB 3BBBA 2XQCA 2YWWA 2YH0A 1U2RA 3NLCA 3NWGA 2MQLA 3OR1A 3S6EA 3TAQA 4FXWA 4RNMA 2VG6A 1FE0A 3O6QA 5ETPA 2LLZA 3HKZD 4UOGA 1Z2ZA 4NI2A 4DV3F 5HLFB 4Y6IA 1P6TA 5CZXA 1WC0A 1WSVA 3CO0P 4USTA 4DV2J 4C4WA 4DSFA 1LWFA 1JLBB 1HBNB 1TKXA 5G4DA 2R2SA 1GH8A 4RWXA 3NS5A 4ZVEA 4F3MA 3RRKA 3OSNA 1EARA 1K0VA 4DOZA 1RAFB 1RTIB 2AEFA 2MSSA 3FC9A 4OI4A 4ZN3A 4ED1A 3UD4P 1TK8A 1S6QA 2DRAA 2FJBB 1IBMF 1ZM9A 5A8KA 3WX4A 4DFMA 4M5JA 1NB7A 3ZTPA 1LEOA 2NXEA 1RHQB 3SV4A 4EK2A 1HNVB 4WP9A 4LF2A 1GFWB 1Z2LA 2QMUB 3CJ2A 4CLYA 4PG4A 2B8QA 1X4AA 1X9SA 3BQ2A 3M8PB 1BC6A 1S9GA 2QO3A 4DV3J 3UCGA 3KYLA 1JX4A 4B9VA 1REVB 3D6TB 4KE5A 4IO1A 4OI0A 2F4VJ 1FXDA 2G4BA 5KFPA 2KFNA 2ILYA 2AJFE 4RBTA 4Z37A 3SI8A 2RU3A 4KKOA 1C0TB 5LJ5Y 3GV5B 2DGVA 4YHHF 2EKYA 4TLQA 3DOLA 4ZP6A 4YEAA 1Y3KA 2OFGX 5B0EA 1HBOB 1SC6A 1WC4A 1UVNA 3TUPA 4BCAA 2UUCJ 1RAOA 3UD5A 2DPJA 1OPIA 4CWBA 1DJ0A 3CJRA 2DO0A 4M63A 5H9FJ 1HQUA 1RADB 3ISND 3M9NB 3AODA 1EIYB 4ZS6A 3HVRA 2E5LF 2KZMA 3O1LA 3MM6B 1CPZA 4FYXB 1WNEA 3MPDA 1S6QB 4UUWA 1S12A 1FEEA 2MQMA 2AP6A 2ZHAA 5D78A 1VQKS 3HHKA 2LA4A 2PEHA 4H4MA 2FDNA 1RTHB 5HMXA 4N47A 3ZTSA 4WFNQ 3M8SA 2MQQA 1R8CA 4ZN1A 2ASDA 1XMQJ 3DDNA 2WOMA 4AXJA 4KO0A 5LMNJ 4JB8B 1HBMA 5U47A 3VVTA 1WF2A 2XZDB 1WOSA 5JVGQ 1S49A 1FO1A 3I0SA 4G1QB 2MHNA 2HGMA 1NHUA 3DOMB 1XERA 3ISNC 2LYVA 2FC8A 3B4MA 3M30A 1Y00A 2AT1B 3MM7B 1REGX 3D9BA 4KC5A 2QYCA 3R8YA 4U67Q 4QWEA 2BOAA 2DNQA 2VASA 2BKPA 3RB3A 1UKUA 2XYGB 4ID5B 4OZNA 5ETRA 2IYIA 2AV5A 3MM5B 1RWXB 2XULA 3UI3A 4DXLA 2W9CA 2NUUG 4ECYA 1N32J 4NCGB 3PKMA 2HBRB 1TZ0A 4E2FB 1HHQA 4CO0A 4DR5F 4KHPF 1U1QA 2O66A 4V1Ak 4NYZA 4NA1A 4YDDB 4UY85 2OPRB 3F0NA 3EGNA 3I5CA 1N5YB 2NR0A 2JC0A 3NBPA 2CPYA 2MGZB 1CEZA 3DLHA 4NWBA 2BE7D 2JFDA 1KQKA 2V2KA 2CZ9A 2ZD1A 3RG6A 4ZIVA 2CJ9A 4OYXA 3D54A 1FKPB 4GVBA 4OZ2A 5CYQB 3SCLE 5M2UA 1UA1A 1UEUA 3CCRS 2WOMB 2GMJA 1AXQA 1FRMA 2HPUA 3FNNA 3G6ES 1S1TA 1M5PC 1SKWA 1TTHB 2FHJA 5A0YB 1BE4A 3OUYA 3KK2B 1N52B 3PHEA 5CA5A 4F2RA 2BMBA 5J1EA 4IH7A 4DF4A 2B9YA 3OXFA 3HZGA 3I82A 2HVDA 3FDSA 2UUCF 5ETLA 1K0TA 4ED4A 2QEXS 5C5JA 1XTZA 2MKYA 2ABYA 3J7AN 5HK4A 1HARA 2BXJA 2R42A 4C48A 4K4UA 1X5SA 4X64J 2AJ2A 3M6WA 4EO6A 3J7YI 4MK9A 3ZTQA 3DOLB 3T1YF 5KTQA 2RRBA 2DRDA 2MKJA 2YQ3A 3TEGA 3OTOJ 2BEFA 1LOUA 2ZUGA 3AOAA 4K7QA 2DR8A 1NDCA 2JDJA 1ZETA 3QO9A 4DQQA 2J0SD 4ZPVR 3PO5A 4NXMF 4C97A 1OS5A 3M2RB 2B43A 2BANA 4X62J 2VFRA 2CZVC 3EWGA 3LPYA 1CJKB 3R5AA 4DV5J 2Z0GA 4DLEA 4LR7A 1RBLA 1TAQA 2YNHB 3TZWA 1WACA 1HW8A 4FYWB 1TFYA 2EFOA 3A3PB 2LXUA 3OFGA 1KEKA 1HNVA 3BN4A 1ZAVA 3LH2S 2H4WB 1U6FA 3C46A 2FQQB 4LJMA 3B8HA 3ENQA 3JSYA 1RT6A 1S1VA 1HHSA 1NK6A 4DQPA 3N6LA 1RWKB 2OPSA 3JQJA 4NA3A 2DNZA 3SCKE 5IV3A 4RU9A 1U1MA 4LF4F 4W92B 3OQ2A 3Q89A 6FD1A 1HNWJ 2PGCA 2CRLA 2LVWA 4ELUA 3AD7C 3QQCD 3VVUA 2U1AA 2R3VA 3CIZA 2IJFA 3EPIA 5IC6B 1FKAF 3HZEA 1KHWA 3BYRA 3IC1A 3T5JA 2UXDJ 1KOHA 2NREA 1VBKA 2O3DA 2MDAA 3CCWA 3DM2B 4I2PB 4P2SA 2KN4A 2XMTA 4CH0S 2M2BA 3KLFB 2HHUA 2V94A 2QA1A 4ZIWA 2V8GA 4P72A 1EAYC 1RSCA 5CQGA 3H42A 2IRUA 5GADI 4CLLA 3BGOP 4A47A 3DHXA 4MMOA 3W2WB 1WHXA 3MAQA 2VPZB 3P96A 3D68A 5D4LA 3LP0A 5B0CA 4AL5A 2B4UA 2DIVA 4ZCKA 1B99A 4ES2A 1AYEA 1JLBA 1HBNA 3GV8B 2V8HA 4RJVA 4U8YA 2VQEF 1PBUA 3KKFA 2ZH8A 1IR0A 1JXEA 4YY3F 2EG1A 4JV5J 2KT2A 2C3YA 2HWHA 3NGSA 2H5JB 1FX4A 4H4OB 3D3BJ 4FKYA 4PG8A 1S6OA 1APSA 3ET6A 1F9HA 1LXNA 4CH7A 4DX5A 3Q86A 3GIIA 4FYVB 1I51B 2CQGA 3EVWA 1JKHB 4F02A 1Z4UA 1IBMJ 4P10A 3KG0A 2XGPA 5E33A 4PG7A 3N4WA 4C3KA 3VAKA 3I5BA 1NK5A 1FE4A 3VHQA 4B3RF 1RABB 2CQ3A 3MM8A 4DQIA 2C2KB 1VJQA 4DUTA 1ZH5A 5D4OA 4MIAA 1PGZA 4NLDA 3KG4A 3ZFVA 4URGA 3HF5A 3VWSA 4TU9A 1I94F 2B8PA 4Q5VA 1S1UA 5I4MA 2MGZA 4RUBA 4H4OA 3V6JA 3RR7A 3IRXA 4P71A 1HNXJ 3V5RA 3NEKA 4AD6A 5KFTA 4L73A 3EXYA 2HVZA 4KO0B 3DLEB 1NK4A 2QL9B 2D7SA 2DB1A 4NCGA 3S8SA 1B0VA 3Q8PB 3THTA 2W9CB 2RS2A 1JWWA 3CPWR 1CJUA 2B5JB 3GJTB 4FNHA 4KB7A 2IM3A 3BB5A 2AKWB 4ES3A 1FDAA 4O3QA 2CJQA 3U1MA 3WC0A 1DFDA 1MN9A 2Z56B 1JKHA 1OJ4A 2AMCB 3MEDB 3I4HX 3W9JA 1T03B 3Q2TC 2W2QP 5F3TA 3ZC4A 2HK3A 1NSPA 5ETVA 1YRXA 2PIIA 2W1BA 3MECB 2H9ZA 1ZAXA 1HQ2A 3MCMA 4Q2LA 4R0JA 4ZPAA 4IQXA 1VBYA 4ZLPA 4AT1B 2DHHA 4ELTA 3EYZA 2IIHA 1UFLA 3ZNJ1 4DV1F 1FDNA 1N6QA 4ZVHA 1DTQB 2V6AA 1FNXH 3UDCA 1BXNA 1EP4A 2YX4A 4ZK7M 1L5UA 1P1LA 2HMIB 1RAHB 2OH2A 2CJBA 4LF7J 2AW0A 3HK2A 1IXKA 4DI6A 4X4VA 4FNIA 2HZVA 2H4YB 1E6VA 4MFBA 4DS5A 3NMAA 3DDKA 2V5HG 3GV7B 2BACA 5HL7Q 4Z7CA 3DLGA 1T9VA 1U1PA 4CI0B 1SKUB 4A8WA 2J6UA 1B7FA 3QAEA 4ATNA 5M2PA 4ECTA 1UAWA 5KT5A 5KT4A 2MZSA 2G13A 5K14A 1TELA 1R27B 2ZNZA 3BPSP 3Q8SB 1HIYA 1FRIA 1N4LA 5F41A 3C2PA 2KI2A 4Q45A 2G0IA 2BANB 4OV1A 1S97A 4MTPA 4G1IA 4CRJA 4WIIA 2BVZA 1WHVA 2EVZA 3PEJA 3QWPA 5CXTA 4I4BA 1HWUA 3KTQA 1FJCA 4PAAA 3Q22A 4C0HA 3DMJA 1M5HA 4UOFA 3ETOA 3TRGA 1S0NA 4WZMA 2M3DA 2IVMA 1FFGB 4DR2F 2F4FA 3CGIA 5DETA 2P6SA 4KFBB 4F8RA 3NAHA 5DDRC 4DR2J 3R1HA 1SI9A 1WEZA 3E01B 4R8UB 1TK5A 4NLYA 2ZBPA 4M5DB 1A0OB 2HAIA 1XR5A 4YR3A 2YNHA 2HQDA 2HBQB 4ZP9A 3JYTB 1FJEB 2V8VA 1XNRF 3KLGA 1KC8T 1LQ9A 2L48A 2MMYA 2WVFA 2YNGA 1LWEA 2R7OA 3N79A 2IDEA 3QSIA 4N76A 2LEPA 1U24A 1YJRA 2XLIA 3V2UC 2KT5A 4ANCA 4AL7A 3PZPA 3MGJA 1E6YA 2W8LA 2QRRA 2MPUA 2N3LA 3H5XA 2MHEA 1HR0F 2DCUB 3VZIA 5B0FA 4LRAA 3G82A 3R6GB 3P6YC 4DFPA 1HNZJ 3MTJA 2CPXA 2LDYA 2PT0A 3IRXB 4RW8B 4ZVFA 3RRHA 3QYYA 3QRPA 3AD9C 4HEA9 1FNOA 4F4AA 3TOQA 1JMTA 1MN7A 2JVRA 4C8NA 9RUBA 1R89A 2ROEA 3FFIA 4B3MF 3PKYA 1UVJA 4ED0A 5IS2A 4C3LA 2HHWA 3D1QA 1CJUB 1GNKA 2B5JA 4P2XA 4UF4A 3OVSA 3SCJE 4FF2A 3V4IB 1WOOA 2IVYA 5AXKA 4DV1J 3MUVP 4LFBF 3GFZA 2OP5A 1Q5YA 2NXCA 3EDRB 3M8QA 3QIPB 4RW9A 4UQTA 4U7CA 2NLWA 2AX1A 4LT6A 2B7CB 5J2NB 3UN2A 1U45A 2IM1A 1EHWA 1MWZA 1MU2A 5KFWA 3IAS9 5L8RC 4EEYA 2W2PP 4N8OA 1BQNA 5HROA 4DWIA 1VBXA 1YG0A 2ZOFA 3BH6B 4PWWA 5KFDA 3UW1A 4F50A 2HQ3A 1Y7PA 2CPJA 2HNYA 1HA1A 1W2IA 4JBCA 1PO6A 2RB7A 5D3GA 5D0RA 1YJVA 2LKZA 3TAMA 3LF0A 2BJDA 3A8EA 3M1VA 3MD3A 2OHDA 4LQ9A 4PQAA 3P4UB 4HHJA 2E5JA 4UT4A 3MUTP 4PWDB 1ZM2A 5JXSA 3QFHA 1UL3A 4IFYB 2BR0A 1ROFA 2R7UA 2HRUA 1A7GE 1UWBA 2D69A 4CDIA 5GMKa 1N8RT 1C1CB 3CO9A 2AYBA 1K9MT 2UUBF 2CA9A 1F9FA 2QMXA 2VV5A 3QMQA 4IG3A 4Y00A 2X1GA 2X51A 3TEHB 2UXCF 3NL0A 2Y3YA 5DZ7A 3MAAA 2NS1B 5HSPA 4PPDA 1JLQB 1HBOA 4F04B 1XEZA 2DY1A 3ZZYA 1RWPB 4B17A 5ETSA 4AE5A 3SYZA 1DRZA 2RUGA 2Q6BA 4HACA 2LQ5A 4OJ3A 2VG5A 3SSQA 1X0FA 5K8PA 4LF7F 3FMWA 1Q53A 4X66J 2WB4A 1RT3B 4IG0B 4LF1A 4OI3A 4DDFA 1HQEA 2B6AB 3CJSA 2MKIA 2HHQA 2D3UA 4C8ZA 3CSKA 3JB9k 4DR6J 5AT1B 2KXFA 3A3OB 2VFSA 5K8NA 2L41A 3W3SA 4FYDA 2C3MA 5I42A 3B54A 3G6YA 1M5SA 1NAQA 1X60A 3PJXA 4DPUA 1NK0A 2KVIA 1KVIA 4QIGA 4ZPBA 1WC3A 5F8NA 3NMRA 2Z2LA 3KNAA 5LJ3Y 5T7LB 1NUEA 1XR7A 3DFEA 4OMFG 3UR0A 1RTIA 5L38A 2KRRA 2BW7A 3QIDA 5KG4A 3BGRA 5KFKA 3CB4A 4NCBA 1XNQJ 4ETXA 4L76A 5A2QY 4WYWA 1TKZA 2ZH4A 4NRTA 4G1PA 4HHUA 5KFSA 4KTQA 1R0BG 4UTGA 2OPPB 4C8LA 4M8LA 2E9TA 3KLIB 4I6YA 4BHQA 4PEOA 3NY0A 1NO8A 3DGPB 3BQ0A 4MKYA 1C4AA 4DV4F 5IWAF 2OMLA 1DAXA 5SZTA 5DLFA 4FKXA 1PSDA 2G1DA 5EX3A 2MQPA 4QWAA 4WBFA 1J5EF 1WTBA 2DNHA 3SQGB 1FJGF 2CDRB 2YPYA 3NKYA 3NXZA 3RJMB 2C3UA 2RQ4A 3GP9A 1SL1A 2RUSA 2MQ8A 2PEBA 1ITPA 4F0HA 3VQSA 5IQ6A 5KT2A 1Q81T 3MAHA 1UVKA 2IDLA 1RBOB 1HPZA 2WW8A 5KG6A 3HT3A 1ZTWA 4IR9A 2XMUA 4QBUA 2V69A 1S1TB 4NLUA 4D3GA 3GYGA 1P9YA 1YJ7A 4PKDB 3KJFB 3N9UC 4K4ZA 2N7YA 3DLLQ 2OTLS 2DGSA 2W9BA 5J1PA 4X66F 1DLOB 2VDIA 3PCOB 3GG0A 1ZAWA 5F8IA 3AOCA 3MPVA 4B3SJ 1PIEA 4YR2A 3GJRB 3GFYA 3DXSX 5C42B 3SIPB 4ZPDA 4ZVTB 1LWCA 4I6AA 4URSA 2VC1A 4GRSA 4OLPA 3EX7B 2PFFB 4B02A 3A8IA 2F5GA 2AEJA 1S77D 3SXLA 4QYRA 3PIPQ 3QT6A 4IYQA 4USUA 2C2DA 3D3CJ 4I56A 3JSBA 1BQXA 1F3VA 1GK8A 2VBWA 4KQZA 3W5ZA 4ZA1A 3UE2A 2QFJA 1SJ3P 3P49B 4OJHA 3CC4S 3MXHP 4KT0C 4KPYA 1FD8A 1GTHA 2SXLA 2H1YA 1VRQC 3DOKA 3LAMA 3I5AA 4J37A 4WJBA 3DOKB 1RTJB 2MB0B 2BOPA 4WFYA 3C3LA 4RKUC 5HP1B 2VQFJ 1NRKA 1TVRA 2W7PA 5BYQA 3DI6B 1YJ9S 2UZAA 1UETA 1HYSB 2HFOA 1B4SA 2P5VA 3C15B 3TO8A 2R8JA 1UVMA 2GIFA 2EG2A 2XMWA 1VIXA 3SQOP 1F1BB 2QL5B 4DLGA 3PX4A 1JLEA 1FFWB 2RVJA 3NNAA 1R43A 3CD7A 3RB4A 4FPIA 2IPOB 1VQ5S 2FLLA 3R1LA 3KLGB 1VQPS 3N5FA 5KFFA 4J91A 1NHVA 5BYSA 1FRJA 3MHYA 4IOBA 1SJRA 2MKSA 2V2ZA 1RT1A 2PO4A 3EZOA 3V6KA 1H74A 1TL3A 3D6MB 4IR1A 2JEIA 3KUEA 3MCSA 1BLUA 1ULRA 2NZ4A 5I3UB 3OXGA 3TVYA 4DR6F 1HL6A 1IKYB 3LUYA 2DHGA 4W4MA 4DV5F 1AUDA 3HJFA 1SC4B 3LWLA 3KLHA 4C8OA 3Q83A 3PW4A 3MMCB 4K0KJ 2UVWA 2KYZA 3H2LA 3NGKA 3UD3P 1WTFA 3TYTA 3ENWA 5IT9Y 3MR2A 2XI2A 1QAJA 3ENAA 3T1YJ 4AQYF 1C0UB 1C1BA 3BQ1A 3KHLA 2U2FA 4URQU 4ZPWR 2ZJQQ 1QAXA 1QSLA 5H9FK 5A8RA 3BGLA 3PO4A 4KHMA 3R5CA 5A8RB 1PJ6A 1SC1B 1IKWA 1VISA 1KKHA 2VG7B 8ATCB 3LWMA 3JSMA 3OR2B 3FEYB 4I69A 4EYIB 3KFWX 4DSEA 4G3IA 4ZVRB 3GSDA 3TP2A 3CCMS 1NZAA 1FEHA 4OZ0A 1FI4A 5BXIA 3L7PA 4ECRA 1WF1A 2ZDOA 2XWXA 4CLSA 1N54B 1RDRA 1NKCA 2CJXB 2GQQA 5KFMA 1R0AA 2FTRA 3C6TA 3K57A 1SH3A 4LBHA 1VQ6S 2CAJA 1TU0B 1V3RA 2V4JA 2M9KA 3CD6S 4GKJJ 4M1KA 3HSJA 3H40A 3BSCA 4OYBA 3BYPA 1JLCA 2G2YA 3POTA 3E3XA 1NCLA 3JTOA 2L08A 3KK1B 3PV8A 2EC2A 1G1XA 4W90B 1QLNA 1UP1A 2A6OA 3H2VE 2J9DE 3QO9B 3NCQA 1L3KA 1GAOA 1M1HA 1RHUB 2ZJRQ 1SJFA 3DN9A 3IMQJ 4XDCA 2XMJA 2CNLB 2OAUA 1QUVA 2X1BA 5T14A 4TLRA 3V6HA 4ILMA 3J7YU 1FFSB 1HD0A 2CQIA 2EFPA 5C25A 2CPDA 4Q8EA 2QSWA 2HVHA 4I6WA 2W4PA 2YKPA 3W5XA 2NPFA 2JVOA 2DVIA 4EMDA 4DUYF 4EU0A 1FJ7A 2PMHA 2VU5A 4OYMA 2MSTA 2OPQA 2DK2A 3GB0A 1VQLS 1HNIA 1J27A 2GJ2A 4RNFA 3TAPA 4AL6A 2RQKA 1NBEB 1HWKA 4HR2A 3US5A 5DJBA 2V9WA 1OY8A 4WKRA 1RBAA 2BJ1A 4Y2IA 5ETTA 4J9RA 1IJEB 5DZ6A 4A8MP 4JI6J 4ZVQB 2N7CA 2MJNA 2YNIA 5IM0A 5DRKA 4J9MA 4UW2A 4B9SA 2CDQA 4DV2F 1VLYA 3H4BA 1TL5A 3CIMA 2APOA 1BQNB 3MR6A 1FHTA 2ZZMA 1TKDA 1JQGA 1DLOA 1U0SA 3ZO7A 2HK2A 2ZBCA 3IBCB 3OVAA 5HBMB 1VDHA 4LRDA 3VF0B 3ONQA 4Q8FA 5A6WA 2M7SA 1BY9A 4DG1A 3N6MA 4A4JA 2P6TA 4DV0F 1X9WA 2X1FA 4JV0A 2AF6A 3QFWA 2DIUA 5F9LA 2EFQA 2HQCA 2EK1A 3C16A 3H25A 1Y5NB 3V4IA 1U49A 4I64A 3M2UB 2NCKL 4ZP8A 1U6ZA 3M8WA 2Y1RI 3TQ1A 1PYOB 4KSEB 1VGYA 1F5BA 1FESA 2NYHA 4NASA 3OSPA 2ZUAA 3DOMA 3JTNA 3EXCX 1ZTTA 3M8RA 1JNRB 4B3OB 4LSLA 1XIQA 4ECZA 4IH5A 3W66A 3SCIE 3IBFB 1C2PA 2FD2A 1NM2A 5GAGI 3KLVA 1HD1A 2GJFA 2WSFC 3K5PA 1HBUA 2IC3A 1U1KA 1CS4B 4EBEA 1ZZFA 1XR6A 3PW5A 1S1WA 3RAXA 4QU7A 2CKWA 4E8UA 1KR4A 4Y3CA 4DCOB 1KLMB 2GGPB 2FHJD 3L4BC 4YQWA 2VA2A 4ECWA 3E51A 4H4MB 5CABA 2QT7A 2ZOMA 3M2VB 5ETNA 1S48A 3BJYA 2DGWA 4L3NA 4M95A 4MYTA 4OI6A 2QFIA 2J0XA 1UW4A 2RJZA 3IFEA 3POTB 2DR7A 2MKHA 2XI3A 2HRTA 4IUFA 1VS3A 3ZZOA 2PDAA 3G9CA 1X4EA 4I68A 4QWBA 4ED3A 2A10A 2ZNYA 1QSYA 2Y0BB 2UUWA 2AX0A 2MZ1A 2QLJB 4LSZB 4LFAJ 4R5PB 1H6KX 1S57A 5HMWA 5KG1A 4CLFA 2D3ZA 2Y9HA 1XBWA 5A76A 3PIOQ 1YQHA 2M8DB 1HQEB 4XO0A 2GV1A 2QTWA 3Q8QB 3ILLA 3VAJA 4GKJF 2BE2B 1AB8A 1LFWA 2ZBRA 1RHJB 4HDHA 4U8VA 5THWA 4DCJB 5DGBA 1WC1A 2LQ8A 2R4FA 1N33J 2B9XA 4M5IA 2DGOA 3UQSA 2NPIA 3FMBA 4PXCA 2VL1A 4WIQA 4B9UA 2HSEB 1YGYA 4A8YA 4K5RA 2ZHOA 5LMUJ 3SV3A 4HI2A 3I0RB 1ACMB 1RAIB 1JLFA 5IXUA 2XO7A 4LRFA 5KG3A 3UDEA 5GVQA 1KQSR 3BR9A 2DGQA 3BBFA 4NZ0A 1DQ9A 3M05A 3T9ZA 3GG1A 3X3UA 1XMOF 1RU2A 3A8KA 3GIRA 4ZVUB 1RLCL 3IWLA 4NEYA 4MYUA 4GC6A 3BZQA 4GVLA 1U47A 4QPTA 4DFJA 2J8SA 4JI2F 1RYSA 3OUYB 4FYYB 4XDDA 2H3EB 2VPXB 4QR1A 5IC4B 5D3GB 3AAWB 1OO0B 2GO8A 2WVBA 2A2CA 3A12A 2H5IB 2UVUA 4DG1B 1NJWA 4C8KA 4OX9J 3MOJB 2ZWOA 3QT5A 3SMZA 3VZHA 4KHRA 3C66A 4HKQA 4X4NA 1S9EB 2X7IA 4FZVA 4OI2A 4Q43A 1U0HB 4K0KF 1WC6A 4DPXA 1G6BA 4LF5F 1HNZF 1WKKA 1OY9A 3ZZTA 4DN9A 2EXUA 2IM2A 3W2VA 4YUDA 2CG8A 3FZBA 2ZH9A 5I3QA 2WBRA 2XC9A 2VH7A 4F4ZA 2Z2MA 1XQIA 4J90A 4XIUA 1AT1B 1XN9A 2ZH6A 2DITA 3QRRA 2WHOA 4X4PA 2HHHF 1IKVB 2CQ4A 3ZZUA 5CYQA 3W65A 3KOAA 3D6FB 4RW7B 4EBDA 1UJ5A 2GAHC 2B4OA 1XMBA 3QJJA 1U0HA 3R9LA 3TWZA 2B4VA 3L95X 1MNEA 4OX9F 1PILA 2DNPA 3DRYA 1NU4A 2ADCA 2HVIA 4LF5J 1YK9A 2GQ2A 2VZ9A 1D9DA 2Q43A 2DYAA 2RDIA 1RU1A 3G8QA 2MQOA 4DSKA 4QW9A 3V6DA 2I5JB 3OT9A 1HLWA 2E66A 4DX8H 1MWQA 1X4BA 4DQRA 3IR6B 1YZ6A 4KGKA 4TXSA 3OJUA 2EFNA 1RK8A 2FJVA 1FT8A 1LW0A 3PTWA 1G3OA 2QLFB 3KJVA 2FYXA 1RT4A 3M6UA 1T95A 1T05A 1KD1T 1EQ0A 2Y1IA 3QBCA 2I9SA 3T5HA 3KLIA 3PR5B 1JJHA 1F3FA 2QLXA 3KG1A 3UPFA 3HP6A 1SB6A 4JI5J 4EYHB 1NPRA 5J2MA 4JI7J 1N33F 5CHCB 4QWDA 2AJ4A 3K5LA 2ZFHA 5KG0A 2LEBA 1H3DA 1RT7A 5AXMA 4JI2J 3TARA 1REVA 5HI7A 2XG8A 3W2WA 1J5OB 1LWEB 2KO1A 4L72B 3E8OA 4MKAA 4Q0BA 5FLXU 4JV1A 3GIJA 2R7VA 2HAFA 1JLAB 1SC3B 2RF2B 2GVZB 3MEGB 4KH0B 4P7VA 2JL9A 1FKOA 2GCFA 2GIRA 2XYPB 3KLEA 1RKJA 2RILA 3ITHB 1EKSA 3FEXB 1NZ8A 2XS5A 2MLYA 5DM7Q 1TK0A 3HXMA 2G9OA 5T41A 3T1HF 3CXCR 5MLCV 5BJRA 3MD1A 1H7WA 4DL5A 2J9DA 5B7WA 2ZM6J 4DMZA 4LF6F 2Y0SD 1QM9A 1VLOA 1ZS6A 3W8GA 3KHRA 5HVGA 2XY6A 1QY7A 2V68A 3DLJA 2BE2A 3DRRA 5D4PA 1RLDA 3KJQB 1YJWS 2VKZG 4ZDNA 3OXLA 2IYGA 4DV4J 3EZUA 2RDJA 1Q82T 2GVDA 4RLEA 2K8GA 3UNYA 4IRKA 1F2GA 2JX2A 1X5PA 3QWUA 4GO5X 1VQ9S 4B3TF 1RWNB 2EFGA 2K3IA 1WG5A 3N28A 2NXUA 3L3CA 3CUNA 1H38A 3I9ZA 2CJAA 4M5LA 4OZJA 4QIEA 1CJTA 1TKTA 4QU6A 2PD1A 3DRSA 4HTJA 2VBZA 2A6MA 3U02A 2PN6A 2RF2A 3GFHA 3OTEA 4F0KA 2DT9A 2FVQA 5FJ4A 4PG5A 2RNEA 1RT5A 3I31A 5B0AA 1SCJB 4OX8A 3UFCX 4ZJLA 4DR3F 5HP1A 3KK2A 2HYIB 4BDPA 3IG1B 1Q8KA 3DC2A 3UVJB 4WFAQ 1SUQA 1TAUA 2WRMA 3MMJA 4NL5A 3DNCA 7FD1A 4OV6A 3ILOA 3MECA 4BS2A 4UOHA 3PYEA 1S1UB 5KFNA 2AGPA 3H0PA 4IG3B 4MKVA 1QVGR 1PC5A 2K7KA 4KGMA 1Z1ZA 4WTYA 1MMDA 4HH1A 2JJ4D 1BWVA 4R25A 4ZPCA 2WAQD 3F41A 4LUBA 3RB6A 2FB0A 4P74A 5D6GA 1S6PB 2FLNA 5J2QB 4PYDA 5KT6A 2VFVA 4FDFA 2VA3A 1RCXB 5L1JA 2W8KA 1SL2A 3C19A 3NNHA 3MFIA 4N7TA 3PXGa 2EW9A 1YVFA 2HURA 2BJ8A 4YFUA 1B70B 1ZA2B 3C14B 5LSLA 4CLZA 2HNDA 3LP2B 1SVDA 4PXDA 5D0EA 5LOQA 2DR9A 2IVFB 3PW7A 1H73A 1TR0A 2MEWA 2VKRA 3O5TB 5E2QA 4X4RA 2OPRA 3BKTA 4C11A 2WVCA 3NG8A 2F9JA 1NSAA 2DH9A 2OEJA 3D1OA 3FUYA 3M8QB 1KONA 3QIPA 4M5GA 2R7RA 3BO4A 4USKA 2ZM6F 1U8WA 3D6HB 2YY3A 2ZH7A 5EX0A 1GXTA 3HO1A 1X4GA 4ICLB 1PC4A 1T9YA 2B9WA 3AQOA 4ZVPB 1RT2A 3RTVA 3UCUP 2XLKA 4OZLA 2CWKA 2N4DA 1CC7A 1V9OA 1XJWB 3FSXA 3M30B 4I0WA 2FZKB 3FFIB 3KK1A 2UP1A 3VGVA 4MT1A 4CO2A 1N56A 1KFSA 4JI8J 1K47A 4DUYJ 2C2EA 4I2PA 5SUHA 2CQ0A 2BW2A 2DO4A 3LGHA 3CJ3A 4KFBA 3UR3C 4DEZA 3TZYA 2HBYB 1BHNA 1QTNB 2VFTA 3NGRA 2ADBA 2C2ZB 2LQ9A 2R7XA 3P3DA 3H20A 4P2MA 5IV4A 2POKA 3CWJA 1FXLA 3EDQB 5HQLA 3B4DA 1RWOB 2HLUA 5HAOA 2XO6A 2YQ0A 3J80Y 1LFPA 3VAIA 1UPMB 4QIFA 2BA9A 1RISA 1GX5A 4OJGA 3Q24A 2VOPA 1K8AT 1YZ7A 3I87A 3TA0A 2D1CA 1FF2A 1IKWB 1O8BA 2MZJA 4M5HA 3CCUS 2EBGA 1SV5A 1R31A 3F73A 2ZDPA 5B09A 3AH6A 1SV5B 1M1GA 3OW2R 2JNJA 4JI0F 3TNVA 4IO9Q 2VJVA 4N41A 1UZHA 2W2NP 1RKIA 2D9OA 2K1RB 3JTPA 2YNFB 3MMAA 5B0DA 2RIJA 1MROB 3PRDA 5LXRA 1DHMA 3BO3A 2R7TA 3GWCA 1YBTA 5DDOC 2WVDA 2UV8G 4X2BA 4K8RA 4Q0BB 3VTIA 3LALA 3M2VA 3TZXA 3WC2A 4ECQA 2MKCA 4EUVA 3QGHA 1JLGA 4ALZA 1YRTA 1B64A 1T11A 4K2XA 3W8PA 3WX8A 4X4OA 2QL7B 5C2CA 4UUXA 3VGSA 3A8JA 3EPGA 3EGVA 3DYAB 1BGXT 2IHR1 3FRYA 3FRZA 2QJ3A 3HSDA 5E41A 4WFBQ 4OX6A 2K3KA 2FJXA 3S7RA 4F25A 3LP1A 1M5VC 3R7BB 2OEKA 1X9MA 3MUMP 3G4SS 1SQEA 3OR1B 4ZLJA 3OL7A 3OHAA 1H2TZ 3PR4A 1E6VB 4MFBB 2GVZA 3KLEB 2BX6A 2YQ1A 4DX7A 4HLBA 4KHPJ 2RQCA 4DR5J 2NSBA 5F0UA 4B08A 2CXEA 1WG1A 3DU5A 4Z7YA 4NRUA 4JV2A 1GMWA 1S4FA 1CBKA 3KDOA 1KLMA 1OQ3A 2GGPA 3QGIA 1LWFB 2C2RA 3HCXA 1YHQS 2DHXA 1S1WB 5KOWA 4USJC 3FCHA 5J2MB 2BQRA 1SIWB 5IFMA 2XCAA 1OPZA 2MZRA 1OSDA 1IKXA 3HDSA 2M5YA 3RBZA 1DQAA 2CPHA 4O3PA 2H5EA 3MAAB 3CF5Q 3QATA 2I2YA 3IM8A 4QW8A 4CQ1A 2RS8A 1UWAA 1LW0B 2JLFA 1IUJA 3EMTA 1FRHA 2HNZA 5J2PA 2KJVA 2HHVA 2E29A 1N5VA 1UEVA 2YBVA 4ECVA 1N5TA 4J9LA 3ZTOA 4AUKA 3HPOA 3SBMA 2AJ1A 2PI5A 1VC0A 1DURA 3CDBA 1Q4RA 2CJYB 3C16B 3U7JA 3VCDA 5ETOA 5HJXA 1WKJA 2IJNA 3HMJG 3CJ0A 6FDRA 4X4TA 3NP5A 5E7OB 1TFWA 3LP2A 3ICLA 3Q8UA 3Q23A 4LVNP 1RQ0A 3QZ8A 1TL1A 1OMSA 2DXEA 2ZH2A 2D3O1 3CDWA 4IFVB 2DNOA 2NXNA 4NLWA 4F36A 2QX0A 3PRVA 2HRYA 2CJKA 5F0WA 5HMYA 1D9AA 5HQMA 1S0MA 3T6JA 1EETA 2JSXA 2JWNA 2KXHA 1JJ4A 4CNZA 3LAKA 3HFZB 1LV5A 3WHIA 5C42A 5MAOA 3AJ1A 2FVRA 2CWXA 1PJ7A 1PG5B 4OYZA 3J81Y 3N5BA 1KS2A 4EI2A 5CAAA 4TQRA 4YOEA 3DM2A 1IM6A 5CCMA 4DZDA 1PYTA 1H2UX 1BMQB 3DGPA 2KM8C 4P52A 2V4JB 1IN0A 1B7YB 2F8EX 2XNQA 3PHTA 1U2FA 5FD1A 2EI5A 2IFXA 2LXFA 3ZZZA 3I56S 4FF3A 3T19A 3HVAA 1RAGB 3P45B 3N6NA 1T9TA 2J0QD 4P75A 5HATA 4DL6A 5EN1A 3G6VA 1SL0A 1MG7A 3G96A 4TY8A 1S0VA 2MTLA 2BKNA 3UN5A 3JSMB 3RRGA 1VMBA 2MYFA 1WG4A 5LL6d 2AYMA 1CLFA 1KSPA 2BV3A 3K5OA 4KGVB 1CJVB 3K17A 4B9LA 5L1IA 3X1LB 2RSQA 1RWWB 2LDIA 3L7OA 3PFEA 4DJBA 2FC9A 4RBVA 1HHTP 2VUGA 1N48A 2B4PA 4CT8A 4KKOB 4DV0J 3HHNB 3DLKB 3I55S 3OPKA 3GFXA 1VQSA 1J5OA 4A8FA 4N56A 5KFQA 1VBZA 2NSCA 2Y8YA 4TVAB 1FVQA 1FTCA 2HGNA 2C2OB 4ANDA 4M5NA 1G4CA 4NLXA 2ZH1A 1HBUB 2IC3B 2CPIA 3HKWA 1WSRA 4B9NA 3IRWP 3LGNA 2UU9J 3TA2A 2HS3A 2JFKA 4RW4B 3RBDA 1HNWF 1I3OB 2KHCA 4AXIA 1FD2A 1NB2A 2KZZA 1FVSA 4HHHA 5EGYA 4NXNF 5AE1A 5D0GA 1PYSB 2R7QA 1PAEX 3RAMA 3HHDA 4J9KA 4ED6A 4NZ7A 2CG4A 5LMUF 1L3UA 3R2CJ 4KY3A 3PNIA 1I5OB 2G2ZA 3BEGB 1TKXB 3JQMA 4MIBA 3NOGA 3VR1A 4CNYA 4U6PA 4XPEA 3OV7A 2MLXA 3THVA 1Y5LB 4IFVA 4GVBB 2VQEJ 2AYEA 2LMIA 4RNOA 4CP5A 5HROB 2ZD1B 3RZAA 4NLVA 1NHKL 3SFUA 2Z2YB 1HI0P 4B3OA 4J9PA 2MJUA 4IOAQ 2FY8A 3HSZA 1UCNA 2GMHA 1W2BR 1LW2A 4ZCMA 1GMUA 2RRNA 4MK7A 2V2QA 2OO4A 4U96A 4U7UD 3AHPA 3TAMB 3CCJS 1UJ6A 1VRTA 3V4MA 1SJ4P 2XCPA 5AE3A 2B0GA 2PMWA 3T41A 1LKZA 1R8BA 1TVRB 1FKPA 1WDTA 3QT7A 4WXWA 2FJEB 5KFYA 3TR5A 4CM2A 5DDPC 3KHGA 1B3TA 4PUOA 4G6VB 1T0TV 2DBBA 1C4CA 2V8PA 4DL2A 2BQUA 5CYMA 2R2UA 2Q6CA 5L9NA 1EQMA 1GMWD 1KVJA 1HBMB 4PYAA 3CJKB 5L39A 3SDEB 4RBUA 4HDGA 3W5YA 4OZ1A 4MKBA 2HHHJ 4PQUB 3GZ7A 1Y10A 2QIFA 1ZOTA 5J2QA 1AFJA 3DLBA 1YRUA 2D9PA 1IBKF 2QSFA 1U8SA 4EZ9A 3DDIA 3KHHA 1RHKB 1FRKA 1JXVA 1UTAA 2FUG9 2CQ2A 4UQGA 2HNZB 4FPRA 5J2PB 3VAHA 1RYRA 5IT4A 2PI4A 1SIZA 1RI7A 2WW4A 4OHZA 1H98A 1TUGB 5HN0A 3WDOA 3NGDA 2QYGA 2JC1A 1S9EA 2OTJS 2FGCA 3RW6A 4F3OA 3CVKA 3MPYA 3VV2B 4K4XA 4I67A 3DYAA 1ZM3A 1S0OA 2D41A 2E5HA 2FZGB 3QLHB 4J5OA 4YDXA 5GAEI 2XMAA 4HYKA 3VAFA 2DEJA 3KWMA 5FLXY 4ZLLA 1S9FA 2KL8A 4IKAA 2FVSA 2FZCB 2BJ9A 4KPCA 3ELHA 2KG0A 2J6SA 2M8HA 3LO3A 3DRRB 1H0HB 5GADU 4J7CA 1CULA 4O44A 1F5AA 1K1SA 4LFAF 2XSFA 3UCZP 3HHEA 3SFGA 1XNRJ 1S4EA 1S79A 2HZCA 1NK8A 2DXDA 1M1KT 2R7SA 3KXDA 4RW4A 1ZBTA 4F4YA 2XZWA 1CJVA 2IRYA 1RWMB 2BABA 4J9VA 2AU0A 4NYPA 3BGUA 1Y4ZB 2HGLA 1Q8IA 3FBCA 1C0TA 1CC8A 1JIHA 1G7CB 2DISA 2CQ1A 1T8EA 2GS8A 2E5LJ 2GHPA 2DNGA 3GTYX 4PXEA 1XK8A 2OPSB 1FK9B 4ZHRB 4JI8F 4NCAA 2RHQB 5T7LA 3QPIA 3RYLA 4DR1F 3IGVA 4F2SA 2ZITA 3V81B 2XGQA 5I3UA 3OR2A 2ERRA 1CS4A 1X8DA 3QLHA 3U27A 4TU7A 3PRBA 2DNRA 4DUZJ 4DR3J 1RWUA 1KVKA 4QQBA 4LMZA 4OL8A 3AXMA 2E7WA 5CYJA 2ATLA 4OJ1A 4M5MA 1N34F 1Q0NA 2QLBB 2E1RA 3CW2C 2XLJA 4C8MA 1P27B 1JLAA 3H7HB 4CTAA 2ZKTA 4UZBA 3GIMA 1HWJA 2IBKA 4DV6J 1VQ7S 2ASJA 4A8OA 4NOHA 5IZHA 4ELVA 5EWEA 2YVSA 1ELOA 1JLEB 1N5SA 5B0GA 2WSCC 5HO4A 4HACB 4CO4A 1SH0A 2F3JA 1YI2S 2IBOA 2HHXA 4CLKA 2XTJP 3SDEA 1RTDA 2EEYA 2DHSA 4KR0B 5KFUA 3MOZA 1F0XA 3CCES 1XMQF 2FVCA 3EVMA 4ES1A 1TMMA 3BSOA 2IMOA 2RDDA 1UJ4A 3C14A 1X7VA 5L9XA 3WIUA 4LSNB 3TQEA 2XZTB 3OVBA 3PEHA 4TU8A 4LF6J 1BUXA 3MMBA 2BQ3A 4DCPB 1NSKL 4R0EA 4WFZA 4W98A 3W9HA 1RA7A 4WYLA 3J80U 1RP5A 3M1VB 4C0OC 1VHIA 5B0BA 1URRA 3H8YA 3LQVA 3ZXWA 2ZH5A 1T3OA 3DI6A 1NJZA 2CPFA 1IR2A 4FN5A 3W2VB 4XK8C 3W64A 2Z30B 3R7NB 5H9EK 5CYMB 5E3QA 5F3ZA 4WF9Q 1HNXF 2QV6A 4PUOB 2A3JA 3TVKA 2ZWPA 2W7OA 2DH7A 2UUTA 2G0CA 2GZOA 4YY3J 3G82B 4WTOB 3DRPA 4CT9A 1DTTB 1FXRA 5IM0B 4O0NA 4O23A 1DZ5A 4MAKA 3NGTA 2XMMA 5C24B 3H5SA 2P9GA 2V67A 4NPOA 1H2VZ 3AXKA 3RR8A 4OLOA 5JMNA 3KLHB 5GMDA 3H90A 4L3KA 5KFEA 3K58A 1OY6A 1ZZNA 3RAQA 5EDWA 4JI3F 4OZ5A 4DR1J 2L9WA 7FDRA 1U2CA 1HI8A 2PE8A 3E01A 3GE9A 3OFEA 1V5IB 3Q8RB 4WE1A 1HWLA 3LOUA 3C6UA 2RKIB 2M52A 2DKOB 2KHDA 1IKXB 3I32A 3K89A 4DS4A 2M70A 2Z8QA 1YTYA 3TANA 2WONA 1D3WA 2B3TB 2ALYB 2B56A 2V63A 2YKMA 4OZ3A 4Y28C 4F26A 5A6PA 3Q2SC 1VJWA 1OIAA 3M8ZA 3OFFA 4QOTA 5DO2A 2JLEA 4A8XA 1NDLA 5CZVA 3U1NA 3VAGA 1RT5B 3T1HJ 1U48A 5KFHA 4USHA 3FBBA 4I2QA 3HHLA 5DG7A 3HHLC 4CTAB 1KWMA 2AZ1A 1UW9A 1KDNA 3FEZA 4ED5A 2DEIA 4R8UA 1IWAA 1TL4A 3E2EA 5CD4A 1JJCB 4FVCA 3T3FA 1R8HA 5DQGA 1URNA 3VGUA 1IBLF 3UDVA 3CULA 4CM0A 1WI8A 3AT1B 3MR3A 4JUZA 1T94A 4WU2A 4O3SA 4RX6A 5KFBA 2ZHBA 3KJNB 2BE9B 2M88A 2Y1LB 3DXBA 3FGVA 4TYBA 1CQMA 2VPYB 3O2IA 1RHRB 4RZRA 2AD9A 1DTQA 3U1LA 4I1TA 4PWUA 3RUBL 1QTMA 2ZC4A 5F8LA 3PX6A 4NLQA 1Q16B 2V50A 3HLUA 3AB4B 2WONB 2J7UA 3MMAB 1BQMB 3S1TA 5E3PA 2E9RX 2ZZNA 4O4GB 1S1XB 1FX2A 2XWYA 4QIVA 3MTKA 4WCEQ 2OD4A 1R0CB 2OSRA 3CEDA 3MDFA 1XC9A 3MEGA 3HSGA 2CUYA 1HKAA 1V3SA 5E5NA 2F40A 3D2WA 4PWDA 5KFVA 3RBEA 1RA6A 2YKNA 2J7WA 1NJYA 2PA8D 3CJTA 1RT7B 2KVQE 4ICLA 4DL0C 3MWBA 4BC9A 3V6DB 2VG5B 3CDAA 3QRQA 2JEJA 5K20B 2XB2D 4PQUA 2HS4A 4NYOA 5EUHA 3M32A 5LM7E 2LU1A 2KT3A 5A8WA 1DTTA 2O5DA 2QZ8A 1RJJA 3QGGA 5KFOA 2ZVSA 4HTIA 3EUNA 3FK4A 3OHBA 4JI0J 3M8YA 1KHVA 1TL7B 2HFNA 1VIOA 1OYEA 1WKLA 3AA8A 1RTJA 2HFSA 3IR7B 4NEZA 4TKTA 1OYDA 2PSZA 2HNDB 1Y11A 1PBAA 4QZVB 2C2MB 3IO1A 3EGZA 2LFVA 2XSJA 4UOCA 4NMLA 2YWGA 4MK8A 3M9MB 3P5BP 3LA0A 4RW9B 1VYAA 3RBXA 5LT5A 2HHTA 3MM8B 1N32F 5LSOA 2KYXA 1QE1B 4FP9A 3M2UA 9ATCB 4ZVOB 2HVEA 2I5JA 2KRBA 2O1PA 1QE1A 1KLNA 2JHEA 1S5ZA 1T9XA 4K2JA 3WIVA 1BD6A 1TMJA 3I9V9 1LWCB 2OD6A 2BRLA 3GPAA 5DQHA 4DL4A 2E9ZA 1NSQA 1GQEA 3A4TA 2V4QA 5ETKA 4XTTA 5KFAA 1NDPA 4RU2A 3MURP 4K4SA 1VQYA 1LNQA 3QGPA 3MR7A 2UXBJ 4BWMA 2KXNB 2HFZA 1TV6B 2HZAA 3FZ2A 2H65B 4BWJA 5IT0A 5KFGA 4ZLNA 4N5SA 2CQCA 3GCWP 5KFLA 3UVJA 2C28A 3M32B 4X65F 2VJUA 4F4XA 2WSEC 1IR1A 2AJ0A 1IWGA 3DU6A 4FVMA 4P2FA 2F63A 1VRTB 2Z4PA 3MM5A 3SZ2A 2NZCA 5EHHA 2RE1A 3BH7B 1NMEB 2OPQB 2ATCB 3F44A 2VHGA 4V19X 4ITSA 1X5OA 3WZ0A 1RXOB 4F67A 2ZE2B 3HX9A 4DU8A 5IOLA 4ILLA 1DQ8A 1UFWA 2GIQA 1PCAA 6AT1B 4B3SF 3BF4A 2HIQA 2YKAA 3R2DJ 4ID8A 3ADAC 2FJDB 3FKBA 2I0XA 4TYAA 2V8DA 1YJNS 2A1BA 1U25A 5E3RA 3R97A 4U95A 5C2GA 2CNNB 3LGMA 1O5JA 3IA0A 3EGWB 1N36F 4N8NA 4F0MA 1N0UA 3O8WA 4OHXA 2I6WA 4OYIA 1DARA 3G87A 4DU7A 3ILJA 2ILZA 1IQTA 1Y0HA 2WK4A 2HFVA 3THPA 2DR5A 1WHWA 2ALZA 4FS2A 4NLPA 2AEMA 4ZCLA 2C2NA 3IWNC 1RCOB 1HW9A 5K14B 3JQKA 2VD3A 2MKKA 2HEKA 1F6TA 2Q1LA 1Q1KA 1S1XA 4KV8B 3I0RA 2YWHA 4CZCA 1FNMA 4KV8A 1L3TA 2EK6A 2H54B 1K73T 2QGFB 3OJSA 3D0GE 5A8KB 2J76E 3CNQP 3LPEA 5L1KA 5KG2A 5E0OA 4YHHJ 4JI3J 3DKDA 4Q2MA 1FK9A 3BGRB 2RH3A 4HVZA 4WK3A 3M2RA 2G1HA 3BSNA 3QJPA 1P8GA 4BLGA 3H5UA 2EC0A 1ZM4A 3I4PA 4DN0A 4R5PA 2OMOA 3M9OB 3CMES 4FS1A 2K1RA 5D4NA 3TVZA 3M4XA 1QSSA 5D77A 4NI2B 3NWRA 2MXYA 3CCQS 5HLFA 4DR4F 3DLGB 4C0BA 2QE5A 4NZ6A 4LFCJ 4DUZF 2HIYA 2J0WA 4J9QA 4GKKF 4ZVGA 2OJ3A 3O44A 4B3TJ 4HL9A 2ZE2A 4ED7A 3QNWB 4U9RA 2Y8WA 4K50A 3CD0A 4DX6A 2F4VF 3D0IE 1F2HA 4P9SA 1N6QB 1I6JA 1IKYA 1NH7A 4DF8A 1GEHA 2D3OR 5C24A 1V6HA 2YXLA 4JV5F 2KB2A 5K9FA 2ZKUA 2GHVC 1JLQA 2M4MA 1ZPWX 4DSLA 3HFKA 4JI6F 2VG6B 4WWSA 1UVIA 3BBCA 5KT3A 1KFDA 4GKKJ 3RB0A 1VQMS 1HMVA 2LA6A 3D28A 4KBIA 2YPZA 1O0PA 1OWXA 2R9LA 7AT1B 1CQNA 1N36J 2UU9F 2MY7A 3T6BA 1FRLA 5BYRA 5F8GA 3CJ8A 2FJWA 2FIUA 2Q3PA 1EKRA 5KAKA 4Y34A 3IWXA 2XMKA 3B82A 1U09A 2BKOA 1NKEA 4KYZA 3HULA 5DS7A 4RUAA 1SJQA 2E1PA 2W9AA 2GAGC 2IM0A 2OLWA 4YS2A 2QA4S 3RW7A 4J9OA 4JI7F 5KG5A 4X62F 2MQNA 4X84A 4CYUB 3EZ5A 2RT3A 4CLPA 3BKUA 3I0SB 4YB5A 4D3HA 4BC7A 4NE9C 4RW8A 3UN3A 3N01A 5ADZA 2W9BB 2PFDA 2GMLA 1YJTA 3K59A 1IQZA 3JAMY 1HR0J 4DL3A 3J81U 1SUQB 3GCXP 4YP3A 1U1LA 2EFVA 3EE3A 5A2QU 5F8HA 3NS7B 3KNGA 3PYGA 5KFJA 5DG9A 3KK3B 3MPWA 4DSIA 1Q7YT 1VOMA 1JJ2R 3LP0B 4PZVA 2LP4A 4ZITA 4ZMMA 1VQNS 1A9NB 1OQ6A 8RUCA 2H51B 5F8JA 3EVOA 3D1HA 2J9EA 2FJAB 2ZVIA 4RNHA 1VC6A 1IBCB 1VQ4S 4G1QA 1X0PA 3B6BA 1TKTB 1HQUB 5LXYA 2HQGA 3LP1B 4JOUA 3QJLA 4C98A 5H1SV 1YX2A 3H98A 3WBZA 1FDDA 2C3OA 4J9NA 2AGOA 2A0FB 1GMVA 1TKZB 1FA0A 1SKSA 1O51A 2OIHA 4FBUA 4DBQA 2A2DA 4OFZA 2FLOA 2Q66A 4PRFA 4AQYJ 2E1CA 3EM1A 4FBTA 4EZ6A 1X4CA 4ER8A 5F9NA 4M5DA 4QYZK 3R5DA 2YNFA 4JI1J 3G71S 3W61A 1T9WA 3PYFA 3J7ZT 2R7WA 2FPHX 1YITS 4Y2MA 2BDPA 4O3RA 3BM7A 5KFIA 1Q8BA 2GA7A 1V5VA 2BM0A 3IS9A 1D09B 2HLTA 4JYAJ 2B9EA 1S10A 3NRBA 3FQLA 4TY8B 2F65A 1NXIA 4KRWA 3HHLB 5F8MA 3JXOA 3HVWA 3AFGA 3MZIA 2ZH3A 4K4TA 2JEGA 1X31C 3ZNUA 2O01C 4NLRA 1G2EA 1EP4B 3K5NA 1VC5A 3PM9A 4USVA 1JK9B 2LU2A 1OSCA 1RTZA 1VCTA 5HVFA 3DHWC 5CCLA 3OFHA 4ED2A 3PW2A 3OBIA 2FGOA 5DGAA 5GAGU 2OELA 2GJIA 2YWEA 3CJ5A 3ULHA 1YLXA 4CO5A 2N3OA 4EBCA 4A8KA 4NA2A 1C1BB 1C0UA 3FCVA 3TW0A 1U4BA 1M5KC 1FKOB 3ZZPA 3QT8A 1LK5A 1CULB 4O44B 4O3OA 3T9NA 5K5MA 3CMQA 4USMA 3PX0A 5ITHA 4ZKAA 2VQFF 1L3SA 3M6VA 1VK8A 4Y2AA 1D8YA 5H9EJ 2P9CA 1SQGA 5HJYA 5HVHA 2R2TA 1VK3A 2VF3A 3TUZC 2E7VA 1S7IA 5G0RB 1Q86T 4GO7X 3OTDA 1XNQF 4CLUA 4ZJOA 4K4YA 1YJUA 3QSYB 2KFZA 3SEOA 3L7UA 1WEYA 3PW0A 2NQPA 4WK1A 4F3QA 1X4HA 2YKOA 3MEDA 3VAMA 2DNMA 1T03A 2R2RA 5J2NA 4IFYA 4C2MA 3NNCA 4X4UA 3D66A 5IT9U 4RUCA 2F1FA 1RT2B 3WQPA 2ZJPQ 4NMXA 5JVHQ 1AFIA 3P8BB 2W4CA 2I38A 2E5GA 2JRSA 2DR6A 2IJRA 2L3MA 1SQFA 4HI1A 2QMWA 3HT0A 4NXNJ 4FF4A 3GJQB 1AROP 4K4VA 1NDKA 1SJ1A 2X3GA 2KU7A 3DRXA 3G86A 5KT7A 5HBMA 3CC2S 1U1NA 1GXLA 1MMNA 2VB6A 2ZBIA 2V9KA 3ZZ0A 3NCRA 2COLA 1S7HA 4PCQA 4HT5A 1K44A 1WELA 2C3PA 2CNOB 3GYNA 4RW6A 4RW7A 4CLTA 5KFCA 1WWHA 2FHOB 2GC8A 4Z2XA 1GX6A 4ECXA 2J6TA 4IRDA 1FJGJ 5B08A 4PABA 1X5TA 3W63A 4G65A 3HFVA 5DQIA 4TQSA 2CQHA 2ROPA 5IWAJ 1RTHA 2Z2ZA 4ED8A 4ECSA 2ASLA 2DRBA 2HHPA 3AJ2A 1HNIB 3CCVS 4ILRA 3CCLS 2LECA 4KGZB 2XY5A 2P9EA 2YWFA 1W7WA 1S72S 3K8VA 2BRKA 1UEKA 3A1YG 2V4RA 1JLCB 1YBUA 4ETZA 4F7VA 3TUIC 4WP3A 3BSAA 2E7XA 3R5JB 3RGIA 3CCTA 4RR5A 4C7QA 2QN6B 4DPOA 2VDHA 5C25B 4ZVSB 2J5AA 3N0VA 1FDBA 2RD5C 3ETMA 2L9DA 3LTOA 2PMZD 4CIOA 3FSIA 1RTDB 2CVEA 5FIIA 1MSWD 5HQ8A 2YX7A 3MR5A 5GAHI 2FHKA 4YB1P 4DPWA 3PJWA 2UUAF 3KUGA 4Q44A 4C6AA 4ZJQA 2I1RA 2L9NA 3Q8VA 3TA1A 1MWYA 1GT8A 4UZCA 2C22A 5J1NA 2QC3A 1RT6B 2AGQA 2F9DA 1IJFB 3K5MA 4E0DA 4P73A 4F4KA 2QA2A
chains in the Genus database with same CATH topology
3B54A 1F6TA 2DXDA 3ZTPA 1LEOA 3G2XA 4EK2A 3VGUA 2AZ3A 5C7PA 1NPKA 3EICA 1ZS6A 3FBCA 2DXFA 1HIYA 1S57A 2B8QA 3DKDA 1NUEA 3NGUA 3Q89A 5BXIA 1NLKL 3VVUA 3WX8A 4ANDA 3VGSA 4UOFA 2DY9A 4FKXA 3FBFA 3FCVA 1NB2A 4WBFA 3BBFA 2BX6A 3MPDA 1NCLA 3GP9A 1PAEX 1S59A 4ANCA 1B99A 3ZTSA 4S0MA 3PJ9A 3Q8YA 3NGSA 3VVTA 4CP5A 3EVMA 1WKLA 1NHKL 3BBCA 4FKYA 4UOHA 3L7UA 4F4AA 3Q86A 1WKKA 1MN7A 2VU5A 3EVWA 1UCNA 3EMTA 4DZ6A 1BUXA 1NSKL 1VYAA 4W98A 4HR2A 3ZTOA 1XQIA 2HVEA 1S5ZA 1WKJA 1HHQA 4DUTA 3GPAA 1LWXA 1EHWA 1NDKA 3FCWA 1NSQA 2HURA 2B8PA 1NDPA 3Q8UA 1K44A 3BH6B 2DXEA 4O0NA 1B4SA 3EE3A 3NGTA 2DYAA 4F36A 3PRVA 1U8WA 1BE4A 2NCKL 3EJMA 1HLWA 3DDIA 4ANEA 2CWKA 3BH7B 3R9LA 1JXVA 1MN9A 2HVDA 1W7WA 3EVOA 1PKUA 2ZUAA 3VGVA 5IOLA 3ZTRA 3BBBA 5CAAA 1NSPA 3B6BA 1XIQA 3FKBA 3VGTA 4UOGA 3ETMA 1BHNA 3ZTQA 1F3FA 3NGRA 4ENOA 2BEFA 1NDCA 4KPCA 3ELHA 1NDLA 3JS9A 3Q83A 5CABA 4C6AA 3FBEA 3FBBA 3Q8VA 3FC9A 4DI6A 3EM1A 2AZ1A 1KDNA 3ENAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B54 A;  1F6T A;  2DXD A;  3ZTP A;  1LEO A;  3G2X A;  4EK2 A;  3VGU A;  2AZ3 A;  5C7P A;  1NPK A;  3EIC A;  1ZS6 A;  3FBC A;  2DXF A;  1HIY A;  1S57 A;  2B8Q A;  3DKD A;  1NUE A;  3NGU A;  3Q89 A;  5BXI A;  1NLK L;  3VVU A;  3WX8 A;  4AND A;  3VGS A;  4UOF A;  2DY9 A;  4FKX A;  3FBF A;  3FCV A;  1NB2 A;  4WBF A;  3BBF A;  2BX6 A;  3MPD A;  1NCL A;  3GP9 A;  1PAE X;  1S59 A;  4ANC A;  1B99 A;  3ZTS A;  4S0M A;  3PJ9 A;  3Q8Y A;  3NGS A;  3VVT A;  4CP5 A;  3EVM A;  1WKL A;  1NHK L;  3BBC A;  4FKY A;  4UOH A;  3L7U A;  4F4A A;  3Q86 A;  1WKK A;  1MN7 A;  2VU5 A;  3EVW A;  1UCN A;  3EMT A;  4DZ6 A;  1BUX A;  1NSK L;  1VYA A;  4W98 A;  4HR2 A;  3ZTO A;  1XQI A;  2HVE A;  1S5Z A;  1WKJ A;  1HHQ A;  4DUT A;  3GPA A;  1LWX A;  1EHW A;  1NDK A;  3FCW A;  1NSQ A;  2HUR A;  2B8P A;  1NDP A;  3Q8U A;  1K44 A;  3BH6 B;  2DXE A;  4O0N A;  1B4S A;  3EE3 A;  3NGT A;  2DYA A;  4F36 A;  3PRV A;  1U8W A;  1BE4 A;  2NCK L;  3EJM A;  1HLW A;  3DDI A;  4ANE A;  2CWK A;  3BH7 B;  3R9L A;  1JXV A;  1MN9 A;  2HVD A;  1W7W A;  3EVO A;  1PKU A;  2ZUA A;  3VGV A;  5IOL A;  3ZTR A;  3BBB A;  5CAA A;  1NSP A;  3B6B A;  1XIQ A;  3FKB A;  3VGT A;  4UOG A;  3ETM A;  1BHN A;  3ZTQ A;  1F3F A;  3NGR A;  4ENO A;  2BEF A;  1NDC A;  4KPC A;  3ELH A;  1NDL A;  3JS9 A;  3Q83 A;  5CAB A;  4C6A A;  3FBE A;  3FBB A;  3Q8V A;  3FC9 A;  4DI6 A;  3EM1 A;  2AZ1 A;  1KDN A;  3ENA A; 
#chains in the Genus database with same CATH topology
 1HFE L;  2G0J A;  3CCZ A;  3FVY A;  3KDN A;  2GHW A;  2VG7 A;  1UVL A;  1JLF B;  1LXJ A;  2DGT A;  2EPI A;  3G2X A;  4O3N A;  4LQ3 A;  1Q7L B;  1W25 A;  4I7F B;  2F7V A;  3UDL A;  3GR1 A;  2KH9 A;  4PG6 A;  4B3M J;  4PR6 A;  2WCX A;  3BRE A;  2DXF A;  4IQM A;  4AFF A;  2OFH X;  2A18 A;  3NGU A;  3PDN A;  1XWL A;  1U1R A;  1RT3 A;  4P6Q A;  1Q79 A;  3MEE A;  4IRC A;  4LF4 J;  2UXC J;  2DNK A;  1S1V B;  3OTO F;  4A8Q A;  3G8T A;  4X65 J;  1MRO A;  3PYD A;  3BN7 A;  5GAH U;  2F8H A;  3CDE A;  1KP6 A;  2HS0 A;  2ZOG A;  1T7P A;  3AA9 A;  2C42 A;  2UXB F;  4JP8 A;  4FXD A;  1T9U A;  1F5C A;  2WBM A;  3W60 A;  1KQG B;  3Q0A A;  1K1Q A;  4E98 A;  5EWG A;  2CQD A;  3ILI A;  4OQJ A;  5D0H A;  4NLO A;  2W24 A;  1J2V A;  2VON A;  1RAA B;  1NJI T;  1B0P A;  1M0S A;  1RB0 A;  1NH8 A;  3GYX B;  4IG0 A;  4DHV A;  5J1E B;  1KBR A;  4LIR A;  2HMI A;  4Y2C A;  3BV8 A;  1M5O C;  2I8E A;  2N4C A;  3MI7 X;  4KIA A;  4WPA A;  1YKW A;  4EFA C;  2KTQ A;  4YB7 A;  4JI1 F;  1Q95 G;  4A8S A;  3D7S B;  3NAI A;  3IM9 A;  2IA6 A;  4DV7 F;  1SH2 A;  3DLE A;  2IAJ A;  2CNK B;  1U7L A;  3GLJ A;  4DQS A;  1NND A;  2WB1 D;  5M2R A;  3AJD A;  3FSY A;  2O67 A;  3C8Y A;  4GMK A;  4WE1 B;  3W7B A;  1YDL A;  4X4S A;  4AYB D;  3O3L A;  3HI9 A;  3NBP B;  1NPP A;  1C1C A;  4K4W A;  2RAQ A;  3CTR A;  1DY3 A;  2KJW A;  2RU9 A;  2V2V A;  5GME A;  1TQL A;  2YNI B;  4J9S A;  1D1U A;  2MY8 A;  4OHW A;  1NKB A;  3BDE A;  1EB0 A;  1MW7 A;  1RE1 B;  4ZOS A;  2BZ2 A;  2HWI A;  1WOP A;  4YN3 B;  1AA1 B;  1RUS A;  1WDD A;  3NS6 A;  1PJ5 A;  4MIW A;  4WXO A;  5L1L A;  2QLW A;  2W01 A;  4H4K C;  2XSJ B;  3AD8 C;  3QAU A;  3R6L B;  4MJK A;  4YB6 A;  3ZZR A;  2FY1 A;  4GC7 A;  5ETQ A;  5D8H B;  5D15 A;  2YH1 A;  2BBE A;  2W2M P;  2UVV A;  1NEE A;  4QYZ J;  1R6V A;  1D9F A;  1F9E B;  1VR6 A;  1I1G A;  2XS7 A;  5IQQ A;  4U7U K;  3TJ9 A;  5LMN F;  4DV7 J;  1X4F A;  5G0R A;  2HHS A;  3P5T L;  2LQJ A;  5A8W B;  1X4D A;  2DHA A;  2HQI A;  3HVT A;  2KG1 A;  3ENV A;  3OD2 A;  4L74 A;  4XAK A;  1HPZ B;  4QWC A;  4P7T A;  2NYI A;  2AWZ A;  4ZP7 A;  2YKN B;  4IH6 A;  5KFZ A;  4WKY A;  2HW3 A;  2VIC A;  4LBI A;  1VRU A;  1IBK J;  4ZPT R;  4M94 A;  4WU3 A;  3ZTR A;  3VQT A;  3OL6 A;  2CFX A;  3MM6 A;  4RUH A;  1EJ7 L;  3ET6 B;  1AZS A;  1NK7 A;  3TX8 A;  3M7V A;  3H4D A;  5DM6 Q;  3KLF A;  4N77 A;  4LRB A;  2XNR A;  1PAU B;  4OIX A;  1JB0 C;  1U02 A;  4O4G A;  1TL7 A;  2PC6 A;  1R8P A;  3SSS A;  3VGT A;  1BQM A;  3ISZ A;  2Y1J A;  5KFR A;  5JUM A;  3MFH A;  2OPP A;  4ENO A;  1WF0 A;  3W1Y C;  3GMG A;  1KTV A;  3DMJ B;  1R0A B;  2JZ5 A;  3JSR A;  2K2P A;  1KTQ A;  4KAI A;  4LR9 A;  4NLT A;  2GVD B;  1RAC B;  4UY8 T;  1A6L A;  3JS9 A;  4DR7 J;  1IVZ A;  3OLA A;  5AXL A;  3FBE A;  3AB2 B;  2N82 B;  2R8H A;  3TJA A;  2B51 A;  1KRP A;  2YNG B;  4JI4 J;  3M8P A;  3PAC A;  4OHY A;  1Y3J A;  3SQG A;  5E3C A;  2GO9 A;  3FQK A;  3VAL A;  1R3N A;  1RHM B;  1ZA1 B;  2KKH A;  2V34 A;  3DRS B;  3IR5 B;  5AE2 A;  4C8Y A;  1CJT B;  2ACY A;  3W62 A;  4B3R J;  1UMJ A;  2GW8 A;  1CG2 A;  1RAJ A;  1SKR A;  3GIK A;  4IDK A;  4RPF A;  2AQ4 A;  1NPK A;  1S99 A;  1VI7 A;  4QCL A;  1SBR A;  4O4R A;  1VFJ A;  1EZZ B;  3GSI A;  4H4K A;  4USI A;  2LCW A;  4FF1 A;  3MEE B;  1CJK A;  3R5B A;  4CH1 A;  4LFC F;  2MZQ A;  3T5L A;  4DR4 J;  3BS9 A;  5FDL B;  1NLK L;  4K5S A;  4TY9 A;  2CIM A;  3DLK A;  3R3T A;  1FCA A;  2GQC A;  3OL8 A;  3G8S A;  3G6X A;  4QJV A;  4F4W A;  2JEF A;  1UPP A;  3I6P A;  1KNZ A;  1RGV A;  3IXQ A;  2GX8 A;  4C9D A;  2CQB A;  2DY9 A;  3MPU B;  4I7F A;  2VC0 A;  4LR8 A;  1FWK A;  1TP7 A;  3BDP A;  3HD1 A;  1ZYQ A;  1WI6 A;  4DSJ A;  2X3D A;  1RT1 B;  5ETM A;  1KQF B;  2E1A A;  3KJV B;  3ITH A;  4NLG A;  5E3A A;  3KMS A;  3GIL A;  2CZ4 A;  3M6X A;  1IM4 A;  3IP0 A;  2DCL A;  4I2Q B;  4KJI A;  2IY5 B;  1F60 B;  2OSQ A;  3MMC A;  1UZD A;  4RL1 A;  2GFF A;  3CDU A;  4NLS A;  2EWH A;  1Y5I B;  2DGX A;  2UUA J;  2MLZ A;  2IRX A;  2YWK A;  3NOC A;  4TNO A;  1I94 J;  1YBA A;  4H54 A;  4LRE A;  2DPI A;  1WOR A;  4CCH A;  3Q8Y A;  1RWV B;  3SSR A;  5GAE U;  2HBZ B;  1S76 D;  2XHW A;  4C11 B;  1VQO S;  5DLG A;  2BUN A;  2DTJ A;  4OYA A;  2DNY A;  3C6U B;  3QZ7 A;  4OI1 A;  4DFK A;  3BPD A;  3IN5 A;  1MLA A;  2QA4 G;  2Z57 B;  4CYU A;  2RRA A;  2MZT A;  2X1A A;  2IMW P;  4X4Q A;  3AQP A;  1UWB B;  1VRU B;  2VOO A;  5BR8 J;  5AJ3 J;  2VBX A;  1KOO A;  1QAY A;  1GTE A;  1R6Y A;  4QIW D;  2V0N A;  2VPW B;  2OGU A;  5A0Y A;  3MM9 A;  4QR0 A;  4DV6 F;  4YME A;  2HNY B;  3BKF A;  2HFU A;  1HYS A;  2J9C A;  1LWX A;  3CD5 A;  3D0H E;  3CJK A;  2JOQ A;  4DPY A;  2R8I A;  1TV6 A;  4BBY A;  1Q78 A;  2M0G B;  4JI4 F;  1AUS L;  2R8K A;  1N34 J;  2VOD A;  1SXL A;  2DNL A;  3GR0 A;  2KFY A;  4IOC Q;  2LEA A;  3PVX A;  1J5E J;  3HHL D;  4CO3 A;  2LXI A;  2Q79 A;  4ECU A;  1N5Y A;  2AHO B;  2NUH A;  4B9T A;  3HM9 A;  2AIR B;  2UUB J;  3OTB A;  1MML A;  4RWW A;  3IGN A;  4OHV A;  4CO1 A;  1HWI A;  2E5I A;  5DDQ C;  1M90 T;  5AXN A;  3HD2 A;  2PA3 A;  1O6X A;  1E6Y B;  3BGF A;  4X64 F;  1QAI A;  3UO0 A;  2W25 A;  3UWT A;  2UXD F;  1N0V C;  3EJM A;  3L9Z A;  4HH0 A;  2JH3 A;  3CJQ A;  2XS2 A;  3PG9 A;  2P8I A;  1WC5 A;  4XPC A;  1JNZ B;  3BR8 A;  4Q7A A;  4QR2 A;  5HMZ A;  1RZM A;  2W7A A;  2ZBQ A;  1PKU A;  1DBD A;  2BYC A;  1QDU B;  1Y9O A;  2F8M A;  1R7I A;  4LSN A;  4LF8 J;  3D67 A;  4OYW A;  3JAM U;  2VIH A;  4LF9 J;  3HJV A;  1WHY A;  4DR7 F;  4LIW A;  1FER A;  4DPT A;  1H7X A;  2IAJ B;  2XHC A;  1QVF R;  4EWT A;  1P9Q C;  4RO0 A;  2XM3 A;  5KOX A;  3L09 A;  4CLW A;  3IG1 A;  3AOB A;  4LFB J;  1T3N A;  4L6V 3;  3MCO A;  4ZHR A;  5FDL A;  2CPZ A;  3CT9 A;  3CC7 S;  8AT1 B;  2JLG A;  3PFO A;  3B78 A;  2J8A A;  3IAM 9;  1QJH A;  2DJW A;  1QD1 A;  4M5K A;  3JYT A;  2BM1 A;  4EO8 A;  5RUB A;  4JYA F;  3F56 A;  2W4D A;  1EX8 A;  2LQB A;  3H2U B;  4B9M A;  4JI5 F;  2DNN A;  2ZEJ A;  1Q8L A;  2OEM A;  4IDK B;  1FWL A;  1N5Q A;  2VFU A;  4NXM J;  3K2Y A;  2FVP A;  4V19 J;  2HG4 A;  3RU0 A;  2XY7 A;  1FRX A;  1T02 A;  2AZ3 A;  3UNG C;  4PXB A;  5C7P A;  5I42 B;  3CMA S;  3C6T B;  3EIC A;  1T05 B;  2FLP A;  3V81 A;  3K7R A;  3OLB A;  2UVR A;  3T1A A;  2NXJ A;  3KUH A;  2C1E B;  1JLG B;  2DH8 A;  2YTC A;  2B6A A;  2DGU A;  4J9U E;  1NK9 A;  3NCP A;  1S9G B;  5CD4 H;  3DCA A;  3TJ8 A;  1P1T A;  2OKQ A;  4NX9 A;  4OYO A;  4DL7 A;  2AYG A;  1KN6 A;  1D8Z A;  2WVE A;  1U6B A;  2XMV A;  1U26 A;  2YKM B;  2CYY A;  4WZQ A;  4LRC A;  2CVI A;  2D74 B;  4WP8 A;  3IS9 B;  1JXL A;  3OL9 A;  2KDO A;  3FJ2 A;  2BJE A;  2FHM A;  4ERD A;  1BWE A;  1UFK A;  2DD8 S;  3TUJ C;  5EWF A;  4K59 A;  4PPZ A;  1ICE B;  3GON A;  1WJ9 A;  1RT4 B;  2CPE A;  3FBF A;  4LBP A;  4LSL B;  1AZS B;  4Y2K A;  2Z58 B;  4QPX A;  2YX1 A;  5L46 A;  2QG9 B;  5JJB A;  2UV8 A;  1N88 A;  3MCN A;  4KGX B;  4O0I A;  3K8W A;  1HI1 A;  4LVO P;  3TX0 A;  1EET B;  1FTR A;  1IBL J;  2XBP A;  1WD6 A;  1S59 A;  2BJ7 A;  1WEX A;  2CAD A;  1B0T A;  2E1M C;  2GNK A;  4FXV A;  1RAE B;  3R7S B;  1QUP A;  1H72 C;  4S0M A;  4TN2 A;  4ZCI A;  3MEK A;  4EGL A;  4MH8 A;  3KK3 A;  1U1O A;  3HVT B;  5HAN A;  3TI0 A;  3PJ9 A;  3KMQ A;  3J81 j;  1W26 A;  1TUV A;  2CQP A;  1D0E A;  2IA0 A;  1WUU A;  2ZC3 A;  2RKI A;  1TL3 B;  3DGV A;  5KFX A;  2OUG A;  5K8M A;  5LSR A;  3CCS S;  3MF5 A;  5DG8 A;  3A13 A;  5K8O A;  1NJX A;  2BJ3 A;  1LK7 A;  2HQF A;  2XYH B;  4WFX A;  4LF9 F;  1CSJ A;  4RNN A;  2ROG A;  2OI2 A;  1MU2 B;  4LF8 F;  3D4J A;  3H59 A;  2XEX A;  3W9I A;  2P2C B;  4DZ6 A;  4Y0F A;  1IKV A;  3T5K A;  3J7A 1;  1ZPV A;  3GU0 A;  3GJS B;  2ASY A;  3AY0 A;  3MM9 B;  2RQM A;  4OX7 A;  2R8G A;  3D5M A;  3LW5 C;  3J7Z 5;  2J7K A;  1VQ8 S;  2B7B B;  2RML A;  1SPB P;  2WZ1 A;  2YKQ A;  3CE8 A;  3C15 A;  3BO2 A;  3IBW A;  4YR0 A;  1LW2 B;  4C3M A;  1XMO J;  3MMB B;  3DRP B;  1TUW A;  3K0J A;  1TL1 B;  3GQC A;  1AW0 A;  1Q5V A;  3FCW A;  3LAN A;  4RW6 B;  1V3Z A;  1CVJ A;  3I96 A;  2G2O A;  4Y65 A;  3CJ4 A;  1FWP A;  4L75 A;  2E44 A;  4USW A;  3S01 A;  1YWX A;  4A48 A;  2WTF A;  1YIJ S;  2AJQ A;  4HT7 A;  3H5Y A;  2HWT A;  1VHF A;  3PY8 A;  2HKE A;  3TZZ A;  2VBY A;  1L3V A;  3OTC A;  1S6U A;  1GXU A;  5CH7 B;  2EKN A;  4KH1 B;  2KM8 B;  1S6P A;  4ID5 A;  5KG7 A;  3R27 A;  2K7J A;  3R5G A;  4OYP A;  2EBE A;  5I3P A;  2W2O P;  1YSJ A;  2RHS B;  4ANE A;  2ZZT A;  2ACM A;  3A3N B;  3MM7 A;  4A46 A;  5BR8 F;  5AJ3 F;  2K06 A;  2H48 B;  1R8A A;  1UA0 A;  1HMV B;  3BBB A;  2XQC A;  2YWW A;  2YH0 A;  1U2R A;  3NLC A;  3NWG A;  2MQL A;  3OR1 A;  3S6E A;  3TAQ A;  4FXW A;  4RNM A;  2VG6 A;  1FE0 A;  3O6Q A;  5ETP A;  2LLZ A;  3HKZ D;  4UOG A;  1Z2Z A;  4NI2 A;  4DV3 F;  5HLF B;  4Y6I A;  1P6T A;  5CZX A;  1WC0 A;  1WSV A;  3CO0 P;  4UST A;  4DV2 J;  4C4W A;  4DSF A;  1LWF A;  1JLB B;  1HBN B;  1TKX A;  5G4D A;  2R2S A;  1GH8 A;  4RWX A;  3NS5 A;  4ZVE A;  4F3M A;  3RRK A;  3OSN A;  1EAR A;  1K0V A;  4DOZ A;  1RAF B;  1RTI B;  2AEF A;  2MSS A;  3FC9 A;  4OI4 A;  4ZN3 A;  4ED1 A;  3UD4 P;  1TK8 A;  1S6Q A;  2DRA A;  2FJB B;  1IBM F;  1ZM9 A;  5A8K A;  3WX4 A;  4DFM A;  4M5J A;  1NB7 A;  3ZTP A;  1LEO A;  2NXE A;  1RHQ B;  3SV4 A;  4EK2 A;  1HNV B;  4WP9 A;  4LF2 A;  1GFW B;  1Z2L A;  2QMU B;  3CJ2 A;  4CLY A;  4PG4 A;  2B8Q A;  1X4A A;  1X9S A;  3BQ2 A;  3M8P B;  1BC6 A;  1S9G A;  2QO3 A;  4DV3 J;  3UCG A;  3KYL A;  1JX4 A;  4B9V A;  1REV B;  3D6T B;  4KE5 A;  4IO1 A;  4OI0 A;  2F4V J;  1FXD A;  2G4B A;  5KFP A;  2KFN A;  2ILY A;  2AJF E;  4RBT A;  4Z37 A;  3SI8 A;  2RU3 A;  4KKO A;  1C0T B;  5LJ5 Y;  3GV5 B;  2DGV A;  4YHH F;  2EKY A;  4TLQ A;  3DOL A;  4ZP6 A;  4YEA A;  1Y3K A;  2OFG X;  5B0E A;  1HBO B;  1SC6 A;  1WC4 A;  1UVN A;  3TUP A;  4BCA A;  2UUC J;  1RAO A;  3UD5 A;  2DPJ A;  1OPI A;  4CWB A;  1DJ0 A;  3CJR A;  2DO0 A;  4M63 A;  5H9F J;  1HQU A;  1RAD B;  3ISN D;  3M9N B;  3AOD A;  1EIY B;  4ZS6 A;  3HVR A;  2E5L F;  2KZM A;  3O1L A;  3MM6 B;  1CPZ A;  4FYX B;  1WNE A;  3MPD A;  1S6Q B;  4UUW A;  1S12 A;  1FEE A;  2MQM A;  2AP6 A;  2ZHA A;  5D78 A;  1VQK S;  3HHK A;  2LA4 A;  2PEH A;  4H4M A;  2FDN A;  1RTH B;  5HMX A;  4N47 A;  3ZTS A;  4WFN Q;  3M8S A;  2MQQ A;  1R8C A;  4ZN1 A;  2ASD A;  1XMQ J;  3DDN A;  2WOM A;  4AXJ A;  4KO0 A;  5LMN J;  4JB8 B;  1HBM A;  5U47 A;  3VVT A;  1WF2 A;  2XZD B;  1WOS A;  5JVG Q;  1S49 A;  1FO1 A;  3I0S A;  4G1Q B;  2MHN A;  2HGM A;  1NHU A;  3DOM B;  1XER A;  3ISN C;  2LYV A;  2FC8 A;  3B4M A;  3M30 A;  1Y00 A;  2AT1 B;  3MM7 B;  1REG X;  3D9B A;  4KC5 A;  2QYC A;  3R8Y A;  4U67 Q;  4QWE A;  2BOA A;  2DNQ A;  2VAS A;  2BKP A;  3RB3 A;  1UKU A;  2XYG B;  4ID5 B;  4OZN A;  5ETR A;  2IYI A;  2AV5 A;  3MM5 B;  1RWX B;  2XUL A;  3UI3 A;  4DXL A;  2W9C A;  2NUU G;  4ECY A;  1N32 J;  4NCG B;  3PKM A;  2HBR B;  1TZ0 A;  4E2F B;  1HHQ A;  4CO0 A;  4DR5 F;  4KHP F;  1U1Q A;  2O66 A;  4V1A k;  4NYZ A;  4NA1 A;  4YDD B;  4UY8 5;  2OPR B;  3F0N A;  3EGN A;  3I5C A;  1N5Y B;  2NR0 A;  2JC0 A;  3NBP A;  2CPY A;  2MGZ B;  1CEZ A;  3DLH A;  4NWB A;  2BE7 D;  2JFD A;  1KQK A;  2V2K A;  2CZ9 A;  2ZD1 A;  3RG6 A;  4ZIV A;  2CJ9 A;  4OYX A;  3D54 A;  1FKP B;  4GVB A;  4OZ2 A;  5CYQ B;  3SCL E;  5M2U A;  1UA1 A;  1UEU A;  3CCR S;  2WOM B;  2GMJ A;  1AXQ A;  1FRM A;  2HPU A;  3FNN A;  3G6E S;  1S1T A;  1M5P C;  1SKW A;  1TTH B;  2FHJ A;  5A0Y B;  1BE4 A;  3OUY A;  3KK2 B;  1N52 B;  3PHE A;  5CA5 A;  4F2R A;  2BMB A;  5J1E A;  4IH7 A;  4DF4 A;  2B9Y A;  3OXF A;  3HZG A;  3I82 A;  2HVD A;  3FDS A;  2UUC F;  5ETL A;  1K0T A;  4ED4 A;  2QEX S;  5C5J A;  1XTZ A;  2MKY A;  2ABY A;  3J7A N;  5HK4 A;  1HAR A;  2BXJ A;  2R42 A;  4C48 A;  4K4U A;  1X5S A;  4X64 J;  2AJ2 A;  3M6W A;  4EO6 A;  3J7Y I;  4MK9 A;  3ZTQ A;  3DOL B;  3T1Y F;  5KTQ A;  2RRB A;  2DRD A;  2MKJ A;  2YQ3 A;  3TEG A;  3OTO J;  2BEF A;  1LOU A;  2ZUG A;  3AOA A;  4K7Q A;  2DR8 A;  1NDC A;  2JDJ A;  1ZET A;  3QO9 A;  4DQQ A;  2J0S D;  4ZPV R;  3PO5 A;  4NXM F;  4C97 A;  1OS5 A;  3M2R B;  2B43 A;  2BAN A;  4X62 J;  2VFR A;  2CZV C;  3EWG A;  3LPY A;  1CJK B;  3R5A A;  4DV5 J;  2Z0G A;  4DLE A;  4LR7 A;  1RBL A;  1TAQ A;  2YNH B;  3TZW A;  1WAC A;  1HW8 A;  4FYW B;  1TFY A;  2EFO A;  3A3P B;  2LXU A;  3OFG A;  1KEK A;  1HNV A;  3BN4 A;  1ZAV A;  3LH2 S;  2H4W B;  1U6F A;  3C46 A;  2FQQ B;  4LJM A;  3B8H A;  3ENQ A;  3JSY A;  1RT6 A;  1S1V A;  1HHS A;  1NK6 A;  4DQP A;  3N6L A;  1RWK B;  2OPS A;  3JQJ A;  4NA3 A;  2DNZ A;  3SCK E;  5IV3 A;  4RU9 A;  1U1M A;  4LF4 F;  4W92 B;  3OQ2 A;  3Q89 A;  6FD1 A;  1HNW J;  2PGC A;  2CRL A;  2LVW A;  4ELU A;  3AD7 C;  3QQC D;  3VVU A;  2U1A A;  2R3V A;  3CIZ A;  2IJF A;  3EPI A;  5IC6 B;  1FKA F;  3HZE A;  1KHW A;  3BYR A;  3IC1 A;  3T5J A;  2UXD J;  1KOH A;  2NRE A;  1VBK A;  2O3D A;  2MDA A;  3CCW A;  3DM2 B;  4I2P B;  4P2S A;  2KN4 A;  2XMT A;  4CH0 S;  2M2B A;  3KLF B;  2HHU A;  2V94 A;  2QA1 A;  4ZIW A;  2V8G A;  4P72 A;  1EAY C;  1RSC A;  5CQG A;  3H42 A;  2IRU A;  5GAD I;  4CLL A;  3BGO P;  4A47 A;  3DHX A;  4MMO A;  3W2W B;  1WHX A;  3MAQ A;  2VPZ B;  3P96 A;  3D68 A;  5D4L A;  3LP0 A;  5B0C A;  4AL5 A;  2B4U A;  2DIV A;  4ZCK A;  1B99 A;  4ES2 A;  1AYE A;  1JLB A;  1HBN A;  3GV8 B;  2V8H A;  4RJV A;  4U8Y A;  2VQE F;  1PBU A;  3KKF A;  2ZH8 A;  1IR0 A;  1JXE A;  4YY3 F;  2EG1 A;  4JV5 J;  2KT2 A;  2C3Y A;  2HWH A;  3NGS A;  2H5J B;  1FX4 A;  4H4O B;  3D3B J;  4FKY A;  4PG8 A;  1S6O A;  1APS A;  3ET6 A;  1F9H A;  1LXN A;  4CH7 A;  4DX5 A;  3Q86 A;  3GII A;  4FYV B;  1I51 B;  2CQG A;  3EVW A;  1JKH B;  4F02 A;  1Z4U A;  1IBM J;  4P10 A;  3KG0 A;  2XGP A;  5E33 A;  4PG7 A;  3N4W A;  4C3K A;  3VAK A;  3I5B A;  1NK5 A;  1FE4 A;  3VHQ A;  4B3R F;  1RAB B;  2CQ3 A;  3MM8 A;  4DQI A;  2C2K B;  1VJQ A;  4DUT A;  1ZH5 A;  5D4O A;  4MIA A;  1PGZ A;  4NLD A;  3KG4 A;  3ZFV A;  4URG A;  3HF5 A;  3VWS A;  4TU9 A;  1I94 F;  2B8P A;  4Q5V A;  1S1U A;  5I4M A;  2MGZ A;  4RUB A;  4H4O A;  3V6J A;  3RR7 A;  3IRX A;  4P71 A;  1HNX J;  3V5R A;  3NEK A;  4AD6 A;  5KFT A;  4L73 A;  3EXY A;  2HVZ A;  4KO0 B;  3DLE B;  1NK4 A;  2QL9 B;  2D7S A;  2DB1 A;  4NCG A;  3S8S A;  1B0V A;  3Q8P B;  3THT A;  2W9C B;  2RS2 A;  1JWW A;  3CPW R;  1CJU A;  2B5J B;  3GJT B;  4FNH A;  4KB7 A;  2IM3 A;  3BB5 A;  2AKW B;  4ES3 A;  1FDA A;  4O3Q A;  2CJQ A;  3U1M A;  3WC0 A;  1DFD A;  1MN9 A;  2Z56 B;  1JKH A;  1OJ4 A;  2AMC B;  3MED B;  3I4H X;  3W9J A;  1T03 B;  3Q2T C;  2W2Q P;  5F3T A;  3ZC4 A;  2HK3 A;  1NSP A;  5ETV A;  1YRX A;  2PII A;  2W1B A;  3MEC B;  2H9Z A;  1ZAX A;  1HQ2 A;  3MCM A;  4Q2L A;  4R0J A;  4ZPA A;  4IQX A;  1VBY A;  4ZLP A;  4AT1 B;  2DHH A;  4ELT A;  3EYZ A;  2IIH A;  1UFL A;  3ZNJ 1;  4DV1 F;  1FDN A;  1N6Q A;  4ZVH A;  1DTQ B;  2V6A A;  1FNX H;  3UDC A;  1BXN A;  1EP4 A;  2YX4 A;  4ZK7 M;  1L5U A;  1P1L A;  2HMI B;  1RAH B;  2OH2 A;  2CJB A;  4LF7 J;  2AW0 A;  3HK2 A;  1IXK A;  4DI6 A;  4X4V A;  4FNI A;  2HZV A;  2H4Y B;  1E6V A;  4MFB A;  4DS5 A;  3NMA A;  3DDK A;  2V5H G;  3GV7 B;  2BAC A;  5HL7 Q;  4Z7C A;  3DLG A;  1T9V A;  1U1P A;  4CI0 B;  1SKU B;  4A8W A;  2J6U A;  1B7F A;  3QAE A;  4ATN A;  5M2P A;  4ECT A;  1UAW A;  5KT5 A;  5KT4 A;  2MZS A;  2G13 A;  5K14 A;  1TEL A;  1R27 B;  2ZNZ A;  3BPS P;  3Q8S B;  1HIY A;  1FRI A;  1N4L A;  5F41 A;  3C2P A;  2KI2 A;  4Q45 A;  2G0I A;  2BAN B;  4OV1 A;  1S97 A;  4MTP A;  4G1I A;  4CRJ A;  4WII A;  2BVZ A;  1WHV A;  2EVZ A;  3PEJ A;  3QWP A;  5CXT A;  4I4B A;  1HWU A;  3KTQ A;  1FJC A;  4PAA A;  3Q22 A;  4C0H A;  3DMJ A;  1M5H A;  4UOF A;  3ETO A;  3TRG A;  1S0N A;  4WZM A;  2M3D A;  2IVM A;  1FFG B;  4DR2 F;  2F4F A;  3CGI A;  5DET A;  2P6S A;  4KFB B;  4F8R A;  3NAH A;  5DDR C;  4DR2 J;  3R1H A;  1SI9 A;  1WEZ A;  3E01 B;  4R8U B;  1TK5 A;  4NLY A;  2ZBP A;  4M5D B;  1A0O B;  2HAI A;  1XR5 A;  4YR3 A;  2YNH A;  2HQD A;  2HBQ B;  4ZP9 A;  3JYT B;  1FJE B;  2V8V A;  1XNR F;  3KLG A;  1KC8 T;  1LQ9 A;  2L48 A;  2MMY A;  2WVF A;  2YNG A;  1LWE A;  2R7O A;  3N79 A;  2IDE A;  3QSI A;  4N76 A;  2LEP A;  1U24 A;  1YJR A;  2XLI A;  3V2U C;  2KT5 A;  4ANC A;  4AL7 A;  3PZP A;  3MGJ A;  1E6Y A;  2W8L A;  2QRR A;  2MPU A;  2N3L A;  3H5X A;  2MHE A;  1HR0 F;  2DCU B;  3VZI A;  5B0F A;  4LRA A;  3G82 A;  3R6G B;  3P6Y C;  4DFP A;  1HNZ J;  3MTJ A;  2CPX A;  2LDY A;  2PT0 A;  3IRX B;  4RW8 B;  4ZVF A;  3RRH A;  3QYY A;  3QRP A;  3AD9 C;  4HEA 9;  1FNO A;  4F4A A;  3TOQ A;  1JMT A;  1MN7 A;  2JVR A;  4C8N A;  9RUB A;  1R89 A;  2ROE A;  3FFI A;  4B3M F;  3PKY A;  1UVJ A;  4ED0 A;  5IS2 A;  4C3L A;  2HHW A;  3D1Q A;  1CJU B;  1GNK A;  2B5J A;  4P2X A;  4UF4 A;  3OVS A;  3SCJ E;  4FF2 A;  3V4I B;  1WOO A;  2IVY A;  5AXK A;  4DV1 J;  3MUV P;  4LFB F;  3GFZ A;  2OP5 A;  1Q5Y A;  2NXC A;  3EDR B;  3M8Q A;  3QIP B;  4RW9 A;  4UQT A;  4U7C A;  2NLW A;  2AX1 A;  4LT6 A;  2B7C B;  5J2N B;  3UN2 A;  1U45 A;  2IM1 A;  1EHW A;  1MWZ A;  1MU2 A;  5KFW A;  3IAS 9;  5L8R C;  4EEY A;  2W2P P;  4N8O A;  1BQN A;  5HRO A;  4DWI A;  1VBX A;  1YG0 A;  2ZOF A;  3BH6 B;  4PWW A;  5KFD A;  3UW1 A;  4F50 A;  2HQ3 A;  1Y7P A;  2CPJ A;  2HNY A;  1HA1 A;  1W2I A;  4JBC A;  1PO6 A;  2RB7 A;  5D3G A;  5D0R A;  1YJV A;  2LKZ A;  3TAM A;  3LF0 A;  2BJD A;  3A8E A;  3M1V A;  3MD3 A;  2OHD A;  4LQ9 A;  4PQA A;  3P4U B;  4HHJ A;  2E5J A;  4UT4 A;  3MUT P;  4PWD B;  1ZM2 A;  5JXS A;  3QFH A;  1UL3 A;  4IFY B;  2BR0 A;  1ROF A;  2R7U A;  2HRU A;  1A7G E;  1UWB A;  2D69 A;  4CDI A;  5GMK a;  1N8R T;  1C1C B;  3CO9 A;  2AYB A;  1K9M T;  2UUB F;  2CA9 A;  1F9F A;  2QMX A;  2VV5 A;  3QMQ A;  4IG3 A;  4Y00 A;  2X1G A;  2X51 A;  3TEH B;  2UXC F;  3NL0 A;  2Y3Y A;  5DZ7 A;  3MAA A;  2NS1 B;  5HSP A;  4PPD A;  1JLQ B;  1HBO A;  4F04 B;  1XEZ A;  2DY1 A;  3ZZY A;  1RWP B;  4B17 A;  5ETS A;  4AE5 A;  3SYZ A;  1DRZ A;  2RUG A;  2Q6B A;  4HAC A;  2LQ5 A;  4OJ3 A;  2VG5 A;  3SSQ A;  1X0F A;  5K8P A;  4LF7 F;  3FMW A;  1Q53 A;  4X66 J;  2WB4 A;  1RT3 B;  4IG0 B;  4LF1 A;  4OI3 A;  4DDF A;  1HQE A;  2B6A B;  3CJS A;  2MKI A;  2HHQ A;  2D3U A;  4C8Z A;  3CSK A;  3JB9 k;  4DR6 J;  5AT1 B;  2KXF A;  3A3O B;  2VFS A;  5K8N A;  2L41 A;  3W3S A;  4FYD A;  2C3M A;  5I42 A;  3B54 A;  3G6Y A;  1M5S A;  1NAQ A;  1X60 A;  3PJX A;  4DPU A;  1NK0 A;  2KVI A;  1KVI A;  4QIG A;  4ZPB A;  1WC3 A;  5F8N A;  3NMR A;  2Z2L A;  3KNA A;  5LJ3 Y;  5T7L B;  1NUE A;  1XR7 A;  3DFE A;  4OMF G;  3UR0 A;  1RTI A;  5L38 A;  2KRR A;  2BW7 A;  3QID A;  5KG4 A;  3BGR A;  5KFK A;  3CB4 A;  4NCB A;  1XNQ J;  4ETX A;  4L76 A;  5A2Q Y;  4WYW A;  1TKZ A;  2ZH4 A;  4NRT A;  4G1P A;  4HHU A;  5KFS A;  4KTQ A;  1R0B G;  4UTG A;  2OPP B;  4C8L A;  4M8L A;  2E9T A;  3KLI B;  4I6Y A;  4BHQ A;  4PEO A;  3NY0 A;  1NO8 A;  3DGP B;  3BQ0 A;  4MKY A;  1C4A A;  4DV4 F;  5IWA F;  2OML A;  1DAX A;  5SZT A;  5DLF A;  4FKX A;  1PSD A;  2G1D A;  5EX3 A;  2MQP A;  4QWA A;  4WBF A;  1J5E F;  1WTB A;  2DNH A;  3SQG B;  1FJG F;  2CDR B;  2YPY A;  3NKY A;  3NXZ A;  3RJM B;  2C3U A;  2RQ4 A;  3GP9 A;  1SL1 A;  2RUS A;  2MQ8 A;  2PEB A;  1ITP A;  4F0H A;  3VQS A;  5IQ6 A;  5KT2 A;  1Q81 T;  3MAH A;  1UVK A;  2IDL A;  1RBO B;  1HPZ A;  2WW8 A;  5KG6 A;  3HT3 A;  1ZTW A;  4IR9 A;  2XMU A;  4QBU A;  2V69 A;  1S1T B;  4NLU A;  4D3G A;  3GYG A;  1P9Y A;  1YJ7 A;  4PKD B;  3KJF B;  3N9U C;  4K4Z A;  2N7Y A;  3DLL Q;  2OTL S;  2DGS A;  2W9B A;  5J1P A;  4X66 F;  1DLO B;  2VDI A;  3PCO B;  3GG0 A;  1ZAW A;  5F8I A;  3AOC A;  3MPV A;  4B3S J;  1PIE A;  4YR2 A;  3GJR B;  3GFY A;  3DXS X;  5C42 B;  3SIP B;  4ZPD A;  4ZVT B;  1LWC A;  4I6A A;  4URS A;  2VC1 A;  4GRS A;  4OLP A;  3EX7 B;  2PFF B;  4B02 A;  3A8I A;  2F5G A;  2AEJ A;  1S77 D;  3SXL A;  4QYR A;  3PIP Q;  3QT6 A;  4IYQ A;  4USU A;  2C2D A;  3D3C J;  4I56 A;  3JSB A;  1BQX A;  1F3V A;  1GK8 A;  2VBW A;  4KQZ A;  3W5Z A;  4ZA1 A;  3UE2 A;  2QFJ A;  1SJ3 P;  3P49 B;  4OJH A;  3CC4 S;  3MXH P;  4KT0 C;  4KPY A;  1FD8 A;  1GTH A;  2SXL A;  2H1Y A;  1VRQ C;  3DOK A;  3LAM A;  3I5A A;  4J37 A;  4WJB A;  3DOK B;  1RTJ B;  2MB0 B;  2BOP A;  4WFY A;  3C3L A;  4RKU C;  5HP1 B;  2VQF J;  1NRK A;  1TVR A;  2W7P A;  5BYQ A;  3DI6 B;  1YJ9 S;  2UZA A;  1UET A;  1HYS B;  2HFO A;  1B4S A;  2P5V A;  3C15 B;  3TO8 A;  2R8J A;  1UVM A;  2GIF A;  2EG2 A;  2XMW A;  1VIX A;  3SQO P;  1F1B B;  2QL5 B;  4DLG A;  3PX4 A;  1JLE A;  1FFW B;  2RVJ A;  3NNA A;  1R43 A;  3CD7 A;  3RB4 A;  4FPI A;  2IPO B;  1VQ5 S;  2FLL A;  3R1L A;  3KLG B;  1VQP S;  3N5F A;  5KFF A;  4J91 A;  1NHV A;  5BYS A;  1FRJ A;  3MHY A;  4IOB A;  1SJR A;  2MKS A;  2V2Z A;  1RT1 A;  2PO4 A;  3EZO A;  3V6K A;  1H74 A;  1TL3 A;  3D6M B;  4IR1 A;  2JEI A;  3KUE A;  3MCS A;  1BLU A;  1ULR A;  2NZ4 A;  5I3U B;  3OXG A;  3TVY A;  4DR6 F;  1HL6 A;  1IKY B;  3LUY A;  2DHG A;  4W4M A;  4DV5 F;  1AUD A;  3HJF A;  1SC4 B;  3LWL A;  3KLH A;  4C8O A;  3Q83 A;  3PW4 A;  3MMC B;  4K0K J;  2UVW A;  2KYZ A;  3H2L A;  3NGK A;  3UD3 P;  1WTF A;  3TYT A;  3ENW A;  5IT9 Y;  3MR2 A;  2XI2 A;  1QAJ A;  3ENA A;  3T1Y J;  4AQY F;  1C0U B;  1C1B A;  3BQ1 A;  3KHL A;  2U2F A;  4URQ U;  4ZPW R;  2ZJQ Q;  1QAX A;  1QSL A;  5H9F K;  5A8R A;  3BGL A;  3PO4 A;  4KHM A;  3R5C A;  5A8R B;  1PJ6 A;  1SC1 B;  1IKW A;  1VIS A;  1KKH A;  2VG7 B;  8ATC B;  3LWM A;  3JSM A;  3OR2 B;  3FEY B;  4I69 A;  4EYI B;  3KFW X;  4DSE A;  4G3I A;  4ZVR B;  3GSD A;  3TP2 A;  3CCM S;  1NZA A;  1FEH A;  4OZ0 A;  1FI4 A;  5BXI A;  3L7P A;  4ECR A;  1WF1 A;  2ZDO A;  2XWX A;  4CLS A;  1N54 B;  1RDR A;  1NKC A;  2CJX B;  2GQQ A;  5KFM A;  1R0A A;  2FTR A;  3C6T A;  3K57 A;  1SH3 A;  4LBH A;  1VQ6 S;  2CAJ A;  1TU0 B;  1V3R A;  2V4J A;  2M9K A;  3CD6 S;  4GKJ J;  4M1K A;  3HSJ A;  3H40 A;  3BSC A;  4OYB A;  3BYP A;  1JLC A;  2G2Y A;  3POT A;  3E3X A;  1NCL A;  3JTO A;  2L08 A;  3KK1 B;  3PV8 A;  2EC2 A;  1G1X A;  4W90 B;  1QLN A;  1UP1 A;  2A6O A;  3H2V E;  2J9D E;  3QO9 B;  3NCQ A;  1L3K A;  1GAO A;  1M1H A;  1RHU B;  2ZJR Q;  1SJF A;  3DN9 A;  3IMQ J;  4XDC A;  2XMJ A;  2CNL B;  2OAU A;  1QUV A;  2X1B A;  5T14 A;  4TLR A;  3V6H A;  4ILM A;  3J7Y U;  1FFS B;  1HD0 A;  2CQI A;  2EFP A;  5C25 A;  2CPD A;  4Q8E A;  2QSW A;  2HVH A;  4I6W A;  2W4P A;  2YKP A;  3W5X A;  2NPF A;  2JVO A;  2DVI A;  4EMD A;  4DUY F;  4EU0 A;  1FJ7 A;  2PMH A;  2VU5 A;  4OYM A;  2MST A;  2OPQ A;  2DK2 A;  3GB0 A;  1VQL S;  1HNI A;  1J27 A;  2GJ2 A;  4RNF A;  3TAP A;  4AL6 A;  2RQK A;  1NBE B;  1HWK A;  4HR2 A;  3US5 A;  5DJB A;  2V9W A;  1OY8 A;  4WKR A;  1RBA A;  2BJ1 A;  4Y2I A;  5ETT A;  4J9R A;  1IJE B;  5DZ6 A;  4A8M P;  4JI6 J;  4ZVQ B;  2N7C A;  2MJN A;  2YNI A;  5IM0 A;  5DRK A;  4J9M A;  4UW2 A;  4B9S A;  2CDQ A;  4DV2 F;  1VLY A;  3H4B A;  1TL5 A;  3CIM A;  2APO A;  1BQN B;  3MR6 A;  1FHT A;  2ZZM A;  1TKD A;  1JQG A;  1DLO A;  1U0S A;  3ZO7 A;  2HK2 A;  2ZBC A;  3IBC B;  3OVA A;  5HBM B;  1VDH A;  4LRD A;  3VF0 B;  3ONQ A;  4Q8F A;  5A6W A;  2M7S A;  1BY9 A;  4DG1 A;  3N6M A;  4A4J A;  2P6T A;  4DV0 F;  1X9W A;  2X1F A;  4JV0 A;  2AF6 A;  3QFW A;  2DIU A;  5F9L A;  2EFQ A;  2HQC A;  2EK1 A;  3C16 A;  3H25 A;  1Y5N B;  3V4I A;  1U49 A;  4I64 A;  3M2U B;  2NCK L;  4ZP8 A;  1U6Z A;  3M8W A;  2Y1R I;  3TQ1 A;  1PYO B;  4KSE B;  1VGY A;  1F5B A;  1FES A;  2NYH A;  4NAS A;  3OSP A;  2ZUA A;  3DOM A;  3JTN A;  3EXC X;  1ZTT A;  3M8R A;  1JNR B;  4B3O B;  4LSL A;  1XIQ A;  4ECZ A;  4IH5 A;  3W66 A;  3SCI E;  3IBF B;  1C2P A;  2FD2 A;  1NM2 A;  5GAG I;  3KLV A;  1HD1 A;  2GJF A;  2WSF C;  3K5P A;  1HBU A;  2IC3 A;  1U1K A;  1CS4 B;  4EBE A;  1ZZF A;  1XR6 A;  3PW5 A;  1S1W A;  3RAX A;  4QU7 A;  2CKW A;  4E8U A;  1KR4 A;  4Y3C A;  4DCO B;  1KLM B;  2GGP B;  2FHJ D;  3L4B C;  4YQW A;  2VA2 A;  4ECW A;  3E51 A;  4H4M B;  5CAB A;  2QT7 A;  2ZOM A;  3M2V B;  5ETN A;  1S48 A;  3BJY A;  2DGW A;  4L3N A;  4M95 A;  4MYT A;  4OI6 A;  2QFI A;  2J0X A;  1UW4 A;  2RJZ A;  3IFE A;  3POT B;  2DR7 A;  2MKH A;  2XI3 A;  2HRT A;  4IUF A;  1VS3 A;  3ZZO A;  2PDA A;  3G9C A;  1X4E A;  4I68 A;  4QWB A;  4ED3 A;  2A10 A;  2ZNY A;  1QSY A;  2Y0B B;  2UUW A;  2AX0 A;  2MZ1 A;  2QLJ B;  4LSZ B;  4LFA J;  4R5P B;  1H6K X;  1S57 A;  5HMW A;  5KG1 A;  4CLF A;  2D3Z A;  2Y9H A;  1XBW A;  5A76 A;  3PIO Q;  1YQH A;  2M8D B;  1HQE B;  4XO0 A;  2GV1 A;  2QTW A;  3Q8Q B;  3ILL A;  3VAJ A;  4GKJ F;  2BE2 B;  1AB8 A;  1LFW A;  2ZBR A;  1RHJ B;  4HDH A;  4U8V A;  5THW A;  4DCJ B;  5DGB A;  1WC1 A;  2LQ8 A;  2R4F A;  1N33 J;  2B9X A;  4M5I A;  2DGO A;  3UQS A;  2NPI A;  3FMB A;  4PXC A;  2VL1 A;  4WIQ A;  4B9U A;  2HSE B;  1YGY A;  4A8Y A;  4K5R A;  2ZHO A;  5LMU J;  3SV3 A;  4HI2 A;  3I0R B;  1ACM B;  1RAI B;  1JLF A;  5IXU A;  2XO7 A;  4LRF A;  5KG3 A;  3UDE A;  5GVQ A;  1KQS R;  3BR9 A;  2DGQ A;  3BBF A;  4NZ0 A;  1DQ9 A;  3M05 A;  3T9Z A;  3GG1 A;  3X3U A;  1XMO F;  1RU2 A;  3A8K A;  3GIR A;  4ZVU B;  1RLC L;  3IWL A;  4NEY A;  4MYU A;  4GC6 A;  3BZQ A;  4GVL A;  1U47 A;  4QPT A;  4DFJ A;  2J8S A;  4JI2 F;  1RYS A;  3OUY B;  4FYY B;  4XDD A;  2H3E B;  2VPX B;  4QR1 A;  5IC4 B;  5D3G B;  3AAW B;  1OO0 B;  2GO8 A;  2WVB A;  2A2C A;  3A12 A;  2H5I B;  2UVU A;  4DG1 B;  1NJW A;  4C8K A;  4OX9 J;  3MOJ B;  2ZWO A;  3QT5 A;  3SMZ A;  3VZH A;  4KHR A;  3C66 A;  4HKQ A;  4X4N A;  1S9E B;  2X7I A;  4FZV A;  4OI2 A;  4Q43 A;  1U0H B;  4K0K F;  1WC6 A;  4DPX A;  1G6B A;  4LF5 F;  1HNZ F;  1WKK A;  1OY9 A;  3ZZT A;  4DN9 A;  2EXU A;  2IM2 A;  3W2V A;  4YUD A;  2CG8 A;  3FZB A;  2ZH9 A;  5I3Q A;  2WBR A;  2XC9 A;  2VH7 A;  4F4Z A;  2Z2M A;  1XQI A;  4J90 A;  4XIU A;  1AT1 B;  1XN9 A;  2ZH6 A;  2DIT A;  3QRR A;  2WHO A;  4X4P A;  2HHH F;  1IKV B;  2CQ4 A;  3ZZU A;  5CYQ A;  3W65 A;  3KOA A;  3D6F B;  4RW7 B;  4EBD A;  1UJ5 A;  2GAH C;  2B4O A;  1XMB A;  3QJJ A;  1U0H A;  3R9L A;  3TWZ A;  2B4V A;  3L95 X;  1MNE A;  4OX9 F;  1PIL A;  2DNP A;  3DRY A;  1NU4 A;  2ADC A;  2HVI A;  4LF5 J;  1YK9 A;  2GQ2 A;  2VZ9 A;  1D9D A;  2Q43 A;  2DYA A;  2RDI A;  1RU1 A;  3G8Q A;  2MQO A;  4DSK A;  4QW9 A;  3V6D A;  2I5J B;  3OT9 A;  1HLW A;  2E66 A;  4DX8 H;  1MWQ A;  1X4B A;  4DQR A;  3IR6 B;  1YZ6 A;  4KGK A;  4TXS A;  3OJU A;  2EFN A;  1RK8 A;  2FJV A;  1FT8 A;  1LW0 A;  3PTW A;  1G3O A;  2QLF B;  3KJV A;  2FYX A;  1RT4 A;  3M6U A;  1T95 A;  1T05 A;  1KD1 T;  1EQ0 A;  2Y1I A;  3QBC A;  2I9S A;  3T5H A;  3KLI A;  3PR5 B;  1JJH A;  1F3F A;  2QLX A;  3KG1 A;  3UPF A;  3HP6 A;  1SB6 A;  4JI5 J;  4EYH B;  1NPR A;  5J2M A;  4JI7 J;  1N33 F;  5CHC B;  4QWD A;  2AJ4 A;  3K5L A;  2ZFH A;  5KG0 A;  2LEB A;  1H3D A;  1RT7 A;  5AXM A;  4JI2 J;  3TAR A;  1REV A;  5HI7 A;  2XG8 A;  3W2W A;  1J5O B;  1LWE B;  2KO1 A;  4L72 B;  3E8O A;  4MKA A;  4Q0B A;  5FLX U;  4JV1 A;  3GIJ A;  2R7V A;  2HAF A;  1JLA B;  1SC3 B;  2RF2 B;  2GVZ B;  3MEG B;  4KH0 B;  4P7V A;  2JL9 A;  1FKO A;  2GCF A;  2GIR A;  2XYP B;  3KLE A;  1RKJ A;  2RIL A;  3ITH B;  1EKS A;  3FEX B;  1NZ8 A;  2XS5 A;  2MLY A;  5DM7 Q;  1TK0 A;  3HXM A;  2G9O A;  5T41 A;  3T1H F;  3CXC R;  5MLC V;  5BJR A;  3MD1 A;  1H7W A;  4DL5 A;  2J9D A;  5B7W A;  2ZM6 J;  4DMZ A;  4LF6 F;  2Y0S D;  1QM9 A;  1VLO A;  1ZS6 A;  3W8G A;  3KHR A;  5HVG A;  2XY6 A;  1QY7 A;  2V68 A;  3DLJ A;  2BE2 A;  3DRR A;  5D4P A;  1RLD A;  3KJQ B;  1YJW S;  2VKZ G;  4ZDN A;  3OXL A;  2IYG A;  4DV4 J;  3EZU A;  2RDJ A;  1Q82 T;  2GVD A;  4RLE A;  2K8G A;  3UNY A;  4IRK A;  1F2G A;  2JX2 A;  1X5P A;  3QWU A;  4GO5 X;  1VQ9 S;  4B3T F;  1RWN B;  2EFG A;  2K3I A;  1WG5 A;  3N28 A;  2NXU A;  3L3C A;  3CUN A;  1H38 A;  3I9Z A;  2CJA A;  4M5L A;  4OZJ A;  4QIE A;  1CJT A;  1TKT A;  4QU6 A;  2PD1 A;  3DRS A;  4HTJ A;  2VBZ A;  2A6M A;  3U02 A;  2PN6 A;  2RF2 A;  3GFH A;  3OTE A;  4F0K A;  2DT9 A;  2FVQ A;  5FJ4 A;  4PG5 A;  2RNE A;  1RT5 A;  3I31 A;  5B0A A;  1SCJ B;  4OX8 A;  3UFC X;  4ZJL A;  4DR3 F;  5HP1 A;  3KK2 A;  2HYI B;  4BDP A;  3IG1 B;  1Q8K A;  3DC2 A;  3UVJ B;  4WFA Q;  1SUQ A;  1TAU A;  2WRM A;  3MMJ A;  4NL5 A;  3DNC A;  7FD1 A;  4OV6 A;  3ILO A;  3MEC A;  4BS2 A;  4UOH A;  3PYE A;  1S1U B;  5KFN A;  2AGP A;  3H0P A;  4IG3 B;  4MKV A;  1QVG R;  1PC5 A;  2K7K A;  4KGM A;  1Z1Z A;  4WTY A;  1MMD A;  4HH1 A;  2JJ4 D;  1BWV A;  4R25 A;  4ZPC A;  2WAQ D;  3F41 A;  4LUB A;  3RB6 A;  2FB0 A;  4P74 A;  5D6G A;  1S6P B;  2FLN A;  5J2Q B;  4PYD A;  5KT6 A;  2VFV A;  4FDF A;  2VA3 A;  1RCX B;  5L1J A;  2W8K A;  1SL2 A;  3C19 A;  3NNH A;  3MFI A;  4N7T A;  3PXG a;  2EW9 A;  1YVF A;  2HUR A;  2BJ8 A;  4YFU A;  1B70 B;  1ZA2 B;  3C14 B;  5LSL A;  4CLZ A;  2HND A;  3LP2 B;  1SVD A;  4PXD A;  5D0E A;  5LOQ A;  2DR9 A;  2IVF B;  3PW7 A;  1H73 A;  1TR0 A;  2MEW A;  2VKR A;  3O5T B;  5E2Q A;  4X4R A;  2OPR A;  3BKT A;  4C11 A;  2WVC A;  3NG8 A;  2F9J A;  1NSA A;  2DH9 A;  2OEJ A;  3D1O A;  3FUY A;  3M8Q B;  1KON A;  3QIP A;  4M5G A;  2R7R A;  3BO4 A;  4USK A;  2ZM6 F;  1U8W A;  3D6H B;  2YY3 A;  2ZH7 A;  5EX0 A;  1GXT A;  3HO1 A;  1X4G A;  4ICL B;  1PC4 A;  1T9Y A;  2B9W A;  3AQO A;  4ZVP B;  1RT2 A;  3RTV A;  3UCU P;  2XLK A;  4OZL A;  2CWK A;  2N4D A;  1CC7 A;  1V9O A;  1XJW B;  3FSX A;  3M30 B;  4I0W A;  2FZK B;  3FFI B;  3KK1 A;  2UP1 A;  3VGV A;  4MT1 A;  4CO2 A;  1N56 A;  1KFS A;  4JI8 J;  1K47 A;  4DUY J;  2C2E A;  4I2P A;  5SUH A;  2CQ0 A;  2BW2 A;  2DO4 A;  3LGH A;  3CJ3 A;  4KFB A;  3UR3 C;  4DEZ A;  3TZY A;  2HBY B;  1BHN A;  1QTN B;  2VFT A;  3NGR A;  2ADB A;  2C2Z B;  2LQ9 A;  2R7X A;  3P3D A;  3H20 A;  4P2M A;  5IV4 A;  2POK A;  3CWJ A;  1FXL A;  3EDQ B;  5HQL A;  3B4D A;  1RWO B;  2HLU A;  5HAO A;  2XO6 A;  2YQ0 A;  3J80 Y;  1LFP A;  3VAI A;  1UPM B;  4QIF A;  2BA9 A;  1RIS A;  1GX5 A;  4OJG A;  3Q24 A;  2VOP A;  1K8A T;  1YZ7 A;  3I87 A;  3TA0 A;  2D1C A;  1FF2 A;  1IKW B;  1O8B A;  2MZJ A;  4M5H A;  3CCU S;  2EBG A;  1SV5 A;  1R31 A;  3F73 A;  2ZDP A;  5B09 A;  3AH6 A;  1SV5 B;  1M1G A;  3OW2 R;  2JNJ A;  4JI0 F;  3TNV A;  4IO9 Q;  2VJV A;  4N41 A;  1UZH A;  2W2N P;  1RKI A;  2D9O A;  2K1R B;  3JTP A;  2YNF B;  3MMA A;  5B0D A;  2RIJ A;  1MRO B;  3PRD A;  5LXR A;  1DHM A;  3BO3 A;  2R7T A;  3GWC A;  1YBT A;  5DDO C;  2WVD A;  2UV8 G;  4X2B A;  4K8R A;  4Q0B B;  3VTI A;  3LAL A;  3M2V A;  3TZX A;  3WC2 A;  4ECQ A;  2MKC A;  4EUV A;  3QGH A;  1JLG A;  4ALZ A;  1YRT A;  1B64 A;  1T11 A;  4K2X A;  3W8P A;  3WX8 A;  4X4O A;  2QL7 B;  5C2C A;  4UUX A;  3VGS A;  3A8J A;  3EPG A;  3EGV A;  3DYA B;  1BGX T;  2IHR 1;  3FRY A;  3FRZ A;  2QJ3 A;  3HSD A;  5E41 A;  4WFB Q;  4OX6 A;  2K3K A;  2FJX A;  3S7R A;  4F25 A;  3LP1 A;  1M5V C;  3R7B B;  2OEK A;  1X9M A;  3MUM P;  3G4S S;  1SQE A;  3OR1 B;  4ZLJ A;  3OL7 A;  3OHA A;  1H2T Z;  3PR4 A;  1E6V B;  4MFB B;  2GVZ A;  3KLE B;  2BX6 A;  2YQ1 A;  4DX7 A;  4HLB A;  4KHP J;  2RQC A;  4DR5 J;  2NSB A;  5F0U A;  4B08 A;  2CXE A;  1WG1 A;  3DU5 A;  4Z7Y A;  4NRU A;  4JV2 A;  1GMW A;  1S4F A;  1CBK A;  3KDO A;  1KLM A;  1OQ3 A;  2GGP A;  3QGI A;  1LWF B;  2C2R A;  3HCX A;  1YHQ S;  2DHX A;  1S1W B;  5KOW A;  4USJ C;  3FCH A;  5J2M B;  2BQR A;  1SIW B;  5IFM A;  2XCA A;  1OPZ A;  2MZR A;  1OSD A;  1IKX A;  3HDS A;  2M5Y A;  3RBZ A;  1DQA A;  2CPH A;  4O3P A;  2H5E A;  3MAA B;  3CF5 Q;  3QAT A;  2I2Y A;  3IM8 A;  4QW8 A;  4CQ1 A;  2RS8 A;  1UWA A;  1LW0 B;  2JLF A;  1IUJ A;  3EMT A;  1FRH A;  2HNZ A;  5J2P A;  2KJV A;  2HHV A;  2E29 A;  1N5V A;  1UEV A;  2YBV A;  4ECV A;  1N5T A;  4J9L A;  3ZTO A;  4AUK A;  3HPO A;  3SBM A;  2AJ1 A;  2PI5 A;  1VC0 A;  1DUR A;  3CDB A;  1Q4R A;  2CJY B;  3C16 B;  3U7J A;  3VCD A;  5ETO A;  5HJX A;  1WKJ A;  2IJN A;  3HMJ G;  3CJ0 A;  6FDR A;  4X4T A;  3NP5 A;  5E7O B;  1TFW A;  3LP2 A;  3ICL A;  3Q8U A;  3Q23 A;  4LVN P;  1RQ0 A;  3QZ8 A;  1TL1 A;  1OMS A;  2DXE A;  2ZH2 A;  2D3O 1;  3CDW A;  4IFV B;  2DNO A;  2NXN A;  4NLW A;  4F36 A;  2QX0 A;  3PRV A;  2HRY A;  2CJK A;  5F0W A;  5HMY A;  1D9A A;  5HQM A;  1S0M A;  3T6J A;  1EET A;  2JSX A;  2JWN A;  2KXH A;  1JJ4 A;  4CNZ A;  3LAK A;  3HFZ B;  1LV5 A;  3WHI A;  5C42 A;  5MAO A;  3AJ1 A;  2FVR A;  2CWX A;  1PJ7 A;  1PG5 B;  4OYZ A;  3J81 Y;  3N5B A;  1KS2 A;  4EI2 A;  5CAA A;  4TQR A;  4YOE A;  3DM2 A;  1IM6 A;  5CCM A;  4DZD A;  1PYT A;  1H2U X;  1BMQ B;  3DGP A;  2KM8 C;  4P52 A;  2V4J B;  1IN0 A;  1B7Y B;  2F8E X;  2XNQ A;  3PHT A;  1U2F A;  5FD1 A;  2EI5 A;  2IFX A;  2LXF A;  3ZZZ A;  3I56 S;  4FF3 A;  3T19 A;  3HVA A;  1RAG B;  3P45 B;  3N6N A;  1T9T A;  2J0Q D;  4P75 A;  5HAT A;  4DL6 A;  5EN1 A;  3G6V A;  1SL0 A;  1MG7 A;  3G96 A;  4TY8 A;  1S0V A;  2MTL A;  2BKN A;  3UN5 A;  3JSM B;  3RRG A;  1VMB A;  2MYF A;  1WG4 A;  5LL6 d;  2AYM A;  1CLF A;  1KSP A;  2BV3 A;  3K5O A;  4KGV B;  1CJV B;  3K17 A;  4B9L A;  5L1I A;  3X1L B;  2RSQ A;  1RWW B;  2LDI A;  3L7O A;  3PFE A;  4DJB A;  2FC9 A;  4RBV A;  1HHT P;  2VUG A;  1N48 A;  2B4P A;  4CT8 A;  4KKO B;  4DV0 J;  3HHN B;  3DLK B;  3I55 S;  3OPK A;  3GFX A;  1VQS A;  1J5O A;  4A8F A;  4N56 A;  5KFQ A;  1VBZ A;  2NSC A;  2Y8Y A;  4TVA B;  1FVQ A;  1FTC A;  2HGN A;  2C2O B;  4AND A;  4M5N A;  1G4C A;  4NLX A;  2ZH1 A;  1HBU B;  2IC3 B;  2CPI A;  3HKW A;  1WSR A;  4B9N A;  3IRW P;  3LGN A;  2UU9 J;  3TA2 A;  2HS3 A;  2JFK A;  4RW4 B;  3RBD A;  1HNW F;  1I3O B;  2KHC A;  4AXI A;  1FD2 A;  1NB2 A;  2KZZ A;  1FVS A;  4HHH A;  5EGY A;  4NXN F;  5AE1 A;  5D0G A;  1PYS B;  2R7Q A;  1PAE X;  3RAM A;  3HHD A;  4J9K A;  4ED6 A;  4NZ7 A;  2CG4 A;  5LMU F;  1L3U A;  3R2C J;  4KY3 A;  3PNI A;  1I5O B;  2G2Z A;  3BEG B;  1TKX B;  3JQM A;  4MIB A;  3NOG A;  3VR1 A;  4CNY A;  4U6P A;  4XPE A;  3OV7 A;  2MLX A;  3THV A;  1Y5L B;  4IFV A;  4GVB B;  2VQE J;  2AYE A;  2LMI A;  4RNO A;  4CP5 A;  5HRO B;  2ZD1 B;  3RZA A;  4NLV A;  1NHK L;  3SFU A;  2Z2Y B;  1HI0 P;  4B3O A;  4J9P A;  2MJU A;  4IOA Q;  2FY8 A;  3HSZ A;  1UCN A;  2GMH A;  1W2B R;  1LW2 A;  4ZCM A;  1GMU A;  2RRN A;  4MK7 A;  2V2Q A;  2OO4 A;  4U96 A;  4U7U D;  3AHP A;  3TAM B;  3CCJ S;  1UJ6 A;  1VRT A;  3V4M A;  1SJ4 P;  2XCP A;  5AE3 A;  2B0G A;  2PMW A;  3T41 A;  1LKZ A;  1R8B A;  1TVR B;  1FKP A;  1WDT A;  3QT7 A;  4WXW A;  2FJE B;  5KFY A;  3TR5 A;  4CM2 A;  5DDP C;  3KHG A;  1B3T A;  4PUO A;  4G6V B;  1T0T V;  2DBB A;  1C4C A;  2V8P A;  4DL2 A;  2BQU A;  5CYM A;  2R2U A;  2Q6C A;  5L9N A;  1EQM A;  1GMW D;  1KVJ A;  1HBM B;  4PYA A;  3CJK B;  5L39 A;  3SDE B;  4RBU A;  4HDG A;  3W5Y A;  4OZ1 A;  4MKB A;  2HHH J;  4PQU B;  3GZ7 A;  1Y10 A;  2QIF A;  1ZOT A;  5J2Q A;  1AFJ A;  3DLB A;  1YRU A;  2D9P A;  1IBK F;  2QSF A;  1U8S A;  4EZ9 A;  3DDI A;  3KHH A;  1RHK B;  1FRK A;  1JXV A;  1UTA A;  2FUG 9;  2CQ2 A;  4UQG A;  2HNZ B;  4FPR A;  5J2P B;  3VAH A;  1RYR A;  5IT4 A;  2PI4 A;  1SIZ A;  1RI7 A;  2WW4 A;  4OHZ A;  1H98 A;  1TUG B;  5HN0 A;  3WDO A;  3NGD A;  2QYG A;  2JC1 A;  1S9E A;  2OTJ S;  2FGC A;  3RW6 A;  4F3O A;  3CVK A;  3MPY A;  3VV2 B;  4K4X A;  4I67 A;  3DYA A;  1ZM3 A;  1S0O A;  2D41 A;  2E5H A;  2FZG B;  3QLH B;  4J5O A;  4YDX A;  5GAE I;  2XMA A;  4HYK A;  3VAF A;  2DEJ A;  3KWM A;  5FLX Y;  4ZLL A;  1S9F A;  2KL8 A;  4IKA A;  2FVS A;  2FZC B;  2BJ9 A;  4KPC A;  3ELH A;  2KG0 A;  2J6S A;  2M8H A;  3LO3 A;  3DRR B;  1H0H B;  5GAD U;  4J7C A;  1CUL A;  4O44 A;  1F5A A;  1K1S A;  4LFA F;  2XSF A;  3UCZ P;  3HHE A;  3SFG A;  1XNR J;  1S4E A;  1S79 A;  2HZC A;  1NK8 A;  2DXD A;  1M1K T;  2R7S A;  3KXD A;  4RW4 A;  1ZBT A;  4F4Y A;  2XZW A;  1CJV A;  2IRY A;  1RWM B;  2BAB A;  4J9V A;  2AU0 A;  4NYP A;  3BGU A;  1Y4Z B;  2HGL A;  1Q8I A;  3FBC A;  1C0T A;  1CC8 A;  1JIH A;  1G7C B;  2DIS A;  2CQ1 A;  1T8E A;  2GS8 A;  2E5L J;  2GHP A;  2DNG A;  3GTY X;  4PXE A;  1XK8 A;  2OPS B;  1FK9 B;  4ZHR B;  4JI8 F;  4NCA A;  2RHQ B;  5T7L A;  3QPI A;  3RYL A;  4DR1 F;  3IGV A;  4F2S A;  2ZIT A;  3V81 B;  2XGQ A;  5I3U A;  3OR2 A;  2ERR A;  1CS4 A;  1X8D A;  3QLH A;  3U27 A;  4TU7 A;  3PRB A;  2DNR A;  4DUZ J;  4DR3 J;  1RWU A;  1KVK A;  4QQB A;  4LMZ A;  4OL8 A;  3AXM A;  2E7W A;  5CYJ A;  2ATL A;  4OJ1 A;  4M5M A;  1N34 F;  1Q0N A;  2QLB B;  2E1R A;  3CW2 C;  2XLJ A;  4C8M A;  1P27 B;  1JLA A;  3H7H B;  4CTA A;  2ZKT A;  4UZB A;  3GIM A;  1HWJ A;  2IBK A;  4DV6 J;  1VQ7 S;  2ASJ A;  4A8O A;  4NOH A;  5IZH A;  4ELV A;  5EWE A;  2YVS A;  1ELO A;  1JLE B;  1N5S A;  5B0G A;  2WSC C;  5HO4 A;  4HAC B;  4CO4 A;  1SH0 A;  2F3J A;  1YI2 S;  2IBO A;  2HHX A;  4CLK A;  2XTJ P;  3SDE A;  1RTD A;  2EEY A;  2DHS A;  4KR0 B;  5KFU A;  3MOZ A;  1F0X A;  3CCE S;  1XMQ F;  2FVC A;  3EVM A;  4ES1 A;  1TMM A;  3BSO A;  2IMO A;  2RDD A;  1UJ4 A;  3C14 A;  1X7V A;  5L9X A;  3WIU A;  4LSN B;  3TQE A;  2XZT B;  3OVB A;  3PEH A;  4TU8 A;  4LF6 J;  1BUX A;  3MMB A;  2BQ3 A;  4DCP B;  1NSK L;  4R0E A;  4WFZ A;  4W98 A;  3W9H A;  1RA7 A;  4WYL A;  3J80 U;  1RP5 A;  3M1V B;  4C0O C;  1VHI A;  5B0B A;  1URR A;  3H8Y A;  3LQV A;  3ZXW A;  2ZH5 A;  1T3O A;  3DI6 A;  1NJZ A;  2CPF A;  1IR2 A;  4FN5 A;  3W2V B;  4XK8 C;  3W64 A;  2Z30 B;  3R7N B;  5H9E K;  5CYM B;  5E3Q A;  5F3Z A;  4WF9 Q;  1HNX F;  2QV6 A;  4PUO B;  2A3J A;  3TVK A;  2ZWP A;  2W7O A;  2DH7 A;  2UUT A;  2G0C A;  2GZO A;  4YY3 J;  3G82 B;  4WTO B;  3DRP A;  4CT9 A;  1DTT B;  1FXR A;  5IM0 B;  4O0N A;  4O23 A;  1DZ5 A;  4MAK A;  3NGT A;  2XMM A;  5C24 B;  3H5S A;  2P9G A;  2V67 A;  4NPO A;  1H2V Z;  3AXK A;  3RR8 A;  4OLO A;  5JMN A;  3KLH B;  5GMD A;  3H90 A;  4L3K A;  5KFE A;  3K58 A;  1OY6 A;  1ZZN A;  3RAQ A;  5EDW A;  4JI3 F;  4OZ5 A;  4DR1 J;  2L9W A;  7FDR A;  1U2C A;  1HI8 A;  2PE8 A;  3E01 A;  3GE9 A;  3OFE A;  1V5I B;  3Q8R B;  4WE1 A;  1HWL A;  3LOU A;  3C6U A;  2RKI B;  2M52 A;  2DKO B;  2KHD A;  1IKX B;  3I32 A;  3K89 A;  4DS4 A;  2M70 A;  2Z8Q A;  1YTY A;  3TAN A;  2WON A;  1D3W A;  2B3T B;  2ALY B;  2B56 A;  2V63 A;  2YKM A;  4OZ3 A;  4Y28 C;  4F26 A;  5A6P A;  3Q2S C;  1VJW A;  1OIA A;  3M8Z A;  3OFF A;  4QOT A;  5DO2 A;  2JLE A;  4A8X A;  1NDL A;  5CZV A;  3U1N A;  3VAG A;  1RT5 B;  3T1H J;  1U48 A;  5KFH A;  4USH A;  3FBB A;  4I2Q A;  3HHL A;  5DG7 A;  3HHL C;  4CTA B;  1KWM A;  2AZ1 A;  1UW9 A;  1KDN A;  3FEZ A;  4ED5 A;  2DEI A;  4R8U A;  1IWA A;  1TL4 A;  3E2E A;  5CD4 A;  1JJC B;  4FVC A;  3T3F A;  1R8H A;  5DQG A;  1URN A;  3VGU A;  1IBL F;  3UDV A;  3CUL A;  4CM0 A;  1WI8 A;  3AT1 B;  3MR3 A;  4JUZ A;  1T94 A;  4WU2 A;  4O3S A;  4RX6 A;  5KFB A;  2ZHB A;  3KJN B;  2BE9 B;  2M88 A;  2Y1L B;  3DXB A;  3FGV A;  4TYB A;  1CQM A;  2VPY B;  3O2I A;  1RHR B;  4RZR A;  2AD9 A;  1DTQ A;  3U1L A;  4I1T A;  4PWU A;  3RUB L;  1QTM A;  2ZC4 A;  5F8L A;  3PX6 A;  4NLQ A;  1Q16 B;  2V50 A;  3HLU A;  3AB4 B;  2WON B;  2J7U A;  3MMA B;  1BQM B;  3S1T A;  5E3P A;  2E9R X;  2ZZN A;  4O4G B;  1S1X B;  1FX2 A;  2XWY A;  4QIV A;  3MTK A;  4WCE Q;  2OD4 A;  1R0C B;  2OSR A;  3CED A;  3MDF A;  1XC9 A;  3MEG A;  3HSG A;  2CUY A;  1HKA A;  1V3S A;  5E5N A;  2F40 A;  3D2W A;  4PWD A;  5KFV A;  3RBE A;  1RA6 A;  2YKN A;  2J7W A;  1NJY A;  2PA8 D;  3CJT A;  1RT7 B;  2KVQ E;  4ICL A;  4DL0 C;  3MWB A;  4BC9 A;  3V6D B;  2VG5 B;  3CDA A;  3QRQ A;  2JEJ A;  5K20 B;  2XB2 D;  4PQU A;  2HS4 A;  4NYO A;  5EUH A;  3M32 A;  5LM7 E;  2LU1 A;  2KT3 A;  5A8W A;  1DTT A;  2O5D A;  2QZ8 A;  1RJJ A;  3QGG A;  5KFO A;  2ZVS A;  4HTI A;  3EUN A;  3FK4 A;  3OHB A;  4JI0 J;  3M8Y A;  1KHV A;  1TL7 B;  2HFN A;  1VIO A;  1OYE A;  1WKL A;  3AA8 A;  1RTJ A;  2HFS A;  3IR7 B;  4NEZ A;  4TKT A;  1OYD A;  2PSZ A;  2HND B;  1Y11 A;  1PBA A;  4QZV B;  2C2M B;  3IO1 A;  3EGZ A;  2LFV A;  2XSJ A;  4UOC A;  4NML A;  2YWG A;  4MK8 A;  3M9M B;  3P5B P;  3LA0 A;  4RW9 B;  1VYA A;  3RBX A;  5LT5 A;  2HHT A;  3MM8 B;  1N32 F;  5LSO A;  2KYX A;  1QE1 B;  4FP9 A;  3M2U A;  9ATC B;  4ZVO B;  2HVE A;  2I5J A;  2KRB A;  2O1P A;  1QE1 A;  1KLN A;  2JHE A;  1S5Z A;  1T9X A;  4K2J A;  3WIV A;  1BD6 A;  1TMJ A;  3I9V 9;  1LWC B;  2OD6 A;  2BRL A;  3GPA A;  5DQH A;  4DL4 A;  2E9Z A;  1NSQ A;  1GQE A;  3A4T A;  2V4Q A;  5ETK A;  4XTT A;  5KFA A;  1NDP A;  4RU2 A;  3MUR P;  4K4S A;  1VQY A;  1LNQ A;  3QGP A;  3MR7 A;  2UXB J;  4BWM A;  2KXN B;  2HFZ A;  1TV6 B;  2HZA A;  3FZ2 A;  2H65 B;  4BWJ A;  5IT0 A;  5KFG A;  4ZLN A;  4N5S A;  2CQC A;  3GCW P;  5KFL A;  3UVJ A;  2C28 A;  3M32 B;  4X65 F;  2VJU A;  4F4X A;  2WSE C;  1IR1 A;  2AJ0 A;  1IWG A;  3DU6 A;  4FVM A;  4P2F A;  2F63 A;  1VRT B;  2Z4P A;  3MM5 A;  3SZ2 A;  2NZC A;  5EHH A;  2RE1 A;  3BH7 B;  1NME B;  2OPQ B;  2ATC B;  3F44 A;  2VHG A;  4V19 X;  4ITS A;  1X5O A;  3WZ0 A;  1RXO B;  4F67 A;  2ZE2 B;  3HX9 A;  4DU8 A;  5IOL A;  4ILL A;  1DQ8 A;  1UFW A;  2GIQ A;  1PCA A;  6AT1 B;  4B3S F;  3BF4 A;  2HIQ A;  2YKA A;  3R2D J;  4ID8 A;  3ADA C;  2FJD B;  3FKB A;  2I0X A;  4TYA A;  2V8D A;  1YJN S;  2A1B A;  1U25 A;  5E3R A;  3R97 A;  4U95 A;  5C2G A;  2CNN B;  3LGM A;  1O5J A;  3IA0 A;  3EGW B;  1N36 F;  4N8N A;  4F0M A;  1N0U A;  3O8W A;  4OHX A;  2I6W A;  4OYI A;  1DAR A;  3G87 A;  4DU7 A;  3ILJ A;  2ILZ A;  1IQT A;  1Y0H A;  2WK4 A;  2HFV A;  3THP A;  2DR5 A;  1WHW A;  2ALZ A;  4FS2 A;  4NLP A;  2AEM A;  4ZCL A;  2C2N A;  3IWN C;  1RCO B;  1HW9 A;  5K14 B;  3JQK A;  2VD3 A;  2MKK A;  2HEK A;  1F6T A;  2Q1L A;  1Q1K A;  1S1X A;  4KV8 B;  3I0R A;  2YWH A;  4CZC A;  1FNM A;  4KV8 A;  1L3T A;  2EK6 A;  2H54 B;  1K73 T;  2QGF B;  3OJS A;  3D0G E;  5A8K B;  2J76 E;  3CNQ P;  3LPE A;  5L1K A;  5KG2 A;  5E0O A;  4YHH J;  4JI3 J;  3DKD A;  4Q2M A;  1FK9 A;  3BGR B;  2RH3 A;  4HVZ A;  4WK3 A;  3M2R A;  2G1H A;  3BSN A;  3QJP A;  1P8G A;  4BLG A;  3H5U A;  2EC0 A;  1ZM4 A;  3I4P A;  4DN0 A;  4R5P A;  2OMO A;  3M9O B;  3CME S;  4FS1 A;  2K1R A;  5D4N A;  3TVZ A;  3M4X A;  1QSS A;  5D77 A;  4NI2 B;  3NWR A;  2MXY A;  3CCQ S;  5HLF A;  4DR4 F;  3DLG B;  4C0B A;  2QE5 A;  4NZ6 A;  4LFC J;  4DUZ F;  2HIY A;  2J0W A;  4J9Q A;  4GKK F;  4ZVG A;  2OJ3 A;  3O44 A;  4B3T J;  4HL9 A;  2ZE2 A;  4ED7 A;  3QNW B;  4U9R A;  2Y8W A;  4K50 A;  3CD0 A;  4DX6 A;  2F4V F;  3D0I E;  1F2H A;  4P9S A;  1N6Q B;  1I6J A;  1IKY A;  1NH7 A;  4DF8 A;  1GEH A;  2D3O R;  5C24 A;  1V6H A;  2YXL A;  4JV5 F;  2KB2 A;  5K9F A;  2ZKU A;  2GHV C;  1JLQ A;  2M4M A;  1ZPW X;  4DSL A;  3HFK A;  4JI6 F;  2VG6 B;  4WWS A;  1UVI A;  3BBC A;  5KT3 A;  1KFD A;  4GKK J;  3RB0 A;  1VQM S;  1HMV A;  2LA6 A;  3D28 A;  4KBI A;  2YPZ A;  1O0P A;  1OWX A;  2R9L A;  7AT1 B;  1CQN A;  1N36 J;  2UU9 F;  2MY7 A;  3T6B A;  1FRL A;  5BYR A;  5F8G A;  3CJ8 A;  2FJW A;  2FIU A;  2Q3P A;  1EKR A;  5KAK A;  4Y34 A;  3IWX A;  2XMK A;  3B82 A;  1U09 A;  2BKO A;  1NKE A;  4KYZ A;  3HUL A;  5DS7 A;  4RUA A;  1SJQ A;  2E1P A;  2W9A A;  2GAG C;  2IM0 A;  2OLW A;  4YS2 A;  2QA4 S;  3RW7 A;  4J9O A;  4JI7 F;  5KG5 A;  4X62 F;  2MQN A;  4X84 A;  4CYU B;  3EZ5 A;  2RT3 A;  4CLP A;  3BKU A;  3I0S B;  4YB5 A;  4D3H A;  4BC7 A;  4NE9 C;  4RW8 A;  3UN3 A;  3N01 A;  5ADZ A;  2W9B B;  2PFD A;  2GML A;  1YJT A;  3K59 A;  1IQZ A;  3JAM Y;  1HR0 J;  4DL3 A;  3J81 U;  1SUQ B;  3GCX P;  4YP3 A;  1U1L A;  2EFV A;  3EE3 A;  5A2Q U;  5F8H A;  3NS7 B;  3KNG A;  3PYG A;  5KFJ A;  5DG9 A;  3KK3 B;  3MPW A;  4DSI A;  1Q7Y T;  1VOM A;  1JJ2 R;  3LP0 B;  4PZV A;  2LP4 A;  4ZIT A;  4ZMM A;  1VQN S;  1A9N B;  1OQ6 A;  8RUC A;  2H51 B;  5F8J A;  3EVO A;  3D1H A;  2J9E A;  2FJA B;  2ZVI A;  4RNH A;  1VC6 A;  1IBC B;  1VQ4 S;  4G1Q A;  1X0P A;  3B6B A;  1TKT B;  1HQU B;  5LXY A;  2HQG A;  3LP1 B;  4JOU A;  3QJL A;  4C98 A;  5H1S V;  1YX2 A;  3H98 A;  3WBZ A;  1FDD A;  2C3O A;  4J9N A;  2AGO A;  2A0F B;  1GMV A;  1TKZ B;  1FA0 A;  1SKS A;  1O51 A;  2OIH A;  4FBU A;  4DBQ A;  2A2D A;  4OFZ A;  2FLO A;  2Q66 A;  4PRF A;  4AQY J;  2E1C A;  3EM1 A;  4FBT A;  4EZ6 A;  1X4C A;  4ER8 A;  5F9N A;  4M5D A;  4QYZ K;  3R5D A;  2YNF A;  4JI1 J;  3G71 S;  3W61 A;  1T9W A;  3PYF A;  3J7Z T;  2R7W A;  2FPH X;  1YIT S;  4Y2M A;  2BDP A;  4O3R A;  3BM7 A;  5KFI A;  1Q8B A;  2GA7 A;  1V5V A;  2BM0 A;  3IS9 A;  1D09 B;  2HLT A;  4JYA J;  2B9E A;  1S10 A;  3NRB A;  3FQL A;  4TY8 B;  2F65 A;  1NXI A;  4KRW A;  3HHL B;  5F8M A;  3JXO A;  3HVW A;  3AFG A;  3MZI A;  2ZH3 A;  4K4T A;  2JEG A;  1X31 C;  3ZNU A;  2O01 C;  4NLR A;  1G2E A;  1EP4 B;  3K5N A;  1VC5 A;  3PM9 A;  4USV A;  1JK9 B;  2LU2 A;  1OSC A;  1RTZ A;  1VCT A;  5HVF A;  3DHW C;  5CCL A;  3OFH A;  4ED2 A;  3PW2 A;  3OBI A;  2FGO A;  5DGA A;  5GAG U;  2OEL A;  2GJI A;  2YWE A;  3CJ5 A;  3ULH A;  1YLX A;  4CO5 A;  2N3O A;  4EBC A;  4A8K A;  4NA2 A;  1C1B B;  1C0U A;  3FCV A;  3TW0 A;  1U4B A;  1M5K C;  1FKO B;  3ZZP A;  3QT8 A;  1LK5 A;  1CUL B;  4O44 B;  4O3O A;  3T9N A;  5K5M A;  3CMQ A;  4USM A;  3PX0 A;  5ITH A;  4ZKA A;  2VQF F;  1L3S A;  3M6V A;  1VK8 A;  4Y2A A;  1D8Y A;  5H9E J;  2P9C A;  1SQG A;  5HJY A;  5HVH A;  2R2T A;  1VK3 A;  2VF3 A;  3TUZ C;  2E7V A;  1S7I A;  5G0R B;  1Q86 T;  4GO7 X;  3OTD A;  1XNQ F;  4CLU A;  4ZJO A;  4K4Y A;  1YJU A;  3QSY B;  2KFZ A;  3SEO A;  3L7U A;  1WEY A;  3PW0 A;  2NQP A;  4WK1 A;  4F3Q A;  1X4H A;  2YKO A;  3MED A;  3VAM A;  2DNM A;  1T03 A;  2R2R A;  5J2N A;  4IFY A;  4C2M A;  3NNC A;  4X4U A;  3D66 A;  5IT9 U;  4RUC A;  2F1F A;  1RT2 B;  3WQP A;  2ZJP Q;  4NMX A;  5JVH Q;  1AFI A;  3P8B B;  2W4C A;  2I38 A;  2E5G A;  2JRS A;  2DR6 A;  2IJR A;  2L3M A;  1SQF A;  4HI1 A;  2QMW A;  3HT0 A;  4NXN J;  4FF4 A;  3GJQ B;  1ARO P;  4K4V A;  1NDK A;  1SJ1 A;  2X3G A;  2KU7 A;  3DRX A;  3G86 A;  5KT7 A;  5HBM A;  3CC2 S;  1U1N A;  1GXL A;  1MMN A;  2VB6 A;  2ZBI A;  2V9K A;  3ZZ0 A;  3NCR A;  2COL A;  1S7H A;  4PCQ A;  4HT5 A;  1K44 A;  1WEL A;  2C3P A;  2CNO B;  3GYN A;  4RW6 A;  4RW7 A;  4CLT A;  5KFC A;  1WWH A;  2FHO B;  2GC8 A;  4Z2X A;  1GX6 A;  4ECX A;  2J6T A;  4IRD A;  1FJG J;  5B08 A;  4PAB A;  1X5T A;  3W63 A;  4G65 A;  3HFV A;  5DQI A;  4TQS A;  2CQH A;  2ROP A;  5IWA J;  1RTH A;  2Z2Z A;  4ED8 A;  4ECS A;  2ASL A;  2DRB A;  2HHP A;  3AJ2 A;  1HNI B;  3CCV S;  4ILR A;  3CCL S;  2LEC A;  4KGZ B;  2XY5 A;  2P9E A;  2YWF A;  1W7W A;  1S72 S;  3K8V A;  2BRK A;  1UEK A;  3A1Y G;  2V4R A;  1JLC B;  1YBU A;  4ETZ A;  4F7V A;  3TUI C;  4WP3 A;  3BSA A;  2E7X A;  3R5J B;  3RGI A;  3CCT A;  4RR5 A;  4C7Q A;  2QN6 B;  4DPO A;  2VDH A;  5C25 B;  4ZVS B;  2J5A A;  3N0V A;  1FDB A;  2RD5 C;  3ETM A;  2L9D A;  3LTO A;  2PMZ D;  4CIO A;  3FSI A;  1RTD B;  2CVE A;  5FII A;  1MSW D;  5HQ8 A;  2YX7 A;  3MR5 A;  5GAH I;  2FHK A;  4YB1 P;  4DPW A;  3PJW A;  2UUA F;  3KUG A;  4Q44 A;  4C6A A;  4ZJQ A;  2I1R A;  2L9N A;  3Q8V A;  3TA1 A;  1MWY A;  1GT8 A;  4UZC A;  2C22 A;  5J1N A;  2QC3 A;  1RT6 B;  2AGQ A;  2F9D A;  1IJF B;  3K5M A;  4E0D A;  4P73 A;  4F4K A;  2QA2 A; 
#chains in the Genus database with same CATH homology
 3B54 A;  1F6T A;  2DXD A;  3ZTP A;  1LEO A;  3G2X A;  4EK2 A;  3VGU A;  2AZ3 A;  5C7P A;  1NPK A;  3EIC A;  1ZS6 A;  3FBC A;  2DXF A;  1HIY A;  1S57 A;  2B8Q A;  3DKD A;  1NUE A;  3NGU A;  3Q89 A;  5BXI A;  1NLK L;  3VVU A;  3WX8 A;  4AND A;  3VGS A;  4UOF A;  2DY9 A;  4FKX A;  3FBF A;  3FCV A;  1NB2 A;  4WBF A;  3BBF A;  2BX6 A;  3MPD A;  1NCL A;  3GP9 A;  1PAE X;  1S59 A;  4ANC A;  1B99 A;  3ZTS A;  4S0M A;  3PJ9 A;  3Q8Y A;  3NGS A;  3VVT A;  4CP5 A;  3EVM A;  1WKL A;  1NHK L;  3BBC A;  4FKY A;  4UOH A;  3L7U A;  4F4A A;  3Q86 A;  1WKK A;  1MN7 A;  2VU5 A;  3EVW A;  1UCN A;  3EMT A;  4DZ6 A;  1BUX A;  1NSK L;  1VYA A;  4W98 A;  4HR2 A;  3ZTO A;  1XQI A;  2HVE A;  1S5Z A;  1WKJ A;  1HHQ A;  4DUT A;  3GPA A;  1LWX A;  1EHW A;  1NDK A;  3FCW A;  1NSQ A;  2HUR A;  2B8P A;  1NDP A;  3Q8U A;  1K44 A;  3BH6 B;  2DXE A;  4O0N A;  1B4S A;  3EE3 A;  3NGT A;  2DYA A;  4F36 A;  3PRV A;  1U8W A;  1BE4 A;  2NCK L;  3EJM A;  1HLW A;  3DDI A;  4ANE A;  2CWK A;  3BH7 B;  3R9L A;  1JXV A;  1MN9 A;  2HVD A;  1W7W A;  3EVO A;  1PKU A;  2ZUA A;  3VGV A;  5IOL A;  3ZTR A;  3BBB A;  5CAA A;  1NSP A;  3B6B A;  1XIQ A;  3FKB A;  3VGT A;  4UOG A;  3ETM A;  1BHN A;  3ZTQ A;  1F3F A;  3NGR A;  4ENO A;  2BEF A;  1NDC A;  4KPC A;  3ELH A;  1NDL A;  3JS9 A;  3Q83 A;  5CAB A;  4C6A A;  3FBE A;  3FBB A;  3Q8V A;  3FC9 A;  4DI6 A;  3EM1 A;  2AZ1 A;  1KDN A;  3ENA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...