4WBFA

Acinetobacter baumannii sdf ndk
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
140
Chain Sequence
EFMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Structural and Functional Characterization of Acinetobacter baumannii Nucleoside Diphosphate Kinase
doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 41
structure length 140
sequence length 140
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4wbfA00
2HVDA 3EJMA 5CABA 2DYAA 3FBFA 3NGRA 1WKJA 3FCVA 1NB2A 4DI6A 3BBBA 1NCLA 1JXVA 4ANEA 3PJ9A 3FKBA 1BUXA 1KDNA 1NDLA 3NGUA 2NCKL 3Q8VA 3ETMA 1NHKL 4KPCA 3B54A 4UOHA 3FC9A 1BE4A 3MPDA 1S59A 3L7UA 3VGTA 4O0NA 1WKLA 4F4AA 4ENOA 1ZS6A 3FBCA 1NDKA 1HHQA 3VGVA 1W7WA 1NPKA 4FKXA 3BBCA 3FBEA 1B4SA 3BH7B 3ZTRA 1K44A 1PAEX 3Q89A 3NGTA 2VU5A 1VYAA 1NSQA 2DXDA 1F6TA 2AZ3A 2BX6A 1F3FA 1WKKA 4DZ6A 2ZUAA 4FKYA 3EM1A 4ANCA 2B8QA 5BXIA 3BBFA 1NSKL 1S5ZA 3BH6B 3ZTSA 4HR2A 4F36A 1B99A 1XIQA 5C7PA 2HURA 3ENAA 1UCNA 3ZTOA 4UOGA 2HVEA 1PKUA 2B8PA 3VVTA 4EK2A 3VGSA 1BHNA 1LWXA 1XQIA 4ANDA 3FCWA 3GPAA 3Q83A 3DDIA 3EE3A 3G2XA 3EVMA 3EVOA 4S0MA 5CAAA 3WX8A 3B6BA 2DXEA 3JS9A 3VVUA 4DUTA 1EHWA 3R9LA 1U8WA 2BEFA 3VGUA 3PRVA 1NDCA 1LEOA 2AZ1A 1HLWA 3ELHA 1NUEA 4WBFA 1NLKL 5IOLA 1HIYA 1MN9A 4UOFA 4C6AA 3ZTPA 2DXFA 2DY9A 3GP9A 4W98A 3DKDA 3ZTQA 3EICA 3NGSA 3EVWA 3Q8UA 1NDPA 3FBBA 2CWKA 3EMTA 3Q8YA 4CP5A 1MN7A 3Q86A 1S57A 1NSPA
chains in the Genus database with same CATH superfamily
4KHPF 1F9FA 2RKIA 5IM0B 4CH0S 1MMDA 2MZJA 2CJBA 1R43A 2CPIA 4J7CA 2WONB 1O51A 2BMBA 1T9TA 2H48B 1DHMA 5LMUJ 2ZH9A 2C2ZB 5DQGA 5CZXA 2BX6A 3A13A 4DZ6A 3NMAA 2U1AA 3KMQA 4ZP7A 1VK8A 3PJXA 1Q86T 2FUG9 1PC4A 4G1QA 4NOHA 1XMOF 1U8SA 1V5IB 3JSMA 4IH7A 2LU1A 3US5A 3EGVA 1NXIA 1HWUA 2BM0A 2KKHA 4M5DA 3KK2B 4TU7A 3UD3P 2HHTA 1WC5A 4W98A 1D8YA 4JB8B 2M2BA 4MK8A 1ACMB 2DR6A 1PG5B 2JLGA 2DGQA 1WKJA 2G0JA 2BE9B 2KO1A 4IUFA 1XR7A 3R5DA 2MQOA 3HHKA 4RW6A 4EMDA 3MUMP 3L4BC 4ZJLA 4O0NA 5GMEA 4DV7F 4B9UA 3UCZP 4LSLA 2V4QA 4AUKA 1N8RT 4OHXA 2FZCB 1PAEX 3UI3A 3TX0A 3NL0A 4KQZA 3GQCA 4XAKA 4OHYA 2OPRB 3I82A 4Y3CA 4DV2F 3BO2A 2QE5A 1VI7A 2KN4A 3KK2A 3G87A 3NCQA 3IRXA 2LDIA 2LCWA 3K5OA 2R8HA 2IDEA 2XYHB 2NXNA 3VQSA 2MKHA 4OYZA 3K57A 2QA4G 4WK3A 2ZHBA 1KTQA 2BKPA 1JIHA 3IN5A 2L3MA 3D0GE 2HFVA 3QATA 5EWGA 2B6AB 3DM2B 2XWYA 1VBKA 2OPRA 4IR1A 1UETA 4C98A 4RW7A 1OY6A 2XMTA 1NDLA 2F40A 4RLEA 4OZ3A 2LXIA 2YKAA 3W9IA 1JXEA 4KSEB 2ATCB 2VV5A 4AL6A 2QLXA 2HS3A 3J80Y 3UDVA 2NR0A 4WYLA 1S4FA 2ZZNA 1NH8A 3PW5A 4AQYJ 3D6TB 1FO1A 3RB3A 1WI6A 1RE1B 2NPFA 4OYIA 1SIZA 1FDAA 2NUUG 2DR5A 1N88A 4WE1A 4N8OA 4U7UK 4A8YA 2H65B 4I56A 4DF8A 1L3TA 2XLKA 2HQCA 1BQMB 3M8RA 2JVOA 4NWBA 3OLAA 4LFBJ 3W3SA 3GPAA 4P2FA 2RAQA 1HNVB 4FBTA 1OYDA 4BC9A 4GC7A 5F3TA 3DOKB 3LPYA 1X9WA 4XPCA 2UUTA 4RW8B 4CO3A 2GCFA 3K2YA 2W01A 5KFDA 4ZA1A 4A8MP 2BE2A 1VRUB 1YRXA 1VS3A 2DY9A 1G7CB 4K50A 4JV5F 1OSDA 2XNRA 2DR7A 3NBPB 1PJ5A 4K8RA 1C1BB 3H2UB 1NK7A 2I0XA 3V4IB 4FZVA 2V68A 4RKUC 2GS8A 5JUMA 3I4PA 1EZZB 2A6OA 2NSCA 3HSJA 1RLDA 3J7A1 5KFGA 2NPIA 1UKUA 2KHDA 1YLXA 3N0VA 4U7UD 4CZCA 2F3JA 4ZVEA 5KFIA 3VGVA 4ECZA 4FNHA 1U2CA 2AW0A 3H40A 1HNVA 4QOTA 2L48A 4QQBA 1RUSA 3W5XA 3SEOA 1AZSB 4RW8A 1N6QB 3PO4A 2ZKTA 3MMAB 1NSKL 3HJFA 4LF4J 4ZVOB 4ECYA 2RD5C 2XCAA 4N8NA 2FJXA 4R8UA 4PXDA 1BHNA 1FRIA 1WF0A 4DL5A 4LF8F 2KRBA 3NBPA 6FDRA 2V4RA 3D1HA 3TUJC 4ZKAA 4F3MA 3DGVA 2N82B 2HVZA 5CYQB 4DN9A 1K0VA 3QRPA 2WOMB 4G6VB 3IS9B 3WDOA 2B9XA 3CWJA 3QRQA 2VJVA 4DV6J 5HQLA 3NXZA 3L95X 1LW0A 1RTHB 4YB7A 2VA2A 4ECSA 1S76D 4C8OA 1HR0F 4QR2A 3G6ES 1AROP 1AZSA 2Q43A 2CQ0A 2HQFA 3T5JA 3PM9A 4JI6J 2W7PA 3MR5A 3OTOF 3CD5A 4KE5A 1U4BA 1TVRA 3D6MB 3MOZA 4LR8A 3TEHB 2V5HG 2NXJA 1QD1A 1Q8KA 1S0VA 2CNKB 4DS5A 4USIA 2CVIA 3ZZPA 5K8MA 1U26A 2H54B 1RA6A 3IS9A 4MYUA 3C66A 1RTHA 1NKEA 2OTLS 2UZAA 2NXEA 2ZBCA 2VICA 3HVTA 1QTNB 4I7FB 4OI3A 5EDWA 2CKWA 4X4UA 3Q8UA 2OH2A 4TYBA 1XNRF 2QO3A 3W9JA 3T1YF 4WP9A 2UUWA 4I6AA 3ULHA 4USKA 4FYVB 2BDPA 2IRYA 3C15B 5D78A 3M8PB 1A9NB 3MHYA 3OPKA 2YQ1A 1JXLA 2C3YA 3NS7B 5JVGQ 4DPUA 2IHR1 2HAFA 2V34A 1F2HA 1ZM2A 3ET6B 2OHDA 4HTJA 2EXUA 2EVZA 1Q7LB 4HACB 4I69A 3FEXB 1TFWA 2IIHA 4MFBB 3KTQA 2ZZTA 1B99A 2DRBA 1ZETA 3CJ5A 3W5ZA 2PMHA 1N33J 5KG3A 2EC0A 5KFRA 2K7JA 2HW3A 5JJBA 1BC6A 2GVDB 3AOCA 4K4TA 2L9WA 4HH0A 1KVIA 3OTCA 2E5GA 5IV4A 1S77D 1RWPB 3ZZRA 2J9EA 3C15A 4MKVA 2COLA 3EPIA 3FJ2A 4FS1A 2CDQA 2R7SA 1RT7B 4M63A 4ZVPB 4DSEA 3ET6A 4Z7YA 5I3PA 5C2CA 2BRKA 4U67Q 2DGVA 3EJMA 4WIQA 1H74A 5LMUF 1NKBA 2XTJP 2PA8D 4DV3J 3LALA 2XBPA 3PX0A 1WG5A 1NM2A 3I5BA 4PXEA 2B51A 3DMJB 4RWWA 4DR4F 2IRXA 2OELA 1MWQA 3NEKA 2GVDA 4HHHA 4ELVA 4KKOB 4YR3A 1XTZA 4Y2KA 1QAXA 1IKWB 4B08A 5D3GB 4I6WA 3MEEB 1LW2A 3KHHA 2ZWOA 3HHEA 4CO4A 2B8PA 2PI4A 1Q79A 2QFIA 1RT7A 3BEGB 4EBEA 3GV7B 1SC3B 4YS2A 3HT0A 1CS4B 2Z8QA 1FD2A 3OJUA 4DL0C 3GIIA 2FVQA 3VAMA 1X31C 3UW1A 5L39A 3K5LA 1KWMA 3T1HJ 1B64A 2VASA 4AE5A 1S7HA 3DMJA 1VQPS 2CA9A 4CP5A 3CCES 1G3OA 1RYSA 3PIPQ 2LVWA 2HFOA 1R0AB 2B4UA 4KKOA 2CNOB 3EWGA 1BGXT 3CJTA 1OY8A 1ZZNA 5D3GA 1FNMA 4KPCA 3QWUA 2DNOA 5A8WB 3BDPA 3M2RA 3BS9A 2ZH7A 3BGRA 4OJ1A 4YY3J 5D0GA 2DXDA 4HDHA 2IA6A 2G9OA 5DETA 2QN6B 3A8EA 4G1PA 5LSOA 3HF5A 1Q8BA 1VQ4S 1X5PA 3ZTOA 1RABB 2HIYA 5E3CA 1NPRA 1WI8A 3QQCD 3VQTA 2IFXA 2J6UA 4ZCIA 4F3QA 3CCLS 1F5AA 1YJWS 2FLPA 4JP8A 2OFHX 4CYUA 2OPSA 1PYOB 2CNLB 2R9LA 2QG9B 3EZUA 1YBAA 3VZIA 5A8WA 2ABYA 5AT1B 2RRNA 1U1NA 2XO6A 1H73A 1I6JA 1MNEA 2VFTA 3MI7X 1XJWB 5H9EK 4L76A 1IWAA 3UN3A 2DNNA 3R5JB 3SSQA 4AQYF 4LMZA 1SKRA 3K58A 2XY5A 2CPEA 1S1TA 4X4NA 2UV8A 1KBRA 3M9MB 5J2QB 2ZE2B 2MQ8A 3N5FA 1DTQB 4DWIA 5HVHA 4LFBF 1D3WA 1OY9A 2N7CA 4NCAA 2VPWB 4OJ3A 3TAPA 4Y2CA 2E1AA 4OX7A 3OR1B 1QE1A 3OFEA 5L38A 2FZGB 3CCTA 4CLLA 4PZVA 1ZTWA 2AKWB 4CLYA 3MCSA 3NGDA 1WUUA 2VQFJ 4OZLA 3TRGA 5CD4H 4ECVA 4IQXA 2WBRA 1WF2A 1WELA 3PNIA 2DGOA 4UQGA 1OPIA 1JXVA 2CZ4A 4NLRA 1VQ7S 3D68A 3R3TA 1BE4A 2E5IA 5C24A 3L7UA 4LF4F 1UMJA 3HSGA 1RXOB 1ZPVA 4ECRA 1YSJA 1FJ7A 4KGKA 2MMYA 2B8QA 3G8TA 2VA3A 3SCIE 5J2PB 5KFTA 2B0GA 2G1HA 2HHSA 4PXCA 2FYXA 3G71S 4QU6A 1TELA 4DV6F 3MFIA 1N34J 4ZJOA 3C14B 1NJWA 1S1WB 3MEKA 3F73A 4TXSA 2B3TB 3GP9A 3GE9A 1KQSR 4KB7A 1YK9A 3D54A 1UJ6A 4RUAA 4CNZA 3SQOP 3BQ1A 1M0SA 4X4TA 2XZDB 2ZKUA 2OPQA 2ALZA 2HMIA 1P1TA 3D9BA 2A3JA 2QYGA 3S8SA 3ITHB 4F7VA 5AE2A 4NLPA 4UTGA 2WK4A 1SVDA 2C2KB 2EFPA 2BABA 2RQMA 2JWNA 2AJQA 5D6GA 3IM8A 4MKYA 1S1WA 2P5VA 1FK9A 2HPUA 1AYEA 3JTPA 3MMBB 1R8HA 3V81B 1Z1ZA 1JK9B 4U95A 4BS2A 4Q2MA 1JLCB 3TA1A 1SQFA 3BDEA 3UVJA 4YB5A 4AD6A 4B9NA 4LIWA 1FRHA 3BKTA 3GU0A 4LSNB 2EFQA 2C2MB 3RAMA 1ZTTA 3O8WA 2W4CA 2IM3A 1RAJA 1FJEB 3HHLD 1UA1A 2ZOGA 3J7YI 4UOFA 3PY8A 3ITHA 4KC5A 4Z7CA 1R8CA 2JEGA 3TZYA 4WFXA 1AA1B 4ES2A 4A47A 1GT8A 3I5AA 2VG7B 4D3GA 3DLGB 1JJ4A 3VR1A 2QSFA 2VOPA 1VC0A 3JTOA 4L73A 4PWDB 4DF4A 4CO0A 3PJ9A 4OZNA 5J1EB 1UW9A 1HYSA 4DLGA 4NMXA 3MMBA 4MIAA 3V81A 1JLCA 2DBBA 2MYFA 2C2NA 3N28A 1VC6A 4HI1A 2J0XA 1F3FA 2VOOA 2GGPB 3BB5A 1HNXJ 3GONA 3GIRA 2VFVA 3I9V9 1TKTA 2CQBA 2VG6B 3ENAA 3KOAA 2F5GA 3G4SS 5KFWA 4URQU 2L9NA 4F2SA 3PW4A 4PYAA 4KYZA 2VG7A 4ILMA 2W8KA 3DLGA 4ZVGA 1P27B 3QAEA 1QDUB 4UQTA 4DQPA 1Y7PA 4PWDA 1JWWA 2Y8WA 1HI8A 4IO9Q 4EGLA 2E7VA 3FSXA 3UO0A 1SL0A 2XGPA 1IBCB 2CJXB 5LSRA 4DV3F 1TUWA 4O4GB 3BR8A 3HULA 3GWCA 2N3OA 2QGFB 2Y1RI 4LF1A 2ZWPA 2XC9A 4USVA 4M5KA 1FFWB 3BGOP 2GGPA 1T11A 1Q4RA 3R2DJ 4GO7X 4F4ZA 4B9MA 3LANA 2PFDA 1FDNA 2LQJA 3SXLA 2QMXA 4OI6A 3M05A 2J8AA 1U1LA 2R7UA 2YPYA 4LF6J 1TKZA 2CPYA 4Q0BA 1FXDA 2UVUA 1GQEA 3FSIA 4DLEA 3VTIA 2OAUA 5KFBA 5IS2A 2R7TA 3T1HF 2FC9A 1X4EA 4WKYA 5KG0A 1YRTA 4P71A 3R1LA 3SSSA 4QCLA 1CJVA 2FVCA 4X62J 4FXWA 2OUGA 1KHWA 3PYEA 2UXDJ 1GMVA 3AB2B 4K5RA 4AL7A 2GFFA 3DRPB 4KFBA 2HFNA 3D66A 4YMEA 2M7SA 4DPTA 2Z56B 5LOQA 2K1RB 3F0NA 3NNAA 3HFVA 3QLHA 4FS2A 2QMWA 2ZBQA 1FTRA 4NLVA 4TNOA 4YY3F 1KC8T 2UVRA 1N56A 4BHQA 1RBLA 1S10A 3G96A 1FT8A 5L8RC 3ZZTA 3KK1A 4N47A 5HL7Q 1RJJA 1RWXB 3DLHA 1T8EA 1UVKA 5GAGI 1FEHA 4F02A 1B7FA 3KJVB 5F0UA 1SH0A 1Y5IB 3DRRB 4DV0J 2JSXA 1FJGJ 3MR3A 2MDAA 4JBCA 3LAKA 5JVHQ 5T14A 2ZNYA 2W24A 2Z2LA 4NLUA 3GG0A 2J8SA 3ICLA 3HHLC 3RYLA 2DXFA 3MM8B 1IWGA 1IKXB 2KJWA 5EX0A 2GIQA 3G9CA 2BKOA 3G8SA 5CCMA 1GAOA 1RWNB 2ROPA 2AD9A 2AIRB 5CABA 2JHEA 3SBMA 1NB2A 3MECB 4QIGA 1XBWA 4QYZJ 1RT6B 4MAKA 3KJVA 3DRRA 1X4GA 5DLGA 2VODA 1HHQA 1SI9A 1LFWA 4F0MA 1IM4A 1O6XA 2QLFB 2DNRA 3DOLB 3H5SA 1VYAA 4B3RJ 4KAIA 3KLEA 3EPGA 2BJ3A 2V0NA 2C3OA 3K5NA 5K14A 3MD3A 5GMDA 2HVEA 2V8DA 1JLFB 2VQFF 1ZYQA 2V69A 1GX6A 2K2PA 2FVRA 5B0DA 5IWAF 3DU6A 4JI4J 4CLFA 3PXGa 2DTJA 2DHHA 3MECA 1H3DA 2VPZB 1GXLA 4RO0A 5KT5A 1X60A 3QO9B 4ECTA 2E1RA 3UD4P 5ETTA 4ZVRB 5AXNA 3FRYA 3UCUP 3M8QA 1Q7YT 2MQNA 2ZD1B 1XMBA 3UD5A 3IBCB 1LNQA 3RBZA 5AXLA 4L75A 3CNQP 3TI0A 3W9HA 1IR1A 3OHAA 3HM9A 2CUYA 1JLFA 5F8JA 3RAQA 3D1OA 5D15A 2OPPB 1KQKA 1LK5A 3IRWP 2D9PA 3KLIA 3DLKA 5C5JA 5M2UA 1UZDA 4NYOA 4C8MA 3RB0A 4KH1B 3U1MA 5CYMB 4NLDA 4WP8A 1JLQB 1JLEB 1S48A 5M2RA 1QLNA 3CJ3A 4UY85 3NLCA 3MXHP 3BGLA 3KUEA 4UT4A 3QO9A 1TAQA 3IWNC 3E01B 4J9UE 1KTVA 4DBQA 3RGIA 2FHJA 3H0PA 3DDIA 4K2XA 2D3UA 2FIUA 4UUWA 1MU2B 2AJ4A 5ETPA 1M5KC 5B0GA 1YHQS 3MMCA 5EX3A 3R8YA 3DC2A 3BJYA 3TEGA 3IBFB 1A6LA 5HQ8A 3H7HB 1NDPA 2ASYA 4ZLJA 4F50A 4TN2A 5A6PA 3WX4A 1Y4ZB 1SKUB 2O3DA 4KH0B 3W64A 3G6YA 3FBFA 4OX9J 3CDEA 4GO5X 5CYMA 2ZOFA 4YR2A 3CCSS 5ETQA 2HNYB 1KVJA 3CJ2A 4DZDA 4DR3J 4B3OB 3PEHA 4B3TJ 2HZVA 3MM9B 2IYGA 5F8MA 1KQGB 2EEYA 4QWBA 2AZ3A 2O1PA 3T6JA 4LBHA 5MAOA 4Y2MA 3Q24A 1YJRA 5B08A 1UFKA 2R7OA 2ZEJA 4RNNA 2HURA 3CD0A 4OZ5A 2GVZA 5KFAA 4LFCJ 4ED2A 4YQWA 3R97A 3EE3A 1SKSA 3EVOA 3BGUA 3GTYX 3NNHA 2VDHA 1JKHB 4ZPAA 3CJ0A 3PG9A 2EC2A 4NI2B 1S1XA 2OP5A 4O44A 4FNIA 1D8ZA 5F9NA 1NLKL 1DLOB 1CLFA 1KN6A 4B3OA 5FDLA 3IWLA 3E2EA 4OJGA 3JXOA 1YKWA 4ES3A 1NPPA 5KG1A 4KTQA 1KQFB 1PYTA 3P5TL 3MM9A 4NYZA 1RAOA 2GA7A 3CT9A 1RHKB 2OO4A 4H4MA 3NGRA 4DX5A 5HATA 2HHHJ 1RDRA 4K59A 3GFYA 2R2RA 1HNXF 2ZM6J 4RPFA 2NSBA 1S97A 2BE7D 1RBAA 1WEZA 3AD8C 3R7NB 1C1CB 4RNOA 4FVMA 4MIWA 4OHVA 2DNHA 3VAJA 2P6TA 4ZJQA 4TVAB 3FFIA 1JKHA 1XR5A 3M6UA 4DR1J 2GNKA 1OJ4A 3CCQS 2AGPA 4DU7A 1MROB 4NI2A 4WXOA 4PG6A 1DLOA 1RBOB 5E3QA 3ZO7A 4Q7AA 3PYDA 2I8EA 3H2LA 3IMQJ 1H2VZ 1PAUB 3R5BA 1GMWD 1KOOA 1VHIA 3T3FA 1JJHA 5FLXY 3EXCX 2QL7B 1RT3B 4RU9A 2RHSB 3DHXA 1YITS 1IBKJ 3SFGA 3I56S 1LXJA 3WHIA 2X1GA 3N6MA 1XMQJ 2OEKA 4PEOA 2YWGA 3ZFVA 1S1VB 1LV5A 4C9DA 4LF6F 1MROA 1K1QA 3ISND 4F4YA 3QGIA 3Q22A 1WHVA 1SJFA 4OZ2A 4KO0A 2Z2YB 1D1UA 4X4PA 3Q89A 4FYDA 1RA7A 2WRMA 1D09B 2YKMB 2K06A 3MPVA 3CJKB 3BSNA 1XIQA 5KFUA 2R4FA 3L09A 1Q1KA 2JDJA 3THVA 1RT3A 2UXDF 3FDSA 3OTDA 2BQ3A 2FLLA 1LKZA 2XB2D 3LWLA 1GEHA 2CPHA 4X4SA 4V19J 1M5OC 2YVSA 3KUGA 2RB7A 5C25B 3RRGA 3UDEA 5KFNA 2N3LA 2QA2A 1LK7A 5F8IA 1B0PA 4HTIA 1WTBA 4B9TA 3OTEA 3KLVA 2HGNA 4DU8A 4OYPA 1M1HA 1JLBB 1AXQA 3DNCA 2J76E 1J5OB 2YKMA 1RYRA 4M5IA 2MQQA 3CJKA 3G82B 4DPYA 1S59A 2W2PP 2YKQA 1BWEA 2YNFB 3QYYA 3NRBA 1PYSB 4DV0F 1K44A 2DGXA 5DJBA 2MGZB 2UUBJ 2F63A 1WKKA 3FK4A 3RJMB 2MB0B 3E8OA 2HG4A 3B82A 1FRKA 4HR2A 4B02A 1VK3A 2B7CB 3AHPA 1NK8A 5DO2A 5AJ3J 2R8GA 2MZRA 3S7RA 1B0TA 3KLFB 1FEEA 2EG2A 1UZHA 2BZ2A 3NY0A 3NS5A 1K9MT 3EXYA 3IP0A 1B70B 3KLHB 2G0IA 2OGUA 3HKZD 2EFOA 4MKAA 3QGHA 4DDFA 3IAS9 2ZH8A 1NZ8A 5EWFA 1CULA 3CB4A 2ZVIA 1P1LA 4EU0A 5KFMA 4B3RF 1BUXA 2J7WA 2DEJA 2C1EB 4NXNJ 4C7QA 3MPDA 1Q5YA 5E2QA 4HT7A 3R1HA 5DDRC 4NEZA 1SJ1A 5RUBA 3T5LA 2X3DA 1NHUA 1EQMA 2W9AA 2PI5A 2XCPA 1Y3JA 2W4DA 2HHUA 1S7IA 1JLAB 2E7WA 2BKNA 1BLUA 2LA4A 4OZ1A 5KFFA 4Q2LA 4RZRA 5L1IA 4ZPVR 5GADU 2CQ2A 3VGUA 2YWEA 4JI8J 4K4YA 1S79A 1R27B 4OFZA 5EN1A 4OX8A 1MWZA 5HQMA 3L3CA 3BREA 1X0FA 3U7JA 4LRBA 2F4VJ 2M8DB 2E66A 4M5HA 3BKFA 4NE9C 3HXMA 2VBXA 1R31A 1S9EA 2LECA 5I42B 2EW9A 2HBYB 2LLZA 1QUPA 2LXFA 3HD2A 4FBUA 4OMFG 2QJ3A 3KLGA 1XNQJ 1FTCA 5HI7A 5DG9A 4ED3A 2E1CA 2FJVA 4I2QB 4XDCA 3PRBA 1JLAA 1GTEA 4USMA 5D4NA 3ISNC 1NPKA 2J9DA 3Q2SC 3NNCA 1QAYA 2CVEA 1YJTA 2XSJA 3ILIA 2C28A 4Q8FA 2R7XA 2N4CA 3OL9A 1KFDA 1FE4A 3RU0A 3CIZA 3J7AN 4WFNQ 4OHZA 5K8NA 3UNGC 3MM7A 4S0MA 5I42A 3X1LB 3OL6A 4Q43A 1EX8A 3UR3C 4O0IA 4WBFA 2B4PA 2I5JB 4OX9F 3IG1B 3TA0A 3OSPA 4CM2A 2VUGA 1GX5A 4ZVUB 1PO6A 4DR3F 2LDYA 3Q86A 3I0RB 1NU4A 1W2IA 3KYLA 4B3TF 2DISA 1RT5A 3HVWA 3LW5C 1HQUB 2B5JB 3CJSA 3Q8QB 4IOBA 3BBBA 1QVGR 1T9VA 2F9JA 1IJEB 5HLFA 5F9LA 2V8PA 1F0XA 2AQ4A 3B54A 3PTWA 3MPWA 1IBMJ 3QJLA 3GG1A 4IRCA 1IM6A 2ROGA 1NMEB 3ENQA 4K4UA 2KXHA 3M8WA 1NSQA 4LFCF 4ZS6A 3T9ZA 1FKPB 1U2RA 4DUZF 2Q66A 2NS1B 3C3LA 1PBUA 2KVIA 1FKOB 1R3NA 1VISA 4K4XA 5KFVA 2C22A 1RQ0A 5CH7B 2APOA 2FY8A 2PSZA 2D41A 3I0RA 1Y5LB 3O6QA 3N5BA 4I67A 2B5JA 1N36J 4JI5F 3F41A 1NJIT 1IN0A 3CDWA 2YNGA 1OIAA 4WJBA 2FVSA 3W2WA 3TX8A 4EO8A 2HHHF 2X1BA 5CD4A 2ZM6F 3LOUA 2IMOA 4KR0B 4NA1A 3AT1B 4L6V3 3JAMU 3T41A 1ZOTA 2QEXS 4LVNP 1V5VA 3M8SA 2NXCA 5B0FA 4OI1A 3HJVA 4DR1F 1RAIB 5HANA 2LFVA 4IQMA 4XIUA 4C2MA 1NO8A 4ZOSA 1X4DA 2H4WB 5KG2A 2UV8G 4X2BA 3AD7C 3RR7A 2M88A 5DZ6A 1FD8A 1HBNB 1X5TA 4ZITA 3M1VB 1XC9A 4JV1A 3KG0A 1GMUA 2KZZA 5F41A 1HQEB 4DN0A 1WC3A 1E6VB 3NG8A 2CJAA 1VBYA 1DBDA 3T6BA 1IBKF 3DGPB 4ZP6A 1X4HA 4ZPWR 1O0PA 2QTWA 2XG8A 2UVVA 4NLOA 1TMMA 3TANA 1XMQF 4H4KC 4PPZA 4USHA 4KPYA 2LYVA 3G6VA 4R0JA 3EVWA 5A0YB 1SJ3P 3BSAA 2XM3A 5E33A 2A6MA 4OYMA 3K5PA 1WJ9A 1Y0HA 2C2EA 4OI2A 4Y34A 4YUDA 4C8LA 4IDKB 2UXBJ 4QIWD 3DFEA 1HWKA 2OD6A 3M1VA 3TQ1A 4A48A 2E7XA 3V2UC 4NLWA 3GYGA 1JNRB 2J5AA 3SMZA 4L74A 4Y28C 3M7VA 4N76A 3DGPA 1S9GA 3SSRA 2W7OA 1KD1T 2H51B 4BBYA 1KHVA 2CPFA 1TKXB 2KL8A 1S0MA 5DS7A 2Q6BA 2I38A 4LF8J 2D74B 3M2VB 2HNDB 5A0YA 2BRLA 2BQRA 2Y0SD 4F2RA 4FPIA 1JLGB 2DY1A 5KFZA 5J2MB 2FJBB 1HL6A 4PWUA 2BVZA 2CZ9A 3HLUA 3LGHA 5H1SV 2AYMA 2C2RA 2ASDA 2ZZMA 1RWMB 3MCNA 2V4JA 1LWCA 4IO1A 3TUIC 1ZZFA 1XK8A 2HWHA 2DR9A 1Y5NB 4O23A 1WWHA 1TK5A 1KLNA 3LP1B 1WOOA 4DL4A 2UUBF 2EK6A 3CCZA 5T7LB 3CJ8A 2V6AA 1TKXA 5KT6A 2HNDA 3QWPA 5AJ3F 1X4CA 2N4DA 1JLGA 1F1BB 4U8YA 4RJVA 4C8YA 8RUCA 3L9ZA 3DLJA 4TQSA 1U0SA 2BV3A 2CPJA 2GV1A 1F5BA 1EJ7L 3CDAA 3HT3A 4P2XA 3TQEA 4R25A 4OX6A 2M0GB 3LP1A 1FNXH 2I2YA 2WW4A 1DFDA 4USJC 2BJDA 3DKDA 4XK8C 1YZ7A 3EICA 2CWKA 1B0VA 5B7WA 5LSLA 2LEAA 2B4VA 3VZHA 1B7YB 3GIKA 2UUAF 4K0KJ 4B3SJ 1T03B 2RKIB 2NXUA 4QJVA 2W2NP 4CDIA 5LXRA 4X4RA 2XNQA 4OYBA 3EX7B 3H25A 3K8VA 2YWHA 4M8LA 4OYXA 3GV5B 3NGTA 4PG5A 2GJIA 5G0RB 2AJ1A 5HMXA 4ZCKA 2RUSA 3DRSA 2GC8A 3GCWP 3UE2A 2ZBRA 1KR4A 2KXFA 2ILYA 1BQNB 4JI8F 4JI1F 2XLIA 3HFZB 3KHRA 4CLZA 1R0BG 1SBRA 2FGOA 1RT1A 2WB1D 2Z57B 1T03A 2B7BB 5BYRA 5D0HA 7AT1B 4Y2IA 2XI3A 2HRYA 4W90B 3ZZ0A 4DX8H 4M5DB 1HMVA 1XNQF 4IH6A 1RTDB 4AFFA 2ZUGA 4N7TA 3PRDA 3RBEA 2X1FA 2J7KA 4DCPB 4YB1P 4DR2J 2D7SA 1PGZA 3OUYA 4DV4J 5G0RA 4EWTA 3AJ2A 4F04B 4Y6IA 2Y9HA 5LXYA 2KG1A 5BYQA 2R2UA 5KG4A 4RR5A 1QSYA 3HCXA 1H2UX 2V9WA 2XSFA 2ASLA 1CVJA 4I4BA 1X0PA 4RW6B 2VQEJ 2Z2ZA 1JB0C 1BQNA 2YKOA 2AV5A 4DR4J 4LSLB 1IVZA 4OZ0A 2QLJB 3QT6A 2BW2A 3MOJB 4DPXA 1FRLA 4NA2A 2XMKA 2DHAA 1I51B 2J0WA 1FJCA 4X66J 3VGSA 3BSOA 3AJ1A 2CAJA 3TOQA 1RTDA 1Q8IA 4ED4A 1UA0A 9ATCB 1UEUA 2XY6A 3IRXB 1VLYA 5D0RA 2RVJA 2YQ3A 1JJCB 3U02A 5A2QY 1X9MA 2FD2A 1AUSL 1HHSA 4CLSA 4M5LA 1HIYA 2HBQB 2LQ5A 2FLOA 3MFHA 2PMWA 2BA9A 3J80U 2RDDA 2XZTB 1IBMF 5EWEA 1RACB 1IKYA 1I94J 1FERA 2GQQA 2C2DA 4ECUA 1FX2A 5LL6d 4RNHA 3CEDA 3K89A 3TZZA 2CPDA 1K73T 1B3TA 2IJRA 2ZH2A 3CCJS 4RW7B 4WCEQ 4NX9A 1V3RA 1OYEA 4ENOA 2HS0A 3DI6B 3MM6A 4PAAA 3THPA 2HFSA 3PYFA 2B43A 4K7QA 2PEBA 2ASJA 2ERRA 3BF4A 5KFKA 1SV5A 4EBCA 3OVAA 3A8IA 2YWWA 2XS2A 1N36F 1VBXA 4DSIA 1HI1A 2E29A 4WE1B 4X4QA 2AYBA 3LP0B 4DPWA 1DQAA 3HHLA 1RTZA 2V8VA 3GSDA 4DS4A 5FJ4A 1IUJA 2XGQA 1VQLS 1WHYA 4MKBA 1T9WA 4DUTA 2ACYA 2BEFA 4MH8A 3SZ2A 5DQIA 4ITSA 4JI2J 2CQHA 3EZOA 2BE2B 3DI6A 5B09A 2UU9J 4B17A 3R7SB 1U7LA 2M3DA 1NJXA 2WSFC 5L9NA 1YJUA 2R2TA 9RUBA 2BANA 3HFKA 3ILJA 1ELOA 2AF6A 4CLUA 2W2MP 4OYWA 3LP0A 3GYNA 1IR2A 3FMBA 2HHVA 2DNMA 2V63A 4ID8A 3M8YA 4ICLB 4ZK7M 1YBUA 1H0HB 4JV2A 4HT5A 3CJQA 4LRDA 2OFGX 4O4RA 3EGWB 2XULA 2RMLA 4R8UB 4JI7J 4DJBA 2UP1A 4ILLA 2DH7A 4LFAJ 1Y3KA 4C11A 2M8HA 3J81U 2Z58B 1U8WA 5J2NA 5HP1B 2Y1JA 3LGMA 2BBEA 4UUXA 4J37A 2KXNB 2UXBF 1VC5A 2DHXA 4F0KA 1R8PA 4I2PA 4C3MA 1LW0B 4TU8A 3QJPA 2MKKA 3RAXA 4LR9A 3IR7B 4J9RA 4FVCA 2AGOA 4ICLA 4DR5J 5KFQA 3I32A 2MTLA 1P9QC 2QSWA 2UUCJ 2IJFA 2NLWA 3AFGA 4QWEA 2IM0A 4OV1A 2BYCA 2J9DE 4PUOB 4FPRA 3HP6A 2MQLA 3ZTRA 1TVRB 1J5EJ 3RW7A 2FZKB 3D0HE 5F0WA 1SC4B 5HJYA 2VBWA 3OHBA 3CPWR 5HP1A 2AJFE 3E3XA 5A76A 4O3OA 1N5YB 1YTYA 2V67A 1RTJB 4ECWA 4PXBA 3W7BA 2AEMA 2GHWA 2YNIB 4DCJB 2RDIA 2XYPB 4N56A 3KJNB 4QR1A 1M5HA 2HQ3A 1HLWA 3A12A 3J81Y 4MK7A 1TKDA 2K7KA 3HVTB 3T9NA 1KLMA 5F8HA 1EETB 3M30A 2G2YA 2RJZA 1U48A 2QIFA 1ZA1B 1WEYA 3GR0A 3B4MA 4LF2A 4PUOA 2KHCA 4BC7A 5MLCV 1S57A 5GAEU 2DYAA 5E7OB 1R8AA 3W5YA 4I6YA 3H5YA 4U8VA 1N5YA 3D1QA 2OEJA 1RTJA 2OD4A 2KJVA 4DSJA 1NDKA 3TAMA 3Q8RB 1W7WA 1H72C 3ETOA 3NWGA 2YNIA 3C19A 4U96A 1HW8A 1BD6A 1WDTA 5F8GA 2MHNA 2BM1A 3OT9A 3PIOQ 1FI4A 1U25A 5BXIA 2JFDA 3O44A 4FXDA 1FESA 1IXKA 1EETA 4QW9A 3H98A 2D3O1 1WC4A 3Q83A 2ZOMA 1E6YA 4AT1B 2C42A 1T0TV 3BZQA 1L3UA 3MEGA 1VGYA 4ID5A 4PQUB 1WACA 3QFHA 3FQLA 2FVPA 4K0KF 2IMWP 4B3SF 4A8SA 3QPIA 1ZAXA 5KOXA 3UNYA 4EBDA 1UVJA 2E9TA 4NA3A 1XN9A 2JEIA 4P7TA 2DNYA 4I1TA 4RW9B 2DD8S 1CJTA 1L3KA 2V50A 1YZ6A 2V9KA 1QTMA 1T94A 2HQDA 3PVXA 1MMNA 3RBDA 3M6XA 3RRKA 1RWVB 3MAAA 5IC6B 3QZ7A 3S6EA 3OL8A 1YQHA 3DYAB 2JX2A 2J6SA 1JNZB 3CMQA 4RW4A 3MDFA 1FRJA 3ENVA 3P45B 1WG4A 2Y0BB 3JQKA 4PQUA 3TW0A 2DPJA 4OQJA 3HK2A 1LW2B 2AX0A 4A8KA 3ONQA 2V2VA 3PX4A 5GAHU 1HNIB 1TU0B 5IC4B 3C16A 4RU2A 1REVA 3EDQB 2M52A 4RW9A 4HYKA 4DR2F 4DFJA 2MLXA 4DV4F 4IG0B 3GSIA 1VRQC 1H6KX 3BYRA 2KFYA 2E5LJ 2AMCB 2IY5B 3S1TA 2VQEF 3PV8A 3DYAA 2C3PA 5DRKA 2DH9A 4PABA 1UFLA 1WOSA 3V6DB 1GNKA 1Z2LA 1RCXB 3OR2A 4WK1A 3CTRA 3IA0A 3M2RB 1HKAA 4FF3A 4X66F 3BGRB 2PMZD 1U0HA 1VQOS 1HNIA 3KUHA 2F7VA 2H4YB 4J9QA 5DM6Q 4IG0A 3UCGA 4DCOB 3QSYB 2CQ3A 4EZ6A 1U6FA 3BR9A 2JL9A 2XO7A 1Q8LA 3PX6A 3WX8A 2DT9A 1TL1B 4ZLLA 4X64J 3HSZA 1FFSB 4NMLA 1HWLA 3HSDA 2AHOB 1I94F 4CYUB 2XHCA 3V6DA 5D0EA 2OPSB 3TO8A 3GV8B 2MKSA 2BJ9A 2HLTA 2KT2A 3TZWA 3AQOA 1FVSA 4ZN3A 1FXRA 1EP4B 2RS8A 4O3QA 1M5PC 1LWEB 3KK3A 4CH1A 2DEIA 3FCVA 4HEA9 3SIPB 2ZH3A 1H7WA 2PT0A 5F8NA 3RR8A 1M1GA 3MR6A 2V8HA 3C6TB 5I3UA 3D5MA 1FRMA 1S1TB 3I4HX 1U1KA 4ZPBA 3N9UC 4DHVA 1TL1A 2Z4PA 2MEWA 5I3QA 1U49A 4P9SA 1VJWA 5GADI 5LT5A 4J9PA 3M6WA 3FMWA 1PKUA 1S99A 1QE1B 3R5AA 4P72A 3A8JA 1NJZA 3ZXWA 3CD6S 4F3OA 2KFNA 1N54B 3PW2A 1RAAB 4JI2F 5ETRA 4J90A 2P2CB 5KT2A 1EP4A 4ED0A 1LWEA 4CLTA 4WP3A 2UU9F 3H4DA 5DM7Q 1NK0A 5GMKa 4YDDB 2J0QD 3BQ2A 5IV3A 4GVBA 3C6TA 1Q95G 1LQ9A 1JQGA 2CG4A 2H5JB 3DLLQ 4DPOA 4G3IA 3BKUA 1VBZA 2IRUA 1UL3A 5U47A 2H5IB 1T05A 5B0CA 3JYTA 3FKBA 3E51A 2W9BB 1RT2B 2JLEA 3VGTA 4IH5A 2DNPA 1WKLA 3OFGA 1TL3B 5C24B 3KNGA 4YEAA 2QZ8A 3CDUA 1WG1A 4NCGA 2HWTA 2WAQD 3SV3A 2G1DA 4NZ0A 2R42A 4JI7F 4IRKA 1FCAA 4LSZB 1VRTA 1VQ9S 4LFAF 2AGQA 1GMWA 1FWKA 4TLRA 3LQVA 5K8PA 4Q5VA 5AE1A 3IR5B 2AYEA 4ECQA 2L41A 3W60A 1MLAA 5IWAJ 5IXUA 3OXGA 2LA6A 4NL5A 4RUHA 1HW9A 4HHUA 4TLQA 4J91A 4QWCA 1EARA 4WFZA 2RQCA 2HFZA 5K20B 1NDCA 1TAUA 4C8ZA 4DL2A 1SUQB 1I3OB 2CJ9A 2RRBA 2W9BA 1RT2A 3LPEA 4DR5F 3KJQB 1TL3A 3NAHA 3I0SA 4C48A 2CYYA 2UUCF 4D3HA 3PW0A 2Q1LA 3EDRB 2H3EB 2JFKA 2C2OB 1YX2A 3C6UB 5DLFA 3ZZUA 1CG2A 1J5EF 2BJ7A 3AJDA 2OPQB 4WF9Q 2HMIB 4RBTA 1AFJA 4KGVB 3FZBA 1TK0A 3BBCA 3L7OA 4QZVB 5A8KB 4GMKA 2RS2A 1DURA 4URSA 1N5QA 3HDSA 3BQ0A 1BXNA 1SUQA 1EKRA 4WFBQ 3V4MA 5KFLA 1H38A 1F9HA 1FK9B 2F9DA 4J9KA 5LMNJ 4U6PA 2A10A 4WZQA 3SV4A 1AW0A 2CJQA 2YX4A 2BW7A 3FVYA 1DTTB 3M6VA 3UVJB 1OWXA 1QSLA 1U2FA 3C6UA 2AZ1A 1Q0NA 4CT8A 3DLEB 5L1KA 5CCLA 4GKJJ 1DQ9A 2XMWA 2MQMA 4LF7F 2EBEA 4LR7A 2B56A 1UTAA 4NLTA 3VHQA 3M8ZA 2BUNA 4W4MA 3I55S 5D4OA 4JOUA 5A8KA 4ZHRA 1P8GA 4M95A 4DSKA 1RWKB 3IWXA 5ETMA 3C46A 2AEFA 1D9AA 3VAIA 1HYSB 3I31A 1FHTA 3BV8A 4GC6A 3BN4A 1RU2A 2M70A 4WU3A 1U1PA 1WF1A 1DTTA 1S49A 4USUA 3TYTA 2RF2A 1UW4A 4YFUA 1R6YA 1IQTA 3DOMB 1T02A 1X4FA 3DLEA 3FZ2A 2KM8B 3OXFA 1TKTB 1T3OA 3FNNA 3NCPA 4FYYB 2XS7A 5D8HB 2A0FB 1RHMB 1UWBB 2W9CB 1YJVA 3BPDA 4TQRA 1QVFR 5A8RB 4JUZA 3R9LA 3I9ZA 2YH1A 5D77A 3WC0A 3VCDA 4X84A 1MN7A 3IGVA 5CA5A 2HHQA 4KHMA 5IM0A 1TQLA 1YWXA 3NCRA 3CC2S 1CC8A 2CZVC 2WONA 4ZP9A 4J9MA 3DOMA 3J81j 3WQPA 5IT9U 3KG1A 1G4CA 2HEKA 4I64A 3U1NA 4JI0J 1N5TA 2DNGA 3WIVA 3AB4B 1UWBA 2W9CA 2CPZA 2MY7A 4H54A 3KMSA 5B0BA 5A8RA 4OV6A 1TKZB 2CWXA 4OL8A 1S5ZA 4Q0BB 4NLYA 2WVBA 4RX6A 3FEYB 1UCNA 2WW8A 3S01A 3GFZA 3CCWA 3VV2B 4OHWA 1YIJS 4CLWA 4H4KA 3AXMA 1SL1A 4ANDA 1NEEA 1LOUA 4CQ1A 3BO4A 2OIHA 5J1PA 4LQ9A 2E5LF 1WNEA 1CJVB 2RU9A 4LRFA 3CXCR 2FJAB 4HL9A 2JOQA 1UFWA 4KFBB 1N32J 1U47A 5ETNA 2K8GA 2HLUA 4X4VA 2MZ1A 5KFCA 4PG4A 4C0BA 4V1Ak 2DCUB 1KKHA 1U09A 2ILZA 1YGYA 2PE8A 2GAGC 3QLHB 3Q8PB 2GO8A 4J9OA 4YN3B 2HBZB 1R0CB 2G0CA 2NCKL 5ITHA 1C4AA 1IBLJ 5IT9Y 2R8JA 5KG5A 2LKZA 4ED1A 2O67A 1B4SA 4OI4A 3HMJG 3QGPA 5KFYA 3KK1B 4ERDA 2WB4A 2FJEB 4X64F 1ZAWA 2IBKA 3P5BP 3QZ8A 3W66A 2E9ZA 3F56A 4ECXA 3CD7A 2Q79A 4OI0A 5CYJA 3GIJA 2XHWA 2WSEC 2IM2A 1URNA 1RHQB 1RHRB 3AOBA 3R2CJ 1KOHA 3BSCA 4DFKA 4LRCA 5D4PA 3TP2A 2IVYA 2ZC3A 5HJXA 4IKAA 3BO3A 4CH7A 1DAXA 2ATLA 5HMYA 2CQCA 2WVCA 1V6HA 1QM9A 2WVEA 2VC1A 2P8IA 1VCTA 2B6AA 3DM2A 3SDEB 1PIEA 2JLFA 2QMUB 1R7IA 4QYRA 1CBKA 2HHXA 2GZOA 3LA0A 2DNLA 1TTHB 4AL5A 3HD1A 2Z0GA 3I6PA 4JYAF 3CSKA 4NLQA 4PG8A 2B4OA 2MKCA 2V2ZA 2YX1A 3U27A 2A2CA 1ZH5A 1HNWJ 3KLEB 4QR0A 5ETSA 2J0SD 1SXLA 3Q2TC 1VQMS 5K14B 1BQMA 4MJKA 3OW2R 3VVTA 4P6QA 3JSRA 1TMJA 3SDEA 1RISA 3R6GB 3DOKA 4FYWB 2VFSA 4F26A 2RU3A 3ZNJ1 4IR9A 2ZH5A 1WD6A 1VRUA 1YJNS 1UVIA 4KGXB 3PKMA 4DXLA 1C1BA 3V4IA 4WXWA 3M8QB 4EFAC 4CLKA 4ZVFA 1OSCA 4F8RA 2IBOA 2CDRB 4MIBA 2LQ8A 2WVDA 2FB0A 5EHHA 3H42A 4ED5A 2R8KA 3Q8VA 4YHHJ 3GZ7A 4IFYB 4ZPDA 1Y00A 4K4SA 3CW2C 3MM5B 2AT1B 2CNNB 3KLIB 5C2GA 3DLKB 4HKQA 3T5HA 3ZZOA 1N6QA 3MMAA 2CQIA 2XWXA 2YKNB 2CG8A 2FPHX 3W1YC 3W65A 4XDDA 5C7PA 1HA1A 5J1NA 2KVQE 2YNHB 3J7Z5 3VAGA 1KEKA 3LGNA 3O5TB 3DU5A 5CYQA 5HROB 3CJ4A 3B6BA 2CADA 3QSIA 1OO0B 2E1MC 4GRSA 2Y1LB 2WOMA 4DSLA 2ALYB 4ZLPA 3AQPA 1EQ0A 3MMCB 4ZCLA 2CQ1A 3HHDA 1DRZA 5E0OA 2H1YA 4C6AA 4M5MA 1Y9OA 4IFYA 4M5GA 1RKIA 3ZTQA 5F8LA 2P6SA 2XZWA 2GMJA 5KFPA 1S12A 3MM5A 1U45A 3M32B 2H5EA 4DI6A 3M2UB 2YKNA 4OYAA 3DRYA 3ADAC 1UJ4A 5E3AA 3SFUA 2HHPA 4X4OA 3MGJA 3OQ2A 2YNHA 2RQKA 2AJ2A 2A18A 3UWTA 2V2KA 2KU7A 3NMRA 5LMNF 5HROA 1RT4B 1PC5A 1F2GA 3GFHA 1TV6B 3GJSB 2A1BA 4EUVA 4WU2A 1TFYA 4QPXA 2HGMA 2HRTA 2YBVA 1XR6A 2JC0A 4K4ZA 5DDOC 1XEZA 3MR2A 3UQSA 2GVZB 4GKJF 1BWVA 1M5VC 1VHFA 3PCOB 4UZCA 1CPZA 4JI3J 1VOMA 3M32A 4PRFA 2EFVA 1KSPA 1S0NA 3BN7A 3M2UA 4I7FA 1M5SA 5KT7A 1DARA 1S1XB 4O44B 3PZPA 3EZ5A 2V8GA 2ZH1A 2ZBPA 2O5DA 5FDLB 2NREA 1T7PA 3K59A 2D1CA 4CCHA 2G4BA 1PBAA 4TY9A 4CO1A 1RT4A 3M8PA 2MZTA 4H4MB 1TV6A 1D9DA 3ENWA 3NGUA 3TUPA 1P6TA 4CTAB 3O1LA 4HACA 3SCKE 2JNJA 3X3UA 2YWKA 4MFBA 1HWJA 3NGKA 2XMUA 4DUZJ 2M9KA 3FFIB 1N0UA 4F36A 5FLXU 4BDPA 3PACA 2RHQB 1X4BA 3ILLA 2X3GA 1K0TA 1VQ6S 3D3CJ 3QBCA 3WIUA 2Q3PA 3PHEA 5KFSA 4V19X 3TVZA 4JI5J 2B9YA 1VQ8S 3MEDB 5CZVA 3MAHA 5IT0A 2OSRA 1LXNA 4O3NA 3NAIA 2K3KA 2E5JA 4CTAA 4U7CA 1T95A 2NZ4A 2DH8A 2PN6A 4JI0F 3GR1A 3QT5A 3U1LA 2KT5A 3TWZA 3W8GA 4P74A 4IG3B 1I1GA 1RCOB 2DNKA 4HI2A 4Q45A 2LQBA 4EYHB 4FN5A 1BY9A 4KO0B 2QLWA 2O01C 3R7BB 2BJ8A 3P96A 2DPIA 1IKWA 1D0EA 1MW7A 3MEEA 3OL7A 3MEDA 2ZHAA 4UF4A 4LBIA 1NZAA 1HD0A 1CS4A 3FRZA 2MZSA 4RUCA 1KONA 3T1AA 5HMZA 1X4AA 4R0EA 1N32F 1C0TB 3GFXA 2EFNA 3TNVA 3PRVA 5GAEI 2DGSA 2AWZA 1UAWA 5LM7E 1K1SA 3UN5A 4IG3A 1QSSA 2DGUA 4DX6A 1GH8A 2MHEA 1IBLF 1MSWD 1R0AA 2CFXA 1JJ2R 1ULRA 1V3ZA 3NWRA 1VMBA 4TU9A 3VAFA 2VJUA 4USWA 5G4DA 5KFHA 2KI2A 1G2EA 3PFEA 2GJFA 2CQGA 1RHJB 3JTNA 1R8BA 4YR0A 4F4WA 4C97A 2VBYA 2HKEA 4O3RA 1C0TA 2CPXA 1UVLA 4DR6J 3D7SB 3UFCX 3FEZA 1MG7A 3UDLA 1WORA 4KGZB 4F67A 5KG7A 2EBGA 4ZVTB 1SH2A 4L3NA 2HIQA 4LREA 2YWFA 2HNZB 5K8OA 2XLJA 5KT4A 2PEHA 1O8BA 4NEYA 1LEOA 1GXUA 1WDDA 3P49B 3FSYA 1EIYB 5AXMA 4DL6A 1N5SA 3EGZA 3CC4S 2ZITA 1SJRA 2R8IA 4HHJA 1OQ3A 2X1AA 3EMTA 2ZNZA 3N6LA 3CCVS 4B9VA 4CM0A 1Z2ZA 2IVMA 5D4LA 2AEJA 2F1FA 2WSCC 2XYGB 5M2PA 4ED7A 1CULB 4B3MJ 3RZAA 1HNWF 1NB7A 3HHNB 5HVFA 5J2QA 3V5RA 3JB9k 1G6BA 2ZE2A 2G2ZA 1DTQA 4QIEA 2QLBB 5DQHA 2HNZA 1F9EB 3H59A 2KT3A 3OR1A 1RAGB 5GAHI 1FRXA 1R6VA 3CCRS 3J7ZT 4LBPA 4OLOA 1R89A 1ZPWX 3CDBA 2LXUA 3G2XA 1VR6A 2W1BA 1U1MA 1V9OA 2MY8A 5H9FJ 1NK9A 3D0IE 1W2BR 2QA4S 2JC1A 4L72B 6FD1A 1QJHA 4WTYA 4YHHF 4KV8B 2ROEA 2UUAJ 4FXVA 1SC6A 5DG7A 1HNZJ 1S9EB 2HK2A 2QFJA 2A2DA 3CE8A 4YOEA 1FX4A 2IDLA 3UR0A 2G2OA 4RNMA 3CC7S 3KLGB 3ETMA 3RW6A 4A8WA 3B4DA 4KGMA 4JI6F 4HH1A 2R7WA 2F8MA 1AT1B 1RWWB 4LF9J 3PKYA 1QAIA 2FQQB 3H8YA 1U1QA 2W4PA 5J2PA 5SUHA 1NSAA 1SJ4P 1I5OB 2XSJB 1VJQA 4JI1J 3DXSX 1YDLA 1D9FA 3FGVA 4KV8A 3P3DA 3C14A 3H20A 5CAAA 3MM7B 5BJRA 2XMJA 1RADB 5CHCB 4XTTA 2PO4A 3N4WA 3MZIA 2GW8A 1W26A 5DDPC 3DXBA 2CIMA 5DDQC 2VFRA 1C4CA 3TUZC 3OVSA 2GJ2A 1G1XA 2GQCA 2ZHOA 1UJ5A 4HDGA 2ACMA 3A3PB 1M90T 3WC2A 4FF2A 2RNEA 4XPEA 5SZTA 4PKDB 4IRDA 1RT5B 1P9YA 2QL5B 3MURP 3UDCA 1YRUA 3BYPA 1J27A 1FWLA 1UEVA 4P2MA 4ZPCA 2MKIA 4ZCMA 5HLFB 3AH6A 4ATNA 1VQYA 4F4XA 2NYHA 4J5OA 4CT9A 5AXKA 1HFEL 5CQGA 1S6PB 3I87A 3MTKA 2VU5A 2ZDPA 2HZCA 5K9FA 5E3PA 3D4JA 1YG0A 2V94A 1SB6A 4M94A 1NBEB 4JI3F 4QIVA 3A8KA 3RUBL 2VBZA 2RILA 1NHVA 5I4MA 1VQKS 3OSNA 1N33F 3R5CA 1LWXA 3HX9A 4F4KA 4OYOA 2MLYA 4LSNA 5IQ6A 1UVNA 2VG5B 2BOPA 4P10A 2I1RA 1S6OA 4W92B 3G6XA 4J9SA 3CGIA 2FY1A 2YNGB 4F0HA 3IM9A 1NNDA 2YPZA 3W2WB 4J9VA 1WOPA 4MT1A 1Q78A 1RZMA 3T19A 2CQ4A 4PG7A 1S0OA 1S6PA 1SCJB 1HD1A 3M9NB 4PR6A 5HMWA 4Y2AA 1ZBTA 5J1EA 2Y1IA 1BMQB 2RRAA 2Y8YA 1FXLA 4KIAA 4L3KA 3VWSA 2AU0A 3LWMA 4ZVHA 1HWIA 1GTHA 2R7VA 1CQNA 4C3LA 5F3ZA 4ZIWA 3MF5A 2YTCA 3OVBA 4BWJA 2VG5A 2VG6A 5KTQA 2KYZA 3HI9A 1RWOB 3H5UA 4I68A 2MJUA 2GMHA 2IAJB 4DV5J 4C0OC 5IZHA 1U02A 1NJYA 1UPPA 3ZZZA 4WKRA 2E1PA 3MWBA 2GIRA 1KS2A 2HK3A 1DY3A 2X7IA 2BJEA 1GFWB 1YJ7A 3P6YC 3ELHA 2Y3YA 2FC8A 3PR5B 3LP2B 4ZVQB 2ADCA 1OPZA 3Q23A 4E0DA 4O4GA 2GQ2A 4G65A 4OLPA 3RG6A 4CO5A 4C0HA 4BLGA 4DV1J 2OI2A 3D28A 2RT3A 2HRUA 4X65J 1Q82T 5THWA 1SH3A 4QBUA 2F65A 2XEXA 3OBIA 5KT3A 4WIIA 3ISZA 1LWFB 8AT1B 2W25A 2UXCJ 1NK5A 1ZA2B 2HZAA 5AE3A 2IAJA 3SQGB 4ZLNA 4NPOA 2U2FA 3K17A 3QGGA 4TYAA 4ANCA 2HAIA 1S9GB 3LP2A 4ES1A 2VKRA 4NCBA 1A7GE 2HWIA 4F25A 1H98A 1H2TZ 3VVUA 5L46A 3DRPA 1NUEA 1LWFA 2VPXB 4IOCQ 2K1RA 5BR8J 2V4JB 2FGCA 1LWCB 2OLWA 2FHKA 3SQGA 1SC1B 1NSPA 1K47A 4LUBA 4C4WA 3KHGA 1VFJA 3MPUB 1S1UB 1UVMA 3CF5Q 4DR6F 1QAJA 1UPMB 4OZJA 1RAFB 4QPTA 2B9WA 3RRHA 1RAEB 1C0UB 2D9OA 3OFFA 1HBMB 4GKKJ 3V6JA 2X51A 4EEYA 3N01A 4LF5J 3OLBA 3GB0A 1S72S 1WSRA 3DN9A 2LQ9A 4C8NA 2ZH6A 1FVQA 4NXMJ 2ZVSA 2XY7A 4BCAA 4ELTA 4IOAQ 2LMIA 3H4BA 1ZAVA 1PJ7A 3CVKA 2DXEA 2YY3A 2ZJPQ 4P52A 4DUYJ 5HVGA 4NLGA 4PWWA 1S1UA 1MMLA 2FHOB 3MM8A 1IKXA 2W2OP 3W62A 2SXLA 4B3MF 1C0UA 4CIOA 2QYCA 1HBMA 5DG8A 4JV0A 2FDNA 3LH2S 2NUHA 3WZ0A 4KT0C 4KHRA 4B9LA 2WHOA 1GK8A 3CMAS 4YDXA 3TJ8A 1K8AT 1Y10A 3MAQA 3IGNA 1RT6A 3HZGA 4LRAA 3KHLA 1CJUB 1IKVB 3FC9A 1BQXA 2LP4A 1NRKA 4LIRA 4ILRA 3DOLA 2JZ5A 2E5HA 5FIIA 1SQEA 2WZ1A 1F60B 1X9SA 4RL1A 3TARA 3ZC4A 3G8QA 2BJ1A 2VH7A 1X5OA 3DRSB 3SCJE 1FWPA 1SQGA 3KWMA 2R3VA 1N0VC 5BYSA 3PFOA 1N34F 3JS9A 2YH0A 3THTA 4I0WA 2DRAA 1RT1B 3MPYA 1HNZF 1UEKA 2V2QA 1C2PA 3TVKA 1S9FA 2LU2A 2ZBIA 1CJUA 3IC1A 1IKVA 2GMLA 3VAHA 2LEBA 1HMVB 2QC3A 1Z4UA 3Q8YA 2ZD1A 4J9NA 4WZMA 2HSEB 6AT1B 3CO0P 2NYIA 3F44A 2MKYA 4CNYA 3OUYB 4ELUA 1RAHB 2WVFA 4LF9F 3PEJA 2ZJRQ 1KDNA 3TA2A 4PQAA 1NHKL 4P2SA 2NQPA 2OPPA 3FBCA 2J7UA 2VKZG 4A8XA 4E2FB 4QWAA 1TL7B 3VAKA 5A2QU 1JLQA 3TJAA 1JLEA 4DG1B 1OS5A 1M1KT 3EM1A 4ZN1A 4USTA 2MZQA 1HBUB 5IT4A 2OMLA 2VPYB 3E01A 3LUYA 3SYZA 1N4LA 4HLBA 3DDKA 5L1JA 3K0JA 5CXTA 1L3SA 1FE0A 4CO2A 1RI7A 3TR5A 4QYZK 5A6WA 1MU2A 3TZXA 3SCLE 4QU7A 3DCAA 1WC6A 2N7YA 3GJTB 1JX4A 3GJRB 1YI2S 4UOCA 5T41A 3OTBA 4WPAA 5ETKA 3AY0A 2IPOB 3GMGA 2K3IA 3NGSA 1DQ8A 3POTB 2MSTA 3AXKA 3HKWA 5HO4A 1N5VA 5ETOA 2HVDA 1TL7A 3KXDA 4A8QA 4DG1A 1IKYB 2HNYA 2F8HA 1IQZA 4WFYA 4FF4A 4DX7A 1HBUA 3IAM9 2UVWA 1ZM9A 1LFPA 2MKJA 3MM6B 2CQDA 2WTFA 2RE1A 4K5SA 1F6TA 4EYIB 1S4EA 1FDDA 3OD2A 1SV5B 1RGVA 3M4XA 2KH9A 3N79A 4EK2A 1XWLA 1KNZA 2WBMA 3POTA 1N48A 1VIOA 3Q8SB 4OIXA 3MTJA 1L5UA 3HHLB 4A4JA 2AP6A 2VZ9A 2C3UA 1TP7A 4YP3A 3K5MA 4ZVSB 1RKJA 3AA9A 4DSFA 2IA0A 3N6NA 3FCHA 2QRRA 3ZTPA 3KFWX 2D3OR 5K5MA 7FDRA 2JEFA 4P7VA 1HHTP 3IXQA 4QW8A 2QT7A 2HQIA 2DVIA 2R7RA 5DGAA 1NCLA 3C8YA 5LJ5Y 2GIFA 2BANB 2FJWA 1ZS6A 1C1CA 4E8UA 3BPSP 3CUNA 1KRPA 4O3SA 1NK6A 3LO3A 4DV5F 2JH3A 3EUNA 1U1RA 3CO9A 3GJQB 3TAQA 4HVZA 2Z2MA 3FQKA 3DHWC 2EKYA 1GXTA 2NZCA 4DV1F 2EK1A 4X62F 1F3VA 3LF0A 1VLOA 2BOAA 4C11B 4X65F 5HK4A 3NOGA 4FDFA 5J2NB 2QV6A 1S6QB 5ADZA 2QX0A 2W7AA 1MN9A 2L9DA 3W63A 4MMOA 2UXCF 2VF3A 1WC0A 2RH3A 5LJ3Y 4I2PB 3LTOA 3QT8A 1FFGB 1KP6A 1S1VA 2DB1A 2LEPA 1URRA 3T5KA 4KY3A 3CCUS 1VQ5S 3V6KA 4ED6A 3BGFA 4N41A 5E5NA 1KFSA 2XMAA 4CWBA 2DITA 4GVLA 1TK8A 3MR7A 4MTPA 2KTQA 4RWXA 3CJRA 3AD9C 2DCLA 4DMZA 2GO9A 4PPDA 3RB4A 4RNFA 2HQGA 4NRTA 3BH6B 4DL7A 1J2VA 3PDNA 1S6QA 2DIVA 4BWMA 1OQ6A 1FF2A 4DQIA 5KFXA 1FJGF 2DJWA 4UZBA 2MQPA 1YVFA 5BR8F 4CLPA 3I5CA 5C25A 3ZNUA 1HI0P 5KAKA 3G86A 1AUDA 3GIMA 2R2SA 2PGCA 3D2WA 1ROFA 3OFHA 3MUVP 2RDJA 3I96A 2DRDA 4IYQA 1KLMB 3M30B 1DZ5A 3HPOA 1JLBA 1J5OA 2ZDOA 5HAOA 3KDOA 4GKKF 4B9SA 1HPZB 3NOCA 3G82A 1Q53A 4KBIA 4LF5F 1PJ6A 4YB6A 3RBXA 2YNFA 2DIUA 4EO6A 2KG0A 4EZ9A 2P9GA 4PYDA 2DK2A 3AAWB 3PYGA 1F5CA 2PC6A 2DGTA 4A8FA 3IFEA 3TAMB 4EI2A 4NXMF 3KJFB 2MGZA 1IR0A 2HBRB 7FD1A 2B9EA 2JEJA 1CEZA 2CXEA 3R27A 4DFMA 1ITPA 3RB6A 1EAYC 4FKYA 4DEZA 3AOAA 2MSSA 1TR0A 1CQMA 1XERA 2XMVA 4DUYF 3KLFA 2HVHA 3A3OB 1RHUB 4R5PB 4UY8T 3VALA 1E6YB 4JI4F 1QUVA 3MEGB 1HPZA 3KLHA 3UN2A 4ID5B 2ZH4A 4LF7J 5B0EA 2DNQA 2MXYA 1TUGB 3W8PA 2DHGA 2YKPA 4DR7J 4UW2A 1YBTA 4K2JA 5C42B 2KZMA 5KG6A 2J6TA 2C3MA 1CJTB 3EGNA 5IQQA 5DGBA 2RSQA 4KHPJ 3AODA 5EUHA 4K4WA 3GYXB 2GHVC 3MAAB 4R5PA 4C8KA 4TY8B 1RB0A 3QRRA 1W25A 5B0AA 5KFJA 2D3ZA 2HHWA 2ZUAA 2XS5A 4RW4B 4Y0FA 3MUTP 4UOGA 1ICEB 4FYXB 1RP5A 1SKWA 1O5JA 1U1OA 4N77A 1A0OB 4DQQA 4Z37A 2GHPA 4XO0A 3JQJA 5C42A 3C16B 2P9EA 1WHXA 4RBUA 4DOZA 2IYIA 1TUVA 1REVB 2YX7A 1XMOJ 4LVOP 3SI8A 1WHWA 2DNZA 2YXLA 3JSYA 3L7PA 3FBBA 4NLSA 1U6BA 1Y11A 5ETVA 4TY8A 3NS6A 2FTRA 1NH7A 3A1YG 4I2QA 4DFPA 2WCXA 3O2IA 3HVAA 4ETXA 1U24A 2POKA 4QIFA 1KVKA 1T3NA 2VDIA 2ZFHA 5HBMB 1PSDA 4UOHA 4O3PA 5E3RA 2MPUA 3H90A 4F4AA 4ED8A 2XMMA 3CMES 1NAQA 4FKXA 1U6ZA 5H9EJ 2I6WA 3OR2B 5IFMA 2DO4A 4P73A 3ILOA 2GAHC 1H7XA 3OXLA 1U0HB 2GX8A 3JQMA 4DV7J 3D3BJ 5H9FK 5ETLA 1OMSA 5L9XA 4MYTA 2I9SA 2AX1A 2BR0A 5DZ7A 1AB8A 3EVMA 2IJNA 4DV2J 2F8EX 4TKTA 2PD1A 3CIMA 1CSJA 1EHWA 1IJFB 2I5JA 3GILA 3IG1A 1T9XA 3K7RA 3PO5A 5HBMA 2RQ4A 1HQ2A 2HVIA 2OJ3A 2EWHA 3QIPB 4MK9A 1HQUA 1L3VA 2HFUA 3W2VB 3KDNA 2KYXA 1RU1A 1RWUA 3KK3B 1VDHA 3OV7A 3C2PA 4ZP8A 1YJ9S 1NK4A 1DJ0A 1S6UA 2M4MA 2OEMA 5I3UB 4DQSA 1N52B 3BM7A 2PIIA 2EI5A 2G13A 3VF0B 2FHMA 3O3LA 1FKPA 3KNAA 2EKNA 3B78A 2IM1A 2VONA 1FKOA 5FD1A 2FJDB 1Q16B 2AYGA 1PCAA 4Q44A 4N5SA 2IC3B 4LT6A 4Y65A 3P8BB 3QIPA 5KOWA 3R5GA 4WTOB 3HVRA 4CRJA 2KM8C 2XQCA 3W2VA 3AA8A 3D6HB 8ATCB 1VQNS 3TJ9A 3IO1A 3WBZA 2JJ4D 2VFUA 1PILA 4ZPTR 2JVRA 3KKFA 1WSVA 4KJIA 4GVBB 2MJNA 4Z2XA 1FKAF 5KFEA 1X7VA 1TZ0A 4NYPA 2IVFB 1HARA 2Z30B 3R6LB 4G1IA 4M5NA 1VIXA 3QMQA 1SL2A 2YQ0A 2KRRA 1APSA 2VIHA 2CQPA 3J7YU 4ANEA 4JYAJ 2DGWA 1T05B 4JV5J 1ZM4A 2J9CA 4Y00A 3JYTB 2KB2A 3ZZYA 2QA1A 4WFAQ 1RLCL 3NP5A 3FBEA 4J9LA 2IC3A 3NKYA 3PHTA 3BH7B 4NCGB 4DQRA 2OSQA 1HBNA 3JAMY 2CRLA 3D67A 2O66A 4URGA 2BQUA 1VRTB 1EB0A 2W2QP 1HQEA 3DLBA 5KFOA 1RTIB 5JMNA 1E6VA 4Q8EA 2BACA 4A8OA 1XQIA 1FDBA 4E98A 3LAMA 2E9RX 3TVYA 2PFFB 3MCMA 2CJKA 3JSBA 1TL5A 3M9OB 3HO1A 2H9ZA 2ZC4A 2OMOA 1REGX 3RTVA 1Q5VA 2FHJD 3GLJA 1SPBP 3H5XA 1CC7A 2Q6CA 3PW7A 3B8HA 4CI0B 2M5YA 3K8WA 4K4VA 2L08A 1T9UA 3MD1A 4LJMA 2EFGA 1VQSA 2PDAA 3I0SB 3A3NB 2MLZA 4AXIA 2P9CA 2HS4A 3UPFA 4IDKA 3DDNA 3D6FB 2KDOA 4A46A 4NRUA 2OTJS 4KRWA 1HBOB 2RIJA 1HR0J 1UP1A 1RTIA 2HGLA 1SJQA 5L1LA 3P4UB 4RUBA 2QL9B 4ZIVA 4WYWA 1NKCA 2R7QA 1FNOA 2VL1A 4ZMMA 5GVQA 1RK8A 3BBFA 4FP9A 3QFWA 3OTOJ 1T9YA 4P75A 4ER8A 2D69A 3ZTSA 4PCQA 3QNWB 4NZ7A 3W61A 5HSPA 3M2VA 4NLXA 4IFVB 1WC1A 1FA0A 3QJJA 2OKQA 2RUGA 2DR8A 4AXJA 5J2MA 3OJSA 2AJ0A 2HYIB 1TL4A 4H4OB 1MWYA 2DKOB 3H2VE 2DHSA 1CJKB 2FLNA 4M1KA 5IOLA 2F4FA 4QWDA 2BXJA 1HBOA 5JXSA 4AYBD 1QY7A 5E41A 2VD3A 2VC0A 1Q81T 3HZEA 2ADBA 1WEXA 1AFIA 2EG1A 2DO0A 3KG4A 3PJWA 3DRXA 3Q0AA 4RBVA 3IR6B 4NASA 4ZHRB 2VHGA 3A4TA 2EPIA 3IBWA 5T7LA 3QT7A 1XNRJ 3QAUA 4DL3A 4NZ6A 3PR4A 4NXNF 3T1YJ 2JRSA 2ZJQQ 4IFVA 5EGYA 1EKSA 1V3SA 1ZM3A 4OJHA 1X5SA 3QIDA 2VB6A 4FF1A 2RF2B 4H4OA 4C3KA 1CJKA 1UWAA 4U9RA 2CJYB 4WWSA 2W8LA 3MCOA 2XI2A 3CCMS 4ZDNA 3FCWA 4ETZA 3EYZA 5GAGU 2E44A 3FUYA 4DR7F 1X8DA 4M5JA 1SIWB 1JMTA 3CULA 4LQ3A 4G1QB 3V6HA 2F4VF 5HN0A 2KFZA 3JSMB 2PA3A 4ALZA 3MMJA 1WTFA 1RSCA 3GCXP
chains in the Genus database with same CATH topology
2HVDA 3EJMA 5CABA 2DYAA 3FBFA 3NGRA 1WKJA 3FCVA 1NB2A 4DI6A 3BBBA 1NCLA 1JXVA 4ANEA 3PJ9A 3FKBA 1BUXA 1KDNA 1NDLA 3NGUA 2NCKL 3Q8VA 3ETMA 1NHKL 4KPCA 3B54A 4UOHA 3FC9A 1BE4A 3MPDA 1S59A 3L7UA 3VGTA 4O0NA 1WKLA 4F4AA 4ENOA 1ZS6A 3FBCA 1NDKA 1HHQA 3VGVA 1W7WA 1NPKA 4FKXA 3BBCA 3FBEA 1B4SA 3BH7B 3ZTRA 1K44A 1PAEX 3Q89A 3NGTA 2VU5A 1VYAA 1NSQA 2DXDA 1F6TA 2AZ3A 2BX6A 1F3FA 1WKKA 4DZ6A 2ZUAA 4FKYA 3EM1A 4ANCA 2B8QA 5BXIA 3BBFA 1NSKL 1S5ZA 3BH6B 3ZTSA 4HR2A 4F36A 1B99A 1XIQA 5C7PA 2HURA 3ENAA 1UCNA 3ZTOA 4UOGA 2HVEA 1PKUA 2B8PA 3VVTA 4EK2A 3VGSA 1BHNA 1LWXA 1XQIA 4ANDA 3FCWA 3GPAA 3Q83A 3DDIA 3EE3A 3G2XA 3EVMA 3EVOA 4S0MA 5CAAA 3WX8A 3B6BA 2DXEA 3JS9A 3VVUA 4DUTA 1EHWA 3R9LA 1U8WA 2BEFA 3VGUA 3PRVA 1NDCA 1LEOA 2AZ1A 1HLWA 3ELHA 1NUEA 4WBFA 1NLKL 5IOLA 1HIYA 1MN9A 4UOFA 4C6AA 3ZTPA 2DXFA 2DY9A 3GP9A 4W98A 3DKDA 3ZTQA 3EICA 3NGSA 3EVWA 3Q8UA 1NDPA 3FBBA 2CWKA 3EMTA 3Q8YA 4CP5A 1MN7A 3Q86A 1S57A 1NSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVD A;  3EJM A;  5CAB A;  2DYA A;  3FBF A;  3NGR A;  1WKJ A;  3FCV A;  1NB2 A;  4DI6 A;  3BBB A;  1NCL A;  1JXV A;  4ANE A;  3PJ9 A;  3FKB A;  1BUX A;  1KDN A;  1NDL A;  3NGU A;  2NCK L;  3Q8V A;  3ETM A;  1NHK L;  4KPC A;  3B54 A;  4UOH A;  3FC9 A;  1BE4 A;  3MPD A;  1S59 A;  3L7U A;  3VGT A;  4O0N A;  1WKL A;  4F4A A;  4ENO A;  1ZS6 A;  3FBC A;  1NDK A;  1HHQ A;  3VGV A;  1W7W A;  1NPK A;  4FKX A;  3BBC A;  3FBE A;  1B4S A;  3BH7 B;  3ZTR A;  1K44 A;  1PAE X;  3Q89 A;  3NGT A;  2VU5 A;  1VYA A;  1NSQ A;  2DXD A;  1F6T A;  2AZ3 A;  2BX6 A;  1F3F A;  1WKK A;  4DZ6 A;  2ZUA A;  4FKY A;  3EM1 A;  4ANC A;  2B8Q A;  5BXI A;  3BBF A;  1NSK L;  1S5Z A;  3BH6 B;  3ZTS A;  4HR2 A;  4F36 A;  1B99 A;  1XIQ A;  5C7P A;  2HUR A;  3ENA A;  1UCN A;  3ZTO A;  4UOG A;  2HVE A;  1PKU A;  2B8P A;  3VVT A;  4EK2 A;  3VGS A;  1BHN A;  1LWX A;  1XQI A;  4AND A;  3FCW A;  3GPA A;  3Q83 A;  3DDI A;  3EE3 A;  3G2X A;  3EVM A;  3EVO A;  4S0M A;  5CAA A;  3WX8 A;  3B6B A;  2DXE A;  3JS9 A;  3VVU A;  4DUT A;  1EHW A;  3R9L A;  1U8W A;  2BEF A;  3VGU A;  3PRV A;  1NDC A;  1LEO A;  2AZ1 A;  1HLW A;  3ELH A;  1NUE A;  4WBF A;  1NLK L;  5IOL A;  1HIY A;  1MN9 A;  4UOF A;  4C6A A;  3ZTP A;  2DXF A;  2DY9 A;  3GP9 A;  4W98 A;  3DKD A;  3ZTQ A;  3EIC A;  3NGS A;  3EVW A;  3Q8U A;  1NDP A;  3FBB A;  2CWK A;  3EMT A;  3Q8Y A;  4CP5 A;  1MN7 A;  3Q86 A;  1S57 A;  1NSP A; 
#chains in the Genus database with same CATH topology
 4KHP F;  1F9F A;  2RKI A;  5IM0 B;  4CH0 S;  1MMD A;  2MZJ A;  2CJB A;  1R43 A;  2CPI A;  4J7C A;  2WON B;  1O51 A;  2BMB A;  1T9T A;  2H48 B;  1DHM A;  5LMU J;  2ZH9 A;  2C2Z B;  5DQG A;  5CZX A;  2BX6 A;  3A13 A;  4DZ6 A;  3NMA A;  2U1A A;  3KMQ A;  4ZP7 A;  1VK8 A;  3PJX A;  1Q86 T;  2FUG 9;  1PC4 A;  4G1Q A;  4NOH A;  1XMO F;  1U8S A;  1V5I B;  3JSM A;  4IH7 A;  2LU1 A;  3US5 A;  3EGV A;  1NXI A;  1HWU A;  2BM0 A;  2KKH A;  4M5D A;  3KK2 B;  4TU7 A;  3UD3 P;  2HHT A;  1WC5 A;  4W98 A;  1D8Y A;  4JB8 B;  2M2B A;  4MK8 A;  1ACM B;  2DR6 A;  1PG5 B;  2JLG A;  2DGQ A;  1WKJ A;  2G0J A;  2BE9 B;  2KO1 A;  4IUF A;  1XR7 A;  3R5D A;  2MQO A;  3HHK A;  4RW6 A;  4EMD A;  3MUM P;  3L4B C;  4ZJL A;  4O0N A;  5GME A;  4DV7 F;  4B9U A;  3UCZ P;  4LSL A;  2V4Q A;  4AUK A;  1N8R T;  4OHX A;  2FZC B;  1PAE X;  3UI3 A;  3TX0 A;  3NL0 A;  4KQZ A;  3GQC A;  4XAK A;  4OHY A;  2OPR B;  3I82 A;  4Y3C A;  4DV2 F;  3BO2 A;  2QE5 A;  1VI7 A;  2KN4 A;  3KK2 A;  3G87 A;  3NCQ A;  3IRX A;  2LDI A;  2LCW A;  3K5O A;  2R8H A;  2IDE A;  2XYH B;  2NXN A;  3VQS A;  2MKH A;  4OYZ A;  3K57 A;  2QA4 G;  4WK3 A;  2ZHB A;  1KTQ A;  2BKP A;  1JIH A;  3IN5 A;  2L3M A;  3D0G E;  2HFV A;  3QAT A;  5EWG A;  2B6A B;  3DM2 B;  2XWY A;  1VBK A;  2OPR A;  4IR1 A;  1UET A;  4C98 A;  4RW7 A;  1OY6 A;  2XMT A;  1NDL A;  2F40 A;  4RLE A;  4OZ3 A;  2LXI A;  2YKA A;  3W9I A;  1JXE A;  4KSE B;  2ATC B;  2VV5 A;  4AL6 A;  2QLX A;  2HS3 A;  3J80 Y;  3UDV A;  2NR0 A;  4WYL A;  1S4F A;  2ZZN A;  1NH8 A;  3PW5 A;  4AQY J;  3D6T B;  1FO1 A;  3RB3 A;  1WI6 A;  1RE1 B;  2NPF A;  4OYI A;  1SIZ A;  1FDA A;  2NUU G;  2DR5 A;  1N88 A;  4WE1 A;  4N8O A;  4U7U K;  4A8Y A;  2H65 B;  4I56 A;  4DF8 A;  1L3T A;  2XLK A;  2HQC A;  1BQM B;  3M8R A;  2JVO A;  4NWB A;  3OLA A;  4LFB J;  3W3S A;  3GPA A;  4P2F A;  2RAQ A;  1HNV B;  4FBT A;  1OYD A;  4BC9 A;  4GC7 A;  5F3T A;  3DOK B;  3LPY A;  1X9W A;  4XPC A;  2UUT A;  4RW8 B;  4CO3 A;  2GCF A;  3K2Y A;  2W01 A;  5KFD A;  4ZA1 A;  4A8M P;  2BE2 A;  1VRU B;  1YRX A;  1VS3 A;  2DY9 A;  1G7C B;  4K50 A;  4JV5 F;  1OSD A;  2XNR A;  2DR7 A;  3NBP B;  1PJ5 A;  4K8R A;  1C1B B;  3H2U B;  1NK7 A;  2I0X A;  3V4I B;  4FZV A;  2V68 A;  4RKU C;  2GS8 A;  5JUM A;  3I4P A;  1EZZ B;  2A6O A;  2NSC A;  3HSJ A;  1RLD A;  3J7A 1;  5KFG A;  2NPI A;  1UKU A;  2KHD A;  1YLX A;  3N0V A;  4U7U D;  4CZC A;  2F3J A;  4ZVE A;  5KFI A;  3VGV A;  4ECZ A;  4FNH A;  1U2C A;  2AW0 A;  3H40 A;  1HNV A;  4QOT A;  2L48 A;  4QQB A;  1RUS A;  3W5X A;  3SEO A;  1AZS B;  4RW8 A;  1N6Q B;  3PO4 A;  2ZKT A;  3MMA B;  1NSK L;  3HJF A;  4LF4 J;  4ZVO B;  4ECY A;  2RD5 C;  2XCA A;  4N8N A;  2FJX A;  4R8U A;  4PXD A;  1BHN A;  1FRI A;  1WF0 A;  4DL5 A;  4LF8 F;  2KRB A;  3NBP A;  6FDR A;  2V4R A;  3D1H A;  3TUJ C;  4ZKA A;  4F3M A;  3DGV A;  2N82 B;  2HVZ A;  5CYQ B;  4DN9 A;  1K0V A;  3QRP A;  2WOM B;  4G6V B;  3IS9 B;  3WDO A;  2B9X A;  3CWJ A;  3QRQ A;  2VJV A;  4DV6 J;  5HQL A;  3NXZ A;  3L95 X;  1LW0 A;  1RTH B;  4YB7 A;  2VA2 A;  4ECS A;  1S76 D;  4C8O A;  1HR0 F;  4QR2 A;  3G6E S;  1ARO P;  1AZS A;  2Q43 A;  2CQ0 A;  2HQF A;  3T5J A;  3PM9 A;  4JI6 J;  2W7P A;  3MR5 A;  3OTO F;  3CD5 A;  4KE5 A;  1U4B A;  1TVR A;  3D6M B;  3MOZ A;  4LR8 A;  3TEH B;  2V5H G;  2NXJ A;  1QD1 A;  1Q8K A;  1S0V A;  2CNK B;  4DS5 A;  4USI A;  2CVI A;  3ZZP A;  5K8M A;  1U26 A;  2H54 B;  1RA6 A;  3IS9 A;  4MYU A;  3C66 A;  1RTH A;  1NKE A;  2OTL S;  2UZA A;  2NXE A;  2ZBC A;  2VIC A;  3HVT A;  1QTN B;  4I7F B;  4OI3 A;  5EDW A;  2CKW A;  4X4U A;  3Q8U A;  2OH2 A;  4TYB A;  1XNR F;  2QO3 A;  3W9J A;  3T1Y F;  4WP9 A;  2UUW A;  4I6A A;  3ULH A;  4USK A;  4FYV B;  2BDP A;  2IRY A;  3C15 B;  5D78 A;  3M8P B;  1A9N B;  3MHY A;  3OPK A;  2YQ1 A;  1JXL A;  2C3Y A;  3NS7 B;  5JVG Q;  4DPU A;  2IHR 1;  2HAF A;  2V34 A;  1F2H A;  1ZM2 A;  3ET6 B;  2OHD A;  4HTJ A;  2EXU A;  2EVZ A;  1Q7L B;  4HAC B;  4I69 A;  3FEX B;  1TFW A;  2IIH A;  4MFB B;  3KTQ A;  2ZZT A;  1B99 A;  2DRB A;  1ZET A;  3CJ5 A;  3W5Z A;  2PMH A;  1N33 J;  5KG3 A;  2EC0 A;  5KFR A;  2K7J A;  2HW3 A;  5JJB A;  1BC6 A;  2GVD B;  3AOC A;  4K4T A;  2L9W A;  4HH0 A;  1KVI A;  3OTC A;  2E5G A;  5IV4 A;  1S77 D;  1RWP B;  3ZZR A;  2J9E A;  3C15 A;  4MKV A;  2COL A;  3EPI A;  3FJ2 A;  4FS1 A;  2CDQ A;  2R7S A;  1RT7 B;  4M63 A;  4ZVP B;  4DSE A;  3ET6 A;  4Z7Y A;  5I3P A;  5C2C A;  2BRK A;  4U67 Q;  2DGV A;  3EJM A;  4WIQ A;  1H74 A;  5LMU F;  1NKB A;  2XTJ P;  2PA8 D;  4DV3 J;  3LAL A;  2XBP A;  3PX0 A;  1WG5 A;  1NM2 A;  3I5B A;  4PXE A;  2B51 A;  3DMJ B;  4RWW A;  4DR4 F;  2IRX A;  2OEL A;  1MWQ A;  3NEK A;  2GVD A;  4HHH A;  4ELV A;  4KKO B;  4YR3 A;  1XTZ A;  4Y2K A;  1QAX A;  1IKW B;  4B08 A;  5D3G B;  4I6W A;  3MEE B;  1LW2 A;  3KHH A;  2ZWO A;  3HHE A;  4CO4 A;  2B8P A;  2PI4 A;  1Q79 A;  2QFI A;  1RT7 A;  3BEG B;  4EBE A;  3GV7 B;  1SC3 B;  4YS2 A;  3HT0 A;  1CS4 B;  2Z8Q A;  1FD2 A;  3OJU A;  4DL0 C;  3GII A;  2FVQ A;  3VAM A;  1X31 C;  3UW1 A;  5L39 A;  3K5L A;  1KWM A;  3T1H J;  1B64 A;  2VAS A;  4AE5 A;  1S7H A;  3DMJ A;  1VQP S;  2CA9 A;  4CP5 A;  3CCE S;  1G3O A;  1RYS A;  3PIP Q;  2LVW A;  2HFO A;  1R0A B;  2B4U A;  4KKO A;  2CNO B;  3EWG A;  1BGX T;  3CJT A;  1OY8 A;  1ZZN A;  5D3G A;  1FNM A;  4KPC A;  3QWU A;  2DNO A;  5A8W B;  3BDP A;  3M2R A;  3BS9 A;  2ZH7 A;  3BGR A;  4OJ1 A;  4YY3 J;  5D0G A;  2DXD A;  4HDH A;  2IA6 A;  2G9O A;  5DET A;  2QN6 B;  3A8E A;  4G1P A;  5LSO A;  3HF5 A;  1Q8B A;  1VQ4 S;  1X5P A;  3ZTO A;  1RAB B;  2HIY A;  5E3C A;  1NPR A;  1WI8 A;  3QQC D;  3VQT A;  2IFX A;  2J6U A;  4ZCI A;  4F3Q A;  3CCL S;  1F5A A;  1YJW S;  2FLP A;  4JP8 A;  2OFH X;  4CYU A;  2OPS A;  1PYO B;  2CNL B;  2R9L A;  2QG9 B;  3EZU A;  1YBA A;  3VZI A;  5A8W A;  2ABY A;  5AT1 B;  2RRN A;  1U1N A;  2XO6 A;  1H73 A;  1I6J A;  1MNE A;  2VFT A;  3MI7 X;  1XJW B;  5H9E K;  4L76 A;  1IWA A;  3UN3 A;  2DNN A;  3R5J B;  3SSQ A;  4AQY F;  4LMZ A;  1SKR A;  3K58 A;  2XY5 A;  2CPE A;  1S1T A;  4X4N A;  2UV8 A;  1KBR A;  3M9M B;  5J2Q B;  2ZE2 B;  2MQ8 A;  3N5F A;  1DTQ B;  4DWI A;  5HVH A;  4LFB F;  1D3W A;  1OY9 A;  2N7C A;  4NCA A;  2VPW B;  4OJ3 A;  3TAP A;  4Y2C A;  2E1A A;  4OX7 A;  3OR1 B;  1QE1 A;  3OFE A;  5L38 A;  2FZG B;  3CCT A;  4CLL A;  4PZV A;  1ZTW A;  2AKW B;  4CLY A;  3MCS A;  3NGD A;  1WUU A;  2VQF J;  4OZL A;  3TRG A;  5CD4 H;  4ECV A;  4IQX A;  2WBR A;  1WF2 A;  1WEL A;  3PNI A;  2DGO A;  4UQG A;  1OPI A;  1JXV A;  2CZ4 A;  4NLR A;  1VQ7 S;  3D68 A;  3R3T A;  1BE4 A;  2E5I A;  5C24 A;  3L7U A;  4LF4 F;  1UMJ A;  3HSG A;  1RXO B;  1ZPV A;  4ECR A;  1YSJ A;  1FJ7 A;  4KGK A;  2MMY A;  2B8Q A;  3G8T A;  2VA3 A;  3SCI E;  5J2P B;  5KFT A;  2B0G A;  2G1H A;  2HHS A;  4PXC A;  2FYX A;  3G71 S;  4QU6 A;  1TEL A;  4DV6 F;  3MFI A;  1N34 J;  4ZJO A;  3C14 B;  1NJW A;  1S1W B;  3MEK A;  3F73 A;  4TXS A;  2B3T B;  3GP9 A;  3GE9 A;  1KQS R;  4KB7 A;  1YK9 A;  3D54 A;  1UJ6 A;  4RUA A;  4CNZ A;  3SQO P;  3BQ1 A;  1M0S A;  4X4T A;  2XZD B;  2ZKU A;  2OPQ A;  2ALZ A;  2HMI A;  1P1T A;  3D9B A;  2A3J A;  2QYG A;  3S8S A;  3ITH B;  4F7V A;  5AE2 A;  4NLP A;  4UTG A;  2WK4 A;  1SVD A;  2C2K B;  2EFP A;  2BAB A;  2RQM A;  2JWN A;  2AJQ A;  5D6G A;  3IM8 A;  4MKY A;  1S1W A;  2P5V A;  1FK9 A;  2HPU A;  1AYE A;  3JTP A;  3MMB B;  1R8H A;  3V81 B;  1Z1Z A;  1JK9 B;  4U95 A;  4BS2 A;  4Q2M A;  1JLC B;  3TA1 A;  1SQF A;  3BDE A;  3UVJ A;  4YB5 A;  4AD6 A;  4B9N A;  4LIW A;  1FRH A;  3BKT A;  3GU0 A;  4LSN B;  2EFQ A;  2C2M B;  3RAM A;  1ZTT A;  3O8W A;  2W4C A;  2IM3 A;  1RAJ A;  1FJE B;  3HHL D;  1UA1 A;  2ZOG A;  3J7Y I;  4UOF A;  3PY8 A;  3ITH A;  4KC5 A;  4Z7C A;  1R8C A;  2JEG A;  3TZY A;  4WFX A;  1AA1 B;  4ES2 A;  4A47 A;  1GT8 A;  3I5A A;  2VG7 B;  4D3G A;  3DLG B;  1JJ4 A;  3VR1 A;  2QSF A;  2VOP A;  1VC0 A;  3JTO A;  4L73 A;  4PWD B;  4DF4 A;  4CO0 A;  3PJ9 A;  4OZN A;  5J1E B;  1UW9 A;  1HYS A;  4DLG A;  4NMX A;  3MMB A;  4MIA A;  3V81 A;  1JLC A;  2DBB A;  2MYF A;  2C2N A;  3N28 A;  1VC6 A;  4HI1 A;  2J0X A;  1F3F A;  2VOO A;  2GGP B;  3BB5 A;  1HNX J;  3GON A;  3GIR A;  2VFV A;  3I9V 9;  1TKT A;  2CQB A;  2VG6 B;  3ENA A;  3KOA A;  2F5G A;  3G4S S;  5KFW A;  4URQ U;  2L9N A;  4F2S A;  3PW4 A;  4PYA A;  4KYZ A;  2VG7 A;  4ILM A;  2W8K A;  3DLG A;  4ZVG A;  1P27 B;  3QAE A;  1QDU B;  4UQT A;  4DQP A;  1Y7P A;  4PWD A;  1JWW A;  2Y8W A;  1HI8 A;  4IO9 Q;  4EGL A;  2E7V A;  3FSX A;  3UO0 A;  1SL0 A;  2XGP A;  1IBC B;  2CJX B;  5LSR A;  4DV3 F;  1TUW A;  4O4G B;  3BR8 A;  3HUL A;  3GWC A;  2N3O A;  2QGF B;  2Y1R I;  4LF1 A;  2ZWP A;  2XC9 A;  4USV A;  4M5K A;  1FFW B;  3BGO P;  2GGP A;  1T11 A;  1Q4R A;  3R2D J;  4GO7 X;  4F4Z A;  4B9M A;  3LAN A;  2PFD A;  1FDN A;  2LQJ A;  3SXL A;  2QMX A;  4OI6 A;  3M05 A;  2J8A A;  1U1L A;  2R7U A;  2YPY A;  4LF6 J;  1TKZ A;  2CPY A;  4Q0B A;  1FXD A;  2UVU A;  1GQE A;  3FSI A;  4DLE A;  3VTI A;  2OAU A;  5KFB A;  5IS2 A;  2R7T A;  3T1H F;  2FC9 A;  1X4E A;  4WKY A;  5KG0 A;  1YRT A;  4P71 A;  3R1L A;  3SSS A;  4QCL A;  1CJV A;  2FVC A;  4X62 J;  4FXW A;  2OUG A;  1KHW A;  3PYE A;  2UXD J;  1GMV A;  3AB2 B;  4K5R A;  4AL7 A;  2GFF A;  3DRP B;  4KFB A;  2HFN A;  3D66 A;  4YME A;  2M7S A;  4DPT A;  2Z56 B;  5LOQ A;  2K1R B;  3F0N A;  3NNA A;  3HFV A;  3QLH A;  4FS2 A;  2QMW A;  2ZBQ A;  1FTR A;  4NLV A;  4TNO A;  4YY3 F;  1KC8 T;  2UVR A;  1N56 A;  4BHQ A;  1RBL A;  1S10 A;  3G96 A;  1FT8 A;  5L8R C;  3ZZT A;  3KK1 A;  4N47 A;  5HL7 Q;  1RJJ A;  1RWX B;  3DLH A;  1T8E A;  1UVK A;  5GAG I;  1FEH A;  4F02 A;  1B7F A;  3KJV B;  5F0U A;  1SH0 A;  1Y5I B;  3DRR B;  4DV0 J;  2JSX A;  1FJG J;  3MR3 A;  2MDA A;  4JBC A;  3LAK A;  5JVH Q;  5T14 A;  2ZNY A;  2W24 A;  2Z2L A;  4NLU A;  3GG0 A;  2J8S A;  3ICL A;  3HHL C;  3RYL A;  2DXF A;  3MM8 B;  1IWG A;  1IKX B;  2KJW A;  5EX0 A;  2GIQ A;  3G9C A;  2BKO A;  3G8S A;  5CCM A;  1GAO A;  1RWN B;  2ROP A;  2AD9 A;  2AIR B;  5CAB A;  2JHE A;  3SBM A;  1NB2 A;  3MEC B;  4QIG A;  1XBW A;  4QYZ J;  1RT6 B;  4MAK A;  3KJV A;  3DRR A;  1X4G A;  5DLG A;  2VOD A;  1HHQ A;  1SI9 A;  1LFW A;  4F0M A;  1IM4 A;  1O6X A;  2QLF B;  2DNR A;  3DOL B;  3H5S A;  1VYA A;  4B3R J;  4KAI A;  3KLE A;  3EPG A;  2BJ3 A;  2V0N A;  2C3O A;  3K5N A;  5K14 A;  3MD3 A;  5GMD A;  2HVE A;  2V8D A;  1JLF B;  2VQF F;  1ZYQ A;  2V69 A;  1GX6 A;  2K2P A;  2FVR A;  5B0D A;  5IWA F;  3DU6 A;  4JI4 J;  4CLF A;  3PXG a;  2DTJ A;  2DHH A;  3MEC A;  1H3D A;  2VPZ B;  1GXL A;  4RO0 A;  5KT5 A;  1X60 A;  3QO9 B;  4ECT A;  2E1R A;  3UD4 P;  5ETT A;  4ZVR B;  5AXN A;  3FRY A;  3UCU P;  3M8Q A;  1Q7Y T;  2MQN A;  2ZD1 B;  1XMB A;  3UD5 A;  3IBC B;  1LNQ A;  3RBZ A;  5AXL A;  4L75 A;  3CNQ P;  3TI0 A;  3W9H A;  1IR1 A;  3OHA A;  3HM9 A;  2CUY A;  1JLF A;  5F8J A;  3RAQ A;  3D1O A;  5D15 A;  2OPP B;  1KQK A;  1LK5 A;  3IRW P;  2D9P A;  3KLI A;  3DLK A;  5C5J A;  5M2U A;  1UZD A;  4NYO A;  4C8M A;  3RB0 A;  4KH1 B;  3U1M A;  5CYM B;  4NLD A;  4WP8 A;  1JLQ B;  1JLE B;  1S48 A;  5M2R A;  1QLN A;  3CJ3 A;  4UY8 5;  3NLC A;  3MXH P;  3BGL A;  3KUE A;  4UT4 A;  3QO9 A;  1TAQ A;  3IWN C;  3E01 B;  4J9U E;  1KTV A;  4DBQ A;  3RGI A;  2FHJ A;  3H0P A;  3DDI A;  4K2X A;  2D3U A;  2FIU A;  4UUW A;  1MU2 B;  2AJ4 A;  5ETP A;  1M5K C;  5B0G A;  1YHQ S;  3MMC A;  5EX3 A;  3R8Y A;  3DC2 A;  3BJY A;  3TEG A;  3IBF B;  1A6L A;  5HQ8 A;  3H7H B;  1NDP A;  2ASY A;  4ZLJ A;  4F50 A;  4TN2 A;  5A6P A;  3WX4 A;  1Y4Z B;  1SKU B;  2O3D A;  4KH0 B;  3W64 A;  3G6Y A;  3FBF A;  4OX9 J;  3CDE A;  4GO5 X;  5CYM A;  2ZOF A;  4YR2 A;  3CCS S;  5ETQ A;  2HNY B;  1KVJ A;  3CJ2 A;  4DZD A;  4DR3 J;  4B3O B;  3PEH A;  4B3T J;  2HZV A;  3MM9 B;  2IYG A;  5F8M A;  1KQG B;  2EEY A;  4QWB A;  2AZ3 A;  2O1P A;  3T6J A;  4LBH A;  5MAO A;  4Y2M A;  3Q24 A;  1YJR A;  5B08 A;  1UFK A;  2R7O A;  2ZEJ A;  4RNN A;  2HUR A;  3CD0 A;  4OZ5 A;  2GVZ A;  5KFA A;  4LFC J;  4ED2 A;  4YQW A;  3R97 A;  3EE3 A;  1SKS A;  3EVO A;  3BGU A;  3GTY X;  3NNH A;  2VDH A;  1JKH B;  4ZPA A;  3CJ0 A;  3PG9 A;  2EC2 A;  4NI2 B;  1S1X A;  2OP5 A;  4O44 A;  4FNI A;  1D8Z A;  5F9N A;  1NLK L;  1DLO B;  1CLF A;  1KN6 A;  4B3O A;  5FDL A;  3IWL A;  3E2E A;  4OJG A;  3JXO A;  1YKW A;  4ES3 A;  1NPP A;  5KG1 A;  4KTQ A;  1KQF B;  1PYT A;  3P5T L;  3MM9 A;  4NYZ A;  1RAO A;  2GA7 A;  3CT9 A;  1RHK B;  2OO4 A;  4H4M A;  3NGR A;  4DX5 A;  5HAT A;  2HHH J;  1RDR A;  4K59 A;  3GFY A;  2R2R A;  1HNX F;  2ZM6 J;  4RPF A;  2NSB A;  1S97 A;  2BE7 D;  1RBA A;  1WEZ A;  3AD8 C;  3R7N B;  1C1C B;  4RNO A;  4FVM A;  4MIW A;  4OHV A;  2DNH A;  3VAJ A;  2P6T A;  4ZJQ A;  4TVA B;  3FFI A;  1JKH A;  1XR5 A;  3M6U A;  4DR1 J;  2GNK A;  1OJ4 A;  3CCQ S;  2AGP A;  4DU7 A;  1MRO B;  4NI2 A;  4WXO A;  4PG6 A;  1DLO A;  1RBO B;  5E3Q A;  3ZO7 A;  4Q7A A;  3PYD A;  2I8E A;  3H2L A;  3IMQ J;  1H2V Z;  1PAU B;  3R5B A;  1GMW D;  1KOO A;  1VHI A;  3T3F A;  1JJH A;  5FLX Y;  3EXC X;  2QL7 B;  1RT3 B;  4RU9 A;  2RHS B;  3DHX A;  1YIT S;  1IBK J;  3SFG A;  3I56 S;  1LXJ A;  3WHI A;  2X1G A;  3N6M A;  1XMQ J;  2OEK A;  4PEO A;  2YWG A;  3ZFV A;  1S1V B;  1LV5 A;  4C9D A;  4LF6 F;  1MRO A;  1K1Q A;  3ISN D;  4F4Y A;  3QGI A;  3Q22 A;  1WHV A;  1SJF A;  4OZ2 A;  4KO0 A;  2Z2Y B;  1D1U A;  4X4P A;  3Q89 A;  4FYD A;  1RA7 A;  2WRM A;  1D09 B;  2YKM B;  2K06 A;  3MPV A;  3CJK B;  3BSN A;  1XIQ A;  5KFU A;  2R4F A;  3L09 A;  1Q1K A;  2JDJ A;  3THV A;  1RT3 A;  2UXD F;  3FDS A;  3OTD A;  2BQ3 A;  2FLL A;  1LKZ A;  2XB2 D;  3LWL A;  1GEH A;  2CPH A;  4X4S A;  4V19 J;  1M5O C;  2YVS A;  3KUG A;  2RB7 A;  5C25 B;  3RRG A;  3UDE A;  5KFN A;  2N3L A;  2QA2 A;  1LK7 A;  5F8I A;  1B0P A;  4HTI A;  1WTB A;  4B9T A;  3OTE A;  3KLV A;  2HGN A;  4DU8 A;  4OYP A;  1M1H A;  1JLB B;  1AXQ A;  3DNC A;  2J76 E;  1J5O B;  2YKM A;  1RYR A;  4M5I A;  2MQQ A;  3CJK A;  3G82 B;  4DPY A;  1S59 A;  2W2P P;  2YKQ A;  1BWE A;  2YNF B;  3QYY A;  3NRB A;  1PYS B;  4DV0 F;  1K44 A;  2DGX A;  5DJB A;  2MGZ B;  2UUB J;  2F63 A;  1WKK A;  3FK4 A;  3RJM B;  2MB0 B;  3E8O A;  2HG4 A;  3B82 A;  1FRK A;  4HR2 A;  4B02 A;  1VK3 A;  2B7C B;  3AHP A;  1NK8 A;  5DO2 A;  5AJ3 J;  2R8G A;  2MZR A;  3S7R A;  1B0T A;  3KLF B;  1FEE A;  2EG2 A;  1UZH A;  2BZ2 A;  3NY0 A;  3NS5 A;  1K9M T;  3EXY A;  3IP0 A;  1B70 B;  3KLH B;  2G0I A;  2OGU A;  3HKZ D;  2EFO A;  4MKA A;  3QGH A;  4DDF A;  3IAS 9;  2ZH8 A;  1NZ8 A;  5EWF A;  1CUL A;  3CB4 A;  2ZVI A;  1P1L A;  4EU0 A;  5KFM A;  4B3R F;  1BUX A;  2J7W A;  2DEJ A;  2C1E B;  4NXN J;  4C7Q A;  3MPD A;  1Q5Y A;  5E2Q A;  4HT7 A;  3R1H A;  5DDR C;  4NEZ A;  1SJ1 A;  5RUB A;  3T5L A;  2X3D A;  1NHU A;  1EQM A;  2W9A A;  2PI5 A;  2XCP A;  1Y3J A;  2W4D A;  2HHU A;  1S7I A;  1JLA B;  2E7W A;  2BKN A;  1BLU A;  2LA4 A;  4OZ1 A;  5KFF A;  4Q2L A;  4RZR A;  5L1I A;  4ZPV R;  5GAD U;  2CQ2 A;  3VGU A;  2YWE A;  4JI8 J;  4K4Y A;  1S79 A;  1R27 B;  4OFZ A;  5EN1 A;  4OX8 A;  1MWZ A;  5HQM A;  3L3C A;  3BRE A;  1X0F A;  3U7J A;  4LRB A;  2F4V J;  2M8D B;  2E66 A;  4M5H A;  3BKF A;  4NE9 C;  3HXM A;  2VBX A;  1R31 A;  1S9E A;  2LEC A;  5I42 B;  2EW9 A;  2HBY B;  2LLZ A;  1QUP A;  2LXF A;  3HD2 A;  4FBU A;  4OMF G;  2QJ3 A;  3KLG A;  1XNQ J;  1FTC A;  5HI7 A;  5DG9 A;  4ED3 A;  2E1C A;  2FJV A;  4I2Q B;  4XDC A;  3PRB A;  1JLA A;  1GTE A;  4USM A;  5D4N A;  3ISN C;  1NPK A;  2J9D A;  3Q2S C;  3NNC A;  1QAY A;  2CVE A;  1YJT A;  2XSJ A;  3ILI A;  2C28 A;  4Q8F A;  2R7X A;  2N4C A;  3OL9 A;  1KFD A;  1FE4 A;  3RU0 A;  3CIZ A;  3J7A N;  4WFN Q;  4OHZ A;  5K8N A;  3UNG C;  3MM7 A;  4S0M A;  5I42 A;  3X1L B;  3OL6 A;  4Q43 A;  1EX8 A;  3UR3 C;  4O0I A;  4WBF A;  2B4P A;  2I5J B;  4OX9 F;  3IG1 B;  3TA0 A;  3OSP A;  4CM2 A;  2VUG A;  1GX5 A;  4ZVU B;  1PO6 A;  4DR3 F;  2LDY A;  3Q86 A;  3I0R B;  1NU4 A;  1W2I A;  3KYL A;  4B3T F;  2DIS A;  1RT5 A;  3HVW A;  3LW5 C;  1HQU B;  2B5J B;  3CJS A;  3Q8Q B;  4IOB A;  3BBB A;  1QVG R;  1T9V A;  2F9J A;  1IJE B;  5HLF A;  5F9L A;  2V8P A;  1F0X A;  2AQ4 A;  3B54 A;  3PTW A;  3MPW A;  1IBM J;  3QJL A;  3GG1 A;  4IRC A;  1IM6 A;  2ROG A;  1NME B;  3ENQ A;  4K4U A;  2KXH A;  3M8W A;  1NSQ A;  4LFC F;  4ZS6 A;  3T9Z A;  1FKP B;  1U2R A;  4DUZ F;  2Q66 A;  2NS1 B;  3C3L A;  1PBU A;  2KVI A;  1FKO B;  1R3N A;  1VIS A;  4K4X A;  5KFV A;  2C22 A;  1RQ0 A;  5CH7 B;  2APO A;  2FY8 A;  2PSZ A;  2D41 A;  3I0R A;  1Y5L B;  3O6Q A;  3N5B A;  4I67 A;  2B5J A;  1N36 J;  4JI5 F;  3F41 A;  1NJI T;  1IN0 A;  3CDW A;  2YNG A;  1OIA A;  4WJB A;  2FVS A;  3W2W A;  3TX8 A;  4EO8 A;  2HHH F;  2X1B A;  5CD4 A;  2ZM6 F;  3LOU A;  2IMO A;  4KR0 B;  4NA1 A;  3AT1 B;  4L6V 3;  3JAM U;  3T41 A;  1ZOT A;  2QEX S;  4LVN P;  1V5V A;  3M8S A;  2NXC A;  5B0F A;  4OI1 A;  3HJV A;  4DR1 F;  1RAI B;  5HAN A;  2LFV A;  4IQM A;  4XIU A;  4C2M A;  1NO8 A;  4ZOS A;  1X4D A;  2H4W B;  5KG2 A;  2UV8 G;  4X2B A;  3AD7 C;  3RR7 A;  2M88 A;  5DZ6 A;  1FD8 A;  1HBN B;  1X5T A;  4ZIT A;  3M1V B;  1XC9 A;  4JV1 A;  3KG0 A;  1GMU A;  2KZZ A;  5F41 A;  1HQE B;  4DN0 A;  1WC3 A;  1E6V B;  3NG8 A;  2CJA A;  1VBY A;  1DBD A;  3T6B A;  1IBK F;  3DGP B;  4ZP6 A;  1X4H A;  4ZPW R;  1O0P A;  2QTW A;  2XG8 A;  2UVV A;  4NLO A;  1TMM A;  3TAN A;  1XMQ F;  4H4K C;  4PPZ A;  4USH A;  4KPY A;  2LYV A;  3G6V A;  4R0J A;  3EVW A;  5A0Y B;  1SJ3 P;  3BSA A;  2XM3 A;  5E33 A;  2A6M A;  4OYM A;  3K5P A;  1WJ9 A;  1Y0H A;  2C2E A;  4OI2 A;  4Y34 A;  4YUD A;  4C8L A;  4IDK B;  2UXB J;  4QIW D;  3DFE A;  1HWK A;  2OD6 A;  3M1V A;  3TQ1 A;  4A48 A;  2E7X A;  3V2U C;  4NLW A;  3GYG A;  1JNR B;  2J5A A;  3SMZ A;  4L74 A;  4Y28 C;  3M7V A;  4N76 A;  3DGP A;  1S9G A;  3SSR A;  2W7O A;  1KD1 T;  2H51 B;  4BBY A;  1KHV A;  2CPF A;  1TKX B;  2KL8 A;  1S0M A;  5DS7 A;  2Q6B A;  2I38 A;  4LF8 J;  2D74 B;  3M2V B;  2HND B;  5A0Y A;  2BRL A;  2BQR A;  2Y0S D;  4F2R A;  4FPI A;  1JLG B;  2DY1 A;  5KFZ A;  5J2M B;  2FJB B;  1HL6 A;  4PWU A;  2BVZ A;  2CZ9 A;  3HLU A;  3LGH A;  5H1S V;  2AYM A;  2C2R A;  2ASD A;  2ZZM A;  1RWM B;  3MCN A;  2V4J A;  1LWC A;  4IO1 A;  3TUI C;  1ZZF A;  1XK8 A;  2HWH A;  2DR9 A;  1Y5N B;  4O23 A;  1WWH A;  1TK5 A;  1KLN A;  3LP1 B;  1WOO A;  4DL4 A;  2UUB F;  2EK6 A;  3CCZ A;  5T7L B;  3CJ8 A;  2V6A A;  1TKX A;  5KT6 A;  2HND A;  3QWP A;  5AJ3 F;  1X4C A;  2N4D A;  1JLG A;  1F1B B;  4U8Y A;  4RJV A;  4C8Y A;  8RUC A;  3L9Z A;  3DLJ A;  4TQS A;  1U0S A;  2BV3 A;  2CPJ A;  2GV1 A;  1F5B A;  1EJ7 L;  3CDA A;  3HT3 A;  4P2X A;  3TQE A;  4R25 A;  4OX6 A;  2M0G B;  3LP1 A;  1FNX H;  2I2Y A;  2WW4 A;  1DFD A;  4USJ C;  2BJD A;  3DKD A;  4XK8 C;  1YZ7 A;  3EIC A;  2CWK A;  1B0V A;  5B7W A;  5LSL A;  2LEA A;  2B4V A;  3VZH A;  1B7Y B;  3GIK A;  2UUA F;  4K0K J;  4B3S J;  1T03 B;  2RKI B;  2NXU A;  4QJV A;  2W2N P;  4CDI A;  5LXR A;  4X4R A;  2XNQ A;  4OYB A;  3EX7 B;  3H25 A;  3K8V A;  2YWH A;  4M8L A;  4OYX A;  3GV5 B;  3NGT A;  4PG5 A;  2GJI A;  5G0R B;  2AJ1 A;  5HMX A;  4ZCK A;  2RUS A;  3DRS A;  2GC8 A;  3GCW P;  3UE2 A;  2ZBR A;  1KR4 A;  2KXF A;  2ILY A;  1BQN B;  4JI8 F;  4JI1 F;  2XLI A;  3HFZ B;  3KHR A;  4CLZ A;  1R0B G;  1SBR A;  2FGO A;  1RT1 A;  2WB1 D;  2Z57 B;  1T03 A;  2B7B B;  5BYR A;  5D0H A;  7AT1 B;  4Y2I A;  2XI3 A;  2HRY A;  4W90 B;  3ZZ0 A;  4DX8 H;  4M5D B;  1HMV A;  1XNQ F;  4IH6 A;  1RTD B;  4AFF A;  2ZUG A;  4N7T A;  3PRD A;  3RBE A;  2X1F A;  2J7K A;  4DCP B;  4YB1 P;  4DR2 J;  2D7S A;  1PGZ A;  3OUY A;  4DV4 J;  5G0R A;  4EWT A;  3AJ2 A;  4F04 B;  4Y6I A;  2Y9H A;  5LXY A;  2KG1 A;  5BYQ A;  2R2U A;  5KG4 A;  4RR5 A;  1QSY A;  3HCX A;  1H2U X;  2V9W A;  2XSF A;  2ASL A;  1CVJ A;  4I4B A;  1X0P A;  4RW6 B;  2VQE J;  2Z2Z A;  1JB0 C;  1BQN A;  2YKO A;  2AV5 A;  4DR4 J;  4LSL B;  1IVZ A;  4OZ0 A;  2QLJ B;  3QT6 A;  2BW2 A;  3MOJ B;  4DPX A;  1FRL A;  4NA2 A;  2XMK A;  2DHA A;  1I51 B;  2J0W A;  1FJC A;  4X66 J;  3VGS A;  3BSO A;  3AJ1 A;  2CAJ A;  3TOQ A;  1RTD A;  1Q8I A;  4ED4 A;  1UA0 A;  9ATC B;  1UEU A;  2XY6 A;  3IRX B;  1VLY A;  5D0R A;  2RVJ A;  2YQ3 A;  1JJC B;  3U02 A;  5A2Q Y;  1X9M A;  2FD2 A;  1AUS L;  1HHS A;  4CLS A;  4M5L A;  1HIY A;  2HBQ B;  2LQ5 A;  2FLO A;  3MFH A;  2PMW A;  2BA9 A;  3J80 U;  2RDD A;  2XZT B;  1IBM F;  5EWE A;  1RAC B;  1IKY A;  1I94 J;  1FER A;  2GQQ A;  2C2D A;  4ECU A;  1FX2 A;  5LL6 d;  4RNH A;  3CED A;  3K89 A;  3TZZ A;  2CPD A;  1K73 T;  1B3T A;  2IJR A;  2ZH2 A;  3CCJ S;  4RW7 B;  4WCE Q;  4NX9 A;  1V3R A;  1OYE A;  4ENO A;  2HS0 A;  3DI6 B;  3MM6 A;  4PAA A;  3THP A;  2HFS A;  3PYF A;  2B43 A;  4K7Q A;  2PEB A;  2ASJ A;  2ERR A;  3BF4 A;  5KFK A;  1SV5 A;  4EBC A;  3OVA A;  3A8I A;  2YWW A;  2XS2 A;  1N36 F;  1VBX A;  4DSI A;  1HI1 A;  2E29 A;  4WE1 B;  4X4Q A;  2AYB A;  3LP0 B;  4DPW A;  1DQA A;  3HHL A;  1RTZ A;  2V8V A;  3GSD A;  4DS4 A;  5FJ4 A;  1IUJ A;  2XGQ A;  1VQL S;  1WHY A;  4MKB A;  1T9W A;  4DUT A;  2ACY A;  2BEF A;  4MH8 A;  3SZ2 A;  5DQI A;  4ITS A;  4JI2 J;  2CQH A;  3EZO A;  2BE2 B;  3DI6 A;  5B09 A;  2UU9 J;  4B17 A;  3R7S B;  1U7L A;  2M3D A;  1NJX A;  2WSF C;  5L9N A;  1YJU A;  2R2T A;  9RUB A;  2BAN A;  3HFK A;  3ILJ A;  1ELO A;  2AF6 A;  4CLU A;  2W2M P;  4OYW A;  3LP0 A;  3GYN A;  1IR2 A;  3FMB A;  2HHV A;  2DNM A;  2V63 A;  4ID8 A;  3M8Y A;  4ICL B;  4ZK7 M;  1YBU A;  1H0H B;  4JV2 A;  4HT5 A;  3CJQ A;  4LRD A;  2OFG X;  4O4R A;  3EGW B;  2XUL A;  2RML A;  4R8U B;  4JI7 J;  4DJB A;  2UP1 A;  4ILL A;  2DH7 A;  4LFA J;  1Y3K A;  4C11 A;  2M8H A;  3J81 U;  2Z58 B;  1U8W A;  5J2N A;  5HP1 B;  2Y1J A;  3LGM A;  2BBE A;  4UUX A;  4J37 A;  2KXN B;  2UXB F;  1VC5 A;  2DHX A;  4F0K A;  1R8P A;  4I2P A;  4C3M A;  1LW0 B;  4TU8 A;  3QJP A;  2MKK A;  3RAX A;  4LR9 A;  3IR7 B;  4J9R A;  4FVC A;  2AGO A;  4ICL A;  4DR5 J;  5KFQ A;  3I32 A;  2MTL A;  1P9Q C;  2QSW A;  2UUC J;  2IJF A;  2NLW A;  3AFG A;  4QWE A;  2IM0 A;  4OV1 A;  2BYC A;  2J9D E;  4PUO B;  4FPR A;  3HP6 A;  2MQL A;  3ZTR A;  1TVR B;  1J5E J;  3RW7 A;  2FZK B;  3D0H E;  5F0W A;  1SC4 B;  5HJY A;  2VBW A;  3OHB A;  3CPW R;  5HP1 A;  2AJF E;  3E3X A;  5A76 A;  4O3O A;  1N5Y B;  1YTY A;  2V67 A;  1RTJ B;  4ECW A;  4PXB A;  3W7B A;  2AEM A;  2GHW A;  2YNI B;  4DCJ B;  2RDI A;  2XYP B;  4N56 A;  3KJN B;  4QR1 A;  1M5H A;  2HQ3 A;  1HLW A;  3A12 A;  3J81 Y;  4MK7 A;  1TKD A;  2K7K A;  3HVT B;  3T9N A;  1KLM A;  5F8H A;  1EET B;  3M30 A;  2G2Y A;  2RJZ A;  1U48 A;  2QIF A;  1ZA1 B;  1WEY A;  3GR0 A;  3B4M A;  4LF2 A;  4PUO A;  2KHC A;  4BC7 A;  5MLC V;  1S57 A;  5GAE U;  2DYA A;  5E7O B;  1R8A A;  3W5Y A;  4I6Y A;  3H5Y A;  4U8V A;  1N5Y A;  3D1Q A;  2OEJ A;  1RTJ A;  2OD4 A;  2KJV A;  4DSJ A;  1NDK A;  3TAM A;  3Q8R B;  1W7W A;  1H72 C;  3ETO A;  3NWG A;  2YNI A;  3C19 A;  4U96 A;  1HW8 A;  1BD6 A;  1WDT A;  5F8G A;  2MHN A;  2BM1 A;  3OT9 A;  3PIO Q;  1FI4 A;  1U25 A;  5BXI A;  2JFD A;  3O44 A;  4FXD A;  1FES A;  1IXK A;  1EET A;  4QW9 A;  3H98 A;  2D3O 1;  1WC4 A;  3Q83 A;  2ZOM A;  1E6Y A;  4AT1 B;  2C42 A;  1T0T V;  3BZQ A;  1L3U A;  3MEG A;  1VGY A;  4ID5 A;  4PQU B;  1WAC A;  3QFH A;  3FQL A;  2FVP A;  4K0K F;  2IMW P;  4B3S F;  4A8S A;  3QPI A;  1ZAX A;  5KOX A;  3UNY A;  4EBD A;  1UVJ A;  2E9T A;  4NA3 A;  1XN9 A;  2JEI A;  4P7T A;  2DNY A;  4I1T A;  4RW9 B;  2DD8 S;  1CJT A;  1L3K A;  2V50 A;  1YZ6 A;  2V9K A;  1QTM A;  1T94 A;  2HQD A;  3PVX A;  1MMN A;  3RBD A;  3M6X A;  3RRK A;  1RWV B;  3MAA A;  5IC6 B;  3QZ7 A;  3S6E A;  3OL8 A;  1YQH A;  3DYA B;  2JX2 A;  2J6S A;  1JNZ B;  3CMQ A;  4RW4 A;  3MDF A;  1FRJ A;  3ENV A;  3P45 B;  1WG4 A;  2Y0B B;  3JQK A;  4PQU A;  3TW0 A;  2DPJ A;  4OQJ A;  3HK2 A;  1LW2 B;  2AX0 A;  4A8K A;  3ONQ A;  2V2V A;  3PX4 A;  5GAH U;  1HNI B;  1TU0 B;  5IC4 B;  3C16 A;  4RU2 A;  1REV A;  3EDQ B;  2M52 A;  4RW9 A;  4HYK A;  4DR2 F;  4DFJ A;  2MLX A;  4DV4 F;  4IG0 B;  3GSI A;  1VRQ C;  1H6K X;  3BYR A;  2KFY A;  2E5L J;  2AMC B;  2IY5 B;  3S1T A;  2VQE F;  3PV8 A;  3DYA A;  2C3P A;  5DRK A;  2DH9 A;  4PAB A;  1UFL A;  1WOS A;  3V6D B;  1GNK A;  1Z2L A;  1RCX B;  3OR2 A;  4WK1 A;  3CTR A;  3IA0 A;  3M2R B;  1HKA A;  4FF3 A;  4X66 F;  3BGR B;  2PMZ D;  1U0H A;  1VQO S;  1HNI A;  3KUH A;  2F7V A;  2H4Y B;  4J9Q A;  5DM6 Q;  4IG0 A;  3UCG A;  4DCO B;  3QSY B;  2CQ3 A;  4EZ6 A;  1U6F A;  3BR9 A;  2JL9 A;  2XO7 A;  1Q8L A;  3PX6 A;  3WX8 A;  2DT9 A;  1TL1 B;  4ZLL A;  4X64 J;  3HSZ A;  1FFS B;  4NML A;  1HWL A;  3HSD A;  2AHO B;  1I94 F;  4CYU B;  2XHC A;  3V6D A;  5D0E A;  2OPS B;  3TO8 A;  3GV8 B;  2MKS A;  2BJ9 A;  2HLT A;  2KT2 A;  3TZW A;  3AQO A;  1FVS A;  4ZN3 A;  1FXR A;  1EP4 B;  2RS8 A;  4O3Q A;  1M5P C;  1LWE B;  3KK3 A;  4CH1 A;  2DEI A;  3FCV A;  4HEA 9;  3SIP B;  2ZH3 A;  1H7W A;  2PT0 A;  5F8N A;  3RR8 A;  1M1G A;  3MR6 A;  2V8H A;  3C6T B;  5I3U A;  3D5M A;  1FRM A;  1S1T B;  3I4H X;  1U1K A;  4ZPB A;  3N9U C;  4DHV A;  1TL1 A;  2Z4P A;  2MEW A;  5I3Q A;  1U49 A;  4P9S A;  1VJW A;  5GAD I;  5LT5 A;  4J9P A;  3M6W A;  3FMW A;  1PKU A;  1S99 A;  1QE1 B;  3R5A A;  4P72 A;  3A8J A;  1NJZ A;  3ZXW A;  3CD6 S;  4F3O A;  2KFN A;  1N54 B;  3PW2 A;  1RAA B;  4JI2 F;  5ETR A;  4J90 A;  2P2C B;  5KT2 A;  1EP4 A;  4ED0 A;  1LWE A;  4CLT A;  4WP3 A;  2UU9 F;  3H4D A;  5DM7 Q;  1NK0 A;  5GMK a;  4YDD B;  2J0Q D;  3BQ2 A;  5IV3 A;  4GVB A;  3C6T A;  1Q95 G;  1LQ9 A;  1JQG A;  2CG4 A;  2H5J B;  3DLL Q;  4DPO A;  4G3I A;  3BKU A;  1VBZ A;  2IRU A;  1UL3 A;  5U47 A;  2H5I B;  1T05 A;  5B0C A;  3JYT A;  3FKB A;  3E51 A;  2W9B B;  1RT2 B;  2JLE A;  3VGT A;  4IH5 A;  2DNP A;  1WKL A;  3OFG A;  1TL3 B;  5C24 B;  3KNG A;  4YEA A;  2QZ8 A;  3CDU A;  1WG1 A;  4NCG A;  2HWT A;  2WAQ D;  3SV3 A;  2G1D A;  4NZ0 A;  2R42 A;  4JI7 F;  4IRK A;  1FCA A;  4LSZ B;  1VRT A;  1VQ9 S;  4LFA F;  2AGQ A;  1GMW A;  1FWK A;  4TLR A;  3LQV A;  5K8P A;  4Q5V A;  5AE1 A;  3IR5 B;  2AYE A;  4ECQ A;  2L41 A;  3W60 A;  1MLA A;  5IWA J;  5IXU A;  3OXG A;  2LA6 A;  4NL5 A;  4RUH A;  1HW9 A;  4HHU A;  4TLQ A;  4J91 A;  4QWC A;  1EAR A;  4WFZ A;  2RQC A;  2HFZ A;  5K20 B;  1NDC A;  1TAU A;  4C8Z A;  4DL2 A;  1SUQ B;  1I3O B;  2CJ9 A;  2RRB A;  2W9B A;  1RT2 A;  3LPE A;  4DR5 F;  3KJQ B;  1TL3 A;  3NAH A;  3I0S A;  4C48 A;  2CYY A;  2UUC F;  4D3H A;  3PW0 A;  2Q1L A;  3EDR B;  2H3E B;  2JFK A;  2C2O B;  1YX2 A;  3C6U B;  5DLF A;  3ZZU A;  1CG2 A;  1J5E F;  2BJ7 A;  3AJD A;  2OPQ B;  4WF9 Q;  2HMI B;  4RBT A;  1AFJ A;  4KGV B;  3FZB A;  1TK0 A;  3BBC A;  3L7O A;  4QZV B;  5A8K B;  4GMK A;  2RS2 A;  1DUR A;  4URS A;  1N5Q A;  3HDS A;  3BQ0 A;  1BXN A;  1SUQ A;  1EKR A;  4WFB Q;  3V4M A;  5KFL A;  1H38 A;  1F9H A;  1FK9 B;  2F9D A;  4J9K A;  5LMN J;  4U6P A;  2A10 A;  4WZQ A;  3SV4 A;  1AW0 A;  2CJQ A;  2YX4 A;  2BW7 A;  3FVY A;  1DTT B;  3M6V A;  3UVJ B;  1OWX A;  1QSL A;  1U2F A;  3C6U A;  2AZ1 A;  1Q0N A;  4CT8 A;  3DLE B;  5L1K A;  5CCL A;  4GKJ J;  1DQ9 A;  2XMW A;  2MQM A;  4LF7 F;  2EBE A;  4LR7 A;  2B56 A;  1UTA A;  4NLT A;  3VHQ A;  3M8Z A;  2BUN A;  4W4M A;  3I55 S;  5D4O A;  4JOU A;  5A8K A;  4ZHR A;  1P8G A;  4M95 A;  4DSK A;  1RWK B;  3IWX A;  5ETM A;  3C46 A;  2AEF A;  1D9A A;  3VAI A;  1HYS B;  3I31 A;  1FHT A;  3BV8 A;  4GC6 A;  3BN4 A;  1RU2 A;  2M70 A;  4WU3 A;  1U1P A;  1WF1 A;  1DTT A;  1S49 A;  4USU A;  3TYT A;  2RF2 A;  1UW4 A;  4YFU A;  1R6Y A;  1IQT A;  3DOM B;  1T02 A;  1X4F A;  3DLE A;  3FZ2 A;  2KM8 B;  3OXF A;  1TKT B;  1T3O A;  3FNN A;  3NCP A;  4FYY B;  2XS7 A;  5D8H B;  2A0F B;  1RHM B;  1UWB B;  2W9C B;  1YJV A;  3BPD A;  4TQR A;  1QVF R;  5A8R B;  4JUZ A;  3R9L A;  3I9Z A;  2YH1 A;  5D77 A;  3WC0 A;  3VCD A;  4X84 A;  1MN7 A;  3IGV A;  5CA5 A;  2HHQ A;  4KHM A;  5IM0 A;  1TQL A;  1YWX A;  3NCR A;  3CC2 S;  1CC8 A;  2CZV C;  2WON A;  4ZP9 A;  4J9M A;  3DOM A;  3J81 j;  3WQP A;  5IT9 U;  3KG1 A;  1G4C A;  2HEK A;  4I64 A;  3U1N A;  4JI0 J;  1N5T A;  2DNG A;  3WIV A;  3AB4 B;  1UWB A;  2W9C A;  2CPZ A;  2MY7 A;  4H54 A;  3KMS A;  5B0B A;  5A8R A;  4OV6 A;  1TKZ B;  2CWX A;  4OL8 A;  1S5Z A;  4Q0B B;  4NLY A;  2WVB A;  4RX6 A;  3FEY B;  1UCN A;  2WW8 A;  3S01 A;  3GFZ A;  3CCW A;  3VV2 B;  4OHW A;  1YIJ S;  4CLW A;  4H4K A;  3AXM A;  1SL1 A;  4AND A;  1NEE A;  1LOU A;  4CQ1 A;  3BO4 A;  2OIH A;  5J1P A;  4LQ9 A;  2E5L F;  1WNE A;  1CJV B;  2RU9 A;  4LRF A;  3CXC R;  2FJA B;  4HL9 A;  2JOQ A;  1UFW A;  4KFB B;  1N32 J;  1U47 A;  5ETN A;  2K8G A;  2HLU A;  4X4V A;  2MZ1 A;  5KFC A;  4PG4 A;  4C0B A;  4V1A k;  2DCU B;  1KKH A;  1U09 A;  2ILZ A;  1YGY A;  2PE8 A;  2GAG C;  3QLH B;  3Q8P B;  2GO8 A;  4J9O A;  4YN3 B;  2HBZ B;  1R0C B;  2G0C A;  2NCK L;  5ITH A;  1C4A A;  1IBL J;  5IT9 Y;  2R8J A;  5KG5 A;  2LKZ A;  4ED1 A;  2O67 A;  1B4S A;  4OI4 A;  3HMJ G;  3QGP A;  5KFY A;  3KK1 B;  4ERD A;  2WB4 A;  2FJE B;  4X64 F;  1ZAW A;  2IBK A;  3P5B P;  3QZ8 A;  3W66 A;  2E9Z A;  3F56 A;  4ECX A;  3CD7 A;  2Q79 A;  4OI0 A;  5CYJ A;  3GIJ A;  2XHW A;  2WSE C;  2IM2 A;  1URN A;  1RHQ B;  1RHR B;  3AOB A;  3R2C J;  1KOH A;  3BSC A;  4DFK A;  4LRC A;  5D4P A;  3TP2 A;  2IVY A;  2ZC3 A;  5HJX A;  4IKA A;  3BO3 A;  4CH7 A;  1DAX A;  2ATL A;  5HMY A;  2CQC A;  2WVC A;  1V6H A;  1QM9 A;  2WVE A;  2VC1 A;  2P8I A;  1VCT A;  2B6A A;  3DM2 A;  3SDE B;  1PIE A;  2JLF A;  2QMU B;  1R7I A;  4QYR A;  1CBK A;  2HHX A;  2GZO A;  3LA0 A;  2DNL A;  1TTH B;  4AL5 A;  3HD1 A;  2Z0G A;  3I6P A;  4JYA F;  3CSK A;  4NLQ A;  4PG8 A;  2B4O A;  2MKC A;  2V2Z A;  2YX1 A;  3U27 A;  2A2C A;  1ZH5 A;  1HNW J;  3KLE B;  4QR0 A;  5ETS A;  2J0S D;  1SXL A;  3Q2T C;  1VQM S;  5K14 B;  1BQM A;  4MJK A;  3OW2 R;  3VVT A;  4P6Q A;  3JSR A;  1TMJ A;  3SDE A;  1RIS A;  3R6G B;  3DOK A;  4FYW B;  2VFS A;  4F26 A;  2RU3 A;  3ZNJ 1;  4IR9 A;  2ZH5 A;  1WD6 A;  1VRU A;  1YJN S;  1UVI A;  4KGX B;  3PKM A;  4DXL A;  1C1B A;  3V4I A;  4WXW A;  3M8Q B;  4EFA C;  4CLK A;  4ZVF A;  1OSC A;  4F8R A;  2IBO A;  2CDR B;  4MIB A;  2LQ8 A;  2WVD A;  2FB0 A;  5EHH A;  3H42 A;  4ED5 A;  2R8K A;  3Q8V A;  4YHH J;  3GZ7 A;  4IFY B;  4ZPD A;  1Y00 A;  4K4S A;  3CW2 C;  3MM5 B;  2AT1 B;  2CNN B;  3KLI B;  5C2G A;  3DLK B;  4HKQ A;  3T5H A;  3ZZO A;  1N6Q A;  3MMA A;  2CQI A;  2XWX A;  2YKN B;  2CG8 A;  2FPH X;  3W1Y C;  3W65 A;  4XDD A;  5C7P A;  1HA1 A;  5J1N A;  2KVQ E;  2YNH B;  3J7Z 5;  3VAG A;  1KEK A;  3LGN A;  3O5T B;  3DU5 A;  5CYQ A;  5HRO B;  3CJ4 A;  3B6B A;  2CAD A;  3QSI A;  1OO0 B;  2E1M C;  4GRS A;  2Y1L B;  2WOM A;  4DSL A;  2ALY B;  4ZLP A;  3AQP A;  1EQ0 A;  3MMC B;  4ZCL A;  2CQ1 A;  3HHD A;  1DRZ A;  5E0O A;  2H1Y A;  4C6A A;  4M5M A;  1Y9O A;  4IFY A;  4M5G A;  1RKI A;  3ZTQ A;  5F8L A;  2P6S A;  2XZW A;  2GMJ A;  5KFP A;  1S12 A;  3MM5 A;  1U45 A;  3M32 B;  2H5E A;  4DI6 A;  3M2U B;  2YKN A;  4OYA A;  3DRY A;  3ADA C;  1UJ4 A;  5E3A A;  3SFU A;  2HHP A;  4X4O A;  3MGJ A;  3OQ2 A;  2YNH A;  2RQK A;  2AJ2 A;  2A18 A;  3UWT A;  2V2K A;  2KU7 A;  3NMR A;  5LMN F;  5HRO A;  1RT4 B;  1PC5 A;  1F2G A;  3GFH A;  1TV6 B;  3GJS B;  2A1B A;  4EUV A;  4WU2 A;  1TFY A;  4QPX A;  2HGM A;  2HRT A;  2YBV A;  1XR6 A;  2JC0 A;  4K4Z A;  5DDO C;  1XEZ A;  3MR2 A;  3UQS A;  2GVZ B;  4GKJ F;  1BWV A;  1M5V C;  1VHF A;  3PCO B;  4UZC A;  1CPZ A;  4JI3 J;  1VOM A;  3M32 A;  4PRF A;  2EFV A;  1KSP A;  1S0N A;  3BN7 A;  3M2U A;  4I7F A;  1M5S A;  5KT7 A;  1DAR A;  1S1X B;  4O44 B;  3PZP A;  3EZ5 A;  2V8G A;  2ZH1 A;  2ZBP A;  2O5D A;  5FDL B;  2NRE A;  1T7P A;  3K59 A;  2D1C A;  4CCH A;  2G4B A;  1PBA A;  4TY9 A;  4CO1 A;  1RT4 A;  3M8P A;  2MZT A;  4H4M B;  1TV6 A;  1D9D A;  3ENW A;  3NGU A;  3TUP A;  1P6T A;  4CTA B;  3O1L A;  4HAC A;  3SCK E;  2JNJ A;  3X3U A;  2YWK A;  4MFB A;  1HWJ A;  3NGK A;  2XMU A;  4DUZ J;  2M9K A;  3FFI B;  1N0U A;  4F36 A;  5FLX U;  4BDP A;  3PAC A;  2RHQ B;  1X4B A;  3ILL A;  2X3G A;  1K0T A;  1VQ6 S;  3D3C J;  3QBC A;  3WIU A;  2Q3P A;  3PHE A;  5KFS A;  4V19 X;  3TVZ A;  4JI5 J;  2B9Y A;  1VQ8 S;  3MED B;  5CZV A;  3MAH A;  5IT0 A;  2OSR A;  1LXN A;  4O3N A;  3NAI A;  2K3K A;  2E5J A;  4CTA A;  4U7C A;  1T95 A;  2NZ4 A;  2DH8 A;  2PN6 A;  4JI0 F;  3GR1 A;  3QT5 A;  3U1L A;  2KT5 A;  3TWZ A;  3W8G A;  4P74 A;  4IG3 B;  1I1G A;  1RCO B;  2DNK A;  4HI2 A;  4Q45 A;  2LQB A;  4EYH B;  4FN5 A;  1BY9 A;  4KO0 B;  2QLW A;  2O01 C;  3R7B B;  2BJ8 A;  3P96 A;  2DPI A;  1IKW A;  1D0E A;  1MW7 A;  3MEE A;  3OL7 A;  3MED A;  2ZHA A;  4UF4 A;  4LBI A;  1NZA A;  1HD0 A;  1CS4 A;  3FRZ A;  2MZS A;  4RUC A;  1KON A;  3T1A A;  5HMZ A;  1X4A A;  4R0E A;  1N32 F;  1C0T B;  3GFX A;  2EFN A;  3TNV A;  3PRV A;  5GAE I;  2DGS A;  2AWZ A;  1UAW A;  5LM7 E;  1K1S A;  3UN5 A;  4IG3 A;  1QSS A;  2DGU A;  4DX6 A;  1GH8 A;  2MHE A;  1IBL F;  1MSW D;  1R0A A;  2CFX A;  1JJ2 R;  1ULR A;  1V3Z A;  3NWR A;  1VMB A;  4TU9 A;  3VAF A;  2VJU A;  4USW A;  5G4D A;  5KFH A;  2KI2 A;  1G2E A;  3PFE A;  2GJF A;  2CQG A;  1RHJ B;  3JTN A;  1R8B A;  4YR0 A;  4F4W A;  4C97 A;  2VBY A;  2HKE A;  4O3R A;  1C0T A;  2CPX A;  1UVL A;  4DR6 J;  3D7S B;  3UFC X;  3FEZ A;  1MG7 A;  3UDL A;  1WOR A;  4KGZ B;  4F67 A;  5KG7 A;  2EBG A;  4ZVT B;  1SH2 A;  4L3N A;  2HIQ A;  4LRE A;  2YWF A;  2HNZ B;  5K8O A;  2XLJ A;  5KT4 A;  2PEH A;  1O8B A;  4NEY A;  1LEO A;  1GXU A;  1WDD A;  3P49 B;  3FSY A;  1EIY B;  5AXM A;  4DL6 A;  1N5S A;  3EGZ A;  3CC4 S;  2ZIT A;  1SJR A;  2R8I A;  4HHJ A;  1OQ3 A;  2X1A A;  3EMT A;  2ZNZ A;  3N6L A;  3CCV S;  4B9V A;  4CM0 A;  1Z2Z A;  2IVM A;  5D4L A;  2AEJ A;  2F1F A;  2WSC C;  2XYG B;  5M2P A;  4ED7 A;  1CUL B;  4B3M J;  3RZA A;  1HNW F;  1NB7 A;  3HHN B;  5HVF A;  5J2Q A;  3V5R A;  3JB9 k;  1G6B A;  2ZE2 A;  2G2Z A;  1DTQ A;  4QIE A;  2QLB B;  5DQH A;  2HNZ A;  1F9E B;  3H59 A;  2KT3 A;  3OR1 A;  1RAG B;  5GAH I;  1FRX A;  1R6V A;  3CCR S;  3J7Z T;  4LBP A;  4OLO A;  1R89 A;  1ZPW X;  3CDB A;  2LXU A;  3G2X A;  1VR6 A;  2W1B A;  1U1M A;  1V9O A;  2MY8 A;  5H9F J;  1NK9 A;  3D0I E;  1W2B R;  2QA4 S;  2JC1 A;  4L72 B;  6FD1 A;  1QJH A;  4WTY A;  4YHH F;  4KV8 B;  2ROE A;  2UUA J;  4FXV A;  1SC6 A;  5DG7 A;  1HNZ J;  1S9E B;  2HK2 A;  2QFJ A;  2A2D A;  3CE8 A;  4YOE A;  1FX4 A;  2IDL A;  3UR0 A;  2G2O A;  4RNM A;  3CC7 S;  3KLG B;  3ETM A;  3RW6 A;  4A8W A;  3B4D A;  4KGM A;  4JI6 F;  4HH1 A;  2R7W A;  2F8M A;  1AT1 B;  1RWW B;  4LF9 J;  3PKY A;  1QAI A;  2FQQ B;  3H8Y A;  1U1Q A;  2W4P A;  5J2P A;  5SUH A;  1NSA A;  1SJ4 P;  1I5O B;  2XSJ B;  1VJQ A;  4JI1 J;  3DXS X;  1YDL A;  1D9F A;  3FGV A;  4KV8 A;  3P3D A;  3C14 A;  3H20 A;  5CAA A;  3MM7 B;  5BJR A;  2XMJ A;  1RAD B;  5CHC B;  4XTT A;  2PO4 A;  3N4W A;  3MZI A;  2GW8 A;  1W26 A;  5DDP C;  3DXB A;  2CIM A;  5DDQ C;  2VFR A;  1C4C A;  3TUZ C;  3OVS A;  2GJ2 A;  1G1X A;  2GQC A;  2ZHO A;  1UJ5 A;  4HDG A;  2ACM A;  3A3P B;  1M90 T;  3WC2 A;  4FF2 A;  2RNE A;  4XPE A;  5SZT A;  4PKD B;  4IRD A;  1RT5 B;  1P9Y A;  2QL5 B;  3MUR P;  3UDC A;  1YRU A;  3BYP A;  1J27 A;  1FWL A;  1UEV A;  4P2M A;  4ZPC A;  2MKI A;  4ZCM A;  5HLF B;  3AH6 A;  4ATN A;  1VQY A;  4F4X A;  2NYH A;  4J5O A;  4CT9 A;  5AXK A;  1HFE L;  5CQG A;  1S6P B;  3I87 A;  3MTK A;  2VU5 A;  2ZDP A;  2HZC A;  5K9F A;  5E3P A;  3D4J A;  1YG0 A;  2V94 A;  1SB6 A;  4M94 A;  1NBE B;  4JI3 F;  4QIV A;  3A8K A;  3RUB L;  2VBZ A;  2RIL A;  1NHV A;  5I4M A;  1VQK S;  3OSN A;  1N33 F;  3R5C A;  1LWX A;  3HX9 A;  4F4K A;  4OYO A;  2MLY A;  4LSN A;  5IQ6 A;  1UVN A;  2VG5 B;  2BOP A;  4P10 A;  2I1R A;  1S6O A;  4W92 B;  3G6X A;  4J9S A;  3CGI A;  2FY1 A;  2YNG B;  4F0H A;  3IM9 A;  1NND A;  2YPZ A;  3W2W B;  4J9V A;  1WOP A;  4MT1 A;  1Q78 A;  1RZM A;  3T19 A;  2CQ4 A;  4PG7 A;  1S0O A;  1S6P A;  1SCJ B;  1HD1 A;  3M9N B;  4PR6 A;  5HMW A;  4Y2A A;  1ZBT A;  5J1E A;  2Y1I A;  1BMQ B;  2RRA A;  2Y8Y A;  1FXL A;  4KIA A;  4L3K A;  3VWS A;  2AU0 A;  3LWM A;  4ZVH A;  1HWI A;  1GTH A;  2R7V A;  1CQN A;  4C3L A;  5F3Z A;  4ZIW A;  3MF5 A;  2YTC A;  3OVB A;  4BWJ A;  2VG5 A;  2VG6 A;  5KTQ A;  2KYZ A;  3HI9 A;  1RWO B;  3H5U A;  4I68 A;  2MJU A;  2GMH A;  2IAJ B;  4DV5 J;  4C0O C;  5IZH A;  1U02 A;  1NJY A;  1UPP A;  3ZZZ A;  4WKR A;  2E1P A;  3MWB A;  2GIR A;  1KS2 A;  2HK3 A;  1DY3 A;  2X7I A;  2BJE A;  1GFW B;  1YJ7 A;  3P6Y C;  3ELH A;  2Y3Y A;  2FC8 A;  3PR5 B;  3LP2 B;  4ZVQ B;  2ADC A;  1OPZ A;  3Q23 A;  4E0D A;  4O4G A;  2GQ2 A;  4G65 A;  4OLP A;  3RG6 A;  4CO5 A;  4C0H A;  4BLG A;  4DV1 J;  2OI2 A;  3D28 A;  2RT3 A;  2HRU A;  4X65 J;  1Q82 T;  5THW A;  1SH3 A;  4QBU A;  2F65 A;  2XEX A;  3OBI A;  5KT3 A;  4WII A;  3ISZ A;  1LWF B;  8AT1 B;  2W25 A;  2UXC J;  1NK5 A;  1ZA2 B;  2HZA A;  5AE3 A;  2IAJ A;  3SQG B;  4ZLN A;  4NPO A;  2U2F A;  3K17 A;  3QGG A;  4TYA A;  4ANC A;  2HAI A;  1S9G B;  3LP2 A;  4ES1 A;  2VKR A;  4NCB A;  1A7G E;  2HWI A;  4F25 A;  1H98 A;  1H2T Z;  3VVU A;  5L46 A;  3DRP A;  1NUE A;  1LWF A;  2VPX B;  4IOC Q;  2K1R A;  5BR8 J;  2V4J B;  2FGC A;  1LWC B;  2OLW A;  2FHK A;  3SQG A;  1SC1 B;  1NSP A;  1K47 A;  4LUB A;  4C4W A;  3KHG A;  1VFJ A;  3MPU B;  1S1U B;  1UVM A;  3CF5 Q;  4DR6 F;  1QAJ A;  1UPM B;  4OZJ A;  1RAF B;  4QPT A;  2B9W A;  3RRH A;  1RAE B;  1C0U B;  2D9O A;  3OFF A;  1HBM B;  4GKK J;  3V6J A;  2X51 A;  4EEY A;  3N01 A;  4LF5 J;  3OLB A;  3GB0 A;  1S72 S;  1WSR A;  3DN9 A;  2LQ9 A;  4C8N A;  2ZH6 A;  1FVQ A;  4NXM J;  2ZVS A;  2XY7 A;  4BCA A;  4ELT A;  4IOA Q;  2LMI A;  3H4B A;  1ZAV A;  1PJ7 A;  3CVK A;  2DXE A;  2YY3 A;  2ZJP Q;  4P52 A;  4DUY J;  5HVG A;  4NLG A;  4PWW A;  1S1U A;  1MML A;  2FHO B;  3MM8 A;  1IKX A;  2W2O P;  3W62 A;  2SXL A;  4B3M F;  1C0U A;  4CIO A;  2QYC A;  1HBM A;  5DG8 A;  4JV0 A;  2FDN A;  3LH2 S;  2NUH A;  3WZ0 A;  4KT0 C;  4KHR A;  4B9L A;  2WHO A;  1GK8 A;  3CMA S;  4YDX A;  3TJ8 A;  1K8A T;  1Y10 A;  3MAQ A;  3IGN A;  1RT6 A;  3HZG A;  4LRA A;  3KHL A;  1CJU B;  1IKV B;  3FC9 A;  1BQX A;  2LP4 A;  1NRK A;  4LIR A;  4ILR A;  3DOL A;  2JZ5 A;  2E5H A;  5FII A;  1SQE A;  2WZ1 A;  1F60 B;  1X9S A;  4RL1 A;  3TAR A;  3ZC4 A;  3G8Q A;  2BJ1 A;  2VH7 A;  1X5O A;  3DRS B;  3SCJ E;  1FWP A;  1SQG A;  3KWM A;  2R3V A;  1N0V C;  5BYS A;  3PFO A;  1N34 F;  3JS9 A;  2YH0 A;  3THT A;  4I0W A;  2DRA A;  1RT1 B;  3MPY A;  1HNZ F;  1UEK A;  2V2Q A;  1C2P A;  3TVK A;  1S9F A;  2LU2 A;  2ZBI A;  1CJU A;  3IC1 A;  1IKV A;  2GML A;  3VAH A;  2LEB A;  1HMV B;  2QC3 A;  1Z4U A;  3Q8Y A;  2ZD1 A;  4J9N A;  4WZM A;  2HSE B;  6AT1 B;  3CO0 P;  2NYI A;  3F44 A;  2MKY A;  4CNY A;  3OUY B;  4ELU A;  1RAH B;  2WVF A;  4LF9 F;  3PEJ A;  2ZJR Q;  1KDN A;  3TA2 A;  4PQA A;  1NHK L;  4P2S A;  2NQP A;  2OPP A;  3FBC A;  2J7U A;  2VKZ G;  4A8X A;  4E2F B;  4QWA A;  1TL7 B;  3VAK A;  5A2Q U;  1JLQ A;  3TJA A;  1JLE A;  4DG1 B;  1OS5 A;  1M1K T;  3EM1 A;  4ZN1 A;  4UST A;  2MZQ A;  1HBU B;  5IT4 A;  2OML A;  2VPY B;  3E01 A;  3LUY A;  3SYZ A;  1N4L A;  4HLB A;  3DDK A;  5L1J A;  3K0J A;  5CXT A;  1L3S A;  1FE0 A;  4CO2 A;  1RI7 A;  3TR5 A;  4QYZ K;  5A6W A;  1MU2 A;  3TZX A;  3SCL E;  4QU7 A;  3DCA A;  1WC6 A;  2N7Y A;  3GJT B;  1JX4 A;  3GJR B;  1YI2 S;  4UOC A;  5T41 A;  3OTB A;  4WPA A;  5ETK A;  3AY0 A;  2IPO B;  3GMG A;  2K3I A;  3NGS A;  1DQ8 A;  3POT B;  2MST A;  3AXK A;  3HKW A;  5HO4 A;  1N5V A;  5ETO A;  2HVD A;  1TL7 A;  3KXD A;  4A8Q A;  4DG1 A;  1IKY B;  2HNY A;  2F8H A;  1IQZ A;  4WFY A;  4FF4 A;  4DX7 A;  1HBU A;  3IAM 9;  2UVW A;  1ZM9 A;  1LFP A;  2MKJ A;  3MM6 B;  2CQD A;  2WTF A;  2RE1 A;  4K5S A;  1F6T A;  4EYI B;  1S4E A;  1FDD A;  3OD2 A;  1SV5 B;  1RGV A;  3M4X A;  2KH9 A;  3N79 A;  4EK2 A;  1XWL A;  1KNZ A;  2WBM A;  3POT A;  1N48 A;  1VIO A;  3Q8S B;  4OIX A;  3MTJ A;  1L5U A;  3HHL B;  4A4J A;  2AP6 A;  2VZ9 A;  2C3U A;  1TP7 A;  4YP3 A;  3K5M A;  4ZVS B;  1RKJ A;  3AA9 A;  4DSF A;  2IA0 A;  3N6N A;  3FCH A;  2QRR A;  3ZTP A;  3KFW X;  2D3O R;  5K5M A;  7FDR A;  2JEF A;  4P7V A;  1HHT P;  3IXQ A;  4QW8 A;  2QT7 A;  2HQI A;  2DVI A;  2R7R A;  5DGA A;  1NCL A;  3C8Y A;  5LJ5 Y;  2GIF A;  2BAN B;  2FJW A;  1ZS6 A;  1C1C A;  4E8U A;  3BPS P;  3CUN A;  1KRP A;  4O3S A;  1NK6 A;  3LO3 A;  4DV5 F;  2JH3 A;  3EUN A;  1U1R A;  3CO9 A;  3GJQ B;  3TAQ A;  4HVZ A;  2Z2M A;  3FQK A;  3DHW C;  2EKY A;  1GXT A;  2NZC A;  4DV1 F;  2EK1 A;  4X62 F;  1F3V A;  3LF0 A;  1VLO A;  2BOA A;  4C11 B;  4X65 F;  5HK4 A;  3NOG A;  4FDF A;  5J2N B;  2QV6 A;  1S6Q B;  5ADZ A;  2QX0 A;  2W7A A;  1MN9 A;  2L9D A;  3W63 A;  4MMO A;  2UXC F;  2VF3 A;  1WC0 A;  2RH3 A;  5LJ3 Y;  4I2P B;  3LTO A;  3QT8 A;  1FFG B;  1KP6 A;  1S1V A;  2DB1 A;  2LEP A;  1URR A;  3T5K A;  4KY3 A;  3CCU S;  1VQ5 S;  3V6K A;  4ED6 A;  3BGF A;  4N41 A;  5E5N A;  1KFS A;  2XMA A;  4CWB A;  2DIT A;  4GVL A;  1TK8 A;  3MR7 A;  4MTP A;  2KTQ A;  4RWX A;  3CJR A;  3AD9 C;  2DCL A;  4DMZ A;  2GO9 A;  4PPD A;  3RB4 A;  4RNF A;  2HQG A;  4NRT A;  3BH6 B;  4DL7 A;  1J2V A;  3PDN A;  1S6Q A;  2DIV A;  4BWM A;  1OQ6 A;  1FF2 A;  4DQI A;  5KFX A;  1FJG F;  2DJW A;  4UZB A;  2MQP A;  1YVF A;  5BR8 F;  4CLP A;  3I5C A;  5C25 A;  3ZNU A;  1HI0 P;  5KAK A;  3G86 A;  1AUD A;  3GIM A;  2R2S A;  2PGC A;  3D2W A;  1ROF A;  3OFH A;  3MUV P;  2RDJ A;  3I96 A;  2DRD A;  4IYQ A;  1KLM B;  3M30 B;  1DZ5 A;  3HPO A;  1JLB A;  1J5O A;  2ZDO A;  5HAO A;  3KDO A;  4GKK F;  4B9S A;  1HPZ B;  3NOC A;  3G82 A;  1Q53 A;  4KBI A;  4LF5 F;  1PJ6 A;  4YB6 A;  3RBX A;  2YNF A;  2DIU A;  4EO6 A;  2KG0 A;  4EZ9 A;  2P9G A;  4PYD A;  2DK2 A;  3AAW B;  3PYG A;  1F5C A;  2PC6 A;  2DGT A;  4A8F A;  3IFE A;  3TAM B;  4EI2 A;  4NXM F;  3KJF B;  2MGZ A;  1IR0 A;  2HBR B;  7FD1 A;  2B9E A;  2JEJ A;  1CEZ A;  2CXE A;  3R27 A;  4DFM A;  1ITP A;  3RB6 A;  1EAY C;  4FKY A;  4DEZ A;  3AOA A;  2MSS A;  1TR0 A;  1CQM A;  1XER A;  2XMV A;  4DUY F;  3KLF A;  2HVH A;  3A3O B;  1RHU B;  4R5P B;  4UY8 T;  3VAL A;  1E6Y B;  4JI4 F;  1QUV A;  3MEG B;  1HPZ A;  3KLH A;  3UN2 A;  4ID5 B;  2ZH4 A;  4LF7 J;  5B0E A;  2DNQ A;  2MXY A;  1TUG B;  3W8P A;  2DHG A;  2YKP A;  4DR7 J;  4UW2 A;  1YBT A;  4K2J A;  5C42 B;  2KZM A;  5KG6 A;  2J6T A;  2C3M A;  1CJT B;  3EGN A;  5IQQ A;  5DGB A;  2RSQ A;  4KHP J;  3AOD A;  5EUH A;  4K4W A;  3GYX B;  2GHV C;  3MAA B;  4R5P A;  4C8K A;  4TY8 B;  1RB0 A;  3QRR A;  1W25 A;  5B0A A;  5KFJ A;  2D3Z A;  2HHW A;  2ZUA A;  2XS5 A;  4RW4 B;  4Y0F A;  3MUT P;  4UOG A;  1ICE B;  4FYX B;  1RP5 A;  1SKW A;  1O5J A;  1U1O A;  4N77 A;  1A0O B;  4DQQ A;  4Z37 A;  2GHP A;  4XO0 A;  3JQJ A;  5C42 A;  3C16 B;  2P9E A;  1WHX A;  4RBU A;  4DOZ A;  2IYI A;  1TUV A;  1REV B;  2YX7 A;  1XMO J;  4LVO P;  3SI8 A;  1WHW A;  2DNZ A;  2YXL A;  3JSY A;  3L7P A;  3FBB A;  4NLS A;  1U6B A;  1Y11 A;  5ETV A;  4TY8 A;  3NS6 A;  2FTR A;  1NH7 A;  3A1Y G;  4I2Q A;  4DFP A;  2WCX A;  3O2I A;  3HVA A;  4ETX A;  1U24 A;  2POK A;  4QIF A;  1KVK A;  1T3N A;  2VDI A;  2ZFH A;  5HBM B;  1PSD A;  4UOH A;  4O3P A;  5E3R A;  2MPU A;  3H90 A;  4F4A A;  4ED8 A;  2XMM A;  3CME S;  1NAQ A;  4FKX A;  1U6Z A;  5H9E J;  2I6W A;  3OR2 B;  5IFM A;  2DO4 A;  4P73 A;  3ILO A;  2GAH C;  1H7X A;  3OXL A;  1U0H B;  2GX8 A;  3JQM A;  4DV7 J;  3D3B J;  5H9F K;  5ETL A;  1OMS A;  5L9X A;  4MYT A;  2I9S A;  2AX1 A;  2BR0 A;  5DZ7 A;  1AB8 A;  3EVM A;  2IJN A;  4DV2 J;  2F8E X;  4TKT A;  2PD1 A;  3CIM A;  1CSJ A;  1EHW A;  1IJF B;  2I5J A;  3GIL A;  3IG1 A;  1T9X A;  3K7R A;  3PO5 A;  5HBM A;  2RQ4 A;  1HQ2 A;  2HVI A;  2OJ3 A;  2EWH A;  3QIP B;  4MK9 A;  1HQU A;  1L3V A;  2HFU A;  3W2V B;  3KDN A;  2KYX A;  1RU1 A;  1RWU A;  3KK3 B;  1VDH A;  3OV7 A;  3C2P A;  4ZP8 A;  1YJ9 S;  1NK4 A;  1DJ0 A;  1S6U A;  2M4M A;  2OEM A;  5I3U B;  4DQS A;  1N52 B;  3BM7 A;  2PII A;  2EI5 A;  2G13 A;  3VF0 B;  2FHM A;  3O3L A;  1FKP A;  3KNA A;  2EKN A;  3B78 A;  2IM1 A;  2VON A;  1FKO A;  5FD1 A;  2FJD B;  1Q16 B;  2AYG A;  1PCA A;  4Q44 A;  4N5S A;  2IC3 B;  4LT6 A;  4Y65 A;  3P8B B;  3QIP A;  5KOW A;  3R5G A;  4WTO B;  3HVR A;  4CRJ A;  2KM8 C;  2XQC A;  3W2V A;  3AA8 A;  3D6H B;  8ATC B;  1VQN S;  3TJ9 A;  3IO1 A;  3WBZ A;  2JJ4 D;  2VFU A;  1PIL A;  4ZPT R;  2JVR A;  3KKF A;  1WSV A;  4KJI A;  4GVB B;  2MJN A;  4Z2X A;  1FKA F;  5KFE A;  1X7V A;  1TZ0 A;  4NYP A;  2IVF B;  1HAR A;  2Z30 B;  3R6L B;  4G1I A;  4M5N A;  1VIX A;  3QMQ A;  1SL2 A;  2YQ0 A;  2KRR A;  1APS A;  2VIH A;  2CQP A;  3J7Y U;  4ANE A;  4JYA J;  2DGW A;  1T05 B;  4JV5 J;  1ZM4 A;  2J9C A;  4Y00 A;  3JYT B;  2KB2 A;  3ZZY A;  2QA1 A;  4WFA Q;  1RLC L;  3NP5 A;  3FBE A;  4J9L A;  2IC3 A;  3NKY A;  3PHT A;  3BH7 B;  4NCG B;  4DQR A;  2OSQ A;  1HBN A;  3JAM Y;  2CRL A;  3D67 A;  2O66 A;  4URG A;  2BQU A;  1VRT B;  1EB0 A;  2W2Q P;  1HQE A;  3DLB A;  5KFO A;  1RTI B;  5JMN A;  1E6V A;  4Q8E A;  2BAC A;  4A8O A;  1XQI A;  1FDB A;  4E98 A;  3LAM A;  2E9R X;  3TVY A;  2PFF B;  3MCM A;  2CJK A;  3JSB A;  1TL5 A;  3M9O B;  3HO1 A;  2H9Z A;  2ZC4 A;  2OMO A;  1REG X;  3RTV A;  1Q5V A;  2FHJ D;  3GLJ A;  1SPB P;  3H5X A;  1CC7 A;  2Q6C A;  3PW7 A;  3B8H A;  4CI0 B;  2M5Y A;  3K8W A;  4K4V A;  2L08 A;  1T9U A;  3MD1 A;  4LJM A;  2EFG A;  1VQS A;  2PDA A;  3I0S B;  3A3N B;  2MLZ A;  4AXI A;  2P9C A;  2HS4 A;  3UPF A;  4IDK A;  3DDN A;  3D6F B;  2KDO A;  4A46 A;  4NRU A;  2OTJ S;  4KRW A;  1HBO B;  2RIJ A;  1HR0 J;  1UP1 A;  1RTI A;  2HGL A;  1SJQ A;  5L1L A;  3P4U B;  4RUB A;  2QL9 B;  4ZIV A;  4WYW A;  1NKC A;  2R7Q A;  1FNO A;  2VL1 A;  4ZMM A;  5GVQ A;  1RK8 A;  3BBF A;  4FP9 A;  3QFW A;  3OTO J;  1T9Y A;  4P75 A;  4ER8 A;  2D69 A;  3ZTS A;  4PCQ A;  3QNW B;  4NZ7 A;  3W61 A;  5HSP A;  3M2V A;  4NLX A;  4IFV B;  1WC1 A;  1FA0 A;  3QJJ A;  2OKQ A;  2RUG A;  2DR8 A;  4AXJ A;  5J2M A;  3OJS A;  2AJ0 A;  2HYI B;  1TL4 A;  4H4O B;  1MWY A;  2DKO B;  3H2V E;  2DHS A;  1CJK B;  2FLN A;  4M1K A;  5IOL A;  2F4F A;  4QWD A;  2BXJ A;  1HBO A;  5JXS A;  4AYB D;  1QY7 A;  5E41 A;  2VD3 A;  2VC0 A;  1Q81 T;  3HZE A;  2ADB A;  1WEX A;  1AFI A;  2EG1 A;  2DO0 A;  3KG4 A;  3PJW A;  3DRX A;  3Q0A A;  4RBV A;  3IR6 B;  4NAS A;  4ZHR B;  2VHG A;  3A4T A;  2EPI A;  3IBW A;  5T7L A;  3QT7 A;  1XNR J;  3QAU A;  4DL3 A;  4NZ6 A;  3PR4 A;  4NXN F;  3T1Y J;  2JRS A;  2ZJQ Q;  4IFV A;  5EGY A;  1EKS A;  1V3S A;  1ZM3 A;  4OJH A;  1X5S A;  3QID A;  2VB6 A;  4FF1 A;  2RF2 B;  4H4O A;  4C3K A;  1CJK A;  1UWA A;  4U9R A;  2CJY B;  4WWS A;  2W8L A;  3MCO A;  2XI2 A;  3CCM S;  4ZDN A;  3FCW A;  4ETZ A;  3EYZ A;  5GAG U;  2E44 A;  3FUY A;  4DR7 F;  1X8D A;  4M5J A;  1SIW B;  1JMT A;  3CUL A;  4LQ3 A;  4G1Q B;  3V6H A;  2F4V F;  5HN0 A;  2KFZ A;  3JSM B;  2PA3 A;  4ALZ A;  3MMJ A;  1WTF A;  1RSC A;  3GCX P; 
#chains in the Genus database with same CATH homology
 2HVD A;  3EJM A;  5CAB A;  2DYA A;  3FBF A;  3NGR A;  1WKJ A;  3FCV A;  1NB2 A;  4DI6 A;  3BBB A;  1NCL A;  1JXV A;  4ANE A;  3PJ9 A;  3FKB A;  1BUX A;  1KDN A;  1NDL A;  3NGU A;  2NCK L;  3Q8V A;  3ETM A;  1NHK L;  4KPC A;  3B54 A;  4UOH A;  3FC9 A;  1BE4 A;  3MPD A;  1S59 A;  3L7U A;  3VGT A;  4O0N A;  1WKL A;  4F4A A;  4ENO A;  1ZS6 A;  3FBC A;  1NDK A;  1HHQ A;  3VGV A;  1W7W A;  1NPK A;  4FKX A;  3BBC A;  3FBE A;  1B4S A;  3BH7 B;  3ZTR A;  1K44 A;  1PAE X;  3Q89 A;  3NGT A;  2VU5 A;  1VYA A;  1NSQ A;  2DXD A;  1F6T A;  2AZ3 A;  2BX6 A;  1F3F A;  1WKK A;  4DZ6 A;  2ZUA A;  4FKY A;  3EM1 A;  4ANC A;  2B8Q A;  5BXI A;  3BBF A;  1NSK L;  1S5Z A;  3BH6 B;  3ZTS A;  4HR2 A;  4F36 A;  1B99 A;  1XIQ A;  5C7P A;  2HUR A;  3ENA A;  1UCN A;  3ZTO A;  4UOG A;  2HVE A;  1PKU A;  2B8P A;  3VVT A;  4EK2 A;  3VGS A;  1BHN A;  1LWX A;  1XQI A;  4AND A;  3FCW A;  3GPA A;  3Q83 A;  3DDI A;  3EE3 A;  3G2X A;  3EVM A;  3EVO A;  4S0M A;  5CAA A;  3WX8 A;  3B6B A;  2DXE A;  3JS9 A;  3VVU A;  4DUT A;  1EHW A;  3R9L A;  1U8W A;  2BEF A;  3VGU A;  3PRV A;  1NDC A;  1LEO A;  2AZ1 A;  1HLW A;  3ELH A;  1NUE A;  4WBF A;  1NLK L;  5IOL A;  1HIY A;  1MN9 A;  4UOF A;  4C6A A;  3ZTP A;  2DXF A;  2DY9 A;  3GP9 A;  4W98 A;  3DKD A;  3ZTQ A;  3EIC A;  3NGS A;  3EVW A;  3Q8U A;  1NDP A;  3FBB A;  2CWK A;  3EMT A;  3Q8Y A;  4CP5 A;  1MN7 A;  3Q86 A;  1S57 A;  1NSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...