4WBFA

Acinetobacter baumannii sdf ndk
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
140
Chain Sequence
b'EFMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Structural and Functional Characterization of Acinetobacter baumannii Nucleoside Diphosphate Kinase
doi rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 41
structure length 140
sequence length 140
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4wbfA00
3ELHA 4F36A 2DXEA 1LWXA 3EVOA 1NLKL 3EICA 1K44A 3EE3A 4ANCA 1NDCA 1HHQA 2HVEA 3FBBA 3Q8VA 1NDPA 1WKKA 3Q83A 4DUTA 1XIQA 2DXDA 1PKUA 1NDLA 3BH6B 1ZS6A 3VGTA 4ENOA 4UOGA 5C7PA 1UCNA 5BXIA 1U8WA 1W7WA 3R9LA 3VVTA 2NCKL 3NGUA 4O0NA 4DI6A 1WKJA 4UOFA 1XQIA 1NPKA 3EVMA 3FBEA 4UOHA 1NSKL 2AZ3A 3NGTA 3PJ9A 3DKDA 3ZTSA 3FCWA 1MN7A 1JXVA 1MN9A 3EJMA 3L7UA 1PAEX 3NGRA 3EM1A 2B8PA 2DXFA 3FBFA 4DZ6A 1HIYA 3ENAA 3EMTA 3FBCA 3BBBA 3B6BA 3NGSA 5IOLA 2BEFA 2DYAA 3B54A 3PRVA 1BHNA 1NUEA 1EHWA 1B99A 1HLWA 3VVUA 3MPDA 3ZTQA 1F6TA 4FKYA 1NDKA 3FC9A 4ANDA 3Q89A 4S0MA 4KPCA 4CP5A 1NCLA 3Q8YA 3Q8UA 3VGVA 3EVWA 1BE4A 3ZTPA 4F4AA 1BUXA 3ETMA 4ANEA 3VGSA 3DDIA 1NSQA 3Q86A 1KDNA 1S57A 3BH7B 1LEOA 2VU5A 3GPAA 2BX6A 3BBFA 1F3FA 3FKBA 3G2XA 2ZUAA 1B4SA 4W98A 1WKLA 1S5ZA 3ZTRA 3VGUA 4HR2A 1S59A 2HVDA 3BBCA 4FKXA 4WBFA 1NHKL 2B8QA 4C6AA 1NB2A 5CAAA 3ZTOA 2CWKA 2DY9A 2HURA 5CABA 3FCVA 3JS9A 4EK2A 1VYAA 2AZ1A 1NSPA 3WX8A 3GP9A
chains in the Genus database with same CATH superfamily
2ALYB 4WKRA 5I3UA 3DRPA 1S72S 2FVRA 3CC7S 2Q66A 1NDLA 1RADB 1VBYA 1KN6A 2RDIA 1Z2LA 3FFIA 2MGZA 1YITS 2QSFA 1IBKJ 1LXNA 3JAMU 3M30A 2ZBCA 3EZUA 4GVBB 1U1RA 3EMTA 2V2KA 5JUMA 1S1XA 2UVRA 3KXDA 4B3SJ 5KOWA 1ZETA 3OTDA 1Q5VA 5DZ6A 2FGCA 1RK8A 4U67Q 2B4PA 2BJ3A 1FCAA 2H48B 4A48A 2XGQA 1ZM3A 2JZ5A 4F4XA 2RRAA 5GMKa 1QVFR 3D3BJ 1LWCA 1S4FA 3PX6A 2U1AA 3GPAA 4YMEA 3P6YC 1OJ4A 5LMNJ 3N4WA 1OPIA 2JDJA 3KDOA 2HG4A 3G8SA 2VC1A 3D0IE 4ZVTB 2DR8A 3W5YA 3TEGA 3OLAA 2ADBA 3SXLA 3A4TA 4QYZJ 2MKYA 1UZHA 2DCLA 2YNIB 5ETMA 3I4HX 4X64F 1KEKA 4DR3F 1FDAA 4I7FA 1RT6B 2G2OA 4JP8A 4ZJQA 1AFJA 3GIJA 4ZP9A 3AA8A 4NLPA 4ZDNA 2RE1A 3GIMA 3LAMA 1K0VA 3LO3A 4LR9A 1X9MA 4P6QA 3M7VA 3L7UA 2Z2ZA 4B3OA 1NU4A 2EG2A 5D6GA 4OX9F 4ZKAA 1BXNA 2R2TA 2FDNA 2KG0A 3Q8UA 4KH1B 4LSNB 3BGUA 4NYZA 3DDIA 2HIYA 4CLZA 3PHEA 1SQFA 5LT5A 2POKA 2OPSA 3THVA 2O67A 2VG5A 2HNYA 4ICLA 2HYIB 3GFYA 1LKZA 1URNA 3T9ZA 2LA6A 4K59A 3MEDB 2ZH7A 2VPZB 5KTQA 4ZJOA 1WELA 3OJUA 1CSJA 2KO1A 5JMNA 4C8YA 3SFUA 2RKIA 4ZP7A 2MXYA 3OPKA 1K8AT 2CWXA 2ZHBA 4WCEQ 5CZVA 2K7KA 2KXHA 2DHHA 2EW9A 1RABB 4J90A 3A8IA 2V34A 5B0FA 2OSRA 2XYGB 2PT0A 2JFKA 5T14A 1GTEA 2EK6A 3GCXP 5CCMA 3W2VA 4DHVA 3DRXA 5ETNA 3MM6A 2HAFA 3DHXA 1RAFB 2H9ZA 2PFDA 2E9RX 3K17A 3CJ3A 5KFTA 3IMQJ 2HEKA 3CCVS 2X51A 1JKHA 5E3AA 1IQTA 1RISA 3LGHA 3KLHB 1KVKA 4HDGA 4DX7A 2IM2A 3AT1B 1CJVA 2OTJS 4IG0A 4ES1A 1GXLA 4ITSA 3CW2C 1E6YA 3MF5A 1VRUB 1TL7A 1FK9B 3M2VB 2GVZB 4DR1F 2J6UA 3LWMA 1X9WA 3D6MB 4JI8J 1U2FA 3C6UA 1RHJB 2QA1A 3E01B 3M8YA 4ILLA 3QSYB 1JLEA 3KHRA 4Z37A 4RX6A 2YNGB 1X9SA 4CCHA 4EBEA 4U9RA 1TUWA 5D4LA 3QZ8A 1TZ0A 3UFCX 5JVGQ 1H6KX 4LFAF 3RRKA 1CJUB 3P96A 5JVHQ 3MR6A 2ZOMA 3LPYA 3IA0A 1B99A 2HS4A 2ZZMA 2A2DA 3OQ2A 3VVUA 5KAKA 1H73A 4ECXA 2QEXS 1XNRJ 4KKOB 2VH7A 2V4RA 4LVOP 3HVWA 1VQSA 2SXLA 1NBEB 3VGUA 3KDNA 3D1QA 4ZOSA 4FF3A 1DQ8A 3DDNA 4FKXA 2KFNA 4NLTA 5LL6d 3CE8A 3I82A 4RKUC 3W3SA 2ZNYA 1YWXA 5KFKA 1Q8BA 2Q79A 1EQ0A 5A6PA 1ICEB 2HS0A 2MZJA 3PG9A 4OX7A 1B0VA 1KLMB 1VIXA 3MI7X 3KKFA 3UE2A 3K8VA 5C7PA 2YNIA 4DUYJ 3CJ0A 1TL4A 5LJ3Y 4O3OA 4KFBB 2UU9F 3FRZA 1NPKA 3L4BC 1TQLA 1GX6A 5CYQA 1RT6A 1C0UA 1X5OA 4UOCA 3ZZOA 2QL5B 1VQNS 2HS3A 1F6TA 2PGCA 3K58A 2RIJA 3UR3C 1NM2A 2W2MP 3Q8RB 2DNMA 2V8VA 2KG1A 1N32F 1NRKA 5AXKA 3GCWP 2C2MB 4TNOA 2NLWA 5EHHA 5DGAA 3IXQA 1R8PA 4M1KA 1S59A 3AB4B 1WNEA 2W9CB 2GMHA 4LSNA 2EK1A 2FVSA 1EX8A 5HATA 3L95X 3HF5A 4C0OC 3ELHA 3KK2B 2XLIA 1HW8A 3RR7A 4OHWA 1YBUA 2M88A 4OZ3A 3RRHA 1VHIA 4F26A 3TJ9A 2AKWB 3TA0A 3R7SB 4P73A 4K2JA 3KK1B 3M6UA 1HBUB 2V9WA 4W90B 4C3KA 2VPYB 5U47A 1HKAA 4ZS6A 1VGYA 2CQBA 1J5OB 1CQNA 4QWEA 2FJEB 4CO2A 2NUUG 4DR7F 4K7QA 2QMUB 4K0KF 4KGXB 1WEXA 3QWUA 2XMTA 2OPRB 1TFWA 2N3OA 4DSLA 2DGUA 1RCXB 5B0EA 2HZCA 4I64A 1PILA 1ZZFA 3H7HB 2K3IA 1P9QC 1N36J 4RBUA 2CADA 3SYZA 3EZ5A 4K8RA 1VRTB 4JI7F 5EWEA 3SSRA 5H9FK 3TI0A 3P8BB 2MPUA 1K44A 2MJNA 1WEZA 1RDRA 1O8BA 4DQPA 3CCTA 3CIMA 3VR1A 1BC6A 1VRUA 5DDQC 1FK9A 3M2VA 4IYQA 2C3UA 2AJQA 1KLNA 2F8EX 3NGUA 1MU2B 1NJZA 3DCAA 2VC0A 2YY3A 1VJWA 1ITPA 2AMCB 4IO9Q 4NEZA 3D9BA 1PAEX 4B3RF 4JI4F 1WC0A 3MEEB 4PWUA 2BOPA 1GQEA 2YNGA 1AUSL 4O3SA 3IFEA 3P3DA 2AX1A 3MOJB 1WOSA 5F8IA 4C97A 2JHEA 4AQYF 2DR5A 3CSKA 3EGZA 3PR4A 4CTAA 1N88A 2DEIA 1N5YB 1U47A 2OELA 5EX0A 2VUGA 1HNVB 1ZM9A 4KKOA 2W7PA 3IM9A 2GC8A 4X2BA 5ETLA 4CO1A 3N6NA 4NPOA 3ADAC 1Q16B 2LEPA 4ZCKA 1KFDA 5KFCA 3UDVA 1VQ6S 1M5KC 4ZITA 2VG7A 2IBOA 2H65B 3CJSA 3LP2B 2PN6A 2WOMA 1H2UX 2N3LA 1RAOA 3BV8A 5HMWA 4J7CA 1KLMA 4KYZA 3ENVA 2FUG9 3BN4A 2EFNA 3KJVB 1FXLA 2A0FB 2Z57B 2J6SA 2CPEA 4QW9A 3G86A 2VBWA 3HFKA 4KFBA 1N33F 5KFBA 3RZAA 2ALZA 2GIFA 2EPIA 5J1NA 4KPYA 2E1PA 3BBFA 2QA4G 3AQOA 5D4OA 3P49B 4WF9Q 2BJ9A 2W4DA 2ZZNA 4DL5A 2K8GA 5KT2A 5ITHA 4B3TJ 2P6TA 4C9DA 3THTA 4P74A 3M8ZA 3V6DB 1TMJA 3DN9A 5L9XA 3N6LA 4C2MA 4EBCA 2DNGA 5K8OA 4I67A 1GXTA 1IQZA 1DQAA 4KTQA 4JI6F 3MCOA 2CKWA 1Y9OA 1NDPA 2AX0A 1FWKA 1LW0B 3VGTA 4IKAA 5KFMA 2COLA 1IR1A 3KK2A 4DI6A 3BO3A 4QIGA 4C0BA 5E3RA 1FDDA 3KG4A 2UUWA 3P4UB 1EKSA 2C3YA 3KK1A 1HBUA 1I51B 3SDEB 4AL5A 3PW2A 5FDLB 1CJKB 1HNWJ 4CLKA 1TP7A 1J5OA 3BJYA 3C46A 3HHLB 1P8GA 2O3DA 2NQPA 4HHJA 1RZMA 3S8SA 3R2DJ 3CCJS 2FJAB 3CCZA 2Y1LB 3K2YA 4N41A 4C8MA 4GMKA 4KGZB 3DYAB 2OPRA 1VLOA 2I2YA 5MAOA 1U0HB 3QLHA 4JUZA 1IBMF 1TELA 4DV4F 4GVLA 1UJ4A 3DRRB 3T5KA 2FHOB 2RH3A 2RILA 3RYLA 2GVDB 1SL0A 4CWBA 5CYMA 5KFEA 1ZS6A 1N54B 1RP5A 1VRTA 3HVTB 4N8NA 1IKXB 2UV8G 4DQSA 2BXJA 5HVHA 4ERDA 3D6FB 2RQCA 1WKJA 1Q53A 1UW9A 4UOHA 3TP2A 2V4QA 4NZ6A 5KFOA 2GJIA 3ZZ0A 2AHOB 2B43A 1KONA 3OJSA 2JVRA 1I6JA 3L7OA 1YBTA 5F8JA 1S7HA 4FBTA 1MU2A 3M9MB 3VALA 2DGQA 2LA4A 1FE0A 2E1MC 1Y3KA 3DLHA 5ETVA 5F0UA 3KHHA 3CMQA 4B9MA 2M9KA 1HARA 2DR7A 1LW2B 1NNDA 3KNGA 1XMQF 2YWKA 1EJ7L 2LQ9A 1D9DA 2HMIB 2F4VF 2HVHA 2HVDA 1HNIB 2MQQA 5AJ3J 1FTRA 3BR9A 3T5HA 3MMBB 2ABYA 4OX6A 3RAQA 2Y8YA 2KRRA 4RUAA 2Q6BA 1ZBTA 2VOOA 3W2WB 1N5YA 5IWAF 3EXYA 4PYDA 4N5SA 1HNVA 2Y3YA 1HHSA 5G0RB 2GAGC 3QT7A 2CQCA 3J80U 4DV2F 5E5NA 2Z58B 4CO0A 4Y2IA 2QYCA 2QA4S 1U26A 5J2PB 5FJ4A 4X4NA 1R27B 2ZHOA 3MPWA 4U6PA 2DGOA 4XAKA 2IA0A 1KFSA 2DYAA 1PJ7A 1OSDA 2I9SA 4EMDA 5AE2A 3U1LA 3M8QB 3C6TA 4F3QA 1IUJA 5L1LA 3LP2A 3VCDA 2MJUA 2FQQB 4RW9B 5AT1B 5LM7E 4Q43A 3T3FA 4YQWA 2MYFA 1JNRB 3KK3B 4ZP8A 3W64A 3EUNA 4RWXA 2EKYA 3UNGC 1X0FA 3BF4A 1DTTB 5DG7A 3LGMA 2GV1A 2UUAF 1PYSB 3FCVA 3CDUA 3FZ2A 1WF0A 2YPZA 1FJGJ 3H5XA 2H5JB 4E98A 2ERRA 1T9WA 4YFUA 2HHHJ 2VDHA 5HN0A 5DLFA 3DOMA 4EGLA 2ASLA 4IUFA 1S48A 1U6BA 4DFKA 4JI1F 1LWEB 1F9FA 4ZHRB 3V6DA 4K4SA 1OY9A 2BJDA 4ILRA 1IJEB 1UW4A 4CNZA 1F60B 3DKDA 2MLZA 3HSGA 2J0QD 5ETOA 5T7LB 3PY8A 2X3GA 1YJNS 2E9TA 1REGX 1LW0A 2JLGA 4F50A 2KHDA 4FPIA 1SUQB 4G65A 2JOQA 1UA1A 3RB4A 4QU6A 2VPXB 4JV5J 3DLGB 3E8OA 4L6V3 1WC6A 3SDEA 1DHMA 5FDLA 2XLJA 2R7WA 1CJKA 2HHTA 4ZVRB 4NCGB 3HHLA 3D1OA 3M9NB 3T5JA 3POTB 2RU9A 4DR6F 1FNMA 4QIEA 4NRUA 3D2WA 1VFJA 2XBPA 3AAWB 2AGOA 2LU2A 3QAUA 2PEBA 3DYAA 3FBBA 3OFFA 1U0HA 2MQLA 1JJ4A 2XHWA 5IV3A 1FFSB 2OP5A 1EETB 4P52A 4DV0F 3DRRA 3PRDA 4XK8C 5K8PA 1Y7PA 2AEMA 2GVDA 4QCLA 2VQFF 3KLIB 2YH1A 1FRXA 1F5AA 5C25B 4LIWA 2GJ2A 3HVTA 3KG0A 3PRVA 4B17A 1IKXA 3QO9B 2HFSA 2ROPA 1N34F 1S6UA 4FXWA 4DR4F 3QIDA 1NAQA 1KS2A 1CG2A 4TU7A 2BX6A 1N0UA 1S5ZA 3UVJB 4YR3A 1NPRA 4WBFA 1Y10A 3G82B 2V0NA 1H2TZ 4LF6J 5E3PA 1B64A 4Y2CA 4J9NA 2V50A 4F4YA 3RRGA 2BKPA 3VF0B 4XIUA 3A8EA 4UZCA 4DV6F 2XY5A 2QL9B 2MSTA 1VCTA 1Q8IA 4OZNA 4U8YA 3R5AA 1WKKA 2YXLA 4IRKA 3Q8PB 3T41A 1YJTA 4ENOA 1IKWA 2IDLA 3BN7A 2AQ4A 5I3QA 2FTRA 4DCOB 3FBEA 2W2QP 4O44B 2DO4A 2KI2A 2ZBQA 1X8DA 4I68A 4O0IA 2ZH3A 1IM6A 5KFDA 4FS2A 1Y5IB 3BPSP 3MAAA 3N79A 1PC4A 2UUBF 4KSEB 5KFZA 5J2PA 4WP8A 5BYRA 3RB6A 4QWAA 3GV7B 1D1UA 3DRYA 1LK7A 1D9AA 5E2QA 2J7WA 1VLYA 3V6KA 2CDQA 3M8QA 4M95A 4NMXA 4RW9A 2H4WB 1UAWA 5B08A 2UXBJ 1NB2A 2J6TA 3BKUA 2JNJA 4DV7J 3KK3A 4C4WA 2QLWA 5BYQA 2F8HA 1RKJA 2MY7A 2LMIA 6AT1B 4WP9A 3DU6A 1DTTA 4DV1F 1R89A 1UTAA 2NZ4A 3N5FA 5F8HA 5D8HB 3NS5A 3R2CJ 1UVLA 3DMJB 3TARA 4HH1A 1Q5YA 4CLLA 4DSIA 3MPYA 2PD1A 3M6XA 4RJVA 3I5AA 3AXKA 3V5RA 2EFOA 4PG8A 1GMWA 3EPGA 4X4PA 1LWEA 1LNQA 2LVWA 4ZHRA 4WTYA 3BKFA 2CUYA 4TKTA 3ISZA 4DLGA 1T11A 1KHVA 1RBLA 3ISNC 2QA2A 3GJSB 2ZE2B 2J0SD 3BSCA 2KH9A 3GR1A 4DU8A 4YDDB 5IV4A 4FVMA 4RUCA 3A3OB 1NH7A 1SUQA 2I0XA 1VQ8S 2J8SA 5E7OB 2UXCJ 1FX2A 4OI1A 1AYEA 2HFVA 3DLGA 3DRSA 3LW5C 1I5OB 1VQPS 5HAOA 1MG7A 3N9UC 4Q45A 4U7UD 2GX8A 4ES3A 3K89A 3I0SB 4NCGA 2YNFB 3OSPA 3BGFA 3POTA 3PZPA 3HHLD 3M2RB 3EWGA 2P5VA 3M32B 3TA1A 4ZLLA 2MQMA 4FVCA 3PX0A 4EU0A 3TW0A 1RE1B 1EETA 1Y11A 2FIUA 2E5LJ 1HLWA 4RW4A 4ZPTR 2BQ3A 4QYZK 2GFFA 3AOCA 4KY3A 2HQIA 3KLIA 5J2NB 1NK5A 5K20B 5LSRA 4OZJA 3SIPB 3QO9A 1RWMB 3NNAA 5HMZA 2OHDA 1FEHA 4CI0B 2PMZD 2GMLA 2YX1A 3LP0B 1JIHA 2IIHA 4EEYA 2KHCA 1RT3A 1M5VC 1XNQJ 2MKHA 3UVJA 2E1CA 1ULRA 5HQ8A 3EE3A 4B3MJ 1FWPA 4RUHA 4K50A 2QN6B 2B5JB 3H8YA 4KB7A 2LKZA 3UD3P 1SH3A 1AFIA 4FYXB 2KN4A 4HTJA 1YRUA 2I38A 3OL6A 3J7Z5 3EJMA 1JWWA 2ZVSA 3T6BA 3ICLA 2GS8A 1HBNB 3WX4A 1NZAA 3OVSA 2MDAA 1VIOA 2JL9A 1TL3A 1U8SA 4O44A 1K73T 2HRTA 1IJFB 1H98A 2MHEA 4WFYA 4ZPDA 3H2VE 1YKWA 5K8MA 4ECUA 3D0HE 3MM7B 1H0HB 3QBCA 3KYLA 2PIIA 4OYPA 5KFAA 3KLFB 4J5OA 2VFVA 3HJVA 1KQFB 1TTHB 3HDSA 2L3MA 3E51A 2NYHA 1EB0A 3TZXA 3R6LB 1FRJA 3OD2A 3OL7A 1RWWB 2DXDA 3DLEB 4OHYA 5B0GA 3BZQA 2WVFA 1QDUB 2Y0SD 4HT5A 2DPJA 1JXEA 3NGTA 4DF4A 2YWWA 2AT1B 4MK9A 2C2RA 2JH3A 4OJGA 3UD5A 5BYSA 4W4MA 3NMRA 4JI2J 2QLJB 4CP5A 1L3TA 4BHQA 1IM4A 4DN0A 2EXUA 1BWVA 2QLBB 2KT3A 3J7A1 3DXSX 4DR5F 5F8MA 2P9CA 3GIKA 4M5DB 2HK2A 4RZRA 1HR0J 1VQOS 5DDOC 1CS4A 3RAMA 2KJVA 2Z2LA 2IY5B 2HHQA 1VBZA 4LF5J 4JI3F 4TQRA 3QFWA 3MXHP 2ZE2A 2E7XA 2BVZA 2MZSA 1N0VC 4I6AA 2B56A 4XDCA 3K5PA 2X1BA 3PEHA 1Y5NB 2YQ3A 3HO1A 2BE7D 1U1MA 4ECWA 3DOKB 2E7WA 1YZ6A 3GFHA 3PW0A 1HW9A 4J9KA 2LDYA 2HSEB 1APSA 4ECYA 3IO1A 2D1CA 5HROB 2C28A 3TO8A 4C8KA 3I0SA 3W65A 2WONB 1T02A 2YNFA 5DDRC 2Q3PA 3OR1B 2M8HA 4ED2A 2BJ7A 5IQ6A 3F73A 5L1JA 4QR1A 4OHZA 1YJWS 4NLXA 4KV8B 4Q0BB 3M8RA 3IBFB 4N77A 3MFIA 5CD4H 1VC0A 4ZN1A 3NWGA 1VK3A 2CJQA 3NS7B 2PA3A 1WKLA 4WZQA 3RB3A 3WC0A 2CJ9A 1HFEL 4NMLA 2JSXA 4AUKA 4IFVB 1R0BG 2P9EA 5L1IA 1R43A 3QPIA 1UFLA 5J2NA 3QT8A 5DQIA 3SQOP 1KTQA 4IH6A 3H25A 2UVWA 3K5LA 1SJQA 3H59A 5IT9U 4KRWA 3CD6S 3VAIA 3LP0A 3SFGA 3FEXB 3QGIA 1WTBA 4CT9A 1SQEA 4KE5A 4J9SA 2AJ1A 2ZH8A 2B5JA 3NGSA 2AJ2A 2I6WA 2O01C 1FNXH 2MZRA 2DNNA 4X4QA 1B70B 4Y0FA 1RLCL 3KUHA 4RU2A 4IOAQ 2V2QA 1BQXA 3DDKA 2HGMA 1HBNA 1A0OB 4DPYA 1BWEA 1FKAF 1OPZA 4CDIA 2MKCA 1KP6A 3R8YA 1NHKL 1HD1A 4A47A 3HD1A 1G2EA 1KQKA 3ZZUA 4Q8FA 3AD8C 4MAKA 2ZWPA 4RBTA 2RQ4A 3C14B 2QJ3A 4PPDA 2DRAA 4HT7A 3KLFA 2QIFA 3BH6B 3SV4A 4E2FB 5J1PA 1S0MA 2WCXA 1QUVA 1KNZA 1RQ0A 2CNLB 4MYUA 3PJ9A 3GG1A 3OBIA 3GWCA 2YWFA 3MDFA 2AU0A 1ACMB 3S6EA 3DLEA 3HULA 1EZZB 3P5TL 1FJCA 1HL6A 3IGVA 3T1HF 5JJBA 2DGWA 2CQHA 1YBAA 4JI5F 4FKYA 3TVZA 4G1IA 4DS4A 4OLOA 3NAHA 4ANEA 4J9QA 2LECA 4OI4A 3I6PA 4JV1A 3BH7B 2RS2A 2V9KA 3DLLQ 2XMUA 2BRKA 2DY1A 2RDDA 4JI0F 4NE9C 1X31C 2AWZA 1TKDA 2Y8WA 1XMOJ 1QVGR 2MLYA 3I32A 4Y2AA 2QGFB 2WHOA 1D8YA 2XCPA 4K4VA 1L3UA 4A8FA 2HQGA 1K1SA 3MM9B 2JEGA 3C19A 3HHNB 4LRFA 5K8NA 1SL2A 5HI7A 5KG6A 3KLGB 4DJBA 1HI0P 1JLAB 1HNXJ 3CDAA 2HBYB 2V67A 1P6TA 3DOKA 4F04B 5CA5A 5IT4A 2XCAA 1VR6A 1FJEB 4RW8A 4DS5A 1H2VZ 3FDSA 1OWXA 5HROA 4R0JA 3U1NA 3PEJA 1VQKS 3I5BA 2C2OB 3EVWA 2W1BA 2WONA 4WFAQ 1QE1B 4LR8A 2XNQA 2D3OR 4WFNQ 4N76A 1PBAA 1DLOB 3OR1A 1IKYB 4YS2A 2W7OA 3FKBA 5KG4A 1B4SA 5A8WA 1N6QB 3M8PB 3BGLA 2IA6A 2RUGA 3D67A 3CO9A 4KV8A 4C6AA 4QIWD 4Q0BA 5KFYA 4ED7A 2J0XA 4O4GB 4G1PA 2RF2B 4NXNJ 4TY9A 4Q5VA 2VA3A 1X4HA 3J7YI 1RAIB 1RT2B 2J5AA 4PPZA 4IFVA 2HVEA 3LWLA 4CO5A 2VV5A 2CPXA 3HSJA 3SCKE 4FP9A 4NI2B 4U96A 1X4AA 3EX7B 2KVQE 1WSVA 2OTLS 4USVA 2DH8A 1RI7A 3EPIA 1L3SA 3UN5A 3ZNUA 3JTNA 1G6BA 2HNDA 1W26A 4P2SA 1RT5A 2UXDF 2JC0A 2DNRA 4DR2J 3WHIA 1KSPA 4IG3A 1FD8A 2C42A 1R3NA 1FE4A 4IH5A 4TXSA 5HBMB 2V68A 3NWRA 4USUA 4ZVFA 5BJRA 1NCLA 3J81U 3FVYA 5F3TA 2DGSA 5EN1A 3L7PA 2CVIA 1Q8KA 1RWXB 2B4UA 4A8YA 4DQRA 4YUDA 1RU2A 3M4XA 4Y6IA 1S97A 1FA0A 5C42A 3LA0A 3G4SS 4CLTA 5LSOA 4EO6A 4BBYA 1VYAA 2HIQA 2XGPA 1S0VA 2C22A 1UMJA 3S1TA 2VD3A 2PMWA 3FRYA 4F25A 3QNWB 7FDRA 2R2UA 4HHHA 2LP4A 4NLOA 4X4OA 1MROB 1TKZB 1Q0NA 3IN5A 2A10A 4H4OB 3VHQA 3C2PA 2OLWA 2CJAA 3MECB 4NOHA 3T1AA 5IOLA 1YQHA 2IM1A 2ZH5A 1RAHB 4LF4J 1XBWA 3OXGA 4LF7J 1RGVA 2WSFC 4NXMJ 4QWCA 4A8MP 3CD7A 4ZPAA 4PAAA 2OH2A 5KT6A 3UD4P 1S6QB 1FRKA 4RL1A 1IKVB 2VOPA 1S77D 4HR2A 4TYBA 6FD1A 4GKJJ 2E5JA 2UUCF 3ZTOA 2AJ0A 2AYBA 1S1TA 3MOZA 3JTPA 1WTFA 4N7TA 4U8VA 3M2UB 1QLNA 1D09B 4X66F 1JNZB 1U09A 4O3PA 4DSFA 3CJQA 1V9OA 3R7BB 3TAMB 1RT1B 2KFYA 2JEJA 2VPWB 1RWVB 3JSYA 1ZZNA 4C8LA 3HCXA 2QMXA 2ZH1A 1UPPA 1U2CA 2Y1IA 1YJRA 2J8AA 3MM9A 1U1PA 3MAQA 4DL0C 2OEJA 5IC4B 2ATLA 2EBEA 2V8HA 1FX4A 1NSAA 3RBXA 2VKRA 3GLJA 2K2PA 2RUSA 1JLAA 2N4DA 1TUVA 2OD6A 4FXDA 4ZPVR 2HVIA 3PVXA 4FS1A 3KMQA 2XO7A 3F0NA 4WYWA 2QFIA 3DOLB 3NEKA 2XZDB 2FC8A 4HEA9 4FDFA 4V19J 2G1DA 2AGPA 4X84A 3KJFB 4DX5A 1J2VA 5D3GA 1QE1A 3ZO7A 2NPIA 3JS9A 5D0RA 1H7XA 4ZVOB 1CC8A 2HZAA 3W63A 3SSSA 4ER8A 4OIXA 2DKOB 2CJKA 1N6QA 3M8PA 4OV1A 4NLYA 5KFIA 1HD0A 3KJNB 2BACA 5KFLA 1A7GE 4DFJA 4JBCA 2HPUA 3RW7A 4B08A 2F4FA 4O4GA 4F2SA 2E1RA 1PCAA 2RF2A 1OQ3A 4ZLNA 2VKZG 1RT2A 4C11A 3THPA 4DZ6A 4PUOA 3FBCA 1DBDA 1N4LA 5HQMA 3B6BA 4NI2A 4KR0B 5KFPA 1S0OA 3VAHA 3CJKB 4YY3F 4V19X 3BO4A 4DSEA 5HVFA 3ZTQA 5D4NA 3OTOJ 2E5HA 4MFBB 5BR8J 3VAJA 2AEFA 3MEGA 2GGPB 3HKWA 2BQUA 4OYOA 1B7YB 5IM0B 3N01A 2ZH4A 5FD1A 3PJXA 3PW7A 4B9LA 1SV5B 4PG7A 3QIPB 3QGHA 5HBMA 1S1VB 2B8QA 3CJ5A 2OFHX 1C1BA 3W9HA 3F44A 2MQOA 1RWKB 1G7CB 3TQ1A 1FRIA 4ZPWR 4H4KC 2DT9A 1RKIA 1T03B 4QR2A 3A8JA 3BGRB 2BW2A 2OEKA 5DG8A 4BLGA 2X7IA 3G9CA 3GV8B 3ILOA 3K8WA 3BGOP 2ASDA 2KXFA 1MMNA 2O5DA 1RWUA 3HJFA 3Q8SB 4LREA 3SSQA 3D0GE 1HA1A 4ED0A 4C0HA 4DG1A 4ZVUB 2GO9A 1M1KT 5M2RA 1Z1ZA 1DZ5A 2VFSA 1VI7A 2WSEC 3HX9A 3TZWA 3J7ZT 4DV5F 4JV0A 2KT5A 4GO7X 4DPXA 4LF9F 2ASJA 4C3MA 3U27A 5KFJA 3ZZZA 2VG6B 4F4ZA 3MPDA 4X4UA 1RU1A 2B0GA 3FSIA 4PWDB 3DU5A 1SH0A 3VAMA 3TAPA 3K7RA 2XSFA 2R42A 4WXOA 3CWJA 4CQ1A 1HNZF 1RUSA 3ZTRA 4KO0B 1HPZB 4WIIA 3RU0A 3RW6A 3BO2A 1SC1B 3NRBA 1Q7LB 3LOUA 4UTGA 2BMBA 3DGPB 2ASYA 2KKHA 4LRBA 3CDWA 2FPHX 5D0HA 1M90T 2X1FA 4M5HA 4CLUA 2MKKA 1T9XA 4X64J 4DR3J 4DL7A 1OY6A 4USKA 1S6QA 4ZK7M 2BDPA 1IKVA 3K57A 4LF8F 2WVCA 2RHQB 2PE8A 4KBIA 4LFBF 3RR8A 3JXOA 1PC5A 3DLJA 5CXTA 1P1TA 4QZVB 1XR7A 2CPYA 3M2UA 2L48A 3HT0A 1K9MT 1L5UA 4IQMA 1FVQA 4K4TA 2D3ZA 1AA1B 2DGVA 3TAMA 1EIYB 1RT1A 3FNNA 4QIFA 1AB8A 4PZVA 2JEIA 4YB7A 4OX9J 5I42B 1WC3A 2YH0A 3FMBA 4K5RA 3NP5A 3IWNC 1BUXA 4BC9A 3H20A 3AXMA 1CJTA 4RBVA 2XMAA 2F7VA 1S9GB 2WBRA 3IAM9 2X1GA 2WZ1A 4M94A 2YX4A 1XR5A 3AHPA 3EZOA 4RNFA 2LEBA 1N52B 3CCLS 3DOLA 3N0VA 3D68A 4KAIA 2R7UA 5J2QB 4D3GA 3P5BP 3R6GB 3B4MA 2R7VA 2FLLA 3PRBA 4Q2MA 3W5ZA 2HVZA 5LJ5Y 3I31A 4CYUB 1VC6A 3US5A 1KWMA 4UOGA 1UCNA 2RNEA 1X4CA 3KUEA 3I56S 1YZ7A 4RNOA 2XMJA 4XO0A 2UZAA 3FQLA 2CG4A 3CCES 4LFCF 2IYIA 1U1NA 3BSNA 2V2VA 1ZAVA 4IFYB 1GEHA 1KR4A 5D77A 5H9FJ 3TVKA 3R3TA 1Z2ZA 4AL6A 4LIRA 4KPCA 4DUZF 2C2KB 4MKBA 1RTHA 3ILIA 1IBLF 3G87A 4J9OA 3CJKA 2MZQA 1JLGB 4DDFA 1XJWB 4OFZA 3G6VA 2LQBA 4OI3A 2Q43A 4KHMA 1WHWA 1FNOA 2B9YA 2CWKA 2C1EB 3Q2TC 4MFBA 1SC3B 4ATNA 2OD4A 3GIIA 5F8GA 2Q1LA 2ZEJA 3KG1A 4YB5A 4DR1J 1TK0A 5IM0A 2FHKA 1GK8A 2XSJA 1N5SA 4I2QB 3CJ4A 1S1VA 4TVAB 2YQ1A 4TU9A 1WUUA 2F63A 1NKCA 2L9DA 2XWYA 4MJKA 2QO3A 1S1WB 4AYBD 5H9EJ 1UL3A 1SQGA 2LQJA 2K1RA 2XI2A 1T03A 1N56A 3IWXA 4Q8EA 4DV3J 3JYTB 4KC5A 5M2UA 3VV2B 5KFUA 5GADI 4IR9A 2DD8S 3CDBA 5DG9A 3VGSA 3W1YC 1RB0A 1HBMB 4KGMA 2A6MA 1HWKA 4ZMMA 4GKKF 2VG6A 1FRMA 5A8RB 3I55S 2F1FA 4RR5A 4OZLA 4I6YA 1O5JA 3BB5A 4TY8B 4TN2A 2WW4A 3U7JA 2O1PA 1CQMA 4B9NA 2B6AB 2M4MA 1HPZA 4ID8A 4HYKA 2KU7A 1QUPA 2LCWA 3BQ0A 2JLEA 4A8XA 1R8AA 4J9PA 3OVBA 3DGPA 2E5IA 2ZBIA 3LANA 1JLCB 3QRRA 1W7WA 2BA9A 3TYTA 3UNYA 1QY7A 2F8MA 2UU9J 2NXCA 2XQCA 3CC4S 4GVBA 4DBQA 3O5TB 2RMLA 1R8HA 2ZOFA 2HQ3A 2VL1A 1RT7B 5H1SV 3HVRA 2XNRA 3TUZC 2G2ZA 4NYOA 1N32J 2R3VA 2R7XA 5I42A 4ZPCA 1IN0A 4D3HA 4JV2A 1H7WA 1WOOA 5HMXA 2ADCA 2CVEA 1OQ6A 1Q95G 4P7VA 1HQUB 2H54B 1VQ4S 3TEHB 4PWWA 3PDNA 1SKRA 3MPUB 1S7IA 2N7YA 1HI1A 5C2CA 3R1LA 1TMMA 1H74A 2N4CA 2CQ0A 1NLKL 1S9GA 2XYPB 1U02A 2CJBA 1LFWA 3W62A 3FSXA 4C8ZA 3HHKA 4KGKA 4ZVPB 3UWTA 4H4KA 5E0OA 1R7IA 4FZVA 2KYXA 4DPTA 3CJTA 2ZNZA 3V81B 4CYUA 5KT7A 4K5SA 4DR7J 4ELVA 4K0KJ 5IQQA 1N5QA 3CJ8A 1WI6A 2HGLA 2BKOA 5LMUF 1VJQA 1RA6A 1ZYQA 2OO4A 4WZMA 1RT4B 4M5MA 2YVSA 3GSDA 4DZDA 1HI8A 2A1BA 3UN2A 4IFYA 2ZUAA 1FKOB 3F41A 1HWLA 1U4BA 3DGVA 3CCWA 3HSDA 3BYRA 5KG0A 2JJ4D 1IR0A 1Q7YT 2ZC3A 3MEDA 4G1QB 4EFAC 4F0HA 4JI7J 5DO2A 4F36A 1JLGA 2CNNB 5EGYA 5DETA 1D9FA 3MM8B 3G96A 4N56A 3OTCA 4A8WA 5BXIA 4ECTA 3MZIA 3H4BA 2F40A 5HJXA 1XQIA 3IS9B 4I2QA 2ZJQQ 8ATCB 4B3RJ 2GQQA 4JI4J 1X4DA 1FEEA 3GTYX 5K9FA 3ILJA 1JXLA 1S1WA 1DARA 3TX8A 3D66A 1N5TA 1HNXF 1S10A 2J9CA 4Y00A 3NCPA 2V8PA 1RAAB 1URRA 3JYTA 4AQYJ 2JX2A 2FJXA 1PJ6A 1RHKB 1NZ8A 4PXCA 1XR6A 3KLHA 1WDTA 4ZCLA 2RHSB 2AF6A 3W5XA 4OZ5A 1RTIB 4EK2A 1TAUA 4DSJA 2W9AA 1HBMA 2GVZA 1UETA 2Z4PA 4FNHA 4X65F 3LPEA 1HYSB 3AODA 3OFHA 5A8RA 5M2PA 2CJXB 4ANCA 4DL4A 3E01A 4DUTA 4TY8A 2R7OA 2R2SA 1IVZA 4NA3A 3DLKB 1JK9B 2HK3A 2YKOA 1SC6A 3GJRB 2D7SA 3HHLC 2VQEF 3NGRA 1UEVA 2DNOA 2FVPA 1CJUA 1AT1B 3RBDA 1PJ5A 3VAGA 2ACYA 5K5MA 3CC2S 1N33J 5IFMA 1Y4ZB 4CO3A 3ZTPA 3BYPA 3C3LA 2XULA 3TUPA 2MZTA 3UCUP 2DRDA 1U1KA 1S4EA 2KTQA 2OMLA 3VZHA 2YBVA 2QG9B 3UCGA 2DIVA 5EWGA 4P72A 1Q8LA 4LR7A 3TJ8A 3LUYA 4YN3B 2I8EA 3HHDA 4P71A 1G3OA 5HJYA 3GYGA 1F2GA 4TLRA 2P8IA 4JI6J 3QGGA 1HQUA 1AW0A 2O66A 3TAQA 4P75A 2WRMA 3D1HA 3FFIB 2GQ2A 2G1HA 3CCUS 1VQ9S 3BREA 1JXVA 2IBKA 2NREA 3KHLA 3PKYA 2AEJA 3BBBA 3AOAA 4QWBA 3A3PB 3NS6A 2DITA 2DNQA 3CT9A 2HHUA 2N7CA 4BDPA 2RB7A 3R5CA 2D69A 4MT1A 3PCOB 4L72B 3W8PA 5IT9Y 2VZ9A 3MM5B 2RAQA 2FZGB 3V81A 4M8LA 4YOEA 4K4ZA 4BWMA 3HD2A 3HFZB 3GZ7A 2W9CA 1LXJA 1X0PA 4ES2A 1HQEB 3OHAA 1TV6B 3PIPQ 1IBMJ 4HI2A 4DV4J 1LK5A 2EC0A 1FKOA 3D4JA 4I7FB 2OI2A 4LRCA 1Q78A 4P7TA 2OIHA 2L9NA 3VAKA 2UV8A 2LQ8A 4G1QA 4YHHF 1C1CB 2ZD1B 1HBOB 2E1AA 5D0EA 1PGZA 4DU7A 2J9DE 3J7YU 5KFSA 1OIAA 2JLFA 3L9ZA 3IGNA 2XY7A 3GFZA 2MY8A 3MM8A 4B3OB 2OSQA 3MTKA 2CNKB 2ZM6F 2BR0A 2VA2A 4K4WA 1EHWA 2F5GA 4NLGA 1YJVA 2CZVC 2BQRA 2QC3A 1EP4B 3IS9A 2IYGA 3A12A 1FFGB 2JEFA 3NOGA 4CRJA 4DWIA 3PFEA 1XMQJ 4DPWA 1OY8A 1X5SA 2F4VJ 4HH0A 3ETOA 2HNYB 3M8WA 4X62F 5DM7Q 1T7PA 2V4JB 3HP6A 2CRLA 4WTOB 2HHXA 1SKSA 2YPYA 2XHCA 1YIJS 5RUBA 2LXUA 5IWAJ 4DLEA 1RTIA 2X3DA 2OUGA 5E3CA 4OJHA 1GXUA 3R5DA 1RJJA 2XI3A 4FPRA 1T0TV 3HK2A 3CD5A 4DV2J 4DFPA 4WK3A 3QSIA 4NEYA 2CJYB 2WVDA 3ILLA 3LQVA 3MR2A 2Z8QA 4L3NA 1WDDA 3QRQA 2FJVA 3MEEA 4NZ7A 3A1YG 2GNKA 2BM1A 3W2VB 4O3RA 3VQSA 3DLKA 3GB0A 3OSNA 3V6JA 1I94F 1SB6A 4X4SA 1NSQA 2W8LA 3HM9A 1UEUA 4WWSA 3ZZTA 4ZVSB 3TWZA 1PG5B 1FD2A 4XPEA 3W8GA 1RLDA 3CVKA 2UUAJ 4FYWB 2E9ZA 2J7KA 5BR8F 2B4OA 3CB4A 1TL7B 8RUCA 1VBXA 1FI4A 3V2UC 4NA2A 3X3UA 1F9HA 1V5IB 3UQSA 1JX4A 4R25A 3JQKA 2XC9A 2RJZA 1OYEA 3C6UB 5EDWA 3OFEA 4NCBA 1U0SA 1XIQA 1BGXT 2C3PA 4JI1J 2CPZA 1ZM2A 4OYXA 3OHBA 5HQLA 4ZCIA 2EC2A 1R0CB 3IC1A 4F8RA 2XMWA 4EI2A 2FJDB 2XTJP 4JYAF 4ALZA 3NG8A 1F5BA 3A3NB 5D78A 2A3JA 3NGDA 3KJVA 4NCAA 2G0JA 3PV8A 1IWGA 3K5MA 4CM0A 3MUTP 3OXLA 4KHPF 2CQDA 3K5OA 3NL0A 1FVSA 2H4YB 2BM0A 2J0WA 1RCOB 2LQ5A 4QOTA 1UZDA 3RJMB 4LQ9A 1HWIA 1RHUB 3BBCA 3RG6A 1QAIA 3EDRB 3H42A 3MM5A 3I0RB 1WG4A 2FZCB 5E41A 4EZ9A 3UR0A 4DR6J 5C24B 5KFWA 3R7NB 1GT8A 4AXJA 3J81Y 1HQEA 2QX0A 2DR6A 2RS8A 2ZZTA 3AB2B 4MIBA 1ZA2B 2KB2A 3B4DA 3TUJC 4F3MA 1TV6A 4F0KA 4DV0J 1GMUA 1O6XA 4B9SA 3HLUA 5EUHA 4Z7CA 1IBKF 4USHA 4OYWA 5CYQB 1C0UB 2Z30B 3MCMA 2B8PA 1SJRA 2VQFJ 2U2FA 5CHCB 3I96A 1C1CA 2ZD1A 1HBOA 4B3SF 1YJ7A 2W7AA 2PSZA 2A2CA 1N34J 4LBIA 2F3JA 3HZGA 4DR4J 3CCQS 3QT6A 3OR2B 4URQU 2PC6A 3Q0AA 1S57A 2F65A 3UDLA 1N48A 2UVVA 3JSMB 5LMNF 3CCRS 4UQTA 5L38A 3MCSA 1EP4A 5A2QU 2H5EA 2V2ZA 2IRYA 3K5NA 5LXRA 4WYLA 1AUDA 5ADZA 3CXCR 4L3KA 1VQMS 3BQ2A 1AZSB 1FRLA 4NLWA 3GG0A 4IOCQ 3E2EA 2KFZA 3DXBA 2E29A 2NYIA 3PM9A 1FDBA 4DV6J 2MQ8A 5KG3A 4CLYA 3H2LA 1NDCA 3UCZP 2V4JA 4HACB 1HHQA 4KT0C 3M05A 4KJIA 1K1QA 2EFPA 2WBMA 2IVFB 4Y2MA 2C2ZB 1KQGB 3T1YJ 2DEJA 4P2XA 1YHQS 2V63A 3MWBA 4J9RA 1UVKA 3TX0A 4WK1A 2DJWA 2CZ4A 2DK2A 1F1BB 2WB1D 4OYIA 1X5PA 5AXNA 4ZIWA 1QJHA 3O3LA 2DIUA 2UUBJ 2W8KA 4ZCMA 1U6FA 2J76E 4CT8A 1UVIA 4RWWA 3KLVA 1LW2A 5ETKA 1OMSA 3BDPA 3BSOA 2HMIA 4ED1A 3LF0A 3MPVA 4ZVEA 1HNIA 4FXVA 2AGQA 2VF3A 2ZDOA 4O4RA 2B7CB 2DNYA 3MMBA 9RUBA 2AW0A 4N47A 1VBKA 5F9NA 1U1LA 3GILA 3W2WA 3W9IA 2IRUA 3AQPA 4NLDA 4DV1J 3IBCB 4CH1A 1H72C 3GONA 1UWBB 3PYDA 1M5PC 2J9DA 5G0RA 2P2CB 1P9YA 1AROP 2MQNA 4RW6B 2QYGA 1R6VA 2A6OA 3WIVA 1MN7A 1RYRA 2QV6A 4ZVQB 2QTWA 4WJBA 3A13A 2MLXA 3JB9k 5GAEI 4M63A 1NEEA 3M8SA 3PJWA 4DQIA 3ET6B 1GTHA 2NUHA 1SH2A 3DLBA 2NXNA 3Q89A 1L3VA 1PIEA 2B7BB 2ZJPQ 3T5LA 4DV3F 1S9EB 1JMTA 5KT3A 1VQ5S 1C0TB 2ZVIA 4CTAB 1J27A 2RSQA 3HHEA 4C8NA 2GW8A 4YR2A 5CAAA 2OKQA 4UT4A 4NLQA 4B02A 1TR0A 2YTCA 4JI8F 2NS1B 5ETRA 2HLUA 2CQ4A 4F2RA 4M5KA 2IHR1 1D0EA 2VG7B 1P27B 1EKRA 2FGOA 3I0RA 3MTJA 5DJBA 3U02A 3R9LA 2CQ1A 1T9TA 1NMEB 2AD9A 5C24A 3S01A 2WOMB 3H40A 3LTOA 2DHAA 2M2BA 2XS7A 2R7RA 5T7LA 4DCPB 1TU0B 4DL3A 4ECRA 2VODA 3V6HA 2DTJA 1IWAA 3GE9A 3ENQA 2HQFA 1QTMA 4URGA 1GMVA 1ZTTA 1C4AA 2LXIA 4PXDA 1XNRF 3D7SB 2IPOB 1F0XA 1JJCB 1OO0B 2XEXA 3WC2A 1T9UA 1F3FA 2DGXA 3G2XA 1M0SA 2EBGA 1MWZA 5AE1A 5C2GA 3I87A 5IZHA 2EFQA 3SEOA 3PW5A 4UQGA 1EAYC 1YSJA 4NYPA 4DN9A 3CJ2A 4I2PB 1UKUA 3OR2A 1NB7A 4OYBA 1YJUA 1U2RA 2ILZA 4F7VA 4R0EA 3JSMA 1LWXA 3SV3A 1YDLA 2CQ3A 1DFDA 2CDRB 3MHYA 3U1MA 1YX2A 5IXUA 2EG1A 1PYTA 1AZSA 4DUYF 5L46A 3EDQB 1S9FA 1FF2A 5B7WA 2VASA 3EVMA 1U1OA 1NSKL 1RHRB 3FEZA 3HVAA 1S1UB 4HACA 1KKHA 3N28A 1BQMB 4ZVHA 5C25A 1Y3JA 3NLCA 3M6WA 4I6WA 5L39A 3PTWA 3PHTA 2M70A 1MW7A 1RYSA 2RT3A 2RU3A 2RRBA 2ZH2A 4L74A 4HLBA 1TKTB 3OL9A 2VDIA 5HL7Q 5GADU 4OJ1A 1YLXA 5LSLA 2ZUGA 3B82A 2HKEA 3G82A 2DRBA 2EFVA 3KLEB 1TK8A 1S6OA 3QLHB 3IG1B 1YI2S 2Z56B 4RPFA 5ETTA 5E33A 1WOPA 2GA7A 1SCJB 2ZBPA 2V8GA 4RLEA 4YR0A 5CYMB 4XPCA 3UPFA 2WVEA 2HBZB 1I1GA 4DQQA 4YB1P 2DISA 1OSCA 2KYZA 3HPOA 1S12A 1SJ1A 2CFXA 1UWBA 2PMHA 5KG5A 1GAOA 2ZJRQ 3TNVA 4RW6A 4DL6A 2KRBA 4R8UB 1XTZA 4OI0A 1RTJB 3Q86A 4NZ0A 4DR5J 4CM2A 3T19A 3ET6A 4C7QA 1N36F 1REVB 2K7JA 3W66A 2RRNA 4JI3J 1JLFB 2W4PA 1NHUA 5B09A 3WBZA 1S9EA 2DHXA 5H9EK 3DC2A 3S7RA 2M3DA 1SI9A 1C0TA 7FD1A 3QGPA 1FERA 2XY6A 4A8SA 2GMJA 4MK7A 2I1RA 3OL8A 2WK4A 1WWHA 4XTTA 2DH7A 3DMJA 1B0TA 3TA2A 2NCKL 3EXCX 3W60A 1QAXA 4AE5A 3G8QA 2CQIA 3BM7A 3R5GA 4K4XA 4M5JA 2GHVC 4Q2LA 1KTVA 2DR9A 4QU7A 3HT3A 5E3QA 5KFQA 5GAGI 2D3UA 4HL9A 2AP6A 3C6TB 1B7FA 4LBHA 2IFXA 4RU9A 1B0PA 3PW4A 3E3XA 1CULB 3NCRA 2ROEA 4GC7A 2LYVA 2B9WA 1Q82T 2HW3A 5DS7A 3HXMA 3VAFA 4QR0A 1PYOB 1QTNB 4Y65A 1LQ9A 3I5CA 1UJ6A 2OPPB 2C2EA 1NJIT 2YKQA 1KRPA 1SVDA 3MMCB 3ZFVA 4FYVB 2OAUA 3VTIA 3SQGB 4YB6A 2BJ8A 4MH8A 1XERA 3UO0A 4QIVA 4UZBA 3OTEA 4M5NA 5SUHA 1GNKA 2CQ2A 1CPZA 1WJ9A 5D0GA 1D8ZA 2VBYA 3DOMB 4WE1B 3NXZA 1KVJA 3Q8VA 2HQDA 2HBRB 1MSWD 4I2PA 3NOCA 1VQYA 2DHGA 1WORA 3M2RA 5A0YB 1BMQB 4PKDB 5D15A 3M32A 5I3PA 5G4DA 2QE5A 1F9EB 2G0IA 3ZXWA 4GRSA 1FXRA 3CCSS 2KL8A 4K4UA 1ZOTA 3L3CA 2QT7A 2G2YA 1HQ2A 4U7UK 2YX7A 1JJHA 1SKWA 3JTOA 3AH6A 1S1UA 2YWHA 1H38A 1BY9A 1WG5A 3CF5Q 2WSCC 1BQMA 4C48A 3RBEA 1V3RA 1E6VB 4ELUA 3T9NA 3Q24A 3GJQB 3KWMA 4PG5A 2BYCA 2Q6CA 4IH7A 4RNNA 3NMAA 2HZVA 3GU0A 1TKTA 5CABA 4B3TF 3CJRA 1XK8A 4A46A 2WVBA 3DNCA 2ILYA 4YDXA 2LDIA 1Y00A 1V3ZA 2XLKA 4WXWA 4ETZA 1KQSR 4ZIVA 3BDEA 4J91A 3KLEA 1V5VA 2RQKA 4URSA 1B3TA 3JQJA 3IG1A 1ELOA 4RNMA 1CVJA 3RGIA 2HGNA 4NASA 2VFTA 4PYAA 2OMOA 1DTQB 1RAJA 1N8RT 3VQTA 3H98A 3EM1A 1JQGA 2APOA 1XWLA 2HFZA 5J2MB 3T1HJ 2J7UA 5FLXU 5J1EB 4JI5J 1HNWF 3P45B 3FUYA 2GQCA 1RHQB 3MGJA 4A8OA 1T9VA 2CYYA 5DLGA 2ZBRA 1LEOA 3TJAA 5CD4A 4ZJLA 5F41A 3MM7A 2YKPA 4H4MB 3QAEA 4KGVB 1R6YA 2IM0A 4R8UA 3V4MA 4X4RA 3CMAS 4JI0J 3CO0P 2IVMA 1RTJA 1W2IA 1KOOA 3CTRA 2QLXA 2XMVA 3EGVA 3O8WA 3TANA 4KQZA 2B51A 1EQMA 1LWFB 1REVA 1JLFA 1ZPVA 2DBBA 1IBCB 2ZKTA 3JSBA 3GR0A 1IKWB 1T94A 5HVGA 1WF2A 3SZ2A 3C8YA 2IM3A 3SCLE 2C3OA 2CPDA 1BD6A 2XYHB 1XN9A 2VBXA 1QM9A 3T6JA 4USMA 3MAAB 1NK6A 5DGBA 4OYZA 3LH2S 3TVYA 3R27A 1WF1A 3SBMA 1KOHA 4L76A 1NK7A 5ETPA 4M5DA 2MTLA 1HMVB 2B3TB 5AJ3F 1KC8T 1CULA 2DY9A 4X4TA 1YVFA 4Q44A 3N6MA 2HRUA 5L1KA 3K0JA 3QYYA 2HNZB 4F4KA 2OPPA 2M7SA 2VFUA 1U49A 2FLOA 4MTPA 1UJ5A 3MMCA 4OI6A 4LSZB 4AFFA 3OFGA 3SQGA 3HI9A 2X1AA 1GFWB 4OI2A 3JSRA 3HMJG 2P6SA 4F4WA 3X1LB 4LRAA 3FEYB 4WE1A 1NHVA 2HHSA 3PNIA 2UP1A 2UXDJ 4BC7A 3B54A 1EARA 4O3NA 1WACA 2W9BB 3I9ZA 2B9EA 5A0YA 2M52A 3BR8A 2HHVA 4B9UA 2H3EB 4PRFA 2FJBB 4F4AA 1A6LA 1K47A 3ETMA 2D9PA 4M5IA 3GV5B 1M1HA 2M5YA 2W2OP 1J5EJ 1TKXB 2KZZA 2ZFHA 5GAHI 1P1LA 3GFXA 1MLAA 2XG8A 3AA9A 2JWNA 3C15B 2FLNA 1Y5LB 1FJGF 1VQLS 4FNIA 4RNHA 2OGUA 2HHHF 3ONQA 3QJJA 4OJ3A 2AYEA 3DRSB 1E6VA 4L75A 1XC9A 4HHUA 5L8RC 4EUVA 4ED5A 5B0DA 2LXFA 3MR7A 2V6AA 2FVCA 5DM6Q 4GO5X 1Q86T 1NK0A 1FESA 3UDEA 2KZMA 2VJVA 1ZA1B 3IM8A 4RW7B 1X5TA 2JFDA 1ZTWA 1BHNA 1NUEA 3PO5A 3CCMS 4RW4B 1NJWA 3QJPA 2G4BA 1DTQA 1YRXA 1WI8A 4JV5F 1KDNA 2N82B 3Q8QB 2R8GA 4NLVA 1QSLA 5J2MA 4C3LA 1UP1A 5J1EA 4F3OA 4USTA 4OMFG 2JRSA 4NLRA 1OYDA 1UFWA 2HRYA 2UUCJ 1RTDB 3M1VB 5KFRA 2V69A 5HANA 4QQBA 5DZ7A 2DNLA 1RT3B 3MR5A 4P10A 4YEAA 4A8KA 4C8OA 3NAIA 4H4MA 4P9SA 2VONA 4X66J 2B9XA 3IP0A 3C14A 3H5UA 3TR5A 1HWUA 4XDDA 1FTCA 4K2XA 4OV6A 4ECZA 4WIQA 2E44A 4LJMA 2ZWOA 4U7CA 1X4GA 1HWJA 1U6ZA 1LWFA 4IOBA 4MIAA 4EYHB 5CQGA 3J7AN 5KFFA 4DX8H 3IRXB 3KMSA 3H5SA 3IR5B 3IAS9 5KFXA 2DCUB 2IJRA 4UF4A 1NJXA 2BE9B 3T1YF 1TL3B 2LFVA 4LBPA 1VHFA 3NY0A 2Y1RI 4ECVA 3QT5A 4PR6A 3BQ1A 4OLPA 2NSBA 2IJFA 3C16B 2NSCA 1NKEA 3QFHA 3B78A 3CULA 1PO6A 1V6HA 3AJ1A 5CH7B 4LF6F 3AY0A 2QRRA 1PAUB 2LLZA 4IQXA 4A8QA 3FGVA 4C98A 4JOUA 3PYFA 4ETXA 2B4VA 1S6PB 5KT4A 2WTFA 1HMVA 1F3VA 4ZVGA 4ELTA 2XMKA 5D4PA 1DJ0A 2OFGX 3IR7B 1HHTP 2HWTA 5IC6B 2AV5A 2YWGA 2HQCA 5B0BA 3VVTA 1PSDA 3KLGA 2HNZA 4OL8A 4TYAA 4WU2A 1ZPWX 4DCJB 3FCWA 2V8DA 2HAIA 2MQPA 4LUBA 4EYIB 4YY3J 4JB8B 2GO8A 2ZHAA 2FLPA 1FWLA 4S0MA 5A6WA 2D74B 2Z2MA 2D9OA 1DLOA 2FVQA 1IKYA 4QJVA 2RDJA 4USWA 1Z4UA 1NK9A 4V1Ak 4ZPBA 2W9BA 4EO8A 1MWQA 4AT1B 2CQGA 2YNHB 2C2NA 1CS4B 1UVNA 1PBUA 2MSSA 2UXBF 1TVRB 2HHWA 3BPDA 2YKMB 3OT9A 4NL5A 3H4DA 4DV7F 3IBWA 1SL1A 2GAHC 1TKXA 3W9JA 5KG2A 2MZ1A 2IJNA 3KUGA 1NK4A 1UWAA 2BZ2A 3C15A 3C66A 1IXKA 1O51A 4KHRA 2G13A 1RA7A 2R7QA 3PYGA 1VQ7S 9ATCB 2FJWA 4O23A 2BJ1A 3QZ7A 2IVYA 2HFOA 2CZ9A 1UPMB 3KHGA 3CIZA 4DV5J 4UY85 4LF9J 2QMWA 2G9OA 4NRTA 1FHTA 4RO0A 2IC3B 5DRKA 1WG1A 4UUXA 1BE4A 1T3NA 3GMGA 1RBOB 2CG8A 4RW7A 5KFHA 3I4PA 1HNZJ 1C4CA 4OZ1A 1QAJA 5B0AA 1BQNB 2ATCB 3QMQA 2UXCF 4IRDA 2MKIA 4J9UE 2OJ3A 3GJTB 1NSPA 2QFJA 2R4FA 2FHMA 1L3KA 2DVIA 5JXSA 1CEZA 1FDNA 4ED6A 3DI6B 2AJ4A 4LF8J 2CQPA 3JAMY 3NCQA 1RTDA 5F0WA 1ZAXA 3M1VA 3CMES 4LFBJ 2BABA 2ZKUA 5ETQA 1MROA 1TKZA 4CLSA 1VRQC 3GYNA 1M5HA 4LF1A 3FZBA 4LMZA 4H4OA 5KG7A 3TZYA 4FF4A 4DEZA 4Z2XA 1MN9A 1LV5A 1SBRA 3MECA 2NXUA 4TLQA 2ROGA 4DXLA 5HP1B 5THWA 3ENAA 3KOAA 4PQUB 1XEZA 2BW7A 1FKPB 2E5LF 1M5OC 4QBUA 1NPPA 4QPXA 2YKNB 1T05B 4K4YA 2IMWP 3AJDA 1DY3A 2E66A 5GAEU 3HSZA 4BCAA 3IRXA 2DH9A 3PACA 5HO4A 2GJFA 1C2PA 5LXYA 2V5HG 3MAHA 2HURA 3NBPB 5HLFB 1QSYA 1NH8A 2CXEA 4CIOA 1XNQF 3C16A 3MMAB 1U45A 4IDKB 3K59A 2WB4A 5DQHA 4B3MF 2Y1JA 3ZZRA 5CYJA 4FN5A 2BV3A 2DNKA 3AD9C 5HMYA 3B8HA 5B0CA 2BANB 1S6PA 3G6YA 2AZ3A 5A2QY 1WC1A 3ENWA 4LFCJ 4DSKA 3ITHB 3FBFA 3L09A 5F9LA 2HBQB 1M5SA 1V3SA 1T3OA 1WC5A 5AXLA 2K06A 3BEGB 1NKBA 4ILMA 4LSLB 3FC9A 2JVOA 4DUZJ 2YKAA 2FC9A 1D3WA 2LEAA 1IBLJ 3CD0A 2VICA 3FCHA 2V94A 4MMOA 1FRHA 1VK8A 4EBDA 3OTBA 1TUGB 4OHXA 4LT6A 1QAYA 3CGIA 3KFWX 2EI5A 1T95A 1CBKA 1UA0A 4PEOA 5LOQA 1Y0HA 2DB1A 4USIA 4PXEA 2RQMA 1GMWD 3N5BA 2YNHA 3RTVA 1TVRA 2YKMA 4ZA1A 3ZZPA 1OS5A 2EFGA 1SJFA 1XMBA 1FXDA 2IAJB 1RAGB 4OQJA 4UOFA 4HVZA 3RUBL 2GCFA 4OHVA 2E5GA 2NR0A 2GHPA 4B9TA 4IR1A 2BEFA 4RW8B 1X4BA 2H5IB 4JI2F 3W61A 2EEYA 3GQCA 3D28A 1KD1T 2KM8C 2PA8D 2BOAA 2MHNA 2G0CA 4LF2A 3DM2B 2CPFA 1ZH5A 2GGPA 4GKKJ 4PG6A 5MLCV 1SJ4P 3W7BA 5A8WB 1HR0F 2C3MA 1SV5A 2IC3A 3QIPA 1R8CA 2HHPA 4LF5F 4AL7A 4DOZA 4G6VB 4F0MA 1MMLA 2P9GA 3SMZA 4DFMA 3AOBA 3BGRA 3CPWR 4B9VA 5I4MA 1BQNA 2RVJA 3MEKA 4LFAJ 1GX5A 1VMBA 3Q83A 4NLSA 2R2RA 3O44A 1UEKA 1TAQA 2Y0BB 1RAEB 4O0NA 1U24A 1U7LA 4WP3A 3DI6A 2ZH6A 1SKUB 4J9MA 3SCJE 2HNDB 1VOMA 1M1GA 3WQPA 1HIYA 1RT5B 1RBAA 4IG3B 2ZDPA 3O2IA 4P2FA 1H3DA 1R31A 1YRTA 1TFYA 4PWDA 3Q8YA 3AD7C 4PG4A 1WHVA 5HP1A 2QZ8A 1MNEA 4OZ0A 4KIAA 4PQUA 2EVZA 4ZN3A 4TU8A 4LRDA 2BBEA 1FKPA 5IS2A 4HKQA 5KT5A 1QSSA 4KO0A 1G1XA 4CZCA 2MB0B 4BWJA 2YKNA 5C42B 1IR2A 1T05A 3NNCA 3ZNJ1 4Y28C 3VZIA 1RWOB 1YJ9S 3MUMP 2AYGA 3HZEA 2CPIA 2L41A 2PO4A 3GIRA 4HI1A 2UVUA 2R9LA 3EVOA 3EGWB 3MURP 1X7VA 4AXIA 2M0GB 2VIHA 3NBPA 5HLFA 2CIMA 4M5GA 4WKYA 3MMAA 4CNYA 1FJ7A 2DGTA 4IDKA 3PXGa 2AYMA 1F2HA 3MR3A 1VDHA 3HKZD 1X4EA 2H1YA 3H90A 5KOXA 1WHYA 2BANA 4CLWA 3OW2R 5LMUJ 5HSPA 2XMMA 2KM8B 3V4IB 2XM3A 3CUNA 4ECSA 1N5VA 3ITHA 1G4CA 1JLBB 2MEWA 2BUNA 1VS3A 5GAGU 1KHWA 4AD6A 1WSRA 3ZZYA 4DX6A 5T41A 2W2PP 4LSLA 3TZZA 2L08A 1JB0C 1ZM4A 1S1TB 4F67A 1UVMA 2I5JB 1R0AB 3H2UB 4G3IA 2QSWA 4R5PB 3WX8A 3GP9A 1VC5A 5J2QA 5SZTA 2ZH9A 4QPTA 2PEHA 2D41A 1R8BA 3TQEA 3D3CJ 1DURA 3G71S 3OLBA 3OV7A 3UI3A 3TUIC 2C2DA 2XS2A 4W92B 5A76A 1UVJA 3OUYB 3RBZA 3FJ2A 5CCLA 2DPIA 2OEMA 4DF8A 3LALA 1YTYA 1RXOB 2DXFA 3G6XA 1S0NA 2QL7B 3VWSA 2IAJA 2BJEA 3NGKA 4CO4A 5K14B 1VISA 1RSCA 3R1HA 1TL5A 2H51B 3TOQA 4FF1A 2KT2A 3M6VA 3MMJA 1WEYA 4ED8A 3F56A 3J81j 3HFVA 3SI8A 2XZTB 1X4FA 6FDRA 2XB2D 3MD3A 1SXLA 3R5JB 2Z0GA 5D3GB 4E0DA 3DM2A 1XMOF 3PX4A 2AZ1A 5F8LA 4X65J 2VB6A 3OXFA 1T9YA 1ZAWA 3IRWP 3QJLA 2R8JA 1MWYA 1FT8A 4KH0B 2ZC4A 2E7VA 2EKNA 3GSIA 3ULHA 4CH0S 1S49A 2GHWA 3RB0A 2XO6A 4MYTA 4FBUA 1NO8A 2DNPA 5F8NA 4C11B 1RHMB 2VQEJ 4PUOB 4OX8A 2IDEA 2W25A 1CC7A 5IT0A 4DL2A 5AXMA 3PR5B 2J9EA 4PCQA 3D6TB 2FB0A 4H54A 1JLQB 4L73A 4PABA 4ANDA 4LQ3A 4I69A 1MMDA 3EGNA 3MEGB 5GMDA 3MCNA 1TL1B 4I4BA 4FF2A 1K0TA 2A18A 4MKVA 1UFKA 4ZLJA 1YG0A 1C1BB 4Q7AA 3QQCD 3PKMA 4BS2A 4MIWA 1J5EF 4NXNF 2B6AA 4I56A 1RWNB 2FHJA 2XWXA 3CNQP 4UUWA 4WFBQ 4QYRA 3LAKA 1FFWB 3WZ0A 1Q1KA 5A8KB 1S76D 3D6HB 1SJ3P 2YQ0A 1JLCA 1S99A 2R8HA 3H5YA 2DHSA 3LP1B 3QWPA 4NLUA 1BLUA 4ID5B 4DG1B 1WD6A 2PFFB 1W2BR 2YWEA 1RACB 4DMZA 2L9WA 3IR6B 4DR2F 2BE2B 4P2MA 5GVQA 1CLFA 4ECQA 3ISND 3JQMA 3G8TA 1RT7A 2PI4A 3IWLA 1RWPB 2HWIA 3FSYA 3FMWA 3VGVA 2HFNA 4ZLPA 2OPQB 5FIIA 3FQKA 2NPFA 2W24A 2CPHA 1DQ9A 2DNZA 1I3OB 3SCIE 2CA9A 3D5MA 4O3QA 2W4CA 4HTIA 4Y34A 5DQGA 5I3UB 3DRPB 3V4IA 2BKNA 3O6QA 2Y9HA 4Y3CA 1JLBA 2FZKB 3BS9A 4NX9A 4LVNP 3LGNA 2MGZB 3AFGA 4Z7YA 5HK4A 3QATA 3EICA 2NXEA 4OZ2A 1SIWB 3M30B 1AXQA 2EWHA 5DDPC 3KTQA 4QW8A 4GC6A 1SC4B 2KVIA 4J37A 1PKUA 4YHHJ 4WFXA 5KFVA 1S1XB 3PIOQ 2I5JA 1R0AA 2NZCA 2BRLA 4R5PA 5KFGA 4MKYA 1T8EA 1WHXA 1WC4A 4OYMA 3PYEA 2MKJA 1LWCB 1ROFA 2NXJA 2QLFB 3BSAA 2R8KA 2ZM6J 3PO4A 4J9VA 5KG1A 4DPUA 2R8IA 2K3KA 4LF4F 5ETSA 2WW8A 4WPAA 4LF7F 3OUYA 4Y2KA 2GZOA 4NXMF 3TRGA 3ZC4A 2M8DB 1W25A 4CLFA 1RT4A 1A9NB 1RTZA 1CJTB 4N8OA 1DAXA 2VFRA 4MK8A 2GIRA 4FYDA 2IRXA 1F5CA 3WIUA 2IMOA 5F3ZA 1QD1A 2RD5C 3Q22A 4GKJF 4X62J 5K14A 5AE3A 3PFOA 2FY1A 1S79A 4F02A 1LOUA 4EWTA 3UDCA 1KBRA 1NXIA 5GAHU 4MKAA 3BKTA 2DXEA 1Q4RA 3R97A 2VJUA 5FLXY 3KNAA 2ACMA 2ZITA 4M5LA 8AT1B 4WU3A 2Z2YB 2PDAA 2F9DA 2LU1A 3G6ES 4U95A 3A8KA 4J9LA 2W2NP 5C5JA 3MFHA 2KDOA 3AJ2A 3Q23A 4HDHA 4OYAA 2CAJA 2OPSB 4PXBA 4UY8T 2VG5B 4WFZA 4ICLB 2HWHA 2MKSA 1I94J 5EX3A 1KVIA 3MUVP 1RTHB 2DNHA 1NK8A 2R7SA 2UUTA 1U25A 2GIQA 4E8UA 4A4JA 3RAXA 1JLQA 2CNOB 1Q79A 1SIZA 2RKIB 4DPOA 4TQSA 5CZXA 3DFEA 3D54A 4X4VA 3CDEA 2DO0A 1YGYA 2HLTA 4IO1A 2FYXA 1TL1A 4I0WA 2FD2A 3J80Y 1HYSA 1NJYA 3MD1A 5L9NA 1O0PA 4YP3A 2XSJB 3KJQB 4QWDA 4ED3A 4EZ6A 2XS5A 2XZWA 3Q2SC 2PI5A 4NA1A 2VHGA 4UW2A 3O1LA 1U8WA 7AT1B 3FK4A 2W01A 3MM6B 1Q81T 3R5BA 2FY8A 2K1RB 2WAQD 3ZTSA 5GMEA 4JYAJ 3WDOA 1U48A 1U1QA 1YK9A 3UN3A 5A8KA 3H0PA 1JKHB 2FHJD 2MMYA 3LP1A 4ED4A 4ID5A 4PQAA 1CJVB 1NDKA 2HFUA 4RUBA 1LFPA 4IG0B 3M9OB 5EWFA 2D3O1 1JJ2R 3NNHA 2AIRB 2CPJA 3OTOF 2AJFE 3QRPA 2R7TA 1E6YB 3DHWC 4I1TA 3OVAA 4KHPJ 3EYZA 2VU5A 2BE2A 2KJWA 1GH8A 1TK5A 4W98A 3NKYA 4USJC 1DRZA 2ZOGA 4FYYB 3UW1A 4IRCA 5KFNA 4NWBA 4ZP6A 3I9V9 3GYXB 2F9JA 1X60A 3CEDA 2JC1A 2OPQA 1SPBP 1FO1A 2KXNB 1JLEB 2VBZA 4CLPA 4CH7A
chains in the Genus database with same CATH topology
3ELHA 4F36A 2DXEA 1LWXA 3EVOA 1NLKL 3EICA 1K44A 3EE3A 4ANCA 1NDCA 1HHQA 2HVEA 3FBBA 3Q8VA 1NDPA 1WKKA 3Q83A 4DUTA 1XIQA 2DXDA 1PKUA 1NDLA 3BH6B 1ZS6A 3VGTA 4ENOA 4UOGA 5C7PA 1UCNA 5BXIA 1U8WA 1W7WA 3R9LA 3VVTA 2NCKL 3NGUA 4O0NA 4DI6A 1WKJA 4UOFA 1XQIA 1NPKA 3EVMA 3FBEA 4UOHA 1NSKL 2AZ3A 3NGTA 3PJ9A 3DKDA 3ZTSA 3FCWA 1MN7A 1JXVA 1MN9A 3EJMA 3L7UA 1PAEX 3NGRA 3EM1A 2B8PA 2DXFA 3FBFA 4DZ6A 1HIYA 3ENAA 3EMTA 3FBCA 3BBBA 3B6BA 3NGSA 5IOLA 2BEFA 2DYAA 3B54A 3PRVA 1BHNA 1NUEA 1EHWA 1B99A 1HLWA 3VVUA 3MPDA 3ZTQA 1F6TA 4FKYA 1NDKA 3FC9A 4ANDA 3Q89A 4S0MA 4KPCA 4CP5A 1NCLA 3Q8YA 3Q8UA 3VGVA 3EVWA 1BE4A 3ZTPA 4F4AA 1BUXA 3ETMA 4ANEA 3VGSA 3DDIA 1NSQA 3Q86A 1KDNA 1S57A 3BH7B 1LEOA 2VU5A 3GPAA 2BX6A 3BBFA 1F3FA 3FKBA 3G2XA 2ZUAA 1B4SA 4W98A 1WKLA 1S5ZA 3ZTRA 3VGUA 4HR2A 1S59A 2HVDA 3BBCA 4FKXA 4WBFA 1NHKL 2B8QA 4C6AA 1NB2A 5CAAA 3ZTOA 2CWKA 2DY9A 2HURA 5CABA 3FCVA 3JS9A 4EK2A 1VYAA 2AZ1A 1NSPA 3WX8A 3GP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ELH A;  4F36 A;  2DXE A;  1LWX A;  3EVO A;  1NLK L;  3EIC A;  1K44 A;  3EE3 A;  4ANC A;  1NDC A;  1HHQ A;  2HVE A;  3FBB A;  3Q8V A;  1NDP A;  1WKK A;  3Q83 A;  4DUT A;  1XIQ A;  2DXD A;  1PKU A;  1NDL A;  3BH6 B;  1ZS6 A;  3VGT A;  4ENO A;  4UOG A;  5C7P A;  1UCN A;  5BXI A;  1U8W A;  1W7W A;  3R9L A;  3VVT A;  2NCK L;  3NGU A;  4O0N A;  4DI6 A;  1WKJ A;  4UOF A;  1XQI A;  1NPK A;  3EVM A;  3FBE A;  4UOH A;  1NSK L;  2AZ3 A;  3NGT A;  3PJ9 A;  3DKD A;  3ZTS A;  3FCW A;  1MN7 A;  1JXV A;  1MN9 A;  3EJM A;  3L7U A;  1PAE X;  3NGR A;  3EM1 A;  2B8P A;  2DXF A;  3FBF A;  4DZ6 A;  1HIY A;  3ENA A;  3EMT A;  3FBC A;  3BBB A;  3B6B A;  3NGS A;  5IOL A;  2BEF A;  2DYA A;  3B54 A;  3PRV A;  1BHN A;  1NUE A;  1EHW A;  1B99 A;  1HLW A;  3VVU A;  3MPD A;  3ZTQ A;  1F6T A;  4FKY A;  1NDK A;  3FC9 A;  4AND A;  3Q89 A;  4S0M A;  4KPC A;  4CP5 A;  1NCL A;  3Q8Y A;  3Q8U A;  3VGV A;  3EVW A;  1BE4 A;  3ZTP A;  4F4A A;  1BUX A;  3ETM A;  4ANE A;  3VGS A;  3DDI A;  1NSQ A;  3Q86 A;  1KDN A;  1S57 A;  3BH7 B;  1LEO A;  2VU5 A;  3GPA A;  2BX6 A;  3BBF A;  1F3F A;  3FKB A;  3G2X A;  2ZUA A;  1B4S A;  4W98 A;  1WKL A;  1S5Z A;  3ZTR A;  3VGU A;  4HR2 A;  1S59 A;  2HVD A;  3BBC A;  4FKX A;  4WBF A;  1NHK L;  2B8Q A;  4C6A A;  1NB2 A;  5CAA A;  3ZTO A;  2CWK A;  2DY9 A;  2HUR A;  5CAB A;  3FCV A;  3JS9 A;  4EK2 A;  1VYA A;  2AZ1 A;  1NSP A;  3WX8 A;  3GP9 A; 
#chains in the Genus database with same CATH topology
 2ALY B;  4WKR A;  5I3U A;  3DRP A;  1S72 S;  2FVR A;  3CC7 S;  2Q66 A;  1NDL A;  1RAD B;  1VBY A;  1KN6 A;  2RDI A;  1Z2L A;  3FFI A;  2MGZ A;  1YIT S;  2QSF A;  1IBK J;  1LXN A;  3JAM U;  3M30 A;  2ZBC A;  3EZU A;  4GVB B;  1U1R A;  3EMT A;  2V2K A;  5JUM A;  1S1X A;  2UVR A;  3KXD A;  4B3S J;  5KOW A;  1ZET A;  3OTD A;  1Q5V A;  5DZ6 A;  2FGC A;  1RK8 A;  4U67 Q;  2B4P A;  2BJ3 A;  1FCA A;  2H48 B;  4A48 A;  2XGQ A;  1ZM3 A;  2JZ5 A;  4F4X A;  2RRA A;  5GMK a;  1QVF R;  3D3B J;  1LWC A;  1S4F A;  3PX6 A;  2U1A A;  3GPA A;  4YME A;  3P6Y C;  1OJ4 A;  5LMN J;  3N4W A;  1OPI A;  2JDJ A;  3KDO A;  2HG4 A;  3G8S A;  2VC1 A;  3D0I E;  4ZVT B;  2DR8 A;  3W5Y A;  3TEG A;  3OLA A;  2ADB A;  3SXL A;  3A4T A;  4QYZ J;  2MKY A;  1UZH A;  2DCL A;  2YNI B;  5ETM A;  3I4H X;  4X64 F;  1KEK A;  4DR3 F;  1FDA A;  4I7F A;  1RT6 B;  2G2O A;  4JP8 A;  4ZJQ A;  1AFJ A;  3GIJ A;  4ZP9 A;  3AA8 A;  4NLP A;  4ZDN A;  2RE1 A;  3GIM A;  3LAM A;  1K0V A;  3LO3 A;  4LR9 A;  1X9M A;  4P6Q A;  3M7V A;  3L7U A;  2Z2Z A;  4B3O A;  1NU4 A;  2EG2 A;  5D6G A;  4OX9 F;  4ZKA A;  1BXN A;  2R2T A;  2FDN A;  2KG0 A;  3Q8U A;  4KH1 B;  4LSN B;  3BGU A;  4NYZ A;  3DDI A;  2HIY A;  4CLZ A;  3PHE A;  1SQF A;  5LT5 A;  2POK A;  2OPS A;  3THV A;  2O67 A;  2VG5 A;  2HNY A;  4ICL A;  2HYI B;  3GFY A;  1LKZ A;  1URN A;  3T9Z A;  2LA6 A;  4K59 A;  3MED B;  2ZH7 A;  2VPZ B;  5KTQ A;  4ZJO A;  1WEL A;  3OJU A;  1CSJ A;  2KO1 A;  5JMN A;  4C8Y A;  3SFU A;  2RKI A;  4ZP7 A;  2MXY A;  3OPK A;  1K8A T;  2CWX A;  2ZHB A;  4WCE Q;  5CZV A;  2K7K A;  2KXH A;  2DHH A;  2EW9 A;  1RAB B;  4J90 A;  3A8I A;  2V34 A;  5B0F A;  2OSR A;  2XYG B;  2PT0 A;  2JFK A;  5T14 A;  1GTE A;  2EK6 A;  3GCX P;  5CCM A;  3W2V A;  4DHV A;  3DRX A;  5ETN A;  3MM6 A;  2HAF A;  3DHX A;  1RAF B;  2H9Z A;  2PFD A;  2E9R X;  3K17 A;  3CJ3 A;  5KFT A;  3IMQ J;  2HEK A;  3CCV S;  2X51 A;  1JKH A;  5E3A A;  1IQT A;  1RIS A;  3LGH A;  3KLH B;  1KVK A;  4HDG A;  4DX7 A;  2IM2 A;  3AT1 B;  1CJV A;  2OTJ S;  4IG0 A;  4ES1 A;  1GXL A;  4ITS A;  3CW2 C;  1E6Y A;  3MF5 A;  1VRU B;  1TL7 A;  1FK9 B;  3M2V B;  2GVZ B;  4DR1 F;  2J6U A;  3LWM A;  1X9W A;  3D6M B;  4JI8 J;  1U2F A;  3C6U A;  1RHJ B;  2QA1 A;  3E01 B;  3M8Y A;  4ILL A;  3QSY B;  1JLE A;  3KHR A;  4Z37 A;  4RX6 A;  2YNG B;  1X9S A;  4CCH A;  4EBE A;  4U9R A;  1TUW A;  5D4L A;  3QZ8 A;  1TZ0 A;  3UFC X;  5JVG Q;  1H6K X;  4LFA F;  3RRK A;  1CJU B;  3P96 A;  5JVH Q;  3MR6 A;  2ZOM A;  3LPY A;  3IA0 A;  1B99 A;  2HS4 A;  2ZZM A;  2A2D A;  3OQ2 A;  3VVU A;  5KAK A;  1H73 A;  4ECX A;  2QEX S;  1XNR J;  4KKO B;  2VH7 A;  2V4R A;  4LVO P;  3HVW A;  1VQS A;  2SXL A;  1NBE B;  3VGU A;  3KDN A;  3D1Q A;  4ZOS A;  4FF3 A;  1DQ8 A;  3DDN A;  4FKX A;  2KFN A;  4NLT A;  5LL6 d;  3CE8 A;  3I82 A;  4RKU C;  3W3S A;  2ZNY A;  1YWX A;  5KFK A;  1Q8B A;  2Q79 A;  1EQ0 A;  5A6P A;  1ICE B;  2HS0 A;  2MZJ A;  3PG9 A;  4OX7 A;  1B0V A;  1KLM B;  1VIX A;  3MI7 X;  3KKF A;  3UE2 A;  3K8V A;  5C7P A;  2YNI A;  4DUY J;  3CJ0 A;  1TL4 A;  5LJ3 Y;  4O3O A;  4KFB B;  2UU9 F;  3FRZ A;  1NPK A;  3L4B C;  1TQL A;  1GX6 A;  5CYQ A;  1RT6 A;  1C0U A;  1X5O A;  4UOC A;  3ZZO A;  2QL5 B;  1VQN S;  2HS3 A;  1F6T A;  2PGC A;  3K58 A;  2RIJ A;  3UR3 C;  1NM2 A;  2W2M P;  3Q8R B;  2DNM A;  2V8V A;  2KG1 A;  1N32 F;  1NRK A;  5AXK A;  3GCW P;  2C2M B;  4TNO A;  2NLW A;  5EHH A;  5DGA A;  3IXQ A;  1R8P A;  4M1K A;  1S59 A;  3AB4 B;  1WNE A;  2W9C B;  2GMH A;  4LSN A;  2EK1 A;  2FVS A;  1EX8 A;  5HAT A;  3L95 X;  3HF5 A;  4C0O C;  3ELH A;  3KK2 B;  2XLI A;  1HW8 A;  3RR7 A;  4OHW A;  1YBU A;  2M88 A;  4OZ3 A;  3RRH A;  1VHI A;  4F26 A;  3TJ9 A;  2AKW B;  3TA0 A;  3R7S B;  4P73 A;  4K2J A;  3KK1 B;  3M6U A;  1HBU B;  2V9W A;  4W90 B;  4C3K A;  2VPY B;  5U47 A;  1HKA A;  4ZS6 A;  1VGY A;  2CQB A;  1J5O B;  1CQN A;  4QWE A;  2FJE B;  4CO2 A;  2NUU G;  4DR7 F;  4K7Q A;  2QMU B;  4K0K F;  4KGX B;  1WEX A;  3QWU A;  2XMT A;  2OPR B;  1TFW A;  2N3O A;  4DSL A;  2DGU A;  1RCX B;  5B0E A;  2HZC A;  4I64 A;  1PIL A;  1ZZF A;  3H7H B;  2K3I A;  1P9Q C;  1N36 J;  4RBU A;  2CAD A;  3SYZ A;  3EZ5 A;  4K8R A;  1VRT B;  4JI7 F;  5EWE A;  3SSR A;  5H9F K;  3TI0 A;  3P8B B;  2MPU A;  1K44 A;  2MJN A;  1WEZ A;  1RDR A;  1O8B A;  4DQP A;  3CCT A;  3CIM A;  3VR1 A;  1BC6 A;  1VRU A;  5DDQ C;  1FK9 A;  3M2V A;  4IYQ A;  2C3U A;  2AJQ A;  1KLN A;  2F8E X;  3NGU A;  1MU2 B;  1NJZ A;  3DCA A;  2VC0 A;  2YY3 A;  1VJW A;  1ITP A;  2AMC B;  4IO9 Q;  4NEZ A;  3D9B A;  1PAE X;  4B3R F;  4JI4 F;  1WC0 A;  3MEE B;  4PWU A;  2BOP A;  1GQE A;  2YNG A;  1AUS L;  4O3S A;  3IFE A;  3P3D A;  2AX1 A;  3MOJ B;  1WOS A;  5F8I A;  4C97 A;  2JHE A;  4AQY F;  2DR5 A;  3CSK A;  3EGZ A;  3PR4 A;  4CTA A;  1N88 A;  2DEI A;  1N5Y B;  1U47 A;  2OEL A;  5EX0 A;  2VUG A;  1HNV B;  1ZM9 A;  4KKO A;  2W7P A;  3IM9 A;  2GC8 A;  4X2B A;  5ETL A;  4CO1 A;  3N6N A;  4NPO A;  3ADA C;  1Q16 B;  2LEP A;  4ZCK A;  1KFD A;  5KFC A;  3UDV A;  1VQ6 S;  1M5K C;  4ZIT A;  2VG7 A;  2IBO A;  2H65 B;  3CJS A;  3LP2 B;  2PN6 A;  2WOM A;  1H2U X;  2N3L A;  1RAO A;  3BV8 A;  5HMW A;  4J7C A;  1KLM A;  4KYZ A;  3ENV A;  2FUG 9;  3BN4 A;  2EFN A;  3KJV B;  1FXL A;  2A0F B;  2Z57 B;  2J6S A;  2CPE A;  4QW9 A;  3G86 A;  2VBW A;  3HFK A;  4KFB A;  1N33 F;  5KFB A;  3RZA A;  2ALZ A;  2GIF A;  2EPI A;  5J1N A;  4KPY A;  2E1P A;  3BBF A;  2QA4 G;  3AQO A;  5D4O A;  3P49 B;  4WF9 Q;  2BJ9 A;  2W4D A;  2ZZN A;  4DL5 A;  2K8G A;  5KT2 A;  5ITH A;  4B3T J;  2P6T A;  4C9D A;  3THT A;  4P74 A;  3M8Z A;  3V6D B;  1TMJ A;  3DN9 A;  5L9X A;  3N6L A;  4C2M A;  4EBC A;  2DNG A;  5K8O A;  4I67 A;  1GXT A;  1IQZ A;  1DQA A;  4KTQ A;  4JI6 F;  3MCO A;  2CKW A;  1Y9O A;  1NDP A;  2AX0 A;  1FWK A;  1LW0 B;  3VGT A;  4IKA A;  5KFM A;  2COL A;  1IR1 A;  3KK2 A;  4DI6 A;  3BO3 A;  4QIG A;  4C0B A;  5E3R A;  1FDD A;  3KG4 A;  2UUW A;  3P4U B;  1EKS A;  2C3Y A;  3KK1 A;  1HBU A;  1I51 B;  3SDE B;  4AL5 A;  3PW2 A;  5FDL B;  1CJK B;  1HNW J;  4CLK A;  1TP7 A;  1J5O A;  3BJY A;  3C46 A;  3HHL B;  1P8G A;  2O3D A;  2NQP A;  4HHJ A;  1RZM A;  3S8S A;  3R2D J;  3CCJ S;  2FJA B;  3CCZ A;  2Y1L B;  3K2Y A;  4N41 A;  4C8M A;  4GMK A;  4KGZ B;  3DYA B;  2OPR A;  1VLO A;  2I2Y A;  5MAO A;  1U0H B;  3QLH A;  4JUZ A;  1IBM F;  1TEL A;  4DV4 F;  4GVL A;  1UJ4 A;  3DRR B;  3T5K A;  2FHO B;  2RH3 A;  2RIL A;  3RYL A;  2GVD B;  1SL0 A;  4CWB A;  5CYM A;  5KFE A;  1ZS6 A;  1N54 B;  1RP5 A;  1VRT A;  3HVT B;  4N8N A;  1IKX B;  2UV8 G;  4DQS A;  2BXJ A;  5HVH A;  4ERD A;  3D6F B;  2RQC A;  1WKJ A;  1Q53 A;  1UW9 A;  4UOH A;  3TP2 A;  2V4Q A;  4NZ6 A;  5KFO A;  2GJI A;  3ZZ0 A;  2AHO B;  2B43 A;  1KON A;  3OJS A;  2JVR A;  1I6J A;  3L7O A;  1YBT A;  5F8J A;  1S7H A;  4FBT A;  1MU2 A;  3M9M B;  3VAL A;  2DGQ A;  2LA4 A;  1FE0 A;  2E1M C;  1Y3K A;  3DLH A;  5ETV A;  5F0U A;  3KHH A;  3CMQ A;  4B9M A;  2M9K A;  1HAR A;  2DR7 A;  1LW2 B;  1NND A;  3KNG A;  1XMQ F;  2YWK A;  1EJ7 L;  2LQ9 A;  1D9D A;  2HMI B;  2F4V F;  2HVH A;  2HVD A;  1HNI B;  2MQQ A;  5AJ3 J;  1FTR A;  3BR9 A;  3T5H A;  3MMB B;  2ABY A;  4OX6 A;  3RAQ A;  2Y8Y A;  2KRR A;  4RUA A;  2Q6B A;  1ZBT A;  2VOO A;  3W2W B;  1N5Y A;  5IWA F;  3EXY A;  4PYD A;  4N5S A;  1HNV A;  2Y3Y A;  1HHS A;  5G0R B;  2GAG C;  3QT7 A;  2CQC A;  3J80 U;  4DV2 F;  5E5N A;  2Z58 B;  4CO0 A;  4Y2I A;  2QYC A;  2QA4 S;  1U26 A;  5J2P B;  5FJ4 A;  4X4N A;  1R27 B;  2ZHO A;  3MPW A;  4U6P A;  2DGO A;  4XAK A;  2IA0 A;  1KFS A;  2DYA A;  1PJ7 A;  1OSD A;  2I9S A;  4EMD A;  5AE2 A;  3U1L A;  3M8Q B;  3C6T A;  4F3Q A;  1IUJ A;  5L1L A;  3LP2 A;  3VCD A;  2MJU A;  2FQQ B;  4RW9 B;  5AT1 B;  5LM7 E;  4Q43 A;  3T3F A;  4YQW A;  2MYF A;  1JNR B;  3KK3 B;  4ZP8 A;  3W64 A;  3EUN A;  4RWX A;  2EKY A;  3UNG C;  1X0F A;  3BF4 A;  1DTT B;  5DG7 A;  3LGM A;  2GV1 A;  2UUA F;  1PYS B;  3FCV A;  3CDU A;  3FZ2 A;  1WF0 A;  2YPZ A;  1FJG J;  3H5X A;  2H5J B;  4E98 A;  2ERR A;  1T9W A;  4YFU A;  2HHH J;  2VDH A;  5HN0 A;  5DLF A;  3DOM A;  4EGL A;  2ASL A;  4IUF A;  1S48 A;  1U6B A;  4DFK A;  4JI1 F;  1LWE B;  1F9F A;  4ZHR B;  3V6D A;  4K4S A;  1OY9 A;  2BJD A;  4ILR A;  1IJE B;  1UW4 A;  4CNZ A;  1F60 B;  3DKD A;  2MLZ A;  3HSG A;  2J0Q D;  5ETO A;  5T7L B;  3PY8 A;  2X3G A;  1YJN S;  2E9T A;  1REG X;  1LW0 A;  2JLG A;  4F50 A;  2KHD A;  4FPI A;  1SUQ B;  4G65 A;  2JOQ A;  1UA1 A;  3RB4 A;  4QU6 A;  2VPX B;  4JV5 J;  3DLG B;  3E8O A;  4L6V 3;  1WC6 A;  3SDE A;  1DHM A;  5FDL A;  2XLJ A;  2R7W A;  1CJK A;  2HHT A;  4ZVR B;  4NCG B;  3HHL A;  3D1O A;  3M9N B;  3T5J A;  3POT B;  2RU9 A;  4DR6 F;  1FNM A;  4QIE A;  4NRU A;  3D2W A;  1VFJ A;  2XBP A;  3AAW B;  2AGO A;  2LU2 A;  3QAU A;  2PEB A;  3DYA A;  3FBB A;  3OFF A;  1U0H A;  2MQL A;  1JJ4 A;  2XHW A;  5IV3 A;  1FFS B;  2OP5 A;  1EET B;  4P52 A;  4DV0 F;  3DRR A;  3PRD A;  4XK8 C;  5K8P A;  1Y7P A;  2AEM A;  2GVD A;  4QCL A;  2VQF F;  3KLI B;  2YH1 A;  1FRX A;  1F5A A;  5C25 B;  4LIW A;  2GJ2 A;  3HVT A;  3KG0 A;  3PRV A;  4B17 A;  1IKX A;  3QO9 B;  2HFS A;  2ROP A;  1N34 F;  1S6U A;  4FXW A;  4DR4 F;  3QID A;  1NAQ A;  1KS2 A;  1CG2 A;  4TU7 A;  2BX6 A;  1N0U A;  1S5Z A;  3UVJ B;  4YR3 A;  1NPR A;  4WBF A;  1Y10 A;  3G82 B;  2V0N A;  1H2T Z;  4LF6 J;  5E3P A;  1B64 A;  4Y2C A;  4J9N A;  2V50 A;  4F4Y A;  3RRG A;  2BKP A;  3VF0 B;  4XIU A;  3A8E A;  4UZC A;  4DV6 F;  2XY5 A;  2QL9 B;  2MST A;  1VCT A;  1Q8I A;  4OZN A;  4U8Y A;  3R5A A;  1WKK A;  2YXL A;  4IRK A;  3Q8P B;  3T41 A;  1YJT A;  4ENO A;  1IKW A;  2IDL A;  3BN7 A;  2AQ4 A;  5I3Q A;  2FTR A;  4DCO B;  3FBE A;  2W2Q P;  4O44 B;  2DO4 A;  2KI2 A;  2ZBQ A;  1X8D A;  4I68 A;  4O0I A;  2ZH3 A;  1IM6 A;  5KFD A;  4FS2 A;  1Y5I B;  3BPS P;  3MAA A;  3N79 A;  1PC4 A;  2UUB F;  4KSE B;  5KFZ A;  5J2P A;  4WP8 A;  5BYR A;  3RB6 A;  4QWA A;  3GV7 B;  1D1U A;  3DRY A;  1LK7 A;  1D9A A;  5E2Q A;  2J7W A;  1VLY A;  3V6K A;  2CDQ A;  3M8Q A;  4M95 A;  4NMX A;  4RW9 A;  2H4W B;  1UAW A;  5B08 A;  2UXB J;  1NB2 A;  2J6T A;  3BKU A;  2JNJ A;  4DV7 J;  3KK3 A;  4C4W A;  2QLW A;  5BYQ A;  2F8H A;  1RKJ A;  2MY7 A;  2LMI A;  6AT1 B;  4WP9 A;  3DU6 A;  1DTT A;  4DV1 F;  1R89 A;  1UTA A;  2NZ4 A;  3N5F A;  5F8H A;  5D8H B;  3NS5 A;  3R2C J;  1UVL A;  3DMJ B;  3TAR A;  4HH1 A;  1Q5Y A;  4CLL A;  4DSI A;  3MPY A;  2PD1 A;  3M6X A;  4RJV A;  3I5A A;  3AXK A;  3V5R A;  2EFO A;  4PG8 A;  1GMW A;  3EPG A;  4X4P A;  1LWE A;  1LNQ A;  2LVW A;  4ZHR A;  4WTY A;  3BKF A;  2CUY A;  4TKT A;  3ISZ A;  4DLG A;  1T11 A;  1KHV A;  1RBL A;  3ISN C;  2QA2 A;  3GJS B;  2ZE2 B;  2J0S D;  3BSC A;  2KH9 A;  3GR1 A;  4DU8 A;  4YDD B;  5IV4 A;  4FVM A;  4RUC A;  3A3O B;  1NH7 A;  1SUQ A;  2I0X A;  1VQ8 S;  2J8S A;  5E7O B;  2UXC J;  1FX2 A;  4OI1 A;  1AYE A;  2HFV A;  3DLG A;  3DRS A;  3LW5 C;  1I5O B;  1VQP S;  5HAO A;  1MG7 A;  3N9U C;  4Q45 A;  4U7U D;  2GX8 A;  4ES3 A;  3K89 A;  3I0S B;  4NCG A;  2YNF B;  3OSP A;  3BGF A;  3POT A;  3PZP A;  3HHL D;  3M2R B;  3EWG A;  2P5V A;  3M32 B;  3TA1 A;  4ZLL A;  2MQM A;  4FVC A;  3PX0 A;  4EU0 A;  3TW0 A;  1RE1 B;  1EET A;  1Y11 A;  2FIU A;  2E5L J;  1HLW A;  4RW4 A;  4ZPT R;  2BQ3 A;  4QYZ K;  2GFF A;  3AOC A;  4KY3 A;  2HQI A;  3KLI A;  5J2N B;  1NK5 A;  5K20 B;  5LSR A;  4OZJ A;  3SIP B;  3QO9 A;  1RWM B;  3NNA A;  5HMZ A;  2OHD A;  1FEH A;  4CI0 B;  2PMZ D;  2GML A;  2YX1 A;  3LP0 B;  1JIH A;  2IIH A;  4EEY A;  2KHC A;  1RT3 A;  1M5V C;  1XNQ J;  2MKH A;  3UVJ A;  2E1C A;  1ULR A;  5HQ8 A;  3EE3 A;  4B3M J;  1FWP A;  4RUH A;  4K50 A;  2QN6 B;  2B5J B;  3H8Y A;  4KB7 A;  2LKZ A;  3UD3 P;  1SH3 A;  1AFI A;  4FYX B;  2KN4 A;  4HTJ A;  1YRU A;  2I38 A;  3OL6 A;  3J7Z 5;  3EJM A;  1JWW A;  2ZVS A;  3T6B A;  3ICL A;  2GS8 A;  1HBN B;  3WX4 A;  1NZA A;  3OVS A;  2MDA A;  1VIO A;  2JL9 A;  1TL3 A;  1U8S A;  4O44 A;  1K73 T;  2HRT A;  1IJF B;  1H98 A;  2MHE A;  4WFY A;  4ZPD A;  3H2V E;  1YKW A;  5K8M A;  4ECU A;  3D0H E;  3MM7 B;  1H0H B;  3QBC A;  3KYL A;  2PII A;  4OYP A;  5KFA A;  3KLF B;  4J5O A;  2VFV A;  3HJV A;  1KQF B;  1TTH B;  3HDS A;  2L3M A;  3E51 A;  2NYH A;  1EB0 A;  3TZX A;  3R6L B;  1FRJ A;  3OD2 A;  3OL7 A;  1RWW B;  2DXD A;  3DLE B;  4OHY A;  5B0G A;  3BZQ A;  2WVF A;  1QDU B;  2Y0S D;  4HT5 A;  2DPJ A;  1JXE A;  3NGT A;  4DF4 A;  2YWW A;  2AT1 B;  4MK9 A;  2C2R A;  2JH3 A;  4OJG A;  3UD5 A;  5BYS A;  4W4M A;  3NMR A;  4JI2 J;  2QLJ B;  4CP5 A;  1L3T A;  4BHQ A;  1IM4 A;  4DN0 A;  2EXU A;  1BWV A;  2QLB B;  2KT3 A;  3J7A 1;  3DXS X;  4DR5 F;  5F8M A;  2P9C A;  3GIK A;  4M5D B;  2HK2 A;  4RZR A;  1HR0 J;  1VQO S;  5DDO C;  1CS4 A;  3RAM A;  2KJV A;  2Z2L A;  2IY5 B;  2HHQ A;  1VBZ A;  4LF5 J;  4JI3 F;  4TQR A;  3QFW A;  3MXH P;  2ZE2 A;  2E7X A;  2BVZ A;  2MZS A;  1N0V C;  4I6A A;  2B56 A;  4XDC A;  3K5P A;  2X1B A;  3PEH A;  1Y5N B;  2YQ3 A;  3HO1 A;  2BE7 D;  1U1M A;  4ECW A;  3DOK B;  2E7W A;  1YZ6 A;  3GFH A;  3PW0 A;  1HW9 A;  4J9K A;  2LDY A;  2HSE B;  1APS A;  4ECY A;  3IO1 A;  2D1C A;  5HRO B;  2C28 A;  3TO8 A;  4C8K A;  3I0S A;  3W65 A;  2WON B;  1T02 A;  2YNF A;  5DDR C;  2Q3P A;  3OR1 B;  2M8H A;  4ED2 A;  2BJ7 A;  5IQ6 A;  3F73 A;  5L1J A;  4QR1 A;  4OHZ A;  1YJW S;  4NLX A;  4KV8 B;  4Q0B B;  3M8R A;  3IBF B;  4N77 A;  3MFI A;  5CD4 H;  1VC0 A;  4ZN1 A;  3NWG A;  1VK3 A;  2CJQ A;  3NS7 B;  2PA3 A;  1WKL A;  4WZQ A;  3RB3 A;  3WC0 A;  2CJ9 A;  1HFE L;  4NML A;  2JSX A;  4AUK A;  4IFV B;  1R0B G;  2P9E A;  5L1I A;  1R43 A;  3QPI A;  1UFL A;  5J2N A;  3QT8 A;  5DQI A;  3SQO P;  1KTQ A;  4IH6 A;  3H25 A;  2UVW A;  3K5L A;  1SJQ A;  3H59 A;  5IT9 U;  4KRW A;  3CD6 S;  3VAI A;  3LP0 A;  3SFG A;  3FEX B;  3QGI A;  1WTB A;  4CT9 A;  1SQE A;  4KE5 A;  4J9S A;  2AJ1 A;  2ZH8 A;  2B5J A;  3NGS A;  2AJ2 A;  2I6W A;  2O01 C;  1FNX H;  2MZR A;  2DNN A;  4X4Q A;  1B70 B;  4Y0F A;  1RLC L;  3KUH A;  4RU2 A;  4IOA Q;  2V2Q A;  1BQX A;  3DDK A;  2HGM A;  1HBN A;  1A0O B;  4DPY A;  1BWE A;  1FKA F;  1OPZ A;  4CDI A;  2MKC A;  1KP6 A;  3R8Y A;  1NHK L;  1HD1 A;  4A47 A;  3HD1 A;  1G2E A;  1KQK A;  3ZZU A;  4Q8F A;  3AD8 C;  4MAK A;  2ZWP A;  4RBT A;  2RQ4 A;  3C14 B;  2QJ3 A;  4PPD A;  2DRA A;  4HT7 A;  3KLF A;  2QIF A;  3BH6 B;  3SV4 A;  4E2F B;  5J1P A;  1S0M A;  2WCX A;  1QUV A;  1KNZ A;  1RQ0 A;  2CNL B;  4MYU A;  3PJ9 A;  3GG1 A;  3OBI A;  3GWC A;  2YWF A;  3MDF A;  2AU0 A;  1ACM B;  3S6E A;  3DLE A;  3HUL A;  1EZZ B;  3P5T L;  1FJC A;  1HL6 A;  3IGV A;  3T1H F;  5JJB A;  2DGW A;  2CQH A;  1YBA A;  4JI5 F;  4FKY A;  3TVZ A;  4G1I A;  4DS4 A;  4OLO A;  3NAH A;  4ANE A;  4J9Q A;  2LEC A;  4OI4 A;  3I6P A;  4JV1 A;  3BH7 B;  2RS2 A;  2V9K A;  3DLL Q;  2XMU A;  2BRK A;  2DY1 A;  2RDD A;  4JI0 F;  4NE9 C;  1X31 C;  2AWZ A;  1TKD A;  2Y8W A;  1XMO J;  1QVG R;  2MLY A;  3I32 A;  4Y2A A;  2QGF B;  2WHO A;  1D8Y A;  2XCP A;  4K4V A;  1L3U A;  4A8F A;  2HQG A;  1K1S A;  3MM9 B;  2JEG A;  3C19 A;  3HHN B;  4LRF A;  5K8N A;  1SL2 A;  5HI7 A;  5KG6 A;  3KLG B;  4DJB A;  1HI0 P;  1JLA B;  1HNX J;  3CDA A;  2HBY B;  2V67 A;  1P6T A;  3DOK A;  4F04 B;  5CA5 A;  5IT4 A;  2XCA A;  1VR6 A;  1FJE B;  4RW8 A;  4DS5 A;  1H2V Z;  3FDS A;  1OWX A;  5HRO A;  4R0J A;  3U1N A;  3PEJ A;  1VQK S;  3I5B A;  2C2O B;  3EVW A;  2W1B A;  2WON A;  4WFA Q;  1QE1 B;  4LR8 A;  2XNQ A;  2D3O R;  4WFN Q;  4N76 A;  1PBA A;  1DLO B;  3OR1 A;  1IKY B;  4YS2 A;  2W7O A;  3FKB A;  5KG4 A;  1B4S A;  5A8W A;  1N6Q B;  3M8P B;  3BGL A;  2IA6 A;  2RUG A;  3D67 A;  3CO9 A;  4KV8 A;  4C6A A;  4QIW D;  4Q0B A;  5KFY A;  4ED7 A;  2J0X A;  4O4G B;  4G1P A;  2RF2 B;  4NXN J;  4TY9 A;  4Q5V A;  2VA3 A;  1X4H A;  3J7Y I;  1RAI B;  1RT2 B;  2J5A A;  4PPZ A;  4IFV A;  2HVE A;  3LWL A;  4CO5 A;  2VV5 A;  2CPX A;  3HSJ A;  3SCK E;  4FP9 A;  4NI2 B;  4U96 A;  1X4A A;  3EX7 B;  2KVQ E;  1WSV A;  2OTL S;  4USV A;  2DH8 A;  1RI7 A;  3EPI A;  1L3S A;  3UN5 A;  3ZNU A;  3JTN A;  1G6B A;  2HND A;  1W26 A;  4P2S A;  1RT5 A;  2UXD F;  2JC0 A;  2DNR A;  4DR2 J;  3WHI A;  1KSP A;  4IG3 A;  1FD8 A;  2C42 A;  1R3N A;  1FE4 A;  4IH5 A;  4TXS A;  5HBM B;  2V68 A;  3NWR A;  4USU A;  4ZVF A;  5BJR A;  1NCL A;  3J81 U;  3FVY A;  5F3T A;  2DGS A;  5EN1 A;  3L7P A;  2CVI A;  1Q8K A;  1RWX B;  2B4U A;  4A8Y A;  4DQR A;  4YUD A;  1RU2 A;  3M4X A;  4Y6I A;  1S97 A;  1FA0 A;  5C42 A;  3LA0 A;  3G4S S;  4CLT A;  5LSO A;  4EO6 A;  4BBY A;  1VYA A;  2HIQ A;  2XGP A;  1S0V A;  2C22 A;  1UMJ A;  3S1T A;  2VD3 A;  2PMW A;  3FRY A;  4F25 A;  3QNW B;  7FDR A;  2R2U A;  4HHH A;  2LP4 A;  4NLO A;  4X4O A;  1MRO B;  1TKZ B;  1Q0N A;  3IN5 A;  2A10 A;  4H4O B;  3VHQ A;  3C2P A;  2OLW A;  2CJA A;  3MEC B;  4NOH A;  3T1A A;  5IOL A;  1YQH A;  2IM1 A;  2ZH5 A;  1RAH B;  4LF4 J;  1XBW A;  3OXG A;  4LF7 J;  1RGV A;  2WSF C;  4NXM J;  4QWC A;  4A8M P;  3CD7 A;  4ZPA A;  4PAA A;  2OH2 A;  5KT6 A;  3UD4 P;  1S6Q B;  1FRK A;  4RL1 A;  1IKV B;  2VOP A;  1S77 D;  4HR2 A;  4TYB A;  6FD1 A;  4GKJ J;  2E5J A;  2UUC F;  3ZTO A;  2AJ0 A;  2AYB A;  1S1T A;  3MOZ A;  3JTP A;  1WTF A;  4N7T A;  4U8V A;  3M2U B;  1QLN A;  1D09 B;  4X66 F;  1JNZ B;  1U09 A;  4O3P A;  4DSF A;  3CJQ A;  1V9O A;  3R7B B;  3TAM B;  1RT1 B;  2KFY A;  2JEJ A;  2VPW B;  1RWV B;  3JSY A;  1ZZN A;  4C8L A;  3HCX A;  2QMX A;  2ZH1 A;  1UPP A;  1U2C A;  2Y1I A;  1YJR A;  2J8A A;  3MM9 A;  1U1P A;  3MAQ A;  4DL0 C;  2OEJ A;  5IC4 B;  2ATL A;  2EBE A;  2V8H A;  1FX4 A;  1NSA A;  3RBX A;  2VKR A;  3GLJ A;  2K2P A;  2RUS A;  1JLA A;  2N4D A;  1TUV A;  2OD6 A;  4FXD A;  4ZPV R;  2HVI A;  3PVX A;  4FS1 A;  3KMQ A;  2XO7 A;  3F0N A;  4WYW A;  2QFI A;  3DOL B;  3NEK A;  2XZD B;  2FC8 A;  4HEA 9;  4FDF A;  4V19 J;  2G1D A;  2AGP A;  4X84 A;  3KJF B;  4DX5 A;  1J2V A;  5D3G A;  1QE1 A;  3ZO7 A;  2NPI A;  3JS9 A;  5D0R A;  1H7X A;  4ZVO B;  1CC8 A;  2HZA A;  3W63 A;  3SSS A;  4ER8 A;  4OIX A;  2DKO B;  2CJK A;  1N6Q A;  3M8P A;  4OV1 A;  4NLY A;  5KFI A;  1HD0 A;  3KJN B;  2BAC A;  5KFL A;  1A7G E;  4DFJ A;  4JBC A;  2HPU A;  3RW7 A;  4B08 A;  2F4F A;  4O4G A;  4F2S A;  2E1R A;  1PCA A;  2RF2 A;  1OQ3 A;  4ZLN A;  2VKZ G;  1RT2 A;  4C11 A;  3THP A;  4DZ6 A;  4PUO A;  3FBC A;  1DBD A;  1N4L A;  5HQM A;  3B6B A;  4NI2 A;  4KR0 B;  5KFP A;  1S0O A;  3VAH A;  3CJK B;  4YY3 F;  4V19 X;  3BO4 A;  4DSE A;  5HVF A;  3ZTQ A;  5D4N A;  3OTO J;  2E5H A;  4MFB B;  5BR8 J;  3VAJ A;  2AEF A;  3MEG A;  2GGP B;  3HKW A;  2BQU A;  4OYO A;  1B7Y B;  5IM0 B;  3N01 A;  2ZH4 A;  5FD1 A;  3PJX A;  3PW7 A;  4B9L A;  1SV5 B;  4PG7 A;  3QIP B;  3QGH A;  5HBM A;  1S1V B;  2B8Q A;  3CJ5 A;  2OFH X;  1C1B A;  3W9H A;  3F44 A;  2MQO A;  1RWK B;  1G7C B;  3TQ1 A;  1FRI A;  4ZPW R;  4H4K C;  2DT9 A;  1RKI A;  1T03 B;  4QR2 A;  3A8J A;  3BGR B;  2BW2 A;  2OEK A;  5DG8 A;  4BLG A;  2X7I A;  3G9C A;  3GV8 B;  3ILO A;  3K8W A;  3BGO P;  2ASD A;  2KXF A;  1MMN A;  2O5D A;  1RWU A;  3HJF A;  3Q8S B;  4LRE A;  3SSQ A;  3D0G E;  1HA1 A;  4ED0 A;  4C0H A;  4DG1 A;  4ZVU B;  2GO9 A;  1M1K T;  5M2R A;  1Z1Z A;  1DZ5 A;  2VFS A;  1VI7 A;  2WSE C;  3HX9 A;  3TZW A;  3J7Z T;  4DV5 F;  4JV0 A;  2KT5 A;  4GO7 X;  4DPX A;  4LF9 F;  2ASJ A;  4C3M A;  3U27 A;  5KFJ A;  3ZZZ A;  2VG6 B;  4F4Z A;  3MPD A;  4X4U A;  1RU1 A;  2B0G A;  3FSI A;  4PWD B;  3DU5 A;  1SH0 A;  3VAM A;  3TAP A;  3K7R A;  2XSF A;  2R42 A;  4WXO A;  3CWJ A;  4CQ1 A;  1HNZ F;  1RUS A;  3ZTR A;  4KO0 B;  1HPZ B;  4WII A;  3RU0 A;  3RW6 A;  3BO2 A;  1SC1 B;  3NRB A;  1Q7L B;  3LOU A;  4UTG A;  2BMB A;  3DGP B;  2ASY A;  2KKH A;  4LRB A;  3CDW A;  2FPH X;  5D0H A;  1M90 T;  2X1F A;  4M5H A;  4CLU A;  2MKK A;  1T9X A;  4X64 J;  4DR3 J;  4DL7 A;  1OY6 A;  4USK A;  1S6Q A;  4ZK7 M;  2BDP A;  1IKV A;  3K57 A;  4LF8 F;  2WVC A;  2RHQ B;  2PE8 A;  4KBI A;  4LFB F;  3RR8 A;  3JXO A;  1PC5 A;  3DLJ A;  5CXT A;  1P1T A;  4QZV B;  1XR7 A;  2CPY A;  3M2U A;  2L48 A;  3HT0 A;  1K9M T;  1L5U A;  4IQM A;  1FVQ A;  4K4T A;  2D3Z A;  1AA1 B;  2DGV A;  3TAM A;  1EIY B;  1RT1 A;  3FNN A;  4QIF A;  1AB8 A;  4PZV A;  2JEI A;  4YB7 A;  4OX9 J;  5I42 B;  1WC3 A;  2YH0 A;  3FMB A;  4K5R A;  3NP5 A;  3IWN C;  1BUX A;  4BC9 A;  3H20 A;  3AXM A;  1CJT A;  4RBV A;  2XMA A;  2F7V A;  1S9G B;  2WBR A;  3IAM 9;  2X1G A;  2WZ1 A;  4M94 A;  2YX4 A;  1XR5 A;  3AHP A;  3EZO A;  4RNF A;  2LEB A;  1N52 B;  3CCL S;  3DOL A;  3N0V A;  3D68 A;  4KAI A;  2R7U A;  5J2Q B;  4D3G A;  3P5B P;  3R6G B;  3B4M A;  2R7V A;  2FLL A;  3PRB A;  4Q2M A;  3W5Z A;  2HVZ A;  5LJ5 Y;  3I31 A;  4CYU B;  1VC6 A;  3US5 A;  1KWM A;  4UOG A;  1UCN A;  2RNE A;  1X4C A;  3KUE A;  3I56 S;  1YZ7 A;  4RNO A;  2XMJ A;  4XO0 A;  2UZA A;  3FQL A;  2CG4 A;  3CCE S;  4LFC F;  2IYI A;  1U1N A;  3BSN A;  2V2V A;  1ZAV A;  4IFY B;  1GEH A;  1KR4 A;  5D77 A;  5H9F J;  3TVK A;  3R3T A;  1Z2Z A;  4AL6 A;  4LIR A;  4KPC A;  4DUZ F;  2C2K B;  4MKB A;  1RTH A;  3ILI A;  1IBL F;  3G87 A;  4J9O A;  3CJK A;  2MZQ A;  1JLG B;  4DDF A;  1XJW B;  4OFZ A;  3G6V A;  2LQB A;  4OI3 A;  2Q43 A;  4KHM A;  1WHW A;  1FNO A;  2B9Y A;  2CWK A;  2C1E B;  3Q2T C;  4MFB A;  1SC3 B;  4ATN A;  2OD4 A;  3GII A;  5F8G A;  2Q1L A;  2ZEJ A;  3KG1 A;  4YB5 A;  4DR1 J;  1TK0 A;  5IM0 A;  2FHK A;  1GK8 A;  2XSJ A;  1N5S A;  4I2Q B;  3CJ4 A;  1S1V A;  4TVA B;  2YQ1 A;  4TU9 A;  1WUU A;  2F63 A;  1NKC A;  2L9D A;  2XWY A;  4MJK A;  2QO3 A;  1S1W B;  4AYB D;  5H9E J;  1UL3 A;  1SQG A;  2LQJ A;  2K1R A;  2XI2 A;  1T03 A;  1N56 A;  3IWX A;  4Q8E A;  4DV3 J;  3JYT B;  4KC5 A;  5M2U A;  3VV2 B;  5KFU A;  5GAD I;  4IR9 A;  2DD8 S;  3CDB A;  5DG9 A;  3VGS A;  3W1Y C;  1RB0 A;  1HBM B;  4KGM A;  2A6M A;  1HWK A;  4ZMM A;  4GKK F;  2VG6 A;  1FRM A;  5A8R B;  3I55 S;  2F1F A;  4RR5 A;  4OZL A;  4I6Y A;  1O5J A;  3BB5 A;  4TY8 B;  4TN2 A;  2WW4 A;  3U7J A;  2O1P A;  1CQM A;  4B9N A;  2B6A B;  2M4M A;  1HPZ A;  4ID8 A;  4HYK A;  2KU7 A;  1QUP A;  2LCW A;  3BQ0 A;  2JLE A;  4A8X A;  1R8A A;  4J9P A;  3OVB A;  3DGP A;  2E5I A;  2ZBI A;  3LAN A;  1JLC B;  3QRR A;  1W7W A;  2BA9 A;  3TYT A;  3UNY A;  1QY7 A;  2F8M A;  2UU9 J;  2NXC A;  2XQC A;  3CC4 S;  4GVB A;  4DBQ A;  3O5T B;  2RML A;  1R8H A;  2ZOF A;  2HQ3 A;  2VL1 A;  1RT7 B;  5H1S V;  3HVR A;  2XNR A;  3TUZ C;  2G2Z A;  4NYO A;  1N32 J;  2R3V A;  2R7X A;  5I42 A;  4ZPC A;  1IN0 A;  4D3H A;  4JV2 A;  1H7W A;  1WOO A;  5HMX A;  2ADC A;  2CVE A;  1OQ6 A;  1Q95 G;  4P7V A;  1HQU B;  2H54 B;  1VQ4 S;  3TEH B;  4PWW A;  3PDN A;  1SKR A;  3MPU B;  1S7I A;  2N7Y A;  1HI1 A;  5C2C A;  3R1L A;  1TMM A;  1H74 A;  2N4C A;  2CQ0 A;  1NLK L;  1S9G A;  2XYP B;  1U02 A;  2CJB A;  1LFW A;  3W62 A;  3FSX A;  4C8Z A;  3HHK A;  4KGK A;  4ZVP B;  3UWT A;  4H4K A;  5E0O A;  1R7I A;  4FZV A;  2KYX A;  4DPT A;  3CJT A;  2ZNZ A;  3V81 B;  4CYU A;  5KT7 A;  4K5S A;  4DR7 J;  4ELV A;  4K0K J;  5IQQ A;  1N5Q A;  3CJ8 A;  1WI6 A;  2HGL A;  2BKO A;  5LMU F;  1VJQ A;  1RA6 A;  1ZYQ A;  2OO4 A;  4WZM A;  1RT4 B;  4M5M A;  2YVS A;  3GSD A;  4DZD A;  1HI8 A;  2A1B A;  3UN2 A;  4IFY A;  2ZUA A;  1FKO B;  3F41 A;  1HWL A;  1U4B A;  3DGV A;  3CCW A;  3HSD A;  3BYR A;  5KG0 A;  2JJ4 D;  1IR0 A;  1Q7Y T;  2ZC3 A;  3MED A;  4G1Q B;  4EFA C;  4F0H A;  4JI7 J;  5DO2 A;  4F36 A;  1JLG A;  2CNN B;  5EGY A;  5DET A;  1D9F A;  3MM8 B;  3G96 A;  4N56 A;  3OTC A;  4A8W A;  5BXI A;  4ECT A;  3MZI A;  3H4B A;  2F40 A;  5HJX A;  1XQI A;  3IS9 B;  4I2Q A;  2ZJQ Q;  8ATC B;  4B3R J;  2GQQ A;  4JI4 J;  1X4D A;  1FEE A;  3GTY X;  5K9F A;  3ILJ A;  1JXL A;  1S1W A;  1DAR A;  3TX8 A;  3D66 A;  1N5T A;  1HNX F;  1S10 A;  2J9C A;  4Y00 A;  3NCP A;  2V8P A;  1RAA B;  1URR A;  3JYT A;  4AQY J;  2JX2 A;  2FJX A;  1PJ6 A;  1RHK B;  1NZ8 A;  4PXC A;  1XR6 A;  3KLH A;  1WDT A;  4ZCL A;  2RHS B;  2AF6 A;  3W5X A;  4OZ5 A;  1RTI B;  4EK2 A;  1TAU A;  4DSJ A;  2W9A A;  1HBM A;  2GVZ A;  1UET A;  2Z4P A;  4FNH A;  4X65 F;  3LPE A;  1HYS B;  3AOD A;  3OFH A;  5A8R A;  5M2P A;  2CJX B;  4ANC A;  4DL4 A;  3E01 A;  4DUT A;  4TY8 A;  2R7O A;  2R2S A;  1IVZ A;  4NA3 A;  3DLK B;  1JK9 B;  2HK3 A;  2YKO A;  1SC6 A;  3GJR B;  2D7S A;  3HHL C;  2VQE F;  3NGR A;  1UEV A;  2DNO A;  2FVP A;  1CJU A;  1AT1 B;  3RBD A;  1PJ5 A;  3VAG A;  2ACY A;  5K5M A;  3CC2 S;  1N33 J;  5IFM A;  1Y4Z B;  4CO3 A;  3ZTP A;  3BYP A;  3C3L A;  2XUL A;  3TUP A;  2MZT A;  3UCU P;  2DRD A;  1U1K A;  1S4E A;  2KTQ A;  2OML A;  3VZH A;  2YBV A;  2QG9 B;  3UCG A;  2DIV A;  5EWG A;  4P72 A;  1Q8L A;  4LR7 A;  3TJ8 A;  3LUY A;  4YN3 B;  2I8E A;  3HHD A;  4P71 A;  1G3O A;  5HJY A;  3GYG A;  1F2G A;  4TLR A;  2P8I A;  4JI6 J;  3QGG A;  1HQU A;  1AW0 A;  2O66 A;  3TAQ A;  4P75 A;  2WRM A;  3D1H A;  3FFI B;  2GQ2 A;  2G1H A;  3CCU S;  1VQ9 S;  3BRE A;  1JXV A;  2IBK A;  2NRE A;  3KHL A;  3PKY A;  2AEJ A;  3BBB A;  3AOA A;  4QWB A;  3A3P B;  3NS6 A;  2DIT A;  2DNQ A;  3CT9 A;  2HHU A;  2N7C A;  4BDP A;  2RB7 A;  3R5C A;  2D69 A;  4MT1 A;  3PCO B;  4L72 B;  3W8P A;  5IT9 Y;  2VZ9 A;  3MM5 B;  2RAQ A;  2FZG B;  3V81 A;  4M8L A;  4YOE A;  4K4Z A;  4BWM A;  3HD2 A;  3HFZ B;  3GZ7 A;  2W9C A;  1LXJ A;  1X0P A;  4ES2 A;  1HQE B;  3OHA A;  1TV6 B;  3PIP Q;  1IBM J;  4HI2 A;  4DV4 J;  1LK5 A;  2EC0 A;  1FKO A;  3D4J A;  4I7F B;  2OI2 A;  4LRC A;  1Q78 A;  4P7T A;  2OIH A;  2L9N A;  3VAK A;  2UV8 A;  2LQ8 A;  4G1Q A;  4YHH F;  1C1C B;  2ZD1 B;  1HBO B;  2E1A A;  5D0E A;  1PGZ A;  4DU7 A;  2J9D E;  3J7Y U;  5KFS A;  1OIA A;  2JLF A;  3L9Z A;  3IGN A;  2XY7 A;  3GFZ A;  2MY8 A;  3MM8 A;  4B3O B;  2OSQ A;  3MTK A;  2CNK B;  2ZM6 F;  2BR0 A;  2VA2 A;  4K4W A;  1EHW A;  2F5G A;  4NLG A;  1YJV A;  2CZV C;  2BQR A;  2QC3 A;  1EP4 B;  3IS9 A;  2IYG A;  3A12 A;  1FFG B;  2JEF A;  3NOG A;  4CRJ A;  4DWI A;  3PFE A;  1XMQ J;  4DPW A;  1OY8 A;  1X5S A;  2F4V J;  4HH0 A;  3ETO A;  2HNY B;  3M8W A;  4X62 F;  5DM7 Q;  1T7P A;  2V4J B;  3HP6 A;  2CRL A;  4WTO B;  2HHX A;  1SKS A;  2YPY A;  2XHC A;  1YIJ S;  5RUB A;  2LXU A;  5IWA J;  4DLE A;  1RTI A;  2X3D A;  2OUG A;  5E3C A;  4OJH A;  1GXU A;  3R5D A;  1RJJ A;  2XI3 A;  4FPR A;  1T0T V;  3HK2 A;  3CD5 A;  4DV2 J;  4DFP A;  4WK3 A;  3QSI A;  4NEY A;  2CJY B;  2WVD A;  3ILL A;  3LQV A;  3MR2 A;  2Z8Q A;  4L3N A;  1WDD A;  3QRQ A;  2FJV A;  3MEE A;  4NZ7 A;  3A1Y G;  2GNK A;  2BM1 A;  3W2V B;  4O3R A;  3VQS A;  3DLK A;  3GB0 A;  3OSN A;  3V6J A;  1I94 F;  1SB6 A;  4X4S A;  1NSQ A;  2W8L A;  3HM9 A;  1UEU A;  4WWS A;  3ZZT A;  4ZVS B;  3TWZ A;  1PG5 B;  1FD2 A;  4XPE A;  3W8G A;  1RLD A;  3CVK A;  2UUA J;  4FYW B;  2E9Z A;  2J7K A;  5BR8 F;  2B4O A;  3CB4 A;  1TL7 B;  8RUC A;  1VBX A;  1FI4 A;  3V2U C;  4NA2 A;  3X3U A;  1F9H A;  1V5I B;  3UQS A;  1JX4 A;  4R25 A;  3JQK A;  2XC9 A;  2RJZ A;  1OYE A;  3C6U B;  5EDW A;  3OFE A;  4NCB A;  1U0S A;  1XIQ A;  1BGX T;  2C3P A;  4JI1 J;  2CPZ A;  1ZM2 A;  4OYX A;  3OHB A;  5HQL A;  4ZCI A;  2EC2 A;  1R0C B;  3IC1 A;  4F8R A;  2XMW A;  4EI2 A;  2FJD B;  2XTJ P;  4JYA F;  4ALZ A;  3NG8 A;  1F5B A;  3A3N B;  5D78 A;  2A3J A;  3NGD A;  3KJV A;  4NCA A;  2G0J A;  3PV8 A;  1IWG A;  3K5M A;  4CM0 A;  3MUT P;  3OXL A;  4KHP F;  2CQD A;  3K5O A;  3NL0 A;  1FVS A;  2H4Y B;  2BM0 A;  2J0W A;  1RCO B;  2LQ5 A;  4QOT A;  1UZD A;  3RJM B;  4LQ9 A;  1HWI A;  1RHU B;  3BBC A;  3RG6 A;  1QAI A;  3EDR B;  3H42 A;  3MM5 A;  3I0R B;  1WG4 A;  2FZC B;  5E41 A;  4EZ9 A;  3UR0 A;  4DR6 J;  5C24 B;  5KFW A;  3R7N B;  1GT8 A;  4AXJ A;  3J81 Y;  1HQE A;  2QX0 A;  2DR6 A;  2RS8 A;  2ZZT A;  3AB2 B;  4MIB A;  1ZA2 B;  2KB2 A;  3B4D A;  3TUJ C;  4F3M A;  1TV6 A;  4F0K A;  4DV0 J;  1GMU A;  1O6X A;  4B9S A;  3HLU A;  5EUH A;  4Z7C A;  1IBK F;  4USH A;  4OYW A;  5CYQ B;  1C0U B;  2Z30 B;  3MCM A;  2B8P A;  1SJR A;  2VQF J;  2U2F A;  5CHC B;  3I96 A;  1C1C A;  2ZD1 A;  1HBO A;  4B3S F;  1YJ7 A;  2W7A A;  2PSZ A;  2A2C A;  1N34 J;  4LBI A;  2F3J A;  3HZG A;  4DR4 J;  3CCQ S;  3QT6 A;  3OR2 B;  4URQ U;  2PC6 A;  3Q0A A;  1S57 A;  2F65 A;  3UDL A;  1N48 A;  2UVV A;  3JSM B;  5LMN F;  3CCR S;  4UQT A;  5L38 A;  3MCS A;  1EP4 A;  5A2Q U;  2H5E A;  2V2Z A;  2IRY A;  3K5N A;  5LXR A;  4WYL A;  1AUD A;  5ADZ A;  3CXC R;  4L3K A;  1VQM S;  3BQ2 A;  1AZS B;  1FRL A;  4NLW A;  3GG0 A;  4IOC Q;  3E2E A;  2KFZ A;  3DXB A;  2E29 A;  2NYI A;  3PM9 A;  1FDB A;  4DV6 J;  2MQ8 A;  5KG3 A;  4CLY A;  3H2L A;  1NDC A;  3UCZ P;  2V4J A;  4HAC B;  1HHQ A;  4KT0 C;  3M05 A;  4KJI A;  1K1Q A;  2EFP A;  2WBM A;  2IVF B;  4Y2M A;  2C2Z B;  1KQG B;  3T1Y J;  2DEJ A;  4P2X A;  1YHQ S;  2V63 A;  3MWB A;  4J9R A;  1UVK A;  3TX0 A;  4WK1 A;  2DJW A;  2CZ4 A;  2DK2 A;  1F1B B;  2WB1 D;  4OYI A;  1X5P A;  5AXN A;  4ZIW A;  1QJH A;  3O3L A;  2DIU A;  2UUB J;  2W8K A;  4ZCM A;  1U6F A;  2J76 E;  4CT8 A;  1UVI A;  4RWW A;  3KLV A;  1LW2 A;  5ETK A;  1OMS A;  3BDP A;  3BSO A;  2HMI A;  4ED1 A;  3LF0 A;  3MPV A;  4ZVE A;  1HNI A;  4FXV A;  2AGQ A;  2VF3 A;  2ZDO A;  4O4R A;  2B7C B;  2DNY A;  3MMB A;  9RUB A;  2AW0 A;  4N47 A;  1VBK A;  5F9N A;  1U1L A;  3GIL A;  3W2W A;  3W9I A;  2IRU A;  3AQP A;  4NLD A;  4DV1 J;  3IBC B;  4CH1 A;  1H72 C;  3GON A;  1UWB B;  3PYD A;  1M5P C;  2J9D A;  5G0R A;  2P2C B;  1P9Y A;  1ARO P;  2MQN A;  4RW6 B;  2QYG A;  1R6V A;  2A6O A;  3WIV A;  1MN7 A;  1RYR A;  2QV6 A;  4ZVQ B;  2QTW A;  4WJB A;  3A13 A;  2MLX A;  3JB9 k;  5GAE I;  4M63 A;  1NEE A;  3M8S A;  3PJW A;  4DQI A;  3ET6 B;  1GTH A;  2NUH A;  1SH2 A;  3DLB A;  2NXN A;  3Q89 A;  1L3V A;  1PIE A;  2B7B B;  2ZJP Q;  3T5L A;  4DV3 F;  1S9E B;  1JMT A;  5KT3 A;  1VQ5 S;  1C0T B;  2ZVI A;  4CTA B;  1J27 A;  2RSQ A;  3HHE A;  4C8N A;  2GW8 A;  4YR2 A;  5CAA A;  2OKQ A;  4UT4 A;  4NLQ A;  4B02 A;  1TR0 A;  2YTC A;  4JI8 F;  2NS1 B;  5ETR A;  2HLU A;  2CQ4 A;  4F2R A;  4M5K A;  2IHR 1;  1D0E A;  2VG7 B;  1P27 B;  1EKR A;  2FGO A;  3I0R A;  3MTJ A;  5DJB A;  3U02 A;  3R9L A;  2CQ1 A;  1T9T A;  1NME B;  2AD9 A;  5C24 A;  3S01 A;  2WOM B;  3H40 A;  3LTO A;  2DHA A;  2M2B A;  2XS7 A;  2R7R A;  5T7L A;  4DCP B;  1TU0 B;  4DL3 A;  4ECR A;  2VOD A;  3V6H A;  2DTJ A;  1IWA A;  3GE9 A;  3ENQ A;  2HQF A;  1QTM A;  4URG A;  1GMV A;  1ZTT A;  1C4A A;  2LXI A;  4PXD A;  1XNR F;  3D7S B;  2IPO B;  1F0X A;  1JJC B;  1OO0 B;  2XEX A;  3WC2 A;  1T9U A;  1F3F A;  2DGX A;  3G2X A;  1M0S A;  2EBG A;  1MWZ A;  5AE1 A;  5C2G A;  3I87 A;  5IZH A;  2EFQ A;  3SEO A;  3PW5 A;  4UQG A;  1EAY C;  1YSJ A;  4NYP A;  4DN9 A;  3CJ2 A;  4I2P B;  1UKU A;  3OR2 A;  1NB7 A;  4OYB A;  1YJU A;  1U2R A;  2ILZ A;  4F7V A;  4R0E A;  3JSM A;  1LWX A;  3SV3 A;  1YDL A;  2CQ3 A;  1DFD A;  2CDR B;  3MHY A;  3U1M A;  1YX2 A;  5IXU A;  2EG1 A;  1PYT A;  1AZS A;  4DUY F;  5L46 A;  3EDQ B;  1S9F A;  1FF2 A;  5B7W A;  2VAS A;  3EVM A;  1U1O A;  1NSK L;  1RHR B;  3FEZ A;  3HVA A;  1S1U B;  4HAC A;  1KKH A;  3N28 A;  1BQM B;  4ZVH A;  5C25 A;  1Y3J A;  3NLC A;  3M6W A;  4I6W A;  5L39 A;  3PTW A;  3PHT A;  2M70 A;  1MW7 A;  1RYS A;  2RT3 A;  2RU3 A;  2RRB A;  2ZH2 A;  4L74 A;  4HLB A;  1TKT B;  3OL9 A;  2VDI A;  5HL7 Q;  5GAD U;  4OJ1 A;  1YLX A;  5LSL A;  2ZUG A;  3B82 A;  2HKE A;  3G82 A;  2DRB A;  2EFV A;  3KLE B;  1TK8 A;  1S6O A;  3QLH B;  3IG1 B;  1YI2 S;  2Z56 B;  4RPF A;  5ETT A;  5E33 A;  1WOP A;  2GA7 A;  1SCJ B;  2ZBP A;  2V8G A;  4RLE A;  4YR0 A;  5CYM B;  4XPC A;  3UPF A;  2WVE A;  2HBZ B;  1I1G A;  4DQQ A;  4YB1 P;  2DIS A;  1OSC A;  2KYZ A;  3HPO A;  1S12 A;  1SJ1 A;  2CFX A;  1UWB A;  2PMH A;  5KG5 A;  1GAO A;  2ZJR Q;  3TNV A;  4RW6 A;  4DL6 A;  2KRB A;  4R8U B;  1XTZ A;  4OI0 A;  1RTJ B;  3Q86 A;  4NZ0 A;  4DR5 J;  4CM2 A;  3T19 A;  3ET6 A;  4C7Q A;  1N36 F;  1REV B;  2K7J A;  3W66 A;  2RRN A;  4JI3 J;  1JLF B;  2W4P A;  1NHU A;  5B09 A;  3WBZ A;  1S9E A;  2DHX A;  5H9E K;  3DC2 A;  3S7R A;  2M3D A;  1SI9 A;  1C0T A;  7FD1 A;  3QGP A;  1FER A;  2XY6 A;  4A8S A;  2GMJ A;  4MK7 A;  2I1R A;  3OL8 A;  2WK4 A;  1WWH A;  4XTT A;  2DH7 A;  3DMJ A;  1B0T A;  3TA2 A;  2NCK L;  3EXC X;  3W60 A;  1QAX A;  4AE5 A;  3G8Q A;  2CQI A;  3BM7 A;  3R5G A;  4K4X A;  4M5J A;  2GHV C;  4Q2L A;  1KTV A;  2DR9 A;  4QU7 A;  3HT3 A;  5E3Q A;  5KFQ A;  5GAG I;  2D3U A;  4HL9 A;  2AP6 A;  3C6T B;  1B7F A;  4LBH A;  2IFX A;  4RU9 A;  1B0P A;  3PW4 A;  3E3X A;  1CUL B;  3NCR A;  2ROE A;  4GC7 A;  2LYV A;  2B9W A;  1Q82 T;  2HW3 A;  5DS7 A;  3HXM A;  3VAF A;  4QR0 A;  1PYO B;  1QTN B;  4Y65 A;  1LQ9 A;  3I5C A;  1UJ6 A;  2OPP B;  2C2E A;  1NJI T;  2YKQ A;  1KRP A;  1SVD A;  3MMC B;  3ZFV A;  4FYV B;  2OAU A;  3VTI A;  3SQG B;  4YB6 A;  2BJ8 A;  4MH8 A;  1XER A;  3UO0 A;  4QIV A;  4UZB A;  3OTE A;  4M5N A;  5SUH A;  1GNK A;  2CQ2 A;  1CPZ A;  1WJ9 A;  5D0G A;  1D8Z A;  2VBY A;  3DOM B;  4WE1 B;  3NXZ A;  1KVJ A;  3Q8V A;  2HQD A;  2HBR B;  1MSW D;  4I2P A;  3NOC A;  1VQY A;  2DHG A;  1WOR A;  3M2R A;  5A0Y B;  1BMQ B;  4PKD B;  5D15 A;  3M32 A;  5I3P A;  5G4D A;  2QE5 A;  1F9E B;  2G0I A;  3ZXW A;  4GRS A;  1FXR A;  3CCS S;  2KL8 A;  4K4U A;  1ZOT A;  3L3C A;  2QT7 A;  2G2Y A;  1HQ2 A;  4U7U K;  2YX7 A;  1JJH A;  1SKW A;  3JTO A;  3AH6 A;  1S1U A;  2YWH A;  1H38 A;  1BY9 A;  1WG5 A;  3CF5 Q;  2WSC C;  1BQM A;  4C48 A;  3RBE A;  1V3R A;  1E6V B;  4ELU A;  3T9N A;  3Q24 A;  3GJQ B;  3KWM A;  4PG5 A;  2BYC A;  2Q6C A;  4IH7 A;  4RNN A;  3NMA A;  2HZV A;  3GU0 A;  1TKT A;  5CAB A;  4B3T F;  3CJR A;  1XK8 A;  4A46 A;  2WVB A;  3DNC A;  2ILY A;  4YDX A;  2LDI A;  1Y00 A;  1V3Z A;  2XLK A;  4WXW A;  4ETZ A;  1KQS R;  4ZIV A;  3BDE A;  4J91 A;  3KLE A;  1V5V A;  2RQK A;  4URS A;  1B3T A;  3JQJ A;  3IG1 A;  1ELO A;  4RNM A;  1CVJ A;  3RGI A;  2HGN A;  4NAS A;  2VFT A;  4PYA A;  2OMO A;  1DTQ B;  1RAJ A;  1N8R T;  3VQT A;  3H98 A;  3EM1 A;  1JQG A;  2APO A;  1XWL A;  2HFZ A;  5J2M B;  3T1H J;  2J7U A;  5FLX U;  5J1E B;  4JI5 J;  1HNW F;  3P45 B;  3FUY A;  2GQC A;  1RHQ B;  3MGJ A;  4A8O A;  1T9V A;  2CYY A;  5DLG A;  2ZBR A;  1LEO A;  3TJA A;  5CD4 A;  4ZJL A;  5F41 A;  3MM7 A;  2YKP A;  4H4M B;  3QAE A;  4KGV B;  1R6Y A;  2IM0 A;  4R8U A;  3V4M A;  4X4R A;  3CMA S;  4JI0 J;  3CO0 P;  2IVM A;  1RTJ A;  1W2I A;  1KOO A;  3CTR A;  2QLX A;  2XMV A;  3EGV A;  3O8W A;  3TAN A;  4KQZ A;  2B51 A;  1EQM A;  1LWF B;  1REV A;  1JLF A;  1ZPV A;  2DBB A;  1IBC B;  2ZKT A;  3JSB A;  3GR0 A;  1IKW B;  1T94 A;  5HVG A;  1WF2 A;  3SZ2 A;  3C8Y A;  2IM3 A;  3SCL E;  2C3O A;  2CPD A;  1BD6 A;  2XYH B;  1XN9 A;  2VBX A;  1QM9 A;  3T6J A;  4USM A;  3MAA B;  1NK6 A;  5DGB A;  4OYZ A;  3LH2 S;  3TVY A;  3R27 A;  1WF1 A;  3SBM A;  1KOH A;  4L76 A;  1NK7 A;  5ETP A;  4M5D A;  2MTL A;  1HMV B;  2B3T B;  5AJ3 F;  1KC8 T;  1CUL A;  2DY9 A;  4X4T A;  1YVF A;  4Q44 A;  3N6M A;  2HRU A;  5L1K A;  3K0J A;  3QYY A;  2HNZ B;  4F4K A;  2OPP A;  2M7S A;  2VFU A;  1U49 A;  2FLO A;  4MTP A;  1UJ5 A;  3MMC A;  4OI6 A;  4LSZ B;  4AFF A;  3OFG A;  3SQG A;  3HI9 A;  2X1A A;  1GFW B;  4OI2 A;  3JSR A;  3HMJ G;  2P6S A;  4F4W A;  3X1L B;  4LRA A;  3FEY B;  4WE1 A;  1NHV A;  2HHS A;  3PNI A;  2UP1 A;  2UXD J;  4BC7 A;  3B54 A;  1EAR A;  4O3N A;  1WAC A;  2W9B B;  3I9Z A;  2B9E A;  5A0Y A;  2M52 A;  3BR8 A;  2HHV A;  4B9U A;  2H3E B;  4PRF A;  2FJB B;  4F4A A;  1A6L A;  1K47 A;  3ETM A;  2D9P A;  4M5I A;  3GV5 B;  1M1H A;  2M5Y A;  2W2O P;  1J5E J;  1TKX B;  2KZZ A;  2ZFH A;  5GAH I;  1P1L A;  3GFX A;  1MLA A;  2XG8 A;  3AA9 A;  2JWN A;  3C15 B;  2FLN A;  1Y5L B;  1FJG F;  1VQL S;  4FNI A;  4RNH A;  2OGU A;  2HHH F;  3ONQ A;  3QJJ A;  4OJ3 A;  2AYE A;  3DRS B;  1E6V A;  4L75 A;  1XC9 A;  4HHU A;  5L8R C;  4EUV A;  4ED5 A;  5B0D A;  2LXF A;  3MR7 A;  2V6A A;  2FVC A;  5DM6 Q;  4GO5 X;  1Q86 T;  1NK0 A;  1FES A;  3UDE A;  2KZM A;  2VJV A;  1ZA1 B;  3IM8 A;  4RW7 B;  1X5T A;  2JFD A;  1ZTW A;  1BHN A;  1NUE A;  3PO5 A;  3CCM S;  4RW4 B;  1NJW A;  3QJP A;  2G4B A;  1DTQ A;  1YRX A;  1WI8 A;  4JV5 F;  1KDN A;  2N82 B;  3Q8Q B;  2R8G A;  4NLV A;  1QSL A;  5J2M A;  4C3L A;  1UP1 A;  5J1E A;  4F3O A;  4UST A;  4OMF G;  2JRS A;  4NLR A;  1OYD A;  1UFW A;  2HRY A;  2UUC J;  1RTD B;  3M1V B;  5KFR A;  2V69 A;  5HAN A;  4QQB A;  5DZ7 A;  2DNL A;  1RT3 B;  3MR5 A;  4P10 A;  4YEA A;  4A8K A;  4C8O A;  3NAI A;  4H4M A;  4P9S A;  2VON A;  4X66 J;  2B9X A;  3IP0 A;  3C14 A;  3H5U A;  3TR5 A;  1HWU A;  4XDD A;  1FTC A;  4K2X A;  4OV6 A;  4ECZ A;  4WIQ A;  2E44 A;  4LJM A;  2ZWO A;  4U7C A;  1X4G A;  1HWJ A;  1U6Z A;  1LWF A;  4IOB A;  4MIA A;  4EYH B;  5CQG A;  3J7A N;  5KFF A;  4DX8 H;  3IRX B;  3KMS A;  3H5S A;  3IR5 B;  3IAS 9;  5KFX A;  2DCU B;  2IJR A;  4UF4 A;  1NJX A;  2BE9 B;  3T1Y F;  1TL3 B;  2LFV A;  4LBP A;  1VHF A;  3NY0 A;  2Y1R I;  4ECV A;  3QT5 A;  4PR6 A;  3BQ1 A;  4OLP A;  2NSB A;  2IJF A;  3C16 B;  2NSC A;  1NKE A;  3QFH A;  3B78 A;  3CUL A;  1PO6 A;  1V6H A;  3AJ1 A;  5CH7 B;  4LF6 F;  3AY0 A;  2QRR A;  1PAU B;  2LLZ A;  4IQX A;  4A8Q A;  3FGV A;  4C98 A;  4JOU A;  3PYF A;  4ETX A;  2B4V A;  1S6P B;  5KT4 A;  2WTF A;  1HMV A;  1F3V A;  4ZVG A;  4ELT A;  2XMK A;  5D4P A;  1DJ0 A;  2OFG X;  3IR7 B;  1HHT P;  2HWT A;  5IC6 B;  2AV5 A;  2YWG A;  2HQC A;  5B0B A;  3VVT A;  1PSD A;  3KLG A;  2HNZ A;  4OL8 A;  4TYA A;  4WU2 A;  1ZPW X;  4DCJ B;  3FCW A;  2V8D A;  2HAI A;  2MQP A;  4LUB A;  4EYI B;  4YY3 J;  4JB8 B;  2GO8 A;  2ZHA A;  2FLP A;  1FWL A;  4S0M A;  5A6W A;  2D74 B;  2Z2M A;  2D9O A;  1DLO A;  2FVQ A;  1IKY A;  4QJV A;  2RDJ A;  4USW A;  1Z4U A;  1NK9 A;  4V1A k;  4ZPB A;  2W9B A;  4EO8 A;  1MWQ A;  4AT1 B;  2CQG A;  2YNH B;  2C2N A;  1CS4 B;  1UVN A;  1PBU A;  2MSS A;  2UXB F;  1TVR B;  2HHW A;  3BPD A;  2YKM B;  3OT9 A;  4NL5 A;  3H4D A;  4DV7 F;  3IBW A;  1SL1 A;  2GAH C;  1TKX A;  3W9J A;  5KG2 A;  2MZ1 A;  2IJN A;  3KUG A;  1NK4 A;  1UWA A;  2BZ2 A;  3C15 A;  3C66 A;  1IXK A;  1O51 A;  4KHR A;  2G13 A;  1RA7 A;  2R7Q A;  3PYG A;  1VQ7 S;  9ATC B;  2FJW A;  4O23 A;  2BJ1 A;  3QZ7 A;  2IVY A;  2HFO A;  2CZ9 A;  1UPM B;  3KHG A;  3CIZ A;  4DV5 J;  4UY8 5;  4LF9 J;  2QMW A;  2G9O A;  4NRT A;  1FHT A;  4RO0 A;  2IC3 B;  5DRK A;  1WG1 A;  4UUX A;  1BE4 A;  1T3N A;  3GMG A;  1RBO B;  2CG8 A;  4RW7 A;  5KFH A;  3I4P A;  1HNZ J;  1C4C A;  4OZ1 A;  1QAJ A;  5B0A A;  1BQN B;  2ATC B;  3QMQ A;  2UXC F;  4IRD A;  2MKI A;  4J9U E;  2OJ3 A;  3GJT B;  1NSP A;  2QFJ A;  2R4F A;  2FHM A;  1L3K A;  2DVI A;  5JXS A;  1CEZ A;  1FDN A;  4ED6 A;  3DI6 B;  2AJ4 A;  4LF8 J;  2CQP A;  3JAM Y;  3NCQ A;  1RTD A;  5F0W A;  1ZAX A;  3M1V A;  3CME S;  4LFB J;  2BAB A;  2ZKU A;  5ETQ A;  1MRO A;  1TKZ A;  4CLS A;  1VRQ C;  3GYN A;  1M5H A;  4LF1 A;  3FZB A;  4LMZ A;  4H4O A;  5KG7 A;  3TZY A;  4FF4 A;  4DEZ A;  4Z2X A;  1MN9 A;  1LV5 A;  1SBR A;  3MEC A;  2NXU A;  4TLQ A;  2ROG A;  4DXL A;  5HP1 B;  5THW A;  3ENA A;  3KOA A;  4PQU B;  1XEZ A;  2BW7 A;  1FKP B;  2E5L F;  1M5O C;  4QBU A;  1NPP A;  4QPX A;  2YKN B;  1T05 B;  4K4Y A;  2IMW P;  3AJD A;  1DY3 A;  2E66 A;  5GAE U;  3HSZ A;  4BCA A;  3IRX A;  2DH9 A;  3PAC A;  5HO4 A;  2GJF A;  1C2P A;  5LXY A;  2V5H G;  3MAH A;  2HUR A;  3NBP B;  5HLF B;  1QSY A;  1NH8 A;  2CXE A;  4CIO A;  1XNQ F;  3C16 A;  3MMA B;  1U45 A;  4IDK B;  3K59 A;  2WB4 A;  5DQH A;  4B3M F;  2Y1J A;  3ZZR A;  5CYJ A;  4FN5 A;  2BV3 A;  2DNK A;  3AD9 C;  5HMY A;  3B8H A;  5B0C A;  2BAN B;  1S6P A;  3G6Y A;  2AZ3 A;  5A2Q Y;  1WC1 A;  3ENW A;  4LFC J;  4DSK A;  3ITH B;  3FBF A;  3L09 A;  5F9L A;  2HBQ B;  1M5S A;  1V3S A;  1T3O A;  1WC5 A;  5AXL A;  2K06 A;  3BEG B;  1NKB A;  4ILM A;  4LSL B;  3FC9 A;  2JVO A;  4DUZ J;  2YKA A;  2FC9 A;  1D3W A;  2LEA A;  1IBL J;  3CD0 A;  2VIC A;  3FCH A;  2V94 A;  4MMO A;  1FRH A;  1VK8 A;  4EBD A;  3OTB A;  1TUG B;  4OHX A;  4LT6 A;  1QAY A;  3CGI A;  3KFW X;  2EI5 A;  1T95 A;  1CBK A;  1UA0 A;  4PEO A;  5LOQ A;  1Y0H A;  2DB1 A;  4USI A;  4PXE A;  2RQM A;  1GMW D;  3N5B A;  2YNH A;  3RTV A;  1TVR A;  2YKM A;  4ZA1 A;  3ZZP A;  1OS5 A;  2EFG A;  1SJF A;  1XMB A;  1FXD A;  2IAJ B;  1RAG B;  4OQJ A;  4UOF A;  4HVZ A;  3RUB L;  2GCF A;  4OHV A;  2E5G A;  2NR0 A;  2GHP A;  4B9T A;  4IR1 A;  2BEF A;  4RW8 B;  1X4B A;  2H5I B;  4JI2 F;  3W61 A;  2EEY A;  3GQC A;  3D28 A;  1KD1 T;  2KM8 C;  2PA8 D;  2BOA A;  2MHN A;  2G0C A;  4LF2 A;  3DM2 B;  2CPF A;  1ZH5 A;  2GGP A;  4GKK J;  4PG6 A;  5MLC V;  1SJ4 P;  3W7B A;  5A8W B;  1HR0 F;  2C3M A;  1SV5 A;  2IC3 A;  3QIP A;  1R8C A;  2HHP A;  4LF5 F;  4AL7 A;  4DOZ A;  4G6V B;  4F0M A;  1MML A;  2P9G A;  3SMZ A;  4DFM A;  3AOB A;  3BGR A;  3CPW R;  4B9V A;  5I4M A;  1BQN A;  2RVJ A;  3MEK A;  4LFA J;  1GX5 A;  1VMB A;  3Q83 A;  4NLS A;  2R2R A;  3O44 A;  1UEK A;  1TAQ A;  2Y0B B;  1RAE B;  4O0N A;  1U24 A;  1U7L A;  4WP3 A;  3DI6 A;  2ZH6 A;  1SKU B;  4J9M A;  3SCJ E;  2HND B;  1VOM A;  1M1G A;  3WQP A;  1HIY A;  1RT5 B;  1RBA A;  4IG3 B;  2ZDP A;  3O2I A;  4P2F A;  1H3D A;  1R31 A;  1YRT A;  1TFY A;  4PWD A;  3Q8Y A;  3AD7 C;  4PG4 A;  1WHV A;  5HP1 A;  2QZ8 A;  1MNE A;  4OZ0 A;  4KIA A;  4PQU A;  2EVZ A;  4ZN3 A;  4TU8 A;  4LRD A;  2BBE A;  1FKP A;  5IS2 A;  4HKQ A;  5KT5 A;  1QSS A;  4KO0 A;  1G1X A;  4CZC A;  2MB0 B;  4BWJ A;  2YKN A;  5C42 B;  1IR2 A;  1T05 A;  3NNC A;  3ZNJ 1;  4Y28 C;  3VZI A;  1RWO B;  1YJ9 S;  3MUM P;  2AYG A;  3HZE A;  2CPI A;  2L41 A;  2PO4 A;  3GIR A;  4HI1 A;  2UVU A;  2R9L A;  3EVO A;  3EGW B;  3MUR P;  1X7V A;  4AXI A;  2M0G B;  2VIH A;  3NBP A;  5HLF A;  2CIM A;  4M5G A;  4WKY A;  3MMA A;  4CNY A;  1FJ7 A;  2DGT A;  4IDK A;  3PXG a;  2AYM A;  1F2H A;  3MR3 A;  1VDH A;  3HKZ D;  1X4E A;  2H1Y A;  3H90 A;  5KOX A;  1WHY A;  2BAN A;  4CLW A;  3OW2 R;  5LMU J;  5HSP A;  2XMM A;  2KM8 B;  3V4I B;  2XM3 A;  3CUN A;  4ECS A;  1N5V A;  3ITH A;  1G4C A;  1JLB B;  2MEW A;  2BUN A;  1VS3 A;  5GAG U;  1KHW A;  4AD6 A;  1WSR A;  3ZZY A;  4DX6 A;  5T41 A;  2W2P P;  4LSL A;  3TZZ A;  2L08 A;  1JB0 C;  1ZM4 A;  1S1T B;  4F67 A;  1UVM A;  2I5J B;  1R0A B;  3H2U B;  4G3I A;  2QSW A;  4R5P B;  3WX8 A;  3GP9 A;  1VC5 A;  5J2Q A;  5SZT A;  2ZH9 A;  4QPT A;  2PEH A;  2D41 A;  1R8B A;  3TQE A;  3D3C J;  1DUR A;  3G71 S;  3OLB A;  3OV7 A;  3UI3 A;  3TUI C;  2C2D A;  2XS2 A;  4W92 B;  5A76 A;  1UVJ A;  3OUY B;  3RBZ A;  3FJ2 A;  5CCL A;  2DPI A;  2OEM A;  4DF8 A;  3LAL A;  1YTY A;  1RXO B;  2DXF A;  3G6X A;  1S0N A;  2QL7 B;  3VWS A;  2IAJ A;  2BJE A;  3NGK A;  4CO4 A;  5K14 B;  1VIS A;  1RSC A;  3R1H A;  1TL5 A;  2H51 B;  3TOQ A;  4FF1 A;  2KT2 A;  3M6V A;  3MMJ A;  1WEY A;  4ED8 A;  3F56 A;  3J81 j;  3HFV A;  3SI8 A;  2XZT B;  1X4F A;  6FDR A;  2XB2 D;  3MD3 A;  1SXL A;  3R5J B;  2Z0G A;  5D3G B;  4E0D A;  3DM2 A;  1XMO F;  3PX4 A;  2AZ1 A;  5F8L A;  4X65 J;  2VB6 A;  3OXF A;  1T9Y A;  1ZAW A;  3IRW P;  3QJL A;  2R8J A;  1MWY A;  1FT8 A;  4KH0 B;  2ZC4 A;  2E7V A;  2EKN A;  3GSI A;  3ULH A;  4CH0 S;  1S49 A;  2GHW A;  3RB0 A;  2XO6 A;  4MYT A;  4FBU A;  1NO8 A;  2DNP A;  5F8N A;  4C11 B;  1RHM B;  2VQE J;  4PUO B;  4OX8 A;  2IDE A;  2W25 A;  1CC7 A;  5IT0 A;  4DL2 A;  5AXM A;  3PR5 B;  2J9E A;  4PCQ A;  3D6T B;  2FB0 A;  4H54 A;  1JLQ B;  4L73 A;  4PAB A;  4AND A;  4LQ3 A;  4I69 A;  1MMD A;  3EGN A;  3MEG B;  5GMD A;  3MCN A;  1TL1 B;  4I4B A;  4FF2 A;  1K0T A;  2A18 A;  4MKV A;  1UFK A;  4ZLJ A;  1YG0 A;  1C1B B;  4Q7A A;  3QQC D;  3PKM A;  4BS2 A;  4MIW A;  1J5E F;  4NXN F;  2B6A A;  4I56 A;  1RWN B;  2FHJ A;  2XWX A;  3CNQ P;  4UUW A;  4WFB Q;  4QYR A;  3LAK A;  1FFW B;  3WZ0 A;  1Q1K A;  5A8K B;  1S76 D;  3D6H B;  1SJ3 P;  2YQ0 A;  1JLC A;  1S99 A;  2R8H A;  3H5Y A;  2DHS A;  3LP1 B;  3QWP A;  4NLU A;  1BLU A;  4ID5 B;  4DG1 B;  1WD6 A;  2PFF B;  1W2B R;  2YWE A;  1RAC B;  4DMZ A;  2L9W A;  3IR6 B;  4DR2 F;  2BE2 B;  4P2M A;  5GVQ A;  1CLF A;  4ECQ A;  3ISN D;  3JQM A;  3G8T A;  1RT7 A;  2PI4 A;  3IWL A;  1RWP B;  2HWI A;  3FSY A;  3FMW A;  3VGV A;  2HFN A;  4ZLP A;  2OPQ B;  5FII A;  3FQK A;  2NPF A;  2W24 A;  2CPH A;  1DQ9 A;  2DNZ A;  1I3O B;  3SCI E;  2CA9 A;  3D5M A;  4O3Q A;  2W4C A;  4HTI A;  4Y34 A;  5DQG A;  5I3U B;  3DRP B;  3V4I A;  2BKN A;  3O6Q A;  2Y9H A;  4Y3C A;  1JLB A;  2FZK B;  3BS9 A;  4NX9 A;  4LVN P;  3LGN A;  2MGZ B;  3AFG A;  4Z7Y A;  5HK4 A;  3QAT A;  3EIC A;  2NXE A;  4OZ2 A;  1SIW B;  3M30 B;  1AXQ A;  2EWH A;  5DDP C;  3KTQ A;  4QW8 A;  4GC6 A;  1SC4 B;  2KVI A;  4J37 A;  1PKU A;  4YHH J;  4WFX A;  5KFV A;  1S1X B;  3PIO Q;  2I5J A;  1R0A A;  2NZC A;  2BRL A;  4R5P A;  5KFG A;  4MKY A;  1T8E A;  1WHX A;  1WC4 A;  4OYM A;  3PYE A;  2MKJ A;  1LWC B;  1ROF A;  2NXJ A;  2QLF B;  3BSA A;  2R8K A;  2ZM6 J;  3PO4 A;  4J9V A;  5KG1 A;  4DPU A;  2R8I A;  2K3K A;  4LF4 F;  5ETS A;  2WW8 A;  4WPA A;  4LF7 F;  3OUY A;  4Y2K A;  2GZO A;  4NXM F;  3TRG A;  3ZC4 A;  2M8D B;  1W25 A;  4CLF A;  1RT4 A;  1A9N B;  1RTZ A;  1CJT B;  4N8O A;  1DAX A;  2VFR A;  4MK8 A;  2GIR A;  4FYD A;  2IRX A;  1F5C A;  3WIU A;  2IMO A;  5F3Z A;  1QD1 A;  2RD5 C;  3Q22 A;  4GKJ F;  4X62 J;  5K14 A;  5AE3 A;  3PFO A;  2FY1 A;  1S79 A;  4F02 A;  1LOU A;  4EWT A;  3UDC A;  1KBR A;  1NXI A;  5GAH U;  4MKA A;  3BKT A;  2DXE A;  1Q4R A;  3R97 A;  2VJU A;  5FLX Y;  3KNA A;  2ACM A;  2ZIT A;  4M5L A;  8AT1 B;  4WU3 A;  2Z2Y B;  2PDA A;  2F9D A;  2LU1 A;  3G6E S;  4U95 A;  3A8K A;  4J9L A;  2W2N P;  5C5J A;  3MFH A;  2KDO A;  3AJ2 A;  3Q23 A;  4HDH A;  4OYA A;  2CAJ A;  2OPS B;  4PXB A;  4UY8 T;  2VG5 B;  4WFZ A;  4ICL B;  2HWH A;  2MKS A;  1I94 J;  5EX3 A;  1KVI A;  3MUV P;  1RTH B;  2DNH A;  1NK8 A;  2R7S A;  2UUT A;  1U25 A;  2GIQ A;  4E8U A;  4A4J A;  3RAX A;  1JLQ A;  2CNO B;  1Q79 A;  1SIZ A;  2RKI B;  4DPO A;  4TQS A;  5CZX A;  3DFE A;  3D54 A;  4X4V A;  3CDE A;  2DO0 A;  1YGY A;  2HLT A;  4IO1 A;  2FYX A;  1TL1 A;  4I0W A;  2FD2 A;  3J80 Y;  1HYS A;  1NJY A;  3MD1 A;  5L9N A;  1O0P A;  4YP3 A;  2XSJ B;  3KJQ B;  4QWD A;  4ED3 A;  4EZ6 A;  2XS5 A;  2XZW A;  3Q2S C;  2PI5 A;  4NA1 A;  2VHG A;  4UW2 A;  3O1L A;  1U8W A;  7AT1 B;  3FK4 A;  2W01 A;  3MM6 B;  1Q81 T;  3R5B A;  2FY8 A;  2K1R B;  2WAQ D;  3ZTS A;  5GME A;  4JYA J;  3WDO A;  1U48 A;  1U1Q A;  1YK9 A;  3UN3 A;  5A8K A;  3H0P A;  1JKH B;  2FHJ D;  2MMY A;  3LP1 A;  4ED4 A;  4ID5 A;  4PQA A;  1CJV B;  1NDK A;  2HFU A;  4RUB A;  1LFP A;  4IG0 B;  3M9O B;  5EWF A;  2D3O 1;  1JJ2 R;  3NNH A;  2AIR B;  2CPJ A;  3OTO F;  2AJF E;  3QRP A;  2R7T A;  1E6Y B;  3DHW C;  4I1T A;  3OVA A;  4KHP J;  3EYZ A;  2VU5 A;  2BE2 A;  2KJW A;  1GH8 A;  1TK5 A;  4W98 A;  3NKY A;  4USJ C;  1DRZ A;  2ZOG A;  4FYY B;  3UW1 A;  4IRC A;  5KFN A;  4NWB A;  4ZP6 A;  3I9V 9;  3GYX B;  2F9J A;  1X60 A;  3CED A;  2JC1 A;  2OPQ A;  1SPB P;  1FO1 A;  2KXN B;  1JLE B;  2VBZ A;  4CLP A;  4CH7 A; 
#chains in the Genus database with same CATH homology
 3ELH A;  4F36 A;  2DXE A;  1LWX A;  3EVO A;  1NLK L;  3EIC A;  1K44 A;  3EE3 A;  4ANC A;  1NDC A;  1HHQ A;  2HVE A;  3FBB A;  3Q8V A;  1NDP A;  1WKK A;  3Q83 A;  4DUT A;  1XIQ A;  2DXD A;  1PKU A;  1NDL A;  3BH6 B;  1ZS6 A;  3VGT A;  4ENO A;  4UOG A;  5C7P A;  1UCN A;  5BXI A;  1U8W A;  1W7W A;  3R9L A;  3VVT A;  2NCK L;  3NGU A;  4O0N A;  4DI6 A;  1WKJ A;  4UOF A;  1XQI A;  1NPK A;  3EVM A;  3FBE A;  4UOH A;  1NSK L;  2AZ3 A;  3NGT A;  3PJ9 A;  3DKD A;  3ZTS A;  3FCW A;  1MN7 A;  1JXV A;  1MN9 A;  3EJM A;  3L7U A;  1PAE X;  3NGR A;  3EM1 A;  2B8P A;  2DXF A;  3FBF A;  4DZ6 A;  1HIY A;  3ENA A;  3EMT A;  3FBC A;  3BBB A;  3B6B A;  3NGS A;  5IOL A;  2BEF A;  2DYA A;  3B54 A;  3PRV A;  1BHN A;  1NUE A;  1EHW A;  1B99 A;  1HLW A;  3VVU A;  3MPD A;  3ZTQ A;  1F6T A;  4FKY A;  1NDK A;  3FC9 A;  4AND A;  3Q89 A;  4S0M A;  4KPC A;  4CP5 A;  1NCL A;  3Q8Y A;  3Q8U A;  3VGV A;  3EVW A;  1BE4 A;  3ZTP A;  4F4A A;  1BUX A;  3ETM A;  4ANE A;  3VGS A;  3DDI A;  1NSQ A;  3Q86 A;  1KDN A;  1S57 A;  3BH7 B;  1LEO A;  2VU5 A;  3GPA A;  2BX6 A;  3BBF A;  1F3F A;  3FKB A;  3G2X A;  2ZUA A;  1B4S A;  4W98 A;  1WKL A;  1S5Z A;  3ZTR A;  3VGU A;  4HR2 A;  1S59 A;  2HVD A;  3BBC A;  4FKX A;  4WBF A;  1NHK L;  2B8Q A;  4C6A A;  1NB2 A;  5CAA A;  3ZTO A;  2CWK A;  2DY9 A;  2HUR A;  5CAB A;  3FCV A;  3JS9 A;  4EK2 A;  1VYA A;  2AZ1 A;  1NSP A;  3WX8 A;  3GP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...