4WBFA

Acinetobacter baumannii sdf ndk
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
140
Chain Sequence
EFMAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQADAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIRADFAVSIDENAAHGSDSVASAEREIAYFFADNEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Structural and Functional Characterization of Acinetobacter baumannii Nucleoside Diphosphate Kinase
doi rcsb
source organism Acinetobacter baumannii
total genus 41
structure length 140
sequence length 140
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4wbfA00
3EJMA 3VGTA 4ANCA 3ZTPA 4DI6A 3PRVA 3ZTOA 1NDCA 2DXFA 5CABA 4EK2A 4O0NA 1WKKA 4ANEA 3DKDA 2HVDA 1VYAA 1BHNA 1EHWA 3EVOA 1NDPA 3ZTQA 3BBFA 3FCWA 1ZS6A 3VVUA 3Q83A 5BXIA 2DXEA 1B99A 3BH6B 2VU5A 2DY9A 3NGTA 2BEFA 1F3FA 3FBBA 4WBFA 3ZTRA 3FBEA 3BH7B 4F36A 4F4AA 3EICA 1WKLA 1S5ZA 3ENAA 3GP9A 5CAAA 1NPKA 1NSKL 3L7UA 3Q8YA 4DZ6A 3EE3A 3VGSA 4FKYA 4ANDA 3FCVA 1S57A 4UOFA 3B6BA 1NHKL 3EM1A 3Q89A 3R9LA 1NUEA 3EVMA 1MN7A 3ETMA 3NGRA 4W98A 3GPAA 3Q8VA 1XIQA 3NGSA 2AZ1A 1W7WA 3WX8A 1K44A 3B54A 1XQIA 1NSPA 4ENOA 3Q86A 1JXVA 3Q8UA 2HVEA 3ZTSA 2CWKA 1S59A 1HLWA 3G2XA 1NDKA 1MN9A 1NDLA 1BE4A 1NB2A 3EVWA 1NLKL 1U8WA 4DUTA 3PJ9A 5IOLA 1HIYA 2B8PA 2NCKL 1LWXA 3BBBA 3VVTA 1F6TA 1UCNA 2DXDA 3NGUA 4KPCA 2DYAA 3EMTA 4UOHA 2ZUAA 4UOGA 3DDIA 2B8QA 1NCLA 3FC9A 3FBCA 1WKJA 3FKBA 2BX6A 3ELHA 3JS9A 1B4SA 3FBFA 1BUXA 2AZ3A 4S0MA 1NSQA 3MPDA 1HHQA 4C6AA 3BBCA 3VGVA 2HURA 4FKXA 5C7PA 1PAEX 1KDNA 1LEOA 4CP5A 4HR2A 3VGUA 1PKUA
chains in the Genus database with same CATH superfamily
5D77A 3EJMA 1T9YA 2ZD1B 1WWHA 5LSOA 3VQSA 4ZP7A 3HZGA 1ZS6A 4ES2A 2HFUA 3T1HF 3HK2A 3R5AA 4MK8A 3PYEA 2YKAA 1TFWA 1RCXB 4JI0J 5E3RA 4N47A 2RDIA 4F3MA 3H8YA 2BRKA 2R7QA 3TRGA 4OHZA 1VHIA 4G3IA 3ETMA 2RF2A 2FD2A 1X0FA 4YS2A 2WW4A 1VRUB 4XPCA 3TQEA 4DX8H 3HM9A 2OUGA 1SC6A 4DPWA 2UXCJ 2ALYB 4QR0A 1KHVA 1IQZA 2BKPA 2ZBQA 2UUCJ 3DLLQ 2ZUAA 1RT7A 4DL4A 4DR2J 1RT1A 5F8IA 5DQHA 1UPMB 3QGHA 4L3NA 4KTQA 2VBYA 1RKJA 3Q23A 3M6XA 5IWAF 5B0AA 2R42A 2GVDA 2IBOA 3IFEA 4OI3A 2GNKA 1JLAB 3GIIA 3NLCA 1RWXB 1B99A 4TY9A 5DGBA 2JNJA 3G86A 5BYRA 5KOXA 3QQCD 4PQAA 4CO1A 1NAQA 4KHPF 2VICA 1WC6A 4FN5A 2HQGA 4DPUA 3Q24A 4A8OA 2WVFA 3EVMA 1TKZA 2KT5A 2HNZB 2LA4A 3KUEA 3A3NB 4DV4J 3Q8SB 2GIRA 1GT8A 2YWWA 1X5TA 3N01A 3FRYA 4DV3J 3C6TA 3UN5A 3AAWB 1VBYA 2DITA 4KR0B 2K3IA 1JWWA 3FEXB 1RK8A 2MQNA 4QIWD 1HBOA 1R6YA 4JV5F 3G6XA 3OW2R 3AA9A 4CIOA 5J2NB 1GMWD 1IQTA 2UU9F 2ASJA 1D8ZA 1T7PA 5HJXA 3MMAA 1GMVA 3PX6A 1C1BA 1JXEA 2V67A 4NEYA 3GMGA 1TL1A 1GTEA 4OYMA 3QIDA 1YITS 3R6LB 3AOBA 2BJ7A 5BXIA 1V9OA 1XMOF 1FTCA 2FGCA 3G71S 2X7IA 3NS5A 3FK4A 2J6UA 1T3OA 2HAFA 2XMAA 5KT5A 4ZVEA 3MOJB 4KH1B 1BY9A 1UVNA 3BQ1A 1DURA 4ECWA 4F0KA 3P4UB 4RW6B 1G3OA 4PXDA 2NUHA 1W2BR 2VOOA 2C3YA 2VL1A 1VI7A 1KR4A 3I32A 4NLYA 2LECA 4NCAA 2M70A 4I69A 3MECA 4CH0S 1HHTP 2C42A 2WB1D 4H54A 3AXMA 3QZ8A 2QC3A 3FC9A 1CJKA 2QZ8A 4OLOA 2JHEA 1OPZA 4I0WA 4I2PB 4Q8EA 4P10A 4AXJA 2LMIA 1I94J 4ICLA 2R8KA 4ER8A 1M5VC 2ZH9A 2Y0BB 7AT1B 1JB0C 2ZE2A 3BKTA 4CLZA 4LF4J 1Y5LB 3PW0A 5B0GA 1RWMB 2HRYA 1S1TA 2ALZA 3GV5B 2AGQA 3KLIA 1OYEA 3ENAA 4OIXA 4W90B 1HQEB 1LFPA 1S57A 1Q81T 2WHOA 3DRYA 4CO0A 3QT5A 2W9CB 3IBCB 5KT4A 1MN7A 2EBEA 1ZA1B 2KXFA 1XIQA 3DDNA 4DX5A 4JV0A 1WEYA 4K50A 2B7BB 2C2NA 1SKWA 2P8IA 1OIAA 2VG7B 4BLGA 3EVWA 4NXNJ 3NY0A 1HW9A 3ONQA 3PJ9A 3CULA 4DDFA 2HYIB 2J0XA 4P2SA 5KG0A 1SI9A 1RTHB 1K8AT 3K59A 2MB0B 4MFBB 1UWBA 2YNHA 4QWAA 3CJQA 1G4CA 2ZBPA 4DV6J 4LQ3A 4M94A 2OSQA 5J2MB 3QFHA 3K8WA 1C1CA 2UUTA 3M2VA 5KFWA 2JVRA 1L3SA 5KFTA 2HK3A 2XMWA 1ZM9A 4WKYA 2CPDA 5HI7A 2DCLA 4UF4A 1FRMA 1N54B 1FHTA 2A2CA 3R2CJ 1U8SA 3HDSA 4MYTA 1VRTA 1V5IB 4TY8A 4PG8A 2CA9A 4Z2XA 3FCHA 3FCVA 4LBIA 4RNHA 2KHCA 3NXZA 3MEKA 3CMQA 4ELUA 4JI2J 3PX0A 4LF7J 5IV4A 3EYZA 1YKWA 4H4OB 2BJDA 4EUVA 1RT2A 4LRFA 3TX0A 5HO4A 2WSCC 1VDHA 3UDVA 2DGQA 1WELA 3PRBA 1S6QB 4LSZB 3S1TA 3H0PA 2CRLA 2LP4A 1ZH5A 4KO0B 1SB6A 2HVZA 5BR8J 4LF8F 2M2BA 3FBFA 4DR4J 1YRXA 1HI8A 3EX7B 2VZ9A 2GJ2A 1N5YA 3QJLA 5F8HA 1MW7A 1VQLS 5B0BA 2NSCA 2ZH8A 5B0DA 1BMQB 2DHHA 3J80Y 3V2UC 2M8HA 4PG4A 2ILYA 3M8YA 2V4RA 3PG9A 4OZ3A 3X3UA 2WONA 4AL5A 2DR8A 1ZZFA 3N0VA 1U49A 1CC7A 1GEHA 2P6SA 3BH6B 3RB0A 5HSPA 2JFDA 1VLYA 2HKEA 4LF5F 5KG5A 1Y9OA 3H42A 2CQBA 3GP9A 3RBXA 4CYUB 4DZ6A 3M6UA 1QE1A 1WUUA 1IWGA 4I7FA 4HKQA 1S0OA 2Y9HA 4M5DB 4I68A 2BDPA 2UXDJ 1FD8A 3NWRA 5M2RA 2XMVA 1HQ2A 3M7VA 3H5XA 4F26A 4ZCMA 1ZM2A 1SCJB 1X4CA 3OL9A 1U8WA 4HI2A 3K5OA 4TU8A 4RNOA 2QRRA 2IM1A 2DYAA 2QL7B 2Q6BA 3ILOA 3V6JA 1RT3B 2YX4A 2OI2A 1PG5B 2F4VF 4EZ9A 3OTOJ 2E5IA 2J8AA 3PEHA 1MU2A 4DFMA 4B3OB 3AD7C 1FRXA 4OL8A 3EXYA 2B9EA 4OHXA 4ZVFA 4TU9A 2ERRA 3WQPA 3IS9B 4UZCA 5HMXA 3I9ZA 4F02A 4O0NA 3NP5A 2GMJA 4B9MA 1SIZA 3IG1B 4FYWB 4GKJF 3GIRA 2MZ1A 4KFBA 2Q66A 2VG5B 3NCPA 4YP3A 2LVWA 3WBZA 4KT0C 2V2ZA 1U09A 2R7OA 5GMKa 3I0RB 4JI4F 2AF6A 4YY3J 4LF1A 3P6YC 4RWWA 3UDCA 4PWWA 4ERDA 1IKXA 1X5OA 5DQIA 3BDPA 3A13A 1FKPB 2KI2A 2IDEA 3MGJA 3HHEA 5DM6Q 3MAQA 1VIXA 2K2PA 2IRXA 1HNXF 3CD6S 3J7YI 5D3GB 3KK2B 1NK6A 2RS8A 4A8QA 2V2VA 4Y2KA 2J9CA 1JJ4A 2VJVA 3CPWR 3ET6B 2DH8A 3FFIB 3CCQS 1N0VC 2VPXB 4PAAA 3QRRA 5ETQA 1K1SA 2ZVIA 1X7VA 2Y1IA 3PW7A 2LU1A 1ZPVA 1HYSB 3RBZA 2V69A 3BGFA 1BHNA 3OFEA 3EVOA 5J1EA 2CQ3A 2PA3A 3DOMB 4CH7A 4OJ3A 1KSPA 1B64A 2WW8A 1T3NA 1QVFR 3DRXA 3MUMP 2VBXA 5A76A 4RZRA 5ETKA 4YB5A 1T9XA 3E3XA 2XZDB 3T1YJ 4MIBA 3K58A 2EK6A 2DNGA 3F0NA 4FVCA 4YHHJ 1U1KA 2IJFA 2XTJP 1U0HA 3D6FB 1MMNA 2B9WA 1FEHA 3PW4A 1NK8A 4ATNA 2RQ4A 1S6PA 5AXMA 5KT3A 1ZM3A 3D0GE 1APSA 1SUQB 4CLWA 1EAYC 3KG4A 3BYPA 2DBBA 4QWCA 2EVZA 1S6OA 1M90T 3R5JB 2ZM6F 2EFOA 1U2CA 1XK8A 2J7KA 3J81j 2FLOA 3FZBA 4ZVRB 2ZKTA 1FERA 1M1HA 1FESA 2HGLA 3J80U 2EG2A 2G13A 1NHVA 2RHQB 2FHMA 3KK1B 2YTCA 1KVKA 1TUWA 4DEZA 4N8OA 3E01B 3BN7A 2R2SA 3LAMA 4TXSA 4ED1A 1F9HA 3P5TL 2OHDA 4RBUA 3V6HA 2FZCB 1KKHA 1YZ7A 2NREA 2OEMA 3Q8UA 4PWUA 4Q45A 4F3OA 1R3NA 1N5QA 4KJIA 3BBBA 3DLKA 1TV6A 5IZHA 3C14B 3LPEA 3CWJA 3MM6B 1WF0A 1R8PA 3D0HE 1WDDA 1J27A 3DRPB 3SDEA 3R5GA 2GIQA 3ZZRA 2QSWA 3PIPQ 1S4FA 2QG9B 3JB9k 2ZOFA 2WOMB 3SSSA 3C8YA 5D78A 5KFSA 4P74A 4X64J 4YR3A 1RA7A 2MKSA 2YX7A 3RZAA 4CLUA 4IH6A 2LKZA 1VK8A 2I1RA 1QAXA 1L3KA 2GMLA 1EETB 1NK7A 4C0OC 2CNKB 4EMDA 4C3MA 5L39A 4ZA1A 1C2PA 1TL7A 3H2LA 4WCEQ 3DLHA 4I2QA 2C1EB 1UVMA 4JV2A 2HIYA 3DLBA 2GVZA 4RW7A 5CA5A 4NLSA 3G96A 3WX8A 2FDNA 1WC4A 4KH0B 4K4YA 5KFGA 1HQUA 1WORA 2XEXA 3TZWA 4O0IA 2AYBA 5E5NA 1YLXA 5L8RC 4MKVA 3KLGB 2ZH6A 5KFDA 3D54A 4GMKA 1Q82T 3N28A 2AX1A 4A46A 1TK5A 4URSA 5F8MA 2AYEA 3PR5B 1KC8T 4OZJA 4DL0C 5LJ5Y 1QSSA 2U1AA 3OXFA 4OYBA 1AFIA 1B7FA 2L9DA 2KVIA 1TU0B 1RAGB 3A8EA 2H4YB 3CJKB 3T19A 3W9JA 3M2RA 2PE8A 3WC0A 1VJQA 4NZ6A 5KFZA 2JDJA 3R6GB 4DX6A 3UR3C 2OD6A 1M1KT 2W01A 3C15A 4IFYB 3DYAA 4WWSA 5CAAA 4CTAA 3L7UA 1MSWD 3LP1A 3HVTA 5DG9A 3MHYA 2JFKA 3IC1A 2BR0A 3CJRA 4OV1A 2HHVA 2W24A 1WC5A 4H4MB 2R7WA 2X1GA 2OPRA 1DFDA 1S48A 2MSSA 1A7GE 1HKAA 2ZWOA 4X66J 3MCOA 3NGUA 2HHHF 2E5HA 4CWBA 1KVIA 1D3WA 2HNDA 5HQMA 1LWFA 5L1LA 1H98A 3DN9A 4YQWA 4NLTA 2BKNA 2FVRA 2VA3A 1FK9A 2J9DE 2CQ2A 4M5MA 5J1NA 2QLFB 1J5OB 2JSXA 1RE1B 1KP6A 3W2VA 3PV8A 4F3QA 3ZZPA 2RQMA 3CSKA 2BANB 2F1FA 4UUXA 4U67Q 4Y2CA 3FVYA 1JLGB 4O3RA 1PYTA 2NZCA 4XPEA 1T8EA 3FZ2A 4Y34A 3OLAA 2AU0A 4A8FA 2DNZA 2RB7A 1IBLJ 4F4ZA 1TKXB 1SV5A 1WG4A 1FJGF 1LWEB 1RZMA 2PO4A 5HMZA 4JP8A 2DGXA 3NOGA 2AHOB 4CRJA 3W1YC 3I9V9 2EXUA 2HQIA 4PXEA 3J7YU 3HF5A 1NJZA 1H2TZ 3KKFA 5K14B 2OPPB 3B78A 4JI8J 5F3ZA 1NB7A 4NRUA 3LAKA 1U1MA 4ZJLA 2GC8A 1UMJA 5D0HA 2NPIA 4DF8A 3RAMA 2AMCB 2HK2A 3DRRB 4ZLJA 2BBEA 1SXLA 2VFUA 4WK1A 1S4EA 3MPVA 2P9CA 4QYRA 1VRUA 2QA4G 3ULHA 2XY6A 1CEZA 3DXBA 2W25A 3KWMA 4ED5A 2BZ2A 2CG4A 2KYZA 4MMOA 2Z2ZA 5KFBA 1M5OC 4C98A 2MJNA 2VC0A 3HPOA 4BHQA 1F5CA 3CDEA 1XN9A 3IGNA 2IVMA 1Q8KA 4DN9A 2KFZA 2WTFA 4JYAF 2CDRB 2F40A 1FI4A 4ID8A 1RYRA 5LXRA 4Y00A 2FHJD 1QLNA 2AJFE 1JLAA 1R8HA 2OEJA 2UVUA 4K0KJ 2FVPA 2BOPA 1YJTA 1DLOB 5I3UA 3AOCA 2FHKA 4OFZA 2FY1A 4GO5X 1UETA 3MTJA 3IM9A 4DFKA 2IJRA 4XTTA 3QLHB 2HNZA 3HO1A 2OEKA 3W9IA 2GQQA 4ZVQB 3PEJA 2DPIA 1KTVA 1FJEB 1NJXA 4D3GA 2HBYB 2V4JB 2G1HA 4A8XA 3CJ3A 4DLEA 1H73A 5AJ3F 2V8HA 3KHLA 3D0IE 3A3PB 4DG1B 2O67A 3AQPA 2KTQA 2OIHA 3BZQA 3GFYA 1URRA 3V4IB 2ZH3A 2RDJA 1H3DA 2DNMA 5J2NA 1GQEA 4EZ6A 4U7CA 1NJYA 2HZCA 4LT6A 1VLOA 4QU6A 4IRKA 4P2MA 1YIJS 5FLXY 2BOAA 3TVKA 3ENQA 4HVZA 4P7TA 2M4MA 4XO0A 2PI4A 4DL6A 3SSQA 5RUBA 4J9QA 1O6XA 5DDPC 2DGVA 4ANCA 1NNDA 5CYQB 4O44B 2CFXA 3U27A 4PUOB 5KFKA 4ZMMA 2Y0SD 2MKCA 3GIJA 3PW5A 4WIQA 5LSLA 4J7CA 3CCRS 2HHTA 1FEEA 2I6WA 1Q4RA 3CCWA 2Z57B 4RW6A 2BV3A 2G2YA 4OZ1A 4A8WA 1IKYB 3OFFA 4LQ9A 2VB6A 4DV7J 1OYDA 2CQ0A 1WEXA 3NWGA 1NK9A 5H9EK 1FDBA 3MFIA 2DPJA 4U6PA 4ELVA 2C2EA 3Q86A 3LOUA 4CLSA 4LREA 3KLHA 2FQQB 2ZZNA 4JI7J 1SJ4P 1Y3KA 1RB0A 4I2PA 2RE1A 4EEYA 2H5EA 1KQFB 2VKRA 2UUAJ 4ZCKA 2ZHAA 5C25B 1BQMB 3V5RA 2HHUA 2WVEA 4JI3F 2V34A 3MR3A 3CEDA 1HHQA 3S7RA 5HP1A 2ASDA 3THVA 3AA8A 3GYNA 4JI5J 2GW8A 2G2ZA 4CP5A 2CPIA 4B3MF 1MROB 1IBKF 1N32J 3OVAA 3DXSX 1HQEA 2C2KB 3K5PA 3JYTB 2D3O1 3UD3P 4PPZA 2DXEA 4HHUA 3KMQA 2W9CA 2AKWB 4WBFA 5KG3A 4AUKA 1PJ7A 4DU8A 1LW2B 4GKKF 1DQAA 2MQPA 4KHMA 1YJ7A 5JMNA 1UAWA 2QIFA 3GFXA 5IT9Y 1YSJA 3BV8A 4U8YA 3FRZA 2ZJQQ 4NMLA 2OELA 2AD9A 3UCZP 2V4QA 2GS8A 4WFXA 1OY6A 4WP9A 2CKWA 1T9VA 1S49A 1IR1A 5A8WB 4MFBA 3QGGA 2BRLA 5J2MA 3ADAC 3ISNC 3PX4A 2GMHA 4LRAA 4H4KC 1P1LA 1RWOB 4PZVA 4I6AA 2DH9A 2W7OA 3BF4A 3K5MA 5CXTA 4KGMA 2IC3B 4Q5VA 5HJYA 1TL3A 2Q1LA 3RAXA 4E0DA 1FKOB 3NL0A 4NCGB 2XO6A 2NPFA 1NDCA 1DJ0A 2FB0A 4FYDA 4EYIB 4WYWA 3HT3A 3NGTA 1OO0B 3QGIA 3ZZ0A 4KE5A 2DNHA 1RHMB 3ISZA 1IKWB 3GV8B 4H4OA 1JKHB 4C8MA 2BJ8A 1C0UA 4ZVSB 2JOQA 3B6BA 2J8SA 2J6SA 1HWKA 1M5KC 3TP2A 1MWYA 1FX4A 1N6QB 2WSEC 1S6QA 3SCJE 3NGSA 2MQ8A 4KO0A 3NAIA 2FLNA 1OWXA 2N4DA 2UUBF 4C8KA 1O51A 2EK1A 1TMJA 4OMFG 2V2KA 3RRHA 4EI2A 1TKDA 1JJHA 2UXBJ 8ATCB 3O8WA 4UQGA 3CDAA 3LH2S 2C22A 4DV1J 1VJWA 3ZO7A 2MZTA 4KV8B 3KJFB 2QN6B 2FLPA 1FD2A 1LXJA 1YG0A 1XR7A 4ZP8A 4CYUA 3T5KA 4P9SA 3BBFA 2F3JA 3FBBA 4MAKA 1F5BA 1WKLA 1NMEB 4QWBA 5HQLA 5LMNF 2B9YA 4DR3F 2EI5A 2BE7D 2NQPA 1QUPA 4ZPWR 3EM1A 3TVYA 2X1FA 1C4CA 2BM1A 5C5JA 2ROPA 2V9WA 1V3SA 3G8QA 1RT6B 2XULA 3HKZD 1A6LA 4ZPAA 1F9EB 2F9DA 4YR2A 3I4HX 1I1GA 2DHSA 1NJWA 3VF0B 4J9KA 4B3OA 3W61A 4LR7A 4RPFA 4TU7A 4CT8A 4ZVUB 3S01A 4FYVB 2MQOA 3DI6B 4UOHA 5KFIA 3PDNA 3IS9A 1U02A 2YKOA 4WYLA 1TUGB 2VH7A 3IG1A 1QSYA 3AFGA 2HQFA 1FXRA 2VG5A 1S97A 4ZITA 2B4VA 1AUSL 2GQ2A 2YH0A 3M8SA 2JEJA 3E2EA 4EGLA 4GO7X 2V68A 3NG8A 4LRDA 1YWXA 2DRDA 3I0RA 1X4DA 5A2QY 1UVJA 3F56A 1UA1A 1D8YA 2VJUA 5D4NA 1GTHA 4DUZJ 1FKPA 3MAAB 4KAIA 2QL5B 2HFSA 3UVJB 3HD1A 4E98A 3LO3A 4LFAJ 3HSGA 2MXYA 5D3GA 4TQSA 1R43A 3AJ2A 2MY8A 3TO8A 2UXCF 3X1LB 2EKYA 1AROP 1GMUA 3CC7S 1FJ7A 2BW7A 3ET6A 1WTBA 5KFYA 3FFIA 3DOLB 2UUCF 5IT9U 2BE2B 2KVQE 3ENWA 3RR7A 4RLEA 5IC4B 1VBKA 2RIJA 3KHRA 2MLXA 2UV8G 2G2OA 2C2DA 1U2FA 5DJBA 1S0MA 5EWGA 3IRXB 1YZ6A 2UP1A 4NA1A 3QMQA 1FVSA 5CYMA 4Q2LA 5EX0A 4Y0FA 3HLUA 2YNIA 4ZN1A 4NLRA 2JEGA 2DNNA 2QLJB 2QJ3A 1CJVB 2RRNA 4C48A 4J9MA 1ZTTA 2IVYA 3UR0A 2GQCA 3W62A 2WAQD 2XBPA 3QT8A 4WE1B 4RW8A 3PR4A 2VDHA 4FKYA 4YB6A 3KOAA 2BYCA 3CJ4A 3DC2A 2L41A 1LFWA 1RSCA 3L7OA 4Y2IA 4J9PA 4DPYA 4USTA 4DR1J 1QUVA 1JLBA 5A6WA 3Q8VA 5GAHI 4DV3F 2ADCA 3T6BA 3CE8A 1JLQB 2ZNYA 1VISA 3R1HA 5CZXA 4ZDNA 2MKHA 3JXOA 3HMJG 1SUQA 1YRUA 3RW7A 2V8VA 4IH7A 4ITSA 4FS2A 3T1HJ 3MM7B 5BJRA 3ZNUA 3M1VB 2XS5A 1RAIB 1UW9A 4Q0BB 3CCTA 2XSFA 4MT1A 3C46A 3N6LA 1EKRA 2PN6A 3D4JA 4LUBA 3C3LA 1Q1KA 3BREA 4NA2A 2R7VA 2OPQB 1X4GA 5FDLB 4WZQA 3AY0A 3KMSA 1CPZA 4OHYA 3PRDA 1RXOB 2RDDA 2OJ3A 1Y4ZB 2M88A 2MKIA 5HVGA 3E01A 4LFCF 4QCLA 4YFUA 1D1UA 3MURP 4NL5A 4DLGA 3GCXP 3GG1A 1S6UA 2OMOA 1JQGA 1NPKA 3VGSA 2GX8A 5THWA 4GVLA 4EYHB 1HWLA 3OV7A 1CJUB 4CLKA 1XWLA 3AOAA 1S7HA 5IWAJ 2RRAA 3K8VA 4LR8A 1XBWA 4ZHRA 1SC4B 3CJ8A 2X3GA 3MM6A 3RB4A 5KT6A 1UFWA 3RR8A 3DRPA 4TYAA 1X4EA 2F8HA 3H40A 4KHPJ 1HNVA 1I94F 5D0EA 3UFCX 5DM7Q 4JI1J 3CCMS 4ZCIA 3M6WA 2E1RA 4LF4F 3M8QB 3PTWA 1T05B 3D7SB 1HWJA 2N4CA 4GRSA 3GCWP 1SJRA 2W2MP 4PKDB 3DOKA 2IM2A 3RRKA 2IMOA 3VZIA 4RKUC 2AP6A 3JQJA 1K0VA 3ENVA 5M2PA 3W5ZA 1DTTB 4X84A 5MAOA 2YQ0A 1M5PC 3BR8A 1D09B 4BC7A 3GYXB 2ATCB 3MDFA 4PG5A 2QSFA 5A2QU 3UCUP 2LQ8A 3KYLA 4NXNF 4C0BA 3POTB 4E8UA 1LKZA 1S0NA 1UVIA 2W9BB 1N5VA 3I96A 1OY9A 1AT1B 2CWKA 5A6PA 4KC5A 3AHPA 1PIEA 5B7WA 4O3NA 3DHXA 3L09A 2XLJA 4OYZA 5ETSA 2EFNA 1ZOTA 3JTPA 4F4XA 2HHPA 2CNOB 2KRBA 2QT7A 1B0TA 2OKQA 2O5DA 4C97A 3KHGA 1QAJA 2IIHA 3BN4A 3OUYB 3PFOA 1PBAA 4IFYA 2XS2A 3GSIA 1CULB 2EKNA 2FLLA 1FFGB 1WEZA 2A10A 5JVGQ 3FJ2A 4QPXA 1N8RT 1T03A 5KFVA 3UPFA 1E6VB 4DBQA 3ZTRA 4H4MA 4FXWA 4CCHA 3HFZB 3NMRA 4JI2F 3DU6A 4LF7F 2JLFA 2A2DA 3CO9A 4DQIA 3JAMY 2COLA 1NHKL 1FA0A 4WTYA 2BUNA 3G82A 1EARA 2Y1LB 1ZYQA 3PY8A 5FJ4A 4OZ0A 2JC1A 4TQRA 4OI1A 1TKTB 1HHSA 1B0PA 4KBIA 1N0UA 2NZ4A 4I56A 3OSPA 3F73A 4LF9J 2HAIA 2RMLA 3DLEB 2Q43A 3BO4A 4DR4F 4I6YA 2VQEJ 4JOUA 2BJEA 1J5OA 1FWLA 1J5EF 3SI8A 3QATA 1XERA 3TWZA 2OD4A 1S9GB 3HVWA 3KJQB 1FKAF 3FMWA 2CQIA 4ED8A 2DRAA 2IAJB 4RW4B 3ZFVA 3VAIA 2K06A 3VV2B 1JLGA 2W2PP 4OZNA 2IJNA 1RQ0A 4YDDB 4NRTA 4B9TA 3UD4P 3ZC4A 4DS4A 4F04B 4IO1A 4DZDA 2VBZA 4QWEA 4CT9A 2XYHB 1FX2A 2ZC4A 2UUWA 1U48A 2A1BA 1W26A 1ZPWX 1TKXA 2Z2LA 3RAQA 1LWEA 2AEJA 4EFAC 2P9GA 3EE3A 5F8NA 3N6NA 5E3AA 2UXDF 3M2UB 3CD7A 4M5GA 4KRWA 3NRBA 4U7UD 4GC7A 2RKIA 2BJ3A 4K2XA 5D0GA 2P9EA 1JIHA 1FE0A 4ZN3A 1T0TV 4A4JA 4KKOB 1PC4A 5E3CA 3VALA 2HRTA 1RTDB 2VD3A 1VQPS 3TI0A 2BABA 3G2XA 4RJVA 5K14A 1Q0NA 1HIYA 4ZP9A 2OPPA 1U25A 2N7YA 4B9LA 5E2QA 5G4DA 4XAKA 4BDPA 5J2QB 4NI2B 1RU2A 4HT5A 3OFGA 3MPDA 4OJHA 1O8BA 3LWLA 3AD9C 3DRRA 1PAEX 3VAKA 4EU0A 2CPJA 2HPUA 1RBOB 5IFMA 4DF4A 4P6QA 3FSXA 4WIIA 2WVCA 5A8RB 2E9ZA 2NR0A 2B0GA 4R5PA 3FBEA 1C0TB 2O01C 4YY3F 4LF8J 1HWUA 3D2WA 3OXLA 1Y0HA 3OR2B 3FUYA 3DLGB 3UD5A 4LSLB 3NGRA 2ZJPQ 1RWKB 4WFZA 5GAHU 2ZC3A 4LIRA 2VG6B 1M5SA 5DG8A 2D3UA 2HFZA 4XDCA 1GXTA 5HN0A 1RWNB 1SJQA 3KNAA 3T9NA 3MOZA 3OXGA 3MMCB 1EQMA 2HBRB 1AZSB 4FS1A 4DN0A 1UA0A 3V4MA 3U1MA 4JI6F 2GJIA 4NXMJ 4LRBA 4IFVB 4DR6J 1RAFB 2KZZA 3N9UC 2CUYA 3LGMA 2BMBA 4U96A 2R2UA 4I4BA 1XNRJ 2HURA 1S1UB 1U2RA 4WFAQ 1GNKA 3TVZA 4WP3A 1WC3A 1UJ5A 4Q7AA 3KDNA 4AXIA 3CD0A 2DGWA 4NLWA 3QLHA 3K2YA 2KDOA 1EHWA 4N7TA 3M9NB 2JRSA 3AJ1A 2VBWA 2V4JA 1TVRB 4ZIVA 4X4QA 2PMHA 3LQVA 4ZVHA 1D0EA 2H65B 3JTNA 3JSMB 4P72A 1RLDA 1RTZA 1QD1A 3U02A 1UZHA 2KM8B 3T1YF 1PAUB 5LMUJ 2ZZMA 2F4VJ 2XSJB 5IS2A 4DFJA 4DG1A 2CDQA 4YUDA 4L73A 2BACA 4YHHF 3I5CA 1FT8A 1U0SA 3US5A 1U1LA 1IVZA 5DLFA 1HD0A 2M9KA 3I82A 1PILA 5IT0A 4A8MP 3JAMU 1ROFA 1FRKA 4NZ7A 1Y00A 2C2OB 1XMQF 1NLKL 2J7WA 3KUGA 1NEEA 4ELTA 1NKBA 4HTJA 4JI4J 3W65A 4X4OA 5CYQA 3PXGa 3K5LA 4O44A 1YJ9S 5JVHQ 4PUOA 4M1KA 5DETA 4ED0A 2DNRA 3M9OB 4F50A 3KK3B 1OS5A 4LR9A 1BGXT 4HLBA 2Y8WA 1XR6A 4LBHA 2KXNB 3GJSB 1WNEA 4USJC 3FCWA 4DHVA 1S10A 2AEMA 4WJBA 1PC5A 2GGPB 4LF6J 4C11A 3NBPB 3PO4A 3BGRB 2D1CA 4UOFA 5CD4A 4B3RJ 4BBYA 4ES1A 1S0VA 2J5AA 2R8IA 2M7SA 1QSLA 5DGAA 2HNYB 1N5SA 2MZQA 4I1TA 2HW3A 5C25A 1BQMA 3SBMA 4LSNB 4DMZA 2B8PA 1JJ2R 4UY8T 3F44A 2UVRA 3FNNA 1HR0J 3HVRA 3CF5Q 5EN1A 1MROA 2F8EX 3HSZA 2HQ3A 1U1RA 4X64F 3JYTA 3EGWB 2EEYA 3IBWA 4YDXA 2AJ0A 4Y3CA 2HIQA 1DTQA 1KOOA 1F60B 4B08A 2MMYA 3GFHA 6FD1A 3C6TB 1SH3A 1JXLA 2VA2A 1VS3A 1T94A 2JVOA 4DSFA 5E7OB 2KM8C 5DG7A 3BPDA 1U45A 4ECQA 2FGOA 2XI3A 3MEGB 5KFJA 3MMAB 1IJEB 1Q79A 4NPOA 1NSPA 5SUHA 4XK8C 1TL1B 2DNOA 1B70B 3MR2A 5B0FA 3TAMB 4C8OA 2R8JA 2IC3A 2J6TA 3TAQA 2RILA 5IV3A 1T95A 2QFJA 1FKOA 2F8MA 5A8KB 5E0OA 2HFOA 1NM2A 2NLWA 3CDUA 2WCXA 3P45B 4OZ2A 2I8EA 1KHWA 2JH3A 3N5BA 5CHCB 2YWEA 2OSRA 2R2TA 3B4MA 1IKWA 3UN2A 1F3VA 3DKDA 3HT0A 2RUGA 2B4OA 1JKHA 2FVSA 2HLTA 4O3QA 3MECB 4HYKA 3H4DA 4WP8A 2PFDA 1N6QA 2DTJA 3FSYA 3TW0A 1VGYA 2BW2A 1BQXA 3GJTB 2YH1A 2XGQA 1RAHB 5KFPA 2YWFA 1KFSA 4DR5J 2VFSA 2YQ1A 2XC9A 3UQSA 3KUHA 3QPIA 4D3HA 4X66F 1N34F 2AJQA 2ZE2B 4PYAA 4K4VA 2HZAA 2O3DA 4WXWA 4ID5A 1S1TB 3ILJA 1RWVB 4B3TJ 3PYGA 3M05A 3QNWB 2HG4A 4KV8A 5HMYA 4ZLPA 3ELHA 4ZVPB 1ELOA 1IM4A 1WSVA 4UW2A 2PT0A 2CPYA 3DM2B 4OLPA 4OI0A 4K4XA 3C19A 2B51A 3W5XA 2QTWA 2WBMA 4ALZA 1U6FA 5D15A 4DV2J 1NK5A 2PMWA 2JLGA 2DY9A 5KG6A 3ZXWA 3I5BA 3I55S 1SVDA 1HMVA 5HBMA 2AGPA 1IR0A 4HT7A 3SV4A 3ITHA 2CZ4A 5DLGA 4X62F 3NCRA 2CPHA 2LDIA 3M2VB 4R8UB 2J7UA 2FJWA 2P2CB 3QO9A 4ZJQA 1TMMA 1EIYB 3DI6A 3CJTA 3DRSB 1T11A 4U7UK 4OX9J 4FDFA 2HGNA 5EWFA 4DPXA 3QIPB 2VFRA 4DV0F 4NMXA 3HZEA 1RAJA 2PGCA 2RSQA 3Q8RB 3W63A 2HZVA 2NSBA 2OFGX 3FBCA 3FEYB 2IMWP 4MTPA 5GAGI 1TQLA 4Z7CA 1WOSA 1TFYA 5H9EJ 4ZPCA 3I0SA 5AXNA 4N77A 5KFHA 3FQLA 5IT4A 4K4UA 2MDAA 4DFPA 4W4MA 4B17A 1KVJA 1LWCB 4C0HA 1S12A 2D3ZA 3ZTQA 3R27A 4P52A 3DMJA 1CLFA 1SL0A 3OJSA 3MAAA 4NA3A 3QSYB 5D4PA 1FXDA 4K59A 5KT2A 2HHHJ 5LM7E 1FTRA 1YJRA 4K4TA 1ZM4A 3VAJA 1KQSR 1VMBA 3RG6A 2MKYA 3DOLA 4R0JA 2BE2A 2CNNB 1DBDA 3MMJA 2HWIA 4JV1A 1Q16B 2XWYA 2H5IB 3VR1A 2E29A 2MQQA 2D9PA 3EDRB 2YQ3A 4NLXA 3N79A 1FRLA 2CZVC 2FY8A 4F2SA 2YWGA 3MUVP 2YWHA 3EMTA 4DSKA 2BX6A 3IAS9 1BXNA 1CJVA 4HACA 2ZOGA 1EB0A 3QFWA 3OHAA 5GAEI 4C8NA 1S72S 1YQHA 2MYFA 5B0EA 5HMWA 1V3RA 4AFFA 2A3JA 4WE1A 4IR9A 4B9NA 2XMJA 4DI6A 4TKTA 1WKKA 3TA2A 4AT1B 2DHAA 3OVSA 1FCAA 1A0OB 3IR6B 1W25A 2J9EA 2CQ4A 2DNLA 2JEFA 1C4AA 1BQNA 2XQCA 3PVXA 1CVJA 1JLQA 3IBFB 2Q6CA 2VQFF 1MU2B 1M5HA 3BO2A 4K4WA 3V81B 2J76E 3MM7A 5KG1A 3QJPA 3CDBA 3M1VA 2EFPA 4DPOA 4EBEA 2OAUA 4O3PA 3HFKA 4R25A 3J81U 1NB2A 3GZ7A 1T9TA 2H48B 3IO1A 1REVB 2YNFA 2HGMA 3IRWP 2OPQA 1F6TA 1BD6A 1M1GA 1XTZA 3NCQA 2NUUG 3BB5A 4ED4A 1PYSB 3VAGA 1FRHA 1VQ6S 1JLCB 4LJMA 1IKXB 2ZJRQ 3VGUA 3OD2A 1H2UX 3ZTPA 5AXKA 1KNZA 1RHRB 1MNEA 2FYXA 3MF5A 2OMLA 3M8PB 2DK2A 4OX7A 4PWDB 3TR5A 1WG5A 1CJUA 2V94A 1RT5B 1F2HA 3VTIA 4JYAJ 1FVQA 3R1LA 4DJBA 1S5ZA 1E6YB 4DV7F 2B6AB 5DRKA 1UKUA 4L74A 3UN3A 2CWXA 5ETRA 2CPFA 2G0JA 4ZVTB 4JB8B 3B54A 3MM5A 4M5IA 4ZLNA 1FRJA 2WK4A 5J1EB 2UUAF 2LYVA 2CXEA 3UDLA 3MM8B 4ETZA 1A9NB 1NDLA 4QQBA 4IG3B 2J9DA 5CCLA 3TANA 1RWWB 1HFEL 1YJNS 2D7SA 4MJKA 3M8QA 1T05A 3MPUB 5CYJA 1F1BB 3ZZZA 1O5JA 5B08A 1NPRA 1JNZB 3O3LA 3CCSS 5AXLA 2MSTA 2K7JA 4MKAA 4FKXA 4F0MA 1H6KX 4HR2A 4NWBA 3FDSA 1U0HB 1ICEB 3T41A 3DGPA 3NS6A 3SFUA 3R5CA 1HPZA 3AODA 4N56A 3UCGA 3QAUA 2LXFA 4QR1A 3LW5C 1S6PB 1AFJA 4V1Ak 3BH7B 2X1AA 3M32A 1KTQA 5A0YA 4F4YA 3HP6A 1HNZF 3J7AN 3POTA 4UT4A 2W9BA 3LP0B 2E5LJ 1UVLA 1UWAA 3AT1B 2MZJA 2QV6A 4OYOA 1QM9A 3KDOA 2Y8YA 1UW4A 1X4FA 2CZ9A 3GILA 2WBRA 2V5HG 4URQU 4UOGA 3MEEB 3UO0A 1SJ3P 1YJUA 3BDEA 2DD8S 1DQ8A 1NSQA 1CULA 3CCLS 3BEGB 3NMAA 1JLFB 1S1XB 5B0CA 1E6VA 1VR6A 3W9HA 4E2FB 2JL9A 4NZ0A 3UNYA 1J2VA 2LQ5A 1GFWB 1TV6B 2P5VA 5C24B 3L95X 2KFYA 3TA0A 4DR7J 1TKTA 1V3ZA 1NSKL 1P9QC 1S79A 4N76A 5KFCA 4B3MJ 1IBKJ 2ZH7A 2UXBF 2NYHA 5KTQA 3JSYA 1VQSA 2V2QA 2CJ9A 3PHTA 1S9FA 4FBUA 3CO0P 1S9GA 1MN9A 2GJFA 3PYDA 4DV1F 2XMUA 2IAJA 1HI0P 4K5RA 1XNQJ 2NXUA 4HDGA 4WF9Q 2DT9A 4DQPA 3H7HB 4DUYJ 2CAJA 2VV5A 2HEKA 2QLXA 3IP0A 3VGVA 5GAGU 2XZWA 2GVZB 4RW7B 2I9SA 2QA2A 4LMZA 4NASA 2BQ3A 3PRVA 1HQUB 4X4VA 3M30B 3M4XA 4F4KA 3M2UA 2QFIA 3QRQA 3MR6A 1U47A 3FEZA 2R7UA 1VRQC 1RADB 4DQRA 4ECSA 2BXJA 3MI7X 4NLQA 2E7VA 1WI6A 3OL6A 2VPZB 1KLMB 1X60A 3KJNB 4DCJB 2NXCA 3VQTA 3QZ7A 4M5NA 2PA8D 3D6MB 1JMTA 4BS2A 3MM9A 5F8LA 4NI2A 1ACMB 4FZVA 3CVKA 2VFTA 4QIGA 2PDAA 3C15B 3WC2A 1ULRA 3MCSA 2AWZA 2C2ZB 2CG8A 5ETOA 5CQGA 2B8QA 1PSDA 4GVBA 3W66A 1VQYA 2IY5B 3PO5A 3QT7A 3EDQB 4IQXA 5A8RA 2OPRB 2ZDOA 2FVQA 5GAEU 2G0IA 3SZ2A 2KN4A 1JJCB 1WI8A 4FP9A 1C0TA 2DXFA 3SEOA 2XY7A 3UE2A 1NDPA 3CUNA 4DUZF 1LOUA 1Q8IA 2ZBIA 3OR2A 2CADA 1F3FA 5GMEA 2MGZA 4LSLA 2XCPA 2N3LA 4M63A 4AL6A 1NH8A 2B4PA 2DO4A 2VG6A 1O0PA 3A8IA 2YBVA 2POKA 2VIHA 1DHMA 4M95A 3IWXA 4QYZK 1NPPA 3EZUA 3W2VB 1BWEA 1Z2LA 3I4PA 2DH7A 2YKPA 3MMCA 1SQEA 1AZSA 3AH6A 4IFVA 3ZTSA 3D5MA 5HROA 2KU7A 2DJWA 1HL6A 1Z1ZA 2DCUB 2Q79A 1NH7A 4X4UA 1S1UA 2BM0A 2MTLA 4I64A 4BWMA 4KIAA 3QWPA 2EWHA 3I6PA 1SV5B 4JUZA 4W92B 3CJ2A 3TUZC 2ADBA 2GAGC 1TVRA 3HJFA 1R89A 4LRCA 3TJ8A 5E3QA 4G6VB 3JSMA 1K73T 4KPYA 5E3PA 2FTRA 1Y11A 5D4LA 2XMMA 3H98A 1S1VB 2DHXA 2XSJA 3SQOP 4KGXB 4NE9C 1ZBTA 3IR7B 1UEKA 5F3TA 4Q43A 1WF1A 1HBMB 3TEGA 3OTCA 2PEBA 5IXUA 4Y2MA 2AT1B 3W7BA 1F9FA 2DR5A 2AQ4A 1Q5VA 2MY7A 3TA1A 2GO8A 5GVQA 2C2MB 4LFBJ 5ETVA 2LEAA 2PC6A 3EXCX 2HVEA 3RJMB 1H38A 1LK5A 1WTFA 4G1QA 4X65J 2C3MA 4KGKA 5LXYA 3KK3A 3A8KA 4KB7A 3GJRB 4WXOA 1DY3A 2EC2A 4B3SF 3RUBL 2OLWA 3GWCA 2GHVC 4K8RA 1OY8A 4NLUA 2GGPA 3AXKA 3NBPA 1T02A 4USIA 1R7IA 3G8TA 3HULA 3BGRA 4KYZA 4WU2A 1ZZNA 3W8GA 3KLVA 1R8CA 4Y6IA 4PRFA 2WRMA 1IJFB 3MPWA 1HARA 2HNYA 1AYEA 4WZMA 3G9CA 5LL6d 4ECTA 3IGVA 2W4CA 4EO6A 2O1PA 8RUCA 1AXQA 1EJ7L 4LSNA 5T7LB 2UV8A 2YY3A 5I3UB 3ZNJ1 1WOOA 2ZD1A 3OLBA 3NEKA 4M5LA 4M5KA 2OFHX 2MJUA 4UOCA 4JI1F 2KJVA 2LCWA 3TUIC 4C8ZA 4FF4A 1VHFA 1JNRB 1OQ3A 1RUSA 4XDDA 2D41A 1NJIT 3G6VA 3OTDA 1YK9A 1HNWF 3Q2TC 5K8NA 1JLEB 1G6BA 4L75A 4ED2A 3NS7B 5BYQA 4B9SA 3A3OB 1SIWB 3M8ZA 1N33F 5LJ3Y 4IRDA 1G7CB 4BC9A 4PEOA 3MEGA 4FYYB 2V8PA 1GK8A 1CG2A 2D3OR 2CQPA 1S7IA 4J90A 2W9AA 1GMWA 3EGNA 2VHGA 1P1TA 3S8SA 1DZ5A 2H9ZA 5CH7B 3TAMA 4O4GB 1X9MA 2XYGB 3KLFB 2IDLA 4F67A 3AJDA 2KT3A 3T3FA 4NYPA 4K2JA 1X5SA 4LFCJ 3GV7B 3HD2A 3BPSP 3WHIA 3LUYA 5A8KA 1S59A 3QRPA 3V6KA 2DHGA 2RHSB 1SC3B 5I3QA 1H7XA 5F0WA 2ZH1A 4ZVOB 1R6VA 4QU7A 2QE5A 4CO2A 2QA4S 4PABA 1Q8BA 2HS0A 3OBIA 2I2YA 4O4RA 2C3PA 3M8RA 3DLJA 1MMDA 3KFWX 3KLHB 5J2PB 2ZHBA 1GX5A 4A8YA 4UTGA 4G1IA 1RAEB 4QWDA 2EFVA 1TK8A 2Z30B 1R8BA 4F4AA 2HBQB 3EICA 5KFQA 2HWTA 1EZZB 3QWUA 5AE2A 4RUHA 3MCMA 4KQZA 5HP1B 1XJWB 4ZCLA 4M5HA 4LF9F 3PW2A 4FF3A 3EZOA 3T9ZA 1Q8LA 2G1DA 1OPIA 2HS3A 2VQEF 1VFJA 2KG1A 2RT3A 1KS2A 1VQMS 1I5OB 2IHR1 2G4BA 4FPRA 5IQQA 3TJAA 3DM2A 4IDKB 2W2OP 4ECZA 3GFZA 2VFVA 2O66A 4ZVGA 3HSDA 4J9SA 4RX6A 2KT2A 3GIKA 1FWPA 1IWAA 3MMBB 1RP5A 3D3BJ 2M52A 5HAOA 3OJUA 4FBTA 2K7KA 3CMES 3MEDB 3MWBA 2VU5A 2IA6A 4ES3A 2KHDA 4R8UA 1AB8A 1TR0A 5T41A 2M0GB 4CLLA 5T14A 2CQGA 4B02A 2C2RA 1IXKA 2XLKA 3DRSA 2X51A 1TL3B 2Z4PA 2XLIA 3RYLA 4C9DA 3QIPA 4LIWA 2EC0A 3FGVA 4RL1A 1W7WA 2XHWA 1FJCA 1X4HA 2YKMB 4FVMA 5EX3A 2CJQA 2FC9A 1CS4B 1NKEA 3AB2B 4TN2A 2VODA 4PQUB 2Y1JA 1BLUA 1RTIB 1QAYA 2DXDA 4CLFA 1Q7LB 2RVJA 3UI3A 4MIWA 1C0UB 2BA9A 1CC8A 1UTAA 1B4SA 2OPSB 4RUCA 1RHJB 1LWCA 2WVBA 1NSAA 2UVWA 2DGSA 4A8SA 3TQ1A 4DL2A 2ZH5A 2XNRA 2J0SD 3BKFA 2NXNA 3W64A 1VIOA 3RU0A 3GB0A 4NLDA 4RNNA 2VC1A 2VG7A 2DR6A 2CIMA 1J5EJ 2H3EB 3EWGA 1ZTWA 4J9UE 2FJAB 3CC4S 1GH8A 3DNCA 3KG0A 1RTHA 2MPUA 1NK4A 1TK0A 1FNMA 1HBNB 2MLYA 2KFNA 2HBZB 1H7WA 1V6HA 1NUEA 3GONA 2ATLA 5K5MA 3TOQA 1N36F 4NXMF 4ZKAA 4DR6F 3V6DB 2L9NA 5KFOA 4V19X 1XNRF 5JJBA 2OTLS 2L48A 4DPTA 3SSRA 4DCPB 2GO9A 2KH9A 3NGKA 4YOEA 2MHEA 5I42B 1S9EB 1P9YA 5C7PA 5DZ6A 2WSFC 1U26A 4ILLA 4EBDA 3GR1A 5LMUF 2C3UA 3RBEA 1QVGR 3CB4A 4J9OA 3V81A 4BWJA 1U1OA 3NNHA 5CZVA 2I0XA 2ZOMA 2HWHA 4CI0B 2ZKUA 4HDHA 1I6JA 1RACB 3OR1B 3O1LA 1VC5A 2W7AA 1REVA 1Q86T 5KFEA 4TVAB 2Z2MA 2IRUA 1I3OB 3R7NB 4BCAA 2XY5A 1UL3A 1JLCA 3D67A 3A8JA 4PPDA 3VHQA 1TTHB 2QEXS 4MIAA 3VVTA 4X4NA 2E66A 3UW1A 1SJFA 3R3TA 4IG0B 1RISA 2W4PA 3LA0A 3OT9A 2YKQA 1Q7YT 1X31C 1XC9A 4MH8A 3E8OA 2QMWA 2RQKA 4AQYJ 3M8PA 2WVDA 5C2GA 3CJ0A 4PWDA 5HQ8A 5K20B 1LNQA 4M5DA 1RT5A 2VONA 2CNLB 4QJVA 3KLEB 2R8GA 5CABA 1E6YA 4LF6F 2GA7A 5KG2A 1R0BG 2B6AA 2B43A 3CD5A 4OYWA 5DDOC 3QGPA 1KWMA 4B3RF 1M0SA 3BSOA 4JI6J 3HHLB 4PXBA 2R7RA 2HFNA 5L9XA 1CSJA 2Y1RI 2EFQA 2B7CB 3ICLA 3GIMA 1EP4B 3EPIA 4ANDA 4Y28C 5CYMB 1RT3A 3RGIA 5BYSA 3JQMA 5G0RB 3MM8A 3R7SB 4OHVA 1ZAXA 5H9FK 2YNGB 2YNIB 4IG3A 1DQ9A 1RABB 2F9JA 4Q8FA 4L6V3 1L5UA 5I4MA 2MKKA 1G1XA 5JUMA 4O3OA 1HR0F 1NXIA 5HVHA 2F63A 3RRGA 1ITPA 4Y65A 2GIFA 2K3KA 3CCJS 3DU5A 4RW8B 4QPTA 3MR7A 3T5JA 5KG4A 2JJ4D 3UNGC 2MZRA 2V50A 5SZTA 3RB6A 1TAUA 2HMIB 1JLBB 3BBCA 5ITHA 3FQKA 4JI0F 5EGYA 2HHWA 3SCLE 2Q3PA 3ZZYA 1PO6A 4IOCQ 4PYDA 1IN0A 1XMQJ 4U9RA 3VAFA 6FDRA 1HI1A 3O44A 4DV5J 1WJ9A 3WIUA 4NLOA 4I67A 3OHBA 2ZWPA 1SJ1A 3KK2A 2JLEA 3LP0A 3HHLD 2W2QP 2XGPA 1IKVB 2BVZA 4DR2F 3WIVA 2YXLA 2GFFA 1RHUB 3K0JA 4ECRA 3TJ9A 4Y2AA 3HSJA 1IBMJ 1Z2ZA 4TLRA 1HYSA 2XCAA 2QYGA 3MEEA 4P71A 4ECYA 1X4BA 4FNHA 4M5JA 1N48A 2E7XA 2Z56B 2DEJA 3DOMA 5ETLA 1JLFA 4OYAA 3QSIA 1S1XA 2KL8A 2LQJA 2Z58B 1SC1B 4HH0A 1NZAA 4OJ1A 2E1AA 2KG0A 5KOWA 4A8KA 1S1WB 1UP1A 4ZHRB 4HL9A 4OYPA 4CQ1A 5C24A 1Y10A 5L46A 4DV4F 4CLPA 2H4WB 2BE9B 2LQBA 3CGIA 1JK9B 1FRIA 1YGYA 4DR5F 3HHLC 3K5NA 1HNVB 1CQMA 4MKBA 3BQ2A 2LDYA 5IM0B 2XNQA 4X4PA 3HKWA 2D9OA 2G0CA 2IRYA 3D3CJ 1UFLA 1VBZA 2FJXA 2RU9A 3CCVS 2P6TA 3C16B 4WFYA 3DOKB 4B3TF 5EHHA 3NOCA 4ZLLA 1NDKA 2CVIA 4WFNQ 5D0RA 4DSLA 2QX0A 1X8DA 5DS7A 1UVKA 4YN3B 2L08A 5DO2A 3KK1A 2X3DA 3G87A 3M30A 2YVSA 2FJVA 4CO4A 5KFXA 3P8BB 1R0AB 4WPAA 4DV2F 3OPKA 1LXNA 3VGTA 2LXIA 4NLGA 3T5LA 3ZTOA 4C8LA 3R8YA 4F2RA 2R8HA 1I51B 1KRPA 4O23A 1KLMA 2NXEA 2DO0A 2W2NP 1W2IA 1D9AA 2B5JB 4HHHA 2XWXA 3D66A 1K47A 1SH2A 3C14A 5ETMA 1JX4A 1GAOA 1VQ8S 4DQQA 4OX9F 3CNQP 2B3TB 1SL2A 2VDIA 3QT6A 3AB4B 1WACA 3LF0A 4J5OA 2RH3A 2AZ1A 4DSIA 4J9RA 2WOMA 3CJ5A 1FE4A 4IQMA 2QMXA 4P2XA 4DXLA 1T03B 2DNPA 3W3SA 1KEKA 4FXVA 3PNIA 2RAQA 2FJEB 1EETA 1PJ5A 2NYIA 2N82B 1BUXA 3G82B 3KXDA 2AEFA 3D1HA 1N34J 1KDNA 5DQGA 3D28A 4JV5J 1YI2S 5M2UA 3Q2SC 5CCMA 2UU9J 3CIMA 2IM3A 2CJXB 1QAIA 3SMZA 3KLGA 2M3DA 5J1PA 4ZPTR 1FDAA 4KGZB 3ILIA 2LEBA 4ZIWA 3A4TA 3E51A 1RAOA 3BGUA 1F2GA 1XMOJ 3LWMA 4YR0A 4DV6F 2D74B 3BSAA 4HH1A 1KLNA 3WDOA 4LBPA 5F8GA 1VQNS 3CJKA 1YHQS 1BE4A 1EKSA 3UDEA 1RDRA 4KPCA 2EPIA 5I3PA 1FO1A 3J7A1 4QIEA 1HNIB 1WKJA 2EBGA 4X62J 2R3VA 3LTOA 4NCBA 3R97A 2W1BA 3VAMA 1U6BA 1WHYA 1ZAWA 2RKIB 1S1VA 2DEIA 2U2FA 2YWKA 3OQ2A 3RTVA 2IM0A 3JQKA 4U95A 4J9VA 3LP2B 2LFVA 1HBMA 2E9RX 4OV6A 2XYPB 4FYXB 2XG8A 4DV0J 4MK9A 2CPEA 2BJ9A 2LU2A 2ZVSA 1LQ9A 4ED7A 3TUPA 3MD1A 3R7BB 1UJ4A 1RA6A 3TX8A 2LA6A 2JEIA 1HBUB 2V63A 1OSCA 5BR8F 2ZZTA 1YBAA 4TLQA 4URGA 2DNKA 4USMA 5HLFB 4RW9B 3MD3A 2RRBA 1NKCA 3KTQA 2IFXA 1WC1A 2BANA 2BJ1A 1P6TA 4L72B 3SFGA 2YKNB 1KQKA 2ZH4A 2X1BA 4R5PB 2Z0GA 1MWZA 4NYOA 1VQOS 3K57A 4DSEA 4FNIA 1XMBA 4NOHA 5F9NA 3EGZA 1CJTB 5HATA 4F7VA 1WHWA 2FIUA 4OI6A 2KZMA 1NO8A 3OSNA 4WFBQ 2LXUA 4ZPDA 4O3SA 3GQCA 2APOA 1SBRA 2MQMA 3THTA 3PHEA 3R2DJ 3P5BP 5LT5A 3RB3A 1H72C 2MQLA 3H90A 5C42B 1KN6A 1ZETA 3IXQA 1YJVA 2HHQA 4P2FA 1PYOB 4DCOB 4EBCA 2E1PA 4CM0A 5T7LA 3OTBA 4ED6A 3S6EA 2FHJA 3CC2S 1B0VA 4PXCA 3EUNA 1RYSA 3OFHA 5K8OA 3T6JA 3OTOF 4K4SA 4W98A 3L9ZA 3MFHA 1WHVA 2RNEA 4PG6A 3CXCR 3K89A 4ENOA 1X5PA 2E5GA 2D69A 3VAHA 4R0EA 1YTYA 1B3TA 2NCKL 2HQDA 1RWUA 1VK3A 4C8YA 2VQFJ 2R7SA 1JLEA 2ZFHA 1URNA 1UJ6A 3C66A 4YB1P 1RTJB 1K0TA 6AT1B 2R7TA 1UEVA 5AE3A 3C6UB 1RT4B 3KJVB 2K1RB 4B9VA 4N5SA 5KT7A 3TAPA 1WC0A 1FFWB 4DWIA 2KO1A 1L3TA 2AYMA 4O4GA 3WZ0A 3KLFA 1KBRA 4C7QA 2I5JB 1OQ6A 1REGX 4DQSA 2E5LF 4IKAA 3D1QA 4WU3A 1G2EA 1U7LA 5KFNA 3G6ES 5KFFA 4LF5J 4UQTA 4IH5A 4USVA 1HWIA 3B8HA 2CJYB 1SKSA 4CDIA 1YVFA 4Q44A 1DLOA 2DGUA 4AE5A 3IR5B 3D9BA 1YBUA 4C11B 5AT1B 3H20A 4IOAQ 4LF2A 3JS9A 3D1OA 2ZHOA 3MCNA 5J2PA 2FHOB 2C28A 1Q78A 2FZKB 4QYZJ 1DRZA 1LW0B 5GADI 3I31A 4AYBD 3SQGB 2IYIA 5ETPA 2ILZA 2AX0A 4OZLA 2AIRB 2DY1A 3ISND 4DR7F 4M8LA 4CLTA 2UZAA 3SCIE 5L9NA 2CQDA 3V4IA 4CO5A 2ZBRA 3W2WB 1R0CB 1QTMA 3CCZA 4RBVA 3HX9A 2KJWA 2DRBA 4QOTA 4H4KA 2HHXA 1H74A 2DGOA 4GKJJ 4NEZA 4CNYA 2R2RA 1U4BA 2ZUGA 1IUJA 1AW0A 1LV5A 4QIFA 4A48A 4RU9A 4DS5A 5D8HB 3GPAA 4C3LA 1DTQB 1XNQF 3BO3A 3O2IA 1TL5A 4ECUA 4IDKA 3O6QA 5L1IA 2F65A 4DUYF 4Z37A 2RF2B 3W5YA 5F8JA 1V5VA 1RCOB 1LWXA 2XMTA 4UUWA 1HNZJ 4I6WA 4RNMA 3IA0A 1NCLA 3CMAS 3PKYA 3MMBA 4ETXA 3CW2C 1RBAA 1R8AA 1HNXJ 3VCDA 1VQKS 1IKYA 2KYXA 3MEDA 2QL9B 2WB4A 1RT7B 3JSRA 5EDWA 2AW0A 4WK3A 1RT1B 4IUFA 2F7VA 3THPA 2VPYB 3PIOQ 4HTIA 5KFMA 4UY85 3N5FA 2ZH2A 2GVDB 1U1NA 4J9LA 4YEAA 1CBKA 2R4FA 3I5AA 1OMSA 2YKMA 1FXLA 3HFVA 3B4DA 5DDRC 1CS4A 3LPYA 1DAXA 4PQUA 2Z2YB 1SH0A 2LEPA 1RTIA 1YJWS 1XQIA 4X4RA 4IR1A 3A1YG 4K5SA 2OPSA 4CNZA 1TKZB 3GR0A 3MAHA 4X4TA 4OYIA 4QIVA 3NKYA 5ETTA 1U6ZA 1UCNA 3NNAA 2CYYA 3UWTA 2QYCA 2NS1B 3FKBA 4RUBA 1H0HB 3EZ5A 1WSRA 4DL3A 1LW2A 4PCQA 4DL7A 3PCOB 1CQNA 4LVNP 2OO4A 4DU7A 2RU3A 5L1KA 1HBOB 4CO3A 1VC6A 5EUHA 2XM3A 1TP7A 3H2VE 3PJWA 3BKUA 1VYAA 2LLZA 5A8WA 4ID5B 2AGOA 1X0PA 1HBNA 1VBXA 2ZM6J 3LGHA 1NHUA 4FF1A 5FLXU 2IBKA 2FJDB 2E44A 4V19J 2JZ5A 1UEUA 1C1BB 1SQGA 2AJ1A 4KGVB 4GC6A 2ZDPA 2ROEA 1Y5IB 2CJKA 3IM8A 2Y3YA 3MTKA 2HHSA 3Q89A 2DB1A 2AV5A 2FC8A 3V6DA 4NYZA 2OTJS 5CD4H 4CM2A 5IC6B 1VQ5S 4NCGA 1K44A 2XMKA 3HI9A 2A18A 1LK7A 4ZP6A 5MLCV 2FZGB 2JWNA 2QGFB 3G8SA 5I42A 1ZA2B 1S9EA 4L76A 3ZZTA 1HMVB 5HBMB 3ITHB 1QJHA 4DL5A 4XIUA 3PACA 3M8WA 3H5UA 2G9OA 3WX4A 4F8RA 2RJZA 3OL8A 4OQJA 2HVIA 3H5SA 3OL7A 3QO9B 2OP5A 5ADZA 3ZZOA 2BQUA 5D6GA 1CJKB 1VQ9S 1AA1B 4EK2A 5KAKA 2W8LA 2DGTA 2GAHC 1YBTA 1FDNA 3L7PA 2HSEB 4RO0A 4USKA 2JC0A 3B82A 4ICLB 3J81Y 3GTYX 3OR1A 5KFLA 1RAAB 3CTRA 4QZVB 3LALA 1PGZA 4LFBF 2W7PA 2E5JA 5HL7Q 2IA0A 4NX9A 3HCXA 3I0SB 3KLIB 4EO8A 1X9WA 4J9NA 1XR5A 5F9LA 1BWVA 3ZZUA 4IG0A 3N6MA 4X65F 3PM9A 3DMJB 1WD6A 2K8GA 3Q22A 1FNOA 1N56A 2H5JB 3MR5A 2Z8QA 4ZPBA 1S77D 2PD1A 8AT1B 1P27B 2R7XA 5FD1A 2FJBB 3OTEA 2B4UA 3KLEA 2L3MA 3P96A 1S99A 3BSNA 3GSDA 4KY3A 1IBLF 4IO9Q 3HHLA 2CJAA 2ZNZA 1UWBB 2AJ2A 3TZZA 1RT6A 3SYZA 1RWPB 4ILMA 2YNHB 4OJGA 3K7RA 2GZOA 1EP4A 5K9FA 2A0FB 1C1CB 3VVUA 3Q83A 4P7VA 3BS9A 5JXSA 5G0RA 1Z4UA 1Q5YA 2YNGA 2DIVA 3J7Z5 1GX6A 2F4FA 3Q8YA 1F5AA 1WDTA 1FFSB 4RBTA 4HACB 4TYBA 3I87A 2EG1A 2BKOA 1VRTB 4TY8B 4JI8F 2H51B 3J7ZT 2YPYA 3TZXA 3M6VA 3DFEA 1KQGB 7FD1A 2R9LA 2J0WA 1FDDA 2HLUA 2HQCA 2V0NA 4TNOA 5IOLA 4CZCA 2HMIA 2QO3A 1BQNB 4OX6A 5U47A 1RT2B 3RW6A 2PI5A 3QAEA 5HK4A 1D9FA 4X2BA 4F4WA 3QBCA 2A6OA 1UFKA 1IM6A 1RHQB 4USUA 4FF2A 2MZSA 3UVJA 2IVFB 2V9KA 4RNFA 5GADU 1NRKA 2LQ9A 2A6MA 3DDKA 4WKRA 4K7QA 1N5YB 2OGUA 2YNFB 1IKVA 5E33A 3R5BA 1MG7A 4F36A 2VUGA 4IRCA 4A47A 2L9WA 4B3SJ 4PR6A 2WONB 4N8NA 2CJBA 5HANA 3IRXA 4OI2A 3GLJA 1MMLA 2CQCA 2F5GA 1KD1T 2DVIA 2CQHA 3EGVA 2E9TA 1QE1B 4I7FB 4K0KF 1RKIA 1QDUB 5H1SV 2E1CA 1HLWA 1FJGJ 5KFUA 1PJ6A 3TEHB 5L1JA 3MXHP 2WZ1A 1Q95G 5K8PA 3Q8QB 3G6YA 4HEA9 1S1WA 4U8VA 3KNGA 3I56S 2EFGA 2AZ3A 3MZIA 3GE9A 1TAQA 1UZDA 4AL7A 1N88A 2CPXA 4QW9A 1PKUA 4ZOSA 2E1MC 3SCKE 3MM5B 2RQCA 4WTOB 4QBUA 1YRTA 3LANA 3K17A 5IM0A 4J37A 2HVDA 2XO7A 1WOPA 3HHKA 4F25A 2M5YA 1Y3JA 2RD5C 2XB2D 4G1PA 4MYUA 1NZ8A 2W4DA 1BC6A 2GV1A 4RWXA 2KXHA 4Q0BA 3C16A 2N3OA 2PFFB 2ABYA 4KFBB 4DX7A 1QY7A 2DNYA 1HNWJ 3R9LA 3P49B 3CDWA 5FDLA 4IYQA 3NAHA 4CLYA 3DGPB 1N33J 1HPZB 3ETOA 5DZ7A 4OZ5A 4ED3A 3M32B 1GXUA 1R0AA 4C4WA 3SIPB 5A0YB 1NK0A 1K1QA 3ILLA 5AE1A 4FPIA 3H25A 4EWTA 2QLWA 1HW8A 1UPPA 4Z7YA 1KFDA 4OX8A 1T9WA 1RLCL 4ZJOA 4OHWA 5D4OA 4KSEB 2B5JA 2YPZA 4YB7A 1SQFA 5IQ6A 2NXJA 4QW8A 4FXDA 4JI7F 2VF3A 2DR7A 1OSDA 4K4ZA 4C3KA 2SXLA 3PJXA 2CVEA 2UVVA 4MK7A 2XS7A 3PZPA 3BGOP 2HS4A 2PIIA 5KFAA 1OJ4A 1L3VA 3D6TB 4IOBA 1Y7PA 2IYGA 4JI5F 1FF2A 1SKRA 1HA1A 2RUSA 1QTNB 1VCTA 1N32F 5AJ3J 1RJJA 3T5HA 1FNXH 2MLZA 5DDQC 5F0UA 3CJSA 4YMEA 1DTTA 1AUDA 4ZK7M 3U1LA 1D9DA 3W60A 1VQ4S 3RBDA 4RU2A 5FIIA 1VC0A 5H9FJ 2KKHA 1U1QA 3NGDA 4B9UA 3HJVA 1K9MT 4QR2A 4HHJA 1NBEB 1R31A 4DSJA 1N52B 4P75A 3GYGA 2V8GA 1U24A 2BQRA 7FDRA 2OH2A 2CPZA 3GU0A 3A12A 2VASA 4NLPA 1S76D 1WG1A 1EX8A 2ASLA 3JTOA 2ZEJA 1WHXA 1YDLA 2IPOB 3T1AA 1DARA 4C2MA 3DCAA 1GXLA 3OUYA 1PCAA 2ACMA 5EWEA 1HNIA 2DISA 5F41A 3U7JA 1PBUA 5KG7A 2HVHA 3GJQB 1R27B 3TYTA 1TL4A 1N4LA 3L3CA 4ILRA 5K8MA 2MHNA 2VOPA 2QA1A 3AQOA 2GHPA 1TZ0A 1SKUB 2J0QD 3LP2A 3D6HB 2RS2A 2PEHA 2AJ4A 3HXMA 1Q53A 1IBCB 4S0MA 3BR9A 3IN5A 2FVCA 2ACYA 1N5TA 3DLKB 2N7CA 4KHRA 3GG0A 3L4BC 2DNQA 3IAM9 3KG1A 4AD6A 4ECXA 4JI3J 3MM9B 1TUVA 3SXLA 4CH1A 4J91A 1HBUA 3SDEB 3DLEA 9RUBA 1RGVA 5HVFA 3BM7A 5C2CA 1P8GA 5HLFA 4PG7A 4GVBB 3Q8PB 5ETNA 3Q0AA 3MUTP 3PKMA 4RW9A 3C2PA 4RUAA 3BQ0A 2VKZG 1NU4A 4ECVA 2YKNA 3BYRA 4JBCA 1EQ0A 4L3KA 2CQ1A 4RW4A 1VQ7S 2AYGA 3BSCA 3KHHA 4GKKJ 1YX2A 2V6AA 1TL7B 3VZHA 2DKOB 4NLVA 2DIUA 2W8KA 4I2QB 1CJTA 2GCFA 3CT9A 4UZBA 1H2VZ 1ZAVA 4DUTA 2B56A 2MGZB 2MKJA 4AQYF 2XZTB 3H4BA 1X9SA 1KONA 3O5TB 1X4AA 4OI4A 2QLBB 1Y5NB 3H5YA 3SV3A 2ASYA 5C42A 3HVAA 3P3DA 5LSRA 1VOMA 1LEOA 1SPBP 1RU1A 1N36J 4F0HA 3CCUS 5HROB 1IR2A 5B09A 4KKOA 4ANEA 1FWKA 3BGLA 1RTDA 2M8DB 2E7WA 1KOHA 5LOQA 3IMQJ 2BEFA 2B9XA 1XEZA 3U1NA 3W8PA 2XHCA 2FUG9 4ZS6A 2PMZD 3M2RB 3MPYA 2EW9A 2GHWA 5J2QA 3IWLA 3F41A 3QJJA 1RBLA 3TUJC 4X4SA 2DR9A 3DYAB 3CCES 4CTAB 3LP1B 3H59A 3HVTB 3R5DA 4DOZA 4P73A 1HD1A 1RHKB 1F0XA 2PSZA 2FPHX 3EPGA 2MEWA 1RTJA 2ROGA 4N41A 3PYFA 2UUBJ 3HHNB 3C6UA 1RT4A 3KJVA 3TNVA 1MWQA 2K1RA 2HRUA 2KB2A 5L38A 2XI2A 4LVOP 3DHWC 1U1PA 3DLGA 4DV5F 2YX1A 3DGVA 3OVBA 4LFAF 3G4SS 2HNDB 1LWFB 2V8DA 2I5JA 3IWNC 1FK9B 2C3OA 2ZBCA 3JSBA 1TELA 2H1YA 3HHDA 4OYXA 4G1QB 3BJYA 2I38A 3FMBA 5E41A 1SL1A 4G65A 2JX2A 1IBMF 1T9UA 3VWSA 3TARA 4USWA 9ATCB 2HFVA 5LMNJ 4USHA 4MKYA 5KFRA 4DR3J 1WF2A 1B7YB 2QMUB 1JXVA 5GMDA 3TZYA 3H2UB 2H54B 1MLAA 4Q2MA 3PFEA 4ZPVR 3LGNA 3NNCA 1LW0A 3CIZA 1RI7A 3DDIA 2VPWB 3SQGA 3AD8C 4RR5A 3D68A 2KRRA 3M9MB 4C6AA 2ZITA 3N4WA 3W2WA 3QYYA 3FSIA 4HI1A 1L3UA 4DR1F
chains in the Genus database with same CATH topology
3EJMA 3VGTA 4ANCA 3ZTPA 4DI6A 3PRVA 3ZTOA 1NDCA 2DXFA 5CABA 4EK2A 4O0NA 1WKKA 4ANEA 3DKDA 2HVDA 1VYAA 1BHNA 1EHWA 3EVOA 1NDPA 3ZTQA 3BBFA 3FCWA 1ZS6A 3VVUA 3Q83A 5BXIA 2DXEA 1B99A 3BH6B 2VU5A 2DY9A 3NGTA 2BEFA 1F3FA 3FBBA 4WBFA 3ZTRA 3FBEA 3BH7B 4F36A 4F4AA 3EICA 1WKLA 1S5ZA 3ENAA 3GP9A 5CAAA 1NPKA 1NSKL 3L7UA 3Q8YA 4DZ6A 3EE3A 3VGSA 4FKYA 4ANDA 3FCVA 1S57A 4UOFA 3B6BA 1NHKL 3EM1A 3Q89A 3R9LA 1NUEA 3EVMA 1MN7A 3ETMA 3NGRA 4W98A 3GPAA 3Q8VA 1XIQA 3NGSA 2AZ1A 1W7WA 3WX8A 1K44A 3B54A 1XQIA 1NSPA 4ENOA 3Q86A 1JXVA 3Q8UA 2HVEA 3ZTSA 2CWKA 1S59A 1HLWA 3G2XA 1NDKA 1MN9A 1NDLA 1BE4A 1NB2A 3EVWA 1NLKL 1U8WA 4DUTA 3PJ9A 5IOLA 1HIYA 2B8PA 2NCKL 1LWXA 3BBBA 3VVTA 1F6TA 1UCNA 2DXDA 3NGUA 4KPCA 2DYAA 3EMTA 4UOHA 2ZUAA 4UOGA 3DDIA 2B8QA 1NCLA 3FC9A 3FBCA 1WKJA 3FKBA 2BX6A 3ELHA 3JS9A 1B4SA 3FBFA 1BUXA 2AZ3A 4S0MA 1NSQA 3MPDA 1HHQA 4C6AA 3BBCA 3VGVA 2HURA 4FKXA 5C7PA 1PAEX 1KDNA 1LEOA 4CP5A 4HR2A 3VGUA 1PKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJM A;  3VGT A;  4ANC A;  3ZTP A;  4DI6 A;  3PRV A;  3ZTO A;  1NDC A;  2DXF A;  5CAB A;  4EK2 A;  4O0N A;  1WKK A;  4ANE A;  3DKD A;  2HVD A;  1VYA A;  1BHN A;  1EHW A;  3EVO A;  1NDP A;  3ZTQ A;  3BBF A;  3FCW A;  1ZS6 A;  3VVU A;  3Q83 A;  5BXI A;  2DXE A;  1B99 A;  3BH6 B;  2VU5 A;  2DY9 A;  3NGT A;  2BEF A;  1F3F A;  3FBB A;  4WBF A;  3ZTR A;  3FBE A;  3BH7 B;  4F36 A;  4F4A A;  3EIC A;  1WKL A;  1S5Z A;  3ENA A;  3GP9 A;  5CAA A;  1NPK A;  1NSK L;  3L7U A;  3Q8Y A;  4DZ6 A;  3EE3 A;  3VGS A;  4FKY A;  4AND A;  3FCV A;  1S57 A;  4UOF A;  3B6B A;  1NHK L;  3EM1 A;  3Q89 A;  3R9L A;  1NUE A;  3EVM A;  1MN7 A;  3ETM A;  3NGR A;  4W98 A;  3GPA A;  3Q8V A;  1XIQ A;  3NGS A;  2AZ1 A;  1W7W A;  3WX8 A;  1K44 A;  3B54 A;  1XQI A;  1NSP A;  4ENO A;  3Q86 A;  1JXV A;  3Q8U A;  2HVE A;  3ZTS A;  2CWK A;  1S59 A;  1HLW A;  3G2X A;  1NDK A;  1MN9 A;  1NDL A;  1BE4 A;  1NB2 A;  3EVW A;  1NLK L;  1U8W A;  4DUT A;  3PJ9 A;  5IOL A;  1HIY A;  2B8P A;  2NCK L;  1LWX A;  3BBB A;  3VVT A;  1F6T A;  1UCN A;  2DXD A;  3NGU A;  4KPC A;  2DYA A;  3EMT A;  4UOH A;  2ZUA A;  4UOG A;  3DDI A;  2B8Q A;  1NCL A;  3FC9 A;  3FBC A;  1WKJ A;  3FKB A;  2BX6 A;  3ELH A;  3JS9 A;  1B4S A;  3FBF A;  1BUX A;  2AZ3 A;  4S0M A;  1NSQ A;  3MPD A;  1HHQ A;  4C6A A;  3BBC A;  3VGV A;  2HUR A;  4FKX A;  5C7P A;  1PAE X;  1KDN A;  1LEO A;  4CP5 A;  4HR2 A;  3VGU A;  1PKU A; 
#chains in the Genus database with same CATH topology
 5D77 A;  3EJM A;  1T9Y A;  2ZD1 B;  1WWH A;  5LSO A;  3VQS A;  4ZP7 A;  3HZG A;  1ZS6 A;  4ES2 A;  2HFU A;  3T1H F;  3HK2 A;  3R5A A;  4MK8 A;  3PYE A;  2YKA A;  1TFW A;  1RCX B;  4JI0 J;  5E3R A;  4N47 A;  2RDI A;  4F3M A;  3H8Y A;  2BRK A;  2R7Q A;  3TRG A;  4OHZ A;  1VHI A;  4G3I A;  3ETM A;  2RF2 A;  2FD2 A;  1X0F A;  4YS2 A;  2WW4 A;  1VRU B;  4XPC A;  3TQE A;  4DX8 H;  3HM9 A;  2OUG A;  1SC6 A;  4DPW A;  2UXC J;  2ALY B;  4QR0 A;  1KHV A;  1IQZ A;  2BKP A;  2ZBQ A;  2UUC J;  3DLL Q;  2ZUA A;  1RT7 A;  4DL4 A;  4DR2 J;  1RT1 A;  5F8I A;  5DQH A;  1UPM B;  3QGH A;  4L3N A;  4KTQ A;  2VBY A;  1RKJ A;  3Q23 A;  3M6X A;  5IWA F;  5B0A A;  2R42 A;  2GVD A;  2IBO A;  3IFE A;  4OI3 A;  2GNK A;  1JLA B;  3GII A;  3NLC A;  1RWX B;  1B99 A;  4TY9 A;  5DGB A;  2JNJ A;  3G86 A;  5BYR A;  5KOX A;  3QQC D;  4PQA A;  4CO1 A;  1NAQ A;  4KHP F;  2VIC A;  1WC6 A;  4FN5 A;  2HQG A;  4DPU A;  3Q24 A;  4A8O A;  2WVF A;  3EVM A;  1TKZ A;  2KT5 A;  2HNZ B;  2LA4 A;  3KUE A;  3A3N B;  4DV4 J;  3Q8S B;  2GIR A;  1GT8 A;  2YWW A;  1X5T A;  3N01 A;  3FRY A;  4DV3 J;  3C6T A;  3UN5 A;  3AAW B;  1VBY A;  2DIT A;  4KR0 B;  2K3I A;  1JWW A;  3FEX B;  1RK8 A;  2MQN A;  4QIW D;  1HBO A;  1R6Y A;  4JV5 F;  3G6X A;  3OW2 R;  3AA9 A;  4CIO A;  5J2N B;  1GMW D;  1IQT A;  2UU9 F;  2ASJ A;  1D8Z A;  1T7P A;  5HJX A;  3MMA A;  1GMV A;  3PX6 A;  1C1B A;  1JXE A;  2V67 A;  4NEY A;  3GMG A;  1TL1 A;  1GTE A;  4OYM A;  3QID A;  1YIT S;  3R6L B;  3AOB A;  2BJ7 A;  5BXI A;  1V9O A;  1XMO F;  1FTC A;  2FGC A;  3G71 S;  2X7I A;  3NS5 A;  3FK4 A;  2J6U A;  1T3O A;  2HAF A;  2XMA A;  5KT5 A;  4ZVE A;  3MOJ B;  4KH1 B;  1BY9 A;  1UVN A;  3BQ1 A;  1DUR A;  4ECW A;  4F0K A;  3P4U B;  4RW6 B;  1G3O A;  4PXD A;  2NUH A;  1W2B R;  2VOO A;  2C3Y A;  2VL1 A;  1VI7 A;  1KR4 A;  3I32 A;  4NLY A;  2LEC A;  4NCA A;  2M70 A;  4I69 A;  3MEC A;  4CH0 S;  1HHT P;  2C42 A;  2WB1 D;  4H54 A;  3AXM A;  3QZ8 A;  2QC3 A;  3FC9 A;  1CJK A;  2QZ8 A;  4OLO A;  2JHE A;  1OPZ A;  4I0W A;  4I2P B;  4Q8E A;  4P10 A;  4AXJ A;  2LMI A;  1I94 J;  4ICL A;  2R8K A;  4ER8 A;  1M5V C;  2ZH9 A;  2Y0B B;  7AT1 B;  1JB0 C;  2ZE2 A;  3BKT A;  4CLZ A;  4LF4 J;  1Y5L B;  3PW0 A;  5B0G A;  1RWM B;  2HRY A;  1S1T A;  2ALZ A;  3GV5 B;  2AGQ A;  3KLI A;  1OYE A;  3ENA A;  4OIX A;  4W90 B;  1HQE B;  1LFP A;  1S57 A;  1Q81 T;  2WHO A;  3DRY A;  4CO0 A;  3QT5 A;  2W9C B;  3IBC B;  5KT4 A;  1MN7 A;  2EBE A;  1ZA1 B;  2KXF A;  1XIQ A;  3DDN A;  4DX5 A;  4JV0 A;  1WEY A;  4K50 A;  2B7B B;  2C2N A;  1SKW A;  2P8I A;  1OIA A;  2VG7 B;  4BLG A;  3EVW A;  4NXN J;  3NY0 A;  1HW9 A;  3ONQ A;  3PJ9 A;  3CUL A;  4DDF A;  2HYI B;  2J0X A;  4P2S A;  5KG0 A;  1SI9 A;  1RTH B;  1K8A T;  3K59 A;  2MB0 B;  4MFB B;  1UWB A;  2YNH A;  4QWA A;  3CJQ A;  1G4C A;  2ZBP A;  4DV6 J;  4LQ3 A;  4M94 A;  2OSQ A;  5J2M B;  3QFH A;  3K8W A;  1C1C A;  2UUT A;  3M2V A;  5KFW A;  2JVR A;  1L3S A;  5KFT A;  2HK3 A;  2XMW A;  1ZM9 A;  4WKY A;  2CPD A;  5HI7 A;  2DCL A;  4UF4 A;  1FRM A;  1N54 B;  1FHT A;  2A2C A;  3R2C J;  1U8S A;  3HDS A;  4MYT A;  1VRT A;  1V5I B;  4TY8 A;  4PG8 A;  2CA9 A;  4Z2X A;  3FCH A;  3FCV A;  4LBI A;  4RNH A;  2KHC A;  3NXZ A;  3MEK A;  3CMQ A;  4ELU A;  4JI2 J;  3PX0 A;  4LF7 J;  5IV4 A;  3EYZ A;  1YKW A;  4H4O B;  2BJD A;  4EUV A;  1RT2 A;  4LRF A;  3TX0 A;  5HO4 A;  2WSC C;  1VDH A;  3UDV A;  2DGQ A;  1WEL A;  3PRB A;  1S6Q B;  4LSZ B;  3S1T A;  3H0P A;  2CRL A;  2LP4 A;  1ZH5 A;  4KO0 B;  1SB6 A;  2HVZ A;  5BR8 J;  4LF8 F;  2M2B A;  3FBF A;  4DR4 J;  1YRX A;  1HI8 A;  3EX7 B;  2VZ9 A;  2GJ2 A;  1N5Y A;  3QJL A;  5F8H A;  1MW7 A;  1VQL S;  5B0B A;  2NSC A;  2ZH8 A;  5B0D A;  1BMQ B;  2DHH A;  3J80 Y;  3V2U C;  2M8H A;  4PG4 A;  2ILY A;  3M8Y A;  2V4R A;  3PG9 A;  4OZ3 A;  3X3U A;  2WON A;  4AL5 A;  2DR8 A;  1ZZF A;  3N0V A;  1U49 A;  1CC7 A;  1GEH A;  2P6S A;  3BH6 B;  3RB0 A;  5HSP A;  2JFD A;  1VLY A;  2HKE A;  4LF5 F;  5KG5 A;  1Y9O A;  3H42 A;  2CQB A;  3GP9 A;  3RBX A;  4CYU B;  4DZ6 A;  3M6U A;  1QE1 A;  1WUU A;  1IWG A;  4I7F A;  4HKQ A;  1S0O A;  2Y9H A;  4M5D B;  4I68 A;  2BDP A;  2UXD J;  1FD8 A;  3NWR A;  5M2R A;  2XMV A;  1HQ2 A;  3M7V A;  3H5X A;  4F26 A;  4ZCM A;  1ZM2 A;  1SCJ B;  1X4C A;  3OL9 A;  1U8W A;  4HI2 A;  3K5O A;  4TU8 A;  4RNO A;  2QRR A;  2IM1 A;  2DYA A;  2QL7 B;  2Q6B A;  3ILO A;  3V6J A;  1RT3 B;  2YX4 A;  2OI2 A;  1PG5 B;  2F4V F;  4EZ9 A;  3OTO J;  2E5I A;  2J8A A;  3PEH A;  1MU2 A;  4DFM A;  4B3O B;  3AD7 C;  1FRX A;  4OL8 A;  3EXY A;  2B9E A;  4OHX A;  4ZVF A;  4TU9 A;  2ERR A;  3WQP A;  3IS9 B;  4UZC A;  5HMX A;  3I9Z A;  4F02 A;  4O0N A;  3NP5 A;  2GMJ A;  4B9M A;  1SIZ A;  3IG1 B;  4FYW B;  4GKJ F;  3GIR A;  2MZ1 A;  4KFB A;  2Q66 A;  2VG5 B;  3NCP A;  4YP3 A;  2LVW A;  3WBZ A;  4KT0 C;  2V2Z A;  1U09 A;  2R7O A;  5GMK a;  3I0R B;  4JI4 F;  2AF6 A;  4YY3 J;  4LF1 A;  3P6Y C;  4RWW A;  3UDC A;  4PWW A;  4ERD A;  1IKX A;  1X5O A;  5DQI A;  3BDP A;  3A13 A;  1FKP B;  2KI2 A;  2IDE A;  3MGJ A;  3HHE A;  5DM6 Q;  3MAQ A;  1VIX A;  2K2P A;  2IRX A;  1HNX F;  3CD6 S;  3J7Y I;  5D3G B;  3KK2 B;  1NK6 A;  2RS8 A;  4A8Q A;  2V2V A;  4Y2K A;  2J9C A;  1JJ4 A;  2VJV A;  3CPW R;  3ET6 B;  2DH8 A;  3FFI B;  3CCQ S;  1N0V C;  2VPX B;  4PAA A;  3QRR A;  5ETQ A;  1K1S A;  2ZVI A;  1X7V A;  2Y1I A;  3PW7 A;  2LU1 A;  1ZPV A;  1HYS B;  3RBZ A;  2V69 A;  3BGF A;  1BHN A;  3OFE A;  3EVO A;  5J1E A;  2CQ3 A;  2PA3 A;  3DOM B;  4CH7 A;  4OJ3 A;  1KSP A;  1B64 A;  2WW8 A;  1T3N A;  1QVF R;  3DRX A;  3MUM P;  2VBX A;  5A76 A;  4RZR A;  5ETK A;  4YB5 A;  1T9X A;  3E3X A;  2XZD B;  3T1Y J;  4MIB A;  3K58 A;  2EK6 A;  2DNG A;  3F0N A;  4FVC A;  4YHH J;  1U1K A;  2IJF A;  2XTJ P;  1U0H A;  3D6F B;  1MMN A;  2B9W A;  1FEH A;  3PW4 A;  1NK8 A;  4ATN A;  2RQ4 A;  1S6P A;  5AXM A;  5KT3 A;  1ZM3 A;  3D0G E;  1APS A;  1SUQ B;  4CLW A;  1EAY C;  3KG4 A;  3BYP A;  2DBB A;  4QWC A;  2EVZ A;  1S6O A;  1M90 T;  3R5J B;  2ZM6 F;  2EFO A;  1U2C A;  1XK8 A;  2J7K A;  3J81 j;  2FLO A;  3FZB A;  4ZVR B;  2ZKT A;  1FER A;  1M1H A;  1FES A;  2HGL A;  3J80 U;  2EG2 A;  2G13 A;  1NHV A;  2RHQ B;  2FHM A;  3KK1 B;  2YTC A;  1KVK A;  1TUW A;  4DEZ A;  4N8O A;  3E01 B;  3BN7 A;  2R2S A;  3LAM A;  4TXS A;  4ED1 A;  1F9H A;  3P5T L;  2OHD A;  4RBU A;  3V6H A;  2FZC B;  1KKH A;  1YZ7 A;  2NRE A;  2OEM A;  3Q8U A;  4PWU A;  4Q45 A;  4F3O A;  1R3N A;  1N5Q A;  4KJI A;  3BBB A;  3DLK A;  1TV6 A;  5IZH A;  3C14 B;  3LPE A;  3CWJ A;  3MM6 B;  1WF0 A;  1R8P A;  3D0H E;  1WDD A;  1J27 A;  3DRP B;  3SDE A;  3R5G A;  2GIQ A;  3ZZR A;  2QSW A;  3PIP Q;  1S4F A;  2QG9 B;  3JB9 k;  2ZOF A;  2WOM B;  3SSS A;  3C8Y A;  5D78 A;  5KFS A;  4P74 A;  4X64 J;  4YR3 A;  1RA7 A;  2MKS A;  2YX7 A;  3RZA A;  4CLU A;  4IH6 A;  2LKZ A;  1VK8 A;  2I1R A;  1QAX A;  1L3K A;  2GML A;  1EET B;  1NK7 A;  4C0O C;  2CNK B;  4EMD A;  4C3M A;  5L39 A;  4ZA1 A;  1C2P A;  1TL7 A;  3H2L A;  4WCE Q;  3DLH A;  4I2Q A;  2C1E B;  1UVM A;  4JV2 A;  2HIY A;  3DLB A;  2GVZ A;  4RW7 A;  5CA5 A;  4NLS A;  3G96 A;  3WX8 A;  2FDN A;  1WC4 A;  4KH0 B;  4K4Y A;  5KFG A;  1HQU A;  1WOR A;  2XEX A;  3TZW A;  4O0I A;  2AYB A;  5E5N A;  1YLX A;  5L8R C;  4MKV A;  3KLG B;  2ZH6 A;  5KFD A;  3D54 A;  4GMK A;  1Q82 T;  3N28 A;  2AX1 A;  4A46 A;  1TK5 A;  4URS A;  5F8M A;  2AYE A;  3PR5 B;  1KC8 T;  4OZJ A;  4DL0 C;  5LJ5 Y;  1QSS A;  2U1A A;  3OXF A;  4OYB A;  1AFI A;  1B7F A;  2L9D A;  2KVI A;  1TU0 B;  1RAG B;  3A8E A;  2H4Y B;  3CJK B;  3T19 A;  3W9J A;  3M2R A;  2PE8 A;  3WC0 A;  1VJQ A;  4NZ6 A;  5KFZ A;  2JDJ A;  3R6G B;  4DX6 A;  3UR3 C;  2OD6 A;  1M1K T;  2W01 A;  3C15 A;  4IFY B;  3DYA A;  4WWS A;  5CAA A;  4CTA A;  3L7U A;  1MSW D;  3LP1 A;  3HVT A;  5DG9 A;  3MHY A;  2JFK A;  3IC1 A;  2BR0 A;  3CJR A;  4OV1 A;  2HHV A;  2W24 A;  1WC5 A;  4H4M B;  2R7W A;  2X1G A;  2OPR A;  1DFD A;  1S48 A;  2MSS A;  1A7G E;  1HKA A;  2ZWO A;  4X66 J;  3MCO A;  3NGU A;  2HHH F;  2E5H A;  4CWB A;  1KVI A;  1D3W A;  2HND A;  5HQM A;  1LWF A;  5L1L A;  1H98 A;  3DN9 A;  4YQW A;  4NLT A;  2BKN A;  2FVR A;  2VA3 A;  1FK9 A;  2J9D E;  2CQ2 A;  4M5M A;  5J1N A;  2QLF B;  1J5O B;  2JSX A;  1RE1 B;  1KP6 A;  3W2V A;  3PV8 A;  4F3Q A;  3ZZP A;  2RQM A;  3CSK A;  2BAN B;  2F1F A;  4UUX A;  4U67 Q;  4Y2C A;  3FVY A;  1JLG B;  4O3R A;  1PYT A;  2NZC A;  4XPE A;  1T8E A;  3FZ2 A;  4Y34 A;  3OLA A;  2AU0 A;  4A8F A;  2DNZ A;  2RB7 A;  1IBL J;  4F4Z A;  1TKX B;  1SV5 A;  1WG4 A;  1FJG F;  1LWE B;  1RZM A;  2PO4 A;  5HMZ A;  4JP8 A;  2DGX A;  3NOG A;  2AHO B;  4CRJ A;  3W1Y C;  3I9V 9;  2EXU A;  2HQI A;  4PXE A;  3J7Y U;  3HF5 A;  1NJZ A;  1H2T Z;  3KKF A;  5K14 B;  2OPP B;  3B78 A;  4JI8 J;  5F3Z A;  1NB7 A;  4NRU A;  3LAK A;  1U1M A;  4ZJL A;  2GC8 A;  1UMJ A;  5D0H A;  2NPI A;  4DF8 A;  3RAM A;  2AMC B;  2HK2 A;  3DRR B;  4ZLJ A;  2BBE A;  1SXL A;  2VFU A;  4WK1 A;  1S4E A;  3MPV A;  2P9C A;  4QYR A;  1VRU A;  2QA4 G;  3ULH A;  2XY6 A;  1CEZ A;  3DXB A;  2W25 A;  3KWM A;  4ED5 A;  2BZ2 A;  2CG4 A;  2KYZ A;  4MMO A;  2Z2Z A;  5KFB A;  1M5O C;  4C98 A;  2MJN A;  2VC0 A;  3HPO A;  4BHQ A;  1F5C A;  3CDE A;  1XN9 A;  3IGN A;  2IVM A;  1Q8K A;  4DN9 A;  2KFZ A;  2WTF A;  4JYA F;  2CDR B;  2F40 A;  1FI4 A;  4ID8 A;  1RYR A;  5LXR A;  4Y00 A;  2FHJ D;  1QLN A;  2AJF E;  1JLA A;  1R8H A;  2OEJ A;  2UVU A;  4K0K J;  2FVP A;  2BOP A;  1YJT A;  1DLO B;  5I3U A;  3AOC A;  2FHK A;  4OFZ A;  2FY1 A;  4GO5 X;  1UET A;  3MTJ A;  3IM9 A;  4DFK A;  2IJR A;  4XTT A;  3QLH B;  2HNZ A;  3HO1 A;  2OEK A;  3W9I A;  2GQQ A;  4ZVQ B;  3PEJ A;  2DPI A;  1KTV A;  1FJE B;  1NJX A;  4D3G A;  2HBY B;  2V4J B;  2G1H A;  4A8X A;  3CJ3 A;  4DLE A;  1H73 A;  5AJ3 F;  2V8H A;  3KHL A;  3D0I E;  3A3P B;  4DG1 B;  2O67 A;  3AQP A;  2KTQ A;  2OIH A;  3BZQ A;  3GFY A;  1URR A;  3V4I B;  2ZH3 A;  2RDJ A;  1H3D A;  2DNM A;  5J2N A;  1GQE A;  4EZ6 A;  4U7C A;  1NJY A;  2HZC A;  4LT6 A;  1VLO A;  4QU6 A;  4IRK A;  4P2M A;  1YIJ S;  5FLX Y;  2BOA A;  3TVK A;  3ENQ A;  4HVZ A;  4P7T A;  2M4M A;  4XO0 A;  2PI4 A;  4DL6 A;  3SSQ A;  5RUB A;  4J9Q A;  1O6X A;  5DDP C;  2DGV A;  4ANC A;  1NND A;  5CYQ B;  4O44 B;  2CFX A;  3U27 A;  4PUO B;  5KFK A;  4ZMM A;  2Y0S D;  2MKC A;  3GIJ A;  3PW5 A;  4WIQ A;  5LSL A;  4J7C A;  3CCR S;  2HHT A;  1FEE A;  2I6W A;  1Q4R A;  3CCW A;  2Z57 B;  4RW6 A;  2BV3 A;  2G2Y A;  4OZ1 A;  4A8W A;  1IKY B;  3OFF A;  4LQ9 A;  2VB6 A;  4DV7 J;  1OYD A;  2CQ0 A;  1WEX A;  3NWG A;  1NK9 A;  5H9E K;  1FDB A;  3MFI A;  2DPJ A;  4U6P A;  4ELV A;  2C2E A;  3Q86 A;  3LOU A;  4CLS A;  4LRE A;  3KLH A;  2FQQ B;  2ZZN A;  4JI7 J;  1SJ4 P;  1Y3K A;  1RB0 A;  4I2P A;  2RE1 A;  4EEY A;  2H5E A;  1KQF B;  2VKR A;  2UUA J;  4ZCK A;  2ZHA A;  5C25 B;  1BQM B;  3V5R A;  2HHU A;  2WVE A;  4JI3 F;  2V34 A;  3MR3 A;  3CED A;  1HHQ A;  3S7R A;  5HP1 A;  2ASD A;  3THV A;  3AA8 A;  3GYN A;  4JI5 J;  2GW8 A;  2G2Z A;  4CP5 A;  2CPI A;  4B3M F;  1MRO B;  1IBK F;  1N32 J;  3OVA A;  3DXS X;  1HQE A;  2C2K B;  3K5P A;  3JYT B;  2D3O 1;  3UD3 P;  4PPZ A;  2DXE A;  4HHU A;  3KMQ A;  2W9C A;  2AKW B;  4WBF A;  5KG3 A;  4AUK A;  1PJ7 A;  4DU8 A;  1LW2 B;  4GKK F;  1DQA A;  2MQP A;  4KHM A;  1YJ7 A;  5JMN A;  1UAW A;  2QIF A;  3GFX A;  5IT9 Y;  1YSJ A;  3BV8 A;  4U8Y A;  3FRZ A;  2ZJQ Q;  4NML A;  2OEL A;  2AD9 A;  3UCZ P;  2V4Q A;  2GS8 A;  4WFX A;  1OY6 A;  4WP9 A;  2CKW A;  1T9V A;  1S49 A;  1IR1 A;  5A8W B;  4MFB A;  3QGG A;  2BRL A;  5J2M A;  3ADA C;  3ISN C;  3PX4 A;  2GMH A;  4LRA A;  4H4K C;  1P1L A;  1RWO B;  4PZV A;  4I6A A;  2DH9 A;  2W7O A;  3BF4 A;  3K5M A;  5CXT A;  4KGM A;  2IC3 B;  4Q5V A;  5HJY A;  1TL3 A;  2Q1L A;  3RAX A;  4E0D A;  1FKO B;  3NL0 A;  4NCG B;  2XO6 A;  2NPF A;  1NDC A;  1DJ0 A;  2FB0 A;  4FYD A;  4EYI B;  4WYW A;  3HT3 A;  3NGT A;  1OO0 B;  3QGI A;  3ZZ0 A;  4KE5 A;  2DNH A;  1RHM B;  3ISZ A;  1IKW B;  3GV8 B;  4H4O A;  1JKH B;  4C8M A;  2BJ8 A;  1C0U A;  4ZVS B;  2JOQ A;  3B6B A;  2J8S A;  2J6S A;  1HWK A;  1M5K C;  3TP2 A;  1MWY A;  1FX4 A;  1N6Q B;  2WSE C;  1S6Q A;  3SCJ E;  3NGS A;  2MQ8 A;  4KO0 A;  3NAI A;  2FLN A;  1OWX A;  2N4D A;  2UUB F;  4C8K A;  1O51 A;  2EK1 A;  1TMJ A;  4OMF G;  2V2K A;  3RRH A;  4EI2 A;  1TKD A;  1JJH A;  2UXB J;  8ATC B;  3O8W A;  4UQG A;  3CDA A;  3LH2 S;  2C22 A;  4DV1 J;  1VJW A;  3ZO7 A;  2MZT A;  4KV8 B;  3KJF B;  2QN6 B;  2FLP A;  1FD2 A;  1LXJ A;  1YG0 A;  1XR7 A;  4ZP8 A;  4CYU A;  3T5K A;  4P9S A;  3BBF A;  2F3J A;  3FBB A;  4MAK A;  1F5B A;  1WKL A;  1NME B;  4QWB A;  5HQL A;  5LMN F;  2B9Y A;  4DR3 F;  2EI5 A;  2BE7 D;  2NQP A;  1QUP A;  4ZPW R;  3EM1 A;  3TVY A;  2X1F A;  1C4C A;  2BM1 A;  5C5J A;  2ROP A;  2V9W A;  1V3S A;  3G8Q A;  1RT6 B;  2XUL A;  3HKZ D;  1A6L A;  4ZPA A;  1F9E B;  2F9D A;  4YR2 A;  3I4H X;  1I1G A;  2DHS A;  1NJW A;  3VF0 B;  4J9K A;  4B3O A;  3W61 A;  4LR7 A;  4RPF A;  4TU7 A;  4CT8 A;  4ZVU B;  3S01 A;  4FYV B;  2MQO A;  3DI6 B;  4UOH A;  5KFI A;  3PDN A;  3IS9 A;  1U02 A;  2YKO A;  4WYL A;  1TUG B;  2VH7 A;  3IG1 A;  1QSY A;  3AFG A;  2HQF A;  1FXR A;  2VG5 A;  1S97 A;  4ZIT A;  2B4V A;  1AUS L;  2GQ2 A;  2YH0 A;  3M8S A;  2JEJ A;  3E2E A;  4EGL A;  4GO7 X;  2V68 A;  3NG8 A;  4LRD A;  1YWX A;  2DRD A;  3I0R A;  1X4D A;  5A2Q Y;  1UVJ A;  3F56 A;  1UA1 A;  1D8Y A;  2VJU A;  5D4N A;  1GTH A;  4DUZ J;  1FKP A;  3MAA B;  4KAI A;  2QL5 B;  2HFS A;  3UVJ B;  3HD1 A;  4E98 A;  3LO3 A;  4LFA J;  3HSG A;  2MXY A;  5D3G A;  4TQS A;  1R43 A;  3AJ2 A;  2MY8 A;  3TO8 A;  2UXC F;  3X1L B;  2EKY A;  1ARO P;  1GMU A;  3CC7 S;  1FJ7 A;  2BW7 A;  3ET6 A;  1WTB A;  5KFY A;  3FFI A;  3DOL B;  2UUC F;  5IT9 U;  2BE2 B;  2KVQ E;  3ENW A;  3RR7 A;  4RLE A;  5IC4 B;  1VBK A;  2RIJ A;  3KHR A;  2MLX A;  2UV8 G;  2G2O A;  2C2D A;  1U2F A;  5DJB A;  1S0M A;  5EWG A;  3IRX B;  1YZ6 A;  2UP1 A;  4NA1 A;  3QMQ A;  1FVS A;  5CYM A;  4Q2L A;  5EX0 A;  4Y0F A;  3HLU A;  2YNI A;  4ZN1 A;  4NLR A;  2JEG A;  2DNN A;  2QLJ B;  2QJ3 A;  1CJV B;  2RRN A;  4C48 A;  4J9M A;  1ZTT A;  2IVY A;  3UR0 A;  2GQC A;  3W62 A;  2WAQ D;  2XBP A;  3QT8 A;  4WE1 B;  4RW8 A;  3PR4 A;  2VDH A;  4FKY A;  4YB6 A;  3KOA A;  2BYC A;  3CJ4 A;  3DC2 A;  2L41 A;  1LFW A;  1RSC A;  3L7O A;  4Y2I A;  4J9P A;  4DPY A;  4UST A;  4DR1 J;  1QUV A;  1JLB A;  5A6W A;  3Q8V A;  5GAH I;  4DV3 F;  2ADC A;  3T6B A;  3CE8 A;  1JLQ B;  2ZNY A;  1VIS A;  3R1H A;  5CZX A;  4ZDN A;  2MKH A;  3JXO A;  3HMJ G;  1SUQ A;  1YRU A;  3RW7 A;  2V8V A;  4IH7 A;  4ITS A;  4FS2 A;  3T1H J;  3MM7 B;  5BJR A;  3ZNU A;  3M1V B;  2XS5 A;  1RAI B;  1UW9 A;  4Q0B B;  3CCT A;  2XSF A;  4MT1 A;  3C46 A;  3N6L A;  1EKR A;  2PN6 A;  3D4J A;  4LUB A;  3C3L A;  1Q1K A;  3BRE A;  4NA2 A;  2R7V A;  2OPQ B;  1X4G A;  5FDL B;  4WZQ A;  3AY0 A;  3KMS A;  1CPZ A;  4OHY A;  3PRD A;  1RXO B;  2RDD A;  2OJ3 A;  1Y4Z B;  2M88 A;  2MKI A;  5HVG A;  3E01 A;  4LFC F;  4QCL A;  4YFU A;  1D1U A;  3MUR P;  4NL5 A;  4DLG A;  3GCX P;  3GG1 A;  1S6U A;  2OMO A;  1JQG A;  1NPK A;  3VGS A;  2GX8 A;  5THW A;  4GVL A;  4EYH B;  1HWL A;  3OV7 A;  1CJU B;  4CLK A;  1XWL A;  3AOA A;  1S7H A;  5IWA J;  2RRA A;  3K8V A;  4LR8 A;  1XBW A;  4ZHR A;  1SC4 B;  3CJ8 A;  2X3G A;  3MM6 A;  3RB4 A;  5KT6 A;  1UFW A;  3RR8 A;  3DRP A;  4TYA A;  1X4E A;  2F8H A;  3H40 A;  4KHP J;  1HNV A;  1I94 F;  5D0E A;  3UFC X;  5DM7 Q;  4JI1 J;  3CCM S;  4ZCI A;  3M6W A;  2E1R A;  4LF4 F;  3M8Q B;  3PTW A;  1T05 B;  3D7S B;  1HWJ A;  2N4C A;  4GRS A;  3GCW P;  1SJR A;  2W2M P;  4PKD B;  3DOK A;  2IM2 A;  3RRK A;  2IMO A;  3VZI A;  4RKU C;  2AP6 A;  3JQJ A;  1K0V A;  3ENV A;  5M2P A;  3W5Z A;  1DTT B;  4X84 A;  5MAO A;  2YQ0 A;  1M5P C;  3BR8 A;  1D09 B;  4BC7 A;  3GYX B;  2ATC B;  3MDF A;  4PG5 A;  2QSF A;  5A2Q U;  3UCU P;  2LQ8 A;  3KYL A;  4NXN F;  4C0B A;  3POT B;  4E8U A;  1LKZ A;  1S0N A;  1UVI A;  2W9B B;  1N5V A;  3I96 A;  1OY9 A;  1AT1 B;  2CWK A;  5A6P A;  4KC5 A;  3AHP A;  1PIE A;  5B7W A;  4O3N A;  3DHX A;  3L09 A;  2XLJ A;  4OYZ A;  5ETS A;  2EFN A;  1ZOT A;  3JTP A;  4F4X A;  2HHP A;  2CNO B;  2KRB A;  2QT7 A;  1B0T A;  2OKQ A;  2O5D A;  4C97 A;  3KHG A;  1QAJ A;  2IIH A;  3BN4 A;  3OUY B;  3PFO A;  1PBA A;  4IFY A;  2XS2 A;  3GSI A;  1CUL B;  2EKN A;  2FLL A;  1FFG B;  1WEZ A;  2A10 A;  5JVG Q;  3FJ2 A;  4QPX A;  1N8R T;  1T03 A;  5KFV A;  3UPF A;  1E6V B;  4DBQ A;  3ZTR A;  4H4M A;  4FXW A;  4CCH A;  3HFZ B;  3NMR A;  4JI2 F;  3DU6 A;  4LF7 F;  2JLF A;  2A2D A;  3CO9 A;  4DQI A;  3JAM Y;  2COL A;  1NHK L;  1FA0 A;  4WTY A;  2BUN A;  3G82 A;  1EAR A;  2Y1L B;  1ZYQ A;  3PY8 A;  5FJ4 A;  4OZ0 A;  2JC1 A;  4TQR A;  4OI1 A;  1TKT B;  1HHS A;  1B0P A;  4KBI A;  1N0U A;  2NZ4 A;  4I56 A;  3OSP A;  3F73 A;  4LF9 J;  2HAI A;  2RML A;  3DLE B;  2Q43 A;  3BO4 A;  4DR4 F;  4I6Y A;  2VQE J;  4JOU A;  2BJE A;  1J5O A;  1FWL A;  1J5E F;  3SI8 A;  3QAT A;  1XER A;  3TWZ A;  2OD4 A;  1S9G B;  3HVW A;  3KJQ B;  1FKA F;  3FMW A;  2CQI A;  4ED8 A;  2DRA A;  2IAJ B;  4RW4 B;  3ZFV A;  3VAI A;  2K06 A;  3VV2 B;  1JLG A;  2W2P P;  4OZN A;  2IJN A;  1RQ0 A;  4YDD B;  4NRT A;  4B9T A;  3UD4 P;  3ZC4 A;  4DS4 A;  4F04 B;  4IO1 A;  4DZD A;  2VBZ A;  4QWE A;  4CT9 A;  2XYH B;  1FX2 A;  2ZC4 A;  2UUW A;  1U48 A;  2A1B A;  1W26 A;  1ZPW X;  1TKX A;  2Z2L A;  3RAQ A;  1LWE A;  2AEJ A;  4EFA C;  2P9G A;  3EE3 A;  5F8N A;  3N6N A;  5E3A A;  2UXD F;  3M2U B;  3CD7 A;  4M5G A;  4KRW A;  3NRB A;  4U7U D;  4GC7 A;  2RKI A;  2BJ3 A;  4K2X A;  5D0G A;  2P9E A;  1JIH A;  1FE0 A;  4ZN3 A;  1T0T V;  4A4J A;  4KKO B;  1PC4 A;  5E3C A;  3VAL A;  2HRT A;  1RTD B;  2VD3 A;  1VQP S;  3TI0 A;  2BAB A;  3G2X A;  4RJV A;  5K14 A;  1Q0N A;  1HIY A;  4ZP9 A;  2OPP A;  1U25 A;  2N7Y A;  4B9L A;  5E2Q A;  5G4D A;  4XAK A;  4BDP A;  5J2Q B;  4NI2 B;  1RU2 A;  4HT5 A;  3OFG A;  3MPD A;  4OJH A;  1O8B A;  3LWL A;  3AD9 C;  3DRR A;  1PAE X;  3VAK A;  4EU0 A;  2CPJ A;  2HPU A;  1RBO B;  5IFM A;  4DF4 A;  4P6Q A;  3FSX A;  4WII A;  2WVC A;  5A8R B;  2E9Z A;  2NR0 A;  2B0G A;  4R5P A;  3FBE A;  1C0T B;  2O01 C;  4YY3 F;  4LF8 J;  1HWU A;  3D2W A;  3OXL A;  1Y0H A;  3OR2 B;  3FUY A;  3DLG B;  3UD5 A;  4LSL B;  3NGR A;  2ZJP Q;  1RWK B;  4WFZ A;  5GAH U;  2ZC3 A;  4LIR A;  2VG6 B;  1M5S A;  5DG8 A;  2D3U A;  2HFZ A;  4XDC A;  1GXT A;  5HN0 A;  1RWN B;  1SJQ A;  3KNA A;  3T9N A;  3MOZ A;  3OXG A;  3MMC B;  1EQM A;  2HBR B;  1AZS B;  4FS1 A;  4DN0 A;  1UA0 A;  3V4M A;  3U1M A;  4JI6 F;  2GJI A;  4NXM J;  4LRB A;  4IFV B;  4DR6 J;  1RAF B;  2KZZ A;  3N9U C;  2CUY A;  3LGM A;  2BMB A;  4U96 A;  2R2U A;  4I4B A;  1XNR J;  2HUR A;  1S1U B;  1U2R A;  4WFA Q;  1GNK A;  3TVZ A;  4WP3 A;  1WC3 A;  1UJ5 A;  4Q7A A;  3KDN A;  4AXI A;  3CD0 A;  2DGW A;  4NLW A;  3QLH A;  3K2Y A;  2KDO A;  1EHW A;  4N7T A;  3M9N B;  2JRS A;  3AJ1 A;  2VBW A;  2V4J A;  1TVR B;  4ZIV A;  4X4Q A;  2PMH A;  3LQV A;  4ZVH A;  1D0E A;  2H65 B;  3JTN A;  3JSM B;  4P72 A;  1RLD A;  1RTZ A;  1QD1 A;  3U02 A;  1UZH A;  2KM8 B;  3T1Y F;  1PAU B;  5LMU J;  2ZZM A;  2F4V J;  2XSJ B;  5IS2 A;  4DFJ A;  4DG1 A;  2CDQ A;  4YUD A;  4L73 A;  2BAC A;  4YHH F;  3I5C A;  1FT8 A;  1U0S A;  3US5 A;  1U1L A;  1IVZ A;  5DLF A;  1HD0 A;  2M9K A;  3I82 A;  1PIL A;  5IT0 A;  4A8M P;  3JAM U;  1ROF A;  1FRK A;  4NZ7 A;  1Y00 A;  2C2O B;  1XMQ F;  1NLK L;  2J7W A;  3KUG A;  1NEE A;  4ELT A;  1NKB A;  4HTJ A;  4JI4 J;  3W65 A;  4X4O A;  5CYQ A;  3PXG a;  3K5L A;  4O44 A;  1YJ9 S;  5JVH Q;  4PUO A;  4M1K A;  5DET A;  4ED0 A;  2DNR A;  3M9O B;  4F50 A;  3KK3 B;  1OS5 A;  4LR9 A;  1BGX T;  4HLB A;  2Y8W A;  1XR6 A;  4LBH A;  2KXN B;  3GJS B;  1WNE A;  4USJ C;  3FCW A;  4DHV A;  1S10 A;  2AEM A;  4WJB A;  1PC5 A;  2GGP B;  4LF6 J;  4C11 A;  3NBP B;  3PO4 A;  3BGR B;  2D1C A;  4UOF A;  5CD4 A;  4B3R J;  4BBY A;  4ES1 A;  1S0V A;  2J5A A;  2R8I A;  2M7S A;  1QSL A;  5DGA A;  2HNY B;  1N5S A;  2MZQ A;  4I1T A;  2HW3 A;  5C25 A;  1BQM A;  3SBM A;  4LSN B;  4DMZ A;  2B8P A;  1JJ2 R;  4UY8 T;  3F44 A;  2UVR A;  3FNN A;  1HR0 J;  3HVR A;  3CF5 Q;  5EN1 A;  1MRO A;  2F8E X;  3HSZ A;  2HQ3 A;  1U1R A;  4X64 F;  3JYT A;  3EGW B;  2EEY A;  3IBW A;  4YDX A;  2AJ0 A;  4Y3C A;  2HIQ A;  1DTQ A;  1KOO A;  1F60 B;  4B08 A;  2MMY A;  3GFH A;  6FD1 A;  3C6T B;  1SH3 A;  1JXL A;  2VA2 A;  1VS3 A;  1T94 A;  2JVO A;  4DSF A;  5E7O B;  2KM8 C;  5DG7 A;  3BPD A;  1U45 A;  4ECQ A;  2FGO A;  2XI3 A;  3MEG B;  5KFJ A;  3MMA B;  1IJE B;  1Q79 A;  4NPO A;  1NSP A;  5SUH A;  4XK8 C;  1TL1 B;  2DNO A;  1B70 B;  3MR2 A;  5B0F A;  3TAM B;  4C8O A;  2R8J A;  2IC3 A;  2J6T A;  3TAQ A;  2RIL A;  5IV3 A;  1T95 A;  2QFJ A;  1FKO A;  2F8M A;  5A8K B;  5E0O A;  2HFO A;  1NM2 A;  2NLW A;  3CDU A;  2WCX A;  3P45 B;  4OZ2 A;  2I8E A;  1KHW A;  2JH3 A;  3N5B A;  5CHC B;  2YWE A;  2OSR A;  2R2T A;  3B4M A;  1IKW A;  3UN2 A;  1F3V A;  3DKD A;  3HT0 A;  2RUG A;  2B4O A;  1JKH A;  2FVS A;  2HLT A;  4O3Q A;  3MEC B;  4HYK A;  3H4D A;  4WP8 A;  2PFD A;  1N6Q A;  2DTJ A;  3FSY A;  3TW0 A;  1VGY A;  2BW2 A;  1BQX A;  3GJT B;  2YH1 A;  2XGQ A;  1RAH B;  5KFP A;  2YWF A;  1KFS A;  4DR5 J;  2VFS A;  2YQ1 A;  2XC9 A;  3UQS A;  3KUH A;  3QPI A;  4D3H A;  4X66 F;  1N34 F;  2AJQ A;  2ZE2 B;  4PYA A;  4K4V A;  2HZA A;  2O3D A;  4WXW A;  4ID5 A;  1S1T B;  3ILJ A;  1RWV B;  4B3T J;  3PYG A;  3M05 A;  3QNW B;  2HG4 A;  4KV8 A;  5HMY A;  4ZLP A;  3ELH A;  4ZVP B;  1ELO A;  1IM4 A;  1WSV A;  4UW2 A;  2PT0 A;  2CPY A;  3DM2 B;  4OLP A;  4OI0 A;  4K4X A;  3C19 A;  2B51 A;  3W5X A;  2QTW A;  2WBM A;  4ALZ A;  1U6F A;  5D15 A;  4DV2 J;  1NK5 A;  2PMW A;  2JLG A;  2DY9 A;  5KG6 A;  3ZXW A;  3I5B A;  3I55 S;  1SVD A;  1HMV A;  5HBM A;  2AGP A;  1IR0 A;  4HT7 A;  3SV4 A;  3ITH A;  2CZ4 A;  5DLG A;  4X62 F;  3NCR A;  2CPH A;  2LDI A;  3M2V B;  4R8U B;  2J7U A;  2FJW A;  2P2C B;  3QO9 A;  4ZJQ A;  1TMM A;  1EIY B;  3DI6 A;  3CJT A;  3DRS B;  1T11 A;  4U7U K;  4OX9 J;  4FDF A;  2HGN A;  5EWF A;  4DPX A;  3QIP B;  2VFR A;  4DV0 F;  4NMX A;  3HZE A;  1RAJ A;  2PGC A;  2RSQ A;  3Q8R B;  3W63 A;  2HZV A;  2NSB A;  2OFG X;  3FBC A;  3FEY B;  2IMW P;  4MTP A;  5GAG I;  1TQL A;  4Z7C A;  1WOS A;  1TFY A;  5H9E J;  4ZPC A;  3I0S A;  5AXN A;  4N77 A;  5KFH A;  3FQL A;  5IT4 A;  4K4U A;  2MDA A;  4DFP A;  4W4M A;  4B17 A;  1KVJ A;  1LWC B;  4C0H A;  1S12 A;  2D3Z A;  3ZTQ A;  3R27 A;  4P52 A;  3DMJ A;  1CLF A;  1SL0 A;  3OJS A;  3MAA A;  4NA3 A;  3QSY B;  5D4P A;  1FXD A;  4K59 A;  5KT2 A;  2HHH J;  5LM7 E;  1FTR A;  1YJR A;  4K4T A;  1ZM4 A;  3VAJ A;  1KQS R;  1VMB A;  3RG6 A;  2MKY A;  3DOL A;  4R0J A;  2BE2 A;  2CNN B;  1DBD A;  3MMJ A;  2HWI A;  4JV1 A;  1Q16 B;  2XWY A;  2H5I B;  3VR1 A;  2E29 A;  2MQQ A;  2D9P A;  3EDR B;  2YQ3 A;  4NLX A;  3N79 A;  1FRL A;  2CZV C;  2FY8 A;  4F2S A;  2YWG A;  3MUV P;  2YWH A;  3EMT A;  4DSK A;  2BX6 A;  3IAS 9;  1BXN A;  1CJV A;  4HAC A;  2ZOG A;  1EB0 A;  3QFW A;  3OHA A;  5GAE I;  4C8N A;  1S72 S;  1YQH A;  2MYF A;  5B0E A;  5HMW A;  1V3R A;  4AFF A;  2A3J A;  4WE1 A;  4IR9 A;  4B9N A;  2XMJ A;  4DI6 A;  4TKT A;  1WKK A;  3TA2 A;  4AT1 B;  2DHA A;  3OVS A;  1FCA A;  1A0O B;  3IR6 B;  1W25 A;  2J9E A;  2CQ4 A;  2DNL A;  2JEF A;  1C4A A;  1BQN A;  2XQC A;  3PVX A;  1CVJ A;  1JLQ A;  3IBF B;  2Q6C A;  2VQF F;  1MU2 B;  1M5H A;  3BO2 A;  4K4W A;  3V81 B;  2J76 E;  3MM7 A;  5KG1 A;  3QJP A;  3CDB A;  3M1V A;  2EFP A;  4DPO A;  4EBE A;  2OAU A;  4O3P A;  3HFK A;  4R25 A;  3J81 U;  1NB2 A;  3GZ7 A;  1T9T A;  2H48 B;  3IO1 A;  1REV B;  2YNF A;  2HGM A;  3IRW P;  2OPQ A;  1F6T A;  1BD6 A;  1M1G A;  1XTZ A;  3NCQ A;  2NUU G;  3BB5 A;  4ED4 A;  1PYS B;  3VAG A;  1FRH A;  1VQ6 S;  1JLC B;  4LJM A;  1IKX B;  2ZJR Q;  3VGU A;  3OD2 A;  1H2U X;  3ZTP A;  5AXK A;  1KNZ A;  1RHR B;  1MNE A;  2FYX A;  3MF5 A;  2OML A;  3M8P B;  2DK2 A;  4OX7 A;  4PWD B;  3TR5 A;  1WG5 A;  1CJU A;  2V94 A;  1RT5 B;  1F2H A;  3VTI A;  4JYA J;  1FVQ A;  3R1L A;  4DJB A;  1S5Z A;  1E6Y B;  4DV7 F;  2B6A B;  5DRK A;  1UKU A;  4L74 A;  3UN3 A;  2CWX A;  5ETR A;  2CPF A;  2G0J A;  4ZVT B;  4JB8 B;  3B54 A;  3MM5 A;  4M5I A;  4ZLN A;  1FRJ A;  2WK4 A;  5J1E B;  2UUA F;  2LYV A;  2CXE A;  3UDL A;  3MM8 B;  4ETZ A;  1A9N B;  1NDL A;  4QQB A;  4IG3 B;  2J9D A;  5CCL A;  3TAN A;  1RWW B;  1HFE L;  1YJN S;  2D7S A;  4MJK A;  3M8Q A;  1T05 A;  3MPU B;  5CYJ A;  1F1B B;  3ZZZ A;  1O5J A;  5B08 A;  1NPR A;  1JNZ B;  3O3L A;  3CCS S;  5AXL A;  2MST A;  2K7J A;  4MKA A;  4FKX A;  4F0M A;  1H6K X;  4HR2 A;  4NWB A;  3FDS A;  1U0H B;  1ICE B;  3T41 A;  3DGP A;  3NS6 A;  3SFU A;  3R5C A;  1HPZ A;  3AOD A;  4N56 A;  3UCG A;  3QAU A;  2LXF A;  4QR1 A;  3LW5 C;  1S6P B;  1AFJ A;  4V1A k;  3BH7 B;  2X1A A;  3M32 A;  1KTQ A;  5A0Y A;  4F4Y A;  3HP6 A;  1HNZ F;  3J7A N;  3POT A;  4UT4 A;  2W9B A;  3LP0 B;  2E5L J;  1UVL A;  1UWA A;  3AT1 B;  2MZJ A;  2QV6 A;  4OYO A;  1QM9 A;  3KDO A;  2Y8Y A;  1UW4 A;  1X4F A;  2CZ9 A;  3GIL A;  2WBR A;  2V5H G;  4URQ U;  4UOG A;  3MEE B;  3UO0 A;  1SJ3 P;  1YJU A;  3BDE A;  2DD8 S;  1DQ8 A;  1NSQ A;  1CUL A;  3CCL S;  3BEG B;  3NMA A;  1JLF B;  1S1X B;  5B0C A;  1E6V A;  1VR6 A;  3W9H A;  4E2F B;  2JL9 A;  4NZ0 A;  3UNY A;  1J2V A;  2LQ5 A;  1GFW B;  1TV6 B;  2P5V A;  5C24 B;  3L95 X;  2KFY A;  3TA0 A;  4DR7 J;  1TKT A;  1V3Z A;  1NSK L;  1P9Q C;  1S79 A;  4N76 A;  5KFC A;  4B3M J;  1IBK J;  2ZH7 A;  2UXB F;  2NYH A;  5KTQ A;  3JSY A;  1VQS A;  2V2Q A;  2CJ9 A;  3PHT A;  1S9F A;  4FBU A;  3CO0 P;  1S9G A;  1MN9 A;  2GJF A;  3PYD A;  4DV1 F;  2XMU A;  2IAJ A;  1HI0 P;  4K5R A;  1XNQ J;  2NXU A;  4HDG A;  4WF9 Q;  2DT9 A;  4DQP A;  3H7H B;  4DUY J;  2CAJ A;  2VV5 A;  2HEK A;  2QLX A;  3IP0 A;  3VGV A;  5GAG U;  2XZW A;  2GVZ B;  4RW7 B;  2I9S A;  2QA2 A;  4LMZ A;  4NAS A;  2BQ3 A;  3PRV A;  1HQU B;  4X4V A;  3M30 B;  3M4X A;  4F4K A;  3M2U A;  2QFI A;  3QRQ A;  3MR6 A;  1U47 A;  3FEZ A;  2R7U A;  1VRQ C;  1RAD B;  4DQR A;  4ECS A;  2BXJ A;  3MI7 X;  4NLQ A;  2E7V A;  1WI6 A;  3OL6 A;  2VPZ B;  1KLM B;  1X60 A;  3KJN B;  4DCJ B;  2NXC A;  3VQT A;  3QZ7 A;  4M5N A;  2PA8 D;  3D6M B;  1JMT A;  4BS2 A;  3MM9 A;  5F8L A;  4NI2 A;  1ACM B;  4FZV A;  3CVK A;  2VFT A;  4QIG A;  2PDA A;  3C15 B;  3WC2 A;  1ULR A;  3MCS A;  2AWZ A;  2C2Z B;  2CG8 A;  5ETO A;  5CQG A;  2B8Q A;  1PSD A;  4GVB A;  3W66 A;  1VQY A;  2IY5 B;  3PO5 A;  3QT7 A;  3EDQ B;  4IQX A;  5A8R A;  2OPR B;  2ZDO A;  2FVQ A;  5GAE U;  2G0I A;  3SZ2 A;  2KN4 A;  1JJC B;  1WI8 A;  4FP9 A;  1C0T A;  2DXF A;  3SEO A;  2XY7 A;  3UE2 A;  1NDP A;  3CUN A;  4DUZ F;  1LOU A;  1Q8I A;  2ZBI A;  3OR2 A;  2CAD A;  1F3F A;  5GME A;  2MGZ A;  4LSL A;  2XCP A;  2N3L A;  4M63 A;  4AL6 A;  1NH8 A;  2B4P A;  2DO4 A;  2VG6 A;  1O0P A;  3A8I A;  2YBV A;  2POK A;  2VIH A;  1DHM A;  4M95 A;  3IWX A;  4QYZ K;  1NPP A;  3EZU A;  3W2V B;  1BWE A;  1Z2L A;  3I4P A;  2DH7 A;  2YKP A;  3MMC A;  1SQE A;  1AZS A;  3AH6 A;  4IFV A;  3ZTS A;  3D5M A;  5HRO A;  2KU7 A;  2DJW A;  1HL6 A;  1Z1Z A;  2DCU B;  2Q79 A;  1NH7 A;  4X4U A;  1S1U A;  2BM0 A;  2MTL A;  4I64 A;  4BWM A;  4KIA A;  3QWP A;  2EWH A;  3I6P A;  1SV5 B;  4JUZ A;  4W92 B;  3CJ2 A;  3TUZ C;  2ADB A;  2GAG C;  1TVR A;  3HJF A;  1R89 A;  4LRC A;  3TJ8 A;  5E3Q A;  4G6V B;  3JSM A;  1K73 T;  4KPY A;  5E3P A;  2FTR A;  1Y11 A;  5D4L A;  2XMM A;  3H98 A;  1S1V B;  2DHX A;  2XSJ A;  3SQO P;  4KGX B;  4NE9 C;  1ZBT A;  3IR7 B;  1UEK A;  5F3T A;  4Q43 A;  1WF1 A;  1HBM B;  3TEG A;  3OTC A;  2PEB A;  5IXU A;  4Y2M A;  2AT1 B;  3W7B A;  1F9F A;  2DR5 A;  2AQ4 A;  1Q5V A;  2MY7 A;  3TA1 A;  2GO8 A;  5GVQ A;  2C2M B;  4LFB J;  5ETV A;  2LEA A;  2PC6 A;  3EXC X;  2HVE A;  3RJM B;  1H38 A;  1LK5 A;  1WTF A;  4G1Q A;  4X65 J;  2C3M A;  4KGK A;  5LXY A;  3KK3 A;  3A8K A;  4KB7 A;  3GJR B;  4WXO A;  1DY3 A;  2EC2 A;  4B3S F;  3RUB L;  2OLW A;  3GWC A;  2GHV C;  4K8R A;  1OY8 A;  4NLU A;  2GGP A;  3AXK A;  3NBP A;  1T02 A;  4USI A;  1R7I A;  3G8T A;  3HUL A;  3BGR A;  4KYZ A;  4WU2 A;  1ZZN A;  3W8G A;  3KLV A;  1R8C A;  4Y6I A;  4PRF A;  2WRM A;  1IJF B;  3MPW A;  1HAR A;  2HNY A;  1AYE A;  4WZM A;  3G9C A;  5LL6 d;  4ECT A;  3IGV A;  2W4C A;  4EO6 A;  2O1P A;  8RUC A;  1AXQ A;  1EJ7 L;  4LSN A;  5T7L B;  2UV8 A;  2YY3 A;  5I3U B;  3ZNJ 1;  1WOO A;  2ZD1 A;  3OLB A;  3NEK A;  4M5L A;  4M5K A;  2OFH X;  2MJU A;  4UOC A;  4JI1 F;  2KJV A;  2LCW A;  3TUI C;  4C8Z A;  4FF4 A;  1VHF A;  1JNR B;  1OQ3 A;  1RUS A;  4XDD A;  2D41 A;  1NJI T;  3G6V A;  3OTD A;  1YK9 A;  1HNW F;  3Q2T C;  5K8N A;  1JLE B;  1G6B A;  4L75 A;  4ED2 A;  3NS7 B;  5BYQ A;  4B9S A;  3A3O B;  1SIW B;  3M8Z A;  1N33 F;  5LJ3 Y;  4IRD A;  1G7C B;  4BC9 A;  4PEO A;  3MEG A;  4FYY B;  2V8P A;  1GK8 A;  1CG2 A;  2D3O R;  2CQP A;  1S7I A;  4J90 A;  2W9A A;  1GMW A;  3EGN A;  2VHG A;  1P1T A;  3S8S A;  1DZ5 A;  2H9Z A;  5CH7 B;  3TAM A;  4O4G B;  1X9M A;  2XYG B;  3KLF B;  2IDL A;  4F67 A;  3AJD A;  2KT3 A;  3T3F A;  4NYP A;  4K2J A;  1X5S A;  4LFC J;  3GV7 B;  3HD2 A;  3BPS P;  3WHI A;  3LUY A;  5A8K A;  1S59 A;  3QRP A;  3V6K A;  2DHG A;  2RHS B;  1SC3 B;  5I3Q A;  1H7X A;  5F0W A;  2ZH1 A;  4ZVO B;  1R6V A;  4QU7 A;  2QE5 A;  4CO2 A;  2QA4 S;  4PAB A;  1Q8B A;  2HS0 A;  3OBI A;  2I2Y A;  4O4R A;  2C3P A;  3M8R A;  3DLJ A;  1MMD A;  3KFW X;  3KLH B;  5J2P B;  2ZHB A;  1GX5 A;  4A8Y A;  4UTG A;  4G1I A;  1RAE B;  4QWD A;  2EFV A;  1TK8 A;  2Z30 B;  1R8B A;  4F4A A;  2HBQ B;  3EIC A;  5KFQ A;  2HWT A;  1EZZ B;  3QWU A;  5AE2 A;  4RUH A;  3MCM A;  4KQZ A;  5HP1 B;  1XJW B;  4ZCL A;  4M5H A;  4LF9 F;  3PW2 A;  4FF3 A;  3EZO A;  3T9Z A;  1Q8L A;  2G1D A;  1OPI A;  2HS3 A;  2VQE F;  1VFJ A;  2KG1 A;  2RT3 A;  1KS2 A;  1VQM S;  1I5O B;  2IHR 1;  2G4B A;  4FPR A;  5IQQ A;  3TJA A;  3DM2 A;  4IDK B;  2W2O P;  4ECZ A;  3GFZ A;  2VFV A;  2O66 A;  4ZVG A;  3HSD A;  4J9S A;  4RX6 A;  2KT2 A;  3GIK A;  1FWP A;  1IWA A;  3MMB B;  1RP5 A;  3D3B J;  2M52 A;  5HAO A;  3OJU A;  4FBT A;  2K7K A;  3CME S;  3MED B;  3MWB A;  2VU5 A;  2IA6 A;  4ES3 A;  2KHD A;  4R8U A;  1AB8 A;  1TR0 A;  5T41 A;  2M0G B;  4CLL A;  5T14 A;  2CQG A;  4B02 A;  2C2R A;  1IXK A;  2XLK A;  3DRS A;  2X51 A;  1TL3 B;  2Z4P A;  2XLI A;  3RYL A;  4C9D A;  3QIP A;  4LIW A;  2EC0 A;  3FGV A;  4RL1 A;  1W7W A;  2XHW A;  1FJC A;  1X4H A;  2YKM B;  4FVM A;  5EX3 A;  2CJQ A;  2FC9 A;  1CS4 B;  1NKE A;  3AB2 B;  4TN2 A;  2VOD A;  4PQU B;  2Y1J A;  1BLU A;  1RTI B;  1QAY A;  2DXD A;  4CLF A;  1Q7L B;  2RVJ A;  3UI3 A;  4MIW A;  1C0U B;  2BA9 A;  1CC8 A;  1UTA A;  1B4S A;  2OPS B;  4RUC A;  1RHJ B;  1LWC A;  2WVB A;  1NSA A;  2UVW A;  2DGS A;  4A8S A;  3TQ1 A;  4DL2 A;  2ZH5 A;  2XNR A;  2J0S D;  3BKF A;  2NXN A;  3W64 A;  1VIO A;  3RU0 A;  3GB0 A;  4NLD A;  4RNN A;  2VC1 A;  2VG7 A;  2DR6 A;  2CIM A;  1J5E J;  2H3E B;  3EWG A;  1ZTW A;  4J9U E;  2FJA B;  3CC4 S;  1GH8 A;  3DNC A;  3KG0 A;  1RTH A;  2MPU A;  1NK4 A;  1TK0 A;  1FNM A;  1HBN B;  2MLY A;  2KFN A;  2HBZ B;  1H7W A;  1V6H A;  1NUE A;  3GON A;  2ATL A;  5K5M A;  3TOQ A;  1N36 F;  4NXM F;  4ZKA A;  4DR6 F;  3V6D B;  2L9N A;  5KFO A;  4V19 X;  1XNR F;  5JJB A;  2OTL S;  2L48 A;  4DPT A;  3SSR A;  4DCP B;  2GO9 A;  2KH9 A;  3NGK A;  4YOE A;  2MHE A;  5I42 B;  1S9E B;  1P9Y A;  5C7P A;  5DZ6 A;  2WSF C;  1U26 A;  4ILL A;  4EBD A;  3GR1 A;  5LMU F;  2C3U A;  3RBE A;  1QVG R;  3CB4 A;  4J9O A;  3V81 A;  4BWJ A;  1U1O A;  3NNH A;  5CZV A;  2I0X A;  2ZOM A;  2HWH A;  4CI0 B;  2ZKU A;  4HDH A;  1I6J A;  1RAC B;  3OR1 B;  3O1L A;  1VC5 A;  2W7A A;  1REV A;  1Q86 T;  5KFE A;  4TVA B;  2Z2M A;  2IRU A;  1I3O B;  3R7N B;  4BCA A;  2XY5 A;  1UL3 A;  1JLC A;  3D67 A;  3A8J A;  4PPD A;  3VHQ A;  1TTH B;  2QEX S;  4MIA A;  3VVT A;  4X4N A;  2E66 A;  3UW1 A;  1SJF A;  3R3T A;  4IG0 B;  1RIS A;  2W4P A;  3LA0 A;  3OT9 A;  2YKQ A;  1Q7Y T;  1X31 C;  1XC9 A;  4MH8 A;  3E8O A;  2QMW A;  2RQK A;  4AQY J;  3M8P A;  2WVD A;  5C2G A;  3CJ0 A;  4PWD A;  5HQ8 A;  5K20 B;  1LNQ A;  4M5D A;  1RT5 A;  2VON A;  2CNL B;  4QJV A;  3KLE B;  2R8G A;  5CAB A;  1E6Y A;  4LF6 F;  2GA7 A;  5KG2 A;  1R0B G;  2B6A A;  2B43 A;  3CD5 A;  4OYW A;  5DDO C;  3QGP A;  1KWM A;  4B3R F;  1M0S A;  3BSO A;  4JI6 J;  3HHL B;  4PXB A;  2R7R A;  2HFN A;  5L9X A;  1CSJ A;  2Y1R I;  2EFQ A;  2B7C B;  3ICL A;  3GIM A;  1EP4 B;  3EPI A;  4AND A;  4Y28 C;  5CYM B;  1RT3 A;  3RGI A;  5BYS A;  3JQM A;  5G0R B;  3MM8 A;  3R7S B;  4OHV A;  1ZAX A;  5H9F K;  2YNG B;  2YNI B;  4IG3 A;  1DQ9 A;  1RAB B;  2F9J A;  4Q8F A;  4L6V 3;  1L5U A;  5I4M A;  2MKK A;  1G1X A;  5JUM A;  4O3O A;  1HR0 F;  1NXI A;  5HVH A;  2F63 A;  3RRG A;  1ITP A;  4Y65 A;  2GIF A;  2K3K A;  3CCJ S;  3DU5 A;  4RW8 B;  4QPT A;  3MR7 A;  3T5J A;  5KG4 A;  2JJ4 D;  3UNG C;  2MZR A;  2V50 A;  5SZT A;  3RB6 A;  1TAU A;  2HMI B;  1JLB B;  3BBC A;  5ITH A;  3FQK A;  4JI0 F;  5EGY A;  2HHW A;  3SCL E;  2Q3P A;  3ZZY A;  1PO6 A;  4IOC Q;  4PYD A;  1IN0 A;  1XMQ J;  4U9R A;  3VAF A;  6FDR A;  1HI1 A;  3O44 A;  4DV5 J;  1WJ9 A;  3WIU A;  4NLO A;  4I67 A;  3OHB A;  2ZWP A;  1SJ1 A;  3KK2 A;  2JLE A;  3LP0 A;  3HHL D;  2W2Q P;  2XGP A;  1IKV B;  2BVZ A;  4DR2 F;  3WIV A;  2YXL A;  2GFF A;  1RHU B;  3K0J A;  4ECR A;  3TJ9 A;  4Y2A A;  3HSJ A;  1IBM J;  1Z2Z A;  4TLR A;  1HYS A;  2XCA A;  2QYG A;  3MEE A;  4P71 A;  4ECY A;  1X4B A;  4FNH A;  4M5J A;  1N48 A;  2E7X A;  2Z56 B;  2DEJ A;  3DOM A;  5ETL A;  1JLF A;  4OYA A;  3QSI A;  1S1X A;  2KL8 A;  2LQJ A;  2Z58 B;  1SC1 B;  4HH0 A;  1NZA A;  4OJ1 A;  2E1A A;  2KG0 A;  5KOW A;  4A8K A;  1S1W B;  1UP1 A;  4ZHR B;  4HL9 A;  4OYP A;  4CQ1 A;  5C24 A;  1Y10 A;  5L46 A;  4DV4 F;  4CLP A;  2H4W B;  2BE9 B;  2LQB A;  3CGI A;  1JK9 B;  1FRI A;  1YGY A;  4DR5 F;  3HHL C;  3K5N A;  1HNV B;  1CQM A;  4MKB A;  3BQ2 A;  2LDY A;  5IM0 B;  2XNQ A;  4X4P A;  3HKW A;  2D9O A;  2G0C A;  2IRY A;  3D3C J;  1UFL A;  1VBZ A;  2FJX A;  2RU9 A;  3CCV S;  2P6T A;  3C16 B;  4WFY A;  3DOK B;  4B3T F;  5EHH A;  3NOC A;  4ZLL A;  1NDK A;  2CVI A;  4WFN Q;  5D0R A;  4DSL A;  2QX0 A;  1X8D A;  5DS7 A;  1UVK A;  4YN3 B;  2L08 A;  5DO2 A;  3KK1 A;  2X3D A;  3G87 A;  3M30 A;  2YVS A;  2FJV A;  4CO4 A;  5KFX A;  3P8B B;  1R0A B;  4WPA A;  4DV2 F;  3OPK A;  1LXN A;  3VGT A;  2LXI A;  4NLG A;  3T5L A;  3ZTO A;  4C8L A;  3R8Y A;  4F2R A;  2R8H A;  1I51 B;  1KRP A;  4O23 A;  1KLM A;  2NXE A;  2DO0 A;  2W2N P;  1W2I A;  1D9A A;  2B5J B;  4HHH A;  2XWX A;  3D66 A;  1K47 A;  1SH2 A;  3C14 A;  5ETM A;  1JX4 A;  1GAO A;  1VQ8 S;  4DQQ A;  4OX9 F;  3CNQ P;  2B3T B;  1SL2 A;  2VDI A;  3QT6 A;  3AB4 B;  1WAC A;  3LF0 A;  4J5O A;  2RH3 A;  2AZ1 A;  4DSI A;  4J9R A;  2WOM A;  3CJ5 A;  1FE4 A;  4IQM A;  2QMX A;  4P2X A;  4DXL A;  1T03 B;  2DNP A;  3W3S A;  1KEK A;  4FXV A;  3PNI A;  2RAQ A;  2FJE B;  1EET A;  1PJ5 A;  2NYI A;  2N82 B;  1BUX A;  3G82 B;  3KXD A;  2AEF A;  3D1H A;  1N34 J;  1KDN A;  5DQG A;  3D28 A;  4JV5 J;  1YI2 S;  5M2U A;  3Q2S C;  5CCM A;  2UU9 J;  3CIM A;  2IM3 A;  2CJX B;  1QAI A;  3SMZ A;  3KLG A;  2M3D A;  5J1P A;  4ZPT R;  1FDA A;  4KGZ B;  3ILI A;  2LEB A;  4ZIW A;  3A4T A;  3E51 A;  1RAO A;  3BGU A;  1F2G A;  1XMO J;  3LWM A;  4YR0 A;  4DV6 F;  2D74 B;  3BSA A;  4HH1 A;  1KLN A;  3WDO A;  4LBP A;  5F8G A;  1VQN S;  3CJK A;  1YHQ S;  1BE4 A;  1EKS A;  3UDE A;  1RDR A;  4KPC A;  2EPI A;  5I3P A;  1FO1 A;  3J7A 1;  4QIE A;  1HNI B;  1WKJ A;  2EBG A;  4X62 J;  2R3V A;  3LTO A;  4NCB A;  3R97 A;  2W1B A;  3VAM A;  1U6B A;  1WHY A;  1ZAW A;  2RKI B;  1S1V A;  2DEI A;  2U2F A;  2YWK A;  3OQ2 A;  3RTV A;  2IM0 A;  3JQK A;  4U95 A;  4J9V A;  3LP2 B;  2LFV A;  1HBM A;  2E9R X;  4OV6 A;  2XYP B;  4FYX B;  2XG8 A;  4DV0 J;  4MK9 A;  2CPE A;  2BJ9 A;  2LU2 A;  2ZVS A;  1LQ9 A;  4ED7 A;  3TUP A;  3MD1 A;  3R7B B;  1UJ4 A;  1RA6 A;  3TX8 A;  2LA6 A;  2JEI A;  1HBU B;  2V63 A;  1OSC A;  5BR8 F;  2ZZT A;  1YBA A;  4TLQ A;  4URG A;  2DNK A;  4USM A;  5HLF B;  4RW9 B;  3MD3 A;  2RRB A;  1NKC A;  3KTQ A;  2IFX A;  1WC1 A;  2BAN A;  2BJ1 A;  1P6T A;  4L72 B;  3SFG A;  2YKN B;  1KQK A;  2ZH4 A;  2X1B A;  4R5P B;  2Z0G A;  1MWZ A;  4NYO A;  1VQO S;  3K57 A;  4DSE A;  4FNI A;  1XMB A;  4NOH A;  5F9N A;  3EGZ A;  1CJT B;  5HAT A;  4F7V A;  1WHW A;  2FIU A;  4OI6 A;  2KZM A;  1NO8 A;  3OSN A;  4WFB Q;  2LXU A;  4ZPD A;  4O3S A;  3GQC A;  2APO A;  1SBR A;  2MQM A;  3THT A;  3PHE A;  3R2D J;  3P5B P;  5LT5 A;  3RB3 A;  1H72 C;  2MQL A;  3H90 A;  5C42 B;  1KN6 A;  1ZET A;  3IXQ A;  1YJV A;  2HHQ A;  4P2F A;  1PYO B;  4DCO B;  4EBC A;  2E1P A;  4CM0 A;  5T7L A;  3OTB A;  4ED6 A;  3S6E A;  2FHJ A;  3CC2 S;  1B0V A;  4PXC A;  3EUN A;  1RYS A;  3OFH A;  5K8O A;  3T6J A;  3OTO F;  4K4S A;  4W98 A;  3L9Z A;  3MFH A;  1WHV A;  2RNE A;  4PG6 A;  3CXC R;  3K89 A;  4ENO A;  1X5P A;  2E5G A;  2D69 A;  3VAH A;  4R0E A;  1YTY A;  1B3T A;  2NCK L;  2HQD A;  1RWU A;  1VK3 A;  4C8Y A;  2VQF J;  2R7S A;  1JLE A;  2ZFH A;  1URN A;  1UJ6 A;  3C66 A;  4YB1 P;  1RTJ B;  1K0T A;  6AT1 B;  2R7T A;  1UEV A;  5AE3 A;  3C6U B;  1RT4 B;  3KJV B;  2K1R B;  4B9V A;  4N5S A;  5KT7 A;  3TAP A;  1WC0 A;  1FFW B;  4DWI A;  2KO1 A;  1L3T A;  2AYM A;  4O4G A;  3WZ0 A;  3KLF A;  1KBR A;  4C7Q A;  2I5J B;  1OQ6 A;  1REG X;  4DQS A;  2E5L F;  4IKA A;  3D1Q A;  4WU3 A;  1G2E A;  1U7L A;  5KFN A;  3G6E S;  5KFF A;  4LF5 J;  4UQT A;  4IH5 A;  4USV A;  1HWI A;  3B8H A;  2CJY B;  1SKS A;  4CDI A;  1YVF A;  4Q44 A;  1DLO A;  2DGU A;  4AE5 A;  3IR5 B;  3D9B A;  1YBU A;  4C11 B;  5AT1 B;  3H20 A;  4IOA Q;  4LF2 A;  3JS9 A;  3D1O A;  2ZHO A;  3MCN A;  5J2P A;  2FHO B;  2C28 A;  1Q78 A;  2FZK B;  4QYZ J;  1DRZ A;  1LW0 B;  5GAD I;  3I31 A;  4AYB D;  3SQG B;  2IYI A;  5ETP A;  2ILZ A;  2AX0 A;  4OZL A;  2AIR B;  2DY1 A;  3ISN D;  4DR7 F;  4M8L A;  4CLT A;  2UZA A;  3SCI E;  5L9N A;  2CQD A;  3V4I A;  4CO5 A;  2ZBR A;  3W2W B;  1R0C B;  1QTM A;  3CCZ A;  4RBV A;  3HX9 A;  2KJW A;  2DRB A;  4QOT A;  4H4K A;  2HHX A;  1H74 A;  2DGO A;  4GKJ J;  4NEZ A;  4CNY A;  2R2R A;  1U4B A;  2ZUG A;  1IUJ A;  1AW0 A;  1LV5 A;  4QIF A;  4A48 A;  4RU9 A;  4DS5 A;  5D8H B;  3GPA A;  4C3L A;  1DTQ B;  1XNQ F;  3BO3 A;  3O2I A;  1TL5 A;  4ECU A;  4IDK A;  3O6Q A;  5L1I A;  2F65 A;  4DUY F;  4Z37 A;  2RF2 B;  3W5Y A;  5F8J A;  1V5V A;  1RCO B;  1LWX A;  2XMT A;  4UUW A;  1HNZ J;  4I6W A;  4RNM A;  3IA0 A;  1NCL A;  3CMA S;  3PKY A;  3MMB A;  4ETX A;  3CW2 C;  1RBA A;  1R8A A;  1HNX J;  3VCD A;  1VQK S;  1IKY A;  2KYX A;  3MED A;  2QL9 B;  2WB4 A;  1RT7 B;  3JSR A;  5EDW A;  2AW0 A;  4WK3 A;  1RT1 B;  4IUF A;  2F7V A;  3THP A;  2VPY B;  3PIO Q;  4HTI A;  5KFM A;  4UY8 5;  3N5F A;  2ZH2 A;  2GVD B;  1U1N A;  4J9L A;  4YEA A;  1CBK A;  2R4F A;  3I5A A;  1OMS A;  2YKM A;  1FXL A;  3HFV A;  3B4D A;  5DDR C;  1CS4 A;  3LPY A;  1DAX A;  4PQU A;  2Z2Y B;  1SH0 A;  2LEP A;  1RTI A;  1YJW S;  1XQI A;  4X4R A;  4IR1 A;  3A1Y G;  4K5S A;  2OPS A;  4CNZ A;  1TKZ B;  3GR0 A;  3MAH A;  4X4T A;  4OYI A;  4QIV A;  3NKY A;  5ETT A;  1U6Z A;  1UCN A;  3NNA A;  2CYY A;  3UWT A;  2QYC A;  2NS1 B;  3FKB A;  4RUB A;  1H0H B;  3EZ5 A;  1WSR A;  4DL3 A;  1LW2 A;  4PCQ A;  4DL7 A;  3PCO B;  1CQN A;  4LVN P;  2OO4 A;  4DU7 A;  2RU3 A;  5L1K A;  1HBO B;  4CO3 A;  1VC6 A;  5EUH A;  2XM3 A;  1TP7 A;  3H2V E;  3PJW A;  3BKU A;  1VYA A;  2LLZ A;  5A8W A;  4ID5 B;  2AGO A;  1X0P A;  1HBN A;  1VBX A;  2ZM6 J;  3LGH A;  1NHU A;  4FF1 A;  5FLX U;  2IBK A;  2FJD B;  2E44 A;  4V19 J;  2JZ5 A;  1UEU A;  1C1B B;  1SQG A;  2AJ1 A;  4KGV B;  4GC6 A;  2ZDP A;  2ROE A;  1Y5I B;  2CJK A;  3IM8 A;  2Y3Y A;  3MTK A;  2HHS A;  3Q89 A;  2DB1 A;  2AV5 A;  2FC8 A;  3V6D A;  4NYZ A;  2OTJ S;  5CD4 H;  4CM2 A;  5IC6 B;  1VQ5 S;  4NCG A;  1K44 A;  2XMK A;  3HI9 A;  2A18 A;  1LK7 A;  4ZP6 A;  5MLC V;  2FZG B;  2JWN A;  2QGF B;  3G8S A;  5I42 A;  1ZA2 B;  1S9E A;  4L76 A;  3ZZT A;  1HMV B;  5HBM B;  3ITH B;  1QJH A;  4DL5 A;  4XIU A;  3PAC A;  3M8W A;  3H5U A;  2G9O A;  3WX4 A;  4F8R A;  2RJZ A;  3OL8 A;  4OQJ A;  2HVI A;  3H5S A;  3OL7 A;  3QO9 B;  2OP5 A;  5ADZ A;  3ZZO A;  2BQU A;  5D6G A;  1CJK B;  1VQ9 S;  1AA1 B;  4EK2 A;  5KAK A;  2W8L A;  2DGT A;  2GAH C;  1YBT A;  1FDN A;  3L7P A;  2HSE B;  4RO0 A;  4USK A;  2JC0 A;  3B82 A;  4ICL B;  3J81 Y;  3GTY X;  3OR1 A;  5KFL A;  1RAA B;  3CTR A;  4QZV B;  3LAL A;  1PGZ A;  4LFB F;  2W7P A;  2E5J A;  5HL7 Q;  2IA0 A;  4NX9 A;  3HCX A;  3I0S B;  3KLI B;  4EO8 A;  1X9W A;  4J9N A;  1XR5 A;  5F9L A;  1BWV A;  3ZZU A;  4IG0 A;  3N6M A;  4X65 F;  3PM9 A;  3DMJ B;  1WD6 A;  2K8G A;  3Q22 A;  1FNO A;  1N56 A;  2H5J B;  3MR5 A;  2Z8Q A;  4ZPB A;  1S77 D;  2PD1 A;  8AT1 B;  1P27 B;  2R7X A;  5FD1 A;  2FJB B;  3OTE A;  2B4U A;  3KLE A;  2L3M A;  3P96 A;  1S99 A;  3BSN A;  3GSD A;  4KY3 A;  1IBL F;  4IO9 Q;  3HHL A;  2CJA A;  2ZNZ A;  1UWB B;  2AJ2 A;  3TZZ A;  1RT6 A;  3SYZ A;  1RWP B;  4ILM A;  2YNH B;  4OJG A;  3K7R A;  2GZO A;  1EP4 A;  5K9F A;  2A0F B;  1C1C B;  3VVU A;  3Q83 A;  4P7V A;  3BS9 A;  5JXS A;  5G0R A;  1Z4U A;  1Q5Y A;  2YNG A;  2DIV A;  3J7Z 5;  1GX6 A;  2F4F A;  3Q8Y A;  1F5A A;  1WDT A;  1FFS B;  4RBT A;  4HAC B;  4TYB A;  3I87 A;  2EG1 A;  2BKO A;  1VRT B;  4TY8 B;  4JI8 F;  2H51 B;  3J7Z T;  2YPY A;  3TZX A;  3M6V A;  3DFE A;  1KQG B;  7FD1 A;  2R9L A;  2J0W A;  1FDD A;  2HLU A;  2HQC A;  2V0N A;  4TNO A;  5IOL A;  4CZC A;  2HMI A;  2QO3 A;  1BQN B;  4OX6 A;  5U47 A;  1RT2 B;  3RW6 A;  2PI5 A;  3QAE A;  5HK4 A;  1D9F A;  4X2B A;  4F4W A;  3QBC A;  2A6O A;  1UFK A;  1IM6 A;  1RHQ B;  4USU A;  4FF2 A;  2MZS A;  3UVJ A;  2IVF B;  2V9K A;  4RNF A;  5GAD U;  1NRK A;  2LQ9 A;  2A6M A;  3DDK A;  4WKR A;  4K7Q A;  1N5Y B;  2OGU A;  2YNF B;  1IKV A;  5E33 A;  3R5B A;  1MG7 A;  4F36 A;  2VUG A;  4IRC A;  4A47 A;  2L9W A;  4B3S J;  4PR6 A;  2WON B;  4N8N A;  2CJB A;  5HAN A;  3IRX A;  4OI2 A;  3GLJ A;  1MML A;  2CQC A;  2F5G A;  1KD1 T;  2DVI A;  2CQH A;  3EGV A;  2E9T A;  1QE1 B;  4I7F B;  4K0K F;  1RKI A;  1QDU B;  5H1S V;  2E1C A;  1HLW A;  1FJG J;  5KFU A;  1PJ6 A;  3TEH B;  5L1J A;  3MXH P;  2WZ1 A;  1Q95 G;  5K8P A;  3Q8Q B;  3G6Y A;  4HEA 9;  1S1W A;  4U8V A;  3KNG A;  3I56 S;  2EFG A;  2AZ3 A;  3MZI A;  3GE9 A;  1TAQ A;  1UZD A;  4AL7 A;  1N88 A;  2CPX A;  4QW9 A;  1PKU A;  4ZOS A;  2E1M C;  3SCK E;  3MM5 B;  2RQC A;  4WTO B;  4QBU A;  1YRT A;  3LAN A;  3K17 A;  5IM0 A;  4J37 A;  2HVD A;  2XO7 A;  1WOP A;  3HHK A;  4F25 A;  2M5Y A;  1Y3J A;  2RD5 C;  2XB2 D;  4G1P A;  4MYU A;  1NZ8 A;  2W4D A;  1BC6 A;  2GV1 A;  4RWX A;  2KXH A;  4Q0B A;  3C16 A;  2N3O A;  2PFF B;  2ABY A;  4KFB B;  4DX7 A;  1QY7 A;  2DNY A;  1HNW J;  3R9L A;  3P49 B;  3CDW A;  5FDL A;  4IYQ A;  3NAH A;  4CLY A;  3DGP B;  1N33 J;  1HPZ B;  3ETO A;  5DZ7 A;  4OZ5 A;  4ED3 A;  3M32 B;  1GXU A;  1R0A A;  4C4W A;  3SIP B;  5A0Y B;  1NK0 A;  1K1Q A;  3ILL A;  5AE1 A;  4FPI A;  3H25 A;  4EWT A;  2QLW A;  1HW8 A;  1UPP A;  4Z7Y A;  1KFD A;  4OX8 A;  1T9W A;  1RLC L;  4ZJO A;  4OHW A;  5D4O A;  4KSE B;  2B5J A;  2YPZ A;  4YB7 A;  1SQF A;  5IQ6 A;  2NXJ A;  4QW8 A;  4FXD A;  4JI7 F;  2VF3 A;  2DR7 A;  1OSD A;  4K4Z A;  4C3K A;  2SXL A;  3PJX A;  2CVE A;  2UVV A;  4MK7 A;  2XS7 A;  3PZP A;  3BGO P;  2HS4 A;  2PII A;  5KFA A;  1OJ4 A;  1L3V A;  3D6T B;  4IOB A;  1Y7P A;  2IYG A;  4JI5 F;  1FF2 A;  1SKR A;  1HA1 A;  2RUS A;  1QTN B;  1VCT A;  1N32 F;  5AJ3 J;  1RJJ A;  3T5H A;  1FNX H;  2MLZ A;  5DDQ C;  5F0U A;  3CJS A;  4YME A;  1DTT A;  1AUD A;  4ZK7 M;  3U1L A;  1D9D A;  3W60 A;  1VQ4 S;  3RBD A;  4RU2 A;  5FII A;  1VC0 A;  5H9F J;  2KKH A;  1U1Q A;  3NGD A;  4B9U A;  3HJV A;  1K9M T;  4QR2 A;  4HHJ A;  1NBE B;  1R31 A;  4DSJ A;  1N52 B;  4P75 A;  3GYG A;  2V8G A;  1U24 A;  2BQR A;  7FDR A;  2OH2 A;  2CPZ A;  3GU0 A;  3A12 A;  2VAS A;  4NLP A;  1S76 D;  1WG1 A;  1EX8 A;  2ASL A;  3JTO A;  2ZEJ A;  1WHX A;  1YDL A;  2IPO B;  3T1A A;  1DAR A;  4C2M A;  3DCA A;  1GXL A;  3OUY A;  1PCA A;  2ACM A;  5EWE A;  1HNI A;  2DIS A;  5F41 A;  3U7J A;  1PBU A;  5KG7 A;  2HVH A;  3GJQ B;  1R27 B;  3TYT A;  1TL4 A;  1N4L A;  3L3C A;  4ILR A;  5K8M A;  2MHN A;  2VOP A;  2QA1 A;  3AQO A;  2GHP A;  1TZ0 A;  1SKU B;  2J0Q D;  3LP2 A;  3D6H B;  2RS2 A;  2PEH A;  2AJ4 A;  3HXM A;  1Q53 A;  1IBC B;  4S0M A;  3BR9 A;  3IN5 A;  2FVC A;  2ACY A;  1N5T A;  3DLK B;  2N7C A;  4KHR A;  3GG0 A;  3L4B C;  2DNQ A;  3IAM 9;  3KG1 A;  4AD6 A;  4ECX A;  4JI3 J;  3MM9 B;  1TUV A;  3SXL A;  4CH1 A;  4J91 A;  1HBU A;  3SDE B;  3DLE A;  9RUB A;  1RGV A;  5HVF A;  3BM7 A;  5C2C A;  1P8G A;  5HLF A;  4PG7 A;  4GVB B;  3Q8P B;  5ETN A;  3Q0A A;  3MUT P;  3PKM A;  4RW9 A;  3C2P A;  4RUA A;  3BQ0 A;  2VKZ G;  1NU4 A;  4ECV A;  2YKN A;  3BYR A;  4JBC A;  1EQ0 A;  4L3K A;  2CQ1 A;  4RW4 A;  1VQ7 S;  2AYG A;  3BSC A;  3KHH A;  4GKK J;  1YX2 A;  2V6A A;  1TL7 B;  3VZH A;  2DKO B;  4NLV A;  2DIU A;  2W8K A;  4I2Q B;  1CJT A;  2GCF A;  3CT9 A;  4UZB A;  1H2V Z;  1ZAV A;  4DUT A;  2B56 A;  2MGZ B;  2MKJ A;  4AQY F;  2XZT B;  3H4B A;  1X9S A;  1KON A;  3O5T B;  1X4A A;  4OI4 A;  2QLB B;  1Y5N B;  3H5Y A;  3SV3 A;  2ASY A;  5C42 A;  3HVA A;  3P3D A;  5LSR A;  1VOM A;  1LEO A;  1SPB P;  1RU1 A;  1N36 J;  4F0H A;  3CCU S;  5HRO B;  1IR2 A;  5B09 A;  4KKO A;  4ANE A;  1FWK A;  3BGL A;  1RTD A;  2M8D B;  2E7W A;  1KOH A;  5LOQ A;  3IMQ J;  2BEF A;  2B9X A;  1XEZ A;  3U1N A;  3W8P A;  2XHC A;  2FUG 9;  4ZS6 A;  2PMZ D;  3M2R B;  3MPY A;  2EW9 A;  2GHW A;  5J2Q A;  3IWL A;  3F41 A;  3QJJ A;  1RBL A;  3TUJ C;  4X4S A;  2DR9 A;  3DYA B;  3CCE S;  4CTA B;  3LP1 B;  3H59 A;  3HVT B;  3R5D A;  4DOZ A;  4P73 A;  1HD1 A;  1RHK B;  1F0X A;  2PSZ A;  2FPH X;  3EPG A;  2MEW A;  1RTJ A;  2ROG A;  4N41 A;  3PYF A;  2UUB J;  3HHN B;  3C6U A;  1RT4 A;  3KJV A;  3TNV A;  1MWQ A;  2K1R A;  2HRU A;  2KB2 A;  5L38 A;  2XI2 A;  4LVO P;  3DHW C;  1U1P A;  3DLG A;  4DV5 F;  2YX1 A;  3DGV A;  3OVB A;  4LFA F;  3G4S S;  2HND B;  1LWF B;  2V8D A;  2I5J A;  3IWN C;  1FK9 B;  2C3O A;  2ZBC A;  3JSB A;  1TEL A;  2H1Y A;  3HHD A;  4OYX A;  4G1Q B;  3BJY A;  2I38 A;  3FMB A;  5E41 A;  1SL1 A;  4G65 A;  2JX2 A;  1IBM F;  1T9U A;  3VWS A;  3TAR A;  4USW A;  9ATC B;  2HFV A;  5LMN J;  4USH A;  4MKY A;  5KFR A;  4DR3 J;  1WF2 A;  1B7Y B;  2QMU B;  1JXV A;  5GMD A;  3TZY A;  3H2U B;  2H54 B;  1MLA A;  4Q2M A;  3PFE A;  4ZPV R;  3LGN A;  3NNC A;  1LW0 A;  3CIZ A;  1RI7 A;  3DDI A;  2VPW B;  3SQG A;  3AD8 C;  4RR5 A;  3D68 A;  2KRR A;  3M9M B;  4C6A A;  2ZIT A;  3N4W A;  3W2W A;  3QYY A;  3FSI A;  4HI1 A;  1L3U A;  4DR1 F; 
#chains in the Genus database with same CATH homology
 3EJM A;  3VGT A;  4ANC A;  3ZTP A;  4DI6 A;  3PRV A;  3ZTO A;  1NDC A;  2DXF A;  5CAB A;  4EK2 A;  4O0N A;  1WKK A;  4ANE A;  3DKD A;  2HVD A;  1VYA A;  1BHN A;  1EHW A;  3EVO A;  1NDP A;  3ZTQ A;  3BBF A;  3FCW A;  1ZS6 A;  3VVU A;  3Q83 A;  5BXI A;  2DXE A;  1B99 A;  3BH6 B;  2VU5 A;  2DY9 A;  3NGT A;  2BEF A;  1F3F A;  3FBB A;  4WBF A;  3ZTR A;  3FBE A;  3BH7 B;  4F36 A;  4F4A A;  3EIC A;  1WKL A;  1S5Z A;  3ENA A;  3GP9 A;  5CAA A;  1NPK A;  1NSK L;  3L7U A;  3Q8Y A;  4DZ6 A;  3EE3 A;  3VGS A;  4FKY A;  4AND A;  3FCV A;  1S57 A;  4UOF A;  3B6B A;  1NHK L;  3EM1 A;  3Q89 A;  3R9L A;  1NUE A;  3EVM A;  1MN7 A;  3ETM A;  3NGR A;  4W98 A;  3GPA A;  3Q8V A;  1XIQ A;  3NGS A;  2AZ1 A;  1W7W A;  3WX8 A;  1K44 A;  3B54 A;  1XQI A;  1NSP A;  4ENO A;  3Q86 A;  1JXV A;  3Q8U A;  2HVE A;  3ZTS A;  2CWK A;  1S59 A;  1HLW A;  3G2X A;  1NDK A;  1MN9 A;  1NDL A;  1BE4 A;  1NB2 A;  3EVW A;  1NLK L;  1U8W A;  4DUT A;  3PJ9 A;  5IOL A;  1HIY A;  2B8P A;  2NCK L;  1LWX A;  3BBB A;  3VVT A;  1F6T A;  1UCN A;  2DXD A;  3NGU A;  4KPC A;  2DYA A;  3EMT A;  4UOH A;  2ZUA A;  4UOG A;  3DDI A;  2B8Q A;  1NCL A;  3FC9 A;  3FBC A;  1WKJ A;  3FKB A;  2BX6 A;  3ELH A;  3JS9 A;  1B4S A;  3FBF A;  1BUX A;  2AZ3 A;  4S0M A;  1NSQ A;  3MPD A;  1HHQ A;  4C6A A;  3BBC A;  3VGV A;  2HUR A;  4FKX A;  5C7P A;  1PAE X;  1KDN A;  1LEO A;  4CP5 A;  4HR2 A;  3VGU A;  1PKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...