5IC4B

Crystal structure of caspase-3 deve peptide complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3 subunit p17
publication title Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 92
sequence length 92
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 5ic4B00
4ZVUB 3NS7B 2C2OB 3GJQB 4DCJB 2XYPB 1RE1B 4DCPB 3R5JB 2H65B 1RWPB 2XYGB 2HBYB 2QLBB 1RWMB 3EDQB 2H5JB 2QLFB 2XYHB 1RHRB 2CNLB 1RWXB 2FQQB 4LSZB 1RWKB 1RWVB 2DKOB 3IBFB 3EDRB 1BMQB 2CNNB 4ZVTB 1SC3B 3R7NB 4ZVSB 2H4YB 3GJTB 1RWOB 3D6MB 2CDRB 4JB8B 5IC6B 3D6HB 3R6LB 2C2MB 1RHQB 2CJXB 3R7BB 2H51B 2Y1LB 1I51B 3KJQB 1F9EB 2C2KB 1PYOB 1IBCB 1RHKB 3RJMB 2CNKB 2XZDB 3SIPB 3QNWB 2CJYB 1SC4B 4ZVOB 2QL5B 2CNOB 2H5IB 2P2CB 1RWWB 3GJSB 3GJRB 2C1EB 3IBCB 3P45B 1GFWB 2HBQB 4ZVQB 5K20B 1RHUB 1QTNB 1RWNB 3R6GB 1I3OB 4ZVRB 2QL7B 4ZVPB 2H48B 1RHMB 2H4WB 2QL9B 1ICEB 3D6FB 3R7SB 3KJNB 2Y0BB 2QLJB 1NMEB 1PAUB 3KJFB 5IC4B 4DCOB 1RHJB 1QDUB 1SC1B 2H54B 2HBZB 2HBRB 2C2ZB 2XZTB 3P4UB
chains in the Genus database with same CATH superfamily
1YJVA 2ZDOA 2WCXA 1X4DA 2W4CA 2FGOA 3QT7A 5GADU 1FRHA 5H1SV 2QLFB 3J7Z5 3ITHB 4ECYA 4FF1A 3CD5A 2EKYA 3EGNA 3A8JA 1RUSA 4KB7A 4Q43A 1GXUA 2GIRA 2XB2D 3QT6A 4CIOA 3QIDA 2J5AA 3SIPB 2FJDB 3EX7B 2V9WA 5HJYA 5DDRC 4KHMA 2ACYA 3NGRA 3SCLE 3PIOQ 4DV1J 3N6LA 2NXJA 2SXLA 3CC2S 3CCMS 1ZH5A 2D3OR 3BGFA 3FSYA 1TL1B 2CQPA 5RUBA 1TKZB 3G86A 2CJAA 5C42A 3EVWA 1S6OA 2KO1A 3G82B 2G1DA 1T95A 4R0EA 2XMUA 1UEVA 3OUYA 1K73T 3DYAB 5BR8J 1CLFA 1SV5A 4ETXA 4WPAA 1CS4B 2J0SD 3JSYA 4FN5A 2HPUA 1TQLA 1LK5A 1PJ5A 3KG0A 3H59A 4ED5A 2HHWA 3NS5A 1VJQA 1Y7PA 4MK8A 3CJTA 2E5LF 2BZ2A 5ETOA 5LSOA 4WYWA 1VBYA 5J2PB 2IMWP 4X4SA 3MURP 3GV8B 2RMLA 4I2PA 5H9FJ 1LOUA 1X4CA 3H98A 1RT4B 4DUZJ 5G4DA 3PHTA 2N4CA 2GO8A 2YWGA 2XMAA 4P7TA 4F4AA 3R7BB 1OQ3A 1ZBTA 2D41A 3T5JA 2Z8QA 5LL6d 1N8RT 1EIYB 1UTAA 2XS5A 2YNFB 2KU7A 3OHAA 3WC0A 5IT9U 1H7WA 1B0TA 1XR7A 1M5OC 1SC4B 4M5NA 2BYCA 3OPKA 1S0VA 1WSRA 2ZD1B 1QAJA 4BWJA 4M8LA 4NASA 2LXUA 3BS9A 2DO4A 4AT1B 1X4EA 2DB1A 2HURA 3CIMA 1UJ6A 1S48A 4OYBA 4PUOB 5C2CA 1FXDA 4B9VA 3LWMA 2BQRA 2ZNYA 3TO8A 1I1GA 5T14A 2VC0A 4J9SA 1HBUA 3CCZA 2V63A 2DHHA 2V6AA 3FUYA 1HD1A 1R0AB 2KRBA 3OFHA 4LFCJ 4JI7J 5DDPC 3L09A 1QTMA 5F8HA 4ZVSB 1H38A 5D6GA 5IC6B 3D6HB 2QFJA 1U2CA 2CADA 2BJEA 1C1CB 1DHMA 1A7GE 3ET6A 1XERA 1PCAA 1HHTP 4NMLA 1U25A 2J8SA 4N8OA 1XEZA 2IRUA 4ETZA 5KOXA 1HQUB 3LWLA 2UXDJ 4P2SA 4YB7A 4KGZB 1KKHA 3KLIA 4J9PA 4LQ3A 3C6UB 3OXLA 2YQ0A 3ISND 4X4RA 3I9ZA 4OQJA 3WX4A 5K8PA 3Q8RB 4QZVB 4P71A 4Z2XA 4J9UE 5HMXA 1HNVB 1FD2A 3M2RA 3RB6A 1DFDA 3GSIA 3EVOA 1IBLJ 4KH0B 2IJRA 3QFWA 2VDHA 1HWIA 2XYPB 2DNOA 4KFBA 1SIZA 2A2DA 3C2PA 4LRFA 4YFUA 3AB2B 3GYGA 4DN0A 5IXUA 3W2VA 1ZPWX 1N32J 3DDKA 3DM2B 5KFWA 2DR8A 2VICA 1RU2A 5G0RB 1VC5A 2C2DA 1OJ4A 4X65J 3MECA 4NLQA 2Y0SD 3QGHA 2CVIA 4O3OA 3Q83A 4HVZA 2OIHA 3NWGA 2HIYA 1D3WA 5KFLA 4AL6A 3EGZA 2CFXA 2CNOB 3D28A 3MM7A 1RTIB 1IN0A 3K59A 2VA3A 1QVGR 4OZNA 2MLXA 3Q23A 4JYAF 2D9PA 3N6NA 5ETVA 3DLKA 2OGUA 1TFYA 3QJJA 5F0UA 4C8MA 1SC6A 2RF2B 2QLJB 1JQGA 3RB4A 1SJ4P 1YBUA 3THVA 2NPIA 4EEYA 1ROFA 2H54B 3CCQS 2JSXA 1SH2A 2Y3YA 4WE1A 2R7VA 1YK9A 4O3NA 3LAMA 1FT8A 4B3MF 3CJKB 3H5YA 2BE2A 4B3OB 3OTOJ 4QIGA 2WW4A 1SXLA 1S1WA 3OXFA 3KK1A 4N8NA 1VI7A 4ZJOA 4XIUA 2RHQB 1RWOB 4ZLPA 1RYRA 3TAMB 1X4AA 1F2GA 3KK3B 3M8QA 1LWCA 3B78A 2FPHX 2G2OA 4EYHB 1R31A 2V34A 3LPYA 2ZJPQ 1FCAA 5AXKA 3ZZYA 4DMZA 4NCGA 2M7SA 2OO4A 4LIRA 1PKUA 4ZVGA 3M7VA 1OSCA 1WUUA 1IQTA 2AV5A 4IG0B 3MR5A 3ZTRA 2XMTA 2DGQA 3SXLA 1NMEB 5KFOA 4RJVA 2ZBQA 3M8SA 1C4CA 1U2FA 3BB5A 3HCXA 3LP2B 1N5SA 2GHWA 4C3LA 3OVBA 4C0HA 4ECXA 3CCES 4NRUA 2JH3A 3N01A 4RUHA 4EBCA 3DKDA 1RBAA 4NZ0A 4M5HA 1NJIT 4LT6A 4ELUA 1VIOA 4K2JA 4ZJQA 1YJWS 4DR1J 4DHVA 4PXCA 2M3DA 4NYPA 2OEKA 3LGNA 4V19X 2DCLA 1TMMA 1JLCB 4MYUA 3PJWA 1CJUB 3D0HE 2VG5A 4F4KA 4RW4A 3K89A 5J1PA 3A8IA 2BJ7A 5BYSA 4B9LA 4N76A 2BXJA 5IZHA 3QRPA 3J80Y 2DGTA 4OYWA 1FX4A 3VVUA 4NOHA 2V4JA 1VK3A 5IV4A 2J9DA 2MGZB 2I2YA 2EK1A 3HZGA 4X4VA 1M90T 2HBZB 2YNHA 3TX0A 4LR7A 3RBZA 3ZO7A 4PQUA 3DHWC 3ILOA 2B5JA 1T05A 4OYPA 2VQFF 4EYIB 4O4GA 4HEA9 2H65B 3MMJA 1S1VA 4TQRA 3D6TB 3EDQB 4YHHF 1WOOA 4GKJF 1S1TB 1EETB 2MQLA 3CC4S 4WWSA 2FZGB 3KLGB 5J2NB 3BO2A 3MM6A 3QSIA 2NXCA 1SQEA 2HVEA 4OHXA 5GADI 1ZM2A 3W62A 3BSCA 5DZ7A 4XPEA 2UUWA 3W66A 2Y1RI 2GIFA 1DZ5A 2HWIA 2J0XA 4L6V3 2JEJA 4ZLNA 3OR2B 3ZZRA 4DI6A 2XSFA 3BSAA 1HKAA 5GAEI 3ENVA 2ZBRA 5CZVA 4RW9A 5CH7B 5D78A 2ZVSA 4Y34A 1AUDA 1KQSR 5LMNF 4I64A 1YIJS 3H2UB 1VOMA 3A1YG 4RR5A 3O3LA 3R9LA 2Q43A 1Z1ZA 2XEXA 4FYYB 2D1CA 4K2XA 1V5IB 2RUGA 4LF9F 1DJ0A 5KG6A 3B4DA 4HTJA 1RAHB 3NRBA 3VHQA 1S1UB 2FQQB 3DLEA 4X64J 1GTHA 2F8EX 4YB6A 1BMQB 4IDKA 2ZNZA 3H5SA 4ES2A 3S6EA 3LTOA 3J81j 3GU0A 4OFZA 4IUFA 3TANA 2OH2A 2JL9A 2WAQD 1S57A 4LFAF 5HMZA 4W92B 2UVRA 2FLPA 3CC7S 1LW0B 1YZ7A 2GAGC 4HDGA 1HA1A 1K47A 3HVRA 3HULA 4ILMA 5C25B 4O3SA 2MQ8A 1VISA 3QAEA 1GMWD 2DNRA 4CTAA 4DPYA 3M2VB 3IS9B 1FF2A 2OEMA 2ZVIA 2E5JA 4LVNP 4F25A 3DRRA 2WTFA 2P5VA 1ZS6A 3I87A 2EC0A 3TEHB 3PG9A 1WC0A 3CDWA 2V4RA 2HHUA 5HP1A 1UFWA 4X62F 3RB3A 2DR7A 4FPIA 5J1EB 4JI3F 1YHQS 4WXOA 4IFYA 4GC7A 2ZWOA 2R7SA 4Y2AA 2ASJA 4F02A 2FZCB 2AYEA 2PDAA 3FDSA 1RQ0A 3K5PA 2QTWA 4MKYA 4ZHRB 5CD4H 2UV8G 1CVJA 3CUNA 3MF5A 2HHXA 1KRPA 2V8PA 1NZAA 2MLYA 2J6SA 4I7FB 1QSLA 2FIUA 3RJMB 1HWKA 5HL7Q 2MZTA 4X4TA 2WZ1A 4LMZA 2OMOA 3E8OA 2DRDA 3CJQA 1KR4A 2ZUAA 2X1GA 3ZZ0A 2H48B 2XMJA 5H9EK 4DR2F 1ICEB 3M8YA 4ZPCA 1X5PA 2QE5A 4USHA 4LRBA 4YY3J 4MIAA 4U8VA 1L3SA 2LVWA 3FMWA 3MPDA 4OZ3A 4WK1A 3V4MA 3VQTA 2XWXA 4A8FA 1UJ4A 2D3UA 4ED2A 3H2LA 5E2QA 1S10A 1JLEB 5LM7E 2J8AA 5D8HB 3LA0A 1RCXB 3OTBA 1GMUA 5K14B 1WKLA 1IR0A 1TK8A 1WF0A 1NM2A 2C22A 3UNYA 3AQOA 1FHTA 4ELTA 1HMVB 2CDRB 5A0YA 3NGSA 4ID5A 2CPEA 3E2EA 4YR2A 2MJUA 1RHKB 4O44B 2LU1A 1E6YA 1EHWA 2ZFHA 5DS7A 4YR0A 4NXMJ 1JJCB 2NLWA 1R0CB 4EK2A 1FO1A 4ED4A 1SH0A 1H2VZ 3X1LB 1TL4A 2DBBA 3DRXA 1M0SA 3CT9A 3H90A 2LQ5A 5KT6A 1RTDB 3JTOA 1H98A 3QSYB 1X4HA 2WW8A 4B9TA 2FVSA 3ENQA 1HBNA 3QWUA 4S0MA 5CYMB 4RW6B 3PW5A 3AODA 4J9RA 3RRHA 3MPYA 1EAYC 2RU9A 4CLKA 4U7UK 2WSCC 2RIJA 4JI4F 4E98A 1O6XA 2UXBF 4HI2A 3MPVA 4GC6A 5KFIA 4NLYA 3CDEA 3LP1A 2VQEF 3KKFA 2YKOA 4K4WA 4C11A 2QG9B 3DOMB 1HW9A 1BE4A 4CLZA 2HFOA 3OSNA 2I6WA 2M5YA 1UFLA 1WEYA 4ER8A 3I0RB 1F60B 2R8HA 4JBCA 2IA6A 2JDJA 1C0TB 2UVVA 1HBMA 2DHSA 3OVAA 3UR0A 2B4UA 4EZ6A 2XS7A 2QA1A 3I56S 1TP7A 3CXCR 4LFBJ 3PDNA 2ZZTA 4QPTA 4FNIA 1H74A 3RB0A 4A8XA 2HMIB 1LEOA 2A2CA 4KGVB 4RNHA 1AUSL 2MQNA 4CH1A 4D3HA 2UXCF 4DXLA 1FE4A 3H7HB 4CO4A 1N33F 4DOZA 5D3GA 1AW0A 5I42A 3HFZB 1J5OA 4RUAA 2MZJA 2UUTA 1CJTB 2ZJQQ 1JLBA 4YDDB 3EYZA 4K4XA 2E1PA 3MMBA 1JWWA 2EPIA 4DSIA 4G3IA 3IM8A 2CUYA 4IG3B 3MR7A 5HLFA 5KFDA 4NXNF 1HLWA 1HPZB 2OTJS 3MUMP 4DR3F 1VBZA 4U67Q 1TKTA 2WB1D 3MI7X 4OI3A 2RU3A 2Q3PA 3BBBA 1VQ5S 4X4UA 4JI0J 4A8WA 5T7LA 2HHPA 2ZOFA 1JLFB 2K7KA 2FVCA 4ZPWR 2VC1A 3R7SB 3KUEA 2HFNA 4ID8A 4YMEA 4KT0C 4NI2B 4P73A 1YJUA 1RT3B 1PJ6A 2LQ9A 1NJXA 3DN9A 4JUZA 2ACMA 4C8OA 4C8NA 2J6UA 2R8GA 1RKIA 2IYIA 5BYRA 4RKUC 1TMJA 3PR5B 4GRSA 2E44A 1EX8A 2KG1A 3IRWP 2V50A 3FBBA 3KJVB 2I8EA 2X7IA 2DXDA 3VAFA 1MWYA 1NUEA 2CWKA 2PA3A 4FS1A 2Y1JA 1RKJA 3K17A 3CD0A 2QL5B 1P1LA 1RT7A 1NKCA 5EDWA 2RKIB 5KG3A 4Y2MA 3QATA 3WZ0A 2RDDA 1M5SA 5KFFA 4USJC 3CDUA 3FBCA 1SVDA 3ZC4A 2FTRA 3BZQA 2B8PA 4PWDB 5HMYA 3LO3A 2KVQE 1C1BB 1YTYA 3NWRA 2WONA 1RISA 4IKAA 4K0KJ 4O4RA 5SZTA 2P9CA 1TKXB 5GMKa 1N5QA 4GKKF 2CZ4A 3ILLA 2XY7A 3BKFA 2HQIA 3MOZA 5KT3A 4DWIA 4CYUB 1WI6A 5LJ5Y 3W5YA 2OPRA 1FKOA 1S0OA 2B6AA 4P75A 4K4VA 2F4VJ 3GJTB 2GVDB 3G8SA 1XNQF 1GTEA 1FXLA 3GLJA 4QU7A 2OPPB 3HSZA 4WIIA 2NZ4A 2RJZA 5EWGA 4OYIA 4M5MA 3DXBA 2EFNA 1U49A 2DJWA 2CQDA 4DG1B 3R27A 2IPOB 1RAFB 2EEYA 3Q8SB 1U1QA 2GHVC 1DARA 2IDEA 3VGVA 4B9NA 4MT1A 1Y3JA 4B9UA 3CO0P 4UOCA 1N36F 3TW0A 3DOKA 1HI1A 3RBXA 2HGNA 4G65A 4JV1A 2VPXB 1FJCA 3HSGA 4IQXA 2FJVA 1IBMJ 3C15B 3I96A 4FXWA 4USKA 2OI2A 2APOA 3OL9A 3K8VA 3GJQB 5KFMA 4QPXA 3HSJA 4IH6A 3TA1A 2ZM6F 2R7WA 3UPFA 4X4QA 3A4TA 2OLWA 3SZ2A 1N34J 1VDHA 1MWQA 2UU9F 1Q53A 1AXQA 4ILRA 2D69A 4QW9A 4JI8F 4ECSA 4EO8A 4R25A 2AP6A 2VFUA 4CLFA 2DD8S 1HYSA 3UW1A 4DV0F 2GX8A 1YSJA 2CIMA 1RLDA 2WSFC 1B99A 3DC2A 4IH7A 1Z4UA 3KLVA 5ETNA 5IT9Y 4LF1A 2FLOA 3FRZA 5CHCB 4ALZA 2DK2A 2GVZA 1VRTB 3P45B 2HW3A 3N0VA 1OYDA 3T41A 3NCRA 3TQEA 1S12A 4KJIA 2CQ4A 3CNQP 1FKAF 2QMUB 5BXIA 3GILA 4B3TJ 2KKHA 2YKMB 2OHDA 2V8GA 2HBRB 1VMBA 2I5JB 2AMCB 2ZJRQ 4USMA 2MKYA 2LEPA 4ZVUB 1JIHA 1D09B 2Q1LA 3CDBA 3M1VB 1FJGF 1M5PC 4X66J 2Z2MA 4UZCA 4XDCA 5F0WA 2OPQB 2L41A 1AFIA 4HYKA 3KUGA 3H20A 3ULHA 2IJFA 2O66A 1JLQB 4DV2J 2F9DA 2HFVA 2CJXB 2ZOGA 3O6QA 5A6WA 2XI3A 1SCJB 1RTHB 5THWA 2DYAA 2VD3A 3HXMA 2VPWB 4H4KA 1V6HA 2IM0A 2ASYA 2VFRA 1TL7B 2K2PA 4WZMA 5MLCV 5B0GA 4W90B 7FD1A 4QYZK 2MY7A 2IHR1 1DY3A 3P6YC 1C0UA 1WELA 3AOBA 5J2QB 5JUMA 2GCFA 2MQPA 2DVIA 4LF7F 1XMOJ 2UVWA 4UOHA 1NSAA 4ECVA 1NK6A 1OWXA 2NSBA 2JX2A 5CZXA 3D1QA 4DPOA 1N5YB 4FBUA 2XYGB 1LW2B 4Y3CA 2BABA 4F0MA 2KT3A 1YRUA 4ZPBA 4NA2A 2F7VA 3ILIA 1AZSA 4WP8A 2DGUA 1FFGB 4LBIA 2UZAA 2CPFA 4MFBB 2FVQA 3ONQA 1FWPA 4J9VA 2PI4A 2JWNA 1HNIB 4CRJA 3HJFA 1S59A 3PFOA 2V2KA 2DH9A 4KIAA 3PJ9A 4Q0BB 5JXSA 3MXHP 4PXBA 4JP8A 4CM0A 4K5SA 5AE2A 1NK0A 4ECRA 3GJRB 2AJQA 3GSDA 1UA1A 3W8PA 4ICLA 3IRXA 1I3OB 3VALA 2XS2A 3OFGA 4RUBA 5KFTA 1IM6A 2HGLA 3KJNB 4U9RA 3Q8VA 1U09A 1DTQB 3RR8A 2UXCJ 3NG8A 1NK9A 1TVRA 5B0EA 4RL1A 1EP4B 1FERA 3SBMA 2PI5A 5I3UB 2AEMA 4ED3A 3GIJA 1TUGB 2W25A 3MM5A 2NXEA 5F8MA 2F8HA 3NP5A 2YX1A 2VKZG 5AE1A 2LEAA 2L9WA 3MDFA 3HHKA 4ZP9A 4QQBA 3P96A 2FLNA 3C16B 4AL5A 1BWEA 4IOBA 5GAGU 2QFIA 3M32A 4ECWA 4EMDA 2VOPA 4ED7A 1XR5A 2R3VA 2G2ZA 1O0PA 3BGRA 2VF3A 3KJQB 2VA2A 3RW7A 1DQ9A 1SQFA 3DI6A 6FD1A 5KG7A 3KK2B 1YDLA 3UN2A 1RT1A 1KBRA 3SFGA 4HACB 2AU0A 4DL3A 5ITHA 2NUUG 3QRQA 4FXDA 5LMUF 3ZNJ1 4M5GA 3GPAA 4F8RA 3I31A 4ZN1A 3OTCA 1FWLA 2V2ZA 2YQ3A 2H9ZA 4PG8A 2LU2A 1YJ7A 2IIHA 1QDUB 2YVSA 1KEKA 3AOAA 1VQ7S 4Y0FA 2JFKA 2MKJA 4ZCMA 3OLBA 1IBKJ 4RNOA 1ZAXA 2LKZA 5T41A 5IM0B 1BY9A 2D9OA 4Q44A 3PO4A 1NHUA 3CMAS 5AJ3F 2ZOMA 4RW7B 3IG1A 3N79A 3T19A 5F8IA 1RHRB 2JFDA 2CPXA 1RWXB 4GVBB 5D77A 2W9BB 2BANA 3GR0A 2QLWA 2E9ZA 1Q1KA 1YJTA 3W2WA 2C2EA 1Y10A 2MMYA 2HQGA 4IYQA 3W7BA 1Y11A 2RB7A 1T94A 3TAQA 3ITHA 2HFZA 1X31C 1PSDA 4EBEA 5A8KA 3JSMA 4DR5J 2AYBA 1F3VA 2Y9HA 1O51A 2HEKA 3V2UC 4NLUA 3OVSA 3U1LA 5LSRA 2R7RA 1U7LA 3S01A 2LQBA 4QWAA 2XHCA 4DN9A 2Z0GA 4HLBA 2NCKL 2MLZA 4FVMA 2AGQA 3BH7B 4J37A 3M9OB 1VCTA 1HW8A 4OI4A 4DSEA 4KPCA 3SYZA 3M05A 2Y8YA 2CA9A 3TUPA 5C24A 3IMQJ 5E0OA 4URQU 4MJKA 5KG1A 2BV3A 3THPA 1FNXH 2MJNA 2FB0A 2UUBF 2KTQA 3DXSX 2V8DA 2CNNB 1YJ9S 4C8KA 3VGTA 4CWBA 1MW7A 3N5FA 2AEJA 2N4DA 4K7QA 4KHPF 2VL1A 4A8YA 1WJ9A 5DRKA 3D66A 3US5A 3ZTPA 3NAIA 2BUNA 2MY8A 4HI1A 4JV2A 2XCPA 5KFYA 4NLPA 4BHQA 3VTIA 3POTA 2C1EB 5CA5A 1GK8A 4XDDA 2ZH5A 3DLGA 2JNJA 1IWAA 1K0VA 4ENOA 1A0OB 5C42B 2QL9B 1HL6A 2HHHF 2XNQA 3D0IE 2LEBA 3VAKA 3OUYB 3J7A1 1S9GB 1SV5B 4URGA 2HFSA 3D68A 4K4SA 3FBFA 3VAIA 3CB4A 1PJ7A 2MSTA 1FNMA 3L3CA 1VQYA 3BPDA 1SL1A 4FYWB 3HZEA 4LRDA 3D1OA 2EW9A 4I2PB 4CO5A 5I3PA 3MEGA 1UL3A 4JI8J 4YS2A 1IKWA 1BHNA 1GX5A 3PX0A 4PR6A 4ZITA 2AYMA 1HNXJ 1B7YB 3G6ES 2F65A 2RRNA 3MMCA 1HWLA 3PCOB 2LXFA 3DOLA 4DF8A 5U47A 1C1CA 5F8LA 3FCWA 4TU9A 4ZVPB 1RHMB 3OLAA 1UCNA 4PEOA 1BQNA 2BW2A 3LQVA 5M2PA 2RQCA 3G9CA 1U0HA 3DNCA 2M9KA 4RUCA 3RRGA 4ZP8A 2B3TB 2PIIA 3C6UA 3HO1A 2G9OA 5F9NA 5DM6Q 1HD0A 2V5HG 3HD2A 2FJXA 4KO0A 4DCPB 5KT4A 1HBUB 5FLXU 2IRYA 3PYFA 3W9JA 1SUQA 3OL8A 1UP1A 2CNLB 3L95X 1HNVA 5D0RA 1PO6A 4EU0A 1ZAWA 2EFQA 4ZPDA 1X8DA 3PIPQ 4FF4A 3TX8A 3VCDA 3ZZPA 1F0XA 2QYCA 3I6PA 4DV1F 9ATCB 3MUVP 3TA2A 3ET6B 2DCUB 4WK3A 3DU6A 3UQSA 5DZ6A 2RVJA 1RT2A 2R2RA 3BYRA 1VYAA 4DX5A 3KLIB 2ZH1A 5BR8F 3AB4B 3L7UA 1WORA 2K7JA 1QJHA 2VG6A 3N4WA 2DGSA 1RHUB 2C2NA 4CNZA 2HZCA 3CTRA 3WQPA 5D4PA 3J81U 2J76E 2LLZA 4N5SA 4KGMA 2XM3A 2IVYA 4A47A 1SB6A 4NA1A 2W8LA 3B8HA 3M2RB 4QR1A 3W8GA 3VAGA 3QAUA 1YG0A 4DUZF 4RNFA 1RE1B 4KFBB 9RUBA 4P6QA 1AA1B 3LGMA 5KOWA 5FDLA 4UW2A 1U8SA 3HX9A 3NGKA 1V5VA 1H7XA 2JEFA 3Q89A 2FHMA 2AX1A 4FF2A 4CLWA 4ZLLA 4KTQA 1HIYA 2F5GA 1MMLA 1JXLA 2IC3A 1WF2A 1DQAA 2ZKUA 4KKOA 1XC9A 2XHWA 2NR0A 2GFFA 1FRJA 1WC3A 4WXWA 1YQHA 5KFCA 4M5DA 3LW5C 3EMTA 1S6QA 2XSJA 4L74A 4DZDA 4NL5A 3MM7B 2KT5A 3BKUA 5GMDA 4HH0A 3P49B 5CYJA 1UMJA 1IR1A 1W2BR 3PYDA 3R3TA 2PN6A 3DLKB 4RX6A 1ACMB 3MM8A 2M8DB 2M70A 4TYAA 1J5EJ 4V19J 3MD3A 4EWTA 1U6ZA 1PAUB 3TEGA 3BO3A 1Q8KA 1KTVA 1Y5NB 4TY9A 1IQZA 3M6XA 2ASLA 4WE1B 4LFCF 4JI7F 1U02A 2HNZA 1LNQA 2VBZA 2OMLA 4WKYA 3BQ1A 2BE2B 3IA0A 4PKDB 2HWTA 3HT3A 3G96A 3QGIA 2CAJA 4J5OA 5D0GA 4LF6J 2H5JB 3HSDA 4LUBA 1S1WB 4ELVA 4KV8A 5L39A 2RILA 3KK1B 4L76A 2UXDF 4DR7J 3KTQA 2OKQA 1K1SA 2C2MB 4OX9J 4OI2A 2ZBIA 3M8QB 3H2VE 1U1LA 2HFUA 4A8OA 3G71S 5IQQA 3MR6A 4LF4J 2C3OA 5GAGI 3H4DA 3MCSA 4NCGB 3HHLA 3K5NA 1H3DA 1VLOA 3GYXB 1IBLF 2BJ9A 4AQYJ 2GNKA 3K0JA 1X5TA 4J9QA 4R8UA 4EZ9A 4OHYA 3PEJA 1CSJA 4F3QA 3M2UB 3CWJA 2HIQA 2Y0BB 1O5JA 1XQIA 2ILYA 1N32F 7FDRA 2F8MA 2CPZA 4QWDA 3DGPA 1FRMA 3VR1A 4X65F 3OL7A 2RAQA 1RB0A 2W4PA 3UCUP 2DPIA 3R1LA 3PW2A 4WTYA 2FHOB 1U1RA 2K06A 1V3RA 1VFJA 4CT8A 1SJFA 3MPUB 1VGYA 5B08A 4AXJA 2EG2A 1NB7A 2CPDA 4DFKA 2E1RA 3R5CA 2HHSA 1ZA2B 3FKBA 3BQ2A 1WTFA 1UEUA 3F0NA 3LANA 4C97A 2O01C 2NZCA 1VQ8S 1P9QC 2Q66A 3HI9A 2VG5B 4DV4F 2CXEA 1S1TA 4RW4B 2YWFA 3R2DJ 1N4LA 4G1QA 3R1HA 3MCNA 1CQMA 4PG6A 1G4CA 3ZZUA 4WYLA 3BH6B 2RT3A 3BDEA 2FDNA 1ZPVA 2P8IA 1QE1A 2LXIA 2VB6A 5IQ6A 4TU7A 2DPJA 2V4JB 3HLUA 4JV0A 1N5VA 3KHGA 4FNHA 3OTOF 2YNHB 1XNRJ 1U2RA 4NLVA 2YKNA 4PQUB 3UVJA 1RA6A 6AT1B 2MKKA 2B5JB 4O4GB 3D54A 1G2EA 4R0JA 3KDOA 5KFPA 1S1VB 5HK4A 1MLAA 4OJ3A 8AT1B 1RWMB 1HHQA 2YPYA 5J2MA 1R6VA 2XNRA 2B4VA 2A0FB 1KDNA 3GONA 5B0CA 2MQMA 1KWMA 1VQOS 2GIQA 5EHHA 3H25A 3MM6B 3BSNA 2ZH7A 3ZZOA 3DRYA 2OP5A 2DGXA 1N6QA 1N0VC 4I6AA 1LV5A 2UUCJ 4LSNA 2EVZA 4IO1A 1Q5VA 2MKIA 2NXUA 3PJXA 3PRDA 1HI8A 2VJUA 5HROA 1XN9A 5KFEA 3PNIA 4DL2A 1QTNB 4FYVB 5ETMA 3CMQA 4RW9B 1GXTA 3HJVA 3QJLA 4ZCLA 5E3QA 2KJVA 3KJFB 5LSLA 5LXYA 2YNIA 4ZA1A 1FJ7A 2DH7A 4NLXA 2ASDA 2FJBB 1U26A 2EWHA 1K0TA 1S7HA 5DQIA 1IKYA 1FKPA 1SJRA 1WD6A 3PRVA 4YUDA 4GVLA 3DLEB 5CABA 1RWKB 1LXJA 4IDKB 4O23A 3TZZA 3CJSA 5LT5A 2IA0A 2C42A 1KN6A 2KDOA 4HDHA 1NDCA 1GEHA 3IGNA 2KL8A 1CULA 3RU0A 1F9EB 3B4MA 3LGHA 1D1UA 3H0PA 3TP2A 2FHJD 4O3PA 1F5CA 3SCJE 4U95A 4ZHRA 3MAAA 1ULRA 2GQ2A 1TL3A 4C9DA 1KOHA 2HBQB 3FJ2A 3JAMU 3JQMA 4IR1A 1WG5A 2AHOB 1IKVA 3VAMA 4CO0A 3CMES 1AROP 1R8PA 4TVAB 1WSVA 2MB0B 1R89A 1XMQJ 2DNKA 1FK9A 3DRRB 1K8AT 3R97A 2BMBA 2GGPB 5HP1B 3K57A 1LFWA 3OHBA 1YVFA 4IFYB 3C6TA 5KFRA 4F0KA 1URRA 2ZKTA 3FC9A 2XLKA 3BM7A 5EX0A 5IFMA 2KM8B 3DLJA 4OZ0A 4K8RA 1D8ZA 2EKNA 1HR0J 2N3OA 2G0JA 1FDBA 1TU0B 3K58A 3HPOA 3K5MA 1RT6A 3JSRA 5E3RA 1N5TA 4DSFA 4HKQA 2BKOA 2QT7A 2HNYA 3WIVA 5A8RA 2PMWA 1VQ9S 1BXNA 4NLTA 1V9OA 4LSLA 1Q95G 3ILJA 5DJBA 4NZ6A 3BN4A 1S5ZA 3MHYA 3ICLA 3M4XA 1JLAA 3QFHA 4BS2A 3TWZA 2QO3A 3T9NA 2AJ2A 4E0DA 1RHJB 3EUNA 2E7XA 2VONA 1L3VA 4X64F 2QV6A 2AZ1A 2GZOA 1T9XA 1S4FA 3W63A 4YR3A 2CQGA 3NNCA 3R2CJ 3NCPA 1NSKL 4DV5F 2CKWA 4QWCA 3CVKA 3HFVA 1R7IA 3MAQA 2G13A 1GAOA 1Q78A 2FVPA 1NJYA 2E9TA 2DEIA 1W7WA 1A9NB 2RNEA 2DTJA 5DQGA 2B7BB 2QA2A 5A0YB 1XK8A 4ID5B 2MDAA 1IVZA 2AD9A 3GYNA 5KAKA 2Y1LB 3H5XA 1SBRA 1T9YA 4RLEA 5I3QA 4K4ZA 4YB1P 1HWJA 5H9EJ 1UPMB 4OYOA 2FGCA 3DMJA 2HK3A 4ANCA 1LWEA 1KHWA 3N9UC 3JYTA 4OZ2A 3UDLA 5EN1A 2GA7A 2AGOA 4A8KA 1Q8BA 1NHVA 1FEEA 8ATCB 1HBNB 4PWUA 3W9IA 4C0BA 3BGLA 4UQTA 3K7RA 2VASA 4DUYJ 1YJNS 3KLEA 4A8MP 2W2QP 4YDXA 4NX9A 2FYXA 1N56A 2POKA 1WC1A 4X2BA 3ZTSA 5B7WA 2R9LA 3ZFVA 3LP1B 4OX7A 2HHTA 1X60A 1N48A 4C11B 4CO1A 2C28A 1EB0A 1S97A 3Q8UA 1R8AA 1Z2ZA 1Q7LB 1X4BA 5A2QU 3HP6A 3TARA 1UVMA 1HBMB 1OPZA 2WVCA 4M95A 2HVDA 3OL6A 4DV3J 3FEYB 4YY3F 2JZ5A 4B02A 2VUGA 3FRYA 1X4GA 1HPZA 3GV5B 5HBMA 4X4OA 2H4WB 1NH7A 5CAAA 4I2QA 3M6UA 2R7XA 4I67A 2ZHAA 3JB9k 4RW8A 1RAOA 1LWXA 2XZTB 4M5JA 2F40A 5D3GB 5GAHU 2ZH3A 2E9RX 3ENAA 3K5OA 4LF2A 5I42B 4JI6J 1SKSA 2AQ4A 4L75A 1SQGA 2B0GA 4ECTA 3GIRA 4JI1J 3D2WA 3SV3A 2ZWPA 2CQIA 4NI2A 2BJ3A 3RRKA 3MMBB 4L73A 3HHEA 3AY0A 4PPZA 1VJWA 1FDNA 4XK8C 4NXMF 5GMEA 1IM4A 2XZWA 1SC3B 5HLFB 2IMOA 3HVWA 2F9JA 2OPSA 2W2NP 4FPRA 1ZA1B 2NYHA 3BN7A 2YNGA 1I51B 4CNYA 4N47A 1TKTB 1UAWA 2DEJA 3J7AN 2YKQA 3MR3A 3D3CJ 4DLGA 2AYGA 1CPZA 1R3NA 2DISA 4DV4J 4PWWA 4ATNA 5IV3A 1U4BA 5T7LB 4DQPA 3MFIA 3Q24A 4ED1A 2WBMA 3P3DA 2I0XA 3Q8QB 3T1HJ 4CLUA 4ZPAA 2VOOA 2BM0A 4E2FB 2Z30B 2HQ3A 3TZXA 3W1YC 4CCHA 4CH0S 5DG8A 4I6WA 2WOMB 2XULA 4I6YA 1CG2A 4I0WA 1WDTA 2O3DA 4NCAA 2QA4G 4H4MA 2E7VA 1RAJA 4ZIWA 4PWDA 5L9XA 2D3O1 2P9GA 1FD8A 2CJKA 3T6JA 1KD1T 1I94J 4OYZA 2Y8WA 4P72A 2YKAA 1EJ7L 3KLHA 2HVZA 2LECA 2IBOA 4QR2A 4LFBF 4DQSA 4Q7AA 4TQSA 3O8WA 4DFPA 2XZDB 2ADBA 2COLA 1VC6A 4F50A 5F8NA 1RT7B 2IDLA 2LQJA 2GVDA 1VC0A 1U47A 3FSIA 2CZVC 2XLJA 2OPPA 3SQOP 2JLFA 2W2MP 1GQEA 4CH7A 3IXQA 1NPRA 3MEKA 1KLMA 2VV5A 4CM2A 4FS2A 4RWXA 3NEKA 3KLFA 1I5OB 1M5KC 2WONB 1QAYA 3ZZTA 2E66A 3C46A 4UOGA 2MPUA 1XJWB 3CSKA 1MMNA 2HBYB 3S7RA 2G2YA 1UWAA 4KHRA 1C2PA 4Y28C 3Q8PB 2QSWA 4QYRA 1F2HA 2OPRB 1FKOB 3EPGA 4ZS6A 2BR0A 7AT1B 5E3PA 4JI0F 4ANEA 4N56A 2R7TA 1HBOA 3IWNC 3RAQA 4WZQA 1NHKL 3DCAA 5DQHA 1IBCB 4B3SJ 4H4OB 3K2YA 1S99A 4QU6A 2R42A 2FVRA 3R5BA 3UCGA 3OR1A 1Q4RA 2Z2LA 5CCMA 5FJ4A 2I9SA 3CD6S 3A12A 4MKBA 3DOKB 2AJ1A 2JHEA 2KZMA 3CJ2A 3BF4A 4DL7A 3PYEA 1Y3KA 5E7OB 2C2ZB 2V67A 3BSOA 2MQQA 5IS2A 1TKDA 2AEFA 1D9FA 2GJ2A 4TY8A 1H72C 3N6MA 3T3FA 2OJ3A 1L3UA 2OSQA 3AD7C 3PEHA 2DNYA 1HNWJ 2QMWA 1FRXA 2HQCA 2J6TA 3D67A 2P6TA 3RG6A 1HYSB 3HVTA 4WKRA 3EVMA 3TNVA 3I5CA 4LBHA 1NSPA 3N28A 1M5HA 2GVZB 5DDOC 4ZIVA 4PQAA 4K0KF 1QSSA 4P2FA 3RBDA 3TUJC 2XMVA 5KG0A 2MTLA 4M5KA 1Q8LA 2M0GB 4Y65A 5AT1B 3OTDA 1HNZJ 3C14A 1ZTTA 2UUAJ 1R8BA 1F5BA 4J9KA 1YITS 2B8QA 1UFKA 2G0IA 2RRBA 2C2OB 2F4VF 3KYLA 4DV5J 2B9WA 4OZJA 4C48A 1ZM9A 4F04B 3NMRA 5FLXY 2ATCB 4P2MA 3NCQA 1KVJA 3W60A 2R2SA 2KN4A 3I4PA 2HHQA 4PABA 8RUCA 1CJVB 1XR6A 3T1YJ 3MEEA 4K4UA 2AWZA 3NAHA 1BQMA 4QWEA 1IBMF 4RNNA 4P52A 1PIEA 5DDQC 2DXFA 4OL8A 3ETOA 4KBIA 2HQDA 4OIXA 3NBPA 4F26A 1GFWB 1FVSA 2M8HA 1U45A 3D5MA 2MQOA 5DO2A 4ZVEA 4IOAQ 3QT5A 4P7VA 4Q8FA 1VHIA 1YX2A 3I32A 1YJRA 1FDDA 3LP0A 3J81Y 1N34F 5E3CA 4WFZA 1NJZA 4ES1A 3M30A 1RSCA 1OY6A 2IM1A 3BQ0A 1WHXA 4OJ1A 3OQ2A 3VGUA 3V81B 4MAKA 3VZHA 4DQRA 3KNGA 1AZSB 4DL0C 2JVOA 4LSZB 1RWVB 4FVCA 1BGXT 4BWMA 2E5IA 1EP4A 3OFEA 3MWBA 4UTGA 2HHVA 3BJYA 3QMQA 3OTEA 2HRUA 2DITA 3UD5A 2RD5C 4G1PA 1X7VA 1Y4ZB 4F2RA 4QYZJ 1VQMS 2HAIA 2MZSA 3IN5A 4B3TF 4Q5VA 1EARA 4HR2A 4LRAA 4ICLB 3IRXB 2HSEB 3MPWA 3S1TA 2DH8A 1T7PA 5ETKA 1OO0B 3SFUA 3RR7A 4D3GA 4X66F 2JJ4D 2KRRA 3D6FB 1NRKA 5E5NA 3BGUA 2DNMA 1GT8A 1TVRB 3WBZA 3KOAA 4UT4A 2QIFA 4DV2F 2FUG9 5KFGA 1R6YA 3MM5B 3TA0A 1KTQA 4ED8A 1MG7A 1CC8A 1YBAA 1S77D 2MHEA 4URSA 5HI7A 1PC4A 1L5UA 2HNDA 1KSPA 4ZP6A 2ZE2B 1S7IA 2DKOB 1RA7A 3A13A 5GAHI 1UWBA 1X9SA 1T3OA 2DR5A 2H5EA 3M32B 2ROPA 2KHCA 1LK7A 2B9YA 4NZ7A 1JJ4A 4JB8B 3GFHA 3BGRB 2VBXA 2W9CA 4AYBD 1RK8A 4RW7A 5LOQA 3DI6B 2DNGA 5D0EA 1RT1B 4PXDA 2J9EA 2Z58B 3V4IA 2RE1A 2Z2YB 2XLIA 1CBKA 1D9AA 2DIVA 1XMOF 4DX6A 4AUKA 2J9DE 1X0FA 2X3DA 2YKPA 3AD9C 5K20B 1TFWA 3I9V9 5DG9A 2CJQA 1UVJA 2RQKA 1SPBP 1VK8A 1CJKA 2WVDA 1S9EA 3ADAC 1NU4A 2GMJA 1WEXA 3FMBA 4PAAA 4I1TA 1B7FA 2GC8A 1DURA 3JTNA 2FHKA 3DGVA 3IG1B 2BANB 1FTRA 1H73A 1VQSA 3W64A 4DS5A 4K59A 3B82A 3W2WB 2OAUA 4PRFA 2EFOA 2HKEA 4C0OC 2G0CA 5HQMA 5I4MA 4C98A 3OJSA 4P74A 4GO5X 2FY1A 2C2KB 4P9SA 1RTJA 3W9HA 2LMIA 5A8KB 4F2SA 3JSMB 3QLHA 4YEAA 3LPEA 4ZK7M 3PW7A 5L38A 4CP5A 3SV4A 3ZZZA 3OW2R 4FDFA 1FRKA 5GAEU 2KM8C 4QIEA 3MCOA 4KQZA 1Z2LA 2AT1B 2R4FA 3E3XA 1OS5A 5AXLA 3CJ3A 4RBVA 3AFGA 4UY85 1LXNA 4K4TA 3QGGA 2P9EA 1TV6A 5C24B 4OV1A 5B09A 5AE3A 1JX4A 2BM1A 4TLQA 3CCWA 1TUWA 1UPPA 2R7QA 3CCJS 3RAMA 1S9GA 4OHVA 4PXEA 5A8WA 2QLXA 4AL7A 5ETQA 4F3OA 3TOQA 3NNHA 2J7KA 5KT7A 4RO0A 3I5BA 4FZVA 2DIUA 2GJFA 4OYMA 1U48A 1PYOB 3QPIA 4DPXA 3FBEA 1MN9A 5ETRA 1RAAB 2CG4A 2CJYB 2ATLA 3TUIC 1F9FA 1S6PA 4USTA 3SCKE 3X3UA 2Z56B 3POTB 1ZAVA 4OMFG 3HDSA 2ZH8A 2E29A 3DLGB 1HQEA 1IBKF 1KONA 2VZ9A 3HMJG 1Q86T 1RBOB 1SI9A 4OZLA 3ETMA 4CO3A 1FXRA 3EICA 2DO0A 1RTZA 3ISZA 1MU2A 5DG7A 3C19A 4J9OA 4RU9A 2VG7A 3F56A 1Q7YT 3M8PA 3FZBA 2WSEC 2HRYA 2XWYA 3MMAA 3G6XA 1KNZA 4DR5F 2XMKA 3SDEA 3JSBA 3MEGB 3OSPA 1PYTA 4WFNQ 1IKWB 1RWUA 5D4LA 1OSDA 3W61A 1FEHA 1Y9OA 1RYSA 3PW4A 3QWPA 4NLOA 4FYDA 4FKXA 2XMMA 3OV7A 1YI2S 4PG7A 5HJXA 1Q16B 4C8YA 3MMCB 3JS9A 3DOLB 3O5TB 3D9BA 5DGAA 1UZDA 1FJEB 3DRPA 1MROA 4DV7J 5A6PA 3W3SA 4TYBA 1BQNB 4W98A 1G6BA 3SCIE 3FFIA 1NB2A 1LWFA 1U0HB 3JAMY 4OZ5A 2A3JA 1H2TZ 1DTTA 4KAIA 1Q82T 1DLOA 1VHFA 3VZIA 4MKVA 3R5GA 4JI5F 4DCJB 4KO0B 2B43A 4RPFA 4CQ1A 1SUQB 2RHSB 2HYIB 2CQ2A 1SIWB 2MYFA 3FZ2A 1VQKS 4Z37A 1JMTA 4Y6IA 2CQ3A 4FKYA 4FP9A 1NK8A 2K3KA 2L48A 3FCVA 1W26A 2IAJA 4I68A 2JLEA 4X84A 2WBRA 4DSKA 3RZAA 4TN2A 4XO0A 5AXNA 1X0PA 1RT2B 4WFYA 5B0BA 3G8QA 3PYGA 3UD3P 3H42A 2HAFA 2CPJA 1SJ3P 2VG6B 1SH3A 1RAIB 3SEOA 4KPYA 3TQ1A 3L7OA 2Q6CA 3IO1A 4J9NA 2EFGA 2U2FA 1ELOA 5IWAJ 1ZM4A 4MIBA 3VAHA 2D74B 3FEXB 3V6DA 1YRXA 2X3GA 1X5SA 3QQCD 3IR7B 5KT2A 3MM9A 4DR4J 3PKMA 3NS7B 4DX7A 4JV5J 2RDIA 1B0PA 3PHEA 2AX0A 4LF8J 4U96A 4N41A 2GQQA 2K1RB 3G87A 1SKRA 2D3ZA 5FDLB 1S1XA 1HNXF 2XGQA 2WVEA 4DV6J 2CRLA 3EDRB 2DY1A 2OELA 3SQGA 4L72B 3TJAA 2IC3B 1RJJA 2B7CB 1RI7A 4KKOB 3OFFA 4JI2J 3GV7B 2KJWA 5E3AA 2WHOA 4M5DB 1S6QB 1VBKA 2XSJB 5L46A 1Q81T 2YWWA 3FCHA 2QSFA 1UVLA 3UWTA 4F4ZA 1ZM3A 1VRQC 3GCWP 2ROGA 3PACA 2KXNB 1EKSA 2KXFA 1U1PA 4OYAA 3D4JA 3QIPA 2W9AA 3MM8B 2V4QA 2YH1A 2KT2A 1VQPS 1QD1A 3E01A 2J0QD 5IC4B 4F67A 2YWHA 3F73A 2M2BA 4QW8A 3J7YU 2XY6A 2HNZB 4ECZA 2CYYA 4RBTA 1I6JA 2RDJA 4DX8H 3M2UA 2CJ9A 1SL0A 2M52A 5K9FA 5CYQA 5HVGA 2RS8A 4KV8B 1NPKA 1TR0A 3CCRS 1UW9A 3CJ0A 3H4BA 2BE7D 2AJ4A 4C2MA 4Q2LA 2H4YB 2RH3A 1FA0A 4IFVA 4RBUA 4YN3B 5DGBA 5ETSA 4O3RA 1LFPA 3DRSB 1NPPA 3RGIA 2LYVA 2V8HA 2BDPA 3NGTA 5A2QY 3N5BA 3RUBL 1HHSA 2HVHA 1WI8A 4R5PA 3HHLB 2C3YA 1VIXA 4NYZA 1P1TA 5HVFA 3AA8A 1VRUA 3MZIA 3TVYA 3QO9A 1HFEL 3KG4A 3EZ5A 1JKHA 1FESA 4R8UB 1OY9A 2VJVA 1REVA 2B56A 2PSZA 5F3TA 2FC8A 4LR8A 2E7WA 1N88A 2VPZB 5KFSA 5DM7Q 1JJ2R 1OPIA 3DGPB 4BC7A 1WWHA 2ZH2A 2MZQA 3GE9A 4F36A 1MSWD 1F1BB 3GIKA 3G8TA 4QR0A 4LBPA 4M94A 2C3UA 4YP3A 2K3IA 2BACA 3QJPA 5LXRA 5BJRA 2VBYA 2VIHA 5K8OA 4C7QA 1TK0A 3TVZA 1YWXA 2W01A 4DS4A 2ZUGA 4EFAC 1H0HB 2EFPA 2XTJP 2EC2A 1U1KA 4UOFA 4AD6A 3PZPA 1J5EF 5DLFA 1ITPA 1BD6A 3AT1B 3W65A 1HQ2A 4G1QB 3NGUA 3EXYA 4ZVOB 3TVKA 3FQKA 1F9HA 2GAHC 1JNZB 3OJUA 2W7PA 5F8JA 5FD1A 2RUSA 1EZZB 3R5AA 1QE1B 5HATA 3CULA 3GR1A 2YY3A 4GMKA 3TR5A 2PFFB 3RAXA 4H54A 3R6GB 1QAIA 3EE3A 1M1GA 3U7JA 2XMWA 1RDRA 5L1IA 2L9NA 3CJ4A 1T3NA 4LF6F 2YKNB 2YBVA 3UVJB 3ZTOA 3P5BP 2CPYA 3Q0AA 1VLYA 1F6TA 4DR7F 1JLGA 2OSRA 1GX6A 4DL4A 3AHPA 1WOPA 3JXOA 4OX9F 4M1KA 4TXSA 3MEDB 2ZC3A 5J2MB 1AYEA 3I0SA 2IBKA 2NXNA 5C7PA 2H1YA 3A8EA 4LF4F 2QC3A 2HG4A 1ZYQA 3PKYA 1RT5A 2BOAA 1N6QB 4AQYF 3F44A 2E5LJ 4LR9A 1T03A 4C3KA 2HLUA 1Q5YA 4LSNB 5F9LA 1JXEA 3IWXA 5KG4A 2KZZA 4RU2A 2V8VA 2NPFA 5HROB 1R27B 2CPIA 1E6VA 4DJBA 4Q45A 3K5LA 2F63A 3QT8A 2YNIB 1YRTA 4DCOB 2WK4A 4C8ZA 2HK2A 2I38A 4QIWD 3IP0A 4J9MA 2BW7A 1IKXA 2XI2A 1IKYB 1FKPB 4ZOSA 2K8GA 4NLDA 5KFXA 3NXZA 1U6FA 3TRGA 1NEEA 4H4KC 2BE9B 3BO4A 1QLNA 1D8YA 1IUJA 1WC6A 4J90A 3GG0A 2GGPA 1QUVA 3CO9A 1CULB 1U1OA 3EGVA 3GMGA 4WIQA 2X1FA 1FFWB 3QZ7A 5H9FK 3D1HA 4DEZA 3KMSA 3HT0A 5HSPA 4TNOA 1MWZA 3GFYA 2W2PP 5D4OA 1UA0A 3UR3C 1XNRF 3MAAB 1TL3B 2BRKA 3EM1A 2PMHA 2HVIA 1IKVB 1RWNB 1TL1A 1TKZA 1DAXA 1U0SA 4WU3A 3LH2S 3G82A 1FK9B 5HQ8A 1WOSA 5CXTA 4WBFA 4WP9A 5IOLA 3UO0A 4N77A 3GIMA 4O0NA 2A6OA 3DYAA 4V1Ak 1DRZA 4HL9A 1CS4A 5CD4A 2W24A 4ZLJA 4NRTA 4JI5J 3C6TB 2Z57B 1KFDA 3DDIA 1T9UA 3UNGC 3VGSA 3NGDA 2XYHB 4MYTA 2QEXS 4CLYA 2UUCF 5J2PA 4NEYA 1FX2A 3KHRA 1S79A 2V2VA 1RT4A 3V6HA 3D0GE 1SJQA 1YZ6A 1K9MT 1RT6B 2I1RA 4N7TA 4HHJA 4TKTA 1RHQB 2KH9A 4OYXA 3I5AA 3KDNA 2NYIA 2HNYB 1YGYA 5A8RB 4IRKA 1TTHB 4FYXB 3MD1A 2YNFA 2R7UA 4CZCA 2M88A 4F0HA 2A6MA 4Y00A 2IRXA 4NE9C 1F3FA 3W5ZA 1V3SA 4LSLB 1VBXA 3WX8A 1JLAB 2BRLA 2ZD1A 3LAKA 4OZ1A 1KC8T 3H5UA 3BBCA 2WVFA 1KVKA 1PAEX 2QYGA 2QJ3A 1T9TA 1IWGA 1TAUA 3SSRA 4PUOA 4W4MA 1K1QA 1MN7A 4JYAJ 2OTLS 1NKEA 1NSQA 2VPYB 2BKPA 5JMNA 4Z7CA 3ENWA 5L8RC 3Q22A 2NSCA 2XY5A 1OMSA 2IYGA 4K50A 1KQGB 2GS8A 2MKSA 3HHDA 1QY7A 4MKAA 1R0AA 5KG2A 2FY8A 4F3MA 4B3MJ 1AFJA 3FEZA 1S49A 1TAQA 2B4PA 1WTBA 1N52B 4ZP7A 4WP3A 2O67A 5KFVA 2KYZA 3GWCA 4KE5A 2JEGA 3UDCA 2VHGA 1XMQF 1HQUA 2CQ1A 3DMJB 2QRRA 3KWMA 2ZDPA 2NREA 4KY3A 2XG8A 3NOCA 2DRAA 1LWEB 1KQKA 3JYTB 3QRRA 2CG8A 3CCTA 1RADB 4UF4A 3SSSA 3H8YA 1UW4A 2VKRA 1U6BA 2DNZA 5JVGQ 4F4YA 2EXUA 5B0AA 1Q8IA 4RZRA 1HR0F 5KT5A 3KLEB 1P9YA 2KVIA 2E5HA 1PILA 3GCXP 3I82A 4B9SA 4G6VB 3HM9A 2VDIA 2ZEJA 4ZKAA 3BGOP 1S0NA 2PC6A 3T9ZA 1FFSB 1PBAA 4ZCKA 3DM2A 3J7YI 4ZPTR 2DHXA 1J27A 1S4EA 4B3RF 5G0RA 3JQKA 4C4WA 3WC2A 2YWEA 3SMZA 2LQ8A 4LJMA 3FGVA 4MK7A 3ZTQA 5CCLA 3VV2B 1VQNS 2F3JA 2VFVA 2DHAA 1RTIA 1X9WA 4U8YA 5HBMB 3IBCB 2R2UA 3H40A 2DNNA 2CQ0A 2XC9A 3CE8A 1W25A 4I2QB 4NWBA 4Y2IA 3J7ZT 2RF2A 2PA8D 4RW8B 4UUWA 2CQCA 2UV8A 3W2VB 3R5DA 2BJ8A 4OV6A 1VQ6S 1IXKA 3M8RA 4G1IA 2X1AA 3IAM9 4ED6A 3AA9A 3VAJA 2BA9A 3VQSA 2NUHA 3MECB 3R5JB 1D0EA 1RAEB 4UQGA 2DNQA 3CJKA 5IT0A 2DNLA 3PVXA 4B3OA 3GQCA 4LQ9A 3E51A 4OI0A 2WOMA 3AXKA 1FI4A 2EG1A 1FTCA 3R7NB 1UVIA 3G2XA 4UY8T 2OPSB 2ZBPA 1URNA 3M6WA 2VQFJ 3MCMA 3RW6A 2YNGB 5D15A 1NNDA 3TAMA 4DL5A 5KFHA 3T6BA 3KK3A 1AT1B 5KG5A 4YHHJ 4PYAA 4GKJJ 1S6UA 3QGPA 2VH7A 2B9XA 5IT4A 4QJVA 1QAXA 1RAGB 4DUYF 2GW8A 2N7YA 2BQ3A 5HO4A 2YPZA 4MIWA 4IG0A 1CEZA 4QBUA 3DU5A 1G3OA 1FWKA 2KHDA 3O2IA 3UD4P 2JC0A 3LP2A 4AXIA 2W8KA 2J7WA 2XQCA 3A8KA 3UN5A 4KYZA 1MNEA 3PX6A 4H4MB 4A48A 3PXGa 1KP6A 3W5XA 4QIVA 3BREA 3NS6A 4EGLA 1LWCB 2BJDA 4DDFA 5LMNJ 2RSQA 1JK9B 1RBLA 4DFMA 2W7OA 2KFYA 3CEDA 3KLHB 4DV3F 4LF9J 2ROEA 2AZ3A 4KR0B 2KG0A 1JLCA 2WRMA 3VVTA 2ALYB 1CJUA 3TJ9A 3IC1A 3GZ7A 2R8KA 1XMBA 1LQ9A 1IR2A 3DDNA 2AKWB 1F5AA 3GFXA 2BOPA 4JI6F 2FLLA 1VQLS 2VODA 1KLMB 4H4OA 4LFAJ 2E1CA 4HHHA 3I55S 3BYPA 4JI1F 5L1LA 2H3EB 1WDDA 2MGZA 1DQ8A 3KLFB 2ZBCA 4KC5A 3HD1A 2XO7A 2FHJA 2MZ1A 4ZVFA 3FK4A 3NMAA 3B54A 1GXLA 3SI8A 2GV1A 4O3QA 4BCAA 2YWKA 3PX4A 3UFCX 4IQMA 2GJIA 4C3MA 1EETA 1T11A 3IBFB 4BC9A 1WF1A 1HBOB 4OI6A 3KLGA 1WG1A 5J2NA 4RWWA 4X62J 4M63A 1PG5B 4IOCQ 3MTJA 4JI3J 4LRCA 2ZH4A 3CJ5A 5K8NA 1VR6A 2KB2A 3I4HX 2CZ9A 3T1HF 1HWUA 5EWEA 1T02A 4B9MA 2DNPA 4ZDNA 4LF5F 3OR1B 3DLHA 4DQIA 3A3PB 1JNRB 3OR2A 2BX6A 4WF9Q 3V6KA 3O1LA 1TZ0A 1T05B 2DRBA 2AIRB 1SKWA 4DL6A 4NMXA 4KGKA 1TK5A 1NCLA 4OX6A 2XGPA 1BWVA 5EGYA 3NNAA 1I94F 1NKBA 2B4OA 2C2RA 3TZYA 4TY8B 3GTYX 4OI1A 4DR2J 1RWPB 2G4BA 4P2XA 2CQBA 1RU1A 2D7SA 2DNHA 1S1UA 1WHWA 4DQQA 4DFJA 1R8CA 2RS2A 1M5VC 1QVFR 4MTPA 3PM9A 1RXOB 4UUXA 2JC1A 3PO5A 4CLSA 2ERRA 1DBDA 1OYEA 3HVTB 2O1PA 4M5LA 4DF4A 1WC4A 2FD2A 4U7UD 5C2GA 1TELA 4WFAQ 2FJWA 2P6SA 2CQHA 2E1MC 1LW0A 2HLTA 4DSLA 3EJMA 4ECQA 1S0MA 4C8LA 1CJVA 3PY8A 4LVOP 2JEIA 2R8IA 2AW0A 5C25A 4X4NA 5SUHA 3CGIA 1RLCL 1SJ1A 2ZH6A 3EZUA 2BVZA 3M2VA 3C14B 3IS9A 1SL2A 2JVRA 3AH6A 4RNMA 1P8GA 1R0BG 2MKCA 5KFJA 3GP9A 2Q6BA 2UP1A 2JOQA 5K5MA 2OFGX 3S8SA 5J1EA 2OEJA 3MOJB 3HHLC 3TUZC 4B3SF 4NLGA 3U1NA 3L7PA 4ZVTB 4WU2A 3P5TL 4AFFA 4ED0A 1RCOB 1X4FA 3M6VA 3V81A 1JXVA 2HZAA 4F4WA 2CVEA 3R6LB 4JI4J 4PG5A 2UXBJ 3MEEB 1GNKA 2J7UA 1TUVA 2LDIA 3TZWA 4ZJLA 4I7FA 4CTAB 4IR9A 1BQMB 3TI0A 3P8BB 3HKZD 1BLUA 2VQEJ 1WEZA 5ADZA 3PV8A 4CT9A 3CW2C 3NBPB 3AXMA 1FVQA 4IO9Q 1M1KT 1T8EA 2PEBA 5EWFA 3GIIA 1D9DA 5JVHQ 3LP0B 3UE2A 5ETLA 3HHNB 4J7CA 4FF3A 1HNWF 3MR2A 3M30B 2EK6A 5HMWA 4USWA 3FNNA 1FE0A 1ZTWA 3AJ2A 2MEWA 2KYXA 2GQCA 4ITSA 4USIA 1Y0HA 1JLEA 1M1HA 1H6KX 1N54B 3CCVS 3AJDA 5K14A 1N33J 1NXIA 4MMOA 4IRDA 4BDPA 3IAS9 1B64A 2HWHA 4B3RJ 1HMVA 1T9WA 3NKYA 4DPWA 1O8BA 1J2VA 2AF6A 4FBTA 2ZE2A 3SSQA 3IWLA 4O44A 1OIAA 4L3KA 2KI2A 1HNZF 1B0VA 5B0DA 5KFZA 3D3BJ 2UUAF 2KFNA 3KHHA 1WKJA 4DPTA 4NXNJ 2OUGA 3ZXWA 4HTIA 3MGJA 4DR3J 1ZOTA 4AE5A 1RTDA 3U02A 2EBEA 4LIWA 2HS3A 3OT9A 2XBPA 1KVIA 2CPHA 2DGWA 1BC6A 4DR6F 3DLLQ 4XTTA 2V9KA 3GG1A 5CYMA 4RW6A 2HS0A 3T1YF 2HNDB 3TYTA 5D0HA 3PTWA 4YOEA 1MMDA 3JTPA 1G1XA 1E6YB 3UI3A 2XO6A 1UWBB 1QM9A 3Q2SC 4NLWA 4PCQA 4DPUA 1EQMA 4ILLA 1WNEA 1XWLA 2PT0A 1T9VA 1NBEB 3AJ1A 3HVAA 2W9CB 3DOMA 2EFVA 1XTZA 5ETPA 2ZZNA 3C8YA 4DSJA 3I0RA 2GMLA 3L4BC 3QNWB 1C0TA 1JJHA 3V4IB 2H5IB 1VS3A 4I4BA 4ZN3A 3K8WA 2VFSA 1A6LA 1FRIA 1PGZA 2FC9A 4NLSA 2CDQA 1WACA 4YB5A 5FIIA 1TL5A 2RRAA 2Z2ZA 2HMIA 2F1FA 2V2QA 1CJKB 5M2RA 1U1MA 5MAOA 4DUTA 3DLBA 1S9EB 3EZOA 3LUYA 3CF5Q 4OHZA 3AAWB 2OFHX 5CQGA 1Y5IB 3FVYA 3FQLA 3HF5A 2QLBB 3BBFA 2V94A 5EUHA 1CJTA 1PYSB 2R2TA 3BDPA 2GHPA 4ZVHA 2QX0A 4ZPVR 4A8QA 1XIQA 4GKKJ 2V0NA 4IG3A 3B6BA 2PD1A 5DLGA 3R8YA 4BBYA 2DR9A 1RTJB 3NOGA 4ECUA 3M9NB 3RTVA 4TU8A 4JOUA 3QYYA 3RYLA 4DLEA 3QLHB 1V3ZA 1NH8A 2HS4A 3J80U 4HT5A 3MFHA 1XNQJ 3WDOA 4HT7A 2MHNA 3HFKA 2YQ1A 1JLFA 1LKZA 4CLLA 1IJEB 3ISNC 2IY5B 2FZKB 1J5OB 4X4PA 4OJHA 2IM3A 1S72S 5F41A 3C3LA 1WG4A 2EBGA 1FDAA 1JLBB 2LFVA 4CI0B 3KFWX 2CWXA 1RT3A 2YH0A 1TV6B 5F3ZA 2BKNA 1N36J 4CLPA 3MAHA 1WHYA 4QIFA 3Q86A 4USVA 3M9MB 4OJGA 3OD2A 4TLRA 4WFBQ 3Q2TC 5F8GA 5A8WB 2GO9A 4WTOB 2QZ8A 2ZH9A 3UDVA 3G6YA 4OHWA 1S9FA 3MTKA 2DGVA 2LDYA 2DY9A 5AXMA 3UN3A 2ZM6J 3KJVA 1X9MA 2H51B 2KFZA 1WC5A 3T5KA 1NDLA 2N3LA 2UU9J 4L3NA 3NY0A 1S6PB 1GMVA 4LF5J 3AQPA 2CJBA 1QUPA 1SKUB 2MXYA 2RKIA 3NL0A 2BEFA 3LALA 4NCBA 2PO4A 1HQEB 4ZVQB 4DV0J 4I69A 5J1NA 4K4YA 2B9EA 5HVHA 1YKWA 3LF0A 5K8MA 4M5IA 2DHGA 3GB0A 1MU2B 4PG4A 1BUXA 4GO7X 5KFAA 1C1BA 2AJFE 1UZHA 2VG7B 1TKXA 4PYDA 2J0WA 2W2OP 5ETTA 3M8PB 1NAQA 2JLGA 3IR5B 3EWGA 4CYUA 2AJ0A 1HI0P 3A3NB 3MMAB 2MKHA 1EKRA 3SDEB 2VFTA 4DZ6A 2NQPA 1FJGJ 1Q79A 3BKTA 5KFBA 2ABYA 2ADCA 2HGMA 3G4SS 3KG1A 4DG1A 4A8SA 3CIZA 2QN6B 4ZCIA 2KXHA 4WCEQ 2MZRA 3TJ8A 4Y2CA 1OQ6A 1APSA 4KSEB 2DGOA 3RBEA 2HRTA 1U1NA 1S76D 2W4DA 2C3PA 4I56A 2M4MA 3DRPB 1MROB 3O44A 2IFXA 3FFIB 1LWFB 2PE8A 3C15A 1DTTB 1CQNA 4IH5A 1DLOB 1PBUA 4ZMMA 5KFKA 1GMWA 2B6AB 5L1JA 5KTQA 4PZVA 1H2UX 2BJ1A 4NA3A 4Q2MA 4NYOA 5DETA 2AGPA 3CDAA 3F41A 4B17A 3OBIA 2DT9A 3EXCX 2LA4A 3BPSP 4NLRA 4Z7YA 4LF7J 3LOUA 1KLNA 2IAJB 3IR6B 1R8HA 3D6MB 4CO2A 3BEGB 1XBWA 2K1RA 1T0TV 1RZMA 2EI5A 2JRSA 4HH1A 4CDIA 1B4SA 1W2IA 1Y00A 3ZNUA 5BYQA 3G6VA 2Q79A 2WB4A 1RWWB 3M8ZA 3CD7A 5HAOA 2WVBA 4ERDA 1WHVA 1RACB 1OY8A 4XPCA 1VRTA 1NO8A 3AOCA 5KFQA 4KH1B 2QL7B 2ZHOA 2BBEA 3V6DB 2YKMA 3TAPA 2C3MA 3KHLA 1P27B 4E8UA 3UCZP 2I5JA 3P4UB 3MM9B 3CPWR 5E41A 4HHUA 3JQJA 2Y1IA 3M1VA 1IJFB 4EUVA 1S1XB 2OPQA 2ILZA 1Q0NA 4P10A 3MUTP 4IRCA 2V68A 4QCLA 4KGXB 1NK4A 3T1AA 3SQGB 1YBTA 4OX8A 1RABB 1JLQA 1UJ5A 1AB8A 1KFSA 3KUHA 4K5RA 2BQUA 2PEHA 3PFEA 4A46A 1EQ0A 2MSSA 3U27A 2LCWA 4DV7F 2ZITA 5L1KA 4Q8EA 4DU7A 1RGVA 1RTHA 2UVUA 4CLTA 1QSYA 3QZ8A 2A18A 2W7AA 4U6PA 5M2UA 4J91A 2OD4A 1RP5A 1TL7A 3QIPB 5EX3A 2V69A 1N0UA 3T5HA 5HN0A 2A1BA 3E01B 4F7VA 5B0FA 2E1AA 3DRSA 4BLGA 1ZZNA 2PMZD 3M8WA 3D7SB 2RQMA 2N7CA 5J2QA 4DR6J 5KFUA 1GH8A 1UVNA 4ANDA 5LMUJ 3DFEA 2QGFB 1NDKA 4MK9A 3BR9A 3L9ZA 3EPIA 1N5YA 1R43A 1LW2A 3T5LA 5CYQB 3THTA 2DR6A 2VBWA 2LP4A 1NK7A 1BQXA 1NLKL 1Y5LB 2YXLA 4A4JA 4MFBA 3CJ8A 2N82B 1HARA 1KS2A 4IFVB 4EO6A 4UZBA 4QOTA 4DBQA 1B70B 1FRLA 1HNIA 4LREA 2DXEA 5AJ3J 5KFNA 1U8WA 3Q8YA 5D4NA 2W1BA 3U1MA 4Q0BA 4QWBA 4R5PB 5IWAF 1C0UB 4ES3A 1VRUB 3QO9B 3GJSB 1KQFB 1JKHB 3NLCA 4DR4F 3BR8A 4JV5F 3IBWA 1REVB 3PW0A 4LF8F 2IVFB 3WIUA 4DU8A 1NZ8A 2PGCA 1NJWA 2YTCA 2ZHBA 4C6AA 1DTQA 4J9LA 1WKKA 4DV6F 2FJEB 3EGWB 3IGVA 3CCUS 5I3UA 2O5DA 3HKWA 4JI2F 2J9CA 1UEKA 2YX7A 3IM9A 4U7CA 4B08A 2YX4A 3C16A 2OD6A 3VWSA 3DHXA 2QA4S 1ZZFA 5LJ3Y 5GVQA 5C5JA 3MEDA 3AD8C 5JJBA 4XAKA 3KMQA 2UUBJ 3QBCA 2A10A 4O0IA 3KK2A 4HACA 1K44A 1REGX 4PPDA 2IM2A 2U1AA 2ZZMA 4KHPJ 2X51A 2F4FA 3BV8A 2PFDA 4F4XA 4NEZA 2R7OA 1C4AA 3PRBA 1G7CB 1JB0C 1KHVA 2RQ4A 2HQFA 3V5RA 1JLGB 2XCAA 4OLOA 1P6TA 3CCLS 4YQWA 2Z4PA 5IM0A 2IVMA 6FDRA 2HHHJ 2L3MA 4WJBA 3VF0B 3I0SB 2R8JA 3HHLD 5A76A 2ZC4A 1B3TA 3C66A 4GVBA 2W9BA 1VQ4S 3IFEA 1NDPA 4USUA 4Y2KA 1KOOA 4DR1F 2VU5A 3PR4A 3FSXA 1UKUA 1PC5A 1FNOA 3WHIA 1ZETA 1RT5B 3KXDA 3CJRA 4EI2A 2NS1B 4KRWA 1T03B 4MH8A 1NK5A 3KNAA 1CC7A 2B51A 2ALZA 1X5OA 2CNKB 1UETA 2QMXA 2IJNA 5L9NA 4FXVA 4OLPA 3A3OB 4WFXA 4EBDA 2L08A 2G1HA 2P2CB 3ELHA 3HK2A 3GFZA 2GMHA 2HZVA 5E33A 1L3KA 1UVKA 3UDEA 5HANA 4NPOA 1E6VB 2E5GA 4ZVRB 2L9DA 3V6JA 2X1BA 1SC1B 1U24A 3OXGA 5HQLA 1YLXA 2FJAB 1IKXB 2LA6A 1L3TA 3CCSS
chains in the Genus database with same CATH topology
4ZVUB 3NS7B 2C2OB 3GJQB 4DCJB 2XYPB 1RE1B 4DCPB 3R5JB 2H65B 1RWPB 2XYGB 2HBYB 2QLBB 1RWMB 3EDQB 2H5JB 2QLFB 2XYHB 1RHRB 2CNLB 1RWXB 2FQQB 4LSZB 1RWKB 1RWVB 2DKOB 3IBFB 3EDRB 1BMQB 2CNNB 4ZVTB 1SC3B 3R7NB 4ZVSB 2H4YB 3GJTB 1RWOB 3D6MB 2CDRB 4JB8B 5IC6B 3D6HB 3R6LB 2C2MB 1RHQB 2CJXB 3R7BB 2H51B 2Y1LB 1I51B 3KJQB 1F9EB 2C2KB 1PYOB 1IBCB 1RHKB 3RJMB 2CNKB 2XZDB 3SIPB 3QNWB 2CJYB 1SC4B 4ZVOB 2QL5B 2CNOB 2H5IB 2P2CB 1RWWB 3GJSB 3GJRB 2C1EB 3IBCB 3P45B 1GFWB 2HBQB 4ZVQB 5K20B 1RHUB 1QTNB 1RWNB 3R6GB 1I3OB 4ZVRB 2QL7B 4ZVPB 2H48B 1RHMB 2H4WB 2QL9B 1ICEB 3D6FB 3R7SB 3KJNB 2Y0BB 2QLJB 1NMEB 1PAUB 3KJFB 5IC4B 4DCOB 1RHJB 1QDUB 1SC1B 2H54B 2HBZB 2HBRB 2C2ZB 2XZTB 3P4UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVU B;  3NS7 B;  2C2O B;  3GJQ B;  4DCJ B;  2XYP B;  1RE1 B;  4DCP B;  3R5J B;  2H65 B;  1RWP B;  2XYG B;  2HBY B;  2QLB B;  1RWM B;  3EDQ B;  2H5J B;  2QLF B;  2XYH B;  1RHR B;  2CNL B;  1RWX B;  2FQQ B;  4LSZ B;  1RWK B;  1RWV B;  2DKO B;  3IBF B;  3EDR B;  1BMQ B;  2CNN B;  4ZVT B;  1SC3 B;  3R7N B;  4ZVS B;  2H4Y B;  3GJT B;  1RWO B;  3D6M B;  2CDR B;  4JB8 B;  5IC6 B;  3D6H B;  3R6L B;  2C2M B;  1RHQ B;  2CJX B;  3R7B B;  2H51 B;  2Y1L B;  1I51 B;  3KJQ B;  1F9E B;  2C2K B;  1PYO B;  1IBC B;  1RHK B;  3RJM B;  2CNK B;  2XZD B;  3SIP B;  3QNW B;  2CJY B;  1SC4 B;  4ZVO B;  2QL5 B;  2CNO B;  2H5I B;  2P2C B;  1RWW B;  3GJS B;  3GJR B;  2C1E B;  3IBC B;  3P45 B;  1GFW B;  2HBQ B;  4ZVQ B;  5K20 B;  1RHU B;  1QTN B;  1RWN B;  3R6G B;  1I3O B;  4ZVR B;  2QL7 B;  4ZVP B;  2H48 B;  1RHM B;  2H4W B;  2QL9 B;  1ICE B;  3D6F B;  3R7S B;  3KJN B;  2Y0B B;  2QLJ B;  1NME B;  1PAU B;  3KJF B;  5IC4 B;  4DCO B;  1RHJ B;  1QDU B;  1SC1 B;  2H54 B;  2HBZ B;  2HBR B;  2C2Z B;  2XZT B;  3P4U B; 
#chains in the Genus database with same CATH topology
 1YJV A;  2ZDO A;  2WCX A;  1X4D A;  2W4C A;  2FGO A;  3QT7 A;  5GAD U;  1FRH A;  5H1S V;  2QLF B;  3J7Z 5;  3ITH B;  4ECY A;  4FF1 A;  3CD5 A;  2EKY A;  3EGN A;  3A8J A;  1RUS A;  4KB7 A;  4Q43 A;  1GXU A;  2GIR A;  2XB2 D;  3QT6 A;  4CIO A;  3QID A;  2J5A A;  3SIP B;  2FJD B;  3EX7 B;  2V9W A;  5HJY A;  5DDR C;  4KHM A;  2ACY A;  3NGR A;  3SCL E;  3PIO Q;  4DV1 J;  3N6L A;  2NXJ A;  2SXL A;  3CC2 S;  3CCM S;  1ZH5 A;  2D3O R;  3BGF A;  3FSY A;  1TL1 B;  2CQP A;  5RUB A;  1TKZ B;  3G86 A;  2CJA A;  5C42 A;  3EVW A;  1S6O A;  2KO1 A;  3G82 B;  2G1D A;  1T95 A;  4R0E A;  2XMU A;  1UEV A;  3OUY A;  1K73 T;  3DYA B;  5BR8 J;  1CLF A;  1SV5 A;  4ETX A;  4WPA A;  1CS4 B;  2J0S D;  3JSY A;  4FN5 A;  2HPU A;  1TQL A;  1LK5 A;  1PJ5 A;  3KG0 A;  3H59 A;  4ED5 A;  2HHW A;  3NS5 A;  1VJQ A;  1Y7P A;  4MK8 A;  3CJT A;  2E5L F;  2BZ2 A;  5ETO A;  5LSO A;  4WYW A;  1VBY A;  5J2P B;  2IMW P;  4X4S A;  3MUR P;  3GV8 B;  2RML A;  4I2P A;  5H9F J;  1LOU A;  1X4C A;  3H98 A;  1RT4 B;  4DUZ J;  5G4D A;  3PHT A;  2N4C A;  2GO8 A;  2YWG A;  2XMA A;  4P7T A;  4F4A A;  3R7B B;  1OQ3 A;  1ZBT A;  2D41 A;  3T5J A;  2Z8Q A;  5LL6 d;  1N8R T;  1EIY B;  1UTA A;  2XS5 A;  2YNF B;  2KU7 A;  3OHA A;  3WC0 A;  5IT9 U;  1H7W A;  1B0T A;  1XR7 A;  1M5O C;  1SC4 B;  4M5N A;  2BYC A;  3OPK A;  1S0V A;  1WSR A;  2ZD1 B;  1QAJ A;  4BWJ A;  4M8L A;  4NAS A;  2LXU A;  3BS9 A;  2DO4 A;  4AT1 B;  1X4E A;  2DB1 A;  2HUR A;  3CIM A;  1UJ6 A;  1S48 A;  4OYB A;  4PUO B;  5C2C A;  1FXD A;  4B9V A;  3LWM A;  2BQR A;  2ZNY A;  3TO8 A;  1I1G A;  5T14 A;  2VC0 A;  4J9S A;  1HBU A;  3CCZ A;  2V63 A;  2DHH A;  2V6A A;  3FUY A;  1HD1 A;  1R0A B;  2KRB A;  3OFH A;  4LFC J;  4JI7 J;  5DDP C;  3L09 A;  1QTM A;  5F8H A;  4ZVS B;  1H38 A;  5D6G A;  5IC6 B;  3D6H B;  2QFJ A;  1U2C A;  2CAD A;  2BJE A;  1C1C B;  1DHM A;  1A7G E;  3ET6 A;  1XER A;  1PCA A;  1HHT P;  4NML A;  1U25 A;  2J8S A;  4N8O A;  1XEZ A;  2IRU A;  4ETZ A;  5KOX A;  1HQU B;  3LWL A;  2UXD J;  4P2S A;  4YB7 A;  4KGZ B;  1KKH A;  3KLI A;  4J9P A;  4LQ3 A;  3C6U B;  3OXL A;  2YQ0 A;  3ISN D;  4X4R A;  3I9Z A;  4OQJ A;  3WX4 A;  5K8P A;  3Q8R B;  4QZV B;  4P71 A;  4Z2X A;  4J9U E;  5HMX A;  1HNV B;  1FD2 A;  3M2R A;  3RB6 A;  1DFD A;  3GSI A;  3EVO A;  1IBL J;  4KH0 B;  2IJR A;  3QFW A;  2VDH A;  1HWI A;  2XYP B;  2DNO A;  4KFB A;  1SIZ A;  2A2D A;  3C2P A;  4LRF A;  4YFU A;  3AB2 B;  3GYG A;  4DN0 A;  5IXU A;  3W2V A;  1ZPW X;  1N32 J;  3DDK A;  3DM2 B;  5KFW A;  2DR8 A;  2VIC A;  1RU2 A;  5G0R B;  1VC5 A;  2C2D A;  1OJ4 A;  4X65 J;  3MEC A;  4NLQ A;  2Y0S D;  3QGH A;  2CVI A;  4O3O A;  3Q83 A;  4HVZ A;  2OIH A;  3NWG A;  2HIY A;  1D3W A;  5KFL A;  4AL6 A;  3EGZ A;  2CFX A;  2CNO B;  3D28 A;  3MM7 A;  1RTI B;  1IN0 A;  3K59 A;  2VA3 A;  1QVG R;  4OZN A;  2MLX A;  3Q23 A;  4JYA F;  2D9P A;  3N6N A;  5ETV A;  3DLK A;  2OGU A;  1TFY A;  3QJJ A;  5F0U A;  4C8M A;  1SC6 A;  2RF2 B;  2QLJ B;  1JQG A;  3RB4 A;  1SJ4 P;  1YBU A;  3THV A;  2NPI A;  4EEY A;  1ROF A;  2H54 B;  3CCQ S;  2JSX A;  1SH2 A;  2Y3Y A;  4WE1 A;  2R7V A;  1YK9 A;  4O3N A;  3LAM A;  1FT8 A;  4B3M F;  3CJK B;  3H5Y A;  2BE2 A;  4B3O B;  3OTO J;  4QIG A;  2WW4 A;  1SXL A;  1S1W A;  3OXF A;  3KK1 A;  4N8N A;  1VI7 A;  4ZJO A;  4XIU A;  2RHQ B;  1RWO B;  4ZLP A;  1RYR A;  3TAM B;  1X4A A;  1F2G A;  3KK3 B;  3M8Q A;  1LWC A;  3B78 A;  2FPH X;  2G2O A;  4EYH B;  1R31 A;  2V34 A;  3LPY A;  2ZJP Q;  1FCA A;  5AXK A;  3ZZY A;  4DMZ A;  4NCG A;  2M7S A;  2OO4 A;  4LIR A;  1PKU A;  4ZVG A;  3M7V A;  1OSC A;  1WUU A;  1IQT A;  2AV5 A;  4IG0 B;  3MR5 A;  3ZTR A;  2XMT A;  2DGQ A;  3SXL A;  1NME B;  5KFO A;  4RJV A;  2ZBQ A;  3M8S A;  1C4C A;  1U2F A;  3BB5 A;  3HCX A;  3LP2 B;  1N5S A;  2GHW A;  4C3L A;  3OVB A;  4C0H A;  4ECX A;  3CCE S;  4NRU A;  2JH3 A;  3N01 A;  4RUH A;  4EBC A;  3DKD A;  1RBA A;  4NZ0 A;  4M5H A;  1NJI T;  4LT6 A;  4ELU A;  1VIO A;  4K2J A;  4ZJQ A;  1YJW S;  4DR1 J;  4DHV A;  4PXC A;  2M3D A;  4NYP A;  2OEK A;  3LGN A;  4V19 X;  2DCL A;  1TMM A;  1JLC B;  4MYU A;  3PJW A;  1CJU B;  3D0H E;  2VG5 A;  4F4K A;  4RW4 A;  3K89 A;  5J1P A;  3A8I A;  2BJ7 A;  5BYS A;  4B9L A;  4N76 A;  2BXJ A;  5IZH A;  3QRP A;  3J80 Y;  2DGT A;  4OYW A;  1FX4 A;  3VVU A;  4NOH A;  2V4J A;  1VK3 A;  5IV4 A;  2J9D A;  2MGZ B;  2I2Y A;  2EK1 A;  3HZG A;  4X4V A;  1M90 T;  2HBZ B;  2YNH A;  3TX0 A;  4LR7 A;  3RBZ A;  3ZO7 A;  4PQU A;  3DHW C;  3ILO A;  2B5J A;  1T05 A;  4OYP A;  2VQF F;  4EYI B;  4O4G A;  4HEA 9;  2H65 B;  3MMJ A;  1S1V A;  4TQR A;  3D6T B;  3EDQ B;  4YHH F;  1WOO A;  4GKJ F;  1S1T B;  1EET B;  2MQL A;  3CC4 S;  4WWS A;  2FZG B;  3KLG B;  5J2N B;  3BO2 A;  3MM6 A;  3QSI A;  2NXC A;  1SQE A;  2HVE A;  4OHX A;  5GAD I;  1ZM2 A;  3W62 A;  3BSC A;  5DZ7 A;  4XPE A;  2UUW A;  3W66 A;  2Y1R I;  2GIF A;  1DZ5 A;  2HWI A;  2J0X A;  4L6V 3;  2JEJ A;  4ZLN A;  3OR2 B;  3ZZR A;  4DI6 A;  2XSF A;  3BSA A;  1HKA A;  5GAE I;  3ENV A;  2ZBR A;  5CZV A;  4RW9 A;  5CH7 B;  5D78 A;  2ZVS A;  4Y34 A;  1AUD A;  1KQS R;  5LMN F;  4I64 A;  1YIJ S;  3H2U B;  1VOM A;  3A1Y G;  4RR5 A;  3O3L A;  3R9L A;  2Q43 A;  1Z1Z A;  2XEX A;  4FYY B;  2D1C A;  4K2X A;  1V5I B;  2RUG A;  4LF9 F;  1DJ0 A;  5KG6 A;  3B4D A;  4HTJ A;  1RAH B;  3NRB A;  3VHQ A;  1S1U B;  2FQQ B;  3DLE A;  4X64 J;  1GTH A;  2F8E X;  4YB6 A;  1BMQ B;  4IDK A;  2ZNZ A;  3H5S A;  4ES2 A;  3S6E A;  3LTO A;  3J81 j;  3GU0 A;  4OFZ A;  4IUF A;  3TAN A;  2OH2 A;  2JL9 A;  2WAQ D;  1S57 A;  4LFA F;  5HMZ A;  4W92 B;  2UVR A;  2FLP A;  3CC7 S;  1LW0 B;  1YZ7 A;  2GAG C;  4HDG A;  1HA1 A;  1K47 A;  3HVR A;  3HUL A;  4ILM A;  5C25 B;  4O3S A;  2MQ8 A;  1VIS A;  3QAE A;  1GMW D;  2DNR A;  4CTA A;  4DPY A;  3M2V B;  3IS9 B;  1FF2 A;  2OEM A;  2ZVI A;  2E5J A;  4LVN P;  4F25 A;  3DRR A;  2WTF A;  2P5V A;  1ZS6 A;  3I87 A;  2EC0 A;  3TEH B;  3PG9 A;  1WC0 A;  3CDW A;  2V4R A;  2HHU A;  5HP1 A;  1UFW A;  4X62 F;  3RB3 A;  2DR7 A;  4FPI A;  5J1E B;  4JI3 F;  1YHQ S;  4WXO A;  4IFY A;  4GC7 A;  2ZWO A;  2R7S A;  4Y2A A;  2ASJ A;  4F02 A;  2FZC B;  2AYE A;  2PDA A;  3FDS A;  1RQ0 A;  3K5P A;  2QTW A;  4MKY A;  4ZHR B;  5CD4 H;  2UV8 G;  1CVJ A;  3CUN A;  3MF5 A;  2HHX A;  1KRP A;  2V8P A;  1NZA A;  2MLY A;  2J6S A;  4I7F B;  1QSL A;  2FIU A;  3RJM B;  1HWK A;  5HL7 Q;  2MZT A;  4X4T A;  2WZ1 A;  4LMZ A;  2OMO A;  3E8O A;  2DRD A;  3CJQ A;  1KR4 A;  2ZUA A;  2X1G A;  3ZZ0 A;  2H48 B;  2XMJ A;  5H9E K;  4DR2 F;  1ICE B;  3M8Y A;  4ZPC A;  1X5P A;  2QE5 A;  4USH A;  4LRB A;  4YY3 J;  4MIA A;  4U8V A;  1L3S A;  2LVW A;  3FMW A;  3MPD A;  4OZ3 A;  4WK1 A;  3V4M A;  3VQT A;  2XWX A;  4A8F A;  1UJ4 A;  2D3U A;  4ED2 A;  3H2L A;  5E2Q A;  1S10 A;  1JLE B;  5LM7 E;  2J8A A;  5D8H B;  3LA0 A;  1RCX B;  3OTB A;  1GMU A;  5K14 B;  1WKL A;  1IR0 A;  1TK8 A;  1WF0 A;  1NM2 A;  2C22 A;  3UNY A;  3AQO A;  1FHT A;  4ELT A;  1HMV B;  2CDR B;  5A0Y A;  3NGS A;  4ID5 A;  2CPE A;  3E2E A;  4YR2 A;  2MJU A;  1RHK B;  4O44 B;  2LU1 A;  1E6Y A;  1EHW A;  2ZFH A;  5DS7 A;  4YR0 A;  4NXM J;  1JJC B;  2NLW A;  1R0C B;  4EK2 A;  1FO1 A;  4ED4 A;  1SH0 A;  1H2V Z;  3X1L B;  1TL4 A;  2DBB A;  3DRX A;  1M0S A;  3CT9 A;  3H90 A;  2LQ5 A;  5KT6 A;  1RTD B;  3JTO A;  1H98 A;  3QSY B;  1X4H A;  2WW8 A;  4B9T A;  2FVS A;  3ENQ A;  1HBN A;  3QWU A;  4S0M A;  5CYM B;  4RW6 B;  3PW5 A;  3AOD A;  4J9R A;  3RRH A;  3MPY A;  1EAY C;  2RU9 A;  4CLK A;  4U7U K;  2WSC C;  2RIJ A;  4JI4 F;  4E98 A;  1O6X A;  2UXB F;  4HI2 A;  3MPV A;  4GC6 A;  5KFI A;  4NLY A;  3CDE A;  3LP1 A;  2VQE F;  3KKF A;  2YKO A;  4K4W A;  4C11 A;  2QG9 B;  3DOM B;  1HW9 A;  1BE4 A;  4CLZ A;  2HFO A;  3OSN A;  2I6W A;  2M5Y A;  1UFL A;  1WEY A;  4ER8 A;  3I0R B;  1F60 B;  2R8H A;  4JBC A;  2IA6 A;  2JDJ A;  1C0T B;  2UVV A;  1HBM A;  2DHS A;  3OVA A;  3UR0 A;  2B4U A;  4EZ6 A;  2XS7 A;  2QA1 A;  3I56 S;  1TP7 A;  3CXC R;  4LFB J;  3PDN A;  2ZZT A;  4QPT A;  4FNI A;  1H74 A;  3RB0 A;  4A8X A;  2HMI B;  1LEO A;  2A2C A;  4KGV B;  4RNH A;  1AUS L;  2MQN A;  4CH1 A;  4D3H A;  2UXC F;  4DXL A;  1FE4 A;  3H7H B;  4CO4 A;  1N33 F;  4DOZ A;  5D3G A;  1AW0 A;  5I42 A;  3HFZ B;  1J5O A;  4RUA A;  2MZJ A;  2UUT A;  1CJT B;  2ZJQ Q;  1JLB A;  4YDD B;  3EYZ A;  4K4X A;  2E1P A;  3MMB A;  1JWW A;  2EPI A;  4DSI A;  4G3I A;  3IM8 A;  2CUY A;  4IG3 B;  3MR7 A;  5HLF A;  5KFD A;  4NXN F;  1HLW A;  1HPZ B;  2OTJ S;  3MUM P;  4DR3 F;  1VBZ A;  4U67 Q;  1TKT A;  2WB1 D;  3MI7 X;  4OI3 A;  2RU3 A;  2Q3P A;  3BBB A;  1VQ5 S;  4X4U A;  4JI0 J;  4A8W A;  5T7L A;  2HHP A;  2ZOF A;  1JLF B;  2K7K A;  2FVC A;  4ZPW R;  2VC1 A;  3R7S B;  3KUE A;  2HFN A;  4ID8 A;  4YME A;  4KT0 C;  4NI2 B;  4P73 A;  1YJU A;  1RT3 B;  1PJ6 A;  2LQ9 A;  1NJX A;  3DN9 A;  4JUZ A;  2ACM A;  4C8O A;  4C8N A;  2J6U A;  2R8G A;  1RKI A;  2IYI A;  5BYR A;  4RKU C;  1TMJ A;  3PR5 B;  4GRS A;  2E44 A;  1EX8 A;  2KG1 A;  3IRW P;  2V50 A;  3FBB A;  3KJV B;  2I8E A;  2X7I A;  2DXD A;  3VAF A;  1MWY A;  1NUE A;  2CWK A;  2PA3 A;  4FS1 A;  2Y1J A;  1RKJ A;  3K17 A;  3CD0 A;  2QL5 B;  1P1L A;  1RT7 A;  1NKC A;  5EDW A;  2RKI B;  5KG3 A;  4Y2M A;  3QAT A;  3WZ0 A;  2RDD A;  1M5S A;  5KFF A;  4USJ C;  3CDU A;  3FBC A;  1SVD A;  3ZC4 A;  2FTR A;  3BZQ A;  2B8P A;  4PWD B;  5HMY A;  3LO3 A;  2KVQ E;  1C1B B;  1YTY A;  3NWR A;  2WON A;  1RIS A;  4IKA A;  4K0K J;  4O4R A;  5SZT A;  2P9C A;  1TKX B;  5GMK a;  1N5Q A;  4GKK F;  2CZ4 A;  3ILL A;  2XY7 A;  3BKF A;  2HQI A;  3MOZ A;  5KT3 A;  4DWI A;  4CYU B;  1WI6 A;  5LJ5 Y;  3W5Y A;  2OPR A;  1FKO A;  1S0O A;  2B6A A;  4P75 A;  4K4V A;  2F4V J;  3GJT B;  2GVD B;  3G8S A;  1XNQ F;  1GTE A;  1FXL A;  3GLJ A;  4QU7 A;  2OPP B;  3HSZ A;  4WII A;  2NZ4 A;  2RJZ A;  5EWG A;  4OYI A;  4M5M A;  3DXB A;  2EFN A;  1U49 A;  2DJW A;  2CQD A;  4DG1 B;  3R27 A;  2IPO B;  1RAF B;  2EEY A;  3Q8S B;  1U1Q A;  2GHV C;  1DAR A;  2IDE A;  3VGV A;  4B9N A;  4MT1 A;  1Y3J A;  4B9U A;  3CO0 P;  4UOC A;  1N36 F;  3TW0 A;  3DOK A;  1HI1 A;  3RBX A;  2HGN A;  4G65 A;  4JV1 A;  2VPX B;  1FJC A;  3HSG A;  4IQX A;  2FJV A;  1IBM J;  3C15 B;  3I96 A;  4FXW A;  4USK A;  2OI2 A;  2APO A;  3OL9 A;  3K8V A;  3GJQ B;  5KFM A;  4QPX A;  3HSJ A;  4IH6 A;  3TA1 A;  2ZM6 F;  2R7W A;  3UPF A;  4X4Q A;  3A4T A;  2OLW A;  3SZ2 A;  1N34 J;  1VDH A;  1MWQ A;  2UU9 F;  1Q53 A;  1AXQ A;  4ILR A;  2D69 A;  4QW9 A;  4JI8 F;  4ECS A;  4EO8 A;  4R25 A;  2AP6 A;  2VFU A;  4CLF A;  2DD8 S;  1HYS A;  3UW1 A;  4DV0 F;  2GX8 A;  1YSJ A;  2CIM A;  1RLD A;  2WSF C;  1B99 A;  3DC2 A;  4IH7 A;  1Z4U A;  3KLV A;  5ETN A;  5IT9 Y;  4LF1 A;  2FLO A;  3FRZ A;  5CHC B;  4ALZ A;  2DK2 A;  2GVZ A;  1VRT B;  3P45 B;  2HW3 A;  3N0V A;  1OYD A;  3T41 A;  3NCR A;  3TQE A;  1S12 A;  4KJI A;  2CQ4 A;  3CNQ P;  1FKA F;  2QMU B;  5BXI A;  3GIL A;  4B3T J;  2KKH A;  2YKM B;  2OHD A;  2V8G A;  2HBR B;  1VMB A;  2I5J B;  2AMC B;  2ZJR Q;  4USM A;  2MKY A;  2LEP A;  4ZVU B;  1JIH A;  1D09 B;  2Q1L A;  3CDB A;  3M1V B;  1FJG F;  1M5P C;  4X66 J;  2Z2M A;  4UZC A;  4XDC A;  5F0W A;  2OPQ B;  2L41 A;  1AFI A;  4HYK A;  3KUG A;  3H20 A;  3ULH A;  2IJF A;  2O66 A;  1JLQ B;  4DV2 J;  2F9D A;  2HFV A;  2CJX B;  2ZOG A;  3O6Q A;  5A6W A;  2XI3 A;  1SCJ B;  1RTH B;  5THW A;  2DYA A;  2VD3 A;  3HXM A;  2VPW B;  4H4K A;  1V6H A;  2IM0 A;  2ASY A;  2VFR A;  1TL7 B;  2K2P A;  4WZM A;  5MLC V;  5B0G A;  4W90 B;  7FD1 A;  4QYZ K;  2MY7 A;  2IHR 1;  1DY3 A;  3P6Y C;  1C0U A;  1WEL A;  3AOB A;  5J2Q B;  5JUM A;  2GCF A;  2MQP A;  2DVI A;  4LF7 F;  1XMO J;  2UVW A;  4UOH A;  1NSA A;  4ECV A;  1NK6 A;  1OWX A;  2NSB A;  2JX2 A;  5CZX A;  3D1Q A;  4DPO A;  1N5Y B;  4FBU A;  2XYG B;  1LW2 B;  4Y3C A;  2BAB A;  4F0M A;  2KT3 A;  1YRU A;  4ZPB A;  4NA2 A;  2F7V A;  3ILI A;  1AZS A;  4WP8 A;  2DGU A;  1FFG B;  4LBI A;  2UZA A;  2CPF A;  4MFB B;  2FVQ A;  3ONQ A;  1FWP A;  4J9V A;  2PI4 A;  2JWN A;  1HNI B;  4CRJ A;  3HJF A;  1S59 A;  3PFO A;  2V2K A;  2DH9 A;  4KIA A;  3PJ9 A;  4Q0B B;  5JXS A;  3MXH P;  4PXB A;  4JP8 A;  4CM0 A;  4K5S A;  5AE2 A;  1NK0 A;  4ECR A;  3GJR B;  2AJQ A;  3GSD A;  1UA1 A;  3W8P A;  4ICL A;  3IRX A;  1I3O B;  3VAL A;  2XS2 A;  3OFG A;  4RUB A;  5KFT A;  1IM6 A;  2HGL A;  3KJN B;  4U9R A;  3Q8V A;  1U09 A;  1DTQ B;  3RR8 A;  2UXC J;  3NG8 A;  1NK9 A;  1TVR A;  5B0E A;  4RL1 A;  1EP4 B;  1FER A;  3SBM A;  2PI5 A;  5I3U B;  2AEM A;  4ED3 A;  3GIJ A;  1TUG B;  2W25 A;  3MM5 A;  2NXE A;  5F8M A;  2F8H A;  3NP5 A;  2YX1 A;  2VKZ G;  5AE1 A;  2LEA A;  2L9W A;  3MDF A;  3HHK A;  4ZP9 A;  4QQB A;  3P96 A;  2FLN A;  3C16 B;  4AL5 A;  1BWE A;  4IOB A;  5GAG U;  2QFI A;  3M32 A;  4ECW A;  4EMD A;  2VOP A;  4ED7 A;  1XR5 A;  2R3V A;  2G2Z A;  1O0P A;  3BGR A;  2VF3 A;  3KJQ B;  2VA2 A;  3RW7 A;  1DQ9 A;  1SQF A;  3DI6 A;  6FD1 A;  5KG7 A;  3KK2 B;  1YDL A;  3UN2 A;  1RT1 A;  1KBR A;  3SFG A;  4HAC B;  2AU0 A;  4DL3 A;  5ITH A;  2NUU G;  3QRQ A;  4FXD A;  5LMU F;  3ZNJ 1;  4M5G A;  3GPA A;  4F8R A;  3I31 A;  4ZN1 A;  3OTC A;  1FWL A;  2V2Z A;  2YQ3 A;  2H9Z A;  4PG8 A;  2LU2 A;  1YJ7 A;  2IIH A;  1QDU B;  2YVS A;  1KEK A;  3AOA A;  1VQ7 S;  4Y0F A;  2JFK A;  2MKJ A;  4ZCM A;  3OLB A;  1IBK J;  4RNO A;  1ZAX A;  2LKZ A;  5T41 A;  5IM0 B;  1BY9 A;  2D9O A;  4Q44 A;  3PO4 A;  1NHU A;  3CMA S;  5AJ3 F;  2ZOM A;  4RW7 B;  3IG1 A;  3N79 A;  3T19 A;  5F8I A;  1RHR B;  2JFD A;  2CPX A;  1RWX B;  4GVB B;  5D77 A;  2W9B B;  2BAN A;  3GR0 A;  2QLW A;  2E9Z A;  1Q1K A;  1YJT A;  3W2W A;  2C2E A;  1Y10 A;  2MMY A;  2HQG A;  4IYQ A;  3W7B A;  1Y11 A;  2RB7 A;  1T94 A;  3TAQ A;  3ITH A;  2HFZ A;  1X31 C;  1PSD A;  4EBE A;  5A8K A;  3JSM A;  4DR5 J;  2AYB A;  1F3V A;  2Y9H A;  1O51 A;  2HEK A;  3V2U C;  4NLU A;  3OVS A;  3U1L A;  5LSR A;  2R7R A;  1U7L A;  3S01 A;  2LQB A;  4QWA A;  2XHC A;  4DN9 A;  2Z0G A;  4HLB A;  2NCK L;  2MLZ A;  4FVM A;  2AGQ A;  3BH7 B;  4J37 A;  3M9O B;  1VCT A;  1HW8 A;  4OI4 A;  4DSE A;  4KPC A;  3SYZ A;  3M05 A;  2Y8Y A;  2CA9 A;  3TUP A;  5C24 A;  3IMQ J;  5E0O A;  4URQ U;  4MJK A;  5KG1 A;  2BV3 A;  3THP A;  1FNX H;  2MJN A;  2FB0 A;  2UUB F;  2KTQ A;  3DXS X;  2V8D A;  2CNN B;  1YJ9 S;  4C8K A;  3VGT A;  4CWB A;  1MW7 A;  3N5F A;  2AEJ A;  2N4D A;  4K7Q A;  4KHP F;  2VL1 A;  4A8Y A;  1WJ9 A;  5DRK A;  3D66 A;  3US5 A;  3ZTP A;  3NAI A;  2BUN A;  2MY8 A;  4HI1 A;  4JV2 A;  2XCP A;  5KFY A;  4NLP A;  4BHQ A;  3VTI A;  3POT A;  2C1E B;  5CA5 A;  1GK8 A;  4XDD A;  2ZH5 A;  3DLG A;  2JNJ A;  1IWA A;  1K0V A;  4ENO A;  1A0O B;  5C42 B;  2QL9 B;  1HL6 A;  2HHH F;  2XNQ A;  3D0I E;  2LEB A;  3VAK A;  3OUY B;  3J7A 1;  1S9G B;  1SV5 B;  4URG A;  2HFS A;  3D68 A;  4K4S A;  3FBF A;  3VAI A;  3CB4 A;  1PJ7 A;  2MST A;  1FNM A;  3L3C A;  1VQY A;  3BPD A;  1SL1 A;  4FYW B;  3HZE A;  4LRD A;  3D1O A;  2EW9 A;  4I2P B;  4CO5 A;  5I3P A;  3MEG A;  1UL3 A;  4JI8 J;  4YS2 A;  1IKW A;  1BHN A;  1GX5 A;  3PX0 A;  4PR6 A;  4ZIT A;  2AYM A;  1HNX J;  1B7Y B;  3G6E S;  2F65 A;  2RRN A;  3MMC A;  1HWL A;  3PCO B;  2LXF A;  3DOL A;  4DF8 A;  5U47 A;  1C1C A;  5F8L A;  3FCW A;  4TU9 A;  4ZVP B;  1RHM B;  3OLA A;  1UCN A;  4PEO A;  1BQN A;  2BW2 A;  3LQV A;  5M2P A;  2RQC A;  3G9C A;  1U0H A;  3DNC A;  2M9K A;  4RUC A;  3RRG A;  4ZP8 A;  2B3T B;  2PII A;  3C6U A;  3HO1 A;  2G9O A;  5F9N A;  5DM6 Q;  1HD0 A;  2V5H G;  3HD2 A;  2FJX A;  4KO0 A;  4DCP B;  5KT4 A;  1HBU B;  5FLX U;  2IRY A;  3PYF A;  3W9J A;  1SUQ A;  3OL8 A;  1UP1 A;  2CNL B;  3L95 X;  1HNV A;  5D0R A;  1PO6 A;  4EU0 A;  1ZAW A;  2EFQ A;  4ZPD A;  1X8D A;  3PIP Q;  4FF4 A;  3TX8 A;  3VCD A;  3ZZP A;  1F0X A;  2QYC A;  3I6P A;  4DV1 F;  9ATC B;  3MUV P;  3TA2 A;  3ET6 B;  2DCU B;  4WK3 A;  3DU6 A;  3UQS A;  5DZ6 A;  2RVJ A;  1RT2 A;  2R2R A;  3BYR A;  1VYA A;  4DX5 A;  3KLI B;  2ZH1 A;  5BR8 F;  3AB4 B;  3L7U A;  1WOR A;  2K7J A;  1QJH A;  2VG6 A;  3N4W A;  2DGS A;  1RHU B;  2C2N A;  4CNZ A;  2HZC A;  3CTR A;  3WQP A;  5D4P A;  3J81 U;  2J76 E;  2LLZ A;  4N5S A;  4KGM A;  2XM3 A;  2IVY A;  4A47 A;  1SB6 A;  4NA1 A;  2W8L A;  3B8H A;  3M2R B;  4QR1 A;  3W8G A;  3VAG A;  3QAU A;  1YG0 A;  4DUZ F;  4RNF A;  1RE1 B;  4KFB B;  9RUB A;  4P6Q A;  1AA1 B;  3LGM A;  5KOW A;  5FDL A;  4UW2 A;  1U8S A;  3HX9 A;  3NGK A;  1V5V A;  1H7X A;  2JEF A;  3Q89 A;  2FHM A;  2AX1 A;  4FF2 A;  4CLW A;  4ZLL A;  4KTQ A;  1HIY A;  2F5G A;  1MML A;  1JXL A;  2IC3 A;  1WF2 A;  1DQA A;  2ZKU A;  4KKO A;  1XC9 A;  2XHW A;  2NR0 A;  2GFF A;  1FRJ A;  1WC3 A;  4WXW A;  1YQH A;  5KFC A;  4M5D A;  3LW5 C;  3EMT A;  1S6Q A;  2XSJ A;  4L74 A;  4DZD A;  4NL5 A;  3MM7 B;  2KT5 A;  3BKU A;  5GMD A;  4HH0 A;  3P49 B;  5CYJ A;  1UMJ A;  1IR1 A;  1W2B R;  3PYD A;  3R3T A;  2PN6 A;  3DLK B;  4RX6 A;  1ACM B;  3MM8 A;  2M8D B;  2M70 A;  4TYA A;  1J5E J;  4V19 J;  3MD3 A;  4EWT A;  1U6Z A;  1PAU B;  3TEG A;  3BO3 A;  1Q8K A;  1KTV A;  1Y5N B;  4TY9 A;  1IQZ A;  3M6X A;  2ASL A;  4WE1 B;  4LFC F;  4JI7 F;  1U02 A;  2HNZ A;  1LNQ A;  2VBZ A;  2OML A;  4WKY A;  3BQ1 A;  2BE2 B;  3IA0 A;  4PKD B;  2HWT A;  3HT3 A;  3G96 A;  3QGI A;  2CAJ A;  4J5O A;  5D0G A;  4LF6 J;  2H5J B;  3HSD A;  4LUB A;  1S1W B;  4ELV A;  4KV8 A;  5L39 A;  2RIL A;  3KK1 B;  4L76 A;  2UXD F;  4DR7 J;  3KTQ A;  2OKQ A;  1K1S A;  2C2M B;  4OX9 J;  4OI2 A;  2ZBI A;  3M8Q B;  3H2V E;  1U1L A;  2HFU A;  4A8O A;  3G71 S;  5IQQ A;  3MR6 A;  4LF4 J;  2C3O A;  5GAG I;  3H4D A;  3MCS A;  4NCG B;  3HHL A;  3K5N A;  1H3D A;  1VLO A;  3GYX B;  1IBL F;  2BJ9 A;  4AQY J;  2GNK A;  3K0J A;  1X5T A;  4J9Q A;  4R8U A;  4EZ9 A;  4OHY A;  3PEJ A;  1CSJ A;  4F3Q A;  3M2U B;  3CWJ A;  2HIQ A;  2Y0B B;  1O5J A;  1XQI A;  2ILY A;  1N32 F;  7FDR A;  2F8M A;  2CPZ A;  4QWD A;  3DGP A;  1FRM A;  3VR1 A;  4X65 F;  3OL7 A;  2RAQ A;  1RB0 A;  2W4P A;  3UCU P;  2DPI A;  3R1L A;  3PW2 A;  4WTY A;  2FHO B;  1U1R A;  2K06 A;  1V3R A;  1VFJ A;  4CT8 A;  1SJF A;  3MPU B;  1VGY A;  5B08 A;  4AXJ A;  2EG2 A;  1NB7 A;  2CPD A;  4DFK A;  2E1R A;  3R5C A;  2HHS A;  1ZA2 B;  3FKB A;  3BQ2 A;  1WTF A;  1UEU A;  3F0N A;  3LAN A;  4C97 A;  2O01 C;  2NZC A;  1VQ8 S;  1P9Q C;  2Q66 A;  3HI9 A;  2VG5 B;  4DV4 F;  2CXE A;  1S1T A;  4RW4 B;  2YWF A;  3R2D J;  1N4L A;  4G1Q A;  3R1H A;  3MCN A;  1CQM A;  4PG6 A;  1G4C A;  3ZZU A;  4WYL A;  3BH6 B;  2RT3 A;  3BDE A;  2FDN A;  1ZPV A;  2P8I A;  1QE1 A;  2LXI A;  2VB6 A;  5IQ6 A;  4TU7 A;  2DPJ A;  2V4J B;  3HLU A;  4JV0 A;  1N5V A;  3KHG A;  4FNH A;  3OTO F;  2YNH B;  1XNR J;  1U2R A;  4NLV A;  2YKN A;  4PQU B;  3UVJ A;  1RA6 A;  6AT1 B;  2MKK A;  2B5J B;  4O4G B;  3D54 A;  1G2E A;  4R0J A;  3KDO A;  5KFP A;  1S1V B;  5HK4 A;  1MLA A;  4OJ3 A;  8AT1 B;  1RWM B;  1HHQ A;  2YPY A;  5J2M A;  1R6V A;  2XNR A;  2B4V A;  2A0F B;  1KDN A;  3GON A;  5B0C A;  2MQM A;  1KWM A;  1VQO S;  2GIQ A;  5EHH A;  3H25 A;  3MM6 B;  3BSN A;  2ZH7 A;  3ZZO A;  3DRY A;  2OP5 A;  2DGX A;  1N6Q A;  1N0V C;  4I6A A;  1LV5 A;  2UUC J;  4LSN A;  2EVZ A;  4IO1 A;  1Q5V A;  2MKI A;  2NXU A;  3PJX A;  3PRD A;  1HI8 A;  2VJU A;  5HRO A;  1XN9 A;  5KFE A;  3PNI A;  4DL2 A;  1QTN B;  4FYV B;  5ETM A;  3CMQ A;  4RW9 B;  1GXT A;  3HJV A;  3QJL A;  4ZCL A;  5E3Q A;  2KJV A;  3KJF B;  5LSL A;  5LXY A;  2YNI A;  4ZA1 A;  1FJ7 A;  2DH7 A;  4NLX A;  2ASD A;  2FJB B;  1U26 A;  2EWH A;  1K0T A;  1S7H A;  5DQI A;  1IKY A;  1FKP A;  1SJR A;  1WD6 A;  3PRV A;  4YUD A;  4GVL A;  3DLE B;  5CAB A;  1RWK B;  1LXJ A;  4IDK B;  4O23 A;  3TZZ A;  3CJS A;  5LT5 A;  2IA0 A;  2C42 A;  1KN6 A;  2KDO A;  4HDH A;  1NDC A;  1GEH A;  3IGN A;  2KL8 A;  1CUL A;  3RU0 A;  1F9E B;  3B4M A;  3LGH A;  1D1U A;  3H0P A;  3TP2 A;  2FHJ D;  4O3P A;  1F5C A;  3SCJ E;  4U95 A;  4ZHR A;  3MAA A;  1ULR A;  2GQ2 A;  1TL3 A;  4C9D A;  1KOH A;  2HBQ B;  3FJ2 A;  3JAM U;  3JQM A;  4IR1 A;  1WG5 A;  2AHO B;  1IKV A;  3VAM A;  4CO0 A;  3CME S;  1ARO P;  1R8P A;  4TVA B;  1WSV A;  2MB0 B;  1R89 A;  1XMQ J;  2DNK A;  1FK9 A;  3DRR B;  1K8A T;  3R97 A;  2BMB A;  2GGP B;  5HP1 B;  3K57 A;  1LFW A;  3OHB A;  1YVF A;  4IFY B;  3C6T A;  5KFR A;  4F0K A;  1URR A;  2ZKT A;  3FC9 A;  2XLK A;  3BM7 A;  5EX0 A;  5IFM A;  2KM8 B;  3DLJ A;  4OZ0 A;  4K8R A;  1D8Z A;  2EKN A;  1HR0 J;  2N3O A;  2G0J A;  1FDB A;  1TU0 B;  3K58 A;  3HPO A;  3K5M A;  1RT6 A;  3JSR A;  5E3R A;  1N5T A;  4DSF A;  4HKQ A;  2BKO A;  2QT7 A;  2HNY A;  3WIV A;  5A8R A;  2PMW A;  1VQ9 S;  1BXN A;  4NLT A;  1V9O A;  4LSL A;  1Q95 G;  3ILJ A;  5DJB A;  4NZ6 A;  3BN4 A;  1S5Z A;  3MHY A;  3ICL A;  3M4X A;  1JLA A;  3QFH A;  4BS2 A;  3TWZ A;  2QO3 A;  3T9N A;  2AJ2 A;  4E0D A;  1RHJ B;  3EUN A;  2E7X A;  2VON A;  1L3V A;  4X64 F;  2QV6 A;  2AZ1 A;  2GZO A;  1T9X A;  1S4F A;  3W63 A;  4YR3 A;  2CQG A;  3NNC A;  3R2C J;  3NCP A;  1NSK L;  4DV5 F;  2CKW A;  4QWC A;  3CVK A;  3HFV A;  1R7I A;  3MAQ A;  2G13 A;  1GAO A;  1Q78 A;  2FVP A;  1NJY A;  2E9T A;  2DEI A;  1W7W A;  1A9N B;  2RNE A;  2DTJ A;  5DQG A;  2B7B B;  2QA2 A;  5A0Y B;  1XK8 A;  4ID5 B;  2MDA A;  1IVZ A;  2AD9 A;  3GYN A;  5KAK A;  2Y1L B;  3H5X A;  1SBR A;  1T9Y A;  4RLE A;  5I3Q A;  4K4Z A;  4YB1 P;  1HWJ A;  5H9E J;  1UPM B;  4OYO A;  2FGC A;  3DMJ A;  2HK3 A;  4ANC A;  1LWE A;  1KHW A;  3N9U C;  3JYT A;  4OZ2 A;  3UDL A;  5EN1 A;  2GA7 A;  2AGO A;  4A8K A;  1Q8B A;  1NHV A;  1FEE A;  8ATC B;  1HBN B;  4PWU A;  3W9I A;  4C0B A;  3BGL A;  4UQT A;  3K7R A;  2VAS A;  4DUY J;  1YJN S;  3KLE A;  4A8M P;  2W2Q P;  4YDX A;  4NX9 A;  2FYX A;  1N56 A;  2POK A;  1WC1 A;  4X2B A;  3ZTS A;  5B7W A;  2R9L A;  3ZFV A;  3LP1 B;  4OX7 A;  2HHT A;  1X60 A;  1N48 A;  4C11 B;  4CO1 A;  2C28 A;  1EB0 A;  1S97 A;  3Q8U A;  1R8A A;  1Z2Z A;  1Q7L B;  1X4B A;  5A2Q U;  3HP6 A;  3TAR A;  1UVM A;  1HBM B;  1OPZ A;  2WVC A;  4M95 A;  2HVD A;  3OL6 A;  4DV3 J;  3FEY B;  4YY3 F;  2JZ5 A;  4B02 A;  2VUG A;  3FRY A;  1X4G A;  1HPZ A;  3GV5 B;  5HBM A;  4X4O A;  2H4W B;  1NH7 A;  5CAA A;  4I2Q A;  3M6U A;  2R7X A;  4I67 A;  2ZHA A;  3JB9 k;  4RW8 A;  1RAO A;  1LWX A;  2XZT B;  4M5J A;  2F40 A;  5D3G B;  5GAH U;  2ZH3 A;  2E9R X;  3ENA A;  3K5O A;  4LF2 A;  5I42 B;  4JI6 J;  1SKS A;  2AQ4 A;  4L75 A;  1SQG A;  2B0G A;  4ECT A;  3GIR A;  4JI1 J;  3D2W A;  3SV3 A;  2ZWP A;  2CQI A;  4NI2 A;  2BJ3 A;  3RRK A;  3MMB B;  4L73 A;  3HHE A;  3AY0 A;  4PPZ A;  1VJW A;  1FDN A;  4XK8 C;  4NXM F;  5GME A;  1IM4 A;  2XZW A;  1SC3 B;  5HLF B;  2IMO A;  3HVW A;  2F9J A;  2OPS A;  2W2N P;  4FPR A;  1ZA1 B;  2NYH A;  3BN7 A;  2YNG A;  1I51 B;  4CNY A;  4N47 A;  1TKT B;  1UAW A;  2DEJ A;  3J7A N;  2YKQ A;  3MR3 A;  3D3C J;  4DLG A;  2AYG A;  1CPZ A;  1R3N A;  2DIS A;  4DV4 J;  4PWW A;  4ATN A;  5IV3 A;  1U4B A;  5T7L B;  4DQP A;  3MFI A;  3Q24 A;  4ED1 A;  2WBM A;  3P3D A;  2I0X A;  3Q8Q B;  3T1H J;  4CLU A;  4ZPA A;  2VOO A;  2BM0 A;  4E2F B;  2Z30 B;  2HQ3 A;  3TZX A;  3W1Y C;  4CCH A;  4CH0 S;  5DG8 A;  4I6W A;  2WOM B;  2XUL A;  4I6Y A;  1CG2 A;  4I0W A;  1WDT A;  2O3D A;  4NCA A;  2QA4 G;  4H4M A;  2E7V A;  1RAJ A;  4ZIW A;  4PWD A;  5L9X A;  2D3O 1;  2P9G A;  1FD8 A;  2CJK A;  3T6J A;  1KD1 T;  1I94 J;  4OYZ A;  2Y8W A;  4P72 A;  2YKA A;  1EJ7 L;  3KLH A;  2HVZ A;  2LEC A;  2IBO A;  4QR2 A;  4LFB F;  4DQS A;  4Q7A A;  4TQS A;  3O8W A;  4DFP A;  2XZD B;  2ADB A;  2COL A;  1VC6 A;  4F50 A;  5F8N A;  1RT7 B;  2IDL A;  2LQJ A;  2GVD A;  1VC0 A;  1U47 A;  3FSI A;  2CZV C;  2XLJ A;  2OPP A;  3SQO P;  2JLF A;  2W2M P;  1GQE A;  4CH7 A;  3IXQ A;  1NPR A;  3MEK A;  1KLM A;  2VV5 A;  4CM2 A;  4FS2 A;  4RWX A;  3NEK A;  3KLF A;  1I5O B;  1M5K C;  2WON B;  1QAY A;  3ZZT A;  2E66 A;  3C46 A;  4UOG A;  2MPU A;  1XJW B;  3CSK A;  1MMN A;  2HBY B;  3S7R A;  2G2Y A;  1UWA A;  4KHR A;  1C2P A;  4Y28 C;  3Q8P B;  2QSW A;  4QYR A;  1F2H A;  2OPR B;  1FKO B;  3EPG A;  4ZS6 A;  2BR0 A;  7AT1 B;  5E3P A;  4JI0 F;  4ANE A;  4N56 A;  2R7T A;  1HBO A;  3IWN C;  3RAQ A;  4WZQ A;  1NHK L;  3DCA A;  5DQH A;  1IBC B;  4B3S J;  4H4O B;  3K2Y A;  1S99 A;  4QU6 A;  2R42 A;  2FVR A;  3R5B A;  3UCG A;  3OR1 A;  1Q4R A;  2Z2L A;  5CCM A;  5FJ4 A;  2I9S A;  3CD6 S;  3A12 A;  4MKB A;  3DOK B;  2AJ1 A;  2JHE A;  2KZM A;  3CJ2 A;  3BF4 A;  4DL7 A;  3PYE A;  1Y3K A;  5E7O B;  2C2Z B;  2V67 A;  3BSO A;  2MQQ A;  5IS2 A;  1TKD A;  2AEF A;  1D9F A;  2GJ2 A;  4TY8 A;  1H72 C;  3N6M A;  3T3F A;  2OJ3 A;  1L3U A;  2OSQ A;  3AD7 C;  3PEH A;  2DNY A;  1HNW J;  2QMW A;  1FRX A;  2HQC A;  2J6T A;  3D67 A;  2P6T A;  3RG6 A;  1HYS B;  3HVT A;  4WKR A;  3EVM A;  3TNV A;  3I5C A;  4LBH A;  1NSP A;  3N28 A;  1M5H A;  2GVZ B;  5DDO C;  4ZIV A;  4PQA A;  4K0K F;  1QSS A;  4P2F A;  3RBD A;  3TUJ C;  2XMV A;  5KG0 A;  2MTL A;  4M5K A;  1Q8L A;  2M0G B;  4Y65 A;  5AT1 B;  3OTD A;  1HNZ J;  3C14 A;  1ZTT A;  2UUA J;  1R8B A;  1F5B A;  4J9K A;  1YIT S;  2B8Q A;  1UFK A;  2G0I A;  2RRB A;  2C2O B;  2F4V F;  3KYL A;  4DV5 J;  2B9W A;  4OZJ A;  4C48 A;  1ZM9 A;  4F04 B;  3NMR A;  5FLX Y;  2ATC B;  4P2M A;  3NCQ A;  1KVJ A;  3W60 A;  2R2S A;  2KN4 A;  3I4P A;  2HHQ A;  4PAB A;  8RUC A;  1CJV B;  1XR6 A;  3T1Y J;  3MEE A;  4K4U A;  2AWZ A;  3NAH A;  1BQM A;  4QWE A;  1IBM F;  4RNN A;  4P52 A;  1PIE A;  5DDQ C;  2DXF A;  4OL8 A;  3ETO A;  4KBI A;  2HQD A;  4OIX A;  3NBP A;  4F26 A;  1GFW B;  1FVS A;  2M8H A;  1U45 A;  3D5M A;  2MQO A;  5DO2 A;  4ZVE A;  4IOA Q;  3QT5 A;  4P7V A;  4Q8F A;  1VHI A;  1YX2 A;  3I32 A;  1YJR A;  1FDD A;  3LP0 A;  3J81 Y;  1N34 F;  5E3C A;  4WFZ A;  1NJZ A;  4ES1 A;  3M30 A;  1RSC A;  1OY6 A;  2IM1 A;  3BQ0 A;  1WHX A;  4OJ1 A;  3OQ2 A;  3VGU A;  3V81 B;  4MAK A;  3VZH A;  4DQR A;  3KNG A;  1AZS B;  4DL0 C;  2JVO A;  4LSZ B;  1RWV B;  4FVC A;  1BGX T;  4BWM A;  2E5I A;  1EP4 A;  3OFE A;  3MWB A;  4UTG A;  2HHV A;  3BJY A;  3QMQ A;  3OTE A;  2HRU A;  2DIT A;  3UD5 A;  2RD5 C;  4G1P A;  1X7V A;  1Y4Z B;  4F2R A;  4QYZ J;  1VQM S;  2HAI A;  2MZS A;  3IN5 A;  4B3T F;  4Q5V A;  1EAR A;  4HR2 A;  4LRA A;  4ICL B;  3IRX B;  2HSE B;  3MPW A;  3S1T A;  2DH8 A;  1T7P A;  5ETK A;  1OO0 B;  3SFU A;  3RR7 A;  4D3G A;  4X66 F;  2JJ4 D;  2KRR A;  3D6F B;  1NRK A;  5E5N A;  3BGU A;  2DNM A;  1GT8 A;  1TVR B;  3WBZ A;  3KOA A;  4UT4 A;  2QIF A;  4DV2 F;  2FUG 9;  5KFG A;  1R6Y A;  3MM5 B;  3TA0 A;  1KTQ A;  4ED8 A;  1MG7 A;  1CC8 A;  1YBA A;  1S77 D;  2MHE A;  4URS A;  5HI7 A;  1PC4 A;  1L5U A;  2HND A;  1KSP A;  4ZP6 A;  2ZE2 B;  1S7I A;  2DKO B;  1RA7 A;  3A13 A;  5GAH I;  1UWB A;  1X9S A;  1T3O A;  2DR5 A;  2H5E A;  3M32 B;  2ROP A;  2KHC A;  1LK7 A;  2B9Y A;  4NZ7 A;  1JJ4 A;  4JB8 B;  3GFH A;  3BGR B;  2VBX A;  2W9C A;  4AYB D;  1RK8 A;  4RW7 A;  5LOQ A;  3DI6 B;  2DNG A;  5D0E A;  1RT1 B;  4PXD A;  2J9E A;  2Z58 B;  3V4I A;  2RE1 A;  2Z2Y B;  2XLI A;  1CBK A;  1D9A A;  2DIV A;  1XMO F;  4DX6 A;  4AUK A;  2J9D E;  1X0F A;  2X3D A;  2YKP A;  3AD9 C;  5K20 B;  1TFW A;  3I9V 9;  5DG9 A;  2CJQ A;  1UVJ A;  2RQK A;  1SPB P;  1VK8 A;  1CJK A;  2WVD A;  1S9E A;  3ADA C;  1NU4 A;  2GMJ A;  1WEX A;  3FMB A;  4PAA A;  4I1T A;  1B7F A;  2GC8 A;  1DUR A;  3JTN A;  2FHK A;  3DGV A;  3IG1 B;  2BAN B;  1FTR A;  1H73 A;  1VQS A;  3W64 A;  4DS5 A;  4K59 A;  3B82 A;  3W2W B;  2OAU A;  4PRF A;  2EFO A;  2HKE A;  4C0O C;  2G0C A;  5HQM A;  5I4M A;  4C98 A;  3OJS A;  4P74 A;  4GO5 X;  2FY1 A;  2C2K B;  4P9S A;  1RTJ A;  3W9H A;  2LMI A;  5A8K B;  4F2S A;  3JSM B;  3QLH A;  4YEA A;  3LPE A;  4ZK7 M;  3PW7 A;  5L38 A;  4CP5 A;  3SV4 A;  3ZZZ A;  3OW2 R;  4FDF A;  1FRK A;  5GAE U;  2KM8 C;  4QIE A;  3MCO A;  4KQZ A;  1Z2L A;  2AT1 B;  2R4F A;  3E3X A;  1OS5 A;  5AXL A;  3CJ3 A;  4RBV A;  3AFG A;  4UY8 5;  1LXN A;  4K4T A;  3QGG A;  2P9E A;  1TV6 A;  5C24 B;  4OV1 A;  5B09 A;  5AE3 A;  1JX4 A;  2BM1 A;  4TLQ A;  3CCW A;  1TUW A;  1UPP A;  2R7Q A;  3CCJ S;  3RAM A;  1S9G A;  4OHV A;  4PXE A;  5A8W A;  2QLX A;  4AL7 A;  5ETQ A;  4F3O A;  3TOQ A;  3NNH A;  2J7K A;  5KT7 A;  4RO0 A;  3I5B A;  4FZV A;  2DIU A;  2GJF A;  4OYM A;  1U48 A;  1PYO B;  3QPI A;  4DPX A;  3FBE A;  1MN9 A;  5ETR A;  1RAA B;  2CG4 A;  2CJY B;  2ATL A;  3TUI C;  1F9F A;  1S6P A;  4UST A;  3SCK E;  3X3U A;  2Z56 B;  3POT B;  1ZAV A;  4OMF G;  3HDS A;  2ZH8 A;  2E29 A;  3DLG B;  1HQE A;  1IBK F;  1KON A;  2VZ9 A;  3HMJ G;  1Q86 T;  1RBO B;  1SI9 A;  4OZL A;  3ETM A;  4CO3 A;  1FXR A;  3EIC A;  2DO0 A;  1RTZ A;  3ISZ A;  1MU2 A;  5DG7 A;  3C19 A;  4J9O A;  4RU9 A;  2VG7 A;  3F56 A;  1Q7Y T;  3M8P A;  3FZB A;  2WSE C;  2HRY A;  2XWY A;  3MMA A;  3G6X A;  1KNZ A;  4DR5 F;  2XMK A;  3SDE A;  3JSB A;  3MEG B;  3OSP A;  1PYT A;  4WFN Q;  1IKW B;  1RWU A;  5D4L A;  1OSD A;  3W61 A;  1FEH A;  1Y9O A;  1RYS A;  3PW4 A;  3QWP A;  4NLO A;  4FYD A;  4FKX A;  2XMM A;  3OV7 A;  1YI2 S;  4PG7 A;  5HJX A;  1Q16 B;  4C8Y A;  3MMC B;  3JS9 A;  3DOL B;  3O5T B;  3D9B A;  5DGA A;  1UZD A;  1FJE B;  3DRP A;  1MRO A;  4DV7 J;  5A6P A;  3W3S A;  4TYB A;  1BQN B;  4W98 A;  1G6B A;  3SCI E;  3FFI A;  1NB2 A;  1LWF A;  1U0H B;  3JAM Y;  4OZ5 A;  2A3J A;  1H2T Z;  1DTT A;  4KAI A;  1Q82 T;  1DLO A;  1VHF A;  3VZI A;  4MKV A;  3R5G A;  4JI5 F;  4DCJ B;  4KO0 B;  2B43 A;  4RPF A;  4CQ1 A;  1SUQ B;  2RHS B;  2HYI B;  2CQ2 A;  1SIW B;  2MYF A;  3FZ2 A;  1VQK S;  4Z37 A;  1JMT A;  4Y6I A;  2CQ3 A;  4FKY A;  4FP9 A;  1NK8 A;  2K3K A;  2L48 A;  3FCV A;  1W26 A;  2IAJ A;  4I68 A;  2JLE A;  4X84 A;  2WBR A;  4DSK A;  3RZA A;  4TN2 A;  4XO0 A;  5AXN A;  1X0P A;  1RT2 B;  4WFY A;  5B0B A;  3G8Q A;  3PYG A;  3UD3 P;  3H42 A;  2HAF A;  2CPJ A;  1SJ3 P;  2VG6 B;  1SH3 A;  1RAI B;  3SEO A;  4KPY A;  3TQ1 A;  3L7O A;  2Q6C A;  3IO1 A;  4J9N A;  2EFG A;  2U2F A;  1ELO A;  5IWA J;  1ZM4 A;  4MIB A;  3VAH A;  2D74 B;  3FEX B;  3V6D A;  1YRX A;  2X3G A;  1X5S A;  3QQC D;  3IR7 B;  5KT2 A;  3MM9 A;  4DR4 J;  3PKM A;  3NS7 B;  4DX7 A;  4JV5 J;  2RDI A;  1B0P A;  3PHE A;  2AX0 A;  4LF8 J;  4U96 A;  4N41 A;  2GQQ A;  2K1R B;  3G87 A;  1SKR A;  2D3Z A;  5FDL B;  1S1X A;  1HNX F;  2XGQ A;  2WVE A;  4DV6 J;  2CRL A;  3EDR B;  2DY1 A;  2OEL A;  3SQG A;  4L72 B;  3TJA A;  2IC3 B;  1RJJ A;  2B7C B;  1RI7 A;  4KKO B;  3OFF A;  4JI2 J;  3GV7 B;  2KJW A;  5E3A A;  2WHO A;  4M5D B;  1S6Q B;  1VBK A;  2XSJ B;  5L46 A;  1Q81 T;  2YWW A;  3FCH A;  2QSF A;  1UVL A;  3UWT A;  4F4Z A;  1ZM3 A;  1VRQ C;  3GCW P;  2ROG A;  3PAC A;  2KXN B;  1EKS A;  2KXF A;  1U1P A;  4OYA A;  3D4J A;  3QIP A;  2W9A A;  3MM8 B;  2V4Q A;  2YH1 A;  2KT2 A;  1VQP S;  1QD1 A;  3E01 A;  2J0Q D;  5IC4 B;  4F67 A;  2YWH A;  3F73 A;  2M2B A;  4QW8 A;  3J7Y U;  2XY6 A;  2HNZ B;  4ECZ A;  2CYY A;  4RBT A;  1I6J A;  2RDJ A;  4DX8 H;  3M2U A;  2CJ9 A;  1SL0 A;  2M52 A;  5K9F A;  5CYQ A;  5HVG A;  2RS8 A;  4KV8 B;  1NPK A;  1TR0 A;  3CCR S;  1UW9 A;  3CJ0 A;  3H4B A;  2BE7 D;  2AJ4 A;  4C2M A;  4Q2L A;  2H4Y B;  2RH3 A;  1FA0 A;  4IFV A;  4RBU A;  4YN3 B;  5DGB A;  5ETS A;  4O3R A;  1LFP A;  3DRS B;  1NPP A;  3RGI A;  2LYV A;  2V8H A;  2BDP A;  3NGT A;  5A2Q Y;  3N5B A;  3RUB L;  1HHS A;  2HVH A;  1WI8 A;  4R5P A;  3HHL B;  2C3Y A;  1VIX A;  4NYZ A;  1P1T A;  5HVF A;  3AA8 A;  1VRU A;  3MZI A;  3TVY A;  3QO9 A;  1HFE L;  3KG4 A;  3EZ5 A;  1JKH A;  1FES A;  4R8U B;  1OY9 A;  2VJV A;  1REV A;  2B56 A;  2PSZ A;  5F3T A;  2FC8 A;  4LR8 A;  2E7W A;  1N88 A;  2VPZ B;  5KFS A;  5DM7 Q;  1JJ2 R;  1OPI A;  3DGP B;  4BC7 A;  1WWH A;  2ZH2 A;  2MZQ A;  3GE9 A;  4F36 A;  1MSW D;  1F1B B;  3GIK A;  3G8T A;  4QR0 A;  4LBP A;  4M94 A;  2C3U A;  4YP3 A;  2K3I A;  2BAC A;  3QJP A;  5LXR A;  5BJR A;  2VBY A;  2VIH A;  5K8O A;  4C7Q A;  1TK0 A;  3TVZ A;  1YWX A;  2W01 A;  4DS4 A;  2ZUG A;  4EFA C;  1H0H B;  2EFP A;  2XTJ P;  2EC2 A;  1U1K A;  4UOF A;  4AD6 A;  3PZP A;  1J5E F;  5DLF A;  1ITP A;  1BD6 A;  3AT1 B;  3W65 A;  1HQ2 A;  4G1Q B;  3NGU A;  3EXY A;  4ZVO B;  3TVK A;  3FQK A;  1F9H A;  2GAH C;  1JNZ B;  3OJU A;  2W7P A;  5F8J A;  5FD1 A;  2RUS A;  1EZZ B;  3R5A A;  1QE1 B;  5HAT A;  3CUL A;  3GR1 A;  2YY3 A;  4GMK A;  3TR5 A;  2PFF B;  3RAX A;  4H54 A;  3R6G B;  1QAI A;  3EE3 A;  1M1G A;  3U7J A;  2XMW A;  1RDR A;  5L1I A;  2L9N A;  3CJ4 A;  1T3N A;  4LF6 F;  2YKN B;  2YBV A;  3UVJ B;  3ZTO A;  3P5B P;  2CPY A;  3Q0A A;  1VLY A;  1F6T A;  4DR7 F;  1JLG A;  2OSR A;  1GX6 A;  4DL4 A;  3AHP A;  1WOP A;  3JXO A;  4OX9 F;  4M1K A;  4TXS A;  3MED B;  2ZC3 A;  5J2M B;  1AYE A;  3I0S A;  2IBK A;  2NXN A;  5C7P A;  2H1Y A;  3A8E A;  4LF4 F;  2QC3 A;  2HG4 A;  1ZYQ A;  3PKY A;  1RT5 A;  2BOA A;  1N6Q B;  4AQY F;  3F44 A;  2E5L J;  4LR9 A;  1T03 A;  4C3K A;  2HLU A;  1Q5Y A;  4LSN B;  5F9L A;  1JXE A;  3IWX A;  5KG4 A;  2KZZ A;  4RU2 A;  2V8V A;  2NPF A;  5HRO B;  1R27 B;  2CPI A;  1E6V A;  4DJB A;  4Q45 A;  3K5L A;  2F63 A;  3QT8 A;  2YNI B;  1YRT A;  4DCO B;  2WK4 A;  4C8Z A;  2HK2 A;  2I38 A;  4QIW D;  3IP0 A;  4J9M A;  2BW7 A;  1IKX A;  2XI2 A;  1IKY B;  1FKP B;  4ZOS A;  2K8G A;  4NLD A;  5KFX A;  3NXZ A;  1U6F A;  3TRG A;  1NEE A;  4H4K C;  2BE9 B;  3BO4 A;  1QLN A;  1D8Y A;  1IUJ A;  1WC6 A;  4J90 A;  3GG0 A;  2GGP A;  1QUV A;  3CO9 A;  1CUL B;  1U1O A;  3EGV A;  3GMG A;  4WIQ A;  2X1F A;  1FFW B;  3QZ7 A;  5H9F K;  3D1H A;  4DEZ A;  3KMS A;  3HT0 A;  5HSP A;  4TNO A;  1MWZ A;  3GFY A;  2W2P P;  5D4O A;  1UA0 A;  3UR3 C;  1XNR F;  3MAA B;  1TL3 B;  2BRK A;  3EM1 A;  2PMH A;  2HVI A;  1IKV B;  1RWN B;  1TL1 A;  1TKZ A;  1DAX A;  1U0S A;  4WU3 A;  3LH2 S;  3G82 A;  1FK9 B;  5HQ8 A;  1WOS A;  5CXT A;  4WBF A;  4WP9 A;  5IOL A;  3UO0 A;  4N77 A;  3GIM A;  4O0N A;  2A6O A;  3DYA A;  4V1A k;  1DRZ A;  4HL9 A;  1CS4 A;  5CD4 A;  2W24 A;  4ZLJ A;  4NRT A;  4JI5 J;  3C6T B;  2Z57 B;  1KFD A;  3DDI A;  1T9U A;  3UNG C;  3VGS A;  3NGD A;  2XYH B;  4MYT A;  2QEX S;  4CLY A;  2UUC F;  5J2P A;  4NEY A;  1FX2 A;  3KHR A;  1S79 A;  2V2V A;  1RT4 A;  3V6H A;  3D0G E;  1SJQ A;  1YZ6 A;  1K9M T;  1RT6 B;  2I1R A;  4N7T A;  4HHJ A;  4TKT A;  1RHQ B;  2KH9 A;  4OYX A;  3I5A A;  3KDN A;  2NYI A;  2HNY B;  1YGY A;  5A8R B;  4IRK A;  1TTH B;  4FYX B;  3MD1 A;  2YNF A;  2R7U A;  4CZC A;  2M88 A;  4F0H A;  2A6M A;  4Y00 A;  2IRX A;  4NE9 C;  1F3F A;  3W5Z A;  1V3S A;  4LSL B;  1VBX A;  3WX8 A;  1JLA B;  2BRL A;  2ZD1 A;  3LAK A;  4OZ1 A;  1KC8 T;  3H5U A;  3BBC A;  2WVF A;  1KVK A;  1PAE X;  2QYG A;  2QJ3 A;  1T9T A;  1IWG A;  1TAU A;  3SSR A;  4PUO A;  4W4M A;  1K1Q A;  1MN7 A;  4JYA J;  2OTL S;  1NKE A;  1NSQ A;  2VPY B;  2BKP A;  5JMN A;  4Z7C A;  3ENW A;  5L8R C;  3Q22 A;  2NSC A;  2XY5 A;  1OMS A;  2IYG A;  4K50 A;  1KQG B;  2GS8 A;  2MKS A;  3HHD A;  1QY7 A;  4MKA A;  1R0A A;  5KG2 A;  2FY8 A;  4F3M A;  4B3M J;  1AFJ A;  3FEZ A;  1S49 A;  1TAQ A;  2B4P A;  1WTB A;  1N52 B;  4ZP7 A;  4WP3 A;  2O67 A;  5KFV A;  2KYZ A;  3GWC A;  4KE5 A;  2JEG A;  3UDC A;  2VHG A;  1XMQ F;  1HQU A;  2CQ1 A;  3DMJ B;  2QRR A;  3KWM A;  2ZDP A;  2NRE A;  4KY3 A;  2XG8 A;  3NOC A;  2DRA A;  1LWE B;  1KQK A;  3JYT B;  3QRR A;  2CG8 A;  3CCT A;  1RAD B;  4UF4 A;  3SSS A;  3H8Y A;  1UW4 A;  2VKR A;  1U6B A;  2DNZ A;  5JVG Q;  4F4Y A;  2EXU A;  5B0A A;  1Q8I A;  4RZR A;  1HR0 F;  5KT5 A;  3KLE B;  1P9Y A;  2KVI A;  2E5H A;  1PIL A;  3GCX P;  3I82 A;  4B9S A;  4G6V B;  3HM9 A;  2VDI A;  2ZEJ A;  4ZKA A;  3BGO P;  1S0N A;  2PC6 A;  3T9Z A;  1FFS B;  1PBA A;  4ZCK A;  3DM2 A;  3J7Y I;  4ZPT R;  2DHX A;  1J27 A;  1S4E A;  4B3R F;  5G0R A;  3JQK A;  4C4W A;  3WC2 A;  2YWE A;  3SMZ A;  2LQ8 A;  4LJM A;  3FGV A;  4MK7 A;  3ZTQ A;  5CCL A;  3VV2 B;  1VQN S;  2F3J A;  2VFV A;  2DHA A;  1RTI A;  1X9W A;  4U8Y A;  5HBM B;  3IBC B;  2R2U A;  3H40 A;  2DNN A;  2CQ0 A;  2XC9 A;  3CE8 A;  1W25 A;  4I2Q B;  4NWB A;  4Y2I A;  3J7Z T;  2RF2 A;  2PA8 D;  4RW8 B;  4UUW A;  2CQC A;  2UV8 A;  3W2V B;  3R5D A;  2BJ8 A;  4OV6 A;  1VQ6 S;  1IXK A;  3M8R A;  4G1I A;  2X1A A;  3IAM 9;  4ED6 A;  3AA9 A;  3VAJ A;  2BA9 A;  3VQS A;  2NUH A;  3MEC B;  3R5J B;  1D0E A;  1RAE B;  4UQG A;  2DNQ A;  3CJK A;  5IT0 A;  2DNL A;  3PVX A;  4B3O A;  3GQC A;  4LQ9 A;  3E51 A;  4OI0 A;  2WOM A;  3AXK A;  1FI4 A;  2EG1 A;  1FTC A;  3R7N B;  1UVI A;  3G2X A;  4UY8 T;  2OPS B;  2ZBP A;  1URN A;  3M6W A;  2VQF J;  3MCM A;  3RW6 A;  2YNG B;  5D15 A;  1NND A;  3TAM A;  4DL5 A;  5KFH A;  3T6B A;  3KK3 A;  1AT1 B;  5KG5 A;  4YHH J;  4PYA A;  4GKJ J;  1S6U A;  3QGP A;  2VH7 A;  2B9X A;  5IT4 A;  4QJV A;  1QAX A;  1RAG B;  4DUY F;  2GW8 A;  2N7Y A;  2BQ3 A;  5HO4 A;  2YPZ A;  4MIW A;  4IG0 A;  1CEZ A;  4QBU A;  3DU5 A;  1G3O A;  1FWK A;  2KHD A;  3O2I A;  3UD4 P;  2JC0 A;  3LP2 A;  4AXI A;  2W8K A;  2J7W A;  2XQC A;  3A8K A;  3UN5 A;  4KYZ A;  1MNE A;  3PX6 A;  4H4M B;  4A48 A;  3PXG a;  1KP6 A;  3W5X A;  4QIV A;  3BRE A;  3NS6 A;  4EGL A;  1LWC B;  2BJD A;  4DDF A;  5LMN J;  2RSQ A;  1JK9 B;  1RBL A;  4DFM A;  2W7O A;  2KFY A;  3CED A;  3KLH B;  4DV3 F;  4LF9 J;  2ROE A;  2AZ3 A;  4KR0 B;  2KG0 A;  1JLC A;  2WRM A;  3VVT A;  2ALY B;  1CJU A;  3TJ9 A;  3IC1 A;  3GZ7 A;  2R8K A;  1XMB A;  1LQ9 A;  1IR2 A;  3DDN A;  2AKW B;  1F5A A;  3GFX A;  2BOP A;  4JI6 F;  2FLL A;  1VQL S;  2VOD A;  1KLM B;  4H4O A;  4LFA J;  2E1C A;  4HHH A;  3I55 S;  3BYP A;  4JI1 F;  5L1L A;  2H3E B;  1WDD A;  2MGZ A;  1DQ8 A;  3KLF B;  2ZBC A;  4KC5 A;  3HD1 A;  2XO7 A;  2FHJ A;  2MZ1 A;  4ZVF A;  3FK4 A;  3NMA A;  3B54 A;  1GXL A;  3SI8 A;  2GV1 A;  4O3Q A;  4BCA A;  2YWK A;  3PX4 A;  3UFC X;  4IQM A;  2GJI A;  4C3M A;  1EET A;  1T11 A;  3IBF B;  4BC9 A;  1WF1 A;  1HBO B;  4OI6 A;  3KLG A;  1WG1 A;  5J2N A;  4RWW A;  4X62 J;  4M63 A;  1PG5 B;  4IOC Q;  3MTJ A;  4JI3 J;  4LRC A;  2ZH4 A;  3CJ5 A;  5K8N A;  1VR6 A;  2KB2 A;  3I4H X;  2CZ9 A;  3T1H F;  1HWU A;  5EWE A;  1T02 A;  4B9M A;  2DNP A;  4ZDN A;  4LF5 F;  3OR1 B;  3DLH A;  4DQI A;  3A3P B;  1JNR B;  3OR2 A;  2BX6 A;  4WF9 Q;  3V6K A;  3O1L A;  1TZ0 A;  1T05 B;  2DRB A;  2AIR B;  1SKW A;  4DL6 A;  4NMX A;  4KGK A;  1TK5 A;  1NCL A;  4OX6 A;  2XGP A;  1BWV A;  5EGY A;  3NNA A;  1I94 F;  1NKB A;  2B4O A;  2C2R A;  3TZY A;  4TY8 B;  3GTY X;  4OI1 A;  4DR2 J;  1RWP B;  2G4B A;  4P2X A;  2CQB A;  1RU1 A;  2D7S A;  2DNH A;  1S1U A;  1WHW A;  4DQQ A;  4DFJ A;  1R8C A;  2RS2 A;  1M5V C;  1QVF R;  4MTP A;  3PM9 A;  1RXO B;  4UUX A;  2JC1 A;  3PO5 A;  4CLS A;  2ERR A;  1DBD A;  1OYE A;  3HVT B;  2O1P A;  4M5L A;  4DF4 A;  1WC4 A;  2FD2 A;  4U7U D;  5C2G A;  1TEL A;  4WFA Q;  2FJW A;  2P6S A;  2CQH A;  2E1M C;  1LW0 A;  2HLT A;  4DSL A;  3EJM A;  4ECQ A;  1S0M A;  4C8L A;  1CJV A;  3PY8 A;  4LVO P;  2JEI A;  2R8I A;  2AW0 A;  5C25 A;  4X4N A;  5SUH A;  3CGI A;  1RLC L;  1SJ1 A;  2ZH6 A;  3EZU A;  2BVZ A;  3M2V A;  3C14 B;  3IS9 A;  1SL2 A;  2JVR A;  3AH6 A;  4RNM A;  1P8G A;  1R0B G;  2MKC A;  5KFJ A;  3GP9 A;  2Q6B A;  2UP1 A;  2JOQ A;  5K5M A;  2OFG X;  3S8S A;  5J1E A;  2OEJ A;  3MOJ B;  3HHL C;  3TUZ C;  4B3S F;  4NLG A;  3U1N A;  3L7P A;  4ZVT B;  4WU2 A;  3P5T L;  4AFF A;  4ED0 A;  1RCO B;  1X4F A;  3M6V A;  3V81 A;  1JXV A;  2HZA A;  4F4W A;  2CVE A;  3R6L B;  4JI4 J;  4PG5 A;  2UXB J;  3MEE B;  1GNK A;  2J7U A;  1TUV A;  2LDI A;  3TZW A;  4ZJL A;  4I7F A;  4CTA B;  4IR9 A;  1BQM B;  3TI0 A;  3P8B B;  3HKZ D;  1BLU A;  2VQE J;  1WEZ A;  5ADZ A;  3PV8 A;  4CT9 A;  3CW2 C;  3NBP B;  3AXM A;  1FVQ A;  4IO9 Q;  1M1K T;  1T8E A;  2PEB A;  5EWF A;  3GII A;  1D9D A;  5JVH Q;  3LP0 B;  3UE2 A;  5ETL A;  3HHN B;  4J7C A;  4FF3 A;  1HNW F;  3MR2 A;  3M30 B;  2EK6 A;  5HMW A;  4USW A;  3FNN A;  1FE0 A;  1ZTW A;  3AJ2 A;  2MEW A;  2KYX A;  2GQC A;  4ITS A;  4USI A;  1Y0H A;  1JLE A;  1M1H A;  1H6K X;  1N54 B;  3CCV S;  3AJD A;  5K14 A;  1N33 J;  1NXI A;  4MMO A;  4IRD A;  4BDP A;  3IAS 9;  1B64 A;  2HWH A;  4B3R J;  1HMV A;  1T9W A;  3NKY A;  4DPW A;  1O8B A;  1J2V A;  2AF6 A;  4FBT A;  2ZE2 A;  3SSQ A;  3IWL A;  4O44 A;  1OIA A;  4L3K A;  2KI2 A;  1HNZ F;  1B0V A;  5B0D A;  5KFZ A;  3D3B J;  2UUA F;  2KFN A;  3KHH A;  1WKJ A;  4DPT A;  4NXN J;  2OUG A;  3ZXW A;  4HTI A;  3MGJ A;  4DR3 J;  1ZOT A;  4AE5 A;  1RTD A;  3U02 A;  2EBE A;  4LIW A;  2HS3 A;  3OT9 A;  2XBP A;  1KVI A;  2CPH A;  2DGW A;  1BC6 A;  4DR6 F;  3DLL Q;  4XTT A;  2V9K A;  3GG1 A;  5CYM A;  4RW6 A;  2HS0 A;  3T1Y F;  2HND B;  3TYT A;  5D0H A;  3PTW A;  4YOE A;  1MMD A;  3JTP A;  1G1X A;  1E6Y B;  3UI3 A;  2XO6 A;  1UWB B;  1QM9 A;  3Q2S C;  4NLW A;  4PCQ A;  4DPU A;  1EQM A;  4ILL A;  1WNE A;  1XWL A;  2PT0 A;  1T9V A;  1NBE B;  3AJ1 A;  3HVA A;  2W9C B;  3DOM A;  2EFV A;  1XTZ A;  5ETP A;  2ZZN A;  3C8Y A;  4DSJ A;  3I0R A;  2GML A;  3L4B C;  3QNW B;  1C0T A;  1JJH A;  3V4I B;  2H5I B;  1VS3 A;  4I4B A;  4ZN3 A;  3K8W A;  2VFS A;  1A6L A;  1FRI A;  1PGZ A;  2FC9 A;  4NLS A;  2CDQ A;  1WAC A;  4YB5 A;  5FII A;  1TL5 A;  2RRA A;  2Z2Z A;  2HMI A;  2F1F A;  2V2Q A;  1CJK B;  5M2R A;  1U1M A;  5MAO A;  4DUT A;  3DLB A;  1S9E B;  3EZO A;  3LUY A;  3CF5 Q;  4OHZ A;  3AAW B;  2OFH X;  5CQG A;  1Y5I B;  3FVY A;  3FQL A;  3HF5 A;  2QLB B;  3BBF A;  2V94 A;  5EUH A;  1CJT A;  1PYS B;  2R2T A;  3BDP A;  2GHP A;  4ZVH A;  2QX0 A;  4ZPV R;  4A8Q A;  1XIQ A;  4GKK J;  2V0N A;  4IG3 A;  3B6B A;  2PD1 A;  5DLG A;  3R8Y A;  4BBY A;  2DR9 A;  1RTJ B;  3NOG A;  4ECU A;  3M9N B;  3RTV A;  4TU8 A;  4JOU A;  3QYY A;  3RYL A;  4DLE A;  3QLH B;  1V3Z A;  1NH8 A;  2HS4 A;  3J80 U;  4HT5 A;  3MFH A;  1XNQ J;  3WDO A;  4HT7 A;  2MHN A;  3HFK A;  2YQ1 A;  1JLF A;  1LKZ A;  4CLL A;  1IJE B;  3ISN C;  2IY5 B;  2FZK B;  1J5O B;  4X4P A;  4OJH A;  2IM3 A;  1S72 S;  5F41 A;  3C3L A;  1WG4 A;  2EBG A;  1FDA A;  1JLB B;  2LFV A;  4CI0 B;  3KFW X;  2CWX A;  1RT3 A;  2YH0 A;  1TV6 B;  5F3Z A;  2BKN A;  1N36 J;  4CLP A;  3MAH A;  1WHY A;  4QIF A;  3Q86 A;  4USV A;  3M9M B;  4OJG A;  3OD2 A;  4TLR A;  4WFB Q;  3Q2T C;  5F8G A;  5A8W B;  2GO9 A;  4WTO B;  2QZ8 A;  2ZH9 A;  3UDV A;  3G6Y A;  4OHW A;  1S9F A;  3MTK A;  2DGV A;  2LDY A;  2DY9 A;  5AXM A;  3UN3 A;  2ZM6 J;  3KJV A;  1X9M A;  2H51 B;  2KFZ A;  1WC5 A;  3T5K A;  1NDL A;  2N3L A;  2UU9 J;  4L3N A;  3NY0 A;  1S6P B;  1GMV A;  4LF5 J;  3AQP A;  2CJB A;  1QUP A;  1SKU B;  2MXY A;  2RKI A;  3NL0 A;  2BEF A;  3LAL A;  4NCB A;  2PO4 A;  1HQE B;  4ZVQ B;  4DV0 J;  4I69 A;  5J1N A;  4K4Y A;  2B9E A;  5HVH A;  1YKW A;  3LF0 A;  5K8M A;  4M5I A;  2DHG A;  3GB0 A;  1MU2 B;  4PG4 A;  1BUX A;  4GO7 X;  5KFA A;  1C1B A;  2AJF E;  1UZH A;  2VG7 B;  1TKX A;  4PYD A;  2J0W A;  2W2O P;  5ETT A;  3M8P B;  1NAQ A;  2JLG A;  3IR5 B;  3EWG A;  4CYU A;  2AJ0 A;  1HI0 P;  3A3N B;  3MMA B;  2MKH A;  1EKR A;  3SDE B;  2VFT A;  4DZ6 A;  2NQP A;  1FJG J;  1Q79 A;  3BKT A;  5KFB A;  2ABY A;  2ADC A;  2HGM A;  3G4S S;  3KG1 A;  4DG1 A;  4A8S A;  3CIZ A;  2QN6 B;  4ZCI A;  2KXH A;  4WCE Q;  2MZR A;  3TJ8 A;  4Y2C A;  1OQ6 A;  1APS A;  4KSE B;  2DGO A;  3RBE A;  2HRT A;  1U1N A;  1S76 D;  2W4D A;  2C3P A;  4I56 A;  2M4M A;  3DRP B;  1MRO B;  3O44 A;  2IFX A;  3FFI B;  1LWF B;  2PE8 A;  3C15 A;  1DTT B;  1CQN A;  4IH5 A;  1DLO B;  1PBU A;  4ZMM A;  5KFK A;  1GMW A;  2B6A B;  5L1J A;  5KTQ A;  4PZV A;  1H2U X;  2BJ1 A;  4NA3 A;  4Q2M A;  4NYO A;  5DET A;  2AGP A;  3CDA A;  3F41 A;  4B17 A;  3OBI A;  2DT9 A;  3EXC X;  2LA4 A;  3BPS P;  4NLR A;  4Z7Y A;  4LF7 J;  3LOU A;  1KLN A;  2IAJ B;  3IR6 B;  1R8H A;  3D6M B;  4CO2 A;  3BEG B;  1XBW A;  2K1R A;  1T0T V;  1RZM A;  2EI5 A;  2JRS A;  4HH1 A;  4CDI A;  1B4S A;  1W2I A;  1Y00 A;  3ZNU A;  5BYQ A;  3G6V A;  2Q79 A;  2WB4 A;  1RWW B;  3M8Z A;  3CD7 A;  5HAO A;  2WVB A;  4ERD A;  1WHV A;  1RAC B;  1OY8 A;  4XPC A;  1VRT A;  1NO8 A;  3AOC A;  5KFQ A;  4KH1 B;  2QL7 B;  2ZHO A;  2BBE A;  3V6D B;  2YKM A;  3TAP A;  2C3M A;  3KHL A;  1P27 B;  4E8U A;  3UCZ P;  2I5J A;  3P4U B;  3MM9 B;  3CPW R;  5E41 A;  4HHU A;  3JQJ A;  2Y1I A;  3M1V A;  1IJF B;  4EUV A;  1S1X B;  2OPQ A;  2ILZ A;  1Q0N A;  4P10 A;  3MUT P;  4IRC A;  2V68 A;  4QCL A;  4KGX B;  1NK4 A;  3T1A A;  3SQG B;  1YBT A;  4OX8 A;  1RAB B;  1JLQ A;  1UJ5 A;  1AB8 A;  1KFS A;  3KUH A;  4K5R A;  2BQU A;  2PEH A;  3PFE A;  4A46 A;  1EQ0 A;  2MSS A;  3U27 A;  2LCW A;  4DV7 F;  2ZIT A;  5L1K A;  4Q8E A;  4DU7 A;  1RGV A;  1RTH A;  2UVU A;  4CLT A;  1QSY A;  3QZ8 A;  2A18 A;  2W7A A;  4U6P A;  5M2U A;  4J91 A;  2OD4 A;  1RP5 A;  1TL7 A;  3QIP B;  5EX3 A;  2V69 A;  1N0U A;  3T5H A;  5HN0 A;  2A1B A;  3E01 B;  4F7V A;  5B0F A;  2E1A A;  3DRS A;  4BLG A;  1ZZN A;  2PMZ D;  3M8W A;  3D7S B;  2RQM A;  2N7C A;  5J2Q A;  4DR6 J;  5KFU A;  1GH8 A;  1UVN A;  4AND A;  5LMU J;  3DFE A;  2QGF B;  1NDK A;  4MK9 A;  3BR9 A;  3L9Z A;  3EPI A;  1N5Y A;  1R43 A;  1LW2 A;  3T5L A;  5CYQ B;  3THT A;  2DR6 A;  2VBW A;  2LP4 A;  1NK7 A;  1BQX A;  1NLK L;  1Y5L B;  2YXL A;  4A4J A;  4MFB A;  3CJ8 A;  2N82 B;  1HAR A;  1KS2 A;  4IFV B;  4EO6 A;  4UZB A;  4QOT A;  4DBQ A;  1B70 B;  1FRL A;  1HNI A;  4LRE A;  2DXE A;  5AJ3 J;  5KFN A;  1U8W A;  3Q8Y A;  5D4N A;  2W1B A;  3U1M A;  4Q0B A;  4QWB A;  4R5P B;  5IWA F;  1C0U B;  4ES3 A;  1VRU B;  3QO9 B;  3GJS B;  1KQF B;  1JKH B;  3NLC A;  4DR4 F;  3BR8 A;  4JV5 F;  3IBW A;  1REV B;  3PW0 A;  4LF8 F;  2IVF B;  3WIU A;  4DU8 A;  1NZ8 A;  2PGC A;  1NJW A;  2YTC A;  2ZHB A;  4C6A A;  1DTQ A;  4J9L A;  1WKK A;  4DV6 F;  2FJE B;  3EGW B;  3IGV A;  3CCU S;  5I3U A;  2O5D A;  3HKW A;  4JI2 F;  2J9C A;  1UEK A;  2YX7 A;  3IM9 A;  4U7C A;  4B08 A;  2YX4 A;  3C16 A;  2OD6 A;  3VWS A;  3DHX A;  2QA4 S;  1ZZF A;  5LJ3 Y;  5GVQ A;  5C5J A;  3MED A;  3AD8 C;  5JJB A;  4XAK A;  3KMQ A;  2UUB J;  3QBC A;  2A10 A;  4O0I A;  3KK2 A;  4HAC A;  1K44 A;  1REG X;  4PPD A;  2IM2 A;  2U1A A;  2ZZM A;  4KHP J;  2X51 A;  2F4F A;  3BV8 A;  2PFD A;  4F4X A;  4NEZ A;  2R7O A;  1C4A A;  3PRB A;  1G7C B;  1JB0 C;  1KHV A;  2RQ4 A;  2HQF A;  3V5R A;  1JLG B;  2XCA A;  4OLO A;  1P6T A;  3CCL S;  4YQW A;  2Z4P A;  5IM0 A;  2IVM A;  6FDR A;  2HHH J;  2L3M A;  4WJB A;  3VF0 B;  3I0S B;  2R8J A;  3HHL D;  5A76 A;  2ZC4 A;  1B3T A;  3C66 A;  4GVB A;  2W9B A;  1VQ4 S;  3IFE A;  1NDP A;  4USU A;  4Y2K A;  1KOO A;  4DR1 F;  2VU5 A;  3PR4 A;  3FSX A;  1UKU A;  1PC5 A;  1FNO A;  3WHI A;  1ZET A;  1RT5 B;  3KXD A;  3CJR A;  4EI2 A;  2NS1 B;  4KRW A;  1T03 B;  4MH8 A;  1NK5 A;  3KNA A;  1CC7 A;  2B51 A;  2ALZ A;  1X5O A;  2CNK B;  1UET A;  2QMX A;  2IJN A;  5L9N A;  4FXV A;  4OLP A;  3A3O B;  4WFX A;  4EBD A;  2L08 A;  2G1H A;  2P2C B;  3ELH A;  3HK2 A;  3GFZ A;  2GMH A;  2HZV A;  5E33 A;  1L3K A;  1UVK A;  3UDE A;  5HAN A;  4NPO A;  1E6V B;  2E5G A;  4ZVR B;  2L9D A;  3V6J A;  2X1B A;  1SC1 B;  1U24 A;  3OXG A;  5HQL A;  1YLX A;  2FJA B;  1IKX B;  2LA6 A;  1L3T A;  3CCS S; 
#chains in the Genus database with same CATH homology
 4ZVU B;  3NS7 B;  2C2O B;  3GJQ B;  4DCJ B;  2XYP B;  1RE1 B;  4DCP B;  3R5J B;  2H65 B;  1RWP B;  2XYG B;  2HBY B;  2QLB B;  1RWM B;  3EDQ B;  2H5J B;  2QLF B;  2XYH B;  1RHR B;  2CNL B;  1RWX B;  2FQQ B;  4LSZ B;  1RWK B;  1RWV B;  2DKO B;  3IBF B;  3EDR B;  1BMQ B;  2CNN B;  4ZVT B;  1SC3 B;  3R7N B;  4ZVS B;  2H4Y B;  3GJT B;  1RWO B;  3D6M B;  2CDR B;  4JB8 B;  5IC6 B;  3D6H B;  3R6L B;  2C2M B;  1RHQ B;  2CJX B;  3R7B B;  2H51 B;  2Y1L B;  1I51 B;  3KJQ B;  1F9E B;  2C2K B;  1PYO B;  1IBC B;  1RHK B;  3RJM B;  2CNK B;  2XZD B;  3SIP B;  3QNW B;  2CJY B;  1SC4 B;  4ZVO B;  2QL5 B;  2CNO B;  2H5I B;  2P2C B;  1RWW B;  3GJS B;  3GJR B;  2C1E B;  3IBC B;  3P45 B;  1GFW B;  2HBQ B;  4ZVQ B;  5K20 B;  1RHU B;  1QTN B;  1RWN B;  3R6G B;  1I3O B;  4ZVR B;  2QL7 B;  4ZVP B;  2H48 B;  1RHM B;  2H4W B;  2QL9 B;  1ICE B;  3D6F B;  3R7S B;  3KJN B;  2Y0B B;  2QLJ B;  1NME B;  1PAU B;  3KJF B;  5IC4 B;  4DCO B;  1RHJ B;  1QDU B;  1SC1 B;  2H54 B;  2HBZ B;  2HBR B;  2C2Z B;  2XZT B;  3P4U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...