5IC4B

Crystal structure of caspase-3 deve peptide complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
b'HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3 subunit p17
publication title Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 92
sequence length 92
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 5ic4B00
3D6MB 4DCOB 3R7SB 1F9EB 1QDUB 2QL5B 4LSZB 2XZTB 1RHQB 3R6LB 1RHUB 2CJYB 2CJXB 2H4WB 1RWXB 2XYHB 2HBRB 1QTNB 5K20B 3KJQB 3R7NB 2C2OB 2CDRB 2HBQB 2XZDB 1RWWB 2QL9B 2QLFB 2P2CB 4ZVTB 5IC6B 2FQQB 1SC3B 3R5JB 2C2ZB 1RE1B 3EDQB 3NS7B 3SIPB 2DKOB 1I3OB 1GFWB 3D6FB 2C1EB 2H48B 2HBYB 1BMQB 3P45B 2CNLB 3GJTB 2CNNB 3IBFB 1IBCB 4DCJB 2XYGB 3GJQB 3KJFB 1RWPB 3KJNB 3GJRB 4ZVOB 1RWMB 2Y0BB 2H54B 1RHRB 1SC1B 2H5JB 2CNKB 2H65B 4ZVSB 1RWKB 4ZVPB 2XYPB 3GJSB 3R7BB 2CNOB 1PAUB 3IBCB 4ZVUB 3EDRB 2Y1LB 3P4UB 2H4YB 1ICEB 1RWOB 4JB8B 4DCPB 3D6HB 1SC4B 2H5IB 3RJMB 2QL7B 2C2KB 4ZVQB 2C2MB 1I51B 1PYOB 2QLJB 1RWNB 1NMEB 1RHMB 1RHJB 3R6GB 1RHKB 4ZVRB 1RWVB 2HBZB 2H51B 2QLBB 5IC4B 3QNWB
chains in the Genus database with same CATH superfamily
1FF2A 1C1BA 3ETMA 1XNQJ 4LSLA 1F9EB 2R7UA 1ZZFA 4DEZA 3GV5B 2CAJA 1DFDA 5EGYA 2HNDB 1S0OA 4L3NA 4K4ZA 4LMZA 3FBCA 4ZJQA 2F1FA 3PYEA 4JP8A 2VPYB 1YZ7A 3SSQA 5F41A 5EDWA 1RSCA 3UFCX 1CSJA 2OEMA 2A2CA 4WP3A 1VC0A 2O1PA 4PXCA 4RW9B 1HIYA 3NBPB 3FGVA 3MR6A 2E1CA 2H5EA 1AW0A 5L38A 3ZTSA 4RNOA 2UXCJ 2Z2MA 1FDDA 3TAPA 5KOWA 3QPIA 2VQEF 2IC3A 2AZ3A 3UN3A 5AXNA 3B82A 4QYRA 1TAUA 2FHJD 4FZVA 3CF5Q 5AT1B 2M70A 1C4AA 4OI3A 3HO1A 5J2NA 4F04B 4OX6A 3CJKA 5KT2A 1VQSA 3QJJA 3KUEA 1YK9A 3T5JA 3QNWB 1FE4A 3SDEB 2ZJRQ 2F9DA 1X60A 1UVMA 3N0VA 4N47A 2BKOA 4IDKA 2V0NA 1D3WA 2HBRB 2P6TA 1QSSA 1JXLA 4JYAJ 3TI0A 2ROEA 1CJUA 4G1QA 1W2IA 1SQGA 4HDGA 2CDRB 5ETNA 2KXNB 3PXGa 4ZLNA 2KM8C 1ZM9A 3RBDA 3K59A 1UAWA 1F2HA 5D78A 2Q3PA 3MM5B 3FMBA 5A6PA 4NZ6A 1S7IA 3DM2B 3KLIA 1U2CA 5DQHA 1CBKA 2L48A 2GGPA 5E3CA 1T7PA 3UDVA 2HYIB 1HR0J 2F4VJ 2CQ4A 1RHRB 2CPDA 4FBTA 4FPRA 2WAQD 3Q0AA 2GHWA 2VIHA 2B4OA 4O44B 4R5PA 2IRXA 4OZNA 1WHYA 4DCPB 1BWEA 2KYXA 2VPWB 1X0FA 3PFOA 3JXOA 3T6JA 4ZVQB 3D7SB 2BQ3A 5C24B 2RKIB 1RTIB 4IG0B 1EARA 2FC8A 4I67A 2XWXA 1R8CA 3FEZA 3DLLQ 2KJVA 4DCOB 2VKRA 5DDPC 3PJXA 4PQUA 5A8WA 4C11A 2VASA 2XMMA 2LDYA 2LQBA 2NS1B 4Y00A 4AQYF 2UVUA 2QL9B 4OYBA 2MMYA 2IAJB 1TL3A 5EX0A 4AL7A 3QIPA 2AW0A 1ZH5A 1D09B 1UVNA 1X9WA 1WHXA 3PEHA 3DRPA 4DLGA 4PPZA 1NKCA 2F63A 4ECUA 2W2NP 2HRUA 3DXSX 3NS6A 2V8DA 5HJXA 4K0KJ 4GC6A 1FWPA 2BE2A 2BYCA 5IFMA 1SJFA 3TQEA 5DZ7A 1JXEA 1RAAB 2KB2A 5JVGQ 1IN0A 1NBEB 3IGNA 4MTPA 4O0NA 1JLQB 1IKWA 3W62A 2G4BA 1WEZA 2ZBIA 3LO3A 5IM0A 1Z2ZA 2Z57B 3G4SS 4JI5J 4OX7A 1XC9A 1I6JA 3EGNA 4R8UA 2M88A 3M32A 3GG0A 2RD5C 2PMZD 3MAQA 2VA2A 4TY9A 3NG8A 2V34A 2Y8WA 3EXYA 1RACB 4FKYA 2RQKA 2PT0A 5LSRA 4DV0J 3FEYB 3UD4P 1NUEA 5KT7A 2V4JA 4USVA 2Y9HA 4LIRA 1F3VA 4Q8FA 4MFBB 4P9SA 1BQXA 3N6MA 4OHZA 4NCGB 2MQ8A 2VODA 3HVAA 4DR4F 2B51A 5F0UA 2B6AA 2CRLA 1XERA 2CQPA 3P49B 2LEPA 4I2QA 3NS5A 4ECVA 3KLHA 2QGFB 2DTJA 2HFVA 5I42A 3H40A 2HHSA 2HAFA 1EB0A 3S8SA 1C0UB 1AZSB 1HYSB 1TKTA 3THPA 3CJQA 1VQNS 3OL8A 3OFHA 3KG4A 3DLGB 2CPHA 1AA1B 4DPWA 5IC6B 1WJ9A 3G86A 4AFFA 4ZKAA 2W2PP 4NMXA 3THTA 2Y1RI 4LSLB 1U0HA 2P8IA 4QW8A 4ZIVA 2J8AA 2VFUA 1JLBA 1IKXA 3DI6A 3POTA 3MECA 2MLZA 5BYRA 2MGZB 2AF6A 1NJZA 2Y0BB 4ED2A 1NK6A 4I69A 1TFYA 3SFGA 4B3OA 2QSFA 4YB7A 4H54A 4LF1A 2CDQA 4X62J 1HI8A 2R8HA 3U7JA 2Y1IA 4DR2J 5DO2A 1RWVB 3L7UA 4L76A 4OJGA 1AFIA 4RUHA 2QMWA 4CH1A 1Q79A 4K5SA 5KFCA 3CIMA 3DHWC 4J9MA 5BR8J 4UZCA 3SEOA 2VFRA 1F0XA 4CLUA 5J2NB 1KQKA 3CJKB 2AX1A 3LPEA 4DF8A 2XULA 3GFZA 2J9DE 2YH1A 4ZVHA 1HNIA 2OO4A 2DHSA 3K2YA 1R8AA 5B0DA 1KWMA 2MXYA 3LOUA 4YDDB 1CJUB 1H38A 4G1QB 2K3IA 1NB2A 4A48A 2BV3A 5CYJA 2FVSA 3EJMA 1GNKA 2XM3A 1CPZA 2CG4A 1NXIA 2YPYA 4P7VA 2LU2A 3GE9A 3AD9C 4RZRA 3GCWP 3KLIB 3CULA 4NCAA 2M8HA 1Y4ZB 2MJNA 1Q81T 2NQPA 4C3KA 3FCVA 4DFPA 2IY5B 5L9XA 4RNHA 4YR2A 1RAEB 2CQDA 4F3MA 4B08A 4GKJJ 3W5XA 5A2QU 4TU9A 3CXCR 4R5PB 4OL8A 4P75A 4ZVFA 3IRWP 2FHKA 4C8OA 2XLKA 3M8SA 1L3UA 1VYAA 3M8QB 4WFZA 3M8PB 2Z8QA 1T9TA 2QMUB 1RZMA 4O23A 2AMCB 2HRYA 1VRTB 4IOBA 4PQUB 4OI2A 2UU9J 3MM6A 1TKDA 3D0IE 5AJ3J 2YKPA 3PIOQ 4CYUA 4A8YA 4DV7J 4USKA 2KHCA 1VQLS 2OJ3A 4ZCIA 1N33F 3G6VA 1WC5A 4ES1A 1UETA 3DGPB 1YRXA 1FJCA 1YRTA 2R42A 4PCQA 3TZZA 1YJTA 4GMKA 1FK9B 2YPZA 4YHHJ 2NLWA 3IWNC 2MJUA 2NXEA 1D9AA 3M4XA 4DU7A 2FUG9 4RUAA 1O5JA 1PJ7A 2XMAA 4F36A 2Z2LA 1SIZA 2GHVC 3JTNA 1TQLA 2NXNA 4HYKA 1KQSR 3NCQA 5KFIA 4B9UA 4FS2A 2HFZA 4EZ9A 4TQRA 1B0VA 2JDJA 2CJXB 1UPMB 3GIKA 2KT5A 1TR0A 4IO1A 3W1YC 2HQ3A 3I6PA 4NLDA 4L3KA 3BGLA 4Q7AA 1HBNA 4J91A 3AB2B 1R43A 1MG7A 3RG6A 4NLYA 4U7CA 1MWYA 4LBHA 3NXZA 5E7OB 5IM0B 4RUBA 1WC0A 3FJ2A 1YJ7A 3U1NA 2IIHA 3P45B 1FEEA 4R8UB 4DV4J 3M2RA 2LXIA 1NDLA 4U8VA 4C8YA 1HQUA 3HKZD 5H9EK 2YH0A 1FJ7A 2UUCF 1GX5A 2B56A 3HKWA 2D41A 3H42A 1A9NB 3QBCA 5C7PA 1OJ4A 5E5NA 4ZVEA 2MZ1A 2W9CA 4CLWA 1VQMS 1M1HA 3SSRA 3ITHB 1RWOB 4S0MA 3CE8A 4CI0B 4WK3A 2O01C 2J9DA 4NLWA 4ANEA 1IJEB 2FY1A 3C15A 2V4JB 4J9QA 1UA0A 4UZBA 3TEHB 2WSCC 3VZIA 2HHXA 3F73A 1SB6A 4CO1A 4CO5A 4DV1F 2ZH9A 4HR2A 2UUAF 2YX7A 2CFXA 3I56S 1FXLA 1ZYQA 2VG5B 1UFKA 2B6AB 3KMSA 2M7SA 2QLWA 2FZGB 4NRTA 5KFTA 1PILA 2NXCA 2ZUAA 2WSEC 1REGX 2IRYA 4OHYA 4JI7J 3Q8YA 1UEKA 3TUZC 2K2PA 4NA1A 2WVCA 5KT5A 1VQ6S 1KVIA 1P1TA 1KTVA 1C2PA 4LRCA 3T1HF 1SH3A 2QLXA 4CLYA 1KBRA 9ATCB 1F5BA 2V69A 4G1PA 5KG2A 4ECRA 2H4YB 5E3PA 1JLBB 3CD6S 3POTB 1SIWB 3MECB 2EKNA 4PUOA 1S4FA 4DR7J 3BJYA 2XSFA 3UCGA 3PX0A 5HATA 4U96A 1QE1A 3B8HA 1U1PA 4F2RA 2J0SD 2JOQA 3QIDA 4RBVA 2MZQA 1ZAXA 3DRSB 1FERA 1RHUB 1BUXA 1K1SA 5J2QA 3D5MA 3GMGA 4NE9C 2IJNA 4WYWA 1A7GE 1RT4A 4WFNQ 3DGVA 3SBMA 1XIQA 2IYGA 1VIXA 5EWFA 4TNOA 1GFWB 3EE3A 2RIJA 1YIJS 3JAMU 4ELTA 3SCKE 2I8EA 3MMAA 5GADU 1M5SA 1N54B 2HHVA 4URGA 3CC7S 3I32A 3JSRA 1ZTTA 1F2GA 1WC4A 1K1QA 2DNLA 2WBMA 5JVHQ 3CJSA 1HNIB 2QC3A 2QJ3A 2WVEA 3HJFA 1NU4A 2CQ3A 3O5TB 1FDAA 1Q5YA 3MUVP 5K9FA 1LW0B 3PW2A 2Z0GA 2HFSA 1XMQJ 2MKJA 1EQMA 3PZPA 1N5YB 2IJRA 4DQSA 2WHOA 4X4NA 2CJYB 3X1LB 4M94A 5K20B 4K4XA 2B9WA 3TQ1A 3CT9A 3Q2SC 2G2OA 2K3KA 4UY85 4ZJLA 3EGWB 3C3LA 2Z2YB 4CT9A 2NUHA 1T9UA 4F3OA 3K5NA 2HVIA 5HVHA 3MCMA 1X4EA 4DR3J 1FRJA 2VL1A 1NCLA 2GCFA 3MCSA 1RISA 1M5PC 2J6UA 5GMEA 4GRSA 3WQPA 2XLJA 3C2PA 3ZFVA 1TUVA 5CZVA 1MROA 3JSYA 2CIMA 2A3JA 1Q0NA 2MYFA 5JXSA 3G82B 2EC0A 3MFHA 2PDAA 1HNVA 2R9LA 4B17A 1X4GA 3IBCB 3MM6B 3AJ1A 1EKSA 3C14A 2G0IA 3KHLA 4CYUB 1SC4B 1YRUA 3RJMB 2CPYA 3ULHA 3CO9A 4BWMA 2R7QA 4P2XA 1EETA 2YKOA 1Y3KA 4I2PA 4JV0A 2IM3A 2HZCA 1PJ5A 1U25A 2LECA 3R7SB 3KXDA 1DTTB 2GW8A 2EFNA 2XHCA 3OR1A 1RP5A 5GMDA 2N7CA 2ZBPA 1VRQC 1GK8A 4FYVB 4BS2A 1JMTA 1N32J 2PFDA 2Q6CA 3KFWX 3O2IA 2QA4S 4A4JA 4L6V3 4WFBQ 1U26A 2KVQE 4ITSA 4CZCA 3MR3A 1MMDA 1DHMA 2KO1A 4DR5J 1X9SA 2HHPA 2ZM6J 2AWZA 3AHPA 1TZ0A 1FD2A 4NPOA 1NB7A 3KK2A 2E1RA 2XI2A 4M5DA 2B3TB 1CULB 1G3OA 5FLXY 2HQIA 2LCWA 1QVFR 4R25A 1NLKL 2BXJA 1I94F 3M9MB 1DRZA 2UUBF 3K57A 2XI3A 3AJDA 1T94A 1JLGB 2LKZA 3TYTA 3T5HA 2ZBRA 4AXIA 1RT3A 1XQIA 1M5HA 4QWAA 4YR3A 1UJ5A 1NSQA 4LF7J 4HH0A 4ZVTB 2GVDA 4AE5A 1IJFB 3HHEA 3HI9A 4NMLA 1HNWF 4LF4J 2C3YA 2EI5A 2FVQA 3H4DA 4NLVA 2F3JA 2GMHA 5G0RA 5C25A 1K47A 1FJGF 2R7WA 2HG4A 4Q43A 3OVAA 3E51A 3MAAA 2ZZTA 3W9HA 4UW2A 1JLAB 1V6HA 5LMUF 1VBZA 4UUXA 3GQCA 1Q53A 2FHOB 2EFVA 3H7HB 2W7AA 3QQCD 2XSJA 3M6UA 1HHSA 3P4UB 5CA5A 5LSOA 2HS3A 3V6DA 3PNIA 4CM2A 3OPKA 1REVA 1PYTA 1WOSA 1RHMB 3ILOA 2OELA 5A8KA 4P2FA 3PIPQ 4PR6A 3CW2C 1XEZA 2ZC4A 3R3TA 3BEGB 1HPZA 3H4BA 3BYRA 5CXTA 2XGPA 3S7RA 5L1LA 2ZHOA 1QM9A 2XZDB 3DLHA 1U2FA 4PUOB 4EO8A 2HVEA 4DPUA 5FDLA 2DIUA 1QE1B 3RU0A 2Y0SD 1TVRA 3GV7B 1LFPA 3FSXA 1RKJA 3NS7B 3EMTA 3R2CJ 3THVA 4C0HA 4KV8B 1PC5A 1U1LA 2MZTA 2HBYB 1Y5IB 2OPPA 4ZCMA 5L46A 4XO0A 3HFVA 5J2QB 1PYSB 1GMVA 3C6UB 4ZHRA 1YZ6A 1RT4B 2GS8A 3VAGA 3ZTOA 1B4SA 1B0PA 2GNKA 2CVEA 3V5RA 2R2SA 3BQ0A 3W2WB 3VVTA 2JNJA 4B3TJ 1U48A 2UV8G 3MMAB 1MN9A 1G2EA 1EQ0A 4CTAB 3FSIA 3FBEA 1AXQA 4QU7A 1WG5A 2P9GA 2KT3A 3ET6B 3ZNJ1 4DV5J 2HHHF 2RRBA 2H4WB 2XG8A 2MQLA 3KJQB 1BXNA 2CZ9A 5HO4A 1RTHA 3CDBA 1R27B 1DJ0A 2N7YA 1N5VA 1YG0A 3C66A 1UP1A 3VAJA 4CO4A 3W2VA 3CUNA 1CJKA 3RBXA 2Q1LA 4UUWA 4JI8J 3DYAA 4ECSA 1OSDA 3K58A 2DH8A 3EXCX 2DNKA 1RJJA 3AXKA 1RLDA 1U8SA 3G2XA 3N4WA 3O8WA 4O3SA 1HNZF 4OZLA 2V2KA 4AUKA 2OD4A 2ZBCA 2XMVA 2X1AA 1S1TB 4Y6IA 5CH7B 3MPYA 5E3RA 4UY8T 4P72A 1RUSA 2XNRA 3CPWR 4DPXA 3P3DA 1XR5A 3IMQJ 3KWMA 4G65A 2BDPA 3K7RA 1SJQA 2FHJA 2E5LF 1LWEB 1MROB 3AH6A 5HQ8A 4YN3B 3UE2A 3ZXWA 2EC2A 2CQ1A 3IBWA 2JSXA 2DH7A 3MEKA 4Q5VA 3HZEA 5KOXA 4HT5A 2BABA 3O1LA 3GIJA 4LBPA 2VG6A 2RMLA 3KHHA 2NZCA 4ECXA 3HULA 2PSZA 3R9LA 3HFZB 4QIFA 3VAMA 2GVZA 2KL8A 1SKUB 5LMNF 3BGUA 3D1QA 4I2PB 1N88A 4LUBA 3TUIC 3SIPB 2GJIA 2JEJA 4TY8A 1BWVA 3D67A 1JLFA 3RB4A 3FBBA 4IUFA 4CP5A 2YXLA 3UDCA 4DN9A 3PHEA 4DR4J 2BACA 2ZBQA 1YBAA 3JQJA 4WE1A 2WCXA 1APSA 3GTYX 1YLXA 3GFHA 2RRAA 1NK4A 5GAEI 4FYDA 2C2EA 5KTQA 4NLGA 1WELA 2JLFA 2JL9A 2BKPA 4URQU 4USHA 3KOAA 1HWUA 2XZTB 3KK2B 3SXLA 1RHQB 2E1AA 1HQEA 3I87A 4RUCA 4ECTA 3HZGA 4ELVA 1IBMF 2XYHB 3PX4A 1YJUA 4OI6A 4HVZA 4KKOA 3PY8A 1JNRB 4JI4J 3ILIA 1WSRA 1RT2A 1VLYA 1TL1B 1A0OB 2M52A 4GVBA 1QAXA 2CQCA 4Q2LA 2KZMA 3UR0A 2OMOA 1Q8IA 1RT3B 1DLOA 1XNRF 5CD4H 5FD1A 1VK3A 2OPSA 4FNHA 5HQLA 3R5CA 1X5OA 4DL3A 1MWZA 5C2CA 3HSGA 1D0EA 1N52B 5C5JA 2VQFF 3AA8A 2DNNA 3ISND 4PG4A 4CO3A 2Y1LB 5G0RB 1FRXA 4MKBA 5C25B 5KFQA 3TARA 5D15A 1S5ZA 3TP2A 1UJ4A 2ZH8A 5J2MA 4FYWB 5KFYA 3PJ9A 3BDEA 2QLBB 4K8RA 2F9JA 4ZPCA 5KFOA 4NLRA 5HI7A 4LJMA 3EICA 2UP1A 4NXMJ 1Q8BA 3HVTB 1S9GB 1VS3A 2EPIA 2CJ9A 4X4PA 5CCMA 3OJUA 3CJ0A 4YP3A 1YKWA 2XBPA 4QPTA 3V6DB 2CVIA 1FA0A 1REVB 3KDOA 1NRKA 2AJ4A 2AJFE 4N56A 4I56A 3EDQB 2ZUGA 4Y0FA 2DGTA 4I7FA 2PC6A 2IVYA 3PG9A 2ZKUA 4O0IA 4H4KC 4Q2MA 2HK2A 1R8BA 2IBOA 4FP9A 4FPIA 5KFVA 1PAEX 3IG1A 1IR1A 4DQRA 2RS2A 3MOZA 1WG1A 2Z56B 5KFSA 1GTEA 4V1Ak 3BO2A 4HHUA 1WHWA 3H90A 1Y5NB 1T9VA 4ERDA 3C16A 2PN6A 3HHKA 2OPPB 2CPFA 4LFBJ 5HBMA 4F4KA 2QLJB 5HN0A 1BE4A 1FRKA 3ZZZA 4K5RA 3OFGA 5KG7A 4KHRA 1NK9A 2OI2A 5T14A 2V8GA 6FDRA 4I6AA 1U8WA 3AAWB 4EYIB 3W3SA 4DWIA 3HD1A 4DFKA 5DRKA 3GYGA 3N5FA 1JJHA 4PWDA 2KFNA 1MMNA 2YBVA 2VBXA 3EVWA 2HZVA 3HHLC 4YB1P 2JWNA 1HWLA 2B4PA 3US5A 5K8MA 3AQOA 2F8MA 2AIRB 4DV2F 2DGQA 3FQLA 3QGHA 1JLCA 2JH3A 3FQKA 4EK2A 3LAKA 3NRBA 4X65J 4M5HA 2GA7A 4A8OA 3GV8B 5J1EA 4DSKA 3KLFB 5K5MA 2PD1A 2KG1A 2BANB 2HK3A 5F3ZA 1N0UA 1L3KA 4KFBA 2FD2A 6FD1A 1VK8A 4LFCJ 2WZ1A 1JK9B 3W2VB 2ZD1A 1XJWB 5KFLA 3E01A 2ATCB 4NWBA 2J7UA 5DGBA 1PBAA 3ILLA 1LKZA 3UDLA 1S1WB 1EJ7L 4PG6A 3T3FA 2HVHA 4PAAA 1JLEB 2H51B 4KHPF 1OPIA 3J7AN 4CDIA 3AFGA 1ULRA 3TVZA 3BH6B 3LA0A 5LXYA 1X5PA 3OR2B 3CCZA 1IKVA 1QSLA 5AE3A 2CZ4A 4QIGA 4I4BA 4WIQA 3KTQA 3MXHP 3FUYA 1J5EJ 2GC8A 1F9HA 2ZWPA 1U1KA 1LWCB 3NNCA 4NXNF 5KFRA 1YJNS 2VDIA 1ZPWX 1S1UB 2OHDA 4IRDA 3T6BA 3A8EA 2QRRA 2UV8A 2QFIA 3AT1B 4F3QA 2F40A 2H5JB 5E33A 3EWGA 3D0HE 1UKUA 3GIMA 3M30A 5I3QA 2AGQA 3CCUS 4N76A 1JLFB 1URRA 2KXFA 3VQTA 2DRAA 3NNHA 2ASYA 2UUAJ 1VQ4S 3WC0A 4DR6F 4U6PA 5KG1A 1WDTA 3T5LA 4IG3B 5KAKA 2XMKA 2MLXA 2X7IA 2AGPA 1NJYA 4F4XA 1YJRA 4C8KA 3MEGB 4USJC 3LTOA 4EO6A 3GFYA 2HRTA 1RWUA 2F8EX 2MTLA 1O51A 3TX8A 4I64A 2LA6A 3DFEA 1WNEA 4MT1A 3I4HX 4FYXB 1YX2A 4FVCA 2ZDPA 5C42B 1OY9A 3ETOA 5LJ5Y 3RRKA 2JC1A 4JI2F 1RT2B 4FBUA 4ANCA 2XC9A 1FKAF 4LF6F 3I4PA 3CMAS 3FC9A 4GVBB 2FGOA 3KUGA 4QYZJ 1ZTWA 3IP0A 1GXTA 3LH2S 3QZ7A 2B4VA 3TEGA 2BJ7A 2QG9B 3NOGA 1DLOB 2CJKA 1UFWA 3DMJA 1NMEB 3W8PA 2OPSB 2DNOA 2BJDA 2BVZA 4NYZA 2B43A 3IRXA 3BO3A 5DM6Q 2JFDA 3RAMA 3OTBA 4NCBA 3IC1A 2DR6A 3UR3C 4K4VA 5J2MB 2PO4A 2CA9A 1FDNA 2IJFA 2M4MA 3HK2A 2YQ0A 3JB9k 2C2ZB 2YVSA 3WIVA 2E7WA 2IFXA 2QE5A 1VHFA 4MAKA 2FZKB 3C6TA 3IGVA 2N82B 5B0BA 4PYDA 1WTFA 3WZ0A 2FJVA 1IXKA 3IFEA 3HF5A 4MYTA 3KJFB 5IWAF 1YBUA 1RWMB 4HKQA 1NH7A 3PM9A 2CNKB 2CQIA 1NO8A 2G1DA 2EEYA 2AX0A 5IT4A 1RBAA 2QSWA 4EEYA 4PQAA 4IO9Q 1VOMA 4F0KA 4RW4A 2YNGB 3LP1A 1IWGA 3ENQA 1FNXH 2ZITA 2DRDA 1T8EA 2ZJQQ 1VJWA 3WIUA 2QL5B 3C16B 2K7JA 3GIIA 3SI8A 3QWPA 4X4RA 4L72B 5HBMB 3IR6B 3A4TA 3KK3B 5E3QA 4ZMMA 5KFNA 3IR7B 3QJLA 4A8WA 4NYPA 2DR5A 2WOMA 4WYLA 3V2UC 3PVXA 4LF9J 4HLBA 3CC2S 1HBOA 3NMRA 2H48B 4IQMA 2E29A 3OL9A 2QMXA 3CCWA 5M2UA 2PA3A 2FY8A 5L1IA 3CD7A 1LNQA 2ZVIA 4PWDB 2XO6A 2QN6B 2J0WA 1IQZA 1X7VA 3IN5A 3GCXP 2DR7A 5H1SV 1ZPVA 3Q89A 4LQ3A 2CQ0A 1JLCB 2GMJA 4EWTA 3CJTA 3BKFA 4KIAA 4EU0A 2WRMA 2IPOB 4TYBA 4O4RA 4WCEQ 3M8YA 3G87A 4ECZA 2ZD1B 1IBKF 1NNDA 5B0FA 4M95A 4YY3F 2PIIA 1WI6A 2QA4G 4B02A 3R7NB 5F3TA 2A6OA 1L3VA 1KKHA 2J0QD 3NGTA 4IFYA 3DU6A 1VQOS 1JKHB 2AU0A 4DPYA 2YNHA 3UW1A 3MWBA 2KG0A 1X4HA 2GAHC 2BJEA 2FGCA 2E44A 2D3OR 4DUZF 2VOPA 2E5GA 3HP6A 4FF2A 1RU2A 5ETSA 3Q22A 5DGAA 5D4LA 4QPXA 4DZDA 2X1FA 2UUBJ 3RAXA 2Z30B 1RAGB 1NPKA 1HW9A 2ACYA 4O3QA 1LXNA 1SJ4P 4KY3A 1KVJA 2EXUA 2NSBA 1NSKL 4JOUA 1U7LA 4CLSA 1LOUA 3QWUA 3BBFA 1QAJA 3CEDA 4DR1J 4B3MJ 1X4CA 3ZZOA 3DXBA 3DKDA 4B9SA 3QRRA 5E0OA 2CJAA 1PBUA 1FJGJ 4F25A 3OTOF 3V6HA 4JUZA 2V63A 5HROA 2R2TA 5LMUJ 2DXFA 5I3UB 3GILA 3UD5A 4ED1A 3O3LA 2Z2ZA 3CSKA 1SV5A 3BKTA 2O3DA 1E6VA 4MMOA 2JX2A 2DGUA 5LT5A 5SZTA 3EPGA 2J76E 2IVMA 3HVRA 2R3VA 3CDEA 4ALZA 4K59A 3FRZA 2XLIA 3KLGB 3HD2A 1SUQB 4CLZA 4C2MA 5HLFB 1U1OA 3B54A 1U1QA 4ZPVR 3EGZA 2RNEA 5IQQA 3A12A 4DX7A 3KYLA 4UOHA 3I5CA 1GQEA 2O5DA 2RU3A 1OMSA 5JUMA 2YKMA 1TL7B 5F9NA 1F3FA 2X1GA 4Y28C 2FLLA 2PEHA 5ETVA 5IC4B 3M6XA 3O6QA 4CLFA 4DL7A 3GWCA 2VD3A 1EP4A 1OQ6A 1UL3A 3B4MA 2DNZA 2XCPA 1VHIA 2DH9A 2U2FA 4N5SA 3MURP 4Q0BB 5GAGU 1U1MA 4LRDA 1NK8A 1RB0A 4X4TA 5IT0A 3HCXA 2MPUA 4F8RA 3LGHA 2DEJA 3IRXB 5E41A 2ZDOA 3NWGA 3DLKA 3QRQA 1X5SA 3M7VA 2C1EB 3OFFA 4HI2A 3V81B 2M0GB 3GYXB 2YWWA 3RAQA 1GXLA 5KFHA 3M6VA 1ZA2B 5KFEA 3X3UA 1XNQF 3D66A 2GJFA 1Z4UA 3UCUP 1HMVA 4C8ZA 4P2MA 2MSSA 4QZVB 4B9TA 1R0CB 3QFWA 1SJRA 3C6TB 4DF4A 3M2VA 2HHHJ 2V8PA 5KFGA 4OYAA 2HQCA 2FVRA 2QO3A 4NEYA 3HT0A 1FFSB 2OEJA 4PABA 3TA2A 3UO0A 2HHUA 1S6PA 1O0PA 1F1BB 1DQ9A 2ZWOA 4IH5A 4TLRA 2D1CA 2UXCF 4DU8A 3C8YA 3TZXA 3BR9A 1U1NA 2UVRA 4HTJA 2ROPA 2QTWA 2RUSA 1H2TZ 2UVVA 1VGYA 1L3SA 3LP1B 1HNZJ 4E2FB 2HZAA 1D1UA 1Z2LA 3VHQA 2AHOB 1SCJB 4OLPA 1NPRA 5IV3A 4WPAA 4CLTA 4LF2A 2EBEA 2DYAA 3GJQB 3EGVA 1WC3A 3JYTA 1RGVA 2E5LJ 4J9VA 2DD8S 4ZVPB 3P8BB 5HMYA 2OLWA 4A8QA 3R7BB 2J7KA 1HBOB 2W7OA 3NP5A 1RBLA 1K44A 1CLFA 3ZTPA 4Z7YA 1TMMA 5F8JA 4MK9A 8AT1B 4K50A 4IOCQ 3LP0A 5KG3A 3TAMA 4DG1A 4K7QA 4JI0J 2MZJA 3K5LA 4LF8J 1E6YA 3KG1A 5LMNJ 1R0AB 3G9CA 3E3XA 2W9BA 1D8ZA 2YY3A 1U6BA 2IA6A 2OAUA 2MQOA 1T05A 1HR0F 2F4VF 4Z37A 4YEAA 1BQMA 4H4KA 3F56A 5CCLA 2L9DA 5T7LA 1NKBA 4K4TA 3A13A 4PG7A 3CB4A 4M5JA 3K5OA 4A8KA 2VA3A 3AD8C 3OQ2A 1FRHA 4O3OA 2W9AA 4FF3A 3RW6A 1VQ8S 3OJSA 3HPOA 2WTFA 2CNNB 2ATLA 5B7WA 2J0XA 1C0TB 3Q2TC 2GO9A 2OKQA 2UXBJ 2D3UA 3PW5A 3L7OA 1FRLA 2H65B 5J2PB 2OSRA 1FE0A 4ZPTR 2B4UA 1B3TA 1KN6A 1NZ8A 4Y2KA 1S97A 4X4VA 1F9FA 2HPUA 2DO0A 1VJQA 4ZN3A 2DCUB 2IMWP 2HGMA 2FVPA 3I55S 4N7TA 3M8WA 5KG5A 4LR7A 1QLNA 3EYZA 4KHMA 1WWHA 4X66J 3HHLA 2WVDA 4TVAB 3OXGA 9RUBA 1G6BA 2BJ8A 3V4IA 5AE2A 2EK1A 2ZH5A 4K0KF 3HJVA 3IS9B 2NR0A 1MMLA 1XNRJ 4LVOP 3TW0A 4F2SA 2I2YA 1NKEA 3R5JB 1HW8A 1ELOA 1CJVA 2I0XA 1LQ9A 4MYUA 3BSOA 2FJAB 4ZPBA 3K5PA 1AB8A 6AT1B 3IAM9 4I68A 4HT7A 3IWXA 1S1XA 2OUGA 2BM0A 2EVZA 4JI5F 3TVKA 2W4PA 5IQ6A 3R1HA 1NDPA 3HSDA 2QZ8A 1RYRA 3TUJC 2HVZA 1SV5B 1ICEB 2DIVA 4HACA 3W5YA 4Y2MA 4IR9A 2GAGC 3HDSA 2DNRA 2H5IB 2FDNA 4DJBA 5AXKA 2E9TA 2XS2A 4YB5A 4KB7A 4USMA 3CCJS 1FKOB 1X4DA 5D4OA 1N5TA 4ZPDA 4A46A 3OUYB 2XMTA 4DV0F 2MY8A 3FCWA 4RBUA 3SYZA 2CJBA 1Y00A 1RT7A 1RDRA 4DQIA 3PW0A 1HHQA 2YNIB 2IDEA 3BSNA 1U24A 3JAMY 3KLVA 4Q44A 2ZE2A 2MKHA 3N5BA 3LP2B 1M90T 2FPHX 1KOHA 2NXJA 3ZZTA 1YJ9S 3MMCA 1EP4B 1TK8A 4E8UA 3FKBA 4ZA1A 4WK1A 2BE7D 1RA6A 1WOOA 1KFSA 1S9EB 3TA1A 3B4DA 4J9LA 3HXMA 2B9XA 4DL4A 3GJSB 4X4SA 5HVFA 3DLKB 5AE1A 2BKNA 2RDIA 3Q8SB 3A8JA 3RRHA 3C19A 2I6WA 3KMQA 1HMVB 3MCOA 1SBRA 2GIQA 2UXDJ 1OYDA 3DC2A 3QAEA 4ID5A 2QYCA 3M2VB 4DV2J 2XS5A 1GX6A 1CS4B 4U67Q 1NK5A 4ECWA 4LREA 4NA2A 1TKZB 3JQMA 1T9WA 4IKAA 4O4GA 3CMQA 3TOQA 1KNZA 1LFWA 4X4OA 4X62F 2C2DA 2YWGA 4RPFA 4ZVGA 2G1HA 3QLHA 1WEXA 1R0BG 4DR2F 3DOMB 3D1OA 3AB4B 4JI3J 3G6XA 4EUVA 3TWZA 2OPQA 4G1IA 3UNGC 3KJNB 3MM8A 3T9NA 3QJPA 4ZVOB 1LW2A 3NL0A 4DOZA 5BR8F 4C98A 3ADAC 2BUNA 4B9NA 1JJ4A 1TK5A 3FSYA 1K0TA 1N0VC 2R7VA 5DLGA 4KHPJ 5I4MA 1Q78A 3CCMS 3G6ES 1BQNA 3BN7A 4KO0A 4GVLA 2E5HA 5KG0A 5KT4A 4DUYJ 4UQTA 4OQJA 4RW8B 3U1MA 4PRFA 2V4RA 3JYTB 1FX4A 5LM7E 1WSVA 2R8GA 2RSQA 1N56A 4CO2A 3OVSA 3BBBA 5E3AA 3BN4A 5ETLA 1C1BB 3VV2B 4EI2A 5THWA 2OPRA 1VLOA 3R97A 3DRRA 3I5AA 2DPJA 4WZQA 4RU2A 4NXNJ 1ZBTA 3KJVA 4TU8A 2RDDA 1Q4RA 3NY0A 3D3CJ 3TAMB 4YQWA 1N5QA 1WKLA 3QO9A 1E6YB 3MMBA 3MUMP 2JHEA 2B7BB 4NLOA 5KT3A 2W9BB 2D3ZA 3RRGA 1SPBP 1VBYA 1T05B 2DHAA 3GYNA 4DL6A 4GKJF 1BQMB 2VBWA 4WXOA 1VQPS 3L95X 3B78A 5T7LB 1K73T 2Y8YA 1ZAWA 2XCAA 2IC3B 5DDRC 1TUGB 3HX9A 4DSJA 4J9RA 2FIUA 1SQEA 2FJDB 3VAFA 2ZZNA 2UU9F 1AROP 3BYPA 2QV6A 1RTZA 3SMZA 5B0CA 4GKKJ 3TO8A 2Q43A 3NWRA 3R6LB 2VH7A 3Q86A 1S6QA 4PWUA 4B3SJ 3OFEA 4IDKB 2HHTA 4DFJA 3PR4A 1NPPA 1NK7A 3QYYA 2ZH4A 3G71S 4B3RJ 4YHHF 4N41A 2J6SA 5IT9Y 4OJ3A 1SJ3P 8RUCA 4JI1J 2VOOA 1ZS6A 2HIQA 4QW9A 3GJTB 1F5AA 3J81U 3V4IB 1JJ2R 4P6QA 2N3OA 3HM9A 2G0CA 1VRUA 1AUDA 2LQJA 2VJVA 3MM9A 3AODA 2B8PA 3CDWA 2GGPB 2DNHA 3BF4A 4KC5A 2XMJA 2EG2A 2W1BA 4OZJA 4LRAA 4DBQA 2N4CA 3HHNB 2GFFA 3T41A 1WG4A 1S1XB 3M2UA 3GSDA 1KC8T 2VPZB 4DV6F 4UT4A 1U09A 5HAOA 4DS5A 3FCHA 1OS5A 2YWEA 1ROFA 5HMZA 2HQFA 4DV4F 1QUVA 2RQCA 4RR5A 5GADI 3GR0A 1QAYA 3PCOB 1SKSA 3VCDA 5HK4A 5A8WB 4CIOA 4C11B 2B7CB 4ATNA 5KG4A 3PYGA 1X4AA 4OYZA 2HURA 3ZZYA 1Q7LB 3I9ZA 1K8AT 5IWAJ 1HHTP 3LW5C 2RS8A 1TL3B 4RW9A 3NBPA 3RUBL 1MN7A 4PXDA 3QIPB 1BMQB 4QIVA 4HH1A 1RT7B 1IBCB 4AXJA 4C4WA 4X4UA 3DRPB 2ZE2B 1SC1B 3H5UA 2DVIA 4OYOA 1X31C 4QWBA 2VB6A 1SKWA 2BE2B 2WW8A 3CNQP 5F8LA 3H2LA 4P10A 1FFGB 2C2KB 4IH7A 4QIWD 2GQ2A 3EM1A 4DQPA 1PSDA 1R6YA 4YMEA 2YX1A 3K5MA 2VJUA 2J5AA 1X4BA 4BC9A 1IKWB 3S1TA 2ASLA 3PW7A 2D74B 2DO4A 3OL7A 3OHAA 3UWTA 3HFKA 4DHVA 2JRSA 1FWLA 3FZBA 3M32B 4ZN1A 1U4BA 3MM5A 3RGIA 2ERRA 5ETTA 3DM2A 1I3OB 2YKNA 4FXDA 4GO7X 4ID5B 3OW2R 3P96A 4ZPAA 4NASA 3J7YU 4DXLA 2CPXA 1JX4A 3MM7A 3PO4A 3LAMA 4M1KA 1P6TA 2OTJS 4F7VA 3DDIA 1X8DA 3NGDA 2IYIA 4C0BA 4Z2XA 4ILLA 3QLHB 3P5BP 1FFWB 4A8XA 4JB8B 2EFQA 1DY3A 2RKIA 3BBCA 3CVKA 1RTIA 4IG0A 1EKRA 2OPQB 2NYHA 2W4DA 3CCES 2ASDA 3MM8B 1LW2B 1VIOA 1NDKA 2HBZB 5H9FJ 4I2QB 2AT1B 3I96A 2A0FB 2FZCB 3KLHB 5I42B 1RQ0A 2P5VA 3BSCA 1BQNB 1RT1A 4KO0B 2QT7A 3DN9A 2OGUA 2IAJA 1TKTB 4NLSA 3ZZUA 2IBKA 2OMLA 1PIEA 4DUZJ 1GXUA 2HVDA 3W61A 2APOA 4WZMA 1S72S 1KHVA 2VFSA 2AYEA 2XY6A 2NZ4A 4KH0B 1VISA 4ZCLA 2V8HA 2RF2A 3FRYA 1U0HB 1OY6A 1XMQF 1BY9A 1H6KX 2C42A 1R31A 1IKXB 1OO0B 4EBCA 4FN5A 3CD0A 3Q8QB 4KE5A 3DI6B 4F67A 1FXRA 3QO9B 2MHNA 4YR0A 2DITA 3MMBB 4B3OB 4TN2A 5DS7A 4DN0A 1UFLA 1R8PA 2MSTA 3PX6A 5D4PA 3R6GB 1JLQA 2DGWA 2E5IA 1H98A 2HQGA 2EFGA 2DR9A 2ZVSA 4W92B 4M5IA 2LFVA 3QATA 2PE8A 1B7YB 4FKXA 1T3NA 1N8RT 3EUNA 1U02A 3TA0A 3W5ZA 5EX3A 4LFAF 4L75A 5ETOA 3VGSA 2HW3A 1N6QA 1W25A 1SI9A 1FTRA 1EX8A 4J9UE 2RILA 3MR5A 2JLEA 1JNZB 4Y3CA 4C3LA 2HS0A 2QYGA 4P74A 5KFKA 4PPDA 1R3NA 1S6QB 3OTCA 2W2MP 3H5SA 3CD5A 3BGOP 2H1YA 4M5LA 3DLJA 4X84A 4F4ZA 1RKIA 2R2RA 3DNCA 4WP8A 1EZZB 1DURA 3ZNUA 3BV8A 3HMJG 1H0HB 1N4LA 3KDNA 1SH2A 2EKYA 4LIWA 4QJVA 4ZVUB 2FHMA 1UVLA 1N32F 4ZLPA 3EZ5A 5GAHU 3GU0A 4NI2A 1KQGB 3SFUA 1VRUB 4LR8A 3BO4A 4HDHA 2V94A 4KR0B 4OX9J 3IM9A 2COLA 3MF5A 4XK8C 4W90B 2ZM6F 3H20A 3MMJA 1C1CA 5CABA 4RWWA 2NPIA 3QT5A 4IRKA 2AP6A 3G96A 1SH0A 3PW4A 5KFJA 3W60A 2KJWA 4DL2A 5DG8A 4WP9A 1T03A 4JI6F 1F6TA 3OLBA 2MGZA 3MTKA 2QFJA 2YWFA 5CYQA 1KR4A 2B9YA 4BC7A 3HLUA 2F5GA 4LF7F 3SV3A 1M1KT 1RU1A 4ZIWA 1NK0A 1RAHB 2CYYA 3R5BA 5EHHA 1KTQA 1I51B 4LF4F 3K8WA 1RWNB 1Q8LA 2RVJA 1WTBA 4DSFA 1TFWA 1HD1A 3DLBA 5DDOC 1C4CA 3JSMA 2POKA 1VC5A 4NA3A 4WJBA 4C0OC 2G2ZA 1KVKA 3NGRA 2HFOA 2LA4A 4AD6A 2HKEA 3CJRA 4KSEB 1FI4A 1ZAVA 2LU1A 4RBTA 1RTJA 3CJ3A 1HBNB 1RTDA 1QUPA 4MH8A 4DX8H 4MIAA 1TMJA 3ZZPA 3VWSA 1KEKA 2YTCA 3GZ7A 1EIYB 1JIHA 1NHKL 2C3MA 2AV5A 3T1YF 4YB6A 4MIWA 3D2WA 3LGMA 2MKIA 4ED8A 2ASJA 3ICLA 5K8NA 3M2RB 1XN9A 2XY7A 1HQUB 3PACA 1XK8A 1I5OB 7FD1A 4I6YA 4RNFA 3F44A 2RHQB 2XB2D 1CJTA 1QAIA 2YKNB 4HEA9 2W9CB 4EYHB 3CC4S 3MM7B 2XGQA 2R4FA 1HNXF 2E7XA 4ED4A 2RB7A 5AXLA 3C15B 4RJVA 3LWMA 2VQEJ 3M8QA 3M8PA 2CWXA 4PXEA 1DQAA 2AYGA 2DGXA 1VRTA 3BB5A 4HI1A 3CCQS 4M5KA 3MEEA 4ZDNA 5IT9U 2R7SA 5K8OA 4UF4A 2VF3A 3I0RA 4B3TF 2CQ2A 5EWEA 1T02A 4OZ5A 4NZ0A 1RT1B 4WTYA 5FIIA 1S9FA 4DV5F 2IM2A 3DGPA 2WVFA 3J80Y 1X9MA 1RWKB 2ZEJA 2BRLA 1FK9A 3M9NB 2P9EA 2HFUA 2IRUA 4WU2A 3A8IA 2RF2B 1YGYA 1WC6A 4HL9A 3R27A 1UZHA 2RAQA 4RO0A 2CXEA 1S76D 3PYDA 2RRNA 5CZXA 4M5GA 4JI8F 5LXRA 4C97A 4LSZB 1S10A 1J5OA 1IKYA 4Y2IA 2AJ1A 4ZLJA 3IM8A 4IR1A 5DM7Q 5DJBA 3AA9A 3DOKA 2OSQA 1RWWB 1KS2A 3KNAA 3L09A 3VGTA 1HLWA 2FC9A 2V67A 5E2QA 2ZZMA 4B9VA 1FCAA 1RK8A 3BM7A 2HFNA 3Q23A 3H25A 2JEIA 2VDHA 3AXMA 4USWA 1PCAA 4Q8EA 4OYIA 2CQGA 2VBZA 4L74A 2BE9B 1CC7A 4PZVA 4ZOSA 1N6QB 1S59A 2ZHAA 4AQYJ 3HHLD 3ITHA 2GJ2A 1SQFA 1SL1A 4DFMA 3MGJA 4J37A 1M5KC 1ZM2A 4W4MA 3QFHA 2CPZA 4DLEA 1ACMB 4ID8A 1RCOB 4MKVA 1WOPA 3P6YC 3AJ2A 3NGKA 3MUTP 4C8NA 1X4FA 1RAJA 1CEZA 4ED7A 1NAQA 3H2VE 2GIFA 5F8GA 2HWTA 2EFPA 2VG5A 2WW4A 3OXFA 2ZFHA 1FVQA 3GPAA 3NGUA 1S48A 1WKKA 4NLXA 3TJAA 3PR5B 4FXWA 4F4AA 4NYOA 2M9KA 4NI2B 2ADCA 1AYEA 2BW7A 2K7KA 1HL6A 2J9EA 2W4CA 5CHCB 5F8NA 3RBEA 5L1KA 2VC0A 1IBLF 1RI7A 4OFZA 2AYMA 4O3RA 1BD6A 1WHVA 2IM1A 1C1CB 3BQ2A 2FJWA 1J2VA 1S7HA 5JJBA 1U49A 1P8GA 4WKYA 2M3DA 3CGIA 1GMWD 3ZTQA 1Y7PA 4DZ6A 2KT2A 4ZVSB 4M63A 4ES2A 4FF1A 2WONA 3D28A 4OLOA 4X64F 1OSCA 1ZETA 1HNVB 2YQ1A 4JI4F 2PGCA 3K0JA 5DLFA 2RHSB 1T03B 1IM4A 3QT6A 1MU2A 3EPIA 3C14B 2GQQA 2OP5A 2YQ3A 3WBZA 3DRSA 5CYQB 1V9OA 1SKRA 1EETB 1XR6A 4K2XA 2AZ1A 3EX7B 3EZOA 3W8GA 3PEJA 2NREA 4JV2A 2KM8B 1Y5LB 2YNFA 3TZYA 1KDNA 1M5OC 4F0HA 1PKUA 3OR1B 4KYZA 3FEXB 4AYBD 4MK8A 2OH2A 3BKUA 3FNNA 2FQQB 1SC3B 1S4EA 1VQ9S 3JSMB 1N48A 4X4QA 1NEEA 3OD2A 3UCZP 1V3ZA 3CJ4A 3E2EA 4MK7A 2I9SA 4F4YA 3CDAA 3H2UB 2DNGA 4AT1B 1PGZA 3T1AA 1H72C 3MEDA 1QJHA 5KFWA 4NRUA 4NXMF 2AD9A 1RTJB 2R8KA 5D8HB 7FDRA 1AFJA 3H5XA 2IA0A 1RTDB 1KLMA 3HHDA 4WTOB 2J8SA 2KTQA 3OSPA 1FVSA 4M5DB 1LW0A 5L9NA 2EK6A 2PMWA 1V5VA 1N34F 1RHJB 5IXUA 1KRPA 1NH8A 4LBIA 3VALA 4UOGA 1N5YA 2YKAA 2O67A 4H4MA 4Y65A 3UN5A 5J1NA 3K8VA 1CJTB 2ZOGA 3NCPA 4M8LA 4IH6A 3S01A 5CQGA 2VFVA 1TUWA 2DGOA 1IWAA 1JWWA 4UOFA 4ETZA 4LFBF 2GVDB 2XTJP 3D6FB 2R8JA 3K17A 2W2OP 1NZAA 3PRVA 4NEZA 2QX0A 3IBFB 1DZ5A 2I5JA 4J7CA 5IOLA 3WHIA 1FX2A 2PA8D 3G82A 4OI4A 4FF4A 3U02A 3MEEB 2VC1A 3MAAB 3N79A 2HIYA 1Y11A 2D3O1 5HMWA 3M1VA 3I0RB 1FNOA 3OXLA 4LRBA 3L3CA 3VQSA 2BZ2A 5HP1A 2VU5A 3P5TL 2H9ZA 4ES3A 2XSJB 2OD6A 1U47A 2ZC3A 2W25A 3PRDA 3M8ZA 3KK1A 5I3PA 4WFYA 4Z7CA 4F0MA 1SC6A 1DTTA 2ILYA 4WIIA 1ZA1B 5A8KB 3VAHA 4X65F 3FK4A 1UCNA 4E98A 1T0TV 3CO0P 2VBYA 1HPZB 2CZVC 1NSPA 3DCAA 3I5BA 2YKQA 4LFCF 3NEKA 5CD4A 4LF5F 3ENWA 5D0RA 4LRFA 4WF9Q 1MLAA 3SZ2A 1RE1B 5FDLB 1TVRB 1CQNA 3NMAA 3AY0A 3FFIA 4DQQA 4J9KA 1UVIA 1F60B 1J5OB 4JBCA 1IKYB 1I1GA 1OQ3A 1BC6A 2L9NA 4R0JA 2HNYA 2HHQA 5B0GA 2CG8A 3DOKB 3PYFA 3V6JA 2DNYA 4J9PA 2CUYA 2C2RA 4NLQA 2JEFA 4ZHRB 3ELHA 4Y2AA 1JQGA 4DV6J 5U47A 4DX5A 2XYPB 1CULA 1HWJA 4USIA 5A0YA 4QU6A 1Y3JA 1S1VA 2GMLA 1SJ1A 2RU9A 4B9LA 1J5EF 2FLOA 3CCSS 4K4UA 4OZ1A 1JLGA 4ZVRB 3LALA 2ABYA 1S0NA 3CCRS 3PDNA 1N33J 2XS7A 4OYMA 2E66A 5ITHA 4ZCKA 3OVBA 5D0HA 5KFZA 1HWIA 3BPDA 2MHEA 1LXJA 2VV5A 1RTHB 3RW7A 3QGPA 3MPUB 3SV4A 1FJEB 1T9XA 4KJIA 1UW9A 3Q24A 1XMOF 4UOCA 4RLEA 2N4DA 1CJKB 3CCTA 3EVOA 3MZIA 5H9EJ 3VF0B 1VI7A 1GMUA 3DYAB 1N36F 1JLAA 1ZOTA 2X51A 3JS9A 1YHQS 4N77A 3SCIE 2WSFC 1UA1A 2F4FA 1XTZA 3UI3A 2UVWA 4LR9A 4WXWA 2P9CA 4ED0A 3W9IA 4F02A 2J6TA 5CAAA 1PAUB 5SUHA 1PC4A 2LMIA 2G9OA 5DDQC 3OV7A 5EUHA 1UWBA 3H8YA 4CNZA 4YUDA 4CRJA 4EGLA 1FTCA 1QTMA 2J7WA 4P52A 4WFXA 2J9CA 3KNGA 2CQBA 2CPEA 4XPEA 2WONB 4ZP8A 1TKXA 2ZKTA 5IS2A 2UUCJ 2E5JA 3R2DJ 2DJWA 4OV6A 4KBIA 3UQSA 2K1RA 1MU2B 2VG6B 1S6OA 5K14A 2JVRA 3GP9A 2LQ9A 3FDSA 2GVZB 7AT1B 1TK0A 3J7A1 4KV8A 4C8LA 1V3SA 3CJ8A 4TY8B 3L7PA 2YNFB 3C6UA 1RCXB 4DV1J 2QA2A 1FD8A 4C7QA 2JJ4D 1T9YA 3J80U 2DHXA 4C3MA 2GHPA 4PG5A 4HTIA 1FHTA 1D8YA 2HGLA 3W2WA 4DL0C 4WE1B 2HWHA 4PG8A 4CTAA 3UVJA 4QYZK 4IYQA 1FO1A 4IFVA 3CIZA 2Y3YA 3MEDB 4FXVA 1QY7A 2LEAA 4ECQA 1MW7A 3QGIA 1DTQA 3ET6A 1WKJA 4WWSA 3QAUA 2DK2A 3T1HJ 1KLMB 5EWGA 5HMXA 5B08A 1T95A 4PXBA 2MQQA 1LV5A 5A76A 3ZZ0A 1PG5B 4U8YA 1MSWD 3M9OB 1HQEB 4CCHA 4RWXA 4OZ3A 3IA0A 1NDCA 4KKOB 1H74A 2V6AA 2AEJA 4H4MB 5A6WA 2AJ0A 1EAYC 4CH0S 2CNLB 2LYVA 4CH7A 4BDPA 2WB4A 4RKUC 4PKDB 2C3OA 3CDUA 4EBDA 4JV5F 3I0SA 2KVIA 3MR2A 1S1TA 2JVOA 1TAQA 2KDOA 1S0VA 5JMNA 3TANA 3C46A 1FDBA 5M2PA 2RQMA 2ACMA 4KQZA 4LF9F 1LWEA 3N6NA 4RW6A 2I5JB 2ROGA 1U1RA 4DSIA 4K4SA 2LQ5A 1KQFB 4DV3F 5MLCV 1IVZA 2PI5A 2E1PA 2D9PA 3NGSA 4LFAJ 3M1VB 2SXLA 4FYYB 4ILRA 5HP1B 3CTRA 4DUTA 2DXDA 1Q7YT 3UPFA 2Q79A 4OHXA 3KK1B 3N28A 3A3OB 3PTWA 3UDEA 4K4WA 1KD1T 2BW2A 3HVWA 2YWKA 3VAKA 1SXLA 2BJ3A 4MKAA 2VG7A 5DG7A 1K0VA 2KN4A 3CMES 4I7FB 3VR1A 1RYSA 2OEKA 3IO1A 4DX6A 3IG1B 4PEOA 4I6WA 1FKPA 3ILJA 3MAHA 4EBEA 3VGVA 3QT7A 1P27B 1RT6A 3FFIB 2BOPA 4I0WA 3PHTA 5DQGA 5GAGI 1PO6A 1QD1A 2RT3A 2A18A 2HNYB 2W8LA 3K89A 2BQRA 3OT9A 3U27A 5G4DA 1VQ5S 1W7WA 1CC8A 3GIRA 4EMDA 1W2BR 3S6EA 5KT6A 5A0YB 1S1VB 4KH1B 4NOHA 1SVDA 3I82A 4OX8A 2Z4PA 1NSAA 5CYMA 3MD1A 4JI6J 4OHWA 2IHR1 1TL1A 4YS2A 1D9FA 2BA9A 3IR5B 2H3EB 4XIUA 1VCTA 4N8NA 2LLZA 2MKSA 2KRRA 3NOCA 5L1JA 4J9OA 5L8RC 3JTPA 3M8RA 3MFIA 1X0PA 4LVNP 1TU0B 4DI6A 3U1LA 4J5OA 3JSBA 1XR7A 3NCRA 4DR1F 1B7FA 2AQ4A 4QR0A 3BR8A 5J1EB 4B3MF 2ILZA 4G6VB 4KFBB 3TZWA 1WF2A 1RAOA 2I1RA 3NNAA 4FNIA 1MNEA 2YWHA 1WF1A 3FMWA 5D3GA 2GV1A 4ED6A 3PO5A 3OLAA 4XPCA 2FLPA 2W7PA 3E01B 1HI0P 4QCLA 1YQHA 2MLYA 1XBWA 2KYZA 4USTA 2ALYB 2D9OA 2FYXA 3HVTA 1OWXA 3V6KA 1S9GA 4B9MA 2VHGA 3MPWA 1AT1B 2MDAA 3RR8A 3SCJE 1QTNB 2UZAA 4PYAA 2C2OB 3T1YJ 3JTOA 2N3LA 2RDJA 4ICLA 1IKVB 1UWBB 1WORA 1YVFA 5ETPA 5F8HA 3Q8UA 3A3NB 3SCLE 1DARA 1I94J 2JZ5A 4G3IA 1TKXB 5EN1A 1IR2A 1H2VZ 2ZOMA 3VAIA 1RADB 2BBEA 1HWKA 2NSCA 2K1RB 3N9UC 5HVGA 5HSPA 3FZ2A 5K14B 4O3PA 1VBKA 2F7VA 1HNXJ 1VQKS 1UW4A 4NLPA 4ZP9A 3TRGA 3OL6A 4X2BA 3M30B 4TYAA 3N6LA 1KHWA 2WBRA 1HNWJ 2ZH3A 2PFFB 1L3TA 4RW7A 2L9WA 4OYXA 1S77D 2RQ4A 5IZHA 1Q8KA 2JEGA 1FNMA 5B0EA 3OTDA 2C2NA 1CG2A 2EW9A 5C2GA 2VKZG 3BH7B 5ETQA 3UVJB 4IFVB 1FRMA 2MKYA 3LQVA 3GB0A 2KFZA 3MPVA 4QWEA 2DGSA 1DTQB 2BJ9A 2XMUA 4ZP6A 2FVCA 4P2SA 4KPYA 2X3DA 4DL5A 2C22A 5M2RA 3TJ8A 3KLFA 1YDLA 2BANA 4FVMA 4CLPA 4RNMA 1TL4A 5KFMA 2FJBB 1YJWS 1WI8A 4PWWA 3CCVS 1RWPB 2R7XA 2RUGA 3Q83A 4LSNA 2E7VA 2O66A 2EG1A 1RBOB 3TAQA 1H7WA 2Z58B 4P7TA 3I9V9 4ZITA 4M5NA 1IUJA 1S1WA 3J7Z5 1GEHA 2C2MB 1JLEA 3EZUA 2XZWA 2C28A 4ZK7M 3I0SB 1RHKB 4KT0C 3DMJB 4WFAQ 1QVGR 2A10A 2KRBA 3D6MB 3G8SA 1YBTA 3AOCA 4Y2CA 3OR2A 4ANDA 1Y9OA 3BZQA 4AL6A 4WU3A 4LQ9A 1UVJA 4RW6B 2B8QA 5J1PA 1TV6A 2A6MA 3J81Y 1FT8A 1L5UA 3BDPA 1HBUA 1VMBA 3NKYA 5HJYA 1TL5A 1LWCA 3RYLA 4DSLA 4IQXA 1J27A 1WC1A 1S1UA 1Q86T 4JI0F 4LF8F 3GFXA 4D3GA 4DCJB 1ZM3A 1H73A 2I38A 4EFAC 3W63A 1UEVA 3NLCA 2K06A 3GJRB 2B5JA 2L3MA 2BRKA 2BQUA 5KFXA 2YX4A 2VG7B 2M8DB 2QA1A 1S12A 3A1YG 2FLNA 3GONA 4IG3A 2V2ZA 3PFEA 4ZP7A 1QSYA 5BYQA 1FKPB 4RW4B 1RT6B 5ADZA 3MEGA 2AGOA 2ZH2A 1IBLJ 1RWXB 3QSYB 1VC6A 2UXBF 3SSSA 4QQBA 1U6FA 1UMJA 2QEXS 2P2CB 2GO8A 2MY7A 2R7RA 4IRCA 2IVFB 2DKOB 1RLCL 2WOMB 2MKKA 4JYAF 1LK5A 2G13A 3H5YA 2WK4A 3DDNA 4ED3A 4X64J 3RTVA 3KHRA 2V68A 3T9ZA 5C42A 3PV8A 4E0DA 3W9JA 2OTLS 1UPPA 5CYMB 4I1TA 3HT3A 4X66F 1GAOA 1WF0A 4TLQA 2BOAA 1B0TA 2CPIA 2LQ8A 2X1BA 4WKRA 1WDDA 3QMQA 3GG1A 1YJVA 3ZTRA 2AJ2A 2XQCA 3D6HB 3F0NA 4KAIA 4F4WA 3Q8PB 1S99A 4U9RA 1OYEA 1NM2A 2JFKA 1H7XA 1M1GA 1W26A 2ZH1A 4CWBA 1LWFA 3DRXA 5IV4A 2KHDA 2HS4A 3W64A 5D3GB 2OFHX 1VQYA 4TXSA 1JJCB 3ISZA 5BJRA 2ZHBA 2LP4A 2KKHA 5F0WA 1DAXA 4IFYB 3BGRA 5MAOA 1LWXA 1OPZA 3HSJA 3MD3A 3MTJA 5LL6d 3VTIA 4TU7A 2HWIA 4KGZB 2YNHB 5RUBA 3SQGA 1B70B 4ICLB 1IBMJ 3Q8RB 4DSEA 3ZC4A 4OI1A 1N34J 1HFEL 3ENAA 2FJEB 5D4NA 1IR0A 1KLNA 1NJXA 2CNOB 1MWQA 2CPJA 2V8VA 3WC2A 3DOLA 1RXOB 2QL7B 1CVJA 2HQDA 2JC0A 1RT5A 2YNGA 3D54A 3BPSP 2BMBA 2CQHA 4JV1A 4O3NA 4BWJA 2FB0A 2V9WA 2HNZA 3KK3A 2C3PA 2AJQA 2VQFJ 2HLUA 4KTQA 2HMIA 4RW7B 4N8OA 2CADA 4ECYA 4BBYA 4FDFA 5AXMA 1HBMA 5KFPA 2R8IA 4OYWA 5HANA 2XY5A 4CLLA 5HROB 5DETA 4A47A 4KRWA 3Q8VA 3DU5A 2PEBA 2JLGA 2NCKL 3D1HA 1UJ6A 1E6VB 4A8FA 2UXDF 3IWLA 3WX8A 4FS1A 1GMWA 3N01A 3TR5A 4U7UK 4MJKA 1B64A 3BQ1A 4HHHA 1XWLA 2KZZA 2GZOA 3VGUA 2C3UA 2G0JA 3RBZA 4DPTA 1Q95G 2X3GA 4LF5J 3AOAA 4LSNB 2LDIA 2YKMB 4BLGA 4JI3F 3T19A 5FLXU 4CNYA 2PI4A 2KU7A 4C8MA 2DHGA 4URSA 3MDFA 2A1BA 4QWDA 3UN2A 3MOJB 3LANA 3ZZRA 2AYBA 5B09A 2VZ9A 3KHGA 3PRBA 3LPYA 1JKHA 1JB0C 1HA1A 5GAEU 2XO7A 3J7ZT 1Y0HA 3AOBA 1VQ7S 3KLEA 1KONA 4DUYF 1V3RA 1JXVA 2AKWB 1RA7A 3D3BJ 1RAIB 4NLUA 2MEWA 3RB0A 2ZNYA 4XTTA 2FJXA 1NJIT 3OBIA 2HHWA 3RZAA 1D9DA 1TV6B 4ED5A 3GR1A 3D9BA 5KG6A 2DY1A 3LUYA 1HBUB 2MZRA 2CKWA 5K8PA 4OZ2A 3TUPA 4OJ1A 1HQ2A 4U7UD 4QOTA 2XMWA 1O8BA 4H4OA 2MKCA 4ILMA 1U45A 2B5JB 1TELA 2XNQA 1IQTA 1S6PB 3DHXA 2OIHA 1U2RA 2AEFA 2DHHA 1XMOJ 1YSJA 3AQPA 3TNVA 2NUUG 2HBQB 3H98A 1N36J 2DT9A 3M6WA 1OIAA 4OIXA 4C9DA 5I3UA 3CWJA 5GVQA 1LEOA 4ZS6A 3OTEA 3LF0A 2OFGX 1ZZNA 2ZH7A 4LT6A 3RB3A 1GT8A 3EVMA 2WB1D 3O44A 2V2VA 3V4MA 4RNNA 2DPIA 4GKKF 2CWKA 3TX0A 1S0MA 2RE1A 1KFDA 3ONQA 5KFUA 3AD7C 4QR2A 2DGVA 3KLGA 1SUQA 2H54B 5L39A 4V19J 2DBBA 4B3SF 3VZHA 5HLFA 4TKTA 1WACA 3EDRB 4NL5A 2V50A 2L08A 4B3RF 1TL7A 2DRBA 2LXUA 4QBUA 3NAIA 2B0GA 4JI1F 4M5MA 3MHYA 3LP0B 2KI2A 2DB1A 4USUA 2KFYA 2BX6A 1BLUA 4DG1B 3M05A 1VBXA 3J7YI 2P6SA 4Q0BA 2HAIA 1UVKA 1VFJA 2KH9A 2WVBA 4RU9A 3QRPA 4F26A 1R89A 2LXFA 3DLEA 1TTHB 1LWFB 3BS9A 4DR6J 3V81A 3ISNC 2HEKA 2W8KA 2ADBA 4CT8A 4L73A 3DDKA 1GTHA 1FWKA 1YITS 2DNMA 2XYGB 1UZDA 2NPFA 5KFAA 5ETKA 2VONA 3A3PB 4XAKA 4YOEA 1R8HA 2B9EA 5AJ3F 3BGRB 2EWHA 2UUWA 4DV7F 3KKFA 2DR8A 1T11A 1H2UX 1R7IA 8ATCB 4QWCA 4ZLLA 2RH3A 1S79A 3SQGB 4DS4A 3RB6A 1B99A 1P9YA 3H59A 4K4YA 1TP7A 4XDDA 3TJ9A 1U0SA 4U95A 2E9ZA 1PJ6A 4C48A 4JI2J 1G4CA 3HHLB 1Y10A 4LF6J 3DOLB 1HARA 1V5IB 4YDXA 2E9RX 1RT5B 2GIRA 2QLFB 3PKMA 1FRIA 4JV5J 4P73A 2RJZA 1OY8A 1AUSL 4KPCA 4NZ7A 2EFOA 1CJVB 4ETXA 2HNZB 2LEBA 4ER8A 4V19X 5F9LA 1M5VC 4ZJOA 3QSIA 1HKAA 5A8RA 2HMIB 1RABB 1HBMB 2VPXB 1SL2A 3PKYA 4DV3J 2BJ1A 3SQOP 4OMFG 2NYIA 4GO5X 2HNDA 5LJ3Y 4CQ1A 1BHNA 1Q16B 2HGNA 3QT8A 4UTGA 2K8GA 2W24A 4XDCA 4HACB 3F41A 5HL7Q 2V4QA 3MCNA 5DQIA 1R0AA 4A8SA 1KP6A 1P9QC 3BSAA 3D68A 2QIFA 3CJ2A 2UUTA 4J90A 3QGGA 5B0AA 2D69A 4QR1A 4A8MP 1YTYA 4UQGA 4KGXB 4NLTA 2DNPA 2MZSA 1NHVA 3HSZA 2GQCA 1DQ8A 4QIEA 5KFBA 4C6AA 3D0GE 2DNQA 2XEXA 3MR7A 1RAFB 3MI7X 3IAS9 2XHWA 2BEFA 5DZ6A 2MQMA 1M0SA 1X5TA 5GAHI 1KSPA 4OHVA 1G1XA 2HLTA 1C0TA 4ELUA 2Q66A 3MMCB 4ENOA 3IXQA 1NJWA 3W66A 3R5DA 2V5HG 3KUHA 3UNYA 4HHJA 4JI7F 1FEHA 5J2PA 5BXIA 3E8OA 4CO0A 2DXEA 5DG9A 2G2YA 3SDEA 2FTRA 3G6YA 3KLEB 5BYSA 3B6BA 4EZ6A 1UTAA 2DY9A 2ZH6A 2F65A 2R7TA 4CM0A 1S6UA 4K2JA 1BGXT 1G7CB 1U6ZA 2PMHA 1IM6A 2A2DA 1K9MT 1EHWA 1CQMA 2U1AA 2MQPA 2IDLA 2R2UA 1LK7A 2MB0B 5F8IA 5H9FK 5D77A 4OV1A 4DR7F 2W01A 4GC7A 3IS9A 3FVYA 2ZNZA 4DPOA 4H4OB 3A8KA 2HSEB 3G8QA 4OYPA 3R1LA 5F8MA 2ZJPQ 3L4BC 2VICA 3J81j 4O4GB 4O44A 2XWYA 2DEIA 1DBDA 2D7SA 4F50A 4MIBA 3CCLS 5FJ4A 1IBKJ 5C24A 4YY3J 1YI2S 3D6TB 1H3DA 3OHBA 1XMBA 3PJWA 4D3HA 3R8YA 4NX9A 4J9SA 3WX4A 4DDFA 2DCLA 2W2QP 4W98A 4BCAA 4IOAQ 1SL0A 2Q6BA 2DISA 2GX8A 4CLKA 3MPDA 1S57A 4TQSA 1FKOA 2CJQA 1PYOB 1VR6A 1N5SA 5ETMA 3NAHA 5GMKa 2Y1JA 5HQMA 3OUYA 3ZO7A 4R0EA 2VUGA 4RX6A 2R7OA 2V9KA 1HI1A 2YNIA 4KGMA 2OPRB 3DRRB 4WBFA 3KJVB 3LP2A 1WEYA 3W65A 3LWLA 3JQKA 3DRYA 1Q82T 4KGVB 1WD6A 4OX9F 1S9EA 1UEUA 2ZOFA 4MKYA 1P1LA 2E1MC 4ZPWR 3GSIA 3CJ5A 1GH8A 2AEMA 3DLEB 4DR3F 3W7BA 2M2BA 1NHUA 1VDHA 2EBGA 3OTOJ 2MQNA 1A6LA 4OZ0A 4OJHA 2ALZA 5LOQA 1URNA 3WDOA 3ENVA 1WUUA 5D6GA 1HD0A 1UWAA 3G8TA 1QDUB 3H0PA 3R5AA 1FXDA 5A2QY 2LVWA 1CS4A 3BGFA 1YWXA 2BM1A 5ETRA 2BR0A 2V2QA 4DMZA 4KGKA 1TKZA 3FBFA 4RL1A 3D4JA 5KFDA 4J9NA 2IMOA 3BREA 1ITPA 2KXHA 1R6VA 4AL5A 2F8HA 3UD3P 4MFBA 2M5YA 2IM0A 3DOMA 4Y34A 4NCGA 5D0EA 5D0GA 4Q45A 2NXUA 5T41A 3LGNA 1Z1ZA 2VFTA 2L41A 1O6XA 1Q5VA 4OI0A 3MM9B 1T3OA 3T5KA 1C0UA 1AZSA 3R5GA 1HYSA 4BHQA 1ZM4A 4YFUA 4DR5F 3RR7A 4P71A 1KOOA 3DLGA 4RW8A 3QZ8A 3VVUA 1S49A 5KFFA 5LSLA 5A8RB 3OSNA 1F5CA 3L9ZA 1FESA 3I31A 3M2UB 3KG0A 3TVYA 1Q1KA 3GLJA
chains in the Genus database with same CATH topology
3D6MB 4DCOB 3R7SB 1F9EB 1QDUB 2QL5B 4LSZB 2XZTB 1RHQB 3R6LB 1RHUB 2CJYB 2CJXB 2H4WB 1RWXB 2XYHB 2HBRB 1QTNB 5K20B 3KJQB 3R7NB 2C2OB 2CDRB 2HBQB 2XZDB 1RWWB 2QL9B 2QLFB 2P2CB 4ZVTB 5IC6B 2FQQB 1SC3B 3R5JB 2C2ZB 1RE1B 3EDQB 3NS7B 3SIPB 2DKOB 1I3OB 1GFWB 3D6FB 2C1EB 2H48B 2HBYB 1BMQB 3P45B 2CNLB 3GJTB 2CNNB 3IBFB 1IBCB 4DCJB 2XYGB 3GJQB 3KJFB 1RWPB 3KJNB 3GJRB 4ZVOB 1RWMB 2Y0BB 2H54B 1RHRB 1SC1B 2H5JB 2CNKB 2H65B 4ZVSB 1RWKB 4ZVPB 2XYPB 3GJSB 3R7BB 2CNOB 1PAUB 3IBCB 4ZVUB 3EDRB 2Y1LB 3P4UB 2H4YB 1ICEB 1RWOB 4JB8B 4DCPB 3D6HB 1SC4B 2H5IB 3RJMB 2QL7B 2C2KB 4ZVQB 2C2MB 1I51B 1PYOB 2QLJB 1RWNB 1NMEB 1RHMB 1RHJB 3R6GB 1RHKB 4ZVRB 1RWVB 2HBZB 2H51B 2QLBB 5IC4B 3QNWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6M B;  4DCO B;  3R7S B;  1F9E B;  1QDU B;  2QL5 B;  4LSZ B;  2XZT B;  1RHQ B;  3R6L B;  1RHU B;  2CJY B;  2CJX B;  2H4W B;  1RWX B;  2XYH B;  2HBR B;  1QTN B;  5K20 B;  3KJQ B;  3R7N B;  2C2O B;  2CDR B;  2HBQ B;  2XZD B;  1RWW B;  2QL9 B;  2QLF B;  2P2C B;  4ZVT B;  5IC6 B;  2FQQ B;  1SC3 B;  3R5J B;  2C2Z B;  1RE1 B;  3EDQ B;  3NS7 B;  3SIP B;  2DKO B;  1I3O B;  1GFW B;  3D6F B;  2C1E B;  2H48 B;  2HBY B;  1BMQ B;  3P45 B;  2CNL B;  3GJT B;  2CNN B;  3IBF B;  1IBC B;  4DCJ B;  2XYG B;  3GJQ B;  3KJF B;  1RWP B;  3KJN B;  3GJR B;  4ZVO B;  1RWM B;  2Y0B B;  2H54 B;  1RHR B;  1SC1 B;  2H5J B;  2CNK B;  2H65 B;  4ZVS B;  1RWK B;  4ZVP B;  2XYP B;  3GJS B;  3R7B B;  2CNO B;  1PAU B;  3IBC B;  4ZVU B;  3EDR B;  2Y1L B;  3P4U B;  2H4Y B;  1ICE B;  1RWO B;  4JB8 B;  4DCP B;  3D6H B;  1SC4 B;  2H5I B;  3RJM B;  2QL7 B;  2C2K B;  4ZVQ B;  2C2M B;  1I51 B;  1PYO B;  2QLJ B;  1RWN B;  1NME B;  1RHM B;  1RHJ B;  3R6G B;  1RHK B;  4ZVR B;  1RWV B;  2HBZ B;  2H51 B;  2QLB B;  5IC4 B;  3QNW B; 
#chains in the Genus database with same CATH topology
 1FF2 A;  1C1B A;  3ETM A;  1XNQ J;  4LSL A;  1F9E B;  2R7U A;  1ZZF A;  4DEZ A;  3GV5 B;  2CAJ A;  1DFD A;  5EGY A;  2HND B;  1S0O A;  4L3N A;  4K4Z A;  4LMZ A;  3FBC A;  4ZJQ A;  2F1F A;  3PYE A;  4JP8 A;  2VPY B;  1YZ7 A;  3SSQ A;  5F41 A;  5EDW A;  1RSC A;  3UFC X;  1CSJ A;  2OEM A;  2A2C A;  4WP3 A;  1VC0 A;  2O1P A;  4PXC A;  4RW9 B;  1HIY A;  3NBP B;  3FGV A;  3MR6 A;  2E1C A;  2H5E A;  1AW0 A;  5L38 A;  3ZTS A;  4RNO A;  2UXC J;  2Z2M A;  1FDD A;  3TAP A;  5KOW A;  3QPI A;  2VQE F;  2IC3 A;  2AZ3 A;  3UN3 A;  5AXN A;  3B82 A;  4QYR A;  1TAU A;  2FHJ D;  4FZV A;  3CF5 Q;  5AT1 B;  2M70 A;  1C4A A;  4OI3 A;  3HO1 A;  5J2N A;  4F04 B;  4OX6 A;  3CJK A;  5KT2 A;  1VQS A;  3QJJ A;  3KUE A;  1YK9 A;  3T5J A;  3QNW B;  1FE4 A;  3SDE B;  2ZJR Q;  2F9D A;  1X60 A;  1UVM A;  3N0V A;  4N47 A;  2BKO A;  4IDK A;  2V0N A;  1D3W A;  2HBR B;  2P6T A;  1QSS A;  1JXL A;  4JYA J;  3TI0 A;  2ROE A;  1CJU A;  4G1Q A;  1W2I A;  1SQG A;  4HDG A;  2CDR B;  5ETN A;  2KXN B;  3PXG a;  4ZLN A;  2KM8 C;  1ZM9 A;  3RBD A;  3K59 A;  1UAW A;  1F2H A;  5D78 A;  2Q3P A;  3MM5 B;  3FMB A;  5A6P A;  4NZ6 A;  1S7I A;  3DM2 B;  3KLI A;  1U2C A;  5DQH A;  1CBK A;  2L48 A;  2GGP A;  5E3C A;  1T7P A;  3UDV A;  2HYI B;  1HR0 J;  2F4V J;  2CQ4 A;  1RHR B;  2CPD A;  4FBT A;  4FPR A;  2WAQ D;  3Q0A A;  2GHW A;  2VIH A;  2B4O A;  4O44 B;  4R5P A;  2IRX A;  4OZN A;  1WHY A;  4DCP B;  1BWE A;  2KYX A;  2VPW B;  1X0F A;  3PFO A;  3JXO A;  3T6J A;  4ZVQ B;  3D7S B;  2BQ3 A;  5C24 B;  2RKI B;  1RTI B;  4IG0 B;  1EAR A;  2FC8 A;  4I67 A;  2XWX A;  1R8C A;  3FEZ A;  3DLL Q;  2KJV A;  4DCO B;  2VKR A;  5DDP C;  3PJX A;  4PQU A;  5A8W A;  4C11 A;  2VAS A;  2XMM A;  2LDY A;  2LQB A;  2NS1 B;  4Y00 A;  4AQY F;  2UVU A;  2QL9 B;  4OYB A;  2MMY A;  2IAJ B;  1TL3 A;  5EX0 A;  4AL7 A;  3QIP A;  2AW0 A;  1ZH5 A;  1D09 B;  1UVN A;  1X9W A;  1WHX A;  3PEH A;  3DRP A;  4DLG A;  4PPZ A;  1NKC A;  2F63 A;  4ECU A;  2W2N P;  2HRU A;  3DXS X;  3NS6 A;  2V8D A;  5HJX A;  4K0K J;  4GC6 A;  1FWP A;  2BE2 A;  2BYC A;  5IFM A;  1SJF A;  3TQE A;  5DZ7 A;  1JXE A;  1RAA B;  2KB2 A;  5JVG Q;  1IN0 A;  1NBE B;  3IGN A;  4MTP A;  4O0N A;  1JLQ B;  1IKW A;  3W62 A;  2G4B A;  1WEZ A;  2ZBI A;  3LO3 A;  5IM0 A;  1Z2Z A;  2Z57 B;  3G4S S;  4JI5 J;  4OX7 A;  1XC9 A;  1I6J A;  3EGN A;  4R8U A;  2M88 A;  3M32 A;  3GG0 A;  2RD5 C;  2PMZ D;  3MAQ A;  2VA2 A;  4TY9 A;  3NG8 A;  2V34 A;  2Y8W A;  3EXY A;  1RAC B;  4FKY A;  2RQK A;  2PT0 A;  5LSR A;  4DV0 J;  3FEY B;  3UD4 P;  1NUE A;  5KT7 A;  2V4J A;  4USV A;  2Y9H A;  4LIR A;  1F3V A;  4Q8F A;  4MFB B;  4P9S A;  1BQX A;  3N6M A;  4OHZ A;  4NCG B;  2MQ8 A;  2VOD A;  3HVA A;  4DR4 F;  2B51 A;  5F0U A;  2B6A A;  2CRL A;  1XER A;  2CQP A;  3P49 B;  2LEP A;  4I2Q A;  3NS5 A;  4ECV A;  3KLH A;  2QGF B;  2DTJ A;  2HFV A;  5I42 A;  3H40 A;  2HHS A;  2HAF A;  1EB0 A;  3S8S A;  1C0U B;  1AZS B;  1HYS B;  1TKT A;  3THP A;  3CJQ A;  1VQN S;  3OL8 A;  3OFH A;  3KG4 A;  3DLG B;  2CPH A;  1AA1 B;  4DPW A;  5IC6 B;  1WJ9 A;  3G86 A;  4AFF A;  4ZKA A;  2W2P P;  4NMX A;  3THT A;  2Y1R I;  4LSL B;  1U0H A;  2P8I A;  4QW8 A;  4ZIV A;  2J8A A;  2VFU A;  1JLB A;  1IKX A;  3DI6 A;  3POT A;  3MEC A;  2MLZ A;  5BYR A;  2MGZ B;  2AF6 A;  1NJZ A;  2Y0B B;  4ED2 A;  1NK6 A;  4I69 A;  1TFY A;  3SFG A;  4B3O A;  2QSF A;  4YB7 A;  4H54 A;  4LF1 A;  2CDQ A;  4X62 J;  1HI8 A;  2R8H A;  3U7J A;  2Y1I A;  4DR2 J;  5DO2 A;  1RWV B;  3L7U A;  4L76 A;  4OJG A;  1AFI A;  4RUH A;  2QMW A;  4CH1 A;  1Q79 A;  4K5S A;  5KFC A;  3CIM A;  3DHW C;  4J9M A;  5BR8 J;  4UZC A;  3SEO A;  2VFR A;  1F0X A;  4CLU A;  5J2N B;  1KQK A;  3CJK B;  2AX1 A;  3LPE A;  4DF8 A;  2XUL A;  3GFZ A;  2J9D E;  2YH1 A;  4ZVH A;  1HNI A;  2OO4 A;  2DHS A;  3K2Y A;  1R8A A;  5B0D A;  1KWM A;  2MXY A;  3LOU A;  4YDD B;  1CJU B;  1H38 A;  4G1Q B;  2K3I A;  1NB2 A;  4A48 A;  2BV3 A;  5CYJ A;  2FVS A;  3EJM A;  1GNK A;  2XM3 A;  1CPZ A;  2CG4 A;  1NXI A;  2YPY A;  4P7V A;  2LU2 A;  3GE9 A;  3AD9 C;  4RZR A;  3GCW P;  3KLI B;  3CUL A;  4NCA A;  2M8H A;  1Y4Z B;  2MJN A;  1Q81 T;  2NQP A;  4C3K A;  3FCV A;  4DFP A;  2IY5 B;  5L9X A;  4RNH A;  4YR2 A;  1RAE B;  2CQD A;  4F3M A;  4B08 A;  4GKJ J;  3W5X A;  5A2Q U;  4TU9 A;  3CXC R;  4R5P B;  4OL8 A;  4P75 A;  4ZVF A;  3IRW P;  2FHK A;  4C8O A;  2XLK A;  3M8S A;  1L3U A;  1VYA A;  3M8Q B;  4WFZ A;  3M8P B;  2Z8Q A;  1T9T A;  2QMU B;  1RZM A;  4O23 A;  2AMC B;  2HRY A;  1VRT B;  4IOB A;  4PQU B;  4OI2 A;  2UU9 J;  3MM6 A;  1TKD A;  3D0I E;  5AJ3 J;  2YKP A;  3PIO Q;  4CYU A;  4A8Y A;  4DV7 J;  4USK A;  2KHC A;  1VQL S;  2OJ3 A;  4ZCI A;  1N33 F;  3G6V A;  1WC5 A;  4ES1 A;  1UET A;  3DGP B;  1YRX A;  1FJC A;  1YRT A;  2R42 A;  4PCQ A;  3TZZ A;  1YJT A;  4GMK A;  1FK9 B;  2YPZ A;  4YHH J;  2NLW A;  3IWN C;  2MJU A;  2NXE A;  1D9A A;  3M4X A;  4DU7 A;  2FUG 9;  4RUA A;  1O5J A;  1PJ7 A;  2XMA A;  4F36 A;  2Z2L A;  1SIZ A;  2GHV C;  3JTN A;  1TQL A;  2NXN A;  4HYK A;  1KQS R;  3NCQ A;  5KFI A;  4B9U A;  4FS2 A;  2HFZ A;  4EZ9 A;  4TQR A;  1B0V A;  2JDJ A;  2CJX B;  1UPM B;  3GIK A;  2KT5 A;  1TR0 A;  4IO1 A;  3W1Y C;  2HQ3 A;  3I6P A;  4NLD A;  4L3K A;  3BGL A;  4Q7A A;  1HBN A;  4J91 A;  3AB2 B;  1R43 A;  1MG7 A;  3RG6 A;  4NLY A;  4U7C A;  1MWY A;  4LBH A;  3NXZ A;  5E7O B;  5IM0 B;  4RUB A;  1WC0 A;  3FJ2 A;  1YJ7 A;  3U1N A;  2IIH A;  3P45 B;  1FEE A;  4R8U B;  4DV4 J;  3M2R A;  2LXI A;  1NDL A;  4U8V A;  4C8Y A;  1HQU A;  3HKZ D;  5H9E K;  2YH0 A;  1FJ7 A;  2UUC F;  1GX5 A;  2B56 A;  3HKW A;  2D41 A;  3H42 A;  1A9N B;  3QBC A;  5C7P A;  1OJ4 A;  5E5N A;  4ZVE A;  2MZ1 A;  2W9C A;  4CLW A;  1VQM S;  1M1H A;  3SSR A;  3ITH B;  1RWO B;  4S0M A;  3CE8 A;  4CI0 B;  4WK3 A;  2O01 C;  2J9D A;  4NLW A;  4ANE A;  1IJE B;  2FY1 A;  3C15 A;  2V4J B;  4J9Q A;  1UA0 A;  4UZB A;  3TEH B;  2WSC C;  3VZI A;  2HHX A;  3F73 A;  1SB6 A;  4CO1 A;  4CO5 A;  4DV1 F;  2ZH9 A;  4HR2 A;  2UUA F;  2YX7 A;  2CFX A;  3I56 S;  1FXL A;  1ZYQ A;  2VG5 B;  1UFK A;  2B6A B;  3KMS A;  2M7S A;  2QLW A;  2FZG B;  4NRT A;  5KFT A;  1PIL A;  2NXC A;  2ZUA A;  2WSE C;  1REG X;  2IRY A;  4OHY A;  4JI7 J;  3Q8Y A;  1UEK A;  3TUZ C;  2K2P A;  4NA1 A;  2WVC A;  5KT5 A;  1VQ6 S;  1KVI A;  1P1T A;  1KTV A;  1C2P A;  4LRC A;  3T1H F;  1SH3 A;  2QLX A;  4CLY A;  1KBR A;  9ATC B;  1F5B A;  2V69 A;  4G1P A;  5KG2 A;  4ECR A;  2H4Y B;  5E3P A;  1JLB B;  3CD6 S;  3POT B;  1SIW B;  3MEC B;  2EKN A;  4PUO A;  1S4F A;  4DR7 J;  3BJY A;  2XSF A;  3UCG A;  3PX0 A;  5HAT A;  4U96 A;  1QE1 A;  3B8H A;  1U1P A;  4F2R A;  2J0S D;  2JOQ A;  3QID A;  4RBV A;  2MZQ A;  1ZAX A;  3DRS B;  1FER A;  1RHU B;  1BUX A;  1K1S A;  5J2Q A;  3D5M A;  3GMG A;  4NE9 C;  2IJN A;  4WYW A;  1A7G E;  1RT4 A;  4WFN Q;  3DGV A;  3SBM A;  1XIQ A;  2IYG A;  1VIX A;  5EWF A;  4TNO A;  1GFW B;  3EE3 A;  2RIJ A;  1YIJ S;  3JAM U;  4ELT A;  3SCK E;  2I8E A;  3MMA A;  5GAD U;  1M5S A;  1N54 B;  2HHV A;  4URG A;  3CC7 S;  3I32 A;  3JSR A;  1ZTT A;  1F2G A;  1WC4 A;  1K1Q A;  2DNL A;  2WBM A;  5JVH Q;  3CJS A;  1HNI B;  2QC3 A;  2QJ3 A;  2WVE A;  3HJF A;  1NU4 A;  2CQ3 A;  3O5T B;  1FDA A;  1Q5Y A;  3MUV P;  5K9F A;  1LW0 B;  3PW2 A;  2Z0G A;  2HFS A;  1XMQ J;  2MKJ A;  1EQM A;  3PZP A;  1N5Y B;  2IJR A;  4DQS A;  2WHO A;  4X4N A;  2CJY B;  3X1L B;  4M94 A;  5K20 B;  4K4X A;  2B9W A;  3TQ1 A;  3CT9 A;  3Q2S C;  2G2O A;  2K3K A;  4UY8 5;  4ZJL A;  3EGW B;  3C3L A;  2Z2Y B;  4CT9 A;  2NUH A;  1T9U A;  4F3O A;  3K5N A;  2HVI A;  5HVH A;  3MCM A;  1X4E A;  4DR3 J;  1FRJ A;  2VL1 A;  1NCL A;  2GCF A;  3MCS A;  1RIS A;  1M5P C;  2J6U A;  5GME A;  4GRS A;  3WQP A;  2XLJ A;  3C2P A;  3ZFV A;  1TUV A;  5CZV A;  1MRO A;  3JSY A;  2CIM A;  2A3J A;  1Q0N A;  2MYF A;  5JXS A;  3G82 B;  2EC0 A;  3MFH A;  2PDA A;  1HNV A;  2R9L A;  4B17 A;  1X4G A;  3IBC B;  3MM6 B;  3AJ1 A;  1EKS A;  3C14 A;  2G0I A;  3KHL A;  4CYU B;  1SC4 B;  1YRU A;  3RJM B;  2CPY A;  3ULH A;  3CO9 A;  4BWM A;  2R7Q A;  4P2X A;  1EET A;  2YKO A;  1Y3K A;  4I2P A;  4JV0 A;  2IM3 A;  2HZC A;  1PJ5 A;  1U25 A;  2LEC A;  3R7S B;  3KXD A;  1DTT B;  2GW8 A;  2EFN A;  2XHC A;  3OR1 A;  1RP5 A;  5GMD A;  2N7C A;  2ZBP A;  1VRQ C;  1GK8 A;  4FYV B;  4BS2 A;  1JMT A;  1N32 J;  2PFD A;  2Q6C A;  3KFW X;  3O2I A;  2QA4 S;  4A4J A;  4L6V 3;  4WFB Q;  1U26 A;  2KVQ E;  4ITS A;  4CZC A;  3MR3 A;  1MMD A;  1DHM A;  2KO1 A;  4DR5 J;  1X9S A;  2HHP A;  2ZM6 J;  2AWZ A;  3AHP A;  1TZ0 A;  1FD2 A;  4NPO A;  1NB7 A;  3KK2 A;  2E1R A;  2XI2 A;  4M5D A;  2B3T B;  1CUL B;  1G3O A;  5FLX Y;  2HQI A;  2LCW A;  1QVF R;  4R25 A;  1NLK L;  2BXJ A;  1I94 F;  3M9M B;  1DRZ A;  2UUB F;  3K57 A;  2XI3 A;  3AJD A;  1T94 A;  1JLG B;  2LKZ A;  3TYT A;  3T5H A;  2ZBR A;  4AXI A;  1RT3 A;  1XQI A;  1M5H A;  4QWA A;  4YR3 A;  1UJ5 A;  1NSQ A;  4LF7 J;  4HH0 A;  4ZVT B;  2GVD A;  4AE5 A;  1IJF B;  3HHE A;  3HI9 A;  4NML A;  1HNW F;  4LF4 J;  2C3Y A;  2EI5 A;  2FVQ A;  3H4D A;  4NLV A;  2F3J A;  2GMH A;  5G0R A;  5C25 A;  1K47 A;  1FJG F;  2R7W A;  2HG4 A;  4Q43 A;  3OVA A;  3E51 A;  3MAA A;  2ZZT A;  3W9H A;  4UW2 A;  1JLA B;  1V6H A;  5LMU F;  1VBZ A;  4UUX A;  3GQC A;  1Q53 A;  2FHO B;  2EFV A;  3H7H B;  2W7A A;  3QQC D;  2XSJ A;  3M6U A;  1HHS A;  3P4U B;  5CA5 A;  5LSO A;  2HS3 A;  3V6D A;  3PNI A;  4CM2 A;  3OPK A;  1REV A;  1PYT A;  1WOS A;  1RHM B;  3ILO A;  2OEL A;  5A8K A;  4P2F A;  3PIP Q;  4PR6 A;  3CW2 C;  1XEZ A;  2ZC4 A;  3R3T A;  3BEG B;  1HPZ A;  3H4B A;  3BYR A;  5CXT A;  2XGP A;  3S7R A;  5L1L A;  2ZHO A;  1QM9 A;  2XZD B;  3DLH A;  1U2F A;  4PUO B;  4EO8 A;  2HVE A;  4DPU A;  5FDL A;  2DIU A;  1QE1 B;  3RU0 A;  2Y0S D;  1TVR A;  3GV7 B;  1LFP A;  3FSX A;  1RKJ A;  3NS7 B;  3EMT A;  3R2C J;  3THV A;  4C0H A;  4KV8 B;  1PC5 A;  1U1L A;  2MZT A;  2HBY B;  1Y5I B;  2OPP A;  4ZCM A;  5L46 A;  4XO0 A;  3HFV A;  5J2Q B;  1PYS B;  1GMV A;  3C6U B;  4ZHR A;  1YZ6 A;  1RT4 B;  2GS8 A;  3VAG A;  3ZTO A;  1B4S A;  1B0P A;  2GNK A;  2CVE A;  3V5R A;  2R2S A;  3BQ0 A;  3W2W B;  3VVT A;  2JNJ A;  4B3T J;  1U48 A;  2UV8 G;  3MMA B;  1MN9 A;  1G2E A;  1EQ0 A;  4CTA B;  3FSI A;  3FBE A;  1AXQ A;  4QU7 A;  1WG5 A;  2P9G A;  2KT3 A;  3ET6 B;  3ZNJ 1;  4DV5 J;  2HHH F;  2RRB A;  2H4W B;  2XG8 A;  2MQL A;  3KJQ B;  1BXN A;  2CZ9 A;  5HO4 A;  1RTH A;  3CDB A;  1R27 B;  1DJ0 A;  2N7Y A;  1N5V A;  1YG0 A;  3C66 A;  1UP1 A;  3VAJ A;  4CO4 A;  3W2V A;  3CUN A;  1CJK A;  3RBX A;  2Q1L A;  4UUW A;  4JI8 J;  3DYA A;  4ECS A;  1OSD A;  3K58 A;  2DH8 A;  3EXC X;  2DNK A;  1RJJ A;  3AXK A;  1RLD A;  1U8S A;  3G2X A;  3N4W A;  3O8W A;  4O3S A;  1HNZ F;  4OZL A;  2V2K A;  4AUK A;  2OD4 A;  2ZBC A;  2XMV A;  2X1A A;  1S1T B;  4Y6I A;  5CH7 B;  3MPY A;  5E3R A;  4UY8 T;  4P72 A;  1RUS A;  2XNR A;  3CPW R;  4DPX A;  3P3D A;  1XR5 A;  3IMQ J;  3KWM A;  4G65 A;  2BDP A;  3K7R A;  1SJQ A;  2FHJ A;  2E5L F;  1LWE B;  1MRO B;  3AH6 A;  5HQ8 A;  4YN3 B;  3UE2 A;  3ZXW A;  2EC2 A;  2CQ1 A;  3IBW A;  2JSX A;  2DH7 A;  3MEK A;  4Q5V A;  3HZE A;  5KOX A;  4HT5 A;  2BAB A;  3O1L A;  3GIJ A;  4LBP A;  2VG6 A;  2RML A;  3KHH A;  2NZC A;  4ECX A;  3HUL A;  2PSZ A;  3R9L A;  3HFZ B;  4QIF A;  3VAM A;  2GVZ A;  2KL8 A;  1SKU B;  5LMN F;  3BGU A;  3D1Q A;  4I2P B;  1N88 A;  4LUB A;  3TUI C;  3SIP B;  2GJI A;  2JEJ A;  4TY8 A;  1BWV A;  3D67 A;  1JLF A;  3RB4 A;  3FBB A;  4IUF A;  4CP5 A;  2YXL A;  3UDC A;  4DN9 A;  3PHE A;  4DR4 J;  2BAC A;  2ZBQ A;  1YBA A;  3JQJ A;  4WE1 A;  2WCX A;  1APS A;  3GTY X;  1YLX A;  3GFH A;  2RRA A;  1NK4 A;  5GAE I;  4FYD A;  2C2E A;  5KTQ A;  4NLG A;  1WEL A;  2JLF A;  2JL9 A;  2BKP A;  4URQ U;  4USH A;  3KOA A;  1HWU A;  2XZT B;  3KK2 B;  3SXL A;  1RHQ B;  2E1A A;  1HQE A;  3I87 A;  4RUC A;  4ECT A;  3HZG A;  4ELV A;  1IBM F;  2XYH B;  3PX4 A;  1YJU A;  4OI6 A;  4HVZ A;  4KKO A;  3PY8 A;  1JNR B;  4JI4 J;  3ILI A;  1WSR A;  1RT2 A;  1VLY A;  1TL1 B;  1A0O B;  2M52 A;  4GVB A;  1QAX A;  2CQC A;  4Q2L A;  2KZM A;  3UR0 A;  2OMO A;  1Q8I A;  1RT3 B;  1DLO A;  1XNR F;  5CD4 H;  5FD1 A;  1VK3 A;  2OPS A;  4FNH A;  5HQL A;  3R5C A;  1X5O A;  4DL3 A;  1MWZ A;  5C2C A;  3HSG A;  1D0E A;  1N52 B;  5C5J A;  2VQF F;  3AA8 A;  2DNN A;  3ISN D;  4PG4 A;  4CO3 A;  2Y1L B;  5G0R B;  1FRX A;  4MKB A;  5C25 B;  5KFQ A;  3TAR A;  5D15 A;  1S5Z A;  3TP2 A;  1UJ4 A;  2ZH8 A;  5J2M A;  4FYW B;  5KFY A;  3PJ9 A;  3BDE A;  2QLB B;  4K8R A;  2F9J A;  4ZPC A;  5KFO A;  4NLR A;  5HI7 A;  4LJM A;  3EIC A;  2UP1 A;  4NXM J;  1Q8B A;  3HVT B;  1S9G B;  1VS3 A;  2EPI A;  2CJ9 A;  4X4P A;  5CCM A;  3OJU A;  3CJ0 A;  4YP3 A;  1YKW A;  2XBP A;  4QPT A;  3V6D B;  2CVI A;  1FA0 A;  1REV B;  3KDO A;  1NRK A;  2AJ4 A;  2AJF E;  4N56 A;  4I56 A;  3EDQ B;  2ZUG A;  4Y0F A;  2DGT A;  4I7F A;  2PC6 A;  2IVY A;  3PG9 A;  2ZKU A;  4O0I A;  4H4K C;  4Q2M A;  2HK2 A;  1R8B A;  2IBO A;  4FP9 A;  4FPI A;  5KFV A;  1PAE X;  3IG1 A;  1IR1 A;  4DQR A;  2RS2 A;  3MOZ A;  1WG1 A;  2Z56 B;  5KFS A;  1GTE A;  4V1A k;  3BO2 A;  4HHU A;  1WHW A;  3H90 A;  1Y5N B;  1T9V A;  4ERD A;  3C16 A;  2PN6 A;  3HHK A;  2OPP B;  2CPF A;  4LFB J;  5HBM A;  4F4K A;  2QLJ B;  5HN0 A;  1BE4 A;  1FRK A;  3ZZZ A;  4K5R A;  3OFG A;  5KG7 A;  4KHR A;  1NK9 A;  2OI2 A;  5T14 A;  2V8G A;  6FDR A;  4I6A A;  1U8W A;  3AAW B;  4EYI B;  3W3S A;  4DWI A;  3HD1 A;  4DFK A;  5DRK A;  3GYG A;  3N5F A;  1JJH A;  4PWD A;  2KFN A;  1MMN A;  2YBV A;  2VBX A;  3EVW A;  2HZV A;  3HHL C;  4YB1 P;  2JWN A;  1HWL A;  2B4P A;  3US5 A;  5K8M A;  3AQO A;  2F8M A;  2AIR B;  4DV2 F;  2DGQ A;  3FQL A;  3QGH A;  1JLC A;  2JH3 A;  3FQK A;  4EK2 A;  3LAK A;  3NRB A;  4X65 J;  4M5H A;  2GA7 A;  4A8O A;  3GV8 B;  5J1E A;  4DSK A;  3KLF B;  5K5M A;  2PD1 A;  2KG1 A;  2BAN B;  2HK3 A;  5F3Z A;  1N0U A;  1L3K A;  4KFB A;  2FD2 A;  6FD1 A;  1VK8 A;  4LFC J;  2WZ1 A;  1JK9 B;  3W2V B;  2ZD1 A;  1XJW B;  5KFL A;  3E01 A;  2ATC B;  4NWB A;  2J7U A;  5DGB A;  1PBA A;  3ILL A;  1LKZ A;  3UDL A;  1S1W B;  1EJ7 L;  4PG6 A;  3T3F A;  2HVH A;  4PAA A;  1JLE B;  2H51 B;  4KHP F;  1OPI A;  3J7A N;  4CDI A;  3AFG A;  1ULR A;  3TVZ A;  3BH6 B;  3LA0 A;  5LXY A;  1X5P A;  3OR2 B;  3CCZ A;  1IKV A;  1QSL A;  5AE3 A;  2CZ4 A;  4QIG A;  4I4B A;  4WIQ A;  3KTQ A;  3MXH P;  3FUY A;  1J5E J;  2GC8 A;  1F9H A;  2ZWP A;  1U1K A;  1LWC B;  3NNC A;  4NXN F;  5KFR A;  1YJN S;  2VDI A;  1ZPW X;  1S1U B;  2OHD A;  4IRD A;  3T6B A;  3A8E A;  2QRR A;  2UV8 A;  2QFI A;  3AT1 B;  4F3Q A;  2F40 A;  2H5J B;  5E33 A;  3EWG A;  3D0H E;  1UKU A;  3GIM A;  3M30 A;  5I3Q A;  2AGQ A;  3CCU S;  4N76 A;  1JLF B;  1URR A;  2KXF A;  3VQT A;  2DRA A;  3NNH A;  2ASY A;  2UUA J;  1VQ4 S;  3WC0 A;  4DR6 F;  4U6P A;  5KG1 A;  1WDT A;  3T5L A;  4IG3 B;  5KAK A;  2XMK A;  2MLX A;  2X7I A;  2AGP A;  1NJY A;  4F4X A;  1YJR A;  4C8K A;  3MEG B;  4USJ C;  3LTO A;  4EO6 A;  3GFY A;  2HRT A;  1RWU A;  2F8E X;  2MTL A;  1O51 A;  3TX8 A;  4I64 A;  2LA6 A;  3DFE A;  1WNE A;  4MT1 A;  3I4H X;  4FYX B;  1YX2 A;  4FVC A;  2ZDP A;  5C42 B;  1OY9 A;  3ETO A;  5LJ5 Y;  3RRK A;  2JC1 A;  4JI2 F;  1RT2 B;  4FBU A;  4ANC A;  2XC9 A;  1FKA F;  4LF6 F;  3I4P A;  3CMA S;  3FC9 A;  4GVB B;  2FGO A;  3KUG A;  4QYZ J;  1ZTW A;  3IP0 A;  1GXT A;  3LH2 S;  3QZ7 A;  2B4V A;  3TEG A;  2BJ7 A;  2QG9 B;  3NOG A;  1DLO B;  2CJK A;  1UFW A;  3DMJ A;  1NME B;  3W8P A;  2OPS B;  2DNO A;  2BJD A;  2BVZ A;  4NYZ A;  2B43 A;  3IRX A;  3BO3 A;  5DM6 Q;  2JFD A;  3RAM A;  3OTB A;  4NCB A;  3IC1 A;  2DR6 A;  3UR3 C;  4K4V A;  5J2M B;  2PO4 A;  2CA9 A;  1FDN A;  2IJF A;  2M4M A;  3HK2 A;  2YQ0 A;  3JB9 k;  2C2Z B;  2YVS A;  3WIV A;  2E7W A;  2IFX A;  2QE5 A;  1VHF A;  4MAK A;  2FZK B;  3C6T A;  3IGV A;  2N82 B;  5B0B A;  4PYD A;  1WTF A;  3WZ0 A;  2FJV A;  1IXK A;  3IFE A;  3HF5 A;  4MYT A;  3KJF B;  5IWA F;  1YBU A;  1RWM B;  4HKQ A;  1NH7 A;  3PM9 A;  2CNK B;  2CQI A;  1NO8 A;  2G1D A;  2EEY A;  2AX0 A;  5IT4 A;  1RBA A;  2QSW A;  4EEY A;  4PQA A;  4IO9 Q;  1VOM A;  4F0K A;  4RW4 A;  2YNG B;  3LP1 A;  1IWG A;  3ENQ A;  1FNX H;  2ZIT A;  2DRD A;  1T8E A;  2ZJQ Q;  1VJW A;  3WIU A;  2QL5 B;  3C16 B;  2K7J A;  3GII A;  3SI8 A;  3QWP A;  4X4R A;  4L72 B;  5HBM B;  3IR6 B;  3A4T A;  3KK3 B;  5E3Q A;  4ZMM A;  5KFN A;  3IR7 B;  3QJL A;  4A8W A;  4NYP A;  2DR5 A;  2WOM A;  4WYL A;  3V2U C;  3PVX A;  4LF9 J;  4HLB A;  3CC2 S;  1HBO A;  3NMR A;  2H48 B;  4IQM A;  2E29 A;  3OL9 A;  2QMX A;  3CCW A;  5M2U A;  2PA3 A;  2FY8 A;  5L1I A;  3CD7 A;  1LNQ A;  2ZVI A;  4PWD B;  2XO6 A;  2QN6 B;  2J0W A;  1IQZ A;  1X7V A;  3IN5 A;  3GCX P;  2DR7 A;  5H1S V;  1ZPV A;  3Q89 A;  4LQ3 A;  2CQ0 A;  1JLC B;  2GMJ A;  4EWT A;  3CJT A;  3BKF A;  4KIA A;  4EU0 A;  2WRM A;  2IPO B;  4TYB A;  4O4R A;  4WCE Q;  3M8Y A;  3G87 A;  4ECZ A;  2ZD1 B;  1IBK F;  1NND A;  5B0F A;  4M95 A;  4YY3 F;  2PII A;  1WI6 A;  2QA4 G;  4B02 A;  3R7N B;  5F3T A;  2A6O A;  1L3V A;  1KKH A;  2J0Q D;  3NGT A;  4IFY A;  3DU6 A;  1VQO S;  1JKH B;  2AU0 A;  4DPY A;  2YNH A;  3UW1 A;  3MWB A;  2KG0 A;  1X4H A;  2GAH C;  2BJE A;  2FGC A;  2E44 A;  2D3O R;  4DUZ F;  2VOP A;  2E5G A;  3HP6 A;  4FF2 A;  1RU2 A;  5ETS A;  3Q22 A;  5DGA A;  5D4L A;  4QPX A;  4DZD A;  2X1F A;  2UUB J;  3RAX A;  2Z30 B;  1RAG B;  1NPK A;  1HW9 A;  2ACY A;  4O3Q A;  1LXN A;  1SJ4 P;  4KY3 A;  1KVJ A;  2EXU A;  2NSB A;  1NSK L;  4JOU A;  1U7L A;  4CLS A;  1LOU A;  3QWU A;  3BBF A;  1QAJ A;  3CED A;  4DR1 J;  4B3M J;  1X4C A;  3ZZO A;  3DXB A;  3DKD A;  4B9S A;  3QRR A;  5E0O A;  2CJA A;  1PBU A;  1FJG J;  4F25 A;  3OTO F;  3V6H A;  4JUZ A;  2V63 A;  5HRO A;  2R2T A;  5LMU J;  2DXF A;  5I3U B;  3GIL A;  3UD5 A;  4ED1 A;  3O3L A;  2Z2Z A;  3CSK A;  1SV5 A;  3BKT A;  2O3D A;  1E6V A;  4MMO A;  2JX2 A;  2DGU A;  5LT5 A;  5SZT A;  3EPG A;  2J76 E;  2IVM A;  3HVR A;  2R3V A;  3CDE A;  4ALZ A;  4K59 A;  3FRZ A;  2XLI A;  3KLG B;  3HD2 A;  1SUQ B;  4CLZ A;  4C2M A;  5HLF B;  1U1O A;  3B54 A;  1U1Q A;  4ZPV R;  3EGZ A;  2RNE A;  5IQQ A;  3A12 A;  4DX7 A;  3KYL A;  4UOH A;  3I5C A;  1GQE A;  2O5D A;  2RU3 A;  1OMS A;  5JUM A;  2YKM A;  1TL7 B;  5F9N A;  1F3F A;  2X1G A;  4Y28 C;  2FLL A;  2PEH A;  5ETV A;  5IC4 B;  3M6X A;  3O6Q A;  4CLF A;  4DL7 A;  3GWC A;  2VD3 A;  1EP4 A;  1OQ6 A;  1UL3 A;  3B4M A;  2DNZ A;  2XCP A;  1VHI A;  2DH9 A;  2U2F A;  4N5S A;  3MUR P;  4Q0B B;  5GAG U;  1U1M A;  4LRD A;  1NK8 A;  1RB0 A;  4X4T A;  5IT0 A;  3HCX A;  2MPU A;  4F8R A;  3LGH A;  2DEJ A;  3IRX B;  5E41 A;  2ZDO A;  3NWG A;  3DLK A;  3QRQ A;  1X5S A;  3M7V A;  2C1E B;  3OFF A;  4HI2 A;  3V81 B;  2M0G B;  3GYX B;  2YWW A;  3RAQ A;  1GXL A;  5KFH A;  3M6V A;  1ZA2 B;  5KFE A;  3X3U A;  1XNQ F;  3D66 A;  2GJF A;  1Z4U A;  3UCU P;  1HMV A;  4C8Z A;  4P2M A;  2MSS A;  4QZV B;  4B9T A;  1R0C B;  3QFW A;  1SJR A;  3C6T B;  4DF4 A;  3M2V A;  2HHH J;  2V8P A;  5KFG A;  4OYA A;  2HQC A;  2FVR A;  2QO3 A;  4NEY A;  3HT0 A;  1FFS B;  2OEJ A;  4PAB A;  3TA2 A;  3UO0 A;  2HHU A;  1S6P A;  1O0P A;  1F1B B;  1DQ9 A;  2ZWO A;  4IH5 A;  4TLR A;  2D1C A;  2UXC F;  4DU8 A;  3C8Y A;  3TZX A;  3BR9 A;  1U1N A;  2UVR A;  4HTJ A;  2ROP A;  2QTW A;  2RUS A;  1H2T Z;  2UVV A;  1VGY A;  1L3S A;  3LP1 B;  1HNZ J;  4E2F B;  2HZA A;  1D1U A;  1Z2L A;  3VHQ A;  2AHO B;  1SCJ B;  4OLP A;  1NPR A;  5IV3 A;  4WPA A;  4CLT A;  4LF2 A;  2EBE A;  2DYA A;  3GJQ B;  3EGV A;  1WC3 A;  3JYT A;  1RGV A;  2E5L J;  4J9V A;  2DD8 S;  4ZVP B;  3P8B B;  5HMY A;  2OLW A;  4A8Q A;  3R7B B;  2J7K A;  1HBO B;  2W7O A;  3NP5 A;  1RBL A;  1K44 A;  1CLF A;  3ZTP A;  4Z7Y A;  1TMM A;  5F8J A;  4MK9 A;  8AT1 B;  4K50 A;  4IOC Q;  3LP0 A;  5KG3 A;  3TAM A;  4DG1 A;  4K7Q A;  4JI0 J;  2MZJ A;  3K5L A;  4LF8 J;  1E6Y A;  3KG1 A;  5LMN J;  1R0A B;  3G9C A;  3E3X A;  2W9B A;  1D8Z A;  2YY3 A;  1U6B A;  2IA6 A;  2OAU A;  2MQO A;  1T05 A;  1HR0 F;  2F4V F;  4Z37 A;  4YEA A;  1BQM A;  4H4K A;  3F56 A;  5CCL A;  2L9D A;  5T7L A;  1NKB A;  4K4T A;  3A13 A;  4PG7 A;  3CB4 A;  4M5J A;  3K5O A;  4A8K A;  2VA3 A;  3AD8 C;  3OQ2 A;  1FRH A;  4O3O A;  2W9A A;  4FF3 A;  3RW6 A;  1VQ8 S;  3OJS A;  3HPO A;  2WTF A;  2CNN B;  2ATL A;  5B7W A;  2J0X A;  1C0T B;  3Q2T C;  2GO9 A;  2OKQ A;  2UXB J;  2D3U A;  3PW5 A;  3L7O A;  1FRL A;  2H65 B;  5J2P B;  2OSR A;  1FE0 A;  4ZPT R;  2B4U A;  1B3T A;  1KN6 A;  1NZ8 A;  4Y2K A;  1S97 A;  4X4V A;  1F9F A;  2HPU A;  2DO0 A;  1VJQ A;  4ZN3 A;  2DCU B;  2IMW P;  2HGM A;  2FVP A;  3I55 S;  4N7T A;  3M8W A;  5KG5 A;  4LR7 A;  1QLN A;  3EYZ A;  4KHM A;  1WWH A;  4X66 J;  3HHL A;  2WVD A;  4TVA B;  3OXG A;  9RUB A;  1G6B A;  2BJ8 A;  3V4I A;  5AE2 A;  2EK1 A;  2ZH5 A;  4K0K F;  3HJV A;  3IS9 B;  2NR0 A;  1MML A;  1XNR J;  4LVO P;  3TW0 A;  4F2S A;  2I2Y A;  1NKE A;  3R5J B;  1HW8 A;  1ELO A;  1CJV A;  2I0X A;  1LQ9 A;  4MYU A;  3BSO A;  2FJA B;  4ZPB A;  3K5P A;  1AB8 A;  6AT1 B;  3IAM 9;  4I68 A;  4HT7 A;  3IWX A;  1S1X A;  2OUG A;  2BM0 A;  2EVZ A;  4JI5 F;  3TVK A;  2W4P A;  5IQ6 A;  3R1H A;  1NDP A;  3HSD A;  2QZ8 A;  1RYR A;  3TUJ C;  2HVZ A;  1SV5 B;  1ICE B;  2DIV A;  4HAC A;  3W5Y A;  4Y2M A;  4IR9 A;  2GAG C;  3HDS A;  2DNR A;  2H5I B;  2FDN A;  4DJB A;  5AXK A;  2E9T A;  2XS2 A;  4YB5 A;  4KB7 A;  4USM A;  3CCJ S;  1FKO B;  1X4D A;  5D4O A;  1N5T A;  4ZPD A;  4A46 A;  3OUY B;  2XMT A;  4DV0 F;  2MY8 A;  3FCW A;  4RBU A;  3SYZ A;  2CJB A;  1Y00 A;  1RT7 A;  1RDR A;  4DQI A;  3PW0 A;  1HHQ A;  2YNI B;  2IDE A;  3BSN A;  1U24 A;  3JAM Y;  3KLV A;  4Q44 A;  2ZE2 A;  2MKH A;  3N5B A;  3LP2 B;  1M90 T;  2FPH X;  1KOH A;  2NXJ A;  3ZZT A;  1YJ9 S;  3MMC A;  1EP4 B;  1TK8 A;  4E8U A;  3FKB A;  4ZA1 A;  4WK1 A;  2BE7 D;  1RA6 A;  1WOO A;  1KFS A;  1S9E B;  3TA1 A;  3B4D A;  4J9L A;  3HXM A;  2B9X A;  4DL4 A;  3GJS B;  4X4S A;  5HVF A;  3DLK B;  5AE1 A;  2BKN A;  2RDI A;  3Q8S B;  3A8J A;  3RRH A;  3C19 A;  2I6W A;  3KMQ A;  1HMV B;  3MCO A;  1SBR A;  2GIQ A;  2UXD J;  1OYD A;  3DC2 A;  3QAE A;  4ID5 A;  2QYC A;  3M2V B;  4DV2 J;  2XS5 A;  1GX6 A;  1CS4 B;  4U67 Q;  1NK5 A;  4ECW A;  4LRE A;  4NA2 A;  1TKZ B;  3JQM A;  1T9W A;  4IKA A;  4O4G A;  3CMQ A;  3TOQ A;  1KNZ A;  1LFW A;  4X4O A;  4X62 F;  2C2D A;  2YWG A;  4RPF A;  4ZVG A;  2G1H A;  3QLH A;  1WEX A;  1R0B G;  4DR2 F;  3DOM B;  3D1O A;  3AB4 B;  4JI3 J;  3G6X A;  4EUV A;  3TWZ A;  2OPQ A;  4G1I A;  3UNG C;  3KJN B;  3MM8 A;  3T9N A;  3QJP A;  4ZVO B;  1LW2 A;  3NL0 A;  4DOZ A;  5BR8 F;  4C98 A;  3ADA C;  2BUN A;  4B9N A;  1JJ4 A;  1TK5 A;  3FSY A;  1K0T A;  1N0V C;  2R7V A;  5DLG A;  4KHP J;  5I4M A;  1Q78 A;  3CCM S;  3G6E S;  1BQN A;  3BN7 A;  4KO0 A;  4GVL A;  2E5H A;  5KG0 A;  5KT4 A;  4DUY J;  4UQT A;  4OQJ A;  4RW8 B;  3U1M A;  4PRF A;  2V4R A;  3JYT B;  1FX4 A;  5LM7 E;  1WSV A;  2R8G A;  2RSQ A;  1N56 A;  4CO2 A;  3OVS A;  3BBB A;  5E3A A;  3BN4 A;  5ETL A;  1C1B B;  3VV2 B;  4EI2 A;  5THW A;  2OPR A;  1VLO A;  3R97 A;  3DRR A;  3I5A A;  2DPJ A;  4WZQ A;  4RU2 A;  4NXN J;  1ZBT A;  3KJV A;  4TU8 A;  2RDD A;  1Q4R A;  3NY0 A;  3D3C J;  3TAM B;  4YQW A;  1N5Q A;  1WKL A;  3QO9 A;  1E6Y B;  3MMB A;  3MUM P;  2JHE A;  2B7B B;  4NLO A;  5KT3 A;  2W9B B;  2D3Z A;  3RRG A;  1SPB P;  1VBY A;  1T05 B;  2DHA A;  3GYN A;  4DL6 A;  4GKJ F;  1BQM B;  2VBW A;  4WXO A;  1VQP S;  3L95 X;  3B78 A;  5T7L B;  1K73 T;  2Y8Y A;  1ZAW A;  2XCA A;  2IC3 B;  5DDR C;  1TUG B;  3HX9 A;  4DSJ A;  4J9R A;  2FIU A;  1SQE A;  2FJD B;  3VAF A;  2ZZN A;  2UU9 F;  1ARO P;  3BYP A;  2QV6 A;  1RTZ A;  3SMZ A;  5B0C A;  4GKK J;  3TO8 A;  2Q43 A;  3NWR A;  3R6L B;  2VH7 A;  3Q86 A;  1S6Q A;  4PWU A;  4B3S J;  3OFE A;  4IDK B;  2HHT A;  4DFJ A;  3PR4 A;  1NPP A;  1NK7 A;  3QYY A;  2ZH4 A;  3G71 S;  4B3R J;  4YHH F;  4N41 A;  2J6S A;  5IT9 Y;  4OJ3 A;  1SJ3 P;  8RUC A;  4JI1 J;  2VOO A;  1ZS6 A;  2HIQ A;  4QW9 A;  3GJT B;  1F5A A;  3J81 U;  3V4I B;  1JJ2 R;  4P6Q A;  2N3O A;  3HM9 A;  2G0C A;  1VRU A;  1AUD A;  2LQJ A;  2VJV A;  3MM9 A;  3AOD A;  2B8P A;  3CDW A;  2GGP B;  2DNH A;  3BF4 A;  4KC5 A;  2XMJ A;  2EG2 A;  2W1B A;  4OZJ A;  4LRA A;  4DBQ A;  2N4C A;  3HHN B;  2GFF A;  3T41 A;  1WG4 A;  1S1X B;  3M2U A;  3GSD A;  1KC8 T;  2VPZ B;  4DV6 F;  4UT4 A;  1U09 A;  5HAO A;  4DS5 A;  3FCH A;  1OS5 A;  2YWE A;  1ROF A;  5HMZ A;  2HQF A;  4DV4 F;  1QUV A;  2RQC A;  4RR5 A;  5GAD I;  3GR0 A;  1QAY A;  3PCO B;  1SKS A;  3VCD A;  5HK4 A;  5A8W B;  4CIO A;  4C11 B;  2B7C B;  4ATN A;  5KG4 A;  3PYG A;  1X4A A;  4OYZ A;  2HUR A;  3ZZY A;  1Q7L B;  3I9Z A;  1K8A T;  5IWA J;  1HHT P;  3LW5 C;  2RS8 A;  1TL3 B;  4RW9 A;  3NBP A;  3RUB L;  1MN7 A;  4PXD A;  3QIP B;  1BMQ B;  4QIV A;  4HH1 A;  1RT7 B;  1IBC B;  4AXJ A;  4C4W A;  4X4U A;  3DRP B;  2ZE2 B;  1SC1 B;  3H5U A;  2DVI A;  4OYO A;  1X31 C;  4QWB A;  2VB6 A;  1SKW A;  2BE2 B;  2WW8 A;  3CNQ P;  5F8L A;  3H2L A;  4P10 A;  1FFG B;  2C2K B;  4IH7 A;  4QIW D;  2GQ2 A;  3EM1 A;  4DQP A;  1PSD A;  1R6Y A;  4YME A;  2YX1 A;  3K5M A;  2VJU A;  2J5A A;  1X4B A;  4BC9 A;  1IKW B;  3S1T A;  2ASL A;  3PW7 A;  2D74 B;  2DO4 A;  3OL7 A;  3OHA A;  3UWT A;  3HFK A;  4DHV A;  2JRS A;  1FWL A;  3FZB A;  3M32 B;  4ZN1 A;  1U4B A;  3MM5 A;  3RGI A;  2ERR A;  5ETT A;  3DM2 A;  1I3O B;  2YKN A;  4FXD A;  4GO7 X;  4ID5 B;  3OW2 R;  3P96 A;  4ZPA A;  4NAS A;  3J7Y U;  4DXL A;  2CPX A;  1JX4 A;  3MM7 A;  3PO4 A;  3LAM A;  4M1K A;  1P6T A;  2OTJ S;  4F7V A;  3DDI A;  1X8D A;  3NGD A;  2IYI A;  4C0B A;  4Z2X A;  4ILL A;  3QLH B;  3P5B P;  1FFW B;  4A8X A;  4JB8 B;  2EFQ A;  1DY3 A;  2RKI A;  3BBC A;  3CVK A;  1RTI A;  4IG0 A;  1EKR A;  2OPQ B;  2NYH A;  2W4D A;  3CCE S;  2ASD A;  3MM8 B;  1LW2 B;  1VIO A;  1NDK A;  2HBZ B;  5H9F J;  4I2Q B;  2AT1 B;  3I96 A;  2A0F B;  2FZC B;  3KLH B;  5I42 B;  1RQ0 A;  2P5V A;  3BSC A;  1BQN B;  1RT1 A;  4KO0 B;  2QT7 A;  3DN9 A;  2OGU A;  2IAJ A;  1TKT B;  4NLS A;  3ZZU A;  2IBK A;  2OML A;  1PIE A;  4DUZ J;  1GXU A;  2HVD A;  3W61 A;  2APO A;  4WZM A;  1S72 S;  1KHV A;  2VFS A;  2AYE A;  2XY6 A;  2NZ4 A;  4KH0 B;  1VIS A;  4ZCL A;  2V8H A;  2RF2 A;  3FRY A;  1U0H B;  1OY6 A;  1XMQ F;  1BY9 A;  1H6K X;  2C42 A;  1R31 A;  1IKX B;  1OO0 B;  4EBC A;  4FN5 A;  3CD0 A;  3Q8Q B;  4KE5 A;  3DI6 B;  4F67 A;  1FXR A;  3QO9 B;  2MHN A;  4YR0 A;  2DIT A;  3MMB B;  4B3O B;  4TN2 A;  5DS7 A;  4DN0 A;  1UFL A;  1R8P A;  2MST A;  3PX6 A;  5D4P A;  3R6G B;  1JLQ A;  2DGW A;  2E5I A;  1H98 A;  2HQG A;  2EFG A;  2DR9 A;  2ZVS A;  4W92 B;  4M5I A;  2LFV A;  3QAT A;  2PE8 A;  1B7Y B;  4FKX A;  1T3N A;  1N8R T;  3EUN A;  1U02 A;  3TA0 A;  3W5Z A;  5EX3 A;  4LFA F;  4L75 A;  5ETO A;  3VGS A;  2HW3 A;  1N6Q A;  1W25 A;  1SI9 A;  1FTR A;  1EX8 A;  4J9U E;  2RIL A;  3MR5 A;  2JLE A;  1JNZ B;  4Y3C A;  4C3L A;  2HS0 A;  2QYG A;  4P74 A;  5KFK A;  4PPD A;  1R3N A;  1S6Q B;  3OTC A;  2W2M P;  3H5S A;  3CD5 A;  3BGO P;  2H1Y A;  4M5L A;  3DLJ A;  4X84 A;  4F4Z A;  1RKI A;  2R2R A;  3DNC A;  4WP8 A;  1EZZ B;  1DUR A;  3ZNU A;  3BV8 A;  3HMJ G;  1H0H B;  1N4L A;  3KDN A;  1SH2 A;  2EKY A;  4LIW A;  4QJV A;  4ZVU B;  2FHM A;  1UVL A;  1N32 F;  4ZLP A;  3EZ5 A;  5GAH U;  3GU0 A;  4NI2 A;  1KQG B;  3SFU A;  1VRU B;  4LR8 A;  3BO4 A;  4HDH A;  2V94 A;  4KR0 B;  4OX9 J;  3IM9 A;  2COL A;  3MF5 A;  4XK8 C;  4W90 B;  2ZM6 F;  3H20 A;  3MMJ A;  1C1C A;  5CAB A;  4RWW A;  2NPI A;  3QT5 A;  4IRK A;  2AP6 A;  3G96 A;  1SH0 A;  3PW4 A;  5KFJ A;  3W60 A;  2KJW A;  4DL2 A;  5DG8 A;  4WP9 A;  1T03 A;  4JI6 F;  1F6T A;  3OLB A;  2MGZ A;  3MTK A;  2QFJ A;  2YWF A;  5CYQ A;  1KR4 A;  2B9Y A;  4BC7 A;  3HLU A;  2F5G A;  4LF7 F;  3SV3 A;  1M1K T;  1RU1 A;  4ZIW A;  1NK0 A;  1RAH B;  2CYY A;  3R5B A;  5EHH A;  1KTQ A;  1I51 B;  4LF4 F;  3K8W A;  1RWN B;  1Q8L A;  2RVJ A;  1WTB A;  4DSF A;  1TFW A;  1HD1 A;  3DLB A;  5DDO C;  1C4C A;  3JSM A;  2POK A;  1VC5 A;  4NA3 A;  4WJB A;  4C0O C;  2G2Z A;  1KVK A;  3NGR A;  2HFO A;  2LA4 A;  4AD6 A;  2HKE A;  3CJR A;  4KSE B;  1FI4 A;  1ZAV A;  2LU1 A;  4RBT A;  1RTJ A;  3CJ3 A;  1HBN B;  1RTD A;  1QUP A;  4MH8 A;  4DX8 H;  4MIA A;  1TMJ A;  3ZZP A;  3VWS A;  1KEK A;  2YTC A;  3GZ7 A;  1EIY B;  1JIH A;  1NHK L;  2C3M A;  2AV5 A;  3T1Y F;  4YB6 A;  4MIW A;  3D2W A;  3LGM A;  2MKI A;  4ED8 A;  2ASJ A;  3ICL A;  5K8N A;  3M2R B;  1XN9 A;  2XY7 A;  1HQU B;  3PAC A;  1XK8 A;  1I5O B;  7FD1 A;  4I6Y A;  4RNF A;  3F44 A;  2RHQ B;  2XB2 D;  1CJT A;  1QAI A;  2YKN B;  4HEA 9;  2W9C B;  4EYH B;  3CC4 S;  3MM7 B;  2XGQ A;  2R4F A;  1HNX F;  2E7X A;  4ED4 A;  2RB7 A;  5AXL A;  3C15 B;  4RJV A;  3LWM A;  2VQE J;  3M8Q A;  3M8P A;  2CWX A;  4PXE A;  1DQA A;  2AYG A;  2DGX A;  1VRT A;  3BB5 A;  4HI1 A;  3CCQ S;  4M5K A;  3MEE A;  4ZDN A;  5IT9 U;  2R7S A;  5K8O A;  4UF4 A;  2VF3 A;  3I0R A;  4B3T F;  2CQ2 A;  5EWE A;  1T02 A;  4OZ5 A;  4NZ0 A;  1RT1 B;  4WTY A;  5FII A;  1S9F A;  4DV5 F;  2IM2 A;  3DGP A;  2WVF A;  3J80 Y;  1X9M A;  1RWK B;  2ZEJ A;  2BRL A;  1FK9 A;  3M9N B;  2P9E A;  2HFU A;  2IRU A;  4WU2 A;  3A8I A;  2RF2 B;  1YGY A;  1WC6 A;  4HL9 A;  3R27 A;  1UZH A;  2RAQ A;  4RO0 A;  2CXE A;  1S76 D;  3PYD A;  2RRN A;  5CZX A;  4M5G A;  4JI8 F;  5LXR A;  4C97 A;  4LSZ B;  1S10 A;  1J5O A;  1IKY A;  4Y2I A;  2AJ1 A;  4ZLJ A;  3IM8 A;  4IR1 A;  5DM7 Q;  5DJB A;  3AA9 A;  3DOK A;  2OSQ A;  1RWW B;  1KS2 A;  3KNA A;  3L09 A;  3VGT A;  1HLW A;  2FC9 A;  2V67 A;  5E2Q A;  2ZZM A;  4B9V A;  1FCA A;  1RK8 A;  3BM7 A;  2HFN A;  3Q23 A;  3H25 A;  2JEI A;  2VDH A;  3AXM A;  4USW A;  1PCA A;  4Q8E A;  4OYI A;  2CQG A;  2VBZ A;  4L74 A;  2BE9 B;  1CC7 A;  4PZV A;  4ZOS A;  1N6Q B;  1S59 A;  2ZHA A;  4AQY J;  3HHL D;  3ITH A;  2GJ2 A;  1SQF A;  1SL1 A;  4DFM A;  3MGJ A;  4J37 A;  1M5K C;  1ZM2 A;  4W4M A;  3QFH A;  2CPZ A;  4DLE A;  1ACM B;  4ID8 A;  1RCO B;  4MKV A;  1WOP A;  3P6Y C;  3AJ2 A;  3NGK A;  3MUT P;  4C8N A;  1X4F A;  1RAJ A;  1CEZ A;  4ED7 A;  1NAQ A;  3H2V E;  2GIF A;  5F8G A;  2HWT A;  2EFP A;  2VG5 A;  2WW4 A;  3OXF A;  2ZFH A;  1FVQ A;  3GPA A;  3NGU A;  1S48 A;  1WKK A;  4NLX A;  3TJA A;  3PR5 B;  4FXW A;  4F4A A;  4NYO A;  2M9K A;  4NI2 B;  2ADC A;  1AYE A;  2BW7 A;  2K7K A;  1HL6 A;  2J9E A;  2W4C A;  5CHC B;  5F8N A;  3RBE A;  5L1K A;  2VC0 A;  1IBL F;  1RI7 A;  4OFZ A;  2AYM A;  4O3R A;  1BD6 A;  1WHV A;  2IM1 A;  1C1C B;  3BQ2 A;  2FJW A;  1J2V A;  1S7H A;  5JJB A;  1U49 A;  1P8G A;  4WKY A;  2M3D A;  3CGI A;  1GMW D;  3ZTQ A;  1Y7P A;  4DZ6 A;  2KT2 A;  4ZVS B;  4M63 A;  4ES2 A;  4FF1 A;  2WON A;  3D28 A;  4OLO A;  4X64 F;  1OSC A;  1ZET A;  1HNV B;  2YQ1 A;  4JI4 F;  2PGC A;  3K0J A;  5DLF A;  2RHS B;  1T03 B;  1IM4 A;  3QT6 A;  1MU2 A;  3EPI A;  3C14 B;  2GQQ A;  2OP5 A;  2YQ3 A;  3WBZ A;  3DRS A;  5CYQ B;  1V9O A;  1SKR A;  1EET B;  1XR6 A;  4K2X A;  2AZ1 A;  3EX7 B;  3EZO A;  3W8G A;  3PEJ A;  2NRE A;  4JV2 A;  2KM8 B;  1Y5L B;  2YNF A;  3TZY A;  1KDN A;  1M5O C;  4F0H A;  1PKU A;  3OR1 B;  4KYZ A;  3FEX B;  4AYB D;  4MK8 A;  2OH2 A;  3BKU A;  3FNN A;  2FQQ B;  1SC3 B;  1S4E A;  1VQ9 S;  3JSM B;  1N48 A;  4X4Q A;  1NEE A;  3OD2 A;  3UCZ P;  1V3Z A;  3CJ4 A;  3E2E A;  4MK7 A;  2I9S A;  4F4Y A;  3CDA A;  3H2U B;  2DNG A;  4AT1 B;  1PGZ A;  3T1A A;  1H72 C;  3MED A;  1QJH A;  5KFW A;  4NRU A;  4NXM F;  2AD9 A;  1RTJ B;  2R8K A;  5D8H B;  7FDR A;  1AFJ A;  3H5X A;  2IA0 A;  1RTD B;  1KLM A;  3HHD A;  4WTO B;  2J8S A;  2KTQ A;  3OSP A;  1FVS A;  4M5D B;  1LW0 A;  5L9N A;  2EK6 A;  2PMW A;  1V5V A;  1N34 F;  1RHJ B;  5IXU A;  1KRP A;  1NH8 A;  4LBI A;  3VAL A;  4UOG A;  1N5Y A;  2YKA A;  2O67 A;  4H4M A;  4Y65 A;  3UN5 A;  5J1N A;  3K8V A;  1CJT B;  2ZOG A;  3NCP A;  4M8L A;  4IH6 A;  3S01 A;  5CQG A;  2VFV A;  1TUW A;  2DGO A;  1IWA A;  1JWW A;  4UOF A;  4ETZ A;  4LFB F;  2GVD B;  2XTJ P;  3D6F B;  2R8J A;  3K17 A;  2W2O P;  1NZA A;  3PRV A;  4NEZ A;  2QX0 A;  3IBF B;  1DZ5 A;  2I5J A;  4J7C A;  5IOL A;  3WHI A;  1FX2 A;  2PA8 D;  3G82 A;  4OI4 A;  4FF4 A;  3U02 A;  3MEE B;  2VC1 A;  3MAA B;  3N79 A;  2HIY A;  1Y11 A;  2D3O 1;  5HMW A;  3M1V A;  3I0R B;  1FNO A;  3OXL A;  4LRB A;  3L3C A;  3VQS A;  2BZ2 A;  5HP1 A;  2VU5 A;  3P5T L;  2H9Z A;  4ES3 A;  2XSJ B;  2OD6 A;  1U47 A;  2ZC3 A;  2W25 A;  3PRD A;  3M8Z A;  3KK1 A;  5I3P A;  4WFY A;  4Z7C A;  4F0M A;  1SC6 A;  1DTT A;  2ILY A;  4WII A;  1ZA1 B;  5A8K B;  3VAH A;  4X65 F;  3FK4 A;  1UCN A;  4E98 A;  1T0T V;  3CO0 P;  2VBY A;  1HPZ B;  2CZV C;  1NSP A;  3DCA A;  3I5B A;  2YKQ A;  4LFC F;  3NEK A;  5CD4 A;  4LF5 F;  3ENW A;  5D0R A;  4LRF A;  4WF9 Q;  1MLA A;  3SZ2 A;  1RE1 B;  5FDL B;  1TVR B;  1CQN A;  3NMA A;  3AY0 A;  3FFI A;  4DQQ A;  4J9K A;  1UVI A;  1F60 B;  1J5O B;  4JBC A;  1IKY B;  1I1G A;  1OQ3 A;  1BC6 A;  2L9N A;  4R0J A;  2HNY A;  2HHQ A;  5B0G A;  2CG8 A;  3DOK B;  3PYF A;  3V6J A;  2DNY A;  4J9P A;  2CUY A;  2C2R A;  4NLQ A;  2JEF A;  4ZHR B;  3ELH A;  4Y2A A;  1JQG A;  4DV6 J;  5U47 A;  4DX5 A;  2XYP B;  1CUL A;  1HWJ A;  4USI A;  5A0Y A;  4QU6 A;  1Y3J A;  1S1V A;  2GML A;  1SJ1 A;  2RU9 A;  4B9L A;  1J5E F;  2FLO A;  3CCS S;  4K4U A;  4OZ1 A;  1JLG A;  4ZVR B;  3LAL A;  2ABY A;  1S0N A;  3CCR S;  3PDN A;  1N33 J;  2XS7 A;  4OYM A;  2E66 A;  5ITH A;  4ZCK A;  3OVB A;  5D0H A;  5KFZ A;  1HWI A;  3BPD A;  2MHE A;  1LXJ A;  2VV5 A;  1RTH B;  3RW7 A;  3QGP A;  3MPU B;  3SV4 A;  1FJE B;  1T9X A;  4KJI A;  1UW9 A;  3Q24 A;  1XMO F;  4UOC A;  4RLE A;  2N4D A;  1CJK B;  3CCT A;  3EVO A;  3MZI A;  5H9E J;  3VF0 B;  1VI7 A;  1GMU A;  3DYA B;  1N36 F;  1JLA A;  1ZOT A;  2X51 A;  3JS9 A;  1YHQ S;  4N77 A;  3SCI E;  2WSF C;  1UA1 A;  2F4F A;  1XTZ A;  3UI3 A;  2UVW A;  4LR9 A;  4WXW A;  2P9C A;  4ED0 A;  3W9I A;  4F02 A;  2J6T A;  5CAA A;  1PAU B;  5SUH A;  1PC4 A;  2LMI A;  2G9O A;  5DDQ C;  3OV7 A;  5EUH A;  1UWB A;  3H8Y A;  4CNZ A;  4YUD A;  4CRJ A;  4EGL A;  1FTC A;  1QTM A;  2J7W A;  4P52 A;  4WFX A;  2J9C A;  3KNG A;  2CQB A;  2CPE A;  4XPE A;  2WON B;  4ZP8 A;  1TKX A;  2ZKT A;  5IS2 A;  2UUC J;  2E5J A;  3R2D J;  2DJW A;  4OV6 A;  4KBI A;  3UQS A;  2K1R A;  1MU2 B;  2VG6 B;  1S6O A;  5K14 A;  2JVR A;  3GP9 A;  2LQ9 A;  3FDS A;  2GVZ B;  7AT1 B;  1TK0 A;  3J7A 1;  4KV8 A;  4C8L A;  1V3S A;  3CJ8 A;  4TY8 B;  3L7P A;  2YNF B;  3C6U A;  1RCX B;  4DV1 J;  2QA2 A;  1FD8 A;  4C7Q A;  2JJ4 D;  1T9Y A;  3J80 U;  2DHX A;  4C3M A;  2GHP A;  4PG5 A;  4HTI A;  1FHT A;  1D8Y A;  2HGL A;  3W2W A;  4DL0 C;  4WE1 B;  2HWH A;  4PG8 A;  4CTA A;  3UVJ A;  4QYZ K;  4IYQ A;  1FO1 A;  4IFV A;  3CIZ A;  2Y3Y A;  3MED B;  4FXV A;  1QY7 A;  2LEA A;  4ECQ A;  1MW7 A;  3QGI A;  1DTQ A;  3ET6 A;  1WKJ A;  4WWS A;  3QAU A;  2DK2 A;  3T1H J;  1KLM B;  5EWG A;  5HMX A;  5B08 A;  1T95 A;  4PXB A;  2MQQ A;  1LV5 A;  5A76 A;  3ZZ0 A;  1PG5 B;  4U8Y A;  1MSW D;  3M9O B;  1HQE B;  4CCH A;  4RWX A;  4OZ3 A;  3IA0 A;  1NDC A;  4KKO B;  1H74 A;  2V6A A;  2AEJ A;  4H4M B;  5A6W A;  2AJ0 A;  1EAY C;  4CH0 S;  2CNL B;  2LYV A;  4CH7 A;  4BDP A;  2WB4 A;  4RKU C;  4PKD B;  2C3O A;  3CDU A;  4EBD A;  4JV5 F;  3I0S A;  2KVI A;  3MR2 A;  1S1T A;  2JVO A;  1TAQ A;  2KDO A;  1S0V A;  5JMN A;  3TAN A;  3C46 A;  1FDB A;  5M2P A;  2RQM A;  2ACM A;  4KQZ A;  4LF9 F;  1LWE A;  3N6N A;  4RW6 A;  2I5J B;  2ROG A;  1U1R A;  4DSI A;  4K4S A;  2LQ5 A;  1KQF B;  4DV3 F;  5MLC V;  1IVZ A;  2PI5 A;  2E1P A;  2D9P A;  3NGS A;  4LFA J;  3M1V B;  2SXL A;  4FYY B;  4ILR A;  5HP1 B;  3CTR A;  4DUT A;  2DXD A;  1Q7Y T;  3UPF A;  2Q79 A;  4OHX A;  3KK1 B;  3N28 A;  3A3O B;  3PTW A;  3UDE A;  4K4W A;  1KD1 T;  2BW2 A;  3HVW A;  2YWK A;  3VAK A;  1SXL A;  2BJ3 A;  4MKA A;  2VG7 A;  5DG7 A;  1K0V A;  2KN4 A;  3CME S;  4I7F B;  3VR1 A;  1RYS A;  2OEK A;  3IO1 A;  4DX6 A;  3IG1 B;  4PEO A;  4I6W A;  1FKP A;  3ILJ A;  3MAH A;  4EBE A;  3VGV A;  3QT7 A;  1P27 B;  1RT6 A;  3FFI B;  2BOP A;  4I0W A;  3PHT A;  5DQG A;  5GAG I;  1PO6 A;  1QD1 A;  2RT3 A;  2A18 A;  2HNY B;  2W8L A;  3K89 A;  2BQR A;  3OT9 A;  3U27 A;  5G4D A;  1VQ5 S;  1W7W A;  1CC8 A;  3GIR A;  4EMD A;  1W2B R;  3S6E A;  5KT6 A;  5A0Y B;  1S1V B;  4KH1 B;  4NOH A;  1SVD A;  3I82 A;  4OX8 A;  2Z4P A;  1NSA A;  5CYM A;  3MD1 A;  4JI6 J;  4OHW A;  2IHR 1;  1TL1 A;  4YS2 A;  1D9F A;  2BA9 A;  3IR5 B;  2H3E B;  4XIU A;  1VCT A;  4N8N A;  2LLZ A;  2MKS A;  2KRR A;  3NOC A;  5L1J A;  4J9O A;  5L8R C;  3JTP A;  3M8R A;  3MFI A;  1X0P A;  4LVN P;  1TU0 B;  4DI6 A;  3U1L A;  4J5O A;  3JSB A;  1XR7 A;  3NCR A;  4DR1 F;  1B7F A;  2AQ4 A;  4QR0 A;  3BR8 A;  5J1E B;  4B3M F;  2ILZ A;  4G6V B;  4KFB B;  3TZW A;  1WF2 A;  1RAO A;  2I1R A;  3NNA A;  4FNI A;  1MNE A;  2YWH A;  1WF1 A;  3FMW A;  5D3G A;  2GV1 A;  4ED6 A;  3PO5 A;  3OLA A;  4XPC A;  2FLP A;  2W7P A;  3E01 B;  1HI0 P;  4QCL A;  1YQH A;  2MLY A;  1XBW A;  2KYZ A;  4UST A;  2ALY B;  2D9O A;  2FYX A;  3HVT A;  1OWX A;  3V6K A;  1S9G A;  4B9M A;  2VHG A;  3MPW A;  1AT1 B;  2MDA A;  3RR8 A;  3SCJ E;  1QTN B;  2UZA A;  4PYA A;  2C2O B;  3T1Y J;  3JTO A;  2N3L A;  2RDJ A;  4ICL A;  1IKV B;  1UWB B;  1WOR A;  1YVF A;  5ETP A;  5F8H A;  3Q8U A;  3A3N B;  3SCL E;  1DAR A;  1I94 J;  2JZ5 A;  4G3I A;  1TKX B;  5EN1 A;  1IR2 A;  1H2V Z;  2ZOM A;  3VAI A;  1RAD B;  2BBE A;  1HWK A;  2NSC A;  2K1R B;  3N9U C;  5HVG A;  5HSP A;  3FZ2 A;  5K14 B;  4O3P A;  1VBK A;  2F7V A;  1HNX J;  1VQK S;  1UW4 A;  4NLP A;  4ZP9 A;  3TRG A;  3OL6 A;  4X2B A;  3M30 B;  4TYA A;  3N6L A;  1KHW A;  2WBR A;  1HNW J;  2ZH3 A;  2PFF B;  1L3T A;  4RW7 A;  2L9W A;  4OYX A;  1S77 D;  2RQ4 A;  5IZH A;  1Q8K A;  2JEG A;  1FNM A;  5B0E A;  3OTD A;  2C2N A;  1CG2 A;  2EW9 A;  5C2G A;  2VKZ G;  3BH7 B;  5ETQ A;  3UVJ B;  4IFV B;  1FRM A;  2MKY A;  3LQV A;  3GB0 A;  2KFZ A;  3MPV A;  4QWE A;  2DGS A;  1DTQ B;  2BJ9 A;  2XMU A;  4ZP6 A;  2FVC A;  4P2S A;  4KPY A;  2X3D A;  4DL5 A;  2C22 A;  5M2R A;  3TJ8 A;  3KLF A;  1YDL A;  2BAN A;  4FVM A;  4CLP A;  4RNM A;  1TL4 A;  5KFM A;  2FJB B;  1YJW S;  1WI8 A;  4PWW A;  3CCV S;  1RWP B;  2R7X A;  2RUG A;  3Q83 A;  4LSN A;  2E7V A;  2O66 A;  2EG1 A;  1RBO B;  3TAQ A;  1H7W A;  2Z58 B;  4P7T A;  3I9V 9;  4ZIT A;  4M5N A;  1IUJ A;  1S1W A;  3J7Z 5;  1GEH A;  2C2M B;  1JLE A;  3EZU A;  2XZW A;  2C28 A;  4ZK7 M;  3I0S B;  1RHK B;  4KT0 C;  3DMJ B;  4WFA Q;  1QVG R;  2A10 A;  2KRB A;  3D6M B;  3G8S A;  1YBT A;  3AOC A;  4Y2C A;  3OR2 A;  4AND A;  1Y9O A;  3BZQ A;  4AL6 A;  4WU3 A;  4LQ9 A;  1UVJ A;  4RW6 B;  2B8Q A;  5J1P A;  1TV6 A;  2A6M A;  3J81 Y;  1FT8 A;  1L5U A;  3BDP A;  1HBU A;  1VMB A;  3NKY A;  5HJY A;  1TL5 A;  1LWC A;  3RYL A;  4DSL A;  4IQX A;  1J27 A;  1WC1 A;  1S1U A;  1Q86 T;  4JI0 F;  4LF8 F;  3GFX A;  4D3G A;  4DCJ B;  1ZM3 A;  1H73 A;  2I38 A;  4EFA C;  3W63 A;  1UEV A;  3NLC A;  2K06 A;  3GJR B;  2B5J A;  2L3M A;  2BRK A;  2BQU A;  5KFX A;  2YX4 A;  2VG7 B;  2M8D B;  2QA1 A;  1S12 A;  3A1Y G;  2FLN A;  3GON A;  4IG3 A;  2V2Z A;  3PFE A;  4ZP7 A;  1QSY A;  5BYQ A;  1FKP B;  4RW4 B;  1RT6 B;  5ADZ A;  3MEG A;  2AGO A;  2ZH2 A;  1IBL J;  1RWX B;  3QSY B;  1VC6 A;  2UXB F;  3SSS A;  4QQB A;  1U6F A;  1UMJ A;  2QEX S;  2P2C B;  2GO8 A;  2MY7 A;  2R7R A;  4IRC A;  2IVF B;  2DKO B;  1RLC L;  2WOM B;  2MKK A;  4JYA F;  1LK5 A;  2G13 A;  3H5Y A;  2WK4 A;  3DDN A;  4ED3 A;  4X64 J;  3RTV A;  3KHR A;  2V68 A;  3T9Z A;  5C42 A;  3PV8 A;  4E0D A;  3W9J A;  2OTL S;  1UPP A;  5CYM B;  4I1T A;  3HT3 A;  4X66 F;  1GAO A;  1WF0 A;  4TLQ A;  2BOA A;  1B0T A;  2CPI A;  2LQ8 A;  2X1B A;  4WKR A;  1WDD A;  3QMQ A;  3GG1 A;  1YJV A;  3ZTR A;  2AJ2 A;  2XQC A;  3D6H B;  3F0N A;  4KAI A;  4F4W A;  3Q8P B;  1S99 A;  4U9R A;  1OYE A;  1NM2 A;  2JFK A;  1H7X A;  1M1G A;  1W26 A;  2ZH1 A;  4CWB A;  1LWF A;  3DRX A;  5IV4 A;  2KHD A;  2HS4 A;  3W64 A;  5D3G B;  2OFH X;  1VQY A;  4TXS A;  1JJC B;  3ISZ A;  5BJR A;  2ZHB A;  2LP4 A;  2KKH A;  5F0W A;  1DAX A;  4IFY B;  3BGR A;  5MAO A;  1LWX A;  1OPZ A;  3HSJ A;  3MD3 A;  3MTJ A;  5LL6 d;  3VTI A;  4TU7 A;  2HWI A;  4KGZ B;  2YNH B;  5RUB A;  3SQG A;  1B70 B;  4ICL B;  1IBM J;  3Q8R B;  4DSE A;  3ZC4 A;  4OI1 A;  1N34 J;  1HFE L;  3ENA A;  2FJE B;  5D4N A;  1IR0 A;  1KLN A;  1NJX A;  2CNO B;  1MWQ A;  2CPJ A;  2V8V A;  3WC2 A;  3DOL A;  1RXO B;  2QL7 B;  1CVJ A;  2HQD A;  2JC0 A;  1RT5 A;  2YNG A;  3D54 A;  3BPS P;  2BMB A;  2CQH A;  4JV1 A;  4O3N A;  4BWJ A;  2FB0 A;  2V9W A;  2HNZ A;  3KK3 A;  2C3P A;  2AJQ A;  2VQF J;  2HLU A;  4KTQ A;  2HMI A;  4RW7 B;  4N8O A;  2CAD A;  4ECY A;  4BBY A;  4FDF A;  5AXM A;  1HBM A;  5KFP A;  2R8I A;  4OYW A;  5HAN A;  2XY5 A;  4CLL A;  5HRO B;  5DET A;  4A47 A;  4KRW A;  3Q8V A;  3DU5 A;  2PEB A;  2JLG A;  2NCK L;  3D1H A;  1UJ6 A;  1E6V B;  4A8F A;  2UXD F;  3IWL A;  3WX8 A;  4FS1 A;  1GMW A;  3N01 A;  3TR5 A;  4U7U K;  4MJK A;  1B64 A;  3BQ1 A;  4HHH A;  1XWL A;  2KZZ A;  2GZO A;  3VGU A;  2C3U A;  2G0J A;  3RBZ A;  4DPT A;  1Q95 G;  2X3G A;  4LF5 J;  3AOA A;  4LSN B;  2LDI A;  2YKM B;  4BLG A;  4JI3 F;  3T19 A;  5FLX U;  4CNY A;  2PI4 A;  2KU7 A;  4C8M A;  2DHG A;  4URS A;  3MDF A;  2A1B A;  4QWD A;  3UN2 A;  3MOJ B;  3LAN A;  3ZZR A;  2AYB A;  5B09 A;  2VZ9 A;  3KHG A;  3PRB A;  3LPY A;  1JKH A;  1JB0 C;  1HA1 A;  5GAE U;  2XO7 A;  3J7Z T;  1Y0H A;  3AOB A;  1VQ7 S;  3KLE A;  1KON A;  4DUY F;  1V3R A;  1JXV A;  2AKW B;  1RA7 A;  3D3B J;  1RAI B;  4NLU A;  2MEW A;  3RB0 A;  2ZNY A;  4XTT A;  2FJX A;  1NJI T;  3OBI A;  2HHW A;  3RZA A;  1D9D A;  1TV6 B;  4ED5 A;  3GR1 A;  3D9B A;  5KG6 A;  2DY1 A;  3LUY A;  1HBU B;  2MZR A;  2CKW A;  5K8P A;  4OZ2 A;  3TUP A;  4OJ1 A;  1HQ2 A;  4U7U D;  4QOT A;  2XMW A;  1O8B A;  4H4O A;  2MKC A;  4ILM A;  1U45 A;  2B5J B;  1TEL A;  2XNQ A;  1IQT A;  1S6P B;  3DHX A;  2OIH A;  1U2R A;  2AEF A;  2DHH A;  1XMO J;  1YSJ A;  3AQP A;  3TNV A;  2NUU G;  2HBQ B;  3H98 A;  1N36 J;  2DT9 A;  3M6W A;  1OIA A;  4OIX A;  4C9D A;  5I3U A;  3CWJ A;  5GVQ A;  1LEO A;  4ZS6 A;  3OTE A;  3LF0 A;  2OFG X;  1ZZN A;  2ZH7 A;  4LT6 A;  3RB3 A;  1GT8 A;  3EVM A;  2WB1 D;  3O44 A;  2V2V A;  3V4M A;  4RNN A;  2DPI A;  4GKK F;  2CWK A;  3TX0 A;  1S0M A;  2RE1 A;  1KFD A;  3ONQ A;  5KFU A;  3AD7 C;  4QR2 A;  2DGV A;  3KLG A;  1SUQ A;  2H54 B;  5L39 A;  4V19 J;  2DBB A;  4B3S F;  3VZH A;  5HLF A;  4TKT A;  1WAC A;  3EDR B;  4NL5 A;  2V50 A;  2L08 A;  4B3R F;  1TL7 A;  2DRB A;  2LXU A;  4QBU A;  3NAI A;  2B0G A;  4JI1 F;  4M5M A;  3MHY A;  3LP0 B;  2KI2 A;  2DB1 A;  4USU A;  2KFY A;  2BX6 A;  1BLU A;  4DG1 B;  3M05 A;  1VBX A;  3J7Y I;  2P6S A;  4Q0B A;  2HAI A;  1UVK A;  1VFJ A;  2KH9 A;  2WVB A;  4RU9 A;  3QRP A;  4F26 A;  1R89 A;  2LXF A;  3DLE A;  1TTH B;  1LWF B;  3BS9 A;  4DR6 J;  3V81 A;  3ISN C;  2HEK A;  2W8K A;  2ADB A;  4CT8 A;  4L73 A;  3DDK A;  1GTH A;  1FWK A;  1YIT S;  2DNM A;  2XYG B;  1UZD A;  2NPF A;  5KFA A;  5ETK A;  2VON A;  3A3P B;  4XAK A;  4YOE A;  1R8H A;  2B9E A;  5AJ3 F;  3BGR B;  2EWH A;  2UUW A;  4DV7 F;  3KKF A;  2DR8 A;  1T11 A;  1H2U X;  1R7I A;  8ATC B;  4QWC A;  4ZLL A;  2RH3 A;  1S79 A;  3SQG B;  4DS4 A;  3RB6 A;  1B99 A;  1P9Y A;  3H59 A;  4K4Y A;  1TP7 A;  4XDD A;  3TJ9 A;  1U0S A;  4U95 A;  2E9Z A;  1PJ6 A;  4C48 A;  4JI2 J;  1G4C A;  3HHL B;  1Y10 A;  4LF6 J;  3DOL B;  1HAR A;  1V5I B;  4YDX A;  2E9R X;  1RT5 B;  2GIR A;  2QLF B;  3PKM A;  1FRI A;  4JV5 J;  4P73 A;  2RJZ A;  1OY8 A;  1AUS L;  4KPC A;  4NZ7 A;  2EFO A;  1CJV B;  4ETX A;  2HNZ B;  2LEB A;  4ER8 A;  4V19 X;  5F9L A;  1M5V C;  4ZJO A;  3QSI A;  1HKA A;  5A8R A;  2HMI B;  1RAB B;  1HBM B;  2VPX B;  1SL2 A;  3PKY A;  4DV3 J;  2BJ1 A;  3SQO P;  4OMF G;  2NYI A;  4GO5 X;  2HND A;  5LJ3 Y;  4CQ1 A;  1BHN A;  1Q16 B;  2HGN A;  3QT8 A;  4UTG A;  2K8G A;  2W24 A;  4XDC A;  4HAC B;  3F41 A;  5HL7 Q;  2V4Q A;  3MCN A;  5DQI A;  1R0A A;  4A8S A;  1KP6 A;  1P9Q C;  3BSA A;  3D68 A;  2QIF A;  3CJ2 A;  2UUT A;  4J90 A;  3QGG A;  5B0A A;  2D69 A;  4QR1 A;  4A8M P;  1YTY A;  4UQG A;  4KGX B;  4NLT A;  2DNP A;  2MZS A;  1NHV A;  3HSZ A;  2GQC A;  1DQ8 A;  4QIE A;  5KFB A;  4C6A A;  3D0G E;  2DNQ A;  2XEX A;  3MR7 A;  1RAF B;  3MI7 X;  3IAS 9;  2XHW A;  2BEF A;  5DZ6 A;  2MQM A;  1M0S A;  1X5T A;  5GAH I;  1KSP A;  4OHV A;  1G1X A;  2HLT A;  1C0T A;  4ELU A;  2Q66 A;  3MMC B;  4ENO A;  3IXQ A;  1NJW A;  3W66 A;  3R5D A;  2V5H G;  3KUH A;  3UNY A;  4HHJ A;  4JI7 F;  1FEH A;  5J2P A;  5BXI A;  3E8O A;  4CO0 A;  2DXE A;  5DG9 A;  2G2Y A;  3SDE A;  2FTR A;  3G6Y A;  3KLE B;  5BYS A;  3B6B A;  4EZ6 A;  1UTA A;  2DY9 A;  2ZH6 A;  2F65 A;  2R7T A;  4CM0 A;  1S6U A;  4K2J A;  1BGX T;  1G7C B;  1U6Z A;  2PMH A;  1IM6 A;  2A2D A;  1K9M T;  1EHW A;  1CQM A;  2U1A A;  2MQP A;  2IDL A;  2R2U A;  1LK7 A;  2MB0 B;  5F8I A;  5H9F K;  5D77 A;  4OV1 A;  4DR7 F;  2W01 A;  4GC7 A;  3IS9 A;  3FVY A;  2ZNZ A;  4DPO A;  4H4O B;  3A8K A;  2HSE B;  3G8Q A;  4OYP A;  3R1L A;  5F8M A;  2ZJP Q;  3L4B C;  2VIC A;  3J81 j;  4O4G B;  4O44 A;  2XWY A;  2DEI A;  1DBD A;  2D7S A;  4F50 A;  4MIB A;  3CCL S;  5FJ4 A;  1IBK J;  5C24 A;  4YY3 J;  1YI2 S;  3D6T B;  1H3D A;  3OHB A;  1XMB A;  3PJW A;  4D3H A;  3R8Y A;  4NX9 A;  4J9S A;  3WX4 A;  4DDF A;  2DCL A;  2W2Q P;  4W98 A;  4BCA A;  4IOA Q;  1SL0 A;  2Q6B A;  2DIS A;  2GX8 A;  4CLK A;  3MPD A;  1S57 A;  4TQS A;  1FKO A;  2CJQ A;  1PYO B;  1VR6 A;  1N5S A;  5ETM A;  3NAH A;  5GMK a;  2Y1J A;  5HQM A;  3OUY A;  3ZO7 A;  4R0E A;  2VUG A;  4RX6 A;  2R7O A;  2V9K A;  1HI1 A;  2YNI A;  4KGM A;  2OPR B;  3DRR B;  4WBF A;  3KJV B;  3LP2 A;  1WEY A;  3W65 A;  3LWL A;  3JQK A;  3DRY A;  1Q82 T;  4KGV B;  1WD6 A;  4OX9 F;  1S9E A;  1UEU A;  2ZOF A;  4MKY A;  1P1L A;  2E1M C;  4ZPW R;  3GSI A;  3CJ5 A;  1GH8 A;  2AEM A;  3DLE B;  4DR3 F;  3W7B A;  2M2B A;  1NHU A;  1VDH A;  2EBG A;  3OTO J;  2MQN A;  1A6L A;  4OZ0 A;  4OJH A;  2ALZ A;  5LOQ A;  1URN A;  3WDO A;  3ENV A;  1WUU A;  5D6G A;  1HD0 A;  1UWA A;  3G8T A;  1QDU B;  3H0P A;  3R5A A;  1FXD A;  5A2Q Y;  2LVW A;  1CS4 A;  3BGF A;  1YWX A;  2BM1 A;  5ETR A;  2BR0 A;  2V2Q A;  4DMZ A;  4KGK A;  1TKZ A;  3FBF A;  4RL1 A;  3D4J A;  5KFD A;  4J9N A;  2IMO A;  3BRE A;  1ITP A;  2KXH A;  1R6V A;  4AL5 A;  2F8H A;  3UD3 P;  4MFB A;  2M5Y A;  2IM0 A;  3DOM A;  4Y34 A;  4NCG A;  5D0E A;  5D0G A;  4Q45 A;  2NXU A;  5T41 A;  3LGN A;  1Z1Z A;  2VFT A;  2L41 A;  1O6X A;  1Q5V A;  4OI0 A;  3MM9 B;  1T3O A;  3T5K A;  1C0U A;  1AZS A;  3R5G A;  1HYS A;  4BHQ A;  1ZM4 A;  4YFU A;  4DR5 F;  3RR7 A;  4P71 A;  1KOO A;  3DLG A;  4RW8 A;  3QZ8 A;  3VVU A;  1S49 A;  5KFF A;  5LSL A;  5A8R B;  3OSN A;  1F5C A;  3L9Z A;  1FES A;  3I31 A;  3M2U B;  3KG0 A;  3TVY A;  1Q1K A;  3GLJ A; 
#chains in the Genus database with same CATH homology
 3D6M B;  4DCO B;  3R7S B;  1F9E B;  1QDU B;  2QL5 B;  4LSZ B;  2XZT B;  1RHQ B;  3R6L B;  1RHU B;  2CJY B;  2CJX B;  2H4W B;  1RWX B;  2XYH B;  2HBR B;  1QTN B;  5K20 B;  3KJQ B;  3R7N B;  2C2O B;  2CDR B;  2HBQ B;  2XZD B;  1RWW B;  2QL9 B;  2QLF B;  2P2C B;  4ZVT B;  5IC6 B;  2FQQ B;  1SC3 B;  3R5J B;  2C2Z B;  1RE1 B;  3EDQ B;  3NS7 B;  3SIP B;  2DKO B;  1I3O B;  1GFW B;  3D6F B;  2C1E B;  2H48 B;  2HBY B;  1BMQ B;  3P45 B;  2CNL B;  3GJT B;  2CNN B;  3IBF B;  1IBC B;  4DCJ B;  2XYG B;  3GJQ B;  3KJF B;  1RWP B;  3KJN B;  3GJR B;  4ZVO B;  1RWM B;  2Y0B B;  2H54 B;  1RHR B;  1SC1 B;  2H5J B;  2CNK B;  2H65 B;  4ZVS B;  1RWK B;  4ZVP B;  2XYP B;  3GJS B;  3R7B B;  2CNO B;  1PAU B;  3IBC B;  4ZVU B;  3EDR B;  2Y1L B;  3P4U B;  2H4Y B;  1ICE B;  1RWO B;  4JB8 B;  4DCP B;  3D6H B;  1SC4 B;  2H5I B;  3RJM B;  2QL7 B;  2C2K B;  4ZVQ B;  2C2M B;  1I51 B;  1PYO B;  2QLJ B;  1RWN B;  1NME B;  1RHM B;  1RHJ B;  3R6G B;  1RHK B;  4ZVR B;  1RWV B;  2HBZ B;  2H51 B;  2QLB B;  5IC4 B;  3QNW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...