5IC4B

Crystal structure of caspase-3 deve peptide complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3 subunit p17
total genus 16
structure length 92
sequence length 92
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 5ic4B00
2DKOB 4ZVOB 1QDUB 2H54B 3D6FB 3NS7B 1RWMB 1SC4B 1RWNB 4ZVTB 3KJNB 2CJXB 1BMQB 3GJTB 2HBRB 3EDQB 2C1EB 2QL5B 3R7NB 1RHQB 5IC6B 3GJSB 2H51B 2QLFB 2QLJB 2H4YB 2C2KB 1RWPB 2XZTB 3IBFB 1QTNB 2QL7B 2XYPB 1RHKB 1RHMB 4ZVRB 2CNOB 2H4WB 2CNLB 2HBQB 3KJFB 3R6GB 1SC3B 3GJRB 4ZVPB 1ICEB 3KJQB 2CNNB 2XYGB 2CJYB 3EDRB 1RWWB 4ZVSB 1I3OB 1RWOB 3D6MB 4JB8B 1PAUB 2FQQB 1RHRB 3P45B 2H5JB 1RE1B 2C2MB 2XYHB 2C2ZB 1RWKB 4ZVUB 1RHJB 2QL9B 1PYOB 4LSZB 2C2OB 2Y1LB 4DCOB 2Y0BB 3GJQB 2QLBB 3IBCB 3SIPB 1NMEB 1GFWB 4ZVQB 2CDRB 1IBCB 1RWVB 2HBYB 4DCPB 2XZDB 3R7SB 4DCJB 1I51B 1RHUB 5K20B 3R5JB 2CNKB 2H5IB 3QNWB 2H65B 3D6HB 5IC4B 2HBZB 3RJMB 3R6LB 3R7BB 2H48B 1F9EB 3P4UB 1RWXB 2P2CB 1SC1B
chains in the Genus database with same CATH superfamily
5HMYA 2ZH2A 3MPYA 4XK8C 4OYZA 3ZTSA 4PQUB 2IYGA 2FLNA 1WHXA 1U02A 3D6FB 3D3BJ 1HHSA 2HNDB 2GJ2A 3BKTA 1IKVB 3HFVA 3EVOA 1KLMB 3NMRA 3QAEA 3VZHA 1ITPA 2V2KA 4PXDA 3KKFA 3KJNB 1KQKA 3N01A 2GS8A 4YEAA 4ZPTR 3KXDA 3PX4A 3GONA 3K5LA 4CLTA 3LH2S 3NS5A 5D4OA 1U47A 1HPZA 3MR5A 1RJJA 1KWMA 4DPXA 4YB7A 2DR5A 3Q86A 2CRLA 4QPTA 2MKJA 4IO1A 4CM0A 2OPRB 3R3TA 1KHWA 2JFDA 1UPPA 3DMJB 2UUTA 2XY7A 4FF1A 2VC1A 2B5JA 1XR7A 2IAJB 3KLIA 1T03A 2MZSA 1U8WA 4KGMA 2DNHA 4NLDA 4IFVA 4IOAQ 1BGXT 2AEMA 2Z57B 2ZJPQ 3QRRA 2GV1A 3LTOA 1TL1A 1QY7A 4H4KC 4RWWA 1J2VA 2QO3A 2YBVA 1S9GB 4C9DA 5BYQA 4JI6F 2XWXA 2CJBA 2WHOA 3M6XA 1YJNS 3V4MA 2MQOA 3IMQJ 5E0OA 4EBDA 2AX1A 1SPBP 1X4DA 8ATCB 4NPOA 4HHHA 1U1KA 2N7YA 3FQKA 3HT3A 1YI2S 1VC6A 4TYBA 5KG2A 1QUPA 6FDRA 2LXUA 2DRDA 4B3TF 3DLKA 2GFFA 2B8QA 4ECRA 4C8LA 2UUBF 1FJGF 1KTVA 5L38A 3RW7A 5DDRC 1S0VA 3IBWA 2ZEJA 2IC3A 3LP2B 2GO8A 3UVJA 1Y11A 2R4FA 3EVMA 5FDLA 1JLEA 3PRBA 5KFJA 3HULA 4BC7A 3W60A 1EETB 1UMJA 4JI1F 4I4BA 2KDOA 3PW7A 1VJWA 1H72C 3CO9A 4N8NA 3U7JA 4D3HA 2F9JA 4TU9A 5HLFA 2BQ3A 1S48A 2DTJA 3THPA 4C0OC 2MJUA 3T41A 3TZYA 3PHEA 1HWIA 3HHKA 4NE9C 3TAQA 2V68A 2EK1A 2R2TA 2KM8C 3MDFA 2UUCF 2JHEA 4NXNF 1Z1ZA 2LXIA 2BQUA 2V8HA 1B0PA 5KFFA 1VQYA 1JLFA 3RTVA 4ZPVR 3NAHA 4ECUA 1KD1T 2VONA 2ILZA 1RP5A 2LDYA 2IFXA 2R7TA 1T3OA 2DXFA 2E1PA 4HLBA 2UUAJ 5C24A 2XMKA 4UZBA 1SKUB 2XMMA 1QAYA 3BGOP 4X2BA 1H7XA 3K89A 3TJ9A 3PR5B 2W25A 2ZBRA 2OPSB 1XNRF 3K0JA 1R6YA 3RAQA 3DN9A 3GFHA 3PO4A 2VDHA 4F2RA 5D77A 1ZM3A 1GFWB 1WEYA 1TKDA 4BS2A 4DV6J 3G96A 3ENWA 4HEA9 4P9SA 3UFCX 1FJ7A 3BB5A 1IKWB 1HI0P 1R31A 1U26A 1HR0F 3UI3A 1TFWA 5F8NA 2W2PP 4LF2A 3TW0A 3W7BA 4DCJB 2DGQA 2YNGB 4KY3A 3HHEA 5B0AA 3PW0A 4O3RA 1S59A 2RMLA 4DL6A 5GADU 3D54A 2Q66A 1F6TA 1NKCA 1KVJA 1RT7B 4LRAA 3V2UC 1YJ9S 2D3OR 3C16A 3HHLA 1NO8A 4LUBA 4ZA1A 4X4TA 2HFZA 2M8DB 1U6ZA 4R8UA 5CAAA 4KQZA 4FP9A 4MIAA 5KFKA 2N7CA 4F2SA 3VQSA 2PA3A 2R7WA 4NLRA 2LP4A 3BYPA 3JSMB 2J0QD 5CYQB 2LEPA 1BQMB 3DLBA 1WC3A 2I9SA 4E98A 5KT2A 2W8LA 3QQCD 2OELA 2XLJA 4DV1J 1X4AA 3FSYA 1H74A 2XMJA 1RU2A 1VISA 1SUQB 2XGQA 3MCSA 4H4OB 1RWMB 4J9VA 4NYZA 4XTTA 4B9MA 4JI5F 1REGX 2OD4A 3U1LA 4K2XA 4C3KA 3GTYX 4LF6J 4LFAF 2M0GB 2HVIA 1TKTB 3LQVA 2HHTA 3IR7B 4NEYA 3OHAA 2IJNA 3A12A 1BQNA 1DQAA 2EI5A 4YB5A 1V6HA 4KFBA 4B3SF 4M8LA 1VIOA 2HBRB 3EDQB 2WONB 1XN9A 1ZPWX 2XS2A 1NK7A 5H1SV 3QT5A 1XIQA 2F40A 2QGFB 2IIHA 3CCVS 4ELUA 4LFBJ 3BJYA 1APSA 3PFEA 1RAOA 2CQDA 3Q83A 2W9BB 2YNIA 2J9EA 3CGIA 1VQOS 2EK6A 1T05A 2JFKA 1RTHB 3DRXA 3QAUA 1RLCL 4C8NA 2C2KB 3FCVA 2WW4A 4DPUA 3DI6A 3F0NA 1JXLA 3TANA 3NP5A 4U67Q 2YKMB 1N5QA 1TAQA 3JS9A 2VF3A 3CJKA 2J6TA 1AZSA 3O5TB 2NPFA 2PFDA 2MEWA 4NLWA 2IHR1 1M5PC 3MFIA 1UJ5A 1HNZF 1SJ3P 4AT1B 3THVA 3UN5A 2MLZA 4G1PA 4DUTA 3M2UA 4LR7A 4OI1A 5IS2A 5JVGQ 5DGBA 4O4GB 1X9WA 1C1CB 1Q8BA 3W5YA 3KJFB 1RCXB 3PG9A 3TA2A 2VC0A 4USVA 4N47A 1ZA2B 2HZVA 3HSJA 2DR7A 4DU7A 1LQ9A 1Q4RA 2MZRA 3M30A 2BW2A 3RAMA 1HBUB 3R5DA 4OX9F 2OMOA 2LKZA 2KI2A 5F9LA 3OQ2A 3MOZA 5DO2A 1CC8A 1RWWB 1YWXA 3HVAA 4WKRA 5DLGA 4LF4F 1WC5A 1X7VA 1MN7A 2JLEA 2Q6BA 3H98A 2UXDF 3LP0B 2WTFA 1C0TB 1S1TB 4YOEA 5C2GA 5DZ7A 4ECVA 3L7UA 4HHJA 1C1BB 2W4CA 3B8HA 1IBLF 2OHDA 3TEGA 3JYTB 5HSPA 3UN2A 3P45B 4MKAA 5ETQA 4Z2XA 1TZ0A 2BE7D 3P5BP 1RT5A 4G1QA 5F8IA 3OHBA 4B3MJ 2ALYB 1R0AA 1RHJB 3G82B 3LAKA 4R25A 1RDRA 2HVZA 4FYXB 4X62J 1R43A 1FKPB 2DGVA 3V81A 3NMAA 5KFDA 1FRLA 3LAMA 5EGYA 2B8PA 1F2HA 4FPIA 4O44B 4QIVA 5HBMA 2HHHJ 2CQ1A 1TL7A 2YWGA 2FC9A 3IBCB 3Q8YA 4C8KA 4X4OA 2EW9A 3CPWR 1V3ZA 2GJFA 3PO5A 5A0YA 2D7SA 1SH0A 4PKDB 3SCJE 3Q22A 2HGLA 2EFGA 2RQ4A 5CYMA 1AROP 2DIUA 2XHWA 1KVKA 2QX0A 2ZVIA 3HVTA 4GMKA 4KC5A 3KK1B 1J5EJ 3UW1A 3VAKA 2G2ZA 1F5CA 3H59A 3KLFB 1M5OC 3I55S 4LREA 1HWLA 2EC2A 2OI2A 4X65F 1WC4A 4DR5F 4YR0A 1WKKA 2FGOA 3ISND 2E7WA 1KR4A 3ZTOA 1HMVA 1ZAWA 2M70A 2QG9B 4KGKA 4MK9A 2OH2A 3ET6A 4UOGA 3HVRA 1AFJA 3KG0A 5I42A 1ZTTA 4N41A 4FN5A 1F5BA 3W5XA 3AAWB 3UNGC 1F9EB 5C42B 3ULHA 4DV4F 3W5ZA 3BO3A 3NEKA 1SC1B 4O3OA 4J9KA 5IFMA 3PW2A 4LQ3A 3TARA 2MDAA 3UD4P 2RHQB 1F1BB 1Y5IB 2R7OA 5LSRA 4KSEB 3D5MA 4BBYA 4DV7F 2ERRA 4JI8F 2KZZA 1FKAF 2FVSA 5D15A 1LFPA 3AFGA 3GQCA 2CQ0A 4DDFA 4C11B 3GFZA 4JV5F 3MAAA 2X3GA 2V4QA 5I3UA 4LSLA 4P7TA 2YNFB 4UOCA 8RUCA 5F8JA 4W98A 2ZH9A 3MMAB 1IVZA 4OIXA 1TMMA 4I6WA 5JUMA 2WVFA 2VQEF 2I0XA 3AD8C 3R7NB 3P5TL 1JXVA 2J9CA 2HRYA 4NLUA 4RBTA 2B4VA 2C22A 5KFHA 4LVOP 3DFEA 4IH7A 4JOUA 1IR0A 2O67A 4RU2A 4JI3J 3BN4A 2DNMA 5ETOA 4DV2F 4PWDA 3QZ8A 3W2WA 1I94F 1HBNA 2NZ4A 3IN5A 1OSDA 1PO6A 3TA0A 4KHPJ 2ROEA 2EBEA 1CS4B 4LBHA 2YWWA 2VU5A 4XPCA 2MKCA 2FJVA 2BEFA 4USTA 1WI8A 3KHHA 2MZ1A 3SV3A 4LBPA 3NNHA 3A3OB 1X9SA 4F4KA 1FEEA 2FYXA 2OKQA 3HSGA 1DTTA 2YWFA 3UPFA 4EEYA 1Y3KA 1DHMA 2IBKA 4ZJOA 2CNLB 3DLHA 3HFZB 1Z2LA 3SEOA 3M05A 4EYHB 1CULB 1FK9A 4ICLA 1O8BA 3KLEA 1ICEB 3NGRA 1PC4A 1T7PA 3T6BA 4EYIB 4Y6IA 1OY8A 3BEGB 1K1QA 3LA0A 3M32A 1DJ0A 3EZUA 3GCXP 1DLOA 3BGFA 3GG1A 1IBMF 2IVFB 1MN9A 1QM9A 2W2QP 3UN3A 1QE1A 1NJZA 1J5OB 2HQDA 4LF9J 2C3MA 1LV5A 2VPXB 1TUGB 3MM7A 4FDFA 5KG3A 4DR7J 3TWZA 1AA1B 3OVBA 1RTDA 4B3OA 2ILYA 1GX5A 4URQU 1YRXA 5H9EK 1RHRB 1S1VA 3HHLC 4NI2A 4DF4A 2CQBA 1U1PA 4C3LA 1X5OA 5A6PA 2GVZA 4OV6A 1T8EA 3OV7A 4F0HA 4ED0A 2RUSA 1EP4A 2LQBA 3CXCR 5B0FA 1P1LA 2LDIA 5ETVA 3V6KA 3Q0AA 2FJAB 2R3VA 4ENOA 5KFBA 3ZTPA 2CXEA 3MEEB 4J9NA 2ABYA 4J9RA 4F4XA 3VF0B 2LEBA 3PHTA 4CWBA 1FVSA 2OLWA 2WK4A 3MZIA 4RNOA 4FS2A 4EU0A 3R97A 2QFIA 4ANCA 1SH2A 1B7YB 1IR2A 2J7UA 3VAMA 4ECWA 4JI4F 3C46A 2QIFA 3GYNA 5IXUA 3NRBA 4HR2A 2MZTA 4CP5A 5CZVA 5I3QA 5AE1A 2DYAA 1VBXA 4Y2IA 1G3OA 3MEKA 4HTIA 2G1HA 3FUYA 1WTFA 1N33J 4LT6A 2Z2LA 1X5SA 1FWKA 1GXUA 3T1YF 3R5JB 2OEKA 3DLGB 2KRBA 3FZBA 3NGUA 2WVCA 4I0WA 3HK2A 4K4UA 3BPSP 3RAXA 3HX9A 2IRYA 1BD6A 1UW9A 3DDIA 5J1EA 3N4WA 5F0WA 2MY8A 2A18A 3I0RB 2HRTA 1JLQA 4UUWA 5KFVA 1M5VC 1U1MA 5AXNA 2KRRA 2DGSA 1N6QA 1F2GA 4A8KA 4WFXA 5KG4A 1RBAA 2RAQA 3P4UB 3HZEA 4W4MA 5CABA 1RAIB 3KMSA 4Q2MA 4OI6A 3OTOF 3ZZZA 2VFUA 1S77D 4ZHRA 3BS9A 5ETLA 1H73A 2FTRA 1VQ9S 1NM2A 2W4DA 4PPZA 3L9ZA 4P6QA 5HVHA 5HROA 1R7IA 2J0XA 2VIHA 4CNYA 1QLNA 2D69A 3AD9C 4ES1A 3QZ7A 3T9ZA 5LT5A 2RNEA 5KFWA 4LBIA 3POTB 4HT5A 3AJ1A 4AD6A 4WFBQ 2AJQA 1FRKA 3GFYA 3HCXA 1ULRA 3MMCA 2HHQA 4LFAJ 1X4FA 3FMBA 2I1RA 3AY0A 3TAMB 5HMXA 4XIUA 5CZXA 3FJ2A 3CJ8A 3QIPA 1CJTA 1FDAA 1VQSA 3D0HE 1MLAA 1WEZA 3ISZA 3MM9A 4PXBA 4UUXA 3W1YC 3U27A 1WJ9A 3MM5A 4CT8A 2GQ2A 1T9WA 1MMNA 2WVEA 4OJ1A 1A6LA 1U24A 1WELA 3CE8A 5DQGA 2ZHAA 3PZPA 2ASJA 3X1LB 3I56S 1FRXA 2MLYA 2ZVSA 1BUXA 1Q5VA 1Q1KA 3VHQA 2GVDA 1Q5YA 1SIWB 2HHPA 2Z2MA 4WTYA 4HI2A 3TR5A 2L41A 2DPJA 3GIJA 3MR2A 3MPVA 1A7GE 1VOMA 3FKBA 3GR0A 1X4BA 3DHWC 3PJ9A 4QR0A 2DBBA 2BE9B 4L74A 2NSCA 3PX0A 1REVB 4KH1B 3DM2A 1IKXB 1QJHA 4FBUA 1FKOB 2ZOFA 3JTPA 4Q45A 1RHKB 2CPJA 1G6BA 4FVCA 3T5LA 5JJBA 3V6HA 3OLBA 2C42A 3HVTB 3GYGA 2HG4A 4ED4A 2BKOA 3E2EA 1EKSA 2MB0B 2SXLA 3NLCA 2DXEA 2P9EA 3EJMA 3GZ7A 1YJTA 4NEZA 3R8YA 1YBTA 3S8SA 2VV5A 3EX7B 1XNQJ 1H2TZ 4LF8F 1FWLA 4OX9J 1DBDA 3Q8VA 3ZZOA 1UEKA 2KYXA 3V81B 2M3DA 1LXNA 3MECA 4NOHA 4LSNA 4HL9A 1F3VA 4I1TA 3G6YA 1XMQJ 3FFIB 3G82A 3QJJA 3KK3B 2OMLA 1AW0A 1PG5B 3BSAA 3QYYA 4QYZJ 1S1WA 2UXDJ 1GH8A 2OO4A 4L6V3 4I2PA 1X60A 4IDKA 7FD1A 1NZAA 1H7WA 2EWHA 3GB0A 3PEJA 5IQQA 5T7LB 2NXJA 3L3CA 1ZTWA 1GXTA 2D41A 2WCXA 2B9XA 1N0UA 3H90A 2FJEB 3OFFA 1G1XA 2NUHA 2W24A 2ZBCA 2ZE2B 3QBCA 4QWEA 3NAIA 1VQPS 4DQIA 1CJVA 2GIRA 2Y1LB 1GQEA 3G2XA 2FPHX 2CIMA 2JLGA 1JJ4A 2L9NA 4DUYJ 5KFRA 1YLXA 1N52B 2XO7A 1UKUA 3CJ0A 5D4NA 2V2ZA 1K1SA 3KLHA 2YNHB 3AA9A 4DSLA 1HBUA 1RT6A 3B82A 3FDSA 5U47A 3UE2A 4FF4A 3D4JA 1TK5A 1JLCB 5DZ6A 4Y3CA 3I4PA 2FC8A 5L39A 2FJXA 1XTZA 2W1BA 4K0KF 1PBUA 5ETSA 2HBYB 2HW3A 4DX8H 4DV5J 4KPYA 3NNCA 3N79A 3W9HA 5ITHA 2F4FA 4YB1P 4DQSA 1XEZA 4TU8A 4KV8B 1RB0A 3I32A 3CWJA 4USIA 1JLCA 4JI5J 4OX7A 3DOKA 5KFUA 2YKMA 4PYDA 3RBEA 1RI7A 2WSFC 2WOMA 2NLWA 1WSRA 1CG2A 2YWHA 1V3RA 2XMTA 3GFXA 4ZKAA 2QFJA 1U1OA 2GNKA 2HMIA 3UDLA 4HKQA 4WK3A 2BJDA 1RT3B 3N6LA 1MW7A 3CJQA 1LXJA 3V4IA 2XQCA 2G13A 4L72B 4WFAQ 2W7PA 2R8KA 1U8SA 3C8YA 3CJTA 4DFKA 3TAPA 1W2BR 1N34J 4M1KA 4BHQA 2GMJA 1K9MT 1NUEA 2FJBB 3HJFA 1Q78A 1S1WB 1CJUA 5D3GB 3CCQS 2B3TB 3PIPQ 3H0PA 2LA6A 4R0JA 1WTBA 1OY6A 4NYPA 4USWA 3OXLA 5DS7A 2Y1JA 3OD2A 1V5IB 2RT3A 3MECB 1TK0A 4ED6A 4QU7A 3D6TB 1XMOF 2O66A 3PM9A 4ZCIA 3RRHA 1NB7A 2ZDPA 2HGMA 4OI3A 4QIGA 3F73A 1UVMA 1HNIA 3H25A 1G4CA 1C4CA 3MWBA 3OL9A 1NK9A 3JTOA 3MD1A 2M2BA 4Y2AA 2MQLA 4YY3J 2GHPA 4Q44A 3K59A 4DR6J 5J1NA 2D9PA 1S5ZA 1FNMA 1UEUA 1B70B 2HQGA 3C3LA 3H5SA 1EKRA 3N6NA 5K8MA 1IM6A 3F44A 4L76A 3BSOA 2W4PA 1JLBB 4U7UK 3CW2C 4I68A 4EUVA 2OEJA 3DM2B 4DR3J 2Y1IA 3H5XA 5FLXY 2OFHX 4RO0A 3G8SA 3M9MB 3WC2A 2RRNA 5J2NB 4HDGA 3VAHA 3V6JA 1TKZB 3NBPB 2VICA 2WAQD 2DT9A 1UFLA 2FIUA 2ZDOA 3Q8PB 1RTJA 2BDPA 2YQ3A 1U09A 3U02A 2A6OA 1RA6A 2MLXA 4ZJLA 1RTJB 1PYTA 1NJWA 3UDCA 2LLZA 4IRCA 4ZVPB 1N5VA 4I64A 4DQRA 2F4VF 4DPYA 5A8RB 1D1UA 3BQ0A 2K1RA 2VBZA 4DHVA 2CQIA 2WVBA 3QWUA 5B0GA 3WQPA 4DR2F 4NMLA 2FVQA 2KT3A 3AQPA 4Y2CA 5KFIA 1YJRA 3LGNA 1F60B 4I7FA 3CTRA 3B4DA 2LU2A 4ZLNA 3MFHA 1VR6A 4PG6A 3KWMA 3ETMA 4HVZA 5HANA 3ILIA 4CYUB 1GMWD 2V8GA 2IA6A 4NL5A 3O8WA 4K4XA 2APOA 4Y2KA 1HNWJ 3EGZA 4YHHJ 3J7AN 1VRQC 4DR7F 3KG4A 2PEHA 3CDEA 3GSDA 1O6XA 1VLYA 4CM2A 1Z2ZA 4PXEA 2BM0A 1ZPVA 5HLFB 3BGRA 2HZAA 5DDOC 4TY8B 3PR4A 4MK8A 4JI0F 1IBKJ 1IN0A 5KFSA 1NPKA 1UJ6A 3NCQA 4R5PB 5L9NA 4DUZJ 2QEXS 2MMYA 1FE0A 3E01B 1HARA 4P52A 1YBAA 1YQHA 3AXMA 2FDNA 4DL3A 1SL0A 4ECTA 1NK0A 3A8EA 2LQ5A 3D66A 4DN9A 3J7YI 2Z0GA 1SQEA 1U1RA 4PEOA 1WSVA 4K5SA 5D3GA 2GHWA 2ADCA 2NR0A 4GC6A 1RT1B 4RR5A 4F36A 2XLIA 1Y0HA 1S7IA 1B0VA 3J80Y 1C0UA 1D09B 1BLUA 1YG0A 4RKUC 4JYAF 2NZCA 4JI7F 2U2FA 2ATCB 1GEHA 2J0WA 1UETA 2CNKB 3D0GE 4WIIA 3PW5A 1N33F 1YZ7A 3S1TA 4M94A 3QNWB 5DM6Q 4QU6A 2GA7A 3CD0A 4YS2A 3CB4A 5E2QA 3H40A 1H6KX 5G0RB 2N82B 1FF2A 5IC4B 4OLOA 3DOKB 3UD5A 1IWAA 1S6OA 3OUYA 2ZJQQ 4CI0B 3PKYA 2V4JA 4KAIA 4BLGA 1MSWD 4X66F 3I5AA 1EP4B 4K50A 3DDNA 3DKDA 4MJKA 2JC0A 3VCDA 3DC2A 2OAUA 5CH7B 4IG3B 2YX4A 3AD7C 5IWAJ 1W26A 2DHAA 1VK3A 1TR0A 1UPMB 1W7WA 3C15B 1HNVB 2QJ3A 3CDAA 1Q0NA 3DHXA 4NLQA 4OYBA 4RNHA 2WVDA 4U96A 5G4DA 4ER8A 3LP1A 1S0OA 1TTHB 2YNHA 1Q81T 4CLZA 2CQCA 2F8EX 1KQGB 3MCOA 1FT8A 3KYLA 3MM7B 4A47A 1NCLA 2NXEA 4UOFA 1HWUA 3IRWP 2A2CA 2NXCA 5L1KA 2RE1A 1KEKA 2V5HG 2XB2D 3FBBA 1DLOB 2UUWA 4XDCA 1NJXA 1UA0A 2C1EB 5IT4A 3M32B 2ZNYA 1RHQB 4TU7A 2FHOB 2RQCA 1NEEA 2ASYA 3LALA 1HQUA 1T11A 3FZ2A 3T9NA 9RUBA 3KLEB 4USUA 5J2MB 1S72S 1JWWA 1CPZA 1GNKA 4U6PA 1TFYA 1BC6A 2OPQB 1PCAA 2FZGB 2QLFB 5F9NA 1WG4A 2H1YA 5SUHA 1MWYA 4X4QA 1NK8A 2V9KA 1C0UB 4KO0B 3CNQP 3I6PA 3M2VA 1RWPB 3CCMS 1CBKA 3P49B 4W90B 2XULA 4WYLA 4J91A 5J2PB 1RT1A 2HK2A 1VBKA 4KGZB 1EHWA 4OYMA 3SCLE 5A8WA 3J7ZT 3KNAA 3HD2A 3BKFA 3CMQA 3TQEA 3MUMP 1O5JA 4B9TA 4QW8A 1KNZA 4NRUA 4A46A 2L9DA 2QLWA 3JSRA 5HVGA 1IJFB 3OT9A 3ZC4A 3OTEA 5D0HA 2ZZNA 2PDAA 1MU2B 2GIQA 4TXSA 3GJRB 2KG1A 1RYSA 4HH0A 2VOPA 3E51A 3MF5A 5D78A 2ADBA 1WF0A 4QWBA 5HQMA 1NKBA 3SCIE 1H38A 1Q16B 4F50A 2XWYA 2YNFA 3QSYB 3NL0A 4ES3A 2IDEA 3ITHB 3QRQA 4CLLA 4F4YA 4P10A 2H9ZA 3MUVP 4P2SA 1YK9A 5F3TA 2KG0A 2LVWA 1XMQF 2BKNA 4B3RF 3NY0A 4YB6A 3V6DA 3VTIA 3R2DJ 1MNEA 1NHUA 1H98A 2XCAA 1JNRB 3SQOP 4J9LA 2OTJS 2BBEA 3QIPB 3Q23A 4CNZA 2N4CA 3BV8A 1GX6A 1HW9A 2KVQE 1R8BA 3MMCB 2HZCA 1BE4A 1FX4A 1N36J 4DL7A 5IV3A 3DYAB 1U0SA 1CJKB 2YKPA 2Z58B 4XO0A 2BXJA 4K8RA 2ZD1B 4WWSA 2BVZA 3OFEA 1UAWA 3ET6B 1NMEB 2ZH3A 1SL2A 1NH7A 1NB2A 1S6PB 3CDWA 2VASA 2AIRB 2O3DA 3ZZYA 4HH1A 2D3ZA 3H5YA 5MAOA 2HVHA 2M4MA 2ZBPA 2YKQA 3NGKA 3SQGB 2Q6CA 1N4LA 1FDBA 2R2UA 1WUUA 5HAOA 1UVNA 3Q2TC 1YJWS 1WKJA 1I51B 2E1AA 1VLOA 1N5YB 2R8IA 2V69A 2LYVA 5KOWA 2EFPA 2FJWA 4ITSA 4M5JA 4LF7J 1G7CB 1FVQA 1S9EB 1Q7YT 2IM3A 5LM7E 4JV2A 4WK1A 1QVGR 2IVYA 2A3JA 3C14A 3NWRA 5J1EB 2G2OA 2ZJRQ 4O3NA 5HBMB 2P8IA 5AXKA 2XSFA 3DCAA 3KUEA 1LNQA 3K5NA 4ZK7M 2B43A 2HAFA 1B3TA 1X0FA 3MPUB 2P2CB 4RNMA 2D74B 2OEMA 3HLUA 4OJHA 4QR1A 1H2VZ 1RAGB 3M8QB 4OV1A 4U8YA 4KTQA 3H4BA 3ONQA 3A1YG 2OPQA 5AJ3J 4NA1A 1CVJA 3OL6A 1CJUB 3CMAS 4WFZA 1S10A 1RCOB 3HXMA 1H0HB 1IQTA 3CUNA 2E9TA 4GKJF 5FJ4A 2WW8A 4KHMA 1T02A 2V8VA 1L3SA 3W3SA 4DOZA 4PWWA 4WKYA 2HMIB 2RSQA 4BWJA 2C2RA 5LOQA 2KFYA 1VK8A 2FHJD 3QT8A 4A8QA 4ZP9A 1T9UA 2GVZB 3TI0A 3I96A 4KHRA 2E5JA 1VQ8S 1JKHA 2JX2A 1S1VB 3IXQA 3CJSA 4NI2B 2ROPA 5KFXA 1Y10A 3TO8A 4KV8A 4ILLA 4IG3A 3PJXA 1WNEA 2LQ9A 4O4GA 3H42A 3W61A 3EPIA 4DI6A 4YY3F 2KU7A 1R8PA 1UP1A 4FPRA 3PRDA 5F3ZA 3HMJG 1QTNB 3AXKA 2HFSA 4QWCA 3QWPA 3W63A 3H2LA 3N28A 1JXEA 1N54B 2VQFF 3S6EA 4Y65A 1VCTA 2YPYA 1WD6A 4CCHA 2NYHA 4E0DA 1S1XB 1QUVA 2DR6A 4Z7YA 5C7PA 4LRDA 3BO2A 1CULA 1FK9B 2B7CB 3FBFA 2OPPB 5JVHQ 4C8YA 5KFAA 5LSOA 2W9CA 3MPDA 4ID5A 5D8HB 3JSBA 3OXGA 5EN1A 2I5JA 5B09A 2CJKA 2UVRA 1QAXA 1NHVA 1RU1A 1FJGJ 2DPIA 1HBMB 4OYOA 1SI9A 3PJWA 4TY9A 4AE5A 3BPDA 1FESA 3A8IA 4NLPA 4OYWA 4CTAB 1NK4A 2XCPA 3DLLQ 5E7OB 2VODA 4DQQA 4M5NA 1IQZA 4NWBA 1FHTA 1HBNB 1PBAA 3OXFA 5E41A 3E01A 4WFNQ 1P8GA 2RQKA 5BR8J 3M8SA 5DG7A 4MKYA 2K7JA 5M2RA 4UF4A 3TVZA 4G65A 4H4OA 3VAIA 4USHA 2BOAA 5HATA 1I6JA 5IOLA 3SBMA 4TQRA 1IUJA 3UCZP 3AOCA 4KKOB 2JWNA 1VHFA 1N56A 4MIWA 4B08A 3RR8A 2J7WA 1PYOB 3IFEA 3FBEA 4LSZB 1S9FA 4B3MF 2IVMA 4CLWA 2QC3A 1DFDA 1UL3A 5F8GA 2DGXA 2JVOA 4CYUA 2XM3A 4PCQA 3D68A 2CWXA 5HI7A 3C16B 3HHLB 4DUZF 3JSYA 4WU3A 3WIUA 3QSIA 1FKOA 5KG0A 2IMOA 4KB7A 3MM8B 4ED1A 2KXHA 9ATCB 2FJDB 1IBCB 4FVMA 1CQMA 1S6PA 2DH9A 2LMIA 2ZBQA 2YNGA 3N9UC 1PJ5A 3NGTA 5A8RA 3CC2S 4DV6F 3KDOA 3Q2SC 4CLKA 3T5KA 4X64J 1VQ5S 1RHUB 1EB0A 5K20B 3BR9A 1CJKA 1IKWA 3GIIA 2C2EA 1Q53A 3FEYB 1HR0J 1WOPA 5H9EJ 2RU9A 4JYAJ 1VS3A 2E44A 5KFZA 2VG5B 4JI7J 3PVXA 5IM0B 2XMUA 3QATA 1K47A 2HQ3A 2VFSA 2PA8D 3N5BA 1NHKL 4EFAC 2MXYA 3RR7A 2IA0A 2KKHA 2XSJA 2VJVA 1S76D 3I4HX 1YJUA 2JNJA 1WHWA 1WDTA 4OHWA 2J5AA 2VFRA 3TAMA 4DX7A 4YR3A 2UXCF 3RGIA 2ZC4A 3EWGA 2BW7A 2FUG9 2KO1A 4J90A 3TVKA 1R0BG 4MYUA 3IM9A 3WC0A 2Z30B 3FRYA 2V67A 4F25A 4ED5A 2KVIA 3NXZA 3POTA 3G8TA 3KK1A 2ZH6A 4OHYA 3T1HJ 1O0PA 1P6TA 1FI4A 1TL5A 1KN6A 4X66J 1RISA 4NCGA 1B0TA 3US5A 4F3MA 5A0YB 4PZVA 2F9DA 5IWAF 2HS4A 4ZVTB 4EMDA 4KGXB 4QIEA 5DDPC 3QGIA 3EGNA 3SSSA 2CJXB 4DV7J 3PDNA 2Z2YB 4JI8J 2MQMA 3PRVA 1BMQB 1MU2A 1PILA 3FVYA 3HM9A 2YX7A 1XWLA 2MKHA 3W9IA 4C6AA 4RUCA 3JTNA 1M1HA 1Y5LB 1H2UX 1L5UA 2YKOA 2OFGX 1VC5A 2H5EA 2QYCA 2IC3B 1JLQB 3L7OA 2R2SA 1T03B 1ELOA 1FFGB 3TNVA 2HWTA 1I1GA 2V94A 3JYTA 4DR2J 2OUGA 2F3JA 3BN7A 3EGWB 1S6UA 3FQLA 2QYGA 1S1TA 2UZAA 1HWJA 4CZCA 4R0EA 2VBXA 2Y8WA 2KJVA 4ZVEA 2DNPA 2OPPA 2DJWA 3BKUA 5BYSA 1HNXJ 1S0MA 4TNOA 5K8PA 1R89A 4P73A 4AFFA 2DXDA 3EGVA 2WOMB 4ZIWA 3C6UB 1S79A 2AEJA 1AUDA 1C4AA 2PI4A 3M30B 2B4PA 3M8PB 2R8HA 1Q86T 1ZM9A 2CJQA 4LR9A 2NUUG 5F0UA 4ZN3A 1U1LA 2DHXA 3PV8A 1D9FA 3FEXB 2W01A 4PXCA 2E1RA 4OZLA 1UW4A 3EDRB 4NCBA 4JI1J 3VGUA 2PN6A 1FJCA 1X4HA 3GPAA 4C8OA 4MAKA 3L4BC 5I3PA 1JKHB 5T14A 1NPPA 2C2DA 1CEZA 3C15A 2NYIA 3WHIA 1RT6B 3NWGA 5GAHU 3EMTA 2XI3A 3OBIA 1NSQA 4DL0C 1D8ZA 3X3UA 1FRHA 2I6WA 2K8GA 2V4JB 1Y7PA 1J5OA 3I0SA 1YITS 2UUCJ 1WOOA 2FQQB 1KLMA 2CJ9A 2DH8A 2RDDA 1JX4A 2HNDA 3IGNA 2H5JB 5FD1A 1B7FA 2EC0A 3Q24A 1RWKB 1VMBA 1X8DA 2VBWA 3S7RA 2HFVA 5G0RA 1E6VA 2UUAF 2QL9B 4Z7CA 3TEHB 2GMLA 1OYDA 3ZZTA 1VFJA 2E5LF 1TKTA 2NCKL 1U25A 3CD7A 1GT8A 4LSNB 2MZQA 3MMJA 3QPIA 1UVJA 2J9DA 1GAOA 4RX6A 1FEHA 4TKTA 2ZH5A 1U2CA 2VPWB 3E8OA 4DCPB 5KT3A 1LW2A 4CLUA 2QTWA 3CDUA 2MKSA 2GC8A 4DN0A 1DQ9A 4ZP8A 4FXDA 4O3QA 2QMWA 2YWKA 4CT9A 3EE3A 2DD8S 4PWDB 2IBOA 2H5IB 2HKEA 2MYFA 3QRPA 4QYZK 4QIFA 3C66A 2CQGA 4TY8A 3TVYA 3G6VA 5CYJA 2ASDA 4O0NA 3JAMY 2CPHA 1YTYA 1FA0A 3SQGA 2CYYA 2BOPA 1N5SA 4EGLA 3UD3P 3ILJA 1RADB 4OI4A 2UVVA 1GMUA 2RHSB 4UQTA 4HT7A 1RWUA 3H4DA 2QSWA 3P8BB 4PAAA 5I3UB 5K9FA 2WBMA 2ZOGA 3Q8QB 3R5CA 3NS6A 3RBZA 3LWLA 2YKNB 1NXIA 4RL1A 2HIYA 3SZ2A 2CQ4A 5HJYA 1XR5A 4D3GA 1XC9A 1WACA 3BDEA 3MM5B 3J81j 2Q3PA 5AJ3F 2XGPA 2QA4S 5K8NA 1M1KT 1TMJA 2FGCA 1CJTB 3FNNA 3L95X 4FNIA 5H9FJ 5KT4A 5KAKA 4B3SJ 5D0GA 2VJUA 4J9PA 3UCUP 1VI7A 3CDBA 3FCHA 2DNYA 5GAHI 4DR1F 4L73A 4ZCKA 4FZVA 4NASA 3GJTB 1URNA 3KFWX 2YKNA 2YXLA 4BWMA 3ITHA 2AYEA 3HVWA 3NBPA 4OZ5A 5DETA 4UY85 2DNRA 4K4VA 2HSEB 1FD8A 5LMNF 4M63A 2XO6A 2Y1RI 1XR6A 4JV0A 2COLA 4QWDA 1WEXA 3NG8A 1NDPA 3C2PA 2ZM6J 3T1HF 2R8GA 1CSJA 1FDDA 3IC1A 1JLBA 1ZAXA 3KOAA 3PEHA 1P1TA 4ZCMA 4N5SA 5ETRA 1P27B 3BBFA 1FXLA 2Y3YA 4OHXA 1KOHA 5HMZA 3HHNB 2KH9A 1KC8T 5B7WA 4S0MA 1K44A 1YZ6A 1JLEB 2VOOA 5LMUF 1DY3A 3EZOA 1EX8A 1SB6A 2QMUB 2RQMA 1HNIB 3D1OA 1JJ2R 1HA1A 2VQFJ 4DMZA 1WG5A 2DISA 2EVZA 1VQMS 3VAJA 2FY1A 3DLKB 1LK7A 3DGVA 1M5HA 3GIRA 4PG7A 5DJBA 5J2PA 1QTMA 3MM6A 1KONA 4P75A 2CVIA 2MQQA 2V2QA 3M2VB 4KRWA 2HK3A 3OJUA 3O3LA 2ZUAA 1R6VA 1VGYA 2BKPA 2E5HA 2GHVC 2POKA 2XG8A 3Q89A 5AXLA 3UO0A 5J2MA 2ZUGA 3QGPA 1HQUB 4KT0C 3SMZA 5ETMA 3N5FA 4DV3F 1NDLA 1RKJA 4OI0A 3KG1A 4ERDA 1X4GA 3M6VA 5D4PA 4FYVB 5HJXA 4DU8A 2MTLA 1FTRA 3NGSA 1BQXA 2IJRA 3V4IB 3CJ4A 2IAJA 2BUNA 3I9V9 3KLIB 5D6GA 2X51A 3I0SB 1RA7A 2B5JB 3U1MA 5EDWA 2YTCA 2AYBA 1NPRA 1P9YA 4NZ6A 4ZVUB 4B02A 2OPRA 3OFGA 3M9NB 2X1FA 5C5JA 3RW6A 3LP1B 5KG1A 1TKXB 3HKZD 4OMFG 1HPZB 3MMBB 3GJQB 1C1CA 2EG1A 4J5OA 3ZNJ1 2MGZA 2R7RA 1RTDB 3M2UB 2MZJA 3BH7B 1RACB 5A2QU 4ED8A 1SQFA 5B0CA 2CPEA 4V1Ak 3OLAA 4DUYF 3TZWA 4WPAA 1SJFA 2VG6A 3MHYA 3QLHA 4I6YA 1AZSB 4AQYF 4OZ2A 3OUYB 3M8PA 5I4MA 3HP6A 1N48A 3RYLA 3LWMA 1SJRA 1RWVB 2DNKA 1Y3JA 4M5KA 1FRMA 1N0VC 2H3EB 3R7SB 3AOAA 3K8VA 2OGUA 3MD3A 3MCMA 4ICLB 3UR0A 4K0KJ 1EQ0A 2RD5C 2XEXA 3DXSX 1CJVB 4FKXA 2KFNA 4DLGA 4PG4A 2H65B 2EFOA 3IG1B 3D6HB 3DRRA 4CO4A 2CA9A 4ZPCA 2DVIA 1OSCA 1V3SA 2HBZB 1LEOA 4DV4J 4ILMA 1LFWA 1OO0B 1WDDA 4NA2A 2CQ2A 2J8SA 2XNQA 3QMQA 3R6LB 2PEBA 4I2PB 4IDKB 5KT5A 3NOGA 2H48B 1PGZA 5GADI 2BJ9A 4F02A 1YRTA 2EEYA 1RBOB 2WB1D 3FFIA 3OL7A 4ZVOB 1S97A 2UXCJ 1T9VA 4RBVA 4NZ0A 4WP9A 2C28A 2Z56B 1HFEL 2R2RA 3HHLD 4KR0B 1RKIA 2X1GA 4LVNP 1XERA 5A8KB 2R9LA 4FYYB 2ALZA 2W7AA 2K3IA 2VPZB 2FZCB 1BQMA 3CJ3A 5E3QA 4QIWD 3VGVA 3HSDA 4X4NA 4ECQA 4M5MA 3VAFA 3GU0A 2VG7B 3G9CA 1SCJB 4HHUA 4LSLB 4JI3F 2DRAA 2VUGA 1CLFA 2GQQA 3GP9A 4ZVFA 5IC6B 3BREA 3ZTRA 4C11A 2C3PA 5THWA 2BM1A 3K5MA 3IR6B 1XMOJ 2CWKA 1I94J 2RUGA 3OTDA 1REVA 4ZCLA 2IJFA 4P2FA 3I82A 5CCLA 1JJHA 1Q8LA 5IZHA 1BWEA 1RQ0A 1ZM4A 2DH7A 3BBCA 4ELVA 1A0OB 4C3MA 4O0IA 2G0JA 2K1RB 1HQEB 4L75A 4U8VA 2MY7A 1ZBTA 5IM0A 1DQ8A 2R8JA 2VG5A 3IBFB 2AP6A 1LWEB 3G4SS 3RBXA 3PYDA 2KN4A 5GMEA 2GGPB 1R8CA 4GKKJ 4UQGA 1TKZA 4WF9Q 5DG8A 4RW8A 1RHMB 4ZVRB 2H4WB 5J2NA 2AYGA 4WFYA 1FWPA 3QO9B 4KIAA 1WF1A 2M88A 4A8OA 3QT7A 2MHEA 3H5UA 4WJBA 3O6QA 2R7QA 2VA3A 5LJ5Y 3F41A 4WYWA 1YKWA 2HURA 5HK4A 5AT1B 2XYGB 4DG1A 3A8KA 3JB9k 1UJ4A 2JSXA 2CJYB 1FJEB 4ES2A 1RAFB 4B3TJ 2HFNA 1W25A 1UVIA 1CC7A 2G0CA 2RIJA 2F4VJ 3M4XA 5AE3A 3PW4A 3JQJA 2XY6A 4IO9Q 4XAKA 2B9WA 1BXNA 4ZP6A 4ZLPA 4ZHRB 1LWXA 1TL7B 2BRKA 3D6MB 3FC9A 4ZIVA 4O44A 5HMWA 2OIHA 2UVWA 5EHHA 4C2MA 1PAUB 2F8HA 3T5JA 3R5BA 2MKKA 2HVDA 2CG8A 2NPIA 1HL6A 4QQBA 3L09A 4U95A 3W8GA 2V9WA 2C2MB 1NK5A 4LFCF 5EWGA 2Q1LA 4M5IA 1RT4B 2VH7A 4B9VA 2CAJA 3TJ8A 3MUTP 4WP3A 2E66A 4TQSA 1DTQB 4J9SA 4RNFA 3LW5C 4JI4J 2ZKUA 2M5YA 2RDJA 1OPIA 2O1PA 4I56A 4L3KA 2VFVA 2ZC3A 4DR4F 2A2DA 3G86A 4ID5B 2YQ0A 4F3QA 4EO6A 2I8EA 1Q82T 1RT3A 1RTZA 2BJ8A 3CO0P 3KHRA 1XNRJ 2ATLA 1MWZA 1HD1A 3Q8RB 4HDHA 4DJBA 3G6XA 3T1YJ 1S1XA 2JEIA 4RWXA 2DR8A 1VBYA 2ZITA 3GSIA 2F8MA 4F0MA 3NCPA 3CCJS 2BANA 2RILA 3QJLA 4IFVB 2RDIA 3ILOA 1JNZB 1LW0A 2CPFA 2MQPA 4DV5F 1X9MA 5KFEA 1DAXA 4Q7AA 1AT1B 2KXFA 2N3OA 4QW9A 1D8YA 1U0HA 2B4OA 1NDCA 1EAYC 1NU4A 3LGHA 2LCWA 2UV8A 1SQGA 1Z4UA 1GMWA 3CJ5A 1KQSR 4K5RA 2FVRA 3HZGA 3FK4A 1MWQA 3FSIA 1UWAA 4XDDA 3DI6B 3KMQA 1IWGA 4EZ9A 3KK2A 1RYRA 1RUSA 2PC6A 2HNZA 1ZOTA 3IM8A 3J81U 2QN6B 2ZE2A 2BR0A 3W62A 2BJ3A 2EXUA 2CQ3A 5F8LA 2BQRA 1L3TA 3GYXB 1TUWA 2HRUA 4KFBB 1PAEX 4P7VA 4J9QA 2KT5A 1T3NA 4LF6F 4W92B 1FNXH 5KFGA 2CPIA 3QJPA 3R5GA 3R1LA 4DR1J 1F5AA 1YGYA 2B9EA 1DTTB 3VALA 1TAUA 4OYXA 3IGVA 1JLGA 3HSZA 2ACMA 4M5HA 3TJAA 3UNYA 2GJIA 4ZLLA 3K5PA 2IY5B 1R3NA 2NXUA 3H2UB 2XMAA 5HN0A 1SJ1A 1AB8A 2YVSA 4N77A 4ZPBA 4PR6A 3WDOA 4C8MA 3W2WB 2DEIA 4JBCA 1J27A 3KJVB 2QMXA 3IR5B 3CVKA 1F0XA 2BRLA 3S01A 2UU9F 1Q7LB 1T9YA 4IG0B 2XYPB 3THTA 4UTGA 3VGSA 2VHGA 4OYAA 4QJVA 2LFVA 3I5CA 1ZAVA 4CO5A 3DGPA 1IKXA 4C0BA 4LF1A 3TZXA 2UUBJ 1OY9A 5C25A 4RW9B 1HNZJ 2GCFA 4DS5A 4EBCA 3MXHP 5DRKA 1XNQF 4ETZA 3ENQA 2ZD1A 5HL7Q 1N88A 3NOCA 4NLXA 1M5KC 3DYAA 2I2YA 2CZ9A 3GIMA 5IV4A 3JAMU 4NLGA 2O01C 1SKRA 4C0HA 4IRKA 2CPDA 4PWUA 3PYGA 4CH1A 1SIZA 5EX0A 3MM9B 2GZOA 2HHXA 1HHQA 2FB0A 3LPEA 5HP1A 2F7VA 4N76A 3BZQA 3JXOA 4X4SA 3R1HA 3G6ES 2Q79A 4NXNJ 4Y00A 3W64A 3O44A 3LANA 2XTJP 5C42A 3GILA 3IAM9 2DGTA 4MKVA 2HWIA 2DO0A 2JLFA 2LXFA 3MTJA 2PD1A 2FZKB 2GMHA 4JV1A 4K7QA 3A8JA 4WE1B 1IBLJ 2AF6A 2OSRA 2F1FA 3RRKA 1L3KA 3W2VB 4C97A 5K8OA 4PPDA 4USKA 3TQ1A 4ZJQA 2D9OA 1R0CB 1B4SA 1HD0A 3ADAC 3M2RB 4PQAA 4J9MA 4ECSA 3AB2B 1UTAA 1PJ6A 3PACA 2ZOMA 2HYIB 4LJMA 1R27B 4X62F 4JI0J 3KLFA 1MROA 1EQMA 4CLSA 1UWBB 2DGOA 3FEZA 2HHHF 1E6YA 2K2PA 2WSCC 1WI6A 2CDRB 1N6QB 2YWEA 1WHVA 1S57A 2PMHA 3MMBA 4RW9A 3AB4B 3GCWP 1H3DA 1WHYA 5KT7A 1NJYA 4QYRA 4OX6A 3CC7S 4X84A 1V5VA 3FRZA 2ZH7A 1VQ4S 3MAHA 3M8YA 4MFBA 4O4RA 3R2CJ 1NJIT 3RRGA 4P2MA 3J81Y 1FKPA 1U7LA 1ZM2A 4Y0FA 1FD2A 3HDSA 4X65J 3KJVA 1IXKA 3J7YU 2EFVA 1R0AB 2GQCA 1RT5B 4G1QB 4N7TA 4B9LA 3D2WA 1KDNA 5KFMA 2KHDA 5CD4H 4B9UA 2V2VA 4AYBD 3PKMA 2LA4A 1TL1B 3AQOA 3ISNC 3R5AA 3W66A 2E29A 2R42A 2HS3A 4E2FB 3EVWA 1YVFA 2B9YA 3LP0A 1R8AA 4DX5A 4YDDB 5CA5A 1RAEB 2AT1B 2PE8A 3CCTA 1QAJA 5CD4A 2JC1A 3I31A 3MEEA 4LRBA 3B6BA 4DZ6A 4RLEA 2QV6A 4K4WA 1S12A 1UVKA 4U9RA 2MSSA 2GO9A 3B4MA 4B9NA 2V8PA 2PIIA 3P96A 4ZVHA 3EYZA 2YH1A 2HWHA 3DRSB 3KUGA 2LECA 3PIOQ 1M90T 3EICA 2FHKA 2DGUA 3ZFVA 2HHVA 1HNVA 1X4EA 3H20A 1MMDA 3O2IA 3DRPA 3GE9A 3UCGA 4B3OB 4LFBF 4TN2A 2QL5B 3GV7B 4BDPA 1HHTP 2V8DA 2CDQA 3HI9A 4CO0A 1JMTA 1IKVA 1GXLA 2FLPA 2JZ5A 4DL2A 3CCZA 5KFLA 4RNNA 5J2QB 5KTQA 4PQUA 4ZP7A 4WZQA 1B64A 2W9CB 3OFHA 5F8MA 2KXNB 1UZDA 4GO5X 2ASLA 1VQ6S 1B99A 2DEJA 2E9RX 1K0TA 3HPOA 2ROGA 3FMWA 5ETPA 1T05B 4A8MP 3D7SB 3CIMA 2YNIB 1VC0A 4IH6A 3RG6A 3MR6A 2HIQA 1FERA 1HLWA 1TQLA 3A3PB 4M5LA 3SDEA 5ETTA 4YR2A 4IOCQ 2CNOB 4M5GA 2UXBJ 4NLOA 4NZ7A 1EIYB 1ACMB 1TL3B 1VRTA 1C2PA 5B08A 2HHUA 4LMZA 1BQNB 4KGVB 5KG5A 3LGMA 5K5MA 4DXLA 2JDJA 5KFTA 2AV5A 4ED7A 2LU1A 3DOMB 3W8PA 2ZHBA 3CCSS 4FXWA 4PRFA 4I6AA 4Q8EA 3D67A 3OJSA 4F0KA 4LF4J 1TV6A 2PO4A 5D0RA 4QBUA 1EARA 3MEGA 5E3CA 4R5PA 5A6WA 4K59A 4RU9A 1NK6A 3BGLA 4DPTA 3BGRB 1TVRB 3HKWA 5DQHA 1DTQA 4RPFA 3K5OA 1QD1A 2Q43A 3VR1A 2W7OA 5L1LA 1YHQS 1IBMJ 1RWOB 2GW8A 2HNYB 2YY3A 3PY8A 1HI1A 1T9XA 2HGNA 4NMXA 2W2MP 2DNQA 5BR8F 2CJAA 2G4BA 3IWNC 1X4CA 3MAAB 5FLXU 3KLGB 1SV5A 1SVDA 2E7XA 2OD6A 3D9BA 4B3RJ 2B6AB 4DFJA 4F7VA 3T5HA 2WSEC 4ANEA 1FFSB 4I7FB 4WXOA 6FD1A 1S7HA 3ENVA 1OJ4A 3GR1A 4JUZA 2QLBB 5HQLA 4U7CA 1VJQA 2FLLA 4DL4A 4G3IA 1NRKA 2AWZA 4J9OA 3GG0A 1T95A 2B51A 3VQTA 3M9OB 4TVAB 2QLXA 6AT1B 1SKWA 1UVLA 2V50A 4UT4A 4O23A 3UDEA 2BJ1A 4H4MA 3OL8A 2DK2A 4DS4A 4WZMA 2FHJA 2VL1A 5I42B 3K57A 5LXYA 2N3LA 1NBEB 3HFKA 3QT6A 3T1AA 2XZDB 2OP5A 4LRFA 5CQGA 4DR5J 1U49A 4O3PA 4RW8B 1T9TA 4CLFA 4PG8A 3GV8B 1WOSA 1X5TA 4ZPDA 4F04B 2E9ZA 3R9LA 1LWEA 4LF5J 4NXMF 3ZZUA 5F8HA 2CVEA 4K4SA 3HJVA 2EBGA 1HYSB 3P6YC 1SBRA 5KFPA 1HQEA 4GVLA 3BM7A 5CYMB 1JLAB 1WC1A 3KUHA 3LF0A 2HLTA 2NSBA 1FRIA 2E7VA 3D0IE 4OHVA 4Y28C 3SFUA 3TZZA 2J76E 4DV1F 4F4AA 1RWXB 1I5OB 4FS1A 4HACA 3TUJC 1WKLA 3PCOB 2D3UA 4QZVB 3KLGA 2YX1A 3OR1A 1K8AT 4A4JA 3VVUA 4NYOA 2XBPA 2HQFA 2V0NA 2VG7A 4QOTA 3OTOJ 4JV5J 2UP1A 1YIJS 2MQ8A 1RWNB 3I5BA 3K2YA 2P5VA 3PXGa 5IQ6A 2IDLA 2U1AA 2AD9A 2VA2A 4GRSA 4IH5A 1UZHA 3LP2A 1WF2A 3T19A 3H7HB 1FRJA 4ZMMA 1RT2A 4AXJA 5A8KA 3IWXA 1QSLA 2EPIA 2HQCA 4NLYA 3J7Z5 1ROFA 2W2NP 3MAQA 3PX6A 4WU2A 2QRRA 3P3DA 1VBZA 4ID8A 3PTWA 3UQSA 1KBRA 4TYAA 3VVTA 4DBQA 2Y9HA 1TELA 4RJVA 4RBUA 4ANDA 4ZPAA 2J9DE 2ZWOA 3N0VA 4AL5A 4DV2J 2L9WA 1RSCA 5B0DA 1MMLA 2QSFA 4GVBA 2MKIA 3M8ZA 1UA1A 2V34A 2H51B 2P6SA 3CIZA 3JQMA 4UY8T 2QLJB 4C4WA 2H4YB 1YX2A 3KTQA 3O1LA 2B4UA 3ZNUA 1VRUA 1LK5A 3DRRB 4OZ1A 4LRCA 2ZZTA 3OSNA 1D9AA 3J7A1 2AJ0A 3T3FA 4OI2A 1KQFB 2W8KA 3H2VE 1RAJA 1S1UB 1ZS6A 2GAGC 5F41A 4DX6A 4DPWA 1ZZNA 2R7UA 4CLPA 1HNXF 2HFOA 2JVRA 4L3NA 2KB2A 1DRZA 2RS2A 1PIEA 2ZH4A 5J2QA 3RB0A 1K0VA 3TP2A 5GMKa 4FF2A 1X31C 2W2OP 3KLHB 4FYWB 1FO1A 4TLQA 5EUHA 1KVIA 1RTIB 4F67A 3RB3A 1QVFR 1BHNA 2FVPA 4LF9F 1BWVA 4IFYA 3OVSA 3G87A 3DRPB 1F3FA 2HS0A 1PC5A 2DNGA 4IOBA 5E3AA 2MGZB 3FGVA 1FXRA 2AJ4A 5FIIA 3V5RA 3CCUS 4ECXA 3ZZ0A 2PSZA 3K17A 2FHMA 4A8FA 2HFUA 2IM0A 3CT9A 2A0FB 3OVAA 4DR6F 3OSPA 1LWCB 5T7LA 4RUBA 2AJFE 4JB8B 4ELTA 1RABB 3Q8UA 5GAEU 1Q95G 1SJQA 3WZ0A 1LWFA 2G2YA 3AODA 1HI8A 4AUKA 1VQNS 5KFYA 3KK3A 2AGQA 1S6QB 1S4FA 3D3CJ 4DSIA 2BYCA 1N32F 3HD1A 3VAGA 3BDPA 4C98A 2Y0BB 4Q0BA 1W2IA 3M1VB 2CG4A 2LQ8A 1OQ3A 1RT2B 1DURA 1OMSA 2G1DA 2DHGA 2IMWP 4F4ZA 1Q8IA 2CPYA 4BCAA 2ZKTA 5KG7A 5K14A 2P9GA 2BABA 4I69A 2I38A 2Z4PA 3AJDA 4IQMA 3UDVA 1R8HA 2G9OA 3JSMA 1J5EF 2VPYB 4OZJA 4LIWA 1KP6A 2CFXA 3HF5A 5L9XA 4YMEA 2XS5A 2QE5A 2IRUA 4R8UB 3OR1B 4C48A 4F4WA 4ZN1A 3R27A 3LUYA 4JI2J 1YJ7A 2M9KA 1JIHA 1RT7A 1OPZA 2VD3A 3C6TB 3CJRA 1VYAA 2CUYA 4I2QB 5D4LA 4B17A 5LL6d 4X64F 4X4PA 4ED3A 4KH0B 2JJ4D 2QA1A 2XI2A 5B0EA 2RKIB 3TX0A 3WX8A 2HHSA 4AXIA 1S49A 1IKYA 3ZZRA 2GVDB 1TP7A 4DSEA 1RAAB 1TL4A 3ICLA 2HHWA 4FNHA 1L3VA 3A4TA 1O51A 3DLJA 1XQIA 1HKAA 4KPCA 2M7SA 7FDRA 1KLNA 4NX9A 3W65A 1NAQA 2MKYA 2BE2B 2OPSA 4OL8A 4C7QA 3MR7A 3W2VA 5KFOA 3SI8A 3MR3A 4RUHA 5C24B 2DB1A 3M6WA 3SSRA 3NS7B 3RZAA 2DHHA 3RB6A 5EWFA 3ZO7A 4JP8A 4OZ3A 5E3PA 1QSYA 3HT0A 4GKJJ 4ECZA 5M2PA 4V19X 3MI7X 3SXLA 1NSPA 1D9DA 2KFZA 2VQEJ 1AFIA 2HQIA 4FBTA 1JK9B 2E1MC 3GMGA 5BJRA 5IT0A 2AZ1A 3RUBL 4J9UE 2AW0A 5T41A 5HROB 3PNIA 4YFUA 4RW4B 1Q8KA 5L8RC 1TU0B 2EKYA 1SV5B 1IKYB 1D0EA 3KHLA 1NDKA 2KJWA 4UW2A 3IRXB 1EETA 2DGWA 7AT1B 4EBEA 2RU3A 4KHPF 1G2EA 3RB4A 5LMNJ 1NKEA 1WORA 5GVQA 3UVJB 1VQLS 1ZH5A 2HVEA 3EM1A 4M95A 3TUZC 3I0RA 4C8ZA 4V19J 4OYPA 1TVRA 3U1NA 1D3WA 1UFKA 4M5DB 1TK8A 4URSA 2AQ4A 1U2RA 1HBOB 4K4ZA 2RF2B 3CULA 3DLGA 3MEGB 4MMOA 1YRUA 3RU0A 1TV6B 1VHIA 2M8HA 2QL7B 1Q79A 4YQWA 3G71S 1HWKA 4ZS6A 5LSLA 5KFNA 1L3UA 2AU0A 4ZOSA 1IM4A 5K14B 4DV0F 1SJ4P 5E3RA 1FDNA 1KRPA 1OQ6A 4MK7A 2CADA 3FSXA 3WBZA 2HBQB 3TRGA 2ZBIA 4IUFA 1S9GA 8AT1B 1T94A 1JLGB 4CQ1A 3TX8A 5LJ3Y 5BXIA 3DU6A 5KG6A 1QSSA 3BR8A 2OTLS 1FE4A 5M2UA 4MIBA 3TYTA 1U1NA 3SDEB 2K06A 5C2CA 3KNGA 2XZWA 4YUDA 5DG9A 2PFFB 4RW7A 1PYSB 2PMWA 1T0TV 3OPKA 4G1IA 2FLOA 1I3OB 4FF3A 3DU5A 2C2NA 3DMJA 4P71A 1LWCA 1KKHA 1E6VB 3NGDA 5L1IA 3BSCA 3PFOA 2CPZA 4OZ0A 1GTEA 2YH0A 3MCNA 2VZ9A 1U2FA 2DNZA 2HPUA 3NCRA 1RE1B 3IS9B 2XYHB 5J1PA 2C2ZB 4P74A 1M0SA 2B0GA 2DY9A 1NLKL 4EWTA 1LKZA 1NZ8A 2ZFHA 4FXVA 4Z37A 5DQIA 4YHHF 3CCES 4PUOB 2DNNA 4IKAA 1QE1B 3IS9A 5AE2A 4LQ9A 1FX2A 1PJ7A 1YDLA 1KOOA 4N56A 3H8YA 2AMCB 1XK8A 1X0PA 4GO7X 1IBKF 2GAHC 2UVUA 1JJCB 2JEJA 4PABA 2J7KA 2WBRA 2UV8G 4RW6B 1JB0C 1NSKL 2XHCA 4NCAA 1S1UA 4CIOA 4G6VB 2VB6A 1PKUA 2F65A 2M52A 2WB4A 4LIRA 4RW7B 4ZVQB 1LW0B 4OFZA 3BQ2A 4DQPA 2F5GA 2DR9A 1M5SA 2FD2A 1WWHA 2BANB 2LQJA 2RJZA 5B0BA 1Y9OA 4Q2LA 3C6UA 1PSDA 4ALZA 1GMVA 1VIXA 3UR3C 2PGCA 3EPGA 2AEFA 3I9ZA 3ILLA 5GAEI 4A8WA 4GVBB 2CKWA 4RUAA 3TOQA 1CS4A 1KSPA 1KS2A 2BA9A 2WZ1A 2Z2ZA 4N8OA 4X4RA 3DOLB 2R7XA 1KFDA 2C3OA 2F63A 4LF5F 2C3UA 4NXMJ 1HBOA 3EZ5A 2DCUB 3IA0A 1OWXA 3R7BB 4M5DA 4UZCA 3D1QA 4Y34A 4ATNA 2JH3A 4WTOB 3NNAA 4AL6A 1RK8A 1RZMA 2HEKA 4MYTA 4K4TA 3MGJA 1KFSA 1RT4A 1IJEB 1QDUB 2H54B 3DLEA 1U45A 3ENAA 2ZM6F 3AHPA 5RUBA 2AKWB 2ZZMA 3MMAA 4MKBA 1URRA 2R7VA 1IR1A 4CLYA 3C19A 1E6YB 1NNDA 1F9HA 3CCRS 3IRXA 3TA1A 2V63A 5ETNA 1UWBA 1P9QC 3K7RA 3CMES 2NREA 1MROB 3LPYA 1EZZB 2Y0SD 2HAIA 4ED2A 1OYEA 2L3MA 3IWLA 3VZIA 5DDQC 4P2XA 4CH0S 3M6UA 4A8SA 4NCGB 3M2RA 1NSAA 2EFQA 2YPZA 3UWTA 5HQ8A 3BO4A 2J6UA 1JLAA 3D1HA 2FVCA 3MEDB 5D0EA 2MJNA 4HI1A 1HYSA 2XMVA 1BY9A 2D1CA 4EZ6A 2X3DA 2GX8A 2BACA 2DNLA 3IAS9 4F8RA 3HHDA 2CQHA 3BF4A 4DR3F 4QCLA 3QO9A 5A76A 3K8WA 2P6TA 2XSJB 3A3NB 4EK2A 5HP1B 1N36F 4JI6J 2IRXA 2PT0A 3CD5A 1EJ7L 1K73T 1HMVB 2XNRA 5GMDA 3W9JA 1RXOB 3KHGA 3QGHA 5SZTA 1JQGA 4DSKA 4H4KA 2MHNA 3CF5Q 2RKIA 5IT9U 4DPOA 3MEDA 3OW2R 5L1JA 5ADZA 4QWAA 3D28A 3R6GB 3CCLS 3MM8A 3MPWA 2ZNZA 3DGPB 3IP0A 4URGA 2X7IA 2AJ1A 3KJQB 2CNNB 4LF8J 2J6SA 2E5GA 3ZZPA 5A2QY 1VQ7S 1XJWB 1N8RT 4IR1A 2NQPA 1V9OA 2BJEA 4J7CA 2E5IA 4ZITA 4NA3A 2XC9A 1U4BA 1U6BA 3M7VA 3CEDA 4X4VA 2W9AA 4YN3B 1ZYQA 4WBFA 5KFCA 2ACYA 4DFMA 1DZ5A 4IRDA 4PYAA 1RAHB 4WCEQ 1ZA1B 4Q8FA 3DLEB 4YDXA 3OR2A 4OHZA 2AGOA 1HNWF 3AA8A 3M8WA 4KKOA 4K2JA 3BGUA 4Y2MA 4AL7A 2E1CA 5DM7Q 4DV3J 3AT1B 4Q0BB 2DCLA 5DGAA 3CD6S 2K3KA 1HQ2A 5E33A 1C1BA 1HIYA 3MTKA 4USJC 5CCMA 4DZDA 3LO3A 2C3YA 1UCNA 2JOQA 3DDKA 1C0TA 1KTQA 2B56A 2RRAA 3L7PA 4CTAA 5AXMA 1N5TA 3ZTQA 1HBMA 2XS7A 4U7UD 2VBYA 5BYRA 1N32J 4KYZA 3JQKA 3DXBA 3SFGA 2X1BA 2NXNA 3F56A 2I5JB 4CO1A 3HO1A 3SIPB 3GWCA 2HNZB 4Q5VA 2IYIA 2BV3A 4Q43A 2RVJA 2PMZD 4KJIA 1F9FA 2RRBA 4IFYB 4DSFA 2G0IA 2EFNA 4LR8A 4EI2A 4WXWA 3QIDA 5HVFA 3KK2B 2K7KA 3N6MA 1RTIA 3K58A 4NRTA 4RW6A 1FCAA 2CQPA 2N4DA 3DNCA 5KT6A 2E5LJ 4OQJA 2DIVA 3CJKB 2DO4A 2ZHOA 4JI2F 2VG6B 2LEAA 3QLHB 3VV2B 2QT7A 3QGGA 3BH6B 4OJ3A 4CO3A 1U0HB 5KFQA 1XMBA 3VWSA 3J80U 3Q8SB 3M8RA 2KM8B 1SL1A 2JEFA 4PUOA 2Y8YA 1RLDA 1RTHA 2AGPA 5LXRA 3MOJB 3KDNA 3RJMB 2D3O1 4OX8A 2MQNA 2XY5A 3GV5B 2MPUA 2W9BA 4ECYA 3OTBA 3ETOA 1N34F 1TKXA 2KHCA 2EG2A 5CHCB 4RZRA 1ZETA 4DEZA 3PYFA 3DRSA 2KYZA 1VRUB 5ETKA 5EX3A 4ZLJA 1M1GA 2DKOB 2WONA 2V4RA 4HYKA 2KZMA 4E8UA 2BMBA 4F26A 4PG5A 1HW8A 1U48A 3EUNA 1WG1A 4TLRA 5DLFA 1SC4B 2P9CA 3GLJA 4OLPA 2DNOA 4MH8A 2BX6A 3CCWA 3I87A 2V6AA 2RH3A 2CZVC 2Z8QA 3QFHA 5CXTA 2L08A 2DHSA 2QA2A 2CPXA 4H54A 2O5DA 5EWEA 4CRJA 3ELHA 3GIKA 1SUQA 4KE5A 3SSQA 3WIVA 2NS1B 3CSKA 1AYEA 4ETXA 2BZ2A 2XLKA 1MG7A 4WP8A 3OR2B 5E5NA 5CYQA 3M8QA 5H9FK 2UXBF 1SC6A 2AJ2A 2AHOB 1GK8A 4NLVA 3GJSB 4QPXA 3MM6B 4OYIA 1YBUA 5MLCV 2RF2A 1RBLA 3RBDA 4NLTA 4MFBB 3QFWA 3B54A 2IPOB 3BQ1A 3EXCX 2CZ4A 4HACB 2JEGA 3C14B 3FCWA 5LMUJ 4K4YA 1Y4ZB 2XZTB 3G8QA 4NLSA 2R7SA 1A9NB 1S9EA 3PYEA 2JRSA 5JXSA 4USMA 3BSNA 3CC4S 2A10A 4CO2A 3AJ2A 3B78A 2WRMA 4MTPA 4ZPWR 4ZVGA 1Y5NB 2A6MA 1SXLA 3TUIC 1GTHA 2DITA 4DG1B 3SCKE 4DSJA 1OIAA 2QA4G 2UU9J 3BBBA 4RW4A 5KOXA 3KLVA 4B9SA 2YKAA 4GKKF 5JMNA 2HLUA 3DRYA 3EXYA 4YP3A 2JL9A 1SC3B 4IR9A 4DV0J 4DWIA 3IO1A 1NH8A 4OZNA 5HO4A 4J37A 1WC6A 1WC0A 4DLEA 1UFWA 2J8AA 4X4UA 1YSJA 4WE1A 2AX0A 1YJVA 2A1BA 3OTCA 2GGPA 1RGVA 2VFTA 4H4MB 2AYMA 4ILRA 4IYQA 4QR2A 4CDIA 4ZVSB 1VQKS 3T6JA 2PI5A 3AH6A 4DL5A 1JLFB 2RB7A 4F3OA 2BE2A 3TUPA 2DRBA 3SV4A 1UEVA 4XPEA 2VDIA 1TUVA 4A8XA 4A8YA 3V6DB 3FBCA 4ZDNA 5IT9Y 1FNOA 2L48A 5L46A 2B6AA 4HTJA 3BYRA 3ZXWA 4GC7A 4FYDA 1XBWA 4O3SA 4UOHA 1KHVA 2VKRA 2EKNA 1S4EA 2C2OB 4DCOB 1SKSA 4LFCJ 5FDLB 1Y00A 5C25B 1OS5A 2HNYA 3C6TA 4I2QA 3NKYA 3CJ2A 1CQNA 2GIFA 4AQYJ 1VDHA 2KT2A 3LOUA 3VGTA 2B7BB 1DARA 2IM2A 4IG0A 4KBIA 3WX4A 4DR4J 5GAGI 3A13A 2AZ3A 4OJGA 1U6FA 1SH3A 3DOLA 1S0NA 2MSTA 1U1QA 4LF7F 3DOMA 2ZH8A 4DFPA 1LW2B 1FTCA 4MT1A 1S99A 4FKYA 2XMWA 3E3XA 3M1VA 2KTQA 2RS8A 4EO8A 1TL3A 1VRTB 1ZZFA 1X5PA 2ZWPA 5A8WB 3MURP 2OSQA 5GAGU 2ZH1A 4IQXA 3AOBA 1AUSL 1LOUA 2FY8A 4CH7A 1AXQA 2DY1A 4KO0A 3SYZA 3IG1A 1S6QA 4BC9A 4DF8A 2X1AA 2KL8A 2QZ8A 4P72A 4A48A 1FXDA 2IM1A 1FFWB 1LWFB 2VKZG 1N5YA 2OJ3A 2YQ1A 1QAIA 2J0SD 4WIQA 4I67A 2BJ7A
chains in the Genus database with same CATH topology
2DKOB 4ZVOB 1QDUB 2H54B 3D6FB 3NS7B 1RWMB 1SC4B 1RWNB 4ZVTB 3KJNB 2CJXB 1BMQB 3GJTB 2HBRB 3EDQB 2C1EB 2QL5B 3R7NB 1RHQB 5IC6B 3GJSB 2H51B 2QLFB 2QLJB 2H4YB 2C2KB 1RWPB 2XZTB 3IBFB 1QTNB 2QL7B 2XYPB 1RHKB 1RHMB 4ZVRB 2CNOB 2H4WB 2CNLB 2HBQB 3KJFB 3R6GB 1SC3B 3GJRB 4ZVPB 1ICEB 3KJQB 2CNNB 2XYGB 2CJYB 3EDRB 1RWWB 4ZVSB 1I3OB 1RWOB 3D6MB 4JB8B 1PAUB 2FQQB 1RHRB 3P45B 2H5JB 1RE1B 2C2MB 2XYHB 2C2ZB 1RWKB 4ZVUB 1RHJB 2QL9B 1PYOB 4LSZB 2C2OB 2Y1LB 4DCOB 2Y0BB 3GJQB 2QLBB 3IBCB 3SIPB 1NMEB 1GFWB 4ZVQB 2CDRB 1IBCB 1RWVB 2HBYB 4DCPB 2XZDB 3R7SB 4DCJB 1I51B 1RHUB 5K20B 3R5JB 2CNKB 2H5IB 3QNWB 2H65B 3D6HB 5IC4B 2HBZB 3RJMB 3R6LB 3R7BB 2H48B 1F9EB 3P4UB 1RWXB 2P2CB 1SC1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKO B;  4ZVO B;  1QDU B;  2H54 B;  3D6F B;  3NS7 B;  1RWM B;  1SC4 B;  1RWN B;  4ZVT B;  3KJN B;  2CJX B;  1BMQ B;  3GJT B;  2HBR B;  3EDQ B;  2C1E B;  2QL5 B;  3R7N B;  1RHQ B;  5IC6 B;  3GJS B;  2H51 B;  2QLF B;  2QLJ B;  2H4Y B;  2C2K B;  1RWP B;  2XZT B;  3IBF B;  1QTN B;  2QL7 B;  2XYP B;  1RHK B;  1RHM B;  4ZVR B;  2CNO B;  2H4W B;  2CNL B;  2HBQ B;  3KJF B;  3R6G B;  1SC3 B;  3GJR B;  4ZVP B;  1ICE B;  3KJQ B;  2CNN B;  2XYG B;  2CJY B;  3EDR B;  1RWW B;  4ZVS B;  1I3O B;  1RWO B;  3D6M B;  4JB8 B;  1PAU B;  2FQQ B;  1RHR B;  3P45 B;  2H5J B;  1RE1 B;  2C2M B;  2XYH B;  2C2Z B;  1RWK B;  4ZVU B;  1RHJ B;  2QL9 B;  1PYO B;  4LSZ B;  2C2O B;  2Y1L B;  4DCO B;  2Y0B B;  3GJQ B;  2QLB B;  3IBC B;  3SIP B;  1NME B;  1GFW B;  4ZVQ B;  2CDR B;  1IBC B;  1RWV B;  2HBY B;  4DCP B;  2XZD B;  3R7S B;  4DCJ B;  1I51 B;  1RHU B;  5K20 B;  3R5J B;  2CNK B;  2H5I B;  3QNW B;  2H65 B;  3D6H B;  5IC4 B;  2HBZ B;  3RJM B;  3R6L B;  3R7B B;  2H48 B;  1F9E B;  3P4U B;  1RWX B;  2P2C B;  1SC1 B; 
#chains in the Genus database with same CATH topology
 5HMY A;  2ZH2 A;  3MPY A;  4XK8 C;  4OYZ A;  3ZTS A;  4PQU B;  2IYG A;  2FLN A;  1WHX A;  1U02 A;  3D6F B;  3D3B J;  1HHS A;  2HND B;  2GJ2 A;  3BKT A;  1IKV B;  3HFV A;  3EVO A;  1KLM B;  3NMR A;  3QAE A;  3VZH A;  1ITP A;  2V2K A;  4PXD A;  3KKF A;  3KJN B;  1KQK A;  3N01 A;  2GS8 A;  4YEA A;  4ZPT R;  3KXD A;  3PX4 A;  3GON A;  3K5L A;  4CLT A;  3LH2 S;  3NS5 A;  5D4O A;  1U47 A;  1HPZ A;  3MR5 A;  1RJJ A;  1KWM A;  4DPX A;  4YB7 A;  2DR5 A;  3Q86 A;  2CRL A;  4QPT A;  2MKJ A;  4IO1 A;  4CM0 A;  2OPR B;  3R3T A;  1KHW A;  2JFD A;  1UPP A;  3DMJ B;  2UUT A;  2XY7 A;  4FF1 A;  2VC1 A;  2B5J A;  1XR7 A;  2IAJ B;  3KLI A;  1T03 A;  2MZS A;  1U8W A;  4KGM A;  2DNH A;  4NLD A;  4IFV A;  4IOA Q;  1BGX T;  2AEM A;  2Z57 B;  2ZJP Q;  3QRR A;  2GV1 A;  3LTO A;  1TL1 A;  1QY7 A;  4H4K C;  4RWW A;  1J2V A;  2QO3 A;  2YBV A;  1S9G B;  4C9D A;  5BYQ A;  4JI6 F;  2XWX A;  2CJB A;  2WHO A;  3M6X A;  1YJN S;  3V4M A;  2MQO A;  3IMQ J;  5E0O A;  4EBD A;  2AX1 A;  1SPB P;  1X4D A;  8ATC B;  4NPO A;  4HHH A;  1U1K A;  2N7Y A;  3FQK A;  3HT3 A;  1YI2 S;  1VC6 A;  4TYB A;  5KG2 A;  1QUP A;  6FDR A;  2LXU A;  2DRD A;  4B3T F;  3DLK A;  2GFF A;  2B8Q A;  4ECR A;  4C8L A;  2UUB F;  1FJG F;  1KTV A;  5L38 A;  3RW7 A;  5DDR C;  1S0V A;  3IBW A;  2ZEJ A;  2IC3 A;  3LP2 B;  2GO8 A;  3UVJ A;  1Y11 A;  2R4F A;  3EVM A;  5FDL A;  1JLE A;  3PRB A;  5KFJ A;  3HUL A;  4BC7 A;  3W60 A;  1EET B;  1UMJ A;  4JI1 F;  4I4B A;  2KDO A;  3PW7 A;  1VJW A;  1H72 C;  3CO9 A;  4N8N A;  3U7J A;  4D3H A;  2F9J A;  4TU9 A;  5HLF A;  2BQ3 A;  1S48 A;  2DTJ A;  3THP A;  4C0O C;  2MJU A;  3T41 A;  3TZY A;  3PHE A;  1HWI A;  3HHK A;  4NE9 C;  3TAQ A;  2V68 A;  2EK1 A;  2R2T A;  2KM8 C;  3MDF A;  2UUC F;  2JHE A;  4NXN F;  1Z1Z A;  2LXI A;  2BQU A;  2V8H A;  1B0P A;  5KFF A;  1VQY A;  1JLF A;  3RTV A;  4ZPV R;  3NAH A;  4ECU A;  1KD1 T;  2VON A;  2ILZ A;  1RP5 A;  2LDY A;  2IFX A;  2R7T A;  1T3O A;  2DXF A;  2E1P A;  4HLB A;  2UUA J;  5C24 A;  2XMK A;  4UZB A;  1SKU B;  2XMM A;  1QAY A;  3BGO P;  4X2B A;  1H7X A;  3K89 A;  3TJ9 A;  3PR5 B;  2W25 A;  2ZBR A;  2OPS B;  1XNR F;  3K0J A;  1R6Y A;  3RAQ A;  3DN9 A;  3GFH A;  3PO4 A;  2VDH A;  4F2R A;  5D77 A;  1ZM3 A;  1GFW B;  1WEY A;  1TKD A;  4BS2 A;  4DV6 J;  3G96 A;  3ENW A;  4HEA 9;  4P9S A;  3UFC X;  1FJ7 A;  3BB5 A;  1IKW B;  1HI0 P;  1R31 A;  1U26 A;  1HR0 F;  3UI3 A;  1TFW A;  5F8N A;  2W2P P;  4LF2 A;  3TW0 A;  3W7B A;  4DCJ B;  2DGQ A;  2YNG B;  4KY3 A;  3HHE A;  5B0A A;  3PW0 A;  4O3R A;  1S59 A;  2RML A;  4DL6 A;  5GAD U;  3D54 A;  2Q66 A;  1F6T A;  1NKC A;  1KVJ A;  1RT7 B;  4LRA A;  3V2U C;  1YJ9 S;  2D3O R;  3C16 A;  3HHL A;  1NO8 A;  4LUB A;  4ZA1 A;  4X4T A;  2HFZ A;  2M8D B;  1U6Z A;  4R8U A;  5CAA A;  4KQZ A;  4FP9 A;  4MIA A;  5KFK A;  2N7C A;  4F2S A;  3VQS A;  2PA3 A;  2R7W A;  4NLR A;  2LP4 A;  3BYP A;  3JSM B;  2J0Q D;  5CYQ B;  2LEP A;  1BQM B;  3DLB A;  1WC3 A;  2I9S A;  4E98 A;  5KT2 A;  2W8L A;  3QQC D;  2OEL A;  2XLJ A;  4DV1 J;  1X4A A;  3FSY A;  1H74 A;  2XMJ A;  1RU2 A;  1VIS A;  1SUQ B;  2XGQ A;  3MCS A;  4H4O B;  1RWM B;  4J9V A;  4NYZ A;  4XTT A;  4B9M A;  4JI5 F;  1REG X;  2OD4 A;  3U1L A;  4K2X A;  4C3K A;  3GTY X;  4LF6 J;  4LFA F;  2M0G B;  2HVI A;  1TKT B;  3LQV A;  2HHT A;  3IR7 B;  4NEY A;  3OHA A;  2IJN A;  3A12 A;  1BQN A;  1DQA A;  2EI5 A;  4YB5 A;  1V6H A;  4KFB A;  4B3S F;  4M8L A;  1VIO A;  2HBR B;  3EDQ B;  2WON B;  1XN9 A;  1ZPW X;  2XS2 A;  1NK7 A;  5H1S V;  3QT5 A;  1XIQ A;  2F40 A;  2QGF B;  2IIH A;  3CCV S;  4ELU A;  4LFB J;  3BJY A;  1APS A;  3PFE A;  1RAO A;  2CQD A;  3Q83 A;  2W9B B;  2YNI A;  2J9E A;  3CGI A;  1VQO S;  2EK6 A;  1T05 A;  2JFK A;  1RTH B;  3DRX A;  3QAU A;  1RLC L;  4C8N A;  2C2K B;  3FCV A;  2WW4 A;  4DPU A;  3DI6 A;  3F0N A;  1JXL A;  3TAN A;  3NP5 A;  4U67 Q;  2YKM B;  1N5Q A;  1TAQ A;  3JS9 A;  2VF3 A;  3CJK A;  2J6T A;  1AZS A;  3O5T B;  2NPF A;  2PFD A;  2MEW A;  4NLW A;  2IHR 1;  1M5P C;  3MFI A;  1UJ5 A;  1HNZ F;  1SJ3 P;  4AT1 B;  3THV A;  3UN5 A;  2MLZ A;  4G1P A;  4DUT A;  3M2U A;  4LR7 A;  4OI1 A;  5IS2 A;  5JVG Q;  5DGB A;  4O4G B;  1X9W A;  1C1C B;  1Q8B A;  3W5Y A;  3KJF B;  1RCX B;  3PG9 A;  3TA2 A;  2VC0 A;  4USV A;  4N47 A;  1ZA2 B;  2HZV A;  3HSJ A;  2DR7 A;  4DU7 A;  1LQ9 A;  1Q4R A;  2MZR A;  3M30 A;  2BW2 A;  3RAM A;  1HBU B;  3R5D A;  4OX9 F;  2OMO A;  2LKZ A;  2KI2 A;  5F9L A;  3OQ2 A;  3MOZ A;  5DO2 A;  1CC8 A;  1RWW B;  1YWX A;  3HVA A;  4WKR A;  5DLG A;  4LF4 F;  1WC5 A;  1X7V A;  1MN7 A;  2JLE A;  2Q6B A;  3H98 A;  2UXD F;  3LP0 B;  2WTF A;  1C0T B;  1S1T B;  4YOE A;  5C2G A;  5DZ7 A;  4ECV A;  3L7U A;  4HHJ A;  1C1B B;  2W4C A;  3B8H A;  1IBL F;  2OHD A;  3TEG A;  3JYT B;  5HSP A;  3UN2 A;  3P45 B;  4MKA A;  5ETQ A;  4Z2X A;  1TZ0 A;  2BE7 D;  3P5B P;  1RT5 A;  4G1Q A;  5F8I A;  3OHB A;  4B3M J;  2ALY B;  1R0A A;  1RHJ B;  3G82 B;  3LAK A;  4R25 A;  1RDR A;  2HVZ A;  4FYX B;  4X62 J;  1R43 A;  1FKP B;  2DGV A;  3V81 A;  3NMA A;  5KFD A;  1FRL A;  3LAM A;  5EGY A;  2B8P A;  1F2H A;  4FPI A;  4O44 B;  4QIV A;  5HBM A;  2HHH J;  2CQ1 A;  1TL7 A;  2YWG A;  2FC9 A;  3IBC B;  3Q8Y A;  4C8K A;  4X4O A;  2EW9 A;  3CPW R;  1V3Z A;  2GJF A;  3PO5 A;  5A0Y A;  2D7S A;  1SH0 A;  4PKD B;  3SCJ E;  3Q22 A;  2HGL A;  2EFG A;  2RQ4 A;  5CYM A;  1ARO P;  2DIU A;  2XHW A;  1KVK A;  2QX0 A;  2ZVI A;  3HVT A;  4GMK A;  4KC5 A;  3KK1 B;  1J5E J;  3UW1 A;  3VAK A;  2G2Z A;  1F5C A;  3H59 A;  3KLF B;  1M5O C;  3I55 S;  4LRE A;  1HWL A;  2EC2 A;  2OI2 A;  4X65 F;  1WC4 A;  4DR5 F;  4YR0 A;  1WKK A;  2FGO A;  3ISN D;  2E7W A;  1KR4 A;  3ZTO A;  1HMV A;  1ZAW A;  2M70 A;  2QG9 B;  4KGK A;  4MK9 A;  2OH2 A;  3ET6 A;  4UOG A;  3HVR A;  1AFJ A;  3KG0 A;  5I42 A;  1ZTT A;  4N41 A;  4FN5 A;  1F5B A;  3W5X A;  3AAW B;  3UNG C;  1F9E B;  5C42 B;  3ULH A;  4DV4 F;  3W5Z A;  3BO3 A;  3NEK A;  1SC1 B;  4O3O A;  4J9K A;  5IFM A;  3PW2 A;  4LQ3 A;  3TAR A;  2MDA A;  3UD4 P;  2RHQ B;  1F1B B;  1Y5I B;  2R7O A;  5LSR A;  4KSE B;  3D5M A;  4BBY A;  4DV7 F;  2ERR A;  4JI8 F;  2KZZ A;  1FKA F;  2FVS A;  5D15 A;  1LFP A;  3AFG A;  3GQC A;  2CQ0 A;  4DDF A;  4C11 B;  3GFZ A;  4JV5 F;  3MAA A;  2X3G A;  2V4Q A;  5I3U A;  4LSL A;  4P7T A;  2YNF B;  4UOC A;  8RUC A;  5F8J A;  4W98 A;  2ZH9 A;  3MMA B;  1IVZ A;  4OIX A;  1TMM A;  4I6W A;  5JUM A;  2WVF A;  2VQE F;  2I0X A;  3AD8 C;  3R7N B;  3P5T L;  1JXV A;  2J9C A;  2HRY A;  4NLU A;  4RBT A;  2B4V A;  2C22 A;  5KFH A;  4LVO P;  3DFE A;  4IH7 A;  4JOU A;  1IR0 A;  2O67 A;  4RU2 A;  4JI3 J;  3BN4 A;  2DNM A;  5ETO A;  4DV2 F;  4PWD A;  3QZ8 A;  3W2W A;  1I94 F;  1HBN A;  2NZ4 A;  3IN5 A;  1OSD A;  1PO6 A;  3TA0 A;  4KHP J;  2ROE A;  2EBE A;  1CS4 B;  4LBH A;  2YWW A;  2VU5 A;  4XPC A;  2MKC A;  2FJV A;  2BEF A;  4UST A;  1WI8 A;  3KHH A;  2MZ1 A;  3SV3 A;  4LBP A;  3NNH A;  3A3O B;  1X9S A;  4F4K A;  1FEE A;  2FYX A;  2OKQ A;  3HSG A;  1DTT A;  2YWF A;  3UPF A;  4EEY A;  1Y3K A;  1DHM A;  2IBK A;  4ZJO A;  2CNL B;  3DLH A;  3HFZ B;  1Z2L A;  3SEO A;  3M05 A;  4EYH B;  1CUL B;  1FK9 A;  4ICL A;  1O8B A;  3KLE A;  1ICE B;  3NGR A;  1PC4 A;  1T7P A;  3T6B A;  4EYI B;  4Y6I A;  1OY8 A;  3BEG B;  1K1Q A;  3LA0 A;  3M32 A;  1DJ0 A;  3EZU A;  3GCX P;  1DLO A;  3BGF A;  3GG1 A;  1IBM F;  2IVF B;  1MN9 A;  1QM9 A;  2W2Q P;  3UN3 A;  1QE1 A;  1NJZ A;  1J5O B;  2HQD A;  4LF9 J;  2C3M A;  1LV5 A;  2VPX B;  1TUG B;  3MM7 A;  4FDF A;  5KG3 A;  4DR7 J;  3TWZ A;  1AA1 B;  3OVB A;  1RTD A;  4B3O A;  2ILY A;  1GX5 A;  4URQ U;  1YRX A;  5H9E K;  1RHR B;  1S1V A;  3HHL C;  4NI2 A;  4DF4 A;  2CQB A;  1U1P A;  4C3L A;  1X5O A;  5A6P A;  2GVZ A;  4OV6 A;  1T8E A;  3OV7 A;  4F0H A;  4ED0 A;  2RUS A;  1EP4 A;  2LQB A;  3CXC R;  5B0F A;  1P1L A;  2LDI A;  5ETV A;  3V6K A;  3Q0A A;  2FJA B;  2R3V A;  4ENO A;  5KFB A;  3ZTP A;  2CXE A;  3MEE B;  4J9N A;  2ABY A;  4J9R A;  4F4X A;  3VF0 B;  2LEB A;  3PHT A;  4CWB A;  1FVS A;  2OLW A;  2WK4 A;  3MZI A;  4RNO A;  4FS2 A;  4EU0 A;  3R97 A;  2QFI A;  4ANC A;  1SH2 A;  1B7Y B;  1IR2 A;  2J7U A;  3VAM A;  4ECW A;  4JI4 F;  3C46 A;  2QIF A;  3GYN A;  5IXU A;  3NRB A;  4HR2 A;  2MZT A;  4CP5 A;  5CZV A;  5I3Q A;  5AE1 A;  2DYA A;  1VBX A;  4Y2I A;  1G3O A;  3MEK A;  4HTI A;  2G1H A;  3FUY A;  1WTF A;  1N33 J;  4LT6 A;  2Z2L A;  1X5S A;  1FWK A;  1GXU A;  3T1Y F;  3R5J B;  2OEK A;  3DLG B;  2KRB A;  3FZB A;  3NGU A;  2WVC A;  4I0W A;  3HK2 A;  4K4U A;  3BPS P;  3RAX A;  3HX9 A;  2IRY A;  1BD6 A;  1UW9 A;  3DDI A;  5J1E A;  3N4W A;  5F0W A;  2MY8 A;  2A18 A;  3I0R B;  2HRT A;  1JLQ A;  4UUW A;  5KFV A;  1M5V C;  1U1M A;  5AXN A;  2KRR A;  2DGS A;  1N6Q A;  1F2G A;  4A8K A;  4WFX A;  5KG4 A;  1RBA A;  2RAQ A;  3P4U B;  3HZE A;  4W4M A;  5CAB A;  1RAI B;  3KMS A;  4Q2M A;  4OI6 A;  3OTO F;  3ZZZ A;  2VFU A;  1S77 D;  4ZHR A;  3BS9 A;  5ETL A;  1H73 A;  2FTR A;  1VQ9 S;  1NM2 A;  2W4D A;  4PPZ A;  3L9Z A;  4P6Q A;  5HVH A;  5HRO A;  1R7I A;  2J0X A;  2VIH A;  4CNY A;  1QLN A;  2D69 A;  3AD9 C;  4ES1 A;  3QZ7 A;  3T9Z A;  5LT5 A;  2RNE A;  5KFW A;  4LBI A;  3POT B;  4HT5 A;  3AJ1 A;  4AD6 A;  4WFB Q;  2AJQ A;  1FRK A;  3GFY A;  3HCX A;  1ULR A;  3MMC A;  2HHQ A;  4LFA J;  1X4F A;  3FMB A;  2I1R A;  3AY0 A;  3TAM B;  5HMX A;  4XIU A;  5CZX A;  3FJ2 A;  3CJ8 A;  3QIP A;  1CJT A;  1FDA A;  1VQS A;  3D0H E;  1MLA A;  1WEZ A;  3ISZ A;  3MM9 A;  4PXB A;  4UUX A;  3W1Y C;  3U27 A;  1WJ9 A;  3MM5 A;  4CT8 A;  2GQ2 A;  1T9W A;  1MMN A;  2WVE A;  4OJ1 A;  1A6L A;  1U24 A;  1WEL A;  3CE8 A;  5DQG A;  2ZHA A;  3PZP A;  2ASJ A;  3X1L B;  3I56 S;  1FRX A;  2MLY A;  2ZVS A;  1BUX A;  1Q5V A;  1Q1K A;  3VHQ A;  2GVD A;  1Q5Y A;  1SIW B;  2HHP A;  2Z2M A;  4WTY A;  4HI2 A;  3TR5 A;  2L41 A;  2DPJ A;  3GIJ A;  3MR2 A;  3MPV A;  1A7G E;  1VOM A;  3FKB A;  3GR0 A;  1X4B A;  3DHW C;  3PJ9 A;  4QR0 A;  2DBB A;  2BE9 B;  4L74 A;  2NSC A;  3PX0 A;  1REV B;  4KH1 B;  3DM2 A;  1IKX B;  1QJH A;  4FBU A;  1FKO B;  2ZOF A;  3JTP A;  4Q45 A;  1RHK B;  2CPJ A;  1G6B A;  4FVC A;  3T5L A;  5JJB A;  3V6H A;  3OLB A;  2C42 A;  3HVT B;  3GYG A;  2HG4 A;  4ED4 A;  2BKO A;  3E2E A;  1EKS A;  2MB0 B;  2SXL A;  3NLC A;  2DXE A;  2P9E A;  3EJM A;  3GZ7 A;  1YJT A;  4NEZ A;  3R8Y A;  1YBT A;  3S8S A;  2VV5 A;  3EX7 B;  1XNQ J;  1H2T Z;  4LF8 F;  1FWL A;  4OX9 J;  1DBD A;  3Q8V A;  3ZZO A;  1UEK A;  2KYX A;  3V81 B;  2M3D A;  1LXN A;  3MEC A;  4NOH A;  4LSN A;  4HL9 A;  1F3V A;  4I1T A;  3G6Y A;  1XMQ J;  3FFI B;  3G82 A;  3QJJ A;  3KK3 B;  2OML A;  1AW0 A;  1PG5 B;  3BSA A;  3QYY A;  4QYZ J;  1S1W A;  2UXD J;  1GH8 A;  2OO4 A;  4L6V 3;  4I2P A;  1X60 A;  4IDK A;  7FD1 A;  1NZA A;  1H7W A;  2EWH A;  3GB0 A;  3PEJ A;  5IQQ A;  5T7L B;  2NXJ A;  3L3C A;  1ZTW A;  1GXT A;  2D41 A;  2WCX A;  2B9X A;  1N0U A;  3H90 A;  2FJE B;  3OFF A;  1G1X A;  2NUH A;  2W24 A;  2ZBC A;  2ZE2 B;  3QBC A;  4QWE A;  3NAI A;  1VQP S;  4DQI A;  1CJV A;  2GIR A;  2Y1L B;  1GQE A;  3G2X A;  2FPH X;  2CIM A;  2JLG A;  1JJ4 A;  2L9N A;  4DUY J;  5KFR A;  1YLX A;  1N52 B;  2XO7 A;  1UKU A;  3CJ0 A;  5D4N A;  2V2Z A;  1K1S A;  3KLH A;  2YNH B;  3AA9 A;  4DSL A;  1HBU A;  1RT6 A;  3B82 A;  3FDS A;  5U47 A;  3UE2 A;  4FF4 A;  3D4J A;  1TK5 A;  1JLC B;  5DZ6 A;  4Y3C A;  3I4P A;  2FC8 A;  5L39 A;  2FJX A;  1XTZ A;  2W1B A;  4K0K F;  1PBU A;  5ETS A;  2HBY B;  2HW3 A;  4DX8 H;  4DV5 J;  4KPY A;  3NNC A;  3N79 A;  3W9H A;  5ITH A;  2F4F A;  4YB1 P;  4DQS A;  1XEZ A;  4TU8 A;  4KV8 B;  1RB0 A;  3I32 A;  3CWJ A;  4USI A;  1JLC A;  4JI5 J;  4OX7 A;  3DOK A;  5KFU A;  2YKM A;  4PYD A;  3RBE A;  1RI7 A;  2WSF C;  2WOM A;  2NLW A;  1WSR A;  1CG2 A;  2YWH A;  1V3R A;  2XMT A;  3GFX A;  4ZKA A;  2QFJ A;  1U1O A;  2GNK A;  2HMI A;  3UDL A;  4HKQ A;  4WK3 A;  2BJD A;  1RT3 B;  3N6L A;  1MW7 A;  3CJQ A;  1LXJ A;  3V4I A;  2XQC A;  2G13 A;  4L72 B;  4WFA Q;  2W7P A;  2R8K A;  1U8S A;  3C8Y A;  3CJT A;  4DFK A;  3TAP A;  1W2B R;  1N34 J;  4M1K A;  4BHQ A;  2GMJ A;  1K9M T;  1NUE A;  2FJB B;  3HJF A;  1Q78 A;  1S1W B;  1CJU A;  5D3G B;  3CCQ S;  2B3T B;  3PIP Q;  3H0P A;  2LA6 A;  4R0J A;  1WTB A;  1OY6 A;  4NYP A;  4USW A;  3OXL A;  5DS7 A;  2Y1J A;  3OD2 A;  1V5I B;  2RT3 A;  3MEC B;  1TK0 A;  4ED6 A;  4QU7 A;  3D6T B;  1XMO F;  2O66 A;  3PM9 A;  4ZCI A;  3RRH A;  1NB7 A;  2ZDP A;  2HGM A;  4OI3 A;  4QIG A;  3F73 A;  1UVM A;  1HNI A;  3H25 A;  1G4C A;  1C4C A;  3MWB A;  3OL9 A;  1NK9 A;  3JTO A;  3MD1 A;  2M2B A;  4Y2A A;  2MQL A;  4YY3 J;  2GHP A;  4Q44 A;  3K59 A;  4DR6 J;  5J1N A;  2D9P A;  1S5Z A;  1FNM A;  1UEU A;  1B70 B;  2HQG A;  3C3L A;  3H5S A;  1EKR A;  3N6N A;  5K8M A;  1IM6 A;  3F44 A;  4L76 A;  3BSO A;  2W4P A;  1JLB B;  4U7U K;  3CW2 C;  4I68 A;  4EUV A;  2OEJ A;  3DM2 B;  4DR3 J;  2Y1I A;  3H5X A;  5FLX Y;  2OFH X;  4RO0 A;  3G8S A;  3M9M B;  3WC2 A;  2RRN A;  5J2N B;  4HDG A;  3VAH A;  3V6J A;  1TKZ B;  3NBP B;  2VIC A;  2WAQ D;  2DT9 A;  1UFL A;  2FIU A;  2ZDO A;  3Q8P B;  1RTJ A;  2BDP A;  2YQ3 A;  1U09 A;  3U02 A;  2A6O A;  1RA6 A;  2MLX A;  4ZJL A;  1RTJ B;  1PYT A;  1NJW A;  3UDC A;  2LLZ A;  4IRC A;  4ZVP B;  1N5V A;  4I64 A;  4DQR A;  2F4V F;  4DPY A;  5A8R B;  1D1U A;  3BQ0 A;  2K1R A;  2VBZ A;  4DHV A;  2CQI A;  2WVB A;  3QWU A;  5B0G A;  3WQP A;  4DR2 F;  4NML A;  2FVQ A;  2KT3 A;  3AQP A;  4Y2C A;  5KFI A;  1YJR A;  3LGN A;  1F60 B;  4I7F A;  3CTR A;  3B4D A;  2LU2 A;  4ZLN A;  3MFH A;  1VR6 A;  4PG6 A;  3KWM A;  3ETM A;  4HVZ A;  5HAN A;  3ILI A;  4CYU B;  1GMW D;  2V8G A;  2IA6 A;  4NL5 A;  3O8W A;  4K4X A;  2APO A;  4Y2K A;  1HNW J;  3EGZ A;  4YHH J;  3J7A N;  1VRQ C;  4DR7 F;  3KG4 A;  2PEH A;  3CDE A;  3GSD A;  1O6X A;  1VLY A;  4CM2 A;  1Z2Z A;  4PXE A;  2BM0 A;  1ZPV A;  5HLF B;  3BGR A;  2HZA A;  5DDO C;  4TY8 B;  3PR4 A;  4MK8 A;  4JI0 F;  1IBK J;  1IN0 A;  5KFS A;  1NPK A;  1UJ6 A;  3NCQ A;  4R5P B;  5L9N A;  4DUZ J;  2QEX S;  2MMY A;  1FE0 A;  3E01 B;  1HAR A;  4P52 A;  1YBA A;  1YQH A;  3AXM A;  2FDN A;  4DL3 A;  1SL0 A;  4ECT A;  1NK0 A;  3A8E A;  2LQ5 A;  3D66 A;  4DN9 A;  3J7Y I;  2Z0G A;  1SQE A;  1U1R A;  4PEO A;  1WSV A;  4K5S A;  5D3G A;  2GHW A;  2ADC A;  2NR0 A;  4GC6 A;  1RT1 B;  4RR5 A;  4F36 A;  2XLI A;  1Y0H A;  1S7I A;  1B0V A;  3J80 Y;  1C0U A;  1D09 B;  1BLU A;  1YG0 A;  4RKU C;  4JYA F;  2NZC A;  4JI7 F;  2U2F A;  2ATC B;  1GEH A;  2J0W A;  1UET A;  2CNK B;  3D0G E;  4WII A;  3PW5 A;  1N33 F;  1YZ7 A;  3S1T A;  4M94 A;  3QNW B;  5DM6 Q;  4QU6 A;  2GA7 A;  3CD0 A;  4YS2 A;  3CB4 A;  5E2Q A;  3H40 A;  1H6K X;  5G0R B;  2N82 B;  1FF2 A;  5IC4 B;  4OLO A;  3DOK B;  3UD5 A;  1IWA A;  1S6O A;  3OUY A;  2ZJQ Q;  4CI0 B;  3PKY A;  2V4J A;  4KAI A;  4BLG A;  1MSW D;  4X66 F;  3I5A A;  1EP4 B;  4K50 A;  3DDN A;  3DKD A;  4MJK A;  2JC0 A;  3VCD A;  3DC2 A;  2OAU A;  5CH7 B;  4IG3 B;  2YX4 A;  3AD7 C;  5IWA J;  1W26 A;  2DHA A;  1VK3 A;  1TR0 A;  1UPM B;  1W7W A;  3C15 B;  1HNV B;  2QJ3 A;  3CDA A;  1Q0N A;  3DHX A;  4NLQ A;  4OYB A;  4RNH A;  2WVD A;  4U96 A;  5G4D A;  4ER8 A;  3LP1 A;  1S0O A;  1TTH B;  2YNH A;  1Q81 T;  4CLZ A;  2CQC A;  2F8E X;  1KQG B;  3MCO A;  1FT8 A;  3KYL A;  3MM7 B;  4A47 A;  1NCL A;  2NXE A;  4UOF A;  1HWU A;  3IRW P;  2A2C A;  2NXC A;  5L1K A;  2RE1 A;  1KEK A;  2V5H G;  2XB2 D;  3FBB A;  1DLO B;  2UUW A;  4XDC A;  1NJX A;  1UA0 A;  2C1E B;  5IT4 A;  3M32 B;  2ZNY A;  1RHQ B;  4TU7 A;  2FHO B;  2RQC A;  1NEE A;  2ASY A;  3LAL A;  1HQU A;  1T11 A;  3FZ2 A;  3T9N A;  9RUB A;  3KLE B;  4USU A;  5J2M B;  1S72 S;  1JWW A;  1CPZ A;  1GNK A;  4U6P A;  1TFY A;  1BC6 A;  2OPQ B;  1PCA A;  2FZG B;  2QLF B;  5F9N A;  1WG4 A;  2H1Y A;  5SUH A;  1MWY A;  4X4Q A;  1NK8 A;  2V9K A;  1C0U B;  4KO0 B;  3CNQ P;  3I6P A;  3M2V A;  1RWP B;  3CCM S;  1CBK A;  3P49 B;  4W90 B;  2XUL A;  4WYL A;  4J91 A;  5J2P B;  1RT1 A;  2HK2 A;  1VBK A;  4KGZ B;  1EHW A;  4OYM A;  3SCL E;  5A8W A;  3J7Z T;  3KNA A;  3HD2 A;  3BKF A;  3CMQ A;  3TQE A;  3MUM P;  1O5J A;  4B9T A;  4QW8 A;  1KNZ A;  4NRU A;  4A46 A;  2L9D A;  2QLW A;  3JSR A;  5HVG A;  1IJF B;  3OT9 A;  3ZC4 A;  3OTE A;  5D0H A;  2ZZN A;  2PDA A;  1MU2 B;  2GIQ A;  4TXS A;  3GJR B;  2KG1 A;  1RYS A;  4HH0 A;  2VOP A;  3E51 A;  3MF5 A;  5D78 A;  2ADB A;  1WF0 A;  4QWB A;  5HQM A;  1NKB A;  3SCI E;  1H38 A;  1Q16 B;  4F50 A;  2XWY A;  2YNF A;  3QSY B;  3NL0 A;  4ES3 A;  2IDE A;  3ITH B;  3QRQ A;  4CLL A;  4F4Y A;  4P10 A;  2H9Z A;  3MUV P;  4P2S A;  1YK9 A;  5F3T A;  2KG0 A;  2LVW A;  1XMQ F;  2BKN A;  4B3R F;  3NY0 A;  4YB6 A;  3V6D A;  3VTI A;  3R2D J;  1MNE A;  1NHU A;  1H98 A;  2XCA A;  1JNR B;  3SQO P;  4J9L A;  2OTJ S;  2BBE A;  3QIP B;  3Q23 A;  4CNZ A;  2N4C A;  3BV8 A;  1GX6 A;  1HW9 A;  2KVQ E;  1R8B A;  3MMC B;  2HZC A;  1BE4 A;  1FX4 A;  1N36 J;  4DL7 A;  5IV3 A;  3DYA B;  1U0S A;  1CJK B;  2YKP A;  2Z58 B;  4XO0 A;  2BXJ A;  4K8R A;  2ZD1 B;  4WWS A;  2BVZ A;  3OFE A;  1UAW A;  3ET6 B;  1NME B;  2ZH3 A;  1SL2 A;  1NH7 A;  1NB2 A;  1S6P B;  3CDW A;  2VAS A;  2AIR B;  2O3D A;  3ZZY A;  4HH1 A;  2D3Z A;  3H5Y A;  5MAO A;  2HVH A;  2M4M A;  2ZBP A;  2YKQ A;  3NGK A;  3SQG B;  2Q6C A;  1N4L A;  1FDB A;  2R2U A;  1WUU A;  5HAO A;  1UVN A;  3Q2T C;  1YJW S;  1WKJ A;  1I51 B;  2E1A A;  1VLO A;  1N5Y B;  2R8I A;  2V69 A;  2LYV A;  5KOW A;  2EFP A;  2FJW A;  4ITS A;  4M5J A;  4LF7 J;  1G7C B;  1FVQ A;  1S9E B;  1Q7Y T;  2IM3 A;  5LM7 E;  4JV2 A;  4WK1 A;  1QVG R;  2IVY A;  2A3J A;  3C14 A;  3NWR A;  5J1E B;  2G2O A;  2ZJR Q;  4O3N A;  5HBM B;  2P8I A;  5AXK A;  2XSF A;  3DCA A;  3KUE A;  1LNQ A;  3K5N A;  4ZK7 M;  2B43 A;  2HAF A;  1B3T A;  1X0F A;  3MPU B;  2P2C B;  4RNM A;  2D74 B;  2OEM A;  3HLU A;  4OJH A;  4QR1 A;  1H2V Z;  1RAG B;  3M8Q B;  4OV1 A;  4U8Y A;  4KTQ A;  3H4B A;  3ONQ A;  3A1Y G;  2OPQ A;  5AJ3 J;  4NA1 A;  1CVJ A;  3OL6 A;  1CJU B;  3CMA S;  4WFZ A;  1S10 A;  1RCO B;  3HXM A;  1H0H B;  1IQT A;  3CUN A;  2E9T A;  4GKJ F;  5FJ4 A;  2WW8 A;  4KHM A;  1T02 A;  2V8V A;  1L3S A;  3W3S A;  4DOZ A;  4PWW A;  4WKY A;  2HMI B;  2RSQ A;  4BWJ A;  2C2R A;  5LOQ A;  2KFY A;  1VK8 A;  2FHJ D;  3QT8 A;  4A8Q A;  4ZP9 A;  1T9U A;  2GVZ B;  3TI0 A;  3I96 A;  4KHR A;  2E5J A;  1VQ8 S;  1JKH A;  2JX2 A;  1S1V B;  3IXQ A;  3CJS A;  4NI2 B;  2ROP A;  5KFX A;  1Y10 A;  3TO8 A;  4KV8 A;  4ILL A;  4IG3 A;  3PJX A;  1WNE A;  2LQ9 A;  4O4G A;  3H42 A;  3W61 A;  3EPI A;  4DI6 A;  4YY3 F;  2KU7 A;  1R8P A;  1UP1 A;  4FPR A;  3PRD A;  5F3Z A;  3HMJ G;  1QTN B;  3AXK A;  2HFS A;  4QWC A;  3QWP A;  3W63 A;  3H2L A;  3N28 A;  1JXE A;  1N54 B;  2VQF F;  3S6E A;  4Y65 A;  1VCT A;  2YPY A;  1WD6 A;  4CCH A;  2NYH A;  4E0D A;  1S1X B;  1QUV A;  2DR6 A;  4Z7Y A;  5C7P A;  4LRD A;  3BO2 A;  1CUL A;  1FK9 B;  2B7C B;  3FBF A;  2OPP B;  5JVH Q;  4C8Y A;  5KFA A;  5LSO A;  2W9C A;  3MPD A;  4ID5 A;  5D8H B;  3JSB A;  3OXG A;  5EN1 A;  2I5J A;  5B09 A;  2CJK A;  2UVR A;  1QAX A;  1NHV A;  1RU1 A;  1FJG J;  2DPI A;  1HBM B;  4OYO A;  1SI9 A;  3PJW A;  4TY9 A;  4AE5 A;  3BPD A;  1FES A;  3A8I A;  4NLP A;  4OYW A;  4CTA B;  1NK4 A;  2XCP A;  3DLL Q;  5E7O B;  2VOD A;  4DQQ A;  4M5N A;  1IQZ A;  4NWB A;  1FHT A;  1HBN B;  1PBA A;  3OXF A;  5E41 A;  3E01 A;  4WFN Q;  1P8G A;  2RQK A;  5BR8 J;  3M8S A;  5DG7 A;  4MKY A;  2K7J A;  5M2R A;  4UF4 A;  3TVZ A;  4G65 A;  4H4O A;  3VAI A;  4USH A;  2BOA A;  5HAT A;  1I6J A;  5IOL A;  3SBM A;  4TQR A;  1IUJ A;  3UCZ P;  3AOC A;  4KKO B;  2JWN A;  1VHF A;  1N56 A;  4MIW A;  4B08 A;  3RR8 A;  2J7W A;  1PYO B;  3IFE A;  3FBE A;  4LSZ B;  1S9F A;  4B3M F;  2IVM A;  4CLW A;  2QC3 A;  1DFD A;  1UL3 A;  5F8G A;  2DGX A;  2JVO A;  4CYU A;  2XM3 A;  4PCQ A;  3D68 A;  2CWX A;  5HI7 A;  3C16 B;  3HHL B;  4DUZ F;  3JSY A;  4WU3 A;  3WIU A;  3QSI A;  1FKO A;  5KG0 A;  2IMO A;  4KB7 A;  3MM8 B;  4ED1 A;  2KXH A;  9ATC B;  2FJD B;  1IBC B;  4FVM A;  1CQM A;  1S6P A;  2DH9 A;  2LMI A;  2ZBQ A;  2YNG A;  3N9U C;  1PJ5 A;  3NGT A;  5A8R A;  3CC2 S;  4DV6 F;  3KDO A;  3Q2S C;  4CLK A;  3T5K A;  4X64 J;  1VQ5 S;  1RHU B;  1EB0 A;  5K20 B;  3BR9 A;  1CJK A;  1IKW A;  3GII A;  2C2E A;  1Q53 A;  3FEY B;  1HR0 J;  1WOP A;  5H9E J;  2RU9 A;  4JYA J;  1VS3 A;  2E44 A;  5KFZ A;  2VG5 B;  4JI7 J;  3PVX A;  5IM0 B;  2XMU A;  3QAT A;  1K47 A;  2HQ3 A;  2VFS A;  2PA8 D;  3N5B A;  1NHK L;  4EFA C;  2MXY A;  3RR7 A;  2IA0 A;  2KKH A;  2XSJ A;  2VJV A;  1S76 D;  3I4H X;  1YJU A;  2JNJ A;  1WHW A;  1WDT A;  4OHW A;  2J5A A;  2VFR A;  3TAM A;  4DX7 A;  4YR3 A;  2UXC F;  3RGI A;  2ZC4 A;  3EWG A;  2BW7 A;  2FUG 9;  2KO1 A;  4J90 A;  3TVK A;  1R0B G;  4MYU A;  3IM9 A;  3WC0 A;  2Z30 B;  3FRY A;  2V67 A;  4F25 A;  4ED5 A;  2KVI A;  3NXZ A;  3POT A;  3G8T A;  3KK1 A;  2ZH6 A;  4OHY A;  3T1H J;  1O0P A;  1P6T A;  1FI4 A;  1TL5 A;  1KN6 A;  4X66 J;  1RIS A;  4NCG A;  1B0T A;  3US5 A;  4F3M A;  5A0Y B;  4PZV A;  2F9D A;  5IWA F;  2HS4 A;  4ZVT B;  4EMD A;  4KGX B;  4QIE A;  5DDP C;  3QGI A;  3EGN A;  3SSS A;  2CJX B;  4DV7 J;  3PDN A;  2Z2Y B;  4JI8 J;  2MQM A;  3PRV A;  1BMQ B;  1MU2 A;  1PIL A;  3FVY A;  3HM9 A;  2YX7 A;  1XWL A;  2MKH A;  3W9I A;  4C6A A;  4RUC A;  3JTN A;  1M1H A;  1Y5L B;  1H2U X;  1L5U A;  2YKO A;  2OFG X;  1VC5 A;  2H5E A;  2QYC A;  2IC3 B;  1JLQ B;  3L7O A;  2R2S A;  1T03 B;  1ELO A;  1FFG B;  3TNV A;  2HWT A;  1I1G A;  2V94 A;  3JYT A;  4DR2 J;  2OUG A;  2F3J A;  3BN7 A;  3EGW B;  1S6U A;  3FQL A;  2QYG A;  1S1T A;  2UZA A;  1HWJ A;  4CZC A;  4R0E A;  2VBX A;  2Y8W A;  2KJV A;  4ZVE A;  2DNP A;  2OPP A;  2DJW A;  3BKU A;  5BYS A;  1HNX J;  1S0M A;  4TNO A;  5K8P A;  1R89 A;  4P73 A;  4AFF A;  2DXD A;  3EGV A;  2WOM B;  4ZIW A;  3C6U B;  1S79 A;  2AEJ A;  1AUD A;  1C4A A;  2PI4 A;  3M30 B;  2B4P A;  3M8P B;  2R8H A;  1Q86 T;  1ZM9 A;  2CJQ A;  4LR9 A;  2NUU G;  5F0U A;  4ZN3 A;  1U1L A;  2DHX A;  3PV8 A;  1D9F A;  3FEX B;  2W01 A;  4PXC A;  2E1R A;  4OZL A;  1UW4 A;  3EDR B;  4NCB A;  4JI1 J;  3VGU A;  2PN6 A;  1FJC A;  1X4H A;  3GPA A;  4C8O A;  4MAK A;  3L4B C;  5I3P A;  1JKH B;  5T14 A;  1NPP A;  2C2D A;  1CEZ A;  3C15 A;  2NYI A;  3WHI A;  1RT6 B;  3NWG A;  5GAH U;  3EMT A;  2XI3 A;  3OBI A;  1NSQ A;  4DL0 C;  1D8Z A;  3X3U A;  1FRH A;  2I6W A;  2K8G A;  2V4J B;  1Y7P A;  1J5O A;  3I0S A;  1YIT S;  2UUC J;  1WOO A;  2FQQ B;  1KLM A;  2CJ9 A;  2DH8 A;  2RDD A;  1JX4 A;  2HND A;  3IGN A;  2H5J B;  5FD1 A;  1B7F A;  2EC0 A;  3Q24 A;  1RWK B;  1VMB A;  1X8D A;  2VBW A;  3S7R A;  2HFV A;  5G0R A;  1E6V A;  2UUA F;  2QL9 B;  4Z7C A;  3TEH B;  2GML A;  1OYD A;  3ZZT A;  1VFJ A;  2E5L F;  1TKT A;  2NCK L;  1U25 A;  3CD7 A;  1GT8 A;  4LSN B;  2MZQ A;  3MMJ A;  3QPI A;  1UVJ A;  2J9D A;  1GAO A;  4RX6 A;  1FEH A;  4TKT A;  2ZH5 A;  1U2C A;  2VPW B;  3E8O A;  4DCP B;  5KT3 A;  1LW2 A;  4CLU A;  2QTW A;  3CDU A;  2MKS A;  2GC8 A;  4DN0 A;  1DQ9 A;  4ZP8 A;  4FXD A;  4O3Q A;  2QMW A;  2YWK A;  4CT9 A;  3EE3 A;  2DD8 S;  4PWD B;  2IBO A;  2H5I B;  2HKE A;  2MYF A;  3QRP A;  4QYZ K;  4QIF A;  3C66 A;  2CQG A;  4TY8 A;  3TVY A;  3G6V A;  5CYJ A;  2ASD A;  4O0N A;  3JAM Y;  2CPH A;  1YTY A;  1FA0 A;  3SQG A;  2CYY A;  2BOP A;  1N5S A;  4EGL A;  3UD3 P;  3ILJ A;  1RAD B;  4OI4 A;  2UVV A;  1GMU A;  2RHS B;  4UQT A;  4HT7 A;  1RWU A;  3H4D A;  2QSW A;  3P8B B;  4PAA A;  5I3U B;  5K9F A;  2WBM A;  2ZOG A;  3Q8Q B;  3R5C A;  3NS6 A;  3RBZ A;  3LWL A;  2YKN B;  1NXI A;  4RL1 A;  2HIY A;  3SZ2 A;  2CQ4 A;  5HJY A;  1XR5 A;  4D3G A;  1XC9 A;  1WAC A;  3BDE A;  3MM5 B;  3J81 j;  2Q3P A;  5AJ3 F;  2XGP A;  2QA4 S;  5K8N A;  1M1K T;  1TMJ A;  2FGC A;  1CJT B;  3FNN A;  3L95 X;  4FNI A;  5H9F J;  5KT4 A;  5KAK A;  4B3S J;  5D0G A;  2VJU A;  4J9P A;  3UCU P;  1VI7 A;  3CDB A;  3FCH A;  2DNY A;  5GAH I;  4DR1 F;  4L73 A;  4ZCK A;  4FZV A;  4NAS A;  3GJT B;  1URN A;  3KFW X;  2YKN A;  2YXL A;  4BWM A;  3ITH A;  2AYE A;  3HVW A;  3NBP A;  4OZ5 A;  5DET A;  4UY8 5;  2DNR A;  4K4V A;  2HSE B;  1FD8 A;  5LMN F;  4M63 A;  2XO6 A;  2Y1R I;  1XR6 A;  4JV0 A;  2COL A;  4QWD A;  1WEX A;  3NG8 A;  1NDP A;  3C2P A;  2ZM6 J;  3T1H F;  2R8G A;  1CSJ A;  1FDD A;  3IC1 A;  1JLB A;  1ZAX A;  3KOA A;  3PEH A;  1P1T A;  4ZCM A;  4N5S A;  5ETR A;  1P27 B;  3BBF A;  1FXL A;  2Y3Y A;  4OHX A;  1KOH A;  5HMZ A;  3HHN B;  2KH9 A;  1KC8 T;  5B7W A;  4S0M A;  1K44 A;  1YZ6 A;  1JLE B;  2VOO A;  5LMU F;  1DY3 A;  3EZO A;  1EX8 A;  1SB6 A;  2QMU B;  2RQM A;  1HNI B;  3D1O A;  1JJ2 R;  1HA1 A;  2VQF J;  4DMZ A;  1WG5 A;  2DIS A;  2EVZ A;  1VQM S;  3VAJ A;  2FY1 A;  3DLK B;  1LK7 A;  3DGV A;  1M5H A;  3GIR A;  4PG7 A;  5DJB A;  5J2P A;  1QTM A;  3MM6 A;  1KON A;  4P75 A;  2CVI A;  2MQQ A;  2V2Q A;  3M2V B;  4KRW A;  2HK3 A;  3OJU A;  3O3L A;  2ZUA A;  1R6V A;  1VGY A;  2BKP A;  2E5H A;  2GHV C;  2POK A;  2XG8 A;  3Q89 A;  5AXL A;  3UO0 A;  5J2M A;  2ZUG A;  3QGP A;  1HQU B;  4KT0 C;  3SMZ A;  5ETM A;  3N5F A;  4DV3 F;  1NDL A;  1RKJ A;  4OI0 A;  3KG1 A;  4ERD A;  1X4G A;  3M6V A;  5D4P A;  4FYV B;  5HJX A;  4DU8 A;  2MTL A;  1FTR A;  3NGS A;  1BQX A;  2IJR A;  3V4I B;  3CJ4 A;  2IAJ A;  2BUN A;  3I9V 9;  3KLI B;  5D6G A;  2X51 A;  3I0S B;  1RA7 A;  2B5J B;  3U1M A;  5EDW A;  2YTC A;  2AYB A;  1NPR A;  1P9Y A;  4NZ6 A;  4ZVU B;  4B02 A;  2OPR A;  3OFG A;  3M9N B;  2X1F A;  5C5J A;  3RW6 A;  3LP1 B;  5KG1 A;  1TKX B;  3HKZ D;  4OMF G;  1HPZ B;  3MMB B;  3GJQ B;  1C1C A;  2EG1 A;  4J5O A;  3ZNJ 1;  2MGZ A;  2R7R A;  1RTD B;  3M2U B;  2MZJ A;  3BH7 B;  1RAC B;  5A2Q U;  4ED8 A;  1SQF A;  5B0C A;  2CPE A;  4V1A k;  3OLA A;  4DUY F;  3TZW A;  4WPA A;  1SJF A;  2VG6 A;  3MHY A;  3QLH A;  4I6Y A;  1AZS B;  4AQY F;  4OZ2 A;  3OUY B;  3M8P A;  5I4M A;  3HP6 A;  1N48 A;  3RYL A;  3LWM A;  1SJR A;  1RWV B;  2DNK A;  1Y3J A;  4M5K A;  1FRM A;  1N0V C;  2H3E B;  3R7S B;  3AOA A;  3K8V A;  2OGU A;  3MD3 A;  3MCM A;  4ICL B;  3UR0 A;  4K0K J;  1EQ0 A;  2RD5 C;  2XEX A;  3DXS X;  1CJV B;  4FKX A;  2KFN A;  4DLG A;  4PG4 A;  2H65 B;  2EFO A;  3IG1 B;  3D6H B;  3DRR A;  4CO4 A;  2CA9 A;  4ZPC A;  2DVI A;  1OSC A;  1V3S A;  2HBZ B;  1LEO A;  4DV4 J;  4ILM A;  1LFW A;  1OO0 B;  1WDD A;  4NA2 A;  2CQ2 A;  2J8S A;  2XNQ A;  3QMQ A;  3R6L B;  2PEB A;  4I2P B;  4IDK B;  5KT5 A;  3NOG A;  2H48 B;  1PGZ A;  5GAD I;  2BJ9 A;  4F02 A;  1YRT A;  2EEY A;  1RBO B;  2WB1 D;  3FFI A;  3OL7 A;  4ZVO B;  1S97 A;  2UXC J;  1T9V A;  4RBV A;  4NZ0 A;  4WP9 A;  2C28 A;  2Z56 B;  1HFE L;  2R2R A;  3HHL D;  4KR0 B;  1RKI A;  2X1G A;  4LVN P;  1XER A;  5A8K B;  2R9L A;  4FYY B;  2ALZ A;  2W7A A;  2K3I A;  2VPZ B;  2FZC B;  1BQM A;  3CJ3 A;  5E3Q A;  4QIW D;  3VGV A;  3HSD A;  4X4N A;  4ECQ A;  4M5M A;  3VAF A;  3GU0 A;  2VG7 B;  3G9C A;  1SCJ B;  4HHU A;  4LSL B;  4JI3 F;  2DRA A;  2VUG A;  1CLF A;  2GQQ A;  3GP9 A;  4ZVF A;  5IC6 B;  3BRE A;  3ZTR A;  4C11 A;  2C3P A;  5THW A;  2BM1 A;  3K5M A;  3IR6 B;  1XMO J;  2CWK A;  1I94 J;  2RUG A;  3OTD A;  1REV A;  4ZCL A;  2IJF A;  4P2F A;  3I82 A;  5CCL A;  1JJH A;  1Q8L A;  5IZH A;  1BWE A;  1RQ0 A;  1ZM4 A;  2DH7 A;  3BBC A;  4ELV A;  1A0O B;  4C3M A;  4O0I A;  2G0J A;  2K1R B;  1HQE B;  4L75 A;  4U8V A;  2MY7 A;  1ZBT A;  5IM0 A;  1DQ8 A;  2R8J A;  2VG5 A;  3IBF B;  2AP6 A;  1LWE B;  3G4S S;  3RBX A;  3PYD A;  2KN4 A;  5GME A;  2GGP B;  1R8C A;  4GKK J;  4UQG A;  1TKZ A;  4WF9 Q;  5DG8 A;  4RW8 A;  1RHM B;  4ZVR B;  2H4W B;  5J2N A;  2AYG A;  4WFY A;  1FWP A;  3QO9 B;  4KIA A;  1WF1 A;  2M88 A;  4A8O A;  3QT7 A;  2MHE A;  3H5U A;  4WJB A;  3O6Q A;  2R7Q A;  2VA3 A;  5LJ5 Y;  3F41 A;  4WYW A;  1YKW A;  2HUR A;  5HK4 A;  5AT1 B;  2XYG B;  4DG1 A;  3A8K A;  3JB9 k;  1UJ4 A;  2JSX A;  2CJY B;  1FJE B;  4ES2 A;  1RAF B;  4B3T J;  2HFN A;  1W25 A;  1UVI A;  1CC7 A;  2G0C A;  2RIJ A;  2F4V J;  3M4X A;  5AE3 A;  3PW4 A;  3JQJ A;  2XY6 A;  4IO9 Q;  4XAK A;  2B9W A;  1BXN A;  4ZP6 A;  4ZLP A;  4ZHR B;  1LWX A;  1TL7 B;  2BRK A;  3D6M B;  3FC9 A;  4ZIV A;  4O44 A;  5HMW A;  2OIH A;  2UVW A;  5EHH A;  4C2M A;  1PAU B;  2F8H A;  3T5J A;  3R5B A;  2MKK A;  2HVD A;  2CG8 A;  2NPI A;  1HL6 A;  4QQB A;  3L09 A;  4U95 A;  3W8G A;  2V9W A;  2C2M B;  1NK5 A;  4LFC F;  5EWG A;  2Q1L A;  4M5I A;  1RT4 B;  2VH7 A;  4B9V A;  2CAJ A;  3TJ8 A;  3MUT P;  4WP3 A;  2E66 A;  4TQS A;  1DTQ B;  4J9S A;  4RNF A;  3LW5 C;  4JI4 J;  2ZKU A;  2M5Y A;  2RDJ A;  1OPI A;  2O1P A;  4I56 A;  4L3K A;  2VFV A;  2ZC3 A;  4DR4 F;  2A2D A;  3G86 A;  4ID5 B;  2YQ0 A;  4F3Q A;  4EO6 A;  2I8E A;  1Q82 T;  1RT3 A;  1RTZ A;  2BJ8 A;  3CO0 P;  3KHR A;  1XNR J;  2ATL A;  1MWZ A;  1HD1 A;  3Q8R B;  4HDH A;  4DJB A;  3G6X A;  3T1Y J;  1S1X A;  2JEI A;  4RWX A;  2DR8 A;  1VBY A;  2ZIT A;  3GSI A;  2F8M A;  4F0M A;  3NCP A;  3CCJ S;  2BAN A;  2RIL A;  3QJL A;  4IFV B;  2RDI A;  3ILO A;  1JNZ B;  1LW0 A;  2CPF A;  2MQP A;  4DV5 F;  1X9M A;  5KFE A;  1DAX A;  4Q7A A;  1AT1 B;  2KXF A;  2N3O A;  4QW9 A;  1D8Y A;  1U0H A;  2B4O A;  1NDC A;  1EAY C;  1NU4 A;  3LGH A;  2LCW A;  2UV8 A;  1SQG A;  1Z4U A;  1GMW A;  3CJ5 A;  1KQS R;  4K5R A;  2FVR A;  3HZG A;  3FK4 A;  1MWQ A;  3FSI A;  1UWA A;  4XDD A;  3DI6 B;  3KMQ A;  1IWG A;  4EZ9 A;  3KK2 A;  1RYR A;  1RUS A;  2PC6 A;  2HNZ A;  1ZOT A;  3IM8 A;  3J81 U;  2QN6 B;  2ZE2 A;  2BR0 A;  3W62 A;  2BJ3 A;  2EXU A;  2CQ3 A;  5F8L A;  2BQR A;  1L3T A;  3GYX B;  1TUW A;  2HRU A;  4KFB B;  1PAE X;  4P7V A;  4J9Q A;  2KT5 A;  1T3N A;  4LF6 F;  4W92 B;  1FNX H;  5KFG A;  2CPI A;  3QJP A;  3R5G A;  3R1L A;  4DR1 J;  1F5A A;  1YGY A;  2B9E A;  1DTT B;  3VAL A;  1TAU A;  4OYX A;  3IGV A;  1JLG A;  3HSZ A;  2ACM A;  4M5H A;  3TJA A;  3UNY A;  2GJI A;  4ZLL A;  3K5P A;  2IY5 B;  1R3N A;  2NXU A;  3H2U B;  2XMA A;  5HN0 A;  1SJ1 A;  1AB8 A;  2YVS A;  4N77 A;  4ZPB A;  4PR6 A;  3WDO A;  4C8M A;  3W2W B;  2DEI A;  4JBC A;  1J27 A;  3KJV B;  2QMX A;  3IR5 B;  3CVK A;  1F0X A;  2BRL A;  3S01 A;  2UU9 F;  1Q7L B;  1T9Y A;  4IG0 B;  2XYP B;  3THT A;  4UTG A;  3VGS A;  2VHG A;  4OYA A;  4QJV A;  2LFV A;  3I5C A;  1ZAV A;  4CO5 A;  3DGP A;  1IKX A;  4C0B A;  4LF1 A;  3TZX A;  2UUB J;  1OY9 A;  5C25 A;  4RW9 B;  1HNZ J;  2GCF A;  4DS5 A;  4EBC A;  3MXH P;  5DRK A;  1XNQ F;  4ETZ A;  3ENQ A;  2ZD1 A;  5HL7 Q;  1N88 A;  3NOC A;  4NLX A;  1M5K C;  3DYA A;  2I2Y A;  2CZ9 A;  3GIM A;  5IV4 A;  3JAM U;  4NLG A;  2O01 C;  1SKR A;  4C0H A;  4IRK A;  2CPD A;  4PWU A;  3PYG A;  4CH1 A;  1SIZ A;  5EX0 A;  3MM9 B;  2GZO A;  2HHX A;  1HHQ A;  2FB0 A;  3LPE A;  5HP1 A;  2F7V A;  4N76 A;  3BZQ A;  3JXO A;  4X4S A;  3R1H A;  3G6E S;  2Q79 A;  4NXN J;  4Y00 A;  3W64 A;  3O44 A;  3LAN A;  2XTJ P;  5C42 A;  3GIL A;  3IAM 9;  2DGT A;  4MKV A;  2HWI A;  2DO0 A;  2JLF A;  2LXF A;  3MTJ A;  2PD1 A;  2FZK B;  2GMH A;  4JV1 A;  4K7Q A;  3A8J A;  4WE1 B;  1IBL J;  2AF6 A;  2OSR A;  2F1F A;  3RRK A;  1L3K A;  3W2V B;  4C97 A;  5K8O A;  4PPD A;  4USK A;  3TQ1 A;  4ZJQ A;  2D9O A;  1R0C B;  1B4S A;  1HD0 A;  3ADA C;  3M2R B;  4PQA A;  4J9M A;  4ECS A;  3AB2 B;  1UTA A;  1PJ6 A;  3PAC A;  2ZOM A;  2HYI B;  4LJM A;  1R27 B;  4X62 F;  4JI0 J;  3KLF A;  1MRO A;  1EQM A;  4CLS A;  1UWB B;  2DGO A;  3FEZ A;  2HHH F;  1E6Y A;  2K2P A;  2WSC C;  1WI6 A;  2CDR B;  1N6Q B;  2YWE A;  1WHV A;  1S57 A;  2PMH A;  3MMB A;  4RW9 A;  3AB4 B;  3GCW P;  1H3D A;  1WHY A;  5KT7 A;  1NJY A;  4QYR A;  4OX6 A;  3CC7 S;  4X84 A;  1V5V A;  3FRZ A;  2ZH7 A;  1VQ4 S;  3MAH A;  3M8Y A;  4MFB A;  4O4R A;  3R2C J;  1NJI T;  3RRG A;  4P2M A;  3J81 Y;  1FKP A;  1U7L A;  1ZM2 A;  4Y0F A;  1FD2 A;  3HDS A;  4X65 J;  3KJV A;  1IXK A;  3J7Y U;  2EFV A;  1R0A B;  2GQC A;  1RT5 B;  4G1Q B;  4N7T A;  4B9L A;  3D2W A;  1KDN A;  5KFM A;  2KHD A;  5CD4 H;  4B9U A;  2V2V A;  4AYB D;  3PKM A;  2LA4 A;  1TL1 B;  3AQO A;  3ISN C;  3R5A A;  3W66 A;  2E29 A;  2R42 A;  2HS3 A;  4E2F B;  3EVW A;  1YVF A;  2B9Y A;  3LP0 A;  1R8A A;  4DX5 A;  4YDD B;  5CA5 A;  1RAE B;  2AT1 B;  2PE8 A;  3CCT A;  1QAJ A;  5CD4 A;  2JC1 A;  3I31 A;  3MEE A;  4LRB A;  3B6B A;  4DZ6 A;  4RLE A;  2QV6 A;  4K4W A;  1S12 A;  1UVK A;  4U9R A;  2MSS A;  2GO9 A;  3B4M A;  4B9N A;  2V8P A;  2PII A;  3P96 A;  4ZVH A;  3EYZ A;  2YH1 A;  2HWH A;  3DRS B;  3KUG A;  2LEC A;  3PIO Q;  1M90 T;  3EIC A;  2FHK A;  2DGU A;  3ZFV A;  2HHV A;  1HNV A;  1X4E A;  3H20 A;  1MMD A;  3O2I A;  3DRP A;  3GE9 A;  3UCG A;  4B3O B;  4LFB F;  4TN2 A;  2QL5 B;  3GV7 B;  4BDP A;  1HHT P;  2V8D A;  2CDQ A;  3HI9 A;  4CO0 A;  1JMT A;  1IKV A;  1GXL A;  2FLP A;  2JZ5 A;  4DL2 A;  3CCZ A;  5KFL A;  4RNN A;  5J2Q B;  5KTQ A;  4PQU A;  4ZP7 A;  4WZQ A;  1B64 A;  2W9C B;  3OFH A;  5F8M A;  2KXN B;  1UZD A;  4GO5 X;  2ASL A;  1VQ6 S;  1B99 A;  2DEJ A;  2E9R X;  1K0T A;  3HPO A;  2ROG A;  3FMW A;  5ETP A;  1T05 B;  4A8M P;  3D7S B;  3CIM A;  2YNI B;  1VC0 A;  4IH6 A;  3RG6 A;  3MR6 A;  2HIQ A;  1FER A;  1HLW A;  1TQL A;  3A3P B;  4M5L A;  3SDE A;  5ETT A;  4YR2 A;  4IOC Q;  2CNO B;  4M5G A;  2UXB J;  4NLO A;  4NZ7 A;  1EIY B;  1ACM B;  1TL3 B;  1VRT A;  1C2P A;  5B08 A;  2HHU A;  4LMZ A;  1BQN B;  4KGV B;  5KG5 A;  3LGM A;  5K5M A;  4DXL A;  2JDJ A;  5KFT A;  2AV5 A;  4ED7 A;  2LU1 A;  3DOM B;  3W8P A;  2ZHB A;  3CCS S;  4FXW A;  4PRF A;  4I6A A;  4Q8E A;  3D67 A;  3OJS A;  4F0K A;  4LF4 J;  1TV6 A;  2PO4 A;  5D0R A;  4QBU A;  1EAR A;  3MEG A;  5E3C A;  4R5P A;  5A6W A;  4K59 A;  4RU9 A;  1NK6 A;  3BGL A;  4DPT A;  3BGR B;  1TVR B;  3HKW A;  5DQH A;  1DTQ A;  4RPF A;  3K5O A;  1QD1 A;  2Q43 A;  3VR1 A;  2W7O A;  5L1L A;  1YHQ S;  1IBM J;  1RWO B;  2GW8 A;  2HNY B;  2YY3 A;  3PY8 A;  1HI1 A;  1T9X A;  2HGN A;  4NMX A;  2W2M P;  2DNQ A;  5BR8 F;  2CJA A;  2G4B A;  3IWN C;  1X4C A;  3MAA B;  5FLX U;  3KLG B;  1SV5 A;  1SVD A;  2E7X A;  2OD6 A;  3D9B A;  4B3R J;  2B6A B;  4DFJ A;  4F7V A;  3T5H A;  2WSE C;  4ANE A;  1FFS B;  4I7F B;  4WXO A;  6FD1 A;  1S7H A;  3ENV A;  1OJ4 A;  3GR1 A;  4JUZ A;  2QLB B;  5HQL A;  4U7C A;  1VJQ A;  2FLL A;  4DL4 A;  4G3I A;  1NRK A;  2AWZ A;  4J9O A;  3GG0 A;  1T95 A;  2B51 A;  3VQT A;  3M9O B;  4TVA B;  2QLX A;  6AT1 B;  1SKW A;  1UVL A;  2V50 A;  4UT4 A;  4O23 A;  3UDE A;  2BJ1 A;  4H4M A;  3OL8 A;  2DK2 A;  4DS4 A;  4WZM A;  2FHJ A;  2VL1 A;  5I42 B;  3K57 A;  5LXY A;  2N3L A;  1NBE B;  3HFK A;  3QT6 A;  3T1A A;  2XZD B;  2OP5 A;  4LRF A;  5CQG A;  4DR5 J;  1U49 A;  4O3P A;  4RW8 B;  1T9T A;  4CLF A;  4PG8 A;  3GV8 B;  1WOS A;  1X5T A;  4ZPD A;  4F04 B;  2E9Z A;  3R9L A;  1LWE A;  4LF5 J;  4NXM F;  3ZZU A;  5F8H A;  2CVE A;  4K4S A;  3HJV A;  2EBG A;  1HYS B;  3P6Y C;  1SBR A;  5KFP A;  1HQE A;  4GVL A;  3BM7 A;  5CYM B;  1JLA B;  1WC1 A;  3KUH A;  3LF0 A;  2HLT A;  2NSB A;  1FRI A;  2E7V A;  3D0I E;  4OHV A;  4Y28 C;  3SFU A;  3TZZ A;  2J76 E;  4DV1 F;  4F4A A;  1RWX B;  1I5O B;  4FS1 A;  4HAC A;  3TUJ C;  1WKL A;  3PCO B;  2D3U A;  4QZV B;  3KLG A;  2YX1 A;  3OR1 A;  1K8A T;  4A4J A;  3VVU A;  4NYO A;  2XBP A;  2HQF A;  2V0N A;  2VG7 A;  4QOT A;  3OTO J;  4JV5 J;  2UP1 A;  1YIJ S;  2MQ8 A;  1RWN B;  3I5B A;  3K2Y A;  2P5V A;  3PXG a;  5IQ6 A;  2IDL A;  2U1A A;  2AD9 A;  2VA2 A;  4GRS A;  4IH5 A;  1UZH A;  3LP2 A;  1WF2 A;  3T19 A;  3H7H B;  1FRJ A;  4ZMM A;  1RT2 A;  4AXJ A;  5A8K A;  3IWX A;  1QSL A;  2EPI A;  2HQC A;  4NLY A;  3J7Z 5;  1ROF A;  2W2N P;  3MAQ A;  3PX6 A;  4WU2 A;  2QRR A;  3P3D A;  1VBZ A;  4ID8 A;  3PTW A;  3UQS A;  1KBR A;  4TYA A;  3VVT A;  4DBQ A;  2Y9H A;  1TEL A;  4RJV A;  4RBU A;  4AND A;  4ZPA A;  2J9D E;  2ZWO A;  3N0V A;  4AL5 A;  4DV2 J;  2L9W A;  1RSC A;  5B0D A;  1MML A;  2QSF A;  4GVB A;  2MKI A;  3M8Z A;  1UA1 A;  2V34 A;  2H51 B;  2P6S A;  3CIZ A;  3JQM A;  4UY8 T;  2QLJ B;  4C4W A;  2H4Y B;  1YX2 A;  3KTQ A;  3O1L A;  2B4U A;  3ZNU A;  1VRU A;  1LK5 A;  3DRR B;  4OZ1 A;  4LRC A;  2ZZT A;  3OSN A;  1D9A A;  3J7A 1;  2AJ0 A;  3T3F A;  4OI2 A;  1KQF B;  2W8K A;  3H2V E;  1RAJ A;  1S1U B;  1ZS6 A;  2GAG C;  5F41 A;  4DX6 A;  4DPW A;  1ZZN A;  2R7U A;  4CLP A;  1HNX F;  2HFO A;  2JVR A;  4L3N A;  2KB2 A;  1DRZ A;  2RS2 A;  1PIE A;  2ZH4 A;  5J2Q A;  3RB0 A;  1K0V A;  3TP2 A;  5GMK a;  4FF2 A;  1X31 C;  2W2O P;  3KLH B;  4FYW B;  1FO1 A;  4TLQ A;  5EUH A;  1KVI A;  1RTI B;  4F67 A;  3RB3 A;  1QVF R;  1BHN A;  2FVP A;  4LF9 F;  1BWV A;  4IFY A;  3OVS A;  3G87 A;  3DRP B;  1F3F A;  2HS0 A;  1PC5 A;  2DNG A;  4IOB A;  5E3A A;  2MGZ B;  3FGV A;  1FXR A;  2AJ4 A;  5FII A;  3V5R A;  3CCU S;  4ECX A;  3ZZ0 A;  2PSZ A;  3K17 A;  2FHM A;  4A8F A;  2HFU A;  2IM0 A;  3CT9 A;  2A0F B;  3OVA A;  4DR6 F;  3OSP A;  1LWC B;  5T7L A;  4RUB A;  2AJF E;  4JB8 B;  4ELT A;  1RAB B;  3Q8U A;  5GAE U;  1Q95 G;  1SJQ A;  3WZ0 A;  1LWF A;  2G2Y A;  3AOD A;  1HI8 A;  4AUK A;  1VQN S;  5KFY A;  3KK3 A;  2AGQ A;  1S6Q B;  1S4F A;  3D3C J;  4DSI A;  2BYC A;  1N32 F;  3HD1 A;  3VAG A;  3BDP A;  4C98 A;  2Y0B B;  4Q0B A;  1W2I A;  3M1V B;  2CG4 A;  2LQ8 A;  1OQ3 A;  1RT2 B;  1DUR A;  1OMS A;  2G1D A;  2DHG A;  2IMW P;  4F4Z A;  1Q8I A;  2CPY A;  4BCA A;  2ZKT A;  5KG7 A;  5K14 A;  2P9G A;  2BAB A;  4I69 A;  2I38 A;  2Z4P A;  3AJD A;  4IQM A;  3UDV A;  1R8H A;  2G9O A;  3JSM A;  1J5E F;  2VPY B;  4OZJ A;  4LIW A;  1KP6 A;  2CFX A;  3HF5 A;  5L9X A;  4YME A;  2XS5 A;  2QE5 A;  2IRU A;  4R8U B;  3OR1 B;  4C48 A;  4F4W A;  4ZN1 A;  3R27 A;  3LUY A;  4JI2 J;  1YJ7 A;  2M9K A;  1JIH A;  1RT7 A;  1OPZ A;  2VD3 A;  3C6T B;  3CJR A;  1VYA A;  2CUY A;  4I2Q B;  5D4L A;  4B17 A;  5LL6 d;  4X64 F;  4X4P A;  4ED3 A;  4KH0 B;  2JJ4 D;  2QA1 A;  2XI2 A;  5B0E A;  2RKI B;  3TX0 A;  3WX8 A;  2HHS A;  4AXI A;  1S49 A;  1IKY A;  3ZZR A;  2GVD B;  1TP7 A;  4DSE A;  1RAA B;  1TL4 A;  3ICL A;  2HHW A;  4FNH A;  1L3V A;  3A4T A;  1O51 A;  3DLJ A;  1XQI A;  1HKA A;  4KPC A;  2M7S A;  7FDR A;  1KLN A;  4NX9 A;  3W65 A;  1NAQ A;  2MKY A;  2BE2 B;  2OPS A;  4OL8 A;  4C7Q A;  3MR7 A;  3W2V A;  5KFO A;  3SI8 A;  3MR3 A;  4RUH A;  5C24 B;  2DB1 A;  3M6W A;  3SSR A;  3NS7 B;  3RZA A;  2DHH A;  3RB6 A;  5EWF A;  3ZO7 A;  4JP8 A;  4OZ3 A;  5E3P A;  1QSY A;  3HT0 A;  4GKJ J;  4ECZ A;  5M2P A;  4V19 X;  3MI7 X;  3SXL A;  1NSP A;  1D9D A;  2KFZ A;  2VQE J;  1AFI A;  2HQI A;  4FBT A;  1JK9 B;  2E1M C;  3GMG A;  5BJR A;  5IT0 A;  2AZ1 A;  3RUB L;  4J9U E;  2AW0 A;  5T41 A;  5HRO B;  3PNI A;  4YFU A;  4RW4 B;  1Q8K A;  5L8R C;  1TU0 B;  2EKY A;  1SV5 B;  1IKY B;  1D0E A;  3KHL A;  1NDK A;  2KJW A;  4UW2 A;  3IRX B;  1EET A;  2DGW A;  7AT1 B;  4EBE A;  2RU3 A;  4KHP F;  1G2E A;  3RB4 A;  5LMN J;  1NKE A;  1WOR A;  5GVQ A;  3UVJ B;  1VQL S;  1ZH5 A;  2HVE A;  3EM1 A;  4M95 A;  3TUZ C;  3I0R A;  4C8Z A;  4V19 J;  4OYP A;  1TVR A;  3U1N A;  1D3W A;  1UFK A;  4M5D B;  1TK8 A;  4URS A;  2AQ4 A;  1U2R A;  1HBO B;  4K4Z A;  2RF2 B;  3CUL A;  3DLG A;  3MEG B;  4MMO A;  1YRU A;  3RU0 A;  1TV6 B;  1VHI A;  2M8H A;  2QL7 B;  1Q79 A;  4YQW A;  3G71 S;  1HWK A;  4ZS6 A;  5LSL A;  5KFN A;  1L3U A;  2AU0 A;  4ZOS A;  1IM4 A;  5K14 B;  4DV0 F;  1SJ4 P;  5E3R A;  1FDN A;  1KRP A;  1OQ6 A;  4MK7 A;  2CAD A;  3FSX A;  3WBZ A;  2HBQ B;  3TRG A;  2ZBI A;  4IUF A;  1S9G A;  8AT1 B;  1T94 A;  1JLG B;  4CQ1 A;  3TX8 A;  5LJ3 Y;  5BXI A;  3DU6 A;  5KG6 A;  1QSS A;  3BR8 A;  2OTL S;  1FE4 A;  5M2U A;  4MIB A;  3TYT A;  1U1N A;  3SDE B;  2K06 A;  5C2C A;  3KNG A;  2XZW A;  4YUD A;  5DG9 A;  2PFF B;  4RW7 A;  1PYS B;  2PMW A;  1T0T V;  3OPK A;  4G1I A;  2FLO A;  1I3O B;  4FF3 A;  3DU5 A;  2C2N A;  3DMJ A;  4P71 A;  1LWC A;  1KKH A;  1E6V B;  3NGD A;  5L1I A;  3BSC A;  3PFO A;  2CPZ A;  4OZ0 A;  1GTE A;  2YH0 A;  3MCN A;  2VZ9 A;  1U2F A;  2DNZ A;  2HPU A;  3NCR A;  1RE1 B;  3IS9 B;  2XYH B;  5J1P A;  2C2Z B;  4P74 A;  1M0S A;  2B0G A;  2DY9 A;  1NLK L;  4EWT A;  1LKZ A;  1NZ8 A;  2ZFH A;  4FXV A;  4Z37 A;  5DQI A;  4YHH F;  3CCE S;  4PUO B;  2DNN A;  4IKA A;  1QE1 B;  3IS9 A;  5AE2 A;  4LQ9 A;  1FX2 A;  1PJ7 A;  1YDL A;  1KOO A;  4N56 A;  3H8Y A;  2AMC B;  1XK8 A;  1X0P A;  4GO7 X;  1IBK F;  2GAH C;  2UVU A;  1JJC B;  2JEJ A;  4PAB A;  2J7K A;  2WBR A;  2UV8 G;  4RW6 B;  1JB0 C;  1NSK L;  2XHC A;  4NCA A;  1S1U A;  4CIO A;  4G6V B;  2VB6 A;  1PKU A;  2F65 A;  2M52 A;  2WB4 A;  4LIR A;  4RW7 B;  4ZVQ B;  1LW0 B;  4OFZ A;  3BQ2 A;  4DQP A;  2F5G A;  2DR9 A;  1M5S A;  2FD2 A;  1WWH A;  2BAN B;  2LQJ A;  2RJZ A;  5B0B A;  1Y9O A;  4Q2L A;  3C6U A;  1PSD A;  4ALZ A;  1GMV A;  1VIX A;  3UR3 C;  2PGC A;  3EPG A;  2AEF A;  3I9Z A;  3ILL A;  5GAE I;  4A8W A;  4GVB B;  2CKW A;  4RUA A;  3TOQ A;  1CS4 A;  1KSP A;  1KS2 A;  2BA9 A;  2WZ1 A;  2Z2Z A;  4N8O A;  4X4R A;  3DOL B;  2R7X A;  1KFD A;  2C3O A;  2F63 A;  4LF5 F;  2C3U A;  4NXM J;  1HBO A;  3EZ5 A;  2DCU B;  3IA0 A;  1OWX A;  3R7B B;  4M5D A;  4UZC A;  3D1Q A;  4Y34 A;  4ATN A;  2JH3 A;  4WTO B;  3NNA A;  4AL6 A;  1RK8 A;  1RZM A;  2HEK A;  4MYT A;  4K4T A;  3MGJ A;  1KFS A;  1RT4 A;  1IJE B;  1QDU B;  2H54 B;  3DLE A;  1U45 A;  3ENA A;  2ZM6 F;  3AHP A;  5RUB A;  2AKW B;  2ZZM A;  3MMA A;  4MKB A;  1URR A;  2R7V A;  1IR1 A;  4CLY A;  3C19 A;  1E6Y B;  1NND A;  1F9H A;  3CCR S;  3IRX A;  3TA1 A;  2V63 A;  5ETN A;  1UWB A;  1P9Q C;  3K7R A;  3CME S;  2NRE A;  1MRO B;  3LPY A;  1EZZ B;  2Y0S D;  2HAI A;  4ED2 A;  1OYE A;  2L3M A;  3IWL A;  3VZI A;  5DDQ C;  4P2X A;  4CH0 S;  3M6U A;  4A8S A;  4NCG B;  3M2R A;  1NSA A;  2EFQ A;  2YPZ A;  3UWT A;  5HQ8 A;  3BO4 A;  2J6U A;  1JLA A;  3D1H A;  2FVC A;  3MED B;  5D0E A;  2MJN A;  4HI1 A;  1HYS A;  2XMV A;  1BY9 A;  2D1C A;  4EZ6 A;  2X3D A;  2GX8 A;  2BAC A;  2DNL A;  3IAS 9;  4F8R A;  3HHD A;  2CQH A;  3BF4 A;  4DR3 F;  4QCL A;  3QO9 A;  5A76 A;  3K8W A;  2P6T A;  2XSJ B;  3A3N B;  4EK2 A;  5HP1 B;  1N36 F;  4JI6 J;  2IRX A;  2PT0 A;  3CD5 A;  1EJ7 L;  1K73 T;  1HMV B;  2XNR A;  5GMD A;  3W9J A;  1RXO B;  3KHG A;  3QGH A;  5SZT A;  1JQG A;  4DSK A;  4H4K A;  2MHN A;  3CF5 Q;  2RKI A;  5IT9 U;  4DPO A;  3MED A;  3OW2 R;  5L1J A;  5ADZ A;  4QWA A;  3D28 A;  3R6G B;  3CCL S;  3MM8 A;  3MPW A;  2ZNZ A;  3DGP B;  3IP0 A;  4URG A;  2X7I A;  2AJ1 A;  3KJQ B;  2CNN B;  4LF8 J;  2J6S A;  2E5G A;  3ZZP A;  5A2Q Y;  1VQ7 S;  1XJW B;  1N8R T;  4IR1 A;  2NQP A;  1V9O A;  2BJE A;  4J7C A;  2E5I A;  4ZIT A;  4NA3 A;  2XC9 A;  1U4B A;  1U6B A;  3M7V A;  3CED A;  4X4V A;  2W9A A;  4YN3 B;  1ZYQ A;  4WBF A;  5KFC A;  2ACY A;  4DFM A;  1DZ5 A;  4IRD A;  4PYA A;  1RAH B;  4WCE Q;  1ZA1 B;  4Q8F A;  3DLE B;  4YDX A;  3OR2 A;  4OHZ A;  2AGO A;  1HNW F;  3AA8 A;  3M8W A;  4KKO A;  4K2J A;  3BGU A;  4Y2M A;  4AL7 A;  2E1C A;  5DM7 Q;  4DV3 J;  3AT1 B;  4Q0B B;  2DCL A;  5DGA A;  3CD6 S;  2K3K A;  1HQ2 A;  5E33 A;  1C1B A;  1HIY A;  3MTK A;  4USJ C;  5CCM A;  4DZD A;  3LO3 A;  2C3Y A;  1UCN A;  2JOQ A;  3DDK A;  1C0T A;  1KTQ A;  2B56 A;  2RRA A;  3L7P A;  4CTA A;  5AXM A;  1N5T A;  3ZTQ A;  1HBM A;  2XS7 A;  4U7U D;  2VBY A;  5BYR A;  1N32 J;  4KYZ A;  3JQK A;  3DXB A;  3SFG A;  2X1B A;  2NXN A;  3F56 A;  2I5J B;  4CO1 A;  3HO1 A;  3SIP B;  3GWC A;  2HNZ B;  4Q5V A;  2IYI A;  2BV3 A;  4Q43 A;  2RVJ A;  2PMZ D;  4KJI A;  1F9F A;  2RRB A;  4IFY B;  4DSF A;  2G0I A;  2EFN A;  4LR8 A;  4EI2 A;  4WXW A;  3QID A;  5HVF A;  3KK2 B;  2K7K A;  3N6M A;  1RTI A;  3K58 A;  4NRT A;  4RW6 A;  1FCA A;  2CQP A;  2N4D A;  3DNC A;  5KT6 A;  2E5L J;  4OQJ A;  2DIV A;  3CJK B;  2DO4 A;  2ZHO A;  4JI2 F;  2VG6 B;  2LEA A;  3QLH B;  3VV2 B;  2QT7 A;  3QGG A;  3BH6 B;  4OJ3 A;  4CO3 A;  1U0H B;  5KFQ A;  1XMB A;  3VWS A;  3J80 U;  3Q8S B;  3M8R A;  2KM8 B;  1SL1 A;  2JEF A;  4PUO A;  2Y8Y A;  1RLD A;  1RTH A;  2AGP A;  5LXR A;  3MOJ B;  3KDN A;  3RJM B;  2D3O 1;  4OX8 A;  2MQN A;  2XY5 A;  3GV5 B;  2MPU A;  2W9B A;  4ECY A;  3OTB A;  3ETO A;  1N34 F;  1TKX A;  2KHC A;  2EG2 A;  5CHC B;  4RZR A;  1ZET A;  4DEZ A;  3PYF A;  3DRS A;  2KYZ A;  1VRU B;  5ETK A;  5EX3 A;  4ZLJ A;  1M1G A;  2DKO B;  2WON A;  2V4R A;  4HYK A;  2KZM A;  4E8U A;  2BMB A;  4F26 A;  4PG5 A;  1HW8 A;  1U48 A;  3EUN A;  1WG1 A;  4TLR A;  5DLF A;  1SC4 B;  2P9C A;  3GLJ A;  4OLP A;  2DNO A;  4MH8 A;  2BX6 A;  3CCW A;  3I87 A;  2V6A A;  2RH3 A;  2CZV C;  2Z8Q A;  3QFH A;  5CXT A;  2L08 A;  2DHS A;  2QA2 A;  2CPX A;  4H54 A;  2O5D A;  5EWE A;  4CRJ A;  3ELH A;  3GIK A;  1SUQ A;  4KE5 A;  3SSQ A;  3WIV A;  2NS1 B;  3CSK A;  1AYE A;  4ETX A;  2BZ2 A;  2XLK A;  1MG7 A;  4WP8 A;  3OR2 B;  5E5N A;  5CYQ A;  3M8Q A;  5H9F K;  2UXB F;  1SC6 A;  2AJ2 A;  2AHO B;  1GK8 A;  4NLV A;  3GJS B;  4QPX A;  3MM6 B;  4OYI A;  1YBU A;  5MLC V;  2RF2 A;  1RBL A;  3RBD A;  4NLT A;  4MFB B;  3QFW A;  3B54 A;  2IPO B;  3BQ1 A;  3EXC X;  2CZ4 A;  4HAC B;  2JEG A;  3C14 B;  3FCW A;  5LMU J;  4K4Y A;  1Y4Z B;  2XZT B;  3G8Q A;  4NLS A;  2R7S A;  1A9N B;  1S9E A;  3PYE A;  2JRS A;  5JXS A;  4USM A;  3BSN A;  3CC4 S;  2A10 A;  4CO2 A;  3AJ2 A;  3B78 A;  2WRM A;  4MTP A;  4ZPW R;  4ZVG A;  1Y5N B;  2A6M A;  1SXL A;  3TUI C;  1GTH A;  2DIT A;  4DG1 B;  3SCK E;  4DSJ A;  1OIA A;  2QA4 G;  2UU9 J;  3BBB A;  4RW4 A;  5KOX A;  3KLV A;  4B9S A;  2YKA A;  4GKK F;  5JMN A;  2HLU A;  3DRY A;  3EXY A;  4YP3 A;  2JL9 A;  1SC3 B;  4IR9 A;  4DV0 J;  4DWI A;  3IO1 A;  1NH8 A;  4OZN A;  5HO4 A;  4J37 A;  1WC6 A;  1WC0 A;  4DLE A;  1UFW A;  2J8A A;  4X4U A;  1YSJ A;  4WE1 A;  2AX0 A;  1YJV A;  2A1B A;  3OTC A;  2GGP A;  1RGV A;  2VFT A;  4H4M B;  2AYM A;  4ILR A;  4IYQ A;  4QR2 A;  4CDI A;  4ZVS B;  1VQK S;  3T6J A;  2PI5 A;  3AH6 A;  4DL5 A;  1JLF B;  2RB7 A;  4F3O A;  2BE2 A;  3TUP A;  2DRB A;  3SV4 A;  1UEV A;  4XPE A;  2VDI A;  1TUV A;  4A8X A;  4A8Y A;  3V6D B;  3FBC A;  4ZDN A;  5IT9 Y;  1FNO A;  2L48 A;  5L46 A;  2B6A A;  4HTJ A;  3BYR A;  3ZXW A;  4GC7 A;  4FYD A;  1XBW A;  4O3S A;  4UOH A;  1KHV A;  2VKR A;  2EKN A;  1S4E A;  2C2O B;  4DCO B;  1SKS A;  4LFC J;  5FDL B;  1Y00 A;  5C25 B;  1OS5 A;  2HNY A;  3C6T A;  4I2Q A;  3NKY A;  3CJ2 A;  1CQN A;  2GIF A;  4AQY J;  1VDH A;  2KT2 A;  3LOU A;  3VGT A;  2B7B B;  1DAR A;  2IM2 A;  4IG0 A;  4KBI A;  3WX4 A;  4DR4 J;  5GAG I;  3A13 A;  2AZ3 A;  4OJG A;  1U6F A;  1SH3 A;  3DOL A;  1S0N A;  2MST A;  1U1Q A;  4LF7 F;  3DOM A;  2ZH8 A;  4DFP A;  1LW2 B;  1FTC A;  4MT1 A;  1S99 A;  4FKY A;  2XMW A;  3E3X A;  3M1V A;  2KTQ A;  2RS8 A;  4EO8 A;  1TL3 A;  1VRT B;  1ZZF A;  1X5P A;  2ZWP A;  5A8W B;  3MUR P;  2OSQ A;  5GAG U;  2ZH1 A;  4IQX A;  3AOB A;  1AUS L;  1LOU A;  2FY8 A;  4CH7 A;  1AXQ A;  2DY1 A;  4KO0 A;  3SYZ A;  3IG1 A;  1S6Q A;  4BC9 A;  4DF8 A;  2X1A A;  2KL8 A;  2QZ8 A;  4P72 A;  4A48 A;  1FXD A;  2IM1 A;  1FFW B;  1LWF B;  2VKZ G;  1N5Y A;  2OJ3 A;  2YQ1 A;  1QAI A;  2J0S D;  4WIQ A;  4I67 A;  2BJ7 A; 
#chains in the Genus database with same CATH homology
 2DKO B;  4ZVO B;  1QDU B;  2H54 B;  3D6F B;  3NS7 B;  1RWM B;  1SC4 B;  1RWN B;  4ZVT B;  3KJN B;  2CJX B;  1BMQ B;  3GJT B;  2HBR B;  3EDQ B;  2C1E B;  2QL5 B;  3R7N B;  1RHQ B;  5IC6 B;  3GJS B;  2H51 B;  2QLF B;  2QLJ B;  2H4Y B;  2C2K B;  1RWP B;  2XZT B;  3IBF B;  1QTN B;  2QL7 B;  2XYP B;  1RHK B;  1RHM B;  4ZVR B;  2CNO B;  2H4W B;  2CNL B;  2HBQ B;  3KJF B;  3R6G B;  1SC3 B;  3GJR B;  4ZVP B;  1ICE B;  3KJQ B;  2CNN B;  2XYG B;  2CJY B;  3EDR B;  1RWW B;  4ZVS B;  1I3O B;  1RWO B;  3D6M B;  4JB8 B;  1PAU B;  2FQQ B;  1RHR B;  3P45 B;  2H5J B;  1RE1 B;  2C2M B;  2XYH B;  2C2Z B;  1RWK B;  4ZVU B;  1RHJ B;  2QL9 B;  1PYO B;  4LSZ B;  2C2O B;  2Y1L B;  4DCO B;  2Y0B B;  3GJQ B;  2QLB B;  3IBC B;  3SIP B;  1NME B;  1GFW B;  4ZVQ B;  2CDR B;  1IBC B;  1RWV B;  2HBY B;  4DCP B;  2XZD B;  3R7S B;  4DCJ B;  1I51 B;  1RHU B;  5K20 B;  3R5J B;  2CNK B;  2H5I B;  3QNW B;  2H65 B;  3D6H B;  5IC4 B;  2HBZ B;  3RJM B;  3R6L B;  3R7B B;  2H48 B;  1F9E B;  3P4U B;  1RWX B;  2P2C B;  1SC1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...