5IC4B

Crystal structure of caspase-3 deve peptide complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3 subunit p17
publication title Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 92
sequence length 92
chains with identical sequence D, F, H
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 5ic4B00
1F9EB 4ZVTB 1RHRB 3IBFB 2C2KB 3IBCB 2XYPB 2H51B 4DCPB 2H65B 2Y0BB 3KJNB 2DKOB 2H5IB 2H4WB 3D6MB 2QL9B 2CNLB 1I3OB 3R7SB 2XYHB 3GJRB 2H4YB 1IBCB 3GJTB 2XYGB 1RHKB 5K20B 2C2MB 1GFWB 1NMEB 3GJSB 3P45B 2CNOB 4ZVSB 3R5JB 4ZVUB 2CNNB 3KJFB 2QLFB 4DCOB 1PAUB 4ZVRB 1I51B 3QNWB 2QLJB 2QLBB 3R7BB 4JB8B 4LSZB 3EDRB 2CJYB 2FQQB 3GJQB 2XZDB 1ICEB 2C2ZB 3D6HB 1RHJB 2C2OB 1RWWB 2HBQB 2CJXB 1SC4B 2CNKB 2H5JB 2CDRB 1RHUB 2QL7B 3P4UB 1QDUB 3EDQB 1QTNB 2HBZB 5IC6B 3R7NB 1BMQB 1RHMB 2Y1LB 3NS7B 1RWKB 2HBRB 2XZTB 4ZVQB 2C1EB 1RWNB 3R6GB 2P2CB 1RWMB 1RWXB 1SC1B 1RWOB 4ZVOB 1RWPB 3RJMB 1RHQB 3R6LB 5IC4B 3SIPB 3KJQB 4ZVPB 3D6FB 2HBYB 1RE1B 2QL5B 2H48B 4DCJB 1PYOB 1RWVB 1SC3B 2H54B
chains in the Genus database with same CATH superfamily
2WW8A 2IFXA 3QO9B 4K2JA 3W64A 1FFGB 4P10A 3AJ1A 1QE1A 1I94J 1TV6A 3DKDA 3HSJA 3PKYA 4C8OA 1DURA 1P9QC 5CH7B 2CPFA 1KQSR 1XEZA 2DR9A 2BBEA 3J7A1 1TMJA 1U02A 2K06A 3FQKA 3QWUA 3PW0A 3MMCB 2UXDJ 5HLFB 1WKKA 2XGPA 2ZJQQ 2Q79A 2ZH5A 5KFBA 1SIWB 2DHGA 2WB4A 3EGNA 2E44A 2FJBB 3KKFA 4W98A 1KLMA 1OQ3A 1OYDA 3M8YA 2JWNA 4DV7J 3EICA 4ETXA 2QLXA 2K7KA 4RWWA 4C97A 1KN6A 4DLGA 3D0IE 3POTA 1V5VA 4MIBA 2C3YA 2ZBRA 2ASLA 2E5IA 1RWOB 3CEDA 3ZZZA 4QR0A 1LWCB 3TP2A 4IO9Q 3SCIE 2DNPA 1F2HA 3I87A 5IFMA 2Y1RI 3FSYA 2ZKUA 3P6YC 1Z4UA 3T1HJ 1OIAA 2BQRA 3BQ1A 3DN9A 4KIAA 1EIYB 4F0MA 2B43A 2YY3A 1VC0A 3SYZA 4HDGA 3DI6A 1DAXA 3AA9A 5M2UA 2X1FA 4I6WA 1V9OA 4IG0B 4WK3A 2UXBJ 2DNNA 3FK4A 2XI2A 3CMES 3E01B 1M5KC 1VHFA 2YTCA 3HHEA 4F2SA 2KG0A 3NGSA 4UY85 1QVFR 1KDNA 2VODA 2B8QA 2AZ1A 3IS9B 4EO8A 3BN4A 3QAUA 3DOMA 4EK2A 3ADAC 4E8UA 5T41A 1KONA 2QV6A 2B56A 4DV1F 4DSJA 3K17A 1MU2B 1TAUA 1MG7A 3MCSA 4B3OB 2XMVA 3MHYA 1PYTA 1A0OB 3IFEA 4QOTA 4LIRA 2X51A 2AWZA 2Q66A 5ETTA 1VK8A 4RUHA 6AT1B 1B3TA 4DR2F 4HI1A 3TQEA 4DSIA 4LF9J 3ZTPA 1HMVA 2W4DA 1PC5A 1BE4A 1HNXJ 1FXDA 3T1AA 2JC0A 1W25A 2XYGB 2G1DA 2V67A 2MQQA 4ZHRA 4OI1A 2KXHA 1REVB 1DRZA 4JI6F 3IAS9 3M8QA 4JI8J 3ET6B 2JHEA 1M5VC 3MM7B 4YB1P 2CWKA 1YTYA 2HHHF 1SV5B 3VAKA 1FI4A 5EGYA 2ZH6A 2CUYA 3VV2B 3SDEB 1B99A 1ZM2A 1FHTA 5C25A 2KG1A 1KS2A 2R8GA 2KT5A 1WORA 1S1TA 3I9V9 4RBUA 3UW1A 4DL2A 1HW9A 4NE9C 2RF2B 1FKPB 2PMWA 3ENAA 4U8YA 4QWEA 5LT5A 5ETSA 3QSYB 3IN5A 4K4ZA 2V69A 1AUDA 3C6TA 4UZBA 3HT0A 4C8NA 2RSQA 3T9ZA 2D41A 4KB7A 4F2RA 1APSA 1XERA 2G0CA 5I3PA 3OQ2A 1UVIA 3MEEB 2B4VA 4YHHJ 5C5JA 2EWHA 4OZ2A 1NXIA 2VZ9A 2AEMA 4B08A 2KYXA 4F7VA 3AQOA 2ZD1A 3PKMA 4GKKJ 2NXCA 5CABA 4DFKA 2VBZA 4ETZA 2VUGA 2W7OA 3PO4A 4FNIA 1S1XA 2R7RA 3OLBA 9ATCB 3VCDA 4U6PA 3SV3A 4USUA 1S7IA 1WWHA 4FF1A 1JLBB 1M1HA 1TUWA 4DUYF 2E5LJ 3MM6B 2E1MC 4Y2MA 3MMBB 1YG0A 1VBXA 3WZ0A 3KJQB 4CT8A 3K5LA 4PYDA 2VQEF 3Q0AA 3HM9A 2KL8A 3HHKA 1EB0A 2JSXA 4G1QA 1WJ9A 3L7UA 4HTIA 3MD3A 1UW4A 4TQSA 2BANA 2UP1A 3TO8A 4DSEA 2XS2A 2V2ZA 4XK8C 1REGX 1RAHB 2KHDA 1S1WA 2J0XA 4X64J 4HL9A 4TU7A 4C11B 5KFIA 3NMRA 2BKNA 2IMOA 1GX5A 2GIFA 1YHQS 2UUAF 4M5HA 3R5AA 2DXEA 2R9LA 1J27A 5I4MA 2V94A 2H5EA 2YKNA 2B51A 1BMQB 1UPPA 2BKPA 2PGCA 1E6YB 4LRCA 4ECWA 3BGRA 2PE8A 1SH3A 4PG6A 3L9ZA 4XPCA 4ZJOA 4WYWA 3GG0A 3EZOA 4WYLA 3KLHA 2JOQA 4J9UE 1RISA 4KAIA 3P3DA 4L3KA 1C0UA 5KT3A 4IOAQ 4F26A 1G1XA 2RU9A 1IN0A 3HZGA 2H5IB 1UWBB 3R8YA 4ALZA 2CQBA 4IRDA 1BHNA 3GIIA 2XLKA 2R7VA 4AYBD 2HS0A 3TYTA 2CNLB 1I3OB 1QUPA 2EKYA 2J76E 4AQYF 1RAFB 1HA1A 3W5ZA 5K14B 1WF0A 1KLNA 1PAUB 3HKWA 4PXDA 1VC5A 1NK8A 1V3RA 5D4PA 3FSXA 3QZ8A 3OL7A 1Q8LA 3FBFA 2CQ2A 2YXLA 1SL1A 1JJCB 1NDLA 1VR6A 3MFIA 1YJRA 4R8UB 2VA2A 5J1EA 2QX0A 3QATA 5HL7Q 2JX2A 4MIWA 2GFFA 4RW8A 2EBEA 5D0HA 3ONQA 4M5DB 1SJ4P 5H9FK 4JUZA 3J81U 1N56A 2LMIA 5J2MB 1LW0A 3HSDA 5SUHA 2MKKA 4A8QA 4YB7A 3QMQA 1NDCA 3OVSA 1S0VA 2VASA 5DZ7A 4FYVB 5D4LA 1RSCA 1YJUA 3IR5B 3N6MA 2CJAA 3ISND 3EZ5A 3BPDA 3CCRS 1DLOA 4GKJF 1LV5A 3DLHA 1XMQF 4ES1A 3MAAB 2J6SA 1S9EA 2NR0A 1VQ7S 3Q89A 3V6HA 3VAFA 2HRTA 4Y00A 4ILMA 3LP2B 5DG8A 2DH9A 4URSA 4ECTA 1VQLS 3N4WA 1C4AA 4JYAJ 5DQGA 5L9XA 3MECB 3M6XA 3JSMB 2ABYA 4QU7A 6FD1A 1NK0A 1RT1A 3W2VB 2ATCB 3V4IA 2YNIA 3GFZA 2VFSA 4OLPA 4ED3A 3R1LA 1T9UA 1IJFB 2RDDA 1S4EA 1EARA 1KFDA 2JFKA 2VG5A 1OPIA 4EBEA 5GAEU 3C6UB 1SL0A 4LR9A 1PSDA 3T19A 4DWIA 4O0NA 3GONA 4KH0B 1BXNA 4K4VA 3JSYA 1VYAA 2YQ0A 4ZITA 1KBRA 3KUEA 3TX8A 2WAQD 2ZOGA 4OX9J 1RT4A 3AT1B 4KR0B 1A6LA 4E0DA 3TJAA 2AHOB 2YWKA 5HMYA 3VAJA 2J5AA 4EMDA 1AB8A 3L4BC 4DPWA 4LIWA 1IBKF 4JV0A 4QW9A 4QWCA 4DZ6A 4KBIA 3KK3A 3K0JA 2MQMA 3N79A 3NOGA 2CNKB 3CVKA 2QL7B 4FXWA 1Z2LA 2QRRA 2GS8A 2UVUA 1HKAA 5DLFA 3KUGA 4ZDNA 2GCFA 1TL4A 2HHVA 5B0DA 2OLWA 1NEEA 3UNYA 3BKUA 3KK2A 3CC2S 4MJKA 2FIUA 3OTBA 1RBOB 2XM3A 2ZUAA 2GVDB 2VQFJ 3GV8B 1ZM3A 4ERDA 4O3PA 4IR9A 5J2NA 3H0PA 4WF9Q 4DPXA 3FUYA 3Q22A 2VONA 3C15B 4LF7F 1CJUA 4DN0A 4LRBA 2OH2A 2QEXS 5A76A 2KJWA 1ZH5A 1GXUA 2NLWA 3Q8QB 1LWFB 4EYHB 1WEXA 3DLEB 4X4SA 3D2WA 4RUCA 5E3RA 5KT6A 4CLWA 2HZAA 1D1UA 2LA4A 4J9NA 1Y9OA 2DPIA 3IG1A 4NLTA 1TV6B 2JL9A 3RB3A 3A8JA 2EG2A 2VG7A 3RRGA 1CULB 2R8IA 2V2VA 1TZ0A 4YP3A 4WK1A 3M30B 2MGZB 5I3UB 2WOMA 1EAYC 3LP0A 2YX4A 1KKHA 4EZ9A 3PW5A 4K0KJ 3QBCA 2L9NA 2DHHA 2UUBJ 1KLMB 2RS8A 3D1OA 3ISZA 3BH7B 2NZ4A 1NU4A 3LGHA 2GVZA 5JMNA 3OTOJ 3TWZA 4Q0BB 1X4BA 3O2IA 3VQSA 1YJVA 5FDLB 5CHCB 3H4BA 3QPIA 1H98A 2DKOB 2FD2A 3TA2A 2P6TA 2VH7A 4EBCA 3FKBA 2BJ9A 2W2QP 1KNZA 5EDWA 2Z2MA 3QT8A 1UFKA 2CJYB 5HQ8A 2CPHA 1I1GA 4ECQA 2VPYB 5CD4H 1RT3B 4L76A 2DD8S 4LFCF 1IJEB 3KJVA 2Z56B 2BJDA 3MMJA 3CIMA 2BM1A 1HBNA 2XY6A 2RQKA 2C2NA 1EKSA 1YIJS 1YITS 2D9OA 4MKAA 4F4WA 1JLAB 1V6HA 1XR5A 4OYZA 4DV4F 2UUTA 3T5KA 2EK1A 3M32B 2HQGA 2FLPA 4MTPA 1UFWA 4LT6A 1Q7YT 4JI0J 4WFNQ 1R6VA 4IOCQ 5KFXA 3JSRA 4RLEA 2ZJRQ 1UA1A 1LKZA 3AOCA 3CXCR 3MOJB 3FMWA 3OW2R 3BF4A 2AD9A 1VS3A 1WTBA 1WUUA 4P2XA 1SC4B 1K0TA 1Q86T 3ILOA 2GV1A 1FVSA 2HFVA 2O3DA 3QJJA 4WFXA 2YX7A 3D1QA 5I42A 3M8QB 5KT2A 2F1FA 2C3MA 1SI9A 5IC6B 4FF2A 4NEYA 4ED0A 2ZE2B 5LSOA 2G2OA 4IG3A 1HIYA 3BB5A 1HHTP 3UI3A 4LF8F 3OD2A 1JXLA 1TL7A 4O3NA 1TU0B 2MKYA 4PEOA 4CYUA 3LPEA 4K4WA 1U0HA 3DNCA 5KFUA 3N6NA 4I7FB 5C25B 2PN6A 2ZM6F 5GVQA 2ZH4A 2KZMA 1UEKA 4O3SA 3OTDA 4WCEQ 1HNVB 5GMEA 1Q81T 4MKYA 2EC0A 2DHXA 3H5XA 4RW6A 4HEA9 4F02A 5LXRA 3M8ZA 4H4OA 4N7TA 4ZVHA 2QLFB 4LVNP 1H38A 3JYTA 1UEUA 2Q1LA 1GK8A 1RTIB 4AXJA 3IRWP 2PIIA 2FB0A 1SUQB 3OJSA 2R7XA 3P8BB 3NNHA 2SXLA 4XDDA 2ZOFA 2XTJP 2ZBIA 4DR2J 2NSBA 1FO1A 1T3NA 1SJRA 1N8RT 2Y1JA 2BW7A 4K50A 2DRBA 3PYEA 2ZH1A 2XMTA 1X31C 1IKYB 2MSTA 3BBFA 2D9PA 3S8SA 4JI6J 4KKOA 1X4GA 4HDHA 1S6QA 3CCLS 1MLAA 4UY8T 4NCBA 5DM6Q 1HWJA 1P1LA 5IT4A 1S1XB 2B9WA 5F8MA 4ZOSA 5CYMA 5BR8F 4NLUA 4DV6F 2NXUA 4CNZA 3DLGA 2X1AA 4I67A 5KFYA 2J7KA 5ETVA 3P96A 2IIHA 4CLKA 2HW3A 5A8KB 3EVMA 3BH6B 2MLYA 4DR7F 4NX9A 2ASYA 3KLVA 3A4TA 5F8HA 3CE8A 1SJ3P 3H25A 2XCAA 2BJ7A 3MAHA 3GJQB 4MKVA 2HNYA 1TR0A 4I2QB 1RHJB 2I5JB 1HARA 2LQ9A 2HHXA 2V8HA 3VVUA 3SCLE 1RT7A 3HVTA 4AL5A 4AD6A 2C42A 1I5OB 3Q2TC 4DI6A 1M5OC 5CD4A 3D68A 2KH9A 1U25A 3UN3A 1S1WB 4P2MA 2VICA 1S1UA 4CO0A 4ZJLA 3QZ7A 3HHNB 2GMHA 1NJIT 1RWPB 3TZZA 2BE7D 2NPFA 1OMSA 4LRAA 3OSNA 1IBMJ 4P2SA 3ZZUA 4UOGA 1IBLF 4RL1A 3ZZRA 3H2LA 3T41A 2KM8B 3PW2A 3T1YJ 5DG7A 3HHLB 2UV8G 2OELA 3D0HE 4FDFA 1RADB 5B0GA 2V4JB 4DUYJ 2OP5A 2HHTA 3KLHB 3AD9C 4O44A 4JI1J 3TRGA 4FS2A 3MUTP 1C0UB 3VZIA 1SJ1A 4RW7A 1OJ4A 1HNWJ 1X9MA 2QYCA 1QAIA 2C2OB 2QA1A 3CMQA 1HHQA 1NHKL 5EWFA 2OHDA 1ZS6A 2ZJPQ 4V19X 1FXRA 2XB2D 2DEIA 4NLWA 3PY8A 1S0OA 1NJZA 4DL7A 4KHPF 2QE5A 3GSIA 3OL6A 4F4YA 1NK4A 1QD1A 3HVAA 5L1IA 4CO5A 2FJWA 2MXYA 2M3DA 2Q6BA 3VQTA 3SIPB 2UUAJ 1HQ2A 4KTQA 1U7LA 2RQMA 2WRMA 1EX8A 1U26A 4B9UA 4PXCA 4RW8B 2VC1A 1RAEB 1WF2A 4YOEA 2LP4A 2KRRA 3DDKA 2KU7A 1RTDB 4DR6F 1D8ZA 1JNRB 2XMWA 3VVTA 2CJKA 1RLDA 1IKWB 3HJVA 3GR0A 4B3TF 4LSNB 3FMBA 3MPYA 2CAJA 1UP1A 3BS9A 3M6WA 3X3UA 2DRDA 4DU7A 1HI0P 4U95A 4H4MA 1IUJA 3HD1A 2RMLA 1QSLA 4ES3A 2LQ8A 1A7GE 3GFYA 1PKUA 1N5QA 3MPUB 4U67Q 3CC7S 3JSBA 5C2GA 1T05B 4AQYJ 4CTAA 2WB1D 4Q8FA 1DTQA 1U09A 2CDQA 2HFSA 2APOA 2R4FA 5KG1A 1TL3A 2LDYA 3N6LA 5HN0A 1S97A 3BQ0A 3THPA 1TK0A 4KJIA 2GJIA 1LOUA 2XO6A 4B9LA 3VGTA 2A3JA 1RT1B 3V4IB 2DO4A 1KD1T 1XK8A 1VRTA 3WIVA 4LREA 5CXTA 5DQIA 2EFOA 2M70A 2DT9A 1FX4A 3MMAA 2YWWA 4WXWA 3PJ9A 2HK2A 2ZFHA 4I4BA 4L6V3 2V2KA 4Q2LA 4PQUA 4RR5A 3G96A 3BM7A 1NMEB 1PJ7A 1RB0A 3W9JA 1CS4A 2Q3PA 4RNHA 3HX9A 3T9NA 4RNMA 2KXFA 1C1BB 2GGPA 4DV3F 1RT4B 4IO1A 3MUMP 2MQNA 3ZZYA 3PHTA 3K5NA 2PEHA 2XMUA 2RS2A 2B5JA 5KFEA 3DOKA 4HVZA 5KOWA 2RIJA 1QM9A 3KG4A 3FNNA 3BV8A 1LFPA 3UDVA 4GKJJ 1B0VA 5C7PA 4KO0A 1XMQJ 4DR3F 1FESA 2GO8A 2NYHA 5K5MA 2HQCA 1OSDA 3KK3B 3GYXB 1ZOTA 2VD3A 4RUAA 2V8GA 5DJBA 1IKXA 1Y11A 2FHKA 1VFJA 5KFTA 1NK7A 2H3EB 2M4MA 2C2RA 2VFUA 4NASA 1F9FA 1HQUB 5KFNA 4C6AA 3ZC4A 1HWUA 2E1PA 4G3IA 2XGQA 2PMZD 4DL3A 3GCWP 4F4AA 1EP4B 3FEXB 4Y2CA 2EEYA 3DRSA 3KK2B 3PYGA 3GCXP 2HG4A 3MFHA 4AL7A 4GMKA 3JQKA 4JI7F 2QN6B 4DSLA 3MR5A 4DF4A 3EYZA 4OYAA 3UCZP 4CP5A 3DFEA 4L74A 1CJUB 3NCQA 4LSLB 1S6OA 2KFZA 2HAFA 2Y9HA 3KDOA 4F4XA 4EO6A 5HANA 4DG1A 5GADI 4X65J 2DHAA 2IM3A 2HBZB 1NJYA 3GU0A 1RT2A 1NUEA 1PJ6A 1IBKJ 2F7VA 2JVRA 3J80Y 2JFDA 3DMJB 2E9RX 4K5SA 2VG7B 2MZSA 1BGXT 2MJNA 2NPIA 3Q86A 4UF4A 1UAWA 1XR7A 1JLFA 4PRFA 1ZZNA 1HBOA 3CCTA 2JEJA 1S59A 2FZKB 4DQRA 1NNDA 4I2PA 4CLUA 2XO7A 4N77A 1T7PA 2XY5A 3DLKB 4WXOA 2ROEA 5KG3A 1H2VZ 1JLEB 3B4MA 5B0FA 2LDIA 1VLOA 2C2MB 1NPPA 2LEPA 3OXFA 4TY9A 3TANA 1MMDA 3V81B 1I6JA 2GA7A 5D0EA 1HHSA 2R42A 1X8DA 4FF3A 4UZCA 1TKXA 1QLNA 2XWYA 3I5CA 4IRCA 8ATCB 5DS7A 3PIPQ 4CH7A 1KWMA 2RDIA 1FD2A 2R8HA 4X4TA 2IC3A 4LFAF 4G1PA 5FJ4A 2HVDA 4LBIA 2LU1A 2IM2A 4LF7J 2ZUGA 2ALYB 1K73T 2JVOA 2WVBA 3EMTA 2FY8A 2FHOB 3UN2A 4IRKA 1J5EF 2IRYA 3M2VA 4FNHA 5KFWA 1RWXB 2IM1A 1FX2A 2JZ5A 3EE3A 5C24B 3I32A 2IMWP 2MSSA 1X4AA 3KJVB 1U1RA 3CCES 2R7TA 2R2TA 3NAIA 2YH0A 5KG5A 4LF6J 1WSRA 4J9QA 3M4XA 4WKYA 1N36J 4IH6A 1HBNB 3MM5A 1CJTA 2UZAA 5A6PA 2UVVA 3KLFA 4DUZJ 2AYEA 4JI2J 3G86A 2HAIA 4PXBA 5AXMA 2IRUA 3JAMU 2LQJA 3CF5Q 5IQQA 3LA0A 1OS5A 1RTJA 3H8YA 4LMZA 4BBYA 2XNQA 5E3CA 4KPYA 2Z58B 3TZWA 4NXMF 1TKTB 4J9SA 5IV4A 3A8IA 5E2QA 3GV5B 3MM8B 4KFBA 3PHEA 1HNIA 1FJ7A 5BYQA 4WP8A 4N76A 1X4EA 2L41A 2HQDA 4ED6A 2UXCJ 1HFEL 3W65A 4PQAA 1UL3A 3PO5A 2BW2A 3WX4A 4Y0FA 4ZPWR 1XMOF 5H9EK 3MCMA 3KHHA 2I8EA 2ZITA 2IHR1 1ZBTA 2ZDOA 2CG4A 3DRRA 3I6PA 2N3LA 5I42B 1VQ6S 3AA8A 3OVAA 1VQYA 3IM9A 5F9LA 1RU1A 1HR0F 3TZXA 1FA0A 2BE2B 1XNRJ 4WE1B 2HNZA 2EFNA 4X66J 1C4CA 3TNVA 4Y65A 1O0PA 5AJ3F 5K9FA 1JJHA 2F40A 2HWIA 4P7VA 1RHKB 4PG5A 5FLXU 1U0HB 4RW9A 1JX4A 3A3PB 2Y3YA 2AP6A 1Q82T 3GIRA 4RZRA 3QGGA 3F73A 1FNOA 5D6GA 3K57A 3L09A 4H4KC 3D6HB 3SV4A 4DV4J 2KFNA 4DX7A 2AV5A 1NK6A 1XR6A 3FCHA 4WP3A 2YWEA 4KV8B 2BE9B 4WFBQ 1PO6A 1CPZA 3NWRA 4O3QA 1N5YB 1SQFA 2CRLA 1FTRA 3DRYA 1JLGA 5KG6A 1PJ5A 2W9CA 1FKOB 1RA6A 2M88A 1BQNB 3W5YA 4ZVFA 1GQEA 2GAGC 3GIJA 1NKCA 5CYQA 3D1HA 4GC7A 1FE0A 4TU9A 2GQ2A 2UVRA 3NNCA 3B6BA 5KFAA 4DSFA 2F8EX 3CT9A 4KKOB 2IAJA 3GP9A 1K1QA 1PCAA 5T7LB 4DV0F 1YLXA 4LF8J 2V50A 2OPRB 3A12A 5D0RA 4AL6A 3TX0A 3NGDA 2G1HA 5KFPA 3B82A 2IBKA 3MURP 1U6FA 1Q5YA 4CZCA 3EDRB 3VGSA 4NMLA 2Y8YA 2ZHAA 3DLGB 3AOAA 4ECXA 4M5IA 4DFJA 2ZM6J 3FBBA 3WIUA 1M1GA 4PZVA 1NB2A 3I0RA 2NCKL 5AE3A 4USTA 2W2OP 5L1LA 5KG0A 1AT1B 1YJNS 1ZTWA 2Z2YB 3WX8A 2HNYB 1VC6A 2BQ3A 2UUCJ 2ERRA 1KEKA 4F36A 4LBHA 2LYVA 3R6LB 3KK1A 2D3O1 1N5SA 1YBUA 4OX6A 2FJEB 2WK4A 3MEKA 4OYWA 2FVQA 1VQSA 2MY8A 2CA9A 3V6KA 2ZZNA 2OPQB 2F9JA 1HNZF 3R1HA 3TUZC 2WVCA 3M9NB 3ILIA 2FLLA 3TUPA 1Y4ZB 1WSVA 2XEXA 3BEGB 4U7CA 4HT5A 3QLHB 1SKSA 1T9XA 3DC2A 3V5RA 2G2ZA 4Y2KA 5KFQA 4X62F 3Q2SC 3UD5A 1IQZA 1Q16B 2O1PA 1X5PA 2ADCA 4IFVA 1WHWA 5E3QA 3WHIA 2PMHA 4ZLJA 2WW4A 3EDQB 4RW7B 2KT3A 5A2QY 2QSWA 4J9VA 1RWKB 2FDNA 2O01C 3MPVA 2XZTB 4C7QA 1F5CA 4V19J 4J9PA 1HLWA 2ZC3A 2CQIA 2IJRA 4Q8EA 1GH8A 1RHQB 4M8LA 2AX1A 2P9EA 4EEYA 5IXUA 2JEIA 4LR7A 2BRLA 2KFYA 1F3VA 3PDNA 3A8EA 2C2KB 2HK3A 5C42A 1TTHB 4EZ6A 4URQU 3KNAA 5EHHA 5DDPC 2HLTA 1CVJA 1N52B 4UQGA 2MMYA 1Q1KA 4J9MA 1R89A 3EX7B 1VJWA 4DDFA 1YQHA 5DQHA 1SQEA 2NREA 4ZPDA 3N01A 5KFFA 2F9DA 3B4DA 2BOAA 2CJ9A 3BBCA 2V4RA 3V6DA 4IUFA 3G6ES 4N8OA 5GAHU 1IBLJ 1FDNA 2AEFA 3NS5A 4MK7A 1LXJA 2R3VA 2W2NP 3CJ5A 4DFPA 2BV3A 2MY7A 4IOBA 1FDAA 4NRUA 3W2WA 1UMJA 4QYZK 5A8WA 3J7YU 3M1VA 2YKAA 2MYFA 2DHSA 2GHPA 3UE2A 5KFOA 4H4MB 5J2QA 2QFIA 4OX7A 2ZDPA 2DGTA 4NXNJ 4OV1A 4MT1A 4RNNA 1D9FA 3BR9A 3KWMA 1SC1B 1TP7A 1Y10A 2W2PP 2N3OA 1RYSA 2M0GB 2YPZA 3KHRA 2MZTA 2MQ8A 2HBYB 3SSSA 1F1BB 1NLKL 1WC6A 3R5GA 4WFYA 3L7PA 1WKJA 3DYAA 3M6VA 3TZYA 1V3ZA 1K44A 2CIMA 2IYIA 4ZLPA 3DLLQ 3D6MB 3R7SB 4FYXB 4TU8A 4ER8A 2E7VA 3IO1A 5HVHA 3UDEA 3OFFA 1TK8A 3ZTRA 2EBGA 2AIRB 3LF0A 4QCLA 2QA4S 2MZRA 1VDHA 2VKRA 4ECUA 1IWGA 3DLJA 4OYXA 1VISA 4RKUC 5A0YB 2I38A 5B08A 3SSQA 4DR6J 3GB0A 2YKPA 4G6VB 2YNFA 2IJNA 4B9NA 2YKQA 5GAHI 1R0CB 3BKTA 2RT3A 2GGPB 3MR6A 3RBXA 3EVOA 1U24A 2OPPB 4KGVB 1MWQA 2B5JB 3DXSX 3DOKB 4DZDA 4IH5A 3M7VA 5KFJA 4DMZA 3C66A 4OFZA 5CZVA 3TAQA 3C3LA 1URRA 3THVA 3CD6S 1IKXB 3HCXA 4DR1J 3HT3A 4K4SA 4G65A 1UVKA 5MLCV 2W8LA 2CPDA 3Q8VA 4ECVA 1IKVA 3FSIA 3ZXWA 3DDIA 2AGPA 1R0AB 4YDXA 4NCAA 2WVDA 3VWSA 1VRQC 3CJ2A 1FJGF 3AH6A 3IM8A 2PDAA 4ZCKA 4PG7A 2WSEC 1MN7A 2DGSA 3FRZA 3IP0A 3CCMS 3G71S 1KSPA 2GHWA 4KT0C 4KHMA 4O4GA 1PBUA 4PWDA 4WJBA 2Y1LB 3K7RA 4USVA 1TAQA 2OSRA 4LF4J 1RWMB 3WC2A 4NLGA 3LQVA 5U47A 2ZNZA 3OUYA 1X5TA 5BYSA 4W92B 3UNGC 3HVRA 2OGUA 3FFIB 5B7WA 2UUWA 3RGIA 2EKNA 4TLRA 3G82B 4YUDA 5KFLA 1A9NB 2HWHA 2U2FA 2HHUA 4UOCA 3OTCA 4GVBA 3BDPA 1BD6A 1JLFB 4MFBB 3MXHP 1VK3A 2ZNYA 4ZP6A 1XMBA 3BGUA 4I2PB 2NXNA 4IDKA 1S9GB 4O3OA 2B4PA 4ID8A 2GW8A 1V3SA 2EFVA 2B4UA 3LUYA 3I4PA 2DRAA 4EU0A 1UTAA 3BO2A 2DH8A 2RDJA 1TKXB 2JEFA 1JIHA 1VQ5S 2HBRB 3ISNC 5H9FJ 4R25A 1FF2A 5CZXA 1ZTTA 2HVHA 1S77D 2CYYA 4OI2A 1IR1A 3VGVA 4J9KA 4LF1A 4EI2A 3WC0A 3ZO7A 2CPXA 4JP8A 5BYRA 4OYPA 5IZHA 3HFKA 3MPWA 4XPEA 4F4KA 1VQKS 2J0WA 3GLJA 4EGLA 2EW9A 3OTEA 2NXJA 4OHYA 1X9SA 3W3SA 2YWGA 4XO0A 2CJQA 2XNRA 2LCWA 4HHUA 2FJXA 2IVMA 3BSOA 4RW4B 4B9MA 5E3AA 3U7JA 4JB8B 3ZTQA 3ZZPA 3MM5B 1CJTB 1TELA 4ZA1A 2HQ3A 4P6QA 3KLFB 4FYWB 1FDDA 2AT1B 3TEHB 2HHPA 2HNDA 1VOMA 1NHVA 1ZA1B 4X4NA 1RTJB 3VTIA 1WHYA 2Z57B 1ZZFA 3QQCD 2J8SA 4QU6A 4PUOA 3FC9A 3NMAA 2O67A 4DX8H 2GIRA 1B70B 3D28A 3H5YA 2C3UA 5ADZA 1UVLA 4RO0A 4ANEA 4LFAJ 2VBYA 3MD1A 2HVZA 1T0TV 1TFYA 2CPEA 1DQAA 5DO2A 5L1KA 1OPZA 3ETOA 2D3UA 3BYRA 2XS7A 2CQHA 2CVIA 5DM7Q 1BQMA 3TUJC 3DRRB 2R2SA 1O6XA 3GJTB 2BYCA 3C16A 4HHJA 4DN9A 4F3QA 1CJVA 2DH7A 5T14A 2V8PA 2YKMA 2HQIA 1UETA 2HNZB 2R7OA 2VG6A 1Y0HA 2Y8WA 4PXEA 1CBKA 4B3RF 1RWWB 2EFGA 4OI0A 4RW9B 2AZ3A 1IVZA 3IR7B 3IRXA 1U1PA 2KN4A 3PJWA 1JLCA 4TXSA 3LTOA 1OY9A 4DV2J 3O5TB 1UW9A 3R5DA 4NXMJ 4ZN1A 3KMQA 4NLRA 4NPOA 2W7AA 1I94F 2WCXA 1E6VA 4TY8B 3M2RA 4DS5A 1HPZA 3K89A 1L3UA 1FK9B 3IBFB 5LJ3Y 5KFVA 3R3TA 4Z37A 2LXIA 2W4CA 1HBUB 4K59A 3HLUA 2XYHB 4ECRA 3Q23A 2LQ5A 3ZZ0A 4JBCA 5CYQB 1WG5A 3A3NB 5HSPA 3JS9A 1X4CA 2DGOA 1S6UA 1LWEA 1U1KA 3OR1B 1HYSA 3HP6A 2RQ4A 3THTA 2DK2A 3GZ7A 1KQFB 1U1QA 4FYYB 4K5RA 2IYGA 3JTPA 5HATA 4QYRA 4YR2A 5BJRA 3NS6A 3GPAA 1RABB 4RUBA 5AJ3J 4ICLA 2HMIA 3P4UB 5J2PA 4KQZA 3H42A 3BSCA 2VL1A 2WONA 3HZEA 1C0TB 1Q8IA 4ECYA 2PT0A 2C1EB 2L3MA 3ZNJ1 3Q8PB 2LEAA 3M8PA 3I0RB 1FWPA 1N6QA 2FJVA 2UU9F 1U1MA 1N32F 1DTTB 4ELVA 1PAEX 3TI0A 3T1HF 5F8GA 5RUBA 5FIIA 3HHLD 5ETLA 3HULA 3TVZA 2OTJS 1N4LA 1T94A 4FBUA 4J9RA 4WFAQ 3PEHA 1RU2A 2QIFA 5KG2A 2BJ8A 2YNHB 2MJUA 4AT1B 2EFQA 1B0PA 3OJUA 2V4QA 3KJFB 3TQ1A 1HD0A 1FE4A 4L75A 2VC0A 2F4VF 2CFXA 1U8WA 3RB0A 5HBMA 4DR4J 2MKJA 5E7OB 2C28A 3EXYA 1YRXA 4NLSA 2YBVA 4UUWA 1S57A 3IAM9 3Q8YA 2ILYA 4U7UD 5G4DA 1HI1A 3HO1A 2NS1B 3GR1A 1LWCA 5L38A 2M8DB 2D3OR 5KT4A 4R0JA 5KFRA 2DR7A 3W60A 2WTFA 3BYPA 1X0PA 5KTQA 3NGRA 2UV8A 1L3TA 4LFBF 2DR8A 1FKAF 1VMBA 2RUSA 2CQCA 5DRKA 4JI8F 3L3CA 3GMGA 1O8BA 2XSJB 3ZFVA 4ZVSB 2DR5A 4IG0A 1BQXA 3WDOA 1G6BA 5GMDA 4QW8A 5JVGQ 2RAQA 3OPKA 1CQNA 2QA4G 1GX6A 5C42B 2KYZA 1U0SA 1UZDA 4QIVA 1PC4A 3DGVA 4Y6IA 1NH7A 1QAJA 4KYZA 3D66A 3UCUP 4DL6A 1QDUB 1FNMA 1CC7A 1QTNB 4FZVA 2BX6A 4DPOA 3V6DB 1GTHA 2E1AA 3D3BJ 5MAOA 2HFZA 2W9BB 3CCZA 3CD5A 4FF4A 2OUGA 4USMA 4X4RA 4JV2A 1RACB 3W2WB 2GAHC 3MOZA 1S10A 5A8WB 4L72B 1F6TA 3M1VB 1YDLA 2CVEA 1RWVB 4KH1B 5A8RA 1V5IB 1ZETA 3DXBA 1Y5NB 1BWEA 1VBYA 1R8BA 1HL6A 4BWJA 2OPSA 1HWKA 3F0NA 3LW5C 3GV7B 2H4YB 2KVIA 4DOZA 5ETKA 1REVA 3CB4A 3OVBA 1HQEB 4K4TA 4TKTA 4YDDB 4UOFA 4GKKF 5D8HB 3DYAB 2BACA 3MM7A 2PA3A 1H6KX 2F3JA 1XNQJ 3VAMA 1SV5A 4MYTA 2VA3A 4AFFA 3X1LB 1C2PA 3U02A 1GT8A 1R43A 4B9TA 2WBRA 2JH3A 2WVEA 1RHUB 5HJXA 2YNGB 2E5LF 3VGUA 1HBMB 1HW8A 4I56A 1YX2A 1FKPA 1ULRA 1EKRA 2AU0A 2L48A 1T95A 2DNLA 8RUCA 1KVKA 3N5BA 3SQGA 3UO0A 2YNFB 3I56S 2K3KA 1SB6A 5ETPA 3UVJB 4RNOA 1SKRA 4I1TA 4TVAB 4ELTA 5LSLA 2I6WA 3M2UB 1S1VA 3AJDA 3JTNA 3IGNA 2X1GA 3MEEA 2QGFB 2QL9B 4OZJA 2OJ3A 1Q4RA 4X64F 2EK6A 1IBCB 2OAUA 3QT5A 3DOLB 2MTLA 3TVYA 4BHQA 4NYOA 3CDUA 1FRKA 2JLGA 5ETRA 3VR1A 1RGVA 1IKVB 3AY0A 4FVCA 1W7WA 5JUMA 5LMUJ 1Y00A 3CNQP 1AYEA 2E7XA 5K8PA 3PACA 5DG9A 5IWAJ 2DISA 3EPIA 1KTQA 1FT8A 3MM6A 1T9TA 1GAOA 4OZ5A 1WNEA 3MMBA 3UR3C 1TL1B 3CJ8A 3L7OA 5LOQA 4OYBA 2D74B 3KLGB 1TKDA 5LL6d 2BDPA 2V0NA 1SQGA 3SI8A 3G87A 7AT1B 4O4GB 1RAGB 1OQ6A 4CO2A 5BXIA 1CG2A 4OQJA 4PWDB 3K58A 3OSPA 1RHRB 2Q6CA 1NDKA 3ZTSA 4O23A 3NRBA 2HVIA 2VPWB 1ZA2B 3PYFA 2V5HG 4DL0C 2PA8D 5L46A 3OUYB 1U2RA 2RU3A 3BPSP 5HMXA 5KAKA 2K2PA 2EG1A 3TJ9A 2C2DA 2FHJA 4C11A 4LQ9A 5D3GA 3GILA 1U8SA 4L73A 2R8JA 1XQIA 3AXMA 1VRUA 4QZVB 1T9YA 1NJWA 1NCLA 1RWUA 2E5GA 5DDQC 2H5JB 1MNEA 4F8RA 1RAJA 4RJVA 1WF1A 1E6YA 4ZIWA 1RHMB 4OI4A 1U45A 2CQPA 4BWMA 4IDKB 4U96A 2P2CB 1NK5A 5GAGU 1IM4A 3HXMA 5IC4B 5AXLA 2QJ3A 4DLEA 1D0EA 2GC8A 2ASDA 3T5JA 3CCWA 2V63A 1SC3B 5D15A 5E5NA 2JDJA 2J0QD 1L3VA 4OV6A 5E33A 4F04B 4J9OA 2HHSA 1NKEA 4A8XA 1VI7A 1WHXA 3W8PA 1Q78A 3MPDA 5K14A 3DM2A 4MAKA 3M9MB 2VOPA 2J6TA 2VFTA 1RLCL 3US5A 3U1MA 3UFCX 1OO0B 3H2VE 2H9ZA 4R8UA 1AFJA 2DGWA 5AT1B 3CCJS 4B02A 2WZ1A 1IXKA 2W01A 1SKUB 4NLXA 4C9DA 4YS2A 4BLGA 3PRBA 2BABA 4M5DA 3E8OA 1FRIA 4AXIA 2CPZA 3TUIC 3W62A 1N5VA 2BEFA 5KG4A 3ICLA 4M5GA 5GAEI 3DRXA 3AXKA 1T02A 2HNDB 3BSNA 1VBKA 4EBDA 2CQGA 4GC6A 4PKDB 4QIGA 4OX9F 5ITHA 1H72C 4KSEB 2MLXA 2RKIB 1SPBP 1NM2A 4ECSA 2MB0B 2MKHA 2DB1A 4PUOB 4ID5A 3DCAA 3KJNB 4DBQA 4OYOA 3H5UA 4P7TA 5CYJA 1QE1B 4BC9A 1RJJA 2Z8QA 1KFSA 1Q7LB 3TARA 4TN2A 1X4HA 1SKWA 1XJWB 3CD7A 1CJKA 1FWLA 1VIXA 2J8AA 1BQMB 2D1CA 3MECA 3JSMA 1ZAVA 2JJ4D 3FVYA 4ZIVA 3PV8A 4QQBA 1Y7PA 3W2VA 2VFVA 1WC4A 3EZUA 2YKMB 4QR2A 2GX8A 3AD7C 3KLEA 1NZAA 3C6UA 2VQFF 1ZPWX 3POTB 2HRUA 2VKZG 3NP5A 1UVNA 1RT6A 1MN9A 1JLCB 3IBWA 2Y1IA 3NXZA 5HO4A 3A1YG 2G2YA 5G0RA 4Q7AA 4FPRA 3UQSA 5JVHQ 1TMMA 4NLOA 3H59A 2R7SA 3DI6B 1E6VB 1RP5A 3G8TA 3M2RB 3K8VA 4URGA 3EWGA 4FPIA 2EFPA 2LECA 4HACA 1X5SA 3BZQA 3BREA 3IWXA 4I68A 2CQDA 4XDCA 1KHVA 5JXSA 3KG1A 3DOMB 2I1RA 4XTTA 1ZYQA 2UUBF 4OX8A 3OTOF 1WC5A 4RX6A 1BC6A 2LQBA 2B9XA 2Z0GA 2BKOA 4OJ3A 2N7YA 4ICLB 3U27A 2AJ2A 2HMIB 5E41A 4OZ3A 4B3RJ 3GIKA 3D9BA 1D9DA 3E51A 5J2PB 5KT7A 2H54B 1RAOA 2WONB 2VDIA 1B0TA 3C15A 1TUGB 4NLPA 3UDCA 3M8PB 3H5SA 3TR5A 2R2UA 1N6QB 1LWFA 1HMVB 2G9OA 1FTCA 2X7IA 4IQXA 3DLEA 1RTHA 2MKSA 2YQ3A 1NB7A 4CLLA 4ZHRB 2C3PA 1J2VA 2J9EA 4P74A 3ZNUA 4NA2A 2ZVSA 4DF8A 1JB0C 2U1AA 2C2ZB 4HR2A 4IYQA 2AYBA 4LRFA 2WBMA 1D09B 1CULA 1K0VA 1QSYA 5B0AA 1UA0A 1AROP 2AQ4A 1N34F 2V6AA 3M30A 2HFUA 2MGZA 5I3UA 3T3FA 4A47A 2RNEA 2A0FB 2DO0A 2CADA 4MMOA 5HBMB 1S1TB 4E2FB 2CG8A 1FVQA 3AJ2A 4ZVPB 4DV1J 4Q0BA 3GWCA 4CM0A 4JI0F 1R31A 5FDLA 4CIOA 2BM0A 1GNKA 2AX0A 3C6TB 2W8KA 4TNOA 6FDRA 2DITA 4J90A 2DBBA 4ATNA 1YI2S 1T8EA 4ANCA 3PG9A 3P5BP 5D4NA 3UR0A 1FRHA 2M52A 3GFXA 2UU9J 1N32J 1VQ4S 5CAAA 1EETA 3IWNC 2E5HA 2FJAB 2QLBB 1XIQA 1DZ5A 2IRXA 1ICEB 4WU3A 4G1IA 5D78A 2L9DA 2J9DA 4NOHA 1RT3A 3AODA 3RG6A 2HS3A 4WP9A 2ZD1B 5B0BA 2E29A 1JWWA 4YQWA 1S72S 4ZKAA 4B17A 3CJ4A 2VHGA 3KTQA 2HHHJ 1VQNS 2DNMA 4PABA 3MTJA 1F5AA 2AJ4A 1QTMA 2HPUA 1FFSB 5H9EJ 1UEVA 3EGVA 2F4VJ 4M5MA 2F5GA 1JLAA 3P49B 1YBTA 4NZ0A 1K9MT 3KG0A 5EWEA 4DCJB 3GIMA 2E1RA 5HAOA 4C4WA 1U1LA 2A2DA 3M32A 2NZCA 2A6OA 1TL5A 1R8HA 1DFDA 3VALA 3J80U 2M8HA 3J7Z5 4G1QB 3RU0A 4L3NA 5L9NA 3CCVS 2ZBCA 1NRKA 3K5MA 2BANB 5A8RB 3R5CA 2POKA 1Q79A 2B0GA 2CQ4A 1AZSA 2XI3A 4LFBJ 2MHNA 2OPSB 1JXVA 1WC3A 4USWA 3IR6B 1ZM9A 4C0BA 2BXJA 4KGZB 2XZWA 3CJ0A 1H7XA 2HWTA 1RAAB 4H4KA 3CJRA 2YKNB 3F56A 2Q43A 2ZE2A 3SFUA 5K8NA 3G6VA 4FXDA 3NS7B 3SXLA 2VIHA 3AOBA 4A8OA 3MTKA 3BGRB 1NJXA 4FKXA 2YQ1A 4CT9A 2V9KA 4I7FA 5E3PA 3CDEA 3KYLA 2G0JA 4C2MA 4C8KA 2LFVA 1S12A 2ZH3A 1FXLA 1LW2A 2XWXA 1HNVA 2FGOA 4LVOP 4Q43A 2VQEJ 1Y5LB 3D6TB 4GVLA 3SEOA 5HQMA 3MR2A 3SQGB 1J5OA 1RBLA 4ZVUB 3OLAA 2HVEA 3TAPA 5ETMA 1RTIA 5HI7A 2DJWA 1SUQA 1S1VB 4ZPTR 1WC1A 2MQLA 1U2FA 2ZZTA 4RBTA 3AHPA 3U1LA 2OFGX 5L39A 3QFWA 4BDPA 4ANDA 1ITPA 1XBWA 2PSZA 4LRDA 3S6EA 2J7WA 3RBEA 4MK8A 4A8KA 4QPXA 3CJTA 1IKYA 1CSJA 1R8CA 3AAWB 5J1EB 1KHWA 3W66A 5KOXA 3PJXA 3W61A 2ACYA 1YZ7A 3W9HA 4ZCIA 3HF5A 1IBMF 3FGVA 1QJHA 4ZVOB 1F9HA 2XMJA 1N0UA 1WEZA 2RB7A 3T1YF 2DR6A 4DHVA 3IWLA 1LW0B 3PR4A 3VZHA 2KTQA 1RT5A 3QWPA 2DCLA 4ZVTB 3UWTA 3NNAA 4JI1F 1NK9A 4KY3A 5F3ZA 3PFOA 2DNHA 1HNWF 5A8KA 2BOPA 5DDRC 1DLOB 2V8VA 2HKEA 5LM7E 3GYGA 3QT6A 1DY3A 1JLQA 4CDIA 5J1NA 1RXOB 2KB2A 3TEGA 3V6JA 5SZTA 1HWLA 1S9EB 4P72A 4CO1A 3R97A 4I2QA 2I5JA 1RYRA 1ZAWA 4M5JA 2P5VA 3DHWC 4YFUA 4F67A 3ETMA 2IY5B 5KFGA 2F65A 3UPFA 5IT9Y 1QAYA 3G2XA 3NWGA 3O6QA 1Z2ZA 5CQGA 1YRUA 5D3GB 3R7NB 1LNQA 3PRDA 3KLIA 3MCNA 4P71A 2YNIB 2UVWA 4B3MF 1VRUB 1RWNB 3SZ2A 4FP9A 3H90A 2VG5B 5EX0A 3CJ3A 3RJMB 4NMXA 4R5PA 3TA0A 1ZAXA 4I6AA 1FRLA 2OSQA 4OYMA 3AQPA 3HHLA 2J6UA 1JXEA 3H7HB 3NKYA 2XYPB 2EVZA 2RJZA 3NBPA 1OWXA 2GMLA 3T5HA 2XQCA 2H1YA 3R9LA 2V4JA 3V2UC 2YX1A 2QFJA 3CJSA 3T5LA 3JXOA 2RD5C 3OXLA 1S99A 4IKAA 3N5FA 3R7BB 4F3MA 2M5YA 1UJ6A 1AUSL 4QIEA 3OXGA 1NSPA 4OZNA 2ALZA 1KQGB 3SQOP 2VBWA 4P73A 4ZMMA 2HSEB 4U7UK 1PIEA 3DM2B 3H2UB 4QYZJ 3OL8A 4JI4F 3BQ2A 2XLJA 3PW4A 1Y3KA 1S0NA 4NLVA 3K59A 2G13A 4WIQA 2ROGA 4LUBA 2FVPA 5LMNF 1L5UA 4DFMA 1Y3JA 4ZLLA 1R3NA 4DXLA 1HI8A 3QGPA 3NGKA 1RTDA 1SJQA 5J2NB 3DU5A 4OI3A 3W8GA 1IKWA 3BGOP 1S49A 4LSNA 4YB5A 2DCUB 3C2PA 3JQJA 3RBZA 7FD1A 4D3GA 3VAHA 4HTJA 2QO3A 2F4FA 4OYIA 4ID5B 3OBIA 3R5BA 4I64A 2NQPA 3M8SA 1UVJA 2WSCC 1WG1A 3M6UA 2MKIA 3IG1B 2KXNB 4K4YA 2ADBA 4YR3A 3KOAA 2DGQA 2DPJA 2CJXB 2PD1A 1M90T 3W7BA 4OHZA 1T03A 2QYGA 1T05A 1T9VA 3ZTOA 1AW0A 1CJKB 2NUHA 4DL5A 2GQCA 1OY6A 5EX3A 2LVWA 2WOMB 3LP0B 1SJFA 3KXDA 2N4DA 4BS2A 5IM0A 2OIHA 1OY8A 4S0MA 3M8RA 1N48A 3AFGA 7FDRA 2D69A 5I3QA 4WIIA 1SVDA 3PFEA 5A2QU 2GVZB 1GMVA 1UZHA 2B9YA 4JI5F 4CO3A 4DR5F 3KLEB 3NAHA 4DCPB 3SCKE 4USKA 2GJFA 4ZPCA 3FJ2A 1RT6B 2N4CA 1BWVA 4U9RA 3R5JB 3EXCX 3U1NA 4A8WA 5HP1A 1S79A 3SBMA 1C1BA 2P9GA 5C2CA 1PILA 5G0RB 4CCHA 3MGJA 4YB6A 3KUHA 4X65F 5F8IA 4P9SA 3QJLA 5DGAA 3E3XA 1GMWD 1WG4A 2DIVA 3VAGA 1YGYA 4JI3F 3TJ8A 1G3OA 2V8DA 4NZ6A 4TYAA 2JEGA 4N5SA 2VV5A 4HACB 1MWYA 2VB6A 2ZWPA 3G8QA 5CA5A 1W2IA 4KGXB 4JV5F 1HQUA 1MROA 4IR1A 3OL9A 2HQFA 4X4PA 2QSFA 4B3SF 1EP4A 2C2EA 1WOOA 1B64A 3IMQJ 1LXNA 2ZOMA 3CC4S 5KFDA 2H4WB 4QR1A 1UFLA 2B9EA 4N41A 1YK9A 1SIZA 1M5SA 3CULA 2PEBA 4ES2A 4UW2A 4KHRA 4A48A 2ZH8A 4ZVRB 5HMZA 3WBZA 3G8SA 2QLJB 3DGPA 2AJFE 4LSLA 4HT7A 4FXVA 4QPTA 4C48A 5F8NA 1G4CA 4CWBA 2MZQA 2PFFB 1WTFA 2R8KA 3BGFA 4J5OA 1RTHB 2BJ3A 2ASJA 4X84A 3CCSS 5LXYA 3HJFA 1MMNA 3H40A 4Q44A 1VCTA 4FYDA 4I6YA 3KHLA 1RZMA 1M5PC 3CJQA 3CW2C 4DQIA 2QLWA 4LFCJ 3NLCA 3D5MA 3DMJA 4IG3B 2DY9A 1URNA 1L3KA 4LF6F 2AKWB 1N36F 2Z30B 2GHVC 1TL7B 1OYEA 3HPOA 1PYOB 4CYUB 4DUZF 4PG4A 1X60A 2XMKA 2DGXA 1X0FA 4JI2F 3H4DA 4J91A 5KFHA 3DLKA 3BO4A 1JLEA 1W26A 4O0IA 1X4FA 2AGQA 4RBVA 1TKZA 3HMJG 3P45B 3V81A 4RW6B 4DL4A 4UQTA 2HYIB 4C3LA 3PM9A 4H4OB 2PFDA 1RKIA 1JKHA 4NEZA 3JYTB 1UJ4A 5F8JA 2LA6A 1S6PA 3RRHA 1W2BR 2CZVC 2NUUG 2KHCA 3A13A 1YVFA 4TQRA 2UXCF 4C8LA 2XSFA 5HMWA 1FWKA 1EETB 5KFCA 4WTYA 1FCAA 1WD6A 4Y2AA 3HK2A 3MUVP 2V2QA 4CI0B 3QRRA 2FZGB 4ZP9A 2ZWOA 5C24A 3MEGA 1S6QB 2JLEA 1XNRF 2AJ1A 3NCRA 5D0GA 3M05A 4X66F 3LAMA 2OKQA 1YJTA 1WOPA 1TFWA 4NLDA 4K8RA 1NH8A 2A18A 1N34J 5CYMB 3F41A 2LKZA 3IA0A 1YSJA 3MM9A 4OIXA 4DV5F 4ZVEA 2NXEA 3JTOA 3K5PA 1M1KT 5ETQA 3C19A 3KDNA 3PEJA 4QWDA 4ECZA 3UD4P 5DETA 4C8ZA 2E1CA 2XCPA 4ILLA 2IA0A 2M2BA 3GJSB 3LGMA 4ZP7A 4PAAA 3KHGA 2XC9A 1TKTA 2RVJA 5F9NA 1AXQA 4LSZB 2EC2A 5HROA 3MM8A 4ITSA 3J81Y 1RT7B 3MI7X 3HVTB 1RA7A 1Q8KA 2PI5A 2QMUB 2FY1A 1VIOA 3FRYA 4JV1A 1AZSB 2HZCA 2ZZMA 1S1UB 3PW7A 4YN3B 3R6GB 2OD6A 4ZPAA 2KJVA 2RRAA 3Q8UA 1FERA 1N88A 3CO9A 3D6FB 3EGWB 5B09A 2QL5B 4X4OA 4ILRA 4DS4A 2QMXA 2BR0A 4CLYA 2BE2A 2AJ0A 2IBOA 2XBPA 4WE1A 2ACMA 1F9EB 1U1OA 4FS1A 3FBEA 3N0VA 2HFNA 4DU8A 2DXFA 3EJMA 5BR8J 3HD2A 4X4UA 1H2TZ 5GMKa 1GFWB 3M9OB 4DV6J 2D3ZA 1IWAA 4O44B 4NCGA 2PO4A 1I51B 1QUVA 1U6ZA 3CDAA 5KFSA 3NGTA 1LW2B 4K2XA 1SCJB 3C46A 5DGBA 2VF3A 1VJQA 3H20A 2RRNA 1KVJA 1S48A 4C8YA 1KTVA 4DR7J 2KM8C 3NY0A 1NO8A 2CWXA 4F3OA 1J5OB 4KV8A 4CH1A 3HHLC 2UUCF 1TVRA 1N5YA 2DGVA 4MK9A 4WWSA 2VJUA 1RCOB 1FKOA 5FD1A 3QGHA 2W7PA 3Q8SB 2ZH7A 1NSAA 1BQNA 1RAIB 2KRBA 3OFEA 4NZ7A 3FZBA 4J7CA 4FVMA 1VBZA 4MIAA 4M1KA 4NL5A 3N9UC 4DX6A 5T7LA 1KOHA 4X4QA 4EFAC 2OPRA 2FUG9 1PBAA 1U47A 2ZHBA 3D7SB 4X4VA 2GIQA 1IR2A 1LEOA 1XN9A 4J9LA 2CNNB 3HDSA 4C98A 2XLIA 1RT5B 5F0UA 1S9FA 4DUTA 4FBTA 1IQTA 1RKJA 4OI6A 2QT7A 1WHVA 1YWXA 3J7ZT 2IVFB 1H3DA 3TVKA 4CNYA 2ATLA 3BN7A 4M95A 3S7RA 3KFWX 1FEEA 3QT7A 2NSCA 1JLQB 2IPOB 1Q5VA 4QWAA 4CTAB 2ZH2A 5HVGA 3QRPA 2GMJA 3HFVA 1DTQB 1TL3B 3I96A 3IGVA 1BLUA 2YKOA 4JOUA 3OFHA 4KHPJ 1F60B 4DEZA 5F3TA 4NYPA 3S01A 2N7CA 3VHQA 4OL8A 2HURA 3KLIB 1B4SA 2KT2A 1FEHA 5B0EA 2OPQA 1VRTB 1LQ9A 4OZLA 2G0IA 1P6TA 3MMAB 2HGMA 3CTRA 2FVCA 4OJ1A 2MHEA 1PG5B 4A4JA 1LFWA 2K7JA 4PQUB 4R5PB 2DNOA 2VOOA 4KE5A 5L8RC 3QLHA 4UOHA 3UN5A 4W90B 2HHWA 1CS4B 3NBPB 2FQQB 4B3TJ 2LLZA 1HWIA 3K5OA 2OEMA 1YJ7A 2DXDA 3P5TL 4MKBA 3RZAA 4OJGA 4N56A 4K4XA 3L95X 3BKFA 4OZ1A 4YY3F 1WEYA 1D8YA 3QSIA 3J7YI 4NXNF 4CH0S 1AFIA 1KVIA 2P6SA 4DQQA 4KO0B 3G6XA 4ZVQB 1RUSA 1JK9B 3SSRA 1GXTA 4NI2A 2R7QA 2B3TB 3BR8A 2XMMA 3PCOB 2BJ1A 1R0BG 1JJ2R 5ETOA 3HFZB 4ZCLA 5ETNA 4HI2A 3A8KA 4PPZA 1SBRA 4CO4A 3DRSB 1NPRA 4B3MJ 1VQ9S 3QRQA 3CGIA 2AGOA 1JMTA 1GMUA 2FJDB 3MZIA 3RTVA 2DVIA 2E9ZA 3FEZA 4HH1A 3A3OB 4PCQA 1FD8A 4OMFG 3N28A 4Y28C 4M5LA 2GQQA 3D54A 4W4MA 3LAKA 2CPYA 2OEKA 2L9WA 3OR2A 2WVFA 3KNGA 3RRKA 3GSDA 3EGZA 2W4PA 3ELHA 4A8MP 1UPMB 4DV3J 4DG1B 4USIA 2AYMA 4K4UA 2K1RA 3O1LA 4F50A 5A6WA 1YZ6A 4PWUA 3NCPA 2XMAA 3RW7A 1RT2B 3O44A 1UVMA 1L3SA 3VAIA 1SXLA 3BDEA 2DNGA 4DR3J 1TUVA 2FLNA 1T03B 3CIZA 2AMCB 1WI8A 4P2FA 3CCUS 3B54A 3SMZA 3QAEA 1VQMS 4DR1F 1SH2A 1JJ4A 4JI4J 1HBOB 3I0SA 2FVRA 3IBCB 1K8AT 2VDHA 1NSQA 2ZC4A 3CUNA 5IM0B 3HVWA 4XIUA 3CJKA 2EPIA 2ILZA 2ZHOA 4UUXA 1B7YB 1PYSB 2CNOB 5LMNJ 3Q8RB 2LEBA 2BZ2A 3ENWA 3LP1A 5EWGA 1D9AA 4EYIB 1ZPVA 2G4BA 3ENQA 5A0YA 3GG1A 2CQ0A 4JI7J 2IDLA 2J7UA 4TYBA 4DQPA 2IC3B 4RU2A 3CPWR 3FQLA 5GADU 2OEJA 4LF4F 1N33F 5HP1B 4OLOA 2B4OA 2RILA 3BGLA 3PVXA 4KRWA 3MDFA 1FRXA 3I55S 2OPPA 3RBDA 2B6AA 3K2YA 2W1BA 4PG8A 2E7WA 3BJYA 3S1TA 2RUGA 3M2VB 1VHIA 2DGUA 1RE1B 4KPCA 1WELA 2XG8A 4ED1A 2R2RA 3D0GE 2F63A 2NYIA 2P8IA 3OFGA 3J81j 1WC0A 2QTWA 1Q0NA 4DPYA 2AF6A 3D4JA 2MZJA 1MROB 4WZQA 1S5ZA 1R0AA 2CZ4A 1WOSA 3CO0P 3MF5A 2FZCB 3R27A 4M63A 4UTGA 1BY9A 2RHSB 2RH3A 4JI5J 3HSGA 4DR5J 2FPHX 4KFBB 5IOLA 3ZZTA 3JB9k 2CXEA 1HNIB 2LU2A 3DGPB 3CSKA 5HK4A 3UCGA 4IFYA 2HIYA 2DY1A 3ITHA 2OFHX 4MH8A 4EUVA 3MCOA 5L1JA 2EXUA 3FEYB 4BCAA 1M0SA 1J5EJ 4JI3J 1IM6A 3FFIA 1UKUA 2QC3A 4D3HA 2D7SA 4LF5F 5EUHA 3G82A 3AD8C 5F0WA 3DRPA 2IVYA 3TOQA 4C0HA 4MFBA 3RB6A 2CPIA 4JV5J 1PGZA 1DARA 2KO1A 1VQ8S 4P52A 4N8NA 2V9WA 4HH0A 4B3SJ 4N47A 1S9GA 1NZ8A 4UT4A 1M5HA 1JNZB 1TKZB 3QIPA 3IXQA 3MR3A 1H0HB 3K8WA 2YVSA 4F0KA 1LWXA 3AB2B 3Q24A 2FLOA 1JKHB 1R8PA 3V4MA 4ZK7M 4YR0A 3RAMA 1Q95G 4C3MA 1S6PB 2OD4A 1JLGB 1T11A 1CEZA 1P27B 2W9CB 3J7AN 2HFOA 1YJWS 4NYZA 2H48B 5JJBA 1XMOJ 1G2EA 4OHVA 3C14A 2UXDF 1YRTA 3FCWA 4M5NA 4OHXA 2K8GA 3Q83A 4M5KA 1VQPS 2IAJB 3FDSA 2QG9B 1T3OA 2COLA 3MEGB 2Z2LA 4KC5A 3QYYA 4DV7F 1HR0J 1OSCA 1N54B 5AXNA 3HHDA 2V68A 1TQLA 4RW4A 4A8SA 1NDPA 2FC9A 3W9IA 2I9SA 1C1CA 4C3KA 2BQUA 4OJHA 3TA1A 1GTEA 3MM9B 5AE2A 5LSRA 3TAMA 2I2YA 2Z2ZA 5H1SV 1RK8A 3W63A 2HBQB 1BUXA 4WTOB 2GO9A 1AA1B 3CDBA 4A46A 1HD1A 4DV2F 3HSZA 2AEJA 5B0CA 3MEDA 2BVZA 2CPJA 3QO9A 5HROB 2O5DA 2KVQE 1VGYA 2DNZA 3EM1A 3GE9A 3LALA 1DBDA 3GYNA 4EWTA 4RWXA 3MAQA 2ZBPA 1U4BA 2UXBF 3KK1B 5KT5A 2DEJA 2OI2A 5IQ6A 1H73A 5KFKA 2R7UA 3B78A 4CLPA 1GXLA 3MMCA 1U48A 2FC8A 4WZMA 1NAQA 5HLFA 2FVSA 3QJPA 1WACA 2IDEA 4P75A 2YPYA 3EUNA 3PZPA 3RR7A 3EPGA 1T9WA 3RR8A 3I82A 1MSWD 3PX0A 1WDDA 5DDOC 4H54A 2C3OA 4QJVA 4LR8A 2VJVA 1S4FA 4DV0J 1H2UX 4YEAA 4ZP8A 4GO5X 4DPUA 3ILLA 3CDWA 3HKZD 2BUNA 1S0MA 4DV5J 1RI7A 4A8FA 3QGIA 4IFVB 4WFZA 4NCGB 1MW7A 3NGUA 4LF9F 1F5BA 4ZS6A 4ED2A 2JNJA 4IQMA 1EQ0A 3ULHA 2LXFA 1HNXF 1O51A 4ZCMA 3PX6A 3PIOQ 2EI5A 5HVFA 4Q45A 2VBXA 3I5BA 2DNYA 2MQPA 2ZVIA 3GFHA 4AUKA 1XTZA 4TY8A 3PTWA 1TVRB 5IT0A 1FK9A 4GO7X 2OMLA 4O4RA 2CJBA 9RUBA 3W5XA 1EHWA 1QY7A 3E01A 1HBUA 1S76D 4RU9A 4WBFA 4Z7CA 4PPDA 1KR4A 1NHUA 2HZVA 2E5JA 4ZVGA 4ELUA 2B7BB 2BA9A 3IS9A 3JQMA 4DR4F 2DYAA 2KDOA 3DDNA 1HNZJ 2AJQA 3OR1A 3F44A 3OHBA 1Q8BA 1Y5IB 2DNKA 4CM2A 3G4SS 4IH7A 2FGCA 1X7VA 3QFHA 2J0SD 1MU2A 4I0WA 5AE1A 4B3OA 2XHWA 4CRJA 2FHJD 1GMWA 1NKBA 4X62J 2CKWA 2QA2A 3VF0B 2FHMA 1C0TA 3ZZOA 1G7CB 4U8VA 3BO3A 4YHHF 1B7FA 1H74A 1FDBA 4ZPBA 5J2QB 2X1BA 1CQMA 5AXKA 1DTTA 1RDRA 5DZ6A 2AYGA 1MMLA 5E0OA 4QIWD 3CWJA 3W1YC 1FJEB 4BC7A 1NBEB 4F4ZA 1MWZA 1DQ9A 3T6BA 1U2CA 2ZEJA 3ET6A 1H7WA 5K8MA 2J9DE 2YNHA 1FNXH 1KC8T 4CLTA 1ACMB 4Y3CA 2BJEA 2HS4A 3SDEA 2LXUA 3M8WA 3LGNA 4ED7A 2C22A 2A6MA 4GRSA 2XZDB 1N5TA 4ZPVR 2B7CB 2RF2A 4Z7YA 4NA1A 1P9YA 1U49A 2CDRB 1TK5A 2M7SA 1CLFA 2QZ8A 3LH2S 2GJ2A 1LK7A 1WI6A 1KRPA 3PYDA 3TW0A 2MZ1A 1F2GA 2KZZA 3QIDA 2QMWA 3UD3P 5HJYA 5CCLA 1FRMA 1FJCA 1DQ8A 2VPZB 2GNKA 2FYXA 3FBCA 3T6JA 4NA3A 4MYUA 4C8MA 2H51B 4V1Ak 3RAXA 2E9TA 2MDAA 4NI2B 2XSJA 3I4HX 1XNQF 3EVWA 1QVGR 4NRTA 4B9SA 4WKRA 2MKCA 2J9CA 1X5OA 2W24A 2V34A 4KGMA 2PC6A 4PYAA 1JLBA 2IA6A 2CZ9A 2ROPA 3BSAA 2XY7A 2IM0A 2ZKTA 1YKWA 4CQ1A 3HI9A 2RRBA 2W9BA 2JRSA 4Q5VA 3IC1A 3OR2B 4ZN3A 2A2CA 1R6YA 1CC8A 1UWAA 2F8HA 2VFRA 3RW6A 3JAMY 4ED4A 1Z1ZA 5LJ5Y 2K1RB 4YY3J 4HKQA 1R8AA 4Y34A 3PXGa 3O3LA 3LANA 2DNQA 2H65B 4Y2IA 4NWBA 2XULA 4I69A 2MLZA 2A1BA 2PI4A 1HQEA 3ENVA 5KFZA 4NLQA 2VU5A 4C0OC 4F25A 4GVBB 3WQPA 1D3WA 4KGKA 3I0SB 1JQGA 3NOCA 2CQ1A 1RBAA 2HRYA 2HHQA 1NSKL 5LMUF 3I5AA 4E98A 1SC6A 3CJKB 2DIUA 5EN1A 2W2MP 4DQSA 5IWAF 1ZM4A 3MWBA 2YNGA 1FJGJ 2E66A 2GZOA 4B9VA 2VPXB 2Z4PA 4XAKA 4YMEA 2AW0A 1HBMA 3LP1B 2P9CA 4HYKA 3OT9A 1UWBA 2CQ3A 1EJ7L 4WPAA 1R27B 2OO4A 3O8WA 4DX5A 3RYLA 1EZZB 1K1SA 2RQCA 1VQOS 2YH1A 3UVJA 4FN5A 3RB4A 5FLXY 2IJFA 3M2UA 5KG7A 2HEKA 3NG8A 3LWMA 3NL0A 2B6AB 2OTLS 4O3RA 4DPTA 2M9KA 4JYAF 2K3IA 4LQ3A 2HGLA 1U6BA 5K20B 2YWHA 2W9AA 4LBPA 1NPKA 3DOLA 2W25A 1KP6A 1SL2A 3CCQS 4ENOA 2WSFC 1UJ5A 1YBAA 4USJC 3PNIA 4LF2A 2MQOA 4ED8A 2WHOA 2R7WA 4NLYA 5J2MA 5K8OA 1QAXA 3RAQA 2HIQA 5IS2A 2F8MA 4USHA 1Q53A 3SCJE 3GTYX 1LK5A 1SH0A 2MPUA 4K7QA 1DHMA 3FCVA 1TL1A 3SFGA 2MEWA 3C8YA 5GAGI 4FKYA 3KLGA 3R2DJ 4QWBA 2YWFA 2RE1A 3BBBA 4CLFA 3MAAA 1X4DA 5M2RA 1XC9A 3DU6A 1IR0A 4RPFA 4IFYB 4CLSA 1R7IA 1N33J 3ITHB 3LP2A 1VLYA 1O5JA 4OHWA 5KFMA 3GJRB 1UCNA 1KOOA 3CMAS 3D67A 3ILJA 3RUBL 1K47A 3C16B 1U1NA 2OMOA 2X3GA 3GQCA 4DCOB 8AT1B 3PX4A 3AB4B 1P8GA 1CJVB 2JC1A 2ZH9A 4DSKA 5IV3A 3LOUA 3DRPB 2VG6B 1QSSA 1ELOA 4HLBA 3UDLA 3I31A 3MR7A 4AE5A 4OZ0A 1FRJA 2BMBA 1DJ0A 4ZLNA 4R0EA 4PR6A 3IRXB 5CCMA 3DHXA 5F8LA 4F0HA 1P1TA 5M2PA 1GEHA 3QIPB 3H98A 4ZJQA 2I0XA 4M94A 4J37A 5D77A 4PWWA 1HPZB 2Y0SD 2A10A 2Y0BB 3B8HA 3PRVA 4QBUA 5THWA 2DNRA 1EQMA 4X2BA 2HLUA 1F0XA 3FZ2A 4Z2XA 5F41A 3G9CA 3C14B 3CD0A 3E2EA 2X3DA 4WU2A 1S7HA 1X9WA 5DLGA 3QNWB 4A8YA 2N82B 3I9ZA 1RTZA 4Q2MA 4K0KF 2DTJA 2KKHA 1FFWB 1LWEB 1HYSB 4HHHA 4TLQA 1WDTA 1RQ0A 5HQLA 3R2CJ 4ED5A 1F3FA 4LF5J 2B8PA 2L08A 4CLZA 2KI2A 2BRKA 2GVDA 3LO3A 1C1CB 4DJBA 1WKLA 2FTRA 4RNFA 1ROFA 5J1PA 2O66A 3LWLA 3TAMB 3PR5B 1N0VC 3OHAA 2JLFA 3D3CJ 2XHCA 4QIFA 1KQKA 3LPYA 2RHQB 1YJ9S 5IT9U 3KMSA 1RCXB 3DLBA 4LJMA 2RKIA 3G6YA 2HGNA 2XS5A 3MEDB 2ZBQA 3OV7A 3NEKA 1XWLA 5D4OA
chains in the Genus database with same CATH topology
1F9EB 4ZVTB 1RHRB 3IBFB 2C2KB 3IBCB 2XYPB 2H51B 4DCPB 2H65B 2Y0BB 3KJNB 2DKOB 2H5IB 2H4WB 3D6MB 2QL9B 2CNLB 1I3OB 3R7SB 2XYHB 3GJRB 2H4YB 1IBCB 3GJTB 2XYGB 1RHKB 5K20B 2C2MB 1GFWB 1NMEB 3GJSB 3P45B 2CNOB 4ZVSB 3R5JB 4ZVUB 2CNNB 3KJFB 2QLFB 4DCOB 1PAUB 4ZVRB 1I51B 3QNWB 2QLJB 2QLBB 3R7BB 4JB8B 4LSZB 3EDRB 2CJYB 2FQQB 3GJQB 2XZDB 1ICEB 2C2ZB 3D6HB 1RHJB 2C2OB 1RWWB 2HBQB 2CJXB 1SC4B 2CNKB 2H5JB 2CDRB 1RHUB 2QL7B 3P4UB 1QDUB 3EDQB 1QTNB 2HBZB 5IC6B 3R7NB 1BMQB 1RHMB 2Y1LB 3NS7B 1RWKB 2HBRB 2XZTB 4ZVQB 2C1EB 1RWNB 3R6GB 2P2CB 1RWMB 1RWXB 1SC1B 1RWOB 4ZVOB 1RWPB 3RJMB 1RHQB 3R6LB 5IC4B 3SIPB 3KJQB 4ZVPB 3D6FB 2HBYB 1RE1B 2QL5B 2H48B 4DCJB 1PYOB 1RWVB 1SC3B 2H54B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9E B;  4ZVT B;  1RHR B;  3IBF B;  2C2K B;  3IBC B;  2XYP B;  2H51 B;  4DCP B;  2H65 B;  2Y0B B;  3KJN B;  2DKO B;  2H5I B;  2H4W B;  3D6M B;  2QL9 B;  2CNL B;  1I3O B;  3R7S B;  2XYH B;  3GJR B;  2H4Y B;  1IBC B;  3GJT B;  2XYG B;  1RHK B;  5K20 B;  2C2M B;  1GFW B;  1NME B;  3GJS B;  3P45 B;  2CNO B;  4ZVS B;  3R5J B;  4ZVU B;  2CNN B;  3KJF B;  2QLF B;  4DCO B;  1PAU B;  4ZVR B;  1I51 B;  3QNW B;  2QLJ B;  2QLB B;  3R7B B;  4JB8 B;  4LSZ B;  3EDR B;  2CJY B;  2FQQ B;  3GJQ B;  2XZD B;  1ICE B;  2C2Z B;  3D6H B;  1RHJ B;  2C2O B;  1RWW B;  2HBQ B;  2CJX B;  1SC4 B;  2CNK B;  2H5J B;  2CDR B;  1RHU B;  2QL7 B;  3P4U B;  1QDU B;  3EDQ B;  1QTN B;  2HBZ B;  5IC6 B;  3R7N B;  1BMQ B;  1RHM B;  2Y1L B;  3NS7 B;  1RWK B;  2HBR B;  2XZT B;  4ZVQ B;  2C1E B;  1RWN B;  3R6G B;  2P2C B;  1RWM B;  1RWX B;  1SC1 B;  1RWO B;  4ZVO B;  1RWP B;  3RJM B;  1RHQ B;  3R6L B;  5IC4 B;  3SIP B;  3KJQ B;  4ZVP B;  3D6F B;  2HBY B;  1RE1 B;  2QL5 B;  2H48 B;  4DCJ B;  1PYO B;  1RWV B;  1SC3 B;  2H54 B; 
#chains in the Genus database with same CATH topology
 2WW8 A;  2IFX A;  3QO9 B;  4K2J A;  3W64 A;  1FFG B;  4P10 A;  3AJ1 A;  1QE1 A;  1I94 J;  1TV6 A;  3DKD A;  3HSJ A;  3PKY A;  4C8O A;  1DUR A;  1P9Q C;  5CH7 B;  2CPF A;  1KQS R;  1XEZ A;  2DR9 A;  2BBE A;  3J7A 1;  1TMJ A;  1U02 A;  2K06 A;  3FQK A;  3QWU A;  3PW0 A;  3MMC B;  2UXD J;  5HLF B;  1WKK A;  2XGP A;  2ZJQ Q;  2Q79 A;  2ZH5 A;  5KFB A;  1SIW B;  2DHG A;  2WB4 A;  3EGN A;  2E44 A;  2FJB B;  3KKF A;  4W98 A;  1KLM A;  1OQ3 A;  1OYD A;  3M8Y A;  2JWN A;  4DV7 J;  3EIC A;  4ETX A;  2QLX A;  2K7K A;  4RWW A;  4C97 A;  1KN6 A;  4DLG A;  3D0I E;  3POT A;  1V5V A;  4MIB A;  2C3Y A;  2ZBR A;  2ASL A;  2E5I A;  1RWO B;  3CED A;  3ZZZ A;  4QR0 A;  1LWC B;  3TP2 A;  4IO9 Q;  3SCI E;  2DNP A;  1F2H A;  3I87 A;  5IFM A;  2Y1R I;  3FSY A;  2ZKU A;  3P6Y C;  1Z4U A;  3T1H J;  1OIA A;  2BQR A;  3BQ1 A;  3DN9 A;  4KIA A;  1EIY B;  4F0M A;  2B43 A;  2YY3 A;  1VC0 A;  3SYZ A;  4HDG A;  3DI6 A;  1DAX A;  3AA9 A;  5M2U A;  2X1F A;  4I6W A;  1V9O A;  4IG0 B;  4WK3 A;  2UXB J;  2DNN A;  3FK4 A;  2XI2 A;  3CME S;  3E01 B;  1M5K C;  1VHF A;  2YTC A;  3HHE A;  4F2S A;  2KG0 A;  3NGS A;  4UY8 5;  1QVF R;  1KDN A;  2VOD A;  2B8Q A;  2AZ1 A;  3IS9 B;  4EO8 A;  3BN4 A;  3QAU A;  3DOM A;  4EK2 A;  3ADA C;  4E8U A;  5T41 A;  1KON A;  2QV6 A;  2B56 A;  4DV1 F;  4DSJ A;  3K17 A;  1MU2 B;  1TAU A;  1MG7 A;  3MCS A;  4B3O B;  2XMV A;  3MHY A;  1PYT A;  1A0O B;  3IFE A;  4QOT A;  4LIR A;  2X51 A;  2AWZ A;  2Q66 A;  5ETT A;  1VK8 A;  4RUH A;  6AT1 B;  1B3T A;  4DR2 F;  4HI1 A;  3TQE A;  4DSI A;  4LF9 J;  3ZTP A;  1HMV A;  2W4D A;  1PC5 A;  1BE4 A;  1HNX J;  1FXD A;  3T1A A;  2JC0 A;  1W25 A;  2XYG B;  2G1D A;  2V67 A;  2MQQ A;  4ZHR A;  4OI1 A;  2KXH A;  1REV B;  1DRZ A;  4JI6 F;  3IAS 9;  3M8Q A;  4JI8 J;  3ET6 B;  2JHE A;  1M5V C;  3MM7 B;  4YB1 P;  2CWK A;  1YTY A;  2HHH F;  1SV5 B;  3VAK A;  1FI4 A;  5EGY A;  2ZH6 A;  2CUY A;  3VV2 B;  3SDE B;  1B99 A;  1ZM2 A;  1FHT A;  5C25 A;  2KG1 A;  1KS2 A;  2R8G A;  2KT5 A;  1WOR A;  1S1T A;  3I9V 9;  4RBU A;  3UW1 A;  4DL2 A;  1HW9 A;  4NE9 C;  2RF2 B;  1FKP B;  2PMW A;  3ENA A;  4U8Y A;  4QWE A;  5LT5 A;  5ETS A;  3QSY B;  3IN5 A;  4K4Z A;  2V69 A;  1AUD A;  3C6T A;  4UZB A;  3HT0 A;  4C8N A;  2RSQ A;  3T9Z A;  2D41 A;  4KB7 A;  4F2R A;  1APS A;  1XER A;  2G0C A;  5I3P A;  3OQ2 A;  1UVI A;  3MEE B;  2B4V A;  4YHH J;  5C5J A;  2EWH A;  4OZ2 A;  1NXI A;  2VZ9 A;  2AEM A;  4B08 A;  2KYX A;  4F7V A;  3AQO A;  2ZD1 A;  3PKM A;  4GKK J;  2NXC A;  5CAB A;  4DFK A;  2VBZ A;  4ETZ A;  2VUG A;  2W7O A;  3PO4 A;  4FNI A;  1S1X A;  2R7R A;  3OLB A;  9ATC B;  3VCD A;  4U6P A;  3SV3 A;  4USU A;  1S7I A;  1WWH A;  4FF1 A;  1JLB B;  1M1H A;  1TUW A;  4DUY F;  2E5L J;  3MM6 B;  2E1M C;  4Y2M A;  3MMB B;  1YG0 A;  1VBX A;  3WZ0 A;  3KJQ B;  4CT8 A;  3K5L A;  4PYD A;  2VQE F;  3Q0A A;  3HM9 A;  2KL8 A;  3HHK A;  1EB0 A;  2JSX A;  4G1Q A;  1WJ9 A;  3L7U A;  4HTI A;  3MD3 A;  1UW4 A;  4TQS A;  2BAN A;  2UP1 A;  3TO8 A;  4DSE A;  2XS2 A;  2V2Z A;  4XK8 C;  1REG X;  1RAH B;  2KHD A;  1S1W A;  2J0X A;  4X64 J;  4HL9 A;  4TU7 A;  4C11 B;  5KFI A;  3NMR A;  2BKN A;  2IMO A;  1GX5 A;  2GIF A;  1YHQ S;  2UUA F;  4M5H A;  3R5A A;  2DXE A;  2R9L A;  1J27 A;  5I4M A;  2V94 A;  2H5E A;  2YKN A;  2B51 A;  1BMQ B;  1UPP A;  2BKP A;  2PGC A;  1E6Y B;  4LRC A;  4ECW A;  3BGR A;  2PE8 A;  1SH3 A;  4PG6 A;  3L9Z A;  4XPC A;  4ZJO A;  4WYW A;  3GG0 A;  3EZO A;  4WYL A;  3KLH A;  2JOQ A;  4J9U E;  1RIS A;  4KAI A;  3P3D A;  4L3K A;  1C0U A;  5KT3 A;  4IOA Q;  4F26 A;  1G1X A;  2RU9 A;  1IN0 A;  3HZG A;  2H5I B;  1UWB B;  3R8Y A;  4ALZ A;  2CQB A;  4IRD A;  1BHN A;  3GII A;  2XLK A;  2R7V A;  4AYB D;  2HS0 A;  3TYT A;  2CNL B;  1I3O B;  1QUP A;  2EKY A;  2J76 E;  4AQY F;  1RAF B;  1HA1 A;  3W5Z A;  5K14 B;  1WF0 A;  1KLN A;  1PAU B;  3HKW A;  4PXD A;  1VC5 A;  1NK8 A;  1V3R A;  5D4P A;  3FSX A;  3QZ8 A;  3OL7 A;  1Q8L A;  3FBF A;  2CQ2 A;  2YXL A;  1SL1 A;  1JJC B;  1NDL A;  1VR6 A;  3MFI A;  1YJR A;  4R8U B;  2VA2 A;  5J1E A;  2QX0 A;  3QAT A;  5HL7 Q;  2JX2 A;  4MIW A;  2GFF A;  4RW8 A;  2EBE A;  5D0H A;  3ONQ A;  4M5D B;  1SJ4 P;  5H9F K;  4JUZ A;  3J81 U;  1N56 A;  2LMI A;  5J2M B;  1LW0 A;  3HSD A;  5SUH A;  2MKK A;  4A8Q A;  4YB7 A;  3QMQ A;  1NDC A;  3OVS A;  1S0V A;  2VAS A;  5DZ7 A;  4FYV B;  5D4L A;  1RSC A;  1YJU A;  3IR5 B;  3N6M A;  2CJA A;  3ISN D;  3EZ5 A;  3BPD A;  3CCR S;  1DLO A;  4GKJ F;  1LV5 A;  3DLH A;  1XMQ F;  4ES1 A;  3MAA B;  2J6S A;  1S9E A;  2NR0 A;  1VQ7 S;  3Q89 A;  3V6H A;  3VAF A;  2HRT A;  4Y00 A;  4ILM A;  3LP2 B;  5DG8 A;  2DH9 A;  4URS A;  4ECT A;  1VQL S;  3N4W A;  1C4A A;  4JYA J;  5DQG A;  5L9X A;  3MEC B;  3M6X A;  3JSM B;  2ABY A;  4QU7 A;  6FD1 A;  1NK0 A;  1RT1 A;  3W2V B;  2ATC B;  3V4I A;  2YNI A;  3GFZ A;  2VFS A;  4OLP A;  4ED3 A;  3R1L A;  1T9U A;  1IJF B;  2RDD A;  1S4E A;  1EAR A;  1KFD A;  2JFK A;  2VG5 A;  1OPI A;  4EBE A;  5GAE U;  3C6U B;  1SL0 A;  4LR9 A;  1PSD A;  3T19 A;  4DWI A;  4O0N A;  3GON A;  4KH0 B;  1BXN A;  4K4V A;  3JSY A;  1VYA A;  2YQ0 A;  4ZIT A;  1KBR A;  3KUE A;  3TX8 A;  2WAQ D;  2ZOG A;  4OX9 J;  1RT4 A;  3AT1 B;  4KR0 B;  1A6L A;  4E0D A;  3TJA A;  2AHO B;  2YWK A;  5HMY A;  3VAJ A;  2J5A A;  4EMD A;  1AB8 A;  3L4B C;  4DPW A;  4LIW A;  1IBK F;  4JV0 A;  4QW9 A;  4QWC A;  4DZ6 A;  4KBI A;  3KK3 A;  3K0J A;  2MQM A;  3N79 A;  3NOG A;  2CNK B;  3CVK A;  2QL7 B;  4FXW A;  1Z2L A;  2QRR A;  2GS8 A;  2UVU A;  1HKA A;  5DLF A;  3KUG A;  4ZDN A;  2GCF A;  1TL4 A;  2HHV A;  5B0D A;  2OLW A;  1NEE A;  3UNY A;  3BKU A;  3KK2 A;  3CC2 S;  4MJK A;  2FIU A;  3OTB A;  1RBO B;  2XM3 A;  2ZUA A;  2GVD B;  2VQF J;  3GV8 B;  1ZM3 A;  4ERD A;  4O3P A;  4IR9 A;  5J2N A;  3H0P A;  4WF9 Q;  4DPX A;  3FUY A;  3Q22 A;  2VON A;  3C15 B;  4LF7 F;  1CJU A;  4DN0 A;  4LRB A;  2OH2 A;  2QEX S;  5A76 A;  2KJW A;  1ZH5 A;  1GXU A;  2NLW A;  3Q8Q B;  1LWF B;  4EYH B;  1WEX A;  3DLE B;  4X4S A;  3D2W A;  4RUC A;  5E3R A;  5KT6 A;  4CLW A;  2HZA A;  1D1U A;  2LA4 A;  4J9N A;  1Y9O A;  2DPI A;  3IG1 A;  4NLT A;  1TV6 B;  2JL9 A;  3RB3 A;  3A8J A;  2EG2 A;  2VG7 A;  3RRG A;  1CUL B;  2R8I A;  2V2V A;  1TZ0 A;  4YP3 A;  4WK1 A;  3M30 B;  2MGZ B;  5I3U B;  2WOM A;  1EAY C;  3LP0 A;  2YX4 A;  1KKH A;  4EZ9 A;  3PW5 A;  4K0K J;  3QBC A;  2L9N A;  2DHH A;  2UUB J;  1KLM B;  2RS8 A;  3D1O A;  3ISZ A;  3BH7 B;  2NZ4 A;  1NU4 A;  3LGH A;  2GVZ A;  5JMN A;  3OTO J;  3TWZ A;  4Q0B B;  1X4B A;  3O2I A;  3VQS A;  1YJV A;  5FDL B;  5CHC B;  3H4B A;  3QPI A;  1H98 A;  2DKO B;  2FD2 A;  3TA2 A;  2P6T A;  2VH7 A;  4EBC A;  3FKB A;  2BJ9 A;  2W2Q P;  1KNZ A;  5EDW A;  2Z2M A;  3QT8 A;  1UFK A;  2CJY B;  5HQ8 A;  2CPH A;  1I1G A;  4ECQ A;  2VPY B;  5CD4 H;  1RT3 B;  4L76 A;  2DD8 S;  4LFC F;  1IJE B;  3KJV A;  2Z56 B;  2BJD A;  3MMJ A;  3CIM A;  2BM1 A;  1HBN A;  2XY6 A;  2RQK A;  2C2N A;  1EKS A;  1YIJ S;  1YIT S;  2D9O A;  4MKA A;  4F4W A;  1JLA B;  1V6H A;  1XR5 A;  4OYZ A;  4DV4 F;  2UUT A;  3T5K A;  2EK1 A;  3M32 B;  2HQG A;  2FLP A;  4MTP A;  1UFW A;  4LT6 A;  1Q7Y T;  4JI0 J;  4WFN Q;  1R6V A;  4IOC Q;  5KFX A;  3JSR A;  4RLE A;  2ZJR Q;  1UA1 A;  1LKZ A;  3AOC A;  3CXC R;  3MOJ B;  3FMW A;  3OW2 R;  3BF4 A;  2AD9 A;  1VS3 A;  1WTB A;  1WUU A;  4P2X A;  1SC4 B;  1K0T A;  1Q86 T;  3ILO A;  2GV1 A;  1FVS A;  2HFV A;  2O3D A;  3QJJ A;  4WFX A;  2YX7 A;  3D1Q A;  5I42 A;  3M8Q B;  5KT2 A;  2F1F A;  2C3M A;  1SI9 A;  5IC6 B;  4FF2 A;  4NEY A;  4ED0 A;  2ZE2 B;  5LSO A;  2G2O A;  4IG3 A;  1HIY A;  3BB5 A;  1HHT P;  3UI3 A;  4LF8 F;  3OD2 A;  1JXL A;  1TL7 A;  4O3N A;  1TU0 B;  2MKY A;  4PEO A;  4CYU A;  3LPE A;  4K4W A;  1U0H A;  3DNC A;  5KFU A;  3N6N A;  4I7F B;  5C25 B;  2PN6 A;  2ZM6 F;  5GVQ A;  2ZH4 A;  2KZM A;  1UEK A;  4O3S A;  3OTD A;  4WCE Q;  1HNV B;  5GME A;  1Q81 T;  4MKY A;  2EC0 A;  2DHX A;  3H5X A;  4RW6 A;  4HEA 9;  4F02 A;  5LXR A;  3M8Z A;  4H4O A;  4N7T A;  4ZVH A;  2QLF B;  4LVN P;  1H38 A;  3JYT A;  1UEU A;  2Q1L A;  1GK8 A;  1RTI B;  4AXJ A;  3IRW P;  2PII A;  2FB0 A;  1SUQ B;  3OJS A;  2R7X A;  3P8B B;  3NNH A;  2SXL A;  4XDD A;  2ZOF A;  2XTJ P;  2ZBI A;  4DR2 J;  2NSB A;  1FO1 A;  1T3N A;  1SJR A;  1N8R T;  2Y1J A;  2BW7 A;  4K50 A;  2DRB A;  3PYE A;  2ZH1 A;  2XMT A;  1X31 C;  1IKY B;  2MST A;  3BBF A;  2D9P A;  3S8S A;  4JI6 J;  4KKO A;  1X4G A;  4HDH A;  1S6Q A;  3CCL S;  1MLA A;  4UY8 T;  4NCB A;  5DM6 Q;  1HWJ A;  1P1L A;  5IT4 A;  1S1X B;  2B9W A;  5F8M A;  4ZOS A;  5CYM A;  5BR8 F;  4NLU A;  4DV6 F;  2NXU A;  4CNZ A;  3DLG A;  2X1A A;  4I67 A;  5KFY A;  2J7K A;  5ETV A;  3P96 A;  2IIH A;  4CLK A;  2HW3 A;  5A8K B;  3EVM A;  3BH6 B;  2MLY A;  4DR7 F;  4NX9 A;  2ASY A;  3KLV A;  3A4T A;  5F8H A;  3CE8 A;  1SJ3 P;  3H25 A;  2XCA A;  2BJ7 A;  3MAH A;  3GJQ B;  4MKV A;  2HNY A;  1TR0 A;  4I2Q B;  1RHJ B;  2I5J B;  1HAR A;  2LQ9 A;  2HHX A;  2V8H A;  3VVU A;  3SCL E;  1RT7 A;  3HVT A;  4AL5 A;  4AD6 A;  2C42 A;  1I5O B;  3Q2T C;  4DI6 A;  1M5O C;  5CD4 A;  3D68 A;  2KH9 A;  1U25 A;  3UN3 A;  1S1W B;  4P2M A;  2VIC A;  1S1U A;  4CO0 A;  4ZJL A;  3QZ7 A;  3HHN B;  2GMH A;  1NJI T;  1RWP B;  3TZZ A;  2BE7 D;  2NPF A;  1OMS A;  4LRA A;  3OSN A;  1IBM J;  4P2S A;  3ZZU A;  4UOG A;  1IBL F;  4RL1 A;  3ZZR A;  3H2L A;  3T41 A;  2KM8 B;  3PW2 A;  3T1Y J;  5DG7 A;  3HHL B;  2UV8 G;  2OEL A;  3D0H E;  4FDF A;  1RAD B;  5B0G A;  2V4J B;  4DUY J;  2OP5 A;  2HHT A;  3KLH B;  3AD9 C;  4O44 A;  4JI1 J;  3TRG A;  4FS2 A;  3MUT P;  1C0U B;  3VZI A;  1SJ1 A;  4RW7 A;  1OJ4 A;  1HNW J;  1X9M A;  2QYC A;  1QAI A;  2C2O B;  2QA1 A;  3CMQ A;  1HHQ A;  1NHK L;  5EWF A;  2OHD A;  1ZS6 A;  2ZJP Q;  4V19 X;  1FXR A;  2XB2 D;  2DEI A;  4NLW A;  3PY8 A;  1S0O A;  1NJZ A;  4DL7 A;  4KHP F;  2QE5 A;  3GSI A;  3OL6 A;  4F4Y A;  1NK4 A;  1QD1 A;  3HVA A;  5L1I A;  4CO5 A;  2FJW A;  2MXY A;  2M3D A;  2Q6B A;  3VQT A;  3SIP B;  2UUA J;  1HQ2 A;  4KTQ A;  1U7L A;  2RQM A;  2WRM A;  1EX8 A;  1U26 A;  4B9U A;  4PXC A;  4RW8 B;  2VC1 A;  1RAE B;  1WF2 A;  4YOE A;  2LP4 A;  2KRR A;  3DDK A;  2KU7 A;  1RTD B;  4DR6 F;  1D8Z A;  1JNR B;  2XMW A;  3VVT A;  2CJK A;  1RLD A;  1IKW B;  3HJV A;  3GR0 A;  4B3T F;  4LSN B;  3FMB A;  3MPY A;  2CAJ A;  1UP1 A;  3BS9 A;  3M6W A;  3X3U A;  2DRD A;  4DU7 A;  1HI0 P;  4U95 A;  4H4M A;  1IUJ A;  3HD1 A;  2RML A;  1QSL A;  4ES3 A;  2LQ8 A;  1A7G E;  3GFY A;  1PKU A;  1N5Q A;  3MPU B;  4U67 Q;  3CC7 S;  3JSB A;  5C2G A;  1T05 B;  4AQY J;  4CTA A;  2WB1 D;  4Q8F A;  1DTQ A;  1U09 A;  2CDQ A;  2HFS A;  2APO A;  2R4F A;  5KG1 A;  1TL3 A;  2LDY A;  3N6L A;  5HN0 A;  1S97 A;  3BQ0 A;  3THP A;  1TK0 A;  4KJI A;  2GJI A;  1LOU A;  2XO6 A;  4B9L A;  3VGT A;  2A3J A;  1RT1 B;  3V4I B;  2DO4 A;  1KD1 T;  1XK8 A;  1VRT A;  3WIV A;  4LRE A;  5CXT A;  5DQI A;  2EFO A;  2M70 A;  2DT9 A;  1FX4 A;  3MMA A;  2YWW A;  4WXW A;  3PJ9 A;  2HK2 A;  2ZFH A;  4I4B A;  4L6V 3;  2V2K A;  4Q2L A;  4PQU A;  4RR5 A;  3G96 A;  3BM7 A;  1NME B;  1PJ7 A;  1RB0 A;  3W9J A;  1CS4 A;  2Q3P A;  4RNH A;  3HX9 A;  3T9N A;  4RNM A;  2KXF A;  1C1B B;  2GGP A;  4DV3 F;  1RT4 B;  4IO1 A;  3MUM P;  2MQN A;  3ZZY A;  3PHT A;  3K5N A;  2PEH A;  2XMU A;  2RS2 A;  2B5J A;  5KFE A;  3DOK A;  4HVZ A;  5KOW A;  2RIJ A;  1QM9 A;  3KG4 A;  3FNN A;  3BV8 A;  1LFP A;  3UDV A;  4GKJ J;  1B0V A;  5C7P A;  4KO0 A;  1XMQ J;  4DR3 F;  1FES A;  2GO8 A;  2NYH A;  5K5M A;  2HQC A;  1OSD A;  3KK3 B;  3GYX B;  1ZOT A;  2VD3 A;  4RUA A;  2V8G A;  5DJB A;  1IKX A;  1Y11 A;  2FHK A;  1VFJ A;  5KFT A;  1NK7 A;  2H3E B;  2M4M A;  2C2R A;  2VFU A;  4NAS A;  1F9F A;  1HQU B;  5KFN A;  4C6A A;  3ZC4 A;  1HWU A;  2E1P A;  4G3I A;  2XGQ A;  2PMZ D;  4DL3 A;  3GCW P;  4F4A A;  1EP4 B;  3FEX B;  4Y2C A;  2EEY A;  3DRS A;  3KK2 B;  3PYG A;  3GCX P;  2HG4 A;  3MFH A;  4AL7 A;  4GMK A;  3JQK A;  4JI7 F;  2QN6 B;  4DSL A;  3MR5 A;  4DF4 A;  3EYZ A;  4OYA A;  3UCZ P;  4CP5 A;  3DFE A;  4L74 A;  1CJU B;  3NCQ A;  4LSL B;  1S6O A;  2KFZ A;  2HAF A;  2Y9H A;  3KDO A;  4F4X A;  4EO6 A;  5HAN A;  4DG1 A;  5GAD I;  4X65 J;  2DHA A;  2IM3 A;  2HBZ B;  1NJY A;  3GU0 A;  1RT2 A;  1NUE A;  1PJ6 A;  1IBK J;  2F7V A;  2JVR A;  3J80 Y;  2JFD A;  3DMJ B;  2E9R X;  4K5S A;  2VG7 B;  2MZS A;  1BGX T;  2MJN A;  2NPI A;  3Q86 A;  4UF4 A;  1UAW A;  1XR7 A;  1JLF A;  4PRF A;  1ZZN A;  1HBO A;  3CCT A;  2JEJ A;  1S59 A;  2FZK B;  4DQR A;  1NND A;  4I2P A;  4CLU A;  2XO7 A;  4N77 A;  1T7P A;  2XY5 A;  3DLK B;  4WXO A;  2ROE A;  5KG3 A;  1H2V Z;  1JLE B;  3B4M A;  5B0F A;  2LDI A;  1VLO A;  2C2M B;  1NPP A;  2LEP A;  3OXF A;  4TY9 A;  3TAN A;  1MMD A;  3V81 B;  1I6J A;  2GA7 A;  5D0E A;  1HHS A;  2R42 A;  1X8D A;  4FF3 A;  4UZC A;  1TKX A;  1QLN A;  2XWY A;  3I5C A;  4IRC A;  8ATC B;  5DS7 A;  3PIP Q;  4CH7 A;  1KWM A;  2RDI A;  1FD2 A;  2R8H A;  4X4T A;  2IC3 A;  4LFA F;  4G1P A;  5FJ4 A;  2HVD A;  4LBI A;  2LU1 A;  2IM2 A;  4LF7 J;  2ZUG A;  2ALY B;  1K73 T;  2JVO A;  2WVB A;  3EMT A;  2FY8 A;  2FHO B;  3UN2 A;  4IRK A;  1J5E F;  2IRY A;  3M2V A;  4FNH A;  5KFW A;  1RWX B;  2IM1 A;  1FX2 A;  2JZ5 A;  3EE3 A;  5C24 B;  3I32 A;  2IMW P;  2MSS A;  1X4A A;  3KJV B;  1U1R A;  3CCE S;  2R7T A;  2R2T A;  3NAI A;  2YH0 A;  5KG5 A;  4LF6 J;  1WSR A;  4J9Q A;  3M4X A;  4WKY A;  1N36 J;  4IH6 A;  1HBN B;  3MM5 A;  1CJT A;  2UZA A;  5A6P A;  2UVV A;  3KLF A;  4DUZ J;  2AYE A;  4JI2 J;  3G86 A;  2HAI A;  4PXB A;  5AXM A;  2IRU A;  3JAM U;  2LQJ A;  3CF5 Q;  5IQQ A;  3LA0 A;  1OS5 A;  1RTJ A;  3H8Y A;  4LMZ A;  4BBY A;  2XNQ A;  5E3C A;  4KPY A;  2Z58 B;  3TZW A;  4NXM F;  1TKT B;  4J9S A;  5IV4 A;  3A8I A;  5E2Q A;  3GV5 B;  3MM8 B;  4KFB A;  3PHE A;  1HNI A;  1FJ7 A;  5BYQ A;  4WP8 A;  4N76 A;  1X4E A;  2L41 A;  2HQD A;  4ED6 A;  2UXC J;  1HFE L;  3W65 A;  4PQA A;  1UL3 A;  3PO5 A;  2BW2 A;  3WX4 A;  4Y0F A;  4ZPW R;  1XMO F;  5H9E K;  3MCM A;  3KHH A;  2I8E A;  2ZIT A;  2IHR 1;  1ZBT A;  2ZDO A;  2CG4 A;  3DRR A;  3I6P A;  2N3L A;  5I42 B;  1VQ6 S;  3AA8 A;  3OVA A;  1VQY A;  3IM9 A;  5F9L A;  1RU1 A;  1HR0 F;  3TZX A;  1FA0 A;  2BE2 B;  1XNR J;  4WE1 B;  2HNZ A;  2EFN A;  4X66 J;  1C4C A;  3TNV A;  4Y65 A;  1O0P A;  5AJ3 F;  5K9F A;  1JJH A;  2F40 A;  2HWI A;  4P7V A;  1RHK B;  4PG5 A;  5FLX U;  1U0H B;  4RW9 A;  1JX4 A;  3A3P B;  2Y3Y A;  2AP6 A;  1Q82 T;  3GIR A;  4RZR A;  3QGG A;  3F73 A;  1FNO A;  5D6G A;  3K57 A;  3L09 A;  4H4K C;  3D6H B;  3SV4 A;  4DV4 J;  2KFN A;  4DX7 A;  2AV5 A;  1NK6 A;  1XR6 A;  3FCH A;  4WP3 A;  2YWE A;  4KV8 B;  2BE9 B;  4WFB Q;  1PO6 A;  1CPZ A;  3NWR A;  4O3Q A;  1N5Y B;  1SQF A;  2CRL A;  1FTR A;  3DRY A;  1JLG A;  5KG6 A;  1PJ5 A;  2W9C A;  1FKO B;  1RA6 A;  2M88 A;  1BQN B;  3W5Y A;  4ZVF A;  1GQE A;  2GAG C;  3GIJ A;  1NKC A;  5CYQ A;  3D1H A;  4GC7 A;  1FE0 A;  4TU9 A;  2GQ2 A;  2UVR A;  3NNC A;  3B6B A;  5KFA A;  4DSF A;  2F8E X;  3CT9 A;  4KKO B;  2IAJ A;  3GP9 A;  1K1Q A;  1PCA A;  5T7L B;  4DV0 F;  1YLX A;  4LF8 J;  2V50 A;  2OPR B;  3A12 A;  5D0R A;  4AL6 A;  3TX0 A;  3NGD A;  2G1H A;  5KFP A;  3B82 A;  2IBK A;  3MUR P;  1U6F A;  1Q5Y A;  4CZC A;  3EDR B;  3VGS A;  4NML A;  2Y8Y A;  2ZHA A;  3DLG B;  3AOA A;  4ECX A;  4M5I A;  4DFJ A;  2ZM6 J;  3FBB A;  3WIU A;  1M1G A;  4PZV A;  1NB2 A;  3I0R A;  2NCK L;  5AE3 A;  4UST A;  2W2O P;  5L1L A;  5KG0 A;  1AT1 B;  1YJN S;  1ZTW A;  2Z2Y B;  3WX8 A;  2HNY B;  1VC6 A;  2BQ3 A;  2UUC J;  2ERR A;  1KEK A;  4F36 A;  4LBH A;  2LYV A;  3R6L B;  3KK1 A;  2D3O 1;  1N5S A;  1YBU A;  4OX6 A;  2FJE B;  2WK4 A;  3MEK A;  4OYW A;  2FVQ A;  1VQS A;  2MY8 A;  2CA9 A;  3V6K A;  2ZZN A;  2OPQ B;  2F9J A;  1HNZ F;  3R1H A;  3TUZ C;  2WVC A;  3M9N B;  3ILI A;  2FLL A;  3TUP A;  1Y4Z B;  1WSV A;  2XEX A;  3BEG B;  4U7C A;  4HT5 A;  3QLH B;  1SKS A;  1T9X A;  3DC2 A;  3V5R A;  2G2Z A;  4Y2K A;  5KFQ A;  4X62 F;  3Q2S C;  3UD5 A;  1IQZ A;  1Q16 B;  2O1P A;  1X5P A;  2ADC A;  4IFV A;  1WHW A;  5E3Q A;  3WHI A;  2PMH A;  4ZLJ A;  2WW4 A;  3EDQ B;  4RW7 B;  2KT3 A;  5A2Q Y;  2QSW A;  4J9V A;  1RWK B;  2FDN A;  2O01 C;  3MPV A;  2XZT B;  4C7Q A;  1F5C A;  4V19 J;  4J9P A;  1HLW A;  2ZC3 A;  2CQI A;  2IJR A;  4Q8E A;  1GH8 A;  1RHQ B;  4M8L A;  2AX1 A;  2P9E A;  4EEY A;  5IXU A;  2JEI A;  4LR7 A;  2BRL A;  2KFY A;  1F3V A;  3PDN A;  3A8E A;  2C2K B;  2HK3 A;  5C42 A;  1TTH B;  4EZ6 A;  4URQ U;  3KNA A;  5EHH A;  5DDP C;  2HLT A;  1CVJ A;  1N52 B;  4UQG A;  2MMY A;  1Q1K A;  4J9M A;  1R89 A;  3EX7 B;  1VJW A;  4DDF A;  1YQH A;  5DQH A;  1SQE A;  2NRE A;  4ZPD A;  3N01 A;  5KFF A;  2F9D A;  3B4D A;  2BOA A;  2CJ9 A;  3BBC A;  2V4R A;  3V6D A;  4IUF A;  3G6E S;  4N8O A;  5GAH U;  1IBL J;  1FDN A;  2AEF A;  3NS5 A;  4MK7 A;  1LXJ A;  2R3V A;  2W2N P;  3CJ5 A;  4DFP A;  2BV3 A;  2MY7 A;  4IOB A;  1FDA A;  4NRU A;  3W2W A;  1UMJ A;  4QYZ K;  5A8W A;  3J7Y U;  3M1V A;  2YKA A;  2MYF A;  2DHS A;  2GHP A;  3UE2 A;  5KFO A;  4H4M B;  5J2Q A;  2QFI A;  4OX7 A;  2ZDP A;  2DGT A;  4NXN J;  4OV1 A;  4MT1 A;  4RNN A;  1D9F A;  3BR9 A;  3KWM A;  1SC1 B;  1TP7 A;  1Y10 A;  2W2P P;  2N3O A;  1RYS A;  2M0G B;  2YPZ A;  3KHR A;  2MZT A;  2MQ8 A;  2HBY B;  3SSS A;  1F1B B;  1NLK L;  1WC6 A;  3R5G A;  4WFY A;  3L7P A;  1WKJ A;  3DYA A;  3M6V A;  3TZY A;  1V3Z A;  1K44 A;  2CIM A;  2IYI A;  4ZLP A;  3DLL Q;  3D6M B;  3R7S B;  4FYX B;  4TU8 A;  4ER8 A;  2E7V A;  3IO1 A;  5HVH A;  3UDE A;  3OFF A;  1TK8 A;  3ZTR A;  2EBG A;  2AIR B;  3LF0 A;  4QCL A;  2QA4 S;  2MZR A;  1VDH A;  2VKR A;  4ECU A;  1IWG A;  3DLJ A;  4OYX A;  1VIS A;  4RKU C;  5A0Y B;  2I38 A;  5B08 A;  3SSQ A;  4DR6 J;  3GB0 A;  2YKP A;  4G6V B;  2YNF A;  2IJN A;  4B9N A;  2YKQ A;  5GAH I;  1R0C B;  3BKT A;  2RT3 A;  2GGP B;  3MR6 A;  3RBX A;  3EVO A;  1U24 A;  2OPP B;  4KGV B;  1MWQ A;  2B5J B;  3DXS X;  3DOK B;  4DZD A;  4IH5 A;  3M7V A;  5KFJ A;  4DMZ A;  3C66 A;  4OFZ A;  5CZV A;  3TAQ A;  3C3L A;  1URR A;  3THV A;  3CD6 S;  1IKX B;  3HCX A;  4DR1 J;  3HT3 A;  4K4S A;  4G65 A;  1UVK A;  5MLC V;  2W8L A;  2CPD A;  3Q8V A;  4ECV A;  1IKV A;  3FSI A;  3ZXW A;  3DDI A;  2AGP A;  1R0A B;  4YDX A;  4NCA A;  2WVD A;  3VWS A;  1VRQ C;  3CJ2 A;  1FJG F;  3AH6 A;  3IM8 A;  2PDA A;  4ZCK A;  4PG7 A;  2WSE C;  1MN7 A;  2DGS A;  3FRZ A;  3IP0 A;  3CCM S;  3G71 S;  1KSP A;  2GHW A;  4KT0 C;  4KHM A;  4O4G A;  1PBU A;  4PWD A;  4WJB A;  2Y1L B;  3K7R A;  4USV A;  1TAQ A;  2OSR A;  4LF4 J;  1RWM B;  3WC2 A;  4NLG A;  3LQV A;  5U47 A;  2ZNZ A;  3OUY A;  1X5T A;  5BYS A;  4W92 B;  3UNG C;  3HVR A;  2OGU A;  3FFI B;  5B7W A;  2UUW A;  3RGI A;  2EKN A;  4TLR A;  3G82 B;  4YUD A;  5KFL A;  1A9N B;  2HWH A;  2U2F A;  2HHU A;  4UOC A;  3OTC A;  4GVB A;  3BDP A;  1BD6 A;  1JLF B;  4MFB B;  3MXH P;  1VK3 A;  2ZNY A;  4ZP6 A;  1XMB A;  3BGU A;  4I2P B;  2NXN A;  4IDK A;  1S9G B;  4O3O A;  2B4P A;  4ID8 A;  2GW8 A;  1V3S A;  2EFV A;  2B4U A;  3LUY A;  3I4P A;  2DRA A;  4EU0 A;  1UTA A;  3BO2 A;  2DH8 A;  2RDJ A;  1TKX B;  2JEF A;  1JIH A;  1VQ5 S;  2HBR B;  3ISN C;  5H9F J;  4R25 A;  1FF2 A;  5CZX A;  1ZTT A;  2HVH A;  1S77 D;  2CYY A;  4OI2 A;  1IR1 A;  3VGV A;  4J9K A;  4LF1 A;  4EI2 A;  3WC0 A;  3ZO7 A;  2CPX A;  4JP8 A;  5BYR A;  4OYP A;  5IZH A;  3HFK A;  3MPW A;  4XPE A;  4F4K A;  1VQK S;  2J0W A;  3GLJ A;  4EGL A;  2EW9 A;  3OTE A;  2NXJ A;  4OHY A;  1X9S A;  3W3S A;  2YWG A;  4XO0 A;  2CJQ A;  2XNR A;  2LCW A;  4HHU A;  2FJX A;  2IVM A;  3BSO A;  4RW4 B;  4B9M A;  5E3A A;  3U7J A;  4JB8 B;  3ZTQ A;  3ZZP A;  3MM5 B;  1CJT B;  1TEL A;  4ZA1 A;  2HQ3 A;  4P6Q A;  3KLF B;  4FYW B;  1FDD A;  2AT1 B;  3TEH B;  2HHP A;  2HND A;  1VOM A;  1NHV A;  1ZA1 B;  4X4N A;  1RTJ B;  3VTI A;  1WHY A;  2Z57 B;  1ZZF A;  3QQC D;  2J8S A;  4QU6 A;  4PUO A;  3FC9 A;  3NMA A;  2O67 A;  4DX8 H;  2GIR A;  1B70 B;  3D28 A;  3H5Y A;  2C3U A;  5ADZ A;  1UVL A;  4RO0 A;  4ANE A;  4LFA J;  2VBY A;  3MD1 A;  2HVZ A;  1T0T V;  1TFY A;  2CPE A;  1DQA A;  5DO2 A;  5L1K A;  1OPZ A;  3ETO A;  2D3U A;  3BYR A;  2XS7 A;  2CQH A;  2CVI A;  5DM7 Q;  1BQM A;  3TUJ C;  3DRR B;  2R2S A;  1O6X A;  3GJT B;  2BYC A;  3C16 A;  4HHJ A;  4DN9 A;  4F3Q A;  1CJV A;  2DH7 A;  5T14 A;  2V8P A;  2YKM A;  2HQI A;  1UET A;  2HNZ B;  2R7O A;  2VG6 A;  1Y0H A;  2Y8W A;  4PXE A;  1CBK A;  4B3R F;  1RWW B;  2EFG A;  4OI0 A;  4RW9 B;  2AZ3 A;  1IVZ A;  3IR7 B;  3IRX A;  1U1P A;  2KN4 A;  3PJW A;  1JLC A;  4TXS A;  3LTO A;  1OY9 A;  4DV2 J;  3O5T B;  1UW9 A;  3R5D A;  4NXM J;  4ZN1 A;  3KMQ A;  4NLR A;  4NPO A;  2W7A A;  1I94 F;  2WCX A;  1E6V A;  4TY8 B;  3M2R A;  4DS5 A;  1HPZ A;  3K89 A;  1L3U A;  1FK9 B;  3IBF B;  5LJ3 Y;  5KFV A;  3R3T A;  4Z37 A;  2LXI A;  2W4C A;  1HBU B;  4K59 A;  3HLU A;  2XYH B;  4ECR A;  3Q23 A;  2LQ5 A;  3ZZ0 A;  4JBC A;  5CYQ B;  1WG5 A;  3A3N B;  5HSP A;  3JS9 A;  1X4C A;  2DGO A;  1S6U A;  1LWE A;  1U1K A;  3OR1 B;  1HYS A;  3HP6 A;  2RQ4 A;  3THT A;  2DK2 A;  3GZ7 A;  1KQF B;  1U1Q A;  4FYY B;  4K5R A;  2IYG A;  3JTP A;  5HAT A;  4QYR A;  4YR2 A;  5BJR A;  3NS6 A;  3GPA A;  1RAB B;  4RUB A;  5AJ3 J;  4ICL A;  2HMI A;  3P4U B;  5J2P A;  4KQZ A;  3H42 A;  3BSC A;  2VL1 A;  2WON A;  3HZE A;  1C0T B;  1Q8I A;  4ECY A;  2PT0 A;  2C1E B;  2L3M A;  3ZNJ 1;  3Q8P B;  2LEA A;  3M8P A;  3I0R B;  1FWP A;  1N6Q A;  2FJV A;  2UU9 F;  1U1M A;  1N32 F;  1DTT B;  4ELV A;  1PAE X;  3TI0 A;  3T1H F;  5F8G A;  5RUB A;  5FII A;  3HHL D;  5ETL A;  3HUL A;  3TVZ A;  2OTJ S;  1N4L A;  1T94 A;  4FBU A;  4J9R A;  4WFA Q;  3PEH A;  1RU2 A;  2QIF A;  5KG2 A;  2BJ8 A;  2YNH B;  2MJU A;  4AT1 B;  2EFQ A;  1B0P A;  3OJU A;  2V4Q A;  3KJF B;  3TQ1 A;  1HD0 A;  1FE4 A;  4L75 A;  2VC0 A;  2F4V F;  2CFX A;  1U8W A;  3RB0 A;  5HBM A;  4DR4 J;  2MKJ A;  5E7O B;  2C28 A;  3EXY A;  1YRX A;  4NLS A;  2YBV A;  4UUW A;  1S57 A;  3IAM 9;  3Q8Y A;  2ILY A;  4U7U D;  5G4D A;  1HI1 A;  3HO1 A;  2NS1 B;  3GR1 A;  1LWC A;  5L38 A;  2M8D B;  2D3O R;  5KT4 A;  4R0J A;  5KFR A;  2DR7 A;  3W60 A;  2WTF A;  3BYP A;  1X0P A;  5KTQ A;  3NGR A;  2UV8 A;  1L3T A;  4LFB F;  2DR8 A;  1FKA F;  1VMB A;  2RUS A;  2CQC A;  5DRK A;  4JI8 F;  3L3C A;  3GMG A;  1O8B A;  2XSJ B;  3ZFV A;  4ZVS B;  2DR5 A;  4IG0 A;  1BQX A;  3WDO A;  1G6B A;  5GMD A;  4QW8 A;  5JVG Q;  2RAQ A;  3OPK A;  1CQN A;  2QA4 G;  1GX6 A;  5C42 B;  2KYZ A;  1U0S A;  1UZD A;  4QIV A;  1PC4 A;  3DGV A;  4Y6I A;  1NH7 A;  1QAJ A;  4KYZ A;  3D66 A;  3UCU P;  4DL6 A;  1QDU B;  1FNM A;  1CC7 A;  1QTN B;  4FZV A;  2BX6 A;  4DPO A;  3V6D B;  1GTH A;  2E1A A;  3D3B J;  5MAO A;  2HFZ A;  2W9B B;  3CCZ A;  3CD5 A;  4FF4 A;  2OUG A;  4USM A;  4X4R A;  4JV2 A;  1RAC B;  3W2W B;  2GAH C;  3MOZ A;  1S10 A;  5A8W B;  4L72 B;  1F6T A;  3M1V B;  1YDL A;  2CVE A;  1RWV B;  4KH1 B;  5A8R A;  1V5I B;  1ZET A;  3DXB A;  1Y5N B;  1BWE A;  1VBY A;  1R8B A;  1HL6 A;  4BWJ A;  2OPS A;  1HWK A;  3F0N A;  3LW5 C;  3GV7 B;  2H4Y B;  2KVI A;  4DOZ A;  5ETK A;  1REV A;  3CB4 A;  3OVB A;  1HQE B;  4K4T A;  4TKT A;  4YDD B;  4UOF A;  4GKK F;  5D8H B;  3DYA B;  2BAC A;  3MM7 A;  2PA3 A;  1H6K X;  2F3J A;  1XNQ J;  3VAM A;  1SV5 A;  4MYT A;  2VA3 A;  4AFF A;  3X1L B;  1C2P A;  3U02 A;  1GT8 A;  1R43 A;  4B9T A;  2WBR A;  2JH3 A;  2WVE A;  1RHU B;  5HJX A;  2YNG B;  2E5L F;  3VGU A;  1HBM B;  1HW8 A;  4I56 A;  1YX2 A;  1FKP A;  1ULR A;  1EKR A;  2AU0 A;  2L48 A;  1T95 A;  2DNL A;  8RUC A;  1KVK A;  3N5B A;  3SQG A;  3UO0 A;  2YNF B;  3I56 S;  2K3K A;  1SB6 A;  5ETP A;  3UVJ B;  4RNO A;  1SKR A;  4I1T A;  4TVA B;  4ELT A;  5LSL A;  2I6W A;  3M2U B;  1S1V A;  3AJD A;  3JTN A;  3IGN A;  2X1G A;  3MEE A;  2QGF B;  2QL9 B;  4OZJ A;  2OJ3 A;  1Q4R A;  4X64 F;  2EK6 A;  1IBC B;  2OAU A;  3QT5 A;  3DOL B;  2MTL A;  3TVY A;  4BHQ A;  4NYO A;  3CDU A;  1FRK A;  2JLG A;  5ETR A;  3VR1 A;  1RGV A;  1IKV B;  3AY0 A;  4FVC A;  1W7W A;  5JUM A;  5LMU J;  1Y00 A;  3CNQ P;  1AYE A;  2E7X A;  5K8P A;  3PAC A;  5DG9 A;  5IWA J;  2DIS A;  3EPI A;  1KTQ A;  1FT8 A;  3MM6 A;  1T9T A;  1GAO A;  4OZ5 A;  1WNE A;  3MMB A;  3UR3 C;  1TL1 B;  3CJ8 A;  3L7O A;  5LOQ A;  4OYB A;  2D74 B;  3KLG B;  1TKD A;  5LL6 d;  2BDP A;  2V0N A;  1SQG A;  3SI8 A;  3G87 A;  7AT1 B;  4O4G B;  1RAG B;  1OQ6 A;  4CO2 A;  5BXI A;  1CG2 A;  4OQJ A;  4PWD B;  3K58 A;  3OSP A;  1RHR B;  2Q6C A;  1NDK A;  3ZTS A;  4O23 A;  3NRB A;  2HVI A;  2VPW B;  1ZA2 B;  3PYF A;  2V5H G;  4DL0 C;  2PA8 D;  5L46 A;  3OUY B;  1U2R A;  2RU3 A;  3BPS P;  5HMX A;  5KAK A;  2K2P A;  2EG1 A;  3TJ9 A;  2C2D A;  2FHJ A;  4C11 A;  4LQ9 A;  5D3G A;  3GIL A;  1U8S A;  4L73 A;  2R8J A;  1XQI A;  3AXM A;  1VRU A;  4QZV B;  1T9Y A;  1NJW A;  1NCL A;  1RWU A;  2E5G A;  5DDQ C;  2H5J B;  1MNE A;  4F8R A;  1RAJ A;  4RJV A;  1WF1 A;  1E6Y A;  4ZIW A;  1RHM B;  4OI4 A;  1U45 A;  2CQP A;  4BWM A;  4IDK B;  4U96 A;  2P2C B;  1NK5 A;  5GAG U;  1IM4 A;  3HXM A;  5IC4 B;  5AXL A;  2QJ3 A;  4DLE A;  1D0E A;  2GC8 A;  2ASD A;  3T5J A;  3CCW A;  2V63 A;  1SC3 B;  5D15 A;  5E5N A;  2JDJ A;  2J0Q D;  1L3V A;  4OV6 A;  5E33 A;  4F04 B;  4J9O A;  2HHS A;  1NKE A;  4A8X A;  1VI7 A;  1WHX A;  3W8P A;  1Q78 A;  3MPD A;  5K14 A;  3DM2 A;  4MAK A;  3M9M B;  2VOP A;  2J6T A;  2VFT A;  1RLC L;  3US5 A;  3U1M A;  3UFC X;  1OO0 B;  3H2V E;  2H9Z A;  4R8U A;  1AFJ A;  2DGW A;  5AT1 B;  3CCJ S;  4B02 A;  2WZ1 A;  1IXK A;  2W01 A;  1SKU B;  4NLX A;  4C9D A;  4YS2 A;  4BLG A;  3PRB A;  2BAB A;  4M5D A;  3E8O A;  1FRI A;  4AXI A;  2CPZ A;  3TUI C;  3W62 A;  1N5V A;  2BEF A;  5KG4 A;  3ICL A;  4M5G A;  5GAE I;  3DRX A;  3AXK A;  1T02 A;  2HND B;  3BSN A;  1VBK A;  4EBD A;  2CQG A;  4GC6 A;  4PKD B;  4QIG A;  4OX9 F;  5ITH A;  1H72 C;  4KSE B;  2MLX A;  2RKI B;  1SPB P;  1NM2 A;  4ECS A;  2MB0 B;  2MKH A;  2DB1 A;  4PUO B;  4ID5 A;  3DCA A;  3KJN B;  4DBQ A;  4OYO A;  3H5U A;  4P7T A;  5CYJ A;  1QE1 B;  4BC9 A;  1RJJ A;  2Z8Q A;  1KFS A;  1Q7L B;  3TAR A;  4TN2 A;  1X4H A;  1SKW A;  1XJW B;  3CD7 A;  1CJK A;  1FWL A;  1VIX A;  2J8A A;  1BQM B;  2D1C A;  3MEC A;  3JSM A;  1ZAV A;  2JJ4 D;  3FVY A;  4ZIV A;  3PV8 A;  4QQB A;  1Y7P A;  3W2V A;  2VFV A;  1WC4 A;  3EZU A;  2YKM B;  4QR2 A;  2GX8 A;  3AD7 C;  3KLE A;  1NZA A;  3C6U A;  2VQF F;  1ZPW X;  3POT B;  2HRU A;  2VKZ G;  3NP5 A;  1UVN A;  1RT6 A;  1MN9 A;  1JLC B;  3IBW A;  2Y1I A;  3NXZ A;  5HO4 A;  3A1Y G;  2G2Y A;  5G0R A;  4Q7A A;  4FPR A;  3UQS A;  5JVH Q;  1TMM A;  4NLO A;  3H59 A;  2R7S A;  3DI6 B;  1E6V B;  1RP5 A;  3G8T A;  3M2R B;  3K8V A;  4URG A;  3EWG A;  4FPI A;  2EFP A;  2LEC A;  4HAC A;  1X5S A;  3BZQ A;  3BRE A;  3IWX A;  4I68 A;  2CQD A;  4XDC A;  1KHV A;  5JXS A;  3KG1 A;  3DOM B;  2I1R A;  4XTT A;  1ZYQ A;  2UUB F;  4OX8 A;  3OTO F;  1WC5 A;  4RX6 A;  1BC6 A;  2LQB A;  2B9X A;  2Z0G A;  2BKO A;  4OJ3 A;  2N7Y A;  4ICL B;  3U27 A;  2AJ2 A;  2HMI B;  5E41 A;  4OZ3 A;  4B3R J;  3GIK A;  3D9B A;  1D9D A;  3E51 A;  5J2P B;  5KT7 A;  2H54 B;  1RAO A;  2WON B;  2VDI A;  1B0T A;  3C15 A;  1TUG B;  4NLP A;  3UDC A;  3M8P B;  3H5S A;  3TR5 A;  2R2U A;  1N6Q B;  1LWF A;  1HMV B;  2G9O A;  1FTC A;  2X7I A;  4IQX A;  3DLE A;  1RTH A;  2MKS A;  2YQ3 A;  1NB7 A;  4CLL A;  4ZHR B;  2C3P A;  1J2V A;  2J9E A;  4P74 A;  3ZNU A;  4NA2 A;  2ZVS A;  4DF8 A;  1JB0 C;  2U1A A;  2C2Z B;  4HR2 A;  4IYQ A;  2AYB A;  4LRF A;  2WBM A;  1D09 B;  1CUL A;  1K0V A;  1QSY A;  5B0A A;  1UA0 A;  1ARO P;  2AQ4 A;  1N34 F;  2V6A A;  3M30 A;  2HFU A;  2MGZ A;  5I3U A;  3T3F A;  4A47 A;  2RNE A;  2A0F B;  2DO0 A;  2CAD A;  4MMO A;  5HBM B;  1S1T B;  4E2F B;  2CG8 A;  1FVQ A;  3AJ2 A;  4ZVP B;  4DV1 J;  4Q0B A;  3GWC A;  4CM0 A;  4JI0 F;  1R31 A;  5FDL A;  4CIO A;  2BM0 A;  1GNK A;  2AX0 A;  3C6T B;  2W8K A;  4TNO A;  6FDR A;  2DIT A;  4J90 A;  2DBB A;  4ATN A;  1YI2 S;  1T8E A;  4ANC A;  3PG9 A;  3P5B P;  5D4N A;  3UR0 A;  1FRH A;  2M52 A;  3GFX A;  2UU9 J;  1N32 J;  1VQ4 S;  5CAA A;  1EET A;  3IWN C;  2E5H A;  2FJA B;  2QLB B;  1XIQ A;  1DZ5 A;  2IRX A;  1ICE B;  4WU3 A;  4G1I A;  5D78 A;  2L9D A;  2J9D A;  4NOH A;  1RT3 A;  3AOD A;  3RG6 A;  2HS3 A;  4WP9 A;  2ZD1 B;  5B0B A;  2E29 A;  1JWW A;  4YQW A;  1S72 S;  4ZKA A;  4B17 A;  3CJ4 A;  2VHG A;  3KTQ A;  2HHH J;  1VQN S;  2DNM A;  4PAB A;  3MTJ A;  1F5A A;  2AJ4 A;  1QTM A;  2HPU A;  1FFS B;  5H9E J;  1UEV A;  3EGV A;  2F4V J;  4M5M A;  2F5G A;  1JLA A;  3P49 B;  1YBT A;  4NZ0 A;  1K9M T;  3KG0 A;  5EWE A;  4DCJ B;  3GIM A;  2E1R A;  5HAO A;  4C4W A;  1U1L A;  2A2D A;  3M32 A;  2NZC A;  2A6O A;  1TL5 A;  1R8H A;  1DFD A;  3VAL A;  3J80 U;  2M8H A;  3J7Z 5;  4G1Q B;  3RU0 A;  4L3N A;  5L9N A;  3CCV S;  2ZBC A;  1NRK A;  3K5M A;  2BAN B;  5A8R B;  3R5C A;  2POK A;  1Q79 A;  2B0G A;  2CQ4 A;  1AZS A;  2XI3 A;  4LFB J;  2MHN A;  2OPS B;  1JXV A;  1WC3 A;  4USW A;  3IR6 B;  1ZM9 A;  4C0B A;  2BXJ A;  4KGZ B;  2XZW A;  3CJ0 A;  1H7X A;  2HWT A;  1RAA B;  4H4K A;  3CJR A;  2YKN B;  3F56 A;  2Q43 A;  2ZE2 A;  3SFU A;  5K8N A;  3G6V A;  4FXD A;  3NS7 B;  3SXL A;  2VIH A;  3AOB A;  4A8O A;  3MTK A;  3BGR B;  1NJX A;  4FKX A;  2YQ1 A;  4CT9 A;  2V9K A;  4I7F A;  5E3P A;  3CDE A;  3KYL A;  2G0J A;  4C2M A;  4C8K A;  2LFV A;  1S12 A;  2ZH3 A;  1FXL A;  1LW2 A;  2XWX A;  1HNV A;  2FGO A;  4LVO P;  4Q43 A;  2VQE J;  1Y5L B;  3D6T B;  4GVL A;  3SEO A;  5HQM A;  3MR2 A;  3SQG B;  1J5O A;  1RBL A;  4ZVU B;  3OLA A;  2HVE A;  3TAP A;  5ETM A;  1RTI A;  5HI7 A;  2DJW A;  1SUQ A;  1S1V B;  4ZPT R;  1WC1 A;  2MQL A;  1U2F A;  2ZZT A;  4RBT A;  3AHP A;  3U1L A;  2OFG X;  5L39 A;  3QFW A;  4BDP A;  4AND A;  1ITP A;  1XBW A;  2PSZ A;  4LRD A;  3S6E A;  2J7W A;  3RBE A;  4MK8 A;  4A8K A;  4QPX A;  3CJT A;  1IKY A;  1CSJ A;  1R8C A;  3AAW B;  5J1E B;  1KHW A;  3W66 A;  5KOX A;  3PJX A;  3W61 A;  2ACY A;  1YZ7 A;  3W9H A;  4ZCI A;  3HF5 A;  1IBM F;  3FGV A;  1QJH A;  4ZVO B;  1F9H A;  2XMJ A;  1N0U A;  1WEZ A;  2RB7 A;  3T1Y F;  2DR6 A;  4DHV A;  3IWL A;  1LW0 B;  3PR4 A;  3VZH A;  2KTQ A;  1RT5 A;  3QWP A;  2DCL A;  4ZVT B;  3UWT A;  3NNA A;  4JI1 F;  1NK9 A;  4KY3 A;  5F3Z A;  3PFO A;  2DNH A;  1HNW F;  5A8K A;  2BOP A;  5DDR C;  1DLO B;  2V8V A;  2HKE A;  5LM7 E;  3GYG A;  3QT6 A;  1DY3 A;  1JLQ A;  4CDI A;  5J1N A;  1RXO B;  2KB2 A;  3TEG A;  3V6J A;  5SZT A;  1HWL A;  1S9E B;  4P72 A;  4CO1 A;  3R97 A;  4I2Q A;  2I5J A;  1RYR A;  1ZAW A;  4M5J A;  2P5V A;  3DHW C;  4YFU A;  4F67 A;  3ETM A;  2IY5 B;  5KFG A;  2F65 A;  3UPF A;  5IT9 Y;  1QAY A;  3G2X A;  3NWG A;  3O6Q A;  1Z2Z A;  5CQG A;  1YRU A;  5D3G B;  3R7N B;  1LNQ A;  3PRD A;  3KLI A;  3MCN A;  4P71 A;  2YNI B;  2UVW A;  4B3M F;  1VRU B;  1RWN B;  3SZ2 A;  4FP9 A;  3H90 A;  2VG5 B;  5EX0 A;  3CJ3 A;  3RJM B;  4NMX A;  4R5P A;  3TA0 A;  1ZAX A;  4I6A A;  1FRL A;  2OSQ A;  4OYM A;  3AQP A;  3HHL A;  2J6U A;  1JXE A;  3H7H B;  3NKY A;  2XYP B;  2EVZ A;  2RJZ A;  3NBP A;  1OWX A;  2GML A;  3T5H A;  2XQC A;  2H1Y A;  3R9L A;  2V4J A;  3V2U C;  2YX1 A;  2QFJ A;  3CJS A;  3T5L A;  3JXO A;  2RD5 C;  3OXL A;  1S99 A;  4IKA A;  3N5F A;  3R7B B;  4F3M A;  2M5Y A;  1UJ6 A;  1AUS L;  4QIE A;  3OXG A;  1NSP A;  4OZN A;  2ALZ A;  1KQG B;  3SQO P;  2VBW A;  4P73 A;  4ZMM A;  2HSE B;  4U7U K;  1PIE A;  3DM2 B;  3H2U B;  4QYZ J;  3OL8 A;  4JI4 F;  3BQ2 A;  2XLJ A;  3PW4 A;  1Y3K A;  1S0N A;  4NLV A;  3K59 A;  2G13 A;  4WIQ A;  2ROG A;  4LUB A;  2FVP A;  5LMN F;  1L5U A;  4DFM A;  1Y3J A;  4ZLL A;  1R3N A;  4DXL A;  1HI8 A;  3QGP A;  3NGK A;  1RTD A;  1SJQ A;  5J2N B;  3DU5 A;  4OI3 A;  3W8G A;  1IKW A;  3BGO P;  1S49 A;  4LSN A;  4YB5 A;  2DCU B;  3C2P A;  3JQJ A;  3RBZ A;  7FD1 A;  4D3G A;  3VAH A;  4HTJ A;  2QO3 A;  2F4F A;  4OYI A;  4ID5 B;  3OBI A;  3R5B A;  4I64 A;  2NQP A;  3M8S A;  1UVJ A;  2WSC C;  1WG1 A;  3M6U A;  2MKI A;  3IG1 B;  2KXN B;  4K4Y A;  2ADB A;  4YR3 A;  3KOA A;  2DGQ A;  2DPJ A;  2CJX B;  2PD1 A;  1M90 T;  3W7B A;  4OHZ A;  1T03 A;  2QYG A;  1T05 A;  1T9V A;  3ZTO A;  1AW0 A;  1CJK B;  2NUH A;  4DL5 A;  2GQC A;  1OY6 A;  5EX3 A;  2LVW A;  2WOM B;  3LP0 B;  1SJF A;  3KXD A;  2N4D A;  4BS2 A;  5IM0 A;  2OIH A;  1OY8 A;  4S0M A;  3M8R A;  1N48 A;  3AFG A;  7FDR A;  2D69 A;  5I3Q A;  4WII A;  1SVD A;  3PFE A;  5A2Q U;  2GVZ B;  1GMV A;  1UZH A;  2B9Y A;  4JI5 F;  4CO3 A;  4DR5 F;  3KLE B;  3NAH A;  4DCP B;  3SCK E;  4USK A;  2GJF A;  4ZPC A;  3FJ2 A;  1RT6 B;  2N4C A;  1BWV A;  4U9R A;  3R5J B;  3EXC X;  3U1N A;  4A8W A;  5HP1 A;  1S79 A;  3SBM A;  1C1B A;  2P9G A;  5C2C A;  1PIL A;  5G0R B;  4CCH A;  3MGJ A;  4YB6 A;  3KUH A;  4X65 F;  5F8I A;  4P9S A;  3QJL A;  5DGA A;  3E3X A;  1GMW D;  1WG4 A;  2DIV A;  3VAG A;  1YGY A;  4JI3 F;  3TJ8 A;  1G3O A;  2V8D A;  4NZ6 A;  4TYA A;  2JEG A;  4N5S A;  2VV5 A;  4HAC B;  1MWY A;  2VB6 A;  2ZWP A;  3G8Q A;  5CA5 A;  1W2I A;  4KGX B;  4JV5 F;  1HQU A;  1MRO A;  4IR1 A;  3OL9 A;  2HQF A;  4X4P A;  2QSF A;  4B3S F;  1EP4 A;  2C2E A;  1WOO A;  1B64 A;  3IMQ J;  1LXN A;  2ZOM A;  3CC4 S;  5KFD A;  2H4W B;  4QR1 A;  1UFL A;  2B9E A;  4N41 A;  1YK9 A;  1SIZ A;  1M5S A;  3CUL A;  2PEB A;  4ES2 A;  4UW2 A;  4KHR A;  4A48 A;  2ZH8 A;  4ZVR B;  5HMZ A;  3WBZ A;  3G8S A;  2QLJ B;  3DGP A;  2AJF E;  4LSL A;  4HT7 A;  4FXV A;  4QPT A;  4C48 A;  5F8N A;  1G4C A;  4CWB A;  2MZQ A;  2PFF B;  1WTF A;  2R8K A;  3BGF A;  4J5O A;  1RTH B;  2BJ3 A;  2ASJ A;  4X84 A;  3CCS S;  5LXY A;  3HJF A;  1MMN A;  3H40 A;  4Q44 A;  1VCT A;  4FYD A;  4I6Y A;  3KHL A;  1RZM A;  1M5P C;  3CJQ A;  3CW2 C;  4DQI A;  2QLW A;  4LFC J;  3NLC A;  3D5M A;  3DMJ A;  4IG3 B;  2DY9 A;  1URN A;  1L3K A;  4LF6 F;  2AKW B;  1N36 F;  2Z30 B;  2GHV C;  1TL7 B;  1OYE A;  3HPO A;  1PYO B;  4CYU B;  4DUZ F;  4PG4 A;  1X60 A;  2XMK A;  2DGX A;  1X0F A;  4JI2 F;  3H4D A;  4J91 A;  5KFH A;  3DLK A;  3BO4 A;  1JLE A;  1W26 A;  4O0I A;  1X4F A;  2AGQ A;  4RBV A;  1TKZ A;  3HMJ G;  3P45 B;  3V81 A;  4RW6 B;  4DL4 A;  4UQT A;  2HYI B;  4C3L A;  3PM9 A;  4H4O B;  2PFD A;  1RKI A;  1JKH A;  4NEZ A;  3JYT B;  1UJ4 A;  5F8J A;  2LA6 A;  1S6P A;  3RRH A;  1W2B R;  2CZV C;  2NUU G;  2KHC A;  3A13 A;  1YVF A;  4TQR A;  2UXC F;  4C8L A;  2XSF A;  5HMW A;  1FWK A;  1EET B;  5KFC A;  4WTY A;  1FCA A;  1WD6 A;  4Y2A A;  3HK2 A;  3MUV P;  2V2Q A;  4CI0 B;  3QRR A;  2FZG B;  4ZP9 A;  2ZWO A;  5C24 A;  3MEG A;  1S6Q B;  2JLE A;  1XNR F;  2AJ1 A;  3NCR A;  5D0G A;  3M05 A;  4X66 F;  3LAM A;  2OKQ A;  1YJT A;  1WOP A;  1TFW A;  4NLD A;  4K8R A;  1NH8 A;  2A18 A;  1N34 J;  5CYM B;  3F41 A;  2LKZ A;  3IA0 A;  1YSJ A;  3MM9 A;  4OIX A;  4DV5 F;  4ZVE A;  2NXE A;  3JTO A;  3K5P A;  1M1K T;  5ETQ A;  3C19 A;  3KDN A;  3PEJ A;  4QWD A;  4ECZ A;  3UD4 P;  5DET A;  4C8Z A;  2E1C A;  2XCP A;  4ILL A;  2IA0 A;  2M2B A;  3GJS B;  3LGM A;  4ZP7 A;  4PAA A;  3KHG A;  2XC9 A;  1TKT A;  2RVJ A;  5F9N A;  1AXQ A;  4LSZ B;  2EC2 A;  5HRO A;  3MM8 A;  4ITS A;  3J81 Y;  1RT7 B;  3MI7 X;  3HVT B;  1RA7 A;  1Q8K A;  2PI5 A;  2QMU B;  2FY1 A;  1VIO A;  3FRY A;  4JV1 A;  1AZS B;  2HZC A;  2ZZM A;  1S1U B;  3PW7 A;  4YN3 B;  3R6G B;  2OD6 A;  4ZPA A;  2KJV A;  2RRA A;  3Q8U A;  1FER A;  1N88 A;  3CO9 A;  3D6F B;  3EGW B;  5B09 A;  2QL5 B;  4X4O A;  4ILR A;  4DS4 A;  2QMX A;  2BR0 A;  4CLY A;  2BE2 A;  2AJ0 A;  2IBO A;  2XBP A;  4WE1 A;  2ACM A;  1F9E B;  1U1O A;  4FS1 A;  3FBE A;  3N0V A;  2HFN A;  4DU8 A;  2DXF A;  3EJM A;  5BR8 J;  3HD2 A;  4X4U A;  1H2T Z;  5GMK a;  1GFW B;  3M9O B;  4DV6 J;  2D3Z A;  1IWA A;  4O44 B;  4NCG A;  2PO4 A;  1I51 B;  1QUV A;  1U6Z A;  3CDA A;  5KFS A;  3NGT A;  1LW2 B;  4K2X A;  1SCJ B;  3C46 A;  5DGB A;  2VF3 A;  1VJQ A;  3H20 A;  2RRN A;  1KVJ A;  1S48 A;  4C8Y A;  1KTV A;  4DR7 J;  2KM8 C;  3NY0 A;  1NO8 A;  2CWX A;  4F3O A;  1J5O B;  4KV8 A;  4CH1 A;  3HHL C;  2UUC F;  1TVR A;  1N5Y A;  2DGV A;  4MK9 A;  4WWS A;  2VJU A;  1RCO B;  1FKO A;  5FD1 A;  3QGH A;  2W7P A;  3Q8S B;  2ZH7 A;  1NSA A;  1BQN A;  1RAI B;  2KRB A;  3OFE A;  4NZ7 A;  3FZB A;  4J7C A;  4FVM A;  1VBZ A;  4MIA A;  4M1K A;  4NL5 A;  3N9U C;  4DX6 A;  5T7L A;  1KOH A;  4X4Q A;  4EFA C;  2OPR A;  2FUG 9;  1PBA A;  1U47 A;  2ZHB A;  3D7S B;  4X4V A;  2GIQ A;  1IR2 A;  1LEO A;  1XN9 A;  4J9L A;  2CNN B;  3HDS A;  4C98 A;  2XLI A;  1RT5 B;  5F0U A;  1S9F A;  4DUT A;  4FBT A;  1IQT A;  1RKJ A;  4OI6 A;  2QT7 A;  1WHV A;  1YWX A;  3J7Z T;  2IVF B;  1H3D A;  3TVK A;  4CNY A;  2ATL A;  3BN7 A;  4M95 A;  3S7R A;  3KFW X;  1FEE A;  3QT7 A;  2NSC A;  1JLQ B;  2IPO B;  1Q5V A;  4QWA A;  4CTA B;  2ZH2 A;  5HVG A;  3QRP A;  2GMJ A;  3HFV A;  1DTQ B;  1TL3 B;  3I96 A;  3IGV A;  1BLU A;  2YKO A;  4JOU A;  3OFH A;  4KHP J;  1F60 B;  4DEZ A;  5F3T A;  4NYP A;  3S01 A;  2N7C A;  3VHQ A;  4OL8 A;  2HUR A;  3KLI B;  1B4S A;  2KT2 A;  1FEH A;  5B0E A;  2OPQ A;  1VRT B;  1LQ9 A;  4OZL A;  2G0I A;  1P6T A;  3MMA B;  2HGM A;  3CTR A;  2FVC A;  4OJ1 A;  2MHE A;  1PG5 B;  4A4J A;  1LFW A;  2K7J A;  4PQU B;  4R5P B;  2DNO A;  2VOO A;  4KE5 A;  5L8R C;  3QLH A;  4UOH A;  3UN5 A;  4W90 B;  2HHW A;  1CS4 B;  3NBP B;  2FQQ B;  4B3T J;  2LLZ A;  1HWI A;  3K5O A;  2OEM A;  1YJ7 A;  2DXD A;  3P5T L;  4MKB A;  3RZA A;  4OJG A;  4N56 A;  4K4X A;  3L95 X;  3BKF A;  4OZ1 A;  4YY3 F;  1WEY A;  1D8Y A;  3QSI A;  3J7Y I;  4NXN F;  4CH0 S;  1AFI A;  1KVI A;  2P6S A;  4DQQ A;  4KO0 B;  3G6X A;  4ZVQ B;  1RUS A;  1JK9 B;  3SSR A;  1GXT A;  4NI2 A;  2R7Q A;  2B3T B;  3BR8 A;  2XMM A;  3PCO B;  2BJ1 A;  1R0B G;  1JJ2 R;  5ETO A;  3HFZ B;  4ZCL A;  5ETN A;  4HI2 A;  3A8K A;  4PPZ A;  1SBR A;  4CO4 A;  3DRS B;  1NPR A;  4B3M J;  1VQ9 S;  3QRQ A;  3CGI A;  2AGO A;  1JMT A;  1GMU A;  2FJD B;  3MZI A;  3RTV A;  2DVI A;  2E9Z A;  3FEZ A;  4HH1 A;  3A3O B;  4PCQ A;  1FD8 A;  4OMF G;  3N28 A;  4Y28 C;  4M5L A;  2GQQ A;  3D54 A;  4W4M A;  3LAK A;  2CPY A;  2OEK A;  2L9W A;  3OR2 A;  2WVF A;  3KNG A;  3RRK A;  3GSD A;  3EGZ A;  2W4P A;  3ELH A;  4A8M P;  1UPM B;  4DV3 J;  4DG1 B;  4USI A;  2AYM A;  4K4U A;  2K1R A;  3O1L A;  4F50 A;  5A6W A;  1YZ6 A;  4PWU A;  3NCP A;  2XMA A;  3RW7 A;  1RT2 B;  3O44 A;  1UVM A;  1L3S A;  3VAI A;  1SXL A;  3BDE A;  2DNG A;  4DR3 J;  1TUV A;  2FLN A;  1T03 B;  3CIZ A;  2AMC B;  1WI8 A;  4P2F A;  3CCU S;  3B54 A;  3SMZ A;  3QAE A;  1VQM S;  4DR1 F;  1SH2 A;  1JJ4 A;  4JI4 J;  1HBO B;  3I0S A;  2FVR A;  3IBC B;  1K8A T;  2VDH A;  1NSQ A;  2ZC4 A;  3CUN A;  5IM0 B;  3HVW A;  4XIU A;  3CJK A;  2EPI A;  2ILZ A;  2ZHO A;  4UUX A;  1B7Y B;  1PYS B;  2CNO B;  5LMN J;  3Q8R B;  2LEB A;  2BZ2 A;  3ENW A;  3LP1 A;  5EWG A;  1D9A A;  4EYI B;  1ZPV A;  2G4B A;  3ENQ A;  5A0Y A;  3GG1 A;  2CQ0 A;  4JI7 J;  2IDL A;  2J7U A;  4TYB A;  4DQP A;  2IC3 B;  4RU2 A;  3CPW R;  3FQL A;  5GAD U;  2OEJ A;  4LF4 F;  1N33 F;  5HP1 B;  4OLO A;  2B4O A;  2RIL A;  3BGL A;  3PVX A;  4KRW A;  3MDF A;  1FRX A;  3I55 S;  2OPP A;  3RBD A;  2B6A A;  3K2Y A;  2W1B A;  4PG8 A;  2E7W A;  3BJY A;  3S1T A;  2RUG A;  3M2V B;  1VHI A;  2DGU A;  1RE1 B;  4KPC A;  1WEL A;  2XG8 A;  4ED1 A;  2R2R A;  3D0G E;  2F63 A;  2NYI A;  2P8I A;  3OFG A;  3J81 j;  1WC0 A;  2QTW A;  1Q0N A;  4DPY A;  2AF6 A;  3D4J A;  2MZJ A;  1MRO B;  4WZQ A;  1S5Z A;  1R0A A;  2CZ4 A;  1WOS A;  3CO0 P;  3MF5 A;  2FZC B;  3R27 A;  4M63 A;  4UTG A;  1BY9 A;  2RHS B;  2RH3 A;  4JI5 J;  3HSG A;  4DR5 J;  2FPH X;  4KFB B;  5IOL A;  3ZZT A;  3JB9 k;  2CXE A;  1HNI B;  2LU2 A;  3DGP B;  3CSK A;  5HK4 A;  3UCG A;  4IFY A;  2HIY A;  2DY1 A;  3ITH A;  2OFH X;  4MH8 A;  4EUV A;  3MCO A;  5L1J A;  2EXU A;  3FEY B;  4BCA A;  1M0S A;  1J5E J;  4JI3 J;  1IM6 A;  3FFI A;  1UKU A;  2QC3 A;  4D3H A;  2D7S A;  4LF5 F;  5EUH A;  3G82 A;  3AD8 C;  5F0W A;  3DRP A;  2IVY A;  3TOQ A;  4C0H A;  4MFB A;  3RB6 A;  2CPI A;  4JV5 J;  1PGZ A;  1DAR A;  2KO1 A;  1VQ8 S;  4P52 A;  4N8N A;  2V9W A;  4HH0 A;  4B3S J;  4N47 A;  1S9G A;  1NZ8 A;  4UT4 A;  1M5H A;  1JNZ B;  1TKZ B;  3QIP A;  3IXQ A;  3MR3 A;  1H0H B;  3K8W A;  2YVS A;  4F0K A;  1LWX A;  3AB2 B;  3Q24 A;  2FLO A;  1JKH B;  1R8P A;  3V4M A;  4ZK7 M;  4YR0 A;  3RAM A;  1Q95 G;  4C3M A;  1S6P B;  2OD4 A;  1JLG B;  1T11 A;  1CEZ A;  1P27 B;  2W9C B;  3J7A N;  2HFO A;  1YJW S;  4NYZ A;  2H48 B;  5JJB A;  1XMO J;  1G2E A;  4OHV A;  3C14 A;  2UXD F;  1YRT A;  3FCW A;  4M5N A;  4OHX A;  2K8G A;  3Q83 A;  4M5K A;  1VQP S;  2IAJ B;  3FDS A;  2QG9 B;  1T3O A;  2COL A;  3MEG B;  2Z2L A;  4KC5 A;  3QYY A;  4DV7 F;  1HR0 J;  1OSC A;  1N54 B;  5AXN A;  3HHD A;  2V68 A;  1TQL A;  4RW4 A;  4A8S A;  1NDP A;  2FC9 A;  3W9I A;  2I9S A;  1C1C A;  4C3K A;  2BQU A;  4OJH A;  3TA1 A;  1GTE A;  3MM9 B;  5AE2 A;  5LSR A;  3TAM A;  2I2Y A;  2Z2Z A;  5H1S V;  1RK8 A;  3W63 A;  2HBQ B;  1BUX A;  4WTO B;  2GO9 A;  1AA1 B;  3CDB A;  4A46 A;  1HD1 A;  4DV2 F;  3HSZ A;  2AEJ A;  5B0C A;  3MED A;  2BVZ A;  2CPJ A;  3QO9 A;  5HRO B;  2O5D A;  2KVQ E;  1VGY A;  2DNZ A;  3EM1 A;  3GE9 A;  3LAL A;  1DBD A;  3GYN A;  4EWT A;  4RWX A;  3MAQ A;  2ZBP A;  1U4B A;  2UXB F;  3KK1 B;  5KT5 A;  2DEJ A;  2OI2 A;  5IQ6 A;  1H73 A;  5KFK A;  2R7U A;  3B78 A;  4CLP A;  1GXL A;  3MMC A;  1U48 A;  2FC8 A;  4WZM A;  1NAQ A;  5HLF A;  2FVS A;  3QJP A;  1WAC A;  2IDE A;  4P75 A;  2YPY A;  3EUN A;  3PZP A;  3RR7 A;  3EPG A;  1T9W A;  3RR8 A;  3I82 A;  1MSW D;  3PX0 A;  1WDD A;  5DDO C;  4H54 A;  2C3O A;  4QJV A;  4LR8 A;  2VJV A;  1S4F A;  4DV0 J;  1H2U X;  4YEA A;  4ZP8 A;  4GO5 X;  4DPU A;  3ILL A;  3CDW A;  3HKZ D;  2BUN A;  1S0M A;  4DV5 J;  1RI7 A;  4A8F A;  3QGI A;  4IFV B;  4WFZ A;  4NCG B;  1MW7 A;  3NGU A;  4LF9 F;  1F5B A;  4ZS6 A;  4ED2 A;  2JNJ A;  4IQM A;  1EQ0 A;  3ULH A;  2LXF A;  1HNX F;  1O51 A;  4ZCM A;  3PX6 A;  3PIO Q;  2EI5 A;  5HVF A;  4Q45 A;  2VBX A;  3I5B A;  2DNY A;  2MQP A;  2ZVI A;  3GFH A;  4AUK A;  1XTZ A;  4TY8 A;  3PTW A;  1TVR B;  5IT0 A;  1FK9 A;  4GO7 X;  2OML A;  4O4R A;  2CJB A;  9RUB A;  3W5X A;  1EHW A;  1QY7 A;  3E01 A;  1HBU A;  1S76 D;  4RU9 A;  4WBF A;  4Z7C A;  4PPD A;  1KR4 A;  1NHU A;  2HZV A;  2E5J A;  4ZVG A;  4ELU A;  2B7B B;  2BA9 A;  3IS9 A;  3JQM A;  4DR4 F;  2DYA A;  2KDO A;  3DDN A;  1HNZ J;  2AJQ A;  3OR1 A;  3F44 A;  3OHB A;  1Q8B A;  1Y5I B;  2DNK A;  4CM2 A;  3G4S S;  4IH7 A;  2FGC A;  1X7V A;  3QFH A;  2J0S D;  1MU2 A;  4I0W A;  5AE1 A;  4B3O A;  2XHW A;  4CRJ A;  2FHJ D;  1GMW A;  1NKB A;  4X62 J;  2CKW A;  2QA2 A;  3VF0 B;  2FHM A;  1C0T A;  3ZZO A;  1G7C B;  4U8V A;  3BO3 A;  4YHH F;  1B7F A;  1H74 A;  1FDB A;  4ZPB A;  5J2Q B;  2X1B A;  1CQM A;  5AXK A;  1DTT A;  1RDR A;  5DZ6 A;  2AYG A;  1MML A;  5E0O A;  4QIW D;  3CWJ A;  3W1Y C;  1FJE B;  4BC7 A;  1NBE B;  4F4Z A;  1MWZ A;  1DQ9 A;  3T6B A;  1U2C A;  2ZEJ A;  3ET6 A;  1H7W A;  5K8M A;  2J9D E;  2YNH A;  1FNX H;  1KC8 T;  4CLT A;  1ACM B;  4Y3C A;  2BJE A;  2HS4 A;  3SDE A;  2LXU A;  3M8W A;  3LGN A;  4ED7 A;  2C22 A;  2A6M A;  4GRS A;  2XZD B;  1N5T A;  4ZPV R;  2B7C B;  2RF2 A;  4Z7Y A;  4NA1 A;  1P9Y A;  1U49 A;  2CDR B;  1TK5 A;  2M7S A;  1CLF A;  2QZ8 A;  3LH2 S;  2GJ2 A;  1LK7 A;  1WI6 A;  1KRP A;  3PYD A;  3TW0 A;  2MZ1 A;  1F2G A;  2KZZ A;  3QID A;  2QMW A;  3UD3 P;  5HJY A;  5CCL A;  1FRM A;  1FJC A;  1DQ8 A;  2VPZ B;  2GNK A;  2FYX A;  3FBC A;  3T6J A;  4NA3 A;  4MYU A;  4C8M A;  2H51 B;  4V1A k;  3RAX A;  2E9T A;  2MDA A;  4NI2 B;  2XSJ A;  3I4H X;  1XNQ F;  3EVW A;  1QVG R;  4NRT A;  4B9S A;  4WKR A;  2MKC A;  2J9C A;  1X5O A;  2W24 A;  2V34 A;  4KGM A;  2PC6 A;  4PYA A;  1JLB A;  2IA6 A;  2CZ9 A;  2ROP A;  3BSA A;  2XY7 A;  2IM0 A;  2ZKT A;  1YKW A;  4CQ1 A;  3HI9 A;  2RRB A;  2W9B A;  2JRS A;  4Q5V A;  3IC1 A;  3OR2 B;  4ZN3 A;  2A2C A;  1R6Y A;  1CC8 A;  1UWA A;  2F8H A;  2VFR A;  3RW6 A;  3JAM Y;  4ED4 A;  1Z1Z A;  5LJ5 Y;  2K1R B;  4YY3 J;  4HKQ A;  1R8A A;  4Y34 A;  3PXG a;  3O3L A;  3LAN A;  2DNQ A;  2H65 B;  4Y2I A;  4NWB A;  2XUL A;  4I69 A;  2MLZ A;  2A1B A;  2PI4 A;  1HQE A;  3ENV A;  5KFZ A;  4NLQ A;  2VU5 A;  4C0O C;  4F25 A;  4GVB B;  3WQP A;  1D3W A;  4KGK A;  3I0S B;  1JQG A;  3NOC A;  2CQ1 A;  1RBA A;  2HRY A;  2HHQ A;  1NSK L;  5LMU F;  3I5A A;  4E98 A;  1SC6 A;  3CJK B;  2DIU A;  5EN1 A;  2W2M P;  4DQS A;  5IWA F;  1ZM4 A;  3MWB A;  2YNG A;  1FJG J;  2E66 A;  2GZO A;  4B9V A;  2VPX B;  2Z4P A;  4XAK A;  4YME A;  2AW0 A;  1HBM A;  3LP1 B;  2P9C A;  4HYK A;  3OT9 A;  1UWB A;  2CQ3 A;  1EJ7 L;  4WPA A;  1R27 B;  2OO4 A;  3O8W A;  4DX5 A;  3RYL A;  1EZZ B;  1K1S A;  2RQC A;  1VQO S;  2YH1 A;  3UVJ A;  4FN5 A;  3RB4 A;  5FLX Y;  2IJF A;  3M2U A;  5KG7 A;  2HEK A;  3NG8 A;  3LWM A;  3NL0 A;  2B6A B;  2OTL S;  4O3R A;  4DPT A;  2M9K A;  4JYA F;  2K3I A;  4LQ3 A;  2HGL A;  1U6B A;  5K20 B;  2YWH A;  2W9A A;  4LBP A;  1NPK A;  3DOL A;  2W25 A;  1KP6 A;  1SL2 A;  3CCQ S;  4ENO A;  2WSF C;  1UJ5 A;  1YBA A;  4USJ C;  3PNI A;  4LF2 A;  2MQO A;  4ED8 A;  2WHO A;  2R7W A;  4NLY A;  5J2M A;  5K8O A;  1QAX A;  3RAQ A;  2HIQ A;  5IS2 A;  2F8M A;  4USH A;  1Q53 A;  3SCJ E;  3GTY X;  1LK5 A;  1SH0 A;  2MPU A;  4K7Q A;  1DHM A;  3FCV A;  1TL1 A;  3SFG A;  2MEW A;  3C8Y A;  5GAG I;  4FKY A;  3KLG A;  3R2D J;  4QWB A;  2YWF A;  2RE1 A;  3BBB A;  4CLF A;  3MAA A;  1X4D A;  5M2R A;  1XC9 A;  3DU6 A;  1IR0 A;  4RPF A;  4IFY B;  4CLS A;  1R7I A;  1N33 J;  3ITH B;  3LP2 A;  1VLY A;  1O5J A;  4OHW A;  5KFM A;  3GJR B;  1UCN A;  1KOO A;  3CMA S;  3D67 A;  3ILJ A;  3RUB L;  1K47 A;  3C16 B;  1U1N A;  2OMO A;  2X3G A;  3GQC A;  4DCO B;  8AT1 B;  3PX4 A;  3AB4 B;  1P8G A;  1CJV B;  2JC1 A;  2ZH9 A;  4DSK A;  5IV3 A;  3LOU A;  3DRP B;  2VG6 B;  1QSS A;  1ELO A;  4HLB A;  3UDL A;  3I31 A;  3MR7 A;  4AE5 A;  4OZ0 A;  1FRJ A;  2BMB A;  1DJ0 A;  4ZLN A;  4R0E A;  4PR6 A;  3IRX B;  5CCM A;  3DHX A;  5F8L A;  4F0H A;  1P1T A;  5M2P A;  1GEH A;  3QIP B;  3H98 A;  4ZJQ A;  2I0X A;  4M94 A;  4J37 A;  5D77 A;  4PWW A;  1HPZ B;  2Y0S D;  2A10 A;  2Y0B B;  3B8H A;  3PRV A;  4QBU A;  5THW A;  2DNR A;  1EQM A;  4X2B A;  2HLU A;  1F0X A;  3FZ2 A;  4Z2X A;  5F41 A;  3G9C A;  3C14 B;  3CD0 A;  3E2E A;  2X3D A;  4WU2 A;  1S7H A;  1X9W A;  5DLG A;  3QNW B;  4A8Y A;  2N82 B;  3I9Z A;  1RTZ A;  4Q2M A;  4K0K F;  2DTJ A;  2KKH A;  1FFW B;  1LWE B;  1HYS B;  4HHH A;  4TLQ A;  1WDT A;  1RQ0 A;  5HQL A;  3R2C J;  4ED5 A;  1F3F A;  4LF5 J;  2B8P A;  2L08 A;  4CLZ A;  2KI2 A;  2BRK A;  2GVD A;  3LO3 A;  1C1C B;  4DJB A;  1WKL A;  2FTR A;  4RNF A;  1ROF A;  5J1P A;  2O66 A;  3LWL A;  3TAM B;  3PR5 B;  1N0V C;  3OHA A;  2JLF A;  3D3C J;  2XHC A;  4QIF A;  1KQK A;  3LPY A;  2RHQ B;  1YJ9 S;  5IT9 U;  3KMS A;  1RCX B;  3DLB A;  4LJM A;  2RKI A;  3G6Y A;  2HGN A;  2XS5 A;  3MED B;  2ZBQ A;  3OV7 A;  3NEK A;  1XWL A;  5D4O A; 
#chains in the Genus database with same CATH homology
 1F9E B;  4ZVT B;  1RHR B;  3IBF B;  2C2K B;  3IBC B;  2XYP B;  2H51 B;  4DCP B;  2H65 B;  2Y0B B;  3KJN B;  2DKO B;  2H5I B;  2H4W B;  3D6M B;  2QL9 B;  2CNL B;  1I3O B;  3R7S B;  2XYH B;  3GJR B;  2H4Y B;  1IBC B;  3GJT B;  2XYG B;  1RHK B;  5K20 B;  2C2M B;  1GFW B;  1NME B;  3GJS B;  3P45 B;  2CNO B;  4ZVS B;  3R5J B;  4ZVU B;  2CNN B;  3KJF B;  2QLF B;  4DCO B;  1PAU B;  4ZVR B;  1I51 B;  3QNW B;  2QLJ B;  2QLB B;  3R7B B;  4JB8 B;  4LSZ B;  3EDR B;  2CJY B;  2FQQ B;  3GJQ B;  2XZD B;  1ICE B;  2C2Z B;  3D6H B;  1RHJ B;  2C2O B;  1RWW B;  2HBQ B;  2CJX B;  1SC4 B;  2CNK B;  2H5J B;  2CDR B;  1RHU B;  2QL7 B;  3P4U B;  1QDU B;  3EDQ B;  1QTN B;  2HBZ B;  5IC6 B;  3R7N B;  1BMQ B;  1RHM B;  2Y1L B;  3NS7 B;  1RWK B;  2HBR B;  2XZT B;  4ZVQ B;  2C1E B;  1RWN B;  3R6G B;  2P2C B;  1RWM B;  1RWX B;  1SC1 B;  1RWO B;  4ZVO B;  1RWP B;  3RJM B;  1RHQ B;  3R6L B;  5IC4 B;  3SIP B;  3KJQ B;  4ZVP B;  3D6F B;  2HBY B;  1RE1 B;  2QL5 B;  2H48 B;  4DCJ B;  1PYO B;  1RWV B;  1SC3 B;  2H54 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...