4DV2J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv2J00
5AJ3J 3T1YJ 4DR4J 5A2QU 4LF5J 4JYAJ 3W1YC 3IMQJ 5BR8J 3R2CJ 4B3TJ 1J5EJ 1XNRJ 1HNZJ 4DUZJ 4V1Ak 4OX9J 4JI7J 4X65J 4JI4J 4LF4J 4B3SJ 4DV5J 4DR6J 5LM7E 2UXDJ 3R2DJ 4NEYA 4KYZA 3J81U 4JI3J 4NXNJ 4JI6J 4DV4J 2MTLA 1XMOJ 4LF8J 2MEWA 3J7AN 1IBMJ 4LF6J 2UXBJ 4DUYJ 4LFCJ 4DV6J 4DR3J 1XMQJ 4YHHJ 4B3RJ 4DV0J 4NEZA 5IT9U 4LFBJ 4YY3J 2KVQE 5IWAJ 1FJGJ 1HR0J 4DR2J 4DV1J 4DR1J 4PWWA 4DV3J 1N33J 3T1HJ 2KL8A 4K0KJ 1HNWJ 4LF9J 1IBLJ 2E5LJ 4X66J 4DV2J 4DR7J 3JAMU 4KHPJ 4GKKJ 2UUBJ 2VQEJ 4JI1J 4KY3A 2UUAJ 1XNQJ 2VQFJ 5FLXU 1I94J 4JI0J 1IBKJ 4LF7J 4DR5J 4GKJJ 1N32J 4JI8J 4HHUA 1HNXJ 4B3MJ 4JI5J 2UU9J 2ZM6J 3D3CJ 1N36J 4X64J 2MQ8A 4X62J 2UUCJ 3J80U 4JI2J 3D3BJ 4RJVA 4LFAJ 4NXMJ 3OTOJ 4AQYJ 5LMNJ 2UXCJ 2F4VJ 4JV5J 5LMUJ 1N34J 4DV7J 2HHHJ
chains in the Genus database with same CATH superfamily
2WBMA 4TY9A 1VBXA 3R6GB 4NI2A 1Q7YT 2FVCA 1RKIA 1U09A 1RT6A 2OEMA 3DLJA 2RDJA 3VHQA 4X4OA 1OIAA 2ZHOA 3JSMB 3OXFA 1S5ZA 1IKVA 2LDIA 3JQMA 4NYZA 5U47A 2AEMA 5M2UA 4DQQA 1M5OC 3ENAA 3IN5A 3NGUA 1ZM4A 3SZ2A 3L95X 4B9LA 1IKVB 1BMQB 1DLOA 1F9FA 3CJ2A 2ROEA 4ED4A 5F9NA 4L76A 4JI4J 1UZHA 5AXNA 3MPDA 1JLGB 1SCJB 1VC6A 4LF4J 3MTKA 4KBIA 3KNAA 4DQIA 4C48A 1YRUA 4FF2A 4CLPA 3T9ZA 2DNZA 4OI3A 2AYMA 3HO1A 5IV3A 2ZOMA 1U1OA 2V8HA 5H9EJ 3X1LB 4H4KC 1F6TA 3GZ7A 4C8YA 1RZMA 3MR7A 4BS2A 3CTRA 3Q8UA 3H98A 2BM1A 1GEHA 2YQ3A 1K0VA 4DCPB 4WFAQ 2DGVA 2X3DA 1UP1A 2GQCA 2CJQA 1GTEA 2H1YA 2HRTA 1XMOJ 5LXRA 2OO4A 3ILIA 4X2BA 2ASDA 3J7Z5 3JB9k 2FJWA 1YJVA 1FNMA 5D77A 1ZA2B 1QTMA 2DPJA 3DOMB 2BQRA 5G0RB 3TX0A 3CWJA 2KFZA 2LECA 4K5SA 1O0PA 3T1AA 2IA6A 2KVQE 4F3OA 4F4KA 3OLAA 1RLDA 1B70B 4IKAA 4ES1A 4QIEA 4G1QA 1N4LA 3BEGB 4LUBA 4I2PB 5DLGA 3KLGB 2KI2A 4DV1J 1B64A 1ZPWX 2H48B 3I82A 4GC7A 1R0AB 1N0VC 2HGNA 3OVAA 2IM2A 2W4DA 3CJ3A 1IWGA 5AXLA 4F0HA 1AZSA 3HI9A 3KK3A 5HSPA 2XYGB 4LF9J 5LOQA 4WF9Q 4ED2A 2JEFA 1LW2A 1MN7A 3IG1B 3HT0A 4ZCLA 4GKKJ 2W7OA 2E1RA 4N8NA 4CI0B 1LV5A 2E9RX 1KVJA 1RB0A 2UXDF 1L3SA 1ZM2A 1XNQJ 3KXDA 2UUAF 1RWUA 4M94A 2J9DA 1SC4B 2ZJPQ 2KZMA 3WIUA 2AT1B 1OMSA 2DGOA 3TANA 5G4DA 1OPIA 2RMLA 4ZVRB 4CLUA 1N32J 2LQBA 2KDOA 5CD4H 4ZVHA 1M1GA 1GFWB 4Q0BA 4CT8A 3BJYA 2PGCA 3DXBA 4R0JA 4DFMA 2W4CA 1FD8A 2VB6A 4QQBA 3I9ZA 5J2NB 1Y4ZB 4QW9A 4PPZA 1G1XA 3DRRA 3TZXA 3HHNB 3CDBA 2FZGB 2F4FA 2RIJA 3Q8VA 2HBZB 2O5DA 4DR5F 2O3DA 3T41A 2GMLA 5J2NA 5DDOC 2DR5A 3H25A 1KHWA 3BQ1A 2IM0A 5SZTA 2EG2A 2XI3A 3D4JA 5KFGA 3MZIA 2FD2A 3D1HA 4F7VA 4ZHRA 2IY5B 3O44A 2ZBIA 4GVBA 1U45A 5DS7A 2DO0A 5M2PA 1MU2A 2MSSA 3SMZA 3W2VB 3HP6A 3EX7B 1YZ7A 3RAXA 2QL9B 1QDUB 1XTZA 2KJVA 3B54A 2AJFE 4NYOA 1SL1A 5KFOA 4U96A 4KGKA 3BO3A 1K0TA 4JI7F 4OIXA 3LPYA 2W8KA 4KGXB 3DU6A 2QL7B 2DIVA 1D8YA 1VMBA 3ISND 5LMUJ 1NJXA 3NNAA 4WIQA 5A8KB 1ZAVA 2B6AB 3PACA 4HDHA 3G8QA 1EKSA 4F3MA 3TUPA 4AD6A 1JLFB 7FD1A 2VPYB 2J6TA 3MMBB 8RUCA 1WC4A 2GHWA 1X9SA 4PUOB 4M5KA 2BMBA 2F8EX 3CUNA 4PQUB 2E5JA 2OTJS 2NR0A 2ZH6A 4CLFA 3EICA 3PW5A 2W01A 4PYDA 1CEZA 1XNRJ 3FMBA 3QGHA 2GCFA 2UUWA 3C66A 3M8QB 1SIWB 3FFIA 4JBCA 2QA1A 3GB0A 3V5RA 4ED0A 3HSZA 5GAGI 1VQ8S 5KG4A 1VRUB 2LXIA 3BO2A 3M8PB 2XTJP 4EZ9A 1JKHB 2C3OA 1C1CB 3R7BB 3ZO7A 2XLJA 4EBCA 4B3OA 2XZTB 2QN6B 1X5OA 2DHGA 2MSTA 3HD2A 5ETMA 4ECZA 4YUDA 3VZHA 1YJ7A 2FVQA 1FTRA 4NEYA 5D8HB 5DM7Q 3ET6B 4Y34A 1ZPVA 1R8BA 3KKFA 2E7VA 2IA0A 2OPQA 2QJ3A 5E2QA 1T9WA 1FI4A 1N52B 3R5BA 4FYVB 2QSFA 3DM2A 4C11B 3TARA 3CC4S 3MMAA 4FYXB 2DHHA 2I5JA 2DEJA 5AT1B 2E1AA 5K5MA 2M3DA 3ZNUA 4ECVA 4LSLA 4RW6A 1U6FA 1IM4A 2V5HG 5CYQA 3HULA 1MNEA 2AMCB 4ZIWA 1RT4B 4DR2F 5F41A 4RW9A 2Z30B 2HFOA 2XYHB 3PDNA 3DNCA 3AB2B 1DHMA 1YJ9S 3CCRS 2AWZA 4OX7A 5KTQA 1RP5A 2BYCA 3DOMA 1FJGJ 4HT7A 1RT5B 5GAGU 3U7JA 3HFKA 2WW8A 2VBXA 3LGMA 1OYEA 2N7YA 4TQRA 4BDPA 2CFXA 1XIQA 2YKMB 4RBTA 1FFSB 3OR2B 5JUMA 4GRSA 3AA8A 5JXSA 3BN7A 1FKOA 2Q1LA 3EM1A 4GMKA 1RT3A 2DNRA 4GVLA 4OYBA 4UUXA 2QGFB 1SVDA 2HYIB 1VQNS 1X4DA 1NK4A 3JAMU 4EEYA 1UVIA 1ZAWA 1FDDA 1JLFA 2B56A 3NGKA 4NCGA 4RL1A 2Z2YB 3BQ0A 4HI1A 2ZZNA 4WIIA 2R7XA 3AHPA 2VQFF 4DR1F 3WHIA 1WHXA 1YQHA 4G1IA 4DF8A 4V19X 3W9HA 2JC1A 5HP1B 2V50A 3D1OA 4ZPCA 1NSQA 2XLIA 2MMYA 1UVNA 2N7CA 2DHAA 3UR0A 2DYAA 3AD8C 2N4CA 3C15B 3M8QA 5HATA 3CCVS 4UOCA 5DZ7A 3KJVA 4JI8J 2Y8YA 2M9KA 1S99A 1T95A 1YBAA 1ULRA 3ZTSA 3DLEA 2BE7D 1SC6A 3QGPA 3NWGA 4RZRA 3POTB 1NJWA 4P74A 2EFVA 2CWKA 1PJ6A 2MJUA 1NK0A 1VRTA 2XMVA 3PJXA 4OHXA 4URQU 1IKWA 1XR5A 1FWLA 1HBMA 2D74B 4AE5A 4C98A 3H59A 1RU2A 3HFVA 2OPSB 4Q44A 1RYRA 1IKXA 1CJKA 3MTJA 3I9V9 2M5YA 5AE3A 4DV6F 4DL5A 1N6QA 4Y2IA 4IO1A 1XR7A 1FDAA 2K3IA 2NLWA 1VQ7S 1RHRB 5B08A 5K8PA 3SV4A 4LFAJ 4NXMJ 4HT5A 1GT8A 2F7VA 4OV1A 1Z2ZA 3GCXP 1VYAA 4DN0A 3SSQA 3CCES 1VOMA 2VG6B 4GVBB 4TLQA 2R2RA 3TI0A 3GJRB 4ECTA 3PYFA 1GH8A 4KFBA 5A6WA 2ZWOA 2D3O1 2Q79A 2QG9B 1S1VB 2VBZA 2W24A 1Q86T 2D9OA 1LWEB 2AHOB 2LU1A 4M5HA 3C16A 4XTTA 4DCJB 1E6VB 4BC7A 2HHHJ 3PIPQ 1TL1B 2HNZB 2LYVA 2OLWA 4U95A 3UDCA 4QU6A 4WU2A 3OFHA 3C3LA 2G0IA 4DZ6A 3PX0A 3HD1A 1UFLA 1NH7A 5CQGA 4KGMA 1TL1A 2FJAB 4AT1B 3KJFB 3MMCB 5HI7A 1B99A 1S1WB 2BE2A 4A8KA 5IZHA 2DGWA 1HNZJ 3BBFA 1TMMA 5KFZA 3H4DA 2YXLA 4M5DB 1RA7A 2XMAA 3J81Y 4DL0C 4DL3A 4ZP8A 4X4VA 2J9DE 4DDFA 3QRPA 4QIFA 3OTDA 1N5VA 2G2YA 5DO2A 3GFHA 2FTRA 3QJJA 2VL1A 3QZ7A 4PG4A 3P3DA 3RBXA 5LSOA 1EAYC 3QRQA 5F8JA 5KFKA 4HH1A 4M8LA 3HDSA 3W5XA 4R5PB 2C2RA 1UVLA 3DOLB 1WEXA 2WHOA 3R2DJ 3C14A 3CNQP 3TEHB 3NKYA 3K57A 2GVZB 3L09A 4Z7CA 2W8LA 3DLHA 4PG6A 3PZPA 1KSPA 4JI3J 2DNLA 1RBOB 4WP3A 1BHNA 3Q8RB 2MKHA 4B08A 2DR8A 1FKAF 4LIWA 1G4CA 1YSJA 2B5JB 3CO9A 1AUDA 2B4VA 4QWCA 1EZZB 3EDRB 3MEDA 4CYUA 5IV4A 4F50A 4URGA 4B3RJ 3BBBA 2I8EA 2DJWA 1LWFA 4ILRA 2AJ4A 2V69A 2WRMA 5A6PA 5JJBA 1S7HA 4EBDA 1Q4RA 1CULB 3DM2B 1EB0A 2NS1B 4C11A 3V6JA 2HQIA 2VBYA 4NXMF 5J1EB 5F8LA 4RW9B 4DL7A 1QAXA 5IQ6A 3BSOA 3A13A 4USMA 4KQZA 1N0UA 2X51A 3N5FA 1QVFR 4OI6A 2XI2A 3IFEA 4E98A 1S1UA 2B9YA 3OTCA 4DEZA 5JVGQ 4FF4A 1WORA 1F2HA 1ZAXA 3R6LB 4OYMA 3KNGA 4UW2A 2ZDOA 1H74A 4AYBD 2Y8WA 5GADU 1IBLJ 3I5CA 1RT2B 3FQKA 3MM7A 2AZ3A 2HGMA 2CQ1A 3GPAA 3PRVA 1SQEA 3GQCA 3M8ZA 4AQYF 3V2UC 4JI1J 2HHUA 3AA9A 2YY3A 5ETTA 1HI1A 1GX5A 1PAUB 1SC1B 1I51B 3LGHA 4FF3A 4HEA9 4PXBA 2LEBA 3CCTA 3PW7A 2XS7A 4IH6A 2M0GB 1OJ4A 2VFUA 2VKZG 4KE5A 4ZVOB 3RBEA 5ETSA 4YQWA 1ZZNA 3UDVA 1CJUA 2VKRA 3HZEA 2KG0A 4C4WA 2B4OA 4U7UD 2UUCF 1TP7A 1DAXA 4DR7F 3FEXB 3K8VA 4C97A 2ZH3A 4Y2CA 3T5KA 3OLBA 1B7YB 3DU5A 4HR2A 2R8JA 2AZ1A 2GX8A 1XMQF 4X62J 4FXVA 5A8WB 4ITSA 4PG7A 3Q86A 4TNOA 4TXSA 1Y5LB 4CYUB 1VGYA 2F9JA 5HANA 1FKPB 4LF1A 2ZC3A 3OT9A 5IQQA 1ICEB 3TAMA 4ELVA 2VICA 4BHQA 4TU8A 1L3KA 9RUBA 3EUNA 2CQGA 1B7FA 3OXLA 3AQPA 1F2GA 5KFHA 3GYNA 1F9HA 3LF0A 4NXNF 3DGPA 3D28A 4Q0BB 1YVFA 4WFNQ 4B9SA 1C0UB 2CNKB 1AFIA 2MGZB 4X4UA 2DNGA 4KAIA 1LFWA 5KFQA 1IBMF 2DY1A 1UFKA 3MCSA 2MZTA 2CA9A 5L1JA 2MZJA 2EBGA 3BR8A 3CJTA 3RU0A 5L1LA 1HNVA 2UZAA 3W1YC 2MLXA 1RLCL 4A4JA 4TY8B 2BJ1A 1J5OB 4CO5A 5I3UA 1HLWA 5D4OA 2OD6A 2QX0A 3GJQB 3FBEA 1NCLA 3M6XA 4H4OB 4ZVQB 2XC9A 2FY8A 3E3XA 3UE2A 1OS5A 2QA2A 4X4PA 3HFZB 1QUPA 5A0YB 5DQHA 2KM8B 5KOXA 1RE1B 3WBZA 2M8DB 4O3QA 4DPTA 2J8AA 3RB6A 1Q0NA 4NLTA 2PI5A 2A3JA 4MT1A 3BGRA 1CJTA 4GO7X 2R7QA 4ZPVR 4ANDA 1APSA 4P71A 1FRKA 1S79A 1ZS6A 2BE2B 5L8RC 4J9QA 4FNHA 2IRUA 3DN9A 4WK1A 3WIVA 3GV5B 4DQPA 3TAPA 4NRUA 2C2ZB 1RWOB 5THWA 5F8HA 2DHXA 1VQKS 1S0VA 1HYSB 1DTQB 4K2XA 4DV4J 4A8WA 5D0RA 2Y0BB 5KG5A 3M32A 3NS7B 3R97A 3RR7A 1GX6A 5FD1A 4F8RA 2JL9A 1ITPA 1R8PA 2W2OP 3GFYA 3W5YA 2JC0A 1LQ9A 4JI8F 5DG8A 1MSWD 4IOCQ 1KS2A 2JSXA 3UN5A 3P8BB 4KHMA 5IWAJ 2NYIA 2IRXA 2NREA 3HHLC 2DR7A 2CPIA 1X8DA 2FHJD 2RDDA 5H1SV 3D0HE 3KHHA 1WC3A 4LSLB 4PQAA 4DR1J 5CXTA 2RF2A 4U7UK 3OJUA 1D9FA 1C0UA 4DV3J 1BWEA 2RQKA 1RTJB 3D6FB 4IH7A 2RQCA 1TL3B 3T1HJ 3FUYA 4MK7A 4OHZA 2BANA 4JYAJ 4OI2A 2KJWA 4NI2B 2DR9A 5KG6A 3QIDA 3D6MB 4GKJF 4FS1A 4G65A 1S9FA 1XK8A 5E3CA 2UV8G 1RCXB 5J2QB 4ED5A 3SCLE 2MQNA 8AT1B 1H2VZ 4JI0F 2I38A 1EHWA 4KY3A 2JEGA 4I67A 2QLFB 2VQFJ 2DHSA 3PCOB 3A3OB 2LA6A 2VF3A 1QM9A 3FCVA 3FSIA 3DFEA 1FDNA 3OFGA 3CCQS 3SDEB 3EPGA 1JNRB 2MHEA 4IO9Q 4WYLA 4UT4A 2L08A 1C0TA 5KFVA 2V2VA 2HHVA 2NXJA 2PA3A 2OEJA 4ANEA 3PYDA 5D4LA 4J9LA 5L46A 4JI5J 2HHPA 1K9MT 2XLKA 3ZXWA 4PUOA 3OFFA 4F4YA 1W2BR 3DRXA 2AJ0A 1N36J 1HR0F 1HNXF 1C1BA 2FQQB 2V2KA 3S8SA 1VQ6S 1MWYA 3WZ0A 4J5OA 5HVHA 1N8RT 3GWCA 4NOHA 4J7CA 4NWBA 4DR3F 1Y7PA 2V4RA 4IDKA 2OSQA 4WKRA 1EX8A 1LKZA 2XMTA 3S7RA 3MM6B 5A8RB 1T3NA 2KXNB 1BQXA 1R31A 4K4VA 1YKWA 1WHYA 4NRTA 4ZJOA 1TK0A 2HLTA 1JJHA 1Q16B 2A10A 5T14A 5IT0A 2DGUA 2OPSA 2VDIA 2RSQA 2CRLA 1VS3A 3MPYA 4A8XA 4RUAA 1DURA 3CCZA 3PRDA 1S0NA 1HWLA 3RGIA 3CDEA 3M1VB 2K06A 3OTEA 5GMEA 4N76A 1YJRA 2DEIA 4M5NA 2XNRA 3QATA 1ZYQA 4F2SA 3ISZA 2F4VJ 4P7VA 3J80Y 5ETQA 2DD8S 4YOEA 4WE1B 3I0SB 1T7PA 3FGVA 4P75A 4P2FA 3P5TL 5BXIA 4IR1A 2KVIA 4CNZA 2GAGC 3ETMA 2RRBA 1JLAB 3NCPA 4DX7A 2HMIA 2FHMA 5F8MA 3T1HF 4J9VA 1KRPA 1SI9A 5BR8J 2W25A 3HSGA 4R0EA 3SSSA 5DETA 3JQJA 4B3TJ 1CS4B 4QYZK 3K59A 4DHVA 2BDPA 1WEZA 4JI7J 2V67A 1IJEB 1XN9A 4QBUA 1JWWA 1SJRA 2LDYA 3GIJA 4LF4F 5DDPC 4ILLA 3SSRA 3KLVA 3CIZA 4M5JA 3GYXB 1BLUA 4I69A 1SH2A 3BF4A 2R8HA 4MIBA 4MK9A 3V81B 3MXHP 2R7UA 1NK9A 5T41A 4F3QA 1FNOA 2ZD1A 1RQ0A 1RHMB 4QWBA 3CEDA 5JVHQ 3W65A 2PFDA 2VFRA 2HHQA 3TJ9A 1VQ5S 3UCUP 5MAOA 1EP4B 1FK9A 1QSLA 5DDQC 5K8OA 2XY7A 3R5CA 4LF6J 4CRJA 1T11A 3QNWB 1X9WA 4B9UA 5D4PA 3MM6A 2QSWA 3MPWA 4OI1A 1D9AA 2RU9A 3K58A 2C2KB 4DUYJ 3NG8A 1FRHA 2D41A 4WXWA 4U7CA 4DPOA 1U25A 3JTOA 3LH2S 4HTJA 4ZCKA 5D3GB 1TK5A 2GVDA 4FP9A 4ZPAA 4LFBJ 3CT9A 3SFGA 4TU7A 3G86A 2IVFB 4O4GB 2BJ9A 3BN4A 3LUYA 1YJUA 4L73A 2QLBB 4PWWA 3RYLA 5L1IA 4DSKA 2L3MA 2KG1A 2AX0A 3MF5A 1K1QA 1WF2A 5H9FK 4CTAA 2CPZA 1UEUA 3DLLQ 2PEHA 1P6TA 3TWZA 3CMAS 4X4QA 1UA1A 1N32F 1WOOA 3CDAA 4DV2J 4M5MA 3I4HX 4NZ0A 4QR0A 2A0FB 1JNZB 4ZPBA 4J9KA 4DOZA 3BGLA 2MY7A 2RQMA 1QJHA 3I31A 2VQEJ 2EFPA 3CJ8A 1PGZA 1C2PA 1QSSA 2UUAJ 4ERDA 4Y28C 2V63A 1XMOF 2Q43A 1T3OA 1MMNA 5FLXU 1UTAA 1V5IB 1Y10A 2JHEA 1U8SA 4LSNB 2K8GA 2N3LA 4PXDA 2GW8A 2W2NP 5ETVA 4PG8A 1XBWA 3T5LA 2HWTA 2IPOB 2KKHA 3D66A 1X4BA 1SJ4P 5AE1A 1PCAA 5HL7Q 2CQIA 3VWSA 3M9NB 4DXLA 1WTFA 1HNIB 1R27B 4NCAA 1U24A 1RT6B 2YWFA 4G1QB 4I7FB 4ZN1A 2R4FA 3NXZA 4KTQA 2WOMB 4HTIA 2JX2A 3F56A 4DV0F 4AL6A 4DR4F 3KK3B 3E01B 3LO3A 5K20B 2J76E 1YJWS 3IRXB 2UUCJ 3HF5A 4TYBA 2MZQA 5GMKa 5E0OA 3TQEA 5HMXA 2ZJQQ 3LA0A 3UD4P 3KK2B 1X5TA 2ROGA 2V34A 3IRXA 2VOOA 2JEIA 2B8QA 2ZZMA 2IBKA 2MQQA 3AQOA 2B9EA 1TMJA 2VJUA 3MM5A 2JDJA 1L3UA 1A9NB 3SI8A 4DL2A 1WD6A 3C6TB 4PR6A 2E44A 4IYQA 1B0TA 5HO4A 4ZJQA 3N9UC 5FIIA 1RKJA 2CPHA 3W9IA 4K4YA 4I2QA 3Q8SB 6FDRA 2YH1A 2H65B 1CC7A 1OYDA 2MKJA 2HVHA 5AJ3J 2WSCC 3G6YA 2GO9A 4ED8A 4DR4J 2WCXA 4ETXA 3LP0A 4I1TA 3PXGa 3C6UA 3PW2A 2QTWA 4QIWD 3KLHA 3PEJA 5IOLA 2YPYA 3QIPA 2ALYB 4K4WA 3RZAA 1EIYB 1B0PA 1X4FA 4EZ6A 1BD6A 2YQ1A 4LT6A 3KWMA 2MJNA 3IG1A 4V1Ak 1FFWB 3U1MA 2P6TA 1YX2A 3OR1A 3TRGA 2C3MA 3H4BA 4DQSA 3BYRA 4LF8F 1RAFB 2WVDA 5HAOA 3K5NA 2BW7A 1DTQA 2Z2LA 3JSRA 4HHJA 1O51A 3D9BA 1NKEA 5D0GA 1NDPA 3PKYA 3W2WA 3OL9A 2J7KA 1T0TV 1C1CA 2IBOA 2MKCA 5HVGA 5E41A 3RBDA 1IWAA 1P1TA 1MMLA 3IA0A 5HN0A 6FD1A 3I55S 3V6HA 2WOMA 3FCHA 3OJSA 1A0OB 1RT1A 4E0DA 3NMRA 2F40A 2XY6A 4ZLJA 2O01C 2B43A 3CULA 2QLJB 3J7AN 3KMSA 1LWFB 1RBLA 2XMWA 5CAAA 5HP1A 2UXBJ 1FE4A 1FE0A 1JK9B 2C42A 2V8PA 3NGSA 4NYPA 4LFCJ 1HWJA 2V9KA 5CYMA 2LMIA 2ZH7A 3CCUS 1KQSR 2PEBA 3DYAB 2XMJA 2MQLA 4B9MA 1Q8KA 5IT9U 2IDLA 4USWA 2I1RA 1KOHA 1UAWA 3NCQA 3DLKB 3SQGB 3TO8A 5HQMA 2D9PA 1S4FA 2CPJA 4ZIVA 3G96A 4ECSA 1HR0J 2KHDA 2X1BA 1H7XA 3FZ2A 1ZTTA 5HMZA 1NH8A 1I5OB 1GXUA 2DIUA 2ASLA 2FY1A 2HFSA 1S10A 3VTIA 4JI5F 2E5IA 2HLUA 4LF6F 1UPPA 1AA1B 4TQSA 5F3ZA 1RHUB 4NPOA 1N33F 1TK8A 1NLKL 2LU2A 1J5OA 2ROPA 3RBZA 1IQZA 3DOKB 3QAEA 2H5EA 4MKAA 4MKBA 1FO1A 4LRCA 1MU2B 3VAKA 1REGX 2HHXA 2KYZA 2Q6CA 4OZ0A 2NXCA 1EQMA 2I5JB 4WTYA 4RO0A 4F26A 3G8SA 4DBQA 4JI0J 1OO0B 4OYXA 4RW6B 4W98A 1KHVA 4YB6A 5ETOA 2OJ3A 2E7WA 1Z2LA 4USJC 4X64F 2IHR1 5FDLA 4GKJJ 3VGUA 5GMDA 2POKA 2PE8A 3KUEA 2COLA 4HHUA 1RTZA 2QYCA 4WXOA 1UWAA 3V6DA 2HZAA 1LW0A 4OYPA 2AEJA 1HBNA 1S6PA 4LIRA 5EUHA 4IG0B 4WU3A 3L3CA 2W2QP 1WG5A 4XAKA 5A8WA 1HQ2A 5IS2A 2JNJA 5IWAF 2G4BA 3BKFA 2GHVC 3CD0A 3K2YA 1M5KC 2OMOA 3CGIA 2ZOGA 2UVWA 2LA4A 1VLYA 3Q8YA 4NLYA 2AU0A 4QPTA 2PI4A 1NJYA 2NZ4A 4DL4A 1VJQA 3UO0A 4B9NA 2UXCF 4ZVPB 3VGVA 2GV1A 4OZ3A 1TKDA 1JJCB 1Q8BA 1S1XA 1RTHB 2NUUG 3NLCA 4I6WA 4NLDA 3ZTRA 4R8UB 2QMXA 3C14B 3W64A 4UQTA 2QA4S 2YKPA 3ZC4A 3H5YA 1XJWB 4YR0A 4ED6A 5A8RA 3MCNA 2IYIA 3CE8A 4JI2F 4DR6F 2VU5A 2DGQA 1X0PA 2YPZA 4ZA1A 2JJ4D 1YWXA 2VD3A 3AJDA 4I4BA 3W2VA 2R9LA 2V8DA 5CZVA 2CQDA 3TOQA 1RT2A 3MM7B 3IMQJ 4C3LA 1F0XA 3SCIE 4CQ1A 3TZYA 4A48A 2DVIA 1S6PB 2W9AA 5JMNA 1RGVA 2DNKA 4JP8A 2MY8A 2RT3A 2FHJA 4QR1A 2GO8A 4WE1A 1TUVA 4FS2A 2CNLB 3HSJA 4ZP6A 1U49A 1N5YB 4YDXA 3PO5A 2CJAA 3EXYA 4X4NA 2K2PA 2ZBCA 3BZQA 3FVYA 1U1NA 3X3UA 5B0BA 2VASA 4QU7A 2WZ1A 2XG8A 2GJIA 3GR0A 4DR6J 4LF7F 2FHKA 1X5PA 1Q81T 2AKWB 2CJYB 2YKMA 3N28A 1R0CB 3PJWA 1WF0A 1J2VA 2BABA 3EVMA 3QO9B 4GO5X 3U1LA 3M30B 4F25A 5J2MB 4LRAA 4RR5A 2Y1JA 3MD3A 1IVZA 2X7IA 1U1PA 1FRJA 1FRIA 1D8ZA 3H5SA 3KYLA 3PW0A 1FCAA 1YRXA 2FGCA 4CLTA 4NXNJ 1R8CA 4RW4A 4KGVB 1ZTWA 2RAQA 4O23A 5E3RA 2HHSA 1YRTA 2UUTA 2FLPA 1X4HA 4RLEA 4O3OA 1U2FA 4F4XA 5C42A 4ZVUB 2AYGA 2E1MC 1XC9A 2BOAA 3BGUA 2YBVA 1Q8IA 3MMCA 4J91A 4DU7A 3GIIA 1RT1B 4MKVA 2U1AA 2FVPA 2YNHA 2R2SA 3ZZPA 3HK2A 2HHTA 3DYAA 1UETA 5ADZA 5AXKA 1VFJA 3ISNC 2HRYA 3UCZP 3CJQA 1SB6A 3DC2A 4LRBA 4JV2A 1R43A 2YNIA 4RNHA 3Q8PB 1NJIT 4B9TA 3OSNA 2OTLS 2PMZD 1DFDA 2D7SA 2F65A 3EZOA 1NKCA 1KLMA 2NCKL 2DNOA 2KL8A 2XULA 3VGTA 2W9BB 1U1MA 1N33J 1RBAA 3HCXA 3L7PA 4P10A 4LBPA 2ZH8A 2NXUA 1SUQB 3AD7C 1BQNB 2DXEA 2P8IA 2YVSA 3U02A 1KQFB 4KHPJ 2VBWA 4EYHB 2AF6A 3FBBA 1HWIA 1U1KA 5HBMB 1NB2A 1RHKB 2MPUA 2B51A 4YR3A 2ASJA 2OPRB 5I3UB 2V9WA 3AB4B 1Y5NB 1RADB 4H4KA 4KFBB 4OZNA 1RT7A 3UQSA 5KT5A 2QIFA 3W3SA 1RISA 3QT6A 1IBLF 1I1GA 4HACB 4KRWA 1IN0A 2VPXB 3VV2B 1GAOA 3D67A 1SKSA 4PXCA 1F5AA 2I9SA 4QIGA 2XO6A 5DGAA 3R8YA 2BA9A 5ETKA 3DGVA 1RTDA 2UVVA 3DRYA 1X4EA 3PM9A 3C15A 2ZEJA 2VPZB 1FESA 2QT7A 5HMWA 4X64J 1HNZF 2E7XA 2V4QA 4Y2KA 1KLMB 3LALA 3S1TA 3W5ZA 1PILA 4Q45A 4PWDA 1RAHB 4B3RF 4ANCA 3ZZ0A 3GV7B 1ZH5A 3MWBA 2H9ZA 4RNNA 3SBMA 1FERA 3OTOJ 1Q53A 3WDOA 3FC9A 5DG7A 1WOSA 3QBCA 4X66F 2HHHF 3A8JA 4MFBB 3HLUA 4K2JA 1H6KX 3FK4A 1ACMB 1U02A 4YHHF 3K5LA 3K0JA 3OD2A 1UL3A 1NJZA 3M6VA 2HKEA 2L9DA 1FA0A 1QE1A 1BXNA 3OV7A 2G1HA 1F1BB 2R7WA 4IRKA 4DPYA 4CZCA 2V8VA 4LVNP 2IM3A 3ITHA 5E7OB 3HZGA 1TUGB 1WEYA 3PIOQ 1Q7LB 2NUHA 1RDRA 3BYPA 3GU0A 3MOZA 4URSA 1TVRB 2Z8QA 2LQ8A 3GSIA 3IS9B 1PYOB 5HBMA 1ZETA 4ZOSA 3TAQA 2HQGA 5KG7A 4N8OA 1VQMS 3AD9C 4MTPA 4ZK7M 1JLQB 3PYGA 5F8IA 4B3SJ 1RTIB 2L9WA 2OEKA 1FX4A 2HWIA 2APOA 5IM0A 1JX4A 4Y65A 4CTAB 5CD4A 3SXLA 2XGQA 2ATLA 1FWKA 1Q5VA 1RAAB 3CF5Q 4F02A 3RB4A 2ACMA 2YKAA 4ZVSB 2JZ5A 3BSAA 4MIAA 3AFGA 2ZH4A 3TQ1A 2RUGA 3CCWA 5KFNA 2X1GA 4ED3A 2CKWA 4J9NA 3MFHA 4DX5A 4M63A 4FZVA 3GV8B 2KHCA 5KFWA 2FJDB 5KG2A 4JI6J 5B09A 2HFZA 3LQVA 2RKIB 2A6MA 3OTBA 2ZC4A 4WP8A 1VQLS 1VISA 4O3SA 2OGUA 5K9FA 1P8GA 4JV5F 3DHWC 4KH1B 3W60A 4WP9A 8ATCB 4PWDB 3ZTPA 1U0HB 1VQYA 4DSFA 2ZBPA 1HA1A 3HKZD 4LF2A 2EFGA 4ZLPA 1R8AA 2XS2A 1LOUA 4CH0S 2J0WA 3MUTP 4CM0A 2HG4A 1HWUA 1NU4A 3ENVA 1VJWA 2DKOB 4RWXA 1AW0A 4ID5B 5KFAA 3CCLS 2XQCA 4NCBA 2MDAA 1UWBA 1YK9A 2ZM6F 2XO7A 1TV6A 3MEDB 1CLFA 1NPKA 1QY7A 2YX1A 1QAYA 1UWBB 4M5LA 3D6TB 2GJ2A 3GMGA 2MQMA 3RB0A 2IC3A 3CDWA 4PAAA 4F4AA 5B0FA 3FEZA 2FHOB 2IJNA 2DY9A 2NXNA 1KKHA 4USVA 4WFZA 3MPUB 5KOWA 2ZVSA 2C3PA 1MN9A 2DGXA 2IM1A 2LVWA 4ZHRB 2E5HA 1W7WA 3QJLA 3M1VA 1IBKJ 5F0UA 3S6EA 4LF7J 2PD1A 1TKTB 2LEPA 4OLOA 4M1KA 3T9NA 2J5AA 2CXEA 4C2MA 4U9RA 2YTCA 1LK5A 3MI7X 4RNMA 1KDNA 2O66A 4K4UA 3SDEA 2XHWA 3I0SA 1RWNB 1OPZA 2W9CA 4W4MA 1VCTA 1VIXA 4LQ9A 4HACA 3HHLD 3NY0A 5ETRA 1KC8T 4OHYA 4L3NA 1HNVB 2PMWA 3J7YI 4AL7A 2C2EA 3D1QA 3KLEA 4K4XA 3D3CJ 1RT7B 4EO8A 5EWFA 3TW0A 2WAQD 1VC5A 4DFJA 2U2FA 1RTJA 4TKTA 3HPOA 2H51B 1FRXA 3KG4A 3M6UA 4OZ2A 3HJVA 2Z56B 1NBEB 4JI2J 2AJ1A 3W63A 3QWUA 3D7SB 3OUYA 1NSAA 4ER8A 1PKUA 1RU1A 1YZ6A 4OJ1A 1T02A 3VAGA 2JVRA 1Q5YA 1GNKA 2BE9B 3ENQA 3DXSX 4RUCA 3VF0B 2Q6BA 4AL5A 1FJCA 5DG9A 1G6BA 2HFVA 4DFPA 4DN9A 3D5MA 4DG1A 3P96A 2PN6A 3OPKA 4CLLA 3CIMA 3MUVP 1QLNA 1X4CA 5HLFB 1JLEB 2UXCJ 2BBEA 2PDAA 3OSPA 4TLRA 1JXLA 2NPIA 3M2VA 4V19J 2LXUA 5F9LA 2BOPA 2QMUB 3P45B 4Z7YA 3M32B 2WVCA 2OPQB 1EARA 4DUTA 2HNYA 2YH0A 4O3RA 1DARA 2CVEA 1TL7A 4C3KA 5LJ5Y 4WZQA 2LXFA 1XERA 3CD5A 4CLKA 1H2TZ 3G82B 4DSLA 3TP2A 2I6WA 4U6PA 1ZBTA 3M05A 4ECRA 3CC7S 4B3TF 2ATCB 3IR6B 4ZVEA 5KT2A 3ZZRA 2LQJA 4O0IA 3BGOP 4NLOA 2DRDA 3G82A 2DNPA 3NOGA 2DR6A 5I4MA 4XK8C 4QWDA 5B0AA 3H5XA 1TU0B 4IFYA 3N5BA 1NUEA 3VR1A 5HROB 2DGSA 2GZOA 1GQEA 1HFEL 3BR9A 2EK6A 1PBUA 4EI2A 5L9NA 2KZZA 2MXYA 4USTA 5B0CA 4UOGA 3WX8A 1UW4A 4H4OA 3GTYX 4FVCA 2KT5A 3IBWA 2NSBA 1OY8A 1XWLA 3CD7A 4OZLA 5C24A 3THPA 1V9OA 4N5SA 3PX4A 2ADCA 2GA7A 4WZMA 1CJKB 1D0EA 4ENOA 5B0DA 3UDEA 2XCAA 2VODA 3PHEA 2GNKA 2PA8D 1FFGB 4QJVA 2FLOA 4HVZA 1PYSB 2XMUA 1FT8A 2WVEA 4O44A 4C8MA 3WQPA 3C46A 3OUYB 5F0WA 4J9OA 1N56A 1RXOB 3KJVB 3E01A 2KTQA 5E33A 2FUG9 4CLWA 2QYGA 1HBUA 1HYSA 2W2PP 1N36F 2BKNA 4RW8A 4QOTA 4LQ3A 4UZCA 1VLOA 1HD1A 1SUQA 1Y3KA 2XWXA 4I7FA 3GYGA 4Q43A 1VBZA 4K4ZA 2XSFA 3SQOP 2BJDA 3DRSA 2B7BB 3MOJB 1J27A 1S0OA 2DITA 1QVGR 1CSJA 4DSJA 1PAEX 3M8YA 3KMQA 3NWRA 1GMVA 1PIEA 5HLFA 3G2XA 5FJ4A 1NZ8A 2ZKUA 5IC6B 1TL7B 2D69A 2V2ZA 1R6VA 2QE5A 2C3UA 3H2UB 4Y2MA 1HQUA 3KOAA 1QTNB 3TNVA 1CQNA 1Y00A 1TV6B 1VDHA 4YB7A 4CO3A 3MR3A 3CJ0A 1BQMA 2RUSA 3TR5A 4DU8A 5C42B 4IQXA 1BGXT 3A4TA 1BC6A 5H9FJ 3G6VA 2ERRA 4PQUA 1SQGA 1A7GE 2K1RA 2F1FA 3EPIA 1RACB 4I56A 4CCHA 4I6AA 2IMOA 2VG6A 3K17A 1PSDA 4WTOB 3IWLA 2R7TA 2EFNA 4RUHA 3FFIB 4RBUA 4CO2A 3D68A 4IG0A 3JYTB 2FYXA 1HNXJ 1FDBA 2YNIB 2YX7A 1U1RA 1UJ5A 1XNRF 2J7UA 4DMZA 2DTJA 3ZZTA 1S97A 5EWGA 1KTVA 2JFDA 2WVFA 3CSKA 5GAHU 1TKTA 4DV5F 3LW5C 3NNCA 3KLFB 1YGYA 2GJFA 4M5GA 4B17A 4CP5A 1JJ4A 1U0SA 4XPEA 2HRUA 2DNMA 2KXHA 3ET6A 5KFTA 3VVTA 3BSCA 1S1VA 1U2RA 4Z37A 5L1KA 3BQ2A 1NEEA 2QRRA 1X5SA 3QQCD 1KQKA 3NGRA 3SCKE 3ZZZA 1ELOA 1NHVA 1ROFA 4YN3B 4FYYB 1HBUB 1WHVA 4DSIA 5GAEU 2MYFA 3Q2SC 4C0OC 2EPIA 3DMJB 3UDLA 3AODA 4IQMA 4O3PA 2V6AA 2A6OA 3FCWA 1HBOA 3RG6A 5DRKA 1VBYA 1O8BA 4IDKB 2AYBA 4IRCA 1KOOA 3A8IA 1O6XA 2FC8A 3ZTOA 2FGOA 1N34J 5L9XA 2XMKA 2FLLA 3IAS9 2B5JA 4NL5A 1T05B 2OKQA 3LP1B 1K1SA 3BREA 4LR8A 1C1BB 4JI6F 4B3SF 3ILJA 1TFYA 4JYAF 3G6XA 3KHRA 2OH2A 5CYMB 4RU9A 3R2CJ 1VHFA 4FYDA 3TJAA 2MHNA 1WHWA 4IUFA 1P9YA 4OHWA 5I3PA 3GR1A 4G6VB 4NMLA 4OX9J 1HQUB 2BQ3A 3BPSP 3ADAC 2M52A 1RT5A 2HMIB 3K89A 2KFYA 2AIRB 3H20A 3BH7B 3H40A 2R7VA 3DCAA 5RUBA 1UA0A 4DL6A 2AX1A 2RH3A 2VZ9A 3MAAB 4HH0A 1WNEA 2RE1A 4WFBQ 3O6QA 4NA2A 3M6WA 2CWXA 1CS4A 2UXDJ 1DJ0A 4ELUA 1FRMA 4QPXA 1FX2A 4YB5A 5CYJA 3L4BC 4J90A 2ZUGA 3A1YG 3J81U 1OY9A 1U47A 4DV2F 4ID8A 4C8OA 2R42A 4P2MA 1E6VA 1KVIA 2QEXS 1LFPA 5F3TA 5KG1A 1NKBA 4DWIA 1QAJA 3HSDA 1IBMJ 4RW7B 2CDQA 4ICLB 1DQAA 3M8WA 2GQ2A 3QAUA 3T6JA 2BW2A 1RYSA 1XMQJ 2HFUA 2A18A 2ZNZA 3ICLA 4KO0A 4CT9A 1RABB 5CCLA 5J2PA 1RWPB 1RAEB 2GGPB 2Y1RI 4A8OA 4ES3A 3N4WA 4KH0B 1EETB 5KT3A 3QGGA 1LWCB 1S9EB 1EP4A 1FTCA 2GMHA 3TA0A 3ZZOA 3PJ9A 5IM0B 5J2PB 4ECWA 2AGQA 2HQDA 1HBNB 1DLOB 2CPEA 2DGTA 1FJEB 2QA4G 3UN3A 2XCPA 1YIJS 3UWTA 4EU0A 1Q82T 2ZD1B 5CH7B 2HQCA 2WK4A 2Z57B 2QMWA 3F0NA 2B0GA 4Q2LA 1SQFA 4P73A 1UFWA 1IKXB 1VQPS 2V4JB 4NX9A 3AXKA 2ZZTA 2CG8A 2WSEC 3DLGB 4BCAA 1RHQB 3JQKA 3CJKA 1HQEA 2VC0A 4ED1A 2EFQA 4NZ7A 3SFUA 4X66J 4UZBA 2KYXA 4OZ5A 1TTHB 4QYRA 1WELA 3H42A 4JI1F 2CQ2A 4KV8B 3E2EA 2J8SA 4EMDA 2KRBA 4B3OB 3D6HB 3VQTA 4ZLNA 3SCJE 1WUUA 2LFVA 3MECB 3K5MA 5C2CA 4YR2A 4CH1A 1M5VC 2NQPA 5EX0A 3B82A 2BANB 2YWGA 2KB2A 1JMTA 3HVTB 3KLIB 5LT5A 4ETZA 4JI4F 3R1HA 3KHGA 1CULA 4K0KF 5B7WA 2UVUA 2CQHA 5G0RA 5EHHA 4KPYA 4WBFA 4NLVA 1D09B 1MLAA 2PIIA 1SPBP 3MMJA 2VG7A 3R7SB 2W4PA 3LP2A 3THVA 1UVJA 4KHPF 3M8RA 1OQ6A 3A8KA 4ZCIA 3HX9A 3MEGB 1W26A 4O4RA 1QAIA 2VONA 2I2YA 1JXEA 1UZDA 4EK2A 5HQLA 2V8GA 2YWEA 3LP2B 5HJXA 3R3TA 4WFXA 5B0GA 2MZ1A 4OI4A 2M88A 3UW1A 1U4BA 2GVZA 3FRZA 1K8AT 3HJFA 4QR2A 5CZXA 2XBPA 3BKTA 2P6SA 1N5YA 3K8WA 2JVOA 3TUJC 4BWJA 4AQYJ 5KAKA 3UR3C 3TZWA 1UMJA 3OL7A 2PO4A 2ZITA 2GIFA 2ZBRA 1VQOS 4PYAA 4Q5VA 3PY8A 5A2QY 1QD1A 3LAKA 1WWHA 1M5PC 1FWPA 3JSBA 2P9CA 4XO0A 4Q8FA 2CPYA 2LCWA 2M7SA 2RKIA 3OVSA 2EKYA 2DXDA 2MZSA 3M2UB 5T7LA 3GFXA 3T5HA 3KK1B 2C28A 2EK1A 3MR6A 2EVZA 3CJKB 1AT1B 3B78A 3IWNC 1KFDA 5KG0A 4YB1P 1LXNA 3OHBA 2YWWA 2ZH9A 2V4JA 3KJQB 4K59A 3AJ1A 4RWWA 1X4GA 2IJRA 3MAQA 4KV8A 4X4RA 1NDKA 1WF1A 2IFXA 4D3HA 2G0CA 3R5GA 1S57A 3I6PA 3PR5B 3CD6S 3ETOA 5HQ8A 5CCMA 2D3OR 3MFIA 2R8GA 4PABA 1KFSA 4QIVA 2LKZA 5L38A 1UVMA 3AJ2A 4TYAA 1M90T 2X1FA 2G9OA 2IYGA 4P2XA 5LM7E 2HS0A 5D78A 3Q23A 1T8EA 4IRDA 4PWUA 4I2QB 3WC2A 2KFNA 2QL5B 1YI2S 3MM8B 4H4MA 4MMOA 2IMWP 3G9CA 1PG5B 2FDNA 4OLPA 3ELHA 1HHQA 3RUBL 2EC0A 1ZM9A 4C3MA 4OI0A 4OYWA 3T6BA 3DRPB 2Y1IA 4L74A 1CC8A 1UPMB 2Z2ZA 4K8RA 3VZIA 4U8VA 2CZ9A 2O67A 3NS5A 3PRBA 3QT5A 4IG3A 4KGZB 4C8NA 4DV3F 1IKYA 2YKNA 4UF4A 2XEXA 3TEGA 4EBEA 3BBCA 4DV6J 2GS8A 2W7AA 1LK7A 4WWSA 1S59A 5M2RA 4YP3A 3Q8QB 1S9GB 4ID5A 4PXEA 2W9CB 1HNWF 1WJ9A 1VRUA 2BJ8A 2H5IB 2DNYA 2IVMA 4ZVGA 5LSLA 3JAMY 4LRFA 2CPXA 1DTTB 2GGPA 1GXTA 1X4AA 5GADI 5IXUA 4XDDA 4O44B 4OQJA 4O3NA 2KO1A 3EVOA 4H54A 3R27A 5HMYA 3PFOA 4F0MA 2UV8A 3I56S 1RTHA 4R8UA 1S7IA 3NMAA 5DQGA 1Z1ZA 3LWMA 3JXOA 2C2OB 3DRRB 5DZ6A 1FEHA 1LXJA 1C0TB 3HMJG 3A3PB 2HVIA 2MKYA 3GIRA 4ZCMA 3DOLA 2GVDB 3QFHA 1E6YB 1TL5A 1X0FA 1EJ7L 3EDQB 5B0EA 3EZ5A 3OQ2A 4NLGA 2R7OA 4EO6A 2L9NA 3IR5B 2RU3A 1JLCB 3ZNJ1 2HS3A 1V3SA 1JLEA 1NK5A 2WB4A 5AXMA 5KFEA 2HURA 2M8HA 1RTIA 2H54B 4NLXA 2G2ZA 2OPRA 3QMQA 4R25A 3U1NA 4R5PA 3MR5A 2AW0A 1X9MA 4YEAA 1B3TA 4CWBA 3WX4A 1IM6A 2OFHX 4CO4A 2AYEA 3MM8A 3N6NA 2CUYA 4H4MB 1G7CB 4EWTA 4OV6A 1JLBB 3BH6B 3CB4A 1RK8A 2GAHC 2XSJB 2Z58B 3I32A 4KSEB 4NLUA 2EI5A 2XGPA 2MB0B 4FYWB 2VG5A 2HNDA 3QT7A 2IVYA 1YJNS 1IKYB 2YKNB 3M7VA 3Q0AA 3JYTA 4K5RA 1M1KT 3CCSS 1T9VA 3V6DB 3NAIA 4DG1B 4N47A 1F3VA 2VIHA 2CQ0A 3GE9A 4KIAA 2Y1LB 4FBUA 4C8LA 4RW8B 3KLFA 2XZWA 3JSYA 5FDLB 5E3AA 3EYZA 4ELTA 1S9GA 1A6LA 1TR0A 2IIHA 4IH5A 1HNIA 4K4TA 4DCOB 1N6QB 5KFDA 4A8FA 2R2UA 1TKZB 4BBYA 1S77D 1FNXH 4CM2A 3ENWA 2J9EA 3MM9B 4X62F 1TZ0A 3G8TA 2CQBA 4MAKA 4FKYA 3M8SA 1VQ4S 4LF9F 1FJGF 3MUMP 1U6ZA 1X31C 3I4PA 1U26A 1VK8A 4C0HA 2FIUA 3VVUA 2OHDA 4K7QA 1K73T 3HHLA 1PJ5A 2CNOB 3HT3A 3I5AA 2F5GA 5ETNA 4DV1F 3M9OB 5BYSA 1DRZA 2ZJRQ 3NL0A 4K50A 3TVKA 5CABA 1KNZA 2UXBF 4YY3F 1W25A 5AJ3F 4IOBA 2HNZA 4OZ1A 4IR9A 2BZ2A 2HAFA 3ZZYA 2W1BA 3D0GE 2W2MP 3DLEB 1MG7A 3K5OA 3J7YU 2HW3A 2ADBA 1TL4A 2CJBA 4LR7A 2DRAA 3DGPB 5D0EA 1GXLA 3I87A 4HL9A 1FKOB 1H2UX 1VRQC 4MYUA 1N88A 1S1TB 3W7BA 3HVRA 3QRRA 3E8OA 3G4SS 3NP5A 1NMEB 3F44A 4LF8J 4NLSA 4MH8A 4PEOA 2MQPA 3J81j 4XDCA 2LEAA 1T03B 1RTDB 3DLBA 1WC0A 4UTGA 1FEEA 2H3EB 2ZHAA 5J2MA 1CQMA 1HKAA 2GIQA 2HIYA 3WC0A 3ILOA 4IFVA 4J9PA 3GONA 4DV0J 1BE4A 3HVAA 1RT3B 2GIRA 1FVQA 3HHLB 4JOUA 2J9CA 3DRPA 4F4ZA 4QYZJ 3T19A 2LP4A 3O5TB 1MWZA 1F3FA 1JQGA 4OL8A 1HQEB 5K8NA 1X7VA 2OUGA 2BVZA 2BEFA 2QFIA 3DI6A 1WSRA 1JLQA 2HBRB 2CJXB 2KRRA 4ICLA 5SUHA 4CO1A 4RW7A 1R6YA 2YKQA 2BACA 2F9DA 2RNEA 4NA1A 5C25A 1NRKA 2EKNA 1TKZA 4ZDNA 2CJ9A 1KTQA 1R8HA 4JV1A 1EETA 4N56A 1UJ6A 4ZS6A 4PG5A 1S72S 1VR6A 1HD0A 1XEZA 3LP0B 3DKDA 2DBBA 3P5BP 2YWHA 3KK2A 2E5LJ 4JI3F 1XNQF 3ZZUA 3D2WA 2UUBJ 3SEOA 2AJQA 3L9ZA 2IRYA 2AP6A 3AY0A 1KONA 3IP0A 3KDNA 4KO0B 4ZN3A 1Q1KA 1WG4A 3DDNA 4CH7A 2BQUA 1VHIA 4MK8A 1TELA 5KFJA 3QYYA 1T03A 4USHA 4F67A 3QSIA 1CPZA 3M2RB 1Q78A 1LNQA 4NE9C 2X1AA 1KD1T 1PJ7A 4CIOA 2HK3A 5KFBA 2DCUB 2SXLA 2E1CA 3RW7A 1SJ3P 2UU9J 1DQ8A 3ITHB 3N79A 1BWVA 4O4GA 4KKOA 2HAIA 2M70A 2WB1D 4OZJA 3JSMA 2JEJA 3KTQA 4BWMA 2J0QD 3F73A 3GSDA 3V4IA 3D54A 4NLWA 5ITHA 1RWWB 1UJ4A 2OFGX 4MYTA 4WFYA 3PYEA 2UU9F 4DS5A 1Z4UA 4E8UA 3W62A 4AFFA 4ECYA 3VCDA 2F8MA 3H2VE 1LEOA 2VH7A 5BJRA 2VA3A 3RR8A 2NSCA 2P2CB 2YKOA 3HKWA 3BDPA 5KFFA 3MMBA 2DNQA 1T9TA 3B8HA 1NSPA 3VAIA 4LFBF 2VUGA 3ONQA 4KHRA 1LWCA 1P1LA 1S9EA 2WBRA 5KT4A 1Q8LA 1P9QC 2MQOA 1WTBA 1N34F 1GTHA 4ZLLA 2JLEA 3B4MA 2Q3PA 2NPFA 3H0PA 3LP1A 3MEEB 1S4EA 2ALZA 4DPWA 1S6QA 1SV5A 3UVJB 4W90B 4KC5A 2C2MB 1WI6A 3C19A 3PEHA 2NXEA 4C8KA 3P6YC 3T1YJ 3N6MA 3DDKA 4TVAB 3M8PA 4L3KA 2YNGB 4NLQA 5F8GA 1Y5IB 5A2QU 4DSEA 3W8GA 1U7LA 2C22A 3AXMA 4LF5J 2VJVA 3IGNA 4C9DA 2FJBB 1YBUA 3BGFA 3QLHA 4CO0A 3V6KA 4C6AA 4Y0FA 2EWHA 3OFEA 2ZUAA 1JIHA 1WDDA 1F5CA 1OSDA 4OX9F 3N0VA 5KFRA 4F04B 4W92B 1XQIA 5D6GA 2ASYA 1F60B 4DUYF 4DUZJ 2QZ8A 3NGDA 2V2QA 2AGOA 2QV6A 4HYKA 4ALZA 2K1RB 2HVEA 1VBKA 5KFYA 4DV5J 1S1XB 4NMXA 3IBFB 3PX6A 1FXLA 2O1PA 4LMZA 1YBTA 4MJKA 1AFJA 2Y3YA 5KT6A 2M4MA 3PG9A 1HHTP 3I0RA 5BR8F 1DZ5A 1U48A 4KYZA 1YLXA 4BLGA 3US5A 4BC9A 3J7ZT 4LVOP 1WOPA 1NHUA 2E9TA 2UVRA 2J0XA 2ZDPA 4OJ3A 4J9MA 2E5GA 3AH6A 4OX8A 3VAFA 4HKQA 2D3UA 2MEWA 2P9GA 1SC3B 2ZNYA 2B3TB 2EXUA 4ZPDA 3OL8A 2R2TA 2F4VF 3MGJA 3O3LA 2OPPA 2ZH2A 4DR3J 4CLZA 3MR2A 1NO8A 1V3RA 4P2SA 4RKUC 3MCMA 4ZP7A 2YX4A 3QGIA 1FRLA 3UNYA 4QZVB 3RRGA 2OMLA 5D0HA 4M5IA 3IR7B 4HHHA 4YY3J 1KR4A 2EW9A 3KUHA 2GMJA 3K7RA 2ZHBA 4AUKA 3GJTB 6AT1B 4DR2J 3MEEA 4ECXA 2UP1A 1U0HA 2PT0A 3POTA 3G6ES 1EQ0A 3H7HB 4I64A 4OYAA 4B3MF 1B4SA 2VQEF 1O5JA 3R5DA 3F41A 1WKKA 2WW4A 3BGRB 3HHKA 4L6V3 3TJ8A 5J1PA 4ECQA 2K3KA 2ZVIA 4QWEA 3SV3A 1TKXA 5IT9Y 1BY9A 3GCWP 2VOPA 1NPPA 2VFVA 3CJ5A 4N41A 1H0HB 4IG3B 2BRKA 4N7TA 5C25B 1SL2A 2MKSA 3PO4A 3R7NB 1TAUA 5CHCB 4FKXA 3PNIA 3C6TA 1UKUA 2ZKTA 3L7OA 1TAQA 3OBIA 1IKWB 1R89A 4PKDB 1REVA 1H3DA 2JOQA 3BS9A 3IM9A 4G1PA 3R9LA 3PVXA 1T05A 4DZDA 1VQSA 2B6AA 4FXWA 1S48A 3DHXA 4B3MJ 2G0JA 1J5EF 2HIQA 2PC6A 2PSZA 3FEYB 1T94A 3LOUA 3Q83A 3TA2A 4E2FB 5AE2A 1FHTA 3CXCR 3C6UB 3MPVA 2KT3A 1F5BA 1N5QA 5BYRA 2EG1A 1SH3A 2HVDA 1KBRA 2HSEB 3EVWA 1S76D 2FC9A 3Q22A 2VDHA 1UW9A 3MHYA 5E5NA 4DUZF 3BV8A 1HW8A 1HPZB 4N77A 1HL6A 3J80U 2AQ4A 1SKRA 2JRSA 2RJZA 3D3BJ 4FXDA 3GIKA 2QLWA 2E66A 2BX6A 2V0NA 3EGVA 2GHPA 1HPZA 3DDIA 5GVQA 1WKLA 3IM8A 1GK8A 3EMTA 1V6HA 4YDDB 2FB0A 1H98A 2Z4PA 4JUZA 3RJMB 3O2IA 3BO4A 5LMNJ 1H73A 1M0SA 2D3ZA 2YNHB 3MDFA 2XSJA 4KPCA 2ABYA 2ZE2A 2E9ZA 2Q66A 2Y9HA 5L39A 1I94F 4A8YA 4X4TA 2HVZA 2RILA 4JV5J 1FD2A 1FF2A 4C0BA 4RW4B 4YMEA 2F8HA 2C3YA 3VAHA 1NK7A 3AOAA 1U8WA 1WC5A 1ZA1B 2KN4A 1UVKA 3QWPA 2HQ3A 2KM8C 2R7RA 1CBKA 1PC4A 1RA6A 5KFPA 1S49A 4ZVTB 2WSFC 2QLXA 2Y0SD 2NZCA 4DX6A 3M9MB 4LSNA 3T5JA 2J6UA 3QO9A 3TVZA 1G3OA 5D4NA 2G1DA 1D3WA 1ZM3A 4LSZB 4ZKAA 1J5EJ 3P49B 3PW4A 3TYTA 2RHQB 1SL0A 4X65J 4WPAA 4U67Q 3HXMA 1Y9OA 1PO6A 2L41A 2JH3A 3PR4A 4MFBA 1QSYA 1YITS 4LF5F 3AOBA 4XPCA 4C8ZA 3EGWB 2HK2A 2JLGA 3T1YF 1HBMB 4CLYA 1C4AA 1W2IA 1SBRA 1AROP 2K7JA 1JXVA 3MAAA 1C4CA 2DXFA 3HVTA 3KLIA 4OHVA 2W7PA 3OW2R 2R8KA 1HI8A 2H4YB 4J9UE 1F9EB 2B4UA 1IJFB 1N5TA 1EKRA 3MECA 1M5SA 1D1UA 3CPWR 2RHSB 5K14A 3CVKA 4YHHJ 4ECUA 4FVMA 4WCEQ 4RNFA 4OYOA 4NEZA 2CYYA 3NBPB 1SH0A 5C24B 4X84A 1AB8A 5KFCA 1ZOTA 5A8KA 3EGNA 2VG7B 2N82B 1IBKF 1VRTB 3OR1B 2MLZA 4O0NA 1RWXB 1GMWA 2OPPB 1CJUB 2CZ4A 5HJYA 4UQGA 2PFFB 2K7KA 2G2OA 4WYWA 1RWKB 1TFWA 1KEKA 1JB0C 2BKPA 4ZJLA 1HW9A 5BYQA 5GAEI 2VHGA 2RRAA 1RSCA 2GC8A 3QZ8A 1JLAA 2P9EA 3VGSA 3Q2TC 3RRKA 2DPIA 1Y0HA 4ZITA 5A76A 2HZVA 4DR7J 1JLCA 4DQRA 1H72C 2EFOA 1U6BA 2ZWPA 2RRNA 3TAMB 2C2NA 2HS4A 4LR9A 2WONA 4UY85 4DS4A 3RAQA 5IT4A 2PMHA 3CCJS 5D3GA 2RDIA 1WG1A 4HLBA 5GAHI 2E5LF 1AXQA 1UCNA 3H8YA 3M2UA 3KG0A 5K14B 4Y00A 3C8YA 1YTYA 1CJVA 3R5AA 4KB7A 5KT7A 3MAHA 2KH9A 3NNHA 1S6UA 1FKPA 4B02A 2ZM6J 1RJJA 1T9YA 1NM2A 4DFKA 2Z0GA 2VG5B 1N5SA 1URNA 1FK9B 2FVSA 2IC3B 4DV4F 2BXJA 2FJVA 3A3NB 4OJHA 3H5UA 1L5UA 1R7IA 1FXDA 2CDRB 2MKKA 1TVRA 2DK2A 3ILLA 2JFKA 4FDFA 3UFCX 1Y3JA 2DCLA 1G2EA 2BJEA 1RAJA 3UPFA 4D3GA 4USIA 2DNNA 1YG0A 3HM9A 3RTVA 4K4SA 1D9DA 1WSVA 3EE3A 2CPFA 5KG3A 1T9UA 5H9EK 2CADA 3O8WA 1FXRA 2DO4A 1AYEA 1RWMB 1S1UB 1WI8A 2B8PA 4Q7AA 2XS5A 1R3NA 2WONB 4LBIA 1NPRA 1PBAA 4UY8T 5FLXY 1MW7A 3KLGA 2HHWA 2CG4A 4DLEA 3LGNA 1N54B 4DV7J 5ETLA 3DOKA 1UEVA 4WK3A 3TA1A 1VIOA 2GQQA 4I6YA 3Q24A 5LSRA 3O1LA 4ES2A 3OTOF 2HBYB 3CDUA 3DMJA 1JLGA 1X60A 1SJQA 2HZCA 5KFXA 3IGVA 1NK6A 5T7LB 4CDIA 2DNHA 5KFUA 3R1LA 3PKMA 1NXIA 1IR2A 2IAJA 2M2BA 2OSRA 4AXIA 1NK8A 1S6QB 3QFWA 3UVJA 1WACA 2B9WA 3FJ2A 1U1QA 1YHQS 1URRA 2G13A 3FBFA 4AXJA 5I42B 1SV5B 2VA2A 4F36A 1IXKA 2P5VA 1QUVA 4JB8B 2IDEA 3B6BA 4G3IA 2N4DA 3CJRA 3ULHA 1K47A 2VFTA 4ZVFA 1MMDA 2DISA 3CMQA 3M2RA 2HNYB 3UD5A 3VAMA 3D0IE 4DV7F 1S12A 4RPFA 2A2CA 3NEKA 2AEFA 5EDWA 1V3ZA 2R3VA 2XNQA 3MEKA 2AGPA 3KLHB 3GP9A 2BRLA 1IUJA 2RF2B 3E51A 4MKYA 1SXLA 2V68A 1BQNA 4C7QA 3FRYA 1TUWA 2UUBF 5I3QA 4EFAC 3NGTA 3NAHA 1DBDA 3CCMS 3PV8A 2HEKA 4KT0C 2HFNA 2MGZA 5KFIA 3GFZA 4EUVA 3V4IB 1FJ7A 3EGZA 3Q89A 4IFVB 3CJSA 2RVJA 3HHDA 2DH9A 2LLZA 3I0RB 5EX3A 2AV5A 1HIYA 1DY3A 5J1NA 4NLPA 4A8MP 2V94A 3DI6B 3S01A 4XIUA 4Q2MA 1NZAA 3MM5B 4J37A 1LW2B 2RS2A 2AD9A 4M95A 4A46A 4Q8EA 4X4SA 3W66A 1SKUB 1KP6A 4HI2A 1RAGB 4HDGA 3KLEB 2ZH1A 3NCRA 3RAMA 3LTOA 1OY6A 4J9SA 4DI6A 2CIMA 4P52A 4QWAA 1SKWA 5DLFA 3C2PA 4FF1A 4KR0B 4LREA 4L72B 4QCLA 3M2VB 2DH7A 2RB7A 3LANA 4DJBA 3BPDA 5KFSA 4F2RA 2HPUA 1UEKA 5DGBA 2XB2D 1HWKA 1RUSA 4RBVA 4TU9A 1HNWJ 4A47A 4QW8A 2N3OA 1KWMA 1NDCA 1V5VA 2VPWB 5E3PA 3OR2A 3KFWX 3LPEA 2Z2MA 4RX6A 3G71S 3KK1A 5EWEA 2YWKA 1WDTA 4MIWA 3QIPB 3FSXA 1LWXA 1M5HA 3CO0P 3GJSB 2VV5A 4P72A 4ZPWR 3TX8A 4CLSA 1AUSL 3MD1A 1CJTB 3GIMA 3G87A 2ZH5A 1I94J 3RW6A 1RHJB 1BUXA 3HHEA 4ZMMA 4P9SA 3IXQA 2R8IA 3OVBA 3DLKA 4OMFG 3SQGA 5I42A 3N01A 2BR0A 1SJFA 2MLYA 1RT4A 1YDLA 4DF4A 3VQSA 1YJTA 1L3VA 2R7SA 2ACYA 3NRBA 4F4WA 4USKA 1NSKL 5DQIA 2H4WB 3NOCA 3VAJA 2BUNA 4PCQA 1RCOB 1R0BG 2FZKB 3EWGA 3P4UB 4WKYA 7FDRA 4EYIB 2E29A 5EN1A 3V4MA 1S1TA 1TKXB 3CJ4A 1IBCB 4P6QA 2D1CA 1GMWD 1Q95G 1XR6A 3OXGA 3KUGA 5DDRC 2WTFA 2W9BA 1RWVB 4WJBA 1NNDA 3ZFVA 2J6SA 4FBTA 5CYQB 3R5JB 5DM6Q 1HARA 3L7UA 2CPDA 2DRBA 1DQ9A 1S6OA 3QT8A 2NYHA 4RJVA 5J1EA 1IR0A 3UNGC 2HQFA 5E3QA 5HVFA 1T9XA 4RNOA 1M1HA 2XY5A 3W61A 4NCGB 4A8SA 2BM0A 4OYIA 5IFMA 1REVB 2FPHX 2ZFHA 4PZVA 2YNFB 4S0MA 2EC2A 3EXCX 4L75A 4OJGA 5KFLA 1JJ2R 1SIZA 3N6LA 2DB1A 4PPDA 1MROA 2BV3A 2QFJA 3UN2A 5C5JA 5LJ3Y 2CQPA 5LXYA 5HK4A 2HGLA 1KQGB 1GMUA 2CQ4A 4TY8A 5D15A 4ZPTR 3I5BA 3NS6A 3VALA 2FLNA 4IFYB 5HROA 3FNNA 1WKJA 4USUA 5CA5A 2I0XA 4Z2XA 2XM3A 3MM9A 2ZOFA 2CNNB 4RUBA 3T3FA 3FZBA 2L48A 4J9RA 4FPIA 4UOFA 3JTPA 3IWXA 2CJKA 1OWXA 3GLJA 2GFFA 4DX8H 2KXFA 1Q79A 7AT1B 3TZZA 2IAJB 4F0KA 1DTTA 1VI7A 1K44A 5DJBA 3LAMA 4TN2A 2FJEB 4YS2A 1VC0A 4OFZA 3BSNA 2QC3A 3MMAB 2ZE2B 4DPXA 3LWLA 2EEYA 2FZCB 3FBCA 1OSCA 1PC5A 3JS9A 5LL6d 3W8PA 2EBEA 1PYTA 4Y3CA 3EZUA 3IAM9 3SYZA 4LFAF 4OYZA 2DH8A 2QO3A 3BM7A 3DRSB 4FN5A 5ETPA 1LW0B 1IQTA 4PRFA 3KDOA 4YFUA 3PTWA 1E6YA 1NB7A 5LMNF 2J7WA 2F3JA 1Y11A 4Y6IA 2CQCA 3CMES 4A8QA 3J7A1 2BJ3A 1JKHA 1MWQA 1HHSA 3C16B 2MTLA 1CG2A 2VFSA 2LQ5A 1SJ1A 3AAWB 4NLRA 4X65F 1JLBA 4UOHA 2C1EB 3IC1A 2OD4A 3TVYA 1I3OB 4P7TA 1TQLA 3IS9A 2CVIA 3FQLA 1WC1A 3BKUA 3KG1A 3IRWP 2B4PA 3OHAA 1QE1B 1KVKA 2E1PA 1HMVB 4M5DA 2OI2A 5C7PA 2WVBA 1H7WA 3CC2S 3FKBA 1OQ3A 5A0YA 1MROB 1HBOB 2A2DA 1BQMB 3IBCB 4NA3A 3M30A 4IOAQ 4UUWA 3TUIC 2AJ2A 3TUZC 4DPUA 2XYPB 3EJMA 5LMUF 1B0VA 2CQ3A 2B7CB 2YNFA 4FPRA 5K8MA 4DLGA 3BB5A 3V81A 3BDEA 3HVWA 3NBPA 4RU2A 2DT9A 4K0KJ 2FJXA 3I96A 1NDLA 3KHLA 2YNGA 1ZZFA 3A12A 4ILMA 3W9JA 5C2GA 3U27A 2C2DA 4FNIA 3ZTQA 1P27B 3FMWA 2CAJA 5KFMA 2YQ0A 3GILA 1I6JA 1KLNA 2HWHA 3AOCA 2BJ7A 1N48A 1CJVB 2ILZA 3A8EA 1U1LA 1KN6A 4OX6A 3QLHB 4EGLA 3MCOA 2HBQB 3QSYB 3OL6A 2X3GA 2XHCA 4DR5J 2FVRA 3H2LA 4ZP9A 2MKIA 5J2QA 4LRDA 5MLCV 4KJIA 1NAQA 4U8YA 2ILYA 5IC4B 4Y2AA 3AT1B 2XWYA 2OAUA 1HI0P 3IO1A 4LFCF 3RB3A 3GG0A 3H90A 3QPIA 2ZBQA 4GKKF 1HMVA 2RQ4A 3SIPB 3PHTA 4ED7A 2JLFA 3DLGA 2A1BA 4I68A 1H38A 2H5JB 2BKOA 3GG1A 3UI3A 2MQ8A 1U2CA 2CZVC 4KKOB 2KT2A 4NZ6A 4JV0A 2F63A 3UCGA 1TL3A 3K5PA 1FVSA 1L3TA 2XZDB 1RI7A 4NASA 2IJFA 4LJMA 3FSYA 1LWEA 3PFEA 3UD3P 1S0MA 1VQ9S 1VK3A 1NHKL 3KJNB 4ATNA 2OELA 3CW2C 3FDSA 4I0WA 3JTNA 2JWNA 1RAIB 2RD5C 3B4DA 1RAOA 1XMBA 9ATCB 2MZRA 4CNYA 2OIHA 1CVJA 3QJPA 3MURP 3MEGA 2B9XA 3M4XA 3RRHA 1WC6A 2XMMA 1IR1A 4GC6A 1AZSB 2KU7A 4I2PA 1S1WA 2HNDB 2J0SD 3W2WB 2RS8A 4LBHA 5EGYA 4B9VA 3THTA 1R0AA 2LQ9A 2VC1A 5F8NA 2OP5A
chains in the Genus database with same CATH topology
5AJ3J 3T1YJ 4DR4J 5A2QU 4LF5J 4JYAJ 3W1YC 3IMQJ 5BR8J 3R2CJ 4B3TJ 1J5EJ 1XNRJ 1HNZJ 4DUZJ 4V1Ak 4OX9J 4JI7J 4X65J 4JI4J 4LF4J 4B3SJ 4DV5J 4DR6J 5LM7E 2UXDJ 3R2DJ 4NEYA 4KYZA 3J81U 4JI3J 4NXNJ 4JI6J 4DV4J 2MTLA 1XMOJ 4LF8J 2MEWA 3J7AN 1IBMJ 4LF6J 2UXBJ 4DUYJ 4LFCJ 4DV6J 4DR3J 1XMQJ 4YHHJ 4B3RJ 4DV0J 4NEZA 5IT9U 4LFBJ 4YY3J 2KVQE 5IWAJ 1FJGJ 1HR0J 4DR2J 4DV1J 4DR1J 4PWWA 4DV3J 1N33J 3T1HJ 2KL8A 4K0KJ 1HNWJ 4LF9J 1IBLJ 2E5LJ 4X66J 4DV2J 4DR7J 3JAMU 4KHPJ 4GKKJ 2UUBJ 2VQEJ 4JI1J 4KY3A 2UUAJ 1XNQJ 2VQFJ 5FLXU 1I94J 4JI0J 1IBKJ 4LF7J 4DR5J 4GKJJ 1N32J 4JI8J 4HHUA 1HNXJ 4B3MJ 4JI5J 2UU9J 2ZM6J 3D3CJ 1N36J 4X64J 2MQ8A 4X62J 2UUCJ 3J80U 4JI2J 3D3BJ 4RJVA 4LFAJ 4NXMJ 3OTOJ 4AQYJ 5LMNJ 2UXCJ 2F4VJ 4JV5J 5LMUJ 1N34J 4DV7J 2HHHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 J;  3T1Y J;  4DR4 J;  5A2Q U;  4LF5 J;  4JYA J;  3W1Y C;  3IMQ J;  5BR8 J;  3R2C J;  4B3T J;  1J5E J;  1XNR J;  1HNZ J;  4DUZ J;  4V1A k;  4OX9 J;  4JI7 J;  4X65 J;  4JI4 J;  4LF4 J;  4B3S J;  4DV5 J;  4DR6 J;  5LM7 E;  2UXD J;  3R2D J;  4NEY A;  4KYZ A;  3J81 U;  4JI3 J;  4NXN J;  4JI6 J;  4DV4 J;  2MTL A;  1XMO J;  4LF8 J;  2MEW A;  3J7A N;  1IBM J;  4LF6 J;  2UXB J;  4DUY J;  4LFC J;  4DV6 J;  4DR3 J;  1XMQ J;  4YHH J;  4B3R J;  4DV0 J;  4NEZ A;  5IT9 U;  4LFB J;  4YY3 J;  2KVQ E;  5IWA J;  1FJG J;  1HR0 J;  4DR2 J;  4DV1 J;  4DR1 J;  4PWW A;  4DV3 J;  1N33 J;  3T1H J;  2KL8 A;  4K0K J;  1HNW J;  4LF9 J;  1IBL J;  2E5L J;  4X66 J;  4DV2 J;  4DR7 J;  3JAM U;  4KHP J;  4GKK J;  2UUB J;  2VQE J;  4JI1 J;  4KY3 A;  2UUA J;  1XNQ J;  2VQF J;  5FLX U;  1I94 J;  4JI0 J;  1IBK J;  4LF7 J;  4DR5 J;  4GKJ J;  1N32 J;  4JI8 J;  4HHU A;  1HNX J;  4B3M J;  4JI5 J;  2UU9 J;  2ZM6 J;  3D3C J;  1N36 J;  4X64 J;  2MQ8 A;  4X62 J;  2UUC J;  3J80 U;  4JI2 J;  3D3B J;  4RJV A;  4LFA J;  4NXM J;  3OTO J;  4AQY J;  5LMN J;  2UXC J;  2F4V J;  4JV5 J;  5LMU J;  1N34 J;  4DV7 J;  2HHH J; 
#chains in the Genus database with same CATH topology
 2WBM A;  4TY9 A;  1VBX A;  3R6G B;  4NI2 A;  1Q7Y T;  2FVC A;  1RKI A;  1U09 A;  1RT6 A;  2OEM A;  3DLJ A;  2RDJ A;  3VHQ A;  4X4O A;  1OIA A;  2ZHO A;  3JSM B;  3OXF A;  1S5Z A;  1IKV A;  2LDI A;  3JQM A;  4NYZ A;  5U47 A;  2AEM A;  5M2U A;  4DQQ A;  1M5O C;  3ENA A;  3IN5 A;  3NGU A;  1ZM4 A;  3SZ2 A;  3L95 X;  4B9L A;  1IKV B;  1BMQ B;  1DLO A;  1F9F A;  3CJ2 A;  2ROE A;  4ED4 A;  5F9N A;  4L76 A;  4JI4 J;  1UZH A;  5AXN A;  3MPD A;  1JLG B;  1SCJ B;  1VC6 A;  4LF4 J;  3MTK A;  4KBI A;  3KNA A;  4DQI A;  4C48 A;  1YRU A;  4FF2 A;  4CLP A;  3T9Z A;  2DNZ A;  4OI3 A;  2AYM A;  3HO1 A;  5IV3 A;  2ZOM A;  1U1O A;  2V8H A;  5H9E J;  3X1L B;  4H4K C;  1F6T A;  3GZ7 A;  4C8Y A;  1RZM A;  3MR7 A;  4BS2 A;  3CTR A;  3Q8U A;  3H98 A;  2BM1 A;  1GEH A;  2YQ3 A;  1K0V A;  4DCP B;  4WFA Q;  2DGV A;  2X3D A;  1UP1 A;  2GQC A;  2CJQ A;  1GTE A;  2H1Y A;  2HRT A;  1XMO J;  5LXR A;  2OO4 A;  3ILI A;  4X2B A;  2ASD A;  3J7Z 5;  3JB9 k;  2FJW A;  1YJV A;  1FNM A;  5D77 A;  1ZA2 B;  1QTM A;  2DPJ A;  3DOM B;  2BQR A;  5G0R B;  3TX0 A;  3CWJ A;  2KFZ A;  2LEC A;  4K5S A;  1O0P A;  3T1A A;  2IA6 A;  2KVQ E;  4F3O A;  4F4K A;  3OLA A;  1RLD A;  1B70 B;  4IKA A;  4ES1 A;  4QIE A;  4G1Q A;  1N4L A;  3BEG B;  4LUB A;  4I2P B;  5DLG A;  3KLG B;  2KI2 A;  4DV1 J;  1B64 A;  1ZPW X;  2H48 B;  3I82 A;  4GC7 A;  1R0A B;  1N0V C;  2HGN A;  3OVA A;  2IM2 A;  2W4D A;  3CJ3 A;  1IWG A;  5AXL A;  4F0H A;  1AZS A;  3HI9 A;  3KK3 A;  5HSP A;  2XYG B;  4LF9 J;  5LOQ A;  4WF9 Q;  4ED2 A;  2JEF A;  1LW2 A;  1MN7 A;  3IG1 B;  3HT0 A;  4ZCL A;  4GKK J;  2W7O A;  2E1R A;  4N8N A;  4CI0 B;  1LV5 A;  2E9R X;  1KVJ A;  1RB0 A;  2UXD F;  1L3S A;  1ZM2 A;  1XNQ J;  3KXD A;  2UUA F;  1RWU A;  4M94 A;  2J9D A;  1SC4 B;  2ZJP Q;  2KZM A;  3WIU A;  2AT1 B;  1OMS A;  2DGO A;  3TAN A;  5G4D A;  1OPI A;  2RML A;  4ZVR B;  4CLU A;  1N32 J;  2LQB A;  2KDO A;  5CD4 H;  4ZVH A;  1M1G A;  1GFW B;  4Q0B A;  4CT8 A;  3BJY A;  2PGC A;  3DXB A;  4R0J A;  4DFM A;  2W4C A;  1FD8 A;  2VB6 A;  4QQB A;  3I9Z A;  5J2N B;  1Y4Z B;  4QW9 A;  4PPZ A;  1G1X A;  3DRR A;  3TZX A;  3HHN B;  3CDB A;  2FZG B;  2F4F A;  2RIJ A;  3Q8V A;  2HBZ B;  2O5D A;  4DR5 F;  2O3D A;  3T41 A;  2GML A;  5J2N A;  5DDO C;  2DR5 A;  3H25 A;  1KHW A;  3BQ1 A;  2IM0 A;  5SZT A;  2EG2 A;  2XI3 A;  3D4J A;  5KFG A;  3MZI A;  2FD2 A;  3D1H A;  4F7V A;  4ZHR A;  2IY5 B;  3O44 A;  2ZBI A;  4GVB A;  1U45 A;  5DS7 A;  2DO0 A;  5M2P A;  1MU2 A;  2MSS A;  3SMZ A;  3W2V B;  3HP6 A;  3EX7 B;  1YZ7 A;  3RAX A;  2QL9 B;  1QDU B;  1XTZ A;  2KJV A;  3B54 A;  2AJF E;  4NYO A;  1SL1 A;  5KFO A;  4U96 A;  4KGK A;  3BO3 A;  1K0T A;  4JI7 F;  4OIX A;  3LPY A;  2W8K A;  4KGX B;  3DU6 A;  2QL7 B;  2DIV A;  1D8Y A;  1VMB A;  3ISN D;  5LMU J;  1NJX A;  3NNA A;  4WIQ A;  5A8K B;  1ZAV A;  2B6A B;  3PAC A;  4HDH A;  3G8Q A;  1EKS A;  4F3M A;  3TUP A;  4AD6 A;  1JLF B;  7FD1 A;  2VPY B;  2J6T A;  3MMB B;  8RUC A;  1WC4 A;  2GHW A;  1X9S A;  4PUO B;  4M5K A;  2BMB A;  2F8E X;  3CUN A;  4PQU B;  2E5J A;  2OTJ S;  2NR0 A;  2ZH6 A;  4CLF A;  3EIC A;  3PW5 A;  2W01 A;  4PYD A;  1CEZ A;  1XNR J;  3FMB A;  3QGH A;  2GCF A;  2UUW A;  3C66 A;  3M8Q B;  1SIW B;  3FFI A;  4JBC A;  2QA1 A;  3GB0 A;  3V5R A;  4ED0 A;  3HSZ A;  5GAG I;  1VQ8 S;  5KG4 A;  1VRU B;  2LXI A;  3BO2 A;  3M8P B;  2XTJ P;  4EZ9 A;  1JKH B;  2C3O A;  1C1C B;  3R7B B;  3ZO7 A;  2XLJ A;  4EBC A;  4B3O A;  2XZT B;  2QN6 B;  1X5O A;  2DHG A;  2MST A;  3HD2 A;  5ETM A;  4ECZ A;  4YUD A;  3VZH A;  1YJ7 A;  2FVQ A;  1FTR A;  4NEY A;  5D8H B;  5DM7 Q;  3ET6 B;  4Y34 A;  1ZPV A;  1R8B A;  3KKF A;  2E7V A;  2IA0 A;  2OPQ A;  2QJ3 A;  5E2Q A;  1T9W A;  1FI4 A;  1N52 B;  3R5B A;  4FYV B;  2QSF A;  3DM2 A;  4C11 B;  3TAR A;  3CC4 S;  3MMA A;  4FYX B;  2DHH A;  2I5J A;  2DEJ A;  5AT1 B;  2E1A A;  5K5M A;  2M3D A;  3ZNU A;  4ECV A;  4LSL A;  4RW6 A;  1U6F A;  1IM4 A;  2V5H G;  5CYQ A;  3HUL A;  1MNE A;  2AMC B;  4ZIW A;  1RT4 B;  4DR2 F;  5F41 A;  4RW9 A;  2Z30 B;  2HFO A;  2XYH B;  3PDN A;  3DNC A;  3AB2 B;  1DHM A;  1YJ9 S;  3CCR S;  2AWZ A;  4OX7 A;  5KTQ A;  1RP5 A;  2BYC A;  3DOM A;  1FJG J;  4HT7 A;  1RT5 B;  5GAG U;  3U7J A;  3HFK A;  2WW8 A;  2VBX A;  3LGM A;  1OYE A;  2N7Y A;  4TQR A;  4BDP A;  2CFX A;  1XIQ A;  2YKM B;  4RBT A;  1FFS B;  3OR2 B;  5JUM A;  4GRS A;  3AA8 A;  5JXS A;  3BN7 A;  1FKO A;  2Q1L A;  3EM1 A;  4GMK A;  1RT3 A;  2DNR A;  4GVL A;  4OYB A;  4UUX A;  2QGF B;  1SVD A;  2HYI B;  1VQN S;  1X4D A;  1NK4 A;  3JAM U;  4EEY A;  1UVI A;  1ZAW A;  1FDD A;  1JLF A;  2B56 A;  3NGK A;  4NCG A;  4RL1 A;  2Z2Y B;  3BQ0 A;  4HI1 A;  2ZZN A;  4WII A;  2R7X A;  3AHP A;  2VQF F;  4DR1 F;  3WHI A;  1WHX A;  1YQH A;  4G1I A;  4DF8 A;  4V19 X;  3W9H A;  2JC1 A;  5HP1 B;  2V50 A;  3D1O A;  4ZPC A;  1NSQ A;  2XLI A;  2MMY A;  1UVN A;  2N7C A;  2DHA A;  3UR0 A;  2DYA A;  3AD8 C;  2N4C A;  3C15 B;  3M8Q A;  5HAT A;  3CCV S;  4UOC A;  5DZ7 A;  3KJV A;  4JI8 J;  2Y8Y A;  2M9K A;  1S99 A;  1T95 A;  1YBA A;  1ULR A;  3ZTS A;  3DLE A;  2BE7 D;  1SC6 A;  3QGP A;  3NWG A;  4RZR A;  3POT B;  1NJW A;  4P74 A;  2EFV A;  2CWK A;  1PJ6 A;  2MJU A;  1NK0 A;  1VRT A;  2XMV A;  3PJX A;  4OHX A;  4URQ U;  1IKW A;  1XR5 A;  1FWL A;  1HBM A;  2D74 B;  4AE5 A;  4C98 A;  3H59 A;  1RU2 A;  3HFV A;  2OPS B;  4Q44 A;  1RYR A;  1IKX A;  1CJK A;  3MTJ A;  3I9V 9;  2M5Y A;  5AE3 A;  4DV6 F;  4DL5 A;  1N6Q A;  4Y2I A;  4IO1 A;  1XR7 A;  1FDA A;  2K3I A;  2NLW A;  1VQ7 S;  1RHR B;  5B08 A;  5K8P A;  3SV4 A;  4LFA J;  4NXM J;  4HT5 A;  1GT8 A;  2F7V A;  4OV1 A;  1Z2Z A;  3GCX P;  1VYA A;  4DN0 A;  3SSQ A;  3CCE S;  1VOM A;  2VG6 B;  4GVB B;  4TLQ A;  2R2R A;  3TI0 A;  3GJR B;  4ECT A;  3PYF A;  1GH8 A;  4KFB A;  5A6W A;  2ZWO A;  2D3O 1;  2Q79 A;  2QG9 B;  1S1V B;  2VBZ A;  2W24 A;  1Q86 T;  2D9O A;  1LWE B;  2AHO B;  2LU1 A;  4M5H A;  3C16 A;  4XTT A;  4DCJ B;  1E6V B;  4BC7 A;  2HHH J;  3PIP Q;  1TL1 B;  2HNZ B;  2LYV A;  2OLW A;  4U95 A;  3UDC A;  4QU6 A;  4WU2 A;  3OFH A;  3C3L A;  2G0I A;  4DZ6 A;  3PX0 A;  3HD1 A;  1UFL A;  1NH7 A;  5CQG A;  4KGM A;  1TL1 A;  2FJA B;  4AT1 B;  3KJF B;  3MMC B;  5HI7 A;  1B99 A;  1S1W B;  2BE2 A;  4A8K A;  5IZH A;  2DGW A;  1HNZ J;  3BBF A;  1TMM A;  5KFZ A;  3H4D A;  2YXL A;  4M5D B;  1RA7 A;  2XMA A;  3J81 Y;  4DL0 C;  4DL3 A;  4ZP8 A;  4X4V A;  2J9D E;  4DDF A;  3QRP A;  4QIF A;  3OTD A;  1N5V A;  2G2Y A;  5DO2 A;  3GFH A;  2FTR A;  3QJJ A;  2VL1 A;  3QZ7 A;  4PG4 A;  3P3D A;  3RBX A;  5LSO A;  1EAY C;  3QRQ A;  5F8J A;  5KFK A;  4HH1 A;  4M8L A;  3HDS A;  3W5X A;  4R5P B;  2C2R A;  1UVL A;  3DOL B;  1WEX A;  2WHO A;  3R2D J;  3C14 A;  3CNQ P;  3TEH B;  3NKY A;  3K57 A;  2GVZ B;  3L09 A;  4Z7C A;  2W8L A;  3DLH A;  4PG6 A;  3PZP A;  1KSP A;  4JI3 J;  2DNL A;  1RBO B;  4WP3 A;  1BHN A;  3Q8R B;  2MKH A;  4B08 A;  2DR8 A;  1FKA F;  4LIW A;  1G4C A;  1YSJ A;  2B5J B;  3CO9 A;  1AUD A;  2B4V A;  4QWC A;  1EZZ B;  3EDR B;  3MED A;  4CYU A;  5IV4 A;  4F50 A;  4URG A;  4B3R J;  3BBB A;  2I8E A;  2DJW A;  1LWF A;  4ILR A;  2AJ4 A;  2V69 A;  2WRM A;  5A6P A;  5JJB A;  1S7H A;  4EBD A;  1Q4R A;  1CUL B;  3DM2 B;  1EB0 A;  2NS1 B;  4C11 A;  3V6J A;  2HQI A;  2VBY A;  4NXM F;  5J1E B;  5F8L A;  4RW9 B;  4DL7 A;  1QAX A;  5IQ6 A;  3BSO A;  3A13 A;  4USM A;  4KQZ A;  1N0U A;  2X51 A;  3N5F A;  1QVF R;  4OI6 A;  2XI2 A;  3IFE A;  4E98 A;  1S1U A;  2B9Y A;  3OTC A;  4DEZ A;  5JVG Q;  4FF4 A;  1WOR A;  1F2H A;  1ZAX A;  3R6L B;  4OYM A;  3KNG A;  4UW2 A;  2ZDO A;  1H74 A;  4AYB D;  2Y8W A;  5GAD U;  1IBL J;  3I5C A;  1RT2 B;  3FQK A;  3MM7 A;  2AZ3 A;  2HGM A;  2CQ1 A;  3GPA A;  3PRV A;  1SQE A;  3GQC A;  3M8Z A;  4AQY F;  3V2U C;  4JI1 J;  2HHU A;  3AA9 A;  2YY3 A;  5ETT A;  1HI1 A;  1GX5 A;  1PAU B;  1SC1 B;  1I51 B;  3LGH A;  4FF3 A;  4HEA 9;  4PXB A;  2LEB A;  3CCT A;  3PW7 A;  2XS7 A;  4IH6 A;  2M0G B;  1OJ4 A;  2VFU A;  2VKZ G;  4KE5 A;  4ZVO B;  3RBE A;  5ETS A;  4YQW A;  1ZZN A;  3UDV A;  1CJU A;  2VKR A;  3HZE A;  2KG0 A;  4C4W A;  2B4O A;  4U7U D;  2UUC F;  1TP7 A;  1DAX A;  4DR7 F;  3FEX B;  3K8V A;  4C97 A;  2ZH3 A;  4Y2C A;  3T5K A;  3OLB A;  1B7Y B;  3DU5 A;  4HR2 A;  2R8J A;  2AZ1 A;  2GX8 A;  1XMQ F;  4X62 J;  4FXV A;  5A8W B;  4ITS A;  4PG7 A;  3Q86 A;  4TNO A;  4TXS A;  1Y5L B;  4CYU B;  1VGY A;  2F9J A;  5HAN A;  1FKP B;  4LF1 A;  2ZC3 A;  3OT9 A;  5IQQ A;  1ICE B;  3TAM A;  4ELV A;  2VIC A;  4BHQ A;  4TU8 A;  1L3K A;  9RUB A;  3EUN A;  2CQG A;  1B7F A;  3OXL A;  3AQP A;  1F2G A;  5KFH A;  3GYN A;  1F9H A;  3LF0 A;  4NXN F;  3DGP A;  3D28 A;  4Q0B B;  1YVF A;  4WFN Q;  4B9S A;  1C0U B;  2CNK B;  1AFI A;  2MGZ B;  4X4U A;  2DNG A;  4KAI A;  1LFW A;  5KFQ A;  1IBM F;  2DY1 A;  1UFK A;  3MCS A;  2MZT A;  2CA9 A;  5L1J A;  2MZJ A;  2EBG A;  3BR8 A;  3CJT A;  3RU0 A;  5L1L A;  1HNV A;  2UZA A;  3W1Y C;  2MLX A;  1RLC L;  4A4J A;  4TY8 B;  2BJ1 A;  1J5O B;  4CO5 A;  5I3U A;  1HLW A;  5D4O A;  2OD6 A;  2QX0 A;  3GJQ B;  3FBE A;  1NCL A;  3M6X A;  4H4O B;  4ZVQ B;  2XC9 A;  2FY8 A;  3E3X A;  3UE2 A;  1OS5 A;  2QA2 A;  4X4P A;  3HFZ B;  1QUP A;  5A0Y B;  5DQH A;  2KM8 B;  5KOX A;  1RE1 B;  3WBZ A;  2M8D B;  4O3Q A;  4DPT A;  2J8A A;  3RB6 A;  1Q0N A;  4NLT A;  2PI5 A;  2A3J A;  4MT1 A;  3BGR A;  1CJT A;  4GO7 X;  2R7Q A;  4ZPV R;  4AND A;  1APS A;  4P71 A;  1FRK A;  1S79 A;  1ZS6 A;  2BE2 B;  5L8R C;  4J9Q A;  4FNH A;  2IRU A;  3DN9 A;  4WK1 A;  3WIV A;  3GV5 B;  4DQP A;  3TAP A;  4NRU A;  2C2Z B;  1RWO B;  5THW A;  5F8H A;  2DHX A;  1VQK S;  1S0V A;  1HYS B;  1DTQ B;  4K2X A;  4DV4 J;  4A8W A;  5D0R A;  2Y0B B;  5KG5 A;  3M32 A;  3NS7 B;  3R97 A;  3RR7 A;  1GX6 A;  5FD1 A;  4F8R A;  2JL9 A;  1ITP A;  1R8P A;  2W2O P;  3GFY A;  3W5Y A;  2JC0 A;  1LQ9 A;  4JI8 F;  5DG8 A;  1MSW D;  4IOC Q;  1KS2 A;  2JSX A;  3UN5 A;  3P8B B;  4KHM A;  5IWA J;  2NYI A;  2IRX A;  2NRE A;  3HHL C;  2DR7 A;  2CPI A;  1X8D A;  2FHJ D;  2RDD A;  5H1S V;  3D0H E;  3KHH A;  1WC3 A;  4LSL B;  4PQA A;  4DR1 J;  5CXT A;  2RF2 A;  4U7U K;  3OJU A;  1D9F A;  1C0U A;  4DV3 J;  1BWE A;  2RQK A;  1RTJ B;  3D6F B;  4IH7 A;  2RQC A;  1TL3 B;  3T1H J;  3FUY A;  4MK7 A;  4OHZ A;  2BAN A;  4JYA J;  4OI2 A;  2KJW A;  4NI2 B;  2DR9 A;  5KG6 A;  3QID A;  3D6M B;  4GKJ F;  4FS1 A;  4G65 A;  1S9F A;  1XK8 A;  5E3C A;  2UV8 G;  1RCX B;  5J2Q B;  4ED5 A;  3SCL E;  2MQN A;  8AT1 B;  1H2V Z;  4JI0 F;  2I38 A;  1EHW A;  4KY3 A;  2JEG A;  4I67 A;  2QLF B;  2VQF J;  2DHS A;  3PCO B;  3A3O B;  2LA6 A;  2VF3 A;  1QM9 A;  3FCV A;  3FSI A;  3DFE A;  1FDN A;  3OFG A;  3CCQ S;  3SDE B;  3EPG A;  1JNR B;  2MHE A;  4IO9 Q;  4WYL A;  4UT4 A;  2L08 A;  1C0T A;  5KFV A;  2V2V A;  2HHV A;  2NXJ A;  2PA3 A;  2OEJ A;  4ANE A;  3PYD A;  5D4L A;  4J9L A;  5L46 A;  4JI5 J;  2HHP A;  1K9M T;  2XLK A;  3ZXW A;  4PUO A;  3OFF A;  4F4Y A;  1W2B R;  3DRX A;  2AJ0 A;  1N36 J;  1HR0 F;  1HNX F;  1C1B A;  2FQQ B;  2V2K A;  3S8S A;  1VQ6 S;  1MWY A;  3WZ0 A;  4J5O A;  5HVH A;  1N8R T;  3GWC A;  4NOH A;  4J7C A;  4NWB A;  4DR3 F;  1Y7P A;  2V4R A;  4IDK A;  2OSQ A;  4WKR A;  1EX8 A;  1LKZ A;  2XMT A;  3S7R A;  3MM6 B;  5A8R B;  1T3N A;  2KXN B;  1BQX A;  1R31 A;  4K4V A;  1YKW A;  1WHY A;  4NRT A;  4ZJO A;  1TK0 A;  2HLT A;  1JJH A;  1Q16 B;  2A10 A;  5T14 A;  5IT0 A;  2DGU A;  2OPS A;  2VDI A;  2RSQ A;  2CRL A;  1VS3 A;  3MPY A;  4A8X A;  4RUA A;  1DUR A;  3CCZ A;  3PRD A;  1S0N A;  1HWL A;  3RGI A;  3CDE A;  3M1V B;  2K06 A;  3OTE A;  5GME A;  4N76 A;  1YJR A;  2DEI A;  4M5N A;  2XNR A;  3QAT A;  1ZYQ A;  4F2S A;  3ISZ A;  2F4V J;  4P7V A;  3J80 Y;  5ETQ A;  2DD8 S;  4YOE A;  4WE1 B;  3I0S B;  1T7P A;  3FGV A;  4P75 A;  4P2F A;  3P5T L;  5BXI A;  4IR1 A;  2KVI A;  4CNZ A;  2GAG C;  3ETM A;  2RRB A;  1JLA B;  3NCP A;  4DX7 A;  2HMI A;  2FHM A;  5F8M A;  3T1H F;  4J9V A;  1KRP A;  1SI9 A;  5BR8 J;  2W25 A;  3HSG A;  4R0E A;  3SSS A;  5DET A;  3JQJ A;  4B3T J;  1CS4 B;  4QYZ K;  3K59 A;  4DHV A;  2BDP A;  1WEZ A;  4JI7 J;  2V67 A;  1IJE B;  1XN9 A;  4QBU A;  1JWW A;  1SJR A;  2LDY A;  3GIJ A;  4LF4 F;  5DDP C;  4ILL A;  3SSR A;  3KLV A;  3CIZ A;  4M5J A;  3GYX B;  1BLU A;  4I69 A;  1SH2 A;  3BF4 A;  2R8H A;  4MIB A;  4MK9 A;  3V81 B;  3MXH P;  2R7U A;  1NK9 A;  5T41 A;  4F3Q A;  1FNO A;  2ZD1 A;  1RQ0 A;  1RHM B;  4QWB A;  3CED A;  5JVH Q;  3W65 A;  2PFD A;  2VFR A;  2HHQ A;  3TJ9 A;  1VQ5 S;  3UCU P;  5MAO A;  1EP4 B;  1FK9 A;  1QSL A;  5DDQ C;  5K8O A;  2XY7 A;  3R5C A;  4LF6 J;  4CRJ A;  1T11 A;  3QNW B;  1X9W A;  4B9U A;  5D4P A;  3MM6 A;  2QSW A;  3MPW A;  4OI1 A;  1D9A A;  2RU9 A;  3K58 A;  2C2K B;  4DUY J;  3NG8 A;  1FRH A;  2D41 A;  4WXW A;  4U7C A;  4DPO A;  1U25 A;  3JTO A;  3LH2 S;  4HTJ A;  4ZCK A;  5D3G B;  1TK5 A;  2GVD A;  4FP9 A;  4ZPA A;  4LFB J;  3CT9 A;  3SFG A;  4TU7 A;  3G86 A;  2IVF B;  4O4G B;  2BJ9 A;  3BN4 A;  3LUY A;  1YJU A;  4L73 A;  2QLB B;  4PWW A;  3RYL A;  5L1I A;  4DSK A;  2L3M A;  2KG1 A;  2AX0 A;  3MF5 A;  1K1Q A;  1WF2 A;  5H9F K;  4CTA A;  2CPZ A;  1UEU A;  3DLL Q;  2PEH A;  1P6T A;  3TWZ A;  3CMA S;  4X4Q A;  1UA1 A;  1N32 F;  1WOO A;  3CDA A;  4DV2 J;  4M5M A;  3I4H X;  4NZ0 A;  4QR0 A;  2A0F B;  1JNZ B;  4ZPB A;  4J9K A;  4DOZ A;  3BGL A;  2MY7 A;  2RQM A;  1QJH A;  3I31 A;  2VQE J;  2EFP A;  3CJ8 A;  1PGZ A;  1C2P A;  1QSS A;  2UUA J;  4ERD A;  4Y28 C;  2V63 A;  1XMO F;  2Q43 A;  1T3O A;  1MMN A;  5FLX U;  1UTA A;  1V5I B;  1Y10 A;  2JHE A;  1U8S A;  4LSN B;  2K8G A;  2N3L A;  4PXD A;  2GW8 A;  2W2N P;  5ETV A;  4PG8 A;  1XBW A;  3T5L A;  2HWT A;  2IPO B;  2KKH A;  3D66 A;  1X4B A;  1SJ4 P;  5AE1 A;  1PCA A;  5HL7 Q;  2CQI A;  3VWS A;  3M9N B;  4DXL A;  1WTF A;  1HNI B;  1R27 B;  4NCA A;  1U24 A;  1RT6 B;  2YWF A;  4G1Q B;  4I7F B;  4ZN1 A;  2R4F A;  3NXZ A;  4KTQ A;  2WOM B;  4HTI A;  2JX2 A;  3F56 A;  4DV0 F;  4AL6 A;  4DR4 F;  3KK3 B;  3E01 B;  3LO3 A;  5K20 B;  2J76 E;  1YJW S;  3IRX B;  2UUC J;  3HF5 A;  4TYB A;  2MZQ A;  5GMK a;  5E0O A;  3TQE A;  5HMX A;  2ZJQ Q;  3LA0 A;  3UD4 P;  3KK2 B;  1X5T A;  2ROG A;  2V34 A;  3IRX A;  2VOO A;  2JEI A;  2B8Q A;  2ZZM A;  2IBK A;  2MQQ A;  3AQO A;  2B9E A;  1TMJ A;  2VJU A;  3MM5 A;  2JDJ A;  1L3U A;  1A9N B;  3SI8 A;  4DL2 A;  1WD6 A;  3C6T B;  4PR6 A;  2E44 A;  4IYQ A;  1B0T A;  5HO4 A;  4ZJQ A;  3N9U C;  5FII A;  1RKJ A;  2CPH A;  3W9I A;  4K4Y A;  4I2Q A;  3Q8S B;  6FDR A;  2YH1 A;  2H65 B;  1CC7 A;  1OYD A;  2MKJ A;  2HVH A;  5AJ3 J;  2WSC C;  3G6Y A;  2GO9 A;  4ED8 A;  4DR4 J;  2WCX A;  4ETX A;  3LP0 A;  4I1T A;  3PXG a;  3C6U A;  3PW2 A;  2QTW A;  4QIW D;  3KLH A;  3PEJ A;  5IOL A;  2YPY A;  3QIP A;  2ALY B;  4K4W A;  3RZA A;  1EIY B;  1B0P A;  1X4F A;  4EZ6 A;  1BD6 A;  2YQ1 A;  4LT6 A;  3KWM A;  2MJN A;  3IG1 A;  4V1A k;  1FFW B;  3U1M A;  2P6T A;  1YX2 A;  3OR1 A;  3TRG A;  2C3M A;  3H4B A;  4DQS A;  3BYR A;  4LF8 F;  1RAF B;  2WVD A;  5HAO A;  3K5N A;  2BW7 A;  1DTQ A;  2Z2L A;  3JSR A;  4HHJ A;  1O51 A;  3D9B A;  1NKE A;  5D0G A;  1NDP A;  3PKY A;  3W2W A;  3OL9 A;  2J7K A;  1T0T V;  1C1C A;  2IBO A;  2MKC A;  5HVG A;  5E41 A;  3RBD A;  1IWA A;  1P1T A;  1MML A;  3IA0 A;  5HN0 A;  6FD1 A;  3I55 S;  3V6H A;  2WOM A;  3FCH A;  3OJS A;  1A0O B;  1RT1 A;  4E0D A;  3NMR A;  2F40 A;  2XY6 A;  4ZLJ A;  2O01 C;  2B43 A;  3CUL A;  2QLJ B;  3J7A N;  3KMS A;  1LWF B;  1RBL A;  2XMW A;  5CAA A;  5HP1 A;  2UXB J;  1FE4 A;  1FE0 A;  1JK9 B;  2C42 A;  2V8P A;  3NGS A;  4NYP A;  4LFC J;  1HWJ A;  2V9K A;  5CYM A;  2LMI A;  2ZH7 A;  3CCU S;  1KQS R;  2PEB A;  3DYA B;  2XMJ A;  2MQL A;  4B9M A;  1Q8K A;  5IT9 U;  2IDL A;  4USW A;  2I1R A;  1KOH A;  1UAW A;  3NCQ A;  3DLK B;  3SQG B;  3TO8 A;  5HQM A;  2D9P A;  1S4F A;  2CPJ A;  4ZIV A;  3G96 A;  4ECS A;  1HR0 J;  2KHD A;  2X1B A;  1H7X A;  3FZ2 A;  1ZTT A;  5HMZ A;  1NH8 A;  1I5O B;  1GXU A;  2DIU A;  2ASL A;  2FY1 A;  2HFS A;  1S10 A;  3VTI A;  4JI5 F;  2E5I A;  2HLU A;  4LF6 F;  1UPP A;  1AA1 B;  4TQS A;  5F3Z A;  1RHU B;  4NPO A;  1N33 F;  1TK8 A;  1NLK L;  2LU2 A;  1J5O A;  2ROP A;  3RBZ A;  1IQZ A;  3DOK B;  3QAE A;  2H5E A;  4MKA A;  4MKB A;  1FO1 A;  4LRC A;  1MU2 B;  3VAK A;  1REG X;  2HHX A;  2KYZ A;  2Q6C A;  4OZ0 A;  2NXC A;  1EQM A;  2I5J B;  4WTY A;  4RO0 A;  4F26 A;  3G8S A;  4DBQ A;  4JI0 J;  1OO0 B;  4OYX A;  4RW6 B;  4W98 A;  1KHV A;  4YB6 A;  5ETO A;  2OJ3 A;  2E7W A;  1Z2L A;  4USJ C;  4X64 F;  2IHR 1;  5FDL A;  4GKJ J;  3VGU A;  5GMD A;  2POK A;  2PE8 A;  3KUE A;  2COL A;  4HHU A;  1RTZ A;  2QYC A;  4WXO A;  1UWA A;  3V6D A;  2HZA A;  1LW0 A;  4OYP A;  2AEJ A;  1HBN A;  1S6P A;  4LIR A;  5EUH A;  4IG0 B;  4WU3 A;  3L3C A;  2W2Q P;  1WG5 A;  4XAK A;  5A8W A;  1HQ2 A;  5IS2 A;  2JNJ A;  5IWA F;  2G4B A;  3BKF A;  2GHV C;  3CD0 A;  3K2Y A;  1M5K C;  2OMO A;  3CGI A;  2ZOG A;  2UVW A;  2LA4 A;  1VLY A;  3Q8Y A;  4NLY A;  2AU0 A;  4QPT A;  2PI4 A;  1NJY A;  2NZ4 A;  4DL4 A;  1VJQ A;  3UO0 A;  4B9N A;  2UXC F;  4ZVP B;  3VGV A;  2GV1 A;  4OZ3 A;  1TKD A;  1JJC B;  1Q8B A;  1S1X A;  1RTH B;  2NUU G;  3NLC A;  4I6W A;  4NLD A;  3ZTR A;  4R8U B;  2QMX A;  3C14 B;  3W64 A;  4UQT A;  2QA4 S;  2YKP A;  3ZC4 A;  3H5Y A;  1XJW B;  4YR0 A;  4ED6 A;  5A8R A;  3MCN A;  2IYI A;  3CE8 A;  4JI2 F;  4DR6 F;  2VU5 A;  2DGQ A;  1X0P A;  2YPZ A;  4ZA1 A;  2JJ4 D;  1YWX A;  2VD3 A;  3AJD A;  4I4B A;  3W2V A;  2R9L A;  2V8D A;  5CZV A;  2CQD A;  3TOQ A;  1RT2 A;  3MM7 B;  3IMQ J;  4C3L A;  1F0X A;  3SCI E;  4CQ1 A;  3TZY A;  4A48 A;  2DVI A;  1S6P B;  2W9A A;  5JMN A;  1RGV A;  2DNK A;  4JP8 A;  2MY8 A;  2RT3 A;  2FHJ A;  4QR1 A;  2GO8 A;  4WE1 A;  1TUV A;  4FS2 A;  2CNL B;  3HSJ A;  4ZP6 A;  1U49 A;  1N5Y B;  4YDX A;  3PO5 A;  2CJA A;  3EXY A;  4X4N A;  2K2P A;  2ZBC A;  3BZQ A;  3FVY A;  1U1N A;  3X3U A;  5B0B A;  2VAS A;  4QU7 A;  2WZ1 A;  2XG8 A;  2GJI A;  3GR0 A;  4DR6 J;  4LF7 F;  2FHK A;  1X5P A;  1Q81 T;  2AKW B;  2CJY B;  2YKM A;  3N28 A;  1R0C B;  3PJW A;  1WF0 A;  1J2V A;  2BAB A;  3EVM A;  3QO9 B;  4GO5 X;  3U1L A;  3M30 B;  4F25 A;  5J2M B;  4LRA A;  4RR5 A;  2Y1J A;  3MD3 A;  1IVZ A;  2X7I A;  1U1P A;  1FRJ A;  1FRI A;  1D8Z A;  3H5S A;  3KYL A;  3PW0 A;  1FCA A;  1YRX A;  2FGC A;  4CLT A;  4NXN J;  1R8C A;  4RW4 A;  4KGV B;  1ZTW A;  2RAQ A;  4O23 A;  5E3R A;  2HHS A;  1YRT A;  2UUT A;  2FLP A;  1X4H A;  4RLE A;  4O3O A;  1U2F A;  4F4X A;  5C42 A;  4ZVU B;  2AYG A;  2E1M C;  1XC9 A;  2BOA A;  3BGU A;  2YBV A;  1Q8I A;  3MMC A;  4J91 A;  4DU7 A;  3GII A;  1RT1 B;  4MKV A;  2U1A A;  2FVP A;  2YNH A;  2R2S A;  3ZZP A;  3HK2 A;  2HHT A;  3DYA A;  1UET A;  5ADZ A;  5AXK A;  1VFJ A;  3ISN C;  2HRY A;  3UCZ P;  3CJQ A;  1SB6 A;  3DC2 A;  4LRB A;  4JV2 A;  1R43 A;  2YNI A;  4RNH A;  3Q8P B;  1NJI T;  4B9T A;  3OSN A;  2OTL S;  2PMZ D;  1DFD A;  2D7S A;  2F65 A;  3EZO A;  1NKC A;  1KLM A;  2NCK L;  2DNO A;  2KL8 A;  2XUL A;  3VGT A;  2W9B B;  1U1M A;  1N33 J;  1RBA A;  3HCX A;  3L7P A;  4P10 A;  4LBP A;  2ZH8 A;  2NXU A;  1SUQ B;  3AD7 C;  1BQN B;  2DXE A;  2P8I A;  2YVS A;  3U02 A;  1KQF B;  4KHP J;  2VBW A;  4EYH B;  2AF6 A;  3FBB A;  1HWI A;  1U1K A;  5HBM B;  1NB2 A;  1RHK B;  2MPU A;  2B51 A;  4YR3 A;  2ASJ A;  2OPR B;  5I3U B;  2V9W A;  3AB4 B;  1Y5N B;  1RAD B;  4H4K A;  4KFB B;  4OZN A;  1RT7 A;  3UQS A;  5KT5 A;  2QIF A;  3W3S A;  1RIS A;  3QT6 A;  1IBL F;  1I1G A;  4HAC B;  4KRW A;  1IN0 A;  2VPX B;  3VV2 B;  1GAO A;  3D67 A;  1SKS A;  4PXC A;  1F5A A;  2I9S A;  4QIG A;  2XO6 A;  5DGA A;  3R8Y A;  2BA9 A;  5ETK A;  3DGV A;  1RTD A;  2UVV A;  3DRY A;  1X4E A;  3PM9 A;  3C15 A;  2ZEJ A;  2VPZ B;  1FES A;  2QT7 A;  5HMW A;  4X64 J;  1HNZ F;  2E7X A;  2V4Q A;  4Y2K A;  1KLM B;  3LAL A;  3S1T A;  3W5Z A;  1PIL A;  4Q45 A;  4PWD A;  1RAH B;  4B3R F;  4ANC A;  3ZZ0 A;  3GV7 B;  1ZH5 A;  3MWB A;  2H9Z A;  4RNN A;  3SBM A;  1FER A;  3OTO J;  1Q53 A;  3WDO A;  3FC9 A;  5DG7 A;  1WOS A;  3QBC A;  4X66 F;  2HHH F;  3A8J A;  4MFB B;  3HLU A;  4K2J A;  1H6K X;  3FK4 A;  1ACM B;  1U02 A;  4YHH F;  3K5L A;  3K0J A;  3OD2 A;  1UL3 A;  1NJZ A;  3M6V A;  2HKE A;  2L9D A;  1FA0 A;  1QE1 A;  1BXN A;  3OV7 A;  2G1H A;  1F1B B;  2R7W A;  4IRK A;  4DPY A;  4CZC A;  2V8V A;  4LVN P;  2IM3 A;  3ITH A;  5E7O B;  3HZG A;  1TUG B;  1WEY A;  3PIO Q;  1Q7L B;  2NUH A;  1RDR A;  3BYP A;  3GU0 A;  3MOZ A;  4URS A;  1TVR B;  2Z8Q A;  2LQ8 A;  3GSI A;  3IS9 B;  1PYO B;  5HBM A;  1ZET A;  4ZOS A;  3TAQ A;  2HQG A;  5KG7 A;  4N8O A;  1VQM S;  3AD9 C;  4MTP A;  4ZK7 M;  1JLQ B;  3PYG A;  5F8I A;  4B3S J;  1RTI B;  2L9W A;  2OEK A;  1FX4 A;  2HWI A;  2APO A;  5IM0 A;  1JX4 A;  4Y65 A;  4CTA B;  5CD4 A;  3SXL A;  2XGQ A;  2ATL A;  1FWK A;  1Q5V A;  1RAA B;  3CF5 Q;  4F02 A;  3RB4 A;  2ACM A;  2YKA A;  4ZVS B;  2JZ5 A;  3BSA A;  4MIA A;  3AFG A;  2ZH4 A;  3TQ1 A;  2RUG A;  3CCW A;  5KFN A;  2X1G A;  4ED3 A;  2CKW A;  4J9N A;  3MFH A;  4DX5 A;  4M63 A;  4FZV A;  3GV8 B;  2KHC A;  5KFW A;  2FJD B;  5KG2 A;  4JI6 J;  5B09 A;  2HFZ A;  3LQV A;  2RKI B;  2A6M A;  3OTB A;  2ZC4 A;  4WP8 A;  1VQL S;  1VIS A;  4O3S A;  2OGU A;  5K9F A;  1P8G A;  4JV5 F;  3DHW C;  4KH1 B;  3W60 A;  4WP9 A;  8ATC B;  4PWD B;  3ZTP A;  1U0H B;  1VQY A;  4DSF A;  2ZBP A;  1HA1 A;  3HKZ D;  4LF2 A;  2EFG A;  4ZLP A;  1R8A A;  2XS2 A;  1LOU A;  4CH0 S;  2J0W A;  3MUT P;  4CM0 A;  2HG4 A;  1HWU A;  1NU4 A;  3ENV A;  1VJW A;  2DKO B;  4RWX A;  1AW0 A;  4ID5 B;  5KFA A;  3CCL S;  2XQC A;  4NCB A;  2MDA A;  1UWB A;  1YK9 A;  2ZM6 F;  2XO7 A;  1TV6 A;  3MED B;  1CLF A;  1NPK A;  1QY7 A;  2YX1 A;  1QAY A;  1UWB B;  4M5L A;  3D6T B;  2GJ2 A;  3GMG A;  2MQM A;  3RB0 A;  2IC3 A;  3CDW A;  4PAA A;  4F4A A;  5B0F A;  3FEZ A;  2FHO B;  2IJN A;  2DY9 A;  2NXN A;  1KKH A;  4USV A;  4WFZ A;  3MPU B;  5KOW A;  2ZVS A;  2C3P A;  1MN9 A;  2DGX A;  2IM1 A;  2LVW A;  4ZHR B;  2E5H A;  1W7W A;  3QJL A;  3M1V A;  1IBK J;  5F0U A;  3S6E A;  4LF7 J;  2PD1 A;  1TKT B;  2LEP A;  4OLO A;  4M1K A;  3T9N A;  2J5A A;  2CXE A;  4C2M A;  4U9R A;  2YTC A;  1LK5 A;  3MI7 X;  4RNM A;  1KDN A;  2O66 A;  4K4U A;  3SDE A;  2XHW A;  3I0S A;  1RWN B;  1OPZ A;  2W9C A;  4W4M A;  1VCT A;  1VIX A;  4LQ9 A;  4HAC A;  3HHL D;  3NY0 A;  5ETR A;  1KC8 T;  4OHY A;  4L3N A;  1HNV B;  2PMW A;  3J7Y I;  4AL7 A;  2C2E A;  3D1Q A;  3KLE A;  4K4X A;  3D3C J;  1RT7 B;  4EO8 A;  5EWF A;  3TW0 A;  2WAQ D;  1VC5 A;  4DFJ A;  2U2F A;  1RTJ A;  4TKT A;  3HPO A;  2H51 B;  1FRX A;  3KG4 A;  3M6U A;  4OZ2 A;  3HJV A;  2Z56 B;  1NBE B;  4JI2 J;  2AJ1 A;  3W63 A;  3QWU A;  3D7S B;  3OUY A;  1NSA A;  4ER8 A;  1PKU A;  1RU1 A;  1YZ6 A;  4OJ1 A;  1T02 A;  3VAG A;  2JVR A;  1Q5Y A;  1GNK A;  2BE9 B;  3ENQ A;  3DXS X;  4RUC A;  3VF0 B;  2Q6B A;  4AL5 A;  1FJC A;  5DG9 A;  1G6B A;  2HFV A;  4DFP A;  4DN9 A;  3D5M A;  4DG1 A;  3P96 A;  2PN6 A;  3OPK A;  4CLL A;  3CIM A;  3MUV P;  1QLN A;  1X4C A;  5HLF B;  1JLE B;  2UXC J;  2BBE A;  2PDA A;  3OSP A;  4TLR A;  1JXL A;  2NPI A;  3M2V A;  4V19 J;  2LXU A;  5F9L A;  2BOP A;  2QMU B;  3P45 B;  4Z7Y A;  3M32 B;  2WVC A;  2OPQ B;  1EAR A;  4DUT A;  2HNY A;  2YH0 A;  4O3R A;  1DAR A;  2CVE A;  1TL7 A;  4C3K A;  5LJ5 Y;  4WZQ A;  2LXF A;  1XER A;  3CD5 A;  4CLK A;  1H2T Z;  3G82 B;  4DSL A;  3TP2 A;  2I6W A;  4U6P A;  1ZBT A;  3M05 A;  4ECR A;  3CC7 S;  4B3T F;  2ATC B;  3IR6 B;  4ZVE A;  5KT2 A;  3ZZR A;  2LQJ A;  4O0I A;  3BGO P;  4NLO A;  2DRD A;  3G82 A;  2DNP A;  3NOG A;  2DR6 A;  5I4M A;  4XK8 C;  4QWD A;  5B0A A;  3H5X A;  1TU0 B;  4IFY A;  3N5B A;  1NUE A;  3VR1 A;  5HRO B;  2DGS A;  2GZO A;  1GQE A;  1HFE L;  3BR9 A;  2EK6 A;  1PBU A;  4EI2 A;  5L9N A;  2KZZ A;  2MXY A;  4UST A;  5B0C A;  4UOG A;  3WX8 A;  1UW4 A;  4H4O A;  3GTY X;  4FVC A;  2KT5 A;  3IBW A;  2NSB A;  1OY8 A;  1XWL A;  3CD7 A;  4OZL A;  5C24 A;  3THP A;  1V9O A;  4N5S A;  3PX4 A;  2ADC A;  2GA7 A;  4WZM A;  1CJK B;  1D0E A;  4ENO A;  5B0D A;  3UDE A;  2XCA A;  2VOD A;  3PHE A;  2GNK A;  2PA8 D;  1FFG B;  4QJV A;  2FLO A;  4HVZ A;  1PYS B;  2XMU A;  1FT8 A;  2WVE A;  4O44 A;  4C8M A;  3WQP A;  3C46 A;  3OUY B;  5F0W A;  4J9O A;  1N56 A;  1RXO B;  3KJV B;  3E01 A;  2KTQ A;  5E33 A;  2FUG 9;  4CLW A;  2QYG A;  1HBU A;  1HYS A;  2W2P P;  1N36 F;  2BKN A;  4RW8 A;  4QOT A;  4LQ3 A;  4UZC A;  1VLO A;  1HD1 A;  1SUQ A;  1Y3K A;  2XWX A;  4I7F A;  3GYG A;  4Q43 A;  1VBZ A;  4K4Z A;  2XSF A;  3SQO P;  2BJD A;  3DRS A;  2B7B B;  3MOJ B;  1J27 A;  1S0O A;  2DIT A;  1QVG R;  1CSJ A;  4DSJ A;  1PAE X;  3M8Y A;  3KMQ A;  3NWR A;  1GMV A;  1PIE A;  5HLF A;  3G2X A;  5FJ4 A;  1NZ8 A;  2ZKU A;  5IC6 B;  1TL7 B;  2D69 A;  2V2Z A;  1R6V A;  2QE5 A;  2C3U A;  3H2U B;  4Y2M A;  1HQU A;  3KOA A;  1QTN B;  3TNV A;  1CQN A;  1Y00 A;  1TV6 B;  1VDH A;  4YB7 A;  4CO3 A;  3MR3 A;  3CJ0 A;  1BQM A;  2RUS A;  3TR5 A;  4DU8 A;  5C42 B;  4IQX A;  1BGX T;  3A4T A;  1BC6 A;  5H9F J;  3G6V A;  2ERR A;  4PQU A;  1SQG A;  1A7G E;  2K1R A;  2F1F A;  3EPI A;  1RAC B;  4I56 A;  4CCH A;  4I6A A;  2IMO A;  2VG6 A;  3K17 A;  1PSD A;  4WTO B;  3IWL A;  2R7T A;  2EFN A;  4RUH A;  3FFI B;  4RBU A;  4CO2 A;  3D68 A;  4IG0 A;  3JYT B;  2FYX A;  1HNX J;  1FDB A;  2YNI B;  2YX7 A;  1U1R A;  1UJ5 A;  1XNR F;  2J7U A;  4DMZ A;  2DTJ A;  3ZZT A;  1S97 A;  5EWG A;  1KTV A;  2JFD A;  2WVF A;  3CSK A;  5GAH U;  1TKT A;  4DV5 F;  3LW5 C;  3NNC A;  3KLF B;  1YGY A;  2GJF A;  4M5G A;  4B17 A;  4CP5 A;  1JJ4 A;  1U0S A;  4XPE A;  2HRU A;  2DNM A;  2KXH A;  3ET6 A;  5KFT A;  3VVT A;  3BSC A;  1S1V A;  1U2R A;  4Z37 A;  5L1K A;  3BQ2 A;  1NEE A;  2QRR A;  1X5S A;  3QQC D;  1KQK A;  3NGR A;  3SCK E;  3ZZZ A;  1ELO A;  1NHV A;  1ROF A;  4YN3 B;  4FYY B;  1HBU B;  1WHV A;  4DSI A;  5GAE U;  2MYF A;  3Q2S C;  4C0O C;  2EPI A;  3DMJ B;  3UDL A;  3AOD A;  4IQM A;  4O3P A;  2V6A A;  2A6O A;  3FCW A;  1HBO A;  3RG6 A;  5DRK A;  1VBY A;  1O8B A;  4IDK B;  2AYB A;  4IRC A;  1KOO A;  3A8I A;  1O6X A;  2FC8 A;  3ZTO A;  2FGO A;  1N34 J;  5L9X A;  2XMK A;  2FLL A;  3IAS 9;  2B5J A;  4NL5 A;  1T05 B;  2OKQ A;  3LP1 B;  1K1S A;  3BRE A;  4LR8 A;  1C1B B;  4JI6 F;  4B3S F;  3ILJ A;  1TFY A;  4JYA F;  3G6X A;  3KHR A;  2OH2 A;  5CYM B;  4RU9 A;  3R2C J;  1VHF A;  4FYD A;  3TJA A;  2MHN A;  1WHW A;  4IUF A;  1P9Y A;  4OHW A;  5I3P A;  3GR1 A;  4G6V B;  4NML A;  4OX9 J;  1HQU B;  2BQ3 A;  3BPS P;  3ADA C;  2M52 A;  1RT5 A;  2HMI B;  3K89 A;  2KFY A;  2AIR B;  3H20 A;  3BH7 B;  3H40 A;  2R7V A;  3DCA A;  5RUB A;  1UA0 A;  4DL6 A;  2AX1 A;  2RH3 A;  2VZ9 A;  3MAA B;  4HH0 A;  1WNE A;  2RE1 A;  4WFB Q;  3O6Q A;  4NA2 A;  3M6W A;  2CWX A;  1CS4 A;  2UXD J;  1DJ0 A;  4ELU A;  1FRM A;  4QPX A;  1FX2 A;  4YB5 A;  5CYJ A;  3L4B C;  4J90 A;  2ZUG A;  3A1Y G;  3J81 U;  1OY9 A;  1U47 A;  4DV2 F;  4ID8 A;  4C8O A;  2R42 A;  4P2M A;  1E6V A;  1KVI A;  2QEX S;  1LFP A;  5F3T A;  5KG1 A;  1NKB A;  4DWI A;  1QAJ A;  3HSD A;  1IBM J;  4RW7 B;  2CDQ A;  4ICL B;  1DQA A;  3M8W A;  2GQ2 A;  3QAU A;  3T6J A;  2BW2 A;  1RYS A;  1XMQ J;  2HFU A;  2A18 A;  2ZNZ A;  3ICL A;  4KO0 A;  4CT9 A;  1RAB B;  5CCL A;  5J2P A;  1RWP B;  1RAE B;  2GGP B;  2Y1R I;  4A8O A;  4ES3 A;  3N4W A;  4KH0 B;  1EET B;  5KT3 A;  3QGG A;  1LWC B;  1S9E B;  1EP4 A;  1FTC A;  2GMH A;  3TA0 A;  3ZZO A;  3PJ9 A;  5IM0 B;  5J2P B;  4ECW A;  2AGQ A;  2HQD A;  1HBN B;  1DLO B;  2CPE A;  2DGT A;  1FJE B;  2QA4 G;  3UN3 A;  2XCP A;  1YIJ S;  3UWT A;  4EU0 A;  1Q82 T;  2ZD1 B;  5CH7 B;  2HQC A;  2WK4 A;  2Z57 B;  2QMW A;  3F0N A;  2B0G A;  4Q2L A;  1SQF A;  4P73 A;  1UFW A;  1IKX B;  1VQP S;  2V4J B;  4NX9 A;  3AXK A;  2ZZT A;  2CG8 A;  2WSE C;  3DLG B;  4BCA A;  1RHQ B;  3JQK A;  3CJK A;  1HQE A;  2VC0 A;  4ED1 A;  2EFQ A;  4NZ7 A;  3SFU A;  4X66 J;  4UZB A;  2KYX A;  4OZ5 A;  1TTH B;  4QYR A;  1WEL A;  3H42 A;  4JI1 F;  2CQ2 A;  4KV8 B;  3E2E A;  2J8S A;  4EMD A;  2KRB A;  4B3O B;  3D6H B;  3VQT A;  4ZLN A;  3SCJ E;  1WUU A;  2LFV A;  3MEC B;  3K5M A;  5C2C A;  4YR2 A;  4CH1 A;  1M5V C;  2NQP A;  5EX0 A;  3B82 A;  2BAN B;  2YWG A;  2KB2 A;  1JMT A;  3HVT B;  3KLI B;  5LT5 A;  4ETZ A;  4JI4 F;  3R1H A;  3KHG A;  1CUL A;  4K0K F;  5B7W A;  2UVU A;  2CQH A;  5G0R A;  5EHH A;  4KPY A;  4WBF A;  4NLV A;  1D09 B;  1MLA A;  2PII A;  1SPB P;  3MMJ A;  2VG7 A;  3R7S B;  2W4P A;  3LP2 A;  3THV A;  1UVJ A;  4KHP F;  3M8R A;  1OQ6 A;  3A8K A;  4ZCI A;  3HX9 A;  3MEG B;  1W26 A;  4O4R A;  1QAI A;  2VON A;  2I2Y A;  1JXE A;  1UZD A;  4EK2 A;  5HQL A;  2V8G A;  2YWE A;  3LP2 B;  5HJX A;  3R3T A;  4WFX A;  5B0G A;  2MZ1 A;  4OI4 A;  2M88 A;  3UW1 A;  1U4B A;  2GVZ A;  3FRZ A;  1K8A T;  3HJF A;  4QR2 A;  5CZX A;  2XBP A;  3BKT A;  2P6S A;  1N5Y A;  3K8W A;  2JVO A;  3TUJ C;  4BWJ A;  4AQY J;  5KAK A;  3UR3 C;  3TZW A;  1UMJ A;  3OL7 A;  2PO4 A;  2ZIT A;  2GIF A;  2ZBR A;  1VQO S;  4PYA A;  4Q5V A;  3PY8 A;  5A2Q Y;  1QD1 A;  3LAK A;  1WWH A;  1M5P C;  1FWP A;  3JSB A;  2P9C A;  4XO0 A;  4Q8F A;  2CPY A;  2LCW A;  2M7S A;  2RKI A;  3OVS A;  2EKY A;  2DXD A;  2MZS A;  3M2U B;  5T7L A;  3GFX A;  3T5H A;  3KK1 B;  2C28 A;  2EK1 A;  3MR6 A;  2EVZ A;  3CJK B;  1AT1 B;  3B78 A;  3IWN C;  1KFD A;  5KG0 A;  4YB1 P;  1LXN A;  3OHB A;  2YWW A;  2ZH9 A;  2V4J A;  3KJQ B;  4K59 A;  3AJ1 A;  4RWW A;  1X4G A;  2IJR A;  3MAQ A;  4KV8 A;  4X4R A;  1NDK A;  1WF1 A;  2IFX A;  4D3H A;  2G0C A;  3R5G A;  1S57 A;  3I6P A;  3PR5 B;  3CD6 S;  3ETO A;  5HQ8 A;  5CCM A;  2D3O R;  3MFI A;  2R8G A;  4PAB A;  1KFS A;  4QIV A;  2LKZ A;  5L38 A;  1UVM A;  3AJ2 A;  4TYA A;  1M90 T;  2X1F A;  2G9O A;  2IYG A;  4P2X A;  5LM7 E;  2HS0 A;  5D78 A;  3Q23 A;  1T8E A;  4IRD A;  4PWU A;  4I2Q B;  3WC2 A;  2KFN A;  2QL5 B;  1YI2 S;  3MM8 B;  4H4M A;  4MMO A;  2IMW P;  3G9C A;  1PG5 B;  2FDN A;  4OLP A;  3ELH A;  1HHQ A;  3RUB L;  2EC0 A;  1ZM9 A;  4C3M A;  4OI0 A;  4OYW A;  3T6B A;  3DRP B;  2Y1I A;  4L74 A;  1CC8 A;  1UPM B;  2Z2Z A;  4K8R A;  3VZI A;  4U8V A;  2CZ9 A;  2O67 A;  3NS5 A;  3PRB A;  3QT5 A;  4IG3 A;  4KGZ B;  4C8N A;  4DV3 F;  1IKY A;  2YKN A;  4UF4 A;  2XEX A;  3TEG A;  4EBE A;  3BBC A;  4DV6 J;  2GS8 A;  2W7A A;  1LK7 A;  4WWS A;  1S59 A;  5M2R A;  4YP3 A;  3Q8Q B;  1S9G B;  4ID5 A;  4PXE A;  2W9C B;  1HNW F;  1WJ9 A;  1VRU A;  2BJ8 A;  2H5I B;  2DNY A;  2IVM A;  4ZVG A;  5LSL A;  3JAM Y;  4LRF A;  2CPX A;  1DTT B;  2GGP A;  1GXT A;  1X4A A;  5GAD I;  5IXU A;  4XDD A;  4O44 B;  4OQJ A;  4O3N A;  2KO1 A;  3EVO A;  4H54 A;  3R27 A;  5HMY A;  3PFO A;  4F0M A;  2UV8 A;  3I56 S;  1RTH A;  4R8U A;  1S7I A;  3NMA A;  5DQG A;  1Z1Z A;  3LWM A;  3JXO A;  2C2O B;  3DRR B;  5DZ6 A;  1FEH A;  1LXJ A;  1C0T B;  3HMJ G;  3A3P B;  2HVI A;  2MKY A;  3GIR A;  4ZCM A;  3DOL A;  2GVD B;  3QFH A;  1E6Y B;  1TL5 A;  1X0F A;  1EJ7 L;  3EDQ B;  5B0E A;  3EZ5 A;  3OQ2 A;  4NLG A;  2R7O A;  4EO6 A;  2L9N A;  3IR5 B;  2RU3 A;  1JLC B;  3ZNJ 1;  2HS3 A;  1V3S A;  1JLE A;  1NK5 A;  2WB4 A;  5AXM A;  5KFE A;  2HUR A;  2M8H A;  1RTI A;  2H54 B;  4NLX A;  2G2Z A;  2OPR A;  3QMQ A;  4R25 A;  3U1N A;  4R5P A;  3MR5 A;  2AW0 A;  1X9M A;  4YEA A;  1B3T A;  4CWB A;  3WX4 A;  1IM6 A;  2OFH X;  4CO4 A;  2AYE A;  3MM8 A;  3N6N A;  2CUY A;  4H4M B;  1G7C B;  4EWT A;  4OV6 A;  1JLB B;  3BH6 B;  3CB4 A;  1RK8 A;  2GAH C;  2XSJ B;  2Z58 B;  3I32 A;  4KSE B;  4NLU A;  2EI5 A;  2XGP A;  2MB0 B;  4FYW B;  2VG5 A;  2HND A;  3QT7 A;  2IVY A;  1YJN S;  1IKY B;  2YKN B;  3M7V A;  3Q0A A;  3JYT A;  4K5R A;  1M1K T;  3CCS S;  1T9V A;  3V6D B;  3NAI A;  4DG1 B;  4N47 A;  1F3V A;  2VIH A;  2CQ0 A;  3GE9 A;  4KIA A;  2Y1L B;  4FBU A;  4C8L A;  4RW8 B;  3KLF A;  2XZW A;  3JSY A;  5FDL B;  5E3A A;  3EYZ A;  4ELT A;  1S9G A;  1A6L A;  1TR0 A;  2IIH A;  4IH5 A;  1HNI A;  4K4T A;  4DCO B;  1N6Q B;  5KFD A;  4A8F A;  2R2U A;  1TKZ B;  4BBY A;  1S77 D;  1FNX H;  4CM2 A;  3ENW A;  2J9E A;  3MM9 B;  4X62 F;  1TZ0 A;  3G8T A;  2CQB A;  4MAK A;  4FKY A;  3M8S A;  1VQ4 S;  4LF9 F;  1FJG F;  3MUM P;  1U6Z A;  1X31 C;  3I4P A;  1U26 A;  1VK8 A;  4C0H A;  2FIU A;  3VVU A;  2OHD A;  4K7Q A;  1K73 T;  3HHL A;  1PJ5 A;  2CNO B;  3HT3 A;  3I5A A;  2F5G A;  5ETN A;  4DV1 F;  3M9O B;  5BYS A;  1DRZ A;  2ZJR Q;  3NL0 A;  4K50 A;  3TVK A;  5CAB A;  1KNZ A;  2UXB F;  4YY3 F;  1W25 A;  5AJ3 F;  4IOB A;  2HNZ A;  4OZ1 A;  4IR9 A;  2BZ2 A;  2HAF A;  3ZZY A;  2W1B A;  3D0G E;  2W2M P;  3DLE B;  1MG7 A;  3K5O A;  3J7Y U;  2HW3 A;  2ADB A;  1TL4 A;  2CJB A;  4LR7 A;  2DRA A;  3DGP B;  5D0E A;  1GXL A;  3I87 A;  4HL9 A;  1FKO B;  1H2U X;  1VRQ C;  4MYU A;  1N88 A;  1S1T B;  3W7B A;  3HVR A;  3QRR A;  3E8O A;  3G4S S;  3NP5 A;  1NME B;  3F44 A;  4LF8 J;  4NLS A;  4MH8 A;  4PEO A;  2MQP A;  3J81 j;  4XDC A;  2LEA A;  1T03 B;  1RTD B;  3DLB A;  1WC0 A;  4UTG A;  1FEE A;  2H3E B;  2ZHA A;  5J2M A;  1CQM A;  1HKA A;  2GIQ A;  2HIY A;  3WC0 A;  3ILO A;  4IFV A;  4J9P A;  3GON A;  4DV0 J;  1BE4 A;  3HVA A;  1RT3 B;  2GIR A;  1FVQ A;  3HHL B;  4JOU A;  2J9C A;  3DRP A;  4F4Z A;  4QYZ J;  3T19 A;  2LP4 A;  3O5T B;  1MWZ A;  1F3F A;  1JQG A;  4OL8 A;  1HQE B;  5K8N A;  1X7V A;  2OUG A;  2BVZ A;  2BEF A;  2QFI A;  3DI6 A;  1WSR A;  1JLQ A;  2HBR B;  2CJX B;  2KRR A;  4ICL A;  5SUH A;  4CO1 A;  4RW7 A;  1R6Y A;  2YKQ A;  2BAC A;  2F9D A;  2RNE A;  4NA1 A;  5C25 A;  1NRK A;  2EKN A;  1TKZ A;  4ZDN A;  2CJ9 A;  1KTQ A;  1R8H A;  4JV1 A;  1EET A;  4N56 A;  1UJ6 A;  4ZS6 A;  4PG5 A;  1S72 S;  1VR6 A;  1HD0 A;  1XEZ A;  3LP0 B;  3DKD A;  2DBB A;  3P5B P;  2YWH A;  3KK2 A;  2E5L J;  4JI3 F;  1XNQ F;  3ZZU A;  3D2W A;  2UUB J;  3SEO A;  2AJQ A;  3L9Z A;  2IRY A;  2AP6 A;  3AY0 A;  1KON A;  3IP0 A;  3KDN A;  4KO0 B;  4ZN3 A;  1Q1K A;  1WG4 A;  3DDN A;  4CH7 A;  2BQU A;  1VHI A;  4MK8 A;  1TEL A;  5KFJ A;  3QYY A;  1T03 A;  4USH A;  4F67 A;  3QSI A;  1CPZ A;  3M2R B;  1Q78 A;  1LNQ A;  4NE9 C;  2X1A A;  1KD1 T;  1PJ7 A;  4CIO A;  2HK3 A;  5KFB A;  2DCU B;  2SXL A;  2E1C A;  3RW7 A;  1SJ3 P;  2UU9 J;  1DQ8 A;  3ITH B;  3N79 A;  1BWV A;  4O4G A;  4KKO A;  2HAI A;  2M70 A;  2WB1 D;  4OZJ A;  3JSM A;  2JEJ A;  3KTQ A;  4BWM A;  2J0Q D;  3F73 A;  3GSD A;  3V4I A;  3D54 A;  4NLW A;  5ITH A;  1RWW B;  1UJ4 A;  2OFG X;  4MYT A;  4WFY A;  3PYE A;  2UU9 F;  4DS5 A;  1Z4U A;  4E8U A;  3W62 A;  4AFF A;  4ECY A;  3VCD A;  2F8M A;  3H2V E;  1LEO A;  2VH7 A;  5BJR A;  2VA3 A;  3RR8 A;  2NSC A;  2P2C B;  2YKO A;  3HKW A;  3BDP A;  5KFF A;  3MMB A;  2DNQ A;  1T9T A;  3B8H A;  1NSP A;  3VAI A;  4LFB F;  2VUG A;  3ONQ A;  4KHR A;  1LWC A;  1P1L A;  1S9E A;  2WBR A;  5KT4 A;  1Q8L A;  1P9Q C;  2MQO A;  1WTB A;  1N34 F;  1GTH A;  4ZLL A;  2JLE A;  3B4M A;  2Q3P A;  2NPF A;  3H0P A;  3LP1 A;  3MEE B;  1S4E A;  2ALZ A;  4DPW A;  1S6Q A;  1SV5 A;  3UVJ B;  4W90 B;  4KC5 A;  2C2M B;  1WI6 A;  3C19 A;  3PEH A;  2NXE A;  4C8K A;  3P6Y C;  3T1Y J;  3N6M A;  3DDK A;  4TVA B;  3M8P A;  4L3K A;  2YNG B;  4NLQ A;  5F8G A;  1Y5I B;  5A2Q U;  4DSE A;  3W8G A;  1U7L A;  2C22 A;  3AXM A;  4LF5 J;  2VJV A;  3IGN A;  4C9D A;  2FJB B;  1YBU A;  3BGF A;  3QLH A;  4CO0 A;  3V6K A;  4C6A A;  4Y0F A;  2EWH A;  3OFE A;  2ZUA A;  1JIH A;  1WDD A;  1F5C A;  1OSD A;  4OX9 F;  3N0V A;  5KFR A;  4F04 B;  4W92 B;  1XQI A;  5D6G A;  2ASY A;  1F60 B;  4DUY F;  4DUZ J;  2QZ8 A;  3NGD A;  2V2Q A;  2AGO A;  2QV6 A;  4HYK A;  4ALZ A;  2K1R B;  2HVE A;  1VBK A;  5KFY A;  4DV5 J;  1S1X B;  4NMX A;  3IBF B;  3PX6 A;  1FXL A;  2O1P A;  4LMZ A;  1YBT A;  4MJK A;  1AFJ A;  2Y3Y A;  5KT6 A;  2M4M A;  3PG9 A;  1HHT P;  3I0R A;  5BR8 F;  1DZ5 A;  1U48 A;  4KYZ A;  1YLX A;  4BLG A;  3US5 A;  4BC9 A;  3J7Z T;  4LVO P;  1WOP A;  1NHU A;  2E9T A;  2UVR A;  2J0X A;  2ZDP A;  4OJ3 A;  4J9M A;  2E5G A;  3AH6 A;  4OX8 A;  3VAF A;  4HKQ A;  2D3U A;  2MEW A;  2P9G A;  1SC3 B;  2ZNY A;  2B3T B;  2EXU A;  4ZPD A;  3OL8 A;  2R2T A;  2F4V F;  3MGJ A;  3O3L A;  2OPP A;  2ZH2 A;  4DR3 J;  4CLZ A;  3MR2 A;  1NO8 A;  1V3R A;  4P2S A;  4RKU C;  3MCM A;  4ZP7 A;  2YX4 A;  3QGI A;  1FRL A;  3UNY A;  4QZV B;  3RRG A;  2OML A;  5D0H A;  4M5I A;  3IR7 B;  4HHH A;  4YY3 J;  1KR4 A;  2EW9 A;  3KUH A;  2GMJ A;  3K7R A;  2ZHB A;  4AUK A;  3GJT B;  6AT1 B;  4DR2 J;  3MEE A;  4ECX A;  2UP1 A;  1U0H A;  2PT0 A;  3POT A;  3G6E S;  1EQ0 A;  3H7H B;  4I64 A;  4OYA A;  4B3M F;  1B4S A;  2VQE F;  1O5J A;  3R5D A;  3F41 A;  1WKK A;  2WW4 A;  3BGR B;  3HHK A;  4L6V 3;  3TJ8 A;  5J1P A;  4ECQ A;  2K3K A;  2ZVI A;  4QWE A;  3SV3 A;  1TKX A;  5IT9 Y;  1BY9 A;  3GCW P;  2VOP A;  1NPP A;  2VFV A;  3CJ5 A;  4N41 A;  1H0H B;  4IG3 B;  2BRK A;  4N7T A;  5C25 B;  1SL2 A;  2MKS A;  3PO4 A;  3R7N B;  1TAU A;  5CHC B;  4FKX A;  3PNI A;  3C6T A;  1UKU A;  2ZKT A;  3L7O A;  1TAQ A;  3OBI A;  1IKW B;  1R89 A;  4PKD B;  1REV A;  1H3D A;  2JOQ A;  3BS9 A;  3IM9 A;  4G1P A;  3R9L A;  3PVX A;  1T05 A;  4DZD A;  1VQS A;  2B6A A;  4FXW A;  1S48 A;  3DHX A;  4B3M J;  2G0J A;  1J5E F;  2HIQ A;  2PC6 A;  2PSZ A;  3FEY B;  1T94 A;  3LOU A;  3Q83 A;  3TA2 A;  4E2F B;  5AE2 A;  1FHT A;  3CXC R;  3C6U B;  3MPV A;  2KT3 A;  1F5B A;  1N5Q A;  5BYR A;  2EG1 A;  1SH3 A;  2HVD A;  1KBR A;  2HSE B;  3EVW A;  1S76 D;  2FC9 A;  3Q22 A;  2VDH A;  1UW9 A;  3MHY A;  5E5N A;  4DUZ F;  3BV8 A;  1HW8 A;  1HPZ B;  4N77 A;  1HL6 A;  3J80 U;  2AQ4 A;  1SKR A;  2JRS A;  2RJZ A;  3D3B J;  4FXD A;  3GIK A;  2QLW A;  2E66 A;  2BX6 A;  2V0N A;  3EGV A;  2GHP A;  1HPZ A;  3DDI A;  5GVQ A;  1WKL A;  3IM8 A;  1GK8 A;  3EMT A;  1V6H A;  4YDD B;  2FB0 A;  1H98 A;  2Z4P A;  4JUZ A;  3RJM B;  3O2I A;  3BO4 A;  5LMN J;  1H73 A;  1M0S A;  2D3Z A;  2YNH B;  3MDF A;  2XSJ A;  4KPC A;  2ABY A;  2ZE2 A;  2E9Z A;  2Q66 A;  2Y9H A;  5L39 A;  1I94 F;  4A8Y A;  4X4T A;  2HVZ A;  2RIL A;  4JV5 J;  1FD2 A;  1FF2 A;  4C0B A;  4RW4 B;  4YME A;  2F8H A;  2C3Y A;  3VAH A;  1NK7 A;  3AOA A;  1U8W A;  1WC5 A;  1ZA1 B;  2KN4 A;  1UVK A;  3QWP A;  2HQ3 A;  2KM8 C;  2R7R A;  1CBK A;  1PC4 A;  1RA6 A;  5KFP A;  1S49 A;  4ZVT B;  2WSF C;  2QLX A;  2Y0S D;  2NZC A;  4DX6 A;  3M9M B;  4LSN A;  3T5J A;  2J6U A;  3QO9 A;  3TVZ A;  1G3O A;  5D4N A;  2G1D A;  1D3W A;  1ZM3 A;  4LSZ B;  4ZKA A;  1J5E J;  3P49 B;  3PW4 A;  3TYT A;  2RHQ B;  1SL0 A;  4X65 J;  4WPA A;  4U67 Q;  3HXM A;  1Y9O A;  1PO6 A;  2L41 A;  2JH3 A;  3PR4 A;  4MFB A;  1QSY A;  1YIT S;  4LF5 F;  3AOB A;  4XPC A;  4C8Z A;  3EGW B;  2HK2 A;  2JLG A;  3T1Y F;  1HBM B;  4CLY A;  1C4A A;  1W2I A;  1SBR A;  1ARO P;  2K7J A;  1JXV A;  3MAA A;  1C4C A;  2DXF A;  3HVT A;  3KLI A;  4OHV A;  2W7P A;  3OW2 R;  2R8K A;  1HI8 A;  2H4Y B;  4J9U E;  1F9E B;  2B4U A;  1IJF B;  1N5T A;  1EKR A;  3MEC A;  1M5S A;  1D1U A;  3CPW R;  2RHS B;  5K14 A;  3CVK A;  4YHH J;  4ECU A;  4FVM A;  4WCE Q;  4RNF A;  4OYO A;  4NEZ A;  2CYY A;  3NBP B;  1SH0 A;  5C24 B;  4X84 A;  1AB8 A;  5KFC A;  1ZOT A;  5A8K A;  3EGN A;  2VG7 B;  2N82 B;  1IBK F;  1VRT B;  3OR1 B;  2MLZ A;  4O0N A;  1RWX B;  1GMW A;  2OPP B;  1CJU B;  2CZ4 A;  5HJY A;  4UQG A;  2PFF B;  2K7K A;  2G2O A;  4WYW A;  1RWK B;  1TFW A;  1KEK A;  1JB0 C;  2BKP A;  4ZJL A;  1HW9 A;  5BYQ A;  5GAE I;  2VHG A;  2RRA A;  1RSC A;  2GC8 A;  3QZ8 A;  1JLA A;  2P9E A;  3VGS A;  3Q2T C;  3RRK A;  2DPI A;  1Y0H A;  4ZIT A;  5A76 A;  2HZV A;  4DR7 J;  1JLC A;  4DQR A;  1H72 C;  2EFO A;  1U6B A;  2ZWP A;  2RRN A;  3TAM B;  2C2N A;  2HS4 A;  4LR9 A;  2WON A;  4UY8 5;  4DS4 A;  3RAQ A;  5IT4 A;  2PMH A;  3CCJ S;  5D3G A;  2RDI A;  1WG1 A;  4HLB A;  5GAH I;  2E5L F;  1AXQ A;  1UCN A;  3H8Y A;  3M2U A;  3KG0 A;  5K14 B;  4Y00 A;  3C8Y A;  1YTY A;  1CJV A;  3R5A A;  4KB7 A;  5KT7 A;  3MAH A;  2KH9 A;  3NNH A;  1S6U A;  1FKP A;  4B02 A;  2ZM6 J;  1RJJ A;  1T9Y A;  1NM2 A;  4DFK A;  2Z0G A;  2VG5 B;  1N5S A;  1URN A;  1FK9 B;  2FVS A;  2IC3 B;  4DV4 F;  2BXJ A;  2FJV A;  3A3N B;  4OJH A;  3H5U A;  1L5U A;  1R7I A;  1FXD A;  2CDR B;  2MKK A;  1TVR A;  2DK2 A;  3ILL A;  2JFK A;  4FDF A;  3UFC X;  1Y3J A;  2DCL A;  1G2E A;  2BJE A;  1RAJ A;  3UPF A;  4D3G A;  4USI A;  2DNN A;  1YG0 A;  3HM9 A;  3RTV A;  4K4S A;  1D9D A;  1WSV A;  3EE3 A;  2CPF A;  5KG3 A;  1T9U A;  5H9E K;  2CAD A;  3O8W A;  1FXR A;  2DO4 A;  1AYE A;  1RWM B;  1S1U B;  1WI8 A;  2B8P A;  4Q7A A;  2XS5 A;  1R3N A;  2WON B;  4LBI A;  1NPR A;  1PBA A;  4UY8 T;  5FLX Y;  1MW7 A;  3KLG A;  2HHW A;  2CG4 A;  4DLE A;  3LGN A;  1N54 B;  4DV7 J;  5ETL A;  3DOK A;  1UEV A;  4WK3 A;  3TA1 A;  1VIO A;  2GQQ A;  4I6Y A;  3Q24 A;  5LSR A;  3O1L A;  4ES2 A;  3OTO F;  2HBY B;  3CDU A;  3DMJ A;  1JLG A;  1X60 A;  1SJQ A;  2HZC A;  5KFX A;  3IGV A;  1NK6 A;  5T7L B;  4CDI A;  2DNH A;  5KFU A;  3R1L A;  3PKM A;  1NXI A;  1IR2 A;  2IAJ A;  2M2B A;  2OSR A;  4AXI A;  1NK8 A;  1S6Q B;  3QFW A;  3UVJ A;  1WAC A;  2B9W A;  3FJ2 A;  1U1Q A;  1YHQ S;  1URR A;  2G13 A;  3FBF A;  4AXJ A;  5I42 B;  1SV5 B;  2VA2 A;  4F36 A;  1IXK A;  2P5V A;  1QUV A;  4JB8 B;  2IDE A;  3B6B A;  4G3I A;  2N4D A;  3CJR A;  3ULH A;  1K47 A;  2VFT A;  4ZVF A;  1MMD A;  2DIS A;  3CMQ A;  3M2R A;  2HNY B;  3UD5 A;  3VAM A;  3D0I E;  4DV7 F;  1S12 A;  4RPF A;  2A2C A;  3NEK A;  2AEF A;  5EDW A;  1V3Z A;  2R3V A;  2XNQ A;  3MEK A;  2AGP A;  3KLH B;  3GP9 A;  2BRL A;  1IUJ A;  2RF2 B;  3E51 A;  4MKY A;  1SXL A;  2V68 A;  1BQN A;  4C7Q A;  3FRY A;  1TUW A;  2UUB F;  5I3Q A;  4EFA C;  3NGT A;  3NAH A;  1DBD A;  3CCM S;  3PV8 A;  2HEK A;  4KT0 C;  2HFN A;  2MGZ A;  5KFI A;  3GFZ A;  4EUV A;  3V4I B;  1FJ7 A;  3EGZ A;  3Q89 A;  4IFV B;  3CJS A;  2RVJ A;  3HHD A;  2DH9 A;  2LLZ A;  3I0R B;  5EX3 A;  2AV5 A;  1HIY A;  1DY3 A;  5J1N A;  4NLP A;  4A8M P;  2V94 A;  3DI6 B;  3S01 A;  4XIU A;  4Q2M A;  1NZA A;  3MM5 B;  4J37 A;  1LW2 B;  2RS2 A;  2AD9 A;  4M95 A;  4A46 A;  4Q8E A;  4X4S A;  3W66 A;  1SKU B;  1KP6 A;  4HI2 A;  1RAG B;  4HDG A;  3KLE B;  2ZH1 A;  3NCR A;  3RAM A;  3LTO A;  1OY6 A;  4J9S A;  4DI6 A;  2CIM A;  4P52 A;  4QWA A;  1SKW A;  5DLF A;  3C2P A;  4FF1 A;  4KR0 B;  4LRE A;  4L72 B;  4QCL A;  3M2V B;  2DH7 A;  2RB7 A;  3LAN A;  4DJB A;  3BPD A;  5KFS A;  4F2R A;  2HPU A;  1UEK A;  5DGB A;  2XB2 D;  1HWK A;  1RUS A;  4RBV A;  4TU9 A;  1HNW J;  4A47 A;  4QW8 A;  2N3O A;  1KWM A;  1NDC A;  1V5V A;  2VPW B;  5E3P A;  3OR2 A;  3KFW X;  3LPE A;  2Z2M A;  4RX6 A;  3G71 S;  3KK1 A;  5EWE A;  2YWK A;  1WDT A;  4MIW A;  3QIP B;  3FSX A;  1LWX A;  1M5H A;  3CO0 P;  3GJS B;  2VV5 A;  4P72 A;  4ZPW R;  3TX8 A;  4CLS A;  1AUS L;  3MD1 A;  1CJT B;  3GIM A;  3G87 A;  2ZH5 A;  1I94 J;  3RW6 A;  1RHJ B;  1BUX A;  3HHE A;  4ZMM A;  4P9S A;  3IXQ A;  2R8I A;  3OVB A;  3DLK A;  4OMF G;  3SQG A;  5I42 A;  3N01 A;  2BR0 A;  1SJF A;  2MLY A;  1RT4 A;  1YDL A;  4DF4 A;  3VQS A;  1YJT A;  1L3V A;  2R7S A;  2ACY A;  3NRB A;  4F4W A;  4USK A;  1NSK L;  5DQI A;  2H4W B;  3NOC A;  3VAJ A;  2BUN A;  4PCQ A;  1RCO B;  1R0B G;  2FZK B;  3EWG A;  3P4U B;  4WKY A;  7FDR A;  4EYI B;  2E29 A;  5EN1 A;  3V4M A;  1S1T A;  1TKX B;  3CJ4 A;  1IBC B;  4P6Q A;  2D1C A;  1GMW D;  1Q95 G;  1XR6 A;  3OXG A;  3KUG A;  5DDR C;  2WTF A;  2W9B A;  1RWV B;  4WJB A;  1NND A;  3ZFV A;  2J6S A;  4FBT A;  5CYQ B;  3R5J B;  5DM6 Q;  1HAR A;  3L7U A;  2CPD A;  2DRB A;  1DQ9 A;  1S6O A;  3QT8 A;  2NYH A;  4RJV A;  5J1E A;  1IR0 A;  3UNG C;  2HQF A;  5E3Q A;  5HVF A;  1T9X A;  4RNO A;  1M1H A;  2XY5 A;  3W61 A;  4NCG B;  4A8S A;  2BM0 A;  4OYI A;  5IFM A;  1REV B;  2FPH X;  2ZFH A;  4PZV A;  2YNF B;  4S0M A;  2EC2 A;  3EXC X;  4L75 A;  4OJG A;  5KFL A;  1JJ2 R;  1SIZ A;  3N6L A;  2DB1 A;  4PPD A;  1MRO A;  2BV3 A;  2QFJ A;  3UN2 A;  5C5J A;  5LJ3 Y;  2CQP A;  5LXY A;  5HK4 A;  2HGL A;  1KQG B;  1GMU A;  2CQ4 A;  4TY8 A;  5D15 A;  4ZPT R;  3I5B A;  3NS6 A;  3VAL A;  2FLN A;  4IFY B;  5HRO A;  3FNN A;  1WKJ A;  4USU A;  5CA5 A;  2I0X A;  4Z2X A;  2XM3 A;  3MM9 A;  2ZOF A;  2CNN B;  4RUB A;  3T3F A;  3FZB A;  2L48 A;  4J9R A;  4FPI A;  4UOF A;  3JTP A;  3IWX A;  2CJK A;  1OWX A;  3GLJ A;  2GFF A;  4DX8 H;  2KXF A;  1Q79 A;  7AT1 B;  3TZZ A;  2IAJ B;  4F0K A;  1DTT A;  1VI7 A;  1K44 A;  5DJB A;  3LAM A;  4TN2 A;  2FJE B;  4YS2 A;  1VC0 A;  4OFZ A;  3BSN A;  2QC3 A;  3MMA B;  2ZE2 B;  4DPX A;  3LWL A;  2EEY A;  2FZC B;  3FBC A;  1OSC A;  1PC5 A;  3JS9 A;  5LL6 d;  3W8P A;  2EBE A;  1PYT A;  4Y3C A;  3EZU A;  3IAM 9;  3SYZ A;  4LFA F;  4OYZ A;  2DH8 A;  2QO3 A;  3BM7 A;  3DRS B;  4FN5 A;  5ETP A;  1LW0 B;  1IQT A;  4PRF A;  3KDO A;  4YFU A;  3PTW A;  1E6Y A;  1NB7 A;  5LMN F;  2J7W A;  2F3J A;  1Y11 A;  4Y6I A;  2CQC A;  3CME S;  4A8Q A;  3J7A 1;  2BJ3 A;  1JKH A;  1MWQ A;  1HHS A;  3C16 B;  2MTL A;  1CG2 A;  2VFS A;  2LQ5 A;  1SJ1 A;  3AAW B;  4NLR A;  4X65 F;  1JLB A;  4UOH A;  2C1E B;  3IC1 A;  2OD4 A;  3TVY A;  1I3O B;  4P7T A;  1TQL A;  3IS9 A;  2CVI A;  3FQL A;  1WC1 A;  3BKU A;  3KG1 A;  3IRW P;  2B4P A;  3OHA A;  1QE1 B;  1KVK A;  2E1P A;  1HMV B;  4M5D A;  2OI2 A;  5C7P A;  2WVB A;  1H7W A;  3CC2 S;  3FKB A;  1OQ3 A;  5A0Y A;  1MRO B;  1HBO B;  2A2D A;  1BQM B;  3IBC B;  4NA3 A;  3M30 A;  4IOA Q;  4UUW A;  3TUI C;  2AJ2 A;  3TUZ C;  4DPU A;  2XYP B;  3EJM A;  5LMU F;  1B0V A;  2CQ3 A;  2B7C B;  2YNF A;  4FPR A;  5K8M A;  4DLG A;  3BB5 A;  3V81 A;  3BDE A;  3HVW A;  3NBP A;  4RU2 A;  2DT9 A;  4K0K J;  2FJX A;  3I96 A;  1NDL A;  3KHL A;  2YNG A;  1ZZF A;  3A12 A;  4ILM A;  3W9J A;  5C2G A;  3U27 A;  2C2D A;  4FNI A;  3ZTQ A;  1P27 B;  3FMW A;  2CAJ A;  5KFM A;  2YQ0 A;  3GIL A;  1I6J A;  1KLN A;  2HWH A;  3AOC A;  2BJ7 A;  1N48 A;  1CJV B;  2ILZ A;  3A8E A;  1U1L A;  1KN6 A;  4OX6 A;  3QLH B;  4EGL A;  3MCO A;  2HBQ B;  3QSY B;  3OL6 A;  2X3G A;  2XHC A;  4DR5 J;  2FVR A;  3H2L A;  4ZP9 A;  2MKI A;  5J2Q A;  4LRD A;  5MLC V;  4KJI A;  1NAQ A;  4U8Y A;  2ILY A;  5IC4 B;  4Y2A A;  3AT1 B;  2XWY A;  2OAU A;  1HI0 P;  3IO1 A;  4LFC F;  3RB3 A;  3GG0 A;  3H90 A;  3QPI A;  2ZBQ A;  4GKK F;  1HMV A;  2RQ4 A;  3SIP B;  3PHT A;  4ED7 A;  2JLF A;  3DLG A;  2A1B A;  4I68 A;  1H38 A;  2H5J B;  2BKO A;  3GG1 A;  3UI3 A;  2MQ8 A;  1U2C A;  2CZV C;  4KKO B;  2KT2 A;  4NZ6 A;  4JV0 A;  2F63 A;  3UCG A;  1TL3 A;  3K5P A;  1FVS A;  1L3T A;  2XZD B;  1RI7 A;  4NAS A;  2IJF A;  4LJM A;  3FSY A;  1LWE A;  3PFE A;  3UD3 P;  1S0M A;  1VQ9 S;  1VK3 A;  1NHK L;  3KJN B;  4ATN A;  2OEL A;  3CW2 C;  3FDS A;  4I0W A;  3JTN A;  2JWN A;  1RAI B;  2RD5 C;  3B4D A;  1RAO A;  1XMB A;  9ATC B;  2MZR A;  4CNY A;  2OIH A;  1CVJ A;  3QJP A;  3MUR P;  3MEG A;  2B9X A;  3M4X A;  3RRH A;  1WC6 A;  2XMM A;  1IR1 A;  4GC6 A;  1AZS B;  2KU7 A;  4I2P A;  1S1W A;  2HND B;  2J0S D;  3W2W B;  2RS8 A;  4LBH A;  5EGY A;  4B9V A;  3THT A;  1R0A A;  2LQ9 A;  2VC1 A;  5F8N A;  2OP5 A; 
#chains in the Genus database with same CATH homology
 5AJ3 J;  3T1Y J;  4DR4 J;  5A2Q U;  4LF5 J;  4JYA J;  3W1Y C;  3IMQ J;  5BR8 J;  3R2C J;  4B3T J;  1J5E J;  1XNR J;  1HNZ J;  4DUZ J;  4V1A k;  4OX9 J;  4JI7 J;  4X65 J;  4JI4 J;  4LF4 J;  4B3S J;  4DV5 J;  4DR6 J;  5LM7 E;  2UXD J;  3R2D J;  4NEY A;  4KYZ A;  3J81 U;  4JI3 J;  4NXN J;  4JI6 J;  4DV4 J;  2MTL A;  1XMO J;  4LF8 J;  2MEW A;  3J7A N;  1IBM J;  4LF6 J;  2UXB J;  4DUY J;  4LFC J;  4DV6 J;  4DR3 J;  1XMQ J;  4YHH J;  4B3R J;  4DV0 J;  4NEZ A;  5IT9 U;  4LFB J;  4YY3 J;  2KVQ E;  5IWA J;  1FJG J;  1HR0 J;  4DR2 J;  4DV1 J;  4DR1 J;  4PWW A;  4DV3 J;  1N33 J;  3T1H J;  2KL8 A;  4K0K J;  1HNW J;  4LF9 J;  1IBL J;  2E5L J;  4X66 J;  4DV2 J;  4DR7 J;  3JAM U;  4KHP J;  4GKK J;  2UUB J;  2VQE J;  4JI1 J;  4KY3 A;  2UUA J;  1XNQ J;  2VQF J;  5FLX U;  1I94 J;  4JI0 J;  1IBK J;  4LF7 J;  4DR5 J;  4GKJ J;  1N32 J;  4JI8 J;  4HHU A;  1HNX J;  4B3M J;  4JI5 J;  2UU9 J;  2ZM6 J;  3D3C J;  1N36 J;  4X64 J;  2MQ8 A;  4X62 J;  2UUC J;  3J80 U;  4JI2 J;  3D3B J;  4RJV A;  4LFA J;  4NXM J;  3OTO J;  4AQY J;  5LMN J;  2UXC J;  2F4V J;  4JV5 J;  5LMU J;  1N34 J;  4DV7 J;  2HHH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...