4DV2J

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 12
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4dv2J00
1HNXJ 4DV1J 4DR5J 4DV0J 2VQFJ 1I94J 4YHHJ 2HHHJ 2UUAJ 1N32J 4KY3A 4DR4J 4JI1J 4DR2J 1N34J 3W1YC 4NXMJ 5LMNJ 3J80U 5IT9U 4JYAJ 4LF9J 3JAMU 4LF8J 4DUYJ 4OX9J 4JI5J 4JI2J 5IWAJ 4JV5J 1XMQJ 4JI0J 3T1YJ 4PWWA 4LF7J 1FJGJ 4LFCJ 4DR7J 1HR0J 4JI3J 3IMQJ 4LFBJ 4K0KJ 2UXCJ 1HNZJ 2KVQE 2MTLA 4DV3J 1IBKJ 4LF6J 5LMUJ 4B3MJ 4JI7J 3J81U 4X64J 1HNWJ 1IBLJ 2MQ8A 4RJVA 5BR8J 2F4VJ 2MEWA 4B3TJ 5AJ3J 4JI4J 4X65J 1N33J 4YY3J 4X62J 3D3BJ 2ZM6J 5LM7E 4V1Ak 3T1HJ 3D3CJ 4DUZJ 4DV4J 4DV6J 1XMOJ 2UXBJ 4LF4J 3J7AN 5FLXU 4KHPJ 1XNQJ 1XNRJ 4HHUA 4GKJJ 2VQEJ 2E5LJ 4DR3J 4LFAJ 1IBMJ 3R2CJ 2UUCJ 3R2DJ 1J5EJ 2UXDJ 4JI6J 4AQYJ 2KL8A 4B3SJ 4X66J 4JI8J 4DV5J 4NEZA 2UUBJ 4DV2J 4DV7J 4LF5J 4KYZA 4DR1J 4B3RJ 3OTOJ 5A2QU 4GKKJ 4NEYA 2UU9J 1N36J 4DR6J 4NXNJ
chains in the Genus database with same CATH superfamily
5L9NA 2V67A 2J6TA 3OVAA 2XCPA 2OEKA 4QWEA 2MZSA 1R43A 5LMNF 2RDJA 2CJXB 2C2MB 3SZ2A 4CM0A 2YQ3A 4TLRA 2R42A 4O3QA 2H54B 4LBIA 4K0KF 2ZEJA 5U47A 2UXCJ 3WC2A 4KGZB 1D09B 4OI6A 1IBKJ 2MQPA 2L48A 1VRQC 3CCVS 2HMIA 5BR8F 1CJUB 1S76D 4R5PB 2O66A 2C3MA 3WZ0A 1H7WA 3T41A 1U48A 1KQSR 1RCOB 3QFWA 4C9DA 2W2PP 2OAUA 3JTNA 4WKYA 2R8IA 3OJUA 4K4VA 3NCRA 1JLBA 4DV2F 1NJXA 1VBKA 2XS7A 2Q1LA 1F9HA 3K2YA 1RWOB 4IOBA 4PYAA 4QYZK 5IXUA 2I5JA 3IS9B 2OIHA 1WWHA 3MD1A 4ZVFA 1TKZA 1FDAA 2Q6BA 3JAMU 2KJWA 2AYEA 1N6QA 5CH7B 3H2UB 3RW7A 2BX6A 4P74A 5KFAA 1Q95G 4DR7F 5HI7A 2EFNA 3CDBA 1MMNA 2DCUB 3KWMA 1U1NA 2XLIA 1CJKB 2RT3A 2WZ1A 3CT9A 2DNZA 4XDCA 1UETA 5HMXA 4NPOA 2XNRA 2P9CA 4K5RA 3GV7B 1GMUA 4ES3A 2DHGA 4IFVA 5IC4B 4KPCA 2QV6A 3SYZA 3IP0A 4OYWA 4J37A 3PYFA 4OZNA 1JLFB 4KO0A 2WSFC 3D0GE 5T14A 5KFCA 4W92B 3I5CA 2C3UA 3E01B 4JV1A 1FK9A 3N01A 3IG1A 4C0BA 3OXFA 4Q7AA 5CYMB 3T3FA 1X60A 3GJTB 4M5LA 1CVJA 1N32F 1JLQB 4WK1A 5DM7Q 1KKHA 1T9YA 1RTHA 4LF1A 3TUPA 2FVSA 4WE1B 1KTQA 1FRIA 2ROEA 4I7FB 3DHXA 3C15B 2A6OA 4J9QA 2HNYB 2I2YA 3PTWA 1TKTA 4GMKA 1HPZA 1WD6A 2MZTA 2QL5B 1T05B 2DRBA 2DXDA 5J2MA 1QTMA 4KGMA 4P2MA 2VIHA 1N33J 1D9FA 4Y65A 5D3GA 2MZ1A 3HP6A 3UCUP 1GT8A 3M8ZA 2E5LJ 1GXTA 3MM5A 1VQSA 4DHVA 1YWXA 4CRJA 1CJVB 3M8QA 1IXKA 3LPYA 2PGCA 2IM1A 4KAIA 3MMBA 3KG1A 3NNAA 3R8YA 1UW9A 2RB7A 4DF4A 5E33A 1KFDA 4ES2A 5HSPA 2FJAB 3ZTPA 3NOGA 2CZ9A 5HL7Q 2C2EA 3GV5B 4I6YA 1FFGB 3GSDA 2DK2A 2HNDB 5L46A 2Y1IA 1A0OB 3KG0A 2FJWA 4ZMMA 1FXRA 2KVQE 3A8EA 1V3SA 3P6YC 3DRSA 4X64J 2J8SA 3UVJA 1T02A 2DHXA 1C1BB 1V9OA 3M9NB 3O44A 1MN9A 2RU9A 4ZVUB 4B3SJ 4QBUA 2YNHB 4J5OA 4YEAA 4RBVA 2WVCA 3JXOA 3QIDA 2A3JA 4CLUA 1N36J 2DJWA 1RAGB 2H48B 1IR0A 4ECQA 5JXSA 2VU5A 3MXHP 1HBOB 3FFIA 1L3VA 2L9DA 2ASDA 4QR1A 3J80U 3Q0AA 4FN5A 3TVYA 3A3OB 1JLAB 3FJ2A 2Y8YA 2NXEA 2FIUA 3QGHA 3W5ZA 4ECSA 2ZC3A 3G96A 3AOCA 3W66A 1UAWA 5CAAA 4MKAA 3AHPA 1R8HA 4RU2A 1VYAA 1AT1B 3DYAB 3J81Y 3ZO7A 2GO9A 4YB6A 2XY6A 5J2QA 2WONA 1NO8A 2ZJRQ 1RWNB 4RNFA 3DDIA 1QY7A 1SUQB 1XMOJ 5KFRA 4E98A 5L1JA 1NPPA 3J7AN 1NDLA 2KM8B 1FD2A 4ED3A 1FJEB 1MN7A 2UXDF 2KL8A 3PX6A 3DCAA 1WHYA 2AW0A 2LA6A 5KFHA 1PSDA 4Y2IA 3SCLE 4IH7A 2I0XA 2B4VA 2LQ5A 2MQLA 3PCOB 4KGKA 5HJYA 2YPYA 1L3TA 5CZVA 1FT8A 3NL0A 1M1HA 3F73A 1Y3KA 3HVAA 3I4PA 2DVIA 3V4IA 4GRSA 1UJ4A 4UUXA 3MURP 3KK3B 1TL1A 2PIIA 4K4XA 4DUYJ 1HNVA 4BBYA 3MI7X 4DDFA 4LFCJ 1S9EB 5EUHA 2XBPA 1H98A 3CD6S 4DL7A 3R27A 4IG3A 2F63A 1NJZA 4WFXA 2V69A 4LF2A 2KG1A 1SKWA 3HKWA 4KFBA 3O6QA 2V4RA 4CH1A 1WG4A 4KQZA 2ZFHA 2K3IA 1S0OA 5CYJA 3EXYA 2H51B 2O01C 3CMAS 3QJLA 2VQEJ 3QT6A 2JRSA 1T9UA 3TZYA 1F5BA 4CIOA 1ZM9A 1S6UA 4F4XA 2W2MP 3LP0B 5KFLA 4ECVA 1FA0A 1SKSA 2HQDA 1WJ9A 5CXTA 1C0UB 3CC2S 1HMVA 5DG8A 2IVYA 3J7YI 4DSIA 2J7UA 4ZHRA 3C6UA 5CD4H 1FKOA 1YBTA 4DR2J 4P72A 4LIRA 4DX5A 4DPXA 3D66A 2CQGA 1TTHB 1T03A 2OPSB 4Q0BB 3N5FA 4UZCA 1IJFB 1S1XA 1R89A 2LU1A 4EK2A 4M8LA 3DOKA 4ED8A 1D1UA 2LYVA 4RKUC 1LK5A 3DI6B 2E5HA 2QG9B 3MCOA 2HG4A 2CIMA 4FYDA 2HYIB 1T11A 3T1HF 4RW6A 4ZVRB 5JJBA 1QE1B 1CLFA 1U8WA 5IT4A 4RW7A 3QIPB 2N3OA 4NLDA 3TVZA 3M7VA 1YJ9S 9ATCB 3BSAA 3W8GA 1SJFA 2XS5A 4DN9A 2I9SA 1GAOA 4LR8A 1TAQA 3BDPA 4J9UE 3GZ7A 4O4RA 2FC8A 4RNHA 4H4KA 3H4BA 3CE8A 2BJ7A 4K4WA 1TL3B 2P8IA 2E9ZA 4LR7A 3A12A 3IM9A 3NS7B 4AUKA 1SC4B 3IWLA 3BBFA 3CO9A 2BV3A 5KFBA 3T9ZA 3SSRA 4XIUA 1IJEB 3Q2TC 1ZM3A 4C7QA 1FVSA 3L9ZA 1N5YB 1WSRA 1JXEA 3G71S 4CLYA 4LSLB 1EQ0A 3W2WB 3QJJA 2QFJA 2PEBA 3R7BB 2CQ2A 3HHLA 5ITHA 3EZOA 4F4WA 1M1GA 3RTVA 3OFGA 1RACB 2ZNYA 4CO5A 4ED7A 2VPZB 4J90A 1IN0A 3AA8A 2FHKA 3QT7A 2QLXA 3R2CJ 4ZPDA 1SJ4P 3NGDA 1O5JA 3VTIA 5DLFA 4OYXA 5THWA 4DL3A 3PX0A 4K7QA 3C2PA 2KN4A 2NUUG 2X3DA 3ETOA 2B6AB 3KDOA 3N28A 1Y7PA 3JSRA 1L5UA 1AZSA 3QWUA 3D0IE 2K1RB 3EMTA 2PA3A 3RU0A 1D8YA 1H2TZ 1VRUA 1U1OA 4TKTA 2EKYA 2IDEA 2XM3A 5CYQA 2R2TA 1S57A 2RRBA 5HMZA 3T5LA 4Q8FA 3EGWB 4Z37A 3R6LB 2JLEA 2W4PA 1P6TA 3OTEA 2Z2ZA 4EWTA 1RHUB 2OLWA 3CJKA 3CD7A 2VUGA 2J6SA 4OX8A 4ED6A 2J9EA 2WBRA 4EO8A 3OLAA 1BGXT 3CDUA 2OFHX 1HNIA 4KHPF 1H2UX 2MZRA 1DHMA 1FI4A 5BYQA 2W24A 3J7ZT 3D4JA 4KBIA 2HQCA 4JI6F 3KNAA 2XLJA 2FB0A 5EGYA 2MGZA 2KT3A 2HIYA 4B3RF 5GAEU 4CWBA 5KFSA 2HHXA 4QPXA 1U6ZA 2BRKA 2XGPA 2AYMA 3ZZPA 3M32A 2IVFB 1PJ7A 5A8WA 3AH6A 2XSFA 3B78A 2QA4G 4UY8T 3F41A 3GLJA 1TFYA 3EYZA 1TV6B 4AL7A 2YPZA 3AXMA 2C42A 4ATNA 1X4HA 1SKRA 2JX2A 2DR8A 3C16A 2IY5B 3VQSA 3MR6A 2HFZA 3C14B 2HS4A 3B82A 3BZQA 2YY3A 3B4MA 4LR9A 4A8KA 1RT4B 2EFQA 4I6AA 2HGLA 3QRPA 3MEGB 2M5YA 3AJ2A 2WTFA 3MFIA 2HFUA 1CJUA 4DUZF 2DTJA 5KG1A 4WTOB 3RJMB 5AXMA 1JNZB 1RWUA 3IR7B 4R5PA 1SJ1A 2VC1A 4RNOA 4RUCA 1KN6A 2ZH1A 3R2DJ 3D6TB 1CS4B 2X1GA 3V6JA 5A8KB 4ETZA 5K9FA 2RHQB 2KYZA 1ACMB 3PW2A 1S9GA 1ULRA 3K0JA 3I9ZA 4YUDA 2YKAA 1ZA2B 4NXMJ 4GO7X 3IS9A 1RT7B 4ECTA 3UWTA 2ZHBA 1NK4A 4N77A 2HURA 3MAAB 2ZH8A 4PWWA 4KE5A 3MEDA 2M7SA 4ZLNA 3RAXA 2IRXA 1KQFB 2CQIA 1L3UA 1IR2A 2ZD1B 2CG8A 2ERRA 4WXWA 1NNDA 2YBVA 3GYXB 5GAGU 2JVRA 4L76A 1CJKA 3AFGA 2B43A 1IBLF 2QT7A 2F4VF 5J2PB 3D2WA 4LJMA 1FDDA 3X3UA 1WTBA 1DBDA 4DV6J 1UP1A 4A8SA 4OJGA 3HFVA 4XPEA 3SQGB 1RHJB 2KYXA 4ZK7M 2HWTA 1VGYA 3FQKA 3FZBA 4DFMA 3UW1A 1MMDA 2CJBA 3GONA 1G6BA 4C8MA 4E0DA 1NZAA 3C66A 1UTAA 2FLPA 1U25A 3LWMA 1WC0A 1C1CB 3HO1A 3E01A 2UU9J 2G4BA 4M5KA 2DXEA 3CC7S 3QGPA 1ZPVA 1WKJA 4CT9A 4P9SA 3HXMA 3KHRA 3BYPA 3DMJB 1EQMA 3IFEA 4MK9A 5KFDA 1G4CA 1K47A 4JI5F 1LEOA 1GTHA 3R7NB 5C2CA 4WE1A 3LGMA 3PYGA 2QTWA 4I7FA 1D3WA 1VMBA 4HI1A 1XR6A 3C15A 3BH6B 3PO5A 2HNYA 4AXIA 4LMZA 2V8DA 4RJVA 2AZ3A 1MLAA 1T05A 3RUBL 5ETOA 3KJFB 2B9WA 2PC6A 3AD7C 2EG1A 3G86A 5IM0B 1LWFB 3SIPB 2CQHA 1UFLA 1KLNA 2C2KB 2ASLA 2FY1A 3MCNA 2POKA 5I3UB 1PAEX 4F26A 1P9QC 5KFZA 2HBZB 2AT1B 2XMVA 1TQLA 3CDAA 5HJXA 4V19X 3VAIA 4ELVA 1FKPB 5L1IA 3UDCA 1WOPA 1N4LA 2CVEA 1NSQA 4JI0J 4K4UA 4PWUA 2ZE2B 5ETQA 3MM8B 2KKHA 3VVTA 2HNDA 4N5SA 3G8SA 3UI3A 2PN6A 5LJ3Y 3DDNA 3EUNA 5LMUJ 5F3TA 3BF4A 1VK3A 4YDDB 1F3VA 4IOCQ 2F4FA 3BDEA 4YMEA 3KNGA 1RHQB 1FEEA 5LSRA 4ZCLA 1GEHA 2OO4A 3MR2A 4N41A 3MTJA 2E1CA 1C1BA 3I32A 4TYBA 5DGBA 2VHGA 2FUG9 4EU0A 1R27B 3GFYA 4AQYJ 5DG7A 2KHCA 3BQ1A 1NK0A 1NBEB 5EWEA 2BQUA 2YNHA 2VG6B 4DR1J 2DO4A 1Y5NB 3NGRA 1Q7LB 5I42B 3B6BA 1ROFA 4F8RA 3S01A 1HNXJ 2IRYA 4PCQA 4ECXA 5B7WA 4DS5A 5ETMA 4YB1P 4X4VA 5F8GA 4O3NA 1SQEA 1HBOA 2JFDA 3RBDA 5F9LA 2EFGA 3FNNA 2R7SA 1FRMA 2IFXA 4ECUA 1JLAA 3MPYA 3MR5A 1ZZNA 2PMZD 3FEYB 3NY0A 1NK7A 4F4AA 4QW9A 5K8MA 3R5CA 4B9VA 5EX0A 5E2QA 3VV2B 3QFHA 4LBHA 3VZHA 3DYAA 2OMOA 3F56A 2MKJA 3ZZYA 1G2EA 1VBYA 1V5VA 1GX6A 5DRKA 1CULB 1SUQA 1XK8A 3LOUA 4LQ3A 4LSZB 5ETNA 4IH5A 4WP3A 1WDDA 3DFEA 2ZH2A 1YRUA 3W5XA 1KVKA 4UZBA 3CCMS 3QMQA 2M3DA 1OO0B 5F9NA 2HK2A 3CVKA 1YJUA 4D3GA 3MFHA 4I68A 2V4QA 4ZVHA 1SB6A 1Z2LA 4DR6J 2NXCA 3AT1B 3OD2A 2O67A 3SSQA 3IRXB 3M6XA 2CQ1A 4H4KC 5HMWA 3TZXA 3GV8B 4X2BA 3T9NA 2ZBQA 2YKPA 3KK3A 2MB0B 3JSMB 4PG7A 1OMSA 1Q81T 2RKIB 2NR0A 1S9EA 3OHBA 3M2VB 1HBNB 4OV6A 3R97A 2HFSA 4O0IA 3CJ0A 1NEEA 1PKUA 4YY3F 3BEGB 1RWPB 3DRPB 3HHLC 4J9LA 3HFKA 3ZTSA 3T6BA 3PEHA 4YR3A 3PACA 4NLOA 3ZTRA 4GKJF 3TARA 2QO3A 2UUCF 1RKIA 2DGVA 4RW9B 5C25B 5F8MA 5LJ5Y 1NKEA 3E2EA 2FHJA 5AE2A 2LVWA 3QYYA 3JB9k 1Q8BA 5C42B 2HS0A 3H5SA 1R0AB 3OXLA 2VOPA 1R8BA 3LP0A 3K8WA 3IR6B 2CPZA 4K2JA 5ADZA 2W01A 2BKPA 3EPGA 3D9BA 1RAHB 3EWGA 5HK4A 1FE0A 3M1VB 5ETKA 4QYRA 1C0UA 2DITA 1X9SA 2J6UA 5KG6A 1BQXA 3W1YC 5LMNJ 4KKOB 2GIFA 2BABA 2ILYA 4WFNQ 1WF1A 4HI2A 4TQRA 4K0KJ 2CJAA 2YWHA 4QIEA 3I5AA 2OPSA 1FXDA 7FD1A 2DNPA 4Q0BA 2BJ1A 1KTVA 2RVJA 4CT8A 2I8EA 3AJ1A 5BR8J 5B0GA 2EKNA 2VBYA 4G3IA 1IBCB 1Q1KA 3CUNA 2IVMA 3GQCA 3BV8A 1XJWB 4F02A 3DI6A 3D5MA 2DO0A 5DDOC 4C3MA 1U0HB 2ALYB 5KFYA 2C3YA 1R8AA 4CLZA 1QE1A 2U2FA 3M6UA 1NH8A 1RAFB 4FP9A 3UN5A 2LFVA 3PW4A 2Z4PA 3HD2A 3O2IA 3C46A 2N7CA 2HRYA 2XQCA 3MOZA 2YKMB 4DV2J 2GVDA 2M8DB 2YKNB 1L3SA 2OPPB 1MWQA 3QZ8A 3WDOA 3ENWA 2DRDA 4DLEA 4ZVEA 3E8OA 2QSWA 5FDLA 4P73A 3M2UB 4XPCA 3LQVA 1R3NA 2KRRA 4A4JA 5AXKA 2N4DA 4JV5F 2JJ4D 4NA2A 5DDPC 4QIWD 2COLA 3GP9A 2FLLA 4DR7J 1ZBTA 2EBEA 3MM6B 2AF6A 5BXIA 3EGNA 2IBKA 2QMUB 3OV7A 4ELTA 2OPQB 4LSLA 1FWLA 3W2WA 3L7UA 5E0OA 3PG9A 4EI2A 2XMUA 1IKYB 1QTNB 2XI2A 2CAJA 3U1MA 3IO1A 3UD4P 2VASA 2JSXA 1VHFA 4CO1A 2O1PA 4GC6A 2ZOGA 1F1BB 2DIUA 2MSTA 3LP1A 1HI8A 1M0SA 2G0IA 2DGXA 1GK8A 4DCPB 5IZHA 4FKXA 3GG1A 2GMHA 4R25A 2V50A 4WJBA 1KRPA 5L8RC 2XULA 3G87A 1QVFR 2EBGA 2QFIA 3MHYA 4CM2A 2MHNA 2C1EB 1BC6A 5KG2A 1YGYA 1FO1A 3CJ8A 2DNYA 2ZUGA 3DKDA 1N32J 1B64A 1IKXB 4DR4F 2ROGA 2XMAA 1NHVA 5ETVA 4JYAF 1LK7A 2PI4A 1V3ZA 3VZIA 1FJGF 1Q4RA 2FHOB 4USHA 3CC4S 3M8YA 2D9PA 1HNZF 1FTCA 3V2UC 3MOJB 3K5NA 1XBWA 2CFXA 3W9JA 1TFWA 4MIBA 1HBMB 3PJXA 3ONQA 4PQUB 2QRRA 3CD5A 2R8KA 3MMAB 2XZTB 2YKOA 4L75A 1KHVA 4PWDB 4IOAQ 1H3DA 1S1TB 3DGPB 4YR2A 3SEOA 1ZTWA 3Q86A 2KU7A 4ES1A 2MSSA 1RK8A 2N7YA 3AD8C 2WAQD 3I0RB 2ZH6A 2E29A 3HI9A 4ZIWA 5H1SV 2K3KA 3NGUA 2X7IA 4NCGB 4PUOB 4FYYB 2WVDA 3JSBA 3KLFA 4CZCA 1HARA 4NEYA 3Q22A 2J76E 2OD4A 2HZCA 3HSZA 4N76A 3OVSA 1BY9A 1SC6A 1EX8A 3O8WA 1ZS6A 4GVLA 1TV6A 1F0XA 1RQ0A 3T1YF 5D78A 2YWFA 2ZKTA 2DNRA 1Q8KA 5GAEI 2NPFA 3C14A 3P45B 3TUZC 2RMLA 4RWWA 2XMKA 3R5GA 4FNIA 2R7UA 4DX7A 1QAXA 4CNYA 1FWPA 3W60A 2BANB 3N5BA 1V3RA 3MEGA 1S97A 4EMDA 2E1PA 1Q5YA 4MIAA 1S0VA 1SIZA 2KFZA 4F3QA 4ZLPA 2I5JB 4JI8F 1FE4A 4DZ6A 3BPDA 2QN6B 2V4JB 4RUAA 3M6WA 3H42A 4G1PA 3BN7A 1GX5A 5KAKA 1FDBA 1YSJA 2JC0A 3P96A 2QMWA 5IQQA 3NOCA 4DR5F 3R5JB 3P3DA 2EEYA 2AHOB 3QLHA 2V8HA 3OT9A 2E9RX 2L9NA 2M2BA 2Z0GA 5DG9A 1OPIA 4OIXA 4LRDA 2VFVA 5H9FJ 3CJ4A 1BD6A 1DQAA 3MAAA 4M5IA 3K5OA 4EBCA 2YNIB 2ZD1A 2JC1A 1HNWF 3KK2B 2NZCA 1CC7A 2E44A 2AIRB 2MDAA 2GX8A 1A6LA 5B09A 2DYAA 3IG1B 4CTAA 4E8UA 5J2PA 4PG4A 2G2OA 1YITS 3NMAA 2YXLA 1FERA 3DNCA 3GJQB 1XC9A 4AD6A 4DWIA 4MFBB 2UXDJ 3SQGA 3DU6A 1T9XA 1RTHB 4WIIA 2RSQA 3D6FB 4PPDA 5GAGI 2JVOA 2LKZA 1M5OC 1E6VA 1ZM4A 2BQRA 3MPWA 2KZZA 2KDOA 1JIHA 5KFTA 2C2NA 2HZVA 1LW0A 4OHWA 2PEHA 2BKOA 1VQ6S 1C1CA 2VH7A 3ILJA 4Y6IA 2B4PA 2JOQA 3EVOA 4QIGA 3UDLA 4YR0A 4USKA 3GFZA 1WI6A 3VHQA 1NSPA 3DMJA 4USIA 3Q8VA 4IQMA 4IO1A 4H4MB 4WKRA 3Q8PB 1MW7A 2XYGB 4QJVA 2K7JA 3AOBA 4OZJA 4F36A 5B08A 1NCLA 2JEGA 5KFVA 2ASJA 4NMLA 4P2SA 5DJBA 3M8QB 4MYTA 3HZEA 2JH3A 3HHLD 1S6PA 3KUHA 3MMBB 2JNJA 4QIVA 1HD0A 1SCJB 2PMHA 1M5PC 2IM0A 4M5JA 3T5KA 2XSJA 3OSNA 2RQCA 3GJRB 2IPOB 2RS8A 2QMXA 1WSVA 5I4MA 3SFUA 3GYGA 4KT0C 5IM0A 1LWFA 1IM4A 2KG0A 4ETXA 3BS9A 5BYSA 1FESA 1NU4A 3OL9A 1FRKA 1RHRB 1NHKL 2R2SA 3T5HA 3S8SA 4FXVA 3CDEA 1Q8IA 5I3UA 1XR5A 1YBUA 2ZKUA 3BO3A 4BLGA 4C0OC 1RAIB 4DQRA 4ZS6A 2E1AA 3HKZD 3ISNC 5EDWA 1I3OB 3VR1A 2VPWB 1Y0HA 3CEDA 4OHZA 1JKHB 2VD3A 4USJC 1FKPA 5K8OA 4X4NA 3FEZA 4WCEQ 1V5IB 3ZC4A 2XWXA 3DC2A 4DFKA 1NJYA 2I38A 1LQ9A 3MPUB 1NK8A 2ZE2A 1QUVA 3MM8A 4LT6A 5KT5A 3HHKA 1GMVA 2H3EB 4BS2A 3V6HA 4IR1A 2F65A 3T1HJ 1RTDB 1IQTA 4NLUA 5F8LA 2IBOA 4TQSA 2LXUA 1DTTB 4E2FB 1Q53A 1S6QB 3PIOQ 3A3PB 4M5MA 2DHHA 5LOQA 4YOEA 3FFIB 2WVBA 4OYOA 4C8LA 4ANEA 2B51A 3MEEA 4DL0C 4X4SA 3CSKA 2XYHB 1MROA 4FZVA 4Z2XA 1RLDA 4DV1F 2G9OA 2IM3A 3PRBA 4C4WA 1M1KT 4PRFA 3KK1B 2WONB 5GMDA 3OXGA 1DARA 4IRKA 3DOMB 1VQ4S 1RCXB 2MLYA 1RTJB 1WI8A 1MSWD 1QAYA 4RW8B 4CO3A 2YWEA 2LXIA 4PXBA 1RT3B 3WX4A 3TO8A 4ANCA 4G6VB 4XAKA 1SH2A 2P9GA 3NGSA 1VCTA 4ED1A 5KFIA 3CCRS 4USVA 3K59A 3V6DB 4RWXA 4BWMA 5CZXA 3KJQB 4F0KA 4K50A 4ZP8A 1UEKA 4F2RA 4K8RA 5D4NA 4CQ1A 2AJQA 3VAKA 1OY6A 5IV4A 3I5BA 4KRWA 3DRXA 4ECZA 3L3CA 3BSNA 2YQ0A 2KT5A 3HT3A 2OELA 1K0VA 2WHOA 5DDRC 2L3MA 1XQIA 5ETSA 1RWXB 1VHIA 2PDAA 4KFBB 3IRXA 4OYMA 1YJTA 4OJHA 8RUCA 3EVWA 3BKTA 2BBEA 4NLPA 2RE1A 4DS4A 3WC0A 3MGJA 2DPJA 2R7XA 4A8MP 2FGCA 3J7YU 2R7QA 3JSMA 3KKFA 3THVA 3D28A 1VQ9S 1A9NB 2M4MA 3J81U 3M2VA 2ZZNA 1HBNA 4KJIA 4Q43A 2ZWOA 1Q0NA 4P71A 3TZWA 5D8HB 2RD5C 1HIYA 5EWFA 4O3SA 5FLXU 4KHPJ 1WF0A 3DRPA 4Y2CA 2ZZTA 3RB3A 2D1CA 1X4DA 4O44B 4JI6J 1FKOB 4DFJA 4NASA 1EETB 4DV5F 4RW9A 1X4EA 3LUYA 3TJAA 5C25A 2LEPA 2APOA 3BN4A 4B3RJ 4L6V3 2EK1A 3SDEB 3P4UB 2IJRA 5C42A 3AB4B 2W2OP 4CI0B 3LGNA 1S1UA 3IAM9 1VIXA 6FD1A 4YHHF 3EDQB 4HKQA 4FXDA 3M1VA 2GS8A 3D0HE 1B70B 5BJRA 2X1AA 2CPIA 3OR2B 3R1HA 4O3RA 5CCMA 4KKOA 2NXUA 2DIVA 1UA1A 3GIRA 1DAXA 4ER8A 2D3OR 5F8IA 3GCXP 4PG6A 4DV3F 2J8AA 5A0YB 1RWMB 1S7IA 4F4YA 1NJIT 4ITSA 1SQFA 7FDRA 1FRLA 3M9MB 1XWLA 2B3TB 4C98A 5AJ3J 3FUYA 4ANDA 2KJVA 4DUZJ 1P27B 4WIQA 4EO6A 1PGZA 3RBXA 1U0HA 3SMZA 2UUWA 3N6NA 1UFKA 2BMBA 5DS7A 3LALA 3NP5A 2VF3A 1QAJA 2HPUA 4DCJB 2PE8A 3TAQA 2HS3A 2DT9A 1RWWB 2YKMA 3MR7A 1P1LA 2J0QD 5KFQA 2Q3PA 2YKNA 1XN9A 1SXLA 2OPPA 3CXCR 3PDNA 4QPTA 2D74B 1U2FA 4KV8A 1F5CA 1OIAA 4P7TA 3HZGA 1X4AA 3CJSA 1X4GA 2CQ0A 3W7BA 1K9MT 3VGTA 4JI2F 5CHCB 3M2UA 4C11B 2CVIA 1FDNA 2QLBB 2D41A 3CO0P 1SH0A 4IQXA 2GAGC 3MM6A 5AE1A 4NWBA 2DH8A 3ZNUA 5KG0A 3OW2R 2G1DA 2OPQA 2GVZB 1S99A 1IBLJ 2F4VJ 3MAHA 5T41A 2CQ4A 2RRAA 1I51B 2VPYB 3GIKA 4LVNP 2H9ZA 1PYTA 4FYVB 1AFIA 5JUMA 1VRUB 2M8HA 2D3UA 4PKDB 4HLBA 4B9MA 1U1QA 1WF2A 2KB2A 1NK6A 2F9JA 2NXJA 4WK3A 4OLPA 5HVFA 2I6WA 3R9LA 3TQ1A 1IKXA 1YJVA 4F7VA 4JI5J 5F8NA 2YTCA 1I1GA 3AQOA 4DSJA 1NJWA 1VI7A 2CZVC 2GGPB 2HW3A 2ZWPA 5FJ4A 4RUBA 2CWXA 1IKWB 3FCHA 2IJFA 1XIQA 4DL5A 1HBMA 2B8PA 4PQUA 1IM6A 4ERDA 1RKJA 1AROP 3MMAA 1AUSL 3DRRA 3BGFA 1KONA 3PHEA 4PWDA 2V8VA 2YVSA 1S1TA 4J91A 3DGPA 5J1PA 4PYDA 2Z8QA 1FVQA 2CJ9A 1FKAF 3OL8A 3JSYA 3I0RA 3KOAA 3C16B 1LXJA 3FBFA 1DLOB 4NCGA 4PUOA 3VGVA 4NXNF 3RAMA 3TEGA 2Y8WA 3VWSA 1N88A 2HVIA 3FDSA 2XB2D 2HVZA 3DLKA 3L7OA 2W2NP 3TA2A 1TKDA 1H72C 1YBAA 1WOOA 3AD9C 4DMZA 3IR5B 5DDQC 3PYDA 1HQUA 8ATCB 2WSCC 3UDVA 5HAOA 2HHTA 4Q2MA 2DISA 3VAJA 2MHEA 4EBDA 4EGLA 3SQOP 4OX6A 5ETLA 5E3RA 3OBIA 1K8AT 3HMJG 1EJ7L 1YHQS 3N4WA 2BANA 4WXOA 1BQNB 4M5NA 1X4BA 3HF5A 1S9GB 3A8KA 3OTBA 5LL6d 5DM6Q 1UJ6A 3K17A 3FSYA 1U24A 4U67Q 2CXEA 5E7OB 4NEZA 1LNQA 2B7CB 4TXSA 2GQ2A 4OHXA 3UR3C 4QU7A 4U96A 1GH8A 2FHJD 1RAAB 3T19A 2V4JA 1Q86T 2E66A 3MEDB 3ITHB 3KHHA 2LA4A 1T94A 1WC4A 1KDNA 1FFWB 3RYLA 3EDRB 1F9EB 4DFPA 3RZAA 2H65B 4I2QB 1BXNA 1TL5A 4PABA 2N82B 4EUVA 2GQQA 5D0GA 2RAQA 3MZIA 2GAHC 1J5OB 1MU2B 2EW9A 5I3QA 3ADAC 1W7WA 1HW8A 2C3PA 2YNIA 2AD9A 1ZOTA 3MD3A 3KXDA 2CNKB 3KK2A 2UZAA 4HH1A 2VL1A 2MPUA 1NXIA 3G9CA 5JMNA 4X62F 3M6VA 1ELOA 1XNQF 3LH2S 3CCQS 4NA1A 4WBFA 1RTIB 3UCGA 1TU0B 3M05A 3GMGA 4YDXA 4MFBA 4A8XA 1TZ0A 4IKAA 4U7CA 5GVQA 2VICA 3CCSS 4DLGA 1LOUA 2R8HA 3IBCB 5KFJA 2VQFF 1YX2A 3AB2B 2ZOFA 3BPSP 5AE3A 3CCTA 1YJ7A 4CP5A 1SL1A 2ZUAA 2GMJA 2KXNB 2FQQB 2O5DA 4KGXB 4DEZA 1PJ5A 1CC8A 2ABYA 1UL3A 3W9HA 3AQPA 4H4MA 3Q8UA 4B3MF 2XZWA 4G1QB 5D0HA 3ISZA 2HGNA 1RBAA 4C97A 1TELA 4YY3J 2AMCB 1NKBA 3CTRA 3BBBA 1QSYA 5B0BA 1RA6A 4P6QA 4F0HA 1IWAA 4GKJJ 1S4FA 4A47A 5C5JA 4DR3J 2R7VA 2UUCJ 3G6ES 1VC0A 2WB4A 4ILRA 1TUWA 2X3GA 4X66F 4J9PA 1RHKB 4FF1A 1OY8A 1RADB 3VF0B 3OL7A 2WVEA 3N9UC 3H2VE 4LSNB 3LAKA 3NEKA 3PY8A 1EP4B 2CJQA 3K5PA 4L74A 4B9TA 4WWSA 2FGOA 3WX8A 3AJDA 4LF7F 1JKHA 1T8EA 2DEJA 4QR2A 2A6MA 4Y28C 1OY9A 3L7PA 3PV8A 1RU2A 4ZLJA 1R6YA 1S1VB 4V1Ak 2E1RA 4XK8C 3HVTA 1M5SA 2ILZA 1N8RT 1RTDA 3W61A 1DTTA 2V9KA 1GXUA 1S6QA 2ADBA 3R5DA 1FF2A 1TL7B 2M52A 3LW5C 1UMJA 4Y2KA 1EZZB 4ECWA 5J1NA 1S59A 2OD6A 2HQIA 4CDIA 1RI7A 4MYUA 2RQ4A 1HW9A 3I56S 4J9MA 5J1EB 2RDDA 3H2LA 4ID8A 1OYDA 5CA5A 3QRQA 3TW0A 3KK1A 4N8OA 2JHEA 2W2QP 4JV5J 1F5AA 2HNZB 1UFWA 4IO9Q 1YDLA 3DLJA 3DOMA 1U02A 3MUVP 1VC6A 4G1IA 1RTJA 5GADI 1N54B 4CO0A 3LP2B 4P52A 4XDDA 1Y5LB 3IXQA 4WZQA 3PEJA 2HEKA 3TA1A 4JOUA 3NS5A 4RW8A 2JDJA 2HIQA 3ENQA 4UOCA 5LM7E 3BR9A 3PYEA 3I82A 1RT3A 2CPEA 2CUYA 1FTRA 4CLWA 4R0JA 2CZ4A 3S6EA 3V6DA 4OYPA 2G1HA 1FWKA 1P9YA 1B99A 3W2VB 1LKZA 4UF4A 4OZ1A 3NS6A 2G2ZA 4ZVTB 5D4OA 1BLUA 2J5AA 4J9SA 1I94F 4ZOSA 2UUAF 1HWKA 2MKCA 1K0TA 1UVJA 3D6MB 4DR4J 2O3DA 4O23A 1KC8T 2F8EX 4JYAJ 2IMOA 3NLCA 2DY1A 3UD5A 1FJGJ 1RWVB 2GFFA 3HSJA 2BJ8A 4LFBF 4M1KA 2DY9A 1HNZJ 2FY8A 2HBQB 3CF5Q 2BA9A 3D1QA 2OFGX 4I64A 4OI4A 3VAFA 2WK4A 2RDIA 5D0EA 1HL6A 1RXOB 4U7UK 3QJPA 3WIUA 3O1LA 2FZCB 2XTJP 1S1WA 4JB8B 2ZH7A 4IYQA 2AGOA 2HQGA 5KG7A 2J0WA 1JJCB 5C7PA 4O44A 2RHSB 4U6PA 5H9FK 1U8SA 1EETA 1OWXA 3MUMP 4DV7F 3D54A 2FJEB 2E1MC 3QPIA 4GKKF 1JNRB 1QDUB 4J9KA 1FRXA 4YQWA 3SDEA 2Q6CA 4OJ1A 4ZJLA 1MNEA 2HHHF 3HHNB 2HVHA 1PBAA 1DURA 4WFZA 1EIYB 1PC4A 1NH7A 5G0RB 1HHTP 4ZP9A 2IAJB 2VDIA 3G6XA 5B0EA 1R6VA 3EX7B 3CW2C 1X4CA 3T1YJ 3OR2A 2J9DE 1S72S 4IRCA 5IV3A 2IM2A 4Q8EA 4DQPA 3S1TA 3CMQA 1HWIA 3BQ2A 5MAOA 3L4BC 3TVKA 4ZDNA 3FGVA 4DI6A 4DPOA 2XCAA 1DZ5A 4KSEB 3U7JA 2JFKA 4S0MA 5A0YA 3SFGA 2JEFA 2PFDA 3TUJC 2QL9B 2GVDB 2QA1A 1BWVA 4PG5A 4B08A 4ZPCA 5KFFA 4K4YA 3NNHA 4ILLA 3WHIA 2FJBB 2H4YB 1T9TA 1BQMA 3PJWA 2AJ0A 1ZTTA 1ZH5A 2KTQA 1IBMF 1GQEA 3CCZA 1LWXA 3P8BB 4RX6A 4X84A 4JI8J 5HMYA 2HK3A 4IH6A 5FDLB 3IN5A 3KMQA 2V9WA 1BMQB 4ZVSB 3BM7A 2EWHA 2G0JA 4PEOA 3J81j 2EK6A 2FD2A 3QO9A 2VC0A 4MIWA 2UUTA 2BKNA 2LMIA 1REGX 1QUPA 4HT7A 2A18A 4FF2A 4DR5J 1HQ2A 3FVYA 3U1LA 2D7SA 4OHYA 4WFYA 2GHVC 2BVZA 1VQLS 4JI1F 2QC3A 4TN2A 4BWJA 5IT9Y 4PXCA 2MQNA 5IWAF 4USTA 3LP1B 2RJZA 3GIIA 4C11A 2JWNA 3I4HX 4M5DB 4ID5B 2EVZA 1VR6A 5D4LA 1HNWJ 1EHWA 2XHWA 3HPOA 2JL9A 4Q45A 4B9NA 1U1MA 2GVZA 2GZOA 3BSCA 3CULA 2UV8A 2Y1LB 2VFTA 1GFWB 2GQCA 2DB1A 3G82B 3EVMA 1NDKA 3BQ0A 3T5JA 4WP8A 1W25A 3EGVA 1JXVA 2X1BA 4YFUA 5HBMB 4HTIA 1IWGA 3GJSB 1KR4A 3TRGA 4RUHA 3OL6A 2VV5A 5IC6B 4C8ZA 1R8CA 3IAS9 4ED4A 2CPJA 2VOOA 1VQMS 4TYAA 2LQJA 1UEVA 1U49A 4M5GA 3W65A 4L73A 5KFUA 3WQPA 3QSYB 5KFNA 1AUDA 5A8RB 3GR1A 3R5AA 2MJUA 1V6HA 2AEFA 1UVLA 2DHSA 4LVOP 3EZUA 4CH7A 4P2XA 1Y3JA 5H9EK 2CNLB 3MM7B 1U45A 1R7IA 1L3KA 1X5PA 3OHAA 1HWJA 5KT2A 4M95A 2UVUA 3JTOA 3POTA 4C48A 2DH9A 2GGPA 2ZOMA 4DPYA 2LQ8A 2R3VA 4CLTA 1IKWA 2CJYB 1LFPA 3CJRA 1FNXH 3DOLB 1LV5A 1X8DA 4URQU 4CYUB 3KLFB 4LF4F 3QT5A 5ETRA 1B0VA 4OYAA 4NX9A 3DLHA 2WVFA 3TA0A 3FMWA 3UDEA 4IR9A 1C4AA 5F41A 1JLGA 4DQIA 1QM9A 4IRDA 2Y1RI 2X1FA 4KR0B 3K89A 3H59A 2VZ9A 5IQ6A 3RW6A 3FCWA 2FTRA 2RILA 1DLOA 2KZMA 3QAUA 3MEKA 2EFOA 2ZBPA 1VDHA 4L72B 4ZLLA 2BW7A 2AEJA 2PI5A 2P9EA 2A2DA 1CG2A 2YWGA 4LIWA 1NPRA 4F4KA 4NCBA 4Z7YA 2AGQA 3SCIE 5AJ3F 2FVPA 1VK8A 1TK8A 1EARA 4NLXA 4A8FA 1KP6A 3G6YA 3NWGA 4HACB 3NBPB 4LREA 4DL6A 2ZM6F 5GAHU 1NDPA 3PR4A 1HWUA 4WFBQ 2XMTA 1E6YB 4H4OB 1VJWA 2IHR1 3US5A 2XHCA 1BQNA 3QLHB 3PHTA 5MLCV 2ZBIA 2B56A 4O0NA 2CPYA 2PFFB 2GJIA 4C8NA 1FNOA 2ZJQQ 3GR0A 1RT6B 2DBBA 1AB8A 4DV1J 4NZ7A 3ICLA 2BYCA 2LLZA 3ITHA 1JX4A 2J7WA 3ETMA 2DEIA 3FQLA 1SJQA 3FRYA 2DGWA 2WOMA 5KTQA 4OMFG 1FJCA 1NDCA 1FRJA 2BM1A 1QSSA 4CTAB 1R0BG 1S48A 3GSIA 1ZZFA 3G8TA 1ZM2A 1ZAVA 5HVHA 4I2QA 4TLQA 3BGUA 1WHVA 3EM1A 4WPAA 4DBQA 4CO2A 2IC3A 5BYRA 4QW8A 3I0SB 3K5LA 1URNA 1S5ZA 4FXWA 3V81A 3KHLA 2V2KA 1MU2A 1J5OA 3FMBA 2CQCA 1KQGB 1X0FA 1E6VB 3FZ2A 4QU6A 5EHHA 1RT5B 2LP4A 1WC1A 3KLIB 4RW4B 3TX8A 3FBBA 3VAHA 4DV4F 1LW0B 1T7PA 2Q43A 1XNRF 1N48A 5E3PA 4DZDA 1RTIA 3GYNA 2EC0A 3GB0A 3A3NB 3HJFA 3PFEA 3Q8YA 2U1AA 4P2FA 2UV8G 2DGSA 5A2QY 3EJMA 3LWLA 2AJ1A 3Q83A 2DH7A 2BE2A 2W8KA 4JV0A 4ICLB 4J9RA 3VCDA 2W4CA 3S7RA 3IM8A 1U47A 2VONA 2DR6A 4DSKA 2BQ3A 2EXUA 3I96A 1S6PB 3AY0A 4NRUA 3M30B 2XSJB 3HJVA 1QJHA 2MKKA 2GO8A 1RAJA 4ZIVA 2ZBRA 3QT8A 1VQ8S 2KVIA 4C8OA 2R4FA 5F8HA 3V4MA 1Q79A 1RISA 2MY8A 4F3MA 4G1QA 5LSOA 3GCWP 4I2PB 1BUXA 2AEMA 3FEXB 5HROB 2XZDB 2RUSA 4OI0A 4EYIB 4V19J 3CJ5A 3FSIA 4DN0A 4UT4A 3UN2A 1EKRA 2DNQA 2MY7A 1HHSA 3NAHA 4DV5J 4ZP6A 4B9LA 4J7CA 4WU2A 4MMOA 4LF5F 4KYZA 4X4OA 4Y2MA 3TANA 3SBMA 2B5JB 1TMMA 3CD0A 1N5TA 5DQHA 4DV0F 1HI1A 4HL9A 4NI2A 4LSNA 4YHHJ 3EPIA 3HM9A 1EP4A 1UWAA 3H5UA 3KLHB 1WNEA 2GC8A 3QNWB 5KG4A 4M63A 3ZNJ1 1N5QA 3PRDA 2C22A 4EFAC 1RJJA 2XG8A 1HR0F 2VBWA 2RU3A 1U6FA 2C2OB 2D3O1 1UVMA 3ZTQA 4DV3J 2HHVA 2A2CA 3MPDA 2GW8A 2UVWA 1OQ6A 2NPIA 3IGNA 1AYEA 3JQKA 2DNHA 3DM2B 2BDPA 3MEEB 2DR5A 1U1RA 2QA4S 3GIJA 1MROB 3UFCX 1S1VA 2FZGB 1DQ8A 4DQSA 2YH1A 4FS2A 3GE9A 3V6KA 2B9YA 3HFZB 4BC9A 2B9XA 2JEJA 3T6JA 5ETTA 1RAOA 1W2BR 1RT1B 2YH0A 1MMLA 1TL7A 2YWWA 1NSAA 2YX1A 2ACMA 1HHQA 4R8UA 2CG4A 2UVVA 3B8HA 2GHWA 3RB0A 5HP1B 2E7VA 2BE9B 3TJ8A 2W7OA 3UO0A 4IDKB 5IFMA 5J1EA 3D6HB 1VQKS 3Q24A 4MH8A 3L09A 4JI2J 3F44A 3ZZRA 1TVRB 3Q8QB 4ZA1A 2HNZA 1D0EA 3UPFA 1KLMB 5KG3A 3PRVA 1NB2A 5KFPA 4A46A 3LP2A 2QEXS 4DX8H 1PAUB 2CPFA 2XO7A 2ROPA 2ZNZA 1UCNA 4MAKA 5LT5A 1Q82T 1TUVA 2XNQA 4KH1B 3M8PB 2DNKA 3N0VA 1SC1B 4K59A 1TK5A 1OS5A 3JYTB 1LWCB 1YRTA 2MZJA 2LECA 4ALZA 2AX0A 4OX7A 5DGAA 1G3OA 3W2VA 5JVHQ 2V2ZA 1WKLA 1IKVB 1HYSA 1N34F 4ECRA 4N7TA 2WRMA 3IA0A 4LF9F 4LF8F 4NLGA 3L95X 1WHWA 3J7Z5 4JP8A 1UVNA 4TVAB 1IVZA 1S0MA 3ZZOA 4FYWB 3OR1B 5L1LA 1T3NA 2OJ3A 5HLFB 4DR3F 5D6GA 1F2HA 1JLCB 5SUHA 3RB4A 1KS2A 3MWBA 5J2NB 3W8PA 2BW2A 1R8PA 4UY85 5HN0A 5KOWA 4N47A 1OSDA 1S1UB 1PJ6A 4NLQA 3LANA 4DL4A 3MAQA 3R3TA 3W9IA 3AA9A 1ZAWA 1PYSB 3PX4A 3EE3A 2LDYA 3SSSA 1S49A 1Z4UA 2YKQA 2XMWA 5FLXY 5E3AA 3BGRA 2BM0A 4NXNJ 4EYHB 3D7SB 3WBZA 3H25A 4DPTA 4F4ZA 4NLSA 1YKWA 2F1FA 5HVGA 3RRGA 3SV3A 1TK0A 1WC3A 5CCLA 4EEYA 2VB6A 2OTJS 1TP7A 3V5RA 2ZBCA 2BOPA 4NMXA 2HHQA 3LAMA 3AOAA 2Y0SD 5G0RA 1PIEA 1VQ5S 2IAJA 3QBCA 4WTYA 2V6AA 5IS2A 3CPWR 4YN3B 1XR7A 3FRZA 2MKSA 4NYOA 2XWYA 4LF6F 1SIWB 5DQGA 2XI3A 2VFSA 4Q5VA 1B7FA 4Z7CA 2W9BA 1UPPA 3FCVA 3HHEA 4WU3A 3MMCB 1Q16B 4RBTA 4QWCA 3D1OA 3HSDA 2CDQA 2WW8A 2KRBA 2YNFB 3MTKA 1KQKA 2K8GA 1FXLA 2LEBA 1WC5A 1RYRA 4KHMA 2ADCA 4I4BA 1Q7YT 3PR5B 4FPIA 2DRAA 2VFUA 3KTQA 2MKYA 2ZH3A 4KV8B 3RG6A 2EC2A 2VODA 4ZPTR 4P7VA 1RWKB 5B0CA 3M8SA 3QSIA 3GIMA 2HFNA 4HEA9 5HQMA 3DLEB 1HI0P 3ZZ0A 2AJFE 2HHPA 1SL2A 1Q8LA 4K4SA 1C0TA 5F3ZA 4C2MA 1AFJA 3W62A 4ZJOA 4OX9F 3SXLA 2WB1D 2KFYA 2YX4A 4JI3F 4FBTA 1FJ7A 5F0WA 1HKAA 5KT4A 2FJVA 4CLLA 4P10A 2VBZA 4M94A 2M9KA 4P75A 1UZDA 1HD1A 1JB0C 4M5DA 4ID5A 3OLBA 4XTTA 4LRAA 4X62J 3DXBA 2FLNA 4WP9A 5AXNA 3ZZTA 1XNQJ 3HDSA 4O3OA 3G82A 4K4ZA 3LO3A 1WACA 1PCAA 1OSCA 2CPXA 4EZ9A 4B9UA 1N56A 2QJ3A 5HBMA 3TUIC 4GC7A 2UUBF 4A8WA 1LXNA 3EGZA 1CBKA 4AL6A 1UWBB 3OTOF 2P2CB 3N79A 1SJ3P 2V2QA 5GMEA 4J9NA 2VQFJ 3UNGC 2NQPA 3GU0A 1T9VA 1LWEB 2IDLA 1FEHA 2R7TA 2OH2A 3EXCX 1P1TA 2J9CA 5A8RA 3OTDA 1RTZA 5HO4A 3OUYA 3DXSX 2DGTA 2MKHA 3Q8SB 1Y9OA 3TP2A 3DRRB 2QE5A 4OZ3A 2LEAA 1X5OA 1XTZA 4NYZA 5L39A 3MM7A 4B3MJ 1H6KX 2DGUA 4OL8A 3CIMA 1VQPS 2FJDB 4LRFA 4X65F 4BCAA 3J7A1 4L3NA 5DO2A 5G4DA 2MZQA 1JJ2R 3DOLA 4CYUA 2DKOB 2Q66A 2HZAA 1RT2B 2C3OA 3KLVA 5CD4A 1D9DA 3DLKB 4X66J 2F7VA 3UQSA 2E7WA 4GVBB 1YVFA 4W98A 1Y11A 1HQUB 3GTYX 4FF3A 3QWPA 4HR2A 1NPKA 1S6OA 2HVEA 2ZJPQ 4QWAA 4C6AA 3MCSA 3FK4A 3QQCD 1DQ9A 3TOQA 1HBUB 2B9EA 5ETPA 1XMQF 3A13A 4ED2A 4LF7J 9RUBA 1YJWS 5GMKa 2AX1A 4UOFA 2D69A 3HULA 2QLWA 4JI7F 3QZ7A 3KJNB 4EBEA 1KNZA 4ILMA 4JBCA 1JWWA 1O8BA 3ILIA 4HACA 3NBPA 3HHDA 3N6LA 3PJ9A 1MG7A 2NCKL 3SCKE 3SI8A 4UQTA 2QYCA 5E41A 4LFAF 2EPIA 1ICEB 2BUNA 1E6YA 4H4OA 1N52B 2BJDA 4A8YA 2LCWA 1KOOA 2M88A 3TI0A 1VJQA 4Q44A 2MMYA 1VIOA 3AXKA 1RAEB 1FNMA 5GAHI 2LQ9A 4DPWA 3ET6B 4HDGA 4CNZA 3ZZUA 1RT6A 2HWHA 1VRTB 2AV5A 1RBLA 5K5MA 2W9AA 2C2RA 3BJYA 5B0AA 3JAMY 4CO4A 3KHGA 4WYLA 1SV5B 3I9V9 4MT1A 1GNKA 5L9XA 3U02A 1H38A 1U7LA 2NLWA 2GJFA 3RB6A 1VQ7S 1N0UA 3C6TB 3I0SA 5IOLA 1WTFA 2MLXA 3D3BJ 1O0PA 3OFEA 2DXFA 3K8VA 1RT5A 3KLIA 4RW4A 4CH0S 2R7OA 2RIJA 2XMMA 4N8NA 4DSEA 3CDWA 2NXNA 4HHHA 3ZTOA 1QAIA 1DRZA 3EZ5A 2MXYA 3ZXWA 4DUTA 5B0DA 3MM9B 3SV4A 2FHMA 4ENOA 2VJVA 3M4XA 3RBEA 4U8YA 1SC3B 5D0RA 2YNGB 5L38A 4TY8B 5M2PA 1X5SA 1I94J 1VQOS 1REVB 2UUAJ 4ICLA 1CJTB 2PT0A 3CJ3A 1WEYA 1TUGB 2AYBA 3VVUA 4B9SA 1NSKL 3H98A 4LFBJ 4NLVA 3M30A 1H74A 2OEJA 1K1SA 1KEKA 4MKYA 4RU9A 2K2PA 1DTQB 3CNQP 1N5VA 4OFZA 3PVXA 1D9AA 3DLGB 4Y0FA 2ZDOA 1HQEB 2UXBF 4I2PA 5B0FA 2W8LA 2LU2A 3MMJA 1PILA 1VISA 4RNMA 3KMSA 5HROA 2X51A 3E51A 3E3XA 6AT1B 2C28A 4IUFA 2OSRA 1J5EF 3RGIA 4USWA 1KBRA 2VG7B 4MK7A 4DPUA 1K44A 2Z58B 4DV7J 1WG1A 2MQMA 1B0TA 4AL5A 4PG8A 4DF8A 4GKKJ 4BHQA 2B5JA 2HKEA 2HAFA 2HHHJ 1NRKA 4KB7A 1JLFA 2DNNA 2G13A 3RR7A 3NGKA 2SXLA 3KLHA 3GFXA 4QR0A 1WELA 4QIFA 2EFPA 4HYKA 2WCXA 3RR8A 2H1YA 2XMJA 3HVTB 4OI3A 2FVQA 4CLSA 3THTA 2MTLA 1I5OB 5CYMA 4RO0A 2Z2LA 2C2ZB 1JLQA 3EICA 2HLUA 4RZRA 2EFVA 2PD1A 2MQQA 3OFFA 4B3TF 4OI1A 5K8PA 4JI4F 4ZPBA 3KYLA 3DM2A 3KLGB 1T3OA 2BR0A 1XERA 2XYPB 1NMEB 2HQ3A 4HHUA 2FZKB 1IBMJ 2DD8S 5GADU 2JLGA 4U8VA 3H8YA 4USMA 4CLFA 3DLLQ 1UEUA 5DETA 2Z57B 2BRLA 2GIQA 2R8JA 1RT1A 1W2IA 2BACA 4HVZA 2MJNA 3M8WA 3P5BP 4AFFA 4OYZA 1SJRA 3BYRA 3HT0A 2H4WB 2W7PA 1WKKA 2CQPA 4JI1J 5HP1A 2RQKA 3J80Y 1CJVA 4UOHA 5A6PA 4IDKA 5IWAJ 1SKUB 3WIVA 2R9LA 1U6BA 1IQZA 1F6TA 2P5VA 4HHJA 2UXCF 3N6MA 1TVRA 1JXLA 1X31C 3QAEA 1IBKF 2DHAA 2HFOA 1UJ5A 1KLMA 3K57A 1TAUA 1X5TA 3H20A 2XY7A 3IC1A 3TX0A 4NL5A 1N0VC 2NREA 3HD1A 2NUHA 4A48A 4DG1B 1AA1B 4B3OB 1IR1A 3FBEA 2HRUA 3BSOA 5C24B 3CJTA 3M8PA 3M2RB 4OV1A 2MKIA 3JYTA 1LWCA 2HFVA 4O4GB 4I6WA 3PM9A 2PSZA 2W9CB 3MUTP 3UCZP 7AT1B 2IRUA 2FYXA 5EN1A 1NK5A 4DSLA 4UOGA 4KY3A 1RUSA 3CCLS 3A8JA 1IKVA 2HWIA 1VBZA 2RF2B 3GWCA 3Q2SC 4NYPA 3VGSA 3B54A 1YK9A 5KG5A 2V8PA 2WSEC 2ZVSA 3PZPA 4OI2A 3BGOP 1S1WB 4QZVB 2FLOA 1S10A 3KLEB 2IA6A 4Y00A 2VA2A 4HTJA 3OR1A 4QWDA 5T7LB 1KVIA 5HLFA 2MQOA 1RE1B 1J2VA 1YIJS 2CNOB 1JLCA 1GMWA 4LF4J 3KJVB 1PG5B 5J2NA 2Z56B 3G8QA 5E5NA 1VS3A 2NSCA 3X1LB 6FDRA 1YTYA 5F0UA 4NLTA 2RQMA 1NAQA 4DXLA 2GV1A 2OKQA 1VLOA 1WHXA 3NGTA 3PW7A 3KG4A 4W4MA 2ATCB 3OTCA 1ZA1B 2ZVIA 3ILLA 3IWNC 2IYIA 3UR0A 2VJUA 2Y3YA 2CRLA 1JK9B 2H5EA 3G6VA 2IMWP 4I0WA 1RBOB 1SBRA 3CGIA 2DPIA 1BQMB 1RGVA 1QSLA 2H5IB 4JV2A 1OYEA 4ZPAA 4QYZJ 1TMJA 1MWYA 4X4RA 3TWZA 3GILA 4I69A 2XGQA 5DLGA 5D15A 1QLNA 1N33F 1ZYQA 2ZM6J 1APSA 3Q8RB 3QO9B 3D3CJ 2MYFA 1JLEB 1B3TA 3MMCA 3HVRA 4F2SA 3CJ2A 5KFEA 3H40A 2F40A 5A76A 1U2RA 3MR3A 2E5LF 2YNFA 2DCLA 4LBPA 4IFYB 3R6GB 3MDFA 3FSXA 4G65A 1CSJA 3BREA 1UVKA 5D77A 1VFJA 2E5JA 4OZ5A 2ZHOA 1XMBA 3ENAA 5KOXA 2NZ4A 3T1AA 2A1BA 4AT1B 4YP3A 3KUEA 3C8YA 4Q2LA 2B4OA 2ZH5A 1ZETA 3DLEA 3IRWP 3K58A 2HHSA 2HAIA 3RBZA 1BHNA 3BKUA 4MKVA 4U9RA 1FRHA 1S79A 3BBCA 5C2GA 4FF4A 3IGVA 3RRHA 1EB0A 4C8KA 1UA0A 4OJ3A 2AU0A 1J27A 1U1PA 4X4UA 4ZCMA 3NNCA 2AZ1A 1T0TV 4J9VA 3PW0A 2J0SD 1NB7A 2VG5B 1TKXB 1NHUA 4X64F 1EAYC 4KPYA 5KT6A 3HLUA 1PBUA 4C0HA 1WDTA 3SCJE 3TR5A 5HANA 3QGIA 4ZVGA 4DV4J 2Z2MA 1AXQA 4B02A 1LW2B 2QGFB 1XNRJ 2E5IA 4ZVQB 3BGLA 4AE5A 1YJRA 4DSFA 2B7BB 4BC7A 1GXLA 4B3SF 2HRTA 5KFGA 4ZP7A 1PO6A 3ULHA 4URGA 2UVRA 1SVDA 3LPEA 2N3LA 3MECB 1N5SA 1UWBA 1N36F 2HVDA 5RUBA 4CLKA 2VKRA 2CA9A 3VQTA 3QIPA 2J9DA 4MKBA 8AT1B 2ZZMA 2GCFA 3POTB 4AXJA 3B4DA 1F2GA 2OP5A 5IT9U 1LWEA 3BB5A 5L1KA 2ASYA 2IYGA 2BJ9A 3FKBA 1FCAA 2KT2A 2BXJA 3Q89A 2V8GA 2HBYB 4ZVPB 4U95A 1TL3A 3IWXA 2CKWA 5HQ8A 4LUBA 1JLGB 2GNKA 2V2VA 2XLKA 4DCOB 5K14B 2ZC4A 4UTGA 1P8GA 2AWZA 1XMOF 3JS9A 1N5YA 4NRTA 3H7HB 1VQNS 5A6WA 4RNNA 3RRKA 3FBCA 4UUWA 2OI2A 2YWKA 5KT3A 3ISND 2OPRB 3DHWC 4F0MA 3OVBA 1UKUA 5DQIA 1BE4A 4PXEA 3CCWA 1RT2A 3DRYA 2VKZG 3G4SS 4LF5J 3C3LA 4GVBA 2CQDA 2GA7A 1X9MA 1FD8A 4DV0J 2PA8D 1U26A 1HLWA 1S9FA 3CCES 3CWJA 4UQGA 4OZLA 1X4FA 1YI2S 2JEIA 1RLCL 3MF5A 4DUYF 2B6AA 2PO4A 1HBUA 4JUZA 1HR0J 4LFCF 2I1RA 1AW0A 3OSPA 4OHVA 3RAQA 1U1KA 4HDHA 5JVGQ 2K1RA 2QLFB 3TAMB 2RH3A 3TYTA 1RZMA 4FVCA 3VAMA 4MTPA 4C3LA 2CWKA 1X0PA 1OPZA 4M5HA 2RS2A 3P49B 5AXLA 4IG0B 1NKCA 3PNIA 2QX0A 3QRRA 4D3HA 2ZDPA 1S4EA 3AODA 5KFOA 4FS1A 2VQEF 2M70A 4Y2AA 4B17A 1Q5VA 3TNVA 2CPHA 1JQGA 3MCMA 2WOMB 5LXRA 2L41A 2EI5A 1B7YB 3F0NA 4HT5A 1M5KC 2BJEA 1YZ6A 4ED5A 2FJXA 2IC3B 3CMES 1OJ4A 1H73A 2R8GA 3ET6A 1KOHA 1MWZA 3V81B 4DR2F 2VPXB 2QLJB 2VDHA 1VRTA 3M9OB 2IA0A 2P6TA 1RU1A 3U27A 4K4TA 5KFWA 4ZPWR 4YB7A 1ZPWX 1SV5A 2HMIB 1U4BA 3CCUS 4MJKA 5M2RA 3DLBA 3ILOA 3C6TA 2N4CA 4C3KA 1RSCA 3OFHA 5I3PA 1G7CB 2BE2B 3NCQA 5HQLA 4KC5A 3UNYA 4Y34A 1NK9A 2OTLS 1RT4A 1JLBB 2DNGA 3CB4A 2QL7B 3AAWB 2Y0BB 2OSQA 2C2DA 4NA3A 3CIZA 3D68A 2QYGA 2CQ3A 2DNMA 1VBXA 2E5GA 3MM9A 3K5MA 3K7RA 1WC6A 4KIAA 1WG5A 2YNGA 2V63A 4TY8A 1TKZB 2AGPA 1CS4A 1N34J 5A8KA 1REVA 3HK2A 2E9TA 1N6QB 2CJKA 2ZH9A 5DZ6A 4LF9J 3KFWX 1CJTA 4LF8J 1Y00A 1UZHA 4U7UD 1QD1A 2BEFA 2ALZA 2H5JB 2HBRB 2HQFA 4OLOA 2V68A 1URRA 3I31A 4NOHA 4OYIA 4MK8A 4QOTA 2D9OA 2AP6A 2RRNA 3LF0A 2KI2A 3Q23A 2AYGA 3TEHB 2A10A 1RT7A 4WYWA 4IFVB 2Z2YB 1Z1ZA 2DR7A 1DTQA 1LFWA 4PR6A 1X7VA 1Q78A 3DLGA 1HQEA 1B0PA 4KO0B 4LRBA 1Y4ZB 2IJNA 1A7GE 4NI2B 3KDNA 1HWLA 2CQBA 1U09A 4NLWA 1PYOB 1FK9B 4TY9A 4TU8A 2Y9HA 5DZ7A 4K5SA 3ZFVA 2VG7A 2KXFA 2F9DA 5A2QU 2W7AA 2CPDA 3JTPA 2FC9A 2LXFA 3LA0A 2RUGA 3UD3P 3KUGA 3UE2A 4ED0A 4I56A 1I6JA 2B0GA 4NLRA 3H5XA 4F25A 1VC5A 1RA7A 2B8QA 1TKTB 1KSPA 4KHRA 1T9WA 2JLFA 4QQBA 1HPZB 4J9OA 4URSA 5J2MB 4LF6J 2Z30B 3NCPA 2WBMA 4ELUA 1WEZA 2CDRB 2ZITA 1RDRA 4W90B 2MQ8A 4ZCIA 3R7SB 5K8NA 5D3GB 3LTOA 4NZ0A 1R0CB 4ZN1A 5CQGA 3DN9A 5EX3A 1FX4A 4O3PA 2VFRA 5IT0A 2F5GA 2GJ2A 3MM5B 1WOSA 2E7XA 3KLGA 1KD1T 4R8UB 2DGOA 1SL0A 3ELHA 1H7XA 4X4TA 3M8RA 3D67A 4KGVB 2HHWA 1M5HA 1RABB 2AJ2A 2MLZA 4PXDA 4FPRA 4RPFA 2CNNB 3DGVA 3TJ9A 1S0NA 3MPVA 3DDKA 3H4DA 2D3ZA 2AKWB 4R0EA 2KM8C 4OX9J 4EZ6A 4LRCA 3QATA 2R7RA 2BOAA 4JI3J 2R2UA 4QWBA 4GO5X 5HATA 3D1HA 3DRSB 1T95A 4WZMA 5M2UA 4OZ2A 2BZ2A 1VQYA 3HCXA 1O51A 3A4TA 3UVJB 3W63A 4WFAQ 1C4CA 4KH0B 3THPA 2CYYA 2FDNA 2A0FB 1CQNA 1VLYA 3O3LA 4F67A 5KFMA 3O5TB 2F8HA 2PMWA 2P6SA 2K7KA 2K06A 2OGUA 2ATLA 4DG1A 1HYSB 4B3OA 1CPZA 5F8JA 4DJBA 2BE7D 1H0HB 2UUBJ 4ZJQA 5C24A 4ZPVR 3OTOJ 3M2RA 4FKYA 3PO4A 5H9EJ 4UW2A 4ZITA 4O4GA 2W9CA 3TQEA 2GIRA 4N56A 3NRBA 4FBUA 3OJSA 1M5VC 1ITPA 1EKSA 4F50A 1NLKL 1YJNS 4NXMF 1CEZA 2W1BA 4DX6A 3C19A 2VG6A 2RF2A 3PXGa 1K1QA 2YX7A 5I42A 2B4UA 3W3SA 3IMQJ 3A1YG 5SZTA 1SH3A 4FDFA 3NMRA 4L3KA 3U1NA 4X4QA 4TU7A 2L08A 5J2QB 1C2PA 3KLEA 2KHDA 1JMTA 3NAIA 3BR8A 5E3CA 1KHWA 1JJHA 2V0NA 4X65J 3BGRB 5T7LA 4DV6F 4OZ0A 3KJVA 2VA3A 2J7KA 1UW4A 1YG0A 1M90T 4A8OA 2G0CA 2QIFA 1K73T 4NLYA 2FVCA 4DU8A 1WEXA 1HFEL 4WF9Q 4OQJA 1Z2ZA 3BO2A 1KWMA 3H5YA 1SI9A 3H90A 2W25A 2V5HG 2OMLA 2UU9F 3NXZA 2V94A 1CULA 3PKMA 1RYSA 3V4IB 4ZCKA 2DNLA 3HX9A 3VGUA 2OUGA 4USUA 4DL2A 2ZH4A 1S77D 1S7HA 1TL1B 2NYIA 1HNVB 2W9BB 1IUJA 1BWEA 2AJ4A 1XMQJ 2HLTA 4IG3B 3NKYA 3UN3A 4K2XA 3I6PA 1D8ZA 1Y10A 4PPZA 3TAPA 1YRXA 2YQ1A 4JI7J 4PZVA 4HH0A 4FVMA 2J0XA 2DNOA 1XEZA 3GFHA 2XC9A 4DU7A 2G2YA 1R31A 2M0GB 1W26A 1F3FA 2HHUA 2RKIA 2QSFA 1U0SA 1JLEA 1KVJA 1DFDA 1JJ4A 4RBUA 4LFAJ 5KFXA 2OEMA 1C0TB 4ZN3A 4IFYA 4PQAA 4X4PA 3ENVA 3TZZA 1U1LA 1SPBP 1RB0A 2L9WA 1HMVB 1YZ7A 4ZHRB 3C6UB 3IBFB 2OHDA 3G2XA 2RNEA 3VALA 2UP1A 2XEXA 1FFSB 2R2RA 1PC5A 3R1LA 1YQHA 1KFSA 3W5YA 3W64A 2QZ8A 1T03B 1WORA 3FC9A 3NG8A 3QGGA 4JI0F 1R0AA 1S1XB 3H0PA 2HGMA 3DOKB 3P5TL 2KFNA 1RHMB 4FNHA 4RL1A 2DGQA 4H54A 4NE9C 5LMUF 2QA2A 4C8YA 5KT7A 2GHPA 1NM2A 2VG5A 1TKXA 4RW6B 2NS1B 3OQ2A 4ZVOB 2KH9A 2LDIA 4FYXB 3LGHA 1QVGR 3OPKA 4RW7B 2ZHAA 1RP5A 5KFKA 1LW2A 3GPAA 4OYBA 3HVWA 1UVIA 2Q79A 2Y1JA 1CQMA 4AQYF 1DJ0A 2AQ4A 5FIIA 2F3JA 1SQGA 1OQ3A 3OUYB 2BJ3A 2VBXA 4DR1F 4F04B 2F8MA 3PIPQ 3VAGA 1HNXF 4Y3CA 1NZ8A 3MECA 4QCLA 4TNOA 2W4DA 4BDPA 1YLXA 2KXHA 2V34A 1X9WA 5LSLA 1HA1A 3BO4A 3JQJA 1WUUA 2DR9A 1ZAXA 3HHLB 1S12A 2CADA 2ACYA 4KTQA 4LQ9A 3R5BA 4XO0A 4YS2A 4DQQA 2MEWA 5K14A 4NZ6A 2UXBJ 3ZZZA 4CCHA 3GG0A 1J5EJ 5LXYA 1GTEA 1TL4A 2IIHA 5K20B 4F3OA 2OPRA 1IKYA 2R7WA 3PW5A 1AZSB 1DY3A 4RLEA 4DR6F 4YB5A 2XY5A 1F60B 3A8IA 1U2CA 4I67A 2WW4A 2FVRA 2XO6A 4I1TA 3BKFA 2LQBA 5CYQB 3PKYA 1FX2A 2FPHX 1UPMB 5FD1A 4TU9A 4DOZA 4NCAA 2NYHA 3DU5A 1B4SA 1Y5IB 3JQMA 3CJKB 5E3QA 5CABA 2NSBA 3NWRA 1H2VZ 3TAMA 5EWGA 1FHTA 4B3TJ 4JI4J 3PFOA 1G1XA 1HNIB 1TR0A 4CLPA 4ECYA 2GMLA 3CCJS 5D4PA 3IBWA 3I55S 4IG0A 3CJQA 1F9FA 1O6XA 4RR5A 4ZKAA 3HSGA 1GMWD 1VOMA 3BH7B 5AT1B 2MGZB 3I87A 4PAAA 2JZ5A 1NUEA 2EG2A 2HSEB 4AYBD 3M32B 2XS2A 2KO1A 5A8WB 4A8QA
chains in the Genus database with same CATH topology
1HNXJ 4DV1J 4DR5J 4DV0J 2VQFJ 1I94J 4YHHJ 2HHHJ 2UUAJ 1N32J 4KY3A 4DR4J 4JI1J 4DR2J 1N34J 3W1YC 4NXMJ 5LMNJ 3J80U 5IT9U 4JYAJ 4LF9J 3JAMU 4LF8J 4DUYJ 4OX9J 4JI5J 4JI2J 5IWAJ 4JV5J 1XMQJ 4JI0J 3T1YJ 4PWWA 4LF7J 1FJGJ 4LFCJ 4DR7J 1HR0J 4JI3J 3IMQJ 4LFBJ 4K0KJ 2UXCJ 1HNZJ 2KVQE 2MTLA 4DV3J 1IBKJ 4LF6J 5LMUJ 4B3MJ 4JI7J 3J81U 4X64J 1HNWJ 1IBLJ 2MQ8A 4RJVA 5BR8J 2F4VJ 2MEWA 4B3TJ 5AJ3J 4JI4J 4X65J 1N33J 4YY3J 4X62J 3D3BJ 2ZM6J 5LM7E 4V1Ak 3T1HJ 3D3CJ 4DUZJ 4DV4J 4DV6J 1XMOJ 2UXBJ 4LF4J 3J7AN 5FLXU 4KHPJ 1XNQJ 1XNRJ 4HHUA 4GKJJ 2VQEJ 2E5LJ 4DR3J 4LFAJ 1IBMJ 3R2CJ 2UUCJ 3R2DJ 1J5EJ 2UXDJ 4JI6J 4AQYJ 2KL8A 4B3SJ 4X66J 4JI8J 4DV5J 4NEZA 2UUBJ 4DV2J 4DV7J 4LF5J 4KYZA 4DR1J 4B3RJ 3OTOJ 5A2QU 4GKKJ 4NEYA 2UU9J 1N36J 4DR6J 4NXNJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNX J;  4DV1 J;  4DR5 J;  4DV0 J;  2VQF J;  1I94 J;  4YHH J;  2HHH J;  2UUA J;  1N32 J;  4KY3 A;  4DR4 J;  4JI1 J;  4DR2 J;  1N34 J;  3W1Y C;  4NXM J;  5LMN J;  3J80 U;  5IT9 U;  4JYA J;  4LF9 J;  3JAM U;  4LF8 J;  4DUY J;  4OX9 J;  4JI5 J;  4JI2 J;  5IWA J;  4JV5 J;  1XMQ J;  4JI0 J;  3T1Y J;  4PWW A;  4LF7 J;  1FJG J;  4LFC J;  4DR7 J;  1HR0 J;  4JI3 J;  3IMQ J;  4LFB J;  4K0K J;  2UXC J;  1HNZ J;  2KVQ E;  2MTL A;  4DV3 J;  1IBK J;  4LF6 J;  5LMU J;  4B3M J;  4JI7 J;  3J81 U;  4X64 J;  1HNW J;  1IBL J;  2MQ8 A;  4RJV A;  5BR8 J;  2F4V J;  2MEW A;  4B3T J;  5AJ3 J;  4JI4 J;  4X65 J;  1N33 J;  4YY3 J;  4X62 J;  3D3B J;  2ZM6 J;  5LM7 E;  4V1A k;  3T1H J;  3D3C J;  4DUZ J;  4DV4 J;  4DV6 J;  1XMO J;  2UXB J;  4LF4 J;  3J7A N;  5FLX U;  4KHP J;  1XNQ J;  1XNR J;  4HHU A;  4GKJ J;  2VQE J;  2E5L J;  4DR3 J;  4LFA J;  1IBM J;  3R2C J;  2UUC J;  3R2D J;  1J5E J;  2UXD J;  4JI6 J;  4AQY J;  2KL8 A;  4B3S J;  4X66 J;  4JI8 J;  4DV5 J;  4NEZ A;  2UUB J;  4DV2 J;  4DV7 J;  4LF5 J;  4KYZ A;  4DR1 J;  4B3R J;  3OTO J;  5A2Q U;  4GKK J;  4NEY A;  2UU9 J;  1N36 J;  4DR6 J;  4NXN J; 
#chains in the Genus database with same CATH topology
 5L9N A;  2V67 A;  2J6T A;  3OVA A;  2XCP A;  2OEK A;  4QWE A;  2MZS A;  1R43 A;  5LMN F;  2RDJ A;  2CJX B;  2C2M B;  3SZ2 A;  4CM0 A;  2YQ3 A;  4TLR A;  2R42 A;  4O3Q A;  2H54 B;  4LBI A;  4K0K F;  2ZEJ A;  5U47 A;  2UXC J;  3WC2 A;  4KGZ B;  1D09 B;  4OI6 A;  1IBK J;  2MQP A;  2L48 A;  1VRQ C;  3CCV S;  2HMI A;  5BR8 F;  1CJU B;  1S76 D;  4R5P B;  2O66 A;  2C3M A;  3WZ0 A;  1H7W A;  3T41 A;  1U48 A;  1KQS R;  1RCO B;  3QFW A;  4C9D A;  2W2P P;  2OAU A;  3JTN A;  4WKY A;  2R8I A;  3OJU A;  4K4V A;  3NCR A;  1JLB A;  4DV2 F;  1NJX A;  1VBK A;  2XS7 A;  2Q1L A;  1F9H A;  3K2Y A;  1RWO B;  4IOB A;  4PYA A;  4QYZ K;  5IXU A;  2I5J A;  3IS9 B;  2OIH A;  1WWH A;  3MD1 A;  4ZVF A;  1TKZ A;  1FDA A;  2Q6B A;  3JAM U;  2KJW A;  2AYE A;  1N6Q A;  5CH7 B;  3H2U B;  3RW7 A;  2BX6 A;  4P74 A;  5KFA A;  1Q95 G;  4DR7 F;  5HI7 A;  2EFN A;  3CDB A;  1MMN A;  2DCU B;  3KWM A;  1U1N A;  2XLI A;  1CJK B;  2RT3 A;  2WZ1 A;  3CT9 A;  2DNZ A;  4XDC A;  1UET A;  5HMX A;  4NPO A;  2XNR A;  2P9C A;  4K5R A;  3GV7 B;  1GMU A;  4ES3 A;  2DHG A;  4IFV A;  5IC4 B;  4KPC A;  2QV6 A;  3SYZ A;  3IP0 A;  4OYW A;  4J37 A;  3PYF A;  4OZN A;  1JLF B;  4KO0 A;  2WSF C;  3D0G E;  5T14 A;  5KFC A;  4W92 B;  3I5C A;  2C3U A;  3E01 B;  4JV1 A;  1FK9 A;  3N01 A;  3IG1 A;  4C0B A;  3OXF A;  4Q7A A;  5CYM B;  3T3F A;  1X60 A;  3GJT B;  4M5L A;  1CVJ A;  1N32 F;  1JLQ B;  4WK1 A;  5DM7 Q;  1KKH A;  1T9Y A;  1RTH A;  4LF1 A;  3TUP A;  2FVS A;  4WE1 B;  1KTQ A;  1FRI A;  2ROE A;  4I7F B;  3DHX A;  3C15 B;  2A6O A;  4J9Q A;  2HNY B;  2I2Y A;  3PTW A;  1TKT A;  4GMK A;  1HPZ A;  1WD6 A;  2MZT A;  2QL5 B;  1T05 B;  2DRB A;  2DXD A;  5J2M A;  1QTM A;  4KGM A;  4P2M A;  2VIH A;  1N33 J;  1D9F A;  4Y65 A;  5D3G A;  2MZ1 A;  3HP6 A;  3UCU P;  1GT8 A;  3M8Z A;  2E5L J;  1GXT A;  3MM5 A;  1VQS A;  4DHV A;  1YWX A;  4CRJ A;  1CJV B;  3M8Q A;  1IXK A;  3LPY A;  2PGC A;  2IM1 A;  4KAI A;  3MMB A;  3KG1 A;  3NNA A;  3R8Y A;  1UW9 A;  2RB7 A;  4DF4 A;  5E33 A;  1KFD A;  4ES2 A;  5HSP A;  2FJA B;  3ZTP A;  3NOG A;  2CZ9 A;  5HL7 Q;  2C2E A;  3GV5 B;  4I6Y A;  1FFG B;  3GSD A;  2DK2 A;  2HND B;  5L46 A;  2Y1I A;  1A0O B;  3KG0 A;  2FJW A;  4ZMM A;  1FXR A;  2KVQ E;  3A8E A;  1V3S A;  3P6Y C;  3DRS A;  4X64 J;  2J8S A;  3UVJ A;  1T02 A;  2DHX A;  1C1B B;  1V9O A;  3M9N B;  3O44 A;  1MN9 A;  2RU9 A;  4ZVU B;  4B3S J;  4QBU A;  2YNH B;  4J5O A;  4YEA A;  4RBV A;  2WVC A;  3JXO A;  3QID A;  2A3J A;  4CLU A;  1N36 J;  2DJW A;  1RAG B;  2H48 B;  1IR0 A;  4ECQ A;  5JXS A;  2VU5 A;  3MXH P;  1HBO B;  3FFI A;  1L3V A;  2L9D A;  2ASD A;  4QR1 A;  3J80 U;  3Q0A A;  4FN5 A;  3TVY A;  3A3O B;  1JLA B;  3FJ2 A;  2Y8Y A;  2NXE A;  2FIU A;  3QGH A;  3W5Z A;  4ECS A;  2ZC3 A;  3G96 A;  3AOC A;  3W66 A;  1UAW A;  5CAA A;  4MKA A;  3AHP A;  1R8H A;  4RU2 A;  1VYA A;  1AT1 B;  3DYA B;  3J81 Y;  3ZO7 A;  2GO9 A;  4YB6 A;  2XY6 A;  5J2Q A;  2WON A;  1NO8 A;  2ZJR Q;  1RWN B;  4RNF A;  3DDI A;  1QY7 A;  1SUQ B;  1XMO J;  5KFR A;  4E98 A;  5L1J A;  1NPP A;  3J7A N;  1NDL A;  2KM8 B;  1FD2 A;  4ED3 A;  1FJE B;  1MN7 A;  2UXD F;  2KL8 A;  3PX6 A;  3DCA A;  1WHY A;  2AW0 A;  2LA6 A;  5KFH A;  1PSD A;  4Y2I A;  3SCL E;  4IH7 A;  2I0X A;  2B4V A;  2LQ5 A;  2MQL A;  3PCO B;  4KGK A;  5HJY A;  2YPY A;  1L3T A;  5CZV A;  1FT8 A;  3NL0 A;  1M1H A;  3F73 A;  1Y3K A;  3HVA A;  3I4P A;  2DVI A;  3V4I A;  4GRS A;  1UJ4 A;  4UUX A;  3MUR P;  3KK3 B;  1TL1 A;  2PII A;  4K4X A;  4DUY J;  1HNV A;  4BBY A;  3MI7 X;  4DDF A;  4LFC J;  1S9E B;  5EUH A;  2XBP A;  1H98 A;  3CD6 S;  4DL7 A;  3R27 A;  4IG3 A;  2F63 A;  1NJZ A;  4WFX A;  2V69 A;  4LF2 A;  2KG1 A;  1SKW A;  3HKW A;  4KFB A;  3O6Q A;  2V4R A;  4CH1 A;  1WG4 A;  4KQZ A;  2ZFH A;  2K3I A;  1S0O A;  5CYJ A;  3EXY A;  2H51 B;  2O01 C;  3CMA S;  3QJL A;  2VQE J;  3QT6 A;  2JRS A;  1T9U A;  3TZY A;  1F5B A;  4CIO A;  1ZM9 A;  1S6U A;  4F4X A;  2W2M P;  3LP0 B;  5KFL A;  4ECV A;  1FA0 A;  1SKS A;  2HQD A;  1WJ9 A;  5CXT A;  1C0U B;  3CC2 S;  1HMV A;  5DG8 A;  2IVY A;  3J7Y I;  4DSI A;  2J7U A;  4ZHR A;  3C6U A;  5CD4 H;  1FKO A;  1YBT A;  4DR2 J;  4P72 A;  4LIR A;  4DX5 A;  4DPX A;  3D66 A;  2CQG A;  1TTH B;  1T03 A;  2OPS B;  4Q0B B;  3N5F A;  4UZC A;  1IJF B;  1S1X A;  1R89 A;  2LU1 A;  4EK2 A;  4M8L A;  3DOK A;  4ED8 A;  1D1U A;  2LYV A;  4RKU C;  1LK5 A;  3DI6 B;  2E5H A;  2QG9 B;  3MCO A;  2HG4 A;  2CIM A;  4FYD A;  2HYI B;  1T11 A;  3T1H F;  4RW6 A;  4ZVR B;  5JJB A;  1QE1 B;  1CLF A;  1U8W A;  5IT4 A;  4RW7 A;  3QIP B;  2N3O A;  4NLD A;  3TVZ A;  3M7V A;  1YJ9 S;  9ATC B;  3BSA A;  3W8G A;  1SJF A;  2XS5 A;  4DN9 A;  2I9S A;  1GAO A;  4LR8 A;  1TAQ A;  3BDP A;  4J9U E;  3GZ7 A;  4O4R A;  2FC8 A;  4RNH A;  4H4K A;  3H4B A;  3CE8 A;  2BJ7 A;  4K4W A;  1TL3 B;  2P8I A;  2E9Z A;  4LR7 A;  3A12 A;  3IM9 A;  3NS7 B;  4AUK A;  1SC4 B;  3IWL A;  3BBF A;  3CO9 A;  2BV3 A;  5KFB A;  3T9Z A;  3SSR A;  4XIU A;  1IJE B;  3Q2T C;  1ZM3 A;  4C7Q A;  1FVS A;  3L9Z A;  1N5Y B;  1WSR A;  1JXE A;  3G71 S;  4CLY A;  4LSL B;  1EQ0 A;  3W2W B;  3QJJ A;  2QFJ A;  2PEB A;  3R7B B;  2CQ2 A;  3HHL A;  5ITH A;  3EZO A;  4F4W A;  1M1G A;  3RTV A;  3OFG A;  1RAC B;  2ZNY A;  4CO5 A;  4ED7 A;  2VPZ B;  4J90 A;  1IN0 A;  3AA8 A;  2FHK A;  3QT7 A;  2QLX A;  3R2C J;  4ZPD A;  1SJ4 P;  3NGD A;  1O5J A;  3VTI A;  5DLF A;  4OYX A;  5THW A;  4DL3 A;  3PX0 A;  4K7Q A;  3C2P A;  2KN4 A;  2NUU G;  2X3D A;  3ETO A;  2B6A B;  3KDO A;  3N28 A;  1Y7P A;  3JSR A;  1L5U A;  1AZS A;  3QWU A;  3D0I E;  2K1R B;  3EMT A;  2PA3 A;  3RU0 A;  1D8Y A;  1H2T Z;  1VRU A;  1U1O A;  4TKT A;  2EKY A;  2IDE A;  2XM3 A;  5CYQ A;  2R2T A;  1S57 A;  2RRB A;  5HMZ A;  3T5L A;  4Q8F A;  3EGW B;  4Z37 A;  3R6L B;  2JLE A;  2W4P A;  1P6T A;  3OTE A;  2Z2Z A;  4EWT A;  1RHU B;  2OLW A;  3CJK A;  3CD7 A;  2VUG A;  2J6S A;  4OX8 A;  4ED6 A;  2J9E A;  2WBR A;  4EO8 A;  3OLA A;  1BGX T;  3CDU A;  2OFH X;  1HNI A;  4KHP F;  1H2U X;  2MZR A;  1DHM A;  1FI4 A;  5BYQ A;  2W24 A;  3J7Z T;  3D4J A;  4KBI A;  2HQC A;  4JI6 F;  3KNA A;  2XLJ A;  2FB0 A;  5EGY A;  2MGZ A;  2KT3 A;  2HIY A;  4B3R F;  5GAE U;  4CWB A;  5KFS A;  2HHX A;  4QPX A;  1U6Z A;  2BRK A;  2XGP A;  2AYM A;  3ZZP A;  3M32 A;  2IVF B;  1PJ7 A;  5A8W A;  3AH6 A;  2XSF A;  3B78 A;  2QA4 G;  4UY8 T;  3F41 A;  3GLJ A;  1TFY A;  3EYZ A;  1TV6 B;  4AL7 A;  2YPZ A;  3AXM A;  2C42 A;  4ATN A;  1X4H A;  1SKR A;  2JX2 A;  2DR8 A;  3C16 A;  2IY5 B;  3VQS A;  3MR6 A;  2HFZ A;  3C14 B;  2HS4 A;  3B82 A;  3BZQ A;  2YY3 A;  3B4M A;  4LR9 A;  4A8K A;  1RT4 B;  2EFQ A;  4I6A A;  2HGL A;  3QRP A;  3MEG B;  2M5Y A;  3AJ2 A;  2WTF A;  3MFI A;  2HFU A;  1CJU A;  4DUZ F;  2DTJ A;  5KG1 A;  4WTO B;  3RJM B;  5AXM A;  1JNZ B;  1RWU A;  3IR7 B;  4R5P A;  1SJ1 A;  2VC1 A;  4RNO A;  4RUC A;  1KN6 A;  2ZH1 A;  3R2D J;  3D6T B;  1CS4 B;  2X1G A;  3V6J A;  5A8K B;  4ETZ A;  5K9F A;  2RHQ B;  2KYZ A;  1ACM B;  3PW2 A;  1S9G A;  1ULR A;  3K0J A;  3I9Z A;  4YUD A;  2YKA A;  1ZA2 B;  4NXM J;  4GO7 X;  3IS9 A;  1RT7 B;  4ECT A;  3UWT A;  2ZHB A;  1NK4 A;  4N77 A;  2HUR A;  3MAA B;  2ZH8 A;  4PWW A;  4KE5 A;  3MED A;  2M7S A;  4ZLN A;  3RAX A;  2IRX A;  1KQF B;  2CQI A;  1L3U A;  1IR2 A;  2ZD1 B;  2CG8 A;  2ERR A;  4WXW A;  1NND A;  2YBV A;  3GYX B;  5GAG U;  2JVR A;  4L76 A;  1CJK A;  3AFG A;  2B43 A;  1IBL F;  2QT7 A;  2F4V F;  5J2P B;  3D2W A;  4LJM A;  1FDD A;  3X3U A;  1WTB A;  1DBD A;  4DV6 J;  1UP1 A;  4A8S A;  4OJG A;  3HFV A;  4XPE A;  3SQG B;  1RHJ B;  2KYX A;  4ZK7 M;  2HWT A;  1VGY A;  3FQK A;  3FZB A;  4DFM A;  3UW1 A;  1MMD A;  2CJB A;  3GON A;  1G6B A;  4C8M A;  4E0D A;  1NZA A;  3C66 A;  1UTA A;  2FLP A;  1U25 A;  3LWM A;  1WC0 A;  1C1C B;  3HO1 A;  3E01 A;  2UU9 J;  2G4B A;  4M5K A;  2DXE A;  3CC7 S;  3QGP A;  1ZPV A;  1WKJ A;  4CT9 A;  4P9S A;  3HXM A;  3KHR A;  3BYP A;  3DMJ B;  1EQM A;  3IFE A;  4MK9 A;  5KFD A;  1G4C A;  1K47 A;  4JI5 F;  1LEO A;  1GTH A;  3R7N B;  5C2C A;  4WE1 A;  3LGM A;  3PYG A;  2QTW A;  4I7F A;  1D3W A;  1VMB A;  4HI1 A;  1XR6 A;  3C15 A;  3BH6 B;  3PO5 A;  2HNY A;  4AXI A;  4LMZ A;  2V8D A;  4RJV A;  2AZ3 A;  1MLA A;  1T05 A;  3RUB L;  5ETO A;  3KJF B;  2B9W A;  2PC6 A;  3AD7 C;  2EG1 A;  3G86 A;  5IM0 B;  1LWF B;  3SIP B;  2CQH A;  1UFL A;  1KLN A;  2C2K B;  2ASL A;  2FY1 A;  3MCN A;  2POK A;  5I3U B;  1PAE X;  4F26 A;  1P9Q C;  5KFZ A;  2HBZ B;  2AT1 B;  2XMV A;  1TQL A;  3CDA A;  5HJX A;  4V19 X;  3VAI A;  4ELV A;  1FKP B;  5L1I A;  3UDC A;  1WOP A;  1N4L A;  2CVE A;  1NSQ A;  4JI0 J;  4K4U A;  4PWU A;  2ZE2 B;  5ETQ A;  3MM8 B;  2KKH A;  3VVT A;  2HND A;  4N5S A;  3G8S A;  3UI3 A;  2PN6 A;  5LJ3 Y;  3DDN A;  3EUN A;  5LMU J;  5F3T A;  3BF4 A;  1VK3 A;  4YDD B;  1F3V A;  4IOC Q;  2F4F A;  3BDE A;  4YME A;  3KNG A;  1RHQ B;  1FEE A;  5LSR A;  4ZCL A;  1GEH A;  2OO4 A;  3MR2 A;  4N41 A;  3MTJ A;  2E1C A;  1C1B A;  3I32 A;  4TYB A;  5DGB A;  2VHG A;  2FUG 9;  4EU0 A;  1R27 B;  3GFY A;  4AQY J;  5DG7 A;  2KHC A;  3BQ1 A;  1NK0 A;  1NBE B;  5EWE A;  2BQU A;  2YNH A;  2VG6 B;  4DR1 J;  2DO4 A;  1Y5N B;  3NGR A;  1Q7L B;  5I42 B;  3B6B A;  1ROF A;  4F8R A;  3S01 A;  1HNX J;  2IRY A;  4PCQ A;  4ECX A;  5B7W A;  4DS5 A;  5ETM A;  4YB1 P;  4X4V A;  5F8G A;  4O3N A;  1SQE A;  1HBO A;  2JFD A;  3RBD A;  5F9L A;  2EFG A;  3FNN A;  2R7S A;  1FRM A;  2IFX A;  4ECU A;  1JLA A;  3MPY A;  3MR5 A;  1ZZN A;  2PMZ D;  3FEY B;  3NY0 A;  1NK7 A;  4F4A A;  4QW9 A;  5K8M A;  3R5C A;  4B9V A;  5EX0 A;  5E2Q A;  3VV2 B;  3QFH A;  4LBH A;  3VZH A;  3DYA A;  2OMO A;  3F56 A;  2MKJ A;  3ZZY A;  1G2E A;  1VBY A;  1V5V A;  1GX6 A;  5DRK A;  1CUL B;  1SUQ A;  1XK8 A;  3LOU A;  4LQ3 A;  4LSZ B;  5ETN A;  4IH5 A;  4WP3 A;  1WDD A;  3DFE A;  2ZH2 A;  1YRU A;  3W5X A;  1KVK A;  4UZB A;  3CCM S;  3QMQ A;  2M3D A;  1OO0 B;  5F9N A;  2HK2 A;  3CVK A;  1YJU A;  4D3G A;  3MFH A;  4I68 A;  2V4Q A;  4ZVH A;  1SB6 A;  1Z2L A;  4DR6 J;  2NXC A;  3AT1 B;  3OD2 A;  2O67 A;  3SSQ A;  3IRX B;  3M6X A;  2CQ1 A;  4H4K C;  5HMW A;  3TZX A;  3GV8 B;  4X2B A;  3T9N A;  2ZBQ A;  2YKP A;  3KK3 A;  2MB0 B;  3JSM B;  4PG7 A;  1OMS A;  1Q81 T;  2RKI B;  2NR0 A;  1S9E A;  3OHB A;  3M2V B;  1HBN B;  4OV6 A;  3R97 A;  2HFS A;  4O0I A;  3CJ0 A;  1NEE A;  1PKU A;  4YY3 F;  3BEG B;  1RWP B;  3DRP B;  3HHL C;  4J9L A;  3HFK A;  3ZTS A;  3T6B A;  3PEH A;  4YR3 A;  3PAC A;  4NLO A;  3ZTR A;  4GKJ F;  3TAR A;  2QO3 A;  2UUC F;  1RKI A;  2DGV A;  4RW9 B;  5C25 B;  5F8M A;  5LJ5 Y;  1NKE A;  3E2E A;  2FHJ A;  5AE2 A;  2LVW A;  3QYY A;  3JB9 k;  1Q8B A;  5C42 B;  2HS0 A;  3H5S A;  1R0A B;  3OXL A;  2VOP A;  1R8B A;  3LP0 A;  3K8W A;  3IR6 B;  2CPZ A;  4K2J A;  5ADZ A;  2W01 A;  2BKP A;  3EPG A;  3D9B A;  1RAH B;  3EWG A;  5HK4 A;  1FE0 A;  3M1V B;  5ETK A;  4QYR A;  1C0U A;  2DIT A;  1X9S A;  2J6U A;  5KG6 A;  1BQX A;  3W1Y C;  5LMN J;  4KKO B;  2GIF A;  2BAB A;  2ILY A;  4WFN Q;  1WF1 A;  4HI2 A;  4TQR A;  4K0K J;  2CJA A;  2YWH A;  4QIE A;  3I5A A;  2OPS A;  1FXD A;  7FD1 A;  2DNP A;  4Q0B A;  2BJ1 A;  1KTV A;  2RVJ A;  4CT8 A;  2I8E A;  3AJ1 A;  5BR8 J;  5B0G A;  2EKN A;  2VBY A;  4G3I A;  1IBC B;  1Q1K A;  3CUN A;  2IVM A;  3GQC A;  3BV8 A;  1XJW B;  4F02 A;  3DI6 A;  3D5M A;  2DO0 A;  5DDO C;  4C3M A;  1U0H B;  2ALY B;  5KFY A;  2C3Y A;  1R8A A;  4CLZ A;  1QE1 A;  2U2F A;  3M6U A;  1NH8 A;  1RAF B;  4FP9 A;  3UN5 A;  2LFV A;  3PW4 A;  2Z4P A;  3HD2 A;  3O2I A;  3C46 A;  2N7C A;  2HRY A;  2XQC A;  3MOZ A;  2YKM B;  4DV2 J;  2GVD A;  2M8D B;  2YKN B;  1L3S A;  2OPP B;  1MWQ A;  3QZ8 A;  3WDO A;  3ENW A;  2DRD A;  4DLE A;  4ZVE A;  3E8O A;  2QSW A;  5FDL A;  4P73 A;  3M2U B;  4XPC A;  3LQV A;  1R3N A;  2KRR A;  4A4J A;  5AXK A;  2N4D A;  4JV5 F;  2JJ4 D;  4NA2 A;  5DDP C;  4QIW D;  2COL A;  3GP9 A;  2FLL A;  4DR7 J;  1ZBT A;  2EBE A;  3MM6 B;  2AF6 A;  5BXI A;  3EGN A;  2IBK A;  2QMU B;  3OV7 A;  4ELT A;  2OPQ B;  4LSL A;  1FWL A;  3W2W A;  3L7U A;  5E0O A;  3PG9 A;  4EI2 A;  2XMU A;  1IKY B;  1QTN B;  2XI2 A;  2CAJ A;  3U1M A;  3IO1 A;  3UD4 P;  2VAS A;  2JSX A;  1VHF A;  4CO1 A;  2O1P A;  4GC6 A;  2ZOG A;  1F1B B;  2DIU A;  2MST A;  3LP1 A;  1HI8 A;  1M0S A;  2G0I A;  2DGX A;  1GK8 A;  4DCP B;  5IZH A;  4FKX A;  3GG1 A;  2GMH A;  4R25 A;  2V50 A;  4WJB A;  1KRP A;  5L8R C;  2XUL A;  3G87 A;  1QVF R;  2EBG A;  2QFI A;  3MHY A;  4CM2 A;  2MHN A;  2C1E B;  1BC6 A;  5KG2 A;  1YGY A;  1FO1 A;  3CJ8 A;  2DNY A;  2ZUG A;  3DKD A;  1N32 J;  1B64 A;  1IKX B;  4DR4 F;  2ROG A;  2XMA A;  1NHV A;  5ETV A;  4JYA F;  1LK7 A;  2PI4 A;  1V3Z A;  3VZI A;  1FJG F;  1Q4R A;  2FHO B;  4USH A;  3CC4 S;  3M8Y A;  2D9P A;  1HNZ F;  1FTC A;  3V2U C;  3MOJ B;  3K5N A;  1XBW A;  2CFX A;  3W9J A;  1TFW A;  4MIB A;  1HBM B;  3PJX A;  3ONQ A;  4PQU B;  2QRR A;  3CD5 A;  2R8K A;  3MMA B;  2XZT B;  2YKO A;  4L75 A;  1KHV A;  4PWD B;  4IOA Q;  1H3D A;  1S1T B;  3DGP B;  4YR2 A;  3SEO A;  1ZTW A;  3Q86 A;  2KU7 A;  4ES1 A;  2MSS A;  1RK8 A;  2N7Y A;  3AD8 C;  2WAQ D;  3I0R B;  2ZH6 A;  2E29 A;  3HI9 A;  4ZIW A;  5H1S V;  2K3K A;  3NGU A;  2X7I A;  4NCG B;  4PUO B;  4FYY B;  2WVD A;  3JSB A;  3KLF A;  4CZC A;  1HAR A;  4NEY A;  3Q22 A;  2J76 E;  2OD4 A;  2HZC A;  3HSZ A;  4N76 A;  3OVS A;  1BY9 A;  1SC6 A;  1EX8 A;  3O8W A;  1ZS6 A;  4GVL A;  1TV6 A;  1F0X A;  1RQ0 A;  3T1Y F;  5D78 A;  2YWF A;  2ZKT A;  2DNR A;  1Q8K A;  5GAE I;  2NPF A;  3C14 A;  3P45 B;  3TUZ C;  2RML A;  4RWW A;  2XMK A;  3R5G A;  4FNI A;  2R7U A;  4DX7 A;  1QAX A;  4CNY A;  1FWP A;  3W60 A;  2BAN B;  3N5B A;  1V3R A;  3MEG A;  1S97 A;  4EMD A;  2E1P A;  1Q5Y A;  4MIA A;  1S0V A;  1SIZ A;  2KFZ A;  4F3Q A;  4ZLP A;  2I5J B;  4JI8 F;  1FE4 A;  4DZ6 A;  3BPD A;  2QN6 B;  2V4J B;  4RUA A;  3M6W A;  3H42 A;  4G1P A;  3BN7 A;  1GX5 A;  5KAK A;  1FDB A;  1YSJ A;  2JC0 A;  3P96 A;  2QMW A;  5IQQ A;  3NOC A;  4DR5 F;  3R5J B;  3P3D A;  2EEY A;  2AHO B;  3QLH A;  2V8H A;  3OT9 A;  2E9R X;  2L9N A;  2M2B A;  2Z0G A;  5DG9 A;  1OPI A;  4OIX A;  4LRD A;  2VFV A;  5H9F J;  3CJ4 A;  1BD6 A;  1DQA A;  3MAA A;  4M5I A;  3K5O A;  4EBC A;  2YNI B;  2ZD1 A;  2JC1 A;  1HNW F;  3KK2 B;  2NZC A;  1CC7 A;  2E44 A;  2AIR B;  2MDA A;  2GX8 A;  1A6L A;  5B09 A;  2DYA A;  3IG1 B;  4CTA A;  4E8U A;  5J2P A;  4PG4 A;  2G2O A;  1YIT S;  3NMA A;  2YXL A;  1FER A;  3DNC A;  3GJQ B;  1XC9 A;  4AD6 A;  4DWI A;  4MFB B;  2UXD J;  3SQG A;  3DU6 A;  1T9X A;  1RTH B;  4WII A;  2RSQ A;  3D6F B;  4PPD A;  5GAG I;  2JVO A;  2LKZ A;  1M5O C;  1E6V A;  1ZM4 A;  2BQR A;  3MPW A;  2KZZ A;  2KDO A;  1JIH A;  5KFT A;  2C2N A;  2HZV A;  1LW0 A;  4OHW A;  2PEH A;  2BKO A;  1VQ6 S;  1C1C A;  2VH7 A;  3ILJ A;  4Y6I A;  2B4P A;  2JOQ A;  3EVO A;  4QIG A;  3UDL A;  4YR0 A;  4USK A;  3GFZ A;  1WI6 A;  3VHQ A;  1NSP A;  3DMJ A;  4USI A;  3Q8V A;  4IQM A;  4IO1 A;  4H4M B;  4WKR A;  3Q8P B;  1MW7 A;  2XYG B;  4QJV A;  2K7J A;  3AOB A;  4OZJ A;  4F36 A;  5B08 A;  1NCL A;  2JEG A;  5KFV A;  2ASJ A;  4NML A;  4P2S A;  5DJB A;  3M8Q B;  4MYT A;  3HZE A;  2JH3 A;  3HHL D;  1S6P A;  3KUH A;  3MMB B;  2JNJ A;  4QIV A;  1HD0 A;  1SCJ B;  2PMH A;  1M5P C;  2IM0 A;  4M5J A;  3T5K A;  2XSJ A;  3OSN A;  2RQC A;  3GJR B;  2IPO B;  2RS8 A;  2QMX A;  1WSV A;  5I4M A;  3SFU A;  3GYG A;  4KT0 C;  5IM0 A;  1LWF A;  1IM4 A;  2KG0 A;  4ETX A;  3BS9 A;  5BYS A;  1FES A;  1NU4 A;  3OL9 A;  1FRK A;  1RHR B;  1NHK L;  2R2S A;  3T5H A;  3S8S A;  4FXV A;  3CDE A;  1Q8I A;  5I3U A;  1XR5 A;  1YBU A;  2ZKU A;  3BO3 A;  4BLG A;  4C0O C;  1RAI B;  4DQR A;  4ZS6 A;  2E1A A;  3HKZ D;  3ISN C;  5EDW A;  1I3O B;  3VR1 A;  2VPW B;  1Y0H A;  3CED A;  4OHZ A;  1JKH B;  2VD3 A;  4USJ C;  1FKP A;  5K8O A;  4X4N A;  3FEZ A;  4WCE Q;  1V5I B;  3ZC4 A;  2XWX A;  3DC2 A;  4DFK A;  1NJY A;  2I38 A;  1LQ9 A;  3MPU B;  1NK8 A;  2ZE2 A;  1QUV A;  3MM8 A;  4LT6 A;  5KT5 A;  3HHK A;  1GMV A;  2H3E B;  4BS2 A;  3V6H A;  4IR1 A;  2F65 A;  3T1H J;  1RTD B;  1IQT A;  4NLU A;  5F8L A;  2IBO A;  4TQS A;  2LXU A;  1DTT B;  4E2F B;  1Q53 A;  1S6Q B;  3PIO Q;  3A3P B;  4M5M A;  2DHH A;  5LOQ A;  4YOE A;  3FFI B;  2WVB A;  4OYO A;  4C8L A;  4ANE A;  2B51 A;  3MEE A;  4DL0 C;  4X4S A;  3CSK A;  2XYH B;  1MRO A;  4FZV A;  4Z2X A;  1RLD A;  4DV1 F;  2G9O A;  2IM3 A;  3PRB A;  4C4W A;  1M1K T;  4PRF A;  3KK1 B;  2WON B;  5GMD A;  3OXG A;  1DAR A;  4IRK A;  3DOM B;  1VQ4 S;  1RCX B;  2MLY A;  1RTJ B;  1WI8 A;  1MSW D;  1QAY A;  4RW8 B;  4CO3 A;  2YWE A;  2LXI A;  4PXB A;  1RT3 B;  3WX4 A;  3TO8 A;  4ANC A;  4G6V B;  4XAK A;  1SH2 A;  2P9G A;  3NGS A;  1VCT A;  4ED1 A;  5KFI A;  3CCR S;  4USV A;  3K59 A;  3V6D B;  4RWX A;  4BWM A;  5CZX A;  3KJQ B;  4F0K A;  4K50 A;  4ZP8 A;  1UEK A;  4F2R A;  4K8R A;  5D4N A;  4CQ1 A;  2AJQ A;  3VAK A;  1OY6 A;  5IV4 A;  3I5B A;  4KRW A;  3DRX A;  4ECZ A;  3L3C A;  3BSN A;  2YQ0 A;  2KT5 A;  3HT3 A;  2OEL A;  1K0V A;  2WHO A;  5DDR C;  2L3M A;  1XQI A;  5ETS A;  1RWX B;  1VHI A;  2PDA A;  4KFB B;  3IRX A;  4OYM A;  1YJT A;  4OJH A;  8RUC A;  3EVW A;  3BKT A;  2BBE A;  4NLP A;  2RE1 A;  4DS4 A;  3WC0 A;  3MGJ A;  2DPJ A;  2R7X A;  4A8M P;  2FGC A;  3J7Y U;  2R7Q A;  3JSM A;  3KKF A;  3THV A;  3D28 A;  1VQ9 S;  1A9N B;  2M4M A;  3J81 U;  3M2V A;  2ZZN A;  1HBN A;  4KJI A;  4Q43 A;  2ZWO A;  1Q0N A;  4P71 A;  3TZW A;  5D8H B;  2RD5 C;  1HIY A;  5EWF A;  4O3S A;  5FLX U;  4KHP J;  1WF0 A;  3DRP A;  4Y2C A;  2ZZT A;  3RB3 A;  2D1C A;  1X4D A;  4O44 B;  4JI6 J;  1FKO B;  4DFJ A;  4NAS A;  1EET B;  4DV5 F;  4RW9 A;  1X4E A;  3LUY A;  3TJA A;  5C25 A;  2LEP A;  2APO A;  3BN4 A;  4B3R J;  4L6V 3;  2EK1 A;  3SDE B;  3P4U B;  2IJR A;  5C42 A;  3AB4 B;  2W2O P;  4CI0 B;  3LGN A;  1S1U A;  3IAM 9;  1VIX A;  6FD1 A;  4YHH F;  3EDQ B;  4HKQ A;  4FXD A;  3M1V A;  2GS8 A;  3D0H E;  1B70 B;  5BJR A;  2X1A A;  2CPI A;  3OR2 B;  3R1H A;  4O3R A;  5CCM A;  4KKO A;  2NXU A;  2DIV A;  1UA1 A;  3GIR A;  1DAX A;  4ER8 A;  2D3O R;  5F8I A;  3GCX P;  4PG6 A;  4DV3 F;  2J8A A;  5A0Y B;  1RWM B;  1S7I A;  4F4Y A;  1NJI T;  4ITS A;  1SQF A;  7FDR A;  1FRL A;  3M9M B;  1XWL A;  2B3T B;  4C98 A;  5AJ3 J;  3FUY A;  4AND A;  2KJV A;  4DUZ J;  1P27 B;  4WIQ A;  4EO6 A;  1PGZ A;  3RBX A;  1U0H A;  3SMZ A;  2UUW A;  3N6N A;  1UFK A;  2BMB A;  5DS7 A;  3LAL A;  3NP5 A;  2VF3 A;  1QAJ A;  2HPU A;  4DCJ B;  2PE8 A;  3TAQ A;  2HS3 A;  2DT9 A;  1RWW B;  2YKM A;  3MR7 A;  1P1L A;  2J0Q D;  5KFQ A;  2Q3P A;  2YKN A;  1XN9 A;  1SXL A;  2OPP A;  3CXC R;  3PDN A;  4QPT A;  2D74 B;  1U2F A;  4KV8 A;  1F5C A;  1OIA A;  4P7T A;  3HZG A;  1X4A A;  3CJS A;  1X4G A;  2CQ0 A;  3W7B A;  1K9M T;  3VGT A;  4JI2 F;  5CHC B;  3M2U A;  4C11 B;  2CVI A;  1FDN A;  2QLB B;  2D41 A;  3CO0 P;  1SH0 A;  4IQX A;  2GAG C;  3MM6 A;  5AE1 A;  4NWB A;  2DH8 A;  3ZNU A;  5KG0 A;  3OW2 R;  2G1D A;  2OPQ A;  2GVZ B;  1S99 A;  1IBL J;  2F4V J;  3MAH A;  5T41 A;  2CQ4 A;  2RRA A;  1I51 B;  2VPY B;  3GIK A;  4LVN P;  2H9Z A;  1PYT A;  4FYV B;  1AFI A;  5JUM A;  1VRU B;  2M8H A;  2D3U A;  4PKD B;  4HLB A;  4B9M A;  1U1Q A;  1WF2 A;  2KB2 A;  1NK6 A;  2F9J A;  2NXJ A;  4WK3 A;  4OLP A;  5HVF A;  2I6W A;  3R9L A;  3TQ1 A;  1IKX A;  1YJV A;  4F7V A;  4JI5 J;  5F8N A;  2YTC A;  1I1G A;  3AQO A;  4DSJ A;  1NJW A;  1VI7 A;  2CZV C;  2GGP B;  2HW3 A;  2ZWP A;  5FJ4 A;  4RUB A;  2CWX A;  1IKW B;  3FCH A;  2IJF A;  1XIQ A;  4DL5 A;  1HBM A;  2B8P A;  4PQU A;  1IM6 A;  4ERD A;  1RKJ A;  1ARO P;  3MMA A;  1AUS L;  3DRR A;  3BGF A;  1KON A;  3PHE A;  4PWD A;  2V8V A;  2YVS A;  1S1T A;  4J91 A;  3DGP A;  5J1P A;  4PYD A;  2Z8Q A;  1FVQ A;  2CJ9 A;  1FKA F;  3OL8 A;  3JSY A;  3I0R A;  3KOA A;  3C16 B;  1LXJ A;  3FBF A;  1DLO B;  4NCG A;  4PUO A;  3VGV A;  4NXN F;  3RAM A;  3TEG A;  2Y8W A;  3VWS A;  1N88 A;  2HVI A;  3FDS A;  2XB2 D;  2HVZ A;  3DLK A;  3L7O A;  2W2N P;  3TA2 A;  1TKD A;  1H72 C;  1YBA A;  1WOO A;  3AD9 C;  4DMZ A;  3IR5 B;  5DDQ C;  3PYD A;  1HQU A;  8ATC B;  2WSC C;  3UDV A;  5HAO A;  2HHT A;  4Q2M A;  2DIS A;  3VAJ A;  2MHE A;  4EBD A;  4EGL A;  3SQO P;  4OX6 A;  5ETL A;  5E3R A;  3OBI A;  1K8A T;  3HMJ G;  1EJ7 L;  1YHQ S;  3N4W A;  2BAN A;  4WXO A;  1BQN B;  4M5N A;  1X4B A;  3HF5 A;  1S9G B;  3A8K A;  3OTB A;  5LL6 d;  5DM6 Q;  1UJ6 A;  3K17 A;  3FSY A;  1U24 A;  4U67 Q;  2CXE A;  5E7O B;  4NEZ A;  1LNQ A;  2B7C B;  4TXS A;  2GQ2 A;  4OHX A;  3UR3 C;  4QU7 A;  4U96 A;  1GH8 A;  2FHJ D;  1RAA B;  3T19 A;  2V4J A;  1Q86 T;  2E66 A;  3MED B;  3ITH B;  3KHH A;  2LA4 A;  1T94 A;  1WC4 A;  1KDN A;  1FFW B;  3RYL A;  3EDR B;  1F9E B;  4DFP A;  3RZA A;  2H65 B;  4I2Q B;  1BXN A;  1TL5 A;  4PAB A;  2N82 B;  4EUV A;  2GQQ A;  5D0G A;  2RAQ A;  3MZI A;  2GAH C;  1J5O B;  1MU2 B;  2EW9 A;  5I3Q A;  3ADA C;  1W7W A;  1HW8 A;  2C3P A;  2YNI A;  2AD9 A;  1ZOT A;  3MD3 A;  3KXD A;  2CNK B;  3KK2 A;  2UZA A;  4HH1 A;  2VL1 A;  2MPU A;  1NXI A;  3G9C A;  5JMN A;  4X62 F;  3M6V A;  1ELO A;  1XNQ F;  3LH2 S;  3CCQ S;  4NA1 A;  4WBF A;  1RTI B;  3UCG A;  1TU0 B;  3M05 A;  3GMG A;  4YDX A;  4MFB A;  4A8X A;  1TZ0 A;  4IKA A;  4U7C A;  5GVQ A;  2VIC A;  3CCS S;  4DLG A;  1LOU A;  2R8H A;  3IBC B;  5KFJ A;  2VQF F;  1YX2 A;  3AB2 B;  2ZOF A;  3BPS P;  5AE3 A;  3CCT A;  1YJ7 A;  4CP5 A;  1SL1 A;  2ZUA A;  2GMJ A;  2KXN B;  2FQQ B;  2O5D A;  4KGX B;  4DEZ A;  1PJ5 A;  1CC8 A;  2ABY A;  1UL3 A;  3W9H A;  3AQP A;  4H4M A;  3Q8U A;  4B3M F;  2XZW A;  4G1Q B;  5D0H A;  3ISZ A;  2HGN A;  1RBA A;  4C97 A;  1TEL A;  4YY3 J;  2AMC B;  1NKB A;  3CTR A;  3BBB A;  1QSY A;  5B0B A;  1RA6 A;  4P6Q A;  4F0H A;  1IWA A;  4GKJ J;  1S4F A;  4A47 A;  5C5J A;  4DR3 J;  2R7V A;  2UUC J;  3G6E S;  1VC0 A;  2WB4 A;  4ILR A;  1TUW A;  2X3G A;  4X66 F;  4J9P A;  1RHK B;  4FF1 A;  1OY8 A;  1RAD B;  3VF0 B;  3OL7 A;  2WVE A;  3N9U C;  3H2V E;  4LSN B;  3LAK A;  3NEK A;  3PY8 A;  1EP4 B;  2CJQ A;  3K5P A;  4L74 A;  4B9T A;  4WWS A;  2FGO A;  3WX8 A;  3AJD A;  4LF7 F;  1JKH A;  1T8E A;  2DEJ A;  4QR2 A;  2A6M A;  4Y28 C;  1OY9 A;  3L7P A;  3PV8 A;  1RU2 A;  4ZLJ A;  1R6Y A;  1S1V B;  4V1A k;  2E1R A;  4XK8 C;  3HVT A;  1M5S A;  2ILZ A;  1N8R T;  1RTD A;  3W61 A;  1DTT A;  2V9K A;  1GXU A;  1S6Q A;  2ADB A;  3R5D A;  1FF2 A;  1TL7 B;  2M52 A;  3LW5 C;  1UMJ A;  4Y2K A;  1EZZ B;  4ECW A;  5J1N A;  1S59 A;  2OD6 A;  2HQI A;  4CDI A;  1RI7 A;  4MYU A;  2RQ4 A;  1HW9 A;  3I56 S;  4J9M A;  5J1E B;  2RDD A;  3H2L A;  4ID8 A;  1OYD A;  5CA5 A;  3QRQ A;  3TW0 A;  3KK1 A;  4N8O A;  2JHE A;  2W2Q P;  4JV5 J;  1F5A A;  2HNZ B;  1UFW A;  4IO9 Q;  1YDL A;  3DLJ A;  3DOM A;  1U02 A;  3MUV P;  1VC6 A;  4G1I A;  1RTJ A;  5GAD I;  1N54 B;  4CO0 A;  3LP2 B;  4P52 A;  4XDD A;  1Y5L B;  3IXQ A;  4WZQ A;  3PEJ A;  2HEK A;  3TA1 A;  4JOU A;  3NS5 A;  4RW8 A;  2JDJ A;  2HIQ A;  3ENQ A;  4UOC A;  5LM7 E;  3BR9 A;  3PYE A;  3I82 A;  1RT3 A;  2CPE A;  2CUY A;  1FTR A;  4CLW A;  4R0J A;  2CZ4 A;  3S6E A;  3V6D A;  4OYP A;  2G1H A;  1FWK A;  1P9Y A;  1B99 A;  3W2V B;  1LKZ A;  4UF4 A;  4OZ1 A;  3NS6 A;  2G2Z A;  4ZVT B;  5D4O A;  1BLU A;  2J5A A;  4J9S A;  1I94 F;  4ZOS A;  2UUA F;  1HWK A;  2MKC A;  1K0T A;  1UVJ A;  3D6M B;  4DR4 J;  2O3D A;  4O23 A;  1KC8 T;  2F8E X;  4JYA J;  2IMO A;  3NLC A;  2DY1 A;  3UD5 A;  1FJG J;  1RWV B;  2GFF A;  3HSJ A;  2BJ8 A;  4LFB F;  4M1K A;  2DY9 A;  1HNZ J;  2FY8 A;  2HBQ B;  3CF5 Q;  2BA9 A;  3D1Q A;  2OFG X;  4I64 A;  4OI4 A;  3VAF A;  2WK4 A;  2RDI A;  5D0E A;  1HL6 A;  1RXO B;  4U7U K;  3QJP A;  3WIU A;  3O1L A;  2FZC B;  2XTJ P;  1S1W A;  4JB8 B;  2ZH7 A;  4IYQ A;  2AGO A;  2HQG A;  5KG7 A;  2J0W A;  1JJC B;  5C7P A;  4O44 A;  2RHS B;  4U6P A;  5H9F K;  1U8S A;  1EET A;  1OWX A;  3MUM P;  4DV7 F;  3D54 A;  2FJE B;  2E1M C;  3QPI A;  4GKK F;  1JNR B;  1QDU B;  4J9K A;  1FRX A;  4YQW A;  3SDE A;  2Q6C A;  4OJ1 A;  4ZJL A;  1MNE A;  2HHH F;  3HHN B;  2HVH A;  1PBA A;  1DUR A;  4WFZ A;  1EIY B;  1PC4 A;  1NH7 A;  5G0R B;  1HHT P;  4ZP9 A;  2IAJ B;  2VDI A;  3G6X A;  5B0E A;  1R6V A;  3EX7 B;  3CW2 C;  1X4C A;  3T1Y J;  3OR2 A;  2J9D E;  1S72 S;  4IRC A;  5IV3 A;  2IM2 A;  4Q8E A;  4DQP A;  3S1T A;  3CMQ A;  1HWI A;  3BQ2 A;  5MAO A;  3L4B C;  3TVK A;  4ZDN A;  3FGV A;  4DI6 A;  4DPO A;  2XCA A;  1DZ5 A;  4KSE B;  3U7J A;  2JFK A;  4S0M A;  5A0Y A;  3SFG A;  2JEF A;  2PFD A;  3TUJ C;  2QL9 B;  2GVD B;  2QA1 A;  1BWV A;  4PG5 A;  4B08 A;  4ZPC A;  5KFF A;  4K4Y A;  3NNH A;  4ILL A;  3WHI A;  2FJB B;  2H4Y B;  1T9T A;  1BQM A;  3PJW A;  2AJ0 A;  1ZTT A;  1ZH5 A;  2KTQ A;  1IBM F;  1GQE A;  3CCZ A;  1LWX A;  3P8B B;  4RX6 A;  4X84 A;  4JI8 J;  5HMY A;  2HK3 A;  4IH6 A;  5FDL B;  3IN5 A;  3KMQ A;  2V9W A;  1BMQ B;  4ZVS B;  3BM7 A;  2EWH A;  2G0J A;  4PEO A;  3J81 j;  2EK6 A;  2FD2 A;  3QO9 A;  2VC0 A;  4MIW A;  2UUT A;  2BKN A;  2LMI A;  1REG X;  1QUP A;  4HT7 A;  2A18 A;  4FF2 A;  4DR5 J;  1HQ2 A;  3FVY A;  3U1L A;  2D7S A;  4OHY A;  4WFY A;  2GHV C;  2BVZ A;  1VQL S;  4JI1 F;  2QC3 A;  4TN2 A;  4BWJ A;  5IT9 Y;  4PXC A;  2MQN A;  5IWA F;  4UST A;  3LP1 B;  2RJZ A;  3GII A;  4C11 A;  2JWN A;  3I4H X;  4M5D B;  4ID5 B;  2EVZ A;  1VR6 A;  5D4L A;  1HNW J;  1EHW A;  2XHW A;  3HPO A;  2JL9 A;  4Q45 A;  4B9N A;  1U1M A;  2GVZ A;  2GZO A;  3BSC A;  3CUL A;  2UV8 A;  2Y1L B;  2VFT A;  1GFW B;  2GQC A;  2DB1 A;  3G82 B;  3EVM A;  1NDK A;  3BQ0 A;  3T5J A;  4WP8 A;  1W25 A;  3EGV A;  1JXV A;  2X1B A;  4YFU A;  5HBM B;  4HTI A;  1IWG A;  3GJS B;  1KR4 A;  3TRG A;  4RUH A;  3OL6 A;  2VV5 A;  5IC6 B;  4C8Z A;  1R8C A;  3IAS 9;  4ED4 A;  2CPJ A;  2VOO A;  1VQM S;  4TYA A;  2LQJ A;  1UEV A;  1U49 A;  4M5G A;  3W65 A;  4L73 A;  5KFU A;  3WQP A;  3QSY B;  5KFN A;  1AUD A;  5A8R B;  3GR1 A;  3R5A A;  2MJU A;  1V6H A;  2AEF A;  1UVL A;  2DHS A;  4LVO P;  3EZU A;  4CH7 A;  4P2X A;  1Y3J A;  5H9E K;  2CNL B;  3MM7 B;  1U45 A;  1R7I A;  1L3K A;  1X5P A;  3OHA A;  1HWJ A;  5KT2 A;  4M95 A;  2UVU A;  3JTO A;  3POT A;  4C48 A;  2DH9 A;  2GGP A;  2ZOM A;  4DPY A;  2LQ8 A;  2R3V A;  4CLT A;  1IKW A;  2CJY B;  1LFP A;  3CJR A;  1FNX H;  3DOL B;  1LV5 A;  1X8D A;  4URQ U;  4CYU B;  3KLF B;  4LF4 F;  3QT5 A;  5ETR A;  1B0V A;  4OYA A;  4NX9 A;  3DLH A;  2WVF A;  3TA0 A;  3FMW A;  3UDE A;  4IR9 A;  1C4A A;  5F41 A;  1JLG A;  4DQI A;  1QM9 A;  4IRD A;  2Y1R I;  2X1F A;  4KR0 B;  3K89 A;  3H59 A;  2VZ9 A;  5IQ6 A;  3RW6 A;  3FCW A;  2FTR A;  2RIL A;  1DLO A;  2KZM A;  3QAU A;  3MEK A;  2EFO A;  2ZBP A;  1VDH A;  4L72 B;  4ZLL A;  2BW7 A;  2AEJ A;  2PI5 A;  2P9E A;  2A2D A;  1CG2 A;  2YWG A;  4LIW A;  1NPR A;  4F4K A;  4NCB A;  4Z7Y A;  2AGQ A;  3SCI E;  5AJ3 F;  2FVP A;  1VK8 A;  1TK8 A;  1EAR A;  4NLX A;  4A8F A;  1KP6 A;  3G6Y A;  3NWG A;  4HAC B;  3NBP B;  4LRE A;  4DL6 A;  2ZM6 F;  5GAH U;  1NDP A;  3PR4 A;  1HWU A;  4WFB Q;  2XMT A;  1E6Y B;  4H4O B;  1VJW A;  2IHR 1;  3US5 A;  2XHC A;  1BQN A;  3QLH B;  3PHT A;  5MLC V;  2ZBI A;  2B56 A;  4O0N A;  2CPY A;  2PFF B;  2GJI A;  4C8N A;  1FNO A;  2ZJQ Q;  3GR0 A;  1RT6 B;  2DBB A;  1AB8 A;  4DV1 J;  4NZ7 A;  3ICL A;  2BYC A;  2LLZ A;  3ITH A;  1JX4 A;  2J7W A;  3ETM A;  2DEI A;  3FQL A;  1SJQ A;  3FRY A;  2DGW A;  2WOM A;  5KTQ A;  4OMF G;  1FJC A;  1NDC A;  1FRJ A;  2BM1 A;  1QSS A;  4CTA B;  1R0B G;  1S48 A;  3GSI A;  1ZZF A;  3G8T A;  1ZM2 A;  1ZAV A;  5HVH A;  4I2Q A;  4TLQ A;  3BGU A;  1WHV A;  3EM1 A;  4WPA A;  4DBQ A;  4CO2 A;  2IC3 A;  5BYR A;  4QW8 A;  3I0S B;  3K5L A;  1URN A;  1S5Z A;  4FXW A;  3V81 A;  3KHL A;  2V2K A;  1MU2 A;  1J5O A;  3FMB A;  2CQC A;  1KQG B;  1X0F A;  1E6V B;  3FZ2 A;  4QU6 A;  5EHH A;  1RT5 B;  2LP4 A;  1WC1 A;  3KLI B;  4RW4 B;  3TX8 A;  3FBB A;  3VAH A;  4DV4 F;  1LW0 B;  1T7P A;  2Q43 A;  1XNR F;  1N48 A;  5E3P A;  4DZD A;  1RTI A;  3GYN A;  2EC0 A;  3GB0 A;  3A3N B;  3HJF A;  3PFE A;  3Q8Y A;  2U1A A;  4P2F A;  2UV8 G;  2DGS A;  5A2Q Y;  3EJM A;  3LWL A;  2AJ1 A;  3Q83 A;  2DH7 A;  2BE2 A;  2W8K A;  4JV0 A;  4ICL B;  4J9R A;  3VCD A;  2W4C A;  3S7R A;  3IM8 A;  1U47 A;  2VON A;  2DR6 A;  4DSK A;  2BQ3 A;  2EXU A;  3I96 A;  1S6P B;  3AY0 A;  4NRU A;  3M30 B;  2XSJ B;  3HJV A;  1QJH A;  2MKK A;  2GO8 A;  1RAJ A;  4ZIV A;  2ZBR A;  3QT8 A;  1VQ8 S;  2KVI A;  4C8O A;  2R4F A;  5F8H A;  3V4M A;  1Q79 A;  1RIS A;  2MY8 A;  4F3M A;  4G1Q A;  5LSO A;  3GCW P;  4I2P B;  1BUX A;  2AEM A;  3FEX B;  5HRO B;  2XZD B;  2RUS A;  4OI0 A;  4EYI B;  4V19 J;  3CJ5 A;  3FSI A;  4DN0 A;  4UT4 A;  3UN2 A;  1EKR A;  2DNQ A;  2MY7 A;  1HHS A;  3NAH A;  4DV5 J;  4ZP6 A;  4B9L A;  4J7C A;  4WU2 A;  4MMO A;  4LF5 F;  4KYZ A;  4X4O A;  4Y2M A;  3TAN A;  3SBM A;  2B5J B;  1TMM A;  3CD0 A;  1N5T A;  5DQH A;  4DV0 F;  1HI1 A;  4HL9 A;  4NI2 A;  4LSN A;  4YHH J;  3EPI A;  3HM9 A;  1EP4 A;  1UWA A;  3H5U A;  3KLH B;  1WNE A;  2GC8 A;  3QNW B;  5KG4 A;  4M63 A;  3ZNJ 1;  1N5Q A;  3PRD A;  2C22 A;  4EFA C;  1RJJ A;  2XG8 A;  1HR0 F;  2VBW A;  2RU3 A;  1U6F A;  2C2O B;  2D3O 1;  1UVM A;  3ZTQ A;  4DV3 J;  2HHV A;  2A2C A;  3MPD A;  2GW8 A;  2UVW A;  1OQ6 A;  2NPI A;  3IGN A;  1AYE A;  3JQK A;  2DNH A;  3DM2 B;  2BDP A;  3MEE B;  2DR5 A;  1U1R A;  2QA4 S;  3GIJ A;  1MRO B;  3UFC X;  1S1V A;  2FZG B;  1DQ8 A;  4DQS A;  2YH1 A;  4FS2 A;  3GE9 A;  3V6K A;  2B9Y A;  3HFZ B;  4BC9 A;  2B9X A;  2JEJ A;  3T6J A;  5ETT A;  1RAO A;  1W2B R;  1RT1 B;  2YH0 A;  1MML A;  1TL7 A;  2YWW A;  1NSA A;  2YX1 A;  2ACM A;  1HHQ A;  4R8U A;  2CG4 A;  2UVV A;  3B8H A;  2GHW A;  3RB0 A;  5HP1 B;  2E7V A;  2BE9 B;  3TJ8 A;  2W7O A;  3UO0 A;  4IDK B;  5IFM A;  5J1E A;  3D6H B;  1VQK S;  3Q24 A;  4MH8 A;  3L09 A;  4JI2 J;  3F44 A;  3ZZR A;  1TVR B;  3Q8Q B;  4ZA1 A;  2HNZ A;  1D0E A;  3UPF A;  1KLM B;  5KG3 A;  3PRV A;  1NB2 A;  5KFP A;  4A46 A;  3LP2 A;  2QEX S;  4DX8 H;  1PAU B;  2CPF A;  2XO7 A;  2ROP A;  2ZNZ A;  1UCN A;  4MAK A;  5LT5 A;  1Q82 T;  1TUV A;  2XNQ A;  4KH1 B;  3M8P B;  2DNK A;  3N0V A;  1SC1 B;  4K59 A;  1TK5 A;  1OS5 A;  3JYT B;  1LWC B;  1YRT A;  2MZJ A;  2LEC A;  4ALZ A;  2AX0 A;  4OX7 A;  5DGA A;  1G3O A;  3W2V A;  5JVH Q;  2V2Z A;  1WKL A;  1IKV B;  1HYS A;  1N34 F;  4ECR A;  4N7T A;  2WRM A;  3IA0 A;  4LF9 F;  4LF8 F;  4NLG A;  3L95 X;  1WHW A;  3J7Z 5;  4JP8 A;  1UVN A;  4TVA B;  1IVZ A;  1S0M A;  3ZZO A;  4FYW B;  3OR1 B;  5L1L A;  1T3N A;  2OJ3 A;  5HLF B;  4DR3 F;  5D6G A;  1F2H A;  1JLC B;  5SUH A;  3RB4 A;  1KS2 A;  3MWB A;  5J2N B;  3W8P A;  2BW2 A;  1R8P A;  4UY8 5;  5HN0 A;  5KOW A;  4N47 A;  1OSD A;  1S1U B;  1PJ6 A;  4NLQ A;  3LAN A;  4DL4 A;  3MAQ A;  3R3T A;  3W9I A;  3AA9 A;  1ZAW A;  1PYS B;  3PX4 A;  3EE3 A;  2LDY A;  3SSS A;  1S49 A;  1Z4U A;  2YKQ A;  2XMW A;  5FLX Y;  5E3A A;  3BGR A;  2BM0 A;  4NXN J;  4EYH B;  3D7S B;  3WBZ A;  3H25 A;  4DPT A;  4F4Z A;  4NLS A;  1YKW A;  2F1F A;  5HVG A;  3RRG A;  3SV3 A;  1TK0 A;  1WC3 A;  5CCL A;  4EEY A;  2VB6 A;  2OTJ S;  1TP7 A;  3V5R A;  2ZBC A;  2BOP A;  4NMX A;  2HHQ A;  3LAM A;  3AOA A;  2Y0S D;  5G0R A;  1PIE A;  1VQ5 S;  2IAJ A;  3QBC A;  4WTY A;  2V6A A;  5IS2 A;  3CPW R;  4YN3 B;  1XR7 A;  3FRZ A;  2MKS A;  4NYO A;  2XWY A;  4LF6 F;  1SIW B;  5DQG A;  2XI3 A;  2VFS A;  4Q5V A;  1B7F A;  4Z7C A;  2W9B A;  1UPP A;  3FCV A;  3HHE A;  4WU3 A;  3MMC B;  1Q16 B;  4RBT A;  4QWC A;  3D1O A;  3HSD A;  2CDQ A;  2WW8 A;  2KRB A;  2YNF B;  3MTK A;  1KQK A;  2K8G A;  1FXL A;  2LEB A;  1WC5 A;  1RYR A;  4KHM A;  2ADC A;  4I4B A;  1Q7Y T;  3PR5 B;  4FPI A;  2DRA A;  2VFU A;  3KTQ A;  2MKY A;  2ZH3 A;  4KV8 B;  3RG6 A;  2EC2 A;  2VOD A;  4ZPT R;  4P7V A;  1RWK B;  5B0C A;  3M8S A;  3QSI A;  3GIM A;  2HFN A;  4HEA 9;  5HQM A;  3DLE B;  1HI0 P;  3ZZ0 A;  2AJF E;  2HHP A;  1SL2 A;  1Q8L A;  4K4S A;  1C0T A;  5F3Z A;  4C2M A;  1AFJ A;  3W62 A;  4ZJO A;  4OX9 F;  3SXL A;  2WB1 D;  2KFY A;  2YX4 A;  4JI3 F;  4FBT A;  1FJ7 A;  5F0W A;  1HKA A;  5KT4 A;  2FJV A;  4CLL A;  4P10 A;  2VBZ A;  4M94 A;  2M9K A;  4P75 A;  1UZD A;  1HD1 A;  1JB0 C;  4M5D A;  4ID5 A;  3OLB A;  4XTT A;  4LRA A;  4X62 J;  3DXB A;  2FLN A;  4WP9 A;  5AXN A;  3ZZT A;  1XNQ J;  3HDS A;  4O3O A;  3G82 A;  4K4Z A;  3LO3 A;  1WAC A;  1PCA A;  1OSC A;  2CPX A;  4EZ9 A;  4B9U A;  1N56 A;  2QJ3 A;  5HBM A;  3TUI C;  4GC7 A;  2UUB F;  4A8W A;  1LXN A;  3EGZ A;  1CBK A;  4AL6 A;  1UWB B;  3OTO F;  2P2C B;  3N79 A;  1SJ3 P;  2V2Q A;  5GME A;  4J9N A;  2VQF J;  3UNG C;  2NQP A;  3GU0 A;  1T9V A;  1LWE B;  2IDL A;  1FEH A;  2R7T A;  2OH2 A;  3EXC X;  1P1T A;  2J9C A;  5A8R A;  3OTD A;  1RTZ A;  5HO4 A;  3OUY A;  3DXS X;  2DGT A;  2MKH A;  3Q8S B;  1Y9O A;  3TP2 A;  3DRR B;  2QE5 A;  4OZ3 A;  2LEA A;  1X5O A;  1XTZ A;  4NYZ A;  5L39 A;  3MM7 A;  4B3M J;  1H6K X;  2DGU A;  4OL8 A;  3CIM A;  1VQP S;  2FJD B;  4LRF A;  4X65 F;  4BCA A;  3J7A 1;  4L3N A;  5DO2 A;  5G4D A;  2MZQ A;  1JJ2 R;  3DOL A;  4CYU A;  2DKO B;  2Q66 A;  2HZA A;  1RT2 B;  2C3O A;  3KLV A;  5CD4 A;  1D9D A;  3DLK B;  4X66 J;  2F7V A;  3UQS A;  2E7W A;  4GVB B;  1YVF A;  4W98 A;  1Y11 A;  1HQU B;  3GTY X;  4FF3 A;  3QWP A;  4HR2 A;  1NPK A;  1S6O A;  2HVE A;  2ZJP Q;  4QWA A;  4C6A A;  3MCS A;  3FK4 A;  3QQC D;  1DQ9 A;  3TOQ A;  1HBU B;  2B9E A;  5ETP A;  1XMQ F;  3A13 A;  4ED2 A;  4LF7 J;  9RUB A;  1YJW S;  5GMK a;  2AX1 A;  4UOF A;  2D69 A;  3HUL A;  2QLW A;  4JI7 F;  3QZ7 A;  3KJN B;  4EBE A;  1KNZ A;  4ILM A;  4JBC A;  1JWW A;  1O8B A;  3ILI A;  4HAC A;  3NBP A;  3HHD A;  3N6L A;  3PJ9 A;  1MG7 A;  2NCK L;  3SCK E;  3SI8 A;  4UQT A;  2QYC A;  5E41 A;  4LFA F;  2EPI A;  1ICE B;  2BUN A;  1E6Y A;  4H4O A;  1N52 B;  2BJD A;  4A8Y A;  2LCW A;  1KOO A;  2M88 A;  3TI0 A;  1VJQ A;  4Q44 A;  2MMY A;  1VIO A;  3AXK A;  1RAE B;  1FNM A;  5GAH I;  2LQ9 A;  4DPW A;  3ET6 B;  4HDG A;  4CNZ A;  3ZZU A;  1RT6 A;  2HWH A;  1VRT B;  2AV5 A;  1RBL A;  5K5M A;  2W9A A;  2C2R A;  3BJY A;  5B0A A;  3JAM Y;  4CO4 A;  3KHG A;  4WYL A;  1SV5 B;  3I9V 9;  4MT1 A;  1GNK A;  5L9X A;  3U02 A;  1H38 A;  1U7L A;  2NLW A;  2GJF A;  3RB6 A;  1VQ7 S;  1N0U A;  3C6T B;  3I0S A;  5IOL A;  1WTF A;  2MLX A;  3D3B J;  1O0P A;  3OFE A;  2DXF A;  3K8V A;  1RT5 A;  3KLI A;  4RW4 A;  4CH0 S;  2R7O A;  2RIJ A;  2XMM A;  4N8N A;  4DSE A;  3CDW A;  2NXN A;  4HHH A;  3ZTO A;  1QAI A;  1DRZ A;  3EZ5 A;  2MXY A;  3ZXW A;  4DUT A;  5B0D A;  3MM9 B;  3SV4 A;  2FHM A;  4ENO A;  2VJV A;  3M4X A;  3RBE A;  4U8Y A;  1SC3 B;  5D0R A;  2YNG B;  5L38 A;  4TY8 B;  5M2P A;  1X5S A;  1I94 J;  1VQO S;  1REV B;  2UUA J;  4ICL A;  1CJT B;  2PT0 A;  3CJ3 A;  1WEY A;  1TUG B;  2AYB A;  3VVU A;  4B9S A;  1NSK L;  3H98 A;  4LFB J;  4NLV A;  3M30 A;  1H74 A;  2OEJ A;  1K1S A;  1KEK A;  4MKY A;  4RU9 A;  2K2P A;  1DTQ B;  3CNQ P;  1N5V A;  4OFZ A;  3PVX A;  1D9A A;  3DLG B;  4Y0F A;  2ZDO A;  1HQE B;  2UXB F;  4I2P A;  5B0F A;  2W8L A;  2LU2 A;  3MMJ A;  1PIL A;  1VIS A;  4RNM A;  3KMS A;  5HRO A;  2X51 A;  3E51 A;  3E3X A;  6AT1 B;  2C28 A;  4IUF A;  2OSR A;  1J5E F;  3RGI A;  4USW A;  1KBR A;  2VG7 B;  4MK7 A;  4DPU A;  1K44 A;  2Z58 B;  4DV7 J;  1WG1 A;  2MQM A;  1B0T A;  4AL5 A;  4PG8 A;  4DF8 A;  4GKK J;  4BHQ A;  2B5J A;  2HKE A;  2HAF A;  2HHH J;  1NRK A;  4KB7 A;  1JLF A;  2DNN A;  2G13 A;  3RR7 A;  3NGK A;  2SXL A;  3KLH A;  3GFX A;  4QR0 A;  1WEL A;  4QIF A;  2EFP A;  4HYK A;  2WCX A;  3RR8 A;  2H1Y A;  2XMJ A;  3HVT B;  4OI3 A;  2FVQ A;  4CLS A;  3THT A;  2MTL A;  1I5O B;  5CYM A;  4RO0 A;  2Z2L A;  2C2Z B;  1JLQ A;  3EIC A;  2HLU A;  4RZR A;  2EFV A;  2PD1 A;  2MQQ A;  3OFF A;  4B3T F;  4OI1 A;  5K8P A;  4JI4 F;  4ZPB A;  3KYL A;  3DM2 A;  3KLG B;  1T3O A;  2BR0 A;  1XER A;  2XYP B;  1NME B;  2HQ3 A;  4HHU A;  2FZK B;  1IBM J;  2DD8 S;  5GAD U;  2JLG A;  4U8V A;  3H8Y A;  4USM A;  4CLF A;  3DLL Q;  1UEU A;  5DET A;  2Z57 B;  2BRL A;  2GIQ A;  2R8J A;  1RT1 A;  1W2I A;  2BAC A;  4HVZ A;  2MJN A;  3M8W A;  3P5B P;  4AFF A;  4OYZ A;  1SJR A;  3BYR A;  3HT0 A;  2H4W B;  2W7P A;  1WKK A;  2CQP A;  4JI1 J;  5HP1 A;  2RQK A;  3J80 Y;  1CJV A;  4UOH A;  5A6P A;  4IDK A;  5IWA J;  1SKU B;  3WIV A;  2R9L A;  1U6B A;  1IQZ A;  1F6T A;  2P5V A;  4HHJ A;  2UXC F;  3N6M A;  1TVR A;  1JXL A;  1X31 C;  3QAE A;  1IBK F;  2DHA A;  2HFO A;  1UJ5 A;  1KLM A;  3K57 A;  1TAU A;  1X5T A;  3H20 A;  2XY7 A;  3IC1 A;  3TX0 A;  4NL5 A;  1N0V C;  2NRE A;  3HD1 A;  2NUH A;  4A48 A;  4DG1 B;  1AA1 B;  4B3O B;  1IR1 A;  3FBE A;  2HRU A;  3BSO A;  5C24 B;  3CJT A;  3M8P A;  3M2R B;  4OV1 A;  2MKI A;  3JYT A;  1LWC A;  2HFV A;  4O4G B;  4I6W A;  3PM9 A;  2PSZ A;  2W9C B;  3MUT P;  3UCZ P;  7AT1 B;  2IRU A;  2FYX A;  5EN1 A;  1NK5 A;  4DSL A;  4UOG A;  4KY3 A;  1RUS A;  3CCL S;  3A8J A;  1IKV A;  2HWI A;  1VBZ A;  2RF2 B;  3GWC A;  3Q2S C;  4NYP A;  3VGS A;  3B54 A;  1YK9 A;  5KG5 A;  2V8P A;  2WSE C;  2ZVS A;  3PZP A;  4OI2 A;  3BGO P;  1S1W B;  4QZV B;  2FLO A;  1S10 A;  3KLE B;  2IA6 A;  4Y00 A;  2VA2 A;  4HTJ A;  3OR1 A;  4QWD A;  5T7L B;  1KVI A;  5HLF A;  2MQO A;  1RE1 B;  1J2V A;  1YIJ S;  2CNO B;  1JLC A;  1GMW A;  4LF4 J;  3KJV B;  1PG5 B;  5J2N A;  2Z56 B;  3G8Q A;  5E5N A;  1VS3 A;  2NSC A;  3X1L B;  6FDR A;  1YTY A;  5F0U A;  4NLT A;  2RQM A;  1NAQ A;  4DXL A;  2GV1 A;  2OKQ A;  1VLO A;  1WHX A;  3NGT A;  3PW7 A;  3KG4 A;  4W4M A;  2ATC B;  3OTC A;  1ZA1 B;  2ZVI A;  3ILL A;  3IWN C;  2IYI A;  3UR0 A;  2VJU A;  2Y3Y A;  2CRL A;  1JK9 B;  2H5E A;  3G6V A;  2IMW P;  4I0W A;  1RBO B;  1SBR A;  3CGI A;  2DPI A;  1BQM B;  1RGV A;  1QSL A;  2H5I B;  4JV2 A;  1OYE A;  4ZPA A;  4QYZ J;  1TMJ A;  1MWY A;  4X4R A;  3TWZ A;  3GIL A;  4I69 A;  2XGQ A;  5DLG A;  5D15 A;  1QLN A;  1N33 F;  1ZYQ A;  2ZM6 J;  1APS A;  3Q8R B;  3QO9 B;  3D3C J;  2MYF A;  1JLE B;  1B3T A;  3MMC A;  3HVR A;  4F2S A;  3CJ2 A;  5KFE A;  3H40 A;  2F40 A;  5A76 A;  1U2R A;  3MR3 A;  2E5L F;  2YNF A;  2DCL A;  4LBP A;  4IFY B;  3R6G B;  3MDF A;  3FSX A;  4G65 A;  1CSJ A;  3BRE A;  1UVK A;  5D77 A;  1VFJ A;  2E5J A;  4OZ5 A;  2ZHO A;  1XMB A;  3ENA A;  5KOX A;  2NZ4 A;  3T1A A;  2A1B A;  4AT1 B;  4YP3 A;  3KUE A;  3C8Y A;  4Q2L A;  2B4O A;  2ZH5 A;  1ZET A;  3DLE A;  3IRW P;  3K58 A;  2HHS A;  2HAI A;  3RBZ A;  1BHN A;  3BKU A;  4MKV A;  4U9R A;  1FRH A;  1S79 A;  3BBC A;  5C2G A;  4FF4 A;  3IGV A;  3RRH A;  1EB0 A;  4C8K A;  1UA0 A;  4OJ3 A;  2AU0 A;  1J27 A;  1U1P A;  4X4U A;  4ZCM A;  3NNC A;  2AZ1 A;  1T0T V;  4J9V A;  3PW0 A;  2J0S D;  1NB7 A;  2VG5 B;  1TKX B;  1NHU A;  4X64 F;  1EAY C;  4KPY A;  5KT6 A;  3HLU A;  1PBU A;  4C0H A;  1WDT A;  3SCJ E;  3TR5 A;  5HAN A;  3QGI A;  4ZVG A;  4DV4 J;  2Z2M A;  1AXQ A;  4B02 A;  1LW2 B;  2QGF B;  1XNR J;  2E5I A;  4ZVQ B;  3BGL A;  4AE5 A;  1YJR A;  4DSF A;  2B7B B;  4BC7 A;  1GXL A;  4B3S F;  2HRT A;  5KFG A;  4ZP7 A;  1PO6 A;  3ULH A;  4URG A;  2UVR A;  1SVD A;  3LPE A;  2N3L A;  3MEC B;  1N5S A;  1UWB A;  1N36 F;  2HVD A;  5RUB A;  4CLK A;  2VKR A;  2CA9 A;  3VQT A;  3QIP A;  2J9D A;  4MKB A;  8AT1 B;  2ZZM A;  2GCF A;  3POT B;  4AXJ A;  3B4D A;  1F2G A;  2OP5 A;  5IT9 U;  1LWE A;  3BB5 A;  5L1K A;  2ASY A;  2IYG A;  2BJ9 A;  3FKB A;  1FCA A;  2KT2 A;  2BXJ A;  3Q89 A;  2V8G A;  2HBY B;  4ZVP B;  4U95 A;  1TL3 A;  3IWX A;  2CKW A;  5HQ8 A;  4LUB A;  1JLG B;  2GNK A;  2V2V A;  2XLK A;  4DCO B;  5K14 B;  2ZC4 A;  4UTG A;  1P8G A;  2AWZ A;  1XMO F;  3JS9 A;  1N5Y A;  4NRT A;  3H7H B;  1VQN S;  5A6W A;  4RNN A;  3RRK A;  3FBC A;  4UUW A;  2OI2 A;  2YWK A;  5KT3 A;  3ISN D;  2OPR B;  3DHW C;  4F0M A;  3OVB A;  1UKU A;  5DQI A;  1BE4 A;  4PXE A;  3CCW A;  1RT2 A;  3DRY A;  2VKZ G;  3G4S S;  4LF5 J;  3C3L A;  4GVB A;  2CQD A;  2GA7 A;  1X9M A;  1FD8 A;  4DV0 J;  2PA8 D;  1U26 A;  1HLW A;  1S9F A;  3CCE S;  3CWJ A;  4UQG A;  4OZL A;  1X4F A;  1YI2 S;  2JEI A;  1RLC L;  3MF5 A;  4DUY F;  2B6A A;  2PO4 A;  1HBU A;  4JUZ A;  1HR0 J;  4LFC F;  2I1R A;  1AW0 A;  3OSP A;  4OHV A;  3RAQ A;  1U1K A;  4HDH A;  5JVG Q;  2K1R A;  2QLF B;  3TAM B;  2RH3 A;  3TYT A;  1RZM A;  4FVC A;  3VAM A;  4MTP A;  4C3L A;  2CWK A;  1X0P A;  1OPZ A;  4M5H A;  2RS2 A;  3P49 B;  5AXL A;  4IG0 B;  1NKC A;  3PNI A;  2QX0 A;  3QRR A;  4D3H A;  2ZDP A;  1S4E A;  3AOD A;  5KFO A;  4FS1 A;  2VQE F;  2M70 A;  4Y2A A;  4B17 A;  1Q5V A;  3TNV A;  2CPH A;  1JQG A;  3MCM A;  2WOM B;  5LXR A;  2L41 A;  2EI5 A;  1B7Y B;  3F0N A;  4HT5 A;  1M5K C;  2BJE A;  1YZ6 A;  4ED5 A;  2FJX A;  2IC3 B;  3CME S;  1OJ4 A;  1H73 A;  2R8G A;  3ET6 A;  1KOH A;  1MWZ A;  3V81 B;  4DR2 F;  2VPX B;  2QLJ B;  2VDH A;  1VRT A;  3M9O B;  2IA0 A;  2P6T A;  1RU1 A;  3U27 A;  4K4T A;  5KFW A;  4ZPW R;  4YB7 A;  1ZPW X;  1SV5 A;  2HMI B;  1U4B A;  3CCU S;  4MJK A;  5M2R A;  3DLB A;  3ILO A;  3C6T A;  2N4C A;  4C3K A;  1RSC A;  3OFH A;  5I3P A;  1G7C B;  2BE2 B;  3NCQ A;  5HQL A;  4KC5 A;  3UNY A;  4Y34 A;  1NK9 A;  2OTL S;  1RT4 A;  1JLB B;  2DNG A;  3CB4 A;  2QL7 B;  3AAW B;  2Y0B B;  2OSQ A;  2C2D A;  4NA3 A;  3CIZ A;  3D68 A;  2QYG A;  2CQ3 A;  2DNM A;  1VBX A;  2E5G A;  3MM9 A;  3K5M A;  3K7R A;  1WC6 A;  4KIA A;  1WG5 A;  2YNG A;  2V63 A;  4TY8 A;  1TKZ B;  2AGP A;  1CS4 A;  1N34 J;  5A8K A;  1REV A;  3HK2 A;  2E9T A;  1N6Q B;  2CJK A;  2ZH9 A;  5DZ6 A;  4LF9 J;  3KFW X;  1CJT A;  4LF8 J;  1Y00 A;  1UZH A;  4U7U D;  1QD1 A;  2BEF A;  2ALZ A;  2H5J B;  2HBR B;  2HQF A;  4OLO A;  2V68 A;  1URR A;  3I31 A;  4NOH A;  4OYI A;  4MK8 A;  4QOT A;  2D9O A;  2AP6 A;  2RRN A;  3LF0 A;  2KI2 A;  3Q23 A;  2AYG A;  3TEH B;  2A10 A;  1RT7 A;  4WYW A;  4IFV B;  2Z2Y B;  1Z1Z A;  2DR7 A;  1DTQ A;  1LFW A;  4PR6 A;  1X7V A;  1Q78 A;  3DLG A;  1HQE A;  1B0P A;  4KO0 B;  4LRB A;  1Y4Z B;  2IJN A;  1A7G E;  4NI2 B;  3KDN A;  1HWL A;  2CQB A;  1U09 A;  4NLW A;  1PYO B;  1FK9 B;  4TY9 A;  4TU8 A;  2Y9H A;  5DZ7 A;  4K5S A;  3ZFV A;  2VG7 A;  2KXF A;  2F9D A;  5A2Q U;  2W7A A;  2CPD A;  3JTP A;  2FC9 A;  2LXF A;  3LA0 A;  2RUG A;  3UD3 P;  3KUG A;  3UE2 A;  4ED0 A;  4I56 A;  1I6J A;  2B0G A;  4NLR A;  3H5X A;  4F25 A;  1VC5 A;  1RA7 A;  2B8Q A;  1TKT B;  1KSP A;  4KHR A;  1T9W A;  2JLF A;  4QQB A;  1HPZ B;  4J9O A;  4URS A;  5J2M B;  4LF6 J;  2Z30 B;  3NCP A;  2WBM A;  4ELU A;  1WEZ A;  2CDR B;  2ZIT A;  1RDR A;  4W90 B;  2MQ8 A;  4ZCI A;  3R7S B;  5K8N A;  5D3G B;  3LTO A;  4NZ0 A;  1R0C B;  4ZN1 A;  5CQG A;  3DN9 A;  5EX3 A;  1FX4 A;  4O3P A;  2VFR A;  5IT0 A;  2F5G A;  2GJ2 A;  3MM5 B;  1WOS A;  2E7X A;  3KLG A;  1KD1 T;  4R8U B;  2DGO A;  1SL0 A;  3ELH A;  1H7X A;  4X4T A;  3M8R A;  3D67 A;  4KGV B;  2HHW A;  1M5H A;  1RAB B;  2AJ2 A;  2MLZ A;  4PXD A;  4FPR A;  4RPF A;  2CNN B;  3DGV A;  3TJ9 A;  1S0N A;  3MPV A;  3DDK A;  3H4D A;  2D3Z A;  2AKW B;  4R0E A;  2KM8 C;  4OX9 J;  4EZ6 A;  4LRC A;  3QAT A;  2R7R A;  2BOA A;  4JI3 J;  2R2U A;  4QWB A;  4GO5 X;  5HAT A;  3D1H A;  3DRS B;  1T95 A;  4WZM A;  5M2U A;  4OZ2 A;  2BZ2 A;  1VQY A;  3HCX A;  1O51 A;  3A4T A;  3UVJ B;  3W63 A;  4WFA Q;  1C4C A;  4KH0 B;  3THP A;  2CYY A;  2FDN A;  2A0F B;  1CQN A;  1VLY A;  3O3L A;  4F67 A;  5KFM A;  3O5T B;  2F8H A;  2PMW A;  2P6S A;  2K7K A;  2K06 A;  2OGU A;  2ATL A;  4DG1 A;  1HYS B;  4B3O A;  1CPZ A;  5F8J A;  4DJB A;  2BE7 D;  1H0H B;  2UUB J;  4ZJQ A;  5C24 A;  4ZPV R;  3OTO J;  3M2R A;  4FKY A;  3PO4 A;  5H9E J;  4UW2 A;  4ZIT A;  4O4G A;  2W9C A;  3TQE A;  2GIR A;  4N56 A;  3NRB A;  4FBU A;  3OJS A;  1M5V C;  1ITP A;  1EKS A;  4F50 A;  1NLK L;  1YJN S;  4NXM F;  1CEZ A;  2W1B A;  4DX6 A;  3C19 A;  2VG6 A;  2RF2 A;  3PXG a;  1K1Q A;  2YX7 A;  5I42 A;  2B4U A;  3W3S A;  3IMQ J;  3A1Y G;  5SZT A;  1SH3 A;  4FDF A;  3NMR A;  4L3K A;  3U1N A;  4X4Q A;  4TU7 A;  2L08 A;  5J2Q B;  1C2P A;  3KLE A;  2KHD A;  1JMT A;  3NAI A;  3BR8 A;  5E3C A;  1KHW A;  1JJH A;  2V0N A;  4X65 J;  3BGR B;  5T7L A;  4DV6 F;  4OZ0 A;  3KJV A;  2VA3 A;  2J7K A;  1UW4 A;  1YG0 A;  1M90 T;  4A8O A;  2G0C A;  2QIF A;  1K73 T;  4NLY A;  2FVC A;  4DU8 A;  1WEX A;  1HFE L;  4WF9 Q;  4OQJ A;  1Z2Z A;  3BO2 A;  1KWM A;  3H5Y A;  1SI9 A;  3H90 A;  2W25 A;  2V5H G;  2OML A;  2UU9 F;  3NXZ A;  2V94 A;  1CUL A;  3PKM A;  1RYS A;  3V4I B;  4ZCK A;  2DNL A;  3HX9 A;  3VGU A;  2OUG A;  4USU A;  4DL2 A;  2ZH4 A;  1S77 D;  1S7H A;  1TL1 B;  2NYI A;  1HNV B;  2W9B B;  1IUJ A;  1BWE A;  2AJ4 A;  1XMQ J;  2HLT A;  4IG3 B;  3NKY A;  3UN3 A;  4K2X A;  3I6P A;  1D8Z A;  1Y10 A;  4PPZ A;  3TAP A;  1YRX A;  2YQ1 A;  4JI7 J;  4PZV A;  4HH0 A;  4FVM A;  2J0X A;  2DNO A;  1XEZ A;  3GFH A;  2XC9 A;  4DU7 A;  2G2Y A;  1R31 A;  2M0G B;  1W26 A;  1F3F A;  2HHU A;  2RKI A;  2QSF A;  1U0S A;  1JLE A;  1KVJ A;  1DFD A;  1JJ4 A;  4RBU A;  4LFA J;  5KFX A;  2OEM A;  1C0T B;  4ZN3 A;  4IFY A;  4PQA A;  4X4P A;  3ENV A;  3TZZ A;  1U1L A;  1SPB P;  1RB0 A;  2L9W A;  1HMV B;  1YZ7 A;  4ZHR B;  3C6U B;  3IBF B;  2OHD A;  3G2X A;  2RNE A;  3VAL A;  2UP1 A;  2XEX A;  1FFS B;  2R2R A;  1PC5 A;  3R1L A;  1YQH A;  1KFS A;  3W5Y A;  3W64 A;  2QZ8 A;  1T03 B;  1WOR A;  3FC9 A;  3NG8 A;  3QGG A;  4JI0 F;  1R0A A;  1S1X B;  3H0P A;  2HGM A;  3DOK B;  3P5T L;  2KFN A;  1RHM B;  4FNH A;  4RL1 A;  2DGQ A;  4H54 A;  4NE9 C;  5LMU F;  2QA2 A;  4C8Y A;  5KT7 A;  2GHP A;  1NM2 A;  2VG5 A;  1TKX A;  4RW6 B;  2NS1 B;  3OQ2 A;  4ZVO B;  2KH9 A;  2LDI A;  4FYX B;  3LGH A;  1QVG R;  3OPK A;  4RW7 B;  2ZHA A;  1RP5 A;  5KFK A;  1LW2 A;  3GPA A;  4OYB A;  3HVW A;  1UVI A;  2Q79 A;  2Y1J A;  1CQM A;  4AQY F;  1DJ0 A;  2AQ4 A;  5FII A;  2F3J A;  1SQG A;  1OQ3 A;  3OUY B;  2BJ3 A;  2VBX A;  4DR1 F;  4F04 B;  2F8M A;  3PIP Q;  3VAG A;  1HNX F;  4Y3C A;  1NZ8 A;  3MEC A;  4QCL A;  4TNO A;  2W4D A;  4BDP A;  1YLX A;  2KXH A;  2V34 A;  1X9W A;  5LSL A;  1HA1 A;  3BO4 A;  3JQJ A;  1WUU A;  2DR9 A;  1ZAX A;  3HHL B;  1S12 A;  2CAD A;  2ACY A;  4KTQ A;  4LQ9 A;  3R5B A;  4XO0 A;  4YS2 A;  4DQQ A;  2MEW A;  5K14 A;  4NZ6 A;  2UXB J;  3ZZZ A;  4CCH A;  3GG0 A;  1J5E J;  5LXY A;  1GTE A;  1TL4 A;  2IIH A;  5K20 B;  4F3O A;  2OPR A;  1IKY A;  2R7W A;  3PW5 A;  1AZS B;  1DY3 A;  4RLE A;  4DR6 F;  4YB5 A;  2XY5 A;  1F60 B;  3A8I A;  1U2C A;  4I67 A;  2WW4 A;  2FVR A;  2XO6 A;  4I1T A;  3BKF A;  2LQB A;  5CYQ B;  3PKY A;  1FX2 A;  2FPH X;  1UPM B;  5FD1 A;  4TU9 A;  4DOZ A;  4NCA A;  2NYH A;  3DU5 A;  1B4S A;  1Y5I B;  3JQM A;  3CJK B;  5E3Q A;  5CAB A;  2NSB A;  3NWR A;  1H2V Z;  3TAM A;  5EWG A;  1FHT A;  4B3T J;  4JI4 J;  3PFO A;  1G1X A;  1HNI B;  1TR0 A;  4CLP A;  4ECY A;  2GML A;  3CCJ S;  5D4P A;  3IBW A;  3I55 S;  4IG0 A;  3CJQ A;  1F9F A;  1O6X A;  4RR5 A;  4ZKA A;  3HSG A;  1GMW D;  1VOM A;  3BH7 B;  5AT1 B;  2MGZ B;  3I87 A;  4PAA A;  2JZ5 A;  1NUE A;  2EG2 A;  2HSE B;  4AYB D;  3M32 B;  2XS2 A;  2KO1 A;  5A8W B;  4A8Q A; 
#chains in the Genus database with same CATH homology
 1HNX J;  4DV1 J;  4DR5 J;  4DV0 J;  2VQF J;  1I94 J;  4YHH J;  2HHH J;  2UUA J;  1N32 J;  4KY3 A;  4DR4 J;  4JI1 J;  4DR2 J;  1N34 J;  3W1Y C;  4NXM J;  5LMN J;  3J80 U;  5IT9 U;  4JYA J;  4LF9 J;  3JAM U;  4LF8 J;  4DUY J;  4OX9 J;  4JI5 J;  4JI2 J;  5IWA J;  4JV5 J;  1XMQ J;  4JI0 J;  3T1Y J;  4PWW A;  4LF7 J;  1FJG J;  4LFC J;  4DR7 J;  1HR0 J;  4JI3 J;  3IMQ J;  4LFB J;  4K0K J;  2UXC J;  1HNZ J;  2KVQ E;  2MTL A;  4DV3 J;  1IBK J;  4LF6 J;  5LMU J;  4B3M J;  4JI7 J;  3J81 U;  4X64 J;  1HNW J;  1IBL J;  2MQ8 A;  4RJV A;  5BR8 J;  2F4V J;  2MEW A;  4B3T J;  5AJ3 J;  4JI4 J;  4X65 J;  1N33 J;  4YY3 J;  4X62 J;  3D3B J;  2ZM6 J;  5LM7 E;  4V1A k;  3T1H J;  3D3C J;  4DUZ J;  4DV4 J;  4DV6 J;  1XMO J;  2UXB J;  4LF4 J;  3J7A N;  5FLX U;  4KHP J;  1XNQ J;  1XNR J;  4HHU A;  4GKJ J;  2VQE J;  2E5L J;  4DR3 J;  4LFA J;  1IBM J;  3R2C J;  2UUC J;  3R2D J;  1J5E J;  2UXD J;  4JI6 J;  4AQY J;  2KL8 A;  4B3S J;  4X66 J;  4JI8 J;  4DV5 J;  4NEZ A;  2UUB J;  4DV2 J;  4DV7 J;  4LF5 J;  4KYZ A;  4DR1 J;  4B3R J;  3OTO J;  5A2Q U;  4GKK J;  4NEY A;  2UU9 J;  1N36 J;  4DR6 J;  4NXN J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...