1S9EB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL polyprotein [Contains:Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 106
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9eB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB02
4ZPCA 2BQ3A 2RDJA 5JXSA 4R0EA 4ED8A 4RW8B 3KJVA 2YKNB 4PWDA 1RA7A 3E01A 5CYQA 2VG7B 2E9RX 2V9WA 3CVKA 5KFTA 1JXLA 3CJ3A 4MK7A 1UWBA 4TN2A 3IGVA 4KFBB 4ED1A 4ED3A 3RB4A 5KFQA 2XCPA 5KFHA 2R2SA 4XPCA 1RA6A 3CDWA 2R8KA 1S1TB 3V6DB 4RNFA 3DRRB 3DM2A 1RT5A 1HQUA 1RT6B 1XR7A 3BSCA 3UPFA 5EWFA 1REVB 4TY9A 1LWEB 2BR0A 2VG6B 3I0RB 3QIPB 4RNHA 4ECXA 2E9TA 5JUMA 4TQRA 3NBPA 4LQ9A 3DRPB 5KFDA 4URSA 2BRKA 3OSPA 1S10A 2OH2A 4ZPBA 3BR9A 4KV8B 5K14B 1LWCA 5KFUA 5DQGA 3MEDB 4XPEA 2AX0A 2W9AA 3NAHA 4Y34A 2AU0A 4EEYA 2JEGA 2FLLA 3HHKA 4J9NA 5F9NA 1QE1B 4Q43A 3BQ2A 1C1BA 3T19A 4DL3A 4J9PA 4U7CA 2AGPA 2FVQA 4ECQA 3ISNC 3MECA 5L1JA 2BE2B 1N6QB 1T03B 5C42A 4IG3A 1TQLA 2WK4A 2BRLA 4WYLA 2ALZA 4I7FA 4NLTA 3TAMB 5HLFA 3N6LA 3T5HA 2YKMB 4WZMA 5DLGA 3CJ2A 4WE1B 4QPXA 2R8HA 1JLFB 3DLEB 1RTJA 5KT6A 2W7PA 3V4IA 5L1KA 4IR9A 3MF5A 4YMEA 5F8GA 3V81A 1BQNA 3NGDA 3MEGA 2F8EX 2IM3A 2B6AB 2JEIA 3KHRA 4ID5A 1T05B 2V4QA 4ZVEA 1VRUB 3H40A 3NKYA 1MU2A 1S0NA 4LQ3A 4Q8EA 4K4YA 2C2DA 3H5XA 5J2NB 2DPIA 2XGPA 3IS9B 4ED7A 2IBKA 4O3OA 5KFYA 5KT4A 1W25A 5C5JA 4NCGB 1T3NA 5F8HA 1S9EA 3IRXA 3DLGB 4FBUA 3H4DA 3HVAA 3QZ7A 4NLWA 3ICLA 1HNIA 5HBMA 3ISND 1SH2A 4EO8A 4O3SA 1IKXB 2YNFA 1R0AA 2IM1A 4ZPAA 1WNEA 4HYKA 3RBDA 2WB4A 4F4ZA 3JYTA 1C0TA 2YNIB 4DL2A 3QO9A 5I42B 4Q0BB 1TKTA 3H5SA 1FKOB 3JSMA 5KG0A 2IJNA 3T5LA 5KFOA 1NNDA 1HMVB 3TQ1A 3FSIA 2ZD1A 4RW7B 3DOLA 5KFRA 3KK2B 3GV5B 3GYNA 5CYMA 3DRSB 4R5PA 2C28A 1EETA 1IKWA 2VG5B 3MFIA 3KHHA 2R8GA 2FJWA 5L1IA 4LSLB 1RTDB 3C6TB 1SUQA 4O3NA 3DYAB 5KFSA 4KSEB 3CO9A 4DL5A 4B3OA 5L1LA 4IR1A 4IRDA 2OPPA 1FK9B 2BANB 1LW2B 4O44B 4RW9B 5I3UA 4ZVHA 4DL4A 3QZ8A 3H59A 3FFIB 1S1WA 3MEEA 4ECYA 4Q8FA 2ZKUA 4TXSA 3CDEA 1LW0B 2B5JA 3H4BA 4EYHB 1HPZA 1EP4A 1K1QA 4NLRA 3QGIA 2OPRA 4JV0A 4EBDA 2R8IA 4QWBA 1BQMB 3RB3A 1C0UB 4MKAA 3Q8SB 3LP0A 4J9KA 1RTIA 2W9BA 4JV2A 1FKPA 1IKYB 1RT2A 1S6PB 4IDKB 4NLXA 3DDKA 2OPSB 3GV8B 1JLBA 3KLVA 4U6PA 2VA2A 4R8UB 1TVRA 4JV1A 1SV5B 4QW8A 5KFAA 5F8LA 4RW4B 1DTTA 4MK9A 4X2BA 1JLAB 3V6HA 1YVFA 2HNDA 3KJVB 1S97A 4PWDB 3E01B 5CYQB 5DG7A 4IFVA 2VA3A 3KLFA 1S6QA 5DGAA 1UWBB 4IOBA 5FDLA 1HNVA 1I6JA 5KFIA 3T5JA 2HNYA 1JLEB 5DLFA 4ZHRA 4I2QB 3DI6A 5KFZA 2ATLA 1TV6A 1RT5B 1HQUB 1N56A 3GQCA 3G86A 3LAKA 1IKVA 3LP2A 2HMIB 4K4TA 3T1AA 1C2PA 3I5AA 3DMJA 3QYYA 4O3QA 1LWFA 1TL1A 1TKXB 4MIAA 2WOMA 2HNZA 3V6JA 1LWCB 5KFJA 3GIJA 3BSOA 3BSNA 2JEJA 4NLSA 4RNNA 3Q8RB 2XC9A 2R2RA 5KFVA 3C6UA 1JLCA 2VG7A 3MTKA 5EWGA 3RAQA 1C1BB 4TYAA 1RT7A 3EPIA 5DQIA 2AGQA 5KFCA 3KNAA 1N5YA 3KLHA 4RUCA 2YNHA 3NMAA 1RTHA 2IC3A 5C42B 1HQEB 3FQLA 3LANA 4ZP9A 3DOKB 4IG3B 1C1CA 2I5JA 4NLOA 4ZPDA 1KLMA 4ECRA 1JLGB 3DRRA 5HLFB 3IGNA 1RT6A 5KFEA 2WONA 3KMSA 3IG1A 4TLRA 3I0SA 3I0RA 3PW0A 4FBTA 3I5CA 1RTJB 3DRPA 2XCAA 4I2PA 3V4IB 3G6YA 4DG1B 4KE5A 5J2QA 1TL3A 1JKHB 2WTFA 3M8QA 4KO0A 4MFBB 1BQNB 5K14A 1S49A 2RKIA 3MEGB 2HAIA 3MEDA 5KT5A 3KK1B 3KHLA 5DG8A 3BJYA 2J6SA 2D7SA 4IQXA 3EPGA 4MK8A 5F8IA 2UVVA 1GX6A 4F4XA 2FLNA 3M8PA 4K4UA 4ID5B 3OLBA 3MR5A 4O4GB 1MU2B 4OL8A 2XGQA 1VRTB 4G1QB 3GIMA 5HP1A 3N6MA 4IRCA 1DTQA 2AGOA 5J2MB 4IG0B 4MKBA 3BGRB 3TAMA 1J5OA 4ECSA 1Z4UA 4KBIA 2EC0A 3GV7B 2YKMA 1S9EB 3CIZA 4QWEA 2E9ZA 1ZETA 5J1EA 4TY8A 2HWIA 4Q44A 1HNIB 5HBMB 1OS5A 2ASLA 4EYIB 2YNFB 1R0AB 2UUTA 3PHEA 4URGA 3UR0A 3KHGA 2W9CA 1RYSA 4J9QA 1TKZB 5HROB 1C0TB 3JYTB 5F9LA 3QO9B 4Q45A 2W8KA 4ECZA 2C22A 2W7OA 4GC6A 2IMWP 4GC7A 3RAXA 3T5KA 2AWZA 3H5YA 2ZD1B 5J2PA 4J9MA 1HYSB 1T05A 2IAJB 1S48A 5CYMB 1TP7A 3E51A 1N4LA 4R5PB 3H98A 4KHRA 1EETB 1IKWB 2YNGA 4NLQA 3MFHA 2W8LA 3ITHA 3LP1A 3HVWA 5J2NA 4NLUA 4NLYA 4PQUB 2UVWA 3H5UA 1HARA 3BREA 4RW6B 4EO6A 4B3OB 2BQUA 4RU9A 4H4MA 1NHUA 2OPPB 4YR0A 4NCGA 2WHOA 1S1UB 4MIBA 2R2UA 5I3UB 4ZP7A 3RB6A 3RBEA 1S1WB 3MEEB 3OL6A 3HVTA 3KLGA 2RF2A 1S1XA 2FJVA 3PJXA 4ZP8A 3DLKA 4NLGA 2O5DA 2B5JB 4ECTA 4EBCA 1HPZB 1EP4B 1S9GA 4F4WA 2IA6A 2JLEA 3UQSA 1K1SA 5KFWA 2OPRB 1S0MA 4Q0BA 2JEFA 3PW4A 2D41A 1RT1A 3LP0B 3KLIA 3PVXA 4K4ZA 3GILA 4WZQA 1RTIB 1HMVA 1FKPB 1RT2B 2B43A 4RW7A 2ZE2B 1ZTWA 1RT4A 1JLBB 5KG5A 1TVRB 4LSNA 4QWAA 3G6XA 1DLOB 3OL7A 3LAMA 2FVSA 1DTTB 2AX1A 4M94A 3KMQA 2HNDB 1S1VB 5F8NA 3QLHA 4YP3A 2OPQA 5KG4A 4ICLA 4IFVB 1ZTTA 5C24A 4J9LA 2R8JA 4Y2AA 1S6QB 3OL9A 5D3GA 5KFBA 5FDLB 1HNVB 3PJWA 4TQSA 2JC1A 3BQ1A 2FVRA 3D5MA 2IJFA 3MR6A 4ZHRB 4PUOA 5C25A 5KG6A 4KKOA 1TV6B 5DG9A 3QGHA 3KK3A 1IKVB 3LP2B 4O4RA 1BQMA 4DL6A 5KFXA 1RT3A 3DM2B 2GIRA 3KLEA 4IH5A 5KG2A 2AQ4A 1IKYA 4K4VA 2BQRA 3DMJB 2GIQA 4G3IA 4J9RA 1LWFB 1TL1B 4NYZA 3NBPB 2IM0A 2HNZB 1XR6A 1SV5A 4H4OA 4RW4A 1JLAA 4IFYA 4IH6A 4NLVA 2ASJA 1JLQA 1NHVA 3QGGA 3RB0A 3N6NA 2WCXA 4DEZA 3C6UB 1RYRA 4RW8A 5KT7A 1JLCB 4NRTA 2DPJA 4KHMA 2R2TA 2YKNA 2ILYA 4ZVFA 3OLAA 3CJ4A 1RT7B 5KFNA 4ED6A 3PW5A 4ZP6A 1N5YB 3KLHB 4ED2A 1JLEA 2YNHB 1RTHB 2IC3B 4I2QA 2HWHA 1U09A 5KG1A 3MECB 3M9MB 4ED0A 1C1CB 2I5JB 4KFBA 3CJ0A 3H2LA 1KLMB 1CSJA 4ZVGA 3SI8A 3SFUA 1SH3A 2WONB 2D3ZA 2D3UA 1S1TA 3V6DA 3IG1B 4I7FB 2HMIA 2GC8A 3I0SB 3OSNA 4IRKA 4ECVA 2QE5A 4NLDA 4J9OA 1REVA 4WXOA 1LWEA 4I2PB 3QIPA 2VG6A 3LALA 5J2QB 1TL3B 2RDIA 3OHAA 4K4XA 3BQ0A 3M8QB 1TKXA 3PW7A 5KT2A 4KO0B 3IN5A 2RKIB 4URQU 5KFFA 1S9FA 3V81B 4KV8A 4F4YA 3GIIA 4F50A 3GIKA 3M8PB 4ZMMA 2CJQA 4FS1A 1QE1A 4FS2A 4YQWA 5KG7A 1RDRA 1HQEA 3EZUA 3SFGA 2BE2A 3DOKA 5HP1B 1T03A 1DTQB 1N6QA 4QW9A 1JLGA 2FVCA 4K4WA 1J5OB 3Q8QB 3PR4A 1IM4A 5F8MA 3V6KA 4K4SA 4WFYA 5J1EB 3PZPA 4TY8B 1JX4A 1RAJA 3IRXB 4DG1A 4WE1A 5KG3A 1JKHA 2IM2A 1JLFA 3DLEA 4MFBA 2W9CB 2C2EA 3KK1A 3M9NB 2J6TA 2UVUA 4IKAA 4O3PA 2FLPA 2ASDA 3FRZA 2CKWA 5KFPA 1TKTB 2FJXA 5J2PB 3JSMB 4NRUA 2B6AA 4O4GA 4WFXA 2V0NA 4H54A 2YNGB 4YR2A 2V4RA 3DOLB 1KHWA 3ITHB 1VRTA 3LP1B 3HKWA 3I5BA 1XR5A 1VRUA 4G1QA 5KFMA 4QWCA 3PW2A 4WFZA 2C2RA 4YR3A 2UVRA 3TVKA 5DQHA 4MH8A 1S0OA 4H4MB 5J2MA 4IG0A 3UDLA 3BGRA 3IS9A 3PR5B 1SUQB 4KAIA 5KFGA 4RZRA 2FVPA 3CJ5A 3HVTB 1KHVA 4Y3CA 5EWEA 3KLGB 2RF2B 4ECWA 1S1XB 3MR3A 4ECUA 3DLGA 3DLKB 5KT3A 3M9OB 1S9GB 2ILZA 4RNMA 2QV6A 4KB7A 1TKZA 5HROA 1IKXA 3FQKA 3NAIA 1GX5A 1RT1B 3KLIB 3FDSA 2J6UA 3QIDA 2YNIA 1QAIA 5I42A 1JIHA 2XI2A 4NZ0A 4Y2CA 1FKOA 3VQSA 5T14A 1HYSA 4IH7A 2IAJA 1RT4B 4HKQA 2W9BB 4LSNB 1MMLA 1S4FA 3Q8PB 3KK2A 1D1UA 3DRSA 4PQUA 2VG5A 4RW6A 2XI3A 3QLHB 4RUAA 4LSLA 2OPQB 1RTDA 3C6TA 3DYAA 1S1UA 4ICLB 5C24B 5EUHA 4JUZA 1SH0A 5KFLA 4EBEA 2I1RA 3OHBA 4K50A 3G6VA 1FK9A 2BANA 2JC0A 5D3GB 4NLPA 1LW2A 4O44A 4RW9A 3KLFB 1QAJA 1T94A 4RNOA 3OL8A 3FFIA 4PUOB 3CWJA 4WYWA 5KFKA 4O3RA 5C25B 4XO0A 3D28A 5DGBA 4KKOB 2HNYB 2WRMA 1D0EA 4WXWA 5L9XA 3DI6B 3KK3B 1LW0A 4J9SA 1RT3B 4QWDA 3BSAA 3KLEB 3NL0A 5EDWA 3KOAA 1C0UA 2ZE2A 2XWYA 3CDUA 1QUVA 3MR2A 4DL7A 1S6PA 4IDKA 1DLOA 4TYBA 2UUWA 4H4OB 2OPSA 4M95A 4R8UA 4IFYB 2WOMB 1S1VA 1JLQB 5F8JA 1N48A
chains in the Genus database with same CATH superfamily
3HD2A 4PEOA 4LF6F 2VQFJ 2B4OA 1GXTA 3IGVA 2VKRA 1OWXA 5J1PA 4ELVA 2BRKA 1C4CA 1UPMB 1HI1A 1RAOA 1JJ4A 4HH1A 1H3DA 2FVQA 1VISA 4S0MA 5L1JA 2BE2B 1N6QB 1FDAA 3UE2A 1BUXA 1J5EJ 2UU9F 3PNIA 1FDBA 4OX8A 3M8WA 3I56S 1FNXH 2E5LJ 2BMBA 3K5LA 2K06A 1XIQA 1X0PA 2FD2A 1SKWA 4NA2A 1RCOB 4LR7A 2AMCB 1U8WA 4CTAB 1HNIA 2ZH5A 1FRHA 4Q0BB 3H5SA 3QQCD 3DDNA 3UNGC 3KUEA 3FSIA 5KFRA 2IRUA 4DF8A 4LJMA 2V9KA 6FDRA 3KYLA 5KFSA 4MYUA 4USTA 4Z7YA 2KH9A 3RJMB 4O44B 4ZVOB 2AZ1A 1NJIT 2MKSA 1F0XA 2KT5A 5MLCV 1KEKA 4RU2A 1FI4A 3CUNA 1N0UA 3PO4A 1VQ9S 3Q2SC 2OPSB 2HWTA 4EWTA 1A7GE 3PACA 4QW8A 4BBYA 4X2BA 4RUHA 2JX2A 5CYQB 2GGPB 1I6JA 1WG4A 3GQCA 2RIJA 2A6OA 5GMEA 4F26A 3DMJA 4ZJLA 2AJ2A 2ZDOA 1TAQA 3DN9A 1FEHA 1OPIA 4KGVB 4N7TA 2AGQA 3NOCA 4KRWA 5E3QA 5E3PA 5C42B 1FXDA 4JI3J 5HK4A 5GVQA 3MCNA 4P52A 3AT1B 3V4IB 4ZJOA 4OV6A 4MFBB 5KT5A 2V34A 2R8GA 3BJYA 4IQXA 1UZDA 1Q53A 3OLBA 1TL7A 2GNKA 2WSCC 3GIMA 1RKJA 4LBIA 3UI3A 3CIZA 1DAXA 3GR0A 1L3TA 2YNFB 5E5NA 4X4NA 1QSLA 1M5HA 5MAOA 1HYSB 1ZAVA 1WKKA 3ITHA 2C3UA 2MGZB 3HJFA 2PE8A 3R1LA 2ZC3A 3BZQA 4K0KF 4WK1A 1MG7A 4YHHF 2IMOA 3M7VA 1YHQS 3QJLA 3I55S 3KLIA 3NOGA 3DLHA 1RT4A 2QA1A 2HFVA 2NS1B 2EG1A 4OI4A 3QLHA 2Q3PA 3AODA 4NL5A 1O51A 3CJQA 2JRSA 1RZMA 1S6QB 3PJWA 2MQQA 1TELA 5B0GA 1OQ6A 5U47A 1HBUB 3DM2B 4OLPA 2CXEA 2ZOMA 5KG2A 1YJTA 1FJ7A 2Q43A 4DLEA 4TU7A 4IH6A 4NLVA 3TEGA 3Q83A 1RYRA 2OI2A 2DR7A 4X4RA 2X1AA 2YNHB 1X9MA 1XTZA 3G96A 1REVA 4TLQA 3UN2A 3GIIA 3GIKA 4UF4A 2L41A 4C8YA 4K59A 3R27A 4WFNQ 1X4EA 1T03A 3AXKA 4K4WA 1SCJB 2QL7B 1FNMA 3WX8A 2HAFA 5A2QU 1X9WA 1RQ0A 2V6AA 1G7CB 4NA1A 3G8TA 1U0SA 2UUCJ 4LFCJ 2KTQA 3IM9A 4GVBA 1W7WA 3DOLB 4BCAA 4FF1A 1U02A 3A8KA 2VJVA 1NCLA 4RPFA 4UZBA 3MCOA 1FX4A 5IOLA 1TKZA 2MQPA 4HEA9 1QTMA 4PWUA 2IAJA 2ZJQQ 4WIQA 2DXEA 4AFFA 4C8KA 2CQ4A 1UJ4A 1FE0A 5HANA 3BPDA 1D8YA 1ZAXA 5C25B 4LIWA 3SCJE 4ITSA 3ZZPA 2XULA 1Y3JA 1R43A 3DGVA 7FD1A 8RUCA 4PR6A 2ZNYA 2HLTA 2CZVC 4UY85 2I2YA 4U8YA 4CO0A 2VFVA 2ZH6A 2ROPA 1JXLA 3R5CA 1GTHA 2R2SA 4XPCA 2R8KA 1XN9A 4CLSA 4CH1A 2OTJS 1B0TA 1S10A 4V19X 5HMYA 3AOBA 3MEDB 2W9AA 2M4MA 3NAHA 2H54B 2P6SA 3JSYA 5F9NA 2DITA 4DCJB 4J9PA 4A8WA 1UJ5A 4F36A 3N6LA 4FF4A 3C14A 3SQOP 2IM3A 2EI5A 2D1CA 3DHXA 1T05B 1YJ9S 3QWUA 2DNRA 2JLGA 3VAJA 1HNZF 3DLGB 4FBUA 2GMLA 4DN9A 3NCRA 3ISND 4ZPAA 4DV7F 2OD6A 4PABA 2E44A 4DL2A 2YNIB 2PFFB 5KG0A 1Q8KA 2VUGA 2GMJA 1VC6A 1VQSA 5L1IA 2DH7A 2RJZA 1SL2A 3EGZA 4O3NA 3FRYA 3VHQA 4LSZB 2XB2D 4X66F 2BANB 3CO0P 1N36J 1NB7A 4AYBD 3HO1A 2M52A 1FX2A 4EYHB 1HPZA 3ZZYA 4P72A 1C4AA 2R7WA 2J9DA 3HFVA 4U6PA 4E98A 1DTTA 2C42A 3KJVB 4PWDB 3E01B 1UVKA 2P9EA 3HD1A 4ZHRA 2J0QD 2PMZD 2HZAA 4ELUA 3C8YA 1LWCB 4GO5X 1DY3A 3EGNA 2M5YA 4HI2A 2PMHA 1M1HA 3MTKA 3DC2A 3HSZA 2VQFF 1B70B 3KFWX 3U27A 1KDNA 3IBFB 4G6VB 3PW0A 3N0VA 3HFKA 1F6TA 4PPDA 1JKHB 1FDNA 1B0PA 3PV8A 3E8OA 5DG8A 2D7SA 1YZ6A 2C1EB 1MU2B 2HURA 4O23A 3MD1A 2LU2A 4EFAC 5HP1A 2EC0A 2H48B 3FBEA 1Q4RA 2LFVA 4NXNF 3PHEA 1RYSA 5A6PA 3ZTOA 1L5UA 3AH6A 1LK5A 4OZ3A 4L3NA 3Q8UA 2UUAF 2R7UA 1TP7A 4ECVA 4Y28C 1TL4A 4NLUA 3I87A 1S1UB 4C8NA 3KLGA 1S1XA 4F2SA 1RBOB 1YIJS 3POTA 4DV3F 1HBMA 2QL5B 1QY7A 1L3KA 3A12A 3NGUA 3QBCA 2H4YB 5C24A 4DLGA 3OL9A 5D3GA 2NUHA 2XS2A 5L38A 2V8PA 4ENOA 4KKOA 4UOGA 2IA0A 4JYAJ 2EFOA 1IWGA 4J9RA 3VZHA 4NYZA 1SKRA 1DRZA 1XR6A 4QYZK 4DUZF 2ASJA 3JQJA 3QGGA 3AA9A 4B3RJ 3CJ4A 1HHTP 1IR1A 4I67A 4DR7J 1FWLA 6FD1A 1KC8T 4E8UA 3CTRA 3D7SB 2G1DA 3IBCB 2OMLA 3GLJA 2QE5A 1Y0HA 2BDPA 2HS4A 2V2QA 3VGSA 3NCPA 3OVSA 1X4FA 1B7YB 3D6FB 2VC1A 2L9DA 1NB2A 2MZQA 4LF8J 4BHQA 1Q82T 4O3PA 2ASDA 4NRUA 2KT3A 1KHWA 3UDCA 2HZVA 4YR3A 3CIMA 3TVKA 3TNVA 4RZRA 3CJ5A 1HKAA 4NZ7A 4ECWA 4ECUA 3MR3A 3FCWA 3MMJA 1ZPWX 4WFBQ 2XS5A 2XI2A 4FYVB 4IH7A 2AJFE 4ILMA 2P8IA 4ZIVA 1TMJA 1CJKA 1FO1A 1ZBTA 4LFBF 1GAOA 4WU3A 1UTAA 5K9FA 3G6VA 3OFFA 4QU7A 1RP5A 2LQBA 3HT3A 4XO0A 1UVMA 2CRLA 2FDNA 4A8YA 1UETA 1CS4A 4QR1A 5GAEU 5F8JA 1U24A 3CJRA 3CVKA 4M1KA 3MM8A 4ZOSA 1WI6A 3GWCA 5H9EK 4F8RA 3V6DB 3BSCA 4OZ2A 2BR0A 2CPYA 2LEPA 2OSQA 2LVWA 3M32A 5KFDA 3OSPA 2FJAB 3FBBA 3U02A 1QE1B 2BE7D 3MMAB 1H38A 3IWLA 5C2GA 2MHEA 2KRBA 2E1PA 5HQ8A 4AD6A 5HLFA 3WQPA 4F04B 3CJ2A 4BDPA 2B3TB 3D1OA 3R7SB 4RBUA 3EX7B 2EK6A 4QR0A 1X4BA 1U1OA 1RWPB 4M5DB 4PPZA 2XSFA 4X4UA 1W2BR 1CG2A 2QLWA 1NJXA 4J5OA 4ZN1A 1BWEA 2DNOA 5ITHA 5A6WA 2CWKA 1VR6A 4JBCA 3PXGa 1IJFB 2C28A 1VCTA 2UUCF 1RTDB 1KBRA 3W64A 4DV5F 2CVIA 2OPPA 2GMHA 1NAQA 4P73A 4RW9B 3G8QA 3A8JA 1S6OA 2BW7A 2ZKUA 3N4WA 4OYAA 2B5JA 1EP4A 1SXLA 5T7LB 4IQMA 3H20A 1JLBA 3KLVA 2HFZA 4WPAA 2Z57B 2KXFA 4A47A 2FHOB 3W1YC 2HQFA 4UTGA 1U2FA 2F8MA 1R8AA 5KFZA 3NWRA 3QSYB 5IFMA 1F9HA 4F02A 2EBGA 1IUJA 2HGMA 4A8OA 1MW7A 2WOMA 2B8PA 1JXVA 3D67A 3MAQA 1GMVA 3BS9A 2WZ1A 3PY8A 4U9RA 1C1CA 1KVIA 3PKYA 1KLMA 2F7VA 3HSDA 3V2UC 5ETOA 4EU0A 1DQ8A 4I2PA 4KE5A 1NK0A 2RKIA 4OI1A 2LEAA 2XMMA 3C15A 3MR5A 1YGYA 1VRTB 2XO7A 4MKBA 2BJ9A 4ILRA 5K5MA 2KI2A 2PSZA 4QWEA 5J1EA 2RU9A 1FFGB 4LFAF 3VAKA 4J9QA 5F9LA 1C0TB 3OT9A 1KR4A 4GC7A 2CPJA 2JLFA 4L72B 3MMBA 1IKWB 2LQ8A 1NHKL 2KXHA 1WTFA 3ILOA 3QFHA 4DR3F 4KC5A 2XYPB 4ID8A 2G2YA 1IQZA 4CWBA 3FSYA 3ETOA 2D41A 3GYXB 4C8MA 2G2OA 3QRRA 1DURA 1A6LA 4NE9C 5G0RB 2R7VA 3LAMA 3PRVA 2HNDB 1S1VB 3PFOA 2UUBJ 3OUYB 1WELA 2QIFA 3HMJG 2JWNA 1WDTA 4LF9F 3JAMU 2MKHA 3BQ1A 3M6VA 1WI8A 5ETPA 4DUTA 2ZH3A 3NRBA 4O4RA 2D9PA 1NSQA 5KFXA 3KLEA 1S7HA 3D1HA 2VZ9A 4QIGA 2HNZB 1JJCB 5CHCB 4F0KA 5IQQA 5F0WA 3PW5A 1HNWJ 1RTHB 2HG4A 4U8VA 2UXBJ 1D9DA 4KGMA 2D3ZA 1S1TA 2DNLA 3U1NA 3R5JB 3QIPA 4K4XA 1HI0P 3BQ0A 3PW7A 2W4DA 4IOCQ 4NEZA 1HA1A 3G71S 1R8BA 2KM8C 4NASA 3KXDA 2CQ2A 2PA3A 2HBQB 3OW2R 1JMTA 1U0HA 2ZJPQ 2W9CB 3Q89A 3KUGA 1X4DA 1KP6A 2FHKA 4ZLNA 1X5TA 3N5BA 1FRKA 3QWPA 2V4RA 3CD6S 3PW2A 4WFZA 2CQHA 5DQHA 3GR1A 3S7RA 3TWZA 2AEMA 1H73A 3QT7A 3RW7A 1IBMJ 2RF2B 5KT3A 2E7VA 3D3BJ 5HROA 2MZRA 2Y8YA 1JJ2R 2DXFA 3CC2S 3SMZA 2V94A 5EUHA 3JSBA 1U1MA 2F9DA 5KFKA 1KSPA 2HNYB 1Q95G 1D0EA 5L9XA 3UD3P 2DHAA 3RYLA 4JI8F 1VQKS 4QWDA 1NPRA 2HVIA 3TO8A 5KTQA 1KLNA 2NQPA 5HMWA 3GJSB 3I4PA 2N7YA 1RTZA 4UUWA 4BC7A 4ED8A 2VG7B 1N88A 4A46A 1CQMA 1UWBA 3CMQA 4DS4A 5KFQA 3K2YA 3K5OA 3HHLA 4ECXA 1T9VA 5D0HA 4CT9A 1HQ2A 1VS3A 3JTPA 4YFUA 2IHR1 1TFYA 3R97A 3BF4A 3TAMB 2UXCF 3S8SA 2YKMB 4WZMA 5A0YA 1FHTA 2W7PA 2DGOA 2QX0A 2V4QA 1BXNA 2HFSA 3R2CJ 5J2NB 4X62J 1F2HA 2AYEA 2IBKA 1FTRA 4DDFA 1ROFA 2BJ1A 5F8HA 2CPZA 1I94J 4HLBA 3GPAA 5D77A 4OHWA 4LF8F 1HMVB 4KJIA 5LSOA 4R5PA 1KRPA 5DS7A 2RH3A 3FMBA 4HVZA 1VC0A 4B3TF 2LA4A 3BO4A 2EK1A 4ES3A 1S1WA 2PA8D 1ZZFA 2YKAA 3QATA 4JV0A 4CZCA 2XS7A 2ZH9A 3Q8SB 2W9BA 1RADB 3CDAA 2DGWA 5F8LA 3TVYA 2QC3A 4CO1A 1UP1A 1XNQJ 3DI6A 5L46A 2X3DA 1LWFA 4N76A 2J7WA 1X60A 2YKQA 3D2WA 4RNNA 1CQNA 1C1BB 2DR6A 2NCKL 4FNHA 2ACMA 3FQLA 1F5CA 5AE3A 2Z56B 1RTJB 1AUSL 2I6WA 2WTFA 4KO0A 4C0BA 2ADBA 4WP3A 3S6EA 3CD5A 1B4SA 4F4XA 4UZCA 3NGRA 5E3CA 5A2QY 2IYGA 1KQSR 4IRCA 4DV0J 1J5OA 4DR2J 1L3VA 4X65J 1RWXB 1QSSA 2G0CA 3R5GA 5HBMB 3OXGA 3UR0A 4M63A 3E3XA 3KJNB 2W8KA 1KFSA 2C2OB 3T1HF 3KJFB 4LF7J 3SFGA 3ILIA 4A8QA 1E6VB 3FC9A 4DR5J 2AT1B 2BQUA 4H4MA 3HCXA 2WHOA 4MIBA 3UR3C 3RB6A 3TA2A 4QYZJ 4ZP8A 3UDEA 2O5DA 2F63A 3M30B 2CPXA 1R31A 1RT2B 4M5IA 2NXCA 4LF2A 1N54B 5F8NA 1VFJA 5IC4B 2R8JA 4OI0A 1R3NA 4A48A 1OYEA 1VRQC 2WVEA 3THTA 2VL1A 5DJBA 1VMBA 4IH5A 3RRHA 1GMWA 4GKKJ 3WX4A 4B3MJ 5IT9U 1TL1B 2K1RB 4UQTA 1URNA 1JLAA 2DNGA 1EJ7L 1PYOB 1SJ1A 2L3MA 3IR7B 2WCXA 3IR5B 4PG6A 2B8QA 3GMGA 2BUNA 2HWHA 3M9MB 4D3GA 1SH3A 2F3JA 4LBPA 3I0SB 2GIFA 5BR8J 1TL3B 3M8QB 5HMZA 1PGZA 3V81B 5LXRA 1XJWB 2DO4A 1JK9B 3TJ8A 5DDPC 2HHTA 2BE2A 1N6QA 3O6QA 4WFYA 4LF5F 4P10A 1JX4A 3MAAB 4BS2A 5FD1A 4K8RA 4QZVB 3N5FA 3ZO7A 5L8RC 1OY6A 1IBKF 2NPIA 4CLTA 3O1LA 1TKTB 4DV1F 3ZC4A 1VJQA 2V69A 5ETKA 2ZUGA 3QSIA 3T1YF 3LP1B 4EI2A 2UVRA 4Y6IA 5CABA 1S77D 1VBZA 4CTAA 1RABB 2KJWA 2KZZA 3CC7S 3UVJB 1JIHA 3VQSA 4PAAA 4LSNB 5H9EJ 2QFJA 3DOMB 5KFLA 4DPOA 4LT6A 1LEOA 4O44A 2WRMA 1KTQA 2BACA 2XMVA 5EDWA 1DBDA 3NG8A 2OPSA 2GW8A 2CJYB 2R3VA 4ZPCA 2DNKA 3CJ8A 4WIIA 2PEBA 2YKNB 2X3GA 5GAGI 5CYQA 2E9RX 4QIEA 2HHWA 4TN2A 3NXZA 1F2GA 4DFJA 4TY9A 2MB0B 1YX2A 4URSA 4ZPBA 2VC0A 4QPTA 2QTWA 2AX0A 4Y34A 1RWMB 3H8YA 1VQPS 1F3VA 1U4BA 2E5IA 2E7WA 4Q43A 4DL3A 3MECA 5C42A 3GJTB 3A3PB 1OY8A 3OV7A 2D69A 3UD5A 3DLEB 3V4IA 2VB6A 1UEKA 2RT3A 1VIXA 2CPFA 3CJSA 3EVWA 1UFKA 3OTOF 3CCUS 1NRKA 2CUYA 4Q8EA 3BYPA 2C2DA 2RE1A 4DCOB 3UCGA 3BBBA 2DPIA 4UOHA 2DRBA 1UVLA 4Y00A 3QNWB 4OI2A 3NGTA 4WFAQ 2YNFA 2VDHA 1HNXJ 4XDDA 3TZZA 4HYKA 4F4ZA 5IC6B 1FKOB 3GP9A 4MIWA 1FT8A 3FZ2A 1CJVB 4LSLB 3F44A 3DYAB 1Q7LB 2NPFA 2MGZA 2K3IA 2VBYA 1VGYA 1JNRB 4DL4A 3UNYA 4ECYA 4Q8FA 3ZTQA 1FCAA 1VHFA 4J9KA 3B8HA 4JV2A 1YVFA 1Q5VA 2LXIA 2EWHA 2GO8A 1S6QA 2P9GA 3J81Y 1JLEB 5DLFA 3CCRS 1HBUA 4CLKA 3ZFVA 3BH6B 2Z2ZA 3I5AA 4O3QA 4I4BA 1NK5A 3V6JA 2M8DB 2R2RA 1UFLA 4FF2A 2WAQD 3EPIA 5IM0B 4RUCA 2YNHA 2EKYA 3LANA 4ZP9A 2MZSA 3DRRA 5K20B 1O8BA 2DIUA 1VK3A 1ZS6A 2XNQA 1F3FA 2GQ2A 3MEGB 3AB4B 1HIYA 1B3TA 4MK8A 3SDEB 2MPUA 1GX6A 4K4UA 3UFCX 4HT5A 2PGCA 4IUFA 1BGXT 2KB2A 4K2JA 2IFXA 2NSCA 1R0AB 4PZVA 1KVKA 5L9NA 4AL5A 4X64J 4J9MA 3IXQA 2E5GA 1XNRJ 5CYMB 4RO0A 1S59A 3H5UA 4RW6B 2K3KA 2U2FA 4CLLA 2CZ9A 1V3SA 1S0MA 4ETZA 1I94F 3LP0B 4NA3A 5B08A 4P74A 1MSWD 2M8HA 5KG4A 4JI2F 4YUDA 4YY3J 3Q0AA 3LOUA 2A6MA 5FDLB 5C25A 3VALA 1NUEA 3PIOQ 1IKYA 3BGFA 1JXEA 1HFEL 1WJ9A 4OHYA 7AT1B 4KHPJ 2R2TA 2YXLA 3CT9A 2FTRA 2HMIA 2CQIA 1HBOB 3QAUA 2DY1A 4P2XA 2EXUA 2E7XA 4AXIA 5IZHA 2MQLA 2BYCA 1QM9A 4DUYJ 3EICA 4NMLA 1FVQA 3Q8QB 2V8DA 1XBWA 4HT7A 2MZTA 3PZPA 3DDIA 1XMBA 4DG1A 5KG3A 1UEUA 3G2XA 1H2VZ 4FP9A 3ENAA 2H3EB 2MQMA 2Z30B 3OQ2A 2AJ4A 3EUNA 2CZ4A 2FC9A 2YH1A 5THWA 1LFWA 2RSQA 3MCSA 3DLGA 2RNEA 2W2NP 2RS8A 4PXCA 4ZVSB 3FDSA 2YNIA 5KAKA 1YITS 2SXLA 3AFGA 4USJC 2L9NA 2NREA 4I68A 5D4NA 3K58A 4JUZA 1YRTA 3LF0A 2BANA 1U6FA 1IVZA 2ZJRQ 4KPCA 3D28A 4WXWA 4GMKA 1Z2ZA 5LMNF 4DR6J 2BOPA 4ZVQB 1CC7A 3CDUA 1YJUA 2HHHF 3K8WA 4CO2A 1SC6A 4RW8B 3KJVA 4PWDA 1RA7A 3E01A 2VBXA 1FJGJ 1AFIA 2CQDA 5EWFA 1LWEB 5A8KB 1YBTA 3NBPA 3HM9A 1LWCA 4B3MF 1NMEB 2RQ4A 4EEYA 4OIXA 4DSIA 5FIIA 2O01C 2AV5A 1DARA 2LCWA 3M4XA 4JI6F 1WORA 2R42A 3H90A 2OIHA 5IV3A 3CPWR 1Y9OA 1PC4A 3QRPA 4U7UD 1WG1A 1TUWA 2Z4PA 3L95X 4DZDA 2FHMA 4CT8A 4HL9A 1WC3A 1MU2A 2I9SA 2KG0A 1VHIA 3FZBA 1T3NA 3FJ2A 3EJMA 3IP0A 5GADU 4P2FA 2M2BA 4B9MA 3TQ1A 5LOQA 3WBZA 2KKHA 4ZLPA 2GX8A 2RQKA 2F9JA 3W9HA 3CXCR 1UCNA 2DGTA 3KHHA 1SUQA 1WF0A 2YWWA 5K8NA 4N8NA 4ES2A 2ZKTA 4USMA 2DRAA 2LECA 1RHUB 4EBDA 1C0UB 4LF6J 3TUJC 2OFHX 3NY0A 1U1NA 2IIHA 4Y0FA 1FNOA 1X4CA 2BJDA 3J81j 1RU1A 3UCUP 1IJEB 1NKEA 2GCFA 1UJ6A 5I4MA 3AD8C 4G1IA 2QGFB 3IR6B 2UU9J 2B9XA 4NLOA 3SQGB 1VQOS 2XY6A 3DRPA 3G6YA 3HHLC 2HPUA 5K14A 2HAIA 3CD0A 1H74A 2ABYA 2QL9B 3BDEA 4M5NA 2HFOA 2FGCA 5D6GA 3K7RA 2ZUAA 2HVZA 2ZITA 3TZXA 1TR0A 2B4VA 4EYIB 2ZDPA 4GC6A 2Q79A 1N34F 4G65A 3E51A 1EETB 5DZ6A 4FXWA 1D3WA 5DZ7A 5CAAA 5CQGA 3T6JA 2EFNA 4K2XA 3GJRB 4RW7A 1TK5A 1UVNA 1OY9A 3EGWB 3C2PA 2KHDA 1AXQA 1TUVA 2ZH7A 1HNVB 3D5MA 4ILLA 3CMAS 1UA1A 1GTEA 3ONQA 3QGHA 1IKVB 3LP2B 3PX6A 1UAWA 5IQ6A 3D1QA 3MAHA 2XLIA 1ZM2A 4ZS6A 4WTOB 3RB0A 2FZGB 1N5SA 4KHMA 4NZ6A 3K5MA 4ED5A 2Z8QA 2XG8A 1QSYA 3V6DA 1GFWB 2EFPA 1WG5A 3W66A 1VK8A 1TKXA 1IR0A 3U1LA 3US5A 2OAUA 2V2KA 1QE1A 5HVGA 1HQEA 3DOKA 1U1PA 3ENQA 2HHVA 2W2OP 1RAJA 3KG0A 2XWXA 4C7QA 1F60B 1X5SA 1NU4A 4LF1A 4OQJA 5J2PB 1LFPA 3QJJA 3NGKA 1E6YB 1HW9A 4K0KJ 3HHLD 3QT6A 4M5DA 3BGRA 5CD4H 4YHHJ 4HTJA 3TI0A 3FBFA 3ZXWA 5D4OA 3NAIA 1GX5A 2D3OR 4OYXA 1QAIA 4HKQA 1Q86T 3MOJB 4I1TA 5HSPA 1YRXA 1RTDA 4FVCA 2CJ9A 3MM6A 3UN5A 4RW9A 4ZPVR 3OD2A 4J9SA 1H98A 3CC4S 1SQEA 2KYZA 2QSWA 2NXUA 3DGPB 1WKLA 4IFYB 1RHJB 2HGLA 5JXSA 1PJ6A 2FZKB 1CC8A 4NI2A 1K47A 1TTHB 1NKCA 2VF3A 3SCKE 3CDWA 3CE8A 5H1SV 3IBWA 4F25A 4WKRA 3DRYA 1MN7A 4B9NA 3TP2A 1Q1KA 2AU0A 1CEZA 4WK3A 2FLLA 1N8RT 4ECQA 4F0MA 2BRLA 4I7FA 3A1YG 1K9MT 1JJHA 4DX8H 3I82A 5A8WB 1B99A 3GSIA 2CFXA 3GFZA 1T9YA 3MF5A 3J80Y 4DOZA 2MTLA 1YDLA 2IY5B 2F8EX 4PYDA 4I69A 2JEIA 3ZTPA 2MZ1A 3NKYA 3SV4A 2P2CB 2XBPA 1BY9A 5C5JA 5B0AA 5F41A 2DVIA 3TQEA 4NX9A 4DUYF 3H4DA 3LGNA 1HWLA 1C0TA 3AXMA 2IJNA 3U1MA 4MKVA 2EKNA 3GV5B 3KK2B 3AA8A 3GYNA 3PYDA 1IKWA 4XTTA 3W2WB 3R5DA 4OX9F 2A3JA 4TU8A 1FRMA 3ENVA 2HIQA 2K7KA 8ATCB 1AFJA 1S6PB 1AB8A 2HNDA 1ZPVA 1HHSA 1X0FA 1ELOA 3OTEA 3OUYA 1MROB 3J7ZT 2VA3A 3GU0A 4O0IA 4DXLA 4DQIA 4A8KA 3NMRA 3GB0A 4LIRA 1UEVA 2MQ8A 2FHJD 2HNZA 4DR6F 5B09A 2XC9A 4X84A 3HZEA 2AEFA 2RILA 1YI2S 3M2VA 1RTHA 1RJJA 2XNRA 5BXIA 1PILA 4C3KA 1RT6A 2CQGA 3I0RA 2YQ0A 1L3UA 1VLYA 4RBTA 5HQMA 1YK9A 2G13A 1HNZJ 2F1FA 4H4KA 2CPEA 1WSVA 2KDOA 2E5HA 4OJGA 1XMQF 5ETMA 1GMWD 4DV7J 1H7XA 3W9IA 4LRCA 2FY1A 4Z2XA 1M5VC 1RACB 2W9CA 1TKZB 4E2FB 1KVJA 2GAGC 2W7OA 3ZTSA 2Y3YA 4DWIA 2IAJB 4WP9A 3CCSS 3HVWA 1UWAA 4B3OB 2R2UA 4ZP7A 2ZBPA 3B4DA 3MEEB 1QVGR 2RF2A 2CA9A 2FJVA 4OJHA 1Y11A 3UQSA 1UMJA 1RTIB 4DR4F 1FKPB 2NXJA 4DI6A 4QWAA 3G6XA 4UT4A 3NCQA 3ILLA 1RAIB 3CMES 4HTIA 3TZYA 1EB0A 4IFVB 2Y1LB 2JC1A 5IWAF 1WEZA 5DDOC 1F9FA 4FKXA 1D8ZA 3K5NA 2AEJA 5ETRA 2GIQA 3PFEA 3LGHA 4LR9A 2GVDB 5CXTA 3BO2A 2DISA 3VWSA 2BX6A 4ZP6A 1N5YB 5EX0A 3HXMA 4ED0A 1WOPA 3N01A 3M05A 2I5JB 3CCQS 1UL3A 2RS2A 3RU0A 1LKZA 3BBCA 2RHQB 4WXOA 1ZM3A 4JB8B 2E5JA 5KT2A 5KFFA 1U49A 2O67A 2CG8A 4KH1B 2PDAA 3R1HA 4J7CA 4L73A 4NXNJ 1FRIA 1JLGA 3RRKA 3PR4A 3OR1B 4K4SA 3FCVA 4ANCA 3G82A 3Q24A 1SQGA 1WF1A 2UUAJ 1EQMA 2WBMA 3KK1A 4N8OA 2UVUA 1HHQA 4OYWA 1HD1A 2BJ7A 1KN6A 1RGVA 3NEKA 1FRJA 4G1QA 3SCLE 3TANA 2C2RA 5J2MA 2OO4A 3QPIA 2AIRB 4DV3J 3HVTB 4OHXA 3M9OB 5FLXY 4YEAA 1PAEX 2AHOB 3QIDA 1F5AA 2XMAA 1XERA 4DFPA 3A4TA 2DBBA 3OVAA 3IAS9 3M8ZA 4ICLB 2AKWB 2MSTA 3S1TA 2LXUA 1VOMA 4Y65A 2HHPA 4DUZJ 1IBCB 1U26A 1UPPA 5BJRA 3H0PA 4DPYA 2P6TA 1U25A 4QIFA 2RU3A 1P27B 4N47A 4JV5F 4HACA 3GCWP 3RGIA 5M2UA 4CLZA 2ZBQA 4RNFA 2ZH2A 4FPRA 2OH2A 2BW2A 3J7AN 2E29A 1TUGB 3P45B 1TMMA 3PYFA 1YKWA 3HHKA 2NSBA 1C1BA 3NWGA 2DNMA 1AZSB 1V5IB 2CNOB 2WK4A 3MMCB 1FD2A 1NK9A 5CZVA 1Q8IA 2DRDA 1VQ7S 4ZPTR 1RTJA 1PAUB 5F8GA 3JSRA 4B9TA 2Z58B 1VRUB 3H40A 2ZWOA 4M5HA 4C4WA 2GAHC 3WIUA 2HHSA 5KT4A 3D3CJ 3QAEA 1TZ0A 3QZ7A 5HBMA 5GAGU 1K0VA 2WB4A 4LFBJ 1HBMB 1T7PA 1VQLS 1QUPA 1S0VA 4DFMA 3DRSB 3V5RA 2DGXA 1E6VA 2CDQA 2OHDA 1RLCL 1U47A 3OR2B 4W98A 2EC2A 3J7YU 1FK9B 3NNHA 2MY8A 4TXSA 4KY3A 1LW0B 3H4BA 3VGTA 3HPOA 3QGIA 3M30A 3IM8A 1KQFB 4OV1A 1RT2A 3GV8B 3V4MA 4P2MA 3R9LA 4DV6J 3W5YA 3V6HA 2F5GA 3FVYA 3VCDA 1AYEA 3IWXA 5KFIA 2GV1A 2XSJB 1LQ9A 1RT5B 3G86A 2EG2A 3W62A 2Y8WA 1TL1A 1GXUA 3B78A 3M1VB 4V19J 1GXLA 1KNZA 3FSXA 5DQIA 3BKUA 3NNCA 4PQAA 2J8SA 2R4FA 3I0SA 1TL3A 3M8QA 1FFWB 1RBAA 3FK4A 1ITPA 4QR2A 2YKPA 2MDAA 3ULHA 2H4WB 3M2UB 1S79A 1KOOA 2WVFA 2UZAA 3N6MA 4PRFA 1RB0A 1REGX 1DZ5A 3MAAA 4ZK7M 2HWIA 3UN3A 4LR8A 3CCES 5ETQA 2CADA 3OJUA 2A10A 3TYTA 2MY7A 4QU6A 1FXLA 2IMWP 3H5YA 4DV5J 1S48A 4NLQA 1N4LA 4FBTA 2FPHX 3LP1A 3RW6A 2WSFC 3M6XA 3Q86A 3D6HB 5BYSA 4NCGA 2AD9A 3CW2C 4FDFA 4ZVPB 3PJXA 2QLJB 2O1PA 3PVXA 1X31C 5IT4A 4LSNA 1GMUA 3IFEA 2FVSA 2F65A 3DOMA 2XY5A 3DFEA 1S4EA 2ZBCA 4NXMJ 3A8EA 5KG6A 3GYGA 4TNOA 1BQMA 3WZ0A 2GIRA 2BOAA 2BQRA 4G3IA 3SCIE 3OBIA 1U1RA 1N5QA 1WEYA 1CVJA 4UOCA 2YKNA 3PM9A 1PO6A 1U09A 2QYGA 1FJEB 3LPYA 1M5KC 4ZVGA 2VOPA 2HHQA 1Q5YA 4GKJF 1VQMS 1RWNB 2DR8A 4NLDA 4OZ0A 3LALA 2V4JB 2XMKA 3F56A 4Y2KA 1X4AA 1WC6A 2RQCA 2L08A 2P5VA 3EZUA 1H2TZ 3S01A 4PWWA 4LFAJ 4GRSA 2ASYA 2OLWA 1WHYA 1N5TA 4LVNP 3DLEA 4PG7A 2NYHA 2FLPA 4DMZA 3CDBA 3SV3A 2YNGB 4DR3J 1T11A 4QWCA 2PN6A 3ET6B 4IG0A 4KAIA 2VIHA 1QD1A 2BKNA 2XZWA 1GQEA 3DLKB 3MOZA 1Q81T 1S9GB 1BWVA 2BE9B 1RT1B 1WC0A 2B9YA 1FKOA 5T14A 3R3TA 3EXCX 4LF9J 1CJVA 2C3MA 4LSLA 2OPQB 3DYAA 2I1RA 3MI7X 2ZOGA 2J7UA 4L6V3 1P9QC 2CNNB 1S5ZA 3BSAA 2ZE2A 3AJDA 1X4HA 4FF3A 1RKIA 1NSPA 4D3HA 2WOMB 2I0XA 4R0EA 2VFUA 3OXLA 3EVMA 3CNQP 4OLOA 2JL9A 4OYPA 4ED3A 2XCPA 3DU5A 5KFHA 2ZVIA 1N33F 2ZZNA 2HHXA 4OI3A 2ZBIA 4OFZA 3PYGA 4C11B 4TQRA 2J76E 4IOAQ 2LU1A 3ZNUA 2LQ9A 3C15B 3BQ2A 2YWKA 3TUPA 1CPZA 5IM0A 4ELTA 5GAHU 2XMUA 4WYLA 5H9FK 2KU7A 1SL1A 4OYIA 4WE1B 2GS8A 2R8HA 3MEGA 2HBYB 1A9NB 1QJHA 1T9WA 3SDEA 4TU9A 5CD4A 4LQ3A 1D09B 4OYMA 3TW0A 3O3LA 5KFYA 1VJWA 3WC0A 2C3YA 3ILJA 2DIVA 4O3SA 1R0AA 2CYYA 5I42B 4JP8A 4X4PA 2XO6A 3T5LA 5KFOA 3OFHA 5CYMA 1T9TA 1WUUA 4EZ9A 5L1LA 1HW8A 4JI8J 3D68A 2DR9A 3H59A 5KOWA 5JVGQ 3QT8A 2HS0A 1YWXA 2AJ1A 4NLRA 2PIIA 4QWBA 2XEXA 3LP0A 1SVDA 2PC6A 3DDKA 3X3UA 3FEZA 2V5HG 4OZLA 4LRFA 5FDLA 2V67A 1LNQA 4AL6A 2G0JA 2YX4A 2ZNZA 4A8SA 3AD9C 1HQUB 3J81U 2EFVA 2HFUA 4C9DA 1CJTA 3J7Z5 3HZGA 1RWUA 4BLGA 3FGVA 1Q16B 4FN5A 5HO4A 1IR2A 3BO3A 2WVCA 2U1AA 3JTOA 2UXCJ 2ZHOA 4DX7A 4W4MA 4WKYA 5IT0A 4LBHA 1NXIA 4IG3B 3FMWA 4ZPDA 1H7WA 3IGNA 1HBNA 2QMXA 1FD8A 1U6ZA 1HBOA 4DL0C 1VIOA 1U0HB 1ZM9A 1BQNB 1Y3KA 1FWKA 2OMOA 2UVVA 5D78A 4FVMA 5SZTA 4ID5B 4R0JA 3F73A 4PYAA 3VAGA 3OTDA 4RUBA 2LP4A 2JJ4D 4AL7A 4LF4F 1S9EB 1H2UX 1WD6A 2DHXA 4URGA 4ZJQA 5HROB 1NBEB 4OZNA 2ZD1B 1Y4ZB 4B3TJ 2MHNA 2JZ5A 3RR8A 8AT1B 3A13A 3GZ7A 4B3SF 3IRWP 4LRAA 1VQNS 2ZBRA 4RX6A 3GILA 3HJVA 3TUZC 4K5SA 3EYZA 4OI6A 3KDNA 1KQKA 3X1LB 1DHMA 5I3QA 2F4FA 3MEKA 2HQDA 3UO0A 3F0NA 2XTJP 1JB0C 2AYBA 3MM5A 4ZCLA 3HHLB 5ADZA 3PX0A 5GADI 2M88A 4DEZA 3C6UB 4RW8A 2O3DA 4B08A 2FJEB 3GG1A 4DV6F 1RT7B 2ZC4A 1AROP 4LRDA 4I2QA 2H5JB 3I9V9 3IG1B 3CSKA 4HR2A 3OFEA 1LWEA 5J2QB 5D4PA 5A8KA 3OHAA 2QRRA 4BWJA 1RHRB 3VAHA 3M8PB 2RB7A 4B17A 4JI0J 1SKUB 1TK0A 3KKFA 4QBUA 4QW9A 1DTQB 3H25A 4HHJA 5JMNA 2DHHA 3PEJA 4TY8B 3D9BA 3T1HJ 2J9CA 2FIUA 4QIVA 2IBOA 5AJ3F 3FRZA 5KOXA 3JXOA 3MURP 4O4GA 4WFXA 4YR2A 2BJ8A 4H54A 1A0OB 4M5MA 2NLWA 3BKFA 4ETXA 5KFMA 4H4KC 4Y2MA 5EGYA 4EZ6A 2FVPA 1KHVA 1P6TA 2V8HA 4X4TA 3AJ2A 2H5EA 1HR0J 3HHEA 1RHKB 2QYCA 2W9BB 2LLZA 4C6AA 2VJUA 4PQUA 4AQYF 2H9ZA 1U1QA 2MQNA 4RNOA 3CWJA 5DGBA 5ETNA 2JFKA 5K8OA 3DI6B 5LXYA 2W24A 1RT3B 4GO7X 1C0UA 2OD4A 2NZCA 1DLOA 3QMQA 1JLQB 2DH8A 4L3KA 1NZAA 5LSRA 3CJ3A 5DETA 5A8RB 4KFBB 1U2RA 2YKOA 2DGUA 2MYFA 4NXMF 3I31A 2DO0A 2OFGX 4G1PA 2W1BA 5LMUF 3A3OB 3SSRA 2HVDA 4LF5J 3TR5A 3VQTA 3IWNC 4ZCKA 4NCBA 1TQLA 2V63A 3SQGA 5EN1A 1IBKJ 1UKUA 4DV1J 5L1KA 4IR9A 2KZMA 3T1YJ 3VAFA 3H7HB 4Q2MA 2F40A 4ZVEA 1U45A 1W25A 4LMZA 3IRXA 2M0GB 2E66A 1FXRA 1IKXB 3R8YA 2YQ3A 3JSMA 3RAMA 1WSRA 2AJQA 1NNDA 4J37A 1EETA 3HDSA 4DL5A 2VBWA 1VI7A 4O0NA 4JI7F 4WF9Q 2CQ3A 3CDEA 3KDOA 4DHVA 4K7QA 1K1QA 3SBMA 3OFGA 4C48A 3CCVS 4PKDB 2ATCB 1UW4A 1NPKA 2VA2A 4R8UB 1JLAB 1ZAWA 1RHMB 2NXEA 2FLOA 2HQGA 3AJ1A 1HNVA 3PEHA 1OSCA 4ANEA 4X4VA 3LAKA 1IKVA 3LP2A 1MNEA 2DGQA 2J0XA 2UXDF 3QYYA 3Q22A 3LGMA 3I9ZA 3C46A 2F4VJ 3RAQA 2KG1A 2RQMA 4B9VA 2BABA 4YDXA 3BPSP 4TLRA 3LO3A 3OTOJ 3BV8A 2WSEC 2VFTA 3E2EA 4DV4F 4B9UA 3HULA 1NK8A 3G87A 2ZZTA 1NK7A 1WHWA 4M5JA 5C7PA 1XMOF 3GV7B 1MWZA 5DO2A 2C2ZB 1OS5A 5B0DA 5AE2A 2Y0BB 2BKPA 2QZ8A 4ECZA 3OTBA 3RAXA 2LEBA 5J2PA 2OEMA 3BM7A 2DR5A 1TL5A 3UD4P 1E6YA 3W5XA 1G2EA 2WW8A 1T02A 3TA0A 1B64A 4C0HA 1TKDA 4CYUB 5AXNA 5HAOA 1R27B 4WZQA 3EM1A 1ZTWA 1TVRB 2W4PA 4OYOA 1NJZA 1MMDA 1RWKB 2APOA 1ZTTA 2KN4A 4AUKA 1F5BA 3SIPB 5KFBA 2CQ1A 4FXVA 4DL6A 1NPPA 2XMJA 3P8BB 4USIA 2AQ4A 1WACA 3DGPA 1SJFA 1SV5A 4RW4A 4DV2J 2N7CA 4IFYA 2IVYA 3PIPQ 3OLAA 3MECB 3H2LA 3Q2TC 1CSJA 4DF4A 1RI7A 3ZNJ1 1IQTA 1EKRA 2KFZA 4J9OA 1Y5LB 2YX7A 1AA1B 4F4YA 4L76A 4LREA 2HHUA 2DNZA 2CJQA 4CO3A 1R8HA 3GE9A 3ZZOA 5GMDA 1SBRA 4JI1F 4MYTA 3IA0A 5F8MA 3V6KA 3MM7B 3TA1A 5A8WA 4ZLJA 2Z2YB 3TJ9A 1RISA 3W7BA 3I5BA 2PFDA 1XR5A 2AZ3A 2MEWA 3UDLA 3N28A 1X4GA 1R89A 2J6UA 2QT7A 4NZ0A 4JI2J 4PXDA 3Q8PB 3KK2A 4ZVTB 2XI3A 2B4UA 2HQ3A 3W2WA 2VQEF 1SKSA 1FJCA 4K50A 4NLPA 3OL8A 5E41A 2CNLB 2IRYA 2JDJA 2ROGA 3KOAA 4KYZA 2DCLA 3BEGB 1S6PA 1MLAA 4ZPWR 4H4OB 1RAFB 5E2QA 1VBYA 3MXHP 5H9FJ 2RDDA 1X7VA 1MROA 4U96A 1NK4A 4ED1A 2N3OA 4QQBA 4OJ3A 1X5OA 3C16B 3DRRB 3K57A 2E9TA 3EVOA 4KV8B 3I6PA 2JNJA 1OIAA 2JEGA 4W92B 3OXFA 3CGIA 1KOHA 3ZZRA 3ISNC 3CCJS 1G1XA 3R5AA 2ALZA 1U2CA 1WDDA 4A4JA 2XLKA 1IBLJ 2HK2A 2RRBA 1YJRA 4P7VA 4CP5A 5CA5A 3J80U 3KHRA 4NOHA 3EE3A 1HWKA 4HH0A 4JI0F 4ZN3A 4O3OA 1T0TV 3MPWA 2J9DE 1ZH5A 2CAJA 2CPHA 1SH2A 2RRNA 3FKBA 4A8XA 3AHPA 2FJWA 4UOFA 4NYOA 4B3OA 4DSEA 5CYJA 2D9OA 1HWJA 5LMNJ 1K0TA 3FFIB 3MEEA 1P1LA 1S6UA 2CDRB 1EZZB 4F0HA 1ZYQA 2HHHJ 2Y1RI 1U1KA 4MKAA 3T41A 1RTIA 1FKPA 1IKYB 2GFFA 3K0JA 1HR0F 2MJUA 1S97A 3DHWC 3TJAA 4IFVA 2Z2MA 3KLFA 4RL1A 1RWWB 3C3LA 4N41A 2BA9A 1R6VA 3AD7C 2HMIB 2NUUG 4MT1A 2EFQA 1KTVA 2B0GA 1EX8A 2VBZA 2GVDA 3RRGA 3K59A 1NLKL 4EGLA 2VOOA 1U48A 1KS2A 4JI6J 4TYAA 4WU2A 4DX6A 5KFCA 2ZM6J 1WC1A 1N5YA 2KHCA 2I5JA 3CJTA 3W60A 3M6WA 4YS2A 3M8YA 3D4JA 2KYXA 4DG1B 3ETMA 3WIVA 3D6TB 1N32J 4JOUA 3PKMA 2GJFA 4PXEA 5F8IA 1WOSA 4OL8A 2XGQA 4C3MA 4DQPA 1WC4A 3MR7A 3GJQB 3DU6A 1RE1B 2QLXA 3HI9A 1JQGA 3MPVA 4KBIA 3OR1A 4J90A 5JVHQ 1MWYA 1YJ7A 3JYTB 1T8EA 3SSSA 3QO9B 4CM0A 3MUTP 2AWZA 2BZ2A 1MWQA 1BLUA 3T5KA 2UVWA 3FCHA 4ZITA 3NGSA 4RU9A 4YR0A 4I0WA 5I3UB 2VPXB 1APSA 2LA6A 3HVTA 4C98A 3HX9A 4CLUA 4EBCA 2OJ3A 4F4WA 5KFWA 4Q0BA 3Q8YA 2DTJA 4OZ1A 1VQ8S 1SJQA 3OL7A 1LK7A 1K73T 4RJVA 4ICLA 3AY0A 4YB7A 1L3SA 3KNGA 3HSGA 4TQSA 3K89A 5AT1B 2HGNA 1TV6B 1PJ5A 2J0SD 2FY8A 4K4VA 3CD7A 3MZIA 2CJAA 2GVZB 3NBPB 2E1AA 4RBVA 3NLCA 5HVHA 1KFDA 2AJ0A 2ROEA 1M5PC 2GGPA 2YWHA 4ZVFA 3IO1A 4CI0B 4RWWA 3KLHB 5KG1A 2B9EA 5I3PA 2WONB 3OSNA 3D6MB 4N56A 4IRKA 1SIWB 3J7YI 4F4KA 2QJ3A 1YJWS 2OUGA 4MKYA 2DHSA 3W2VB 4X4SA 2LQJA 5KG7A 2V8GA 1EHWA 2F4VF 2WW4A 2JHEA 2B7BB 1AZSA 3MMCA 1M1GA 1N34J 4MFBA 4ZCMA 4HHUA 3VV2B 2DHGA 3B6BA 1J5EF 5LJ5Y 2B9WA 4P75A 2K7JA 1I1GA 3MPYA 5AXKA 1VRUA 4C8LA 4MH8A 3PR5B 1SUQB 2E5LF 1FFSB 2GQCA 2HKEA 2YVSA 1PJ7A 5AXMA 1HYSA 2MLZA 5FLXU 3NNAA 1MMLA 1SB6A 5HATA 3DRSA 3R2DJ 2FJDB 3OR2A 3RG6A 2HBRB 1FK9A 4PUOB 1ZZNA 2R7QA 3C19A 3TUIC 4HI1A 1QDUB 2VHGA 3KK3B 1LW0A 1FA0A 1DFDA 2XWYA 2E1CA 4M95A 3W8PA 1BC6A 5B0CA 2BQ3A 3DLLQ 3ENWA 3RBZA 4XDCA 3T9ZA 5KFTA 1FF2A 4HHHA 2DGVA 2XSJA 4P6QA 3DM2A 1RT5A 1GNKA 4LQ9A 3DRPB 2XHWA 2BJ3A 5K14B 5KFUA 2Y0SD 3M1VA 3W63A 4UQGA 1V9OA 3THVA 4DV2F 5A76A 1Y00A 1I51B 2XZTB 1NZ8A 1I5OB 2J0WA 4DSFA 4TVAB 4QPXA 2XMWA 1JLFB 1DQ9A 4JI3F 2C3OA 1WTBA 2VKZG 2BVZA 3ISZA 2KXNB 2B6AB 2VPZB 4XK8C 2Q6CA 3M2UA 4K4YA 1FE4A 3IS9B 2M7SA 4MJKA 3M2RB 2C2MB 4X4QA 2W7AA 1NH7A 3DLJA 4WCEQ 1SJRA 1MMNA 2W25A 4EO8A 5LM7E 3HP6A 3MM9B 4RW7B 3DOLA 1IM6A 3JS9A 2QFIA 3C6TB 4WBFA 2CPDA 4IR1A 1LW2B 3QZ8A 4E0DA 3DXSX 2MKKA 2YX1A 4V1Ak 2R8IA 4WP8A 3DXBA 1KONA 3CF5Q 1CJUB 4IDKB 3CEDA 2COLA 4M5LA 1OJ4A 3BN4A 3BDPA 2WB1D 3CB4A 4FYYB 3TX0A 4IOBA 1YG0A 4DSJA 2HK3A 2ATLA 2QA2A 4MAKA 1P9YA 2CQBA 2QSFA 1AT1B 3DCAA 4USUA 2A1BA 1TKXB 4MIAA 4OHZA 1J2VA 3GIJA 2JEJA 4ZA1A 4NLSA 3Q8RB 4F67A 4I6WA 2LXFA 3LH2S 3CJKB 4WJBA 3PTWA 1HQEB 1VBXA 3DOKB 4JI5J 3GTYX 3HVRA 2V4JA 3K8VA 3GFYA 3MEDA 2G1HA 1ZA2B 4J9UE 2ADCA 2FQQB 4X4OA 1NDLA 1BMQB 2AW0A 2C2KB 2N4DA 3BGRB 1T9UA 4ECSA 2BXJA 1PG5B 3CCMS 2ERRA 2N82B 2FC8A 2CJBA 2UUTA 3IMQJ 3KHGA 1H6KX 5G4DA 3EDQB 1IBLF 4OX9J 4OX7A 1WHVA 4L74A 1T05A 3H98A 4KHRA 3UPFA 2QG9B 3GCXP 2YNGA 1HARA 1CULB 3ET6A 4LFCF 3MM6B 4A8MP 3RBEA 3VTIA 3HHDA 4CDIA 3DLKA 1S9GA 2G4BA 2IA6A 2OPRB 3I32A 4F2RA 4XAKA 4OJ1A 5GAHI 1XQIA 1RT1A 1ULRA 5D0EA 2EW9A 4YP3A 4YN3B 2OPQA 3M8RA 5ETSA 1M1KT 4NI2B 3B4MA 4NMXA 5E7OB 2OEJA 3Q8VA 3MR6A 1HLWA 1YBAA 1R0CB 5EHHA 3EZOA 2XZDB 4NEYA 4Q2LA 2XQCA 2GHPA 4Z37A 3N6NA 1JLCB 3H2VE 3W8GA 4N5SA 4ED2A 2IC3B 3CJ0A 2QLFB 3SFUA 4I7FB 1X8DA 2VU5A 4C11A 2RDIA 3AQPA 1WKJA 4OHVA 2AF6A 1XMQJ 4KTQA 3SZ2A 4ZMMA 2A2CA 2HQCA 5F3TA 1XC9A 1OSDA 2GHWA 5FJ4A 2ZM6F 3EGVA 2HVHA 2VD3A 4WE1A 1JKHA 3R5BA 4WTYA 2FJXA 1N32F 1GK8A 3MPDA 3B54A 3VAMA 2NR0A 1OPZA 1N52B 5EWEA 4DR4J 2ILZA 4KB7A 5F3ZA 2QN6B 2MKJA 4LVOP 2DYAA 1EAYC 2R7OA 5I42A 1QLNA 2DB1A 5M2RA 1D1UA 5IWAJ 3GIRA 3TAQA 1S1UA 4RKUC 1G4CA 3OHBA 2OKQA 1QAJA 1T94A 3DKDA 4DPUA 1N36F 3WC2A 3HT0A 3MR2A 2RUGA 2CNKB 3GSDA 4F4AA 1FKAF 1T9XA 3M2VB 1EIYB 4DSLA 5D15A 4B02A 2Q66A 3H2UB 1HQUA 1RT6B 2CQPA 1PC5A 2HSEB 2VG6B 3I0RB 3H42A 4DPXA 4ALZA 2BJEA 2D74B 1RAEB 3SXLA 2AGPA 4BWMA 2YBVA 2YQ1A 4OZ5A 4IG3A 2YWEA 2DCUB 3T5HA 4YB5A 1TAUA 3FUYA 1BQNA 3RZAA 2Q1LA 5SUHA 4ID5A 4ZIWA 1S0NA 2N3LA 1S9EA 2MQOA 1WNEA 2IM1A 5BYQA 2MSSA 5LSLA 2HRTA 2PEHA 1WEXA 2ZD1A 3HK2A 5HI7A 2VG5B 3PG9A 4CCHA 9ATCB 3O5TB 2KL8A 2MXYA 1P1TA 4A8FA 3W9JA 3WDOA 5HJXA 1M90T 2VH7A 2MKCA 4JV5J 5LT5A 4MK9A 3GG0A 4W90B 2HYIB 2ALYB 1Y10A 4DZ6A 1HI8A 2OELA 4HDGA 1NK6A 1FWPA 4JYAF 2DK2A 1G3OA 2GZOA 1RSCA 3C6UA 5KFVA 5EWGA 1RT7A 2MLXA 2KFNA 1JLGB 5KFEA 4B3RF 3G6ES 3IG1A 2H5IB 3G82B 2X7IA 4DR7F 1FERA 5J2QA 3KK1B 2CJXB 1Q79A 2Z2LA 2ZEJA 2Q6BA 3EPGA 5D0RA 3EWGA 3M8PA 3Q23A 9RUBA 3NS6A 3MMAA 3AQOA 5ETVA 3T6BA 4G1QB 4K5RA 4KPYA 1DTQA 5J2MB 2HW3A 1Z4UA 2W01A 3A3NB 1T95A 1ZETA 4TY8A 4Q44A 1HNIB 1Z2LA 2ASLA 1KWMA 2B56A 2UP1A 1SI9A 1VQ5S 3LUYA 2HS3A 3ZZ0A 1NEEA 4EO6A 3BGOP 1NHUA 1NJWA 4WWSA 1ZOTA 3KJQB 3MHYA 2OP5A 2XYHB 2IPOB 1K1SA 4CH7A 2PO4A 2CVEA 4M5GA 4K4ZA 1CLFA 4OYBA 4QOTA 5HJYA 4DFKA 3KMQA 2OSRA 1RU2A 1R8PA 4J9LA 3BBFA 2R7TA 2IJFA 4IYQA 4HACB 1SL0A 2WBRA 4AT1B 5DG9A 4FYDA 5T7LA 1RT3A 4ERDA 3DMJB 2IJRA 2UV8G 2IDEA 1FRLA 3G8SA 4PG5A 1JLQA 2KM8B 5KT7A 1ZA1B 3QJPA 3PRBA 3KG4A 5CCLA 4ED6A 2KVQE 1OO0B 3QRQA 5A8RA 4KFBA 4B9LA 3UWTA 1BHNA 1UZHA 1HWIA 3VZIA 4MMOA 4OZJA 5C2CA 4TKTA 1V3ZA 2OEKA 1UFWA 2XY7A 4ATNA 1NH8A 1TL7B 2HIYA 2FVCA 4FYXB 2OTLS 4PXBA 1V5VA 1JNZB 1TK8A 4JI5F 1PIEA 3M9NB 3HFZB 2CKWA 4GVLA 2HVEA 2V0NA 7FDRA 1S72S 3ITHB 1VRTA 1V6HA 3B82A 4DU8A 4CO4A 4QJVA 2FHJA 2CIMA 4M8LA 1IKXA 2C3PA 3FQKA 4DQSA 3KLIB 1RT4B 5E33A 1GEHA 3QLHB 1YZ7A 2IVFB 2JC0A 4ZKAA 4O3RA 1AUDA 2X51A 4P7TA 2IRXA 3U7JA 2JVRA 1SJ3P 3NL0A 2YWGA 2RD5C 5G0RA 2DT9A 4TYBA 1PYTA 4ZCIA 2DEIA 4R8UA 1S1VA 2MZJA 1R8CA 1M5OC 3P5TL 3BR8A 4GKJJ 4PCQA 3MGJA 4UUXA 2B7CB 2LDIA 2FYXA 1XR7A 3JB9k 2P9CA 3AB2B 2YTCA 1REVB 1N0VC 2VODA 4RNHA 5JUMA 2FUG9 1OMSA 1WOOA 2BEFA 2G0IA 5K8MA 1YLXA 2LKZA 1M0SA 1TFWA 2GHVC 5M2PA 4DQRA 4J9NA 1T03B 2DNPA 3MUMP 1YTYA 3QFWA 4C2MA 3VGVA 4KGXB 3KWMA 4YMEA 3D66A 3NGDA 2FGOA 1P8GA 4GVBB 1BQXA 5IV4A 4C3LA 4EMDA 4NCGB 1RUSA 4C8OA 5CZXA 3HVAA 1NSKL 4J9VA 1RK8A 2BV3A 3HF5A 3RBDA 3BGLA 1B0VA 2L9WA 3LWMA 5D4LA 1R6YA 3CO9A 4IRDA 1I3OB 2FB0A 1GT8A 4CYUA 4KGZB 1BQMB 3RB3A 3CULA 1TVRA 5KFAA 1N33J 2V2VA 1NKBA 2YPYA 2VFRA 4KIAA 1V3RA 1ZM4A 2HNYA 2UUBF 3MD3A 4EUVA 2QEXS 5J1NA 3PDNA 3BSOA 3BSNA 1Q78A 1NJYA 1SC3B 2VG7A 3CCWA 3VVTA 2DJWA 5BYRA 2X1BA 3KNAA 4CO5A 2JH3A 1HNWF 2UXBF 4RR5A 3C14B 4ZVRB 5T41A 2V68A 4DCPB 1S76D 4IG0B 1S7IA 3TAMA 2HZCA 4DR1J 3MM7A 5AXLA 2YKMA 5HQLA 4XIUA 2ZFHA 3KUHA 3BGUA 4KGKA 2POKA 2EFGA 1GH8A 3MFHA 3R7NB 3AOAA 5J2NA 5E0OA 1ACMB 3SYZA 1JWWA 2KRRA 1HD0A 2E1RA 3OL6A 1T3OA 1RBLA 3MCMA 3I4HX 1HPZB 2JLEA 4LUBA 2XLJA 2XYGB 3BH7B 1IBMF 1HMVA 1R0BG 2ZE2B 3T3FA 1DTTB 2DY9A 4M94A 4CRJA 1PKUA 2VPWB 3N9UC 1UVJA 4ZHRB 2ZH4A 2ZWPA 5AE1A 2JSXA 5B7WA 2IM0A 4H4OA 2HFNA 3P5BP 2DPJA 4NRTA 2ILYA 1MN9A 3EXYA 4CIOA 2Y1IA 2GC8A 3C16A 1Q0NA 1PSDA 3EZ5A 4C8ZA 2DNHA 2VONA 4URQU 3MPUB 2FJBB 4KV8A 1S9FA 2DXDA 2ZH8A 3W65A 4DQQA 2ACYA 4LF4J 2BM0A 5HP1B 3OPKA 3UCZP 1IM4A 1Y7PA 2PMWA 5CCMA 4QCLA 4NPOA 2C2EA 1Q8BA 2J6TA 2R9LA 2I8EA 4IKAA 3UW1A 3W5ZA 2KVIA 3IC1A 4B3SJ 3N79A 5B0BA 4P9SA 5KFGA 2XHCA 2HRYA 5DDRC 4RLEA 3KLGB 1S1XB 4X62F 4RNMA 2QV6A 3G4SS 5E3RA 1EQ0A 3POTB 4I56A 1VYAA 1IXKA 5ETTA 3MTJA 2R7SA 5K8PA 5F0UA 4RUAA 3ZZTA 4JI4J 4EBEA 5C24B 4F3OA 5IXUA 2J8AA 5D3GB 1LOUA 3P6YC 3FFIA 2HEKA 2K8GA 4KKOB 2OGUA 2O66A 3DNCA 1QUVA 1WWHA 2IYIA 1CJTB 2PI5A 2RDJA 3BN7A 2RMLA 2DH9A 2V9WA 2AP6A 4U67Q 4NYPA 2GA7A 4USWA 2XM3A 1HL6A 2JFDA 1SPBP 1NDCA 3NS5A 1HBNB 2QO3A 5B0EA 2K1RA 1XNQF 2ZZMA 4CLPA 4J91A 1RCXB 3BR9A 1PBAA 5DQGA 4XPEA 2MLYA 1LXJA 3TOQA 1LXNA 1RWVB 1H72C 2X1FA 1XK8A 1EKSA 3JQKA 1FEEA 3D0IE 4FXDA 2R7XA 5AJ3J 1RLDA 2DKOB 1G6BA 3VAIA 5DLGA 1DQAA 3V81A 2RVJA 3EMTA 1FDDA 5CH7B 5DM7Q 2QMWA 2JVOA 1BD6A 1RAHB 2MJNA 2XGPA 4ED7A 1D9AA 1F1BB 4R25A 4OYZA 4NLWA 4DV0F 2QLBB 4DPWA 4DR2F 4AQYJ 1W2IA 1D9FA 4X65F 3JYTA 3ELHA 5HVFA 3QO9A 1TKTA 2DNYA 1VLOA 1CJKB 4L75A 1VC5A 3H5XA 4LF7F 2GJ2A 5I3UA 4DR5F 4FNIA 3EDRB 3GFXA 1BE4A 1LWXA 3UVJA 3MM5B 3JTNA 1EARA 1O6XA 1S12A 1KKHA 3VGUA 5LL6d 2W4CA 1FRXA 3HHNB 2V50A 1CS4B 3L7UA 4DJBA 4N77A 1U1LA 3CCZA 1XEZA 3MM8B 3NP5A 1URRA 5LMUJ 4I2QB 2ZHAA 4F3MA 3IAM9 1TV6A 5DDQC 1N56A 1NO8A 1LV5A 4B9SA 4K4TA 3GFHA 4Q7AA 2NZ4A 3M32B 2CG4A 4Q5VA 2GVZA 5HMXA 2BKOA 5KFJA 4GKKF 1VDHA 1CBKA 3FNNA 3K5PA 3M8SA 3KLHA 1SC1B 4ECRA 3OTCA 4YOEA 5HLFB 2M9KA 1J27A 2WONA 3KMSA 2Y9HA 4KT0C 4ES1A 2E1MC 3LA0A 3THPA 2B51A 3KHLA 3W2VA 5BR8F 3AAWB 4O4GB 1YQHA 1WC5A 3PYEA 2AGOA 4LRBA 4Y2IA 2MKIA 1UW9A 4KH0B 3CCTA 4FYWB 2PI4A 4QIWD 1Q8LA 2YY3A 4P71A 4ED4A 2UV8A 2RUSA 2W2PP 4CNYA 4MTPA 2W8LA 4NLYA 4CH0S 4PQUB 4JI7J 3BREA 4USVA 2OPPB 2V2ZA 3PO5A 1RHQB 2YH0A 4F3QA 2VICA 2EBEA 4CLFA 2LQ5A 4NLGA 4CLYA 2B5JB 1EP4B 2JEFA 3P49B 1UA0A 1JLBB 5KG5A 1X9SA 2WVBA 1DLOB 1FESA 1PBUA 2AX1A 5B0FA 3JAMY 3HSJA 5E3AA 2KT2A 1Y5NB 1Z1ZA 2EVZA 4YDDB 2HLUA 2FVRA 4PUOA 2UXDJ 1Q7YT 3TAPA 3BKTA 2IVMA 3KK3A 4PG8A 1B7FA 3RBXA 4KR0B 4ZVUB 4P2SA 2D3O1 1NHVA 4YB1P 3HKZD 5KFNA 3W61A 1JLEA 1C1CB 1KLMB 3SI8A 2WVDA 3ADAC 4DV4J 2CPIA 3D54A 4I2PB 1K44A 3IN5A 2RKIB 1QVFR 5EX3A 2J9EA 2DEJA 3TRGA 5GMKa 4F50A 4FS1A 1XMOJ 1S57A 3W3SA 3VR1A 3O8WA 4FS2A 4YQWA 1RDRA 2BBEA 2Z0GA 2MKYA 3UDVA 3SEOA 5J1EB 5GAEI 4ER8A 3IRXB 2IM2A 1JLFA 2RHSB 2W2QP 1F9EB 5KFPA 4M5KA 3JSMB 2B6AA 1RWOB 3MMBB 3HKWA 3P3DA 1S0OA 1W26A 3IS9A 2ZH1A 2JOQA 3M2RA 2R7RA 1VQ6S 4DR1F 3DLBA 2QMUB 1UVIA 3FBCA 4Y2CA 4OMFG 3MM9A 4AE5A 1HNXF 5D8HB 4RW6A 3BB5A 4ZLLA 3C6TA 4C0OC 1U6BA 1RAGB 3BYRA 1LW2A 2V8VA 4QYRA 4WYWA 4UY8T 1DJ0A 3I96A 3KLEB 4DN0A 1CJUA 4DL7A 4IDKA 2UUWA 2HBZB 4CQ1A 3L9ZA 1N48A 1O5JA 2G9OA 2GQQA 1KQGB 5JJBA 1OQ3A 3FEXB 4MK7A 3PX4A 2PD1A 3RB4A 3PJ9A 1RA6A 1S1TB 2VASA 2X1GA 3QIPB 3TARA 2HQIA 2H51B 2CQCA 4JI1J 2CWXA 2CJKA 3KTQA 4FPIA 3T19A 2CQ0A 2LYVA 4RWXA 2IDLA 4U7CA 3CJKA 4NLTA 2A0FB 4DSKA 5KT6A 3K17A 3RUBL 1WF2A 4DS5A 4I6AA 1OYDA 4YB6A 3J7A1 1QTNB 4Z7CA 2K2PA 2W2MP 2GJIA 3LW5C 1ICEB 3CCLS 3L3CA 3ICLA 3O2IA 1IWAA 2VQEJ 2AYGA 2MMYA 4PG4A 3MFIA 3OJSA 4CM2A 3PCOB 1CULA 4KSEB 1NM2A 4X64F 1XNRF 2BM1A 3QT5A 3P96A 4ZVHA 2YWFA 3WHIA 2VFSA 5RUBA 4C97A 1H0HB 2OPRA 4CNZA 2I38A 4NLXA 4JV1A 2GO9A 3R6GB 1SV5B 4NWBA 4RW4B 2NYIA 1Y5IB 4OX6A 3GONA 2QA4G 5DG7A 3ZTRA 5DGAA 1UWBB 3T5JA 4JI4F 2A18A 4U7UK 4DU7A 3LWLA 4YY3F 2LMIA 2AYMA 1KD1T 3T1AA 1C2PA 1IN0A 1PYSB 2KJVA 2G2ZA 6AT1B 2KO1A 1JLCA 2J5AA 3AOCA 3NMAA 2IC3A 4USHA 2YPZA 4KHPF 1U7LA 2J7KA 5A0YB 3M6UA 5DM6Q 3I5CA 3HLUA 2XCAA 1S49A 3D0GE 2J6SA 2EEYA 3MUVP 2H65B 2FLNA 4UW2A 4ZDNA 1O0PA 1TU0B 3P4UB 1RAAB 3TX8A 4AXJA 3TZWA 4EK2A 2FZCB 3TVZA 2E9ZA 3D0HE 1RXOB 3A8IA 2N4CA 4Q45A 2C22A 3MDFA 3NS7B 4FKYA 3LTOA 1R7IA 4IO9Q 1SQFA 4R5PB 3VVUA 2NXNA 2ZOFA 4HDHA 1YJVA 3L7PA 3L09A 2H1YA 2LDYA 1YSJA 1S1WB 2PT0A 4U95A 3L7OA 4ECTA 1NDKA 2M3DA 5IS2A 3PW4A 3O44A 4IO1A 2B43A 2KFYA 3LPEA 2RAQA 4Y2AA 3MWBA 3R7BB 1SC4B 4ANDA 1N5VA 5IT9Y 1NSAA 1NDPA 1LWFB 1VBKA 3RTVA 3JQMA 1YBUA 3TEHB 3FEYB 1HWUA 3PHTA 3R6LB 5ETLA 3SSQA 1YRUA 2ZHBA 3L4BC 1U8SA 4DPTA 2QA4S 3DRXA 2D3UA 3PRDA 1XWLA 1M5SA 1VQYA 1FJGF 2VG6A 2M70A 2DGSA 4KO0B 5HN0A 1QAYA 2DNNA 1X5PA 4DBQA 1SJ4P 1J5OB 4DX5A 3F41A 2VPYB 2DNQA 1SIZA 1VQ4S 2ZVSA 1FVSA 2L48A 4I64A 3KG1A 4X66J 5DRKA 2F8HA 3QGPA 1WHXA 4FZVA 4H4MB 1S99A 4BC9A 3C66A 4Y3CA 1AW0A 4NCAA 4F7VA 1K8AT 5HL7Q 3G9CA 2DD8S 1YJNS 1S4FA 1QAXA 2VV5A 2VG5A 2RRAA 2HRUA 2Y1JA 1SH0A 2A2DA 3RR7A 3KLFB 3VF0B 5D0GA 4CLWA 1FTCA 2XMTA 3ZZZA 3LQVA 2C2NA 2B4PA 3T9NA 3ZZUA 2VDIA 5L39A 2EPIA 4KQZA 1PCAA 4I6YA 4USKA 5LJ3Y 3OVBA
chains in the Genus database with same CATH topology
4ZPCA 2DNKA 4R0EA 4WIIA 4LF6F 2YKNB 2X3GA 5GAGI 2VFUA 5CYQA 3OXLA 2E9RX 4QIEA 2B4OA 1FKAF 2HHWA 1GXTA 4OLOA 4TN2A 3IGVA 3M2VB 2JL9A 4ED3A 2XCPA 3DU5A 4B02A 5KFHA 4DSLA 1N33F 2VKRA 2ZZNA 2Q66A 3H2UB 2HHXA 1OWXA 5J1PA 1HQUA 1RT6B 2ZBIA 4OI3A 2CQPA 1PC5A 4OFZA 4DFJA 1F2GA 4C11B 4TY9A 2MB0B 2VG6B 3I0RB 4ELVA 4TQRA 2J76E 4URSA 2BRKA 4ALZA 4ZPBA 2VC0A 1C4CA 4QPTA 4IOAQ 2LU1A 2BJEA 2AX0A 2D74B 4Y34A 3H8YA 1HI1A 1VQPS 2LQ9A 1U4BA 2E5IA 3SXLA 1JJ4A 2E7WA 4Q43A 3BQ2A 2YWKA 4HH1A 1H3DA 4BWMA 4DL3A 2AGPA 2FVQA 1CPZA 3MECA 5IM0A 5L1JA 2BE2B 1N6QB 4ELTA 1FDAA 4OZ5A 5GAHU 5C42A 4IG3A 2XMUA 4WYLA 2YWEA 3UE2A 2DCUB 3T5HA 3OV7A 2KU7A 4YB5A 1SL1A 2UU9F 4WE1B 1TAUA 2R8HA 3PNIA 3DLEB 3V4IA 2VB6A 1FDBA 4OX8A 2RT3A 3I56S 1BQNA 1FNXH 3MEGA 1VIXA 2CPFA 1A9NB 3RZAA 1QJHA 2Q1LA 3SDEA 3OTOF 3CCUS 1NRKA 4TU9A 5SUHA 3K5LA 4ID5A 1X0PA 2FD2A 1S0NA 1SKWA 4LQ3A 4Q8EA 2C2DA 4NA2A 2RE1A 3UCGA 3TW0A 2DPIA 3O3LA 2DRBA 5KFYA 1UVLA 1VJWA 2N3LA 4Y00A 3WC0A 1S9EA 2C3YA 2MQOA 4CTAB 4OI2A 1HNIA 2DIVA 2ZH5A 1FRHA 4WFAQ 2YNFA 1R0AA 2IM1A 2CYYA 4O3SA 4XDDA 4HYKA 1WNEA 5BYQA 2MSSA 4F4ZA 5LSLA 5I42B 4Q0BB 3H5SA 3DDNA 4X4PA 1FKOB 4MIWA 3T5LA 5KFOA 2PEHA 3UNGC 3FSIA 1WEXA 2ZD1A 3OFHA 2IRUA 1FT8A 5KFRA 4DF8A 5HI7A 3HK2A 5CYMA 3FZ2A 2VG5B 4LJMA 2V9KA 4EZ9A 4LSLB 3F44A 4CCHA 6FDRA 3KYLA 3DYAB 1Q7LB 2NPFA 5KFSA 2MGZA 5L1LA 2K3IA 2VBYA 3O5TB 4MYUA 2KH9A 1HW8A 1VGYA 4O44B 1JNRB 2DR9A 4DL4A 3H59A 1NJIT 2MXYA 2MKSA 1F0XA 2KT5A 5KOWA 5MLCV 5JVGQ 4ECYA 4Q8FA 1KEKA 1FCAA 1P1TA 2HS0A 4RU2A 4A8FA 3CUNA 1YWXA 1N0UA 2AJ1A 4NLRA 3PO4A 3WDOA 2PIIA 4QWBA 1VHFA 1VQ9S 1M90T 2XEXA 3LP0A 4J9KA 3B8HA 2VH7A 3Q2SC 4JV2A 2PC6A 2MKCA 3DDKA 2OPSB 2HWTA 5LT5A 4EWTA 1A7GE 3PACA 4QW8A 3X3UA 4BBYA 4X2BA 4MK9A 3FEZA 3GG0A 4RUHA 1YVFA 2V5HG 4OZLA 2JX2A 4W90B 5CYQB 2LXIA 2GGPB 2EWHA 2GO8A 2HYIB 1S6QA 2P9GA 3J81Y 5FDLA 1I6JA