1S9EB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains:Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 106
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9eB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB02
1S49A 3PVXA 1VRUA 2D3ZA 4I2PB 2R2TA 1JLGA 2V0NA 4RW9B 3DDKA 1OS5A 3QIDA 3H40A 1RT2A 3C6TA 3MECB 2ZKUA 4TXSA 3GIJA 2YNHA 2DPJA 2UVVA 1WNEA 4URSA 1S6QA 5L1LA 4G1QB 3KLHA 2ASDA 1RYSA 2IBKA 3D28A 4IKAA 4EBDA 3FFIA 4RUCA 4RW8A 2VG7A 3NAHA 1UWBB 3PJXA 3V81B 4PUOB 1JLBA 2IC3B 5K14B 5KG2A 3RB4A 2RKIB 4R0EA 4KB7A 2C2RA 5F9LA 2QE5A 2XGPA 4JV1A 5F8LA 4DL4A 1S4FA 4ECRA 3DRPA 4PWDB 3CIZA 3BSOA 4TY8B 1C1BB 4I7FA 3KHLA 3KK3A 1T3NA 3NMAA 2YNIB 3QO9A 3KLEB 2JEJA 3GV7B 1BQMA 4NLUA 1HQUA 4NLTA 3QZ7A 1DTQB 1TP7A 1SUQA 1GX6A 3FDSA 4WYLA 4ED7A 1IKVB 4PQUA 3GYNA 5KT3A 3NBPA 1HNVA 4KO0B 5HLFB 5KFOA 3PJWA 3CDWA 5KT2A 1S6PB 1FKPA 1RT3A 2IM0A 3KK1B 3KK2A 2BRKA 4K4WA 3DRRA 2ILZA 3C6UA 2QV6A 2DPIA 4O3RA 2ALZA 4DEZA 3V6HA 4TYBA 1S1XB 2UUWA 5DG8A 4ED3A 4RW6B 1RT1B 3CJ0A 3DYAB 3LANA 4Q0BB 2BE2A 4JUZA 3D5MA 4F4ZA 4KFBB 1RYRA 5L9XA 4YQWA 2IM3A 4ECVA 4RW7B 5HBMB 1R0AB 3DOKA 2HNZB 4EYHB 2RF2A 1LW0B 4WZMA 3V81A 5DGBA 2IC3A 5K14A 4IRCA 2E9RX 3QIPB 3DLEA 2RKIA 3BR9A 4IRKA 4ECTA 3IGNA 4TQSA 3OHAA 1KLMB 4IH6A 1LWEB 2EC0A 3CWJA 3HHKA 1HPZA 4K4VA 2YNIA 5J1EA 4IG3B 1K1QA 3MEDB 3KLEA 3GIKA 3I0RA 4J9QA 3T19A 1VRTB 3LALA 1DTQA 3M8PA 3MEEB 2B6AB 4NLVA 2ZD1B 3CJ2A 3I5CA 5KFTA 5I42A 2HNDB 1IKVA 2GIRA 5HLFA 2YNFA 3E01B 4IDKB 1RA6A 1D1UA 1EP4B 2HWHA 1IKYA 1RT6B 4MIAA 4NCGB 5KG1A 4ED8A 2BANB 1DLOB 3TQ1A 3BSNA 3IRXA 4JV2A 3G6VA 2JC1A 4URGA 4DL5A 2OPRB 4IFYB 1TKZB 3ITHA 4F4XA 1TKTB 3DYAA 4QPXA 5L1IA 4KV8B 1TKXA 2GIQA 1DTTB 3C6TB 2YNHB 4KFBA 4MIBA 3QZ8A 3DLKA 2BQRA 3KLHB 3MR3A 4YR3A 4Q45A 3H4BA 1C1CA 3FFIB 2AX1A 3CDUA 3BJYA 1R0AA 3NAIA 3QGIA 4MK8A 2VG7B 4JV0A 2W8LA 3PW0A 5F9NA 3OSNA 4J9RA 1JLAA 3QIPA 2XGQA 5J2MA 2W9BA 2E9ZA 2B5JB 1RA7A 5KFAA 1BQNB 1S0OA 5KFMA 4LSNA 1KLMA 3DRPB 1LWEA 2W9AA 1HMVB 4NLSA 4EBEA 2ATLA 3IS9B 3IN5A 1S48A 4O3QA 2D41A 4NLXA 3QO9B 4IG3A 4J9MA 3OLBA 4ZPBA 4ZVGA 4Q43A 1VRTA 1QUVA 1HQUB 4QWDA 3BGRA 2CKWA 2B6AA 1S9FA 2VG5A 2ZD1A 1SUQB 2F8EX 2XI3A 4TYAA 5KG5A 3LP0A 4PQUB 1HNVB 4IDKA 2VG6A 3LP2A 4RW4B 3H5UA 1RT3B 1RT6A 4NCGA 3KLGB 3KK2B 3M9NB 1DLOA 1TL1A 3KHHA 3UPFA 4DG1A 1KHVA 4RUAA 4WFXA 4O3NA 3C6UB 1HQEB 4IFYA 1TKZA 2WONB 4YP3A 4EEYA 5DG7A 3EPIA 3Q8RB 4H4MB 4NZ0A 3MR6A 1TKTA 2V4QA 4K4SA 5F8JA 3TAMB 4MK9A 2BE2B 2E9TA 4KV8A 3V6KA 1DTTA 1RT5B 1FK9B 2AQ4A 4R8UB 2YKNB 4IFVA 3QYYA 4RZRA 1NNDA 5D3GB 2J6TA 1SH3A 4NRUA 1LWFA 3NGDA 1JXLA 2AGQA 3DOKB 1IM4A 2RF2B 3T5JA 3ISNC 2ILYA 4EO8A 4GC7A 3DLEB 2FLPA 4J9LA 2AGPA 4IR9A 3T1AA 4GC6A 2B5JA 1BQNA 1ZTTA 5FDLA 4ZMMA 4EBCA 1HMVA 5DLGA 5DG9A 1S0NA 5KT5A 3IS9A 1N6QA 4QWCA 4ZPAA 5KG6A 1HPZB 5HP1B 3SFUA 3LP1A 5J1EB 1C0TB 4LQ9A 2FJWA 3I0RB 3UQSA 4QWBA 3G6YA 1RTIB 4ED2A 2J6UA 3M8PB 4MFBA 2FLLA 2R2UA 3V6DA 5L1KA 2BQ3A 5I42B 3RB0A 4ZP8A 3RB6A 3UDLA 5KFKA 2YNFB 5EWFA 4RW4A 1T94A 5DGAA 4K4ZA 1IKYB 3KLGA 1N4LA 3G6XA 3CJ5A 4J9SA 5EWEA 3PW5A 3RAXA 2R2RA 3IRXB 1N48A 2VA3A 1C2PA 1HQEA 3HVAA 2WONA 3KLFA 3H5XA 2CJQA 4K50A 3ITHB 4H4MA 1XR5A 4WE1A 3TAMA 4G3IA 4NLQA 1FKOA 3KOAA 1TKXB 1RT5A 1FK9A 3DLKB 3JSMB 4TY9A 5KFVA 4YR0A 4XO0A 2YKNA 4R8UA 2V4RA 1S97A 4ED0A 1C1CB 1EETB 5D3GA 4RU9A 1CSJA 1W25A 4QWAA 1RT7A 3N6NA 4WFZA 3PR4A 4IRDA 4RNFA 4KKOB 3OL9A 1JLAB 5KG3A 5KG7A 4K4YA 3PW4A 3MF5A 4WYWA 3ISND 2I5JB 4O3SA 2OPQA 5J2MB 3MFHA 2W9BB 2FVQA 1S9GA 4IQXA 3I0SB 3PZPA 3HVTB 4LSNB 2R2SA 5KG4A 4U7CA 4ZPDA 3JYTA 4ZP7A 5HP1A 2V9WA 1TVRA 2BQUA 1C0TA 5F8NA 2XWYA 4TLRA 5KFGA 2HMIA 3H59A 2VA2A 4HKQA 3G86A 1RTIA 5KFFA 2ASLA 4NLGA 3BGRB 3FQKA 1JLQB 2JLEA 1S1TA 2VG5B 1QAIA 3DLGA 3I5BA 3GILA 3LP0B 3V6JA 4H54A 4B3OA 3KHGA 2C28A 2VG6B 3LP2B 4HYKA 3N6MA 3EPGA 1QAJA 1T03B 4TN2A 1TL1B 5KFXA 3MR2A 3BQ2A 4DG1B 2JEFA 2C2DA 2YNGB 1JLEB 3DRSB 3PR5B 5T14A 1SV5A 4J9NA 4KHMA 3E51A 3Q8PB 2D3UA 4IH7A 4ZHRA 5KFDA 2GC8A 3VQSA 4WFYA 3JSMA 1J5OB 3QGGA 4IFVB 1EETA 4ID5A 5F8GA 5KFEA 5EDWA 2WHOA 1LWFB 4QWEA 2J6SA 3H98A 1RTDB 5CYMB 4KKOA 4URQU 1YVFA 5KFHA 4KBIA 4NLOA 2I5JA 4Y34A 2W8KA 5C25B 4IOBA 4F4YA 3I0SA 5KT4A 1HYSA 2FLNA 3IG1B 3HVTA 3KMQA 5KFYA 5FDLB 3NL0A 3MEGB 5HROA 2R8KA 3DOLA 4XPEA 1N6QB 2XI2A 4J9OA 2ZE2B 3LP1B 1LW2A 5KFBA 2WRMA 2IMWP 1TL3A 4Q44A 1REVB 2W7PA 4NLRA 3FQLA 2FJXA 2YKMA 3CVKA 4MFBB 4Y2CA 1JLQA 4DL2A 1GX5A 3OL7A 3V6DB 3V4IB 4H4OB 4KSEB 4K4UA 1C0UA 3KLVA 4DL6A 3HKWA 4FS1A 5KFSA 1T03A 3N6LA 5KFRA 3CDEA 1LWCA 1S1WB 4ECQA 4DL3A 2YNGA 1JLEA 3DRSA 3RAQA 3KLFB 1QE1A 2WOMB 2FVSA 4WE1B 2C2EA 3PHEA 5DQGA 4FBUA 1FKOB 5KG0A 2C22A 1ZETA 2AX0A 2RDIA 3LAKA 2AWZA 3KNAA 1J5OA 2ASJA 3M8QB 1TV6A 1RAJA 4O44B 1RT4B 4KHRA 2OPPB 4NRTA 4QW9A 4NLWA 4RNOA 1RT7B 1RTDA 5CYMA 4Q8EA 1SH0A 2I1RA 1JX4A 4M94A 2OPQB 5C25A 1Z4UA 5KFWA 3BQ1A 1S9GB 4MKBA 2HWIA 3T5LA 3IG1A 1JLFA 3ICLA 1IKWA 4MKAA 5KFIA 3MEGA 3QLHB 3SI8A 1HARA 5J2QB 3JYTB 4LSLA 2IM1A 2ZE2A 3LAMA 1TVRB 2R8IA 4I2QA 1N5YA 2FVRA 2HMIB 1REVA 5J2PA 3Q8SB 2FJVA 3GV8B 4M95A 2JEIA 5EUHA 2HNYA 5F8MA 1T05B 4Q8FA 4WXOA 1S1TB 4O3OA 3KLIA 3DLGB 3V4IA 3TVKA 4X2BA 4H4OA 4ICLA 4B3OB 1MMLA 5C42A 5JUMA 1MU2B 3RB3A 3OSPA 2UVUA 3M9MB 4O3PA 1S1WA 3OHBA 4OL8A 1S1VB 3FRZA 1JIHA 5J2NA 4NYZA 4QW8A 4ED6A 5KFCA 1SV5B 2WOMA 2UUTA 1RTHB 2WK4A 3PW7A 2BR0A 3HVWA 4EO6A 4R5PA 3T5KA 1K1SA 1IKXA 4ZHRB 1SH2A 5I3UA 4ED1A 1S9EB 5C24A 3BSCA 5KFJA 3M8QA 4O44A 1RT4A 2B43A 2AGOA 2OPPA 2FVCA 2JC0A 4ID5B 3KMSA 3GQCA 1N56A 1HNIB 4ZVFA 3GIMA 5C5JA 1RTJB 5CYQA 1S0MA 2XCPA 4NLDA 1HYSB 3DI6A 3CO9A 3NKYA 2RDJA 3KJVB 3GV5B 4I2PA 3QLHA 5EWGA 5HROB 4J9KA 3DOLB 3QGHA 4MK7A 5J2QA 4RW9A 4F4WA 4J9PA 4ZVHA 4O4GB 1LW2B 3MECA 4Y2AA 2IJFA 4NLPA 5KT7A 3T5HA 1TL3B 1TQLA 1JKHB 4ECSA 4G1QA 3FSIA 3KHRA 2YKMB 2HAIA 3DMJB 2OH2A 1T05A 1JLCB 4ECXA 4WXWA 5KFZA 1UWBA 4F50A 2WB4A 1MU2A 1C0UB 4PUOA 2IM2A 1S1UB 1XR6A 5KFPA 4RNMA 4LQ3A 4WZQA 4TQRA 1LWCB 3H5SA 5DLFA 1S1VA 3IGVA 3M9OB 2W9CB 2WCXA 4PWDA 2IJNA 4ECYA 3PW2A 2WTFA 1QE1B 4TY8A 1C1BA 1RTHA 2IAJB 4K4TA 3I5AA 4YMEA 2W7OA 4IR1A 2OPSB 1S9EA 5DQHA 3MTKA 5JXSA 1TV6B 5F8IA 4ZPCA 4KAIA 5KFQA 3MFIA 4RNHA 4DL7A 1HNIA 3BSAA 4U6PA 4IG0B 4ZVEA 4KO0A 4K4XA 5KFUA 1RTJA 2O5DA 1S6PA 4XPCA 3KK1A 3GIIA 1RDRA 4YR2A 3DM2B 4ZP9A 5F8HA 1JLFB 2BRLA 3RBDA 1IKWB 1S1XA 3KJVA 2FVPA 1U09A 1VRUB 5L1JA 4RW6A 3UR0A 1RT1A 1JLGB 3OLAA 4Q0BA 4NLYA 4MH8A 4KE5A 1S10A 4LSLB 2UVRA 4O4GA 1RT2B 4I2QB 1XR7A 1N5YB 1JKHA 1S6QB 5J2PB 2UVWA 4RW7A 3H4DA 3DMJA 2HNYB 1JLCA 5HBMA 2AU0A 4FS2A 3KLIB 4RW8B 2HNZA 4ICLB 1LW0A 5C42B 1JLBB 1S1UA 5KT6A 2XCAA 3H5YA 2XC9A 2W9CA 2R8GA 5J2NB 3MR5A 4RNNA 4ECUA 3EZUA 2IAJA 4I7FB 5KFLA 3OL8A 2IA6A 3KK3B 4R5PB 1IKXB 3MEDA 1KHWA 4Y3CA 2OPSA 5I3UB 3H2LA 5KFNA 5C24B 1BQMB 2JEGA 1D0EA 3Q8QB 3MEEA 2D7SA 4ECZA 3CJ4A 3RBEA 2R8HA 2R8JA 2HNDA 3OL6A 4IG0A 3CJ3A 5DQIA 3NBPB 3E01A 1ZTWA 1NHUA 5CYQB 4IH5A 1EP4A 1I6JA 1NHVA 1FKPB 3SFGA 4EYIB 4O4RA 4ECWA 2BANA 4FBTA 3BQ0A 3DM2A 3DRRB 4ZP6A 3DI6B 3BREA 2OPRA
chains in the Genus database with same CATH superfamily
1S49A 4NXNF 5HN0A 2R2TA 2MDAA 2OD6A 3C6TA 3GIJA 1WNEA 1SJ1A 1K73T 1UWBB 4JV1A 5RUBA 1HIYA 3UNYA 4NE9C 3WX8A 5HMZA 2CAJA 4ZVPB 3D9BA 4C8OA 2B9WA 5MLCV 1IKVB 1FKPA 1GMWA 2HLTA 3PIOQ 2DPIA 3C16B 4JI4F 4HVZA 4KFBB 4DCPB 4YDXA 5L9XA 3CD7A 4C7QA 1KQGB 1ZM2A 2HSEB 2CFXA 1R89A 4YB1P 4ZKAA 4DV2F 2VQFJ 4U95A 2Y9HA 2KRRA 4OYWA 1F6TA 3HD1A 3C14A 3GIKA 4ZK7M 3M8PA 2GIRA 4X65F 3MCMA 2VOOA 4ED8A 2DO4A 1IUJA 4E98A 3UVJB 4NXMF 3TEHB 4IFYB 1RAFB 4QPXA 3IA0A 2MHEA 4JV0A 1V3SA 4J9RA 4QYZK 1MSWD 2XGQA 3BPDA 3AB4B 4ZDNA 4EBEA 4USJC 3OR2B 1VR6A 1S48A 2QX0A 4NLXA 4ZCIA 4OX8A 2CKWA 2AYGA 8ATCB 4LFCJ 5LMUJ 2QTWA 3KHHA 1KHVA 3ZO7A 2I9SA 2E9TA 3LGHA 1WACA 3AODA 1B0PA 4UQTA 4IFVA 4GMKA 5DS7A 2BX6A 3VAGA 2ZH3A 3PYFA 4NMXA 4LQ9A 4MAKA 3FGVA 2E5GA 2ZJPQ 1WG5A 5I42B 3JAMU 5EWFA 2XBPA 3PW5A 3J81j 2MLZA 1U2RA 1PGZA 4FZVA 4WE1A 2D9PA 4C8MA 1HNXJ 2LQ8A 2B51A 2KB2A 3PR4A 4K8RA 1YBTA 1AXQA 3PNIA 3MWBA 2XZDB 4KGKA 1FHTA 3H59A 4PXBA 3AOAA 3I5BA 1V3ZA 2Q66A 3KHGA 3LP2B 1WI8A 2RVJA 1TL1B 3TEGA 4C97A 5KAKA 5E7OB 1FEHA 4ZHRA 4F3QA 4WFYA 4C3MA 1J5OB 2EPIA 3ILJA 3W61A 1DQ8A 3TI0A 4A8QA 2DY1A 1R8HA 1IQTA 3NWGA 4PG8A 5KFBA 1Y0HA 4MFBB 1RXOB 4Y2CA 2XLJA 4K4UA 3DNCA 4LSZB 3CDEA 2B0GA 5D0RA 1E6YA 4OZJA 5FLXY 3L09A 2C2EA 1FKOB 4O0NA 2AIRB 4P10A 3R5CA 2DHHA 3EX7B 2OPPB 4OJHA 4WTOB 4NZ6A 2VICA 3B6BA 3EGZA 1S9GB 4OZ2A 4JI7F 1TVRB 3N28A 2X3DA 4CO5A 2HMIB 3TZZA 4F2SA 3L95X 2EG2A 2MQPA 5LXYA 4DV7J 3PIPQ 2QO3A 3LGMA 4LIRA 2BE9B 1VQ6S 2E5IA 3MPUB 3PY8A 1SV5B 4LF4F 4HEA9 1B99A 3EM1A 4DSLA 2B43A 4R25A 3FZ2A 1NBEB 3BS9A 3B82A 1S0MA 2PA3A 4OYOA 2DB1A 4P7TA 2MY8A 2DNLA 1UL3A 2VODA 2HZVA 1LW2B 3MECA 2D3O1 1TUWA 3JB9k 3VAMA 2UUAF 1TUGB 4X4TA 4CP5A 4C8ZA 2HGMA 1PILA 2K1RB 1QE1B 3DRXA 2MSTA 3K7RA 5DQHA 2KFYA 1RHJB 2UXBF 1BE4A 3BSAA 4WJBA 4AXJA 2ROGA 3NP5A 1H3DA 2RSQA 4CLZA 3OTCA 3SXLA 2VH7A 2EFGA 1VQOS 1S7IA 3UWTA 3D7SB 2UVWA 3KLIB 2ROPA 2ZH5A 2R4FA 2EWHA 1Y5NB 2NXNA 1OPZA 1EHWA 2OPSA 4ECZA 1IQZA 2DNOA 2B9XA 3CC2S 4FPRA 3KJFB 3NNHA 2DPJA 1HW9A 4F36A 4ILLA 5CQGA 2IBKA 1K9MT 2IC3B 3MUVP 4GKJJ 2C3UA 2YX7A 3I4HX 4PWDB 3NGUA 1Q95G 1UVMA 4JI2J 1C1BB 4Z37A 3KK3A 5CYJA 1CULA 2VFTA 1REGX 1WDDA 1PG5B 1UFWA 3WDOA 4KO0B 2ZKTA 3KK1B 1YRUA 2QV6A 4DEZA 3V6HA 3J7Z5 4ED3A 1FTCA 4QR2A 3DGPB 4RW7B 4PR6A 2UUCJ 3DOKA 4C3KA 3QGPA 2VQEF 5B0BA 3X1LB 1HBUA 2FY8A 3KLEA 2ZH6A 5F41A 3S01A 4XIUA 3EICA 4X4NA 1JNRB 4ZVSB 3M8WA 1YQHA 1VBYA 1Q8IA 3DYAA 3MAAA 4NCBA 5CH7B 1IBMJ 2DNRA 3QGIA 1MNEA 2HURA 3NS5A 4Y28C 5ETPA 2ZHBA 1NDLA 5GVQA 4NEYA 1IBLJ 5KFMA 3DRPB 5K9FA 3QRRA 3QJLA 4PG5A 1KFDA 1UFKA 3W63A 1BXNA 4R0JA 1HNVB 1X4EA 4F4YA 2HFVA 1F0XA 4O3NA 4DSJA 1QAYA 3KG4A 4PXCA 1TKZA 8AT1B 2ASYA 4WIIA 3TAMB 4CLFA 5A8WA 3N4WA 3WIUA 4DFMA 4OFZA 4DPWA 1TK0A 5FD1A 3AD8C 3KUGA 2H9ZA 1ZTTA 4M5IA 5DG9A 4WP8A 1VYAA 2K3KA 5J1EB 4WF9Q 1FFWB 3BPSP 4YFUA 5IT9U 2J76E 3RB0A 1NM2A 3A8JA 1T94A 3HVRA 3KLGA 1SKRA 5DZ6A 3HVAA 1RSCA 1M5KC 3JSMB 3UD4P 4ILMA 3HVTB 2KJVA 2V8DA 2R2SA 4DUZJ 5F8NA 3T6BA 3LWMA 3R3TA 1XMBA 5A0YB 2VG6B 4HYKA 2M9KA 5CZXA 3TVYA 4KTQA 2DNNA 3E51A 4WP9A 3SV3A 2KG0A 5A2QU 3MPWA 2DNYA 3TO8A 4KKOA 1WJ9A 2E7XA 3KFWX 3EGVA 2XSFA 1U02A 1ZYQA 5HROA 3ZZPA 2R8KA 4ED5A 2ZE2B 1IBKJ 3MOJB 3FQLA 1SQEA 3UE2A 1RADB 3CJSA 4FS1A 3N6LA 4OV1A 4JYAJ 2HPUA 1BY9A 2GIFA 5G4DA 2O66A 1QAXA 1PAUB 2AX0A 1KNZA 3IBCB 5IQ6A 1R27B 2FJAB 4PG6A 4RNOA 4Q8EA 2H1YA 2NZCA 1GMUA 2VJVA 4DV0J 3JYTB 3Q8SB 2M0GB 3DLGB 1FX2A 1N32J 4NA1A 2H5IB 1WTBA 1NCLA 2UUTA 1YKWA 1L3UA 4J91A 5B0CA 2P8IA 2FUG9 3M1VB 4ID5B 3TUJC 1T0TV 4HDHA 1SJ4P 1UA1A 1LK7A 1HYSB 2HZAA 4J9KA 3DOLB 4MK7A 3VCDA 4ELTA 1UZDA 4DX5A 1JLCB 3U1NA 1HD0A 1TKDA 1TAQA 4AE5A 4NCAA 1NK0A 1FXLA 4F8RA 1UZHA 3BN4A 1NZAA 1QSYA 3TX0A 3M30B 2NSBA 1KWMA 2Z57B 4NLYA 1S10A 2UVRA 2NXUA 3T1HF 2AU0A 4LREA 1BHNA 3E2EA 2W9CA 1X4DA 3ZTSA 5E3QA 4FXDA 4C0BA 2XB2D 5KFNA 1X4CA 2R42A 3CJKA 1RWXB 2M3DA 1T11A 1FKPB 4O4RA 2NXJA 1F60B 4KGZB 2GVZB 1Y9OA 1TU0B 1OS5A 1OYDA 2V8VA 3KLHA 4LF6F 3D28A 4RW8A 2EC2A 4HHJA 4MMOA 2CQ0A 1VQ7S 3M8SA 4KB7A 3GCWP 5E3PA 2C2NA 4P75A 3GWCA 2I6WA 2BKPA 4ENOA 3CDWA 4UOCA 5DG8A 2U2FA 4B9SA 5BR8J 3W60A 2FHMA 1XMQF 1UPMB 3I32A 1NKBA 2EK1A 4EYHB 5K14A 3U1MA 5JVHQ 4PWUA 2N82B 4IRKA 2PIIA 4NA3A 2VASA 2X1GA 4K4VA 1YITS 3SQGA 4Z7CA 1YJWS 1T9YA 4DR5F 4XDCA 2FC9A 2VPXB 2ZOMA 2V2QA 3PXGa 2XMAA 2FHKA 1AROP 3QIPA 2E9ZA 2DEJA 2P2CB 4ZJQA 1PO6A 4K0KF 4X64F 2RQMA 4HACA 1VRTA 5IWAF 4TYAA 5LXRA 2CG8A 3W64A 2G1HA 4WFXA 2EEYA 4L3NA 4QOTA 5T41A 3K8WA 3W9HA 3Q8RB 2R9LA 1LXNA 2NS1B 1URNA 4CDIA 2E29A 1D3WA 5B09A 1HHSA 5K5MA 2C2KB 1TZ0A 4QWCA 1ZS6A 5AXLA 3EXYA 4USIA 2RU9A 3AJ2A 3D68A 3V6DA 3RB6A 2LU2A 3J7YI 3N79A 4J9SA 2R2RA 3Q8YA 3RBZA 1S99A 1H0HB 1KVKA 3TWZA 2MQMA 2VDIA 2A6OA 1FK9A 3SCIE 4YR0A 4ZJLA 3CW2C 4ED0A 3UDCA 3W7BA 2YWGA 3L9ZA 1HD1A 2G9OA 4DFKA 3PZPA 3DLBA 4AL5A 4ZPTR 4N41A 1RTIA 2ASLA 3BGRB 1QUPA 2JLEA 3HPOA 1U6ZA 5KFXA 1SVDA 4Z7YA 2JEFA 1E6YB 5T14A 2V2VA 2G0JA 2CPJA 2CQ3A 4FF4A 2AP6A 1EETA 4GKKJ 4MJKA 2VBZA 2I38A 1FRJA 2B56A 3F56A 3R5GA 3MM9A 2GNKA 4XPEA 3J80Y 2AD9A 3IM8A 3CVKA 1FRLA 2NUUG 4B9LA 2LDIA 3HFZB 1Q16B 5KFRA 1H98A 1JLEA 2K2PA 2YH0A 1EAYC 2HGLA 1KQSR 2RDIA 1UWAA 1A9NB 1ZAXA 5AJ3F 3DRYA 5ETLA 4FXWA 2CPYA 2LDYA 3A8KA 4TKTA 1HARA 3N9UC 3MMCB 4C8LA 1YHQS 2VFRA 2JEIA 4DR4F 1S1TB 4QJVA 3O3LA 3AHPA 3TW0A 2FYXA 1RBLA 4TU9A 4DZ6A 2MY7A 2BXJA 5C24A 4FKXA 2ZOGA 1UVIA 2C1EB 2VF3A 2G13A 4YHHF 2M52A 4ETXA 4C11A 2A10A 3K5OA 2N4DA 4DX7A 3OTEA 3MUTP 1RHMB 1I94F 2WZ1A 2J9DA 3QATA 1RWWB 1S6OA 4MT1A 4V1Ak 2Z2ZA 4AT1B 2XMWA 2CZ9A 1UKUA 1MU2A 4PUOA 1CJUB 4CI0B 4B3TF 4B9VA 5DLFA 2F4VF 2ZEJA 5HJYA 3POTB 1FO1A 1RTHA 2EBGA 2V5HG 3WC2A 4I1TA 2OPSB 3CMAS 4C4WA 5KFQA 2DR6A 3GIIA 4YR2A 1WC5A 2ATCB 1OO0B 2L41A 1VS3A 2BEFA 1N5YB 2ROEA 1JKHA 5J2PB 4CYUA 2YKOA 2YKPA 1LW0A 2XCAA 1UEUA 5J2NB 3EGWB 1M5HA 3KK3B 1CULB 2QLBB 2B9YA 1H38A 1N0VC 3RBEA 3A3PB 4TU8A 1PIEA 3SFGA 1NHVA 4EYIB 1R8CA 4DV1J 1G2EA 5L38A 3PVXA 2E5LF 1X5OA 4DR2J 2BM0A 2GV1A 4RW9B 2KL8A 3HHLB 4RUBA 3M6XA 4IKAA 3FFIA 3K58A 5D78A 2EI5A 4LRDA 4DL4A 2L9NA 4ZCKA 1HBUB 4DR3J 3TZWA 2NQPA 2XZTB 3KLEB 3MUMP 1NPKA 4ZOSA 4IQMA 1S6PB 2PE8A 1OQ3A 2XMTA 3DLJA 4DUYJ 3DYAB 2HVDA 2JFKA 3AXMA 1AA1B 1N5VA 3MAAB 4I0WA 4DV6J 2E9RX 1WKLA 1HA1A 2OUGA 2OLWA 3OXGA 2YNIA 2XS5A 2Z30B 4JI6J 4NLVA 4ZLJA 2HNDB 2MPUA 1S12A 4A8XA 3D2WA 3O8WA 4DL5A 2OPRB 1TKZB 2NXCA 3CCES 2IFXA 4EMDA 3UDVA 4J5OA 3D66A 3C46A 3JAMY 2ZM6F 3QZ8A 4YR3A 3CCVS 4Q45A 3MM8A 3CDUA 2YWEA 1X60A 1NJZA 1N5QA 3K57A 1MG7A 5IOLA 3KLGB 2W4CA 4X4RA 2X1AA 1RISA 1RHUB 4N47A 3GFXA 1F9HA 4YP3A 2H54B 1GMWD 4K4SA 1HNZJ 4ZPVR 3NGDA 2Z2YB 5HL7Q 4EO8A 4NXNJ 3T1AA 2ZNZA 2B5JA 1BQNA 1HPZB 3TAPA 1O5JA 2ZC4A 3H7HB 2PA8D 2VFSA 5IS2A 4RW4A 1YJUA 2YQ1A 2BJ9A 1XK8A 3H5XA 3VAJA 2WW4A 3DDNA 2GS8A 4TY9A 1FE4A 2YKNA 2V4RA 1HHQA 1VK8A 3GFZA 4CT8A 2M5YA 4KKOB 5KG7A 3MF5A 2W9BB 4JI4J 1Q8KA 5U47A 2GJFA 2M70A 1OQ6A 5BXIA 1QAIA 4B3OA 3D4JA 4FNHA 2RS2A 5ETVA 4OX9F 2VA3A 2N3LA 1N8RT 3PR5B 2KT3A 4KJIA 4J9NA 1BD6A 3QAEA 4IH7A 3P3DA 2DCUB 4X65J 4NXMJ 4QWEA 2DGOA 2GZOA 2KJWA 4EZ6A 3FBCA 1P1LA 4EI2A 2J7KA 3D6HB 4H4KA 3MCOA 1N34F 4HR2A 3M8RA 1NKCA 1RAIB 4LFCF 3FSXA 1M1KT 3QT6A 3RAQA 3CC4S 2C2OB 1WHVA 5DQGA 4NWBA 2Y0SD 2EVZA 2AZ3A 2DNMA 3HSJA 2PT0A 4DV4F 2FJBB 3ZZ0A 4N77A 4A8MP 4WK3A 4QIVA 1R0CB 2MLXA 1V6HA 3GU0A 5BJRA 1SI9A 3PFEA 4N7TA 4DS5A 1U8WA 4P7VA 3OPKA 4RBUA 4Q8FA 4O3OA 3ULHA 3HZEA 3RB3A 3TA0A 2VPZB 4YUDA 1GTHA 3OHBA 2D74B 4OYAA 5GAEU 1K1SA 1KTVA 2CXEA 5M2RA 3MM6B 1WHWA 3GIMA 5C5JA 2KN4A 4B9TA 4XDDA 3T9ZA 3U1LA 5EWGA 1MN7A 4M5JA 4UZCA 5DJBA 1FWLA 1ZOTA 3MMBA 1RE1B 2CJXB 4CLSA 2LEBA 2W9CB 2F5GA 4YEAA 1GT8A 3ENAA 2IDEA 3CJKB 1HL6A 4Q2LA 1YRTA 2FTRA 2QEXS 1KEKA 5F8HA 2IMWP 4S0MA 2MZ1A 4KGVB 5DDPC 5GAGU 4MH8A 3SCJE 2KM8B 5B0EA 4BCAA 3J81U 2V2KA 4JI0F 2MQNA 5HBMA 3PYDA 4RW8B 5ETMA 1A7GE 3ZFVA 4OX7A 3CIMA 1ZZNA 4LF5F 2OHDA 4F04B 1FDDA 2XC9A 2ZZNA 1MROA 5EN1A 5A8RB 3BM7A 4Y3CA 4ZVTB 1D0EA 2E66A 3E01A 4IH5A 5BYRA 1X4BA 3HZGA 3CCQS 4Q5VA 2CNKB 3CULA 4A8YA 1RHQB 1S6QA 3TUZC 5L1LA 2K7JA 2YX1A 2AW0A 4QU6A 5K14B 1Q1KA 2QJ3A 3AD7C 4WWSA 2EFPA 1F5BA 4JI7J 4AUKA 4TY8B 4KR0B 1RKJA 4B3RF 4RWWA 2IBOA 3SQGB 4YS2A 3GR0A 2HRYA 4LF4J 4LJMA 3RRKA 1Q5VA 2MYFA 1FTRA 4DU8A 1RP5A 3VAIA 2YPZA 5HI7A 3QIPB 2XG8A 4TQSA 4UQGA 4A4JA 3A12A 2VDHA 2UUAJ 1MWZA 4J9QA 4GRSA 1VRTB 1HI8A 3AT1B 3HP6A 3I5CA 1FJEB 2BANB 2YWFA 3P45B 5IT9Y 1XC9A 4CLKA 3QWUA 2VFUA 4MIBA 4RWXA 1UP1A 2Z56B 2HRTA 2DGQA 3W3SA 5ETNA 1ZAWA 4N76A 2HQ3A 4LSNA 5GMKa 2WSFC 2MZTA 1R7IA 1O8BA 3MZIA 4OI1A 4W90B 4ZPBA 3D1OA 1V5IB 1X31C 2HW3A 4DSKA 1RCXB 2B4PA 3UPFA 2DEIA 1CJVA 5DG7A 3EPIA 3MR6A 1FA0A 4MK9A 3LPEA 1XIQA 3OJSA 1FK9B 2AQ4A 2AGQA 2QLXA 3FEZA 2YH1A 4ZVOB 5DRKA 4JI2F 1RTIB 5L1KA 2LA6A 4DZDA 4ZP8A 3VVTA 3CF5Q 2OMLA 1XERA 1WEZA 1IR1A 2DYAA 4WP3A 1EETB 2P9GA 1D9DA 5LM7E 3PW4A 1VC6A 3CCJS 5J2MB 4LF7F 1NSAA 3G8SA 3MM9B 1AW0A 2FZKB 4OYXA 2VA2A 3G4SS 3AXKA 4M63A 2J5AA 4H54A 2ZOFA 2C2DA 1JLEB 2VL1A 3UW1A 2RMLA 1PJ7A 5D0EA 2PFDA 4OQJA 2DRAA 5IXUA 3H98A 4NI2A 1KRPA 3LW5C 3DGVA 1L3KA 2V63A 4K59A 5KT4A 3WBZA 1J2VA 1IBLF 2WRMA 2W7PA 4NLRA 2MQQA 1N5SA 1JLQA 4DL2A 2OSRA 4PWWA 1TL7B 1HWJA 3HX9A 3PHEA 3Q8UA 1ZA2B 1M5PC 4IO1A 4C11B 3I9ZA 5CYMA 4X84A 5IT0A 2I1RA 4M94A 2HWIA 4OJGA 1IKWA 3I87A 3BKUA 1REVA 2P6SA 3TVKA 4ICLA 4GVBB 1MU2B 2AJQA 1JNZB 5B0AA 4O3PA 3Q89A 2WOMA 1RTHB 4EO6A 2YQ3A 1U24A 2XMKA 2G2ZA 1AFJA 3KMSA 1N56A 2BA9A 3LH2S 4P2MA 3SMZA 4MKVA 3UD3P 3QLHA 2O3DA 3QGHA 4DUZF 1JKHB 5L9NA 5G0RA 1UWBA 4FXVA 1S76D 5E3AA 3BO4A 4A47A 1QDUB 1DBDA 1UTAA 1B0TA 4KAIA 4DL7A 4G65A 1YBUA 2RIJA 1WC3A 3G71S 1U09A 3A3OB 3BBBA 1RWNB 4O4GA 3MMAA 2G2OA 5IM0A 2EKNA 4X4PA 5I3QA 2OTLS 2A18A 3EE3A 1U45A 5LMNF 3LWLA 2DR9A 3OL8A 4ZS6A 3H2LA 4YB6A 5THWA 4USVA 2D7SA 6AT1B 3VAFA 1PBUA 1H2UX 2HQIA 4ZP6A 3W66A 1R43A 1YWXA 2NLWA 3T3FA 4CLUA 5D4PA 3M6UA 3PTWA 4G6VB 2YNIB 3R5JB 1UFLA 2PI4A 2HBZB 1K44A 1WG4A 1FERA 2EK6A 2OI2A 3F44A 4F4ZA 4KHPJ 4DQIA 2QZ8A 1YJTA 4FF1A 1QD1A 4M5MA 3IGNA 1N36J 2RQ4A 2QLJB 3LPYA 1VI7A 2ZBIA 5ETRA 3HM9A 1DTQA 3MEEB 5I42A 3WHIA 4M5DA 2MLYA 2LYVA 3BDPA 3BR8A 4F4XA 4B9UA 1PSDA 4HT5A 4NASA 3RUBL 3EGNA 3MR3A 4DWIA 3OSNA 1UCNA 2ZDOA 1LFWA 1RWUA 1WC6A 3J7ZT 2AHOB 2B5JB 3LUYA 1BQNB 1WF1A 2W9AA 3OFHA 3EZ5A 3GJQB 3CEDA 1MMDA 3HMJG 3LP2A 4RW4B 1DLOA 1TL1A 2BW2A 2KG1A 1OSCA 3GONA 3OV7A 2V4QA 1FD8A 3ZZZA 3TUIC 1R8BA 4CRJA 2YKNB 4NYPA 2J6TA 3TANA 5A6PA 4MYUA 3V4MA 3CE8A 4LF6J 2C3PA 3NG8A 1RQ0A 5AE1A 3UQSA 4MFBA 3QJPA 5KFKA 2DHXA 2YNFB 2XMJA 1FF2A 3G6XA 1HWLA 2DT9A 1N48A 4DLGA 3H42A 1DQAA 1FKOA 2J0XA 4R8UA 5GAGI 2RDDA 2C42A 2RRBA 3N6NA 1P8GA 2QFJA 2YXLA 4RNFA 5KG3A 1FNXH 3ISND 2KHDA 1S9GA 4F67A 2BUNA 1XMQJ 2LQBA 1TVRA 2ZJQQ 1YZ6A 2XWYA 2HMIA 4DFPA 3WIVA 2OTJS 1D8YA 5F0UA 3RW6A 2E5JA 1SV5A 3MPDA 3OVSA 2EKYA 4DR5J 2E7WA 2V8GA 2HQCA 3QGGA 3D0HE 1S59A 2B4VA 2JFDA 2WAQD 1HWUA 4OHVA 2DTJA 4KRWA 1G6BA 2BOPA 4DU7A 2GAHC 1LW2A 3SYZA 3KUHA 1W26A 3UCUP 3SDEA 1R31A 3JTNA 4B3SF 1SB6A 4U7UK 1WC0A 4K0KJ 2R7XA 4X64J 4LF9F 1QE1A 3W9IA 5IWAJ 2V34A 3GMGA 3TJ8A 5I3PA 1I3OB 4FF2A 4OI6A 2XS7A 4P73A 2IPOB 4MKAA 4BC7A 3SI8A 2IHR1 3M2UA 4M95A 1WF2A 2GAGC 3KLIA 4X2BA 3R6GB 2WK4A 3R1LA 1JJCB 2Y8YA 3BKFA 5KFJA 2FVCA 1ZBTA 1P9QC 2ZVSA 1YGYA 4EGLA 3IR6B 4J9PA 3RG6A 1T9UA 1UPPA 1HWKA 3T5HA 1TL3B 2YKMB 3AJ1A 2IYGA 4CNZA 2B4OA 1D8ZA 4F4AA 3M9OB 3C66A 4OHXA 1C4CA 4PWDA 4QQBA 1OSDA 1XNQF 1C1BA 1AUSL 3BZQA 1TV6B 2RT3A 1YJRA 4KT0C 2W2QP 1HFEL 3CCWA 4KO0A 1VBKA 3KK1A 2J8SA 4GKKF 3PO4A 3V5RA 3NGSA 1RTZA 3DGPA 1HI0P 2FGOA 1S6QB 2Z58B 4RW7A 3PX6A 1T7PA 2PN6A 7FD1A 3SIPB 3BGOP 5B7WA 1L5UA 4I69A 1RAOA 3M7VA 3ILIA 4R5PB 4PPDA 2GVDB 3K5MA 1O0PA 1NH8A 2R8HA 2K8GA 2B7BB 3CSKA 1HBNA 5AJ3J 2Y8WA 2AJ1A 4OZLA 1KD1T 4FYVB 4OI4A 1T02A 1OIAA 1YLXA 3DRPA 1T95A 4DR4J 1FFSB 2OAUA 3TYTA 1BQMA 2F63A 4NLTA 2VBYA 4RU2A 3NBPA 1HNVA 3DRRA 1VMBA 3BB5A 2E7VA 1U7LA 4Q0BB 4OZ0A 3THTA 4EUVA 1XBWA 4DN9A 2CA9A 3V81A 1I94J 1V5VA 3H90A 2RAQA 1QM9A 2QC3A 2R7RA 5J1EA 3IWXA 1XEZA 3PG9A 4B3TJ 1VC5A 3GSDA 3ZTOA 2GQ2A 5HLFA 2XULA 5JMNA 3T41A 1CJVB 1UJ4A 2JRSA 4K2JA 1M1GA 2HFNA 1NZ8A 3NAIA 5F9NA 2W1BA 3OQ2A 4I6YA 4O3QA 2HHPA 4IG3A 2ZD1A 3X3UA 1SUQB 3KYLA 5A0YA 2KU7A 2VG6A 3AOBA 3H5UA 3C2PA 1RT3B 2BOAA 3C6UB 4DV1F 5F8JA 3A4TA 1QSLA 2LA4A 3HD2A 4B17A 2GJ2A 1YIJS 5DDQC 1OY8A 2ILYA 3ZTQA 2D3OR 4RBTA 1X9WA 1VHFA 5DLGA 4DR3F 2AF6A 3ET6B 3P8BB 4DR1J 3W8PA 4OZ1A 2AZ1A 2EBEA 2BW7A 1DFDA 4DUYF 1WOSA 3DLKB 5KFVA 3NGTA 3AFGA 5BYQA 1RJJA 4NI2B 2IRXA 4NZ7A 2CDQA 4WYWA 1NSQA 4DV6F 1PC5A 1B7FA 3IR5B 1QY7A 3JYTA 4CO3A 4TLRA 3OW2R 2NCKL 1JLQB 5L46A 3DLGA 1TELA 1NJIT 3D6TB 1SC4B 1QAJA 4BWMA 1JJ2R 1SJ3P 5E0OA 1S4EA 3I31A 1NAQA 2KVQE 3HI9A 2RRAA 2D3UA 4ID5A 3U02A 5CYMB 1U6FA 2GQCA 2MKSA 2DNZA 5K8PA 3MAHA 2SXLA 1HYSA 5KFYA 3B4DA 3DOLA 2HGNA 3PEHA 2HS4A 2JVOA 4Q44A 1REVB 2FJDB 1J5EF 3UDEA 3G96A 1M5SA 1Q8BA 1NK6A 1FESA 2Y0BB 2YNGA 3DRSA 5KOWA 2WOMB 2JH3A 3ZC4A 4P2XA 2ASJA 1RAJA 2HS3A 1RT7B 1CPZA 1SH0A 3C8YA 2PI5A 4OIXA 2OPQB 1Z4UA 2FZGB 3RJMB 2XY6A 3BV8A 3T5LA 1WC4A 2HRUA 3MEGA 3QLHB 3MM5A 2RS8A 3NY0A 2HBQB 2R8IA 3FC9A 1FDAA 5G0RB 3V4IA 3I56S 3RRGA 3W2VB 1NB2A 5E41A 2BJEA 3J81Y 1Q0NA 3HVWA 1HBMB 2GMHA 4C3LA 3D3CJ 4O44A 1JXVA 3KXDA 4I56A 8RUCA 2W4PA 4CT9A 3W1YC 2GVZA 5GADI 4X62F 1UMJA 4O4GB 2RB7A 3MMAB 3KDOA 4USWA 1T05A 5IM0B 4K2XA 2WB4A 4ZA1A 3R97A 3NNAA 3FSYA 2LMIA 2C3YA 3QAUA 5F0WA 5C2CA 4AQYF 3L4BC 1Q7LB 4OX9J 1UW9A 2F65A 1JLFB 2V8HA 1JWWA 3KUEA 5DO2A 5D77A 1U1NA 4LSLB 3R27A 4MKYA 4I2QB 3HHNB 1XMOF 2IRUA 1LQ9A 3H4DA 3DMJA 3KJNB 2V8PA 2B4UA 4Y6IA 1SXLA 2QLFB 3IAS9 2LXUA 3FCWA 1NHKL 1QSSA 4YY3F 1CEZA 2M8HA 1IKXB 1N34J 2BKOA 2JEGA 4YDDB 3Q8QB 3M2VB 1EX8A 4FPIA 1FDNA 1GQEA 2F8MA 4RL1A 3ZNUA 1UA0A 1IXKA 3OD2A 3K8VA 1RAEB 4P71A 4DV4J 3H40A 2HS0A 1RKIA 3N0VA 3PDNA 4URSA 4G1QB 2ASDA 3OXLA 4RUCA 2HFOA 2LEAA 3RB4A 2JNJA 4R0EA 4X4OA 3QSIA 3GSIA 5GAHI 5H9FJ 5F8LA 3FK4A 2XHWA 2UV8A 3O5TB 3D6MB 3R5DA 3Q22A 1ELOA 1DTQB 2NR0A 2R3VA 3IAM9 4AL7A 4M5DB 1L3TA 3NEKA 4C8NA 3UNGC 4MIWA 1R6VA 4FYDA 4OV6A 2HIYA 4ECVA 2GMJA 3M05A 2QL7B 2CRLA 2J9DE 2JVRA 3ZTPA 2YTCA 1B0VA 2QN6B 3MEDB 4N8OA 1CG2A 3BYRA 3T19A 1KOOA 2FIUA 4HT7A 2MEWA 5KG1A 3TQ1A 1DLOB 2C3OA 2CVIA 1R3NA 4M8LA 5ETTA 2ADCA 3KDNA 3WX4A 1VCTA 2VG7B 1VBZA 1NKEA 1CQNA 2JJ4D 2L9WA 5KFAA 1S0OA 3K0JA 3PACA 4JI0J 5HMYA 5AXKA 4Q43A 4LF5J 4EK2A 3BGRA 3R9LA 2K3IA 1ROFA 3KK2B 5CHCB 4KH1B 2DNHA 5IV3A 2HK3A 5LSLA 2HHHF 1SKWA 4BBYA 4KV8A 3GE9A 2RD5C 4R8UB 4RZRA 5SUHA 2Q6CA 1FEEA 2E1AA 4J9LA 2RNEA 2B8PA 4EBCA 2QSWA 1SL1A 3IS9A 1APSA 3ADAC 1X4AA 5KG6A 3W9JA 2DGVA 3I0RB 2BV3A 1NSKL 2FLLA 4C2MA 1IKYB 4B3RJ 4OMFG 3CCZA 1QJHA 3QT7A 2MGZA 1RT5A 2F7VA 1BWEA 5D3GA 3HKZD 4WFZA 4IRDA 2IRYA 2RU3A 4IQXA 2K7KA 4USHA 1VJQA 5F3TA 3MMCA 3DU6A 3OBIA 3CD0A 3SDEB 2VG5B 1S1TA 2C28A 3NWRA 2H51B 4KH0B 3FBFA 2BMBA 2CQ1A 3VQTA 1U49A 5A6WA 4DSEA 5M2UA 5KFDA 3C19A 2CQ2A 1K8AT 3J7YU 2IA0A 2DGWA 5E2QA 4URQU 1YVFA 4JI5F 2I5JA 3CCLS 2GCFA 3LP1B 5IT4A 3M2UB 2DGSA 2MB0B 1T9XA 3Q2SC 4DL6A 1CJUA 3POTA 5CD4H 5DETA 3ZXWA 2DGTA 2C22A 9RUBA 4L73A 1WOPA 4ZN1A 3MI7X 1VQMS 2ZC3A 2QGFB 5C25A 2DK2A 3VHQA 1GXLA 4OYPA 3IP0A 2LXIA 5ETSA 3CJ8A 1N5YA 2FVRA 5J2PA 3H2UB 3AOCA 4YN3B 5F8MA 2HQGA 5ITHA 2CPFA 1MMLA 3M2RB 4WCEQ 4QBUA 2PEBA 2VC1A 3PO5A 3Q83A 3OJUA 5J2NA 3CD6S 2RHSB 2UXCF 1SIWB 1R8AA 3CJQA 3CCTA 2AYMA 4LF8F 2CIMA 2HVHA 5HAOA 3EVMA 4NLDA 3JXOA 1ZPWX 3CC7S 4P2FA 2KZZA 5J2QA 4RW9A 3HHLA 1OJ4A 4ZVHA 2JZ5A 4DV5F 2R7WA 4WU3A 2HAIA 3U7JA 4ECXA 4LF7J 5H9EJ 2XNRA 5KFZA 3QT8A 2LLZA 4WZQA 1D9FA 1RWMB 4TQRA 1FNOA 2HVIA 3KWMA 3OTOF 4U9RA 5JXSA 4V19X 2QL5B 1RTJA 4E8UA 1S6PA 4XPCA 1RDRA 1LKZA 3TX8A 4NX9A 3RBDA 3BGUA 1FVSA 2HVEA 4HI1A 1HBNB 2BJ7A 2MKHA 3JSBA 4ZJOA 3I55S 3BBFA 1NJWA 4ZLLA 4CZCA 2KO1A 4OLOA 2APOA 3BDEA 1KHWA 2DNQA 2HHVA 5I3UB 3PM9A 1BQMB 1GEHA 4WFBQ 2HNDA 3NBPB 1NHUA 3SBMA 3ILLA 3DRRB 3M6VA 2QA1A 3DI6B 2YX4A 2OPRA 1UVJA 2DGXA 4CQ1A 3T6JA 4ZLPA 2K06A 4B3MF 1NDPA 4DOZA 4JBCA 2JHEA 3V81B 4PQAA 5C2GA 1EZZB 2HHXA 3KHLA 3NMAA 2UUBF 3QZ7A 2NREA 3THVA 4ED7A 1XQIA 5HLFB 5KT2A 2COLA 4K4WA 3NCPA 4YOEA 4O3RA 3MM7B 4AFFA 2HFUA 3E3XA 2ALYB 2VFVA 2XTJP 1Z1ZA 3PX0A 2CPIA 3GG0A 1T8EA 4IRCA 3CTRA 2YPYA 4CH0S 4O0IA 1VOMA 2HKEA 1HPZA 3US5A 1RLCL 4IG3B 2CQHA 2ZD1B 1FWKA 2UXDF 4MIAA 4P9SA 3CPWR 3B78A 2Y3YA 3B54A 2YNHB 4NPOA 4MK8A 2CJKA 3HHEA 2W9BA 3BN7A 1AZSB 2BVZA 4X4VA 5JJBA 2D41A 4DMZA 4X66F 5FJ4A 2B6AA 1DAXA 2F8EX 1Q8LA 5LMNJ 4P72A 4ZCMA 4RO0A 3BH6B 2LQ9A 2MKIA 3FVYA 4QIWD 4WU2A 4ES3A 4KGXB 1SH3A 2MXYA 1JXLA 2RF2B 2CDRB 3K17A 3VGVA 4JV5F 2DKOB 2WB1D 1S0NA 4ZPAA 1RI7A 3W2WB 2W25A 1XNRF 1W7WA 2CJ9A 4DPXA 3IRXB 3M32A 2WONA 1H6KX 1RAAB 4NLQA 3L7PA 1KBRA 1HKAA 1BUXA 3ETMA 1S97A 1C1CB 1GTEA 4KHPF 2ZBQA 2FLOA 4LBIA 4QCLA 2EFQA 3EVWA 2WVCA 4ELVA 1N33J 5HP1A 2BQUA 3QJJA 1C0TA 2LECA 1N36F 1MWYA 5KFFA 1LWXA 3HXMA 1I51B 3HULA 2YNGB 3DRSB 3FKBA 5D8HB 4ZLNA 3RGIA 2B7CB 2OEKA 5AT1B 1RB0A 4WFNQ 3MM6A 1KLNA 1LWFB 3VR1A 3T1YF 2MJUA 2QG9B 1FRKA 2DH7A 1WSRA 2FLNA 3OVAA 4W98A 5FDLB 3MEGB 3MM5B 1R6YA 3QFHA 1N6QB 2FC8A 3QRQA 5IV4A 2FJXA 1FJGJ 5HVHA 3V4IB 2VJUA 2Y1RI 3KLVA 3H8YA 1KTQA 3QT5A 1RWKB 5E3RA 3IBWA 2FVSA 4FVMA 1AT1B 1NRKA 5A8KB 4O44B 2B8QA 1E6VA 4B08A 1NK5A 1TK5A 3M4XA 2GQQA 3PV8A 5KFWA 4MKBA 1QTNB 3IG1A 3ICLA 3TOQA 1EB0A 3MMJA 2JWNA 5EX0A 1RBOB 5EUHA 1T05B 4H4OA 3GZ7A 2UU9F 2UVUA 3M9MB 4RBVA 1S57A 4QW8A 1Q4RA 1S6UA 4FYXB 2OGUA 2BR0A 3T5KA 5A8RA 4U8YA 2A2CA 2MZJA 3M8ZA 1KVIA 2W4DA 3C15B 2PD1A 3PYGA 3U27A 4Y2AA 1TQLA 3KHRA 3DMJB 2HFSA 4WKYA 5KFPA 1H74A 3DHXA 1YJVA 2ZBCA 4OI0A 4HLBA 4KC5A 4FP9A 1F9FA 4TY8A 2G4BA 1D09B 3OR1A 1B4SA 1PYOB 3DLHA 1X0PA 3D54A 4N56A 1N52B 2Q3PA 4OHWA 4HDGA 1FI4A 3KJVA 3MEKA 4HH1A 2BYCA 1UEVA 1KFSA 3NXZA 2DXFA 4DPOA 3M8YA 4FS2A 2M7SA 3VAKA 2XSJB 5KFLA 3A1YG 3AQOA 4B3SJ 2W01A 3FEYB 2MKKA 4RX6A 1WHXA 4IG0A 4LF9J 5HQMA 2BANA 3DM2A 1CS4B 4I2PB 2KKHA 2CADA 3VF0B 2ZKUA 1QTMA 2A0FB 1WDTA 4NA2A 1BC6A 1VGYA 2DJWA 4Q7AA 4FKYA 2XWXA 1VQLS 3N01A 4CH7A 1NJXA 3FDSA 4WYLA 3IO1A 4PAAA 3K2YA 1YRXA 2AJ2A 4CM0A 2FHJA 3CJ0A 4HH0A 2YKAA 4PCQA 3UO0A 1RYRA 3VWSA 2HNZB 4OI3A 2H5EA 2VOPA 3GIRA 1IBCB 4IYQA 3NRBA 3AY0A 4DX6A 3TARA 3A13A 3CWJA 3AAWB 1O6XA 1VQ4S 3MCNA 5I4MA 3LALA 2CJBA 3CJ2A 5HO4A 1RA6A 1U25A 1XNQJ 3BSNA 2JC1A 1A0OB 3OUYA 1T9TA 1HQ2A 3V2UC 4KV8B 2YQ0A 2GIQA 3GJRB 2DISA 3Q86A 1IM6A 2FB0A 3AB2B 4USMA 5J2MA 2IYIA 5AE2A 3CCUS 1NEEA 3IS9B 1WHYA 2OD4A 1WD6A 3P6YC 1QUVA 1HQUB 2A2DA 1KSPA 2C3MA 4DQSA 2YWWA 1I5OB 1FJ7A 3TP2A 3VGSA 4DQQA 3CGIA 2X1BA 1TKTA 4CLLA 3NLCA 4RPFA 2MGZB 1DHMA 1RT5B 4Y2KA 5D3GB 1B64A 3ISNC 3ENVA 3DLEB 2AGPA 4IR9A 2DR7A 1Z2ZA 4JI8F 2OP5A 2KXHA 1NDCA 3HO1A 3QBCA 4ED2A 3CD5A 3OT9A 2R2UA 2BQ3A 2CZVC 1KQFB 2M88A 3B4MA 2KI2A 1C2PA 1TL7A 1FCAA 3RBXA 3ITHB 2MQOA 2MZSA 2RE1A 1TKXB 1Y4ZB 3CB4A 2AYBA 2LKZA 1CSJA 4DQPA 2I5JB 3R5BA 4K5RA 2ADBA 4ZPDA 4DCJB 5KTQA 1NXIA 4CO4A 2CPZA 4GVBA 1YG0A 2ZBPA 4QU7A 3MR2A 1RAHB 3NNCA 4UY8T 3FBBA 1U1LA 2W24A 1YBAA 3CDBA 3PHTA 3PRDA 2DITA 2QRRA 4NLOA 2P9EA 5C25B 3EXCX 3KMQA 1YX2A 5ETQA 1VLYA 2AEMA 3MD3A 4TNOA 4KSEB 1DY3A 2ZZTA 2F3JA 2NUHA 3KLFB 2ZUGA 1LNQA 4FBUA 2HAFA 1UJ5A 1MW7A 4C6AA 4NRTA 4QW9A 4NLWA 5ADZA 2XLIA 4DF8A 3GFYA 2ZH7A 1JX4A 1VLOA 3HT0A 4CTAB 3NGKA 5K8NA 3VV2B 4J90A 5J2QB 1WELA 1YJ7A 2FJVA 1LEOA 3K5PA 5JUMA 4DR1F 4KIAA 3N5BA 3ELHA 1BQXA 1TUVA 4HHUA 3KTQA 3BBCA 1JIHA 3IRWP 5D4LA 1PKUA 2CZ4A 2MSSA 6FD1A 2GO8A 2HEKA 1NSPA 1FKAF 1RTJB 3UCZP 1UVNA 3RR8A 2CPDA 4C9DA 4KPYA 3KKFA 2QIFA 2CPEA 2KT2A 4DPUA 1LWCB 1S1VA 3IGVA 4KY3A 3OVBA 2L9DA 2RRNA 2MQLA 2DO0A 1OYEA 3TA1A 4DUTA 1S9EA 4IO9Q 2DRBA 1C4AA 1X4HA 4ZVEA 2O5DA 4DBQA 3UR0A 1TL5A 3BGLA 1KKHA 2RQKA 4QYZJ 2HNYB 2BZ2A 3HSZA 2DXDA 3SSSA 2HK2A 1X0FA 3EZUA 1J5EJ 2DHGA 1U1KA 3MEEA 3OL6A 5CYQB 1BWVA 3IR7B 3LF0A 2WBMA 2QSFA 1JLGA 1IN0A 2Y1IA 4QYRA 4EBDA 4JI3J 1L3SA 2AKWB 4I7FA 4JI1F 3D1QA 2JEJA 3W8GA 2VB6A 4C48A 2ZHAA 5KT3A 2OIHA 1CC8A 3I6PA 3QPIA 1S1XB 2UUWA 4RW6B 4L6V3 4M5GA 2VC0A 4C0HA 2JSXA 4PXDA 1SJQA 3R2DJ 2HHUA 1UEKA 3BR9A 4X62J 2J9CA 4U8VA 4OYBA 2EC0A 2Z8QA 2Z0GA 3D3BJ 5KFTA 2B6AB 1UETA 1BGXT 2YNFA 1EP4B 4XK8C 4F2RA 1U2CA 5CCMA 3N5FA 1JXEA 3NGRA 4AQYJ 5H1SV 1NK8A 3G82A 1R0AA 3PW0A 2MZRA 1S72S 1HI1A 1CQMA 2RILA 1XMOJ 2QMXA 3IN5A 1HNWJ 1P1TA 3QO9B 2VUGA 3AD9C 4N8NA 3G8TA 5K20B 4PQUB 1SC3B 1RT6A 4YY3J 3M9NB 3HT3A 4DHVA 3M32B 2WONB 2BE2B 4DR7F 3FEXB 3F41A 1WEXA 3V6KA 2QYCA 5C7PA 3PKYA 4ILRA 3QYYA 3VGUA 1HR0F 4JP8A 5D0GA 1RHRB 2PFFB 5HP1B 3SFUA 3BO2A 1C0TB 2O01C 3TJ9A 1DZ5A 5AXNA 4QWBA 1F1BB 5T7LB 1YI2S 2QA4S 3RAXA 2PMHA 3RU0A 1HQEA 1ZM4A 4P74A 2VZ9A 2GX8A 3LQVA 4G3IA 1KR4A 4XO0A 4LBHA 1VIXA 1K0VA 1JLAB 1Q7YT 2YWKA 1ZA1B 3AA8A 3LO3A 4U7CA 3QFWA 1GNKA 3G86A 1AYEA 3BH7B 3DCAA 2GGPB 3V6JA 2NZ4A 3LP0B 1MN9A 2ZWOA 3WQPA 2ZJRQ 4DG1B 1RLDA 2Y1JA 4OX6A 1U4BA 2Q79A 1T3OA 5CAAA 2DR5A 2EFOA 2VU5A 3Q8PB 4ERDA 4AXIA 1E6VB 2ERRA 1VK3A 2CQPA 4N5SA 2KH9A 3VAHA 2ZH4A 2CUYA 4CO1A 3IG1B 1X5SA 4IOCQ 3FNNA 1TL3A 4Q2MA 2HHSA 4OI2A 2YKMA 4H4OB 2VD3A 3L3CA 1FRHA 3A8IA 4F26A 2FHOB 4OJ3A 2AWZA 3OTBA 2WW8A 1TV6A 2Q6BA 1PBAA 3J7A1 2HHHJ 3BQ1A 3I9V9 3QSYB 1SKSA 3PKMA 3AH6A 1O51A 3FRYA 3JQKA 4H4KC 3ZZTA 2D69A 4NMLA 1YJ9S 2PO4A 1VDHA 1MLAA 1VC0A 1DQ9A 2V50A 2WVDA 2P6TA 3PW7A 3FCHA 4R5PA 1XN9A 2GVDA 4ED1A 2WVFA 3OR1B 3M8QA 2R7TA 4ZVFA 3GJTB 3KJVB 4QIGA 4F4WA 3SV4A 2HQFA 3BEGB 2CNLB 3D1HA 1C0UB 2IM2A 4M5LA 1XR6A 1GK8A 3H5SA 1CLFA 5LSRA 2WTFA 4WIQA 1CJTB 3S7RA 1WUUA 4K4TA 1OY6A 4A46A 3W65A 4DPYA 4AL6A 4CH1A 3K89A 1FVQA 1XWLA 4IG0B 3TR5A 4F3MA 2ZWPA 1SQGA 4UOFA 4Y65A 4CWBA 4RKUC 3DM2B 2H48B 4OHZA 4PZVA 4Q0BA 4KE5A 2DVIA 2ZITA 4X4SA 4JI5J 5C42B 5HMWA 2JLFA 2IJRA 2M2BA 1T9VA 3OFFA 4LFBF 1VQSA 4RNNA 2BACA 1MMNA 5HSPA 1OY9A 3JQMA 1G3OA 5B08A 5LT5A 3HFVA 6FDRA 2HWTA 4U96A 2H3EB 4HHHA 2HBRB 4M1KA 4ID8A 2PDAA 3QIDA 1RT2A 3S6EA 4TXSA 3HHLD 1ICEB 2OSQA 2XS2A 1G7CB 3PJXA 3T9NA 1IJFB 2LEPA 3GG1A 2QE5A 3CIZA 3BSOA 2RQCA 3P96A 3QMQA 2XO7A 3QQCD 1U0HB 4LBPA 2YVSA 3GV7B 2FPHX 1F5AA 2UZAA 1TP7A 1SUQA 1RWVB 2BJ3A 3VZHA 1IVZA 5KFOA 1RT3A 1H72C 2UXCJ 3C6UA 3PJ9A 3OUYB 1RT1B 1B70B 5IQQA 2MKJA 4LF8J 1NK7A 2E1MC 4OZNA 2KT5A 3CT9A 2IM3A 1U1MA 3RAMA 2KZMA 1UJ6A 4WZMA 5DGBA 2RKIA 2PC6A 2R7OA 4DV5J 4IH6A 3HHKA 2CYYA 3HJFA 3ET6A 2D9OA 4WPAA 1NJYA 2GFFA 4JV2A 3OTOJ 4CO0A 5D15A 1TKTB 3C6TB 3DLKA 1Y11A 4ZVQB 2OMOA 2BJDA 3OFEA 1RA7A 3VALA 3JSRA 2UV8G 3DN9A 1FRMA 4QPTA 3QWPA 2V9KA 1G1XA 3EWGA 4QWDA 1WC1A 4UOHA 3TAQA 2KYXA 4IDKA 3Q23A 4NCGA 3H20A 1L3VA 2DH9A 4M5HA 4OJ1A 1IM4A 4CO2A 2CQGA 4LMZA 1DARA 1AUDA 4GC6A 1X5TA 4ZMMA 5KT5A 4CNYA 4B3MJ 4QIFA 4J37A 2KXNB 3C14B 3M8PB 4LR7A 4LUBA 3UDLA 4ANCA 5EWEA 2UUBJ 1WTFA 4B02A 4LT6A 2XMVA 5B0FA 3P5TL 1W25A 1RT7A 1M5VC 1RU2A 4O3SA 2OPQA 4OHYA 3KG1A 4E0DA 3LGNA 4DDFA 4WBFA 3G2XA 4DN0A 3MOZA 1GMVA 2V9WA 1VQNS 2ZUAA 1YSJA 4LR9A 2H4YB 1EKSA 3MPVA 4UW2A 3NOCA 5L8RC 4Y00A 2CQBA 3W2VA 3TRGA 3DU5A 1DJ0A 5M2PA 4KHMA 3C3LA 1HBMA 2W2OP 2ABYA 2UXDJ 2GC8A 1X4GA 3IM9A 4UF4A 4IFVB 4WFAQ 3MD1A 4JB8B 3OXFA 1VQ9S 4L3KA 3NS6A 4B9MA 2N7YA 3EDRB 5KOXA 3L7OA 3HKWA 1YZ7A 3M6WA 4X66J 4WE1B 3MURP 3KG0A 2AEJA 1U6BA 4PPZA 4KHRA 2PMWA 1JLFA 1Q79A 1JQGA 4LSLA 3G87A 2CQDA 3TJAA 4I2QA 2AEFA 2MMYA 4QIEA 4P6QA 4WXOA 2QFIA 3PCOB 4ANEA 3O6QA 2B3TB 3OSPA 4JV5J 3DKDA 1S1VB 3Q8VA 3FRZA 1NK4A 4K5SA 5E5NA 1WOOA 1SH2A 1IKXA 4ZHRB 1XNRJ 1S9EB 4L72B 1X9SA 4NOHA 3M2VA 2JC0A 5AE3A 4A8FA 1Q53A 1NMEB 2ZBRA 2HVZA 2CNOB 2XCPA 5ETOA 3L7UA 5K8MA 1SQFA 5LSOA 4WTYA 4F3OA 5HK4A 4G1QA 1N33F 2MZQA 3K5NA 3KNGA 1V9OA 3Q0AA 4PXEA 1JJHA 3D6FB 1UVKA 5HVFA 5DDRC 3I5AA 1PC4A 3EUNA 1U1OA 2JLGA 1PJ6A 1TMJA 2IVFB 5KFUA 4TVAB 4ZP9A 2V4JA 5L1JA 5B0GA 4DPTA 1JLGB 3OLAA 5DZ7A 1X8DA 5CXTA 1G4CA 2EFNA 3T1YJ 1RHKB 3W5ZA 4ZIVA 5J1PA 2BBEA 1NB7A 4M5NA 1P27B 3FUYA 4F0MA 3NS7B 1FJGF 5CD4A 5GADU 4BHQA 1M1HA 5A76A 2IAJA 4I7FB 4USUA 3MEDA 2LP4A 5DQIA 2DNGA 3CCRS 1SKUB 4DV3F 2YWHA 4ZIWA 2D3ZA 2FD2A 3HSDA 3MECB 2UVVA 3JTPA 4AD6A 2VG7A 3NAHA 2ZHOA 1JLBA 5ETKA 5KG2A 2C2RA 4O23A 3SEOA 1SBRA 1TFWA 2XHCA 2UU9J 1GX6A 3GYNA 3KK2A 2RHQB 2L08A 2AYEA 3D67A 1RZMA 2DRDA 1ZPVA 2E1CA 1RACB 3FJ2A 4YQWA 1M90T 3G82B 1R0AB 1X4FA 3VZIA 3OFGA 2XLKA 3RZAA 2KVIA 2POKA 2IY5B 4E2FB 4Y2IA 2WVBA 1UAWA 3I0RA 2DNKA 1VQKS 5D4NA 4CLPA 2HBYB 3DOMA 5GAHU 1IKYA 1RT6B 4ZPWR 3O2IA 3IWNC 2ACYA 3WZ0A 1NDKA 3Q24A 3A8EA 2BQRA 3MDFA 3VTIA 2VBXA 2W8LA 1CC7A 2Q43A 2XNQA 1NLKL 2MKYA 2DY9A 2A1BA 1LWEA 2ATLA 1RGVA 2PSZA 3GFHA 4BC9A 2VG5A 5KG5A 2BE7D 7AT1B 2X51A 4L75A 5B0DA 1HQEB 2Q1LA 3JSYA 4C8YA 2AT1B 3HDSA 3H0PA 2FHJD 1M0SA 1DURA 4WK1A 3TVZA 1ULRA 3DOKB 4Y2MA 3T5JA 4I64A 1GXTA 1K47A 1URRA 4LFAF 2OJ3A 2Z2MA 5HATA 1OWXA 1HMVA 5IFMA 3LP1A 3R1HA 2FJWA 2LVWA 3G6YA 4FF3A 3PEJA 1X7VA 2KXFA 3NOGA 5DGAA 1EJ7L 2DHAA 1Y00A 3R8YA 4DFJA 3ZZOA 4DS4A 4LF1A 4HTJA 2F9DA 4OYMA 3CDAA 2DBBA 3VGTA 1LXJA 2FVQA 1S5ZA 3ETOA 4XAKA 4ZP7A 3TZXA 4DR6F 3CXCR 4LVOP 2C2MB 3NCQA 4NLGA 4GO5X 1NU4A 2N4CA 3M2RA 1XTZA 3BQ2A 2MHNA 4M5KA 3G8QA 4OYZA 5A8WB 1HBOA 2ZVIA 3EDQB 2HYIB 4L74A 5KFHA 2DCLA 1S7HA 1TAUA 4IOBA 3W5XA 1HHTP 3I0SA 2RH3A 3NL0A 1PJ5A 2YY3A 2ZH2A 2VPWB 1GX5A 2HHTA 4DSIA 3RW7A 1IR0A 1T03A 1AB8A 1T9WA 3MPYA 3KNAA 3M8QB 2HHQA 3GP9A 2RJZA 3TUPA 1JJ4A 3MR7A 4F02A 3LAMA 1BMQB 2HZCA 1KC8T 4ATNA 2KYZA 4JI8J 1VHIA 1EQ0A 4LRBA 4F25A 5KFCA 3GPAA 2AJ0A 2OEJA 1FD2A 5I3UA 3GYGA 3RRHA 1F2GA 1ZH5A 4XTTA 3K59A 3DI6A 3NKYA 4CLTA 5HROB 1LOUA 4RUHA 2VQFF 3D0GE 4ECSA 2F8HA 3GTYX 4F50A 4FVCA 4DV2J 3ENQA 4LF2A 2XM3A 2W2PP 2CQCA 3HLUA 4YMEA 1Y10A 4UT4A 1F2HA 3UN2A 4QR1A 4ZPCA 5F8IA 3EJMA 1HNIA 2N3OA 5DDOC 4NL5A 1S0VA 2DHSA 1F3FA 3MM7A 1RT2B 1XR7A 4ES2A 4CIOA 1TK8A 2AV5A 1S1UA 4QR0A 3H5YA 3A3NB 3CNQP 4LRAA 1H7XA 3MR5A 5LMUF 3FCVA 3CJTA 1SC6A 2IVYA 3BO3A 2CJAA 2R8JA 4PRFA 3LA0A 2ZH8A 1Q78A 3CJ3A 1TFYA 4MTPA 2KHCA 4ZN3A 2CNNB 4FYYB 4UUXA 2YNHA 4FDFA 1RYSA 2QYGA 3ONQA 3UR3C 3VVUA 1VQPS 3RR7A 2R7SA 2RKIB 3ZTRA 3DDIA 1AZSA 1S4FA 1TL4A 2HHWA 3P5BP 1U47A 4NLUA 3P4UB 2HLUA 3CJRA 2VONA 2WSEC 1FT8A 1HNXF 1PAEX 4DX8H 3HHDA 2KTQA 2ALZA 4U7UD 2YBVA 4JUZA 3G9CA 1WI6A 4PEOA 5DM6Q 2QL9B 3CUNA 1KP6A 2RF2A 3R2CJ 2G1DA 4LRFA 4UTGA 3K5LA 4IOAQ 1F5CA 1Y3JA 2A6MA 3W2WA 1F9EB 4W92B 3EMTA 4IDKB 4ETZA 4NCGB 1U2FA 3IRXA 4URGA 1QVGR 4DXLA 4G1IA 4A8KA 1B7YB 3KLHB 1C1CA 3S1TA 3BJYA 2AMCB 4A8OA 1JK9B 4PG7A 4CCHA 1KLMA 3HK2A 4F4KA 4OYIA 1F3VA 3UFCX 3OLBA 1U8SA 2KFZA 1S9FA 2MTLA 2W2NP 3WC0A 2B9EA 2GHWA 4EEYA 2QA4G 3ILOA 1DTTA 2P9CA 1N54B 3QRPA 2GHPA 4NRUA 1LWFA 1U1QA 2V6AA 2CPHA 2KFNA 1LFPA 4JI3F 4DV7F 5FDLA 5E3CA 1N6QA 2E1RA 5H9FK 2MKCA 5CABA 1J27A 2J7UA 2GMLA 2LQ5A 4C0OC 2DXEA 2UP1A 4JI1J 1WKKA 4K50A 2CJQA 2EFVA 4H4MA 4KQZA 2Z2LA 3KOAA 5A8KA 1HLWA 3W5YA 4QWAA 2AJ4A 4K4YA 1U1RA 5KG4A 5MAOA 4YB5A 4WKRA 4HACB 1H73A 4ZVRB 3TQEA 2BJ1A 1RUSA 2V68A 4TU7A 1N88A 4TN2A 2XY7A 4UUWA 4BS2A 2FDNA 2UXBJ 2AJFE 3VQSA 2V69A 1U1PA 1NUEA 2V94A 5KFEA 5EDWA 2WHOA 4Y34A 2W8KA 4DL0C 3R7BB 2H5JB 3C15A 3MTJA 2X3GA 3O1LA 2BM1A 3IFEA 3FMBA 1H7WA 4I68A 1HNWF 4F0HA 3V6DB 3ENWA 1SJRA 1W2BR 4ECQA 1W2IA 4RJVA 5SZTA 4BLGA 1R8PA 4DSFA 3NCRA 1RBAA 1RTDA 1JB0C 3HSGA 4DR7J 3MCSA 4A48A 4GKJF 5A2QY 3EYZA 1SL2A 4I4BA 1HR0J 2ZFHA 3FBEA 1RWPB 2XSJA 1S1WA 3DHWC 3GCXP 3DXSX 4NYZA 3TZYA 1K0TA 4J9VA 2NPFA 5GMEA 1FE0A 2CG4A 1RT4A 2AGOA 2VKZG 4KPCA 1FXRA 3LOUA 3GQCA 4ELUA 2OO4A 2QMUB 2J0QD 3JTOA 4EZ9A 2UUCF 1Q82T 2V4JB 3CO9A 2RDJA 1CS4A 4I2PA 3R5AA 5LJ3Y 2IJFA 2Z4PA 2FY1A 2DNPA 2VIHA 2VQEJ 5FLXU 2PMZD 2O67A 4LQ3A 3DC2A 2DIUA 4USTA 1TMMA 2IAJB 1TTHB 4AYBD 2QLWA 3BYPA 3MFIA 4ITSA 4RNHA 3HFKA 2R7QA 1SC1B 4CLWA 4K4XA 1FFGB 2BJ8A 2CPXA 1IBMF 3R7NB 3CCMS 5LJ5Y 1U0SA 1PYTA 5L39A 3CMQA 2HNZA 1Y5LB 1JLBB 1Y3KA 1Z2LA 3H2VE 1WWHA 2R8GA 1PYSB 4TLQA 2GHVC 1P9YA 3R6LB 5C24B 1WSVA 4JOUA 2D1CA 3S8SA 3PX4A 2P5VA 4PYAA 3UN5A 2DD8S 1VRUA 1CJKA 3E8OA 2NSCA 3RTVA 2WSCC 5HANA 1UVLA 4PUOB 4ECRA 2ZDPA 2DIVA 3BGFA 4UOGA 1YJNS 1QLNA 5HVGA 1ZM3A 1HQUA 3DOMB 2BRKA 4PKDB 5K8OA 4TYBA 3D5MA 1ITPA 4LR8A 4CYUB 2E44A 1LW0B 2VBWA 4HTIA 3DLEA 4ECTA 3OHAA 5H9EK 1LWEB 2CQ4A 2XYGB 3HJVA 2N7CA 5HJXA 1K1QA 1XJWB 3JQJA 4LIWA 1N5TA 4DI6A 1IKVA 1NPRA 3F73A 1U26A 3C16A 3ITHA 2XY5A 4Z2XA 4CLYA 5L1IA 1TKXA 4KFBA 2CVEA 5AXMA 3FFIB 1RAGB 2AX1A 5IC6B 1IBKF 4KYZA 3SCKE 1HMVB 4NLSA 5EX3A 3ZZUA 4UZBA 1GH8A 4NYOA 4JYAF 1B3TA 4ZVGA 3PRBA 4I6WA 2J0SD 1FWPA 4LFBJ 4QZVB 3UVJA 3G6ES 4FYWB 2R7UA 2IMOA 3IC1A 4IFYA 1HW8A 4NZ0A 3B8HA 5F3ZA 2LQJA 1WG1A 3DXBA 4DCOB 4DV0F 1NNDA 1ZM9A 3I96A 4RR5A 4GC7A 5GMDA 2G0CA 2FLPA 2DH8A 4P2SA 1VQYA 1N32F 3OR2A 2NXEA 2XQCA 2BDPA 2J6UA 1CVJA 1VQ8S 4J9UE 3DLLQ 2OFHX 4K4ZA 3CJ5A 3KLFA 1RU1A 1ZZFA 2XMUA 1XR5A 4OZ3A 3MM8B 4IUFA 4RU9A 1HBOB 2ZH9A 1QVFR 3OL9A 3FZBA 3IBFB 3MFHA 4CTAA 3I0SB 2VPYB 5E33A 2HQDA 3H25A 3ISZA 3FQKA 4X4QA 3SCLE 1T03B 4C8KA 2ACMA 1OPIA 4ED4A 1KN6A 2LCWA 2ZZMA 4DJBA 2EW9A 2J6SA 3GJSB 3F0NA 3MAQA 4KBIA 3J7AN 2H65B 3PRVA 4LVNP 4J9OA 3T1HJ 1FJCA 5GAEI 1LWCA 2W7AA 1Y7PA 2RUSA 5DM7Q 2XZWA 5KG0A 1ZETA 3LAKA 1U48A 1J5OA 2CQIA 7FDRA 1NO8A 2OKQA 4V19J 2J0WA 4PABA 4FN5A 1FDBA 4I6AA 4A8SA 4UY85 2HNYA 1IJEB 1LV5A 1V3RA 4B3OB 2NYIA 3CMES 2LFVA 2Y1LB 5CZVA 4ED6A 1X9MA 2CJYB 3BSCA 3THPA 1ZAVA 2VHGA 2OPPA 1HNIB 5BR8F 2OEMA 1EARA 5CYQA 1RABB 3GR1A 3GV5B 4RLEA 3AQPA 4NLPA 5KT7A 2IVMA 3FSIA 2OH2A 4WXWA 5EGYA 1S1UB 4RNMA 1TR0A 3NMRA 2RUGA 2WCXA 2IJNA 4ECYA 3PW2A 2W7OA 4IR1A 3MHYA 1R0BG 3QNWB 4C98A 2M8DB 2F9JA 2M4MA 4U6PA 2IIHA 1VRQC 3IWLA 1RK8A 1KDNA 1NPPA 3Q2TC 1S1XA 4RW6A 2GW8A 3IXQA 3HHLC 2U1AA 2VKRA 4OLPA 3TNVA 1GAOA 5KT6A 2DGUA 4PG4A 4YB7A 2K1RA 2O1PA 4B9NA 3EVOA 2IA6A 4CM2A 3ZZRA 2XO6A 2ZNYA 4DLEA 1ZTWA 4ECWA 1EP4A 4FBTA 1SIZA 4LRCA 1D9AA 1EQMA 4DQRA 5IC4B 2V0NA 3DDKA 2I8EA 2F4FA 1S77D 2HG4A 4K7QA 1DRZA 3MMBB 3CCSS 4GO7X 2YKQA 1PCAA 1KS2A 5F9LA 2XGPA 1T3NA 5D4OA 3QO9A 2BKNA 4I67A 2JX2A 1Q81T 4ALZA 4PQUA 3BKTA 3PJWA 1I1GA 2IM0A 2ILZA 1H2TZ 3LANA 2BE2A 1SCJB 3GB0A 5HBMB 2IC3A 3R7SB 3EZOA 2V2ZA 1KLMB 3OTDA 3LTOA 1MROB 4P52A 2PGCA 2J7WA 1KONA 2PEHA 5T7LA 3E01B 2HWHA 1D1UA 4ZITA 3MGJA 3G6VA 2GJIA 5EHHA 1YDLA 1DTTB 2CWXA 1VJWA 1YTYA 2JL9A 1S79A 2IDLA 2E1PA 3W62A 3H4BA 2QMWA 4ANDA 2MQ8A 1SPBP 3AA9A 2JDJA 3PFOA 2FJEB 2I0XA 1KQKA 1JLAA 5J1NA 1VIOA 2L48A 5D6GA 1VFJA 5HQLA 4J9MA 3ZZYA 1KOHA 2WVEA 2KRBA 2GGPA 2XI3A 2FGCA 2I2YA 3LP0A 3ZNJ1 1EIYB 4RUAA 4DG1A 4ZCLA 3D0IE 4H4MB 2R7VA 1X5PA 2G2YA 4BWJA 4MYTA 1MWQA 1EKRA 2XYPB 4EWTA 3PYEA 2EG1A 2KDOA 4DV3J 1FNMA 4G1PA 1Y5IB 4F7VA 4ZVUB 4Y0FA 2G0IA 4FNIA 3TA2A 3BF4A 1N4LA 3UN3A 1HWIA 2V67A 3TAMA 2XMMA 5JVGQ 4YHHJ 4OZ5A 4X4UA 2DR8A 3FMWA 2X1FA 1OMSA 1FRIA 2QT7A 1VQ5S 1ACMB 4LSNB 1Q5YA 9ATCB 2C2ZB 5KFGA 2X7IA 4HKQA 4W4MA 2OELA 4DF4A 1VBXA 3GILA 3SSRA 2F4VJ 3UI3A 5LOQA 4J7CA 3N6MA 3EPGA 1YK9A 5BYSA 4EFAC 5CA5A 1IR2A 1NK9A 3GYXB 5HQ8A 3JSMA 3O44A 5F8GA 1RTDB 2VV5A 1WKJA 2NYHA 4L76A 4NEZA 2J9EA 3HVTA 5LL6d 2MJNA 3UCGA 1RWOB 2HIQA 1H2VZ 2XI2A 1LK5A 2F40A 3SZ2A 3I4PA 1JMTA 3JS9A 2L3MA 2CWKA 4GVLA 3OL7A 1RCOB 1C0UA 2HFZA 3I82A 1BLUA 5KFSA 1S1WB 4DL3A 1IWAA 1CJTA 2A3JA 2BABA 4U67Q 1M5OC 2J8AA 4DR2F 1RT4B 2NPIA 5HMXA 1WF0A 2E5LJ 4EU0A 5KFIA 4A8WA 1GXUA 2IM1A 2ZE2A 3CO0P 1VISA 3GV8B 1SL0A 1Q86T 2FQQB 5IZHA 4BDPA 2JOQA 4LFAJ 5C42A 1UW4A 1FRXA 2XYHB 2QA2A 4OL8A 1FXDA 2WBRA 5D0HA 2XEXA 1P6TA 1WORA 1FX4A 1NH7A 4HL9A 3J80U 3DFEA 2EXUA 3UD5A 3GLJA 1KVJA 1IWGA 2KM8C 3HCXA 4JI6F 2H4WB 1AFIA 4DR6J 2OFGX 2W2MP 2ZH1A 1WEYA 2LXFA 1U0HA 3MTKA 3M1VA 4F0KA 1GFWB 2BRLA 1IKWB 2FVPA 1VRUB 2ZM6J 1CJKB 2GA7A 1RT1A 3AJDA 3SQOP 4PYDA 3P49B 5FIIA 1JLCA 3SSQA 4ICLB 3RYLA 3KJQB 4ES1A 4D3HA 2E5HA 1SJFA 2FZCB 3IMQJ 2GO9A 4ECUA 3MXHP 4USKA 1HNZF 1N0UA 3CJ4A 1A6LA 1CBKA 3HF5A 5CCLA 4D3GA 4HI2A 1I6JA 4ER8A 2F1FA 3BQ0A 3M30A 4KGMA 2LU1A 3BREA
chains in the Genus database with same CATH topology
1S49A 2YWHA 4Q5VA 2D3ZA 4NXNF 5HN0A 2R2TA 1UVJA 2MDAA 2DGXA 2FD2A 2OD6A 4CQ1A 3T6JA 3C6TA 3MECB 3GIJA 2UVVA 4ZLPA 3CULA 4A8YA 1WNEA 1S6QA 3TUZC 5L1LA 2K7JA 4B3MF 2YX1A 3JTPA 4DOZA 2AW0A 1SJ1A 4JBCA 2VG7A 1K73T 2JHEA 1UWBB 3NAHA 2ZHOA 3V81B 4QU6A 1JLBA 5K14B 1Q1KA 5KG2A 4PQAA 2C2RA 2EFPA 1F5BA 4JV1A 4O23A 3SEOA 4AUKA 2HHXA 4TY8B 1SBRA 4KR0B 5HMZA 3KHLA 1TFWA 3NMAA 4C8OA 1RKJA 2B9WA 4B3RF 4RWWA 2UUBF 2IBOA 3SQGB 3QZ7A 1GX6A 2NREA 3THVA 4ED7A 5MLCV 1IKVB 3GYNA 5HLFB 5KT2A 3GR0A 2COLA 1FKPA 2HRYA 3KK2A 2HLTA 4K4WA 3NCPA 3PIOQ 4YOEA 2L08A 4O3RA 2DPIA 2AYEA 3MM7B 4LJMA 3RRKA 4AFFA 3E3XA 1ZPVA 4JI4F 2MYFA 2E1CA 1FTRA 2VFVA 4HVZA 4KFBB 4YDXA 1RP5A 3FJ2A 5L9XA 4YQWA 3VAIA 1M90T 3CD7A 1Z1ZA 1R0AB 3PX0A 2CPIA 1X4FA 3VZIA 3GG0A 3OFGA 4C7QA 1T8EA 1KQGB 2XLKA 4IRCA 3CTRA 5HI7A 3QIPB 1ZM2A 3RZAA 2KVIA 2POKA 4CH0S 4O0IA 2CFXA 1R89A 2XG8A 4ZKAA 4YB1P 1VOMA 4TQSA 4UQGA 4DV2F 4A4JA 2KRRA 4Y2IA 1HPZA 1UAWA 3US5A 1MWZA 4IG3B 3GIKA 3I0RA 2DNKA 4J9QA 1VQKS 4ZK7M 5D4NA 1VRTB 1HI8A 2CQHA 3HP6A 3M8PA 2ZD1B 3DOMA 3I5CA 2UXDF 5GAHU 2GIRA 4X65F 4MIAA 2VOOA 4ED8A 1IKYA 1RT6B 2DO4A 1FJEB 1IUJA 2BANB 4E98A 4NXMF 4ZPWR 3O2IA 3IWNC 2YWFA 4IFYB 3CPWR 2ACYA 3B78A 3WZ0A 4QPXA 3Q24A 5IT9Y 1XC9A 3QWUA 2YNHB 2VFUA 4MIBA 4RWXA 3A8EA 3IA0A 3MDFA 2BQRA 4NPOA 1UP1A 3VTIA 2MHEA 2VBXA 4MK8A 2CJKA 4JV0A 2W8LA 1V3SA 2DGQA 4J9RA 3W3SA 1CC7A 3HHEA 2Q43A 2XNQA 1MSWD 2XGQA 1ZAWA 2W9BA 4N76A 3BN7A 3AB4B 2HQ3A 4LSNA 4ZDNA 5GMKa 2A1BA 1LWEA 2BVZA 2WSFC 4EBEA 2MZTA 4USJC 3OR2B 5JJBA 1RGVA 1R7IA 2ATLA 4X4VA 1S48A 1O8BA 2D41A 3MZIA 4NLXA 4OI1A 4DMZA 4ZCIA 4W90B 2PSZA 4ZPBA 4OX8A 4X66F 3GFHA 5FJ4A 4BC9A 2CKWA 2B6AA 1DAXA 2VG5A 2AYGA 2F8EX 3D1OA 1Q8LA 5KG5A 4ZCMA 2HW3A 4DSKA 2B4PA 2X51A 3KHHA 2LQ9A 3UPFA 1KHVA 5B0DA 1HQEB 2MKIA 5DG7A 3EPIA 3MR6A 2Q1LA 1FA0A 3JSYA 4MK9A 2I9SA 2E9TA 3FVYA 4QIWD 4WU2A