1S9EB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r129385
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL polyprotein [Contains:Reverse transcriptase]
total genus 106
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s9eB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s9eB02
4QPXA 3PR5B 1NHVA 3OL6A 5KFTA 1C0UB 5FDLA 2OPSA 1S6QA 4MIAA 4TY8B 5KG1A 2GC8A 1KLMA 4PWDA 3OSPA 3DLGA 4NLTA 3HVTA 1TL1B 5HBMA 3BSNA 4RW8A 3G6YA 3QZ8A 5J2PA 1FKOB 4QW9A 4K4VA 2QV6A 1HQUA 1S1XB 1S1VB 4WFZA 4O3PA 2YNIB 3QO9A 2RKIA 3DLEB 3DDKA 1ZTTA 2XGQA 4Y2AA 2B5JA 3MEEB 4ICLA 1EETB 4YR0A 4Y34A 4JUZA 4KKOB 2VG7B 3UDLA 1TKTB 3LP2B 5J1EB 2YKNA 2FVCA 4TN2A 3LAKA 2R2TA 1IKWA 3MEEA 1ZETA 4I2QA 2WONB 3H4BA 4XPCA 3CJ4A 2VG6A 4ZP7A 1SH2A 2YNIA 4ZMMA 1MU2A 5KFPA 5KFJA 2ATLA 3G6VA 1FKPB 3I0RA 3M8PB 1RYSA 1IKWB 1T05B 3DM2B 3MFHA 4H4MB 1T03A 2HWIA 3I5AA 3DRSA 4J9RA 4IDKB 1REVB 2WRMA 1S48A 5CYQA 5KFFA 5KT4A 5DGBA 5EWFA 3HHKA 5KFMA 1JXLA 5D3GB 4ID5A 3UR0A 3QLHB 3CJ5A 3CDWA 2OPPB 2ZE2A 4ZPDA 5KG7A 2AGOA 1S1UA 3TAMB 4IG3B 1HYSB 4ECQA 4PWDB 2FVQA 5KFSA 1RT7A 3H5YA 4IDKA 4KFBB 3JYTB 1DLOA 3BSAA 4TY8A 3KLIB 3M9NB 4EYHB 4ZP8A 3T5HA 1S6PB 2E9ZA 3BGRB 3IG1A 4Q43A 4F50A 1RTIA 2OPPA 3T1AA 3GYNA 1TL1A 1HMVA 2AGQA 3M8QA 5KFKA 1N6QB 5CYQB 4I7FB 4J9KA 3KK2B 2D3ZA 2BQ3A 3RAQA 2QE5A 3LP1A 4GC7A 3DOLA 4ZVHA 1RTIB 4M95A 3FQKA 1S0OA 2D7SA 3V6HA 1DLOB 5I3UA 3KLEB 1RTHB 2R2SA 2C2DA 1IKXB 4QWAA 5KFUA 1ZTWA 4R0EA 5J2NA 2UVVA 1LW0A 5C42B 4IH6A 5F8GA 1RA7A 5C24B 3C6UB 5J2QA 3H98A 2HMIB 1JLGA 3MR3A 3DM2A 5HBMB 5HROB 1I6JA 4B3OB 4ZVFA 3V6DB 4WFYA 1FKPA 4YMEA 4KV8B 1IM4A 2W9BB 4NRUA 3GIJA 4DG1A 4WYWA 2HNYB 4EBEA 4ED3A 5HLFA 3PHEA 3ISNC 4ICLB 5HROA 4B3OA 4EYIB 1C1BA 2W9BA 3KK1A 4NRTA 3QO9B 2W9CB 5F8IA 2J6TA 1LWEB 1JLCB 3KOAA 3CDUA 3UQSA 4HYKA 5EUHA 3LALA 3IN5A 1OS5A 2RDIA 2ZD1B 3H4DA 4RW7A 2ASLA 3NKYA 3FFIB 2OPQB 3I0RB 1C0TA 1TKZB 3M8PA 4RW8B 1TL3A 5K14A 4NLDA 2FLPA 4H54A 3KLHB 3KHHA 2IM2A 1J5OB 1TVRB 4IOBA 3DRPA 4KAIA 2WOMB 1LWCA 2FVPA 2W8LA 3EZUA 2ZE2B 1K1SA 1FK9B 1NNDA 4DL6A 3MECA 4MK9A 4YR2A 4KFBA 1RTJB 3MEGB 4ZHRB 3KJVB 3Q8PB 5KT3A 3V81B 1S1UB 1SUQB 3BSCA 3QGHA 5EWEA 1VRUA 3TVKA 1RT2A 2RF2B 4H4OA 4O3OA 4RNNA 4ECXA 4NLWA 5F8JA 2IM3A 4HKQA 2HNYA 4RUCA 3MF5A 3N6NA 4FBTA 2JLEA 1S1TA 4Y3CA 1BQMA 2B6AA 1EP4A 1HNIB 2IM1A 2XI2A 3T19A 1SV5B 4ZP9A 1JIHA 2HAIA 1S9GA 3H5UA 4FBUA 5C25B 4URQU 2XI3A 2FJWA 1CSJA 5J2NB 5L1KA 4IR1A 1RT6B 3QGGA 1DTQB 5KT2A 2GIQA 2YNFB 3KLEA 4KKOA 3C6UA 2R2UA 4RZRA 3UPFA 4MIBA 4IRKA 1HNVA 1RT1A 3D5MA 5KFNA 1R0AA 4PQUB 3V4IA 4RW9A 4O4GB 4RW4B 3T5KA 1TV6A 3PR4A 1JLFA 3JSMA 5C25A 5KFEA 4F4YA 4JV1A 4I2PA 5F8NA 3NAIA 1JLEA 3KLGA 3RB0A 2UVWA 4FS2A 5KFHA 3RBEA 3NBPA 4DG1B 3IGVA 5KG0A 3RBDA 3QGIA 1FK9A 4R5PA 4TQRA 3KLFB 1S0MA 4NLVA 2XC9A 2WTFA 3T5JA 1HARA 2BANA 2FJXA 4XPEA 3SI8A 4JV2A 3KJVA 1BQNB 2DPIA 1JLAA 3CJ3A 2WB4A 4XO0A 3QLHA 2IM0A 4EO8A 3NBPB 1RT2B 2RF2A 3MEDB 3BQ1A 1REVA 2IJNA 4J9MA 4IFYA 4RW7B 3JYTA 2R8IA 1U09A 5KFQA 3KMSA 2C22A 1JLQB 1RA6A 4ZP6A 3KLHA 1S4FA 3PJWA 2C2RA 1C2PA 1KHWA 1JX4A 3OLAA 3H5SA 4WZQA 4K50A 1S9GB 3DYAB 3KK2A 3QYYA 1DTQA 4I7FA 2UUTA 5KFXA 1TKTA 4Q45A 3OL7A 3DMJA 4Q0BA 1S1WB 4IG0A 4ED6A 2AX1A 2BE2B 2J6UA 1XR6A 2ASDA 1RYRA 4PQUA 4J9QA 3D28A 1RT4A 2ILYA 3I5BA 1RT1B 4TXSA 4EBCA 4RU9A 2D41A 3NAHA 4WE1A 4NLYA 2VG5B 4ID5B 2IBKA 2FLNA 1RT3B 4O3NA 4KE5A 3DLKB 1XR7A 5KG3A 1HNIA 4J9NA 3T5LA 3SFUA 4FS1A 3V6DA 4R8UA 4U7CA 2VA2A 3GIIA 4WZMA 5C24A 5J2QB 1N5YA 4DL7A 3DRRB 4J9LA 5L1LA 2GIRA 2VA3A 3QIDA 2VG6B 4KV8A 5HP1B 4O44A 2OPRB 1K1QA 1VRTB 4IFVA 1YVFA 4ED8A 1KLMB 4DL2A 2JEIA 5I42B 1N6QA 2R8JA 4K4WA 1C0UA 1JLQA 3EPGA 3NL0A 2W7PA 3GV5B 3LP1B 4RUAA 1KHVA 1VRTA 2RKIB 3DLEA 4ECSA 5DQHA 4KSEB 1QE1B 3OL9A 1T05A 5DQIA 5T14A 1TL3B 4RNFA 1S6PA 2YNGB 5I42A 1N4LA 4LQ3A 4DEZA 2ZKUA 3HVAA 4R5PB 4I2QB 2F8EX 2WCXA 4PUOB 2BQUA 1JLGB 3LP2A 4QWDA 2XCAA 1MU2B 4WE1B 3DI6A 1W25A 3CO9A 4LQ9A 4M94A 2AWZA 3KLVA 1D0EA 3KK1B 4ECUA 3Q8SB 2AX0A 4MK7A 3V4IB 5KG4A 2JEFA 2YNHA 3CJ2A 3IGNA 4KHMA 3MEGA 4ZHRA 3PW4A 5KFZA 2UUWA 5DG9A 3LP0B 2IC3B 5F8HA 3H59A 3CWJA 3M9OB 2ASJA 1BQMB 2B6AB 3BR9A 3N6LA 1TKXB 3MR2A 4NLUA 2HMIA 3C6TA 1Z4UA 4F4WA 3IRXB 1MMLA 5F8MA 2V4QA 3RB6A 4ECTA 3PVXA 3MR5A 1EP4B 4Q0BB 2BRKA 3HKWA 2W9AA 4ED7A 2R8GA 3FFIA 5EWGA 1LW2A 3KLIA 3PW7A 3DLKA 4NLQA 2VG7A 2OPSB 3PW2A 2EC0A 1HMVB 4YP3A 4ED0A 1LWCB 1JLCA 3DLGB 4KO0A 1SH3A 3MFIA 3ICLA 2CKWA 4WXOA 3GILA 1JKHA 3IS9B 4NCGA 3N6MA 4H4MA 1S1VA 4WFXA 3OHBA 4O3SA 4TQSA 3H40A 4G3IA 4O44B 4DL3A 4DL4A 3DMJB 1D1UA 1JLEB 4KHRA 2C2EA 5D3GA 4IQXA 3GQCA 2W7OA 4RNOA 5KT5A 5KFCA 4I2PB 1S49A 3DRSB 4LSNA 4RNHA 4ZVEA 2O5DA 2WK4A 1RDRA 4NLRA 5KFYA 3KHGA 2RDJA 5CYMA 2AGPA 4MFBB 1J5OA 2XGPA 4QWEA 3NMAA 4IH7A 3ITHA 5JUMA 4URGA 2E9RX 2HNZB 4WYLA 2OPQA 4NZ0A 2JC1A 4IFYB 3G86A 4R8UB 4IR9A 4Q44A 4J9SA 2BQRA 5J1EA 3QIPA 4URSA 5HLFB 3BJYA 3DRRA 2FJVA 3DOKB 3IRXA 1SH0A 5J2PB 1C1BB 3V6KA 5KFWA 2YKMB 3QZ7A 4ED1A 4K4UA 5KFBA 4U6PA 1IKVB 4K4YA 2R8HA 3DYAA 4ECVA 4ED2A 5L1JA 4LSLB 1S9EB 1FKOA 5DG8A 4F4XA 4H4OB 1JLBB 3MTKA 4PUOA 1JLFB 1SV5A 3JSMB 4ECZA 4X2BA 4DL5A 3PZPA 3ISND 3Q8RB 3DOKA 3LP0A 1RT3A 2AQ4A 2VG5A 3V6JA 2YNHB 5DQGA 2YNFA 1GX5A 2IAJB 1UWBA 1N56A 2WOMA 1WNEA 2OH2A 1HPZA 4QWCA 3RAXA 5C5JA 1LWFB 3M8QB 5KFVA 3ITHB 3LAMA 5I3UB 1QUVA 4MFBA 3HVTB 5F9LA 2HNDA 3KLGB 3DOLB 3Q8QB 4IH5A 3TAMA 4ECRA 2FVSA 3OHAA 1R0AB 3LANA 5HP1A 3NGDA 1UWBB 3PW0A 2I5JA 3GV7B 2ALZA 1T3NA 5K14B 4NLXA 4MK8A 1JKHB 3BGRA 3IG1B 3IS9A 4NCGB 1LWFA 4ZPAA 5KG6A 2FVRA 3EPIA 4IG3A 2ZD1A 1HYSA 1EETA 3MR6A 2UVRA 1RT7B 3MEDA 2B5JB 3RB4A 1RT6A 2JEGA 4NLOA 4G1QB 3OSNA 5J2MB 2XCPA 1XR5A 2JEJA 2J6SA 2B43A 3CDEA 4OL8A 1JLBA 4YQWA 2JC0A 3KK3B 3DRPB 4NLSA 2WONA 5KT7A 3BSOA 4NLPA 3I0SA 1S0NA 1LW2B 3KHLA 1RTDA 2WHOA 2IMWP 4MKAA 3GIMA 5FDLB 5KFOA 5DG7A 2V9WA 4O4RA 1LW0B 4RW9B 1RT5A 5C42A 5J2MA 4TYBA 5KFIA 3I0SB 2IAJA 1S1TB 1IKXA 3FDSA 4IRCA 3SFGA 4IRDA 3DI6B 3KK3A 3CVKA 2HWHA 3GIKA 4K4ZA 2IC3A 2BRLA 2V0NA 4RW6B 4TLRA 3KHRA 2XWYA 1HQEA 1BQNA 4ZVGA 4GC6A 4K4SA 4K4TA 5KT6A 2IA6A 4TYAA 5F9NA 5F8LA 4YR3A 3FRZA 5KFLA 3OL8A 4RNMA 3CIZA 1DTTA 1S6QB 4J9PA 4O4GA 4RW4A 2D3UA 3E51A 2YNGA 2R8KA 4KB7A 1GX6A 3QIPB 1HNVB 5KFDA 1SUQA 4F4ZA 1RTHA 2BR0A 1T03B 1DTTB 3PJXA 4ZPBA 4EO6A 3CJ0A 4ECWA 1TQLA 1RT4B 4MH8A 3BREA 4EBDA 1S9FA 2DPJA 3E01B 4Q8FA 3RB3A 1C0TB 1TKZA 1S9EA 4LSLA 3BQ0A 2E9TA 2R2RA 2BANB 4LSNB 1TKXA 5KFRA 1TVRA 4QW8A 2HNDB 3M9MB 2YKNB 1TP7A 1RT5B 2IJFA 1N5YB 4O3RA 2W8KA 5KFAA 5L1IA 1C1CA 2W9CA 1TV6B 2C28A 1HQEB 4G1QA 5EDWA 4KBIA 2AU0A 3TQ1A 4K4XA 4NYZA 4ZPCA 5KG5A 1LWEA 3GV8B 1S1WA 4IG0B 1HQUB 1S1XA 4J9OA 1QAJA 3HVWA 1JLAB 2YKMA 2ILZA 4IKAA 3I5CA 1QAIA 1C1CB 1N48A 1S97A 2V4RA 2CJQA 5DGAA 2BE2A 1IKVA 1NHUA 1RTDB 2I5JB 3C6TB 1RAJA 3BQ2A 3VQSA 4TY9A 4ECYA 5DLFA 2UVUA 3KNAA 1QE1A 5L9XA 5JXSA 3OLBA 1IKYB 1RTJA 3G6XA 4WXWA 3KMQA 2I1RA 2FLLA 3E01A 3MECB 4RW6A 2HNZA 3H2LA 5KFGA 4EEYA 4MKBA 1T94A 1VRUB 3FQLA 5DLGA 5KG2A 5CYMB 1S10A 3V81A 3PW5A 4Y2CA 3FSIA 1HPZB 4QWBA 4Q8EA 2OPRA 1IKYA 3H5XA 4NLGA 3KLFA 4IFVB 4JV0A 4KO0B 4O3QA
chains in the Genus database with same CATH superfamily
4QPXA 1FE0A 1Q8KA 2XZDB 5KFTA 1C0UB 3I9ZA 2ZVIA 1X0FA 4DL0C 4G1PA 5G4DA 2UXDF 2OAUA 3CCLS 1YBUA 3DLGA 4NLTA 3HVTA 1FA0A 2B9WA 3RU0A 2Y1RI 2OSQA 4RW8A 1VC5A 3QZ8A 5J2PA 2LKZA 3HD1A 4QW9A 4PG6A 1RWNB 5AXKA 4O3PA 1WELA 2L9NA 1B3TA 3RAMA 2E5LJ 4W90B 1HBOB 4CLLA 5A8KB 3QO9A 2DNNA 4MAKA 2HK2A 1HNZJ 4CO0A 4HT5A 3P3DA 3MEEB 4DUYJ 1WEZA 4C98A 4JUZA 2DNLA 3GYGA 3D67A 3UDLA 2XLIA 1TKTB 1Q4RA 4DBQA 4TN2A 1U0HA 2K3IA 2Q43A 1J5EJ 2YQ0A 5DRKA 3H4BA 3R3TA 4DQIA 4ZP7A 3ZO7A 1SH2A 1HBOA 1PYTA 2AYMA 1F6TA 4DV3J 1UTAA 2AJFE 2ATLA 1FKPB 3I0RA 3M8PB 2B9XA 2RSQA 2Y3YA 3RZAA 1LFPA 2OO4A 3JTPA 1T03A 2HWIA 3MTJA 4WFNQ 1F5CA 4FF4A 1X4DA 2EBGA 3QWUA 3B4DA 3QLHB 2PGCA 4ID8A 1Q7LB 1S1UA 1RU2A 3TAMB 2FC8A 4OLOA 1HR0F 1HYSB 2CQ2A 2RB7A 4DPYA 1FJEB 2FVQA 1BE4A 1CQMA 4GVBA 4UTGA 4KFBB 2XQCA 3SCJE 1XMOJ 3BDEA 4ZP8A 4JI4F 3CSKA 2GQQA 1R27B 2MZJA 2OPPA 3DLJA 1OSCA 2QLFB 4RWXA 5A8WA 5KFKA 1G3OA 1PGZA 3BPDA 2AEMA 3HFZB 4C0HA 1REGX 3G87A 2HHHJ 2VIHA 2XS5A 4FPIA 3W8GA 2BQ3A 2ZDOA 2QE5A 3BH7B 4QR0A 3PV8A 3DOLA 3A1YG 3IWNC 4ZVHA 1RTIB 3Q86A 2D74B 4AD6A 5IFMA 2XY7A 4ELTA 3J80U 2D7SA 2GJ2A 3MMAB 4GO5X 1MG7A 2VJUA 5IQQA 2E7VA 3FVYA 3LTOA 3MDFA 2V8GA 3ZZ0A 3HDSA 4OYIA 2R2SA 2C2DA 1GT8A 1HKAA 1ZTWA 2PSZA 2LXIA 2DNMA 3M6UA 3QT8A 3VAHA 1SJFA 1HBNB 1H6KX 2W2QP 3AODA 1RA7A 3AT1B 3H98A 5EHHA 4DV2F 2HMIB 4DR1J 1VC6A 3CIMA 3T41A 5HBMB 5HROB 3LPEA 4M5HA 3EZ5A 5BYSA 2UUCF 2RUSA 3LGNA 2W9BB 4OI0A 2OJ3A 1Q8IA 1BXNA 2GAGC 3M8YA 3GIJA 4Y2KA 2CVIA 4MYTA 2VODA 2DGTA 2NSCA 1UFKA 3PHEA 2C2MB 4H4KC 3VZHA 1MN7A 2G1HA 1X4FA 3VGVA 3RRHA 4C97A 4FVCA 1N88A 1N5TA 3MAHA 2CDRB 3M8RA 1X5TA 2FYXA 1NJZA 2W9CB 2J6TA 4GRSA 5D0RA 1UJ4A 1F2HA 2M9KA 1WDDA 1T02A 4MTPA 3UQSA 3W2VA 2XWXA 5H1SV 4USJC 2HFVA 1NDKA 1OS5A 5B0AA 1YJNS 1TK0A 2C3MA 2MKCA 2RDIA 3OFFA 2J0SD 1Y5LB 2BACA 4LBPA 5D4LA 2ASLA 5MLCV 1Y4ZB 1Q81T 1FHTA 2EI5A 5K14A 2AF6A 4K2JA 4NLDA 1O6XA 3KHHA 4B3SJ 1TVRB 4IOBA 2WB1D 4PG7A 4YEAA 1VBYA 2X1GA 1K73T 1LWCA 4U9RA 1F60B 3R5JB 2XYGB 5HMXA 1NXIA 1VRQC 1FKAF 4DL6A 2QEXS 2CJXB 2CZ9A 4YR2A 3TZWA 1UWAA 3UCGA 1RTJB 2N4CA 3ZXWA 3KG1A 3MXHP 2A18A 4P75A 1SUQB 4OX9F 2WTFA 5EWEA 4HTJA 3W2WB 4LSZB 5IWAF 4OJGA 4RNNA 1WC6A 3CJ8A 4ILMA 1VDHA 1FDDA 2DGSA 2BM0A 2QGFB 3BKFA 4AQYF 4F26A 2DIUA 4L3KA 2OD6A 4J37A 4RUCA 2IIHA 3MF5A 1ZM3A 2F63A 2DJWA 1UEUA 1MROB 4V1Ak 1GXLA 4Y3CA 3DCAA 1GMUA 3OBIA 2ZEJA 2ZBPA 2ZHAA 1JIHA 4DR2F 3M2VA 4DX8H 4FBUA 1PIEA 1RHQB 4URQU 1YRXA 2MMYA 2VFVA 2W2PP 2FJWA 1CSJA 3QT5A 4OFZA 1KC8T 4LF4F 5J2NB 4IR1A 1FCAA 3QGGA 2JWNA 2FJEB 2KO1A 2RE1A 4EMDA 3KLEA 1YHQS 4KKOA 3T9ZA 3W5YA 1Q5YA 4USMA 2VF3A 2MZSA 3GWCA 4RL1A 3IM9A 1HNVA 4O0IA 1EKRA 2CPJA 1Q78A 1UVMA 2MJNA 4FKYA 1R0AA 2G0IA 3V4IA 4O4GB 3OTCA 3QGPA 3PR4A 4C11B 3CC7S 2KFZA 2B7BB 3NAIA 1JLEA 1CC7A 1WACA 2EFOA 2GVDB 3HHLB 3KFWX 4EUVA 3RB0A 3NBPA 3RBDA 3S01A 1G2EA 1FK9A 2O67A 2VICA 3GZ7A 3T5JA 1ZPWX 2P8IA 1NU4A 3W7BA 4WF9Q 2WVDA 5GAHU 4OMFG 3KJVA 1CJKA 1Q8LA 4PYDA 2CPFA 4ES1A 3MMBB 2WB4A 3VGSA 4EO8A 3O8WA 4ZK7M 3A8IA 3NCPA 5IC4B 4DQQA 3AD8C 1REVA 2OTJS 1FWLA 1SKSA 3OQ2A 3JYTA 3KMSA 1JLQB 1ROFA 1NEEA 1U2RA 2Z57B 4NZ7A 3PJWA 4PKDB 4X4TA 2DYAA 1C2PA 2A2DA 4N56A 2C2RA 1GMWD 1JX4A 3QBCA 5H9FK 4K50A 1M5PC 1S9GB 2NYIA 2B9YA 2YVSA 4I7FA 1A6LA 1VIOA 2P5VA 3ZTRA 1U4BA 3KYLA 1Y10A 5KFXA 4FVMA 4M5NA 1WG4A 3LGMA 3WIVA 4LMZA 3DMJA 3LO3A 1S1WB 4IG0A 2GVZA 1SQEA 4JI7J 2CFXA 1XWLA 5JVGQ 3EX7B 2B8PA 3MM7B 3CPWR 1UW4A 1P27B 5THWA 2KXHA 4RU9A 1SB6A 1NMEB 2V8PA 4MT1A 2HVZA 2BX6A 1RT3B 1Y3KA 2KRBA 1WC0A 2UZAA 5KG3A 3N5FA 4A46A 3T5LA 2CPIA 2KVIA 3V6DA 3GTYX 2KJWA 4C2MA 3SBMA 1XK8A 4O0NA 5J2QB 2R7VA 4IO9Q 2HWTA 1FDNA 2K8GA 3DRRB 3WC2A 3M2RB 3HK2A 4PR6A 2VG6B 4P73A 4KV8A 2B7CB 2PI4A 2ZVSA 5K8NA 4DI6A 3F0NA 2EFPA 1VRTB 2F3JA 4YB5A 3RBZA 3NGRA 2JEIA 1X9MA 3CB4A 2ZH9A 1N6QA 5GAGU 3DDNA 3R2DJ 3SDEA 4QR2A 2M7SA 4M8LA 3VAIA 5E7OB 4C8MA 3EPGA 2FB0A 4JB8B 3WC0A 3NL0A 1F9EB 3M6XA 1CEZA 2XYHB 2UUAJ 4BC9A 1FESA 3B82A 5DQHA 4M5MA 4P74A 1RU1A 4HHHA 3MPYA 5DQIA 5T14A 5HMYA 2N3LA 5CH7B 4UZBA 1S6PA 1FTCA 1WTBA 1N4LA 1FFWB 2ROEA 1SBRA 3PCOB 4CZCA 4LQ3A 5G0RB 4TU7A 4PUOB 4OX8A 1JLGB 1E6VA 2BQUA 4A8FA 3LP2A 1I3OB 4UOFA 3NGSA 4WE1B 2ZC3A 3DI6A 1XMQF 3A12A 4LF4J 1D0EA 2DCLA 5F0UA 1FRXA 4F2SA 2AX0A 3G8QA 5KG4A 2YH0A 4KHPF 4TVAB 3IGNA 4CYUA 2CZVC 4ZHRA 3HFKA 4B08A 3HT3A 3PW4A 2UUWA 3H5XA 5F8HA 3NOGA 4ZJLA 1MWZA 2NXUA 1B99A 3OXLA 5HQ8A 1ZS6A 2UUCJ 4L74A 1XERA 4DV1F 3N6LA 3SYZA 1CJTA 3ISZA 1ZBTA 4X66J 2BE9B 2FJBB 4NI2A 3FC9A 4UZCA 1FWPA 3RB6A 4I67A 3B6BA 4ECTA 1KTVA 1U1PA 1KP6A 4OI4A 2BRKA 1RWOB 3HKWA 5B0FA 2W24A 4ED7A 3FFIA 4M5LA 2HHPA 4JOUA 2BJ3A 4LT6A 5ETNA 4CNYA 4P7TA 1AUDA 1Q16B 1NK9A 3QQCD 1NKEA 2ZOFA 2ZOGA 4ED0A 1D3WA 4JV5F 2RUGA 5H9EK 2XMMA 3MFIA 3DKDA 2CKWA 3PHTA 4CLSA 1L3UA 3AJ1A 1JWWA 4B9LA 3OHBA 4DV6J 2EEYA 1NB2A 3ILOA 3H40A 1NJWA 4O3SA 5KTQA 4DL3A 4DL4A 4QCLA 3G2XA 1LNQA 2PD1A 3JQJA 4UOHA 3GQCA 4DLGA 2W7OA 3S6EA 2AD9A 1SC6A 3FEZA 2N4DA 4I2PB 1S49A 3DRSB 1AXQA 1Q95G 1D8ZA 2WK4A 3MUMP 1Q1KA 4E2FB 4M5IA 3J81U 1FJ7A 4I56A 4L75A 1P9YA 3TYTA 3RRKA 1D9AA 3ITHA 2FHJA 4IH7A 4QWEA 3EYZA 3P5BP 2EBEA 3NGTA 5SZTA 3HSJA 4C6AA 1PBAA 1PKUA 2NXCA 2XO6A 3M2UA 4DU7A 3LF0A 1N54B 3EVMA 1D8YA 1Q79A 1UZHA 1B7FA 4R8UB 1MW7A 1D09B 2BQRA 1F5BA 3QIPA 1WI8A 5HLFB 2L9DA 4YHHF 3S1TA 2MGZA 4PG4A 3R5CA 3BJYA 2P6TA 2KZMA 3IRXA 4DHVA 3UVJA 2JFKA 3NMRA 4FXVA 4K5SA 2YKPA 5K8OA 1S7IA 2W2MP 4ZN1A 4DX6A 4LF5F 1APSA 3QRQA 3PACA 1CJUA 1IKVB 1DQ8A 5T41A 3DYAA 4U6PA 5L1JA 5A0YA 2F65A 1FKOA 4ECZA 1JLBB 2OI2A 3C16B 1JLFB 3D68A 3PNIA 1RHKB 5B09A 3KJFB 2P2CB 4O23A 3MURP 3TAQA 5CAAA 1YWXA 3LP0A 2CJKA 1MSWD 1DBDA 1CQNA 2VG5A 1WHWA 2LDIA 1S57A 2VPXB 1VBKA 4OYXA 4C3LA 2AJ2A 4W92B 1RADB 2IAJB 4R0JA 3DU5A 2WOMA 3GJTB 3N01A 4C8YA 4HI1A 3RAXA 3CCQS 2GMJA 1SC1B 1LWFB 4LF8F 1T0TV 4PCQA 1VQMS 3SMZA 1LWXA 2NXNA 3D3CJ 4MFBA 3HVTB 2HFZA 1SL1A 4RUBA 4OHVA 4QIGA 3DOLB 2DD8S 3PM9A 1QTMA 1VQ7S 1JMTA 3WQPA 4ECRA 3OHAA 3BYRA 2EFNA 3W9HA 2I5JA 1W26A 2YX7A 1IR0A 1WG1A 2CQBA 3IS9A 3BGRA 5L39A 1S79A 1LWFA 1H2VZ 2FVRA 4ED4A 4IG3A 2ZD1A 3EPIA 4CM2A 3VAFA 4DF8A 4DV0J 4M5KA 1P9QC 3HZGA 4WWSA 2JEJA 2Y9HA 3PY8A 2G4BA 1WWHA 2RIJA 2JC0A 3KK3B 2ZFHA 4P9SA 1VBZA 3DRPB 3GG1A 3BSOA 2Z2YB 4QU6A 2J5AA 3IBCB 1S0NA 4YB1P 1WF1A 2ZH8A 2P9EA 3M2RA 3R9LA 3GIMA 1TAUA 1FRHA 2MLZA 2NPFA 5KFOA 1YX2A 2ZH2A 2V9WA 2GMHA 4MKYA 2GQCA 5C42A 4RW9B 3E8OA 4ITSA 2Z8QA 1NSQA 1U1KA 3I0SB 4WFAQ 5I3QA 2CJBA 3TZYA 1AZSB 2W1BA 1IKXA 3FDSA 4I6WA 4IRCA 4C8OA 3CUNA 3KK3A 3TUZC 3ZZUA 3CVKA 2Y1IA 3GIKA 3I6PA 2PMHA 4YY3J 1JJCB 3B78A 3FJ2A 1TTHB 3CC4S 4CIOA 1CS4A 1BQNA 2DHGA 1NDLA 2E5IA 2QT7A 3K0JA 3WIUA 1ITPA 5HSPA 2IA6A 1HHTP 1VQ4S 1YRTA 2QMXA 1S12A 4Y65A 3MOZA 1BD6A 1U47A 2E66A 2HZAA 5F9NA 2WAQD 5F8LA 1M90T 4GKKJ 4WKYA 1NK5A 2VBXA 4XIUA 5KFLA 4KTQA 1WTFA 3KNGA 4RNMA 2QG9B 2ACMA 5G0RA 1Y5IB 2KXFA 3VALA 4RW4A 2HRTA 1QJHA 2B4VA 3H25A 1GTEA 3W3SA 4KB7A 2BA9A 3IRWP 1YSJA 1YITS 1S0VA 1SUQA 2JZ5A 2HS0A 2PE8A 4F4ZA 3MD1A 3GE9A 2BR0A 4F3MA 4ZLPA 3TI0A 3DHXA 2DO0A 1H74A 2GGPA 3M32B 4PYAA 4OX9J 1SQFA 3E01B 1E6YB 1C0TB 1S9EA 2BANB 2IRXA 2NXJA 3SQOP 5KFRA 3TEGA 3VVTA 3W63A 2KM8C 2HNDB 2K3KA 1RT5B 4N8OA 4WP9A 4P7VA 1FE4A 2RJZA 2W7AA 5E2QA 2L9WA 2W8KA 4O3RA 2R7SA 2IDLA 3R7NB 4BHQA 2LQJA 1QDUB 2W9CA 1TV6B 1ZZNA 4PABA 1Q0NA 1HQEB 1RJJA 1Y0HA 1F9FA 2HKEA 2QLXA 1F1BB 1UL3A 2AU0A 2CNNB 1O0PA 2E1RA 4Y6IA 4DZDA 2V9KA 3PYGA 4F67A 1NK0A 1FXDA 1TUWA 1U8SA 2JOQA 2VBYA 1RHUB 4W98A 4CLPA 1S1XA 4KC5A 4K59A 4OZ5A 5BR8J 2ZJPQ 4YFUA 1SPBP 2CAJA 2NLWA 3D3BJ 2BVZA 3I5CA 1A0OB 3OUYA 2CQIA 2ZUGA 1S77D 2AZ3A 2E5HA 2K7KA 3IMQJ 1NHUA 4USIA 1UVNA 1V5VA 3VQSA 4DQPA 1MLAA 1FX2A 3N0VA 4ECYA 3CJRA 5LM7E 1QE1A 2UXBJ 2WZ1A 3OLBA 1OYDA 1RTJA 2BKPA 3IBWA 1V9OA 3G6XA 4A8SA 1NK7A 1ELOA 3QAUA 5HMZA 1I94J 1EZZB 2DGOA 2CVEA 3VTIA 4J9VA 4MKBA 4JV5J 1T94A 1VHIA 3W2WA 1P1LA 5DLGA 4DJBA 1WOSA 3TA2A 4WCEQ 1HPZB 2BKOA 2OPRA 3SV3A 2LFVA 2RQKA 4JV0A 4KO0B 3TP2A 4ELVA 1UMJA 4ANCA 3M7VA 1NHVA 7FDRA 4UY85 3OL6A 4X65F 4K2XA 5FDLA 1DQAA 4MIAA 1S6QA 4P71A 3JAMU 1FTRA 1VCTA 2BJ7A 2GC8A 2OGUA 4YB7A 2BJDA 5HVFA 2CUYA 4B9MA 1TL1B 2HQ3A 3FMBA 3G6YA 3BSNA 1UCNA 1X4CA 3BDPA 2OFHX 3MPUB 1FKOB 5GAEU 1TL7B 3D6TB 1S1VB 4D3GA 3Q2TC 1RAAB 1U6BA 2C2ZB 4OHWA 4DV4F 1QVFR 3Q22A 2HZVA 2AJ4A 1YG0A 2NUHA 3NS5A 2LP4A 4Y2AA 2B5JA 3UNYA 2GHVC 3AQPA 4ICLA 2DNQA 4EU0A 4ZIWA 1F9HA 2ZH5A 2CQCA 4QIEA 1U25A 3TUPA 3D4JA 3QJPA 3P5TL 3M8WA 2KHDA 3J7A1 4B17A 1ZETA 3K57A 4DPUA 4I2QA 2WONB 3O3LA 3G71S 2IRYA 2HHQA 2V2VA 4LF2A 2VG6A 5KOXA 2DGXA 4DR2J 1NDCA 3POTB 4Z7YA 4ZMMA 3BGOP 1U1MA 1NUEA 2EG2A 5KFJA 2HSEB 5HI7A 2RQCA 1RYSA 3EWGA 1VQ8S 1T05B 5L8RC 4CT8A 1ZZFA 4H4MB 3K89A 3MFHA 3I5AA 3DRSA 2IJRA 1YK9A 1REVB 2KU7A 2WRMA 3MM8A 4TLQA 4A8YA 5KFMA 3UCZP 5D3GB 4ID5A 1RCXB 1F0XA 2W01A 3TJ9A 2OPPB 1X7VA 4P6QA 2ZE2A 2AGOA 1NAQA 3K2YA 2HRYA 4RLEA 2FY8A 4IG3B 4ECQA 4WJBA 1G6BA 3H5YA 2QX0A 4IDKA 3KLIB 2XB2D 1S6PB 3IG1A 4Q43A 1RP5A 3T6JA 1RTIA 1M5SA 3M8SA 1HMVA 3B54A 3MM8B 4I7FB 4YOEA 1AW0A 4HI2A 2VQEJ 4GC7A 1I1GA 1NZ8A 3F44A 2B3TB 3R5AA 3LWMA 3J7ZT 4X4QA 4V19X 4A48A 3MM5A 2Z2MA 2B51A 3SZ2A 2HLTA 2F9DA 3GMGA 3KLEB 4MKVA 2F4FA 1RTHB 4WTYA 4JI0F 1IKXB 1Z2ZA 5KFUA 1WKKA 1RBAA 1KTQA 2JLFA 4R0EA 5HMWA 4X4PA 2HS4A 1KRPA 3HHNB 3W5XA 1LW0A 4IH6A 4AYBD 5D8HB 1MWQA 3I4HX 3ZTOA 4B3TF 4EZ6A 4F4AA 5J2QA 3HI9A 4JI2J 1AA1B 3D7SB 1YJVA 3U1NA 4DQRA 3CULA 1I6JA 4NA3A 2V50A 3AFGA 1FKPA 3AH6A 4KV8B 1IM4A 4YMEA 1N0VC 1FRMA 2HNYB 1S7HA 1H2UX 4ED3A 4RKUC 4XK8C 3GP9A 3CCVS 2HHWA 3SQGA 4ZPWR 1X4GA 1FT8A 1GAOA 2JSXA 1IM6A 4NOHA 4B3OA 3RTVA 3DXSX 1X5SA 1C1BA 2JH3A 3KK1A 3MUVP 4NRTA 2IHR1 1H98A 1LWEB 3K17A 1SC4B 1U1LA 3KOAA 2E1AA 4RX6A 3U1MA 6FDRA 2AYGA 5EUHA 3HO1A 1HFEL 4KY3A 4CM0A 1QUPA 4DPOA 1B70B 4ES2A 3IXQA 2ZD1B 4ECVA 3H4DA 2EC2A 3NKYA 4BBYA 2OPQB 1NO8A 2QFIA 1C0TA 4RW8B 1NM2A 3UW1A 5AE3A 2FLPA 3KLHB 5DZ7A 2OTLS 2IM2A 3GCWP 1BC6A 3LQVA 5LSLA 1CJVB 1HBUA 2MQ8A 3DRPA 4EWTA 1YJUA 1ZOTA 4KGMA 3GSIA 2FHJD 2DXFA 2IPOB 3EZUA 3PIOQ 1GMVA 1H0HB 2QO3A 2DR5A 2V63A 4GVLA 8ATCB 1ZM2A 2F8HA 3N28A 1T9XA 4MK9A 1SVDA 5LMUJ 4ZHRB 3Q8PB 5IXUA 5KT3A 1D9DA 4EK2A 1HD1A 3TR5A 3QGHA 1VRUA 3TVKA 1RT2A 2RF2B 3CCES 4DR6J 2EKYA 4NLWA 1HNWJ 3G9CA 4F25A 2F9JA 1GEHA 4FBTA 2JLEA 3IC1A 1CJUB 1G4CA 4DS5A 3ILIA 5ETRA 1DURA 2GZOA 3FCHA 4P2SA 3EJMA 3GFZA 4PRFA 1URRA 3J7AN 3T19A 1WKJA 2CPHA 1RACB 2CWXA 2HAIA 3AB4B 2RRAA 4YDDB 1F3FA 1RGVA 3NGKA 3VAMA 4H4KA 1BLUA 5JVHQ 1M5OC 5KT2A 3CCJS 1DTQB 4CO4A 5LMNJ 4WFBQ 3TA0A 2ZBIA 1TK8A 1T3OA 3KJNB 3C6UA 3QJJA 4RZRA 4N41A 2B8QA 4AXJA 2JL9A 1RT1A 4NXNF 4OYBA 3D5MA 4OZLA 3VZIA 5KFNA 4PQUB 3JSMA 3I32A 5KFEA 1G7CB 4I2PA 2IDEA 4AL6A 3VF0B 4JI4J 4X4NA 3D0GE 5KFHA 4KGKA 4DG1B 2VU5A 4QQBA 1S0MA 3KLFB 1HA1A 1YZ7A 2KM8B 2NR0A 1VQYA 2BANA 2FGOA 4XPEA 4WK3A 4Q2MA 2DPIA 3TO8A 2FHOB 3GYXB 3T1HF 3K5PA 3R8YA 2W4DA 3ENWA 2CIMA 5EGYA 2VKRA 2R9LA 3OPKA 3UCUP 4EGLA 4A4JA 4RBUA 4RW7B 3DRYA 1VJQA 4ZVOB 4WTOB 4J9MA 3R1LA 2R8IA 1U09A 4DV6F 2H1YA 4DV0F 4F8RA 4ZP6A 1N5SA 3PYEA 1S4FA 1KHWA 2CQHA 3DC2A 3RYLA 3EMTA 5LSOA 4WZQA 2BJ8A 1TFYA 4ZIVA 3DYAB 2RS2A 3JTOA 3KK2A 1VQPS 5K5MA 2AJ1A 1FJGJ 1KNZA 5IT9Y 3HF5A 4C8NA 1VOMA 2AEFA 3AQOA 3DNCA 1SL2A 2HRUA 1TKTA 1TFWA 2DR7A 5D15A 2HVEA 5LXYA 2J6UA 1VK3A 2Z0GA 1XR6A 2ASDA 1HI8A 1RYRA 2CQ0A 2CQDA 4J9QA 1UW9A 1RT4A 2ILYA 2HPUA 4QU7A 4HL9A 3HULA 3MAAB 3NAHA 2BMBA 3UR3C 3TUJC 2VG5B 4ID5B 4NL5A 4USVA 4CH0S 3K58A 2IBKA 2ZM6J 3DLKB 1VK8A 5FIIA 3OTOF 1KN6A 1HNIA 1SQGA 3A8JA 4J9NA 4JI6J 1OO0B 2EFGA 3GJRB 4NASA 2H3EB 2MKKA 3GIIA 1IBLJ 2VA2A 3QFHA 5C24A 4DX7A 4BC7A 3LA0A 3E2EA 1HWKA 1NB7A 2RD5C 1N52B 2OD4A 3D54A 1KBRA 3OXGA 3QIDA 4USWA 2MQOA 4O44A 3NWRA 3OD2A 2AYEA 4ED8A 4IFVA 3R2CJ 1FWKA 3U7JA 2VV5A 3AXMA 3S8SA 4WU3A 4K4WA 1C0UA 4B3MJ 2LDYA 3IR5B 1JLQA 3MM6A 4FYVB 2FJDB 5K8MA 1AFIA 1T95A 4DN0A 4WP8A 3W61A 2W7PA 3GV5B 4WPAA 4RUAA 2CQ1A 3BGFA 1WI6A 2CJ9A 4U96A 3M30B 3IAS9 2MSTA 5M2RA 4CLWA 3MHYA 3GFXA 2H51B 1TL3B 1WC5A 2D69A 3DDIA 3D1HA 2YWGA 3P96A 5ADZA 1KD1T 4DEZA 2VQEF 1YJ9S 1KOOA 4R5PB 2GIFA 4ANDA 4I2QB 2F8EX 6FD1A 1VYAA 2MZQA 3CCMS 3C16A 4IQMA 4LR8A 3HSGA 3Q23A 5CABA 4QWDA 2RQMA 3V5RA 4J7CA 1V3ZA 4L73A 4LQ9A 1QLNA 3HHLD 4M94A 2AIRB 2ZZTA 4JP8A 7FD1A 3KK1B 3RBXA 3HT0A 2DR9A 3V4IB 1B0PA 3SCIE 3K7RA 2Y1LB 1K0TA 3L4BC 3MEGA 1KKHA 1V3SA 2EVZA 2WSFC 2IC3B 4DR1F 2DR8A 3QT7A 3H59A 4WK1A 4X4SA 2LQ5A 3M9OB 2ASJA 3TOQA 2VC1A 1BQMB 2B6AB 3R1HA 1TKXB 5BJRA 4IOAQ 1FJCA 1C4AA 2HQFA 2HQCA 4PWUA 4CLYA 3HCXA 5DJBA 1XJWB 2MLXA 2VDHA 2XHWA 4PZVA 4CO3A 1JXEA 2RMLA 2V4QA 3V4MA 2Y1JA 2GO8A 1NJIT 2DRAA 2BYCA 2V5HG 4FNHA 5T7LA 1Q82T 2R8GA 3BB5A 1LW2A 2NZ4A 4DV7F 3GSDA 3U02A 1DRZA 1RUSA 4ZITA 2EC0A 4USUA 1WSVA 3ET6A 1T9WA 1KVJA 1LWCB 3DLGB 4KO0A 1PYOB 1SH3A 4UQTA 4Y00A 3BR8A 2ALYB 1RBOB 4OQJA 1JKHA 3N6MA 2YX4A 1VQOS 1YRUA 3P8BB 2X3DA 4K8RA 4K5RA 4TQSA 1NPPA 2KKHA 3DMJB 3TANA 3D6MB 3K5MA 2G0CA 1U24A 1OQ3A 1RKIA 5KFCA 1QTNB 4RNHA 4LSNA 4IRKA 3D1QA 4HACA 2RDJA 1IBMJ 3HHEA 2B9EA 4ZLJA 1J5OA 5HATA 1TL4A 5HANA 2VD3A 4FP9A 2XGPA 2PI5A 1X0PA 2P6SA 4L76A 5JUMA 2QTWA 3W1YC 2E9RX 3QRPA 2ZBCA 2K7JA 2LA4A 2C2OB 4NXMJ 2ZKTA 3OFHA 4DV4J 1CJTB 4IFYB 1FDBA 2BBEA 2DNRA 2FHKA 3E3XA 1U2CA 5ETOA 1HNZF 4J9SA 4IR9A 2VDIA 3PXGa 2FQQB 1R8CA 1F5AA 2IVYA 3K5OA 1CLFA 5B0GA 1T11A 3DRRA 2FJVA 3DOKB 2PA3A 3OXFA 1B0VA 2HVHA 3L9ZA 4ALZA 4NZ6A 3OUYB 4JI6F 2YKMB 1FXRA 2J7KA 4ED1A 4AUKA 2DH8A 1R8HA 4KGXB 2QMUB 2CRLA 4UF4A 4LSLB 2MZTA 3C19A 4ZPVR 5DG8A 4H4OB 4UOCA 1S59A 2ZOMA 1SV5A 2HIQA 4X2BA 2FJAB 2V8VA 5A6WA 4DR3J 2KT5A 3BF4A 3JSRA 5LMNF 3Q8RB 3WBZA 5F41A 3DOKA 2FGCA 3AJ2A 2QA2A 1KEKA 3THPA 2AQ4A 3V6JA 1WF2A 2YNHB 4WIIA 5DQGA 3FRYA 2LXUA 3N9UC 3DGPB 5F3ZA 1JNZB 4LVNP 2VHGA 1UWBA 2PT0A 1U1RA 2DITA 3MMBA 1N36F 1VGYA 1GTHA 2QA4S 2ADBA 3RR7A 2NQPA 1PJ7A 1XBWA 3M1VA 5KFVA 3LWLA 3ITHB 3LAMA 3H42A 2KZZA 1HNXF 5F9LA 5ETTA 3J81j 3CJSA 2HNDA 4W4MA 4UUXA 3KLGB 5DM7Q 2X51A 4FKXA 4IH5A 3HMJG 4DSKA 1H38A 5DO2A 3T1YF 3T1HJ 2FVSA 1IBCB 2LYVA 3LANA 5HP1A 4CLUA 2M3DA 1UWBB 3PW0A 3C15B 1T3NA 5E3PA 4F04B 2ZH1A 4NLXA 1BQXA 4NCGB 2Z2ZA 3Q0AA 3QFWA 2M4MA 1RLCL 3H2VE 1RT7B 3MEDA 4DPWA 2UVRA 1NKBA 4NLOA 4G1QB 2CNOB 4QJVA 2MQNA 3OSNA 3CMES 5A0YB 1KSPA 4JI8J 3CDEA 1KFDA 1OY6A 4OL8A 1JLBA 3PRVA 3J7YU 1IUJA 3CCTA 1LK5A 3VAGA 4DR5F 1Y7PA 5KT7A 2WONA 1NBEB 5ETSA 5B7WA 4NLPA 3I0SA 1XEZA 2CXEA 2DXDA 4ZPTR 3KHLA 3HJFA 2WHOA 2DY9A 1R0CB 4MKAA 1BUXA 3QSYB 1X31C 4KIAA 2FC9A 3LOUA 5DG7A 4OJ3A 2KH9A 1RQ0A 4O4RA 1ZAXA 2YH1A 4G1IA 4TYBA 4CNZA 3L3CA 1PJ6A 2IAJA 1S1TB 5RUBA 4F3OA 3NXZA 4ZVSB 4GKJJ 4B3SF 4K4ZA 2HWHA 4G6VB 4IUFA 2JX2A 5LJ3Y 5EN1A 1HHSA 2U1AA 2PO4A 2ABYA 3IWXA 4TLRA 2QA4G 4OZJA 2X3GA 3A8KA 4CTAB 4DZ6A 4K4TA 4K4SA 1VIXA 3BH6B 3FCVA 3SSRA 2DY1A 5IT4A 1Z1ZA 3MR7A 1BWVA 2GHPA 2BE7D 3FUYA 4M63A 3IWLA 4TYAA 2D3OR 2BJEA 3P49B 2DK2A 1BGXT 4HHUA 3FRZA 2OMOA 1GK8A 3CIZA 3ZZRA 3E51A 1NKCA 4ER8A 1UETA 1RAEB 1XTZA 3GLJA 4D3HA 1T8EA 2E1CA 3QIPB 3HD2A 1FFGB 2HG4A 3SSQA 5D6GA 1HI1A 1RTHA 2Y0BB 1FDAA 3W66A 3OV7A 2H48B 3PJXA 4HT7A 3DLHA 4ZA1A 3G8TA 4ECWA 1TQLA 1RT4B 2EPIA 3BREA 2CZ4A 2XMKA 4EBDA 1S9FA 5IWAJ 3R5BA 2BOPA 3MI7X 1TKZA 2LXFA 2YWFA 3CMQA 2RRNA 4LF9J 3BQ0A 2CA9A 1TL5A 2R3VA 1TKXA 4C9DA 3THVA 4CLFA 4PEOA 2IJFA 5HO4A 2VBWA 4DPTA 5IT0A 2KVQE 2ZC4A 3OR2A 5KFAA 4AT1B 3JSBA 1WOOA 4I0WA 3B4MA 3PIPQ 4I64A 5AXNA 3TZXA 4LUBA 5CZVA 5GMEA 4KBIA 5D77A 4A8OA 5CYJA 2N3OA 1FO1A 4DFKA 3TQ1A 4K4XA 4TKTA 4NYZA 4ZPCA 4B3RJ 5KG5A 1Z2LA 5FJ4A 4DV2J 2B4PA 3FBBA 1HQUB 4OYOA 3UFCX 4J9OA 2LCWA 4CT9A 3AJDA 4FF3A 4NA2A 4C7QA 3ZTSA 2WVBA 4NE9C 4LF7F 4DV5J 1SI9A 1N48A 2UU9J 1DQ9A 3A4TA 1EJ7L 1PILA 2CJQA 2Q6CA 4LRCA 1S97A 2FPHX 1WC4A 3EXCX 1AROP 1RTDB 2I5JB 2VFUA 4I6AA 5I3PA 5J1NA 5GAEI 3BQ2A 2SXLA 1TUGB 4DV7J 2EFQA 2HW3A 2P9GA 3NRBA 4LJMA 5JXSA 1FFSB 3C8YA 2DIVA 4WXWA 2I1RA 2FLLA 3E01A 1E6YA 1FERA 4RW6A 3BBCA 3H2LA 3JS9A 3PRDA 4ZCLA 8RUCA 4EEYA 1VRUB 1KDNA 2BUNA 4Y2IA 2IMOA 2CQ3A 1S10A 1UKUA 1IXKA 2MPUA 4DUTA 3BEGB 4Y2CA 4QWBA 2J0QD 4Q8EA 1UVJA 2PC6A 4EBCA 1DFDA 3QSIA 3W64A 3Q83A 3HX9A 3KKFA 4NMLA 2OPSA 4TY8B 5KG1A 3CF5Q 3TWZA 4PWDA 2BABA 1TELA 3U27A 3OSPA 3CD7A 2HQDA 5HBMA 3FNNA 3AA8A 4Y28C 1J27A 3VCDA 4K4VA 1S1XB 2ATCB 3UD4P 3BBBA 2YNIB 4U8YA 2RKIA 3DLEB 1RAHB 1O51A 1ZTTA 1ICEB 1CS4B 1JXVA 1RB0A 1R89A 2C3YA 2OHDA 3BGLA 2XGQA 2KI2A 1AB8A 4DR4F 3I9V9 4FF2A 2HHSA 4AQYJ 1EB0A 4KKOB 1VFJA 2DHHA 5D4NA 2LU1A 3ETMA 5E5NA 5J1EB 3TX0A 2YKNA 1Y9OA 2FVCA 4KJIA 2E44A 3LAKA 2R2TA 2G2YA 5AE1A 1RWKB 1B64A 2C3UA 3W65A 4XPCA 4DX5A 3CJ4A 1XNRF 4C8ZA 2YNIA 3EGWB 1MU2A 5KFPA 2L41A 2A2CA 4IOCQ 3G6VA 5GADU 1YI2S 2VFSA 2KYXA 3G82A 2D9OA 1IKWB 5B0EA 2YKOA 3C14B 3DM2B 2Q6BA 1MMNA 2DVIA 3GG0A 4FYXB 4IDKB 4LR9A 4ZCKA 4J9RA 1JXLA 1UA0A 2E7XA 4J9UE 3HHDA 3GJSB 3UR0A 1TMJA 3CDWA 3CCSS 2AEJA 4ED2A 2HGMA 2WW4A 1CC8A 4NEYA 5I4MA 5KFSA 1RT7A 3JYTB 1DLOA 1RWXB 2Q1LA 3BSAA 3FBCA 4EYHB 2XY5A 2V69A 2LQBA 2KL8A 3RG6A 3BGRB 2E29A 2GA7A 3G82B 4PG5A 5U47A 1F3VA 2VFRA 2XMTA 4F0KA 4F50A 1TL1A 1K8AT 2AGQA 3L09A 4HH1A 2KJVA 4DF4A 1LKZA 3VGUA 5LSRA 2GNKA 4J9KA 4JI1J 5DS7A 1M0SA 1RISA 3KUGA 2FIUA 2LQ8A 3LP1A 2Z4PA 3AOAA 3BGUA 5LXRA 4DR7F 3D1OA 4M95A 2V2QA 1S0OA 2GS8A 3HJVA 4XDCA 1DLOB 5I3UA 2DEJA 3NEKA 4A8QA 4ZVTB 1Q5VA 4RUHA 4LFCF 1UJ6A 3MAAA 1NPRA 5E3QA 1NK8A 5J2NA 2XMUA 1J2VA 4JI8F 2CDQA 5C42B 2UVVA 2K1RB 1VLYA 3F73A 3P45B 5C24B 3WZ0A 4QYRA 5BR8F 1VJWA 3HVRA 4B3OB 3KUEA 4ZVFA 1QSLA 3V6DB 2R7XA 3PFEA 4NCAA 4NRUA 4DG1A 2KB2A 4ETXA 3MPWA 1H7WA 2XBPA 4Q7AA 2W4PA 3SSSA 1X4BA 5A8RB 3ISNC 1NLKL 3RW7A 4ZLLA 1JNRB 3BO3A 1GNKA 2AYBA 1UVIA 3Q8YA 4FYDA 1YQHA 4OZ1A 2DXEA 4HEA9 3IP0A 2RU9A 4GKJF 5F8IA 2PN6A 3MPDA 2ZM6F 3CDUA 3C3LA 4HYKA 4N76A 1T9UA 3R97A 3N4WA 2KFNA 3JAMY 4X4RA 3ZZYA 2CPXA 3IM8A 3IN5A 2QIFA 2QZ8A 2W2NP 2XEXA 3O1LA 2BW2A 3EM1A 4K7QA 3I0RB 1TKZB 3M8PA 3EVWA 4OX7A 2CWKA 2O66A 1KQKA 4S0MA 4X65J 4DSFA 1KVKA 3WDOA 5C2CA 1J5OB 1JK9B 3JB9k 4OI3A 2FVPA 2H5EA 2V4JB 2OMLA 1KONA 2W8LA 1K1SA 4LF6J 2OP5A 3H7HB 3MECA 4NXMF 2GFFA 3MD3A 2XTJP 4KFBA 3SEOA 3MEGB 2PFFB 3EICA 4DPXA 2L48A 3V81B 1P6TA 2YPZA 2HVDA 2DNHA 4XTTA 5D0GA 3ZNUA 1FEEA 2GO9A 5CCMA 2G13A 5M2PA 4FF1A 2F4VF 2VQFJ 5BXIA 1SC3B 5F8JA 3CCRS 2WSEC 2IM3A 2RDDA 1MMDA 2HNYA 3CD5A 3FBEA 4KQZA 4PPDA 2O3DA 3CEDA 3N6NA 1OMSA 1AZSA 3DGVA 2WW8A 4X4UA 2E1MC 2IM1A 2J0WA 5T7LB 1SV5B 4ZP9A 3H5UA 4NI2B 2X1FA 4C0OC 5C25B 1RWMB 2NSBA 2H54B 2XI3A 1VMBA 1HWJA 1IQZA 1K9MT 1KOHA 3FZBA 4FDFA 1RT6B 3HZEA 4M5DA 4ELUA 4KHPJ 1I5OB 4Q2LA 1S5ZA 2GIQA 4Y0FA 5FD1A 3IBFB 4B02A 2R2UA 3RJMB 1LOUA 1UVLA 3L7OA 3MCMA 3SDEB 1CBKA 3VVUA 1U6ZA 2QYCA 2C3PA 3D6HB 3J81Y 4RW4B 4DV5F 1HR0J 2JHEA 3UN2A 5C25A 1W7WA 1CJVA 1R6VA 2ROPA 4ZJOA 4F4YA 4LF8J 3KLGA 2UVWA 1IJEB 2QRRA 1YDLA 4A47A 5KG0A 1HNXJ 4TQRA 4R5PA 3DU6A 4NLVA 5DM6Q 2ZDPA 2XC9A 3M32A 4JI5J 3MWBA 4HACB 5L46A 2I2YA 3MCOA 2ZH6A 2FJXA 1QM9A 4AXIA 4JV2A 1JLAA 1B7YB 2MEWA 4XO0A 3QLHA 5IV3A 4DR7J 2B0GA 4DFJA 1RT2B 2RF2A 1N32F 3MM9A 3MEDB 4F4KA 4IFYA 4BWMA 4TU8A 1R8AA 3M8ZA 3CMAS 1HLWA 3GJQB 5KFQA 1RAFB 1WHYA 3CJQA 1RA6A 4OLPA 5D4OA 2MQPA 2C22A 1CVJA 1YIJS 1SKWA 1YZ6A 2WVCA 4ZVQB 3SQGB 4B3TJ 2G2ZA 4PXBA 5CHCB 1OPIA 3FEYB 4DR5J 2ERRA 1DTQA 5F0WA 1N34F 1LV5A 2MYFA 1KR4A 1LFWA 2XSFA 2VONA 2V8HA 4Q45A 2GX8A 2JJ4D 4ED6A 3K8WA 3LH2S 4P2XA 5M2UA 4ERDA 2L3MA 2RVJA 1T9YA 3PO4A 4LFAF 2E5JA 2V2ZA 4PQUA 1RWUA 1FF2A 4ATNA 4TXSA 1RT1B 1HW8A 3DGPA 1VQ5S 3ET6B 4LR7A 4PXDA 4E98A 1M1KT 1IQTA 4I68A 2FLNA 8AT1B 1GFWB 4KE5A 4CLTA 1N33F 2RT3A 3T6BA 2NUUG 4FS1A 1H72C 2EWHA 3UDEA 2XY6A 2MJUA 4U7CA 3VAKA 4QOTA 1FD8A 4ZN3A 5H9EJ 1NH7A 2DNPA 4UT4A 1N5YA 4DL7A 3P4UB 2ZNZA 4J9LA 1FRKA 4CWBA 4DFPA 2M2BA 5HP1B 4IO1A 2OPRB 1K1QA 1ZYQA 4QIVA 3NNCA 2BZ2A 5CCLA 2R8JA 4UUWA 4LF6F 1NZAA 1SXLA 3GU0A 2VASA 4I6YA 3PX6A 3A3PB 4DUZF 3I4PA 3ENQA 1P8GA 1KHVA 1EKSA 2RKIB 3DLEA 2VB6A 3D0HE 5J1PA 4KSEB 1R7IA 2MDAA 2ZH4A 3DRXA 1QSSA 3OL9A 3CCUS 3AY0A 3W9IA 4M5GA 1R8PA 2HYIB 4DSEA 2YNGB 3NCQA 1RHRB 2MZRA 1KWMA 1OY8A 2Z30B 3D6FB 2G1DA 3AA9A 3EXYA 5E3CA 3K59A 2DEIA 3VAJA 1SIZA 2GCFA 2WCXA 2MSSA 3GIRA 4A8WA 4GMKA 3OT9A 2XCAA 2UUBJ 1MU2B 2EFVA 3VR1A 4X4VA 2AWZA 4N7TA 4CDIA 3KLVA 1VQ9S 2DB1A 4USHA 3Q8SB 1V3RA 2FD2A 2VC0A 2YBVA 3C14A 2RILA 1EX8A 3QPIA 2ZWPA 4MK7A 5HQMA 2YNHA 3G96A 3RRGA 3QWPA 5DZ6A 4FXDA 3EZOA 5KFZA 5B08A 3TARA 4OZ3A 5DG9A 2HFSA 3LP0B 1NDPA 3QAEA 2MHEA 1SJRA 3FBFA 1UVKA 4X4OA 2ZWOA 2HHXA 4QZVB 3W9JA 4U95A 4NLUA 1JJHA 2NXEA 3H90A 1Z4UA 4F4WA 1KFSA 1MMLA 3ZNJ1 5F8MA 4F36A 1OSDA 2HURA 2DCUB 4G65A 4LBHA 3MR5A 1EP4B 4Q0BB 5ETQA 2QFJA 3PVXA 3OTBA 2F1FA 5EWGA 1OJ4A 2KRRA 2AP6A 3KLIA 3PW7A 3M30A 1FNOA 5HAOA 5HL7Q 1LXNA 3GFYA 4NLQA 2VG7A 4MYUA 4Z2XA 1HMVB 2QSWA 1A7GE 4KRWA 2R7WA 3AD9C 1JLCA 1WC3A 2QLBB 2QL5B 1U1NA 3ICLA 3GILA 4WXOA 1W2IA 3IS9B 2GGPB 1Y3JA 5D0EA 3TUIC 2NYHA 4DXLA 1S1VA 2VL1A 2YXLA 1RWVB 2WVFA 3L95X 3JXOA 4WFXA 5DETA 5IZHA 4USKA 1IBKF 1CPZA 1D1UA 3IR7B 6AT1B 1U49A 1CG2A 4IQXA 3W62A 4RNOA 3TZZA 5KT5A 4P2MA 3ZZOA 3M05A 4ZVPB 1FJGF 2O5DA 2O1PA 1RDRA 3KHGA 5CYMA 1H73A 2HFNA 3FZ2A 3ILJA 3K5LA 1JB0C 1SJQA 4XAKA 4FZVA 2DNYA 2HNZB 3ETOA 4JI7F 1HWIA 1GQEA 4WYLA 1FNMA 4NZ0A 2H65B 2JC1A 4P52A 4NYPA 1QY7A 2CJYB 1R43A 3MMCA 5J1EA 1WD6A 3KUHA 3BM7A 1GXTA 4LF9F 1SH0A 4U67Q 2POKA 5J2PB 1C1BB 3V6KA 3FSYA 2DGQA 3GONA 5KFWA 2DHAA 4F3QA 3QZ7A 1J5EF 2CQPA 1S76D 2PEBA 1YGYA 4K4UA 5KFBA 4K4YA 2K06A 3JTNA 1UPPA 3CW2C 3MTKA 3D9BA 4DS4A 3JSMB 5DDPC 3R6LB 2Q66A 2XULA 2YWHA 3O5TB 2XS7A 1IJFB 3ISND 1X4HA 2M5YA 3AAWB 3UWTA 3BN7A 1RAOA 5IQ6A 1RT3A 3BN4A 3DN9A 4LRAA 5GADI 3EDQB 4MJKA 1ZM9A 2YNFA 1GX5A 2KDOA 2NPIA 1ZA2B 1Q86T 1IVZA 2DR6A 2AKWB 3I56S 4LF7J 3TX8A 2F40A 1HPZA 2JRSA 4QWCA 2UXCF 5C5JA 2YX1A 3OJSA 1K47A 4M5JA 4Q5VA 1FNXH 4FN5A 5AJ3J 1NCLA 3IO1A 4YN3B 5BYRA 3Q8QB 1PAUB 4JI1F 4OZ0A 4ENOA 5CZXA 3TAMA 1UEVA 1R0AB 3NGDA 3MGJA 2H5JB 4CO2A 1X5PA 3GV7B 2J7UA 5K14B 2MQLA 1WC1A 3EUNA 5KG6A 4JYAJ 3EGNA 4I1TA 1I51B 3RB4A 2JEGA 2B5JB 1PG5B 1RT6A 3NNAA 4F02A 2D1CA 5HJXA 2XCPA 3DLLQ 2GW8A 1XR5A 2APOA 3WX8A 3J7YI 2B43A 4LIWA 4YQWA 1NK4A 5CQGA 2BOAA 3OR1A 1VS3A 1Y00A 2YTCA 2CNKB 4NLSA 5HVHA 1G1XA 1XIQA 2C1EB 2KXNB 3OVBA 1LW2B 5D0HA 1N5QA 1DAXA 1HBMA 1RTDA 3PKYA 5ITHA 2IMWP 1QAYA 3POTA 2IRUA 4V19J 2V6AA 5HVGA 5A2QU 4J5OA 3FCWA 4YUDA 2IY5B 3CT9A 2AJ0A 2HBZB 3GFHA 2QN6B 4DUYF 4N77A 4IRDA 2CPDA 5IM0A 3OR1B 2EK1A 2MB0B 3R5DA 3BZQA 3H0PA 4LVOP 1VBXA 2N7CA 1FD2A 1NSKL 4PQAA 2U2FA 3ZZTA 1DHMA 1HBMB 4RU2A 2XWYA 4LFBJ 4ANEA 2RQ4A 4KT0C 3X3UA 4AFFA 4GC6A 2XNQA 4QYZJ 2HVIA 5KT6A 2PIIA 1URNA 2VZ9A 4FNIA 2LEBA 1IN0A 2A6MA 3PO5A 2J9EA 5ETMA 2W25A 1EAYC 5E0OA 5E3RA 2GMLA 2V4JA 4MMOA 4OJHA 1NPKA 2JDJA 3OL8A 1X9SA 3PKMA 5A2QY 2CJAA 1S6QB 2DO4A 1QD1A 2XSJA 2XM3A 4O4GA 3CTRA 2D3UA 5B0CA 1TUVA 3B8HA 1UFWA 2V34A 1PC5A 9ATCB 4B3MF 4ED5A 4DUZJ 2ZJRQ 3OFGA 1AFJA 1RZMA 4IYQA 4LRBA 4NPOA 2MQQA 4ZOSA 2VH7A 1T03B 3HP6A 1DTTB 5LMUF 5E3AA 3IA0A 1IBKJ 4EO6A 1TMMA 1CULA 4DMZA 4K0KJ 2F4VJ 1F2GA 2DPJA 2P9CA 4PG8A 1OIAA 4Q8FA 4C8KA 3BO2A 1KVIA 1LEOA 2A1BA 2J9DA 3HLUA 4LSLA 2XSJB 3OR2B 3CJKB 2FZGB 1RK8A 1S6OA 3D0IE 1L3SA 4WKRA 4U7UK 1YBTA 2J9DE 4QW8A 3M9MB 2BDPA 3A3NB 1TP7A 2CPZA 2E1PA 2YWWA 1GXUA 5A76A 3F56A 1N5YB 2DNGA 3HHLC 2LEPA 5D78A 5L1IA 4OZNA 2YKAA 1SJ4P 2MY8A 3TEHB 5JJBA 4JI0J 3ULHA 4RBTA 5B0BA 2ZHOA 3R27A 5EDWA 2X1AA 3AOBA 2M88A 3MPVA 1AYEA 1LWEA 3ADAC 5A8KA 1S1WA 4IG0B 2GVZB 4FYYB 3Q24A 1PAEX 3UE2A 5GAGI 1QAJA 1N36J 3EVOA 2LVWA 1HL6A 4GO7X 1NJYA 1QAIA 4ZCMA 1ZAVA 1S4EA 2V4RA 4DSIA 1HBNA 5DGAA 2BE2A 3SCLE 4FXWA 2JVOA 2Z2LA 3C15A 3C6TB 1RAJA 1U7LA 2PEHA 4NEZA 5FLXU 4TY9A 2UVUA 1U0HB 3KNAA 3SXLA 3ZTPA 2RS8A 3HXMA 1NHKL 2LA6A 3MECB 2HNZA 2DRBA 4Y2MA 3R6GB 5GAHI 3ZFVA 3V81A 2DGWA 2PA8D 1WDTA 1R6YA 3RUBL 2FLOA 3JSYA 3PW5A 3NOCA 4LRDA 1IKYA 2AMCB 3BBFA 1OPZA 4N5SA 4NLGA 4JI3F 4O3QA 1FRIA 3PR5B 2MLYA 1HQ2A 1FVSA 1VHFA 2VKZG 2PFDA 1KLMA 2FZKB 1RTZA 3FKBA 5GMDA 2QSFA 5CD4A 1R3NA 1UZDA 1V5IB 4BLGA 7AT1B 3PX4A 3TJAA 2MHNA 2QV6A 1HQUA 3NWGA 3T9NA 4WFZA 5DDRC 2NREA 1U0SA 1WORA 3IFEA 4X62F 2MZ1A 1RWWB 3DDKA 4M5DB 3BYPA 4PWWA 4DCPB 4YR0A 1EETB 3UN5A 2M8HA 1VISA 2B56A 2VPYB 4Y34A 2VFTA 2VG7B 4HVZA 3PEHA 4U7UD 3MMAA 3LP2B 3MMJA 3OTOJ 1SJ3P 4OYPA 4ZVUB 4CO1A 4WP3A 1IKWA 3MEEA 3ENAA 2HGNA 3DFEA 3VQTA 2D9PA 3M2UB 3OVAA 1K0VA 1FRJA 2HZCA 4ES3A 1ZAWA 1K44A 1SJ1A 3HFVA 2RU3A 2ZH3A 1JJ2R 4KH0B 3M1VB 3TW0A 4B9SA 5HQLA 4C8LA 2IFXA 1IWGA 5CYQA 1S48A 2GHWA 2W4CA 3NS7B 3ONQA 3HHKA 4DCOB 5KFFA 1IR1A 5KT4A 5DGBA 1H7XA 4X64F 3CJ5A 2IA0A 3MM9B 3NLCA 3ZTQA 5KG7A 4ZPDA 3OTEA 5IT9U 2QC3A 2BM1A 5LOQA 3EGZA 4PWDB 3M9NB 2CG8A 2HAFA 3T5HA 2AZ1A 4TY8A 2E9ZA 3NMAA 1TR0A 5AJ3F 1UA1A 1ZM4A 2BKNA 2DNZA 3T1AA 3GYNA 4KGZB 4PXEA 2X7IA 5K9FA 3M8QA 2J8SA 3CD0A 1N6QB 1Y11A 5CYQB 3G8SA 2N82B 1O8BA 2YPYA 3I96A 3KK2B 1XMBA 1OY9A 2D3ZA 2I0XA 1QVGR 1PSDA 2PMWA 3FMWA 3RAQA 2VUGA 2CYYA 3U1LA 2LECA 3FQKA 1N32J 2XYPB 2K1RA 3V6HA 2DBBA 2UUBF 5DDOC 2KT2A 1KQSR 3BV8A 4QWAA 1FVQA 1IR2A 5CA5A 1ZA1B 2XG8A 3N5BA 3LUYA 4OHYA 1T9VA 1NJXA 5F8GA 3TNVA 3WX4A 3C6UB 3MR3A 3ZZPA 5GVQA 1JLGA 1R31A 2DH7A 3DM2A 2CG4A 2YKQA 2COLA 4X84A 4Z37A 1N34J 3MCNA 4WFYA 1H3DA 2GV1A 3W8PA 3K8VA 2M70A 3HSDA 4WYWA 4EBEA 4BCAA 3D2WA 1U02A 2XZWA 4EI2A 2VPZB 4EZ9A 1XNQJ 5HLFA 4NMXA 1DARA 4CYUB 4E8UA 4ICLB 5HROA 4EYIB 2RH3A 4QR1A 2W9BA 2WBMA 4C3KA 2UP1A 3QO9B 2DTJA 4YY3F 1JLCB 2RHSB 1EIYB 2XS2A 1PCAA 1X4AA 3LALA 1KS2A 2JNJA 2OLWA 4AL7A 3DLBA 2G2OA 5ETLA 1IBLF 1CULB 1VQSA 1Y5NB 3TRGA 4RW7A 2KG1A 4ZLNA 2A10A 3FFIB 2FY1A 3H2UB 2F7VA 1S72S 4EFAC 2XHCA 3C46A 1TL3A 4GKKF 1AT1B 4H54A 2ACYA 3VHQA 1VQNS 2K2PA 3N79A 1TKDA 4RWWA 4NA1A 4USTA 5HJYA 5L38A 3LGHA 3BPSP 4KAIA 2WOMB 1RAIB 3PDNA 3G6ES 3M4XA 4DSJA 1A9NB 2ZE2B 3WHIA 1FK9B 1NNDA 2GJIA 2HGLA 4ZCIA 3DOMB 3TJ8A 2NCKL 3KJVB 1CJKB 3F41A 3SV4A 2UUAF 5AT1B 1M5VC 1S6UA 3T3FA 1S1UB 2ZNYA 1EQ0A 3BSCA 4ZS6A 3TA1A 1HIYA 1LQ9A 2LMIA 4O3OA 4H4OA 1BHNA 3AHPA 5K20B 4ECXA 1YJWS 2CNLB 4DR4J 1TU0B 3RW6A 4HKQA 1PC4A 1Q53A 1UP1A 5A8RA 3QATA 1S1TA 1R8BA 1BQMA 2B6AA 3CD6S 1EP4A 3FGVA 1HNIB 5IV4A 1RSCA 2Q3PA 2XI2A 5E41A 4R25A 5L9NA 1S9GA 2DHXA 3R5GA 2J0XA 4B9VA 5C7PA 4DV3F 2CADA 3M6WA 5ETKA 4HR2A 3VV2B 5L1KA 4NCBA 4OX6A 3Q8UA 2XMJA 4C4WA 4QBUA 2YNFB 5BYQA 4ZVRB 4RO0A 2IVFB 4BWJA 1M5HA 1YJTA 2OEMA 2J9CA 3THTA 2MKIA 3UPFA 4X64J 4MIBA 3NNHA 2MTLA 1RKJA 1OQ6A 3CDBA 2YWEA 3T5KA 3MM7A 3HKZD 4RW9A 3ENVA 1TV6A 2CQ4A 1JLFA 1RLDA 2BJ9A 3NY0A 2UXCJ 4JV1A 4AL5A 5F8NA 1UEKA 2EXUA 5AXMA 1UFLA 4FS2A 3RBEA 3IGVA 2BV3A 2ZZMA 3QGIA 2DRDA 3UI3A 4DSLA 3UD5A 4PPZA 2Q79A 1SL0A 1HARA 3SI8A 1BQNB 3CJ3A 3EGVA 3MAQA 3LW5C 2IM0A 3PRBA 3NBPB 3S7RA 4QIWD 3MMCB 3BQ1A 2FTRA 2IJNA 1WUUA 2FHMA 1AUSL 2J8AA 1MWYA 4OIXA 4OI2A 1R0BG 2JFDA 4KGVB 3UD3P 2QMWA 3H20A 3CJTA 4JI3J 3NG8A 5IS2A 3KLHA 3EDRB 2VOOA 2FUG9 3OLAA 2CPEA 4ECUA 3H5SA 4CI0B 2YQ3A 2HFOA 4CCHA 4OHZA 3QYYA 2H9ZA 1YTYA 1EHWA 2DT9A 3Q8VA 4A8XA 1IBMF 3QRRA 2YQ1A 2UUTA 2ZBRA 3AOCA 4YB6A 5A8WB 2Y8WA 1WF0A 3GCXP 3OL7A 4Q0BA 1LXJA 3UO0A 5K8PA 2XO7A 2AX1A 1YLXA 2E5LF 1XNQF 2BE2B 2HBRB 2V68A 4CTAA 2PDAA 4BDPA 3AXKA 1U2FA 3D28A 3I5BA 3PG9A 3V2UC 2D41A 1C4CA 2C2NA 4YHHJ 4WE1A 4NLYA 4U8VA 3A3OB 4UOGA 4O3NA 4RPFA 1E6VB 1VQ6S 3UDCA 1XR7A 5LL6d 3A13A 3OVSA 3CNQP 3OTDA 3SFUA 4R8UA 5B0DA 4ZJQA 2M8DB 1U1OA 4LF5J 3CCZA 2IVMA 1Q7YT 4WZMA 2AHOB 5C2GA 2NZCA 4OJ1A 1DJ0A 1X9WA 3KWMA 4N8NA 2GIRA 3TVZA 4F7VA 5L1LA 2LEAA 2VA3A 3EE3A 1GH8A 1UJ5A 3QMQA 3M6VA 4YDXA 1EARA 1KQFB 1YVFA 1KLMB 4DL2A 2CPYA 2G9OA 1SIWB 3BS9A 5I42B 2H4YB 1H2TZ 2R7QA 4NX9A 1M1HA 2N7YA 4P10A 4DQSA 3LPYA 3W5ZA 2EW9A 3LP1B 5AE2A 2BJ1A 1XMOF 4B9NA 1VRTA 3KG4A 2E7WA 2HEKA 1HWUA 4AE5A 4ECSA 2B4UA 1QE1B 1XQIA 1T05A 4KPYA 4ILLA 2DNKA 2HHUA 1JQGA 2DKOB 2VQFF 4HDGA 4RNFA 1X5OA 3O6QA 3MUTP 2ZHBA 1WSRA 2KYZA 2VOPA 5I42A 1HBUB 3BKUA 4ZDNA 2ZKUA 4CH7A 3HVAA 4A8KA 1RHMB 1EQMA 1WEXA 4YS2A 2MKJA 2H5IB 2MXYA 3I55S 2HIYA 2KHCA 5GMKa 4BS2A 2QA1A 3I87A 1W25A 2GQ2A 3CO9A 3PFOA 4KH1B 4L72B 3J80Y 2AT1B 2QYGA 3Q89A 5SUHA 2MKSA 1U1QA 3KDOA 2JEFA 3KG0A 4CP5A 1TZ0A 1TK5A 3CJ2A 4KHMA 2C3OA 4WU2A 1TL7A 3CWJA 5DDQC 2YWKA 4OYZA 2HFUA 1VR6A 3DXBA 1ULRA 2MQMA 3A8EA 4N47A 3BR9A 4DN9A 2OFGX 3KXDA 1TAQA 2I6WA 3SCKE 3MR2A 2ADCA 2R7OA 2HMIA 4C0BA 3C6TA 3J7Z5 1X4EA 4C3MA 3IRXB 3X1LB 3RGIA 2OKQA 5ETPA 3M2VB 1YKWA 3ZZZA 3HPOA 3HM9A 2XMWA 2KN4A 2ZUAA 2W9AA 4UY8T 2KTQA 5H9FJ 1WKLA 2CQGA 4UQGA 1OWXA 1RCOB 3CCWA 2QL7B 3DLKA 2DNOA 1HHQA 1RHJB 3GPAA 2OPSB 3O2IA 4UW2A 2JLGA 3PW2A 1IWAA 1MN9A 4YP3A 2O01C 1I94F 1M5KC 4DOZA 1FXLA 2Z58B 2MKYA 3R7BB 5D4PA 4CQ1A 3C2PA 4TNOA 4HHJA 4LFBF 5CXTA 2DH9A 3CDAA 1FEHA 4NCGA 2C42A 4DDFA 4H4MA 2FDNA 5HK4A 4G3IA 2IYIA 4O44B 2C2EA 4QIFA 4KHRA 1JLEB 2GVDA 2V8DA 5D3GA 2Z56B 3OW2R 4OYAA 2V67A 2R7UA 2GJFA 4ZVEA 3FK4A 4JBCA 4NLRA 5KFYA 3KJQB 2AGPA 2UXDJ 4P72A 1U6FA 4MFBB 4OYWA 4PAAA 2MY7A 3PYFA 1DZ5A 2R7RA 2IBOA 3UDVA 4URGA 3TAPA 2V94A 3US5A 3L7PA 1N5VA 2OPQA 3K5NA 1L5UA 4K0KF 4LFAJ 4X62J 5IM0B 2ZITA 1UPMB 2JVRA 3G86A 4DR6F 4DWIA 4Q44A 4NXNJ 4DLEA 1NRKA 1HNWF 4URSA 4HLBA 4M1KA 5A6PA 2J76E 3H8YA 2XLKA 1NH8A 1NSPA 2XNRA 2OELA 4HH0A 3TVYA 3CO0P 3ELHA 4HTIA 2BEFA 2BXJA 4ETZA 4CLKA 5E33A 1ZPVA 5CD4H 3GB0A 3PYDA 3VWSA 1MROA 4F0MA 2PMZD 2R8HA 1L3KA 4P2FA 3PJ9A 4B9TA 1S9EB 4F4XA 2IYGA 2H4WB 2HQGA 1BY9A 2OUGA 3SIPB 4PUOA 4ZKAA 3UN3A 4DFMA 1JJ4A 4HDHA 2RRBA 3IAM9 2R42A 2RHQB 2I38A 4DL5A 3PZPA 2OEKA 2XLJA 1WHXA 4B3RF 3D66A 1X8DA 1SCJB 2DGVA 2OIHA 1N56A 1WNEA 2OH2A 2A6OA 2UU9F 4F0HA 1W2BR 1XC9A 3M8QB 3PTWA 2I8EA 5I3UB 4OI1A 1QUVA 3IR6B 1M1GA 3GR0A 4E0DA 1U45A 1HW9A 2HHTA 2J7WA 4MIWA 4DR3F 2Y0SD 3O44A 2HQIA 2MKHA 3HHLA 4XDDA 4CRJA 9RUBA 2LLZA 4I69A 5KOWA 4WIQA 1PO6A 2F8MA 2UXBF 4KR0B 1VI7A 4LREA 3KTQA 3DHWC 3W2VB 3MM6B 2ALZA 3QT6A 5JMNA 1RE1B 3MCSA 4MK8A 1JKHB 3IG1B 1FRLA 1RI7A 4ZPAA 4L3NA 3PX0A 2EG1A 2V2KA 1XMQJ 1HYSA 5FLXY 4RR5A 1EETA 4Z7CA 3MR6A 1RAGB 4GVBB 4J91A 4NWBA 1D9FA 5J2MB 1X60A 2WVEA 3PEJA 3VGTA 2J6SA 3CE8A 1VC0A 4ILRA 4OI6A 4DU8A 1QSYA 2XMAA 3P6YC 3MOJB 4KYZA 4TU9A 1VQKS 2XMVA 1UAWA 4LF1A 4DV1J 1T7PA 3Q2SC 1YJRA 4OV6A 5FDLB 1O5JA 4FPRA 4A8MP 3NS6A 3AB2B 2B4OA 1LW0B 2LU2A 1RT5A 1N0UA 5J2MA 5ETVA 5KFIA 1QAXA 1WEYA 2R4FA 3DI6B 1WHVA 3SFGA 2F5GA 4LRFA 1KLNA 4KPCA 2AW0A 2IC3A 2BRLA 1SKRA 1N33J 2UV8G 2MGZB 2V0NA 4RW6B 2ZZNA 2DISA 2KFYA 3KHRA 1OYEA 1HQEA 1N8RT 4ZVGA 2BW7A 2OSRA 2FZCB 2GAHC 2KT3A 3FEXB 1YBAA 3HSZA 4OHXA 3MEKA 4WBFA 3RR8A 1XNRJ 2ROGA 1GMWA 1ACMB 2C2KB 5EX0A 3CXCR 4J90A 2A3JA 2XZTB 1PBUA 3ILLA 2L08A 5IOLA 4YR3A 4B9UA 3QJLA 1S99A 1DTTA 2VJVA 1WG5A 4J9PA 1RABB 2RNEA 2VBZA 3DOMA 2NS1B 5F3TA 2YNGA 4C48A 4DCJB 2R8KA 1B4SA 4F2RA 1GX6A 1BWEA 1HNVB 1V6HA 5KFDA 5LT5A 2AV5A 2HBQB 2WSCC 1Q8BA 3CC2S 4C11A 4FYWB 4ZPBA 3CJ0A 1NK6A 4MH8A 3NP5A 1BMQB 4I4BA 4CLZA 3FSXA 1P1TA 3RB3A 4PXCA 2VPWB 2HS3A 1RXOB 2HLUA 1PYSB 2HK3A 2LQ9A 2RAQA 2W2OP 2R2RA 2ZBQA 3JQKA 4LSNB 2EKNA 2HHHF 2E9TA 1TVRA 2M52A 5EX3A 5IC6B 2R7TA 5KAKA 1T9TA 2YKNB 1FI4A 1VQLS 2Y8YA 3I31A 2X1BA 1FX4A 3I82A 3KDNA 1KQGB 4L6V3 2I9SA 2QLJB 1C1CA 2EK6A 2OEJA 2UV8A 1ZH5A 4LFCJ 2C28A 4RJVA 4G1QA 5EWFA 2HHVA 3QNWB 3UNGC 1WOPA 4LBIA 2D3O1 1LK7A 2HBYB 2WBRA 2ZJQQ 1L3TA 2DGUA 4CH1A 3TQEA 2QLWA 3C66A 5AXLA 3NCRA 4CO5A 3GV8B 3MM5B 4RBVA 3CGIA 4JI2F 3G4SS 1NSAA 2E5GA 3GR1A 1L3VA 2G0JA 3MZIA 3HVWA 3OFEA 3BO4A 1JLAB 2YKMA 4OYMA 2ILZA 4IKAA 4X66F 4LIRA 2QL9B 3W60A 1C1CB 3UVJB 2ZH7A 1MNEA 4NYOA 1IKVA 1HWLA 1U8WA 2ASYA 2DHSA 1VLOA 3BKTA 3R7SB 1HD0A 1U26A 5DLFA 4OV1A 1U48A 3ZC4A 1RWPB 3NGUA 5L9XA 5HN0A 1WJ9A 4JI5F 1IKYB 1SKUB 3T1YJ 1HI0P 3KMQA 1RBLA 5KFGA 5LJ5Y 3CJKA 2A0FB 2YY3A 2QJ3A 3FQLA 4OZ2A 2M0GB 5KG2A 5CYMB 3L7UA 4QYZK 1PJ5A 2AJQA 1YJ7A 3FSIA 5MAOA 3OJUA 2KG0A 1B0TA 1DY3A 3AD7C 3JQMA 4QPTA 4JYAF 3KLFA 4IFVB 1XN9A
chains in the Genus database with same CATH topology
4QPXA 1FE0A 5KFTA 1C0UB 3I9ZA 1X0FA 4DL0C 4G1PA 5G4DA 2UXDF 2OAUA 3CCLS 3DLGA 4NLTA 3HVTA 1FA0A 2B9WA 3RU0A 2Y1RI 2OSQA 4RW8A 1VC5A 3QZ8A 5J2PA 2LKZA 4QW9A 4PG6A 5AXKA 4O3PA 1WELA 2L9NA 3RAMA 4W90B 1HBOB 5A8KB 3QO9A 2DNNA 4MAKA 4CO0A 4HT5A 3P3DA 3MEEB 1WEZA 4JUZA 2DNLA 3UDLA 2XLIA 1TKTB 1Q4RA 4DBQA 4TN2A 2K3IA 2Q43A 5DRKA 3H4BA 3R3TA 4DQIA 4ZP7A 1SH2A 1HBOA 2AYMA 2AJFE 2ATLA 1FKPB 3I0RA 3M8PB 2B9XA 2RSQA 3RZAA 1LFPA 2OO4A 3JTPA 1T03A 2HWIA 3MTJA 4WFNQ 1F5CA 4FF4A 1X4DA 2EBGA 3QWUA 3B4DA 3QLHB 2PGCA 4ID8A 1Q7LB 1S1UA 3TAMB 2FC8A 4OLOA 1HR0F 1HYSB 2CQ2A 2RB7A 1FJEB 2FVQA 1CQMA 4KFBB 3SCJE 3BDEA 4ZP8A 4JI4F 3CSKA 1R27B 2MZJA 2OPPA 3DLJA 1OSCA 5A8WA 4RWXA 1PGZA 5KFKA 1G3OA 4C0HA 2XS5A 2BQ3A 2ZDOA 2QE5A 4QR0A 3PV8A 3DOLA 3A1YG 3IWNC 4ZVHA 1RTIB 2XY7A 2D74B 5IFMA 4ELTA 2D7SA 2GJ2A 3MMAB 4GO5X 5IQQA 3FVYA 3MDFA 2V8GA 3ZZ0A 3HDSA 2R2SA 2C2DA 1GT8A 1ZTWA 2PSZA 2LXIA 2DNMA 3M6UA 3VAHA 1SJFA 1HBNB 1H6KX 1RA7A 4DV2F 3H98A 5EHHA 1VC6A 2HMIB 3CIMA 5HBMB 5HROB 2UUCF 3EZ5A 5BYSA 3LGNA 2W9BB 4OI0A 2OJ3A 1Q8IA 3GIJA 4Y2KA 2CVIA 4MYTA 2VODA 2DGTA 2NSCA 3PHEA 4H4KC 3VZHA 1X4FA 3RRHA 4C97A 4FVCA 1N88A 1N5TA 3MAHA 3M8RA 1NJZA 1X5TA 2W9CB 2J6TA 1UJ4A 2M9KA 3UQSA 1T02A 4MTPA 3W2VA 2XWXA 5H1SV 4USJC 1TK0A 1OS5A 5B0AA 1YJNS 2C3MA 2MKCA 2RDIA 3OFFA 2J0SD 1Y5LB 2BACA 5D4LA 2ASLA 5MLCV 1Y4ZB 1Q81T 1FHTA 2EI5A 5K14A 2AF6A 4NLDA 3KHHA 1TVRB 4IOBA 2WB1D 4PG7A 4YEAA 1VBYA 2X1GA 1K73T 1LWCA 4U9RA 1F60B 5HMXA 1FKAF 2QEXS 4DL6A 4YR2A 3UCGA 1RTJB 2N4CA 3KG1A 3MXHP 2A18A 1SUQB 4OX9F 2WTFA 5EWEA 4HTJA 3W2WB 5IWAF 4OJGA 4RNNA 4ILMA 2DGSA 1FDDA 2BM0A 4AQYF 4F26A 2DIUA 2OD6A 4J37A 4RUCA 3MF5A 1ZM3A 2DJWA 1UEUA 1MROB 1GXLA 4Y3CA 3DCAA 3OBIA 2ZHAA 1JIHA 4DR2F 3M2VA 4DX8H 4FBUA 4URQU 1YRXA 2MMYA 2VFVA 1KC8T 2FJWA 1CSJA 4OFZA 4LF4F 5J2NB 4IR1A 1FCAA 3QGGA 2JWNA 2FJEB 2KO1A 2RE1A 3KLEA