4RW7B

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 102
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B03
2D3UA 3M9OB 3TAMB 2FVCA 1RDRA 3HVAA 3SFGA 1HARA 1XR6A 4YQWA 5J2QA 3EPIA 1FKOB 2W8KA 4LQ9A 5KG3A 5HLFB 2V9WA 1KLMB 1S1VA 3DRSA 3M8PA 3HHKA 1JLEA 4MIAA 3UR0A 4TY9A 1S0OA 3T19A 1RT2A 4WYWA 5KFXA 5L1IA 5F9NA 4RW8B 1IKYB 4J9PA 1C1BB 1S9EA 1HQUB 3BQ2A 1N6QB 3KK3A 4NRUA 4ECWA 3M9NB 4YMEA 5F8HA 5DQIA 4MFBA 2AQ4A 2YKMB 2YKNA 5J2QB 2V0NA 3CJ2A 1RT3B 4NLRA 3PW0A 3NL0A 2ZD1B 1MMLA 1S1WA 2OPPB 3LAMA 1RT1B 3OSPA 3NMAA 2C2DA 3OL6A 4QW8A 4I2PA 1S49A 2RKIA 4DG1B 5KFJA 4ZP9A 1VRTB 2IC3A 2ILYA 1S9EB 5CYMB 4ICLA 2GIRA 3HVTA 4J9OA 2O5DA 3M8QA 1HQEA 3DI6B 1HMVB 4EO6A 2YKNB 3LP1B 5HP1A 5F8MA 4YP3A 3NGDA 4J9KA 1TL3B 1LW2B 4O3RA 2YNIA 2ASJA 5KFIA 5F8LA 2FJVA 3KLIA 4LSNA 3N6LA 4GC6A 4EBDA 2YNFA 1HYSA 3FDSA 3ITHB 3GIKA 5L1LA 3DDKA 1T05B 4IFVA 1DLOA 1MU2A 5HBMA 2AX1A 1FK9A 4Y2AA 1QE1B 1D1UA 1FKPB 4RW4A 4WYLA 2HNDB 2RF2B 5HP1B 2I1RA 4JV0A 1QAIA 5KFRA 3IN5A 4DL3A 4PUOB 1TV6B 3DOLA 3RAQA 4ID5A 2C2RA 3IS9A 1QAJA 5C25A 4LSLB 1XR5A 3I5BA 1UWBA 3V6DB 5K14B 3KHRA 2GC8A 2BE2A 1TL1B 1FK9B 4ECSA 1SUQA 3HKWA 3RB3A 4WZQA 3DLGB 4URGA 4NLVA 1DTTB 4NCGB 4MKBA 2B5JA 5KFTA 5KFYA 5T14A 1TKZA 4O4RA 3C6TA 4F4WA 4ECVA 1C0UA 4IG3B 5D3GB 4NLSA 1I6JA 3DMJA 3JSMA 3QYYA 3DOLB 2BQRA 1S97A 4IG0A 2BR0A 1N5YB 4Q0BA 3BQ0A 3KLVA 3KK2B 4U6PA 3V4IA 2WRMA 3TQ1A 4IFYA 3LP0B 2BANB 3V81A 3H40A 2B6AA 1SUQB 2IM3A 4NLOA 2ZE2A 4KKOB 3GV8B 2W9BB 2XGQA 2DPIA 1EP4B 4IRDA 5KFAA 2E9TA 4RUCA 3DOKA 1NHVA 3LALA 3G6VA 4MK7A 3DMJB 1HNIA 5KFSA 5C24A 1W25A 4NZ0A 4RW7A 4J9RA 4IG0B 3V6HA 3MECA 4DL2A 1WNEA 4RW6A 2AX0A 1S6PB 4K4YA 5KFDA 3V4IB 3H5UA 1C1CB 5JXSA 4U7CA 3LANA 1S1UA 3KJVA 2UVUA 3KMSA 2R8HA 1S1TB 4O3QA 4ECRA 3EPGA 2AU0A 4IDKA 3QZ7A 3H5YA 4KAIA 4KE5A 2R8JA 1LWCB 3CDUA 5FDLA 2HAIA 2FLLA 3M9MB 4RW6B 4KHMA 5KFQA 3KLFB 2XGPA 1KHWA 4QWDA 4K4UA 1ZETA 4ZVFA 2XCAA 2JEGA 2W9CA 3QIPA 4ZHRB 3C6UB 1RTHA 4XPEA 1S9FA 2J6SA 1S1UB 3KJVB 5EWFA 3FSIA 5J2NA 3Q8QB 4IDKB 3TAMA 1JLBB 1JLQB 1REVB 4Q8EA 5KT2A 1FKOA 3CIZA 4KBIA 4Y3CA 3MEEA 5HLFA 4NLUA 1KLMA 1HNVA 3BREA 1S6QB 4ECYA 3CWJA 2AGPA 4I2QB 1SH3A 5CYQA 2R2SA 1RTHB 4RW8A 3RB6A 1IKYA 4RNFA 3KHLA 1C1BA 5J2NB 3GIIA 3JYTB 4IKAA 4QPXA 4X2BA 1N6QA 2HNYB 3H4DA 3CJ3A 5KFPA 3GIMA 3DYAB 5L1KA 3LP2B 2HMIB 3MFIA 4ED7A 2WHOA 2YKMA 5J2PB 1RT3A 1SH0A 4IRKA 2D41A 2ZD1A 2OPPA 3MEEB 1HNVB 1RT1A 3QLHB 4WXWA 4OL8A 3DRRA 2D7SA 2OPQB 5CYQB 2R2TA 3IGVA 3OSNA 2ILZA 3RAXA 4DG1A 1J5OB 1VRTA 1T03B 4O44B 3MR5A 4MKAA 5CYMA 4K4ZA 2FLPA 3H98A 1K1QA 3DI6A 1HMVA 3D5MA 3OL9A 4ZP7A 3OHBA 2WK4A 3LP1A 2CKWA 3FQKA 4URQU 3N6MA 1TL3A 1LW2A 2UUTA 2UUWA 3DRRB 4TXSA 4KSEB 4J9QA 4ZPBA 1Z4UA 4O4GB 3ITHA 3T5LA 1S0MA 3MEGB 4LQ3A 1T05A 1BQNB 1LW0B 2DPJA 1TKXB 4J9SA 1N4LA 1IKXB 4RW9A 2XI2A 1QE1A 4TYAA 1FKPA 1ZTTA 2IM2A 1XR7A 4TQRA 4RU9A 3H4BA 3G6XA 2HNDA 2RF2A 3BSNA 2V4QA 2F8EX 2R8IA 5DG7A 4PUOA 1TV6A 4B3OB 4FS2A 1RT7B 1IKVB 5DLGA 1VRUA 3KLEB 4LSLA 3DRPB 3NKYA 3GIJA 2C28A 3V6DA 5K14A 5KG7A 2VA2A 2JEIA 5KFEA 1TL1A 5KFWA 3RB4A 2VG6B 4RW9B 3FFIB 1RYSA 5DG8A 3DLGA 4JV2A 5KFVA 1DTTA 4NCGA 1ZTWA 3IG1B 4GC7A 3IGNA 1JX4A 4YR0A 1RA6A 5EDWA 4IG3A 5D3GA 1SV5B 4TLRA 3BJYA 1S10A 4NLTA 4ZP8A 4ED2A 3CDWA 1N5YA 4NLYA 4EBCA 1EETB 1VRUB 4NRTA 3KK2A 1JKHB 2QV6A 2IBKA 3H5XA 2WONB 1RTDB 4TY8A 2XC9A 3LP0A 2BANA 5J2MB 4KKOA 3BR9A 4RNOA 2W9BA 4F4ZA 1BQMA 1EP4A 1JLAB 2QE5A 3BSCA 5DQGA 4H4OB 4IR1A 4J9NA 2RDJA 4Q8FA 2C22A 3H59A 1DTQA 5HROB 1IKWB 4DL5A 1S1XA 3KK1B 4Q44A 2FVSA 5J1EA 3KLHB 1S6PA 3PW2A 4FBUA 2E9RX 2R2UA 5C42B 1C1CA 3OL7A 1RA7A 4TY8B 2W8LA 1JLCB 3DM2B 3CJ0A 4KFBB 1TVRB 4KHRA 1S1TA 4R5PB 2XI3A 2XWYA 3MF5A 1BQMB 3OL8A 2HNZB 4J9MA 4J9LA 5I42B 3I0RB 4ZPDA 4PWDB 2E9ZA 3PJXA 1LWCA 1TKTB 4WFXA 1DTQB 5I3UB 4WZMA 3MEDB 4IH6A 1S1XB 3GYNA 5J1EB 4O3NA 2AGQA 3KLFA 4FS1A 4ECXA 2R8GA 4IRCA 4IR9A 2VG7B 4ED3A 4H4MB 4ZHRA 3C6UA 2VA3A 2IMWP 4JUZA 4RUAA 1RYRA 4NLGA 4DL4A 4ED1A 1S48A 1RAJA 4HYKA 2IM0A 3E51A 1JLQA 1JLBA 1REVA 4FBTA 1RT6B 4ZVHA 3QO9B 5KFBA 3GILA 3BGRA 3KLGB 4IH7A 2BQUA 4QWEA 5KFFA 1S6QA 4O3OA 1JXLA 4I2QA 3QIDA 3CDEA 5KFKA 4MIBA 1KHVA 1NNDA 3DLKB 1LWEB 4EO8A 3MTKA 4NLDA 3Q8RB 4RNNA 3MR2A 2B43A 4K4WA 4K4XA 3CJ4A 2IA6A 3JYTA 1CSJA 2JC0A 2HNYA 5L1JA 5KT7A 3DYAA 3LP2A 2HMIA 3RBEA 2UVVA 4RNMA 5J2PA 4Y2CA 1S4FA 4IOBA 3BGRB 4K4TA 3RBDA 2ALZA 2YNGB 3QLHA 4IQXA 5KG5A 3NBPB 4EYHB 3QGHA 2IAJB 2WTFA 1RT5B 3GQCA 2BQ3A 2OPQA 4PQUB 3T5HA 2FVPA 1J5OA 1GX5A 1JLGB 3OLBA 1T03A 4O44A 3Q8SB 5KG0A 4EYIB 2WOMB 2R2RA 3IRXB 3ISND 2W7PA 4Y34A 5KFOA 4EBEA 3I5CA 1RTIB 2V4RA 4URSA 2OPSB 4ECTA 5KT6A 3T5JA 2UVRA 3N6NA 1R0AB 4QWBA 3KHGA 4QWCA 3MR6A 4O4GA 2OPRB 3CJ5A 3MEGA 3GV7B 2XCPA 4KO0A 1BQNA 4XPCA 1LW0A 1TKXA 4F4YA 4K4SA 4KV8A 2FVRA 1IKXA 2J6TA 2W7OA 1NHUA 4ZPAA 4MK9A 1HPZB 4I7FB 4ED6A 4NYZA 3KNAA 4ZVEA 2YNHB 2BRLA 4B3OA 4RZRA 1LWFB 1IKVA 1RT7A 2JC1A 2ASLA 3ISNC 3KLEA 3PJWA 3DRPA 4KO0B 2OH2A 3PVXA 1C2PA 5C5JA 4EEYA 5EUHA 1JLFB 4KV8B 2VG6A 3CO9A 3FFIA 3TVKA 4XO0A 5KG2A 3G6YA 3IG1A 3E01A 4MK8A 2CJQA 2IJNA 5EWEA 2WB4A 3NAHA 3OLAA 1SV5A 5KG1A 1GX6A 5DQHA 4JV1A 3RB0A 3FRZA 1EETA 1S1VB 3DRSB 3M8PB 1JKHA 1JLEB 1TQLA 4WFZA 2WONA 1RTDA 2FVQA 2W9AA 5JUMA 1RT2B 4QWAA 4ZPCA 4KB7A 1U09A 2AGOA 4K50A 5KT4A 2FLNA 4NLPA 4DEZA 5DG9A 3QGIA 5J2MA 4TQSA 1JLAA 1S0NA 3E01B 3KK3B 4H54A 1RT4A 4H4OA 3H2LA 4ZVGA 4O3SA 2HWHA 4MFBB 5KFCA 4YR3A 4M95A 3V6KA 5F8NA 5KFNA 5L9XA 4WE1A 5HROA 1IKWA 5KFUA 3KK1A 1S1WB 3OHAA 5KFHA 3KLHA 5C42A 3I0SA 1JLCA 4I2PB 3NAIA 3QZ8A 3DM2A 3UDLA 2RKIB 4KFBA 1TVRA 3KMQA 4R5PA 2IC3B 1QUVA 1SH2A 3VQSA 4IH5A 2HNZA 4ICLB 3HVTB 4K4VA 5I42A 1RT4B 3I0RA 3M8QB 4G1QA 1HQEB 4PWDA 3CVKA 1TKTA 5KG4A 5EWGA 3SI8A 5I3UA 3MEDA 4MH8A 4WE1B 3MR3A 2ASDA 2IM1A 3H5SA 2YNIB 4O3PA 2J6UA 3I0SB 4ECQA 2VG7A 3KLIB 4H4MA 4LSNB 3DLEA 3T5KA 3BSOA 2YNFB 1HYSB 5F9LA 4TN2A 4ECZA 3D28A 3PW4A 4IFVB 1DLOB 1MU2B 3KHHA 5HBMB 5KG6A 4Q45A 3V6JA 4G1QB 3PHEA 4NLWA 2JEJA 1RT6A 4RW4B 2I5JA 3PR5B 3QO9A 4WFYA 4QW9A 3KLGA 4G3IA 3PW7A 2VG5A 3PZPA 4F4XA 3DLEB 1LWEA 3DLKA 2JEFA 4ID5B 4NLQA 3IS9B 1C0TA 5C25B 3FQLA 3I5AA 3QGGA 1UWBB 4DL6A 3EZUA 1T3NA 2R8KA 5F8JA 2BE2B 4NLXA 1S9GA 5KT3A 5KFZA 2D3ZA 1N56A 2I5JB 2B5JB 1T94A 2AWZA 4ZP6A 2EC0A 2YNGA 1TKZB 4R8UA 3C6TB 5KFMA 2RDIA 2JLEA 3NBPA 1C0UB 2IAJA 2VG5B 1RT5A 4DL7A 4WXOA 4PQUA 3JSMB 2FJXA 4ED0A 1JLGA 4Q0BB 5KFLA 1C0TB 4HKQA 4IFYB 5DGAA 2WOMA 4ECUA 3IRXA 4F50A 3V81B 2B6AB 1S9GB 2WCXA 5KT5A 2GIQA 2IJFA 2ZE2B 1RTJA 3PW5A 1RTIA 3BSAA 4Q43A 1N48A 2OPSA 4R8UB 3SFUA 4TYBA 3DOKB 2ZKUA 4R0EA 1R0AA 4ZMMA 1HNIB 3UQSA 5C24B 2OPRA 4RW7B 3MECB 3HVWA 1K1SA 2BRKA 3PR4A 5F8IA 3KOAA 2ATLA 3MFHA 4M94A 3Q8PB 2FJWA 1HPZA 4I7FA 1RTJB 5DLFA 5KFGA 2YNHA 1OS5A 1IM4A 2UVWA 1JIHA 3G86A 5F8GA 1LWFA 5DGBA 5FDLB 3BQ1A 2C2EA 2HWIA 1D0EA 4YR2A 1TP7A 3UPFA 1JLFA 3LAKA 3QIPB 2W9CB 4ED8A 3ICLA 3T1AA 1YVFA 3GV5B 4RNHA 1HQUA
chains in the Genus database with same CATH superfamily
1PC4A 1FA0A 4JI7F 2W8KA 2BM0A 1KLMB 1S1VA 4OX6A 1Y7PA 2HVIA 4TY9A 4HACA 2MHNA 1RT3B 2VPXB 1G1XA 1S1WA 2VFVA 3FVYA 4NXNF 2DCUB 1TUWA 3LP1B 4YP3A 2YX1A 4J9KA 5A2QY 3N6LA 3EZ5A 4I64A 3G82B 2HIQA 1YJUA 1QE1B 2DNGA 2OMLA 1WEYA 1R8PA 1A6LA 3GG0A 4EI2A 5C25A 4LSLB 1VLOA 2OD4A 3FSXA 2BJEA 4IOCQ 4LFCF 3RB3A 1OJ4A 1FKAF 4URGA 2KHCA 3PYEA 4C3MA 4WF9Q 3IMQJ 4ZN1A 1UA1A 1S6OA 4GVLA 2W9BB 2DPIA 2XYPB 4BWJA 4MK7A 5B0BA 3PTWA 3HFZB 2OTJS 2WVDA 4GVBB 3KJNB 4PCQA 2PEBA 5LSOA 2H4YB 4C8ZA 3EMTA 2EFGA 1KHWA 4QWDA 1ZETA 3OXLA 5IT0A 4OJGA 1EQMA 4CT9A 4M5MA 5J2NA 1AYEA 3R5DA 1RAAB 3CWJA 4OHVA 1RE1B 5MLCV 2DB1A 2R2SA 1RKIA 5U47A 4RNFA 2AJFE 5KFPA 2GAHC 1SH0A 3JSRA 4LF7F 1M5OC 1WHVA 5C2GA 3MCOA 4A8WA 2OSQA 4MKAA 2VDHA 1FFGB 3PIOQ 5GAEU 2AJ2A 4M5KA 1S0MA 1YQHA 1RHRB 3KWMA 2DPJA 3VCDA 1FJGJ 1ZTTA 3LO3A 2EFQA 2ZM6F 2E7WA 2Z2ZA 1PSDA 1CJVA 4CH0S 4CO5A 2J7UA 3NKYA 5KFEA 3VAFA 4J7CA 5EDWA 2NREA 2C2NA 2R7TA 4P52A 2XTJP 1X4BA 3PXGa 2VOPA 3BSCA 3H42A 1VLYA 5LSRA 2C3MA 2XMMA 1B0PA 5KOXA 1HBOB 1ITPA 3KKFA 2KT3A 4R5PB 1VR6A 3MF5A 3GONA 3I0RB 4PWDB 3I56S 1RBAA 2N7CA 3MEDB 2PD1A 4C6AA 2AGQA 2LXIA 3KLFA 1YJNS 4ZPTR 4IQMA 2MZTA 4DV2F 4DFJA 4KGKA 4HYKA 2IM0A 4UY8T 2CJXB 3N9UC 2LFVA 4FVCA 1YTYA 5CD4A 3FMBA 1MWYA 3UW1A 4USUA 4FXWA 4QPTA 3BGRB 2MY8A 2FZCB 3NEKA 1RT5B 1FEHA 2CQ1A 3UI3A 4DR1F 2E1RA 3HO1A 1OYDA 4DR2J 2KL8A 3QSIA 3JXOA 4YUDA 3R1HA 2ZZTA 1IKXA 2DO4A 2AKWB 1N5QA 1Q8LA 4RZRA 3W2WB 4AXIA 1YITS 2DIVA 1W26A 3RB0A 5A8KA 2FVQA 1HNWF 5KT4A 3QGIA 4FDFA 2AYMA 2HS0A 1T8EA 2XY5A 4QQBA 3CXCR 3I0SA 1U48A 3G87A 2WVEA 2AJ0A 4K0KJ 2Z0GA 2MKCA 1TKTA 4F02A 1FO1A 2MPUA 4H4MA 3T5KA 3QRQA 2VODA 2NR0A 5DDOC 4DV4F 2JEJA 3IAM9 4G3IA 3BGUA 1LK7A 4A8SA 4TLQA 3OVAA 3IS9B 4C8MA 2B4OA 2R8KA 5AE3A 1SL1A 4PXCA 2HQGA 4DL7A 2C1EB 1Y9OA 2WOMA 2J8SA 1BQXA 2ZKUA 2CNNB 4TVAB 2DR7A 2J9EA 2GQ2A 5AXNA 3R1LA 5DLFA 2UXDF 2UVWA 2Z58B 1QVFR 3O2IA 2DNHA 1D0EA 2QTWA 3MCMA 3NCQA 1VRQC 3PJ9A 1FDBA 2YH0A 3ICLA 3GV5B 1XNQF 1RDRA 3G96A 3EPIA 3K2YA 3ZNUA 1ZH5A 5HO4A 4KGZB 1OMSA 5GADU 1RT2A 2ZH1A 1U25A 2JZ5A 3CMES 3CJ2A 1X4FA 1H2TZ 4OYOA 4I2PA 1S49A 2LQ5A 2X1AA 2QA4G 2EFVA 2YKNB 1RWPB 3P3DA 2ASJA 1WOSA 3LGHA 3MMCA 1PAUB 3GIKA 2DY1A 5BR8J 2FPHX 3ETOA 2E5JA 2VICA 3DHXA 2C2RA 1J5EF 3QFHA 2DH7A 5K14B 2ZC3A 1SUQA 3HKWA 1CQMA 5D3GB 2O66A 1PG5B 2H54B 3DOLB 3R5CA 2WRMA 1FWPA 2JL9A 1SI9A 2EPIA 8ATCB 1U2RA 4I6AA 3JAMY 3EICA 2QO3A 1M90T 4QOTA 3MM7A 2UXCJ 3MM8A 1FESA 2ZJRQ 1EAYC 3LANA 3KJVA 2P9GA 2QX0A 2N3LA 5HAOA 1AA1B 1RK8A 1N0VC 3B78A 5FLXY 3AJ1A 1U1KA 2RQKA 1XEZA 2Z4PA 4RUHA 4DV5J 4KBIA 2XY7A 4NLUA 3DRYA 1HR0J 2QIFA 3ZZUA 4CLYA 1L3VA 1N6QA 3H4DA 4Y0FA 4CH1A 2PMZD 1ZM3A 2VFTA 4BS2A 3MEEB 1NJZA 4ZJLA 3RAXA 3MCSA 1R0BG 4WKYA 3J81Y 4CO2A 2UUTA 3PX6A 3SSSA 2BACA 3B6BA 1YDLA 1BQNB 4F04B 2DKOB 2XI2A 4TYAA 4IO1A 4PWUA 1Y5NB 2V4QA 4FPRA 1HHSA 2APOA 1RT7B 4XIUA 1GQEA 2GO8A 2KH9A 4RW9B 5KFVA 2UUAJ 1JNZB 3QMQA 3K17A 1WACA 5C2CA 3GP9A 1MROA 5HVHA 2UV8G 3N5FA 3QT8A 3BR9A 2NXCA 5DQGA 2RDJA 5HQ8A 2YVSA 1DTQA 2VC1A 4I0WA 3PCOB 1FJ7A 1S6PA 2DHGA 4KHRA 3IXQA 1NK0A 2W2OP 4IH6A 2FZGB 4UY85 5K8OA 5D0HA 4ZHRA 4JUZA 2IBOA 1REVA 1RAIB 2PEHA 5KFFA 1JXLA 1NNDA 4V19J 3JYTA 5HQLA 4EWTA 2HMIA 3HD2A 2QC3A 3C2PA 2E1MC 1H0HB 2ALZA 2ZKTA 3QLHA 2EKNA 3SSRA 2POKA 4DR4F 3EXCX 5KG0A 3MHYA 2IVFB 3I5CA 2PI4A 4CNYA 4NZ6A 3MWBA 5E0OA 3BBCA 2NS1B 2KJVA 1HPZB 1UCNA 1FJCA 4PG4A 1KR4A 2G13A 1N33J 4OZ3A 1P9QC 2BEFA 5HMZA 1UFWA 2A6MA 2ACMA 1GX6A 1M5SA 3DRSB 2J6SA 1RTDA 2YQ1A 4YHHF 2MQLA 5MAOA 4DEZA 2VIHA 1P6TA 4H54A 4K7QA 3R5GA 1UWAA 4MFBB 1OSCA 1S57A 4MYUA 1GTHA 4KFBA 4ICLB 2DEIA 1HQEB 2XZWA 3CVKA 2F4VJ 4OI4A 4OZ0A 3P6YC 4ECQA 3DLHA 3BSOA 3T9ZA 3ILOA 4A48A 4Q45A 4NLWA 4FF3A 1M0SA 2IPOB 4PXBA 1KQGB 4DSFA 5KFZA 2LEPA 1X0FA 2FD2A 2HBRB 2B5JB 2CWKA 2YNGA 2KM8C 1SBRA 2NXEA 4BWMA 1C0UB 3ONQA 1VGYA 3R97A 1C0TB 3BZQA 4HKQA 1X4HA 2ZE2B 5FD1A 4Q43A 2MZSA 3UQSA 5C24B 3UD4P 3CSKA 2XO7A 5F8IA 1WC0A 1XMQF 5GAHU 2M70A 2VZ9A 1OS5A 2XZTB 1U0HA 5F3ZA 3BF4A 2ZNYA 3D6MB 4P2MA 3TA0A 2D3UA 4RL1A 3TA1A 2NQPA 2V2VA 3OVSA 3B82A 3UNYA 3BDEA 3CNQP 1S0OA 1SVDA 5A2QU 4WYWA 4YDXA 4ZCKA 3AA8A 1S99A 4ECWA 2IDLA 5DQIA 2RT3A 2PA8D 2J0QD 3X1LB 2ZD1B 1RT1B 3EJMA 4DU7A 1IVZA 1FD8A 1R8CA 4HTJA 1SPBP 1EQ0A 1HMVB 2W2QP 3HPOA 4WFNQ 3BPDA 3C15A 5IT9U 4B9UA 3GYXB 2F3JA 5L1LA 4DR6F 3OTOF 2R7OA 4RO0A 4GKJJ 1TL1B 4X84A 3T6JA 4MKBA 4OI2A 5T14A 1YRUA 3OXGA 1Q82T 1MSWD 4O0NA 2OJ3A 4CLTA 3IR7B 3DGPA 1HD0A 1K73T 1X5TA 2XGQA 3DOKA 5ADZA 4X66F 1U8WA 2ADBA 1P8GA 2AX0A 1WG1A 3H20A 3H5UA 1C1CB 2C2OB 2R8HA 3J80Y 3HHLC 2E5GA 2KFZA 4H4KC 3C6UB 1S9FA 4LF5F 3AD8C 3MAHA 1EJ7L 1AXQA 5CCMA 3QT6A 2XEXA 3D1HA 1IKYA 3GIIA 1Q1KA 3MFIA 3K0JA 5BYQA 3OSNA 2KG1A 4QIFA 3CCSS 5A0YB 3H98A 3KXDA 3B4MA 3QATA 2DGVA 3GFHA 3N6MA 1S7HA 4WP9A 5J1NA 4J37A 4CQ1A 4KH1B 1KDNA 4OLOA 4PUOA 3ZFVA 3D1QA 8AT1B 4E2FB 4L3KA 2XMKA 5KFWA 2CDQA 3FFIB 5E3PA 1RA6A 1ZS6A 2Q6BA 5LM7E 3H5XA 1XIQA 2V8HA 1Y5IB 1S5ZA 1FCAA 2HK3A 2OFHX 1O6XA 2ZVSA 1RA7A 4OYPA 3DM2B 3PNIA 1PJ5A 3VF0B 2HNZB 1LWCA 1RGVA 2W4CA 3THVA 4RUAA 1UW9A 5IWAF 3ENAA 1FI4A 1CJUA 2WAQD 3BGRA 1PCAA 1T9VA 2HRTA 2ZH3A 4QR1A 5KT7A 4FXVA 4DS4A 3NNAA 3NLCA 1PAEX 4YB6A 4K4TA 5ETMA 3MPUB 4Y2KA 1QSLA 1UVJA 1RWKB 3T5HA 2CPJA 2YWFA 3ZTOA 1FNMA 2W7PA 3QAUA 1Q4RA 3AODA 4LBIA 3TARA 2Z30B 1MNEA 1GMWA 3W2WA 4U7UK 5IM0A 2IYIA 1D3WA 4F3MA 4FYWB 2YNHB 4Q2LA 3FBCA 2ZHAA 4QU6A 4C8KA 3MMBB 3UN3A 1RACB 2B3TB 3GCWP 4DV0F 3JTPA 4ES1A 1EETA 1H2VZ 4DX8H 4K50A 2ZH4A 1U09A 1H6KX 3L7PA 2RH3A 2YY3A 1JLAA 4LR7A 4UF4A 2VONA 3NCRA 2MB0B 2RQCA 2DNZA 2IMOA 3NAIA 3QWUA 2RKIB 1F2GA 3TWZA 1BE4A 4IH5A 3HVTB 3CW2C 2WVCA 3FCWA 1H3DA 3H5SA 1B7FA 4O3PA 2VG7A 1FDAA 1VQPS 2EBEA 1C4AA 3P45B 2XHCA 4WFYA 2HFNA 3HSZA 4AT1B 2ZOMA 3BEGB 4HVZA 3K5OA 4Q7AA 2A3JA 4UZBA 5KFMA 3P96A 3JSYA 2V4JA 4JI6F 2L9WA 2DNYA 2HHHJ 1HKAA 4DUZF 2B51A 3M05A 3ILJA 3FBEA 3MFHA 1I3OB 1CLFA 1RTJB 3A8JA 4DV6J 1HD1A 2LXFA 2AEMA 2W9CB 2UU9J 1MW7A 2AF6A 3WDOA 2LU1A 1TAUA 1XR6A 2CQCA 1HWUA 2V9WA 1BXNA 3HHKA 3Q89A 2LDIA 2QLFB 1VBZA 3IWNC 4NRUA 2PIIA 4MYTA 4L72B 5AXMA 4YMEA 5HQMA 2YKNA 5J2QB 3LAMA 5DDPC 2E66A 3M8RA 2EW9A 3CT9A 1OPIA 2EFPA 1RISA 4J9OA 1M1GA 1NRKA 1X9MA 4KPCA 4PG6A 5BYSA 3DCAA 2GQCA 4IFVA 1M1KT 1AROP 4DZDA 4JV0A 2VH7A 1F2HA 3JAMU 3EE3A 4OYIA 3DOLA 3RAQA 4ID5A 4F36A 4OHYA 1VHFA 2RRNA 3V6DB 1U8SA 1GXTA 2OSRA 3NOGA 2XMAA 2JFDA 2MY7A 4M5DB 4F4WA 4B3RJ 4IG3B 3JSMA 3GG1A 4ZVTB 3DKDA 4YB1P 3KLVA 3LP0B 2OELA 4RLEA 3D0IE 1I5OB 4YY3F 3ZTQA 1F9HA 1N8RT 1QSSA 1NKBA 2F8HA 2VDIA 1QM9A 2LA6A 2JLFA 3T41A 4FKYA 2AU0A 5CYJA 3D66A 4EMDA 2FLLA 4JI4F 3MM5A 2Y8WA 2GVDA 1RSCA 3A8IA 3HK2A 2B8PA 3J81U 1VK3A 2OP5A 3MEEA 4N8NA 1RTHB 3U1LA 4RW8A 1C1BA 3FGVA 3OV7A 3BGOP 1E6VB 4NA3A 2OPQB 1R43A 2H51B 1VRTA 5I3PA 1B99A 4AL6A 1N36F 4JYAF 2FDNA 2HZCA 2V63A 1LW0B 4RW9A 2D69A 3M2UA 2F8EX 1MMDA 2QMUB 5L39A 4B3OB 1TV6A 1WWHA 2FIUA 2XULA 4DR7J 3R5AA 1WC5A 4HI1A 2MQMA 3SDEA 4K8RA 5J2MB 2BVZA 4Z37A 1HNXF 4BLGA 2IRUA 2KHDA 3H59A 2DR9A 4AE5A 3KLHB 3S8SA 3ZZZA 1JLCB 4XTTA 4ZPDA 3TZWA 5D15A 4WK1A 1P9YA 1S1XB 3CC4S 4KTQA 5J1EB 4HT7A 3POTA 4X4NA 1JLBA 2M88A 4LF4J 2GAGC 2J0XA 2WVFA 3NXZA 4MIBA 1LWEB 2IA6A 2LCWA 2E5LJ 3RBEA 3A8KA 4Y2CA 1MLAA 1ICEB 2NCKL 4O44A 3Q8SB 2FHOB 1FNOA 3QGPA 2LEAA 4DV7J 1O0PA 5LT5A 5ETKA 5ETPA 4K5RA 2GS8A 3N6NA 2LP4A 1XJWB 1XQIA 4X4QA 2HGMA 1X4EA 3KNAA 4ZVEA 4ITSA 3CJTA 1UZDA 2PMHA 1Z2LA 3OR2A 1TK0A 2CJQA 5A8WB 1XNRF 2V9KA 4JV1A 2WONA 3JSBA 4KB7A 4WP3A 1ZZNA 1HHQA 3D7SB 3PYGA 1U6FA 2B56A 2HWTA 3L09A 5L9XA 5HROA 2A0FB 1U49A 3AFGA 3LWMA 1X31C 2EC2A 1NM2A 2ALYB 5I3UA 3MR3A 3K5PA 4DF8A 2JSXA 2JFKA 5A8RA 4HL9A 1MU2B 3MEKA 3PHEA 4RW4B 2AYEA 1WJ9A 1RAOA 1C0TA 1YWXA 1NCLA 2KZZA 3NWRA 1UP1A 3M30B 4Z2XA 5JVHQ 1U6BA 1NDPA 2V34A 3K59A 5DETA 1N48A 1IQZA 3PKMA 1HNIB 1NSKL 3PR4A 1V3RA 1I94F 3KOAA 3ZZTA 1D8ZA 1SJQA 3Q8PB 4I7FA 2YWEA 2Y1JA 4CDIA 4WTYA 3CJSA 2IVYA 3M8ZA 3H2VE 3T1AA 1WUUA 2NZCA 1G6BA 3AAWB 5L8RC 3UCUP 2I9SA 4ZCLA 3ET6A 3S7RA 1CJTA 3M9NB 4KGVB 4YN3B 3ZNJ1 1RHMB 2CYYA 1VIXA 5T7LB 2ZH2A 1WSVA 1IR1A 2GIRA 4B9SA 2C3UA 2CZ4A 1E6YB 3BBBA 2P9EA 1WKLA 3UDCA 3M1VB 3IBWA 3SQGB 2HNDB 3CCZA 1FJGF 4ZVRB 3CC7S 3CD6S 3A3NB 1IBLJ 3DOMA 5LMUJ 4ZPWR 4WZQA 3J80U 1TKZA 3PACA 4JI0F 2RILA 2QMXA 1KNZA 1JJ4A 4U6PA 5FJ4A 2HG4A 3V81A 2QMWA 2F9DA 2H9ZA 1EP4B 4LF6J 1R6YA 1H98A 4CLWA 2PE8A 5AJ3J 2OTLS 3UCGA 2HZAA 4RW6B 5KFQA 1FFWB 3VVUA 4W98A 1S1UB 5EWFA 1N0UA 4A8QA 4IDKB 1DJ0A 2V67A 2MZRA 2FJEB 5DZ6A 2OGUA 2H1YA 3D6HB 1IQTA 4LVOP 3AB4B 4IKAA 5IQ6A 4NI2A 2JLGA 1T95A 1S59A 5E3AA 2VFRA 5CYQB 3U1NA 1RXOB 3Q23A 1T03B 4K4ZA 2H3EB 4JOUA 4HH0A 3O44A 4O4GB 4CT8A 5CA5A 1VMBA 1TKXB 2VBXA 3CTRA 2E1CA 5A76A 1S76D 1KVJA 2B8QA 3THTA 1IKVB 3C16B 3KLEB 3DRPB 2AJ1A 2LU2A 1QUPA 2VA2A 4UZCA 3DGVA 1K47A 2HHVA 3ZZOA 3NY0A 1JX4A 2EWHA 3GFXA 3AY0A 4TLRA 4K59A 4EBCA 1KQFB 2BANA 3DU5A 2AZ1A 3I32A 2V8DA 1RWNB 3TX0A 4Q44A 2ZWOA 2W8LA 1YKWA 2J5AA 1K9MT 4WZMA 1V3ZA 1YI2S 4FKXA 1X4DA 1NZAA 1UW4A 3VGVA 2QL5B 3H7HB 2Z2YB 1Y3KA 5K9FA 1JLQA 5KOWA 2BQUA 1H72C 4DQQA 4ZLPA 1KHVA 1HQ2A 3MR2A 4NLDA 4RNNA 2GNKA 2JC0A 3UDEA 3FKBA 2HW3A 1CC8A 2CVIA 1WC3A 3OUYB 4WKRA 1J5OA 3OLBA 5E33A 2B0GA 4Y2MA 2W4DA 1XBWA 2OMOA 1M5PC 2B7CB 2B9WA 3MEGA 4ILLA 2C2MB 3HX9A 2YWWA 1RWOB 3BGFA 2DBBA 3GSIA 1MMNA 2XO6A 3S01A 4DF4A 2UUBJ 1PILA 3ISNC 4KO0B 1UVKA 2ZJQQ 5EHHA 3AXMA 5CABA 2IJNA 1YJ9S 1RZMA 1UMJA 1FRMA 3FRZA 1S1VB 4ETXA 4DHVA 4M5IA 2BA9A 4DCPB 2K1RA 4HACB 4H4OA 4O3SA 3G6ES 1S1WB 4RBTA 2Q3PA 3FK4A 1UEKA 3DNCA 4DPXA 5AE2A 2ZJPQ 1GH8A 1TVRA 3QAEA 1SH2A 1F3FA 1NJYA 3UN5A 2HBQB 3IRWP 1KFSA 3CULA 1Q95G 5E3CA 2G4BA 1HW8A 1IXKA 2W2NP 3QO9A 2XMWA 5BR8F 2HVZA 2Y1RI 5C25B 2DJWA 2AWZA 1QSYA 1OY9A 5BJRA 3NBPA 4PQUA 5KFLA 3H90A 1BC6A 2RE1A 1RTJA 3PW5A 1RTIA 5LSLA 3NS6A 4IOAQ 1LKZA 1NSPA 5D4NA 2Z56B 4YS2A 1WI6A 1ZA1B 1N52B 5KFGA 3H25A 1NEEA 1LWFA 4QYZJ 1QY7A 4YB7A 4ZCMA 5J2QA 4KIAA 1NH8A 1Y11A 1YBAA 4DV5F 3BM7A 1HR0F 3GFYA 3KK3A 1HNZF 3ELHA 3R2CJ 2GJFA 4ID8A 2HHWA 3FUYA 3PHTA 1B4SA 1R8BA 4OLPA 5KFJA 1S9EB 3M8QA 2X51A 4EO6A 1PJ7A 4DPWA 1RAEB 3CMQA 1UVIA 4A8XA 3DDKA 1P27B 2VF3A 4YOEA 1G2EA 4PXDA 2L3MA 2R4FA 3IN5A 2E7XA 1Q78A 1CJVB 1QAJA 1SJ1A 4KYZA 3HT3A 3KHRA 4ECSA 1F0XA 4NLSA 4JV5F 4Y2IA 2UUAF 2NZ4A 1S97A 4USWA 3KFWX 2LQJA 2PGCA 2KFYA 2E9TA 3DFEA 2QYGA 2EI5A 2G0JA 3SXLA 2QA1A 2BE7D 1TUGB 4P2XA 4DQSA 2A2DA 3QZ7A 3W9JA 4KAIA 1RQ0A 4X65J 2MQ8A 2UXBF 3KLFB 2OEMA 2E29A 4RU2A 1RTHA 3K58A 2X3GA 2E7VA 2QFIA 1E6VA 4AXJA 4A8YA 4EK2A 4OZ2A 2HHUA 1T9UA 1H74A 2UP1A 3R7BB 2Z2MA 4X2BA 2A18A 2VV5A 3M4XA 2YKMA 1N5VA 4O23A 2VQEJ 4B9NA 4OL8A 2W2MP 4WIQA 5I4MA 1SCJB 4C0OC 5CYMA 5B7WA 2FLPA 1SL0A 2JHEA 1TL3A 4TXSA 2PT0A 2MZJA 1RTZA 4LREA 3BO3A 4LQ3A 1IKXB 3H4BA 4G6VB 2R8IA 2OKQA 3US5A 3N01A 2KXNB 3TJ8A 2DGWA 4AFFA 5DLGA 4OHZA 1F1BB 5KG7A 1GK8A 4WCEQ 2KVIA 4YR0A 5RUBA 4HEA9 5A8KB 2VKZG 4OHXA 1VJQA 4QIGA 4ZJQA 2CPHA 3I82A 4KKOA 1GMVA 2W01A 4ANCA 1S1XA 5J1EA 2DXFA 1S1TA 4ED4A 5D6GA 1F5BA 2OEKA 1TKTB 2EFOA 2RQ4A 4UOGA 3BH7B 4X4PA 7FDRA 4ECXA 2F4VF 4H4MB 1RYRA 2QL9B 4ZVHA 1VQKS 1FXDA 4O3OA 4I2QA 2ROEA 1FXLA 4EO8A 2J0WA 3R3TA 3W2VA 4JI7J 5LOQA 5J2PA 1PKUA 5L38A 3O6QA 2DGTA 4EYHB 3QGHA 3JTNA 2XMJA 2HSEB 1URNA 2CQ3A 2WOMB 4A8KA 3S1TA 4Y34A 4NXNJ 3C66A 1K0TA 1HWKA 4LRBA 2UVRA 1NHKL 1X5PA 2G1DA 5B0DA 3GV7B 2NYHA 1UJ5A 1WHWA 2W7OA 4U9RA 4UOHA 3R5JB 4HI2A 2NPFA 2AYGA 2ASLA 2DITA 1H7WA 5EUHA 1B64A 4KV8B 3CO9A 3G6YA 3F73A 4EZ9A 2F63A 4CH7A 3EDQB 5EWEA 3VZHA 4C2MA 1SV5A 4FYYB 4DBQA 1VQ6S 1M1HA 2B4UA 1RT2B 4QWAA 2JX2A 5LMNJ 1WDTA 5DG9A 1S0NA 3H2LA 4ZVGA 3IC1A 5KFCA 3HJVA 4LR9A 5IZHA 3OQ2A 1RWMB 1YK9A 1BHNA 4I2PB 5D4LA 4DSKA 3AT1B 4ZVQB 1HLWA 3QFWA 3KUEA 3AD7C 2ASDA 3IR6B 1KC8T 5HK4A 1ZPVA 1X60A 4DWIA 5KAKA 3MMCB 1N88A 2HVHA 1LK5A 5KG6A 4G1QB 1TL7A 3CCWA 2BJ1A 3RAMA 2MZQA 4RUBA 4DSLA 2PN6A 1KLNA 2OI2A 3BKTA 4ANEA 1TFWA 4DL6A 4HT5A 5KT3A 1TU0B 4GKJF 1KD1T 4B3SJ 4LF9J 1WD6A 4P71A 3WC0A 3D9BA 1VQMS 1FVSA 2WCXA 1ULRA 2HRUA 4C8OA 4B08A 1RBLA 3QQCD 2XS2A 2VB6A 4LVNP 1NLKL 5CD4H 3MM7B 4U8VA 3MM8B 4M94A 1KOHA 3KG0A 1IM4A 5CQGA 3U1MA 3PIPQ 4HLBA 2ZM6J 4ZITA 3BN7A 2CNLB 1YG0A 1Q53A 3HVAA 3SFGA 1J27A 1NDLA 4W4MA 3UR0A 4G65A 2ATCB 5HVGA 2OD6A 2RNEA 1N6QB 2YKQA 2MQPA 3NL0A 2RRBA 3OL6A 1P1LA 3FZBA 2ILYA 2M8DB 2Y8YA 1HBNB 2IHR1 3HULA 1QD1A 3Q8VA 2G2OA 1G7CB 4K2XA 1WHYA 2KN4A 3HI9A 3M6VA 4I67A 2GHWA 4CLSA 4F0KA 4DV2J 3J7YI 2RRAA 3ZZPA 1IBMF 3I5BA 3HCXA 5IOLA 5KFYA 3C6TA 3LGNA 1VC5A 1ACMB 3TQ1A 1MROB 2K3KA 4DR1J 4PKDB 4IRDA 3MDFA 3HFKA 4RW6A 1S6PB 3MM9A 1Z2ZA 1S1UA 2MQOA 2D1CA 4IDKA 4KE5A 2ZEJA 3M9MB 2CADA 4RR5A 4ZHRB 4XPEA 2IRXA 4B9TA 3CUNA 1FRLA 3TAMA 1REVB 2D3OR 1VQ4S 3W9HA 5CYQA 2DNNA 1REGX 3JYTB 1RP5A 2HMIB 4OYBA 2DY9A 2E5HA 3QLHB 4ZN3A 3M8WA 3D6FB 9RUBA 1EX8A 4ZP7A 1BMQB 1PIEA 4CI0B 5K5MA 5ETSA 1T02A 1KONA 3ITHA 1T05A 2IM2A 3BKUA 1SJ4P 3C46A 2CDRB 4DV4J 2RHQB 2ZUGA 1Y10A 2R7WA 1KP6A 4F3QA 1ZTWA 1BD6A 1IBKF 3OR1A 4L6V3 5A6WA 2NSCA 3CDWA 1VRUB 2QV6A 1AZSA 1RTDB 5B0FA 2XC9A 1U1LA 3HFVA 4OX9J 1UPMB 4ELTA 4KFBB 4OYAA 1BQMB 5LXRA 5ETQA 2EXUA 4CLFA 3CJKA 2BV3A 2LECA 1KSPA 3VALA 1RAJA 1H38A 4N8OA 2CQ0A 3RRKA 1CQNA 3K8WA 2HRYA 3JQJA 2HFVA 1UVNA 2KZMA 3CDEA 1R89A 3TW0A 2V8PA 2XNRA 1RWUA 1U24A 1WF2A 1JWWA 1SJFA 3BYRA 2YNGB 4ENOA 1U1NA 3GFZA 3WX4A 4NMXA 4JI1J 2JRSA 3RR8A 2YWGA 2J8AA 4CO4A 2HHHF 1CVJA 5ETVA 4HDGA 1F60B 5J1PA 4KO0A 2CPFA 2NPIA 5EN1A 4CLKA 1U0HB 2FY1A 3Q2SC 2RUSA 4DV6F 4XO0A 2DHSA 1Q8BA 4ES2A 1IJFB 2BBEA 2EEYA 1JKHA 2FLNA 2DR5A 3W63A 3E01B 2KTQA 1YZ6A 2Q1LA 4NE9C 1GTEA 1U1QA 5HN0A 3GU0A 4DFPA 3QZ8A 2QLXA 4MH8A 2IM1A 4P2SA 1GMWD 3MPWA 2AJ4A 3C15B 1KQKA 3GR1A 1NXIA 4PR6A 2RSQA 1RT6A 2V2QA 1GFWB 3UO0A 1KFDA 4USVA 3PFOA 2HHQA 3FQLA 3QGGA 2BX6A 1FD2A 1T3NA 3EZUA 3IBFB 2D3ZA 3K7RA 2C42A 3HXMA 1RLDA 4WXOA 3DGPB 4F26A 4ED0A 4M5NA 3TANA 5BYRA 5CAAA 4OV6A 2ZBQA 1VHIA 3DOKB 4A8MP 3UD5A 2FUG9 5AT1B 2RJZA 1S77D 1Z1ZA 4NEZA 2FJWA 1LFWA 3OXFA 2BJ9A 4JI2J 1TUVA 2QJ3A 4RBUA 2FZKB 3J7ZT 1NH7A 2CVEA 1SIZA 4V1Ak 4CM2A 3QJPA 2LXUA 2BMBA 3K57A 1SKWA 4LJMA 1WKJA 4MIAA 5GAEI 1KWMA 2GVZA 5KFXA 5L1IA 1T9YA 4B3MF 1X5OA 1IKYB 1U4BA 1S9EA 3TX8A 2V0NA 5CHCB 1MMLA 2C2DA 2MHEA 4JB8B 3UE2A 4FXDA 2W24A 2IC3A 3ISZA 4WWSA 3CPWR 4L3NA 5GMEA 4O3RA 3NGUA 3PG9A 2DR8A 4LSNA 4DZ6A 1FDNA 3KTQA 1FDDA 3S6EA 2AX1A 5GVQA 1VIOA 1WC4A 1YJ7A 6AT1B 1W2IA 5IFMA 2GGPA 4PUOB 5H9EJ 2RHSB 2MKSA 1K8AT 1MWQA 1XR5A 1UWBA 1FK9B 3UD3P 2ZH5A 1NPKA 4DOZA 4NLVA 4DR7F 4ZJOA 1GMUA 1DQ9A 1YGYA 2BR0A 3P5TL 3RZAA 2B6AA 3MAQA 2IM3A 2M52A 3I9V9 3UWTA 4DR4J 1NMEB 2LQBA 1W25A 4RW7A 4N47A 4LFAF 1WNEA 1V5IB 4DX6A 2R7SA 2DGQA 4AD6A 3CCQS 1LWCB 2CQPA 1S72S 2HAIA 2JEGA 3EUNA 3Q86A 3FSIA 3Q8QB 4ANDA 1CJUB 3W5ZA 4Y3CA 2FYXA 4KGMA 1T3OA 3CDAA 4DN9A 1M5HA 4C11B 3GIMA 1GNKA 4YHHJ 2OPPA 4DR5J 1HNVB 1UA0A 2Y1LB 2R2TA 3W3SA 3VAGA 2DD8S 4DG1A 2VU5A 1FF2A 3D5MA 4NXMF 2YX4A 1L3TA 4DV7F 2BKNA 4CWBA 5IM0B 1N4LA 2ZH8A 1FKPA 1TL4A 2PFFB 2RF2A 1X9WA 3TUPA 1G3OA 4TKTA 3DLBA 2P8IA 1BY9A 4CM0A 5HSPA 1QTNB 4ZIWA 1HFEL 3UNGC 4DMZA 2BW7A 4K2JA 5D78A 3BPSP 2QSWA 4ZP8A 3I9ZA 1EETB 2J9DA 4BBYA 1JLAB 2QE5A 4FYDA 5DO2A 4LF2A 1DBDA 2DTJA 4PAAA 1OPZA 4DSEA 1DHMA 2HFSA 3PJXA 1PBUA 2A6OA 1URRA 2VG7B 2GJ2A 1QLNA 3E51A 1UFKA 4D3HA 3N4WA 1RCOB 5M2PA 2PSZA 1S6QA 3QIDA 3KHGA 2QRRA 1S79A 3CJ4A 2W4PA 1F5AA 4CP5A 3TUJC 2V4JB 2WTFA 3PYDA 3LPYA 2WBMA 1RHJB 2VBYA 2P5VA 2K8GA 3B54A 2ZHOA 3MCNA 3OW2R 3NGTA 4KV8A 4P72A 4NYZA 3OTDA 2B7BB 2BRLA 2JC1A 3OD2A 4C8YA 1QTMA 2WW8A 2D74B 1TL5A 2VG6A 4DR6J 5KG2A 3OTOJ 2G0CA 3PEHA 2RDDA 2PC6A 4DN0A 4GRSA 4WBFA 2GMLA 3IR5B 5JJBA 2KRRA 2XS5A 3HSJA 2CQGA 3ILLA 3KK1A 4P73A 1IR2A 4G1QA 4WK3A 3SI8A 5I3QA 3TVYA 1WC1A 2J6UA 3ZZ0A 1KRPA 4IFVB 1PBAA 1KTVA 3KHHA 4X4UA 3TZYA 1O8BA 3MM6A 3KLGA 1Y00A 1RAHB 4QBUA 3DLKA 1PYTA 4ID5B 4ZOSA 4HR2A 3I5AA 2XWXA 5D0GA 4OV1A 5F8JA 4W92B 1N56A 1JJHA 2I5JB 1DURA 2R7VA 3GJRB 1Y4ZB 1OY6A 1IBLF 2CQBA 3JSMB 1JLGA 2OPSA 4KHPJ 2XLIA 4R0EA 1R0AA 2MLXA 3GR0A 4LIRA 2FQQB 4LF6F 4E0DA 1UJ4A 1CBKA 2DNPA 5AJ3F 4ED8A 3MM5B 2GVDB 2HFUA 4M63A 3M9OB 2FVCA 5KG3A 2HGLA 1M5VC 5F9NA 4RW8B 1C1BB 1HBNA 3BV8A 3I31A 2WW4A 3NMAA 1D8YA 4QW8A 2VD3A 1VRTB 2UV8A 3W1YC 2KKHA 2O5DA 1FEEA 4JI8F 4LBHA 2YNIA 3D0GE 3RGIA 1DLOA 3W62A 4Y2AA 2BJDA 3M2UB 4RBVA 1TV6B 2AEFA 3HZGA 3VV2B 3SV4A 2FJDB 3QYYA 4ZDNA 3AOAA 4LF8F 3FEYB 3ENWA 3SDEB 4LBPA 1ZA2B 2VFUA 4FF4A 3DRXA 5DJBA 3DMJB 1T9XA 3N28A 4IG0B 1RADB 5B0AA 8RUCA 2J9DE 1NBEB 4JI5J 2OLWA 2P2CB 3ENVA 2AD9A 4K4UA 3POTB 3UFCX 4NYPA 1JLBB 1FKOA 5HLFA 1FRXA 1OWXA 1KKHA 4DV0J 1WTBA 1ZM4A 2ZDOA 4KRWA 2VPZB 2ZBRA 4UW2A 4PPZA 2AP6A 2NXJA 2P6TA 1ROFA 4HHHA 2JWNA 4O44B 3RW7A 3R2DJ 1Q8KA 1DQAA 3OHBA 6FD1A 2UUWA 1XERA 4ZPBA 1Z4UA 3JS9A 3T5LA 4DDFA 3LH2S 2B4PA 3AQPA 1JJ2R 2XS7A 1CS4A 2VQFJ 4FS2A 3FMWA 1VRUA 2UUBF 4DV3F 3RB4A 3OR2B 1YHQS 2CWXA 1D9FA 4OI1A 3MGJA 1R7IA 2IBKA 2HQDA 2WONB 4F7VA 1VDHA 1BQMA 3OFFA 4X4TA 3CO0P 1VYAA 3HSGA 5HROB 4DL5A 2E9RX 4FBUA 4MMOA 2M5YA 1RHQB 2GQQA 4L75A 3W64A 3MXHP 5I3UB 4N7TA 4O3NA 3EGVA 1JXVA 3BN4A 3HM9A 2IMWP 3BH6B 4A47A 5A8RB 1NSQA 1EIYB 2VC0A 3IBCB 3BYPA 1Q5YA 2DRAA 3PO5A 3GB0A 1SC6A 3AJ2A 1CSJA 3DYAA 3LP2A 2KO1A 4RNMA 4F25A 2V50A 1U2CA 1PGZA 1EHWA 5D0RA 3RG6A 4PYAA 2DHXA 2DVIA 4ILRA 2GV1A 1B0TA 4I7FB 1DQ8A 2DR6A 1Q8IA 2KB2A 2DNOA 4EEYA 2HLUA 4Y6IA 2XG8A 3TJAA 3IG1A 3E01A 3BR8A 3FBFA 1TQLA 4F4ZA 2UZAA 4C9DA 3ET6B 1RWXB 1CJTB 2XMUA 1X0PA 3WIVA 3A1YG 4YB5A 5C42A 4FPIA 1U2FA 4YY3J 1TFYA 3DLLQ 1N32J 2HVDA 2XBPA 2CNKB 1IM6A 4OZLA 2MQNA 2ZVIA 2MQQA 4ECZA 4IYQA 1R31A 2HBZB 3L7UA 1SKSA 2ZDPA 3UVJB 3ZTPA 3DOMB 2EFNA 2IA0A 4ZVUB 1HBMA 1TKZB 4G1IA 2JLEA 2ZH9A 1FWLA 3V81B 5KT5A 3N0VA 4UTGA 3M8SA 4RJVA 1NUEA 4X64F 1N36J 2IY5B 2GZOA 4JYAJ 1NK6A 5IS2A 3C14B 4LMZA 1PYSB 4L74A 4DS5A 3MAAA 4DPUA 1ZAXA 3HHLA 1C4CA 4ELUA 4NZ7A 1WF1A 3LW5C 3K8VA 4NI2B 2CQ2A 3PW0A 4H4KA 2W7AA 1HWIA 3OSPA 4EZ6A 2VQEF 5G0RA 2XMTA 1HNXJ 3QWPA 5E41A 3VAKA 1CULA 4DPYA 5F8LA 2GIFA 3CCUS 4PXEA 2YNFA 4AUKA 1VK8A 1KQSR 2L08A 1FK9A 1UEUA 1R6VA 4FNHA 3BBFA 4CZCA 3R7NB 1EZZB 1U6ZA 5T41A 4DSIA 2BE2A 2YPYA 4ELVA 2IDEA 3BGLA 1NB7A 5K8MA 4FZVA 4IFYA 2BANB 2KG0A 3R27A 5LJ5Y 4P75A 5AE1A 3LALA 1XN9A 2WBRA 4J9RA 2EVZA 1HIYA 5IV4A 2L9NA 2D3O1 1UAWA 5SZTA 1HWJA 2DH8A 3R5BA 3QJJA 2KU7A 3CGIA 3KJQB 4KHMA 2MLYA 3JQMA 4C11A 2CG8A 1JLQB 1HNVA 3BREA 4ECYA 3MOZA 3O5TB 5CZXA 5E5NA 3CJ3A 5L1KA 1GAOA 3W66A 3K5LA 3SEOA 1AUDA 2KJWA 3TAPA 3FZ2A 2OUGA 2D7SA 1H73A 2IJRA 1J5OB 3KG4A 3DI6A 3OFEA 2WK4A 1LW2A 4QZVB 3ILIA 1LXNA 4KSEB 4N56A 3QRRA 3MEGB 3VGTA 1SC3B 2CJYB 3TI0A 4DL0C 2L48A 1U1PA 1VQ5S 1A9NB 3MPVA 3DLGA 4NL5A 4NCGA 3IFEA 1KEKA 4CTAA 4KY3A 5CCLA 4LFBF 3KK2A 2Y0SD 5ETRA 3QRPA 2QLBB 2ZNZA 2K1RB 1V6HA 5CZVA 4H4OB 5LMNF 1YRTA 1VQ9S 5IT9Y 1RAGB 2RAQA 3PFEA 3OL7A 4TY8B 3CJ0A 1TVRB 1VI7A 3SZ2A 1I94J 2W1BA 3G8QA 2E5IA 2KVQE 2R8GA 4PPDA 4N41A 4IR9A 2UUCF 3IA0A 2VA3A 4X4OA 1XMBA 1KOOA 1S48A 3M2RB 1YRXA 4FBTA 4N5SA 4NWBA 3QO9B 3GILA 4IH7A 3PO4A 2WSFC 1A0OB 2HNYA 2ZZNA 3LTOA 3RBDA 4M5LA 1WKKA 3NBPB 2DGSA 2BQ3A 2M9KA 4PQUB 2CJBA 2GW8A 1HL6A 3NOCA 4B3SF 4LF9F 1TAQA 1RTIB 4GO5X 3T5JA 2EG2A 3MR6A 1RB0A 3CJ5A 1RAFB 2FGOA 3RRGA 4ZPAA 1LFPA 1SKUB 1LWFB 2FY8A 2CJKA 3PJWA 4CO1A 5C5JA 4X62J 4C3KA 2GMJA 3W9IA 2B4VA 5L46A 4DR3F 2M7SA 3G9CA 5DQHA 2BOPA 2Q79A 2BJ3A 4FN5A 1TZ0A 4JI0J 5F0WA 3KK3B 2NLWA 2CQ4A 3SMZA 4M95A 2MGZB 3PKYA 2BKPA 3OHAA 3W65A 3AB2B 2CPYA 1QUVA 5I42A 1RT4B 3M8QB 5EWGA 1CEZA 5F9LA 5ITHA 1ZZFA 3PW4A 2ZITA 2V8VA 3PY8A 1FHTA 2OO4A 2I5JA 4GKKJ 2HFZA 4WTOB 3CD7A 5FLXU 4XDDA 3G8SA 2QL7B 5F3TA 4FF1A 3NG8A 1U47A 2FJXA 3V2UC 3ULHA 3QSYB 2QEXS 2GIQA 3NGSA 5CH7B 3P49B 2L9DA 2Z57B 2VL1A 2J0SD 2OPRA 4GO7X 2IYGA 3WBZA 3AOBA 3H8YA 4ATNA 1JIHA 1WI8A 2XY6A 3C19A 2HWIA 5GMKa 3UPFA 1JLFA 2MKHA 1YVFA 3F41A 3M6UA 3R8YA 2AV5A 4I1TA 5ETTA 3M8PA 2ZC4A 1KVKA 4NA1A 1QAYA 2JVRA 1R27B 5F8HA 2M4MA 2YKMB 2B9EA 1RKJA 4PG5A 4OJHA 1APSA 5CYMB 1VQNS 3OTCA 1NPRA 3NGDA 1TL3B 3VVTA 2K3IA 2VKRA 2HQIA 4F3OA 3CJRA 1XTZA 1TK5A 4FNIA 1QDUB 5HBMA 2MKYA 4LRFA 4CNZA 1BGXT 4OI6A 2Q6CA 5KFRA 2W25A 3RU0A 2NXNA 3SV3A 1QJHA 5KFTA 2FHMA 2KXHA 4O4RA 4ECVA 2AHOB 3DMJA 4C98A 4W90B 4IG0A 4Q0BA 3BQ0A 4JI3J 4UT4A 2MKJA 4M1KA 4UQTA 4NCAA 1T9TA 4KKOB 3Q8YA 2WVBA 1UZHA 3LA0A 3TP2A 2M3DA 3GJQB 4OX9F 1RLCL 2EK1A 2KYXA 2LA4A 1S1TB 2OAUA 4LRAA 5DM7Q 4AQYJ 2OHDA 2AGPA 4I2QB 4OZ1A 3W2VB 2XSJA 5J2PB 4IRKA 2ZWPA 1IWGA 1V5VA 2L41A 1GXLA 2CPDA 2I8EA 4BHQA 5H9FK 2DNKA 4JI1F 1FTCA 5KTQA 1UJ6A 3RW6A 1UPPA 3DRRB 1VISA 4BCAA 4XAKA 1LOUA 3F0NA 1H7XA 4N77A 3I4HX 3G6XA 4ETZA 3P5BP 3DN9A 1NPPA 3MOJB 3MD3A 5JVGQ 1GEHA 3ZXWA 4PG7A 1RYSA 1SXLA 4P7VA 3GLJA 1DTTA 4OI3A 4U7UD 1S6UA 1HWLA 2GA7A 1SV5B 4U96A 4ED2A 1N5YA 1NJIT 3WHIA 1ZOTA 4U8YA 2F9JA 4I69A 4PYDA 2HVEA 3LGMA 3CB4A 3DXSX 3CJQA 3PW2A 1W2BR 4F8RA 1NKEA 2QLJB 3VAHA 3ZTRA 1FE4A 2XWYA 5IQQA 4J9LA 1IR0A 2E9ZA 2FC8A 1DAXA 1F9EB 1Q7LB 3GYNA 3OFHA 2MTLA 4ERDA 1OYEA 2D9OA 4CCHA 4WU2A 1TL7B 5HMWA 3KYLA 2HHTA 1V3SA 2F40A 3MR7A 1AW0A 1XWLA 4IOBA 1FX2A 4PG8A 5KG5A 4DI6A 1U7LA 1HNZJ 2FVPA 3KNGA 2ZUAA 2R2RA 2FHJA 2NXUA 1P1TA 1U45A 1R0CB 4B3TJ 5KT6A 3HHNB 2MJUA 2Y9HA 2J6TA 2HKEA 1NHUA 4CLUA 2XHWA 1UL3A 2I38A 2A1BA 1NU4A 4JI2F 1FRJA 2OH2A 4F4AA 3PVXA 1F5CA 3NAHA 3SIPB 1DZ5A 2MYFA 4WFZA 2DT9A 2RU9A 3DC2A 4ZVSB 4JV5J 2DYAA 4FP9A 1VC6A 5F8NA 1IKWA 1TK8A 2R7RA 5H1SV 3K5NA 4EUVA 1IN0A 3L9ZA 4CYUB 4ES3A 1FRKA 2MSTA 4KC5A 1Y5LB 1IJEB 3UVJA 3R7SB 2HYIB 2UXBJ 4I68A 4I6WA 4OMFG 4F4XA 2F65A 2N82B 4Q2MA 3R9LA 3G8TA 4Q5VA 1KS2A 3MURP 3NNHA 2KRBA 3C6TB 3W8PA 1S12A 2IAJA 2VG5B 2BZ2A 4ZLNA 3SCJE 5DDQC 3IRXA 2VPWB 2VOOA 2R7QA 2N4CA 3CCES 3SFUA 5B08A 3C14A 2G9OA 3SYZA 3MM9B 3PYFA 1EB0A 1YX2A 1U26A 2BJ8A 2DGXA 1XC9A 3SCLE 5F8GA 5DGBA 2C2EA 3LAKA 4Z7CA 4RNHA 5AXKA 3TAMB 2ZBCA 4ZVPB 4CLLA 4C8LA 1HARA 4YQWA 3BKFA 1EKSA 1U1RA 2ZBIA 1JLEA 2DEJA 1L3SA 3IWXA 3RJMB 1YJTA 4USJC 1T0TV 4OYZA 3ZTSA 3VTIA 4JBCA 4ZIVA 5B0CA 4QIWD 4DR2F 4DR5F 2C3YA 4ZP9A 5DM6Q 1X4GA 3T1HJ 4Z7YA 3SSQA 2CJ9A 3KLIA 1NB2A 1HYSA 3ITHB 3M8YA 1RHUB 1T05B 1R3NA 4WYLA 4D3GA 1UVMA 2PO4A 4MIWA 3QNWB 1LQ9A 1L3UA 4MKVA 2PFDA 4USKA 3OR1B 2VBWA 3W5YA 2QSFA 4NCBA 1AZSB 1N34J 1AB8A 2N7YA 2FLOA 3H40A 1PJ6A 3MMAA 3GV8B 4DV1J 3TYTA 5KFAA 4DUYJ 4K0KF 3G6VA 4NZ0A 3M32A 3MECA 4DL2A 5JXSA 1RCXB 2ABYA 3KMSA 3N79A 1RABB 5FDLA 2CA9A 3MD1A 3CJKB 1TR0A 3O1LA 3CJ8A 2XGPA 3QIPA 2H5EA 2XLKA 5KT2A 3CIZA 3KG1A 1KLMA 1R8AA 3PM9A 2ADCA 3KHLA 4QPXA 2FTRA 4P10A 4A8OA 3L4BC 4DX7A 4QYZK 1RT3A 4TU8A 4WXWA 3TJ9A 3C8YA 4OJ3A 3LP1A 3G82A 4AYBD 4J9SA 5JMNA 1QE1A 1XR7A 4RU9A 5DRKA 1OY8A 2KDOA 2P9CA 4LSLA 4V19X 3G4SS 4ED5A 1IBCB 3CD5A 2DNRA 2Z8QA 5B09A 4NMLA 4NLYA 4NRTA 1JKHB 3GCXP 4TY8A 4ZLJA 4RNOA 2W9BA 1NK5A 2FHKA 1U1OA 4LF1A 3I4PA 3OL9A 3R6LB 2PI5A 1HI1A 4GVBA 3WC2A 3T1YJ 3M2RA 2FC9A 1AFJA 2LQ9A 4P74A 3EVMA 2QA4S 5M2UA 3EDRB 4ED1A 2RQMA 3HF5A 1RWWB 4KGXB 1RT6B 3OTEA 2LYVA 5B0EA 4DLGA 4PEOA 5IC6B 4QWEA 3A3PB 1WOPA 3LQVA 1YJWS 3DHWC 1TKDA 5L1JA 1TTHB 1SKRA 2GJIA 5GMDA 2BE9B 3IAS9 4F67A 3GZ7A 3EGZA 2G1HA 3NNCA 1Q7YT 2O3DA 3NWGA 4EYIB 2DRDA 5KFOA 2UXCF 4K5SA 2NUUG 5IV3A 4J90A 1R8HA 4WFAQ 1TMMA 2MJNA 4QWBA 1CJKB 2WZ1A 4JP8A 4KHPF 2M0GB 4DCJB 3PX4A 2DNLA 2G2ZA 3P8BB 4AL7A 2F5GA 3GIRA 4DFMA 3OLAA 1IBMJ 2MGZA 3FNNA 2GVZB 1UKUA 2O1PA 4TQSA 2YKPA 2VBZA 1RT4A 3CCJS 5ETLA 4I6YA 5KFUA 3JTOA 1HBOA 1ZAVA 1KVIA 5BXIA 2J7KA 3TQEA 2BOAA 4R5PA 2IC3B 4K4VA 2QFJA 3I0RA 4PWDA 3CF5Q 4DCOB 3MEDA 4WE1B 3RYLA 1XMOJ 4LSNB 4Y28C 2IIHA 4ZLLA 4L73A 2E1AA 1NK9A 3VWSA 2M8HA 1WF0A 2HLTA 2GGPB 3PW7A 2JEFA 3TEGA 2CJAA 1UWBB 2J7WA 3I87A 1T9WA 2PA3A 3CCLS 3OBIA 1RT5A 3CEDA 2MXYA 5DGAA 3WX8A 4F50A 2B6AB 3Q2TC 1S9GB 2HS4A 2IJFA 3D2WA 3BSAA 4R8UB 2C2KB 4WIIA 4RW7B 1JQGA 4USMA 2AYBA 2KT2A 4U67Q 2DHAA 5E2QA 1BWVA 1UFLA 4C8NA 2U1AA 4DPTA 3BQ1A 2DH9A 5AXLA 3ZO7A 5D4OA 4JI5F 1ZM2A 2RS8A 4OIXA 1OO0B 1VQSA 3W61A 1IBKJ 2D9PA 5LL6d 3U02A 3TA2A 6FDRA 2CG4A 2MSSA 5ETNA 2OPPB 4DG1B 1A7GE 2X3DA 1OSDA 3AHPA 4X4VA 4NA2A 5F8MA 4M5HA 1FTRA 3KDNA 3D6TB 1AT1B 1EKRA 2JVOA 1ZAWA 2M2BA 5SUHA 2I2YA 3TRGA 1N33F 1FKPB 2JNJA 2DO0A 2RF2B 1HI0P 5HP1B 3HKZD 4QCLA 3IS9A 2VQFF 2HK2A 2RIJA 1DRZA 1I6JA 3EX7B 2BQRA 4B9LA 3PDNA 2CUYA 2HIYA 2VJVA 2ZOGA 3VAJA 4E8UA 3GJSB 2RUGA 5HATA 4NLOA 3NGRA 2CRLA 3R6GB 1J2VA 3V6HA 4IUFA 4RPFA 4DX5A 2UVUA 3BO4A 3GPAA 2CAJA 2R8JA 3CDUA 2KFNA 3LPEA 3OJUA 1NK8A 4QIVA 4ZVOB 4Q8EA 2K7KA 1RU1A 3QBCA 2H48B 3FRYA 1SB6A 1S4EA 1S6QB 3MMJA 3FCHA 2F8MA 1VOMA 5F0UA 2YQ3A 3DRRA 1U02A 3MR5A 2R42A 2HS3A 3HVRA 2BJ7A 1D9DA 4J9QA 2AW0A 2HPUA 4P2FA 2DXEA 2PMWA 4YDDB 3SCIE 4LFCJ 2JEIA 5K14A 3CD0A 4RWWA 2VG6B 2GX8A 3M2VB 3UN2A 3IGNA 1FT8A 1JB0C 5D3GA 3K5MA 3BJYA 1F9FA 2HAFA 2C3OA 3X3UA 2Y0BB 2C22A 3EVOA 3KK1B 4DJBA 4CO0A 1B70B 3TOQA 1X4AA 2LVWA 5THWA 4WFXA 1FNXH 1N32F 2ZHBA 1NDKA 3D4JA 4ED3A 1WEXA 2R7UA 1FVQA 3KUHA 3JQKA 2HZVA 3MM6B 5KFBA 3KLGB 2RU3A 4UQGA 3DLKB 4K4WA 3MTKA 3Q8RB 4K4XA 3F56A 2R7XA 4LF7J 5G4DA 2UVVA 4J91A 4PZVA 1JK9B 1BUXA 4B3MJ 1CPZA 4G1PA 4UUXA 1JLGB 4A46A 4C4WA 4RKUC 4OZJA 3VGSA 4C97A 2V4RA 2OPSB 3BB5A 1R0AB 3VR1A 4QWCA 3CIMA 3HLUA 1NO8A 1BQNA 4XPCA 1YJRA 1HW9A 5E3QA 2X1BA 3B4DA 1RT7A 2YPZA 2N3OA 4IO9Q 2HGNA 1C2PA 2BKOA 2DIUA 2MZ1A 2J76E 2BABA 1DFDA 2N4DA 5JUMA 2LDYA 5L9NA 3UCZP 4NLPA 4B17A 4CYUA 2HWHA 3V6KA 1MN7A 3GSDA 5KFHA 3SBMA 3TVZA 1AFIA 2W2PP 3UDLA 1NJWA 3VQSA 3I6PA 2DXDA 4LFAJ 4ALZA 1VQOS 1NZ8A 2JDJA 2YNIB 3L7OA 3HHDA 4BDPA 2H5JB 2V8GA 2KT5A 1PYOB 1DLOB 3V6JA 3TAQA 3HZEA 4OI0A 2VG5A 2G0IA 4NLQA 3HDSA 3MPDA 2IRYA 3MZIA 3Q83A 3SCKE 4P7TA 1LWXA 2XM3A 4HH1A 1T94A 4ZP6A 2JJ4D 2X1GA 2KXFA 4TNOA 3AQOA 4A8FA 2CPXA 4ECUA 2EG1A 2LLZA 3GTYX 3HVWA 3VAIA 4NXMJ 2J9CA 1VC0A 3IO1A 1HPZA 4RWXA 4YFUA 4WPAA 4ZA1A 3NS7B 4UOCA 4YR2A 3M7VA 1YIJS 4OX8A 1VFJA 3B8HA 1N5TA 1FKOB 5IXUA 1HNWJ 4LQ9A 5HLFB 3DRSA 2AZ3A 1F6TA 2QN6B 4HHUA 1HQUB 3BQ2A 4MFBA 1D09B 4NLRA 2CPIA 4I4BA 1X9SA 2EBGA 4ICLA 1OQ6A 3UDVA 1HQEA 3J7AN 2MKIA 3CCVS 2AIRB 2JH3A 3RTVA 2FJVA 3VZIA 4GC6A 3W7BA 2V2ZA 3I55S 1D1UA 3F44A 3HSDA 1CS4B 1AUSL 5DZ7A 5GAGI 2X1FA 3RBXA 1B0VA 2CQDA 2GC8A 5HJYA 1RU2A 2B5JA 1FRIA 1S0VA 1C0UA 2OFGX 1JJCB 1FX4A 3HHLD 4BC7A 5ETOA 2DK2A 1SQFA 4KH0B 4P6QA 2X7IA 5M2RA 2ZE2A 4ZKAA 4F2SA 1D9AA 3L95X 5KFSA 5C24A 1SJRA 3CDBA 3D54A 3V4IB 3ADAC 2ROGA 2UXDJ 4U7CA 2V94A 5D0EA 3G71S 3EPGA 2WSEC 4UOFA 1WOOA 1YJVA 1ZPWX 1VQ8S 5HL7Q 1XNQJ 4OHWA 1KN6A 1X4CA 2FJAB 3CCTA 2WB1D 3D0HE 2VHGA 3T6BA 1WG5A 4R25A 1LNQA 4QJVA 2XYGB 5EGYA 1RWVB 2CQIA 3GMGA 1SL2A 4MKYA 4OZ5A 3DYAB 3LP2B 1RJJA 2WHOA 5H9FJ 3I96A 2D41A 2ZD1A 1RT1A 1X7VA 2MLZA 2O67A 4B9MA 2ILZA 1Y0HA 1NDCA 1W7WA 2YQ0A 1K1QA 3FCVA 1HMVA 4HTIA 3FQKA 3P4UB 1Y3JA 4NX9A 2KM8B 4TQRA 1J5EJ 2YWKA 4XK8C 2UU9F 1PC5A 1IWAA 1HA1A 3PV8A 1TL1A 3FJ2A 1Q81T 5K8PA 5DG8A 3PRDA 3IG1B 4X62F 1U1MA 1NK4A 1KTQA 5E3RA 7AT1B 1S10A 2V68A 5IC4B 1HBUB 4PABA 4DU8A 3HJFA 4S0MA 3Q24A 4R0JA 2OEJA 2KI2A 5H9EK 4N76A 4LT6A 2ROPA 2ERRA 5C42B 1C1CA 5K20B 3MI7X 4PWWA 2XI3A 4J9MA 1JMTA 2CNOB 5FIIA 4M8LA 4IRCA 2F4FA 3U27A 3C6UA 2MDAA 4ZK7M 4F0MA 2BDPA 1MG7A 5KFKA 2ASYA 2B43A 4B3RF 4GKKF 5D4PA 5D77A 1HBMB 2HHSA 4IQXA 1B3TA 3GQCA 1CJKA 2B9XA 2Q66A 5A0YA 3A12A 1NAQA 4ECTA 3E3XA 1RI7A 1GXUA 2YX7A 4JI8J 2XCPA 1L5UA 4F4YA 2FVRA 3MPYA 1Q5VA 4ED6A 3V4MA 2YTCA 1UEVA 2VFSA 1HI8A 1WTFA 1SIWB 4EFAC 3HT0A 3CMAS 2CZVC 1RBOB 3Q8UA 2RS2A 3FFIA 3TVKA 4MK8A 2V5HG 2WB4A 3MAAB 4EBEA 1HHTP 4ILMA 3HHLB 3QPIA 1ZBTA 1YSJA 5LXYA 4LF8J 2BXJA 1T7PA 1VS3A 4WE1A 5DS7A 4BC9A 5B0GA 3DM2A 5G0RB 2HNZA 4HDHA 5KG4A 4ER8A 1CULB 3DDIA 2QG9B 4WP8A 1FE0A 4C7QA 4DQIA 2YNFB 5E7OB 3NP5A 4TN2A 4CLPA 3MUTP 3PX0A 3LWLA 3AXKA 4QR2A 2DGOA 3DLEB 1KBRA 2V6AA 4USIA 3PRVA 1VJWA 2BE2B 1S9GA 2A2CA 2EC0A 2MEWA 4R8UA 2XQCA 4IFYB 2DGUA 4DXLA 1Q0NA 1LV5A 4JI3F 1H2UX 1S7IA 5HI7A 5HJXA 4KR0B 3THPA 4MJKA 2I0XA 2BRKA 3SQOP 2BW2A 2KYZA 3CE8A 3DU6A 2YNHA 1CG2A 4CLZA 4Y65A 3MMBA 1WELA 2U2FA 1VBYA 2HFOA 4LF4F 5K8NA 3E8OA 1WEZA 4AQYF 4DV3J 4HHJA 4WFBQ 2E5LF 2GFFA 3T19A 3IWLA 4TU7A 4FF2A 2AQ4A 4J9VA 4A4JA 3NGKA 4NEYA 2VPYB 3EGNA 2RKIA 4MT1A 3HVTA 2XZDB 3DI6B 5HP1A 2ZBPA 1LW2B 1ELOA 1WSRA 4CO3A 4EBDA 3FDSA 4Y00A 4LIWA 4USTA 2Y1IA 1FERA 1QAIA 1QVGR 3RRHA 3OT9A 4AL5A 3KUGA 4MAKA 2LMIA 4KJIA 5HANA 3MUVP 2Q43A 3DLGB 4NCGB 4U95A 1X8DA 3QT5A 4CTAB 3AH6A 3E2EA 3KK2B 1ZYQA 1WORA 3RUBL 4RUCA 1NHVA 3O8WA 2F7VA 1XMQJ 4QYRA 1VBKA 4B9VA 3AJDA 3N5BA 4OYXA 3W5XA 2QGFB 4EU0A 2VASA 4ZVFA 2XCAA 2W9CA 2Y3YA 3DLJA 2JOQA 2ZOFA 3Q22A 4FVMA 4LUBA 2XNQA 2ZFHA 2K06A 2MKKA 1MN9A 4QR0A 3V5RA 1SH3A 2QYCA 1PO6A 2K2PA 4ZPVR 3ZC4A 5J2NB 4E98A 3MTJA 2HNYB 3IM8A 3U7JA 3OFGA 4O0IA 3IGVA 4RX6A 5GADI 2V2KA 4URQU 3KJFB 3CCMS 1O51A 4OYMA 1TELA 4WJBA 4B3TF 3LF0A 1X5SA 5HMYA 2RB7A 5LJ3Y 3M2VA 3LUYA 3BSNA 2RVJA 5EX0A 4NPOA 3GIJA 3V6DA 3EVWA 4DLEA 4GC7A 4M5DA 1FJEB 4IG3A 1G4CA 3OPKA 3QJLA 2NUHA 4C0BA 1NJXA 3LP0A 2V69A 4X66J 4IR1A 2ZH6A 4J9NA 1WC6A 2GO9A 2HEKA 3GYGA 1DY3A 2FVSA 4LSZB 2R2UA 2IFXA 3WQPA 3VHQA 5I42B 2EKYA 4X64J 1NK7A 2OIHA 2PDAA 5IT4A 2CIMA 4DSJA 4LF5J 2R3VA 4UUWA 5LMUF 9ATCB 3NMRA 5A6PA 1LXJA 1S4FA 1F3VA 1BLUA 2OPQA 3G2XA 1FXRA 3M6WA 2VJUA 3J7Z5 2HQFA 3FSYA 2YBVA 3Q0AA 2OPRB 2ZZMA 2HURA 1LW0A 2AEJA 1B7YB 1FFSB 4K4SA 4OZNA 4MK9A 3ENQA 3IM9A 4B3OA 4M5JA 1JLFB 1WG4A 5HMXA 2LEBA 4L76A 2DNMA 2G2YA 4WU3A 5KG1A 3M8PB 2YH1A 4ZPCA 2AGOA 3TUZC 2Z2LA 1M5KC 3J81j 5J2MA 1MWZA 5KFNA 3EGWB 2CZ9A 3KLHA 2IVMA 3L3CA 1JLCA 2FHJD 3KMQA 3EWGA 3EZOA 3GE9A 1LEOA 1Q16B 5IWAJ 3T1HF 5F41A 3I0SB 2FB0A 3W60A 3EYZA 3DDNA 4OQJA 3VAMA 1WDDA 4KPYA 3DXBA 5HBMB 4MTPA 3PR5B 2GHPA 2HQ3A 1LWEA 1T11A 3EM1A 3HD1A 2RDIA 4OFZA 2COLA 2K7JA 4Q0BB 1RUSA 1N34F 4TYBA 5D8HB 2GCFA 1N54B 4DV1F 4DUYF 1K1SA 4LRCA 1Q86T 2HHPA 3T9NA 2DHHA 3KDOA 3TZZA 3RBZA 1VQYA 4J9UE 2E44A 2BM1A 1V9OA 1N5SA 3TZXA 1HQUA 5A8WA 3H2UB 3A3OB 2P6SA 2BUNA 2HBYB 3TO8A 4X4SA 4J9PA 2AMCB 2XSJB 4LFBJ 4X4RA 4OX7A 3BO2A 3D1OA 4CRJA 2YKOA 3HP6A 1QAXA 4NASA 1UTAA 2EK6A 4CIOA 1ZM9A 1YBUA 1SQGA 1L3KA 5KFIA 1SJ3P 2QA2A 2GHVC 3ETMA 2DCLA 1MU2A 1NSAA 4RW4A 2UUCJ 2I1RA 4DFKA 4EGLA 5CXTA 4DL3A 2YWHA 3W8GA 3WZ0A 1OIAA 4J5OA 2ACYA 4QIEA 3O3LA 4JI6J 1DTTB 2HHXA 3M30A 4OJ1A 5C7PA 4DUZJ 2XLJA 1N5YB 3VGUA 3V4IA 4F2RA 3J7A1 1SUQB 1FWKA 3D68A 3BS9A 2MMYA 2E1PA 3AA9A 4C3LA 1HNIA 4K4YA 4KT0C 5KFDA 4M5GA 4O3QA 4I56A 4ECRA 4P9SA 3H5YA 3T1YF 1O5JA 4LR8A 3M6XA 1JXEA 2R9LA 3KJVB 4F4KA 5GAHI 4USHA 4DR3J 3RB6A 3BDPA 2H4WB 4ED7A 3PEJA 2CPEA 3VQTA 4LRDA 1VQ7S 5T7LA 3A8EA 2C3PA 2LQ8A 2AT1B 4NOHA 3EXYA 2CKWA 3HMJG 1E6YA 2LKZA 2DRBA 4ZCIA 3M1VA 4F0HA 2HQCA 3SQGA 2AJQA 3CC2S 2HNDA 5DG7A 1RHKB 2QT7A 4NYOA 2C28A 1HBUA 1IUJA 1VBXA 4JV2A 1GT8A 4PRFA 1NKCA 2XB2D 1I1GA 2FJBB 4NLTA 2DNQA 3A4TA 1U0SA 2BYCA 1UETA 3LOUA 1EP4A 3JB9k 3K89A 3J7YU 4Q8FA 3FEXB 1IKWB 3OVBA 1Q79A 3PRBA 2XYHB 3OL8A 2CPZA 4JI4J 4ZS6A 1DTQB 1YLXA 1SQEA 3D3BJ 1K44A 2NSBA 4C0HA 3D3CJ 4TU9A 4C48A 4FS1A 3CCRS 2YXLA 4NLGA 4DL4A 1XMOF 3QT7A 2C2ZB 4FYVB 1YBTA 3UR3C 2SXLA 1K0VA 1UVLA 2O01C 2CXEA 2IAJB 4DUTA 1GX5A 1T03A 2CQHA 3IRXB 3ISND 3ZZRA 3RR7A 4URSA 3A13A 4O4GA 4X65F 3AD9C 1TKXA 2DISA 4YEAA 3WIUA 2QZ8A 4FYXB 3NCPA 1IKVA 3C16A 2H65B 3KLEA 3DRPA 2XSFA 2YKAA 2CFXA 1VCTA 3NS5A 4KQZA 1FRHA 3GWCA 3ZZYA 5DDRC 3MUMP 3FBBA 2W9AA 1JLEB 3OTBA 2GMHA 5HVFA 1TMJA 3FEZA 1I51B 1DARA 4YR3A 3TNVA 4QU7A 1BWEA 1YZ7A 1CC7A 4GMKA 2H5IB 2B9YA 2RMLA 3IP0A 5GAGU 2NYIA 2RD5C 3AOCA 4DQRA 3HHEA 4DPOA 3KLIB 3DLEA 1HYSB 3D28A 3H0PA 2A10A 2VUGA 1WHXA 3OJSA 3GJTB 4OYWA 4QW9A 3FC9A 3PZPA 3T3FA 2QLWA 2WSCC 7FD1A 4NLXA 3TUIC 1XK8A 3OUYA 3C3LA 5EX3A 1EARA 2ZH7A 3D67A 2I6WA 4B02A 2F1FA 1SC4B 3MMAB 1SC1B 4ZMMA 4XDCA 2XMVA 3M32B 2FGCA 3MECB 4PQAA 3TEHB 2ATLA 1VQLS 3G86A 1JNRB 3NRBA 5FDLB 4DQPA 1TP7A 3QIPB 3TR5A 1XNRJ 1OQ3A
chains in the Genus database with same CATH topology
3M9OB 1PC4A 2FVCA 1G6BA 3AAWB 1ZM2A 1FA0A 2RS8A 4JI7F 2W8KA 4OIXA 2BM0A 5KG3A 1KLMB 1S1VA 4OX6A 1Y7PA 2HGLA 5L8RC 2I9SA 3UCUP 1M5VC 4TY9A 2HVIA 1OO0B 1VQSA 4ZCLA 2D9PA 5LL6d 5F9NA 4RW8B 2MHNA 1C1BB 3S7RA 3U02A 3TA2A 3M9NB 6FDRA 1HBNA 2CG4A 2MSSA 3I31A 1RT3B 2VPXB 1G1XA 3NMAA 2OPPB 1S1WA 2VFVA 3FVYA 1D8YA 4NXNF 4QW8A 2DCUB 2CYYA 1VIXA 5T7LB 2VD3A 4DG1B 2ZH2A 1A7GE 1VRTB 2UV8A 1OSDA 2GIRA 3AHPA 2KKHA 2O5DA 1FEEA 4X4VA 4B9SA 4JI8F 2C3UA 3LP1B 2CZ4A 4NA2A 5F8MA 4YP3A 2YX1A 1E6YB 4J9KA 2YNIA 5A2QY 2P9EA 1FTRA 3N6LA 3UDCA 3EZ5A 3M1VB 4I64A 3IBWA 3D0GE 1DLOA 3SQGB 2JVOA 1ZAWA 2HIQA 2M2BA 5SUHA 1YJUA 4Y2AA 1QE1B 2BJDA 1FKPB 3TRGA 2I2YA 3M2UB 1N33F 2DO0A 2DNGA 2HNDB 2RF2B 1HI0P 5HP1B 2OMLA 3HKZD 3CCZA 4QCLA 4RBVA 1FJGF 1TV6B 1WEYA 1R8PA 3IS9A 1A6LA 3GG0A 2VQFF 3CC7S 5C25A 3CD6S 4LSLB 2OD4A 3FSXA 3HZGA 2BJEA 3DOMA 4IOCQ 4LFCF 3RB3A 2RIJA 4ZPWR 4WZQA 1FKAF 4URGA 2KHCA 1TKZA 3PACA 3SV4A 1DRZA 4C3MA 4JI0F 4WF9Q 1I6JA 2RILA 2FJDB 3EX7B 2QMXA 3QYYA 4ZDNA 2BQRA 4B9LA 1UA1A 3PDNA 4LF8F 1KNZA 1JJ4A 4U6PA 3FEYB 5FJ4A 2HG4A 1S6OA 2ZOGA 3VAJA 3V81A 4E8UA 3ENWA 3SDEB 2RUGA 2QMWA 2F9DA 4NLOA 2H9ZA 2W9BB 2DPIA 2VFUA 1EP4B 2CRLA 4FF4A 3DRXA 4BWJA 4MK7A 3DMJB 5DJBA 5B0BA 1J2VA 3N28A 4IG0B 3V6HA 4IUFA 5B0AA 2OTJS 1R6YA 1H98A 2J9DE 2UVUA 2PE8A 4PCQA 2OTLS 5LSOA 3BO4A 3UCGA 2R8JA 3CDUA 4C8ZA 2OLWA 3ENVA 4RW6B 5KFQA 2AD9A 2EFGA 3OJUA 2KFNA 1KHWA 4QWDA 1NK8A 3POTB 1ZETA 4K4UA 3UFCX 3OXLA 5IT0A 4NYPA 4OJGA 4QIVA 1S1UB 4CT9A 5EWFA 5J2NA 1N0UA 4A8QA 4IDKB 1DJ0A 1JLBB 4Q8EA 2K7KA 2MZRA 1FKOA 2FJEB 3R5DA 5HLFA 1FRXA 3FRYA 1SB6A 3MMJA 1S6QB 1OWXA 3CWJA 4OHVA 5MLCV 2DB1A 2R2SA 1RKIA 3FCHA 5U47A 2F8MA 1IQTA 1VOMA 4RNFA 1WTBA 4LVOP 1ZM4A 3AB4B 4IKAA 2ZDOA 2AJFE 4KRWA 5IQ6A 5KFPA 5F0UA 2VPZB 2JLGA 1SH0A 3JSRA 4LF7F 1M5OC 1WHVA 2YQ3A 1T95A 4UW2A 5E3AA 3DRRA 4PPZA 2AP6A 2VFRA 5CYQB <