4RW7B

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
424
structure length
405
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 102
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B03
3MTKA 5CYMB 4FBTA 4O3RA 2FVCA 5HROB 5KFGA 3FQLA 1QE1A 1W25A 1TKZA 3C6TB 1QAIA 4KFBA 3OSNA 1CSJA 4YR2A 4RNMA 1N5YB 1C1BA 4EBDA 4KV8A 2HWHA 4ED7A 5JUMA 3BJYA 4MKBA 1IKXA 4NLOA 1RT3A 1SUQB 3LP1A 3M8QA 3TAMA 2UVRA 4YR0A 3H2LA 4O44B 3BGRB 5C42B 3GILA 3MECA 3MF5A 4ZP9A 3GIJA 3T5KA 1TP7A 4DG1B 1LW2B 3KLHA 2J6SA 2YNIB 4K4YA 3HVWA 1S1UB 1TL3B 3V81A 2OPQB 3IN5A 4GC6A 3V6DB 4ZVHA 5D3GB 1WNEA 4O3SA 4RNHA 2UUWA 4QWAA 3GV5B 3HVTB 1HYSB 3NKYA 2IAJB 4ICLA 2IC3A 1N56A 3FRZA 2RKIA 2YKNA 1SH2A 1RTIB 2B5JA 1D1UA 3DI6A 5KG4A 4QWEA 5I42B 2R8JA 3DOLA 4MK9A 3DLGB 1LWEB 3GIKA 3EPIA 3PW5A 4NLTA 3KHRA 4MFBA 4HYKA 4ID5A 3HHKA 3CJ0A 4K4WA 3BSOA 3QIPB 2RF2A 4B3OA 1HNVA 1RT5B 3DLKB 2IM2A 2ZE2A 4NLRA 1S0OA 2GC8A 3QGHA 4ZPAA 2D3ZA 4LQ9A 3NAHA 4EO8A 5J2NA 3C6UA 3QLHA 1S9GA 3QO9A 3GIMA 4K4VA 2XCAA 1NNDA 2D3UA 2W9AA 2UUTA 3OLBA 2YNFA 2GIRA 3EZUA 4WYLA 3MFHA 4ECZA 4DL3A 2HNZA 4LSLA 3IG1A 3LAMA 4WE1B 5L1LA 1REVB 2VA2A 1IKYA 4ECVA 3Q8QB 1C1CB 1HPZA 3MEGA 5KFDA 1S9FA 3N6LA 4R5PB 4RW7A 1S49A 5KFFA 3BQ0A 1MU2B 5K14A 3KK1B 1RA6A 5JXSA 3IRXB 3PR5B 4IR1A 3KMSA 4Y2CA 2JEGA 4NLUA 2YNHB 4IOBA 3UDLA 4ED1A 3FSIA 1RYSA 4NLWA 4PUOB 4J9MA 4IRCA 1HQEA 1REVA 1TL1A 3KK2A 2R2RA 4H4OB 4YP3A 2XWYA 1JIHA 3DLEA 1S6PA 3KK3A 2AX0A 3H40A 4IRDA 1ZTTA 4EBEA 2W9CB 3KLIB 5KT6A 3CDEA 3IGNA 1JLFB 2BRKA 1RTJA 4M94A 3I0RA 1HQUB 1MU2A 1XR7A 3KLVA 3LANA 2XC9A 3M9MB 2AGOA 2R8KA 1SV5B 3DYAA 5DGBA 4K4UA 5KFOA 1EP4B 4QWCA 1JKHA 4NLSA 1TKXA 4ZPDA 4QPXA 4TQRA 1DLOB 3DOKB 4IH5A 4Q8EA 2FJVA 3DRSA 2VG7B 4PUOA 3NBPA 4I2QA 3KLFA 3LP0A 2R8GA 2ZD1B 3MR5A 2BE2B 4ECUA 2WK4A 5HP1B 3UQSA 1RT6B 2OPRB 3D5MA 4F4WA 2DPIA 1DTTA 3FFIA 2WONA 4K4ZA 2YNGB 5DLFA 2R8IA 3T19A 3GQCA 1FKOB 2W9BA 1DLOA 3NAIA 5KG0A 4WFXA 1T03A 3CWJA 1RT7B 3I0SA 4OL8A 1NHVA 4O3PA 4ED2A 1TKTB 3RBEA 1RTHB 5HBMA 3DMJA 3MR6A 1JLQA 3RB0A 2C22A 3LALA 5HP1A 1ZTWA 2OPRA 5KT4A 3BSNA 1QE1B 2FVRA 5KG5A 4TY9A 5EDWA 5F9LA 1TKZB 2FLLA 4KFBB 5DG9A 4TN2A 4NYZA 1HNIA 4ZP6A 4YR3A 4F4ZA 1GX5A 3V6JA 2HNYB 4O4GA 4J9OA 4IDKA 2V4QA 2XI2A 1K1QA 3LP2A 1IKXB 3BREA 3CJ4A 3LP1B 3M8QB 3TAMB 3BSCA 4KE5A 1IM4A 5KFUA 1JLCA 4DEZA 5DQIA 1QUVA 3Q8RB 4K4XA 3MECB 3T5JA 3GV8B 5F8JA 3ISND 3T1AA 4NLYA 3Q8PB 1TVRB 3KLHB 4RNFA 3H5YA 2BQUA 2BR0A 4NZ0A 4Q8FA 4MKAA 2WTFA 2VG6A 4JV0A 3KLEB 5KFWA 2HMIB 1LWCA 3V81B 3MEEA 3DDKA 2HNYA 4WYWA 4ECTA 4GC7A 4HKQA 4NLDA 4U6PA 3KHGA 4ICLB 2IC3B 1OS5A 1FKPA 4ZVFA 5C24A 2RKIB 1JLEB 2YKNB 4Y34A 2XCPA 4R8UA 2B5JB 4WXOA 3DI6B 4KKOA 2FLNA 2ILZA 5KG3A 3MR2A 2OPPA 4ZHRA 4YMEA 4EBCA 3DOLB 1TVRA 5EUHA 2AGPA 4DL2A 2AU0A 1RT4A 4MFBB 3V6KA 4ID5B 1KLMA 3KLEA 3OSPA 1S9EA 2HMIA 4Q45A 4H4MA 3KHLA 2RF2B 4B3OB 1HNVB 2WHOA 4U7CA 2ZE2B 3TQ1A 3NMAA 1S1WA 3EPGA 1VRTA 2FVPA 5J2NB 2BQRA 3KMQA 3C6UB 3KJVA 1BQNA 3QLHB 1S9GB 3QO9B 3CVKA 1JLEA 1I6JA 4NLPA 2XGQA 1R0AA 4PWDA 2YNFB 4IH6A 4URGA 5F8LA 5F9NA 4RW8A 5DQHA 5KFCA 2HNZB 2VG5A 3IG1B 4LSLB 1GX6A 4ZP8A 4RU9A 4QWDA 2ASJA 5C25A 2OH2A 3G6XA 1S0NA 1IKYB 2B6AA 1HPZB 3MEGB 3DRRA 2YKMA 1IKWA 1YVFA 1T05A 4RW7B 4I2PB 3GYNA 2IM1A 5K14B 2IJNA 5L1KA 3BSAA 3CJ2A 4IKAA 4LSNA 4K4TA 2RDIA 3RB4A 1UWBA 4NRTA 4WFYA 2AGQA 1HQEB 2I5JA 1RTDA 5KFZA 3KK2B 1TL1B 4ED0A 5DQGA 2WCXA 3OL6A 3DLEB 1S6PB 3KK3B 2J6TA 4K50A 4I2PA 4IFVA 4MH8A 2FVSA 3KOAA 1RTJB 1DTQA 1S48A 5J2MA 3I0RB 3IS9A 3JYTB 3ICLA 1TV6A 5F8MA 3DYAB 3D28A 4Y3CA 4ECSA 3RAQA 1S1VB 4KHRA 1JKHB 2C2EA 1TKXB 2OPSA 3ISNC 4RW6A 1JXLA 4QW9A 3DRSB 1JLBA 3NBPB 4I2QB 4IG3A 3LP0B 3KLFB 2IM0A 2AWZA 4JV1A 4M95A 2CJQA 4FS1A 5DG7A 1S97A 2AQ4A 2HNDA 4O3QA 4J9PA 1C0UB 1K1SA 3SFUA 3DRPA 1DTTB 3FFIB 2WONB 1S1TA 3JYTA 3QIDA 4KHMA 3I5CA 4KBIA 4ECWA 4RW9A 1N6QA 1MMLA 1S1VA 1S6QA 4Q43A 5F8GA 2W9BB 1TQLA 4J9RA 4DL4A 4ZPBA 3CO9A 1NHUA 2D41A 3H59A 3SFGA 1T03B 5KFNA 3MEDA 3I0SB 3OL9A 4Q0BA 5KG6A 4J9QA 3UR0A 5HBMB 3DMJB 4ED6A 1JLQB 1FK9A 2E9ZA 5L9XA 1C0UA 3HKWA 2B43A 2UVWA 3CIZA 4NLVA 4KO0A 3T5LA 1N4LA 3RB6A 1HNIB 5J2PA 2BQ3A 2F8EX 4FS2A 3KLGA 1J5OA 3MFIA 4O4GB 2WOMA 4IDKB 3LP2B 5KFSA 4ECXA 3PW2A 1IKVA 4QW8A 1QAJA 4KSEB 5KFRA 3DM2B 1JLCB 3G6VA 5DGAA 1N48A 3RB3A 3NL0A 4XO0A 2BANA 4RW4B 4H54A 1BQMA 2VG6B 2ILYA 3FDSA 1EETA 1LWCB 3H4BA 3MEEB 4RUCA 5KFLA 1Z4UA 3PVXA 1XR5A 5J1EA 5F8IA 2W7PA 4J9KA 2XGPA 2W7OA 3SI8A 1JLGB 1RT1A 1FKPB 3G86A 3M8PA 5C24B 3DM2A 4G1QA 2O5DA 3GIIA 4R8UB 5DG8A 4IRKA 4KKOB 1RT2B 3JSMA 5J2QB 3V4IA 3RAXA 2OPPB 4ZHRB 4F50A 2C2DA 4URSA 5KG7A 2CKWA 4RW4A 1RT4B 4O3NA 4J9LA 3OHBA 4FBUA 1KLMB 3CDWA 1S9EB 4JV2A 4H4MB 3PZPA 4JUZA 3KHHA 4I7FA 1RAJA 4MK8A 3OL7A 1D0EA 1S1WB 1VRTB 4F4YA 3KJVB 1JLGA 1BQNB 4TXSA 2EC0A 4EEYA 5KFJA 4NCGA 4ED3A 3UPFA 4MIBA 1RT2A 5J2QA 1R0AB 1JLAA 4PWDB 2ZKUA 4TQSA 4RW8B 2VG5B 1LWFA 5C25B 5T14A 5HLFA 4IFYB 1S0MA 4WZQA 2B6AB 4K4SA 3Q8SB 3E01A 3DRRB 2YKMB 1IKWB 3LAKA 4WFZA 3ITHA 1HMVA 1T05B 5KT3A 1S1XA 2FJXA 2AX1A 3I5AA 5KFQA 3FQKA 5FDLA 2ALZA 4KB7A 1ZETA 2VA3A 2V4RA 4LQ3A 2E9RX 5F8HA 4XPEA 3PW7A 4LSNB 5KT2A 5EWGA 1UWBB 3PJXA 5CYMA 3KNAA 2QE5A 2GIQA 2I5JB 5HROA 1RTDB 4MIAA 5DLGA 4IFYA 2ASDA 2E9TA 4X2BA 5KG1A 2V9WA 3C6TA 2RDJA 3QYYA 4IFVB 1KHWA 4RZRA 1DTQB 1N5YA 2XI3A 5J2MB 3IS9B 1TV6B 5KG2A 1SUQA 2OPSB 3PJWA 4IQXA 4ZMMA 4O44A 3BGRA 4RW6B 5C42A 4ZVEA 3V6HA 2IBKA 1JLBB 5KFBA 2UVVA 4IG3B 5KFMA 2R2TA 4DG1A 1LW2A 3BQ2A 4ECYA 4IR9A 2YNIA 4NLQA 3QZ7A 4TY8B 1S1UA 2HNDB 5C5JA 1TL3A 2J6UA 2JEJA 2OPQA 3N6MA 1S10A 3V6DA 2UVUA 2ASLA 3DRPB 1S1TB 5D3GA 3MR3A 2IM3A 1VRUB 2JC1A 5KT7A 4RW9B 1N6QB 3HVTA 1HYSA 1S6QB 2R2UA 2IAJA 1RA7A 3CDUA 4O3OA 2ATLA 1RYRA 1RTIA 3CJ5A 3OL8A 4NLXA 2R2SA 3QGGA 3MEDB 5I42A 4ZPCA 2IA6A 2C2RA 4Q0BB 5KFEA 3DLGA 1LWEA 5EWEA 3M9NB 1FK9B 5KFIA 4TY8A 3T5HA 3BR9A 4EYHB 3E51A 3QIPA 3QZ8A 1RT5A 3DLKA 3IGVA 4PQUB 4KO0B 4XPCA 1VRUA 4ED8A 2FJWA 3RBDA 3PW0A 2FVQA 1KHVA 5I3UB 4ECQA 5J2PB 4TLRA 1SH0A 2JC0A 3CJ3A 3KLGB 1J5OB 1T94A 3I5BA 4EO6A 2WOMB 4Y2AA 5KFKA 5CYQB 4URQU 5KFYA 5KFXA 1IKVB 2C28A 3VQSA 4WE1A 2D7SA 3H5SA 3OLAA 1C1CA 4PQUA 5KFTA 4KAIA 2WB4A 3PW4A 2BANB 4R5PA 2HWIA 1BQMB 2W8KA 4YQWA 1EETB 5I3UA 3N6NA 3KK1A 2QV6A 1U09A 2I1RA 3IRXA 5J1EB 4NLGA 4RNNA 2IJFA 5CYQA 3TVKA 4QWBA 2YNHA 2IMWP 4RUAA 1HARA 1RT1B 4TYBA 3M8PB 4G1QB 4EYIB 4H4OA 3G6YA 4J9NA 3JSMB 3V4IB 3BQ1A 1LW0B 4ZVGA 4F4XA 1SH3A 3KLIA 3PR4A 1C0TB 2W9CA 1JLFA 3PHEA 5L1JA 4O4RA 1HQUA 1RDRA 1XR6A 1S4FA 4I7FB 2BRLA 5KFVA 1SV5A 2WRMA 1EP4A 5EWFA 5L1IA 4DL5A 3H5XA 2JLEA 2W8LA 4R0EA 4MK7A 3DOKA 2R8HA 4IG0B 4J9SA 4WZMA 2VG7A 4NRUA 5KT5A 4NCGB 4ECRA 3M9OB 2ZD1A 2BE2A 1JLAB 3QGIA 1LW0A 4WXWA 3NGDA 5KFPA 3H98A 3HVAA 1RT6A 1LWFB 5KFAA 1C0TA 3OHAA 2JEFA 1T3NA 1C2PA 5HLFB 4ZP7A 2DPJA 4DL6A 2YNGA 4TYAA 3H4DA 4IH7A 4Q44A 5F8NA 3E01B 3GV7B 1HMVB 3ITHB 1FKOA 1S1XB 2HAIA 2JEIA 5FDLB 4IG0A 3H5UA 1C1BB 4KV8B 2FLPA 1RT7A 4DL7A 5KFHA 1JX4A 1TKTA 1RT3B 1RTHA 2V0NA 4RNOA 4G3IA
chains in the Genus database with same CATH superfamily
1EQ0A 4EZ6A 3TW0A 5JUMA 4MKBA 2QMWA 4P6QA 4KQZA 3LP1A 1N0UA 2MQMA 4ZP9A 1NK0A 4HH1A 1RWMB 4C98A 3BR8A 4RPFA 1UETA 3AB4B 3VTIA 3B4MA 3T3FA 2GJFA 5IWAJ 4BDPA 3GTYX 4GKKF 1PAEX 3PW5A 2D3O1 4LT6A 3QIPB 3MEKA 3K5MA 1ZS6A 1I3OB 2XCAA 4ZIVA 5MLCV 4ANCA 3Q2SC 1RB0A 5L1LA 1VC0A 1XMOF 5ITHA 1U2FA 2Y0BB 4IR1A 4Y2CA 4LF7J 1KVIA 2C42A 1T9WA 2Y8WA 3SDEB 3U1MA 1RBLA 3H40A 3P4UB 3QT8A 1WC3A 2QTWA 4L3NA 3DRSA 4LF2A 1CG2A 2KFZA 2R8GA 1PSDA 3N28A 4OYZA 4C11B 3N5FA 1FRXA 5GAEI 1T03A 4HHJA 4C0OC 2C22A 2GHVC 1YLXA 4PEOA 4YHHJ 2E1AA 5EDWA 1TKZB 1HR0J 2UXCJ 2QO3A 5IFMA 5B0DA 2YXLA 1DFDA 4F3MA 4K2XA 2Y1JA 1T9TA 3VCDA 1UJ5A 5LMUF 2F5GA 2CA9A 2BX6A 2IC3B 5BYRA 2XMWA 4ZVFA 1N36F 1JLEB 2BJEA 1SQEA 2B4PA 1JXEA 2OPPA 5AXNA 5EUHA 1KBRA 3QRQA 4K0KF 5E3RA 3KHLA 1NBEB 2KU7A 2M8HA 1CJKB 3KMQA 1I6JA 4NZ7A 1HI8A 4LR7A 1PIEA 2D74B 2CG8A 3CCLS 3TOQA 2GA7A 4I2PA 4F4AA 1RTJB 3B82A 3ICLA 4X4OA 5ETLA 1TKXB 3P96A 4RW6A 5ETPA 4IG3A 4B08A 1NCLA 4M95A 3BGOP 3CDAA 1WC6A 5LT5A 3FFIB 2WONB 3ZZYA 3I5CA 1YBUA 1O8BA 1S1VA 4DX5A 2W9BB 3JQKA 3MM6B 4U96A 3SFGA 3R5AA 2Z30B 4K8RA 2ZH2A 1YK9A 3UR0A 5HBMB 4NPOA 3TAPA 3LWLA 3MHYA 3QFWA 3PFEA 5HQLA 1U1QA 4R0JA 1N5VA 1U6FA 5HAOA 4QYZK 5KFSA 1EJ7L 2R9LA 4KHPJ 2H51B 1JLCB 2XB2D 2XMMA 4QR0A 1BQMA 2DIVA 4J9KA 2NZ4A 2GMJA 3AD7C 1RT1A 1GNKA 3AA9A 2C2DA 2OUGA 2R7RA 3KXDA 4JV2A 2I9SA 4MK8A 1G3OA 1YHQS 4WP8A 3JTNA 2GO8A 4AXIA 1JJ4A 1M5SA 4WFZA 2YKMB 3QSIA 5B0BA 2Z8QA 2CZ4A 4LSNB 2AF6A 2I5JB 4IFYA 5KG1A 2OEJA 2FZCB 4DQSA 2CPFA 4QU6A 4RZRA 2MZSA 4M5DB 2UVVA 1JLBB 2CPHA 3CD6S 4UQTA 1S12A 4X65J 3J81U 4QIWD 2FLOA 3M9NB 4CTAA 4YUDA 3J81j 3T5HA 1XEZA 1X5TA 2ABYA 3BDEA 1QVFR 3IGVA 4KYZA 2AEMA 3O3LA 5GAEU 2JVRA 2XYGB 1NB7A 3HO1A 5KFKA 4ZA1A 2DD8S 1LXNA 3LA0A 4NI2B 3DGPB 2WB4A 2IDEA 4LVOP 3KK1A 3W9JA 2FJAB 2LQ8A 1QTNB 1B3TA 3FC9A 2DEIA 2DNNA 1Q8BA 4UOGA 1VQNS 1RLDA 1I94J 1VJWA 4P2FA 3AJ1A 2DGWA 3HVAA 1SQFA 3E01B 2B56A 3GV7B 4N76A 4M5JA 2VC0A 3QRRA 2FLPA 4UOFA 3SCJE 1JX4A 3IR5B 2QA1A 4PABA 4O3RA 3N0VA 2E5IA 3M2RA 2NXCA 4PRFA 2CNKB 1WEXA 4HHUA 2JL9A 6FD1A 4ED7A 2C2NA 5GAGI 3TAMA 1SI9A 1NH7A 2C2ZB 2BYCA 1WI8A 2PFFB 3KLHA 2SXLA 1SBRA 4X4UA 3UVJB 2BA9A 3IN5A 5GVQA 1U1PA 3UN3A 4C3LA 2DGVA 2YKNA 2F7VA 3O8WA 3EDQB 2CQHA 1X8DA 4WIIA 3DLGB 5HMWA 3MI7X 1GT8A 2RF2A 1HNVA 3BO4A 1S9GA 4W92B 2FUG9 3NMRA 1HLWA 1TU0B 4Z2XA 2RS2A 2HEKA 1IKYA 2GMHA 4ECVA 2DNYA 3C16B 3BEGB 1OO0B 5A8KB 4IRCA 1KOHA 3MMBA 2HQIA 3KLIB 4MIWA 4RWXA 2AGOA 4CT8A 3EWGA 3Q86A 3KJNB 3DYAA 3QWPA 2XLKA 1YJVA 3KFWX 3NWRA 2VG7B 5HMYA 2BE2B 4ZLNA 1DHMA 1FKOB 2HHVA 4K2JA 2OSRA 4JI0J 4O3PA 2AYMA 5T7LA 3MR6A 3W5XA 5HP1A 4DCOB 1FJEB 3M30A 1NKCA 4X4QA 4DSJA 1GAOA 4TN2A 4F4ZA 4KIAA 4EK2A 2RT3A 4K4XA 3GG1A 1F2HA 2AT1B 4Q8FA 5HN0A 1XJWB 3DDKA 2IYIA 2ZNYA 4KKOA 4WJBA 1SXLA 2V63A 4C8ZA 4ZHRA 2CDRB 2AU0A 2VD3A 1YQHA 4H4MA 3KUGA 3ZZRA 3TQ1A 3DGVA 4N7TA 3I9V9 5D0GA 1C4AA 3ENAA 3G71S 1UKUA 5F9NA 3MCSA 2Q6CA 4F7VA 4WTYA 1XMQJ 4LF9J 1IKWA 2MHNA 1YVFA 1HI1A 4Z7CA 3OL6A 5I3QA 3I0RB 1UW9A 2YWGA 3D28A 3B8HA 1WKLA 1AW0A 5GMKa 1JXLA 3LP0B 1PGZA 2HNDA 1QUPA 3U02A 5BR8F 1S6QA 2CXEA 1YJRA 3HPOA 1NK4A 3CO9A 3I32A 2BEFA 2UXDF 2CPIA 3DMJB 2E9ZA 3D6FB 4QQBA 2B43A 2YPYA 3GE9A 1RWUA 3TUZC 2JZ5A 4F3OA 1J5OA 3H2UB 4LF4J 2YPZA 2DGSA 2KVQE 2EKNA 4XO0A 2KT2A 1KWMA 1DRZA 4HL9A 2VQFJ 5GAGU 2ZJRQ 4ZOSA 2QX0A 2HBQB 4LBHA 2W7PA 4OZ0A 3SI8A 2YBVA 4R8UB 5J2QB 3RAXA 1B4SA 4PG5A 4DR3F 1L3VA 2XM3A 5DZ6A 3NNAA 1H74A 2W2QP 3R8YA 2R7VA 4Z7YA 1NK5A 1X4EA 1LKZA 1HMVA 1TK5A 3KDOA 3PG9A 5B08A 1B0VA 3I9ZA 3PNIA 5DLGA 2XYPB 1BGXT 3PM9A 2VPWB 3IAM9 2L9NA 1DAXA 4F04B 3JS9A 3MM9B 2VBYA 5KFMA 4NXMJ 3BQ2A 3TVYA 3O6QA 2M9KA 4USUA 4Y0FA 3DRPB 3IBWA 1MWQA 3C19A 2G0CA 2N82B 2BACA 3GSDA 3QIPA 2OMLA 3TJAA 1S99A 1IN0A 1NEEA 2FVQA 2VICA 2HHTA 5KFYA 2VPXB 3PFOA 1YBAA 3KJFB 3JQJA 3H7HB 1L3UA 2ZUGA 1VQ5S 4RUAA 2IVYA 4M5HA 2YKPA 3SDEA 2VKRA 5L1JA 4WIQA 2UXBF 4DZDA 3CO0P 3OV7A 2VIHA 5KT5A 3IBCB 1ROFA 4C9DA 1FD2A 1LWFB 1VK3A 2DPJA 4C11A 2F4FA 5J1PA 3OT9A 1VK8A 4KTQA 3OR2B 5HROB 3TZXA 1TKZA 1LFPA 1VQSA 1VLYA 1SC6A 3VQTA 2CVIA 2QRRA 1P8GA 5A76A 5KOXA 4PG4A 3QT7A 4EI2A 1U0HB 1SPBP 2QA4G 5D3GB 1KC8T 4BCAA 2GJIA 2IC3A 2M8DB 5IV4A 3CD5A 4OLPA 4LRBA 3F44A 1K47A 3EGZA 1QDUB 2MLYA 5F3TA 2QLWA 3NAHA 4KH0B 4AQYF 2W9AA 2KJVA 4WYLA 1DQ9A 1C1CB 3GYXB 5K20B 2J8SA 2G0JA 3AHPA 2PEBA 2JEGA 1U26A 2OD4A 3NCQA 4USTA 4ED1A 3J7AN 3RYLA 4DR1J 4A4JA 4OV1A 2CYYA 3MURP 3OVBA 1RTJA 5DGBA 5KFOA 4QWCA 1TKXA 1Y0HA 2EW9A 3MR5A 5IT0A 2CJ9A 3FFIA 2WONA 1OSDA 3TEGA 2R8IA 4ZITA 2W9BA 3MM6A 1Q1KA 5HBMA 3GYGA 5BXIA 1G7CB 3HK2A 3D1OA 3OBIA 3Q83A 2KRBA 3G87A 3UWTA 4AE5A 4J9OA 2V4QA 2BW2A 3TJ8A 5A8RB 3OPKA 1JLCA 4DEZA 1QUVA 3F73A 4PXEA 3GONA 4JV0A 3WDOA 2OMOA 3RG6A 3CXCR 3Q24A 4WXOA 3K7RA 4C0HA 1U4BA 4DV2J 2WHOA 3NMAA 3T41A 5J2NB 1Y11A 4ELUA 1H98A 2CFXA 4JI7F 2XGQA 3RRGA 4IH6A 5F8LA 2P9GA 4ZP8A 4F67A 2YKMA 3GG0A 1G6BA 3NY0A 3GMGA 4P73A 3SQGB 4LSNA 2RDIA 3RB4A 2I5JA 5A0YB 2D9PA 3KK3B 2LVWA 1OPZA 3JYTB 1JKHB 4M5DA 1L3SA 2M5YA 1JLBA 1Y5NB 3L4BC 5DG7A 1PBAA 2J9CA 2D41A 5KFNA 5KG6A 3CJTA 2A1BA 1D9FA 1EX8A 1C0UA 1HBOB 3CUNA 1HNIB 4OHXA 4KC5A 2C2MB 4OX9F 4NI2A 1W26A 3ADAC 3DGPA 1ZM2A 3OFEA 2GZOA 1TAQA 3RW6A 4H54A 1L3TA 1HBUB 3H4BA 1HHQA 2Z58B 5A6WA 5H9EK 4XAKA 2VBZA 1V3RA 3E3XA 1SL1A 4JI3F 1D0EA 3DXSX 1JLGA 1B99A 3VZIA 1R0AB 4IQMA 4NWBA 3TO8A 5C25B 2MY7A 5T14A 1S0MA 2B6AB 3Q8SB 3E01A 3DRRB 2FJXA 5KFQA 2JH3A 4GVBB 4WCEQ 4USWA 3PO4A 4X2BA 5L9NA 5BJRA 3GSIA 1KP6A 2L48A 2JLFA 1IBKJ 1V5VA 3SSQA 2DNRA 3K5LA 4UY8T 3UVJA 2J6UA 2EPIA 1N52B 3HX9A 3M6UA 1T11A 1IJFB 3A1YG 3MEDB 3DLGA 1FK9B 3BR9A 2WSFC 3HVRA 4NZ6A 1KHVA 4RKUC 3CT9A 4Y6IA 3WHIA 1GH8A 1FWPA 2HFSA 2HGNA 2FD2A 3A3NB 4PQUA 3BV8A 4KAIA 5E33A 4GVLA 1UFLA 5C2GA 3C16A 5J1EB 2IJFA 5A8KA 4G1QB 3HHDA 2XNRA 5K8NA 2J7UA 3KLIA 2FZKB 5ETQA 2W4DA 4DPTA 5L1IA 3FMWA 2ZBPA 2R8HA 2CPEA 2VG7A 1CC8A 4B9LA 2PT0A 2BE2A 5CH7B 5KFPA 2BKOA 2GNKA 2CZVC 1HW9A 1FDNA 4DU8A 1FKOA 4NYPA 3H5UA 3EE3A 5B7WA 2WAQD 1RP5A 4Y2KA 4AYBD 1Y5LB 4JYAF 4RUHA 3ZNUA 4LRAA 2KTQA 4X4NA 2HBZB 1H38A 1RT3A 2VODA 2UVRA 3MUTP 4O44B 3K5OA 1Q8KA 4K4YA 3U27A 3ZC4A 1J2VA 3MCMA 1RTIB 1QTMA 1FEHA 2MHEA 2N7CA 4NLTA 1VI7A 1WJ9A 2E1MC 3IBFB 2VFSA 5AT1B 4ZPVR 2V8GA 3UI3A 3GP9A 5HQ8A 2MPUA 2EG2A 5JMNA 2MZ1A 2ZH3A 1BUXA 4ZJOA 3BH6B 3IC1A 1F9EB 3FSIA 2AIRB 2ZOMA 1REVA 2HSEB 2WSCC 2UV8A 2HHPA 3IM9A 3I0RA 1EP4B 2B4VA 4YHHF 5D6GA 3LP0A 1FTCA 3JXOA 1WI6A 2CRLA 4P7TA 3HD2A 4X84A 3QBCA 2UXCF 2G13A 2LDYA 1OYEA 3K0JA 2R7QA 2H3EB 3P5BP 1GK8A 3RBEA 3DMJA 1DBDA 4WK1A 3TARA 4Y2IA 1HWKA 3OR1A 2J9DA 2QA4S 4YR3A 8AT1B 3PYGA 3PCOB 2BM0A 3RBXA 1IKXB 1S4EA 3PHTA 1RACB 3T5JA 2E5GA 4ZVQB 2DT9A 3ZFVA 4WF9Q 4OJ3A 3V81B 4GC7A 4UOHA 2MZQA 2RILA 4R8UA 3D0HE 3DI6B 2CJAA 2GV1A 2ILZA 2YQ0A 1TVRA 4USIA 4MFBB 1HL6A 2AJ2A 3LTOA 1X5SA 1APSA 4YEAA 2CAJA 3QO9B 2YNFB 5HI7A 1GX6A 5HL7Q 2BJ3A 4ES1A 4RW7B 1M90T 2DY1A 3W61A 4TU8A 3LO3A 4CO5A 3EGWB 2B9WA 5KFZA 3CD0A 5DQGA 4L75A 1S6PB 3CE8A 4K50A 4LFBJ 1E6VA 4H4KC 1TELA 4J7CA 2HZCA 3MM9A 2ZFHA 1RWXB 3EXCX 2HFNA 4FS1A 4EUVA 2CPXA 1FRLA 1SVDA 3DRPA 2MEWA 4Q43A 4KHPF 4A8YA 1LK7A 5K8MA 3OL9A 4ED6A 3O1LA 3HKWA 1RHUB 1V6HA 3CIZA 2RU9A 1SL0A 1X0FA 2CDQA 3C66A 3OTOJ 4UQGA 1U1KA 3N4WA 4UT4A 2ZOFA 4IDKB 4E0DA 2AHOB 4QIVA 2PFDA 4P71A 4C2MA 2L9DA 1N48A 2NR0A 5ETSA 3NL0A 4G6VB 2VG6B 1RHMB 3B4DA 4RX6A 3G86A 3CCSS 2O5DA 3EVWA 1D8YA 4IO9Q 2ZJPQ 4M1KA 1RT4B 5DS7A 4FBUA 4Y2MA 1R27B 3D6MB 1S59A 2P8IA 1N5TA 2KHCA 1LWFA 1MW7A 2HG4A 1FVSA 3EVMA 3PRVA 4F2RA 5EWGA 3OR2A 3KNAA 4W98A 5HROA 4DUYJ 4X65F 1U1OA 1TV6B 1VQKS 1N34J 4ZVEA 4HDGA 1H2UX 2CJKA 3B78A 1U0HA 5D3GA 2A3JA 1N6QB 3CSKA 3M4XA 2LEBA 2J76E 4DR2F 3CCES 2X1AA 3TP2A 2L41A 2FHKA 3R3TA 1TUVA 2PI4A 4URQU 1FF2A 2KFYA 1F6TA 1C1CA 1GMWA 3CGIA 2W8KA 5L46A 3AQPA 5CYQA 2OKQA 3M8PB 1MROB 1BLUA 1Y7PA 3GR0A 3MM5B 4MAKA 1NJIT 1XQIA 5CZXA 4FYVB 2BRLA 4CLSA 4CRJA 3M8RA 1WTBA 2F1FA 1CULB 3MCNA 3CJQA 1NXIA 4LBIA 5KFAA 4ZP7A 4FXDA 2KL8A 1FRMA 1R0BG 3Q0AA 3RJMB 1MSWD 3WX8A 2W2NP 4N77A 2IJRA 3FQLA 3AB2B 1QAIA 3K8WA 1UMJA 1NZ8A 2VKZG 4EU0A 1X60A 2D9OA 2IFXA 3MF5A 3NGSA 2H1YA 4PCQA 3BYPA 1FNXH 3HHNB 1CVJA 1DARA 1PILA 1SC1B 2KZMA 2ADBA 5B0AA 4MK9A 1F0XA 3KHRA 2BOAA 1FI4A 3R7BB 2DHGA 5J2NA 1X4FA 5A2QY 2NS1B 5M2UA 2EC2A 1TTHB 4OJHA 3R2CJ 5HANA 1MU2B 2V8DA 2DGQA 3IRXB 4Y65A 2YNHB 4IOBA 3W5ZA 5A0YA 3KK3A 1TFWA 4PPZA 2W9CB 3CDEA 5H1SV 3D1HA 1JKHA 1U7LA 3IO1A 5BYSA 3DOKB 4PUOA 3R97A 1RU1A 3E8OA 2X1FA 4MT1A 2DNLA 3NAIA 4WFXA 2K1RA 2F40A 1ZTWA 1HBOA 3UDVA 1QE1B 3U1NA 4NYZA 1HNIA 3KDNA 1PAUB 5KFUA 2H9ZA 2G2OA 2BR0A 1K44A 1HBUA 4FVCA 3AFGA 1XIQA 3R7SB 4AFFA 3VR1A 4P74A 3FK4A 4DV1J 4RBTA 2FIUA 4LF9F 2FLNA 2DH9A 2BVZA 1FVQA 1EARA 2DO4A 3EPGA 1O6XA 3QLHB 4ANDA 2OELA 5D78A 3K57A 5SZTA 1R0AA 3M2UB 1NPPA 2HYIB 2V2QA 4LSLB 3M1VA 5C25A 2B6AA 1HPZB 3DRRA 3EUNA 5F3ZA 1FJGF 4NRTA 1F2GA 1HQEB 4OYIA 9ATCB 3BKTA 3R5JB 2CQGA 3FBFA 4CLZA 4QW9A 3KLFB 1XNQJ 2CJQA 7FDRA 2DVIA 2DNPA 3SSRA 1LOUA 4BC7A 2R7UA 2BKNA 1RTZA 1LXJA 2YKQA 3M8SA 3A8EA 5DJBA 1M0SA 3MEDA 1BE4A 1FRKA 4DFKA 1FK9A 1ITPA 4WK3A 3UDCA 4ILRA 4NLVA 3HT0A 1P6TA 2V8VA 2B7BB 1WG4A 1WF2A 3MFIA 2I6WA 1RHRB 1U45A 2CJYB 2C2KB 5IT9Y 1ZOTA 1QM9A 4A47A 2W4CA 5J1EA 2UV8G 3PDNA 2WVCA 2U1AA 2ZM6F 1KQSR 4G1QA 1Q5VA 1RAIB 5DG8A 4IRKA 4URSA 5HSPA 1NUEA 4LRDA 3W2WB 4UTGA 1BQNB 4PR6A 4EEYA 2JSXA 1YBTA 4TQSA 1M1GA 3T1HF 5KT3A 4ILMA 4K7QA 4JI5F 3PEHA 1RLCL 1EQMA 2UU9J 1SL2A 2GVDB 4OFZA 2PD1A 1MWYA 4BS2A 1QAYA 3PJ9A 2IRXA 3NNCA 1LFWA 4O44A 1PCAA 3OFHA 3V6HA 4B3RF 3AH6A 4ZIWA 1DQ8A 3CF5Q 5D4LA 1RYRA 1RTIA 2DBBA 1VGYA 4NEZA 1TL7B 1RWOB 1N33F 2GMLA 4XPCA 2BXJA 5J2PB 4X4TA 2ZH4A 3I5BA 1WWHA 4CLKA 3RBZA 3EXYA 2D7SA 4YN3B 2DR8A 4FNIA 2EK6A 5I3UA 3OW2R 1U09A 4Y28C 4X64J 4NLGA 2H5EA 1VFJA 2DEJA 4NL5A 2HBYB 3JSMB 2QC3A 1RCXB 1SH3A 4L76A 3W3SA 5KFVA 5RUBA 3J7Z5 1EP4A 1WSRA 4PZVA 4MK7A 3PX4A 1SJ4P 1KVKA 2HVHA 2DNGA 4HI2A 1RE1B 5CD4H 1N5SA 3Q89A 2JEFA 4DL6A 5CHCB 1R43A 4LBPA 1LK5A 2V0NA 4N8OA 4L74A 1OJ4A 1CSJA 2IHR1 4FF4A 1IKXA 1A9NB 4G1PA 1FJ7A 4EGLA 3IA0A 3V81A 2JDJA 1U48A 4ZVHA 3OTDA 4QWAA 3AJ2A 2IAJB 4ZN3A 3HI9A 3DI6A 2ROEA 4MFBA 1RCOB 1TMMA 2N3OA 5IT4A 4NLRA 4C3MA 1S0OA 4USJC 2M0GB 3CJKB 3QO9A 2XY5A 2YNFA 3MFHA 4ZVRB 4KPCA 4C0BA 1NB2A 1PO6A 4RW7A 4B9SA 2MZTA 2HZVA 2QL7B 1HD1A 2OI2A 1IUJA 4YP3A 1F3VA 1S6PA 2AX0A 1RSCA 4FPRA 2ERRA 3HJVA 3KLVA 2HAFA 2XC9A 4QJVA 1LWXA 5GAHI 3CCVS 4AL6A 4M8LA 1NU4A 3MPDA 4QBUA 1NAQA 2HHXA 2D1CA 3T6BA 4JI6J 1SKSA 3P45B 5A2QU 3X1LB 1YJTA 3D7SB 1D09B 1IBMJ 5E2QA 4IDKA 4AUKA 1IM6A 2R4FA 4YS2A 2HHHJ 4MKAA 4NASA 2VG6A 3GZ7A 3C15B 2B0GA 2F8MA 1VR6A 2RQCA 4ES3A 1KRPA 4EBCA 5KG3A 1M1KT 1RT4A 4Q45A 1VISA 1KOOA 3D4JA 3A3PB 1EZZB 2QFIA 3MAAB 4HDHA 1NKEA 1NPRA 3AXKA 4ZVOB 2V9KA 4ENOA 4I2PB 5E41A 5K14B 3MMAB 3M32B 2CUYA 1TL1B 3TNVA 1P9YA 2W2MP 1GMWD 4DR6J 4NA2A 4FF1A 1TV6A 2VBXA 1S1VB 2GGPB 2VPYB 4JI2J 2MZJA 2A2DA 1D9AA 3VGVA 1FNOA 4JV1A 1B0PA 2ZHBA 3R1HA 3MUMP 3SFUA 2OGUA 5K5MA 1R8CA 1Q78A 1N6QA 2W24A 3POTB 2EFQA 4DL4A 1EIYB 5HVGA 4NE9C 2YX1A 2PE8A 2DYAA 3RB6A 2DO0A 4DLGA 3S6EA 5D77A 2LU2A 4JI8J 3RB3A 1KN6A 1OY8A 3UFCX 3JQMA 3MEEB 3WZ0A 2W7OA 3M8PA 2C3OA 1MROA 4OYAA 1KQFB 3MM5A 4JUZA 3N9UC 3DN9A 3FCWA 1R8PA 2J8AA 1CULA 2ALYB 4B3TJ 3UPFA 5AE3A 2ZH1A 4WPAA 2G1HA 4IFYB 3KG1A 4K4SA 3J80Y 3LW5C 1WEYA 1HHTP 1P1LA 2ALZA 1GTHA 4KB7A 5K9FA 3PW7A 1I51B 3ZTQA 4DPXA 1AROP 1CJTB 2GIQA 4PYAA 5IT9U 3QYYA 4AXJA 5AE2A 4M5KA 4NCAA 2OEKA 5KG2A 2YKOA 2HGLA 2IBKA 1SJQA 2UVUA 3ETMA 2XHWA 5GAHU 4OI3A 1RA7A 3MMCA 4NLXA 3EGNA 5B09A 4Q0BB 4FXWA 1YRTA 2EI5A 2NPIA 4KRWA 1NK8A 1UZHA 1VQ6S 4EO6A 5AXLA 2KKHA 3VQSA 3GIRA 4CI0B 2QA2A 1X0PA 1HNZJ 2VFRA 2DHHA 3IRXA 4B9UA 4ES2A 2YNHA 2GHPA 1U25A 2BUNA 4ZVGA 1F5CA 1YJ9S 3PR4A 2W9CA 3QQCD 4LF8F 1RDRA 1S4FA 1RBOB 3MXHP 2LCWA 2JNJA 1BHNA 3DOKA 2M3DA 1JNZB 3E2EA 1DJ0A 4A8XA 1JMTA 2E7XA 1C0TA 1WD6A 1NO8A 1D3WA 4CZCA 3M2RB 4TYAA 4Q44A 5HJXA 4FKYA 1RZMA 2R7OA 3ZO7A 3HDSA 4FDFA 4ED5A 3B54A 2JVOA 3FSXA 2IDLA 1QE1A 2BE9B 2QG9B 4KT0C 4CWBA 1O51A 2ZH9A 2QT7A 3H2LA 6AT1B 3MM8B 2HZAA 3SEOA 1S1UB 4NX9A 1TL3B 3OVSA 4C4WA 3NCPA 2UUWA 1FDAA 3CPWR 5G4DA 4X62F 1D1UA 3EPIA 2E5LJ 3HHKA 3R2DJ 2HQ3A 3DLKB 4DQPA 2KG0A 4ETZA 2D3ZA 3BGFA 3QLHA 2JOQA 3UO0A 4LJMA 1UEVA 4DSEA 2UUBJ 2CQ1A 4LSLA 4PXCA 4WE1B 2Q3PA 4PYDA 3ULHA 1HPZA 5I4MA 4X66J 4D3HA 3TANA 3W7BA 2A2CA 3BQ0A 3PV8A 3BO3A 3BO2A 4QIGA 1HQEA 3UN5A 4UZBA 4B3SJ 1Q95G 4ZCIA 2R8KA 2X51A 1M5VC 3GFHA 3KLFA 3ZZTA 5T7LB 3UNYA 5HP1B 2G2YA 2WVFA 2MSTA 4ZN1A 2VFVA 5M2RA 4M5NA 1JJCB 1IR0A 1VRQC 4QU7A 3T9ZA 2J9DE 4EFAC 1YRUA 1L3KA 2PA8D 4C97A 5EGYA 3R9LA 2NYIA 4ZCMA 4TU7A 3GV8B 3ISND 3H90A 3R6GB 4B17A 4WFNQ 1WORA 5DDRC 1H7WA 4N41A 3MR2A 4YMEA 3HSDA 2K06A 4DL2A 3Q2TC 2HMIA 4IO1A 2BE7D 3BF4A 2ZH5A 1BQNA 1NJXA 2FQQB 3HSGA 6FDRA 4URGA 4F4KA 4GKJJ 2OH2A 1Q79A 5D0EA 2N4DA 2AZ3A 5HQMA 1VC6A 2OD6A 2VL1A 3TUJC 2GVDA 1RKJA 2MLZA 3DLEB 2VF3A 4GKKJ 2VONA 2DGOA 2KB2A 5IS2A 3EDRB 2DR7A 3X3UA 4QCLA 2EK1A 3OTOF 2AQ4A 4LREA 2OP5A 3TA2A 4DV3F 4KBIA 1XMOJ 1U24A 2H4YB 5A6PA 2PIIA 1NHUA 1TL7A 2GQ2A 2YVSA 1Y00A 4WU3A 1X4AA 2YQ3A 3T5LA 1YG0A 5J2PA 2BQ3A 4OLOA 2CZ9A 3LP2B 4QW8A 3ISZA 4NYOA 1YSJA 3DDNA 2OSQA 1XR5A 1H0HB 2MKSA 4Q7AA 2H65B 3VALA 5C24B 1OY9A 3JSMA 4J9LA 3VWSA 4CO1A 2Q6BA 2VH7A 4DUYF 3IRWP 1UEUA 4QYZJ 3LUYA 4WU2A 3VGSA 2MY8A 2VG5B 3D6HB 1N32F 3K8VA 3LAKA 2XMJA 1N34F 5F8HA 3KG4A 2Z2LA 1XNRJ 1UWBB 4DQQA 2ZZTA 1DY3A 3BBFA 3VAHA 2ZWPA 1UVIA 2LECA 1TZ0A 3T9NA 4HEA9 4IQXA 3QNWB 4Z37A 1KNZA 2GS8A 2RAQA 4ID8A 3ENWA 1IR1A 1YTYA 2IAJA 2IA6A 3Q8VA 1J5EJ 1C4CA 2QLBB 3J80U 4DV5J 3I96A 3CJKA 2MB0B 3IFEA 2HS3A 2JC0A 1RKIA 3JTOA 2O66A 1RISA 2APOA 2VC1A 3FBEA 4QWBA 1HARA 4J9NA 3V4IB 3OJUA 4F4XA 1LEOA 1NJZA 2RJZA 1S57A 1ZA1B 4C8KA 3M9OB 1X31C 1JLAB 2YQ1A 3BKFA 3DCAA 4U8VA 2XMUA 5F8NA 3ITHB 3VHQA 1YIJS 4PWUA 2ZHAA 1XERA 2FVCA 5THWA 5H9FK 3CCTA 2AJQA 1V5IB 5LJ5Y 2P9CA 1SUQB 1G2EA 4JV5F 3GIJA 2J6SA 2YNIB 4DR5J 3C15A 2H48B 2B8QA 3HVTB 2GIFA 3VAGA 1Q0NA 4LFCJ 3GIKA 2BOPA 4MYUA 1YI2S 4DMZA 1MMDA 5M2PA 5DM6Q 3FBBA 2HIYA 3PTWA 5LM7E 3IR7B 3UCUP 2UUTA 1D9DA 3OLBA 2XZDB 3TI0A 3MAAA 2CPZA 2XY6A 2VA2A 3Q8QB 3DHWC 1S49A 5KFFA 4YOEA 5CD4A 4DR4J 5K14A 1VQ9S 4I6YA 4ZK7M 2KO1A 3MMAA 3M32A 9RUBA 3MGJA 4B9VA 1TL1A 2K7JA 3OD2A 1UEKA 3S1TA 3G9CA 2RRBA 4F2SA 3THPA 2GGPA 4A8WA 2QMUB 3CCRS 4Q8EA 2DR9A 3R5BA 2NXJA 2PN6A 4K4ZA 5IQQA 3POTA 2FC8A 4FXVA 3AOAA 1DLOA 5E3PA 4ED4A 2WZ1A 4OL8A 4ED2A 4MMOA 3MPYA 3FNNA 1P1TA 2FVRA 2AV5A 7FD1A 3CCZA 4IOCQ 4A8OA 3BSCA 3KG0A 2X1BA 1FE4A 1V3SA 1TKDA 2W1BA 5E5NA 3MEEA 3ZZPA 4I6AA 2HNYA 4WYWA 2NZCA 4NLDA 4U6PA 1OS5A 1Y5IB 4F36A 4C8LA 1PYOB 4ZLPA 2RHQB 2AGPA 3KLEA 4PAAA 2E66A 2PSZA 2FJBB 1E6YB 3CVKA 3S7RA 8RUCA 2QMXA 1XK8A 5DQHA 5KFCA 2HNZB 4RU9A 2NLWA 4X4PA 2LEAA 4LF1A 3EM1A 2KXFA 4DV0F 4OYOA 4WBFA 1XNQF 2HVZA 4V19X 4IKAA 1CJTA 4HT5A 3PRBA 4DXLA 2J6TA 1IWAA 3HZEA 4U95A 2CQ0A 4CLPA 4ZDNA 2BDPA 1WELA 4LFAJ 3AD9C 1S97A 4N47A 1C0UB 1SIZA 4ECWA 1D8ZA 4KHMA 1NK9A 1FNMA 1S6UA 5F8GA 2XO7A 1TQLA 1Y3KA 5J1NA 4Q0BA 2B4OA 5ETNA 3HD1A 3W9HA 3W62A 3BM7A 5BYQA 3IXQA 1QAJA 1VQYA 1RU2A 5DGAA 3M6VA 1OQ6A 1KONA 1X9MA 3R5DA 5U47A 5F8IA 2ZHOA 1JLGB 3DM2A 1I1GA 4F50A 2MKKA 1W7WA 3KJVB 4NEYA 4DFJA 3WBZA 5D4OA 1RT2A 4ZVSB 2ZKUA 1OPIA 4ZJQA 1RK8A 1AA1B 3K5PA 4C6AA 3FJ2A 4USKA 2XS5A 3M05A 1S79A 3DNCA 1HA1A 2E9RX 1Q4RA 5IZHA 2VBWA 2ASDA 3H8YA 1PG5B 2ZKTA 4UUXA 2UP1A 4WFBQ 1RBAA 1VLOA 2W01A 3LPYA 3MM8A 1WHVA 4LMZA 4C3KA 4IR9A 4LRFA 1S1UA 2RB7A 1U1RA 1TL3A 2VDIA 1VBKA 2O1PA 1CEZA 3PEJA 1JK9B 3CJ5A 1KFSA 3FMBA 5EWEA 2RS8A 4X64F 3DLKA 1SJRA 4PQUB 2JLGA 3I6PA 4ED8A 3PW0A 3O44A 3CJRA 1SH0A 3BZQA 3CJ3A 5B0GA 2G9OA 2BJDA 3D67A 4WE1A 3I56S 1WKJA 1PJ5A 4FYXB 1W2IA 3PW4A 1EETB 1VQOS 2W2PP 4UW2A 3TVKA 5HO4A 2EXUA 2AJ1A 3PHEA 2RQ4A 1XR6A 4I7FB 2OTLS 3ZZ0A 2AP6A 4QOTA 4ECRA 4WXWA 3S01A 4U7UD 2DNKA 2H5IB 1T3NA 4KGVB 5DRKA 2HAIA 5EN1A 4ZPWR 1JJ2R 1RT3B 4RNOA 3TX0A 1ZYQA 3HHLC 1YZ6A 4B3MF 4RNMA 4DR3J 4CLYA 2E44A 2FB0A 4C8MA 1WACA 2Q66A 1WNEA 3HKZD 1ZAXA 2VJVA 2Y3YA 1IQZA 4HYKA 5F41A 2GC8A 4LQ9A 4DL0C 4X4VA 2OFGX 2J7WA 1JNRB 1REVB 4W90B 3JSRA 4DSKA 3M8ZA 3MR7A 2XS7A 2CNNB 2V5HG 3VGUA 1HWIA 2AJ4A 4LUBA 3DLEA 1T95A 2OHDA 1ZTTA 2XSJA 2Y1IA 1SV5B 3BPDA 4TQRA 1CLFA 2H5JB 3H20A 2ZD1B 2XNQA 1HWLA 3GU0A 3TVZA 4WFAQ 2ZZNA 3L7PA 3OR1B 3A8KA 2GCFA 2HHHF 2ZZMA 2YWHA 4PKDB 2MQQA 1YDLA 5KG5A 1GQEA 1PBUA 4ZP6A 3V6JA 4C7QA 2HGMA 2XI2A 3W65A 3LP2A 2UXBJ 3DLBA 4GO7X 4KE5A 2IBOA 5DQIA 4KPYA 3GJRB 1TVRB 4NZ0A 3SZ2A 2AKWB 3LOUA 1KDNA 1CQNA 1RADB 4DDFA 2KM8C 2ROGA 3QMQA 5C24A 3CCJS 1ZM4A 5AJ3J 1F60B 2DISA 4F8RA 1SQGA 2VG5A 2NREA 3CMES 1QY7A 3BPSP 2B7CB 3HULA 1E6VB 5K8PA 4NMXA 4EZ9A 1UWBA 1Q82T 3KJQB 3UD3P 1S48A 2HRUA 5F8MA 4ECSA 1WTFA 3MPWA 1PYSB 1FE0A 4AQYJ 1WF1A 2V67A 3M2VB 4LF5F 2E5JA 5D0RA 2V94A 1FHTA 3M8YA 4OI1A 3ETOA 4OV6A 1F5BA 1KS2A 3SXLA 3SV3A 5KOWA 5IM0A 1NJWA 3OTEA 4JI8F 3F0NA 2OO4A 3DLJA 3QSYB 5HMXA 1NZAA 2CQ2A 3C14A 3ILOA 2RUSA 1N54B 4FS2A 4O4GB 1MN7A 5KFRA 4LF6F 5CXTA 2ZDPA 2MXYA 1VIXA 3AXMA 2ILYA 2W7AA 4B3TF 1IBCB 1MLAA 3DRXA 1YZ7A 3U1LA 3V4IA 3IWXA 3OHBA 1KLMB 2CJXB 3PZPA 3QRPA 3KHHA 3VF0B 2EC0A 5KFJA 3I55S 4MIBA 2V68A 3G8SA 1JLAA 4ZS6A 2NXUA 3ITHA 3IAS9 1U47A 4CYUB 5H9EJ 2GQQA 1QLNA 4A48A 4DPWA 4MIAA 2COLA 4JI4F 3P3DA 2RU3A 2E7VA 2RSQA 4QZVB 2DH8A 1SUQA 5IC6B 2VDHA 3PX0A 5KFBA 1HQ2A 4JI7J 2YNIA 2V69A 3MMJA 3T6JA 1UJ4A 2JEJA 2ASLA 4FN5A 1ZM3A 3HVTA 2R2UA 4O3OA 3CDUA 1U2RA 2DTJA 1KKHA 3MOJB 2B9XA 1HNZF 2KDOA 4PG6A 1FDDA 2KI2A 3QZ8A 1UFKA 4ERDA 4KO0B 2IPOB 3BKUA 4ECQA 1QJHA 4LVNP 3BJYA 3CJ8A 5CYQB 3OJSA 2RD5C 1WUUA 2Y0SD 3OLAA 5KFTA 1NHKL 2DY9A 1AT1B 3F41A 1FX4A 4LRCA 2HIQA 2FJEB 4HH0A 1UPPA 3GJTB 2JRSA 3J7ZT 3PO5A 4DX7A 2VZ9A 4NCGB 2BABA 2RDDA 4KR0B 2BJ7A 1RWPB 1U1MA 1S7IA 1U0SA 2NQPA 1S1XB 2K2PA 4IG0A 5T41A 2FTRA 4DL7A 1N88A 1NDCA 1OQ3A 3T1YJ 4I6WA 1C1BA 4EBDA 4A8FA 4OIXA 1U6BA 3BGRB 3T5KA 1O5JA 4DG1B 2XMAA 3HVWA 2X3DA 1Y4ZB 3CTRA 2MQNA 4RL1A 3G6ES 4O3SA 3GV5B 2LFVA 4DLEA 2DK2A 2XLIA 3NLCA 4G1IA 4RUBA 4X66F 4DBQA 1LWEB 1EKSA 3BSOA 1RAEB 1RT5B 1UCNA 3QGHA 2LP4A 1E6YA 2HBRB 1MWZA 4B3SF 1SIWB 2HNZA 2YTCA 1U8WA 2GJ2A 4PPDA 1SKUB 3MDFA 5KFDA 2HPUA 1RXOB 2MQPA 4B02A 2M70A 2YH1A 1UA0A 1REGX 1RYSA 3SSSA 2C3PA 4PUOB 3TJ9A 3BN7A 3AD8C 2XG8A 4ZKAA 3FBCA 3DXBA 2CQDA 2K1RB 1LQ9A 2X3GA 4QIEA 2EG1A 3FZ2A 3A13A 3I4HX 1WEZA 4OI0A 1ZA2B 3CWJA 1RT7B 3EVOA 4DR7J 2NPFA 4IOAQ 5HATA 4RLEA 4LIWA 2FLLA 2QYCA 3A4TA 2C2OB 1K1QA 4DS4A 1QD1A 1IM4A 1H6KX 5F8JA 1N8RT 4NLYA 1HBNA 3Q8PB 4RNFA 2EFNA 3G2XA 2V2KA 4X4RA 3KHGA 4GKJF 2JWNA 2DRBA 2I8EA 3DOLB 4FP9A 3M1VB 4CLWA 1MNEA 2AEFA 4ID5B 4JI1J 3H0PA 2UUCF 2KHDA 2FVPA 4JYAJ 2IRYA 3KJVA 5L38A 4RBVA 1SJ1A 3IWLA 4NLPA 3IG1B 3ENQA 1WSVA 3MEGB 1FCAA 3GYNA 3VAMA 3RAMA 2CQ4A 2HRYA 2A6OA 4DV4J 1HNWF 1QSLA 3IMQJ 3UD5A 2NSBA 2DNZA 4OX6A 3EZOA 4IYQA 3J7YI 4JP8A 8ATCB 3ENVA 1AYEA 2W25A 2DITA 1R89A 5IQ6A 2AYBA 3MAHA 3FGVA 2XEXA 2FZGB 2BV3A 2RQMA 1N4LA 4OZNA 2FGOA 2VQEF 1GTEA 3TUIC 4RBUA 1RAFB 3NP5A 1EB0A 1VQ7S 2CIMA 4OYBA 4P10A 2A0FB 4J9VA 1EETA 2DXDA 1LWCB 2J7KA 4P52A 4CM0A 2LXIA 2KRRA 3GIIA 5HVHA 2KT3A 1Q16B 4RW4A 2RMLA 3NEKA 4O3NA 4I7FA 3W9IA 1WOPA 1KEKA 4R25A 2EFOA 2YX4A 1XNRF 1VRTB 2HLTA 3FEZA 4CLFA 3NXZA 2PGCA 4RW8B 1P27B 1FESA 2N4CA 5DDPC 2CQCA 5IWAF 3K58A 4F25A 2VA3A 4H4KA 5KT2A 4C8OA 3QPIA 4FPIA 1OMSA 3DOMB 2V9WA 2HHSA 4OJGA 1KVJA 1J5EF 4ZMMA 3HLUA 1VMBA 2RH3A 4JOUA 3BB5A 2LQ9A 4DV5F 4LF7F 4PWWA 1J27A 5IC4B 3FEXB 3TWZA 3Q22A 2R2SA 3QAUA 5KFEA 1UVJA 2LXFA 5B0CA 3D1QA 4KGZB 2FJWA 5I3UB 4DPYA 3SV4A 4Y2AA 1Z1ZA 3L7UA 2C28A 4U7UK 2CQBA 2VU5A 2IY5B 4USHA 3NRBA 4YDDB 2HWIA 1V3ZA 3L9ZA 3CMAS 2HVEA 3I87A 1HR0F 3P8BB 1VHIA 4NMLA 3HFVA 4O4RA 1SV5A 3HF5A 4DSFA 2ZD1A 4ZVUB 2ZWOA 4P75A 3LQVA 4DR5F 5CYMB 2OLWA 4TNOA 4N56A 4KV8A 4LFCF 4DSIA 4U8YA 4UOCA 1NLKL 3ZXWA 1KFDA 2LU1A 1HKAA 1HNXJ 2UUAJ 4CLTA 4GC6A 3V6DB 2FJDB 3OTCA 3ZTRA 4JBCA 3NKYA 1UTAA 3J7YU 1TAUA 1GEHA 1H2TZ 3LPEA 2V4JB 3EYZA 4OZ2A 4DR4F 4I1TA 2IM2A 2P5VA 3WC0A 3CULA 1NNDA 4ECZA 2B8PA 3HSJA 1CQMA 2J0QD 2O3DA 5D0HA 2ZITA 4ZJLA 1RA6A 5JXSA 1B7YB 3KMSA 4NLUA 2VOOA 2YWEA 2MZRA 4J9MA 5LXYA 2K7KA 3D3BJ 2XWYA 2J0WA 1JLFB 4DR2J 1FRJA 1HQUB 3LANA 2B3TB 5LSOA 3M2VA 3IWNC 1A0OB 2YNGB 5DLFA 1NHVA 2LQJA 2KFNA 3RB0A 2MQ8A 2Q43A 2B9YA 3O2IA 2OPRA 1XC9A 4CNZA 1AZSB 4DQRA 3BSNA 3HHEA 4P2XA 2EWHA 1YITS 1MMNA 3GR1A 4MJKA 4O4GA 4PG8A 4OZ1A 2XHCA 3CJ4A 3ZZOA 1T7PA 3UW1A 1SB6A 3FSYA 4HLBA 2L9WA 2VV5A 3KUHA 5KFWA 2HFVA 2BKPA 3RTVA 2KN4A 1SC4B 2U2FA 4YB5A 2H54B 4Y34A 2B5JB 2Z2MA 4WTOB 4B9NA 1T3OA 3N5BA 3FEYB 1KLMA 2ZE2B 4OZ5A 4V19J 2BQRA 3C6UB 3SBMA 3L95X 4AL5A 2P6TA 3C46A 2ASJA 3G6XA 2AYGA 2MQOA 1YKWA 4UUWA 4LFAF 3CJ2A 4CYUA 3ZTOA 2HQGA 4WFYA 1QAXA 4OYPA 4QPTA 1WDDA 4OJ1A 4BBYA 4MH8A 3KOAA 1T9XA 4I4BA 4WWSA 2OFHX 3GB0A 4I2QB 4I56A 2IM0A 5LSRA 4X4SA 4J9PA 2BMBA 5SUHA 1JQGA 1PJ6A 2KYZA 2LDIA 4DV7J 3EZ5A 4CCHA 1ZZFA 1FWKA 4HACB 2DCLA 4L3KA 3D0GE 2QJ3A 3PYDA 3CIMA 2PC6A 4KO0A 2NUUG 1I94F 3S8SA 2F65A 3SQOP 3AAWB 1UVLA 4KSEB 3G6VA 2O01C 2DR6A 2R42A 3IP0A 3A12A 5E3CA 5KFLA 2ZBIA 2CQIA 2XGPA 3GFZA 4J91A 1OYDA 1GXUA 5F0UA 5ETMA 2X7IA 4OZJA 1T0TV 2LQBA 5LMNJ 4NCGA 3LH2S 3TZYA 4PWDB 1XWLA 1U1NA 1FKAF 7AT1B 1WHXA 5FIIA 3CCUS 1S1XA 4ZCKA 4PXDA 1SCJB 2V4RA 1T9UA 3RR7A 2AW0A 2RUGA 3W64A 1B7FA 1RTDB 3SMZA 3QJLA 3M6XA 5D8HB 2OJ3A 4F3QA 1YRXA 1KHWA 3IS9B 3NS7B 3O5TB 2OPSB 3BGRA 3MMCB 4EWTA 2J5AA 2R2TA 4DG1A 1T8EA 1ZH5A 5FJ4A 3VGTA 3LWMA 3KTQA 1NM2A 1LWEA 4TY8A 2F9JA 2GO9A 1FJGJ 1RT5A 1VRUA 2CPJA 2PDAA 4TLRA 2WOMB 1WOSA 3PYEA 4I64A 3BS9A 1B0TA 3W5YA 3US5A 2XQCA 4MYTA 4JI0F 1R8AA 2MKIA 2QV6A 4HHHA 1MN9A 3KNGA 4RO0A 2IMWP 2FHJA 4DX8H 1T9VA 2RE1A 4I67A 1C0TB 2D69A 1JJHA 5C2CA 4CO4A 3C2PA 1SJFA 1U8SA 4IUFA 4E2FB 2JLEA 3H5XA 1DQAA 3TAQA 5EX3A 3QGIA 1LW0A 3GJQB 2JJ4D 1NK7A 2LXUA 4KY3A 2GVZB 4GMKA 3EGVA 2MKYA 3VVUA 1FDBA 1VCTA 4OQJA 4DN0A 4OHZA 1FA0A 3HXMA 1TK0A 1RAOA 1RT7A 3W8PA 4A8MP 3PRDA 2ZM6J 1W25A 3EICA 1YGYA 1URRA 3C3LA 1VHFA 3F56A 2L3MA 4N5SA 4CO3A 3MCOA 3ILLA 1XMQF 2OAUA 1TP7A 3NGUA 3GCXP 2EBEA 3T1HJ 1RHJB 1XBWA 5IOLA 1HYSB 1IXKA 2NSCA 3FRZA 4QWEA 3DOLA 4XK8C 1K73T 2EEYA 4JI5J 4F02A 4ID5A 4J90A 2CG4A 4EO8A 2YX7A 1U02A 2Z2YB 2XZTB 3R1LA 2Z56B 4HT7A 1TMJA 4DWIA 2GIRA 3EZUA 4DL3A 3I4PA 2M52A 3NS5A 3IG1A 4CNYA 2V34A 2QLFB 3G82B 3MEGA 4B3RJ 4QR1A 1OSCA 4F0HA 5CYJA 4NLWA 3P6YC 2R2RA 1VQLS 1Z2ZA 1JIHA 4EBEA 3FCHA 2BRKA 1N33J 1WC1A 4RU2A 4LF4F 4NLSA 2RHSB 2ZH7A 3R7NB 3BN4A 4QPXA 4IH5A 2XY7A 1VQ8S 4DJBA 2CJBA 2K8GA 1QVGR 3CD7A 2VQFF 1RT6B 4CDIA 3D5MA 2R7SA 2HRTA 1FRIA 3T19A 2XSFA 2W2OP 1R6VA 4OZ3A 2Z4PA 4IRDA 1TKTB 1RTHB 4DZ6A 1SJ3P 3DC2A 5FLXY 4Y00A 4KFBB 1FT8A 2DB1A 3CC2S 5AJ3F 3TQEA 3Q8RB 1VJQA 3PIOQ 2GX8A 4LR8A 2XLJA 2HMIB 1LWCA 5DM7Q 4NOHA 5LL6d 4ICLB 1RQ0A 3UCGA 2XCPA 2RKIB 5D15A 4OX8A 4ZVTB 2GAHC 3ZZUA 4B3OB 3N79A 2A18A 2ZJQQ 1VRTA 2HS4A 3TZZA 2KXHA 4NXMF 1JLEA 1TK8A 1NSKL 4RW8A 4QWDA 5EHHA 1TR0A 1CJKA 1FXRA 1RWWB 5E3QA 5G0RB 2K3KA 1UZDA 1OWXA 2FHMA 2AGQA 3DOMA 1DURA 2J0XA 2PI5A 1Q8LA 2QEXS 1M5OC 2HFZA 1F3FA 1UWAA 1KLNA 2HWTA 1WKKA 3TX8A 2XWXA 2B4UA 4WP3A 1DTTB 3QIDA 3LGHA 1A7GE 4O0NA 4FYWB 1VIOA 5L9XA 1WDTA 3D6TB 1Q53A 3WQPA 4AL7A 1RWKB 4YDXA 3RR8A 3DFEA 4RUCA 4M5IA 3C8YA 3CCQS 2FY8A 1R31A 5KG7A 1RAJA 2ZVIA 1S1WB 4EMDA 1CS4B 1M5PC 2W4PA 4PQAA 4E98A 2KG1A 3W60A 4D3GA 2ZBQA 3FQKA 1AUDA 4XPEA 2O67A 1R8BA 2B9EA 3DU5A 2ZEJA 5CYMA 1KSPA 4BLGA 2POKA 4MTPA 2RDJA 1DTQB 3GCWP 2HK3A 2HFOA 1BY9A 1QSYA 1FTRA 3G8QA 2PO4A 1U1LA 2G2ZA 3N6MA 3V6DA 2ACMA 1KQKA 3D0IE 3U7JA 2ATLA 1R7IA 3K17A 4DR1F 3QGGA 1EHWA 1VOMA 1TFYA 5HK4A 4F0KA 2V4JA 3A8JA 1KQGB 4M5LA 3VAFA 1VBXA 4G65A 3KLGB 2R7WA 4DUZJ 3R5GA 1GFWB 2MQLA 4CH1A 1L5UA 3DHXA 4GRSA 1VQ4S 4ZVPB 2BANB 2QSWA 3HM9A 1HD0A 2ZC4A 4OYXA 3N6NA 3GFYA 2N3LA 1HW8A 2BJ9A 3G6YA 1W2BR 2IVMA 5ADZA 1JLFA 2QIFA 2XMKA 1HQUA 2WRMA 1TUGB 4WZMA 4NRUA 3T1YF 3AT1B 4P9SA 3JAMY 4YY3J 2YNGA 1UVMA 5CCLA 5DDOC 1VYAA 5B0FA 5E0OA 1IVZA 1JB0C 4G3IA 4DV2F 5ETOA 1AZSA 1MG7A 4OI2A 3DRYA 1ULRA 3SYZA 1N5YB 2HWHA 2IIHA 3B6BA 4KGXB 1YJNS 2XO6A 4DS5A 1RWVB 3HP6A 4RNHA 1AFIA 1FFSB 3FZBA 3ET6B 1IBLJ 2B5JA 4LR9A 5I42B 1PKUA 3DU6A 1ZPVA 2ZUAA 2ZE2A 3CJSA 1M5HA 2HVDA 3CCMS 4V1Ak 3C6UA 1UW4A 2N7YA 4J9UE 3VAKA 2KH9A 4CLLA 4CLUA 3LAMA 3RW7A 4A8QA 4WKYA 4DHVA 3MUVP 1R8HA 3MD1A 2V2ZA 2KVIA 2HFUA 1Y9OA 2V8PA 3QT5A 5AXMA 1NDLA 2VFTA 1BWVA 1R3NA 3M9MB 4K4UA 1DZ5A 4DR7F 1YX2A 5JVHQ 3NGTA 1DLOB 4I2QA 1X9SA 2WK4A 2EVZA 1ELOA 4M63A 4HACA 2C1EB 1S77D 1FRHA 4TY9A 2C3UA 3KYLA 5DG9A 2HNYB 4LF8J 4ZLJA 1BD6A 3BREA 1WHWA 3M8QB 3D66A 4JI1F 3MECB 3T1AA 4I68A 3KLEB 2MGZB 1RAHB 3NNHA 4HKQA 4ZLLA 2PEHA 2G4BA 4NA1A 1B64A 4RJVA 5ETVA 1IBKF 3OSPA 2F4VJ 2BJ1A 2DH7A 4OYMA 2AD9A 1S0VA 3DLLQ 2OEMA 4PWDA 3HCXA 2VUGA 1RWNB 4DV4F 2VHGA 4Q5VA 3ZZZA 5FLXU 4CO0A 4UZCA 1ZAWA 3G4SS 4DI6A 4DCPB 2IA0A 4K4TA 1RHQB 2HS0A 3ILIA 1RTDA 3KK2B 4X62J 2FGCA 1UL3A 3AJDA 3IS9A 1QSSA 2NYHA 4A8SA 2OPSA 2FHJD 3NS6A 2AWZA 5A8WB 3BGLA 3K5NA 1P9QC 1K1SA 4QYRA 2JEIA 2DGUA 3HHLB 3H59A 3ZTSA 4FYDA 2E29A 4HR2A 2UVWA 2P6SA 2ZNZA 3VAIA 4CT9A 2DRAA 1PJ7A 2YH0A 2WOMA 1K8AT 3DM2B 3ZNJ1 2RQKA 4YFUA 3FDSA 1B70B 3PVXA 1HBMB 3CDBA 1RT2B 1H3DA 3TUPA 2CKWA 3L7OA 1ZBTA 1S9EB 2Y8YA 3OL7A 3JSBA 2UZAA 4ED3A 5J2QA 3RRHA 3JB9k 3VVTA 2GVZA 3MZIA 2KT5A 4WZQA 2IVFB 3WIUA 3TZWA 3W66A 2JHEA 2FPHX 1ZETA 4LQ3A 1UJ6A 1YJ7A 2RIJA 1H2VZ 3PJXA 1NKBA 2QE5A 1PYTA 2E9TA 1HWUA 4IFVB 4QR2A 3MTJA 3PJWA 4Q2LA 4AT1B 5C5JA 4DV6J 1WF0A 2MDAA 2IM3A 4RW9B 1HYSA 2JX2A 1CBKA 3OL8A 5E3AA 2BW7A 2EFGA 1VQMS 3VAJA 3UR3C 2LA4A 1H7XA 1LNQA 1IKVB 2PMHA 2KM8B 4OHWA 3G82A 4DV3J 2XBPA 1GXTA 3HT3A 4P7VA 1CC7A 2PA3A 2HKEA 2LEPA 1WC4A 4BC9A 1CJUB 4ELVA 1A6LA 1FEEA 2XULA 3NGDA 3OHAA 1RT6A 3HFKA 3HJFA 1C2PA 4HTIA 3DKDA 2CNOB 3JSYA 5FDLB 4DFPA 1TKTA 1RTHA 1HNXF 3MM7B 2UUAF 1GMVA 4NXNJ 2Z57B 4KFBA 2E7WA 2RRNA 1IQTA 1TUWA 4KH1B 2WBRA 2ZC3A 2ATCB 5C42B 4U9RA 2AJ0A 3A3OB 1CJVB 2MLXA 3OXLA 5EX0A 1N32J 4ICLA 2EFPA 2QFJA 2RKIA 1SH2A 2R8JA 4LFBF 5H9FJ 3JAMU 4B3OA 4J37A 1HWJA 4OX7A 1H73A 3GIMA 4B9MA 1GXLA 2D3UA 3M7VA 2Q1LA 1YJUA 4OI6A 4KJIA 1BC6A 4R5PB 3NGKA 4C8YA 2XSJB 1NDKA 2BM1A 5FD1A 3PR5B 2IMOA 1TL5A 1O0PA 5K8OA 5G0RA 4TVAB 1AB8A 5D4PA 4BWJA 3QAEA 3IGNA 3RU0A 3TYTA 3I31A 4NCBA 4KGMA 2CPYA 4ATNA 4P2SA 1SC3B 1DTTA 3GQCA 4O23A 3SCIE 3G96A 1UP1A 2R3VA 3K59A 5D4NA 1WC5A 2DJWA 3A8IA 2ZOGA 2NCKL 1Q86T 3EX7B 1R0CB 2BQUA 3H5YA 1PC5A 2WTFA 3BDPA 5CZVA 2MJNA 5A8RA 3MPUB 1G4CA 1ZAVA 3OUYB 1X4DA 3ONQA 2J9EA 2QLXA 3PY8A 3R27A 5HVFA 4CO2A 1HI0P 4U7CA 2QYGA 1YJWS 2WB1D 2HVIA 1S1WA 2DR5A 4XTTA 4BHQA 5LMUJ 1CS4A 3D2WA 4YB7A 3GJSB 2QL9B 1X4CA 3J7A1 1N36J 4JV5J 2FY1A 2EFVA 4K0KJ 2IM1A 2IJNA 3N01A 3KKFA 4DV7F 5DETA 4ED0A 2WCXA 4DPUA 3QFHA 1DTQA 3OQ2A 3CEDA 2GW8A 5LSLA 3NOGA 3RAQA 2Y1LB 3SQGA 3GFXA 1NH8A 5IM0B 3NBPB 3H42A 2K3IA 3JYTA 3C14B 1MMLA 2BZ2A 4J9RA 3VZHA 4ZPBA 2NUHA 2DHAA 1Q7YT 2HW3A 1XN9A 3I0SB 4DN9A 1JLQB 3OVAA 1IR2A 1FJCA 3OXFA 4L6V3 3UE2A 3KLGA 2GHWA 3L09A 2CVEA 4ECXA 1VQPS 3TRGA 3PYFA 2M4MA 5KTQA 2BANA 3UNGC 1Q81T 2ROPA 5LMNF 1UVNA 4OHVA 1HFEL 1FKPB 2MKJA 3BYRA 3LGNA 1Q8IA 1OY6A 3KWMA 4ILLA 3OTBA 3FCVA 3MAQA 5GADI 4F4YA 4TXSA 4HTJA 2F9DA 5MAOA 2QSFA 2LKZA 4CQ1A 2WW4A 1T05B 1U49A 3I5AA 2AEJA 2HQDA 4F26A 2DNQA 1WC0A 1NSQA 2DHXA 3V4MA 1N5YA 5J2MB 2XMVA 4GVBA 4A46A 4XDCA 4C8NA 3QZ7A 4NLQA 4MKVA 1X5OA 4FZVA 1S10A 2YKAA 2FDNA 1S1TB 3MR3A 2JC1A 2HK2A 3ET6A 3GPAA 4OI4A 1UVKA 4DV0J 1JWWA 5I42A 3W63A 2MYFA 3FRYA 1XTZA 3AODA 3E51A 4P2MA 4U67Q 3RBDA 1FFWB 4M5GA 1T94A 4DPOA 1N5QA 4Q2MA 3D68A 1FXDA 2RRAA 2M2BA 3H5SA 2D3OR 1KR4A 2P9EA 2E1PA 3IR6B 4FVMA 3BGUA 2MKHA 5ETRA 2Y9HA 2M7SA 4TYBA 2KZZA 3I82A 2KYXA 1X5PA 2WBMA 2V50A 2QL5B 4DL5A 4IG0B 1GMUA 2PMWA 1S7HA 1RI7A 4OYWA 5HLFB 3H4DA 1JXVA 4DV1F 1R6YA 1FWLA 3OFGA 4CIOA 1C1BB 1S0NA 4FBTA 2KJWA 2P2CB 4FYYB 5KFGA 4UF4A 3C6TB 4K59A 2DNOA 5LOQA 3M8QA 3IM8A 3MECA 1XMBA 4DCJB 4CH0S 2YWWA 1LW2B 2XTJP 1T02A 2ZDOA 2MGZA 2OPQB 4TKTA 1N56A 3PX6A 3PKYA 3AA8A 2IYGA 3CJ0A 2A6MA 1UFWA 2ASYA 4ZPAA 1VBYA 2CADA 2EKYA 5CQGA 5CAAA 1WHYA 1NMEB 1HHSA 4CH7A 4FF3A 1FO1A 5I3PA 3K89A 4OHYA 1S9FA 2LQ5A 2WSEC 3N6LA 3RGIA 2C3MA 3QGPA 2MTLA 2BJ8A 3CCWA 3ILJA 3Q8YA 3W2VB 3HSZA 3KK2A 3PKMA 4H4OB 1Q7LB 4ZCLA 2L08A 5KT6A 1LV5A 1XR7A 3OFFA 4ZPDA 3QJJA 2FJVA 2E1RA 1NRKA 2LLZA 5A8WA 1RABB 3AOBA 2HHWA 3JTPA 4W4MA 3THTA 4F4WA 2DPIA 2X1GA 5GADU 3HHLA 1FXLA 2DNHA 2V6AA 5KG0A 1VC5A 3GWCA 3OXGA 2VJUA 4B9TA 1HBNB 1RUSA 2V2VA 3HZGA 4I69A 1GX5A 5L8RC 2KXNB 3LP1B 1KD1T 3H25A 1T9YA 1X4HA 2FHOB 3NCRA 3ZTPA 3ELHA 3TR5A 4ECTA 4DF8A 2UU9F 1HBMA 1KTQA 2EBGA 2CQPA 1K9MT 3V6KA 1S9EA 2VPZB 4FKXA 2XMTA 3GLJA 3NG8A 4B3MJ 3CW2C 3PIPQ 3UDEA 3DLHA 4BWMA 1S76D 5LXRA 1AFJA 4RWWA 3UD4P 2ZBCA 3BSAA 2HHQA 1F5AA 2ZH6A 1FERA 3EJMA 1BXNA 3R6LB 4USVA 4IFVA 2FVSA 4YB6A 4N8NA 1Y3JA 4KHRA 2AYEA 4NA3A 4OZLA 3ISNC 3DRSB 4CM2A 2AJFE 3PXGa 2E1CA 4FNHA 4RW9A 4S0MA 2DNMA 1RAAB 3QT6A 1T03B 1RHKB 4J9QA 1EKRA 3D3CJ 4TLQA 3RZAA 2DXEA 2C3YA 2NXEA 2F8EX 1V9OA 1AXQA 5BR8J 4KGKA 1IKVA 4LSZB 1M5KC 2CQ3A 1CPZA 3AQOA 2VOPA 2ADCA 2HQFA 2UXDJ 4RW4B 2VB6A 2MSSA 3M8WA 1Z4UA 3SIPB 4ELTA 2XZWA 2AMCB 3QATA 2OPPB 1F9HA 2ACYA 3WIVA 1BWEA 4YB1P 3CDWA 1SKRA 1ICEB 5L39A 4DF4A 1CJUA 5DDQC 2RVJA 3VV2B 1F1BB 5FDLA 5AXKA 1NSPA 2BBEA 3MM7A 5AE1A 2QN6B 1ZM9A 2H4WB 2XI3A 2F3JA 2E5HA 2I0XA 5LJ3Y 3CMQA 4RW6B 5C42A 4IG3B 1CJVA 4UY85 1M1HA 3NOCA 2LA6A 4DUZF 5IXUA 2GQCA 2PMZD 1Q5YA 4AD6A 2C2RA 2MMYA 5HJYA 4ALZA 1NPKA 3V5RA 4F0MA 1U2CA 2XS2A 1KTVA 3G8TA 2V8HA 5KFXA 2Z2ZA 2QGFB 3P5TL 4JI6F 4R5PA 2G1DA 1BQMB 4LF5J 2I1RA 2F8HA 4RNNA 1X9WA 1WG5A 3RRKA 1RT1B 2ZH8A 2LMIA 2WVDA 4YY3F 4EYIB 4DSLA 1IBMF 3BQ1A 1WG1A 3AY0A 2JFKA 2Q79A 3BBBA 4R0EA 4J9SA 1TL4A 3PACA 1YWXA 1UAWA 3H98A 4IH7A 4LF6J 5E7OB 5JVGQ 4KV8B 2M88A 4DU7A 4O0IA 5ETTA 3MTKA 2VFUA 3OSNA 4YR2A 1IBLF 3EMTA 1NJYA 5ETKA 4NLOA 3TA0A 3NGRA 4YR0A 4TU9A 3GILA 3FVYA 1Y10A 4E8UA 2F63A 2CPDA 3CB4A 1RAGB 4USMA 1URNA 5KG4A 3OUYA 4DR6F 5CABA 4CTAB 4K4WA 4JI2F 2MJUA 4JI4J 4K4VA 2DGTA 1VDHA 3KK1B 1ZPWX 2WVBA 3CC7S 1RGVA 3UDLA 1ZZNA 4QIFA 4OMFG 5KAKA 2R7XA 4M94A 1MU2A 4GO5X 4WKRA 3NBPA 2WVEA 2OIHA 4ECUA 3UQSA 3TEHB 2OPRB 1I5OB 3Q23A 1H72C 3QWUA 3L3CA 5GMEA 3M6WA 4PG7A 3I0SA 2JFDA 1JLQA 3LALA 5KT4A 5F9LA 3MD3A 4WP9A 3TAMB 2J0SD 3WX4A 1PC4A 3W8GA 5JJBA 4RR5A 2G0IA 1SKWA 1IWGA 4DX6A 2F4VF 1NDPA 4K5RA 3KLHB 2FC9A 3W1YC 3THVA 4DOZA 3SCLE 2QLJB 1AUSL 2GAGC 1FKPA 2YKNB 3MPVA 4DQIA 2WW8A 2Z0GA 2DKOB 2RF2B 1HNVB 5C7PA 1Z2LA 2I38A 3HFZB 4M5MA 1S9GB 3RUBL 1K0TA 3BBCA 2ZBRA 4ITSA 5F0WA 3CC4S 1ACMB 1IKYB 1T05A 5DO2A 5L1KA 3M2UA 2RNEA 2A10A 3MMBB 3MOZA 4L73A 5J2MA 3DYAB 2YWKA 3FUYA 4Y3CA 2HQCA 2C2EA 1WOOA 3DDIA 3LGMA 3LF0A 4O3QA 4J5OA 1S1TA 2B51A 1X4BA 3M30B 2YWFA 4XDDA 3KUEA 4DFMA 2NXNA 5CA5A 1U6ZA 3SCKE 2HURA 4XIUA 3PW2A 4A8KA 3D54A 5IV3A 4L72B 2Y1RI 1X7VA 2VASA 2CWKA 4KKOB 4PXBA 4ZHRB 1FX2A 4OX9J 2CNLB 4ZPTR 2ZVSA 2DRDA 4H4MB 2DGXA 3FKBA 1FFGB 3J81Y 2DHSA 1IJEB 4MKYA 1S6OA 5GMDA 1OIAA 4CP5A 1EAYC 5HLFA 4ER8A 3W2WA 5DZ7A 1IKWB 2XYHB 2AX1A 3UCZP 4ETXA 4JI3J 2E5LF 3AOCA 4DV6F 2FYXA 4FF2A 3D9BA 2DIUA 3C6TA 3BH7B 2UUBF 3V2UC 1NK6A 2I2YA 3Q8UA 3WC2A 2UUCJ 1LW2A 4ECYA 4TY8B 2HNDB 2OPQA 3NWGA 5KT7A 1VRUB 1S6QB 3K2YA 4I0WA 4K5SA 1BMQB 4ZPCA 4ANEA 2R7TA 1RJJA 3TA1A 5KFIA 3H2VE 2HHUA 3R5CA 1G1XA 4EYHB 1S5ZA 3HHLD 5HMZA 1J5OB 1HNWJ 4LIRA 2DXFA 1VS3A 2CWXA 2QZ8A 3MWBA 5CCMA 4YQWA 1UA1A 3UN2A 3P49B 3W2VA 4H4OA 2GFFA 1LW0B 1S72S 2MKCA 1F9FA 2HLUA 1X4GA 2OTJS 3QJPA 1N0VC 4C48A 3CNQP 4P72A 5EWFA 1FD8A 2LYVA 2W8LA 4NXNF 2DCUB 1NSAA 2VQEJ 1HIYA 2AZ1A 3HMJG 1UPMB 1VBZA 4HVZA 4HI1A 4DUTA 1BQXA 2IRUA 1HMVB 1K0VA 5B0EA 5KFHA 2YY3A 4JB8B
chains in the Genus database with same CATH topology
4N77A 4DV2F 3FQLA 4OI2A 1ZYQA 3DRYA 1ULRA 4EZ6A 3HHLC 3AB2B 1QAIA 3SYZA 3TW0A 3K8WA 4B3MF 4RNMA 1N5YB 1UMJA 2HWHA 5JUMA 4MKBA 2QMWA 4P6QA 4KQZA 3LP1A 2VKZG 2E44A 4EU0A 1N0UA 2FB0A 2MQMA 2D9OA 2IFXA 4C8MA 3MF5A 4ZP9A 1YJNS 1NK0A 1WACA 4HH1A 4PCQA 4C98A 2Q66A 3BR8A 1UETA 3AB4B 1FNXH 3HHNB 4DS5A 1CVJA 1WNEA 3HP6A 3VTIA 4RNHA 1AFIA 1DARA 1PILA 3B4MA 3FZBA 3HKZD 2KZMA 2ADBA 2B5JA 3T3FA 4BDPA 1ZAXA 5B0AA 5I42B 4MK9A 1F0XA 4GKKF 3DU6A 3PW5A 1IQZA 3KHRA 4HYKA 4LT6A 5F41A 1ZPVA 3QIPB 3MEKA 3K5MA 2ZE2A 2GC8A 4LQ9A 2DHGA 5J2NA 1M5HA 3CCMS 3C6UA 1UW4A 1X4FA 2N7YA 4DL0C 5A2QY 2XCAA 2NS1B 5M2UA 5MLCV 3VAKA 2KH9A 3Q2SC 4X4VA 2OFGX 2J7WA 3LAMA 3RW7A 1JNRB 5L1LA 1VC0A 1REVB 4W90B 3JSRA 1XMOF 4OJHA 5ITHA 4A8QA 4WKYA 4DSKA 4DHVA 3MUVP 1R8HA 3MD1A 1U2FA 1MU2B 2XS7A 2V8DA 2DGQA 2V5HG 3IRXB 2KVIA 4Y65A 4IR1A 4Y2CA 2YNHB 4IOBA 1HWIA 1Y9OA 2C42A 1KVIA 5A0YA 2AJ4A 3SDEB 4LUBA 3DLEA 3KK3A 1T95A 4PPZA 3U1MA 5AXMA 1ZTTA 3H40A 1TFWA 2W9CB 3CDEA 2VFTA 1R3NA 3M9MB 2XSJA 4K4UA 2Y1IA 1DZ5A 4DR7F 1SV5B 5H1SV 3D1HA 5JVHQ 1JKHA 1U7LA 3IO1A 5BYSA 4TQRA 1DLOB 3DOKB 4L3NA 3DRSA 4PUOA 1CLFA 1CG2A 2KFZA 4I2QA 3H20A 2ZD1B 2XNQA 2R8GA 1PSDA 1X9SA 1HWLA 2WK4A 3TVZA 4WFAQ 2ZZNA 2EVZA 3L7PA 3N28A 1ELOA 3OR1B 3E8OA 4C11B 3N5FA 4M63A 2X1FA 1FRXA 5GAEI 2DNLA 2GCFA 3NAIA 4WFXA 1T03A 2K1RA 2HHHF 4HHJA 4C0OC 2C22A 2ZZMA 2GHVC 2YWHA 4PKDB 2MQQA 1FRHA 2F40A 1ZTWA 1S77D 1HBOA 2E1AA 1QE1B 5KG5A 1GQEA 4TY9A 5EDWA 2C3UA 1TKZB 3KYLA 3U1NA 5DG9A 4NYZA 1HNIA 4ZP6A 3V6JA 4C7QA 2HNYB 1BD6A 2HGMA 2XI2A 2QO3A 3LP2A 5B0DA 3BREA 5IFMA 1WHWA 3DLBA 3M8QB 4GO7X 4KE5A 1DFDA 2IBOA 4F3MA 4JI1F 5KFUA 4K2XA 5DQIA 3MECB 2Y1JA 4KPYA 3T1AA 4I68A 2H9ZA 1TVRB 2BR0A 4NZ0A 3SZ2A 1HBUA 3LOUA 3KLEB 3VCDA 4FVCA 1UJ5A 2MGZB 5LMUF 1CQNA 4AFFA 3VR1A 3NNHA 4HKQA 4DDFA 2KM8C 2IC3B 2ROGA 2PEHA 3QMQA 2XMWA 4ZVFA 5C24A 4RBTA 1JLEB