4RW7B

Crystal structure of hiv-1 reverse transcriptase (k103n, y181c) variant in complex with (e)-3-(3-chloro-5-(2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj532), a non-nucleoside inhibitor
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
424
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 102
structure length 405
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw7B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw7B03
3JYTB 2IJNA 4G1QB 3PW4A 3ISNC 1HQEB 1LWEA 2YNIA 5C42B 4QWBA 2YNHA 5KFBA 4ED0A 4DL7A 3V6DA 3GV8B 1UWBB 1JKHA 1TVRA 3C6UA 2QV6A 3MECA 3KK1B 3V4IA 4K4TA 4EYHB 1S0OA 2AWZA 1XR5A 2IA6A 4MIBA 1RA6A 1RT6B 1TQLA 5KFMA 5CYMB 4U7CA 2VA2A 4K50A 1BQMB 1C0UA 4NLRA 4WFYA 2AGPA 3H5XA 4TQSA 4IDKA 5F8NA 1NHUA 1BQNB 1J5OA 1RDRA 5F8MA 4M95A 4IRDA 4R5PA 2ASJA 1FKOB 4IFYA 4U6PA 3KLHA 4NLDA 1TL1A 3IS9B 4NLTA 4FBUA 3I0RA 4K4ZA 2WONB 1RT1B 4WXOA 5KT5A 4NLPA 1FKPB 5KFTA 3OL7A 3BSCA 5HP1A 4R8UA 3QO9A 3NBPA 3V81A 4RW7B 2W9CB 2YKMB 5EWFA 4KV8A 1JLBA 4R0EA 1QE1B 2HNYA 1S1WB 1JLCA 5K14A 3GQCA 3KJVB 4RU9A 3EPGA 2YNGB 2IM0A 4B3OA 1W25A 2BRKA 3TQ1A 2R8GA 2ILZA 4K4WA 4IRCA 3H59A 2J6UA 5C24B 3QZ8A 1RTDA 4F4YA 2UVVA 1S1VA 4WFZA 3SFUA 3CJ5A 2OH2A 2WRMA 1MU2A 4ID5B 4IR9A 2FVPA 3MEDB 4TY8A 3G6VA 1S1TA 5KFLA 3DRSA 4ECRA 4KKOA 3PW5A 1S6PA 2WB4A 3N6NA 4IG0B 1C1BA 4Y2CA 3KOAA 4IRKA 2HNZA 3QYYA 4K4YA 2R8HA 5KG6A 4MFBA 4RW8A 5EWGA 1VRTA 4GC6A 5FDLB 1S9EB 3I5AA 4EEYA 3TAMB 4WXWA 3IGVA 4I7FA 4I2QA 5KFWA 2WHOA 5KFIA 3PR4A 1IM4A 3DOKB 3KLGA 4Y34A 2R8IA 3GYNA 4KFBA 3BR9A 2E9ZA 5J1EA 2RDIA 3Q8SB 3OL6A 1RTJA 3JYTA 4G1QA 2YNIB 3LP1B 2YNHB 1HQEA 5C42A 3QGGA 4YR3A 3V6DB 5KG3A 2GC8A 1JKHB 1TVRB 2OPSA 3C6UB 4F50A 2UVRA 3MECB 2XCPA 5KFXA 4ED2A 1NNDA 4J9PA 2IAJA 4QWEA 2C28A 5KFDA 4I2PA 2ASDA 1C0UB 5CYMA 5EUHA 1BQMA 4IDKB 1R0AA 1RT4B 2I5JA 5D3GB 1K1QA 3G6YA 5KFNA 2W9BA 2F8EX 3BQ0A 1J5OB 1RTHA 3C6TB 4ZVFA 3CWJA 1TKZA 4IH7A 1FKOA 3EZUA 3H2LA 1JLFA 2UVUA 4ICLB 1TL1B 3I0RB 4Q0BA 4XPEA 2WONA 3EPIA 4MKBA 5HP1B 5KFKA 1ZTWA 2UUWA 3DDKA 3QO9B 4FS2A 3NBPB 3KK2A 2W9CA 4KSEB 2YKMA 1JLBB 4O3NA 3OL8A 4URQU 5K14B 1TP7A 4TLRA 4YR2A 3OSNA 5DQHA 2JEJA 1JLEB 3ISND 2GIRA 4EO6A 3PR5B 3H5YA 5C24A 3MR6A 3LP0A 1DTQA 1RTDB 5L1LA 2ILYA 3CDEA 2B6AB 4J9KA 1S48A 1MU2B 3BSOA 4TY8B 4ID5A 1T05A 4NLOA 4ZP7A 3DRSB 5CYQA 4KKOB 3MEGA 1S6PB 1C1BB 1XR7A 2FVCA 5KT6A 4IG0A 3MF5A 2W9AA 3G86A 2HNZB 2E9TA 1Z4UA 5DGAA 3ITHA 4MFBB 4MH8A 4NLSA 4RW8B 5KT7A 1VRTB 3KMQA 4O3OA 2AGQA 3BQ1A 1S9EA 2RKIA 4KAIA 4NZ0A 4RZRA 3TAMA 4I7FB 1T94A 4JV0A 1RT5B 4NLUA 4EO8A 2B43A 4HKQA 5C5JA 4KFBB 4IQXA 3V6HA 5J1EB 3FFIB 2ASLA 4PQUB 1S9GA 1RTJB 1RAJA 4ZPDA 4Q45A 3DLGA 2D3ZA 4HYKA 3LP1A 2D7SA 3PW0A 1C0TA 4TN2A 3RB6A 2OPSB 4JV1A 1N48A 3LANA 2IAJB 4NLGA 2R2RA 1JXLA 4I2PB 3CDWA 4RW6A 2DPIA 1R0AB 2I5JB 1RT4A 1RT7A 5D3GA 4MK8A 2RF2B 5KT3A 2W9BB 4GC7A 1RTHB 3PJXA 1TKZB 3C6TA 2ATLA 5I42A 3Q8RB 4H4OB 1JLFB 3MFIA 3BSAA 4WFXA 4G3IA 4ICLA 2W8KA 4Q0BB 3ICLA 3KHRA 3RB0A 4IR1A 2AX1A 2VG7B 5JUMA 3DLEA 3KK2B 1S1UB 3DOLB 1N5YA 1S0NA 3DYAA 4DEZA 3UR0A 1JLGB 1D1UA 2OPQB 1S1XA 1VRUA 2OPRA 5J2QA 2J6TA 3DLKA 4LQ3A 1IKXA 3KMSA 5J2PB 4ZVHA 1JLEA 5L9XA 1TV6B 1N6QB 3LP0B 1DTQB 5KT2A 3KHGA 2BR0A 3LALA 4KHMA 4WZMA 3BJYA 2O5DA 2B6AA 3BSNA 4IKAA 1K1SA 4O4RA 4URSA 3T5HA 2XI2A 4WZQA 1T05B 3IN5A 2ZKUA 5CYQB 4XPCA 3MEGB 5KFHA 4KE5A 4URGA 1DLOA 5KFUA 3NL0A 4RNFA 3CJ3A 3ITHB 1SV5A 2BQRA 1RTIA 1HMVA 1S6QA 2HNDB 1S97A 2R2TA 1GX6A 3N6MA 4ECWA 5KFPA 3CO9A 4DL6A 5KFJA 4JV2A 2RKIB 4JUZA 1EP4B 3Q8PB 3KLEA 1RT5A 5HBMA 4IH5A 2XWYA 3OLBA 3G6XA 1EETA 1JIHA 3VQSA 1S9GB 4ED6A 3FFIA 5KG2A 4PQUA 1QAJA 3NAIA 3DLGB 3PHEA 4TY9A 1IKVB 1S0MA 1C0TB 3KHLA 4F4XA 3FQKA 4IFVA 4O3RA 4YQWA 1TKXA 1MMLA 4Q44A 1REVB 4NRUA 3GILA 1RT2A 4IOBA 4RW6B 2C2RA 3QIPA 1RA7A 3I0SB 3T1AA 1RT7B 4ZHRB 2IJFA 2AX0A 2RF2A 4KHRA 4EBEA 1SH0A 3H5SA 5I42B 4O3SA 3OL9A 4WE1B 3MTKA 2V4QA 3GIIA 2EC0A 4H4OA 1LW0A 2UVWA 1ZTTA 3HKWA 3TVKA 4ED3A 5KG1A 3GIJA 4RUAA 1SH3A 3M9NB 3DLEB 4O4GB 2VG7A 4ZP6A 2W7PA 2ZE2A 4J9SA 1FK9A 1N5YB 1S1UA 3DYAB 3DOLA 3RAXA 4ZPBA 5J2NA 2R2SA 2W8LA 1JLGA 2BQ3A 1RYRA 1S1XB 1VRUB 2OPRB 2OPQA 5J2QB 3DLKB 3BQ2A 3CIZA 1IKXB 1S49A 3NGDA 5J2PA 4PWDB 4YMEA 5F8IA 4ED1A 3I5BA 1NHVA 1TV6A 3LAKA 2R2UA 1N6QA 2WK4A 3PZPA 2BANA 4YP3A 3NMAA 3E51A 5KFYA 4ECVA 1S4FA 3N6LA 3H5UA 3M8QA 4F4ZA 4Y2AA 5J2MB 4MK9A 5DGBA 3H4DA 5HLFB 4OL8A 3QZ7A 4ECZA 3DMJA 1HNIA 4KO0A 3T5LA 1DLOB 3PJWA 2FVQA 5KG4A 3M9OB 3D5MA 3HHKA 1SV5B 4NLVA 4DL5A 1RTIB 1HMVB 1S6QB 4DG1A 2HNDA 4ECQA 3KLVA 3E01A 3T19A 3NAHA 4NLQA 4RUCA 4J9NA 4J9LA 4F4WA 3MR5A 3KK3A 3M8PB 5DQGA 1EP4A 3KLEB 4TQRA 2WOMA 5HBMB 2FLPA 1EETB 2R8KA 5KFFA 2HWIA 1LW2A 4PUOB 4RW9A 5KFOA 4EBCA 3QIDA 4Q8FA 3DRRB 2BE2A 3DM2A 1IKVA 1DTTA 2ZD1B 2XI3A 3OLAA 3CJ0A 2J6SA 4LSNB 4O3QA 4FBTA 4X2BA 3KNAA 4IFVB 1TKXB 3BGRB 1RT2B 1REVA 5F8LA 2YKNA 5KFVA 3QIPB 1T03A 4ZPAA 3CVKA 3I0SA 2JEIA 4ZHRA 3FSIA 1RT3A 3RBDA 3MFHA 4DL4A 4RNMA 1IKYA 3DRPB 2B5JB 2C2DA 4WE1A 4IH6A 2YNFA 4XO0A 1LW0B 5KFAA 2JC1A 5KFSA 1LWCA 2FJVA 1LWFA 4NLXA 4NRTA 5DG8A 3FQLA 2BQUA 2OPPB 4RW4A 5EWEA 4O4GA 3CJ2A 2ZE2B 1FK9B 3FDSA 4EYIB 4ECSA 5I3UA 4RNOA 5J2NB 4LSLB 1C1CA 2WCXA 5L1IA 3Q8QB 1HPZA 4H54A 2WTFA 4K4VA 3H98A 2HWHA 4PWDA 1IKWB 4MIAA 4NCGB 4MK7A 2BANB 1RYSA 3KHHA 1S9FA 2AGOA 5KT4A 3KLIA 3M8QB 5DG9A 2XGPA 1S10A 1JLAA 4H4MA 2FLLA 5J2MA 3HVTB 2CKWA 2CJQA 5HLFA 3PW7A 3NKYA 3DMJB 1HNIB 4KO0B 4WYWA 3GV5B 1ZETA 4ECUA 4RNHA 2AU0A 1HNVB 4Q43A 2D3UA 4DG1B 5KFRA 1GX5A 1TKTB 2FVRA 3MR2A 3E01B 3HVWA 2I1RA 2VG5B 5C25B 4QWDA 4Q8EA 3IG1A 4O44A 4ZMMA 3KK3B 4QW8A 3M8PA 1OS5A 2HMIB 2WOMB 4QW9A 3GIMA 2VA3A 1WNEA 1KLMA 2IC3A 4IG3A 2IM1A 5KG0A 1LW2B 3KLFA 4RW9B 4NLWA 2UUTA 1JLQA 4PUOA 5KFQA 5DLGA 5KG5A 3IRXA 2BE2B 3DM2B 5HROA 1DTTB 3DRRA 5F8GA 2ZD1A 3UQSA 3MEEB 1TL3B 1N4LA 1HYSA 4LSNA 2JLEA 2VG6A 2GIQA 1YVFA 3OHAA 3BGRA 5KFEA 3DI6A 3LP2B 1SH2A 3QLHA 2YKNB 3LAMA 4WYLA 4TXSA 3H4BA 1T03B 3OSPA 2RDJA 1SUQB 1RT3B 2W7OA 4J9OA 4ZP9A 4ED7A 1IKYB 3V6JA 4ZVGA 3DRPA 1XR6A 2B5JA 2YNFB 1QUVA 1HQUA 3JSMA 1C2PA 4LQ9A 5KFGA 5KFZA 5EDWA 2XCAA 3IGNA 4DL2A 1LWCB 1LWFB 1LWEB 4EBDA 4RW4B 2OPPA 4K4SA 3GIKA 3H40A 1UWBA 3T5JA 2HAIA 3V4IB 4ED8A 2DPJA 5I3UB 1JX4A 3KK1A 3M9MB 3FRZA 1C1CB 5KFCA 4LSLA 4KB7A 2FLNA 5T14A 2IMWP 4J9QA 1RT6A 3RB4A 5F9NA 1HPZB 2FJXA 2FVSA 2C22A 3OHBA 5JXSA 3UDLA 3MR3A 1BQNA 5L1JA 4YR0A 4FS1A 2IBKA 4R5PB 2D41A 1IKWA 1D0EA 3PW2A 4NCGA 4IFYB 3SFGA 4MKAA 3KLIB 4KBIA 5F8HA 3KLHB 4ECTA 4QWCA 4ZPCA 3IS9A 1JLAB 4H4MB 1CSJA 3D28A 4TYAA 1U09A 1RT1A 2JC0A 3HVTA 2IM2A 4ECXA 1FKPA 3GV7B 4R8UB 3V6KA 4TYBA 2XGQA 3V81B 4ZVEA 5KG7A 3T5KA 4RW7A 2C2EA 2JEGA 1HNVA 4KV8B 2BRLA 4NLYA 2IM3A 2HNYB 1JLCB 1TKTA 1QE1A 3BREA 1S1WA 4Y3CA 4RNNA 3KJVA 4B3OB 3IG1B 2VG5A 2YNGA 4O44B 5C25A 1KHWA 5L1KA 2R8JA 1KHVA 2QE5A 1HARA 5F8JA 2XC9A 2HMIA 3HVAA 5DLFA 5F9LA 5DG7A 4IG3B 1KLMB 1S1VB 2IC3B 3KLFB 4DL3A 1JLQB 3QGHA 1QAIA 4QPXA 4ZP8A 3IRXB 1S1TB 5HROB 3MEDA 2E9RX 2V0NA 4J9MA 3PVXA 1HYSB 4O3PA 3MEEA 1TL3A 2V9WA 2VG6B 2AQ4A 5DQIA 2FJWA 3RBEA 3CDUA 3DI6B 2ALZA 3QLHB 3RB3A 3LP2A 4K4UA 4QWAA 3RAQA 5FDLA 3SI8A 1I6JA 1SUQA 4ECYA 2JEFA 4K4XA 1N56A 4I2QB 3UPFA 1HQUB 3JSMB 3KLGB 4M94A 3CJ4A 3DOKA 3QGIA 4J9RA 4NYZA 3I5CA 2V4RA 1T3NA
chains in the Genus database with same CATH superfamily
4QWBA 5C42B 3O1LA 4ZS6A 3V4IA 1RHMB 3M1VB 4K50A 3LGHA 1N32J 1PC5A 3HO1A 1UMJA 1BQNB 4R5PA 2QIFA 1RT1B 1FKPB 2ROGA 2OIHA 2JDJA 1YI2S 1N36F 2N3LA 5T41A 2XMTA 1WWHA 4B3OA 5C24B 5ETPA 1S1VA 3DGPA 1M90T 1YJUA 2KT2A 1LXJA 4MTPA 1OY6A 3W2WB 2MYFA 4X4QA 2E7XA 2HVIA 1IM4A 1P27B 5DDPC 1XQIA 4RLEA 4I6YA 4B02A 2YNHB 1W7WA 2FC9A 2D74B 2OPSA 4ED2A 2Z58B 5BR8F 2GAHC 2XEXA 3Q8YA 2ZBCA 3H2UB 2UVUA 3PYFA 1TL1B 1WOSA 3H7HB 1ZTWA 1OMSA 3AA9A 2QO3A 1K9MT 1S79A 1RKJA 2H65B 2A18A 2AEFA 4FYDA 1SKSA 4X65J 1G4CA 1DTQA 2C42A 3CDEA 2BM0A 4CO4A 4IG0A 1NO8A 5F41A 1IUJA 3M6XA 2B3TB 4DV3F 2RS8A 4I7FB 3KUEA 1M5KC 1RTJB 4PXEA 3OVAA 1RU2A 4CT9A 4OI2A 4B9MA 4RW6A 4HDGA 5HMWA 4MK8A 4GKKJ 1A0OB 1WEXA 2X1GA 4HHHA 4J90A 3NY0A 5ADZA 2AX1A 1NK6A 1GAOA 3UR0A 5FIIA 2ZJQQ 2EEYA 1Q8BA 3FCHA 4DPYA 2DR7A 4PG7A 3ZZOA 2G4BA 1T05B 3D3BJ 3W9HA 2FJEB 2CG4A 2VV5A 1HHTP 3PACA 2HNDB 3TP2A 1EP4B 3TX0A 2XS5A 4PQUA 2Q66A 2D3O1 3P49B 1YJTA 3C15A 4USIA 2BKNA 3TA1A 2E66A 2E5JA 1RA7A 3I0SB 4KHRA 5HSPA 4EBEA 1HNXF 4WE1B 3OUYB 4BLGA 4H4OA 2MZJA 3LW5C 2E7VA 1GFWB 1NK4A 3UE2A 3D0HE 1FK9A 3QQCD 4CO0A 1CPZA 4G1PA 1H98A 3J7AN 3CIZA 1KONA 3TUJC 2VFVA 3OT9A 2BKPA 3KWMA 2J8SA 5CAAA 3M9OB 3A13A 2RVJA 1U47A 3LA0A 3KLVA 3E01A 3KK3A 1F5BA 2FLPA 3DGVA 4PUOB 2DRDA 4OMFG 2J6SA 5LM7E 4IFVB 1YQHA 4F4AA 2YKNA 4K59A 4ZHRA 1I1GA 1YRUA 3MMAB 5FD1A 2YBVA 2XM3A 5LOQA 4NLXA 2KM8B 4ANDA 5DG8A 4EYIB 1JWWA 1TK8A 2DY9A 3W64A 4PWDA 1QSYA 4L6V3 3ZNJ1 5DG9A 2DEIA 3BB5A 3P5BP 1PBUA 4DG1B 2DGWA 2GVZA 2DNMA 1OS5A 1UFWA 2HEKA 4HHUA 2AYBA 4OHVA 1SC3B 4IG3A 3KLFA 3AOBA 2IBOA 3Q23A 4J91A 2VUGA 3BGRA 3W66A 1UZHA 1R8CA 3DU6A 1OYDA 4TXSA 4OZ2A 2EG1A 3T9NA 4M5DA 4XK8C 1SJRA 1W26A 2KFNA 2G2ZA 4WKRA 3VR1A 2OPPA 4ED8A 2UP1A 2IMWP 4PG6A 4WPAA 3MURP 1PKUA 4B9NA 4KPYA 2CQ3A 5JXSA 2AEMA 1D0EA 2JOQA 3BEGB 2BJ8A 3MM7B 2HHWA 2ZOGA 1JLAB 4H4MB 3HVTA 4R8UB 2QYGA 6FDRA 2EBGA 4LRDA 1KHVA 1WORA 1VCTA 5ETRA 3C19A 3MCMA 2O66A 4OZNA 3IRXB 1YBAA 2VQFF 3U7JA 1TL3A 3BBBA 2ALZA 4JI2F 1OPIA 2XG8A 1BQXA 1HQUB 2H9ZA 2GGPA 4FKYA 2P9GA 4DV7F 3VCDA 2BQ3A 4C48A 1XIQA 1Y5NB 2BA9A 4LVNP 3OVSA 3Q2TC 1C0UA 4DZDA 2DHXA 3KLHA 3L7PA 2KVQE 2VFUA 2CQBA 5HP1A 1NEEA 3D68A 2JJ4D 1CJTB 1H7WA 3EPGA 2EFQA 1Q81T 4ILRA 3ZFVA 3H59A 3Q24A 4GKJJ 3CULA 5AT1B 5A8WA 1UW4A 1V3RA 3N6NA 3HZGA 3M4XA 2HNZA 4K4YA 3IWNC 2KZZA 5KG6A 4DF8A 3ADAC 1VRTA 2XMJA 5FDLB 4WU3A 2XBPA 1IQZA 4ENOA 4E98A 1S76D 3SSSA 2I2YA 3LP1B 3IBCB 1O8BA 5KFXA 4GVBA 3DDIA 4GMKA 3G6YA 4ZVFA 3EZOA 1U1RA 3KYLA 3H90A 2BZ2A 4Q0BA 1UJ4A 3NBPB 2M88A 3DLLQ 1DRZA 2MQLA 2OELA 2J8AA 4LFAF 3BO4A 2E5GA 3CJTA 4NLOA 3HHLD 3MEGA 1YJWS 2Q1LA 3Q89A 1IWAA 2BABA 2IFXA 4F26A 1KNZA 3BQ1A 2ASYA 2MLYA 3JTPA 1H6KX 3UW1A 4KHPF 5C5JA 1LV5A 3DLGA 1B0PA 4TN2A 3GG1A 1RWMB 3QT8A 2RF2B 1RTHB 5B0BA 2HBYB 4OX9F 4PPZA 3BSAA 2Z0GA 3TZZA 3D54A 4Q7AA 3IAM9 5AXNA 1TKDA 2ZH6A 1JLGB 3C14A 5SUHA 3KMSA 1JLEA 3VF0B 3CCVS 2V4JB 3I9V9 1KTVA 4USWA 1S72S 2VIHA 4CI0B 2KB2A 3N6MA 5KFPA 3TJ8A 2Y8YA 1JMTA 2AKWB 5B7WA 3TEHB 3KHLA 2LQJA 1JQGA 2HK2A 1IQTA 4U8VA 5IXUA 1RT7B 2HQIA 1N8RT 1RADB 2BMBA 3HSGA 3M6VA 2A1BA 3GR1A 1LFPA 1U45A 4CCHA 2FJBB 1VRUB 5J2QB 2OP5A 4L75A 4CLYA 5J2PA 2ZH3A 4YP3A 4KT0C 3N6LA 1YBTA 3M8QA 2X1AA 1KS2A 1X4FA 2B4UA 1WSVA 4KO0A 1DLOB 2KHCA 3HHKA 1Q79A 4NYOA 2HIYA 3HJVA 2YY3A 2V2QA 5IT9Y 3MWBA 1FVQA 4DOZA 3RGIA 4OYXA 2DH7A 4EBCA 4EI2A 3IO1A 3M30A 4PCQA 1TKXB 3GJSB 3NCRA 3VQTA 3HHNB 1PCAA 1PJ5A 2XY7A 1KKHA 1UW9A 2ZNYA 3G8SA 3LWLA 4U96A 3OJUA 5I3UA 4RNOA 2OTLS 2W4PA 4UOCA 3M2VA 4MIAA 2IRUA 4ZCKA 1RYSA 1R0BG 2PMWA 1TELA 3OV7A 1H3DA 3NKYA 4WYWA 4C6AA 5K5MA 4B9UA 4UQGA 2PC6A 2VG5B 4Q8EA 4PKDB 1SQEA 1U6ZA 2RDDA 2H1YA 3DLJA 4MKVA 3MEEB 4PR6A 2YQ3A 3H4BA 1WJ9A 3OXGA 3K5LA 2XZTB 4U7UD 3IGNA 1ZA1B 1LWEB 3HFKA 1CS4B 1SBRA 1XERA 1LFWA 2C2ZB 4PZVA 2WW8A 3NGUA 4B9TA 3DCAA 5GAHI 4NLYA 4MYTA 1QTNB 1S1WA 2HVHA 3CMAS 3UVJB 5A8KB 2NXCA 1YG0A 2OFHX 3MD1A 4DUZJ 4K2XA 3ET6A 3BYRA 3JSMB 3KLGB 3HDSA 3CJ4A 5DM6Q 3JYTB 1F5AA 4ED0A 6AT1B 5G4DA 3VZIA 3H5XA 1M0SA 1EZZB 4DSKA 2JFKA 2XMMA 1U24A 4U6PA 1I94F 3POTB 1FCAA 4J5OA 5AE1A 5D15A 4WK3A 1D9DA 3PHTA 4CZCA 1VLYA 2W7AA 1QVGR 4OLPA 4OHYA 4IR9A 2AJ0A 4IRKA 1JJHA 3QYYA 4USTA 4OIXA 4JI7F 1TUVA 1G6BA 5MAOA 3PR4A 1VK3A 1FE0A 3Q8SB 3ZTQA 1JKHB 2VC1A 2J9DE 4JV5J 5KFDA 3J81U 1F9FA 1U4BA 3T1HJ 4WP9A 2W9BA 3BQ0A 2MY8A 4ANEA 3MM9B 3TA2A 2C3PA 3AFGA 2QX0A 2G2YA 3DDKA 4FS2A 4NXNJ 2F7VA 3W2VB 2LA4A 1NM2A 4YR2A 3ISND 4K5RA 2G0CA 4X4UA 1RTDB 3BGUA 2PA3A 4ZVUB 2Y8WA 2LFVA 2MJNA 3HVRA 5CYQA 1ZOTA 5D4OA 1J2VA 2MQQA 2AIRB 2WSEC 4CO5A 1IBMF 3AB2B 3CEDA 3K17A 3FFIB 2LDIA 4HYKA 3S6EA 3K2YA 3M8ZA 3MEKA 4RPFA 1B3TA 3CDWA 2VFRA 1YJ7A 4GC7A 4LRAA 1XNRJ 2NZ4A 3UO0A 2HHHJ 4DV2J 3ICLA 1WD6A 2DNZA 4NX9A 3HD1A 1HW9A 3TNVA 2QLJB 4KHMA 4URSA 4KE5A 1U48A 5KFUA 4RNFA 2G9OA 3UFCX 1S97A 1F5CA 1H72C 3H8YA 3TJ9A 2BV3A 4WKYA 1RT5A 3M7VA 2XWYA 4K5SA 3CC2S 3M2RB 2FGCA 2RRBA 2B8PA 1MMLA 2XSJA 1RT2A 3VGUA 1NJYA 1NK8A 2NZCA 4DQIA 2R7XA 4ZVTB 5I42B 1R31A 3NRBA 1FRHA 2QA4S 5KG1A 4AL7A 2F8HA 4U8YA 4O4GB 4DSJA 1GXTA 1D9AA 1IBCB 4ED1A 4DPOA 2QN6B 4F4ZA 1DQ8A 3LOUA 1HNIA 2XY5A 1HKAA 1HMVB 2HLTA 3NNCA 1CJKB 1S5ZA 5ETLA 1WC4A 4DV6J 4PYDA 1FHTA 1M1GA 5KFFA 2HWIA 1CEZA 3CJ0A 1HD1A 2RUGA 2VPWB 4DCOB 5CD4A 1U1LA 1Y00A 2B5JB 4UZCA 2E1RA 3KNGA 1LWFA 3CJ2A 2ZE2B 4ECSA 2YH1A 4DV0J 4GO5X 1NK5A 2AP6A 1BMQB 1HPZA 2HLUA 2I8EA 3HKZD 2KFYA 4PG8A 2W01A 2YWKA 2NUHA 4ED5A 4V19X 3EWGA 2M3DA 1RZMA 4A8FA 2HKEA 2CDQA 2L48A 2MQOA 1NCLA 1FRMA 4QW9A 5KFQA 1X4GA 5F8GA 3DRRA 2MKHA 3LGNA 2JLEA 3OSPA 1F60B 1NLKL 2LDYA 3MM6A 3M2UB 1VS3A 2QA2A 1UEKA 3NS5A 2KXFA 3H40A 1UWBA 3V4IB 1TTHB 3WIUA 2FLNA 2BJDA 3CCUS 2CQIA 4MAKA 2FJXA 1YSJA 4R5PB 2B0GA 4WFAQ 3KLIB 4KBIA 4QWCA 2QYCA 2P6TA 5IFMA 4DUTA 1U6BA 3I32A 3DOMA 4N7TA 5SZTA 1QUPA 4C3MA 2X3GA 4B3OB 1HL6A 2ZUGA 3NGRA 4EWTA 4KGMA 2G0JA 2BOPA 3DXSX 2J76E 3HZEA 5LSRA 2ZZMA 1S1VB 3DGPB 2DGUA 3QGHA 4HVZA 1UVNA 3BKTA 2MHEA 5DS7A 3JS9A 1O6XA 1IXKA 3DHWC 3RAQA 1NU4A 4DV4J 1T0TV 1M5VC 1N56A 4ELUA 4R0EA 1E6VA 4J9UE 2YNIA 1XMQF 1OY9A 2G2OA 1RT6B 4WFYA 3G9CA 2ZHOA 4ZN3A 4M63A 3GSDA 1GQEA 3CJSA 2MLXA 3TVYA 3O8WA 5K14A 4I0WA 2AZ3A 2WB1D 1JB0C 2V68A 2ZHBA 1M5OC 7FD1A 3O6QA 4OI4A 1S4EA 3AJ2A 1S6PA 2QEXS 4IG0B 4LIWA 1RSCA 5EWGA 1REGX 4F0KA 4GC6A 4ALZA 3KTQA 4ZITA 3EGWB 2AJ4A 4EEYA 4X62F 2WHOA 1U25A 2MQMA 4A8QA 2E9ZA 5IV4A 1HQEA 3R2CJ 3IXQA 2P8IA 2FY8A 1KRPA 3CCTA 2F8EX 1J5OB 3K7RA 1RAEB 4NXMF 1WKLA 2RU3A 2DGSA 2W9CA 4LUBA 3NXZA 4URQU 3M6UA 4P2MA 4A8MP 3SV3A 1HWJA 3H5YA 4JP8A 2FHJA 1VQLS 3CJ8A 1TL4A 4KGXB 3MCNA 4ELTA 1U1PA 3ITHA 3ISZA 1YJRA 3GFYA 1Z2ZA 3HF5A 4DS4A 5K8PA 3ZXWA 3QFWA 4PQUB 5G0RB 4C8NA 4Q45A 2LECA 1NB7A 1X9WA 2DIUA 3C15B 1AFIA 1HW8A 3W5XA 3T1YJ 3SIPB 1SXLA 2G0IA 4H4OB 4G3IA 4ICLA 2W8KA 1FDNA 5RUBA 2HBRB 3DLEA 1VYAA 1N5YA 1SJQA 1HQ2A 5C2GA 3A3OB 2KI2A 4LR7A 3VGTA 4CM2A 2HIQA 4XPCA 5KFHA 5JVHQ 2DNYA 4FYYB 4LF6J 2W2NP 1YX2A 2MJUA 1PJ6A 2RKIB 1N33J 1UKUA 1VQKS 4XIUA 3OLBA 1EETA 1FT8A 4DQRA 4QQBA 1TAQA 3P8BB 3FQKA 3O44A 2I0XA 4FF4A 4ZHRB 2IJFA 2PI5A 1SH0A 3MPYA 4AE5A 5HANA 4FF1A 1BLUA 4J37A 5K8OA 2KYXA 2KU7A 3GIJA 2MEWA 1E6YA 2GZOA 2R7VA 1HI0P 3HSJA 2XLJA 4PWDB 3IWXA 1TV6A 2K1RB 2R2UA 2NSCA 1XTZA 4MK9A 3PCOB 3PEHA 4RBTA 3QZ7A 1QD1A 4JI5J 2EWHA 1MWQA 1WOPA 3NAHA 1NAQA 1YKWA 2ZEJA 3DHXA 3HT0A 5HBMB 2CQHA 4N5SA 4HH1A 1ZA2B 2CVEA 1SIZA 1QSSA 3QIDA 1IKVA 1H2TZ 3R97A 4Q2MA 4HT7A 2DR5A 3BGRB 1REVA 4OYPA 2EFPA 4M5DB 2PFDA 2DYAA 1VBXA 2JC1A 1P9QC 3SSQA 4F36A 5LJ5Y 2OPPB 5E3QA 2CDRB 4PPDA 3OTCA 3D6MB 5L1IA 3G82A 1ZBTA 1NRKA 1HBOA 2RH3A 5J2MA 3HVTB 4PRFA 3PW7A 2OD4A 4ZPVR 3THVA 1UPPA 4QW8A 2ZITA 4OZ3A 3GIMA 1LW2B 5DLGA 2ZVIA 3QSIA 1TL3B 2KXNB 4NYPA 5JJBA 1D8ZA 3W9IA 1RT3B 1UA1A 3BGOP 4ZVGA 1QUVA 1C2PA 5E5NA 1M5SA 1IR2A 1FRXA 5LSLA 1Y5LB 3VAHA 2C1EB 3M1VA 1BQNA 5L1JA 1DBDA 4OYIA 1OYEA 3KLHB 4XTTA 1RT1A 4CM0A 1FKPA 4TYBA 2PEHA 1VR6A 3M32B 4X66J 1HNVA 3BREA 3MPVA 4DX7A 2ZDOA 4N8OA 2YTCA 1K73T 4U9RA 3GG0A 3ILOA 5A8WB 3FCVA 5GAEI 1ICEB 3MTJA 3TZYA 3VAKA 4WU2A 2VG6B 3FEYB 3PRVA 4B9VA 2PD1A 3W2WA 4F7VA 1KQFB 5IS2A 4B3MJ 1X60A 2OEMA 2UUCJ 3PW4A 1FFGB 3ZZRA 2YNHA 1CG2A 3KG1A 3GV8B 1P9YA 1Q1KA 4GVBB 4L74A 1RA6A 2LCWA 3MUVP 1FJCA 1T7PA 2ASJA 5KOXA 3S01A 4NLDA 1TL1A 3IS9B 3I4HX 5KT5A 1KLNA 5KFTA 3BSCA 3NNAA 3NOGA 4F3OA 2ILZA 2DNKA 4IRCA 4UUXA 2YWEA 3QZ8A 3R7BB 5BYSA 4CT8A 1NKCA 4P2XA 3UN5A 5EN1A 1RWWB 2DGQA 3MXHP 4I7FA 4JYAJ 4CO1A 2GQ2A 3OL6A 1RTJA 3D0GE 3MECB 2DR8A 2DRAA 4CTAB 4OV6A 2BOAA 1FJ7A 2BJ7A 3EZUA 3KXDA 1Q7LB 5ETNA 1GMWA 1AA1B 2GHPA 2UUWA 3QO9B 4A8XA 3C8YA 2XO7A 5L39A 3OSNA 1T3OA 1JLEB 2GIRA 4EO6A 3JQJA 3QJPA 1T05A 3FBBA 1HNZJ 4ZIVA 1Z4UA 4MFBB 1TFWA 5AE2A 2IVFB 1FFSB 4LVOP 3EJMA 2VQEJ 2XYGB 2YKQA 4IUFA 4AUKA 4C7QA 3CJKB 3R3TA 2NXNA 3PIPQ 2MKSA 2RRNA 3AQPA 3OUYA 2Y1RI 2Z56B 4F3MA 3W65A 5JUMA 3D7SB 2N3OA 5J2PB 4ZVHA 4B3RJ 3GFHA 1FF2A 5HVFA 2IDLA 2ZKUA 4PQAA 3H20A 4URGA 3MDFA 1OJ4A 3UD5A 2PA8D 3AD7C 1MLAA 5A6WA 3X3UA 1JIHA 5E3PA 1AROP 2K3KA 4F4XA 4DPTA 4IFVA 3GILA 3MMAA 2JNJA 4ZLNA 2P5VA 2VG7A 2CFXA 4HACB 4J9SA 3DYAB 3DOLA 3EXYA 3PKYA 3DLKB 3EM1A 4P7TA 3ZTRA 4K0KJ 3I5BA 3UN3A 2EVZA 4DR1F 1DAXA 3VAIA 5LMNF 2FUG9 3ZC4A 4DG1A 1T11A 1B7FA 3RAMA 1WC0A 1OQ3A 2N4CA 2YX7A 4DDFA 4DPWA 3ENAA 2G1HA 2KRBA 2R4FA 3NMRA 2LQ8A 2HFOA 4IH6A 4PYAA 5KFAA 3Q0AA 4C2MA 5J2NB 2XMKA 3P6YC 4KTQA 5GMEA 1MNEA 4JB8B 1UEVA 5BXIA 3H98A 2HWHA 4LIRA 1S9FA 2AGOA 1QVFR 1S10A 3EUNA 1JLAA 4H4MA 4OX6A 2AYEA 1X5OA 3PV8A 1QAXA 4RNHA 2XNRA 3MMBB 2V2KA 3I4PA 2LQBA 2MPUA 4B3SF 3KUHA 4KRWA 5DO2A 2VF3A 3PJ9A 1UA0A 1Y10A 5EHHA 3IRXA 2BE2B 1N4LA 5F3TA 2XZWA 4P6QA 1SH2A 2IYGA 5D4NA 1RHUB 4F8RA 4DLEA 1IKYB 5A0YA 2AZ1A 3MPUB 1HQUA 4DL2A 1FKAF 1MN9A 2AMCB 2UXBF 4OQJA 3RB4A 4PEOA 2AJ1A 3BN4A 4OJ1A 1NJIT 3T3FA 2CQCA 5K8MA 3UWTA 1YJNS 4KPCA 3T5KA 1CJTA 2C2KB 4NMXA 3UNGC 3IG1B 5C25A 3M6WA 4O44B 5L1KA 2R8JA 4KIAA 1J5EJ 1T9UA 2CQ4A 1CQMA 3HCXA 8AT1B 1JLQB 3H25A 4V19J 2NQPA 2HRTA 3K5PA 3LP2A 4K4UA 2F4FA 1NDPA 2DITA 5FDLA 4JI3F 4PG5A 5H1SV 3H42A 2LEBA 1X4BA 1P1TA 4IOAQ 1KD1T 4FNIA 2M5YA 1S0OA 4WIQA 2VC0A 4Q2LA 2ZVSA 2BE9B 1NHUA 4IO1A 2NXEA 1XNQJ 4CP5A 2F40A 4QIGA 2DNQA 3NBPA 1HWUA 1RTZA 5EWFA 3GQCA 1JLCA 1JJCB 1K47A 3KJVB 4KH1B 2YWWA 3CF5Q 1WG4A 2V8HA 1ZM4A 2VICA 4ZVQB 3EXCX 1CC7A 4JI6J 3BH6B 3RYLA 4DR3J 2WBRA 4QU6A 4EGLA 4Y34A 2RDIA 1A6LA 1TVRB 2UVRA 1IM6A 1NNDA 2LLZA 2ZC4A 3IC1A 3IBWA 1RTHA 4P2SA 3IMQJ 2M7SA 3EPIA 1HR0F 4BC9A 2RB7A 8RUCA 2Y3YA 4TLRA 4A48A 1RK8A 2H5IB 3PR5B 3ULHA 3R5GA 2V4JA 3BSOA 1NBEB 3VZHA 3G86A 4LFCJ 3HSZA 3US5A 1RT5B 2VB6A 2HQDA 1XC9A 5J1EB 2ASLA 4DX8H 4PWWA 3FMWA 3X1LB 5DETA 4UF4A 2IAJB 4NLGA 1S57A 4MIWA 1WTBA 2I5JB 1RT4A 1RT7A 5D3GA 1T95A 3V2UC 1KC8T 3T41A 5HO4A 4QPTA 1NSKL 1U2FA 5D4PA 1VRUA 4LQ3A 5J2QA 2DNGA 4N47A 3BV8A 4O4RA 3TYTA 1FEHA 3IN5A 2B9WA 1DLOA 4KH0B 4X64J 2KXHA 4ECWA 3UD3P 3QRRA 4PXDA 4KC5A 2F4VJ 9ATCB 3VQSA 5A6PA 1VI7A 3PHEA 4Z7YA 1RCOB 4DR6F 3FJ2A 3HFZB 2KJWA 1TKXA 2LQ5A 2IVYA 3L3CA 2AX0A 4NOHA 2V4QA 2CG8A 2F5GA 4ED3A 2N82B 2VBWA 1N36J 3FBCA 4WWSA 2DEJA 4J9VA 1NHVA 1NSQA 2BEFA 3W5ZA 2AF6A 3TUIC 4ZN1A 4ECZA 5LJ3Y 1JXVA 3PJWA 3IFEA 4RUBA 2CJAA 3T19A 4NLQA 2GVDA 2CWKA 2K06A 4UZBA 2QLXA 4R25A 5DQGA 4ZLLA 5M2UA 5HI7A 4ZVSB 3ONQA 3UI3A 3DRRB 3MUMP 4P72A 2LU2A 2L9NA 5BR8J 2BJEA 3MM6B 1NMEB 1R8AA 2PT0A 1V3ZA 2GJIA 5LXRA 2BQUA 1S59A 5EWEA 1CS4A 3KKFA 3CMES 4EU0A 1SCJB 1WI6A 4H54A 5HL7Q 2F3JA 2LEPA 4M5JA 2VDIA 2ADCA 2DR6A 3DMJB 2DK2A 1MWZA 3DOMB 4ILMA 2ZH5A 2YWHA 4QWDA 4DV3J 5FJ4A 3W63A 2UUAJ 4ZVPB 3R6LB 4M5GA 4RW9B 3F41A 4W4MA 2ZD1A 2B9EA 2R9LA 1O0PA 1VBKA 3GPAA 3C16A 4ZLPA 4IYQA 2W25A 4B3TF 3JSMA 1UVMA 1E6VB 4RW4B 1SJ3P 3T5JA 5H9FJ 2JVOA 1JX4A 3OW2R 1N5SA 2FVSA 1IKWA 2MTLA 4NE9C 2JC0A 4B08A 1BGXT 2VPXB 4HHJA 2WBMA 4CLZA 2YXLA 2BW7A 2Y9HA 2PMHA 3RTVA 1KLMB 3AB4B 3GONA 4ZP8A 3JB9k 2B4PA 3NS6A 3DI6B 1RHKB 4RO0A 3ETOA 1GTEA 4OV1A 2JRSA 2OGUA 1HQEB 2W4DA 1JKHA 2QV6A 3MMJA 3CO0P 2ZUAA 2IA6A 5KFMA 4JV5F 4U7CA 2FDNA 3FSYA 4TQSA 1IBLJ 1OSDA 4OYAA 3ZTOA 4Y65A 3H2VE 4F3QA 3G2XA 4PXBA 3MM9A 2ROPA 3O5TB 4WXOA 1VK8A 4C8OA 2W9CB 1CULB 5F0UA 1PBAA 4RU9A 3TQ1A 3AJDA 2AEJA 1OY8A 3UNYA 1RTDA 2PGCA 5M2RA 4ECRA 4Y2CA 1KQKA 4C8YA 4USKA 2GQCA 2DR9A 3QWPA 1ZM2A 2CPYA 3HK2A 4ED4A 5KFWA 2IY5B 3GYNA 4DFMA 4WJBA 2E5LJ 3W8PA 1OPZA 4QIFA 4DX5A 2MZ1A 1HLWA 2C28A 4I4BA 4OLOA 4CO2A 2J7UA 2QL5B 5KFNA 3W61A 3R1LA 3LPYA 4ICLB 2VFTA 1NHKL 2OEKA 5DQHA 2Q6CA 4N8NA 4JI1F 3GP9A 2GA7A 1MU2B 2AYMA 4TY8B 1XR7A 2FVCA 2SXLA 3CD6S 2HRYA 1L5UA 4JOUA 4NA1A 1PYSB 3NG8A 1WC5A 1K0TA 4ZLJA 4DUYF 3THPA 1VC5A 3GWCA 1UETA 1TKZB 5I42A 2J7WA 2C3UA 1FTRA 1JLFB 1KEKA 3CCES 5A8RA 4DX6A 1BXNA 4X4RA 3OTOF 4DPUA 5IWAF 1TV6B 1B0VA 2JSXA 2Y1LB 5K9FA 2K8GA 2BR0A 5B0CA 2XI2A 2VQFJ 1W2BR 4FN5A 1KOOA 4ETXA 1HMVA 2ZOFA 4W92B 4AD6A 4AYBD 1EQ0A 4LF9F 3SMZA 3RW7A 4LMZA 4DV7J 2OUGA 1R7IA 1S9GB 4GVLA 1IKVB 1C0TB 2B7BB 1REVB 1GXUA 2M4MA 3IWLA 4I1TA 1RWUA 3AY0A 3GFZA 2ZE2A 5B0GA 1OIAA 4C11B 3G82B 2HFUA 4YMEA 3H5UA 5J2MB 5B0FA 3H4DA 2CQGA 1RTIB 4FXWA 1S6QB 5HMXA 4LBPA 4RUCA 1U2RA 4EFAC 3KLEB 2CPDA 3GCWP 2R8KA 1BY9A 2OO4A 4WCEQ 2VPYB 1HBNB 3I6PA 2M8DB 1RBOB 3BPDA 1XWLA 1V9OA 4X4VA 3NCQA 2E5HA 3UN2A 2CPIA 5AXMA 3M2UA 5JMNA 1LW0B 3SQOP 2XLIA 1WKKA 4HTJA 1MG7A 3MOZA 4ES1A 2KH9A 3TR5A 3TOQA 4HEA9 3RBZA 4LFAJ 4QJVA 3KLIA 3F73A 2GFFA 2CJQA 3NGTA 1HNVB 3AT1B 1UTAA 4KHPJ 3LQVA 5LMUF 3OFFA 2ADBA 1T8EA 2Z30B 1WNEA 4NLWA 2UUTA 5C7PA 4LR9A 1WACA 3W3SA 1NDKA 3RZAA 3QPIA 1NPKA 3D67A 4CLUA 2XQCA 1U8WA 4ED7A 4OX9J 4DCJB 3I56S 3BBFA 3N9UC 5KFZA 3T9ZA 5A76A 5DM7Q 1EARA 2KHDA 2MDAA 4X4OA 2AD9A 4J9QA 1RT6A 3WX4A 2ZFHA 4TU9A 1FI4A 1RHJB 2BJ3A 1Q86T 4HT5A 4F2RA 2E44A 1R8HA 3GV7B 3PFOA 2XGQA 5LSOA 2C2EA 3AXKA 4Y3CA 3VALA 1T9WA 2QE5A 1ROFA 3J81j 3A12A 1QAIA 4YB6A 4O3PA 4CNZA 5DQIA 4HL9A 4TU8A 3CCJS 2FHMA 2QA4G 3P45B 1FJGJ 1LEOA 3P96A 4ERDA 2YQ0A 4DL7A 4OI0A 3NS7B 3OFHA 3KK1B 1VQYA 1LK7A 2VA2A 3F56A 1F0XA 1J5OA 4D3HA 4IFYA 3N0VA 5A2QU 3RJMB 3FC9A 1VGYA 1U0HB 1EQMA 1NXIA 2YNGB 2H5JB 2IM0A 1W25A 3E3XA 2UXCF 1NJWA 2NUUG 2OHDA 1Q7YT 3EDRB 5DZ6A 2HURA 4LSZB 1VDHA 2WRMA 3V5RA 2FVPA 3MEDB 2FQQB 1VMBA 2WB4A 4DU8A 3ZTPA 4JI8F 5H9EK 2RQCA 2XHWA 2ZH7A 3J7Z5 1EKSA 2NCKL 5CH7B 2GMHA 5G0RA 4G1QA 1YIJS 3TA0A 2KO1A 4S0MA 1N0UA 5CYMA 1AZSB 4PAAA 4IDKB 4V1Ak 1XEZA 3T1YF 1FKOA 3QATA 3UDVA 3CD5A 1CC8A 2P9CA 4DU7A 5LL6d 3M8WA 2DD8S 1Y3JA 4YUDA 3PX4A 2B4OA 5L1LA 3LWMA 3U02A 1RU1A 1ZAWA 4RW8B 2KTQA 3ZNUA 3TANA 2VJVA 2CNNB 3CGIA 3J7ZT 2RKIA 3KG0A 3GJTB 4B17A 5IZHA 2GV1A 2FJAB 3JAMU 4YS2A 4WFBQ 1FRLA 4JV1A 3CDAA 3Q83A 2QJ3A 1HNWF 2Z2MA 4FNHA 1KN6A 3K59A 3HJFA 3MFIA 3HFVA 1RLCL 2VG7B 2JH3A 3DOLB 4OYOA 1X9MA 1RWXB 2K1RA 4TVAB 3LALA 3R8YA 2O5DA 2B6AA 2DH9A 1R0CB 3KG4A 2CJYB 4WF9Q 3NL0A 5F0WA 3CJRA 2CXEA 4DF4A 3CO9A 2DO4A 1XJWB 5HBMA 4G6VB 3CCWA 1S0MA 3CNQP 1EX8A 4Q44A 3HX9A 3OPKA 3T1AA 1FNOA 1N52B 3D1QA 4O3SA 4CH1A 1I94J 1T02A 3FUYA 3LGMA 2APOA 2H54B 1PSDA 4ZP6A 5GAGU 2OPQA 3CTRA 1IKXB 4LF5J 4WP3A 4E0DA 5E2QA 1S4FA 4ZKAA 3FBEA 3BKUA 4OL8A 2K2PA 3D5MA 4NLVA 2IRXA 4JI7J 4F4WA 4DSIA 1DQ9A 1MW7A 4OJHA 1LW2A 4M5MA 2ATCB 3D6HB 2QT7A 2AW0A 1U0SA 4NI2A 3CVKA 1RT3A 4DL4A 2EW9A 5A0YB 2M8HA 1AUDA 3GB0A 1MWYA 3R9LA 3EICA 2FJVA 3FQLA 3MI7X 5GADI 1BUXA 3HD2A 3GCXP 1WF2A 1CQNA 4K4VA 7AT1B 4CLTA 2HHPA 3BKFA 2P6SA 3M32A 5CABA 3W8GA 4X66F 5C25B 4BDPA 3MPWA 2NSBA 2J0SD 4DI6A 2IDEA 3F44A 4O23A 2MKYA 2QSFA 3FCWA 1AYEA 5IC4B 2UV8A 1WSRA 2VG6A 4DV1F 3LP2B 1GXLA 3FRYA 2V63A 2W7OA 5ETKA 2P9EA 4FKXA 2HYIB 3B4DA 1YJVA 5D0RA 1RE1B 2HS3A 2DPJA 1TUGB 1CJVA 5FLXU 1D09B 3N01A 2IBKA 1FD2A 4QYRA 3W62A 4DSFA 1YJ9S 3IS9A 4ECXA 3V6KA 1SL2A 1RWPB 3MCOA 4LBIA 3GYXB 1D9FA 1UP1A 1JLCB 3TAPA 5F9LA 4FVCA 4OYZA 3I55S 4G1IA 3QLHB 1LWXA 1RWKB 4QWAA 2MHNA 1SUQA 3KJNB 3CJQA 4NEZA 4QYZJ 3UPFA 3FSXA 2EFGA 1VQPS 3AA8A 2HWTA 3MECA 4CTAA 4YY3F 2AGPA 4OJ3A 2H48B 4MMOA 1RDRA 1NUEA 3U1LA 2MMYA 2WW4A 2CJ9A 3QO9A 3B54A 4KV8A 4KQZA 3CDBA 2BRKA 4CQ1A 2AJQA 1ZM9A 2V50A 2J6UA 3C2PA 2HHQA 2UVVA 3CJ5A 3AAWB 5KFLA 2CNKB 3A3PB 4MFBA 5AXKA 5BYRA 3R27A 3IAS9 2HZAA 2DVIA 1Q95G 1KVKA 1Q8IA 3A8EA 4KGZB 2VQEF 3DOKB 2HQCA 2VPZB 4ATNA 3P4UB 3C6UB 4NZ7A 1RI7A 3SQGB 3UDCA 3CJKA 4QWEA 2GQQA 4QIEA 2ZM6J 2FZKB 1RT4B 5D3GB 3I82A 2NLWA 3CWJA 1WTFA 2DHAA 3H2LA 3RW6A 2LEAA 4U95A 3N5FA 3EE3A 4RWXA 5IM0B 2ZKTA 3MAQA 3ZZUA 1U2CA 3NNHA 2U1AA 1R6VA 4H4KC 4OI1A 5IQQA 1LQ9A 2X51A 4U67Q 1YRTA 2QA1A 4DR2F 3RBXA 4O3OA 4RZRA 2DCUB 2AJFE 4KFBB 1S99A 4C8KA 1HBMA 1TMMA 2YPZA 2VONA 3PTWA 1Q8LA 2JZ5A 1R0AB 2CQDA 3PJXA 3I9ZA 1G1XA 4N56A 2ZH1A 4HACA 4DFPA 3DYAA 5E7OB 2MZTA 4QIWD 2HGNA 3DLKA 5D8HB 4QCLA 4WZMA 5DDOC 1FXRA 3MOJB 1HWLA 2B56A 3DU5A 2BQRA 3GZ7A 3BF4A 3C3LA 2GVDB 1GX6A 1DQAA 4JV2A 3C66A 3Q8PB 4UT4A 1VC0A 1XMQJ 4OX7A 4O3RA 2V67A 2C3YA 2MKIA 5KOWA 4XDCA 2VBZA 2F8MA 3ZZYA 5ETVA 1X5TA 5J2NA 1SJFA 1AUSL 3BDEA 3BS9A 1S1XB 1S49A 5F8IA 4JBCA 3ZTSA 3NOCA 4EUVA 3G96A 4DL5A 3PRBA 4FXVA 3MMBA 4X62J 3GSIA 3MR5A 1Z1ZA 4TQRA 5KFOA 2GJFA 3THTA 2BE2A 2ZD1B 3W9JA 3C16B 4QR1A 3E8OA 3P5TL 1CBKA 1IKYA 3NCPA 4NXMJ 2XYHB 3QAEA 5KFSA 3NWRA 4RBVA 3FDSA 3OXLA 2J0QD 4LFBF 2DT9A 1Y7PA 2WTFA 3VGVA 1IKWB 1RAOA 2IRYA 4I67A 2CQ0A 4F02A 1RBLA 3FMBA 1N34F 1XMBA 1URNA 2YKAA 4F0MA 3IG1A 3HXMA 4O44A 3K57A 3M8PA 2CQ2A 3TW0A 2IM1A 1JLQA 1DTTB 4BBYA 4FP9A 2FLOA 2AT1B 2LU1A 3CD7A 5HAOA 4GRSA 1H2UX 3ZZPA 1X7VA 4C8ZA 3DRPA 5KFGA 1VQ4S 1LWCB 3GTYX 2J0WA 2VDHA 4LSLA 1F3FA 1RWNB 1FNXH 3EGZA 4W98A 4MKAA 1G3OA 4ZPCA 2QTWA 3HLUA 4Y28C 1U1KA 3KUGA 3DFEA 3KJVA 2DB1A 2HHVA 4AQYF 1NKBA 1WEZA 5E3RA 2ZJRQ 2V0NA 2W1BA 3RBEA 3CDUA 3VAFA 4DR3F 4D3GA 2NXUA 8ATCB 4RWWA 2PDAA 2IJNA 4DQPA 3S7RA 1TVRA 4EYHB 4K4TA 3GIRA 2O3DA 1NK9A 1Q4RA 2B7CB 2CIMA 4RX6A 4ELVA 1KWMA 4K4ZA 2FHOB 2OMOA 4OYMA 1QE1B 2HNYA 2W24A 4K4WA 4HDHA 5K8NA 4C9DA 3LTOA 3HHLA 2KFZA 1S1TA 1FRIA 4OJGA 2YPYA 4MT1A 2YWGA 2VU5A 5J1EA 1YTYA 2UUBF 1QM9A 2IAJA 1B64A 1P1LA 5EUHA 2PMZD 2I5JA 3T6BA 4UW2A 4DV5J 1RAAB 3IP0A 5L38A 1FX4A 2WVEA 5A8RB 2ZBRA 4CNYA 3VWSA 2B8QA 2ZBPA 3C46A 3P3DA 2KRRA 1ACMB 5U47A 1RHRB 7FDRA 3DRSB 1C1BB 3Q8UA 3ZO7A 2E9TA 5KT7A 1T9VA 1FEEA 1S9EA 4WTYA 3AH6A 1T94A 4EO8A 1O5JA 2B43A 3H0PA 2E5IA 1RAJA 1KFSA 4LF2A 2DPIA 4A8YA 3PFEA 1FO1A 1VJQA 5GVQA 2MKCA 3CC7S 4WFXA 3RB0A 2I9SA 1X0FA 2MQ8A 4YN3B 2Z2ZA 5IT0A 3M8RA 3CSKA 1VIOA 2CPXA 3TWZA 2HGLA 3BH7B 1RACB 3CCSS 3EVMA 2DH8A 2CWXA 3J81Y 1XK8A 2R7TA 1QAYA 1GNKA 1RISA 1RQ0A 4IQMA 3M8YA 2VZ9A 1U7LA 5DZ7A 1T9YA 4IH5A 4ED6A 1R89A 4TY9A 3D66A 4FPRA 1YZ7A 5GAHU 2NR0A 3OFEA 4NRUA 2CRLA 1X4CA 4MKYA 3PYGA 1ZH5A 2ALYB 3M9NB 3TZXA 2CZVC 2RHQB 2Q6BA 4IOCQ 3NGDA 1N6QA 4NZ6A 4TKTA 4ECVA 1G7CB 4NWBA 3DMJA 3OBIA 5KG4A 2DXDA 2JLFA 4LF8J 1YWXA 5D77A 4J9NA 3WQPA 4NASA 4E2FB 2KKHA 2BE7D 3BYPA 2UUAF 4RW9A 2ZZTA 2GIFA 4C8LA 4X2BA 4I6AA 2HBZB 1FXLA 1RGVA 4KR0B 4LF1A 1IBKF 2COLA 3ENWA 2C2DA 3DRXA 1HIYA 5HJYA 2DNLA 2BXJA 3HMJG 4RW4A 4FVMA 1WI8A 2MZSA 1GMUA 2ACMA 3WZ0A 1NZ8A 2D9OA 5HMYA 3EZ5A 2QSWA 1RB0A 3PIOQ 2OI2A 5KTQA 5DDQC 3K5OA 2D3UA 2LQ9A 1GX5A 3MR2A 1N88A 4ZVOB 3CCZA 1V6HA 4ZMMA 3OTDA 1SL0A 1RAGB 3VVUA 3B78A 1KLMA 4NA3A 3DM2B 4F2SA 2HFVA 1UPMB 2GIQA 1ZAXA 3DI6A 1FDAA 4WYLA 2D69A 4NCAA 2C3OA 3G87A 3V6JA 3M05A 3VAGA 3B4MA 2W2PP 5AJ3J 1PG5B 3FZ2A 1B4SA 5T14A 3VV2B 5F9NA 3UDLA 3MM5B 1IBLF 4FS1A 2D41A 1GT8A 2MZRA 4IFYB 3MR7A 1R6YA 4ECTA 1CSJA 1VISA 2DRBA 1VQ7S 1F2HA 4Y2MA 4MYUA 2Z4PA 1QDUB 1R8PA 1CULA 1B7YB 4ILLA 4P75A 1TL5A 2M0GB 2YX1A 3TAQA 1M1HA 2RD5C 4DR5F 2KJVA 2IC3B 2VBXA 5HROB 2I6WA 4W90B 1HYSB 2V9WA 4XAKA 2ZOMA 1VQ9S 4LF7F 5E33A 4XDDA 5T7LA 4RKUC 3HHDA 1ZM3A 3FK4A 2JL9A 2JFDA 4YB7A 2VODA 1OO0B 4Z7CA 3UCGA 2VBYA 1W2IA 4G1QB 1TL7B 2E5LF 2CAJA 2OMLA 2FZGB 5CYMB 3HHLC 1IJFB 1YBUA 5F8MA 3SCIE 2HHXA 1FKOB 4X84A 1FWKA 4DR1J 5LMNJ 2QMXA 4RW7B 1XMOF 2RJZA 4P10A 1WEYA 4DR7F 3ZZTA 2BACA 3SFUA 1MU2A 2XMVA 4TY8A 3G6VA 3MCSA 2B4VA 1DURA 3K8WA 1X9SA 4OX8A 4YEAA 4I2QA 3NGSA 4ZOSA 1T9XA 3QGGA 2GC8A 1V3SA 4Y0FA 1HBUB 2DHHA 2MKKA 2FC8A 1B70B 2CNLB 1H0HB 2MSTA 1TKZA 1JLFA 4G65A 1RLDA 5H9FK 2HZCA 1FXDA 1DARA 4UTGA 5DJBA 2RQ4A 2O1PA 3MR6A 4B3SJ 2B6AB 1ZZNA 4ID5A 2VOPA 5KT6A 1FDBA 5IC6B 1Q5VA 2RRAA 3KMQA 4A4JA 4IQXA 1S9GA 4UOHA 4RU2A 1C0TA 3CMQA 2UXBJ 2X3DA 4JI4F 2VKRA 1UL3A 1VHFA 4HH0A 5I3PA 5IT9U 3UCZP 3B8HA 4DR4F 2QLBB 2DY1A 3W7BA 1FFWB 1F3VA 2XMAA 1LXNA 2W4CA 4DEZA 1CJUB 4C11A 2OPQB 2IPOB 3FVYA 1P6TA 4DL0C 3BJYA 4Z2XA 2DGOA 5I3QA 2H5EA 3U1NA 3K89A 1RTIA 4CWBA 1S6QA 3DKDA 4JI3J 3IR7B 4ZCIA 4L72B 3CD0A 3KLEA 4F4KA 1PJ7A 1QAJA 1HBNA 1IR1A 1HI8A 4ID8A 5CZXA 2E7WA 1H2VZ 4NI2B 1F9HA 2RQKA 3OFGA 2GJ2A 3RUBL 2EC0A 3QFHA 1LW0A 2BBEA 1ZTTA 3HKWA 4CO3A 1S1UA 2L3MA 4LR8A 3RAXA 1TU0B 2CQPA 2H4YB 3BO3A 2J5AA 2N7YA 3VHQA 1RWOB 1N32F 3RRKA 3OR1B 4OZLA 3NMAA 3E51A 1URRA 1SC1B 1SV5B 1EIYB 4LRCA 2W2MP 4L73A 2QRRA 1NSAA 3GYGA 2EKYA 4K7QA 1SB6A 3OLAA 4HLBA 4FBTA 4HI2A 2C3MA 4EK2A 3PO4A 1R43A 3QIPB 3DN9A 1RXOB 1JK9B 1XBWA 5I4MA 3MD3A 1HR0J 3QT6A 1U8SA 1CJVB 3K5MA 2NREA 2JHEA 2WCXA 4AT1B 5DDRC 2G1DA 3KDNA 2HHTA 4DZ6A 4KGKA 2CKWA 5HVGA 1J27A 2MGZA 4ECUA 2AU0A 3AD8C 3MPDA 2FVRA 4CRJA 1LK5A 3PKMA 2WOMB 4X65F 4FYWB 3AOAA 3TJAA 3EGNA 1QJHA 1IJEB 2LKZA 2Z2LA 3AODA 4X4PA 1TMJA 4X4TA 3W60A 3TO8A 1SUQB 3TUPA 3K0JA 4LRFA 2ZBIA 3QSYB 1U1QA 2YNFB 1FJGF 3R5DA 2YKOA 1NH8A 2MZQA 3KK1A 2GW8A 2DNNA 4ZPTR 3A3NB 3OHBA 3S8SA 4GKKF 4UUWA 1U0HA 1KP6A 2E1CA 3BGFA 5KG7A 1APSA 4KV8B 3QBCA 5D4LA 2YNGA 2PSZA 2HHSA 3OR2B 2DXEA 1L3UA 3MEDA 4J9MA 4DR6J 2N7CA 3RB3A 1X4EA 2JEFA 1ULRA 1UEUA 3FGVA 3TUZC 2WVBA 3ISNC 5KFBA 1RAFB 4Q5VA 3Q22A 1AZSA 4IDKA 2O01C 2GCFA 1AT1B 4QU7A 4NEYA 1KQGB 4NLPA 5J1PA 3MAAA 1FERA 2XS2A 3QRQA 1B99A 1VQ6S 3HM9A 5E3CA 2C2MB 2QG9B 3MM8B 2EFVA 1V5IB 1ITPA 3V4MA 1DZ5A 1LNQA 2QZ8A 4RW8A 4FYVB 3I5AA 2RMLA 3EYZA 1HBMB 3V6DB 4F50A 2WSFC 2HQ3A 6FD1A 2XCPA 4J9PA 4PWUA 2WZ1A 2VA3A 2ZWPA 1RABB 2ZNZA 2OSRA 1X5SA 2IMOA 3I0RB 4MKBA 2V34A 2M9KA 1TUWA 1YK9A 4KSEB 2YKMA 1JLBB 4ER8A 5HJXA 3GR0A 3Q86A 1F1BB 2GMLA 4WP8A 4DQSA 4KKOB 2POKA 3MF5A 4ZDNA 4MH8A 4NLSA 3BPSP 4JI0J 1X4DA 1K44A 4C3LA 2K7JA 4B3TJ 1KVIA 1H73A 2YWFA 4HKQA 2R7RA 3S1TA 2HPUA 4R0JA 2HVEA 4I2PB 1N0VC 5F3ZA 2BYCA 3C6TA 2HFZA 1OQ6A 1Q82T 4C8MA 4IR1A 2FD2A 1FRJA 3KK2B 1F6TA 2HAFA 4P7VA 2GO9A 1IKXA 3DRYA 5L9XA 3LP0B 4LF5F 3J80U 2FHJD 4WZQA 4FPIA 4DCPB 2FJDB 1VIXA 3CJ3A 1VBYA 3PX0A 4DWIA 2D9PA 3I31A 2UXDJ 3UCUP 1UJ5A 3JTNA 3G6XA 5ETTA 1T9TA 4C97A 4I56A 4IOBA 2C2RA 4YHHJ 2J0XA 2DXFA 3JSRA 1KDNA 5HQ8A 4DSLA 2IVMA 4CLSA 5GAEU 1SH3A 1Q78A 1YDLA 5D0EA 5DRKA 1RHQB 2FY1A 2OPRB 4LF4J 4FF3A 3UD4P 4PABA 4M8LA 3M8SA 2HQGA 5DGBA 3T5LA 1NB2A 3M8PB 2MQNA 2Z57B 3CCQS 4RR5A 2V94A 4GKJF 2PI4A 1KOHA 4O3QA 3KNAA 2LXIA 4ZPAA 5EX3A 2JEIA 3DRPB 2WAQD 1UJ6A 4ZCMA 2XZDB 1NK7A 1SIWB 1N5VA 3OVBA 2HFSA 4CYUA 2V9KA 2FTRA 4LSLB 1VHIA 1WDTA 3IR5B 3Q8QB 1YZ6A 4JI1J 2J9DA 4DFJA 2BANB 1WUUA 2CA9A 4QIVA 2XGPA 2V2ZA 5HLFA 4TLQA 3VTIA 1Q16B 4USMA 5CCLA 1I5OB 1Q8KA 4Y6IA 5E3AA 4M5NA 3K5NA 1JNRB 1Y0HA 4DMZA 1FA0A 4ZK7M 4DUYJ 2C2OB 2X1FA 4HI1A 3QLHA 3LPEA 1KSPA 1T03B 3R1HA 3WX8A 2OD6A 2DGXA 2G13A 4LQ9A 3SCKE 1R8BA 4IO9Q 3WC2A 2XYPB 1U1NA 2UU9J 1C1CB 3OTOJ 4CLFA 5IWAJ 1VOMA 3G6ES 3D1HA 5F8HA 1TK5A 2OAUA 5EX0A 3R5AA 2HNYB 2IJRA 2V8PA 1TKTA 2QMWA 1HARA 4LF9J 4UOGA 2HMIA 2BX6A 1V5VA 3HHLB 2F9DA 1S1TB 1C4CA 4L3NA 2N4DA 2MB0B 5ETSA 2FJWA 1WC1A 3QJJA 3D0IE 1YLXA 4M5IA 2LXFA 1RAIB 1I6JA 4DN0A 3AXMA 3J80Y 4L3KA 3DOKA 3J7YU 2CNOB 3DLHA 4AL6A 3C6UA 3L9ZA 1FD8A 3SQGA 2AWZA 2H3EB 3SEOA 4MIBA 3QMQA 4CH0S 1GEHA 2ZM6F 5J1NA 3GU0A 2DISA 1R27B 1M5HA 4OHWA 5ITHA 2EK6A 3OL7A 5IM0A 4PXCA 2HK3A 3ETMA 3MHYA 2CQ1A 2CZ9A 5H9EJ 4QBUA 1MMNA 3AQOA 2BJ9A 4WFZA 2OH2A 4DSEA 1ZPVA 5B0DA 1Y5IB 1SC6A 3PW5A 4MJKA 3KOAA 3MMCB 3I96A 1MROB 1BE4A 3QNWB 1S9EB 3HULA 2V2VA 5KFIA 4KFBA 2MKJA 1U02A 4FYXB 2HFNA 3KFWX 3LUYA 1BQMA 1R0AA 4A8KA 3VVTA 1NKEA 2VOOA 2WONA 2R7OA 3ZZZA 1XN9A 3OL8A 3JTOA 4UOFA 2KT5A 2JEJA 2MLZA 4X4SA 5LMUJ 5LXYA 1ZAVA 4J9KA 2DHSA 3DXBA 5AE3A 4NA2A 3D9BA 2DTJA 2FB0A 5DGAA 3B82A 2KG0A 4N77A 3PYEA 2O67A 2ERRA 2R7SA 3TAMA 4KY3A 2W2QP 3BN7A 2D7SA 2D1CA 2OPSB 1NH7A 4P74A 2ZWOA 2R2RA 1JXLA 4CDIA 4QYZK 1SKUB 3D6FB 5THWA 3EVOA 1SC4B 1WELA 3Q8RB 2DGTA 4J7CA 5IQ6A 2Y1IA 2JVRA 1KBRA 1GMWD 1S0NA 2YVSA 5HK4A 1RJJA 1S1XA 2J6TA 2MXYA 2F9JA 4GO7X 1SQGA 1N6QB 1DTQB 3KHGA 4OI3A 1K1SA 3W1YC 1TFYA 1S77D 2HGMA 1IR0A 2HW3A 4WTOB 2Q43A 2CPHA 2RT3A 3R7NB 4DFKA 2VJUA 2E1PA 3VAMA 3TZWA 5E41A 1AXQA 1WC6A 4RW6B 1L3KA 1O51A 4DUZF 3H5SA 3MTKA 3GIIA 3PY8A 4QR2A 2A2DA 4B9LA 3SCJE 3SV4A 3SZ2A 2OJ3A 2UXCJ 3NEKA 2JLGA 2XWXA 2WK4A 2DNRA 4JI8J 3OTEA 2FVQA 4QZVB 5D0GA 1EKRA 1HA1A 1F2GA 1QY7A 3PG9A 2E1MC 4YDXA 2J7KA 2Q3PA 2V5HG 1WOOA 1DTTA 1IN0A 2XI3A 4TNOA 4AFFA 2L41A 2XY6A 3N28A 2E29A 2CZ4A 2KN4A 3D1OA 1HNXJ 3BR8A 2V8VA 3Q2SC 1LWCA 3JSBA 3JQMA 1U49A 1FK9B 3BGLA 4N41A 2NXJA 2DNPA 2CYYA 4ETZA 3T1HF 2KDOA 4UQTA 4KJIA 2RILA 4I6WA 3GV5B 3ENQA 2FIUA 4NXNF 1CVJA 4Q43A 3EX7B 5KFRA 3E01B 3HVWA 2I1RA 3L7OA 4M5KA 4YDDB 1EAYC 3RR7A 4LT6A 3KK3B 2FPHX 2GHVC 4A8WA 3BBCA 3BO2A 4BWJA 1S7IA 4LSNA 2YH0A 5KFEA 2MQPA 1HNWJ 2YKNB 1EJ7L 5T7LB 1PYOB 4OHZA 3FEXB 1Z2LA 1S6OA 5D6GA 2QC3A 2PIIA 3PYDA 2QGFB 2BJ1A 3GFXA 1FWLA 1DY3A 3R6GB 2C22A 4YR0A 4NCGA 3K8VA 1XNRF 1RP5A 1VRQC 3HSDA 2HHHF 4DXLA 4DV2F 1U26A 2IM3A 1QE1A 2DO0A 1WHXA 1UFKA 2GVZB 5F8JA 2WVDA 4AXJA 1OSCA 2XC9A 5DLFA 2DCLA 4WIIA 4IG3B 3KLFB 4Y2IA 3WBZA 5C2CA 4I69A 2E9RX 3HHEA 2J9EA 3SDEA 1HHSA 5HMZA 2AQ4A 2RAQA 2CADA 1YHQS 5HQMA 3SI8A 1GK8A 4I2QB 2GAGC 5BYQA 1ZS6A 3A8JA 2LA6A 1XR5A 2BW2A 1TQLA 2WSCC 4M95A 1HWIA 4DV5F 2M52A 5LT5A 1VQSA 1HI1A 4NLTA 2XHCA 3JQKA 1WF0A 4L76A 3V81A 1NDCA 1MN7A 3NP5A 3QJLA 1GH8A 2R8GA 4N76A 4F4YA 4NCBA 1X31C 4ID5B 1X4AA 2ZC3A 3DRSA 2CJXB 3L4BC 3CCLS 4OHXA 1C1BA 2F65A 2RUSA 2R8HA 2FYXA 4JI2J 5IV3A 4BC7A 1UVIA 3IGVA 4DV6F 1BC6A 2ZJPQ 1L3TA 2GGPB 5C42A 1ELOA 3LO3A 2IIHA 3IM8A 1S0VA 2ASDA 1C0UB 1VQMS 2DJWA 2AYGA 4IH7A 3KJQB 2R7UA 1NJZA 4UY85 5IOLA 5HP1B 3A8KA 4O3NA 2R3VA 4DV0F 1Q53A 3AOCA 5C24A 3HI9A 2V8GA 2W2OP 1VQNS 5M2PA 4ZP7A 4NL5A 2HQFA 1RUSA 5CXTA 4LREA 4DV1J 2W9AA 2HNZB 1VC6A 1VRTB 1YRXA 2P2CB 4NZ0A 3V6HA 2NPIA 1R3NA 5MLCV 5E0OA 4OZ0A 1UVLA 2L9WA 2RIJA 1SKWA 2XMWA 3GJRB 2ATLA 1WG1A 4UY8T 2AJ2A 4Q0BB 3KHRA 2EK1A 3U27A 1S1UB 3QT7A 3W5YA 1SJ4P 4EZ6A 1NPPA 2ZHAA 2CPJA 2B9YA 3O2IA 3T5HA 1BD6A 2DGVA 5HATA 3MEGB 1X8DA 3BM7A 4LF8F 2RQMA 1FNMA 4DL6A 3O3LA 5KFJA 4EMDA 1S12A 4C0OC 2PEBA 2EI5A 3DLBA 5JVGQ 3DLGB 1VFJA 4WK1A 2HVZA 1SPBP 2VHGA 4YQWA 2KG1A 1WKJA 4YY3J 4DV4F 1ZYQA 2EC2A 3B6BA 3OL9A 2A0FB 2U2FA 1FX2A 3A4TA 2GMJA 4RUAA 1BHNA 2ZH2A 2EPIA 1PYTA 1Y3KA 4RJVA 1FE4A 1RYRA 2DNOA 3C14B 3ELHA 1WC3A 3LAKA 3PZPA 1BWEA 5KFYA 4OYWA 1SL1A 4BS2A 2MGZB 3UDEA 4CIOA 2CPEA 4LRBA 2HNDA 4YB5A 4ECQA 2F1FA 2DKOB 2XO6A 5KAKA 1EP4A 2FGOA 4DS5A 3DM2A 2RHSB 2BVZA 3LF0A 4CLWA 5F8LA 1QSLA 3I0SA 3RBDA 2CJKA 4WE1A 3U1MA 4XO0A 1KTQA 1GTHA 4A8SA 4KYZA 2KL8A 5EGYA 1TR0A 5HQLA 3PX6A 5AJ3F 2VL1A 3MM5A 5CQGA 4ZCLA 4MK7A 2UV8G 2RU9A 5KT4A 3M8QB 3J7YI 3L09A 4C3KA 1MMDA 4KO0B 3R5BA 5CA5A 4DR2J 1RAHB 3KDOA 2EXUA 3G8TA 5KG0A 2IC3A 4PUOA 5HROA 3M30B 3UQSA 1YITS 4M5HA 4DHVA 1HYSA 2CVIA 3WDOA 1JNZB 3LAMA 3PRDA 4ES2A 2QLWA 5ETQA 2RDJA 1TZ0A 1PILA 1XR6A 1JJ4A 3CC4S 4LJMA 1RWVB 1TL7A 3NGKA 5I3UB 3G71S 4NMLA 4C0BA 4M1KA 4HTIA 3MR3A 3M2VB 3EMTA 4PG4A 2EG2A 3PW2A 3SFGA 4ZJOA 1PAEX 2XLKA 3D28A 4TYAA 3EVWA 2IM2A 2LP4A 3MAAB 4OZ1A 4RW7A 2K3IA 1LOUA 4DLGA 1KHWA 2NYIA 3RRGA 2A6OA 2CPZA 1TAUA 3OXFA 2Y0SD 3DDNA 2RSQA 2WVCA 1L3SA 4P73A 3F0NA 4LF6F 3CPWR 1M5PC 1N33F 3RRHA 4M94A 2NYHA 4NYZA 1T3NA 3CE8A 4H4KA 2EFOA 1HBUA 2Q79A 3SBMA 5F8NA 4IRDA 3IR6B 2PO4A 3MM7A 1HFEL 2WVFA 4R8UA 3CT9A 4RUHA 2YKMB 1S1WB 1Y4ZB 4P52A 2ABYA 4ZIWA 1F9EB 4OYBA 4JI5F 2ACYA 4OZ5A 2VH7A 1D3WA 3ET6B 4K2JA 1KFDA 5KG3A 3PXGa 3EDQB 4ZPWR 3N79A 3CB4A 4LFBJ 2R42A 3SXLA 1WHWA 2X7IA 3C6TB 3WIVA 3OQ2A 1NK0A 4K8RA 1VBZA 4P9SA 2IHR1 1N34J 3GJQB 1TP7A 1CJUA 2ILYA 3NLCA 2JWNA 2KYZA 3GLJA 2A10A 2ZBQA 3TRGA 1UAWA 4JV0A 5A2QY 2KZMA 1M1KT 1WDDA 2M70A 4QR0A 3LP1A 3PW0A 2Z8QA 1SVDA 1N48A 1BWVA 3ZZ0A 2RNEA 1WG5A 2W9BB 1K8AT 1NJXA 2CJBA 1TK0A 2L08A 3AD9C 3QGPA 4CH7A 4ZJQA 1K0VA 2VFSA 1OWXA 1D1UA 1FRKA 2ROEA 1LKZA 4AQYJ 4LBHA 1N5QA 2A3JA 3OR1A 1S7HA 5GMDA 4IKAA 5CYQB 2XTJP 2HRUA 3LH2S 1SV5A 2YKPA 1IBMJ 3QAUA 2GNKA 1QTMA 4AL5A 1DJ0A 2IYIA 4CLKA 4NPOA 5KG2A 1AB8A 2GX8A 3E2EA 1FVSA 5K20B 1IVZA 2B9XA 3ENVA 2C2NA 3QIPA 2OTJS 4F04B 2RF2A 4F0HA 4B3MF 4USUA 2PFFB 3VAJA 2RS2A 2UUCF 2Y1JA 2ZH8A 2W7PA 4CYUB 1P8GA 2MY7A 4FDFA 1JLGA 1UVKA 3BQ2A 4O0IA 2LVWA 2GHWA 1NDLA 3D2WA 1JJ2R 4Y2AA 3JAMY 5HLFB 4ZJLA 4WFNQ 4ITSA 2OEJA 1FDDA 4BHQA 3FZBA 3CCRS 2E1AA 4J9LA 2WOMA 4YOEA 1VLOA 2UUBJ 3CUNA 4USJC 3A8IA 3TQEA 2XSJB 1RT2B 4FZVA 1UVJA 3MFHA 4RNMA 2YNFA 4JYAF 3ILLA 2YQ1A 3CXCR 4O0NA 4WBFA 3R7SB 4ZA1A 1NSPA 1MSWD 3RR8A 1AW0A 2RE1A 3WHIA 3TARA 4YB1P 2HVDA 5CYJA 3KHHA 1RBAA 1SI9A 2FLLA 2JX2A 1HNIB 1ZETA 2QFIA 2GO8A 1TKTB 3A1YG 4QOTA 1PC4A 2KM8C 2KVIA 2HMIB 3WC0A 3R5JB 4C4WA 5CD4H 3OR2A 1Y11A 3CIMA 1HNZF 4DJBA 3AJ1A 3R5CA 4I64A 5D0HA 4J9OA 4ZP9A 3T6JA 5EDWA 1QLNA 3RU0A 1LWFB 2A2CA 1I51B 3OJSA 2A6MA 2HZVA 1I3OB 3M9MB 3FRZA 1RKIA 5L8RC 2HSEB 1HD0A 2BDPA 1HPZB 4U7UK 2EBEA 2HG4A 3SSRA 1C4AA 4HR2A 4M5LA 3IA0A 3JXOA 4ZVEA 2K7KA 1VQ5S 4OFZA 2JEGA 4RNNA 2VG5A 4USVA 4DN9A 5DG7A 3IRWP 4B3RF 5ETMA 4DL3A 3MM8A 3I87A 2DBBA 2H51B 3MEEA 3MAHA 4ECYA 2XSFA 4P2FA 4FXDA 3AHPA 1N54B 3QGIA 2Z2YB 3R2DJ 5IT4A 1LWEA 1U1OA 5GMKa 3V6DA 2FHKA 1UWBB 2UZAA 1UZDA 4BCAA 1BQMB 4NLRA 2PE8A 5B0EA 4TU7A 1HWKA 2VD3A 1Q5YA 4FBUA 2FZCB 3I0RA 2WONB 1ZPWX 5BJRA 1JXEA 5ETOA 4A46A 2F63A 1JLBA 1YGYA 3OTBA 1VQ8S 3PO5A 2BM1A 1H74A 4K0KF 2ZDPA 3IBFB 4BWMA 3ILIA 3UVJA 5A8KA 4KKOA 5B08A 1KVJA 5HN0A 5FLXY 2AHOB 3K58A 4JI0F 4E8UA 2QMUB 1IBKJ 2VASA 2LXUA 3TAMB 4WXWA 3SYZA 2ZH4A 3KLGA 2R8IA 3DC2A 3BR9A 4ZVRB 3JYTA 2YNIB 1FTCA 2QL7B 4YR3A 2AGQA 3VGSA 1SQFA 2B51A 5HVHA 4I2PA 2X1BA 3KJFB 4RBUA 1K1QA 4YFUA 2H4WB 3POTA 4XPEA 2XMUA 3PNIA 5KFKA 2YX4A 3PEJA 4Z37A 3CCMS 3KK2A 2NS1B 1EB0A 5K14B 4Y2KA 2OFGX 3ILJA 5CHCB 4AXIA 3LP0A 2V8DA 2XS7A 1HHQA 1S48A 2EKNA 1VQOS 3GE9A 1S6PB 2DHGA 5GADU 2QLFB 3IM9A 4CLPA 4F25A 1H38A 1A7GE 1S6UA 1CLFA 5B0AA 4KAIA 2UXDF 1RCXB 4NLUA 3Q8VA 2ZZNA 4ZPDA 2D3ZA 2PN6A 1L3VA 3RB6A 3LANA 1KQSR 3G8QA 5D78A 1EHWA 1G2EA 5KT3A 4YHHF 2Y0BB 3PM9A 1X4HA 4X4NA 3QRPA 2EFNA 3W2VA 3L95X 2V69A 2OPRA 2VKZG 4I68A 4LF4F 1PGZA 3TI0A 1FWPA 4DR5J 4A47A 1DHMA 4OI6A 5KT2A 4C0HA 3N5BA 5AXLA 2HS4A 1A9NB 4P71A 4LF7J 2HS0A 3ITHB 2R2TA 1UFLA 4JUZA 4USHA 4C98A 2I38A 1FJEB 1J5EF 3HT3A 1D8YA 1U6FA 2OKQA 3FFIA 3NAIA 2J9CA 1NPRA 2XULA 4DBQA 3D3CJ 3NWGA 2LYVA 2XNQA 3N4WA 2UVWA 3TVKA 2D3OR 3HP6A 3DLEB 2DNHA 1N5YB 2MSSA 4ZPBA 1IWGA 1XMOJ 2R2SA 2W8LA 2CPFA 4DR7J 5CCMA 4B9SA 5CZVA 2BANA 3D4JA 1XNQF 2KT3A 1UWAA 1X5PA 5L9NA 3JSYA 1SKRA 3GMGA 1N5TA 2LMIA 3FBFA 2M2BA 3OD2A 2NPFA 1EETB 2GS8A 3MGJA 1Q0NA 4Q8FA 3M2RA 4LSNB 3UR3C 4ANCA 2BKOA 3QT5A 5KFVA 1T03A 4JI6F 3FSIA 3EGVA 3FKBA 4A8OA 4F67A 3RG6A 4NRTA 4O4GA 1E6YB 1ZZFA 1C1CA 2UU9F 1SJ1A 3SCLE 4NCGB 3TX8A 3TEGA 1WF1A 2OSQA 4EZ9A 4RL1A 1VJWA 1CJKA 2HHUA 2QL9B 5B09A 3MZIA 3BSNA 5KG5A 3MUTP 9RUBA 3SDEB 1WHYA 4JI4J 2CUYA 1FESA 1YVFA 3OHAA 4CLLA 4FF2A 4LFCF 3QWUA 3PDNA 2B5JA 2XCAA 4DR4J 3FEZA 4EBDA 3L7UA 4K4SA 3GIKA 1U1MA 2HAIA 3HPOA 1DFDA 5KFCA 3J7A1 4KGVB 4KB7A 3CW2C 2QFJA 3G4SS 2R7WA 5L46A 2L9DA 2HBQB 1AFJA 1PO6A 4OZJA 2IA0A 3D6TB 1NZAA 2ZH9A 1HBOB 4DPXA 1U09A 1Y9OA 4Y00A 3V81B 2BRLA 1KR4A 2AV5A 2BUNA 3BDPA 2OLWA 2R7QA 1B0TA 2V6AA 1PAUB 3HVAA 3BZQA 1PIEA 1GMVA 1X0PA 3DNCA 2DIVA 1WHVA 4QPXA 4ES3A 3PVXA 1H7XA 5GAGI 3MMCA 4X64F 1MROA 3FNNA 3TVZA 4K4XA 2XB2D 2F4VF 4DQQA 1UCNA 4J9RA 3I5CA 2V4RA
chains in the Genus database with same CATH topology
2EFGA 1VQPS 3DLHA 3PW4A 3ZZRA 4QWBA 5C42B 4AL6A 2YNHA 3AA8A 1CG2A 3KG1A 3GV8B 3C6UA 2HWTA 3O1LA 3MECA 3V4IA 1FD8A 1Q1KA 4ZS6A 3SQGA 2AWZA 3SEOA 4MIBA 4CTAA 3M1VB 3QMQA 1RA6A 4K50A 4YY3F 2LCWA 4CH0S 2AGPA 3MUVP 1PC5A 4OJ3A 2ZM6F 1T7PA 1UMJA 1BQNB 4MMOA 5J1NA 3HO1A 1FJCA 1RDRA 4R5PA 2ASJA 3U1LA 2DISA 3S01A 5KOXA 1R27B 4NLDA 1TL1A 3IS9B 1M5HA 2MMYA 2QIFA 3I4HX 4OHWA 5ITHA 1RT1B 5KT5A 2CJ9A 2EK6A 1FKPB 1KLNA 5KFTA 3OL7A 3BSCA 2ROGA 2OIHA 3QO9A 5IM0A 3NNAA 4PXCA 2JDJA 3MHYA 4KV8A 1YI2S 4F3OA 1N36F 2N3LA 2CQ1A 4KQZA 2XMTA 5T41A 1WWHA 4B3OA 3CDBA 2BRKA 4QBUA 5H9EJ 2ILZA 2DNKA 4IRCA 4CQ1A 2AJQA 1ZM9A 4UUXA 2J6UA 5C24B 1MMNA 2YWEA 3C2PA 3QZ8A 3AQOA 5BYSA 2HHQA 2UVVA 4CT8A 1S1VA 4WFZA 3CJ5A 3AAWB 3DGPA 4DSEA 1NKCA 2OH2A 1ZPVA 5B0DA 1M90T 1Y5IB 1SC6A 3PW5A 1YJUA 5KFLA 4MJKA 3KOAA 2KT2A 1LXJA 3MMCB 4MTPA 4MFBA 3I96A 5AXKA 1MROB 3R27A 5BYRA 3W2WB 3IAS9 2DVIA 5EN1A 1S9EB 2MYFA 2DGQA 1Q8IA 3A8EA 3MXHP 4X4QA 4I7FA 2E7XA 5KFIA 2VQEF 2HVIA 1IM4A 3DOKB 4CO1A 1P27B 2GQ2A 5DDPC 4KFBA 2MKJA 2VPZB 3OL6A 4ATNA 1RTJA 3D0GE 4RLEA 4I6YA 4B02A 2YNHB 2FC9A 2D74B 3C6UB 2OPSA 4NZ7A 2HFNA 3MECB 3KFWX 4ED2A 2DR8A 1RI7A 3SQGB 3UDCA 3CJKA 4CTAB 4QWEA 2DRAA 3LUYA 5BR8F 2GQQA 2XEXA 4QIEA 1BQMA 1R0AA 1RT4B 5D3GB 3I82A 4A8KA 2NLWA 2ZBCA 3CWJA 3H2UB 1WTFA 1FJ7A 2DHAA 3EZUA 3H2LA 3RW6A 2UVUA 2LEAA 1TL1B 1Q7LB 1NKEA 2VOOA 2WONA 2GHPA 3N5FA 1ZTWA 2UUWA 2R7OA 3QO9B 1XN9A 3AA9A 4RWXA 3ZZZA 5IM0B 2ZKTA 2QO3A 4A8XA 3OL8A 3C8YA 3ZZUA 1S79A 2XO7A 3MAQA 3JTOA 1RKJA 1K9MT 2A18A 5L39A 3OSNA 4FYDA 1T3OA 2KT5A 2JEJA 3NNHA 1JLEB 2GIRA 2U1AA 4EO6A 1SKSA 4H4KC 4X4SA 4OI1A 5LXYA 5IQQA 1DTQA 1ZAVA 1LQ9A 2C42A 3CDEA 4J9KA 2DHSA 2X51A 3DXBA 3QJPA 5AE3A 1T05A 4NA2A 4U67Q 2DTJA 1YRTA 2BM0A 2FB0A 4CO4A 4IG0A 1NO8A 1Z4UA 5DGAA 3B82A 4MFBB 2KG0A 4N77A 5F41A 1TFWA 1IUJA 3M6XA 2QA1A 4DR2F 5AE2A 2O67A 2B3TB