1CS4A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE V ADENYLATE CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4A00
3C16B 1CJTB 1Y11A 4CLLA 4OYXA 4P2XA 3MAAA 4OYZA 3MR7A 1TL7A 1CULA 1WC1A 4OYAA 4CLWA 3C14B 1CJVA 4OYBA 4OYIA 4OZ3A 5D0EA 4USTA 3ET6B 1U0HA 4CM0A 1CJKA 3G82A 4USWA 4CLPA 1AZSB 5D0GA 4OYPA 4CLFA 2WZ1A 4P2FA 1YBTA 1WC5A 2GVZA 1CS4B 4CLZA 1CJUB 1TL7B 1WC0A 1WC6A 1CJVB 1FX4A 2QV6A 4CLSA 3R5GA 1FX2A 2GVDB 4CLTA 3C15B 1CJKB 2W01A 4NI2B 4OZ2A 5D0RA 1AB8A 4OYMA 3C16A 1YK9A 1CJTA 3UVJB 4USUA 4CLYA 4WP8A 3MAAB 4WPAA 1CULB 3C14A 5D15A 4OYOA 3ET6A 1U0HB 1AZSA 3G82B 4OYWA 1Y10A 1WC4A 5IV3A 1CS4A 2GVZB 5D0HA 1CJUA 2BW7A 4CLUA 5IV4A 4CM2A 4WP9A 2GVDA 3C15A 4NI2A 4USVA 1WC3A 4CLKA 4P2MA 4WP3A 1YBUA 3UVJA
chains in the Genus database with same CATH superfamily
2BVZA 9ATCB 2CVIA 4YQWA 2OELA 4P74A 3POTA 3NNCA 4JP8A 4X4RA 4CWBA 2WSCC 1PG5B 2IRXA 4URSA 1CJKA 1UMJA 3ISND 5KFRA 4QCLA 5D0GA 3TJ8A 1JXLA 3NCPA 5KFQA 4I7FA 1YJUA 2CVEA 3DCAA 1RGVA 2J76E 4F0MA 2E5LF 3DLGB 4DEZA 1AT1B 3VAJA 5KFTA 3R7SB 2ASYA 4DS5A 3M2UB 1URNA 2ZHAA 2H4YB 3LP0A 3H4DA 5KTQA 1HI0P 1XR7A 4ZJOA 2YNFA 3SFGA 1HNWJ 2CQCA 2RQKA 4ZPBA 3PJWA 5ETRA 3GFXA 4Q8FA 4DR7F 4NXMF 3BKTA 3PW4A 1U0HB 4ECZA 2ASDA 4HVZA 4NCGB 5ETLA 1PYSB 3UN5A 6FD1A 3LPEA 3MMJA 1DZ5A 3C6UB 3MUMP 3DOMA 4CYUA 3TQ1A 4X4UA 2H9ZA 4DUYF 2HFSA 3T1YJ 5HP1A 4LF1A 3ZTRA 5LOQA 5K8MA 2IAJA 3OTOF 5I42A 4FPRA 1RT2A 3ZTSA 2QTWA 4ZVOB 4KR0B 2W24A 3IN5A 2ASLA 5DM7Q 3PM9A 3PXGa 3BYPA 4M63A 3CCWA 4JUZA 3D6MB 5DO2A 4ZVSB 1UCNA 1LW0A 1CS4B 4YY3J 1W2BR 2L9WA 3POTB 2DR5A 2PFFB 1CJKB 4NMLA 4B3SJ 2BANA 4DQIA 5BXIA 1AB8A 4DSIA 3UR3C 5IT9Y 2ZH3A 4OJGA 4I7FB 3HSZA 5DZ6A 3CMQA 4TY9A 3QAEA 2IVYA 4KV8A 3MOZA 1JK9B 2YNFB 5DQIA 2PMWA 3I6PA 1PYTA 4HDHA 2CNOB 4DU8A 4ZMMA 4X65J 3TARA 2C2DA 1U45A 1G6BA 2KM8B 3T9NA 1S7HA 2RQMA 2PEBA 3JSYA 2UXDF 1WC3A 3MMAB 5EN1A 3RB0A 3J80U 4ZP8A 1HNVA 5KG7A 4JI8F 3L7OA 4UZBA 3PJ9A 2HRYA 4FPIA 1WC1A 1HNXF 2HQGA 1FERA 4OYIA 3RBXA 1M5HA 5F8LA 3S6EA 3VCDA 3L9ZA 1FA0A 3S7RA 3R6LB 1RT2B 1IVZA 3EDQB 3JAMU 4JI6J 2JH3A 1V5IB 3P8BB 3K89A 1RT5A 2FLOA 1HFEL 4NRTA 4M5MA 2AZ1A 1IQZA 5D0RA 5GMKa 4WKRA 3MCOA 4AQYJ 2XMMA 2E1AA 1GXLA 4NLRA 5DDQC 3IAM9 5F3TA 1IKWA 1JKHA 2CQ2A 3L7PA 2M88A 4QYRA 3CJSA 4M8LA 3TZYA 4C97A 2HHTA 2BANB 8RUCA 5E41A 1IJEB 2YY3A 5C25B 3S01A 3DGPA 1VGYA 2JEIA 3V6DB 1SV5A 1S1WA 4HDGA 3FSYA 4K8RA 4BHQA 4TU9A 1Q8BA 1MN9A 1S9FA 4JYAJ 3QPIA 3CJ2A 2FC9A 1SBRA 3GIIA 4Y2AA 3CJKA 3WHIA 2BE2A 2VZ9A 3LWMA 4ZS6A 1ZS6A 2I0XA 1H3DA 5FDLA 4UY8T 1IBLF 2CZVC 3GR0A 1VFJA 4IRDA 2D41A 4Y65A 2WONB 1HBOB 2ZH5A 4ECWA 1P6TA 5GADI 4NLTA 1N5TA 3IG1A 2ZWOA 5JXSA 1VR6A 2AJ2A 3ENAA 1U4BA 3AB4B 1SJRA 3MMBB 2MZTA 3EZUA 5G0RA 2YBVA 4J90A 4WYWA 4ZCMA 1Q5YA 4DFMA 1KSPA 5I3PA 1K73T 1Y10A 4EZ6A 1IBKJ 3PO4A 1UPPA 1B7YB 4KGVB 2WOMA 4H4OB 2C2MB 4K5RA 1H2UX 2DGOA 4FVMA 1JKHB 1RA7A 3HD1A 3HDSA 4LBPA 3GLJA 1U24A 2HZVA 2K3IA 1D1UA 1YJRA 4WZMA 2CG4A 3IGNA 3C16B 4NWBA 1TMMA 3NLCA 4LF2A 3HHNB 3IS9A 2HHPA 4RW9B 4GKJJ 3AQOA 3I4HX 1SV5B 1S1WB 1UWAA 5KFLA 4TKTA 2VQFJ 2FJWA 5F9LA 5DRKA 4K4XA 2Z30B 3KFWX 1S77D 2HPUA 1CJUB 4QOTA 1QAYA 4YHHF 4B9TA 1RAJA 2IHR1 4DMZA 3OSPA 3CJKB 1RT3B 4U95A 1O0PA 4FF3A 4CZCA 4DQRA 4GKKF 3CIMA 4EUVA 5A76A 2E9TA 2VFUA 5EX0A 1RUSA 1DQ8A 4LF9F 3MEDA 1XMOF 3SQOP 5LJ3Y 4QWDA 5DLGA 2DIUA 1UFWA 3GCWP 5D0HA 2G9OA 1X9SA 1PCAA 3TZWA 4DV0J 1WOPA 4B3OA 4ZITA 1N4LA 4ER8A 2MGZB 4U8VA 3PNIA 1NK9A 4MKVA 4C0OC 2WOMB 2X1GA 2ZDOA 3KK3A 4PG6A 2OJ3A 1JLQA 3LW5C 2E5JA 5AE3A 2N3LA 5D0EA 4YB7A 3FCHA 5J2NA 4TYBA 4KFBA 2B4VA 2VB6A 3EGZA 5HAOA 3FK4A 4NL5A 2MKJA 4JI4F 1RP5A 2DHSA 2OO4A 3IS9B 4RBTA 3FQKA 4RL1A 3SDEA 2C28A 3CDAA 4BWJA 1YWXA 4YMEA 4LFAF 4JI3F 2XS5A 4LFCJ 3DDNA 3G2XA 3UDLA 1Y00A 3RUBL 3Q8YA 3GIJA 1PKUA 4ZJQA 1GXTA 1DRZA 3MM5B 3LP1B 3G8SA 2XMKA 3R7BB 1RAIB 3MF5A 4TYAA 1TKDA 6AT1B 3O44A 2BQRA 1X4DA 1RZMA 3DLJA 3HT3A 1W26A 4WE1A 2V8GA 3EWGA 2VG5B 4PWUA 1UKUA 2VFVA 3MEKA 1T95A 1IKVA 4OV1A 3S8SA 1FO1A 2D9OA 1S72S 5D78A 3CO0P 4B17A 4HHHA 1YTYA 1RT6B 1IKYA 2GO9A 1LXNA 2XZDB 4K0KJ 3N5FA 1YBAA 4EBDA 2WB1D 3I9V9 2CIMA 4PUOB 3M30B 4M5NA 1NJXA 2YVSA 5H9EK 2BV3A 2JRSA 3DM2A 4JOUA 4Y2CA 3LP2A 2ZITA 1X0FA 2HHSA 4UUWA 4YDXA 4PAAA 1OYDA 2W4DA 3UCGA 5J2NB 1IBMJ 3HSJA 4Q0BA 3AOAA 2A18A 4DQPA 3HT0A 4FS1A 1RTHA 1VC5A 3LAMA 3RYLA 2KHDA 3U7JA 4ECYA 3SSSA 1S6UA 4ZN1A 5GAGU 3VVUA 1N33F 1KS2A 2NPFA 2LU2A 2D3OR 3MCMA 4UOGA 1KBRA 3E51A 1N36F 3QGGA 1SL2A 3RR7A 3NGRA 4AXIA 3ENWA 4CM2A 5C2CA 2FD2A 1N32J 3C15A 2IIHA 3FBCA 4UUXA 4YB1P 1GQEA 2XO6A 3FKBA 3MFHA 5LL6d 1KQSR 2R2TA 1K8AT 1VIOA 4WE1B 4KRWA 4ZOSA 3QBCA 2MLZA 1FVSA 1T05B 1IKVB 3HO1A 2OFHX 2WCXA 4ZLLA 1I5OB 1IKYB 3Q8PB 3SCIE 2OEJA 3RBEA 2HHUA 2WSFC 4JI2J 5FIIA 3OR2A 1H73A 1XN9A 3HFKA 2OPQA 3LP2B 2UUTA 4K2XA 5L46A 2ZZTA 1U09A 2HZCA 5CHCB 4OQJA 5KT3A 2KN4A 1FI4A 1HMVB 4Q0BB 1S97A 3HP6A 1VISA 4OX9J 2AV5A 2D3ZA 4LVOP 2FB0A 2W4PA 2HGLA 2VKZG 2BW2A 1RTHB 3BGRA 1DTQA 3JSMB 5I3UB 5HATA 1R7IA 2HBQB 4OL8A 3CD6S 2EW9A 2AGOA 5ETTA 3G6YA 2VPXB 4ID8A 1EKRA 4J9PA 1SUQB 5MAOA 2NSCA 1B0VA 5B0DA 2JLEA 2Y8YA 4DV4F 3WIVA 4ES1A 1YBTA 2HBZB 2EK6A 1FFGB 2ZH1A 1JLGA 4DPOA 1QSLA 3A8IA 3GG0A 1UZHA 2B4PA 2W01A 3KMSA 2B9XA 5JVHQ 3W5XA 2MHNA 2R7UA 1B4SA 2V68A 3BGLA 3PVXA 4BC7A 2K8GA 1SC6A 3Q24A 4GC6A 5LXRA 4C3MA 4FZVA 3H2LA 3I0RA 4A8XA 2V94A 4QWBA 3TX8A 4Y28C 4NZ6A 4A47A 3GV8B 3OUYB 2VJVA 4CTAB 5D4LA 2FHMA 4OIXA 1I1GA 2RMLA 1VC6A 3SI8A 3SCKE 5BR8F 5B0CA 1M90T 4AFFA 3ILIA 3DOLB 1YI2S 2A6MA 4ECQA 1AFJA 4URGA 3GR1A 3NS6A 4ZVQB 4IG3A 1DTQB 3BGUA 2QRRA 4DCPB 2YNHB 3OL7A 2K06A 4C8NA 1WC5A 2XTJP 1WKJA 3DLEB 1XNQJ 5EDWA 4A8FA 1X8DA 2W2QP 1SKUB 3D0GE 2C3YA 2VJUA 3MMCB 4RNMA 3CWJA 1WEZA 2J0XA 4OHYA 1EX8A 5J2QA 2EVZA 1Q78A 3A4TA 3PIPQ 4WTYA 3CUNA 3D0HE 1FEEA 4B08A 4ZVRB 1V3RA 2C2KB 3VGVA 5JJBA 4NA1A 1MW7A 1FRIA 2H51B 1S1UA 3PEHA 3F73A 1XK8A 2CWKA 1S6PA 5ETQA 1YVFA 4DPUA 2ZH9A 4RU9A 1RISA 5CYQA 1ZPVA 2ZDPA 4EBEA 2AIRB 3MEEA 4CLKA 5E3CA 3Q22A 1LWEB 2YQ1A 3N79A 3RRKA 2EG2A 4LSLB 4USKA 2IC3B 1U8SA 2KM8C 1BC6A 5A8RB 4CLWA 4K7QA 4DL0C 1LFWA 4QBUA 4V1Ak 1RWKB 4ED3A 2WHOA 5K14B 2WK4A 1QJHA 1BQNA 3R5JB 3QJPA 4Z37A 2WZ1A 4ECRA 3G8QA 1YRTA 1S9EA 1OY6A 1S76D 1QAIA 3GQCA 2LP4A 1RE1B 1NDKA 2B8QA 4RBVA 4E0DA 3BR9A 4X66J 2HVEA 3I5CA 3KJVA 1HNZF 3BZQA 3CW2C 2B7CB 1YJVA 2I6WA 2CPFA 4MTPA 2OUGA 1N34J 2Q66A 5KT6A 1BMQB 2Z8QA 1GMWD 1S1VB 3IWLA 2IBOA 4U8YA 4DCOB 2UVVA 2GJ2A 2QFIA 4DR4F 1U49A 3C19A 1HARA 4DUZF 3OR1A 1NJIT 5J2QB 2F4VF 1HLWA 1I94J 1ZM4A 4O3OA 1SQFA 2VBZA 2R7XA 2B43A 4ILLA 3K8WA 1TUWA 4B9NA 1D3WA 5ADZA 3C46A 4ZP7A 2L41A 3J7YU 1MWZA 1F5BA 3VV2B 2RD5C 4P52A 2FVSA 1XR6A 3M6UA 2E5IA 4MT1A 4I68A 2JEGA 3MEEB 1S59A 5DDOC 3MM8A 1N5YB 4EFAC 1KDNA 3RAXA 4OI0A 3N6MA 4O4GA 3EGNA 4MK9A 3BF4A 3MAQA 4XPCA 1BQNB 4ZK7M 1KTQA 4TY8A 3KHRA 2QLXA 2G0IA 4CP5A 4YFUA 4LFBF 3OBIA 1UEVA 2WW8A 2XQCA 4M5LA 2NZ4A 1FWPA 3KJVB 3L4BC 2ILYA 1R89A 2QYGA 1XNRJ 5CZXA 3SBMA 3W7BA 1RBAA 4DSKA 2XLKA 2YWFA 3CE8A 2MSTA 1AFIA 2GIRA 4IH6A 3R5DA 4DR5J 1XMQJ 2G2ZA 2DNMA 3CDUA 3C14B 4FNHA 2VASA 2BX6A 4IRCA 3DYAA 1CQNA 5KFKA 4USWA 3W61A 3B6BA 2KI2A 1M5KC 1TELA 4PXEA 4S0MA 3MTJA 3TO8A 1HWJA 3VAFA 3GZ7A 2XGQA 1PAUB 1X7VA 2PMHA 4KGXB 4BWMA 3TANA 3NS7B 4YP3A 3IP0A 5KFAA 2XY5A 2RKIB 3NCRA 2QFJA 4ECTA 1N48A 2OMLA 3W62A 3TRGA 1E6YA 1CVJA 1OPIA 4O4GB 4ED4A 1NSKL 2X3DA 3NGUA 3H40A 5HROA 4J37A 3QFWA 4JI0F 4OI6A 4TY8B 4KKOA 2LQBA 2BE7D 2CNLB 2AX1A 3L09A 3MAHA 4OZ1A 3U27A 4PYAA 4KO0B 4OYXA 4NYOA 2W2NP 1MLAA 3T1HJ 4LRDA 4HEA9 3FVYA 2MZJA 2YH1A 1LK5A 3GFHA 1KC8T 2IM1A 2RSQA 2DNZA 3MXHP 4F50A 2VA3A 4AL5A 7AT1B 1UJ6A 3E01A 1ZYQA 4A4JA 1FX4A 2QV6A 3HVRA 2ROEA 3SFUA 4RU2A 2BA9A 3M32A 4M5DB 4CNYA 1F6TA 1S49A 1TU0B 2DB1A 4LJMA 2EFOA 4G65A 1X4GA 1K0VA 2YQ3A 2A6OA 3GSIA 1OY9A 1IXKA 2VD3A 1R43A 3FQLA 3I87A 2GJIA 4C7QA 3H5UA 1BQXA 2BYCA 3QRPA 3NOCA 2OAUA 2Q43A 3Q23A 1T9YA 5AE2A 2KXHA 1ZM3A 2AP6A 4U67Q 3BSOA 2AX0A 3EXYA 2BKNA 4E2FB 2LLZA 3QGHA 3TUZC 4A8KA 2ZH7A 1CQMA 4I64A 3RZAA 2DR8A 1M1KT 2GHPA 3MCNA 2EK1A 4ZPDA 2RILA 2KVQE 2AU0A 3B4MA 2KJVA 1U48A 4F2RA 4RUBA 4UZCA 1C4CA 3QATA 4Y2IA 1N52B 2CJYB 3M2VA 4AYBD 5HSPA 1APSA 4L75A 4ES2A 1ZM9A 2DGUA 1PGZA 4TU8A 4DL4A 2QZ8A 3GIRA 1WDTA 4NLYA 3FZBA 2XO7A 1WF1A 2ZBPA 2H54B 1TL4A 1WI8A 4WU2A 2VV5A 2H4WB 4LF5J 3JB9k 2O5DA 1VQLS 2EG1A 4CO2A 3P4UB 1LNQA 1VHFA 2HKEA 3H59A 2JHEA 5JMNA 5IQ6A 3FUYA 1U02A 2AKWB 3SQGA 3CCZA 5J2PB 5A8WA 5L9XA 4QR0A 3QIPA 2QEXS 4MMOA 1Y0HA 3HHLD 4OHXA 2LKZA 2LQ8A 1ICEB 5DDRC 4OYPA 2XY6A 4IQMA 1MMNA 1WG1A 1NPKA 4RW4A 2E5LJ 1Q95G 3DRSA 1IR0A 4K50A 8ATCB 2GVDB 1EP4B 2ZHOA 3A13A 2V9KA 2OGUA 2KRBA 2VOOA 4FP9A 3AOCA 1SH2A 4RUAA 1PIEA 4L72B 2AEJA 3NMAA 5KFFA 3GJQB 1RTIA 4DR7J 2DYAA 4NXMJ 2M8HA 1SPBP 4KH0B 1NK0A 2DY9A 2CA9A 3R7NB 2MZ1A 4PPDA 2R3VA 3Q2SC 2RQCA 1HWUA 2FDNA 2NPIA 3N6LA 1L3TA 4UW2A 2VQEF 1FJEB 1AUDA 4Y2KA 4DUYJ 1MN7A 2HG4A 3KKFA 3DXSX 2HEKA 2ERRA 5B09A 2FLNA 3EUNA 2VL1A 3ZZOA 1NKBA 3OTOJ 2D1CA 1QLNA 2CADA 4AD6A 3WZ0A 4OYZA 4H4MA 5KG3A 1KVJA 4CM0A 2MKIA 2DGVA 1R8HA 1UETA 5KG5A 4Y3CA 3SQGB 3CF5Q 5A8WB 3G96A 3ZXWA 3WQPA 4ID5A 2YKNB 5L38A 1UZDA 1SIZA 4IFVA 2CPIA 2MKKA 2B0GA 2ZZNA 4N8OA 2V63A 1LFPA 1J5OB 2H3EB 3TUPA 3V6JA 4LT6A 2YX4A 4OI2A 2POKA 1NJWA 3TAMB 2DHAA 3D1QA 2HNYB 5BYRA 2VFTA 3FSIA 2AGQA 1VLOA 1IWGA 1SH0A 2XWYA 2QC3A 5RUBA 2E1PA 2Z4PA 2CPDA 1UP1A 3QLHB 3FGVA 3SYZA 5KG6A 1RTIB 3PRVA 4WXWA 3BYRA 4IDKB 3AAWB 2UXDJ 5F0UA 4XPEA 5HLFB 4N56A 1F60B 2UV8A 5EWEA 5J2MB 5CYJA 2QJ3A 3DI6B 3G86A 3ISNC 3D28A 3T9ZA 4OI1A 3DRPA 2LVWA 2BBEA 5CYMA 4UQTA 4ELVA 1Y3KA 3V4MA 1RT1B 5KT2A 4DCJB 1LXJA 3SV3A 1R27B 1NKEA 3OFGA 2HVZA 3D9BA 4IFVB 2B9YA 4RBUA 2PGCA 3M6WA 3GYNA 3UDVA 3KG0A 1D9AA 3D4JA 3M8SA 2Y3YA 5KT4A 2W9CA 1V3ZA 2J7KA 3N6NA 1F0XA 4FF1A 4WP3A 3LF0A 1VRUA 1U1QA 3H20A 5GAHI 2LECA 4K2JA 3PKMA 3PJXA 2NREA 3H98A 1GMWA 3EDRB 1IR1A 3D54A 2XLJA 4EU0A 1FWLA 1GX6A 2ZJQQ 1IBLJ 1RWVB 2DH7A 2YQ0A 3QO9A 2XHCA 1Z2LA 4CO5A 1EQMA 4IQXA 4NXNF 5C42A 2P9EA 2HWHA 1X4FA 3UR0A 2V4JB 3OXFA 4PG7A 3A3OB 3FFIB 2CQPA 1MU2B 3E2EA 5I4MA 1ITPA 2V67A 5KFXA 3G82B 1RWMB 2XHWA 3B8HA 1XIQA 3J81j 5DETA 1OIAA 2YNIB 2PE8A 3L3CA 1F1BB 4DDFA 2RS2A 5EX3A 1KLMA 2MTLA 2V6AA 1GTHA 2OMOA 3KLHA 2VC1A 1VQ6S 1QTNB 2LEAA 4DPYA 2LU1A 5CXTA 4ILRA 2ZBRA 1HBMB 1VRUB 2BJ3A 5E33A 2Z57B 4F0HA 4WYLA 3W65A 4USHA 3OTDA 4YHHJ 2ZKTA 3T6BA 5U47A 2IM2A 3BKUA 1W7WA 1FK9A 3I82A 3V5RA 4JI7F 4J9LA 4GKKJ 1B99A 3BQ2A 2CJAA 4DLGA 5AT1B 3PCOB 2X51A 1GMVA 4V19X 4K5SA 2FJBB 3SIPB 4LF9J 1ULRA 5C42B 1XMOJ 3B78A 3VAIA 2R2SA 4LQ9A 2BJ7A 2QL9B 1S12A 1LWCB 2EPIA 3HVAA 1DURA 4PG8A 3TZXA 4PR6A 5H9FK 5HO4A 5IT0A 1VQ4S 1O51A 4J9UE 4ZIWA 3ITHA 1C0TB 1AYEA 4P2MA 1C1CA 4JV2A 3HLUA 4P9SA 1KR4A 2HS4A 1YQHA 2E1RA 2HFVA 4OYBA 1HHSA 3HHDA 3L7UA 3DOKA 5J1PA 4F4YA 3W64A 3V81B 3KK2A 4CLPA 1RAGB 2H48B 2GC8A 1TAQA 2XZWA 4JI4J 2F1FA 3MD3A 3TA2A 1VK8A 3IWXA 3TUIC 3MM6B 3UDCA 5CCMA 4Q2MA 5A8KA 4LFAJ 4F67A 4JI3J 3N4WA 4RLEA 1FNXH 2ZUAA 3BGOP 3TAQA 1Q5VA 4LBHA 2BJ8A 1HIYA 4UQGA 3QFHA 3MPWA 4ZVEA 2BOAA 4USUA 1F2GA 3MM9B 4Q7AA 3G9CA 2BACA 3R5CA 2UXBF 2XCAA 4QJVA 3QSYB 5D15A 2HAFA 1M5PC 2FTRA 3VGTA 1FRKA 1S5ZA 1RHQB 2NXCA 4DV1F 2RDDA 3W5ZA 1HA1A 4K4ZA 1N5VA 5F0WA 3QGPA 1S1TA 2HHXA 4CH1A 2KG0A 3FC9A 3THPA 3GG1A 4ECXA 3NL0A 2PI4A 3AODA 2AJ1A 3IR7B 1B0TA 3PYGA 4OYAA 2AGPA 4X4VA 3KLIB 3SCJE 1YGYA 2F63A 3I96A 3DLBA 2XB2D 2RQ4A 1AROP 1SC4B 3OLAA 1AUSL 4BDPA 1RKJA 5DJBA 3NGSA 1VK3A 1YLXA 1HBUB 2V2KA 2PI5A 3CMES 4Y6IA 1C0UB 3VAHA 3C8YA 3K5NA 1SC3B 1B70B 3KLGB 4YS2A 4LBIA 3KK2B 3KDOA 3QT7A 4OHVA 3NAIA 3K5MA 4KB7A 3DNCA 2ZD1A 3UVJB 2DO4A 4P71A 1NAQA 3PKYA 4DL5A 2HGMA 2MZQA 3CCQS 2HS0A 3ET6A 4J5OA 1WD6A 1RI7A 1N33J 4ED2A 2X7IA 2QN6B 1N36J 2HW3A 1LWFA 1OYEA 1VQSA 5KFGA 1DAXA 3CJ5A 1RHRB 4Q5VA 1ZBTA 2P8IA 1PBUA 3UQSA 3CCLS 3KUEA 2QMUB 4B3RF 4PKDB 2RVJA 1CJTB 2HQDA 5GAEI 2XI2A 2C2OB 4LREA 4ZA1A 2VU5A 2CPEA 2RE1A 3D68A 1B7FA 4CH0S 4QQBA 4PXCA 2HMIB 1NHUA 1PAEX 3IAS9 1RT7A 2QLJB 1TKTA 1KFSA 2N3OA 3FSXA 3O8WA 1PSDA 1JXVA 2DNYA 4R8UB 2H65B 1IKXB 3WX4A 4F4WA 1X4EA 3PZPA 3FMWA 3TW0A 5J1NA 5C24B 1FT8A 4B9MA 5KFSA 5T7LA 1RYSA 5AJ3F 1R6YA 5FLXY 1NJZA 1MROA 1UVNA 4LR8A 1LK7A 2OPSA 2FHJD 3H8YA 1OQ6A 3G6XA 4O4RA 5ETOA 1V9OA 1R0AB 1U7LA 1REVA 3ZZUA 5IZHA 1FJ7A 3PHEA 4RKUC 2UXCJ 3ZTPA 1DQAA 2CRLA 4IFYA 4HHUA 2HNZA 2HZAA 4O23A 1SJFA 3DGVA 1B64A 4X62F 4DV4J 4QWCA 1M1GA 2QL5B 2CQ1A 4MKBA 3MGJA 1KHVA 3J81Y 3R97A 3NNAA 2BMBA 2RHQB 2FUG9 3IR5B 4O3RA 3SMZA 3I0SB 1RTZA 1RT7B 3TJ9A 4BC9A 1JLAB 2LQ9A 2HQ3A 1TKTB 3OV7A 3MCSA 4ZPCA 2Z2LA 2YX7A 2AYBA 2NUHA 4AUKA 3UFCX 1XQIA 2GCFA 5E3QA 1RACB 2KL8A 3W1YC 3BSCA 4X4PA 3K59A 4C3KA 2K1RA 2J8SA 3FRYA 5KFWA 1CBKA 4A8QA 5BR8J 3CDEA 2DHXA 2WB4A 2MJUA 3MFIA 4B02A 2ZKUA 2W2PP 3HHLB 4NI2A 2RS8A 1EJ7L 1WTBA 4A8SA 1FRXA 2OPSB 3CIZA 4DV3F 3OTCA 2VBYA 4K4WA 3IRXA 3NP5A 4ED7A 3TP2A 1I6JA 2I5JB 4CIOA 3MDFA 4FS2A 1NH7A 4J9RA 1C2PA 4ZKAA 1N0VC 2GQQA 4LR7A 2Y9HA 3CJ8A 1VC0A 3NG8A 2HNZB 2FZKB 3PY8A 3GSDA 2JLFA 1FWKA 1NU4A 1NB2A 1SH3A 3IBCB 4YB5A 4F04B 4RW6A 3P96A 2AZ3A 4R0EA 3V4IB 1TK8A 1RCXB 4ED6A 4ED0A 3EYZA 4FYYB 5DDPC 4DSLA 5DGBA 1WSVA 2W9BA 4MJKA 1H2VZ 2GIFA 1MMDA 5IM0A 2QA1A 4KPYA 2B5JA 4N47A 4I6WA 2J6UA 3DU5A 3OHAA 2GMHA 4DXLA 3FBFA 2MQQA 3RB4A 3M8PA 4P7TA 4QYZK 4LRAA 2W1BA 1JMTA 4QPXA 1HHTP 1S0MA 1XTZA 4TQSA 3KNGA 4R25A 4JV5F 2Z2ZA 4U7UD 4UOFA 2VG6A 1S0NA 1LW2A 1AZSB 3C6TB 5A0YA 3CJRA 2X3GA 1QE1A 1U25A 3ILJA 3PX4A 4MK8A 3ZZ0A 4FXVA 5ITHA 4GO5X 2NXJA 4HH0A 1VQPS 1HNZJ 1J2VA 3DRRA 2LA6A 5HI7A 5F41A 3P5TL 4OHWA 4F02A 5IT9U 1KFDA 3IWNC 4F4ZA 4TLQA 4DR4J 5GAHU 2QT7A 5KFBA 4DUZJ 3CULA 3UD4P 2F4VJ 1VHIA 2K2PA 2XMVA 4RW6B 1FTCA 3GP9A 2UV8G 3DLGA 2J0WA 5KT7A 1TQLA 2PC6A 4C8YA 3JTPA 4F26A 2XI3A 1NDCA 3Q8VA 4USIA 3M2UA 2W9BB 2MHEA 5IM0B 5BYSA 1PC5A 5ETKA 4WBFA 1VS3A 3EVOA 4C11B 1X60A 4OFZA 1ZAVA 4EEYA 4I6AA 1T9VA 2HHQA 2DH9A 1FE0A 3PHTA 4KHPF 1LWXA 3M8PB 4OZ3A 1S6QB 1H0HB 1U0HA 2JL9A 3HFZB 2O66A 1VQNS 5A6PA 5L39A 4CRJA 2Q79A 4W90B 1ZA2B 3D67A 3C6UA 1HPZA 1MWYA 1Q8LA 4LF6J 1SJ4P 2M8DB 3FBBA 1DLOA 2KYZA 4GKJF 2F4FA 4O0NA 2DEIA 2OSQA 1Z2ZA 1IWAA 1ZETA 1GXUA 1LW2B 2N4DA 1NZ8A 3Q8SB 2V69A 1G4CA 1RDRA 4QW8A 1RTJB 4LFBJ 3G71S 4WFAQ 4OYOA 1S4FA 4AXJA 2ACYA 1Y5LB 7FDRA 1U1MA 1NDLA 2BKOA 4KSEB 2P9GA 5DQHA 1WHXA 2ZH4A 1CS4A 2GVZB 4B3MF 2J9DA 4NLSA 4DR6F 2F8EX 1F5AA 3GCXP 3TQEA 1K9MT 4QWEA 1UW9A 3DLKB 5HVFA 4HTJA 2GMJA 2JJ4D 2J5AA 4EYIB 2DXEA 2DH8A 2CJKA 2XGPA 4Q2LA 1N5SA 1PYOB 2UUAF 2GX8A 3LWLA 1S48A 4M5HA 2XLIA 2ZEJA 2DR6A 2ZM6F 5CCLA 3WDOA 3CVKA 1WORA 4LSNA 3MMAA 2GHWA 3AOBA 4YR2A 3GWCA 3RBZA 3QJLA 1HPZB 3MAAB 5CD4H 1DLOB 1RADB 4MK7A 5IWAF 2QMWA 2DNHA 2C2ZB 2EFNA 5IXUA 1GFWB 4D3HA 4UOCA 4YN3B 1HQEB 4JI0J 4DV2F 5BYQA 5KFNA 4WCEQ 2AEMA 3ZZZA 1E6VB 1IM6A 2E5GA 2MEWA 3PV8A 1H38A 3EE3A 1YZ6A 1JJ2R 1I51B 2XG8A 4HYKA 5F8JA 1AW0A 2F3JA 4ZLNA 2E9RX 2VC0A 1FKPA 3W5YA 3MOJB 4XO0A 3BO3A 4ELTA 3W3SA 2QL7B 1K44A 5C25A 1FFWB 3BKFA 1XC9A 1RLDA 3V6DA 3D6TB 1AA1B 2CQHA 3NNHA 2XY7A 4EYHB 3MD1A 2OLWA 2JVRA 5HJYA 4KPCA 4DR1F 2XC9A 1Q16B 2V8DA 3ZZTA 2QA2A 4DS4A 4OX8A 3K58A 4U7UK 2OI2A 2AEFA 2VBXA 3CB4A 1Q53A 3ZZPA 2EC0A 3T41A 4LSNB 5GMEA 2YWKA 5HL7Q 3M9OB 1Q86T 3PO5A 4WIQA 1G7CB 4FVCA 3KYLA 1ACMB 3DHWC 1TK5A 2DD8S 2VOPA 1URRA 2R7VA 3F0NA 2FVPA 2WONA 3U02A 1HBOA 3A1YG 3K5PA 3KNAA 1Z4UA 4CO4A 4F25A 2R7WA 1KTVA 3RJMB 3MMBA 1U1NA 3QJJA 3HKZD 2N4CA 1KLNA 2JNJA 1EAYC 4NMXA 3G87A 2V9WA 5AXKA 3NAHA 1TKXB 2XMUA 3Q0AA 4I0WA 4QIGA 1IJFB 4H4OA 5A2QY 4X4TA 2ATCB 1TMJA 4WFZA 1BLUA 1FKPB 1JLEB 4KGMA 4OX6A 4DV7F 2EI5A 5DS7A 3LALA 4PRFA 1R0CB 3C16A 4XIUA 3X3UA 2G13A 2Z2YB 1MWQA 2H1YA 4IH5A 4RW9A 1KKHA 3CJTA 4ITSA 1FDAA 2HGNA 1FDBA 2BDPA 5ETNA 4HL9A 1ZTTA 2CFXA 2MY7A 2XZTB 5K20B 2V4QA 1CJUA 3NBPB 2LEPA 4QZVB 4AL6A 2G2OA 3DHXA 4EMDA 4LIWA 1N6QB 1RT3A 4ZVGA 5J1EB 2KFNA 4F3OA 5D4OA 3OPKA 1VMBA 3OFHA 2FGOA 2BJDA 2EFPA 1Y4ZB 2FHKA 4DZDA 2BZ2A 1TL3A 3H25A 4AL7A 3KLEB 5IFMA 3MZIA 3ELHA 1A7GE 4RNFA 1HBNB 5CQGA 3CJ0A 2Y0SD 2MKHA 1WG4A 1JJ4A 3BH6B 1NRKA 3G4SS 4BLGA 2GQ2A 2XMTA 2ZJPQ 3CCUS 1V5VA 4QIFA 1VQ7S 1CPZA 2MGZA 2GFFA 1HYSB 3GTYX 1DFDA 2P5VA 5ETSA 1U47A 2HBYB 4ICLB 4NLGA 4JI1F 3UPFA 1ZTWA 1JLBB 3N5BA 4X4OA 5DGAA 4KH1B 2AT1B 2VQEJ 3CJ3A 4EZ9A 3T5JA 3R2DJ 3T5HA 3IBWA 1NZAA 2AHOB 3FZ2A 1NPRA 3Q2TC 2ACMA 4DSJA 4O0IA 5HBMB 2XMWA 1ZOTA 5DM6Q 1JNRB 2KRRA 3IFEA 2WVDA 3QZ8A 1GTEA 5H9FJ 1H72C 1VQ8S 1KP6A 2I1RA 3MM5A 3LP1A 3T5KA 4ED8A 4ZN3A 1FNOA 4EGLA 3RTVA 2VA2A 3GJRB 1CEZA 4OLPA 1WEYA 1NK8A 4C8LA 2VFSA 3MURP 3ZFVA 1TL3B 4PWDB 2ZOMA 2VG5A 4HLBA 3UE2A 1UVMA 3KOAA 2AMCB 2OFGX 4GVBB 1LEOA 2VPYB 2AW0A 2KT3A 3R3TA 1RT6A 2BE9B 4C3LA 3TEHB 2JLGA 1CULB 3E8OA 2DY1A 3M8RA 3M30A 4PUOA 5E0OA 4LF8J 1VQ5S 4JI5F 3EVMA 2MXYA 3QWPA 2FIUA 1T3NA 3D2WA 2RDIA 1SJ3P 5JUMA 2DXDA 4DL3A 4CH7A 3LUYA 2IDEA 3RAMA 3M2RB 4L3KA 4DL2A 3TEGA 4HR2A 3KLFB 3V6KA 4NZ0A 3TVYA 3HSDA 1Q7YT 3LA0A 3HHLC 2BXJA 4FYVB 1NO8A 3QRQA 1Q79A 2ZH6A 4WU3A 5HVGA 4P7VA 5HQLA 2FC8A 4NE9C 3OVAA 2HRTA 5DG8A 2XMJA 2WVFA 1EIYB 3B82A 1VIXA 3F44A 3MI7X 2DHGA 1OY8A 4ETXA 1IQTA 3OT9A 3QNWB 3A3NB 4JV0A 3PW2A 3HVTA 1S0VA 4P2SA 4I4BA 1T05A 4K4YA 1SKSA 4O44B 4M95A 3QIDA 2HQIA 5L1JA 3VTIA 1WG5A 5D8HB 3M8QB 4DI6A 3O3LA 2MJNA 2PA8D 1SB6A 1RABB 2BW7A 1WDDA 2O67A 3ENVA 4IO9Q 5CH7B 3P6YC 2OPRB 2MY8A 2FJEB 3RB3A 2BQUA 1S99A 4X64F 2M0GB 1IBCB 1VQKS 2C22A 1VRTB 2JWNA 3OQ2A 2C42A 2VDIA 5KFCA 1HMVA 4P10A 1S0OA 3PYDA 2PIIA 1K47A 3MECB 1RHKB 3GJTB 4I67A 5F8MA 3JSMA 3RAQA 4NXNJ 1G1XA 5I3UA 1F9EB 1V3SA 1YITS 3KK1B 2XYPB 2RRBA 2R7TA 5KT5A 1U2FA 2YPZA 2KYXA 4D3GA 2ZBQA 1KD1T 1SUQA 1T0TV 3A8JA 2ILZA 3RW7A 3ZNJ1 1KEKA 3AB2B 3QT6A 2J9EA 4ANDA 2LCWA 2IMWP 2HSEB 4WWSA 2W9AA 3I32A 3HVTB 4OJ1A 5L8RC 2NYIA 3QQCD 3HM9A 1FTRA 4DU7A 2M4MA 1DJ0A 3AD9C 4RW7A 2RH3A 3JQJA 1XNRF 1JJCB 4KY3A 1EARA 1NSPA 4O3PA 2B6AB 3RRHA 1KNZA 3OUYA 4CLFA 4MIWA 4CTAA 4TXSA 1TFWA 1M5VC 1OPZA 3BV8A 5D3GB 2EBGA 2F40A 4GVLA 1PJ7A 2V4RA 3EXCX 1S9GB 3EPGA 4JI7J 2DO0A 2ZE2B 3VF0B 3DOLA 2V8PA 5IS2A 1Y3JA 5M2RA 4MAKA 4PQUA 2AWZA 1KRPA 2Q1LA 2YNHA 3OXGA 1WKLA 3SCLE 1ZAXA 3DLEA 2QMXA 1VRQC 3UD3P 5IC4B 1X4BA 3HCXA 4WP9A 4WFYA 1VQ9S 3MMCA 4QIEA 2L08A 1NK4A 2DGQA 4DN0A 3HX9A 4HKQA 2OTLS 2E1CA 3MM7A 2FYXA 2CPYA 3W8PA 1H6KX 2CPXA 3VQSA 2E7VA 2GGPA 3QWUA 3G8TA 4RW7B 2A2CA 5L1KA 2XSJB 1R8CA 2MKSA 3EJMA 4HTIA 3OVBA 2IM0A 3I5BA 1U1PA 1RCOB 4PG5A 1LWEA 3FEZA 3D66A 4LSLA 2UXBJ 3K5OA 2VIHA 1KOOA 2IC3A 4YUDA 5F8HA 5B0FA 2JX2A 5A8RA 3J7ZT 1RAAB 2F65A 1HR0F 1G2EA 5DQGA 2CPHA 4ZVHA 3I31A 5K14A 2YKQA 4J9NA 1OWXA 4DV1J 4EO6A 1M0SA 2LQJA 2A0FB 3W63A 4WK3A 4PQUB 5D77A 4EO8A 2G4BA 4TVAB 2HFOA 5ETVA 5D4NA 2YX1A 1ZPWX 3UN2A 2D9PA 1FFSB 4UF4A 3UNGC 1RU1A 4URQU 4FYXB 4OI4A 1S1VA 4QYZJ 2IJRA 1S6OA 3DXBA 2R4FA 3PDNA 4CO3A 1SL0A 2VODA 2ZH8A 2HWIA 5KG0A 2GW8A 2NLWA 1NK7A 4C48A 4ZHRB 5GAGI 4ZVPB 3MM7B 2OEKA 4N7TA 1W2IA 2K7JA 2L3MA 1HNIB 5ETPA 2XS7A 2D69A 2FQQB 2GGPB 2ZNZA 1X5OA 3D1HA 3N0VA 2BOPA 5E5NA 2MQMA 3FCVA 2XS2A 3QGIA 3OW2R 4O3QA 2Y1RI 1BY9A 4N8NA 1QVGR 1N5YA 4OI3A 2Z56B 1N88A 1WF2A 1WKKA 1BQMA 1S57A 1T8EA 2DT9A 2HYIB 4B3RJ 2MQLA 5EGYA 1TK0A 4DOZA 3I55S 5ETMA 4I2PB 2WBMA 2HVHA 3GV7B 4OHZA 3J7AN 1FRHA 1U1RA 2GAHC 5B08A 1WELA 3C2PA 4YR0A 4KQZA 3VGUA 2IVMA 2JEJA 2CQDA 3MR6A 1YJNS 3M8WA 4KGZB 3PW0A 3GE9A 5MLCV 4L76A 4C2MA 2RF2B 3Q83A 4OZ2A 2UU9F 9RUBA 2FJXA 1X4HA 2W7PA 3C14A 4C8KA 3Q89A 5AJ3J 4OZ5A 5D6GA 2E9ZA 3WX8A 3V6HA 3IRWP 2E44A 2C3UA 5LSRA 4B9UA 1XJWB 5DG7A 3QT8A 4KTQA 3CC2S 2DR9A 5GADU 1UFKA 3MWBA 4DX7A 4MFBB 2RKIA 3Q8UA 3K2YA 2CJBA 3CCVS 3U1NA 2Z0GA 1T03B 2O1PA 3NOGA 1BUXA 2ROPA 1RWWB 3NRBA 1BQMB 4ES3A 3BPSP 4ERDA 2L9DA 2UUBJ 4YDDB 1TKZB 4X62J 4FF4A 2HHWA 2ZH2A 1REGX 3KG1A 2VFRA 3TZZA 2QA4S 2HFUA 5E2QA 1U2RA 2WAQD 3KHGA 4LRBA 1NNDA 2CJXB 4R5PA 4X4QA 2DPJA 1HW8A 2MLXA 4KO0A 4KT0C 2DGXA 4WP8A 2BQ3A 2DNRA 2VBWA 1NH8A 4TN2A 4LF7F 1RWNB 2CJQA 4TU7A 2B4OA 5GVQA 1FDDA 4QU7A 3GIKA 1J5EF 5M2PA 2FHOB 2QIFA 2EFVA 2CAJA 3DRXA 5LMUF 2KT2A 3F41A 4YB6A 1OQ3A 5HJXA 2LMIA 3Q86A 4DPWA 5L1LA 1T7PA 3NKYA 4M5DA 2AJ4A 2BR0A 1YBUA 3LP0B 1UW4A 4WXOA 4DV3J 4M1KA 2ZC3A 4X2BA 4IRKA 1UJ4A 1JB0C 2PA3A 3R27A 1FEHA 2PMZD 3J7Z5 4DBQA 4IR1A 1VQOS 4B9LA 1D0EA 3H5XA 2Y0BB 3DOMB 3K8VA 4CYUB 4BCAA 4DPTA 3DMJA 1FX2A 2ADCA 5LM7E 1YHQS 4RWXA 5HP1B 6FDRA 3JQKA 4ZLPA 4DV5F 3THTA 2IAJB 5I42B 4QIVA 5HMXA 2BJ9A 1BGXT 4WTOB 1FE4A 2LDIA 2P2CB 2U1AA 4R5PB 1GNKA 2FVCA 1X9MA 1DHMA 3KJQB 1M5OC 2RNEA 4FYWB 1LW0B 5FJ4A 3ETMA 3LPYA 2CQ3A 5DG9A 2MYFA 1TL5A 4USVA 2OH2A 4HI1A 4I1TA 1PO6A 2CZ9A 4CO1A 3UO0A 2N7CA 4W98A 4AT1B 2B7BB 4JV5J 4C8OA 1RBLA 4LR9A 2MQPA 1RWXB 2EBEA 4KV8B 2EEYA 3AD7C 2F9JA 2H5EA 1BE4A 3GONA 3EGWB 3JQMA 5KFMA 5C2GA 4NLWA 2YNGA 3CD5A 1HNVB 5J2PA 3ZNUA 3OLBA 3FBEA 3NXZA 2QO3A 1Y5IB 1PJ6A 4CDIA 1FJGF 5IC6B 3Q8QB 1Q8KA 3DMJB 1HWKA 2DNPA 4IUFA 1ZZFA 2HQCA 2DRAA 3J7YI 2Y1JA 5HMZA 2G2YA 4C8MA 1IM4A 4RX6A 3CXCR 2ZFHA 4QR1A 4C0HA 2DGTA 1YZ7A 4DWIA 1RT5B 3PRBA 2GVDA 4AE5A 1EP4A 2J9CA 5AXMA 3SXLA 4U7CA 3OFFA 4TLRA 1KQGB 2GJFA 4IOCQ 4YR3A 3CT9A 3KUGA 4QW9A 4PPZA 1U2CA 3PW7A 2WVBA 4QU6A 3KLVA 4KHPJ 4HHJA 1IKWB 3HZEA 4NZ7A 3RRGA 5M2UA 1JQGA 3HJFA 2HHHJ 2V0NA 2DVIA 3BBBA 4KC5A 3DGPB 4H54A 1N5QA 2AYMA 1VBKA 3D5MA 1T02A 5HMWA 1ROFA 2O01C 1P8GA 1XERA 2QX0A 1H7XA 3Q8RB 2RT3A 3K0JA 5D4PA 3L95X 2DITA 3IXQA 5CD4A 3KJNB 1FXRA 1X4AA 2FJDB 3GILA 1R3NA 4C98A 2BE2B 4X4SA 1BWEA 2DIVA 3PEJA 1FD8A 4OYWA 4DLEA 2YNGB 4OV6A 2CQ4A 3KWMA 2HS3A 5FDLB 4B3MJ 3MR3A 2FZGB 3EVWA 4NCAA 4DR6J 4NLQA 3W9HA 2YKNA 2IRUA 3LH2S 5IV4A 2YTCA 1UVLA 5F8NA 4DR2F 1Q81T 3J80Y 4I56A 2GNKA 2O3DA 1M5SA 2J0QD 1J5OA 3CJQA 3B54A 5F9NA 3PFOA 3IG1B 3PTWA 1C4AA 4RPFA 4A46A 5LMNF 3TAMA 5G0RB 2HNYA 4HACA 1D8ZA 3RB6A 4USTA 2UUAJ 3HI9A 4ED5A 1R8BA 3OD2A 4Z7CA 4P2FA 3QLHA 4Y34A 2ZM6J 4DF4A 2MZSA 3JAMY 3NGDA 1NXIA 4LQ3A 2B9WA 3PYFA 4USMA 2IBKA 2M70A 1OSDA 2ADBA 4IDKA 1GT8A 3CTRA 1KQKA 5HLFA 1YSJA 4IO1A 3MUTP 1NCLA 2IRYA 2XCPA 5J2MA 4WPAA 2BRLA 2DISA 2JZ5A 4ED1A 4GO7X 3DI6A 5L9NA 2YKPA 5T41A 5IWAJ 1GEHA 2LFVA 2UUWA 4PZVA 3P49B 1GMUA 2Y8WA 4DV2J 2EWHA 3R1HA 1H74A 1NSAA 1X5PA 5KFDA 5GMDA 2XNQA 1RQ0A 1RT1A 4LMZA 4FKYA 4C4WA 1K1QA 5K9FA 2MMYA 1B3TA 4DL7A 2FJVA 1NB7A 1XWLA 1QY7A 1OS5A 1KVIA 2LQ5A 1HQ2A 1Q0NA 4DJBA 2DGSA 4FN5A 4WFBQ 3MEDB 2IM3A 3VZIA 2RIJA 2CG8A 4PXBA 4ZCIA 1KHWA 3HSGA 3BO4A 2FLLA 1L3UA 2DKOB 1ZA1B 1A6LA 1RBOB 1WC6A 2BM0A 4HACB 3H5YA 4B3OB 3K17A 4W4MA 2Z2MA 4XDDA 4DR1J 3NEKA 5EHHA 3BEGB 4WK1A 1N54B 3OL9A 1SVDA 3KK3B 4A8OA 1Y7PA 5KG2A 3T1AA 1JLQB 4ZPVR 4UTGA 3N01A 3JSBA 1WWHA 1PJ5A 2C3PA 4JI8J 2QGFB 4KFBB 2OHDA 3CDBA 4H4KA 2I2YA 5AXLA 4N41A 1HNXJ 2R2RA 3VALA 3ZZYA 1WEXA 3AY0A 1IUJA 2LXFA 4M5KA 2CDQA 3VAGA 3QT5A 3SDEB 2VF3A 3RR8A 2YKMA 2NQPA 4USJC 2V4JA 3FFIA 3BREA 2DNQA 1MU2A 1RAEB 7FD1A 1YDLA 2KHCA 3GFZA 4F36A 5CAAA 2R8GA 1FJCA 3QRRA 1SKRA 1W25A 5H9EJ 3PYEA 4NYZA 3G82A 4Z2XA 4UY85 2VG7A 5AXNA 3UCZP 4E8UA 2KXFA 2ABYA 1XEZA 3NCQA 4DSEA 2KKHA 1RK8A 1OMSA 4LIRA 1YJ9S 5K5MA 4I6YA 3VR1A 2HNDA 2YNIA 3FJ2A 1R6VA 3GU0A 2YWHA 4X84A 3ADAC 4DV7J 3VVTA 3M05A 2EKNA 4N5SA 2DCLA 2MDAA 4CNZA 2RUSA 3IM8A 1TV6A 3IR6B 1YJTA 2OP5A 2M2BA 1QUPA 5IT4A 1WHWA 1RLCL 1Q4RA 1HBMA 2NYHA 3KUHA 1WC4A 3DM2B 4B3TF 3WBZA 2MZRA 2XWXA 4J9QA 2KXNB 1SIWB 1S79A 4KBIA 3AXMA 1O6XA 2DRDA 2UZAA 4MYUA 2J8AA 5HN0A 1FKAF 4P6QA 3GYXB 2DNLA 3KHLA 1LWCA 2YKMB 2J6TA 3MEGA 2DHHA 3UI3A 3D7SB 4LF4F 4CLZA 1UEKA 3CCTA 3CO9A 1KOHA 1BD6A 5K8PA 2UXCF 1Y5NB 1H2TZ 3IA0A 1S7IA 3UCUP 4FBTA 2GA7A 3C15B 1C0TA 2W8LA 2VG7B 4CT8A 4Y2MA 3LOUA 4WIIA 4DX5A 1U1LA 2HNDB 3H0PA 1VLYA 1WHVA 4JI1J 2UUCF 3V81A 4YOEA 5HK4A 4A8YA 1GH8A 2WTFA 1RTDA 1DQ9A 4O3SA 5K8OA 4NLXA 3MM6A 3WC0A 2EFGA 1TV6B 2J7UA 4EWTA 4FBUA 3KTQA 3OR2B 1VDHA 2RU9A 1H98A 2YH0A 2F7VA 1NK6A 3TVZA 3WC2A 3MM9A 2OPQB 4L3NA 3SEOA 4CLLA 3TR5A 1CG2A 2AD9A 1FHTA 2OKQA 4F0KA 1NPPA 4DR3F 1HQUA 4J9OA 1EHWA 4DN9A 4N76A 2W25A 2KZZA 3M8YA 3BM7A 2KFYA 3BGRB 4NA2A 2JEFA 4JBCA 2DJWA 5HQ8A 3TYTA 3MEGB 2OD4A 1NSQA 4MH8A 1P1TA 1U6BA 3KLIA 4JI5J 2ZZMA 1QTMA 2AYEA 2X1FA 5E3RA 4CCHA 5FLXU 4ECUA 4A48A 1MG7A 1HBUA 1JLGB 2DXFA 5JVGQ 2PD1A 2OSRA 4F8RA 4ZPTR 5B0EA 4CLUA 1C0UA 2ZHBA 1F9FA 4OZNA 3KLGA 1RTDB 1LKZA 4YEAA 2HVIA 2RDJA 1YIJS 3UVJA 3A8KA 3ZO7A 3NGTA 1WI6A 1F5CA 1UJ5A 4F3QA 2VONA 3VWSA 1WUUA 1ZM2A 3M7VA 2LXIA 2M9KA 2DNGA 1C1BA 3I0RB 3W9IA 2VKRA 2QLBB 1X4CA 2CPJA 2CQGA 3C3LA 3J81U 3JS9A 2CQ0A 1RHUB 3W2VA 1HQUB 3MR5A 3DC2A 2OEMA 1A9NB 2UVUA 2GIQA 1CJTA 2EC2A 1BHNA 1YRXA 1EQ0A 3SSQA 1TZ0A 2OD6A 4OX7A 3NMRA 2AJFE 5LSLA 3D6HB 2KT5A 2KVIA 4IG3B 4DV6F 2HWTA 4E98A 1UFLA 4EK2A 4NOHA 2HMIA 3O2IA 3LGMA 2XNRA 5A6WA 4L74A 3GPAA 3A12A 1AXQA 4ANEA 5SZTA 4R8UA 2NUUG 5IOLA 1IKXA 4U6PA 3O5TB 1T9UA 4NRUA 3HMJG 3KJFB 3CNQP 3EPIA 3H7HB 3CCSS 3D1OA 5C24A 3RG6A 3IMQJ 2LYVA 4R0JA 2CPZA 4X64J 3J7A1 3BJYA 1U6FA 1VQMS 4J9KA 3UN3A 3OJUA 1JX4A 2ZOFA 1XMBA 5F8IA 4A8MP 5E3PA 1HD0A 3EZOA 4Y0FA 2DR7A 5HVHA 3HXMA 2PDAA 1FRLA 2R8IA 1T94A 1S1UB 1UAWA 3IM9A 3GV5B 1R0AA 1RSCA 1S6PB 3C66A 5HANA 2WBRA 3H90A 5CYQB 4PQAA 1C1BB 3KMQA 2XYHB 2KJWA 1NM2A 3DDKA 2QSFA 2V2QA 1V6HA 4LF6F 1TVRA 2PEHA 1F2HA 1JIHA 1YJ7A 3BH7B 1OSCA 1FD2A 2IA6A 2CWXA 3W2VB 2EFQA 4BS2A 4Q43A 2G0JA 2E66A 2QLWA 4ELUA 1S9EB 4RO0A 3G6ES 2MQOA 3TA1A 3I0SA 4ZCKA 2IFXA 1IN0A 1JLAA 2E7WA 3CSKA 2XM3A 3X1LB 3GJSB 1RA6A 4RJVA 4RUHA 2V8VA 4DQSA 2NZCA 4ZDNA 4UOHA 4ZJLA 3S1TA 4ZVUB 3DFEA 3OR1B 4PXDA 2DCUB 2QA4G 3MHYA 2NCKL 2ZOGA 2VH7A 5B7WA 5SUHA 3EX7B 3M1VA 4CLSA 3HHLA 1Z1ZA 3P5BP 2RRAA 1SL1A 1T3OA 3CDWA 1Q1KA 4WZQA 2B9EA 4ZP9A 1HNWF 4RZRA 1KWMA 3VGSA 3H2UB 1QM9A 4J9SA 1JJHA 4OMFG 3IBFB 1VI7A 4OJHA 2G0CA 2I5JA 3MM8B 3JSRA 4MYTA 4P72A 2AF6A 2BJEA 2GHVC 4G1IA 5KAKA 2R9LA 1TVRB 1WNEA 1KN6A 3T6JA 3T1YF 1UPMB 2XEXA 5CABA 3CPWR 3ETOA 5B0AA 3HPOA 2IJNA 3AXKA 4KHRA 2P6TA 2OPPA 4ZVFA 2F8HA 3EICA 3V4IA 2IPOB 2JDJA 1Q82T 1SJQA 1BWVA 1X9WA 2CXEA 4CT9A 2P9CA 4M5IA 4QPTA 1UL3A 2A10A 3DN9A 4YY3F 1U26A 1VBYA 1VBZA 1L5UA 1YKWA 4B3SF 1VOMA 2ZBIA 2CKWA 2D74B 2CYYA 1HR0J 2M52A 2ALYB 1D9DA 4ECVA 4NCBA 2PO4A 3MPUB 1KVKA 3M1VB 4C9DA 2J7WA 2VHGA 3CGIA 3DYAB 1AZSA 3C6TA 3K5LA 4ZCLA 2VICA 3B4DA 4NYPA 4Q8EA 4X65F 1X31C 4P73A 4PWWA 3OSNA 1B0PA 2XULA 4IKAA 2B56A 4ETZA 3TUJC 4K4SA 2UVRA 4PABA 3OTEA 4OZLA 4RNNA 3WIUA 3CCRS 3BGFA 2FGCA 2MPUA 1TL7A 1E6YB 2CJ9A 1LQ9A 2QYCA 4TNOA 1T9WA 1SKWA 1T9XA 1T11A 5C7PA 2LEBA 5HROB 2XSFA 3OHBA 3HK2A 2EKYA 1U6ZA 4MIAA 2OPPB 4KKOB 4JI6F 2HAIA 2I8EA 3R5GA 1Q7LB 5C5JA 4CLTA 2WSEC 1UA1A 4C11A 4J9VA 1DTTA 2R8HA 3AQPA 3US5A 4NLPA 4AQYF 4NA3A 2IVFB 1YJWS 2MKCA 2IYGA 1S6QA 1RXOB 2BUNA 2K7KA 1WF0A 1RT4A 4F4AA 1MSWD 3PX0A 3D3CJ 2E1MC 1Q8IA 2HFNA 3GIMA 2HK3A 2WVEA 3AJDA 3A3PB 3E01B 3BQ0A 2V8HA 4ZPWR 1N8RT 3BN7A 3M32B 4B9SA 3FEXB 2B4UA 3OL6A 2JC0A 1CLFA 4JYAF 4RUCA 1YG0A 2LXUA 1RTJA 3O6QA 4QWAA 3NWRA 3TWZA 1TUVA 1QD1A 3LO3A 1VJWA 1HI1A 1L3KA 4DFPA 2GVZA 2ZVSA 2R8JA 4IH7A 5KFJA 1TL7B 5FD1A 4C0BA 4A8WA 4G3IA 5CA5A 3OVSA 3W60A 2ASJA 3VAKA 3T3FA 2UU9J 2AQ4A 2HVDA 3DLKA 4OYMA 4CLYA 1SXLA 3NGKA 2JSXA 2AYGA 2R2UA 2P6SA 5EWGA 1NUEA 4IOBA 4J7CA 4OJ3A 4LRCA 1WSRA 3MTKA 2M7SA 4DX8H 1RYRA 3EMTA 1IBKF 3KXDA 1DTTB 2RJZA 3I4PA 3HFVA 2WVCA 4RWWA 4BBYA 3W8GA 1U8WA 1TAUA 1R8AA 2E5HA 3M2VB 1RT4B 3PFEA 1SI9A 1PBAA 2W4CA 4HT5A 1Y11A 3MAAA 3VHQA 3MR7A 4U96A 2HIQA 2RUGA 3AA9A 1PC4A 1RWUA 2CNKB 3QMQA 5KFZA 4M5JA 2JVOA 5LSOA 1CSJA 2VQFF 3QZ7A 1RHMB 1HQEA 4MKYA 4H4KC 3BSNA 1E6VA 5A2QU 2BEFA 1MNEA 2LA4A 1WC0A 3SZ2A 1JNZB 3TNVA 1EZZB 1FXDA 2PT0A 4DFJA 1TL1A 4L6V3 3I56S 3BN4A 2H5JB 3M4XA 2FVQA 3QIPB 2C1EB 3AA8A 2X1AA 3DDIA 1QSSA 1P9QC 4HH1A 4LUBA 4LF7J 3FMBA 2D3O1 3BSAA 1J5EJ 3ILLA 2DTJA 2AJ0A 3JYTA 3RU0A 4IG0A 3JTNA 5LMUJ 4RW4B 3CD0A 3CCMS 2W7OA 2V5HG 1JWWA 3DRSB 4DV0F 5HMYA 1HKAA 3PR5B 4LF8F 1I3OB 2CQIA 2IDLA 2Q6CA 1X0PA 5B0GA 2A3JA 2FY8A 1L3VA 2F9DA 2FZCB 2ZVIA 1DBDA 1IR2A 3DRYA 3MPYA 2V2VA 2FPHX 3R8YA 1S4EA 2G1HA 2GV1A 2ZNYA 1RAOA 3O1LA 5E7OB 2YWEA 3TX0A 3BDEA 1WOSA 1D9FA 2IA0A 5LJ5Y 3AH6A 4WFXA 1L3SA 4OLOA 4NLDA 2D3UA 2FJAB 4LFCF 2R7QA 4DV5J 4NLUA 1U1OA 1NLKL 3MPDA 1Y9OA 4CI0B 2CDRB 4RW8A 4H4MB 1KQFB 2CQBA 1TKXA 2NXEA 3VQTA 4QIWD 5LXYA 1F9HA 1TL1B 2HRUA 4FKXA 3BS9A 2HQFA 1JLEA 4ID5B 3VAMA 3QAUA 3F56A 1F3VA 2HURA 1FVQA 2BABA 5G4DA 3LGHA 3SV4A 3JYTB 1HWLA 4IG0B 2JFKA 2NXUA 2C2EA 1FF2A 4ALZA 4K0KF 1RJJA 2DGWA 1CC8A 2HFZA 2R7RA 2W2OP 3BPDA 5KFIA 3R1LA 4GC7A 3CC7S 1TTHB 3NBPA 4Q45A 1WTFA 3R2CJ 1UTAA 1P27B 1YX2A 1N6QA 3MUVP 3R6GB 5J1EA 3HVWA 4IR9A 1WACA 2VPZB 2EXUA 3FRZA 1IBMF 2ZUGA 5KFYA 2KZMA 3KLEA 2QG9B 1R8PA 2DPIA 1RU2A 1FJGJ 1NMEB 1HBNA 2HBRB 4NLOA 5KG4A 4N77A 1QUVA 2HLTA 3BR8A 4K4VA 4ATNA 1HWIA 2W8KA 3FNNA 2VPWB 3DRPB 1UEUA 5CYMB 1NKCA 4RW8B 3UDEA 1S1XA 2DNKA 1R31A 1N32F 2KDOA 2I9SA 1GAOA 2CNNB 3HF5A 2QE5A 4CQ1A 5THWA 1QAXA 2HLUA 2XMAA 4EBCA 2GO8A 2J9DE 1WHYA 1K0TA 1HYSA 2ROGA 3FDSA 4P2XA 3CD7A 1NEEA 3MR2A 4ICLA 3NWGA 4ZIVA 2RB7A 1WJ9A 2QLFB 3K57A 1X5SA 1JLBA 2R7OA 3HULA 2V34A 3CCJS 4DF8A 1QVFR 2KO1A 3HD2A 2W9CB 4DL6A 4F7VA 3PW5A 4JB8B 4JI2F 3BDPA 1OO0B 1QAJA 2M3DA 3RBDA 3GB0A 5GAEU 1NHVA 2A2DA 3PG9A 5HBMA 2XBPA 4ENOA 5K8NA 5KFPA 2MB0B 3R5AA 1SCJB 1N56A 3AD8C 3M8ZA 4C8ZA 3ULHA 3H5SA 4C6AA 1JLCA 1BXNA 4OX9F 2GS8A 3QO9B 4PWDA 1TP7A 4DR2J 4RNOA 2U2FA 4PEOA 2Z58B 3HJVA 1U0SA 3PR4A 3M9MB 4G1QA 4J91A 4GVBA 3ONQA 1ZH5A 3HKWA 4MKAA 3T19A 3AHPA 2JFDA 3OL8A 3BB5A 1LOUA 5B0BA 2FHJA 1CULA 5KG1A 4O3NA 5LMNJ 2GQCA 4LRFA 1S1XB 2BM1A 3BBCA 4ILMA 3LANA 1SC1B 2J6SA 5KFVA 2MKYA 3W9JA 4QR2A 3E3XA 4DSFA 2L48A 3P3DA 3I9ZA 1D09B 3TOQA 3M2RA 1KLMB 1RWOB 2MLYA 1GK8A 3KLFA 3KLHB 1DARA 2BRKA 4F3MA 3IGVA 1QSYA 1FRJA 1EETA 2DRBA 3THVA 5F8GA 1UVIA 1RB0A 3LTOA 4NX9A 2UVWA 5KOXA 4KHMA 2D7SA 5H1SV 1RHJB 3ZZRA 1FDNA 3P45B 4G6VB 1FK9B 2QSWA 5T14A 2FY1A 1JLCB 4FNIA 3CC4S 1X5TA 1O5JA 3PX6A 4K4TA 2B3TB 3ZC4A 4O44A 2YWWA 3BBFA 4DHVA 3AJ2A 4TQRA 4G1QB 4K59A 3UD5A 3M8QA 1XNQF 2FLPA 3RGIA 4ANCA 2OPRA 1U1KA 3W2WA 1T9TA 3IC1A 3KDNA 5KFEA 3ITHB 3G6VA 4KYZA 1C1CB 4RR5A 4DG1A 3BQ1A 1NJYA 1VRTA 3AFGA 4Y00A 3R5BA 1FRMA 2NXNA 2F8MA 3D6FB 3DOKB 5I3QA 1RKIA 2M5YA 2FVRA 3LAKA 4KJIA 1VQYA 3MECA 4ZP6A 3M6XA 3PACA 3AJ1A 1TUGB 5A8KB 4M5GA 4DFKA 1EETB 3KK1A 2AJQA 1UVKA 4OZJA 5DLFA 4WJBA 1F3FA 3HHEA 4NLVA 3UWTA 3U1LA 1JLFA 5E3AA 4V19J 2YKOA 1HL6A 4OZ0A 2RHSB 1HHQA 1A0OB 1GX5A 1ELOA 1SQEA 1EKSA 4XAKA 2B8PA 3CJ4A 1SJ1A 3CEDA 3NY0A 1P9YA 3QSIA 1FCAA 2PN6A 4KIAA 2VDHA 2Y1IA 1S1TB 4I69A 1XBWA 2W2MP 4X66F 3VZHA 2E7XA 1M1HA 3DU6A 2ZC4A 3KHHA 4K4UA 1CC7A 4DZ6A 3OFEA 1N34F 1PILA 3ILOA 3W66A 1SQGA 3GFYA 2ATLA 1FNMA 2B6AA 3MPVA 3W2WB 3FCWA 2H5IB 3TAPA 4B3TJ 3UW1A 4DG1B 3H4BA 1I94F 5KFHA 2IYIA 5D3GA 1FKOA 2R7SA 1S9GA 1XR5A 4W92B 2DNNA 5EUHA 2ZE2A 2GAGC 2ZD1B 3QYYA 4I2QA 2YWGA 2DNOA 4HI2A 3H42A 3PIOQ 3ET6B 3OXLA 2C3MA 2APOA 2GMLA 3I5AA 4LF4J 4L73A 1YRUA 3TVKA 1LWFB 3D3BJ 1JLFB 4FF2A 2COLA 3N9UC 4B9VA 2UUBF 2XYGB 3EZ5A 1J27A 1NBEB 4WFNQ 1HW9A 4FDFA 1UA0A 1UVJA 1WOOA 2UP1A 2YXLA 3DLLQ 2E29A 4PG4A 5DZ7A 2UUCJ 4CO0A 3ZTQA 2MSSA 1UWBA 5IV3A 2XSJA 2B51A 3CCES 4DQQA 3IO1A 2HIYA 1HI8A 3PRDA 3DLHA 3SSRA 2VUGA 2DK2A 2LDYA 1FXLA 2OIHA 5KFOA 4DR5F 4IOAQ 4NEYA 1XMQF 3CMAS 2F5GA 1FKOB 5KFUA 4WKYA 4DR3J 5T7LB 2KH9A 5LT5A 2Y1LB 2MQNA 1MROB 2IMOA 4I2QB 1D8YA 1VJQA 2ZWPA 4DX6A 1ZAWA 2Q6BA 2N7YA 3TI0A 1HD1A 1REVB 2JC1A 1R0BG 1KONA 8AT1B 3K7RA 4F2SA 2KG1A 3A8EA 3OJSA 2SXLA 2NSBA 2DBBA 3H2VE 4F4XA 4G1PA 2I38A 4J9MA 1G3OA 4Q44A 4IFYB 4FXWA 4M94A 2JOQA 4ECSA 1OJ4A 2YPYA 4NEZA 3JXOA 3FEYB 2PFDA 4LVNP 4ZHRA 5L1IA 2PSZA 1P1LA 1FESA 3R9LA 3EGVA 4NPOA 5AE1A 3D0IE 1HNIA 1S10A 2C2RA 1VBXA 4RNHA 3AT1B 2CUYA 1UWBB 3M9NB 2KTQA 3T1HF 2ZBCA 1CJVA 2L9NA 1QDUB 3BO2A 2V50A 4DUTA 1K1SA 2YKAA 4PCQA 2G1DA 1VYAA 1RWPB 2RRNA 2IY5B 4JV1A 2K1RB 3RW6A 4HT7A 4WF9Q 3ICLA 5IQQA 2HK2A 2R42A 2KU7A 4NI2B 4DPXA 3LGNA 1TFYA 4FYDA 4I2PA 2C3OA 3KG4A 4XTTA 4MIBA 2BKPA 2A1BA 1JXEA 2RAQA 2WRMA 4GRSA 4DV6J 2X1BA 2K3KA 4F4KA 3IRXB 3N28A 4ZPAA 3ZTOA 3DKDA 2BJ1A 2NR0A 2R8KA 2RU3A 2WW4A 5HQMA 2GZOA 3U1MA 1ZZNA 2ALZA 3T5LA 2KFZA 4Z7YA 2RF2A 3V2UC 2OTJS 3M6VA 2DEJA 4IYQA 2IJFA 4FXDA 3JTOA 3EM1A 1NHKL 3UNYA 1LV5A 2NS1B 2V2ZA 4XK8C 2HHVA 4KAIA 4ZVTB 2B5JB 4EI2A 2W7AA 1N0UA 4X4NA 4UT4A 1RAHB 4PYDA 1NDPA 1NK5A 1H7WA 3OTBA 1RAFB 1TR0A 5F3ZA 2N82B 1CJVB 1O8BA 4MFBA 2ZJRQ 3ISZA 4NCGA 5EWFA 1T03A 1YK9A 5BJRA 5CZVA 3ENQA 3HHKA 4KE5A 2HHHF 2C2NA 3GYGA 1TKZA 3GMGA 1EB0A 3HZGA 1VCTA 2VG6B 4GMKA 2Q3PA 5A0YB 4LF5F 4ZLJA 2J0SD 1QE1B 4XDCA 5KOWA 2CZ4A 4U9RA 3TJAA 2MQ8A 1MMLA 4KGKA 4LSZB 3TA0A 3LQVA 3NS5A 2KB2A 4NASA 4P75A 3DRRB 1DY3A
chains in the Genus database with same CATH topology
3C16B 1CJTB 1Y11A 4CLLA 4OYXA 4P2XA 3MAAA 4OYZA 3MR7A 1TL7A 1CULA 1WC1A 4OYAA 4CLWA 3C14B 1CJVA 4OYBA 4OYIA 4OZ3A 5D0EA 4USTA 3ET6B 1U0HA 4CM0A 1CJKA 3G82A 4USWA 4CLPA 1AZSB 5D0GA 4OYPA 4CLFA 2WZ1A 4P2FA 1YBTA 1WC5A 2GVZA 1CS4B 4CLZA 1CJUB 1TL7B 1WC0A 1WC6A 1CJVB 1FX4A 2QV6A 4CLSA 3R5GA 1FX2A 2GVDB 4CLTA 3C15B 1CJKB 2W01A 4NI2B 4OZ2A 5D0RA 1AB8A 4OYMA 3C16A 1YK9A 1CJTA 3UVJB 4USUA 4CLYA 4WP8A 3MAAB 4WPAA 1CULB 3C14A 5D15A 4OYOA 3ET6A 1U0HB 1AZSA 3G82B 4OYWA 1Y10A 1WC4A 5IV3A 1CS4A 2GVZB 5D0HA 1CJUA 2BW7A 4CLUA 5IV4A 4CM2A 4WP9A 2GVDA 3C15A 4NI2A 4USVA 1WC3A 4CLKA 4P2MA 4WP3A 1YBUA 3UVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C16 B;  1CJT B;  1Y11 A;  4CLL A;  4OYX A;  4P2X A;  3MAA A;  4OYZ A;  3MR7 A;  1TL7 A;  1CUL A;  1WC1 A;  4OYA A;  4CLW A;  3C14 B;  1CJV A;  4OYB A;  4OYI A;  4OZ3 A;  5D0E A;  4UST A;  3ET6 B;  1U0H A;  4CM0 A;  1CJK A;  3G82 A;  4USW A;  4CLP A;  1AZS B;  5D0G A;  4OYP A;  4CLF A;  2WZ1 A;  4P2F A;  1YBT A;  1WC5 A;  2GVZ A;  1CS4 B;  4CLZ A;  1CJU B;  1TL7 B;  1WC0 A;  1WC6 A;  1CJV B;  1FX4 A;  2QV6 A;  4CLS A;  3R5G A;  1FX2 A;  2GVD B;  4CLT A;  3C15 B;  1CJK B;  2W01 A;  4NI2 B;  4OZ2 A;  5D0R A;  1AB8 A;  4OYM A;  3C16 A;  1YK9 A;  1CJT A;  3UVJ B;  4USU A;  4CLY A;  4WP8 A;  3MAA B;  4WPA A;  1CUL B;  3C14 A;  5D15 A;  4OYO A;  3ET6 A;  1U0H B;  1AZS A;  3G82 B;  4OYW A;  1Y10 A;  1WC4 A;  5IV3 A;  1CS4 A;  2GVZ B;  5D0H A;  1CJU A;  2BW7 A;  4CLU A;  5IV4 A;  4CM2 A;  4WP9 A;  2GVD A;  3C15 A;  4NI2 A;  4USV A;  1WC3 A;  4CLK A;  4P2M A;  4WP3 A;  1YBU A;  3UVJ A; 
#chains in the Genus database with same CATH topology
 2BVZ A;  9ATC B;  2CVI A;  4YQW A;  2OEL A;  4P74 A;  3POT A;  3NNC A;  4JP8 A;  4X4R A;  4CWB A;  2WSC C;  1PG5 B;  2IRX A;  4URS A;  1CJK A;  1UMJ A;  3ISN D;  5KFR A;  4QCL A;  5D0G A;  3TJ8 A;  1JXL A;  3NCP A;  5KFQ A;  4I7F A;  1YJU A;  2CVE A;  3DCA A;  1RGV A;  2J76 E;  4F0M A;  2E5L F;  3DLG B;  4DEZ A;  1AT1 B;  3VAJ A;  5KFT A;  3R7S B;  2ASY A;  4DS5 A;  3M2U B;  1URN A;  2ZHA A;  2H4Y B;  3LP0 A;  3H4D A;  5KTQ A;  1HI0 P;  1XR7 A;  4ZJO A;  2YNF A;  3SFG A;  1HNW J;  2CQC A;  2RQK A;  4ZPB A;  3PJW A;  5ETR A;  3GFX A;  4Q8F A;  4DR7 F;  4NXM F;  3BKT A;  3PW4 A;  1U0H B;  4ECZ A;  2ASD A;  4HVZ A;  4NCG B;  5ETL A;  1PYS B;  3UN5 A;  6FD1 A;  3LPE A;  3MMJ A;  1DZ5 A;  3C6U B;  3MUM P;  3DOM A;  4CYU A;  3TQ1 A;  4X4U A;  2H9Z A;  4DUY F;  2HFS A;  3T1Y J;  5HP1 A;  4LF1 A;  3ZTR A;  5LOQ A;  5K8M A;  2IAJ A;  3OTO F;  5I42 A;  4FPR A;  1RT2 A;  3ZTS A;  2QTW A;  4ZVO B;  4KR0 B;  2W24 A;  3IN5 A;  2ASL A;  5DM7 Q;  3PM9 A;  3PXG a;  3BYP A;  4M63 A;  3CCW A;  4JUZ A;  3D6M B;  5DO2 A;  4ZVS B;  1UCN A;  1LW0 A;  1CS4 B;  4YY3 J;  1W2B R;  2L9W A;  3POT B;  2DR5 A;  2PFF B;  1CJK B;  4NML A;  4B3S J;  2BAN A;  4DQI A;  5BXI A;  1AB8 A;  4DSI A;  3UR3 C;  5IT9 Y;  2ZH3 A;  4OJG A;  4I7F B;  3HSZ A;  5DZ6 A;  3CMQ A;  4TY9 A;  3QAE A;  2IVY A;  4KV8 A;  3MOZ A;  1JK9 B;  2YNF B;  5DQI A;  2PMW A;  3I6P A;  1PYT A;  4HDH A;  2CNO B;  4DU8 A;  4ZMM A;  4X65 J;  3TAR A;  2C2D A;  1U45 A;  1G6B A;  2KM8 B;  3T9N A;  1S7H A;  2RQM A;  2PEB A;  3JSY A;  2UXD F;  1WC3 A;  3MMA B;  5EN1 A;  3RB0 A;  3J80 U;  4ZP8 A;  1HNV A;  5KG7 A;  4JI8 F;  3L7O A;  4UZB A;  3PJ9 A;  2HRY A;  4FPI A;  1WC1 A;  1HNX F;  2HQG A;  1FER A;  4OYI A;  3RBX A;  1M5H A;  5F8L A;  3S6E A;  3VCD A;  3L9Z A;  1FA0 A;  3S7R A;  3R6L B;  1RT2 B;  1IVZ A;  3EDQ B;  3JAM U;  4JI6 J;  2JH3 A;  1V5I B;  3P8B B;  3K89 A;  1RT5 A;  2FLO A;  1HFE L;  4NRT A;  4M5M A;  2AZ1 A;  1IQZ A;  5D0R A;  5GMK a;  4WKR A;  3MCO A;  4AQY J;  2XMM A;  2E1A A;  1GXL A;  4NLR A;  5DDQ C;  3IAM 9;  5F3T A;  1IKW A;  1JKH A;  2CQ2 A;  3L7P A;  2M88 A;  4QYR A;  3CJS A;  4M8L A;  3TZY A;  4C97 A;  2HHT A;  2BAN B;  8RUC A;  5E41 A;  1IJE B;  2YY3 A;  5C25 B;  3S01 A;  3DGP A;  1VGY A;  2JEI A;  3V6D B;  1SV5 A;  1S1W A;  4HDG A;  3FSY A;  4K8R A;  4BHQ A;  4TU9 A;  1Q8B A;  1MN9 A;  1S9F A;  4JYA J;  3QPI A;  3CJ2 A;  2FC9 A;  1SBR A;  3GII A;  4Y2A A;  3CJK A;  3WHI A;  2BE2 A;  2VZ9 A;  3LWM A;  4ZS6 A;  1ZS6 A;  2I0X A;  1H3D A;  5FDL A;  4UY8 T;  1IBL F;  2CZV C;  3GR0 A;  1VFJ A;  4IRD A;  2D41 A;  4Y65 A;  2WON B;  1HBO B;  2ZH5 A;  4ECW A;  1P6T A;  5GAD I;  4NLT A;  1N5T A;  3IG1 A;  2ZWO A;  5JXS A;  1VR6 A;  2AJ2 A;  3ENA A;  1U4B A;  3AB4 B;  1SJR A;  3MMB B;  2MZT A;  3EZU A;  5G0R A;  2YBV A;  4J90 A;  4WYW A;  4ZCM A;  1Q5Y A;  4DFM A;  1KSP A;  5I3P A;  1K73 T;  1Y10 A;  4EZ6 A;  1IBK J;  3PO4 A;  1UPP A;  1B7Y B;  4KGV B;  2WOM A;  4H4O B;  2C2M B;  4K5R A;  1H2U X;  2DGO A;  4FVM A;  1JKH B;  1RA7 A;  3HD1 A;  3HDS A;  4LBP A;  3GLJ A;  1U24 A;  2HZV A;  2K3I A;  1D1U A;  1YJR A;  4WZM A;  2CG4 A;  3IGN A;  3C16 B;  4NWB A;  1TMM A;  3NLC A;  4LF2 A;  3HHN B;  3IS9 A;  2HHP A;  4RW9 B;  4GKJ J;  3AQO A;  3I4H X;  1SV5 B;  1S1W B;  1UWA A;  5KFL A;  4TKT A;  2VQF J;  2FJW A;  5F9L A;  5DRK A;  4K4X A;  2Z30 B;  3KFW X;  1S77 D;  2HPU A;  1CJU B;  4QOT A;  1QAY A;  4YHH F;  4B9T A;  1RAJ A;  2IHR 1;  4DMZ A;  3OSP A;  3CJK B;  1RT3 B;  4U95 A;  1O0P A;  4FF3 A;  4CZC A;  4DQR A;  4GKK F;  3CIM A;  4EUV A;  5A76 A;  2E9T A;  2VFU A;  5EX0 A;  1RUS A;  1DQ8 A;  4LF9 F;  3MED A;  1XMO F;  3SQO P;  5LJ3 Y;  4QWD A;  5DLG A;  2DIU A;  1UFW A;  3GCW P;  5D0H A;  2G9O A;  1X9S A;  1PCA A;  3TZW A;  4DV0 J;  1WOP A;  4B3O A;  4ZIT A;  1N4L A;  4ER8 A;  2MGZ B;  4U8V A;  3PNI A;  1NK9 A;  4MKV A;  4C0O C;  2WOM B;  2X1G A;  2ZDO A;  3KK3 A;  4PG6 A;  2OJ3 A;  1JLQ A;  3LW5 C;  2E5J A;  5AE3 A;  2N3L A;  5D0E A;  4YB7 A;  3FCH A;  5J2N A;  4TYB A;  4KFB A;  2B4V A;  2VB6 A;  3EGZ A;  5HAO A;  3FK4 A;  4NL5 A;  2MKJ A;  4JI4 F;  1RP5 A;  2DHS A;  2OO4 A;  3IS9 B;  4RBT A;  3FQK A;  4RL1 A;  3SDE A;  2C28 A;  3CDA A;  4BWJ A;  1YWX A;  4YME A;  4LFA F;  4JI3 F;  2XS5 A;  4LFC J;  3DDN A;  3G2X A;  3UDL A;  1Y00 A;  3RUB L;  3Q8Y A;  3GIJ A;  1PKU A;  4ZJQ A;  1GXT A;  1DRZ A;  3MM5 B;  3LP1 B;  3G8S A;  2XMK A;  3R7B B;  1RAI B;  3MF5 A;  4TYA A;  1TKD A;  6AT1 B;  3O44 A;  2BQR A;  1X4D A;  1RZM A;  3DLJ A;  3HT3 A;  1W26 A;  4WE1 A;  2V8G A;  3EWG A;  2VG5 B;  4PWU A;  1UKU A;  2VFV A;  3MEK A;  1T95 A;  1IKV A;  4OV1 A;  3S8S A;  1FO1 A;  2D9O A;  1S72 S;  5D78 A;  3CO0 P;  4B17 A;  4HHH A;  1YTY A;  1RT6 B;  1IKY A;  2GO9 A;  1LXN A;  2XZD B;  4K0K J;  3N5F A;  1YBA A;  4EBD A;  2WB1 D;  3I9V 9;  2CIM A;  4PUO B;  3M30 B;  4M5N A;  1NJX A;  2YVS A;  5H9E K;  2BV3 A;  2JRS A;  3DM2 A;  4JOU A;  4Y2C A;  3LP2 A;  2ZIT A;  1X0F A;  2HHS A;  4UUW A;  4YDX A;  4PAA A;  1OYD A;  2W4D A;  3UCG A;  5J2N B;  1IBM J;  3HSJ A;  4Q0B A;  3AOA A;  2A18 A;  4DQP A;  3HT0 A;  4FS1 A;  1RTH A;  1VC5 A;  3LAM A;  3RYL A;  2KHD A;  3U7J A;  4ECY A;  3SSS A;  1S6U A;  4ZN1 A;  5GAG U;  3VVU A;  1N33 F;  1KS2 A;  2NPF A;  2LU2 A;  2D3O R;  3MCM A;  4UOG A;  1KBR A;  3E51 A;  1N36 F;  3QGG A;  1SL2 A;  3RR7 A;  3NGR A;  4AXI A;  3ENW A;  4CM2 A;  5C2C A;  2FD2 A;  1N32 J;  3C15 A;  2IIH A;  3FBC A;  4UUX A;  4YB1 P;  1GQE A;  2XO6 A;  3FKB A;  3MFH A;  5LL6 d;  1KQS R;  2R2T A;  1K8A T;  1VIO A;  4WE1 B;  4KRW A;  4ZOS A;  3QBC A;  2MLZ A;  1FVS A;  1T05 B;  1IKV B;  3HO1 A;  2OFH X;  2WCX A;  4ZLL A;  1I5O B;  1IKY B;  3Q8P B;  3SCI E;  2OEJ A;  3RBE A;  2HHU A;  2WSF C;  4JI2 J;  5FII A;  3OR2 A;  1H73 A;  1XN9 A;  3HFK A;  2OPQ A;  3LP2 B;  2UUT A;  4K2X A;  5L46 A;  2ZZT A;  1U09 A;  2HZC A;  5CHC B;  4OQJ A;  5KT3 A;  2KN4 A;  1FI4 A;  1HMV B;  4Q0B B;  1S97 A;  3HP6 A;  1VIS A;  4OX9 J;  2AV5 A;  2D3Z A;  4LVO P;  2FB0 A;  2W4P A;  2HGL A;  2VKZ G;  2BW2 A;  1RTH B;  3BGR A;  1DTQ A;  3JSM B;  5I3U B;  5HAT A;  1R7I A;  2HBQ B;  4OL8 A;  3CD6 S;  2EW9 A;  2AGO A;  5ETT A;  3G6Y A;  2VPX B;  4ID8 A;  1EKR A;  4J9P A;  1SUQ B;  5MAO A;  2NSC A;  1B0V A;  5B0D A;  2JLE A;  2Y8Y A;  4DV4 F;  3WIV A;  4ES1 A;  1YBT A;  2HBZ B;  2EK6 A;  1FFG B;  2ZH1 A;  1JLG A;  4DPO A;  1QSL A;  3A8I A;  3GG0 A;  1UZH A;  2B4P A;  2W01 A;  3KMS A;  2B9X A;  5JVH Q;  3W5X A;  2MHN A;  2R7U A;  1B4S A;  2V68 A;  3BGL A;  3PVX A;  4BC7 A;  2K8G A;  1SC6 A;  3Q24 A;  4GC6 A;  5LXR A;  4C3M A;  4FZV A;  3H2L A;  3I0R A;  4A8X A;  2V94 A;  4QWB A;  3TX8 A;  4Y28 C;  4NZ6 A;  4A47 A;  3GV8 B;  3OUY B;  2VJV A;  4CTA B;  5D4L A;  2FHM A;  4OIX A;  1I1G A;  2RML A;  1VC6 A;  3SI8 A;  3SCK E;  5BR8 F;  5B0C A;  1M90 T;  4AFF A;  3ILI A;  3DOL B;  1YI2 S;  2A6M A;  4ECQ A;  1AFJ A;  4URG A;  3GR1 A;  3NS6 A;  4ZVQ B;  4IG3 A;  1DTQ B;  3BGU A;  2QRR A;  4DCP B;  2YNH B;  3OL7 A;  2K06 A;  4C8N A;  1WC5 A;  2XTJ P;  1WKJ A;  3DLE B;  1XNQ J;  5EDW A;  4A8F A;  1X8D A;  2W2Q P;  1SKU B;  3D0G E;  2C3Y A;  2VJU A;  3MMC B;  4RNM A;  3CWJ A;  1WEZ A;  2J0X A;  4OHY A;  1EX8 A;  5J2Q A;  2EVZ A;  1Q78 A;  3A4T A;  3PIP Q;  4WTY A;  3CUN A;  3D0H E;  1FEE A;  4B08 A;  4ZVR B;  1V3R A;  2C2K B;  3VGV A;  5JJB A;  4NA1 A;  1MW7 A;  1FRI A;  2H51 B;  1S1U A;  3PEH A;  3F73 A;  1XK8 A;  2CWK A;  1S6P A;  5ETQ A;  1YVF A;  4DPU A;  2ZH9 A;  4RU9 A;  1RIS A;  5CYQ A;  1ZPV A;  2ZDP A;  4EBE A;  2AIR B;  3MEE A;  4CLK A;  5E3C A;  3Q22 A;  1LWE B;  2YQ1 A;  3N79 A;  3RRK A;  2EG2 A;  4LSL B;  4USK A;  2IC3 B;  1U8S A;  2KM8 C;  1BC6 A;  5A8R B;  4CLW A;  4K7Q A;  4DL0 C;  1LFW A;  4QBU A;  4V1A k;  1RWK B;  4ED3 A;  2WHO A;  5K14 B;  2WK4 A;  1QJH A;  1BQN A;  3R5J B;  3QJP A;  4Z37 A;  2WZ1 A;  4ECR A;  3G8Q A;  1YRT A;  1S9E A;  1OY6 A;  1S76 D;  1QAI A;  3GQC A;  2LP4 A;  1RE1 B;  1NDK A;  2B8Q A;  4RBV A;  4E0D A;  3BR9 A;  4X66 J;  2HVE A;  3I5C A;  3KJV A;  1HNZ F;  3BZQ A;  3CW2 C;  2B7C B;  1YJV A;  2I6W A;  2CPF A;  4MTP A;  2OUG A;  1N34 J;  2Q66 A;  5KT6 A;  1BMQ B;  2Z8Q A;  1GMW D;  1S1V B;  3IWL A;  2IBO A;  4U8Y A;  4DCO B;  2UVV A;  2GJ2 A;  2QFI A;  4DR4 F;  1U49 A;  3C19 A;  1HAR A;  4DUZ F;  3OR1 A;  1NJI T;  5J2Q B;  2F4V F;  1HLW A;  1I94 J;  1ZM4 A;  4O3O A;  1SQF A;  2VBZ A;  2R7X A;  2B43 A;  4ILL A;  3K8W A;  1TUW A;  4B9N A;  1D3W A;  5ADZ A;  3C46 A;  4ZP7 A;  2L41 A;  3J7Y U;  1MWZ A;  1F5B A;  3VV2 B;  2RD5 C;  4P52 A;  2FVS A;  1XR6 A;  3M6U A;  2E5I A;  4MT1 A;  4I68 A;  2JEG A;  3MEE B;  1S59 A;  5DDO C;  3MM8 A;  1N5Y B;  4EFA C;  1KDN A;  3RAX A;  4OI0 A;  3N6M A;  4O4G A;  3EGN A;  4MK9 A;  3BF4 A;  3MAQ A;  4XPC A;  1BQN B;  4ZK7 M;  1KTQ A;  4TY8 A;  3KHR A;  2QLX A;  2G0I A;  4CP5 A;  4YFU A;  4LFB F;  3OBI A;  1UEV A;  2WW8 A;  2XQC A;  4M5L A;  2NZ4 A;  1FWP A;  3KJV B;  3L4B C;  2ILY A;  1R89 A;  2QYG A;  1XNR J;  5CZX A;  3SBM A;  3W7B A;  1RBA A;  4DSK A;  2XLK A;  2YWF A;  3CE8 A;  2MST A;  1AFI A;  2GIR A;  4IH6 A;  3R5D A;  4DR5 J;  1XMQ J;  2G2Z A;  2DNM A;  3CDU A;  3C14 B;  4FNH A;  2VAS A;  2BX6 A;  4IRC A;  3DYA A;  1CQN A;  5KFK A;  4USW A;  3W61 A;  3B6B A;  2KI2 A;  1M5K C;  1TEL A;  4PXE A;  4S0M A;  3MTJ A;  3TO8 A;  1HWJ A;  3VAF A;  3GZ7 A;  2XGQ A;  1PAU B;  1X7V A;  2PMH A;  4KGX B;  4BWM A;  3TAN A;  3NS7 B;  4YP3 A;  3IP0 A;  5KFA A;  2XY5 A;  2RKI B;  3NCR A;  2QFJ A;  4ECT A;  1N48 A;  2OML A;  3W62 A;  3TRG A;  1E6Y A;  1CVJ A;  1OPI A;  4O4G B;  4ED4 A;  1NSK L;  2X3D A;  3NGU A;  3H40 A;  5HRO A;  4J37 A;  3QFW A;  4JI0 F;  4OI6 A;  4TY8 B;  4KKO A;  2LQB A;  2BE7 D;  2CNL B;  2AX1 A;  3L09 A;  3MAH A;  4OZ1 A;  3U27 A;  4PYA A;  4KO0 B;  4OYX A;  4NYO A;  2W2N P;  1MLA A;  3T1H J;  4LRD A;  4HEA 9;  3FVY A;  2MZJ A;  2YH1 A;  1LK5 A;  3GFH A;  1KC8 T;  2IM1 A;  2RSQ A;  2DNZ A;  3MXH P;  4F50 A;  2VA3 A;  4AL5 A;  7AT1 B;  1UJ6 A;  3E01 A;  1ZYQ A;  4A4J A;  1FX4 A;  2QV6 A;  3HVR A;  2ROE A;  3SFU A;  4RU2 A;  2BA9 A;  3M32 A;  4M5D B;  4CNY A;  1F6T A;  1S49 A;  1TU0 B;  2DB1 A;  4LJM A;  2EFO A;  4G65 A;  1X4G A;  1K0V A;  2YQ3 A;  2A6O A;  3GSI A;  1OY9 A;  1IXK A;  2VD3 A;  1R43 A;  3FQL A;  3I87 A;  2GJI A;  4C7Q A;  3H5U A;  1BQX A;  2BYC A;  3QRP A;  3NOC A;  2OAU A;  2Q43 A;  3Q23 A;  1T9Y A;  5AE2 A;  2KXH A;  1ZM3 A;  2AP6 A;  4U67 Q;  3BSO A;  2AX0 A;  3EXY A;  2BKN A;  4E2F B;  2LLZ A;  3QGH A;  3TUZ C;  4A8K A;  2ZH7 A;  1CQM A;  4I64 A;  3RZA A;  2DR8 A;  1M1K T;  2GHP A;  3MCN A;  2EK1 A;  4ZPD A;  2RIL A;  2KVQ E;  2AU0 A;  3B4M A;  2KJV A;  1U48 A;  4F2R A;  4RUB A;  4UZC A;  1C4C A;  3QAT A;  4Y2I A;  1N52 B;  2CJY B;  3M2V A;  4AYB D;  5HSP A;  1APS A;  4L75 A;  4ES2 A;  1ZM9 A;  2DGU A;  1PGZ A;  4TU8 A;  4DL4 A;  2QZ8 A;  3GIR A;  1WDT A;  4NLY A;  3FZB A;  2XO7 A;  1WF1 A;  2ZBP A;  2H54 B;  1TL4 A;  1WI8 A;  4WU2 A;  2VV5 A;  2H4W B;  4LF5 J;  3JB9 k;  2O5D A;  1VQL S;  2EG1 A;  4CO2 A;  3P4U B;  1LNQ A;  1VHF A;  2HKE A;  3H59 A;  2JHE A;  5JMN A;  5IQ6 A;  3FUY A;  1U02 A;  2AKW B;  3SQG A;  3CCZ A;  5J2P B;  5A8W A;  5L9X A;  4QR0 A;  3QIP A;  2QEX S;  4MMO A;  1Y0H A;  3HHL D;  4OHX A;  2LKZ A;  2LQ8 A;  1ICE B;  5DDR C;  4OYP A;  2XY6 A;  4IQM A;  1MMN A;  1WG1 A;  1NPK A;  4RW4 A;  2E5L J;  1Q95 G;  3DRS A;  1IR0 A;  4K50 A;  8ATC B;  2GVD B;  1EP4 B;  2ZHO A;  3A13 A;  2V9K A;  2OGU A;  2KRB A;  2VOO A;  4FP9 A;  3AOC A;  1SH2 A;  4RUA A;  1PIE A;  4L72 B;  2AEJ A;  3NMA A;  5KFF A;  3GJQ B;  1RTI A;  4DR7 J;  2DYA A;  4NXM J;  2M8H A;  1SPB P;  4KH0 B;  1NK0 A;  2DY9 A;  2CA9 A;  3R7N B;  2MZ1 A;  4PPD A;  2R3V A;  3Q2S C;  2RQC A;  1HWU A;  2FDN A;  2NPI A;  3N6L A;  1L3T A;  4UW2 A;  2VQE F;  1FJE B;  1AUD A;  4Y2K A;  4DUY J;  1MN7 A;  2HG4 A;  3KKF A;  3DXS X;  2HEK A;  2ERR A;  5B09 A;  2FLN A;  3EUN A;  2VL1 A;  3ZZO A;  1NKB A;  3OTO J;  2D1C A;  1QLN A;  2CAD A;  4AD6 A;  3WZ0 A;  4OYZ A;  4H4M A;  5KG3 A;  1KVJ A;  4CM0 A;  2MKI A;  2DGV A;  1R8H A;  1UET A;  5KG5 A;  4Y3C A;  3SQG B;  3CF5 Q;  5A8W B;  3G96 A;  3ZXW A;  3WQP A;  4ID5 A;  2YKN B;  5L38 A;  1UZD A;  1SIZ A;  4IFV A;  2CPI A;  2MKK A;  2B0G A;  2ZZN A;  4N8O A;  2V63 A;  1LFP A;  1J5O B;  2H3E B;  3TUP A;  3V6J A;  4LT6 A;  2YX4 A;  4OI2 A;  2POK A;  1NJW A;  3TAM B;  2DHA A;  3D1Q A;  2HNY B;  5BYR A;  2VFT A;  3FSI A;  2AGQ A;  1VLO A;  1IWG A;  1SH0 A;  2XWY A;  2QC3 A;  5RUB A;  2E1P A;  2Z4P A;  2CPD A;  1UP1 A;  3QLH B;  3FGV A;  3SYZ A;  5KG6 A;  1RTI B;  3PRV A;  4WXW A;  3BYR A;  4IDK B;  3AAW B;  2UXD J;  5F0U A;  4XPE A;  5HLF B;  4N56 A;  1F60 B;  2UV8 A;  5EWE A;  5J2M B;  5CYJ A;  2QJ3 A;  3DI6 B;  3G86 A;  3ISN C;  3D28 A;  3T9Z A;  4OI1 A;  3DRP A;  2LVW A;  2BBE A;  5CYM A;  4UQT A;  4ELV A;  1Y3K A;  3V4M A;  1RT1 B;  5KT2 A;  4DCJ B;  1LXJ A;  3SV3 A;  1R27 B;  1NKE A;  3OFG A;  2HVZ A;  3D9B A;  4IFV B;  2B9Y A;  4RBU A;  2PGC A;  3M6W A;  3GYN A;  3UDV A;  3KG0 A;  1D9A A;  3D4J A;  3M8S A;  2Y3Y A;  5KT4 A;  2W9C A;  1V3Z A;  2J7K A;  3N6N A;  1F0X A;  4FF1 A;  4WP3 A;  3LF0 A;  1VRU A;  1U1Q A;  3H20 A;  5GAH I;  2LEC A;  4K2J A;  3PKM A;  3PJX A;  2NRE A;  3H98 A;  1GMW A;  3EDR B;  1IR1 A;  3D54 A;  2XLJ A;  4EU0 A;  1FWL A;  1GX6 A;  2ZJQ Q;  1IBL J;  1RWV B;  2DH7 A;  2YQ0 A;  3QO9 A;  2XHC A;  1Z2L A;  4CO5 A;  1EQM A;  4IQX A;  4NXN F;  5C42 A;  2P9E A;  2HWH A;  1X4F A;  3UR0 A;  2V4J B;  3OXF A;  4PG7 A;  3A3O B;  3FFI B;  2CQP A;  1MU2 B;  3E2E A;  5I4M A;  1ITP A;  2V67 A;  5KFX A;  3G82 B;  1RWM B;  2XHW A;  3B8H A;  1XIQ A;  3J81 j;  5DET A;  1OIA A;  2YNI B;  2PE8 A;  3L3C A;  1F1B B;  4DDF A;  2RS2 A;  5EX3 A;  1KLM A;  2MTL A;  2V6A A;  1GTH A;  2OMO A;  3KLH A;  2VC1 A;  1VQ6 S;  1QTN B;  2LEA A;  4DPY A;  2LU1 A;  5CXT A;  4ILR A;  2ZBR A;  1HBM B;  1VRU B;  2BJ3 A;  5E33 A;  2Z57 B;  4F0H A;  4WYL A;  3W65 A;  4USH A;  3OTD A;  4YHH J;  2ZKT A;  3T6B A;  5U47 A;  2IM2 A;  3BKU A;  1W7W A;  1FK9 A;  3I82 A;  3V5R A;  4JI7 F;  4J9L A;  4GKK J;  1B99 A;  3BQ2 A;  2CJA A;  4DLG A;  5AT1 B;  3PCO B;  2X51 A;  1GMV A;  4V19 X;  4K5S A;  2FJB B;  3SIP B;  4LF9 J;  1ULR A;  5C42 B;  1XMO J;  3B78 A;  3VAI A;  2R2S A;  4LQ9 A;  2BJ7 A;  2QL9 B;  1S12 A;  1LWC B;  2EPI A;  3HVA A;  1DUR A;  4PG8 A;  3TZX A;  4PR6 A;  5H9F K;  5HO4 A;  5IT0 A;  1VQ4 S;  1O51 A;  4J9U E;  4ZIW A;  3ITH A;  1C0T B;  1AYE A;  4P2M A;  1C1C A;  4JV2 A;  3HLU A;  4P9S A;  1KR4 A;  2HS4 A;  1YQH A;  2E1R A;  2HFV A;  4OYB A;  1HHS A;  3HHD A;  3L7U A;  3DOK A;  5J1P A;  4F4Y A;  3W64 A;  3V81 B;  3KK2 A;  4CLP A;  1RAG B;  2H48 B;  2GC8 A;  1TAQ A;  2XZW A;  4JI4 J;  2F1F A;  3MD3 A;  3TA2 A;  1VK8 A;  3IWX A;  3TUI C;  3MM6 B;  3UDC A;  5CCM A;  4Q2M A;  5A8K A;  4LFA J;  4F67 A;  4JI3 J;  3N4W A;  4RLE A;  1FNX H;  2ZUA A;  3BGO P;  3TAQ A;  1Q5V A;  4LBH A;  2BJ8 A;  1HIY A;  4UQG A;  3QFH A;  3MPW A;  4ZVE A;  2BOA A;  4USU A;  1F2G A;  3MM9 B;  4Q7A A;  3G9C A;  2BAC A;  3R5C A;  2UXB F;  2XCA A;  4QJV A;  3QSY B;  5D15 A;  2HAF A;  1M5P C;  2FTR A;  3VGT A;  1FRK A;  1S5Z A;  1RHQ B;  2NXC A;  4DV1 F;  2RDD A;  3W5Z A;  1HA1 A;  4K4Z A;  1N5V A;  5F0W A;  3QGP A;  1S1T A;  2HHX A;  4CH1 A;  2KG0 A;  3FC9 A;  3THP A;  3GG1 A;  4ECX A;  3NL0 A;  2PI4 A;  3AOD A;  2AJ1 A;  3IR7 B;  1B0T A;  3PYG A;  4OYA A;  2AGP A;  4X4V A;  3KLI B;  3SCJ E;  1YGY A;  2F63 A;  3I96 A;  3DLB A;  2XB2 D;  2RQ4 A;  1ARO P;  1SC4 B;  3OLA A;  1AUS L;  4BDP A;  1RKJ A;  5DJB A;  3NGS A;  1VK3 A;  1YLX A;  1HBU B;  2V2K A;  2PI5 A;  3CME S;  4Y6I A;  1C0U B;  3VAH A;  3C8Y A;  3K5N A;  1SC3 B;  1B70 B;  3KLG B;  4YS2 A;  4LBI A;  3KK2 B;  3KDO A;  3QT7 A;  4OHV A;  3NAI A;  3K5M A;  4KB7 A;  3DNC A;  2ZD1 A;  3UVJ B;  2DO4 A;  4P71 A;  1NAQ A;  3PKY A;  4DL5 A;  2HGM A;  2MZQ A;  3CCQ S;  2HS0 A;  3ET6 A;  4J5O A;  1WD6 A;  1RI7 A;  1N33 J;  4ED2 A;  2X7I A;  2QN6 B;  1N36 J;  2HW3 A;  1LWF A;  1OYE A;  1VQS A;  5KFG A;  1DAX A;  3CJ5 A;  1RHR B;  4Q5V A;  1ZBT A;  2P8I A;  1PBU A;  3UQS A;  3CCL S;  3KUE A;  2QMU B;  4B3R F;  4PKD B;  2RVJ A;  1CJT B;  2HQD A;  5GAE I;  2XI2 A;  2C2O B;  4LRE A;  4ZA1 A;  2VU5 A;  2CPE A;  2RE1 A;  3D68 A;  1B7F A;  4CH0 S;  4QQB A;  4PXC A;  2HMI B;  1NHU A;  1PAE X;  3IAS 9;  1RT7 A;  2QLJ B;  1TKT A;  1KFS A;  2N3O A;  3FSX A;  3O8W A;  1PSD A;  1JXV A;  2DNY A;  4R8U B;  2H65 B;  1IKX B;  3WX4 A;  4F4W A;  1X4E A;  3PZP A;  3FMW A;  3TW0 A;  5J1N A;  5C24 B;  1FT8 A;  4B9M A;  5KFS A;  5T7L A;  1RYS A;  5AJ3 F;  1R6Y A;  5FLX Y;  1NJZ A;  1MRO A;  1UVN A;  4LR8 A;  1LK7 A;  2OPS A;  2FHJ D;  3H8Y A;  1OQ6 A;  3G6X A;  4O4R A;  5ETO A;  1V9O A;  1R0A B;  1U7L A;  1REV A;  3ZZU A;  5IZH A;  1FJ7 A;  3PHE A;  4RKU C;  2UXC J;  3ZTP A;  1DQA A;  2CRL A;  4IFY A;  4HHU A;  2HNZ A;  2HZA A;  4O23 A;  1SJF A;  3DGV A;  1B64 A;  4X62 F;  4DV4 J;  4QWC A;  1M1G A;  2QL5 B;  2CQ1 A;  4MKB A;  3MGJ A;  1KHV A;  3J81 Y;  3R97 A;  3NNA A;  2BMB A;  2RHQ B;  2FUG 9;  3IR5 B;  4O3R A;  3SMZ A;  3I0S B;  1RTZ A;  1RT7 B;  3TJ9 A;  4BC9 A;  1JLA B;  2LQ9 A;  2HQ3 A;  1TKT B;  3OV7 A;  3MCS A;  4ZPC A;  2Z2L A;  2YX7 A;  2AYB A;  2NUH A;  4AUK A;  3UFC X;  1XQI A;  2GCF A;  5E3Q A;  1RAC B;  2KL8 A;  3W1Y C;  3BSC A;  4X4P A;  3K59 A;  4C3K A;  2K1R A;  2J8S A;  3FRY A;  5KFW A;  1CBK A;  4A8Q A;  5BR8 J;  3CDE A;  2DHX A;  2WB4 A;  2MJU A;  3MFI A;  4B02 A;  2ZKU A;  2W2P P;  3HHL B;  4NI2 A;  2RS8 A;  1EJ7 L;  1WTB A;  4A8S A;  1FRX A;  2OPS B;  3CIZ A;  4DV3 F;  3OTC A;  2VBY A;  4K4W A;  3IRX A;  3NP5 A;  4ED7 A;  3TP2 A;  1I6J A;  2I5J B;  4CIO A;  3MDF A;  4FS2 A;  1NH7 A;  4J9R A;  1C2P A;  4ZKA A;  1N0V C;  2GQQ A;  4LR7 A;  2Y9H A;  3CJ8 A;  1VC0 A;  3NG8 A;  2HNZ B;  2FZK B;  3PY8 A;  3GSD A;  2JLF A;  1FWK A;  1NU4 A;  1NB2 A;  1SH3 A;  3IBC B;  4YB5 A;  4F04 B;  4RW6 A;  3P96 A;  2AZ3 A;  4R0E A;  3V4I B;  1TK8 A;  1RCX B;  4ED6 A;  4ED0 A;  3EYZ A;  4FYY B;  5DDP C;  4DSL A;  5DGB A;  1WSV A;  2W9B A;  4MJK A;  1H2V Z;  2GIF A;  1MMD A;  5IM0 A;  2QA1 A;  4KPY A;  2B5J A;  4N47 A;  4I6W A;  2J6U A;  3DU5 A;  3OHA A;  2GMH A;  4DXL A;  3FBF A;  2MQQ A;  3RB4 A;  3M8P A;  4P7T A;  4QYZ K;  4LRA A;  2W1B A;  1JMT A;  4QPX A;  1HHT P;  1S0M A;  1XTZ A;  4TQS A;  3KNG A;  4R25 A;  4JV5 F;  2Z2Z A;  4U7U D;  4UOF A;  2VG6 A;  1S0N A;  1LW2 A;  1AZS B;  3C6T B;  5A0Y A;  3CJR A;  2X3G A;  1QE1 A;  1U25 A;  3ILJ A;  3PX4 A;  4MK8 A;  3ZZ0 A;  4FXV A;  5ITH A;  4GO5 X;  2NXJ A;  4HH0 A;  1VQP S;  1HNZ J;  1J2V A;  3DRR A;  2LA6 A;  5HI7 A;  5F41 A;  3P5T L;  4OHW A;  4F02 A;  5IT9 U;  1KFD A;  3IWN C;  4F4Z A;  4TLQ A;  4DR4 J;  5GAH U;  2QT7 A;  5KFB A;  4DUZ J;  3CUL A;  3UD4 P;  2F4V J;  1VHI A;  2K2P A;  2XMV A;  4RW6 B;  1FTC A;  3GP9 A;  2UV8 G;  3DLG A;  2J0W A;  5KT7 A;  1TQL A;  2PC6 A;  4C8Y A;  3JTP A;  4F26 A;  2XI3 A;  1NDC A;  3Q8V A;  4USI A;  3M2U A;  2W9B B;  2MHE A;  5IM0 B;  5BYS A;  1PC5 A;  5ETK A;  4WBF A;  1VS3 A;  3EVO A;  4C11 B;  1X60 A;  4OFZ A;  1ZAV A;  4EEY A;  4I6A A;  1T9V A;  2HHQ A;  2DH9 A;  1FE0 A;  3PHT A;  4KHP F;  1LWX A;  3M8P B;  4OZ3 A;  1S6Q B;  1H0H B;  1U0H A;  2JL9 A;  3HFZ B;  2O66 A;  1VQN S;  5A6P A;  5L39 A;  4CRJ A;  2Q79 A;  4W90 B;  1ZA2 B;  3D67 A;  3C6U A;  1HPZ A;  1MWY A;  1Q8L A;  4LF6 J;  1SJ4 P;  2M8D B;  3FBB A;  1DLO A;  2KYZ A;  4GKJ F;  2F4F A;  4O0N A;  2DEI A;  2OSQ A;  1Z2Z A;  1IWA A;  1ZET A;  1GXU A;  1LW2 B;  2N4D A;  1NZ8 A;  3Q8S B;  2V69 A;  1G4C A;  1RDR A;  4QW8 A;  1RTJ B;  4LFB J;  3G71 S;  4WFA Q;  4OYO A;  1S4F A;  4AXJ A;  2ACY A;  1Y5L B;  7FDR A;  1U1M A;  1NDL A;  2BKO A;  4KSE B;  2P9G A;  5DQH A;  1WHX A;  2ZH4 A;  1CS4 A;  2GVZ B;  4B3M F;  2J9D A;  4NLS A;  4DR6 F;  2F8E X;  1F5A A;  3GCX P;  3TQE A;  1K9M T;  4QWE A;  1UW9 A;  3DLK B;  5HVF A;  4HTJ A;  2GMJ A;  2JJ4 D;  2J5A A;  4EYI B;  2DXE A;  2DH8 A;  2CJK A;  2XGP A;  4Q2L A;  1N5S A;  1PYO B;  2UUA F;  2GX8 A;  3LWL A;  1S48 A;  4M5H A;  2XLI A;  2ZEJ A;  2DR6 A;  2ZM6 F;  5CCL A;  3WDO A;  3CVK A;  1WOR A;  4LSN A;  3MMA A;  2GHW A;  3AOB A;  4YR2 A;  3GWC A;  3RBZ A;  3QJL A;  1HPZ B;  3MAA B;  5CD4 H;  1DLO B;  1RAD B;  4MK7 A;  5IWA F;  2QMW A;  2DNH A;  2C2Z B;  2EFN A;  5IXU A;  1GFW B;  4D3H A;  4UOC A;  4YN3 B;  1HQE B;  4JI0 J;  4DV2 F;  5BYQ A;  5KFN A;  4WCE Q;  2AEM A;  3ZZZ A;  1E6V B;  1IM6 A;  2E5G A;  2MEW A;  3PV8 A;  1H38 A;  3EE3 A;  1YZ6 A;  1JJ2 R;  1I51 B;  2XG8 A;  4HYK A;  5F8J A;  1AW0 A;  2F3J A;  4ZLN A;  2E9R X;  2VC0 A;  1FKP A;  3W5Y A;  3MOJ B;  4XO0 A;  3BO3 A;  4ELT A;  3W3S A;  2QL7 B;  1K44 A;  5C25 A;  1FFW B;  3BKF A;  1XC9 A;  1RLD A;  3V6D A;  3D6T B;  1AA1 B;  2CQH A;  3NNH A;  2XY7 A;  4EYH B;  3MD1 A;  2OLW A;  2JVR A;  5HJY A;  4KPC A;  4DR1 F;  2XC9 A;  1Q16 B;  2V8D A;  3ZZT A;  2QA2 A;  4DS4 A;  4OX8 A;  3K58 A;  4U7U K;  2OI2 A;  2AEF A;  2VBX A;  3CB4 A;  1Q53 A;  3ZZP A;  2EC0 A;  3T41 A;  4LSN B;  5GME A;  2YWK A;  5HL7 Q;  3M9O B;  1Q86 T;  3PO5 A;  4WIQ A;  1G7C B;  4FVC A;  3KYL A;  1ACM B;  3DHW C;  1TK5 A;  2DD8 S;  2VOP A;  1URR A;  2R7V A;  3F0N A;  2FVP A;  2WON A;  3U02 A;  1HBO A;  3A1Y G;  3K5P A;  3KNA A;  1Z4U A;  4CO4 A;  4F25 A;  2R7W A;  1KTV A;  3RJM B;  3MMB A;  1U1N A;  3QJJ A;  3HKZ D;  2N4C A;  1KLN A;  2JNJ A;  1EAY C;  4NMX A;  3G87 A;  2V9W A;  5AXK A;  3NAH A;  1TKX B;  2XMU A;  3Q0A A;  4I0W A;  4QIG A;  1IJF B;  4H4O A;  5A2Q Y;  4X4T A;  2ATC B;  1TMJ A;  4WFZ A;  1BLU A;  1FKP B;  1JLE B;  4KGM A;  4OX6 A;  4DV7 F;  2EI5 A;  5DS7 A;  3LAL A;  4PRF A;  1R0C B;  3C16 A;  4XIU A;  3X3U A;  2G13 A;  2Z2Y B;  1MWQ A;  2H1Y A;  4IH5 A;  4RW9 A;  1KKH A;  3CJT A;  4ITS A;  1FDA A;  2HGN A;  1FDB A;  2BDP A;  5ETN A;  4HL9 A;  1ZTT A;  2CFX A;  2MY7 A;  2XZT B;  5K20 B;  2V4Q A;  1CJU A;  3NBP B;  2LEP A;  4QZV B;  4AL6 A;  2G2O A;  3DHX A;  4EMD A;  4LIW A;  1N6Q B;  1RT3 A;  4ZVG A;  5J1E B;  2KFN A;  4F3O A;  5D4O A;  3OPK A;  1VMB A;  3OFH A;  2FGO A;  2BJD A;  2EFP A;  1Y4Z B;  2FHK A;  4DZD A;  2BZ2 A;  1TL3 A;  3H25 A;  4AL7 A;  3KLE B;  5IFM A;  3MZI A;  3ELH A;  1A7G E;  4RNF A;  1HBN B;  5CQG A;  3CJ0 A;  2Y0S D;  2MKH A;  1WG4 A;  1JJ4 A;  3BH6 B;  1NRK A;  3G4S S;  4BLG A;  2GQ2 A;  2XMT A;  2ZJP Q;  3CCU S;  1V5V A;  4QIF A;  1VQ7 S;  1CPZ A;  2MGZ A;  2GFF A;  1HYS B;  3GTY X;  1DFD A;  2P5V A;  5ETS A;  1U47 A;  2HBY B;  4ICL B;  4NLG A;  4JI1 F;  3UPF A;  1ZTW A;  1JLB B;  3N5B A;  4X4O A;  5DGA A;  4KH1 B;  2AT1 B;  2VQE J;  3CJ3 A;  4EZ9 A;  3T5J A;  3R2D J;  3T5H A;  3IBW A;  1NZA A;  2AHO B;  3FZ2 A;  1NPR A;  3Q2T C;  2ACM A;  4DSJ A;  4O0I A;  5HBM B;  2XMW A;  1ZOT A;  5DM6 Q;  1JNR B;  2KRR A;  3IFE A;  2WVD A;  3QZ8 A;  1GTE A;  5H9F J;  1H72 C;  1VQ8 S;  1KP6 A;  2I1R A;  3MM5 A;  3LP1 A;  3T5K A;  4ED8 A;  4ZN3 A;  1FNO A;  4EGL A;  3RTV A;  2VA2 A;  3GJR B;  1CEZ A;  4OLP A;  1WEY A;  1NK8 A;  4C8L A;  2VFS A;  3MUR P;  3ZFV A;  1TL3 B;  4PWD B;  2ZOM A;  2VG5 A;  4HLB A;  3UE2 A;  1UVM A;  3KOA A;  2AMC B;  2OFG X;  4GVB B;  1LEO A;  2VPY B;  2AW0 A;  2KT3 A;  3R3T A;  1RT6 A;  2BE9 B;  4C3L A;  3TEH B;  2JLG A;  1CUL B;  3E8O A;  2DY1 A;  3M8R A;  3M30 A;  4PUO A;  5E0O A;  4LF8 J;  1VQ5 S;  4JI5 F;  3EVM A;  2MXY A;  3QWP A;  2FIU A;  1T3N A;  3D2W A;  2RDI A;  1SJ3 P;  5JUM A;  2DXD A;  4DL3 A;  4CH7 A;  3LUY A;  2IDE A;  3RAM A;  3M2R B;  4L3K A;  4DL2 A;  3TEG A;  4HR2 A;  3KLF B;  3V6K A;  4NZ0 A;  3TVY A;  3HSD A;  1Q7Y T;  3LA0 A;  3HHL C;  2BXJ A;  4FYV B;  1NO8 A;  3QRQ A;  1Q79 A;  2ZH6 A;  4WU3 A;  5HVG A;  4P7V A;  5HQL A;  2FC8 A;  4NE9 C;  3OVA A;  2HRT A;  5DG8 A;  2XMJ A;  2WVF A;  1EIY B;  3B82 A;  1VIX A;  3F44 A;  3MI7 X;  2DHG A;  1OY8 A;  4ETX A;  1IQT A;  3OT9 A;  3QNW B;  3A3N B;  4JV0 A;  3PW2 A;  3HVT A;  1S0V A;  4P2S A;  4I4B A;  1T05 A;  4K4Y A;  1SKS A;  4O44 B;  4M95 A;  3QID A;  2HQI A;  5L1J A;  3VTI A;  1WG5 A;  5D8H B;  3M8Q B;  4DI6 A;  3O3L A;  2MJN A;  2PA8 D;  1SB6 A;  1RAB B;  2BW7 A;  1WDD A;  2O67 A;  3ENV A;  4IO9 Q;  5CH7 B;  3P6Y C;  2OPR B;  2MY8 A;  2FJE B;  3RB3 A;  2BQU A;  1S99 A;  4X64 F;  2M0G B;  1IBC B;  1VQK S;  2C22 A;  1VRT B;  2JWN A;  3OQ2 A;  2C42 A;  2VDI A;  5KFC A;  1HMV A;  4P10 A;  1S0O A;  3PYD A;  2PII A;  1K47 A;  3MEC B;  1RHK B;  3GJT B;  4I67 A;  5F8M A;  3JSM A;  3RAQ A;  4NXN J;  1G1X A;  5I3U A;  1F9E B;  1V3S A;  1YIT S;  3KK1 B;  2XYP B;  2RRB A;  2R7T A;  5KT5 A;  1U2F A;  2YPZ A;  2KYX A;  4D3G A;  2ZBQ A;  1KD1 T;  1SUQ A;  1T0T V;  3A8J A;  2ILZ A;  3RW7 A;  3ZNJ 1;  1KEK A;  3AB2 B;  3QT6 A;  2J9E A;  4AND A;  2LCW A;  2IMW P;  2HSE B;  4WWS A;  2W9A A;  3I32 A;  3HVT B;  4OJ1 A;  5L8R C;  2NYI A;  3QQC D;  3HM9 A;  1FTR A;  4DU7 A;  2M4M A;  1DJ0 A;  3AD9 C;  4RW7 A;  2RH3 A;  3JQJ A;  1XNR F;  1JJC B;  4KY3 A;  1EAR A;  1NSP A;  4O3P A;  2B6A B;  3RRH A;  1KNZ A;  3OUY A;  4CLF A;  4MIW A;  4CTA A;  4TXS A;  1TFW A;  1M5V C;  1OPZ A;  3BV8 A;  5D3G B;  2EBG A;  2F40 A;  4GVL A;  1PJ7 A;  2V4R A;  3EXC X;  1S9G B;  3EPG A;  4JI7 J;  2DO0 A;  2ZE2 B;  3VF0 B;  3DOL A;  2V8P A;  5IS2 A;  1Y3J A;  5M2R A;  4MAK A;  4PQU A;  2AWZ A;  1KRP A;  2Q1L A;  2YNH A;  3OXG A;  1WKL A;  3SCL E;  1ZAX A;  3DLE A;  2QMX A;  1VRQ C;  3UD3 P;  5IC4 B;  1X4B A;  3HCX A;  4WP9 A;  4WFY A;  1VQ9 S;  3MMC A;  4QIE A;  2L08 A;  1NK4 A;  2DGQ A;  4DN0 A;  3HX9 A;  4HKQ A;  2OTL S;  2E1C A;  3MM7 A;  2FYX A;  2CPY A;  3W8P A;  1H6K X;  2CPX A;  3VQS A;  2E7V A;  2GGP A;  3QWU A;  3G8T A;  4RW7 B;  2A2C A;  5L1K A;  2XSJ B;  1R8C A;  2MKS A;  3EJM A;  4HTI A;  3OVB A;  2IM0 A;  3I5B A;  1U1P A;  1RCO B;  4PG5 A;  1LWE A;  3FEZ A;  3D66 A;  4LSL A;  2UXB J;  3K5O A;  2VIH A;  1KOO A;  2IC3 A;  4YUD A;  5F8H A;  5B0F A;  2JX2 A;  5A8R A;  3J7Z T;  1RAA B;  2F65 A;  1HR0 F;  1G2E A;  5DQG A;  2CPH A;  4ZVH A;  3I31 A;  5K14 A;  2YKQ A;  4J9N A;  1OWX A;  4DV1 J;  4EO6 A;  1M0S A;  2LQJ A;  2A0F B;  3W63 A;  4WK3 A;  4PQU B;  5D77 A;  4EO8 A;  2G4B A;  4TVA B;  2HFO A;  5ETV A;  5D4N A;  2YX1 A;  1ZPW X;  3UN2 A;  2D9P A;  1FFS B;  4UF4 A;  3UNG C;  1RU1 A;  4URQ U;  4FYX B;  4OI4 A;  1S1V A;  4QYZ J;  2IJR A;  1S6O A;  3DXB A;  2R4F A;  3PDN A;  4CO3 A;  1SL0 A;  2VOD A;  2ZH8 A;  2HWI A;  5KG0 A;  2GW8 A;  2NLW A;  1NK7 A;  4C48 A;  4ZHR B;  5GAG I;  4ZVP B;  3MM7 B;  2OEK A;  4N7T A;  1W2I A;  2K7J A;  2L3M A;  1HNI B;  5ETP A;  2XS7 A;  2D69 A;  2FQQ B;  2GGP B;  2ZNZ A;  1X5O A;  3D1H A;  3N0V A;  2BOP A;  5E5N A;  2MQM A;  3FCV A;  2XS2 A;  3QGI A;  3OW2 R;  4O3Q A;  2Y1R I;  1BY9 A;  4N8N A;  1QVG R;  1N5Y A;  4OI3 A;  2Z56 B;  1N88 A;  1WF2 A;  1WKK A;  1BQM A;  1S57 A;  1T8E A;  2DT9 A;  2HYI B;  4B3R J;  2MQL A;  5EGY A;  1TK0 A;  4DOZ A;  3I55 S;  5ETM A;  4I2P B;  2WBM A;  2HVH A;  3GV7 B;  4OHZ A;  3J7A N;  1FRH A;  1U1R A;  2GAH C;  5B08 A;  1WEL A;  3C2P A;  4YR0 A;  4KQZ A;  3VGU A;  2IVM A;  2JEJ A;  2CQD A;  3MR6 A;  1YJN S;  3M8W A;  4KGZ B;  3PW0 A;  3GE9 A;  5MLC V;  4L76 A;  4C2M A;  2RF2 B;  3Q83 A;  4OZ2 A;  2UU9 F;  9RUB A;  2FJX A;  1X4H A;  2W7P A;  3C14 A;  4C8K A;  3Q89 A;  5AJ3 J;  4OZ5 A;  5D6G A;  2E9Z A;  3WX8 A;  3V6H A;  3IRW P;  2E44 A;  2C3U A;  5LSR A;  4B9U A;  1XJW B;  5DG7 A;  3QT8 A;  4KTQ A;  3CC2 S;  2DR9 A;  5GAD U;  1UFK A;  3MWB A;  4DX7 A;  4MFB B;  2RKI A;  3Q8U A;  3K2Y A;  2CJB A;  3CCV S;  3U1N A;  2Z0G A;  1T03 B;  2O1P A;  3NOG A;  1BUX A;  2ROP A;  1RWW B;  3NRB A;  1BQM B;  4ES3 A;  3BPS P;  4ERD A;  2L9D A;  2UUB J;  4YDD B;  1TKZ B;  4X62 J;  4FF4 A;  2HHW A;  2ZH2 A;  1REG X;  3KG1 A;  2VFR A;  3TZZ A;  2QA4 S;  2HFU A;  5E2Q A;  1U2R A;  2WAQ D;  3KHG A;  4LRB A;  1NND A;  2CJX B;  4R5P A;  4X4Q A;  2DPJ A;  1HW8 A;  2MLX A;  4KO0 A;  4KT0 C;  2DGX A;  4WP8 A;  2BQ3 A;  2DNR A;  2VBW A;  1NH8 A;  4TN2 A;  4LF7 F;  1RWN B;  2CJQ A;  4TU7 A;  2B4O A;  5GVQ A;  1FDD A;  4QU7 A;  3GIK A;  1J5E F;  5M2P A;  2FHO B;  2QIF A;  2EFV A;  2CAJ A;  3DRX A;  5LMU F;  2KT2 A;  3F41 A;  4YB6 A;  1OQ3 A;  5HJX A;  2LMI A;  3Q86 A;  4DPW A;  5L1L A;  1T7P A;  3NKY A;  4M5D A;  2AJ4 A;  2BR0 A;  1YBU A;  3LP0 B;  1UW4 A;  4WXO A;  4DV3 J;  4M1K A;  2ZC3 A;  4X2B A;  4IRK A;  1UJ4 A;  1JB0 C;  2PA3 A;  3R27 A;  1FEH A;  2PMZ D;  3J7Z 5;  4DBQ A;  4IR1 A;  1VQO S;  4B9L A;  1D0E A;  3H5X A;  2Y0B B;  3DOM B;  3K8V A;  4CYU B;  4BCA A;  4DPT A;  3DMJ A;  1FX2 A;  2ADC A;  5LM7 E;  1YHQ S;  4RWX A;  5HP1 B;  6FDR A;  3JQK A;  4ZLP A;  4DV5 F;  3THT A;  2IAJ B;  5I42 B;  4QIV A;  5HMX A;  2BJ9 A;  1BGX T;  4WTO B;  1FE4 A;  2LDI A;  2P2C B;  2U1A A;  4R5P B;  1GNK A;  2FVC A;  1X9M A;  1DHM A;  3KJQ B;  1M5O C;  2RNE A;  4FYW B;  1LW0 B;  5FJ4 A;  3ETM A;  3LPY A;  2CQ3 A;  5DG9 A;  2MYF A;  1TL5 A;  4USV A;  2OH2 A;  4HI1 A;  4I1T A;  1PO6 A;  2CZ9 A;  4CO1 A;  3UO0 A;  2N7C A;  4W98 A;  4AT1 B;  2B7B B;  4JV5 J;  4C8O A;  1RBL A;  4LR9 A;  2MQP A;  1RWX B;  2EBE A;  4KV8 B;  2EEY A;  3AD7 C;  2F9J A;  2H5E A;  1BE4 A;  3GON A;  3EGW B;  3JQM A;  5KFM A;  5C2G A;  4NLW A;  2YNG A;  3CD5 A;  1HNV B;  5J2P A;  3ZNU A;  3OLB A;  3FBE A;  3NXZ A;  2QO3 A;  1Y5I B;  1PJ6 A;  4CDI A;  1FJG F;  5IC6 B;  3Q8Q B;  1Q8K A;  3DMJ B;  1HWK A;  2DNP A;  4IUF A;  1ZZF A;  2HQC A;  2DRA A;  3J7Y I;  2Y1J A;  5HMZ A;  2G2Y A;  4C8M A;  1IM4 A;  4RX6 A;  3CXC R;  2ZFH A;  4QR1 A;  4C0H A;  2DGT A;  1YZ7 A;  4DWI A;  1RT5 B;  3PRB A;  2GVD A;  4AE5 A;  1EP4 A;  2J9C A;  5AXM A;  3SXL A;  4U7C A;  3OFF A;  4TLR A;  1KQG B;  2GJF A;  4IOC Q;  4YR3 A;  3CT9 A;  3KUG A;  4QW9 A;  4PPZ A;  1U2C A;  3PW7 A;  2WVB A;  4QU6 A;  3KLV A;  4KHP J;  4HHJ A;  1IKW B;  3HZE A;  4NZ7 A;  3RRG A;  5M2U A;  1JQG A;  3HJF A;  2HHH J;  2V0N A;  2DVI A;  3BBB A;  4KC5 A;  3DGP B;  4H54 A;  1N5Q A;  2AYM A;  1VBK A;  3D5M A;  1T02 A;  5HMW A;  1ROF A;  2O01 C;  1P8G A;  1XER A;  2QX0 A;  1H7X A;  3Q8R B;  2RT3 A;  3K0J A;  5D4P A;  3L95 X;  2DIT A;  3IXQ A;  5CD4 A;  3KJN B;  1FXR A;  1X4A A;  2FJD B;  3GIL A;  1R3N A;  4C98 A;  2BE2 B;  4X4S A;  1BWE A;  2DIV A;  3PEJ A;  1FD8 A;  4OYW A;  4DLE A;  2YNG B;  4OV6 A;  2CQ4 A;  3KWM A;  2HS3 A;  5FDL B;  4B3M J;  3MR3 A;  2FZG B;  3EVW A;  4NCA A;  4DR6 J;  4NLQ A;  3W9H A;  2YKN A;  2IRU A;  3LH2 S;  5IV4 A;  2YTC A;  1UVL A;  5F8N A;  4DR2 F;  1Q81 T;  3J80 Y;  4I56 A;  2GNK A;  2O3D A;  1M5S A;  2J0Q D;  1J5O A;  3CJQ A;  3B54 A;  5F9N A;  3PFO A;  3IG1 B;  3PTW A;  1C4A A;  4RPF A;  4A46 A;  5LMN F;  3TAM A;  5G0R B;  2HNY A;  4HAC A;  1D8Z A;  3RB6 A;  4UST A;  2UUA J;  3HI9 A;  4ED5 A;  1R8B A;  3OD2 A;  4Z7C A;  4P2F A;  3QLH A;  4Y34 A;  2ZM6 J;  4DF4 A;  2MZS A;  3JAM Y;  3NGD A;  1NXI A;  4LQ3 A;  2B9W A;  3PYF A;  4USM A;  2IBK A;  2M70 A;  1OSD A;  2ADB A;  4IDK A;  1GT8 A;  3CTR A;  1KQK A;  5HLF A;  1YSJ A;  4IO1 A;  3MUT P;  1NCL A;  2IRY A;  2XCP A;  5J2M A;  4WPA A;  2BRL A;  2DIS A;  2JZ5 A;  4ED1 A;  4GO7 X;  3DI6 A;  5L9N A;  2YKP A;  5T41 A;  5IWA J;  1GEH A;  2LFV A;  2UUW A;  4PZV A;  3P49 B;  1GMU A;  2Y8W A;  4DV2 J;  2EWH A;  3R1H A;  1H74 A;  1NSA A;  1X5P A;  5KFD A;  5GMD A;  2XNQ A;  1RQ0 A;  1RT1 A;  4LMZ A;  4FKY A;  4C4W A;  1K1Q A;  5K9F A;  2MMY A;  1B3T A;  4DL7 A;  2FJV A;  1NB7 A;  1XWL A;  1QY7 A;  1OS5 A;  1KVI A;  2LQ5 A;  1HQ2 A;  1Q0N A;  4DJB A;  2DGS A;  4FN5 A;  4WFB Q;  3MED B;  2IM3 A;  3VZI A;  2RIJ A;  2CG8 A;  4PXB A;  4ZCI A;  1KHW A;  3HSG A;  3BO4 A;  2FLL A;  1L3U A;  2DKO B;  1ZA1 B;  1A6L A;  1RBO B;  1WC6 A;  2BM0 A;  4HAC B;  3H5Y A;  4B3O B;  3K17 A;  4W4M A;  2Z2M A;  4XDD A;  4DR1 J;  3NEK A;  5EHH A;  3BEG B;  4WK1 A;  1N54 B;  3OL9 A;  1SVD A;  3KK3 B;  4A8O A;  1Y7P A;  5KG2 A;  3T1A A;  1JLQ B;  4ZPV R;  4UTG A;  3N01 A;  3JSB A;  1WWH A;  1PJ5 A;  2C3P A;  4JI8 J;  2QGF B;  4KFB B;  2OHD A;  3CDB A;  4H4K A;  2I2Y A;  5AXL A;  4N41 A;  1HNX J;  2R2R A;  3VAL A;  3ZZY A;  1WEX A;  3AY0 A;  1IUJ A;  2LXF A;  4M5K A;  2CDQ A;  3VAG A;  3QT5 A;  3SDE B;  2VF3 A;  3RR8 A;  2YKM A;  2NQP A;  4USJ C;  2V4J A;  3FFI A;  3BRE A;  2DNQ A;  1MU2 A;  1RAE B;  7FD1 A;  1YDL A;  2KHC A;  3GFZ A;  4F36 A;  5CAA A;  2R8G A;  1FJC A;  3QRR A;  1SKR A;  1W25 A;  5H9E J;  3PYE A;  4NYZ A;  3G82 A;  4Z2X A;  4UY8 5;  2VG7 A;  5AXN A;  3UCZ P;  4E8U A;  2KXF A;  2ABY A;  1XEZ A;  3NCQ A;  4DSE A;  2KKH A;  1RK8 A;  1OMS A;  4LIR A;  1YJ9 S;  5K5M A;  4I6Y A;  3VR1 A;  2HND A;  2YNI A;  3FJ2 A;  1R6V A;  3GU0 A;  2YWH A;  4X84 A;  3ADA C;  4DV7 J;  3VVT A;  3M05 A;  2EKN A;  4N5S A;  2DCL A;  2MDA A;  4CNZ A;  2RUS A;  3IM8 A;  1TV6 A;  3IR6 B;  1YJT A;  2OP5 A;  2M2B A;  1QUP A;  5IT4 A;  1WHW A;  1RLC L;  1Q4R A;  1HBM A;  2NYH A;  3KUH A;  1WC4 A;  3DM2 B;  4B3T F;  3WBZ A;  2MZR A;  2XWX A;  4J9Q A;  2KXN B;  1SIW B;  1S79 A;  4KBI A;  3AXM A;  1O6X A;  2DRD A;  2UZA A;  4MYU A;  2J8A A;  5HN0 A;  1FKA F;  4P6Q A;  3GYX B;  2DNL A;  3KHL A;  1LWC A;  2YKM B;  2J6T A;  3MEG A;  2DHH A;  3UI3 A;  3D7S B;  4LF4 F;  4CLZ A;  1UEK A;  3CCT A;  3CO9 A;  1KOH A;  1BD6 A;  5K8P A;  2UXC F;  1Y5N B;  1H2T Z;  3IA0 A;  1S7I A;  3UCU P;  4FBT A;  2GA7 A;  3C15 B;  1C0T A;  2W8L A;  2VG7 B;  4CT8 A;  4Y2M A;  3LOU A;  4WII A;  4DX5 A;  1U1L A;  2HND B;  3H0P A;  1VLY A;  1WHV A;  4JI1 J;  2UUC F;  3V81 A;  4YOE A;  5HK4 A;  4A8Y A;  1GH8 A;  2WTF A;  1RTD A;  1DQ9 A;  4O3S A;  5K8O A;  4NLX A;  3MM6 A;  3WC0 A;  2EFG A;  1TV6 B;  2J7U A;  4EWT A;  4FBU A;  3KTQ A;  3OR2 B;  1VDH A;  2RU9 A;  1H98 A;  2YH0 A;  2F7V A;  1NK6 A;  3TVZ A;  3WC2 A;  3MM9 A;  2OPQ B;  4L3N A;  3SEO A;  4CLL A;  3TR5 A;  1CG2 A;  2AD9 A;  1FHT A;  2OKQ A;  4F0K A;  1NPP A;  4DR3 F;  1HQU A;  4J9O A;  1EHW A;  4DN9 A;  4N76 A;  2W25 A;  2KZZ A;  3M8Y A;  3BM7 A;  2KFY A;  3BGR B;  4NA2 A;  2JEF A;  4JBC A;  2DJW A;  5HQ8 A;  3TYT A;  3MEG B;  2OD4 A;  1NSQ A;  4MH8 A;  1P1T A;  1U6B A;  3KLI A;  4JI5 J;  2ZZM A;  1QTM A;  2AYE A;  2X1F A;  5E3R A;  4CCH A;  5FLX U;  4ECU A;  4A48 A;  1MG7 A;  1HBU A;  1JLG B;  2DXF A;  5JVG Q;  2PD1 A;  2OSR A;  4F8R A;  4ZPT R;  5B0E A;  4CLU A;  1C0U A;  2ZHB A;  1F9F A;  4OZN A;  3KLG A;  1RTD B;  1LKZ A;  4YEA A;  2HVI A;  2RDJ A;  1YIJ S;  3UVJ A;  3A8K A;  3ZO7 A;  3NGT A;  1WI6 A;  1F5C A;  1UJ5 A;  4F3Q A;  2VON A;  3VWS A;  1WUU A;  1ZM2 A;  3M7V A;  2LXI A;  2M9K A;  2DNG A;  1C1B A;  3I0R B;  3W9I A;  2VKR A;  2QLB B;  1X4C A;  2CPJ A;  2CQG A;  3C3L A;  3J81 U;  3JS9 A;  2CQ0 A;  1RHU B;  3W2V A;  1HQU B;  3MR5 A;  3DC2 A;  2OEM A;  1A9N B;  2UVU A;  2GIQ A;  1CJT A;  2EC2 A;  1BHN A;  1YRX A;  1EQ0 A;  3SSQ A;  1TZ0 A;  2OD6 A;  4OX7 A;  3NMR A;  2AJF E;  5LSL A;  3D6H B;  2KT5 A;  2KVI A;  4IG3 B;  4DV6 F;  2HWT A;  4E98 A;  1UFL A;  4EK2 A;  4NOH A;  2HMI A;  3O2I A;  3LGM A;  2XNR A;  5A6W A;  4L74 A;  3GPA A;  3A12 A;  1AXQ A;  4ANE A;  5SZT A;  4R8U A;  2NUU G;  5IOL A;  1IKX A;  4U6P A;  3O5T B;  1T9U A;  4NRU A;  3HMJ G;  3KJF B;  3CNQ P;  3EPI A;  3H7H B;  3CCS S;  3D1O A;  5C24 A;  3RG6 A;  3IMQ J;  2LYV A;  4R0J A;  2CPZ A;  4X64 J;  3J7A 1;  3BJY A;  1U6F A;  1VQM S;  4J9K A;  3UN3 A;  3OJU A;  1JX4 A;  2ZOF A;  1XMB A;  5F8I A;  4A8M P;  5E3P A;  1HD0 A;  3EZO A;  4Y0F A;  2DR7 A;  5HVH A;  3HXM A;  2PDA A;  1FRL A;  2R8I A;  1T94 A;  1S1U B;  1UAW A;  3IM9 A;  3GV5 B;  1R0A A;  1RSC A;  1S6P B;  3C66 A;  5HAN A;  2WBR A;  3H90 A;  5CYQ B;  4PQA A;  1C1B B;  3KMQ A;  2XYH B;  2KJW A;  1NM2 A;  3DDK A;  2QSF A;  2V2Q A;  1V6H A;  4LF6 F;  1TVR A;  2PEH A;  1F2H A;  1JIH A;  1YJ7 A;  3BH7 B;  1OSC A;  1FD2 A;  2IA6 A;  2CWX A;  3W2V B;  2EFQ A;  4BS2 A;  4Q43 A;  2G0J A;  2E66 A;  2QLW A;  4ELU A;  1S9E B;  4RO0 A;  3G6E S;  2MQO A;  3TA1 A;  3I0S A;  4ZCK A;  2IFX A;  1IN0 A;  1JLA A;  2E7W A;  3CSK A;  2XM3 A;  3X1L B;  3GJS B;  1RA6 A;  4RJV A;  4RUH A;  2V8V A;  4DQS A;  2NZC A;  4ZDN A;  4UOH A;  4ZJL A;  3S1T A;  4ZVU B;  3DFE A;  3OR1 B;  4PXD A;  2DCU B;  2QA4 G;  3MHY A;  2NCK L;  2ZOG A;  2VH7 A;  5B7W A;  5SUH A;  3EX7 B;  3M1V A;  4CLS A;  3HHL A;  1Z1Z A;  3P5B P;  2RRA A;  1SL1 A;  1T3O A;  3CDW A;  1Q1K A;  4WZQ A;  2B9E A;  4ZP9 A;  1HNW F;  4RZR A;  1KWM A;  3VGS A;  3H2U B;  1QM9 A;  4J9S A;  1JJH A;  4OMF G;  3IBF B;  1VI7 A;  4OJH A;  2G0C A;  2I5J A;  3MM8 B;  3JSR A;  4MYT A;  4P72 A;  2AF6 A;  2BJE A;  2GHV C;  4G1I A;  5KAK A;  2R9L A;  1TVR B;  1WNE A;  1KN6 A;  3T6J A;  3T1Y F;  1UPM B;  2XEX A;  5CAB A;  3CPW R;  3ETO A;  5B0A A;  3HPO A;  2IJN A;  3AXK A;  4KHR A;  2P6T A;  2OPP A;  4ZVF A;  2F8H A;  3EIC A;  3V4I A;  2IPO B;  2JDJ A;  1Q82 T;  1SJQ A;  1BWV A;  1X9W A;  2CXE A;  4CT9 A;  2P9C A;  4M5I A;  4QPT A;  1UL3 A;  2A10 A;  3DN9 A;  4YY3 F;  1U26 A;  1VBY A;  1VBZ A;  1L5U A;  1YKW A;  4B3S F;  1VOM A;  2ZBI A;  2CKW A;  2D74 B;  2CYY A;  1HR0 J;  2M52 A;  2ALY B;  1D9D A;  4ECV A;  4NCB A;  2PO4 A;  3MPU B;  1KVK A;  3M1V B;  4C9D A;  2J7W A;  2VHG A;  3CGI A;  3DYA B;  1AZS A;  3C6T A;  3K5L A;  4ZCL A;  2VIC A;  3B4D A;  4NYP A;  4Q8E A;  4X65 F;  1X31 C;  4P73 A;  4PWW A;  3OSN A;  1B0P A;  2XUL A;  4IKA A;  2B56 A;  4ETZ A;  3TUJ C;  4K4S A;  2UVR A;  4PAB A;  3OTE A;  4OZL A;  4RNN A;  3WIU A;  3CCR S;  3BGF A;  2FGC A;  2MPU A;  1TL7 A;  1E6Y B;  2CJ9 A;  1LQ9 A;  2QYC A;  4TNO A;  1T9W A;  1SKW A;  1T9X A;  1T11 A;  5C7P A;  2LEB A;  5HRO B;  2XSF A;  3OHB A;  3HK2 A;  2EKY A;  1U6Z A;  4MIA A;  2OPP B;  4KKO B;  4JI6 F;  2HAI A;  2I8E A;  3R5G A;  1Q7L B;  5C5J A;  4CLT A;  2WSE C;  1UA1 A;  4C11 A;  4J9V A;  1DTT A;  2R8H A;  3AQP A;  3US5 A;  4NLP A;  4AQY F;  4NA3 A;  2IVF B;  1YJW S;  2MKC A;  2IYG A;  1S6Q A;  1RXO B;  2BUN A;  2K7K A;  1WF0 A;  1RT4 A;  4F4A A;  1MSW D;  3PX0 A;  3D3C J;  2E1M C;  1Q8I A;  2HFN A;  3GIM A;  2HK3 A;  2WVE A;  3AJD A;  3A3P B;  3E01 B;  3BQ0 A;  2V8H A;  4ZPW R;  1N8R T;  3BN7 A;  3M32 B;  4B9S A;  3FEX B;  2B4U A;  3OL6 A;  2JC0 A;  1CLF A;  4JYA F;  4RUC A;  1YG0 A;  2LXU A;  1RTJ A;  3O6Q A;  4QWA A;  3NWR A;  3TWZ A;  1TUV A;  1QD1 A;  3LO3 A;  1VJW A;  1HI1 A;  1L3K A;  4DFP A;  2GVZ A;  2ZVS A;  2R8J A;  4IH7 A;  5KFJ A;  1TL7 B;  5FD1 A;  4C0B A;  4A8W A;  4G3I A;  5CA5 A;  3OVS A;  3W60 A;  2ASJ A;  3VAK A;  3T3F A;  2UU9 J;  2AQ4 A;  2HVD A;  3DLK A;  4OYM A;  4CLY A;  1SXL A;  3NGK A;  2JSX A;  2AYG A;  2R2U A;  2P6S A;  5EWG A;  1NUE A;  4IOB A;  4J7C A;  4OJ3 A;  4LRC A;  1WSR A;  3MTK A;  2M7S A;  4DX8 H;  1RYR A;  3EMT A;  1IBK F;  3KXD A;  1DTT B;  2RJZ A;  3I4P A;  3HFV A;  2WVC A;  4RWW A;  4BBY A;  3W8G A;  1U8W A;  1TAU A;  1R8A A;  2E5H A;  3M2V B;  1RT4 B;  3PFE A;  1SI9 A;  1PBA A;  2W4C A;  4HT5 A;  1Y11 A;  3MAA A;  3VHQ A;  3MR7 A;  4U96 A;  2HIQ A;  2RUG A;  3AA9 A;  1PC4 A;  1RWU A;  2CNK B;  3QMQ A;  5KFZ A;  4M5J A;  2JVO A;  5LSO A;  1CSJ A;  2VQF F;  3QZ7 A;  1RHM B;  1HQE A;  4MKY A;  4H4K C;  3BSN A;  1E6V A;  5A2Q U;  2BEF A;  1MNE A;  2LA4 A;  1WC0 A;  3SZ2 A;  1JNZ B;  3TNV A;  1EZZ B;  1FXD A;  2PT0 A;  4DFJ A;  1TL1 A;  4L6V 3;  3I56 S;  3BN4 A;  2H5J B;  3M4X A;  2FVQ A;  3QIP B;  2C1E B;  3AA8 A;  2X1A A;  3DDI A;  1QSS A;  1P9Q C;  4HH1 A;  4LUB A;  4LF7 J;  3FMB A;  2D3O 1;  3BSA A;  1J5E J;  3ILL A;  2DTJ A;  2AJ0 A;  3JYT A;  3RU0 A;  4IG0 A;  3JTN A;  5LMU J;  4RW4 B;  3CD0 A;  3CCM S;  2W7O A;  2V5H G;  1JWW A;  3DRS B;  4DV0 F;  5HMY A;  1HKA A;  3PR5 B;  4LF8 F;  1I3O B;  2CQI A;  2IDL A;  2Q6C A;  1X0P A;  5B0G A;  2A3J A;  2FY8 A;  1L3V A;  2F9D A;  2FZC B;  2ZVI A;  1DBD A;  1IR2 A;  3DRY A;  3MPY A;  2V2V A;  2FPH X;  3R8Y A;  1S4E A;  2G1H A;  2GV1 A;  2ZNY A;  1RAO A;  3O1L A;  5E7O B;  2YWE A;  3TX0 A;  3BDE A;  1WOS A;  1D9F A;  2IA0 A;  5LJ5 Y;  3AH6 A;  4WFX A;  1L3S A;  4OLO A;  4NLD A;  2D3U A;  2FJA B;  4LFC F;  2R7Q A;  4DV5 J;  4NLU A;  1U1O A;  1NLK L;  3MPD A;  1Y9O A;  4CI0 B;  2CDR B;  4RW8 A;  4H4M B;  1KQF B;  2CQB A;  1TKX A;  2NXE A;  3VQT A;  4QIW D;  5LXY A;  1F9H A;  1TL1 B;  2HRU A;  4FKX A;  3BS9 A;  2HQF A;  1JLE A;  4ID5 B;  3VAM A;  3QAU A;  3F56 A;  1F3V A;  2HUR A;  1FVQ A;  2BAB A;  5G4D A;  3LGH A;  3SV4 A;  3JYT B;  1HWL A;  4IG0 B;  2JFK A;  2NXU A;  2C2E A;  1FF2 A;  4ALZ A;  4K0K F;  1RJJ A;  2DGW A;  1CC8 A;  2HFZ A;  2R7R A;  2W2O P;  3BPD A;  5KFI A;  3R1L A;  4GC7 A;  3CC7 S;  1TTH B;  3NBP A;  4Q45 A;  1WTF A;  3R2C J;  1UTA A;  1P27 B;  1YX2 A;  1N6Q A;  3MUV P;  3R6G B;  5J1E A;  3HVW A;  4IR9 A;  1WAC A;  2VPZ B;  2EXU A;  3FRZ A;  1IBM F;  2ZUG A;  5KFY A;  2KZM A;  3KLE A;  2QG9 B;  1R8P A;  2DPI A;  1RU2 A;  1FJG J;  1NME B;  1HBN A;  2HBR B;  4NLO A;  5KG4 A;  4N77 A;  1QUV A;  2HLT A;  3BR8 A;  4K4V A;  4ATN A;  1HWI A;  2W8K A;  3FNN A;  2VPW B;  3DRP B;  1UEU A;  5CYM B;  1NKC A;  4RW8 B;  3UDE A;  1S1X A;  2DNK A;  1R31 A;  1N32 F;  2KDO A;  2I9S A;  1GAO A;  2CNN B;  3HF5 A;  2QE5 A;  4CQ1 A;  5THW A;  1QAX A;  2HLU A;  2XMA A;  4EBC A;  2GO8 A;  2J9D E;  1WHY A;  1K0T A;  1HYS A;  2ROG A;  3FDS A;  4P2X A;  3CD7 A;  1NEE A;  3MR2 A;  4ICL A;  3NWG A;  4ZIV A;  2RB7 A;  1WJ9 A;  2QLF B;  3K57 A;  1X5S A;  1JLB A;  2R7O A;  3HUL A;  2V34 A;  3CCJ S;  4DF8 A;  1QVF R;  2KO1 A;  3HD2 A;  2W9C B;  4DL6 A;  4F7V A;  3PW5 A;  4JB8 B;  4JI2 F;  3BDP A;  1OO0 B;  1QAJ A;  2M3D A;  3RBD A;  3GB0 A;  5GAE U;  1NHV A;  2A2D A;  3PG9 A;  5HBM A;  2XBP A;  4ENO A;  5K8N A;  5KFP A;  2MB0 B;  3R5A A;  1SCJ B;  1N56 A;  3AD8 C;  3M8Z A;  4C8Z A;  3ULH A;  3H5S A;  4C6A A;  1JLC A;  1BXN A;  4OX9 F;  2GS8 A;  3QO9 B;  4PWD A;  1TP7 A;  4DR2 J;  4RNO A;  2U2F A;  4PEO A;  2Z58 B;  3HJV A;  1U0S A;  3PR4 A;  3M9M B;  4G1Q A;  4J91 A;  4GVB A;  3ONQ A;  1ZH5 A;  3HKW A;  4MKA A;  3T19 A;  3AHP A;  2JFD A;  3OL8 A;  3BB5 A;  1LOU A;  5B0B A;  2FHJ A;  1CUL A;  5KG1 A;  4O3N A;  5LMN J;  2GQC A;  4LRF A;  1S1X B;  2BM1 A;  3BBC A;  4ILM A;  3LAN A;  1SC1 B;  2J6S A;  5KFV A;  2MKY A;  3W9J A;  4QR2 A;  3E3X A;  4DSF A;  2L48 A;  3P3D A;  3I9Z A;  1D09 B;  3TOQ A;  3M2R A;  1KLM B;  1RWO B;  2MLY A;  1GK8 A;  3KLF A;  3KLH B;  1DAR A;  2BRK A;  4F3M A;  3IGV A;  1QSY A;  1FRJ A;  1EET A;  2DRB A;  3THV A;  5F8G A;  1UVI A;  1RB0 A;  3LTO A;  4NX9 A;  2UVW A;  5KOX A;  4KHM A;  2D7S A;  5H1S V;  1RHJ B;  3ZZR A;  1FDN A;  3P45 B;  4G6V B;  1FK9 B;  2QSW A;  5T14 A;  2FY1 A;  1JLC B;  4FNI A;  3CC4 S;  1X5T A;  1O5J A;  3PX6 A;  4K4T A;  2B3T B;  3ZC4 A;  4O44 A;  2YWW A;  3BBF A;  4DHV A;  3AJ2 A;  4TQR A;  4G1Q B;  4K59 A;  3UD5 A;  3M8Q A;  1XNQ F;  2FLP A;  3RGI A;  4ANC A;  2OPR A;  1U1K A;  3W2W A;  1T9T A;  3IC1 A;  3KDN A;  5KFE A;  3ITH B;  3G6V A;  4KYZ A;  1C1C B;  4RR5 A;  4DG1 A;  3BQ1 A;  1NJY A;  1VRT A;  3AFG A;  4Y00 A;  3R5B A;  1FRM A;  2NXN A;  2F8M A;  3D6F B;  3DOK B;  5I3Q A;  1RKI A;  2M5Y A;  2FVR A;  3LAK A;  4KJI A;  1VQY A;  3MEC A;  4ZP6 A;  3M6X A;  3PAC A;  3AJ1 A;  1TUG B;  5A8K B;  4M5G A;  4DFK A;  1EET B;  3KK1 A;  2AJQ A;  1UVK A;  4OZJ A;  5DLF A;  4WJB A;  1F3F A;  3HHE A;  4NLV A;  3UWT A;  3U1L A;  1JLF A;  5E3A A;  4V19 J;  2YKO A;  1HL6 A;  4OZ0 A;  2RHS B;  1HHQ A;  1A0O B;  1GX5 A;  1ELO A;  1SQE A;  1EKS A;  4XAK A;  2B8P A;  3CJ4 A;  1SJ1 A;  3CED A;  3NY0 A;  1P9Y A;  3QSI A;  1FCA A;  2PN6 A;  4KIA A;  2VDH A;  2Y1I A;  1S1T B;  4I69 A;  1XBW A;  2W2M P;  4X66 F;  3VZH A;  2E7X A;  1M1H A;  3DU6 A;  2ZC4 A;  3KHH A;  4K4U A;  1CC7 A;  4DZ6 A;  3OFE A;  1N34 F;  1PIL A;  3ILO A;  3W66 A;  1SQG A;  3GFY A;  2ATL A;  1FNM A;  2B6A A;  3MPV A;  3W2W B;  3FCW A;  2H5I B;  3TAP A;  4B3T J;  3UW1 A;  4DG1 B;  3H4B A;  1I94 F;  5KFH A;  2IYI A;  5D3G A;  1FKO A;  2R7S A;  1S9G A;  1XR5 A;  4W92 B;  2DNN A;  5EUH A;  2ZE2 A;  2GAG C;  2ZD1 B;  3QYY A;  4I2Q A;  2YWG A;  2DNO A;  4HI2 A;  3H42 A;  3PIO Q;  3ET6 B;  3OXL A;  2C3M A;  2APO A;  2GML A;  3I5A A;  4LF4 J;  4L73 A;  1YRU A;  3TVK A;  1LWF B;  3D3B J;  1JLF B;  4FF2 A;  2COL A;  3N9U C;  4B9V A;  2UUB F;  2XYG B;  3EZ5 A;  1J27 A;  1NBE B;  4WFN Q;  1HW9 A;  4FDF A;  1UA0 A;  1UVJ A;  1WOO A;  2UP1 A;  2YXL A;  3DLL Q;  2E29 A;  4PG4 A;  5DZ7 A;  2UUC J;  4CO0 A;  3ZTQ A;  2MSS A;  1UWB A;  5IV3 A;  2XSJ A;  2B51 A;  3CCE S;  4DQQ A;  3IO1 A;  2HIY A;  1HI8 A;  3PRD A;  3DLH A;  3SSR A;  2VUG A;  2DK2 A;  2LDY A;  1FXL A;  2OIH A;  5KFO A;  4DR5 F;  4IOA Q;  4NEY A;  1XMQ F;  3CMA S;  2F5G A;  1FKO B;  5KFU A;  4WKY A;  4DR3 J;  5T7L B;  2KH9 A;  5LT5 A;  2Y1L B;  2MQN A;  1MRO B;  2IMO A;  4I2Q B;  1D8Y A;  1VJQ A;  2ZWP A;  4DX6 A;  1ZAW A;  2Q6B A;  2N7Y A;  3TI0 A;  1HD1 A;  1REV B;  2JC1 A;  1R0B G;  1KON A;  8AT1 B;  3K7R A;  4F2S A;  2KG1 A;  3A8E A;  3OJS A;  2SXL A;  2NSB A;  2DBB A;  3H2V E;  4F4X A;  4G1P A;  2I38 A;  4J9M A;  1G3O A;  4Q44 A;  4IFY B;  4FXW A;  4M94 A;  2JOQ A;  4ECS A;  1OJ4 A;  2YPY A;  4NEZ A;  3JXO A;  3FEY B;  2PFD A;  4LVN P;  4ZHR A;  5L1I A;  2PSZ A;  1P1L A;  1FES A;  3R9L A;  3EGV A;  4NPO A;  5AE1 A;  3D0I E;  1HNI A;  1S10 A;  2C2R A;  1VBX A;  4RNH A;  3AT1 B;  2CUY A;  1UWB B;  3M9N B;  2KTQ A;  3T1H F;  2ZBC A;  1CJV A;  2L9N A;  1QDU B;  3BO2 A;  2V50 A;  4DUT A;  1K1S A;  2YKA A;  4PCQ A;  2G1D A;  1VYA A;  1RWP B;  2RRN A;  2IY5 B;  4JV1 A;  2K1R B;  3RW6 A;  4HT7 A;  4WF9 Q;  3ICL A;  5IQQ A;  2HK2 A;  2R42 A;  2KU7 A;  4NI2 B;  4DPX A;  3LGN A;  1TFY A;  4FYD A;  4I2P A;  2C3O A;  3KG4 A;  4XTT A;  4MIB A;  2BKP A;  2A1B A;  1JXE A;  2RAQ A;  2WRM A;  4GRS A;  4DV6 J;  2X1B A;  2K3K A;  4F4K A;  3IRX B;  3N28 A;  4ZPA A;  3ZTO A;  3DKD A;  2BJ1 A;  2NR0 A;  2R8K A;  2RU3 A;  2WW4 A;  5HQM A;  2GZO A;  3U1M A;  1ZZN A;  2ALZ A;  3T5L A;  2KFZ A;  4Z7Y A;  2RF2 A;  3V2U C;  2OTJ S;  3M6V A;  2DEJ A;  4IYQ A;  2IJF A;  4FXD A;  3JTO A;  3EM1 A;  1NHK L;  3UNY A;  1LV5 A;  2NS1 B;  2V2Z A;  4XK8 C;  2HHV A;  4KAI A;  4ZVT B;  2B5J B;  4EI2 A;  2W7A A;  1N0U A;  4X4N A;  4UT4 A;  1RAH B;  4PYD A;  1NDP A;  1NK5 A;  1H7W A;  3OTB A;  1RAF B;  1TR0 A;  5F3Z A;  2N82 B;  1CJV B;  1O8B A;  4MFB A;  2ZJR Q;  3ISZ A;  4NCG A;  5EWF A;  1T03 A;  1YK9 A;  5BJR A;  5CZV A;  3ENQ A;  3HHK A;  4KE5 A;  2HHH F;  2C2N A;  3GYG A;  1TKZ A;  3GMG A;  1EB0 A;  3HZG A;  1VCT A;  2VG6 B;  4GMK A;  2Q3P A;  5A0Y B;  4LF5 F;  4ZLJ A;  2J0S D;  1QE1 B;  4XDC A;  5KOW A;  2CZ4 A;  4U9R A;  3TJA A;  2MQ8 A;  1MML A;  4KGK A;  4LSZ B;  3TA0 A;  3LQV A;  3NS5 A;  2KB2 A;  4NAS A;  4P75 A;  3DRR B;  1DY3 A; 
#chains in the Genus database with same CATH homology
 3C16 B;  1CJT B;  1Y11 A;  4CLL A;  4OYX A;  4P2X A;  3MAA A;  4OYZ A;  3MR7 A;  1TL7 A;  1CUL A;  1WC1 A;  4OYA A;  4CLW A;  3C14 B;  1CJV A;  4OYB A;  4OYI A;  4OZ3 A;  5D0E A;  4UST A;  3ET6 B;  1U0H A;  4CM0 A;  1CJK A;  3G82 A;  4USW A;  4CLP A;  1AZS B;  5D0G A;  4OYP A;  4CLF A;  2WZ1 A;  4P2F A;  1YBT A;  1WC5 A;  2GVZ A;  1CS4 B;  4CLZ A;  1CJU B;  1TL7 B;  1WC0 A;  1WC6 A;  1CJV B;  1FX4 A;  2QV6 A;  4CLS A;  3R5G A;  1FX2 A;  2GVD B;  4CLT A;  3C15 B;  1CJK B;  2W01 A;  4NI2 B;  4OZ2 A;  5D0R A;  1AB8 A;  4OYM A;  3C16 A;  1YK9 A;  1CJT A;  3UVJ B;  4USU A;  4CLY A;  4WP8 A;  3MAA B;  4WPA A;  1CUL B;  3C14 A;  5D15 A;  4OYO A;  3ET6 A;  1U0H B;  1AZS A;  3G82 B;  4OYW A;  1Y10 A;  1WC4 A;  5IV3 A;  1CS4 A;  2GVZ B;  5D0H A;  1CJU A;  2BW7 A;  4CLU A;  5IV4 A;  4CM2 A;  4WP9 A;  2GVD A;  3C15 A;  4NI2 A;  4USV A;  1WC3 A;  4CLK A;  4P2M A;  4WP3 A;  1YBU A;  3UVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...