1CS4A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
b'MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE V ADENYLATE CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4A00
1U0HB 5D0EA 4CLLA 1CJUB 4USVA 1AZSA 1WC5A 4OYAA 4OYOA 3ET6A 1CS4B 1CJTA 4CLZA 2GVDB 1U0HA 1CJVB 1WC1A 1CJUA 1WC0A 2QV6A 2W01A 5D0RA 1WC6A 4OYZA 4NI2B 4OYMA 1YBUA 4WPAA 4CLKA 4WP8A 1CJTB 1CS4A 1YBTA 2GVDA 4OZ3A 1Y11A 1CJVA 3R5GA 3G82B 4NI2A 1AB8A 1WC3A 3C15B 3C14B 4CLYA 4P2XA 4CM2A 4P2FA 4WP3A 4CLSA 4CM0A 3G82A 3C15A 3C14A 1Y10A 3MAAB 4WP9A 4USWA 4CLUA 4OYBA 4CLPA 1TL7B 1WC4A 1CJKB 1YK9A 3UVJA 3MAAA 5IV4A 3C16B 4OYXA 1CULB 1TL7A 2GVZB 1FX2A 1CJKA 3UVJB 5D0HA 4OYPA 4CLFA 4CLTA 3C16A 5D0GA 4USUA 5IV3A 4OYIA 1CULA 1FX4A 4CLWA 2GVZA 1AZSB 3MR7A 4OZ2A 4OYWA 2BW7A 5D15A 4P2MA 2WZ1A 3ET6B 4USTA
chains in the Genus database with same CATH superfamily
1REGX 4DPXA 4YY3F 3ZZPA 2RF2A 4A8XA 4J91A 5BXIA 3CCLS 4J9PA 4C4WA 3CEDA 4MIBA 2VD3A 2R2UA 2H4YB 2V8GA 3U02A 2MY8A 4OZ5A 2Y1RI 2PO4A 3L7UA 5HBMB 4JV5F 1IQTA 1FKPA 1BUXA 5DRKA 1TQLA 1MW7A 4PUOB 3M4XA 2WAQD 4CH1A 2YH0A 4QR0A 1N5SA 4B9TA 1N5VA 4NWBA 1RTDB 2HNDA 4HTJA 3V6DB 1YKWA 3I5AA 4OYBA 4QWDA 3JSMA 1S49A 3FK4A 1F5AA 1Q5VA 3NMRA 2GGPB 2MQLA 4DR7J 3MAAA 4LFCJ 2HZVA 1LV5A 4UOHA 2FYXA 1NSQA 3NBPA 3UVJB 2DNOA 2G9OA 5L9NA 1NMEB 3I32A 4DFMA 4YHHF 1HWIA 3Q2SC 3ZTPA 4BBYA 2ZH8A 3FEYB 1W2BR 1LFPA 2HYIB 3L4BC 1AZSA 3VAHA 4QIVA 2GMHA 1E6YA 2XC9A 4IYQA 4B9NA 4GC7A 3M2RB 1S0NA 3Q8VA 4OQJA 1Q16B 5EWEA 4CO4A 4PWDB 1FERA 2QX0A 3PM9A 3IA0A 3H90A 3QT6A 2I6WA 1FRHA 4B3RF 1FK9A 3PEJA 1U7LA 1Q81T 2W9CA 3MEDA 1WKLA 3GTYX 2N7CA 1KQSR 3RJMB 2BANA 1HHTP 3DC2A 2ZDPA 1I5OB 4EGLA 1T0TV 2ASLA 3W60A 2GVZB 2RUGA 4M5IA 1G4CA 2DH9A 2RB7A 1JLFB 2V50A 4I69A 4M5JA 3OUYB 4OYIA 1T3OA 4O0NA 3B8HA 3VAJA 2BYCA 3SFUA 1NBEB 3M8WA 4IOCQ 3PHTA 2HQIA 1S6QA 2XQCA 3MPDA 3HKZD 3QGGA 5BYRA 2ALZA 1HBNA 1U48A 3ISZA 4F0HA 4J9KA 2AT1B 1WSRA 5F0UA 2NSCA 4I6YA 2F9JA 1IKWB 4ZLLA 3CIZA 2O3DA 4K4ZA 1YDLA 4PQUB 4Y2MA 3Q24A 4DCJB 3KK3B 1KNZA 2CJYB 4NL5A 1EAYC 3TVYA 2Z2MA 4GKKF 3D6FB 2LQ9A 4X62J 4LSLA 1BQMA 1TL1A 3CB4A 1X7VA 2RS8A 1TL7B 3RW6A 1VRTA 1B0PA 1WC4A 3BGOP 4WXOA 2WSEC 1NJZA 4JI4F 1G3OA 2CJ9A 2CQ4A 3EJMA 5L1LA 1RWVB 3M8YA 1H3DA 4BS2A 2YNHA 3FSIA 1MMNA 2H4WB 3D54A 2XMUA 1WI6A 3RGIA 2AU0A 4LF5J 5C42B 3ZNUA 3J81j 5ETOA 5CH7B 2CXEA 4XPCA 2HPUA 3GJRB 1BQNB 1XIQA 1RU2A 3PX0A 3UN3A 4PXDA 2V8PA 3DRSB 5DDRC 2GHPA 3ISND 3BSNA 4DV7J 2XY7A 3GSIA 3UWTA 2DT9A 2FY1A 3PCOB 5J2MB 4QYZK 3H2LA 2BKPA 2OSRA 6FDRA 2D69A 4CIOA 4ZPTR 3MOJB 1RB0A 1EP4A 1YHQS 5HROA 4IFVB 2LEBA 3PYDA 4KKOB 2RRNA 4Y6IA 3C2PA 1D1UA 1IWGA 3AXKA 1FXDA 2IA0A 5KG3A 2Y1IA 3MPYA 4LF4F 2EG2A 4K7QA 4R0JA 4ZPDA 5LXRA 1QAYA 2R8HA 3BBFA 5GMKa 3HPOA 2XEXA 1VOMA 2CNLB 2VFVA 5AXMA 3DDIA 3I96A 2VONA 4RU9A 1RT4A 2JEJA 4J7CA 5KFNA 3CCRS 1FX2A 1AFIA 4WJBA 3MFIA 3VVTA 1VHFA 4KV8B 2V8VA 4AUKA 3MUVP 3T41A 3DLKB 3BR9A 4FYWB 4Z37A 2OJ3A 2X1GA 2XY5A 4ILMA 2QLXA 2FJWA 1GX5A 2PD1A 4ZJQA 4MT1A 3KK1A 3PO4A 4DL5A 2GA7A 1U8WA 3GE9A 1S1UB 4NLDA 2F9DA 5D4LA 2B9EA 2QO3A 4WKYA 3CNQP 3GV7B 5KT7A 2XSJA 3VQTA 2C2NA 5KFYA 3MECB 2FJDB 3IXQA 2AYBA 2PA8D 3BO2A 2EBGA 4NLPA 1U1OA 3DOLA 5B09A 5GADI 3TA0A 2HHHF 1OPIA 3LP1B 3CD7A 1F6TA 1UL3A 1D9DA 4BDPA 3BN7A 3K5LA 3VVUA 3MOZA 3QIPB 1RADB 2MLYA 3F44A 2QE5A 2DO4A 2CNOB 1UW4A 1ELOA 2BKOA 4MK7A 3LPEA 4R5PB 2R7QA 4ED6A 2O01C 3H25A 5T7LB 5E7OB 3HD1A 4NLGA 2HNZA 4LF8F 5KFEA 1N32J 2CJBA 3M2VA 5ETMA 4NI2B 4DL0C 4WP8A 3EM1A 3DOMB 4CO5A 4JI7J 4USJC 3FC9A 3CE8A 5E3RA 1S6UA 3BKUA 1X8DA 5J2NB 1OJ4A 1U1LA 2VKRA 1M0SA 4V1Ak 4DL6A 3ZTSA 4G1QA 3H5UA 4URQU 4WP3A 3DRYA 1XERA 2V9WA 1N36F 1UW9A 4ELTA 5F8LA 2AJFE 3DRRA 3OR1A 4B3TF 2FVPA 4EMDA 4F3QA 3OL8A 2VA3A 1KONA 2H9ZA 3ZZZA 2LMIA 1RYRA 4Q43A 3QAUA 2NUUG 2NQPA 4RBVA 1IBKJ 3GU0A 1B0TA 1S1XA 2GMLA 1TR0A 2KB2A 1XEZA 4YR2A 3HHLA 4LF1A 5A0YA 4P10A 4J9MA 1M1GA 3NCRA 3ET6B 4YY3J 3FRZA 3G8QA 5D0EA 2EC2A 2CRLA 2M3DA 4ECQA 3WBZA 2K7KA 1A6LA 2OP5A 2R8JA 3BR8A 3D6HB 2XGPA 5K8OA 1RQ0A 2CADA 2ZDOA 3KYLA 2LXIA 1RAFB 5HJYA 5ETRA 2MQQA 5KOXA 3L7PA 1NXIA 4RW6A 4UQTA 2AZ3A 3VAIA 3KXDA 3MM8A 2J7KA 4JV5J 1X9MA 5KT5A 1X0FA 3TNVA 2QMXA 3OTEA 4UZBA 1LEOA 2R7VA 2B7CB 2X1BA 3N28A 3DI6A 3V81A 4ID5A 3G6VA 3DOKA 5K14A 3MF5A 4X4OA 3TANA 3AB4B 1ZTTA 3Q86A 4DEZA 3AT1B 1S6PB 1UJ6A 2LVWA 1OWXA 1TTHB 1S0MA 4WU3A 2XGQA 1SIZA 4N5SA 4DSLA 1FVQA 4UUWA 4Z7YA 5EGYA 1N88A 2JX2A 1BLUA 4LFBF 4ED2A 3QT5A 1VIOA 4YHHJ 4CYUA 2YBVA 4CO2A 5ITHA 2M2BA 1U45A 1ZYQA 1RDRA 1LOUA 3QJLA 4USVA 4FS1A 1B3TA 1MWZA 4DPTA 4DSKA 3FDSA 4I56A 3KLEA 5I3UA 1U1NA 2CJQA 2YKPA 1LW2A 5KFBA 5DDPC 5DZ7A 3CIMA 1LW0B 1CJVA 3EICA 1B0VA 1FI4A 2V5HG 2XSFA 2YWEA 3GZ7A 4F7VA 3OVSA 1U02A 2DO0A 2Z2ZA 1KEKA 2ZZMA 4B3RJ 3CC2S 4I0WA 3VAFA 3T19A 3C15A 3TJAA 1N5YA 2ZBRA 2HVDA 5DDOC 3CJ5A 4DZDA 1NJXA 1Y4ZB 3FGVA 1RK8A 2LXUA 1RA6A 2YH1A 4K2JA 5KG2A 1BC6A 4IH7A 4B3MF 2VODA 2R9LA 2NXNA 2VG6B 1XNRJ 4KGKA 3B4DA 3OPKA 3I0RA 1JXLA 4I7FA 1N6QA 3WQPA 1DZ5A 4LJMA 5H9EK 2JH3A 4WWSA 2D3O1 3K57A 1IKXB 2W2OP 2CQ1A 3KJNB 2CQIA 2BA9A 3HX9A 2JLFA 5F8NA 4NLYA 1Q86T 2G2OA 4AXJA 3M8PB 1WC0A 3CD0A 2HFUA 4HACA 2X1FA 1YWXA 2DXEA 3GJTB 2MGZA 3DU5A 4ES3A 3KK2B 2DGQA 1F0XA 4WIIA 4A8OA 2L48A 3LAKA 4CQ1A 4DX8H 4EO6A 2UXDF 1XN9A 3WIUA 3RTVA 4GKKJ 4KE5A 4QZVB 3CCJS 4FZVA 2ABYA 3RRGA 2DNPA 5DG7A 4RW4A 2RHQB 4TU7A 2NXUA 1HNWJ 1Q5YA 4QYRA 1ICEB 4JI4J 4O3PA 2GFFA 4LQ9A 2UXBF 3GJQB 3UD3P 1XMQF 2FC8A 2BVZA 4OYPA 1X4DA 3HCXA 4X4VA 4ERDA 2K8GA 4UZCA 2Y8YA 2DNZA 1FDBA 4AYBD 1VHIA 1F2GA 5E3PA 2AJ1A 4ECRA 2DY1A 2P2CB 3CJ8A 2UXCF 1PG5B 3BGFA 4WU2A 2YNGA 1XBWA 3DM2B 5EX3A 4F0MA 1FDNA 3QGIA 3H2VE 5DGBA 2LLZA 4HYKA 3MPUB 3T9ZA 2QV6A 4ZVFA 3AOAA 1KKHA 3D6MB 1JLQB 5KT2A 5BR8F 3I0SA 3DKDA 2NXEA 3HHLC 3IGVA 1WEYA 3DRPA 1MU2A 1YRTA 2FZGB 2BEFA 3E3XA 4LF4J 3KDOA 3U1LA 2D7SA 5J1NA 1RT2A 2Z8QA 2IYIA 3BKFA 4F3OA 4ZN1A 4K50A 1R8CA 2ZBQA 5IV4A 2XMWA 1P27B 4B02A 2OPSB 3QATA 4QWBA 4DX7A 1K1QA 5F9LA 4LF7F 5C2GA 2J9DE 2WOMB 2AGPA 3AD8C 1KD1T 2CAJA 4JYAF 4FXDA 4P2MA 1QAIA 2VFRA 1L3SA 2AV5A 2HHWA 1RTHB 1UKUA 2QT7A 2GAGC 2YKNB 3ENWA 3SFGA 2WCXA 1W2IA 1VQ5S 2EFPA 2A10A 1T95A 2Z58B 2VF3A 4URSA 2AQ4A 4H4MB 4MTPA 1U2FA 3O44A 3BSAA 2XYPB 2LYVA 4ZLJA 1DFDA 4JBCA 4ZVUB 2HHHJ 2MHEA 5DS7A 3DGPB 1KC8T 4WTOB 2AYGA 1RTJB 1CJKB 2QIFA 1HNIA 1GMWD 4KH0B 1WDDA 3DFEA 2OO4A 2DNHA 2BOAA 2N82B 3OSNA 3KHHA 1H2VZ 1UTAA 4C8KA 1S76D 5BYQA 2VB6A 2WRMA 4TN2A 1P1LA 4AL5A 2F8EX 3BH7B 3W7BA 5JVGQ 3JTOA 4NCBA 3KOAA 2HS0A 3IR7B 4LF8J 1S4FA 2LA6A 5KT3A 2HVEA 3T5JA 3RAQA 3TVKA 2K06A 1KFDA 1Q4RA 4L3KA 3IAS9 4ZN3A 4NYOA 5HO4A 3HVTB 2DR8A 5KT6A 4D3GA 4FF4A 4IDKB 2AGOA 2FJBB 1N36J 2C3YA 4ED1A 1Y00A 1IN0A 2E7WA 3FUYA 3CCMS 3CJSA 5FLXY 3PYEA 3C6TB 2KM8B 3PVXA 2HNYA 1K44A 1SH3A 2QA4G 4FNHA 1MN9A 3QRPA 1HQUB 2Q79A 1KWMA 2KJWA 1D09B 4HT7A 4ECZA 4DSJA 1C0UB 4DR1F 2AJQA 1WF0A 2E9ZA 1B70B 3BPDA 3PJWA 1W26A 3PKYA 4D3HA 1RT3A 1WTBA 2J6TA 4WE1A 1FE0A 1YJWS 2R3VA 2UUCF 3AJDA 3LW5C 2MZJA 4FN5A 1HNVA 1RBAA 3I4HX 2FHOB 3MEEB 1RACB 2MKHA 3OVAA 4U95A 1WSVA 1RAJA 3UDCA 5EUHA 2MYFA 3QFHA 3IRXA 4N8NA 2RJZA 3N6MA 3SQGA 3JB9k 5IXUA 2YNIB 4QIEA 3G6YA 1LWFA 4RBTA 2L08A 4LFBJ 2DCUB 4IFYB 2EFNA 2CQBA 1JXVA 1Y5LB 1ZAWA 1U25A 1RBLA 5C5JA 4DN0A 3HK2A 2IMWP 3FMWA 2WBMA 3VCDA 8AT1B 5HMXA 2I9SA 3E01A 4K8RA 1ZM3A 2CFXA 1PJ6A 5ETQA 2NR0A 3JYTA 1GT8A 1S9GB 1GH8A 1WC1A 1RLCL 2GW8A 3BM7A 3HZGA 4A8YA 2R7SA 4JB8B 3SDEB 3J81Y 3GFYA 2OELA 2DR7A 2HZAA 5KFGA 4Y0FA 4YQWA 1ZOTA 2QA1A 1BD6A 4J9LA 3C6UA 1JX4A 1H0HB 3HP6A 1QLNA 3N5FA 5D4OA 3M05A 2VPZB 1NM2A 5KFTA 3QGPA 2ZHAA 4IG3A 2HHUA 2BJ1A 2RU3A 5A8RA 3H42A 1MMDA 2MZRA 4RLEA 3ICLA 3OXFA 3MMBA 3MM7B 1WG4A 4B3MJ 2OIHA 3G8TA 2HGMA 1UZDA 3MMAB 3OFHA 2DNGA 3HULA 2OEKA 1WKKA 3P96A 1WG5A 3NY0A 1VLOA 2W2QP 1NAQA 3WX8A 3CTRA 3G8SA 4GRSA 3X1LB 2C42A 1SC6A 1T9YA 2FY8A 1UWBB 1MNEA 2MLXA 1TKTA 3K2YA 4DL3A 3K5OA 3BDEA 2EFOA 4FF2A 2P6TA 4NLQA 4WFYA 2F63A 3PYFA 3UCZP 4IKAA 2OKQA 1H7XA 2Q6BA 2AJ2A 1EETB 5KFIA 3UI3A 2HZCA 1I94F 4RNMA 3CDBA 4YB5A 4DLEA 1HHSA 2VH7A 4NLVA 3KLVA 1YBUA 3LP2A 4FKXA 4U9RA 1HW9A 1UAWA 1UEVA 1J5OA 1L3UA 2IAJB 2UVUA 1HIYA 2UXDJ 4DS4A 5AE1A 4ZP6A 3N01A 4B08A 5L9XA 4CM2A 2W7PA 1VBKA 4ECWA 1CBKA 1L5UA 1X9WA 4ZVRB 2KL8A 2BW2A 2W9AA 2B5JB 1K0VA 1BMQB 2XMJA 3GIJA 3HXMA 2YWKA 2FIUA 2KKHA 1ZM4A 2Y8WA 2UXBJ 1QDUB 1XMQJ 3HFVA 2E7VA 3QO9B 4NXMF 3C16A 1FA0A 1C4CA 2BJEA 4USMA 2CQ3A 4TY8A 4ICLB 1T02A 4HL9A 4EEYA 2UXCJ 1GTHA 1TL3A 4ELUA 4QWEA 4A8SA 1KQFB 3PW2A 1RT1B 1JLGA 1B7YB 4KFBB 3CF5Q 3NL0A 4M8LA 5ETLA 2Y1LB 5G0RB 2ADCA 4P72A 3MEGB 5BR8J 1S7HA 4EO8A 1NZAA 3TAQA 1SV5B 3AODA 1JKHA 3NS7B 3LP0B 2BR0A 1BQXA 3H4BA 1TV6B 1ZA1B 1GXLA 1R0AA 4BWJA 2B3TB 1LNQA 4MYTA 1RAOA 1N4LA 3CUNA 1IKYB 1UMJA 3BQ1A 1VQMS 2FPHX 1F9FA 1NJWA 4P6QA 2BJ7A 5A8KA 2DIVA 3UE2A 2WONB 5H1SV 2ROPA 2AW0A 1K8AT 1KLMA 3GPAA 4LF7J 4ZVSB 1N34F 4JYAJ 2ERRA 2W4CA 4YR0A 5DM6Q 4C7QA 2MQ8A 1FFWB 1UEUA 2ROEA 3ILLA 1UP1A 4L76A 2O5DA 3KJVB 4CWBA 2COLA 1LWEA 3P8BB 5RUBA 2GVDB 3GR1A 2CKWA 1TELA 3D3BJ 1S72S 1JLCA 1EQ0A 2G0CA 1IBCB 3ZTQA 2GAHC 1NK7A 5H9FK 2DNMA 4DV2F 1ZAXA 4HT5A 4F26A 8ATCB 2NZCA 5IZHA 3R7SB 2M9KA 1J2VA 5J1EA 3C14A 4NMLA 3M2UA 2DR5A 1RBOB 5LMNF 4O4GB 5JXSA 2E5LF 4IRDA 4K5SA 4TQSA 3KLGB 3FEZA 3HJFA 2D3ZA 3AD7C 1KQGB 2V4JB 3PR5B 4OLPA 4U7UK 4OX8A 3OLBA 3TP2A 3TOQA 2KYZA 2DGXA 1IJFB 4TYAA 4RNOA 3NNAA 4MYUA 4L73A 5J2QB 4RJVA 1HBMA 1IUJA 2CVEA 3EVOA 4C8NA 1NH7A 1M5SA 5B0DA 2RQCA 3DDNA 2VDHA 4RW8A 1FWLA 3RAXA 3FVYA 3TJ8A 4Y2IA 1WOOA 1EHWA 1QUVA 4C11B 1JQGA 2HWIA 2D1CA 1PJ5A 4X4PA 2F8MA 2NPFA 5CD4A 4P2XA 3S7RA 5E3AA 2OPRA 2R42A 1O6XA 3THPA 2CA9A 1EQMA 1YITS 4WKRA 4MFBB 3R5CA 2QMWA 2RQKA 1SL1A 5EDWA 4QIFA 4LR9A 5FLXU 4Q2LA 3JQMA 3LUYA 1M5VC 2VV5A 4WCEQ 2LDIA 1SUQB 5SUHA 2DCLA 2GO8A 1G2EA 1SJQA 4OHZA 2HHPA 1YBAA 3PV8A 3WX4A 4DR1J 5CA5A 2AMCB 2OI2A 3VV2B 3OL9A 3S6EA 5F8IA 1VQKS 2YQ0A 3ZZ0A 1QY7A 2V94A 4IR1A 3W62A 1HQEA 2XI2A 4DFJA 2UUWA 3DLGA 3G71S 2KYXA 3V4IB 2UUCJ 2RAQA 2J0XA 3FCVA 3HFZB 3DLEB 2DY9A 4UOFA 2VHGA 4YUDA 2RNEA 1YRUA 4C8MA 5HI7A 4IR9A 4USHA 2CDRB 2JEFA 3R6GB 2VUGA 4QIGA 4U7CA 3A4TA 1J27A 4Q8EA 5HBMA 4TU9A 1VBYA 5HQMA 2E44A 2VFSA 4RW9B 1PO6A 1DLOB 4PUOA 3KMQA 3CD5A 4PABA 2AYMA 3Q2TC 3OTOF 1S0VA 3R27A 1P6TA 2BMBA 2FVSA 5LM7E 1RTDA 3V6DA 3OLAA 4H54A 2LQ8A 4DV4F 1KVIA 3F41A 2DGVA 2R7UA 2GGPA 1PAEX 2DEJA 2LKZA 2R7TA 3ZTRA 3IS9B 4PPDA 2IJFA 4CO0A 2MJUA 3B82A 3PO5A 4DF4A 1TL5A 4ECSA 4TVAB 2PC6A 5FDLB 2ZE2B 3PW7A 5CYJA 1R43A 4ECYA 1N8RT 2YX7A 3A1YG 2RRBA 5A6PA 1PYOB 3OJSA 4GC6A 2MKSA 1OYDA 4ZITA 4RZRA 3M30B 3Q23A 4NLTA 5JUMA 3J81U 2JC1A 4C8ZA 2PIIA 4QW8A 2ZC3A 1AYEA 3M2RA 4JI2F 4B9LA 3G2XA 4LRDA 1XC9A 3OJUA 5CCLA 4HKQA 1D8ZA 4PWDA 4Q8FA 1QM9A 2QN6B 1CQMA 5J2PB 2AF6A 5DZ6A 1RLDA 4KPYA 3SI8A 1D9AA 3K17A 3DMJB 3FCWA 4TU8A 4B9VA 1RT5B 4FKYA 2KVIA 2GNKA 3FNNA 4NLWA 2VG5B 3H2UB 3EVMA 3QT7A 3I56S 2GVZA 3MR7A 1KBRA 5IT9Y 4ILRA 2CQ0A 2CJAA 1OSDA 1YZ7A 2OPPB 4B3OB 1RT7B 1JLFA 2DKOB 2GCFA 3OUYA 2DPIA 4P71A 2ZFHA 2D41A 1I94J 3TUPA 3GB0A 1WDTA 2NUHA 1HBUB 1M1HA 1S77D 2L9NA 5D0RA 2UV8A 4H4KA 5KFOA 2DBBA 2MMYA 4A8MP 1YGYA 2GHVC 1F5BA 3T5LA 1VS3A 4M5GA 3B54A 4EI2A 4M5DB 1Y0HA 3R5AA 3RYLA 5IC4B 4ECUA 2H54B 1IKWA 5I4MA 4JI1F 2HRYA 4LSNB 3MM5B 4PQUA 3FQKA 2CDQA 2KRBA 1RAGB 3W2VB 1VISA 4F3MA 1RT6B 2DEIA 1N52B 3KK3A 1OQ6A 1FK9B 3CCWA 4AT1B 2AZ1A 2W9CB 2MHNA 1H7WA 4XO0A 1NCLA 4J9NA 4YDXA 1RWMB 2A3JA 1N56A 3G4SS 3KNGA 1S7IA 3RBZA 4OYXA 2ZJRQ 1LK7A 1TL7A 3UN2A 1YJUA 4OV6A 4B17A 1MLAA 4NLUA 1NRKA 5IV3A 2E1AA 2F40A 1YLXA 4CT9A 4TYBA 5A6WA 3UR0A 3QFWA 2KG1A 3DDKA 2KDOA 3G86A 4ANEA 1X4AA 1JWWA 3D2WA 1VC5A 1SXLA 2KHCA 2CQGA 3MZIA 5C42A 1QTMA 2J9EA 2MQPA 4KQZA 1BQNA 2AJ4A 1BGXT 5K20B 4NEZA 1H6KX 2QC3A 3DRSA 2PFFB 3HSGA 5B0CA 2ATCB 4HH1A 4WFAQ 5J2MA 2WW4A 1T03B 3G6ES 3RB0A 2DHSA 4F36A 3MTKA 3RR7A 1KDNA 3BGLA 5K8MA 3GIMA 4IFVA 1TAQA 4K4TA 4KKOA 1H72C 4IO1A 2ZJPQ 4GO5X 1MN7A 4W92B 2FLNA 2BJDA 5DM7Q 4LF6F 3KLIB 5L1KA 4TLRA 1Z1ZA 2VPWB 1X0PA 2FQQB 1ZA2B 2E1RA 3M9OB 1U24A 4N47A 2CUYA 2PGCA 4KHRA 1U0SA 3H0PA 1N34J 1EZZB 3SSQA 3B6BA 4U96A 3D1QA 4CTAB 3GP9A 1CC8A 2RT3A 1Y3KA 5KFWA 2Z30B 4KV8A 3DLKA 4I1TA 2FJAB 4ZP7A 1XR7A 2R8IA 2PEHA 3A3NB 1PJ7A 4DR2F 5A76A 4M5NA 4FXWA 1TMMA 3W9HA 1YX2A 1K1SA 2DNQA 4DV2J 3MD3A 4ES1A 4B9UA 4ZVEA 4ZVTB 3W3SA 4J9QA 2ZOFA 3JSBA 1S1UA 4C6AA 4DFKA 4IG0B 2CWXA 2OD6A 4FXVA 5F9NA 5LMNJ 5EN1A 3C3LA 4K4UA 2ZZNA 3MECA 4IH6A 2E5LJ 3CMQA 3MCNA 3IM9A 4ZVPB 4UF4A 4H4OB 4QBUA 2X51A 2WVFA 4S0MA 4V19X 1WHYA 2NLWA 2RDDA 5I3PA 4DBQA 1WOSA 4DR4F 3LP1A 2CPIA 4ZPVR 2KJVA 3QIPA 1R8HA 3AHPA 4LVOP 4DX5A 1S1TB 2H65B 4R5PA 2O67A 1Z2ZA 3CJ4A 1KHVA 3MGJA 5T7LA 4ZJOA 1AXQA 3QMQA 3ENVA 2FZCB 2J76E 3JTNA 1DQ9A 2YKMB 4F4WA 2CJKA 3GV8B 2DNRA 3GG0A 1O0PA 5HVFA 5G4DA 2W4PA 3JSRA 3BF4A 2AIRB 1FNXH 4DMZA 4NI2A 4M5MA 3K5MA 4AFFA 3DOMA 2V4QA 3N79A 2BUNA 3NAHA 2BE7D 4DUZF 1RWNB 2BJ9A 2FC9A 3F73A 5J2NA 5KG6A 4PCQA 4Y3CA 3VTIA 3I55S 4OX7A 1FESA 3VZIA 3B78A 4H4KC 3DLLQ 1U49A 6AT1B 3PACA 4DV1F 4ZHRB 5EHHA 2FHJA 1FEHA 2VBYA 3M8SA 1NEEA 3A8JA 2DTJA 1ZZNA 4ZIWA 2OTJS 1AUSL 3ENQA 4RL1A 4F2RA 2E1PA 1IR0A 3ET6A 4K0KF 1H2TZ 2JLEA 2V9KA 4LUBA 1TAUA 3CJ3A 3BYRA 1DTTB 1FRIA 2VC0A 3J7YU 4CNYA 4WYWA 2XLIA 4NYZA 1T3NA 2CPEA 2BOPA 1RWOB 3MXHP 1RAAB 2CZVC 3IC1A 1QTNB 3AA9A 2VG7A 4MKBA 4DV6F 2XLJA 3FFIB 2HGNA 3PHEA 4DL2A 4CCHA 1FRLA 2JVOA 3MPWA 2YWHA 4X64F 4OV1A 3MM9B 3OTOJ 4OX9F 4NLOA 3UN5A 2CPDA 3BZQA 3BQ0A 1O8BA 4P2SA 2HFNA 3M8QA 3HHNB 2LCWA 4DV4J 2M5YA 1RHQB 4CO1A 1T9UA 3JS9A 1S6PA 2MXYA 2CPZA 2HQCA 1CLFA 3T1AA 1N33F 2XYHB 4OJHA 1ITPA 2J8AA 4TNOA 2FD2A 3FBEA 4OI6A 3GONA 4DU7A 4CLLA 2LFVA 2HHTA 2W2MP 3VALA 3V6HA 4LRFA 4KGXB 4F02A 2B43A 7AT1B 1Q7LB 2AX1A 3D68A 3W5ZA 3MUTP 2NS1B 4RNFA 3IBFB 1OPZA 2M8HA 4OJ1A 1GQEA 3SYZA 4JI2J 2ZUGA 1VR6A 3BN4A 4GO7X 1EB0A 1ZETA 2HMIB 4OHWA 1LW0A 4RW7B 2UU9F 2B4VA 2ROGA 4WXWA 2OTLS 3NP5A 1WEZA 4HEA9 2BRLA 3RB4A 2ZUAA 1RHMB 5HN0A 3EDRB 2XS7A 3RR8A 1RA7A 2OUGA 2WVBA 1YQHA 3TA2A 4NEYA 5E41A 1SKSA 1ACMB 5A8WB 5DLGA 1KLNA 1CULB 4Z2XA 3NNHA 4LRAA 4QW9A 5L1IA 1HWKA 2U2FA 4ITSA 3QLHB 1P9YA 1GXTA 2GQ2A 2VG6A 3TI0A 3HHLD 4W90B 3OR2B 1SC3B 5IT9U 3VHQA 2F65A 1HL6A 4DDFA 1N48A 3FMBA 2PSZA 5DJBA 3CJKB 3GYXB 1VQPS 1CJTA 2HBZB 3P45B 1Q82T 1IKXA 3SMZA 3IO1A 4JUZA 5IFMA 3IRWP 3C8YA 1KRPA 5MAOA 4DQIA 1FDAA 3M8PA 4F04B 4J5OA 3CJTA 2KG0A 5EX0A 2ZH5A 3HVRA 3KK2A 4JI1J 3A13A 1MSWD 4O44B 1PYTA 2I5JB 2CQDA 4IQMA 3ONQA 4A4JA 2CPJA 3TX0A 1RHUB 3BGUA 1RAEB 4C97A 3UCGA 3VAKA 3NG8A 3FKBA 1WACA 4ANCA 3PIPQ 4PQAA 2BKNA 3DHWC 1VDHA 2R4FA 1NO8A 2DISA 4NX9A 2KHDA 2G1DA 3PW5A 2R7WA 3EUNA 1R8AA 2J9CA 4OI2A 1FT8A 5LSRA 5ETVA 2J0QD 2SXLA 2UUTA 2W9BA 3IBCB 3BYPA 2OMOA 1VBZA 3DM2A 3P3DA 4B9MA 2Z0GA 3GQCA 3Q8YA 2QSWA 5IWAF 4ZCIA 4F8RA 1JLQA 3UDEA 1IKVB 2F3JA 3M6UA 1WF2A 4LVNP 1T9XA 4WFZA 2N4CA 2R8KA 4ZIVA 4LF6J 3D4JA 4QQBA 3KUEA 2QMUB 3R7NB 3J80Y 3G6XA 3WIVA 2HVZA 2MLZA 2I1RA 1WUUA 4RNNA 4KC5A 3FEXB 2KO1A 4UW2A 1B64A 5I42B 4DSFA 4A8QA 4QPTA 2OPSA 2EK6A 3QNWB 4C3LA 3RRHA 3T1YF 4J90A 2E5IA 2WOMA 5AXNA 4DR2J 4ZMMA 4A46A 1RSCA 1RTHA 2VJUA 3J7Z5 1UWAA 2UV8G 2YKNA 5ETKA 1JJ2R 4OZNA 4F4ZA 3PJXA 1VYAA 2AD9A 2QA4S 3C46A 3A8IA 4DX6A 1JXEA 2XMVA 2IDLA 1VQSA 2Y1JA 2C3UA 1R0CB 2DHHA 2YTCA 1R8BA 3BB5A 2GJFA 4H4MA 1PSDA 3RB6A 2RIJA 1K9MT 1XMOF 3SEOA 2OLWA 1X60A 1E6VA 3HMJG 1ZM9A 2J6SA 2IJRA 4DR4J 2ZH7A 2K1RB 4MKVA 1Y3JA 1RTJA 1CJKA 3GCWP 2JJ4D 2XCAA 5D0HA 5GVQA 5DETA 3AOBA 5HVHA 4KGMA 3ZNJ1 1WJ9A 2V68A 3EGNA 3Q8RB 2OAUA 3V6JA 4C8LA 5KT4A 1CS4B 4G3IA 1TK5A 3ILJA 1ZPWX 2BZ2A 3CDUA 3AD9C 1X5TA 3EPGA 3KDNA 3EVWA 1NK4A 2FJEB 1Y11A 4RX6A 1SH2A 3MAHA 1FJEB 3AJ1A 3HVTA 2RD5C 2ZH9A 4DUZJ 1HHQA 4DR6F 5C24B 3H8YA 3PYGA 4IDKA 1UFWA 2A0FB 4RBUA 3RBXA 2OGUA 2MTLA 4YOEA 5ETTA 1I1GA 3VAGA 2QFIA 5GAGU 4XPEA 3BV8A 4JV0A 4KR0B 2IA6A 3LGNA 3C6TA 4RUHA 1Q8LA 2B9YA 4DV1J 1F2HA 3DHXA 3TARA 2BV3A 2WSFC 5JVHQ 2E5HA 1I6JA 3UD4P 1HQUA 1VC6A 4ZP9A 4HR2A 1DARA 3L09A 4JOUA 4USTA 5F8HA 3CO0P 2GX8A 4O3SA 4DXLA 1C0UA 1HQ2A 4FF1A 1SCJB 4PXCA 4O3RA 2DGWA 1S9EB 3JXOA 3H59A 4ED8A 3VGSA 2IIHA 3T5KA 3R97A 4LRCA 3GSDA 4M94A 5D3GB 3RU0A 3J7ZT 3A3OB 3NEKA 4DV6J 4DV0F 2I2YA 4KPCA 5D77A 4CLSA 3QJJA 3BBBA 3ZZTA 4X64J 1ZTWA 1NK9A 1VFJA 1I51B 2HG4A 4OX9J 3NS5A 1OSCA 3MEEA 4LF2A 5LSOA 2MPUA 2ZNZA 1YJ9S 4HH0A 3OBIA 4KHPF 1NK6A 3W8PA 3P4UB 2KFNA 5B0GA 3E8OA 4JV2A 1DBDA 1N33J 3AQOA 1SIWB 2MQOA 2PDAA 4IFYA 1HPZB 4DUYF 2ZVSA 5AXKA 1UFLA 3W9JA 4M1KA 1K0TA 4DJBA 4OI3A 1YSJA 1RGVA 1JNRB 4F25A 3IMQJ 1WHXA 1X5OA 2HVHA 2FGCA 2RILA 3P49B 2A2DA 5MLCV 1S9GA 2G1HA 1UVLA 1JLEB 4ZDNA 3SDEA 5B0FA 3EDQB 5GMEA 2UU9J 3POTB 3R1HA 4K4XA 4DR3F 2M4MA 2E1CA 4YN3B 1EX8A 4DHVA 1QE1B 1PIEA 4LMZA 1Q95G 3OVBA 2NPIA 3ZZOA 4MK8A 4R0EA 4DF8A 2KH9A 2GQCA 5LOQA 4WF9Q 2P5VA 2I0XA 1SKUB 2WK4A 3MM7A 2B4OA 1WOPA 2HQ3A 1U1MA 3TA1A 1RABB 5IOLA 3MMAA 3K89A 3R1LA 3GWCA 3WHIA 4ER8A 1B4SA 1OMSA 3ILIA 3C66A 1RZMA 1UZHA 1FJCA 2RUSA 3BKTA 2C2ZB 1UWBA 4DU8A 4UT4A 1IQZA 2OD4A 3UW1A 5A2QY 5GMDA 2M88A 3MMCB 2F7VA 3CVKA 2QG9B 3HF5A 3WDOA 1EETA 1X9SA 2R7OA 1VQOS 3NRBA 4C2MA 1Y5NB 2PMZD 5HLFB 5KG4A 4LIWA 4PG6A 4CLYA 2HIQA 4NLRA 3OXGA 3GJSB 3EGWB 3D6TB 1JJCB 3TYTA 2IAJA 4I4BA 1T9WA 4I6AA 3FBBA 4N7TA 3SCLE 2MZQA 1LK5A 4PWUA 2UUAF 2YKQA 3W5YA 1FJ7A 3NLCA 4CLUA 3GMGA 2VC1A 3QBCA 1SJ3P 2NCKL 4OHVA 2EVZA 5I3QA 3GIIA 1ZM2A 2B5JA 2HLTA 1LWCB 2G0IA 4UOCA 2FHMA 5HQLA 2HW3A 2QYCA 1I3OB 3CXCR 3PTWA 2OMLA 3M32B 3H4DA 4YDDB 3A3PB 4W98A 5D0GA 2FVCA 3LGMA 5CABA 3Q22A 4FS2A 3I5CA 2LDYA 3QO9A 2Y0BB 2F4VF 3UPFA 2KTQA 3CD6S 5KFHA 4ICLA 2MSTA 1JK9B 4U6PA 4X2BA 5AJ3F 1VQ9S 2Q1LA 2GIRA 4LBHA 2KZZA 1RT1A 2XWXA 4KFBA 2KM8C 3R5GA 1GXUA 3IN5A 2FLLA 2W2PP 2C2EA 4NLXA 3J7YI 1S12A 4NOHA 5G0RA 5IWAJ 1VGYA 2ZKUA 3MEGA 2D9PA 2B8QA 4ZCMA 1SV5A 4NZ7A 2C1EB 4PWWA 4EYIB 1PAUB 3PZPA 1T7PA 3LP0A 5LSLA 1TV6A 4XDCA 1S9FA 1NPKA 3RRKA 4DQQA 3J80U 1IKYA 2ZH3A 4F2SA 3ZTOA 4XIUA 2D3OR 2EG1A 1RAIB 3PRBA 5LL6d 4EUVA 3BDPA 1HA1A 2WONA 3ILOA 3PIOQ 4K4WA 2A18A 5IM0A 2L9WA 1C0TB 4CO3A 1LFWA 4NZ6A 3UNYA 3KUGA 2CG8A 2CQHA 1RE1B 3D0HE 1NJYA 3CCES 1Y5IB 1S59A 1VJQA 1S1WB 5IS2A 2XWYA 3KJVA 2ZEJA 4JI8F 2GVDA 3HO1A 4GVBB 4DS5A 1IM6A 5KFQA 2VJVA 4HVZA 3RG6A 1WC3A 2HHSA 1URNA 2B7BB 4Q45A 3H5XA 2XZWA 1NJIT 4RNHA 1VK8A 1X4FA 4KB7A 3OTCA 2AX0A 4X4TA 5HAOA 1ZPVA 1JLBB 2VU5A 1XMOJ 3PW4A 2WVCA 3EXYA 3UFCX 1R0AB 2N3OA 4OZ0A 2H3EB 2C2KB 1QSSA 4O4GA 1YIJS 3KLGA 4IUFA 4DR5F 2V4JA 1SPBP 4TKTA 4CH7A 4P7TA 4UUXA 1CEZA 2VQFF 3I6PA 4NZ0A 2B56A 3LWMA 2QRRA 4O3OA 4QWAA 5KG5A 1NH8A 1U0HB 2CPYA 3DLHA 2DGTA 4C0HA 3VGVA 1LQ9A 4RWXA 4DPYA 5J2QA 2JZ5A 8RUCA 2BQ3A 1JIHA 4UOGA 4DL4A 2W8KA 4N41A 2XY6A 1WHVA 2JC0A 1HMVB 3PNIA 2CYYA 2HHXA 1F5CA 9RUBA 1VQ8S 3VGTA 3G82B 1U1RA 2ILYA 3LH2S 1FXRA 2B51A 4ZKAA 4C11A 4DR6J 4QU6A 2MB0B 1HWUA 1X4HA 1FRJA 1RTZA 4M95A 1ZZFA 5DLFA 2E5GA 3RZAA 1AW0A 1DQ8A 2NYHA 4ZCKA 2APOA 1D8YA 4CLPA 4MFBA 3SCJE 1GEHA 2CWKA 4NPOA 2CZ9A 1AUDA 2VOOA 3L3CA 4Q44A 1IJEB 1L3VA 3OL6A 3GG1A 4UY8T 4G1PA 3U27A 1SUQA 3U7JA 4QU7A 3I4PA 4FBUA 3M8ZA 5KFVA 1HD1A 4OYWA 2X1AA 3HD2A 3H98A 2R2TA 1REVB 1Q78A 4ETZA 3MPVA 1RP5A 2Q43A 2XB2D 3CDEA 4LREA 1U6BA 4ECVA 4X4QA 5E5NA 4RPFA 1B7FA 2ZHBA 2EKNA 2NREA 1RWPB 5DQIA 3HKWA 1O51A 4AQYF 3V4IA 3DLEA 1U4BA 4DV0J 5C25B 2DHXA 1NLKL 3T5HA 5KOWA 4MH8A 3OSPA 1N32F 4ZPWR 1V5IB 4K2XA 1RHKB 2LU2A 3CDAA 3FBCA 3HHEA 5C7PA 3P6YC 4OL8A 1FRXA 3KTQA 3VGUA 1HFEL 3DCAA 1ULRA 2O66A 1IR2A 4RW9A 1KP6A 2QLJB 3QGHA 1DLOA 2LQJA 2C2DA 2HFSA 1HWJA 3UCUP 1PC4A 3THVA 3OFEA 1A7GE 2X3GA 1VK3A 3MDFA 4DUYJ 3IS9A 3W2WB 2I38A 2FHKA 1TMJA 2V8HA 3CCQS 4WZQA 3D66A 4I2QB 1A9NB 5FDLA 2ZE2A 3NGKA 4OFZA 2ZBIA 4WK3A 3R5DA 4I6WA 4E0DA 1ZS6A 1TKXB 3FSXA 3O8WA 2XMTA 3DLJA 3NS6A 1V3ZA 4DG1B 4L72B 3GFZA 1F60B 1RYSA 1H73A 1PBAA 4BC7A 3MI7X 4Q5VA 1FJGF 2EC0A 3TUZC 3M30A 2BM0A 3MHYA 5L1JA 1S1VB 2ZWPA 4J9SA 1UPMB 2VBWA 1NDPA 2CPXA 4DR3J 1VQYA 2P8IA 4JI6F 1CQNA 2RVJA 2HK3A 1RXOB 1HNXF 3MR5A 5DQGA 1V3SA 2LECA 3QRQA 5J2PA 1KN6A 3IM8A 2ATLA 4J9OA 3DMJA 1RT5A 4IOAQ 5D78A 3MEKA 2IMOA 4F4KA 4KTQA 3N6NA 3R3TA 3D0IE 3CCZA 2BW7A 4WZMA 3TEHB 1HARA 2VG5A 3R8YA 3DXSX 3NCPA 3BGRB 4ED4A 4DQSA 3EYZA 1DAXA 3K5NA 2HK2A 2PMHA 4IH5A 3TEGA 2OPPA 4B3OA 1RT7A 5CHCB 5A2QU 3CJRA 4DPOA 4WPAA 3TX8A 1UVIA 2LEAA 3WC2A 3ZZRA 4B3TJ 1F3VA 1TKZB 4OZ3A 2Q6CA 1HBUA 2KFZA 1RISA 4Q0BB 1G7CB 3M1VB 4CP5A 3ZFVA 1OY9A 4ZA1A 2W8LA 4M5DA 3Q8SB 3KJQB 2IYGA 2UUAJ 1FHTA 2BM1A 4Y28C 4K4SA 3NGTA 4LSNA 3MM5A 3NWRA 3W2VA 1IM4A 1RT6A 1DURA 1RTIB 5GAGI 3PR4A 5K5MA 3PDNA 3NOCA 5KFJA 1JNZB 1UJ5A 1TVRB 1TFWA 2FZKB 2KZMA 4ZPCA 2F4VJ 5LXYA 1OY6A 2Z2YB 5AT1B 2KXFA 4DZ6A 3T9NA 3UD5A 3MD1A 1XNRF 3PFEA 1FXLA 5HVGA 2P9CA 5AJ3J 1CC7A 3W5XA 4ED7A 3F56A 4G6VB 1JLAB 1OY8A 1YZ6A 2J8SA 2AP6A 1DY3A 4FYVB 4NRUA 1FWKA 1TK0A 4LQ3A 1RWUA 4OLOA 1PKUA 1GMUA 2DXFA 3ELHA 2C2OB 5KFZA 1SQFA 5KAKA 5ETPA 4ENOA 2N7YA 3QPIA 1T03A 3I31A 2R2SA 4P7VA 2YWGA 1F9EB 4M5HA 4QJVA 5B0BA 2CNNB 2WSCC 4DQRA 5LT5A 1MROB 3P5TL 2RKIB 3M6WA 2V8DA 2ZD1B 3UQSA 4I2PB 4OJGA 1SJ1A 3KLIA 2MQNA 1VBXA 4P9SA 1U47A 3AAWB 1HNWF 2WZ1A 4Q2MA 4K4VA 4ED3A 3NAIA 5GAHU 1CJUB 3B4MA 4CTAA 1N0UA 1PGZA 4CNZA 2JL9A 1T11A 2WBRA 4ANDA 2VBZA 3IGNA 4JI8J 4EBCA 2B4PA 3PX6A 3W66A 1T05A 3D7SB 4CT8A 3KG1A 2RRAA 1R7IA 2DD8S 2IC3B 2AYEA 3SQOP 2IM2A 3KHLA 1KFSA 3R2CJ 3H20A 2OFHX 4DPWA 4P52A 4ED0A 2YX1A 4IG0A 4FPRA 2YKAA 2LEPA 4IRCA 2HWHA 2JEIA 2XULA 4IO9Q 3MAQA 4DR5J 4H4OA 1PCAA 5E0OA 4X4UA 2CIMA 2OHDA 2OEJA 2VQFJ 3HT3A 4DFPA 4UQGA 4L75A 4Y00A 4KAIA 2YPZA 5LMUF 2FUG9 3TVZA 3KLHB 2DYAA 2J9DA 4F4AA 2CPFA 1S1TA 3NNCA 1DTQB 3IG1B 3DGVA 5KFFA 3N4WA 2GJ2A 5KTQA 1MWYA 1M5HA 1VRUB 1V5VA 4NXNF 1KOOA 1X4EA 4X4RA 2YKMA 2QEXS 4HI2A 1WG1A 2BJ3A 4IOBA 2HFZA 1CPZA 1IBMF 3M7VA 3FSYA 2VPXB 4JV1A 4PG8A 3O5TB 2FLPA 3UO0A 4M5LA 1GTEA 3TUIC 2XO6A 1HLWA 2QA2A 4PR6A 4LRBA 2DRAA 3G9CA 3NMAA 3IAM9 2PE8A 5D8HB 2HS4A 3ETMA 4JP8A 4L74A 3CT9A 1KHWA 1QSYA 2K2PA 4ZHRA 1R8PA 1RCOB 4C3MA 3N9UC 2XS2A 4X4SA 2YNFB 3R6LB 3D0GE 2Q3PA 3DYAB 3LO3A 2AKWB 5ADZA 4DI6A 4AQYJ 1TK8A 5KFDA 1DTTA 5KG7A 1XNQF 1C1BB 1FKOB 1SH0A 1MG7A 2ASDA 2B6AA 1NNDA 2BX6A 2I8EA 3E51A 1UVNA 1QSLA 3HT0A 1GK8A 3FFIA 2LA4A 4NMXA 1QD1A 5LJ3Y 2VPYB 2MZTA 1RKJA 1VLYA 2AEFA 1Q8IA 5FIIA 4WFNQ 4I64A 4DSIA 2QTWA 4JI0F 3MM9A 3IR6B 1TU0B 2POKA 3QSIA 1Z2LA 4KYZA 1XQIA 3AQPA 3LAMA 1M90T 1R6VA 4I67A 2NYIA 5CYMB 4DL7A 4OHXA 2GJIA 3SCKE 2LQBA 2WB1D 4RWWA 4C8OA 4RUAA 1YJVA 1FJGJ 4FYXB 1BXNA 3W64A 4KGVB 2V2KA 4LFAF 2M7SA 1NU4A 2AWZA 2HS3A 1J5EF 3D5MA 2J0WA 2HHVA 4PKDB 3S01A 2ACYA 3ITHB 2GIQA 4C9DA 4NA1A 4JI6J 2HEKA 2JLGA 2IPOB 3TAMA 4ZS6A 4C98A 4QYZJ 5F0WA 4FNIA 4O0IA 1HNXJ 4YP3A 1NPRA 2K7JA 3KKFA 2QYGA 2VG7B 5KFUA 5DDQC 2HMIA 2IBOA 4KO0B 3JQKA 4RW7A 1C1CA 3MM6B 2DPJA 2CZ4A 1X4CA 1L3TA 2V2VA 2XI3A 2GZOA 5M2UA 4R8UB 2XMMA 1QJHA 1F1BB 3K5PA 1EJ7L 5A8WA 4DCOB 3M8QB 3AFGA 3G96A 3R2DJ 4M5KA 2FHJD 1CULA 1XR6A 2BQRA 3QLHA 4Y2AA 1HYSB 7FDRA 5AE2A 4GKJF 1S57A 3OR2A 2XG8A 2DRBA 5HQ8A 1VQ7S 1P1TA 2XHCA 4CLZA 5HK4A 3KLFB 1D9FA 1WC6A 3CGIA 2BE2B 2EEYA 3PXGa 2PT0A 3I9ZA 3CCSS 2YY3A 4QR2A 5DG9A 3CJKA 1FFSB 4PG5A 3SIPB 4KBIA 3M9NB 3GR0A 3OFGA 5E3QA 2XM3A 3TQ1A 3H40A 4AE5A 2J0SD 3O6QA 1DJ0A 3SV4A 4MIWA 1H38A 2OPQB 3QWPA 2EFQA 2YQ3A 4O44A 4HLBA 3K8VA 3E2EA 2I5JA 3LQVA 3UDLA 2ZZTA 2NZ4A 2HHQA 4KHMA 5CD4H 1R3NA 2FVRA 1YJTA 4C0OC 3ZZUA 4EZ6A 2DNLA 2JSXA 2NXCA 3LALA 1EKSA 4USUA 2IY5B 1HBOB 1FX4A 5KFCA 1S48A 3CJ2A 3DXBA 2WVEA 3AA8A 5CYQB 1M1KT 3V2UC 4UTGA 4HDHA 3LGHA 4OYZA 3WZ0A 4PYAA 1U6FA 1CJTB 3D1OA 2IM1A 2ASYA 3R7BB 1FD8A 2HQDA 4NLSA 3D9BA 2XMAA 4BHQA 2K3IA 4DV5F 5ETNA 2ILZA 3I5BA 2DRDA 4NCGB 5HP1B 1Q53A 1SQEA 4G1IA 3ETOA 2UZAA 4KH1B 1M5KC 2DITA 1IKVA 4W4MA 2EPIA 1A0OB 1NDLA 2WW8A 3UVJA 2RQMA 1KOHA 4DN9A 3EE3A 4JI5F 1IWAA 4LT6A 4IQXA 3S1TA 3K0JA 3TW0A 5IQ6A 2GIFA 2KXNB 2ZITA 2DGOA 2RF2B 2ZBCA 1VJWA 3HDSA 3MMJA 4BC9A 4URGA 2XZTB 5I42A 4HHUA 4NCAA 2V2ZA 4Y2KA 2RDIA 1H74A 1SB6A 1U2CA 1GMVA 1X5PA 2A6MA 2MY7A 2W9BB 1FKPB 2B9WA 2P6SA 2XMKA 1RUSA 4Y34A 3HHDA 3US5A 1SVDA 1T8EA 4EBEA 2DR6A 2HNDB 2Z4PA 1UA0A 3JSMB 2ZC4A 2KU7A 3DN9A 1RAHB 3MAAB 2VBXA 5THWA 1XMBA 3NBPB 1UFKA 2Z57B 1SC1B 2HQGA 1KTVA 1NKCA 1FO1A 3PX4A 2IRUA 3N0VA 3K7RA 2VKZG 3W8GA 3QYYA 2GS8A 2K1RA 4EBDA 5LMUJ 3Q8PB 1AZSB 2V69A 1E6YB 2W2NP 2ZOGA 3K59A 2P9GA 2C3OA 2Z2LA 2JWNA 4OYOA 1S5ZA 2J7UA 2M70A 3HVAA 1KSPA 3A8EA 3BH6B 2D3UA 1OYEA 3M6XA 4NXNJ 3GFHA 1NK8A 1WORA 4P75A 1CS4A 1CVJA 2KT3A 1Q0NA 2DNNA 1WHWA 3LWLA 2V34A 3MEDB 1IBMJ 2Q66A 4CRJA 4LR8A 4X65F 3IP0A 4F67A 5FD1A 2BANB 2N3LA 3R5JB 4RU2A 1U26A 4NXMJ 4YB7A 1YJRA 5C24A 1B99A 4LR7A 3BSCA 3LOUA 2JNJA 2FLOA 5M2RA 3TJ9A 1ZH5A 1E6VB 2RE1A 1V3RA 3TZZA 1XK8A 3QIDA 1WWHA 4CLWA 4KIAA 4OZ2A 4N77A 1NZ8A 5BYSA 1S6QB 5KFLA 4HHJA 2H5JB 1CSJA 1ZBTA 2XNRA 1HBNB 1MMLA 1O5JA 3EX7B 1LWXA 2YQ1A 1NKEA 1VCTA 5C2CA 1D0EA 5H9EJ 3SCIE 3PFOA 1UVJA 5L38A 2QFJA 2RH3A 1S9EA 1R6YA 3TAPA 3GCXP 3EGVA 4C3KA 4AD6A 1XNQJ 4LSLB 1BQMB 1V6HA 1AT1B 5F3TA 4JI3F 5D3GA 1TL1B 3BJYA 5J1PA 2PEBA 1VRTB 2ZHOA 1Y10A 3M8RA 2C28A 1OS5A 2QGFB 3V5RA 2L3MA 3CMES 2YNHB 4JI0J 5F3ZA 1N5TA 4EFAC 2XS5A 2G13A 3MCMA 5HJXA 1SL0A 2B4UA 4QPXA 3JQJA 3IR5B 4YR3A 5KG0A 1GAOA 4R25A 1SBRA 2IJNA 1FNOA 3UR3C 4MMOA 1RJJA 5GAHI 3PEHA 1HPZA 2MKCA 4F0KA 5KFKA 1EP4B 2Y9HA 5CZXA 5HROB 3RB3A 4ZVOB 4LFAJ 2PMWA 4OZLA 2LU1A 1SL2A 1J5EJ 4EU0A 4KT0C 2VA2A 4ZOSA 2XZDB 5E3CA 4K5RA 4NRTA 4FP9A 2M0GB 1WTFA 1PILA 1JLEA 2E66A 3MURP 5D4NA 2R2RA 1S6OA 2CQPA 3POTA 4EYHB 1RT4B 3QRRA 5L46A 3FZ2A 5JMNA 3TQEA 2C3PA 1QE1A 1C2PA 4ZJLA 2BDPA 4DLGA 3ZC4A 2XTJP 2EBEA 2HGLA 3X3UA 2DH7A 4OJ3A 3RAMA 1KTQA 4RUCA 3D28A 4ZPBA 4WFXA 5HMWA 1OQ3A 4EZ9A 3MCOA 1IBLF 4NA3A 4L6V3 5KG1A 3KK1B 1NB2A 5HMYA 3GILA 4GKJJ 1HWLA 1BWEA 3NWGA 1GNKA 2QZ8A 2YKOA 3PKMA 4OHYA 1W25A 1NDKA 2ACMA 2ZKTA 4P73A 2NSBA 4OI0A 4J9UE 1PC5A 5L39A 2XSJB 2ZWOA 1RWWB 3H5SA 2EK1A 1U09A 1FE4A 2ASJA 4OZ1A 3EMTA 5D4PA 3O2IA 2IRYA 3MMCA 1C4AA 2OH2A 1N54B 2IVMA 1YRXA 3DOLB 2UP1A 3GLJA 1XR5A 4PG4A 1NDCA 4P2FA 2QL5B 4CM0A 4N56A 5HLFA 4RR5A 5IT4A 3ISNC 4ZLNA 2W24A 4O3QA 2F4FA 4L3NA 2HAFA 2VL1A 2HWTA 2M8DB 4IRKA 2MJNA 5EWGA 4MK9A 4YB6A 1G6BA 1LWCA 2HNZB 2DJWA 2RQ4A 3M32A 4OZJA 3M2VB 3OFFA 3Q8QB 2VFTA 3EWGA 4PXBA 2ZH6A 2H48B 2P9EA 5KFSA 2BRKA 4PEOA 1R31A 5LJ5Y 5AE3A 3EPIA 2F1FA 3OQ2A 4MJKA 3TZYA 1HI8A 4G1QB 3U1NA 4A48A 3DRRB 3OR1B 4DV5J 4QIWD 1OIAA 5HATA 1S79A 2VZ9A 4B9SA 4U8YA 3AJ2A 3NGDA 3KG0A 4X66F 3P5BP 2EI5A 3FJ2A 2BACA 1FCAA 2AEMA 4X84A 4CZCA 1S1XB 3DRXA 4F50A 4JI5J 3HHLB 4GVLA 2JDJA 4OX6A 5A0YB 4LBPA 1LKZA 1S97A 5HL7Q 1T9VA 2DXDA 2IRXA 1KVKA 1X5SA 1FEEA 1XTZA 1KQKA 2XYGB 4PPZA 3A8KA 2J5AA 5M2PA 2EXUA 1QAJA 5GAEU 3JTPA 4ETXA 4N8OA 1YJNS 3KFWX 4RW6B 2DK2A 3M6VA 3VZHA 1VQ4S 1VC0A 1C0TA 3MM8B 2PI5A 1EKRA 2VDIA 1NSAA 2E9TA 3KWMA 3QSYB 3NKYA 1TUVA 3D67A 1TL4A 4ILLA 1S1WA 1ROFA 1F3FA 4ZLPA 1T9TA 2GV1A 2IVYA 3DI6B 4GVBA 3V81B 2EFVA 4ID5B 3DOKB 1UCNA 5K14B 3HJVA 2HRTA 4BLGA 7FD1A 3JSYA 2VQEF 3VAMA 1YJ7A 2GHWA 1XJWB 2EW9A 1Q8KA 3ENAA 2VOPA 1SKRA 4G65A 1JLBA 2VASA 2XCPA 5CQGA 3OL7A 3OT9A 2R8GA 3MTJA 4CYUB 2KVQE 4F4XA 2CJXB 3EZOA 3NGSA 4PYDA 1G1XA 3CJ0A 3KLEB 5I3UB 3DNCA 1HD0A 2C3MA 1LW2B 3EGZA 3C19A 5IM0B 4CDIA 1U0HA 1CJVB 3BBCA 2QSFA 1OO0B 2A1BA 3QWUA 1NK0A 3LF0A 2MZSA 2WHOA 3MR6A 1Q7YT 5L8RC 3C15B 4AXIA 1HMVA 1N5YB 3KG4A 1AA1B 4X65J 3G82A 2UUBF 3HM9A 3CSKA 1TKDA 2O1PA 1FRMA 2MDAA 2GMJA 1VI7A 3TR5A 4YMEA 1FRKA 3ZO7A 4Y2CA 1Q1KA 2AGQA 1UA1A 3I0RB 5U47A 4I7FB 1N6QB 2UVWA 4DSEA 3LA0A 1VQLS 3GYNA 5KFAA 4F4YA 4NASA 4Q7AA 4ZVGA 2IDEA 3T1HF 1SKWA 5HSPA 2RSQA 2KFYA 1JB0C 5KFRA 3TO8A 4Z7CA 5BJRA 3CC4S 4HACB 2N4DA 4OI4A 4U67Q 3BSOA 3EZUA 2MGZB 1DRZA 2CQ2A 1REVA 1FNMA 4ELVA 2EKYA 2R7XA 5EWFA 2MZ1A 4J9VA 2G0JA 1F9HA 1AFJA 2C22A 2MKJA 4YEAA 4FVMA 3JAMY 4DUTA 5KFPA 4JI3J 5E33A 3OHAA 4RW4B 2V0NA 1R89A 1HR0F 1U1KA 1FVSA 2YPYA 5C25A 3NCQA 2HBYB 2JFDA 3TZXA 4XDDA 4RKUC 3CMAS 4MIAA 2Y3YA 5F41A 5F8JA 1GMWA 4FDFA 2K3KA 2YWWA 3N6LA 3PRDA 1R27B 4YFUA 2H51B 2KT5A 3OW2R 9ATCB 4WK1A 1M5PC 3ZXWA 2W4DA 2YNGB 3SBMA 4ZK7M 2R7RA 4E98A 3ADAC 3HLUA 2YVSA 4DPUA 3L9ZA 1WD6A 3K8WA 3W2WA 2UVRA 2DHAA 3OXLA 1QVFR 1S0OA 4I2QA 5DO2A 2V63A 4Y65A 1UVKA 2DIUA 1U8SA 2PN6A 3I0SB 4CLKA 1TKXA 3GFXA 3HSDA 2YWFA 3AH6A 3DRPB 3FZBA 1MU2B 2GO9A 4DG1A 2W7AA 1QUPA 2EWHA 2KRRA 2AEJA 1AB8A 2ALYB 5CCMA 2DB1A 4MAKA 2MKKA 2GC8A 2JEGA 1Q8BA 4FVCA 1RT2B 1S1VA 2JHEA 1UVMA 1V9OA 1FTRA 5F8GA 3DGPA 3HVWA 3H7HB 1FFGB 3NOGA 4RO0A 4USWA 2FGOA 3CCVS 1IR1A 3HZEA 1H2UX 2IFXA 4K4YA 2EFGA 1VQ6S 2F8HA 1NHVA 4OI1A 3THTA 2C2MB 5HMZA 2CNKB 2DH8A 3LANA 3O1LA 3HHKA 5KFMA 1IBLJ 4ID8A 4LIRA 2G4BA 4U7UD 3MUMP 4YB1P 5IC6B 1K73T 4ED5A 3OTDA 1HKAA 6FD1A 3D3CJ 1SJ4P 2RU9A 3QJPA 3W61A 5K9FA 3LTOA 4YS2A 4RUBA 2ADBA 2V2QA 3BGRA 3CCTA 3OTBA 1U1PA 3Q0AA 3K58A 1BY9A 2BBEA 3U1MA 3HSZA 4WYLA 2RMLA 4EWTA 1L3KA 4PAAA 2ZVIA 4PXEA 4P74A 1TKZA 5CXTA 2OEMA 3CC7S 4NE9C 2B0GA 4LF9F 2CQCA 2OFGX 1WKJA 2RHSB 2JRSA 5B0AA 1HNIB 1NUEA 1X31C 4Q0BA 4DV3F 1Y9OA 2H5EA 3M1VA 5H9FJ 3MCSA 4OMFG 2MEWA 3PRVA 3OHBA 3KNAA 2F5GA 4MKYA 2A2CA 4K59A 1U2RA 4WBFA 4ZVQB 1W7WA 3T3FA 3G87A 2ZOMA 1FTCA 4K0KJ 1RTIA 2E9RX 2MSSA 2HBQB 2HLUA 2HAIA 4NA2A 3CCUS 4KY3A 2ZM6F 1TVRA 2M52A 4I68A 4CI0B 2QLBB 5CAAA 1Q79A 2G2YA 3MR3A 1RWKB 2X7IA 1BWVA 3Q83A 2Y0SD 4PZVA 1NPPA 4V19J 1JLAA 2VFUA 2VICA 3VR1A 4ZP8A 2L41A 2NXJA 3NGUA 1HNZF 2RDJA 2XNQA 4DQPA 4FYYB 2W25A 4X66J 2HNYB 1SI9A 2YNIA 2ZH2A 4TLQA 4GMKA 2HKEA 2KN4A 3V4MA 3VWSA 3SSSA 4KJIA 4B3SF 2WTFA 1S99A 3O3LA 2XBPA 4AL7A 2J6UA 3CDWA 1MROA 3D1HA 3QT8A 4CLFA 2RKIA 4BCAA 1WF1A 3PG9A 2ZD1A 3MWBA 4I2PA 4QCLA 3AY0A 2ZBPA 3CWJA 1RT3B 3W63A 1UETA 1DQAA 2U1AA 2DVIA 3PW0A 4WE1B 4OIXA 5KFXA 1M5OC 2YX4A 2XLKA 1RU1A 1EIYB 5T41A 2MQMA 1MWQA 1CJUA 1P8GA 1QAXA 4MKAA 3KMSA 1VIXA 2MKYA 2E1MC 2D9OA 2WVDA 3EZ5A 4KSEB 1JJ4A 1H98A 4XAKA 1HNVB 4FPIA 4ZCLA 3TUJC 3OV7A 3FQLA 2QL7B 2AHOB 1Y7PA 5K8NA 2V4RA 5ETSA 1HI0P 1PYSB 3GYGA 3IRXB 1N5QA 2IC3A 3SQGB 4J37A 2FJVA 2VQEJ 1D3WA 2DGSA 2DNYA 3HI9A 3S8SA 1LWFB 2MKIA 4DR7F 1JMTA 2BQUA 4LFCF 1IXKA 1JJHA 3PJ9A 4A47A 3BO3A 3E01B 1ZAVA 1APSA 3I82A 1FWPA 3TZWA 5B0EA 3JYTB 4HHHA 3CW2C 3L95X 1U6ZA 2YXLA 2HURA 5K8PA 2HQFA 1WC5A 3HSJA 1NHKL 4DOZA 3KLHA 3OD2A 3W65A 2QJ3A 4OYMA 3C6UB 1DHMA 3WC0A 2IBKA 1SQGA 1DTQA 1LXNA 3IG1A 2KT2A 3CPWR 1HI1A 1VRUA 4IG3B 4J9RA 4WIQA 2V6AA 1RCXB 5A8RB 1T05B 2UUBJ 4USIA 5GADU 2DGUA 3MMBB 2H1YA 5JJBA 3PY8A 1R0BG 2HBRB 4C0BA 1PBUA 1QVGR 1UJ4A 3UNGC 3HFKA 4TXSA 5AXLA 3RW7A 4CH0S 1TKTB 1RHRB 5E2QA 3KHGA 2FVQA 3T1HJ 4CLTA 3TRGA 3UDVA 2C2RA 4DCPB 4FYDA 3T6BA 4USKA 5D15A 4TQRA 3R5BA 1GFWB 3Q8UA 4WTYA 4NYPA 3MR2A 2W7OA 3LP2B 2ZH4A 2QLWA 1TUGB 1J5OB 3V6KA 4QWCA 2FTRA 5HANA 4E8UA 2IVFB 2WB4A 3LPYA 2BXJA 4E2FB 4FBTA 2YNFA 1U1QA 1N0VC 3M9MB 4AL6A 2VIHA 2PFDA 3DYAA 2LXFA 3JAMU 4UY85 1KVJA 4ECXA 3W9IA 1HR0J 4X4NA 3QZ8A 1P9QC 4DWIA 1YG0A 2BE9B 3R9LA 4O23A 1FF2A 4X62F 2B8PA 3ZZYA 1C1BA 1FKOA 2IM3A 4A8FA 2XO7A 4M63A 3VQSA 3SSRA 1EARA 3T1YJ 3BREA 5IQQA 3C16B 4EK2A 2HSEB 3A12A 1UPPA 4O4RA 1AROP 1NHUA 4TY8B 4N76A 1TL3B 3I9V9 4A8WA 2Z56B 3MFHA 4KRWA 4ZPAA 1JLGB 1S4EA 2DNKA 4LF5F 2DR9A 2CPHA 3KJFB 2BABA 2W1BA 4PG7A 2HRUA 4LSZB 4OYAA 2B9XA 5DG8A 3SV3A 5CYMA 5GAEI 1X4GA 1FD2A 4DV7F 2W01A 3BPSP 2E7XA 1VQNS 2X3DA 3H5YA 3DLBA 1JKHB 2PI4A 3FCHA 2KXHA 3SXLA 1NB7A 1UEKA 3GV5B 1YTYA 2FB0A 4BWMA 4TY9A 2CG4A 2PA3A 2E29A 1TP7A 3IWXA 3ITHA 3EXCX 3N5BA 3GIKA 5A8KB 1FDDA 2B6AB 2ZNYA 1KR4A 1RI7A 2DHGA 5SZTA 4HTIA 1CG2A 2KI2A 1KLMB 4U8VA 5T14A 4KO0A 1S10A 1Z4UA 3CJQA 3DU6A 3MM6A 3L7OA 5IT0A 4FF3A 4ECTA 2A6OA 4XK8C 1NSKL 4R8UA 1HW8A 3QZ7A 1IVZA 1BHNA 3QAEA 5B08A 2V67A 1YI2S 3RBDA 1LWEB 2J7WA 5CZVA 2FJXA 1T94A 3BEGB 1SJRA 1JLCB 3CULA 1XWLA 2UVVA 2GQQA 2HIYA 4HDGA 3AOCA 1HYSA 3TWZA 1YVFA 5DQHA 3SZ2A 3Q89A 2IM0A 4WFBQ 1TFYA 1SJFA 4KGZB 5D6GA 3J7AN 1TUWA 3KLFA 3I87A 2ZJQQ 2D74B 3CO9A 3IWNC 3RBEA 2BE2A 4ZVHA 3VF0B 5J1EB 3BS9A 3C14B 3M2UB 1BE4A 3KHRA 4QOTA 2IHR1 2HFVA 4LF9J 4C8YA 3FRYA 1K47A 2JVRA 2CVIA 3NGRA 2QL9B 4DV3J 3TAMB 4XTTA 4C48A 5F8MA 3IWLA 1X4BA 2OPQA 1YK9A 3NXZA 1LXJA 3IBWA 1C1CB 5DGAA 3T6JA 1HBMB 4O3NA 4A8KA 2FDNA 2OSQA 3GIRA 4HI1A 3BO4A 3BQ2A 4RW8B 1WNEA 2QLFB 2ZM6J 2LQ5A 1NK5A 1HBOA 1URRA 4ATNA 1KS2A 2L9DA 1FKAF 3IFEA 1GX6A 5CYQA 1TZ0A 5B7WA 2XHWA 1YBTA 3KUHA 2ZH1A 2OPRB 4JI7F 4QR1A 3ULHA 1WI8A 1HNZJ 1WELA 4KHPJ 2JOQA 3RUBL 4LBIA 2HVIA 1VRQC 3AB2B 5FJ4A 1SC4B 2LP4A 2E5JA 4WP9A 4NCGA 1RWXB 3QQCD 2JFKA 2HFOA 1WEXA 5HP1A 2BJ8A 4B3SJ 1VMBA 3F0NA 2G2ZA 1NKBA 1RHJB 4PRFA 3J7A1 2H5IB 4ES2A 1IBKF 1NSPA 2AJ0A 2RS2A 3W1YC 3AXMA 3FBFA 1HQEB 1RKIA 4ALZA 3DLGB
chains in the Genus database with same CATH topology
1U0HB 5D0EA 4CLLA 1CJUB 4USVA 1AZSA 1WC5A 4OYAA 4OYOA 3ET6A 1CS4B 1CJTA 4CLZA 2GVDB 1U0HA 1CJVB 1WC1A 1CJUA 1WC0A 2QV6A 2W01A 5D0RA 1WC6A 4OYZA 4NI2B 4OYMA 1YBUA 4WPAA 4CLKA 4WP8A 1CJTB 1CS4A 1YBTA 2GVDA 4OZ3A 1Y11A 1CJVA 3R5GA 3G82B 4NI2A 1AB8A 1WC3A 3C15B 3C14B 4CLYA 4P2XA 4CM2A 4P2FA 4WP3A 4CLSA 4CM0A 3G82A 3C15A 3C14A 1Y10A 3MAAB 4WP9A 4USWA 4CLUA 4OYBA 4CLPA 1TL7B 1WC4A 1CJKB 1YK9A 3UVJA 3MAAA 5IV4A 3C16B 4OYXA 1CULB 1TL7A 2GVZB 1FX2A 1CJKA 3UVJB 5D0HA 4OYPA 4CLFA 4CLTA 3C16A 5D0GA 4USUA 5IV3A 4OYIA 1CULA 1FX4A 4CLWA 2GVZA 1AZSB 3MR7A 4OZ2A 4OYWA 2BW7A 5D15A 4P2MA 2WZ1A 3ET6B 4USTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0H B;  5D0E A;  4CLL A;  1CJU B;  4USV A;  1AZS A;  1WC5 A;  4OYA A;  4OYO A;  3ET6 A;  1CS4 B;  1CJT A;  4CLZ A;  2GVD B;  1U0H A;  1CJV B;  1WC1 A;  1CJU A;  1WC0 A;  2QV6 A;  2W01 A;  5D0R A;  1WC6 A;  4OYZ A;  4NI2 B;  4OYM A;  1YBU A;  4WPA A;  4CLK A;  4WP8 A;  1CJT B;  1CS4 A;  1YBT A;  2GVD A;  4OZ3 A;  1Y11 A;  1CJV A;  3R5G A;  3G82 B;  4NI2 A;  1AB8 A;  1WC3 A;  3C15 B;  3C14 B;  4CLY A;  4P2X A;  4CM2 A;  4P2F A;  4WP3 A;  4CLS A;  4CM0 A;  3G82 A;  3C15 A;  3C14 A;  1Y10 A;  3MAA B;  4WP9 A;  4USW A;  4CLU A;  4OYB A;  4CLP A;  1TL7 B;  1WC4 A;  1CJK B;  1YK9 A;  3UVJ A;  3MAA A;  5IV4 A;  3C16 B;  4OYX A;  1CUL B;  1TL7 A;  2GVZ B;  1FX2 A;  1CJK A;  3UVJ B;  5D0H A;  4OYP A;  4CLF A;  4CLT A;  3C16 A;  5D0G A;  4USU A;  5IV3 A;  4OYI A;  1CUL A;  1FX4 A;  4CLW A;  2GVZ A;  1AZS B;  3MR7 A;  4OZ2 A;  4OYW A;  2BW7 A;  5D15 A;  4P2M A;  2WZ1 A;  3ET6 B;  4UST A; 
#chains in the Genus database with same CATH topology
 1REG X;  4DPX A;  4YY3 F;  3ZZP A;  2RF2 A;  4A8X A;  4J91 A;  5BXI A;  3CCL S;  4J9P A;  4C4W A;  3CED A;  4MIB A;  2VD3 A;  2R2U A;  2H4Y B;  2V8G A;  3U02 A;  2MY8 A;  4OZ5 A;  2Y1R I;  2PO4 A;  3L7U A;  5HBM B;  4JV5 F;  1IQT A;  1FKP A;  1BUX A;  5DRK A;  1TQL A;  1MW7 A;  4PUO B;  3M4X A;  2WAQ D;  4CH1 A;  2YH0 A;  4QR0 A;  1N5S A;  4B9T A;  1N5V A;  4NWB A;  1RTD B;  2HND A;  4HTJ A;  3V6D B;  1YKW A;  3I5A A;  4OYB A;  4QWD A;  3JSM A;  1S49 A;  3FK4 A;  1F5A A;  1Q5V A;  3NMR A;  2GGP B;  2MQL A;  4DR7 J;  3MAA A;  4LFC J;  2HZV A;  1LV5 A;  4UOH A;  2FYX A;  1NSQ A;  3NBP A;  3UVJ B;  2DNO A;  2G9O A;  5L9N A;  1NME B;  3I32 A;  4DFM A;  4YHH F;  1HWI A;  3Q2S C;  3ZTP A;  4BBY A;  2ZH8 A;  3FEY B;  1W2B R;  1LFP A;  2HYI B;  3L4B C;  1AZS A;  3VAH A;  4QIV A;  2GMH A;  1E6Y A;  2XC9 A;  4IYQ A;  4B9N A;  4GC7 A;  3M2R B;  1S0N A;  3Q8V A;  4OQJ A;  1Q16 B;  5EWE A;  4CO4 A;  4PWD B;  1FER A;  2QX0 A;  3PM9 A;  3IA0 A;  3H90 A;  3QT6 A;  2I6W A;  1FRH A;  4B3R F;  1FK9 A;  3PEJ A;  1U7L A;  1Q81 T;  2W9C A;  3MED A;  1WKL A;  3GTY X;  2N7C A;  1KQS R;  3RJM B;  2BAN A;  1HHT P;  3DC2 A;  2ZDP A;  1I5O B;  4EGL A;  1T0T V;  2ASL A;  3W60 A;  2GVZ B;  2RUG A;  4M5I A;  1G4C A;  2DH9 A;  2RB7 A;  1JLF B;  2V50 A;  4I69 A;  4M5J A;  3OUY B;  4OYI A;  1T3O A;  4O0N A;  3B8H A;  3VAJ A;  2BYC A;  3SFU A;  1NBE B;  3M8W A;  4IOC Q;  3PHT A;  2HQI A;  1S6Q A;  2XQC A;  3MPD A;  3HKZ D;  3QGG A;  5BYR A;  2ALZ A;  1HBN A;  1U48 A;  3ISZ A;  4F0H A;  4J9K A;  2AT1 B;  1WSR A;  5F0U A;  2NSC A;  4I6Y A;  2F9J A;  1IKW B;  4ZLL A;  3CIZ A;  2O3D A;  4K4Z A;  1YDL A;  4PQU B;  4Y2M A;  3Q24 A;  4DCJ B;  3KK3 B;  1KNZ A;  2CJY B;  4NL5 A;  1EAY C;  3TVY A;  2Z2M A;  4GKK F;  3D6F B;  2LQ9 A;  4X62 J;  4LSL A;  1BQM A;  1TL1 A;  3CB4 A;  1X7V A;  2RS8 A;  1TL7 B;  3RW6 A;  1VRT A;  1B0P A;  1WC4 A;  3BGO P;  4WXO A;  2WSE C;  1NJZ A;  4JI4 F;  1G3O A;  2CJ9 A;  2CQ4 A;  3EJM A;  5L1L A;  1RWV B;  3M8Y A;  1H3D A;  4BS2 A;  2YNH A;  3FSI A;  1MMN A;  2H4W B;  3D54 A;  2XMU A;  1WI6 A;  3RGI A;  2AU0 A;  4LF5 J;  5C42 B;  3ZNU A;  3J81 j;  5ETO A;  5CH7 B;  2CXE A;  4XPC A;  2HPU A;  3GJR B;  1BQN B;  1XIQ A;  1RU2 A;  3PX0 A;  3UN3 A;  4PXD A;  2V8P A;  3DRS B;  5DDR C;  2GHP A;  3ISN D;  3BSN A;  4DV7 J;  2XY7 A;  3GSI A;  3UWT A;  2DT9 A;  2FY1 A;  3PCO B;  5J2M B;  4QYZ K;  3H2L A;  2BKP A;  2OSR A;  6FDR A;  2D69 A;  4CIO A;  4ZPT R;  3MOJ B;  1RB0 A;  1EP4 A;  1YHQ S;  5HRO A;  4IFV B;  2LEB A;  3PYD A;  4KKO B;  2RRN A;  4Y6I A;  3C2P A;  1D1U A;  1IWG A;  3AXK A;  1FXD A;  2IA0 A;  5KG3 A;  2Y1I A;  3MPY A;  4LF4 F;  2EG2 A;  4K7Q A;  4R0J A;  4ZPD A;  5LXR A;  1QAY A;  2R8H A;  3BBF A;  5GMK a;  3HPO A;  2XEX A;  1VOM A;  2CNL B;  2VFV A;  5AXM A;  3DDI A;  3I96 A;  2VON A;  4RU9 A;  1RT4 A;  2JEJ A;  4J7C A;  5KFN A;  3CCR S;  1FX2 A;  1AFI A;  4WJB A;  3MFI A;  3VVT A;  1VHF A;  4KV8 B;  2V8V A;  4AUK A;  3MUV P;  3T41 A;  3DLK B;  3BR9 A;  4FYW B;  4Z37 A;  2OJ3 A;  2X1G A;  2XY5 A;  4ILM A;  2QLX A;  2FJW A;  1GX5 A;  2PD1 A;  4ZJQ A;  4MT1 A;  3KK1 A;  3PO4 A;  4DL5 A;  2GA7 A;  1U8W A;  3GE9 A;  1S1U B;  4NLD A;  2F9D A;  5D4L A;  2B9E A;  2QO3 A;  4WKY A;  3CNQ P;  3GV7 B;  5KT7 A;  2XSJ A;  3VQT A;  2C2N A;  5KFY A;  3MEC B;  2FJD B;  3IXQ A;  2AYB A;  2PA8 D;  3BO2 A;  2EBG A;  4NLP A;  1U1O A;  3DOL A;  5B09 A;  5GAD I;  3TA0 A;  2HHH F;  1OPI A;  3LP1 B;  3CD7 A;  1F6T A;  1UL3 A;  1D9D A;  4BDP A;  3BN7 A;  3K5L A;  3VVU A;  3MOZ A;  3QIP B;  1RAD B;  2MLY A;  3F44 A;  2QE5 A;  2DO4 A;  2CNO B;  1UW4 A;  1ELO A;  2BKO A;  4MK7 A;  3LPE A;  4R5P B;  2R7Q A;  4ED6 A;  2O01 C;  3H25 A;  5T7L B;  5E7O B;  3HD1 A;  4NLG A;  2HNZ A;  4LF8 F;  5KFE A;  1N32 J;  2CJB A;  3M2V A;  5ETM A;  4NI2 B;  4DL0 C;  4WP8 A;  3EM1 A;  3DOM B;  4CO5 A;  4JI7 J;  4USJ C;  3FC9 A;  3CE8 A;  5E3R A;  1S6U A;  3BKU A;  1X8D A;  5J2N B;  1OJ4 A;  1U1L A;  2VKR A;  1M0S A;  4V1A k;  4DL6 A;  3ZTS A;  4G1Q A;  3H5U A;  4URQ U;  4WP3 A;  3DRY A;  1XER A;  2V9W A;  1N36 F;  1UW9 A;  4ELT A;  5F8L A;  2AJF E;  3DRR A;  3OR1 A;  4B3T F;  2FVP A;  4EMD A;  4F3Q A;  3OL8 A;  2VA3 A;  1KON A;  2H9Z A;  3ZZZ A;  2LMI A;  1RYR A;  4Q43 A;  3QAU A;  2NUU G;  2NQP A;  4RBV A;  1IBK J;  3GU0 A;  1B0T A;  1S1X A;  2GML A;  1TR0 A;  2KB2 A;  1XEZ A;  4YR2 A;  3HHL A;  4LF1 A;  5A0Y A;  4P10 A;  4J9M A;  1M1G A;  3NCR A;  3ET6 B;  4YY3 J;  3FRZ A;  3G8Q A;  5D0E A;  2EC2 A;  2CRL A;  2M3D A;  4ECQ A;  3WBZ A;  2K7K A;  1A6L A;  2OP5 A;  2R8J A;  3BR8 A;  3D6H B;  2XGP A;  5K8O A;  1RQ0 A;  2CAD A;  2ZDO A;  3KYL A;  2LXI A;  1RAF B;  5HJY A;  5ETR A;  2MQQ A;  5KOX A;  3L7P A;  1NXI A;  4RW6 A;  4UQT A;  2AZ3 A;  3VAI A;  3KXD A;  3MM8 A;  2J7K A;  4JV5 J;  1X9M A;  5KT5 A;  1X0F A;  3TNV A;  2QMX A;  3OTE A;  4UZB A;  1LEO A;  2R7V A;  2B7C B;  2X1B A;  3N28 A;  3DI6 A;  3V81 A;  4ID5 A;  3G6V A;  3DOK A;  5K14 A;  3MF5 A;  4X4O A;  3TAN A;  3AB4 B;  1ZTT A;  3Q86 A;  4DEZ A;  3AT1 B;  1S6P B;  1UJ6 A;  2LVW A;  1OWX A;  1TTH B;  1S0M A;  4WU3 A;  2XGQ A;  1SIZ A;  4N5S A;  4DSL A;  1FVQ A;  4UUW A;  4Z7Y A;  5EGY A;  1N88 A;  2JX2 A;  1BLU A;  4LFB F;  4ED2 A;  3QT5 A;  1VIO A;  4YHH J;  4CYU A;  2YBV A;  4CO2 A;  5ITH A;  2M2B A;  1U45 A;  1ZYQ A;  1RDR A;  1LOU A;  3QJL A;  4USV A;  4FS1 A;  1B3T A;  1MWZ A;  4DPT A;  4DSK A;  3FDS A;  4I56 A;  3KLE A;  5I3U A;  1U1N A;  2CJQ A;  2YKP A;  1LW2 A;  5KFB A;  5DDP C;  5DZ7 A;  3CIM A;  1LW0 B;  1CJV A;  3EIC A;  1B0V A;  1FI4 A;  2V5H G;  2XSF A;  2YWE A;  3GZ7 A;  4F7V A;  3OVS A;  1U02 A;  2DO0 A;  2Z2Z A;  1KEK A;  2ZZM A;  4B3R J;  3CC2 S;  4I0W A;  3VAF A;  3T19 A;  3C15 A;  3TJA A;  1N5Y A;  2ZBR A;  2HVD A;  5DDO C;  3CJ5 A;  4DZD A;  1NJX A;  1Y4Z B;  3FGV A;  1RK8 A;  2LXU A;  1RA6 A;  2YH1 A;  4K2J A;  5KG2 A;  1BC6 A;  4IH7 A;  4B3M F;  2VOD A;  2R9L A;  2NXN A;  2VG6 B;  1XNR J;  4KGK A;  3B4D A;  3OPK A;  3I0R A;  1JXL A;  4I7F A;  1N6Q A;  3WQP A;  1DZ5 A;  4LJM A;  5H9E K;  2JH3 A;  4WWS A;  2D3O 1;  3K57 A;  1IKX B;  2W2O P;  2CQ1 A;  3KJN B;  2CQI A;  2BA9 A;  3HX9 A;  2JLF A;  5F8N A;  4NLY A;  1Q86 T;  2G2O A;  4AXJ A;  3M8P B;  1WC0 A;  3CD0 A;  2HFU A;  4HAC A;  2X1F A;  1YWX A;  2DXE A;  3GJT B;  2MGZ A;  3DU5 A;  4ES3 A;  3KK2 B;  2DGQ A;  1F0X A;  4WII A;  4A8O A;  2L48 A;  3LAK A;  4CQ1 A;  4DX8 H;  4EO6 A;  2UXD F;  1XN9 A;  3WIU A;  3RTV A;  4GKK J;  4KE5 A;  4QZV B;  3CCJ S;  4FZV A;  2ABY A;  3RRG A;  2DNP A;  5DG7 A;  4RW4 A;  2RHQ B;  4TU7 A;  2NXU A;  1HNW J;  1Q5Y A;  4QYR A;  1ICE B;  4JI4 J;  4O3P A;  2GFF A;  4LQ9 A;  2UXB F;  3GJQ B;  3UD3 P;  1XMQ F;  2FC8 A;  2BVZ A;  4OYP A;  1X4D A;  3HCX A;  4X4V A;  4ERD A;  2K8G A;  4UZC A;  2Y8Y A;  2DNZ A;  1FDB A;  4AYB D;  1VHI A;  1F2G A;  5E3P A;  2AJ1 A;  4ECR A;  2DY1 A;  2P2C B;  3CJ8 A;  2UXC F;  1PG5 B;  3BGF A;  4WU2 A;  2YNG A;  1XBW A;  3DM2 B;  5EX3 A;  4F0M A;  1FDN A;  3QGI A;  3H2V E;  5DGB A;  2LLZ A;  4HYK A;  3MPU B;  3T9Z A;  2QV6 A;  4ZVF A;  3AOA A;  1KKH A;  3D6M B;  1JLQ B;  5KT2 A;  5BR8 F;  3I0S A;  3DKD A;  2NXE A;  3HHL C;  3IGV A;  1WEY A;  3DRP A;  1MU2 A;  1YRT A;  2FZG B;  2BEF A;  3E3X A;  4LF4 J;  3KDO A;  3U1L A;  2D7S A;  5J1N A;  1RT2 A;  2Z8Q A;  2IYI A;  3BKF A;  4F3O A;  4ZN1 A;  4K50 A;  1R8C A;  2ZBQ A;  5IV4 A;  2XMW A;  1P27 B;  4B02 A;  2OPS B;  3QAT A;  4QWB A;  4DX7 A;  1K1Q A;  5F9L A;  4LF7 F;  5C2G A;  2J9D E;  2WOM B;  2AGP A;  3AD8 C;  1KD1 T;  2CAJ A;  4JYA F;  4FXD A;  4P2M A;  1QAI A;  2VFR A;  1L3S A;  2AV5 A;  2HHW A;  1RTH B;  1UKU A;  2QT7 A;  2GAG C;  2YKN B;  3ENW A;  3SFG A;  2WCX A;  1W2I A;  1VQ5 S;  2EFP A;  2A10 A;  1T95 A;  2Z58 B;  2VF3 A;  4URS A;  2AQ4 A;  4H4M B;  4MTP A;  1U2F A;  3O44 A;  3BSA A;  2XYP B;  2LYV A;  4ZLJ A;  1DFD A;  4JBC A;  4ZVU B;  2HHH J;  2MHE A;  5DS7 A;  3DGP B;  1KC8 T;  4WTO B;  2AYG A;  1RTJ B;  1CJK B;  2QIF A;  1HNI A;  1GMW D;  4KH0 B;  1WDD A;  3DFE A;  2OO4 A;  2DNH A;  2BOA A;  2N82 B;  3OSN A;  3KHH A;  1H2V Z;  1UTA A;  4C8K A;  1S76 D;  5BYQ A;  2VB6 A;  2WRM A;  4TN2 A;  1P1L A;  4AL5 A;  2F8E X;  3BH7 B;  3W7B A;  5JVG Q;  3JTO A;  4NCB A;  3KOA A;  2HS0 A;  3IR7 B;  4LF8 J;  1S4F A;  2LA6 A;  5KT3 A;  2HVE A;  3T5J A;  3RAQ A;  3TVK A;  2K06 A;  1KFD A;  1Q4R A;  4L3K A;  3IAS 9;  4ZN3 A;  4NYO A;  5HO4 A;  3HVT B;  2DR8 A;  5KT6 A;  4D3G A;  4FF4 A;  4IDK B;  2AGO A;  2FJB B;  1N36 J;  2C3Y A;  4ED1 A;  1Y00 A;  1IN0 A;  2E7W A;  3FUY A;  3CCM S;  3CJS A;  5FLX Y;  3PYE A;  3C6T B;  2KM8 B;  3PVX A;  2HNY A;  1K44 A;  1SH3 A;  2QA4 G;  4FNH A;  1MN9 A;  3QRP A;  1HQU B;  2Q79 A;  1KWM A;  2KJW A;  1D09 B;  4HT7 A;  4ECZ A;  4DSJ A;  1C0U B;  4DR1 F;  2AJQ A;  1WF0 A;  2E9Z A;  1B70 B;  3BPD A;  3PJW A;  1W26 A;  3PKY A;  4D3H A;  1RT3 A;  1WTB A;  2J6T A;  4WE1 A;  1FE0 A;  1YJW S;  2R3V A;  2UUC F;  3AJD A;  3LW5 C;  2MZJ A;  4FN5 A;  1HNV A;  1RBA A;  3I4H X;  2FHO B;  3MEE B;  1RAC B;  2MKH A;  3OVA A;  4U95 A;  1WSV A;  1RAJ A;  3UDC A;  5EUH A;  2MYF A;  3QFH A;  3IRX A;  4N8N A;  2RJZ A;  3N6M A;  3SQG A;  3JB9 k;  5IXU A;  2YNI B;  4QIE A;  3G6Y A;  1LWF A;  4RBT A;  2L08 A;  4LFB J;  2DCU B;  4IFY B;  2EFN A;  2CQB A;  1JXV A;  1Y5L B;  1ZAW A;  1U25 A;  1RBL A;  5C5J A;  4DN0 A;  3HK2 A;  2IMW P;  3FMW A;  2WBM A;  3VCD A;  8AT1 B;  5HMX A;  2I9S A;  3E01 A;  4K8R A;  1ZM3 A;  2CFX A;  1PJ6 A;  5ETQ A;  2NR0 A;  3JYT A;  1GT8 A;  1S9G B;  1GH8 A;  1WC1 A;  1RLC L;  2GW8 A;  3BM7 A;  3HZG A;  4A8Y A;  2R7S A;  4JB8 B;  3SDE B;  3J81 Y;  3GFY A;  2OEL A;  2DR7 A;  2HZA A;  5KFG A;  4Y0F A;  4YQW A;  1ZOT A;  2QA1 A;  1BD6 A;  4J9L A;  3C6U A;  1JX4 A;  1H0H B;  3HP6 A;  1QLN A;  3N5F A;  5D4O A;  3M05 A;  2VPZ B;  1NM2 A;  5KFT A;  3QGP A;  2ZHA A;  4IG3 A;  2HHU A;  2BJ1 A;  2RU3 A;  5A8R A;  3H42 A;  1MMD A;  2MZR A;  4RLE A;  3ICL A;  3OXF A;  3MMB A;  3MM7 B;  1WG4 A;  4B3M J;  2OIH A;  3G8T A;  2HGM A;  1UZD A;  3MMA B;  3OFH A;  2DNG A;  3HUL A;  2OEK A;  1WKK A;  3P96 A;  1WG5 A;  3NY0 A;  1VLO A;  2W2Q P;  1NAQ A;  3WX8 A;  3CTR A;  3G8S A;  4GRS A;  3X1L B;  2C42 A;  1SC6 A;  1T9Y A;  2FY8 A;  1UWB B;  1MNE A;  2MLX A;  1TKT A;  3K2Y A;  4DL3 A;  3K5O A;  3BDE A;  2EFO A;  4FF2 A;  2P6T A;  4NLQ A;  4WFY A;  2F63 A;  3PYF A;  3UCZ P;  4IKA A;  2OKQ A;  1H7X A;  2Q6B A;  2AJ2 A;  1EET B;  5KFI A;  3UI3 A;  2HZC A;  1I94 F;  4RNM A;  3CDB A;  4YB5 A;  4DLE A;  1HHS A;  2VH7 A;  4NLV A;  3KLV A;  1YBU A;  3LP2 A;  4FKX A;  4U9R A;  1HW9 A;  1UAW A;  1UEV A;  1J5O A;  1L3U A;  2IAJ B;  2UVU A;  1HIY A;  2UXD J;  4DS4 A;  5AE1 A;  4ZP6 A;  3N01 A;  4B08 A;  5L9X A;  4CM2 A;  2W7P A;  1VBK A;  4ECW A;  1CBK A;  1L5U A;  1X9W A;  4ZVR B;  2KL8 A;  2BW2 A;  2W9A A;  2B5J B;  1K0V A;  1BMQ B;  2XMJ A;  3GIJ A;  3HXM A;  2YWK A;  2FIU A;  2KKH A;  1ZM4 A;  2Y8W A;  2UXB J;  1QDU B;  1XMQ J;  3HFV A;  2E7V A;  3QO9 B;  4NXM F;  3C16 A;  1FA0 A;  1C4C A;  2BJE A;  4USM A;  2CQ3 A;  4TY8 A;  4ICL B;  1T02 A;  4HL9 A;  4EEY A;  2UXC J;  1GTH A;  1TL3 A;  4ELU A;  4QWE A;  4A8S A;  1KQF B;  3PW2 A;  1RT1 B;  1JLG A;  1B7Y B;  4KFB B;  3CF5 Q;  3NL0 A;  4M8L A;  5ETL A;  2Y1L B;  5G0R B;  2ADC A;  4P72 A;  3MEG B;  5BR8 J;  1S7H A;  4EO8 A;  1NZA A;  3TAQ A;  1SV5 B;  3AOD A;  1JKH A;  3NS7 B;  3LP0 B;  2BR0 A;  1BQX A;  3H4B A;  1TV6 B;  1ZA1 B;  1GXL A;  1R0A A;  4BWJ A;  2B3T B;  1LNQ A;  4MYT A;  1RAO A;  1N4L A;  3CUN A;  1IKY B;  1UMJ A;  3BQ1 A;  1VQM S;  2FPH X;  1F9F A;  1NJW A;  4P6Q A;  2BJ7 A;  5A8K A;  2DIV A;  3UE2 A;  2WON B;  5H1S V;  2ROP A;  2AW0 A;  1K8A T;  1KLM A;  3GPA A;  4LF7 J;  4ZVS B;  1N34 F;  4JYA J;  2ERR A;  2W4C A;  4YR0 A;  5DM6 Q;  4C7Q A;  2MQ8 A;  1FFW B;  1UEU A;  2ROE A;  3ILL A;  1UP1 A;  4L76 A;  2O5D A;  3KJV B;  4CWB A;  2COL A;  1LWE A;  3P8B B;  5RUB A;  2GVD B;  3GR1 A;  2CKW A;  1TEL A;  3D3B J;  1S72 S;  1JLC A;  1EQ0 A;  2G0C A;  1IBC B;  3ZTQ A;  2GAH C;  1NK7 A;  5H9F K;  2DNM A;  4DV2 F;  1ZAX A;  4HT5 A;  4F26 A;  8ATC B;  2NZC A;  5IZH A;  3R7S B;  2M9K A;  1J2V A;  5J1E A;  3C14 A;  4NML A;  3M2U A;  2DR5 A;  1RBO B;  5LMN F;  4O4G B;  5JXS A;  2E5L F;  4IRD A;  4K5S A;  4TQS A;  3KLG B;  3FEZ A;  3HJF A;  2D3Z A;  3AD7 C;  1KQG B;  2V4J B;  3PR5 B;  4OLP A;  4U7U K;  4OX8 A;  3OLB A;  3TP2 A;  3TOQ A;  2KYZ A;  2DGX A;  1IJF B;  4TYA A;  4RNO A;  3NNA A;  4MYU A;  4L73 A;  5J2Q B;  4RJV A;  1HBM A;  1IUJ A;  2CVE A;  3EVO A;  4C8N A;  1NH7 A;  1M5S A;  5B0D A;  2RQC A;  3DDN A;  2VDH A;  4RW8 A;  1FWL A;  3RAX A;  3FVY A;  3TJ8 A;  4Y2I A;  1WOO A;  1EHW A;  1QUV A;  4C11 B;  1JQG A;  2HWI A;  2D1C A;  1PJ5 A;  4X4P A;  2F8M A;  2NPF A;  5CD4 A;  4P2X A;  3S7R A;  5E3A A;  2OPR A;  2R42 A;  1O6X A;  3THP A;  2CA9 A;  1EQM A;  1YIT S;  4WKR A;  4MFB B;  3R5C A;  2QMW A;  2RQK A;  1SL1 A;  5EDW A;  4QIF A;  4LR9 A;  5FLX U;  4Q2L A;  3JQM A;  3LUY A;  1M5V C;  2VV5 A;  4WCE Q;  2LDI A;  1SUQ B;  5SUH A;  2DCL A;  2GO8 A;  1G2E A;  1SJQ A;  4OHZ A;  2HHP A;  1YBA A;  3PV8 A;  3WX4 A;  4DR1 J;  5CA5 A;  2AMC B;  2OI2 A;  3VV2 B;  3OL9 A;  3S6E A;  5F8I A;  1VQK S;  2YQ0 A;  3ZZ0 A;  1QY7 A;  2V94 A;  4IR1 A;  3W62 A;  1HQE A;  2XI2 A;  4DFJ A;  2UUW A;  3DLG A;  3G71 S;  2KYX A;  3V4I B;  2UUC J;  2RAQ A;  2J0X A;  3FCV A;  3HFZ B;  3DLE B;  2DY9 A;  4UOF A;  2VHG A;  4YUD A;  2RNE A;  1YRU A;  4C8M A;  5HI7 A;  4IR9 A;  4USH A;  2CDR B;  2JEF A;  3R6G B;  2VUG A;  4QIG A;  4U7C A;  3A4T A;  1J27 A;  4Q8E A;  5HBM A;  4TU9 A;  1VBY A;  5HQM A;  2E44 A;  2VFS A;  4RW9 B;  1PO6 A;  1DLO B;  4PUO A;  3KMQ A;  3CD5 A;  4PAB A;  2AYM A;  3Q2T C;  3OTO F;  1S0V A;  3R27 A;  1P6T A;  2BMB A;  2FVS A;  5LM7 E;  1RTD A;  3V6D A;  3OLA A;  4H54 A;  2LQ8 A;  4DV4 F;  1KVI A;  3F41 A;  2DGV A;  2R7U A;  2GGP A;  1PAE X;  2DEJ A;  2LKZ A;  2R7T A;  3ZTR A;  3IS9 B;  4PPD A;  2IJF A;  4CO0 A;  2MJU A;  3B82 A;  3PO5 A;  4DF4 A;  1TL5 A;  4ECS A;  4TVA B;  2PC6 A;  5FDL B;  2ZE2 B;  3PW7 A;  5CYJ A;  1R43 A;  4ECY A;  1N8R T;  2YX7 A;  3A1Y G;  2RRB A;  5A6P A;  1PYO B;  3OJS A;  4GC6 A;  2MKS A;  1OYD A;  4ZIT A;  4RZR A;  3M30 B;  3Q23 A;  4NLT A;  5JUM A;  3J81 U;  2JC1 A;  4C8Z A;  2PII A;  4QW8 A;  2ZC3 A;  1AYE A;  3M2R A;  4JI2 F;  4B9L A;  3G2X A;  4LRD A;  1XC9 A;  3OJU A;  5CCL A;  4HKQ A;  1D8Z A;  4PWD A;  4Q8F A;  1QM9 A;  2QN6 B;  1CQM A;  5J2P B;  2AF6 A;  5DZ6 A;  1RLD A;  4KPY A;  3SI8 A;  1D9A A;  3K17 A;  3DMJ B;  3FCW A;  4TU8 A;  4B9V A;  1RT5 B;  4FKY A;  2KVI A;  2GNK A;  3FNN A;  4NLW A;  2VG5 B;  3H2U B;  3EVM A;  3QT7 A;  3I56 S;  2GVZ A;  3MR7 A;  1KBR A;  5IT9 Y;  4ILR A;  2CQ0 A;  2CJA A;  1OSD A;  1YZ7 A;  2OPP B;  4B3O B;  1RT7 B;  1JLF A;  2DKO B;  2GCF A;  3OUY A;  2DPI A;  4P71 A;  2ZFH A;  2D41 A;  1I94 J;  3TUP A;  3GB0 A;  1WDT A;  2NUH A;  1HBU B;  1M1H A;  1S77 D;  2L9N A;  5D0R A;  2UV8 A;  4H4K A;  5KFO A;  2DBB A;  2MMY A;  4A8M P;  1YGY A;  2GHV C;  1F5B A;  3T5L A;  1VS3 A;  4M5G A;  3B54 A;  4EI2 A;  4M5D B;  1Y0H A;  3R5A A;  3RYL A;  5IC4 B;  4ECU A;  2H54 B;  1IKW A;  5I4M A;  4JI1 F;  2HRY A;  4LSN B;  3MM5 B;  4PQU A;  3FQK A;  2CDQ A;  2KRB A;  1RAG B;  3W2V B;  1VIS A;  4F3M A;  1RT6 B;  2DEI A;  1N52 B;  3KK3 A;  1OQ6 A;  1FK9 B;  3CCW A;  4AT1 B;  2AZ1 A;  2W9C B;  2MHN A;  1H7W A;  4XO0 A;  1NCL A;  4J9N A;  4YDX A;  1RWM B;  2A3J A;  1N56 A;  3G4S S;  3KNG A;  1S7I A;  3RBZ A;  4OYX A;  2ZJR Q;  1LK7 A;  1TL7 A;  3UN2 A;  1YJU A;  4OV6 A;  4B17 A;  1MLA A;  4NLU A;  1NRK A;  5IV3 A;  2E1A A;  2F40 A;  1YLX A;  4CT9 A;  4TYB A;  5A6W A;  3UR0 A;  3QFW A;  2KG1 A;  3DDK A;  2KDO A;  3G86 A;  4ANE A;  1X4A A;  1JWW A;  3D2W A;  1VC5 A;  1SXL A;  2KHC A;  2CQG A;  3MZI A;  5C42 A;  1QTM A;  2J9E A;  2MQP A;  4KQZ A;  1BQN A;  2AJ4 A;  1BGX T;  5K20 B;  4NEZ A;  1H6K X;  2QC3 A;  3DRS A;  2PFF B;  3HSG A;  5B0C A;  2ATC B;  4HH1 A;  4WFA Q;  5J2M A;  2WW4 A;  1T03 B;  3G6E S;  3RB0 A;  2DHS A;  4F36 A;  3MTK A;  3RR7 A;  1KDN A;  3BGL A;  5K8M A;  3GIM A;  4IFV A;  1TAQ A;  4K4T A;  4KKO A;  1H72 C;  4IO1 A;  2ZJP Q;  4GO5 X;  1MN7 A;  4W92 B;  2FLN A;  2BJD A;  5DM7 Q;  4LF6 F;  3KLI B;  5L1K A;  4TLR A;  1Z1Z A;  2VPW B;  1X0P A;  2FQQ B;  1ZA2 B;  2E1R A;  3M9O B;  1U24 A;  4N47 A;  2CUY A;  2PGC A;  4KHR A;  1U0S A;  3H0P A;  1N34 J;  1EZZ B;  3SSQ A;  3B6B A;  4U96 A;  3D1Q A;  4CTA B;  3GP9 A;  1CC8 A;  2RT3 A;  1Y3K A;  5KFW A;  2Z30 B;  4KV8 A;  3DLK A;  4I1T A;  2FJA B;  4ZP7 A;  1XR7 A;  2R8I A;  2PEH A;  3A3N B;  1PJ7 A;  4DR2 F;  5A76 A;  4M5N A;  4FXW A;  1TMM A;  3W9H A;  1YX2 A;  1K1S A;  2DNQ A;  4DV2 J;  3MD3 A;  4ES1 A;  4B9U A;  4ZVE A;  4ZVT B;  3W3S A;  4J9Q A;  2ZOF A;  3JSB A;  1S1U A;  4C6A A;  4DFK A;  4IG0 B;  2CWX A;  2OD6 A;  4FXV A;  5F9N A;  5LMN J;  5EN1 A;  3C3L A;  4K4U A;  2ZZN A;  3MEC A;  4IH6 A;  2E5L J;  3CMQ A;  3MCN A;  3IM9 A;  4ZVP B;  4UF4 A;  4H4O B;  4QBU A;  2X51 A;  2WVF A;  4S0M A;  4V19 X;  1WHY A;  2NLW A;  2RDD A;  5I3P A;  4DBQ A;  1WOS A;  4DR4 F;  3LP1 A;  2CPI A;  4ZPV R;  2KJV A;  3QIP A;  1R8H A;  3AHP A;  4LVO P;  4DX5 A;  1S1T B;  2H65 B;  4R5P A;  2O67 A;  1Z2Z A;  3CJ4 A;  1KHV A;  3MGJ A;  5T7L A;  4ZJO A;  1AXQ A;  3QMQ A;  3ENV A;  2FZC B;  2J76 E;  3JTN A;  1DQ9 A;  2YKM B;  4F4W A;  2CJK A;  3GV8 B;  2DNR A;  3GG0 A;  1O0P A;  5HVF A;  5G4D A;  2W4P A;  3JSR A;  3BF4 A;  2AIR B;  1FNX H;  4DMZ A;  4NI2 A;  4M5M A;  3K5M A;  4AFF A;  3DOM A;  2V4Q A;  3N79 A;  2BUN A;  3NAH A;  2BE7 D;  4DUZ F;  1RWN B;  2BJ9 A;  2FC9 A;  3F73 A;  5J2N A;  5KG6 A;  4PCQ A;  4Y3C A;  3VTI A;  3I55 S;  4OX7 A;  1FES A;  3VZI A;  3B78 A;  4H4K C;  3DLL Q;  1U49 A;  6AT1 B;  3PAC A;  4DV1 F;  4ZHR B;  5EHH A;  2FHJ A;  1FEH A;  2VBY A;  3M8S A;  1NEE A;  3A8J A;  2DTJ A;  1ZZN A;  4ZIW A;  2OTJ S;  1AUS L;  3ENQ A;  4RL1 A;  4F2R A;  2E1P A;  1IR0 A;  3ET6 A;  4K0K F;  1H2T Z;  2JLE A;  2V9K A;  4LUB A;  1TAU A;  3CJ3 A;  3BYR A;  1DTT B;  1FRI A;  2VC0 A;  3J7Y U;  4CNY A;  4WYW A;  2XLI A;  4NYZ A;  1T3N A;  2CPE A;  2BOP A;  1RWO B;  3MXH P;  1RAA B;  2CZV C;  3IC1 A;  1QTN B;  3AA9 A;  2VG7 A;  4MKB A;  4DV6 F;  2XLJ A;  3FFI B;  2HGN A;  3PHE A;  4DL2 A;  4CCH A;  1FRL A;  2JVO A;  3MPW A;  2YWH A;  4X64 F;  4OV1 A;  3MM9 B;  3OTO J;  4OX9 F;  4NLO A;  3UN5 A;  2CPD A;  3BZQ A;  3BQ0 A;  1O8B A;  4P2S A;  2HFN A;  3M8Q A;  3HHN B;  2LCW A;  4DV4 J;  2M5Y A;  1RHQ B;  4CO1 A;  1T9U A;  3JS9 A;  1S6P A;  2MXY A;  2CPZ A;  2HQC A;  1CLF A;  3T1A A;  1N33 F;  2XYH B;  4OJH A;  1ITP A;  2J8A A;  4TNO A;  2FD2 A;  3FBE A;  4OI6 A;  3GON A;  4DU7 A;  4CLL A;  2LFV A;  2HHT A;  2W2M P;  3VAL A;  3V6H A;  4LRF A;  4KGX B;  4F02 A;  2B43 A;  7AT1 B;  1Q7L B;  2AX1 A;  3D68 A;  3W5Z A;  3MUT P;  2NS1 B;  4RNF A;  3IBF B;  1OPZ A;  2M8H A;  4OJ1 A;  1GQE A;  3SYZ A;  4JI2 J;  2ZUG A;  1VR6 A;  3BN4 A;  4GO7 X;  1EB0 A;  1ZET A;  2HMI B;  4OHW A;  1LW0 A;  4RW7 B;  2UU9 F;  2B4V A;  2ROG A;  4WXW A;  2OTL S;  3NP5 A;  1WEZ A;  4HEA 9;  2BRL A;  3RB4 A;  2ZUA A;  1RHM B;  5HN0 A;  3EDR B;  2XS7 A;  3RR8 A;  1RA7 A;  2OUG A;  2WVB A;  1YQH A;  3TA2 A;  4NEY A;  5E41 A;  1SKS A;  1ACM B;  5A8W B;  5DLG A;  1KLN A;  1CUL B;  4Z2X A;  3NNH A;  4LRA A;  4QW9 A;  5L1I A;  1HWK A;  2U2F A;  4ITS A;  3QLH B;  1P9Y A;  1GXT A;  2GQ2 A;  2VG6 A;  3TI0 A;  3HHL D;  4W90 B;  3OR2 B;  1SC3 B;  5IT9 U;  3VHQ A;  2F65 A;  1HL6 A;  4DDF A;  1N48 A;  3FMB A;  2PSZ A;  5DJB A;  3CJK B;  3GYX B;  1VQP S;  1CJT A;  2HBZ B;  3P45 B;  1Q82 T;  1IKX A;  3SMZ A;  3IO1 A;  4JUZ A;  5IFM A;  3IRW P;  3C8Y A;  1KRP A;  5MAO A;  4DQI A;  1FDA A;  3M8P A;  4F04 B;  4J5O A;  3CJT A;  2KG0 A;  5EX0 A;  2ZH5 A;  3HVR A;  3KK2 A;  4JI1 J;  3A13 A;  1MSW D;  4O44 B;  1PYT A;  2I5J B;  2CQD A;  4IQM A;  3ONQ A;  4A4J A;  2CPJ A;  3TX0 A;  1RHU B;  3BGU A;  1RAE B;  4C97 A;  3UCG A;  3VAK A;  3NG8 A;  3FKB A;  1WAC A;  4ANC A;  3PIP Q;  4PQA A;  2BKN A;  3DHW C;  1VDH A;  2R4F A;  1NO8 A;  2DIS A;  4NX9 A;  2KHD A;  2G1D A;  3PW5 A;  2R7W A;  3EUN A;  1R8A A;  2J9C A;  4OI2 A;  1FT8 A;  5LSR A;  5ETV A;  2J0Q D;  2SXL A;  2UUT A;  2W9B A;  3IBC B;  3BYP A;  2OMO A;  1VBZ A;  3DM2 A;  3P3D A;  4B9M A;  2Z0G A;  3GQC A;  3Q8Y A;  2QSW A;  5IWA F;  4ZCI A;  4F8R A;  1JLQ A;  3UDE A;  1IKV B;  2F3J A;  3M6U A;  1WF2 A;  4LVN P;  1T9X A;  4WFZ A;  2N4C A;  2R8K A;  4ZIV A;  4LF6 J;  3D4J A;  4QQB A;  3KUE A;  2QMU B;  3R7N B;  3J80 Y;  3G6X A;  3WIV A;  2HVZ A;  2MLZ A;  2I1R A;  1WUU A;  4RNN A;  4KC5 A;  3FEX B;  2KO1 A;  4UW2 A;  1B64 A;  5I42 B;  4DSF A;  4A8Q A;  4QPT A;  2OPS A;  2EK6 A;  3QNW B;  4C3L A;  3RRH A;  3T1Y F;  4J90 A;  2E5I A;  2WOM A;  5AXN A;  4DR2 J;  4ZMM A;  4A46 A;  1RSC A;  1RTH A;  2VJU A;  3J7Z 5;  1UWA A;  2UV8 G;  2YKN A;  5ETK A;  1JJ2 R;  4OZN A;  4F4Z A;  3PJX A;  1VYA A;  2AD9 A;  2QA4 S;  3C46 A;  3A8I A;  4DX6 A;  1JXE A;  2XMV A;  2IDL A;  1VQS A;  2Y1J A;  2C3U A;  1R0C B;  2DHH A;  2YTC A;  1R8B A;  3BB5 A;  2GJF A;  4H4M A;  1PSD A;  3RB6 A;  2RIJ A;  1K9M T;  1XMO F;  3SEO A;  2OLW A;  1X60 A;  1E6V A;  3HMJ G;  1ZM9 A;  2J6S A;  2IJR A;  4DR4 J;  2ZH7 A;  2K1R B;  4MKV A;  1Y3J A;  1RTJ A;  1CJK A;  3GCW P;  2JJ4 D;  2XCA A;  5D0H A;  5GVQ A;  5DET A;  3AOB A;  5HVH A;  4KGM A;  3ZNJ 1;  1WJ9 A;  2V68 A;  3EGN A;  3Q8R B;  2OAU A;  3V6J A;  4C8L A;  5KT4 A;  1CS4 B;  4G3I A;  1TK5 A;  3ILJ A;  1ZPW X;  2BZ2 A;  3CDU A;  3AD9 C;  1X5T A;  3EPG A;  3KDN A;  3EVW A;  1NK4 A;  2FJE B;  1Y11 A;  4RX6 A;  1SH2 A;  3MAH A;  1FJE B;  3AJ1 A;  3HVT A;  2RD5 C;  2ZH9 A;  4DUZ J;  1HHQ A;  4DR6 F;  5C24 B;  3H8Y A;  3PYG A;  4IDK A;  1UFW A;  2A0F B;  4RBU A;  3RBX A;  2OGU A;  2MTL A;  4YOE A;  5ETT A;  1I1G A;  3VAG A;  2QFI A;  5GAG U;  4XPE A;  3BV8 A;  4JV0 A;  4KR0 B;  2IA6 A;  3LGN A;  3C6T A;  4RUH A;  1Q8L A;  2B9Y A;  4DV1 J;  1F2H A;  3DHX A;  3TAR A;  2BV3 A;  2WSF C;  5JVH Q;  2E5H A;  1I6J A;  3UD4 P;  1HQU A;  1VC6 A;  4ZP9 A;  4HR2 A;  1DAR A;  3L09 A;  4JOU A;  4UST A;  5F8H A;  3CO0 P;  2GX8 A;  4O3S A;  4DXL A;  1C0U A;  1HQ2 A;  4FF1 A;  1SCJ B;  4PXC A;  4O3R A;  2DGW A;  1S9E B;  3JXO A;  3H59 A;  4ED8 A;  3VGS A;  2IIH A;  3T5K A;  3R97 A;  4LRC A;  3GSD A;  4M94 A;  5D3G B;  3RU0 A;  3J7Z T;  3A3O B;  3NEK A;  4DV6 J;  4DV0 F;  2I2Y A;  4KPC A;  5D77 A;  4CLS A;  3QJJ A;  3BBB A;  3ZZT A;  4X64 J;  1ZTW A;  1NK9 A;  1VFJ A;  1I51 B;  2HG4 A;  4OX9 J;  3NS5 A;  1OSC A;  3MEE A;  4LF2 A;  5LSO A;  2MPU A;  2ZNZ A;  1YJ9 S;  4HH0 A;  3OBI A;  4KHP F;  1NK6 A;  3W8P A;  3P4U B;  2KFN A;  5B0G A;  3E8O A;  4JV2 A;  1DBD A;  1N33 J;  3AQO A;  1SIW B;  2MQO A;  2PDA A;  4IFY A;  1HPZ B;  4DUY F;  2ZVS A;  5AXK A;  1UFL A;  3W9J A;  4M1K A;  1K0T A;  4DJB A;  4OI3 A;  1YSJ A;  1RGV A;  1JNR B;  4F25 A;  3IMQ J;  1WHX A;  1X5O A;  2HVH A;  2FGC A;  2RIL A;  3P49 B;  2A2D A;  5MLC V;  1S9G A;  2G1H A;  1UVL A;  1JLE B;  4ZDN A;  3SDE A;  5B0F A;  3EDQ B;  5GME A;  2UU9 J;  3POT B;  3R1H A;  4K4X A;  4DR3 F;  2M4M A;  2E1C A;  4YN3 B;  1EX8 A;  4DHV A;  1QE1 B;  1PIE A;  4LMZ A;  1Q95 G;  3OVB A;  2NPI A;  3ZZO A;  4MK8 A;  4R0E A;  4DF8 A;  2KH9 A;  2GQC A;  5LOQ A;  4WF9 Q;  2P5V A;  2I0X A;  1SKU B;  2WK4 A;  3MM7 A;  2B4O A;  1WOP A;  2HQ3 A;  1U1M A;  3TA1 A;  1RAB B;  5IOL A;  3MMA A;  3K89 A;  3R1L A;  3GWC A;  3WHI A;  4ER8 A;  1B4S A;  1OMS A;  3ILI A;  3C66 A;  1RZM A;  1UZH A;  1FJC A;  2RUS A;  3BKT A;  2C2Z B;  1UWB A;  4DU8 A;  4UT4 A;  1IQZ A;  2OD4 A;  3UW1 A;  5A2Q Y;  5GMD A;  2M88 A;  3MMC B;  2F7V A;  3CVK A;  2QG9 B;  3HF5 A;  3WDO A;  1EET A;  1X9S A;  2R7O A;  1VQO S;  3NRB A;  4C2M A;  1Y5N B;  2PMZ D;  5HLF B;  5KG4 A;  4LIW A;  4PG6 A;  4CLY A;  2HIQ A;  4NLR A;  3OXG A;  3GJS B;  3EGW B;  3D6T B;  1JJC B;  3TYT A;  2IAJ A;  4I4B A;  1T9W A;  4I6A A;  3FBB A;  4N7T A;  3SCL E;  2MZQ A;  1LK5 A;  4PWU A;  2UUA F;  2YKQ A;  3W5Y A;  1FJ7 A;  3NLC A;  4CLU A;  3GMG A;  2VC1 A;  3QBC A;  1SJ3 P;  2NCK L;  4OHV A;  2EVZ A;  5I3Q A;  3GII A;  1ZM2 A;  2B5J A;  2HLT A;  1LWC B;  2G0I A;  4UOC A;  2FHM A;  5HQL A;  2HW3 A;  2QYC A;  1I3O B;  3CXC R;  3PTW A;  2OML A;  3M32 B;  3H4D A;  4YDD B;  3A3P B;  4W98 A;  5D0G A;  2FVC A;  3LGM A;  5CAB A;  3Q22 A;  4FS2 A;  3I5C A;  2LDY A;  3QO9 A;  2Y0B B;  2F4V F;  3UPF A;  2KTQ A;  3CD6 S;  5KFH A;  4ICL A;  2MST A;  1JK9 B;  4U6P A;  4X2B A;  5AJ3 F;  1VQ9 S;  2Q1L A;  2GIR A;  4LBH A;  2KZZ A;  1RT1 A;  2XWX A;  4KFB A;  2KM8 C;  3R5G A;  1GXU A;  3IN5 A;  2FLL A;  2W2P P;  2C2E A;  4NLX A;  3J7Y I;  1S12 A;  4NOH A;  5G0R A;  5IWA J;  1VGY A;  2ZKU A;  3MEG A;  2D9P A;  2B8Q A;  4ZCM A;  1SV5 A;  4NZ7 A;  2C1E B;  4PWW A;  4EYI B;  1PAU B;  3PZP A;  1T7P A;  3LP0 A;  5LSL A;  1TV6 A;  4XDC A;  1S9F A;  1NPK A;  3RRK A;  4DQQ A;  3J80 U;  1IKY A;  2ZH3 A;  4F2S A;  3ZTO A;  4XIU A;  2D3O R;  2EG1 A;  1RAI B;  3PRB A;  5LL6 d;  4EUV A;  3BDP A;  1HA1 A;  2WON A;  3ILO A;  3PIO Q;  4K4W A;  2A18 A;  5IM0 A;  2L9W A;  1C0T B;  4CO3 A;  1LFW A;  4NZ6 A;  3UNY A;  3KUG A;  2CG8 A;  2CQH A;  1RE1 B;  3D0H E;  1NJY A;  3CCE S;  1Y5I B;  1S59 A;  1VJQ A;  1S1W B;  5IS2 A;  2XWY A;  3KJV A;  2ZEJ A;  4JI8 F;  2GVD A;  3HO1 A;  4GVB B;  4DS5 A;  1IM6 A;  5KFQ A;  2VJV A;  4HVZ A;  3RG6 A;  1WC3 A;  2HHS A;  1URN A;  2B7B B;  4Q45 A;  3H5X A;  2XZW A;  1NJI T;  4RNH A;  1VK8 A;  1X4F A;  4KB7 A;  3OTC A;  2AX0 A;  4X4T A;  5HAO A;  1ZPV A;  1JLB B;  2VU5 A;  1XMO J;  3PW4 A;  2WVC A;  3EXY A;  3UFC X;  1R0A B;  2N3O A;  4OZ0 A;  2H3E B;  2C2K B;  1QSS A;  4O4G A;  1YIJ S;  3KLG A;  4IUF A;  4DR5 F;  2V4J A;  1SPB P;  4TKT A;  4CH7 A;  4P7T A;  4UUX A;  1CEZ A;  2VQF F;  3I6P A;  4NZ0 A;  2B56 A;  3LWM A;  2QRR A;  4O3O A;  4QWA A;  5KG5 A;  1NH8 A;  1U0H B;  2CPY A;  3DLH A;  2DGT A;  4C0H A;  3VGV A;  1LQ9 A;  4RWX A;  4DPY A;  5J2Q A;  2JZ5 A;  8RUC A;  2BQ3 A;  1JIH A;  4UOG A;  4DL4 A;  2W8K A;  4N41 A;  2XY6 A;  1WHV A;  2JC0 A;  1HMV B;  3PNI A;  2CYY A;  2HHX A;  1F5C A;  9RUB A;  1VQ8 S;  3VGT A;  3G82 B;  1U1R A;  2ILY A;  3LH2 S;  1FXR A;  2B51 A;  4ZKA A;  4C11 A;  4DR6 J;  4QU6 A;  2MB0 B;  1HWU A;  1X4H A;  1FRJ A;  1RTZ A;  4M95 A;  1ZZF A;  5DLF A;  2E5G A;  3RZA A;  1AW0 A;  1DQ8 A;  2NYH A;  4ZCK A;  2APO A;  1D8Y A;  4CLP A;  4MFB A;  3SCJ E;  1GEH A;  2CWK A;  4NPO A;  2CZ9 A;  1AUD A;  2VOO A;  3L3C A;  4Q44 A;  1IJE B;  1L3V A;  3OL6 A;  3GG1 A;  4UY8 T;  4G1P A;  3U27 A;  1SUQ A;  3U7J A;  4QU7 A;  3I4P A;  4FBU A;  3M8Z A;  5KFV A;  1HD1 A;  4OYW A;  2X1A A;  3HD2 A;  3H98 A;  2R2T A;  1REV B;  1Q78 A;  4ETZ A;  3MPV A;  1RP5 A;  2Q43 A;  2XB2 D;  3CDE A;  4LRE A;  1U6B A;  4ECV A;  4X4Q A;  5E5N A;  4RPF A;  1B7F A;  2ZHB A;  2EKN A;  2NRE A;  1RWP B;  5DQI A;  3HKW A;  1O51 A;  4AQY F;  3V4I A;  3DLE A;  1U4B A;  4DV0 J;  5C25 B;  2DHX A;  1NLK L;  3T5H A;  5KOW A;  4MH8 A;  3OSP A;  1N32 F;  4ZPW R;  1V5I B;  4K2X A;  1RHK B;  2LU2 A;  3CDA A;  3FBC A;  3HHE A;  5C7P A;  3P6Y C;  4OL8 A;  1FRX A;  3KTQ A;  3VGU A;  1HFE L;  3DCA A;  1ULR A;  2O66 A;  1IR2 A;  4RW9 A;  1KP6 A;  2QLJ B;  3QGH A;  1DLO A;  2LQJ A;  2C2D A;  2HFS A;  1HWJ A;  3UCU P;  1PC4 A;  3THV A;  3OFE A;  1A7G E;  2X3G A;  1VK3 A;  3MDF A;  4DUY J;  3IS9 A;  3W2W B;  2I38 A;  2FHK A;  1TMJ A;  2V8H A;  3CCQ S;  4WZQ A;  3D66 A;  4I2Q B;  1A9N B;  5FDL A;  2ZE2 A;  3NGK A;  4OFZ A;  2ZBI A;  4WK3 A;  3R5D A;  4I6W A;  4E0D A;  1ZS6 A;  1TKX B;  3FSX A;  3O8W A;  2XMT A;  3DLJ A;  3NS6 A;  1V3Z A;  4DG1 B;  4L72 B;  3GFZ A;  1F60 B;  1RYS A;  1H73 A;  1PBA A;  4BC7 A;  3MI7 X;  4Q5V A;  1FJG F;  2EC0 A;  3TUZ C;  3M30 A;  2BM0 A;  3MHY A;  5L1J A;  1S1V B;  2ZWP A;  4J9S A;  1UPM B;  2VBW A;  1NDP A;  2CPX A;  4DR3 J;  1VQY A;  2P8I A;  4JI6 F;  1CQN A;  2RVJ A;  2HK3 A;  1RXO B;  1HNX F;  3MR5 A;  5DQG A;  1V3S A;  2LEC A;  3QRQ A;  5J2P A;  1KN6 A;  3IM8 A;  2ATL A;  4J9O A;  3DMJ A;  1RT5 A;  4IOA Q;  5D78 A;  3MEK A;  2IMO A;  4F4K A;  4KTQ A;  3N6N A;  3R3T A;  3D0I E;  3CCZ A;  2BW7 A;  4WZM A;  3TEH B;  1HAR A;  2VG5 A;  3R8Y A;  3DXS X;  3NCP A;  3BGR B;  4ED4 A;  4DQS A;  3EYZ A;  1DAX A;  3K5N A;  2HK2 A;  2PMH A;  4IH5 A;  3TEG A;  2OPP A;  4B3O A;  1RT7 A;  5CHC B;  5A2Q U;  3CJR A;  4DPO A;  4WPA A;  3TX8 A;  1UVI A;  2LEA A;  3WC2 A;  3ZZR A;  4B3T J;  1F3V A;  1TKZ B;  4OZ3 A;  2Q6C A;  1HBU A;  2KFZ A;  1RIS A;  4Q0B B;  1G7C B;  3M1V B;  4CP5 A;  3ZFV A;  1OY9 A;  4ZA1 A;  2W8L A;  4M5D A;  3Q8S B;  3KJQ B;  2IYG A;  2UUA J;  1FHT A;  2BM1 A;  4Y28 C;  4K4S A;  3NGT A;  4LSN A;  3MM5 A;  3NWR A;  3W2V A;  1IM4 A;  1RT6 A;  1DUR A;  1RTI B;  5GAG I;  3PR4 A;  5K5M A;  3PDN A;  3NOC A;  5KFJ A;  1JNZ B;  1UJ5 A;  1TVR B;  1TFW A;  2FZK B;  2KZM A;  4ZPC A;  2F4V J;  5LXY A;  1OY6 A;  2Z2Y B;  5AT1 B;  2KXF A;  4DZ6 A;  3T9N A;  3UD5 A;  3MD1 A;  1XNR F;  3PFE A;  1FXL A;  5HVG A;  2P9C A;  5AJ3 J;  1CC7 A;  3W5X A;  4ED7 A;  3F56 A;  4G6V B;  1JLA B;  1OY8 A;  1YZ6 A;  2J8S A;  2AP6 A;  1DY3 A;  4FYV B;  4NRU A;  1FWK A;  1TK0 A;  4LQ3 A;  1RWU A;  4OLO A;  1PKU A;  1GMU A;  2DXF A;  3ELH A;  2C2O B;  5KFZ A;  1SQF A;  5KAK A;  5ETP A;  4ENO A;  2N7Y A;  3QPI A;  1T03 A;  3I31 A;  2R2S A;  4P7V A;  2YWG A;  1F9E B;  4M5H A;  4QJV A;  5B0B A;  2CNN B;  2WSC C;  4DQR A;  5LT5 A;  1MRO B;  3P5T L;  2RKI B;  3M6W A;  2V8D A;  2ZD1 B;  3UQS A;  4I2P B;  4OJG A;  1SJ1 A;  3KLI A;  2MQN A;  1VBX A;  4P9S A;  1U47 A;  3AAW B;  1HNW F;  2WZ1 A;  4Q2M A;  4K4V A;  4ED3 A;  3NAI A;  5GAH U;  1CJU B;  3B4M A;  4CTA A;  1N0U A;  1PGZ A;  4CNZ A;  2JL9 A;  1T11 A;  2WBR A;  4AND A;  2VBZ A;  3IGN A;  4JI8 J;  4EBC A;  2B4P A;  3PX6 A;  3W66 A;  1T05 A;  3D7S B;  4CT8 A;  3KG1 A;  2RRA A;  1R7I A;  2DD8 S;  2IC3 B;  2AYE A;  3SQO P;  2IM2 A;  3KHL A;  1KFS A;  3R2C J;  3H20 A;  2OFH X;  4DPW A;  4P52 A;  4ED0 A;  2YX1 A;  4IG0 A;  4FPR A;  2YKA A;  2LEP A;  4IRC A;  2HWH A;  2JEI A;  2XUL A;  4IO9 Q;  3MAQ A;  4DR5 J;  4H4O A;  1PCA A;  5E0O A;  4X4U A;  2CIM A;  2OHD A;  2OEJ A;  2VQF J;  3HT3 A;  4DFP A;  4UQG A;  4L75 A;  4Y00 A;  4KAI A;  2YPZ A;  5LMU F;  2FUG 9;  3TVZ A;  3KLH B;  2DYA A;  2J9D A;  4F4A A;  2CPF A;  1S1T A;  3NNC A;  1DTQ B;  3IG1 B;  3DGV A;  5KFF A;  3N4W A;  2GJ2 A;  5KTQ A;  1MWY A;  1M5H A;  1VRU B;  1V5V A;  4NXN F;  1KOO A;  1X4E A;  4X4R A;  2YKM A;  2QEX S;  4HI2 A;  1WG1 A;  2BJ3 A;  4IOB A;  2HFZ A;  1CPZ A;  1IBM F;  3M7V A;  3FSY A;  2VPX B;  4JV1 A;  4PG8 A;  3O5T B;  2FLP A;  3UO0 A;  4M5L A;  1GTE A;  3TUI C;  2XO6 A;  1HLW A;  2QA2 A;  4PR6 A;  4LRB A;  2DRA A;  3G9C A;  3NMA A;  3IAM 9;  2PE8 A;  5D8H B;  2HS4 A;  3ETM A;  4JP8 A;  4L74 A;  3CT9 A;  1KHW A;  1QSY A;  2K2P A;  4ZHR A;  1R8P A;  1RCO B;  4C3M A;  3N9U C;  2XS2 A;  4X4S A;  2YNF B;  3R6L B;  3D0G E;  2Q3P A;  3DYA B;  3LO3 A;  2AKW B;  5ADZ A;  4DI6 A;  4AQY J;  1TK8 A;  5KFD A;  1DTT A;  5KG7 A;  1XNQ F;  1C1B B;  1FKO B;  1SH0 A;  1MG7 A;  2ASD A;  2B6A A;  1NND A;  2BX6 A;  2I8E A;  3E51 A;  1UVN A;  1QSL A;  3HT0 A;  1GK8 A;  3FFI A;  2LA4 A;  4NMX A;  1QD1 A;  5LJ3 Y;  2VPY B;  2MZT A;  1RKJ A;  1VLY A;  2AEF A;  1Q8I A;  5FII A;  4WFN Q;  4I64 A;  4DSI A;  2QTW A;  4JI0 F;  3MM9 A;  3IR6 B;  1TU0 B;  2POK A;  3QSI A;  1Z2L A;  4KYZ A;  1XQI A;  3AQP A;  3LAM A;  1M90 T;  1R6V A;  4I67 A;  2NYI A;  5CYM B;  4DL7 A;  4OHX A;  2GJI A;  3SCK E;  2LQB A;  2WB1 D;  4RWW A;  4C8O A;  4RUA A;  1YJV A;  1FJG J;  4FYX B;  1BXN A;  3W64 A;  4KGV B;  2V2K A;  4LFA F;  2M7S A;  1NU4 A;  2AWZ A;  2HS3 A;  1J5E F;  3D5M A;  2J0W A;  2HHV A;  4PKD B;  3S01 A;  2ACY A;  3ITH B;  2GIQ A;  4C9D A;  4NA1 A;  4JI6 J;  2HEK A;  2JLG A;  2IPO B;  3TAM A;  4ZS6 A;  4C98 A;  4QYZ J;  5F0W A;  4FNI A;  4O0I A;  1HNX J;  4YP3 A;  1NPR A;  2K7J A;  3KKF A;  2QYG A;  2VG7 B;  5KFU A;  5DDQ C;  2HMI A;  2IBO A;  4KO0 B;  3JQK A;  4RW7 A;  1C1C A;  3MM6 B;  2DPJ A;  2CZ4 A;  1X4C A;  1L3T A;  2V2V A;  2XI3 A;  2GZO A;  5M2U A;  4R8U B;  2XMM A;  1QJH A;  1F1B B;  3K5P A;  1EJ7 L;  5A8W A;  4DCO B;  3M8Q B;  3AFG A;  3G96 A;  3R2D J;  4M5K A;  2FHJ D;  1CUL A;  1XR6 A;  2BQR A;  3QLH A;  4Y2A A;  1HYS B;  7FDR A;  5AE2 A;  4GKJ F;  1S57 A;  3OR2 A;  2XG8 A;  2DRB A;  5HQ8 A;  1VQ7 S;  1P1T A;  2XHC A;  4CLZ A;  5HK4 A;  3KLF B;  1D9F A;  1WC6 A;  3CGI A;  2BE2 B;  2EEY A;  3PXG a;  2PT0 A;  3I9Z A;  3CCS S;  2YY3 A;  4QR2 A;  5DG9 A;  3CJK A;  1FFS B;  4PG5 A;  3SIP B;  4KBI A;  3M9N B;  3GR0 A;  3OFG A;  5E3Q A;  2XM3 A;  3TQ1 A;  3H40 A;  4AE5 A;  2J0S D;  3O6Q A;  1DJ0 A;  3SV4 A;  4MIW A;  1H38 A;  2OPQ B;  3QWP A;  2EFQ A;  2YQ3 A;  4O44 A;  4HLB A;  3K8V A;  3E2E A;  2I5J A;  3LQV A;  3UDL A;  2ZZT A;  2NZ4 A;  2HHQ A;  4KHM A;  5CD4 H;  1R3N A;  2FVR A;  1YJT A;  4C0O C;  3ZZU A;  4EZ6 A;  2DNL A;  2JSX A;  2NXC A;  3LAL A;  1EKS A;  4USU A;  2IY5 B;  1HBO B;  1FX4 A;  5KFC A;  1S48 A;  3CJ2 A;  3DXB A;  2WVE A;  3AA8 A;  5CYQ B;  1M1K T;  3V2U C;  4UTG A;  4HDH A;  3LGH A;  4OYZ A;  3WZ0 A;  4PYA A;  1U6F A;  1CJT B;  3D1O A;  2IM1 A;  2ASY A;  3R7B B;  1FD8 A;  2HQD A;  4NLS A;  3D9B A;  2XMA A;  4BHQ A;  2K3I A;  4DV5 F;  5ETN A;  2ILZ A;  3I5B A;  2DRD A;  4NCG B;  5HP1 B;  1Q53 A;  1SQE A;  4G1I A;  3ETO A;  2UZA A;  4KH1 B;  1M5K C;  2DIT A;  1IKV A;  4W4M A;  2EPI A;  1A0O B;  1NDL A;  2WW8 A;  3UVJ A;  2RQM A;  1KOH A;  4DN9 A;  3EE3 A;  4JI5 F;  1IWA A;  4LT6 A;  4IQX A;  3S1T A;  3K0J A;  3TW0 A;  5IQ6 A;  2GIF A;  2KXN B;  2ZIT A;  2DGO A;  2RF2 B;  2ZBC A;  1VJW A;  3HDS A;  3MMJ A;  4BC9 A;  4URG A;  2XZT B;  5I42 A;  4HHU A;  4NCA A;  2V2Z A;  4Y2K A;  2RDI A;  1H74 A;  1SB6 A;  1U2C A;  1GMV A;  1X5P A;  2A6M A;  2MY7 A;  2W9B B;  1FKP B;  2B9W A;  2P6S A;  2XMK A;  1RUS A;  4Y34 A;  3HHD A;  3US5 A;  1SVD A;  1T8E A;  4EBE A;  2DR6 A;  2HND B;  2Z4P A;  1UA0 A;  3JSM B;  2ZC4 A;  2KU7 A;  3DN9 A;  1RAH B;  3MAA B;  2VBX A;  5THW A;  1XMB A;  3NBP B;  1UFK A;  2Z57 B;  1SC1 B;  2HQG A;  1KTV A;  1NKC A;  1FO1 A;  3PX4 A;  2IRU A;  3N0V A;  3K7R A;  2VKZ G;  3W8G A;  3QYY A;  2GS8 A;  2K1R A;  4EBD A;  5LMU J;  3Q8P B;  1AZS B;  2V69 A;  1E6Y B;  2W2N P;  2ZOG A;  3K59 A;  2P9G A;  2C3O A;  2Z2L A;  2JWN A;  4OYO A;  1S5Z A;  2J7U A;  2M70 A;  3HVA A;  1KSP A;  3A8E A;  3BH6 B;  2D3U A;  1OYE A;  3M6X A;  4NXN J;  3GFH A;  1NK8 A;  1WOR A;  4P75 A;  1CS4 A;  1CVJ A;  2KT3 A;  1Q0N A;  2DNN A;  1WHW A;  3LWL A;  2V34 A;  3MED B;  1IBM J;  2Q66 A;  4CRJ A;  4LR8 A;  4X65 F;  3IP0 A;  4F67 A;  5FD1 A;  2BAN B;  2N3L A;  3R5J B;  4RU2 A;  1U26 A;  4NXM J;  4YB7 A;  1YJR A;  5C24 A;  1B99 A;  4LR7 A;  3BSC A;  3LOU A;  2JNJ A;  2FLO A;  5M2R A;  3TJ9 A;  1ZH5 A;  1E6V B;  2RE1 A;  1V3R A;  3TZZ A;  1XK8 A;  3QID A;  1WWH A;  4CLW A;  4KIA A;  4OZ2 A;  4N77 A;  1NZ8 A;  5BYS A;  1S6Q B;  5KFL A;  4HHJ A;  2H5J B;  1CSJ A;  1ZBT A;  2XNR A;  1HBN B;  1MML A;  1O5J A;  3EX7 B;  1LWX A;  2YQ1 A;  1NKE A;  1VCT A;  5C2C A;  1D0E A;  5H9E J;  3SCI E;  3PFO A;  1UVJ A;  5L38 A;  2QFJ A;  2RH3 A;  1S9E A;  1R6Y A;  3TAP A;  3GCX P;  3EGV A;  4C3K A;  4AD6 A;  1XNQ J;  4LSL B;  1BQM B;  1V6H A;  1AT1 B;  5F3T A;  4JI3 F;  5D3G A;  1TL1 B;  3BJY A;  5J1P A;  2PEB A;  1VRT B;  2ZHO A;  1Y10 A;  3M8R A;  2C28 A;  1OS5 A;  2QGF B;  3V5R A;  2L3M A;  3CME S;  2YNH B;  4JI0 J;  5F3Z A;  1N5T A;  4EFA C;  2XS5 A;  2G13 A;  3MCM A;  5HJX A;  1SL0 A;  2B4U A;  4QPX A;  3JQJ A;  3IR5 B;  4YR3 A;  5KG0 A;  1GAO A;  4R25 A;  1SBR A;  2IJN A;  1FNO A;  3UR3 C;  4MMO A;  1RJJ A;  5GAH I;  3PEH A;  1HPZ A;  2MKC A;  4F0K A;  5KFK A;  1EP4 B;  2Y9H A;  5CZX A;  5HRO B;  3RB3 A;  4ZVO B;  4LFA J;  2PMW A;  4OZL A;  2LU1 A;  1SL2 A;  1J5E J;  4EU0 A;  4KT0 C;  2VA2 A;  4ZOS A;  2XZD B;  5E3C A;  4K5R A;  4NRT A;  4FP9 A;  2M0G B;  1WTF A;  1PIL A;  1JLE A;  2E66 A;  3MUR P;  5D4N A;  2R2R A;  1S6O A;  2CQP A;  3POT A;  4EYH B;  1RT4 B;  3QRR A;  5L46 A;  3FZ2 A;  5JMN A;  3TQE A;  2C3P A;  1QE1 A;  1C2P A;  4ZJL A;  2BDP A;  4DLG A;  3ZC4 A;  2XTJ P;  2EBE A;  2HGL A;  3X3U A;  2DH7 A;  4OJ3 A;  3RAM A;  1KTQ A;  4RUC A;  3D28 A;  4ZPB A;  4WFX A;  5HMW A;  1OQ3 A;  4EZ9 A;  3MCO A;  1IBL F;  4NA3 A;  4L6V 3;  5KG1 A;  3KK1 B;  1NB2 A;  5HMY A;  3GIL A;  4GKJ J;  1HWL A;  1BWE A;  3NWG A;  1GNK A;  2QZ8 A;  2YKO A;  3PKM A;  4OHY A;  1W25 A;  1NDK A;  2ACM A;  2ZKT A;  4P73 A;  2NSB A;  4OI0 A;  4J9U E;  1PC5 A;  5L39 A;  2XSJ B;  2ZWO A;  1RWW B;  3H5S A;  2EK1 A;  1U09 A;  1FE4 A;  2ASJ A;  4OZ1 A;  3EMT A;  5D4P A;  3O2I A;  2IRY A;  3MMC A;  1C4A A;  2OH2 A;  1N54 B;  2IVM A;  1YRX A;  3DOL B;  2UP1 A;  3GLJ A;  1XR5 A;  4PG4 A;  1NDC A;  4P2F A;  2QL5 B;  4CM0 A;  4N56 A;  5HLF A;  4RR5 A;  5IT4 A;  3ISN C;  4ZLN A;  2W24 A;  4O3Q A;  2F4F A;  4L3N A;  2HAF A;  2VL1 A;  2HWT A;  2M8D B;  4IRK A;  2MJN A;  5EWG A;  4MK9 A;  4YB6 A;  1G6B A;  1LWC A;  2HNZ B;  2DJW A;  2RQ4 A;  3M32 A;  4OZJ A;  3M2V B;  3OFF A;  3Q8Q B;  2VFT A;  3EWG A;  4PXB A;  2ZH6 A;  2H48 B;  2P9E A;  5KFS A;  2BRK A;  4PEO A;  1R31 A;  5LJ5 Y;  5AE3 A;  3EPI A;  2F1F A;  3OQ2 A;  4MJK A;  3TZY A;  1HI8 A;  4G1Q B;  3U1N A;  4A48 A;  3DRR B;  3OR1 B;  4DV5 J;  4QIW D;  1OIA A;  5HAT A;  1S79 A;  2VZ9 A;  4B9S A;  4U8Y A;  3AJ2 A;  3NGD A;  3KG0 A;  4X66 F;  3P5B P;  2EI5 A;  3FJ2 A;  2BAC A;  1FCA A;  2AEM A;  4X84 A;  4CZC A;  1S1X B;  3DRX A;  4F50 A;  4JI5 J;  3HHL B;  4GVL A;  2JDJ A;  4OX6 A;  5A0Y B;  4LBP A;  1LKZ A;  1S97 A;  5HL7 Q;  1T9V A;  2DXD A;  2IRX A;  1KVK A;  1X5S A;  1FEE A;  1XTZ A;  1KQK A;  2XYG B;  4PPZ A;  3A8K A;  2J5A A;  5M2P A;  2EXU A;  1QAJ A;  5GAE U;  3JTP A;  4ETX A;  4N8O A;  1YJN S;  3KFW X;  4RW6 B;  2DK2 A;  3M6V A;  3VZH A;  1VQ4 S;  1VC0 A;  1C0T A;  3MM8 B;  2PI5 A;  1EKR A;  2VDI A;  1NSA A;  2E9T A;  3KWM A;  3QSY B;  3NKY A;  1TUV A;  3D67 A;  1TL4 A;  4ILL A;  1S1W A;  1ROF A;  1F3F A;  4ZLP A;  1T9T A;  2GV1 A;  2IVY A;  3DI6 B;  4GVB A;  3V81 B;  2EFV A;  4ID5 B;  3DOK B;  1UCN A;  5K14 B;  3HJV A;  2HRT A;  4BLG A;  7FD1 A;  3JSY A;  2VQE F;  3VAM A;  1YJ7 A;  2GHW A;  1XJW B;  2EW9 A;  1Q8K A;  3ENA A;  2VOP A;  1SKR A;  4G65 A;  1JLB A;  2VAS A;  2XCP A;  5CQG A;  3OL7 A;  3OT9 A;  2R8G A;  3MTJ A;  4CYU B;  2KVQ E;  4F4X A;  2CJX B;  3EZO A;  3NGS A;  4PYD A;  1G1X A;  3CJ0 A;  3KLE B;  5I3U B;  3DNC A;  1HD0 A;  2C3M A;  1LW2 B;  3EGZ A;  3C19 A;  5IM0 B;  4CDI A;  1U0H A;  1CJV B;  3BBC A;  2QSF A;  1OO0 B;  2A1B A;  3QWU A;  1NK0 A;  3LF0 A;  2MZS A;  2WHO A;  3MR6 A;  1Q7Y T;  5L8R C;  3C15 B;  4AXI A;  1HMV A;  1N5Y B;  3KG4 A;  1AA1 B;  4X65 J;  3G82 A;  2UUB F;  3HM9 A;  3CSK A;  1TKD A;  2O1P A;  1FRM A;  2MDA A;  2GMJ A;  1VI7 A;  3TR5 A;  4YME A;  1FRK A;  3ZO7 A;  4Y2C A;  1Q1K A;  2AGQ A;  1UA1 A;  3I0R B;  5U47 A;  4I7F B;  1N6Q B;  2UVW A;  4DSE A;  3LA0 A;  1VQL S;  3GYN A;  5KFA A;  4F4Y A;  4NAS A;  4Q7A A;  4ZVG A;  2IDE A;  3T1H F;  1SKW A;  5HSP A;  2RSQ A;  2KFY A;  1JB0 C;  5KFR A;  3TO8 A;  4Z7C A;  5BJR A;  3CC4 S;  4HAC B;  2N4D A;  4OI4 A;  4U67 Q;  3BSO A;  3EZU A;  2MGZ B;  1DRZ A;  2CQ2 A;  1REV A;  1FNM A;  4ELV A;  2EKY A;  2R7X A;  5EWF A;  2MZ1 A;  4J9V A;  2G0J A;  1F9H A;  1AFJ A;  2C22 A;  2MKJ A;  4YEA A;  4FVM A;  3JAM Y;  4DUT A;  5KFP A;  4JI3 J;  5E33 A;  3OHA A;  4RW4 B;  2V0N A;  1R89 A;  1HR0 F;  1U1K A;  1FVS A;  2YPY A;  5C25 A;  3NCQ A;  2HBY B;  2JFD A;  3TZX A;  4XDD A;  4RKU C;  3CMA S;  4MIA A;  2Y3Y A;  5F41 A;  5F8J A;  1GMW A;  4FDF A;  2K3K A;  2YWW A;  3N6L A;  3PRD A;  1R27 B;  4YFU A;  2H51 B;  2KT5 A;  3OW2 R;  9ATC B;  4WK1 A;  1M5P C;  3ZXW A;  2W4D A;  2YNG B;  3SBM A;  4ZK7 M;  2R7R A;  4E98 A;  3ADA C;  3HLU A;  2YVS A;  4DPU A;  3L9Z A;  1WD6 A;  3K8W A;  3W2W A;  2UVR A;  2DHA A;  3OXL A;  1QVF R;  1S0O A;  4I2Q A;  5DO2 A;  2V63 A;  4Y65 A;  1UVK A;  2DIU A;  1U8S A;  2PN6 A;  3I0S B;  4CLK A;  1TKX A;  3GFX A;  3HSD A;  2YWF A;  3AH6 A;  3DRP B;  3FZB A;  1MU2 B;  2GO9 A;  4DG1 A;  2W7A A;  1QUP A;  2EWH A;  2KRR A;  2AEJ A;  1AB8 A;  2ALY B;  5CCM A;  2DB1 A;  4MAK A;  2MKK A;  2GC8 A;  2JEG A;  1Q8B A;  4FVC A;  1RT2 B;  1S1V A;  2JHE A;  1UVM A;  1V9O A;  1FTR A;  5F8G A;  3DGP A;  3HVW A;  3H7H B;  1FFG B;  3NOG A;  4RO0 A;  4USW A;  2FGO A;  3CCV S;  1IR1 A;  3HZE A;  1H2U X;  2IFX A;  4K4Y A;  2EFG A;  1VQ6 S;  2F8H A;  1NHV A;  4OI1 A;  3THT A;  2C2M B;  5HMZ A;  2CNK B;  2DH8 A;  3LAN A;  3O1L A;  3HHK A;  5KFM A;  1IBL J;  4ID8 A;  4LIR A;  2G4B A;  4U7U D;  3MUM P;  4YB1 P;  5IC6 B;  1K73 T;  4ED5 A;  3OTD A;  1HKA A;  6FD1 A;  3D3C J;  1SJ4 P;  2RU9 A;  3QJP A;  3W61 A;  5K9F A;  3LTO A;  4YS2 A;  4RUB A;  2ADB A;  2V2Q A;  3BGR A;  3CCT A;  3OTB A;  1U1P A;  3Q0A A;  3K58 A;  1BY9 A;  2BBE A;  3U1M A;  3HSZ A;  4WYL A;  2RML A;  4EWT A;  1L3K A;  4PAA A;  2ZVI A;  4PXE A;  4P74 A;  1TKZ A;  5CXT A;  2OEM A;  3CC7 S;  4NE9 C;  2B0G A;  4LF9 F;  2CQC A;  2OFG X;  1WKJ A;  2RHS B;  2JRS A;  5B0A A;  1HNI B;  1NUE A;  1X31 C;  4Q0B A;  4DV3 F;  1Y9O A;  2H5E A;  3M1V A;  5H9F J;  3MCS A;  4OMF G;  2MEW A;  3PRV A;  3OHB A;  3KNA A;  2F5G A;  4MKY A;  2A2C A;  4K59 A;  1U2R A;  4WBF A;  4ZVQ B;  1W7W A;  3T3F A;  3G87 A;  2ZOM A;  1FTC A;  4K0K J;  1RTI A;  2E9R X;  2MSS A;  2HBQ B;  2HLU A;  2HAI A;  4NA2 A;  3CCU S;  4KY3 A;  2ZM6 F;  1TVR A;  2M52 A;  4I68 A;  4CI0 B;  2QLB B;  5CAA A;  1Q79 A;  2G2Y A;  3MR3 A;  1RWK B;  2X7I A;  1BWV A;  3Q83 A;  2Y0S D;  4PZV A;  1NPP A;  4V19 J;  1JLA A;  2VFU A;  2VIC A;  3VR1 A;  4ZP8 A;  2L41 A;  2NXJ A;  3NGU A;  1HNZ F;  2RDJ A;  2XNQ A;  4DQP A;  4FYY B;  2W25 A;  4X66 J;  2HNY B;  1SI9 A;  2YNI A;  2ZH2 A;  4TLQ A;  4GMK A;  2HKE A;  2KN4 A;  3V4M A;  3VWS A;  3SSS A;  4KJI A;  4B3S F;  2WTF A;  1S99 A;  3O3L A;  2XBP A;  4AL7 A;  2J6U A;  3CDW A;  1MRO A;  3D1H A;  3QT8 A;  4CLF A;  2RKI A;  4BCA A;  1WF1 A;  3PG9 A;  2ZD1 A;  3MWB A;  4I2P A;  4QCL A;  3AY0 A;  2ZBP A;  3CWJ A;  1RT3 B;  3W63 A;  1UET A;  1DQA A;  2U1A A;  2DVI A;  3PW0 A;  4WE1 B;  4OIX A;  5KFX A;  1M5O C;  2YX4 A;  2XLK A;  1RU1 A;  1EIY B;  5T41 A;  2MQM A;  1MWQ A;  1CJU A;  1P8G A;  1QAX A;  4MKA A;  3KMS A;  1VIX A;  2MKY A;  2E1M C;  2D9O A;  2WVD A;  3EZ5 A;  4KSE B;  1JJ4 A;  1H98 A;  4XAK A;  1HNV B;  4FPI A;  4ZCL A;  3TUJ C;  3OV7 A;  3FQL A;  2QL7 B;  2AHO B;  1Y7P A;  5K8N A;  2V4R A;  5ETS A;  1HI0 P;  1PYS B;  3GYG A;  3IRX B;  1N5Q A;  2IC3 A;  3SQG B;  4J37 A;  2FJV A;  2VQE J;  1D3W A;  2DGS A;  2DNY A;  3HI9 A;  3S8S A;  1LWF B;  2MKI A;  4DR7 F;  1JMT A;  2BQU A;  4LFC F;  1IXK A;  1JJH A;  3PJ9 A;  4A47 A;  3BO3 A;  3E01 B;  1ZAV A;  1APS A;  3I82 A;  1FWP A;  3TZW A;  5B0E A;  3JYT B;  4HHH A;  3CW2 C;  3L95 X;  1U6Z A;  2YXL A;  2HUR A;  5K8P A;  2HQF A;  1WC5 A;  3HSJ A;  1NHK L;  4DOZ A;  3KLH A;  3OD2 A;  3W65 A;  2QJ3 A;  4OYM A;  3C6U B;  1DHM A;  3WC0 A;  2IBK A;  1SQG A;  1DTQ A;  1LXN A;  3IG1 A;  2KT2 A;  3CPW R;  1HI1 A;  1VRU A;  4IG3 B;  4J9R A;  4WIQ A;  2V6A A;  1RCX B;  5A8R B;  1T05 B;  2UUB J;  4USI A;  5GAD U;  2DGU A;  3MMB B;  2H1Y A;  5JJB A;  3PY8 A;  1R0B G;  2HBR B;  4C0B A;  1PBU A;  1QVG R;  1UJ4 A;  3UNG C;  3HFK A;  4TXS A;  5AXL A;  3RW7 A;  4CH0 S;  1TKT B;  1RHR B;  5E2Q A;  3KHG A;  2FVQ A;  3T1H J;  4CLT A;  3TRG A;  3UDV A;  2C2R A;  4DCP B;  4FYD A;  3T6B A;  4USK A;  5D15 A;  4TQR A;  3R5B A;  1GFW B;  3Q8U A;  4WTY A;  4NYP A;  3MR2 A;  2W7O A;  3LP2 B;  2ZH4 A;  2QLW A;  1TUG B;  1J5O B;  3V6K A;  4QWC A;  2FTR A;  5HAN A;  4E8U A;  2IVF B;  2WB4 A;  3LPY A;  2BXJ A;  4E2F B;  4FBT A;  2YNF A;  1U1Q A;  1N0V C;  3M9M B;  4AL6 A;  2VIH A;  2PFD A;  3DYA A;  2LXF A;  3JAM U;  4UY8 5;  1KVJ A;  4ECX A;  3W9I A;  1HR0 J;  4X4N A;  3QZ8 A;  1P9Q C;  4DWI A;  1YG0 A;  2BE9 B;  3R9L A;  4O23 A;  1FF2 A;  4X62 F;  2B8P A;  3ZZY A;  1C1B A;  1FKO A;  2IM3 A;  4A8F A;  2XO7 A;  4M63 A;  3VQS A;  3SSR A;  1EAR A;  3T1Y J;  3BRE A;  5IQQ A;  3C16 B;  4EK2 A;  2HSE B;  3A12 A;  1UPP A;  4O4R A;  1ARO P;  1NHU A;  4TY8 B;  4N76 A;  1TL3 B;  3I9V 9;  4A8W A;  2Z56 B;  3MFH A;  4KRW A;  4ZPA A;  1JLG B;  1S4E A;  2DNK A;  4LF5 F;  2DR9 A;  2CPH A;  3KJF B;  2BAB A;  2W1B A;  4PG7 A;  2HRU A;  4LSZ B;  4OYA A;  2B9X A;  5DG8 A;  3SV3 A;  5CYM A;  5GAE I;  1X4G A;  1FD2 A;  4DV7 F;  2W01 A;  3BPS P;  2E7X A;  1VQN S;  2X3D A;  3H5Y A;  3DLB A;  1JKH B;  2PI4 A;  3FCH A;  2KXH A;  3SXL A;  1NB7 A;  1UEK A;  3GV5 B;  1YTY A;  2FB0 A;  4BWM A;  4TY9 A;  2CG4 A;  2PA3 A;  2E29 A;  1TP7 A;  3IWX A;  3ITH A;  3EXC X;  3N5B A;  3GIK A;  5A8K B;  1FDD A;  2B6A B;  2ZNY A;  1KR4 A;  1RI7 A;  2DHG A;  5SZT A;  4HTI A;  1CG2 A;  2KI2 A;  1KLM B;  4U8V A;  5T14 A;  4KO0 A;  1S10 A;  1Z4U A;  3CJQ A;  3DU6 A;  3MM6 A;  3L7O A;  5IT0 A;  4FF3 A;  4ECT A;  2A6O A;  4XK8 C;  1NSK L;  4R8U A;  1HW8 A;  3QZ7 A;  1IVZ A;  1BHN A;  3QAE A;  5B08 A;  2V67 A;  1YI2 S;  3RBD A;  1LWE B;  2J7W A;  5CZV A;  2FJX A;  1T94 A;  3BEG B;  1SJR A;  1JLC B;  3CUL A;  1XWL A;  2UVV A;  2GQQ A;  2HIY A;  4HDG A;  3AOC A;  1HYS A;  3TWZ A;  1YVF A;  5DQH A;  3SZ2 A;  3Q89 A;  2IM0 A;  4WFB Q;  1TFY A;  1SJF A;  4KGZ B;  5D6G A;  3J7A N;  1TUW A;  3KLF A;  3I87 A;  2ZJQ Q;  2D74 B;  3CO9 A;  3IWN C;  3RBE A;  2BE2 A;  4ZVH A;  3VF0 B;  5J1E B;  3BS9 A;  3C14 B;  3M2U B;  1BE4 A;  3KHR A;  4QOT A;  2IHR 1;  2HFV A;  4LF9 J;  4C8Y A;  3FRY A;  1K47 A;  2JVR A;  2CVI A;  3NGR A;  2QL9 B;  4DV3 J;  3TAM B;  4XTT A;  4C48 A;  5F8M A;  3IWL A;  1X4B A;  2OPQ A;  1YK9 A;  3NXZ A;  1LXJ A;  3IBW A;  1C1C B;  5DGA A;  3T6J A;  1HBM B;  4O3N A;  4A8K A;  2FDN A;  2OSQ A;  3GIR A;  4HI1 A;  3BO4 A;  3BQ2 A;  4RW8 B;  1WNE A;  2QLF B;  2ZM6 J;  2LQ5 A;  1NK5 A;  1HBO A;  1URR A;  4ATN A;  1KS2 A;  2L9D A;  1FKA F;  3IFE A;  1GX6 A;  5CYQ A;  1TZ0 A;  5B7W A;  2XHW A;  1YBT A;  3KUH A;  2ZH1 A;  2OPR B;  4JI7 F;  4QR1 A;  3ULH A;  1WI8 A;  1HNZ J;  1WEL A;  4KHP J;  2JOQ A;  3RUB L;  4LBI A;  2HVI A;  1VRQ C;  3AB2 B;  5FJ4 A;  1SC4 B;  2LP4 A;  2E5J A;  4WP9 A;  4NCG A;  1RWX B;  3QQC D;  2JFK A;  2HFO A;  1WEX A;  5HP1 A;  2BJ8 A;  4B3S J;  1VMB A;  3F0N A;  2G2Z A;  1NKB A;  1RHJ B;  4PRF A;  3J7A 1;  2H5I B;  4ES2 A;  1IBK F;  1NSP A;  2AJ0 A;  2RS2 A;  3W1Y C;  3AXM A;  3FBF A;  1HQE B;  1RKI A;  4ALZ A;  3DLG B; 
#chains in the Genus database with same CATH homology
 1U0H B;  5D0E A;  4CLL A;  1CJU B;  4USV A;  1AZS A;  1WC5 A;  4OYA A;  4OYO A;  3ET6 A;  1CS4 B;  1CJT A;  4CLZ A;  2GVD B;  1U0H A;  1CJV B;  1WC1 A;  1CJU A;  1WC0 A;  2QV6 A;  2W01 A;  5D0R A;  1WC6 A;  4OYZ A;  4NI2 B;  4OYM A;  1YBU A;  4WPA A;  4CLK A;  4WP8 A;  1CJT B;  1CS4 A;  1YBT A;  2GVD A;  4OZ3 A;  1Y11 A;  1CJV A;  3R5G A;  3G82 B;  4NI2 A;  1AB8 A;  1WC3 A;  3C15 B;  3C14 B;  4CLY A;  4P2X A;  4CM2 A;  4P2F A;  4WP3 A;  4CLS A;  4CM0 A;  3G82 A;  3C15 A;  3C14 A;  1Y10 A;  3MAA B;  4WP9 A;  4USW A;  4CLU A;  4OYB A;  4CLP A;  1TL7 B;  1WC4 A;  1CJK B;  1YK9 A;  3UVJ A;  3MAA A;  5IV4 A;  3C16 B;  4OYX A;  1CUL B;  1TL7 A;  2GVZ B;  1FX2 A;  1CJK A;  3UVJ B;  5D0H A;  4OYP A;  4CLF A;  4CLT A;  3C16 A;  5D0G A;  4USU A;  5IV3 A;  4OYI A;  1CUL A;  1FX4 A;  4CLW A;  2GVZ A;  1AZS B;  3MR7 A;  4OZ2 A;  4OYW A;  2BW7 A;  5D15 A;  4P2M A;  2WZ1 A;  3ET6 B;  4UST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...