1CS4A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase/lyase/signaling protein
molecule keywords TYPE V ADENYLATE CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4A00
2GVZA 4CLTA 1FX4A 1TL7B 1WC1A 4USUA 5D0GA 4OYWA 4USWA 1U0HB 2W01A 4WP8A 1CULB 1U0HA 3MAAB 4OYXA 3MR7A 4OYMA 4CLFA 4CM2A 4P2MA 3C14B 1CJTB 4CLPA 1FX2A 5D0EA 3C14A 1AB8A 1CJTA 3ET6B 4OZ2A 2WZ1A 1YBTA 2QV6A 1AZSB 4CLSA 2GVDB 1TL7A 4USVA 5IV3A 4CLYA 2GVDA 1CJVB 3G82B 4OYPA 4CLUA 4OYAA 3UVJB 1CJKB 1WC3A 1CULA 3MAAA 4OYBA 4CLLA 4WPAA 3C16B 3ET6A 4WP3A 1CS4B 1CJUB 4USTA 4CM0A 1CS4A 4CLKA 1AZSA 3C15B 1WC6A 4OYOA 4OYZA 4OYIA 2BW7A 3C15A 1CJVA 2GVZB 3G82A 1YK9A 4CLWA 3R5GA 4P2XA 3UVJA 1CJKA 1Y10A 1WC4A 5D0RA 1WC5A 1Y11A 4OZ3A 5D15A 4P2FA 4CLZA 5IV4A 3C16A 1CJUA 4NI2B 1WC0A 5D0HA 4WP9A 4NI2A 1YBUA
chains in the Genus database with same CATH superfamily
2GA7A 2C3PA 4C0HA 1QTNB 3H2LA 1QSYA 3K17A 4DUZJ 1HW8A 2HHQA 2DH9A 5LMUJ 3RUBL 3RAQA 1RA6A 3E51A 2EC2A 4NEZA 1FHTA 2VPYB 2QA4G 1R6YA 3R27A 4GRSA 1TKXB 3O1LA 4LF5J 1AZSB 1XMQJ 5J2PB 4C48A 4CO2A 3CIMA 4A4JA 2J6SA 3I5BA 1TL3B 3UDVA 3Q22A 2NREA 2ATLA 1PCAA 2WOMA 4OX9F 2HAIA 4DV0F 4KHPF 3KJVA 3MAHA 4LBIA 2D74B 5A8RA 3R6LB 5JMNA 1RT2B 1I94J 3W66A 3A12A 1TKDA 1IKYA 2EFOA 3UE2A 4GKKJ 4ZPWR 4K8RA 4DV2J 4DUTA 1TVRA 1HWIA 3DMJA 2K06A 3H5XA 4O3PA 2OFHX 4MMOA 4CH0S 2E7WA 1PC5A 1B70B 4Z2XA 4A8XA 2LFVA 4N56A 2BANB 1FXRA 1Q86T 4J90A 3GG0A 3M9OB 1HWUA 3W1YC 4CLTA 4S0MA 5A2QU 4PQUB 4C97A 1NB7A 1MG7A 1IJEB 1RWNB 2W1BA 5KG0A 2DO0A 2I1RA 4ZVTB 1S10A 2HHHJ 2LQBA 1V5IB 2QFIA 2ZM6F 4AYBD 3EDRB 3FGVA 1HNVB 3EGVA 3HHNB 3ENWA 5IM0B 2L9WA 4PG7A 1P1LA 1RHRB 1IBLF 2Z2YB 1FD2A 2HMIB 2W2NP 1L3SA 4RBUA 1WJ9A 1IXKA 2X1AA 2I5JA 2OHDA 3EICA 4RX6A 3UNGC 2QFJA 3H2UB 4TY8A 3P96A 3LGMA 4NLTA 4J9OA 3BF4A 2M70A 5CCMA 1UA1A 1MU2B 4NI2B 3TA2A 3UQSA 4J9RA 2OPQB 3CD5A 3QSYB 4NA3A 4OL8A 1SVDA 4LF1A 3G87A 2XLKA 1GMWA 4Z7YA 2V4QA 1M5SA 4ECVA 1JLGA 2I38A 1S6PB 1U25A 1HD0A 1HWKA 4B3MJ 3D3CJ 2JHEA 1T03A 2FZCB 3CC7S 1C1CA 4LRFA 1Y0HA 2R3VA 5L46A 2RRBA 3ILJA 4DBQA 1RWWB 1T95A 2I8EA 3UWTA 4YOEA 3OJSA 3A3NB 1JQGA 2JEFA 5KFSA 3KTQA 2HK2A 2ZDOA 1SC6A 4ZCIA 2HHUA 3LTOA 1K0TA 5HL7Q 1DTTB 3CF5Q 4L3NA 4LREA 2AJFE 3NGTA 1R89A 1B3TA 3VQTA 4OZNA 4QYRA 1LEOA 2FLPA 1G4CA 2LXFA 5F3TA 3QT6A 1X4CA 3D6FB 2FJDB 3C15A 4W90B 1RE1B 3U1NA 3R5GA 2VG6A 1T9XA 4U7CA 3R5CA 5K8NA 2WSCC 1PJ7A 2OELA 3BSNA 5DO2A 5IV4A 1NK6A 1OYDA 4YB7A 1H74A 2AT1B 2DPIA 1ZZNA 3VAKA 4PXEA 2MYFA 3DRRA 2LU1A 3A8JA 4FZVA 2G4BA 1ACMB 1H7WA 5KG4A 3FBBA 1NK4A 2ZDPA 5D4NA 3RJMB 2D3ZA 5F9NA 3I0RB 3HPOA 4WIQA 3GQCA 2DIVA 3C6UA 3DRPA 1S99A 1EX8A 3ET6B 3IGNA 1T94A 5DM6Q 2HVHA 2W2QP 2P5VA 4IRDA 3V6DA 1KP6A 2CJQA 4AT1B 1PGZA 5LJ3Y 3L9ZA 2DR8A 3KFWX 3DNCA 2FVRA 1FERA 1Y9OA 1FKOA 3TW0A 2C3UA 3BN7A 1RTIB 1I5OB 2B9WA 3WDOA 3DDKA 3CCUS 1S6OA 6AT1B 3DU5A 5J1NA 2CRLA 3LPEA 3R97A 1LW2A 1RAFB 3JQJA 1Y7PA 2XMUA 2JSXA 3J81Y 5B0EA 1RTJA 1WC5A 4YR2A 3KLGA 1YZ6A 2KFZA 1NDCA 2NYHA 2P9GA 3Q8PB 3KUEA 1YGYA 3TWZA 2L3MA 4LR8A 2QMXA 1YJ7A 4LSZB 2ILZA 4YR3A 1Q95G 4K4TA 2JLGA 3L4BC 3CCMS 2RAQA 2UVVA 2QZ8A 3J7A1 3A8EA 3QGHA 4WU3A 4OYMA 3H5YA 1Y5IB 1CBKA 3TEGA 4U9RA 1XMOJ 4WTYA 3TZWA 5HSPA 1BXNA 1BE4A 3TARA 2YNGA 2DNGA 3IRXA 1SPBP 4XDDA 1X9WA 2DIUA 3OQ2A 2NSCA 2UXCJ 4WPAA 4O4GB 1U2FA 5CYJA 4ECZA 4YY3F 4KIAA 4ENOA 1HR0J 5DGBA 2ASLA 5IT9Y 2ADBA 4OX7A 1S6QB 3R7SB 3FMBA 1Y10A 3HD2A 2DGXA 4GVLA 6FDRA 4C98A 2N82B 3BH6B 3T41A 2YWGA 3PJWA 1XBWA 3IAM9 1WKKA 3DOKB 4OI3A 2XZDB 4ER8A 2C28A 4HH0A 5GADU 3J80Y 2GIQA 3IO1A 2IYIA 3WZ0A 4M5IA 1X4DA 2MEWA 3OXFA 1DQ8A 5J2QB 1HNXJ 4QWEA 4GVBA 3MUVP 1SUQB 4HACA 1FJEB 1NK9A 3M8PA 2XGPA 2RQCA 3AOCA 4BLGA 2R7VA 2FC8A 2IBKA 2R8JA 2RU3A 3HLUA 1S1VB 1K8AT 3W2WB 1W7WA 4BHQA 1BGXT 4FN5A 3HHEA 1ZAVA 3MMJA 4EUVA 4OJGA 2W4PA 2QG9B 1JLAB 4NLXA 1TL4A 1VJWA 1DQAA 3ZXWA 1TK5A 4P71A 4E2FB 2ASYA 1F9EB 4DR5J 1ZOTA 2G9OA 2YKNA 3CXCR 4IO9Q 4RW9B 3FSIA 3D1OA 5GADI 1FNMA 1Y3KA 4C8LA 2PA8D 1NDLA 1YBAA 4CT8A 2Z58B 1IKXB 1FRMA 4I64A 4AL6A 3OR2A 5EHHA 4X62J 3OVSA 5I4MA 1QE1A 2HQ3A 1B0TA 1NDPA 4DDFA 3CCWA 2QSFA 4Q2LA 1KVKA 3KKFA 1WHYA 2V8DA 3LWMA 1OPZA 1U1PA 1S9FA 3MXHP 2NXUA 3CNQP 4KV8A 4NLDA 4ZLNA 4G1QA 3H0PA 4DSIA 2W9CB 5T14A 1HQEA 2OEJA 4JV2A 3N0VA 2QV6A 3GV7B 4MIWA 3GR0A 4HTJA 1EQ0A 3ICLA 3Q2TC 2CWKA 3Q8SB 1GTHA 2GX8A 4JV1A 2YKOA 5GAEU 1ZYQA 1C1BB 2VPXB 3BO3A 1T3OA 1T9TA 2ACMA 1ZPVA 1X9SA 3AD8C 1UZDA 1TL5A 4I7FA 2Z2MA 2X1BA 2FD2A 2SXLA 3RRKA 4LF7J 5BR8F 2ZD1B 1B4SA 1RWUA 4HTIA 5KG3A 4QR2A 2XMTA 3KNGA 2BOAA 2CQDA 4R25A 1ZM3A 4CP5A 2B8PA 2ZH8A 4DFJA 1FDBA 4BS2A 4MFBA 1VFJA 3JTOA 1WG5A 3ZTPA 2LECA 1HKAA 2CQ1A 3R2CJ 1UVLA 2XS2A 5ETVA 4PG6A 2PFFB 1GMVA 1SL0A 1BY9A 2FHJD 3MMCB 3MM6B 2CZ9A 2N4DA 2V8HA 5GAEI 2DHSA 2AGOA 1BQMB 1EB0A 5J2MA 4OZ0A 3UI3A 3SFGA 2HSEB 3BGOP 1FA0A 2PEBA 1QTMA 3PG9A 2YNHB 3FZBA 1H3DA 4J37A 3KLFA 4U6PA 1D1UA 5CA5A 3RW7A 2EKYA 1BLUA 4DL5A 4RUHA 1W25A 3UD5A 3I96A 3FJ2A 4YQWA 2KN4A 2C2EA 2OTLS 3G8TA 3I82A 2PT0A 2E5IA 5D0RA 3A13A 3N6NA 4G1PA 3NMAA 3E2EA 4PR6A 1UVKA 4QU6A 3NMRA 1DQ9A 1A6LA 4Y2IA 2DXDA 2V6AA 4ZVUB 3VTIA 1U1RA 4DPYA 3QJPA 2RQMA 2C42A 3NCQA 2QMUB 2OSRA 4CLPA 2UVRA 1TV6B 1BWVA 2GQQA 4O44B 5D4PA 2WZ1A 3RR8A 3M8WA 3DLHA 2EBGA 3ZTSA 3PYDA 3BEGB 3R7BB 2Z2ZA 4UT4A 2IRUA 4N47A 3T9ZA 2CQ4A 5AXNA 3VAGA 3D0GE 2OGUA 3EGNA 2K3IA 3M2RB 2O66A 1VQSA 2UXBF 3IC1A 3MECB 1RT7B 2LU2A 2HQGA 4W92B 5HROB 1KWMA 3NEKA 3JQKA 2PMWA 2MZSA 4DLEA 1FEEA 3CIZA 4M5DA 3PHTA 3UDCA 3KK3B 4OX8A 4IG3B 5D0HA 3T5KA 2GCFA 3SSQA 1RDRA 1HNZJ 1MMNA 3LP0A 3LW5C 5DQHA 1VRUA 4DR4J 4ZP6A 1FNXH 3RBEA 3BGRB 1I3OB 3OTOJ 4CO0A 2M9KA 1SH0A 1SB6A 2R7TA 4C0OC 4DF4A 2EFNA 4DPTA 1FI4A 4DV5J 3FEZA 3ZTQA 4AFFA 2VC1A 5HK4A 4X2BA 3G82B 1XWLA 1X4AA 4K4YA 3C66A 2RF2B 4OI4A 1X4HA 3JTPA 5HVGA 3G9CA 4WTOB 1H2VZ 2DCLA 1VQNS 4QR0A 2AYMA 4C11B 3DGPA 2XO7A 4QPTA 4NLQA 2BM1A 2R4FA 1UPPA 3BH7B 1Q8KA 1IBMF 3MGJA 3D9BA 3UD3P 2MQQA 3JSMA 1D3WA 4RU9A 4IQXA 4DN0A 5LJ5Y 4P9SA 2BABA 4AQYJ 1RP5A 3GV5B 2D3UA 1NHUA 2WSEC 2UXDJ 3OL6A 2ZH6A 4CIOA 4TKTA 2ZWOA 4IOAQ 2EXUA 3ISNC 2ZH1A 3D66A 4B3TJ 2DHGA 4O3NA 2NXNA 3AB2B 3FQKA 4NXNF 2DBBA 1IN0A 4QQBA 4KB7A 5CYMB 2E1RA 5ETSA 1N52B 3VAHA 2DB1A 4HH1A 2AEFA 4USJC 1JLQB 2ZH2A 4K4SA 1FE4A 4ZDNA 3UVJB 1M1KT 3IP0A 2VDIA 2C2RA 4DQRA 5E3CA 1M5OC 1NHVA 2KRBA 4NA1A 1O51A 4WFBQ 1IVZA 4PUOB 3E8OA 4HVZA 2CJAA 1TL1A 2DH8A 3GFXA 1VGYA 4NCGA 4ANEA 4PG8A 4UOFA 4NLRA 4CO5A 3RAMA 3PHEA 5G4DA 3RBXA 5JUMA 2CJ9A 4A8KA 1ELOA 2VA3A 1F2HA 2YKMB 4KH0B 2BBEA 4RUCA 7FD1A 3OL8A 2IPOB 2DY9A 4DQQA 5HVFA 4ED2A 1WELA 5KFOA 1PJ6A 1LV5A 2OPRA 2LA4A 4N7TA 3CD0A 4X66J 4UZBA 4I2QA 1NH7A 1YRXA 4DV1F 1FDNA 1KEKA 2AKWB 4BDPA 2Y1RI 1J5EF 1M0SA 1WHVA 2F4FA 3BGFA 2GHVC 4F0KA 3Q0AA 4K0KF 1OQ6A 4F0HA 1HMVB 3SDEB 2JC0A 1FDAA 1RWPB 3IS9B 5KFKA 2UUCJ 5CABA 4WFNQ 4DR6J 1NSPA 2J6TA 4OHZA 3DOMA 1FTCA 2AQ4A 1UJ4A 2HFOA 3JXOA 2J7WA 3M32A 5L1IA 1N6QA 4UOGA 3DKDA 1RTHA 4KAIA 2FLNA 4PEOA 2HFSA 4DS5A 4DU7A 1NZ8A 3OFGA 3K8WA 1T8EA 2R7UA 1NEEA 1UWAA 4WK1A 4YMEA 1XR7A 2IY5B 2AGQA 5IWAF 5JVHQ 2FVQA 3UR3C 3H5UA 2ZUAA 1HNIA 4GKJF 2QO3A 3PACA 2YKQA 2VDHA 2WVCA 3RW6A 2GVDA 4DPOA 3KUHA 1D8YA 3CT9A 2ZVIA 2WOMB 2Q3PA 4J9MA 4KYZA 3TUPA 2FHJA 3KJVB 4TVAB 2H4WB 4B3SF 3SCIE 3UW1A 1KDNA 3T1AA 1CJUB 4NZ6A 2ALYB 4ZJLA 5HLFA 5I3PA 1S72S 2QJ3A 2VPWB 4Q5VA 2UUAJ 3SSSA 1TVRB 3ZZRA 4YB1P 4JI8J 2KYXA 2HNZA 2ADCA 1W26A 4B3RJ 2R7SA 4JI2J 1QVFR 3EUNA 4DSFA 3TAPA 3GTYX 3AB4B 2FZKB 2PO4A 2FJWA 3TOQA 4LF2A 4MH8A 2HRTA 1SCJB 2VQFJ 4NZ7A 1KBRA 2ERRA 4FF2A 3ENVA 1U0HA 1JLBA 2ZBQA 1HQUA 3R2DJ 4ES3A 3SCLE 1CC8A 2IHR1 2W7AA 2E5LJ 2QLJB 1WDDA 5T7LA 3TAQA 4NCBA 4WYLA 4JI3J 1F1BB 1OSDA 3Q89A 4ZVOB 2W7PA 1P6TA 2D7SA 3W60A 1REVB 1KOHA 1KN6A 1F5CA 2UU9F 2I5JB 2A2CA 4ZA1A 4DV3J 2BW7A 4P52A 2DO4A 2K3KA 5HBMA 2C2DA 3RZAA 4QCLA 3V5RA 1IM4A 4IO1A 2KXNB 2DGQA 4KQZA 1VC6A 4GO7X 3W9JA 4KRWA 2H54B 2DJWA 4RR5A 2N3OA 1JLGB 4LFAF 4H4MB 2MDAA 2YBVA 4KGKA 4X4TA 4QYZK 4JI6J 4DMZA 2HURA 3GB0A 4PWWA 4HT7A 1N34F 3HI9A 1LW0A 4FF3A 5E41A 1XNQF 4N77A 3DDNA 2CNKB 3QJLA 4I56A 5G0RA 2X3DA 2EI5A 1UJ6A 1VDHA 3D0IE 5IV3A 2E9TA 5L1KA 2XMKA 3UNYA 2K2PA 4ZK7M 1S6UA 4LSLA 3OFHA 3PTWA 4K4XA 5SUHA 2QL5B 4NX9A 5KT2A 2NLWA 3S6EA 3JQMA 3C15B 3OUYA 3VCDA 3LO3A 2ZVSA 2ZBIA 2VG6B 3MCOA 5F3ZA 1RYSA 1WHXA 3LP2A 2FUG9 2PC6A 3AODA 1VRTA 4XO0A 3CUNA 3DLKB 4FVMA 2HQDA 2RDJA 4F7VA 1K44A 3DRRB 3MD3A 3MHYA 2L41A 3U02A 4DUZF 1CSJA 1FRKA 2BXJA 1SJ4P 2CPDA 3KK1A 4CCHA 3GPAA 5LMUF 1LWXA 4ANCA 3SEOA 1S79A 2E5JA 1CLFA 3H7HB 3C6UB 3DRPB 3MR7A 4NLYA 1BD6A 4LF5F 3JAMU 2KT5A 3L7UA 3OTEA 3V6DB 2H5JB 1SC1B 3Q8VA 3DLGB 1XMQF 3GU0A 2GJIA 5C24B 3MPWA 1FKOB 3KDNA 4P75A 2Y1IA 3VVUA 2VBXA 4YEAA 2O01C 3CVKA 3H8YA 3TVYA 3K8VA 3OTBA 4ETXA 2MHNA 4CLLA 2XMWA 1MROA 3WHIA 2XQCA 4XPCA 1I94F 2QA1A 4GKKF 2IMOA 1SC4B 4U95A 1U6ZA 2DYAA 1CJKA 1F5BA 4LR7A 2F8EX 2QEXS 1JLCA 3R9LA 3G71S 5KG1A 1XMBA 2HHXA 4J9SA 1UVNA 5A8WB 2QMWA 2HWHA 2HQIA 5F8JA 1K1SA 3N6LA 3BO4A 2PEHA 4WP8A 2VZ9A 4RNHA 5JXSA 7FDRA 3QZ7A 5I3UA 1HBUB 2P9CA 3CJKA 1KTVA 3O6QA 4RBVA 4RW7A 5D0EA 1U09A 2Y1LB 3GFZA 5AJ3J 1ZTTA 4RW8A 4M95A 2YNGB 3D6HB 1WHWA 1HPZA 5B0DA 1REGX 2ZH7A 4ZMMA 3C16B 1UVIA 4WZMA 4A8FA 4DX7A 3GCXP 3FFIB 3FRZA 3FBFA 4D3HA 2E7XA 3KMSA 3BSOA 3DDIA 2F40A 1SJ3P 4M5MA 1S76D 4WJBA 1C4AA 4WWSA 1NPRA 2EFQA 3AT1B 4U7UD 3U27A 2E44A 4B3MF 3HF5A 2DRAA 2K1RA 2FTRA 1I6JA 3MM9B 4DL4A 4HACB 2CG4A 5EWGA 4IH5A 4N76A 2B0GA 3QT7A 5KFTA 2BJ1A 2OMOA 3CEDA 5HO4A 1RA7A 1IWGA 4L76A 1ITPA 4YN3B 2H65B 1X7VA 2DEIA 2RDIA 2NUUG 3QLHB 2IC3B 2BJDA 4JI4F 3R3TA 3U1LA 4PPDA 2YKPA 4F67A 4OIXA 2YKNB 4V19X 2J7UA 2G2OA 2XMJA 2XI3A 4H4OA 4OZLA 1T05B 2AWZA 3OR2B 4OZ3A 4GC7A 4I68A 2UUBJ 1DAXA 2HPUA 4WXOA 2UVUA 5GAGU 2MXYA 3R1HA 1RWVB 3TUIC 4HL9A 5J1EA 2X7IA 4IQMA 3MPYA 3OVAA 3DLJA 2AHOB 3UCGA 3LP1A 3K5OA 2AJ0A 2JFKA 1LWEA 4Y2AA 2J9DA 5D3GB 3KUGA 4Y28C 2YPZA 3MD1A 2OP5A 1PBUA 5FDLA 3QFWA 3F41A 2BZ2A 2E29A 5RUBA 4PWUA 2ABYA 3PNIA 5F8IA 2FJXA 2BA9A 5HQMA 2J8SA 3AFGA 1PSDA 5C25A 2C3OA 3AH6A 3UCUP 3LH2S 1X8DA 4I7FB 1W2IA 3JYTA 1KVIA 4ICLA 2DVIA 5GAGI 3W61A 4LQ9A 1GXUA 1GMUA 2HBQB 1N5TA 2CQ2A 2V9WA 2B4VA 3OFEA 5A8KB 4X4PA 1XIQA 2E5GA 3MCSA 4CO4A 3M2UB 3D1HA 4LJMA 1QVGR 2BW2A 4MYTA 4UUWA 2LEBA 2ALZA 2KKHA 4YFUA 3DI6B 3ZZOA 5D4OA 5JVGQ 2OIHA 2GNKA 5L39A 2PI4A 1DLOA 1XMOF 2AEJA 3JB9k 4EBEA 1WTBA 2VOOA 1UA0A 2OD6A 2AF6A 4H4KC 4G6VB 3CJTA 3HZEA 3V4IA 2IRYA 2UXCF 4LR9A 3KLVA 4WP3A 2VONA 3UO0A 2ZITA 3UDLA 1FESA 5L8RC 2IA6A 2G0IA 2O5DA 3P45B 3HKWA 3W2VA 3BO2A 1NK0A 3CJ4A 1KKHA 3M1VA 3G6YA 2RHSB 2WK4A 1RKJA 2HBZB 1AYEA 8RUCA 2EC0A 4LF6J 1YIJS 1XNRF 1HBOA 5HMYA 2KO1A 4RKUC 4RWWA 3I5CA 3M05A 1ICEB 4ECYA 3LF0A 3NNHA 3KK2B 3DXSX 1HNXF 2KI2A 5IZHA 3TRGA 2MLXA 1VQYA 2HW3A 3T5HA 2AYEA 1OO0B 5A2QY 5DG7A 3IA0A 2J5AA 4DXLA 3I87A 4WFAQ 3CO0P 2VUGA 3OTDA 2WB4A 3D3BJ 4B9MA 3HZGA 5DETA 5IS2A 3MEDA 3EDQB 2Q1LA 1RGVA 3M30A 5CYQA 3T6BA 2PN6A 1TUVA 3T5JA 1QLNA 2HHTA 2B7CB 2B4OA 4FPIA 4DR5F 3W7BA 3VGVA 3EXCX 2WW8A 2CPIA 2XLIA 2HYIB 5D77A 7AT1B 4X62F 1T9WA 2CNNB 4DHVA 1PKUA 1R0CB 3GWCA 3SQGA 3HHKA 5EX3A 4OQJA 3WBZA 1WG4A 3LP0B 1VRUB 2V0NA 1DARA 1X4FA 2R2SA 2YXLA 2HVEA 3CW2C 4LF4J 2H51B 2JLEA 1HBMB 2Z30B 1S77D 1SIZA 1Q5VA 1WF2A 3NCPA 3QAEA 5CQGA 3I4PA 2XMMA 2IJNA 2J8AA 1RWXB 1S9EA 2HIQA 1R8AA 1MMDA 2MKCA 1UVMA 4N5SA 2CJKA 1VCTA 3GIRA 4I4BA 4BC7A 1S0OA 1P9YA 1H7XA 1KS2A 4Q43A 2NUHA 2VFSA 4MK8A 3VAFA 2J9EA 1B99A 4UTGA 4RW6A 3FVYA 2EG1A 3DGPB 1T11A 1ZTWA 4E98A 3CMAS 1S1XA 2ZBCA 3GZ7A 2W9BB 4LF7F 5KG7A 4G3IA 3JSMB 5D6GA 3DOLB 1FTRA 1FFSB 2D41A 2F65A 3P49B 2MKSA 2Y1JA 3NS6A 3W65A 1E6VB 4FYDA 2FC9A 2DK2A 2W8KA 4DFMA 3RAXA 3QPIA 4L6V3 2Y8WA 2A0FB 2DY1A 4FKXA 2OMLA 5KT4A 3NWGA 3J81j 4ZPAA 1TU0B 1RUSA 3N5BA 5HMXA 3F0NA 2VJUA 3IG1A 2ATCB 3OHBA 3BPDA 3C3LA 2ZUGA 4OYAA 4JB8B 4N8OA 3CB4A 5J2NB 4EMDA 2HVZA 2OPSA 2BMBA 2W4DA 3A1YG 2KVIA 3D0HE 1DURA 1RT5A 4V1Ak 2VG7A 2BM0A 2MSTA 3D7SB 1R0AA 2VOPA 5J1PA 1NKBA 4JI7J 4PPZA 2CYYA 2IBOA 1YITS 1TL1B 4FS2A 3MUMP 1S48A 4NCGB 3OBIA 2CJBA 4UUXA 5D15A 3P6YC 2HRUA 4NYPA 2Y0BB 1GEHA 2XI2A 3OL7A 3MM8B 2VBYA 3VGUA 4LVNP 3JSRA 3O5TB 1UETA 4CRJA 2LEAA 3HCXA 1WG1A 5LSRA 4NCAA 1I51B 4ANDA 2GJ2A 3IWXA 3JS9A 2OPRB 1RT6A 2XEXA 3J7Z5 1RLCL 4EYIB 4I2QB 4NOHA 1LXNA 4C3MA 2IJFA 2KVQE 2Y8YA 3EYZA 3EMTA 2G2ZA 2VBWA 5KTQA 4LSNA 4O0NA 4FVCA 1Q7LB 2WCXA 1S1UA 4P7VA 5KOXA 4OYBA 1J27A 1NNDA 5HN0A 3GONA 3MTJA 1RJJA 1LQ9A 2W8LA 2GQ2A 3D67A 5KFDA 4LIRA 1WD6A 2V5HG 4C8NA 2K8GA 1YK9A 2LP4A 2AJ1A 4DR3J 1SH3A 5FD1A 3T9NA 2KHDA 5CD4H 3WX4A 1RTHB 1R8HA 3KXDA 3AJ1A 1HNZF 5ETNA 1RLDA 2YWWA 3CJ8A 5K9FA 2HQFA 4DR4F 3MOJB 3KOAA 1KD1T 4CNZA 1Q79A 1XC9A 2AX1A 2UUTA 3DLLQ 1R0BG 2XCAA 3TVKA 1U8SA 3AQOA 2W9AA 1HNIB 2ZJRQ 4IFVA 1ZETA 4F4KA 2GGPB 1CJTA 3S01A 4Q2MA 2OI2A 4DV5F 5LM7E 2QRRA 2Z57B 3QIDA 2FGOA 2GVDB 4LT6A 1LFWA 3W5ZA 2CNOB 2YNIB 3HMJG 1TAQA 1PG5B 2C2NA 1LNQA 1L3UA 4KO0A 1QAXA 1RHUB 2ZH3A 1SXLA 2KDOA 2VFTA 1NU4A 1RAAB 3MI7X 1HLWA 2H5IB 2XYGB 4ELTA 1N56A 1NZAA 3IBWA 4FKYA 5AXMA 2RVJA 5K20B 5DDOC 5C2GA 2X1GA 2RQKA 1NK7A 4X4QA 4CLZA 2WONB 2QGFB 4NA2A 1BQXA 3M6UA 2HNDA 3ZZPA 5F8NA 4AQYF 2GQCA 2QLBB 4F50A 2HAFA 1RTZA 2UXDF 5KFGA 4ZPBA 1N32J 2QA4S 4A8YA 4M63A 2VFVA 4JI0J 2RIJA 3JSBA 4NE9C 2XSJA 4JUZA 1LKZA 4B3TF 3RB4A 3PKMA 4KY3A 1U0HB 1JLBB 4N41A 1HQUB 1SBRA 4QOTA 3ENAA 1EP4B 1X4GA 4JYAJ 2FHOB 1S0MA 1A9NB 2CVIA 1UP1A 1CJVB 4MAKA 2AV5A 4JV0A 4CLUA 3HKZD 4NZ0A 1LFPA 1B64A 4CO3A 4FF1A 3K5LA 1P8GA 4PYDA 4I0WA 4K50A 2YX4A 1RI7A 1VR6A 2AD9A 3C19A 2IDEA 1AZSA 3V6JA 2EKNA 5HBMB 4U8YA 1QY7A 2CADA 4G1IA 1ULRA 1TL3A 3PY8A 2YQ3A 3DRSB 3Q86A 1D9FA 3K2YA 3IR6B 1RT2A 4ZVHA 2DNPA 3OTCA 2XZWA 1T7PA 2YNFB 4X4NA 3PXGa 1TL7B 5K14A 4URGA 4PYAA 2KB2A 2MY7A 2QIFA 3EVOA 3HX9A 4YP3A 1LW0B 4X66F 4LRBA 2I0XA 2KT3A 2C3YA 5G0RB 4ZOSA 1WOPA 2BANA 4IRCA 1JWWA 3U7JA 1YBTA 4HHJA 3A4TA 5GMKa 2F4VJ 1APSA 2MQNA 4U7UK 3OT9A 2DR9A 1EKRA 2HFVA 4ERDA 4Q8EA 4USIA 4F25A 2J6UA 3TZXA 4LSLB 2OTJS 1N33F 2C22A 2B56A 4DR6F 1JNZB 2FVCA 3OUYB 2RMLA 4DPUA 1HNVA 1KFDA 1NUEA 2HVDA 4EO6A 4NLSA 2HGNA 3TP2A 2B6AA 4B3OA 1VRTB 1MN7A 4OI6A 2OH2A 1Q8BA 4F04B 3OW2R 3KLIA 3GFHA 2HMIA 4PXBA 1JJHA 5ETKA 2LQJA 4JOUA 1NAQA 1NXIA 1RAEB 4MK9A 5KG6A 3KK1B 3O2IA 4A8MP 2F8MA 4ILMA 1NB2A 2OSQA 1VBKA 1VLYA 3W64A 4J7CA 3NGDA 4FS1A 4ES2A 9ATCB 4B9VA 1C0TA 5KFCA 2OPQA 4LFCJ 1AB8A 2PIIA 4F4ZA 5LXRA 4ZVSB 1RISA 1TMJA 2WVFA 4TLRA 3EGZA 1HWJA 4UZCA 1PIEA 1NCLA 1SQFA 5LSLA 2PA3A 4OX6A 1MROB 2NCKL 2AJ4A 1L5UA 3N28A 1JK9B 4QIGA 2NR0A 3HVTB 4ED0A 4ZPDA 4YB5A 2UUAF 1KLNA 4OYOA 2IMWP 1TK8A 4JI8F 2JJ4D 5DZ6A 1RAGB 1H73A 4F0MA 4O3SA 2P6SA 4DEZA 5AE1A 4W4MA 2V2KA 2CDRB 4B3RF 5CAAA 4JI2F 1LWFA 4WFZA 3WIVA 3CE8A 4WIIA 1UVJA 5ETPA 4DS4A 1M1HA 2CQCA 3OLAA 2XZTB 2GHPA 5F41A 4TYAA 1GK8A 1C2PA 1VBYA 3M8QB 3SMZA 1RTDB 2CAJA 1ZA2B 3L3CA 2VQFF 4DI6A 4R8UB 2QA2A 4ECSA 3MAAB 3H98A 3L7PA 3CJKB 4RW7B 2E5LF 2PFDA 1OYEA 1FFGB 2ZKUA 4CLSA 2F3JA 4JI3F 4P74A 3HO1A 2B8QA 4A8OA 1JLEB 2QLWA 2DNOA 3NXZA 2ASJA 2Q79A 4BWJA 2BDPA 1EARA 2QLXA 4UQGA 3ET6A 4V19J 1YX2A 1FK9B 1OJ4A 1X60A 2YWHA 4CM0A 4DV3F 2W7OA 2KT2A 2IVMA 1ZAXA 3BZQA 2R7OA 2JDJA 2RSQA 1WC4A 4LF9J 4QIFA 1X4BA 4I1TA 1HW9A 4P72A 2LXUA 1NRKA 5E3RA 1WC0A 3MMAA 4CH1A 1X5OA 1NJWA 3MMBB 4DUYJ 4JI6F 2POKA 2C3MA 2LA6A 1PYOB 2K1RB 2CFXA 1U2CA 2ZOMA 1Z1ZA 5L1LA 2YH0A 1UTAA 3L7OA 1R7IA 2KXFA 2R8KA 2W2OP 4DSJA 2CG8A 4JI4J 2ZHAA 3N4WA 2ZNYA 3ISND 5KFIA 2FLLA 4FYVB 1MWZA 1H38A 1TUGB 3WC0A 1VQ9S 1MNEA 5F0UA 4WXWA 4AL5A 1NK5A 4X4SA 2HK3A 1QSSA 1OIAA 4DFKA 5IQ6A 3X1LB 2KHCA 1UWBA 4R5PA 2WHOA 2VJVA 3TZZA 3NBPA 2W2PP 3LPYA 2RKIB 3IFEA 2V94A 3GJTB 1TZ0A 3CD6S 2DR7A 4O4GA 4Y34A 1FRLA 4DX6A 2VIHA 3BBCA 4JV5J 3BYPA 4QW8A 4BC9A 4WCEQ 2U1AA 1S0VA 3B8HA 1IKWA 2E1CA 5J1EB 3PW7A 1S6QA 2G1DA 4NYZA 4DV6F 5KFHA 2RILA 5H9EJ 3LP1B 4X4VA 4J9PA 3J7YI 2C2ZB 2HS4A 2K7KA 4KPCA 1WEXA 3OXGA 5FDLB 3R8YA 3G4SS 2M88A 1MW7A 1SKWA 2FLOA 2LVWA 3BKTA 2N7CA 3GMGA 4USVA 2GJFA 4A8WA 1U8WA 4B9LA 4J9VA 1U6FA 3PZPA 2FHMA 3MCMA 3PW0A 2IM3A 5A76A 3PX0A 1GXTA 3DRXA 4DL2A 2NZCA 3MEEA 5KFMA 2QYGA 2MGZB 3DN9A 2KU7A 3FSYA 4ICLB 1ZM4A 3AOAA 3E01B 2MB0B 2UZAA 1S1VA 5DG9A 4X64J 4DSKA 3KG4A 2H4YB 5CHCB 4ZP7A 1WNEA 1JLFA 2CZVC 1DY3A 3G8SA 2QN6B 4Z7CA 2XYHB 4ZIWA 1X0PA 4O3RA 3THVA 1TAUA 5A0YB 3GYGA 3KLHA 1ZBTA 4Y0FA 2W24A 3TUZC 4IKAA 4MKYA 5THWA 1RACB 1NSAA 2RU9A 5AJ3F 1BC6A 3T1HJ 1N5YA 3AA8A 1KLMB 4PABA 3V4IB 2GZOA 3T1YJ 3W9IA 2W9CA 2J76E 1HQ2A 3MCNA 4I2PA 2ZC4A 4KSEB 4WU2A 2UV8A 3ZZZA 4K4WA 1AT1B 4PRFA 5HP1A 2VBZA 1N54B 4DJBA 1S0NA 1XNRJ 2XTJP 4TXSA 3GSIA 4WF9Q 3W2VB 3NLCA 3MR6A 2Q6BA 2MTLA 2M4MA 4I67A 1HBOB 1M5PC 3P4UB 1R43A 4N8NA 2XC9A 4CI0B 1ZH5A 1G6BA 1XR5A 3S8SA 1HIYA 2DD8S 3I32A 4LRAA 3M8YA 4P2SA 3IM9A 2AZ3A 3ETOA 1TP7A 1X5PA 2VL1A 3ZC4A 2F9DA 2VODA 2KH9A 2HZCA 3TAMB 4NXMJ 4HDGA 4M8LA 4EI2A 2RH3A 2DNLA 3C14A 3ELHA 2A1BA 2XO6A 1K47A 1YJWS 4B9SA 4NMLA 3NS7B 4DR1J 4TYBA 2L9DA 3EGWB 4KE5A 1VHFA 1X4EA 2HZAA 1UFWA 1FO1A 3KNAA 3M30B 4TLQA 2E9RX 3D68A 4EYHB 3OVBA 1EIYB 1CS4A 4FBUA 3AA9A 2VB6A 4CNYA 2HZVA 4Q7AA 2YQ1A 3KG1A 1FT8A 3PKYA 1VQOS 4YR0A 1V3RA 3W5YA 2H9ZA 1XN9A 3B54A 4RUBA 2UUBF 4C2MA 4IDKA 2D3OR 1FE0A 4M5NA 1TUWA 4IG0B 3H25A 1E6YB 5B0GA 4F26A 3ITHB 2QX0A 4NLUA 3AY0A 3PW4A 5DGAA 4DZDA 5ETOA 1TFYA 5LXYA 2HRYA 5MAOA 1YRUA 4F2SA 2XNRA 3K58A 1FJGJ 4JP8A 4PZVA 2MSSA 1BQNB 3K5MA 3PYFA 4XIUA 2XY6A 1IR0A 3O3LA 1HYSA 1Q8LA 4OI0A 3NY0A 3PEJA 5E3QA 3KJFB 5HJXA 4L73A 2O1PA 2HHWA 2X3GA 2M0GB 1HI0P 1S1TA 2AJ2A 5KT6A 4ZIVA 4O44A 4YS2A 3IR7B 3PX4A 1G3OA 1S1XB 1FXDA 1VIXA 2KM8B 4KGZB 3CMES 2Q43A 2RRNA 1LK5A 4NLVA 1M5VC 1WI8A 3LUYA 3ZO7A 3CMQA 3H20A 1F3FA 3HK2A 3BBFA 3CJ2A 1F60B 4KKOB 5BYQA 1WF1A 3L09A 3NOCA 2FJEB 3W62A 4PG5A 1D9DA 5HROA 5E3AA 1N5VA 1BHNA 3C46A 3IM8A 1U0SA 4ZVGA 1U26A 4X65J 3BKUA 3LQVA 3TJAA 4EBDA 1U1KA 2HLUA 2BRKA 3VWSA 5JJBA 1RCXB 2HNYB 5M2RA 3IG1B 3UDEA 4LFBJ 1N0UA 1S59A 3HFVA 1S4FA 4OHWA 4ETZA 4R0JA 3JAMY 1QUPA 2OPSB 3BGRA 3MTKA 5C2CA 3G6XA 4M94A 2DXEA 3DGVA 4RWXA 3N01A 3RU0A 1FRIA 3BR8A 2HQCA 3TI0A 3GJQB 2MKKA 4B9TA 3G82A 2COLA 4C0BA 4RNFA 5B09A 2P8IA 3FC9A 5FLXU 4LF6F 1SIWB 1R31A 2VFUA 1VJQA 2IAJB 4HDHA 4DCOB 2DNQA 2GIRA 2G1HA 4ID5B 4C11A 4ZVRB 2K7JA 2IIHA 4DCPB 2FVSA 1RT6B 1NMEB 4BCAA 1NSKL 4IYQA 4BBYA 1F2GA 3FNNA 4C8ZA 1CULB 4DL0C 1RHMB 1RWKB 4F3QA 1FKPA 5HQLA 2PE8A 5DDRC 4ZJQA 1O0PA 2MLYA 1WF0A 1VMBA 4LBPA 1OMSA 3OR1A 2DEJA 4KHMA 2MZTA 1RU2A 1URNA 1S1UB 3DFEA 5IXUA 2MZRA 4KBIA 1EAYC 1V9OA 3J7AN 3TX0A 2H48B 2QL9B 1YJRA 2CIMA 1SQEA 3BV8A 4DSEA 2PDAA 4YHHF 2FY1A 1PAEX 4OZJA 3UVJA 2M7SA 3IR5B 3C6TB 1KFSA 2G13A 5K8OA 3T5LA 2XY7A 1BMQB 3V6KA 5H9FK 1WKJA 1FCAA 1IM6A 1GTEA 2FVPA 3OFFA 4LF4F 3HDSA 2KRRA 2RB7A 1C0UA 4IRKA 1H72C 4IH7A 2MKJA 4F36A 4WKRA 1UEKA 1L3KA 3SQOP 3ILIA 1EQMA 3KJNB 1KOOA 3POTA 2B7BB 2RUSA 3QT5A 4JI1J 1CJTB 4DX5A 5F8MA 3GE9A 4XTTA 1GAOA 1PILA 3OSPA 4Y2MA 5IFMA 3HJVA 2BKPA 2CWXA 5B0FA 3AQPA 2DRDA 2ZJPQ 2EK6A 4ZVFA 3I0SB 4KO0B 1XQIA 2B9EA 1SH2A 2C1EB 2D69A 2EWHA 3WIUA 5MLCV 4Z37A 2CQHA 4EZ6A 4CO1A 1SC3B 2PSZA 3Q8QB 4YDXA 1NKCA 4U67Q 3SYZA 1CVJA 3ZZYA 4ZHRA 4ZLJA 2IRXA 2VH7A 4RNNA 4NPOA 2HNDB 2G0CA 3TR5A 4D3GA 1HI1A 1DBDA 2HG4A 3OLBA 3Q24A 3Q23A 2RT3A 1HNWJ 2KXHA 4DR2J 2KZZA 1U24A 2PMHA 1JXLA 2BYCA 1RSCA 3T3FA 5F0WA 3DU6A 1SV5B 3CD7A 1TKTB 4FPRA 2B43A 3MUTP 1JJCB 3BM7A 2JEJA 3K7RA 4XAKA 3HM9A 4I69A 3QT8A 4L72B 1S5ZA 4JI7F 4KFBA 1S1WA 2PI5A 4OJ3A 2GVZB 3X3UA 8AT1B 1UPMB 1DRZA 1GXLA 3R5AA 2JRSA 2HLTA 3DLEA 3SFUA 1CJUA 3AJ2A 4RPFA 4CWBA 4PG4A 2ZEJA 4DV7J 2DHHA 2H5EA 1NHKL 5K14B 1AXQA 2GV1A 1PO6A 3FQLA 4O3QA 2JWNA 5DZ7A 2MQMA 2CXEA 1R8CA 3CO9A 1X9MA 4K7QA 3VALA 1N33J 4ZP9A 4DU8A 3MEGA 1TKZA 2NS1B 3JSYA 5T41A 1NH8A 4NL5A 3M2VB 1JJ4A 3W9HA 2JOQA 3I9ZA 3FZ2A 2D1CA 3DM2A 5GMEA 3EZOA 2O67A 3BS9A 1YHQS 2R8IA 5B08A 4NLWA 4KC5A 1IR2A 1YJVA 3EJMA 4U8VA 4LF8J 1S97A 3PJXA 1RBOB 2OLWA 4OYIA 4LUBA 4RNMA 4DR3F 2B6AB 4ED7A 4B3OB 4EEYA 2B9YA 1XTZA 2HS3A 1O6XA 3CDUA 3K57A 2XHWA 4TU9A 2BE2A 1KONA 1QD1A 3EM1A 4DPWA 3KLIB 1U49A 4WFXA 2CPHA 1REVA 1VQPS 4L75A 3DHWC 5EX0A 3V81A 1RCOB 2IM1A 2BR0A 1WTFA 2D9OA 3B4DA 2V4JA 1EZZB 2BV3A 2ZHBA 4QBUA 4FYWB 1C0TB 3Q2SC 4HR2A 2E9ZA 3ZNUA 5A8RB 1VBZA 3PM9A 2R2UA 4H4MA 4RO0A 1IKYB 2CPZA 2GS8A 2PD1A 5B0BA 4FNHA 2GMHA 1IBKF 4OLPA 3PV8A 4C8MA 3DHXA 3BGUA 3DMJB 2B51A 3AJDA 1N5SA 2E1MC 3VGTA 3PIPQ 3IMQJ 1RXOB 1J5OA 3SCKE 2MY8A 1EHWA 4ECTA 5DS7A 1LWFB 4J9KA 2GC8A 1M5HA 4RJVA 2WBMA 4FDFA 1U1MA 1O8BA 1U1LA 1YBUA 3DC2A 4ED5A 1YZ7A 1N32F 2E1AA 1JKHA 4HHHA 1NDKA 4JI0F 4O3OA 1OY6A 3FSXA 2BJEA 4IR1A 3DLKA 1UFLA 1H2UX 4KGXB 4J9NA 2LEPA 4DR7J 4JYAF 1FX2A 2BKNA 2FJBB 2DHXA 4KGMA 3BSAA 2M3DA 4ATNA 1IKVA 4TY8B 4K5RA 4U96A 2HVIA 4WK3A 2IFXA 1OPIA 4W98A 3J7ZT 5KFBA 1Q81T 3IWLA 1EETA 1R6VA 3DLGA 3ZFVA 3NRBA 5BYRA 4K59A 5C24A 2YVSA 3PFEA 1V6HA 2LYVA 2BE7D 2FB0A 4EFAC 1T03B 1C1CB 3MMAB 1MMLA 3UN3A 4P10A 4ECQA 3K0JA 1RHJB 3HFKA 3NP5A 2GAGC 1IQZA 3CDWA 1WDTA 1P9QC 2V8GA 2XMVA 1AW0A 1RT4A 3QQCD 1RAJA 4ZITA 3W5XA 4CM2A 3CJ0A 1CPZA 2ZOGA 4CZCA 5A8WA 1JJ2R 3RYLA 1SI9A 2F4VF 4RNOA 1RAHB 2DGWA 4ES1A 1D8ZA 3HVAA 1HBUA 2M8DB 4GO5X 1V5VA 4LBHA 1RZMA 4B9NA 2L08A 2VASA 1HA1A 1UWBB 4R5PB 1HD1A 5K5MA 2NXEA 4RW4A 3QAUA 3NBPB 1XERA 2YWFA 2DNNA 1RT1A 4OV1A 3RRHA 4FBTA 1LOUA 4ZVPB 4IH6A 5IC6B 5DQGA 1OY9A 1OS5A 1FDDA 2CQPA 4MTPA 3MURP 2OD4A 4GMKA 1OWXA 2V68A 5C42A 4DV6J 4JI5J 2MJUA 4P2FA 2EFVA 3C16A 2DNMA 1IKWB 2LXIA 1KHWA 4ELUA 2YH1A 5EWFA 4AXJA 1HL6A 4AE5A 2KL8A 1UL3A 4CYUA 2YY3A 3FFIA 3BSCA 4DSLA 4IFYA 2J9DE 4OI1A 2C2MB 1WSRA 2MZJA 2XYPB 1GX6A 1Y5NB 2QLFB 1KQGB 2ZBRA 5F9LA 3G8QA 2RD5C 4LFCF 1DZ5A 3P3DA 4OJHA 4DL6A 3NWRA 1KTQA 1LW2B 1H6KX 1O5JA 1VRQC 2DITA 3O8WA 3D2WA 3FK4A 3PDNA 3I5AA 4QZVB 3FKBA 1RTJB 3MM9A 3PFOA 1VS3A 2BJ8A 4IR9A 2CPFA 1RT3A 3KLGB 3HSGA 3MEEB 1U02A 2V2QA 4DV4J 3A3PB 2Y3YA 3NGRA 2WTFA 3PJ9A 2UVWA 2N4CA 5ADZA 2VC0A 1FRHA 1KQKA 4ZKAA 3M9MB 2QYCA 4Y00A 3CCSS 3QLHA 2IC3A 2CDQA 3LA0A 4J9LA 1JLFB 3EX7B 4Y6IA 2ZZMA 3I56S 3WQPA 2B4UA 1YJTA 3GYNA 2D3O1 1T05A 2J9CA 3KLHB 1JB0C 5D0GA 2E1PA 2QL7B 3NL0A 3NKYA 4WYWA 4HI1A 5E5NA 3IRXB 4K5SA 2HKEA 1WEZA 3HHLD 4GC6A 2M5YA 2WVEA 3EZ5A 3QGIA 2YWEA 4NASA 1N5YB 3E3XA 5E33A 3M6VA 1VBXA 1FEHA 4CLYA 2Y9HA 5KFEA 4ITSA 3TVZA 4F3MA 2KG0A 1Q4RA 1FJCA 1ZAWA 5D3GA 4I2PB 2BQUA 1S12A 3Q8YA 2CQGA 5HP1B 4ED8A 2DKOB 4EK2A 5KT3A 1WC6A 2ILYA 1FKAF 2BJ7A 2RS8A 4Y2CA 2R7RA 4LF9F 4QIVA 2P9EA 3R5DA 4NWBA 5AXLA 3M8SA 3M6WA 2NZ4A 1Z4UA 4GVBB 1U7LA 3PRDA 3ENQA 3I4HX 2Z2LA 3MPVA 4J9QA 3QYYA 4DUYF 3M8PB 4ELVA 2ZWPA 3LANA 4H4KA 5DDPC 4PWDA 1FX4A 1N36J 1JXEA 1AA1B 1VLOA 4MT1A 1KR4A 4FNIA 1KQFB 1J2VA 4USUA 3KMQA 3K5NA 5C5JA 4B9UA 2OPPA 5E2QA 3C14B 4TN2A 5A8KA 3RGIA 3GIJA 3L95X 3GCWP 5HATA 3BJYA 2KFNA 4EWTA 3M2UA 2X1FA 1HBNA 4PQAA 2JEIA 3DI6A 2BQRA 2KFYA 1BWEA 3MZIA 4LVOP 3A3OB 1CS4B 1QE1B 4FYXB 4NMXA 4MIAA 4KPYA 2A6OA 2XULA 3B6BA 3O44A 3RB0A 2BEFA 3TJ8A 2X51A 1UAWA 3WC2A 2A18A 5IC4B 1TFWA 1YJUA 1FWPA 2NXCA 3RBDA 2Z56B 1NBEB 2MQ8A 3HVWA 3LOUA 4JV5F 4AXIA 4IDKB 4KV8B 4G1QB 2WSFC 2ZE2A 1G7CB 3ZZTA 4KGVB 1HQEB 4Y3CA 4UY8T 1YRTA 4LRCA 1WORA 4MKAA 3BBBA 1LWCA 3MR2A 5I42A 3MDFA 3U1MA 1LK7A 5H1SV 4A8SA 2JC1A 1HYSB 2XHCA 1YLXA 2P6TA 1FJ7A 3H4DA 2V9KA 4WE1A 4LIWA 3KK2A 1Y3JA 5KFJA 1NK8A 2CPJA 1S1TB 5KFYA 4DX8H 5DJBA 2HBRB 2XB2D 3IWNC 5BYSA 4OZ1A 4KJIA 1N88A 5HJYA 2YQ0A 4QWDA 2IM0A 4MFBB 4WKYA 4X64F 3FCVA 4G65A 4NRUA 1K0VA 4P7TA 1MWQA 1K73T 3VGSA 4I6AA 4C9DA 1S57A 3HJFA 5B0AA 2D9PA 3OHAA 3LAMA 4TY9A 4RU2A 3PEHA 5J2MB 4EBCA 4K4VA 5H9FJ 1RHKB 4FXVA 1RYRA 1Y00A 3QO9A 5KFUA 4UQTA 2V34A 4OYXA 4UOCA 3KLFB 2BJ3A 3ETMA 3T1HF 2J0QD 5HI7A 3D54A 1UFKA 1HBMA 3TQEA 5IT0A 3T1YF 1VK8A 1D09B 2MKHA 5L38A 2ZZNA 3TZYA 2E66A 4J91A 3MAQA 4JBCA 4QIWD 3GYXB 3FCHA 3H59A 4CLKA 3EVMA 2R8HA 3I55S 2UP1A 5U47A 3R6GB 3CCJS 2BVZA 4YUDA 5H9EK 4ZPTR 2VHGA 4FP9A 1F6TA 3PYEA 1Y11A 4C7QA 4ZPVR 3FEXB 1QAYA 1U4BA 3UN5A 2ZC3A 2F7VA 4L3KA 2RJZA 2IVYA 3QIPA 5HMWA 1DTQA 3BGLA 2NXJA 3N79A 2W9BA 1S9GA 2OEMA 3CCTA 1WOSA 4NXMF 3US5A 3TA1A 3DOLA 2A10A 4CLFA 3QFHA 1FKPB 2VICA 3B82A 5KG2A 1MN9A 2GIFA 5L9NA 4Q45A 3OR1B 4DR1F 4AL7A 2HWTA 1V3SA 4QPXA 1E6VA 1TTHB 2ZKTA 3S7RA 3SV3A 3MFIA 2HFZA 3BR9A 4YHHJ 4F4WA 4EZ9A 1H0HB 1C4CA 4M5DB 4DZ6A 4E0DA 3F44A 5LMNJ 1WUUA 2MJNA 1N5QA 3FCWA 3CDAA 1QUVA 2FY8A 4ZLPA 5J2NA 5SZTA 2W25A 1OQ3A 1UJ5A 4OFZA 4MK7A 1RU1A 2XCPA 1SL2A 2JEGA 3ADAC 5EN1A 5KT7A 3KLEA 1S4EA 2PMZD 1YTYA 2R7QA 1ZM2A 1FWKA 1C0UB 4IUFA 3D6TB 3HSDA 3GIMA 2IVFB 3EPIA 4CH7A 5GVQA 4USWA 5ETLA 3SCJE 3POTB 3ILLA 4K4ZA 1FJGF 4USMA 3QWPA 3MM8A 2QE5A 2BUNA 3C2PA 3NNCA 2VKZG 3LGHA 2RHQB 2CKWA 2W2MP 3HHDA 3DLBA 3BDPA 3M8ZA 2DXFA 3AD7C 3QATA 3CDBA 2AJQA 4M1KA 5KFVA 3OPKA 3OV7A 4A47A 4O23A 3DXBA 3J81U 2FZGB 3HHLA 1N8RT 5LSOA 5KT5A 2AMCB 4QWCA 2HS0A 4ZHRB 2LCWA 1K9MT 5L1JA 1W2BR 1R8BA 2Q66A 2NYIA 4ECXA 4DG1A 5KFQA 2APOA 1WKLA 3AOBA 2B5JA 3TEHB 1F5AA 3CULA 3VV2B 4DL3A 3M7VA 3QSIA 3QRPA 3RRGA 1P27B 3CJQA 3FBCA 3KHRA 1IBCB 5BXIA 4X65F 4YB6A 3GIKA 1H2TZ 2GMLA 4C3LA 2DNHA 2L48A 1CEZA 4M5GA 4LFBF 2R7XA 3HSJA 5KFZA 1HHTP 4MKVA 4NLPA 3W3SA 2MPUA 3CC2S 4KT0C 1V3ZA 2LKZA 5IT9U 1EJ7L 1YWXA 3WX8A 2M52A 4A46A 4J5OA 3OSNA 2GGPA 3CCQS 4OX9J 4XDCA 4DV0J 3DYAA 4KHPJ 3CGIA 1AUDA 2EFPA 4KFBB 1S1WB 2N3LA 5ETRA 2V2VA 4OLOA 3HSZA 2YNIA 3MM5A 5KG5A 1CQNA 3PRVA 2LQ8A 3DLEB 3J80U 4URQU 2FIUA 3G6ES 2BQ3A 3Q83A 4OV6A 2XSFA 4F2RA 4K2JA 1U47A 4CT9A 2PGCA 1QJHA 2Z0GA 3IBFB 1U45A 1M1GA 1VQ8S 1YJ9S 1VOMA 3ZNJ1 2WONA 2MQLA 4K2XA 1B0VA 6FD1A 5CCLA 1RQ0A 1T9VA 2EG2A 2EEYA 3VQSA 4TU8A 3BQ0A 2JZ5A 2LQ5A 3MEGB 1N0VC 1TKZB 1VQKS 2ZM6J 4MJKA 4ED6A 1TR0A 1XJWB 4KTQA 3DOMB 2V4RA 4CDIA 2DPJA 3DM2B 5CZXA 3F73A 2IDLA 1JX4A 1EP4A 3MM7A 3M32B 3TUJC 1IBLJ 1N6QB 3EE3A 1AROP 2NPIA 5KFNA 5A6PA 4DCJB 3JTNA 1FVSA 1IJFB 1CJVA 2UUWA 2BE2B 2WRMA 4TNOA 2J0WA 2XWXA 4CTAA 2I2YA 1TMMA 4FXDA 3HHLC 3R7NB 2B4PA 3KHLA 3V81B 3UN2A 5KFFA 3CTRA 2B9XA 2GFFA 3G6VA 3KG0A 3W63A 3MOZA 3H5SA 2V4JB 4ZN3A 3CCES 1QAJA 1WC1A 9RUBA 3DRSA 1IBKJ 2DNYA 2ZJQQ 4JI1F 2FQQB 2BKOA 3TO8A 3M9NB 1VC5A 1L3VA 4ILRA 3K89A 2LDIA 2E5HA 4L74A 1HFEL 2YNFA 1FFWB 3SXLA 2VG5A 5HLFB 1Q53A 1TL7A 5E0OA 2F8HA 2HEKA 3NGUA 1FRJA 2LMIA 2JH3A 5EWEA 3H4BA 2HNZB 1QSLA 2VV5A 1NLKL 2GAHC 1KNZA 4LMZA 4OJ1A 3R5JB 2OEKA 2DGOA 1J5OB 2R8GA 1Q1KA 1VQ7S 1OY8A 3GJRB 1DFDA 2DNZA 4RL1A 1RWOB 3I6PA 2BACA 4WFYA 5L9XA 5A6WA 2C2OB 4Q0BA 3ZTOA 3UCZP 1WOOA 1SKRA 1H98A 3R5BA 2A3JA 1IUJA 2VQEF 3C8YA 1JKHB 3QGGA 4NLGA 5ETQA 5EDWA 1PYSB 2RS2A 4ZCMA 1HNWF 4DR2F 5T7LB 2JFDA 5ITHA 2WB1D 4EGLA 2ZHOA 4O4RA 3PO5A 2ZFHA 1IR1A 1PAUB 1Q78A 3RTVA 3H40A 2VPZB 4A48A 3I31A 4HLBA 1GFWB 1TKXA 1U1OA 1Y4ZB 2ZH4A 4DPXA 4WBFA 1VQ6S 1IKVB 3H42A 5J2PA 1QAIA 2CQBA 2M2BA 5DDQC 4DOZA 3SBMA 1EETB 2CUYA 3MPUB 3BYRA 4F4XA 3PW2A 5LOQA 4HKQA 1RHQB 3EPGA 2MLZA 2R2TA 2DGUA 3LAKA 1Q16B 2V50A 1MSWD 4WZQA 3KYLA 2WW4A 5LL6d 1HWLA 2DTJA 3CJ5A 3HVTA 4DV2F 1VHIA 4DV7F 5K8MA 4URSA 2CPYA 4OMFG 3NS5A 3N5FA 3I9V9 3MF5A 5KOWA 5LT5A 2ZZTA 1RAOA 1RT4B 4PQUA 4OZ5A 2G0JA 2QT7A 1VC0A 4Y65A 1Q8IA 2BX6A 2XMAA 4ED3A 4PKDB 3M8QA 2AU0A 1RTDA 3F56A 2IM2A 1FF2A 3FRYA 1FRXA 5AE2A 2HHHF 4R8UA 2DR6A 5IM0A 3MAAA 3HT0A 1URRA 3DCAA 1PBAA 3LP2B 4XPEA 5IT4A 3MWBA 1NJXA 3QMQA 3GFYA 3T6JA 1S49A 4RW4B 3CPWR 4USHA 3PYGA 2OUGA 2GHWA 1SQGA 4F8RA 4LF8F 1RT1B 1B0PA 4YY3J 1JIHA 4C3KA 4DFPA 3UFCX 1JLEA 1LXJA 3GILA 4NEYA 5C42B 3V2UC 1JXVA 1Q7YT 4FXWA 1MU2A 3IRWP 1FK9A 1SJFA 4NI2A 1R8PA 4CYUB 1SJQA 4TQRA 5FLXY 4OHYA 3V4MA 2DGVA 4IFYB 4J9UE 5BJRA 1S6PA 2P2CB 3QBCA 2KTQA 3NCRA 4OI2A 3RB3A 4HI2A 3AHPA 3NAHA 3N9UC 1FVQA 3FMWA 4DF8A 2CJXB 3MMBA 2HGLA 2F9JA 1ROFA 4UY85 1T9UA 2YPYA 4ED1A 2VD3A 1CJKB 3NGSA 5AT1B 1RT3B 1KC8T 2WVDA 1JLCB 2EPIA 1DTTA 3A8KA 2XS5A 3CCRS 4H54A 4UW2A 3GSDA 1GT8A 4X4OA 2BE9B 2QTWA 3IGVA 2RE1A 2Q6CA 1WWHA 1ZA1B 2MQOA 3BQ1A 1B7YB 5I3UB 3GG1A 3D28A 4Y2KA 2EBEA 3EVWA 2ROGA 2AX0A 2ROEA 4B02A 4O0IA 2RKIA 3CJ3A 1UEVA 1NJZA 5C7PA 3QGPA 4RW8B 2AGPA 4C8YA 3SSRA 1HPZB 4F4AA 3VAJA 3I0RA 1FWLA 4DR7F 2VA2A 1I1GA 2IA0A 4PAAA 2E7VA 4YDDB 5K8PA 3THTA 2A2DA 4ID8A 3IAS9 3P5TL 5E3PA 2FPHX 3VVTA 3VF0B 5F8GA 3VAMA 1AFIA 3PR4A 1KRPA 1RTIA 3NGKA 4HHUA 1R3NA 1WACA 5HAOA 4XK8C 3S1TA 1FD8A 3TNVA 2FGCA 1VIOA 4TU7A 4OYZA 2ZH5A 2HIYA 1T02A 1YKWA 1K1QA 3CJRA 1P1TA 4ZCKA 4QWBA 2KZMA 2DNRA 1U6BA 4RBTA 5BR8J 4I6WA 1Z2LA 1Y5LB 1AFJA 2EW9A 2F5GA 5HQ8A 2MGZA 2J7KA 2ASDA 3MFHA 2CPEA 4PWDB 4C8OA 1VQ5S 2YTCA 3TQ1A 3AXMA 3E01A 3NG8A 3J7YU 1FXLA 2A6MA 2OPPB 4QW9A 1TELA 2JL9A 4NRTA 1JNRB 1RK8A 2O3DA 2MKIA 3RG6A 1Q82T 2GW8A 1CC7A 5I3QA 2DHAA 1X0FA 1IQTA 1HBNB 3BREA 5A0YA 4H4OB 5CXTA 1NPPA 3GV8B 1WSVA 1GNKA 1S7IA 2BRLA 3QRQA 4DWIA 2LLZA 3D4JA 4QR1A 4X4RA 3CJSA 2XLJA 3ULHA 3W8PA 2R2RA 4ZLLA 4OHVA 1CQMA 3P8BB 2MMYA 1KLMA 3H90A 5HVHA 2YWKA 3V6HA 1Q5YA 8ATCB 4JI5F 3GJSB 3KHHA 1RKIA 1NKEA 1RAIB 1YG0A 3TX8A 1HR0F 1RB0A 3AAWB 1LWEB 2ZE2B 3VZHA 1VQ4S 4ALZA 2RUGA 3P5BP 2DCUB 4KHRA 3THPA 1LWCB 3DOKA 3EXYA 4IOCQ 4DL7A 5I42B 1VI7A 3M8RA 2Z4PA 2CQ3A 1TK0A 4LQ3A 4OYWA 2FDNA 5J2QA 2M8HA 2LDYA 1UW9A 2MKYA 1F3VA 4QU7A 3KWMA 3ONQA 3TA0A 2WAQD 3M6XA 4RUAA 1SUQA 3FUYA 4AUKA 5C25B 4WE1B 1BUXA 4QJVA 5AXKA 3TYTA 3CSKA 2VFRA 5EGYA 2R42A 3G86A 3JYTB 3QNWB 5ETTA 2WVBA 5GAHU 1JMTA 4KR0B 3TAMA 1YJNS 4ECUA 3W2WA 4DV4F 1YDLA 3MR3A 1HHQA 2I6WA 2JVOA 1U2RA 2UXBJ 1FNOA 1JLAA 5FJ4A 1NM2A 1UEUA 1VISA 1VQMS 2RNEA 2AIRB 4RW9A 4BWMA 1IKXA 3VR1A 2QSWA 4WP9A 4K4UA 3KDOA 2AZ1A 1G2EA 1MWYA 1DLOB 2ACYA 1XK8A 2V8PA 1WEYA 3QO9B 1GH8A 2H3EB 5KFAA 4DQPA 3BB5A 4M5LA 2OO4A 5DLFA 1RABB 4X4UA 2FHKA 4IG0A 5GAHI 3PVXA 1E6YA 3W8GA 1N4LA 3G96A 1G1XA 3NNAA 2CVEA 3ITHA 1PYTA 3RB6A 1RBAA 1VK3A 2NPFA 1RBLA 2AP6A 3SZ2A 4ED4A 1QM9A 2MZ1A 1C1BA 2L9NA 2V63A 3M1VB 3HVRA 1SKSA 4P73A 1BQNA 3CC4S 1EKSA 3MPDA 5IOLA 2JX2A 1YSJA 3TANA 1U48A 2CPXA 3SI8A 3BKFA 1QDUB 3LGNA 2XGQA 4UF4A 3KHGA 2DISA 2DR5A 2CJYB 3Q8RB 1ZS6A 4HYKA 1IWAA 2YKAA 4DQIA 3MEKA 1IBMJ 2XG8A 2ZD1A 4A8QA 2XBPA 4F02A 4P6QA 1MLAA 3D5MA 3BQ2A 3QIPB 1ZZFA 5DM7Q 1DTQB 5B7WA 5B0CA 2ZBPA 1N36F 1S9GB 2N7YA 3FEYB 4CQ1A 4M5JA 3RBZA 3OJUA 2J0XA 1UCNA 1VYAA 1X5SA 3MEDB 3MMCA 2F63A 3LWLA 3MM6A 5CYQB 4E8UA 4KKOA 4NXNJ 3CDEA 4C6AA 4M5KA 3Q8UA 4MKBA 1BQMA 4LRDA 3DRYA 3VZIA 3PRBA 1VQLS 4PCQA 3UD4P 3GIIA 2MQPA 2JLFA 3D6MB 3GR1A 5DG8A 1RADB 2YNHA 2HNYA 3GP9A 1SJ1A 2GO8A 3SQGB 1R27B 2XNQA 4F3OA 2HHSA 3ISZA 1UMJA 5FIIA 2V2ZA 2HWIA 1OSCA 3ILOA 1U1NA 4ILLA 3HD1A 2VU5A 2HHVA 2OAUA 2I9SA 3BPSP 2XY5A 3ZZ0A 2OFGX 2Z8QA 2FYXA 1UZHA 1TQLA 3KLEB 3B78A 3FDSA 1S9EB 1XR6A 2RDDA 5M2UA 1HARA 4NYOA 3OD2A 2YX1A 4TQSA 2UV8G 5AE3A 1NJYA 4AD6A 4DN9A 1YVFA 3FBEA 3QZ8A 3SV4A 3IBCB 2W01A 5IQQA 5KFLA 1WI6A 3CCLS 3VHQA 2IAJA 3ZZUA 2DT9A 2XM3A 1TV6A 4F4YA 4DV1J 4RW6B 4M5HA 5D78A 3PW5A 2R9LA 4HT5A 3M4XA 4ID5A 2VF3A 2B3TB 1J5EJ 2J0SD 4MIBA 4K0KJ 1CULA 3KJQB 4MYUA 2FJVA 5HMZA 2Y0SD 2GMJA 3HP6A 4RZRA 3EWGA 2KJWA 3M2RA 1M90T 3HHLB 1GMWD 1NJIT 1U1QA 2MHEA 3MECA 1RT7A 2HBYB 5GMDA 3HXMA 5KFRA 1X31C 1CG2A 4CLWA 1KSPA 1Z2ZA 4USKA 2GO9A 2QC3A 5EUHA 3LALA 4ZJOA 3PIOQ 2MZQA 2XS7A 1PJ5A 2HGMA 2CA9A 2ROPA 3ZTRA 4DG1B 2CNLB 2VKRA 5KAKA 3CWJA 2BOPA 1L3TA 3G2XA 3KK3A 2B5JB 5F8LA 4IG3A 3SIPB 3CCZA 1X5TA 1D9AA 5F8HA 1SKUB 2BJ9A 2ZNZA 1RWMB 2G2YA 3C6TA 4ECWA 2IYGA 5CH7B 1KVJA 2NSBA 5KFPA 3EZUA 2F1FA 2H1YA 3HFZB 2KM8C 4P2MA 4FF4A 4UOHA 5IWAJ 2JVRA 3BDEA 2DGTA 4ZS6A 1YI2S 4OZ2A 3N6MA 3RR7A 4HEA9 4GKJJ 1RT5B 2EVZA 2VG7B 2RQ4A 1Q0NA 1R0AB 5CZVA 4RLEA 4ZVQB 3OTOF 5KFXA 3H2VE 4QYZJ 2EK1A 2WBRA 2NQPA 3TJ9A 3IXQA 4R0EA 2RF2A 3NOGA 2AYGA 3DYAB 2XWYA 2AW0A 4ZVEA 4B3SJ 1HI8A 3GLJA 2HHPA 4C4WA 3MM5B 2EFGA 3D1QA 2DNKA 3I0SA 1NSQA 3AD9C 4ZPCA 3NAIA 4ZN1A 4QIEA 5ETMA 2IJRA 1F9FA 1F0XA 3K59A 1M5KC 4LSNB 1XEZA 2HFUA 1KQSR 2CQIA 3QWUA 4DQSA 1N48A 4C8KA 5DLGA 1UKUA 3UPFA 4ZP8A 3BN4A 2AYBA 1DJ0A 1DHMA 4ZCLA 5CYMA 1SL1A 1NPKA 4PXCA 2ZOFA 2W4CA 3AXKA 1T3NA 1JLQA 3QRRA 3PCOB 4OYPA 4PXDA 3MM7B 1UW4A 3QJJA 3K5PA 5LMNF 4USTA 4I6YA 1GQEA 5CD4A 3HULA 4KH1B 2UU9J 1SV5A 2AEMA 1D0EA 4PUOA 2V67A 1TKTA 2KYZA 3B4MA 4CTAB 2RRAA 1A7GE 1KHVA 4Q44A 1ZPWX 5DRKA 3CCVS 4OHXA 3A8IA 2R7WA 1GX5A 1S7HA 2ZH9A 1ZM9A 4EO8A 4IFVB 2OJ3A 4ECRA 5M2PA 2JNJA 3T19A 2YKMA 1A0OB 1HHSA 1B7FA 4QWAA 5D8HB 2GVZA 2DRBA 4LFAJ 1SJRA 2YX7A 1T9YA 3HT3A 3OXLA 2DGSA 3PO4A 2V8VA 1N34J 2HFNA 3OL9A 2CZ4A 1YQHA 1XNQJ 4B08A 2VG5B 1F9HA 5E7OB 3VAIA 3UR0A 2KG1A 1WC3A 4EU0A 1HMVA 3SDEA 1PC4A 3PR5B 5KFWA 3IS9A 1T0TV 2VQEJ 3R1LA 2V69A 3M2VA 2U2FA 3MR5A 4Q8FA 4B17A 4Q0BB 4P2XA 3PX6A 2DH7A 2OKQA 2CQ0A 2C2KB 4DLGA 2XSJB 2UUCF 1AUSL 4FYYB 4NLOA 2KJVA 5HANA 5DQIA 2LQ9A 4X84A 1NO8A 3IN5A 5D4LA 2FJAB 4IOBA
chains in the Genus database with same CATH topology
2GVZA 4CLTA 1FX4A 1TL7B 1WC1A 4USUA 5D0GA 4OYWA 4USWA 1U0HB 2W01A 4WP8A 1CULB 1U0HA 3MAAB 4OYXA 3MR7A 4OYMA 4CLFA 4CM2A 4P2MA 3C14B 1CJTB 4CLPA 1FX2A 5D0EA 3C14A 1AB8A 1CJTA 3ET6B 4OZ2A 2WZ1A 1YBTA 2QV6A 1AZSB 4CLSA 2GVDB 1TL7A 4USVA 5IV3A 4CLYA 2GVDA 1CJVB 3G82B 4OYPA 4CLUA 4OYAA 3UVJB 1CJKB 1WC3A 1CULA 3MAAA 4OYBA 4CLLA 4WPAA 3C16B 3ET6A 4WP3A 1CS4B 1CJUB 4USTA 4CM0A 1CS4A 4CLKA 1AZSA 3C15B 1WC6A 4OYOA 4OYZA 4OYIA 2BW7A 3C15A 1CJVA 2GVZB 3G82A 1YK9A 4CLWA 3R5GA 4P2XA 3UVJA 1CJKA 1Y10A 1WC4A 5D0RA 1WC5A 1Y11A 4OZ3A 5D15A 4P2FA 4CLZA 5IV4A 3C16A 1CJUA 4NI2B 1WC0A 5D0HA 4WP9A 4NI2A 1YBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GVZ A;  4CLT A;  1FX4 A;  1TL7 B;  1WC1 A;  4USU A;  5D0G A;  4OYW A;  4USW A;  1U0H B;  2W01 A;  4WP8 A;  1CUL B;  1U0H A;  3MAA B;  4OYX A;  3MR7 A;  4OYM A;  4CLF A;  4CM2 A;  4P2M A;  3C14 B;  1CJT B;  4CLP A;  1FX2 A;  5D0E A;  3C14 A;  1AB8 A;  1CJT A;  3ET6 B;  4OZ2 A;  2WZ1 A;  1YBT A;  2QV6 A;  1AZS B;  4CLS A;  2GVD B;  1TL7 A;  4USV A;  5IV3 A;  4CLY A;  2GVD A;  1CJV B;  3G82 B;  4OYP A;  4CLU A;  4OYA A;  3UVJ B;  1CJK B;  1WC3 A;  1CUL A;  3MAA A;  4OYB A;  4CLL A;  4WPA A;  3C16 B;  3ET6 A;  4WP3 A;  1CS4 B;  1CJU B;  4UST A;  4CM0 A;  1CS4 A;  4CLK A;  1AZS A;  3C15 B;  1WC6 A;  4OYO A;  4OYZ A;  4OYI A;  2BW7 A;  3C15 A;  1CJV A;  2GVZ B;  3G82 A;  1YK9 A;  4CLW A;  3R5G A;  4P2X A;  3UVJ A;  1CJK A;  1Y10 A;  1WC4 A;  5D0R A;  1WC5 A;  1Y11 A;  4OZ3 A;  5D15 A;  4P2F A;  4CLZ A;  5IV4 A;  3C16 A;  1CJU A;  4NI2 B;  1WC0 A;  5D0H A;  4WP9 A;  4NI2 A;  1YBU A; 
#chains in the Genus database with same CATH topology
 2GA7 A;  2C3P A;  4C0H A;  1QTN B;  3H2L A;  1QSY A;  3K17 A;  4DUZ J;  1HW8 A;  2HHQ A;  2DH9 A;  5LMU J;  3RUB L;  3RAQ A;  1RA6 A;  3E51 A;  2EC2 A;  4NEZ A;  1FHT A;  2VPY B;  2QA4 G;  1R6Y A;  3R27 A;  4GRS A;  1TKX B;  3O1L A;  4LF5 J;  1AZS B;  1XMQ J;  5J2P B;  4C48 A;  4CO2 A;  3CIM A;  4A4J A;  2J6S A;  3I5B A;  1TL3 B;  3UDV A;  3Q22 A;  2NRE A;  2ATL A;  1PCA A;  2WOM A;  4OX9 F;  2HAI A;  4DV0 F;  4KHP F;  3KJV A;  3MAH A;  4LBI A;  2D74 B;  5A8R A;  3R6L B;  5JMN A;  1RT2 B;  1I94 J;  3W66 A;  3A12 A;  1TKD A;  1IKY A;  2EFO A;  3UE2 A;  4GKK J;  4ZPW R;  4K8R A;  4DV2 J;  4DUT A;  1TVR A;  1HWI A;  3DMJ A;  2K06 A;  3H5X A;  4O3P A;  2OFH X;  4MMO A;  4CH0 S;  2E7W A;  1PC5 A;  1B70 B;  4Z2X A;  4A8X A;  2LFV A;  4N56 A;  2BAN B;  1FXR A;  1Q86 T;  4J90 A;  3GG0 A;  3M9O B;  1HWU A;  3W1Y C;  4CLT A;  4S0M A;  5A2Q U;  4PQU B;  4C97 A;  1NB7 A;  1MG7 A;  1IJE B;  1RWN B;  2W1B A;  5KG0 A;  2DO0 A;  2I1R A;  4ZVT B;  1S10 A;  2HHH J;  2LQB A;  1V5I B;  2QFI A;  2ZM6 F;  4AYB D;  3EDR B;  3FGV A;  1HNV B;  3EGV A;  3HHN B;  3ENW A;  5IM0 B;  2L9W A;  4PG7 A;  1P1L A;  1RHR B;  1IBL F;  2Z2Y B;  1FD2 A;  2HMI B;  2W2N P;  1L3S A;  4RBU A;  1WJ9 A;  1IXK A;  2X1A A;  2I5J A;  2OHD A;  3EIC A;  4RX6 A;  3UNG C;  2QFJ A;  3H2U B;  4TY8 A;  3P96 A;  3LGM A;  4NLT A;  4J9O A;  3BF4 A;  2M70 A;  5CCM A;  1UA1 A;  1MU2 B;  4NI2 B;  3TA2 A;  3UQS A;  4J9R A;  2OPQ B;  3CD5 A;  3QSY B;  4NA3 A;  4OL8 A;  1SVD A;  4LF1 A;  3G87 A;  2XLK A;  1GMW A;  4Z7Y A;  2V4Q A;  1M5S A;  4ECV A;  1JLG A;  2I38 A;  1S6P B;  1U25 A;  1HD0 A;  1HWK A;  4B3M J;  3D3C J;  2JHE A;  1T03 A;  2FZC B;  3CC7 S;  1C1C A;  4LRF A;  1Y0H A;  2R3V A;  5L46 A;  2RRB A;  3ILJ A;  4DBQ A;  1RWW B;  1T95 A;  2I8E A;  3UWT A;  4YOE A;  3OJS A;  3A3N B;  1JQG A;  2JEF A;  5KFS A;  3KTQ A;  2HK2 A;  2ZDO A;  1SC6 A;  4ZCI A;  2HHU A;  3LTO A;  1K0T A;  5HL7 Q;  1DTT B;  3CF5 Q;  4L3N A;  4LRE A;  2AJF E;  3NGT A;  1R89 A;  1B3T A;  3VQT A;  4OZN A;  4QYR A;  1LEO A;  2FLP A;  1G4C A;  2LXF A;  5F3T A;  3QT6 A;  1X4C A;  3D6F B;  2FJD B;  3C15 A;  4W90 B;  1RE1 B;  3U1N A;  3R5G A;  2VG6 A;  1T9X A;  4U7C A;  3R5C A;  5K8N A;  2WSC C;  1PJ7 A;  2OEL A;  3BSN A;  5DO2 A;  5IV4 A;  1NK6 A;  1OYD A;  4YB7 A;  1H74 A;  2AT1 B;  2DPI A;  1ZZN A;  3VAK A;  4PXE A;  2MYF A;  3DRR A;  2LU1 A;  3A8J A;  4FZV A;  2G4B A;  1ACM B;  1H7W A;  5KG4 A;  3FBB A;  1NK4 A;  2ZDP A;  5D4N A;  3RJM B;  2D3Z A;  5F9N A;  3I0R B;  3HPO A;  4WIQ A;  3GQC A;  2DIV A;  3C6U A;  3DRP A;  1S99 A;  1EX8 A;  3ET6 B;  3IGN A;  1T94 A;  5DM6 Q;  2HVH A;  2W2Q P;  2P5V A;  4IRD A;  3V6D A;  1KP6 A;  2CJQ A;  4AT1 B;  1PGZ A;  5LJ3 Y;  3L9Z A;  2DR8 A;  3KFW X;  3DNC A;  2FVR A;  1FER A;  1Y9O A;  1FKO A;  3TW0 A;  2C3U A;  3BN7 A;  1RTI B;  1I5O B;  2B9W A;  3WDO A;  3DDK A;  3CCU S;  1S6O A;  6AT1 B;  3DU5 A;  5J1N A;  2CRL A;  3LPE A;  3R97 A;  1LW2 A;  1RAF B;  3JQJ A;  1Y7P A;  2XMU A;  2JSX A;  3J81 Y;  5B0E A;  1RTJ A;  1WC5 A;  4YR2 A;  3KLG A;  1YZ6 A;  2KFZ A;  1NDC A;  2NYH A;  2P9G A;  3Q8P B;  3KUE A;  1YGY A;  3TWZ A;  2L3M A;  4LR8 A;  2QMX A;  1YJ7 A;  4LSZ B;  2ILZ A;  4YR3 A;  1Q95 G;  4K4T A;  2JLG A;  3L4B C;  3CCM S;  2RAQ A;  2UVV A;  2QZ8 A;  3J7A 1;  3A8E A;  3QGH A;  4WU3 A;  4OYM A;  3H5Y A;  1Y5I B;  1CBK A;  3TEG A;  4U9R A;  1XMO J;  4WTY A;  3TZW A;  5HSP A;  1BXN A;  1BE4 A;  3TAR A;  2YNG A;  2DNG A;  3IRX A;  1SPB P;  4XDD A;  1X9W A;  2DIU A;  3OQ2 A;  2NSC A;  2UXC J;  4WPA A;  4O4G B;  1U2F A;  5CYJ A;  4ECZ A;  4YY3 F;  4KIA A;  4ENO A;  1HR0 J;  5DGB A;  2ASL A;  5IT9 Y;  2ADB A;  4OX7 A;  1S6Q B;  3R7S B;  3FMB A;  1Y10 A;  3HD2 A;  2DGX A;  4GVL A;  6FDR A;  4C98 A;  2N82 B;  3BH6 B;  3T41 A;  2YWG A;  3PJW A;  1XBW A;  3IAM 9;  1WKK A;  3DOK B;  4OI3 A;  2XZD B;  4ER8 A;  2C28 A;  4HH0 A;  5GAD U;  3J80 Y;  2GIQ A;  3IO1 A;  2IYI A;  3WZ0 A;  4M5I A;  1X4D A;  2MEW A;  3OXF A;  1DQ8 A;  5J2Q B;  1HNX J;  4QWE A;  4GVB A;  3MUV P;  1SUQ B;  4HAC A;  1FJE B;  1NK9 A;  3M8P A;  2XGP A;  2RQC A;  3AOC A;  4BLG A;  2R7V A;  2FC8 A;  2IBK A;  2R8J A;  2RU3 A;  3HLU A;  1S1V B;  1K8A T;  3W2W B;  1W7W A;  4BHQ A;  1BGX T;  4FN5 A;  3HHE A;  1ZAV A;  3MMJ A;  4EUV A;  4OJG A;  2W4P A;  2QG9 B;  1JLA B;  4NLX A;  1TL4 A;  1VJW A;  1DQA A;  3ZXW A;  1TK5 A;  4P71 A;  4E2F B;  2ASY A;  1F9E B;  4DR5 J;  1ZOT A;  2G9O A;  2YKN A;  3CXC R;  4IO9 Q;  4RW9 B;  3FSI A;  3D1O A;  5GAD I;  1FNM A;  1Y3K A;  4C8L A;  2PA8 D;  1NDL A;  1YBA A;  4CT8 A;  2Z58 B;  1IKX B;  1FRM A;  4I64 A;  4AL6 A;  3OR2 A;  5EHH A;  4X62 J;  3OVS A;  5I4M A;  1QE1 A;  2HQ3 A;  1B0T A;  1NDP A;  4DDF A;  3CCW A;  2QSF A;  4Q2L A;  1KVK A;  3KKF A;  1WHY A;  2V8D A;  3LWM A;  1OPZ A;  1U1P A;  1S9F A;  3MXH P;  2NXU A;  3CNQ P;  4KV8 A;  4NLD A;  4ZLN A;  4G1Q A;  3H0P A;  4DSI A;  2W9C B;  5T14 A;  1HQE A;  2OEJ A;  4JV2 A;  3N0V A;  2QV6 A;  3GV7 B;  4MIW A;  3GR0 A;  4HTJ A;  1EQ0 A;  3ICL A;  3Q2T C;  2CWK A;  3Q8S B;  1GTH A;  2GX8 A;  4JV1 A;  2YKO A;  5GAE U;  1ZYQ A;  1C1B B;  2VPX B;  3BO3 A;  1T3O A;  1T9T A;  2ACM A;  1ZPV A;  1X9S A;  3AD8 C;  1UZD A;  1TL5 A;  4I7F A;  2Z2M A;  2X1B A;  2FD2 A;  2SXL A;  3RRK A;  4LF7 J;  5BR8 F;  2ZD1 B;  1B4S A;  1RWU A;  4HTI A;  5KG3 A;  4QR2 A;  2XMT A;  3KNG A;  2BOA A;  2CQD A;  4R25 A;  1ZM3 A;  4CP5 A;  2B8P A;  2ZH8 A;  4DFJ A;  1FDB A;  4BS2 A;  4MFB A;  1VFJ A;  3JTO A;  1WG5 A;  3ZTP A;  2LEC A;  1HKA A;  2CQ1 A;  3R2C J;  1UVL A;  2XS2 A;  5ETV A;  4PG6 A;  2PFF B;  1GMV A;  1SL0 A;  1BY9 A;  2FHJ D;  3MMC B;  3MM6 B;  2CZ9 A;  2N4D A;  2V8H A;  5GAE I;  2DHS A;  2AGO A;  1BQM B;  1EB0 A;  5J2M A;  4OZ0 A;  3UI3 A;  3SFG A;  2HSE B;  3BGO P;  1FA0 A;  2PEB A;  1QTM A;  3PG9 A;  2YNH B;  3FZB A;  1H3D A;  4J37 A;  3KLF A;  4U6P A;  1D1U A;  5CA5 A;  3RW7 A;  2EKY A;  1BLU A;  4DL5 A;  4RUH A;  1W25 A;  3UD5 A;  3I96 A;  3FJ2 A;  4YQW A;  2KN4 A;  2C2E A;  2OTL S;  3G8T A;  3I82 A;  2PT0 A;  2E5I A;  5D0R A;  3A13 A;  3N6N A;  4G1P A;  3NMA A;  3E2E A;  4PR6 A;  1UVK A;  4QU6 A;  3NMR A;  1DQ9 A;  1A6L A;  4Y2I A;  2DXD A;  2V6A A;  4ZVU B;  3VTI A;  1U1R A;  4DPY A;  3QJP A;  2RQM A;  2C42 A;  3NCQ A;  2QMU B;  2OSR A;  4CLP A;  2UVR A;  1TV6 B;  1BWV A;  2GQQ A;  4O44 B;  5D4P A;  2WZ1 A;  3RR8 A;  3M8W A;  3DLH A;  2EBG A;  3ZTS A;  3PYD A;  3BEG B;  3R7B B;  2Z2Z A;  4UT4 A;  2IRU A;  4N47 A;  3T9Z A;  2CQ4 A;  5AXN A;  3VAG A;  3D0G E;  2OGU A;  3EGN A;  2K3I A;  3M2R B;  2O66 A;  1VQS A;  2UXB F;  3IC1 A;  3MEC B;  1RT7 B;  2LU2 A;  2HQG A;  4W92 B;  5HRO B;  1KWM A;  3NEK A;  3JQK A;  2PMW A;  2MZS A;  4DLE A;  1FEE A;  3CIZ A;  4M5D A;  3PHT A;  3UDC A;  3KK3 B;  4OX8 A;  4IG3 B;  5D0H A;  3T5K A;  2GCF A;  3SSQ A;  1RDR A;  1HNZ J;  1MMN A;  3LP0 A;  3LW5 C;  5DQH A;  1VRU A;  4DR4 J;  4ZP6 A;  1FNX H;  3RBE A;  3BGR B;  1I3O B;  3OTO J;  4CO0 A;  2M9K A;  1SH0 A;  1SB6 A;  2R7T A;  4C0O C;  4DF4 A;  2EFN A;  4DPT A;  1FI4 A;  4DV5 J;  3FEZ A;  3ZTQ A;  4AFF A;  2VC1 A;  5HK4 A;  4X2B A;  3G82 B;  1XWL A;  1X4A A;  4K4Y A;  3C66 A;  2RF2 B;  4OI4 A;  1X4H A;  3JTP A;  5HVG A;  3G9C A;  4WTO B;  1H2V Z;  2DCL A;  1VQN S;  4QR0 A;  2AYM A;  4C11 B;  3DGP A;  2XO7 A;  4QPT A;  4NLQ A;  2BM1 A;  2R4F A;  1UPP A;  3BH7 B;  1Q8K A;  1IBM F;  3MGJ A;  3D9B A;  3UD3 P;  2MQQ A;  3JSM A;  1D3W A;  4RU9 A;  4IQX A;  4DN0 A;  5LJ5 Y;  4P9S A;  2BAB A;  4AQY J;  1RP5 A;  3GV5 B;  2D3U A;  1NHU A;  2WSE C;  2UXD J;  3OL6 A;  2ZH6 A;  4CIO A;  4TKT A;  2ZWO A;  4IOA Q;  2EXU A;  3ISN C;  2ZH1 A;  3D66 A;  4B3T J;  2DHG A;  4O3N A;  2NXN A;  3AB2 B;  3FQK A;  4NXN F;  2DBB A;  1IN0 A;  4QQB A;  4KB7 A;  5CYM B;  2E1R A;  5ETS A;  1N52 B;  3VAH A;  2DB1 A;  4HH1 A;  2AEF A;  4USJ C;  1JLQ B;  2ZH2 A;  4K4S A;  1FE4 A;  4ZDN A;  3UVJ B;  1M1K T;  3IP0 A;  2VDI A;  2C2R A;  4DQR A;  5E3C A;  1M5O C;  1NHV A;  2KRB A;  4NA1 A;  1O51 A;  4WFB Q;  1IVZ A;  4PUO B;  3E8O A;  4HVZ A;  2CJA A;  1TL1 A;  2DH8 A;  3GFX A;  1VGY A;  4NCG A;  4ANE A;  4PG8 A;  4UOF A;  4NLR A;  4CO5 A;  3RAM A;  3PHE A;  5G4D A;  3RBX A;  5JUM A;  2CJ9 A;  4A8K A;  1ELO A;  2VA3 A;  1F2H A;  2YKM B;  4KH0 B;  2BBE A;  4RUC A;  7FD1 A;  3OL8 A;  2IPO B;  2DY9 A;  4DQQ A;  5HVF A;  4ED2 A;  1WEL A;  5KFO A;  1PJ6 A;  1LV5 A;  2OPR A;  2LA4 A;  4N7T A;  3CD0 A;  4X66 J;  4UZB A;  4I2Q A;  1NH7 A;  1YRX A;  4DV1 F;  1FDN A;  1KEK A;  2AKW B;  4BDP A;  2Y1R I;  1J5E F;  1M0S A;  1WHV A;  2F4F A;  3BGF A;  2GHV C;  4F0K A;  3Q0A A;  4K0K F;  1OQ6 A;  4F0H A;  1HMV B;  3SDE B;  2JC0 A;  1FDA A;  1RWP B;  3IS9 B;  5KFK A;  2UUC J;  5CAB A;  4WFN Q;  4DR6 J;  1NSP A;  2J6T A;  4OHZ A;  3DOM A;  1FTC A;  2AQ4 A;  1UJ4 A;  2HFO A;  3JXO A;  2J7W A;  3M32 A;  5L1I A;  1N6Q A;  4UOG A;  3DKD A;  1RTH A;  4KAI A;  2FLN A;  4PEO A;  2HFS A;  4DS5 A;  4DU7 A;  1NZ8 A;  3OFG A;  3K8W A;  1T8E A;  2R7U A;  1NEE A;  1UWA A;  4WK1 A;  4YME A;  1XR7 A;  2IY5 B;  2AGQ A;  5IWA F;  5JVH Q;  2FVQ A;  3UR3 C;  3H5U A;  2ZUA A;  1HNI A;  4GKJ F;  2QO3 A;  3PAC A;  2YKQ A;  2VDH A;  2WVC A;  3RW6 A;  2GVD A;  4DPO A;  3KUH A;  1D8Y A;  3CT9 A;  2ZVI A;  2WOM B;  2Q3P A;  4J9M A;  4KYZ A;  3TUP A;  2FHJ A;  3KJV B;  4TVA B;  2H4W B;  4B3S F;  3SCI E;  3UW1 A;  1KDN A;  3T1A A;  1CJU B;  4NZ6 A;  2ALY B;  4ZJL A;  5HLF A;  5I3P A;  1S72 S;  2QJ3 A;  2VPW B;  4Q5V A;  2UUA J;  3SSS A;  1TVR B;  3ZZR A;  4YB1 P;  4JI8 J;  2KYX A;  2HNZ A;  2ADC A;  1W26 A;  4B3R J;  2R7S A;  4JI2 J;  1QVF R;  3EUN A;  4DSF A;  3TAP A;  3GTY X;  3AB4 B;  2FZK B;  2PO4 A;  2FJW A;  3TOQ A;  4LF2 A;  4MH8 A;  2HRT A;  1SCJ B;  2VQF J;  4NZ7 A;  1KBR A;  2ERR A;  4FF2 A;  3ENV A;  1U0H A;  1JLB A;  2ZBQ A;  1HQU A;  3R2D J;  4ES3 A;  3SCL E;  1CC8 A;  2IHR 1;  2W7A A;  2E5L J;  2QLJ B;  1WDD A;  5T7L A;  3TAQ A;  4NCB A;  4WYL A;  4JI3 J;  1F1B B;  1OSD A;  3Q89 A;  4ZVO B;  2W7P A;  1P6T A;  2D7S A;  3W60 A;  1REV B;  1KOH A;  1KN6 A;  1F5C A;  2UU9 F;  2I5J B;  2A2C A;  4ZA1 A;  4DV3 J;  2BW7 A;  4P52 A;  2DO4 A;  2K3K A;  5HBM A;  2C2D A;  3RZA A;  4QCL A;  3V5R A;  1IM4 A;  4IO1 A;  2KXN B;  2DGQ A;  4KQZ A;  1VC6 A;  4GO7 X;  3W9J A;  4KRW A;  2H54 B;  2DJW A;  4RR5 A;  2N3O A;  1JLG B;  4LFA F;  4H4M B;  2MDA A;  2YBV A;  4KGK A;  4X4T A;  4QYZ K;  4JI6 J;  4DMZ A;  2HUR A;  3GB0 A;  4PWW A;  4HT7 A;  1N34 F;  3HI9 A;  1LW0 A;  4FF3 A;  5E41 A;  1XNQ F;  4N77 A;  3DDN A;  2CNK B;  3QJL A;  4I56 A;  5G0R A;  2X3D A;  2EI5 A;  1UJ6 A;  1VDH A;  3D0I E;  5IV3 A;  2E9T A;  5L1K A;  2XMK A;  3UNY A;  2K2P A;  4ZK7 M;  1S6U A;  4LSL A;  3OFH A;  3PTW A;  4K4X A;  5SUH A;  2QL5 B;  4NX9 A;  5KT2 A;  2NLW A;  3S6E A;  3JQM A;  3C15 B;  3OUY A;  3VCD A;  3LO3 A;  2ZVS A;  2ZBI A;  2VG6 B;  3MCO A;  5F3Z A;  1RYS A;  1WHX A;  3LP2 A;  2FUG 9;  2PC6 A;  3AOD A;  1VRT A;  4XO0 A;  3CUN A;  3DLK B;  4FVM A;  2HQD A;  2RDJ A;  4F7V A;  1K44 A;  3DRR B;  3MD3 A;  3MHY A;  2L41 A;  3U02 A;  4DUZ F;  1CSJ A;  1FRK A;  2BXJ A;  1SJ4 P;  2CPD A;  3KK1 A;  4CCH A;  3GPA A;  5LMU F;  1LWX A;  4ANC A;  3SEO A;  1S79 A;  2E5J A;  1CLF A;  3H7H B;  3C6U B;  3DRP B;  3MR7 A;  4NLY A;  1BD6 A;  4LF5 F;  3JAM U;  2KT5 A;  3L7U A;  3OTE A;  3V6D B;  2H5J B;  1SC1 B;  3Q8V A;  3DLG B;  1XMQ F;  3GU0 A;  2GJI A;  5C24 B;  3MPW A;  1FKO B;  3KDN A;  4P75 A;  2Y1I A;  3VVU A;  2VBX A;  4YEA A;  2O01 C;  3CVK A;  3H8Y A;  3TVY A;  3K8V A;  3OTB A;  4ETX A;  2MHN A;  4CLL A;  2XMW A;  1MRO A;  3WHI A;  2XQC A;  4XPC A;  1I94 F;  2QA1 A;  4GKK F;  2IMO A;  1SC4 B;  4U95 A;  1U6Z A;  2DYA A;  1CJK A;  1F5B A;  4LR7 A;  2F8E X;  2QEX S;  1JLC A;  3R9L A;  3G71 S;  5KG1 A;  1XMB A;  2HHX A;  4J9S A;  1UVN A;  5A8W B;  2QMW A;  2HWH A;  2HQI A;  5F8J A;  1K1S A;  3N6L A;  3BO4 A;  2PEH A;  4WP8 A;  2VZ9 A;  4RNH A;  5JXS A;  7FDR A;  3QZ7 A;  5I3U A;  1HBU B;  2P9C A;  3CJK A;  1KTV A;  3O6Q A;  4RBV A;  4RW7 A;  5D0E A;  1U09 A;  2Y1L B;  3GFZ A;  5AJ3 J;  1ZTT A;  4RW8 A;  4M95 A;  2YNG B;  3D6H B;  1WHW A;  1HPZ A;  5B0D A;  1REG X;  2ZH7 A;  4ZMM A;  3C16 B;  1UVI A;  4WZM A;  4A8F A;  4DX7 A;  3GCX P;  3FFI B;  3FRZ A;  3FBF A;  4D3H A;  2E7X A;  3KMS A;  3BSO A;  3DDI A;  2F40 A;  1SJ3 P;  4M5M A;  1S76 D;  4WJB A;  1C4A A;  4WWS A;  1NPR A;  2EFQ A;  3AT1 B;  4U7U D;  3U27 A;  2E44 A;  4B3M F;  3HF5 A;  2DRA A;  2K1R A;  2FTR A;  1I6J A;  3MM9 B;  4DL4 A;  4HAC B;  2CG4 A;  5EWG A;  4IH5 A;  4N76 A;  2B0G A;  3QT7 A;  5KFT A;  2BJ1 A;  2OMO A;  3CED A;  5HO4 A;  1RA7 A;  1IWG A;  4L76 A;  1ITP A;  4YN3 B;  2H65 B;  1X7V A;  2DEI A;  2RDI A;  2NUU G;  3QLH B;  2IC3 B;  2BJD A;  4JI4 F;  3R3T A;  3U1L A;  4PPD A;  2YKP A;  4F67 A;  4OIX A;  2YKN B;  4V19 X;  2J7U A;  2G2O A;  2XMJ A;  2XI3 A;  4H4O A;  4OZL A;  1T05 B;  2AWZ A;  3OR2 B;  4OZ3 A;  4GC7 A;  4I68 A;  2UUB J;  1DAX A;  2HPU A;  4WXO A;  2UVU A;  5GAG U;  2MXY A;  3R1H A;  1RWV B;  3TUI C;  4HL9 A;  5J1E A;  2X7I A;  4IQM A;  3MPY A;  3OVA A;  3DLJ A;  2AHO B;  3UCG A;  3LP1 A;  3K5O A;  2AJ0 A;  2JFK A;  1LWE A;  4Y2A A;  2J9D A;  5D3G B;  3KUG A;  4Y28 C;  2YPZ A;  3MD1 A;  2OP5 A;  1PBU A;  5FDL A;  3QFW A;  3F41 A;  2BZ2 A;  2E29 A;  5RUB A;  4PWU A;  2ABY A;  3PNI A;  5F8I A;  2FJX A;  2BA9 A;  5HQM A;  2J8S A;  3AFG A;  1PSD A;  5C25 A;  2C3O A;  3AH6 A;  3UCU P;  3LH2 S;  1X8D A;  4I7F B;  1W2I A;  3JYT A;  1KVI A;  4ICL A;  2DVI A;  5GAG I;  3W61 A;  4LQ9 A;  1GXU A;  1GMU A;  2HBQ B;  1N5T A;  2CQ2 A;  2V9W A;  2B4V A;  3OFE A;  5A8K B;  4X4P A;  1XIQ A;  2E5G A;  3MCS A;  4CO4 A;  3M2U B;  3D1H A;  4LJM A;  1QVG R;  2BW2 A;  4MYT A;  4UUW A;  2LEB A;  2ALZ A;  2KKH A;  4YFU A;  3DI6 B;  3ZZO A;  5D4O A;  5JVG Q;  2OIH A;  2GNK A;  5L39 A;  2PI4 A;  1DLO A;  1XMO F;  2AEJ A;  3JB9 k;  4EBE A;  1WTB A;  2VOO A;  1UA0 A;  2OD6 A;  2AF6 A;  4H4K C;  4G6V B;  3CJT A;  3HZE A;  3V4I A;  2IRY A;  2UXC F;  4LR9 A;  3KLV A;  4WP3 A;  2VON A;  3UO0 A;  2ZIT A;  3UDL A;  1FES A;  5L8R C;  2IA6 A;  2G0I A;  2O5D A;  3P45 B;  3HKW A;  3W2V A;  3BO2 A;  1NK0 A;  3CJ4 A;  1KKH A;  3M1V A;  3G6Y A;  2RHS B;  2WK4 A;  1RKJ A;  2HBZ B;  1AYE A;  8RUC A;  2EC0 A;  4LF6 J;  1YIJ S;  1XNR F;  1HBO A;  5HMY A;  2KO1 A;  4RKU C;  4RWW A;  3I5C A;  3M05 A;  1ICE B;  4ECY A;  3LF0 A;  3NNH A;  3KK2 B;  3DXS X;  1HNX F;  2KI2 A;  5IZH A;  3TRG A;  2MLX A;  1VQY A;  2HW3 A;  3T5H A;  2AYE A;  1OO0 B;  5A2Q Y;  5DG7 A;  3IA0 A;  2J5A A;  4DXL A;  3I87 A;  4WFA Q;  3CO0 P;  2VUG A;  3OTD A;  2WB4 A;  3D3B J;  4B9M A;  3HZG A;  5DET A;  5IS2 A;  3MED A;  3EDQ B;  2Q1L A;  1RGV A;  3M30 A;  5CYQ A;  3T6B A;  2PN6 A;  1TUV A;  3T5J A;  1QLN A;  2HHT A;  2B7C B;  2B4O A;  4FPI A;  4DR5 F;  3W7B A;  3VGV A;  3EXC X;  2WW8 A;  2CPI A;  2XLI A;  2HYI B;  5D77 A;  7AT1 B;  4X62 F;  1T9W A;  2CNN B;  4DHV A;  1PKU A;  1R0C B;  3GWC A;  3SQG A;  3HHK A;  5EX3 A;  4OQJ A;  3WBZ A;  1WG4 A;  3LP0 B;  1VRU B;  2V0N A;  1DAR A;  1X4F A;  2R2S A;  2YXL A;  2HVE A;  3CW2 C;  4LF4 J;  2H51 B;  2JLE A;  1HBM B;  2Z30 B;  1S77 D;  1SIZ A;  1Q5V A;  1WF2 A;  3NCP A;  3QAE A;  5CQG A;  3I4P A;  2XMM A;  2IJN A;  2J8A A;  1RWX B;  1S9E A;  2HIQ A;  1R8A A;  1MMD A;  2MKC A;  1UVM A;  4N5S A;  2CJK A;  1VCT A;  3GIR A;  4I4B A;  4BC7 A;  1S0O A;  1P9Y A;  1H7X A;  1KS2 A;  4Q43 A;  2NUH A;  2VFS A;  4MK8 A;  3VAF A;  2J9E A;  1B99 A;  4UTG A;  4RW6 A;  3FVY A;  2EG1 A;  3DGP B;  1T11 A;  1ZTW A;  4E98 A;  3CMA S;  1S1X A;  2ZBC A;  3GZ7 A;  2W9B B;  4LF7 F;  5KG7 A;  4G3I A;  3JSM B;  5D6G A;  3DOL B;  1FTR A;  1FFS B;  2D41 A;  2F65 A;  3P49 B;  2MKS A;  2Y1J A;  3NS6 A;  3W65 A;  1E6V B;  4FYD A;  2FC9 A;  2DK2 A;  2W8K A;  4DFM A;  3RAX A;  3QPI A;  4L6V 3;  2Y8W A;  2A0F B;  2DY1 A;  4FKX A;  2OML A;  5KT4 A;  3NWG A;  3J81 j;  4ZPA A;  1TU0 B;  1RUS A;  3N5B A;  5HMX A;  3F0N A;  2VJU A;  3IG1 A;  2ATC B;  3OHB A;  3BPD A;  3C3L A;  2ZUG A;  4OYA A;  4JB8 B;  4N8O A;  3CB4 A;  5J2N B;  4EMD A;  2HVZ A;  2OPS A;  2BMB A;  2W4D A;  3A1Y G;  2KVI A;  3D0H E;  1DUR A;  1RT5 A;  4V1A k;  2VG7 A;  2BM0 A;  2MST A;  3D7S B;  1R0A A;  2VOP A;  5J1P A;  1NKB A;  4JI7 J;  4PPZ A;  2CYY A;  2IBO A;  1YIT S;  1TL1 B;  4FS2 A;  3MUM P;  1S48 A;  4NCG B;  3OBI A;  2CJB A;  4UUX A;  5D15 A;  3P6Y C;  2HRU A;  4NYP A;  2Y0B B;  1GEH A;  2XI2 A;  3OL7 A;  3MM8 B;  2VBY A;  3VGU A;  4LVN P;  3JSR A;  3O5T B;  1UET A;  4CRJ A;  2LEA A;  3HCX A;  1WG1 A;  5LSR A;  4NCA A;  1I51 B;  4AND A;  2GJ2 A;  3IWX A;  3JS9 A;  2OPR B;  1RT6 A;  2XEX A;  3J7Z 5;  1RLC L;  4EYI B;  4I2Q B;  4NOH A;  1LXN A;  4C3M A;  2IJF A;  2KVQ E;  2Y8Y A;  3EYZ A;  3EMT A;  2G2Z A;  2VBW A;  5KTQ A;  4LSN A;  4O0N A;  4FVC A;  1Q7L B;  2WCX A;  1S1U A;  4P7V A;  5KOX A;  4OYB A;  1J27 A;  1NND A;  5HN0 A;  3GON A;  3MTJ A;  1RJJ A;  1LQ9 A;  2W8L A;  2GQ2 A;  3D67 A;  5KFD A;  4LIR A;  1WD6 A;  2V5H G;  4C8N A;  2K8G A;  1YK9 A;  2LP4 A;  2AJ1 A;  4DR3 J;  1SH3 A;  5FD1 A;  3T9N A;  2KHD A;  5CD4 H;  3WX4 A;  1RTH B;  1R8H A;  3KXD A;  3AJ1 A;  1HNZ F;  5ETN A;  1RLD A;  2YWW A;  3CJ8 A;  5K9F A;  2HQF A;  4DR4 F;  3MOJ B;  3KOA A;  1KD1 T;  4CNZ A;  1Q79 A;  1XC9 A;  2AX1 A;  2UUT A;  3DLL Q;  1R0B G;  2XCA A;  3TVK A;  1U8S A;  3AQO A;  2W9A A;  1HNI B;  2ZJR Q;  4IFV A;  1ZET A;  4F4K A;  2GGP B;  1CJT A;  3S01 A;  4Q2M A;  2OI2 A;  4DV5 F;  5LM7 E;  2QRR A;  2Z57 B;  3QID A;  2FGO A;  2GVD B;  4LT6 A;  1LFW A;  3W5Z A;  2CNO B;  2YNI B;  3HMJ G;  1TAQ A;  1PG5 B;  2C2N A;  1LNQ A;  1L3U A;  4KO0 A;  1QAX A;  1RHU B;  2ZH3 A;  1SXL A;  2KDO A;  2VFT A;  1NU4 A;  1RAA B;  3MI7 X;  1HLW A;  2H5I B;  2XYG B;  4ELT A;  1N56 A;  1NZA A;  3IBW A;  4FKY A;  5AXM A;  2RVJ A;  5K20 B;  5DDO C;  5C2G A;  2X1G A;  2RQK A;  1NK7 A;  4X4Q A;  4CLZ A;  2WON B;  2QGF B;  4NA2 A;  1BQX A;  3M6U A;  2HND A;  3ZZP A;  5F8N A;  4AQY F;  2GQC A;  2QLB B;  4F50 A;  2HAF A;  1RTZ A;  2UXD F;  5KFG A;  4ZPB A;  1N32 J;  2QA4 S;  4A8Y A;  4M63 A;  2VFV A;  4JI0 J;  2RIJ A;  3JSB A;  4NE9 C;  2XSJ A;  4JUZ A;  1LKZ A;  4B3T F;  3RB4 A;  3PKM A;  4KY3 A;  1U0H B;  1JLB B;  4N41 A;  1HQU B;  1SBR A;  4QOT A;  3ENA A;  1EP4 B;  1X4G A;  4JYA J;  2FHO B;  1S0M A;  1A9N B;  2CVI A;  1UP1 A;  1CJV B;  4MAK A;  2AV5 A;  4JV0 A;  4CLU A;  3HKZ D;  4NZ0 A;  1LFP A;  1B64 A;  4CO3 A;  4FF1 A;  3K5L A;  1P8G A;  4PYD A;  4I0W A;  4K50 A;  2YX4 A;  1RI7 A;  1VR6 A;  2AD9 A;  3C19 A;  2IDE A;  1AZS A;  3V6J A;  2EKN A;  5HBM B;  4U8Y A;  1QY7 A;  2CAD A;  4G1I A;  1ULR A;  1TL3 A;  3PY8 A;  2YQ3 A;  3DRS B;  3Q86 A;  1D9F A;  3K2Y A;  3IR6 B;  1RT2 A;  4ZVH A;  2DNP A;  3OTC A;  2XZW A;  1T7P A;  2YNF B;  4X4N A;  3PXG a;  1TL7 B;  5K14 A;  4URG A;  4PYA A;  2KB2 A;  2MY7 A;  2QIF A;  3EVO A;  3HX9 A;  4YP3 A;  1LW0 B;  4X66 F;  4LRB A;  2I0X A;  2KT3 A;  2C3Y A;  5G0R B;  4ZOS A;  1WOP A;  2BAN A;  4IRC A;  1JWW A;  3U7J A;  1YBT A;  4HHJ A;  3A4T A;  5GMK a;  2F4V J;  1APS A;  2MQN A;  4U7U K;  3OT9 A;  2DR9 A;  1EKR A;  2HFV A;  4ERD A;  4Q8E A;  4USI A;  4F25 A;  2J6U A;  3TZX A;  4LSL B;  2OTJ S;  1N33 F;  2C22 A;  2B56 A;  4DR6 F;  1JNZ B;  2FVC A;  3OUY B;  2RML A;  4DPU A;  1HNV A;  1KFD A;  1NUE A;  2HVD A;  4EO6 A;  4NLS A;  2HGN A;  3TP2 A;  2B6A A;  4B3O A;  1VRT B;  1MN7 A;  4OI6 A;  2OH2 A;  1Q8B A;  4F04 B;  3OW2 R;  3KLI A;  3GFH A;  2HMI A;  4PXB A;  1JJH A;  5ETK A;  2LQJ A;  4JOU A;  1NAQ A;  1NXI A;  1RAE B;  4MK9 A;  5KG6 A;  3KK1 B;  3O2I A;  4A8M P;  2F8M A;  4ILM A;  1NB2 A;  2OSQ A;  1VBK A;  1VLY A;  3W64 A;  4J7C A;  3NGD A;  4FS1 A;  4ES2 A;  9ATC B;  4B9V A;  1C0T A;  5KFC A;  2OPQ A;  4LFC J;  1AB8 A;  2PII A;  4F4Z A;  5LXR A;  4ZVS B;  1RIS A;  1TMJ A;  2WVF A;  4TLR A;  3EGZ A;  1HWJ A;  4UZC A;  1PIE A;  1NCL A;  1SQF A;  5LSL A;  2PA3 A;  4OX6 A;  1MRO B;  2NCK L;  2AJ4 A;  1L5U A;  3N28 A;  1JK9 B;  4QIG A;  2NR0 A;  3HVT B;  4ED0 A;  4ZPD A;  4YB5 A;  2UUA F;  1KLN A;  4OYO A;  2IMW P;  1TK8 A;  4JI8 F;  2JJ4 D;  5DZ6 A;  1RAG B;  1H73 A;  4F0M A;  4O3S A;  2P6S A;  4DEZ A;  5AE1 A;  4W4M A;  2V2K A;  2CDR B;  4B3R F;  5CAA A;  4JI2 F;  1LWF A;  4WFZ A;  3WIV A;  3CE8 A;  4WII A;  1UVJ A;  5ETP A;  4DS4 A;  1M1H A;  2CQC A;  3OLA A;  2XZT B;  2GHP A;  5F41 A;  4TYA A;  1GK8 A;  1C2P A;  1VBY A;  3M8Q B;  3SMZ A;  1RTD B;  2CAJ A;  1ZA2 B;  3L3C A;  2VQF F;  4DI6 A;  4R8U B;  2QA2 A;  4ECS A;  3MAA B;  3H98 A;  3L7P A;  3CJK B;  4RW7 B;  2E5L F;  2PFD A;  1OYE A;  1FFG B;  2ZKU A;  4CLS A;  2F3J A;  4JI3 F;  4P74 A;  3HO1 A;  2B8Q A;  4A8O A;  1JLE B;  2QLW A;  2DNO A;  3NXZ A;  2ASJ A;  2Q79 A;  4BWJ A;  2BDP A;  1EAR A;  2QLX A;  4UQG A;  3ET6 A;  4V19 J;  1YX2 A;  1FK9 B;  1OJ4 A;  1X60 A;  2YWH A;  4CM0 A;  4DV3 F;  2W7O A;  2KT2 A;  2IVM A;  1ZAX A;  3BZQ A;  2R7O A;  2JDJ A;  2RSQ A;  1WC4 A;  4LF9 J;  4QIF A;  1X4B A;  4I1T A;  1HW9 A;  4P72 A;  2LXU A;  1NRK A;  5E3R A;  1WC0 A;  3MMA A;  4CH1 A;  1X5O A;  1NJW A;  3MMB B;  4DUY J;  4JI6 F;  2POK A;  2C3M A;  2LA6 A;  1PYO B;  2K1R B;  2CFX A;  1U2C A;  2ZOM A;  1Z1Z A;  5L1L A;  2YH0 A;  1UTA A;  3L7O A;  1R7I A;  2KXF A;  2R8K A;  2W2O P;  4DSJ A;  2CG8 A;  4JI4 J;  2ZHA A;  3N4W A;  2ZNY A;  3ISN D;  5KFI A;  2FLL A;  4FYV B;  1MWZ A;  1H38 A;  1TUG B;  3WC0 A;  1VQ9 S;  1MNE A;  5F0U A;  4WXW A;  4AL5 A;  1NK5 A;  4X4S A;  2HK3 A;  1QSS A;  1OIA A;  4DFK A;  5IQ6 A;  3X1L B;  2KHC A;  1UWB A;  4R5P A;  2WHO A;  2VJV A;  3TZZ A;  3NBP A;  2W2P P;  3LPY A;  2RKI B;  3IFE A;  2V94 A;  3GJT B;  1TZ0 A;  3CD6 S;  2DR7 A;  4O4G A;  4Y34 A;  1FRL A;  4DX6 A;  2VIH A;  3BBC A;  4JV5 J;  3BYP A;  4QW8 A;  4BC9 A;  4WCE Q;  2U1A A;  1S0V A;  3B8H A;  1IKW A;  2E1C A;  5J1E B;  3PW7 A;  1S6Q A;  2G1D A;  4NYZ A;  4DV6 F;  5KFH A;  2RIL A;  5H9E J;  3LP1 B;  4X4V A;  4J9P A;  3J7Y I;  2C2Z B;  2HS4 A;  2K7K A;  4KPC A;  1WEX A;  3OXG A;  5FDL B;  3R8Y A;  3G4S S;  2M88 A;  1MW7 A;  1SKW A;  2FLO A;  2LVW A;  3BKT A;  2N7C A;  3GMG A;  4USV A;  2GJF A;  4A8W A;  1U8W A;  4B9L A;  4J9V A;  1U6F A;  3PZP A;  2FHM A;  3MCM A;  3PW0 A;  2IM3 A;  5A76 A;  3PX0 A;  1GXT A;  3DRX A;  4DL2 A;  2NZC A;  3MEE A;  5KFM A;  2QYG A;  2MGZ B;  3DN9 A;  2KU7 A;  3FSY A;  4ICL B;  1ZM4 A;  3AOA A;  3E01 B;  2MB0 B;  2UZA A;  1S1V A;  5DG9 A;  4X64 J;  4DSK A;  3KG4 A;  2H4Y B;  5CHC B;  4ZP7 A;  1WNE A;  1JLF A;  2CZV C;  1DY3 A;  3G8S A;  2QN6 B;  4Z7C A;  2XYH B;  4ZIW A;  1X0P A;  4O3R A;  3THV A;  1TAU A;  5A0Y B;  3GYG A;  3KLH A;  1ZBT A;  4Y0F A;  2W24 A;  3TUZ C;  4IKA A;  4MKY A;  5THW A;  1RAC B;  1NSA A;  2RU9 A;  5AJ3 F;  1BC6 A;  3T1H J;  1N5Y A;  3AA8 A;  1KLM B;  4PAB A;  3V4I B;  2GZO A;  3T1Y J;  3W9I A;  2W9C A;  2J76 E;  1HQ2 A;  3MCN A;  4I2P A;  2ZC4 A;  4KSE B;  4WU2 A;  2UV8 A;  3ZZZ A;  4K4W A;  1AT1 B;  4PRF A;  5HP1 A;  2VBZ A;  1N54 B;  4DJB A;  1S0N A;  1XNR J;  2XTJ P;  4TXS A;  3GSI A;  4WF9 Q;  3W2V B;  3NLC A;  3MR6 A;  2Q6B A;  2MTL A;  2M4M A;  4I67 A;  1HBO B;  1M5P C;  3P4U B;  1R43 A;  4N8N A;  2XC9 A;  4CI0 B;  1ZH5 A;  1G6B A;  1XR5 A;  3S8S A;  1HIY A;  2DD8 S;  3I32 A;  4LRA A;  3M8Y A;  4P2S A;  3IM9 A;  2AZ3 A;  3ETO A;  1TP7 A;  1X5P A;  2VL1 A;  3ZC4 A;  2F9D A;  2VOD A;  2KH9 A;  2HZC A;  3TAM B;  4NXM J;  4HDG A;  4M8L A;  4EI2 A;  2RH3 A;  2DNL A;  3C14 A;  3ELH A;  2A1B A;  2XO6 A;  1K47 A;  1YJW S;  4B9S A;  4NML A;  3NS7 B;  4DR1 J;  4TYB A;  2L9D A;  3EGW B;  4KE5 A;  1VHF A;  1X4E A;  2HZA A;  1UFW A;  1FO1 A;  3KNA A;  3M30 B;  4TLQ A;  2E9R X;  3D68 A;  4EYH B;  3OVB A;  1EIY B;  1CS4 A;  4FBU A;  3AA9 A;  2VB6 A;  4CNY A;  2HZV A;  4Q7A A;  2YQ1 A;  3KG1 A;  1FT8 A;  3PKY A;  1VQO S;  4YR0 A;  1V3R A;  3W5Y A;  2H9Z A;  1XN9 A;  3B54 A;  4RUB A;  2UUB F;  4C2M A;  4IDK A;  2D3O R;  1FE0 A;  4M5N A;  1TUW A;  4IG0 B;  3H25 A;  1E6Y B;  5B0G A;  4F26 A;  3ITH B;  2QX0 A;  4NLU A;  3AY0 A;  3PW4 A;  5DGA A;  4DZD A;  5ETO A;  1TFY A;  5LXY A;  2HRY A;  5MAO A;  1YRU A;  4F2S A;  2XNR A;  3K58 A;  1FJG J;  4JP8 A;  4PZV A;  2MSS A;  1BQN B;  3K5M A;  3PYF A;  4XIU A;  2XY6 A;  1IR0 A;  3O3L A;  1HYS A;  1Q8L A;  4OI0 A;  3NY0 A;  3PEJ A;  5E3Q A;  3KJF B;  5HJX A;  4L73 A;  2O1P A;  2HHW A;  2X3G A;  2M0G B;  1HI0 P;  1S1T A;  2AJ2 A;  5KT6 A;  4ZIV A;  4O44 A;  4YS2 A;  3IR7 B;  3PX4 A;  1G3O A;  1S1X B;  1FXD A;  1VIX A;  2KM8 B;  4KGZ B;  3CME S;  2Q43 A;  2RRN A;  1LK5 A;  4NLV A;  1M5V C;  1WI8 A;  3LUY A;  3ZO7 A;  3CMQ A;  3H20 A;  1F3F A;  3HK2 A;  3BBF A;  3CJ2 A;  1F60 B;  4KKO B;  5BYQ A;  1WF1 A;  3L09 A;  3NOC A;  2FJE B;  3W62 A;  4PG5 A;  1D9D A;  5HRO A;  5E3A A;  1N5V A;  1BHN A;  3C46 A;  3IM8 A;  1U0S A;  4ZVG A;  1U26 A;  4X65 J;  3BKU A;  3LQV A;  3TJA A;  4EBD A;  1U1K A;  2HLU A;  2BRK A;  3VWS A;  5JJB A;  1RCX B;  2HNY B;  5M2R A;  3IG1 B;  3UDE A;  4LFB J;  1N0U A;  1S59 A;  3HFV A;  1S4F A;  4OHW A;  4ETZ A;  4R0J A;  3JAM Y;  1QUP A;  2OPS B;  3BGR A;  3MTK A;  5C2C A;  3G6X A;  4M94 A;  2DXE A;  3DGV A;  4RWX A;  3N01 A;  3RU0 A;  1FRI A;  3BR8 A;  2HQC A;  3TI0 A;  3GJQ B;  2MKK A;  4B9T A;  3G82 A;  2COL A;  4C0B A;  4RNF A;  5B09 A;  2P8I A;  3FC9 A;  5FLX U;  4LF6 F;  1SIW B;  1R31 A;  2VFU A;  1VJQ A;  2IAJ B;  4HDH A;  4DCO B;  2DNQ A;  2GIR A;  2G1H A;  4ID5 B;  4C11 A;  4ZVR B;  2K7J A;  2IIH A;  4DCP B;  2FVS A;  1RT6 B;  1NME B;  4BCA A;  1NSK L;  4IYQ A;  4BBY A;  1F2G A;  3FNN A;  4C8Z A;  1CUL B;  4DL0 C;  1RHM B;  1RWK B;  4F3Q A;  1FKP A;  5HQL A;  2PE8 A;  5DDR C;  4ZJQ A;  1O0P A;  2MLY A;  1WF0 A;  1VMB A;  4LBP A;  1OMS A;  3OR1 A;  2DEJ A;  4KHM A;  2MZT A;  1RU2 A;  1URN A;  1S1U B;  3DFE A;  5IXU A;  2MZR A;  4KBI A;  1EAY C;  1V9O A;  3J7A N;  3TX0 A;  2H48 B;  2QL9 B;  1YJR A;  2CIM A;  1SQE A;  3BV8 A;  4DSE A;  2PDA A;  4YHH F;  2FY1 A;  1PAE X;  4OZJ A;  3UVJ A;  2M7S A;  3IR5 B;  3C6T B;  1KFS A;  2G13 A;  5K8O A;  3T5L A;  2XY7 A;  1BMQ B;  3V6K A;  5H9F K;  1WKJ A;  1FCA A;  1IM6 A;  1GTE A;  2FVP A;  3OFF A;  4LF4 F;  3HDS A;  2KRR A;  2RB7 A;  1C0U A;  4IRK A;  1H72 C;  4IH7 A;  2MKJ A;  4F36 A;  4WKR A;  1UEK A;  1L3K A;  3SQO P;  3ILI A;  1EQM A;  3KJN B;  1KOO A;  3POT A;  2B7B B;  2RUS A;  3QT5 A;  4JI1 J;  1CJT B;  4DX5 A;  5F8M A;  3GE9 A;  4XTT A;  1GAO A;  1PIL A;  3OSP A;  4Y2M A;  5IFM A;  3HJV A;  2BKP A;  2CWX A;  5B0F A;  3AQP A;  2DRD A;  2ZJP Q;  2EK6 A;  4ZVF A;  3I0S B;  4KO0 B;  1XQI A;  2B9E A;  1SH2 A;  2C1E B;  2D69 A;  2EWH A;  3WIU A;  5MLC V;  4Z37 A;  2CQH A;  4EZ6 A;  4CO1 A;  1SC3 B;  2PSZ A;  3Q8Q B;  4YDX A;  1NKC A;  4U67 Q;  3SYZ A;  1CVJ A;  3ZZY A;  4ZHR A;  4ZLJ A;  2IRX A;  2VH7 A;  4RNN A;  4NPO A;  2HND B;  2G0C A;  3TR5 A;  4D3G A;  1HI1 A;  1DBD A;  2HG4 A;  3OLB A;  3Q24 A;  3Q23 A;  2RT3 A;  1HNW J;  2KXH A;  4DR2 J;  2KZZ A;  1U24 A;  2PMH A;  1JXL A;  2BYC A;  1RSC A;  3T3F A;  5F0W A;  3DU6 A;  1SV5 B;  3CD7 A;  1TKT B;  4FPR A;  2B43 A;  3MUT P;  1JJC B;  3BM7 A;  2JEJ A;  3K7R A;  4XAK A;  3HM9 A;  4I69 A;  3QT8 A;  4L72 B;  1S5Z A;  4JI7 F;  4KFB A;  1S1W A;  2PI5 A;  4OJ3 A;  2GVZ B;  3X3U A;  8AT1 B;  1UPM B;  1DRZ A;  1GXL A;  3R5A A;  2JRS A;  2HLT A;  3DLE A;  3SFU A;  1CJU A;  3AJ2 A;  4RPF A;  4CWB A;  4PG4 A;  2ZEJ A;  4DV7 J;  2DHH A;  2H5E A;  1NHK L;  5K14 B;  1AXQ A;  2GV1 A;  1PO6 A;  3FQL A;  4O3Q A;  2JWN A;  5DZ7 A;  2MQM A;  2CXE A;  1R8C A;  3CO9 A;  1X9M A;  4K7Q A;  3VAL A;  1N33 J;  4ZP9 A;  4DU8 A;  3MEG A;  1TKZ A;  2NS1 B;  3JSY A;  5T41 A;  1NH8 A;  4NL5 A;  3M2V B;  1JJ4 A;  3W9H A;  2JOQ A;  3I9Z A;  3FZ2 A;  2D1C A;  3DM2 A;  5GME A;  3EZO A;  2O67 A;  3BS9 A;  1YHQ S;  2R8I A;  5B08 A;  4NLW A;  4KC5 A;  1IR2 A;  1YJV A;  3EJM A;  4U8V A;  4LF8 J;  1S97 A;  3PJX A;  1RBO B;  2OLW A;  4OYI A;  4LUB A;  4RNM A;  4DR3 F;  2B6A B;  4ED7 A;  4B3O B;  4EEY A;  2B9Y A;  1XTZ A;  2HS3 A;  1O6X A;  3CDU A;  3K57 A;  2XHW A;  4TU9 A;  2BE2 A;  1KON A;  1QD1 A;  3EM1 A;  4DPW A;  3KLI B;  1U49 A;  4WFX A;  2CPH A;  1REV A;  1VQP S;  4L75 A;  3DHW C;  5EX0 A;  3V81 A;  1RCO B;  2IM1 A;  2BR0 A;  1WTF A;  2D9O A;  3B4D A;  2V4J A;  1EZZ B;  2BV3 A;  2ZHB A;  4QBU A;  4FYW B;  1C0T B;  3Q2S C;  4HR2 A;  2E9Z A;  3ZNU A;  5A8R B;  1VBZ A;  3PM9 A;  2R2U A;  4H4M A;  4RO0 A;  1IKY B;  2CPZ A;  2GS8 A;  2PD1 A;  5B0B A;  4FNH A;  2GMH A;  1IBK F;  4OLP A;  3PV8 A;  4C8M A;  3DHX A;  3BGU A;  3DMJ B;  2B51 A;  3AJD A;  1N5S A;  2E1M C;  3VGT A;  3PIP Q;  3IMQ J;  1RXO B;  1J5O A;  3SCK E;  2MY8 A;  1EHW A;  4ECT A;  5DS7 A;  1LWF B;  4J9K A;  2GC8 A;  1M5H A;  4RJV A;  2WBM A;  4FDF A;  1U1M A;  1O8B A;  1U1L A;  1YBU A;  3DC2 A;  4ED5 A;  1YZ7 A;  1N32 F;  2E1A A;  1JKH A;  4HHH A;  1NDK A;  4JI0 F;  4O3O A;  1OY6 A;  3FSX A;  2BJE A;  4IR1 A;  3DLK A;  1UFL A;  1H2U X;  4KGX B;  4J9N A;  2LEP A;  4DR7 J;  4JYA F;  1FX2 A;  2BKN A;  2FJB B;  2DHX A;  4KGM A;  3BSA A;  2M3D A;  4ATN A;  1IKV A;  4TY8 B;  4K5R A;  4U96 A;  2HVI A;  4WK3 A;  2IFX A;  1OPI A;  4W98 A;  3J7Z T;  5KFB A;  1Q81 T;  3IWL A;  1EET A;  1R6V A;  3DLG A;  3ZFV A;  3NRB A;  5BYR A;  4K59 A;  5C24 A;  2YVS A;  3PFE A;  1V6H A;  2LYV A;  2BE7 D;  2FB0 A;  4EFA C;  1T03 B;  1C1C B;  3MMA B;  1MML A;  3UN3 A;  4P10 A;  4ECQ A;  3K0J A;  1RHJ B;  3HFK A;  3NP5 A;  2GAG C;  1IQZ A;  3CDW A;  1WDT A;  1P9Q C;  2V8G A;  2XMV A;  1AW0 A;  1RT4 A;  3QQC D;  1RAJ A;  4ZIT A;  3W5X A;  4CM2 A;  3CJ0 A;  1CPZ A;  2ZOG A;  4CZC A;  5A8W A;  1JJ2 R;  3RYL A;  1SI9 A;  2F4V F;  4RNO A;  1RAH B;  2DGW A;  4ES1 A;  1D8Z A;  3HVA A;  1HBU A;  2M8D B;  4GO5 X;  1V5V A;  4LBH A;  1RZM A;  4B9N A;  2L08 A;  2VAS A;  1HA1 A;  1UWB B;  4R5P B;  1HD1 A;  5K5M A;  2NXE A;  4RW4 A;  3QAU A;  3NBP B;  1XER A;  2YWF A;  2DNN A;  1RT1 A;  4OV1 A;  3RRH A;  4FBT A;  1LOU A;  4ZVP B;  4IH6 A;  5IC6 B;  5DQG A;  1OY9 A;  1OS5 A;  1FDD A;  2CQP A;  4MTP A;  3MUR P;  2OD4 A;  4GMK A;  1OWX A;  2V68 A;  5C42 A;  4DV6 J;  4JI5 J;  2MJU A;  4P2F A;  2EFV A;  3C16 A;  2DNM A;  1IKW B;  2LXI A;  1KHW A;  4ELU A;  2YH1 A;  5EWF A;  4AXJ A;  1HL6 A;  4AE5 A;  2KL8 A;  1UL3 A;  4CYU A;  2YY3 A;  3FFI A;  3BSC A;  4DSL A;  4IFY A;  2J9D E;  4OI1 A;  2C2M B;  1WSR A;  2MZJ A;  2XYP B;  1GX6 A;  1Y5N B;  2QLF B;  1KQG B;  2ZBR A;  5F9L A;  3G8Q A;  2RD5 C;  4LFC F;  1DZ5 A;  3P3D A;  4OJH A;  4DL6 A;  3NWR A;  1KTQ A;  1LW2 B;  1H6K X;  1O5J A;  1VRQ C;  2DIT A;  3O8W A;  3D2W A;  3FK4 A;  3PDN A;  3I5A A;  4QZV B;  3FKB A;  1RTJ B;  3MM9 A;  3PFO A;  1VS3 A;  2BJ8 A;  4IR9 A;  2CPF A;  1RT3 A;  3KLG B;  3HSG A;  3MEE B;  1U02 A;  2V2Q A;  4DV4 J;  3A3P B;  2Y3Y A;  3NGR A;  2WTF A;  3PJ9 A;  2UVW A;  2N4C A;  5ADZ A;  2VC0 A;  1FRH A;  1KQK A;  4ZKA A;  3M9M B;  2QYC A;  4Y00 A;  3CCS S;  3QLH A;  2IC3 A;  2CDQ A;  3LA0 A;  4J9L A;  1JLF B;  3EX7 B;  4Y6I A;  2ZZM A;  3I56 S;  3WQP A;  2B4U A;  1YJT A;  3GYN A;  2D3O 1;  1T05 A;  2J9C A;  3KLH B;  1JB0 C;  5D0G A;  2E1P A;  2QL7 B;  3NL0 A;  3NKY A;  4WYW A;  4HI1 A;  5E5N A;  3IRX B;  4K5S A;  2HKE A;  1WEZ A;  3HHL D;  4GC6 A;  2M5Y A;  2WVE A;  3EZ5 A;  3QGI A;  2YWE A;  4NAS A;  1N5Y B;  3E3X A;  5E33 A;  3M6V A;  1VBX A;  1FEH A;  4CLY A;  2Y9H A;  5KFE A;  4ITS A;  3TVZ A;  4F3M A;  2KG0 A;  1Q4R A;  1FJC A;  1ZAW A;  5D3G A;  4I2P B;  2BQU A;  1S12 A;  3Q8Y A;  2CQG A;  5HP1 B;  4ED8 A;  2DKO B;  4EK2 A;  5KT3 A;  1WC6 A;  2ILY A;  1FKA F;  2BJ7 A;  2RS8 A;  4Y2C A;  2R7R A;  4LF9 F;  4QIV A;  2P9E A;  3R5D A;  4NWB A;  5AXL A;  3M8S A;  3M6W A;  2NZ4 A;  1Z4U A;  4GVB B;  1U7L A;  3PRD A;  3ENQ A;  3I4H X;  2Z2L A;  3MPV A;  4J9Q A;  3QYY A;  4DUY F;  3M8P B;  4ELV A;  2ZWP A;  3LAN A;  4H4K A;  5DDP C;  4PWD A;  1FX4 A;  1N36 J;  1JXE A;  1AA1 B;  1VLO A;  4MT1 A;  1KR4 A;  4FNI A;  1KQF B;  1J2V A;  4USU A;  3KMQ A;  3K5N A;  5C5J A;  4B9U A;  2OPP A;  5E2Q A;  3C14 B;  4TN2 A;  5A8K A;  3RGI A;  3GIJ A;  3L95 X;  3GCW P;  5HAT A;  3BJY A;  2KFN A;  4EWT A;  3M2U A;  2X1F A;  1HBN A;  4PQA A;  2JEI A;  3DI6 A;  2BQR A;  2KFY A;  1BWE A;  3MZI A;  4LVO P;  3A3O B;  1CS4 B;  1QE1 B;  4FYX B;  4NMX A;  4MIA A;  4KPY A;  2A6O A;  2XUL A;  3B6B A;  3O44 A;  3RB0 A;  2BEF A;  3TJ8 A;  2X51 A;  1UAW A;  3WC2 A;  2A18 A;  5IC4 B;  1TFW A;  1YJU A;  1FWP A;  2NXC A;  3RBD A;  2Z56 B;  1NBE B;  2MQ8 A;  3HVW A;  3LOU A;  4JV5 F;  4AXI A;  4IDK B;  4KV8 B;  4G1Q B;  2WSF C;  2ZE2 A;  1G7C B;  3ZZT A;  4KGV B;  1HQE B;  4Y3C A;  4UY8 T;  1YRT A;  4LRC A;  1WOR A;  4MKA A;  3BBB A;  1LWC A;  3MR2 A;  5I42 A;  3MDF A;  3U1M A;  1LK7 A;  5H1S V;  4A8S A;  2JC1 A;  1HYS B;  2XHC A;  1YLX A;  2P6T A;  1FJ7 A;  3H4D A;  2V9K A;  4WE1 A;  4LIW A;  3KK2 A;  1Y3J A;  5KFJ A;  1NK8 A;  2CPJ A;  1S1T B;  5KFY A;  4DX8 H;  5DJB A;  2HBR B;  2XB2 D;  3IWN C;  5BYS A;  4OZ1 A;  4KJI A;  1N88 A;  5HJY A;  2YQ0 A;  4QWD A;  2IM0 A;  4MFB B;  4WKY A;  4X64 F;  3FCV A;  4G65 A;  4NRU A;  1K0V A;  4P7T A;  1MWQ A;  1K73 T;  3VGS A;  4I6A A;  4C9D A;  1S57 A;  3HJF A;  5B0A A;  2D9P A;  3OHA A;  3LAM A;  4TY9 A;  4RU2 A;  3PEH A;  5J2M B;  4EBC A;  4K4V A;  5H9F J;  1RHK B;  4FXV A;  1RYR A;  1Y00 A;  3QO9 A;  5KFU A;  4UQT A;  2V34 A;  4OYX A;  4UOC A;  3KLF B;  2BJ3 A;  3ETM A;  3T1H F;  2J0Q D;  5HI7 A;  3D54 A;  1UFK A;  1HBM A;  3TQE A;  5IT0 A;  3T1Y F;  1VK8 A;  1D09 B;  2MKH A;  5L38 A;  2ZZN A;  3TZY A;  2E66 A;  4J91 A;  3MAQ A;  4JBC A;  4QIW D;  3GYX B;  3FCH A;  3H59 A;  4CLK A;  3EVM A;  2R8H A;  3I55 S;  2UP1 A;  5U47 A;  3R6G B;  3CCJ S;  2BVZ A;  4YUD A;  5H9E K;  4ZPT R;  2VHG A;  4FP9 A;  1F6T A;  3PYE A;  1Y11 A;  4C7Q A;  4ZPV R;  3FEX B;  1QAY A;  1U4B A;  3UN5 A;  2ZC3 A;  2F7V A;  4L3K A;  2RJZ A;  2IVY A;  3QIP A;  5HMW A;  1DTQ A;  3BGL A;  2NXJ A;  3N79 A;  2W9B A;  1S9G A;  2OEM A;  3CCT A;  1WOS A;  4NXM F;  3US5 A;  3TA1 A;  3DOL A;  2A10 A;  4CLF A;  3QFH A;  1FKP B;  2VIC A;  3B82 A;  5KG2 A;  1MN9 A;  2GIF A;  5L9N A;  4Q45 A;  3OR1 B;  4DR1 F;  4AL7 A;  2HWT A;  1V3S A;  4QPX A;  1E6V A;  1TTH B;  2ZKT A;  3S7R A;  3SV3 A;  3MFI A;  2HFZ A;  3BR9 A;  4YHH J;  4F4W A;  4EZ9 A;  1H0H B;  1C4C A;  4M5D B;  4DZ6 A;  4E0D A;  3F44 A;  5LMN J;  1WUU A;  2MJN A;  1N5Q A;  3FCW A;  3CDA A;  1QUV A;  2FY8 A;  4ZLP A;  5J2N A;  5SZT A;  2W25 A;  1OQ3 A;  1UJ5 A;  4OFZ A;  4MK7 A;  1RU1 A;  2XCP A;  1SL2 A;  2JEG A;  3ADA C;  5EN1 A;  5KT7 A;  3KLE A;  1S4E A;  2PMZ D;  1YTY A;  2R7Q A;  1ZM2 A;  1FWK A;  1C0U B;  4IUF A;  3D6T B;  3HSD A;  3GIM A;  2IVF B;  3EPI A;  4CH7 A;  5GVQ A;  4USW A;  5ETL A;  3SCJ E;  3POT B;  3ILL A;  4K4Z A;  1FJG F;  4USM A;  3QWP A;  3MM8 A;  2QE5 A;  2BUN A;  3C2P A;  3NNC A;  2VKZ G;  3LGH A;  2RHQ B;  2CKW A;  2W2M P;  3HHD A;  3DLB A;  3BDP A;  3M8Z A;  2DXF A;  3AD7 C;  3QAT A;  3CDB A;  2AJQ A;  4M1K A;  5KFV A;  3OPK A;  3OV7 A;  4A47 A;  4O23 A;  3DXB A;  3J81 U;  2FZG B;  3HHL A;  1N8R T;  5LSO A;  5KT5 A;  2AMC B;  4QWC A;  2HS0 A;  4ZHR B;  2LCW A;  1K9M T;  5L1J A;  1W2B R;  1R8B A;  2Q66 A;  2NYI A;  4ECX A;  4DG1 A;  5KFQ A;  2APO A;  1WKL A;  3AOB A;  2B5J A;  3TEH B;  1F5A A;  3CUL A;  3VV2 B;  4DL3 A;  3M7V A;  3QSI A;  3QRP A;  3RRG A;  1P27 B;  3CJQ A;  3FBC A;  3KHR A;  1IBC B;  5BXI A;  4X65 F;  4YB6 A;  3GIK A;  1H2T Z;  2GML A;  4C3L A;  2DNH A;  2L48 A;  1CEZ A;  4M5G A;  4LFB F;  2R7X A;  3HSJ A;  5KFZ A;  1HHT P;  4MKV A;  4NLP A;  3W3S A;  2MPU A;  3CC2 S;  4KT0 C;  1V3Z A;  2LKZ A;  5IT9 U;  1EJ7 L;  1YWX A;  3WX8 A;  2M52 A;  4A46 A;  4J5O A;  3OSN A;  2GGP A;  3CCQ S;  4OX9 J;  4XDC A;  4DV0 J;  3DYA A;  4KHP J;  3CGI A;  1AUD A;  2EFP A;  4KFB B;  1S1W B;  2N3L A;  5ETR A;  2V2V A;  4OLO A;  3HSZ A;  2YNI A;  3MM5 A;  5KG5 A;  1CQN A;  3PRV A;  2LQ8 A;  3DLE B;  3J80 U;  4URQ U;  2FIU A;  3G6E S;  2BQ3 A;  3Q83 A;  4OV6 A;  2XSF A;  4F2R A;  4K2J A;  1U47 A;  4CT9 A;  2PGC A;  1QJH A;  2Z0G A;  3IBF B;  1U45 A;  1M1G A;  1VQ8 S;  1YJ9 S;  1VOM A;  3ZNJ 1;  2WON A;  2MQL A;  4K2X A;  1B0V A;  6FD1 A;  5CCL A;  1RQ0 A;  1T9V A;  2EG2 A;  2EEY A;  3VQS A;  4TU8 A;  3BQ0 A;  2JZ5 A;  2LQ5 A;  3MEG B;  1N0V C;  1TKZ B;  1VQK S;  2ZM6 J;  4MJK A;  4ED6 A;  1TR0 A;  1XJW B;  4KTQ A;  3DOM B;  2V4R A;  4CDI A;  2DPJ A;  3DM2 B;  5CZX A;  3F73 A;  2IDL A;  1JX4 A;  1EP4 A;  3MM7 A;  3M32 B;  3TUJ C;  1IBL J;  1N6Q B;  3EE3 A;  1ARO P;  2NPI A;  5KFN A;  5A6P A;  4DCJ B;  3JTN A;  1FVS A;  1IJF B;  1CJV A;  2UUW A;  2BE2 B;  2WRM A;  4TNO A;  2J0W A;  2XWX A;  4CTA A;  2I2Y A;  1TMM A;  4FXD A;  3HHL C;  3R7N B;  2B4P A;  3KHL A;  3V81 B;  3UN2 A;  5KFF A;  3CTR A;  2B9X A;  2GFF A;  3G6V A;  3KG0 A;  3W63 A;  3MOZ A;  3H5S A;  2V4J B;  4ZN3 A;  3CCE S;  1QAJ A;  1WC1 A;  9RUB A;  3DRS A;  1IBK J;  2DNY A;  2ZJQ Q;  4JI1 F;  2FQQ B;  2BKO A;  3TO8 A;  3M9N B;  1VC5 A;  1L3V A;  4ILR A;  3K89 A;  2LDI A;  2E5H A;  4L74 A;  1HFE L;  2YNF A;  1FFW B;  3SXL A;  2VG5 A;  5HLF B;  1Q53 A;  1TL7 A;  5E0O A;  2F8H A;  2HEK A;  3NGU A;  1FRJ A;  2LMI A;  2JH3 A;  5EWE A;  3H4B A;  2HNZ B;  1QSL A;  2VV5 A;  1NLK L;  2GAH C;  1KNZ A;  4LMZ A;  4OJ1 A;  3R5J B;  2OEK A;  2DGO A;  1J5O B;  2R8G A;  1Q1K A;  1VQ7 S;  1OY8 A;  3GJR B;  1DFD A;  2DNZ A;  4RL1 A;  1RWO B;  3I6P A;  2BAC A;  4WFY A;  5L9X A;  5A6W A;  2C2O B;  4Q0B A;  3ZTO A;  3UCZ P;  1WOO A;  1SKR A;  1H98 A;  3R5B A;  2A3J A;  1IUJ A;  2VQE F;  3C8Y A;  1JKH B;  3QGG A;  4NLG A;  5ETQ A;  5EDW A;  1PYS B;  2RS2 A;  4ZCM A;  1HNW F;  4DR2 F;  5T7L B;  2JFD A;  5ITH A;  2WB1 D;  4EGL A;  2ZHO A;  4O4R A;  3PO5 A;  2ZFH A;  1IR1 A;  1PAU B;  1Q78 A;  3RTV A;  3H40 A;  2VPZ B;  4A48 A;  3I31 A;  4HLB A;  1GFW B;  1TKX A;  1U1O A;  1Y4Z B;  2ZH4 A;  4DPX A;  4WBF A;  1VQ6 S;  1IKV B;  3H42 A;  5J2P A;  1QAI A;  2CQB A;  2M2B A;  5DDQ C;  4DOZ A;  3SBM A;  1EET B;  2CUY A;  3MPU B;  3BYR A;  4F4X A;  3PW2 A;  5LOQ A;  4HKQ A;  1RHQ B;  3EPG A;  2MLZ A;  2R2T A;  2DGU A;  3LAK A;  1Q16 B;  2V50 A;  1MSW D;  4WZQ A;  3KYL A;  2WW4 A;  5LL6 d;  1HWL A;  2DTJ A;  3CJ5 A;  3HVT A;  4DV2 F;  1VHI A;  4DV7 F;  5K8M A;  4URS A;  2CPY A;  4OMF G;  3NS5 A;  3N5F A;  3I9V 9;  3MF5 A;  5KOW A;  5LT5 A;  2ZZT A;  1RAO A;  1RT4 B;  4PQU A;  4OZ5 A;  2G0J A;  2QT7 A;  1VC0 A;  4Y65 A;  1Q8I A;  2BX6 A;  2XMA A;  4ED3 A;  4PKD B;  3M8Q A;  2AU0 A;  1RTD A;  3F56 A;  2IM2 A;  1FF2 A;  3FRY A;  1FRX A;  5AE2 A;  2HHH F;  4R8U A;  2DR6 A;  5IM0 A;  3MAA A;  3HT0 A;  1URR A;  3DCA A;  1PBA A;  3LP2 B;  4XPE A;  5IT4 A;  3MWB A;  1NJX A;  3QMQ A;  3GFY A;  3T6J A;  1S49 A;  4RW4 B;  3CPW R;  4USH A;  3PYG A;  2OUG A;  2GHW A;  1SQG A;  4F8R A;  4LF8 F;  1RT1 B;  1B0P A;  4YY3 J;  1JIH A;  4C3K A;  4DFP A;  3UFC X;  1JLE A;  1LXJ A;  3GIL A;  4NEY A;  5C42 B;  3V2U C;  1JXV A;  1Q7Y T;  4FXW A;  1MU2 A;  3IRW P;  1FK9 A;  1SJF A;  4NI2 A;  1R8P A;  4CYU B;  1SJQ A;  4TQR A;  5FLX Y;  4OHY A;  3V4M A;  2DGV A;  4IFY B;  4J9U E;  5BJR A;  1S6P A;  2P2C B;  3QBC A;  2KTQ A;  3NCR A;  4OI2 A;  3RB3 A;  4HI2 A;  3AHP A;  3NAH A;  3N9U C;  1FVQ A;  3FMW A;  4DF8 A;  2CJX B;  3MMB A;  2HGL A;  2F9J A;  1ROF A;  4UY8 5;  1T9U A;  2YPY A;  4ED1 A;  2VD3 A;  1CJK B;  3NGS A;  5AT1 B;  1RT3 B;  1KC8 T;  2WVD A;  1JLC B;  2EPI A;  1DTT A;  3A8K A;  2XS5 A;  3CCR S;  4H54 A;  4UW2 A;  3GSD A;  1GT8 A;  4X4O A;  2BE9 B;  2QTW A;  3IGV A;  2RE1 A;  2Q6C A;  1WWH A;  1ZA1 B;  2MQO A;  3BQ1 A;  1B7Y B;  5I3U B;  3GG1 A;  3D28 A;  4Y2K A;  2EBE A;  3EVW A;  2ROG A;  2AX0 A;  2ROE A;  4B02 A;  4O0I A;  2RKI A;  3CJ3 A;  1UEV A;  1NJZ A;  5C7P A;  3QGP A;  4RW8 B;  2AGP A;  4C8Y A;  3SSR A;  1HPZ B;  4F4A A;  3VAJ A;  3I0R A;  1FWL A;  4DR7 F;  2VA2 A;  1I1G A;  2IA0 A;  4PAA A;  2E7V A;  4YDD B;  5K8P A;  3THT A;  2A2D A;  4ID8 A;  3IAS 9;  3P5T L;  5E3P A;  2FPH X;  3VVT A;  3VF0 B;  5F8G A;  3VAM A;  1AFI A;  3PR4 A;  1KRP A;  1RTI A;  3NGK A;  4HHU A;  1R3N A;  1WAC A;  5HAO A;  4XK8 C;  3S1T A;  1FD8 A;  3TNV A;  2FGC A;  1VIO A;  4TU7 A;  4OYZ A;  2ZH5 A;  2HIY A;  1T02 A;  1YKW A;  1K1Q A;  3CJR A;  1P1T A;  4ZCK A;  4QWB A;  2KZM A;  2DNR A;  1U6B A;  4RBT A;  5BR8 J;  4I6W A;  1Z2L A;  1Y5L B;  1AFJ A;  2EW9 A;  2F5G A;  5HQ8 A;  2MGZ A;  2J7K A;  2ASD A;  3MFH A;  2CPE A;  4PWD B;  4C8O A;  1VQ5 S;  2YTC A;  3TQ1 A;  3AXM A;  3E01 A;  3NG8 A;  3J7Y U;  1FXL A;  2A6M A;  2OPP B;  4QW9 A;  1TEL A;  2JL9 A;  4NRT A;  1JNR B;  1RK8 A;  2O3D A;  2MKI A;  3RG6 A;  1Q82 T;  2GW8 A;  1CC7 A;  5I3Q A;  2DHA A;  1X0F A;  1IQT A;  1HBN B;  3BRE A;  5A0Y A;  4H4O B;  5CXT A;  1NPP A;  3GV8 B;  1WSV A;  1GNK A;  1S7I A;  2BRL A;  3QRQ A;  4DWI A;  2LLZ A;  3D4J A;  4QR1 A;  4X4R A;  3CJS A;  2XLJ A;  3ULH A;  3W8P A;  2R2R A;  4ZLL A;  4OHV A;  1CQM A;  3P8B B;  2MMY A;  1KLM A;  3H90 A;  5HVH A;  2YWK A;  3V6H A;  1Q5Y A;  8ATC B;  4JI5 F;  3GJS B;  3KHH A;  1RKI A;  1NKE A;  1RAI B;  1YG0 A;  3TX8 A;  1HR0 F;  1RB0 A;  3AAW B;  1LWE B;  2ZE2 B;  3VZH A;  1VQ4 S;  4ALZ A;  2RUG A;  3P5B P;  2DCU B;  4KHR A;  3THP A;  1LWC B;  3DOK A;  3EXY A;  4IOC Q;  4DL7 A;  5I42 B;  1VI7 A;  3M8R A;  2Z4P A;  2CQ3 A;  1TK0 A;  4LQ3 A;  4OYW A;  2FDN A;  5J2Q A;  2M8H A;  2LDY A;  1UW9 A;  2MKY A;  1F3V A;  4QU7 A;  3KWM A;  3ONQ A;  3TA0 A;  2WAQ D;  3M6X A;  4RUA A;  1SUQ A;  3FUY A;  4AUK A;  5C25 B;  4WE1 B;  1BUX A;  4QJV A;  5AXK A;  3TYT A;  3CSK A;  2VFR A;  5EGY A;  2R42 A;  3G86 A;  3JYT B;  3QNW B;  5ETT A;  2WVB A;  5GAH U;  1JMT A;  4KR0 B;  3TAM A;  1YJN S;  4ECU A;  3W2W A;  4DV4 F;  1YDL A;  3MR3 A;  1HHQ A;  2I6W A;  2JVO A;  1U2R A;  2UXB J;  1FNO A;  1JLA A;  5FJ4 A;  1NM2 A;  1UEU A;  1VIS A;  1VQM S;  2RNE A;  2AIR B;  4RW9 A;  4BWM A;  1IKX A;  3VR1 A;  2QSW A;  4WP9 A;  4K4U A;  3KDO A;  2AZ1 A;  1G2E A;  1MWY A;  1DLO B;  2ACY A;  1XK8 A;  2V8P A;  1WEY A;  3QO9 B;  1GH8 A;  2H3E B;  5KFA A;  4DQP A;  3BB5 A;  4M5L A;  2OO4 A;  5DLF A;  1RAB B;  4X4U A;  2FHK A;  4IG0 A;  5GAH I;  3PVX A;  1E6Y A;  3W8G A;  1N4L A;  3G96 A;  1G1X A;  3NNA A;  2CVE A;  3ITH A;  1PYT A;  3RB6 A;  1RBA A;  1VK3 A;  2NPF A;  1RBL A;  2AP6 A;  3SZ2 A;  4ED4 A;  1QM9 A;  2MZ1 A;  1C1B A;  2L9N A;  2V63 A;  3M1V B;  3HVR A;  1SKS A;  4P73 A;  1BQN A;  3CC4 S;  1EKS A;  3MPD A;  5IOL A;  2JX2 A;  1YSJ A;  3TAN A;  1U48 A;  2CPX A;  3SI8 A;  3BKF A;  1QDU B;  3LGN A;  2XGQ A;  4UF4 A;  3KHG A;  2DIS A;  2DR5 A;  2CJY B;  3Q8R B;  1ZS6 A;  4HYK A;  1IWA A;  2YKA A;  4DQI A;  3MEK A;  1IBM J;  2XG8 A;  2ZD1 A;  4A8Q A;  2XBP A;  4F02 A;  4P6Q A;  1MLA A;  3D5M A;  3BQ2 A;  3QIP B;  1ZZF A;  5DM7 Q;  1DTQ B;  5B7W A;  5B0C A;  2ZBP A;  1N36 F;  1S9G B;  2N7Y A;  3FEY B;  4CQ1 A;  4M5J A;  3RBZ A;  3OJU A;  2J0X A;  1UCN A;  1VYA A;  1X5S A;  3MED B;  3MMC A;  2F63 A;  3LWL A;  3MM6 A;  5CYQ B;  4E8U A;  4KKO A;  4NXN J;  3CDE A;  4C6A A;  4M5K A;  3Q8U A;  4MKB A;  1BQM A;  4LRD A;  3DRY A;  3VZI A;  3PRB A;  1VQL S;  4PCQ A;  3UD4 P;  3GII A;  2MQP A;  2JLF A;  3D6M B;  3GR1 A;  5DG8 A;  1RAD B;  2YNH A;  2HNY A;  3GP9 A;  1SJ1 A;  2GO8 A;  3SQG B;  1R27 B;  2XNQ A;  4F3O A;  2HHS A;  3ISZ A;  1UMJ A;  5FII A;  2V2Z A;  2HWI A;  1OSC A;  3ILO A;  1U1N A;  4ILL A;  3HD1 A;  2VU5 A;  2HHV A;  2OAU A;  2I9S A;  3BPS P;  2XY5 A;  3ZZ0 A;  2OFG X;  2Z8Q A;  2FYX A;  1UZH A;  1TQL A;  3KLE B;  3B78 A;  3FDS A;  1S9E B;  1XR6 A;  2RDD A;  5M2U A;  1HAR A;  4NYO A;  3OD2 A;  2YX1 A;  4TQS A;  2UV8 G;  5AE3 A;  1NJY A;  4AD6 A;  4DN9 A;  1YVF A;  3FBE A;  3QZ8 A;  3SV4 A;  3IBC B;  2W01 A;  5IQQ A;  5KFL A;  1WI6 A;  3CCL S;  3VHQ A;  2IAJ A;  3ZZU A;  2DT9 A;  2XM3 A;  1TV6 A;  4F4Y A;  4DV1 J;  4RW6 B;  4M5H A;  5D78 A;  3PW5 A;  2R9L A;  4HT5 A;  3M4X A;  4ID5 A;  2VF3 A;  2B3T B;  1J5E J;  2J0S D;  4MIB A;  4K0K J;  1CUL A;  3KJQ B;  4MYU A;  2FJV A;  5HMZ A;  2Y0S D;  2GMJ A;  3HP6 A;  4RZR A;  3EWG A;  2KJW A;  3M2R A;  1M90 T;  3HHL B;  1GMW D;  1NJI T;  1U1Q A;  2MHE A;  3MEC A;  1RT7 A;  2HBY B;  5GMD A;  3HXM A;  5KFR A;  1X31 C;  1CG2 A;  4CLW A;  1KSP A;  1Z2Z A;  4USK A;  2GO9 A;  2QC3 A;  5EUH A;  3LAL A;  4ZJO A;  3PIO Q;  2MZQ A;  2XS7 A;  1PJ5 A;  2HGM A;  2CA9 A;  2ROP A;  3ZTR A;  4DG1 B;  2CNL B;  2VKR A;  5KAK A;  3CWJ A;  2BOP A;  1L3T A;  3G2X A;  3KK3 A;  2B5J B;  5F8L A;  4IG3 A;  3SIP B;  3CCZ A;  1X5T A;  1D9A A;  5F8H A;  1SKU B;  2BJ9 A;  2ZNZ A;  1RWM B;  2G2Y A;  3C6T A;  4ECW A;  2IYG A;  5CH7 B;  1KVJ A;  2NSB A;  5KFP A;  3EZU A;  2F1F A;  2H1Y A;  3HFZ B;  2KM8 C;  4P2M A;  4FF4 A;  4UOH A;  5IWA J;  2JVR A;  3BDE A;  2DGT A;  4ZS6 A;  1YI2 S;  4OZ2 A;  3N6M A;  3RR7 A;  4HEA 9;  4GKJ J;  1RT5 B;  2EVZ A;  2VG7 B;  2RQ4 A;  1Q0N A;  1R0A B;  5CZV A;  4RLE A;  4ZVQ B;  3OTO F;  5KFX A;  3H2V E;  4QYZ J;  2EK1 A;  2WBR A;  2NQP A;  3TJ9 A;  3IXQ A;  4R0E A;  2RF2 A;  3NOG A;  2AYG A;  3DYA B;  2XWY A;  2AW0 A;  4ZVE A;  4B3S J;  1HI8 A;  3GLJ A;  2HHP A;  4C4W A;  3MM5 B;  2EFG A;  3D1Q A;  2DNK A;  3I0S A;  1NSQ A;  3AD9 C;  4ZPC A;  3NAI A;  4ZN1 A;  4QIE A;  5ETM A;  2IJR A;  1F9F A;  1F0X A;  3K59 A;  1M5K C;  4LSN B;  1XEZ A;  2HFU A;  1KQS R;  2CQI A;  3QWU A;  4DQS A;  1N48 A;  4C8K A;  5DLG A;  1UKU A;  3UPF A;  4ZP8 A;  3BN4 A;  2AYB A;  1DJ0 A;  1DHM A;  4ZCL A;  5CYM A;  1SL1 A;  1NPK A;  4PXC A;  2ZOF A;  2W4C A;  3AXK A;  1T3N A;  1JLQ A;  3QRR A;  3PCO B;  4OYP A;  4PXD A;  3MM7 B;  1UW4 A;  3QJJ A;  3K5P A;  5LMN F;  4UST A;  4I6Y A;  1GQE A;  5CD4 A;  3HUL A;  4KH1 B;  2UU9 J;  1SV5 A;  2AEM A;  1D0E A;  4PUO A;  2V67 A;  1TKT A;  2KYZ A;  3B4M A;  4CTA B;  2RRA A;  1A7G E;  1KHV A;  4Q44 A;  1ZPW X;  5DRK A;  3CCV S;  4OHX A;  3A8I A;  2R7W A;  1GX5 A;  1S7H A;  2ZH9 A;  1ZM9 A;  4EO8 A;  4IFV B;  2OJ3 A;  4ECR A;  5M2P A;  2JNJ A;  3T19 A;  2YKM A;  1A0O B;  1HHS A;  1B7F A;  4QWA A;  5D8H B;  2GVZ A;  2DRB A;  4LFA J;  1SJR A;  2YX7 A;  1T9Y A;  3HT3 A;  3OXL A;  2DGS A;  3PO4 A;  2V8V A;  1N34 J;  2HFN A;  3OL9 A;  2CZ4 A;  1YQH A;  1XNQ J;  4B08 A;  2VG5 B;  1F9H A;  5E7O B;  3VAI A;  3UR0 A;  2KG1 A;  1WC3 A;  4EU0 A;  1HMV A;  3SDE A;  1PC4 A;  3PR5 B;  5KFW A;  3IS9 A;  1T0T V;  2VQE J;  3R1L A;  2V69 A;  3M2V A;  2U2F A;  3MR5 A;  4Q8F A;  4B17 A;  4Q0B B;  4P2X A;  3PX6 A;  2DH7 A;  2OKQ A;  2CQ0 A;  2C2K B;  4DLG A;  2XSJ B;  2UUC F;  1AUS L;  4FYY B;  4NLO A;  2KJV A;  5HAN A;  5DQI A;  2LQ9 A;  4X84 A;  1NO8 A;  3IN5 A;  5D4L A;  2FJA B;  4IOB A; 
#chains in the Genus database with same CATH homology
 2GVZ A;  4CLT A;  1FX4 A;  1TL7 B;  1WC1 A;  4USU A;  5D0G A;  4OYW A;  4USW A;  1U0H B;  2W01 A;  4WP8 A;  1CUL B;  1U0H A;  3MAA B;  4OYX A;  3MR7 A;  4OYM A;  4CLF A;  4CM2 A;  4P2M A;  3C14 B;  1CJT B;  4CLP A;  1FX2 A;  5D0E A;  3C14 A;  1AB8 A;  1CJT A;  3ET6 B;  4OZ2 A;  2WZ1 A;  1YBT A;  2QV6 A;  1AZS B;  4CLS A;  2GVD B;  1TL7 A;  4USV A;  5IV3 A;  4CLY A;  2GVD A;  1CJV B;  3G82 B;  4OYP A;  4CLU A;  4OYA A;  3UVJ B;  1CJK B;  1WC3 A;  1CUL A;  3MAA A;  4OYB A;  4CLL A;  4WPA A;  3C16 B;  3ET6 A;  4WP3 A;  1CS4 B;  1CJU B;  4UST A;  4CM0 A;  1CS4 A;  4CLK A;  1AZS A;  3C15 B;  1WC6 A;  4OYO A;  4OYZ A;  4OYI A;  2BW7 A;  3C15 A;  1CJV A;  2GVZ B;  3G82 A;  1YK9 A;  4CLW A;  3R5G A;  4P2X A;  3UVJ A;  1CJK A;  1Y10 A;  1WC4 A;  5D0R A;  1WC5 A;  1Y11 A;  4OZ3 A;  5D15 A;  4P2F A;  4CLZ A;  5IV4 A;  3C16 A;  1CJU A;  4NI2 B;  1WC0 A;  5D0H A;  4WP9 A;  4NI2 A;  1YBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...