1CS4A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
molecule keywords TYPE V ADENYLATE CYCLASE
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4A00
1FX4A 3MR7A 1CS4A 4WP9A 4NI2B 3C15A 3MAAA 4OYAA 4WPAA 4CLYA 5D0HA 3UVJA 4WP8A 1YK9A 4CM0A 1CJUA 1Y10A 2W01A 4P2FA 1CJVA 2WZ1A 4CM2A 1CJKA 4USTA 4CLKA 2GVDA 3ET6A 4OYXA 1WC0A 1YBTA 1TL7B 2GVZA 1CULB 1AZSA 4OZ2A 1U0HA 1WC1A 3C16B 4CLTA 5D0EA 4OYWA 1FX2A 1CJTA 2BW7A 1CS4B 3G82B 4USVA 4OYBA 3C15B 4CLUA 5IV3A 5D15A 1CULA 4OZ3A 1U0HB 3C16A 1CJUB 4USUA 4NI2A 2QV6A 3C14B 3MAAB 4CLLA 4CLFA 4CLZA 1WC4A 5IV4A 3UVJB 1CJVB 1WC3A 1CJKB 4P2MA 4OYPA 1WC5A 1AB8A 4CLSA 4OYIA 4OYMA 1WC6A 1TL7A 2GVZB 3C14A 4CLPA 1AZSB 4OYZA 1CJTB 4OYOA 5D0RA 4CLWA 3R5GA 4WP3A 2GVDB 3ET6B 3G82A 5D0GA 4P2XA 1Y11A 4USWA 1YBUA
chains in the Genus database with same CATH superfamily
2MZJA 2CADA 3M32A 3QSIA 4DOZA 4RBUA 4J9PA 8AT1B 1TELA 4B08A 5F8JA 1R8AA 4JV2A 3EPGA 4R8UA 2BR0A 2EC2A 2DH8A 3GR0A 1DURA 2LFVA 4H4MA 2GGPB 2VPZB 2RDJA 2OPPB 4AQYF 4FVMA 4JI4F 2HFVA 4WFNQ 5IM0A 3NBPB 4DCPB 3K8VA 2F65A 1X7VA 2HHPA 2YH0A 4FP9A 5B0FA 2OTJS 3GLJA 3CCUS 4PWDA 1RTDA 3NNAA 1GXTA 2OD4A 1RBAA 2J7UA 2WTFA 3VVTA 1W2IA 2QLXA 3NRBA 4RPFA 2Q1LA 3EGVA 4ZLJA 3IN5A 2XY5A 3OFHA 4AQYJ 2CPYA 4FF1A 4PABA 1RBLA 1RTJA 4ECXA 1RT4A 2AEJA 3RG6A 3US5A 1Q81T 4KHPJ 5LXRA 2Q6BA 1L3TA 2PI4A 1MW7A 2M52A 3BH6B 4KKOB 2DNLA 1NJIT 4LFCF 2K3IA 1VBZA 2NSCA 2CPJA 4C8MA 2LDYA 1IBLF 5AJ3J 4IR1A 1ROFA 2HBRB 2IRXA 3KLEB 1SL1A 2E9TA 3NCRA 4HH0A 1U1NA 4FYYB 2CJAA 3JTNA 1NK9A 2XS5A 2BVZA 2GO9A 3BQ1A 3ET6A 3LP2A 4DV7F 3A8KA 1U1RA 2VC0A 4F7VA 4C8ZA 4J90A 3T6BA 1D9FA 2LQJA 1JXVA 3JS9A 2D1CA 3MWBA 2E5LF 4IFVB 3VQSA 2B4OA 3CXCR 4XO0A 3D68A 2YH1A 4M1KA 2CQDA 1V3SA 1P6TA 3PYGA 1C2PA 4TY8B 3HKZD 2YKOA 3OQ2A 3SEOA 2XHCA 5JMNA 4AL6A 1M1GA 1RTHB 4OX9J 3NS6A 1RKIA 1UVLA 4DS4A 2MQMA 2KL8A 4W92B 3HP6A 5EN1A 4DF8A 3PW4A 4NLGA 4EEYA 1FJCA 3KHRA 5ETLA 3C15B 3BN7A 4X64F 4M5GA 1ZM9A 1N34F 2A0FB 4Y2MA 1RACB 2DGQA 4DDFA 4ZKAA 3K0JA 2EFOA 4HL9A 3CMAS 2QMWA 2BQUA 4UUWA 1C0TA 1K1QA 3H42A 3HT3A 2AMCB 2OPQB 1S7HA 3DLHA 1B0TA 2HQCA 3PJ9A 4WFZA 2OPPA 4YB5A 5A6WA 3W5YA 4RW8A 2AJ0A 4J9NA 5BYRA 1U8SA 1NHVA 4DLGA 1Q86T 2CJBA 2BKPA 3DLGA 4PWUA 5B0EA 1EKRA 1JNZB 5KFUA 3Q23A 3RR7A 2KT3A 3PYEA 2NXCA 3MM8B 1RTDB 1LWCA 3AJDA 1F9HA 3FCVA 3CCQS 3Q24A 2QLBB 3KG4A 1KQGB 1YVFA 3RUBL 3WHIA 1S1XB 2IM0A 3GFXA 5KFEA 5IQ6A 1ZAWA 4LRCA 1RAFB 1N5YB 3VZIA 2DD8S 4Q7AA 3AOCA 2NLWA 2Z58B 1LK7A 3DGPA 2RHQB 4E0DA 5D3GA 4UY8T 4X4NA 5GAHI 4EFAC 1LNQA 3CDEA 2IMWP 2VL1A 1Q8IA 1U02A 2D9PA 3O5TB 3LWMA 4J9OA 5FDLA 3PHEA 2ASJA 3ILLA 4B3MJ 2R8GA 3J81j 8RUCA 1QSYA 1JKHB 4KQZA 4WIQA 4GMKA 3CJ0A 3V5RA 1Y00A 2C1EB 3LAMA 4RW6B 5DRKA 1CJTB 2RNEA 4FYVB 3UN3A 4C48A 3V6DB 4JI1J 4G3IA 4CLWA 4I69A 4WF9Q 2V63A 1RT6B 1N36J 4PG7A 5E3RA 2BV3A 4DMZA 4LF2A 4P2XA 1V5IB 1X4GA 5FIIA 3WC0A 4U6PA 3U02A 3BF4A 1IVZA 4L72B 3MEDB 4X4UA 4WE1A 2V69A 1HIYA 4NEYA 3FUYA 2CQHA 3H5UA 1M0SA 1VQMS 2U1AA 2OEMA 3UI3A 1T8EA 4XPEA 1MNEA 1WG4A 1NH8A 1Y5LB 4NXNF 1BQMB 2PGCA 1S6UA 1KWMA 4O4GB 2HHSA 2QSWA 3MAAA 4BCAA 2V8HA 3HPOA 3J81U 5L39A 3KFWX 2PN6A 1N4LA 4CLYA 1AA1B 1O0PA 2NXNA 2BE2B 3BZQA 3NCQA 3CJSA 4OLPA 5E3AA 4RO0A 4Q2LA 1VQ4S 1VMBA 4DFJA 1RA6A 4DR1J 4KE5A 3H98A 4WFYA 3EDRB 5EDWA 4WTOB 4KGZB 3CIMA 2NQPA 1IQTA 5SZTA 3DLGB 3OUYB 1WG5A 3KK2A 4ECTA 3PIPQ 2DB1A 3JXOA 4JI0J 4ECVA 3PRDA 1D0EA 2DNQA 3G6VA 2V0NA 3LPYA 4P2FA 1M5HA 3T5JA 3TAPA 4X66J 1V3ZA 4J9RA 2I2YA 2B9EA 1WI6A 4QWEA 3IP0A 1NB7A 2HZVA 2VB6A 3I4PA 4YFUA 4DR5J 1REVA 2RMLA 2HS4A 2QL5B 4WXOA 4KAIA 3E2EA 2NZCA 2QJ3A 3CJTA 5HQLA 2B8PA 4B9SA 2XLIA 4JI6J 4DV5J 3KMSA 1TKTB 3EX7B 2CQGA 4NCAA 1AUSL 1SQGA 3HSJA 1FCAA 3ENVA 4DUYJ 3DMJA 4CNZA 2HVHA 2JHEA 3RJMB 3SQGA 4DCJB 3N79A 3MD3A 2KT2A 1AFJA 4IFYA 3IM9A 2R42A 4R5PB 3GYXB 1W25A 1N54B 2V4JA 3M8YA 4K59A 2ADBA 3KK1A 1PILA 2MLXA 3CDAA 4OX8A 1Z4UA 1T3OA 4G1QB 3QATA 1GEHA 4OZ1A 4P6QA 2P6SA 5ETVA 2MTLA 4DSLA 1UCNA 3NMAA 1IXKA 4DX6A 4JYAF 2VASA 1N33F 1DTTA 2V4RA 2EK1A 2EG2A 5EUHA 3KWMA 3RW7A 3GILA 5GMKa 3EE3A 2B6AB 4HDGA 2LKZA 5KT3A 2KM8C 2C2DA 4BS2A 4BBYA 3N6NA 2FLOA 3PR5B 2DNGA 1RB0A 3GZ7A 4LQ9A 4NLXA 4DN0A 2QFJA 4C98A 3RB0A 1L3UA 2V8DA 1NPPA 2MGZB 2VPYB 2YX7A 1QAJA 4JI4J 2IYGA 3R9LA 1KRPA 2N3LA 4ED4A 1QJHA 1LV5A 3IO1A 4YN3B 4YR2A 4KSEB 2XWYA 3EICA 3MECA 1KC8T 2FVRA 2R2SA 3TOQA 2ZJPQ 2X51A 4OYPA 1X4BA 2LQ5A 4CRJA 3NXZA 3LPEA 3DOKA 4OJGA 2CPXA 4WU3A 4ZLLA 3QRPA 5C2CA 2V2VA 4ED7A 5MAOA 3KHHA 2B6AA 4J5OA 1OYEA 1S6QB 3DRXA 3R27A 1BWVA 3N01A 4G65A 3GIKA 4CLPA 3CD6S 1S99A 2EFVA 4ED0A 1U1PA 2B4UA 4CYUA 4WFAQ 2VBWA 4HHUA 4A8XA 3FEYB 1HBUB 4ZPAA 1X5SA 5DETA 1SH0A 4GKKF 3I0RB 3QAEA 4NEZA 3DHXA 3SXLA 3GWCA 4WP3A 4DCOB 3QGIA 1EHWA 3ILOA 2MZ1A 4PYDA 3OSPA 3ETOA 1Q82T 3DOKB 3FBBA 4LMZA 1Y4ZB 3R1HA 1WTBA 1REGX 1C0UA 3OVSA 1WKLA 4CZCA 4MT1A 3KLEA 2GHWA 1H72C 3CCES 2J0SD 4LFAF 3DI6B 1VLYA 5F9NA 1DRZA 2HBQB 3MR7A 3Q83A 3NOGA 3R97A 3H5XA 3HVRA 3HVAA 3TAMA 3KK1B 1UMJA 3NGKA 3GTYX 1SCJB 2IMOA 4DUTA 3QT5A 4USMA 4LF6F 4K4SA 3PW2A 4S0MA 5GAGI 5L9XA 4C4WA 2UZAA 3R5DA 3HFKA 2EKYA 1NK5A 1BQNB 3G87A 3RRKA 1AUDA 4PKDB 2OFHX 2HLTA 4ATNA 2CZ4A 5T7LA 5BXIA 3IR5B 1FE4A 3VAJA 3OT9A 4U8VA 4DL2A 1N48A 4AXIA 2DHHA 2FZCB 2C3PA 2LVWA 2PC6A 4KFBA 3J7AN 4F02A 4I6AA 1AW0A 2AYEA 2DO0A 4I68A 3IRWP 1KTVA 3GSDA 4LRAA 1PC5A 2JEIA 2MKSA 4QJVA 5J1EA 3G8QA 4MAKA 1SVDA 2MQ8A 2HVDA 2BJDA 1CJKA 2QZ8A 4O44B 4JI5F 1RLCL 2FHJD 4EBEA 4UUXA 4JV1A 3OLAA 2F4FA 1R0BG 1RCOB 3OFGA 3POTA 1YLXA 4L76A 5BR8J 3MURP 2R8HA 2BOPA 2J0QD 2OPSA 2UUTA 4EGLA 2Z2YB 2PT0A 2JJ4D 2ZM6F 4F3MA 1FXDA 3OR2B 2GVZA 3DOLB 4B3TF 2P9GA 2MB0B 3LW5C 4QWBA 1SUQA 1H2TZ 1H7XA 4F4ZA 1HQ2A 2XSFA 3HSZA 5ETNA 4B3OA 1HD1A 2FDNA 4OX9F 2XWXA 1X9SA 4JB8B 3SV3A 4DLEA 5KFSA 1HWIA 2MMYA 1FT8A 1GFWB 2HRUA 1CS4B 2WB1D 2VKZG 4M8LA 3UCGA 4EWTA 5BR8F 1ZPWX 3PX4A 2M5YA 2XEXA 2ASLA 2DIUA 2J6SA 3TX0A 1M5PC 3LA0A 2LQBA 2IM1A 2L9NA 1T9WA 3AD9C 3HX9A 3JQMA 1JLFB 2VG6B 4KC5A 2N7CA 3DYAB 3PRBA 1S1UA 3J7YU 1DTQB 2FVQA 4DR6J 2KG0A 1EETA 3DRRA 3OFEA 4FVCA 5DLGA 4TKTA 2UU9J 1WORA 3R5JB 1RUSA 3LP0A 1R8HA 2OPRA 2WSEC 3K7RA 4IYQA 1UA0A 1TR0A 4I67A 1FWPA 5KFFA 1Q78A 1UWBA 2BACA 1J5OB 2QLFB 2XMUA 3FRZA 4ZLNA 1XEZA 1BD6A 1LK5A 1WNEA 5B0DA 3TZZA 2BKNA 3EGZA 1NDLA 2ZVSA 4DPUA 2Q79A 3EVWA 4I6YA 3OXLA 2HYIB 2GA7A 4U7CA 4QWDA 1TL3A 1RKJA 1V3RA 1NLKL 1WOOA 3PV8A 2A2DA 5KFHA 4FNIA 1RWKB 2P6TA 2G0IA 1T02A 4ZVGA 3K5LA 4J9LA 2XMVA 2JLFA 1VC6A 3I5CA 3MEKA 2UVVA 1R3NA 3UE2A 1H38A 4OYIA 2N4CA 1WC6A 3D0HE 2XB2D 4QQBA 1X0PA 1QTMA 1Y3KA 1DLOB 2CVIA 2HLUA 2HVIA 2WAQD 2P5VA 3BBBA 5K20B 2GCFA 1K1SA 2XHWA 3DOMA 3M05A 5DZ6A 3PX6A 3RAQA 4C8KA 2BE9B 5KG6A 4RUHA 5HMWA 5HVHA 3QFWA 4QW9A 1LXNA 1VC0A 3JYTA 3VGTA 2KN4A 1S1WB 4B3SJ 2DXEA 1FWKA 1U6FA 3CO9A 3G82A 1U26A 3BN4A 3HT0A 4HI2A 3AT1B 5DGAA 1WKJA 2KZZA 4F36A 1FI4A 2FHKA 3CCSS 2Y1IA 4ICLB 2EFNA 1S97A 2Z57B 3PO4A 1UJ4A 2C3MA 1KQFB 3OJSA 2HHXA 1UVMA 2E1MC 2C2EA 1FE0A 4DFMA 5F8LA 4PG6A 3IGVA 2CJYB 1CS4A 3MEGA 2VQEJ 4DHVA 5A8WA 2ATLA 3NGUA 1JLAA 3M6WA 2CQPA 1HHTP 1ITPA 5HQMA 4B9UA 2APOA 3NCPA 1R89A 1LXJA 2ZBCA 2XMJA 1FRLA 1Z1ZA 3QYYA 3GJRB 3DRYA 2EKNA 4WZQA 4WKRA 1WF1A 1U0SA 2K06A 1IR1A 3AXKA 3NWRA 1PJ5A 3UVJA 3WZ0A 4KB7A 3PW0A 1GTHA 2ZKTA 1GT8A 2EBEA 1IKXB 3O2IA 1TMMA 2BJ8A 4KGVB 4OJ1A 1TAQA 4C11B 1S0NA 2HHQA 3MMCA 1FTRA 3H5SA 1N5TA 4TYAA 5A8WB 3BV8A 1GNKA 1RT3A 2K1RA 2ZNZA 2DVIA 3M8QA 3BO3A 1UZHA 3MXHP 3I31A 4LF6J 3KLGA 2DNNA 4ZP7A 5I3UB 1I1GA 3DFEA 1K9MT 3VVUA 4NXMF 2DCLA 3FCHA 1FWLA 3R5AA 5CCMA 3BO4A 2OSRA 3ZZ0A 3V81A 3S1TA 4DWIA 1S6PB 5L38A 1YI2S 4M95A 5CYMA 2FHMA 3W65A 4F2RA 3B6BA 3ZZYA 1DLOA 2MEWA 3X3UA 1HR0F 2MY8A 1X8DA 2CZ9A 3WX4A 4OYWA 2YNIA 1UFKA 2V50A 4DUYF 2FJAB 4PQUB 4LRBA 2KRRA 3SFUA 4QPTA 1Y7PA 2DGUA 2M0GB 3OSNA 1VQ6S 3KDOA 4H4MB 4DV7J 3I0SB 1MWYA 1NRKA 1S0MA 1N33J 1RWUA 4OYBA 5HBMB 1KS2A 4TLQA 2I8EA 3GV8B 1QAYA 1UFLA 2AJ2A 2OO4A 3PRVA 4DSEA 4KPCA 5L1IA 2WK4A 2V2QA 3M1VB 4DEZA 1Q53A 4RW7B 3T5LA 4JI8J 3EXCX 3GFHA 5KFTA 1A7GE 5A2QY 3CJKA 2W2NP 1FVSA 1SQFA 4LFCJ 5HL7Q 2XMMA 4RU2A 1JQGA 3KUEA 3AY0A 5GMEA 4ZJOA 3EMTA 3QMQA 4WCEQ 4A8SA 1DFDA 3MEEB 1FKPA 2UXCJ 3WBZA 7FDRA 4NLTA 4XIUA 1KDNA 1PAEX 1RP5A 1I5OB 1WHVA 1NSAA 1WJ9A 1OQ6A 5D77A 2SXLA 3M8RA 1T7PA 4I56A 4R25A 1PO6A 4C3KA 3DLEB 4C97A 2XY6A 5IV4A 1VQKS 4B3RF 2D69A 3FBCA 4BWJA 4DQQA 1UEUA 4NA3A 4RW7A 2EW9A 4WYLA 1Q8BA 4C11A 5L9NA 3I9ZA 3IG1B 4PPDA 1KBRA 1JLQB 2A6MA 2J9EA 1HQUB 2VFTA 2W4PA 2NYHA 3H0PA 3KJNB 3UD3P 2VIHA 4PWWA 3K2YA 4RJVA 3M32B 3A8EA 1U6ZA 4C8NA 2XQCA 1OSDA 4ECZA 4CQ1A 2FC9A 5G0RB 2KTQA 1HNZJ 2GMHA 2GNKA 5AXKA 4QCLA 2KM8B 2ZH2A 4EZ6A 5IC4B 2UP1A 4I7FB 2GW8A 4FS2A 4P52A 4ZLPA 2EEYA 3B4DA 4URQU 1UVNA 4U9RA 2RUGA 4XK8C 2DNYA 2WOMA 2IJNA 5CH7B 2CXEA 3CJRA 3I96A 1XWLA 3K89A 3QIPB 3ZTSA 3MFIA 5ETTA 5D78A 4KY3A 4UOGA 3G9CA 1UVKA 2VFVA 2DJWA 2YNGA 1RAIB 1RT4B 1RT7B 1RI7A 1C0TB 1YBAA 3O44A 3GB0A 4OZNA 3R8YA 3VTIA 1S72S 2KFYA 1M5VC 1AYEA 5HMYA 1VJQA 1LW0A 2M8HA 2MZRA 4L73A 5KFKA 3TW0A 2NXUA 5CAAA 2G9OA 4I7FA 2HG4A 1M5OC 4IG3B 1S77D 3AQPA 1X4CA 4DXLA 1RGVA 2WOMB 4QU7A 3ZZRA 2O01C 1F9EB 4DU8A 4YOEA 4QPXA 2V4QA 2PFFB 5LXYA 3KJVB 1F9FA 1FDNA 3CJKB 2E9RX 3DU5A 3T9NA 2OP5A 1N5YA 3J7Z5 4DQPA 4PRFA 4DR3J 2VFUA 4IG0B 4OI2A 1H74A 4I0WA 3AD8C 4MKYA 4K4VA 1HBMA 2AJ1A 3KLVA 5DS7A 3GIJA 3E51A 1RAJA 1RWNB 5KG4A 3C19A 3MCOA 5CYQB 3VAFA 4HACA 4ZHRA 2GIFA 2HWIA 5KFPA 2JSXA 4MMOA 1TK5A 4ZCMA 3UDEA 1S9GA 2N4DA 1T95A 4DU7A 1LWFA 3GCXP 3VAMA 4DUZJ 2DGSA 3CMQA 2IIHA 4J9SA 2P8IA 4RW6A 5A6PA 2VG7A 1U2FA 3KG0A 2HIYA 5LSLA 3OR1B 2ZEJA 2H5IB 2PA3A 1Q5YA 3IAM9 1B7FA 2OTLS 1OYDA 1EQ0A 1OPIA 3VALA 4KKOA 3A1YG 2QMUB 1E6VB 3GR1A 2DR8A 4JV5F 2I9SA 4LF4J 2V2ZA 1O8BA 2HRTA 1D8ZA 2VUGA 4X4QA 4MTPA 3Q8PB 2MKYA 4N76A 2CNOB 4OL8A 4WBFA 3T5KA 1O51A 3QIPA 2ADCA 4IUFA 1ZM3A 4MYUA 4Y2CA 1APSA 5HK4A 1FNMA 4NOHA 1SL2A 1J5EF 3PKMA 1X4HA 3IC1A 1VISA 2ZVIA 3N5BA 4FDFA 4UQTA 3J80U 1NAQA 2HKEA 1S9FA 3HVWA 2Y0BB 1B64A 3AXMA 1FK9B 4TNOA 2Y1JA 1JLCB 3P96A 2PSZA 3I9V9 3GJSB 1CQNA 1UTAA 3EVMA 4OQJA 5A2QU 3D1HA 2FB0A 2GFFA 3K5NA 1KNZA 5LL6d 2HNYA 2XI2A 3DRSB 4KGXB 3SSSA 3THPA 4J37A 4DL0C 5FJ4A 4PWDB 3DLKA 4X62F 2XCPA 1Q8KA 3FDSA 1OO0B 4GC6A 1W2BR 5KFNA 2XC9A 2IAJA 3ILJA 3THVA 4A8YA 2U2FA 4DS5A 4GKJF 1Q4RA 3HHLD 2VKRA 4B3RJ 1ACMB 2ABYA 3I6PA 4YQWA 4K2JA 3CGIA 4U95A 4FS1A 1WACA 2DEIA 3CJ8A 3GJQB 4BHQA 3TVZA 3CC4S 1P1LA 4RW8B 1S79A 3W3SA 3DLLQ 4LFBF 2AJQA 2IA0A 3DRSA 3SBMA 2V6AA 3C14A 1NJZA 4DX8H 2KXHA 3SQGB 3G8TA 1H2UX 2XTJP 5E2QA 2B5JA 4K4XA 3FMBA 2RDDA 4IQXA 3OL6A 3MZIA 4OYOA 3R5GA 2VQFF 3ET6B 3MTJA 2K3KA 3T9ZA 4O3SA 3QRRA 3IS9B 1KLMA 3U27A 4DV5F 3DLBA 3LWLA 2OIHA 4N41A 3BSCA 4DR7F 1XK8A 2W2OP 2N82B 5KT5A 2B4PA 2HK2A 4ZVEA 1H0HB 3DLJA 3G86A 3KK2B 3CB4A 1NSKL 4LBHA 4ZA1A 1HR0J 1F2GA 3HZEA 5KFBA 1HNVA 1HMVA 3A12A 3OXFA 1QDUB 1S9EA 3DXBA 4WJBA 4O4RA 4X66F 1LW2B 2EK6A 3CD5A 3OTOJ 3FSIA 2A3JA 3DM2A 3HSGA 2ZBIA 1KHWA 4JI0F 3P5BP 4L74A 3M9OB 4LF9J 2YWGA 4Y00A 2W8LA 2YTCA 3TR5A 4FF2A 1FK9A 5GAHU 3A3PB 1HBOA 2PMHA 3FVYA 4U8YA 1YHQS 1IBCB 4Z7YA 2QX0A 5HI7A 1KEKA 1R6YA 1GQEA 2HNYB 4D3HA 1ZZNA 1DQ9A 1YRXA 4RLEA 3O1LA 2LP4A 2AKWB 1B7YB 2ZHBA 2KI2A 3KLHB 3P45B 1BHNA 3CVKA 3JQJA 1YKWA 4A46A 1Q7LB 2DH9A 2YVSA 3HHLC 4G1PA 3QNWB 4MIBA 4Y65A 3D67A 4PR6A 1B0VA 4LSLA 4X4TA 5LT5A 5KFLA 3ZXWA 5D3GB 4AD6A 2BANB 5DO2A 3UO0A 1HW9A 1NJYA 4GC7A 4K50A 2KFZA 3WIUA 4DV4J 4QYZJ 1F5BA 3IBFB 4NLWA 3M6VA 4DQIA 3HJFA 1BY9A 4O0IA 3OUYA 1NKCA 1HWUA 3RU0A 2Z0GA 3QJLA 2N7YA 5H9EJ 2W7PA 3EJMA 2W1BA 4QIGA 4XTTA 5ETQA 4LIRA 3Q8VA 1T94A 4DJBA 2VQEF 2RILA 3RBDA 1S1TB 1CJTA 1XMOJ 1VGYA 5E3PA 5K9FA 2O66A 1UPMB 2I1RA 5D6GA 4OX6A 1ZYQA 4B3MF 4K4UA 1LOUA 1Q79A 1LKZA 3BBCA 3DRPA 3E8OA 3K5PA 3O3LA 4FN5A 1BXNA 1CPZA 1SJFA 1KLMB 2CDRB 2DKOB 4KT0C 4B02A 4HYKA 1QM9A 3H2LA 2HQ3A 3JSYA 3BGFA 4AE5A 1P27B 4TU9A 3HM9A 3EYZA 3PVXA 2ROGA 2L9WA 4ZIWA 1YDLA 1Y5NB 2A18A 1EAYC 2KKHA 5DDQC 1HNVB 3K17A 1HNWJ 1AT1B 2W4DA 1NSQA 3CO0P 3RB6A 1S1TA 1Z2LA 1LW2A 2GMLA 2AYMA 3PDNA 3C2PA 2VA3A 2FJXA 2I5JA 3QZ8A 2E5GA 2YKAA 4CLZA 1NZAA 3NS5A 1SKRA 2YQ3A 2D41A 3GCWP 5A0YB 2DHSA 4M63A 1H6KX 1WC4A 2P9EA 7FD1A 1VQYA 4TVAB 2OHDA 4NZ7A 4ZVPB 1XERA 5KT6A 5F8MA 1CJKB 3A8IA 3BKFA 5E7OB 3CD0A 4ZVSB 5F3ZA 2QYCA 2Y1LB 4DG1B 4F3OA 4OHWA 2WRMA 2YKPA 1R8CA 1HQEB 1UJ5A 1AFIA 1M1KT 3TVYA 2R4FA 3SMZA 1BGXT 2MPUA 3D6MB 5DLFA 5F8IA 4YR3A 3TQEA 2HGLA 5I3QA 3BGUA 4HI1A 2GVZB 3DOLA 4N5SA 3RGIA 5HN0A 4DQRA 4K4WA 1NUEA 1SUQB 2GV1A 2V67A 3TJ8A 5CYJA 2CNLB 3SSQA 4NL5A 4ED8A 4K0KJ 4UF4A 2UXDJ 2OLWA 3JTOA 3SDEB 5C2GA 2HHTA 2YY3A 2AT1B 5KG2A 4IH7A 5LSRA 2Y9HA 1D8YA 3ZNJ1 2QL9B 2HBYB 5B0CA 1ZTWA 2XM3A 2RS8A 1JJHA 1R8PA 1ZZFA 3ENWA 4USWA 2Q3PA 3BPSP 3DYAA 5T7LB 4YY3F 3K58A 5GMDA 5DJBA 2PIIA 2MQPA 1R6VA 1EETB 2C3OA 5GVQA 2MKCA 5EHHA 4DV3F 1X4AA 2B7BB 1YJ9S 3IWXA 2DH7A 4RWWA 5I42B 1FRXA 2XO6A 1FFGB 5GADI 1FJGF 2ACMA 3DRPB 3DNCA 4CO4A 3CT9A 2GAHC 1HBUA 1WDDA 3SCJE 2L41A 3GQCA 2X7IA 2YX4A 1R0AB 2UUCJ 2YKNA 3KXDA 2C2ZB 2UXBF 2ZZTA 1MMLA 4OHVA 1VQ8S 4B9LA 1B4SA 2J9DA 2L3MA 2DRAA 2F4VF 2NYIA 4LR9A 3W64A 4K8RA 3JAMU 4KBIA 1ZPVA 2JC1A 4JI5J 2MKJA 1EIYB 4JI3F 2L08A 3L7UA 3VR1A 2IRUA 4CO2A 3FSYA 2BX6A 2AV5A 2W01A 1J2VA 2VICA 4X4PA 3O8WA 2J0WA 1UAWA 3T1YF 3A4TA 1QY7A 2DCUB 3EUNA 3NP5A 2XMAA 2H51B 3R7NB 3D6FB 4ED6A 4QYZK 5IS2A 1VFJA 1XTZA 2WZ1A 3NNHA 2AW0A 2YKNB 3K8WA 5E0OA 3CDUA 1VDHA 1B0PA 2CPZA 5K8OA 3OLBA 3CF5Q 4JV0A 4KGKA 4A8KA 2XNRA 1P8GA 1UWAA 3L09A 1RAAB 1C1BB 3RB3A 4UT4A 2VODA 2AIRB 2VJVA 4OMFG 5KFGA 1YJTA 2HQFA 2DRDA 2XNQA 2YWKA 3R7SB 3SCIE 1BC6A 3IWNC 1J27A 1FRKA 2KDOA 3BGLA 1S6QA 3PG9A 4LSZB 4JI8F 1RWMB 1U7LA 4DSJA 2YQ1A 5HSPA 2ZC4A 4OZ2A 1QAIA 1GTEA 1Q95G 2XI3A 4D3GA 2BQRA 2RVJA 1T03A 2AHOB 2EXUA 4HVZA 4NMXA 1XMQF 5D4OA 1JXEA 2DHAA 3GIMA 5DM7Q 3I4HX 5E3QA 4RL1A 2DY1A 1GMWD 1NNDA 3IM8A 1U1LA 2XZTB 1SJRA 4RNFA 2KRBA 1AROP 2HNZB 2VF3A 3ZTOA 1NBEB 5F0UA 1N32F 3I5AA 2BUNA 1QVFR 2M88A 2CQ3A 2R8JA 2AP6A 2LA4A 2MZSA 4LT6A 4LREA 3CCRS 2MHNA 3M4XA 1RQ0A 2YQ0A 3MCMA 1UETA 5K8PA 5DM6Q 1GMVA 2QSFA 4WIIA 2VOOA 1RT5A 4JI2F 1KLNA 2DEJA 1T9TA 5DQGA 4OZLA 1H73A 1WHWA 1NM2A 2B0GA 2BJ9A 3GONA 3TAQA 1HA1A 2BRKA 4AXJA 1Q0NA 4LJMA 4CLLA 5B0BA 4ECRA 1SC4B 2FGOA 1NEEA 4O0NA 1SH2A 2DYAA 1LFPA 5KG3A 2CG8A 3GU0A 3KKFA 4NRUA 2XYPB 4OZJA 1TP7A 1R27B 2FZKB 2KJWA 1K0VA 1S1WA 2R3VA 1DTQA 2E66A 5JUMA 5HROA 1QSSA 4DR4J 1BLUA 1FA0A 1AB8A 3D5MA 2XLJA 4J9MA 1OMSA 2QIFA 1NKBA 4ICLA 1MROB 1S7IA 4USJC 1YWXA 4ELTA 1QTNB 4I2QB 5A8RB 3KUHA 2H5EA 3GV7B 4LBIA 3H2VE 4RNMA 1HKAA 2J9CA 2F9JA 2UVUA 1C4AA 3C3LA 5E3CA 5AXLA 3F56A 4MKBA 1FDDA 2F40A 4NLSA 3EVOA 1LQ9A 4MH8A 2ROEA 4JYAJ 4DZ6A 3BDPA 5CABA 3G4SS 3LP1A 2MQOA 4LSNA 2WBRA 5D0GA 3HSDA 1RHRB 1WHXA 5LM7E 4FF4A 1VRQC 5HJXA 3SQOP 2VJUA 4MFBB 4RUBA 3TI0A 2P2CB 1BE4A 3NAIA 1WEZA 3JQKA 5CA5A 3MMBA 1TUGB 1N32J 3AODA 1VHIA 4RW4A 4KO0B 1GAOA 2AEMA 3UR0A 3PEJA 1GH8A 5HMXA 4DQSA 2RF2B 1RISA 2MQNA 2FGCA 1SBRA 2HNZA 3N28A 1RJJA 1WELA 2RKIB 1S1UB 2GX8A 1SC3B 4YUDA 3Q8UA 1EB0A 2ZWOA 3LAKA 4LSNB 1EP4A 1S59A 4P10A 1UW4A 4ZN1A 5MLCV 1AXQA 2LQ8A 4DR5F 4RUCA 4RNOA 3C6UA 1FRJA 2O3DA 5CYMB 2IM3A 3C6TB 3NY0A 4ERDA 2WVDA 5DQIA 2DNRA 5HANA 3W9HA 1VK8A 1TKXB 2ILZA 1CSJA 3A3OB 4I1TA 4KH0B 3BB5A 2UUBF 3HHNB 5FLXU 3HXMA 3UN5A 1TL3B 3MUTP 1RTZA 3NOCA 2YNHB 2IA6A 1RTIA 3RAXA 5A8KA 2JNJA 1T05A 3EM1A 4USTA 4NYZA 5E5NA 5KG1A 1Y5IB 3KLIA 2EC0A 4RU9A 1PJ6A 2HWHA 2MSSA 3OTBA 4IDKA 4ZDNA 2UU9F 2XCAA 3CDWA 2NUUG 4MYTA 1WEXA 1UKUA 3U1LA 4LF7J 3C16B 3SCKE 2ZHAA 3MEEA 1HW8A 1KTQA 2D9OA 1RADB 4R8UB 5KFMA 1VQOS 1S57A 4C3LA 5I3UA 3G82B 1K8AT 2VPWB 2NZ4A 3MAQA 3IGNA 3W2WB 1MWQA 3KG1A 3KLIB 4MFBA 3V81B 2AGQA 2HVEA 3HHEA 4WU2A 5GAGU 3DXSX 2DR9A 2R8KA 2MLZA 3BBFA 2CJQA 2H65B 2ZOGA 3B4MA 2MZQA 1VLOA 4ANDA 2H9ZA 3CCJS 1HPZB 5JVHQ 3UW1A 2B56A 5KFQA 2RF2A 2FLNA 1JLAB 3OL9A 1VQSA 2YNIB 4MK9A 1V6HA 2HQGA 5K14A 2IFXA 3FC9A 4YR0A 2PEBA 4DFKA 4NRTA 1L3VA 3C66A 4ZP8A 4CLFA 1I94J 3UNYA 1MU2A 1U45A 1MLAA 5GAEI 2F3JA 2D74B 5CYQA 4LF5J 1RLDA 1HWJA 4I2PA 4PXBA 1NHKL 4USHA 5HBMA 4LF9F 3UVJB 2VA2A 2C42A 2QEXS 2KG1A 1TAUA 1IBMF 2RH3A 1ZAVA 1JWWA 3R7BB 1RXOB 5EX0A 2QYGA 4X84A 1WWHA 3QO9B 1M5KC 3G71S 4F0HA 1TKZB 2FZGB 4G6VB 1SJ1A 2L48A 2WVCA 3CCWA 3C46A 5F8NA 1URRA 3KUGA 3OTCA 1FRIA 2AJFE 1DJ0A 2X1GA 3AQOA 1R8BA 4C7QA 1YZ7A 3M2VB 1IUJA 2XG8A 4I2PB 2BJ1A 3CEDA 4DL4A 1ZTTA 1IM4A 4LF8J 2G0CA 4IG3A 1SKUB 3D3CJ 2ZH1A 5D0RA 2LDIA 1K44A 3FRYA 3LO3A 4PXCA 1ZETA 2XY7A 1F5CA 1QAXA 1SQEA 2AX1A 2ZD1B 4NYOA 3IBCB 3KJVA 1WF0A 3P3DA 2R7OA 4TQRA 1FVQA 4C8OA 3FEZA 2NR0A 6FDRA 1NJWA 4Z2XA 4P74A 4DBQA 5IXUA 3OL8A 3I0SA 1VQ7S 4GKKJ 1WD6A 1CLFA 4NCGB 1RHMB 4H4KA 2IVFB 3OJUA 4Q8FA 1TL1A 3QLHA 4KJIA 2WONB 5DQHA 2R7RA 4DV2F 2IBKA 4Y2AA 3MPWA 1HPZA 4JBCA 5AJ3F 4CO3A 3JSMA 2QG9B 3W9JA 3M30A 2YNGB 2FYXA 4CM0A 2BYCA 4AUKA 4Q2MA 5K14B 3HFVA 2Y8YA 5J2NA 1U1QA 4PXDA 2AWZA 1RWOB 1TFWA 2M2BA 3IXQA 1PJ7A 2COLA 3NGTA 3WQPA 5IM0B 3W9IA 4NLOA 2MZTA 3VAKA 2WHOA 1S6OA 2VHGA 2R7SA 3RBEA 4ZVHA 4X4VA 2GZOA 3PYDA 3E3XA 4NA2A 2C2RA 1SL0A 2IBOA 1U1MA 1JLQA 1SKSA 3TVKA 2PI5A 1HWLA 3TUZC 3R5CA 1IJFB 4CLKA 2POKA 2GVDA 2C3YA 3W8PA 2OEKA 2ZOMA 4KIAA 3UDVA 2RQCA 2BM1A 2AU0A 3SCLE 2ZZNA 1N52B 4EYHB 3DKDA 2BM0A 4TU7A 2HHUA 2A2CA 3RRGA 2VOPA 2ZFHA 2K2PA 3H90A 3M8PA 5BYSA 1QLNA 4NLRA 3DDIA 4DV1J 3R2DJ 1S9GB 3UWTA 2VDIA 3TEGA 3H7HB 1G1XA 3FSXA 4LF7F 2EVZA 4WK1A 5C5JA 2O5DA 2OMOA 1IBKF 3UCZP 2FY8A 1PGZA 3TUIC 1NPKA 2E5JA 2FVSA 1NK4A 1SI9A 4PPZA 2M4MA 3R6LB 1ZH5A 3HI9A 5M2UA 2N3OA 1A0OB 3ADAC 5EX3A 4UOFA 4FXVA 1DZ5A 3M8WA 2DNZA 4TXSA 3IMQJ 1L3SA 3K5OA 4ZCLA 1RABB 2DNKA 2IVMA 1YJWS 1NK8A 2RE1A 2V8GA 3FFIB 2GIRA 3M8PB 4NCGA 4USUA 5BJRA 4FPRA 1UA1A 3TZXA 3TZWA 2G0JA 3BSNA 4O23A 4QYRA 3OTEA 4V19X 1OIAA 3IR7B 1TL1B 3QLHB 4M5MA 3CIZA 4YDXA 5DG7A 2R2TA 1I6JA 3X1LB 3N0VA 4TU8A 4ED2A 2OGUA 2LECA 1YX2A 3BKTA 5DZ7A 1Q8LA 2Z2ZA 4O3OA 3JSMB 3L3CA 4C8YA 4URSA 3MF5A 3MCSA 2M9KA 4NX9A 1FNXH 2O1PA 1NDKA 3ZTPA 4Y28C 3JB9k 4HACB 2DIVA 4ID8A 4UZCA 3ZC4A 1JNRB 3FFIA 1F0XA 2EPIA 3SIPB 3ZZOA 2G13A 4FBTA 1F1BB 3D6TB 3DCAA 2ZH5A 1IM6A 3DLKB 2HHHF 2B7CB 1N88A 2CA9A 1T0TV 2OEJA 3CE8A 3G6YA 1TFYA 5G4DA 1S1XA 3AA9A 1NMEB 2JZ5A 3QT7A 1T9XA 4ZVTB 1ZBTA 2WBMA 3PM9A 4C0OC 4N8OA 3O6QA 2MKKA 1RAHB 3DC2A 3BEGB 4EBDA 2Z4PA 4KH1B 2MQLA 3TUPA 2DBBA 3D54A 3W66A 5HVGA 3PIOQ 2AYBA 3ILIA 3ITHA 1NK6A 1VC5A 1FX4A 1UW9A 2JLEA 5FDLB 4AFFA 2OJ3A 1VK3A 2AX0A 3QJPA 4ZIVA 3GYNA 3L4BC 2CQ0A 4ELUA 1KP6A 1YQHA 1B3TA 3AHPA 4A8MP 3C15A 2DTJA 3WDOA 4KHRA 2F8HA 4QOTA 4NPOA 1Y3JA 1RAGB 2HFOA 3I87A 4WPAA 4IH5A 4NMLA 3H8YA 2V5HG 4NLDA 2UVWA 1CC8A 1VJWA 3BS9A 1D09B 2H54B 3LOUA 4WE1B 5HMZA 5AE2A 2HS3A 1PYOB 2FC8A 2GJ2A 3DMJB 4LRFA 1YTYA 2DPJA 1PIEA 4X65F 2ZC3A 2LEBA 5J2QB 4Y2IA 3CJ2A 2OD6A 5ETKA 4AL7A 1I3OB 1CQMA 1FRMA 3KK3B 4W4MA 4ES3A 1DQAA 2AYGA 2RQ4A 2DGVA 3CJ3A 4IR9A 1S5ZA 3GPAA 5L1LA 2IPOB 2HAFA 2DR5A 1JLEA 1F3FA 1UPPA 2PEHA 4NZ6A 1TQLA 4OFZA 4RW9A 4ZVFA 2DPIA 1RU2A 4A47A 3R3TA 5JJBA 4Q8EA 4FF3A 1IR2A 2CYYA 1NHUA 2KYXA 4QW8A 2C2MB 1VBYA 1YBTA 4V19J 3TYTA 1HD0A 2LMIA 5KFDA 2IJRA 3WX8A 1C0UB 5KAKA 3KTQA 2FJDB 1TMJA 1MN9A 3MR3A 1OSCA 3K59A 2VBXA 4MK8A 3DI6A 5D0EA 1R31A 3I55S 3KK3A 1U1KA 5CXTA 3G96A 3LTOA 1JJ2R 1TU0B 5ETRA 3DU6A 5KOXA 1VQNS 1U47A 1A6LA 2LXIA 3M2UB 4I64A 1RZMA 2HZAA 5EWFA 1REVB 2MJNA 3PJXA 2MGZA 2V8VA 5A0YA 4F4XA 2G4BA 1LWEB 1WUUA 4RW9B 1BQXA 4ETXA 1Q16B 5L46A 4A48A 3MECB 4USKA 5KT4A 5C24A 4B9MA 5D15A 1FXRA 1KONA 1U8WA 2E5LJ 4ELVA 1HI1A 4ZP9A 2DR7A 1M5SA 2FPHX 1YJUA 1C1CB 2WB4A 2WVFA 3MHYA 3QGHA 4IH6A 3ZTRA 1H3DA 3I5BA 4OJ3A 4O3PA 4DX7A 1KHVA 2F7VA 2PA8D 2M7SA 1BQMA 4O4GA 3MTKA 3EZOA 3UFCX 5HP1B 4NLYA 2BEFA 2RRBA 2DY9A 3DM2B 3H2UB 1SB6A 4HKQA 2F8MA 2B43A 5ITHA 3H40A 2B9XA 1NPRA 3PO5A 2XGQA 2HAIA 3HULA 1NU4A 1VIXA 4P72A 2FUG9 3TWZA 2RAQA 2HFZA 4P7VA 2RRAA 5KFWA 4OI3A 5LOQA 4K4TA 2VU5A 3GE9A 2Z2LA 3D3BJ 3MUMP 4FYWB 1U1OA 1I51B 4ID5A 2Y8WA 2AEFA 5ETMA 4QR2A 4FYDA 2QLWA 2OPSB 4OYMA 2FJVA 5IWAF 2FHOB 2K7KA 3FQKA 4ITSA 2CQBA 3OR2A 3IRXB 4CO0A 4QIWD 2UUAJ 3MPYA 4HLBA 3D0IE 4B3OB 1EJ7L 5C42B 1PYTA 1HBNA 2RD5C 2BA9A 2IVYA 3N5FA 3MPVA 2C2OB 1OJ4A 1OQ3A 2H3EB 4LVNP 3MUVP 3NMRA 3W60A 2VFRA 4PCQA 2YWEA 4DG1A 3PFEA 3G8SA 2NSBA 4YB6A 2QGFB 3OBIA 4QZVB 4JI6F 2EI5A 1PSDA 1TVRA 2WVBA 1N0VC 2ASYA 4KRWA 4CTAA 4O3NA 2W9BB 1GMUA 2QC3A 2RT3A 5CZXA 1KFDA 2V4JB 2OPRB 5KFRA 4NWBA 3IWLA 4ZN3A 1X4EA 4WP9A 1KQKA 4CYUB 4F50A 1Q7YT 1I94F 4K0KF 2LLZA 4R0JA 2F4VJ 2G1DA 2BJEA 2D3OR 3I0RA 4GO7X 5CHCB 5IT9U 1FFSB 3TZYA 4B17A 1Q1KA 2Y0SD 1DQ8A 4P75A 4C6AA 4EO6A 3SI8A 1TK8A 1QE1B 5CZVA 1C1BA 1YJRA 2VG5A 2RIJA 3N9UC 1MMDA 2FVPA 4UOCA 3PR4A 4ZPDA 4N77A 1F5AA 2QL7B 3D66A 4YEAA 2XLKA 4QU6A 4M94A 3D6HB 2E44A 2BXJA 1S1VB 2KT5A 5IOLA 1SIWB 2CKWA 4NXNJ 2FHJA 1OPZA 3HF5A 3F44A 4Q0BB 4PG5A 2QA1A 1R0AA 2DXDA 1RSCA 3T1AA 1JLGA 3MM5B 1W7WA 2Z8QA 3DOMB 2MKHA 4OV6A 5AXMA 2QTWA 5C25A 1W26A 2MXYA 3KHLA 3CJ4A 2ZJQQ 4H4OB 3EDQB 3QT8A 2P9CA 5F3TA 1N8RT 2RJZA 1JLFA 1PYSB 2XYGB 2PO4A 4EI2A 1EARA 2B8QA 4F4KA 3TX8A 1XNRJ 4J9QA 4OI4A 4OYXA 1WC0A 3DRRB 3TA1A 3Q2TC 4HT7A 2CQ4A 4ZPTR 1CULB 4OLOA 1FJ7A 3LP0B 1RWWB 4V1Ak 1S1VA 4WFBQ 2ZM6J 2OSQA 3T6JA 3MMBB 3BJYA 3GMGA 4JI7F 4ED3A 1VQPS 2FVCA 4RW4B 5HAOA 3UD4P 2BW7A 2J6UA 2OAUA 2HS0A 2KYZA 1JLGB 3MM5A 4NLPA 1XMBA 1FD2A 2CNNB 4W98A 1VBXA 4TYBA 1SKWA 1CC7A 4NLQA 4PZVA 4DX5A 1R7IA 3POTB 1N5QA 4OIXA 1LWXA 1OY9A 2C2KB 2EFPA 3W5XA 5IV3A 1DAXA 4PQAA 3CUNA 2LXFA 1FDBA 1GMWA 1O6XA 1SC6A 5CQGA 2PMZD 4BC7A 5KG5A 4ZP6A 4F67A 3JAMY 3T41A 3RTVA 2NCKL 2PE8A 4ZVOB 5I42A 1M1HA 1TL4A 5B7WA 3TQ1A 1XIQA 2DR6A 3AB4B 3RR8A 4ZCIA 2HIQA 1ICEB 4IO9Q 3FCWA 3PYFA 4OHXA 5AE1A 1YZ6A 3IR6B 1SV5A 1RK8A 2GQ2A 2IYIA 1SJQA 1JLBA 2XMTA 3U7JA 2YPYA 3RBZA 2JEFA 1BQNA 2W9CA 1KVJA 1XNRF 1UJ6A 4QR0A 3TRGA 1KFSA 3QRQA 1IQZA 4M5JA 4KFBB 2AD9A 5LMUF 4H4KC 2XBPA 4N47A 3OD2A 2R7WA 1D3WA 3VAIA 3U1NA 2BDPA 3TNVA 3CPWR 1QSLA 1FHTA 2HPUA 3J7ZT 1PBUA 5J2PA 1RA7A 3QFHA 4RX6A 1ZM4A 3EXYA 1JX4A 3HKWA 3CMES 4F2SA 4EUVA 3MEGB 1E6YA 2M3DA 4O44A 2DT9A 2L9DA 1XJWB 2JWNA 4OI6A 5HLFB 4PQUA 1FXLA 3EGNA 3FBFA 3UDLA 3Q8RB 4AYBD 1NH7A 2G2OA 5HROB 4OZ0A 3B8HA 3B78A 5D4NA 3BQ0A 2H4WB 3D9BA 5DG8A 3ELHA 1V9OA 3NLCA 3Q22A 1WHYA 4CP5A 2HHHJ 4J91A 4A8OA 1IWGA 1ZM2A 2R7QA 1UEKA 1N0UA 3AOBA 1VBKA 3GP9A 3MMCB 3MMJA 2X3DA 4KV8A 4MIAA 2RU9A 2FJWA 3Q8YA 2F1FA 2NREA 3DN9A 1G2EA 4UY85 4U7UD 2I0XA 2DO4A 2DHGA 2HQDA 3OVBA 4EU0A 5KFCA 3J81Y 5HLFA 3OVAA 1TK0A 2W7AA 4PAAA 1IKYA 4ZVQB 1NK7A 3KOAA 2XS2A 3UCUP 3GSIA 2E7WA 2IY5B 2ZH3A 2J5AA 3GJTB 2ZZMA 2QN6B 1QUVA 2YNHA 2CAJA 1IKWA 5D0HA 2CVEA 3LGNA 1UZDA 1NJXA 1EX8A 4ZITA 2XMKA 3EZUA 3KLFA 1SIZA 4Q44A 2MHEA 1T9UA 2OMLA 3NAHA 3QPIA 5J2MB 1UWBB 2FLLA 1H7WA 2ZJRQ 3DDNA 3RYLA 4Q5VA 2OI2A 4GVBB 3QT6A 3HLUA 2MQQA 4IRDA 3OHBA 4MIWA 2ZITA 3VGVA 4YP3A 2ZH6A 3RW6A 4DI6A 4WK3A 3TUJC 4ZPBA 4X4OA 3QJJA 1IKYB 1WG1A 2GJIA 2X1FA 1CVJA 2ZE2B 3CSKA 4FXWA 1HARA 4CT8A 3AAWB 2VQFJ 1PCAA 3V4MA 4WKYA 4NYPA 5L1JA 4ECQA 4DL6A 1VIOA 1PBAA 4TY9A 1VOMA 1P9YA 5K5MA 4Y6IA 1FEHA 5KFIA 1NO8A 4PEOA 4CNYA 1PAUB 2LXUA 4OV1A 1G7CB 2J76E 3D28A 4EMDA 3PJWA 2HNDA 4I2QA 5A8RA 3S7RA 3LGHA 1JXLA 3HFZB 4K5RA 1HI0P 1FJGJ 1YG0A 2CWKA 2E1PA 5E41A 1RT3B 1KOOA 2VD3A 1ZAXA 3G2XA 4YDDB 4M5LA 1IWAA 2O67A 1HHSA 1RT7A 1SXLA 1JIHA 2CRLA 2LA6A 3AA8A 2B51A 2GJFA 3ISZA 3UR3C 2W4CA 5KT2A 4NASA 5GADU 1YGYA 2W7OA 4GRSA 4RR5A 3CCLS 3LP1B 1RTIB 1UL3A 1SC1B 4ILLA 2IM2A 2LCWA 3TANA 3WC2A 5IT9Y 1XQIA 4X62J 4JI3J 2V68A 4QIFA 2DNOA 2BABA 4DV0J 4DL3A 2JEJA 2QFIA 2CQCA 1FD8A 3G6XA 2CWXA 2HBZB 4N7TA 1X5TA 4R0EA 5LMUJ 4ECUA 3L7PA 4LF1A 2CPDA 2GC8A 1D9AA 3M30B 2X1AA 4OHYA 5IT4A 1RTJB 3C16A 4P9SA 3ZZPA 1MG7A 3D4JA 2FLPA 4O3RA 4LFBJ 5J1NA 3A3NB 2KXNB 1T9YA 2F8EX 3KDNA 3NL0A 2IJFA 1H98A 3BGRA 3Q0AA 1IKWB 4TLRA 2BOAA 4OX7A 1KD1T 4LR8A 3W2WA 4EBCA 1F6TA 2JVRA 3ZFVA 1IKXA 5BYQA 2UV8A 3W62A 4PUOA 4WYWA 3C6TA 4WTYA 1XC9A 2ALZA 5KG7A 4QWCA 4ER8A 1RHUB 5HO4A 3BSAA 3M7VA 5SUHA 3OR1A 3FJ2A 2Y3YA 4ANCA 4ED5A 1YRUA 4RUAA 4URGA 4BC9A 1TKDA 4XPCA 3HO1A 4X65J 5C7PA 1AZSB 2MJUA 2B4VA 1TTHB 1VS3A 4DPTA 4WZMA 4LF5F 3BGRB 4ILMA 1N36F 3Q89A 1GK8A 2JH3A 2W2QP 2WCXA 2MKIA 4DUZF 1J5EJ 2XYHB 3MM6A 1S6PA 1XR7A 4OJHA 2CNKB 5HQ8A 2DGOA 1CG2A 2LEPA 3CTRA 2HFSA 2CQIA 3EWGA 6AT1B 4DR2F 5ETSA 1VQLS 2ZUAA 3BSOA 4QBUA 1NZ8A 4K7QA 1FNOA 2LU2A 4QR1A 5DDRC 4IG0A 4J9UE 5D4PA 2QA4G 2KVQE 1CBKA 2RDIA 5G0RA 2AGPA 2ZBRA 3UD5A 1YITS 4X2BA 2R9LA 4M5DA 4JUZA 2HMIB 2VBZA 1IKVA 2VV5A 4YHHF 3CD7A 1FF2A 3W1YC 1UVIA 5E33A 2GO8A 4NCBA 2YNFB 5EWEA 3MCNA 5DDOC 5EGYA 3H4BA 1X4FA 1WF2A 2E5IA 2NXEA 2V8PA 2ZD1A 4MKVA 3UN2A 3VGSA 4TQSA 2QA2A 2HQIA 2VG7B 4OZ5A 2Q66A 1N34J 1RAOA 2BMBA 1N5VA 3BQ2A 3LH2S 1F2HA 1WSVA 3DGPB 3G6ES 3N6MA 1FKPB 2VDHA 3IBWA 3ZNUA 3TO8A 3QZ7A 2ZDOA 3T1HF 1XNQJ 3H59A 3MFHA 4K4ZA 1YJ7A 4M5DB 1FKAF 4I6WA 1MU2B 1LW0B 2JFDA 2GGPA 4MK7A 1K73T 3NWGA 4K5SA 1Y0HA 4DPWA 3CCTA 7AT1B 4TY8A 3T1HJ 2Z30B 3TEHB 1TUVA 5JXSA 4ES1A 1U49A 2ZNYA 2I38A 5L1KA 2YNFA 4P2SA 4RZRA 1JKHA 4U67Q 2B5JB 2RSQA 3Q2SC 2E1RA 4Q45A 3L7OA 2AZ1A 1HYSA 1ZOTA 3W8GA 4DV6J 2KVIA 1T11A 1L5UA 1IR0A 3MAHA 1RT6A 4J9VA 3CULA 3LGMA 1FFWB 3IS9A 1Z2ZA 1UP1A 4YHHJ 1AZSA 2OPQA 3MM7B 1SPBP 4DZDA 4Q0BA 3WIVA 3FBEA 3M2RB 4HTJA 3T19A 1DBDA 2JL9A 5F0WA 2YPZA 1FX2A 2YWFA 4AT1B 2NUHA 2QRRA 3J7A1 2CPEA 1PG5B 2WW8A 4XDCA 5B0GA 2X3GA 3MM6B 3HDSA 1LWFB 1LWCB 9RUBA 4USVA 1HMVB 2UUAF 4W90B 1KVKA 1T9VA 1QD1A 2ZH8A 2RUSA 4CLUA 5LSOA 5M2PA 3MR6A 3PCOB 3D0GE 4JOUA 3CNQP 2EBGA 4IOBA 5CD4H 1IBKJ 3BKUA 3DDKA 2ZBPA 3LUYA 2UXCF 3ISND 3FNNA 3QWPA 1G3OA 4ILRA 2DRBA 4C2MA 3AD7C 4Y3CA 3PZPA 3QIDA 4KHPF 4BLGA 5HJYA 2OFGX 1NDPA 5HATA 4LIWA 3OHAA 2CDQA 3NBPA 1B70B 3C14B 1IN0A 4IQMA 5J2QA 1RTHA 3EZ5A 4FPIA 1U09A 2GHVC 3CJ5A 3QGGA 3QWUA 4F4YA 2UVRA 3V6DA 1RWPB 2EFGA 2EWHA 2J9DE 2CFXA 2GS8A 2V2KA 2Y1RI 3BYPA 3TA0A 3HK2A 1WC3A 1OS5A 4P7TA 3E01A 4L75A 3CWJA 2BANA 3GFYA 5J2NB 1A9NB 6FD1A 3MGJA 4O3QA 3W7BA 3BR9A 3HZGA 2FY1A 4DR4F 2BBEA 1BUXA 3UDCA 4C9DA 3MPDA 2AQ4A 1RYRA 3OXGA 3A13A 4CO5A 5JVGQ 2LYVA 3LALA 4OYZA 4U7UK 3MM8A 1FEEA 3SFGA 2IRYA 2W9AA 1VQ5S 1S76D 1GX5A 1OY6A 2NPIA 5H1SV 1BMQB 4DV1F 2MDAA 1U25A 5B0AA 3RBXA 2JEGA 4R5PA 1RT2B 4NXMJ 2R8IA 4HH1A 4I4BA 4BWMA 2GVDB 4ZK7M 2BE7D 4YB7A 4LFAJ 4G1QA 1DY3A 2BE2A 3AB2B 3PX0A 4LF8F 4J9KA 1ULRA 2KO1A 4NZ0A 1FKOA 4ZCKA 2A6OA 1M90T 3MM7A 1VHFA 4HHJA 1Y9OA 4HHHA 4F4AA 2CG4A 2FD2A 2JRSA 3UPFA 4Q43A 4ECWA 5M2RA 2W25A 4PXEA 1T3NA 4IRCA 2FQQB 5B08A 2CPFA 1C1CA 3QAUA 4K4YA 1BWEA 2H48B 1DARA 3KNGA 2XULA 2ZUGA 4F26A 2KFNA 4ZPCA 2ZDPA 1U48A 2HRYA 5I3PA 2IDEA 4CH1A 4IOAQ 4X4SA 3ENAA 4Y34A 3CJQA 5HP1A 3J7YI 4Y0FA 4J7CA 1XMQJ 1JK9B 2ERRA 4RWXA 3ZO7A 2CZVC 1WKKA 3ISNC 4WXWA 2QA4S 4Z7CA 5K8NA 3CCVS 2M8DB 2PFDA 4LSLB 5GAEU 3CC7S 1RBOB 4ECYA 2BJ7A 1N6QA 2Z56B 1JLCA 3VF0B 2EG1A 1FKOB 3GFZA 4WP8A 3V6JA 2RQMA 5IT0A 4YMEA 2BQ3A 1YK9A 3ITHB 5LJ5Y 3H25A 4UTGA 5AXNA 2GHPA 2DGXA 1X31C 3R5BA 1YIJS 4DSKA 2KZMA 2CPIA 2FJEB 1HQEA 1DHMA 2HWTA 3C8YA 2A10A 4JI2J 1RYSA 2F9DA 2CIMA 3OV7A 2WVEA 3DGVA 4ETZA 2DISA 4LQ3A 4LF4F 1XN9A 3I82A 2IAJB 4RKUC 4IRKA 4JV5J 3M2UA 1UEVA 4F8RA 5KFAA 5D8HB 1P9QC 3BDEA 3E01B 1KVIA 1F3VA 2VONA 5C42A 1EZZB 1LWEA 4KTQA 3BO2A 4FXDA 1MSWD 2K8GA 1RWXB 2E7VA 3MM9B 2UV8G 3ZZTA 1JB0C 2E5HA 2DGWA 4C8LA 1S4EA 4A8WA 2PDAA 2E29A 2RRNA 2OH2A 3KJFB 4DL7A 3RAMA 2YWHA 4CH0S 5KFXA 2HK3A 1RCXB 2F63A 3SSRA 3M9MB 2J6TA 2JFKA 4WFXA 4CI0B 3PEHA 3N4WA 2UUWA 4G1IA 1RWVB 3HCXA 3PFOA 2NPFA 3TJAA 1RT2A 2XO7A 1RT1B 2W9BA 1TV6A 4HEA9 3L9ZA 4EZ9A 1RE1B 4ZS6A 3FQLA 3VAGA 2E1CA 3NGDA 1FTCA 1JLEB 1D9DA 4B3SF 2V9WA 3MM9A 5IFMA 2KXFA 2DXFA 2HW3A 4F25A 2V9KA 4B3TJ 5L8RC 3MEDA 3D1OA 3PHTA 4OI1A 4ZPWR 3V6HA 2J8AA 2QO3A 1FERA 3SYZA 2QMXA 3SZ2A 2EFQA 1S49A 2JOQA 4OZ3A 4ES2A 4KGMA 3LF0A 3SV4A 3QSYB 3MMAA 5H9FJ 3BPDA 1S9EB 2HGNA 4L3KA 4EK2A 4K2XA 3S6EA 2QV6A 3L95X 3HD1A 1XBWA 1EKSA 2D7SA 2B9YA 1S48A 2ZBQA 1TV6B 3MAAB 3QGPA 4PYAA 5F8HA 3BM7A 2XZDB 3GG0A 4DR6F 2DNMA 2MYFA 4WWSA 2YX1A 4KYZA 2ZOFA 3SDEA 2ASDA 1N6QB 1CJVB 1HBOB 3W2VB 1HFEL 2GQQA 3F73A 1HLWA 4PUOB 4AL5A 2NXJA 1B99A 1WC5A 2WSFC 4ZVRB 1WI8A 4UZBA 1UVJA 4DR1F 2ALYB 3T3FA 4RBVA 1X0FA 1R43A 3NNCA 3M6UA 4X4RA 3KLHA 3H4DA 1V5VA 2CJ9A 3TARA 1TL7A 1XR6A 1URNA 3PTWA 4CTAB 5IC6B 4DPOA 1U24A 1YJVA 2I5JB 1WDTA 3VZHA 3D2WA 2R2UA 5T41A 5FLXY 1NDCA 2BJ3A 1T03B 3P5TL 1TZ0A 3B82A 1N56A 4PG4A 4F0KA 1HNZF 2VPXB 4NE9C 2WSCC 4QWAA 3DHWC 1FJEB 2PMWA 2KH9A 3NKYA 1TKTA 2MSTA 4F4WA 1X9WA 1K47A 2FJBB 3BREA 3RRHA 2HURA 3HMJG 2W2MP 1QVGR 1GXLA 1QE1A 4EO8A 4ID5B 2HFNA 5CCLA 3Q8QB 1YBUA 4LUBA 5EWGA 2IC3B 5KFVA 1WSRA 1R0CB 4IFYB 3ZZZA 4JI1F 1RT1A 1RU1A 2R7XA 1RHJB 3EPIA 1VRTA 3R1LA 2HGMA 4OHZA 2F5GA 1VR6A 2M70A 3NGSA 1HBNB 4NI2B 4NA1A 4QIEA 1JMTA 1X9MA 2ZKUA 2UUBJ 4DSFA 4OYAA 2W8KA 1WOPA 2QE5A 3GG1A 1Q5VA 3VV2B 5C24B 1JLBB 3THTA 1DTTB 1X5PA 2KB2A 2ATCB 3I32A 4ENOA 5KFZA 3D7SB 2XZWA 3HHKA 3AFGA 3FGVA 4CT9A 4B9VA 3ZZUA 3A8JA 2IC3A 3MMAB 1NCLA 4DV4F 2XSJA 4DV2J 1Y10A 2Q6CA 3U1MA 1K0TA 1HNXF 3GIRA 5H9FK 3LANA 2AGOA 2DITA 3BR8A 2ILYA 3MOZA 1MROA 1VRTB 3TAMB 4UQGA 3UQSA 4M5NA 5J2PB 2VFSA 3HD2A 2RU3A 3V2UC 1SJ3P 1NKEA 2HHVA 3GIIA 2JC0A 1CJVA 2MY7A 1ZA2B 3ENQA 4H54A 2ROPA 3W2VA 4CM2A 4N56A 2HZCA 3QQCD 3V4IA 3HVTA 3EGWB 4ZPVR 2YBVA 4Z37A 4CCHA 3VAHA 3JYTB 2VG5B 4ALZA 4QIVA 3IA0A 2HSEB 5LMNF 3MDFA 2XSJB 1TL5A 1TL7B 2J7KA 3IRXA 5KFYA 1G4CA 1P1TA 1HWKA 4MKAA 2JLGA 1U0HA 2YKQA 4ANEA 4PG8A 5F8GA 5LMNJ 3V6KA 2E9ZA 4U96A 5J1EB 2E1AA 3MR5A 4A4JA 4ECSA 2CJXB 4USIA 3OTOF 3V4IB 1CEZA 4DL5A 1MMNA 4UW2A 2GIQA 1YJNS 1GXUA 2DK2A 5ADZA 2MLYA 2GMJA 4DF4A 2W9CB 4Y2KA 3W5ZA 3J80Y 3FEXB 2AF6A 3PXGa 1VCTA 3VCDA 2K7JA 2JDJA 3N6LA 4ED1A 2D3O1 4ZOSA 1TVRB 4N8NA 4C0BA 2RQKA 2Q43A 3PW5A 3CCZA 1SJ4P 2CJKA 1C4CA 1CULA 4FKYA 2DNPA 1IBMJ 1L3KA 4DN9A 5DDPC 3T1YJ 4E2FB 2DHXA 1HNXJ 5DG9A 1U0HB 1G6BA 1NK0A 1QUPA 2H5JB 2XS7A 1CJUB 4NI2A 3AH6A 5IWAJ 1IBLJ 3M9NB 1UFWA 1VQ9S 1TKXA 2V34A 3MPUB 4XAKA 2J8SA 4GVBA 4YB1P 4FBUA 5LJ3Y 4KHMA 8ATCB 2KHDA 2VZ9A 4NLVA 4LVOP 2C22A 4C0HA 3KLGB 5KG0A 4RNHA 2PD1A 1KSPA 2UUCF 4CDIA 2V94A 2ZH9A 3T5HA 3P49B 5THWA 3W61A 1WEYA 3GYGA 1SH3A 2KU7A 3HHDA 2XMWA 2YXLA 1S4FA 1RT5B 4M5HA 4CH7A 3AJ2A 3M8SA 4A8QA 4IDKB 4DPXA 3ZTQA 1OY8A 3FK4A 3RB4A 3IAS9 1J5OA 4L6V3 4GKJJ 1X60A 2UXBJ 3Q8SB 4B9TA 1VYAA 2HEKA 5F41A 2BZ2A 2JVOA 4KO0A 5B09A 4YS2A 4YY3J 1KOHA 2H4YB 5KT7A 4DR7J 2R7TA 3HVTB 5C25B 5J1PA 1IJEB 4F3QA 5KOWA 5KFJA 2RS2A 4ZJLA 1KQSR 4H4OA 3PW7A 5IZHA 5I4MA 2IHR1 4BDPA 5U47A 2BRLA 2G1HA 1FESA 3ONQA 3UNGC 3LQVA 3JTPA 3BGOP 4DFPA 3IFEA 2LEAA 5IQQA 2C28A 3KNAA 3HHLA 2UXDF 1FO1A 2ZH7A 1LEOA 2FIUA 4KPYA 4P71A 3KLFB 4DV6F 3BYRA 4CWBA 2D3UA 1N5SA 1S12A 3C6UB 4ZVUB 5J2MA 5HVFA 2GAGC 4FYXB 1NB2A 5AE3A 1PKUA 1E6YB 3PY8A 2K1RB 3OW2R 2X1BA 1WOSA 2RB7A 3D1QA 3KMQA 3MOJB 3I56S 1GX6A 3VGUA 4FKXA 3S8SA 3CCMS 1VRUB 2VG6A 2ZE2A 5ETPA 1FDAA 2B3TB 2R2RA 3NEKA 3F41A 4FNHA 3HHLB 1HHQA 3DLEA 3NG8A 3TA2A 2W24A 5A8KB 3KYLA 5D4LA 1S10A 1U4BA 1T05B 1D1UA 3K5MA 1F60B 1HI8A 1X4DA 1ZS6A 3OPKA 5K8MA 1CJUA 4UOHA 3M8ZA 5DGBA 2YWWA 5A76A 1HQUA 3TJ9A 3TP2A 2J7WA 3JSBA 1TKZA 3KHGA 1SV5B 1ZA1B 3Q86A 2C3UA 1RAEB 4P73A 3H5YA 1U2CA 4HR2A 3ETMA 3M6XA 3VQTA 4XDDA 4C3MA 3P6YC 4FZVA 2VC1A 2RKIA 1WTFA 2WW4A 2IDLA 3PKYA 4IKAA 3PNIA 3CW2C 2VH7A 5RUBA 4DSIA 1EP4B 1RHQB 3OL7A 3MR2A 3R2CJ 2I6WA 4DV3J 4HT5A 3VHQA 2OELA 1RHKB 3W63A 4DR2J 1YSJA 3ULHA 2JX2A 1U6BA 2A1BA 3JSRA 3R6GB 1LFWA 3B54A 2B9WA 4M5KA 1H2VZ 1HNIA 4ZJQA 3P8BB 1HNWF 1FRHA 1WC1A 3AJ1A 3MD1A 4CLTA 2W2PP 4HDHA 4IOCQ 1S0OA 4TN2A 2FTRA 4ZMMA 3P4UB 1XNQF 4HTIA 2HMIA 3RZAA 1O5JA 2J0XA 4LRDA 4DPYA 3ICLA 4MJKA 4JI7J 2LQ9A 4M5IA 3MI7X 2BKOA 9ATCB 2ZH4A 5F9LA 3CC2S 3H20A 2QT7A 2WONA 3FZ2A 2HFUA 1KR4A 2QLJB 2RHSB 4KV8B 3GV5B 2ZHOA 2D3ZA 2YKMB 4EYIB 3CDBA 3BH7B 3FKBA 2DGTA 3PACA 2Z2MA 1JJ4A 2KHCA 4CIOA 2ACYA 4OI0A 1HBMB 4E98A 1NSPA 1EQMA 1MN7A 2HVZA 1VRUA 4GO5X 3OFFA 5T14A 1MWZA 3K57A 1RDRA 2CPHA 3M2VA 5ETOA 4ZHRB 4X64J 3KJQB 4RNNA 4CO1A 4F0MA 4LBPA 2AZ3A 2KJVA 4E8UA 4B9NA 2OUGA 3M1VA 4P2MA 3OTDA 2H1YA 2CUYA 4GVLA 4DV0F 2R7VA 4LR7A 4RBTA 2DNHA 3QBCA 4A8FA 1HYSB 1ELOA 2OKQA 4JP8A 4KR0B 4NLUA 2GQCA 2YKMA 1OWXA 4CLSA 5KTQA 2C2NA 3F0NA 3AOAA 3FMWA 3LP2B 5FD1A 3M8QB 4F04B 2XGPA 5AT1B 2CQ2A 1U2RA 1S0VA 1KKHA 4IFVA 5CD4A 2G2ZA 2LU1A 3FZBA 4L3NA 3M2RA 3NGRA 1IKVB 4DR3F 2HHWA 1E6VA 5H9EK 1XMOF 3VWSA 1PC4A 2AJ4A 2E7XA 2G2YA 3HJVA 2ZWPA 1NXIA 1KN6A 2R7UA 1YRTA 1TUWA 1X5OA 1XR5A 2NS1B 1HL6A 2VBYA 3S01A 2HNDB 3IG1A 2CQ1A 1JJCB 1VI7A 5KFOA 4IO1A 3NS7B 3QO9A 1Y11A 2BW2A 1HNIB
chains in the Genus database with same CATH topology
1FX4A 3MR7A 1CS4A 4WP9A 4NI2B 3C15A 3MAAA 4OYAA 4WPAA 4CLYA 5D0HA 3UVJA 4WP8A 1YK9A 4CM0A 1CJUA 1Y10A 2W01A 4P2FA 1CJVA 2WZ1A 4CM2A 1CJKA 4USTA 4CLKA 2GVDA 3ET6A 4OYXA 1WC0A 1YBTA 1TL7B 2GVZA 1CULB 1AZSA 4OZ2A 1U0HA 1WC1A 3C16B 4CLTA 5D0EA 4OYWA 1FX2A 1CJTA 2BW7A 1CS4B 3G82B 4USVA 4OYBA 3C15B 4CLUA 5IV3A 5D15A 1CULA 4OZ3A 1U0HB 3C16A 1CJUB 4USUA 4NI2A 2QV6A 3C14B 3MAAB 4CLLA 4CLFA 4CLZA 1WC4A 5IV4A 3UVJB 1CJVB 1WC3A 1CJKB 4P2MA 4OYPA 1WC5A 1AB8A 4CLSA 4OYIA 4OYMA 1WC6A 1TL7A 2GVZB 3C14A 4CLPA 1AZSB 4OYZA 1CJTB 4OYOA 5D0RA 4CLWA 3R5GA 4WP3A 2GVDB 3ET6B 3G82A 5D0GA 4P2XA 1Y11A 4USWA 1YBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FX4 A;  3MR7 A;  1CS4 A;  4WP9 A;  4NI2 B;  3C15 A;  3MAA A;  4OYA A;  4WPA A;  4CLY A;  5D0H A;  3UVJ A;  4WP8 A;  1YK9 A;  4CM0 A;  1CJU A;  1Y10 A;  2W01 A;  4P2F A;  1CJV A;  2WZ1 A;  4CM2 A;  1CJK A;  4UST A;  4CLK A;  2GVD A;  3ET6 A;  4OYX A;  1WC0 A;  1YBT A;  1TL7 B;  2GVZ A;  1CUL B;  1AZS A;  4OZ2 A;  1U0H A;  1WC1 A;  3C16 B;  4CLT A;  5D0E A;  4OYW A;  1FX2 A;  1CJT A;  2BW7 A;  1CS4 B;  3G82 B;  4USV A;  4OYB A;  3C15 B;  4CLU A;  5IV3 A;  5D15 A;  1CUL A;  4OZ3 A;  1U0H B;  3C16 A;  1CJU B;  4USU A;  4NI2 A;  2QV6 A;  3C14 B;  3MAA B;  4CLL A;  4CLF A;  4CLZ A;  1WC4 A;  5IV4 A;  3UVJ B;  1CJV B;  1WC3 A;  1CJK B;  4P2M A;  4OYP A;  1WC5 A;  1AB8 A;  4CLS A;  4OYI A;  4OYM A;  1WC6 A;  1TL7 A;  2GVZ B;  3C14 A;  4CLP A;  1AZS B;  4OYZ A;  1CJT B;  4OYO A;  5D0R A;  4CLW A;  3R5G A;  4WP3 A;  2GVD B;  3ET6 B;  3G82 A;  5D0G A;  4P2X A;  1Y11 A;  4USW A;  1YBU A; 
#chains in the Genus database with same CATH topology
 2MZJ A;  2CAD A;  3M32 A;  3QSI A;  4DOZ A;  4RBU A;  4J9P A;  8AT1 B;  1TEL A;  4B08 A;  5F8J A;  1R8A A;  4JV2 A;  3EPG A;  4R8U A;  2BR0 A;  2EC2 A;  2DH8 A;  3GR0 A;  1DUR A;  2LFV A;  4H4M A;  2GGP B;  2VPZ B;  2RDJ A;  2OPP B;  4AQY F;  4FVM A;  4JI4 F;  2HFV A;  4WFN Q;  5IM0 A;  3NBP B;  4DCP B;  3K8V A;  2F65 A;  1X7V A;  2HHP A;  2YH0 A;  4FP9 A;  5B0F A;  2OTJ S;  3GLJ A;  3CCU S;  4PWD A;  1RTD A;  3NNA A;  1GXT A;  2OD4 A;  1RBA A;  2J7U A;  2WTF A;  3VVT A;  1W2I A;  2QLX A;  3NRB A;  4RPF A;  2Q1L A;  3EGV A;  4ZLJ A;  3IN5 A;  2XY5 A;  3OFH A;  4AQY J;  2CPY A;  4FF1 A;  4PAB A;  1RBL A;  1RTJ A;  4ECX A;  1RT4 A;  2AEJ A;  3RG6 A;  3US5 A;  1Q81 T;  4KHP J;  5LXR A;  2Q6B A;  1L3T A;  2PI4 A;  1MW7 A;  2M52 A;  3BH6 B;  4KKO B;  2DNL A;  1NJI T;  4LFC F;  2K3I A;  1VBZ A;  2NSC A;  2CPJ A;  4C8M A;  2LDY A;  1IBL F;  5AJ3 J;  4IR1 A;  1ROF A;  2HBR B;  2IRX A;  3KLE B;  1SL1 A;  2E9T A;  3NCR A;  4HH0 A;  1U1N A;  4FYY B;  2CJA A;  3JTN A;  1NK9 A;  2XS5 A;  2BVZ A;  2GO9 A;  3BQ1 A;  3ET6 A;  3LP2 A;  4DV7 F;  3A8K A;  1U1R A;  2VC0 A;  4F7V A;  4C8Z A;  4J90 A;  3T6B A;  1D9F A;  2LQJ A;  1JXV A;  3JS9 A;  2D1C A;  3MWB A;  2E5L F;  4IFV B;  3VQS A;  2B4O A;  3CXC R;  4XO0 A;  3D68 A;  2YH1 A;  4M1K A;  2CQD A;  1V3S A;  1P6T A;  3PYG A;  1C2P A;  4TY8 B;  3HKZ D;  2YKO A;  3OQ2 A;  3SEO A;  2XHC A;  5JMN A;  4AL6 A;  1M1G A;  1RTH B;  4OX9 J;  3NS6 A;  1RKI A;  1UVL A;  4DS4 A;  2MQM A;  2KL8 A;  4W92 B;  3HP6 A;  5EN1 A;  4DF8 A;  3PW4 A;  4NLG A;  4EEY A;  1FJC A;  3KHR A;  5ETL A;  3C15 B;  3BN7 A;  4X64 F;  4M5G A;  1ZM9 A;  1N34 F;  2A0F B;  4Y2M A;  1RAC B;  2DGQ A;  4DDF A;  4ZKA A;  3K0J A;  2EFO A;  4HL9 A;  3CMA S;  2QMW A;  2BQU A;  4UUW A;  1C0T A;  1K1Q A;  3H42 A;  3HT3 A;  2AMC B;  2OPQ B;  1S7H A;  3DLH A;  1B0T A;  2HQC A;  3PJ9 A;  4WFZ A;  2OPP A;  4YB5 A;  5A6W A;  3W5Y A;  4RW8 A;  2AJ0 A;  4J9N A;  5BYR A;  1U8S A;  1NHV A;  4DLG A;  1Q86 T;  2CJB A;  2BKP A;  3DLG A;  4PWU A;  5B0E A;  1EKR A;  1JNZ B;  5KFU A;  3Q23 A;  3RR7 A;  2KT3 A;  3PYE A;  2NXC A;  3MM8 B;  1RTD B;  1LWC A;  3AJD A;  1F9H A;  3FCV A;  3CCQ S;  3Q24 A;  2QLB B;  3KG4 A;  1KQG B;  1YVF A;  3RUB L;  3WHI A;  1S1X B;  2IM0 A;  3GFX A;  5KFE A;  5IQ6 A;  1ZAW A;  4LRC A;  1RAF B;  1N5Y B;  3VZI A;  2DD8 S;  4Q7A A;  3AOC A;  2NLW A;  2Z58 B;  1LK7 A;  3DGP A;  2RHQ B;  4E0D A;  5D3G A;  4UY8 T;  4X4N A;  5GAH I;  4EFA C;  1LNQ A;  3CDE A;  2IMW P;  2VL1 A;  1Q8I A;  1U02 A;  2D9P A;  3O5T B;  3LWM A;  4J9O A;  5FDL A;  3PHE A;  2ASJ A;  3ILL A;  4B3M J;  2R8G A;  3J81 j;  8RUC A;  1QSY A;  1JKH B;  4KQZ A;  4WIQ A;  4GMK A;  3CJ0 A;  3V5R A;  1Y00 A;  2C1E B;  3LAM A;  4RW6 B;  5DRK A;  1CJT B;  2RNE A;  4FYV B;  3UN3 A;  4C48 A;  3V6D B;  4JI1 J;  4G3I A;  4CLW A;  4I69 A;  4WF9 Q;  2V63 A;  1RT6 B;  1N36 J;  4PG7 A;  5E3R A;  2BV3 A;  4DMZ A;  4LF2 A;  4P2X A;  1V5I B;  1X4G A;  5FII A;  3WC0 A;  4U6P A;  3U02 A;  3BF4 A;  1IVZ A;  4L72 B;  3MED B;  4X4U A;  4WE1 A;  2V69 A;  1HIY A;  4NEY A;  3FUY A;  2CQH A;  3H5U A;  1M0S A;  1VQM S;  2U1A A;  2OEM A;  3UI3 A;  1T8E A;  4XPE A;  1MNE A;  1WG4 A;  1NH8 A;  1Y5L B;  4NXN F;  1BQM B;  2PGC A;  1S6U A;  1KWM A;  4O4G B;  2HHS A;  2QSW A;  3MAA A;  4BCA A;  2V8H A;  3HPO A;  3J81 U;  5L39 A;  3KFW X;  2PN6 A;  1N4L A;  4CLY A;  1AA1 B;  1O0P A;  2NXN A;  2BE2 B;  3BZQ A;  3NCQ A;  3CJS A;  4OLP A;  5E3A A;  4RO0 A;  4Q2L A;  1VQ4 S;  1VMB A;  4DFJ A;  1RA6 A;  4DR1 J;  4KE5 A;  3H98 A;  4WFY A;  3EDR B;  5EDW A;  4WTO B;  4KGZ B;  3CIM A;  2NQP A;  1IQT A;  5SZT A;  3DLG B;  3OUY B;  1WG5 A;  3KK2 A;  4ECT A;  3PIP Q;  2DB1 A;  3JXO A;  4JI0 J;  4ECV A;  3PRD A;  1D0E A;  2DNQ A;  3G6V A;  2V0N A;  3LPY A;  4P2F A;  1M5H A;  3T5J A;  3TAP A;  4X66 J;  1V3Z A;  4J9R A;  2I2Y A;  2B9E A;  1WI6 A;  4QWE A;  3IP0 A;  1NB7 A;  2HZV A;  2VB6 A;  3I4P A;  4YFU A;  4DR5 J;  1REV A;  2RML A;  2HS4 A;  2QL5 B;  4WXO A;  4KAI A;  3E2E A;  2NZC A;  2QJ3 A;  3CJT A;  5HQL A;  2B8P A;  4B9S A;  2XLI A;  4JI6 J;  4DV5 J;  3KMS A;  1TKT B;  3EX7 B;  2CQG A;  4NCA A;  1AUS L;  1SQG A;  3HSJ A;  1FCA A;  3ENV A;  4DUY J;  3DMJ A;  4CNZ A;  2HVH A;  2JHE A;  3RJM B;  3SQG A;  4DCJ B;  3N79 A;  3MD3 A;  2KT2 A;  1AFJ A;  4IFY A;  3IM9 A;  2R42 A;  4R5P B;  3GYX B;  1W25 A;  1N54 B;  2V4J A;  3M8Y A;  4K59 A;  2ADB A;  3KK1 A;  1PIL A;  2MLX A;  3CDA A;  4OX8 A;  1Z4U A;  1T3O A;  4G1Q B;  3QAT A;  1GEH A;  4OZ1 A;  4P6Q A;  2P6S A;  5ETV A;  2MTL A;  4DSL A;  1UCN A;  3NMA A;  1IXK A;  4DX6 A;  4JYA F;  2VAS A;  1N33 F;  1DTT A;  2V4R A;  2EK1 A;  2EG2 A;  5EUH A;  3KWM A;  3RW7 A;  3GIL A;  5GMK a;  3EE3 A;  2B6A B;  4HDG A;  2LKZ A;  5KT3 A;  2KM8 C;  2C2D A;  4BS2 A;  4BBY A;  3N6N A;  2FLO A;  3PR5 B;  2DNG A;  1RB0 A;  3GZ7 A;  4LQ9 A;  4NLX A;  4DN0 A;  2QFJ A;  4C98 A;  3RB0 A;  1L3U A;  2V8D A;  1NPP A;  2MGZ B;  2VPY B;  2YX7 A;  1QAJ A;  4JI4 J;  2IYG A;  3R9L A;  1KRP A;  2N3L A;  4ED4 A;  1QJH A;  1LV5 A;  3IO1 A;  4YN3 B;  4YR2 A;  4KSE B;  2XWY A;  3EIC A;  3MEC A;  1KC8 T;  2FVR A;  2R2S A;  3TOQ A;  2ZJP Q;  2X51 A;  4OYP A;  1X4B A;  2LQ5 A;  4CRJ A;  3NXZ A;  3LPE A;  3DOK A;  4OJG A;  2CPX A;  4WU3 A;  4ZLL A;  3QRP A;  5C2C A;  2V2V A;  4ED7 A;  5MAO A;  3KHH A;  2B6A A;  4J5O A;  1OYE A;  1S6Q B;  3DRX A;  3R27 A;  1BWV A;  3N01 A;  4G65 A;  3GIK A;  4CLP A;  3CD6 S;  1S99 A;  2EFV A;  4ED0 A;  1U1P A;  2B4U A;  4CYU A;  4WFA Q;  2VBW A;  4HHU A;  4A8X A;  3FEY B;  1HBU B;  4ZPA A;  1X5S A;  5DET A;  1SH0 A;  4GKK F;  3I0R B;  3QAE A;  4NEZ A;  3DHX A;  3SXL A;  3GWC A;  4WP3 A;  4DCO B;  3QGI A;  1EHW A;  3ILO A;  2MZ1 A;  4PYD A;  3OSP A;  3ETO A;  1Q82 T;  3DOK B;  3FBB A;  4LMZ A;  1Y4Z B;  3R1H A;  1WTB A;  1REG X;  1C0U A;  3OVS A;  1WKL A;  4CZC A;  4MT1 A;  3KLE A;  2GHW A;  1H72 C;  3CCE S;  2J0S D;  4LFA F;  3DI6 B;  1VLY A;  5F9N A;  1DRZ A;  2HBQ B;  3MR7 A;  3Q83 A;  3NOG A;  3R97 A;  3H5X A;  3HVR A;  3HVA A;  3TAM A;  3KK1 B;  1UMJ A;  3NGK A;  3GTY X;  1SCJ B;  2IMO A;  4DUT A;  3QT5 A;  4USM A;  4LF6 F;  4K4S A;  3PW2 A;  4S0M A;  5GAG I;  5L9X A;  4C4W A;  2UZA A;  3R5D A;  3HFK A;  2EKY A;  1NK5 A;  1BQN B;  3G87 A;  3RRK A;  1AUD A;  4PKD B;  2OFH X;  2HLT A;  4ATN A;  2CZ4 A;  5T7L A;  5BXI A;  3IR5 B;  1FE4 A;  3VAJ A;  3OT9 A;  4U8V A;  4DL2 A;  1N48 A;  4AXI A;  2DHH A;  2FZC B;  2C3P A;  2LVW A;  2PC6 A;  4KFB A;  3J7A N;  4F02 A;  4I6A A;  1AW0 A;  2AYE A;  2DO0 A;  4I68 A;  3IRW P;  1KTV A;  3GSD A;  4LRA A;  1PC5 A;  2JEI A;  2MKS A;  4QJV A;  5J1E A;  3G8Q A;  4MAK A;  1SVD A;  2MQ8 A;  2HVD A;  2BJD A;  1CJK A;  2QZ8 A;  4O44 B;  4JI5 F;  1RLC L;  2FHJ D;  4EBE A;  4UUX A;  4JV1 A;  3OLA A;  2F4F A;  1R0B G;  1RCO B;  3OFG A;  3POT A;  1YLX A;  4L76 A;  5BR8 J;  3MUR P;  2R8H A;  2BOP A;  2J0Q D;  2OPS A;  2UUT A;  4EGL A;  2Z2Y B;  2PT0 A;  2JJ4 D;  2ZM6 F;  4F3M A;  1FXD A;  3OR2 B;  2GVZ A;  3DOL B;  4B3T F;  2P9G A;  2MB0 B;  3LW5 C;  4QWB A;  1SUQ A;  1H2T Z;  1H7X A;  4F4Z A;  1HQ2 A;  2XSF A;  3HSZ A;  5ETN A;  4B3O A;  1HD1 A;  2FDN A;  4OX9 F;  2XWX A;  1X9S A;  4JB8 B;  3SV3 A;  4DLE A;  5KFS A;  1HWI A;  2MMY A;  1FT8 A;  1GFW B;  2HRU A;  1CS4 B;  2WB1 D;  2VKZ G;  4M8L A;  3UCG A;  4EWT A;  5BR8 F;  1ZPW X;  3PX4 A;  2M5Y A;  2XEX A;  2ASL A;  2DIU A;  2J6S A;  3TX0 A;  1M5P C;  3LA0 A;  2LQB A;  2IM1 A;  2L9N A;  1T9W A;  3AD9 C;  3HX9 A;  3JQM A;  1JLF B;  2VG6 B;  4KC5 A;  2N7C A;  3DYA B;  3PRB A;  1S1U A;  3J7Y U;  1DTQ B;  2FVQ A;  4DR6 J;  2KG0 A;  1EET A;  3DRR A;  3OFE A;  4FVC A;  5DLG A;  4TKT A;  2UU9 J;  1WOR A;  3R5J B;  1RUS A;  3LP0 A;  1R8H A;  2OPR A;  2WSE C;  3K7R A;  4IYQ A;  1UA0 A;  1TR0 A;  4I67 A;  1FWP A;  5KFF A;  1Q78 A;  1UWB A;  2BAC A;  1J5O B;  2QLF B;  2XMU A;  3FRZ A;  4ZLN A;  1XEZ A;  1BD6 A;  1LK5 A;  1WNE A;  5B0D A;  3TZZ A;  2BKN A;  3EGZ A;  1NDL A;  2ZVS A;  4DPU A;  2Q79 A;  3EVW A;  4I6Y A;  3OXL A;  2HYI B;  2GA7 A;  4U7C A;  4QWD A;  1TL3 A;  1RKJ A;  1V3R A;  1NLK L;  1WOO A;  3PV8 A;  2A2D A;  5KFH A;  4FNI A;  1RWK B;  2P6T A;  2G0I A;  1T02 A;  4ZVG A;  3K5L A;  4J9L A;  2XMV A;  2JLF A;  1VC6 A;  3I5C A;  3MEK A;  2UVV A;  1R3N A;  3UE2 A;  1H38 A;  4OYI A;  2N4C A;  1WC6 A;  3D0H E;  2XB2 D;  4QQB A;  1X0P A;  1QTM A;  1Y3K A;  1DLO B;  2CVI A;  2HLU A;  2HVI A;  2WAQ D;  2P5V A;  3BBB A;  5K20 B;  2GCF A;  1K1S A;  2XHW A;  3DOM A;  3M05 A;  5DZ6 A;  3PX6 A;  3RAQ A;  4C8K A;  2BE9 B;  5KG6 A;  4RUH A;  5HMW A;  5HVH A;  3QFW A;  4QW9 A;  1LXN A;  1VC0 A;  3JYT A;  3VGT A;  2KN4 A;  1S1W B;  4B3S J;  2DXE A;  1FWK A;  1U6F A;  3CO9 A;  3G82 A;  1U26 A;  3BN4 A;  3HT0 A;  4HI2 A;  3AT1 B;  5DGA A;  1WKJ A;  2KZZ A;  4F36 A;  1FI4 A;  2FHK A;  3CCS S;  2Y1I A;  4ICL B;  2EFN A;  1S97 A;  2Z57 B;  3PO4 A;  1UJ4 A;  2C3M A;  1KQF B;  3OJS A;  2HHX A;  1UVM A;  2E1M C;  2C2E A;  1FE0 A;  4DFM A;  5F8L A;  4PG6 A;  3IGV A;  2CJY B;  1CS4 A;  3MEG A;  2VQE J;  4DHV A;  5A8W A;  2ATL A;  3NGU A;  1JLA A;  3M6W A;  2CQP A;  1HHT P;  1ITP A;  5HQM A;  4B9U A;  2APO A;  3NCP A;  1R89 A;  1LXJ A;  2ZBC A;  2XMJ A;  1FRL A;  1Z1Z A;  3QYY A;  3GJR B;  3DRY A;  2EKN A;  4WZQ A;  4WKR A;  1WF1 A;  1U0S A;  2K06 A;  1IR1 A;  3AXK A;  3NWR A;  1PJ5 A;  3UVJ A;  3WZ0 A;  4KB7 A;  3PW0 A;  1GTH A;  2ZKT A;  1GT8 A;  2EBE A;  1IKX B;  3O2I A;  1TMM A;  2BJ8 A;  4KGV B;  4OJ1 A;  1TAQ A;  4C11 B;  1S0N A;  2HHQ A;  3MMC A;  1FTR A;  3H5S A;  1N5T A;  4TYA A;  5A8W B;  3BV8 A;  1GNK A;  1RT3 A;  2K1R A;  2ZNZ A;  2DVI A;  3M8Q A;  3BO3 A;  1UZH A;  3MXH P;  3I31 A;  4LF6 J;  3KLG A;  2DNN A;  4ZP7 A;  5I3U B;  1I1G A;  3DFE A;  1K9M T;  3VVU A;  4NXM F;  2DCL A;  3FCH A;  1FWL A;  3R5A A;  5CCM A;  3BO4 A;  2OSR A;  3ZZ0 A;  3V81 A;  3S1T A;  4DWI A;  1S6P B;  5L38 A;  1YI2 S;  4M95 A;  5CYM A;  2FHM A;  3W65 A;  4F2R A;  3B6B A;  3ZZY A;  1DLO A;  2MEW A;  3X3U A;  1HR0 F;  2MY8 A;  1X8D A;  2CZ9 A;  3WX4 A;  4OYW A;  2YNI A;  1UFK A;  2V50 A;  4DUY F;  2FJA B;  4PQU B;  4LRB A;  2KRR A;  3SFU A;  4QPT A;  1Y7P A;  2DGU A;  2M0G B;  3OSN A;  1VQ6 S;  3KDO A;  4H4M B;  4DV7 J;  3I0S B;  1MWY A;  1NRK A;  1S0M A;  1N33 J;  1RWU A;  4OYB A;  5HBM B;  1KS2 A;  4TLQ A;  2I8E A;  3GV8 B;  1QAY A;  1UFL A;  2AJ2 A;  2OO4 A;  3PRV A;  4DSE A;  4KPC A;  5L1I A;  2WK4 A;  2V2Q A;  3M1V B;  4DEZ A;  1Q53 A;  4RW7 B;  3T5L A;  4JI8 J;  3EXC X;  3GFH A;  5KFT A;  1A7G E;  5A2Q Y;  3CJK A;  2W2N P;  1FVS A;  1SQF A;  4LFC J;  5HL7 Q;  2XMM A;  4RU2 A;  1JQG A;  3KUE A;  3AY0 A;  5GME A;  4ZJO A;  3EMT A;  3QMQ A;  4WCE Q;  4A8S A;  1DFD A;  3MEE B;  1FKP A;  2UXC J;  3WBZ A;  7FDR A;  4NLT A;  4XIU A;  1KDN A;  1PAE X;  1RP5 A;  1I5O B;  1WHV A;  1NSA A;  1WJ9 A;  1OQ6 A;  5D77 A;  2SXL A;  3M8R A;  1T7P A;  4I56 A;  4R25 A;  1PO6 A;  4C3K A;  3DLE B;  4C97 A;  2XY6 A;  5IV4 A;  1VQK S;  4B3R F;  2D69 A;  3FBC A;  4BWJ A;  4DQQ A;  1UEU A;  4NA3 A;  4RW7 A;  2EW9 A;  4WYL A;  1Q8B A;  4C11 A;  5L9N A;  3I9Z A;  3IG1 B;  4PPD A;  1KBR A;  1JLQ B;  2A6M A;  2J9E A;  1HQU B;  2VFT A;  2W4P A;  2NYH A;  3H0P A;  3KJN B;  3UD3 P;  2VIH A;  4PWW A;  3K2Y A;  4RJV A;  3M32 B;  3A8E A;  1U6Z A;  4C8N A;  2XQC A;  1OSD A;  4ECZ A;  4CQ1 A;  2FC9 A;  5G0R B;  2KTQ A;  1HNZ J;  2GMH A;  2GNK A;  5AXK A;  4QCL A;  2KM8 B;  2ZH2 A;  4EZ6 A;  5IC4 B;  2UP1 A;  4I7F B;  2GW8 A;  4FS2 A;  4P52 A;  4ZLP A;  2EEY A;  3B4D A;  4URQ U;  1UVN A;  4U9R A;  2RUG A;  4XK8 C;  2DNY A;  2WOM A;  2IJN A;  5CH7 B;  2CXE A;  3CJR A;  3I96 A;  1XWL A;  3K89 A;  3QIP B;  3ZTS A;  3MFI A;  5ETT A;  5D78 A;  4KY3 A;  4UOG A;  3G9C A;  1UVK A;  2VFV A;  2DJW A;  2YNG A;  1RAI B;  1RT4 B;  1RT7 B;  1RI7 A;  1C0T B;  1YBA A;  3O44 A;  3GB0 A;  4OZN A;  3R8Y A;  3VTI A;  1S72 S;  2KFY A;  1M5V C;  1AYE A;  5HMY A;  1VJQ A;  1LW0 A;  2M8H A;  2MZR A;  4L73 A;  5KFK A;  3TW0 A;  2NXU A;  5CAA A;  2G9O A;  4I7F A;  2HG4 A;  1M5O C;  4IG3 B;  1S77 D;  3AQP A;  1X4C A;  4DXL A;  1RGV A;  2WOM B;  4QU7 A;  3ZZR A;  2O01 C;  1F9E B;  4DU8 A;  4YOE A;  4QPX A;  2V4Q A;  2PFF B;  5LXY A;  3KJV B;  1F9F A;  1FDN A;  3CJK B;  2E9R X;  3DU5 A;  3T9N A;  2OP5 A;  1N5Y A;  3J7Z 5;  4DQP A;  4PRF A;  4DR3 J;  2VFU A;  4IG0 B;  4OI2 A;  1H74 A;  4I0W A;  3AD8 C;  4MKY A;  4K4V A;  1HBM A;  2AJ1 A;  3KLV A;  5DS7 A;  3GIJ A;  3E51 A;  1RAJ A;  1RWN B;  5KG4 A;  3C19 A;  3MCO A;  5CYQ B;  3VAF A;  4HAC A;  4ZHR A;  2GIF A;  2HWI A;  5KFP A;  2JSX A;  4MMO A;  1TK5 A;  4ZCM A;  3UDE A;  1S9G A;  2N4D A;  1T95 A;  4DU7 A;  1LWF A;  3GCX P;  3VAM A;  4DUZ J;  2DGS A;  3CMQ A;  2IIH A;  4J9S A;  2P8I A;  4RW6 A;  5A6P A;  2VG7 A;  1U2F A;  3KG0 A;  2HIY A;  5LSL A;  3OR1 B;  2ZEJ A;  2H5I B;  2PA3 A;  1Q5Y A;  3IAM 9;  1B7F A;  2OTL S;  1OYD A;  1EQ0 A;  1OPI A;  3VAL A;  4KKO A;  3A1Y G;  2QMU B;  1E6V B;  3GR1 A;  2DR8 A;  4JV5 F;  2I9S A;  4LF4 J;  2V2Z A;  1O8B A;  2HRT A;  1D8Z A;  2VUG A;  4X4Q A;  4MTP A;  3Q8P B;  2MKY A;  4N76 A;  2CNO B;  4OL8 A;  4WBF A;  3T5K A;  1O51 A;  3QIP A;  2ADC A;  4IUF A;  1ZM3 A;  4MYU A;  4Y2C A;  1APS A;  5HK4 A;  1FNM A;  4NOH A;  1SL2 A;  1J5E F;  3PKM A;  1X4H A;  3IC1 A;  1VIS A;  2ZVI A;  3N5B A;  4FDF A;  4UQT A;  3J80 U;  1NAQ A;  2HKE A;  1S9F A;  3HVW A;  2Y0B B;  1B64 A;  3AXM A;  1FK9 B;  4TNO A;  2Y1J A;  1JLC B;  3P96 A;  2PSZ A;  3I9V 9;  3GJS B;  1CQN A;  1UTA A;  3EVM A;  4OQJ A;  5A2Q U;  3D1H A;  2FB0 A;  2GFF A;  3K5N A;  1KNZ A;  5LL6 d;  2HNY A;  2XI2 A;  3DRS B;  4KGX B;  3SSS A;  3THP A;  4J37 A;  4DL0 C;  5FJ4 A;  4PWD B;  3DLK A;  4X62 F;  2XCP A;  1Q8K A;  3FDS A;  1OO0 B;  4GC6 A;  1W2B R;  5KFN A;  2XC9 A;  2IAJ A;  3ILJ A;  3THV A;  4A8Y A;  2U2F A;  4DS5 A;  4GKJ F;  1Q4R A;  3HHL D;  2VKR A;  4B3R J;  1ACM B;  2ABY A;  3I6P A;  4YQW A;  4K2J A;  3CGI A;  4U95 A;  4FS1 A;  1WAC A;  2DEI A;  3CJ8 A;  3GJQ B;  4BHQ A;  3TVZ A;  3CC4 S;  1P1L A;  4RW8 B;  1S79 A;  3W3S A;  3DLL Q;  4LFB F;  2AJQ A;  2IA0 A;  3DRS A;  3SBM A;  2V6A A;  3C14 A;  1NJZ A;  4DX8 H;  2KXH A;  3SQG B;  3G8T A;  1H2U X;  2XTJ P;  5E2Q A;  2B5J A;  4K4X A;  3FMB A;  2RDD A;  4IQX A;  3OL6 A;  3MZI A;  4OYO A;  3R5G A;  2VQF F;  3ET6 B;  3MTJ A;  2K3K A;  3T9Z A;  4O3S A;  3QRR A;  3IS9 B;  1KLM A;  3U27 A;  4DV5 F;  3DLB A;  3LWL A;  2OIH A;  4N41 A;  3BSC A;  4DR7 F;  1XK8 A;  2W2O P;  2N82 B;  5KT5 A;  2B4P A;  2HK2 A;  4ZVE A;  1H0H B;  3DLJ A;  3G86 A;  3KK2 B;  3CB4 A;  1NSK L;  4LBH A;  4ZA1 A;  1HR0 J;  1F2G A;  3HZE A;  5KFB A;  1HNV A;  1HMV A;  3A12 A;  3OXF A;  1QDU B;  1S9E A;  3DXB A;  4WJB A;  4O4R A;  4X66 F;  1LW2 B;  2EK6 A;  3CD5 A;  3OTO J;  3FSI A;  2A3J A;  3DM2 A;  3HSG A;  2ZBI A;  1KHW A;  4JI0 F;  3P5B P;  4L74 A;  3M9O B;  4LF9 J;  2YWG A;  4Y00 A;  2W8L A;  2YTC A;  3TR5 A;  4FF2 A;  1FK9 A;  5GAH U;  3A3P B;  1HBO A;  2PMH A;  3FVY A;  4U8Y A;  1YHQ S;  1IBC B;  4Z7Y A;  2QX0 A;  5HI7 A;  1KEK A;  1R6Y A;  1GQE A;  2HNY B;  4D3H A;  1ZZN A;  1DQ9 A;  1YRX A;  4RLE A;  3O1L A;  2LP4 A;  2AKW B;  1B7Y B;  2ZHB A;  2KI2 A;  3KLH B;  3P45 B;  1BHN A;  3CVK A;  3JQJ A;  1YKW A;  4A46 A;  1Q7L B;  2DH9 A;  2YVS A;  3HHL C;  4G1P A;  3QNW B;  4MIB A;  4Y65 A;  3D67 A;  4PR6 A;  1B0V A;  4LSL A;  4X4T A;  5LT5 A;  5KFL A;  3ZXW A;  5D3G B;  4AD6 A;  2BAN B;  5DO2 A;  3UO0 A;  1HW9 A;  1NJY A;  4GC7 A;  4K50 A;  2KFZ A;  3WIU A;  4DV4 J;  4QYZ J;  1F5B A;  3IBF B;  4NLW A;  3M6V A;  4DQI A;  3HJF A;  1BY9 A;  4O0I A;  3OUY A;  1NKC A;  1HWU A;  3RU0 A;  2Z0G A;  3QJL A;  2N7Y A;  5H9E J;  2W7P A;  3EJM A;  2W1B A;  4QIG A;  4XTT A;  5ETQ A;  4LIR A;  3Q8V A;  1T94 A;  4DJB A;  2VQE F;  2RIL A;  3RBD A;  1S1T B;  1CJT A;  1XMO J;  1VGY A;  5E3P A;  5K9F A;  2O66 A;  1UPM B;  2I1R A;  5D6G A;  4OX6 A;  1ZYQ A;  4B3M F;  4K4U A;  1LOU A;  1Q79 A;  1LKZ A;  3BBC A;  3DRP A;  3E8O A;  3K5P A;  3O3L A;  4FN5 A;  1BXN A;  1CPZ A;  1SJF A;  1KLM B;  2CDR B;  2DKO B;  4KT0 C;  4B02 A;  4HYK A;  1QM9 A;  3H2L A;  2HQ3 A;  3JSY A;  3BGF A;  4AE5 A;  1P27 B;  4TU9 A;  3HM9 A;  3EYZ A;  3PVX A;  2ROG A;  2L9W A;  4ZIW A;  1YDL A;  1Y5N B;  2A18 A;  1EAY C;  2KKH A;  5DDQ C;  1HNV B;  3K17 A;  1HNW J;  1AT1 B;  2W4D A;  1NSQ A;  3CO0 P;  3RB6 A;  1S1T A;  1Z2L A;  1LW2 A;  2GML A;  2AYM A;  3PDN A;  3C2P A;  2VA3 A;  2FJX A;  2I5J A;  3QZ8 A;  2E5G A;  2YKA A;  4CLZ A;  1NZA A;  3NS5 A;  1SKR A;  2YQ3 A;  2D41 A;  3GCW P;  5A0Y B;  2DHS A;  4M63 A;  1H6K X;  1WC4 A;  2P9E A;  7FD1 A;  1VQY A;  4TVA B;  2OHD A;  4NZ7 A;  4ZVP B;  1XER A;  5KT6 A;  5F8M A;  1CJK B;  3A8I A;  3BKF A;  5E7O B;  3CD0 A;  4ZVS B;  5F3Z A;  2QYC A;  2Y1L B;  4DG1 B;  4F3O A;  4OHW A;  2WRM A;  2YKP A;  1R8C A;  1HQE B;  1UJ5 A;  1AFI A;  1M1K T;  3TVY A;  2R4F A;  3SMZ A;  1BGX T;  2MPU A;  3D6M B;  5DLF A;  5F8I A;  4YR3 A;  3TQE A;  2HGL A;  5I3Q A;  3BGU A;  4HI1 A;  2GVZ B;  3DOL A;  4N5S A;  3RGI A;  5HN0 A;  4DQR A;  4K4W A;  1NUE A;  1SUQ B;  2GV1 A;  2V67 A;  3TJ8 A;  5CYJ A;  2CNL B;  3SSQ A;  4NL5 A;  4ED8 A;  4K0K J;  4UF4 A;  2UXD J;  2OLW A;  3JTO A;  3SDE B;  5C2G A;  2HHT A;  2YY3 A;  2AT1 B;  5KG2 A;  4IH7 A;  5LSR A;  2Y9H A;  1D8Y A;  3ZNJ 1;  2QL9 B;  2HBY B;  5B0C A;  1ZTW A;  2XM3 A;  2RS8 A;  1JJH A;  1R8P A;  1ZZF A;  3ENW A;  4USW A;  2Q3P A;  3BPS P;  3DYA A;  5T7L B;  4YY3 F;  3K58 A;  5GMD A;  5DJB A;  2PII A;  2MQP A;  1R6V A;  1EET B;  2C3O A;  5GVQ A;  2MKC A;  5EHH A;  4DV3 F;  1X4A A;  2B7B B;  1YJ9 S;  3IWX A;  2DH7 A;  4RWW A;  5I42 B;  1FRX A;  2XO6 A;  1FFG B;  5GAD I;  1FJG F;  2ACM A;  3DRP B;  3DNC A;  4CO4 A;  3CT9 A;  2GAH C;  1HBU A;  1WDD A;  3SCJ E;  2L41 A;  3GQC A;  2X7I A;  2YX4 A;  1R0A B;  2UUC J;  2YKN A;  3KXD A;  2C2Z B;  2UXB F;  2ZZT A;  1MML A;  4OHV A;  1VQ8 S;  4B9L A;  1B4S A;  2J9D A;  2L3M A;  2DRA A;  2F4V F;  2NYI A;  4LR9 A;  3W64 A;  4K8R A;  3JAM U;  4KBI A;  1ZPV A;  2JC1 A;  4JI5 J;  2MKJ A;  1EIY B;  4JI3 F;  2L08 A;  3L7U A;  3VR1 A;  2IRU A;  4CO2 A;  3FSY A;  2BX6 A;  2AV5 A;  2W01 A;  1J2V A;  2VIC A;  4X4P A;  3O8W A;  2J0W A;  1UAW A;  3T1Y F;  3A4T A;  1QY7 A;  2DCU B;  3EUN A;  3NP5 A;  2XMA A;  2H51 B;  3R7N B;  3D6F B;  4ED6 A;  4QYZ K;  5IS2 A;  1VFJ A;  1XTZ A;  2WZ1 A;  3NNH A;  2AW0 A;  2YKN B;  3K8W A;  5E0O A;  3CDU A;  1VDH A;  1B0P A;  2CPZ A;  5K8O A;  3OLB A;  3CF5 Q;  4JV0 A;  4KGK A;  4A8K A;  2XNR A;  1P8G A;  1UWA A;  3L09 A;  1RAA B;  1C1B B;  3RB3 A;  4UT4 A;  2VOD A;  2AIR B;  2VJV A;  4OMF G;  5KFG A;  1YJT A;  2HQF A;  2DRD A;  2XNQ A;  2YWK A;  3R7S B;  3SCI E;  1BC6 A;  3IWN C;  1J27 A;  1FRK A;  2KDO A;  3BGL A;  1S6Q A;  3PG9 A;  4LSZ B;  4JI8 F;  1RWM B;  1U7L A;  4DSJ A;  2YQ1 A;  5HSP A;  2ZC4 A;  4OZ2 A;  1QAI A;  1GTE A;  1Q95 G;  2XI3 A;  4D3G A;  2BQR A;  2RVJ A;  1T03 A;  2AHO B;  2EXU A;  4HVZ A;  4NMX A;  1XMQ F;  5D4O A;  1JXE A;  2DHA A;  3GIM A;  5DM7 Q;  3I4H X;  5E3Q A;  4RL1 A;  2DY1 A;  1GMW D;  1NND A;  3IM8 A;  1U1L A;  2XZT B;  1SJR A;  4RNF A;  2KRB A;  1ARO P;  2HNZ B;  2VF3 A;  3ZTO A;  1NBE B;  5F0U A;  1N32 F;  3I5A A;  2BUN A;  1QVF R;  2M88 A;  2CQ3 A;  2R8J A;  2AP6 A;  2LA4 A;  2MZS A;  4LT6 A;  4LRE A;  3CCR S;  2MHN A;  3M4X A;  1RQ0 A;  2YQ0 A;  3MCM A;  1UET A;  5K8P A;  5DM6 Q;  1GMV A;  2QSF A;  4WII A;  2VOO A;  1RT5 A;  4JI2 F;  1KLN A;  2DEJ A;  1T9T A;  5DQG A;  4OZL A;  1H73 A;  1WHW A;  1NM2 A;  2B0G A;  2BJ9 A;  3GON A;  3TAQ A;  1HA1 A;  2BRK A;  4AXJ A;  1Q0N A;  4LJM A;  4CLL A;  5B0B A;  4ECR A;  1SC4 B;  2FGO A;  1NEE A;  4O0N A;  1SH2 A;  2DYA A;  1LFP A;  5KG3 A;  2CG8 A;  3GU0 A;  3KKF A;  4NRU A;  2XYP B;  4OZJ A;  1TP7 A;  1R27 B;  2FZK B;  2KJW A;  1K0V A;  1S1W A;  2R3V A;  1DTQ A;  2E66 A;  5JUM A;  5HRO A;  1QSS A;  4DR4 J;  1BLU A;  1FA0 A;  1AB8 A;  3D5M A;  2XLJ A;  4J9M A;  1OMS A;  2QIF A;  1NKB A;  4ICL A;  1MRO B;  1S7I A;  4USJ C;  1YWX A;  4ELT A;  1QTN B;  4I2Q B;  5A8R B;  3KUH A;  2H5E A;  3GV7 B;  4LBI A;  3H2V E;  4RNM A;  1HKA A;  2J9C A;  2F9J A;  2UVU A;  1C4A A;  3C3L A;  5E3C A;  5AXL A;  3F56 A;  4MKB A;  1FDD A;  2F40 A;  4NLS A;  3EVO A;  1LQ9 A;  4MH8 A;  2ROE A;  4JYA J;  4DZ6 A;  3BDP A;  5CAB A;  3G4S S;  3LP1 A;  2MQO A;  4LSN A;  2WBR A;  5D0G A;  3HSD A;  1RHR B;  1WHX A;  5LM7 E;  4FF4 A;  1VRQ C;  5HJX A;  3SQO P;  2VJU A;  4MFB B;  4RUB A;  3TI0 A;  2P2C B;  1BE4 A;  3NAI A;  1WEZ A;  3JQK A;  5CA5 A;  3MMB A;  1TUG B;  1N32 J;  3AOD A;  1VHI A;  4RW4 A;  4KO0 B;  1GAO A;  2AEM A;  3UR0 A;  3PEJ A;  1GH8 A;  5HMX A;  4DQS A;  2RF2 B;  1RIS A;  2MQN A;  2FGC A;  1SBR A;  2HNZ A;  3N28 A;  1RJJ A;  1WEL A;  2RKI B;  1S1U B;  2GX8 A;  1SC3 B;  4YUD A;  3Q8U A;  1EB0 A;  2ZWO A;  3LAK A;  4LSN B;  1EP4 A;  1S59 A;  4P10 A;  1UW4 A;  4ZN1 A;  5MLC V;  1AXQ A;  2LQ8 A;  4DR5 F;  4RUC A;  4RNO A;  3C6U A;  1FRJ A;  2O3D A;  5CYM B;  2IM3 A;  3C6T B;  3NY0 A;  4ERD A;  2WVD A;  5DQI A;  2DNR A;  5HAN A;  3W9H A;  1VK8 A;  1TKX B;  2ILZ A;  1CSJ A;  3A3O B;  4I1T A;  4KH0 B;  3BB5 A;  2UUB F;  3HHN B;  5FLX U;  3HXM A;  3UN5 A;  1TL3 B;  3MUT P;  1RTZ A;  3NOC A;  2YNH B;  2IA6 A;  1RTI A;  3RAX A;  5A8K A;  2JNJ A;  1T05 A;  3EM1 A;  4UST A;  4NYZ A;  5E5N A;  5KG1 A;  1Y5I B;  3KLI A;  2EC0 A;  4RU9 A;  1PJ6 A;  2HWH A;  2MSS A;  3OTB A;  4IDK A;  4ZDN A;  2UU9 F;  2XCA A;  3CDW A;  2NUU G;  4MYT A;  1WEX A;  1UKU A;  3U1L A;  4LF7 J;  3C16 B;  3SCK E;  2ZHA A;  3MEE A;  1HW8 A;  1KTQ A;  2D9O A;  1RAD B;  4R8U B;  5KFM A;  1VQO S;  1S57 A;  4C3L A;  5I3U A;  3G82 B;  1K8A T;  2VPW B;  2NZ4 A;  3MAQ A;  3IGN A;  3W2W B;  1MWQ A;  3KG1 A;  3KLI B;  4MFB A;  3V81 B;  2AGQ A;  2HVE A;  3HHE A;  4WU2 A;  5GAG U;  3DXS X;  2DR9 A;  2R8K A;  2MLZ A;  3BBF A;  2CJQ A;  2H65 B;  2ZOG A;  3B4M A;  2MZQ A;  1VLO A;  4AND A;  2H9Z A;  3CCJ S;  1HPZ B;  5JVH Q;  3UW1 A;  2B56 A;  5KFQ A;  2RF2 A;  2FLN A;  1JLA B;  3OL9 A;  1VQS A;  2YNI B;  4MK9 A;  1V6H A;  2HQG A;  5K14 A;  2IFX A;  3FC9 A;  4YR0 A;  2PEB A;  4DFK A;  4NRT A;  1L3V A;  3C66 A;  4ZP8 A;  4CLF A;  1I94 J;  3UNY A;  1MU2 A;  1U45 A;  1MLA A;  5GAE I;  2F3J A;  2D74 B;  5CYQ A;  4LF5 J;  1RLD A;  1HWJ A;  4I2P A;  4PXB A;  1NHK L;  4USH A;  5HBM A;  4LF9 F;  3UVJ B;  2VA2 A;  2C42 A;  2QEX S;  2KG1 A;  1TAU A;  1IBM F;  2RH3 A;  1ZAV A;  1JWW A;  3R7B B;  1RXO B;  5EX0 A;  2QYG A;  4X84 A;  1WWH A;  3QO9 B;  1M5K C;  3G71 S;  4F0H A;  1TKZ B;  2FZG B;  4G6V B;  1SJ1 A;  2L48 A;  2WVC A;  3CCW A;  3C46 A;  5F8N A;  1URR A;  3KUG A;  3OTC A;  1FRI A;  2AJF E;  1DJ0 A;  2X1G A;  3AQO A;  1R8B A;  4C7Q A;  1YZ7 A;  3M2V B;  1IUJ A;  2XG8 A;  4I2P B;  2BJ1 A;  3CED A;  4DL4 A;  1ZTT A;  1IM4 A;  4LF8 J;  2G0C A;  4IG3 A;  1SKU B;  3D3C J;  2ZH1 A;  5D0R A;  2LDI A;  1K44 A;  3FRY A;  3LO3 A;  4PXC A;  1ZET A;  2XY7 A;  1F5C A;  1QAX A;  1SQE A;  2AX1 A;  2ZD1 B;  4NYO A;  3IBC B;  3KJV A;  1WF0 A;  3P3D A;  2R7O A;  4TQR A;  1FVQ A;  4C8O A;  3FEZ A;  2NR0 A;  6FDR A;  1NJW A;  4Z2X A;  4P74 A;  4DBQ A;  5IXU A;  3OL8 A;  3I0S A;  1VQ7 S;  4GKK J;  1WD6 A;  1CLF A;  4NCG B;  1RHM B;  4H4K A;  2IVF B;  3OJU A;  4Q8F A;  1TL1 A;  3QLH A;  4KJI A;  2WON B;  5DQH A;  2R7R A;  4DV2 F;  2IBK A;  4Y2A A;  3MPW A;  1HPZ A;  4JBC A;  5AJ3 F;  4CO3 A;  3JSM A;  2QG9 B;  3W9J A;  3M30 A;  2YNG B;  2FYX A;  4CM0 A;  2BYC A;  4AUK A;  4Q2M A;  5K14 B;  3HFV A;  2Y8Y A;  5J2N A;  1U1Q A;  4PXD A;  2AWZ A;  1RWO B;  1TFW A;  2M2B A;  3IXQ A;  1PJ7 A;  2COL A;  3NGT A;  3WQP A;  5IM0 B;  3W9I A;  4NLO A;  2MZT A;  3VAK A;  2WHO A;  1S6O A;  2VHG A;  2R7S A;  3RBE A;  4ZVH A;  4X4V A;  2GZO A;  3PYD A;  3E3X A;  4NA2 A;  2C2R A;  1SL0 A;  2IBO A;  1U1M A;  1JLQ A;  1SKS A;  3TVK A;  2PI5 A;  1HWL A;  3TUZ C;  3R5C A;  1IJF B;  4CLK A;  2POK A;  2GVD A;  2C3Y A;  3W8P A;  2OEK A;  2ZOM A;  4KIA A;  3UDV A;  2RQC A;  2BM1 A;  2AU0 A;  3SCL E;  2ZZN A;  1N52 B;  4EYH B;  3DKD A;  2BM0 A;  4TU7 A;  2HHU A;  2A2C A;  3RRG A;  2VOP A;  2ZFH A;  2K2P A;  3H90 A;  3M8P A;  5BYS A;  1QLN A;  4NLR A;  3DDI A;  4DV1 J;  3R2D J;  1S9G B;  3UWT A;  2VDI A;  3TEG A;  3H7H B;  1G1X A;  3FSX A;  4LF7 F;  2EVZ A;  4WK1 A;  5C5J A;  2O5D A;  2OMO A;  1IBK F;  3UCZ P;  2FY8 A;  1PGZ A;  3TUI C;  1NPK A;  2E5J A;  2FVS A;  1NK4 A;  1SI9 A;  4PPZ A;  2M4M A;  3R6L B;  1ZH5 A;  3HI9 A;  5M2U A;  2N3O A;  1A0O B;  3ADA C;  5EX3 A;  4UOF A;  4FXV A;  1DZ5 A;  3M8W A;  2DNZ A;  4TXS A;  3IMQ J;  1L3S A;  3K5O A;  4ZCL A;  1RAB B;  2DNK A;  2IVM A;  1YJW S;  1NK8 A;  2RE1 A;  2V8G A;  3FFI B;  2GIR A;  3M8P B;  4NCG A;  4USU A;  5BJR A;  4FPR A;  1UA1 A;  3TZX A;  3TZW A;  2G0J A;  3BSN A;  4O23 A;  4QYR A;  3OTE A;  4V19 X;  1OIA A;  3IR7 B;  1TL1 B;  3QLH B;  4M5M A;  3CIZ A;  4YDX A;  5DG7 A;  2R2T A;  1I6J A;  3X1L B;  3N0V A;  4TU8 A;  4ED2 A;  2OGU A;  2LEC A;  1YX2 A;  3BKT A;  5DZ7 A;  1Q8L A;  2Z2Z A;  4O3O A;  3JSM B;  3L3C A;  4C8Y A;  4URS A;  3MF5 A;  3MCS A;  2M9K A;  4NX9 A;  1FNX H;  2O1P A;  1NDK A;  3ZTP A;  4Y28 C;  3JB9 k;  4HAC B;  2DIV A;  4ID8 A;  4UZC A;  3ZC4 A;  1JNR B;  3FFI A;  1F0X A;  2EPI A;  3SIP B;  3ZZO A;  2G13 A;  4FBT A;  1F1B B;  3D6T B;  3DCA A;  2ZH5 A;  1IM6 A;  3DLK B;  2HHH F;  2B7C B;  1N88 A;  2CA9 A;  1T0T V;  2OEJ A;  3CE8 A;  3G6Y A;  1TFY A;  5G4D A;  1S1X A;  3AA9 A;  1NME B;  2JZ5 A;  3QT7 A;  1T9X A;  4ZVT B;  1ZBT A;  2WBM A;  3PM9 A;  4C0O C;  4N8O A;  3O6Q A;  2MKK A;  1RAH B;  3DC2 A;  3BEG B;  4EBD A;  2Z4P A;  4KH1 B;  2MQL A;  3TUP A;  2DBB A;  3D54 A;  3W66 A;  5HVG A;  3PIO Q;  2AYB A;  3ILI A;  3ITH A;  1NK6 A;  1VC5 A;  1FX4 A;  1UW9 A;  2JLE A;  5FDL B;  4AFF A;  2OJ3 A;  1VK3 A;  2AX0 A;  3QJP A;  4ZIV A;  3GYN A;  3L4B C;  2CQ0 A;  4ELU A;  1KP6 A;  1YQH A;  1B3T A;  3AHP A;  4A8M P;  3C15 A;  2DTJ A;  3WDO A;  4KHR A;  2F8H A;  4QOT A;  4NPO A;  1Y3J A;  1RAG B;  2HFO A;  3I87 A;  4WPA A;  4IH5 A;  4NML A;  3H8Y A;  2V5H G;  4NLD A;  2UVW A;  1CC8 A;  1VJW A;  3BS9 A;  1D09 B;  2H54 B;  3LOU A;  4WE1 B;  5HMZ A;  5AE2 A;  2HS3 A;  1PYO B;  2FC8 A;  2GJ2 A;  3DMJ B;  4LRF A;  1YTY A;  2DPJ A;  1PIE A;  4X65 F;  2ZC3 A;  2LEB A;  5J2Q B;  4Y2I A;  3CJ2 A;  2OD6 A;  5ETK A;  4AL7 A;  1I3O B;  1CQM A;  1FRM A;  3KK3 B;  4W4M A;  4ES3 A;  1DQA A;  2AYG A;  2RQ4 A;  2DGV A;  3CJ3 A;  4IR9 A;  1S5Z A;  3GPA A;  5L1L A;  2IPO B;  2HAF A;  2DR5 A;  1JLE A;  1F3F A;  1UPP A;  2PEH A;  4NZ6 A;  1TQL A;  4OFZ A;  4RW9 A;  4ZVF A;  2DPI A;  1RU2 A;  4A47 A;  3R3T A;  5JJB A;  4Q8E A;  4FF3 A;  1IR2 A;  2CYY A;  1NHU A;  2KYX A;  4QW8 A;  2C2M B;  1VBY A;  1YBT A;  4V19 J;  3TYT A;  1HD0 A;  2LMI A;  5KFD A;  2IJR A;  3WX8 A;  1C0U B;  5KAK A;  3KTQ A;  2FJD B;  1TMJ A;  1MN9 A;  3MR3 A;  1OSC A;  3K59 A;  2VBX A;  4MK8 A;  3DI6 A;  5D0E A;  1R31 A;  3I55 S;  3KK3 A;  1U1K A;  5CXT A;  3G96 A;  3LTO A;  1JJ2 R;  1TU0 B;  5ETR A;  3DU6 A;  5KOX A;  1VQN S;  1U47 A;  1A6L A;  2LXI A;  3M2U B;  4I64 A;  1RZM A;  2HZA A;  5EWF A;  1REV B;  2MJN A;  3PJX A;  2MGZ A;  2V8V A;  5A0Y A;  4F4X A;  2G4B A;  1LWE B;  1WUU A;  4RW9 B;  1BQX A;  4ETX A;  1Q16 B;  5L46 A;  4A48 A;  3MEC B;  4USK A;  5KT4 A;  5C24 A;  4B9M A;  5D15 A;  1FXR A;  1KON A;  1U8W A;  2E5L J;  4ELV A;  1HI1 A;  4ZP9 A;  2DR7 A;  1M5S A;  2FPH X;  1YJU A;  1C1C B;  2WB4 A;  2WVF A;  3MHY A;  3QGH A;  4IH6 A;  3ZTR A;  1H3D A;  3I5B A;  4OJ3 A;  4O3P A;  4DX7 A;  1KHV A;  2F7V A;  2PA8 D;  2M7S A;  1BQM A;  4O4G A;  3MTK A;  3EZO A;  3UFC X;  5HP1 B;  4NLY A;  2BEF A;  2RRB A;  2DY9 A;  3DM2 B;  3H2U B;  1SB6 A;  4HKQ A;  2F8M A;  2B43 A;  5ITH A;  3H40 A;  2B9X A;  1NPR A;  3PO5 A;  2XGQ A;  2HAI A;  3HUL A;  1NU4 A;  1VIX A;  4P72 A;  2FUG 9;  3TWZ A;  2RAQ A;  2HFZ A;  4P7V A;  2RRA A;  5KFW A;  4OI3 A;  5LOQ A;  4K4T A;  2VU5 A;  3GE9 A;  2Z2L A;  3D3B J;  3MUM P;  4FYW B;  1U1O A;  1I51 B;  4ID5 A;  2Y8W A;  2AEF A;  5ETM A;  4QR2 A;  4FYD A;  2QLW A;  2OPS B;  4OYM A;  2FJV A;  5IWA F;  2FHO B;  2K7K A;  3FQK A;  4ITS A;  2CQB A;  3OR2 A;  3IRX B;  4CO0 A;  4QIW D;  2UUA J;  3MPY A;  4HLB A;  3D0I E;  4B3O B;  1EJ7 L;  5C42 B;  1PYT A;  1HBN A;  2RD5 C;  2BA9 A;  2IVY A;  3N5F A;  3MPV A;  2C2O B;  1OJ4 A;  1OQ3 A;  2H3E B;  4LVN P;  3MUV P;  3NMR A;  3W60 A;  2VFR A;  4PCQ A;  2YWE A;  4DG1 A;  3PFE A;  3G8S A;  2NSB A;  4YB6 A;  2QGF B;  3OBI A;  4QZV B;  4JI6 F;  2EI5 A;  1PSD A;  1TVR A;  2WVB A;  1N0V C;  2ASY A;  4KRW A;  4CTA A;  4O3N A;  2W9B B;  1GMU A;  2QC3 A;  2RT3 A;  5CZX A;  1KFD A;  2V4J B;  2OPR B;  5KFR A;  4NWB A;  3IWL A;  4ZN3 A;  1X4E A;  4WP9 A;  1KQK A;  4CYU B;  4F50 A;  1Q7Y T;  1I94 F;  4K0K F;  2LLZ A;  4R0J A;  2F4V J;  2G1D A;  2BJE A;  2D3O R;  3I0R A;  4GO7 X;  5CHC B;  5IT9 U;  1FFS B;  3TZY A;  4B17 A;  1Q1K A;  2Y0S D;  1DQ8 A;  4P75 A;  4C6A A;  4EO6 A;  3SI8 A;  1TK8 A;  1QE1 B;  5CZV A;  1C1B A;  1YJR A;  2VG5 A;  2RIJ A;  3N9U C;  1MMD A;  2FVP A;  4UOC A;  3PR4 A;  4ZPD A;  4N77 A;  1F5A A;  2QL7 B;  3D66 A;  4YEA A;  2XLK A;  4QU6 A;  4M94 A;  3D6H B;  2E44 A;  2BXJ A;  1S1V B;  2KT5 A;  5IOL A;  1SIW B;  2CKW A;  4NXN J;  2FHJ A;  1OPZ A;  3HF5 A;  3F44 A;  4Q0B B;  4PG5 A;  2QA1 A;  1R0A A;  2DXD A;  1RSC A;  3T1A A;  1JLG A;  3MM5 B;  1W7W A;  2Z8Q A;  3DOM B;  2MKH A;  4OV6 A;  5AXM A;  2QTW A;  5C25 A;  1W26 A;  2MXY A;  3KHL A;  3CJ4 A;  2ZJQ Q;  4H4O B;  3EDQ B;  3QT8 A;  2P9C A;  5F3T A;  1N8R T;  2RJZ A;  1JLF A;  1PYS B;  2XYG B;  2PO4 A;  4EI2 A;  1EAR A;  2B8Q A;  4F4K A;  3TX8 A;  1XNR J;  4J9Q A;  4OI4 A;  4OYX A;  1WC0 A;  3DRR B;  3TA1 A;  3Q2T C;  4HT7 A;  2CQ4 A;  4ZPT R;  1CUL B;  4OLO A;  1FJ7 A;  3LP0 B;  1RWW B;  4V1A k;  1S1V A;  4WFB Q;  2ZM6 J;  2OSQ A;  3T6J A;  3MMB B;  3BJY A;  3GMG A;  4JI7 F;  4ED3 A;  1VQP S;  2FVC A;  4RW4 B;  5HAO A;  3UD4 P;  2BW7 A;  2J6U A;  2OAU A;  2HS0 A;  2KYZ A;  1JLG B;  3MM5 A;  4NLP A;  1XMB A;  1FD2 A;  2CNN B;  4W98 A;  1VBX A;  4TYB A;  1SKW A;  1CC7 A;  4NLQ A;  4PZV A;  4DX5 A;  1R7I A;  3POT B;  1N5Q A;  4OIX A;  1LWX A;  1OY9 A;  2C2K B;  2EFP A;  3W5X A;  5IV3 A;  1DAX A;  4PQA A;  3CUN A;  2LXF A;  1FDB A;  1GMW A;  1O6X A;  1SC6 A;  5CQG A;  2PMZ D;  4BC7 A;  5KG5 A;  4ZP6 A;  4F67 A;  3JAM Y;  3T41 A;  3RTV A;  2NCK L;  2PE8 A;  4ZVO B;  5I42 A;  1M1H A;  1TL4 A;  5B7W A;  3TQ1 A;  1XIQ A;  2DR6 A;  3AB4 B;  3RR8 A;  4ZCI A;  2HIQ A;  1ICE B;  4IO9 Q;  3FCW A;  3PYF A;  4OHX A;  5AE1 A;  1YZ6 A;  3IR6 B;  1SV5 A;  1RK8 A;  2GQ2 A;  2IYI A;  1SJQ A;  1JLB A;  2XMT A;  3U7J A;  2YPY A;  3RBZ A;  2JEF A;  1BQN A;  2W9C A;  1KVJ A;  1XNR F;  1UJ6 A;  4QR0 A;  3TRG A;  1KFS A;  3QRQ A;  1IQZ A;  4M5J A;  4KFB B;  2AD9 A;  5LMU F;  4H4K C;  2XBP A;  4N47 A;  3OD2 A;  2R7W A;  1D3W A;  3VAI A;  3U1N A;  2BDP A;  3TNV A;  3CPW R;  1QSL A;  1FHT A;  2HPU A;  3J7Z T;  1PBU A;  5J2P A;  1RA7 A;  3QFH A;  4RX6 A;  1ZM4 A;  3EXY A;  1JX4 A;  3HKW A;  3CME S;  4F2S A;  4EUV A;  3MEG B;  1E6Y A;  2M3D A;  4O44 A;  2DT9 A;  2L9D A;  1XJW B;  2JWN A;  4OI6 A;  5HLF B;  4PQU A;  1FXL A;  3EGN A;  3FBF A;  3UDL A;  3Q8R B;  4AYB D;  1NH7 A;  2G2O A;  5HRO B;  4OZ0 A;  3B8H A;  3B78 A;  5D4N A;  3BQ0 A;  2H4W B;  3D9B A;  5DG8 A;  3ELH A;  1V9O A;  3NLC A;  3Q22 A;  1WHY A;  4CP5 A;  2HHH J;  4J91 A;  4A8O A;  1IWG A;  1ZM2 A;  2R7Q A;  1UEK A;  1N0U A;  3AOB A;  1VBK A;  3GP9 A;  3MMC B;  3MMJ A;  2X3D A;  4KV8 A;  4MIA A;  2RU9 A;  2FJW A;  3Q8Y A;  2F1F A;  2NRE A;  3DN9 A;  1G2E A;  4UY8 5;  4U7U D;  2I0X A;  2DO4 A;  2DHG A;  2HQD A;  3OVB A;  4EU0 A;  5KFC A;  3J81 Y;  5HLF A;  3OVA A;  1TK0 A;  2W7A A;  4PAA A;  1IKY A;  4ZVQ B;  1NK7 A;  3KOA A;  2XS2 A;  3UCU P;  3GSI A;  2E7W A;  2IY5 B;  2ZH3 A;  2J5A A;  3GJT B;  2ZZM A;  2QN6 B;  1QUV A;  2YNH A;  2CAJ A;  1IKW A;  5D0H A;  2CVE A;  3LGN A;  1UZD A;  1NJX A;  1EX8 A;  4ZIT A;  2XMK A;  3EZU A;  3KLF A;  1SIZ A;  4Q44 A;  2MHE A;  1T9U A;  2OML A;  3NAH A;  3QPI A;  5J2M B;  1UWB B;  2FLL A;  1H7W A;  2ZJR Q;  3DDN A;  3RYL A;  4Q5V A;  2OI2 A;  4GVB B;  3QT6 A;  3HLU A;  2MQQ A;  4IRD A;  3OHB A;  4MIW A;  2ZIT A;  3VGV A;  4YP3 A;  2ZH6 A;  3RW6 A;  4DI6 A;  4WK3 A;  3TUJ C;  4ZPB A;  4X4O A;  3QJJ A;  1IKY B;  1WG1 A;  2GJI A;  2X1F A;  1CVJ A;  2ZE2 B;  3CSK A;  4FXW A;  1HAR A;  4CT8 A;  3AAW B;  2VQF J;  1PCA A;  3V4M A;  4WKY A;  4NYP A;  5L1J A;  4ECQ A;  4DL6 A;  1VIO A;  1PBA A;  4TY9 A;  1VOM A;  1P9Y A;  5K5M A;  4Y6I A;  1FEH A;  5KFI A;  1NO8 A;  4PEO A;  4CNY A;  1PAU B;  2LXU A;  4OV1 A;  1G7C B;  2J76 E;  3D28 A;  4EMD A;  3PJW A;  2HND A;  4I2Q A;  5A8R A;  3S7R A;  3LGH A;  1JXL A;  3HFZ B;  4K5R A;  1HI0 P;  1FJG J;  1YG0 A;  2CWK A;  2E1P A;  5E41 A;  1RT3 B;  1KOO A;  2VD3 A;  1ZAX A;  3G2X A;  4YDD B;  4M5L A;  1IWA A;  2O67 A;  1HHS A;  1RT7 A;  1SXL A;  1JIH A;  2CRL A;  2LA6 A;  3AA8 A;  2B51 A;  2GJF A;  3ISZ A;  3UR3 C;  2W4C A;  5KT2 A;  4NAS A;  5GAD U;  1YGY A;  2W7O A;  4GRS A;  4RR5 A;  3CCL S;  3LP1 B;  1RTI B;  1UL3 A;  1SC1 B;  4ILL A;  2IM2 A;  2LCW A;  3TAN A;  3WC2 A;  5IT9 Y;  1XQI A;  4X62 J;  4JI3 J;  2V68 A;  4QIF A;  2DNO A;  2BAB A;  4DV0 J;  4DL3 A;  2JEJ A;  2QFI A;  2CQC A;  1FD8 A;  3G6X A;  2CWX A;  2HBZ B;  4N7T A;  1X5T A;  4R0E A;  5LMU J;  4ECU A;  3L7P A;  4LF1 A;  2CPD A;  2GC8 A;  1D9A A;  3M30 B;  2X1A A;  4OHY A;  5IT4 A;  1RTJ B;  3C16 A;  4P9S A;  3ZZP A;  1MG7 A;  3D4J A;  2FLP A;  4O3R A;  4LFB J;  5J1N A;  3A3N B;  2KXN B;  1T9Y A;  2F8E X;  3KDN A;  3NL0 A;  2IJF A;  1H98 A;  3BGR A;  3Q0A A;  1IKW B;  4TLR A;  2BOA A;  4OX7 A;  1KD1 T;  4LR8 A;  3W2W A;  4EBC A;  1F6T A;  2JVR A;  3ZFV A;  1IKX A;  5BYQ A;  2UV8 A;  3W62 A;  4PUO A;  4WYW A;  3C6T A;  4WTY A;  1XC9 A;  2ALZ A;  5KG7 A;  4QWC A;  4ER8 A;  1RHU B;  5HO4 A;  3BSA A;  3M7V A;  5SUH A;  3OR1 A;  3FJ2 A;  2Y3Y A;  4ANC A;  4ED5 A;  1YRU A;  4RUA A;  4URG A;  4BC9 A;  1TKD A;  4XPC A;  3HO1 A;  4X65 J;  5C7P A;  1AZS B;  2MJU A;  2B4V A;  1TTH B;  1VS3 A;  4DPT A;  4WZM A;  4LF5 F;  3BGR B;  4ILM A;  1N36 F;  3Q89 A;  1GK8 A;  2JH3 A;  2W2Q P;  2WCX A;  2MKI A;  4DUZ F;  1J5E J;  2XYH B;  3MM6 A;  1S6P A;  1XR7 A;  4OJH A;  2CNK B;  5HQ8 A;  2DGO A;  1CG2 A;  2LEP A;  3CTR A;  2HFS A;  2CQI A;  3EWG A;  6AT1 B;  4DR2 F;  5ETS A;  1VQL S;  2ZUA A;  3BSO A;  4QBU A;  1NZ8 A;  4K7Q A;  1FNO A;  2LU2 A;  4QR1 A;  5DDR C;  4IG0 A;  4J9U E;  5D4P A;  2QA4 G;  2KVQ E;  1CBK A;  2RDI A;  5G0R A;  2AGP A;  2ZBR A;  3UD5 A;  1YIT S;  4X2B A;  2R9L A;  4M5D A;  4JUZ A;  2HMI B;  2VBZ A;  1IKV A;  2VV5 A;  4YHH F;  3CD7 A;  1FF2 A;  3W1Y C;  1UVI A;  5E33 A;  2GO8 A;  4NCB A;  2YNF B;  5EWE A;  3MCN A;  5DDO C;  5EGY A;  3H4B A;  1X4F A;  1WF2 A;  2E5I A;  2NXE A;  2V8P A;  2ZD1 A;  4MKV A;  3UN2 A;  3VGS A;  4TQS A;  2QA2 A;  2HQI A;  2VG7 B;  4OZ5 A;  2Q66 A;  1N34 J;  1RAO A;  2BMB A;  1N5V A;  3BQ2 A;  3LH2 S;  1F2H A;  1WSV A;  3DGP B;  3G6E S;  3N6M A;  1FKP B;  2VDH A;  3IBW A;  3ZNU A;  3TO8 A;  3QZ7 A;  2ZDO A;  3T1H F;  1XNQ J;  3H59 A;  3MFH A;  4K4Z A;  1YJ7 A;  4M5D B;  1FKA F;  4I6W A;  1MU2 B;  1LW0 B;  2JFD A;  2GGP A;  4MK7 A;  1K73 T;  3NWG A;  4K5S A;  1Y0H A;  4DPW A;  3CCT A;  7AT1 B;  4TY8 A;  3T1H J;  2Z30 B;  3TEH B;  1TUV A;  5JXS A;  4ES1 A;  1U49 A;  2ZNY A;  2I38 A;  5L1K A;  2YNF A;  4P2S A;  4RZR A;  1JKH A;  4U67 Q;  2B5J B;  2RSQ A;  3Q2S C;  2E1R A;  4Q45 A;  3L7O A;  2AZ1 A;  1HYS A;  1ZOT A;  3W8G A;  4DV6 J;  2KVI A;  1T11 A;  1L5U A;  1IR0 A;  3MAH A;  1RT6 A;  4J9V A;  3CUL A;  3LGM A;  1FFW B;  3IS9 A;  1Z2Z A;  1UP1 A;  4YHH J;  1AZS A;  2OPQ A;  3MM7 B;  1SPB P;  4DZD A;  4Q0B A;  3WIV A;  3FBE A;  3M2R B;  4HTJ A;  3T19 A;  1DBD A;  2JL9 A;  5F0W A;  2YPZ A;  1FX2 A;  2YWF A;  4AT1 B;  2NUH A;  2QRR A;  3J7A 1;  2CPE A;  1PG5 B;  2WW8 A;  4XDC A;  5B0G A;  2X3G A;  3MM6 B;  3HDS A;  1LWF B;  1LWC B;  9RUB A;  4USV A;  1HMV B;  2UUA F;  4W90 B;  1KVK A;  1T9V A;  1QD1 A;  2ZH8 A;  2RUS A;  4CLU A;  5LSO A;  5M2P A;  3MR6 A;  3PCO B;  3D0G E;  4JOU A;  3CNQ P;  2EBG A;  4IOB A;  5CD4 H;  1IBK J;  3BKU A;  3DDK A;  2ZBP A;  3LUY A;  2UXC F;  3ISN D;  3FNN A;  3QWP A;  1G3O A;  4ILR A;  2DRB A;  4C2M A;  3AD7 C;  4Y3C A;  3PZP A;  3QID A;  4KHP F;  4BLG A;  5HJY A;  2OFG X;  1NDP A;  5HAT A;  4LIW A;  3OHA A;  2CDQ A;  3NBP A;  1B70 B;  3C14 B;  1IN0 A;  4IQM A;  5J2Q A;  1RTH A;  3EZ5 A;  4FPI A;  1U09 A;  2GHV C;  3CJ5 A;  3QGG A;  3QWU A;  4F4Y A;  2UVR A;  3V6D A;  1RWP B;  2EFG A;  2EWH A;  2J9D E;  2CFX A;  2GS8 A;  2V2K A;  2Y1R I;  3BYP A;  3TA0 A;  3HK2 A;  1WC3 A;  1OS5 A;  4P7T A;  3E01 A;  4L75 A;  3CWJ A;  2BAN A;  3GFY A;  5J2N B;  1A9N B;  6FD1 A;  3MGJ A;  4O3Q A;  3W7B A;  3BR9 A;  3HZG A;  2FY1 A;  4DR4 F;  2BBE A;  1BUX A;  3UDC A;  4C9D A;  3MPD A;  2AQ4 A;  1RYR A;  3OXG A;  3A13 A;  4CO5 A;  5JVG Q;  2LYV A;  3LAL A;  4OYZ A;  4U7U K;  3MM8 A;  1FEE A;  3SFG A;  2IRY A;  2W9A A;  1VQ5 S;  1S76 D;  1GX5 A;  1OY6 A;  2NPI A;  5H1S V;  1BMQ B;  4DV1 F;  2MDA A;  1U25 A;  5B0A A;  3RBX A;  2JEG A;  4R5P A;  1RT2 B;  4NXM J;  2R8I A;  4HH1 A;  4I4B A;  4BWM A;  2GVD B;  4ZK7 M;  2BE7 D;  4YB7 A;  4LFA J;  4G1Q A;  1DY3 A;  2BE2 A;  3AB2 B;  3PX0 A;  4LF8 F;  4J9K A;  1ULR A;  2KO1 A;  4NZ0 A;  1FKO A;  4ZCK A;  2A6O A;  1M90 T;  3MM7 A;  1VHF A;  4HHJ A;  1Y9O A;  4HHH A;  4F4A A;  2CG4 A;  2FD2 A;  2JRS A;  3UPF A;  4Q43 A;  4ECW A;  5M2R A;  2W25 A;  4PXE A;  1T3N A;  4IRC A;  2FQQ B;  5B08 A;  2CPF A;  1C1C A;  3QAU A;  4K4Y A;  1BWE A;  2H48 B;  1DAR A;  3KNG A;  2XUL A;  2ZUG A;  4F26 A;  2KFN A;  4ZPC A;  2ZDP A;  1U48 A;  2HRY A;  5I3P A;  2IDE A;  4CH1 A;  4IOA Q;  4X4S A;  3ENA A;  4Y34 A;  3CJQ A;  5HP1 A;  3J7Y I;  4Y0F A;  4J7C A;  1XMQ J;  1JK9 B;  2ERR A;  4RWX A;  3ZO7 A;  2CZV C;  1WKK A;  3ISN C;  4WXW A;  2QA4 S;  4Z7C A;  5K8N A;  3CCV S;  2M8D B;  2PFD A;  4LSL B;  5GAE U;  3CC7 S;  1RBO B;  4ECY A;  2BJ7 A;  1N6Q A;  2Z56 B;  1JLC A;  3VF0 B;  2EG1 A;  1FKO B;  3GFZ A;  4WP8 A;  3V6J A;  2RQM A;  5IT0 A;  4YME A;  2BQ3 A;  1YK9 A;  3ITH B;  5LJ5 Y;  3H25 A;  4UTG A;  5AXN A;  2GHP A;  2DGX A;  1X31 C;  3R5B A;  1YIJ S;  4DSK A;  2KZM A;  2CPI A;  2FJE B;  1HQE A;  1DHM A;  2HWT A;  3C8Y A;  2A10 A;  4JI2 J;  1RYS A;  2F9D A;  2CIM A;  3OV7 A;  2WVE A;  3DGV A;  4ETZ A;  2DIS A;  4LQ3 A;  4LF4 F;  1XN9 A;  3I82 A;  2IAJ B;  4RKU C;  4IRK A;  4JV5 J;  3M2U A;  1UEV A;  4F8R A;  5KFA A;  5D8H B;  1P9Q C;  3BDE A;  3E01 B;  1KVI A;  1F3V A;  2VON A;  5C42 A;  1EZZ B;  1LWE A;  4KTQ A;  3BO2 A;  4FXD A;  1MSW D;  2K8G A;  1RWX B;  2E7V A;  3MM9 B;  2UV8 G;  3ZZT A;  1JB0 C;  2E5H A;  2DGW A;  4C8L A;  1S4E A;  4A8W A;  2PDA A;  2E29 A;  2RRN A;  2OH2 A;  3KJF B;  4DL7 A;  3RAM A;  2YWH A;  4CH0 S;  5KFX A;  2HK3 A;  1RCX B;  2F63 A;  3SSR A;  3M9M B;  2J6T A;  2JFK A;  4WFX A;  4CI0 B;  3PEH A;  3N4W A;  2UUW A;  4G1I A;  1RWV B;  3HCX A;  3PFO A;  2NPF A;  3TJA A;  1RT2 A;  2XO7 A;  1RT1 B;  2W9B A;  1TV6 A;  4HEA 9;  3L9Z A;  4EZ9 A;  1RE1 B;  4ZS6 A;  3FQL A;  3VAG A;  2E1C A;  3NGD A;  1FTC A;  1JLE B;  1D9D A;  4B3S F;  2V9W A;  3MM9 A;  5IFM A;  2KXF A;  2DXF A;  2HW3 A;  4F25 A;  2V9K A;  4B3T J;  5L8R C;  3MED A;  3D1O A;  3PHT A;  4OI1 A;  4ZPW R;  3V6H A;  2J8A A;  2QO3 A;  1FER A;  3SYZ A;  2QMX A;  3SZ2 A;  2EFQ A;  1S49 A;  2JOQ A;  4OZ3 A;  4ES2 A;  4KGM A;  3LF0 A;  3SV4 A;  3QSY B;  3MMA A;  5H9F J;  3BPD A;  1S9E B;  2HGN A;  4L3K A;  4EK2 A;  4K2X A;  3S6E A;  2QV6 A;  3L95 X;  3HD1 A;  1XBW A;  1EKS A;  2D7S A;  2B9Y A;  1S48 A;  2ZBQ A;  1TV6 B;  3MAA B;  3QGP A;  4PYA A;  5F8H A;  3BM7 A;  2XZD B;  3GG0 A;  4DR6 F;  2DNM A;  2MYF A;  4WWS A;  2YX1 A;  4KYZ A;  2ZOF A;  3SDE A;  2ASD A;  1N6Q B;  1CJV B;  1HBO B;  3W2V B;  1HFE L;  2GQQ A;  3F73 A;  1HLW A;  4PUO B;  4AL5 A;  2NXJ A;  1B99 A;  1WC5 A;  2WSF C;  4ZVR B;  1WI8 A;  4UZB A;  1UVJ A;  4DR1 F;  2ALY B;  3T3F A;  4RBV A;  1X0F A;  1R43 A;  3NNC A;  3M6U A;  4X4R A;  3KLH A;  3H4D A;  1V5V A;  2CJ9 A;  3TAR A;  1TL7 A;  1XR6 A;  1URN A;  3PTW A;  4CTA B;  5IC6 B;  4DPO A;  1U24 A;  1YJV A;  2I5J B;  1WDT A;  3VZH A;  3D2W A;  2R2U A;  5T41 A;  5FLX Y;  1NDC A;  2BJ3 A;  1T03 B;  3P5T L;  1TZ0 A;  3B82 A;  1N56 A;  4PG4 A;  4F0K A;  1HNZ F;  2VPX B;  4NE9 C;  2WSC C;  4QWA A;  3DHW C;  1FJE B;  2PMW A;  2KH9 A;  3NKY A;  1TKT A;  2MST A;  4F4W A;  1X9W A;  1K47 A;  2FJB B;  3BRE A;  3RRH A;  2HUR A;  3HMJ G;  2W2M P;  1QVG R;  1GXL A;  1QE1 A;  4EO8 A;  4ID5 B;  2HFN A;  5CCL A;  3Q8Q B;  1YBU A;  4LUB A;  5EWG A;  2IC3 B;  5KFV A;  1WSR A;  1R0C B;  4IFY B;  3ZZZ A;  4JI1 F;  1RT1 A;  1RU1 A;  2R7X A;  1RHJ B;  3EPI A;  1VRT A;  3R1L A;  2HGM A;  4OHZ A;  2F5G A;  1VR6 A;  2M70 A;  3NGS A;  1HBN B;  4NI2 B;  4NA1 A;  4QIE A;  1JMT A;  1X9M A;  2ZKU A;  2UUB J;  4DSF A;  4OYA A;  2W8K A;  1WOP A;  2QE5 A;  3GG1 A;  1Q5V A;  3VV2 B;  5C24 B;  1JLB B;  3THT A;  1DTT B;  1X5P A;  2KB2 A;  2ATC B;  3I32 A;  4ENO A;  5KFZ A;  3D7S B;  2XZW A;  3HHK A;  3AFG A;  3FGV A;  4CT9 A;  4B9V A;  3ZZU A;  3A8J A;  2IC3 A;  3MMA B;  1NCL A;  4DV4 F;  2XSJ A;  4DV2 J;  1Y10 A;  2Q6C A;  3U1M A;  1K0T A;  1HNX F;  3GIR A;  5H9F K;  3LAN A;  2AGO A;  2DIT A;  3BR8 A;  2ILY A;  3MOZ A;  1MRO A;  1VRT B;  3TAM B;  4UQG A;  3UQS A;  4M5N A;  5J2P B;  2VFS A;  3HD2 A;  2RU3 A;  3V2U C;  1SJ3 P;  1NKE A;  2HHV A;  3GII A;  2JC0 A;  1CJV A;  2MY7 A;  1ZA2 B;  3ENQ A;  4H54 A;  2ROP A;  3W2V A;  4CM2 A;  4N56 A;  2HZC A;  3QQC D;  3V4I A;  3HVT A;  3EGW B;  4ZPV R;  2YBV A;  4Z37 A;  4CCH A;  3VAH A;  3JYT B;  2VG5 B;  4ALZ A;  4QIV A;  3IA0 A;  2HSE B;  5LMN F;  3MDF A;  2XSJ B;  1TL5 A;  1TL7 B;  2J7K A;  3IRX A;  5KFY A;  1G4C A;  1P1T A;  1HWK A;  4MKA A;  2JLG A;  1U0H A;  2YKQ A;  4ANE A;  4PG8 A;  5F8G A;  5LMN J;  3V6K A;  2E9Z A;  4U96 A;  5J1E B;  2E1A A;  3MR5 A;  4A4J A;  4ECS A;  2CJX B;  4USI A;  3OTO F;  3V4I B;  1CEZ A;  4DL5 A;  1MMN A;  4UW2 A;  2GIQ A;  1YJN S;  1GXU A;  2DK2 A;  5ADZ A;  2MLY A;  2GMJ A;  4DF4 A;  2W9C B;  4Y2K A;  3W5Z A;  3J80 Y;  3FEX B;  2AF6 A;  3PXG a;  1VCT A;  3VCD A;  2K7J A;  2JDJ A;  3N6L A;  4ED1 A;  2D3O 1;  4ZOS A;  1TVR B;  4N8N A;  4C0B A;  2RQK A;  2Q43 A;  3PW5 A;  3CCZ A;  1SJ4 P;  2CJK A;  1C4C A;  1CUL A;  4FKY A;  2DNP A;  1IBM J;  1L3K A;  4DN9 A;  5DDP C;  3T1Y J;  4E2F B;  2DHX A;  1HNX J;  5DG9 A;  1U0H B;  1G6B A;  1NK0 A;  1QUP A;  2H5J B;  2XS7 A;  1CJU B;  4NI2 A;  3AH6 A;  5IWA J;  1IBL J;  3M9N B;  1UFW A;  1VQ9 S;  1TKX A;  2V34 A;  3MPU B;  4XAK A;  2J8S A;  4GVB A;  4YB1 P;  4FBU A;  5LJ3 Y;  4KHM A;  8ATC B;  2KHD A;  2VZ9 A;  4NLV A;  4LVO P;  2C22 A;  4C0H A;  3KLG B;  5KG0 A;  4RNH A;  2PD1 A;  1KSP A;  2UUC F;  4CDI A;  2V94 A;  2ZH9 A;  3T5H A;  3P49 B;  5THW A;  3W61 A;  1WEY A;  3GYG A;  1SH3 A;  2KU7 A;  3HHD A;  2XMW A;  2YXL A;  1S4F A;  1RT5 B;  4M5H A;  4CH7 A;  3AJ2 A;  3M8S A;  4A8Q A;  4IDK B;  4DPX A;  3ZTQ A;  1OY8 A;  3FK4 A;  3RB4 A;  3IAS 9;  1J5O A;  4L6V 3;  4GKJ J;  1X60 A;  2UXB J;  3Q8S B;  4B9T A;  1VYA A;  2HEK A;  5F41 A;  2BZ2 A;  2JVO A;  4KO0 A;  5B09 A;  4YS2 A;  4YY3 J;  1KOH A;  2H4Y B;  5KT7 A;  4DR7 J;  2R7T A;  3HVT B;  5C25 B;  5J1P A;  1IJE B;  4F3Q A;  5KOW A;  5KFJ A;  2RS2 A;  4ZJL A;  1KQS R;  4H4O A;  3PW7 A;  5IZH A;  5I4M A;  2IHR 1;  4BDP A;  5U47 A;  2BRL A;  2G1H A;  1FES A;  3ONQ A;  3UNG C;  3LQV A;  3JTP A;  3BGO P;  4DFP A;  3IFE A;  2LEA A;  5IQQ A;  2C28 A;  3KNA A;  3HHL A;  2UXD F;  1FO1 A;  2ZH7 A;  1LEO A;  2FIU A;  4KPY A;  4P71 A;  3KLF B;  4DV6 F;  3BYR A;  4CWB A;  2D3U A;  1N5S A;  1S12 A;  3C6U B;  4ZVU B;  5J2M A;  5HVF A;  2GAG C;  4FYX B;  1NB2 A;  5AE3 A;  1PKU A;  1E6Y B;  3PY8 A;  2K1R B;  3OW2 R;  2X1B A;  1WOS A;  2RB7 A;  3D1Q A;  3KMQ A;  3MOJ B;  3I56 S;  1GX6 A;  3VGU A;  4FKX A;  3S8S A;  3CCM S;  1VRU B;  2VG6 A;  2ZE2 A;  5ETP A;  1FDA A;  2B3T B;  2R2R A;  3NEK A;  3F41 A;  4FNH A;  3HHL B;  1HHQ A;  3DLE A;  3NG8 A;  3TA2 A;  2W24 A;  5A8K B;  3KYL A;  5D4L A;  1S10 A;  1U4B A;  1T05 B;  1D1U A;  3K5M A;  1F60 B;  1HI8 A;  1X4D A;  1ZS6 A;  3OPK A;  5K8M A;  1CJU A;  4UOH A;  3M8Z A;  5DGB A;  2YWW A;  5A76 A;  1HQU A;  3TJ9 A;  3TP2 A;  2J7W A;  3JSB A;  1TKZ A;  3KHG A;  1SV5 B;  1ZA1 B;  3Q86 A;  2C3U A;  1RAE B;  4P73 A;  3H5Y A;  1U2C A;  4HR2 A;  3ETM A;  3M6X A;  3VQT A;  4XDD A;  4C3M A;  3P6Y C;  4FZV A;  2VC1 A;  2RKI A;  1WTF A;  2WW4 A;  2IDL A;  3PKY A;  4IKA A;  3PNI A;  3CW2 C;  2VH7 A;  5RUB A;  4DSI A;  1EP4 B;  1RHQ B;  3OL7 A;  3MR2 A;  3R2C J;  2I6W A;  4DV3 J;  4HT5 A;  3VHQ A;  2OEL A;  1RHK B;  3W63 A;  4DR2 J;  1YSJ A;  3ULH A;  2JX2 A;  1U6B A;  2A1B A;  3JSR A;  3R6G B;  1LFW A;  3B54 A;  2B9W A;  4M5K A;  1H2V Z;  1HNI A;  4ZJQ A;  3P8B B;  1HNW F;  1FRH A;  1WC1 A;  3AJ1 A;  3MD1 A;  4CLT A;  2W2P P;  4HDH A;  4IOC Q;  1S0O A;  4TN2 A;  2FTR A;  4ZMM A;  3P4U B;  1XNQ F;  4HTI A;  2HMI A;  3RZA A;  1O5J A;  2J0X A;  4LRD A;  4DPY A;  3ICL A;  4MJK A;  4JI7 J;  2LQ9 A;  4M5I A;  3MI7 X;  2BKO A;  9ATC B;  2ZH4 A;  5F9L A;  3CC2 S;  3H20 A;  2QT7 A;  2WON A;  3FZ2 A;  2HFU A;  1KR4 A;  2QLJ B;  2RHS B;  4KV8 B;  3GV5 B;  2ZHO A;  2D3Z A;  2YKM B;  4EYI B;  3CDB A;  3BH7 B;  3FKB A;  2DGT A;  3PAC A;  2Z2M A;  1JJ4 A;  2KHC A;  4CIO A;  2ACY A;  4OI0 A;  1HBM B;  4E98 A;  1NSP A;  1EQM A;  1MN7 A;  2HVZ A;  1VRU A;  4GO5 X;  3OFF A;  5T14 A;  1MWZ A;  3K57 A;  1RDR A;  2CPH A;  3M2V A;  5ETO A;  4ZHR B;  4X64 J;  3KJQ B;  4RNN A;  4CO1 A;  4F0M A;  4LBP A;  2AZ3 A;  2KJV A;  4E8U A;  4B9N A;  2OUG A;  3M1V A;  4P2M A;  3OTD A;  2H1Y A;  2CUY A;  4GVL A;  4DV0 F;  2R7V A;  4LR7 A;  4RBT A;  2DNH A;  3QBC A;  4A8F A;  1HYS B;  1ELO A;  2OKQ A;  4JP8 A;  4KR0 B;  4NLU A;  2GQC A;  2YKM A;  1OWX A;  4CLS A;  5KTQ A;  2C2N A;  3F0N A;  3AOA A;  3FMW A;  3LP2 B;  5FD1 A;  3M8Q B;  4F04 B;  2XGP A;  5AT1 B;  2CQ2 A;  1U2R A;  1S0V A;  1KKH A;  4IFV A;  5CD4 A;  2G2Z A;  2LU1 A;  3FZB A;  4L3N A;  3M2R A;  3NGR A;  1IKV B;  4DR3 F;  2HHW A;  1E6V A;  5H9E K;  1XMO F;  3VWS A;  1PC4 A;  2AJ4 A;  2E7X A;  2G2Y A;  3HJV A;  2ZWP A;  1NXI A;  1KN6 A;  2R7U A;  1YRT A;  1TUW A;  1X5O A;  1XR5 A;  2NS1 B;  1HL6 A;  2VBY A;  3S01 A;  2HND B;  3IG1 A;  2CQ1 A;  1JJC B;  1VI7 A;  5KFO A;  4IO1 A;  3NS7 B;  3QO9 A;  1Y11 A;  2BW2 A;  1HNI B; 
#chains in the Genus database with same CATH homology
 1FX4 A;  3MR7 A;  1CS4 A;  4WP9 A;  4NI2 B;  3C15 A;  3MAA A;  4OYA A;  4WPA A;  4CLY A;  5D0H A;  3UVJ A;  4WP8 A;  1YK9 A;  4CM0 A;  1CJU A;  1Y10 A;  2W01 A;  4P2F A;  1CJV A;  2WZ1 A;  4CM2 A;  1CJK A;  4UST A;  4CLK A;  2GVD A;  3ET6 A;  4OYX A;  1WC0 A;  1YBT A;  1TL7 B;  2GVZ A;  1CUL B;  1AZS A;  4OZ2 A;  1U0H A;  1WC1 A;  3C16 B;  4CLT A;  5D0E A;  4OYW A;  1FX2 A;  1CJT A;  2BW7 A;  1CS4 B;  3G82 B;  4USV A;  4OYB A;  3C15 B;  4CLU A;  5IV3 A;  5D15 A;  1CUL A;  4OZ3 A;  1U0H B;  3C16 A;  1CJU B;  4USU A;  4NI2 A;  2QV6 A;  3C14 B;  3MAA B;  4CLL A;  4CLF A;  4CLZ A;  1WC4 A;  5IV4 A;  3UVJ B;  1CJV B;  1WC3 A;  1CJK B;  4P2M A;  4OYP A;  1WC5 A;  1AB8 A;  4CLS A;  4OYI A;  4OYM A;  1WC6 A;  1TL7 A;  2GVZ B;  3C14 A;  4CLP A;  1AZS B;  4OYZ A;  1CJT B;  4OYO A;  5D0R A;  4CLW A;  3R5G A;  4WP3 A;  2GVD B;  3ET6 B;  3G82 A;  5D0G A;  4P2X A;  1Y11 A;  4USW A;  1YBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...