1CS4A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TYPE V ADENYLATE CYCLASE
publication title Molecular basis for P-site inhibition of adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 57
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cs4A00
1WC0A 4USVA 2QV6A 4P2MA 1CJKA 1CJKB 1WC5A 5D0GA 2GVDB 3ET6A 3C14A 3ET6B 2GVZA 1Y10A 3C15A 4CLWA 2GVZB 4OYMA 4OZ2A 3C15B 3MAAA 1AZSA 3MAAB 1AZSB 4P2FA 5IV4A 1TL7A 1CJVA 1TL7B 1U0HB 4CLTA 1CJVB 4NI2A 2GVDA 3R5GA 4NI2B 5D0RA 4WPAA 5D0HA 1Y11A 1WC6A 1WC1A 4CLUA 4USTA 4USWA 2WZ1A 4CLYA 4OYPA 1CJTB 1WC4A 1AB8A 4WP9A 1U0HA 5D15A 1FX4A 4OYOA 2W01A 1CULA 4CLSA 3G82A 1CULB 3G82B 1YBUA 1CJUB 1YK9A 1WC3A 4CLZA 2BW7A 4OYAA 1CJTA 1CS4A 4USUA 4OZ3A 3MR7A 1CS4B 3UVJA 5D0EA 4CLPA 4OYWA 3UVJB 4OYIA 5IV3A 4OYBA 4OYZA 1CJUA 1FX2A 4CM0A 4CM2A 3C16A 1YBTA 3C14B 4WP8A 3C16B 4CLKA 4CLLA 4P2XA 4OYXA 4WP3A 4CLFA
chains in the Genus database with same CATH superfamily
3JSMB 1EETB 2QSWA 2P8IA 5AE2A 3T19A 1BMQB 3MEGA 4PWDA 4ZPWR 1G2EA 2UUCJ 1OY8A 1W2IA 2R7TA 2C28A 4B3OB 1RTJA 1LWXA 2A3JA 2J7KA 4ETXA 2YH1A 2XYPB 1UPPA 3T1HF 2FC9A 1ZAVA 3KMSA 1DQAA 4BDPA 3KLGA 4O44A 4C97A 3G87A 2ZZNA 4LR9A 1UJ6A 4FN5A 2LXFA 5CABA 3TVYA 2YTCA 4O4GB 5ETSA 1T9XA 1GMVA 1YBUA 1BWVA 2IA6A 3HVTB 5B7WA 1QDUB 4JI6J 3KK2B 1U4BA 2ASJA 4EGLA 2W8KA 4DR6F 3R5CA 2G0JA 3C14B 1ACMB 1U25A 4FPIA 4OX7A 2WOMA 4YFUA 1HBMB 4RBVA 2N4CA 2YNHB 3SI8A 4X4SA 4DV4J 2MSSA 4W4MA 4I7FA 1RTIA 3PRBA 4KHPJ 2D9PA 3CMES 2J9DE 2DHGA 4LBIA 2HWIA 1KEKA 2BQUA 1VGYA 1RYRA 2XB2D 2DGXA 4CLTA 1WDTA 4X4PA 2HBQB 2EFVA 4X2BA 1C4AA 4OHWA 1XMOJ 3PJWA 4DOZA 2MY8A 1TL3B 3I0SA 2J6TA 2CQ3A 3P5TL 1YSJA 5HP1B 1IKYB 3CCVS 1IM6A 1URNA 1WHXA 3G82B 1XIQA 1TKZA 1C1BB 4YR2A 1WOOA 4IRKA 3QJLA 2DK2A 2KL8A 2DGQA 3FEXB 3N01A 4ILRA 1F9HA 1S48A 1SCJB 3NY0A 1X31C 1W7WA 3HSGA 4TXSA 3G6YA 3QGHA 1BQMA 3I32A 2W2MP 3I31A 3LO3A 1HARA 2WVBA 2HGMA 3QFWA 4KR0B 1RHQB 2GV1A 1Q95G 3BPSP 4IDKB 2FUG9 2FDNA 3CCUS 3W8GA 4N41A 1RT3B 4YUDA 3TUIC 4BWMA 3TYTA 4C11A 4FVCA 1D09B 4IG0A 2J0WA 4UOHA 1JLCB 4NI2A 1HBUB 2CZ4A 2B8PA 4I6AA 1FNOA 3CJKB 4E2FB 3TWZA 2HQIA 1C2PA 4F4ZA 2E5IA 5T7LB 1XMBA 5GMEA 3TW0A 3PX0A 3KUHA 4NPOA 3HXMA 2FLLA 4CH7A 4B3TJ 1KTVA 3FBEA 3VCDA 3VV2B 1N52B 2OIHA 3HD1A 2KTQA 4MAKA 5E33A 4HH0A 5M2PA 3TRGA 3AOCA 3ISZA 2F4VF 1YBTA 1FO1A 1KOHA 1S1TA 1HI0P 3AODA 9ATCB 1L3UA 4USVA 1Q81T 3MTJA 1RU2A 4XTTA 1PAUB 2WSFC 5HQMA 2XYGB 2FHKA 4FKYA 4EYHB 2QA2A 4DQQA 2GVZA 2V2ZA 4XDCA 3OVBA 4FPRA 4UTGA 1JKHB 1A0OB 3GYNA 4NLSA 3UNYA 1S6QB 3M2RB 2CNOB 5F41A 3ITHB 3NP5A 2DRDA 4ZVSB 1FERA 3Q8UA 1UVMA 2QE5A 2CWXA 3P96A 3NGRA 1CEZA 2V0NA 3EXYA 2AV5A 4KAIA 3HZGA 5HVGA 2DXEA 3VAIA 3EDQB 2VKZG 3W2WA 2XZDB 4M94A 1TKTB 3VHQA 3OSPA 2LDYA 3ZNUA 5DG8A 2ZD1B 4GKKF 3M2VB 5DRKA 4C98A 4Y0FA 2ASLA 1QAJA 4N56A 2MKJA 3T1HJ 4I56A 2NZCA 1TAQA 3AQPA 2OKQA 2H4WB 3PIPQ 3DGPA 3OFEA 3DLBA 2CAJA 1IBKF 5HI7A 2IYGA 5A0YA 3CD7A 1CJKB 2DT9A 1IKVA 2CPIA 3I87A 5KG0A 2XNQA 2Z30B 1SC6A 4WU2A 3TARA 5RUBA 1A7GE 4PG7A 3DGVA 2V9WA 4P52A 3J7YU 3OR2A 3CCLS 3PRVA 1UMJA 1SKSA 3S01A 3M2UA 3UN5A 1UP1A 1XJWB 2J7UA 4F3MA 1RKJA 5L1LA 1YRTA 3D7SB 1UWBA 1SQFA 3GYGA 3CUNA 4O3QA 1H2VZ 4FS2A 3R2CJ 1LEOA 3KLHB 2Z56B 1CS4A 3KK1A 3KK3B 5KFBA 5FIIA 1T7PA 2DNLA 3MZIA 2W9BB 2DEIA 2VHGA 4CO3A 4NZ0A 3T41A 3OHBA 3SV4A 4AD6A 2BW2A 4C3KA 4HT5A 4TY8A 1EZZB 4V19X 1FKPA 2ZOMA 3A13A 2QV6A 3BDEA 4AE5A 4LF4F 3UNGC 1R0AA 1P8GA 4TLRA 5CCMA 3D6TB 3M1VA 3V4MA 1R8HA 4NZ7A 4PG4A 4X4QA 2IAJB 2ZUAA 4AL7A 1VQSA 2AJ0A 1MU2B 1YVFA 3W5ZA 1JLBB 5DQHA 4OJ1A 5KG4A 3KXDA 5KFLA 1WF0A 3M8ZA 2CJQA 5KOXA 1T3OA 1RCOB 1RWKB 2EK1A 1RTHA 1EJ7L 4ID5A 1YRXA 2DNRA 3M6WA 5E3RA 3HHLA 3PYEA 3JYTA 3TI0A 3AHPA 4MTPA 2XZTB 2LQ8A 3S6EA 2MQLA 2GIQA 4E98A 4A46A 3ZZRA 1HW8A 1J5EF 1N36J 3ZTPA 4J90A 3KUGA 4ED7A 3RBZA 1Q5YA 5ETQA 3I4PA 4KJIA 4WE1B 4NA3A 2AJQA 3QRPA 1YTYA 4HYKA 3D0GE 2HYIB 3FKBA 5J2QA 2A18A 2HLTA 2BBEA 3K5LA 4B9LA 2VU5A 3DRPA 4CDIA 3BSNA 4MFBB 4O3RA 3AT1B 4DV2F 5A8WA 3H40A 3POTA 2YNFA 1YJ9S 4CT9A 4DQSA 3MEEB 2E5LF 4PXDA 1X4EA 2DCUB 2UVRA 1P1TA 4U7CA 4O4RA 8RUCA 3MM9B 4LSNB 1CJVB 3DLKB 2GVDA 4ALZA 5EWGA 4S0MA 1MMLA 3BQ0A 1ZM2A 1GQEA 3W60A 3DLHA 1FKAF 3NGDA 4DJBA 2QFIA 1RT2A 4RL1A 3CIMA 3QIPA 1TV6B 2DITA 3WDOA 2XM3A 4G6VB 2MQPA 5E3CA 3U27A 3U1LA 2ZBCA 4ZS6A 2RUGA 3WX4A 1YITS 4HACA 2RKIA 3D68A 3PW2A 4J9OA 4FKXA 3PHEA 4ZCLA 4JI2J 4QR0A 1U6BA 5K8OA 1SKRA 3M9NB 3EVOA 1NKEA 2CIMA 3MDFA 3EGNA 2XHWA 3VVTA 2PDAA 2DIUA 4DR2J 3HHEA 5IZHA 2MJUA 4MMOA 1M5VC 2WVCA 1V5VA 1WEXA 5J2PA 1IBKJ 3DKDA 2FTRA 5D0RA 4Y6IA 4DZ6A 1NJWA 2YBVA 3M8QA 4PXEA 2HHHF 1F9EB 4ZIVA 2OD6A 2ZHAA 3DLJA 1QAIA 2OEMA 1Q53A 1MG7A 1GNKA 3C6UB 3HSJA 4WTOB 1N5SA 3OTCA 4NE9C 4RW8A 3SEOA 4FYXB 3SCKE 4R25A 1RADB 3G6VA 1KLMA 3LAKA 3NS7B 2IA0A 5CA5A 5FDLA 4CLPA 4ZPBA 2BM0A 2XMJA 4HHJA 4LR8A 3BGRB 1JMTA 2YVSA 3OVAA 5IM0B 3T5HA 1F0XA 3DM2A 2MKHA 4ECWA 1KWMA 1RI7A 1QD1A 1SJ3P 4F2SA 1F1BB 3Q8YA 2GIFA 1ZA1B 1I3OB 3IXQA 5G4DA 4B9SA 4JI4J 4K4TA 1AZSA 2AEJA 4WYWA 2GS8A 2L9DA 1HD1A 2A2DA 2ZWPA 3UFCX 1CC7A 1WNEA 2QLWA 2X3DA 4UZBA 2FJWA 3OR1B 1X4CA 1FRIA 3I55S 1AB8A 1HHQA 4ED2A 1E6YB 3RW6A 5KFSA 2FJBB 2IVYA 2ZEJA 1LFWA 4QIGA 3MD3A 4UT4A 4MKAA 3VF0B 3S8SA 5A2QU 5LXRA 3PKMA 4KKOB 4LF1A 4IG3B 1FD8A 2HQ3A 3TJ8A 5HVHA 2BR0A 3FSXA 1Q82T 1VBXA 4EI2A 3W66A 2DR7A 5KFFA 1UJ4A 2MZQA 3VGTA 4OYZA 4AXIA 1S12A 4K5RA 5E7OB 4C0BA 3J81j 2OI2A 2ZHBA 3NNAA 2ZH8A 4DEZA 2X1FA 3K5PA 4I2PB 2VOPA 5KFTA 3KOAA 1FTRA 4ED5A 2JWNA 1SIWB 5LMUJ 2MTLA 1WSRA 4J7CA 5I3UA 2HNZA 1WTFA 5J2MA 3CE8A 3W5YA 3CJ0A 5F3TA 2MLZA 5ETTA 4QZVB 5IV4A 1REVA 3LWLA 2HVDA 2XLIA 3H2UB 2VJUA 2FD2A 3AB4B 4XAKA 1G6BA 1UZDA 1YHQS 3OTBA 3AY0A 3NOGA 4DCPB 3GV5B 4BC9A 5B09A 2ZJRQ 2E5LJ 3TVKA 3D2WA 4GC7A 1QSLA 1B4SA 4B9VA 3DDNA 2HAIA 3OV7A 5KG3A 3BR8A 4ENOA 2L3MA 3BYRA 1SPBP 3PX4A 1CSJA 4WWSA 3Q2TC 1JQGA 1YWXA 3TA1A 2HMIB 4PXBA 4KFBA 2LQJA 3MEDB 3JSBA 4O3SA 4DU8A 1BY9A 4LR7A 4WP8A 3C16B 2CJ9A 5KFYA 1M5SA 2MZJA 1IN0A 3EWGA 1RZMA 4HH1A 1Q78A 4ZN1A 3UPFA 1RE1B 2UV8G 2KVQE 5E3QA 3C6TA 1PBAA 4CLWA 4JI0F 2CYYA 3C15B 5J2NA 4DSKA 3N6LA 4DSIA 1T9TA 2BJ9A 3RAQA 2BQ3A 4UY8T 4Y2IA 2DHAA 1JLGB 2NLWA 4KYZA 4U9RA 3H5SA 1VBYA 1PAEX 4CLYA 1HQUA 2H65B 3BSAA 4C8NA 4J9LA 3TNVA 3NWGA 2UXCJ 5CYMA 4DSEA 3NBPB 4GC6A 1PCAA 4B3RJ 3BZQA 2I2YA 5CQGA 3CDBA 1C0UB 3G86A 2HQGA 5KFAA 2OTJS 2DRAA 4ECXA 4DN9A 1ZPWX 2BMBA 3HPOA 4MKVA 1QY7A 2KJVA 5KTQA 4YB6A 2IBOA 4O3OA 2N3LA 1C1CA 3BKUA 4MKYA 3MUMP 1IR0A 2FHOB 2HHWA 3IWNC 2XY6A 3M32A 4PEOA 3V6DA 1L5UA 3VAGA 4WTYA 3CD0A 1V3SA 4YHHF 3KJNB 2VPXB 2RQCA 3G96A 3SCLE 3AFGA 1FE0A 4WFXA 3GU0A 2LXUA 4TNOA 4RW4A 1EP4B 4CP5A 1PO6A 2HZVA 4IQMA 3G6XA 4FF4A 1Y3JA 1WC4A 5F0UA 1FK9A 1S1VB 3PW4A 1RB0A 3SSRA 4UW2A 3SDEB 1L3VA 3SYZA 3IBCB 1VLYA 1JIHA 1NK8A 1VQ6S 4DUYF 1SV5B 1R8PA 1NJYA 3UVJA 3UDVA 3G4SS 1UW4A 5GAGU 4M5JA 3M6VA 1WKKA 2H5IB 2M5YA 2ZH1A 2Q6BA 3VAKA 3UCZP 4DL3A 2W4DA 3WBZA 4MH8A 3MPWA 2DYAA 1UVNA 2M8HA 1KRPA 1RT4A 4E8UA 3TX0A 2RQKA 4DFKA 2VQFF 1X4AA 2RUSA 3QYYA 2B56A 3PJ9A 3E01B 1UWAA 2LP4A 1RKIA 2JX2A 1W2BR 4DV6F 1TL4A 5BYRA 1ZM9A 3IRXA 1MROA 4QOTA 1N32F 3BQ2A 3P45B 2NREA 4F4AA 1FTCA 3SV3A 5IXUA 3F0NA 3HSDA 4V19J 4PYAA 4CLZA 3W9IA 4J9VA 3M9OB 2W2OP 5KAKA 2GCFA 4WKYA 2EBGA 1SJFA 2J7WA 2JZ5A 1F2HA 2GA7A 2K06A 3GG0A 4ZVTB 4IOAQ 4Q0BA 2Z2YB 2DO0A 4QYZK 1IXKA 5KT4A 3DI6B 3A8IA 2CQCA 4NMXA 4JI7F 3IO1A 4HVZA 2V8PA 3DYAB 2H1YA 1DRZA 4A47A 3R7NB 3BS9A 4JI1F 1NO8A 1PC4A 1QSYA 2ZOGA 4OZ2A 3BYPA 1TTHB 3PHTA 5D4PA 2BE7D 1CLFA 1NK0A 2G0IA 4MK9A 2FVRA 3J7Z5 2QMXA 3KWMA 1HIYA 3KG1A 4ZLJA 1R8BA 5E5NA 1W26A 3CD5A 4RNOA 1VISA 2IMWP 1RWWB 3TA2A 3VAMA 3Q0AA 4ELUA 4H4MA 3D3CJ 3R2DJ 4NXMF 2J9EA 2QEXS 2AX1A 3DRRA 3CDWA 1QVGR 3EPIA 4DR4F 2E66A 3CJ4A 3RB0A 2V2VA 4TU7A 3TZYA 3Q24A 4ICLB 2NXNA 1DARA 2HFNA 1VRUB 4Q8FA 1WOPA 2DR5A 3LW5C 4WK3A 4I1TA 4ZPVR 3UN2A 4F0MA 4NEYA 1RAAB 1S59A 5KT6A 4AT1B 1S6PB 3Q86A 2YWWA 3LANA 2ERRA 4Y28C 2LDIA 3U1MA 2OSQA 3CCMS 3W3SA 1Y00A 2BJDA 2UVVA 3CCJS 4QW8A 4M5HA 1O5JA 3JXOA 3ISND 1NDCA 1FT8A 1VC5A 2VBZA 4L74A 4M5MA 4PG5A 3BGLA 3NXZA 2X3GA 2MMYA 2ZNYA 5HVFA 1MMNA 2NZ4A 4IOCQ 1DAXA 4IH5A 4NLUA 1HWUA 3CC7S 1HNWJ 2CADA 2D74B 1RSCA 2IDEA 3MD1A 4TQSA 3KLVA 2AX0A 1SUQB 1CJUA 4F67A 5KFWA 2FVPA 1VOMA 2LVWA 1T94A 2KHDA 4MT1A 3WQPA 3MPVA 5JVGQ 2QL7B 1T03A 4EBEA 4TVAB 5GAGI 2M88A 4EBDA 3LP1A 1RHJB 3D54A 1RWXB 4U95A 2VF3A 3IAM9 4MYUA 2MYFA 5A8RB 3TUJC 2JNJA 1V3ZA 1S1UB 2QMWA 3CDEA 1S49A 2W1BA 3DLGB 2BQRA 1YX2A 2VG5A 1WI8A 1RT7B 1FWKA 2QLXA 2PI4A 2LLZA 2VASA 2VQFJ 4WU3A 4ECTA 2HRUA 1Z4UA 3PKYA 3NGUA 3MR5A 3EDRB 4RX6A 3E8OA 3IN5A 3NRBA 3V4IB 4LT6A 4ZJOA 1Z1ZA 2I5JB 3P8BB 2MKYA 3PYDA 4R5PB 1YBAA 3J81U 3H5YA 4KGMA 4LVNP 1ZM3A 2B5JA 4X66F 2C2KB 3D1OA 3QLHB 3HK2A 5LXYA 3LP0A 4L75A 2B6AA 1X9WA 1E6VB 2Y8YA 1UEUA 2UUAF 2ZM6J 3D1HA 1AT1B 2CQGA 4J9PA 2AGQA 2BJ8A 5J1EB 1SC1B 4KRWA 2FJXA 5HJXA 1OY9A 3IG1A 1B0PA 1OO0B 4XO0A 3P4UB 4U67Q 2W9CA 2GMLA 4LF8F 1NNDA 5CD4A 1Y11A 1S9EA 4KPCA 1SVDA 2J0SD 2MZRA 4JI1J 3QPIA 2QJ3A 4FF1A 3DCAA 3RTVA 4F25A 1NH8A 2ZUGA 2O5DA 4J91A 2W01A 3FFIA 4OV6A 4DR1F 2OFHX 1YJNS 2CQPA 2VQEJ 4O0NA 2HPUA 2I1RA 4KY3A 3OFGA 1B0VA 1HMVB 3P6YC 1RCXB 5HN0A 5A6WA 2KZZA 4BWJA 4CT8A 3CJQA 4RUHA 2D1CA 1H7WA 3BF4A 3OL9A 1LW0B 2MKSA 4A8XA 3PM9A 1TK8A 5KFGA 2HGLA 1VLOA 1NJIT 1XN9A 4PWDB 1NM2A 3EICA 4ED0A 4J9SA 4OHVA 5C24A 2R7RA 1N33J 3HLUA 3CULA 2C3UA 4Q7AA 3JQKA 3M9MB 4OX9F 3PW7A 4OLPA 2BE2B 2KZMA 2GMJA 3SSSA 1U1NA 1WC6A 4Y3CA 1JXEA 1NZ8A 2B7BB 2CPDA 3T1YF 1C4CA 5AJ3F 1R0BG 4F3OA 5I42A 1TL5A 2EFQA 3KLGB 3GCWP 4O44B 1UFLA 2KFNA 5K5MA 3F56A 5D3GB 2RS8A 2KXHA 2FVCA 5KFPA 5G0RA 2POKA 1BWEA 4NASA 2C3YA 4LSZB 2QN6B 2ALYB 4CH1A 3QWUA 5MAOA 1FJ7A 5JUMA 2BX6A 2HHPA 2WOMB 4F36A 4CLFA 2CWKA 1VQPS 4X65J 2HIYA 2DISA 4B02A 4I7FB 1RTIB 1GX5A 2AGOA 3DHXA 4F2RA 5KT5A 3D4JA 2RSQA 2Y1RI 1JJ4A 3F41A 1RAJA 5A2QY 5EUHA 3HHDA 5HSPA 4LRBA 3K57A 2RU9A 3D0IE 4U6PA 4UOCA 4YDDB 4A8QA 1KQFB 1WI6A 2DR6A 2YNGA 3OLBA 3B78A 2F8EX 3MTKA 3FMBA 2V6AA 2JLGA 3I0SB 3KUEA 4W90B 1IWGA 4FXWA 3MR3A 2EXUA 1BLUA 1EKSA 3EGZA 4M5KA 3QRRA 2RNEA 5DO2A 1AW0A 2VDIA 1TKZB 3GPAA 1YQHA 1J27A 4ECUA 1QVFR 3UE2A 2MSTA 4J5OA 1VFJA 1QLNA 3GR1A 1B70B 3TQEA 4N7TA 4LJMA 3DOKA 2FB0A 3K59A 4G1QA 4F0KA 4GVLA 3QRQA 1FCAA 1BQMB 3O2IA 3B54A 2FJAB 3O1LA 2YKMA 4L6V3 4BC7A 2J9DA 2KDOA 2D3ZA 4Z7YA 2MEWA 1HR0J 4ZK7M 2OEKA 4IG0B 4NI2B 3LGHA 4NZ6A 2XWXA 3DHWC 2IM2A 4UOGA 4ES2A 4ED3A 4OYPA 1X4GA 1VJWA 1LNQA 3UD5A 2K2PA 3TANA 3A3PB 4Y00A 2CDRB 2KYZA 2JSXA 3Q23A 1OYDA 4K0KF 2RF2A 1X5TA 2YNIA 1IUJA 2B43A 2A10A 1WUUA 4F02A 1HPZA 2UU9F 2F63A 4P71A 2D3O1 2Y1IA 4DSFA 5LMNJ 1JLQB 3UDCA 2FGOA 4KC5A 9RUBA 2QA4G 3S7RA 2RH3A 3OVSA 1NB7A 1S1TB 4DR1J 3GMGA 2DNQA 4A8OA 2ZH5A 4PZVA 1F3FA 3I96A 5A8KA 1N6QA 4Q43A 3C2PA 1RGVA 2GVZB 5KFXA 1X9MA 3JSMA 2IM1A 3O8WA 2G1DA 4Q44A 1HHTP 2NXEA 1ZAWA 2XULA 5L38A 3W8PA 2JL9A 5D0HA 3G6ES 1UCNA 2KKHA 2IRYA 4JB8B 2AJ4A 1P9QC 4O3PA 2XHCA 2LEPA 3W2WB 1CULA 3KJQB 2PFDA 2UP1A 3VZIA 5DGAA 3H2LA 4DR5J 2CQ4A 2QO3A 3ICLA 3CJSA 2I38A 1XR5A 1SJQA 4NLYA 1FRKA 1R89A 3UO0A 3LGMA 4C2MA 1RT1A 5K8MA 3DGPB 1Z2ZA 4QIVA 3OTOF 2ZDOA 1C0TA 4CO0A 3C14A 1XWLA 1IKVB 4EBCA 3P49B 2JC0A 3IGNA 1DURA 3FMWA 1HNIA 4OJ3A 3CCTA 5IOLA 1HHSA 1V3RA 2ZJPQ 2KRRA 4HL9A 2H9ZA 2BXJA 3OR2B 3AXMA 5KG6A 4NLQA 4CCHA 2V4JA 2MKCA 3MMBA 3U1NA 3FEZA 3WIVA 2IIHA 4OFZA 4ZOSA 3W2VA 1LKZA 3M2UB 2WW4A 1UW9A 4DL5A 1G1XA 3IS9A 1YIJS 5CHCB 1UWBB 2P5VA 3A8JA 4CIOA 1K1QA 1RA6A 3OXGA 2VBYA 4X64F 4RUCA 3CMQA 4ZN3A 1CS4B 3KK1B 3W63A 3PW5A 1HWJA 4H4OA 5K20B 1I94J 5IV3A 2CJKA 1TAUA 3CEDA 2MQQA 3EPGA 3QJJA 4LF9J 1C1BA 1FI4A 4TY8B 1FKPB 5EWFA 3MPYA 3ET6A 2UXDF 5AXMA 4GRSA 3HO1A 2WTFA 1R0AB 4LQ3A 3M1VB 1XMQF 2YXLA 4NA2A 4LVOP 3G71S 1X4FA 2EG2A 2JEGA 3PXGa 4MYTA 4Y2CA 2RQ4A 2CPFA 1RTHB 1RT3A 4ID5B 1WWHA 4FNIA 4OI0A 2XMAA 1Q8KA 3LTOA 5B0BA 3OL7A 3HHLB 4F0HA 2ZJQQ 2PIIA 3JYTB 4NXNJ 1S7HA 3AA9A 2HS3A 2Z57B 4YQWA 2MQNA 2IPOB 3MAQA 3HVAA 2MZSA 1KKHA 1DTTA 1U48A 3D9BA 2DD8S 1X5SA 1TFYA 3MCOA 1DBDA 1MN7A 3LAMA 4PWUA 4C8KA 2VV5A 5BJRA 2XNRA 4ZHRA 2XLKA 2CFXA 5J2QB 3G8SA 3V6JA 5KG5A 4TU8A 4CYUA 3V6HA 3DRPB 4Y34A 3ZZ0A 4NLTA 1XNRF 5F9NA 3MMCA 5A8WB 1RT6A 3POTB 2YNFB 2B0GA 2PT0A 4YY3F 2HAFA 1GMUA 4N47A 2XMTA 2CPHA 1RTDB 2DNKA 4C48A 4Z7CA 1SH0A 4DR7J 1U02A 1S1XA 3I4HX 2OFGX 1NBEB 1QE1A 4WXOA 4ZITA 2F40A 2XLJA 3RW7A 3VAHA 3SIPB 2BACA 1RT2B 1RAEB 5JVHQ 4LFAF 2R2RA 3QIPB 4B3SJ 3JTOA 3P5BP 2XCAA 3VTIA 4QR1A 2ZBIA 5SUHA 2EWHA 4DMZA 5CXTA 1JNRB 4YOEA 4LIWA 2V69A 1ZM4A 5KFRA 4JOUA 4HACB 2RKIB 2Y9HA 3M2VA 4YR3A 1TK5A 2E5JA 2YWHA 3OSNA 1ZAXA 4I6YA 5L1JA 1TL1A 3AJ2A 2CJXB 4UQTA 4DPYA 4I4BA 2VPYB 1XTZA 3VWSA 4R0EA 4DFJA 4DV3F 1J5OB 1UAWA 2O01C 1U6ZA 2Q66A 2EG1A 3EZUA 3R5GA 5J2PB 5LT5A 1M5HA 3CCWA 1UETA 2N7YA 2J0XA 1IQZA 1VCTA 3M8QB 3DC2A 2NUUG 1Y5LB 4CNYA 2DRBA 2RD5C 1O8BA 5D8HB 2QG9B 4P7VA 3KJVA 1Q79A 2BJ3A 4WXWA 3QNWB 2XMUA 2GJFA 4RW8B 1HQEB 1Q7YT 1TK0A 2Z2LA 3CJ3A 1QAXA 2KJWA 1KLMB 3KTQA 2M52A 5HK4A 4LF5F 4OYWA 4ZPTR 1X4DA 4RLEA 2E29A 4TN2A 3CSKA 1XEZA 5FDLB 2HBRB 5GAHU 4ZP7A 3MFHA 3GFZA 1NHKL 2GQQA 1RYSA 3W9HA 4KE5A 3DM2B 2IHR1 1B64A 3BR9A 2CQIA 2J5AA 2GMHA 3M8WA 5GVQA 2I0XA 1FXRA 4M5IA 1RHRB 2CUYA 1QTNB 3KLFB 3O5TB 5IWAF 2KG0A 2NXUA 3PY8A 5DLFA 1AZSB 3M8YA 3QSIA 3PDNA 4TYBA 2MZTA 2DHXA 3KHRA 3J81Y 3PW0A 1U8SA 3DRXA 2XO7A 2F65A 3QSYB 4BHQA 3AJ1A 4K4XA 4LF7F 3CJ5A 2HNDA 4M5NA 4OYOA 1NDLA 2PC6A 5IC6B 3ZZZA 3FSYA 1JNZB 2XGQA 3T3FA 1U6FA 1LWFA 5ETVA 1AA1B 2HHTA 1OQ6A 1V6HA 1YJVA 3W62A 1L3TA 5HMXA 4ITSA 4DZDA 4CLKA 3IP0A 1D3WA 4USKA 1AUSL 2DJWA 2VG6A 1S79A 1N34F 2IC3B 1FRHA 1GXUA 2VFSA 4DCOB 4OZ1A 2DNMA 2P9CA 3DN9A 1NKCA 4OI2A 4K2XA 2GAHC 4DBQA 4K4ZA 7AT1B 1Y10A 3GE9A 2PMHA 5I3UB 2HNZB 4AQYF 4KPYA 3TJAA 2HZCA 5CZXA 5L39A 3PO4A 4MFBA 2R7SA 4DWIA 2E9TA 1REVB 2EEYA 1FDDA 4FYWB 4ETZA 5KOWA 3D67A 5DG7A 2EI5A 2UUBJ 1S57A 2WW8A 5B0EA 4EZ6A 3MEEA 4ZVRB 2MZ1A 3HMJG 2M70A 2FJVA 2MGZA 3FNNA 5ETMA 2HVEA 3BH7B 3HKZD 3KKFA 3DLLQ 1YJWS 5LM7E 4ZPCA 2ZITA 2BJ7A 2HQDA 4KB7A 5DDOC 3E2EA 1N5QA 5D0EA 2KI2A 3HHKA 4LFBJ 4KFBB 1N5YA 1GX6A 1RUSA 3ZNJ1 3MGJA 5F8HA 4OI1A 4LFAJ 2QFJA 3N6NA 4W98A 3R6LB 3DMJA 1FVSA 3ILIA 1VQOS 1S77D 3WX8A 3C6TB 1CPZA 2WONA 5FLXU 1XC9A 4C8LA 3W65A 5J2NB 1S1WA 4ED6A 1PIEA 2LQ5A 3DRSA 2ZE2B 1FFGB 2HLUA 2IJRA 2DGUA 1HQUB 4I2QA 2PN6A 3Q8QB 3BO3A 3QIDA 3HHLD 2X1GA 1FX4A 4ED4A 4EK2A 4WCEQ 2XC9A 3K7RA 5EDWA 4OLOA 4NCAA 3K8VA 4J9NA 1WOSA 2AHOB 1N54B 5M2RA 3ZTOA 3HJVA 4Q5VA 3R7BB 3CO9A 2DH7A 3L9ZA 3HHLC 1R43A 3LH2S 2DEJA 4Q2MA 1TFWA 4P74A 1A9NB 3CJ2A 4YDXA 1S97A 3TZXA 3KHGA 2NQPA 5EHHA 2VFRA 1C1CB 4ZVPB 3L7OA 3ZXWA 3FJ2A 3NGTA 4A4JA 4JV2A 4LF5J 6FD1A 4DPXA 5D4NA 2JC1A 1SBRA 2FHMA 3V6DB 4UOFA 5GAHI 4LFCF 1UVJA 4Y2MA 3MAAA 3OQ2A 3ELHA 2OEJA 5D78A 3T5LA 1EARA 1GK8A 2F4FA 4EWTA 2XS2A 1SI9A 3MM5A 2HK3A 4FYYB 1X8DA 2BABA 1NXIA 4RW4B 4QR2A 1HL6A 5IWAJ 4JI3F 1LXNA 3L4BC 5EWEA 3X1LB 5F8IA 2PGCA 3K5NA 3US5A 4OYAA 2A1BA 4FS1A 2VOOA 2LU2A 2E7VA 4ZCIA 5HMWA 1FDAA 2Q79A 4DSLA 1HYSA 2JDJA 4UUWA 2Y0BB 4N76A 3UVJB 3VQSA 2G0CA 1HFEL 5IFMA 3AD7C 1DTQA 5HANA 3LP2A 1S0VA 3H42A 3JAMU 3GJTB 3N5BA 1ITPA 1ZBTA 2R8KA 1WC5A 4PUOA 2YKPA 1RT4B 1VR6A 1VRTB 3GP9A 2Y1JA 5F0WA 4ECRA 2XO6A 2GC8A 4DF4A 1GMWA 2AYGA 3D1QA 1HA1A 3TOQA 5EX3A 3BBCA 2XYHB 3I0RA 2FPHX 1MROB 2Z58B 1WSVA 4RR5A 3L7UA 2HHUA 4P9SA 4IR1A 1RHKB 1Y9OA 4C8MA 5HROB 2AGPA 2PSZA 2RB7A 4I67A 2DPIA 3NNCA 5I3PA 1HNZF 1DHMA 3RB4A 2DKOB 4URGA 1K0VA 2FHJA 1FDNA 2HEKA 1JLAA 2E5GA 3CD6S 1VRQC 2OPQB 5HMYA 4DV5J 1WHYA 4DS5A 3GR0A 4Q0BB 5HQ8A 1EQMA 1RK8A 1X0FA 3H59A 2R8JA 2C2EA 4K2JA 2CJYB 2R2UA 4ER8A 2MKIA 1KQKA 4TQRA 2GHPA 3QO9A 4QPTA 4FXVA 2AKWB 3FZBA 1S6OA 1U26A 4HDHA 3THTA 2E1RA 5ETPA 2RS2A 1QSSA 1YJUA 2H5JB 3KFWX 2J0QD 2M4MA 1FJEB 1ZOTA 1X60A 1H2UX 2G9OA 3F73A 1TKXA 1TMJA 1FJGF 2NYHA 3RGIA 2YWGA 2VBXA 4DL4A 3H2VE 5C5JA 5FJ4A 4M63A 5BXIA 1GEHA 1WEZA 4F4XA 4PABA 3UWTA 2BYCA 4JV5F 3RU0A 4OZLA 4H4MB 3OJSA 3M8PB 1T02A 5DJBA 1UZHA 2LEBA 2CQBA 4KSEB 4QJVA 1ELOA 2K1RA 2WHOA 2BRLA 2YWFA 1IBLF 4DR6J 3BEGB 3WZ0A 1WHWA 3RB6A 1R31A 1YJ7A 2CVIA 2JFKA 4CQ1A 3GIIA 5BR8F 2QIFA 2F8HA 2DR8A 4LRAA 5DM7Q 1NDPA 1OWXA 2OUGA 3H4BA 4X4OA 1IBMF 3DLEA 3PG9A 3K89A 3JTPA 1PYTA 2G2OA 1S0MA 2V8VA 4USIA 4ZDNA 1R7IA 2ATLA 5H1SV 4LSLA 2UVWA 1FKOA 1U8WA 2A0FB 4NCBA 2L9NA 4LRDA 4LFCJ 2A2CA 1ZZFA 1VQ5S 2V4QA 1KD1T 5ETRA 3NL0A 3HM9A 1SL2A 1Z2LA 3CWJA 4WZMA 4FZVA 2DNGA 1VBZA 2KG1A 1JK9B 4DPUA 3NCQA 1RHUB 4UQGA 2BJ1A 1G4CA 1HNXF 3SQOP 4LIRA 2X1BA 1X5PA 3SXLA 3R5JB 4JI3J 3AA8A 5LJ5Y 4OYBA 5IQQA 2DNYA 4FDFA 4CM2A 3J7ZT 1IBCB 2V9KA 3F44A 4J9QA 1FJCA 2VG7B 4K4SA 1XK8A 3D28A 3HFZB 2UVUA 1SKUB 2AYEA 2FC8A 1T03B 3VAFA 3EZOA 2KO1A 2V2KA 4B17A 4KIAA 3E3XA 3LP1B 3GV8B 3H5XA 3TP2A 3BPDA 2DPJA 1WORA 2DNOA 3TZZA 3QT7A 1VDHA 2CQHA 4A8MP 4FXDA 2VG5B 2HQCA 4J9RA 3E01A 1U1PA 3I82A 5C25A 2H4YB 5D77A 1IR2A 1UJ5A 2APOA 2OD4A 1YRUA 5C7PA 3ZO7A 4X62F 4RWWA 2D3UA 2DNZA 3C8YA 4QWDA 3TVZA 2F9DA 3K58A 1BD6A 2G2ZA 4M5DA 3M7VA 2W8LA 4BLGA 3TAMA 2J6SA 2JVRA 1GH8A 2HGNA 3TX8A 2K7JA 2G13A 2C2ZB 2F4VJ 5DLGA 1SJ1A 1IKXA 3DFEA 2A6OA 3FDSA 3LP0B 2B6AB 3FBBA 4X84A 4WF9Q 3MI7X 4Q2LA 1RBAA 4OHXA 4JP8A 1D9DA 4IO1A 1DJ0A 4WJBA 1WG4A 2AJFE 1BQNB 4NOHA 1HKAA 8ATCB 3IRWP 4CTAA 2WBMA 2GQCA 3N79A 5KT2A 3NEKA 2GW8A 2AJ2A 4ECQA 1XNQF 2W9CB 3GV7B 2EKYA 1S9EB 4PRFA 2XY7A 2DGTA 1VQNS 2XG8A 1MWQA 1T9VA 3GQCA 2YKAA 1XR7A 5K8NA 3PR4A 4EZ9A 4IRCA 4DL7A 1VQKS 4AL5A 3BREA 2HFOA 1LWEB 2HVZA 2ZH6A 1T05B 1U1QA 4GKKJ 2ZZTA 5DZ6A 2MLYA 4HDGA 2YH0A 4RJVA 2B51A 2J76E 3H4DA 1JXVA 5AXNA 3R5DA 1T9YA 2VODA 3HHNB 2YY3A 2XSJA 4OI3A 2ROPA 4ES1A 3A12A 4IQXA 2UUCF 2NCKL 1GTHA 3WHIA 1JXLA 1VJQA 1BXNA 3MHYA 4AFFA 4RBTA 3BV8A 5C24B 2MPUA 3T9ZA 1L3KA 4G3IA 1N5TA 2D69A 3PYFA 4DX6A 4QU7A 3CCQS 4ZP8A 1YZ7A 1S6PA 4KGVB 3V5RA 1QJHA 1IR1A 1F5CA 5DQIA 1I6JA 3A1YG 5I42B 5B0CA 2ATCB 2VICA 2C1EB 2RHSB 4ZMMA 1Q7LB 4JYAF 3K2YA 4QYRA 2XS7A 3MECA 2M2BA 1QUPA 3MMAA 4JI6F 1UPMB 4MK8A 4ZVHA 3CNQP 4D3HA 3MR7A 2C2OB 5G0RB 4X4TA 2C42A 2HWTA 2IVFB 5H9FK 3GILA 5ETLA 4GVBA 4DV4F 4H4KC 5GAEI 1HNXJ 3E51A 2LA6A 3DDKA 3G8TA 3QWPA 4KHPF 2VL1A 1SUQA 2EK6A 3GJSB 3AQOA 4LF4J 2F9JA 4IH6A 2DXFA 1OPIA 2R7WA 4DPOA 4KQZA 1XMOF 3H7HB 1NK7A 1UEKA 2Z0GA 2L48A 2YNGB 2CG4A 1IQTA 2IMOA 4DU7A 4JI8F 4ZVOB 4HI1A 2QA1A 5CYJA 1CC8A 4CI0B 2GNKA 3EVMA 5DETA 2V8DA 1RA7A 5A8RA 2HVHA 2WK4A 1PKUA 4IFYA 2XS5A 5BYQA 1T3NA 3UDEA 2HHQA 1ZYQA 5T41A 1S0OA 2UUWA 1J5EJ 1NRKA 2WAQD 1KFDA 4RUBA 1S72S 5HLFA 3NGKA 3IWXA 4L73A 4RW6A 1DQ9A 2LYVA 4PAAA 4A8KA 2RHQB 3V4IA 2OAUA 2LQBA 1IM4A 3DOKB 2B9WA 4K8RA 2HNYA 1F9FA 2L08A 1RLCL 2QX0A 1HI1A 4G1QB 1LW2B 2ZH2A 4DV2J 3T6BA 4URSA 1TP7A 4NLDA 1LWCA 4IO9Q 5LOQA 3PJXA 2GGPA 3MOJB 3MWBA 2O1PA 4PCQA 2Y3YA 3PV8A 1LK5A 4QYZJ 4C8YA 5CZVA 4HHHA 3C66A 4OZ0A 2WCXA 4RBUA 4LMZA 4K4UA 2P9GA 2OLWA 3K0JA 3UR0A 2C3PA 3FVYA 2J8SA 4WFBQ 2Z2ZA 5IT4A 4B3TF 2RF2B 1Y4ZB 1YK9A 2BJEA 2YNIB 1X4HA 4OJHA 3SFUA 5FLXY 1HPZB 4DX8H 2YKNA 3KJFB 4ZPDA 3G8QA 1TVRA 3ZZTA 3FK4A 4KH1B 2NS1B 4AL6A 2CZ9A 4P2XA 1RT5A 3HDSA 2X7IA 3KDOA 2H51B 2QL9B 4RNNA 2OPSA 1N4LA 3MM7A 2QLJB 5E41A 5A8KB 1N6QB 2ROGA 3PX6A 4OYMA 1GXTA 3J80U 4FP9A 4QW9A 2ZNZA 3BQ1A 1TL7A 1M90T 3R1LA 4ZJQA 5AT1B 1M5KC 1PJ7A 3VALA 4K4VA 4B9NA 1YLXA 4RUAA 2GAGC 1HI8A 4L72B 4JBCA 3M8SA 1NSAA 2HHHJ 1JLFA 3NWRA 2FY1A 2ZH7A 2BE2A 4C9DA 1CULB 2DNHA 3PEHA 2ADCA 4QWCA 1F60B 4C3MA 5EN1A 1RACB 4GO7X 4NLPA 3MEKA 2JH3A 4QBUA 3QBCA 2WVEA 3MPDA 1RT1B 5D3GA 1HWLA 3FC9A 3HCXA 4JYAJ 4P6QA 3R97A 5IQ6A 2IY5B 4WK1A 1M5PC 2NPFA 1FF2A 3AD9C 3BBBA 2XCPA 4RU2A 2XMKA 1C0TB 3EZ5A 1KVKA 3N4WA 4RWXA 2G4BA 2MHEA 1K8AT 3GG1A 2RDDA 1HNIB 2ASYA 1Q4RA 2R8GA 4FYDA 1U0HB 1FRXA 4WPAA 1WC1A 3C19A 3ENAA 3PFOA 2BKNA 4NLGA 1T9WA 2FYXA 2AP6A 2GQ2A 2V4JB 4IYQA 3MMBB 1N48A 4EFAC 4ELTA 3UD4P 3HF5A 2EW9A 3W2VB 4HHUA 2DNPA 2JFDA 1SIZA 4CRJA 3JAMY 4ECYA 3OPKA 3IS9B 1NJXA 4LUBA 1OSCA 3H5UA 2QYCA 4PQUA 3UI3A 4JI8J 4L3KA 1RWOB 3D6FB 4NWBA 4H4OB 2P2CB 1CBKA 1NU4A 2LU1A 3PVXA 3NAHA 4G65A 4ID8A 1KOOA 4F7VA 4NCGA 3OL8A 1S76D 1WC0A 4MIBA 3VGSA 5KFOA 1D9FA 1ZA2B 3QQCD 3A8KA 1Q1KA 3ET6B 4DLEA 3SQGA 1R6YA 1RAFB 4USMA 2H3EB 4F26A 3NS5A 1F5BA 3D5MA 3CCZA 1ROFA 2HFVA 4X4VA 1NLKL 4NA1A 2CJBA 2IVMA 4OZNA 4KV8A 1GXLA 3FBCA 1FDBA 3BSCA 2OPRA 5CYQA 3HJFA 2AU0A 1OJ4A 1H3DA 4YEAA 1CJTB 1SC4B 2NXJA 3FQLA 1JJ2R 3FCHA 4DR3F 4LF6F 4K50A 1REGX 4Z37A 1I51B 1N36F 1U24A 5DZ7A 2N3OA 3BGOP 5HBMA 3AD8C 3I9V9 1DTTB 3M05A 2EBEA 4B9TA 1RWVB 1UA0A 4DL6A 4Q45A 1H2TZ 1FESA 2EC0A 1WG5A 4ELVA 4ZHRB 2ROEA 2XTJP 4YR0A 1S9GA 2AD9A 1JLQA 4CYUB 4ZVEA 4FF2A 5H9EK 3FCVA 3Q83A 2ZC3A 3GSDA 3EYZA 3MMCB 2ZZMA 4ZLLA 1RT6B 2PEHA 5C2GA 1B0TA 1R8CA 4JI0J 2LMIA 5E2QA 4DPTA 3DRYA 3RRHA 4ED8A 1KFSA 4CLUA 3N0VA 1S1XB 4IFVA 1QE1B 3QT5A 1OY6A 2UUTA 4ILMA 2CA9A 4USHA 4EO6A 2GHWA 4F50A 3SZ2A 2DBBA 1HWIA 3LA0A 4FNHA 2VA3A 3QFHA 2QGFB 2W25A 5K14B 2M0GB 4ZP6A 3CDAA 3ILOA 1RQ0A 3DOMA 3ZZPA 1VK8A 3D66A 5AE3A 1GTEA 2ALZA 2B9EA 2M9KA 1RJJA 4DFPA 4O0IA 3HP6A 2X51A 2KM8B 1NPKA 4LF2A 4P2SA 3A4TA 1KONA 4JI2F 2E9RX 4TY9A 3H98A 2K8GA 2KT3A 3R9LA 3WIUA 4IKAA 4EU0A 4BBYA 1TL1B 1LXJA 2JLFA 4IR9A 4DR2F 2VZ9A 3HFVA 1ZETA 3CJTA 3QAEA 2B4PA 4D3GA 3KNGA 1FWLA 4L3NA 3WC0A 5DDQC 1RXOB 4YHHJ 3GIJA 4PYDA 3D6MB 3V81A 3M6XA 1X0PA 4QWAA 4K5SA 3UW1A 2NUHA 4KGXB 1KSPA 3W61A 2BM1A 3ISNC 3T9NA 4TKTA 3VGVA 3MXHP 2QZ8A 2KFZA 1N8RT 1VQ4S 3ENVA 1R6VA 2AF6A 1U09A 5B0FA 4FBTA 2KH9A 1D8YA 2WB4A 3VQTA 4ZVGA 2RVJA 2B9XA 4OQJA 4J9UE 3KJVB 2BW7A 3B82A 1S7IA 1OSDA 5LL6d 4DUYJ 4EMDA 1U1KA 2VD3A 5AE1A 5J1PA 4DG1A 3OL6A 3NCPA 4KHMA 7FDRA 2HG4A 1D9AA 1DLOA 1MN9A 4ECSA 2BANA 1PSDA 5E3AA 3ZZYA 2ZC4A 3M6UA 1HNVA 4JI4F 1WF1A 1N5VA 1U7LA 2CG8A 1S99A 1UVKA 3LPYA 3ZTSA 5FD1A 3M30A 1D8ZA 2B4UA 2YPZA 4DV6J 4OL8A 3THVA 1JJHA 4ZLPA 2FVSA 1S4EA 2W4PA 1N32J 2XWYA 3NS6A 2DXDA 2LQ9A 2IDLA 2ZBPA 2G2YA 2R42A 2EKNA 3EJMA 2JEJA 3A3OB 3O44A 4B3MF 2PA3A 2HNDB 2ZH4A 1OMSA 1KBRA 2R8IA 3R3TA 4RW9A 2J8AA 2Z4PA 2MDAA 4CWBA 1LWFB 3WC2A 4UF4A 1RP5A 3B4DA 4WBFA 2ZKTA 2YQ1A 1X4BA 2SXLA 1NSKL 1FX2A 4DR3J 4LF6J 4A8SA 2ABYA 3CJ8A 2Y1LB 4QU6A 2UXBF 1F6TA 2VG6B 2ASDA 2AT1B 5DG9A 1T0TV 1XQIA 5LMUF 1LV5A 4DUTA 4DLGA 4JI7J 2CPEA 1H38A 4NL5A 2E7XA 2XI2A 3TO8A 1SB6A 4ZCMA 1WJ9A 3O6QA 4P75A 1UA1A 5L9NA 2HZAA 5DGBA 2AWZA 3O3LA 1BHNA 1H72C 3IAS9 1O6XA 2RDJA 1YI2S 3HKWA 2WSEC 5SZTA 4EYIB 4PQAA 1PGZA 3KLEA 4DV1F 3N5FA 3IBWA 1KVIA 1FFSB 1BC6A 2ACMA 4F4YA 1FEEA 2VKRA 1RTDA 2MGZB 3I56S 4XDDA 2C2NA 1EHWA 1TELA 1WC3A 4NXMJ 2LFVA 2ZVIA 3TAPA 1MLAA 4DQPA 1PG5B 1KS2A 3HD2A 1T95A 3PFEA 3MEGB 2QT7A 3HSZA 1N5YB 4K59A 4DR4J 3KLIA 1KR4A 1ZPVA 1LW0A 1UTAA 4EUVA 2JHEA 3DOLA 2L41A 4RNHA 2W7OA 4ERDA 3DMJB 3A8EA 1HBOA 4MIAA 5D0GA 1RTJB 5CD4H 5KFHA 4YMEA 4DS4A 4GO5X 1X5OA 2E1PA 2M3DA 2WONB 1KQSR 3KG0A 2VIHA 1K1SA 3JQJA 3N9UC 1T8EA 5D6GA 4M1KA 1S1WB 1JLEA 2DY1A 2KXFA 5C42A 2ILYA 3DRSB 1RAHB 2KN4A 3UN3A 3OHAA 1IWAA 1KTQA 4I0WA 2BVZA 4ES3A 1IJEB 2UXCF 1J5OA 4I2QB 4B3RF 2X1AA 3BGFA 4A8YA 2QTWA 4HEA9 2EFGA 1NJZA 2NXCA 1TUWA 3BDPA 5KFKA 4YN3B 3T5KA 4PWWA 5EX0A 4JUZA 2R7UA 2FVQA 1P1LA 2E44A 4P7TA 2BE9B 2XBPA 3FQKA 3RR7A 2FLPA 2OPPA 4NYZA 2KVIA 4GMKA 4YB5A 4ATNA 2R9LA 5HJYA 4OJGA 1IVZA 3W7BA 1NK4A 3J7YI 1HQEA 1NZAA 2IFXA 5CH7B 1B7YB 3A3NB 4ZJLA 4OIXA 3J7AN 3R1HA 3MURP 2XSFA 5HMZA 1FWPA 2OMOA 1HBNA 4CO1A 5KT7A 1NEEA 1WKLA 3MAAB 2HRYA 3MM6A 3PTWA 2KT2A 3IR6B 4HKQA 5IT0A 5ETNA 2GHVC 1P27B 1S4FA 3KLFA 3PCOB 4KHRA 3MM5B 1U2FA 1FA0A 2CQDA 4B9MA 4WP9A 1NSQA 4U96A 2B4VA 4RKUC 4DX5A 1Q0NA 5LSLA 3EGVA 3ILLA 1Y0HA 1UKUA 2DIVA 4QCLA 1NHUA 1NCLA 2JEFA 1X7VA 1OYEA 5LSOA 1HYSB 4R8UA 3RAXA 4NMLA 1S10A 2IRUA 2NSCA 1IKWA 1NH7A 4ZPAA 4B3MJ 2O3DA 5JMNA 5GMDA 3UR3C 2KHCA 4KO0A 1MMDA 1DTQB 1RABB 4X66J 3IFEA 3LP2B 3GWCA 2ZOFA 1SKWA 1TU0B 2GX8A 4C11B 2P9EA 2V63A 2UUAJ 5A76A 4XK8C 2KM8C 4PUOB 3CTRA 2J6UA 3L09A 1SL1A 1BGXT 2IC3A 3RZAA 1RLDA 3FBFA 2UXBJ 1MW7A 2IM3A 2FLOA 4RW7A 4LF8J 2O66A 3I9ZA 2ACYA 3PZPA 1Q5VA 4UUXA 3I0RB 4BS2A 3CIZA 5KFQA 3LUYA 2EFOA 3BH6B 1FEHA 3NCRA 3MM8A 3GLJA 2ZWOA 3JTNA 1KNZA 1YDLA 2GIRA 3IR5B 2B3TB 4WFZA 3MF5A 3R6GB 3T1AA 1UVIA 4E0DA 3MMJA 3LF0A 4OV1A 4KGKA 4DV1J 2GZOA 3GIRA 4RO0A 1MWZA 4CO4A 1VC6A 2AJ1A 3J80Y 1R27B 3QGPA 2R2SA 1VHFA 3OUYA 1JLAB 4J9MA 3M4XA 2VG7A 1EETA 3R8YA 5HL7Q 1HLWA 1EIYB 3GJRB 4F3QA 4TU9A 3IR7B 2XGPA 4RNMA 2Z2MA 3QO9B 1VIOA 3RAMA 4B3OA 1VQMS 2VB6A 2YX4A 2O67A 4KBIA 2RT3A 2HFZA 4G1IA 1PYOB 4YB7A 5GMKa 4OX9J 1WELA 4YB1P 3W9JA 5IC4B 3I5BA 1N56A 3QT8A 2WZ1A 1TKXB 2PMZD 3CDUA 2OGUA 3OT9A 1VYAA 1VI7A 1G7CB 1O0PA 3T1YJ 1S6UA 5AJ3J 1U1LA 4ZIWA 1Q8IA 2DH8A 1KVJA 2VDHA 2CZVC 4O4GA 2ZE2A 4XIUA 2AYBA 1KHVA 3S1TA 3HVTA 4C8OA 3GTYX 2IM0A 2PE8A 1H7XA 3I5AA 3QGGA 3KK2A 4K4YA 5A0YB 1NK5A 2K1RB 3GCXP 2Q1LA 2EFNA 3NLCA 4MKBA 2Z8QA 5F3ZA 3V6KA 4N5SA 1HBMA 2OJ3A 2YNHA 3JQMA 4KGZB 2QSFA 4WFNQ 3EX7B 3PO5A 1KHWA 1B7FA 2GJIA 3OXLA 4R0JA 2DY9A 1APSA 4N8OA 3MR2A 1M1GA 4IUFA 2ZFHA 3DLEB 2NR0A 1G3OA 2V8GA 4JI5F 3CCRS 2P6TA 3FSIA 1XBWA 4W92B 1NDKA 3VR1A 4BCAA 2F3JA 1FRMA 1TL3A 3HI9A 3Q8PB 4LSLB 1SH3A 4QIFA 1FKOB 5HATA 3TAQA 2HIQA 5HP1A 3Q22A 1IKYA 1GT8A 1ZS6A 4NLXA 1ULRA 3G82A 3SCIE 4Y2AA 2HHXA 4WIIA 1HNWF 2R7XA 4ZA1A 1VBKA 1SJRA 5LSRA 4NLOA 1OIAA 2ZHOA 1RWPB 1S9FA 3Q8SB 2JRSA 4P10A 2KFYA 4HR2A 4WP3A 2OMLA 2FLNA 3CJRA 3ONQA 3LQVA 2CNNB 2CKWA 1FFWB 3V2UC 3ENWA 3RUBL 4CH0S 4IDKA 1GFWB 1VQLS 2OTLS 4F4KA 2IYIA 2B4OA 2YWEA 1PYSB 4WYLA 1JLCA 3DDIA 2V94A 1RHMB 1XERA 1HBUA 5F9LA 3NMAA 1U47A 3OD2A 2AW0A 3CJKA 1VRTA 4URQU 6FDRA 4F4WA 3CW2C 5T7LA 3MAHA 1CQMA 2CJAA 4JV0A 5C25B 2PA8D 3LGNA 2FZGB 4K0KJ 3ZZOA 2FQQB 5L1IA 4DV0F 2F8MA 1VC0A 4N77A 3W1YC 2DO4A 2DGWA 5F8NA 2UU9J 5CAAA 2IRXA 4M5DB 3TEHB 5HROA 2JVOA 2AEFA 3BGUA 3TAMB 2I6WA 3KHLA 2WRMA 5KFJA 2RRAA 1YKWA 4WKRA 2LCWA 4ILLA 5D4OA 4DQRA 4H4KA 1IKXB 2B8QA 3QATA 2ZM6F 1UVLA 4LBPA 3BN4A 2GVDB 2OPQA 2HHVA 1JKHA 1A6LA 3R5BA 1S6QA 3IWLA 3M2RA 1P9YA 2QC3A 1SQGA 3ITHA 1K73T 2CVEA 4CTAB 2E1AA 2AMCB 1LK7A 2CPYA 1KQGB 4F04B 4PXCA 2DCLA 1RAIB 4DUZF 8AT1B 4C7QA 3MUVP 2C2MB 3B4MA 1TKTA 1GAOA 5D15A 2ZBRA 1NK9A 2CQ2A 3AOBA 4DXLA 4G1PA 2ZD1A 4IH7A 5IT9U 2VQEF 2CPZA 3DNCA 3FRYA 2XQCA 2H5EA 2AEMA 1HW9A 1QAYA 4LQ9A 1EQ0A 3QAUA 2I9SA 3JB9k 2W4CA 3MOZA 3M8PA 1HWKA 2FZKB 1RDRA 3ZTQA 4PR6A 3D0HE 3ZTRA 1WKJA 4MJKA 4Q8EA 2NPIA 1WTBA 1CJKA 2XSJB 3OTOJ 3T6JA 2RRBA 1RAOA 2ZDPA 1ICEB 2QYGA 5U47A 3GIKA 4RU9A 3W5XA 1N33F 2HRTA 1UFWA 3IC1A 1PBUA 4ED1A 4MK7A 2PEBA 3NMRA 3PR5B 1GMWD 3BM7A 1VIXA 3TZWA 5JXSA 3TJ9A 3SSQA 3I6PA 1FXDA 3CVKA 1MSWD 3QGIA 3JSYA 2VC1A 1S5ZA 3D6HB 5M2UA 3NGSA 1ZH5A 4JI5J 2EFPA 4K7QA 3KLHA 4DL2A 3MECB 1RU1A 4X64J 3KK3A 3TEGA 3MMAB 2E1CA 4OZ3A 2HKEA 2W9BA 2FHJD 4NRTA 3KMQA 1AROP 3CXCR 2F1FA 4I68A 3FUYA 4GVBB 1KDNA 4ZLNA 4X65F 3GFXA 2ZH9A 1CG2A 4AYBD 2MKKA 2UXDJ 2EVZA 2CQ0A 3H20A 3P3DA 3MFIA 1FNMA 2RMLA 2QLFB 2IAJA 4PPDA 1NAQA 1MU2A 2RIJA 2W24A 1XMQJ 1JLBA 3RBEA 1T11A 2E1MC 1R3NA 3IGVA 4NLVA 4X4RA 4CO2A 5L1KA 5B0AA 3H25A 4V1Ak 3GB0A 4IOBA 2WBRA 2BUNA 3Q8RB 3K8WA 3GONA 4IFYB 2QA4S 1AYEA 4K4WA 2VONA 4P73A 1AFJA 3RBDA 5DS7A 4WE1A 3T5JA 3RB3A 4L76A 1KN6A 5HLFB 1BE4A 1ZZNA 1FNXH 2HHSA 2MXYA 4RW6B 2DNNA 4QIWD 4I69A 5J2MB 1M1KT 4J37A 4DV0J 2MHNA 3OXFA 3C3LA 2HNYB 2V67A 4F8RA 3H8YA 1XNRJ 2Q43A 4NRUA 3AB2B 3GIMA 1R0CB 2RDIA 3OFFA 2MQ8A 1JB0C 1LWCB 1HR0F 5KT3A 1N0VC 4YY3J 3MM9A 4LSNA 4QWBA 3EVWA 1CJVA 3DLKA 2GGPB 3Q89A 2C2RA 3U02A 3HFKA 3EGWB 1CQNA 2C3OA 5KFVA 3LWMA 4NYOA 1BQNA 2LA4A 2ILZA 3EM1A 2D41A 3KYLA 1RWMB 1SC3B 3C46A 1V5IB 3RR8A 3NAIA 1TV6A 4GKJF 2UV8A 1UL3A 2BDPA 4DI6A 1U0SA 2XY5A 3PNIA 3ILJA 5LMNF 1HD0A 4DUZJ 4U7UD 2YKNB 1TVRB 4CNZA 4CM0A 1LWEA 1T05A 4ANEA 2QMUB 3GFHA 4HT7A 1RT5B 2JJ4D 1H6KX 4J9KA 2MLXA 3ULHA 2VUGA 5DQGA 1TZ0A 3RYLA 2OPSB 3MM7B 3CPWR 3FCWA 4ZCKA 1P6TA 3R27A 2C3MA 5CYMB 1SXLA 1TL7B 4DV3J 3SCJE 3HVWA 3H90A 3PACA 5ETKA 2YQ0A 2KRBA 2RE1A 2BEFA 2NSBA 1H98A 5HQLA 1JLFB 4TLQA 1TUVA 2WSCC 3C6UA 2CQ1A 1Q8BA 4OX8A 1BUXA 1WF2A 4DR5F 3H0PA 4DV7F 4WZQA 5LJ3Y 3TUZC 1L3SA 1RAGB 2OHDA 4ECZA 3ZFVA 3UDLA 3BGRA 1KLNA 2DGSA 4O3NA 4OX6A 4TYAA 5IM0A 3M32B 4X4NA 4M5GA 1T9UA 4AXJA 1VHIA 4DF8A 1QTMA 3TUPA 3G9CA 2GO8A 3IM8A 3GSIA 2YPYA 1JJCB 1YGYA 4I6WA 2VBWA 4U8YA 3NNHA 2CPXA 2HBYB 3L3CA 1R8AA 2W2NP 3OTEA 3BKFA 1FK9B 5C2CA 4XPCA 2KXNB 4EEYA 1D1UA 1SQEA 3HT0A 4USTA 2OELA 3OR1A 2F7VA 4ANCA 1K44A 5KFUA 2R4FA 4C0HA 2D9OA 1E6YA 3J7A1 4LF7J 2R7OA 3EUNA 4KKOA 1JX4A 4C4WA 4IG3A 2XMMA 5KFNA 3K5MA 3BJYA 4UY85 2R8HA 4PQUB 4DSJA 3TQ1A 1I94F 4OI6A 4LF9F 4X4UA 2LKZA 4ECVA 1PJ5A 3K17A 4AUKA 3B6BA 3DU6A 4NCGB 4DFMA 4I2PA 1N34J 2JLEA 5F8LA 4OZJA 3IRXB 4NYPA 1ZTTA 1VMBA 3SQGB 2U2FA 4O23A 4AQYJ 1RTZA 3CT9A 2FGCA 4WFYA 3VGUA 4XPEA 1LW2A 2Y8WA 4KV8B 1FE4A 1NPPA 3PRDA 2OPRB 1YJTA 1OS5A 5CYQB 2VFTA 4ZVUB 1DQ8A 2KU7A 4H54A 1EKRA 2HWHA 2ZVSA 4B08A 2CRLA 2V34A 4CZCA 1O51A 2FJEB 1YZ6A 2G1HA 4NXNF 1UEVA 1RBOB 4CLSA 2N82B 3IBFB 2IBKA 4JV1A 1B3TA 1RBLA 4OHZA 3ETOA 2AQ4A 4A8FA 2RAQA 1AUDA 2HVIA 2HSEB 5HAOA 2J9CA 2OO4A 5A6PA 2BKPA 4DQIA 2HMIA 4DN0A 4DDFA 1KC8T 5HBMB 3MCMA 2V68A 3GFYA 3MEDA 4NLRA 4QWEA 3GZ7A 1WDDA 2EPIA 4Y65A 1Q8LA 4DCJB 1F5AA 3C16A 2I8EA 4GKJJ 2HFUA 4B9UA 4ZVQB 1B99A 3DU5A 1S9GB 2HS0A 2W7PA 1URRA 4DL0C 6AT1B 5KFEA 2RU3A 4WFAQ 5I4MA 2VPZB 1RWNB 3C15A 1AXQA 1WHVA 2YX7A 2VPWB 4ANDA 2BV3A 1JLGA 3CGIA 4KT0C 1MNEA 4DR7F 3AJDA 3KNAA 1X9SA 2DHSA 1F2GA 1OPZA 1EAYC 2R7VA 4A48A 4IFVB 1M1HA 2P6SA 2A6MA 2YWKA 1RISA 3NBPA 1Y3KA 3OBIA 3DRRB 1FXLA 4WIQA 1SH2A 1RWUA 2OP5A 1OQ3A 4B3SF 1C0UA 3MCSA 3MPUB 2V50A 5F8MA 3BN7A 1IJFB 2R2TA 2C22A 1VS3A 3DOMB 2XMVA 3LPEA 1QM9A 2YQ3A 2NYIA 3CCES 5BYSA 1U2RA 3HZEA 1AFIA 2PFFB 1FRJA 2V4RA 3RG6A 3NG8A 4DV7J 3DXSX 4FBUA 2PI5A 2QRRA 3R5AA 2B9YA 3UCGA 3QZ8A 1LQ9A 2VA2A 4M8LA 4U8VA 5B0GA 3I5CA 4YP3A 1SL0A 4RPFA 4KH0B 1NMEB 3VAJA 1NK6A 2W2QP 4Z2XA 3V81B 5H9FJ 5GADU 2QLBB 2RJZA 5ITHA 3CMAS 1VQYA 4USWA 3NKYA 3D3BJ 4M5LA 1EP4A 5GAEU 1BQXA 1V9OA 1S1VA 3IMQJ 1U0HA 3KHHA 3SDEA 4YS2A 4QIEA 2FJDB 3BBFA 1CJUB 2K3KA 4HTIA 1CVJA 2V2QA 2AIRB 1SV5A 4OHYA 2BA9A 1H74A 1DZ5A 3RJMB 3HULA 3JSRA 1FRLA 1U1OA 2VJVA 2CXEA 4DG1B 5K8PA 1U45A 3K5OA 2V5HG 1DLOB 1I5OB 2BANB 2BKOA 5T14A 4P2MA 1NB2A 4OI4A 3QT6A 2IJNA 5KFZA 2DVIA 2E5HA 1HNVB 2MJNA 3U7JA 5F8JA 3FZ2A 2DGVA 2LEAA 5F8GA 2N4DA 3G2XA 5EGYA 3M30B 3MUTP 2WB1D 2E7WA 4DHVA 2ADBA 3FRZA 4UZCA 3AXKA 3MCNA 4FVMA 2C2DA 1NHVA 2XZWA 4NLWA 3AH6A 2YKQA 2YKOA 2HK2A 1QUVA 2GJ2A 4PG8A 4FYVB 2MQOA 4USJC 1VQ7S 2PD1A 2B5JB 1CJTA 4RW9B 2CDQA 4QQBA 1M5OC 1HNZJ 4CO5A 2W9AA 4OYIA 2R7QA 1NPRA 2BRKA 3GYXB 3R7SB 3BO4A 3RRKA 4MIWA 3KG4A 5KG1A 3Q2SC 3CC4S 3M8RA 4C6AA 3DI6A 4LREA 1VQ8S 1JWWA 1Y7PA 2WVDA 3SFGA 3OW2R 1TUGB 3DYAA 2DGOA 1Q86T 1FD2A 3X3UA 3IG1B 1Y5NB 2U1AA 2W7AA 5D4LA 3HT3A 3RRGA 3UCUP 1K9MT 5MLCV 5IT9Y 3AAWB 1U1MA 2MY7A 3EMTA 5KFDA 4A8WA 3FFIB 3CO0P 2UUBF 4IRDA 5ADZA 3ENQA 4C0OC 2AYMA 3JS9A 4U7UK 1I1GA 2B7CB 5CCLA 1FJGJ 2H54B 3KLEB 5DDRC 1FHTA 2VFUA 1TKDA 2DB1A 1TQLA 1EB0A 2YX1A 1UFKA 4JV5J 5J1NA 2WVFA 5HO4A 1NKBA 3SBMA 2DH9A 1VQ9S 4LFBF 1H0HB 5THWA 4LRCA 4DX7A 2GO9A 3GJQB 2BOPA 2D7SA 5E0OA 1U49A 2HFSA 2LECA 2AZ1A 5K14A 1LOUA 3OJUA 3UD3P 2HURA 1IBLJ 4ICLA 5KG2A 2FY8A 3KLIB 5B0DA 2Q6CA 3B8HA 5BR8J 1VRUA 4ZVFA 5IS2A 5E3PA 2ZKUA 3DOLB 3W64A 1LFPA 5KG7A 1HBOB 4OZ5A 4C8ZA 2IJFA 5AXLA 1H73A 1YJRA 5I3QA 1IBMJ 2K3IA 5KFIA 3SMZA 4FF3A 2HBZB 2DHHA 5KFMA 5DM6Q 1F3VA 1JLEB 3QZ7A 5B08A 1TMMA 5C42B 3ZC4A 3Q8VA 3L7PA 1N0UA 2COLA 3ADAC 2FIUA 2M8DB 3CB4A 2VFVA 1D0EA 2Y0SD 3QMQA 3QJPA 3N6MA 1WEYA 3IA0A 2OSRA 1S0NA 5GADI 5ETOA 4DPWA 2ZBQA 4USUA 2L9WA 3LALA 1PILA 1VK3A 2V8HA 3EXCX 2OPPB 2W2PP 3VVUA 2RILA 2HW3A 5K9FA 1EX8A 1MWYA 3KDNA 4ZP9A 2AZ3A 1K0TA 3OFHA 2M7SA 4HI2A 1Q16B 4NX9A 3CCSS 1HBNB 5KFCA 4NEZA 4I64A 4RNFA 2QL5B 1Y5IB 3RBXA 2H48B 3PYGA 2HS4A 3CF5Q 1S1UA 1ZTWA 3MM6B 3AOAA 3TR5A 2ZH3A 3DLGA 4HTJA 1RT7A 1YG0A 2CPJA 3FGVA 1N88A 2PMWA 4RZRA 4LBHA 3CC2S 3DXBA 3BKTA 3OLAA 2KB2A 3TA0A 5JJBA 1SJ4P 2KYXA 2GFFA 1M0SA 2CNLB 2UZAA 3NOCA 1WD6A 3UQSA 1NSPA 2I5JA 2N7CA 4LRFA 5L8RC 3EE3A 3PEJA 2KT5A 4X62J 2F5GA 7FD1A 4R5PA 2MB0B 4R8UB 4Y2KA 4KTQA 3ZZUA 2D3OR 3QLHA 3THPA 1W25A 2CNKB 1IKWB 4OMFG 2K7KA 2YKMB 1U1RA 4CLLA 4KO0B 1E6VA 2VC0A 5L46A 1J2VA 4P72A 3HVRA 2FZCB 2BOAA 3PIOQ 2BZ2A 2PO4A 5J1EA 3LOUA 2RQMA 1FVQA 3ETMA 2JEIA 1WACA 5AXKA 1PJ6A 4QPXA 4P2FA 1U2CA 2HQFA 4PKDB 2OH2A 2XI3A 2DTJA 5L9XA 3FEYB 3IM9A 2XMWA 4RW7B 4ZKAA 3L95X 2EC2A 2LXIA 1WG1A 1XNQJ 2XEXA 5DDPC 3HX9A 4M95A 5H9EJ 1TR0A 1HQ2A 4EO8A 3BO2A 3OTDA 3MM8B 4PPZA 1DY3A 4HLBA 4N8NA 2VH7A 2RRNA 4C3LA 2DR9A 4PG6A 2MQMA 3BB5A 1NUEA 1HMVA 2Q3PA 3BSOA 4DV5F 3MR6A 2R3VA 2JOQA 1K47A 1DFDA 1XR6A 3OUYB 4OYXA 2E9ZA 1PC5A 1KP6A 3N28A 3VZHA
chains in the Genus database with same CATH topology
1WC0A 4USVA 2QV6A 4P2MA 1CJKA 1CJKB 1WC5A 5D0GA 2GVDB 3ET6A 3C14A 3ET6B 2GVZA 1Y10A 3C15A 4CLWA 2GVZB 4OYMA 4OZ2A 3C15B 3MAAA 1AZSA 3MAAB 1AZSB 4P2FA 5IV4A 1TL7A 1CJVA 1TL7B 1U0HB 4CLTA 1CJVB 4NI2A 2GVDA 3R5GA 4NI2B 5D0RA 4WPAA 5D0HA 1Y11A 1WC6A 1WC1A 4CLUA 4USTA 4USWA 2WZ1A 4CLYA 4OYPA 1CJTB 1WC4A 1AB8A 4WP9A 1U0HA 5D15A 1FX4A 4OYOA 2W01A 1CULA 4CLSA 3G82A 1CULB 3G82B 1YBUA 1CJUB 1YK9A 1WC3A 4CLZA 2BW7A 4OYAA 1CJTA 1CS4A 4USUA 4OZ3A 3MR7A 1CS4B 3UVJA 5D0EA 4CLPA 4OYWA 3UVJB 4OYIA 5IV3A 4OYBA 4OYZA 1CJUA 1FX2A 4CM0A 4CM2A 3C16A 1YBTA 3C14B 4WP8A 3C16B 4CLKA 4CLLA 4P2XA 4OYXA 4WP3A 4CLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WC0 A;  4USV A;  2QV6 A;  4P2M A;  1CJK A;  1CJK B;  1WC5 A;  5D0G A;  2GVD B;  3ET6 A;  3C14 A;  3ET6 B;  2GVZ A;  1Y10 A;  3C15 A;  4CLW A;  2GVZ B;  4OYM A;  4OZ2 A;  3C15 B;  3MAA A;  1AZS A;  3MAA B;  1AZS B;  4P2F A;  5IV4 A;  1TL7 A;  1CJV A;  1TL7 B;  1U0H B;  4CLT A;  1CJV B;  4NI2 A;  2GVD A;  3R5G A;  4NI2 B;  5D0R A;  4WPA A;  5D0H A;  1Y11 A;  1WC6 A;  1WC1 A;  4CLU A;  4UST A;  4USW A;  2WZ1 A;  4CLY A;  4OYP A;  1CJT B;  1WC4 A;  1AB8 A;  4WP9 A;  1U0H A;  5D15 A;  1FX4 A;  4OYO A;  2W01 A;  1CUL A;  4CLS A;  3G82 A;  1CUL B;  3G82 B;  1YBU A;  1CJU B;  1YK9 A;  1WC3 A;  4CLZ A;  2BW7 A;  4OYA A;  1CJT A;  1CS4 A;  4USU A;  4OZ3 A;  3MR7 A;  1CS4 B;  3UVJ A;  5D0E A;  4CLP A;  4OYW A;  3UVJ B;  4OYI A;  5IV3 A;  4OYB A;  4OYZ A;  1CJU A;  1FX2 A;  4CM0 A;  4CM2 A;  3C16 A;  1YBT A;  3C14 B;  4WP8 A;  3C16 B;  4CLK A;  4CLL A;  4P2X A;  4OYX A;  4WP3 A;  4CLF A; 
#chains in the Genus database with same CATH topology
 3JSM B;  1EET B;  2QSW A;  2P8I A;  5AE2 A;  3T19 A;  1BMQ B;  3MEG A;  4PWD A;  4ZPW R;  1G2E A;  2UUC J;  1OY8 A;  1W2I A;  2R7T A;  2C28 A;  4B3O B;  1RTJ A;  1LWX A;  2A3J A;  2J7K A;  4ETX A;  2YH1 A;  2XYP B;  1UPP A;  3T1H F;  2FC9 A;  1ZAV A;  3KMS A;  1DQA A;  4BDP A;  3KLG A;  4O44 A;  4C97 A;  3G87 A;  2ZZN A;  4LR9 A;  1UJ6 A;  4FN5 A;  2LXF A;  5CAB A;  3TVY A;  2YTC A;  4O4G B;  5ETS A;  1T9X A;  1GMV A;  1YBU A;  1BWV A;  2IA6 A;  3HVT B;  5B7W A;  1QDU B;  4JI6 J;  3KK2 B;  1U4B A;  2ASJ A;  4EGL A;  2W8K A;  4DR6 F;  3R5C A;  2G0J A;  3C14 B;  1ACM B;  1U25 A;  4FPI A;  4OX7 A;  2WOM A;  4YFU A;  1HBM B;  4RBV A;  2N4C A;  2YNH B;  3SI8 A;  4X4S A;  4DV4 J;  2MSS A;  4W4M A;  4I7F A;  1RTI A;  3PRB A;  4KHP J;  2D9P A;  3CME S;  2J9D E;  2DHG A;  4LBI A;  2HWI A;  1KEK A;  2BQU A;  1VGY A;  1RYR A;  2XB2 D;  2DGX A;  4CLT A;  1WDT A;  4X4P A;  2HBQ B;  2EFV A;  4X2B A;  1C4A A;  4OHW A;  1XMO J;  3PJW A;  4DOZ A;  2MY8 A;  1TL3 B;  3I0S A;  2J6T A;  2CQ3 A;  3P5T L;  1YSJ A;  5HP1 B;  1IKY B;  3CCV S;  1IM6 A;  1URN A;  1WHX A;  3G82 B;  1XIQ A;  1TKZ A;  1C1B B;  4YR2 A;  1WOO A;  4IRK A;  3QJL A;  2DK2 A;  2KL8 A;  2DGQ A;  3FEX B;  3N01 A;  4ILR A;  1F9H A;  1S48 A;  1SCJ B;  3NY0 A;  1X31 C;  1W7W A;  3HSG A;  4TXS A;  3G6Y A;  3QGH A;  1BQM A;  3I32 A;  2W2M P;  3I31 A;  3LO3 A;  1HAR A;  2WVB A;  2HGM A;  3QFW A;  4KR0 B;  1RHQ B;  2GV1 A;  1Q95 G;  3BPS P;  4IDK B;  2FUG 9;  2FDN A;  3CCU S;  3W8G A;  4N41 A;  1RT3 B;  4YUD A;  3TUI C;  4BWM A;  3TYT A;  4C11 A;  4FVC A;  1D09 B;  4IG0 A;  2J0W A;  4UOH A;  1JLC B;  4NI2 A;  1HBU B;  2CZ4 A;  2B8P A;  4I6A A;  1FNO A;  3CJK B;  4E2F B;  3TWZ A;  2HQI A;  1C2P A;  4F4Z A;  2E5I A;  5T7L B;  1XMB A;  5GME A;  3TW0 A;  3PX0 A;  3KUH A;  4NPO A;  3HXM A;  2FLL A;  4CH7 A;  4B3T J;  1KTV A;  3FBE A;  3VCD A;  3VV2 B;  1N52 B;  2OIH A;  3HD1 A;  2KTQ A;  4MAK A;  5E33 A;  4HH0 A;  5M2P A;  3TRG A;  3AOC A;  3ISZ A;  2F4V F;  1YBT A;  1FO1 A;  1KOH A;  1S1T A;  1HI0 P;  3AOD A;  9ATC B;  1L3U A;  4USV A;  1Q81 T;  3MTJ A;  1RU2 A;  4XTT A;  1PAU B;  2WSF C;  5HQM A;  2XYG B;  2FHK A;  4FKY A;  4EYH B;  2QA2 A;  4DQQ A;  2GVZ A;  2V2Z A;  4XDC A;  3OVB A;  4FPR A;  4UTG A;  1JKH B;  1A0O B;  3GYN A;  4NLS A;  3UNY A;  1S6Q B;  3M2R B;  2CNO B;  5F41 A;  3ITH B;  3NP5 A;  2DRD A;  4ZVS B;  1FER A;  3Q8U A;  1UVM A;  2QE5 A;  2CWX A;  3P96 A;  3NGR A;  1CEZ A;  2V0N A;  3EXY A;  2AV5 A;  4KAI A;  3HZG A;  5HVG A;  2DXE A;  3VAI A;  3EDQ B;  2VKZ G;  3W2W A;  2XZD B;  4M94 A;  1TKT B;  3VHQ A;  3OSP A;  2LDY A;  3ZNU A;  5DG8 A;  2ZD1 B;  4GKK F;  3M2V B;  5DRK A;  4C98 A;  4Y0F A;  2ASL A;  1QAJ A;  4N56 A;  2MKJ A;  3T1H J;  4I56 A;  2NZC A;  1TAQ A;  3AQP A;  2OKQ A;  2H4W B;  3PIP Q;  3DGP A;  3OFE A;  3DLB A;  2CAJ A;  1IBK F;  5HI7 A;  2IYG A;  5A0Y A;  3CD7 A;  1CJK B;  2DT9 A;  1IKV A;  2CPI A;  3I87 A;  5KG0 A;  2XNQ A;  2Z30 B;  1SC6 A;  4WU2 A;  3TAR A;  5RUB A;  1A7G E;  4PG7 A;  3DGV A;  2V9W A;  4P52 A;  3J7Y U;  3OR2 A;  3CCL S;  3PRV A;  1UMJ A;  1SKS A;  3S01 A;  3M2U A;  3UN5 A;  1UP1 A;  1XJW B;  2J7U A;  4F3M A;  1RKJ A;  5L1L A;  1YRT A;  3D7S B;  1UWB A;  1SQF A;  3GYG A;  3CUN A;  4O3Q A;  1H2V Z;  4FS2 A;  3R2C J;  1LEO A;  3KLH B;  2Z56 B;  1CS4 A;  3KK1 A;  3KK3 B;  5KFB A;  5FII A;  1T7P A;  2DNL A;  3MZI A;  2W9B B;  2DEI A;  2VHG A;  4CO3 A;  4NZ0 A;  3T41 A;  3OHB A;  3SV4 A;  4AD6 A;  2BW2 A;  4C3K A;  4HT5 A;  4TY8 A;  1EZZ B;  4V19 X;  1FKP A;  2ZOM A;  3A13 A;  2QV6 A;  3BDE A;  4AE5 A;  4LF4 F;  3UNG C;  1R0A A;  1P8G A;  4TLR A;  5CCM A;  3D6T B;  3M1V A;  3V4M A;  1R8H A;  4NZ7 A;  4PG4 A;  4X4Q A;  2IAJ B;  2ZUA A;  4AL7 A;  1VQS A;  2AJ0 A;  1MU2 B;  1YVF A;  3W5Z A;  1JLB B;  5DQH A;  4OJ1 A;  5KG4 A;  3KXD A;  5KFL A;  1WF0 A;  3M8Z A;  2CJQ A;  5KOX A;  1T3O A;  1RCO B;  1RWK B;  2EK1 A;  1RTH A;  1EJ7 L;  4ID5 A;  1YRX A;  2DNR A;  3M6W A;  5E3R A;  3HHL A;  3PYE A;  3JYT A;  3TI0 A;  3AHP A;  4MTP A;  2XZT B;  2LQ8 A;  3S6E A;  2MQL A;  2GIQ A;  4E98 A;  4A46 A;  3ZZR A;  1HW8 A;  1J5E F;  1N36 J;  3ZTP A;  4J90 A;  3KUG A;  4ED7 A;  3RBZ A;  1Q5Y A;  5ETQ A;  3I4P A;  4KJI A;  4WE1 B;  4NA3 A;  2AJQ A;  3QRP A;  1YTY A;  4HYK A;  3D0G E;  2HYI B;  3FKB A;  5J2Q A;  2A18 A;  2HLT A;  2BBE A;  3K5L A;  4B9L A;  2VU5 A;  3DRP A;  4CDI A;  3BSN A;  4MFB B;  4O3R A;  3AT1 B;  4DV2 F;  5A8W A;  3H40 A;  3POT A;  2YNF A;  1YJ9 S;  4CT9 A;  4DQS A;  3MEE B;  2E5L F;  4PXD A;  1X4E A;  2DCU B;  2UVR A;  1P1T A;  4U7C A;  4O4R A;  8RUC A;  3MM9 B;  4LSN B;  1CJV B;  3DLK B;  2GVD A;  4ALZ A;  5EWG A;  4S0M A;  1MML A;  3BQ0 A;  1ZM2 A;  1GQE A;  3W60 A;  3DLH A;  1FKA F;  3NGD A;  4DJB A;  2QFI A;  1RT2 A;  4RL1 A;  3CIM A;  3QIP A;  1TV6 B;  2DIT A;  3WDO A;  2XM3 A;  4G6V B;  2MQP A;  5E3C A;  3U27 A;  3U1L A;  2ZBC A;  4ZS6 A;  2RUG A;  3WX4 A;  1YIT S;  4HAC A;  2RKI A;  3D68 A;  3PW2 A;  4J9O A;  4FKX A;  3PHE A;  4ZCL A;  4JI2 J;  4QR0 A;  1U6B A;  5K8O A;  1SKR A;  3M9N B;  3EVO A;  1NKE A;  2CIM A;  3MDF A;  3EGN A;  2XHW A;  3VVT A;  2PDA A;  2DIU A;  4DR2 J;  3HHE A;  5IZH A;  2MJU A;  4MMO A;  1M5V C;  2WVC A;  1V5V A;  1WEX A;  5J2P A;  1IBK J;  3DKD A;  2FTR A;  5D0R A;  4Y6I A;  4DZ6 A;  1NJW A;  2YBV A;  3M8Q A;  4PXE A;  2HHH F;  1F9E B;  4ZIV A;  2OD6 A;  2ZHA A;  3DLJ A;  1QAI A;  2OEM A;  1Q53 A;  1MG7 A;  1GNK A;  3C6U B;  3HSJ A;  4WTO B;  1N5S A;  3OTC A;  4NE9 C;  4RW8 A;  3SEO A;  4FYX B;  3SCK E;  4R25 A;  1RAD B;  3G6V A;  1KLM A;  3LAK A;  3NS7 B;  2IA0 A;  5CA5 A;  5FDL A;  4CLP A;  4ZPB A;  2BM0 A;  2XMJ A;  4HHJ A;  4LR8 A;  3BGR B;  1JMT A;  2YVS A;  3OVA A;  5IM0 B;  3T5H A;  1F0X A;  3DM2 A;  2MKH A;  4ECW A;  1KWM A;  1RI7 A;  1QD1 A;  1SJ3 P;  4F2S A;  1F1B B;  3Q8Y A;  2GIF A;  1ZA1 B;  1I3O B;  3IXQ A;  5G4D A;  4B9S A;  4JI4 J;  4K4T A;  1AZS A;  2AEJ A;  4WYW A;  2GS8 A;  2L9D A;  1HD1 A;  2A2D A;  2ZWP A;  3UFC X;  1CC7 A;  1WNE A;  2QLW A;  2X3D A;  4UZB A;  2FJW A;  3OR1 B;  1X4C A;  1FRI A;  3I55 S;  1AB8 A;  1HHQ A;  4ED2 A;  1E6Y B;  3RW6 A;  5KFS A;  2FJB B;  2IVY A;  2ZEJ A;  1LFW A;  4QIG A;  3MD3 A;  4UT4 A;  4MKA A;  3VF0 B;  3S8S A;  5A2Q U;  5LXR A;  3PKM A;  4KKO B;  4LF1 A;  4IG3 B;  1FD8 A;  2HQ3 A;  3TJ8 A;  5HVH A;  2BR0 A;  3FSX A;  1Q82 T;  1VBX A;  4EI2 A;  3W66 A;  2DR7 A;  5KFF A;  1UJ4 A;  2MZQ A;  3VGT A;  4OYZ A;  4AXI A;  1S12 A;  4K5R A;  5E7O B;  4C0B A;  3J81 j;  2OI2 A;  2ZHB A;  3NNA A;  2ZH8 A;  4DEZ A;  2X1F A;  3K5P A;  4I2P B;  2VOP A;  5KFT A;  3KOA A;  1FTR A;  4ED5 A;  2JWN A;  1SIW B;  5LMU J;  2MTL A;  1WSR A;  4J7C A;  5I3U A;  2HNZ A;  1WTF A;  5J2M A;  3CE8 A;  3W5Y A;  3CJ0 A;  5F3T A;  2MLZ A;  5ETT A;  4QZV B;  5IV4 A;  1REV A;  3LWL A;  2HVD A;  2XLI A;  3H2U B;  2VJU A;  2FD2 A;  3AB4 B;  4XAK A;  1G6B A;  1UZD A;  1YHQ S;  3OTB A;  3AY0 A;  3NOG A;  4DCP B;  3GV5 B;  4BC9 A;  5B09 A;  2ZJR Q;  2E5L J;  3TVK A;  3D2W A;  4GC7 A;  1QSL A;  1B4S A;  4B9V A;  3DDN A;  2HAI A;  3OV7 A;  5KG3 A;  3BR8 A;  4ENO A;  2L3M A;  3BYR A;  1SPB P;  3PX4 A;  1CSJ A;  4WWS A;  3Q2T C;  1JQG A;  1YWX A;  3TA1 A;  2HMI B;  4PXB A;  4KFB A;  2LQJ A;  3MED B;  3JSB A;  4O3S A;  4DU8 A;  1BY9 A;  4LR7 A;  4WP8 A;  3C16 B;  2CJ9 A;  5KFY A;  1M5S A;  2MZJ A;  1IN0 A;  3EWG A;  1RZM A;  4HH1 A;  1Q78 A;  4ZN1 A;  3UPF A;  1RE1 B;  2UV8 G;  2KVQ E;  5E3Q A;  3C6T A;  1PBA A;  4CLW A;  4JI0 F;  2CYY A;  3C15 B;  5J2N A;  4DSK A;  3N6L A;  4DSI A;  1T9T A;  2BJ9 A;  3RAQ A;  2BQ3 A;  4UY8 T;  4Y2I A;  2DHA A;  1JLG B;  2NLW A;  4KYZ A;  4U9R A;  3H5S A;  1VBY A;  1PAE X;  4CLY A;  1HQU A;  2H65 B;  3BSA A;  4C8N A;  4J9L A;  3TNV A;  3NWG A;  2UXC J;  5CYM A;  4DSE A;  3NBP B;  4GC6 A;  1PCA A;  4B3R J;  3BZQ A;  2I2Y A;  5CQG A;  3CDB A;  1C0U B;  3G86 A;  2HQG A;  5KFA A;  2OTJ S;  2DRA A;  4ECX A;  4DN9 A;  1ZPW X;  2BMB A;  3HPO A;  4MKV A;  1QY7 A;  2KJV A;  5KTQ A;  4YB6 A;  2IBO A;  4O3O A;  2N3L A;  1C1C A;  3BKU A;  4MKY A;  3MUM P;  1IR0 A;  2FHO B;  2HHW A;  3IWN C;  2XY6 A;  3M32 A;  4PEO A;  3V6D A;  1L5U A;  3VAG A;  4WTY A;  3CD0 A;  1V3S A;  4YHH F;  3KJN B;  2VPX B;  2RQC A;  3G96 A;  3SCL E;  3AFG A;  1FE0 A;  4WFX A;  3GU0 A;  2LXU A;  4TNO A;  4RW4 A;  1EP4 B;  4CP5 A;  1PO6 A;  2HZV A;  4IQM A;  3G6X A;  4FF4 A;  1Y3J A;  1WC4 A;  5F0U A;  1FK9 A;  1S1V B;  3PW4 A;  1RB0 A;  3SSR A;  4UW2 A;  3SDE B;  1L3V A;  3SYZ A;  3IBC B;  1VLY A;  1JIH A;  1NK8 A;  1VQ6 S;  4DUY F;  1SV5 B;  1R8P A;  1NJY A;  3UVJ A;  3UDV A;  3G4S S;  1UW4 A;  5GAG U;  4M5J A;  3M6V A;  1WKK A;  2H5I B;  2M5Y A;  2ZH1 A;  2Q6B A;  3VAK A;  3UCZ P;  4DL3 A;  2W4D A;  3WBZ A;  4MH8 A;  3MPW A;  2DYA A;  1UVN A;  2M8H A;  1KRP A;  1RT4 A;  4E8U A;  3TX0 A;  2RQK A;  4DFK A;  2VQF F;  1X4A A;  2RUS A;  3QYY A;  2B56 A;  3PJ9 A;  3E01 B;  1UWA A;  2LP4 A;  1RKI A;  2JX2 A;  1W2B R;  4DV6 F;  1TL4 A;  5BYR A;  1ZM9 A;  3IRX A;  1MRO A;  4QOT A;  1N32 F;  3BQ2 A;  3P45 B;  2NRE A;  4F4A A;  1FTC A;  3SV3 A;  5IXU A;  3F0N A;  3HSD A;  4V19 J;  4PYA A;  4CLZ A;  3W9I A;  4J9V A;  3M9O B;  2W2O P;  5KAK A;  2GCF A;  4WKY A;  2EBG A;  1SJF A;  2J7W A;  2JZ5 A;  1F2H A;  2GA7 A;  2K06 A;  3GG0 A;  4ZVT B;  4IOA Q;  4Q0B A;  2Z2Y B;  2DO0 A;  4QYZ K;  1IXK A;  5KT4 A;  3DI6 B;  3A8I A;  2CQC A;  4NMX A;  4JI7 F;  3IO1 A;  4HVZ A;  2V8P A;  3DYA B;  2H1Y A;  1DRZ A;  4A47 A;  3R7N B;  3BS9 A;  4JI1 F;  1NO8 A;  1PC4 A;  1QSY A;  2ZOG A;  4OZ2 A;  3BYP A;  1TTH B;  3PHT A;  5D4P A;  2BE7 D;  1CLF A;  1NK0 A;  2G0I A;  4MK9 A;  2FVR A;  3J7Z 5;  2QMX A;  3KWM A;  1HIY A;  3KG1 A;  4ZLJ A;  1R8B A;  5E5N A;  1W26 A;  3CD5 A;  4RNO A;  1VIS A;  2IMW P;  1RWW B;  3TA2 A;  3VAM A;  3Q0A A;  4ELU A;  4H4M A;  3D3C J;  3R2D J;  4NXM F;  2J9E A;  2QEX S;  2AX1 A;  3DRR A;  3CDW A;  1QVG R;  3EPI A;  4DR4 F;  2E66 A;  3CJ4 A;  3RB0 A;  2V2V A;  4TU7 A;  3TZY A;  3Q24 A;  4ICL B;  2NXN A;  1DAR A;  2HFN A;  1VRU B;  4Q8F A;  1WOP A;  2DR5 A;  3LW5 C;  4WK3 A;  4I1T A;  4ZPV R;  3UN2 A;  4F0M A;  4NEY A;  1RAA B;  1S59 A;  5KT6 A;  4AT1 B;  1S6P B;  3Q86 A;  2YWW A;  3LAN A;  2ERR A;  4Y28 C;  2LDI A;  3U1M A;  2OSQ A;  3CCM S;  3W3S A;  1Y00 A;  2BJD A;  2UVV A;  3CCJ S;  4QW8 A;  4M5H A;  1O5J A;  3JXO A;  3ISN D;  1NDC A;  1FT8 A;  1VC5 A;  2VBZ A;  4L74 A;  4M5M A;  4PG5 A;  3BGL A;  3NXZ A;  2X3G A;  2MMY A;  2ZNY A;  5HVF A;  1MMN A;  2NZ4 A;  4IOC Q;  1DAX A;  4IH5 A;  4NLU A;  1HWU A;  3CC7 S;  1HNW J;  2CAD A;  2D74 B;  1RSC A;  2IDE A;  3MD1 A;  4TQS A;  3KLV A;  2AX0 A;  1SUQ B;  1CJU A;  4F67 A;  5KFW A;  2FVP A;  1VOM A;  2LVW A;  1T94 A;  2KHD A;  4MT1 A;  3WQP A;  3MPV A;  5JVG Q;  2QL7 B;  1T03 A;  4EBE A;  4TVA B;  5GAG I;  2M88 A;  4EBD A;  3LP1 A;  1RHJ B;  3D54 A;  1RWX B;  4U95 A;  2VF3 A;  3IAM 9;  4MYU A;  2MYF A;  5A8R B;  3TUJ C;  2JNJ A;  1V3Z A;  1S1U B;  2QMW A;  3CDE A;  1S49 A;  2W1B A;  3DLG B;  2BQR A;  1YX2 A;  2VG5 A;  1WI8 A;  1RT7 B;  1FWK A;  2QLX A;  2PI4 A;  2LLZ A;  2VAS A;  2VQF J;  4WU3 A;  4ECT A;  2HRU A;  1Z4U A;  3PKY A;  3NGU A;  3MR5 A;  3EDR B;  4RX6 A;  3E8O A;  3IN5 A;  3NRB A;  3V4I B;  4LT6 A;  4ZJO A;  1Z1Z A;  2I5J B;  3P8B B;  2MKY A;  3PYD A;  4R5P B;  1YBA A;  3J81 U;  3H5Y A;  4KGM A;  4LVN P;  1ZM3 A;  2B5J A;  4X66 F;  2C2K B;  3D1O A;  3QLH B;  3HK2 A;  5LXY A;  3LP0 A;  4L75 A;  2B6A A;  1X9W A;  1E6V B;  2Y8Y A;  1UEU A;  2UUA F;  2ZM6 J;  3D1H A;  1AT1 B;  2CQG A;  4J9P A;  2AGQ A;  2BJ8 A;  5J1E B;  1SC1 B;  4KRW A;  2FJX A;  5HJX A;  1OY9 A;  3IG1 A;  1B0P A;  1OO0 B;  4XO0 A;  3P4U B;  4U67 Q;  2W9C A;  2GML A;  4LF8 F;  1NND A;  5CD4 A;  1Y11 A;  1S9E A;  4KPC A;  1SVD A;  2J0S D;  2MZR A;  4JI1 J;  3QPI A;  2QJ3 A;  4FF1 A;  3DCA A;  3RTV A;  4F25 A;  1NH8 A;  2ZUG A;  2O5D A;  4J91 A;  2W01 A;  3FFI A;  4OV6 A;  4DR1 F;  2OFH X;  1YJN S;  2CQP A;  2VQE J;  4O0N A;  2HPU A;  2I1R A;  4KY3 A;  3OFG A;  1B0V A;  1HMV B;  3P6Y C;  1RCX B;  5HN0 A;  5A6W A;  2KZZ A;  4BWJ A;  4CT8 A;  3CJQ A;  4RUH A;  2D1C A;  1H7W A;  3BF4 A;  3OL9 A;  1LW0 B;  2MKS A;  4A8X A;  3PM9 A;  1TK8 A;  5KFG A;  2HGL A;  1VLO A;  1NJI T;  1XN9 A;  4PWD B;  1NM2 A;  3EIC A;  4ED0 A;  4J9S A;  4OHV A;  5C24 A;  2R7R A;  1N33 J;  3HLU A;  3CUL A;  2C3U A;  4Q7A A;  3JQK A;  3M9M B;  4OX9 F;  3PW7 A;  4OLP A;  2BE2 B;  2KZM A;  2GMJ A;  3SSS A;  1U1N A;  1WC6 A;  4Y3C A;  1JXE A;  1NZ8 A;  2B7B B;  2CPD A;  3T1Y F;  1C4C A;  5AJ3 F;  1R0B G;  4F3O A;  5I42 A;  1TL5 A;  2EFQ A;  3KLG B;  3GCW P;  4O44 B;  1UFL A;  2KFN A;  5K5M A;  3F56 A;  5D3G B;  2RS8 A;  2KXH A;  2FVC A;  5KFP A;  5G0R A;  2POK A;  1BWE A;  4NAS A;  2C3Y A;  4LSZ B;  2QN6 B;  2ALY B;  4CH1 A;  3QWU A;  5MAO A;  1FJ7 A;  5JUM A;  2BX6 A;  2HHP A;  2WOM B;  4F36 A;  4CLF A;  2CWK A;  1VQP S;  4X65 J;  2HIY A;  2DIS A;  4B02 A;  4I7F B;  1RTI B;  1GX5 A;  2AGO A;  3DHX A;  4F2R A;  5KT5 A;  3D4J A;  2RSQ A;  2Y1R I;  1JJ4 A;  3F41 A;  1RAJ A;  5A2Q Y;  5EUH A;  3HHD A;  5HSP A;  4LRB A;  3K57 A;  2RU9 A;  3D0I E;  4U6P A;  4UOC A;  4YDD B;  4A8Q A;  1KQF B;  1WI6 A;  2DR6 A;  2YNG A;  3OLB A;  3B78 A;  2F8E X;  3MTK A;  3FMB A;  2V6A A;  2JLG A;  3I0S B;  3KUE A;  4W90 B;  1IWG A;  4FXW A;  3MR3 A;  2EXU A;  1BLU A;  1EKS A;  3EGZ A;  4M5K A;  3QRR A;  2RNE A;  5DO2 A;  1AW0 A;  2VDI A;  1TKZ B;  3GPA A;  1YQH A;  1J27 A;  4ECU A;  1QVF R;  3UE2 A;  2MST A;  4J5O A;  1VFJ A;  1QLN A;  3GR1 A;  1B70 B;  3TQE A;  4N7T A;  4LJM A;  3DOK A;  2FB0 A;  3K59 A;  4G1Q A;  4F0K A;  4GVL A;  3QRQ A;  1FCA A;  1BQM B;  3O2I A;  3B54 A;  2FJA B;  3O1L A;  2YKM A;  4L6V 3;  4BC7 A;  2J9D A;  2KDO A;  2D3Z A;  4Z7Y A;  2MEW A;  1HR0 J;  4ZK7 M;  2OEK A;  4IG0 B;  4NI2 B;  3LGH A;  4NZ6 A;  2XWX A;  3DHW C;  2IM2 A;  4UOG A;  4ES2 A;  4ED3 A;  4OYP A;  1X4G A;  1VJW A;  1LNQ A;  3UD5 A;  2K2P A;  3TAN A;  3A3P B;  4Y00 A;  2CDR B;  2KYZ A;  2JSX A;  3Q23 A;  1OYD A;  4K0K F;  2RF2 A;  1X5T A;  2YNI A;  1IUJ A;  2B43 A;  2A10 A;  1WUU A;  4F02 A;  1HPZ A;  2UU9 F;  2F63 A;  4P71 A;  2D3O 1;  2Y1I A;  4DSF A;  5LMN J;  1JLQ B;  3UDC A;  2FGO A;  4KC5 A;  9RUB A;  2QA4 G;  3S7R A;  2RH3 A;  3OVS A;  1NB7 A;  1S1T B;  4DR1 J;  3GMG A;  2DNQ A;  4A8O A;  2ZH5 A;  4PZV A;  1F3F A;  3I96 A;  5A8K A;  1N6Q A;  4Q43 A;  3C2P A;  1RGV A;  2GVZ B;  5KFX A;  1X9M A;  3JSM A;  2IM1 A;  3O8W A;  2G1D A;  4Q44 A;  1HHT P;  2NXE A;  1ZAW A;  2XUL A;  5L38 A;  3W8P A;  2JL9 A;  5D0H A;  3G6E S;  1UCN A;  2KKH A;  2IRY A;  4JB8 B;  2AJ4 A;  1P9Q C;  4O3P A;  2XHC A;  2LEP A;  3W2W B;  1CUL A;  3KJQ B;  2PFD A;  2UP1 A;  3VZI A;  5DGA A;  3H2L A;  4DR5 J;  2CQ4 A;  2QO3 A;  3ICL A;  3CJS A;  2I38 A;  1XR5 A;  1SJQ A;  4NLY A;  1FRK A;  1R89 A;  3UO0 A;  3LGM A;  4C2M A;  1RT1 A;  5K8M A;  3DGP B;  1Z2Z A;  4QIV A;  3OTO F;  2ZDO A;  1C0T A;  4CO0 A;  3C14 A;  1XWL A;  1IKV B;  4EBC A;  3P49 B;  2JC0 A;  3IGN A;  1DUR A;  3FMW A;  1HNI A;  4OJ3 A;  3CCT A;  5IOL A;  1HHS A;  1V3R A;  2ZJP Q;  2KRR A;  4HL9 A;  2H9Z A;  2BXJ A;  3OR2 B;  3AXM A;  5KG6 A;  4NLQ A;  4CCH A;  2V4J A;  2MKC A;  3MMB A;  3U1N A;  3FEZ A;  3WIV A;  2IIH A;  4OFZ A;  4ZOS A;  3W2V A;  1LKZ A;  3M2U B;  2WW4 A;  1UW9 A;  4DL5 A;  1G1X A;  3IS9 A;  1YIJ S;  5CHC B;  1UWB B;  2P5V A;  3A8J A;  4CIO A;  1K1Q A;  1RA6 A;  3OXG A;  2VBY A;  4X64 F;  4RUC A;  3CMQ A;  4ZN3 A;  1CS4 B;  3KK1 B;  3W63 A;  3PW5 A;  1HWJ A;  4H4O A;  5K20 B;  1I94 J;  5IV3 A;  2CJK A;  1TAU A;  3CED A;  2MQQ A;  3EPG A;  3QJJ A;  4LF9 J;  1C1B A;  1FI4 A;  4TY8 B;  1FKP B;  5EWF A;  3MPY A;  3ET6 A;  2UXD F;  5AXM A;  4GRS A;  3HO1 A;  2WTF A;  1R0A B;  4LQ3 A;  3M1V B;  1XMQ F;  2YXL A;  4NA2 A;  4LVO P;  3G71 S;  1X4F A;  2EG2 A;  2JEG A;  3PXG a;  4MYT A;  4Y2C A;  2RQ4 A;  2CPF A;  1RTH B;  1RT3 A;  4ID5 B;  1WWH A;  4FNI A;  4OI0 A;  2XMA A;  1Q8K A;  3LTO A;  5B0B A;  3OL7 A;  3HHL B;  4F0H A;  2ZJQ Q;  2PII A;  3JYT B;  4NXN J;  1S7H A;  3AA9 A;  2HS3 A;  2Z57 B;  4YQW A;  2MQN A;  2IPO B;  3MAQ A;  3HVA A;  2MZS A;  1KKH A;  1DTT A;  1U48 A;  3D9B A;  2DD8 S;  1X5S A;  1TFY A;  3MCO A;  1DBD A;  1MN7 A;  3LAM A;  4PWU A;  4C8K A;  2VV5 A;  5BJR A;  2XNR A;  4ZHR A;  2XLK A;  2CFX A;  5J2Q B;  3G8S A;  3V6J A;  5KG5 A;  4TU8 A;  4CYU A;  3V6H A;  3DRP B;  4Y34 A;  3ZZ0 A;  4NLT A;  1XNR F;  5F9N A;  3MMC A;  5A8W B;  1RT6 A;  3POT B;  2YNF B;  2B0G A;  2PT0 A;  4YY3 F;  2HAF A;  1GMU A;  4N47 A;  2XMT A;  2CPH A;  1RTD B;  2DNK A;  4C48 A;  4Z7C A;  1SH0 A;  4DR7 J;  1U02 A;  1S1X A;  3I4H X;  2OFG X;  1NBE B;  1QE1 A;  4WXO A;  4ZIT A;  2F40 A;  2XLJ A;  3RW7 A;  3VAH A;  3SIP B;  2BAC A;  1RT2 B;  1RAE B;  5JVH Q;  4LFA F;  2R2R A;  3QIP B;  4B3S J;  3JTO A;  3P5B P;  2XCA A;  3VTI A;  4QR1 A;  2ZBI A;  5SUH A;  2EWH A;  4DMZ A;  5CXT A;  1JNR B;  4YOE A;  4LIW A;  2V69 A;  1ZM4 A;  5KFR A;  4JOU A;  4HAC B;  2RKI B;  2Y9H A;  3M2V A;  4YR3 A;  1TK5 A;  2E5J A;  2YWH A;  3OSN A;  1ZAX A;  4I6Y A;  5L1J A;  1TL1 A;  3AJ2 A;  2CJX B;  4UQT A;  4DPY A;  4I4B A;  2VPY B;  1XTZ A;  3VWS A;  4R0E A;  4DFJ A;  4DV3 F;  1J5O B;  1UAW A;  2O01 C;  1U6Z A;  2Q66 A;  2EG1 A;  3EZU A;  3R5G A;  5J2P B;  5LT5 A;  1M5H A;  3CCW A;  1UET A;  2N7Y A;  2J0X A;  1IQZ A;  1VCT A;  3M8Q B;  3DC2 A;  2NUU G;  1Y5L B;  4CNY A;  2DRB A;  2RD5 C;  1O8B A;  5D8H B;  2QG9 B;  4P7V A;  3KJV A;  1Q79 A;  2BJ3 A;  4WXW A;  3QNW B;  2XMU A;  2GJF A;  4RW8 B;  1HQE B;  1Q7Y T;  1TK0 A;  2Z2L A;  3CJ3 A;  1QAX A;  2KJW A;  1KLM B;  3KTQ A;  2M52 A;  5HK4 A;  4LF5 F;  4OYW A;  4ZPT R;  1X4D A;  4RLE A;  2E29 A;  4TN2 A;  3CSK A;  1XEZ A;  5FDL B;  2HBR B;  5GAH U;  4ZP7 A;  3MFH A;  3GFZ A;  1NHK L;  2GQQ A;  1RYS A;  3W9H A;  4KE5 A;  3DM2 B;  2IHR 1;  1B64 A;  3BR9 A;  2CQI A;  2J5A A;  2GMH A;  3M8W A;  5GVQ A;  2I0X A;  1FXR A;  4M5I A;  1RHR B;  2CUY A;  1QTN B;  3KLF B;  3O5T B;  5IWA F;  2KG0 A;  2NXU A;  3PY8 A;  5DLF A;  1AZS B;  3M8Y A;  3QSI A;  3PDN A;  4TYB A;  2MZT A;  2DHX A;  3KHR A;  3J81 Y;  3PW0 A;  1U8S A;  3DRX A;  2XO7 A;  2F65 A;  3QSY B;  4BHQ A;  3AJ1 A;  4K4X A;  4LF7 F;  3CJ5 A;  2HND A;  4M5N A;  4OYO A;  1NDL A;  2PC6 A;  5IC6 B;  3ZZZ A;  3FSY A;  1JNZ B;  2XGQ A;  3T3F A;  1U6F A;  1LWF A;  5ETV A;  1AA1 B;  2HHT A;  1OQ6 A;  1V6H A;  1YJV A;  3W62 A;  1L3T A;  5HMX A;  4ITS A;  4DZD A;  4CLK A;  3IP0 A;  1D3W A;  4USK A;  1AUS L;  2DJW A;  2VG6 A;  1S79 A;  1N34 F;  2IC3 B;  1FRH A;  1GXU A;  2VFS A;  4DCO B;  4OZ1 A;  2DNM A;  2P9C A;  3DN9 A;  1NKC A;  4OI2 A;  4K2X A;  2GAH C;  4DBQ A;  4K4Z A;  7AT1 B;  1Y10 A;  3GE9 A;  2PMH A;  5I3U B;  2HNZ B;  4AQY F;  4KPY A;  3TJA A;  2HZC A;  5CZX A;  5L39 A;  3PO4 A;  4MFB A;  2R7S A;  4DWI A;  2E9T A;  1REV B;  2EEY A;  1FDD A;  4FYW B;  4ETZ A;  5KOW A;  3D67 A;  5DG7 A;  2EI5 A;  2UUB J;  1S57 A;  2WW8 A;  5B0E A;  4EZ6 A;  3MEE A;  4ZVR B;  2MZ1 A;  3HMJ G;  2M70 A;  2FJV A;  2MGZ A;  3FNN A;  5ETM A;  2HVE A;  3BH7 B;  3HKZ D;  3KKF A;  3DLL Q;  1YJW S;  5LM7 E;  4ZPC A;  2ZIT A;  2BJ7 A;  2HQD A;  4KB7 A;  5DDO C;  3E2E A;  1N5Q A;  5D0E A;  2KI2 A;  3HHK A;  4LFB J;  4KFB B;  1N5Y A;  1GX6 A;  1RUS A;  3ZNJ 1;  3MGJ A;  5F8H A;  4OI1 A;  4LFA J;  2QFJ A;  3N6N A;  4W98 A;  3R6L B;  3DMJ A;  1FVS A;  3ILI A;  1VQO S;  1S77 D;  3WX8 A;  3C6T B;  1CPZ A;  2WON A;  5FLX U;  1XC9 A;  4C8L A;  3W65 A;  5J2N B;  1S1W A;  4ED6 A;  1PIE A;  2LQ5 A;  3DRS A;  2ZE2 B;  1FFG B;  2HLU A;  2IJR A;  2DGU A;  1HQU B;  4I2Q A;  2PN6 A;  3Q8Q B;  3BO3 A;  3QID A;  3HHL D;  2X1G A;  1FX4 A;  4ED4 A;  4EK2 A;  4WCE Q;  2XC9 A;  3K7R A;  5EDW A;  4OLO A;  4NCA A;  3K8V A;  4J9N A;  1WOS A;  2AHO B;  1N54 B;  5M2R A;  3ZTO A;  3HJV A;  4Q5V A;  3R7B B;  3CO9 A;  2DH7 A;  3L9Z A;  3HHL C;  1R43 A;  3LH2 S;  2DEJ A;  4Q2M A;  1TFW A;  4P74 A;  1A9N B;  3CJ2 A;  4YDX A;  1S97 A;  3TZX A;  3KHG A;  2NQP A;  5EHH A;  2VFR A;  1C1C B;  4ZVP B;  3L7O A;  3ZXW A;  3FJ2 A;  3NGT A;  4A4J A;  4JV2 A;  4LF5 J;  6FD1 A;  4DPX A;  5D4N A;  2JC1 A;  1SBR A;  2FHM A;  3V6D B;  4UOF A;  5GAH I;  4LFC F;  1UVJ A;  4Y2M A;  3MAA A;  3OQ2 A;  3ELH A;  2OEJ A;  5D78 A;  3T5L A;  1EAR A;  1GK8 A;  2F4F A;  4EWT A;  2XS2 A;  1SI9 A;  3MM5 A;  2HK3 A;  4FYY B;  1X8D A;  2BAB A;  1NXI A;  4RW4 B;  4QR2 A;  1HL6 A;  5IWA J;  4JI3 F;  1LXN A;  3L4B C;  5EWE A;  3X1L B;  5F8I A;  2PGC A;  3K5N A;  3US5 A;  4OYA A;  2A1B A;  4FS1 A;  2VOO A;  2LU2 A;  2E7V A;  4ZCI A;  5HMW A;  1FDA A;  2Q79 A;  4DSL A;  1HYS A;  2JDJ A;  4UUW A;  2Y0B B;  4N76 A;  3UVJ B;  3VQS A;  2G0C A;  1HFE L;  5IFM A;  3AD7 C;  1DTQ A;  5HAN A;  3LP2 A;  1S0V A;  3H42 A;  3JAM U;  3GJT B;  3N5B A;  1ITP A;  1ZBT A;  2R8K A;  1WC5 A;  4PUO A;  2YKP A;  1RT4 B;  1VR6 A;  1VRT B;  3GP9 A;  2Y1J A;  5F0W A;  4ECR A;  2XO6 A;  2GC8 A;  4DF4 A;  1GMW A;  2AYG A;  3D1Q A;  1HA1 A;  3TOQ A;  5EX3 A;  3BBC A;  2XYH B;  3I0R A;  2FPH X;  1MRO B;  2Z58 B;  1WSV A;  4RR5 A;  3L7U A;  2HHU A;  4P9S A;  4IR1 A;  1RHK B;  1Y9O A;  4C8M A;  5HRO B;  2AGP A;  2PSZ A;  2RB7 A;  4I67 A;  2DPI A;  3NNC A;  5I3P A;  1HNZ F;  1DHM A;  3RB4 A;  2DKO B;  4URG A;  1K0V A;  2FHJ A;  1FDN A;  2HEK A;  1JLA A;  2E5G A;  3CD6 S;  1VRQ C;  2OPQ B;  5HMY A;  4DV5 J;  1WHY A;  4DS5 A;  3GR0 A;  4Q0B B;  5HQ8 A;  1EQM A;  1RK8 A;  1X0F A;  3H59 A;  2R8J A;  2C2E A;  4K2J A;  2CJY B;  2R2U A;  4ER8 A;  2MKI A;  1KQK A;  4TQR A;  2GHP A;  3QO9 A;  4QPT A;  4FXV A;  2AKW B;  3FZB A;  1S6O A;  1U26 A;  4HDH A;  3THT A;  2E1R A;  5ETP A;  2RS2 A;  1QSS A;  1YJU A;  2H5J B;  3KFW X;  2J0Q D;  2M4M A;  1FJE B;  1ZOT A;  1X60 A;  1H2U X;  2G9O A;  3F73 A;  1TKX A;  1TMJ A;  1FJG F;  2NYH A;  3RGI A;  2YWG A;  2VBX A;  4DL4 A;  3H2V E;  5C5J A;  5FJ4 A;  4M63 A;  5BXI A;  1GEH A;  1WEZ A;  4F4X A;  4PAB A;  3UWT A;  2BYC A;  4JV5 F;  3RU0 A;  4OZL A;  4H4M B;  3OJS A;  3M8P B;  1T02 A;  5DJB A;  1UZH A;  2LEB A;  2CQB A;  4KSE B;  4QJV A;  1ELO A;  2K1R A;  2WHO A;  2BRL A;  2YWF A;  1IBL F;  4DR6 J;  3BEG B;  3WZ0 A;  1WHW A;  3RB6 A;  1R31 A;  1YJ7 A;  2CVI A;  2JFK A;  4CQ1 A;  3GII A;  5BR8 F;  2QIF A;  2F8H A;  2DR8 A;  4LRA A;  5DM7 Q;  1NDP A;  1OWX A;  2OUG A;  3H4B A;  4X4O A;  1IBM F;  3DLE A;  3PG9 A;  3K89 A;  3JTP A;  1PYT A;  2G2O A;  1S0M A;  2V8V A;  4USI A;  4ZDN A;  1R7I A;  2ATL A;  5H1S V;  4LSL A;  2UVW A;  1FKO A;  1U8W A;  2A0F B;  4NCB A;  2L9N A;  4LRD A;  4LFC J;  2A2C A;  1ZZF A;  1VQ5 S;  2V4Q A;  1KD1 T;  5ETR A;  3NL0 A;  3HM9 A;  1SL2 A;  1Z2L A;  3CWJ A;  4WZM A;  4FZV A;  2DNG A;  1VBZ A;  2KG1 A;  1JK9 B;  4DPU A;  3NCQ A;  1RHU B;  4UQG A;  2BJ1 A;  1G4C A;  1HNX F;  3SQO P;  4LIR A;  2X1B A;  1X5P A;  3SXL A;  3R5J B;  4JI3 J;  3AA8 A;  5LJ5 Y;  4OYB A;  5IQQ A;  2DNY A;  4FDF A;  4CM2 A;  3J7Z T;  1IBC B;  2V9K A;  3F44 A;  4J9Q A;  1FJC A;  2VG7 B;  4K4S A;  1XK8 A;  3D28 A;  3HFZ B;  2UVU A;  1SKU B;  2AYE A;  2FC8 A;  1T03 B;  3VAF A;  3EZO A;  2KO1 A;  2V2K A;  4B17 A;  4KIA A;  3E3X A;  3LP1 B;  3GV8 B;  3H5X A;  3TP2 A;  3BPD A;  2DPJ A;  1WOR A;  2DNO A;  3TZZ A;  3QT7 A;  1VDH A;  2CQH A;  4A8M P;  4FXD A;  2VG5 B;  2HQC A;  4J9R A;  3E01 A;  1U1P A;  3I82 A;  5C25 A;  2H4Y B;  5D77 A;  1IR2 A;  1UJ5 A;  2APO A;  2OD4 A;  1YRU A;  5C7P A;  3ZO7 A;  4X62 F;  4RWW A;  2D3U A;  2DNZ A;  3C8Y A;  4QWD A;  3TVZ A;  2F9D A;  3K58 A;  1BD6 A;  2G2Z A;  4M5D A;  3M7V A;  2W8L A;  4BLG A;  3TAM A;  2J6S A;  2JVR A;  1GH8 A;  2HGN A;  3TX8 A;  2K7J A;  2G13 A;  2C2Z B;  2F4V J;  5DLG A;  1SJ1 A;  1IKX A;  3DFE A;  2A6O A;  3FDS A;  3LP0 B;  2B6A B;  3FBB A;  4X84 A;  4WF9 Q;  3MI7 X;  4Q2L A;  1RBA A;  4OHX A;  4JP8 A;  1D9D A;  4IO1 A;  1DJ0 A;  4WJB A;  1WG4 A;  2AJF E;  1BQN B;  4NOH A;  1HKA A;  8ATC B;  3IRW P;  4CTA A;  2WBM A;  2GQC A;  3N79 A;  5KT2 A;  3NEK A;  2GW8 A;  2AJ2 A;  4ECQ A;  1XNQ F;  2W9C B;  3GV7 B;  2EKY A;  1S9E B;  4PRF A;  2XY7 A;  2DGT A;  1VQN S;  2XG8 A;  1MWQ A;  1T9V A;  3GQC A;  2YKA A;  1XR7 A;  5K8N A;  3PR4 A;  4EZ9 A;  4IRC A;  4DL7 A;  1VQK S;  4AL5 A;  3BRE A;  2HFO A;  1LWE B;  2HVZ A;  2ZH6 A;  1T05 B;  1U1Q A;  4GKK J;  2ZZT A;  5DZ6 A;  2MLY A;  4HDG A;  2YH0 A;  4RJV A;  2B51 A;  2J76 E;  3H4D A;  1JXV A;  5AXN A;  3R5D A;  1T9Y A;  2VOD A;  3HHN B;  2YY3 A;  2XSJ A;  4OI3 A;  2ROP A;  4ES1 A;  3A12 A;  4IQX A;  2UUC F;  2NCK L;  1GTH A;  3WHI A;  1JXL A;  1VJQ A;  1BXN A;  3MHY A;  4AFF A;  4RBT A;  3BV8 A;  5C24 B;  2MPU A;  3T9Z A;  1L3K A;  4G3I A;  1N5T A;  2D69 A;  3PYF A;  4DX6 A;  4QU7 A;  3CCQ S;  4ZP8 A;  1YZ7 A;  1S6P A;  4KGV B;  3V5R A;  1QJH A;  1IR1 A;  1F5C A;  5DQI A;  1I6J A;  3A1Y G;  5I42 B;  5B0C A;  2ATC B;  2VIC A;  2C1E B;  2RHS B;  4ZMM A;  1Q7L B;  4JYA F;  3K2Y A;  4QYR A;  2XS7 A;  3MEC A;  2M2B A;  1QUP A;  3MMA A;  4JI6 F;  1UPM B;  4MK8 A;  4ZVH A;  3CNQ P;  4D3H A;  3MR7 A;  2C2O B;  5G0R B;  4X4T A;  2C42 A;  2HWT A;  2IVF B;  5H9F K;  3GIL A;  5ETL A;  4GVB A;  4DV4 F;  4H4K C;  5GAE I;  1HNX J;  3E51 A;  2LA6 A;  3DDK A;  3G8T A;  3QWP A;  4KHP F;  2VL1 A;  1SUQ A;  2EK6 A;  3GJS B;  3AQO A;  4LF4 J;  2F9J A;  4IH6 A;  2DXF A;  1OPI A;  2R7W A;  4DPO A;  4KQZ A;  1XMO F;  3H7H B;  1NK7 A;  1UEK A;  2Z0G A;  2L48 A;  2YNG B;  2CG4 A;  1IQT A;  2IMO A;  4DU7 A;  4JI8 F;  4ZVO B;  4HI1 A;  2QA1 A;  5CYJ A;  1CC8 A;  4CI0 B;  2GNK A;  3EVM A;  5DET A;  2V8D A;  1RA7 A;  5A8R A;  2HVH A;  2WK4 A;  1PKU A;  4IFY A;  2XS5 A;  5BYQ A;  1T3N A;  3UDE A;  2HHQ A;  1ZYQ A;  5T41 A;  1S0O A;  2UUW A;  1J5E J;  1NRK A;  2WAQ D;  1KFD A;  4RUB A;  1S72 S;  5HLF A;  3NGK A;  3IWX A;  4L73 A;  4RW6 A;  1DQ9 A;  2LYV A;  4PAA A;  4A8K A;  2RHQ B;  3V4I A;  2OAU A;  2LQB A;  1IM4 A;  3DOK B;  2B9W A;  4K8R A;  2HNY A;  1F9F A;  2L08 A;  1RLC L;  2QX0 A;  1HI1 A;  4G1Q B;  1LW2 B;  2ZH2 A;  4DV2 J;  3T6B A;  4URS A;  1TP7 A;  4NLD A;  1LWC A;  4IO9 Q;  5LOQ A;  3PJX A;  2GGP A;  3MOJ B;  3MWB A;  2O1P A;  4PCQ A;  2Y3Y A;  3PV8 A;  1LK5 A;  4QYZ J;  4C8Y A;  5CZV A;  4HHH A;  3C66 A;  4OZ0 A;  2WCX A;  4RBU A;  4LMZ A;  4K4U A;  2P9G A;  2OLW A;  3K0J A;  3UR0 A;  2C3P A;  3FVY A;  2J8S A;  4WFB Q;  2Z2Z A;  5IT4 A;  4B3T F;  2RF2 B;  1Y4Z B;  1YK9 A;  2BJE A;  2YNI B;  1X4H A;  4OJH A;  3SFU A;  5FLX Y;  1HPZ B;  4DX8 H;  2YKN A;  3KJF B;  4ZPD A;  3G8Q A;  1TVR A;  3ZZT A;  3FK4 A;  4KH1 B;  2NS1 B;  4AL6 A;  2CZ9 A;  4P2X A;  1RT5 A;  3HDS A;  2X7I A;  3KDO A;  2H51 B;  2QL9 B;  4RNN A;  2OPS A;  1N4L A;  3MM7 A;  2QLJ B;  5E41 A;  5A8K B;  1N6Q B;  2ROG A;  3PX6 A;  4OYM A;  1GXT A;  3J80 U;  4FP9 A;  4QW9 A;  2ZNZ A;  3BQ1 A;  1TL7 A;  1M90 T;  3R1L A;  4ZJQ A;  5AT1 B;  1M5K C;  1PJ7 A;  3VAL A;  4K4V A;  4B9N A;  1YLX A;  4RUA A;  2GAG C;  1HI8 A;  4L72 B;  4JBC A;  3M8S A;  1NSA A;  2HHH J;  1JLF A;  3NWR A;  2FY1 A;  2ZH7 A;  2BE2 A;  4C9D A;  1CUL B;  2DNH A;  3PEH A;  2ADC A;  4QWC A;  1F60 B;  4C3M A;  5EN1 A;  1RAC B;  4GO7 X;  4NLP A;  3MEK A;  2JH3 A;  4QBU A;  3QBC A;  2WVE A;  3MPD A;  1RT1 B;  5D3G A;  1HWL A;  3FC9 A;  3HCX A;  4JYA J;  4P6Q A;  3R97 A;  5IQ6 A;  2IY5 B;  4WK1 A;  1M5P C;  2NPF A;  1FF2 A;  3AD9 C;  3BBB A;  2XCP A;  4RU2 A;  2XMK A;  1C0T B;  3EZ5 A;  1KVK A;  3N4W A;  4RWX A;  2G4B A;  2MHE A;  1K8A T;  3GG1 A;  2RDD A;  1HNI B;  2ASY A;  1Q4R A;  2R8G A;  4FYD A;  1U0H B;  1FRX A;  4WPA A;  1WC1 A;  3C19 A;  3ENA A;  3PFO A;  2BKN A;  4NLG A;  1T9W A;  2FYX A;  2AP6 A;  2GQ2 A;  2V4J B;  4IYQ A;  3MMB B;  1N48 A;  4EFA C;  4ELT A;  3UD4 P;  3HF5 A;  2EW9 A;  3W2V B;  4HHU A;  2DNP A;  2JFD A;  1SIZ A;  4CRJ A;  3JAM Y;  4ECY A;  3OPK A;  3IS9 B;  1NJX A;  4LUB A;  1OSC A;  3H5U A;  2QYC A;  4PQU A;  3UI3 A;  4JI8 J;  4L3K A;  1RWO B;  3D6F B;  4NWB A;  4H4O B;  2P2C B;  1CBK A;  1NU4 A;  2LU1 A;  3PVX A;  3NAH A;  4G65 A;  4ID8 A;  1KOO A;  4F7V A;  4NCG A;  3OL8 A;  1S76 D;  1WC0 A;  4MIB A;  3VGS A;  5KFO A;  1D9F A;  1ZA2 B;  3QQC D;  3A8K A;  1Q1K A;  3ET6 B;  4DLE A;  3SQG A;  1R6Y A;  1RAF B;  4USM A;  2H3E B;  4F26 A;  3NS5 A;  1F5B A;  3D5M A;  3CCZ A;  1ROF A;  2HFV A;  4X4V A;  1NLK L;  4NA1 A;  2CJB A;  2IVM A;  4OZN A;  4KV8 A;  1GXL A;  3FBC A;  1FDB A;  3BSC A;  2OPR A;  5CYQ A;  3HJF A;  2AU0 A;  1OJ4 A;  1H3D A;  4YEA A;  1CJT B;  1SC4 B;  2NXJ A;  3FQL A;  1JJ2 R;  3FCH A;  4DR3 F;  4LF6 F;  4K50 A;  1REG X;  4Z37 A;  1I51 B;  1N36 F;  1U24 A;  5DZ7 A;  2N3O A;  3BGO P;  5HBM A;  3AD8 C;  3I9V 9;  1DTT B;  3M05 A;  2EBE A;  4B9T A;  1RWV B;  1UA0 A;  4DL6 A;  4Q45 A;  1H2T Z;  1FES A;  2EC0 A;  1WG5 A;  4ELV A;  4ZHR B;  2ROE A;  2XTJ P;  4YR0 A;  1S9G A;  2AD9 A;  1JLQ A;  4CYU B;  4ZVE A;  4FF2 A;  5H9E K;  3FCV A;  3Q83 A;  2ZC3 A;  3GSD A;  3EYZ A;  3MMC B;  2ZZM A;  4ZLL A;  1RT6 B;  2PEH A;  5C2G A;  1B0T A;  1R8C A;  4JI0 J;  2LMI A;  5E2Q A;  4DPT A;  3DRY A;  3RRH A;  4ED8 A;  1KFS A;  4CLU A;  3N0V A;  1S1X B;  4IFV A;  1QE1 B;  3QT5 A;  1OY6 A;  2UUT A;  4ILM A;  2CA9 A;  4USH A;  4EO6 A;  2GHW A;  4F50 A;  3SZ2 A;  2DBB A;  1HWI A;  3LA0 A;  4FNH A;  2VA3 A;  3QFH A;  2QGF B;  2W25 A;  5K14 B;  2M0G B;  4ZP6 A;  3CDA A;  3ILO A;  1RQ0 A;  3DOM A;  3ZZP A;  1VK8 A;  3D66 A;  5AE3 A;  1GTE A;  2ALZ A;  2B9E A;  2M9K A;  1RJJ A;  4DFP A;  4O0I A;  3HP6 A;  2X51 A;  2KM8 B;  1NPK A;  4LF2 A;  4P2S A;  3A4T A;  1KON A;  4JI2 F;  2E9R X;  4TY9 A;  3H98 A;  2K8G A;  2KT3 A;  3R9L A;  3WIU A;  4IKA A;  4EU0 A;  4BBY A;  1TL1 B;  1LXJ A;  2JLF A;  4IR9 A;  4DR2 F;  2VZ9 A;  3HFV A;  1ZET A;  3CJT A;  3QAE A;  2B4P A;  4D3G A;  3KNG A;  1FWL A;  4L3N A;  3WC0 A;  5DDQ C;  1RXO B;  4YHH J;  3GIJ A;  4PYD A;  3D6M B;  3V81 A;  3M6X A;  1X0P A;  4QWA A;  4K5S A;  3UW1 A;  2NUH A;  4KGX B;  1KSP A;  3W61 A;  2BM1 A;  3ISN C;  3T9N A;  4TKT A;  3VGV A;  3MXH P;  2QZ8 A;  2KFZ A;  1N8R T;  1VQ4 S;  3ENV A;  1R6V A;  2AF6 A;  1U09 A;  5B0F A;  4FBT A;  2KH9 A;  1D8Y A;  2WB4 A;  3VQT A;  4ZVG A;  2RVJ A;  2B9X A;  4OQJ A;  4J9U E;  3KJV B;  2BW7 A;  3B82 A;  1S7I A;  1OSD A;  5LL6 d;  4DUY J;  4EMD A;  1U1K A;  2VD3 A;  5AE1 A;  5J1P A;  4DG1 A;  3OL6 A;  3NCP A;  4KHM A;  7FDR A;  2HG4 A;  1D9A A;  1DLO A;  1MN9 A;  4ECS A;  2BAN A;  1PSD A;  5E3A A;  3ZZY A;  2ZC4 A;  3M6U A;  1HNV A;  4JI4 F;  1WF1 A;  1N5V A;  1U7L A;  2CG8 A;  1S99 A;  1UVK A;  3LPY A;  3ZTS A;  5FD1 A;  3M30 A;  1D8Z A;  2B4U A;  2YPZ A;  4DV6 J;  4OL8 A;  3THV A;  1JJH A;  4ZLP A;  2FVS A;  1S4E A;  2W4P A;  1N32 J;  2XWY A;  3NS6 A;  2DXD A;  2LQ9 A;  2IDL A;  2ZBP A;  2G2Y A;  2R42 A;  2EKN A;  3EJM A;  2JEJ A;  3A3O B;  3O44 A;  4B3M F;  2PA3 A;  2HND B;  2ZH4 A;  1OMS A;  1KBR A;  2R8I A;  3R3T A;  4RW9 A;  2J8A A;  2Z4P A;  2MDA A;  4CWB A;  1LWF B;  3WC2 A;  4UF4 A;  1RP5 A;  3B4D A;  4WBF A;  2ZKT A;  2YQ1 A;  1X4B A;  2SXL A;  1NSK L;  1FX2 A;  4DR3 J;  4LF6 J;  4A8S A;  2ABY A;  3CJ8 A;  2Y1L B;  4QU6 A;  2UXB F;  1F6T A;  2VG6 B;  2ASD A;  2AT1 B;  5DG9 A;  1T0T V;  1XQI A;  5LMU F;  1LV5 A;  4DUT A;  4DLG A;  4JI7 J;  2CPE A;  1H38 A;  4NL5 A;  2E7X A;  2XI2 A;  3TO8 A;  1SB6 A;  4ZCM A;  1WJ9 A;  3O6Q A;  4P75 A;  1UA1 A;  5L9N A;  2HZA A;  5DGB A;  2AWZ A;  3O3L A;  1BHN A;  1H72 C;  3IAS 9;  1O6X A;  2RDJ A;  1YI2 S;  3HKW A;  2WSE C;  5SZT A;  4EYI B;  4PQA A;  1PGZ A;  3KLE A;  4DV1 F;  3N5F A;  3IBW A;  1KVI A;  1FFS B;  1BC6 A;  2ACM A;  4F4Y A;  1FEE A;  2VKR A;  1RTD A;  2MGZ B;  3I56 S;  4XDD A;  2C2N A;  1EHW A;  1TEL A;  1WC3 A;  4NXM J;  2LFV A;  2ZVI A;  3TAP A;  1MLA A;  4DQP A;  1PG5 B;  1KS2 A;  3HD2 A;  1T95 A;  3PFE A;  3MEG B;  2QT7 A;  3HSZ A;  1N5Y B;  4K59 A;  4DR4 J;  3KLI A;  1KR4 A;  1ZPV A;  1LW0 A;  1UTA A;  4EUV A;  2JHE A;  3DOL A;  2L41 A;  4RNH A;  2W7O A;  4ERD A;  3DMJ B;  3A8E A;  1HBO A;  4MIA A;  5D0G A;  1RTJ B;  5CD4 H;  5KFH A;  4YME A;  4DS4 A;  4GO5 X;  1X5O A;  2E1P A;  2M3D A;  2WON B;  1KQS R;  3KG0 A;  2VIH A;  1K1S A;  3JQJ A;  3N9U C;  1T8E A;  5D6G A;  4M1K A;  1S1W B;  1JLE A;  2DY1 A;  2KXF A;  5C42 A;  2ILY A;  3DRS B;  1RAH B;  2KN4 A;  3UN3 A;  3OHA A;  1IWA A;  1KTQ A;  4I0W A;  2BVZ A;  4ES3 A;  1IJE B;  2UXC F;  1J5O A;  4I2Q B;  4B3R F;  2X1A A;  3BGF A;  4A8Y A;  2QTW A;  4HEA 9;  2EFG A;  1NJZ A;  2NXC A;  1TUW A;  3BDP A;  5KFK A;  4YN3 B;  3T5K A;  4PWW A;  5EX0 A;  4JUZ A;  2R7U A;  2FVQ A;  1P1L A;  2E44 A;  4P7T A;  2BE9 B;  2XBP A;  3FQK A;  3RR7 A;  2FLP A;  2OPP A;  4NYZ A;  2KVI A;  4GMK A;  4YB5 A;  4ATN A;  2R9L A;  5HJY A;  4OJG A;  1IVZ A;  3W7B A;  1NK4 A;  3J7Y I;  1HQE A;  1NZA A;  2IFX A;  5CH7 B;  1B7Y B;  3A3N B;  4ZJL A;  4OIX A;  3J7A N;  3R1H A;  3MUR P;  2XSF A;  5HMZ A;  1FWP A;  2OMO A;  1HBN A;  4CO1 A;  5KT7 A;  1NEE A;  1WKL A;  3MAA B;  2HRY A;  3MM6 A;  3PTW A;  2KT2 A;  3IR6 B;  4HKQ A;  5IT0 A;  5ETN A;  2GHV C;  1P27 B;  1S4F A;  3KLF A;  3PCO B;  4KHR A;  3MM5 B;  1U2F A;  1FA0 A;  2CQD A;  4B9M A;  4WP9 A;  1NSQ A;  4U96 A;  2B4V A;  4RKU C;  4DX5 A;  1Q0N A;  5LSL A;  3EGV A;  3ILL A;  1Y0H A;  1UKU A;  2DIV A;  4QCL A;  1NHU A;  1NCL A;  2JEF A;  1X7V A;  1OYE A;  5LSO A;  1HYS B;  4R8U A;  3RAX A;  4NML A;  1S10 A;  2IRU A;  2NSC A;  1IKW A;  1NH7 A;  4ZPA A;  4B3M J;  2O3D A;  5JMN A;  5GMD A;  3UR3 C;  2KHC A;  4KO0 A;  1MMD A;  1DTQ B;  1RAB B;  4X66 J;  3IFE A;  3LP2 B;  3GWC A;  2ZOF A;  1SKW A;  1TU0 B;  2GX8 A;  4C11 B;  2P9E A;  2V63 A;  2UUA J;  5A76 A;  4XK8 C;  2KM8 C;  4PUO B;  3CTR A;  2J6U A;  3L09 A;  1SL1 A;  1BGX T;  2IC3 A;  3RZA A;  1RLD A;  3FBF A;  2UXB J;  1MW7 A;  2IM3 A;  2FLO A;  4RW7 A;  4LF8 J;  2O66 A;  3I9Z A;  2ACY A;  3PZP A;  1Q5V A;  4UUX A;  3I0R B;  4BS2 A;  3CIZ A;  5KFQ A;  3LUY A;  2EFO A;  3BH6 B;  1FEH A;  3NCR A;  3MM8 A;  3GLJ A;  2ZWO A;  3JTN A;  1KNZ A;  1YDL A;  2GIR A;  3IR5 B;  2B3T B;  4WFZ A;  3MF5 A;  3R6G B;  3T1A A;  1UVI A;  4E0D A;  3MMJ A;  3LF0 A;  4OV1 A;  4KGK A;  4DV1 J;  2GZO A;  3GIR A;  4RO0 A;  1MWZ A;  4CO4 A;  1VC6 A;  2AJ1 A;  3J80 Y;  1R27 B;  3QGP A;  2R2S A;  1VHF A;  3OUY A;  1JLA B;  4J9M A;  3M4X A;  2VG7 A;  1EET A;  3R8Y A;  5HL7 Q;  1HLW A;  1EIY B;  3GJR B;  4F3Q A;  4TU9 A;  3IR7 B;  2XGP A;  4RNM A;  2Z2M A;  3QO9 B;  1VIO A;  3RAM A;  4B3O A;  1VQM S;  2VB6 A;  2YX4 A;  2O67 A;  4KBI A;  2RT3 A;  2HFZ A;  4G1I A;  1PYO B;  4YB7 A;  5GMK a;  4OX9 J;  1WEL A;  4YB1 P;  3W9J A;  5IC4 B;  3I5B A;  1N56 A;  3QT8 A;  2WZ1 A;  1TKX B;  2PMZ D;  3CDU A;  2OGU A;  3OT9 A;  1VYA A;  1VI7 A;  1G7C B;  1O0P A;  3T1Y J;  1S6U A;  5AJ3 J;  1U1L A;  4ZIW A;  1Q8I A;  2DH8 A;  1KVJ A;  2VDH A;  2CZV C;  4O4G A;  2ZE2 A;  4XIU A;  2AYB A;  1KHV A;  3S1T A;  3HVT A;  4C8O A;  3GTY X;  2IM0 A;  2PE8 A;  1H7X A;  3I5A A;  3QGG A;  3KK2 A;  4K4Y A;  5A0Y B;  1NK5 A;  2K1R B;  3GCX P;  2Q1L A;  2EFN A;  3NLC A;  4MKB A;  2Z8Q A;  5F3Z A;  3V6K A;  4N5S A;  1HBM A;  2OJ3 A;  2YNH A;  3JQM A;  4KGZ B;  2QSF A;  4WFN Q;  3EX7 B;  3PO5 A;  1KHW A;  1B7F A;  2GJI A;  3OXL A;  4R0J A;  2DY9 A;  1APS A;  4N8O A;  3MR2 A;  1M1G A;  4IUF A;  2ZFH A;  3DLE B;  2NR0 A;  1G3O A;  2V8G A;  4JI5 F;  3CCR S;  2P6T A;  3FSI A;  1XBW A;  4W92 B;  1NDK A;  3VR1 A;  4BCA A;  2F3J A;  1FRM A;  1TL3 A;  3HI9 A;  3Q8P B;  4LSL B;  1SH3 A;  4QIF A;  1FKO B;  5HAT A;  3TAQ A;  2HIQ A;  5HP1 A;  3Q22 A;  1IKY A;  1GT8 A;  1ZS6 A;  4NLX A;  1ULR A;  3G82 A;  3SCI E;  4Y2A A;  2HHX A;  4WII A;  1HNW F;  2R7X A;  4ZA1 A;  1VBK A;  1SJR A;  5LSR A;  4NLO A;  1OIA A;  2ZHO A;  1RWP B;  1S9F A;  3Q8S B;  2JRS A;  4P10 A;  2KFY A;  4HR2 A;  4WP3 A;  2OML A;  2FLN A;  3CJR A;  3ONQ A;  3LQV A;  2CNN B;  2CKW A;  1FFW B;  3V2U C;  3ENW A;  3RUB L;  4CH0 S;  4IDK A;  1GFW B;  1VQL S;  2OTL S;  4F4K A;  2IYI A;  2B4O A;  2YWE A;  1PYS B;  4WYL A;  1JLC A;  3DDI A;  2V94 A;  1RHM B;  1XER A;  1HBU A;  5F9L A;  3NMA A;  1U47 A;  3OD2 A;  2AW0 A;  3CJK A;  1VRT A;  4URQ U;  6FDR A;  4F4W A;  3CW2 C;  5T7L A;  3MAH A;  1CQM A;  2CJA A;  4JV0 A;  5C25 B;  2PA8 D;  3LGN A;  2FZG B;  4K0K J;  3ZZO A;  2FQQ B;  5L1I A;  4DV0 F;  2F8M A;  1VC0 A;  4N77 A;  3W1Y C;  2DO4 A;  2DGW A;  5F8N A;  2UU9 J;  5CAA A;  2IRX A;  4M5D B;  3TEH B;  5HRO A;  2JVO A;  2AEF A;  3BGU A;  3TAM B;  2I6W A;  3KHL A;  2WRM A;  5KFJ A;  2RRA A;  1YKW A;  4WKR A;  2LCW A;  4ILL A;  5D4O A;  4DQR A;  4H4K A;  1IKX B;  2B8Q A;  3QAT A;  2ZM6 F;  1UVL A;  4LBP A;  3BN4 A;  2GVD B;  2OPQ A;  2HHV A;  1JKH A;  1A6L A;  3R5B A;  1S6Q A;  3IWL A;  3M2R A;  1P9Y A;  2QC3 A;  1SQG A;  3ITH A;  1K73 T;  2CVE A;  4CTA B;  2E1A A;  2AMC B;  1LK7 A;  2CPY A;  1KQG B;  4F04 B;  4PXC A;  2DCL A;  1RAI B;  4DUZ F;  8AT1 B;  4C7Q A;  3MUV P;  2C2M B;  3B4M A;  1TKT A;  1GAO A;  5D15 A;  2ZBR A;  1NK9 A;  2CQ2 A;  3AOB A;  4DXL A;  4G1P A;  2ZD1 A;  4IH7 A;  5IT9 U;  2VQE F;  2CPZ A;  3DNC A;  3FRY A;  2XQC A;  2H5E A;  2AEM A;  1HW9 A;  1QAY A;  4LQ9 A;  1EQ0 A;  3QAU A;  2I9S A;  3JB9 k;  2W4C A;  3MOZ A;  3M8P A;  1HWK A;  2FZK B;  1RDR A;  3ZTQ A;  4PR6 A;  3D0H E;  3ZTR A;  1WKJ A;  4MJK A;  4Q8E A;  2NPI A;  1WTB A;  1CJK A;  2XSJ B;  3OTO J;  3T6J A;  2RRB A;  1RAO A;  2ZDP A;  1ICE B;  2QYG A;  5U47 A;  3GIK A;  4RU9 A;  3W5X A;  1N33 F;  2HRT A;  1UFW A;  3IC1 A;  1PBU A;  4ED1 A;  4MK7 A;  2PEB A;  3NMR A;  3PR5 B;  1GMW D;  3BM7 A;  1VIX A;  3TZW A;  5JXS A;  3TJ9 A;  3SSQ A;  3I6P A;  1FXD A;  3CVK A;  1MSW D;  3QGI A;  3JSY A;  2VC1 A;  1S5Z A;  3D6H B;  5M2U A;  3NGS A;  1ZH5 A;  4JI5 J;  2EFP A;  4K7Q A;  3KLH A;  4DL2 A;  3MEC B;  1RU1 A;  4X64 J;  3KK3 A;  3TEG A;  3MMA B;  2E1C A;  4OZ3 A;  2HKE A;  2W9B A;  2FHJ D;  4NRT A;  3KMQ A;  1ARO P;  3CXC R;  2F1F A;  4I68 A;  3FUY A;  4GVB B;  1KDN A;  4ZLN A;  4X65 F;  3GFX A;  2ZH9 A;  1CG2 A;  4AYB D;  2MKK A;  2UXD J;  2EVZ A;  2CQ0 A;  3H20 A;  3P3D A;  3MFI A;  1FNM A;  2RML A;  2QLF B;  2IAJ A;  4PPD A;  1NAQ A;  1MU2 A;  2RIJ A;  2W24 A;  1XMQ J;  1JLB A;  3RBE A;  1T11 A;  2E1M C;  1R3N A;  3IGV A;  4NLV A;  4X4R A;  4CO2 A;  5L1K A;  5B0A A;  3H25 A;  4V1A k;  3GB0 A;  4IOB A;  2WBR A;  2BUN A;  3Q8R B;  3K8W A;  3GON A;  4IFY B;  2QA4 S;  1AYE A;  4K4W A;  2VON A;  4P73 A;  1AFJ A;  3RBD A;  5DS7 A;  4WE1 A;  3T5J A;  3RB3 A;  4L76 A;  1KN6 A;  5HLF B;  1BE4 A;  1ZZN A;  1FNX H;  2HHS A;  2MXY A;  4RW6 B;  2DNN A;  4QIW D;  4I69 A;  5J2M B;  1M1K T;  4J37 A;  4DV0 J;  2MHN A;  3OXF A;  3C3L A;  2HNY B;  2V67 A;  4F8R A;  3H8Y A;  1XNR J;  2Q43 A;  4NRU A;  3AB2 B;  3GIM A;  1R0C B;  2RDI A;  3OFF A;  2MQ8 A;  1JB0 C;  1LWC B;  1HR0 F;  5KT3 A;  1N0V C;  4YY3 J;  3MM9 A;  4LSN A;  4QWB A;  3EVW A;  1CJV A;  3DLK A;  2GGP B;  3Q89 A;  2C2R A;  3U02 A;  3HFK A;  3EGW B;  1CQN A;  2C3O A;  5KFV A;  3LWM A;  4NYO A;  1BQN A;  2LA4 A;  2ILZ A;  3EM1 A;  2D41 A;  3KYL A;  1RWM B;  1SC3 B;  3C46 A;  1V5I B;  3RR8 A;  3NAI A;  1TV6 A;  4GKJ F;  2UV8 A;  1UL3 A;  2BDP A;  4DI6 A;  1U0S A;  2XY5 A;  3PNI A;  3ILJ A;  5LMN F;  1HD0 A;  4DUZ J;  4U7U D;  2YKN B;  1TVR B;  4CNZ A;  4CM0 A;  1LWE A;  1T05 A;  4ANE A;  2QMU B;  3GFH A;  4HT7 A;  1RT5 B;  2JJ4 D;  1H6K X;  4J9K A;  2MLX A;  3ULH A;  2VUG A;  5DQG A;  1TZ0 A;  3RYL A;  2OPS B;  3MM7 B;  3CPW R;  3FCW A;  4ZCK A;  1P6T A;  3R27 A;  2C3M A;  5CYM B;  1SXL A;  1TL7 B;  4DV3 J;  3SCJ E;  3HVW A;  3H90 A;  3PAC A;  5ETK A;  2YQ0 A;  2KRB A;  2RE1 A;  2BEF A;  2NSB A;  1H98 A;  5HQL A;  1JLF B;  4TLQ A;  1TUV A;  2WSC C;  3C6U A;  2CQ1 A;  1Q8B A;  4OX8 A;  1BUX A;  1WF2 A;  4DR5 F;  3H0P A;  4DV7 F;  4WZQ A;  5LJ3 Y;  3TUZ C;  1L3S A;  1RAG B;  2OHD A;  4ECZ A;  3ZFV A;  3UDL A;  3BGR A;  1KLN A;  2DGS A;  4O3N A;  4OX6 A;  4TYA A;  5IM0 A;  3M32 B;  4X4N A;  4M5G A;  1T9U A;  4AXJ A;  1VHI A;  4DF8 A;  1QTM A;  3TUP A;  3G9C A;  2GO8 A;  3IM8 A;  3GSI A;  2YPY A;  1JJC B;  1YGY A;  4I6W A;  2VBW A;  4U8Y A;  3NNH A;  2CPX A;  2HBY B;  3L3C A;  1R8A A;  2W2N P;  3OTE A;  3BKF A;  1FK9 B;  5C2C A;  4XPC A;  2KXN B;  4EEY A;  1D1U A;  1SQE A;  3HT0 A;  4UST A;  2OEL A;  3OR1 A;  2F7V A;  4ANC A;  1K44 A;  5KFU A;  2R4F A;  4C0H A;  2D9O A;  1E6Y A;  3J7A 1;  4LF7 J;  2R7O A;  3EUN A;  4KKO A;  1JX4 A;  4C4W A;  4IG3 A;  2XMM A;  5KFN A;  3K5M A;  3BJY A;  4UY8 5;  2R8H A;  4PQU B;  4DSJ A;  3TQ1 A;  1I94 F;  4OI6 A;  4LF9 F;  4X4U A;  2LKZ A;  4ECV A;  1PJ5 A;  3K17 A;  4AUK A;  3B6B A;  3DU6 A;  4NCG B;  4DFM A;  4I2P A;  1N34 J;  2JLE A;  5F8L A;  4OZJ A;  3IRX B;  4NYP A;  1ZTT A;  1VMB A;  3SQG B;  2U2F A;  4O23 A;  4AQY J;  1RTZ A;  3CT9 A;  2FGC A;  4WFY A;  3VGU A;  4XPE A;  1LW2 A;  2Y8W A;  4KV8 B;  1FE4 A;  1NPP A;  3PRD A;  2OPR B;  1YJT A;  1OS5 A;  5CYQ B;  2VFT A;  4ZVU B;  1DQ8 A;  2KU7 A;  4H54 A;  1EKR A;  2HWH A;  2ZVS A;  4B08 A;  2CRL A;  2V34 A;  4CZC A;  1O51 A;  2FJE B;  1YZ6 A;  2G1H A;  4NXN F;  1UEV A;  1RBO B;  4CLS A;  2N82 B;  3IBF B;  2IBK A;  4JV1 A;  1B3T A;  1RBL A;  4OHZ A;  3ETO A;  2AQ4 A;  4A8F A;  2RAQ A;  1AUD A;  2HVI A;  2HSE B;  5HAO A;  2J9C A;  2OO4 A;  5A6P A;  2BKP A;  4DQI A;  2HMI A;  4DN0 A;  4DDF A;  1KC8 T;  5HBM B;  3MCM A;  2V68 A;  3GFY A;  3MED A;  4NLR A;  4QWE A;  3GZ7 A;  1WDD A;  2EPI A;  4Y65 A;  1Q8L A;  4DCJ B;  1F5A A;  3C16 A;  2I8E A;  4GKJ J;  2HFU A;  4B9U A;  4ZVQ B;  1B99 A;  3DU5 A;  1S9G B;  2HS0 A;  2W7P A;  1URR A;  4DL0 C;  6AT1 B;  5KFE A;  2RU3 A;  4WFA Q;  5I4M A;  2VPZ B;  1RWN B;  3C15 A;  1AXQ A;  1WHV A;  2YX7 A;  2VPW B;  4AND A;  2BV3 A;  1JLG A;  3CGI A;  4KT0 C;  1MNE A;  4DR7 F;  3AJD A;  3KNA A;  1X9S A;  2DHS A;  1F2G A;  1OPZ A;  1EAY C;  2R7V A;  4A48 A;  4IFV B;  1M1H A;  2P6S A;  2A6M A;  2YWK A;  1RIS A;  3NBP A;  1Y3K A;  3OBI A;  3DRR B;  1FXL A;  4WIQ A;  1SH2 A;  1RWU A;  2OP5 A;  1OQ3 A;  4B3S F;  1C0U A;  3MCS A;  3MPU B;  2V50 A;  5F8M A;  3BN7 A;  1IJF B;  2R2T A;  2C22 A;  1VS3 A;  3DOM B;  2XMV A;  3LPE A;  1QM9 A;  2YQ3 A;  2NYI A;  3CCE S;  5BYS A;  1U2R A;  3HZE A;  1AFI A;  2PFF B;  1FRJ A;  2V4R A;  3RG6 A;  3NG8 A;  4DV7 J;  3DXS X;  4FBU A;  2PI5 A;  2QRR A;  3R5A A;  2B9Y A;  3UCG A;  3QZ8 A;  1LQ9 A;  2VA2 A;  4M8L A;  4U8V A;  5B0G A;  3I5C A;  4YP3 A;  1SL0 A;  4RPF A;  4KH0 B;  1NME B;  3VAJ A;  1NK6 A;  2W2Q P;  4Z2X A;  3V81 B;  5H9F J;  5GAD U;  2QLB B;  2RJZ A;  5ITH A;  3CMA S;  1VQY A;  4USW A;  3NKY A;  3D3B J;  4M5L A;  1EP4 A;  5GAE U;  1BQX A;  1V9O A;  1S1V A;  3IMQ J;  1U0H A;  3KHH A;  3SDE A;  4YS2 A;  4QIE A;  2FJD B;  3BBF A;  1CJU B;  2K3K A;  4HTI A;  1CVJ A;  2V2Q A;  2AIR B;  1SV5 A;  4OHY A;  2BA9 A;  1H74 A;  1DZ5 A;  3RJM B;  3HUL A;  3JSR A;  1FRL A;  1U1O A;  2VJV A;  2CXE A;  4DG1 B;  5K8P A;  1U45 A;  3K5O A;  2V5H G;  1DLO B;  1I5O B;  2BAN B;  2BKO A;  5T14 A;  4P2M A;  1NB2 A;  4OI4 A;  3QT6 A;  2IJN A;  5KFZ A;  2DVI A;  2E5H A;  1HNV B;  2MJN A;  3U7J A;  5F8J A;  3FZ2 A;  2DGV A;  2LEA A;  5F8G A;  2N4D A;  3G2X A;  5EGY A;  3M30 B;  3MUT P;  2WB1 D;  2E7W A;  4DHV A;  2ADB A;  3FRZ A;  4UZC A;  3AXK A;  3MCN A;  4FVM A;  2C2D A;  1NHV A;  2XZW A;  4NLW A;  3AH6 A;  2YKQ A;  2YKO A;  2HK2 A;  1QUV A;  2GJ2 A;  4PG8 A;  4FYV B;  2MQO A;  4USJ C;  1VQ7 S;  2PD1 A;  2B5J B;  1CJT A;  4RW9 B;  2CDQ A;  4QQB A;  1M5O C;  1HNZ J;  4CO5 A;  2W9A A;  4OYI A;  2R7Q A;  1NPR A;  2BRK A;  3GYX B;  3R7S B;  3BO4 A;  3RRK A;  4MIW A;  3KG4 A;  5KG1 A;  3Q2S C;  3CC4 S;  3M8R A;  4C6A A;  3DI6 A;  4LRE A;  1VQ8 S;  1JWW A;  1Y7P A;  2WVD A;  3SFG A;  3OW2 R;  1TUG B;  3DYA A;  2DGO A;  1Q86 T;  1FD2 A;  3X3U A;  3IG1 B;  1Y5N B;  2U1A A;  2W7A A;  5D4L A;  3HT3 A;  3RRG A;  3UCU P;  1K9M T;  5MLC V;  5IT9 Y;  3AAW B;  1U1M A;  2MY7 A;  3EMT A;  5KFD A;  4A8W A;  3FFI B;  3CO0 P;  2UUB F;  4IRD A;  5ADZ A;  3ENQ A;  4C0O C;  2AYM A;  3JS9 A;  4U7U K;  1I1G A;  2B7C B;  5CCL A;  1FJG J;  2H54 B;  3KLE B;  5DDR C;  1FHT A;  2VFU A;  1TKD A;  2DB1 A;  1TQL A;  1EB0 A;  2YX1 A;  1UFK A;  4JV5 J;  5J1N A;  2WVF A;  5HO4 A;  1NKB A;  3SBM A;  2DH9 A;  1VQ9 S;  4LFB F;  1H0H B;  5THW A;  4LRC A;  4DX7 A;  2GO9 A;  3GJQ B;  2BOP A;  2D7S A;  5E0O A;  1U49 A;  2HFS A;  2LEC A;  2AZ1 A;  5K14 A;  1LOU A;  3OJU A;  3UD3 P;  2HUR A;  1IBL J;  4ICL A;  5KG2 A;  2FY8 A;  3KLI B;  5B0D A;  2Q6C A;  3B8H A;  5BR8 J;  1VRU A;  4ZVF A;  5IS2 A;  5E3P A;  2ZKU A;  3DOL B;  3W64 A;  1LFP A;  5KG7 A;  1HBO B;  4OZ5 A;  4C8Z A;  2IJF A;  5AXL A;  1H73 A;  1YJR A;  5I3Q A;  1IBM J;  2K3I A;  5KFI A;  3SMZ A;  4FF3 A;  2HBZ B;  2DHH A;  5KFM A;  5DM6 Q;  1F3V A;  1JLE B;  3QZ7 A;  5B08 A;  1TMM A;  5C42 B;  3ZC4 A;  3Q8V A;  3L7P A;  1N0U A;  2COL A;  3ADA C;  2FIU A;  2M8D B;  3CB4 A;  2VFV A;  1D0E A;  2Y0S D;  3QMQ A;  3QJP A;  3N6M A;  1WEY A;  3IA0 A;  2OSR A;  1S0N A;  5GAD I;  5ETO A;  4DPW A;  2ZBQ A;  4USU A;  2L9W A;  3LAL A;  1PIL A;  1VK3 A;  2V8H A;  3EXC X;  2OPP B;  2W2P P;  3VVU A;  2RIL A;  2HW3 A;  5K9F A;  1EX8 A;  1MWY A;  3KDN A;  4ZP9 A;  2AZ3 A;  1K0T A;  3OFH A;  2M7S A;  4HI2 A;  1Q16 B;  4NX9 A;  3CCS S;  1HBN B;  5KFC A;  4NEZ A;  4I64 A;  4RNF A;  2QL5 B;  1Y5I B;  3RBX A;  2H48 B;  3PYG A;  2HS4 A;  3CF5 Q;  1S1U A;  1ZTW A;  3MM6 B;  3AOA A;  3TR5 A;  2ZH3 A;  3DLG A;  4HTJ A;  1RT7 A;  1YG0 A;  2CPJ A;  3FGV A;  1N88 A;  2PMW A;  4RZR A;  4LBH A;  3CC2 S;  3DXB A;  3BKT A;  3OLA A;  2KB2 A;  3TA0 A;  5JJB A;  1SJ4 P;  2KYX A;  2GFF A;  1M0S A;  2CNL B;  2UZA A;  3NOC A;  1WD6 A;  3UQS A;  1NSP A;  2I5J A;  2N7C A;  4LRF A;  5L8R C;  3EE3 A;  3PEJ A;  2KT5 A;  4X62 J;  2F5G A;  7FD1 A;  4R5P A;  2MB0 B;  4R8U B;  4Y2K A;  4KTQ A;  3ZZU A;  2D3O R;  3QLH A;  3THP A;  1W25 A;  2CNK B;  1IKW B;  4OMF G;  2K7K A;  2YKM B;  1U1R A;  4CLL A;  4KO0 B;  1E6V A;  2VC0 A;  5L46 A;  1J2V A;  4P72 A;  3HVR A;  2FZC B;  2BOA A;  3PIO Q;  2BZ2 A;  2PO4 A;  5J1E A;  3LOU A;  2RQM A;  1FVQ A;  3ETM A;  2JEI A;  1WAC A;  5AXK A;  1PJ6 A;  4QPX A;  4P2F A;  1U2C A;  2HQF A;  4PKD B;  2OH2 A;  2XI3 A;  2DTJ A;  5L9X A;  3FEY B;  3IM9 A;  2XMW A;  4RW7 B;  4ZKA A;  3L95 X;  2EC2 A;  2LXI A;  1WG1 A;  1XNQ J;  2XEX A;  5DDP C;  3HX9 A;  4M95 A;  5H9E J;  1TR0 A;  1HQ2 A;  4EO8 A;  3BO2 A;  3OTD A;  3MM8 B;  4PPZ A;  1DY3 A;  4HLB A;  4N8N A;  2VH7 A;  2RRN A;  4C3L A;  2DR9 A;  4PG6 A;  2MQM A;  3BB5 A;  1NUE A;  1HMV A;  2Q3P A;  3BSO A;  4DV5 F;  3MR6 A;  2R3V A;  2JOQ A;  1K47 A;  1DFD A;  1XR6 A;  3OUY B;  4OYX A;  2E9Z A;  1PC5 A;  1KP6 A;  3N28 A;  3VZH A; 
#chains in the Genus database with same CATH homology
 1WC0 A;  4USV A;  2QV6 A;  4P2M A;  1CJK A;  1CJK B;  1WC5 A;  5D0G A;  2GVD B;  3ET6 A;  3C14 A;  3ET6 B;  2GVZ A;  1Y10 A;  3C15 A;  4CLW A;  2GVZ B;  4OYM A;  4OZ2 A;  3C15 B;  3MAA A;  1AZS A;  3MAA B;  1AZS B;  4P2F A;  5IV4 A;  1TL7 A;  1CJV A;  1TL7 B;  1U0H B;  4CLT A;  1CJV B;  4NI2 A;  2GVD A;  3R5G A;  4NI2 B;  5D0R A;  4WPA A;  5D0H A;  1Y11 A;  1WC6 A;  1WC1 A;  4CLU A;  4UST A;  4USW A;  2WZ1 A;  4CLY A;  4OYP A;  1CJT B;  1WC4 A;  1AB8 A;  4WP9 A;  1U0H A;  5D15 A;  1FX4 A;  4OYO A;  2W01 A;  1CUL A;  4CLS A;  3G82 A;  1CUL B;  3G82 B;  1YBU A;  1CJU B;  1YK9 A;  1WC3 A;  4CLZ A;  2BW7 A;  4OYA A;  1CJT A;  1CS4 A;  4USU A;  4OZ3 A;  3MR7 A;  1CS4 B;  3UVJ A;  5D0E A;  4CLP A;  4OYW A;  3UVJ B;  4OYI A;  5IV3 A;  4OYB A;  4OYZ A;  1CJU A;  1FX2 A;  4CM0 A;  4CM2 A;  3C16 A;  1YBT A;  3C14 B;  4WP8 A;  3C16 B;  4CLK A;  4CLL A;  4P2X A;  4OYX A;  4WP3 A;  4CLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...