3AJ1A

The structure of axcesd octamer (n-terminal his-tag) from acetobacter xylinum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
KKPDFTLFLQTLSWEIDDQVGIEVRNELLREVGRGMGTRIMPPPCQTVDKLQIELNALLALIGWGTVTLELLSEDQSLRIVHENLPQVGSAGEPSGTWLAPVLEGLYGRWVTSQAGAFGDYVVTRDVDAEDLNAVPRQTIIMYMRVRSSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulose synthase operon protein D
publication title Structure of bacterial cellulose synthase subunit D octamer with four inner passageways
pubmed doi rcsb
source organism Acetobacter xylinus
molecule tags Biosynthetic protein
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03500 Cellsynth_D Cellulose synthase subunit D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2590 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aj1A02
3A8EA 3AJ2A 3AJ1A
chains in the Genus database with same CATH superfamily
1VI7A 2CJXB 4USMA 1H73A 1WF2A 1X0PA 3HHLB 3VAKA 2E9TA 4X65J 5IC4B 1VRTA 4GMKA 1WHXA 4F3MA 3J7ZT 1U0SA 4URSA 1W7WA 2DRDA 2E7XA 1F5AA 2X3DA 2N3OA 4CNZA 4Q45A 5D3GA 4ID5A 4QOTA 4DV0F 2EKNA 1IKVB 2DR5A 1VHFA 4KPCA 1KLMB 3ZZOA 4P6QA 5B0EA 1LKZA 1NSQA 2FIUA 2DNNA 4LBHA 4FYYB 3Q0AA 3OLBA 1FXRA 5CAAA 4TU8A 1O0PA 2CVEA 5ETPA 4YY3F 2B7BB 4C0OC 4UZBA 4I2PB 1APSA 1D3WA 3I31A 2ZKUA 4HACA 2YXLA 4PABA 5CZVA 1RTJB 1ZM2A 3TOQA 4RUBA 1T94A 4FYWB 4IO1A 4I6WA 2Q43A 3M8PA 3KK2B 1Q79A 1FI4A 3ILLA 3QGHA 2X1FA 4IFYA 2FLOA 1UAWA 1QAYA 2DR7A 3RUBL 2EFVA 1Y00A 1YGYA 4JV5F 4ZHRA 2PO4A 4KFBB 4OLPA 4RW4A 2LKZA 2CPJA 1DBDA 2HURA 3ITHB 1AROP 1J27A 2W9BA 1EZZB 4LR9A 1EAYC 2FJDB 4NL5A 1BC6A 4X64J 5RUBA 4ANEA 3M30A 1UTAA 2HFOA 3VAIA 1WF0A 3X1LB 2R7RA 4JB8B 1IVZA 3JQMA 2NCKL 3BGFA 1R8CA 2Y1RI 3J7YU 2Y8WA 3FQKA 4QYRA 3G8QA 1FDDA 1ZYQA 4ITSA 3OR2B 3V6DB 4U96A 4AE5A 3TJAA 1NZ8A 2DNHA 2VC1A 3R5GA 4ZN3A 1V9OA 4X65F 2ZH1A 4FNIA 3UE2A 1RT1A 3D0HE 2QYGA 1XN9A 2H4WB 1GH8A 2VPXB 4DX5A 2VASA 2RQCA 3HJFA 3JXOA 1RACB 2XNRA 5KFTA 4EWTA 2DIVA 1LNQA 2ZH7A 2J7KA 1TKXA 2B9EA 1Q7YT 1FE4A 1MROA 1RJJA 3N9UC 3P49B 3MR6A 4FF1A 2DGUA 1S6UA 1Q16B 3CE8A 3PR4A 4U7UK 2DRBA 2DNPA 5C24A 4DQRA 2MHEA 1MU2B 1N32J 1S1VA 1GAOA 5E5NA 3P5BP 4FNHA 3E2EA 2F8EX 4K0KJ 5LSLA 5AE2A 4DU7A 2FJAB 3RG6A 1RAFB 2W2MP 4TU7A 3AB2B 2AU0A 1NSPA 2KB2A 4PYAA 2Z2LA 3KHRA 4YR3A 2AJ4A 1RBAA 1OYDA 3TZZA 4HTJA 2YTCA 4QU6A 1S1XA 3VAHA 3D0GE 2QE5A 5A0YB 4I67A 3CJ8A 3GJTB 2HPUA 4RW9B 4K4WA 1T9XA 2R8IA 1VC6A 2O1PA 5HANA 3EZUA 1CSJA 3JB9k 2GGPA 5HBMA 2JFKA 5KFXA 4U95A 1UPPA 4LRDA 4XTTA 1AA1B 2RQMA 1FNXH 2RQKA 1CG2A 1H72C 3Q8QB 4KC5A 3RB6A 4GVLA 2NXCA 4ZP8A 4BCAA 4DG1A 3V81B 4ALZA 1RI7A 5G0RA 2W25A 1RWXB 2YNFB 4PG8A 2FJXA 4OYBA 4U7UD 3TAPA 1AZSB 2HHUA 1YBUA 1JMTA 5IQ6A 4FPIA 2OUGA 3UVJB 1EX8A 2ZOMA 2CDRB 1TFYA 4LF5J 1NK5A 4C8ZA 2BEFA 4CTAB 2ZC3A 2WVFA 2GHPA 5B0BA 3GFYA 4QIFA 3K59A 2HHWA 4DLGA 3FSXA 1RWKB 3V2UC 1JLAB 1NO8A 1N32F 3T9NA 2BQRA 4NZ0A 1S76D 3PRBA 3M8SA 3GG0A 4K0KF 3QQCD 3CF5Q 5DZ6A 3R9LA 1VQ4S 3D2WA 3ZNJ1 3DKDA 4Y3CA 1URRA 4IH5A 3NAHA 1U24A 5B0AA 4YN3B 1E6YB 4LQ9A 5JMNA 4ES3A 1VQPS 2JLFA 1TUVA 1U49A 2VA2A 1MMDA 1IKWB 4J9QA 3CCLS 2CNKB 4ED4A 1HW9A 4WK3A 3UO0A 5L38A 5AXNA 4Y34A 4A8QA 4ENOA 2F8HA 1TVRB 3DNCA 4KGVB 1TQLA 5C42A 4K50A 4NRUA 1AFIA 4X4UA 2C3UA 4JI5J 1F6TA 1L3SA 2B7CB 5HVFA 2PFDA 3DFEA 2KJVA 1VOMA 3LP0B 5LJ3Y 4WFXA 2QLJB 3CD7A 4C7QA 3VZHA 2A18A 2VFRA 4CO0A 3D6TB 4L73A 1N6QB 1NKCA 1VRUA 3AFGA 3ILJA 3ZZZA 2ZJQQ 1SJFA 4PWDB 3CGIA 2QSFA 2ZDOA 3HMJG 1T8EA 3HZEA 1X0FA 3V4IA 2JRSA 1TL5A 4IO9Q 2DGTA 1U7LA 3CMQA 2GQ2A 5B7WA 1TKTA 2BV3A 3I0SB 4P2FA 3KDNA 4CLUA 3PXGa 1WC4A 2R7TA 2FVPA 4R0EA 1SH2A 1VQYA 1F9EB 4I2QA 2XMWA 5CABA 2VFTA 3MAAA 3RU0A 4RWXA 2YWHA 3EYZA 2YQ0A 3P5TL 3TAMA 1G1XA 2W7AA 4A46A 4LF5F 3MM5A 2C2MB 1JKHB 1WACA 2BJ1A 3M6VA 3AD8C 3NNHA 3AT1B 3LP2B 1V3ZA 2UXCF 2H51B 5HP1A 3EICA 4G3IA 4CIOA 2YVSA 4M8LA 3MR7A 5D0GA 1OSCA 4FF4A 3IMQJ 5GMKa 1SKUB 5FDLB 6FD1A 4JI7F 1R0AA 5J2PA 5HROB 5I3UA 4UOGA 1S6QA 4RR5A 3CDUA 3PYFA 4YDDB 4QWAA 5IM0A 3IA0A 5KT4A 1RTHA 2DYAA 2H65B 1F60B 3BSCA 4I4BA 5HLFB 1HBOA 5DM6Q 2OEJA 3LW5C 1WG1A 1N5YA 3KJFB 2DGWA 1S10A 3CJTA 4FYDA 2O66A 2QLBB 4OZLA 2GCFA 1IBLJ 5ETQA 3DLKA 2FC9A 3Q22A 4R8UB 1SQGA 3M2VA 4ZVSB 3B4DA 1X5TA 4LF9J 1M5KC 4DS5A 2N82B 3FSIA 1FWPA 4RZRA 2RS8A 4CLSA 2E5JA 1H0HB 4RW6B 4ZVEA 2MGZB 3WHIA 3LP1B 3NGDA 2JC0A 4N76A 3R5JB 1MLAA 1YJ7A 2IPOB 2M2BA 2OPPA 3IG1B 4NCGA 2G0CA 4LFBF 1IBMJ 3D66A 3VZIA 2HK3A 2N7CA 5A8RB 2VHGA 2JLEA 1H38A 2B9XA 2KHCA 2CJAA 5HVGA 3HCXA 2EW9A 2XZTB 1DQ8A 5H1SV 2FD2A 1S12A 2VG5A 4EZ9A 1MNEA 3TEGA 2WB4A 2LXUA 4CLLA 2A2CA 1O8BA 2CZ4A 2MKHA 3H2LA 1H6KX 4Q8FA 3KWMA 1UA0A 1KKHA 2NXEA 2V0NA 3GFXA 5LSOA 1ZA2B 3U02A 4CDIA 2K7JA 1O5JA 2K7KA 3VWSA 1ROFA 3L7UA 1DQAA 4RWWA 1YVFA 2SXLA 2QG9B 3KYLA 3I55S 3S7RA 2XHCA 4ER8A 1NU4A 2BR0A 1FERA 1PGZA 1JIHA 1N5VA 4OYOA 4EBDA 2OP5A 4P74A 4JI0F 1RWWB 3P4UB 1HHSA 4OYXA 2EFGA 2W2PP 2J7WA 4J9KA 3TQEA 4ZPAA 1RHUB 1SJQA 5GADI 2WW8A 3C6TA 4OX6A 5BR8J 5KFDA 1EKRA 3DXBA 2WOMA 2EG2A 3OT9A 2OPSB 4WFZA 4WIIA 2Y3YA 1IBLF 4TNOA 3PRDA 4XIUA 5D0RA 2OKQA 4CI0B 2XMAA 3MM9A 3V4MA 4HR2A 2Z2YB 4WKRA 3TX8A 2CRLA 1DJ0A 4B3RJ 4DX7A 5F8JA 5KFZA 2BANA 1RTIA 2XMTA 4DSJA 4KR0B 3UD5A 1GTEA 2KYXA 1HNIA 1PIEA 4CLPA 2RRBA 1RT4A 4OL8A 2C2RA 4CRJA 3WC2A 1CC7A 6AT1B 1RA6A 4X4RA 2CDQA 2NYHA 1HMVA 2OIHA 4X4NA 2IRYA 2VL1A 3NNCA 1UJ4A 2GVDB 3NBPA 4IG3A 3VGUA 3CCMS 3ENVA 4DR1J 4KGMA 2DRAA 5EX3A 1YKWA 5DDPC 1JXVA 1DHMA 4WPAA 3I9V9 2V4JB 2OPQA 2CPZA 2V50A 3I5BA 2DO0A 1FKOA 1WC1A 4PQUB 2M70A 4DV3F 3ZO7A 3EPIA 2RAQA 2XI3A 2UXBJ 1VRTB 5A8WA 2N4CA 2UXDJ 1BQMA 1CQMA 1FDAA 3H5SA 2RHQB 4QQBA 3GJSB 1DTTB 4A47A 2R7XA 2ZBQA 1Y10A 3K2YA 1HNVB 4OQJA 1ZH5A 1RWMB 3SDEA 2YKOA 1FESA 4YR0A 3A4TA 4NA2A 2LXIA 5BYQA 2VPYB 2LDIA 2J0SD 3J7AN 1JLEB 1LWCA 2QYCA 2BACA 5KFQA 5BR8F 4ZLJA 3OTEA 3TA0A 8RUCA 4UY8T 2G9OA 2JZ5A 2HZCA 4L75A 3UPFA 2QLWA 1FRHA 2QMWA 4FF2A 1PCAA 8ATCB 1WG5A 4F67A 4M5IA 4FXDA 3W2WB 2HQDA 3UD4P 2XO6A 3UFCX 4J5OA 1CJUA 2LEBA 1OPZA 4ZHRB 2MKSA 2PEBA 3B78A 2DHSA 5L1JA 3THPA 2HS4A 4ZP6A 4OMFG 2LQ9A 1K73T 2XYPB 1VBZA 2KRBA 3MGJA 1KR4A 1XEZA 3EDQB 2HNZB 1WHVA 4H54A 2FPHX 3OTDA 3BREA 5A6WA 1JLCB 1R27B 1B0VA 1FD8A 2H3EB 4CLZA 3K5NA 4OX9J 2G4BA 1FHTA 2HFUA 3ZZRA 4TYBA 3RB4A 3M05A 1S72S 3ZZTA 4NCBA 2V94A 5J2NB 3GIMA 1TV6B 1LWFA 3TUPA 2J6TA 4Q8EA 1KWMA 2UXBF 5JVHQ 3EMTA 2UXDF 2OFHX 2EVZA 3ZZPA 3NLCA 2XNQA 4XPCA 3BF4A 2ZH8A 4PQAA 5L9XA 4HT5A 3TJ8A 4M94A 2AJQA 4DFPA 3M6WA 3UNGC 1MROB 4JV1A 3NKYA 4USUA 3E8OA 5ETOA 1I51B 1ZA1B 5CYQB 3ETMA 4Q5VA 5J2MA 3DOMB 5C24B 2G13A 3U1LA 5HMWA 4O3NA 1X4EA 3CVKA 1GT8A 4Y6IA 3AD9C 4NLPA 2E5IA 3HM9A 2LQ5A 4RBTA 2DY1A 4RBVA 1DARA 3D6HB 4AXIA 3GIKA 4DR2J 2RRNA 2WTFA 1HI8A 3HVWA 1JJCB 1LXJA 3MM6A 3W65A 1DURA 5LT5A 1IUJA 4R0JA 3K8WA 5KG4A 4ELTA 4P2XA 2ASLA 5KFPA 3TZYA 4MKYA 3NS6A 3GJQB 2IC3A 3QRRA 1UP1A 1TL1B 1P1TA 3MXHP 3M1VA 4WZQA 2C3PA 4QR0A 2ZBIA 4Q0BA 3H90A 5L8RC 3G4SS 2CWKA 3DHWC 3LALA 3DRRA 4N7TA 2ZH2A 5IZHA 1S59A 2HGMA 2E1PA 3JYTA 2XYGB 3HD1A 3PFEA 4DR6F 2AX1A 2C2ZB 3IWLA 3BGRA 2FY8A 2HLUA 5J2QB 1RYSA 1XIQA 2VH7A 4ZCLA 4EGLA 1JLQA 2HFZA 2JEIA 4DZ6A 1N5TA 2DH7A 3JAMU 1C1BA 1TL4A 2HKEA 4RNHA 3VAJA 2LA4A 4DPUA 3J7YI 2RUSA 1JLGA 3KHLA 3NS7B 1S1TA 3CDBA 2BJ9A 2E9RX 4I7FB 1S9EB 1M1GA 2C28A 1Q5YA 3HVAA 2QX0A 4LF1A 4ID8A 2AYMA 4GKJJ 3W8GA 5KG0A 5CHCB 4DOZA 2XHWA 3CUNA 1P9YA 2VJVA 2NUUG 1UFLA 1RHMB 1NJXA 2CFXA 3K5PA 2WCXA 3DGPB 2OD6A 1S9GB 4EFAC 5KFWA 1HBMB 1X4BA 4S0MA 4TY9A 1T03A 4K4SA 3UWTA 2VKRA 3IC1A 1K1QA 4QIEA 2GW8A 2VBZA 4BWMA 1S99A 1NDLA 2HBYB 1RB0A 2IVFB 4B08A 2O67A 4H4MA 4KT0C 5KFSA 2HQFA 2H9ZA 2V2ZA 3JS9A 2VBXA 3TANA 1Q81T 5AE3A 4X2BA 4LFCF 2E44A 4ELUA 2MB0B 1G4CA 1RHQB 1XNQJ 3MAQA 1YRXA 2G2YA 2AZ3A 3GPAA 4FVMA 1Y7PA 2W8KA 4RBUA 1L3TA 3KMSA 1LW2B 1U1PA 1T9TA 2DO4A 3KK3A 1C0UA 2XWYA 3SFUA 1HHTP 1RK8A 1WEZA 4YB6A 2JC1A 3PYGA 4B9VA 3OD2A 1FWLA 1NB2A 1SIZA 5GAHU 3MWBA 4B3OA 4EBCA 2BQ3A 4NXMF 3US5A 4DLEA 3K0JA 1HFEL 3MPVA 4FP9A 4KB7A 3LAMA 1HNZF 1HWJA 3MM5B 1RT5B 3OXGA 1QVGR 5JXSA 5LMUF 3K5LA 3QIDA 1TL3A 4ECVA 2P5VA 3H0PA 5D4OA 2R4FA 3FQLA 2P6SA 1UW4A 2W4CA 3CJSA 1RAHB 5D4PA 4EYHB 2CNNB 2HG4A 4GKJF 3MTJA 2CQHA 4P7TA 2A6MA 1R0AB 2M4MA 3HSJA 4UUXA 1TFWA 4MH8A 4N5SA 2W1BA 5I3UB 3CC4S 4HDHA 3VCDA 3CDAA 3PCOB 4DR7F 4DSIA 2CG8A 2Y1IA 2FHMA 1SL2A 4YQWA 1N5YB 5K8NA 1Q95G 2MY7A 1HKAA 3KJNB 3SQGB 2YNIA 3C46A 2VG7B 3IS9B 4NWBA 2XY6A 3T5KA 2B9YA 2BKOA 2CPHA 2VBWA 3CIZA 3FEXB 4LSLA 2PT0A 1XTZA 1BUXA 1NK7A 4FF3A 3NGKA 3X3UA 1MN9A 3MMJA 1SH3A 1X5PA 3PEHA 4JI4J 4EMDA 1XNQF 4LF7J 3ICLA 3PX0A 2PSZA 1UKUA 3ZTRA 3TEHB 2AEMA 4HH0A 4J91A 3CTRA 2KM8C 2WSFC 3H42A 3ULHA 1OJ4A 2OPPB 3FRZA 5E3QA 1J5OA 2FC8A 2V34A 4WFYA 1YHQS 4C0HA 2BRKA 4JV2A 1REVA 3C8YA 4WIQA 2RSQA 1U1MA 4JI2J 3HKWA 4LRCA 3MMAB 1Z2ZA 2DR8A 4L74A 4BBYA 2GMHA 5KT6A 3MUVP 2ALZA 2KHDA 4OLOA 1T3OA 1VQSA 3ELHA 1RSCA 2OI2A 4ZCIA 1ZS6A 2NPIA 1QLNA 5IOLA 3LPYA 2L9NA 3DLHA 1F0XA 2E66A 1HARA 2GJ2A 4U9RA 4N8OA 2B8PA 3RBDA 5HMXA 2FZKB 3C16A 2JEJA 4ZMMA 3A1YG 3H7HB 2E7WA 4HEA9 3SYZA 4OZ0A 1U1KA 3OHAA 3RR7A 2BKNA 2YPYA 2YY3A 2OMLA 5FJ4A 4OZ5A 2PI5A 2WZ1A 2F4FA 5GVQA 1QSSA 1WKLA 3P6YC 1YBTA 3DRPA 1R6VA 2GJFA 3C6TB 1UVNA 2NR0A 2C22A 3M4XA 3TWZA 4DV2J 1KDNA 5L9NA 4Z7YA 3FC9A 2R8KA 2F1FA 3NGTA 3T1YJ 1NJZA 3DM2A 3MM8A 5K14B 1PILA 3DHXA 1RWPB 3MM9B 1DFDA 2PC6A 3LGHA 1Q0NA 3EGVA 3M6XA 1KFSA 1PSDA 4LF7F 2XSJA 3G96A 5HAOA 1DZ5A 4P72A 4B3TJ 3IM8A 3PW5A 4P73A 3IR5B 3QGGA 2DHHA 1RCXB 2J0WA 3WDOA 2DGXA 2Q1LA 1LEOA 1RADB 3DRSB 2AIRB 3K5MA 1RAJA 3QAUA 2VJUA 2UUWA 3TUIC 1R3NA 3QZ7A 4LF8J 1KNZA 5KFKA 3HHLA 3C19A 2XCPA 4ED2A 1J2VA 1U45A 3SZ2A 4LQ3A 4HHUA 4C3MA 4R25A 1IBKJ 1IKVA 4OJGA 3IWNC 1YJNS 2ZDPA 4F25A 3T5JA 1KLMA 2HIQA 4FZVA 3SMZA 2OEMA 3D1QA 2MXYA 2DJWA 5MLCV 4M1KA 2VU5A 2RDDA 1W25A 3TJ9A 1YTYA 1T05B 2OTLS 1NUEA 2QA1A 3G86A 2AKWB 1KQSR 3SXLA 4DX8H 4JI1J 4NEZA 1B70B 2COLA 2J0QD 2B5JB 4PEOA 1SV5B 4NCAA 2ZD1A 2NXJA 1F2GA 5M2UA 1RTJA 1PAEX 3IXQA 5IT9Y 4RW8B 2XMJA 2MJUA 2GIQA 2OSRA 5ITHA 2BA9A 1R43A 3SDEB 3BM7A 2E5GA 3KK2A 2ZBCA 3NGSA 2H4YB 2KM8B 2PI4A 1SKSA 1U26A 4U6PA 2XLKA 2W9AA 3KNAA 3CMES 1SXLA 1SI9A 2CJ9A 1LWCB 1VQKS 2ZH5A 1UZHA 2CG4A 2HQ3A 3T5HA 4CO1A 4KFBA 2RRAA 4OX8A 2EI5A 4DV2F 4V1Ak 2VZ9A 3ITHA 2R2TA 3CSKA 3LA0A 5HJXA 4IOCQ 1R6YA 3ZTSA 4WFNQ 2X51A 5DLGA 1TAQA 4DSKA 3BYRA 4Y2IA 1HQ2A 4QPTA 1VLYA 1X9MA 3RRHA 2KH9A 4WCEQ 1CJUB 3Q23A 2LECA 1V6HA 4B3TF 4IYQA 5I42B 5A8KB 3BR9A 1VQNS 5ETVA 3R1HA 3V6DA 5KFYA 3CCVS 2Y0SD 4PXDA 5HL7Q 3V6KA 4UOHA 2AYGA 1NHKL 4OI2A 3HVRA 2EFQA 4X66J 2XMMA 2XG8A 5EX0A 2D7SA 4LF8F 4QYZK 3DRYA 3MFHA 4C6AA 3I6PA 4MYUA 5M2PA 5KFJA 2F5GA 2KFZA 2IM1A 2NS1B 4G1PA 3G6XA 4ZPWR 1IBKF 5HATA 3GQCA 4LR8A 4I6YA 4L6V3 2F4VJ 2DNGA 1YJVA 2WAQD 2VV5A 2J9DE 3G6VA 3NWGA 3C14A 4A8SA 2OEKA 3O6QA 1X5SA 2F9DA 2C2OB 4PG4A 2DCUB 4OJHA 3DGVA 2VA3A 4BHQA 4PCQA 4RU2A 2H54B 2Q3PA 4C48A 2FLPA 1FK9B 3FCVA 3O3LA 2WRMA 4WXWA 2KXNB 1KVIA 3N6MA 2RF2B 4TN2A 1MWQA 3BSAA 4PPDA 2D74B 2LVWA 3W9HA 2DNMA 1H7WA 4B3MJ 4JI6J 5A0YA 5J2MB 1S7HA 5DQHA 1T9UA 1WD6A 1YSJA 4M5GA 3Q8RB 3IGVA 4DL2A 1IR1A 3G2XA 2NQPA 1D09B 1RAGB 2CQ0A 2BYCA 4USIA 5KAKA 3EGWB 1GMUA 1G2EA 3TX0A 3Q86A 3RB0A 1FJ7A 2R7WA 2KZMA 3EZOA 4KIAA 4ILLA 4PWWA 2W9CB 4DV1J 4PXBA 1S6PA 1TR0A 4QR2A 4I1TA 3V81A 1M5PC 5KG2A 1U8WA 1SBRA 4NLQA 3QJLA 1LWEA 2I9SA 2YNFA 3T6JA 4X66F 2J0XA 1AZSA 2GO9A 4DCJB 3RR8A 1G7CB 5F8LA 3KLFB 1RLDA 2L48A 2HHSA 4F8RA 1NDCA 4NLXA 5AJ3J 3UVJA 2W4DA 1KEKA 2RKIB 2ZWPA 3TR5A 1QSLA 3GWCA 4CTAA 5CA5A 1HWIA 4OIXA 1AB8A 1HNWJ 2JL9A 3OJUA 5L1IA 1JK9B 3ENAA 2FVRA 3C66A 5H9EJ 3O5TB 5BYRA 2FGOA 2BE2B 1N33J 4RNOA 1W2IA 4DFJA 4ECRA 3B54A 2EG1A 1RCOB 2Z56B 4HLBA 4DSLA 5H9FK 3MCSA 4ZS6A 5FD1A 2ZUGA 2E1RA 3BB5A 2ZFHA 2HGLA 1Q53A 1JLQB 2AYEA 2WW4A 2X1BA 3DMJB 2E29A 1S4EA 4N47A 1TKDA 2QO3A 4MFBB 3CB4A 3I4PA 5J1EB 3RBEA 2ZVSA 1KQGB 4AFFA 1WDTA 5KFCA 4QWCA 4O3QA 1C1BB 4USVA 3VGTA 2OD4A 2L41A 3TUZC 2UUAJ 1E6YA 4FYVB 5HVHA 4B3MF 4MIBA 3DXSX 1SC6A 5DG7A 4X4OA 1VMBA 2XGQA 3DU6A 1EKSA 1WWHA 4NA3A 1TVRA 4ES1A 5ETMA 2DGSA 2JHEA 4KHPJ 2IMWP 4ZPTR 2MZQA 3LP0A 3K5OA 1VHIA 2MKJA 2QL7B 1MSWD 2V9WA 3C3LA 1N6QA 5KFLA 1BQXA 4PWDA 2IJRA 2XB2D 2RJZA 4WWSA 3NCRA 2W2QP 2XMUA 5IWAJ 1P8GA 2V8VA 2HHVA 3VTIA 4IOBA 3T19A 5AT1B 2R7OA 4KH0B 4X4SA 4LRBA 4F4KA 1FJCA 3I0SA 4QIVA 3FJ2A 3I5AA 4NPOA 2AJ0A 4TQSA 1LK7A 5KFEA 2XLJA 1X4FA 3EDRB 3PTWA 1H98A 4BC9A 3EUNA 4CO5A 3W3SA 3IR7B 4LFAF 2PFFB 4H4KA 2ADCA 1Y5LB 1AYEA 5T14A 1WG4A 4HT7A 2LEPA 2G2ZA 2XQCA 4KBIA 5LJ5Y 1JKHA 4OYIA 3LP2A 1HNWF 5AE1A 4HL9A 4GVBA 3N28A 1UEUA 4EBEA 2IMOA 2YQ3A 2RQ4A 1JXEA 2Q6CA 4YDXA 2AMCB 2ROEA 1RHKB 5KT2A 5GAEU 3CPWR 1PYOB 3M32B 3JAMY 2MQPA 5D15A 4ECYA 1N33F 2J9DA 2HMIA 2BVZA 4ED0A 4OV6A 3HPOA 5FDLA 4J37A 2AD9A 1RKIA 3L4BC 3NY0A 3R5BA 3MEGB 2YKQA 4M5DA 1LWXA 4WF9Q 4KPYA 3W66A 3JSBA 2KT3A 2CQDA 3MOJB 2UUAF 5HLFA 3MD1A 5HO4A 1C0TB 1N34F 2W4PA 4DL6A 1IWAA 4C3KA 1B7YB 2F3JA 2AEJA 3T41A 2L9DA 1VISA 3D5MA 5DRKA 4WBFA 3HHLC 4UQGA 3AXKA 2C3MA 2D3UA 4C11B 2DNYA 4RW6A 2MGZA 1N4LA 3TZWA 3LP1A 5A2QU 2EC2A 3ZC4A 2W8LA 1RYRA 1H74A 4EO8A 2WVCA 4Y00A 2YNIB 2EK6A 2XI2A 3QJJA 1RA7A 3IG1A 2CZ9A 1X5OA 3MI7X 4KAIA 4KSEB 3B6BA 2IM0A 4LSLB 3WQPA 3LO3A 5A8RA 2ZBPA 3HVTA 2J6UA 4DV6J 3H59A 2OELA 3I0RA 1EP4B 1CPZA 2CPYA 2BZ2A 1RT3B 5DLFA 3BV8A 2MZRA 3AY0A 1N56A 4L76A 3AQPA 1K9MT 4RUCA 4OFZA 1SJ3P 4J9PA 2JOQA 1FNOA 4LIRA 1A7GE 5CD4H 5E0OA 3BSOA 4IDKB 4F2SA 4ED6A 4NI2B 4NZ6A 2LA6A 3RAXA 3A12A 4WZMA 2PDAA 4ED3A 3AD7C 2ASDA 4LF2A 3EXYA 2FLNA 2WSCC 4OHWA 1REVB 4P9SA 1N5QA 4NOHA 4Q2LA 2R8HA 2HEKA 3CCRS 3OSPA 3PX6A 3RAQA 4DN9A 4CNYA 2J6SA 1VLOA 4MMOA 4A48A 3W5YA 1KHWA 1XK8A 3TA1A 1KVKA 2YWFA 7FDRA 4L3KA 9ATCB 4J9LA 4GO5X 2MQOA 2MQ8A 4DHVA 4NLSA 5E2QA 4F4WA 3G6ES 4ED1A 1MMLA 2PA3A 2GA7A 1YJTA 3DU5A 1XBWA 3PV8A 1XC9A 2OPSA 3OFHA 2ZH4A 1L3VA 3G6YA 1UL3A 3GYGA 5EWGA 3R2DJ 5E41A 3VAMA 1Q82T 5GAHI 2DEJA 3TRGA 2K3KA 3ENWA 2LU1A 5T7LA 5D0HA 1PG5B 3QIPB 1FRLA 3BN7A 1HWUA 3SSRA 2XYHB 3KDOA 4FN5A 3HHLD 1FDNA 2UUTA 2DNRA 2ZC4A 1XERA 4YOEA 4OI0A 2DGQA 3ONQA 3FRYA 4QR1A 3KLIA 1NPPA 4J9VA 3MM8B 4C98A 1U0HA 1D0EA 3PO5A 4B9UA 1IN0A 3CD0A 4HVZA 4DV6F 4F0MA 1YZ6A 4EYIB 3AHPA 3RGIA 1U25A 3BBBA 2CKWA 3HFKA 1YQHA 2V4JA 3R7NB 4HHJA 4KYZA 1I5OB 3VVUA 4U7CA 3NAIA 3U7JA 1D1UA 2YWWA 5ETSA 3D1HA 2YX7A 4PQUA 4AT1B 2BE9B 4J90A 1NH8A 5H9EK 2VC0A 3L7PA 5SZTA 3HX9A 2HVIA 2QEXS 5EN1A 2HSEB 3MHYA 1RWVB 3BGUA 4C0BA 3RTVA 1EJ7L 2Z58B 3NP5A 3KG1A 3PO4A 3ISZA 2UU9J 1DTTA 5IQQA 2QMUB 4A4JA 3PJ9A 1HNVA 1VQOS 3MPWA 3OQ2A 2NXNA 1PJ5A 2D3ZA 4LBIA 5ETTA 1HD1A 1NPKA 1JLEA 2QV6A 3FSYA 3QGPA 1Q1KA 2DEIA 5K8OA 4F0KA 1O6XA 2IA6A 2KTQA 2BRLA 2HVEA 2VG6B 2ZD1B 2KVIA 3HSDA 3SV3A 4AXJA 2RILA 4D3GA 3ZFVA 2VKZG 4LRAA 3W9JA 2U1AA 1UWBB 2QRRA 3TYTA 2FJEB 4ECZA 1Z2LA 1ZM9A 1U1LA 3W2WA 2PEHA 2ACYA 1FDBA 2HQCA 5D4NA 3D6FB 4CH1A 2OFGX 4IR9A 2V68A 1S9FA 2D1CA 1UJ6A 2IY5B 3CCES 2E5LJ 4JI3F 1NK0A 1N0UA 2WVBA 2XS5A 3GJRB 1XJWB 3RBZA 1S0NA 5B0GA 1Y3KA 5L46A 3FMWA 1JNRB 1FRKA 1HA1A 4CZCA 2HNZA 3N6LA 4B9MA 3SV4A 2F63A 2HVZA 1JLCA 5KTQA 1NNDA 3UN5A 3LAKA 5KFFA 2ADBA 4GKKJ 5CD4A 1RTDB 3KHGA 5EGYA 2RDJA 4XDDA 2DCLA 5J2NA 3D3BJ 3OL8A 3UCGA 4ZPCA 1TV6A 3Q89A 1BY9A 2HAFA 3TUJC 4IH6A 4I0WA 2QGFB 1ZPVA 1KQKA 1R7IA 5C25B 4NLVA 5F8MA 2H5JB 1YZ7A 1RQ0A 2VQEJ 1I94F 2ZHAA 1IQTA 2IVYA 3BSNA 3R8YA 2I2YA 1RP5A 2NXUA 4NE9C 4OZ1A 2UU9F 2ATCB 4KH1B 3GV5B 3QJPA 3NRBA 3KJQB 3BH7B 3MR5A 2A2DA 3C14B 4KO0B 5HQ8A 3N4WA 2HBRB 5CYQA 1VYAA 5IT4A 1CS4B 1SJRA 3DOMA 2JNJA 3W9IA 2FJWA 3MMCB 1HQUB 4DR5J 4ED5A 4KKOB 2X3GA 4N77A 4W92B 4RL1A 4H4KC 4USWA 3UR3C 2XCAA 5KG3A 5F8GA 3TP2A 3HP6A 1NLKL 2BX6A 4WU3A 2YNGA 1ZOTA 1R8PA 4RX6A 2LFVA 4A8OA 2JWNA 5HSPA 2BM1A 2A0FB 2FGCA 3MDFA 4B3SJ 3NMRA 2E5LF 1HW8A 4LVNP 4M5KA 4OYPA 4A8XA 3CMAS 1TL1A 4UW2A 4XAKA 2XC9A 1HR0F 4EUVA 3VQSA 3HSZA 4P52A 3QO9A 1R31A 4LBPA 1OY6A 3V6JA 3LGMA 3F56A 2EXUA 2XY5A 1S6PB 1FRXA 4QBUA 4HH1A 3S8SA 4GKKF 4NASA 5D4LA 4ED7A 3AA8A 2DHAA 3LH2S 1SL0A 1LWEB 1A6LA 3D4JA 4RPFA 1FEEA 3OW2R 3PW2A 1ZAVA 1WHWA 3CO9A 3Q24A 2LXFA 4LMZA 2ZJPQ 4O3RA 1OWXA 1ZBTA 3M2UB 5GMDA 4BDPA 1LOUA 2N4DA 4ZK7M 5J2QA 5B0FA 3T5LA 2AHOB 3F41A 1XNRJ 2VQEF 3HLUA 3BEGB 4ZVGA 3G8TA 2E1AA 5BXIA 4EZ6A 3A3PB 4IH7A 5J1PA 1BGXT 4OZNA 4YB5A 1Q8BA 2QA2A 4LRFA 2UXCJ 4DPYA 3KHHA 1LW0B 4I7FA 1S9EA 3OR1A 2EFOA 4BC7A 3I9ZA 2M7SA 2YKAA 2XY7A 1EARA 3D3CJ 1BMQB 2DR6A 1R0CB 1FKAF 3FEYB 2C3YA 4JI7J 4NA1A 4UZCA 3ILOA 1TMMA 3BO4A 4DR5F 4Z2XA 5FIIA 4UOCA 3DGPA 2K2PA 1S9GA 4AQYJ 3ZTQA 3KLHA 1VRQC 1IR0A 3GCWP 1HBMA 2AW0A 1ZTWA 2MHNA 3PG9A 2CNLB 1HNXF 2DH9A 4QWBA 1ZTTA 2C1EB 2MJNA 1K1SA 1RT6B 3KUEA 1UVIA 2HRUA 3RRKA 3N0VA 2QLXA 1FFGB 3DOKA 3J81j 1MMNA 4B3SF 2HS0A 2KU7A 4IFVA 2HK2A 4LUBA 1XR7A 1IWGA 2CNOB 4DSFA 1VJQA 2BOAA 2UUBJ 3CDEA 1YRTA 4ZJQA 5CCLA 1FXLA 4I6AA 1R8AA 2MY8A 3W7BA 1VQ7S 3IO1A 1T95A 1LW2A 3L95X 4Z37A 2V8PA 4LFBJ 1I1GA 2J8SA 2VOPA 4ZPBA 4EK2A 2D41A 1GFWB 1SJ1A 1IJEB 4NRTA 4OYAA 5C5JA 2CPIA 1X4CA 4OV1A 1KOOA 2AEFA 2V6AA 4J9MA 1KP6A 2B43A 2FTRA 1XNRF 1HL6A 4LREA 4TQRA 2MSTA 1XQIA 1RT5A 1HQEB 3TA2A 4ILRA 3CEDA 4MIWA 1RU1A 4GVBB 1RKJA 4F50A 3W8PA 1VGYA 1NK6A 4ZVPB 1S7IA 4J9UE 3BYPA 1WELA 2JEGA 2HMIB 3IRWP 2FVSA 2DK2A 1F2HA 3M9NB 3OBIA 5M2RA 5ETLA 3OLAA 4JI0J 2HHXA 2LP4A 2NREA 1T9WA 4FVCA 4AYBD 4Y2AA 2NUHA 4K2XA 1GNKA 1S77D 4M5DB 4AQYF 1JLBB 3QRPA 3AJDA 1ZETA 5AXKA 4OI3A 1P27B 2VFVA 4ES2A 4ZLLA 2QLFB 1WKJA 2FZGB 2WONB 5LMNF 4RKUC 3SQGA 1U4BA 1VC0A 1CLFA 2AJFE 2VG7A 2EWHA 3IS9A 3JQJA 2R7QA 3ILIA 3NG8A 3PFOA 3C6UA 1KONA 1WOOA 2HVDA 4OHYA 1CULB 2J76E 4KY3A 5JJBA 2WVDA 3MUMP 1B4SA 2QFJA 3DDNA 1S57A 3F0NA 2UZAA 3AOCA 2UUBF 1ITPA 2CQ2A 4RUAA 3S6EA 3BZQA 2QA4S 1TKZB 1FRJA 3MPDA 2HNYB 4OYWA 4OYZA 2A3JA 2YKMB 2BDPA 2AQ4A 4OHXA 3HVTB 4ZLPA 1NKEA 4OI6A 1YRUA 3I0RB 3N01A 2DNOA 4C8LA 3QMQA 3W61A 1EETB 3GLJA 3W62A 3NMAA 4X4TA 3MMAA 4K2JA 4NYOA 4F4ZA 5F8IA 3RW7A 2WHOA 1RHJB 2CUYA 2AP6A 4CT8A 2W24A 3GYNA 3L7OA 4DV3J 4BWJA 3R7BB 3TVZA 1XMQF 2V2QA 4DI6A 2D69A 3E01B 2GVZA 4KGZB 2DITA 2KG1A 1M5SA 3JQKA 2RB7A 5LOQA 1XMOF 4C9DA 2OO4A 4K4XA 3GFHA 3LTOA 2FHOB 4QW8A 4DL7A 4HI1A 4I68A 2OPRB 3QPIA 3DDKA 5LXYA 1LFPA 5DM7Q 1U09A 3MR2A 1YJRA 1X9SA 3LUYA 3THTA 3HULA 5IT9U 1JXLA 4ZP7A 4N56A 1SB6A 2C2DA 5A2QY 4KQZA 2VQFF 1IXKA 4X62J 3AA9A 5GAEI 2XTJP 5F41A 3KK1B 1VQ8S 3HHNB 5KFBA 5K14A 5T7LB 3TAQA 1Y9OA 1F5BA 2W2OP 3GE9A 3S01A 2KVQE 5ETKA 4LVOP 1EQMA 1L3KA 3DRSA 3Q8PB 4IR1A 4PYDA 2FVCA 1HHQA 3CT9A 1G6BA 2BABA 1S5ZA 5AXMA 4DR3F 4MKBA 1ZZFA 3KLIB 1I6JA 1U0HB 4DUTA 1Q7LB 4IKAA 4O44B 2B51A 3OVSA 4Y0FA 2FB0A 5B0CA 5FLXU 1ZM3A 3TVYA 2A1BA 2X7IA 1FT8A 3M2RA 1JLFB 2R9LA 2J9CA 1VBYA 2D9PA 3SIPB 1LXNA 3M8WA 1K0VA 1WC3A 2R7VA 1UVJA 4WP3A 3BKTA 1S49A 2YH1A 1M1HA 4O23A 1T05A 2FY1A 3AJ2A 3HI9A 2F7VA 3PM9A 4DR4F 2B5JA 4LF4F 2L3MA 1A0OB 4OHZA 1SV5A 1B3TA 3HT0A 3HHDA 2R8GA 4WE1B 2BJ7A 4UTGA 4RW8A 1NHUA 5E33A 5IS2A 3FVYA 2MLXA 1TP7A 4ZITA 1EB0A 3DI6B 1NAQA 5GAGU 3ISNC 3AOAA 3GFZA 1V3SA 1FKPB 4ZVQB 2AJ1A 4IRDA 1VJWA 2E1MC 2HBQB 1S79A 1SKWA 1D9DA 3CJ4A 4CYUB 4LT6A 5EWFA 1OSDA 1TZ0A 5D0EA 4X62F 1PBUA 1SC4B 4CLTA 4L3NA 1RT2B 3GR0A 2PGCA 5CH7B 1LV5A 4QCLA 3PZPA 2BJEA 3VVTA 2ZZNA 1FA0A 2M0GB 1NSAA 4F36A 3WC0A 3KLEB 4K59A 4W4MA 2BJDA 4YR2A 5I42A 5A8KA 1VIXA 4DXLA 2YWEA 1A9NB 4DF8A 2YQ1A 3MECA 1QSYA 2XWXA 3VV2B 2AJ2A 3A3OB 3TI0A 2XSFA 5A6PA 2OLWA 5EHHA 2WSEC 3DLEB 2HHTA 3MCNA 1CJKB 3GSIA 3HHEA 4DPXA 3IGNA 1KTQA 2R42A 3NL0A 1VQ6S 2JEFA 1S6OA 2QSWA 3QGIA 2MQQA 1P9QC 1FCAA 1U48A 3NGUA 3TZXA 3F73A 3SEOA 4Y2MA 4ZPVR 4CWBA 4PR6A 2EEYA 1EIYB 5B0DA 4ETZA 4WFAQ 1F3VA 4M5HA 4DR6J 2PD1A 2WK4A 3CCZA 1TUGB 2MZTA 4M63A 3EGNA 2N3LA 1Q8KA 2AWZA 3QT8A 2FDNA 3R97A 3D0IE 4M5NA 1U1OA 1N36J 1BQNA 1FK9A 3QZ8A 2RF2A 2BKPA 8AT1B 1WHYA 4NLUA 1X60A 2B4VA 3VQTA 3AH6A 1ZAWA 2ZM6F 2K1RB 5C2GA 2IDLA 2FQQB 1DAXA 1UFWA 2D3O1 1YIJS 5ETRA 3CJKB 2VUGA 3D9BA 1FX4A 2YPZA 3PIPQ 2ZE2B 3KG0A 4LR7A 3ISND 3MEDA 1C4CA 3UW1A 4XK8C 2CWXA 3QSIA 1NKBA 5B08A 5CQGA 5IV3A 2CPXA 3P45B 4C4WA 3DLGB 1BWEA 3MMBA 2Y0BB 2VPWB 2YKNB 2W9CA 4KHMA 3ZZUA 4E8UA 2YNGB 2M88A 1C4AA 2V4QA 2H48B 3TW0A 2RT3A 1YK9A 2ZOGA 2I8EA 4M95A 1U1NA 2P9EA 4LFCJ 1Q4RA 3LGNA 3KLFA 2IM2A 3T1HF 3WZ0A 1MWYA 3QFWA 4J9SA 3G87A 3SSQA 4DEZA 2MKIA 2NYIA 3QO9B 2PIIA 3HKZD 2RKIA 3FFIA 3KTQA 1UCNA 2BOPA 4MJKA 1N52B 2I5JB 1S1WB 4NLRA 4ZJOA 2GQCA 2KJWA 5CYMB 2C2EA 4PG6A 1GK8A 5F0UA 1GX6A 3OUYB 2AX0A 2ABYA 1WOPA 4MAKA 3K8VA 4DV5J 1WC6A 1IKYB 2BE2A 1UZDA 1UPMB 3GR1A 1T02A 2MKYA 2AGOA 4NXMJ 1VBXA 4OJ1A 2M9KA 3UCZP 3N79A 4F7VA 2RNEA 1HNZJ 3DMJA 1N36F 2MKKA 3OHBA 2E9ZA 2P9GA 4PWUA 4CCHA 3KLGB 4MFBA 1LFWA 5LMUJ 3QWUA 5J1EA 1QE1B 5K9FA 1S1UB 4PPZA 2ZH3A 2Z0GA 4RJVA 4DMZA 1IKXA 3OR1B 1RISA 1GMWA 4UOFA 3GU0A 3KJVB 2EFPA 3EVMA 2CYYA 2I38A 2XEXA 2KL8A 2DXDA 3TARA 4LSNB 3EX7B 2XZDB 3A3NB 1GQEA 1UW9A 3D68A 3KUHA 3CJ5A 3G82B 3O2IA 5C7PA 4A8WA 3CDWA 3RJMB 3KLHB 2V4RA 4DR7J 5HMZA 2Z30B 2IBOA 1H2VZ 4KE5A 2XMKA 4O4GB 4WP8A 2C2KB 2ZKTA 3VAGA 3KXDA 5D77A 3CJQA 4UUWA 4X64F 3POTB 2RU3A 3BR8A 1RHRB 3ZZ0A 4FKYA 1CJTB 2ILZA 3DOKB 5HJYA 3J81Y 1QUPA 5E3CA 4B9LA 4K5SA 3JTNA 2HAIA 4IFVB 4NYPA 3M8ZA 5DDQC 1YLXA 1QAXA 1IR2A 2RUGA 4MKVA 3UNYA 4MIAA 3Q8UA 3W63A 1KN6A 2G1HA 2HVHA 1HI0P 2H5EA 3NGRA 3V6HA 3C15B 3SQOP 4URGA 4QYZJ 2JVOA 3WBZA 5ETNA 3N5BA 2U2FA 1WSRA 1ZAXA 4DV5F 3JSMB 1GEHA 3ET6B 4PXCA 3M32A 3EXCX 3D1OA 3PX4A 5IT0A 2D3OR 2B6AB 3THVA 2GQQA 3O1LA 1NK4A 1JB0C 2OSQA 2JVRA 3MPYA 3MEGA 1X4GA 1Z1ZA 4P2SA 2ZNZA 4ZVTB 3AAWB 1SC3B 1SQEA 2Z8QA 2KFYA 4HKQA 4K4VA 1V5VA 1C0TA 1RE1B 2YNHB 1SCJB 4JI8J 3FMBA 3CCQS 4RNMA 4O0IA 2IBKA 5I4MA 2HFVA 2ZHBA 4NLDA 3AXMA 3B8HA 1VIOA 4C11A 3PHEA 4DCPB 2ZZTA 2KDOA 3FNNA 7AT1B 1YJUA 1UVMA 4FS1A 4WTYA 5DETA 2KZZA 3GP9A 2HWHA 4OYMA 2DTJA 3OL9A 4PKDB 3D67A 4YB7A 1OPIA 3D6MB 1UVLA 3DN9A 2VFSA 3SFGA 2BBEA 1OQ6A 3DOLB 5AXLA 4WXOA 1H2TZ 5HK4A 4LJMA 4OZJA 3C6UB 4DV7J 4WFBQ 4MK8A 2DXEA 4YHHJ 4K4TA 3O44A 1U1QA 3PNIA 2V67A 1EP4A 4Y2CA 2HFNA 1RT3A 3CULA 3MURP 3CIMA 1OIAA 1FVQA 2HYIB 4DSEA 3AOBA 3GSDA 5JUMA 1FVSA 1RT7B 4W98A 3PY8A 4IDKA 5KFAA 2JX2A 4QU7A 4NI2A 1F1BB 2VOOA 2CQPA 1EHWA 1M5VC 2HNDA 4C2MA 3MM7A 5KOWA 2UVUA 3G8SA 4ZCKA 3MAHA 2DH8A 3PJXA 4IRCA 2IVMA 1K0TA 1HD0A 5DDOC 1NDPA 2XM3A 5L39A 3WIUA 1RGVA 4FKXA 1K8AT 1XMBA 3DDIA 3PKYA 2QL5B 1TL7B 2W2NP 1HWLA 3PIOQ 5H9FJ 3HFVA 2XO7A 1HBNA 2GVZB 3ZZYA 5EWEA 4JI8F 4IG0B 2R2UA 4RNNA 4E98A 3RYLA 3M8QB 4JYAJ 2ZNYA 3FBBA 3GIRA 3QBCA 4IOAQ 3EVOA 5F3ZA 4JV0A 1X8DA 2YKPA 4KTQA 2JJ4D 4ZIVA 4NZ7A 3PJWA 3ETOA 3QIPA 2IHR1 4FXVA 5IC6B 4YUDA 4UT4A 3FZBA 2E5HA 1WEYA 4AD6A 4JI5F 4ECXA 1QVFR 3WX4A 1CBKA 1ZM4A 4KV8B 3MZIA 2HS3A 2FYXA 4IQMA 5KG7A 1VQMS 1QAIA 2D9OA 4DV7F 1X9WA 4ECTA 2XMVA 4H4OB 4YHHF 2M5YA 2DIUA 3BBFA 2Q66A 4ANCA 4EO6A 4PRFA 2LLZA 5J1NA 3W2VB 2MLYA 4EEYA 3FUYA 2DPJA 3IRXB 4F2RA 2FZCB 1T9VA 2K3IA 3H5UA 4F4AA 3HXMA 4ZPDA 2ATLA 1VR6A 2KO1A 4KGXB 1M5OC 5CXTA 1S4FA 3O8WA 1UMJA 4C8NA 1K44A 2UUCJ 2PN6A 1S0VA 3OXLA 5CYJA 4WU2A 1VK8A 2DGVA 2AGQA 2MEWA 2B3TB 4PUOB 5E3RA 1E6VB 3M2RB 2ASJA 1YX2A 1U6ZA 1GXLA 1CJVB 3ZXWA 1T9YA 2W7PA 5IFMA 3BGOP 5KFIA 1HPZB 1X4AA 1FD2A 5DZ7A 2V9KA 1RZMA 3MOZA 4Q7AA 2V8DA 4TY8B 3SSSA 3MCOA 1NBEB 3VALA 1WTBA 4RUHA 5HQLA 3BQ0A 5KFHA 3DLBA 2VG6A 3CD5A 3I4HX 2X1AA 3OSNA 3SI8A 4JYAF 2JFDA 4V19X 4RO0A 2FJVA 5LXRA 2I0XA 2BW7A 3QATA 4R5PB 2MYFA 3CJ3A 4FPRA 1Q5VA 1UWBA 1N88A 1R0BG 3Q8SB 2IRXA 1BD6A 4ZA1A 2DNLA 4LF9F 2QJ3A 3W5ZA 2WBMA 3CCSS 5BYSA 3H98A 4ZOSA 2CQGA 2CVIA 3FBEA 2K06A 1HLWA 1HYSB 4DL0C 2RU9A 4DBQA 2P6TA 5KFVA 3KMQA 1WOSA 2KFNA 3DCAA 4P7VA 4MYTA 1RBLA 1M90T 4ICLB 2RDIA 3TQ1A 1XR6A 1K47A 3FK4A 2CPDA 1DTQB 4WJBA 1IBMF 5EDWA 1PYTA 5FLXY 3R7SB 4IUFA 1RTDA 2VD3A 3CJRA 1ZZNA 3MECB 3CW2C 4G1QB 3CJ2A 3HSGA 2ZBRA 3L9ZA 2NZ4A 2J8AA 4DL3A 3KKFA 2UUCF 2V2KA 5C25A 4UQTA 3PACA 4G6VB 2MZ1A 1VCTA 2N7YA 1MN7A 2CQ1A 1DLOA 1F9FA 2CQIA 4O0NA 5JVGQ 3H2UB 4O4RA 1TTHB 3F44A 2B4PA 4DF4A 1WTFA 4DU8A 3H8YA 2BXJA 5D3GB 4ID5B 4GC7A 3I82A 1D9AA 1Z4UA 2LQBA 4YMEA 1NEEA 4KO0A 2IJFA 3J7Z5 2ZOFA 3GCXP 3AJ1A 4FXWA 4FYXB 4O3SA 3JSYA 2FLLA 1CS4A 5KFGA 5KG5A 2V5HG 3NCPA 1R8BA 2RE1A 2CJKA 4MT1A 4ZVUB 3N5FA 3MMCA 4ZP9A 2OHDA 1HQUA 1RWOB 3PRVA 1BQNB 1OS5A 3UN3A 2ACMA 2HZVA 4KKOA 2JDJA 3DC2A 1J5EJ 2ROGA 4HACB 4HI2A 4TXSA 4L72B 3DYAA 3M8PB 1YJWS 3A13A 3H40A 4ZVRB 1Y5NB 2HHHJ 4IFYB 3IWXA 3LF0A 4ZCMA 4NEYA 4Q43A 4B3RF 3MEDB 1R8HA 3VGVA 2OJ3A 4PAAA 5KT3A 1V5IB 4RW4B 3MR3A 1GXUA 1T3NA 4QIWD 3NXZA 3MMBB 4X4VA 4BS2A 2GIRA 4DPOA 1VDHA 2W9BB 2F40A 3QLHA 5DDRC 4QPXA 3A8JA 1OY8A 1REGX 3MF5A 2CPFA 3M30B 1LK5A 5GAGI 2MZSA 3VGSA 1QJHA 2DY9A 5F8HA 3IBFB 2ZJRQ 5KFNA 3H4BA 1IM4A 4WKYA 4E0DA 1D8ZA 4OZ3A 3NWRA 3QAEA 2YX4A 4I64A 2IFXA 4DR1F 2G1DA 4NX9A 2EK1A 1JNZB 3QRQA 3M2UA 3BKUA 4LFAJ 2DNZA 1RAOA 1KRPA 3U27A 2V63A 1L3UA 3PVXA 1M5HA 3G71S 3FFIB 4NMLA 1C1CA 4ECQA 4CLKA 1GMWD 3HO1A 1HI1A 4MK9A 2CJBA 1RAEB 4ATNA 1M1KT 1NCLA 1RT1B 3OV7A 3J80U 3BGLA 3JTPA 2OMOA 4NLGA 1TELA 4Q44A 3WIVA 1LW0A 2MSSA 3KOAA 4ZIWA 1Y4ZB 1TKXB 4LF6J 3QYYA 1NXIA 3U1MA 1HBUA 2P8IA 4DJBA 1RABB 2IYGA 3UN2A 3R27A 4HYKA 4ERDA 2J5AA 2DHXA 3AODA 1FRIA 1S1VB 2WVEA 2HFSA 4QJVA 4HHHA 5F9NA 3BBCA 4JOUA 1J5EF 1U2CA 3SCIE 4CQ1A 4JBCA 1N34J 1IKXB 1RT6A 2J7UA 2QA4G 2Z2ZA 2QTWA 3SCLE 2UVRA 3CD6S 3Q8YA 1U6BA 3K57A 2KRRA 2HHHF 4J9NA 3EGZA 1W26A 1CVJA 2HWTA 1JJHA 1S1XB 2GZOA 2UP1A 1QTNB 4W90B 2VDIA 5C2CA 5E7OB 3RB3A 3PYEA 2MQNA 2ROPA 4OJ3A 4P10A 3SCJE 1Q8LA 2GGPB 5HBMB 1YBAA 1QM9A 4CO4A 1TK0A 2GC8A 4N41A 2IIHA 4IRKA 4DV4J 3QNWB 1FO1A 3NOCA 4U8YA 4YEAA 2LU2A 1KSPA 2HHQA 4G1IA 4DG1B 4OX9F 3IR6B 1B7FA 1AFJA 3GV7B 5G0RB 1DQ9A 2HQIA 2VICA 1RUSA 1FJGJ 2HWIA 1OY9A 3P3DA 4NLWA 1SKRA 2HHPA 2CADA 2V69A 1URNA 1HQEA 4PG5A 1X4DA 4EI2A 2B56A 5IV4A 4CLYA 1VQLS 5D6GA 2MZJA 3MFIA 3S1TA 1PJ6A 5LL6d 2V8HA 1PO6A 3UD3P 4YS2A 2WBRA 3BQ2A 4DQPA 3CWJA 3MEEA 3FBFA 4LIWA 4LF6F 1P6TA 3MD3A 3PEJA 1SUQA 1IBCB 1RLCL 4Q2MA 1Y3JA 3OL7A 2ILYA 2EFNA 2NSCA 2GMLA 3RW6A 3M8YA 1JLBA 2IRUA 2GV1A 3GILA 2I1RA 1O51A 2QIFA 4CLWA 1W2BR 1NPRA 2WONA 1GMVA 1KLNA 2XBPA 1NHVA 4B9NA 4DR2F 1S48A 3UDVA 3P96A 4HTIA 2KKHA 1CULA 1Y0HA 3OVAA 2UV8A 4F02A 1TAUA 1FJEB 3HF5A 2GX8A 1PC5A 1NJIT 4FDFA 5KFMA 2ZUAA 5C42B 6FDRA 2CZVC 4X4QA 2QZ8A 3CCJS 3R5AA 4DPWA 2R3VA 4I69A 1KD1T 4EU0A 1TKZA 1IM6A 2RD5C 3IAS9 2HNYA 3HHKA 2Y9HA 2GHVC 1VRUB 4DV4F 2KXFA 2YBVA 2YKMA 4OZ2A 4CT9A 4P75A 2LEAA 3CNQP 2CQBA 1D9FA 4ZVFA 1GXTA 4QIGA 1QTMA 4CO2A 3FDSA 3V4IB 2DNKA 3W60A 4OI4A 1VC5A 1TKTB 4WP9A 1B0PA 2UV8G 1EETA 2MLZA 2YWGA 3HJVA 1T7PA 3BN4A 3EM1A 2VONA 1FJGF 1RXOB 5DO2A 4J9RA 2EBGA 3W1YC 3VF0B 4OX7A 1FTCA 4I2QB 4ZJLA 4Z7CA 4F3OA 1WNEA 2DT9A 2XS2A 1RAAB 2APOA 3MAAB 1WC5A 3TAMB 2ZH9A 2BMBA 1C2PA 4USTA 3UCUP 2FUG9 2LDYA 3K7RA 2QN6B 3KLVA 3BPDA 3MUTP 2HNDB 3MM7B 3E01A 4F0HA 1UWAA 3QWPA 3R5CA 4OI1A 2FHKA 1WF1A 3GMGA 5KT5A 1LQ9A 5HP1B 3OL6A 4DQIA 4HDGA 4U8VA 4CO3A 2G0JA 5D78A 5CZXA 4DFMA 1MW7A 1MWZA 3PR5B 2GMJA 4DL4A 2Z57B 1RDRA 2QFIA 2ZVIA 3OTBA 3UDLA 2OPRA 5DQGA 5GMEA 2LCWA 2YX1A 5J2PB 1NJWA 1M0SA 1HBNB 1S6QB 2DXFA 2E1CA 4NMXA 5IM0B 4UF4A 1R89A 1RTHB 3RRGA 3KUGA 3T1AA 2H5IB 4DS4A 2NLWA 1HBOB 1U2RA 3KK1A 2HW3A 2OTJS 2L08A 3AB4B 2HQGA 4P2MA 2R8JA 1OO0B 3DLKB 3M2VB 1N54B 3EZ5A 2DISA 4DN0A 2GS8A 1YG0A 7FD1A 3BH6B 2DD8S 2Y1LB 4JI3J 3FCHA 1VK3A 4RW7A 2GJIA 1IQZA 2AGPA 2XLIA 4F3QA 4O44A 5HQMA 2FJBB 3I56S 1FTRA 1T0TV 4B17A 2GFFA 4NCGB 1U47A 3R3TA 1JLFA 4QWEA 4AL5A 2YH0A 1N48A 2I6WA 2AF6A 5MAOA 2PA8D 2B4UA 2VG5B 1RU2A 3GYXB 3FGVA 4ANDA 3RAMA 4C8MA 2IAJA 2BM0A 5K8MA 1BE4A 2DR9A 1F5CA 1ULRA 1I94J 3JSRA 2POKA 1JX4A 4BLGA 3SCKE 2MPUA 2YWKA 2WB1D 5K20B 1SIWB 4WE1A 4GO7X 1PAUB 2R2SA 4KGKA 2ZITA 4U67Q 1N0VC 3H5YA 3DI6A 1Q8IA 2RVJA 2GAGC 3BPSP 1FKPA 3M9MB 4DUYJ 2FHJA 1Y11A 2M8HA 4TKTA 3FCWA 1AUDA 4CYUA 2VF3A 3H4DA 3BO3A 5F3TA 2AYBA 1SC1B 2IDEA 3QT6A 2XS7A 4USHA 1RT2A 5F9LA 3CXCR 2WOMB 1WORA 3MEKA 3UDEA 3H2VE 3TO8A 2XGPA 3ZNUA 2ZWOA 2HBZB 4NLYA 4F26A 2F65A 3R6GB 4CLFA 3KLEA 2IYIA 1PC4A 1NMEB 3QT7A 5U47A 3BS9A 3FZ2A 3RZAA 4DCOB 2IM3A 4J9OA 4JI4F 4NLTA 1RTZA 3OVBA 2P2CB 3OXFA 2BANB 1RTIB 2O01C 1TUWA 4RNFA 4WK1A 1SVDA 2CQCA 2QMXA 1UVKA 3UR0A 3VR1A 3RBXA 4ELVA 1HNIB 1HR0J 9RUBA 4NLOA 3DLEA 3LANA 1CJKA 4A8FA 1RWNB 2K8GA 2R7SA 1RT4B 4NXNJ 1U2FA 3R2CJ 2Q6BA 3I87A 5K8PA 1H3DA 1HMVB 1KS2A 3UI3A 1WDDA 4JI2F 2EC0A 1U8SA 3Q83A 3DLLQ 3NBPB 1ACMB 4IG3B 5T41A 2LYVA 4B9TA 1SL1A 5LM7E 4KJIA 4ZLNA 5DS7A 2OPQB 4AL7A 5ADZA 3OTCA 2IA0A 3BDPA 3BQ1A 2W7OA 1PYSB 1FKOB 2H1YA 2RMLA 3AQOA 4PXEA 1DLOB 1VBKA 4DUZJ 3GB0A 3B82A 1V3RA 4X84A 5A8WB 1N5SA 1UA1A 4XPEA 3VHQA 1BQMB 2O5DA 2MTLA 5L1LA 4I2PA 4TU9A 3TNVA 2K1RA 3BO2A 3I5CA 5EUHA 2HZAA 3NOGA 1WI8A 5F8NA 4ZDNA 4DFKA 1WUUA 4DUYF 4WTOB 3CJKA 4MKAA 1FFSB 3CO0P 2VBYA 4CH0S 3HT3A 3FBCA 3MTKA 2ZE2A 3LOUA 4OHVA 4ECWA 4V19J 3WX8A 2DNQA 3T3FA 1WEXA 2NPFA 3DLGA 3D54A 1HNXJ 2HGNA 1F3FA 3C2PA 4KHRA 3T1YF 4P71A 4UY85 3OFEA 2YKNA 3QSYB 2VODA 4CP5A 1UEKA 3VAFA 3IBCB 1CC8A 3DYAB 3GONA 2DPIA 1NDKA 4FBUA 1OQ3A 2AZ1A 2LQ8A 3CC7S 4M5MA 2GHWA 3HDSA 2KN4A 1UJ5A 3OR2A 2UVWA 3CCWA 3U1NA 4USJC 2DVIA 1ICEB 2Y8YA 2E7VA 1I3OB 3M9OB 1OYEA 1FRMA 1U6FA 4CM0A 3PKMA 5DG9A 4NXNF 3QLHB 3J81U 1QY7A 3Q2SC 4DDFA 2HRTA 2NSBA 4M5JA 3PDNA 3B4MA 2I5JA 1WKKA 3T6BA 4C8KA 1S1WA 2XZWA 4K5RA 3A8IA 5CYMA 2RHSB 3OUYA 4QW9A 3LPEA 4QZVB 1IKYA 2A10A 1AT1B 3ENQA 3UQSA 3E3XA 1KC8T 2RS2A 3BKFA 3M6UA 2P9CA 3IM9A 1LWFB 1C1CB 4DUZF 1WJ9A 3Q8VA 4ED8A 4X4PA 2B8QA 1FEHA 3IBWA 3KLGA 1SPBP 2B9WA 1MU2A 4K8RA 1QE1A 3CCUS 4JI1F 2HLTA 1S1UA 1YJ9S 4NYZA 3KJVA 3D7SB 1JWWA 4ECSA 1JJ2R 1HBUB 3L3CA 2QT7A 2R7UA 1WSVA 1BLUA 4LSNA 1KTVA 1ELOA 4YP3A 5BJRA 3G82A 2GIFA 2R2RA 4TVAB 2PMWA 5DQIA 2FVQA 3CJ0A 3IP0A 4RW9A 1U1RA 4YFUA 1XR5A 2KYZA 3CCTA 4O4GA 3GZ7A 1Y5IB 1X4HA 1HWKA 5LMNJ 2V8GA 1TU0B 4C97A 1NJYA 1ZPWX 2ZHOA 2MQMA 3POTA 4C8OA 5KFOA 4CH7A 2QC3A 2CJYB 4FBTA 1CJTA 1B64A 3MM6B 2XULA 2GAHC 4Y28C 5F0WA 1GTHA 4PZVA 5KG6A 1YITS 1SH0A 1PKUA 2CJQA 3NNAA 5A76A 2ASYA 2V2VA 2IC3B 2DHGA 1N8RT 1JQGA 2C2NA 3EPGA 2Q79A 3M1VB 3NEKA 3ADAC 4Q0BB 1FFWB 3C15A 3MCMA 3ZTPA 1B99A 3PYDA 4QWDA 4C8YA 4K4UA 3JSMA 3J80Y 3DRRB 5I3PA 4K4YA 3R1LA 3ET6A 2CA9A 2F4VF 3IFEA 3PW0A 2B6AA 2L9WA 3BJYA 3OPKA 1YWXA 3JYTB 3KNGA 3GTYX 3BGRB 2CAJA 1JLAA 3R6LB 2DBBA 2IJNA 1BXNA 3LWLA 5CCMA 1XWLA 2VFUA 2GNKA 2Z2MA 1XMQJ 1F9HA 2YNHA 2LQJA 2X1GA 4F04B 3MEEB 2UVVA 4F4XA 1S0MA 5KFUA 4GC6A 1SUQB 1XMOJ 3OJSA 1Q78A 1WC0A 2OAUA 3N6NA 1JLGB 1S1TB 2Z4PA 4JI6F 5K5MA 3K17A 1IKWA 3R5DA 3HD2A 1D8YA 5HI7A 1DRZA 1GX5A 1UETA 1KOHA 4WYLA 3Q2TC 4K4ZA 3JTOA 4KRWA 2DKOB 1KVJA 1FF2A 2ZZMA 2C42A 4O3OA 1MG7A 3DOLA 2VQFJ 1NRKA 1RBOB 1T03B 3FEZA 2CIMA 3D28A 4DV1F 2VDHA 3OTOJ 2NZCA 3KFWX 1FXDA 4H4MB 3W5XA 1Q86T 2KXHA 3V5RA 1JJ4A 4B02A 4G65A 1T11A 4USKA 2MQLA 2BJ3A 2BW2A 5E3PA 2MMYA 2A6OA 4O3PA 4M5LA 1RT7A 1KHVA 5AJ3F 1P1LA 4ZKAA 3A8KA 2LMIA 1KQFB 4DR3J 1FX2A 3LQVA 3GG1A 5GADU 3HFZB 1VQ9S 2VPZB 5DGBA 1PJ7A 2BUNA 2JLGA 4N8NA 3KK3B 1C0UB 1EQ0A 4TLRA 2AV5A 2Y1JA 2EBEA 4RLEA 4ZVOB 4E2FB 1S0OA 4DZDA 2DGOA 3ZTOA 2AT1B 3L09A 3G9CA 2OH2A 3MPUB 4B3OB 2ERRA 1QUVA 5B09A 3H5XA 3IAM9 3I32A 3EE3A 2ZEJA 5HN0A 2CPEA 4DL5A 1TL7A 4LSZB 5HROA 4F4YA 3K58A 1S97A 2KT5A 4DR4J 5SUHA 4LF4J 1TL3B 1L5UA 4IG0A 2JH3A 2DB1A 4Y2KA 4J7CA 2GO8A 3NS5A 3M8QA 4GRSA 1VS3A 4ETXA 5KOXA 4I56A 3HZGA 1CEZA 5DG8A 1NK9A 4C3LA 4XDCA 2CQ4A 1SQFA 1TK5A 1SJ4P 2ALYB 3P8BB 4R8UA 3IN5A 1QD1A 5G4DA 3DLJA 4KHPF 2ZH6A 3H20A 4DPTA 2J9EA 3K89A 4JP8A 2PE8A 4KV8A 2PMZD 2M8DB 3PW4A 4H4OA 1H7XA 1KBRA 2W01A 3OTOF 2F9JA 5IWAF 2G2OA 2RH3A 1TK8A 3UDCA 3W2VA 2EKYA 2B4OA 5KT7A 3NCQA 3QT5A 1NH7A 4ECUA 3IRXA 4RU9A 1QAJA 2M52A 2BE7D 1H2UX 1NM2A 1HIYA 3GIIA 1OMSA 1BHNA 4MTPA 4MK7A 2VIHA 3M8RA 3PW7A 2HRYA 4RW7B 1UFKA 2CQ3A 3FKBA 1YI2S 5D8HB 1UEVA 1FE0A 1U02A 4TLQA 4URQU 1J5OB 3KG4A 4PUOA 1AXQA 1E6VA 1BWVA 4IQXA 1X31C 2OGUA 1AW0A 1QDUB 1CJVA 4YB1P 2FHJD 2PMHA 3GIJA 4A8MP 4ZVHA 3HK2A 4DQQA 4D3HA 2G0IA 1RAIB 3EJMA 3PHTA 1NSKL 1HPZA 1NK8A 4DV0J 3H25A 2EPIA 2BJ8A 3BDEA 3W64A 4ILMA 4TY8A 1DY3A 1AUSL 4B9SA 4K7QA 4A8KA 2JSXA 3GV8B 2IAJB 4DQSA 5THWA 5DGAA 5KFRA 1VFJA 3T9ZA 3I96A 5DJBA 5E3AA 5L1KA 3J7A1 2QL9B 1PBAA 4A8YA 3E51A 5I3QA 4YY3J 1RWUA 4R5PA 1B0TA 3C16B 4CM2A 3DRXA 1CQNA 2ZM6J 2HIYA 2CXEA 4XO0A 2BQUA 2RIJA 2C3OA 2KG0A 5HMYA 1NB7A 5KG1A 3TVKA 4ZN1A 4WYWA 2O3DA 3OFGA 1HYSA 3DRPB 4JV5J 4TYAA 1VQ5S 5IXUA 1IJFB 2B0GA 3OFFA 4PG7A 3CC2S 3SBMA 1KFDA 4ICLA 4AUKA 2M3DA 3QFHA 3A8EA 1DTQA 1YDLA 3M7VA 2MKCA 4DX6A 3EWGA 3DM2B 2F8MA 2KT2A 1X7VA 1G3OA 1FWKA 1TMJA 5LSRA 1FNMA 2MDAA 1WI6A 1NZAA 2VB6A 4AL6A 2XSJB 4FS2A 2GVDA 4G1QA 4Y65A 3T1HJ 3EVWA 4DWIA 2KI2A 3LWMA 4JUZA
chains in the Genus database with same CATH topology
4C0HA 1VI7A 1SJ1A 2BRKA 1WF2A 2DNZA 1IJEB 4NRTA 1X0PA 4JV2A 1REVA 1KRPA 3U27A 5C5JA 2CPIA 1X4CA 3HHLB 3VAKA 3C8YA 1L3UA 2E9TA 3PVXA 4OV1A 1M5HA 3G71S 1KOOA 2RSQA 1VRTA 3FFIB 4J9MA 1U1MA 4GMKA 4NMLA 1C1CA 1WHXA 4ECQA 4F3MA 3J7ZT 3HO1A 1HI1A 4MK9A 2FTRA 2B43A 3HKWA 2CJBA 1XNRF 4URSA 1HL6A 4ATNA 4TQRA 2MSTA 1M1KT 2E7XA 1F5AA 3MMAB 1Z2ZA 2N3OA 2DR8A 4BBYA 4CNZA 2GMHA 5KT6A 4Q45A 5D3GA 1RT1B 4ID5A 3MUVP 4QOTA 1RT5A 3OV7A 4DV0F 1HQEB 3TA2A 4ILRA 3CEDA 3BGLA 3JTPA 2OMOA 4MIWA 2ALZA 4NLGA 1IKVB 2KHDA 2DR5A 4Q44A 1VHFA 1LW0A 2UVVA 2MSSA 3KOAA 4OLOA 1RKJA 4F50A 1T3OA 1KLMB 3ZZOA 1VGYA 1VQSA 4P6QA 5B0EA 4ZCIA 1LKZA 1NK6A 2NPIA 1QLNA 3LPYA 1Y4ZB 1TKXB 2L9NA 3QYYA 2FIUA 3U1MA 1HBUA 3DLHA 1F0XA 2E66A 2DNNA 4DJBA 1WELA 2JEGA 1HARA 2GJ2A 2HMIB 3IRWP 4U9RA 2FVSA 2IYGA 4N8OA 2DK2A 3M9NB 3Q0AA 3OLBA 1FXRA 5HMXA 3RBDA 3OBIA 5M2RA 2JEJA 3R27A 4ZMMA 3A1YG 4TU8A 3OLAA 1O0PA 2CVEA 4YY3F 2B7BB 4C0OC 4HYKA 2E7WA 4ERDA 4I2PB 4HEA9 1APSA 2J5AA 1D3WA 2HHXA 2DHXA 3SYZA 2NREA 4OZ0A 3I31A 1FRIA 1S1VB 1U1KA 3OHAA 4FVCA 4AYBD 2ZKUA 4Y2AA 4QJVA 3RR7A 2NUHA 4K2XA 1GNKA 5F9NA 1S77D 5CZVA 4JOUA 4M5DB 1JLBB 1RTJB 2YY3A 2OMLA 4AQYF 1J5EF 1ZM2A 3SCIE 3TOQA 1T94A 4CQ1A 5AXKA 1ZETA 5FJ4A 4JBCA 1FJCA 4OZ5A 4IO1A 1IKXB 4OI3A 1P27B 2PI5A 1RT6A 2VFVA 4I6WA 2J7UA 2Q43A 4ES2A 2QA4G 3M8PA 3KK2B 1Q79A 3SCLE 2UVRA 3QGHA 2X1FA 5GVQA 3CD6S 1QSSA 2WONB 4IFYA 3P6YC 1U6BA 2FLOA 3DRPA 5LMNF 3K57A 1UAWA 4RKUC 3C6TB 2KRRA 1UVNA 3SQGA 1U4BA 2C22A 1VC0A 2NR0A 2HHHF 1QAYA 3M4XA 2DR7A 1CLFA 2AJFE 2VG7A 2EWHA 3IS9A 2EFVA 1Y00A 1YGYA 4JV5F 2R7QA 4ZHRA 4J9NA 2PO4A 3NG8A 3C6UA 3PFOA 4KFBB 3EGZA 1KONA 4OLPA 5L9NA 1CVJA 2HWTA 4RW4A 1JJHA 1S1XB 2LKZA 2CPJA 4OHYA 1DBDA 2J76E 5JJBA 2UP1A 4W90B 2R8KA 2F1FA 1NJZA 3MUMP 5E7OB 3ITHB 1AROP 2QFJA 3DM2A 3RB3A 3MM8A 2W9BA 5K14B 3DDNA 1PILA 3DHXA 2UZAA 3MM9B 2FJDB 2MQNA 4NL5A 2ROPA 1DFDA 4OJ3A 1BC6A 2PC6A 3SCJE 2UUBF 3M30A 1Q8LA 2CQ2A 2GGPB 4RUAA 5HBMB 3M6XA 1KFSA 1PSDA 3S6EA 2XSJA 4LF7F 1YBAA 3G96A 1DZ5A 1QM9A 4CO4A 2HFOA 1TK0A 2GC8A 3VAIA 4N41A 3BZQA 3PW5A 4IRKA 1WF0A 2QA4S 3X1LB 3IR5B 3QGGA 1FO1A 2R7RA 1TKZB 1FRJA 2J0WA 3WDOA 3BGFA 1R8CA 2DGXA 2HNYB 2LU2A 2Q1LA 2Y1RI 4YEAA 3J7YU 3DRSB 3FQKA 4QYRA 3G8QA 1FDDA 2A3JA 3K5MA 1ZYQA 1KSPA 4ITSA 1RAJA 2YKMB 2BDPA 3OR2B 2AQ4A 3QAUA 4OHXA 3V6DB 2HHQA 4G1IA 4DG1B 4OX9F 3IR6B 1B7FA 1AFJA 4AE5A 2UUWA 3TUIC 1R3NA 3QZ7A 1KNZA 5KFKA 3HVTB 4ZLPA 1NKEA 3HHLA 3GV7B 4OI6A 5G0RB 1YRUA 3I0RB 1DQ9A 2HQIA 3N01A 2XCPA 4ED2A 2DNOA 4C8LA 3QMQA 1J2VA 2DNHA 2VC1A 2HWIA 3P3DA 4NLWA 1EETB 1V9OA 1SKRA 4X65F 3NMAA 4X4TA 2ZH1A 3MMAA 4FNIA 2HHPA 3UE2A 1RT1A 1U45A 3D0HE 3SZ2A 4NYOA 1XN9A 5F8IA 4F4ZA 1HQEA 4LQ3A 1URNA 3RW7A 4PG5A 1GH8A 4C3MA 1X4DA 4R25A 1IKVA 2B56A 2VPXB 2VASA 4OJGA 3IWNC 2WHOA 1YJNS 2ZDPA 2RQCA 3HJFA 4F25A 3T5JA 1VQLS 5D6GA 2AP6A 4CT8A 2MZJA 1KLMA 2W24A 3GYNA 2XNRA 2HIQA 4FZVA 3L7OA 5KFTA 3SMZA 4EWTA 3MFIA 3S1TA 2DIVA 5LL6d 2ZH7A 2J7KA 3D1QA 1TKXA 2V8HA 4BWJA 2DJWA 2MXYA 1PO6A 3TVZA 3UD3P 5MLCV 1XMQF 1Q7YT 4M1KA 1FE4A 2WBRA 1MROA 1RJJA 3BQ2A 3N9UC 1W25A 3CWJA 3MEEA 4LIWA 4DQPA 4LF6F 3P49B 1P6TA 3E01B 1YTYA 3MD3A 3PEJA 1SUQA 3MR6A 1T05B 4FF1A 2DITA 2DGUA 2OTLS 2QA1A 2KG1A 1S6UA 1Q16B 3G86A 1KQSR 3CE8A 3SXLA 3PR4A 4DX8H 1M5SA 4U7UK 2DRBA 2RB7A 4Q2MA 2COLA 2DNPA 1XMOF 2J0QD 5C24A 1Y3JA 4DQRA 2B5JB 4C9DA 2MHEA 3OL7A 1MU2B 1S1VA 1GAOA 1SV5B 2ILYA 2EFNA 2NSCA 2OO4A 4NCAA 2GMLA 4K4XA 2ZD1A 3GFHA 3RW6A 1F2GA 5E5NA 4FNHA 5M2UA 2FHOB 1JLBA 1RTJA 3IXQA 3E2EA 5IT9Y 4RW8B 4QW8A 4DL7A 2IRUA 2F8EX 2GV1A 2XMJA 3GILA 2MJUA 2GIQA 2I1RA 2OSRA 5ITHA 5LSLA 2BA9A 1O51A 1R43A 2QIFA 3SDEB 5AE2A 4HI1A 3BM7A 2E5GA 4I68A 2FJAB 3KK2A 2ZBCA 2OPRB 3QPIA 1W2BR 2KM8B 2PI4A 1SKSA 3DDKA 5LXYA 1U26A 3AB2B 4U6PA 2WONA 4TU7A 2AU0A 2XLKA 1LFPA 2W9AA 5DM7Q 1U09A 3CMES 3KNAA 3MR2A 2KB2A 1SXLA 1YJRA 1SI9A 2Z2LA 3LUYA 1X9SA 1KLNA 2CJ9A 1LWCB 2XBPA 3THTA 1NHVA 3KHRA 2ZH5A 1VQKS 4B9NA 4DR2F 3T5HA 2CG4A 1S48A 2HQ3A 4YR3A 1JXLA 4ZP7A 2AJ4A 4N56A 3P96A 4CO1A 1SB6A 4HTIA 4HTJA 4KFBA 5A2QY 2RRAA 4KQZA 2C2DA 2YTCA 4QU6A 4OX8A 1S1XA 2VQFF 3VAHA 3D0GE 2QE5A 1IXKA 2EI5A 5A0YB 2KKHA 4DV2F 1Y0HA 3OVAA 4I67A 3AA9A 2UV8A 5GAEI 4F02A 1TAUA 1FJEB 3HF5A 2VZ9A 5F41A 3ITHA 3KK1B 1VQ8S 2R2TA 2GX8A 1PC5A 2HPUA 3CSKA 4RW9B 3HHNB 5KFBA 4K4WA 1NJIT 5K14A 5T7LB 2R8IA 1VC6A 2O1PA 4IOCQ 3EZUA 1R6YA 1CSJA 3TAQA 1Y9OA 5KFMA 4WFNQ 2X51A 3JB9k 1F5BA 5DLGA 5C42B 1TAQA 6FDRA 2GGPA 4DSKA 2CZVC 3GE9A 5HBMA 4Y2IA 4X4QA 2QZ8A 2JFKA 5KFXA 3S01A 4QPTA 1VLYA 3CCJS 1X9MA 3RRHA 3R5AA 2KH9A 4WCEQ 4I69A 1KD1T 2RQMA 4EU0A 4LVOP 3Q23A 1TKZA 1L3KA 1FNXH 2RD5C 2LECA 1V6HA 3IAS9 2HNYA 2RQKA 3HHKA 4B3TF 3DRSA 2GHVC 4IYQA 1VRUB 5I42B 1CG2A 2KXFA 3Q8PB 2FVCA 5A8KB 4DV4F 4IR1A 3BR9A 3Q8QB 1VQNS 4KC5A 2YKMA 3CT9A 3R1HA 3RB6A 4ZP8A 4CT9A 1G6BA 3V6DA 5KFYA 2BABA 3CCVS 5AXMA 4BCAA 4DG1A 3V81B 2Y0SD 4PXDA 5HL7Q 3V6KA 2LEAA 2CQBA 4ALZA 4DR3F 1D9FA 1RI7A 4MKBA 1ZZFA 3KLIB 2AYGA 4OI2A 3HVRA 4ZVFA 1GXTA 4QIGA 1QTMA 2EFQA 2XMMA 2XG8A 5G0RA 4CO2A 3FDSA 5EX0A 3V4IB 1I6JA 2W25A 1Q7LB 2DNKA 2D7SA 4IKAA 2YNFB 4OI4A 4PG8A 1VC5A 4LF8F 2FJXA 4O44B 1TKTB 2B51A 3DRYA 3OVSA 3TAPA 4Y0FA 1B0PA 2FB0A 1EETA 2UV8G 5B0CA 3MFHA 2YWGA 2HHUA 1ZM3A 1T7PA 3BN4A 3TVYA 2VONA 2A1BA 1JMTA 5IQ6A 1FT8A 1FJGF 3I6PA 5DO2A 4MYUA 3M2RA 1JLFB 5M2PA 4J9RA 2R9LA 2EBGA 3VF0B 2J9CA 5KFJA 4OX7A 1FTCA 4I2QB 2KFZA 1VBYA 2D9PA 2IM1A 4F3OA 2NS1B 1WNEA 2DT9A 4G1PA 2XS2A 3G6XA 4ZPWR 2ZOMA 1IBKF 1LXNA 1K0VA 2APOA 3GQCA 1TFYA 4I6YA 1NK5A 4L6V3 4C8ZA 2R7VA 4CTAB 1UVJA 2ZC3A 3TAMB 2ZH9A 2DNGA 1C2PA 1YJVA 2WAQD 2VV5A 3UCUP 2J9DE 3G6VA 2FUG9 2LDYA 1S49A 2GHPA 2YH1A 3NWGA 3K7RA 5B0BA 3KLVA 3MUTP 4O23A 4A8SA 3GFYA 4ELVA 2HNDB 3MM7B 3O6QA 1X5SA 3E01A 2F9DA 4QIFA 1T05A 4PG4A 2DCUB 2FY1A 3AJ2A 3QWPA 3K59A 3R5CA 4OI1A 4OJHA 2FHKA 1WF1A 3GMGA 3HI9A 5KT5A 1LQ9A 2F7VA 5HP1B 3PM9A 4DR4F 2HHWA 3OL6A 2B5JA 3FSXA 4DLGA 4DQIA 4HDGA 4LF4F 2L3MA 4OHZA 1SV5A 2VA3A 4BHQA 4PCQA 4RU2A 3V2UC 1JLAB 4CO3A 3HHDA 2R8GA 4WE1B 5D78A 5CZXA 1NO8A 4DFMA 2Q3PA 1N32F 1MW7A 4RW8A 1MWZA 1NHUA 2FLPA 1FK9B 2GMJA 3FVYA 2WRMA 3O3LA 5E33A 5IS2A 4WXWA 3T9NA 2KXNB 4DL4A 2BQRA 1KVIA 3N6MA 4NZ0A 1TP7A 2RF2B 1S76D 1RDRA 4TN2A 3OTBA 3PRBA 3M8SA 3UDLA 2OPRA 3BSAA 3GG0A 5DQGA 4K0KF 3DI6B 4PPDA 3CF5Q 2LCWA 2D74B 1NAQA 2YX1A 2LVWA 5GAGU 3ISNC 3GFZA 5J2PB 1NJWA 1VQ4S 1V3SA 3D2WA 1FKPB 4Y3CA 2DNMA 1URRA 1M0SA 4IH5A 1HBNB 1H7WA 1S6QB 2E1CA 2AJ1A 4IRDA 3NAHA 1U24A 1VJWA 5IM0B 1R89A 5B0AA 1E6YB 2E1MC 4LQ9A 1S79A 1RTHB 3RRGA 1SKWA 1D9DA 5A0YA 3T1AA 4ES3A 3CJ4A 2JLFA 5J2MB 4DS4A 1TUVA 1VQPS 1U49A 2VA2A 4LT6A 1S7HA 1MMDA 1IKWB 2NLWA 5DQHA 5EWFA 4J9QA 1WD6A 1YSJA 1HBOB 1OSDA 1TZ0A 3CCLS 1U2RA 3Q8RB 3KK1A 4X62F 1HW9A 3IGVA 2HW3A 4WK3A 2OTJS 5L38A 5AXNA 2L08A 4DL2A 3AB4B 4L3NA 1RT2B 3GR0A 4Y34A 4A8QA 2F8HA 2NQPA 2PGCA 1TVRB 3DNCA 5CH7B 1TQLA 2R8JA 2CQ0A 2BYCA 4USIA 1OO0B 5C42A 1LV5A 4K50A 3DLKB 4NRUA 5KAKA 1AFIA 4QCLA 4X4UA 2C3UA 3EGWB 1L3SA 2B7CB 3PZPA 2BJEA 3M2VB 3DFEA 1G2EA 1N54B 2KJVA 1VOMA 3EZ5A 3LP0B 3RB0A 5LJ3Y 4WFXA 2ZZNA 1FA0A 1FJ7A 2DISA 2M0GB 3CD7A 4DN0A 2R7WA 4C7QA 3WC0A 3VZHA 3KLEB 2KZMA 2A18A 2VFRA 4CO0A 4K59A 1N6QB 1YG0A 4KIAA 4ILLA 2BJDA 7FD1A 1NKCA 1VRUA 4YR2A 5I42A 2W9CB 4PXBA 1VIXA 5A8KA 1S6PA 1TR0A 3ZZZA 2DD8S 4QR2A 2ZJQQ 1SJFA 2YWEA 4I1TA 4PWDB 3CGIA 2QSFA 3V81A 3FCHA 1M5PC 1VK3A 1A9NB 2ZDOA 5KG2A 3HMJG 4DF8A 4RW7A 1SBRA 2GJIA 3MECA 1T8EA 4NLQA 3QJLA 3HZEA 1IQZA 2AGPA 1X0FA 1QSYA 1LWEA 3V4IA 2JRSA 2I9SA 1TL5A 2XWXA 2XLIA 2DGTA 1U7LA 2YNFA 4F3QA 4IO9Q 2GQ2A 3TI0A 3T6JA 4O44A 2XSFA 2FJBB 5B7WA 3I56S 1TKTA 4X66F 1FTRA 2J0XA 5A6PA 2BV3A 2OLWA 3I0SB 2GO9A 2GFFA 4NCGB 4B17A 5EHHA 3RR8A 2WSEC 3PXGa 1G7CB 3DLEB 2HHTA 5F8LA 3KLFB 1U47A 2R7TA 3R3TA 2L48A 1JLFA 4R0EA 2FVPA 2HHSA 1SH2A 1VQYA 3HHEA 4F8RA 3IGNA 4QWEA 4NLXA 1KTQA 3NL0A 4I2QA 4AL5A 2YH0A 2W4DA 2XMWA 1VQ6S 2JEFA 1S6OA 2QSWA 3QGIA 1N48A 2MQQA 1KEKA 2RKIB 1P9QC 2VFTA 3TR5A 1QSLA 1FCAA 4RWXA 2YWHA 3RU0A 3EYZA 3GWCA 2AF6A 5MAOA 1U48A 4CTAA 5CA5A 2PA8D 3P5TL 3TAMA 1G1XA 2B4UA 3F73A 1HWIA 4OIXA 2VG5B 2W7AA 4A46A 3GYXB 3SEOA 3MM5A 4LF5F 4Y2MA 2JL9A 4ZPVR 1JKHB 1WACA 4PR6A 3M6VA 3FGVA 3OJUA 5L1IA 1JK9B 3NNHA 5B0DA 4ETZA 4WFAQ 2FVRA 3RAMA 3LP2B 4C8MA 3C66A 2IAJA 2BM0A 2PD1A 5K8MA 5H9EJ 1V3ZA 3O5TB 2DR9A 1F5CA 2WK4A 2UXCF 5BYRA 3CCZA 5HP1A 1ULRA 3JSRA 2POKA 4G3IA 2FGOA 2MZTA 4M63A 1JX4A 2BE2B 3EGNA 2N3LA 4CIOA 3SCKE 2MPUA 4RNOA 2YVSA 2YWKA 1W2IA 4DFJA 4M8LA 2WB1D 4ECRA 2AWZA 1SIWB 2EG1A 1OSCA 4HLBA 4DSLA 2FDNA 4WE1A 3D0IE 4GO7X 3MCSA 4ZS6A 2R2SA 4FF4A 1U1OA 1BQNA 1FK9A 2ZUGA 5FD1A 5GMKa 2E1RA 4KGKA 3BB5A 2ZFHA 3QZ8A 2ZITA 2HGLA 2RF2A 1Q53A 1JLQB 2AYEA 2X1BA 4U67Q 3DMJB 5FDLB 6FD1A 1N0VC 1WHYA 2E29A 4JI7F 4NLUA