3AJ1A

The structure of axcesd octamer (n-terminal his-tag) from acetobacter xylinum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
KKPDFTLFLQTLSWEIDDQVGIEVRNELLREVGRGMGTRIMPPPCQTVDKLQIELNALLALIGWGTVTLELLSEDQSLRIVHENLPQVGSAGEPSGTWLAPVLEGLYGRWVTSQAGAFGDYVVTRDVDAEDLNAVPRQTIIMYMRVRSSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bacterial cellulose synthase subunit D octamer with four inner passageways
pubmed doi rcsb
source organism Acetobacter xylinus
molecule tags Biosynthetic protein
molecule keywords Cellulose synthase operon protein D
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03500 Cellsynth_D Cellulose synthase subunit D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2590 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aj1A02
3AJ2A 3A8EA 3AJ1A
chains in the Genus database with same CATH superfamily
2ZZMA 3DI6A 5GMEA 2PFDA 4A8FA 2WVDA 3GG0A 1QM9A 4EFAC 2B8QA 2M7SA 2QLJB 2FVPA 1QSYA 3M2VA 2DIVA 2HIYA 1WC5A 2HQFA 1RT4B 5AT1B 5HANA 4CZCA 1U49A 4GVLA 1T9UA 2Y0BB 4KGKA 1UVIA 4PEOA 1H6KX 4LF7F 4B3MJ 4OI0A 4QWEA 1L3TA 4EK2A 2UVRA 4ZLPA 4OL8A 2Q79A 2LYVA 1Q8IA 5HMWA 2ROGA 1M5VC 2GHWA 2O5DA 3VALA 1FHTA 3OR2A 4OJGA 2E1PA 3CD0A 3BO3A 1GXLA 3QPIA 2GJIA 2GC8A 2PE8A 5KFIA 5KFJA 3KLVA 3UDLA 3GYGA 1ZAWA 5ETLA 5JUMA 4ZVSB 1RTJB 1GMWA 4WTOB 1T05A 4NYZA 1QY7A 1FO1A 4ED6A 4O3RA 4B3OB 3DKDA 1MU2A 3N6MA 1K47A 3R5AA 1TKXB 5HBMA 1U1OA 4YDDB 2K7JA 2HNDB 4ZP8A 1KC8T 4IUFA 2DD8S 2V8PA 3BSOA 2QC3A 5HQMA 5HVGA 3MM7A 4JI2J 2FLOA 4PABA 5JJBA 5B0GA 5DQIA 3HKZD 1KNZA 4LSLB 1M90T 2H51B 2P8IA 3BZQA 4J9LA 3DU6A 5D8HB 4ZCLA 1UMJA 3H2VE 4JP8A 2F7VA 1NJWA 4WFAQ 4NPOA 1M5SA 4KV8A 2XCAA 2BRKA 3QZ8A 1B4SA 2A2DA 3QT5A 3JAMU 4UOFA 2ADBA 2UXBF 3WC0A 1V3SA 2V2ZA 4DV5J 3SDEA 2FLPA 4HT7A 2X3GA 4KGZB 3JQKA 4LVNP 8AT1B 4U7UD 2UZAA 3P3DA 3SCJE 2MGZB 1JWWA 2YNGA 3I87A 1BLUA 5THWA 3ZO7A 4DV3J 1VMBA 2KKHA 2KVIA 5SZTA 1IKYB 1JXLA 3OL6A 3GJRB 3PX6A 4KBIA 2FVRA 3DLLQ 3GFZA 5A0YB 3OXFA 4RU9A 3BSCA 2HMIB 2XMVA 4LF8J 4LF7J 1HQUB 1KN6A 1S1TB 2YH1A 1T8EA 4TKTA 1UJ4A 1VCTA 2AU0A 1FT8A 4ZIVA 4USUA 4PKDB 3ZZUA 4DX6A 1DQ8A 4FZVA 2KHDA 4LJMA 3FEYB 2GV1A 1U2RA 3ZTQA 1C1CB 2QL7B 3NP5A 4UQTA 2EPIA 2IMWP 1Y00A 2DH9A 2FTRA 1RK8A 2GZOA 4WYLA 4CYUB 4QCLA 2GVZA 4RW7B 1N5QA 4ED3A 1WKJA 1C1BA 2J0XA 2MHEA 2DNLA 4MTPA 2UUAF 3CUNA 3UCGA 2YTCA 5AXMA 2DCLA 2CPYA 4DR4J 1PCAA 1S0OA 2UVUA 6FDRA 1T7PA 3NS7B 1DLOB 1T0TV 2W9CA 3QRRA 1Y3KA 3I6PA 1S9GB 1DJ0A 2E1RA 3QSYB 3I0SA 3TZZA 3Q8PB 2XYHB 4A4JA 1N36J 2YNGB 4K8RA 1RZMA 3S01A 1BE4A 2ASLA 2DR9A 3VGSA 1E6VA 1MU2B 2QLBB 3D1OA 5KOWA 1HNZF 2PD1A 1PJ5A 2EK1A 2RDIA 3HSJA 4W98A 5CAAA 1JXVA 2UV8A 4KGVB 4N56A 1I3OB 2H54B 5LMNJ 1O0PA 4ZHRB 5BJRA 1S10A 2UUBJ 5C2CA 2E7VA 3E01B 3QGIA 4I6AA 4OI2A 5KFQA 4C9DA 3O1LA 2HHVA 4DF4A 1RJJA 4OX6A 3DDKA 3ENVA 2AJQA 5FJ4A 1NK7A 1WG5A 2H48B 1HBUA 1TMJA 3EVMA 1N0VC 3HP6A 3M4XA 2KFZA 1F3VA 1KKHA 4JYAF 1CS4A 1S77D 2K3KA 3VV2B 4DF8A 2IM0A 5KOXA 3TQ1A 1IBCB 1Q0NA 4F2SA 1MN7A 3HJVA 1UW9A 5CYMB 3T3FA 2BKOA 2V4RA 2WAQD 3MAQA 3BPDA 2CKWA 1P27B 1WI6A 3ISZA 1BY9A 5JVGQ 1S9GA 5E7OB 3N5FA 3GILA 3WBZA 1BWEA 1QTMA 1AB8A 4KGXB 5I4MA 2YKMA 1BGXT 3DC2A 1WDDA 1IKYA 2YKAA 1YBAA 2PEBA 2V63A 4G1IA 4NLSA 4ZVFA 1U1QA 2PA8D 2ZE2B 3IS9A 3AXMA 4ANDA 1XJWB 4RW8A 2OD4A 4FVMA 4X65J 2DVIA 4F3OA 2DB1A 4DR4F 3D0GE 4LFBJ 1OYDA 3M30A 3UN2A 4EBDA 3RR7A 4GKJF 2F8MA 1TZ0A 3DHWC 1C2PA 1H7XA 2DBBA 3GJQB 4NEZA 1T9VA 2YY3A 4DR7J 3I9V9 3OVSA 1AUDA 2ZBPA 1D9AA 1P1LA 3FCVA 3POTA 4OZ2A 2VQEJ 2ZOMA 1F60B 1N5YB 1FWLA 2LU2A 3DRSA 1N36F 3W8GA 2FZCB 4RNFA 5L1IA 1D0EA 4P2FA 4R8UB 3CNQP 4LF1A 3M9OB 3F73A 2DXDA 2F5GA 3GP9A 1VRUA 2C3PA 2W8KA 4PG4A 3G87A 4I64A 4P7VA 1RU2A 4AUKA 5IV3A 3CSKA 4DPXA 5KG4A 1RAOA 2OEKA 2XWXA 4AL6A 4I7FB 2XI2A 2NSCA 3SBMA 2XI3A 4HH0A 3P96A 3CCQS 5L1LA 2HHHF 4K0KF 4HI1A 4BLGA 2W2QP 2DY9A 3W2VB 1WEYA 3IBWA 3PEHA 2OI2A 3CDAA 2KL8A 3I0RA 2R8GA 1U0SA 4UY8T 1FNMA 2QV6A 1KVKA 1NEEA 2FZKB 2A6OA 4NEYA 2RUGA 2YPYA 2Z0GA 4ZMMA 4ZHRA 3C66A 5H9EJ 1LWXA 1NZAA 4J7CA 2H5IB 3RB0A 1Q79A 4WP3A 5DGBA 4ZVUB 2RJZA 3EMTA 4DS5A 3J7AN 1KTVA 3MM7B 2R8KA 1ELOA 5AJ3J 1CJVB 2VDHA 5I42A 4NLOA 4RNOA 1YVFA 2N7YA 4XDDA 2HHXA 1L3KA 3FK4A 3TR5A 5DS7A 2OELA 3HO1A 1UW4A 2AZ1A 1T02A 2DEIA 4OFZA 3TUPA 4G1QB 1QSLA 2DYAA 3BDPA 2CAJA 1NSKL 4LFCF 1C0UA 2I1RA 5M2RA 2MQPA 4OHXA 1SJRA 5A0YA 5J1NA 2OH2A 3MMCB 2JC0A 3E3XA 4WKYA 4G1PA 5HLFA 2ZUAA 4K5SA 4N41A 1Y5NB 4LVOP 2V8GA 3WQPA 4D3HA 2LMIA 3SSQA 3H25A 2ZD1A 2D9OA 3PKMA 3AB4B 1SKRA 4ERDA 3G71S 1IM6A 1S5ZA 4PWDB 1X4EA 3IRXA 4CNZA 4FYXB 3AJ2A 3P4UB 3PFOA 5CD4A 1OSCA 5ETSA 1UWBA 4TVAB 1RWWB 4RW7A 1RHMB 4NA2A 3GCWP 1FDAA 3H5UA 3IWLA 4RWWA 4TQRA 3QQCD 2DCUB 4F2RA 2KXHA 5IT0A 4N7TA 5EX3A 1VQNS 3E8OA 2HFOA 5E3PA 1U26A 2JHEA 2DHSA 5DG8A 5KFLA 2XO7A 4MIAA 2C2ZB 4CYUA 4R8UA 4C3LA 4B9LA 1Y5IB 3L09A 2R2SA 3FZ2A 2VASA 4OI6A 1L3SA 2ZKTA 1FEEA 2BKNA 3MEDB 2J7WA 3TZWA 2RQKA 1X7VA 4M5NA 1VISA 4DN0A 1K1QA 3R7SB 1J5EJ 3LW5C 2MYFA 5C7PA 3RRHA 2B3TB 1FRMA 2G1HA 5T41A 1NK4A 1HWIA 4Y34A 2VQFF 3QGPA 3M2UB 4I2PA 1RADB 1X5TA 4DLEA 4F02A 4XK8C 4O23A 5LSLA 5J2PB 2CVEA 4JI7J 1BQMB 2M0GB 4A8YA 2HHHJ 3BQ1A 3TQEA 4FNHA 4DDFA 8ATCB 4JI1F 3RAXA 4U7UK 4DX8H 3OL8A 3MEKA 3PYEA 1X4FA 2DIUA 2V4JB 3W63A 4CNYA 2VA2A 1X60A 3EPGA 2GA7A 3L4BC 3P5BP 4JI4F 3HZEA 3W65A 5IT4A 2H65B 2OGUA 4FPIA 2XY7A 3LALA 3NAHA 2OPSA 4YQWA 4DQIA 3TVZA 1ZPVA 3T5KA 3PY8A 3WIUA 1FFWB 5EWFA 4JI3F 1SQEA 1TAQA 2BJ9A 1X4BA 4NLYA 2XLKA 2BX6A 2NXUA 4OZNA 2OPPB 4NMLA 4PQUA 2XS7A 2RT3A 3HT0A 5AJ3F 2HWTA 1PBUA 4DV3F 4IO9Q 2XS5A 3F0NA 3HK2A 2BE7D 1T9YA 2XBPA 3UFCX 4ZPVR 1HR0J 4OX8A 5DM6Q 1RTJA 2CXEA 3A8EA 3IS9B 1DTTA 1C0TA 1NDPA 3DOMB 4FXWA 1Q86T 2M8DB 2JEGA 3QAUA 2GVDB 1TKXA 4A47A 5HBMB 4DU7A 4N8NA 2CVIA 3MWBA 3HX9A 4LRDA 5CZVA 4R25A 4CLUA 4X62J 3CVKA 2N7CA 2P5VA 3KJVB 1NK8A 3MCMA 1B99A 2YWFA 3TA2A 1X0FA 4AD6A 2KH9A 2WW8A 1VLYA 1PGZA 1CSJA 1KQSR 2WBMA 5LOQA 3V81B 1TL5A 3RUBL 4U95A 2UUCJ 3D66A 4CO0A 1E6YB 4Q0BB 1B7FA 3I32A 1ZETA 2LXUA 5E3CA 3B8HA 3IAM9 4CT9A 3KMQA 4O4RA 3PR4A 1I1GA 5HQ8A 2XO6A 1HW9A 4M95A 5KFXA 2E9RX 1XMOJ 3CJRA 4HEA9 1SC6A 2W9CB 4ZPTR 4CLTA 4PG8A 4ID5A 2RKIA 3LP1B 2UXCJ 5IZHA 3HM9A 1UEVA 2CIMA 4OJHA 3QO9A 3OPKA 4ZP9A 2KM8C 4GC7A 2AGOA 3V6HA 2XB2D 4WZQA 3M6WA 3CB4A 2QTWA 3NGRA 4A8KA 2KRRA 2BOPA 4P2MA 2ZH7A 1LW0A 2XMMA 3SV4A 5LXRA 4CLFA 1FRKA 2DH7A 4ECXA 5EN1A 3RW6A 2F4VJ 2PEHA 3CW2C 3K5LA 2XULA 2XMTA 2UV8G 4WFBQ 3FSYA 2JDJA 1EAYC 1HBNB 3BR8A 4K2XA 5ETKA 5C25B 1VQ5S 3QZ7A 3TZYA 1YHQS 2A10A 1FEHA 3S1TA 3OTCA 3DLJA 2LQ9A 1M5HA 2FGCA 3N79A 2RQMA 3DFEA 4LF4F 3MAAB 1R3NA 2CQ4A 1E6YA 1EX8A 2IVMA 1EZZB 1NH8A 1Q4RA 2MKSA 4K4TA 2A3JA 2HFNA 4ED4A 3G8QA 2XGPA 1YJTA 5ADZA 2E66A 1FKOA 3NMRA 3LGMA 1EB0A 2JVOA 4BS2A 1VFJA 4ANCA 4PQAA 3HXMA 5HLFB 2H9ZA 3GG1A 3I0SB 2HNYB 2VPYB 3UNYA 2NSBA 2V2VA 2QEXS 2QRRA 1NXIA 3K5OA 3PDNA 3VQSA 2XCPA 3JQMA 3EGWB 2NZ4A 1JLFB 1UKUA 2PA3A 2DGUA 4ZJOA 3D7SB 3QBCA 2WVFA 4DQSA 3MOJB 2AX0A 2C3OA 2QLXA 3J7Z5 3HCXA 4F36A 2XMUA 2DJWA 5M2UA 4NLGA 3BS9A 1HYSA 3DDIA 4IR1A 1V3RA 4CDIA 2XGQA 1IKVA 3A3NB 3MR3A 1YRTA 3SYZA 5CXTA 5D0HA 4F0KA 3AXKA 2OHDA 5J2MB 4ECUA 1GT8A 4UOGA 5C24B 4PWDA 2HFUA 4C8NA 1S6QA 2X1GA 3FFIA 1RI7A 1VOMA 1IR1A 3MPWA 3R3TA 1WD6A 4Z7YA 4CTAB 2F4FA 1S6PB 3CO9A 4C2MA 3TJAA 4G65A 4WFYA 1BUXA 1KBRA 1U2CA 3IP0A 3H98A 5E3QA 5K8OA 1QJHA 1W2IA 1YLXA 3EVWA 4KKOA 5CQGA 5A8WB 3THVA 2AGPA 4F4WA 3AD8C 4WYWA 4DL0C 3D0HE 4B9TA 3BQ2A 3HHKA 4DCJB 1KP6A 2QT7A 1HBMB 2XEXA 3M2UA 2GCFA 4DMZA 2NREA 3OL9A 2AV5A 2PT0A 1IN0A 2VG7A 2VQEF 3G2XA 2MKKA 1IQTA 1Z1ZA 1O6XA 2H5EA 3MMBA 3OHBA 3M8QB 1RWKB 3BYRA 4CH7A 1F5BA 3KDOA 1S76D 1B7YB 1NAQA 3HULA 3EUNA 3ILJA 3T41A 4DLGA 3N6LA 3MUVP 2X1AA 1R8AA 1RT2B 3UDEA 2W25A 2GFFA 5E41A 1VQ4S 2HZVA 3VVTA 2HSEB 2KT5A 1N33F 4C11B 1BQMA 2GQCA 3NKYA 4ICLA 1LK7A 4HHUA 4EO8A 1FJGF 2APOA 1AZSA 1XEZA 3FEZA 2XHWA 1T3OA 1G1XA 2OPPA 3R7BB 3MI7X 3RAMA 4RW9B 2Z30B 5KG5A 2PDAA 3IGVA 2OFGX 4R0EA 4OI4A 4DR2J 3VWSA 1B0VA 1C0TB 2E29A 4IG3A 3BGFA 1UP1A 2MQMA 4OLPA 4RJVA 4RU2A 4NL5A 2AEFA 4O44A 3CEDA 5MAOA 4YHHF 4TLRA 1SIZA 4ZPAA 2OTJS 3A8IA 3TX8A 1XR6A 3JTPA 1JLFA 2EFVA 3GIMA 2KRBA 2EKYA 1BMQB 2J8SA 3N9UC 2RVJA 4LRFA 4RW6B 1D8YA 1S6UA 3CCVS 1SJ3P 3VZIA 1KONA 4NRTA 2BANB 4F0MA 3A1YG 1P6TA 2FJDB 2KG1A 2IJNA 5DM7Q 2BYCA 3EDRB 1IJEB 2DHXA 2QYCA 4HVZA 1HPZA 4NZ7A 2C22A 5A6PA 2QL9B 3DI6B 4P52A 4CH0S 5A2QU 3W8PA 4ICLB 4EMDA 1LW2A 3ZZTA 3G82A 4RR5A 5DQGA 2RF2A 2B5JA 4RUBA 3BM7A 4CLLA 2E5GA 5H9EK 2QA2A 3N0VA 2DEJA 1X5OA 3K57A 3OR1A 4ILMA 5ETQA 3SDEB 1F9EB 5KG0A 2BEFA 4DPTA 1NJZA 3K0JA 1OWXA 1LFPA 1F5AA 2CWKA 2O1PA 2A2CA 3NGKA 2HZAA 2UUAJ 4Q43A 1Q5YA 1TL1B 3C8YA 4DSJA 1FESA 1WUUA 3NMAA 2CPXA 2JLFA 3C6UA 1U7LA 2C2MB 5DQHA 1VQLS 1KD1T 2HMIA 2CDRB 1U25A 4P72A 3Q8SB 4QW8A 2B0GA 2UUWA 2VF3A 1JMTA 1H72C 2XS2A 2IRUA 1V9OA 2KYXA 4U96A 2VPXB 3MM6A 3QLHB 3W2WB 3W64A 1QUPA 3C15A 1FJ7A 3L7PA 1EQ0A 2UUBF 2XMWA 4OJ3A 1RWMB 2LQBA 2L9NA 2MHNA 3IG1B 1OO0B 4IH7A 4QQBA 4F26A 2XM3A 1QAIA 5GADU 1FJGJ 3QMQA 4PR6A 4B3MF 2CQ0A 4M5MA 5LMNF 3HI9A 4AXIA 1C1BB 3CIZA 2LP4A 2ZVIA 3MDFA 2XLIA 2EC2A 4DV7J 1N5YA 2E9ZA 2E44A 3MAHA 3SFGA 1HMVA 2B9YA 2YNFA 1RBAA 1YRXA 4J9UE 2VBWA 1TAUA 3AQPA 3JXOA 4DR3F 2WVBA 2XZWA 4I0WA 4DFKA 3MEEB 2N4CA 3R5GA 2GGPB 1EKSA 4TY9A 4ZP6A 2D41A 2DY1A 2G0JA 3DRPB 1NKBA 2RS8A 1RTZA 2KB2A 4WJBA 2AJ4A 4B08A 3W1YC 2RNEA 1F5CA 4I2PB 1U1NA 1IKXA 3BYPA 2DR5A 3C6UB 4DS4A 4DSKA 1MNEA 1J5OA 3WDOA 1AFJA 4YY3J 3X1LB 1IKVB 3O3LA 5DJBA 4CLPA 4OZ3A 5KFHA 1NPPA 3CJ0A 3KHRA 1R0BG 3PVXA 2VG6B 2DNYA 3OXLA 3NNHA 2GIRA 4X84A 2BQRA 1EP4A 1UVNA 2XHCA 4XPEA 1HBUB 4X65F 2HQDA 2E1MC 5LJ3Y 3RRKA 2D3OR 2M5YA 2ZH1A 3ETOA 5KFTA 4NLUA 1SJ4P 1H38A 2IC3A 4IDKB 1DLOA 4CRJA 3WX8A 2BVZA 3NOCA 5GMDA 2JJ4D 5C24A 4DR7F 3M8SA 4QIEA 1S6QB 3FFIB 4ZVRB 2EFQA 2VG7B 2GVZB 4BC9A 3TA1A 2CQHA 1Y9OA 1M0SA 1FCAA 4P9SA 4HKQA 2BM0A 1U4BA 1OJ4A 2I9SA 4JV0A 2CRLA 3THTA 1RHUB 3B78A 1VQ6S 3W7BA 2FDNA 3PYDA 1TV6A 4ZJLA 3TOQA 3ICLA 1NM2A 3M7VA 4RW8B 2GO8A 3JQJA 1T05B 2QA1A 2JLGA 2EG2A 9RUBA 1MSWD 4KYZA 1GTEA 2F8EX 5CCMA 1D9FA 3D6FB 4DFJA 2DNRA 2CNNB 4LSZB 3KYLA 2XZTB 1FK9A 1NNDA 5K14A 3W5ZA 3WZ0A 5GAGU 3GFHA 3CJKB 3J7YI 4DV6F 3PRVA 2NXEA 4LF2A 4USHA 5HO4A 3PO5A 1G6BA 3THPA 3GQCA 4K4ZA 1CJTA 1BXNA 4J90A 3DOKB 2KFNA 1PC5A 3OR1B 2JSXA 4UTGA 2AGQA 1KFSA 2KZZA 4LMZA 2E5LF 4ZDNA 2F4VF 2BOAA 2RD5C 3MMAB 3HHLA 2QMUB 1VR6A 3PJWA 3TARA 4OYPA 2W01A 4LIWA 4ID5B 3HT3A 4Y28C 4DV7F 1I6JA 2G2ZA 2V9WA 3EM1A 2L41A 2YKMB 2HIQA 2M88A 4IO1A 4M5GA 5H1SV 4X4TA 1SKSA 3P8BB 3ZZYA 1DZ5A 2K1RA 1RT6B 2B6AA 2G1DA 4JOUA 4ID8A 4NRUA 3NEKA 2IVFB 4N8OA 4DR3J 1PO6A 3CIMA 4IR9A 2FHKA 3QRQA 2D9PA 4FN5A 4CO3A 1Q82T 3GR0A 1TV6B 2ZZTA 5DETA 3G86A 1GQEA 2GS8A 4KHPJ 3CJQA 2JFKA 4OHYA 1SBRA 3K89A 4LSNB 4PG7A 2QSWA 3RGIA 3TANA 1QLNA 3BF4A 5L46A 1LW2B 1SKUB 3PRBA 2XMJA 4OV1A 1NSQA 3T1HJ 2IAJA 2HKEA 4I6WA 2DHHA 4Z37A 5JMNA 1XMQJ 2UVVA 2CNKB 2HQGA 4LQ9A 4H4MA 1GTHA 1HARA 4NA1A 3K58A 1Q7YT 3EZUA 2MXYA 4K7QA 4C0OC 5I3PA 3EGNA 3V6DA 3T5JA 3M1VB 2DRDA 4DR6F 2J9DE 2NXJA 3C6TB 2A18A 3HD2A 5AE2A 2RU9A 4PWUA 5IOLA 3B82A 4PQUB 4DL5A 3P5TL 1OIAA 2Y8WA 1W25A 4MK7A 3HSZA 4ZVPB 2Z4PA 4LBIA 5K9FA 1KS2A 1NLKL 1S1XB 1VRUB 4ZOSA 3W2VA 2QA4S 3TJ9A 1RYSA 5B7WA 3DLKB 3W9HA 1RTDA 1MG7A 4I67A 2BJ1A 3IXQA 3TO8A 4I7FA 5CYQB 1WG4A 4IRKA 3EE3A 3ZTRA 3A3OB 4ELUA 3FVYA 2W2PP 4K5RA 4JI3J 3PW5A 1H2TZ 1VC5A 1UJ5A 2LQ8A 2OD6A 2B51A 2FIUA 4ANEA 4JI4J 2H3EB 3M9NB 3IBFB 4ZPDA 2AP6A 1HD0A 4RO0A 2R2UA 2K7KA 1U1PA 1RSCA 4DR2F 2B4VA 4HI2A 1G7CB 2ZNZA 4FNIA 1N0UA 4E8UA 4ECVA 1HNXF 2O66A 3JSRA 4ES3A 2E1CA 2K06A 2DKOB 2VC1A 4OYOA 3DRPA 4WK3A 4F3QA 2CG8A 1SXLA 4DUYF 4DV4F 3CC2S 1RCXB 1RLCL 5D0RA 4QWBA 1YJ9S 4K50A 5DDOC 1LXJA 3Q8YA 1X0PA 4DL6A 4KO0B 3Q22A 1JLGA 5D0EA 1NHKL 4J9SA 4TQSA 4DCOB 2CJKA 5F8IA 2VFSA 4U8VA 1FXRA 5KFFA 1IKWB 1S79A 2Q1LA 3TYTA 3HZGA 2DK2A 3HMJG 4CT8A 1JKHB 3LOUA 1UWBB 2RDJA 1IKXB 3US5A 4URQU 1UFKA 3ETMA 2HBQB 3BSNA 4J5OA 3M30B 2C2NA 4OHWA 2Q6CA 2SXLA 1KSPA 3AQOA 2ZH8A 1RTHB 4WBFA 2XY5A 3KG0A 3SCIE 1N48A 3H5YA 4P7TA 1JXEA 3IBCB 3PG9A 4H4MB 4QWDA 4K4YA 4YEAA 3U27A 2ASJA 1YJUA 2HQIA 4URSA 5B0FA 2C2EA 1Y10A 4JV1A 1NHVA 4WU2A 4FBUA 1FX2A 3GSDA 2HEKA 1TKZA 3M1VA 4M5DA 1KQGB 1QE1A 1WJ9A 2WHOA 2YNHA 4ZVOB 3AD7C 3M8PA 3UVJB 4LFAJ 4C8YA 3NXZA 4ETXA 4ES1A 3IWNC 3LP0A 2J7KA 1FKPB 5F8MA 1FDDA 3JSMA 2R8IA 4Y2KA 3HD1A 1YX2A 2EFPA 2E9TA 2GVDA 4B3RJ 3MM8A 2VBZA 2W9BA 4NLTA 4RW6A 3ET6B 4UW2A 4X64F 2FHMA 3G6ES 1K0TA 2CQGA 2MKCA 4LF4J 1JJCB 2CQIA 2CADA 2KVQE 3MTKA 4J91A 3T9NA 3W2WA 5DLFA 3QIDA 3T9ZA 3MM9B 1HWLA 1QD1A 2NS1B 3V81A 4C4WA 5D0GA 4OYBA 1HPZB 3Q8UA 3KK1A 1H3DA 1RT4A 3U1LA 4YR3A 4K0KJ 3KJNB 1S0NA 3CDBA 5D4OA 4RUHA 3IAS9 2PFFB 5T7LA 3J80U 3IM8A 2KT2A 4U8YA 1RAHB 4NWBA 3W60A 2V4JA 5A6WA 2EC0A 3I4PA 1HI1A 1RE1B 5GVQA 2HPUA 2DNMA 3OD2A 4KKOB 5A8WA 1M1GA 3EWGA 5KG3A 3C19A 3WX4A 3J81Y 1VQOS 4Y2CA 2EBGA 1DFDA 3DOLB 3S8SA 3HVTB 3VGVA 1DRZA 4ZPCA 3CCRS 1AXQA 5J1PA 1P1TA 3Q8QB 4ATNA 1U8WA 1TTHB 2V8HA 2RS2A 2KN4A 2R7VA 1WG1A 3TUZC 4NMXA 2AJ0A 5JVHQ 2AHOB 5ETOA 3MTJA 3D5MA 1RHKB 2XZDB 1FTCA 3M8ZA 1G4CA 3R9LA 3TWZA 4URGA 3VAIA 2FJWA 1SPBP 2X7IA 2Z2ZA 4KFBB 1RHRB 1JJ4A 5AXLA 1WC3A 3D54A 1AW0A 3MMJA 4IDKA 2ZITA 1XNQJ 1P8GA 1S4FA 2B9EA 4F4AA 1OQ6A 3PR5B 1TKZB 2A1BA 4M5DB 3LWLA 3J80Y 2C2DA 4TYBA 3Q86A 3I82A 3NGTA 1FRHA 1FF2A 5E33A 2HLUA 2QFJA 4DG1A 4USJC 3H4BA 3OXGA 1SV5A 3Q2SC 3AH6A 1JQGA 1RTIA 2V8VA 2EG1A 2FYXA 3S7RA 4CM0A 1ZOTA 6AT1B 5KTQA 5A8KB 3J7ZT 3ET6A 4QPXA 4WK1A 3AOAA 3K5PA 4MH8A 2BMBA 4K4VA 1HBNA 3IR7B 4P71A 1FXLA 3UR0A 2J76E 2BV3A 3DLKA 3Q83A 1NHUA 1ZBTA 2BJ7A 1VRTB 3GJSB 4DL4A 2DNHA 3KKFA 4DV0J 5KG7A 1URNA 4J9VA 2AF6A 3PHTA 2CJ9A 2NPFA 2KG0A 4EEYA 1M1HA 2OMLA 5IWAJ 2ZUGA 1S1VB 2FZGB 3GJTB 4DL7A 4OZ5A 2FLNA 5B08A 2WB4A 1N32J 4IYQA 3BR9A 2DGVA 2G13A 3M6XA 4TY8A 4USMA 2Z57B 3JSYA 2KTQA 2WOMA 1O5JA 2J5AA 3R27A 4XO0A 3JYTB 3R7NB 3GPAA 3MMBB 4RZRA 4YFUA 4WWSA 3N6NA 3M8QA 3GIJA 3CCUS 3WC2A 1DQ9A 2BR0A 1JLAB 3NWGA 2XY6A 5KG2A 2GHPA 5EDWA 1VQMS 3OTOF 2HAIA 2F8HA 1V5IB 3Q8RB 1JLGB 1NMEB 1HQEB 1RDRA 3D6HB 3DMJA 3BKUA 4OQJA 5D6GA 2ZJQQ 3NBPA 5HQLA 4YB6A 3Q89A 5ETTA 2MQOA 3A8KA 5LT5A 3MUTP 2CYYA 2PSZA 2F65A 2CPZA 1R27B 4USTA 3HHDA 4JI0F 4DX5A 3SMZA 2E7WA 4AQYF 2BZ2A 2FQQB 1CQMA 5I3UA 2W4PA 4GVBA 3H2LA 1EARA 5F8GA 4PAAA 5KFPA 2IM1A 3UVJA 3EICA 1IR2A 4MJKA 3AOBA 2BUNA 4NLQA 4QR0A 3U02A 2HNZA 1PAEX 5HVFA 4DL2A 1XK8A 3AFGA 1CJVA 3DU5A 1OSDA 4QIGA 2HAFA 3C6TA 1VQKS 1SCJB 1HHQA 1JLEB 4I1TA 4PUOA 3FRZA 2WRMA 4NLXA 5BXIA 2LCWA 3KLHA 1GH8A 2DHGA 2OKQA 4TN2A 1URRA 3PKYA 4QWAA 3L3CA 4PWWA 2WOMB 2D3UA 4X4NA 2BQUA 3JYTA 3QJJA 2VKZG 4V19J 2LDYA 3M32B 1R6VA 1Y0HA 2AYMA 4IKAA 1X31C 3ITHB 4LF5J 5J1EA 2GQQA 2BJEA 5M2PA 3C14A 2DNGA 2JEIA 3GE9A 2D3ZA 2EKNA 4BBYA 4WIIA 2R7UA 2DGWA 2FHJD 1VDHA 1WC6A 1FFGB 1IBLJ 3PV8A 2UXCF 2YWEA 1AZSB 2J6TA 4M5LA 2L3MA 1FDBA 4KPCA 2CPJA 2JZ5A 4KQZA 5F0UA 4EO6A 4UT4A 2CQDA 1TFWA 3IGNA 5D3GA 3IR5B 2H4YB 1RT2A 4PXCA 3J81U 2W4DA 3I55S 4DV5F 4C6AA 1FVQA 4ZP7A 1R8CA 1RT7A 1VIOA 1HNWF 1TL7A 3W3SA 4EUVA 1IXKA 3MPVA 1RT1A 4DSIA 2CJQA 4RW9A 4JI2F 3O44A 1RABB 2DXFA 3ELHA 4UZCA 3OL7A 1JLEA 1XBWA 2VKRA 3T6JA 1NDKA 2FGOA 1N32F 4L74A 3AA8A 1U45A 1RWNB 4LF8F 4JI8J 4DV1J 3HHNB 3R6LB 2QFIA 1CG2A 3CC7S 3KWMA 2WVCA 3H59A 4NLWA 3CULA 1PSDA 3ZZRA 3G8SA 4DV4J 2VBYA 2VICA 2UVWA 2AIRB 3NOGA 3VAMA 2VOPA 4L76A 3QGHA 2I0XA 4DBQA 4K4XA 5CD4H 1SH3A 4PCQA 3V4IA 5F8JA 2VA3A 3DYAA 1HNIB 1NSAA 5F0WA 2M52A 4OZ0A 4AQYJ 2HWHA 4KAIA 1RTHA 2DGTA 1R8PA 2BRLA 2W4CA 2C2RA 3B6BA 3MECA 2FJBB 3I5AA 4I6YA 4WXOA 1S48A 2UXDF 1HMVB 4X2BA 5HL7Q 1LWCB 2ATCB 3DM2B 3A4TA 4ZCKA 3OSNA 3BREA 5KT3A 4DR5J 1W2BR 4LF5F 5KFZA 1BQNB 3E51A 3UPFA 3WHIA 1U24A 1QE1B 4WIQA 4NCAA 1VBYA 5IT9U 1IWAA 2E1AA 3HKWA 4KJIA 4C8OA 1N8RT 1DY3A 4RKUC 1ICEB 1HWUA 1KLMB 4ED5A 1MROA 2AT1B 2IM2A 3NY0A 5KT4A 4XPCA 3K5MA 4ELTA 5DDRC 2CPDA 3VF0B 4CH1A 4RPFA 3LO3A 4DU8A 2YQ1A 2CWXA 1WELA 5LSOA 4Y2IA 3R5JB 3VAHA 3KHHA 4ZN3A 2B8PA 2VUGA 1IBMF 2ZM6J 3SSSA 4U6PA 2CFXA 3JS9A 4IFYB 4UOCA 1R6YA 3MR6A 4LF9F 4MFBA 1RHQB 2A0FB 1NPKA 5DZ7A 1L5UA 1EIYB 3PO4A 1LOUA 2CG4A 1WSVA 2CJAA 2YX1A 4EBCA 1IM4A 4Y00A 3LH2S 5KFMA 2J9DA 1U0HB 3BGLA 1JNZB 5KFAA 4ENOA 1WKLA 2DTJA 2J9CA 3W62A 1U48A 4RL1A 5GAGI 2W7OA 2QL5B 2MQLA 2XC9A 3D6MB 2XYGB 2E5LJ 5GMKa 2GGPA 2VONA 2GMJA 3R1LA 1QAXA 4ZJQA 1TL7B 4LR9A 1BQXA 2GJ2A 3D9BA 4ZK7M 3K2YA 2BW2A 1FKAF 3KHLA 4M8LA 3LAKA 1KVJA 1IVZA 3GTYX 1LV5A 1R43A 3DRRA 4B9NA 1P9YA 4DN9A 3OLAA 2J0QD 2MY8A 4PYDA 4DPUA 1OPZA 3G8TA 4B9VA 4OHZA 2J6UA 3PEJA 5KFCA 2VB6A 5SUHA 2X1FA 1WTFA 1HW8A 2FVSA 4UOHA 1NK9A 2HW3A 1RA6A 2MMYA 4Y6IA 1YI2S 1NB7A 4JUZA 1IWGA 2LEAA 1WC4A 3KFWX 4C0HA 4ZCIA 5BR8F 1FRIA 4C98A 3FJ2A 1QDUB 2UUTA 1EKRA 1S97A 4MIBA 1R8BA 4O4GA 2F40A 3OW2R 1N54B 3DOKA 5C25A 3RTVA 3IO1A 2HK3A 2QIFA 1TU0B 4E0DA 3RU0A 3SQGA 3POTB 1SL0A 3HHLB 4NI2B 4ZA1A 1HFEL 4EU0A 3NGDA 3KLHB 2DO0A 2L9WA 4X4QA 2FHOB 1YBTA 4DR1F 3Q23A 4KC5A 5DG7A 2W8LA 1CVJA 1HLWA 3GFXA 1XMQF 2H1YA 4LFBF 3GZ7A 2MQ8A 1RLDA 4EGLA 2LQJA 5HATA 1I5OB 2XQCA 1VK3A 4HTIA 4O0IA 2IVYA 5F3TA 2C42A 2FC8A 1MMNA 1RUSA 2PGCA 2R4FA 3GSIA 1EHWA 3NCRA 4OYAA 3ZZOA 1Y3JA 5HMXA 4L3NA 2NLWA 1YJNS 1UVMA 4YOEA 2HHTA 2GMHA 2HRTA 3AT1B 4NZ0A 1QAJA 2ZM6F 9ATCB 2W24A 4O3QA 1X8DA 4DOZA 4E2FB 2F3JA 2XNRA 1N56A 2VV5A 3GU0A 4DQQA 1CJKA 1QAYA 2HFSA 2J7UA 2L08A 4Y2AA 4Y3CA 3IG1A 1PC4A 1VI7A 2YPZA 3TAMA 2EBEA 4PZVA 1UL3A 2N82B 1LWFB 3ILIA 5KFSA 3AAWB 4Q8EA 3CF5Q 2LU1A 3L7OA 5DZ6A 5ETMA 5DLGA 5GADI 4IQMA 3EZ5A 2CQBA 1RT1B 2YH0A 1GX6A 4RX6A 3ZXWA 3PACA 3M2RA 2ROEA 4WFNQ 1LEOA 1REGX 3PHEA 1YGYA 2YNFB 3ZZ0A 4CLWA 3MGJA 1S6PA 1FJCA 3KG4A 4LR7A 1KLMA 1SC4B 5CCLA 3IRWP 3UQSA 4EZ9A 1WI8A 1PYSB 2BW7A 2OSQA 3IMQJ 2Q66A 5B0AA 1TL3A 1Z4UA 5HI7A 4DG1B 2MPUA 4NLPA 5KG6A 1AYEA 5HAOA 1NZ8A 2WCXA 3CJ8A 1T03B 4ZN1A 1HBMA 3DLBA 5LSRA 3MCNA 3K17A 1ZH5A 3NL0A 1P9QC 2Y1RI 1R8HA 2HVEA 3OT9A 5K5MA 3TJ8A 1HNIA 1MN9A 1RT6A 2B6AB 3O8WA 5AE1A 4HTJA 4UQGA 3GIIA 3BDEA 1TVRB 1S0MA 1V6HA 1GXTA 4F25A 2JNJA 2MSTA 1TMMA 3D6TB 3UW1A 4P73A 1LQ9A 2QG9B 3MUMP 4QYZJ 4IG0A 3IN5A 2YWWA 1YZ6A 3RZAA 3RR8A 4H4OA 4LSNA 1HWJA 1S1VA 3SCLE 3NCPA 1S6OA 1SJFA 3D1HA 4QIFA 3M8WA 3HHLC 1OQ3A 2EI5A 1RT3B 2ERRA 4WPAA 2HNZB 2K3IA 4X64J 3LGNA 3GFYA 1VK8A 4DSEA 1S1WA 1Q78A 4AYBD 3JTOA 4L73A 2LECA 1PYTA 3NG8A 1GK8A 5KFVA 3BH7B 4G6VB 4P75A 3BBFA 2VQFJ 2CQ2A 2P6TA 3QAEA 4ED8A 2KU7A 1K0VA 1SI9A 3KMSA 4DL3A 1HQEA 4FVCA 1F9FA 5H9FK 3UDCA 3EGZA 4DQRA 3FDSA 2D3O1 1HI8A 1VQPS 4KIAA 1UETA 2H4WB 2JLEA 4OYWA 4KB7A 3TEGA 5F3ZA 3GMGA 4RUCA 5J2PA 2AJFE 4GKKF 1LXNA 2HYIB 1U0HA 2NXCA 2KDOA 5ETNA 2VU5A 3H5XA 1X9SA 1U8SA 3V4IB 1XNRJ 2R7TA 2CPFA 5KT5A 3SQGB 5I3UB 2R7WA 1QTNB 1HNZJ 1CPZA 1K1SA 4KY3A 3RBDA 1S4EA 3R5DA 4X4VA 1TQLA 1FE4A 5FD1A 4ED7A 3M8PB 3I31A 2B5JB 5F8NA 2B4OA 3Q0AA 3PW4A 2AD9A 4PUOB 2Y8YA 2VBXA 2P9EA 2RIJA 3A3PB 3UNGC 4KSEB 5B09A 4DV6J 3K7RA 1PBAA 3UN5A 3UR3C 4OI3A 2AYBA 2BJ8A 4FP9A 4WFXA 4OX9J 2YXLA 4I2QA 1C4CA 1WF2A 3EVOA 3T19A 2AW0A 1OY8A 2IPOB 4RNNA 2I8EA 1O51A 3G96A 4J9MA 2DXEA 2ROPA 3HVRA 5D4NA 1S49A 1MMDA 3M9MB 4C11A 2G0IA 4JV5J 2ABYA 3MM6B 3QLHA 1WACA 4F8RA 2XNQA 1IKWA 3M6VA 4Y2MA 5HMZA 3PW7A 1WNEA 3CCWA 1ZPWX 2R9LA 4OYXA 3TVYA 3P45B 4F4XA 1SC1B 1MWYA 4QIWD 3SEOA 5CYJA 3FBBA 3I0RB 2FPHX 4JI1J 2VZ9A 2DNPA 1SC3B 2IBOA 1TUWA 3LAMA 4CO2A 5F8LA 3ENAA 2PMHA 1FWPA 2DNOA 4CIOA 1BQNA 3V6DB 3QFWA 3HVAA 4CI0B 2F1FA 5A76A 3AHPA 5LMUJ 2UUCF 1FX4A 4D3GA 1NB2A 1XNQF 2Z56B 2ZH6A 2DO4A 2CPEA 3MEEA 2UXDJ 2F63A 1YK9A 2V2KA 2X51A 5C2GA 3NRBA 5DO2A 4C8ZA 2WTFA 4EYHB 1WHVA 3A8JA 4BHQA 3N01A 3FNNA 1JLAA 4CWBA 5K8MA 2ZJPQ 2EEYA 4G1QA 2Z58B 2IJRA 3K8WA 4YUDA 4X4SA 1WSRA 3D67A 1RBLA 1KR4A 4S0MA 4HLBA 3KLIA 3NGSA 2BA9A 8RUCA 2VPZB 4Q5VA 1U6ZA 2GAHC 3MM9A 1NBEB 5HSPA 3J81j 3T1YF 4ILRA 1TK0A 2R8JA 3RW7A 5IWAF 3NNAA 5ETVA 2N3OA 1TUGB 4GKKJ 4MMOA 3RBEA 4LUBA 1HIYA 1LWFA 2HHPA 4AXJA 1M5KC 2KZMA 1FKOB 3IR6B 2MQQA 1VIXA 2QSFA 2B7BB 5KFRA 3MM5A 2DR7A 1FDNA 3SXLA 2MB0B 2R7XA 2GQ2A 2MJNA 2AJ2A 2VFRA 1TL1A 4UUWA 3SFUA 5JXSA 3IM9A 5B0BA 1XN9A 4A8XA 4CO4A 3G4SS 4B3TJ 3EYZA 2R2TA 4A48A 2HVHA 2GAGC 3NS5A 2NYIA 2YKNA 2RU3A 2I5JA 2YX7A 5ETPA 2IIHA 3PJXA 3U1MA 2FVQA 3DOLA 3TNVA 5DRKA 1HHSA 1ZM9A 1LFWA 3BGOP 1XIQA 3VGTA 4WZMA 3CCSS 4HHHA 2OEJA 2CZ4A 1UPPA 2AYGA 1XQIA 1RWXB 2EFNA 3FCWA 3TI0A 1RAEB 2MEWA 4JI0J 3VGUA 5IC4B 1IR0A 2Z8QA 2IJFA 5J2MA 5IXUA 4XDCA 4XIUA 3CJKA 5K8PA 3RYLA 3FQLA 3UD4P 2LKZA 3W5XA 4BWJA 4J9RA 2IHR1 4PXDA 1S9EB 4K4SA 4HL9A 2KM8B 4EBEA 1TELA 2F9JA 3D3BJ 1M1KT 1B64A 7FD1A 2QZ8A 4CLSA 1KLNA 2HBRB 2O01C 1AA1B 3MMAA 1SV5B 2KO1A 3FBEA 1XWLA 4OYIA 4R0JA 3I56S 1N6QB 4HACB 1SKWA 1Y11A 2AEMA 2B9WA 2V4QA 1Y7PA 4Z2XA 2QO3A 3RAQA 3I96A 3MM8B 1PKUA 2YKNB 1R0CB 3N28A 1VRTA 5IM0B 4DPYA 2VFTA 3R5BA 2HS0A 1CC7A 1VGYA 2BJDA 2W2MP 2WB1D 2WVEA 2ZBIA 2LA6A 3EJMA 3HDSA 4CLYA 4QW9A 3I5BA 5CABA 5KFEA 1T9WA 4IRCA 1CBKA 3OTEA 3CJ3A 2HLTA 3KJFB 4GMKA 4WE1A 1VBZA 1I94J 4UUXA 1YKWA 4FF1A 1YDLA 1VBKA 2CJYB 2KT3A 4O3OA 3X3UA 1Q7LB 4M5KA 4ZLNA 2GX8A 3KLFB 3EX7B 1Y5LB 3DXBA 3BKTA 1RBOB 1HI0P 4M94A 1K8AT 1HNVA 4FKXA 2E5IA 3CTRA 4YHHJ 3AA9A 2CJXB 2OMOA 2KJWA 1GXUA 3SIPB 3MZIA 4I2QB 3S6EA 3UCUP 4Q0BA 1HBOA 2WBRA 3HVTA 4IOBA 5F41A 3IRXB 4UY85 4FF2A 1RAFB 4Q2MA 1ZTTA 4IRDA 5MLCV 2CQPA 1FRLA 2C3MA 2HGNA 2ZDPA 5KFOA 2YQ0A 2AEJA 3FKBA 5D4PA 5B0EA 2RQCA 3H40A 1K9MT 3C46A 4L72B 1SIWB 1HWKA 2M4MA 2VC0A 3DDNA 1TKDA 2UU9F 1JB0C 4WKRA 2DPIA 2JC1A 1MW7A 1UCNA 5C42A 3VHQA 3AJDA 3QT7A 3OV7A 3DMJB 3FQKA 2YWKA 1L3VA 1PIEA 4KHPF 3I9ZA 3M8RA 4OYZA 1VQ8S 3E2EA 2G4BA 1FXDA 4F0HA 3CMAS 4ECQA 2FJAB 3GB0A 2RMLA 5D77A 1QUVA 2RE1A 2Q3PA 4L6V3 3QRPA 1NJXA 1JLCB 3D1QA 3DLGA 4USKA 3W66A 3PZPA 2KXFA 4GVBB 1IQZA 1T94A 2DHAA 4KHMA 2V68A 1HNXJ 4KPYA 2PMWA 1IBMJ 2UP1A 2ACMA 1KHWA 2IYIA 3RBZA 2GW8A 3DRSB 1ZS6A 1DTTB 3DGPB 3DOMA 1ZA1B 3UD5A 4A8WA 2JX2A 1XMOF 1CJUB 5ETRA 2IDLA 2JRSA 3ZTSA 2MZJA 4X4UA 1RWPB 1Z2LA 2PC6A 3IFEA 2VFUA 3UWTA 2C28A 4DQPA 1XNRF 4M5IA 1F2HA 2J0SD 3NCQA 1NK5A 3C15B 4TU7A 1OS5A 3EXYA 3C14B 1R0AB 4IG0B 1NPRA 3BBCA 5L38A 1UA1A 1WHYA 2VH7A 2FY1A 2HFZA 2V0NA 2ZH5A 1K44A 1S9EA 4CQ1A 4LT6A 4O4GB 4FBTA 2AYEA 2GHVC 3MEGA 2V34A 2MZ1A 1I94F 4RWXA 2I38A 5L9XA 4QYZK 3FBFA 3Q24A 2C2OB 3CJ4A 2LXIA 3PYFA 4MKYA 1VJWA 5U47A 4ECRA 1T3NA 4P74A 2OP5A 3CCZA 2BBEA 1IJFB 1T9XA 1VYAA 2EFOA 2JL9A 3O6QA 3QO9B 4ZS6A 4M63A 3OHAA 2FHJA 4O3NA 1S57A 1HA1A 2DGXA 3BGUA 3H7HB 4YY3F 1CULB 3PCOB 4LRCA 3AODA 3KG1A 5CYQA 3UO0A 2LXFA 4IFYA 4U67Q 4RNMA 2XTJP 4ED0A 4ZCMA 1U2FA 3SQOP 2KHCA 1TKTA 1UPMB 2Y1IA 5HP1B 1RYRA 4ZITA 2NCKL 4WE1B 4DR1J 4CM2A 2M9KA 3HF5A 3LWMA 4CLKA 2VG6A 4DZ6A 1OPIA 2POKA 2OFHX 2VD3A 1ZAVA 5CZXA 2HGMA 1NH7A 4F04B 1CJKB 3T5HA 5A2QY 1N34J 3PIPQ 1JIHA 3PX0A 4Q7AA 3O2IA 3CCJS 3MPYA 2JH3A 4DSFA 3RB3A 2R7SA 4CLZA 2U1AA 2Y9HA 1QVFR 4OYMA 4QU7A 2VODA 2D1CA 1MMLA 1NCLA 4LRBA 1JLQB 3KHGA 5L9NA 1X5SA 4R5PB 1QVGR 1HD1A 1SB6A 1U09A 4PYAA 3M2RB 2RHQB 4P6QA 4RBUA 4WCEQ 4CO5A 2HNYA 1T9TA 1UWAA 1FE0A 1GAOA 1FRJA 2P6SA 1U6BA 1ROFA 2HURA 3Q2TC 1DARA 1ZM2A 3CJ2A 2R42A 4B3RF 3QIPA 3MXHP 3MOZA 2WSEC 4W90B 3M05A 2EXUA 4NASA 3TA0A 2C1EB 2ZBQA 4E98A 1RXOB 1WOSA 3GYNA 2R7OA 5LJ5Y 4B9UA 3D2WA 4TXSA 1U47A 4RLEA 2AJ1A 3H90A 1MWQA 4QU6A 5IFMA 1N5TA 5C42B 1H2UX 3T1AA 2LEPA 2A6MA 2FC9A 4CO1A 3A12A 3HFVA 1L3UA 3CCTA 4ZVEA 3OFGA 1TVRA 1YITS 4QBUA 1FNXH 2MLZA 1RQ0A 4DX7A 5G0RB 3KLFA 4LBPA 3H4DA 4B9MA 3DN9A 4FYDA 5BYSA 3PJ9A 4IOCQ 5D3GB 1HNWJ 3QYYA 2ZE2A 2RRBA 3HSGA 5EX0A 1IUJA 1VRQC 4KE5A 4JYAJ 3BV8A 4AFFA 1C1CA 2Z2LA 1RT3A 4Z7CA 4O0NA 4KT0C 2LQ5A 1Q16B 1JLQA 3RBXA 4B9SA 1OY6A 5KFBA 3N5BA 4DJBA 4ZIWA 3GV5B 1R31A 4FYYB 4B3SF 4AE5A 4A8SA 2QMXA 1V3ZA 2WW4A 2DRBA 3KXDA 4V1Ak 1PJ7A 1A0OB 3ZZPA 1CULA 3TX0A 1ZM4A 1NKEA 4WF9Q 2R2RA 3R6GB 4LIRA 1NK6A 3CD7A 1RTIB 4YB7A 2FJVA 3H2UB 1TP7A 3R97A 4FS1A 1CQNA 3FCHA 3QSIA 4H4KA 3V5RA 1NJIT 2B9XA 2HVDA 5D78A 4WU3A 2MQNA 4JV2A 2OPQB 1Q95G 3HLUA 3IA0A 2RRNA 3LTOA 4NYOA 5T7LB 2VL1A 4NI2A 3PRDA 3T6BA 4QZVB 5GAEU 4ZKAA 1NSPA 3MURP 2C2KB 2MLXA 4OJ1A 3G6XA 1WHWA 2ZFHA 4HH1A 3ILLA 3MF5A 3PW0A 2BE2A 1TL4A 4V19X 1YZ7A 2L48A 2YKQA 4NXNJ 3AJ1A 1KQKA 3VVUA 2ZC4A 4B02A 2IA0A 3BGRA 3QWPA 2MKJA 2RUSA 2XWYA 4WP8A 1RCOB 1F0XA 3TEHB 1NUEA 2Y1LB 1S1XA 3MPUB 1S59A 3UI3A 1UEUA 4DI6A 2HHSA 4WFZA 4DR5F 1D1UA 2AWZA 3DGPA 3M8YA 4FF4A 4DR6J 3GCXP 5KG1A 2XLJA 2PMZD 2YQ3A 1K73T 2ZZNA 5DGAA 3CD5A 3MFIA 1B70B 3KUGA 1Q5VA 2ZEJA 1REVA 3CT9A 3ISNC 3NBPB 5AXNA 2QLFB 5D15A 2KFYA 1PG5B 5KFUA 1LW0B 5CHCB 4J9NA 4QR2A 2M70A 2AQ4A 2JOQA 5G0RA 3J7A1 4JB8B 4TU9A 4ECWA 3V4MA 2ZHAA 4R5PA 4FF3A 3TAMB 4YR0A 2UXBJ 2OPRA 1VC6A 3KK3A 4BDPA 1TL3B 4LF9J 5KAKA 1WF1A 1KWMA 4X66F 2D74B 1NRKA 1UAWA 1NO8A 2L9DA 2VG5B 4DV2F 4B3SJ 3SI8A 1WDTA 3C16B 3SV3A 4ED1A 2ZOFA 2B43A 4FXVA 4KGMA 1AFIA 5KT2A 2E7XA 3H8YA 1RT5A 4KO0A 3CE8A 4USVA 4DPWA 4F67A 2MKIA 4OZ1A 2DRAA 4KH1B 2O3DA 4U9RA 3CDWA 1UVKA 3M32A 4MKVA 4ZVGA 1IBKJ 1T03A 3LUYA 2N3LA 2ZDOA 3L7UA 4DUYJ 2GMLA 1D09B 1JKHA 1RISA 2HRYA 3ENQA 4AT1B 3B4MA 1U1LA 1Z2ZA 1W26A 4JV5F 3HSDA 2HS4A 3CDUA 3HVWA 1GX5A 4UF4A 2RB7A 2CQCA 4YR2A 4DFPA 4LQ3A 2HHUA 1S99A 1WC0A 2P2CB 3DGVA 1Q8LA 3VZHA 3VAGA 4DZDA 2X3DA 2BJ3A 1UEKA 1SVDA 2J9EA 2QX0A 1HQ2A 3KK2A 4W92B 2HS3A 5BYQA 1F2GA 2J6SA 1HNVB 1WOOA 3GWCA 5B0CA 1SL1A 5BR8J 5F9LA 2NR0A 1LWEA 1RT7B 2CUYA 4CTAA 4C48A 2K2PA 2GNKA 3QFHA 3KDNA 3LP0B 2IRXA 3M2VB 4ZVHA 4PPDA 2NPIA 1OYEA 5DDQC 1GMUA 1S1WB 1PYOB 2IYGA 4F4YA 1O8BA 3CMES 2HHQA 2V6AA 3K59A 1ZYQA 4NXMJ 2VFVA 3FMBA 4FDFA 1CLFA 1UFWA 1NDLA 3FUYA 3W61A 1XTZA 3DXSX 5ITHA 1LKZA 2CDQA 5L1KA 2ATLA 3VAFA 3VQTA 2DNQA 2HFVA 4Q2LA 3MCSA 3ZNJ1 3TP2A 5KFKA 4TU8A 4J9QA 1N33J 4PPZA 1KRPA 3CXCR 2K1RB 2MDAA 2COLA 3GV7B 1ZA2B 2FJEB 3R5CA 2RRAA 2NUHA 1VQSA 1YJWS 1UZDA 2NZCA 1Q53A 1APSA 1H7WA 1VQ9S 4I56A 3CJ5A 1X4DA 2I6WA 3KLGA 4IOAQ 2OLWA 2OPRB 1AUSL 1J5EF 4ITSA 1SL2A 2D69A 4DV1F 2HNDA 4G3IA 4PXBA 1XMBA 1YRUA 3BGRB 4O3PA 1KEKA 3PFEA 4ALZA 1YJ7A 2VIHA 3KNAA 1FNOA 2KYZA 1SJQA 7FDRA 4ZPWR 2NQPA 1RWVB 2AMCB 3GIRA 3HFKA 3VCDA 2KXNB 2ZJRQ 4X4RA 4X66J 4A8MP 1BWVA 4EI2A 4ECSA 1U1RA 1HR0F 5GAHI 1U6FA 1MROB 3CJSA 1EETB 2ZBCA 2LLZA 3DLEB 5HVHA 5F8HA 2R8HA 1JLBB 1OY9A 2B56A 5G4DA 3HHLD 2DNNA 2MZSA 3HHEA 2VHGA 3OJSA 1REVB 2HBZB 2OPQA 4L3KA 1WHXA 1Q81T 2QMWA 2QE5A 3KJQB 4C3MA 4DHVA 4DXLA 1B3TA 3OBIA 2GJFA 1RP5A 2ADCA 2ZHBA 2ASDA 3VTIA 3ONQA 3BSAA 1AROP 2O67A 2CJBA 2DGOA 4H4OB 2DR8A 1Q1KA 3ISND 2ILZA 2AZ3A 2MKHA 2V8DA 1NK0A 4USIA 3AB2B 1VQYA 2DNZA 1RACB 3KUEA 4J37A 4C8KA 1ULRA 2WSFC 4MKBA 3SCKE 4NXMF 2BQ3A 3OFHA 5CH7B 1RGVA 2B4UA 2CNLB 1UFLA 3W9IA 1Q8KA 2W7PA 2ALZA 1U02A 2DT9A 3LGHA 5E5NA 2VDIA 1FWKA 1DAXA 1RT5B 3G82B 4MK8A 2ZH9A 4X62F 3LANA 3UDVA 1OMSA 3MD1A 2QGFB 3BB5A 2M3DA 3EGVA 3HPOA 2QN6B 4YB1P 4HYKA 3QIPB 1HBOB 3GLJA 2G0CA 1RB0A 1TUVA 4PG5A 2JEFA 4KV8B 5DG9A 3MCOA 4WXWA 4YS2A 5KFNA 1FERA 2HWIA 3VAJA 1EETA 4GO5X 3DLEA 2CQ1A 4ETZA 3OJUA 2XMKA 2QLWA 5RUBA 3F56A 3TZXA 1SQGA 2JEJA 2IAJB 1JNRB 1I51B 2HRUA 4H54A 1S7HA 1PAUB 2FUG9 2V5HG 4FYVB 5IQ6A 2ZVSA 4TNOA 4C0BA 1F1BB 2PIIA 4FS2A 1N5VA 3ZNUA 4DPOA 1LWCA 3DM2A 2R7RA 3OLBA 4OI1A 2W9BB 3I4HX 3UD3P 1TK5A 2HVIA 3TUIC 4C7QA 2QA4G 3KLIB 1RU1A 2HZCA 2DISA 2MSSA 4RW4B 3KLGB 1TK8A 2CNOB 5KFYA 1HYSB 2OTLS 4M5HA 3LA0A 4YDXA 2OJ3A 3FC9A 2CZVC 2M2BA 2V67A 2FB0A 1GMWD 3FBCA 3OFEA 3SSRA 3UE2A 5FIIA 3G6VA 1SUQA 3EDQB 4TY8B 3UN3A 2JVRA 4OZJA 3KK3B 4A8OA 3DLHA 2DGQA 2EVZA 1EJ7L 2BE9B 2EFGA 2WONA 4ZVTB 1F3FA 1MLAA 3BH6B 4I68A 4QYRA 1UZHA 2FY8A 2ZBRA 3K8VA 3ZC4A 4LRAA 1X4GA 2E5JA 2Y0SD 4OIXA 4YMEA 4K59A 1VC0A 3RB6A 4RBTA 3W9JA 2IY5B 1FKPA 3MR7A 3JSMB 1TR0A 3DCAA 1WWHA 4B3OA 2XSJB 3H20A 4LFCJ 1H0HB 2J0WA 3J7YU 1J5OB 4BCAA 2EW9A 3F44A 3ENWA 3LF0A 4KR0B 4LF6J 3BKFA 2ZD1B 2HG4A 3B4DA 5L1JA 4NE9C 2V9KA 4NXNF 3NAIA 4IFVA 2ZHOA 4LSLA 1DQAA 4CP5A 1EP4B 2FLLA 3MR2A 1N6QA 3WIVA 5L39A 4EYIB 2ZH4A 2RDDA 4WTYA 4PRFA 2LDIA 5H9FJ 1WTBA 1FTRA 5KT6A 3E01A 1GFWB 1YQHA 4FPRA 5GAHU 5KFWA 4LFAF 1SUQB 1X4CA 1C4AA 2R7QA 2XSFA 3DRRB 1LNQA 5J2NA 2F9DA 1FI4A 3JB9k 4K4UA 5IM0A 3V6KA 1FFSB 5J2QA 1KOOA 3ITHA 3OSPA 2V50A 4C8MA 2E5HA 3U7JA 1NJYA 4LBHA 3C3LA 3OVBA 3MEDA 4IH5A 1KQFB 1YWXA 5K8NA 2W9AA 3G9CA 3JTNA 2RAQA 2YX4A 3RB4A 2CZ9A 2W2NP 1KOHA 3L9ZA 4C97A 4M1KA 4IQXA 3PNIA 3OVAA 2EWHA 4O44B 5HP1A 1GEHA 3PYGA 1T11A 3QJLA 4FXDA 1FA0A 5HJXA 1R89A 2IMOA 2Y3YA 3A13A 4RBVA 3NS6A 3ILOA 3TAPA 3MR5A 1J2VA 4GRSA 5FLXY 4N5SA 2YWGA 4DWIA 1YTYA 5LL6d 1RWUA 3I5CA 4DV2J 1X9MA 1N5SA 1KHVA 1FK9B 5K14B 3P6YC 2BANA 2G9OA 2RILA 3CWJA 4MT1A 4RW4A 2ZOGA 5EWEA 3OUYB 1IBLF 1G2EA 2GIQA 1U1MA 4KRWA 4L75A 4JI6F 3MM5B 5LXYA 3V6JA 3H0PA 4ECYA 2YKOA 4JI8F 1RAAB 2AX1A 3CCES 4OV6A 1SH0A 1CJUA 3BBBA 3UCZP 2K8GA 2YBVA 1YIJS 2HGLA 5EHHA 1IBKF 5AE3A 2MZTA 1DURA 1CEZA 1WC1A 1ZZFA 1N34F 3D4JA 3DNCA 1F9HA 4I4BA 3BEGB 5CA5A 1HL6A 1J27A 3VAKA 4RNHA 6FD1A 3AD9C 1R0AA 1HKAA 4NLRA 4AL5A 2IM3A 1SH2A 3CJTA 4OLOA 2Q6BA 4QPTA 3D68A 3BO2A 2ASYA 3FRYA 3Q8VA 1ZM3A 1WORA 1WKKA 4P2XA 1JLCA 4KH0B 2OUGA 3TUJC 2ZWPA 5IQQA 2MZRA 4HHJA 4NOHA 3KK2B 2MLYA 3R2CJ 1D8ZA 3FSIA 1JK9B 3DHXA 2HK2A 3F41A 4J9PA 3QJPA 2IDEA 4GKJJ 3KUHA 2U2FA 2C3UA 2ZH2A 3HJFA 4X4OA 3AY0A 4NLVA 5T14A 3OUYA 1T95A 4IH6A 4RUAA 2FJXA 2D7SA 1ACMB 1ZAXA 3CGIA 1GMVA 1N52B 4H4KC 1BD6A 1B0TA 1V5VA 3H5SA 2GO9A 4F7VA 3GIKA 3CO0P 1XC9A 4QWCA 4ILLA 2FD2A 1SQFA 4NLDA 3SZ2A 2RQ4A 2NYHA 2W7AA 3KLEA 3EZOA 1NKCA 2PI4A 2RKIB 5DDPC 2ILYA 3HFZB 4HR2A 4FYWB 3R1HA 2VJVA 5D4LA 1UTAA 3TRGA 4F50A 4M5JA 1M5PC 1C0UB 1EQMA 1KDNA 2CA9A 2I2YA 4JI6J 4ZVQB 3QGGA 4KFBA 3OTBA 1G3OA 4NCGA 1RKJA 2DGSA 4PG6A 3IC1A 3RG6A 3BO4A 2Q43A 1YBUA 2V69A 2XG8A 3PM9A 4Y0FA 2DITA 3LPEA 2IBKA 3CD6S 1S7IA 4HDGA 1FJEB 3D3CJ 4DV0F 4USWA 3N4WA 3PX4A 4OX9F 2KI2A 5LM7E 3NNCA 3VR1A 3CCLS 2XYPB 4KHRA 2MY7A 5FDLB 4GC6A 2RF2B 3MAAA 4XAKA 2WONB 1S1UB 2LA4A 2MKYA 2N4DA 4X4PA 5BYRA 1AT1B 2Z2MA 4Q44A 4ER8A 4LREA 2IC3B 3CDEA 4MYUA 1UVJA 5A8KA 2ZWOA 1RAGB 1RA7A 4ECTA 1FVSA 4TLQA 3QT8A 4K4WA 5HROB 2XSJA 2RHSB 3AOCA 1FD2A 4JBCA 2YNIB 3OTOJ 4DUTA 1MWZA 3D28A 3B54A 4MKAA 5KFDA 4W4MA 5E2QA 2IRYA 4B17A 4O3SA 2JWNA 1H98A 5E3AA 5GAEI 2KJVA 3KJVA 2JFDA 3FZBA 1VHIA 3MPDA 5A8RB 1X5PA 3TW0A 1XERA 1TKTB 3MFHA 1A9NB 5LMUF 4OZLA 5HMYA 3C2PA 5J1EB 2XMAA 1BHNA 2H5JB 3QT6A 2OSRA 5HN0A 1S1TA 2P9GA 3BJYA 4EZ6A 4NCBA 3FEXB 2FVCA 4CCHA 1NU4A 1RAJA 4C8LA 4JI7F 3GONA 3DLGB 3OFFA 3BPSP 4LR8A 3TAQA 4Q8FA 4ES2A 4MIWA 2HBYB 1WEZA 4DSLA 5FDLA 5I42B 5EGYA 1GNKA 4K2JA 3RJMB 4HT5A 4OMFG 1CJTB 2VG5A 2YKPA 3JSBA 4GO7X 4N77A 3ULHA 1ZZNA 2WK4A 2NXNA 3PIOQ 1CS4B 1RHJB 4ZPBA 2C3YA 2OPSB 1RAIB 1WOPA 3M6UA 4FKYA 2DR6A 2ZNYA 3EXCX 1JLBA 2BM1A 4MAKA 4ECZA 1N4LA 3QWUA 3LP2A 3KTQA 1R7IA 2I5JB 4ZLLA 3GV8B 2DPJA 5FLXU 4A8QA 1JJHA 2RH3A 4A46A 4HDHA 2PN6A 5HK4A 4BC7A 1VLOA 2ZKUA 1XR7A 1PILA 3JAMY 4U7CA 3EPIA 4DUZF 5EWGA 1U1KA 2V94A 1A7GE 2EK6A 3MD3A 4PXEA 4J9OA 4JI5J 2DH8A 1UVLA 3DRYA 2MZQA 1VS3A 3GR1A 3P49B 3MEGB 2WZ1A 4YN3B 3T5LA 2BKPA 2Z2YB 1DHMA 1H2VZ 4F3MA 4N47A 4C3KA 3KK1B 3DYAB 1DTQA 3T1YJ 4MYTA 4NA3A 1M5OC 3ZFVA 1VQ7S 1S72S 5AXKA 2ZH3A 1KFDA 5IC6B 2J8AA 3QNWB 2YVSA 3MECB 1S1UA 3MHYA 4ELVA 1H73A 2BABA 2NUUG 4DFMA 2ZC3A 5I3QA 2BXJA 2MGZA 3FMWA 2BDPA 5CYMA 2B7CB 5F9NA 5HJYA 2ALYB 5HROA 1DBDA 3BN4A 4OHVA 3CMQA 4B3TF 1S9FA 4QIVA 1X4AA 1B0PA 3LP1A 4NCGB 4LF6F 1HQUA 3IWXA 2P9CA 3NWRA 2AKWB 1SJ1A 4XTTA 2WSCC 2W1BA 4DEZA 3LQVA 1RTDB 3R2DJ 1FD8A 4P10A 3CCMS 2B4PA 1F6TA 1Y4ZB 1BC6A 1VHFA 1FRXA 4F4ZA 3CPWR 3FGVA 1UJ6A 2BE2B 2MJUA 4IFVB 3NLCA 2ACYA 3CC4S 4AL7A 2LFVA 5IV4A 3T1HF 3C16A 5KFGA 3BN7A 3PXGa 4N76A 3TVKA 4ED2A 1JJ2R 1DTQB 3NGUA 1UA0A 2LVWA 4QJVA 4EWTA 1YG0A 1H74A 5K20B 5J2NB 4NZ6A 1QSSA 1RKIA 5E0OA 1WEXA 4NX9A 4BWMA 5IS2A 2OO4A 2R3VA 5EUHA 4UZBA 2IFXA 3D0IE 2HVZA 3G6YA 4DUZJ 4NYPA 2QYGA 3OQ2A 3ZZZA 3OR2B 1A6LA 1KVIA 3BQ0A 4P2SA 5KT7A 1YSJA 2M8HA 1XR5A 5IT9Y 4Y65A 5A8RA 2X1BA 1E6VB 2G2YA 3KLEB 2BACA 2VJUA 1NDCA 2LEBA 5E3RA 3MMCA 3V2UC 4WP9A 4I69A 4JI5F 3QATA 1VJQA 2W2OP 3RRGA 4KTQA 2CQ3A 1TFYA 1S0VA 1PJ6A 2Y1JA 1LWEB 2VOOA 1ITPA 2G2OA 2CPIA 2HQ3A 3ADAC 4F4KA 3DRXA 4OX7A 1YJVA 1Q8BA 4HACA 2OIHA 3ZTPA 1YJRA 1HHTP 4DCPB 2UU9J 3O5TB 3FSXA 4QOTA 4IG3B 3K5NA 1JX4A 4YB5A 1N88A 2VPWB 5L8RC 3KOAA 2V2QA 3LP2B 3ZTOA 5J2QB 4ZLJA 3GYXB 4TYAA 1ZTWA 1D9DA 2RSQA 3R8YA 3U1NA 2CPHA 5B0DA 4YP3A 3L95X 2HQCA 4QR1A 1W7WA 4Q45A 1KTQA 2DNKA 1LK5A 1RWOB 1WF0A 2YNHB 2YWHA 3PTWA 4MFBB 3W5YA 7AT1B 1X9WA 1VBXA 2PI5A 2HHWA 1S12A 2OEMA 5C5JA 2IA6A 1X4HA 2YNIA 4MK9A 3LPYA 2MTLA 2OAUA 1CC8A 3H42A 2PO4A 3KNGA 3OTDA 3PW2A 4J9KA 1D3WA 2QJ3A 2GIFA
chains in the Genus database with same CATH topology
2ZZMA 3DI6A 4A8FA 3GG0A 1QM9A 4EFAC 2M7SA 2FVPA 3M2VA 2DIVA 4CZCA 1RT4B 4KGKA 1UVIA 4LF7F 1H6KX 4OI0A 4QWEA 1L3TA 2UVRA 4ZLPA 4OL8A 2Q79A 2LYVA 1Q8IA 5HMWA 2ROGA 1M5VC 2GHWA 2O5DA 3VALA 1FHTA 3OR2A 4OJGA 3CD0A 3BO3A 1GXLA 3QPIA 2GJIA 2GC8A 2PE8A 5KFIA 5KFJA 3KLVA 3UDLA 1ZAWA 5JUMA 1RTJB 1T05A 4NYZA 1QY7A 1FO1A 4ED6A 4O3RA 4B3OB 1MU2A 3N6MA 3R5AA 1TKXB 5HBMA 1U1OA 4YDDB 2K7JA 2HNDB 4ZP8A 1KC8T 4IUFA 2DD8S 3BSOA 3MM7A 2FLOA 5JJBA 5DQIA 5B0GA 3HKZD 1KNZA 4LSLB 1M90T 4J9LA 3BZQA 3DU6A 5D8HB 4ZCLA 1UMJA 3H2VE 2F7VA 1NJWA 4WFAQ 4NPOA 1M5SA 4KV8A 2XCAA 2BRKA 3QZ8A 2A2DA 2UXBF 2ADBA 3WC0A 1V3SA 3SDEA 2FLPA 4HT7A 2X3GA 4LVNP 2UZAA 3P3DA 3SCJE 2MGZB 1JWWA 2YNGA 3I87A 1BLUA 5THWA 1VMBA 2KKHA 2KVIA 5SZTA 1IKYB 3OL6A 3PX6A 2FVRA 4KBIA 3DLLQ 3GFZA 5A0YB 3OXFA 3BSCA 2HMIB 2XMVA 1HQUB 1S1TB 2YH1A 1T8EA 4TKTA 1UJ4A 2AU0A 1FT8A 4PKDB 3ZZUA 1DQ8A 4FZVA 2KHDA 4LJMA 3FEYB 2GV1A 1U2RA 1C1CB 3NP5A 4UQTA 2EPIA 2IMWP 1Y00A 2DH9A 2FTRA 1RK8A 4WYLA 4QCLA 4RW7B 1N5QA 4ED3A 2J0XA 1C1BA 2MHEA 4MTPA 2DNLA 2UUAF 3CUNA 3UCGA 2YTCA 5AXMA 2DCLA 2CPYA 1S0OA 2UVUA 6FDRA 1T7PA 1DLOB 2W9CA 1Y3KA 3I6PA 1S9GB 1DJ0A 2E1RA 3I0SA 3Q8PB 4A4JA 2YNGB 3S01A 2DR9A 2ASLA 1E6VA 1MU2B 3D1OA 1HNZF 5KOWA 2PD1A 2RDIA 2EK1A 4DS5A 2UV8A 4N56A 1O0PA 4ZHRB 5BJRA 1S10A 3E01B 4I6AA 3QGIA 4OI2A 5KFQA 4C9DA 2HHVA 3O1LA 4DF4A 1RJJA 4OX6A 3DDKA 3ENVA 2AJQA 5FJ4A 1NK7A 1WG5A 1HBUA 1N0VC 3HP6A 3M4XA 2KFZA 4JYAF 1S77D 2K3KA 4DF8A 2IM0A 5KOXA 3TQ1A 5CYMB 3T3FA 2V4RA 2WAQD 3MAQA 2CKWA 1P27B 1WI6A 3ISZA 1BY9A 5JVGQ 1S9GA 5E7OB 3N5FA 3GILA 3WBZA 1BWEA 1QTMA 5I4MA 2YKMA 1BGXT 3DC2A 1IKYA 2YKAA 1YBAA 4NLSA 4ZVFA 4G1IA 1U1QA 2PA8D 2ZE2B 3IS9A 4RW8A 2OD4A 4FVMA 2DVIA 4F3OA 2DB1A 4DR4F 3D0GE 3M30A 4EBDA 3RR7A 4GKJF 2F8MA 1TZ0A 3DHWC 1C2PA 1H7XA 2DBBA 2YY3A 3I9V9 3OVSA 1AUDA 1D9AA 1P1LA 3POTA 2ZOMA 1F60B 2LU2A 3DRSA 1N36F 5L1IA 4RNFA 1D0EA 4R8UB 3M9OB 3F73A 1VRUA 2C3PA 2W8KA 4PG4A 4I64A 4P7VA 4AUKA 3CSKA 5KG4A 4AL6A 2XWXA 4I7FB 2XI2A 2NSCA 2XI3A 4HH0A 3P96A 3CCQS 5L1LA 2HHHF 4K0KF 4HI1A 3W2VB 1WEYA 3IBWA 3PEHA 3CDAA 3I0RA 2R8GA 4UY8T 1FNMA 2QV6A 1NEEA 2RUGA 4ZMMA 2Z0GA 4ZHRA 3C66A 5H9EJ 1NZAA 1Q79A 5DGBA 2RJZA 1KTVA 3MM7B 2R8KA 1ELOA 5I42A 4NLOA 4RNOA 1YVFA 2N7YA 4XDDA 2HHXA 1L3KA 3TR5A 5DS7A 3HO1A 1UW4A 1T02A 4OFZA 4G1QB 1QSLA 4LFCF 3BDPA 1C0UA 2I1RA 5M2RA 2MQPA 4OHXA 1SJRA 5A0YA 5J1NA 2OH2A 3MMCB 2JC0A 3E3XA 4WKYA 4G1PA 5HLFA 4K5SA 4N41A 1Y5NB 4LVOP 2V8GA 4D3HA 2LMIA 3SSQA 3H25A 2ZD1A 2D9OA 3PKMA 3AB4B 1SKRA 4ERDA 3G71S 4PWDB 1X4EA 3IRXA 4CNZA 3AJ2A 3PFOA 1OSCA 1UWBA 4RW7A 4NA2A 3IWLA 1FDAA 3H5UA 4RWWA 4TQRA 4F2RA 2DCUB 2KXHA 5IT0A 5EX3A 1VQNS 3E8OA 2HFOA 5E3PA 1U26A 2JHEA 2DHSA 5DG8A 5KFLA 2XO7A 4MIAA 4R8UA 4C3LA 1Y5IB 3L09A 2R2SA 3FZ2A 2VASA 4OI6A 1L3SA 2ZKTA 1FEEA 3MEDB 2J7WA 2RQKA 1X7VA 4DN0A 1K1QA 3LW5C 2MYFA 3RRHA 2B3TB 1FRMA 5T41A 1NK4A 1HWIA 4Y34A 2VQFF 3QGPA 3M2UB 4I2PA 1X5TA 4DLEA 4F02A 4XK8C 4O23A 5LSLA 5J2PB 2CVEA 1BQMB 2M0GB 4A8YA 3BQ1A 4FNHA 4DDFA 3RAXA 4U7UK 4DX8H 3OL8A 3MEKA 4CNYA 1X4FA 2DIUA 2V4JB 2VA2A 4JI4F 3EPGA 2GA7A 3HZEA 5IT4A 2XY7A 3LALA 3NAHA 2OPSA 4YQWA 4DQIA 3TVZA 1ZPVA 3T5KA 3PY8A 4JI3F 2XLKA 5EWFA 1SQEA 1TAQA 1X4BA 4NLYA 2NXUA 4OZNA 2OPPB 4NMLA 4PQUA 2XS7A 2RT3A 4IO9Q 5AJ3F 2HWTA 4DV3F 2XS5A 3HK2A 3UFCX 2XBPA 4ZPVR 4OX8A 5DM6Q 1RTJA 3A8EA 3IS9B 1DTTA 1C0TA 1Q86T 4FXWA 2M8DB 2JEGA 3QAUA 1TKXA 4A47A 5HBMB 4N8NA 2CVIA 3MWBA 3HX9A 5CZVA 4R25A 3CVKA 2N7CA 2P5VA 3KJVB 1NK8A 3TA2A 2YWFA 1X0FA 2KH9A 2WW8A 1VLYA 1PGZA 1CSJA 1KQSR 2WBMA 3V81B 1TL5A 4CO0A 1E6YB 4Q0BB 1B7FA 3I32A 1ZETA 2LXUA 5E3CA 3B8HA 3IAM9 4CT9A 3KMQA 4O4RA 3PR4A 1I1GA 5HQ8A 1HW9A 4M95A 5KFXA 2E9RX 4HEA9 1SC6A 2W9CB 4ZPTR 4PG8A 4ID5A 2RKIA 3LP1B 5IZHA 3HM9A 1UEVA 2CIMA 4OJHA 3QO9A 3OPKA 4ZP9A 2KM8C 4GC7A 2AGOA 3V6HA 2XB2D 4WZQA 3M6WA 3CB4A 4A8KA 2BOPA 2KRRA 2ZH7A 1LW0A 2XMMA 3SV4A 5LXRA 1FRKA 2DH7A 4ECXA 3RW6A 2PEHA 3K5LA 2XULA 2XMTA 2UV8G 4WFBQ 3FSYA 3BR8A 1HBNB 2JDJA 4K2XA 5C25B 1VQ5S 3QZ7A 1YHQS 2A10A 1FEHA 3S1TA 3OTCA 3DLJA 2LQ9A 1M5HA 2FGCA 3N79A 2RQMA 3DFEA 4LF4F 1R3NA 1E6YA 2CQ4A 4K4TA 2IVMA 2MKSA 1NH8A 1Q4RA 2A3JA 2HFNA 2XGPA 3G8QA 1YJTA 5ADZA 2E66A 1FKOA 3NMRA 3LGMA 2JVOA 4BS2A 1VFJA 4PQAA 3HXMA 5HLFB 2H9ZA 3GG1A 3I0SB 2HNYB 2VPYB 2NSBA 2QEXS 2QRRA 3K5OA 3PDNA 3VQSA 2XCPA 3EGWB 2NZ4A 1JLFB 1UKUA 2PA3A 2DGUA 4DQSA 3MOJB 2AX0A 2C3OA 2QLXA 3J7Z5 2XMUA 2DJWA 5M2UA 4NLGA 3BS9A 1HYSA 4IR1A 1V3RA 2XGQA 1IKVA 3MR3A 3SYZA 1YRTA 5CXTA 4ECUA 5J2MB 1GT8A 5C24B 4PWDA 4C8NA 1S6QA 2X1GA 3FFIA 1RI7A 1VOMA 3R3TA 3MPWA 4CTAB 1WD6A 4C2MA 2ADCA 1S6PB 3CO9A 4WFYA 5E3QA 5K8OA 3H98A 4RU9A 2OTJS 1QJHA 1W2IA 4KKOA 5CQGA 5A8WB 3THVA 2AGPA 4F4WA 4WYWA 4DL0C 3D0HE 4B9TA 3BQ2A 3HHKA 2QT7A 1HBMB 2XEXA 3M2UA 2GCFA 4DMZA 2NREA 3OL9A 2AV5A 2PT0A 1IN0A 2VG7A 2VQEF 2MKKA 1IQTA 1Z1ZA 3MMBA 2H5EA 3OHBA 3M8QB 4CH7A 1F5BA 1S76D 1NAQA 3EUNA 4DLGA 3N6LA 3MUVP 2X1AA 1R8AA 1RT2B 5E41A 2W25A 2GFFA 1VQ4S 2KT5A 1N33F 4C11B 1BQMA 2GQCA 3NKYA 4ICLA 1LK7A 4EO8A 1FJGF 2APOA 1XEZA 3FEZA 2XHWA 1T3OA 1G1XA 2OPPA 3MI7X 3RAMA 4RW9B 5KG5A 2PDAA 3IGVA 2OFGX 4R0EA 4OI4A 3VWSA 1B0VA 1C0TB 2E29A 4IG3A 3BGFA 1UP1A 2MQMA 4OLPA 4RU2A 4NL5A 4O44A 3CEDA 5MAOA 4YHHF 4TLRA 1SIZA 4ZPAA 3TX8A 1XR6A 3JTPA 1JLFA 2EFVA 3GIMA 2KRBA 2EKYA 2W9BB 3N9UC 2RVJA 4RW6B 1D8YA 1S6UA 3CCVS 1SJ3P 3VZIA 1KONA 4NRTA 2BANB 3A1YG 1P6TA 2FJDB 2KG1A 2IJNA 5DM7Q 2BYCA 1IJEB 2DHXA 2QYCA 4HVZA 1HPZA 4NZ7A 2C22A 5A6PA 3DI6B 4CH0S 4ICLB 1LW2A 3ZZTA 5DQGA 2RF2A 2B5JA 3BM7A 2E5GA 2QA2A 3N0VA 1X5OA 3OR1A 4ILMA 3SDEB 5KG0A 3K0JA 1NJZA 1OWXA 1LFPA 1F5AA 2O1PA 2A2CA 3NGKA 4Q43A 3C8YA 1TL1B 3NMAA 4DSJA 1FESA 2CPXA 2JLFA 3C6UA 1U7LA 5DQHA 1VQLS 1KD1T 2HMIA 1U25A 3Q8SB 4QW8A 2B0GA 2UUWA 2XS2A 1JMTA 2IRUA 1V9OA 2KYXA 3W2WB 2VPXB 3MM6A 3QLHB 1QUPA 1FJ7A 3L7PA 2UUBF 2XMWA 4OJ3A 2LQBA 2L9NA 2MHNA 3IG1B 1OO0B 4IH7A 4QQBA 4F26A 1QAIA 5GADU 3QMQA 4PR6A 4B3MF 2CQ0A 5LMNF 3HI9A 4AXIA 1C1BB 3CIZA 3MDFA 2XLIA 1N5YA 2E9ZA 2E44A 3MAHA 3SFGA 1HMVA 2B9YA 2YNFA 1YRXA 2VBWA 1TAUA 3AQPA 4DR3F 2XZWA 4I0WA 4DFKA 3MEEB 2N4CA 2GGPB 4TY9A 4ZP6A 2D41A 3DRPB 1NKBA 2RS8A 2KB2A 1U1NA 4WJBA 2AJ4A 4B08A 2FJXA 2RNEA 1F5CA 4I2PB 4DSKA 1IKXA 2DR5A 3C6UB 4DS4A 1MNEA 1J5OA 3WDOA 1AFJA 3X1LB 1IKVB 3O3LA 5DJBA 5KFHA 3CJ0A 3KHRA 3PVXA 2VG6B 2DNYA 3OXLA 3NNHA 2GIRA 4X84A 2BQRA 1EP4A 1UVNA 4XPEA 1HBUB 4X65F 5LJ3Y 2E1MC 2D3OR 3RRKA 1H38A 2M5YA 2ZH1A 3ETOA 5KFTA 4NLUA 1SJ4P 2IC3A 4IDKB 1DLOA 2BVZA 2JJ4D 5C24A 4DR7F 3M8SA 4QIEA 1S6QB 3FFIB 2EFQA 2VG7B 4BC9A 3TA1A 2CQHA 1Y9OA 1M0SA 1FCAA 4HKQA 2BM0A 1U4BA 3THTA 2I9SA 4JV0A 2CRLA 3B78A 1VQ6S 3W7BA 2FDNA 1TV6A 3TOQA 3ICLA 1T05B 4RW8B 2GO8A 2QA1A 2JLGA 2EG2A 1MSWD 1GTEA 2F8EX 5CCMA 1D9FA 4DFJA 2DNRA 2BDPA 3KYLA 5EN1A 1FK9A 1NNDA 5K14A 3WZ0A 5GAGU 3GFHA 3CJKB 3J7YI 4DV6F 3V4IA 4USHA 5HO4A 3PO5A 1G6BA 3THPA 3GQCA 4K4ZA 3DOKB 2KFNA 1PC5A 3OR1B 2JSXA 2KZZA 2AGQA 1KFSA 4LMZA 2E5LF 4ZDNA 2F4VF 2RD5C 3MMAB 3HHLA 3PJWA 3TARA 3HT3A 4LIWA 4ID5B 1I6JA 4Y28C 4DV7F 2V9WA 2L41A 2YKMB 2HIQA 2M88A 4IO1A 5H1SV 4X4TA 1SKSA 1DZ5A 3ZZYA 2K1RA 1RT6B 2B6AA 2G1DA 4JOUA 4ID8A 4NRUA 2IVFB 1PO6A 4N8OA 4IR9A 4NCBA 3CIMA 2FHKA 2D9PA 4FN5A 4CO3A 1Q82T 3GR0A 1TV6B 5DETA 3G86A 1GQEA 2JFKA 4OHYA 1SBRA 4LSNB 4PG7A 2QSWA 3TANA 3BF4A 1LW2B 3PRBA 4OV1A 2XMJA 2IAJA 4I6WA 4Z37A 2UVVA 4LQ9A 4H4MA 1GTHA 1HARA 4NA1A 3K58A 1Q7YT 3EZUA 2MXYA 4C0OC 5I3PA 3EGNA 3V6DA 3T5JA 3M1VB 4DR6F 2J9DE 3C6TB 2A18A 5AE2A 2RU9A 4PWUA 3B82A 4PQUB 4DL5A 3P5TL 1OIAA 1W25A 4MK7A 5K9FA 2Z4PA 3W2VA 1KS2A 1S1XB 1VRUB 4ZOSA 2QA4S 1RYSA 5B7WA 3DLKB 1RTDA 4I67A 3IXQA 3TO8A 4I7FA 5CYQB 1WG4A 4IRKA 4ELUA 3FVYA 4K5RA 3PW5A 1H2TZ 1VC5A 1UJ5A 2OD6A 2B51A 2FIUA 3M9NB 4ZPDA 2AP6A 1HD0A 1U1PA 2R2UA 2K7KA 4DR2F 2B4VA 4HI2A 1G7CB 2ZNZA 4FNIA 1N0UA 4E8UA 4ECVA 1HNXF 2O66A 3JSRA 4ES3A 2E1CA 2VC1A 4A8QA 3DRPA 4WK3A 4F3QA 4DUYF 1SXLA 4DV4F 3CC2S 4QWBA 1YJ9S 4K50A 5DDOC 1LXJA 4DL6A 1X0PA 4KO0B 3Q22A 1JLGA 4J9SA 4TQSA 2CJKA 5F8IA 2VFSA 5KFFA 1FXRA 1IKWB 1S79A 2Q1LA 3TYTA 3HZGA 2DK2A 3HMJG 4CT8A 1JKHB 3LOUA 1UWBB 2RDJA 1IKXB 3US5A 4URQU 3BSNA 4J5OA 3M30B 4OHWA 2Q6CA 2SXLA 1KSPA 3AQOA 2ZH8A 1RTHB 2XY5A 3KG0A 3SCIE 1N48A 3H5YA 4P7TA 1JXEA 4H4MB 4QWDA 4K4YA 2ASJA 4YEAA 3U27A 2C2EA 1YJUA 2HQIA 4URSA 5B0FA 4JV1A 1NHVA 4WU2A 4FBUA 3GSDA 1TKZA 3M1VA 4M5DA 2DRBA 1KQGB 1QE1A 2WHOA 2YNHA 3M8PA 4C8YA 4ETXA 4ES1A 3LP0A 2J7KA 1FKPB 5F8MA 1FDDA 3JSMA 2R8IA 4Y2KA 2EFPA 2E9TA 3MM8A 2VBZA 2W9BA 4NLTA 4RW6A 4X64F 4UW2A 3G6ES 2FHMA 1K0TA 2CQGA 2MKCA 2CQIA 3MTKA 5DLFA 3T9NA 3W2WA 3QIDA 3T9ZA 3MM9B 1HWLA 2NS1B 3V81A 4C4WA 1HPZB 3KK1A 1H3DA 1RT4A 3U1LA 4YR3A 1S0NA 3CDBA 5D4OA 4RUHA 3IAS9 2PFFB 5T7LA 2KT2A 4NWBA 2V4JA 5A6WA 2EC0A 3I4PA 1HI1A 5GVQA