3AJ1A

The structure of axcesd octamer (n-terminal his-tag) from acetobacter xylinum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
KKPDFTLFLQTLSWEIDDQVGIEVRNELLREVGRGMGTRIMPPPCQTVDKLQIELNALLALIGWGTVTLELLSEDQSLRIVHENLPQVGSAGEPSGTWLAPVLEGLYGRWVTSQAGAFGDYVVTRDVDAEDLNAVPRQTIIMYMRVRSSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bacterial cellulose synthase subunit D octamer with four inner passageways
pubmed doi rcsb
source organism Acetobacter xylinus
molecule tags Biosynthetic protein
molecule keywords Cellulose synthase operon protein D
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03500 Cellsynth_D Cellulose synthase subunit D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2590 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aj1A02
3AJ2A 3AJ1A 3A8EA
chains in the Genus database with same CATH superfamily
3AODA 3LH2S 2LU2A 4M5KA 4OI3A 4OZ2A 4USKA 3MR7A 2FYXA 3LO3A 4UUXA 1RBLA 2HZVA 4C8ZA 3C2PA 3M8RA 3AJ1A 3M7VA 3MCOA 2MZSA 4C2MA 1N33J 1C0TA 3W9IA 1Q78A 3PM9A 3RAQA 1FXDA 4HACA 4KO0B 4DSFA 2MLZA 5C42A 2UVUA 4DR6J 3HZGA 1KOHA 2ROEA 1TKZA 2VFTA 4UZCA 3KLVA 3KK2A 3KG1A 1GAOA 2BE2B 4P2MA 3HKWA 3UDLA 1R8PA 2VF3A 4O44B 4N47A 3TRGA 3ZNUA 5E3PA 3M9NB 1UETA 2W4PA 4TVAB 2HBZB 5IQ6A 3RR8A 1MMNA 1XK8A 1FVSA 3G86A 3OSPA 4RX6A 5FLXY 3QWUA 3OSNA 1RYSA 1YTYA 4MK7A 4UOHA 1NSQA 4OI2A 3MPVA 5D4PA 2CWXA 1QSLA 2J6SA 1Q7YT 3H5YA 3D3CJ 3FKBA 3LP0A 1L5UA 4X2BA 3CJ2A 1ZA1B 2NXEA 2FC9A 1MROB 4PG4A 3D6MB 3U1MA 4DDFA 1HR0F 3ENVA 3LALA 2POKA 3O5TB 1IWAA 3NBPB 4B3RF 4WIIA 3QO9A 4FYXB 3ZXWA 1IQZA 2R7XA 2WOMB 1XIQA 5C24A 1S6UA 3T41A 4FZVA 3SSSA 2KXHA 4ECUA 4Z7YA 2GS8A 3CJQA 1UL3A 5L46A 2AGPA 1Q0NA 2QGFB 3ZTRA 2HFVA 4OYBA 1LWFB 1K73T 1SKWA 3CCJS 3DXBA 4EBCA 4I69A 2NS1B 1R6VA 1YBUA 2MKHA 4OHXA 4TKTA 2FJBB 1KQFB 1PJ6A 2A6MA 1M1HA 3IAM9 4M5MA 4LF5J 4ECRA 4RBUA 3LGMA 2EK1A 1XR6A 1S1UA 1TL1B 2ZH9A 2R7WA 3TUPA 4FF1A 2DGQA 4HI2A 2HFOA 1LW2A 1U1KA 1KKHA 1T9UA 3UCGA 3VAKA 2ZNYA 5CXTA 4ELUA 4QR1A 4LR8A 2R7RA 1YBTA 2C2KB 3B78A 4C0OC 2YNIB 3PVXA 1VQ4S 3BQ0A 4Q5VA 2MY7A 4O44A 1FDDA 1JJ2R 2XZDB 1HL6A 1KOOA 3MM6A 4FKXA 5DZ6A 2C2RA 1A9NB 1U47A 1HARA 1UW9A 3FEXB 4R25A 3KFWX 4DCOB 3PJ9A 5KFCA 3J81j 1U6BA 5I42B 3FSXA 4RWXA 4PYDA 5BYRA 3J81U 4JI1F 1MMDA 2FZKB 4F02A 1FWKA 1EHWA 3ILOA 3OUYB 2R2TA 3WC2A 3T1YF 5D0GA 1VC6A 1CQMA 2WW8A 2CQDA 3TJ9A 4RJVA 3MAAA 2ZJPQ 2VC1A 1S48A 1S1VB 1OO0B 3UR3C 1H2TZ 1WF1A 2J5AA 4OQJA 5HBMA 4UT4A 2W25A 4TU7A 4ELTA 2IYIA 1G3OA 3FNNA 1XMQJ 2UUBF 3CJ3A 2YNHA 1IJFB 3ADAC 3DLEA 4EMDA 3OHBA 1FJGF 3FC9A 1N5SA 1WEZA 2DXFA 1K44A 1Y5NB 4P75A 4DR1J 1MN9A 1RHJB 3AY0A 4X4UA 4DL4A 4B3TF 3VVUA 1DURA 1RAJA 1BGXT 3A4TA 3QAEA 5G0RA 4WFZA 1HWUA 2COLA 1ZM2A 2E5LJ 2IM1A 5HAOA 1F3VA 5IT0A 2UXCJ 3I31A 1YJ9S 4RW9A 4PAAA 3T6JA 1I51B 1T94A 2BJ1A 1CJUA 4BHQA 5JJBA 3MR3A 1YZ6A 3JAMY 3A8EA 3QGHA 1S57A 4X64F 3G4SS 3BO3A 1I3OB 1KHVA 4YR3A 4DV2F 4DLEA 3V6JA 2ACMA 2DIVA 1OIAA 1TMMA 4P2SA 3BKUA 2ZWOA 2A10A 4U7UD 3D3BJ 3OD2A 2F9JA 4J9KA 1DLOA 1WEXA 1YGYA 2FVRA 4RU2A 2LQ8A 4M94A 5SUHA 4P71A 3H5XA 4LFBJ 1RTIA 1TVRA 5CAAA 4KTQA 1S76D 4KSEB 1FJ7A 5IQQA 4I6WA 2F8EX 2FJEB 1HWKA 4FYVB 3UW1A 1O0PA 4WP8A 2XMAA 5DQHA 4Y2CA 5AXNA 3TI0A 1N8RT 1GMWD 2VH7A 2LQBA 4LIRA 4OYXA 4MFBB 3VZIA 1L3SA 3T1HJ 1QTMA 1U2RA 2HNYB 2OSQA 2AYEA 3ZZUA 3U27A 3SQOP 3TOQA 4NLOA 3PIPQ 3OLBA 3OW2R 4HLBA 1P1TA 4CM0A 1WHVA 2MZTA 5L38A 1QSSA 1FK9B 3RAMA 1S1UB 3MR5A 1BC6A 3EUNA 1RUSA 3ET6A 1L3UA 5AXMA 1LQ9A 2G1DA 3QGIA 3VAJA 3UD4P 1N33F 4ANCA 4CQ1A 1SKUB 4O3PA 4LBPA 4ZHRA 4DCJB 1XERA 4AXJA 2CYYA 4Y3CA 3G9CA 3FBCA 5KFWA 3TZZA 1FXLA 3ZZZA 3GB0A 1DAXA 2RKIB 4RW4B 4O23A 1RISA 2OPSA 5DS7A 5K8MA 2I38A 4B08A 4QQBA 3OV7A 3M9OB 1FKPA 3M05A 5LM7E 3F0NA 3MURP 5KG4A 2J6TA 2ZBIA 1CBKA 3KK1B 2VJVA 3P3DA 3UE2A 3GFYA 1ZH5A 3VTIA 2FY1A 1TKTB 1UVIA 2VUGA 3LOUA 4F3MA 2AX0A 4FP9A 4LQ3A 3MPYA 1WWHA 3FEZA 4MMOA 1X5OA 3M1VB 4MYTA 2CDQA 2YNGB 3GR0A 2W1BA 3JYTA 1RT2A 3D1OA 5B0DA 5K14B 1JLBB 2CNKB 3BH6B 3C16A 3DLEB 2XYGB 4MIBA 2YXLA 3DMJB 1KQGB 4NWBA 5ETTA 4QIWD 4X64J 1KD1T 1QE1B 4ZA1A 3A8KA 3N28A 3WBZA 4NLGA 1RA7A 2IJFA 2WONB 5HVFA 1LWEA 2C2EA 4M5DB 4JI8F 4TY8A 2QL7B 3KUEA 4UOCA 5LSLA 1VQ7S 1M90T 1QAIA 1HNXJ 5SZTA 1AFJA 5HVHA 4WCEQ 2RDIA 3CJ5A 2XO7A 4DUZJ 2JC0A 1KVIA 1NB7A 4J91A 4DR1F 4L73A 2L9WA 1KLNA 1CQNA 2GMJA 1WDDA 3ENQA 2I8EA 4LFBF 1RBAA 3CIZA 3CJ4A 4QPXA 4F2RA 3W2WB 5LJ3Y 4KIAA 3F73A 2YWKA 1IKYA 1W2BR 4Q8EA 1IJEB 2MEWA 4ZLPA 3VZHA 3A3NB 4OHZA 3WIUA 3E51A 4OFZA 4F4AA 4CNYA 1KLMA 1KBRA 2AJ4A 3QFWA 2CPDA 3SQGB 2HQ3A 4PZVA 1URNA 1KS2A 1HMVA 2V68A 3O8WA 5AXLA 4ZITA 4J9MA 1JLFB 4I56A 2AEMA 2YQ0A 3RR7A 3V81A 2VICA 3M6WA 1REGX 4O3SA 4B9UA 2J9CA 1WF0A 5IZHA 1URRA 5KFTA 2JVRA 2J9EA 3GU0A 5DETA 4LR7A 1KWMA 4F4ZA 4LF7J 1OYDA 2BMBA 1Y3JA 4NMXA 4KHMA 3WX8A 1S9GB 3H98A 5J1NA 3ZTSA 2X1AA 5KFVA 2V8DA 2ZUAA 4DR3J 2Y9HA 3EMTA 4KHPJ 1XMQF 2UUBJ 1RTJB 4BCAA 2EBGA 1IM6A 3K5OA 4ZVQB 4RNHA 2R7SA 4PUOB 2O67A 4MKYA 4C97A 3ULHA 4OX8A 1QE1A 3LWLA 2FVSA 1N34J 4A8XA 4OI4A 4K4SA 1GMUA 2Z8QA 1SH3A 2ZVSA 4LRCA 1YI2S 4KFBA 1D9FA 4CO5A 5M2PA 4ZVSB 4RNMA 2UUAJ 2MGZB 4AQYJ 4R0JA 4WK3A 3VAIA 1Q4RA 2VASA 4IRCA 5FDLA 1Y4ZB 1HYSB 1WORA 1QTNB 1VQPS 2KYXA 4UUWA 3A8JA 3DGPB 3TEHB 2CJYB 5KTQA 2B4OA 2CIMA 4TU9A 2NXUA 4KGVB 3Q8VA 3M8SA 3T5HA 4C11A 3CMES 1V6HA 2XO6A 1AROP 1K1QA 2B8QA 3KK1A 4DS4A 1B7YB 5A2QU 5D0HA 1CJKB 4RO0A 4B9SA 1JJHA 2C2ZB 4DFMA 4YR0A 4DSLA 2V67A 4FNHA 2P2CB 3HHLD 4AYBD 1F9EB 2EFGA 2FJDB 2OFHX 3DRPA 2ZH4A 3CCRS 4ECXA 2ADBA 2ASDA 3P49B 3FQLA 1NK4A 5HROB 4U6PA 2BJ3A 2KRRA 2HFZA 1F3FA 2B9EA 4JUZA 2EW9A 2IMWP 1NJWA 3QJJA 2PEHA 3BREA 3C66A 4ZJLA 1KTQA 4CTAB 1X5TA 3S1TA 2LFVA 4CO3A 1CS4A 3UCUP 1V5IB 1PILA 2J9DA 1RBOB 2V8VA 3W63A 2WBRA 3DLJA 4J9NA 4ECYA 2Y1JA 1VQKS 4K4UA 1VK3A 3KLFA 5LMUJ 4MH8A 4F7VA 4E98A 1K8AT 1Y5LB 2LDIA 1NUEA 5J2QA 2FPHX 1KEKA 2Y0SD 3EWGA 2Q6BA 2QIFA 3W9HA 3K58A 1WTBA 1FF2A 1HBMB 4JV2A 3CT9A 3I9V9 2CDRB 4KR0B 2Y3YA 3GPAA 4ZPVR 1HNZF 4PG7A 3KHRA 3RGIA 3JQMA 1BLUA 3FZBA 1APSA 1TUVA 3I55S 3IS9A 1RT1A 3FSIA 2CPZA 2MKKA 1Q5VA 2DNLA 1T02A 4QIVA 1DFDA 1YLXA 3WQPA 3HFVA 1A7GE 3R5CA 4JV1A 1FFSB 4F04B 1D9AA 1PAEX 3IWNC 3QT7A 4IFVA 4DG1A 1WACA 4A8SA 1U6FA 1S1TB 1GEHA 4RR5A 4DPXA 5T7LA 3AB4B 4R5PA 3G6YA 2XNRA 4E2FB 4HHHA 1OS5A 3NGTA 3QBCA 4IFYA 3P5TL 4UW2A 3I4HX 2GAGC 3C3LA 2JWNA 5DM7Q 2W4CA 2HHSA 3OL8A 2QJ3A 2MJNA 1N48A 1FNXH 3R2DJ 1JJ4A 4DX8H 2VPWB 2YKNB 3ETMA 1NB2A 2RH3A 1H6KX 1M5PC 1RAAB 5IM0A 3R6GB 3CULA 3CE8A 3OBIA 3NMAA 3B6BA 1BXNA 2IVMA 3BO4A 2QX0A 5CA5A 5A8RA 1VQSA 2Y0BB 4R8UB 2B5JA 2BKNA 2CZVC 1DY3A 2UVWA 5IV4A 2YKPA 2HHVA 2BRKA 4HEA9 1U25A 4WF9Q 2R8HA 5HO4A 4ZIVA 1C2PA 3CJTA 4NZ0A 4LF4F 4ANDA 1HFEL 4GVBA 1VQOS 2C3MA 5B0FA 3UNGC 1U2CA 4DUTA 8AT1B 3HM9A 4ED3A 1M5HA 3RRGA 5B0CA 4H54A 3H8YA 1R8CA 4UQTA 3W65A 5H1SV 4EEYA 2HHHF 2KI2A 3A8IA 4RW8B 4ALZA 5CYMA 1S6OA 3IS9B 4OHVA 2WTFA 3OXFA 1UVJA 5GMDA 1HLWA 4I1TA 1JLGB 3S01A 2BJ8A 1CG2A 1X0PA 4ZVEA 1ZA2B 3DYAA 5RUBA 4IRKA 3CIMA 3ZC4A 2DGSA 4DQRA 2OPRB 1P9QC 2BJ7A 2NQPA 4JI4F 5LXRA 5KT4A 2HSEB 4OJ3A 3I5AA 3UR0A 3TP2A 2DGTA 4EZ9A 2GJIA 3BYRA 3L7UA 2HNZB 1RADB 1VFJA 3M2UB 2MTLA 3MM8A 4ZOSA 4C98A 4CLYA 4UZBA 2ZH6A 3PW2A 1VBYA 2I2YA 1ZOTA 1MU2B 1O6XA 2YKAA 2Z2YB 4YR2A 2U1AA 3MEKA 3MR2A 3V4IB 1SB6A 2KJVA 3UI3A 5H9EJ 4USWA 4XDDA 3IN5A 4BS2A 3T19A 3W5YA 1FE4A 4CZCA 2LCWA 3I32A 4JI5J 3JSYA 3ILLA 5J2NA 4GMKA 4Y65A 3DU5A 4CH7A 1S0MA 4NZ7A 1AXQA 3SCLE 4E8UA 3HO1A 1VIOA 1X4HA 1GMWA 3SZ2A 3X1LB 4KHRA 2G1HA 2KRBA 2VFSA 2WB1D 3W66A 1VQ8S 7FD1A 4M5HA 1DLOB 1RXOB 3HJVA 1ZM3A 4YB1P 2IVFB 2XSJA 4EK2A 1DZ5A 1RSCA 4W92B 1HI1A 1RT4A 3PJXA 4C0BA 5D4OA 2Z2LA 3PW7A 2KO1A 5A8KB 2BOAA 1VQ9S 4GKJJ 4HTJA 3MD3A 5CD4H 1N6QB 2KZZA 1LWCB 1SIZA 2W2OP 4I64A 3K7RA 4WWSA 1RU1A 3ZZYA 2DRBA 4NLDA 1FWPA 4DHVA 3RBEA 3GCXP 4KGMA 2A2DA 2UUTA 4DR2F 3RBZA 2YKMA 3EDRB 4KH1B 3QSYB 4YQWA 1UEUA 1T05B 2DNPA 3C8YA 1CVJA 1WHWA 2ABYA 4KFBB 4B9NA 4WZQA 3PFOA 3SMZA 3SDEA 2W24A 3DRSA 3CXCR 2GV1A 2GVDA 2L9NA 3CC4S 1NH8A 5D0RA 2CNNB 4OX6A 2GMHA 1KDNA 1RE1B 2RVJA 3M2UA 3MM8B 2B6AB 4M5LA 4F0HA 5HANA 4ZHRB 3PY8A 1N32J 2LECA 4HKQA 4JYAJ 4Y00A 3OT9A 2ACYA 4P52A 5I3UA 3N5FA 3VCDA 3B8HA 5BR8F 1PGZA 2BACA 4JI3J 2KXFA 1S1VA 1XMBA 3QT5A 2RQKA 2DGVA 2XS5A 2AX1A 3G82A 4LF9F 2KVQE 2CFXA 2OSRA 2RF2A 1PC4A 4FYWB 1T3OA 1RWXB 3MUMP 1K0VA 2FVPA 1S10A 3M30A 2Q1LA 1XTZA 1N4LA 3LGNA 2HNDB 3R9LA 5J1EA 2B7BB 3RB3A 1QVGR 1M1GA 2W2NP 4ER8A 4ZN1A 5MLCV 2GHVC 1VHFA 4CLPA 3MMAA 1CC7A 5DDRC 1FO1A 4ZP9A 1TZ0A 4C3LA 3CSKA 5GAGI 5DG7A 2MQQA 4L74A 3CCES 1ZAXA 4DR4F 4I68A 2W2PP 3ZFVA 2F3JA 3MMBB 2W2MP 2AGOA 3P8BB 5H9FJ 2Y1IA 4NLYA 2BW2A 3DOLA 2ZC4A 4B3SF 2KXNB 4OZJA 3UO0A 1FI4A 2OP5A 2FJWA 2HVDA 2MZQA 4PEOA 3GV8B 3BJYA 1A6LA 4U8YA 4DQSA 5HL7Q 3DCAA 4FVMA 3DI6A 2HBYB 1GTHA 3R27A 1S49A 2WHOA 2I0XA 1DTTA 1NO8A 3J7YI 1YJVA 5B7WA 2OHDA 1BUXA 3H2UB 5KG1A 3KHGA 5GAHI 4CLZA 5JUMA 4B9VA 1T0TV 4OV1A 2RAQA 5KT5A 2OEMA 1RAFB 2B0GA 1PKUA 2PMHA 2HS0A 1EETB 4K0KF 2MKIA 2UZAA 1YQHA 1SJQA 4CO0A 3HHNB 3H4DA 3E8OA 5M2UA 1S4EA 4ZIWA 3GIIA 3JTOA 1N5TA 3NS5A 4WFYA 5LT5A 3QGPA 1TUWA 4WPAA 1CJTA 4S0MA 2RRAA 1M0SA 2DCLA 3EZ5A 2IMOA 2XSFA 2YY3A 2E9RX 2V4JA 2R2UA 3B82A 2ZJRQ 2OMOA 3DDKA 2DH9A 4F4WA 2I9SA 4YOEA 4W90B 3CDEA 2EBEA 4YN3B 2VBYA 2UUWA 2HIQA 3NS7B 2A0FB 3ILJA 4I7FA 6FD1A 2K8GA 1Y7PA 1U1RA 4LRAA 5AJ3J 2NUUG 5AJ3F 1HQUB 2E5LF 3S8SA 2OFGX 4I0WA 1IKXB 3GYNA 4ZVGA 1RP5A 1SCJB 3CCLS 4DV4J 5ETKA 2DTJA 1FTCA 3MTKA 5I4MA 3D5MA 3MM7A 4R0EA 3D0HE 4USMA 3MCNA 4NLXA 5D77A 4A48A 3VGTA 5DQGA 4C3KA 2ZKUA 1IR0A 4QW9A 5HMXA 4DSIA 2B7CB 3TR5A 2JLFA 3TA0A 3C46A 1WSVA 2ZH8A 1D09B 4LFCF 3QMQA 4IKAA 5K14A 2EFNA 2CQIA 4ZJQA 2W9CB 3TANA 2C1EB 5K8NA 3ZNJ1 2FJVA 4M5NA 2LLZA 1C4CA 1J5OB 3LUYA 1OYEA 2DO4A 4DUYF 3JSMB 3CF5Q 3SI8A 2VG5A 3SBMA 2H5IB 1SXLA 1XQIA 1V5VA 1JX4A 3RU0A 2OI2A 3TWZA 2GMLA 1EETA 1Y5IB 1ELOA 2FQQB 2HGLA 4DZDA 2QLBB 2ZZMA 2BANA 2B4PA 3GFXA 3JSBA 3KHHA 3NLCA 4HACB 4KO0A 4ZPBA 3FBEA 5ADZA 4H4KC 3CCVS 4JBCA 3HP6A 3IG1B 9RUBA 1KC8T 2QFIA 2GW8A 3A3OB 2X3DA 1RHUB 2K3KA 4DV3J 3PW0A 1IKWA 4QWBA 1U48A 1NHUA 3GYXB 3PFEA 1HNVA 2FJAB 4UQGA 4A4JA 4HR2A 4C8LA 4CP5A 1H2UX 2A1BA 2VFUA 3KHLA 1M1KT 4ETXA 2HRYA 1TL7B 2IVYA 3ITHB 2RMLA 3PHEA 3D54A 2DNRA 5U47A 2VG7A 2VPXB 4YFUA 2M8DB 4LJMA 4NEYA 4JI4J 1S77D 2G13A 3PKMA 1RWOB 5L9XA 4IO1A 4XPCA 2YWGA 1JLFA 1EP4A 1R0BG 2P6TA 3EGVA 4MK9A 4LF1A 1L3VA 4F0KA 5ETOA 1IBLF 4DBQA 4ERDA 1FEHA 2WRMA 5KFJA 1C1BB 3CGIA 2B51A 1SV5B 2DHGA 3EVOA 2XB2D 1NSAA 3FCWA 3HMJG 4B3MF 1WI8A 3JTNA 4NLTA 2XGPA 1IUJA 2UXBF 2CJAA 1MWYA 2LA6A 1FVQA 2AT1B 3N6MA 2IY5B 2WVBA 1EQ0A 1VJWA 4OI1A 3FJ2A 3MM5A 2XMWA 2HVEA 2Z0GA 1HNWJ 3SIPB 1QVFR 2PD1A 5EHHA 1WOOA 2E1PA 3AOAA 5KT3A 2CQ0A 3NOCA 4ZCKA 4IR1A 2DR9A 3TZXA 2BKPA 2CKWA 3M2VA 2UVRA 2KB2A 2DB1A 2RS8A 3UCZP 1YHQS 4B9TA 1ULRA 2E5GA 4WTOB 4K2JA 4G1PA 4FKYA 4TQSA 4DR2J 3EE3A 2DGOA 1NJXA 3TQEA 5KT7A 3HPOA 1H3DA 1IBMJ 1RLDA 3WX4A 4CCHA 2R7TA 4QIEA 1GXTA 1WC1A 1B70B 1WC6A 2EC2A 2FHOB 2QG9B 3AJ2A 4NX9A 3TAMA 3VQSA 3HFZB 4CRJA 2PEBA 1LK5A 4DPWA 1HW9A 3DOKB 5K8PA 4NYZA 3CMAS 3D67A 1YSJA 2JZ5A 5L1IA 2RIJA 2RRBA 2V2QA 2R42A 2HS3A 3G8QA 5J1PA 1D0EA 4DQIA 2CWKA 3LP2B 1IBCB 1H98A 1WKLA 3MAAB 4ID5A 4YUDA 4C4WA 2KHCA 2HZAA 1GH8A 3TA2A 4F3QA 4RBTA 2X1BA 3K0JA 5IWAJ 4F3OA 3LGHA 3CCUS 3KLHA 2BM1A 3B4MA 3DOMA 4QR2A 4RNFA 4ZVTB 4CLUA 5KG0A 4YB7A 3KK3B 4KY3A 3MEGB 4IG3B 1SJFA 3O1LA 4JI7J 1PC5A 1X4DA 2B3TB 2NXJA 2MGZA 1X9MA 1N5YB 3EM1A 2E7VA 1EQMA 2LMIA 3C6UA 4UOFA 3V2UC 1ZM9A 1UEVA 4TNOA 5KG5A 2MDAA 3HVAA 4DL5A 1VC5A 1C0TB 1IKVA 3EPGA 2IC3A 3UDCA 4CH1A 4ZVUB 4NCBA 3OR1A 1JLEA 2QYCA 4YY3F 2CQ1A 3TYTA 2ZBCA 2H48B 3MOZA 3HLUA 3QLHB 1X4CA 2BE2A 4G3IA 1KONA 1M5OC 2IFXA 1GX5A 1TKZB 1WSRA 2DY9A 3CD7A 4OIXA 5BXIA 3GYGA 4C7QA 4WJBA 1E6VB 1OPZA 3TZYA 2MKJA 1S97A 4WE1B 3GSDA 1B99A 1JB0C 4DFPA 2QL5B 1VDHA 4DV6F 2J0SD 1C1CB 2D1CA 2CQ4A 3DGVA 3EJMA 4P7VA 1KRPA 3OPKA 3GJSB 4OZLA 7AT1B 3W60A 1UWAA 4QYZK 4Q7AA 2V5HG 4YB6A 4ECZA 1VRUB 4WTYA 3L7OA 3A12A 1Q79A 4NEZA 3DI6B 3G96A 4WFBQ 1RYRA 4O4RA 3TAPA 1EJ7L 4BDPA 1YWXA 3N0VA 4C48A 4NMLA 3RG6A 3GE9A 1XNQJ 2XS7A 3QPIA 5E3RA 1Z4UA 2JSXA 1SKSA 3BF4A 1F1BB 3QGGA 4RW6A 4IFYB 3UN3A 3I82A 4K5RA 3C19A 3R5AA 2DHXA 3N01A 4NI2A 4Q2MA 2EFVA 3LPYA 1EKSA 4NASA 4U7UK 1UEKA 3VGVA 4Y0FA 1JLAA 4ZVPB 4F4KA 2YWWA 3D68A 2M3DA 3H5SA 3MCSA 5KFXA 3MWBA 3KDOA 1HQEB 3KOAA 3ISNC 4YY3J 3KLGB 3DOLB 1NPKA 4LSNA 1QJHA 2V8PA 1YRUA 2GC8A 3LTOA 3CMQA 4WFNQ 3H59A 2DGXA 4QWCA 2HHXA 2DR6A 4JOUA 1WC4A 5LMNF 4K4XA 4FF3A 2MZRA 5T7LB 4R5PB 1FFGB 1HI8A 1F5AA 1NU4A 1JIHA 3MAQA 4X65F 1JLBA 3NXZA 4IFVB 3BQ2A 1TKTA 3QRRA 2ZH3A 4K0KJ 1U8SA 1S1WA 3BSNA 4W98A 4NCAA 2HHQA 4U96A 2JEFA 4PQUA 5DG9A 2EK6A 2YKQA 2HVZA 2RU9A 4USJC 1W25A 5F41A 4DN9A 1B0PA 4KRWA 4J9OA 2C3YA 3SXLA 3CO0P 1TFWA 5CYQA 1N0VC 2LU1A 2OTLS 4FBTA 4X62F 4I2PB 1EARA 4ED6A 1ZS6A 2FB0A 3I56S 2X3GA 4ES3A 3W1YC 1OY9A 2EKNA 1S4FA 3RB6A 3IRWP 1BQMB 1XMOF 2WSCC 2XCAA 3RAXA 1S6QA 4HDGA 2W9BB 2J7UA 2W7AA 4QIFA 2IJRA 4YMEA 2B4UA 4IYQA 3CCMS 2B56A 2XWXA 3EICA 2E1CA 3OJUA 2E9ZA 5A6WA 4LBIA 2FZGB 2IC3B 1XJWB 3OLAA 4DJBA 2PI5A 3DM2A 4BBYA 4ETZA 2QLJB 1HBNB 4J9VA 2V2VA 2XWYA 2J7KA 4DZ6A 5KFMA 1MLAA 1X31C 2ADCA 4DWIA 3BBBA 1FDAA 3QQCD 3K57A 1BWVA 1TFYA 1UWBA 2FC8A 1Q81T 4FXDA 1N6QA 1JLCA 1RT3B 4ANEA 1UAWA 3TJAA 1X9SA 5FLXU 2Q66A 4ZP6A 4C3MA 2DNHA 1N52B 4ZP7A 2ROPA 5ETSA 4LFAJ 3GZ7A 4ES1A 3LP1B 5B0BA 2W01A 2XLJA 3GILA 2ERRA 4DR7F 4RW4A 4ZVOB 1J5OA 3DLKA 1FA0A 4OYIA 3PXGa 1U8WA 3D1HA 1T11A 3ZZ0A 3SSQA 1RT5B 5BR8J 4JI3F 2AJ0A 1JWWA 2BBEA 1NDCA 4WXOA 4EU0A 2IYGA 5ETVA 2UUAF 2C2OB 4OYOA 4JYAF 2JX2A 1ZPWX 1XR7A 2OLWA 4ZLLA 1R0AB 1IBKJ 2Z56B 3E3XA 2ATLA 1C4AA 1YJUA 2RE1A 3FVYA 3L7PA 3LAMA 2HQCA 5JXSA 2DXEA 4CLLA 1VMBA 4CT8A 5AE3A 2XM3A 1BQMA 4Q43A 1I6JA 2ZH5A 1FFWB 2DEIA 2R2RA 3OR2A 1ZTTA 5FDLB 4X4NA 2DRAA 1AT1B 2V0NA 1YVFA 4KHPF 2ZH2A 2IDEA 3DKDA 3MTJA 2D69A 3D6TB 4MYUA 5HN0A 5C42B 2LYVA 3TNVA 4WFAQ 2EFOA 3M8PA 5I3QA 3NGDA 1NDKA 5A8WB 4N76A 5KFPA 2H65B 1RQ0A 3DLGA 3DRPB 2LEBA 2ZZNA 1ZAWA 3WZ0A 5KFUA 1X4BA 1LOUA 2BABA 2BRLA 2GIFA 5HMYA 4C8KA 1MNEA 3OTBA 2HPUA 5LSOA 1Q7LB 5HLFB 1EAYC 3NOGA 1JNZB 3PJWA 3UPFA 1RI7A 5FIIA 5DDOC 2RQ4A 5EWEA 1U2FA 4DCPB 5BYSA 1JXVA 2FY8A 1FD8A 1SV5A 1SQFA 2GGPB 3ILIA 3OL9A 4G1QB 3DLHA 3HVTA 5JVHQ 5F8NA 2DNMA 2OEKA 3CD6S 2ZC3A 5CYQB 4H4OA 2F4FA 3CNQP 2FIUA 4A8YA 1S7HA 2C22A 4TLRA 1HIYA 3IAS9 4F36A 5ETRA 2G9OA 2YKOA 2H1YA 3HKZD 3TJ8A 4KC5A 4OJHA 3Q0AA 1M5KC 4LVNP 2HGMA 2V94A 4ZLNA 4LFCJ 4X4VA 1LFPA 4YP3A 2V2ZA 4O4GB 3J81Y 4DV4F 3L3CA 1R0AA 4RWWA 1N54B 1N88A 2ZHBA 2JH3A 4Q44A 2KT2A 1Y3KA 2ZBQA 3NGRA 1FE0A 2EI5A 4EZ6A 3VV2B 4LF6J 1TELA 2FD2A 2N4CA 5E2QA 1RU2A 5KFQA 2LQJA 2GX8A 2WW4A 3E2EA 2WONA 2MHEA 3VAGA 4ILRA 1QM9A 3IFEA 3CCSS 2UV8G 3QSIA 3R5DA 4MIAA 1SJ1A 2ASYA 2K06A 3R3TA 2CJBA 3QT6A 2F8HA 5EN1A 1UP1A 4DSKA 3RYLA 1YITS 3BPSP 3I5BA 3KJVA 1ICEB 2M4MA 2PSZA 3X3UA 2AEFA 2K1RA 1DBDA 1U0HB 3T5KA 1NPPA 3KG4A 5J2NB 1VGYA 1UVNA 2AV5A 1SBRA 1RB0A 3S7RA 1VLOA 3TX0A 2ZOMA 1GXLA 1NDLA 3SEOA 2DEJA 4JV0A 1MWZA 3ISZA 1FJEB 3DDIA 3W8GA 1IWGA 3GV5B 3JXOA 4A8QA 3DLKB 1XN9A 2DHHA 2KU7A 3MD1A 3KNAA 1AB8A 3RB4A 3CJSA 3T6BA 2DCUB 1TMJA 5HI7A 2YX1A 3FCHA 3O3LA 3MM9A 1TKXB 1G7CB 1SC6A 1ZBTA 2MQNA 2PFDA 3KUGA 4HVZA 2G0IA 1U1LA 1SC4B 2CPJA 3HHDA 1DQAA 3KDNA 5KFAA 3MM7B 5K8OA 4MIWA 1JKHA 2N4DA 3D0IE 2DVIA 4OHYA 1YJ7A 2ZDOA 4K4WA 4KE5A 2AP6A 2MQMA 3D2WA 3M2VB 4DOZA 4OJ1A 5A2QY 5KFHA 1KFSA 3GIKA 5DGAA 1FT8A 4RW7A 2OD4A 1DJ0A 4CM2A 3OR1B 3Q83A 1I94F 3DRSB 2F4VJ 1RT6A 1JLGA 2V50A 5IV3A 2YNGA 4LVOP 1LW2B 1EX8A 5CYMB 3B4DA 5KFGA 3SV4A 2VODA 5HSPA 4DL7A 1IQTA 1PBUA 2HLUA 4DEZA 2KL8A 1R89A 2P9CA 2MQPA 4ED4A 1M5SA 2CQ2A 1U0HA 2WVFA 2KTQA 3NP5A 5L39A 5DGBA 4ZPWR 2DHAA 2LEAA 3M8QA 1VBXA 2R8KA 1NEEA 4IDKB 2AZ1A 2DD8S 5F0WA 3KTQA 1HYSA 1RTDA 1CSJA 4PG6A 3NRBA 2ZEJA 1G6BA 3FQKA 3TA1A 3W8PA 5LMUF 2RQMA 4Y2MA 2PMWA 2ZDPA 3BN7A 1OQ6A 3OL7A 3BO2A 9ATCB 4F2SA 1WC5A 3A1YG 1NK6A 4J7CA 2M70A 3OQ2A 1NPRA 2NXCA 2ZUGA 3LWMA 2JFKA 3H40A 5HBMB 1H0HB 3UD5A 4B9MA 4ZCIA 2OIHA 2RNEA 4DV7J 4OJGA 4DV1J 4EI2A 5B0GA 3P45B 4X4RA 3KUHA 3T5LA 3MMBA 4UF4A 2HQDA 5E5NA 2RHQB 2FHKA 2N7YA 4LSNB 2OEJA 2ZM6J 1HKAA 5K9FA 2A18A 1Q8IA 4MFBA 4ZPAA 4Z37A 1B0TA 2DJWA 2ALZA 1RWUA 3K2YA 3G6VA 3PEHA 5CZXA 2FHJA 1TL3A 2MKYA 1NJIT 1E6VA 1F2HA 3BBCA 3HULA 3DRRA 1J27A 4NRTA 1RAIB 1RK8A 2OO4A 3KWMA 3NWGA 1UPPA 5T14A 2XMTA 2KG1A 1NKEA 1RCXB 2UU9F 4P9SA 4C6AA 2VKRA 3FK4A 2BJ9A 3QATA 4PR6A 5EGYA 2JVOA 2DT9A 2I5JA 5J2QB 4KKOB 5J2MA 5ITHA 4B3MJ 2B9XA 2J7WA 1SC1B 3EZUA 4LSLA 1P9YA 3D4JA 1U24A 4DX5A 3GIMA 1U0SA 5F3TA 4RPFA 1GT8A 3PRBA 2KYZA 3GMGA 2YWEA 2VD3A 4YB5A 2NYIA 1PYOB 3HVRA 3HSJA 2AF6A 4LSZB 4JI6F 1WHXA 4F67A 2W8KA 2NPFA 2XULA 3CJ0A 3OVAA 2CPIA 5DLFA 2NSBA 2H9ZA 1Y9OA 4DV5J 3IGNA 2Y8WA 2AW0A 3S6EA 2H5JB 5A8WA 2JEJA 3QRQA 3QT8A 2BE7D 1FRJA 1H2VZ 4LF7F 4C8YA 3DMJA 3M1VA 5KOXA 2HHTA 3UNYA 1VS3A 4ID5B 4J37A 4WU2A 2GQCA 4LR9A 1TU0B 2KFYA 3PYFA 4P2FA 2ZNZA 5AT1B 1SH2A 2RB7A 5B0EA 2VQEF 1NSKL 1RABB 5KG2A 4URQU 1YJNS 1R8BA 2CQCA 2EG1A 2WSEC 2CRLA 5CCMA 5MAOA 5GVQA 2KFNA 1HR0J 2D7SA 4DR5J 2QZ8A 2L41A 4J9PA 4QCLA 2HS4A 4ZCMA 5IC4B 2L48A 3DOMB 4CNZA 2W9CA 1BD6A 3M8QB 4YDXA 2EKYA 1WELA 1FEEA 3CJRA 2HQGA 3CD0A 2VPZB 1FKPB 3R7BB 2E9TA 2VV5A 1SUQB 1TK5A 4ZKAA 2OJ3A 2D41A 3QLHA 3A3PB 3BEGB 1DTTB 1JLEB 4RUBA 3CC2S 2GIRA 3LP2A 1UA0A 1K9MT 1Q16B 2VDHA 4TU8A 3NBPA 2E1AA 3M2RB 1QDUB 4HTIA 3GJQB 2GHWA 2OGUA 4KQZA 1UKUA 3GG1A 3C15B 4KYZA 5EX0A 5KOWA 1WEYA 4DR6F 1X4AA 4QPTA 3OJSA 4IOCQ 4WFXA 2BQUA 2MPUA 2V9WA 5FJ4A 3U02A 4KV8A 4IG0B 4IR9A 2V2KA 4P72A 5B08A 4XO0A 5F3ZA 2DNOA 2GNKA 2DK2A 2AYGA 2Z4PA 1SPBP 1PYTA 2CXEA 1L3KA 2OPRA 2GAHC 2GO8A 5HP1A 3OFHA 1BQXA 3KLHB 2D3O1 1HD1A 3TQ1A 4NZ6A 5C5JA 3UD3P 3SYZA 4OL8A 3MEGA 4IG3A 1WG4A 2VQFJ 2JL9A 4XPEA 1NKCA 3H0PA 1NZAA 3K5LA 2CJQA 1NM2A 1RHMB 1E6YB 1UCNA 1V3RA 2AMCB 2CQHA 2RT3A 3MUTP 1JLQB 5HLFA 2QC3A 3Q86A 1VYAA 3NAHA 3OXGA 1VQYA 2DISA 3BN4A 4QWAA 1TKXA 4OX9F 2W9AA 1FDBA 3CC7S 3PX4A 2EFPA 5EWFA 3LA0A 1FX2A 1LW0A 3G82B 2PMZD 3NCQA 2NR0A 1QY7A 3MR6A 1VHIA 3MDFA 4AL7A 4U95A 2YH1A 2J0QD 2CAJA 3HSDA 4PYAA 3RTVA 1S7IA 4ED8A 3DGPA 1S9EA 2HYIB 1VR6A 3AQOA 3DLBA 1B64A 5THWA 1HI0P 1HQEA 5D4NA 4DSJA 2P6SA 1AYEA 2G0JA 1I1GA 2DIUA 3ETOA 4QBUA 3PTWA 3ZO7A 2RS2A 3T1HF 4TYBA 5IXUA 3NGKA 2XYPB 2VG5B 3GR1A 4EUVA 4ZP8A 1VQLS 2HGNA 4MKBA 2Q6CA 1AA1B 1S9GA 3JS9A 1GQEA 3MHYA 2BA9A 4USUA 3KJFB 3GONA 4A8KA 1UA1A 3THVA 4M1KA 1Z2ZA 4PUOA 3N6NA 1RTZA 1DQ9A 3UDVA 1CJVB 1IXKA 4QYRA 3AD9C 5CH7B 4DX6A 1U09A 1RHQB 1XNRJ 3BR9A 3MPWA 5JMNA 2PDAA 1UZHA 4MT1A 2XMKA 4RW6B 2FGOA 4ZS6A 1CULA 2OPPB 3C6TB 3HD2A 2WAQD 4KGKA 2ZD1B 4PXEA 4WK1A 3BKFA 4E0DA 5C7PA 1U49A 4USHA 1QSYA 4ED0A 2E1RA 4LRDA 2FHJD 2R8JA 2ASLA 3Q8YA 2QFJA 2GGPA 4PXDA 2C2DA 1VRQC 2AJFE 2KVIA 3IBFB 3V6DB 4FXWA 4LF9J 3W62A 2UXCF 4USTA 3PW5A 2HWIA 4EGLA 1JK9B 2R7OA 1FRLA 3M32B 2E29A 2CQ3A 4OV6A 3Q23A 1RJJA 2B9YA 3H2VE 3CTRA 3VQTA 3C15A 3PX6A 2DH7A 1X9WA 3AJDA 4HT7A 2JLEA 1FJGJ 2MSTA 3VHQA 3W2WA 4UOGA 2IPOB 2F7VA 4IG0A 2AKWB 2F40A 4CH0S 2B43A 2EWHA 2GVZA 4KGZB 5GMKa 2EPIA 1S0OA 3KMQA 3LPEA 2DGWA 5KT2A 3IGVA 4JI6J 1EKRA 1JQGA 4CTAA 4OI6A 4L76A 3EYZA 3NAIA 2FHMA 2HNYA 2BV3A 3W5ZA 2C3OA 5HROA 1SKRA 1KSPA 3HHEA 3UWTA 1OJ4A 2LXIA 5HMZA 2HBRB 4DR3F 1UJ6A 1Q86T 1CLFA 3T1YJ 2R4FA 1VQ5S 3IG1A 1Y0HA 4OYPA 2CA9A 3DRYA 2I6WA 2V34A 3HHKA 4BLGA 1RT7B 3BYPA 3QWPA 2WOMA 4ENOA 5E3CA 3BB5A 2J9DE 4A46A 1GX6A 1T9YA 5AXKA 2UU9J 2QLFB 1W2IA 4EBDA 3F44A 2DITA 1P27B 4AL5A 1T9TA 2LDYA 2RDDA 3M6VA 1U1QA 2NZCA 1HW8A 5C25A 1HBUB 4QZVB 4C8NA 2QA2A 3J80U 3W61A 1KNZA 2DNNA 2JC1A 4PWDA 4WP3A 2ZH1A 4KPYA 3TARA 2ZM6F 4I67A 2XZWA 1BE4A 3FEYB 4KPCA 2I1RA 4ATNA 1JLCB 4WIQA 2HLTA 1F60B 4DV1F 2ZH7A 3TAMB 3QIPB 2Q43A 2GO9A 3EZOA 3VAFA 4N7TA 2GQQA 3CJKB 3HJFA 3NL0A 2M8HA 4DUZF 4LF5F 4AT1B 4DN0A 2OD6A 1JKHB 3PKYA 1HNXF 2HRUA 1VJQA 3M30B 1IKXA 4IOBA 2WVEA 2QLXA 4ED2A 4ZPCA 3ISND 1R0CB 2FGCA 2H54B 3CDBA 2E7XA 3DFEA 3K5PA 4I7FB 4N8OA 3VR1A 2HHPA 1FK9A 2W4DA 4NLRA 2NZ4A 4L3KA 4OI0A 3H7HB 1X4EA 4B3RJ 1T03A 4OZNA 3CDAA 4LF2A 2HQIA 3I96A 3GLJA 4OZ1A 2XMMA 2YX7A 5E33A 4X4OA 5LXYA 1VLYA 3HHLA 4EYIB 1B3TA 1DHMA 3FGVA 5IM0B 1PO6A 3M8PB 3N4WA 1XNRF 4ED5A 2CNOB 4J90A 1WDTA 4CWBA 4QU6A 4XK8C 3M9MB 4OX9J 2IDLA 3FBFA 4LREA 2KJWA 4R8UA 5CCLA 4TQRA 1C1BA 4JB8B 2MB0B 1QAXA 4NA3A 4BC9A 1HWJA 4BWJA 5F8MA 2XCPA 2FVCA 4USVA 3L4BC 4FVCA 1B4SA 3DLGB 3N6LA 4HHJA 4NPOA 1FRKA 2AEJA 3I0RB 5LL6d 2AU0A 3HSGA 2XBPA 3HFKA 5DO2A 1IVZA 1LWEB 3J80Y 4RW9B 4OYMA 3D9BA 2OELA 4ECQA 1QLNA 3DNCA 2ZFHA 1HNVB 3QIDA 4FYDA 2WCXA 3IBCB 5D3GA 5AE1A 1ZPVA 3CPWR 1OY6A 4NLSA 3VVTA 1HWLA 1RTHA 3BBFA 4ZMMA 5F8LA 4LF8J 3POTB 1AZSB 4KGXB 2M0GB 3TZWA 1HBMA 4OZ5A 3R5BA 1LK7A 3TX8A 2V4RA 3HF5A 2JHEA 3IRXA 3ENAA 5T41A 4RL1A 2VQFF 3FMWA 1RT3A 2L9DA 4O3OA 2JLGA 1LNQA 1R27B 4N77A 1K47A 3RW6A 1WUUA 2Y1LB 4WP9A 2ZOGA 4AXIA 3DOKA 2FVQA 3BDEA 4M8LA 1OMSA 4DXLA 4EWTA 2LQ9A 5HJYA 3JAMU 1VK8A 4MKAA 3LP1A 1FCAA 2XSJB 3H25A 1H38A 3SCIE 3CDUA 2QA4S 1LWXA 1YJTA 4XDCA 1KR4A 1NAQA 5KFBA 4EFAC 2D3ZA 3AXKA 3HX9A 3AH6A 1TTHB 2E66A 1HD0A 4RW7B 1Q8LA 1UZDA 2J0XA 2Q3PA 3ICLA 2K2PA 2V8HA 3ZZOA 4LF6F 2OPSB 3KYLA 1UTAA 3BSCA 4U8VA 1RWWB 1FD2A 2DR5A 1JNRB 1R7IA 2GJFA 4RNNA 4ICLA 4DS5A 4KB7A 1TAUA 3E01A 1BHNA 1PBAA 4MAKA 3M8WA 2O1PA 3SDEB 4B3TJ 4D3GA 3M8YA 4AFFA 2O66A 2BVZA 2G0CA 1GMVA 2C2NA 4DL0C 3C6UB 5HMWA 4X4SA 4O3NA 3WC0A 4Z7CA 4DL3A 2LP4A 4GO7X 1HPZA 2QLWA 4ZJOA 4PG8A 2A3JA 4DV5F 3PG9A 1CS4B 2YVSA 4DR5F 1UVMA 4HL9A 2V6AA 3VWSA 1HWIA 1UW4A 2XEXA 4K5SA 1FKAF 3GJRB 4K8RA 1EZZB 4L72B 3TVYA 4WKRA 3RW7A 4LRBA 3BSOA 5KFLA 3HXMA 3EXYA 2GHPA 2Z30B 4YHHJ 2VQEJ 1WJ9A 3RBDA 2PI4A 1VRTB 2W8LA 5HJXA 5E3AA 3J7A1 2IM0A 3D66A 4J5OA 3HT3A 2D3UA 1RKJA 2VA2A 3BR8A 4Q0BB 2F8MA 4KT0C 4RBVA 1IR1A 5HVGA 2J8AA 1R3NA 5A0YB 2YKNA 1MU2A 3TUJC 5KFNA 2MZJA 4AQYF 1NJZA 1EP4B 3H4BA 2CJ9A 2AHOB 1NH7A 2YQ3A 3SCJE 1X60A 2Q79A 2P9GA 1JJCB 5ETPA 1C0UB 4RZRA 2DPJA 1N34F 2H4WB 3U1NA 1TV6B 2VZ9A 2DNQA 3CCTA 1RTDB 3R2CJ 2NCKL 1FX4A 1NHVA 2ZE2A 3NGUA 5D3GB 3MMCB 2RSQA 4USIA 4NLVA 2HQFA 2JJ4D 1U7LA 4IDKA 1HHQA 2FLOA 4K4TA 5DG8A 2XQCA 2PC6A 4G1IA 1MSWD 1XR5A 3FFIA 5HK4A 1YZ7A 5CABA 2RJZA 1OQ3A 3HHLC 1H73A 4HH1A 5C25B 3OTOF 4DV0J 1T8EA 1N5QA 2XMUA 5J2PB 1UMJA 2IA6A 2VONA 2C42A 4JP8A 1TR0A 5J2MB 3FZ2A 1OPIA 3CB4A 4LFAF 3SSRA 2L08A 2OKQA 2YBVA 3WIVA 3T9ZA 4PWUA 5KFZA 1FESA 2IA0A 1YG0A 2MY8A 4PPZA 3IWXA 3RJMB 4D3HA 4YS2A 2AIRB 3MEDA 4OYAA 2KM8C 1LEOA 1ROFA 5D15A 3D7SB 2IBKA 3W5XA 4JI2J 2OPQB 2WVDA 1OWXA 1SH0A 1V9OA 2GIQA 4M5JA 4Y2IA 3NCRA 1PJ7A 3CJKA 5H9FK 3GJTB 1OY8A 1RLCL 3GFHA 4OYZA 4J9UE 1VRUA 2JNJA 1S99A 3Q8SB 1N5VA 4OX7A 3US5A 3FUYA 4FPRA 5IOLA 3KG0A 4P2XA 2XS2A 5K20B 4C8MA 2B8PA 1UPMB 2QMXA 2BR0A 1R31A 2E1MC 3UN2A 5I3UB 3G71S 1VQMS 1N56A 2R9LA 3HZEA 2XHWA 1UJ5A 4DPOA 3GG0A 2Z57B 5EUHA 2F4VF 4M5IA 4RLEA 3BV8A 3HDSA 1RAOA 1U1PA 2GVDB 2U2FA 1WHYA 4YEAA 1JLAB 5LJ5Y 4JI8J 3W3SA 1DQ8A 1KVKA 4CI0B 2LXFA 2CQGA 3MI7X 5EWGA 5GADU 4IH7A 4HHUA 1HQUA 1NLKL 1RACB 2DHSA 1DTQB 1QUVA 2HK3A 3OTDA 3Q24A 4Y6IA 3AD8C 4X62J 4ECTA 1TUGB 1PAUB 3ENWA 2MHNA 3BH7B 3Q2SC 2FLNA 3ITHA 1F5BA 3IC1A 4NA1A 4DQPA 3PRVA 3EGNA 3KK3A 3QIPA 2N7CA 4G65A 2RHSB 3CO9A 3M6UA 4EO8A 4F0MA 5ETMA 1DRZA 1I5OB 2YNFB 3H2LA 2LA4A 1KQSR 1Q8BA 1FNMA 4X4QA 1SUQA 2QN6B 4FBUA 4DF8A 1MN7A 2A6OA 1D8ZA 2G2OA 5IT4A 4RUCA 3PYEA 4K4ZA 3UVJA 4FS1A 1I94J 2FJXA 1FKOA 3D28A 4PPDA 1Q53A 1Z1ZA 5CHCB 4JV5J 3G87A 4F26A 1X4FA 3LAKA 4ZN3A 2MSSA 2O01C 1HNIB 3D0GE 3PDNA 1J2VA 1YKWA 4DL2A 1FHTA 3PRDA 2H51B 2YQ1A 2RILA 2VBXA 5DZ7A 4O0IA 2XTJP 2V4QA 3G8SA 2UUCJ 1ZM4A 2P5VA 5C2GA 4Q45A 2QA4G 1RTHB 2EVZA 2OTJS 3VGSA 2DYAA 5IT9Y 2CG4A 2HZCA 1WNEA 2K7KA 3BM7A 2IM3A 3EGZA 2AYBA 1K0TA 3KJNB 1U26A 5L9NA 1VI7A 3Q8RB 4JI0F 4TYAA 1CJKA 3SV3A 3N9UC 1XC9A 2OH2A 4HT5A 2GZOA 4C11B 1MG7A 4P73A 2HVIA 4W4MA 4CO1A 1R8AA 4QYZJ 5F8JA 4WKYA 3PO4A 2FDNA 1SQGA 4WXWA 3OL6A 2IAJA 1P1LA 1T9VA 2P8IA 3K5MA 5E3QA 2Y1RI 1KQKA 4CLSA 3I0SA 3K5NA 3J7AN 1NK9A 3NS6A 2PIIA 2CG8A 4DU7A 1NZ8A 2XG8A 1CJTB 3K17A 4ID8A 1LKZA 3CEDA 4M95A 2ZBRA 1FNOA 3BGRB 1KHWA 2F65A 1EIYB 4IUFA 3FSYA 4KBIA 4DV2J 3R5GA 5D6GA 1VIXA 1Z2LA 5G0RB 1S0NA 3IR5B 2UXDF 1U1MA 4UY85 1ZETA 1UFLA 4PQAA 2E7WA 2KT3A 1A0OB 1T95A 3ONQA 5A8RB 5KFDA 2XY7A 1T05A 4Q8FA 1NKBA 1NHKL 4P7TA 2BQ3A 2RUSA 2HIYA 4K50A 4FF2A 2NREA 3IBWA 4NLWA 4NOHA 3GV7B 2BX6A 5F8GA 3RRHA 3JB9k 3AA9A 4NXMJ 3Q8QB 2H4YB 3MECA 3FCVA 1S72S 1SJRA 1X5SA 2YKMB 2MQ8A 4LQ9A 3JSMA 4KAIA 2CJXB 3NNHA 5DRKA 3FMBA 2MKSA 4DPYA 2CNLB 4L75A 2LEPA 2QSFA 3GWCA 4DG1B 2BANB 2HBQB 2YPYA 2YX4A 3GTYX 5GAEU 1NDPA 1GXUA 4NXNF 1F6TA 3UFCX 2EXUA 1PJ5A 1XWLA 4WYWA 5F0UA 3T1AA 4CLFA 4PXBA 2WVCA 3R8YA 3CWJA 2N3LA 3G8TA 2DNYA 1C1CA 2BM0A 4BWMA 3IWLA 3TUZC 2GVZB 4J9SA 4IO9Q 1X8DA 4JI1J 3MM6B 2IAJB 1VQ6S 3DDNA 2YWFA 4RNOA 4DQQA 2UP1A 1HPZB 4DR7J 4G1QA 2YNIA 2IJNA 2M5YA 4DX7A 1IBMF 3TEGA 2FUG9 2R8GA 2J8SA 3G2XA 4LIWA 2ALYB 5I42A 3CVKA 3R6LB 4K7QA 3CJ8A 1AUSL 4TY8B 2X1FA 1JMTA 2MKCA 4K2XA 2LXUA 2HFUA 2HNZA 3R1HA 2VKZG 1N5YA 1WTFA 2BYCA 5DM6Q 2BE9B 3V4MA 3Q8PB 1U45A 4OHWA 1R43A 4U9RA 2YH0A 1IBKF 1TK0A 4DV7F 2F63A 4ICLB 4Z2XA 4A8FA 4Y2KA 3H42A 1RHKB 3OVBA 1TL5A 1MMLA 2E44A 3MF5A 2MXYA 4IRDA 2DBBA 5HATA 1LXJA 2JOQA 2XZTB 2DRDA 4NLUA 3QRPA 3AD7C 1WI6A 4KV8B 4NA2A 1HBUA 4XTTA 3R1LA 1HHTP 1BQNB 5M2RA 1TK8A 1Y10A 2NSCA 4L3NA 4GVBB 2BOPA 4DL6A 2MQLA 2QE5A 3OFFA 2NUHA 1DARA 6AT1B 3RZAA 5E0OA 3MCMA 2PO4A 3C14B 2BDPA 1XMOJ 2XNQA 2PT0A 3NCPA 1O51A 4NXNJ 2BQRA 2L3MA 1LWFA 5E41A 1UVKA 5A76A 5CD4A 1LXNA 1S1WB 2K1RB 2BW7A 2AQ4A 1R8HA 3MEEB 5BYQA 3NY0A 3KJVB 1AUDA 1IN0A 1QAJA 2QL9B 5L1LA 4N5SA 3QJLA 4CT9A 1T7PA 1RHRB 3I4PA 5KFEA 5D78A 2N82B 1UJ4A 2X1GA 1SQEA 2VFRA 2LKZA 3TW0A 1U1NA 1S5ZA 4IQXA 4X65J 1U02A 2R2SA 5B0AA 4O0NA 2XY5A 1NK7A 2DR7A 5L1JA 4L6V3 5GMEA 1DTQA 4ZDNA 3EX7B 4Q2LA 1PYSB 4DV3F 5F8IA 4ZK7M 2XLKA 4DFKA 2QRRA 1AFIA 3MPDA 4V1Ak 2APOA 3WHIA 1RDRA 1X7VA 1NJYA 2OPQA 4NI2B 4C8OA 4URGA 1VISA 4F50A 1G4CA 3GIJA 2KKHA 1HBNA 2MLYA 1MW7A 4NYOA 2W7PA 1SL2A 3D6HB 2VPYB 3Q22A 2RF2B 5LSRA 1BWEA 3IM9A 3KLIA 3KLEB 1T9XA 2V8GA 2YTCA 1VC0A 4TXSA 4X66F 1V3SA 1XNQF 2GQ2A 3RUBL 2RD5C 3GFZA 3I6PA 3Q89A 4F8RA 4NLQA 3TVKA 2MQOA 5DQIA 3O6QA 4PQUB 1H72C 3KKFA 3HCXA 1FXRA 3OTCA 1TL3B 3F56A 2CPXA 2QMUB 2IRYA 1VOMA 2IHR1 3BGUA 4HH0A 5LOQA 2RQCA 3MOJB 4JI0J 4DMZA 4AD6A 1Q95G 3IR6B 2EEYA 4Y2AA 5F8HA 1U4BA 1T03B 4ILLA 2F9DA 2G2YA 4TY9A 4ITSA 3KLFB 4FS2A 1WC0A 5F9LA 2JDJA 4QOTA 2BXJA 2GCFA 1NNDA 2XLIA 3QZ8A 1SI9A 4ECVA 1N36J 2HK2A 4RUAA 2Z2MA 3NGSA 2B6AA 5IC6B 5BJRA 2ILYA 2G4BA 4IOAQ 1IKVB 4AL6A 4I6YA 3CD5A 1YJRA 4N8NA 5C24B 2NXNA 1FERA 4FPIA 3D1QA 5FD1A 3R97A 3JYTB 1W7WA 2K3IA 3LQVA 2R7VA 3BSAA 4C9DA 2VJUA 3BZQA 4CDIA 1OSCA 2A2CA 5L8RC 1O5JA 1RT1B 2M9KA 3HVWA 4ECWA 1LW0B 1HNIA 3DLLQ 2KH9A 2PFFB 3T5JA 4FXVA 3C16B 3LW5C 3OVSA 4RKUC 4PKDB 5K5MA 3VGUA 3G6ES 2D3OR 4C0HA 2HNDA 2M7SA 4YDDB 3IO1A 5J1EB 1RAEB 5L1KA 2MJUA 1VCTA 2PN6A 2LQ5A 1S79A 2FZCB 2WBMA 3B54A 4XAKA 4CIOA 1UFWA 2OAUA 3A13A 3C14A 2DPIA 2CADA 3PEJA 3V5RA 4NYPA 3PR4A 1D1UA 5F9NA 2ZHAA 4OLOA 5KFYA 3THPA 2AJ1A 2XI3A 5HP1B 2KHDA 2XMJA 1GNKA 3E01B 3PACA 2ILZA 2VHGA 4DFJA 4PRFA 3UDEA 1MROA 2DR8A 8ATCB 2KFZA 3AOBA 3ET6B 1AZSA 4NLPA 1TAQA 3OFGA 5ETLA 4TLQA 4U67Q 3MFIA 5DJBA 2V63A 2DNKA 3BGFA 3KMSA 4ED7A 5G4DA 3W2VB 1JXLA 3DC2A 3MMJA 1REVA 3CUNA 3DN9A 4OLPA 2KDOA 3BKTA 2XY6A 2DNGA 2QTWA 3AOCA 2KZMA 5B09A 2DXDA 5KFSA 3OHAA 4FYYB 4N41A 2ROGA 3QFHA 4DPUA 1J5EJ 3V6DA 4OZ0A 3TUIC 1U1OA 3N5BA 5IS2A 4F4YA 3M32A 2ZBPA 4CO4A 1TL4A 1WG5A 4I2PA 3KLIB 4NRUA 3KLEA 4I6AA 3PV8A 1RWNB 4NCGB 4ZVHA 2HURA 4ZVRB 4RW8A 3IM8A 2HMIA 1HNWF 2HWTA 4B02A 2KT5A 4FN5A 1XBWA 2RU3A 2C2MB 3JQJA 3RB0A 4V19J 2BEFA 3QZ7A 3R7SB 2B9WA 3TVZA 3OTOJ 1S12A 2ZHOA 3KNGA 1Q1KA 2HHWA 1TP7A 2V9KA 5CZVA 1SVDA 2IBOA 4P6QA 5KFRA 3HHLB 3P96A 2ZE2B 1YRTA 2ZJQQ 3IR7B 2D9PA 2FLPA 5GADI 3AT1B 3EGWB 2BJDA 3GCWP 1BY9A 2O5DA 3HK2A 3MAHA 4LUBA 4QWDA 1UVLA 1C0UA 3AXMA 1IBLJ 1IKWB 3M8ZA 3V4IA 2CZ4A 4M5DA 2VG7B 1YDLA 1HBOA 1GTEA 2HWHA 3U1LA 1HQ2A 3MGJA 3NKYA 3CW2C 1PIEA 3P4UB 2QMWA 4LBHA 1NRKA 3MMCA 5IFMA 5KAKA 3CDWA 1RAGB 1X0FA 1B0VA 2CPFA 2C3UA 4O4GA 2RDJA 4O3QA 3PZPA 1ZTWA 1S9EB 3R5JB 2N3OA 2QEXS 2PE8A 4QIGA 4EYHB 1H74A 2RRNA 2CPYA 3MMAB 4PWDB 2KN4A 2XHCA 2MLXA 5KFIA 1BMQB 4O3RA 2UXBJ 5HQ8A 2Y8YA 1WD6A 3F41A 1RGVA 2VB6A 3DXSX 3H90A 1G1XA 4DI6A 2QSWA 1TV6A 3CCZA 2HFNA 3MEEA 4PCQA 4CLTA 4H4MB 1YX2A 4CYUA 3PR5B 2UVVA 4YHHF 4EBEA 3PX0A 1NK8A 1FJCA 3I9ZA 3M6XA 5DDPC 2D9OA 4A8MP 3V81B 2PGCA 3OTEA 4OZ3A 4M63A 5I3PA 4X4TA 1KN6A 3MM5B 4WZMA 3SFUA 3BS9A 3M4XA 2E5HA 1U6ZA 3BGOP 2UV8A 1HHSA 1TQLA 1RT6B 3ELHA 4WE1A 3H5UA 3UN5A 3QJPA 4DUYJ 3QAUA 1WG1A 2FLLA 1E6YA 1RWKB 1ZYQA 4NXMF 4QR0A 1JXEA 3PHTA 3Q8UA 4GVLA 3CCWA 1QUPA 1SIWB 1PSDA 4CLKA 3VALA 4GKKF 4KJIA 3DHWC 1V3ZA 2QT7A 3LANA 2O3DA 3DHXA 4UY8T 1CC8A 2ZKTA 2CVEA 2RKIA 3HSZA 3PW4A 5LMNJ 1RZMA 4LT6A 1TL1A 1KVJA 1FWLA 2J0WA 3NWRA 3W2VA 2E5JA 2PA3A 1REVB 4UTGA 2R3VA 2JEGA 8RUCA 1OSDA 1G2EA 3MM9B 3OXLA 3RBXA 1HA1A 3NEKA 3THTA 2AJQA 1D8YA 3EVMA 2IRUA 3MZIA 7FDRA 2EFQA 4MK8A 2EG2A 1F0XA 1NBEB 2OUGA 1WKJA 4CLWA 1AW0A 3AFGA 5CYJA 3G6XA 3WDOA 1RT5A 1K1SA 3ZZPA 6FDRA 4TN2A 1ACMB 2YNFA 3UVJB 3MXHP 1FKOB 1RT4B 3ZZTA 4A47A 5D8HB 1RT2B 5A8KA 1WOSA 3BPDA 4P10A 4I2QB 4MTPA 3VAMA 4QJVA 2JFDA 4URSA 1FDNA 1CULB 2OPPA 3C6TA 5ETQA 2XGQA 4U7CA 4J9RA 4IH5A 5KFKA 3W64A 2ZWPA 2DNZA 1VQNS 2DH8A 4F4XA 2VL1A 1B7FA 3R7NB 1VBKA 1D3WA 2R7QA 4B17A 1F9FA 1MWQA 2AD9A 2CPHA 2VA3A 5A6PA 4LF8F 1RWMB 2QV6A 2BKOA 3L9ZA 1KP6A 4X66J 4DV6J 3GQCA 4QW8A 4HI1A 2SXLA 4ZLJA 2CQPA 4ELVA 2WK4A 1NXIA 2HFSA 1S6PA 3MFHA 1S1XB 4X84A 4LMZA 3IA0A 3ZTQA 2UUCF 3H20A 2BZ2A 1LV5A 1W26A 2IIHA 3O44A 4A8WA 2WB4A 2W2QP 1S0VA 2VBWA 3FRZA 3JTPA 4OYWA 4DSEA 4A8OA 3PNIA 1F2GA 3SFGA 1S6QB 4M5GA 3NG8A 4H4KA 3W7BA 3V6HA 4JV5F 2HW3A 4B3SJ 2YPZA 4ZPDA 3DYAB 2E5IA 1D9DA 3J7YU 4J9LA 2EC0A 3JSRA 1NK5A 2CUYA 1Q8KA 2DKOB 3BGLA 3N79A 4K59A 4ZPTR 5KFFA 4B3OB 5GAHU 4DR4J 4JI7F 2HAFA 1FRHA 4CYUB 4GKKJ 3SCKE 2D74B 4DPTA 2QYGA 2M2BA 4DU8A 1RTJA 4ES2A 2F5GA 3I0SB 1IKYB 1P8GA 1FTRA 2DO0A 4P74A 4PABA 4F25A 1M5VC 1ZZFA 3FFIB 1HNZJ 1Q5YA 4MKVA 5E7OB 4H4MA 1TVRB 2B4VA 2CVIA 3DRRB 2PA8D 5IWAF 5KFOA 5J2PA 4GC6A 1KLMB 2I5JB 2C28A 3BDPA 1YBAA 4X4PA 1WKKA 5D0EA 4MJKA 4LRFA 3J7ZT 2AJ2A 5D4LA 2NPIA 3K59A 2AWZA 1RWPB 5GAGU 3TAQA 3O2IA 3EDQB 2XMVA 3I87A 3SQGA 1CJVA 3KLGA 3LF0A 4GC7A 2R8IA 2X7IA 4GRSA 3FBBA 2NLWA 3QNWB 4Y34A 2QO3A 2VG6B 2J6UA 3NNAA 1S6PB 4BC7A 5GAEI 4DLGA 3M2RA 3FRYA 3NMRA 1NCLA 3MECB 5HQMA 1WC3A 3L09A 3V6KA 3I0RA 3GSIA 1YIJS 4Q0BA 2GFFA 3BQ1A 5IT9U 1ZZNA 1NK0A 1Q82T 4JI2F 1VRTA 2X51A 3OR2B 5A0YA 3D6FB 2ZITA 3BGRA 4FDFA 4ECSA 4PG5A 3K89A 2XI2A 2XYHB 4XIUA 2ZVIA 1UFKA 2M88A 1XEZA 2KG0A 2AZ3A 4I2QA 1H7XA 1P6TA 1PG5B 1WF2A 2YNHB 2KM8B 4DV0F 1SC3B 1SJ3P 1NMEB 2ATCB 3P5BP 1IM4A 3GIRA 1SL1A 5AE2A 1R6YA 3IP0A 4J9QA 1X4GA 3W9JA 1YRXA 1CPZA 3EVWA 1GFWB 3DM2B 3GP9A 3L95X 4PXCA 2JEIA 4ZVFA 1N32F 1RAHB 2AYMA 2NYHA 3ZTPA 2FTRA 4WU3A 3U7JA 3T3FA 2VDIA 3OUYA 2M52A 2HAIA 3ZTOA 2HMIB 3KK2B 1JLQA 1J5EF 3ZZRA 5KG6A 1SJ4P 3EXCX 5DDQC 2W7OA 1BQNA 1RT7A 3FDSA 2JRSA 5ETNA 1QD1A 1S1XA 4RU9A 2HVHA 3PIOQ 2OMLA 3VF0B 3AHPA 3I5CA 1T9WA 1WOPA 2H3EB 2VFVA 1PCAA 2DGUA 3HI9A 2VU5A 3MEDB 4HDHA 1RTIB 1YK9A 1FRMA 3RRKA 3MUVP 4PWWA 4GKJF 4N56A 4NE9C 2HRTA 1RKIA 4IH6A 2GA7A 1TKDA 2V4JB 4LSLB 2C3PA 4CO2A 1YJWS 4EO6A 1T3NA 2UXDJ 2IM2A 1S59A 1FRXA 3AB2B 3JQKA 2MMYA 1NSPA 1GK8A 2HEKA 3K8WA 3LP0B 3QYYA 2W9BA 2VIHA 4FF4A 2HG4A 4DF4A 4AE5A 3PYDA 5KG7A 1CJUB 2H5EA 3POTA 2WSFC 2HHHJ 2CPEA 1LWCA 2G2ZA 3IRXB 1O8BA 1F5CA 1L3TA 4JI5F 3PYGA 3QO9B 1ZAVA 3DU6A 4B3OA 1EB0A 1X5PA 2MZ1A 5H9EK 4HYKA 4LF4J 1RWVB 3IMQJ 2CZ9A 4ZCLA 2B5JB 3UQSA 4ED1A 2YWHA 2P9EA 1N0UA 2CQBA 2RUGA 3PO5A 2IRXA 4WYLA 1F9HA 4IQMA 1LFWA 5DLGA 1S9FA 4I4BA 5KT6A 1UWBB 2V69A 1H7WA 3P6YC 3HD1A 2BUNA 2HKEA 4G6VB 2VG6A 1KFDA 2XC9A 1S1TA 2HHUA 4QU7A 3K8VA 4K4YA 1HBOB 2VBZA 3PCOB 3OFEA 2Z58B 5CQGA 2MYFA 3AQPA 4KH0B 2AGQA 1RA6A 1Y11A 2VC0A 2K7JA 4GO5X 1KTVA 5KG3A 4V19X 3EPIA 3AAWB 1Y00A 4RUHA 1FRIA 5HQLA 1N36F 4KKOA 3AA8A 1ITPA 3KXDA 4AUKA 3DRXA 1SL0A 4OMFG 2GJ2A 2J76E 3HVTB 2CJKA 4WBFA 3IXQA 3HT0A 2F1FA 4NL5A 3Q2TC 4FNIA 3VAHA 5C2CA 1VBZA 4K4VA 5JVGQ 4H4OB 3T9NA 4NCGA 1HMVB 2DY1A 1QAYA 2ZZTA 2VOPA 3NNCA 3MPUB 2ASJA 1CEZA 4QWEA 2WZ1A 4ILMA 2BJEA 3J7Z5 1TL7A 2ZD1A 1RCOB 2LVWA 4Y28C 3TO8A 5EDWA 2VOOA 3KJQB 2QA1A 2ZOFA 5EX3A 2R7UA 3CCQS 4B9LA 2Z2ZA 1IR2A
chains in the Genus database with same CATH topology
3LH2S 2LU2A 4OI3A 4C8ZA 3LO3A 4UUXA 3C2PA 3M8RA 3AJ1A 4C2MA 2MZSA 1C0TA 1Q78A 3PM9A 3RAQA 1FXDA 4KO0B 4DSFA 5C42A 2UVUA 3HZGA 1KOHA 2ROEA 1TKZA 2VFTA 3KK2A 3KLVA 3KG1A 1GAOA 2BE2B 3HKWA 3UDLA 1R8PA 4N47A 4O44B 3TRGA 3M9NB 5E3PA 1UETA 2W4PA 5IQ6A 3RR8A 1MMNA 1XK8A 1FVSA 3G86A 3OSPA 4RX6A 5FLXY 3QWUA 3OSNA 1RYSA 1YTYA 4MK7A 4OI2A 3MPVA 5D4PA 1QSLA 2J6SA 1Q7YT 3H5YA 3LP0A 1L5UA 3CJ2A 1HR0F 2FC9A 1MROB 4PG4A 3U1MA 4DDFA 3ENVA 3LALA 2POKA 3O5TB 3NBPB 4B3RF 4WIIA 3QO9A 1IQZA 2R7XA 2WOMB 5C24A 1S6UA 4FZVA 3SSSA 2KXHA 4ECUA 4BS2A 2AGPA 1UL3A 1SKWA 1K73T 1LWFB 3CCJS 3DXBA 4I69A 2NS1B 4TKTA 2MKHA 4OHXA 2FJBB 1KQFB 3IAM9 4ECRA 4RBUA 3LGMA 2EK1A 1XR6A 1S1UA 1TL1B 2ZH9A 2R7WA 4FF1A 2DGQA 4HI2A 2HFOA 1LW2A 1U1KA 3VAKA 3UCGA 2ZNYA 5CXTA 4ELUA 4QR1A 2R7RA 2HHSA 3B78A 4C0OC 3PVXA 2YNIB 1VQ4S 3BQ0A 4Q5VA 2MY7A 4O44A 1FDDA 1JJ2R 1HL6A 1KOOA 3MM6A 2C2RA 1A9NB 1U47A 1HARA 3FEXB 4R25A 3KFWX 5KFCA 1U6BA 5I42B 3FSXA 4RWXA 5BYRA 4JI1F 1MMDA 4F02A 3OUYB 2R2TA 3WC2A 3T1YF 1VC6A 1CQMA 2WW8A 2CQDA 2ZJPQ 2VC1A 1S48A 1S1VB 1OO0B 3UR3C 1H2TZ 1WF1A 2J5AA 4OQJA 5HBMA 2W25A 4TU7A 4ELTA 2IYIA 1G3OA 3FNNA 2UUBF 3CJ3A 2YNHA 1IJFB 3DLEA 3OHBA 1FJGF 1N5SA 1WEZA 1Y5NB 3AY0A 4X4UA 4DL4A 4B3TF 1DURA 1RAJA 1BGXT 3QAEA 5G0RA 4WFZA 1HWUA 2COLA 1ZM2A 2IM1A 5IT0A 3I31A 1YJ9S 4RW9A 3T6JA 4BHQA 1T94A 5JJBA 3MR3A 3JAMY 3A8EA 3QGHA 4X64F 3G4SS 3BO3A 4DV2F 1KHVA 4DLEA 4YR3A 3V6JA 2DIVA 1OIAA 4P2SA 2A10A 2F9JA 4J9KA 1DLOA 1WEXA 1YGYA 2FVRA 4RU2A 4M94A 5SUHA 3H5XA 1RTIA 1TVRA 1S76D 4KTQA 4KSEB 5IQQA 4I6WA 2F8EX 2FJEB 1HWKA 3UW1A 1O0PA 1N8RT 5DQHA 4Y2CA 5AXNA 3TI0A 2VH7A 4LIRA 2LQBA 3VZIA 1QTMA 4MFBB 1L3SA 2KZZA 1U2RA 2HNYB 2OSQA 2AYEA 3ZZUA 3U27A 3TOQA 3OLBA 4NLOA 3PIPQ 3OW2R 4HLBA 1P1TA 1QSSA 1WHVA 2MZTA 5L38A 1FK9B 3RAMA 1S1UB 3MR5A 1BC6A 3EUNA 1L3UA 5AXMA 1LQ9A 2G1DA 3QGIA 3VAJA 3UD4P 1N33F 4CQ1A 4O3PA 4ZHRA 1XERA 4AXJA 2CYYA 4Y3CA 3G9CA 5KFWA 1FXLA 3ZZZA 3GB0A 1DAXA 2RKIB 4RW4B 4O23A 1RISA 2OPSA 5DS7A 5K8MA 2I38A 4B08A 4QQBA 3OV7A 1FKPA 3M05A 3MURP 5KG4A 2J6TA 2ZBIA 3KK1B 3P3DA 3UE2A 3GFYA 1ZH5A 3VTIA 2FY1A 1TKTB 1UVIA 2VUGA 3LOUA 4F3MA 2AX0A 4FP9A 4LQ3A 3MPYA 1WWHA 3FEZA 4MMOA 1X5OA 3M1VB 4MYTA 2CDQA 2YNGB 3GR0A 3JYTA 1RT2A 3D1OA 5B0DA 5K14B 1JLBB 3DLEB 4MIBA 3DMJB 1KQGB 4NWBA 4QIWD 1KD1T 1QE1B 4ZA1A 3N28A 3WBZA 4NLGA 1RA7A 2IJFA 2WONB 2C2EA 1LWEA 4M5DB 4JI8F 4TY8A 5LSLA 4UOCA 1VQ7S 1M90T 1QAIA 5SZTA 1AFJA 2XO7A 4WCEQ 2RDIA 3CJ5A 1KVIA 2JC0A 1NB7A 4DR1F 2L9WA 1KLNA 1CQNA 2GMJA 3ENQA 2I8EA 4LFBF 3CIZA 4QPXA 3CJ4A 4F2RA 3W2WB 5LJ3Y 4KIAA 3F73A 2YWKA 1IKYA 1W2BR 4Q8EA 1IJEB 4ZLPA 3VZHA 4OHZA 3E51A 4OFZA 4CNYA 1KLMA 2AJ4A 2CPDA 3SQGB 2HQ3A 1URNA 1KS2A 1HMVA 3O8WA 5AXLA 4J9MA 1JLFB 4I56A 3RR7A 3V81A 3M6WA 4O3SA 4B9UA 2J9CA 1WF0A 5IZHA 1URRA 5KFTA 2JVRA 2J9EA 5DETA 4F4ZA 1Y3JA 4KHMA 1S9GB 3H98A 5J1NA 2X1AA 5KFVA 2V8DA 1XMQF 1RTJB 4BCAA 2EBGA 3K5OA 4RNHA 2R7SA 4PUOB 2O67A 4MKYA 4C97A 3ULHA 4OX8A 1QE1A 3LWLA 2FVSA 4A8XA 4OI4A 4K4SA 2Z8QA 1SH3A 2ZVSA 1YI2S 4KFBA 1D9FA 4CO5A 5M2PA 4RNMA 2MGZB 4R0JA 4WK3A 3VAIA 1Q4RA 2VASA 4IRCA 5FDLA 1Y4ZB 1HYSB 1VQPS 2KYXA 4UUWA 5KTQA 2B4OA 2CIMA 4TU9A 2NXUA 3M8SA 3T5HA 4C11A 3CMES 1V6HA 1AROP 1K1QA 3KK1A 4DS4A 4B9SA 1JJHA 4DFMA 4YR0A 4DSLA 4FNHA 3HHLD 4AYBD 4ECXA 2EFGA 2FJDB 2OFHX 3DRPA 2ADBA 2ZH4A 3CCRS 2ASDA 3P49B 3FQLA 1NK4A 5HROB 4U6PA 2KRRA 2HFZA 4JUZA 2EW9A 2IMWP 1NJWA 3QJJA 2PEHA 3BREA 3C66A 1KTQA 4CTAB 1X5TA 3S1TA 3UCUP 1PILA 2J9DA 2V8VA 4J9NA 4ECYA 2WBRA 3DLJA 2Y1JA 1VQKS 4K4UA 1VK3A 3KLFA 4MH8A 4E98A 1K8AT 1Y5LB 2LDIA 5J2QA 2FPHX 1KEKA 2Y0SD 2Q6BA 2QIFA 1WTBA 3K58A 1FF2A 1HBMB 4JV2A 3CT9A 3I9V9 4KR0B 4ZPVR 1HNZF 4PG7A 3KHRA 1BLUA 3FZBA 1APSA 1TUVA 3I55S 3IS9A 1RT1A 3FSIA 2CPZA 2MKKA 2DNLA 1T02A 4QIVA 1DFDA 1A7GE 3R5CA 4JV1A 1D9AA 3IWNC 4IFVA 4DG1A 1WACA 1U6FA 1S1TB 5T7LA 3AB4B 4R5PA 3G6YA 2XNRA 1OS5A 4IFYA 3P5TL 4UW2A 3I4HX 3C3LA 2JWNA 5DM7Q 2W4CA 3OL8A 2MJNA 1N48A 1FNXH 1JJ4A 4DX8H 2VPWB 2YKNB 2RH3A 1H6KX 1M5PC 5IM0A 3CULA 3CE8A 3OBIA 3NMAA 2IVMA 3BO4A 5CA5A 5A8RA 1VQSA 4R8UB 2B5JA 2CZVC 2UVWA 2YKPA 2HHVA 2BRKA 4HEA9 1U25A 4WF9Q 2R8HA 5HO4A 1C2PA 4NZ0A 4LF4F 1HFEL 1VQOS 2C3MA 5B0FA 3UNGC 3HM9A 4ED3A 4WKRA 3RRGA 1M5HA 5B0CA 4H54A 3H8YA 1R8CA 4UQTA 5H1SV 4EEYA 2HHHF 2R7VA 2KI2A 4RW8B 4ALZA 5CYMA 1S6OA 3IS9B 4OHVA 2WTFA 3OXFA 1UVJA 3S01A 4I1TA 1JLGB 1CG2A 1X0PA 4ZVEA 3DYAA 4IRKA 3CIMA 3ZC4A 2DGSA 4DQRA 2OPRB 1P9QC 2NQPA 4JI4F 5LXRA 5KT4A 4OJ3A 3I5AA 3UR0A 3TP2A 2DGTA 4EZ9A 2GJIA 4C98A 3M2UB 2HNZB 3MM8A 1VFJA 4ZOSA 2E5LF 3PW2A 2ZH6A 1VBYA 2I2YA 1ZOTA 1MU2B 2YKAA 4YR2A 2U1AA 3MEKA 3MR2A 3V4IB 1SB6A 2KJVA 3UI3A 5H9EJ 4XDDA 3IN5A 3T19A 1FE4A 4CZCA 2LCWA 3I32A 3JSYA 5J2NA 4GMKA 4Y65A 3DU5A 4CH7A 1S0MA 4NZ7A 1AXQA 3SCLE 4E8UA 3HO1A 1VIOA 1X4HA 3SZ2A 3X1LB 4KHRA 2KRBA 2VFSA 2WB1D 1VQ8S 7FD1A 1DLOB 1ZM3A 4YB1P 2IVFB 2XSJA 1DZ5A 4W92B 1HI1A 1RT4A 3PJXA 4C0BA 5D4OA 2Z2LA 3PW7A 2KO1A 5A8KB 1VQ9S 4HTJA 3MD3A 5CD4H 1N6QB 1LWCB 1SIZA 4I64A 3K7RA 3ZZYA 2DRBA 4NLDA 4DHVA 3RBEA 4KGMA 2A2DA 2UUTA 4DR2F 2YKMA 1T05B 4YQWA 1UEUA 2DNPA 3C8YA 1CVJA 1WHWA 2ABYA 4KFBB 4B9NA 4WZQA 3PFOA 3SMZA 3SDEA 2W24A 3DRSA 3CXCR 2GV1A 2L9NA 3CC4S 1NH8A 4OX6A 2GMHA 3M2UA 3MM8B 2RVJA 2B6AB 3PY8A 4HKQA 4ZHRB 2LECA 4Y00A 2ACYA 5I3UA 3N5FA 3VCDA 3B8HA 5BR8F 1PGZA 2BACA 2KXFA 1S1VA 1XMBA 2RQKA 2DGVA 2XS5A 2AX1A 4LF9F 2OSRA 2CFXA 2RF2A 1PC4A 1T3OA 3MUMP 1K0VA 2FVPA 1S10A 3M30A 2Q1LA 1XTZA 1N4LA 3LGNA 2HNDB 5J1EA 1QVGR 2B7BB 3RB3A 5MLCV 2GHVC 1VHFA 3MMAA 1CC7A 5DDRC 1FO1A 4ZP9A 1TZ0A 4C3LA 3CSKA 5GAGI 5DG7A 2MQQA 3CCES 1ZAXA 4DR4F 4I68A 3ZFVA 2AGOA 2F3JA 3MMBB 5H9FJ 2Y1IA 4NLYA 2BW2A 3DOLA 2ZC4A 4B3SF 2KXNB 4OZJA 2FJWA 2OP5A 2MZQA 3GV8B 3BJYA 1A6LA 4DQSA 5HL7Q 3DCAA 4FVMA 3DI6A 3R27A 1GTHA 1S49A 2WHOA 2I0XA 1DTTA 1NO8A 3J7YI 1YJVA 5B7WA 3H2UB 5KG1A 3KHGA 5GAHI 5JUMA 4B9VA 4OV1A 5KT5A 2B0GA 2PMHA 2HS0A 1EETB 4K0KF 2MKIA 2UZAA 1YQHA 1SJQA 4CO0A 3HHNB 3H4DA 3E8OA 5M2UA 3GIIA 3JTOA 1N5TA 3NS5A 4WFYA 5LT5A 3QGPA 2RRAA 1M0SA 2DCLA 3EZ5A 2IMOA 2XSFA 2YY3A 2E9RX 2V4JA 2R2UA 3B82A 2ZJRQ 2OMOA 3DDKA 2DH9A 4F4WA 2I9SA 4YOEA 4W90B 3CDEA 2EBEA 2VBYA 2UUWA 2HIQA 4I7FA 6FD1A 2K8GA 1Y7PA 1U1RA 2NUUG 5AJ3F 1HQUB 3S8SA 2OFGX 4I0WA 1IKXB 3GYNA 4ZVGA 1RP5A 3CCLS 2DTJA 1FTCA 3MTKA 5I4MA 3D5MA 3MM7A 4R0EA 3D0HE 4QW9A 4NLXA 5D77A 4A48A 5DQGA 4C3KA 2ZKUA 1IR0A 5HMXA 4DSIA 2B7CB 3TR5A 2JLFA 3TA0A 3C46A 2ZH8A 4LFCF 3QMQA 4IKAA 5K14A 2EFNA 2CQIA 2W9CB 3TANA 5K8NA 2FJVA 2LLZA 1C4CA 1J5OB 3LUYA 2DO4A 4DUYF 3JSMB 3CF5Q 3SI8A 2VG5A 1SXLA 1JX4A 3RU0A 2GMLA 1EETA 1Y5IB 1ELOA 2HGLA 2ZZMA 2BANA 2B4PA 3GFXA 3JSBA 3KHHA 3NLCA 4KO0A 4ZPBA 5ADZA 4H4KC 3CCVS 4JBCA 3HP6A 3IG1B 1KC8T 2GW8A 2K3KA 3PW0A 1IKWA 4QWBA 1U48A 1NHUA 3GYXB 3PFEA 1HNVA 2FJAB 4UQGA 4A4JA 4C8LA 1H2UX 2A1BA 2VFUA 3KHLA 1M1KT 4ETXA 2HRYA 2IVYA 5U47A 3ITHB 2RMLA 3PHEA 3D54A 2DNRA 2VG7A 2VPXB 4YFUA 2M8DB 4LJMA 1S77D 3PKMA 2G13A 5L9XA 4IO1A 4XPCA 2YWGA 1JLFA 1EP4A 2P6TA 4MK9A 1L3VA 1IBLF 4ERDA 4DBQA 1FEHA 2WRMA 5KFJA 3CGIA 1C1BB 2B51A 1SV5B 2DHGA 2XB2D 3HMJG 4B3MF 1WI8A 3JTNA 4NLTA 2XGPA 1IUJA 2UXBF 2CJAA 1MWYA 2LA6A 1FVQA 3N6MA 1VJWA 4OI1A 3FJ2A 3MM5A 2XMWA 2Z0GA 1QVFR 2PD1A 5EHHA 5KT3A 2CQ0A 4IR1A 4ZCKA 2DR9A 2CKWA 3M2VA 2UVRA 2KB2A 2DB1A 2RS8A 3UCZP 1YHQS 4B9TA 1ULRA 2E5GA 4G1PA 4TQSA 2DGOA 1NJXA 4CCHA 5KT7A 3HPOA 1H3DA 2R7TA 3WX4A 4QIEA 1GXTA 2FHOB 1VQ5S 3AJ2A 4NX9A 3TAMA 3VQSA 1LK5A 5K8PA 1HW9A 3DOKB 3CMAS 4NYZA 5L1IA 3VAGA 1YSJA 2JZ5A 2RIJA 2RRBA 1D0EA 3G8QA 2HS3A 5J1PA 4DQIA 3LP2B 1H98A 4C4WA 4ID5A 4YUDA 1GH8A 2KHCA 3TA2A 4F3QA 4RBTA 2X1BA 3K0JA 4F3OA 3CCUS 3KLHA 2BM1A 3B4MA 3DOMA 4QR2A 4RNFA 5KG0A 4YB7A 3KK3B 3MEGB 4IG3B 1SJFA 3O1LA 1PC5A 1X4DA 2B3TB 2MGZA 1X9MA 1N5YB 2LMIA 5EWGA 3C6UA 4DL5A 3V2UC 1ZM9A 1UEVA 4TNOA 5KG5A 2MDAA 3HVAA 1VC5A 1C0TB 1IKVA 3EPGA 2IC3A 3UDCA 4CH1A 4NCBA 3OR1A 1JLEA 2QYCA 4YY3F 2CQ1A 3TYTA 2ZBCA 3MOZA 3QLHB 3HLUA 1X4CA 2BE2A 4G3IA 1KONA 1M5OC 2IFXA 1GX5A 1TKZB 3CD7A 4OIXA 4C7QA 1E6VB 1OPZA 2MKJA 1S97A 4WE1B 3GSDA 1JB0C 4DFPA 2J0SD 4DV6F 1C1CB 2D1CA 2CQ4A 4P7VA 1KRPA 3OPKA 4OZLA 4Q7AA 2V5HG 4YB6A 4ECZA 1VRUB 4WTYA 3L7OA 1Q79A 3DI6B 3G96A 4WFBQ 1RYRA 4O4RA 3TAPA 4BDPA 1YWXA 3N0VA 4NMLA 2XS7A 3GE9A 3QPIA 5E3RA 1Z4UA 2JSXA 1SKSA 3BF4A 4RW6A 3QGGA 4IFYB 3I82A 4K5RA 3R5AA 2DHXA 3N01A 2EFVA 4Q2MA 3LPYA 4U7UK 4Y0FA 1JLAA 4F4KA 2M3DA 3H5SA 3MCSA 5KFXA 3MWBA 1HQEB 3KOAA 3ISNC 3KLGB 3DOLB 4LSNA 1QJHA 1YRUA 2GC8A 4WFNQ 3H59A 2DGXA 4QWCA 2HHXA 4JOUA 5LMNF 4K4XA 4FF3A 2MZRA 5T7LB 4R5PB 1HI8A 1F5AA 1NU4A 1JIHA 3MAQA 4X65F 1JLBA 3BQ2A 4IFVB 1TKTA 2ZH3A 1U8SA 1S1WA 3BSNA 4NCAA 2HHQA 2JEFA 4PQUA 5DG9A 2EK6A 2YKQA 2HVZA 2RU9A 4USJC 1W25A 5F41A 4DN9A 1B0PA 4KRWA 4J9OA 2C3YA 3SXLA 1TFWA