3AJ1A

The structure of axcesd octamer (n-terminal his-tag) from acetobacter xylinum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
KKPDFTLFLQTLSWEIDDQVGIEVRNELLREVGRGMGTRIMPPPCQTVDKLQIELNALLALIGWGTVTLELLSEDQSLRIVHENLPQVGSAGEPSGTWLAPVLEGLYGRWVTSQAGAFGDYVVTRDVDAEDLNAVPRQTIIMYMRVRSSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of bacterial cellulose synthase subunit D octamer with four inner passageways
pubmed doi rcsb
source organism Acetobacter xylinus
molecule tags Biosynthetic protein
molecule keywords Cellulose synthase operon protein D
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03500 Cellsynth_D Cellulose synthase subunit D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2590 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aj1A02
3AJ2A 3AJ1A 3A8EA
chains in the Genus database with same CATH superfamily
1L3KA 2NCKL 3N5FA 4DV3F 3BKTA 1N4LA 4QWAA 1GXLA 4QOTA 2GHPA 2NSCA 4C4WA 4P10A 2CJ9A 5F9NA 3KLVA 3TZWA 4USUA 5AXMA 5ADZA 1N33F 1SIWB 3P45B 4GC7A 1WC6A 2OAUA 2HGMA 2V63A 2VUGA 2EG2A 3M6VA 2W9BB 3CCQS 1URNA 1CULB 2F9DA 3M1VB 4OHXA 4YDDB 2ZFHA 4QYRA 2OEKA 2KN4A 1EQMA 1TFWA 3GJQB 2HVZA 4YB6A 2J7WA 4RU2A 2CQGA 4C7QA 2KO1A 3BB5A 4TKTA 3ZZZA 3ETMA 2V4RA 2HHWA 5D8HB 3OQ2A 2PE8A 2UU9J 5D4LA 3LUYA 1FE4A 2BJ8A 3IGVA 1Q1KA 1CQNA 4Z2XA 4TQRA 3VAFA 1VQ7S 5KFGA 5DG8A 5FLXY 4CWBA 1L5UA 1R6YA 3MUMP 4DPUA 3D7SB 3LPYA 2BEFA 1XMQF 1C1CA 3KK3A 2DXDA 1DLOA 1KVKA 3AD9C 3CD7A 2VBXA 4OHYA 3QSIA 4J9MA 1UTAA 2W24A 3BV8A 3C66A 2FIUA 3ZTPA 2KU7A 1Q81T 1G4CA 4LSLA 4K0KJ 5J2QB 3I6PA 2C3OA 3PJXA 2FJVA 1FKPB 1WC5A 2KM8B 1S0NA 4IRKA 1PGZA 1S6UA 2MQOA 1SJ1A 1UMJA 1Z1ZA 2DD8S 2NXJA 3G82B 1HQ2A 2DR8A 1UVIA 2LA4A 3DN9A 3IR7B 3PFEA 1SH3A 3T6JA 1UW9A 2N4CA 4F25A 2MYFA 3F41A 4JYAJ 1PAEX 3AAWB 4X4PA 5HMWA 2QFIA 1HI0P 4OI3A 4AE5A 3OLBA 1CJTB 1R6VA 2VFSA 5A8RB 2B5JA 1KR4A 3O1LA 3A3NB 2MKYA 4Y3CA 4F0KA 3THTA 3M9MB 3HJFA 1C0TA 4M5GA 3HHDA 4PG8A 2QE5A 1X5TA 2DO4A 3OTBA 3DFEA 2BVZA 5K9FA 4A47A 2E1PA 4M5MA 5JJBA 3KHRA 2R7RA 1PG5B 3W65A 1B3TA 3MM7B 3NWGA 4RNOA 4WFAQ 1QAYA 2HK2A 1OO0B 2DT9A 3WIUA 2P6TA 5AE2A 2U2FA 2BRKA 2NYHA 4DV0F 2MKHA 2VC0A 2ZDPA 2ZOMA 3H90A 4FDFA 4AL7A 1J5OB 2BQRA 4YR0A 2V67A 1HWJA 1WSRA 3H0PA 3KG4A 5F8IA 2L41A 1RTHB 5T7LA 3H5XA 4R25A 3KOAA 3VAIA 1EZZB 4RUCA 1C0TB 2AMCB 2JL9A 5C7PA 3DHWC 3MCOA 2EFOA 2A18A 2JC0A 1T0TV 3WIVA 3BBFA 1RT1A 2ZBQA 3TYTA 2LYVA 1MN7A 3I9ZA 1SB6A 2GGPA 4CLLA 4YFUA 3HKWA 2OIHA 1R0AA 1DBDA 1PYOB 4MYTA 2UUCJ 2C2DA 1XNQJ 5J2NB 2UUBF 1EB0A 1DZ5A 1YX2A 4GVBB 2WCXA 2H51B 4P6QA 3DOKA 3D3CJ 4XTTA 2QTWA 3UE2A 3GJSB 3CC2S 2XC9A 2QLXA 4PEOA 4PR6A 1ITPA 4WF9Q 2FJBB 2V8VA 3MI7X 4DX7A 4JI2J 2M9KA 2QLBB 4I64A 4ZKAA 4ZVOB 4GKJF 5KTQA 2CWXA 2CPYA 1GT8A 4ZVHA 1RISA 2DH8A 3UR0A 3EGVA 4ATNA 3KDNA 1NJWA 3FCVA 4HEA9 3BR9A 4OYMA 2CJBA 4X2BA 3M2UA 1C4CA 2BKNA 3GSIA 5GAHU 5C25A 5IC4B 4NXMJ 5G0RA 2DKOB 1H72C 3TX0A 4ILRA 5F3ZA 1WF2A 3GB0A 2RIJA 2ZZTA 3R2CJ 3M8RA 2F5GA 3MD3A 3TP2A 3HDSA 4RJVA 1QSYA 1S1WA 2CQCA 3HHNB 1VQYA 2QA2A 2ZVIA 4R5PB 3TW0A 2WVBA 4EU0A 2YVSA 1YK9A 2MMYA 1U8SA 2FZGB 3FEXB 2EK1A 3FZBA 3MTJA 4J90A 3SDEB 3QZ8A 4QYZJ 1M5PC 2BX6A 1N36J 1KD1T 3OR2A 3V6DB 1WEXA 4JI2F 1KVIA 2HQGA 1O0PA 4B9UA 1RU1A 4RX6A 5AXNA 2XM3A 2XY5A 1UZDA 2G4BA 2CQ3A 3JQKA 1RLCL 4DX6A 3HT3A 2VONA 5A8RA 3CJ2A 5ETLA 4UOGA 1T03B 1TK5A 1YBAA 2R42A 3QT8A 2C2RA 1YI2S 4RL1A 4RKUC 1SL2A 4DXLA 3SXLA 4KTQA 2HQ3A 5F9LA 2UVVA 4GKKF 1EIYB 1NU4A 4F2SA 2E1MC 1RWPB 2VHGA 3CC4S 4UOHA 3OXGA 1OYEA 3UFCX 3DRPA 1BHNA 1D8ZA 1H74A 1Q7LB 1F0XA 2GJIA 3BEGB 3BH7B 3PRVA 4J9NA 3TANA 4ES1A 4CNYA 3VV2B 3TJ9A 3SFUA 2Z2ZA 2NREA 3KMSA 1E6YA 3DOMB 3D1OA 4MIBA 3P49B 1BMQB 1S1XA 1VIOA 1IKXB 1XQIA 1SL0A 3AD7C 1NK9A 1FJGJ 4CO3A 1RHUB 4CTAA 2DGSA 4NLGA 2HAFA 4I2QB 3NGTA 3R5CA 3OJUA 2C3UA 4LRDA 1MROB 2Z0GA 5I3UB 3TZYA 2L9WA 3MEGB 2ZH9A 2W7OA 4R8UA 5HMYA 3SV3A 4K4XA 2VOOA 2CKWA 2VBWA 4FXVA 4NRTA 1JX4A 2KT2A 4LF7F 3J7Z5 4O44A 2EI5A 2BJDA 1R31A 4HTIA 2ZE2A 2DHXA 4RW4A 4YR2A 3OV7A 3H4DA 2KM8C 3HD2A 3QGIA 5I3PA 1JWWA 5KFUA 1JMTA 1SJRA 5LXYA 3EWGA 3N9UC 4KKOA 1HNVB 3OVBA 2KJVA 3OL8A 3N6MA 2IDLA 5E3AA 2CNNB 4PAAA 3H7HB 4B3SF 3VVUA 4F3OA 3K0JA 2OTJS 5GAEU 1XR6A 3A12A 3FNNA 3PIOQ 4DR4J 2YKMB 1LWEB 3X1LB 3GV7B 3LF0A 3UQSA 4LFAJ 4LF1A 4EZ6A 5KG3A 2DHGA 2BANB 5BR8F 1V6HA 4V19X 2GJFA 4AQYJ 1CJKA 1IWAA 2Q3PA 1S9GA 1DJ0A 2N7YA 4QPTA 4B3OA 4DL4A 3ONQA 3R5JB 3T41A 2RILA 5DS7A 3UDCA 3KMQA 1BE4A 1OWXA 4ZPTR 2HVHA 4UOFA 3RU0A 5HLFA 4DR7F 4M5IA 5A8WA 4A8FA 3UN5A 3AODA 4ZJOA 3K17A 2HG4A 5LL6d 2XB2D 3HVWA 3OSPA 2MXYA 2KFNA 2BJ9A 3M2VA 4ANCA 2E66A 2MLXA 3J7ZT 1WI6A 2DGOA 1MWZA 4C11B 5IT9U 2HNDB 3LAMA 2DK2A 3UDLA 1JLEB 2HK3A 2EEYA 3CCTA 4FBUA 1UJ4A 2RKIB 1IBKF 1LFPA 3MEDA 2KYXA 3SDEA 4CM2A 5DQGA 3KYLA 4DWIA 1TMMA 2X1FA 2W2QP 2AZ3A 4WIQA 3H2VE 2X1GA 4A8YA 4MAKA 2UUBJ 1X5SA 4FVCA 3MEKA 1Q79A 1G1XA 1WDDA 3D66A 4RW8B 3PW2A 3JB9k 2E9RX 4NLVA 1JLGB 4PCQA 5MLCV 5D4OA 2HRYA 1TUVA 2LCWA 3N4WA 3I0RB 1NSAA 4PABA 5KFCA 3WDOA 3KHHA 2F4VF 1QSLA 1KTQA 3ILIA 2DNNA 4KY3A 2DH7A 1FFSB 1U6FA 2OFHX 3C3LA 3DLJA 1F1BB 1T8EA 1TL1B 4X64F 1S99A 3DI6B 3UN3A 5KFJA 1LWFA 2QL5B 3M2VB 3NS5A 4NYPA 1WEYA 3CC7S 4ECSA 3CMQA 4URSA 1RHMB 3F0NA 4F3QA 4O0IA 3Q22A 5JVGQ 2C1EB 2CPHA 2HFZA 2NZCA 3MD1A 2MZ1A 3OLAA 4ZP6A 3GV8B 3VAJA 1M90T 3PO4A 4FNHA 4J9RA 4O4RA 4FPIA 2RUSA 2HBZB 4FVMA 1N5QA 2QYCA 3T1YF 2CRLA 4J37A 3HULA 2IVYA 4CLZA 3RBDA 3NL0A 4Y0FA 2L08A 2DR5A 5GAGU 1HWUA 3PTWA 2H48B 4DN0A 3DRSB 2BANA 3LW5C 3BGRB 4ZLJA 1VQ5S 1NDPA 2V8GA 2H5EA 3NEKA 2A2DA 4X62J 3TOQA 1KLNA 6FD1A 2MKJA 3PKMA 5BJRA 2ADBA 2P6SA 4DEZA 2OEMA 1S9EB 2NYIA 2DY1A 3HHLC 2KVQE 4JI4F 1OY6A 3PJ9A 4WE1B 4OJ3A 1GQEA 2UP1A 2D7SA 5K20B 5B0AA 5M2RA 3J7AN 2PT0A 1VI7A 3NCPA 2AYBA 3CDEA 1P9QC 1KNZA 3HHEA 4HYKA 5K8PA 1SPBP 3CWJA 3DC2A 4DHVA 5BXIA 2QA4S 2M2BA 4X64J 1SKSA 1SQGA 5CA5A 3BO3A 3U02A 2Y1LB 4C97A 3HT0A 3Q2SC 1ZYQA 3M30B 4MFBA 1JXLA 1VQKS 1RABB 3PVXA 2EBGA 1E6VB 2IJFA 4LQ9A 2MQ8A 2V5HG 4RNHA 3Q89A 4Z7YA 5LOQA 2P8IA 2W9CB 2AD9A 4DUZF 1C2PA 4AL5A 2LKZA 4PKDB 2AKWB 2DHAA 1R0CB 4ITSA 4X62F 2YNFB 1KFSA 2O1PA 3M2UB 4JI6J 3UVJB 4B9TA 1UJ5A 1HD0A 1WDTA 2MQPA 3V4IB 4KR0B 2J7KA 3NWRA 4AFFA 3M8SA 2OUGA 2M8HA 4OYPA 1TVRA 4ZJQA 1S1TA 2JSXA 3TUPA 1S6QB 3CCWA 2AJQA 4PXDA 2CADA 1FF2A 1RT5A 1TAUA 2W4CA 2GO9A 1R43A 2ALZA 2IM1A 3G6ES 4B9LA 1T9TA 3FMBA 1MLAA 3POTA 4A4JA 5I3QA 4OJHA 1PJ6A 5F8MA 4QWEA 2V2QA 2V4JA 2JLEA 1SXLA 3UD4P 4OZ3A 4XAKA 1Q82T 2C42A 1WC1A 2W2OP 2C2EA 2DY9A 1RAEB 3CF5Q 4ERDA 3CDWA 1KP6A 4DPOA 5EGYA 5LSLA 3OUYB 2B4VA 3RBEA 2YQ3A 3GG1A 5A6WA 4C0OC 1TK8A 3QO9B 3VGSA 1ZA1B 3PYDA 3R6LB 2HFSA 5K14B 3CJ5A 4PRFA 5L1KA 1Q8LA 1H2VZ 4LJMA 2E29A 2OD6A 2OP5A 4H4KC 1X0PA 4USVA 1HKAA 3O44A 2G0CA 3BSNA 3BGFA 5D77A 3G4SS 2QGFB 1RJJA 2I8EA 1U02A 3I4HX 1YVFA 3MMJA 2EXUA 4Y6IA 4YQWA 1U1RA 1FKAF 3KJFB 2G2ZA 1I94J 2LDYA 3K7RA 1RT2A 4TLQA 3C6TB 4JI1F 2CWKA 2MHEA 4WXWA 1S1VA 3WC2A 3DCAA 4DV6J 3MM8A 5ETRA 3HM9A 2HQIA 4U9RA 4K4WA 2UUAF 3S7RA 3MM7A 1PC4A 1DQ9A 2OGUA 1EX8A 2NPIA 3HP6A 4FPRA 2SXLA 3BDEA 3CD0A 4RUHA 1VIXA 3WQPA 1ZH5A 2LFVA 2LQ5A 4NLDA 5CD4A 2LEAA 4Q2LA 1SC1B 4WXOA 3OUYA 4FYDA 1Q8KA 2A3JA 1ZM9A 1FWLA 4RPFA 4DDFA 1EKSA 2N3OA 3MDFA 1N34J 1UWBA 3IMQJ 4M63A 4DCPB 5A2QU 2IC3B 5IQ6A 2OPPB 1T11A 2UV8A 3GFHA 4HH0A 1X60A 1CC8A 3BO4A 4F4YA 4ELVA 3K5NA 1QVGR 4QYZK 1RCXB 3N5BA 2V9WA 2OSRA 2I2YA 1WKKA 1FJGF 3GR0A 1EP4A 5B7WA 2CIMA 1RGVA 1G7CB 3ETOA 3G2XA 5KFLA 3L7OA 4CP5A 5B0BA 2Q6BA 2XGQA 3KXDA 2ZWOA 1S6QA 1R0AB 4B3MF 1KC8T 1VBKA 4N5SA 3GIJA 4LF7J 5I42B 3BSCA 3J7YI 3V4IA 3M8PB 1C1CB 4HLBA 5E3QA 1F9HA 2MZJA 4ZMMA 5HJXA 3K5LA 3HO1A 3DXBA 4OI4A 4E0DA 1IQZA 4ER8A 2ILYA 2CPDA 3NGKA 4IH7A 4OI1A 5LXRA 5KT2A 3T1YJ 3A8KA 3UR3C 4E98A 1JLCA 1E6VA 2QLJB 3CCVS 3AY0A 4K4SA 2B9WA 1FXRA 1JQGA 1VR6A 2RU9A 3S01A 1T9VA 3AJDA 2AEFA 1C0UA 4FKXA 5CZXA 4N56A 5ETQA 1N36F 3MM6B 1RK8A 2HHQA 2HWIA 4DUTA 3BSAA 4DI6A 3QZ7A 1NSPA 3CXCR 1YJWS 3V6KA 4WKYA 1RBOB 2O5DA 2W25A 3PHEA 1F5AA 3W9HA 1HFEL 5KFBA 2XS5A 4WZQA 3OVSA 3H42A 5D15A 3N01A 1U25A 2YWWA 1YSJA 4JI5F 2V2VA 3IS9A 2NUHA 4CCHA 2HHSA 2CQPA 4YB5A 4K0KF 3E2EA 1CJTA 2BBEA 4DR1J 1YTYA 3OFHA 4LF9J 2IM3A 3HPOA 3VAMA 3QO9A 5A2QY 4MK7A 4UQGA 3W2WB 1CJVA 4WCEQ 1YITS 2UXCJ 1AT1B 2L3MA 4ZVTB 1RXOB 4ZVRB 4URGA 4IDKB 4GO5X 3T1HF 4WIIA 4BDPA 3DLGB 1UAWA 2XI3A 1IQTA 1LW2B 2Z57B 3L9ZA 3N28A 2VQFF 3IP0A 3QJPA 2V4JB 1TL7A 4I6WA 5LT5A 3NNCA 2APOA 2HW3A 3FCWA 2RQCA 2DNZA 1HR0J 1VRTB 3Q0AA 1HBNB 3KK3B 1YDLA 2L48A 1FK9B 1VC5A 4KE5A 2WB4A 3CB4A 3MCMA 4XDCA 4ED4A 2XO6A 2PGCA 1TL1A 3BSOA 1GX5A 2EBEA 4CLYA 1S5ZA 2BJ3A 2E5IA 1U6BA 1FXLA 1FRHA 2A1BA 4ZPVR 5IS2A 4LBIA 2HNYA 2KXFA 2CQ1A 5D0RA 4U67Q 1VK8A 1ZM2A 2KG0A 4M94A 2YNFA 2ZC3A 4N8OA 4ZLLA 3TEGA 4LF9F 5KT7A 2JEJA 2E1AA 2VBZA 3DRRB 5U47A 2L9NA 1SJFA 1L3VA 3DMJB 3OD2A 2HZVA 3MAHA 3MMAA 1IUJA 3BO2A 2EG1A 1VLOA 2FLOA 4PG4A 2XMAA 2W9CA 1QM9A 2DXEA 4AT1B 1XWLA 2WTFA 4KFBB 1XC9A 1HNZJ 1RHQB 2QX0A 3M30A 4MFBB 2ZH4A 5RUBA 4C0HA 2MHNA 1ZAVA 1JLFA 4KO0A 1S49A 4ZN3A 1KDNA 4RZRA 3EPIA 3GTYX 3TA2A 3U1MA 2PMHA 5LMUF 2FGCA 3J7A1 1REGX 4WFZA 5DQHA 4MK9A 4P2XA 3HKZD 2B8PA 1TKXA 3HZEA 1HR0F 3AOBA 2OD4A 3OTEA 3A13A 4DV3J 2QMXA 3M6UA 1HPZA 4CH0S 3MR5A 3OFGA 4JI8F 4JI7F 1Y00A 2J6TA 5ITHA 4N41A 1IKVA 1MMLA 1Y3JA 1AZSA 3B54A 3ENWA 4PYDA 2ADCA 3R5AA 4UOCA 3UD5A 1T94A 2F3JA 1VFJA 3DDKA 4M5DA 2X1BA 1KEKA 5AE3A 3L09A 3CJKB 3CCES 1P8GA 2IPOB 2BE2B 3QJJA 2Y1JA 3FQKA 3CD6S 4DX8H 5HMXA 2DNKA 3GU0A 2W9AA 2Y9HA 4KGMA 4IRDA 4QW9A 1N32F 2VH7A 4K4YA 5D78A 4ZVUB 3MR3A 3K5OA 3ZTQA 4ECRA 1R89A 3J81j 2GMHA 2GHVC 2YKOA 1SCJB 3BPSP 4X4UA 1W26A 1LWFB 1JXEA 1NSKL 1TP7A 1Q95G 2MEWA 5J2MA 2CZVC 2WAQD 3NOCA 1ZZNA 2LXFA 2C3PA 2Y3YA 3ZXWA 4I68A 4BBYA 3NP5A 3HXMA 4WP8A 1ACMB 2YPZA 3QGPA 3HHKA 5CYQB 4P9SA 4RNNA 3TQ1A 5DGAA 3GE9A 2LMIA 1JJ4A 2WK4A 2PA8D 4ZITA 5J1NA 3QAUA 4C2MA 2AJ2A 4U95A 3BQ2A 2WHOA 3G96A 1FJEB 3QYYA 1H98A 1RQ0A 2GVDB 5D0GA 4CLPA 2P9EA 1XMOJ 1NDLA 4AYBD 3CJRA 3DXSX 3KK2A 4EBDA 4LFCF 5AXLA 1JK9B 1YRXA 3HVTA 1WG1A 3MOZA 4ZHRB 1TL3A 1RBLA 1VJWA 2IRYA 2VV5A 2Z8QA 5C24A 4CT9A 5HVHA 4DV2J 3VVTA 4CI0B 5A76A 2ASLA 3ZC4A 1S1XB 3D6FB 2CZ9A 2QC3A 3ZZYA 1SQEA 2HNYB 1NXIA 1B99A 2JJ4D 1M5VC 4EK2A 1D1UA 4ICLA 4ZP8A 1NKEA 3EGZA 2D9OA 3HFKA 5E2QA 2D9PA 4C11A 4OYXA 3TAQA 2EK6A 2D3ZA 4YEAA 3IWXA 4ID8A 1WACA 2X7IA 4OI6A 3SQGB 3MXHP 2WW4A 2WONA 4CLTA 5DM6Q 4C8KA 1HNXJ 1LXJA 3DOLA 5KFQA 1IBKJ 3MMCB 2O66A 3S1TA 4DV4J 2R3VA 1ZZFA 2IIHA 2NLWA 5BYRA 4LIWA 2R7WA 4ZCLA 4NCAA 4X65J 5FD1A 1SC3B 3Q8RB 3MPUB 4NLSA 1ZM3A 3MPWA 1ELOA 2V4QA 1FD8A 4DUYF 2R9LA 2FY8A 1HIYA 4K2JA 3PEHA 2WOMB 2B6AA 1UPPA 3UWTA 1RTIB 4M8LA 3W2WA 3V81A 3CCLS 5KG0A 1RWWB 2POKA 3NS7B 3KWMA 4IFYB 5ETSA 4ZVEA 2W7PA 4DV6F 2AJFE 3IAM9 4QWBA 2G13A 2IM0A 1H73A 4I69A 4ZN1A 1D8YA 4HHHA 1YJNS 1WELA 1IBCB 2IVMA 3KG0A 4DU7A 1VQOS 1RT3B 2YWHA 2B4PA 3OBIA 3PHTA 4KSEB 2YX1A 4KFBA 1Q53A 5DDRC 4FS2A 2YH1A 5E3CA 1TKDA 1M1KT 3D5MA 2JC1A 2XMUA 1I6JA 3GIIA 3AQPA 3ILLA 3MMAB 5IQQA 3ET6A 1RU2A 4BCAA 4O44B 3PX4A 3EVOA 3GFYA 1HHTP 2IA6A 4EYIB 3QIDA 5BYQA 3W5XA 2UV8G 2RU3A 3QIPA 4F04B 2CVEA 4Q8FA 1WC4A 3EXCX 1RWNB 3HD1A 3PDNA 2JOQA 5IFMA 1ZM4A 2AU0A 4DUYJ 2BKPA 1CVJA 5F8JA 4NE9C 4PQAA 2B3TB 4WFXA 4X65F 4C8LA 4NLRA 5D4PA 1DQAA 5KFFA 3OHBA 3PXGa 1SKWA 1HARA 1FK9A 1WKLA 3OL6A 4DV4F 5AT1B 1QTMA 3JS9A 3R7SB 5E41A 5KFSA 3K59A 1NM2A 1JJCB 3PW5A 1FVSA 4KGZB 3MEEB 2QRRA 3NLCA 2J0QD 1LW2A 1MG7A 2HBYB 2KL8A 3MM9A 5GMKa 2GQ2A 3UDVA 1P1TA 3KG1A 5IM0A 2MY7A 2HPUA 4CYUB 2ZBRA 2VG7B 4IDKA 1CS4A 4X4TA 4AL6A 4ZS6A 2GMLA 5J2NA 1YJUA 3E01A 1HBUB 2ZH7A 4NZ0A 7AT1B 5IXUA 2Q66A 1QSSA 1SQFA 1YZ6A 3IG1A 3B78A 1VJQA 4MYUA 3TAPA 2UXDJ 1RWKB 4DR2F 1ZTTA 1B0PA 3VALA 3OPKA 1LW0A 2YY3A 4A8MP 5H9EJ 1SL1A 4FBTA 3WBZA 1SH2A 2VFRA 3IS9B 3FJ2A 2E1RA 4K4VA 1YRUA 1VQ9S 4DUZJ 4DR3J 2ZBCA 1KLMA 3HSZA 1F5CA 2X1AA 3TJ8A 2VOPA 4JI8J 2HIQA 1RTHA 4O4GB 4NMLA 2HZAA 1RAFB 1CQMA 2J9DA 1NB2A 3DM2A 3PJWA 3RR8A 1RAOA 3NMRA 1KRPA 3G6VA 3EDRB 5LSRA 3M9NB 1XTZA 3J81U 1MU2A 1JJ2R 5CHCB 5D4NA 3F44A 1DURA 4ZJLA 2MZTA 1WOSA 5KFTA 3SYZA 2KB2A 2Y1IA 2ASJA 3PX0A 2RRNA 1OPZA 2FJEB 2RE1A 3A8IA 1QAIA 3DRRA 1T9WA 2CQDA 3SCJE 4F4KA 2EKNA 3JYTB 4QR2A 1R8AA 3DLEB 4ED8A 3FKBA 3EICA 1IVZA 3HSJA 1JKHA 3K58A 3OR1B 3OXFA 1UFWA 3A3PB 1KKHA 1O8BA 1T9YA 1Y5IB 4C48A 4TU9A 4Y00A 3OTOJ 1BQMB 4ZIVA 4DQIA 1V3RA 3ZFVA 2JVRA 3HVRA 1UVJA 2R7QA 2VG5A 3ISZA 4JI1J 2V34A 4QBUA 2KKHA 3QAEA 1VRTA 3G82A 1VBXA 1VQ6S 4CYUA 3H2UB 1VQSA 1VGYA 5HJYA 3VGTA 3JAMY 3W64A 2HLTA 2HMIB 3MECB 4MIWA 1NUEA 3QJLA 5J2QA 2YNHB 3W9JA 2H65B 1RADB 2IC3A 1ZPWX 1NHVA 2ZZNA 4YY3F 4O3PA 4CM0A 3D0GE 4G1IA 3ZNJ1 3PO5A 1TQLA 1RT4B 4FS1A 2WBMA 3DNCA 1N0VC 3P5TL 4ECYA 2RDJA 4RW9A 1V5VA 2HURA 3FBBA 4OLOA 2BYCA 1LWXA 4F4ZA 4MKAA 4DQSA 1WC0A 3GCXP 3SV4A 4DL0C 4Y34A 3CCUS 3T3FA 2V68A 3H4BA 2NXCA 3D3BJ 1Q4RA 4P72A 1R0BG 3D67A 3MM8B 4PXEA 1VHIA 4QWDA 2G0IA 3PNIA 4OZNA 3QATA 3CJ3A 2VFVA 4J5OA 4N76A 2I5JA 2DRBA 2RVJA 5IZHA 4B3RF 5H9FK 1FE0A 3MR2A 1JLAA 1YWXA 2FPHX 1HA1A 2VFTA 3D6TB 1FTRA 1APSA 3PM9A 4U7CA 1C0UB 1HWLA 3MAQA 1IBMF 1G3OA 3Q83A 3SSSA 4PQUB 1PBUA 2MDAA 4M1KA 2CDQA 2HEKA 2NQPA 1SVDA 4DR7J 2BV3A 1OY8A 1WOPA 4RW7A 1ZS6A 5K14A 1Q5YA 5HVFA 3ZZUA 3TUJC 4DPXA 2JH3A 1KLMB 3EZ5A 3BKFA 3KTQA 4PWDA 3KK1B 2HHUA 1TUGB 1X4AA 2EVZA 4NLQA 1M5KC 3CMES 2AYEA 1KQFB 3L7PA 4I1TA 3JSBA 4WYWA 2F7VA 3SFGA 2YNHA 1A6LA 2IJRA 3DLBA 3MM5A 4WZMA 3MMCA 3PEJA 2ZH5A 2YWFA 2LA6A 2HMIA 3W3SA 1FJCA 3M8ZA 1UKUA 2DCLA 4NLOA 4WJBA 4CO5A 5A6PA 3ENVA 5KFWA 1KWMA 1N5SA 3UPFA 1U1NA 3KLIA 3WX4A 3I9V9 2KZZA 1EARA 3THPA 2IBKA 2EFNA 4KHPF 4MKVA 1RHRB 4A48A 4F0HA 2DO0A 3U1LA 3RUBL 5DJBA 3K57A 5B09A 4LRBA 4ECUA 5C2CA 3GLJA 4G6VB 3P96A 3GIKA 1PILA 3A8JA 4CLUA 4FN5A 4WWSA 1PYTA 2V2KA 4IQMA 4RW6A 5HO4A 3JYTA 3KLGA 2P9CA 1CBKA 2M88A 2HS3A 2DNLA 3IR5B 4FYYB 5CABA 3IR6B 4J9UE 4WPAA 2JLGA 4IOCQ 2A6OA 2AGQA 1VQLS 2MKCA 1NLKL 2XYPB 4N7TA 4LR7A 1C1BB 1VCTA 2Y8WA 2BKOA 1YBUA 1Z2LA 4DSJA 5B0GA 2MJNA 1FX4A 2BW2A 2FD2A 2HBRB 3M8YA 4F02A 2I38A 2PD1A 4YN3B 4BLGA 1Y0HA 2UU9F 2HGNA 1OJ4A 4F4AA 4LF8J 3MZIA 2GQQA 1YRTA 2CNKB 4LBHA 2R8JA 3PFOA 4TLRA 1URRA 3MR6A 2UXDF 3QT6A 3HHLB 2H3EB 2OPRB 1OQ6A 3CD5A 4S0MA 2RQMA 1YJ9S 1S9EA 2OPSB 4YMEA 1NRKA 2R7XA 2V50A 5HVGA 4G1PA 2XMVA 1RB0A 3KJVB 2M7SA 1N5TA 4UY8T 1R8PA 2C2ZB 4OJGA 3T6BA 2DGXA 1WORA 2JNJA 2CAJA 3EE3A 1KONA 4WP3A 3PV8A 3R8YA 2WBRA 3LTOA 4Y2MA 2OMOA 3B4DA 4L75A 1F6TA 2MLZA 4USKA 2RRAA 1QE1A 2HQFA 3MM9B 3LP1A 4UUXA 4WK3A 2J8AA 1GNKA 2WRMA 5L8RC 2XY7A 3BH6B 2IHR1 3POTB 2FVRA 2PEBA 4KHRA 2E9TA 1GFWB 2IDEA 2B9XA 4DX5A 5B0FA 4KH0B 1M0SA 3CO9A 4PUOA 2R7TA 3CMAS 5B0CA 4QW8A 4J91A 1T02A 3CIZA 4ICLB 1KFDA 2RRBA 1WOOA 2HQCA 1RWUA 1Q16B 2YKMA 4TXSA 4ZVQB 2DNOA 2IRXA 1MN9A 1UFLA 3LH2S 5J1EB 5D3GA 3O2IA 2QLFB 3FRZA 1N33J 4GMKA 4J9KA 1Q8BA 2DGVA 4NCGA 2VQEF 3Q2TC 2OTLS 2Y0SD 3OXLA 1KHWA 2G9OA 1GK8A 3BBCA 3CJTA 1SBRA 4ELTA 3DMJA 5DDQC 4IRCA 3QFWA 1S59A 3NRBA 2O67A 1IBMJ 1RT3A 1J5EF 1R27B 4JI3J 4OZ0A 2BZ2A 2RHSB 2DISA 1H7WA 1UEVA 4HACA 4TY8B 5L39A 1J5EJ 4IQXA 3KNAA 4C9DA 1VLYA 2WVCA 3MHYA 4QR1A 4NLUA 3OFFA 4KT0C 4CNZA 3RB0A 2DR7A 2DNMA 2GZOA 5HQLA 2K1RA 3HI9A 2YWGA 1R3NA 3R6GB 4ED1A 2R7SA 1HBOA 3Q86A 5L46A 3ULHA 4CT8A 4B08A 3LALA 4LFAF 1IM4A 1REVB 1YJ7A 2BXJA 4TNOA 2D1CA 1FT8A 1PAUB 2YWEA 2E5LF 4P7TA 2NR0A 1FRXA 2ZH8A 4B9SA 4ZLNA 2JVOA 2GAGC 2W2MP 4F8RA 2FVQA 4NA1A 1QAXA 3NGUA 4I56A 1HQEB 3VR1A 1V3SA 5THWA 2BE2A 1S9GB 1TKTB 4M5HA 2M5YA 2WVDA 1W7WA 5A8KB 5HANA 8RUCA 2WZ1A 3FC9A 3VQTA 1QTNB 1RWOB 2FYXA 3Q8SB 3TAMA 1FDAA 1VHFA 5ETTA 1V5IB 3QRQA 2D3UA 2DGQA 2F1FA 2B56A 4ED0A 3UCZP 4O3OA 4DPWA 2OI2A 2EFPA 3GMGA 1UA0A 2X3DA 3C6UA 4KQZA 5GADU 4UY85 3A8EA 2PMWA 1BQNA 1RT6A 3L95X 1HD1A 1OQ3A 1TELA 1HNVA 2YWKA 4ZPBA 1M1GA 3MMBA 3RW7A 4OYAA 1NK8A 3IWNC 1CPZA 4YP3A 3KLFB 2DNRA 2BUNA 3D68A 4NLPA 3RB3A 3QWPA 2ZNZA 2ZE2B 4RW4B 3LP2B 4I0WA 2XLJA 1NNDA 2J0WA 2IAJA 2AZ1A 2XYHB 3KUEA 4TY8A 4W4MA 4ECXA 3M6XA 3FDSA 4OV6A 1TZ0A 1NK7A 1WEZA 1X4HA 3NAHA 4JI7J 3TA1A 3RRHA 1HI8A 1S7IA 3I96A 1U1MA 2CQ4A 2AEMA 3DDNA 4H4KA 1GMUA 2DGTA 2QJ3A 2W2PP 4TVAB 4F3MA 1X4EA 1VS3A 3R5DA 4ALZA 4NCGB 3KLGB 2R2TA 5IT9Y 5C25B 1BGXT 5J2MB 3QRRA 1X4CA 3LP0B 5KFIA 1DTQA 3ZZRA 1XK8A 1RLDA 3M8PA 4ECZA 1NJYA 3PYFA 3GONA 4FF2A 2ZH2A 4C8ZA 3GJRB 3ENQA 2B0GA 3W9IA 1MNEA 2HFUA 4YUDA 2MQQA 4ECWA 3O8WA 4A46A 1N88A 1HBNA 4L76A 1F2GA 4LF4J 1HNWF 4IOBA 4QU6A 1H6KX 4HR2A 4KB7A 1ZETA 1X4DA 1QE1B 4FP9A 1BY9A 1DAXA 1SI9A 1LK5A 5E33A 4IR1A 2DH9A 1U1OA 1RSCA 2F65A 1U8WA 3HLUA 3RZAA 1B70B 4DL7A 4B3OB 3W66A 2KVIA 2ZM6J 1RTJB 5IV4A 1GAOA 1SC4B 5KFNA 1RA7A 3T5LA 2PSZA 2B4UA 4ZCIA 1PBAA 5IOLA 2HS0A 2NSBA 1HQUB 2WVFA 3MGJA 3OR2B 2G0JA 2KG1A 2C22A 1KQSR 5KG5A 4LUBA 4B3TF 3HHLA 1X9WA 2VU5A 2VICA 5GADI 5B0DA 1NPPA 1YKWA 2QIFA 1S1VB 1ZAXA 3P5BP 5KFKA 3SIPB 2ZZMA 4DZ6A 3CTRA 4JV1A 3WC0A 1F2HA 2R2RA 3RBZA 4E2FB 3K89A 4EEYA 3LWLA 2C2MB 2YBVA 4ZVPB 1R8BA 2M52A 5JXSA 2WB1D 4USIA 1FESA 1D3WA 3VZHA 2H5JB 5DDPC 4UZBA 2KZMA 4YR3A 5HAOA 3IAS9 4R8UB 2R8HA 5M2UA 2V9KA 4BHQA 5L38A 2XCPA 4DFJA 2ZH1A 2LP4A 2IM2A 4I2QA 4ECQA 3IRWP 2ZM6F 5CCMA 4RW9B 2KT3A 1HNXF 4I2PA 5H9FJ 3R7BB 4HI2A 1NMEB 2RF2A 5F0UA 1CEZA 3FFIA 1RBAA 2CXEA 4DSKA 5D0HA 3QGGA 4QIFA 1S6PB 2ATCB 4MMOA 4ID5A 5C2GA 4DMZA 1NJXA 2OH2A 3TZXA 2PA3A 1LEOA 2VKRA 3MUTP 1EQ0A 3BM7A 1H38A 4KPCA 2ZVSA 2MZRA 2VC1A 1Q5VA 3MWBA 4ZDNA 3PW0A 1VMBA 2DJWA 2HQDA 3D0IE 2X3GA 3DOKB 2RS8A 4IYQA 5MAOA 5IWAJ 1S0MA 4GO7X 4NASA 1LFWA 2OPQA 3TJAA 1FNXH 2WW8A 4WK1A 5E0OA 2HIYA 1WTBA 4OHVA 3SBMA 3H5YA 1AB8A 1KVJA 2PFFB 2CQ2A 5DM7Q 1BC6A 1PIEA 2XZWA 3IFEA 1SKRA 3ITHA 1UWBB 1X4GA 3CSKA 2R8IA 3AOCA 4OYWA 3AHPA 3UD3P 4O3NA 2AV5A 3FSXA 1F9FA 4WTYA 4A8SA 4M5KA 2JFKA 1N6QB 2DR6A 3W5ZA 4DR6F 2QSWA 3ZO7A 2RUGA 1FNMA 1UL3A 1YLXA 2C28A 2XWYA 3EJMA 3H59A 2J0SD 2P9GA 1VQNS 4LF6F 1SIZA 2DIUA 2QSFA 1I5OB 3MM6A 3TR5A 4UTGA 1TTHB 3BQ0A 4ZLPA 2VBYA 1GTHA 4YHHF 5B0EA 2BW7A 4JI0J 5FDLA 1RT2B 4MIAA 3DU5A 3CJ8A 3LQVA 4OI0A 5KOXA 2EC0A 3LA0A 1SV5A 4LRCA 3VHQA 3IM9A 4ED6A 1IXKA 2DB1A 1NK0A 4IO1A 1FHTA 2FUG9 4JOUA 3KUHA 1NKCA 4TY9A 1OYDA 3AFGA 2XS7A 1PKUA 1LW0B 3C16A 2XGPA 1UEUA 5KFZA 2GVZA 4N8NA 3R97A 2DYAA 2R8KA 3BGRA 1T05A 1NK4A 2NUUG 3GJTB 4MKYA 1J27A 2ASYA 2V94A 2NS1B 2B9YA 5KG4A 3PYEA 4GKKJ 3W2VB 5CYMB 2OPQB 4C3MA 3SCLE 2DHSA 4OZ5A 1Q7YT 2GHWA 1WWHA 1WUUA 3PZPA 3MF5A 3L3CA 2B4OA 2VJVA 5H9EK 2KDOA 1N8RT 1XNRJ 2W2NP 3BREA 1Y9OA 2GS8A 3JSYA 4LSLB 3EXYA 5LM7E 4LFBF 3JTPA 3LGMA 4CQ1A 4DV7F 3M4XA 4KV8B 1BLUA 5CYMA 4RUAA 2VZ9A 1JLBB 2ZD1B 1RT5B 2XI2A 1NH8A 2E5HA 2DHHA 1OMSA 3RBXA 2YKPA 3T19A 2XCAA 1T05B 3W60A 4HDGA 2AT1B 1TVRB 5LJ3Y 4DN9A 2HHHF 4QIVA 1JJHA 2Z4PA 3C16B 2RJZA 1KQKA 1S79A 2OFGX 2QA1A 1RT1B 3D6MB 4FXWA 4LREA 1KOHA 1NZAA 4UZCA 5ETPA 3BPDA 3U27A 3UVJA 3CJ0A 3LP0A 3RAMA 2XO7A 5EX0A 3DKDA 1WC3A 2LLZA 2WVEA 3CNQP 3NGSA 1UZHA 4HT5A 4C8NA 2YXLA 4Q0BA 5T7LB 2ALYB 1UVMA 1VQ8S 2HFOA 3H5SA 1IKYB 1W25A 2U1AA 2V8PA 3M8QB 3IA0A 2XMMA 3LGHA 1DQ8A 3I82A 3O6QA 2CVIA 5FDLB 3GZ7A 1J5OA 3MR7A 1GXTA 2YNGB 3FGVA 2CNLB 5C5JA 2R7UA 3GPAA 3TO8A 4G3IA 3EM1A 4JI6F 2Y0BB 5GAEI 5F8LA 1JLEA 2JWNA 3FSYA 5AJ3F 2LU2A 1S77D 4DQQA 1PCAA 2FHMA 2KT5A 1RT6B 2ZUGA 3HF5A 4MH8A 2B6AB 4X4QA 3Q8PB 3SI8A 2VKZG 3C6UB 1RTJA 3V2UC 2B5JB 3RAQA 1TU0B 1B7YB 1HLWA 1H2UX 4N77A 2DRAA 3LWMA 1R7IA 3VAHA 2IY5B 3FBCA 5G4DA 3I4PA 3G86A 4CLFA 2BABA 5HP1B 3IG1B 4USJC 2CJAA 4NLWA 1OPIA 2FVPA 2GA7A 3PG9A 4QCLA 2CPXA 3IBCB 3DGVA 1FNOA 1NAQA 3W7BA 2QT7A 3E01B 3AH6A 4NPOA 3MCNA 1FXDA 2R4FA 1B7FA 4ZVGA 3VAKA 4W98A 4XK8C 3V4MA 1KQGB 1QDUB 4WYLA 1FVQA 1RAAB 3QFHA 2LEBA 3FQLA 3M2RB 4YB7A 1U45A 2FLLA 4JV5J 1FWPA 4DR2J 1S6PA 1NCLA 4HHJA 3B6BA 3OVAA 5AXKA 3IGNA 4H4OB 2E7WA 1RAGB 4L74A 3NKYA 3ELHA 2YQ1A 1M1HA 4J9LA 1MMDA 3CO0P 2MZSA 3ISNC 2DGUA 4L3KA 2A10A 1WG5A 3B82A 2EC2A 1N56A 1GMWA 3CDUA 1S48A 2I9SA 2Z58B 3UCGA 2V0NA 1BXNA 4ZIWA 1I3OB 2VASA 4AD6A 3TWZA 4XPEA 4DS5A 3C14A 5AJ3J 5HN0A 3ENAA 1FERA 4DS4A 2OELA 3ZTOA 4AXIA 3OL9A 4DZDA 2Z2LA 3MEGA 3OHAA 4B9VA 3VAGA 3CCRS 1L3SA 3KJNB 2ZUAA 3E3XA 4CLWA 1RAIB 5C42B 1OIAA 4Y2KA 3KFWX 1IKXA 5DDOC 1LKZA 4WE1A 4PPDA 5FIIA 3F73A 2RS2A 1HHSA 3CUNA 4LRFA 2W9BA 1I1GA 1U09A 4C6AA 4DF8A 3PACA 3EYZA 2FJXA 2QEXS 2CQ0A 2RQKA 3GWCA 4ZA1A 1VK3A 2HNZA 1NDCA 4A8XA 5J1PA 2PI5A 1SJ3P 5HMZA 2ZWPA 3GIRA 5F41A 2J76E 8ATCB 4PWWA 5DO2A 1Y10A 1WG4A 3AJ1A 3CJQA 4J7CA 1D09B 1LNQA 2WSCC 2FHOB 2HWTA 4K7QA 4FYVB 1CJUA 1FI4A 2AEJA 3QLHA 4JUZA 2W8KA 3DOLB 2D41A 2HFNA 3NMAA 3DDIA 3NNAA 4MT1A 1VQMS 1O5JA 1G2EA 3RB6A 1HNZF 3PKYA 2DNYA 2HSEB 1HBOB 3T5HA 3M32A 4PWUA 1GEHA 2AP6A 3CGIA 4F50A 3BZQA 5CCLA 4IR9A 1GTEA 2F40A 2FC9A 1X9MA 4JI3F 3ICLA 3V6DA 4FZVA 4URQU 2E5GA 1XR7A 2OPRA 1D9AA 3QQCD 4KGXB 3N6LA 1DTQB 2GIQA 4X66J 4DPYA 3JTOA 3UDEA 2RSQA 1RACB 2J5AA 3DU6A 4QIWD 5HSPA 1MWYA 1U1QA 4X4VA 3W62A 3HK2A 1JLGA 3X3UA 5D6GA 1U1PA 4R5PA 2MY8A 1XERA 1YG0A 2KYZA 4U6PA 4JV2A 1S1WB 1CC7A 1M5SA 3VZIA 2Z2MA 1PJ7A 1GXUA 2VG6A 4KIAA 4DL5A 3TVKA 3G8QA 1ULRA 2JFDA 5KG2A 4DR1F 5DG7A 1PO6A 4ZCKA 1HYSB 4RWWA 3E8OA 3BDPA 3LP2A 5D3GB 1HW9A 2LVWA 3B8HA 2D74B 2I1RA 4Q43A 2K06A 4Q5VA 4ECTA 5FJ4A 4B9MA 3JSRA 4JP8A 3ZZOA 3BBBA 2B9EA 3C15B 5IT4A 1JNRB 1Q78A 3JQMA 4K50A 3BGOP 3IXQA 4ZP9A 1P27B 1JLBA 2ZD1A 1U48A 4KH1B 1E6YB 2XEXA 1IR2A 3D0HE 3DOMA 4I4BA 3AOAA 5LMNF 1K73T 5F8NA 3QNWB 5HROB 4DR4F 3GP9A 3AQOA 2FTRA 3VTIA 4M5NA 2QMWA 1IM6A 4XPCA 2BQUA 1XNQF 4LVNP 4DU8A 3AA9A 5LJ5Y 4NLTA 2FJDB 4EWTA 4DR6J 1AFJA 2KXNB 3C2PA 2QYGA 4K4UA 1FKOB 2W7AA 2CG4A 3M9OB 2HYIB 3CJ4A 1WSVA 3MM5B 8AT1B 4NXNJ 1IKVB 2CQIA 4XO0A 1MWQA 1RKIA 3P3DA 3KLHB 2C2NA 3FMWA 3UN2A 4CLSA 1S4EA 4QR0A 5FLXU 1JLQB 2BJEA 3CDAA 1HPZB 1Z2ZA 2DNHA 2F8HA 2FHJD 2Z30B 4OHWA 4ANEA 3K2YA 5KOWA 2GC8A 4WBFA 3KK1A 3G8SA 4JI0F 4LQ3A 2AIRB 4DCJB 3S8SA 4ED2A 3PW7A 5ETMA 4ETXA 1R8CA 1K1SA 1UWAA 4NX9A 4RW7B 1RE1B 4ZCMA 4MTPA 1TFYA 1NH7A 2P5VA 2YNGA 3D2WA 2NXNA 3T5JA 2RQ4A 3PIPQ 2CJKA 3KLEB 2HHXA 2B43A 1B4SA 4OX7A 2OJ3A 2MLYA 3M8QA 1MROA 1T3OA 4HTJA 5I3UA 2GMJA 2PDAA 2YKNA 5KFEA 4F26A 1HHQA 5KT6A 2XHWA 2HRTA 4RW6B 5G0RB 4OYZA 1K0VA 1HNIA 2H4YB 2NXUA 3L4BC 1TV6A 4JV0A 4AUKA 2WSEC 1IWGA 3KKFA 4KHPJ 2R8GA 1FRIA 4KAIA 2ZH3A 5EWFA 4ZOSA 5T14A 3H8YA 4DSIA 4LSNB 3DRPB 2R2SA 2AYMA 3A1YG 4QIEA 1V9OA 2C3MA 3KLIB 4CO2A 4F0MA 5BYSA 5EDWA 3H40A 3CCSS 3RRGA 2ASDA 1YGYA 2HHPA 3UW1A 1I51B 3N6NA 4B3TJ 4USHA 3TA0A 3PW4A 2CNOB 3DLGA 4DR5F 2C3YA 2J6SA 5HL7Q 1YJTA 1T03A 2VQFJ 1DLOB 3R1LA 2MKSA 2GFFA 3BS9A 1NDKA 1ZAWA 2MTLA 3R5GA 4USWA 3TEHB 5GAHI 1BQMA 4USTA 5CD4H 4HL9A 2BQ3A 2FLNA 2W1BA 4E8UA 4OYBA 1U49A 2GVZB 4QJVA 4EO8A 4B9NA 2DNGA 3M6WA 2FQQB 3R3TA 2UUCF 3FK4A 1UCNA 1RWXB 2EW9A 2BM1A 2IMOA 2UUTA 2JZ5A 4RWXA 2ZH6A 4GRSA 4OX8A 1WHXA 2YKQA 2XMJA 2AGOA 1IKYA 2PMZD 3J80Y 3ADAC 2CG8A 1QY7A 3OTCA 5DZ6A 3D1HA 3BQ1A 1MU2B 2IYGA 3NY0A 3R5BA 4ILLA 3PR5B 4DSLA 2G1HA 2GCFA 3GYXB 4CDIA 1UP1A 2P2CB 4P73A 1RTDA 1HQUA 2MKIA 1ZOTA 1D9DA 4NEZA 3FCHA 2HVEA 3T1HJ 3DHXA 5KFAA 4JB8B 4RBVA 2KXHA 3I32A 2VODA 3IM8A 3JTNA 2XLKA 3U7JA 1CLFA 3Q8YA 2W4DA 3EVWA 2IMWP 4IH5A 3N0VA 1KN6A 4DSEA 4RLEA 4DR3F 3D28A 4UQTA 1FRLA 1K9MT 3T5KA 2AHOB 4LF6J 3CW2C 4ES2A 4Q8EA 4LVOP 3DLKA 4H4MB 2AYGA 2PFDA 1NPKA 3QGHA 3IBFB 2ZHAA 1W2BR 2VG7A 1FFWB 4DG1B 1XIQA 2HVDA 3W8PA 5HP1A 1S0OA 3AJ2A 2HRUA 4RBUA 2J0XA 2L9DA 1N0UA 3PCOB 1VRUA 4QQBA 4CO4A 1N5YA 3BN4A 2DBBA 2GGPB 3I5AA 2X51A 1IJFB 2MGZB 1VRQC 1Q0NA 4ID5B 4A8QA 4DFMA 1PYSB 3QT5A 1JKHB 3GILA 2N3LA 4A8OA 1UPMB 2GX8A 4OV1A 1NJZA 1FEHA 2I0XA 2Q79A 3E51A 3KUGA 5ETKA 2Z56B 1MW7A 2K2PA 3CJSA 1S12A 4NL5A 4NA3A 5LMNJ 4WFBQ 4OYIA 4ZPDA 3TI0A 2VL1A 3IBWA 1F3FA 3NBPB 4DPTA 1WNEA 1WTFA 5DETA 3BGUA 4F2RA 2Y1RI 4Y65A 2BDPA 4BC9A 1P6TA 4NEYA 3J80U 2CJYB 4N47A 4ELUA 4EFAC 3NOGA 3L7UA 1OY9A 2UZAA 4HHUA 1EHWA 3AB4B 1FJ7A 1TR0A 4QIGA 3DM2B 3FUYA 3BYRA 1DARA 4LT6A 3FZ2A 3C19A 1U26A 1ROFA 2K7JA 4X4OA 2DITA 2J9EA 1Y5NB 1WKJA 3MAAA 1VBYA 3HFZB 2BOAA 4LF5J 2ZDOA 4QU7A 2VA3A 2HZCA 1HWKA 2I6WA 3GR1A 2F4VJ 1JLQA 2XZTB 4OIXA 4PZVA 5E5NA 2W8LA 2LDIA 3ITHB 1VOMA 1UA1A 1RHJB 4ZPWR 2ZJQQ 2KJWA 4IFVA 2LQBA 3HX9A 3RRKA 4QWCA 2VPXB 1BUXA 2NPFA 1RTIA 3TAMB 5IWAF 3RTVA 4DQRA 2AGPA 2XZDB 2ZJPQ 3MTKA 1NK6A 1F60B 3CULA 4KJIA 1AUDA 2FLPA 3EGWB 3ILJA 1TKTA 4PG7A 1RA6A 3TX8A 2QLWA 4EO6A 5JUMA 5KG7A 4LBPA 1HL6A 1HQEA 2BRLA 3AD8C 2GIRA 4DFKA 1BD6A 1DRZA 1FKPA 3IC1A 3MECA 1S4FA 1NEEA 6AT1B 2COLA 2MQLA 2ROGA 4MK8A 4J9PA 2VA2A 2LQJA 4P2FA 2E44A 3D4JA 3MURP 5KG6A 4RR5A 3CE8A 3V6JA 2M4MA 2O01C 3A3OB 3KDOA 3DI6A 4NZ7A 5HI7A 2E7VA 2XMKA 3C15A 4BC7A 7FD1A 4PXBA 5B08A 2UVRA 3JQJA 1FRMA 2IBOA 4BS2A 1DFDA 2VQEJ 1GH8A 2CYYA 2ZBIA 2CJXB 2CPFA 1HBMA 3K8WA 2GQCA 1ZBTA 3KNGA 5AE1A 4AQYF 5KFHA 5DG9A 1XEZA 1TV6B 4NRUA 2LEPA 2UUWA 5L9NA 3B4MA 2BMBA 3JSMA 5KFPA 2YNIA 4Y2CA 2VG6B 2YX7A 4ZPCA 2DCUB 3LOUA 1UW4A 3ZTRA 4HVZA 2WSFC 4IG0B 2QA4G 1P1LA 2CQHA 4O3RA 3W61A 3QPIA 4C8YA 3AB2B 4NOHA 3V6HA 2YQ0A 1LWCA 3M05A 1A0OB 3FVYA 1DY3A 3R7NB 4B17A 4D3HA 3JAMU 4ED3A 5F3TA 3T9ZA 1N48A 4G1QB 4OX9J 2IYIA 4DR5J 2ZITA 3M1VA 5HK4A 2ACMA 1IKWB 1QUPA 2C2OB 2F4FA 2J7UA 3DRXA 3LAKA 3H5UA 4K59A 4F67A 3PY8A 5T41A 4CH1A 1Q8IA 4X4NA 1U0HB 2PEHA 5IT0A 4J9SA 3ZNUA 4Y28C 1XN9A 1B64A 1Y4ZB 5J2PA 2ATLA 1MSWD 2MJUA 5A0YA 2AJ0A 2EFQA 5KFDA 3IO1A 4OZJA 4I6YA 1FEEA 1TKZB 1XMQJ 2M3DA 1OS5A 1V3ZA 5A8WB 3TVYA 2HVIA 3DRSA 4JI5J 3A4TA 2LXUA 2A6MA 2VPWB 1FRJA 3AT1B 3TUZC 2BJ1A 1VQ4S 4LR8A 3G71S 1AA1B 2GV1A 4JYAF 4I6AA 3C8YA 4C3KA 4O23A 4BWMA 2YTCA 1PC5A 2QV6A 5EWGA 3NGDA 2HNZB 3C46A 3G9CA 1X7VA 3FEZA 3I5BA 2CJQA 2B7BB 1REVA 2G2OA 2OPSA 3CCZA 3PYGA 4FKYA 4NYZA 1HMVB 4ANDA 4C0BA 9ATCB 1KSPA 2J6UA 2D3OR 3LPEA 5CQGA 1Z4UA 4AXJA 1S97A 2DEIA 5KFYA 4NI2A 2KTQA 3MUVP 2QL9B 1TKXB 1IR0A 2J9CA 2K7KA 3NGRA 4I7FA 3HVTB 4D3GA 4ZHRA 4YHHJ 1IR1A 1L3TA 2FHKA 2JDJA 2XBPA 5HATA 1ZTWA 2PI4A 1HWIA 1TL5A 1IKWA 3N79A 4KO0B 5CYJA 5E3PA 5DLFA 1TK0A 2F8MA 2JX2A 1CSJA 2M8DB 5L1JA 4NXNF 2Z2YB 4OJ1A 3ET6B 4F4XA 1QD1A 2LXIA 4PWDB 4RW8A 4XDDA 2A2CA 3QMQA 4USMA 5CYQA 3VF0B 4CTAB 3K8VA 5HQ8A 1UEKA 2YNIB 2UXBF 4J9QA 3UNYA 1S1UA 2QO3A 1FCAA 5KFRA 3HCXA 2XHCA 3MEDB 1XR5A 3IWLA 1IJEB 1HMVA 3ZZ0A 2KFYA 2E1CA 2GIFA 2RMLA 3TRGA 4NXMF 3FEYB 4IH6A 2HAIA 4Y2AA 2RDDA 1GMVA 3AXMA 2OEJA 4CH7A 4X66F 3M8WA 3DGPA 1TAQA 1RCOB 1KBRA 3CDBA 2HS4A 1KHVA 4MKBA 3CJKA 3SCKE 2AF6A 3FSIA 4OL8A 2BACA 1TL7B 2R7OA 4CLKA 3LP1B 4P74A 1S6OA 5E7OB 5IC6B 1EKRA 1K1QA 3T9NA 2R7VA 1FX2A 2BE7D 2RDIA 5EX3A 2Q1LA 4LFBJ 1VC6A 4LSZB 5A0YB 2G1DA 2YX4A 1CJKB 2ZOGA 1L3UA 2RT3A 3EZOA 4RBTA 2K1RB 1HW8A 3BGLA 1NBEB 4OYOA 2MKKA 4ED7A 4YY3J 2A0FB 3KJVA 5EUHA 4LMZA 2QG9B 1LXNA 3Q24A 1RKJA 1RTZA 1X5PA 2IRUA 4OMFG 2BA9A 2V69A 1JLFB 4PG5A 2HLUA 4WKRA 1S1UB 2FJAB 1RZMA 1RHKB 1T9XA 1A7GE 4P2SA 4R0JA 1U2RA 2CUYA 5C42A 5HQMA 4HI1A 5EWEA 3Q8VA 4HKQA 3MAAB 1LWCB 2ZHOA 1AUSL 3KHGA 1N5YB 3KJQB 3Q23A 2HBQB 2DR9A 3R2DJ 1JLAB 2BM0A 2ZKUA 1UVLA 3NXZA 4IG0A 2GVDA 2K3IA 4EMDA 2KFZA 4KGVB 3DYAB 1UVKA 2VJUA 4LF8F 4NMXA 1RT7B 2BJ7A 3BN7A 2B8QA 4WTOB 3JSMB 4A8WA 4Q0BB 1C1BA 1NZ8A 2ACYA 4LF2A 1U2FA 4DV0J 5DLGA 4ZP7A 2FHJA 2JRSA 2XSFA 2RD5C 3OT9A 1YIJS 2HHHJ 2AX0A 1S76D 5CXTA 3UCUP 1X4BA 3JXOA 5F8GA 4DV7J 5KT5A 3GIMA 2H54B 3P8BB 3SCIE 4C3LA 3RGIA 1S9FA 1H7XA 2AJ4A 3HVAA 4ES3A 3OW2R 3D1QA 4KV8A 3SMZA 1S10A 2DVIA 3MCSA 4NLYA 3QBCA 4B02A 1T95A 1SH0A 4QPXA 1UVNA 4HDHA 3M2RA 3TZZA 1YJRA 1VRUB 4NLXA 1F3VA 4IO9Q 1WJ9A 4U96A 1RYSA 2N82B 2BE9B 1EP4B 1YZ7A 1XMBA 1X9SA 1N32J 3HSDA 2H1YA 2BOPA 3W2VA 1Y5LB 1VC0A 2W4PA 3K5MA 1SUQA 1RAJA 5L1IA 4OHZA 4M5DB 2FJWA 1NO8A 4RNFA 9RUBA 4B3SJ 1AFIA 4YS2A 1EETB 2HGLA 4U8YA 4RU9A 4EBEA 1AROP 1VISA 4CRJA 1K44A 4EGLA 2FB0A 2LECA 2B51A 1U47A 3W8GA 4C98A 5GAGI 4EBCA 4WP9A 4Q45A 1SKUB 4O0NA 3G6XA 2JEGA 2JHEA 1U0HA 1SV5B 1OSDA 1KTVA 3EVMA 2GW8A 2IA0A 1IBLF 2DPJA 4JI4J 1MMNA 1DHMA 4PUOB 1N52B 2DEJA 4NWBA 5CZVA 4OQJA 3EPGA 3D6HB 5KFVA 1NKBA 4LIRA 4DV5F 1JB0C 1Y7PA 1FDNA 2AX1A 3P4UB 3ZZTA 1X8DA 3AXKA 4CO0A 4TN2A 1NB7A 2H4WB 3NBPA 1B0TA 4RUBA 1O51A 5JVHQ 2UUAJ 4O4GA 2XSJA 2I5JB 2YKAA 4JBCA 4WFYA 5EHHA 3I5CA 1TMJA 1ZA2B 2H5IB 5KT4A 4ED5A 3GFXA 4TU8A 2XULA 1RI7A 4XIUA 2PN6A 3I0SA 1YBTA 5E3RA 4PQUA 3EUNA 4DFPA 2BR0A 4NZ6A 4NYOA 5I42A 3HHLD 3G6YA 1LQ9A 2MGZA 2IJNA 3EMTA 5KAKA 1N34F 3VCDA 3H25A 2GJ2A 1W2IA 4J9VA 5HBMA 1VYAA 1LV5A 2ZOFA 4U7UD 4W90B 2E5JA 2J8SA 3DRYA 2HKEA 3SZ2A 2FC8A 1T9UA 1GMWD 3VGUA 2E9ZA 1H2TZ 5L9XA 1PJ5A 5IM0B 5SZTA 3CCJS 2JEFA 2RH3A 3MEEA 2IVFB 4EI2A 1FDDA 3WHIA 4F4WA 2QL7B 2ZBPA 3RG6A 4KGKA 3J7YU 2YH0A 3OTDA 4GVBA 4OZ1A 4P71A 3I56S 1CJVB 2CPIA 2XWXA 1WF0A 2ZEJA 4LSNA 2RF2B 4R0EA 3TVZA 1XBWA 3HMJG 4TQSA 4EZ9A 4OZLA 1DTTA 4CO1A 1S1TB 2N7CA 2RAQA 3WX8A 3GV5B 4IFVB 2Q6CA 3GG0A 3THVA 1RDRA 3SQOP 2FZKB 2VDHA 2UXCF 4K4ZA 2JEIA 5DRKA 4DJBA 1WD6A 5IV3A 4OZ2A 3FBFA 1YHQS 3NG8A 3TQEA 4DF4A 1Y3KA 3I0SB 5KG1A 5DGBA 1NJIT 1O6XA 4HH1A 2KH9A 2PC6A 2GNKA 2VIHA 4DV1J 4WU2A 3C6TA 3CVKA 1FTCA 1U0SA 1BQXA 1Y11A 1FDBA 2MSTA 3OFEA 1WI8A 5CH7B 3W1YC 3G8TA 3G87A 3D9BA 3TARA 2C2KB 3CPWR 4LFCJ 4Q44A 3GSDA 1HI1A 3HJVA 1B0VA 3EDQB 2AWZA 1JLCB 1NK5A 3ZTSA 4OI2A 3K5PA 3OSNA 4DV2F 4LF4F 4DSFA 3AA8A 1DTTB 3V5RA 1LK7A 4EUVA 1BWVA 1N6QA 1HNWJ 1RT4A 2DNQA 4DL3A 2AJ1A 3VWSA 3BKUA 3CEDA 5KFMA 2ZJRQ 1K0TA 1P9YA 3GFZA 1QAJA 3RR7A 4LR9A 4ZPAA 3W5YA 4DV5J 3PRBA 4IUFA 2DRDA 2EKYA 3T1AA 2VPYB 2D3O1 5F0WA 2ZHBA 2CQBA 2EPIA 3O3LA 1QUVA 1EAYC 2XMWA 2E7XA 3D54A 4P75A 3RYLA 2UVWA 5LSOA 1CS4B 1VDHA 4O3QA 1SC6A 2VG5B 1K47A 3DLKB 4H4MA 3TNVA 5K8OA 3IN5A 2M70A 4MJKA 3DGPB 1TUWA 1M5OC 5HBMB 1J2VA 4DQPA 1RWVB 4M95A 1RP5A 2CFXA 2QMUB 5ETNA 3PX6A 2OPPA 3M7VA 1X31C 1ZPVA 4A8KA 4JV5F 3OR1A 2JLFA 2D69A 2UXBJ 3ISND 5F8HA 2K8GA 4TYBA 4WU3A 5ETOA 4BWJA 3VQSA 4DL2A 4KPYA 2LQ8A 3FFIB 2ROEA 4B3MJ 3DLEA 2NXEA 3US5A 1VQPS 3R1HA 3HFVA 4UW2A 1UJ6A 1WHVA 3SSQA 4V19J 4I2PB 1FFGB 1TL3B 1WHWA 5C24B 2FY1A 2XSJB 2YKNB 3MOJB 2FGOA 1ICEB 1NHKL 1U7LA 3LANA 3PRDA 1QLNA 5DZ7A 1H0HB 2DTJA 1RTDB 2F63A 1EJ7L 2DNPA 3QIPB 2OLWA 3I0RA 4Z7CA 3KLEA 4K5SA 4OLPA 1HYSA 2ROPA 4L3NA 2HHVA 3Q8UA 4Y2IA 5DQIA 4DOZA 1KOOA 2MQNA 5GMDA 4UUWA 3R27A 1WHYA 2V2ZA 4FF4A 2F9JA 2XYGB 4WFNQ 3EX7B 1U1LA 1RAHB 2OO4A 2VDIA 3MMBB 4L72B 4OX6A 3W63A 5JMNA 4O3SA 2HHTA 4P52A 3U1NA 4F7VA 5LMUJ 1X5OA 1FO1A 1XJWB 3GYNA 1CULA 4GVLA 4QZVB 4B3RJ 1AXQA 2EWHA 2ZKTA 1R8HA 2RKIA 1GX6A 3KLHA 1D9FA 5KT3A 3CCMS 5CAAA 3GCWP 4IFYA 1EETA 3O5TB 2HNDA 4OFZA 4PXCA 5K8MA 2XTJP 1U24A 3NAIA 4M5LA 3KHLA 4F36A 4ZVFA 2XLIA 2ZC4A 3NCQA 1SUQB 3RAXA 1HBUA 2F8EX 1I94F 2LU1A 3NS6A 2OHDA 7FDRA 3MFIA 1NHUA 2MB0B 1TL4A 2ZNYA 1FRKA 5ETVA 2LQ9A 2V8HA 2M0GB 2Q43A 1U4BA 4ILMA 1JXVA 5HLFB 3QRPA 4YB1P 2N4DA 3IRXB 4KC5A 4FYXB 2CZ4A 1N54B 1TKZA 2XNRA 4OX9F 2WONB 2XQCA 2HWHA 2QN6B 3VGVA 4IG3A 2VFUA 3CIMA 5KFXA 1OSCA 1U6ZA 5I4MA 5J2PB 1FWKA 1YQHA 3OL7A 3OJSA 1RYRA 3NNHA 2Y8YA 3UNGC 4K4TA 2QFJA 2W01A 2IFXA 2MQMA 2ABYA 2DIVA 4PPZA 5H1SV 2CA9A 3BF4A 2MPUA 4CIOA 2J9DE 1AYEA 2OMLA 3SSRA 1IN0A 3Q8QB 3P6YC 2MZQA 4G1QA 1HNIB 3UI3A 1RT7A 2R2UA 1KS2A 3RJMB 2MSSA 2OSQA 3DYAA 4G65A 4KKOB 5SUHA 4X4RA 4NA2A 3MPDA 2OKQA 4K2XA 1WF1A 2V6AA 4H54A 1S72S 4ZK7M 3KK2B 3DLHA 4NCBA 3I31A 1QJHA 2GAHC 3EGNA 2XNQA 4K5RA 2ILZA 2DPIA 3ZZPA 2XS2A 4KHMA 2KHDA 3C14B 3H2LA 3HZGA 4X4SA 2XG8A 1PSDA 2IAJB 3FRYA 2UVUA 3RB4A 4GKJJ 2KRBA 3BR8A 1T3NA 1HBMB 4KYZA 4U8VA 1U2CA 2RNEA 1YJVA 3KLFA 4V1Ak 3SEOA 4L73A 3DLLQ 1F9EB 4TYAA 1BQNB 1X0FA 2VD3A 3HSGA 2WOMA 2KRRA 1JIHA 2YPYA 4GC6A 3QSYB 4IG3B 4DV1F 1XNRF 3OTOF 1JNZB 3I87A 1H3DA 4KRWA 4LRAA 4YOEA 1FA0A 4C8MA 3J81Y 4TU7A 3IRXA 1T7PA 4FYWB 1CJUB 3QLHB 4ZVSB 1IBLJ 4U7UK 2K3KA 5A8KA 1FKOA 1N5VA 5BR8J 3BJYA 3SQGA 4IKAA 1M5HA 3RW6A 3FBEA 2DGWA 2PO4A 1K8AT 1NPRA 2EFVA 4CZCA 4DCOB 2G2YA 2HFVA 2CPEA 3R9LA 4C8OA 1S0VA 3MFHA 4ECVA 1AZSB 2CDRB 1LWEA 3LGNA 4FXDA 1A9NB 4DBQA 1FD2A 4M5JA 5HROA 2GO8A 2VB6A 5D0EA 4FF3A 2VPZB 4DLGA 4K8RA 1S57A 4FF1A 3QWUA 4DLEA 3MPYA 2FVCA 2FVSA 3GQCA 1LOUA 3F56A 4P2MA 4RNMA 1G6BA 3PR4A 3LO3A 4Q2MA 1VBZA 3H98A 1BWEA 4EYHB 1AW0A 2QZ8A 2XMTA 4HT7A 3WZ0A 3I55S 4J9OA 1QVFR 4X84A 4IOAQ 2VF3A 3H20A 4HACB 2FZCB 1F5BA 1UFKA 4Z37A 3TUIC 4W92B 4LF5F 4FNIA 2ERRA 2XY6A 1XMOF 2RHQB 1C4AA 4PYAA 3EZUA 5K8NA 4ETZA 2H9ZA 3CT9A 4I7FB 4P7VA 2DXFA 1X4FA 3UO0A 2KHCA 5KFOA 4NI2B 5GMEA 2AQ4A 1RWMB 2CPJA 2RB7A 4H4OA 1D0EA 2V8DA 4RO0A 5GVQA 2NZ4A 5J1EA 1SJQA 2O3DA 1UETA 3NCRA 4UT4A 5M2PA 1CG2A 1U1KA 1S7HA 4DL6A 5K5MA 4I67A 3BYPA 6FDRA 4ENOA 3M32B 4PG6A 2EFGA 3ILOA 4DG1A 2FDNA 3GYGA 1NSQA 3V81B 1Q86T 5EN1A 2CPZA 1RUSA 4Q7AA 3MPVA 3QT7A 2PIIA 4L6V3 2E5LJ 5L1LA 4KBIA 2KI2A 4UF4A 1SJ4P 2AW0A 3S6EA 2B7CB 4YDXA
chains in the Genus database with same CATH topology
1L3KA 3N5FA 4DV3F 1N4LA 4QWAA 1GXLA 4QOTA 2GHPA 2NSCA 4C4WA 5F9NA 2CJ9A 3KLVA 5AXMA 5ADZA 1N33F 1SIWB 4GC7A 2OAUA 2HGMA 3CCQS 2VUGA 2EG2A 3M6VA 2W9BB 1URNA 2F9DA 3M1VB 4OHXA 4YDDB 2ZFHA 4QYRA 2KN4A 1TFWA 2HVZA 4YB6A 2J7WA 4RU2A 2CQGA 4C7QA 2KO1A 3BB5A 4TKTA 3ZZZA 2V4RA 5D8HB 3OQ2A 2PE8A 4ED5A 5D4LA 3LUYA 1FE4A 3IGVA 4Z2XA 1Q1KA 1CQNA 4TQRA 1VQ7S 3VAFA 5KFGA 5DG8A 5FLXY 1L5UA 1R6YA 3MUMP 3LPYA 1XMQF 1C1CA 3KK3A 3CD7A 1DLOA 4OHYA 2VBXA 4J9MA 2W24A 3C66A 2FIUA 2KU7A 1Q81T 4LSLA 5J2QB 3I6PA 2C3OA 3PJXA 2FJVA 1FKPB 4IRKA 2KM8B 1S0NA 1PGZA 1S6UA 2MQOA 1SJ1A 1UMJA 1Z1ZA 2DD8S 1UVIA 2DR8A 2LA4A 3DN9A 3IR7B 3PFEA 1SH3A 3T6JA 2N4CA 4F25A 2MYFA 3F41A 3AAWB 4X4PA 5HMWA 1HI0P 4OI3A 4AE5A 3OLBA 2VFSA 5A8RB 2B5JA 1KR4A 3O1LA 4Y3CA 3THTA 3M9MB 3HJFA 1C0TA 3HHDA 4PG8A 2QE5A 1X5TA 2DO4A 3OTBA 3DFEA 2BVZA 5K9FA 4A47A 5JJBA 3KHRA 2R7RA 3MM7B 3NWGA 4RNOA 4WFAQ 1QAYA 5AE2A 1OO0B 2DT9A 2P6TA 2U2FA 2BRKA 4DV0F 2MKHA 2VC0A 2ZDPA 2ZOMA 4AL7A 1J5OB 2BQRA 4YR0A 1HWJA 3KG4A 2L41A 5F8IA 1RTHB 5T7LA 3H5XA 4R25A 3KOAA 3VAIA 4RUCA 1C0TB 2JL9A 3DHWC 2EFOA 2A18A 2JC0A 1RT1A 3TYTA 2LYVA 3I9ZA 1SB6A 2GGPA 4YFUA 3HKWA 2OIHA 1R0AA 1DBDA 4MYTA 2C2DA 5J2NB 2UUBF 1DZ5A 2WCXA 4P6QA 3DOKA 3UE2A 3CC2S 2XC9A 2QLXA 4PR6A 4WF9Q 2FJBB 2V8VA 3MI7X 2M9KA 4I64A 4ZKAA 4GKJF 5KTQA 2CPYA 1GT8A 4ZVHA 1RISA 2DH8A 3UR0A 4ATNA 1NJWA 4HEA9 3BR9A 2CJBA 4X2BA 3M2UA 1C4CA 5GAHU 5C25A 5G0RA 5F3ZA 4ILRA 1WF2A 3GB0A 2RIJA 3M8RA 3MD3A 3TP2A 3HDSA 1QSYA 1S1WA 2CQCA 3HHNB 1VQYA 2QA2A 4R5PB 3TW0A 4EU0A 2YVSA 2MMYA 1U8SA 3FEXB 3MTJA 2EK1A 3FZBA 3SDEB 3QZ8A 4QYZJ 1KD1T 3OR2A 3V6DB 1WEXA 4JI2F 1KVIA 1O0PA 4B9UA 4RX6A 5AXNA 2XY5A 2G4BA 2CQ3A 2VONA 3HT3A 5A8RA 3CJ2A 1T03B 1TK5A 1YBAA 1YI2S 4RKUC 1SL2A 3SXLA 4KTQA 2HQ3A 5F9LA 2UVVA 4GKKF 1NU4A 4F2SA 2E1MC 3OXGA 3UFCX 3DRPA 1D8ZA 1Q7LB 4J9NA 3TANA 1F0XA 2GJIA 3BEGB 4ES1A 4CNYA 3SFUA 2NREA 3KMSA 1E6YA 4MIBA 3D1OA 3P49B 1S1XA 1VIOA 1IKXB 1SL0A 1NK9A 4CO3A 4NLGA 4CTAA 2DGSA 4I2QB 3OJUA 3R5CA 2C3UA 1MROB 2Z0GA 5I3UB 2L9WA 3MEGB 2ZH9A 2W7OA 4R8UA 5HMYA 3SV3A 4K4XA 2VOOA 2CKWA 2VBWA 4FXVA 4NRTA 1JX4A 2KT2A 4LF7F 3J7Z5 4O44A 2EI5A 2BJDA 1R31A 4HTIA 2ZE2A 2DHXA 4RW4A 4YR2A 3OV7A 3H4DA 2KM8C 5I3PA 3QGIA 1JWWA 5KFUA 1JMTA 1SJRA 5LXYA 3N9UC 4KKOA 1HNVB 2KJVA 3OL8A 3N6MA 5E3AA 4B3SF 4F3OA 3K0JA 2OTJS 5GAEU 1XR6A 3FNNA 3PIOQ 2YKMB 1LWEB 3X1LB 3GV7B 3LF0A 3UQSA 4EZ6A 5KG3A 2DHGA 2BANB 5BR8F 1V6HA 4V19X 2Q3PA 1S9GA 1DJ0A 2N7YA 4QPTA 4B3OA 4DL4A 3ONQA 2RILA 5DS7A 3UDCA 3KMQA 1OWXA 4ZPTR 2HVHA 3RU0A 5HLFA 4DR7F 5A8WA 4A8FA 2HG4A 5LL6d 2XB2D 3HVWA 3OSPA 2MXYA 2KFNA 3M2VA 2E66A 3J7ZT 1WI6A 2DGOA 1MWZA 4C11B 2HNDB 3LAMA 2DK2A 3UDLA 1JLEB 3CCTA 4FBUA 1UJ4A 2RKIB 1IBKF 1LFPA 3MEDA 2KYXA 3SDEA 5DQGA 3KYLA 4DWIA 4NCBA 2X1FA 3H2VE 2X1GA 4A8YA 4MAKA 1X5SA 4FVCA 3MEKA 1Q79A 4RW8B 3PW2A 3JB9k 2E9RX 4NLVA 1JLGB 4PCQA 5MLCV 5D4OA 2HRYA 1TUVA 2LCWA 3N4WA 3I0RB 3KHHA 5KFCA 4UY8T 3WDOA 2F4VF 1QSLA 1KTQA 2DNNA 2DH7A 1U6FA 2OFHX 3DLJA 1T8EA 1TL1B 4X64F 1S99A 3DI6B 5KFJA 1LWFA 3M2VB 3NS5A 4NYPA 1WEYA 3CC7S 4ECSA 4URSA 4F3QA 4O0IA 3Q22A 5JVGQ 2CPHA 2HFZA 2MZ1A 3GV8B 3MD1A 3OLAA 3VAJA 4ZP6A 1M90T 3PO4A 4FNHA 4J9RA 4O4RA 4FVMA 1N5QA 2QYCA 3T1YF 2CRLA 4J37A 2IVYA 3RBDA 3NL0A 4Y0FA 2L08A 2DR5A 5GAGU 1HWUA 4DN0A 3DRSB 2BANA 3LW5C 3BGRB 1VQ5S 2V8GA 2H5EA 2A2DA 3TOQA 1KLNA 6FD1A 2MKJA 3PKMA 5BJRA 2ADBA 2P6SA 4DEZA 1S9EB 2NYIA 3HHLC 4JI4F 4WE1B 4OJ3A 1GQEA 2UP1A 2D7SA 5B0AA 5M2RA 2PT0A 1VI7A 3NCPA 2AYBA 3CDEA 1P9QC 1KNZA 3HHEA 4HYKA 5K8PA 3CWJA 3DC2A 4DHVA 2QA4S 2M2BA 1SKSA 5CA5A 3BO3A 3U02A 4C97A 1VQKS 3Q2SC 1ZYQA 3M30B 4MFBA 1JXLA 3PVXA 2EBGA 1E6VB 2IJFA 4LQ9A 4RNHA 2V5HG 2AD9A 2W9CB 4DUZF 1C2PA 4AL5A 2LKZA 4PKDB 2DHAA 4ITSA 4X62F 2YNFB 1KFSA 2O1PA 3M2UB 4B9TA 1UJ5A 1HD0A 2MQPA 3V4IB 4KR0B 2J7KA 4AFFA 3M8SA 2M8HA 1TVRA 1S1TA 2JSXA 1S6QB 3CCWA 2AJQA 4PXDA 1FF2A 1RT5A 1TAUA 2W4CA 2GO9A 1R43A 2ALZA 2IM1A 3G6ES 4B9LA 3FMBA 3POTA 5I3QA 4A4JA 5F8MA 4OJHA 4QWEA 3UD4P 2V4JA 2JLEA 1SXLA 4XAKA 1Q82T 2C42A 2C2EA 3CF5Q 4ERDA 3CDWA 4DPOA 5EGYA 5LSLA 3OUYB 2B4VA 3RBEA 2YQ3A 3GG1A 5A6WA 4C0OC 1TK8A 3QO9B 5K14B 3CJ5A 4PRFA 5L1KA 1Q8LA 1H2VZ 4LJMA 2E29A 2OD6A 2OP5A 4H4KC 1X0PA 3O44A 2G0CA 3BSNA 3BGFA 5D77A 3G4SS 1RJJA 2I8EA 3I4HX 1YVFA 3MMJA 4Y6IA 4YQWA 1U1RA 1FKAF 4JI1F 2LDYA 3K7RA 1RT2A 4TLQA 3C6TB 2MHEA 4WXWA 1S1VA 3WC2A 3DCAA 3MM8A 4K4WA 3HM9A 2HQIA 4U9RA 2UUAF 3S7RA 3MM7A 1PC4A 1DQ9A 2NPIA 3HP6A 4FPRA 2SXLA 3BDEA 3CD0A 4RUHA 1VIXA 1ZH5A 2LQ5A 4NLDA 2LEAA 4Q2LA 4WXOA 3OUYA 4FYDA 2A3JA 1ZM9A 2N3OA 4DDFA 3MDFA 1UWBA 4M63A 2IC3B 5IQ6A 2OPPB 2UV8A 3GFHA 4HH0A 1CC8A 3BO4A 4F4YA 4ELVA 3K5NA 1QVGR 3N5BA 2V9WA 2OSRA 2I2YA 1FJGF 3GR0A 1EP4A 5B7WA 2CIMA 1RGVA 1G7CB 3ETOA 5KFLA 5B0BA 3L7OA 2XGQA 1R0AB 2Q6BA 1G1XA 4B3MF 1S6QA 1KC8T 4N5SA 5I42B 3BSCA 3J7YI 3V4IA 3M8PB 1C1CB 4HLBA 5E3QA 3K5LA 2MZJA 4ZMMA 3HO1A 3DXBA 4OI4A 4E0DA 1IQZA 2ILYA 2CPDA 3NGKA 4IH7A 4OI1A 5LXRA 5KT2A 3UR3C 4E98A 1JLCA 1E6VA 3CCVS 3AY0A 4K4SA 2B9WA 1FXRA 2RU9A 3S01A 4N56A 2HHHF 5CZXA 1C0UA 1N36F 3MM6B 1RK8A 2HHQA 2HWIA 1YJWS 3BSAA 3QZ7A 3CXCR 3V6KA 4WKYA 2O5DA 2W25A 3PHEA 1F5AA 4WZQA 1HFEL 5KFBA 2XS5A 3OVSA 3N01A 1U25A 1YSJA 4JI5F 3IS9A 2NUHA 4CCHA 2HHSA 2CQPA 4YB5A 4K0KF 3E2EA 2BBEA 1YTYA 3OFHA 2IM3A 3HPOA 3VAMA 3QO9A 5A2QY 4MK7A 4UQGA 3W2WB 4WCEQ 1YITS 2L3MA 4URGA 4IDKB 4GO5X 3T1HF 4WIIA 4BDPA 3DLGB 1UAWA 2XI3A 1IQTA 1LW2B 3N28A 2VQFF 3QJPA 2V4JB 4I6WA 5LT5A 3NNCA 2APOA 2HW3A 2RQCA 2DNZA 1VRTB 3Q0AA 1HBNB 3KK3B 2L48A 1CVJA 1FK9B 1VC5A 4KE5A 2WB4A 3CB4A 4XDCA 2PGCA 1TL1A 3BSOA 1GX5A 2EBEA 2E5IA 1U6BA 1FXLA 1FRHA 2A1BA 4ZPVR 5IS2A 2HNYA 2KXFA 2CQ1A 4U67Q 1VK8A 1ZM2A 2KG0A 4M94A 2YNFA 2ZC3A 4LF9F 4PQUB 5KT7A 2JEJA 2E1AA 2VBZA 3DRRB 5U47A 2L9NA 1SJFA 3DMJB 3MAHA 3MMAA 1IUJA 3BO2A 2EG1A 2FLOA 4PG4A 2W9CA 1QM9A 1XWLA 2WTFA 4KFBB 1XC9A 3M30A 4MFBB 2ZH4A 4C0HA 2MHNA 1ZAVA 1JLFA 4KO0A 1S49A 4RZRA 3EPIA 3TA2A 3U1MA 2PMHA 5LMUF 2FGCA 4WFZA 5DQHA 4MK9A 1HR0F 3HKZD 3HZEA 1TKXA 2OD4A 3OTEA 2QMXA 3M6UA 1HPZA 4CH0S 3MR5A 3OFGA 4JI8F 4JI7F 1Y00A 2J6TA 5ITHA 4N41A 1IKVA 1MMLA 1Y3JA 3ENWA 2ADCA 3R5AA 4UOCA 1T94A 2F3JA 1VFJA 3DDKA 4M5DA 2X1BA 1KEKA 5AE3A 3L09A 3CJKB 3CCES 1P8GA 2BE2B 3QJJA 2Y1JA 3FQKA 3CD6S 4DX8H 5HMXA 2DNKA 2W9AA 4KGMA 4IRDA 4QW9A 1N32F 2VH7A 4K4YA 5D78A 3MR3A 3K5OA 4ECRA 1R89A 2GMHA 2GHVC 2YKOA 4X4UA 1LWFB 1JXEA 1TP7A 5J2MA 2CZVC 2WAQD 1ZZNA 2LXFA 2C3PA 4BBYA 2HHWA 4I68A 3NP5A 3HXMA 3TQ1A 3QGPA 3HHKA 5CYQB 4RNNA 5DGAA 3GE9A 2LMIA 1JJ4A 2WK4A 2PA8D 5J1NA 3QAUA 4C2MA 3BQ2A 2WHOA 3G96A 1FJEB 3QYYA 1H98A 1RQ0A 2P9EA 4AYBD 3KK2A 3DXSX 4EBDA 4LFCF 5AXLA 1JK9B 1YRXA 3HVTA 1WG1A 3MOZA 4ZHRB 1TL3A 1VJWA 2VV5A 2IRYA 2Z8QA 5C24A 4CT9A 4CI0B 2ASLA 3ZC4A 1S1XB 3ZZYA 1SQEA 2HNYB 1D1UA 2JJ4D 1M5VC 4ICLA 4ZP8A 1NKEA 3EGZA 2D9OA 3HFKA 5E2QA 2D9PA 4C11A 3TAQA 2EK6A 2D3ZA 4YEAA 3IWXA 4ID8A 1WACA 4OI6A 3MXHP 3SQGB 2WONA 5DM6Q 4C8KA 1LXJA 3DOLA 5KFQA 3MMCB 2O66A 3S1TA 1ZZFA 2NLWA 5BYRA 4LIWA 2R7WA 4ZCLA 4NCAA 3Q8RB 5FD1A 4NLSA 1ZM3A 3MPWA 1ELOA 2V4QA 1FD8A 4DUYF 2R9LA 3PEHA 2WOMB 2B6AA 3W2WA 3UWTA 1RTIB 4M8LA 3V81A 3CCLS 5KG0A 2POKA 4IFYB 3KWMA 4ZVEA 2W7PA 4DV6F 2AJFE 3IAM9 4QWBA 2G13A 2IM0A 4I69A 1D8YA 1YJNS 1WELA 2IVMA 3KG0A 1VQOS 1RT3B 2YWHA 2B4PA 3OBIA 4KSEB 2YX1A 4KFBA 1Q53A 5DDRC 4FS2A 2YH1A 5E3CA 1TKDA 1M1KT 3D5MA 2JC1A 2XMUA 1I6JA 3GIIA 3AQPA 3MMAB 5IQQA 4BCAA 3PX4A 4O44B 1HHTP 3GFYA 2IA6A 4EYIB 3QIDA 5BYQA 2UV8G 2RU3A 3QIPA 2CVEA 3EXCX 5IFMA 3PDNA 2JOQA 2AU0A 1ZM4A 5F8JA 4PQAA 2B3TB 4WFXA 4X65F 4C8LA 4NLRA 5D4PA 1DQAA 5KFFA 3OHBA 3PXGa 1SKWA 1HARA 1FK9A 3OL6A 4DV4F 1QTMA 5E41A 5KFSA 3K59A 3PW5A 1FVSA 3MEEB 2QRRA 3NLCA 2J0QD 1LW2A 5GMKa 3MM9A 2GQ2A 1P1TA 3KG1A 5IM0A 2MY7A 2HPUA 4IDKA 2VG7B 4X4TA 4AL6A 4ZS6A 2GMLA 5J2NA 1YJUA 3E01A 1HBUB 2ZH7A 4NZ0A 5IXUA 2Q66A 1QSSA 3TAPA 3IG1A 3B78A 4MYUA 4DR2F 1ZTTA 1SL1A 1B0PA 3VALA 3OPKA 1LW0A 2YY3A 4A8MP 5H9EJ 4FBTA 3WBZA 1SH2A 2VFRA 3IS9B 3FJ2A 2E1RA 4K4VA 1YRUA 1VQ9S 2ZBCA 1KLMA 1F5CA 2X1AA 2VOPA 2HIQA 1RTHA 4O4GB 4NMLA 3RR8A 1CQMA 2J9DA 3DM2A 3PJWA 3NMRA 1KRPA 3G6VA 5LSRA 3M9NB 1XTZA 1MU2A 1JJ2R 5CHCB 5D4NA 3F44A 1DURA 5KFTA 2MZTA 3SYZA 2Y1IA 3C3LA 2KB2A 2ASJA 3PX0A 2RRNA 1OPZA 2FJEB 2RE1A 1QAIA 3DRRA 2CQDA 3SCJE 4F4KA 3JYTB 4QR2A 1R8AA 3DLEB 4ED8A 1JKHA 3K58A 3OR1B 3OXFA 1UFWA 1O8BA 1Y5IB 4TU9A 4Y00A 1BQMB 4DQIA 1V3RA 3ZFVA 2JVRA 3HVRA 1UVJA 2R7QA 2VG5A 3ISZA 4QBUA 1VQ6S 2KKHA 3QAEA 1VRTA 1VBXA 3H2UB 1VQSA 1VGYA 3JAMY 2HLTA 2HMIB 3MECB 4MIWA 3QJLA 5J2QA 2YNHB 2IC3A 1ZPWX 1NHVA 2ZZNA 4YY3F 4O3PA 3D0GE 4G1IA 3PO5A 1TQLA 1RT4B 4FS1A 2WBMA 3DNCA 1N0VC 3P5TL 4ECYA 2RDJA 4RW9A 4OLOA 2BYCA 4F4ZA 4MKAA 4DQSA 3SV4A 3J7A1 4DL0C 4Y34A 3CCUS 3T3FA 3H4BA 1Q4RA 3MM8B