3AJ1A

The structure of axcesd octamer (n-terminal his-tag) from acetobacter xylinum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
KKPDFTLFLQTLSWEIDDQVGIEVRNELLREVGRGMGTRIMPPPCQTVDKLQIELNALLALIGWGTVTLELLSEDQSLRIVHENLPQVGSAGEPSGTWLAPVLEGLYGRWVTSQAGAFGDYVVTRDVDAEDLNAVPRQTIIMYMRVRSSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellulose synthase operon protein D
publication title Structure of bacterial cellulose synthase subunit D octamer with four inner passageways
pubmed doi rcsb
source organism Acetobacter xylinus
molecule tags Biosynthetic protein
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03500 Cellsynth_D Cellulose synthase subunit D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2590 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aj1A02
3AJ2A 3AJ1A 3A8EA
chains in the Genus database with same CATH superfamily
4NX9A 1C4CA 2ZM6F 1RB0A 5HROB 4MYTA 4B3SF 5KFWA 1LFWA 3F0NA 2MLYA 3IMQJ 2XS5A 3OTEA 4ERDA 1BMQB 1N5TA 4N56A 3SDEB 2AGQA 4MK8A 4DFMA 3VVUA 5KFYA 2YTCA 2D3O1 1RT5A 4I7FB 5J2MB 3VAGA 2QA2A 4OHWA 1EETA 5KFNA 4YB7A 1F0XA 1QVFR 4ZVFA 2CZ9A 4RR5A 4DR2F 3T9ZA 1I5OB 2RRAA 4DPXA 3KLEA 2GHVC 5C2CA 2NSCA 3IA0A 2NZCA 1ULRA 1U6BA 1JX4A 3G96A 1YDLA 4X62J 4OLPA 1T03A 1F9FA 5DLGA 3OR2B 4ICLA 2EXUA 4FVMA 2MXYA 3HP6A 3QMQA 1FJGJ 3H20A 3L9ZA 5A8KA 4JI6F 2MKSA 1UA1A 2DT9A 3I56S 1Q95G 3H90A 2HGLA 5B0CA 4OI0A 1J27A 2CVEA 5B0GA 3A8KA 2C2NA 4U96A 2DGTA 1NHKL 3BN7A 4NLYA 2L9WA 5L46A 3TVZA 1S97A 4NYZA 4JV2A 5H9FJ 5D0GA 4KT0C 2LA4A 4DV2F 2V8DA 1UVNA 1NPKA 4ZP8A 5A76A 1S1TA 1SQEA 3ZZRA 3CJ4A 5FD1A 2KTQA 2CAJA 4WFAQ 3NGKA 2UV8G 4O23A 4MIWA 2BW7A 2CYYA 4ECXA 1Q4RA 1RAOA 2UUCF 1NMEB 3E3XA 4K2JA 1XTZA 3GFXA 1Q81T 2ZZTA 2AZ3A 3DLLQ 2BANA 3LGNA 3TX0A 4HT5A 3NBPB 1YBUA 1VQPS 3MUTP 1M5SA 4HKQA 3NEKA 4Y3CA 5KTQA 2RSQA 5EX3A 2M7SA 2BA9A 4DLEA 4ETXA 3E8OA 2DEJA 2ZH7A 2KM8C 3BPDA 2ZUAA 2D3ZA 1CG2A 3MGJA 4USWA 1WOSA 3QLHA 1SBRA 3ZZYA 4N47A 1CULA 1VC0A 1EKRA 4G3IA 5D0HA 2E7XA 2PC6A 1FTCA 3JTPA 4JI0J 3CJKA 4NYOA 4CLZA 2QLJB 2X1AA 4CRJA 4RWXA 3MMCA 2Z0GA 1NPRA 4CP5A 2FD2A 2LMIA 2P6TA 2KN4A 5IT9Y 2COLA 5ETSA 3OW2R 3HHLD 2L9DA 3K0JA 2C28A 2FB0A 4OYMA 2YNHB 3RTVA 3CJ0A 3HI9A 5HL7Q 2K3IA 3CDWA 4CH0S 3T9NA 1U2RA 3Q83A 1N34J 4RNNA 3MEDB 1YSJA 3PACA 3CMES 1NAQA 4RW9B 1HWKA 5K14A 4WWSA 3NL0A 2HK3A 5HQ8A 4DV0J 1SJQA 2QG9B 1R27B 3PIOQ 2KG0A 2IRXA 4EO8A 2VUGA 3HHNB 2VU5A 5HBMB 2XGQA 2HAIA 1XIQA 1CS4B 5HATA 2CPXA 3D3BJ 4ZPTR 5C5JA 1APSA 1QSSA 5K8NA 5C7PA 1K44A 5D77A 1IKYA 2E66A 5IOLA 4MKBA 1HPZB 3EGZA 2MJNA 1RTIB 4H4MB 1QAIA 5LXYA 3E01B 4DS5A 1WEYA 4K8RA 4TY8A 1CC7A 2VFTA 3R5CA 5KFAA 4DV5F 2UUAJ 4MK7A 5DDOC 4I2QB 2RQCA 4X2BA 5F8MA 3MM5B 3K5NA 3P8BB 3DYAA 1RDRA 4USTA 3TQ1A 3G8TA 2BJ3A 4XO0A 1QTMA 3JSRA 1YRTA 4NLSA 1S9GB 3T5LA 2OFGX 4ES1A 4PG7A 4GRSA 4ZVEA 5T14A 2ZNYA 3M30B 1QTNB 3LAMA 3TA2A 1KQGB 4OV1A 2DNHA 1PIEA 2XTJP 4JI2J 1URRA 4LR7A 2D7SA 5KFKA 4M5IA 2DNNA 2LEAA 4ED5A 4WP8A 4JI5J 2BV3A 3KXDA 2DYAA 5DQGA 1HW8A 3KLFA 3IXQA 1S10A 2V67A 4DU7A 4UT4A 1TL5A 1SKRA 3KJVB 1XEZA 3MURP 3TJ8A 4KFBB 4P72A 2KFZA 3C66A 1UMJA 2E1PA 2Z58B 5GMDA 5HQMA 2H4YB 2RRBA 1M5HA 1UTAA 7FDRA 3EYZA 2H5EA 2L48A 2BQRA 1RU2A 4OZNA 2KRRA 2LVWA 2YQ0A 1RT2A 3CULA 2CUYA 2GAHC 4X4NA 4YOEA 3HFVA 4OZ5A 2UXDJ 4P6QA 5GMEA 1TAUA 3D6MB 2JLFA 2HWIA 1VQLS 3MPYA 2PMHA 4TLRA 2HQFA 2F9DA 3HZGA 5THWA 4ZA1A 3JAMU 2ZH3A 1N32F 5D0RA 4DCOB 4NZ0A 2OD4A 1F5CA 2OAUA 3DXSX 1JK9B 1M5VC 3R5GA 3P6YC 2IBKA 4F2RA 3KLEB 3MFIA 1TL3A 3MCNA 5KG3A 2PSZA 5KFFA 1KOHA 1B64A 1FRJA 5B0FA 4K4ZA 1URNA 1WC5A 3K5PA 1FA0A 1EKSA 1G1XA 2CQDA 3T1YJ 2JC0A 3DLHA 1EQ0A 4RO0A 2JFDA 4I6WA 4DFPA 4OI6A 3M1VB 4XAKA 1YITS 1IN0A 1RCOB 3AD8C 5DJBA 2QMWA 1YHQS 2P5VA 3C6TB 1S6QA 3NS6A 2MY7A 3HULA 1VJQA 3KKFA 3NOGA 3B4DA 4ZLLA 2W9AA 3T5HA 1S9FA 1NK5A 1ZPWX 2OEJA 1U1LA 2YKPA 3THPA 4LVOP 3HD2A 1X5TA 1HBUB 3HVAA 3F41A 3IR7B 1NZ8A 1BQNA 3W2VB 1HI0P 1S1TB 4HEA9 2DXFA 4DV7F 3UVJB 3K17A 1TKTB 1VHIA 4MTPA 3QSYB 4IRCA 1VBKA 1KLNA 3BH7B 2AYBA 2IHR1 1KC8T 1VBXA 3BPSP 3V81B 1S1WA 3HF5A 1J5OB 3VCDA 1HNVB 3I9ZA 1PYTA 1BLUA 3CMQA 1L3TA 2MZ1A 1HNWJ 3HHLB 3MWBA 1N5QA 2GA7A 2BEFA 2Q6BA 3ISZA 4HT7A 1JQGA 2YWWA 4X64J 1WTBA 4PAAA 3VAFA 3ILLA 4HTJA 1WI8A 1FXRA 3VAKA 1TL4A 2QSFA 5GADI 2E1RA 3ZTRA 4FDFA 3WBZA 4NYPA 3UO0A 4IKAA 1RWPB 2I6WA 1SV5A 4ZVQB 1R0BG 2UXBF 1QAYA 2LEPA 4ANEA 3RUBL 2FJBB 1RJJA 3PRVA 4OI1A 3D66A 3W63A 1XQIA 2GO9A 4WXOA 1T9WA 4G1PA 1WDTA 1QVGR 1RYSA 2DGXA 1YRUA 2HHXA 1LWXA 1QUPA 2ZFHA 5HQLA 1SKWA 4TU7A 2BKOA 3CCLS 4RUBA 3MD1A 3MXHP 1TL1A 1U09A 4MT1A 1WSVA 4OJ3A 2J7KA 3H5UA 1KHWA 4IFYB 2B8QA 1RTJA 4LBIA 2EFNA 4KY3A 4F26A 2CQCA 1PAUB 1HFEL 1XR6A 5K14B 2DIUA 1REGX 2HFNA 2M8HA 3QPIA 1AA1B 1XMQJ 1JMTA 1IR0A 3ZO7A 2YPZA 4DR3F 2HYIB 2RT3A 1ZA1B 1EIYB 2J7UA 4DR6J 2BE7D 1CJKA 2R2TA 2KG1A 2RH3A 4ATNA 4MKAA 1WG4A 3A3PB 4FNIA 3DLKA 4KGMA 3ETMA 2CJAA 3ZZZA 1T9UA 3PR5B 1WWHA 5A8WA 4NASA 1NDCA 1LNQA 4FYWB 2EFVA 4TNOA 2VBZA 5KG4A 3OPKA 4ZVGA 1S1XA 1X4HA 3P3DA 2VG7A 1EAYC 1VQ5S 3GZ7A 3LW5C 2MKKA 1TV6A 1J5EF 3RRGA 5LSRA 1N8RT 2NXEA 4FBUA 2Z2MA 2UVRA 4R5PA 1IQZA 3TZXA 3NY0A 3ET6B 2KT2A 3QIPA 2QV6A 4RW6B 2F65A 4H4OA 1HBMA 3DYAB 2V4JB 3UE2A 4DV3J 1RHUB 4FF2A 4CLKA 1SCJB 2EC2A 3A8EA 1U6ZA 4GKJF 4QYZJ 2D41A 1LWCB 1UWAA 2C2OB 4OI2A 2YX4A 3WX4A 3FEXB 4UZCA 2DEIA 1RXOB 1G7CB 3FQLA 3MR3A 4IH5A 3HFZB 4Q7AA 4HHJA 3HVWA 1K1SA 2OEKA 4IH7A 3FCHA 1UAWA 1M1KT 1O8BA 2WVBA 3UDVA 3I32A 1HNXF 4USMA 3N5BA 4ANDA 2IPOB 4KH1B 4MJKA 1F60B 2HNYB 4RW4B 4DSKA 2ZZMA 3B78A 1G2EA 2Y1JA 4DV6F 1S72S 3GIKA 1B7YB 5KFVA 2FZCB 5KG7A 2V8VA 2V2VA 1FRLA 1U1KA 3DDKA 2KI2A 2WK4A 3GCWP 4LF4J 1ZTTA 3WIVA 1S79A 1M5KC 5DDRC 1RTDB 2EEYA 1SJFA 2JC1A 3BEGB 3GIMA 3QNWB 4PQUA 1RGVA 2HNZA 3JYTA 3JXOA 3PO5A 3BGUA 4ANCA 5HANA 4E98A 1YGYA 1HHSA 3BKFA 3DLBA 3LWLA 2Z56B 5HMYA 3UD4P 2HPUA 4A8WA 4C2MA 3V4MA 3HCXA 2HVIA 1PAEX 3GG1A 2R8KA 3IS9A 2XLIA 1R8AA 1VYAA 5ETPA 4W98A 2FPHX 1RT1B 1FESA 4XTTA 4I1TA 2HQIA 1FJCA 4WP9A 1S6OA 1RWNB 2E5GA 2OPPA 3ZZOA 2MKCA 2XLJA 5L1KA 1NJYA 3CCWA 4HR2A 1TL3B 2ZOGA 2IC3A 2Y9HA 3H25A 4DF4A 3G2XA 2HWHA 5CAAA 4HL9A 1T94A 3RYLA 4BC7A 4LQ9A 4LBPA 3ONQA 1Y3KA 2QL7B 2NUHA 2YWHA 3TAMA 1R3NA 3GFHA 2FTRA 1NCLA 4B9NA 2AHOB 2CWKA 3C15A 2CQ2A 4BCAA 5ETKA 3M7VA 4G6VB 2MZRA 3TEGA 1GEHA 3EVOA 2GVDA 2WW8A 2OFHX 4ECSA 2H5IB 1KP6A 3MECB 3N79A 3J7ZT 3MAHA 2FLLA 4BHQA 3PX4A 1VGYA 4GO7X 3GYXB 1AW0A 2GO8A 4RNMA 1O0PA 1SH0A 1TKXB 2B7CB 1EHWA 1TELA 3KNGA 1IBKF 2E5HA 3R27A 4UTGA 3J80U 1RUSA 4JV1A 3VAJA 4IR9A 2LP4A 4GVBA 4ZJQA 1UWBB 4X4QA 2G13A 1R8BA 1EZZB 3IBFB 3K57A 3N6LA 1VQ7S 4F2SA 4Q0BA 3QT8A 2DGWA 4K0KF 2M52A 2AV5A 1W2IA 3NCPA 1IKXA 5RUBA 1Y11A 1LW0B 4HDHA 4LF1A 2CPHA 1YJ9S 3K8WA 4UF4A 3OXLA 2MKJA 1RTHB 5F8IA 3QYYA 4WE1A 5IM0A 2OMOA 4KHMA 1SV5B 4F02A 2JEIA 1D3WA 1F5AA 4Y28C 1RE1B 1GTEA 5K8MA 1U1PA 3C6UA 4Q2MA 1ROFA 3QZ8A 3LPEA 1SVDA 4CYUA 2A6OA 3GJQB 2EC0A 3MM6B 3P4UB 1S7IA 1RP5A 2GJ2A 1RADB 1SKSA 1TL1B 1ELOA 4H4KA 4YS2A 4OZLA 2FY1A 3RR7A 3IWNC 3OVAA 1X0FA 2QA1A 4Y65A 1TKZA 2RDDA 5HVHA 1ZBTA 4OX9F 2F9JA 4LRDA 4TQSA 4JI3J 3W61A 3MM8A 4AYBD 4DSLA 4V19J 1OY8A 3GR0A 3O5TB 4X62F 2ASDA 2NYIA 3WX8A 5G0RA 3MMAB 1VRUA 4HLBA 4IDKB 2A2DA 1PGZA 1KTQA 1FJGF 7AT1B 2MB0B 5H9EK 4F0KA 3H2VE 1NSQA 2XYGB 1YBTA 4JBCA 3MDFA 4N76A 1ZAWA 4ZPDA 5A8WB 2CJXB 4EBCA 4RNOA 3POTB 1R0AA 3NGRA 3W2WB 4ZPAA 1SJ1A 4DSFA 1DQ8A 5EX0A 3PJWA 2VG7B 2QMUB 3C16A 3HO1A 2MYFA 2GQQA 1IUJA 1NBEB 3J81U 4RW8A 2I2YA 1U1NA 3QIPB 2GX8A 4FXVA 4ED0A 2DRDA 3EWGA 2CDRB 1NJXA 1WHXA 3LA0A 3Q8YA 2LXFA 2RMLA 1J2VA 3FSXA 1B0PA 1CBKA 4X4TA 1U0HA 1KVKA 3HVTA 2EG2A 1RQ0A 1HNZJ 5C24B 2EPIA 4DL5A 2JLGA 3I96A 1D0EA 2F8EX 3HKWA 1Q1KA 5CYQB 1OSDA 3AAWB 2GMJA 5AXKA 4CT8A 5A0YA 1C1BA 1NM2A 1AXQA 3CIZA 4EI2A 4O3PA 1JNZB 1TTHB 2JZ5A 4N8OA 5FLXU 2FLPA 3CCSS 3MMBA 2XSJB 3A12A 4ZJLA 2AQ4A 2YWFA 4X65J 2W7OA 2DHGA 4YY3J 4DL3A 1LQ9A 4FS1A 2EWHA 4PQUB 5KFHA 4DUYJ 1N34F 1UETA 3P45B 2J9DE 1SL0A 1X4GA 4ED3A 2FJXA 3PR4A 5KFGA 4NOHA 3EVMA 1D09B 1PKUA 4DU8A 4MH8A 4KKOB 4A8OA 1TFYA 3LP0B 4ZN1A 2KFNA 4DV0F 2MHEA 3PX6A 5E33A 5A6PA 3PW2A 3D1QA 3CCTA 3H0PA 2YKQA 3K89A 3G6XA 1P9QC 3D54A 3TJ9A 1YJUA 2VHGA 1KBRA 1AROP 3OBIA 5DM7Q 3GSDA 4CI0B 4F04B 5EWGA 2QC3A 4C8ZA 3IWLA 2YWKA 3DRRB 5DG8A 2X3GA 3CMAS 5HK4A 1RBLA 1B4SA 4U8VA 4UOFA 1H6KX 1MROB 2IM0A 2KB2A 4J7CA 2R2SA 4B3SJ 1HIYA 2YWEA 1UEUA 3NLCA 1FVQA 2M5YA 2ZD1B 4GMKA 5D15A 5KT7A 2H9ZA 1W7WA 2PT0A 2B9YA 3C15B 4IUFA 3AY0A 3BGRB 2UUAF 1V3ZA 4ZP7A 1FI4A 4F4ZA 3ILOA 2IA0A 4ZJOA 3NWGA 1FWKA 1WC3A 2KXNB 2XZWA 2F8MA 5L1LA 4K4VA 2ZH5A 2E5IA 2L08A 2J9EA 4J90A 3UNYA 4C3MA 5J2NA 3SYZA 1O5JA 4AXJA 1UVJA 3FRYA 5LMUF 2VA3A 1E6VB 4J37A 3BBCA 4I0WA 3VGUA 2V2KA 4JI2F 4ZIWA 3FMWA 1W25A 3DRSA 5HI7A 1S48A 4GVBB 5D0EA 5EGYA 2WOMA 1TZ0A 2MQMA 1XR7A 4JI6J 2I0XA 2KXHA 2MPUA 4J9UE 1PYOB 2DPJA 1LXJA 3F73A 3MUVP 1IKXB 1UEKA 4Y2AA 2G0JA 3DOLA 2N3OA 4ZPBA 4KQZA 1T7PA 2KVQE 4C3KA 4S0MA 4ZPVR 2R8JA 1RA6A 4DL7A 2OPQA 3TZWA 2N7YA 2A6MA 8ATCB 1JIHA 3LF0A 2KM8B 2HS4A 1RI7A 4ZKAA 2OGUA 2MZSA 4B9LA 1JWWA 3MEKA 4URQU 3OFEA 5F8GA 4CO0A 4QWCA 1FXDA 3C6UB 3M6VA 3G9CA 4C11A 4TY9A 1ICEB 2UUCJ 4F67A 2HHSA 3GV5B 3KLIA 2B6AA 4F7VA 4BWJA 3GTYX 2KZZA 4L75A 2EKYA 1S0NA 1U45A 2VKRA 2Z8QA 4HACA 2YNIB 4NI2B 4M5LA 3TJAA 4M5GA 2NCKL 1P6TA 3CEDA 3O2IA 3SQGB 3SEOA 4EK2A 2CVIA 3X3UA 2XQCA 2J8SA 2GGPA 2DBBA 2HRYA 3ICLA 3MM8B 4X4VA 3AA8A 1FKPA 1C4AA 2XY7A 2XMAA 2K06A 1DBDA 3R3TA 5I3UA 3OSNA 1NKEA 1WKJA 4X66F 1GMWA 2ROEA 1NSKL 3CSKA 2Y8WA 2IAJB 1TK8A 1VRUB 1JLQB 4IFVB 2CQIA 2XMTA 2LFVA 3PZPA 3TEHB 3A3NB 2DHSA 2QE5A 4ELUA 4FF3A 3MF5A 2XYPB 4DX8H 4LFAF 2FJWA 3Q8SB 3H8YA 2BABA 2C42A 3UCUP 1RAGB 4X4PA 1RT3B 5F8NA 4Y2KA 1HNIA 2CPFA 3D6TB 3CD7A 3MEGA 2MHNA 2FJAB 1F3VA 2J5AA 3CJ5A 3MEEA 2H4WB 3C16B 3TA0A 3CW2C 2GHPA 2JEJA 3FCVA 3PRDA 3VGVA 4F50A 1Q79A 4OZJA 1GMWD 3G4SS 1NB2A 2LU1A 4E2FB 2M88A 4EBDA 2M9KA 2HFOA 5M2PA 3GMGA 3TZZA 5HVGA 4CO2A 1HQEB 1MLAA 4YUDA 3W65A 3RB6A 1FE4A 3VF0B 4YHHJ 2HNDB 2ABYA 4NLWA 1R43A 2Y8YA 4PRFA 5J1NA 4EYIB 3AB4B 4ZVUB 1Y0HA 4X64F 3KLVA 2R7RA 4CLFA 1NH8A 3H4BA 3UN3A 2O66A 5DDPC 1HYSB 4WYLA 1OY9A 3PW7A 2X1BA 1C0TB 1H7XA 4LT6A 2OSQA 4ZCIA 5A0YB 3PM9A 2HW3A 2NXUA 4GC6A 2IJRA 4FPRA 2E9RX 3TAPA 2ZJRQ 4P7VA 1FRMA 4C8LA 1VJWA 2BYCA 2XNQA 4X84A 4DV5J 2AX0A 2WSCC 4U8YA 4DI6A 3MMBB 4IO9Q 1LXNA 2BE2A 1RWMB 5C25A 2H48B 3CD6S 2WVFA 3DGPA 1NKBA 3MUMP 3QRRA 2H3EB 3EZ5A 5GAEI 1SH3A 3KYLA 3UR0A 4C97A 3TUPA 1Z2ZA 4DR5F 3GR1A 2MGZB 1T9YA 4NLPA 3ADAC 2QRRA 4RUHA 3ENAA 2OUGA 2K1RB 4P10A 2BJEA 2PDAA 3BO4A 1O51A 5KFIA 1U1QA 2DNRA 1Z2LA 1CC8A 4X4OA 2YBVA 1LWFA 3HXMA 4JV0A 1MSWD 2W01A 2CG4A 1XMQF 1TKDA 3R7SB 4DPUA 2VQFJ 1TK0A 1FX4A 4WKYA 3OL7A 5J2PA 4ZLPA 2XEXA 3V6DA 4HHHA 5U47A 5DQIA 5MLCV 4QR1A 2DRAA 4R8UA 5B0DA 2ZH2A 4ZCMA 1EJ7L 1SL1A 2HIYA 4WIIA 2NR0A 2K7KA 3LH2S 1T9VA 2NUUG 1QJHA 1FRIA 2CIMA 2HS0A 1HBNB 2OELA 1RT4A 5IWAF 2V8GA 5BR8F 4DEZA 1B0VA 3TUJC 1FK9A 4B02A 2CADA 4USKA 1XK8A 2AMCB 1X31C 2CJ9A 1VK3A 2J0WA 1GXLA 3ZZ0A 2R7SA 4LRBA 2ZC3A 1N32J 4QIGA 3RU0A 1V5VA 2XMJA 1K73T 2PMWA 4NLXA 1CLFA 3PIPQ 1RLCL 2AW0A 1IVZA 4CDIA 5LJ5Y 4RNHA 1DLOB 3FFIA 2VG5A 5BJRA 3RB0A 5EUHA 4B9UA 1D9FA 2DXEA 4MKYA 1VQMS 4O3QA 1YZ7A 3RW7A 1FDBA 4NRUA 2P9EA 3QJJA 1TMMA 2B43A 5E7OB 2RJZA 4ZCKA 1ZH5A 3DOLB 4JV5J 1YI2S 6AT1B 2KXFA 1FHTA 2B8PA 4FYVB 4HI2A 3AXKA 5D78A 2FDNA 3ITHA 1RAFB 3QIDA 4OLOA 3M8YA 1Q86T 5MAOA 5AT1B 1BQMA 4ZVSB 3NGUA 4PXBA 2DH9A 1Q7YT 2FVQA 4DV7J 2ALZA 1DTTA 3DU5A 2HSEB 1U2FA 3M32A 3NGTA 4RW7B 2CJYB 2HZAA 2C3UA 2WB1D 2K7JA 2BKPA 5CABA 1DY3A 1ZS6A 4CWBA 4OX7A 5I3PA 1M1HA 4QW9A 2AP6A 2B5JB 4DSIA 4WFZA 1YVFA 2JEFA 2O67A 2OLWA 4HACB 1VCTA 3D3CJ 3DLGA 1DHMA 3W5YA 4YR2A 3GU0A 1L5UA 2ZITA 1T3OA 2O1PA 4K5RA 4LF8F 1DAXA 3H7HB 4BS2A 1HA1A 1TAQA 1FKPB 3VZHA 3NCQA 1U8WA 2UXBJ 2CQPA 2O01C 1DURA 4XPEA 4KV8A 4ZPWR 4DX7A 4M5MA 3TRGA 5KG0A 4YN3B 1RABB 3IBWA 4PZVA 2UXCF 2RQMA 1WHWA 3MM7B 2EFOA 3PKMA 3QGHA 2U2FA 3X1LB 3A1YG 2XMVA 1DFDA 1ZTWA 2G4BA 2QX0A 5L1IA 3HPOA 3CXCR 1RKJA 2XSFA 1HQUB 4O0NA 2QYGA 4NCGB 2AYGA 3MPVA 2NQPA 2HG4A 1UCNA 3NNHA 2EVZA 4A48A 5BYQA 1PG5B 5KFJA 4U67Q 3QJPA 5KFBA 2EBGA 1NJZA 1QM9A 2DR6A 4GO5X 4ZS6A 2R8GA 1JLBA 1NHVA 1RCXB 4DLGA 2HMIA 2X3DA 3IRXB 4LR8A 3VR1A 3V5RA 2ZNZA 4IQMA 5D4LA 3VAIA 4DR3J 3DI6B 1W2BR 4JB8B 1N5VA 1DARA 1RSCA 1HW9A 1MW7A 3NNAA 3UDEA 4DQSA 4LSNA 3QRQA 3W62A 1RWOB 4JI7F 4ED7A 4ETZA 2RF2A 3UR3C 5FDLB 3JAMY 2C3MA 2AGPA 4AL5A 4OI4A 4TVAB 3QO9A 3B4MA 4URSA 3T1HJ 4PUOA 2WHOA 4B08A 1SJRA 2R8HA 1J5EJ 1WC1A 4FF1A 4KGXB 1NK7A 2ASJA 3TNVA 2O5DA 3F56A 4I68A 3LWMA 1NO8A 5KFQA 2BE2B 2VFVA 1XMOF 4L76A 5KT6A 3FZBA 3D1HA 1ZZFA 3THTA 5ETQA 3S7RA 2VF3A 3BGFA 3A8IA 1EB0A 4GKJJ 1Y7PA 2BVZA 2YNGA 4NEZA 1GNKA 3BR9A 3CO0P 5EHHA 1X4CA 1SB6A 3O6QA 1W26A 5HJXA 3DN9A 2XHCA 4ZDNA 2HLTA 2XZDB 3MR5A 5KT3A 3MCMA 1UPPA 1GX6A 1HNXJ 1YJTA 2W4CA 1LWFB 3HHKA 2PE8A 4DR7J 4A8XA 4I64A 1U1RA 4DV6J 2MLZA 1Y5NB 3KHGA 3IGNA 1KHVA 2DH8A 3M2UA 5J2PB 1N33F 3PKYA 3TVYA 2HFVA 4LF9J 1S1UA 1I1GA 1VI7A 1RAAB 5KAKA 3KUHA 3KLGA 4XIUA 3BZQA 4P7TA 3SZ2A 3Q8UA 4UQTA 3T5KA 4USIA 3QT6A 5AXLA 4DCPB 1H73A 4ZITA 2DD8S 1N4LA 3S01A 1MU2A 2OPRA 1OQ6A 2XY6A 4EWTA 1NSAA 3EVWA 1ZAVA 3BQ2A 4RUAA 4DCJB 4J91A 4PG8A 2XS2A 1FK9B 2YWGA 1NDPA 5CCMA 3G8QA 3FCWA 1FDNA 1PSDA 2OPSA 1R6VA 5CHCB 2YH1A 2HKEA 5GAHU 3DOMA 4KTQA 2LQ8A 4JUZA 1BY9A 4EZ9A 1M1GA 4I69A 3J81j 4FYDA 1HQ2A 3OLAA 2QZ8A 3JTOA 4B9SA 1V5IB 1X60A 3Q23A 3OJSA 3OFFA 2NLWA 3Q0AA 3BBFA 4QWBA 4WZMA 2UVWA 1QAXA 2VG5B 4J9RA 2I5JA 4J9LA 2VICA 3SIPB 3QBCA 1FVSA 2VFSA 4C0HA 5DRKA 2HRTA 2XZTB 2VV5A 3CD0A 2DR8A 2VQEJ 1A9NB 2LYVA 1JLGB 3LGMA 2MEWA 2WB4A 1N36F 1N6QA 1X4AA 2Y1IA 2OD6A 3NKYA 3TAQA 3ITHB 1RYRA 1E6YA 4YY3F 2D3OR 2MKIA 3QT5A 2FVCA 1DTTB 2CJQA 1IBKJ 5B0AA 3GILA 2QYCA 4RU2A 4R0JA 2JLEA 1JXVA 2BRKA 1VRTB 3U1NA 1SUQB 1EP4A 4YP3A 2YKMA 1Y10A 1ZPVA 4DPYA 1KS2A 5IC4B 1UVKA 2OSRA 4UOHA 5BYRA 3WIUA 2LXIA 2UP1A 3KLHA 4CH1A 1IKVA 4PXEA 4UY85 4K0KJ 2DNQA 2IVMA 2ZUGA 3G6VA 1U47A 3DLGB 4LMZA 4ILMA 3BSCA 3G6ES 4JP8A 2QN6B 2FLOA 4IR1A 1VIXA 2ZHOA 1SL2A 4YMEA 4JYAF 3DLEB 1XJWB 2GQ2A 4I56A 2M70A 3QRPA 4QWAA 3AJDA 3BYRA 4HI1A 4K4SA 1NK9A 3D4JA 2HZVA 3FSYA 1YTYA 3QSIA 4DBQA 1HWIA 1YG0A 1NKCA 3ISNC 3AHPA 4WF9Q 3FRZA 1WG5A 2RHSB 1RWVB 6FD1A 2FZGB 3PHEA 4CNYA 1I3OB 2DGQA 4J9KA 2E9ZA 1D9AA 1MMLA 4LFCF 4WU3A 2GJIA 2XMMA 4LFBF 1WHYA 2B7BB 3IM9A 1FKOB 4D3GA 1N5SA 2OP5A 4OX9J 4LRCA 2HQDA 4MFBA 3K5MA 2WVDA 3QQCD 4ZVPB 2E29A 4OV6A 1B3TA 1HWLA 2AEFA 3JSMA 4CLYA 3SFGA 2W8KA 2VBXA 1JLBB 3M2VA 2AJ2A 3AODA 3NS5A 1I6JA 1NLKL 2BR0A 3UCZP 4F3QA 2A0FB 1Q5VA 2QFJA 3HVRA 4B3TF 3ZZPA 3DCAA 3GLJA 2F3JA 5HJYA 1OQ3A 3UD3P 2RILA 1NK4A 2V4RA 4CCHA 4ZVTB 2ZDPA 3OL9A 2RUSA 1GX5A 2Q43A 2G2ZA 2A10A 3S6EA 4J9PA 2AKWB 4UW2A 3PDNA 2Q6CA 2JEGA 1GMVA 4A8QA 3RBDA 2LA6A 4DPWA 4DR4J 3QFHA 1HMVB 4WTOB 1WUUA 4LF6F 4A47A 2HVEA 3A3OB 3T41A 5HN0A 2C3YA 1LW2B 1WELA 4D3HA 2DY1A 2CZ4A 4DDFA 1RAIB 4LIRA 3Q22A 1JNRB 1XERA 1G3OA 1U48A 1BE4A 4DHVA 2OTJS 1OIAA 2HIQA 1CPZA 3DDNA 3V6JA 2F63A 1SIWB 4ZHRB 3ZZTA 4WP3A 5D3GB 5KOXA 3OUYB 1NJWA 1CQNA 5J1EB 2WRMA 2R7VA 3P96A 4OI3A 3RGIA 3CCMS 4M5KA 1P27B 2PFFB 2XWXA 1DZ5A 2AWZA 5FIIA 5IV4A 3J80Y 2AJFE 4ZP9A 1RK8A 3HHDA 3DGVA 1WDDA 3CJ8A 2JHEA 3M9MB 2AGOA 2B51A 1S1UB 4H4KC 4BDPA 5CYMB 4ZCLA 3KLGB 5LXRA 4KGVB 5ETRA 4ZLJA 4NRTA 3NCRA 2AJQA 1EQMA 2ZJQQ 1TVRA 2WONB 1MU2B 2D9PA 1VQSA 4L3NA 4ELVA 3QAUA 2BJ7A 1RHQB 1FXLA 4MAKA 4ELTA 2XM3A 1VQOS 2R7XA 2KDOA 3D5MA 4Q44A 5I42A 2GMHA 1HL6A 3BQ1A 2AX1A 3SI8A 1IJFB 2R9LA 2DGSA 2RS2A 3C14A 2NXCA 4YHHF 1FEHA 3EGWB 1JJCB 1KSPA 1T9TA 2FHJA 2JH3A 4ITSA 3KWMA 1X9WA 1CJTA 4HTIA 3KK2B 4GC7A 3HD1A 5KG1A 2LECA 1WF2A 4J9SA 2AF6A 2LEBA 1RWXB 4E0DA 2M2BA 5T41A 4ECUA 4IG0A 1WEZA 4KR0B 4PCQA 5J1PA 4KSEB 1UW9A 1HR0F 1RA7A 2ATCB 1B0TA 4ILLA 1BC6A 2GAGC 2E7VA 1NDLA 5F8LA 2ZH4A 4QPXA 3ILJA 3W64A 1VQ6S 4O4GA 4YR0A 2HBYB 3R1LA 5HVFA 1ZETA 1FDAA 1QD1A 1WHVA 5LMUJ 2R3VA 1KN6A 3G6YA 3Q8RB 1BWEA 2VPWB 3TUIC 2RKIB 3CIMA 4Q8FA 3IBCB 2PI5A 4HDGA 4Y2MA 3HX9A 2ZJPQ 4I6YA 4UOGA 4USHA 3M8QB 3KUEA 2Q79A 2VQFF 4KJIA 3J81Y 1PILA 1TL7A 4C48A 2RNEA 3T5JA 1WC0A 4CZCA 3F44A 1IWGA 2BJ9A 4J9OA 1NNDA 1NB7A 1K1QA 2ROPA 2BBEA 1L3VA 4OZ2A 4LSLA 5KFLA 1M90T 4C8NA 1ZAXA 4RL1A 3R2CJ 4LF7F 4EO6A 2BACA 1HKAA 4DZDA 1LK7A 2V9WA 3CJ3A 2G1HA 1RT5B 3ZTOA 1V6HA 4Y2IA 1F3FA 1QE1A 4NA1A 3H98A 5FLXY 1EETB 1MWQA 4OX8A 1ACMB 1FRKA 2CNLB 3O8WA 5D6GA 1AZSA 4P2FA 4QWDA 4KGZB 1YQHA 4DXLA 4MFBB 2R42A 1AUSL 3QGGA 4FKYA 3G82A 3UDCA 2JDJA 5E3CA 3OV7A 3I0SA 2H1YA 3SXLA 4X66J 1S0VA 1OPZA 3RZAA 1T03B 2C3PA 3MM9A 3M2VB 4K50A 2DO4A 2AJ1A 1XBWA 2ALYB 4ICLB 2RU9A 2CQHA 3DRXA 3H5XA 1U49A 4Y2CA 5A8KB 3VAHA 3AOBA 2VC1A 4QJVA 2Y1RI 2J0QD 3EGVA 1VDHA 4M94A 2QIFA 4MK9A 4OFZA 1RT6A 4LFAJ 3AXMA 1OO0B 4DMZA 5F0WA 2FC8A 4JV5F 1FFSB 3W9IA 4PEOA 2FJDB 2LU2A 1OJ4A 3NP5A 3SDEA 3EZUA 3OJUA 1A0OB 3N9UC 4KHRA 5CH7B 1YJNS 4I7FA 4UUXA 3PYGA 5J2MA 2ZVIA 4RBUA 3SV4A 1QSLA 3VQSA 2DVIA 2ZH9A 2CWXA 3I4HX 1X5SA 4N8NA 5ITHA 2VPYB 1RU1A 2W7AA 2C2RA 2ZE2A 2AYEA 2BANB 2RS8A 4EBEA 3WDOA 5IT0A 2KL8A 2AYMA 4OYBA 3HSGA 3OR2A 2MLXA 5KFDA 4C3LA 4OYWA 4OHYA 1KWMA 1WD6A 2M8DB 4V1Ak 4TXSA 3N0VA 2KU7A 4FNHA 4WPAA 3QLHB 3AFGA 3UQSA 2CQ0A 2ZOMA 1CULB 2VOOA 2XI3A 2LQJA 2C1EB 3CVKA 2HQ3A 3BJYA 1NHUA 1SKUB 3PHTA 4IOAQ 4TN2A 2VASA 2W9CA 3FVYA 2CPDA 3JQKA 3QAEA 3CJKB 3CCQS 1QY7A 5LT5A 4Q45A 4IYQA 3MMCB 1TK5A 1YJVA 3UPFA 4TYAA 4KPYA 2B4UA 2W4DA 2AJ4A 2WCXA 2BMBA 1H0HB 4NMLA 2RAQA 2WVEA 3W8PA 3KHHA 2BM1A 5JMNA 4OYIA 3O1LA 4DR5J 1ITPA 1TVRB 1MNEA 3EM1A 1L3SA 2UVVA 2KFYA 2IMOA 4JOUA 3UCGA 3GSIA 1YWXA 1S6PA 1VQ9S 2VC0A 3Q8QB 4C7QA 3GFYA 1Q0NA 3BS9A 2ZDOA 4CO4A 3A13A 2XWYA 1S6UA 3MPWA 4NLVA 1JJ4A 1RHJB 2E5JA 1H2VZ 2JFKA 2C2KB 3LO3A 4ECYA 2F1FA 3DRYA 2CPZA 3MOJB 1IKYB 1U1MA 1X8DA 3IRWP 4LREA 4W4MA 5DQHA 2J9CA 2DGUA 4NLRA 4WZQA 2YNHA 1S49A 4Z7CA 4IG0B 3T1HF 3KDNA 1S5ZA 5IWAJ 4UQGA 5BR8J 4J9NA 4TY8B 3PW0A 2VD3A 4NLQA 2QSWA 2V94A 5DO2A 2HHPA 3PRBA 1WI6A 4C8OA 3LP2A 3IP0A 4RW9A 2OEMA 3BF4A 4B3RF 1FDDA 2IYGA 3VGSA 1H98A 2DITA 1YJRA 3O3LA 2L9NA 3CT9A 1LV5A 4IOCQ 1GH8A 1RWWB 3BGLA 2E1CA 5CZVA 3FK4A 3G87A 1LOUA 1IBMJ 2GJFA 2XY5A 2CQBA 1FTRA 3OD2A 1Q8BA 3BREA 1X4DA 3NRBA 2YKAA 3CDUA 4PXCA 4ZLNA 1VK8A 5HBMA 1JLCA 2FQQB 2YQ3A 2NYHA 4XPCA 5DZ6A 3VGTA 1R8CA 1KD1T 2VODA 3KLFB 3OR1A 5F8JA 4WFBQ 3K59A 2JWNA 1BGXT 1HPZA 1WSRA 4DR7F 1Y4ZB 2Q1LA 1SQGA 1P1TA 1RTIA 3FZ2A 3RB4A 4LR9A 4U9RA 2I38A 4BWMA 1FRXA 3E01A 2VKZG 1TL7B 3U1MA 4DSJA 4LF9F 2HRUA 2MKYA 5HO4A 3U1LA 3TO8A 3N28A 4Q43A 2EW9A 4GKKJ 2ZZNA 4WK3A 3KJQB 1FX2A 1YX2A 4I2QA 3MM5A 2K3KA 2IMWP 2YXLA 5F41A 3MMJA 4WJBA 2XMWA 2VFRA 3AJ2A 4XDCA 1RT2B 1SJ3P 5AE1A 1S9GA 1RKIA 4RBVA 1CJVA 3HM9A 2NS1B 1NSPA 3M30A 4WKRA 2ACMA 3AQPA 2DH7A 4USUA 2F4VF 3ZFVA 4YEAA 4Q2LA 3MAAA 3BM7A 1NK0A 2ACYA 4O44A 2E5LF 1AZSB 4NA3A 3PYDA 3H5YA 1IR1A 4IRDA 4LF8J 3G82B 1N5YA 3KJVA 4NLTA 4DWIA 2XI2A 4OZ0A 3CGIA 3BB5A 5ETMA 4A8YA 4P2MA 5SZTA 3SFUA 4O3RA 1NJIT 4QBUA 2XC9A 2CG8A 4HHUA 5KFRA 2MQNA 2W8LA 2R7WA 2UXCJ 1UFLA 1S6QB 3ISND 3EZOA 2CJKA 2U1AA 5L38A 1RT6B 4NXNJ 4EMDA 2QA4S 2VQEF 2BXJA 5IV3A 4OYOA 1WF1A 5AXMA 3I55S 5GAEU 1BQNB 1I94F 5H9FK 2VOPA 3AH6A 1Y5IB 3H40A 2DNLA 1Y00A 1QUVA 2W7PA 5B08A 4CNZA 2DGOA 4KHPF 5GAGU 2VFUA 3MOZA 1S0OA 2D1CA 2DR7A 2XCAA 4IO1A 1S4FA 2LCWA 3PFEA 4YB1P 1X4FA 3HDSA 1S1WB 2JX2A 2W2OP 3OHBA 2ZE2B 3UD5A 4YFUA 1U7LA 2IJFA 4HYKA 3G71S 1TU0B 1Y3JA 2XMUA 2W4PA 1R6YA 4JI7J 3M1VA 1IXKA 4L74A 5KFUA 3PVXA 3C6TA 5CA5A 2DNKA 3KJNB 2IM3A 1NRKA 1VR6A 2W9CB 2RDJA 3KTQA 1HBUA 3FC9A 4ED1A 2LQBA 3W2VA 1HLWA 4B3OA 1JJHA 3PNIA 3UVJA 4ES3A 2CPIA 1XMOJ 1VC5A 1XNQF 3SQOP 4F36A 5KG5A 1TKTA 1BHNA 2E44A 1VIOA 4X4SA 2A2CA 2ZBRA 4J9MA 4DFJA 1G4CA 1TR0A 5T7LA 5HMZA 4F3OA 2J6UA 1FWLA 3V81A 1D1UA 3HHEA 3EUNA 1J5OA 4DQRA 2EI5A 5KFEA 1HNVA 5K8PA 1FJ7A 2DHXA 1RTJB 3HHLA 4IH6A 3G86A 1H74A 3QGIA 2PN6A 2CPJA 3B8HA 4M5DA 4U95A 4USVA 3CDBA 1S6PB 3EPIA 3IN5A 2VDIA 2AIRB 3W3SA 2B4VA 1C0UA 3CNQP 4M5JA 5D8HB 1U26A 3RAMA 3EE3A 3CDAA 4V19X 1Q53A 3BKTA 1PJ7A 2DNPA 4TYBA 2DISA 2WW4A 1KTVA 1CJKB 2IFXA 1N33J 3L3CA 3W7BA 3NGDA 1LFPA 1UFKA 3M6UA 3DKDA 3W9JA 2VPXB 3IM8A 1X0PA 2QEXS 4FP9A 3DLKB 3OFHA 2HURA 2HWTA 3B82A 4ECZA 3HT3A 5LMNJ 4W92B 3H2UB 4DL2A 1UVIA 1S1XB 3D28A 4QZVB 1TV6B 2XMKA 4I2PA 4AE5A 1X5PA 3IGVA 1X4EA 3P49B 4WFXA 3L4BC 2B4PA 4H54A 3I6PA 4R5PB 2WZ1A 4DR4F 2JVRA 3LP2B 4LF2A 4C0OC 2ZHAA 4IFYA 5IFMA 4ER8A 5A2QU 4F0MA 5CYJA 3HT0A 4RU9A 3FSIA 4H4OB 1HBMB 4J5OA 4CLWA 2JNJA 4KGKA 3NAHA 1S59A 3OTOF 1YKWA 5HAOA 4P9SA 2XO6A 4PQAA 1XR5A 4ID8A 4WCEQ 2IYIA 3DDIA 2ZH6A 5EDWA 2Q3PA 1SQFA 5H9EJ 1FNXH 1FRHA 4RX6A 1GMUA 1JLCB 1WKLA 5DETA 3DU6A 5L9NA 1RHKB 4QPTA 2DPIA 1R8HA 4ALZA 2HK2A 4N77A 1F9EB 4PPDA 3OR1B 3CUNA 3GE9A 4NEYA 3AD9C 2C2MB 3CB4A 4QWEA 3DHWC 4TU8A 2QTWA 1Q16B 2CNOB 9ATCB 1PO6A 1VBYA 4P2SA 4DV4J 2LKZA 4L3KA 4L6V3 4LJMA 1N36J 2XBPA 2DJWA 1SIZA 5E3PA 1U02A 4RJVA 3ET6A 3CC4S 4PG6A 4RW6A 3ILIA 1VHFA 2ASYA 3NS7B 4RKUC 3SMZA 2F8HA 2V4JA 4FBTA 4NMXA 2HNZB 4YB6A 3JYTB 3RAQA 5ETLA 4M5NA 2QGFB 4RLEA 2G2OA 1JLEA 1LWCA 1CJVB 5KG6A 1D8YA 2IIHA 2CQ3A 2VJUA 1OPIA 3RW6A 3UFCX 2ZWOA 3IS9B 2E1MC 5DLFA 4G1IA 1M5OC 2M3DA 3TARA 2DCLA 3MAAB 3UDLA 3FGVA 2BJ8A 2G0CA 1NH7A 3E51A 2EG1A 1UW4A 1F1BB 3LOUA 2MDAA 5ETOA 4O44B 4B17A 2OPPB 1T9XA 2FY8A 5IC6B 4DOZA 1FF2A 2GIRA 3HFKA 3WZ0A 4JI1F 5KT5A 3CCJS 4KB7A 1JXLA 4JYAJ 1KOOA 1GQEA 2MQOA 2FHKA 2HNYA 4RW4A 1N5YB 2IC3B 2ADBA 4Z2XA 4EZ6A 1EARA 1TUVA 3GFZA 4K59A 3QATA 2BQ3A 3AJ1A 3J7YI 1B70B 3TAMB 2CKWA 1KNZA 3CCES 1R8PA 2ZBIA 1GAOA 3B54A 1RTDA 3DXBA 1R7IA 2IM1A 2J0SD 3CO9A 5IS2A 4OHXA 2J6TA 3EGNA 3J7AN 1RWUA 3RB3A 2QL9B 5HMXA 4AD6A 2AZ1A 2J9DA 2YX7A 2GVDB 2GCFA 1S0MA 2NPFA 4LFCJ 3PV8A 4LFBJ 2KYXA 3CJTA 3CJ2A 1F9HA 4AL7A 2X51A 3K2YA 3FQKA 4DV1J 2GW8A 1KQFB 3U7JA 3CTRA 1RT1A 2BZ2A 2ZKUA 1RACB 2UU9J 3DLJA 2Y3YA 5KT2A 3R6GB 3VQTA 4B9VA 4LIWA 2CQ4A 2V9KA 4NWBA 1P8GA 2KKHA 3I5BA 4ZVHA 1NK6A 2J7WA 4ID5A 5HSPA 1QAJA 4Q0BB 4IOBA 4B3TJ 3CJQA 5C42A 2MY8A 2HVDA 3H4DA 2CA9A 2I9SA 2UVUA 2N82B 1SC4B 1IBLF 2ERRA 4CLUA 1OYEA 4OIXA 5E2QA 1WTFA 4WE1B 5IM0B 5IQ6A 3RBEA 3FMBA 2CQGA 2W25A 1U1OA 4CLLA 4M95A 3H42A 3MCOA 1RBOB 3MECA 3ZTQA 4P75A 4A8MP 4F4XA 1QLNA 5EN1A 4LF6J 4A8KA 4ECWA 4B3OB 1TKXA 1U25A 4CYUB 3KK3A 2DNMA 3OFGA 4OL8A 3VZIA 1KLMA 1UA0A 1VOMA 2SXLA 5T7LB 5KG2A 2VBYA 5GAHI 1UWBA 2ZEJA 3GJSB 1Q8IA 3I5AA 1TP7A 2DR9A 2VONA 3MR7A 4ECVA 1TKZB 4YB5A 4OHZA 3EX7B 1RAJA 3GIIA 4ZMMA 3CC7S 3PJXA 3I82A 1PJ5A 2ADCA 4LRFA 2FJVA 1RAHB 1KKHA 2G1DA 2IJNA 3NMAA 4M5DB 1LW0A 2J76E 2V5HG 1PJ6A 5G0RB 3UN5A 5IT4A 1C0UB 3D9BA 4EUVA 1RTHA 1B99A 5D4NA 1N54B 2WVCA 2MQPA 3C8YA 3IFEA 1P9YA 3V6KA 2GFFA 2IM2A 3OVSA 2POKA 2DNOA 1HI8A 3HLUA 4RUCA 3ZXWA 1X7VA 1R0AB 1XNRF 1ZM4A 3M4XA 4NA2A 2ZH8A 4F3MA 3DOKA 2Z2LA 2HHHF 3HSJA 3MM6A 1T8EA 5SUHA 4Y6IA 4I2PB 2BW2A 3CCVS 3UNGC 4F4WA 3OL6A 2Q66A 2AEMA 5KOWA 2AJ0A 4ZVOB 7FD1A 2Y0SD 4PWWA 3P5BP 3V2UC 1FO1A 4RW8B 2W24A 1M0SA 1BWVA 2MKHA 2KHCA 2LXUA 1H2UX 4AXIA 2A1BA 5GVQA 4DZ6A 4QW8A 1H3DA 3KG4A 1T3NA 3KFWX 3MMAA 3H5SA 4QYZK 4IDKA 1U0HB 2VH7A 1SXLA 3HVTB 3K5OA 2Y0BB 1X4BA 3AB2B 2V50A 2EFPA 3HKZD 1VQ4S 2KH9A 4DQIA 4DR1J 5M2UA 5KT4A 3GQCA 1C1BB 1JLAA 5DG7A 2JRSA 3KMSA 4CLSA 3SSSA 3POTA 1K0VA 4USJC 4DX5A 1ZA2B 5A8RA 2BOAA 3ENVA 3W2WA 1NPPA 1HR0J 5KFXA 3N6NA 4DQQA 3J7A1 3PYFA 4NCAA 2DKOB 4YDDB 3IR6B 3KMQA 4QQBA 3T1AA 2FGCA 4DL6A 4AL6A 2W9BA 3PW5A 3MAQA 1F2HA 3PJ9A 4Z7YA 1CVJA 2B9EA 2RQKA 3JSBA 1F6TA 2ZC4A 4N7TA 3OVBA 1XMBA 2ROGA 2G2YA 4AQYJ 3WC0A 4P2XA 3K5LA 4JI4J 3JTNA 2HBQB 1JLEB 3A8JA 2K8GA 1NEEA 3ZTSA 3R7NB 2R7OA 3OHAA 1UJ6A 1GXTA 4NL5A 3AT1B 2HGNA 2BX6A 2V0NA 5C24A 2IA6A 3M9NB 5L1JA 4NPOA 2KZMA 3S1TA 5CYQA 3EXCX 4YR3A 4J9QA 4DUTA 5KFZA 1SC3B 8AT1B 3OLBA 2HQGA 2HBZB 3EDRB 2J6SA 3N5FA 3SCKE 8RUCA 3LPYA 2HVZA 1CJUA 4M1KA 4HVZA 3KNAA 1NUEA 2QLFB 3MTJA 4CIOA 2XSJA 2Z2YB 4BC9A 3GWCA 4DL0C 2OH2A 2EKNA 2GMLA 2HZCA 2BKNA 3R7BB 3MPUB 3C3LA 4JI8J 3MR2A 3ZC4A 1NK8A 2IRUA 3THVA 2QLWA 1V3SA 1MWYA 4LF7J 3CJRA 3L09A 3R5JB 2DHHA 2FVPA 2FGOA 4URGA 1A7GE 3E2EA 5E5NA 4PG4A 2JVOA 2KRBA 4HH0A 2CNKB 1AFJA 4CO1A 4KKOA 2G9OA 2HHQA 2GHWA 3LP0A 2KT3A 2MZQA 4Q5VA 1TMJA 2O3DA 1IBMF 5J2NB 4EGLA 3GJTB 4O0IA 3W5ZA 3GYNA 3QWPA 2FZKB 4FPIA 3OTDA 2FJEB 4UOCA 3RJMB 2FYXA 3GPAA 2RB7A 1PCAA 3DRSB 2VA2A 3DRRA 1Q82T 2WOMB 4DUZF 3M6XA 2B9XA 1FE0A 1MROA 4RNFA 4ID5B 5C42B 2MSSA 1Y9OA 2UV8A 2EFGA 2V63A 4KPCA 3ZZUA 2N4CA 3PY8A 2ZD1A 2N4DA 3QGPA 2GZOA 3MD3A 5K20B 1FFGB 1OMSA 3D68A 2OPQB 4GKKF 1A6LA 3BGRA 1UVMA 4ES2A 1VLOA 5HLFA 2NZ4A 1WF0A 4RZRA 3UWTA 5CQGA 1N0VC 5IXUA 4PWUA 5LM7E 4C8MA 3U27A 1ZOTA 4C11B 5J2QA 3D6HB 3HSDA 3KLIB 4EFAC 2FVSA 1RWKB 2GS8A 3KK3B 2B6AB 3M8ZA 4I67A 5ETVA 1E6VA 2QLBB 5CXTA 1KLMB 3US5A 1OSCA 3I0RA 3M8RA 2BJ1A 2UUWA 4F25A 2JL9A 1OY6A 2J8AA 5IT9U 3D6FB 1SC6A 1Z4UA 2UUBJ 3BO3A 3JQMA 3A4TA 2HQCA 1YZ6A 2WSFC 1ZM9A 2GGPB 2M4MA 2XGPA 2PA3A 3HZEA 1X9MA 1Q8LA 5I3UB 3IO1A 2PEHA 5C2GA 3M9OB 1HD1A 4UZBA 4P74A 1WOOA 4OZ3A 4B3MJ 2IRYA 2OO4A 4NXNF 1FCAA 2RUGA 1DJ0A 3KG1A 1DQ9A 2OIHA 4PG5A 5AJ3J 2OTLS 3OSPA 4OHVA 4LVNP 4U6PA 3AD7C 2Y1LB 3HJVA 1HNIB 3MEGB 3DOKB 4WFNQ 5F3TA 3MEEB 3C46A 4PWDA 4M63A 2E7WA 3OL8A 3BV8A 4CTAA 2UZAA 5DG9A 4AT1B 2YNIA 4NI2A 3VHQA 4A4JA 1AB8A 4KH0B 4F8RA 3MZIA 4QIWD 5ETNA 3SQGA 4PR6A 4KYZA 3MFHA 3KK1A 5DGAA 3D0GE 5LL6d 4WXWA 1BQXA 2PO4A 5D4PA 2NXJA 3CWJA 3KHRA 3Q8PB 1FNMA 1HD0A 2YKNA 2IAJA 2NPIA 2CQ1A 1JLQA 4CH7A 1RLDA 4IFVA 3PEHA 3LTOA 4NXMJ 5ETTA 1KQKA 3RBZA 2RIJA 2IBOA 3KJFB 3ETOA 4PKDB 1QSYA 1AUDA 2UUTA 5E41A 1UJ4A 3D0IE 5KFMA 3V4IA 1K0TA 2FIUA 1JLAB 1HWJA 5FJ4A 2X1FA 1FD8A 1RT3A 5A8RB 4F4AA 1S76D 4A8SA 3BBBA 4IG3A 4E8UA 5B0BA 2H5JB 3AOAA 5C25B 4B3RJ 3J7Z5 4CM0A 3UN2A 1T05A 3DGPB 3Q86A 1UZDA 2DIVA 2FVRA 2W9BB 3RR8A 2V8PA 2J0XA 5CCLA 2H54B 4ED8A 1XWLA 2P6SA 1MN9A 5DS7A 1HQEA 1GT8A 1VRQC 3HJFA 4KO0A 2BM0A 3IC1A 4ENOA 1MG7A 2GQCA 3PYEA 2XS7A 3R2DJ 2HNDA 4UY8T 1WJ9A 1VLYA 1FJEB 4DFKA 2PA8D 1PC5A 4IQXA 4NE9C 2BE9B 4MIBA 3ZNJ1 2GV1A 4ZIVA 5I4MA 3V6HA 2QA4G 1HYSA 4X4UA 1C0TA 1HHQA 5DDQC 3GONA 3R9LA 4LUBA 2HHWA 3W66A 5B09A 3D2WA 2LDIA 4K2XA 2GC8A 3S8SA 2R2UA 3V6DB 5BXIA 4CO5A 3MI7X 3FBEA 4JI0F 4K4TA 4WBFA 1PBAA 2YKOA 1CJUB 2XG8A 4R8UB 1Q8KA 1WNEA 3CE8A 5JXSA 4CM2A 1L3UA 3AQOA 5LMNF 2F7VA 4WYWA 1N56A 4TQRA 5A6WA 4DN0A 3Q2TC 4G1QA 3LP1A 3NGSA 4DS4A 2DO0A 4K4YA 1RT4B 2IVFB 4FYYB 1MMDA 1WORA 4LF5J 3MR6A 3CCUS 3IG1A 4I6AA 2MGZA 1JJ2R 2E9TA 1WOPA 2F4VJ 2K1RA 2AU0A 3GJRB 4WIQA 3PTWA 2XCPA 2BOPA 2E5LJ 3HK2A 3GIRA 4M8LA 4XDDA 1FKAF 5K9FA 1VISA 1NDKA 2YX1A 1RT7A 2IDLA 4PYDA 3HSZA 3R5BA 1QDUB 3DNCA 4MYUA 2PEBA 3FFIB 2VG6A 5KFTA 4MIAA 1SPBP 3PXGa 2WBRA 2HLUA 3Q8VA 5CZXA 3KUGA 5GADU 3GG0A 4Y34A 2CNNB 2HBRB 2V6AA 4PXDA 3T6BA 3LUYA 2HFUA 1UKUA 4B9MA 2PMZD 3IAM9 3OQ2A 2ZM6J 2P2CB 2PIIA 5B7WA 4N5SA 5LJ3Y 1FWPA 2CFXA 1HBNA 3EJMA 2FLNA 1RHMB 2CPYA 4DV4F 2B3TB 1T02A 3LGHA 4QU7A 2HFSA 2C2ZB 2PFDA 2JSXA 4OMFG 3I9V9 2V8HA 1I94J 5HLFB 1BQMB 2MTLA 2NSBA 4YQWA 2RHQB 2R7TA 3IR5B 1XC9A 2W2NP 3ELHA 4KHPJ 4W90B 3M32B 2V34A 3BGOP 3JS9A 4OYAA 5J2QB 3EDQB 4DR2J 3OTCA 2KHDA 1S9EA 2MZTA 1CQMA 3U02A 1UVLA 1DLOA 3VVTA 1L3KA 3FBFA 5K5MA 3I0RB 4PPZA 1AT1B 2QO3A 1FEEA 2VDHA 4TKTA 2ZHBA 1IR2A 4JI5F 1T95A 2HEKA 1HI1A 1DRZA 2PI4A 3DRPA 3KG0A 3QWUA 1H38A 4ZVRB 2L3MA 1VQ8S 1AFIA 3GV7B 3G8SA 1KFSA 2YNFA 1NU4A 2ZH1A 2VJVA 1C2PA 4K4WA 3L7PA 3K58A 3R97A 3DFEA 1ZM2A 4KV8B 1WACA 3FUYA 4DV2J 2YQ1A 2OI2A 1S99A 2MZJA 2D3UA 4BLGA 3L95X 4GVLA 4NZ6A 3PX0A 1XNQJ 4DPTA 5G4DA 1IKWA 4RW7A 1REVA 3T6JA 1S1VA 4QR2A 3M8SA 3NWRA 1VFJA 1N88A 1Z1ZA 2ILZA 4WU2A 2UXDF 1KEKA 1Y5LB 3FKBA 5IQQA 2BRLA 4ECRA 1U0SA 4K5SA 2B5JA 2WBMA 4PWDB 2HHUA 4DV1F 5DM6Q 3LQVA 3CF5Q 4CTAB 3D0HE 4U7CA 1IM6A 2C22A 2QLXA 2UU9F 3EXYA 3CCRS 2GNKA 2HMIB 3KK1B 1U4BA 1Q5YA 1C1CA 4A8FA 4QCLA 1WKKA 1YJ7A 5HMWA 1BUXA 5H1SV 4ECTA 3BN4A 3TA1A 4KBIA 1GFWB 3VALA 2YKNB 3M8WA 3T1YF 4LSNB 5KFOA 3L7OA 4DG1A 2Z30B 2HS3A 3NAIA 4KE5A 1XN9A 4ED2A 2RF2B 2XYHB 4RWWA 3MM7A 3V4IB 2OHDA 3QO9B 2R7UA 5ADZA 4PUOB 2AEJA 1U24A 4K4XA 4F4KA 4ZP6A 1UL3A 1HQUA 4DF8A 3B6BA 3RBXA 4NCGA 5EWEA 3WC2A 5IZHA 4I4BA 5DGBA 3M2RA 4IG3B 3OT9A 4U7UK 3LAKA 5D4OA 1T05B 5KFCA 2BJDA 3VV2B 1UPMB 2ZVSA 3D67A 3OTOJ 3M05A 4BBYA 2D9OA 3H2LA 3GIJA 1D9DA 3K8VA 1V3RA 2MMYA 2YNGB 3IRXA 3MTKA 5L9XA 2XO7A 3DI6A 1HARA 4KO0B 4DX6A 2DHAA 5EWFA 2D69A 1SH2A 3TWZA 1HNWF 3UI3A 4FS2A 2IY5B 1OYDA 4LSZB 3SSRA 2DRBA 5AE2A 5F3ZA 2KJVA 2JOQA 4MKVA 5FDLA 3PO4A 4ILRA 2ZOFA 3R1HA 1FERA 2R8IA 2HHTA 3OTBA 3TYTA 1UFWA 3M2UB 3RG6A 3D7SB 3AA9A 1PYSB 2A18A 4QYRA 3ULHA 2W2QP 4QIEA 2VPZB 3JQJA 3DC2A 2OJ3A 3HHLC 2V4QA 4RPFA 1AYEA 2EK6A 4G1QB 5F9NA 3LP1B 1U6FA 4LRAA 2OPRB 3ZTPA 4C4WA 3BYPA 4OYZA 2CDQA 4ZPCA 1H7WA 2OMLA 5LSLA 3FEZA 4O3SA 3IG1B 4K7QA 2OPSB 3M8PA 4EEYA 1ZYQA 3IAS9 3DOMB 4OJ1A 5I3QA 5GAGI 1N48A 4ZOSA 2P9CA 3TANA 5E3AA 1SI9A 1KR4A 3FNNA 4JI1J 1RT7B 3I31A 4XK8C 4CT9A 3BO2A 1LWEA 3M6WA 3BSNA 4G65A 4R0EA 2I5JB 5F0UA 2VG6B 4DR6F 1R0CB 1UZHA 4IRKA 2GVZA 3H59A 3PFOA 4DR1F 5E0OA 4K4UA 1T0TV 3R6LB 2YVSA 4C0BA 4AFFA 4TU9A 3LALA 1H2TZ 5AE3A 1VQNS 2CXEA 4NLDA 3TP2A 4DQPA 2RD5C 3QZ7A 4CQ1A 2HFZA 3TOQA 3Q24A 2PD1A 3P5TL 2HVHA 1VS3A 1N6QB 2DR5A 3SCLE 2EK1A 4N41A 3RRKA 1WC4A 6FDRA 1IQTA 2FHJD 1E6YB 4R25A 2VB6A 4RBTA 5CD4A 3Q2SC 3GCXP 4DV3F 5BYSA 4AQYF 2ASLA 1VBZA 5AXNA 2FHOB 2XLKA 2V69A 3SBMA 4JI4F 3C2PA 3OXGA 1U2CA 1V9OA 1EP4B 1FNOA 1S9EB 2JJ4D 2YKMB 1B7FA 4X4RA 1YK9A 2MQ8A 5GMKa 4NLUA 1JLFA 3BDPA 3KLHB 1TFWA 1IKVB 2IVYA 4J9VA 2V2ZA 1YLXA 1DTQA 3DM2A 4KRWA 2DY9A 1G6BA 2AD9A 4F0HA 5HP1A 2KO1A 1MWZA 1IBLJ 2V2QA 5A2QY 1S4EA 3DRPB 2C2EA 3BSOA 3VAMA 4Z37A 4O3NA 2QJ3A 2P8IA 4FF4A 1JB0C 1TQLA 3W1YC 2CRLA 3CJSA 1N0UA 3C19A 1UJ5A 2YNFB 2B4OA 1JLGA 5M2RA 5KFPA 1GK8A 2DK2A 4KIAA 4UUWA 2W2PP 4LF4F 2E1AA 1S57A 1KRPA 4AUKA 1F2GA 3WHIA 5L8RC 4JI8F 2QMXA 1MMNA 4FVCA 3N4WA 5LOQA 2M0GB 1D8ZA 2Z57B 1OWXA 2VBWA 1IKWB 4OZ1A 1REVB 2B9WA 1VRTA 1SUQA 3DHXA 3UW1A 3JSYA 1S1VB 1Q78A 4NLOA 4ZN3A 2RVJA 2MSTA 1TUGB 3QFWA 4LBHA 4L73A 4C8YA 3GYGA 1O6XA 4FKXA 1CEZA 3TR5A 4OJGA 2LQ9A 4ED6A 3DMJA 1HBOA 1R31A 2LLZA 3Q89A 4P73A 3JSMB 1WG1A 4MMOA 4OYXA 4CO3A 3JB9k 1JKHA 2YY3A 3DLEA 4QIVA 1C1CB 2QFIA 2R7QA 3TZYA 3GB0A 3PEJA 4A46A 2DNZA 1I51B 5HROA 4DPOA 4QR0A 4DG1B 3TQEA 2MJUA 5CD4H 2GIFA 4PABA 2F40A 3MPDA 2N7CA 2LQ5A 4Y00A 5JJBA 1XNRJ 3AOCA 1VC6A 4B9TA 4PYAA 3PW4A 2HHHJ 2BQUA 2AT1B 3SV3A 2XB2D 4FN5A 3NG8A 3IWXA 1IWAA 3SCIE 1FKOA 3RAXA 4KAIA 2QL5B 3M2RB 4NLGA 3I5CA 4OYPA 1X9SA 3WQPA 3EPGA 5E3QA 1VMBA 1KFDA 4DN9A 1RTZA 2DNYA 3FEYB 1GXUA 2RU3A 4CLPA 1M5PC 4F4YA 1S12A 3I4PA 2UUBF 4LQ3A 1FD2A 3EICA 4OJHA 4CLTA 1K47A 3VWSA 2KJWA 2B0GA 2MQQA 3FDSA 4FXDA 3J7YU 2ILYA 2WSEC 1EX8A 3QJLA 5E3RA 2CZVC 2Z4PA 3FJ2A 3T3FA 2XNRA 1PC4A 5JUMA 2WTFA 4C8KA 1N52B 5F8HA 2RDIA 1DQAA 2OKQA 4ECQA 1S77D 2CPEA 3ENQA 4B3MF 1KVIA 4QOTA 1NZAA 2BDPA 5AJ3F 1YIJS 1HMVA 4OX6A 2IDEA 1IM4A 2A3JA 2ZBPA 5KFSA 1LW2A 3GV8B 4KC5A 1KQSR 2F4FA 2KT5A 2GIQA 3NBPA 1KONA 2APOA 2KYZA 3KOAA 4EYHB 2R4FA 1S7HA 1RZMA 3R5AA 4O3OA 2ZWPA 4L72B 1FT8A 3W9HA 1LKZA 1VQYA 1KDNA 3MHYA 2XHWA 4FYXB 1LK5A 4ZHRA 3TI0A 3M8PB 5I42B 3TW0A 5D3GA 3OUYA 4JI3F 2W1BA 3BKUA 4QIFA 3NMRA 1RISA 2RQ4A 5J1EA 1PBUA 3FBBA 2ZBQA 3BSAA 2NXNA 1IJEB 4DSEA 3C14B 2DB1A 4QU6A 2FUG9 4TLQA 4M5HA 2QT7A 2ATLA 2CJBA 1R89A 3FBCA 3W60A 1RHRB 2DCUB 4NXMF 1CJTB 5JVGQ 1UP1A 1LWEB 3LANA 1CSJA 4C6AA 2VZ9A 4EU0A 3SCJE 5F9LA 3BDEA 4C98A 2GVZB 3EMTA 5CYMA 4P71A 4WK1A 1ZZNA 1YJWS 1WC6A 4Y0FA 4WFYA 9RUBA 2BUNA 3N6MA 3T19A 3VTIA 1IBCB 1SC1B 1K8AT 4WTYA 3TX8A 3ZNUA 1JXEA 3KDOA 2H65B 2WONA 3CCZA 1RBAA 3K7RA 3MEDA 2B56A 3BQ0A 2V68A 3O44A 2F5GA 2FHMA 4O4GB 3BH6B 2Z2ZA 1BD6A 1SJ4P 1UEVA 1MN7A 5B0EA 3SSQA 2EFQA 1ZM3A 2G0IA 3HMJG 3QT7A 3CD5A 2YPYA 2VIHA 3KHLA 1BXNA 3RRHA 1CS4A 1GTHA 1H72C 3PCOB 1HHTP 4C9DA 2C3OA 2P9GA 4ZK7M 2RE1A 2HHVA 3I87A 4DUZJ 2HGMA 1HNZF 1JLFB 3CC2S 3KK2A 2VL1A 3W8GA 5DZ7A 4NCBA 3TVKA 2ZBCA 3NXZA 3D1OA 1DTQB 3DM2B 2YH0A 2H51B 5K8OA 4H4MA 3BR8A 2R2RA 2NREA 5HP1B 3CPWR 3GP9A 2EBEA 1U8SA 2X1GA 3NNCA 2MQLA 3OXFA 4HH1A 1OS5A 1YBAA 1VQKS 4NZ7A 1Q7LB 2RRNA 1KVJA 3W5XA 1WEXA 1X5OA 2DGVA 1TUWA 2N3LA 1LEOA 3TUZC 4LSLB 4X65F 2W2MP 2XULA 4YDXA 2DTJA 4ED4A 3L7UA 4LF5F 3R5DA 2LDYA 3N01A 4DUYF 4DJBA 2ZKTA 4FZVA 1YRXA 2I1RA 4P52A 4U7UD 1NXIA 3MCSA 5LSOA 2RKIA 2DNGA 1QE1B 1P1LA 2HAFA 2L41A 1FFWB 2I8EA 2WAQD 2X7IA 4Q8EA 3R8YA 4O4RA 4OQJA 3M8QA 2D74B 2C2DA 3DMJB 1HBOB 5L39A 5JVHQ 4KFBA 1RAEB 3I0SB 3ENWA 3NOCA 1T11A 1JKHB 2FC9A 3MM9B 4DL4A 1K9MT 1HWUA 1F5BA 2DXDA 4FXWA 2PGCA 3CDEA 2KVIA 3PG9A 2K2PA
chains in the Genus database with same CATH topology
5EGYA 2WOMA 1QE1A 5CQGA 1N0VC 2W9AA 1TZ0A 4NX9A 2MQMA 1XR7A 4NA1A 3H98A 5IXUA 5FLXY 1EETB 2I0XA 1C4CA 2KXHA 2MPUA 4OX8A 4PWUA 1FRKA 4C8MA 3U27A 2ZM6F 3O8WA 5HROB 5D6GA 1ZOTA 4MYTA 4QWDA 1YQHA 4B3SF 5KFWA 4C11B 2DPJA 1LFWA 4MFBB 5J2QA 1LXJA 3QGGA 3F73A 3MUVP 2XS5A 1IKXB 3OTEA 4ERDA 4Y2AA 3UDCA 3DOLA 3KLIB 2N3OA 4ZPBA 4EFAC 2FVSA 2JDJA 1N5TA 4N56A 4KQZA 2B6AB 3KK3B 1T7PA 4I67A 3CMES 5E3CA 3OV7A 3I0SA 3SXLA 1E6VA 3SDEB 4C3KA 5CXTA 4ZPVR 2AGQA 4MK8A 2R8JA 1S0VA 1OPZA 3RZAA 4DFMA 1T03B 1KLMB 3US5A 2C3PA 1OSCA 1RA6A 3I0RA 3MM9A 5KFYA 3M8RA 4DL7A 2OPQA 3M2VB 2UUWA 4K50A 2DO4A 2AJ1A 1XBWA 2YTCA 4ICLB 2RU9A 2N7YA 2CQHA 3DRXA 4F25A 1JIHA 1RT5A 2JL9A 3LF0A 4I7FB 3H5XA 2KM8B 1U49A 2J8AA 2HS4A 5J2MB 1RI7A 1SC6A 4Y2CA 4ZKAA 5A8KB 3VAGA 3VAHA 2MZSA 4B9LA 1JWWA 2VC1A 1Z4UA 4QJVA 3MEKA 4URQU 2Y1RI 2QA2A 2J0QD 4OHWA 1EETA 5KFNA 3BO3A 3OFEA 4M94A 5F8GA 4YB7A 4CO0A 4QWCA 1F0XA 2QIFA 4MK9A 4OFZA 4ZVFA 1QVFR 1FXDA 1G2EA 2WSFC 1RT6A 3C6UB 1ZM9A 4DR2F 3T9ZA 3M6VA 3G9CA 2GGPB 4C11A 4TY9A 2RRAA 2M4MA 2XGPA 1OO0B 2GHVC 2PA3A 2NSCA 3HZEA 5F0WA 3IA0A 4DMZA 2FC8A 4F67A 4JV5F 3GV5B 1X9MA 2HHSA 1ULRA 2FJDB 1Q8LA 3KLIA 5I3UB 1U6BA 1JX4A 2B6AA 2LU2A 4BWJA 3NP5A 3G96A 2KZZA 3IO1A 3EZUA 3SDEA 2EKYA 3OJUA 1S0NA 2PEHA 3N9UC 4OLPA 1T03A 1U45A 1F9FA 4KHRA 5DLGA 2VKRA 3OR2B 5CH7B 4ICLA 3M9OB 1HD1A 2Z8QA 2YNIB 4FVMA 1YJNS 2MXYA 3HP6A 3QMQA 1P6TA 4I7FA 3H20A 4UUXA 5J2MA 5A8KA 4JI6F 2MKSA 1UA1A 3CEDA 3O2IA 2DT9A 3SQGB 4RBUA 3I56S 2IRYA 2HGLA 5B0CA 3SV4A 3SEOA 4OI0A 2OO4A 4NXNF 1FCAA 2RUGA 1QSLA 2CVEA 5B0GA 3VQSA 2CVIA 3X3UA 1DJ0A 2DVIA 3KG1A 1DQ9A 2ZH9A 2OIHA 4PG5A 2DGTA 3I4HX 1X5SA 2GGPA 3OSPA 2DBBA 2HRYA 3ICLA 3MM8B 2OTLS 4X4VA 3AA8A 4OHVA 4LVNP 3BN7A 4N8NA 4NLYA 2VPYB 5ITHA 2W7AA 4U6PA 1FKPA 1C4AA 2L9WA 2XY7A 3R3TA 1DBDA 2C2RA 2ZE2A 3TVZA 5I3UA 2AYEA 1S97A 3OSNA 1NKEA 2BANB 4X66F 4NYZA 1HNIB 2ROEA 3MEGB 3DOKB 3CSKA 4WFNQ 4JV2A 2RS8A 4EBEA 2IAJB 1TK8A 5H9FJ 1VRUB 4KT0C 3WDOA 2LA4A 5F3TA 5IT0A 3MEEB 1JLQB 2AYMA 3C46A 4PWDA 4M63A 2E7WA 4DV2F 2V8DA 1UVNA 4ZP8A 3OL8A 4IFVB 1S1TA 2CQIA 3OR2A 4CTAA 2UZAA 5DG9A 2YNIA 5KFDA 1SQEA 3ZZRA 2XMTA 4A4JA 4C3LA 3PZPA 3CJ4A 5FD1A 4F8RA 4OHYA 2KTQA 3MZIA 2DHSA 4QIWD 2QE5A 4ELUA 3SQGA 4FF3A 1WD6A 4PR6A 3MF5A 2M8DB 4WFAQ 3NGKA 4TXSA 4DX8H 2UV8G 4O23A 3N0VA 4MIWA 2KU7A 4LFAF 4FNHA 2FJWA 3QLHB 3Q8SB 2CYYA 3H8YA 3UQSA 4ECXA 2BABA 3MFHA 3KK1A 1Q4RA 2C42A 2CQ0A 5DGAA 2UUCF 2ZOMA 2VOOA 2XI3A 2LQJA 3E3XA 1XTZA 3D0GE 3CVKA 2HQ3A 3BJYA 3GFXA 3UCUP 1NHUA 5LL6d 4WXWA 1Q81T 4IOAQ 1BQXA 4TN2A 2PO4A 4X4PA 2VASA 2W9CA 1RT3B 3FVYA 2CPDA 3DLLQ 5F8NA 5D4PA 2BANA 3LGNA 3CWJA 4Y2KA 4HT5A 3Q8PB 3KHRA 1HNIA 2CPFA 3QAEA 1FNMA 1HD0A 3CD7A 2MHNA 3MEGA 3CJKB 3CCQS 2FJAB 1QY7A 2IAJA 2YKNA 3NBPB 1VQPS 5LT5A 4Q45A 2J5AA 2NPIA 3CJ5A 2CQ1A 3MUTP 4IYQA 1M5SA 3MEEA 1JLQA 4HKQA 3MMCB 4CH7A 4Y3CA 3TA0A 4IFVA 3PEHA 5KTQA 1TK5A 1YJVA 3UPFA 2GHPA 4TYAA 2JEJA 4KPYA 2RSQA 2B4UA 2W4DA 2AJ4A 2WCXA 5EX3A 1KQKA 2RIJA 2IBOA 3PRDA 4F50A 1Q79A 2M7SA 3ETOA 2BA9A 4PKDB 4OZJA 4DLEA 3G4SS 1QSYA 4ETXA 1H0HB 3E8OA 4NMLA 2KM8C 2ZH7A 2UUTA 5E41A 1AUDA 1UJ4A 3D0IE 2LU1A 2M88A 5KFMA 3V4IA 2D3ZA 4EBDA 1K0TA 1CG2A 3MGJA 2FIUA 2M9KA 1JLAB 2HFOA 3QLHA 1SBRA 1HWJA 3ZZYA 4N47A 3KHHA 5FJ4A 5M2PA 3GMGA 2BM1A 1VC0A 4CO2A 1HQEB 4YUDA 3O1LA 4G3IA 2X1FA 1FD8A 2E7XA 1RT3A 2PC6A 1FTCA 5A8RB 1S76D 3JTPA 3RB6A 1TVRB 1FE4A 3VF0B 1MNEA 3CJKA 2HNDB 4NYOA 2ABYA 4A8SA 4NLWA 1R43A 1L3SA 2X1AA 4RWXA 4PRFA 5J1NA 2UVVA 4IG3A 3MMCA 2Z0GA 2KFYA 4E8UA 4EYIB 3AB4B 5B0BA 2IMOA 4JOUA 3UCGA 1Y0HA 4X64F 3KLVA 2R7RA 5C25B 1NH8A 3H4BA 3J7Z5 1T05A 1YWXA 2FD2A 2LMIA 2O66A 2P6TA 5DDPC 2DIVA 2KN4A 2FVRA 1S6PA 2W9BB 1HYSB 1VQ9S 3RR8A 5IT9Y 4WYLA 2COLA 2VC0A 3PW7A 2X1BA 1C0TB 3HHLD 1H7XA 2L9DA 4LT6A 3Q8QB 3OW2R 3K0JA 2C28A 2FB0A 4C7QA 2J0XA 5CCLA 3RTVA 2YNHB 2OSQA 4ZCIA 3CJ0A 3GFYA 5A0YB 3PM9A 3HI9A 5HL7Q 3BS9A 2HW3A 2K3IA 4ED8A 3CDWA 1XWLA 2P6SA 2ZDOA 2NXUA 4CO4A 4GC6A 4FPRA 5DS7A 2E9RX 1HQEA 1GT8A 4CH0S 2XWYA 3TAPA 3HJFA 1S6UA 4KO0A 3MPWA 4NLVA 2BM0A 3IC1A 3T9NA 2ZJRQ 1JJ4A 2E5JA 1H2VZ 1U2RA 2JFKA 1FRMA 2GQCA 4P7VA 4C8LA 1VJWA 2BYCA 2XNQA 2XS7A 3LO3A 4ECYA 4X84A 2F1FA 2HNDA 3DRYA 2CPZA 4RNNA 4UY8T 3MOJB 3MEDB 1YSJA 1VLYA 1NAQA 2AX0A 2WSCC 1IKYB 3PACA 4DFKA 1FJEB 2PA8D 1U1MA 4RW9B 1X8DA 3MMBB 3IRWP 1PC5A 4IO9Q 1LXNA 2BE2A 4IQXA 1HWKA 4MIBA 5C25A 5K14A 2GV1A 3CD6S 3NL0A 3DGPA 5I4MA 1NKBA 3MUMP 3V6HA 2QA4G 1HYSA 5DQHA 5HQ8A 2J9CA 4X4UA 2DGUA 4NLRA 1C0TA 1SJQA 3EZ5A 5GAEI 4WZQA 2YNHA 1S49A 5DDQC 4IG0B 1R27B 1SH3A 3T1HF 3KYLA 3PIOQ 4LUBA 2HHWA 3UR0A 5B09A 3D2WA 2KG0A 4C97A 2IRXA 2LDIA 4UQGA 4EO8A 2VUGA 4K2XA 4J9NA 3HHNB 2GC8A 4TY8B 3PW0A 1Z2ZA 3S8SA 2R2UA 2VD3A 4DR5F 5HBMB 4NLQA 2QSWA 3GR1A 2XGQA 3V6DB 2MGZB 2HAIA 4CO5A 3MI7X 2V94A 5DO2A 4JI0F 2CPXA 2HHPA 3PRBA 4ZPTR 1WI6A 5C5JA 4K4TA 4C8OA 1APSA 3LP2A 1QSSA 2YKOA 4NLPA 2QRRA 4RUHA 5K8NA 2XG8A 2K1RB 4R8UB 2BJEA 2PDAA 1WNEA 3CE8A 5D77A 1IKYA 5JXSA 3BO4A 1O51A 3AQOA 5KFIA 4RW9A 5LMNF 1L3UA 3BF4A 1U1QA 4B3RF 1FDDA 2DNRA 1Z2LA 2IYGA 2E66A 1H98A 2DITA 1CC8A 1YJRA 2F7VA 3O3LA 4WYWA 4TQRA 1N56A 2L9NA 4X4OA 5A6WA 4MKBA 1HPZB 1LWFA 3CT9A 4DN0A 3EGZA 3Q2TC 3HXMA 4IOCQ 1LV5A 4G1QA 1GH8A 3LP1A 2MJNA 3BGLA 4JV0A 5CZVA 2E1CA 4DS4A 2DO0A 1MSWD 1RTIB 2CG4A 3KLEA 4K4YA 1LOUA 4H4MB 1RT4B 1QAIA 5LXYA 1XMQF 2XY5A 2CQBA 2IVFB 1FTRA 3E01B 1TKDA 1Q8BA 1MMDA 4DS5A 3BREA 1WEYA 1X4DA 1TK0A 3NRBA 2YKAA 3CDUA 4PXCA 4WKYA 3MR6A 3CCUS 4TY8A 3IG1A 3OL7A 5J2PA 4ZLPA 1VK8A 4I6AA 2XEXA 5HBMA 3V6DA 1CC7A 2MGZA 1JLCA 2VFTA 3R5CA 5U47A 5KFAA 4DV5F 1JJ2R 2E9TA 4MK7A 5DQIA 2YQ3A 5MLCV 5DDOC 4QR1A 2DRAA 4XPCA 2K1RA 4I2QB 2RQCA 4X2BA 4R8UA 5F8MA 5B0DA 3MM5B 2ZH2A 4ZCMA 2AU0A 3K5NA 1R8CA 1KD1T 3DYAA 1SL1A 1RDRA 3TQ1A 2VODA 3G8TA 4XO0A 3KLFB 1QTMA 3JSRA 3OR1A 5F8JA 2XCPA 4WIIA 2BOPA 2NR0A 2K7KA 4WFBQ 3K59A 3LH2S 2JWNA 1BGXT 1HPZA 2NUUG 1YRTA 4NLSA 1QJHA 4M8LA 3HK2A 4DR7F 1S9GB 1FRIA 1Y4ZB 3T5LA 2Q1LA 2OFGX 4ES1A 4XDDA 2CIMA 1P1TA 1FKAF 2HS0A 5K9FA 1HBNB 2YX1A 1RTIA 1RT7A 4PG7A 3FZ2A 3RB4A 4ZVEA 1RT4A 5T14A 2ZNYA 2I38A 4U9RA 4BWMA 3M30B 3R5BA 1FRXA 3LAMA 5IWAF 3E01A 2VKZG 3TA2A 2V8GA 3DNCA 5BR8F 4MYUA 3U1MA 1KQGB 4OV1A 4DEZA 1B0VA 3FFIB 3TUJC 2DNHA 2VG6A 5KFTA 4DSJA 1FK9A 4LF9F 2HRUA 4B02A 4MIAA 3PXGa 5HO4A 3U1LA 2WBRA 3TO8A 2HLUA 3N28A 4Q43A 1URRA 5CZXA 1XK8A 2EW9A 2D7SA 5KFKA 5GADU 2DNNA 2LEAA 3GG0A 4ED5A 2ZZNA 4WK3A 2CJ9A 4Y34A 1VK3A 2J0WA 4PXDA 4I2QA 1GXLA 3T6BA 3ZZ0A 3MM5A 2R7SA 2BV3A 2K3KA 2IMWP 3LUYA 2ZC3A 1UKUA 4B9MA 2PMZD 5DQGA 5F41A 3MMJA 1HW8A 4WJBA 2XMWA 3IAM9 3IXQA 3OQ2A 4QIGA 2XMJA 2VFRA 3RU0A 3KLFA 1K73T 3AJ2A 4NLXA 4XDCA 1RT2B 1S10A 2PIIA 1CLFA 1SJ3P 3PIPQ 5AE1A 2AW0A 5B7WA 1S9GA 1RKIA 4RBVA 5LJ3Y 4N5SA 2CFXA 1HBNA 1TL5A 1SKRA 3KJVB 1XEZA 2FLNA 3HM9A 3MURP 2CPYA 2NS1B 4DV4F 2B3TB 3M30A 4WKRA 1T02A 4KFBB 5LJ5Y 4RNHA 1DLOB 4QU7A 3AQPA 3FFIA 2KFZA 2JSXA 2VG5A 4OMFG 3I9V9 2DH7A 5BJRA 3C66A 3RB0A 5EUHA 1UMJA 2V8HA 5HLFB 4B9UA 2F4VF 1D9FA 3ZFVA 4YEAA 1BQMB 4Q2LA 2NSBA 2RRBA 3BM7A 1M5HA 4YQWA 1NK0A 4MKYA 7FDRA 2ACYA 1VQMS 4O3QA 2R7TA 3EYZA 2H5EA 3IR5B 3RW7A 1FDBA 2L48A 1XC9A 4W90B 4NRUA 4O44A 2BQRA 3M32B 4OZNA 2P9EA 2E5LF 2KRRA 3QJJA 2B43A 2LVWA 4NA3A 5E7OB 1RT2A 3CULA 3H5YA 2RJZA 5J2QB 4ZCKA 1ZH5A 3OTCA 2KHDA 4IRDA 1S9EA 4X4NA 4YOEA 1N5YA 3DOLB 3KJVA 2MZTA 4NLTA 4DWIA 1CQMA 4OZ5A 2XI2A 3U02A 1YI2S 1UVLA 4OZ0A 4P6QA 1TAUA 3CGIA 1DLOA 2KXFA 3BB5A 1L3KA 1FHTA 2JLFA 5K5MA 4A8YA 3I0RB 4PPZA 5SZTA 2QO3A 4HI2A 2HWIA 1VQLS 3SFUA 1FEEA 5D78A 4TKTA 2FDNA 3ITHA 3QIDA 4OLOA 1Q86T 1NJIT 4O3RA 4QBUA 5MAOA 2ZHBA 1BQMA 3MPYA 4JI5F 2PMHA 1T95A 4PXBA 4TLRA 2DH9A 2XC9A 1Q7YT 2FVQA 2F9DA 3HZGA 1HI1A 4ZA1A 5THWA 2ZH3A 5KFRA 2MQNA 2ALZA 2W8LA 1DTTA 1DRZA 2PI4A 2R7WA 1N32F 3DRPA 3DU5A 3KG0A 1U2FA 1UFLA 3QWUA 1S6QB 3ISND 3M32A 4NZ0A 1H38A 2CJKA 2OD4A 2U1AA 1F5CA 5L38A 1RT6B 4RW7B 2OAUA 3DXSX 1JK9B 2C3UA 2L3MA 1M5VC 3P6YC 2QA4S 1VQ8S 2VQEF 2IBKA 2WB1D 1AFIA 2K7JA 4F2RA 3KLEB 3GV7B 3MFIA 1TL3A 2BXJA 3G8SA 5KG3A 2PSZA 5KFFA 1KFSA 1KOHA 2YNFA 1B64A 1NU4A 4OX7A 1FRJA 5B0FA 5I3PA 2ZH1A 4K4ZA 4QW9A 1WF1A 1URNA 1C2PA 3K5PA 1FA0A 2AP6A 5AXMA 1G1XA 2B5JB 5GAEU 3I55S 1BQNB 1I94F 2CQDA 4DSIA 4WFZA 1YVFA 2JEFA 4K4WA 2VOPA 2O67A 3AH6A 3L7PA 2JC0A 3DLHA 3K58A 2OLWA 1ZM2A 3DFEA 1Y5IB 4KV8B 3H40A 2DNLA 1WACA 1Y00A 1QUVA 2W7PA 5B08A 2JFDA 4I6WA 4DFPA 4OI6A 3M1VB 4XAKA 4CNZA 1S99A 1YITS 1IN0A 2MZJA 2D3UA 3DLGA 3L95X 1DHMA 2DGOA 4KHPF 5DJBA 4NZ6A 3PX0A 4YR2A 2QMWA 5GAGU 1L5UA 2VFUA 1YHQS 2P5VA 3C6TB 3MOZA 1S6QA 5G4DA 1S0OA 1IKWA 2ZITA 2D1CA 2DR7A 3NS6A 1T3OA 4RW7A 2O1PA 4IO1A 1S4FA 2MY7A 2XCAA 1REVA 2LCWA 4K5RA 3PFEA 4YB1P 3T6JA 4LF8F 1DAXA 3KKFA 1X4FA 4BS2A 3B4DA 1HA1A 1S1VA 4QR2A 1TAQA 1FKPB 3HDSA