3AJ1A

The structure of axcesd octamer (n-terminal his-tag) from acetobacter xylinum
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
151
structure length
151
Chain Sequence
KKPDFTLFLQTLSWEIDDQVGIEVRNELLREVGRGMGTRIMPPPCQTVDKLQIELNALLALIGWGTVTLELLSEDQSLRIVHENLPQVGSAGEPSGTWLAPVLEGLYGRWVTSQAGAFGDYVVTRDVDAEDLNAVPRQTIIMYMRVRSSAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Cellulose synthase operon protein D
publication title Structure of bacterial cellulose synthase subunit D octamer with four inner passageways
pubmed doi rcsb
source organism Acetobacter xylinus
total genus 42
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2010-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03500 Cellsynth_D Cellulose synthase subunit D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2590 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3aj1A02
3AJ2A 3A8EA 3AJ1A
chains in the Genus database with same CATH superfamily
4OIXA 3C19A 5D3GA 3HKZD 5EHHA 4TYAA 5JVGQ 1QY7A 4KE5A 3W62A 4X4TA 3SXLA 3NLCA 1ZAXA 2ZWOA 3BF4A 4YQWA 2GGPA 2LQ9A 2AQ4A 4RU9A 1FX2A 1Y5LB 3NNAA 4X64F 3HCXA 1UA1A 4A8FA 3LP0B 2YWFA 1KTVA 1IKWA 1QE1A 4LFAJ 1NXIA 3ILOA 3N0VA 1XQIA 4LUBA 2WONA 4A8KA 2M8HA 5KT5A 1U1OA 4J9NA 3RAMA 1WDTA 3DC2A 2DNYA 4CQ1A 5H1SV 2FVQA 4H4KC 2PI5A 3NCPA 1TL7A 2ATLA 4FXWA 2MQLA 1QAYA 5IT9Y 1FFGB 1S1WA 2C1EB 4UUWA 3T5JA 3VAHA 3SFGA 4Y0FA 1IKYA 3A3NB 5K20B 1FNOA 1P8GA 3EZ5A 2YNHB 1ELOA 4WK3A 5K8MA 2Z8QA 3A3PB 5JVHQ 4DCOB 3BDEA 2DKOB 4YEAA 3RBZA 2KT5A 3MAHA 4C2MA 1RTHA 2DNKA 4F4ZA 1Q5VA 3Q86A 1RZMA 4NRUA 1IR0A 2DNLA 2MYFA 4E98A 2GX8A 1NJIT 1MROB 4TU8A 2IM0A 5CQGA 3DMJA 2Z57B 2DR5A 3GCXP 3GB0A 2HVHA 1HBOA 3EWGA 4M1KA 2M7SA 2XWXA 2IVMA 4OI6A 1S1XA 3W7BA 1QE1B 2UZAA 2W2NP 2VFTA 4IH6A 5HJYA 1HNZJ 4ZCMA 4QR2A 3DU5A 1F9HA 1U24A 4J90A 1JJ4A 2QE5A 3I0SB 1B0TA 3MI7X 4LQ3A 2F8MA 2B9XA 4DV4F 3LO3A 1T03B 1FK9A 2F9JA 3CSKA 4WU2A 4F0KA 5KFJA 1FE0A 4PCQA 2K1RA 2ZUGA 1NBEB 1MMNA 1WOOA 3OXGA 5KG6A 2GW8A 3QWUA 3NGKA 3KJVA 2OJ3A 2NXCA 3MMCA 3IN5A 2QO3A 3PW4A 4FBTA 2IIHA 2V2ZA 2BKNA 3KNAA 2OAUA 2Y1RI 4F26A 2BYCA 1WC5A 1B70B 1E6YB 3OVBA 2DNQA 4DN9A 3KMQA 1S6UA 2FGOA 2MQNA 5CA5A 2UUBJ 4O3OA 4OZ5A 2Q6CA 1RBAA 3C6UA 4IG0A 1WDDA 4TQRA 2Y1JA 2AT1B 4A4JA 1X31C 4O0IA 1TMMA 1S7HA 4OI1A 3RRKA 1HBMB 3EM1A 1NZ8A 4ENOA 3A8EA 5ETPA 3TAQA 3PX6A 3BR9A 3THTA 3TP2A 3NGUA 3MPDA 4WFAQ 3HI9A 3J7ZT 1P1LA 3O3LA 1XMQJ 3V6DA 1X0FA 1QVGR 5B09A 2OPQB 5A8RA 3EUNA 3GYXB 2YWWA 2QJ3A 3UD5A 1YJNS 2LVWA 2W9AA 2P6TA 1IKXA 1TTHB 3IWNC 1UZHA 5DQHA 1NB2A 1RK8A 4N76A 2LEAA 2J0XA 3KJQB 4CNZA 2UV8A 2A1BA 3K8VA 2O3DA 1MLAA 3TI0A 2KVIA 2UXDF 1FXRA 3ET6B 2VA3A 3W61A 3M9MB 2VQFF 4DR2J 4CLZA 5FDLB 4CP5A 3JYTB 4LFCJ 5KOXA 2RE1A 3IO1A 3LAKA 4N8OA 3QJPA 3ETOA 2Q3PA 2PEHA 4TVAB 2VPWB 4DV5F 2V34A 1UJ4A 3OTBA 3HD1A 4D3HA 3K5PA 4DEZA 3OLAA 3KUEA 3KLIA 4OV6A 3TZXA 3FGVA 2AV5A 3CMQA 3QATA 2KN4A 3KHGA 3PY8A 2OUGA 2PC6A 1Y9OA 3A3OB 2VBWA 2B9YA 3LP2B 4Q8EA 4QWBA 1WF2A 1JXEA 1SUQA 2ZOMA 1ZZFA 4L74A 4X84A 2ROGA 2KG1A 3PYFA 2J7WA 2MHNA 1BWVA 3QLHB 3SQGB 2HNYA 3MFIA 1CJVA 4J9MA 1ZM3A 3MEDA 7FD1A 3UE2A 4EBEA 5DETA 2A18A 1JQGA 3H2UB 3K89A 2BKPA 3FBCA 1HWJA 5LMNF 3P3DA 3IBFB 3FDSA 1B7FA 4H4KA 4NA2A 1LW2B 1FKOB 4LF9J 3FUYA 1UPPA 1JLBA 3A8IA 4NEYA 1FF2A 4JI5F 2NSBA 2Q79A 2VG6A 4ECSA 3PHEA 2M70A 1RU1A 4DV0F 3A12A 2XNRA 2DCLA 1NM2A 5ETVA 3PFOA 1OJ4A 3QWPA 4YOEA 1Q82T 3G96A 2B51A 3KLGA 3HSJA 4O4GA 4DOZA 5HROA 3I55S 3LUYA 1FJ7A 2OMOA 1FRHA 4LF1A 2JEGA 5HVFA 3SCLE 4NXNJ 4PABA 2FHJD 1CS4A 5LSRA 3E2EA 2CPYA 2HW3A 1CJVB 5J2PB 4V1Ak 3HHKA 3PR4A 3MEDB 2HNDA 1TUWA 5HO4A 1KRPA 2DGWA 5H9EK 3BR8A 2WOMA 1JJ2R 4OX9F 1X4GA 3K2YA 4QWCA 4ZJOA 1M1KT 1KBRA 1VQKS 1QVFR 2F63A 1JLAA 4X65J 2CWKA 2GJ2A 1BMQB 2H9ZA 1GH8A 1XR6A 4Q44A 3IA0A 3AH6A 2PD1A 1VBKA 1S97A 1FERA 2WVDA 3AODA 1O6XA 2W9CA 2VH7A 2MQPA 4MIWA 2B4UA 5A6WA 1NK9A 4QJVA 2JX2A 3TX0A 4O4GB 1C1CB 1FJGJ 3VAFA 5AXKA 1IWAA 1LOUA 1S1UA 5KFDA 1QDUB 4QYZJ 3VZIA 1WI6A 2DD8S 3K17A 2QLBB 4DQRA 2YKMA 3MCMA 3DNCA 4QZVB 4ECXA 4IRCA 2AEJA 1X5TA 1S79A 2DNOA 3GIJA 1OY8A 2Q6BA 1N33J 3QSYB 1WF1A 5L38A 2HVIA 4F02A 3BN7A 1KFDA 1YZ6A 1HWKA 1NDKA 2YKNA 5E3CA 2FDNA 1XN9A 4N7TA 3RR7A 2LXFA 1QD1A 2ZC4A 3NXZA 5KFWA 1WC0A 2W9CB 1TKZB 4WJBA 2MZ1A 2VQEJ 4NLUA 1RTJB 1Z2LA 1BQMA 3NMAA 2R2RA 2B8PA 1OPZA 4OHXA 3DM2B 2GA7A 3J80U 3X1LB 2RF2B 4ECZA 2ERRA 3RZAA 2WRMA 1K8AT 1BHNA 1S0NA 2A0FB 1OIAA 4L73A 2I8EA 2J8AA 2B8QA 5A8KB 4B3TF 1RAGB 5L1LA 4NEZA 2MZTA 2ZEJA 2I9SA 4J9RA 3IFEA 3OFGA 3IG1A 5DS7A 4NPOA 1FDNA 4N47A 2VC0A 4QR0A 3CD5A 2CPJA 4NI2B 4G3IA 2IVYA 2AD9A 1N5TA 2C2NA 3KLVA 1U8WA 4OI2A 3NAIA 4CO0A 3UN2A 2B4OA 1N48A 4LRCA 2D1CA 2NXUA 4U7UD 3DLKA 3AQOA 4FPIA 1F5AA 4Y00A 3UR0A 4KJIA 2AX1A 4MAKA 1VQ7S 5CH7B 1R0BG 1FT8A 2ZBCA 2E29A 2EKYA 1YIJS 2Z56B 3CGIA 1N5QA 4ALZA 2CPIA 4FN5A 1WKKA 1IBKF 1LV5A 1TZ0A 1P9YA 1UL3A 2C42A 2IC3B 3Q23A 8AT1B 4F7VA 3I82A 4IFVA 3UR3C 1SI9A 2W1BA 3GG1A 3WC0A 4L3KA 3ILIA 1U0HA 1WELA 3MCOA 3W5ZA 3Q8RB 4FYYB 3GV8B 3OFHA 3SCIE 3CCVS 2POKA 3GV7B 4JI8J 4CWBA 2F40A 4FYVB 4RL1A 4EU0A 1KQFB 2LMIA 3J81j 3PW2A 1XERA 4B9TA 2VBXA 1HW8A 3G2XA 1TKXB 2G1HA 1EX8A 3AOAA 4FZVA 3MR5A 5B0BA 4DCJB 1NPPA 1SC4B 1AROP 2EW9A 2MSTA 1BQNA 3DDIA 4OLOA 1HL6A 2C2EA 3BREA 2KYXA 2VKZG 1N32F 1U1LA 5F3ZA 3ZTRA 1SJ4P 3OFEA 1LNQA 4OZLA 4HR2A 4QPTA 4OYIA 5C25A 1I51B 1T9TA 1QJHA 4ZPDA 1T95A 3N5FA 1B3TA 5KT4A 1FKPA 2JRSA 4IFVB 1IBMF 2O1PA 3EZUA 3I9ZA 2CQ2A 4ILRA 2KHCA 4EMDA 1RUSA 3T1HF 4USMA 5HBMB 3UCGA 3W8GA 1TQLA 3R1HA 3PTWA 2NYIA 2UUCF 1JLEA 5IZHA 3TJ9A 2I38A 4DPTA 3C66A 4YDXA 3E01A 2LCWA 2L9NA 3OW2R 4CH1A 2LA4A 4O4RA 2VBZA 3SSSA 1H2TZ 3EE3A 2AJFE 1L3SA 5D77A 1S4FA 1BQNB 2CQ1A 2FHMA 3E8OA 1VYAA 4JV2A 3QRPA 4OHVA 4WP9A 2O67A 3HFKA 2VPYB 5I42A 3AA9A 2FJXA 1KNZA 3N6MA 1S9EA 3H4DA 4UQGA 4NLRA 2FC9A 6FDRA 4WE1A 4C4WA 3DYAA 3SV3A 1HNXJ 4U7CA 4NLXA 3H90A 2J9CA 3NGTA 1LKZA 2X7IA 2IHR1 3GYNA 4RW8B 1FDAA 1PSDA 3UPFA 2BANB 4OX7A 3TA2A 2W4CA 3MM8B 1VDHA 3GIKA 1FRIA 1GAOA 4NOHA 2J9DE 3S6EA 3UW1A 1SC6A 2B4VA 3HT0A 4NASA 3TQ1A 2LU2A 2Y9HA 4RUCA 4PG5A 4OZJA 4WKYA 4P2FA 1TL3B 1KDNA 1NSQA 4LIWA 1ZPWX 1MU2A 4X4VA 1NB7A 4DV4J 3PG9A 2YPZA 3GJSB 4J9KA 1S77D 1KVIA 4CLWA 2OPPB 2DR6A 4YY3F 5EWEA 2VUGA 4O23A 1ZOTA 4HTJA 2M52A 3DYAB 4OYMA 1HQUA 4Q0BB 2WBMA 2GJIA 5A2QU 1WEXA 2RILA 3R27A 1ZA1B 3K58A 1TL1A 4NCGB 4ECRA 4C8LA 4TLRA 4LF8J 2QA1A 2WSFC 2Z0GA 4DXLA 2BW2A 5IV4A 3TAPA 3DFEA 2Y8YA 2HZVA 4Y2CA 1YBAA 1R6YA 2GFFA 1RHRB 4B3RF 2XSJB 1N5YB 3OUYB 4DSLA 1NAQA 3H5UA 1SB6A 4OYZA 2KRRA 1XC9A 3NS7B 3PEJA 4CTAA 4YR2A 1HQEA 1OMSA 2VF3A 4FS1A 2MLZA 1UFWA 4ICLB 4JP8A 4RW7B 1GT8A 3OR2B 4KY3A 3W9IA 2CPZA 4LQ9A 1HD1A 3DLHA 4FS2A 3W63A 2RNEA 3O8WA 4RJVA 5KFAA 5D0HA 1HQUB 1U7LA 1KS2A 1UMJA 5C5JA 4DR5F 1U47A 3FFIA 5HVHA 1RABB 4YB6A 2BABA 3Q89A 3I5BA 3UN5A 1WJ9A 2MTLA 5IQQA 2BW7A 2R2SA 3KWMA 3MFHA 1Q7LB 4Q8FA 3HJVA 2GNKA 3RB6A 3JB9k 2EG1A 1UVIA 2VQFJ 3PR5B 3TEGA 2WSEC 3JXOA 4ZPTR 4H54A 1EP4B 3ILLA 4EEYA 4FNIA 2A2DA 1EQ0A 2ASLA 2DHHA 1RWUA 5KFUA 3ENWA 4PEOA 1XR7A 1T9WA 1WSVA 2BJ7A 1L3UA 4DV5J 2HK3A 5ETLA 2HHWA 3WQPA 5EWGA 4N56A 2V67A 1WG1A 2J7UA 4B9UA 2CG4A 1HWLA 1S49A 4PWDA 4USTA 3A1YG 1KD1T 1AUDA 5J2NB 1DAXA 4NZ7A 1JJCB 1NJZA 3MMBB 3OL7A 4RO0A 4FVMA 4JI2J 2Y0SD 4LVOP 1L3VA 4K5RA 5GAGI 2HVDA 1XMOJ 1OSCA 4EO8A 2AW0A 3HSZA 4L6V3 1R0AA 4LF4J 3THVA 1UJ5A 2YKPA 4ZA1A 4KV8A 5GAHU 3NBPA 4I2QA 1NKBA 5C42A 5IC4B 4MKVA 5ETSA 2F4FA 5KT6A 3EGZA 2O5DA 3DRPB 3V6JA 3TRGA 1PC5A 3CDAA 2PSZA 3CDUA 1HWUA 3FBBA 1S4EA 4JV5F 3CT9A 3AOCA 3K7RA 3MAAA 3US5A 3DOKA 3QGIA 2B7BB 2LQJA 2PMWA 2M88A 4DQPA 1GNKA 4DV0J 3MM6B 4JI7J 4Q5VA 1SKSA 2P2CB 1YG0A 4ZP9A 4NXMF 3NMRA 4DV7F 2B4PA 3B6BA 1OY9A 2R3VA 3JSRA 2HHPA 1LWEA 1PBAA 4FYDA 2WVBA 1X0PA 3OXFA 5AXNA 4QW8A 2XS7A 3ISNC 4OI4A 2MLXA 2R7UA 4QQBA 2XCPA 2A6OA 3R1LA 1HPZA 1UZDA 5D78A 3JAMY 1R0AB 2DHGA 3KK3B 4MFBB 3TANA 1WC3A 4HKQA 3AAWB 3D6FB 4UUXA 2X1AA 2LQ5A 2ROEA 3IGVA 3PNIA 3QFWA 3M32A 1K47A 4DL6A 3VV2B 4C97A 5KT3A 3HVTA 4MIAA 2Y1IA 1N0UA 2CDQA 2V68A 4TNOA 4Z37A 4DV3F 3OVSA 3HHLC 2RH3A 2ZH3A 2HIYA 3IMQJ 4HI1A 4NA1A 1WG5A 2ZWPA 3I32A 4LT6A 2Y1LB 5LMUJ 1B99A 4CLYA 4QWEA 4AL7A 1UEKA 8ATCB 4JB8B 2V69A 4ED0A 4U6PA 3MEKA 5L9NA 1YX2A 4EO6A 3MM7B 5DG9A 3KLEA 3MPYA 3TWZA 2IRXA 5ETMA 1RBLA 2KTQA 3M8SA 4LR9A 2MQMA 2EG2A 1LWFA 2UUWA 4KHPJ 4CLLA 2CPEA 5KFOA 3KDNA 4A8QA 1UVNA 4WF9Q 1YTYA 4K8RA 2XS5A 5JJBA 1RXOB 3D1OA 1JMTA 3CCJS 2GJFA 5DG8A 1HMVA 5LT5A 4BWJA 4RNNA 3N9UC 2YVSA 2V8PA 1WI8A 4RLEA 3MXHP 2E5GA 3UVJA 2PMHA 2KO1A 1RT2B 4IR1A 2VFUA 3K57A 1KP6A 5HQMA 3MM5B 2O66A 2GMLA 3BPSP 2I6WA 1X9MA 1OYEA 1RT4A 4RW4A 2X1FA 2BRLA 5DQGA 1XNRF 2C2DA 2CRLA 3C14A 3D1QA 1S57A 1TKTA 4MIBA 1WSRA 3M2RA 4USWA 3BGRA 3EXYA 2C2MB 4I2PB 1RLCL 1VBZA 2B0GA 3UDCA 2RJZA 1TVRB 1DTTA 1YJ7A 2KZZA 5HMXA 3M6VA 4DQQA 1TL4A 4ED5A 1NUEA 4MKAA 5G0RB 2MHEA 4KRWA 3IGNA 1HNVA 4Y2MA 3CC4S 2I5JB 2NLWA 4M5DB 3CCES 1KONA 4P6QA 3M9OB 1KSPA 2V94A 1ROFA 3HVRA 4KPCA 4H4OB 3NS6A 1HIYA 5GVQA 2J6TA 2XLJA 1UEUA 4JI6F 2RDJA 4O3NA 2J0WA 2DGSA 4K0KJ 3PIPQ 1VBXA 4M94A 1SJQA 3WIVA 4OI0A 5K14A 1WKLA 4F0HA 3SCJE 1PIEA 2MDAA 2DGXA 2HZAA 2C2RA 4A8WA 1TK0A 5ETTA 4JOUA 4Y2AA 3R7BB 2QMUB 2HHSA 3HF5A 2BEFA 4IRKA 4DV1J 3S01A 1QSSA 3DLGA 3HMJG 3GSIA 4GC7A 4RUHA 3PZPA 2YWGA 4X2BA 2HEKA 3CJ5A 3IRWP 3IC1A 1Q95G 3J7YI 5KAKA 3O44A 3DDKA 1DLOA 1MWZA 3OJUA 2QMXA 3RAQA 4ZOSA 3M8PB 2CJKA 3UNGC 1VRTA 3QT8A 2DK2A 5F8NA 3VCDA 1PAUB 1NEEA 5C7PA 5GAEI 1XJWB 4CCHA 1YBTA 5AXMA 1ZAVA 4ECUA 3R5DA 5DDPC 3JQJA 5GADI 2VFVA 3OXLA 5K14B 1DY3A 4A8YA 2OP5A 3QZ8A 2CJQA 4KR0B 1QAIA 1U1QA 1NK6A 2W25A 2UUCJ 1RYSA 2KRBA 1FHTA 5FD1A 2E7WA 4FF2A 4HYKA 5AJ3F 2CPXA 2OSRA 2FY1A 4UT4A 3MF5A 2G0JA 1WNEA 2DPIA 4LMZA 3FSYA 2M5YA 5CZXA 1VQPS 3ICLA 4N77A 3R5CA 4O3SA 5BYSA 2V2VA 4YB1P 4ZPBA 2XULA 3MEGA 1IWGA 4DN0A 2FJVA 1T94A 3TNVA 2KH9A 4IO9Q 1KQSR 1UP1A 3BSAA 3PEHA 4ZP6A 1VRTB 1UW4A 4LF7F 3M8RA 2DRAA 4X4RA 1QAJA 2QL5B 4M63A 2YH0A 4GKKJ 1RTZA 1T9XA 4ZJLA 4K4YA 3VAIA 2ZZMA 2W9BB 2BJEA 3ZC4A 4ID5B 1SKWA 2A6MA 3CNQP 3IBCB 1NK4A 2HHUA 4KGXB 1RE1B 4KH1B 4GKJJ 2DO4A 1RBOB 5J1EB 1JWWA 3FRZA 3ZZPA 2QLXA 1SV5A 1FXDA 2BACA 5HQ8A 5F8MA 4R8UB 4K4VA 1Q78A 3R6GB 3HSDA 3FRYA 4JI1F 2E1PA 2WVCA 5BJRA 1YJVA 1F5BA 3MEEA 2RHQB 1IXKA 2OO4A 2QGFB 1F60B 3PO4A 4DUYJ 1PJ7A 2EPIA 1U6FA 3V81A 4DL0C 3CULA 2D3ZA 3ZZZA 4FKXA 3GONA 2UVVA 3AJ2A 4LRBA 1N34J 5KFBA 4X4UA 4ERDA 3MEGB 1EJ7L 4CLUA 1WEYA 5KG2A 4R25A 4IQXA 4IR9A 5KFPA 2E5JA 5F9NA 3M1VA 5CYMA 5KFCA 3HHLB 3GYGA 4F3QA 1T9UA 4DCPB 3Q8SB 2FVSA 2ZKUA 1Q7YT 1I5OB 2C22A 5A8WA 1REVA 4J7CA 1ZTWA 4M5JA 4YDDB 4P2MA 4WXWA 1KQKA 4ED7A 2DT9A 5KFKA 5DZ6A 4W90B 4WP8A 2F8HA 1IJFB 2CNLB 2MY8A 4RNHA 1GXLA 2D3OR 5D4LA 2W01A 2MKJA 5T7LA 3FMWA 2GZOA 4PWUA 3BYRA 1M5OC 4ILMA 1OSDA 2VL1A 4KHMA 4DR1F 4RU2A 2Y8WA 4JI3J 3ZXWA 3V2UC 5LL6d 3PM9A 4UOGA 4RWWA 1M5HA 3MR3A 4W98A 5HP1A 4H4MA 1BUXA 1O5JA 2VOPA 2NXJA 2GS8A 1HHTP 3FCVA 2OPSA 2HQFA 2VG7B 4HHJA 1AA1B 3RUBL 2F8EX 1EETB 2HHHF 2OTLS 2GV1A 3EMTA 5KT7A 4ZLJA 2LEPA 5A76A 3D6MB 4A8XA 2BUNA 5DDOC 4FP9A 2DGQA 4CH0S 2DRDA 4ES2A 3GG0A 2ZH2A 2V4QA 5DJBA 1W2BR 1KFSA 1SQEA 3KJNB 4DUZF 1EKRA 1VJQA 1SH0A 2MZQA 4IFYA 1YI2S 4BDPA 1CLFA 1JK9B 1FJCA 5F8GA 2LECA 6FD1A 1TFWA 2MB0B 3RGIA 2QN6B 4TU9A 4YHHF 4BHQA 1UWBA 4EYHB 3LP1B 3W3SA 4ZCLA 3BKFA 4Q7AA 1UWAA 4DLGA 4ZDNA 2AYBA 1SJRA 2LEBA 4NLWA 3CJKA 1ZTTA 5F9LA 3VGSA 1YQHA 1UPMB 2CJYB 1HBNA 2ACMA 3R7SB 3QAUA 4P72A 2KHDA 1JJHA 1VQ6S 3AXMA 3ITHA 2F9DA 4GVBB 3F41A 3OFFA 4WZQA 1W7WA 1EZZB 3VQTA 2EBGA 2AZ3A 1SL0A 4ZCKA 3HXMA 4C11A 5CYQA 2Z58B 3HP6A 4OZ2A 3VVUA 3K5NA 5C24B 3BBFA 3VWSA 4UY85 5KG1A 3RBDA 3VALA 3MR6A 2KI2A 1Q81T 4LBHA 4PUOB 4I6WA 5M2RA 3K5LA 2HBZB 2PFDA 4NX9A 2K3KA 1DQAA 1LWCB 3CCRS 5I4MA 2EEYA 1K1SA 3M8QB 1RWNB 2M0GB 3BZQA 3K0JA 3ZO7A 1MN7A 3AQPA 2KM8C 2BR0A 1WUUA 4X4SA 2CQBA 1C0TA 4JV5J 1J5EF 4AD6A 5M2UA 3DOLA 3PVXA 2YNGB 4I0WA 2WHOA 3DOMB 4DV6J 3BV8A 1SQFA 2IRYA 3QFHA 3LGHA 4LF6J 2VU5A 1ZM2A 1S6OA 3R7NB 4OHYA 1N52B 2ZKTA 4RW9B 3SDEA 4YUDA 2DVIA 4R5PB 3CIMA 3G8SA 2V9KA 1Y7PA 2XMAA 4YMEA 3MD3A 4F2RA 2N7CA 1RDRA 2A3JA 4NLPA 5AT1B 3TZYA 2NCKL 4AYBD 1S9GA 2HMIA 2VJVA 1VQMS 5D0GA 1H0HB 3FMBA 3I96A 2JJ4D 5ETOA 1T05A 2Q1LA 2Z2YB 3TA1A 1I3OB 3RB4A 1C0TB 2OD6A 3MCSA 1YJ9S 3I0RA 3OTOF 2XWYA 4CLKA 3KG0A 4DL2A 3QBCA 4DSKA 1IBLJ 3B78A 3T19A 1M1HA 3CCQS 4G1QA 3D66A 1S1TA 3P96A 4BC9A 2MKHA 1SKUB 3SDEB 2XEXA 1X4AA 4B9SA 5E5NA 4DSIA 2F4VF 3QQCD 2C3YA 3T1YJ 1KVJA 3R5BA 2EXUA 2EI5A 4KBIA 5IM0A 3CD6S 4XAKA 3LOUA 1BC6A 2RKIB 3TZWA 1RHUB 2HRUA 5KFEA 2XTJP 1M5PC 4JYAF 2EBEA 1M5KC 1GEHA 3OSNA 1UEVA 1KLMA 2Z30B 2V0NA 3GCWP 4TXSA 4WCEQ 2MGZA 2HYIB 3PRBA 4LF2A 4ER8A 4C9DA 3NNHA 3GP9A 1Y4ZB 2VFSA 4ZHRA 3CE8A 4LFBJ 2J0SD 2J9DA 1TK5A 4DX7A 3KLFA 2OMLA 3DRSB 3EPGA 3A8KA 1GTHA 4OX8A 1PO6A 1DQ8A 2AGQA 3ZTPA 3D4JA 1TAQA 3CJ0A 4QIGA 2AZ1A 5THWA 4Z2XA 1S1TB 2CKWA 4PAAA 2DIVA 1EHWA 4MKBA 2UVRA 2R8IA 1P27B 1XNQJ 1AW0A 4DX5A 2RQ4A 2YNIB 1V9OA 3MTKA 5HJXA 1XNRJ 5E3RA 1UJ6A 2HGLA 4DSJA 2BBEA 3QYYA 4ELTA 1HYSA 2MQOA 1OQ6A 1NK0A 2F7VA 2NSCA 2XLKA 1IBCB 5B0DA 3G82B 3SBMA 3AD9C 1KLMB 3GJRB 2AEMA 3GFYA 2H5IB 2R7XA 3GPAA 3ZNUA 1R8CA 4ZVGA 3JSBA 3QT5A 1U6ZA 4PG8A 2WBRA 1FEEA 2P9GA 4KFBB 5I3PA 3OL6A 5K5MA 3J80Y 3FKBA 1HW9A 4C98A 3VAJA 1RTDB 4K59A 1U1PA 3D6HB 4XK8C 1NSAA 3B54A 2JFKA 4ZVTB 7AT1B 4I56A 2R9LA 2VA2A 2LYVA 3OVAA 4RW6A 5KFVA 1X4DA 3V4IA 2HQDA 3BKTA 3HULA 5D4NA 1DTQA 1EQMA 2BJDA 2FZGB 4WK1A 1U26A 2YXLA 3OD2A 2DXDA 2JZ5A 4LR7A 1RB0A 1IKVA 1CJKB 3CJ4A 2C2ZB 2MY7A 2G0CA 4M5IA 2FLPA 2V5HG 5KFZA 3ZZUA 3TUIC 3MUMP 1UETA 2HKEA 1FKAF 1JLGA 4DR4F 1UVKA 3MM9A 1S6QA 2VICA 4X4QA 5E33A 3DRRA 3EGNA 2P8IA 2HHQA 3ZTSA 3FSXA 2BE2B 1XR5A 1U49A 1Q4RA 2XY5A 1M90T 2EFOA 4J9QA 3ZZ0A 4DR3J 2NUUG 2OTJS 2LA6A 3MDFA 2YQ0A 5JUMA 4ZLPA 3F56A 4USJC 3LP0A 1SXLA 2HG4A 3IP0A 1IQTA 2YKAA 1U6BA 3Q2SC 1ZS6A 2JLGA 4XTTA 1K0TA 1Q8BA 1RISA 5CCLA 1T11A 5AJ3J 3OTDA 3WIUA 1RGVA 3DI6B 2YH1A 1J2VA 1Y11A 1YRTA 3RW7A 4I68A 4ES3A 3SZ2A 4I4BA 3RB3A 1I94F 4WFNQ 2KM8B 2VB6A 1RYRA 3SEOA 4B3SJ 3THPA 3TX8A 1YGYA 5HLFB 3ZTQA 1EKSA 2CJ9A 3MM9B 2YNHA 2QIFA 1S6QB 3GJQB 3DRRB 3MOJB 2DCUB 2AYEA 4LF7J 3UWTA 2IDLA 2CQIA 2YPYA 5KG0A 1YJTA 5EWFA 3W8PA 3O5TB 4KKOB 4USVA 1MROA 4NLYA 1FVSA 2W2OP 2EK6A 1HQ2A 3HVWA 4DI6A 1UA0A 2IMWP 4DSFA 2PDAA 4DV2J 3OHBA 3CCTA 3CO0P 4QIFA 2NREA 2HK2A 2IJFA 1GQEA 4M5KA 4JI1J 1XWLA 3L7UA 4FNHA 4K4XA 4FBUA 4ED4A 3I0SA 4CT9A 4K2JA 1T03A 3MAQA 1G3OA 1CJTB 3G8QA 3NKYA 1VC0A 1F1BB 3CJRA 4FF4A 1TK8A 3J7Z5 2JVRA 3NGSA 3R6LB 4DSEA 3M30B 5K8NA 1HD0A 1YZ7A 5A0YB 4QU7A 1UFLA 1KKHA 4ZK7M 5T41A 4EUVA 4J9PA 3DGPA 2HFOA 4ZVOB 1KWMA 5HATA 5EGYA 4FXDA 1RCOB 1M5VC 2PT0A 2V8GA 3HVAA 4IH7A 1YITS 1E6YA 2CNNB 3I5AA 3T1AA 2UV8G 4FXVA 7FDRA 1AFIA 1FJEB 4ZJQA 4C8KA 4DL3A 3MECB 1Q79A 2W7OA 2CXEA 3H25A 4OV1A 4ILLA 3H7HB 1CJUB 1HR0J 5LXYA 4ECVA 3GTYX 3M6XA 5FLXU 4CO2A 3CJSA 3KG4A 3M8ZA 2IBKA 4WU3A 3H42A 1HBMA 1JX4A 1TELA 4A46A 4AQYF 1WHWA 3PRDA 3R5GA 3MUVP 5E7OB 3KMSA 2GO8A 1FRXA 1ICEB 2XMTA 3Q8QB 4F04B 4TY8A 2OPQA 4FVCA 2FC8A 4DF4A 5KFHA 5KG7A 5F3TA 1YJWS 4KHRA 1RAFB 3DGPB 2QYCA 1BD6A 2K2PA 3FJ2A 2DITA 1D0EA 2QG9B 2HRTA 4AFFA 5KT2A 4LFAF 5A2QY 2ZD1B 4F4YA 2D9PA 2XYPB 1QSYA 3ET6A 3FC9A 3OR1B 3GR0A 2BZ2A 3ISND 2KVQE 3Q8VA 4KB7A 1V6HA 2JL9A 5FDLA 3H0PA 3OT9A 1T9VA 4P7VA 3JYTA 2CYYA 2U2FA 1RLDA 3VR1A 4P74A 1LW0A 3DCAA 4IDKB 2L9WA 4QCLA 4DUZJ 2ALZA 2DR8A 2LQ8A 1HNIB 4KO0B 1N8RT 2ZH6A 2JVOA 1V3ZA 1Q86T 4YHHJ 1ZA2B 2RU3A 4LF5F 2V8DA 5BYQA 2NR0A 2X51A 3Q2TC 2YQ1A 5KFMA 4TY8B 4ECYA 4Y3CA 4UQTA 2IVFB 3W65A 3LP2A 3WX4A 1X60A 2EFGA 3BSOA 3HHLD 2UUAF 2M3DA 4C0OC 2OGUA 4WTYA 1H7XA 4KSEB 4X4NA 3IR5B 4U8YA 4ZVEA 3KK1B 3FVYA 5KOWA 4DPXA 2UXCJ 3CUNA 1XEZA 2U1AA 2ASYA 3KK2B 4ED8A 3QLHA 3SQGA 3AXKA 3HHDA 2RDDA 3HHEA 1HNZF 1T0TV 1K1QA 1PYSB 2QL9B 4KGVB 1RA6A 4RX6A 2OELA 3RW6A 1LW0B 3GJTB 3KXDA 3KFWX 3UD3P 1FRLA 5AE3A 4Y28C 4QIWD 1LW2A 5H9FJ 1FKOA 1SKRA 3QJLA 4ZIVA 5DLGA 3GILA 5IFMA 4DS4A 2G13A 3I5CA 2V4JB 3U1LA 1IJEB 4DZDA 3FEZA 2IM2A 1VQ8S 4OLPA 2ZFHA 5B0EA 4CRJA 2ASDA 3QO9B 5HAOA 4Q45A 2OFGX 4NLTA 4DS5A 1OYDA 4ETXA 1LFPA 1UVMA 1H3DA 5CAAA 4NL5A 1AXQA 2WZ1A 2CJXB 4C6AA 1RADB 4DG1B 1PG5B 3Q8UA 4F50A 3MCNA 4HT5A 3BH7B 1VK3A 2OFHX 5J2PA 1S76D 4IG3B 4GC6A 1R6VA 2EC0A 4IH5A 1V3SA 5J2QB 3QGGA 2E9RX 1NH7A 4WFXA 5FJ4A 1HARA 5KFTA 5J2MB 2CNOB 1IM6A 2N4DA 3LA0A 3NWRA 2DHXA 4LSLB 4U7UK 4JI0F 2W8LA 2ADBA 3ONQA 2LFVA 1U4BA 1NHKL 1L3TA 3GLJA 2AIRB 2DIUA 4K7QA 3IS9B 1Q1KA 3ENQA 1XMQF 2GHVC 2XYHB 4WIIA 2KT3A 4OX6A 2MKKA 4ED2A 1RI7A 1D9AA 2PI4A 5F8JA 1C1CA 2C3UA 2QEXS 1NRKA 1ULRA 5D4OA 1HHQA 3OTOJ 5L9XA 2R2UA 3EICA 5HL7Q 4ED1A 3HM9A 3OTCA 3GFXA 2AP6A 2YX1A 2XMKA 4LRFA 4B3MF 4J37A 4UOFA 3CJ2A 3AJDA 3F0NA 2BDPA 3J81U 4LFCF 4TY9A 5I3UA 1H74A 2HRYA 3PACA 2LLZA 1TU0B 3TW0A 4AE5A 2HGNA 3KUHA 1X5SA 4NLVA 4A47A 3W5YA 2XC9A 5K9FA 2MJNA 2ZVSA 2DHSA 5IWAJ 2RT3A 1DJ0A 1JLFB 4EZ9A 1V5VA 1TKZA 2V4RA 4PQUB 2GC8A 1RTJA 1U1MA 5JMNA 3I31A 2AGPA 4ZLLA 3T9NA 2UU9J 4OJGA 2HS3A 4JYAJ 2HIQA 3DM2A 4DHVA 4FF3A 3NGDA 1F3VA 2RF2A 5IOLA 4NRTA 1YSJA 2CJBA 2RIJA 2XO7A 2KKHA 3E51A 4ECQA 5KFNA 2BRKA 4DZ6A 3AA8A 4ETZA 3EGWB 5A8KA 3EJMA 3NEKA 5HQLA 3CO9A 1R0CB 3BPDA 1GXTA 5KFIA 2FVRA 1AFJA 3C3LA 4DR6J 1C0UB 5I3UB 2GVZB 4NI2A 1VHIA 3OQ2A 3W2VB 2IAJB 4B3OB 3VQSA 4NZ6A 4HT7A 1GK8A 2ATCB 1RAIB 1JKHB 3TAMB 4LF9F 3UCUP 2VKRA 1X5OA 4ZVSB 2VDIA 1KLNA 4M8LA 1A9NB 2O01C 2QLJB 2HHVA 2B7CB 2KZMA 1FFWB 3W2WB 1AT1B 2G2YA 1PC4A 1KQGB 2BJ9A 3AJ1A 2WVFA 2MSSA 3P8BB 4HLBA 3J7YU 5CABA 1VQLS 3NAHA 5BYRA 2CUYA 2IC3A 4C0HA 4NXNF 5E2QA 3CCLS 3P5BP 2KT2A 1RT5B 2GHPA 2ZZTA 2XBPA 1TKDA 5GAEU 4DLEA 3EPIA 1K9MT 4CT8A 4O44A 3K5OA 1T8EA 1A6LA 3BN4A 2BJ3A 2DXFA 2V2KA 1Z2ZA 5GADU 1C2PA 1FI4A 2WTFA 4UOHA 2YNFB 1JNZB 4NLGA 5HMYA 2NQPA 1TKXA 3PHTA 4F4AA 4EWTA 5AE1A 2CQCA 2BOPA 1RT7B 1PGZA 3H8YA 1SL1A 1CQNA 2AWZA 3CTRA 3T6BA 1VQNS 4DQSA 4USUA 3PJWA 5LJ3Y 1H2VZ 1FJGF 4O0NA 2WSCC 1VQOS 1NK7A 4QPXA 2X1GA 5L1KA 2ZM6J 2JLEA 1YDLA 4OI3A 3BQ1A 1FDBA 4ZS6A 1ZAWA 3MPUB 2QTWA 2LU1A 1SJ1A 4KIAA 1YKWA 2BM0A 3POTB 5L46A 3IRXB 5DG7A 4O44B 3RYLA 2J9EA 4OZNA 4LJMA 4QOTA 5HBMA 4EI2A 1SC1B 4LSNB 1RTIB 1E6VB 3AD7C 2P9EA 4P2SA 1HI0P 3QNWB 3LALA 1N33F 3DDNA 3P6YC 3SQOP 4CZCA 3VAGA 2IA0A 2DNPA 1RT6B 5IQ6A 2VD3A 2HNZB 1QTNB 2VQEF 2BXJA 4CNYA 3VGVA 2MKCA 2J7KA 1UAWA 4DWIA 4I7FB 2BQ3A 3C15B 4RBTA 1IR1A 1Q5YA 1FRKA 2AHOB 2OPRB 3M2UB 1TV6B 2C28A 4RR5A 4P10A 3QIPB 3HD2A 4QW9A 4F4WA 2FJWA 3BJYA 2GIFA 2BJ1A 3BSCA 3NRBA 1O0PA 4HDGA 2ZC3A 1MMLA 3PV8A 2BE9B 4OYOA 3UDVA 3KNGA 2E1AA 2EFQA 2XMVA 2ZH9A 1VS3A 1CULB 1XBWA 1D9FA 1GX5A 3D1HA 5IS2A 2FZCB 3E3XA 3PJXA 2RUGA 4RW8A 1UW9A 2HAIA 1MN9A 2BANA 3OL9A 2CZ4A 3MM8A 4X64J 2ZHOA 2MKYA 4C8MA 2G4BA 3JSMB 1OS5A 2SXLA 3QZ7A 1WHYA 2MKIA 1YLXA 3OBIA 2QC3A 2PO4A 3ZZRA 2V8VA 1R7IA 3EZOA 4J9LA 1TL3A 1RHKB 4R0JA 4ZCIA 2VPXB 2WW8A 2G0IA 1V3RA 5F8IA 1SJFA 4NA3A 1R8HA 1YJUA 1WG4A 3PYGA 3ULHA 1NO8A 3H98A 4G1IA 2OPPA 3B8HA 4DFMA 1MSWD 2XSFA 3BS9A 3TO8A 3W64A 2KXNB 1Z1ZA 5AXLA 4Q0BA 3PX0A 3FZBA 2CIMA 1BLUA 2YX7A 2UP1A 3P49B 2FPHX 4YP3A 2XMUA 2GVDB 2CVEA 4JI8F 4NCGA 3TUPA 3GWCA 4G1PA 1N0VC 1G2EA 2ZH5A 1NJWA 1S6PA 3HDSA 4ANCA 2HLTA 1J27A 2B9WA 3TZZA 5CHCB 2APOA 4RUBA 5K8PA 2OIHA 2E5LF 2C2OB 3MR7A 2XSJA 1N5YA 3OUYA 3DGVA 2JSXA 2ADCA 3SI8A 2PA3A 2HHXA 3I56S 4HACB 1S7IA 4ZPCA 3PIOQ 9RUBA 4LIRA 2FB0A 4YB5A 1P9QC 4IQMA 3R2DJ 3Q8YA 3UN3A 3EDRB 4ICLA 3CMES 4RW7A 2W7AA 2OEMA 1G6BA 3AT1B 3OR2A 3L95X 4BC7A 4RNOA 1YK9A 4JBCA 4QYZK 5MAOA 1C1BA 4F3MA 2WAQD 3TUZC 4OJ1A 2B5JA 5D0RA 1F9FA 3WX8A 4O3PA 1U8SA 1MG7A 2ROPA 4KT0C 3C16B 5G4DA 3EDQB 1S6PB 3A8JA 4P52A 3L7OA 2VFRA 4XO0A 3DN9A 5BR8F 1NLKL 5H9EJ 3HPOA 1EP4A 1FXLA 1RT1B 4CM2A 1R27B 2YQ3A 3LWMA 2OH2A 5DM6Q 4UZBA 4BLGA 2Q66A 1TUGB 1S5ZA 2NUHA 5JXSA 2KFNA 1U1KA 2KFYA 5LSOA 4DX8H 1VOMA 1JLQB 2PA8D 2K8GA 3HX9A 4PR6A 5D3GB 2MKSA 5D4PA 4LF5J 1C1BB 1OY6A 1HNXF 2E5HA 3NCQA 3LPYA 2M2BA 5J2NA 2PIIA 2B5JB 2R7WA 3PKMA 3MMBA 3LGMA 3ZZTA 2GGPB 2J76E 2DO0A 2CADA 2E1RA 3F73A 2UUAJ 2FGCA 4K2XA 1MW7A 1IKWB 5ETNA 2B56A 2IY5B 3H20A 2WONB 2UXDJ 2QSFA 1Y3JA 2LP4A 5EDWA 4PG6A 2DNHA 4Y2IA 3J7AN 1F2GA 2HFSA 3HK2A 3AB2B 4IYQA 2ZVIA 3DRPA 1KHWA 1LXJA 2HS0A 5B7WA 2XMWA 4V19X 3LTOA 1TL7B 4M95A 3OLBA 1S1WB 2ZJPQ 5LM7E 4C8NA 3DLLQ 1IKYB 3WZ0A 1U09A 3T41A 2ZOGA 3BB5A 3ZZYA 1RKIA 3V6HA 1N88A 1U1RA 3C2PA 5E3AA 4QWAA 3MM6A 1LK7A 2FHKA 1OWXA 1RTHB 4ZP8A 3LPEA 1NZAA 1QLNA 3GQCA 4LF8F 5ITHA 1ZPVA 3CIZA 3ZNJ1 4OL8A 4NE9C 3DMJB 3MWBA 3OHAA 2VZ9A 1HBOB 3UQSA 1S1XB 3D67A 1VQSA 1X8DA 2DGUA 2Z2ZA 5CYJA 5KTQA 1RHJB 4YFUA 2P5VA 2AF6A 3G6VA 3KK3A 4MFBA 4GO7X 4AL5A 2A10A 3M6WA 1GMVA 2E5IA 4OYAA 4MH8A 2MQQA 2DY1A 2M4MA 1IR2A 3R8YA 4OHWA 3DLEA 5LMNJ 2F65A 2RD5C 1FK9B 3RU0A 4Q2MA 4ZLNA 1FWKA 4JI0J 2XB2D 1YJRA 4C3LA 4F4XA 1VCTA 2K1RB 4JI5J 4J9VA 3M8YA 3LW5C 4U67Q 4MJKA 1R3NA 3G71S 3KJVB 3MMCB 3IR7B 3IWXA 1SBRA 1O8BA 3TVKA 1SH3A 3GU0A 2HBYB 4KAIA 2XY6A 4ANEA 4ZPWR 3TJAA 2KJWA 3LQVA 1HFEL 2NPIA 3HO1A 3QT7A 5DDRC 1N36F 4B3MJ 1Y10A 3D28A 3MM7A 5DM7Q 2VOOA 2L3MA 4Y6IA 2H48B 4DL4A 2M9KA 3MD1A 5KFQA 3C6UB 3K5MA 2GCFA 4IG0B 4OX9J 1BE4A 4N5SA 4IRDA 1CC7A 3DLEB 3QGHA 3EXCX 4EBCA 2RVJA 4MYTA 2YWHA 4EFAC 1NPKA 1Y0HA 1YRUA 4F0MA 1F9EB 1Q0NA 3HJFA 3MPVA 4NMXA 1HLWA 4W4MA 3CCZA 4U95A 3SMZA 5IT0A 3V6DB 1B0VA 2HZCA 5A8RB 2ZH1A 3PJ9A 3JQKA 3EVWA 3TJ8A 1NK5A 1IKXB 2B9EA 4JI2F 1R8PA 5KFLA 1RT2A 3D0HE 3MM5A 5ETKA 3M2VA 4CH7A 1XMOF 2FLNA 4LBPA 3FCWA 4ZKAA 4PZVA 4LF4F 2G1DA 2IM1A 2FJAB 4ES1A 3CXCR 4P71A 2LQBA 2W2QP 2NPFA 1FWLA 2IJRA 2F1FA 2VIHA 3PYDA 3MMAA 4I2PA 1HHSA 1TVRA 1XMBA 2BQUA 2I2YA 2GO9A 1APSA 2ASJA 1CC8A 2DNMA 1LQ9A 2VC1A 1EAYC 5G0RA 2IMOA 2I5JA 2QYGA 3JQMA 3KLIB 4M5DA 4JI7F 1UTAA 2OSQA 3BGUA 4F36A 4H4OA 4N8NA 2CG8A 1TUVA 3GIRA 2VONA 2V2QA 3P45B 1SUQB 1B7YB 3M2VB 4FYWB 3RRGA 2CWXA 4F4KA 2HWHA 2H5JB 1FWPA 4HL9A 3O2IA 1F2HA 1GMUA 4B3TJ 4XIUA 2HNYB 1N54B 1UKUA 2ILZA 4DPYA 4QIVA 1QUPA 2J6SA 2D41A 1K44A 4M5HA 1FRJA 1VIXA 4A8SA 1VMBA 4G65A 4OJ3A 2QT7A 3MMAB 4DFPA 4LRDA 9ATCB 3U1NA 1QTMA 2FYXA 3HSGA 3CPWR 4NCAA 3LGNA 1JLBB 4G6VB 2VG6B 3TQEA 1X4BA 3R5JB 5E0OA 1WF0A 3WC2A 4ECTA 5B0CA 4K4UA 4XDDA 3M8PA 1NK8A 2XHWA 1S1VA 2HBQB 1G1XA 3KLGB 3Q0AA 1FX4A 2EFNA 4JV1A 5HROB 4OMFG 5LMUF 2D7SA 2QSWA 3R5AA 1IBKJ 2DHAA 4DL5A 2QRRA 2RHSB 2XQCA 1CS4B 4CM0A 5L1JA 3BBBA 5IT4A 4P75A 5U47A 2ZNZA 2HNDB 3LF0A 3I6PA 1EARA 2BKOA 2WOMB 3FBEA 4RBUA 1X9WA 4KHPF 4DR7F 2DR7A 4RPFA 2XGQA 3CW2C 2WW4A 1YVFA 2AJ0A 3BQ2A 1PILA 1JLAB 4OYPA 3CMAS 2NS1B 1NDCA 1EB0A 2QA4G 3QRRA 1NDPA 2ZE2A 2R8JA 1NDLA 2IDEA 2OEJA 4WXOA 4OZ0A 1W26A 3L4BC 3QSIA 1C4CA 3S8SA 2ZBPA 1S1VB 5DGBA 4OQJA 1N32J 2DBBA 2BVZA 1LFWA 2ZBRA 2YTCA 2W9BA 4ID5A 2ZZNA 4URSA 1S1UB 3TEHB 2R7SA 2CQ3A 1S9FA 2FTRA 2RQKA 2HVEA 4NLQA 8RUCA 5EX0A 1IBMJ 3G6XA 2KDOA 2ZBQA 4J5OA 5J1EA 2LKZA 3DLJA 2QV6A 4ID8A 4BCAA 3Q24A 2YKMB 3EX7B 3T1HJ 4R8UA 1QM9A 3QJJA 2HBRB 2GHWA 1VI7A 3AHPA 4X4OA 2DPJA 5F8LA 4FF1A 4DL7A 2YKNB 1YHQS 2JEIA 4X66F 5L1IA 2CQPA 2KFZA 3M8WA 5E3QA 2ZE2B 2CQ4A 3HFZB 2N82B 2DGTA 4PQAA 5F8HA 2FY8A 3KHLA 1BQMB 2ZUAA 1P1TA 2R7QA 2W2PP 1RWVB 1AB8A 4O3RA 1SPBP 3FQLA 4WFBQ 3HT3A 3PW0A 2BMBA 3HHLA 3DKDA 1KOOA 1VR6A 2YBVA 2IFXA 5GMDA 4WIQA 2FVPA 2WVEA 3I87A 4K0KF 1T02A 2KYZA 2DNNA 3SSRA 1VC5A 4ZVQB 4ITSA 3IG1B 2ZH8A 1GFWB 5J1NA 2AJ4A 1NH8A 3R9LA 1ZM9A 4K4TA 2K7KA 1FA0A 4DV1F 4E8UA 2HVZA 4PG4A 2IRUA 1DBDA 2CZ9A 1IVZA 2YKQA 1CPZA 2CPHA 3RG6A 1VC6A 5KFSA 1TAUA 2NXNA 3D0IE 3DRXA 4C3KA 2V6AA 2VODA 3DLKB 2YWEA 1FTRA 3T5LA 3RRHA 2C2KB 1RWMB 4CLTA 2ABYA 2DTJA 4NMLA 1TMJA 5CD4A 2B6AA 2E5LJ 4M5NA 1MMDA 1IUJA 3OPKA 3OV7A 3H4BA 4WFZA 5C2GA 3QGPA 4HH0A 1OPIA 3DHWC 4C0BA 1X7VA 2W24A 3BGOP 2VG7A 6AT1B 5KG5A 5ETQA 2HS4A 4DQIA 1EETA 1HA1A 1S59A 1MWQA 3UFCX 2QFIA 5HK4A 3J7A1 3K59A 4YY3J 5F0WA 2E44A 2AMCB 4KGKA 5M2PA 3MR2A 1U0HB 3Q83A 2AJ2A 2OD4A 2XY7A 1HBUA 5HI7A 4A8OA 2JC1A 2RU9A 1DZ5A 1Q8IA 2YX4A 1SH2A 5D6GA 3CJTA 2H1YA 3EVOA 2J5AA 1NU4A 4UTGA 2JEFA 2PFFB 3C46A 4TQSA 3ISZA 4QU6A 5IT9U 4Q43A 2DNGA 2MZRA 2B6AB 4PXEA 5BR8J 4B3RJ 1HWIA 1JLCA 3ETMA 1G4CA 1GTEA 1W25A 3T9ZA 2D3UA 5FLXY 1IM4A 4P2XA 3LP1A 1FRMA 3G9CA 2JC0A 2D3O1 4GKKF 4WYWA 2DGOA 4C48A 4DU8A 2KB2A 3W9HA 4YR0A 2IYIA 5C25B 4W92B 2M8DB 2MLYA 5B0AA 4GKJF 1NHUA 1KEKA 1FKPB 4PPDA 4ZVFA 4USIA 2AEFA 3BO2A 3CCMS 4DPUA 4IO1A 3JSYA 4OHZA 4RKUC 3EGVA 1URNA 4V19J 1X4CA 4GVBA 2XCAA 4ANDA 4DR5J 4WKRA 1HBUB 4DFJA 1JLEB 2UXBF 4AXIA 2OI2A 3ZTOA 3BKUA 3HHNB 3BYPA 1N5SA 2GIRA 4ZVHA 4YS2A 3I9V9 5C24A 3OL8A 5B0GA 3E01B 3H40A 1N5VA 4DUYF 1FD2A 4TU7A 2ZBIA 1JB0C 4I1TA 4JUZA 4B9MA 2E9TA 3CCSS 4RWXA 4YR3A 2GAHC 2XGPA 4PUOA 1N34F 1KC8T 2L41A 1X5PA 2JH3A 2H4WB 1JLCB 1NHVA 1LWCA 4KYZA 3SV4A 3MTJA 2CA9A 4HHHA 4U8VA 5EX3A 3Q8PB 3M8QA 3N28A 4RBVA 3ADAC 5I42B 2DXEA 2LDYA 1DQ9A 5KG4A 1S9EB 2VPZB 1DARA 2YNGA 3TVYA 1WKJA 3IXQA 3DOMA 1D3WA 4WE1B 4HI2A 2CNKB 1M0SA 1UVLA 3KLHA 2NZCA 4JI4F 5B0FA 3KKFA 1JNRB 2AJQA 3N4WA 2FJEB 3KHHA 1H6KX 2D69A 3PDNA 4RW9A 5DDQC 3V6KA 3X3UA 4R5PA 2FQQB 4PPZA 4B9LA 1M1GA 3Q22A 2KXFA 2W4PA 1VFJA 2ZHBA 3JTNA 1HNWF 4RNMA 1RP5A 2LXUA 2DB1A 4JI3F 1T9YA 3DLBA 1ITPA 4F3OA 4ZPVR 2V50A 5KFGA 1WORA 4DJBA 1NKCA 4IOAQ 1D09B 3ELHA 4CLPA 1VRUA 1WC1A 2QX0A 2HFVA 1U2CA 3NY0A 4LREA 1MU2B 3KTQA 4TKTA 1GMWA 2R42A 2LDIA 5SZTA 4OYXA 2R8HA 2CQDA 2GQQA 5BXIA 2P6SA 4U96A 1LEOA 3CD7A 3P4UB 1OO0B 1RHQB 1CEZA 3KLHB 5KG3A 2QMWA 5HSPA 5D8HB 3VTIA 4NXMJ 4DV7J 4X4PA 1RWWB 4IOCQ 1FESA 4TLQA 1TL1B 1H2UX 4TYBA 5DZ7A 2BA9A 1Z4UA 3PKYA 4WTOB 4E2FB 4IUFA 1WC6A 2FD2A 3B4DA 1N36J 1FO1A 2KXHA 3HZEA 2BOAA 1H72C 3UDEA 2J6UA 1WHXA 4FPRA 4DPWA 2Z2LA 3NNCA 1VRUB 2XI3A 4EYIB 2RKIA 1F0XA 2GQ2A 1KTQA 3D5MA 4CTAB 4NYPA 1HQEB 2HQGA 1NCLA 3N5BA 4LVNP 1VQ9S 2FJBB 1D9DA 2W8KA 3V4MA 2Z4PA 3T5KA 4DV3J 2UVWA 3DRSA 4P7TA 2V9WA 2XMJA 1VQYA 3FFIB 1SJ3P 1RWKB 4FDFA 1PYTA 4NCBA 3FSIA 2Z2MA 2OHDA 4RNFA 2E66A 4B02A 3N01A 1VLYA 3NG8A 4CYUA 1WHVA 3CB4A 3BO3A 4Y34A 2BE7D 2KG0A 1VRQC 4OYBA 3H59A 4IKAA 4DPOA 2H4YB 1B64A 3FBFA 1H38A 3FEXB 2YNIA 2VG5A 3HFVA 3J81Y 3D3CJ 1D8ZA 3MURP 2ZHAA 4M5LA 3KHRA 1I1GA 2FLLA 3AD8C 1T3OA 3G82A 2R4FA 1P6TA 3RBEA 2QLFB 4GRSA 4PYDA 4DV6F 4MKYA 2XZWA 1U48A 1VLOA 4DMZA 1F5CA 4PWDB 4LF6F 4NYZA 1TL5A 2JNJA 4KFBA 5T14A 3CVKA 4WFYA 4LRAA 4CI0B 3MPWA 1RTDA 1X4EA 3BGFA 4J9OA 4Y2KA 1Q8KA 4L75A 2AYGA 3EYZA 4CYUB 4CIOA 3G6YA 3SFUA 3CJ8A 4GMKA 4L72B 2VJUA 1KR4A 2JLFA 1RU2A 4QBUA 3U27A 3H5YA 1Y5IB 1AUSL 3EVMA 5HVGA 5LJ5Y 1MWYA 2VG5B 4P73A 4KV8B 3NBPB 2VASA 4I2QB 1RWXB 5C42B 2MZSA 3T6JA 3OTEA 2XLIA 5IC6B 4BBYA 2XG8A 3MUTP 1TR0A 4K4ZA 2PE8A 4I67A 1S0MA 1T7PA 1CJKA 1SL2A 4QYRA 1F3FA 4KPYA 2CFXA 3MAAB 1S99A 3NGRA 3DOKB 2C3PA 3G4SS 4XPCA 2QL7B 2CZVC 3D68A 2QA4S 5D0EA 4IOBA 4F2SA 1NNDA 1PCAA 4Y65A 1IBLF 1W2IA 4PYAA 3LAMA 1PYOB 1WWHA 4KGZB 2BE2A 4O3QA 3W5XA 1LWEB 5EUHA 1DRZA 2EVZA 4LSZB 4JI6J 5KFFA 1S12A 2YKOA 2COLA 2B43A 3CC7S 3SYZA 4M5GA 4Z7CA 1VJWA 3RBXA 2PEBA 1HPZB 3R97A 2XS2A 1IN0A 3NOCA 1L5UA 1H7WA 3T1YF 1SIWB 4AL6A 4UZCA 2R2TA 4DR7J 2ILYA 5DO2A 1BQXA 4C8OA 4ZN1A 1JXVA 1IQZA 5LSLA 3NWGA 5MLCV 1RWPB 2GIQA 2R7VA 3M32B 4K4SA 3DI6A 2AYMA 4WYLA 4RZRA 1HI8A 4EZ6A 3M7VA 3QRQA 3F44A 4B17A 3HVTB 3N79A 2C3MA 3B82A 3H5XA 1UVJA 4JV0A 3UD4P 3TYTA 4LFBF 2DJWA 5HLFA 2C3OA 1GX6A 4X62F 4J9SA 2ZJRQ 3PW7A 3UNYA 3G6ES 3LANA 1CBKA 2G2OA 3JTPA 3RAXA 2GMHA 2HWTA 2ZOFA 2UVUA 2ZH4A 4KKOA 4MK7A 1XNQF 1EIYB 2XNQA 3QIDA 1HI1A 2VBYA 1RAJA 2DYAA 2KL8A 2DRBA 3KLEB 5E41A 4CO1A 2EKNA 1MNEA 1ZH5A 2CQ0A 1LWFB 1RCXB 2QFJA 1R8BA 4ED3A 1LWXA 4I64A 2I0XA 1RWOB 1FE4A 3T5HA 2DNZA 4WZMA 4X66J 4L76A 1CJTA 1HMVB 1FNMA 3BEGB 2FHOB 3KYLA 3U02A 1U2RA 3G87A 2E1MC 4URGA 1AZSA 3GV5B 2F3JA 2GMJA 4BWMA 1WOSA 3M30A 3UVJB 5DRKA 1SCJB 5A0YA 1KOHA 1AYEA 4YB7A 3VVTA 1M5SA 1RT4B 4RW4B 4EGLA 3D2WA 3IWLA 2QLWA 2YWKA 3C14B 2N3OA 1TKTB 2RRAA 4PKDB 2XZDB 1G7CB 3NL0A 3M2RB 3MECA 4ZVUB 3HKWA 1V5IB 3GIIA 3BGRB 1B4SA 1QUVA 4HTIA 4KH0B 2WK4A 1CJUA 2DGVA 1DTTB 3GIMA 4GO5X 1Q16B 1U0SA 2OEKA 4HHUA 5SUHA 3WBZA 1HNVB 2J0QD 3S7RA 3TUJC 3G8TA 3BBCA 4WPAA 3AOBA 4RUAA 1AZSB 2DEIA 1WACA 1KHVA 4J91A 4OFZA 3I4HX 4DX6A 1X4FA 2AKWB 2UUTA 1FEHA 5CCMA 1S48A 1ZYQA 1FNXH 3GSDA 4DR3F 2VDHA 4WWSA 1CG2A 3TR5A 2W2MP 5KFYA 1YBUA 3CCUS 2OKQA 3W9JA 3RR8A 2MJUA 2ZD1A 4OYWA 2HFZA 3KJFB 3OR1A 5KFRA 2BQRA 2X3DA 1H73A 2WB4A 4YN3B 4USHA 3MZIA 2CQGA 2NXEA 1HKAA 3DLGB 2P9CA 2DEJA 4IDKA 3QT6A 1LK5A 1GXUA 2IPOB 4DR1J 2V8HA 3DRYA 2E1CA 4K5SA 3QPIA 3WDOA 4B3SF 2HGMA 2CPFA 2ZDOA 1HNIA 2DY9A 4KO0A 2DH7A 2AU0A 1DLOB 3MHYA 1VQ5S 5ETRA 1VGYA 2DH9A 3FZ2A 1R43A 4ZIWA 2CDRB 1WTFA 3SSQA 2XYGB 3BH6B 2HHHJ 3CD0A 4B9NA 1QAXA 3ENAA 2I1RA 4DV2F 3KK1A 3NCRA 3IM9A 3KK2A 1YRXA 1FVQA 2YY3A 2MMYA 1Y5NB 5EN1A 2UXBJ 4PG7A 3FCHA 1D1UA 5GAGU 2JFDA 3T3FA 3MMJA 1BWEA 1DHMA 4QIEA 3CJ3A 1PAEX 4C7QA 3G86A 3N6NA 4P9SA 3H5SA 4ELUA 4AUKA 2D9OA 2IJNA 2R7RA 3TA0A 2EWHA 2MQ8A 3GFZA 4C8ZA 2RS8A 1OQ3A 2K06A 2V4JA 4OZ3A 1CSJA 5E3PA 2Y0BB 2X3GA 4HDHA 4NWBA 5F0UA 3QO9A 2QA2A 5J1PA 5HMZA 1VK8A 5FIIA 2H51B 2DISA 5C2CA 1RACB 1S0OA 2R8GA 4MT1A 1RAEB 3DHXA 2XMMA 4A48A 5HMWA 3PW5A 3UO0A 4DG1A 3BDPA 4JI4J 1CVJA 5L39A 1SV5B 1UCNA 1NKEA 2E7XA 4IG3A 4WBFA 4I69A 5J2QA 2B3TB 2HQCA 1HR0F 4CLFA 3MEEB 4U9RA 5DQIA 1FD8A 5J2MA 2RQCA 3V81B 5F41A 1VIOA 2HQ3A 5DLFA 1HNWJ 4PXCA 4LSLA 2RS2A 5L8RC 5DGAA 1RAHB 2EK1A 2W4DA 2F5GA 3IS9A 1ZBTA 3L3CA 2JOQA 4PRFA 4MK8A 3VAKA 4UW2A 3FQKA 3M1VB 3K8WA 5CYMB 2K3IA 5LXRA 1RAAB 1XK8A 1J5EJ 5A8WB 1REVB 4MK9A 4ZVPB 2FHJA 1A7GE 1DFDA 3PX4A 1R8AA 3MGJA 3M05A 1ZM4A 1RT3A 3M6UA 3L09A 2CPDA 1NJXA 2FUG9 2IYGA 2WCXA 3DXSX 3PO5A 4J9UE 1WEZA 1R89A 2HHTA 3H2LA 4DBQA 2UUBF 3VHQA 4K50A 1TP7A 1WD6A 2ZDPA 3CWJA 5T7LB 2OLWA 2CVIA 4CLSA 4KGMA 4ATNA 4TN2A 2RAQA 3OJSA 2N7YA 2ACYA 4C8YA 4KQZA 1XIQA 4D3GA 4BS2A 1JLFA 4HH1A 5HP1B 4H4MB 3D54A 4UOCA 3D0GE 1R31A 2BV3A 4PQUA 2OPSB 2HPUA 2Q43A 2RUSA 2RQMA 2RSQA 2ZH7A 1S10A 4Q2LA 4MYUA 2N3LA 3H2VE 3U1MA 3S1TA 1D8YA 4K4WA 4QR1A 2XO6A 1PKUA 1RT3B 4DDFA 2UXCF 1L3KA 2DR9A 2CJAA 3LH2S 4FYXB 3W1YC 4DR2F 2ZITA 1U02A 3RJMB 4F8RA 4AT1B 3C6TA 3IAS9 1C0UA 4CO5A 4CO4A 2D74B 2GVZA 2H65B 3W2VA 2IAJA 4B3OA 1B0PA 3IBWA 5GMEA 2H54B 2RMLA 4R0EA 3D7SB 2R8KA 3NS5A 2ZJQQ 4DUTA 2F4VJ 2HQIA 1H98A 1JKHA 4IFYB 3TAMA 3BM7A 4KTQA 1N4LA 4ED6A 4MTPA 2EFVA 2V63A 1KN6A 5AE2A 2MZJA 5RUBA 3V5RA 1REGX 1UWBB 2FVCA 5A6PA 3W2WA 4ZVRB 2L48A 1PJ5A 3UCZP 3NP5A 3AY0A 3PYEA 2EFPA 5HANA 3CJKB 2HFNA 1ZZNA 2XI2A 4NYOA 1HBNB 3PRVA 1N56A 1U45A 3N6LA 1PBUA 1PJ6A 1RT5A 4USKA 3ITHB 4Z7YA 1Q8LA 4OJHA 1FDDA 3JAMU 1C4AA 2JHEA 3UI3A 4C11B 5CYQB 4PWWA 3U7JA 1RKJA 3C6TB 2BJ8A 2KU7A 1RJJA 2L9DA 2YNFA 4M5MA 3FK4A 1LXNA 2H5EA 4A8MP 3ILJA 3TVZA 3IR6B 1RT7A 1X4HA 3CC2S 2BM1A 5D15A 1DURA 1RQ0A 3B4MA 3DOLB 1URRA 2XM3A 5IV3A 1FFSB 3CDEA 1RA7A 2RB7A 2MPUA 3L9ZA 4CO3A 2WB1D 1GMWD 3R3TA 3VZHA 3AB4B 3DU6A 3POTA 3IRXA 1K0VA 4L3NA 4OZ1A 1TFYA 5I3QA 2ZNYA 3A4TA 4GVLA 5GAHI 4LSNA 3VF0B 1RTIA 3PCOB 3ZFVA 1E6VA 3HLUA 2HAFA 1NPRA 5IXUA 1VISA 2R7OA 5HN0A 2MEWA 3QAEA 3P5TL 4UY8T 1VHFA 4X65F 4HVZA 5ADZA 2J8SA 1FCAA 3GE9A 1RT6A 3TOQA 5IWAF 3M9NB 3CDBA 2HWIA 1S9GB 2HNZA 4ELVA 2HMIB 3BO4A 4DU7A 2UU9F 4DF8A 4I7FA 1T05B 1YWXA 3C15A 3TARA 2PN6A 1JXLA 2K7JA 1ACMB 3CJQA 4I6AA 3WHIA 2FIUA 3I0RB 3VGUA 2OPRA 2G9OA 3M2UA 1TV6A 1BGXT 1BXNA 1Y3KA 3QIPA 3RTVA 4X62J 4DR4J 1SVDA 2RRBA 1JIHA 1SIZA 1NMEB 4G1QB 3AFGA 4DR6F 1NSPA 1X9SA 4N41A 1CULA 1T3NA 2E9ZA 1UFKA 3OSPA 3CEDA 2W7PA 3D9BA 4AXJA 2QZ8A 1VBYA 1ZETA 1QSLA 2XHCA 4PXBA 3HZGA 3QMQA 5H9FK 2FLOA 3PFEA 4NLOA 4XDCA 3JSMA 2PMZD 5IM0B 2AX0A 2NYHA 5LOQA 4HEA9 4I6YA 4E0DA 1NSKL 2NZ4A 2JDJA 4WP3A 4LR8A 2GQCA 3C8YA 2MGZB 1N6QA 1I94J 2EC2A 4UF4A 1Q53A 3DXBA 5B08A 4URQU 1K73T 4ZHRB 1CQMA 2JWNA 5CXTA 3KLFB 3ENVA 4ZMMA 3UDLA 3D3BJ 4NZ0A 3W60A 2VHGA 2L08A 3GFHA 3VAMA 1O51A 4F25A 4KC5A 2GVDA 2IBOA 2KJVA 3PXGa 4EK2A 5CD4H 2G2ZA 4DFKA 3NOGA 3L7PA 3ZZOA 3CF5Q 4EBDA 1U2FA 1RAOA 1WC4A 4ECWA 4S0MA 2E7VA 4NLDA 4CDIA 4NLSA 2AJ1A 2HLUA 3FEYB 1HYSB 3KOAA 3FNNA 3IAM9 2RRNA 2DNRA 2N4CA 4HACA 4ZN3A 1I6JA 2R7TA 2CQHA 1FTCA 5KFXA 3IM8A 4MMOA 2ZM6F 5GMKa 1N6QB 3GMGA 2MXYA 3SCKE 1WOPA 1J5OA 1VQ4S 1KVKA 3CDWA 3W66A 1U1NA 4B08A 2IM3A 2VV5A 1RSCA 4PXDA 3BGLA 3KDOA 2Y3YA 3CCWA 3I4PA 2GAGC 3KUGA 1F6TA 2BX6A 2RDIA 2JEJA 3KG1A 2FZKB 3LWLA 1NJYA 4F67A 1SC3B 4ZPAA 3R2CJ 5K8OA 3MOZA 3C16A 4RW6B 1U25A 1WTBA 4XPEA 4C3MA 2LXIA 3V4IB 3VGTA 3A13A 1S72S 1A0OB 2HSEB 2CAJA 3SIPB 2H3EB 2A2CA 4QWDA 4ZITA 3O1LA 1DTQB 3M4XA 2PGCA 1XTZA 2FJDB 1SQGA 2HFUA 1BY9A 1IKVB 1RT1A 4B9VA 3GZ7A 4ZP7A 3RB0A 2IA6A 3BSNA 4LBIA 2XZTB 1Y00A 2HURA 2ALYB 1J5OB 2DH8A 3BQ0A 3GR1A 4FKYA 1JLGB 5CZVA 4AQYJ 3JTOA 3O6QA 2X1BA 3JS9A 1RHMB 1S0VA 1JLQA 2AGOA 3D6TB
chains in the Genus database with same CATH topology
4OIXA 3TW0A 1H6KX 4AE5A 5D3GA 3HKZD 2HGNA 5G0RB 3PDNA 2MHEA 4KRWA 5EHHA 3IGNA 1HNVA 4TYAA 4Y2MA 4RW9A 5JVGQ 3CC4S 2I5JB 1X5SA 2NLWA 5DDQC 1QY7A 4KE5A 4M5DB 3V6KA 3CCES 4NLVA 3X3UA 4R5PA 1KONA 4P6QA 4X4TA 4A47A 2XC9A 4PPZA 4B9LA 3M9OB 5K9FA 1KSPA 3SXLA 3NLCA 2MJNA 3Q22A 2V94A 1ZAXA 2KXFA 2W4PA 1ROFA 3HVRA 1VFJA 2ZVSA 3JTNA 2DHSA 4H4OB 2ZHBA 2RT3A 1DJ0A 1JLFB 3BF4A 4RNMA 1RP5A 4YQWA 2GGPA 4EZ9A 1HNWF 2LQ9A 2LXUA 2DB1A 3NS6A 4JI3F 1TKZA 3DLBA 5GVQA 2V4RA 2AQ4A 4RU9A 4PQUB 2J6TA 2XLJA 4F3OA 2GC8A 1Y5LB 1RTJA 4ZPVR 1U1MA 3NNAA 1UEUA 3I31A 4JI6F 4X64F 2AGPA 2RDJA 4O3NA 1UA1A 4A8FA 2J0WA 5KFGA 3T9NA 3LP0B 2DGSA 4DJBA 1NKCA 2YWFA 1KTVA 1IKWA 4IOAQ 4OJGA 1QE1A 2HS3A 2HIQA 4ED5A 1VRUA 3DM2A 4DHVA 3N0VA 3PIPQ 1VBXA 4M94A 4FF3A 1SJQA 3NGDA 4LUBA 2WONA 4A8KA 2M8HA 4OI0A 5K14A 2RF2A 4NRTA 5KT5A 1U1OA 4J9NA 3RAMA 1YSJA 2CJBA 2RIJA 3DC2A 1MU2B 3SCJE 3KTQA 4TKTA 2XO7A 2KKHA 2DNYA 4CQ1A 3E51A 4ECQA 2MDAA 2DGXA 5H1SV 5KFNA 2LDIA 2BRKA 5SZTA 3AA8A 2C2RA 2R8HA 4ETZA 4A8WA 1TK0A 3EGWB 4JOUA 2FVQA 5A8KA 4H4KC 2CQDA 2GQQA 2PI5A 4Y2AA 3NCPA 2ATLA 4FXWA 2HHSA 2MQLA 3CO9A 1QAYA 2P6SA 1GXTA 3CD7A 5IT9Y 3HF5A 5KFIA 1S1WA 2FVRA 1OO0B 4UUWA 4IRKA 3T5JA 1CEZA 1AFJA 3S01A 3C3LA 3KLHB 1QSSA 5KG3A 3VAHA 3DLGA 3SFGA 1C0UB 4Y0FA 1IKYA 2QMWA 5I3UB 3HMJG 3OQ2A 4GC7A 3W2VB 5D8HB 2IAJB 3VTIA 1FNOA 4RUHA 4B3OB 1P8GA 3EZ5A 2YNHB 3VQSA 3PZPA 2YWGA 4NZ6A 4X4PA 1ELOA 4IOCQ 1FESA 4TLQA 4X2BA 3CJ5A 1TL1B 4WK3A 1H2UX 3IC1A 4HT7A 3IRWP 5K8MA 2Z8QA 4TYBA 3J7YI 5JVHQ 5KAKA 1JKHB 3BDEA 3TAMB 3O44A 3DDKA 4YEAA 4LF9F 1DLOA 1MWZA 2BA9A 2VKRA 3UCUP 1Z4UA 1X5OA 2KT5A 3OJUA 2QMXA 3MAHA 4C2MA 3PKYA 1RTHA 3RAQA 4ZOSA 2DNKA 3M8PB 1KLNA 4F4ZA 2CJKA 4IUFA 4M8LA 3UNGC 4NRUA 1IR0A 2DNLA 2MYFA 2FD2A 4E98A 1A9NB 1VRTA 2O01C 3B4DA 2DK2A 2GX8A 1NJIT 1MROB 1FO1A 5F8NA 3VCDA 2KXHA 2HHVA 2B7CB 3HZEA 1NEEA 2KZMA 4TU8A 5GAEI 2IM0A 5CQGA 4CCHA 3W2WB 3DMJA 2DR5A 2J6UA 1WHXA 3GB0A 2HVHA 4FPRA 5AXMA 1ZAVA 1PC4A 1HBOA 1KQGB 4M1KA 1K9MT 2M7SA 2XWXA 2Z2LA 2IVMA 3NNCA 4OI6A 1S1XA 3W7BA 1QE1B 4ECUA 2UZAA 3AJ1A 3R5DA 2VFTA 1VRUB 2MSSA 2XI3A 5DDPC 4IH6A 4HLBA 4EYIB 2RKIA 5GADI 1F0XA 2VFVA 3OXLA 3J7YU 2GQ2A 5K14B 1KTQA 3D5MA 4CTAB 1VQLS 4ZCMA 4QR2A 3NAHA 5BYRA 4NYPA 4A8YA 1HQEB 2OP5A 3QZ8A 3DU5A 2IC3A 2CJQA 4C0HA 4KR0B 1U24A 4NXNF 3N5BA 1QAIA 1JJ4A 2QE5A 5E2QA 3CCLS 1U1QA 1NK6A 3I0SB 1B0TA 3MI7X 2KT2A 1RT5B 4LQ3A 2GHPA 4LVNP 1VQ9S 2FJBB 1D9DA 2W8KA 2F8MA 3V4MA 2Z4PA 2XBPA 2W25A 2B9XA 5GAEU 1TKDA 1RYSA 4DLEA 2KRBA 3LO3A 3EPIA 5FD1A 4DV4F 4CT8A 4O44A 1FK9A 2F9JA 3CSKA 1T03B 2E7WA 3K5OA 3T5KA 4FF2A 4WU2A 4HYKA 5AJ3F 5KFJA 1FE0A 2CPXA 1A6LA 1T8EA 2OSRA 2FY1A 3BN4A 2UVWA 4PCQA 3MF5A 2K1RA 2ZUGA 3DRSA 4P7TA 2V9WA 2V2KA 1WNEA 1Z2ZA 2XMJA 1MMNA 1VQYA 2DPIA 4LMZA 3FFIB 3FSYA 1C2PA 5GADU 2M5YA 1SJ3P 5CZXA 2WTFA 2YNFB 3ICLA 3OXGA 1JNZB 1VQPS 5KG6A 4N77A 2GW8A 3QWUA 4NCBA 3R5CA 3FSIA 2Z2MA 4O3SA 4RNFA 5BYSA 3NGKA 4NLGA 2E66A 4B02A 3KJVA 2OJ3A 3N01A 1VLYA 3NG8A 3MMCA 4YB1P 5HMYA 3IN5A 2NQPA 4ZPBA 1WHVA 2XULA 1TKXA 3MEGA 3CB4A 3BO3A 2QO3A 4DN0A 4EWTA 1T94A 3TNVA 2FJVA 4Y34A 2KH9A 4IO9Q 3PW4A 4FBTA 1KQSR 1UP1A 3BSAA 3PEHA 4ZP6A 2KG0A 3H59A 4IKAA 1VRTB 4DPOA 5AE1A 1UW4A 4LF7F 3M8RA 2CQCA 2BOPA 1B64A 2DRAA 4X4RA 1QAJA 4M63A 1RT7B 1H38A 3KNAA 2YH0A 3FEXB 1PGZA 3H8YA 2OAUA 2YNIA 2VG5A 1SL1A 2Y1RI 3J81Y 4F26A 1CQNA 4K4YA 3VAIA 2ZZMA 2BYCA 2W9BB 2BJEA 2AWZA 3ZC4A 4ID5B 1SKWA 3CTRA 3T6BA 1E6YB 1VQNS 4DQSA 1NK4A 1D8ZA 3PJWA 5LJ3Y 1H2VZ 3OVBA 2HHUA 1FJGF 3MURP 2ZHAA 2WSCC 3KHRA 2DNQA 1I1GA 4DN9A 1VQOS 1NK7A 1S6UA 2DO4A 2FGOA 4QPXA 2FLLA 3KMQA 2MQNA 2X1GA 5CA5A 5L1KA 2JLEA 4O3OA 1T3OA 4OZ5A 5J1EB 2Q6CA 4OI3A 1JWWA 3BQ1A 3FRZA 3ZZPA 2QLXA 1FDBA 1SV5A 3C6UA 1FXDA 4ZS6A 2BACA 1ZAWA 2R4FA 1P6TA 4IG0A 2LU1A 4TQRA 2Y1JA 4A4JA 5HQ8A 5F8MA 3RBEA 1SJ1A 4KIAA 4R8UB 4O0IA 1S7HA 2BM0A 4OI1A 3POTB 4K4VA 1Q78A 3RRKA 3FRYA 4DV6F 4MKYA 2XZWA 1U48A 4JI1F 3IRXB 5DG7A 4DMZA 4O44B 3RYLA 1HBMB 5BJRA 2J9EA 1YJVA 4OZNA 1F5CA 4LJMA 4QOTA 4PWDB 4LF6F 1F5BA 3MEEA 3A8EA 4NYZA 1IXKA 5HBMA 2OO4A 3PO4A 1F60B 1VQ6S 4LSNB 1TL5A 4KFBA 1RTIB 3TAQA 5T14A 1E6VB 3CVKA 3PX6A 3BR9A 2EPIA 1U6FA 2P9EA 4WFYA 3THTA 3V81A 3TP2A 4DL0C 4P2SA 1HI0P 3CULA 2D3ZA 4CI0B 4WFAQ 3LALA 1N33F 3DDNA 3ZZZA 3MPWA 1RTDA 1FHTA 1X4EA 3HI9A 3J7ZT 3P6YC 3BGFA 1P1LA 4J9OA 4Y2KA 3O3LA 2UVVA 3AJ2A 3V6DA 1X0FA 1QVGR 5B09A 2AYGA 3EYZA 5KFBA 2OPQB 4CZCA 4X4UA 5A8RA 3EUNA 3GYXB 4CIOA 3VAGA 4ERDA 3G6YA 3MEGB 1YJNS 2IA0A 1WEYA 3SFUA 2DNPA 4GMKA 4L72B 5KG2A 2LVWA 1RT6B 4R25A 1KR4A 4IQXA 4IR9A 2W9AA 2P6TA 5KFPA 1IKXA 2JLFA 3IWNC 5IQ6A 2VD3A 2E5JA 5DQHA 4QBUA 3U27A 3H5YA 1Y5IB 2HNZB 1RK8A 5F9NA 2VQEF 4N76A 2BXJA 4CNYA 3M1VA 5CYMA 2LEAA 2MKCA 3HHLB 5KFCA 2J0XA 5LJ5Y 1MWYA 4CNZA 2VG5B 2UV8A 2A1BA 4KV8B 2J7KA 3NBPB 2VASA 4I2QB 4F3QA 1UAWA 3K8VA 3Q8SB 2FVSA 5C42B 2O3DA 2ZKUA 4DWIA 2MZSA 4I7FB 3T6JA 1Q7YT 2BQ3A 2C22A 5A8WA 1REVA 3TI0A 2KVIA 3OTEA 2XLIA 1ZTWA 2UXDF 1FXRA 4RBTA 4BBYA 4YDDB 2VA3A 2XG8A 4WXWA 1KQKA 3M9MB 2VQFF 4ED7A 3MUTP 2DT9A 1TR0A 5KFKA 1FRKA 5FDLB 4W90B 4K4ZA 3JYTB 2PE8A 2F8HA 1IJFB 2OPRB 3M2UB 1TV6B 2C28A 4I67A 5KOXA 1S0MA 3QIPB 2MY8A 4RNHA 2RE1A 1T7PA 1SL2A 3IO1A 4QYRA 4QW9A 4F4WA 4KPYA 2FJWA 3LAKA 2CFXA 4N8OA 3BJYA 1GXLA 3QJPA 3BSCA 3NRBA 1S99A 3ETOA 1O0PA 4HDGA 3DOKB 2C3PA 2ZC3A 2D3OR 5D4LA 3G4SS 1MMLA 3PV8A 2Q3PA 2PEHA 4XPCA 2MKJA 2VPWB 5T7LA 2CZVC 3FMWA 4DV5F 3KNGA 2QA4S 4PWUA 4IOBA 1M5OC 4F2SA 4ILMA 2E1AA 2XMVA 1OSDA 2EFQA 2VL1A 1NNDA 1UJ4A 3OTBA 4Y65A 1W2IA 1VS3A 4KHMA 2ZH9A 1IBLF 1XBWA 1D9FA 1GX5A 4DR1F 3LAMA 4D3HA 3D1HA 5IS2A 3E3XA 3K5PA 3PJXA 2RUGA 4RU2A 1WWHA 4DEZA 3OLAA 2BE2A 4RW8A 4O3QA 3KLIA 3FGVA 2HAIA 1LWEB 5EUHA 1DRZA 2AV5A 3V2UC 2EVZA 5LL6d 2BANA 3PM9A 3OL9A 2CZ4A 2KN4A 3MM8A 5KFFA 3KHGA 2ZHOA 2YKOA 3PY8A 4RWWA 4C8MA 2COLA 1M5HA 2G4BA 3JSMB 2B43A 2PC6A 3MR3A 3CC7S 1Y9OA 1OS5A 3SYZA 5HP1A 2VBWA 4H4MA 1O5JA 2VOPA 2B9YA 1VJWA 3LP2B 4Q8EA 1HPZB 2SXLA 3QZ7A 1WHYA 1HHTP 2OPSA 2XS2A 1IN0A 4QWBA 1WF2A 1JXEA 1SUQA 2ZOMA 1ZZFA 2MKIA 2VG7B 1L5UA 3OBIA 4X84A 1H7WA 4HHJA 3T1YF 2PO4A 3ZZRA 1SIWB 2ROGA 2KG1A 2V8VA 1R7IA 2F8EX 2J7WA 4J9LA 2MHNA 1TL3A 4R0JA 1EETB 4ZCIA 2HHHF 2OTLS 2VPXB 2WW8A 4AL6A 2GV1A 1V3RA 3QLHB 5F8IA 3SQGB 2R2TA 1SJFA 2HNYA 5KT7A 3MFIA 4J9MA 4NA3A 2ILYA 5DO2A 1BQXA 1ZM3A 1R8HA 2LEPA 1YJUA 4C8OA 1IQZA 1WG4A 3MEDA 3ULHA 5LSLA 7FD1A 3UE2A 1NO8A 3NWGA 3H98A 4EBEA 5MLCV 2GIQA 4G1IA 3M32B 5DETA 4K4SA 3DI6A 2R7VA 2AYMA 4WYLA 2A18A 4A8XA 2OPPA 2BUNA 3B8HA 1HI8A 4RZRA 4DFMA 4EZ6A 3F44A 4B17A 1MSWD 3H2UB 2XSFA 3HVTB 1HWJA 5LMNF 3N79A 5DDOC 3BS9A 2C3MA 4FP9A 2DGQA 3TO8A 4CH0S 3B82A 3H5XA 2KXNB 1UVJA 4JV0A 4ES2A 1TL4A 1Z1ZA 3P3DA 3GG0A 3UD4P 3TYTA 5AXLA 3FDSA 2ZH2A 4H4KA 4LFBF 3PX0A 4Q0BA 1B7FA 3FZBA 1LW2B 1BLUA 2CIMA 2YX7A 1FKOB 4NA2A 2V4QA 5DJBA 1W2BR 1KFSA 2DJWA 1SQEA 1JLBA 2C3OA 1GX6A 5HLFA 2UP1A 4X62F 3P49B 2FPHX 1FF2A 4YP3A 4JI5F 2NSBA 2Q79A 2XMUA 2VG6A 4DUZF 4J9SA 4ECSA 3PHEA 2ZJRQ 3PW7A 2M70A 2CVEA 4JI8F 1SH0A 4NCGA 3GWCA 3G6ES 4G1PA 3LANA 2MZQA 4IFYA 4DV0F 1N0VC 1YI2S 3JTPA 4BDPA 1G2EA 3RAXA 2ZH5A 2XNRA 2DCLA 1CLFA 1JK9B 2GMHA 1FJCA 3PFOA 1NJWA 1S6PA 5F8GA 3HDSA 4B9VA 3QWPA 2LECA 2HWTA 4YOEA 6FD1A 2ZOFA 2UVUA 1Q82T 1TFWA 2MB0B 3G96A 2ZH4A 2B51A 4KKOA 4MK7A 2HLTA 3KLGA 4O4GA 4TU9A 2B9WA 4DOZA 4BHQA 4YHHF 1XNQF 1UWBA 4EYHB 5CHCB 3LP1B 2APOA 3W3SA 5HROA 2XNQA 5K8PA 2OIHA 2E5LF 3I55S 3LUYA 4ZCLA 3QIDA 2XSJA 1HI1A 2VBYA 4Q7AA 1RAJA 1N5YA 3OUYA 1FJ7A 2OMOA 1FRHA 4DLGA 2JSXA 2ADCA 2JEGA 3SI8A 2PA3A 2HHXA 4ZDNA 3I56S 2DRBA 3KLEB 2AYBA 5E41A 1SJRA 3SCLE 4CO1A 2LEBA 4ZPCA 3PIOQ 4NLWA 4LIRA 3CJKA 2FB0A 1ZTTA 2FHJD 4YB5A 1P9QC 1MNEA 4IQMA 5F9LA 1YQHA 5LSRA 3E2EA 2CPYA 2HW3A 1ZH5A 2CQ0A 1LWFB 1HBNA 2QFJA 1R8BA 5J2PB 4ED3A 3QAUA 3HHKA 3PR4A 3MEDB 2HNDA 1KRPA 5HO4A 2DGWA 4ICLA 2KHDA 4I64A 3CMES 3BR8A 4RW7A 2W7AA 1JJHA 2I0XA 2WOMA 1G6BA 1JJ2R 3OR2A 3L95X 4OX9F 4BC7A 3ITHA 1X4GA 3K2YA 1FE4A 4RNOA 2F9DA 3F41A 3OFFA 4WZQA 4QWCA 3T5HA 2DNZA 4WZMA 4JBCA 1M1KT 3VQTA 1VQKS 1QVFR 2EBGA 5MAOA 1C1BA 4F3MA 1HMVB 1SL0A 4ZCKA 3HXMA 4C11A 1FNMA 5CYQA 3BEGB 2FHOB 3KYLA 3U02A 1U2RA 3HP6A 2WAQD 3TUZC 1JLAA 4OJ1A 2B5JA 3K5NA 5C24B 2GJ2A 1F9FA 2E1MC 4O3PA 4URGA 3VWSA 1U8SA 4UY85 2H9ZA 1GH8A 3GV5B 2F3JA 2GMJA 1XR6A 4BWMA 3IA0A 4Q44A 3AH6A 2PD1A 1S97A 1FERA 5KG1A 2ROPA 4KT0C 3M30A 2W9CA 3RBDA 3VALA 3MR6A 2KI2A 5DRKA 1Q81T 2VH7A 2MQPA 4MIWA 4PUOB 4I6WA 5M2RA 2B4UA 5G4DA 3K5LA 5A6WA 1NK9A 5A0YA 1KOHA 1S6PB 4QJVA 4YB7A 4NX9A 2K3KA 1DQAA 1LWCB 2JX2A 3CCRS 5I4MA 1M5SA 4O4GB 1C1CB 3L7OA 2VFRA 1K1SA 1RT4B 4RW4B 4EGLA 3VAFA 4XO0A 3D2WA 3DN9A 3M8QB 5BR8F 3IWLA 2M0GB 3BZQA 3K0JA 5AXKA 5H9EJ 1LOUA 3AQPA 1S1UA 2QLWA 2YWKA 5KFDA 2KM8C 3HPOA 2BR0A 1EP4A 1FXLA 2N3OA