3EGZA

Crystal structure of an in vitro evolved tetracycline aptamer and artificial riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural basis for specific, high-affinity tetracycline binding by an in vitro evolved aptamer and artificial riboswitch
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3egzA00
2D9OA 3B4MA 4LMZA 3H2UB 1WHYA 2RRBA 2FY1A 1D8ZA 3VAJA 1WG5A 5DM6Q 2KU7A 1QVGR 1N88A 2A3JA 3CXCR 1X4BA 2ERRA 1HL6A 2RRAA 1S79A 2DK2A 1YTYA 3MXHP 1FHTA 1VQMS 3CCUS 2J0QD 1OO0B 2DISA 1IQTA 4BS2A 3G9CA 2PEHA 3PIOQ 1U1QA 3J7YU 3R1HA 3CCES 4WFAQ 1U1OA 2M9KA 2X1AA 2J8AA 1WELA 3JB9k 2D3OR 3P3DA 1WF1A 2DGSA 4V19X 2F9DA 3UE2A 2KXNB 1JJ4A 2XNRA 4QPTA 2CQBA 5DETA 2GO9A 5LXYA 3VAHA 2DB1A 2M88A 4OZ0A 2CPXA 3G71S 1S72S 1DBDA 1VBYA 2X1FA 3CCQS 2E5HA 2CPIA 1W2BR 2M7SA 3HI9A 3VAGA 2LCWA 1VQ7S 1VQKS 1U6FA 1JJ2R 5DDRC 1Q81T 1WHVA 1X4EA 2MHNA 1VQLS 1SJ3P 1FJEB 4IUFA 1M1KT 1YWXA 2XS2A 1UFWA 2CQHA 2CQ1A 2WBRA 1YJNS 1FJ7A 2E5GA 4F02A 2ZJRQ 2J0SD 3MD3A 5DDPC 2CQ0A 3VF0B 1FXLA 2KYXA 2MZTA 2F9JA 1K8AT 2YH1A 2FC8A 3FEXB 1F9FA 4WFBQ 2M8DB 1SJQA 2DGUA 2ADBA 3CULA 1YI2S 3NS5A 2OJ3A 1ZZNA 2MKHA 3D2WA 1SXLA 2LQ5A 3MI7X 1UAWA 5JVGQ 4UY8T 2LA6A 3SDEA 2CQDA 5IM0B 3L3CA 1U1KA 1H2TZ 2JWNA 3VAKA 2PE8A 2MY7A 3MD1A 1ZZFA 3IRWP 1A9NB 2DNZA 1VQNS 1KOHA 5CA5A 3S01A 4U67Q 1SJFA 1URNA 2MJUA 3R1LA 3TP2A 1OPIA 1KC8T 1VC5A 2XS7A 2KVIA 2G1DA 2XNQA 3I55S 3CPWR 2JVRA 2MZRA 2DIUA 4TU9A 5IQQA 2N3OA 2JX2A 1WEXA 2KRRA 2M4MA 3R27A 2LKZA 2HGMA 1YHQS 2JRSA 5LJ3Y 2G4BA 3VALA 5FJ4A 2KG0A 2QFJA 2RQ4A 1P27B 1R8HA 4TU7A 3ULHA 1M5VC 2AYBA 2CQGA 4IOAQ 1CVJA 3MUMP 2L41A 5H1SV 4FXVA 1YJ9S 2DGQA 4A8XA 2MGZA 4CH1A 4TU8A 2DHGA 2DNGA 3IWNC 2DHSA 2CQCA 4FXWA 1DZ5A 2DNHA 2MYFA 5GAGU 4J5OA 3Q2SC 3PIPQ 1U1LA 5BJRA 2CPDA 3NMRA 2MQMA 2OSQA 1WI8A 2OSRA 1YJWS 1H2UX 4WIIA 1UW4A 3EGZA 3B4DA 2DH8A 1U2FA 1X4GA 2I2YA 2RVJA 1M90T 2MQNA 1X4HA 2U1AA 1X4CA 2MKJA 2X1GA 2B0GA 2MSSA 2X1BA 3CC7S 1X4FA 2DO0A 1VQ4S 1QVFR 2UP1A 3DXBA 3I56S 1VC6A 2MXYA 1WF2A 1M5KC 2AYEA 3EX7B 2KM8C 2MY8A 2Q79A 4PR6A 2MKSA 1H2VZ 2OTJS 2MZQA 2K8GA 3HHNB 2YH0A 3ZZYA 4Z2XA 2J76E 2AYMA 3S6EA 4EGLA 4IO9Q 1YITS 2L9WA 3MOJB 3BEGB 2KI2A 3Q2TC 2EVZA 3S7RA 3S8SA 1U6BA 1JJHA 2RS8A 2MMYA 5GVQA 1KD1T 2N3LA 4QQBA 2DNOA 2E5IA 1X5SA 3CCSS 2QA4S 1X4AA 2MQLA 2O3DA 2CQIA 2M0GB 3MURP 1K73T 4ED5A 3J7ZT 3RW7A 3CC4S 1Q7YT 1FNXH 1NO8A 1DRZA 1WEYA 1JMTA 2LA4A 3U1MA 2FC9A 3P5TL 5JVHQ 5GAEU 3SDEB 5GMKa 2DHXA 3CF5Q 4WFNQ 2HVZA 4Y00A 2D9PA 3VAMA 4YUDA 4C0OC 2MZSA 2NZ4A 2FHOB 4W92B 3K0JA 1WEZA 2YKAA 5DDQC 4UQTA 2KFYA 3CCRS 4CQ1A 4TLQA 1SJ4P 2E44A 5ITHA 1YIJS 2CQPA 4YOEA 2MKKA 3UWTA 2CPZA 1VBZA 2KT5A 3ZZZA 2OIHA 2EK6A 2MQQA 2DGXA 1UP1A 2HZCA 3H2VE 1G2EA 2DNLA 4P6QA 3BO4A 1RKJA 5GADU 3US5A 4F25A 1HD1A 1U1MA 2NLWA 3CMAS 1D9AA 1NU4A 1H6KX 4CH0S 1NJIT 2DNYA 2RQCA 3UD3P 1XN9A 4RU2A 2L08A 2CPYA 3UCUP 3P6YC 2M52A 3UCGA 4F26A 2XS5A 2BZ2A 4YB1P 1PGZA 1QM9A 3G6ES 1WHXA 2RUGA 1X0FA 1X5OA 5D77A 5DDOC 2MZ1A 1WI6A 2FPHX 1FJCA 2CPFA 2DIVA 4W90B 3CC2S 2KRBA 5HO4A 5GAHU 2CJKA 2CQ3A 1VQ6S 1N52B 2DGTA 1RK8A 2DH7A 5LSLA 2F3JA 4LJMA 1KOOA 3NNHA 1N54B 1U1PA 2M8HA 2GHPA 3UD4P 2VOPA 2N82B 2CPEA 2LECA 2ZJQQ 2CQ2A 3OW2R 2DNRA 2HGLA 3NNAA 1VQ8S 1R8PA 3CCMS 4WKRA 1B7FA 4CIOA 4PRFA 1FO1A 3BO2A 1VQOS 2DGVA 3G96A 1X4DA 1O0PA 2DNNA 2DNPA 1KQSR 1AUDA 3EGNA 2DGWA 3G8SA 2YTCA 2AYGA 2M2BA 2N7CA 2MKIA 4C4WA 3UCZP 2E5JA 2XB2D 1U1RA 2LYVA 4PKDB 4WCEQ 2XSFA 2RS2A 2VONA 2ADCA 1L3KA 2MQOA 2K3KA 2KXHA 2MZJA 3MUTP 1Q86T 1ZH5A 3CD6S 4ERDA 3CCLS 5CXTA 1P1TA 1WF0A 3V4MA 2DO4A 2CPJA 2YWKA 2KM8B 3MDFA 1VQ5S 2BOPA 1FT8A 2MQPA 3THTA 1OIAA 2LEAA 2EK1A 3CCJS 2JVOA 2VODA 2MKCA 3CCVS 2KN4A 1N8RT 2KH9A 3NNCA 2U2FA 3CTRA 3TYTA 2OTLS 1WWHA 5IM0A 2CQ4A 2DHAA 3THPA 2DH9A 2HGNA 1WHWA 5D78A 2KG1A 2G0CA 3LPYA 3BS9A 5LJ5Y 3BO3A 2DNMA 2RT3A 1U1NA 2HYIB 2VOOA 4QU6A 1VBXA 1OWXA 2CPHA 2KXFA 2MSTA 2AD9A 1K9MT 2ZJPQ 3FEYB 2MJNA 4LIRA 1M5OC 4WF9Q 5DM7Q 3LQVA 4IOCQ 1A7GE 2V94A 3SXLA 1WG4A 2I38A 4ZKAA 2DITA 2DNKA 5CYJA 3DLLQ 3NS6A 4M5DB 3SMZA 2RNEA 5HL7Q 2LXUA 2QEXS 2DNQA 5LXRA 1WG1A 1VC0A 1M5PC 3P49B 3N9UC 3G4SS 2MPUA 5EN1A 1WTBA 1X5PA 1Q82T 1VQPS 4C7QA 2DGOA 1X5TA 5MLCV 1SJRA 5IFMA 3G8TA 1VQ9S 1BY9A 2MB0B 3VAIA 4OZ1A 2RU3A 3CUNA 3VAFA 1HD0A 1PO6A 2M70A 1DHMA 2KHCA 4QU7A 3CMES 1HA1A 2SXLA 4Y0FA 2MGZB 2LMIA 3U1LA 2LEBA 2LXIA 5LSOA 3MUVP 3RW6A 3TO8A
chains in the Genus database with same CATH superfamily
4USWA 2UUAJ 5F9NA 2RDJA 4XDDA 3ET6A 1X9SA 2NXJA 2K2PA 4KV8A 3M32B 3TW0A 1N5SA 1X8DA 3OFEA 2C2RA 3KHLA 1LW2A 5K20B 4WFAQ 5E5NA 4M5HA 2PSZA 4U7UK 3JB9k 2DGSA 4ZVEA 2V4RA 5DETA 3FEZA 1DTQA 2BMBA 1S1WB 3K89A 3SSRA 3FVYA 2XMMA 4C97A 5DDRC 3PRVA 2CQ1A 4LF8F 3D6FB 1FXLA 2KYXA 5J2QB 4CO1A 2PEBA 4ELVA 2A6MA 3GV7B 2MDAA 1ZZNA 2MKHA 4PQAA 3KYLA 3PV8A 3MI7X 5JVGQ 1FFWB 4FF1A 3UD5A 3O6QA 2Q66A 1GMVA 5KFDA 1AZSA 1VQNS 4U67Q 2VG5B 2RHQB 4HACB 1XEZA 1LV5A 3CO9A 1R6VA 4O3NA 4CO5A 3ZZ0A 4BC9A 4LIWA 4WU2A 2KG0A 2BXJA 1S6UA 3HHLC 1DAXA 3CGIA 3GIIA 4P2FA 2AYBA 1CVJA 4RZRA 3LOUA 3KLEB 2VKZG 4M95A 2BR0A 1UCNA 3NMRA 3I82A 2ASYA 2ZD1A 4DX6A 2IDLA 4V19J 3MPVA 1U8WA 3LA0A 3G6YA 2I9SA 3AXKA 2GAGC 5LL6d 2AMCB 3C14A 3NKYA 3QZ7A 2ZDPA 1VK3A 2C2KB 2IC3B 1XBWA 2H4YB 2Q79A 1YJVA 2BYCA 4F4WA 3W2WB 2VC1A 3J7A1 4FF3A 2D74B 2J76E 3MOJB 1HNIB 3W63A 3U02A 2QA4G 4P72A 2BABA 3QO9B 3CCSS 2O3DA 4Y2AA 1ZA2B 3MURP 2HIYA 3BGRB 1OSDA 1WDDA 2FB0A 4L76A 4P2SA 2V2QA 4RW7A 1JMTA 9RUBA 3UDVA 2YX7A 3MR3A 4K0KJ 2H48B 1XQIA 2H3EB 2XG8A 3QT5A 4I4BA 1FK9B 1HBOB 2CFXA 3QGHA 1UL3A 1VBZA 5LOQA 1N48A 1H98A 4L72B 4J90A 2MQQA 3PJ9A 4JI7J 3CDBA 4GKJJ 2BKPA 3A8KA 4DXLA 1WACA 1T03B 3GIMA 4F26A 2AU0A 2VZ9A 5AE3A 2R7XA 2EFGA 3PW4A 4USTA 2XWXA 3UVJA 3M1VA 1X0FA 1WI6A 2FPHX 3IM8A 3CC2S 2BJ1A 5HO4A 3TEHB 1KLNA 5GAHU 1UVNA 3EPGA 3BJYA 2KO1A 4LJMA 1FKPB 5ETOA 4KH1B 2HBYB 2ZJQQ 4AD6A 2UUCF 4NMLA 1NDLA 4PUOA 1K44A 3M8PB 3M8QA 4LF4F 3MFIA 1U25A 3BGFA 2ZBQA 3CDEA 2N7CA 3UCZP 2ZDOA 3SSSA 1RA6A 1CJTB 2XSJB 4M5GA 3EXCX 2D7SA 1S10A 2CPJA 3BR9A 4C8ZA 2ZOFA 2AW0A 1OIAA 5E3AA 2AQ4A 4OHXA 3RB4A 1FJGJ 1WWHA 4DLEA 2DH9A 2V34A 4R0JA 5KFRA 2YNIB 4XDCA 4QU6A 2CPHA 2FJXA 2FLNA 1AA1B 4DLGA 4B9TA 1Y5NB 3CJSA 3LQVA 2V94A 1JLGB 4Q45A 2DITA 2BM0A 2V2KA 2UV8A 2GQ2A 3GILA 1RT7B 1RXOB 5J2PA 2A6OA 2C28A 3RZAA 1LNQA 4MFBA 4Y2IA 1MWQA 3AJDA 3V81B 1PO6A 1PYSB 5LSOA 1NHKL 2C2EA 4QYZK 2FY1A 3GJRB 3IS9A 2A3JA 3M6VA 3DCAA 2C3UA 2DK2A 2IRYA 4JV2A 2V4JB 5T41A 3MXHP 1VQMS 1OO0B 2DHHA 4F4YA 2NYIA 1I1GA 1U1OA 3RAQA 2X1AA 3LTOA 4CLPA 4FNHA 1M1GA 4C2MA 2JC0A 3SFGA 2KXNB 1WNEA 2XNRA 2L48A 4OV1A 4LRFA 4KB7A 3VVTA 5HP1A 2E5HA 4JI8J 3HJFA 4YQWA 1BMQB 4PABA 3W64A 1XJWB 1G6BA 4DV0J 3BGUA 2K1RB 2GVZB 3WIUA 2YKPA 1F9FA 1WOOA 2OAUA 4OQJA 2AGOA 3OVBA 1I94F 4X66J 1UAWA 2ILYA 5I3UB 2OEMA 1S4FA 1YKWA 1RT1B 3T3FA 3BH6B 2OO4A 2HNYA 2OKQA 2AWZA 3ZNUA 2FGOA 3QGPA 2HQGA 4JI6J 4N41A 3JTNA 2WRMA 3SCJE 2NS1B 3FMBA 1WEXA 3H98A 3TAPA 4OLPA 3PW2A 2QFJA 1XTZA 4DV4F 4DR5J 4P2XA 1IWAA 5H1SV 4A8XA 2JLGA 2YKQA 3HHLD 4FXWA 4YN3B 4J5OA 3D28A 2OSQA 1FA0A 2KVQE 4P9SA 1V6HA 4DSEA 2E66A 1S6QA 4OZJA 5A0YB 1X4HA 3R5CA 2YWEA 3CE8A 3G6VA 1KTVA 3BSAA 3K8WA 4UOGA 2CZVC 4Y6IA 2UXDJ 2W9BB 2L9WA 2KI2A 5KAKA 1KVIA 1F0XA 3QGIA 4DJBA 1OPZA 1TQLA 4NXMF 2PIIA 4B9MA 4F2SA 1GTHA 1GNKA 4ED7A 5LMNF 1HNVB 4CLTA 5C42B 3J7ZT 3F73A 1NHUA 1RABB 4ITSA 4O3OA 1QUPA 3OL6A 2KKHA 4CNZA 5K14B 3VZHA 2DHXA 3CCZA 1J27A 3GV5B 2IMWP 3OR2B 1X9MA 4DR6J 1PBUA 4NZ6A 4G1QB 5E41A 4F3MA 5K8OA 2XCPA 1TVRB 2OPRA 4R8UA 2YNFA 1YK9A 1KRPA 3TAQA 1RZMA 2PT0A 4WXWA 1FWPA 2HFOA 1V9OA 3T5LA 5D77A 2ZUAA 4RW8B 1TUVA 2V2VA 4W90B 4UTGA 5C25A 2QC3A 1VHIA 4S0MA 1UWBB 4N77A 4DV3J 3T5JA 4A4JA 2V2ZA 3ETOA 2C3MA 4PG5A 1QAXA 3EZOA 3H0PA 2PI4A 3BO2A 1URRA 4RW6B 2DGVA 3HULA 1VRTB 1EIYB 2R7QA 4MT1A 3GIKA 1WSRA 3NAIA 5LM7E 3C15B 1ZH5A 2HQFA 5B08A 3H5SA 3OFHA 4BWMA 1KLMB 4GVBB 4JYAF 3MPDA 2EK1A 1S1TB 2GV1A 3W3SA 3NGRA 4H4KC 1JLEB 3TR5A 2R4FA 1GXTA 2RT3A 1VBXA 2E7VA 1RWKB 4R25A 2DVIA 4CO2A 2ALYB 3R7BB 5G0RA 2J9DA 5IS2A 3M7VA 2B4OA 1WG4A 4FS2A 3K17A 4GRSA 2YPZA 1WG1A 2VA2A 1SV5A 1JLCB 2ZH1A 2DGOA 4TXSA 1KEKA 4PWDA 4O23A 3UW1A 4A8YA 4DSJA 2HKEA 4AL5A 3VAFA 2NCKL 1Y4ZB 4ZJOA 2EFOA 4O44A 3UNYA 4QU7A 1ROFA 3DOKA 3PYEA 2EPIA 4B3TJ 2QL5B 4TNOA 3RRHA 3DYAB 3PYDA 5L8RC 1XNRJ 4TYAA 1U6ZA 2IVYA 1S77D 3OFFA 3WZ0A 3TJ9A 1S1UA 1IQTA 1ZS6A 2ACMA 3TZYA 2WOMB 1S4EA 4ED0A 3MCOA 2AJ1A 4ZVOB 4X4TA 5LXYA 2DB1A 1RBOB 1S72S 3EMTA 3HK2A 2Z56B 1T95A 1S9EB 4H4OB 3EZUA 1KONA 3OSPA 1X4EA 2Y1IA 1YWXA 2XS2A 1BD6A 1UFWA 1FJ7A 3ISND 2ROGA 2J0SD 3D54A 2B9XA 5HANA 1PCAA 4HH0A 1FWKA 1SJQA 3S1TA 4ZPWR 4ZCKA 2V63A 1B0PA 4DG1A 3TA0A 3TVYA 2IYGA 5IM0B 3J81U 2EI5A 5IV4A 6FD1A 3GFZA 4JI0F 2PE8A 1FFSB 4CCHA 2H9ZA 2W8LA 4J9PA 1E6VA 3TP2A 1KC8T 5KFMA 2XS7A 3PO4A 3DI6A 3OL8A 5JMNA 1J5EJ 4Y65A 2AJQA 2H4WB 3R5JB 3WX8A 2VKRA 2YY3A 2EG1A 1RB0A 2P6SA 1ZOTA 2WK4A 4ETZA 3E01B 4OX9F 4TYBA 2VU5A 4YHHF 1S7HA 1F2GA 4HHJA 5GAGU 3PIPQ 4NLQA 2CJYB 3QYYA 3DXSX 1YJWS 4DR1J 1IKYA 1R0CB 4KV8B 2P9GA 2Q6BA 4UY85 3D68A 3QMQA 2B0GA 3OJSA 3OVAA 3TZXA 3MR6A 4ATNA 3MR2A 5KT4A 3FCVA 3GFYA 4LSZB 4GC7A 4OX6A 2IM1A 4EGLA 1HHSA 3UO0A 5DQHA 3DN9A 1N33J 2GHWA 2EVZA 4M1KA 5IT4A 1I51B 4CLSA 2OFGX 3O8WA 2N3LA 3HPOA 3EYZA 1NK6A 3RR8A 4UOCA 5F8IA 1RT3B 3DMJB 4P52A 3RAMA 4WYLA 4WP3A 4XTTA 1CLFA 3KHHA 4OI6A 2ZH7A 1RAHB 1OYDA 1ZM9A 5GMKa 4OHVA 2G1HA 5CAAA 2HHQA 4LBPA 3PFOA 3PNIA 4DUYF 2MZSA 1AZSB 1QAJA 3W9JA 1HPZA 1F6TA 4YDDB 1WC5A 1AFJA 1U49A 2BEFA 3GCXP 4LF8J 4LF1A 2PMZD 3T19A 2HZCA 1RBAA 1TAUA 2NLWA 6FDRA 1NU4A 2ZZTA 2VFRA 2HNZB 3A3OB 2FQQB 4QR1A 4PG8A 3ITHA 4DL5A 1XK8A 3I9ZA 3Q8UA 2GJIA 3VCDA 3K58A 3TX0A 4NLGA 4NA2A 4IG0A 3SSQA 2GS8A 1Q5VA 2XY7A 3C14B 5SZTA 4P10A 4K2JA 1X60A 2VFTA 2WONA 1RWVB 4KGVB 2BQ3A 2B8QA 2LFVA 4RBUA 4WCEQ 1FFGB 2ADCA 2MQOA 1Q86T 4HT5A 1NKEA 3LP2B 3KJFB 3DDIA 2KM8B 2AV5A 1LWFB 2HHSA 5ETQA 3EE3A 5KFZA 2KN4A 4NCBA 5C2CA 2A2DA 2O66A 2GVDA 4F50A 2XI3A 2XZDB 4I0WA 2VC0A 2OHDA 2DNMA 4OI3A 4RW7B 1H72C 4RNFA 2VPXB 2XWYA 5HBMA 2ZJPQ 3BDEA 1EKSA 2VL1A 4KT0C 4HDGA 3EICA 4RW9A 2FD2A 3IG1A 3G2XA 1S49A 2I0XA 4RX6A 2Z2YB 5DO2A 1UMJA 2WVEA 2G9OA 2XBPA 4CO4A 2O01C 1JXLA 1T0TV 2ILZA 2HVIA 1BY9A 4NEYA 2NPIA 2OP5A 3RJMB 4ZPVR 2I5JA 4HLBA 5E0OA 1IKXB 1XMOF 3EVWA 2ZH2A 4QYZJ 3ZZPA 4B3OB 1N5TA 4DN0A 1JX4A 3I87A 3UVJB 3M1VB 2ERRA 1V3ZA 3CCUS 2DISA 2PEHA 3LPEA 4WXOA 3CO0P 5AXMA 3L4BC 4DX5A 4QW9A 4URGA 3HDSA 1HNZF 3UE2A 3SCKE 4CM0A 1NHVA 3AHPA 2MQ8A 1DBDA 5EHHA 1S0MA 4DV5J 1TL1A 3E2EA 1PYTA 3I31A 4RKUC 2Q6CA 1B0VA 2MZTA 1R27B 3GE9A 3GCWP 3BSNA 2MLXA 4NA1A 2ADBA 3OPKA 4P7VA 3CJKA 4DR4F 1XNQF 5BYSA 3D67A 1N0VC 3Q8SB 2UUCJ 3JAMU 3HVWA 5HQLA 2KB2A 2CNLB 4LF4J 4FP9A 3ADAC 2EWHA 2YPYA 3R1LA 5L9XA 2MZRA 3QRPA 1REGX 4LT6A 5J2PB 3JSYA 4MFBB 4X4RA 3I9V9 4QIVA 3H8YA 4J37A 1R31A 1SBRA 3RG6A 4M94A 4GKKF 2NSBA 1N34J 3VVUA 2QRRA 1UW4A 3JTOA 1U2FA 3IS9B 4MIAA 4ZS6A 4PG7A 2B51A 4FS1A 5BR8J 1Y11A 1R89A 2EG2A 4TY8B 2JLEA 1NEEA 4IO1A 3G87A 4QPXA 3HHNB 2OH2A 2FYXA 2HK3A 4X4NA 5HROB 4EYIB 5HP1B 5KFGA 5D0RA 3Q2TC 3MEEA 1IKWA 3K5OA 2M3DA 2XY6A 4RPFA 3MWBA 3OUYA 1K73T 5D3GB 2F8MA 3HT3A 4LBIA 3CC4S 2GZOA 5D6GA 2BRLA 1VIXA 2HHUA 3SFUA 3ZTRA 1RAEB 3BKUA 3EPIA 3I4PA 4ECUA 3SQGA 3JS9A 4KFBA 2LXFA 1WOPA 2RD5C 4KKOA 4DR2F 2HVZA 4A48A 4P74A 2D9PA 2HSEB 2RE1A 3L7UA 2Z8QA 3N5BA 3CCTA 3VGTA 2P2CB 2YKAA 3CCRS 2HNYB 3WIVA 4C0BA 1EZZB 3MAAA 2ZH3A 2DNLA 2HVDA 3ENAA 3BBBA 3R7NB 1Q8LA 1R3NA 4DPUA 1H6KX 2WVDA 3T1YF 4L3NA 3M6XA 3G82A 2XS5A 4YB1P 4ZIWA 3G6ES 2W4CA 3WC2A 2CPFA 3SIPB 1T11A 3E8OA 2DEJA 1TUGB 1NPRA 1S0VA 2CJKA 3LGNA 2AZ1A 2BQUA 3JQMA 1S6QB 1WKKA 2VOPA 4FVMA 2VPZB 1PSDA 4RNHA 2CXEA 3CJ8A 2FHKA 5KT5A 2CDQA 4X84A 3CIZA 1RWUA 5M2UA 4CWBA 3KUHA 2WVCA 1KQSR 3FQLA 2J6UA 1IKVA 1RTDA 1Q8KA 4WZMA 1EP4A 2B5JB 4PKDB 2XMWA 3PCOB 8AT1B 3IGNA 1HYSA 3OD2A 1QY7A 3TZWA 1FT8A 1KSPA 4U7CA 4OFZA 3KDNA 1PBAA 3O44A 1RTJA 1EAYC 1SC1B 1IBLF 2KXFA 5DZ7A 1TMMA 2CJAA 4OYOA 4LFBF 5LMUF 2YQ1A 2IBKA 2G0JA 1CPZA 4BWJA 1M5PC 3CDWA 3ELHA 1WTBA 2W7PA 4NXMJ 4J9NA 1SJRA 4DDFA 5LMNJ 5H9FK 1FEEA 1J5OA 2MGZB 3PX0A 1R0AA 1Y5IB 3MUVP 2KJWA 1SKUB 4R0EA 1Q4RA 3WDOA 5C25B 3QRQA 3MECA 4GVLA 3TWZA 1N6QB 4KYZA 1HFEL 3GG1A 4J91A 1U4BA 4QPTA 2M88A 1VJQA 1VBYA 3NWRA 4WIQA 4QCLA 2EBEA 1VQ7S 1JJ2R 1SUQA 3TI0A 2WZ1A 2QYGA 1RT5A 4G1PA 2YKNA 4DPXA 4CM2A 5L38A 1KFDA 3VF0B 2XZWA 1TV6A 2YNGA 4J9VA 4OZ3A 2YH1A 4X4UA 2CZ4A 3IRXB 4YR0A 2QA1A 2M8DB 5HLFA 4RBTA 2Z4PA 1FDBA 1Q0NA 4Q43A 1JXEA 2B7CB 4OI0A 2CQDA 1RWNB 5CQGA 2VPWB 2OUGA 4MJKA 3OXGA 4ILMA 3FJ2A 3EVOA 2XHCA 2XMUA 2JEFA 4OZNA 1VC5A 2N4DA 2H5JB 1O6XA 3CJ3A 2ZOMA 3BB5A 1JQGA 2LKZA 1SV5B 4AXIA 1K0VA 3BQ2A 1V3RA 3IP0A 5FJ4A 1QUVA 4JYAJ 4KGKA 3N6NA 2HFSA 4LRCA 1EB0A 2HQ3A 3NGDA 1GMUA 4PWDB 3KLHB 4ZCLA 3R5AA 3ZXWA 2BKOA 4G3IA 1XC9A 2NZCA 2M5YA 4DCJB 1VISA 3DOKB 5CYMA 2HRTA 3A13A 2DH8A 5B0EA 4A8QA 4NXNF 2OPSA 2VQEF 3JXOA 2VG6B 3DRXA 4I1TA 4YY3F 4B9UA 1X4FA 3R97A 3I56S 4JI2F 5SUHA 2AYEA 4ED8A 2KM8C 2BBEA 1S12A 3QJPA 1EHWA 4IFVB 4KHPJ 1HIYA 1YITS 2J9EA 4DL4A 3S7RA 1UZHA 1N32J 3KMQA 2BOAA 4A47A 2AEFA 1QSLA 3ETMA 1QTMA 2DRDA 4WTOB 1TL3A 3MPUB 4DG1B 4ED1A 4JI3F 4USHA 1IBKF 3FFIA 1N5YA 2VG5A 4ED6A 5ETKA 2PN6A 2QL9B 4ECQA 4CQ1A 1I5OB 3B8HA 4DV6F 1NLKL 2E44A 4OI1A 1NH7A 3CJ0A 2CWKA 2HS4A 3DI6B 4I64A 2FHJA 2R8JA 2VICA 1GX5A 3Q8QB 4ZP9A 4OX7A 5F8MA 1PJ5A 1W7WA 3KLEA 2ZEJA 2X51A 5KFYA 3DKDA 4JI0J 1E6YA 2QMWA 3DU5A 2P6TA 1Q95G 3KNAA 2DGTA 1IKYB 5A2QY 4UF4A 1HNXJ 2GIRA 2UV8G 1QDUB 2WAQD 3DHWC 3TAMB 1HWIA 4NLXA 1VQOS 2ZM6F 1NMEB 1IBCB 3W2WA 3OL7A 1TMJA 2BJ7A 1C0UA 1UEVA 2AYGA 1KHVA 2LYVA 5IV3A 1HNIA 4ZHRA 4Y3CA 4OX9J 3QO9A 4YHHJ 3V4MA 4Y2KA 2NUUG 5KT7A 3DDNA 3MEKA 4M5JA 1A0OB 3IA0A 3CCJS 1NH8A 2JDJA 4QR0A 3ENWA 4HT7A 2DHAA 4DV2F 4NMXA 2HGNA 2G0CA 4LREA 2AD9A 1EJ7L 3FEYB 3C2PA 3Q23A 3B6BA 4NLYA 1UJ5A 2ZH4A 1RAFB 3AA9A 1FX4A 2LXUA 3VQTA 2HG4A 3G8QA 2MPUA 2OEKA 3MFHA 1HPZB 2UVVA 2ZITA 3AH6A 1OSCA 4DPOA 1H7XA 2BJDA 1GMWD 3BR8A 1RT2A 3L7OA 3CMES 4ILRA 1T9WA 2KU7A 3NRBA 4FF2A 4RW4A 1FHTA 3ITHB 4MMOA 2HHPA 5KT2A 3KHGA 3PIOQ 4NRTA 2C42A 1CG2A 2DRBA 3OLBA 2D3OR 3D1QA 4DU8A 2HVHA 5KG3A 3M8PA 2CPXA 4MYUA 3NAHA 2EC0A 2WONB 5E3CA 4DSIA 1WHVA 1FJEB 2ZH8A 3GPAA 2CQHA 3J81Y 4Q2LA 4CT9A 1TKTB 1HWUA 2E1PA 2W2OP 5D4PA 4ZVRB 3V6KA 3K5MA 2HRUA 4LF5F 1S5ZA 2BX6A 2LVWA 3EUNA 2VD3A 1KVJA 3DOMA 1F2HA 5AE1A 3EXYA 5HJXA 2E5LF 2F65A 3L3CA 4Y34A 2LEPA 4ALZA 1S1XA 1OY9A 1IBMF 5HBMB 5CA5A 1B3TA 1VLYA 4RW9B 1K1QA 1GAOA 1RT7A 4PG4A 3IG1B 3H59A 5IQQA 2N3OA 1Y3KA 4PXCA 3VALA 1HI8A 4ZP6A 3A3PB 5AE2A 4E0DA 4BLGA 3LALA 2V9WA 4NI2B 2I5JB 3IBWA 2CVIA 1YRUA 3P5BP 3VWSA 2CNKB 5IWAJ 1SH3A 2CPDA 3IR6B 1N4LA 2XMTA 2N4CA 3RRKA 4PPDA 3D6HB 3EGZA 2GW8A 1NDPA 2V4JA 3CJRA 1JNZB 3SCLE 2FLPA 2FGCA 1X4CA 3D6TB 4OLOA 2DO0A 2F8HA 5I3PA 5A76A 2DXEA 4Q44A 4MYTA 4UZCA 5IQ6A 3S6EA 2HPUA 6AT1B 1ZM4A 1TL1B 3Q24A 1XMOJ 4GMKA 5GMDA 3R8YA 3W5XA 2HS3A 5JJBA 1X31C 4ZVSB 2K1RA 4DI6A 2ZBCA 1UKUA 2V6AA 2HFVA 3HFKA 2LDIA 3G6XA 2HVEA 3U1NA 4ED5A 2PA3A 1MROB 1NO8A 3CJKB 5KG0A 2FJVA 1GX6A 5CZXA 2BJEA 3E3XA 4AL6A 1HNZJ 4LRAA 4LSNB 3LGMA 2RILA 5KG5A 2KT3A 1UJ6A 5DJBA 1FRHA 1J2VA 2B8PA 3O1LA 3DDKA 1GH8A 2RUSA 2ZKTA 1UPMB 4DN9A 1BWEA 2Z58B 3NWGA 4F8RA 1QLNA 4DL2A 4YOEA 1F3FA 4IYQA 3PX4A 3IR5B 4ANCA 1U2CA 3US5A 1U1MA 4KRWA 2HIQA 3NCRA 5GAEI 2RDDA 3FBFA 1PAUB 5KG4A 4EU0A 4DR4J 1XNQJ 2LU2A 4UUXA 2MZ1A 2BJ8A 3Q8PB 1FJCA 1UW9A 2D69A 3CWJA 3RU0A 1G3OA 4ANEA 5RUBA 1WUUA 1IM6A 3A3NB 1S99A 1LEOA 4YP3A 4IQMA 4OHWA 4LR8A 1S6PA 2Q3PA 1FO1A 2VPYB 5A6PA 4ICLB 2BW7A 1O51A 4L6V3 1O0PA 1VQYA 2YKMB 1TFWA 3G8SA 2Z57B 2W9BA 4F0HA 3BQ1A 3BPDA 2YQ0A 2W7AA 1LWCA 4LR9A 4GKKJ 3PY8A 3MEEB 3ZZOA 1IKWB 1NDKA 1T9XA 5DGAA 3CDUA 1MMLA 5F8NA 4PWUA 1AW0A 3Q86A 3CCVS 5K8MA 5C42A 3OUYB 2C2NA 1SL2A 3HZEA 1WHWA 3JQKA 4KY3A 1R7IA 4Z7YA 2V9KA 2HYIB 1UPPA 1EETA 5K14A 4LF7J 4CNYA 1CSJA 1M5OC 4WF9Q 3SQGB 1DARA 3SXLA 4KKOB 4B9VA 1T7PA 5LXRA 3M4XA 4DV1F 1TVRA 2EXUA 2EFVA 4DUZF 5IFMA 3MAAB 3TUPA 3D3CJ 3H20A 4NLUA 1M5HA 2CVEA 2O1PA 3I0SA 5IC4B 2LXIA 3G82B 2AF6A 3D5MA 2RJZA 1WHYA 4RW8A 4DR2J 3GV8B 1S0OA 1UWBA 3UFCX 1AROP 4JUZA 4BS2A 1TK0A 3IXQA 4CLFA 3KDOA 4MKVA 4RW6A 3VAHA 1RE1B 1P6TA 3CT9A 3RGIA 2CPIA 3OHBA 5KFCA 2LCWA 3T1YJ 2MHNA 1ELOA 2ZNZA 2XULA 3C15A 2J7WA 1EP4B 3NGUA 4F02A 1NJXA 4HHHA 3JAMY 4K5RA 1KLMA 3I0RB 1KKHA 3AODA 2UUWA 3FEXB 2DR9A 1TFYA 1HYSB 3W66A 4HEA9 1P1LA 3PFEA 3O5TB 2P9CA 2OPPB 1TK5A 1JLBB 1JLEA 1VGYA 1R6YA 1R8AA 4Z37A 4URQU 2OEJA 1VRUA 1ITPA 2GA7A 1TK8A 1KOHA 4ZLLA 1DLOB 2PO4A 1QE1A 1WSVA 1FDAA 2W8KA 2VBYA 2HHVA 2J6TA 1BWVA 1HW9A 1AB8A 1RHUB 3ISZA 2KRRA 4ANDA 2HGMA 4LF9F 3Q83A 2CAJA 1EX8A 3H90A 4PYAA 4ZOSA 4X62F 4P2MA 4OYMA 1M5VC 3MUMP 2L41A 2JFKA 2R7SA 2DGQA 4AFFA 3FSXA 2DHSA 4B17A 3KG0A 2CQCA 1DZ5A 1J5OB 1IBLJ 1R0AB 4CDIA 1T9UA 2I1RA 3QQCD 1FVQA 3IN5A 1X4GA 2I2YA 1M90T 1T94A 2MKJA 2FVSA 1PC4A 3MECB 2RKIA 5CD4A 1LWXA 1NDCA 3D1HA 2KHDA 1FRJA 1W25A 3FBEA 1RBLA 4USIA 3DRYA 5J2MB 1L3SA 3N79A 1WOSA 2XO6A 3OSNA 1SUQB 4DU7A 1FCAA 1RT5B 2E5IA 1X4AA 1SVDA 1OY8A 4HTIA 3QNWB 2FUG9 2J7UA 1TV6B 2YNGB 5J1EB 2K7JA 1Q7YT 3DHXA 2PC6A 1WEYA 4IOBA 3DU6A 4JI1F 3K57A 5IC6B 1FRKA 3POTA 4WPAA 2FC9A 3OJUA 2UXCF 1TTHB 3D4JA 4FYDA 2OI2A 1Y5LB 2PFFB 3B78A 2WSFC 2VA3A 4UQTA 4IQXA 2Z2ZA 1JK9B 3RBDA 2W1BA 4LSLA 2RSQA 5GADU 3JQJA 3UD3P 1XN9A 2R8HA 1LWEA 3UCUP 2EEYA 2W2MP 2DT9A 4J9OA 2G2YA 3H40A 2NXEA 3LP1A 4ILLA 3VTIA 3AD7C 3TVKA 3LGHA 3BGLA 4X65F 2W4DA 1KR4A 2FVQA 1WJ9A 5CYMB 1K47A 2DH7A 5LSLA 5E2QA 4IRCA 3D0HE 1U24A 8ATCB 2VBXA 2OPSB 2LECA 3NNAA 1Y9OA 3SV4A 4CLYA 4JV0A 4WFZA 1HR0F 5HMXA 3PEJA 5B09A 5D4NA 2ROPA 1SIZA 1RHJB 3H4BA 2FVPA 3QZ8A 4I67A 4ZLPA 2K3KA 3CD6S 5D15A 4JP8A 2FVCA 1HWKA 2MQPA 4RWWA 1RT3A 3DMJA 4OJHA 2U2FA 3TYTA 4F36A 3OXFA 4O0NA 4UZBA 2UUAF 3NGTA 2VQEJ 4L73A 1TL7B 2AHOB 4RL1A 4X4VA 1BHNA 3BS9A 2XQCA 2AKWB 4P75A 5LJ5Y 3OHAA 2XYHB 4LQ9A 1TL3B 4J9SA 4XK8C 3PR5B 3GB0A 1HI1A 5KFJA 4F4XA 2QSWA 3RBXA 5DM7Q 4DCPB 3KG4A 1EQMA 3FFIB 1N5YB 4J9RA 1HHQA 4JI4F 3N9UC 3DLKB 1IR2A 3JYTA 1NK9A 2YKOA 1VQPS 1WC6A 2FIUA 4L75A 5MLCV 5JXSA 4F04B 1NPPA 2AIRB 2APOA 5ADZA 1ZPVA 5DGBA 2RU3A 2VFVA 3NL0A 2EFNA 1HA1A 3E51A 3FBBA 4IR9A 2HNZA 2AJFE 1G1XA 2CZ9A 4F0KA 1N88A 1GEHA 3A12A 4JI3J 1IBKJ 3HHEA 1E6YB 3AB4B 2G0IA 2BRKA 2BJ3A 3JSRA 5C2GA 2M9KA 4RNMA 1OJ4A 1WF1A 1XIQA 2FHMA 4PCQA 3I5AA 4DV6J 1YJ7A 5KG6A 3M8ZA 3CVKA 5U47A 4DX7A 4O4GA 1KN6A 2L3MA 5KFFA 2OELA 3C66A 1NK8A 2M7SA 2FJWA 1VMBA 1Q81T 3T1HF 1C0UB 1ZETA 1YJNS 3GFXA 2E5GA 4ZJQA 2YNHA 3LP2A 2IVFB 4ZHRB 3W7BA 2ZHAA 2J0WA 1MLAA 5F8LA 1LWFA 2V4QA 5L1LA 4ZPAA 5H9EK 1VR6A 3CULA 2NXCA 3NS5A 1QAIA 2P8IA 1SXLA 4M5LA 1UETA 3SDEA 4C3LA 4ES3A 3N5FA 4ECXA 3MMJA 2XM3A 1ZZFA 3B54A 2ZM6J 2ABYA 1JLQA 5AT1B 5T7LA 5CABA 1U48A 1U8SA 1RU2A 4PXBA 2G1DA 3I55S 9ATCB 2V0NA 3MHYA 4TU9A 5JUMA 5F0UA 2IAJA 5MAOA 5DG9A 4B3RF 4YB6A 2G4BA 5KFTA 2RQ4A 2R8IA 3RB6A 1VFJA 1HI0P 2AJ2A 3K5LA 4KBIA 1RHRB 1IKXA 1FNOA 3BDPA 1U26A 2DHGA 2XGQA 4KPCA 1RT2B 2FLLA 4B3OA 4DUTA 3GP9A 2Y8WA 1H2UX 3CD7A 5KOXA 2MQNA 3M2RB 4J9UE 4RW4B 4KH0B 3BYRA 3FZBA 2HHTA 1WF2A 2EFQA 1X9WA 2MKSA 1SH0A 3UI3A 5D8HB 3GJQB 4YR2A 4NYZA 2HAIA 1S9FA 1CJKB 2BV3A 4RR5A 1KD1T 1FE4A 1RCOB 3LAMA 3A1YG 2CYYA 3AD9C 3P4UB 5CYQA 2B6AB 1RAIB 1JLAB 3FBCA 3DOMB 4ZPDA 4O0IA 3KLIA 1S1XB 2BVZA 4M5DA 3IGVA 1OS5A 1Z2ZA 1FX2A 5EDWA 5F9LA 5CD4H 3AQOA 2AEJA 2R7OA 1B99A 2CQPA 3UWTA 2XZTB 1VDHA 1JLFA 4Q2MA 1Z1ZA 3CW2C 1RKJA 3CMAS 3BBFA 1NJIT 1RWMB 3MTJA 4I7FA 1FWLA 3ONQA 1Y10A 1CBKA 1JB0C 2AJ0A 3LO3A 2E5LJ 4LQ3A 3AFGA 3EWGA 1FJGF 1FXDA 1MU2B 1T02A 4H54A 1BGXT 2CWXA 3ILJA 1IBMJ 1LFWA 1LXNA 4KHMA 1S1VB 4O3RA 3UD4P 2V8HA 3ZTSA 2CQ2A 2HGLA 5FLXU 3FK4A 5GAGI 4WKRA 4TY8A 2WVBA 4X64F 2Q43A 4F7VA 2J8SA 1YGYA 3EGNA 2MKIA 3D66A 2E5JA 1RQ0A 4GO7X 5HROA 1U1RA 4MKAA 4K4SA 4ERDA 2GX8A 3HSGA 1VRQC 2K06A 4NLOA 5ETLA 3CCLS 3LUYA 1S57A 2HLUA 3N0VA 3THTA 3AA8A 4TQSA 3FCHA 4Q8EA 1VHFA 5D3GA 1YJRA 2JEIA 3OL9A 3CTRA 2YXLA 3TA1A 2GMJA 1LOUA 2UUBF 4ZVQB 2JJ4D 4C0HA 3C6TA 2GFFA 3NG8A 4C8NA 2RB7A 4NEZA 1NAQA 5I42A 4C9DA 4I6WA 4PQUA 2JHEA 4I6YA 4ZPTR 2ZC3A 2F4VF 3UDLA 4K59A 2Y3YA 5HQMA 2EKNA 3KOAA 2VFSA 5L1JA 4LFCJ 3RB0A 1LFPA 1U2RA 1NZ8A 2XMVA 1B70B 1HLWA 3B4MA 3FZ2A 3FGVA 1KDNA 1W2IA 1QVGR 3HHLB 4KIAA 1U02A 1HQUA 4X66F 2DXFA 4DR7F 1HWJA 2C2MB 2ZH6A 2FY8A 1U1QA 3J7YU 5C24B 3OQ2A 4CTAA 4C3MA 4C3KA 3P3DA 1ULRA 2F9DA 4C8YA 4FXDA 1V3SA 1S6PB 2HBRB 2BANA 3F41A 4LF6J 2B5JA 1KBRA 1Q16B 2VBZA 3BKFA 1RA7A 5IZHA 1RTIA 4DR5F 4IG3A 1ZTTA 2JC1A 1LWCB 4DF8A 3KJQB 3KNGA 4KHRA 3EGVA 3C16A 3HXMA 2V50A 3RRGA 1RISA 1HARA 3R5GA 3L7PA 4NLRA 4QIWD 2DKOB 3JSMA 3AY0A 4A8KA 1SC6A 2PMHA 1FI4A 3OTOF 2QJ3A 4OI4A 2A1BA 2D3ZA 3IRWP 1EETB 2DNZA 3QLHA 3S01A 3MAQA 3RAXA 1IR0A 5T14A 4P73A 3W8PA 3QJLA 2YWHA 3U7JA 3R27A 5D0EA 5HMZA 4C48A 1RHKB 5ETSA 3ILIA 3CDAA 4ZJLA 2AP6A 4DV7F 4NA3A 2MGZA 3M8RA 3CJQA 3C8YA 3I0SB 3GSDA 2W2NP 2H1YA 1Q8IA 2WB4A 1N6QA 1TR0A 2HW3A 1QVFR 1WC3A 2AX0A 4ZLNA 3KJNB 4DV1J 4D3HA 1VJWA 3P45B 3MOZA 5F3ZA 2GMHA 2K8GA 2R7TA 1O8BA 4N5SA 4Z2XA 4DUZJ 2AYMA 2DCUB 3AJ2A 2HBQB 1FRMA 2VB6A 2AGQA 2OPQB 4DPWA 1FRIA 3OXLA 3IRXA 2CQIA 4YEAA 1T9YA 4C8OA 1QSYA 4PXDA 4N7TA 4CO3A 4E2FB 1FNXH 5E33A 3L9ZA 2FLOA 2HWIA 5D4OA 2LA4A 1M1HA 1RAAB 1KNZA 3QJJA 2V8DA 5JVHQ 3CF5Q 4DV3F 4CI0B 4XIUA 4OYAA 3R5BA 1P8GA 1VRUB 3QBCA 1N56A 1SQEA 4F67A 2OFHX 3KK3A 5DDQC 4IH6A 1QE1B 1N5QA 1FD2A 3CIMA 3H2VE 2NXUA 4DCOB 4XAKA 2ZVIA 2M52A 2XMAA 3KLHA 3D0IE 3SYZA 3HSDA 4M5IA 2DYAA 4QOTA 4LFAJ 1X5OA 5DDOC 3HVAA 4OJGA 4P71A 2OD6A 3J7Z5 5L46A 1SPBP 1KS2A 1DQ8A 4JI5F 1JIHA 1R8BA 1JKHB 2VG6A 1LXJA 4HVZA 4EMDA 5KFIA 3CCMS 1NK4A 2NUHA 2RKIB 3V6DB 1X4DA 4WP9A 4IFVA 4NPOA 2DNNA 4DQPA 3I5CA 4C8MA 2XB2D 3MGJA 2RS2A 3BGOP 3GONA 1FXRA 3CJ2A 3OR1B 3MUTP 1MWZA 2C22A 3NBPB 1C1BB 2DO4A 4E98A 2YWKA 3DLEA 3MM9A 4I6AA 5IT9U 4DSLA 4F2RA 2ZWOA 3I4HX 3I96A 1N8RT 2OTLS 1T3OA 4ZCMA 1RAOA 1SKRA 4PXEA 2CQ4A 3PW0A 3F44A 3C6UB 2W4PA 3DGPA 4EO6A 2UU9J 4ZCIA 3POTB 3DLHA 2LLZA 1K9MT 4LIRA 4FVCA 1H38A 1YDLA 3LP0A 1HBUA 3MEDA 3SMZA 4DR3F 2QEXS 3LAKA 3SV3A 2MTLA 3DRPA 1FRXA 2QYCA 4DZ6A 2J0XA 1V5IB 4LSLB 3VAIA 4OZ1A 4NLDA 2O67A 3HJVA 2M70A 2KHCA 4MAKA 5E7OB 2ZZMA 3JTPA 2LEBA 3GIJA 1LWEB 4JI1J 2R7RA 3RW6A 3FNNA 3TO8A 3NEKA 5J1NA 1FKOA 4WP8A 3UR3C 4AXJA 3VAJA 3NP5A 3GTYX 3LP1B 2C3YA 3H42A 4ED2A 3VGUA 1B4SA 5DG8A 3MMAA 1UA0A 1UEKA 5J2NA 3TAMA 2B9WA 3M8YA 3RTVA 2V68A 3CD5A 2ZH5A 3TARA 2HMIB 4EZ9A 3M8SA 1DY3A 3N6LA 5AXLA 3HI9A 3IMQJ 3BF4A 4DOZA 1ZAVA 4OL8A 2CQ0A 1RWOB 4KSEB 2DPJA 5H9EJ 1U45A 4XO0A 5EWEA 3L09A 5KFKA 2QFIA 2MEWA 3DOLB 3V4IA 3KHRA 2B7BB 4DR1F 2K7KA 1RYRA 2ZBPA 4HI2A 1HR0J 1LW0B 4ELUA 2D1CA 1WKLA 2Z2MA 2GJFA 1URNA 1SH2A 1ZAXA 3PHEA 5AJ3F 3HFZB 1X7VA 3PRBA 4KTQA 4EUVA 2JX2A 3HP6A 1RAGB 5LJ3Y 4NCGA 1FDNA 3X1LB 1N33F 2ZBRA 1YJUA 3PYFA 3JYTB 1RCXB 3FMWA 1P27B 3ULHA 2DY1A 2CQGA 3QSYB 1M0SA 2DNGA 1X0PA 4PZVA 1FEHA 4CP5A 2DNHA 1DURA 1U1LA 2DCLA 1XR5A 4HR2A 4WIIA 3DRSA 1FKAF 2QLJB 1HBMA 1F9HA 1BLUA 1RGVA 5A8KA 4WU3A 2JEJA 1FTCA 1VQ4S 2UP1A 5FIIA 4JI4J 5J1PA 3KUEA 1M5KC 1NCLA 2X3GA 1T8EA 5THWA 4FN5A 3MM6A 2D3O1 4RWXA 4O4GB 4C8LA 4TN2A 4EBEA 4MK8A 1WC1A 3J81j 2KJVA 2JL9A 4K7QA 4LBHA 5EGYA 1TKTA 2QA4S 1T05A 1B0TA 2YNHB 1NB2A 3KMSA 3KKFA 2FJEB 2IJFA 4BHQA 4A8WA 5DQIA 3MZIA 5CH7B 3UN3A 5A8RB 4X4OA 3VZIA 5GAEU 3SDEB 5ETTA 4NLPA 3V2UC 5KT3A 2JNJA 4YUDA 4USVA 1JLQB 1C0TA 3UN2A 5T7LB 4DX8H 5C7PA 1PAEX 3W65A 4TLQA 3T1HJ 3M9MB 4U9RA 2FHJD 1WDTA 1OYEA 2CPZA 4IRKA 2EK6A 2DGXA 2QTWA 4O3QA 4NASA 4P6QA 2IAJB 5ETVA 4ZMMA 2RQCA 2IJNA 2RQMA 4NI2A 1PGZA 5F3TA 3U27A 2BE9B 5E3RA 3PW5A 1FDDA 1CULB 2QL7B 3MAHA 3IWXA 3HVRA 2R2SA 3K5PA 4HYKA 4DZDA 4OHYA 4ZP7A 3TX8A 5KFVA 1G4CA 4ZP8A 4CIOA 4B3RJ 2KZMA 3OTDA 3EZ5A 3FCWA 2R9LA 4OZLA 2YTCA 1HWLA 2ATLA 3GU0A 4UUWA 2R2TA 4NYOA 1HBNA 1UZDA 2VONA 2E9RX 2KXHA 3I6PA 4ECYA 3GJSB 1WD6A 2VODA 2KYZA 1MROA 1UVKA 5HK4A 2Z30B 3TUIC 5D78A 5CYQB 2HHWA 1ZM2A 1IM4A 1FTRA 1OWXA 2GNKA 1DQAA 3EGWB 5HSPA 4EYHB 1NSQA 2ZZNA 4LSNA 4JBCA 4KE5A 3ZZTA 3KLIB 2PDAA 4M63A 4M5DB 3W2VB 4DL7A 3HHKA 5C5JA 2DNQA 5G4DA 3PM9A 2DTJA 3DLGB 3G4SS 2B43A 4MIBA 4NLTA 4DV5F 3DC2A 1PILA 3CEDA 1HQEB 4DQRA 1JLFB 3G8TA 2NR0A 1KFSA 2ASLA 2IBOA 3GR1A 1DHMA 2RIJA 1RHQB 3QIPA 2LMIA 1RADB 4I7FB 4ECWA 2YX1A 1TZ0A 2VFUA 1WG5A 1RYSA 3X3UA 2H51B 3DLBA 1X4BA 1HL6A 3O2IA 1YTYA 2IY5B 2J0QD 3ILOA 5L1IA 2HRYA 3FDSA 2ACYA 2RRNA 2VV5A 3G9CA 2FZKB 1SL1A 1UFLA 4ECRA 4ICLA 4QJVA 3BN7A 5FDLA 1LK5A 1F5AA 4UT4A 3HM9A 2YKMA 1BC6A 2ZC4A 4ZPBA 2CA9A 4K4TA 3AOBA 1VBKA 2Q1LA 3PZPA 4IR1A 1LKZA 4NX9A 3D0GE 4J9MA 3R7SB 4WFBQ 4KC5A 3N4WA 3EJMA 3KTQA 2BJ9A 2IIHA 3PW7A 1N34F 4ID8A 2QO3A 2HZVA 5M2RA 2RAQA 4RUAA 1HQ2A 2W9AA 1REVB 1VCTA 2WSCC 1H2TZ 3VAKA 3MD1A 2DJWA 3KK1B 4X64J 1KHWA 5BR8F 4I68A 1AXQA 1I3OB 3C6TB 2MJUA 4ZITA 1APSA 5ETNA 3LWMA 3CPWR 2JVRA 1D0EA 5I42B 2DIUA 4PQUB 5KFWA 1B64A 1YHQS 1UWAA 2JRSA 4BDPA 1TKZA 3PDNA 4EFAC 4NL5A 2HBZB 5KFLA 4U8VA 4ZDNA 4IOAQ 2VQFF 1MG7A 4LRBA 4USJC 4CH1A 2YWFA 2E9TA 2KFNA 1YG0A 3QIDA 2E1MC 5A8WB 3FKBA 2UUBJ 1I94J 2OSRA 1RKIA 1Z4UA 2Y8YA 1HQUB 1B7YB 2XLJA 2ZKUA 2U1AA 2VJUA 4K4WA 4G6VB 4URSA 3KXDA 3QWUA 5DS7A 2YBVA 1HW8A 1XMBA 4CTAB 4PR6A 2F4VJ 3ISNC 3W5YA 2MZQA 2YH0A 1Q8BA 3H5XA 3KLVA 3MCSA 1FESA 2CKWA 5CCLA 2HHXA 3W1YC 2BANB 4EWTA 4DV4J 1NJZA 1UJ4A 4OJ3A 3I0RA 4DF4A 3GJTB 3LH2S 1RTIB 2KTQA 2HZAA 4IG3B 4NZ7A 2LQ9A 3KFWX 1ZAWA 4DR7J 2IYIA 2OPPA 1JLBA 2AT1B 2HFUA 3QPIA 3C16B 1EKRA 1VI7A 1WORA 2NSCA 3HF5A 5KFHA 3JSMB 4NWBA 2MHEA 4Y00A 4DL3A 5B7WA 3QT6A 3OT9A 2F63A 1DLOA 4C0OC 2R3VA 3OTBA 4NCAA 4W92B 3QLHB 2XY5A 1C4AA 2KFZA 4QWCA 7FD1A 3KK2B 4O3PA 3QT7A 2P9EA 4WJBA 4DWIA 3MF5A 2RF2A 2COLA 1BUXA 2A2CA 4DFMA 2ZUGA 4F0MA 2UVRA 3PVXA 2CADA 4RNNA 4U95A 2A18A 1ZPWX 5IT0A 5FLXY 1JNRB 1BQXA 1HMVB 2QIFA 4PPZA 1Q53A 5F0WA 3OTOJ 1JWWA 3HX9A 4C98A 1RSCA 1SIWB 2QSFA 4M5MA 3KLGA 1N54B 1ZTWA 2F5GA 4ECTA 2N82B 4V1Ak 4X4PA 4WE1A 2QGFB 4IDKA 3P96A 4ZVHA 2BDPA 4YDXA 2DGWA 4QIGA 3NOGA 2M2BA 2Y1LB 2NREA 2V8PA 1CQMA 3R2CJ 5J2MA 1F5CA 4DV7J 5CXTA 2WVFA 5A6WA 5AXKA 4DQSA 3MM8A 1VQ5S 2W01A 3VR1A 1C4CA 2IRXA 1OQ6A 5J1EA 3ZTQA 1S0NA 2HWTA 2OMOA 4AE5A 3FQKA 5B0FA 3QSIA 1V5VA 4JV5F 3B82A 1RI7A 1NJYA 2IPOB 2I38A 4Q8FA 5HI7A 2J9DE 5DG7A 3HHDA 3W60A 1SKWA 4KO0B 1NM2A 3NS6A 3P49B 1DFDA 3M2VA 2J5AA 1NPKA 3KK3B 2CNNB 5F8JA 4NOHA 3IO1A 4HI1A 4EK2A 2LQJA 2JEGA 1TP7A 3KJVA 1CEZA 5B0DA 2OLWA 2AEMA 1HD0A 2PI5A 4OHZA 3U1LA 3M2UB 3H2UB 1RLDA 5KFBA 4DBQA 2KZZA 3K2YA 2XEXA 2HQIA 2IJRA 4JV1A 1ZA1B 1YZ7A 4JOUA 4HHUA 5KTQA 2IA6A 3PKYA 5K9FA 3R1HA 3CCES 2J8AA 3NLCA 1C1CB 4V19X 3UDEA 2E9ZA 3A8JA 1YSJA 2GO9A 3WC0A 3FC9A 4QBUA 2HAFA 2AGPA 5A2QU 3CCQS 3W9IA 1L3TA 4E8UA 3CD0A 1Y0HA 3BV8A 1F9EB 2WBRA 2ZH9A 2E1AA 3AOCA 3C3LA 2F9JA 2W9CA 3DLEB 3QGGA 5DRKA 2IM3A 3MM9B 2DGUA 4Y2MA 4IRDA 4U6PA 1O5JA 5DZ6A 4JI5J 2DXDA 3GYNA 2HNDA 1H0HB 3TQEA 1TL7A 4H4MA 4UY8T 4X4SA 1UVIA 4DPTA 2ZFHA 3Q8VA 2I6WA 1NKBA 3DGPB 4DEZA 1F5BA 1RT6A 2VUGA 3MMCB 3LP0B 1HBUB 3GZ7A 3DLJA 1PJ6A 5EUHA 3MEDB 2AJ4A 4MK7A 3DLKA 2M4MA 4KHPF 2HFNA 3DRPB 3L95X 5B0AA 4FYYB 1MWYA 3CB4A 1R0BG 4CLLA 2B56A 5KFAA 4TU7A 1SL0A 1N32F 4ID5A 4FNIA 4TU8A 1N36F 2IMOA 3IWNC 4KQZA 3J80U 2MQMA 4PG6A 4IKAA 4I2QA 4MKYA 1FKOB 2LU1A 4C8KA 2HK2A 2Z0GA 2R7VA 3SCIE 2ZE2B 1U09A 2J7KA 4FYVB 4DR3J 2MXYA 3MMAB 2MY8A 4ECZA 1H2VZ 5J2NB 4HKQA 4DFJA 4NE9C 3PHTA 3HKZD 5D0GA 1T3NA 1JJHA 1YQHA 4N76A 3R9LA 2RS8A 2MMYA 5GVQA 4QQBA 4OYBA 2DNOA 1TL4A 3TEGA 4YMEA 3N01A 3NCPA 2GHVC 2YWWA 2FZCB 2BM1A 1SJ1A 2QLFB 4MK9A 2UVUA 4EZ6A 4QIFA 3IR7B 3ZO7A 3SZ2A 3V4IB 4WFNQ 2CIMA 1HNXF 1PYOB 3R2DJ 3IAM9 1GFWB 4QWAA 3H2LA 1GK8A 2NZ4A 1WEZA 4FYXB 1Q78A 4IH5A 5ITHA 1ICEB 4OZ2A 1UP1A 2HURA 4A8MP 5KFOA 4NCGB 4USMA 2LQ8A 1FF2A 2L08A 7FDRA 1CS4B 1U7LA 1YZ6A 1WHXA 5KFQA 4WYWA 1MW7A 2ZVSA 3ET6B 2XHWA 4FYWB 4B3SF 2KRBA 2V69A 4YB5A 1VQ6S 1N52B 3TVZA 1H7WA 3CSKA 4WFYA 3M2RA 3DRSB 5KFUA 5KFSA 1HBMB 1LW2B 1U1PA 5AJ3J 4DUYJ 2GIFA 5A8KB 1R8PA 4UOHA 4PRFA 5IT9Y 4QIEA 4CT8A 4WZQA 1DTQB 2OMLA 1IR1A 3BPSP 5HAOA 3Q22A 4DSKA 1RJJA 1I6JA 4RUHA 3MM6B 1CJKA 2K3IA 1P1TA 1S9GA 3H25A 2B4PA 2ZHOA 2LEAA 2F4FA 1VYAA 2MKCA 2XCAA 1T05B 3NNCA 2UXBF 1BXNA 2GQCA 2FVRA 4DL0C 2B6AA 1JLAA 4N47A 5HMWA 2KG1A 3UNGC 4CLZA 1QD1A 2MLZA 2RDIA 2MJNA 4DS4A 2MKYA 2HHHF 3UPFA 4ZKAA 2E1RA 2VG7A 5CYJA 2P5VA 2VF3A 5DLFA 3UN5A 2FJAB 2R8GA 1C0TB 3HZGA 3TRGA 1VLOA 1Q82T 1WTFA 1X5TA 2MB0B 2LDYA 1ZBTA 2HFZA 2WB1D 1R8CA 4ZIVA 3MM5A 1NRKA 2UUTA 4ETXA 2RRBA 2ATCB 2ZD1B 4B3MF 1MU2A 3GSIA 3CXCR 3ZTOA 5GADI 3RB3A 1S1VA 4DS5A 3CMQA 4HDHA 1AUSL 2RHSB 3ZZRA 3CNQP 1RU1A 3UDCA 4EBDA 4FKYA 2R7UA 4M8LA 4MKBA 1VQKS 1U6FA 1Y7PA 3SBMA 1VQLS 1HBNB 2A10A 3VGSA 2LP4A 4DFPA 1IJFB 4KGZB 3PX6A 4K4XA 4R5PA 1RT4A 2DY9A 3OFGA 2C3OA 3WBZA 4CYUA 2OJ3A 1F3VA 5IWAF 2LA6A 3CJ4A 3IC1A 1JXVA 3BYPA 1QTNB 4I56A 3PRDA 4ECSA 2EFPA 1VIOA 3I5BA 1DTTA 1U0HA 3TNVA 1XMQF 4O3SA 3IAS9 4FKXA 3BN4A 4AQYF 2Y1JA 2WCXA 4BBYA 3WX4A 4FXVA 2GGPA 2V67A 2BE7D 1TAQA 3QIPB 5BJRA 1WI8A 3HHLA 2G13A 3QAEA 2ZHBA 4OYWA 1VS3A 5ETRA 3H4DA 2H5EA 4JB8B 4K5SA 5C24A 3CC7S 2XYGB 5I3QA 4PUOB 2ALZA 3FRZA 1YRTA 2NXNA 3M8QB 3VGVA 3HSZA 5FDLB 2FDNA 2AZ3A 3OTCA 2HLTA 3M8WA 2XC9A 1X5SA 4K4YA 3MEGA 3M05A 4B9SA 4J9LA 2Y0BB 2H5IB 1QJHA 3NXZA 4ZA1A 4WK1A 4UOFA 2B9EA 4FDFA 1UVMA 5HVGA 3HVTA 3MMBA 4I2PA 1T9TA 1A6LA 1UA1A 3M9NB 3VHQA 4ELTA 4B02A 2Y0SD 1UTAA 2F8EX 2RMLA 2YX4A 1TELA 4B08A 3NGKA 3K0JA 3W8GA 2H65B 4DHVA 4IH7A 4N56A 1KQKA 3ZZZA 1F1BB 2L9NA 1RTZA 4DSFA 5KOWA 3GIRA 3T9ZA 3TOQA 3ZFVA 2DNYA 1EQ0A 1LK7A 4RU2A 5K8PA 1TKZB 1QSSA 2CPYA 2BZ2A 2KL8A 2QMXA 2H54B 1UVLA 1BQNA 1TUWA 4DL6A 5HJYA 2DIVA 3Q8YA 4KAIA 4ES1A 3EDQB 3T1AA 4TLRA 3C46A 2D3UA 1KOOA 4LF7F 3SI8A 4FBUA 4NZ0A 2DNRA 1VQ8S 1B7FA 3MR7A 1GXLA 4KR0B 2ZNYA 5GAHI 1L3KA 2VQFJ 3R5DA 3KUGA 2MZJA 5K8NA 1HNWF 1AYEA 2QV6A 2OPQA 3T41A 4Q0BA 3GYGA 2QMUB 1Q79A 3FSIA 1IXKA 1EARA 2JFDA 1DQ9A 1PC5A 3HSJA 2XGPA 3NMAA 4MH8A 1F60B 1YX2A 3LPYA 2VH7A 2RU9A 1NXIA 3BO3A 3AT1B 3M9OB 4WKYA 3TUZC 3ICLA 4I69A 1PIEA 2KT2A 3V6HA 1Y00A 2ASDA 2VHGA 4ENOA 2V8VA 2R42A 2UVWA 5HVFA 3MCNA 4LF2A 2IM0A 5HQ8A 3K5NA 5LSRA 3KG1A 1WC0A 2BW2A 1P9QC 2RF2B 4LVNP 5EX3A 3FRYA 1BQMA 3W9HA 2VJVA 2PGCA 3P8BB 1TKDA 2R2UA 3IBFB 4NLVA 2BE2A 4TY9A 1SCJB 1NNDA 1CJVA 4FZVA 1FVSA 1S79A 1SQFA 2IHR1 1Q1KA 2HEKA 3AJ1A 4KGXB 3JSBA 4G1IA 3GQCA 1JKHA 4LFBJ 3PG9A 5LMUJ 4ZVUB 4LVOP 1ACMB 1P9YA 3AOAA 1S59A 2NPFA 3KLGB 2GAHC 2CQBA 2VBWA 3QWPA 3V6DA 5HATA 2V8GA 4PAAA 4CH7A 2X1FA 4WE1B 4IFYA 4IDKB 4OYIA 3VQSA 3VAGA 3BBCA 5DLGA 4A8FA 1SJ3P 3OR1A 1M1KT 1NB7A 4OIXA 1XR6A 3NBPA 3DM2A 2ZJRQ 1C1BA 3DRRA 3M30A 1K8AT 3KLFA 2CRLA 3CJ5A 3MM8B 3D2WA 2HQCA 4WBFA 1NSKL 3C6UA 1YLXA 2J9CA 2WSEC 2VIHA 3D9BA 4ZPCA 5HMYA 1U1KA 1WKJA 2MY7A 3T9NA 2PD1A 2ZBIA 3A8EA 4RO0A 1L3VA 2G2ZA 1SJFA 1OPIA 2XNQA 3MM7A 5F8HA 2EBGA 3EM1A 1XWLA 4J9QA 2OPRB 1NK0A 4R8UB 4EO8A 3M2VB 2YNFB 4F4AA 2G2OA 3W62A 3WQPA 1AFIA 1RHMB 3PYGA 3HT0A 3KJVB 2C3PA 2E7WA 1TKXA 1RP5A 2JSXA 1GTEA 1RDRA 4C11A 3ZZUA 1QAYA 4QWDA 1HKAA 2WBMA 2CG4A 4A8OA 8RUCA 4OI2A 4JV5J 3B4DA 4Q7AA 2RVJA 1VOMA 3LANA 2BACA 3PJWA 4O4RA 3LWLA 2Z2LA 1DJ0A 3D7SB 1Q5YA 1UEUA 4D3GA 3BREA 5KG2A 1CJUA 2OTJS 2HMIA 3T6JA 2C2OB 4HH1A 4DFKA 1KQGB 3SEOA 4QWBA 3S8SA 3J7YI 2HWHA 1ZYQA 1YRXA 2FJDB 4CLUA 3Q89A 2IDEA 2QT7A 2W9CB 2XO7A 1KP6A 2OD4A 3DOLA 2ZWPA 3A4TA 3U1MA 2W24A 4NXNJ 1R43A 4RBVA 2HNDB 4U8YA 4H4MB 4YY3J 1LW0A 1RTHA 5G0RB 4JI2J 3MPYA 2L9DA 4MIWA 4ZVFA 1S7IA 2X3DA 1RT6B 2QLWA 2FHOB 4K4ZA 1FD8A 4RLEA 1YIJS 3ILLA 2MKKA 4EBCA 4QZVB 2CJQA 1G2EA 2Y1RI 5LT5A 1HD1A 4F25A 1D9AA 2DBBA 3QFHA 3TJ8A 1K0TA 2WW8A 3P6YC 4F4KA 4O44B 3TJAA 4RNOA 4F3OA 1QM9A 4ID5B 1MMNA 1NZAA 4AYBD 3M32A 2RQKA 3H5YA 3VV2B 1VQSA 4OJ1A 2CQ3A 3MTKA 4I2QB 1S1UB 2F3JA 5GMEA 3NNHA 2GHPA 5CZVA 2Y9HA 4NRUA 4XPEA 1IUJA 1NJWA 1S1WA 2GO8A 3K7RA 2DRAA 3G96A 4OYXA 4ZVPB 4GO5X 3HFVA 4C4WA 1GQEA 2V5HG 2XSFA 5DQGA 2HQDA 4OMFG 4NLSA 3QFWA 5J2QA 4QYRA 3Q8RB 3NS7B 1FRLA 1WF0A 5F41A 1N36J 2KDOA 2F7VA 2BOPA 3A8IA 5K5MA 1U47A 3J7AN 3BZQA 1Z2LA 3IWLA 3IBCB 2W2PP 3THPA 3DGVA 2B9YA 2EC2A 2XYPB 1U1NA 5A8RA 4YFUA 4HACA 4H4KA 2LQBA 3PXGa 4IOCQ 1A7GE 5L9NA 3DNCA 3QT8A 2XMJA 1H3DA 5HN0A 2DNKA 3DLLQ 1E6VB 4CZCA 4FPRA 4RJVA 4OYPA 4USKA 3GG0A 1L3UA 1SB6A 1YBAA 2FZGB 4Z7CA 4OZ5A 1VQ9S 3TANA 1KWMA 5CCMA 3R6LB 3T5KA 2BUNA 4LMZA 4DV2J 3HCXA 5DM6Q 4ER8A 3BQ0A 2QN6B 2RRAA 1CULA 4K2XA 3CJTA 1XR7A 2DEIA 2HS0A 1UFKA 2IC3A 4ECVA 4K0KF 4YR3A 1WELA 1IVZA 1JJ4A 1NSPA 4K4UA 3BKTA 4OYZA 4K8RA 3M6WA 3V5RA 4P7TA 4K4VA 1D09B 1U0SA 4FBTA 4F3QA 3MD3A 2POKA 4JI7F 4GKJF 2W25A 1S9GB 2FC8A 3BGRA 4WTYA 4ZN3A 4B3SJ 1S6OA 3D3BJ 2LQ5A 3ZC4A 2ASJA 3TQ1A 4RUBA 5IOLA 2IRUA 2JWNA 1FK9A 3K8VA 1HBOA 2E29A 2E1CA 3AD8C 3N28A 3IFEA 3G86A 4LRDA 3NGSA 2IA0A 3TA2A 1W26A 4ZVTB 4WWSA 2XI2A 3W2VA 1T9VA 5KT6A 2KVIA 1YBUA 3N6MA 3DLGA 2VG7B 3J80Y 3KWMA 4J7CA 5KFXA 1T03A 1HQEA 3GR0A 1S97A 3GLJA 1NKCA 1H74A 1R8HA 1GT8A 3PO5A 2UXBJ 4M5NA 2VASA 1TL5A 1YJ9S 4LF5J 3H7HB 2BQRA 2QE5A 3RUBL 3EDRB 2GCFA 2VDHA 3Q2SC 4QWEA 3MM5B 4OX8A 1FKPA 4W98A 4WFXA 1KTQA 2DR5A 2HHHJ 4CO0A 1ZM3A 5ETPA 4IG0B 1TU0B 4X2BA 1RWWB 1VC6A 1N5VA 3HLUA 3HMJG 2MLYA 3RR7A 5F8GA 3PACA 3MCMA 5BYRA 1CJTA 2XSJA 1S76D 1S48A 3ENQA 1MN9A 2B4VA 2QX0A 2CG8A 3HD2A 4B3MJ 2D41A 2M0GB 2YQ3A 1CC8A 4R5PB 1RT4B 3RW7A 2XTJP 3GYXB 2YNIA 2GVDB 1DRZA 5ETMA 4CYUB 4DQQA 2VDIA 1REVA 3BH7B 5FD1A 2BA9A 3P5TL 3KK1A 3OBIA 2CNOB 1JLGA 3MPWA 1IWGA 3VAMA 1H73A 1PG5B 4B9LA 2CJ9A 2CDRB 1XERA 1DTTB 1U0HB 4BCAA 3Q0AA 5BXIA 2OIHA 4PYDA 4HTJA 3BO4A 3V81A 4JI8F 4CH0S 5D4LA 3AB2B 4U96A 2IM2A 3R6GB 4DV0F 2WW4A 2GGPB 5A8WA 4CLKA 2NYHA 4QR2A 2GJ2A 4ZN1A 2A0FB 2RH3A 2M8HA 2DPIA 3R3TA 4BC7A 2JOQA 4RUCA 1XMQJ 5EWGA 4G65A 4NLWA 4TKTA 2C2ZB 3PR4A 3ENVA 4KJIA 1D3WA 2DNPA 1NK7A 4AQYJ 2QLXA 1MN7A 4KGMA 4JI6F 4QW8A 2GVZA 3MDFA 5BYQA 4LFCF 2JVOA 1AT1B 3MEGB 1KQFB 2FJBB 4ES2A 5D0HA 5I3UA 3OLAA 3TZZA 2VOOA 2R8KA 3HVTB 1RT1A 3FSYA 2CJXB 3MMBB 4I2PB 2MSTA 1YJTA 3W5ZA 4M5KA 1NSAA 2XLKA 3NOCA 5HL7Q 3C19A 3LF0A 2OGUA 1YVFA 1SQGA 5EN1A 3KK2A 1X5PA 4GC6A 4LF6F 4C7QA 3RBEA 2UXDF 4ED3A 3CUNA 4FPIA 3BSCA 4Y0FA 2PA8D 1RUSA 3QRRA 2D9OA 3CCWA 1D8ZA 1VK8A 1BQNB 1HMVA 3AQPA 1PJ7A 5A0YA 3T6BA 3V6JA 4DPYA 5KFNA 1YBTA 2GMLA 1KVKA 1IQZA 2F40A 3TUJC 2PFDA 3UQSA 4OZ0A 3G71S 1CC7A 3ZNJ1 2DR8A 3BSOA 4DR6F 5I4MA 3BM7A 2DR7A 1G7CB 2DR6A 1JJCB 1W2BR 1SC4B 4K50A 1CQNA 1RWXB 4IUFA 3MR5A 3PEHA 5DDPC 2XLIA 3D6MB 3UR0A 1C2PA 1HNVA 3IM9A 4B9NA 4Q0BB 2YWGA 2EW9A 1YI2S 1MMDA 3QAUA 4TQRA 2O5DA 1MNEA 2DD8S 5IXUA 3OR2A 4KFBB 2B3TB 3O3LA 2XMKA 4G1QA 1RLCL 3AAWB 3PTWA 1A9NB 3GWCA 2IFXA 3RYLA 4U7UD 4KO0A 1M5SA 1Y3JA 1NBEB 4NYPA 4N8NA 4A46A 2QA2A 3RBZA 7AT1B 1HNWJ 3M6UA 2X7IA 5KFPA 4RU9A 4Q5VA 5H9FJ 1OQ3A 1OMSA 3SQOP 1D1UA 3PJXA 4L3KA 2N7YA 5E3QA 5HVHA 1WC4A 2R7WA 2C1EB 2JLFA 3M2UA 2MYFA 3PKMA 1K1SA 2JZ5A 2BKNA 4CLWA 1BQMB 4ZVGA 5KG7A 2BE2B 3K59A 4AUKA 2QLBB 5L39A 1IN0A 1CJVB 3NCQA 1MSWD 3OTEA 4A8SA 4DQIA 2X1GA 2X1BA 2MSSA 5AXNA 5EX0A 1C1CA 2E7XA 3DXBA 1BE4A 2IVMA 3EX7B 2W7OA 1VRTA 4LR7A 3GFHA 2I8EA 3ZZYA 1IJEB 1IKVB 1RTDB 1PKUA 4XPCA 4IO9Q 4LF9J 3F0NA 4IFYB 3BEGB 3OVSA 4X62J 1U6BA 4GVBA 3F56A 4Y2CA 2PMWA 4HL9A 1S1TA 2MQLA 3DM2B 4PEOA 2NQPA 3DRRB 1NUEA 3M30B 5KFEA 3KLFB 1N0UA 4LFAF 5B0CA 4TVAB 1RTJB 1OY6A 5M2PA 4B3TF 2GC8A 1RAJA 2EKYA 3D1OA 1XNRF 2AX1A 3HD1A 4FF4A 3MMCA 2YVSA 1JLCA 2WHOA 1SC3B 2QZ8A 4WK3A 2KFYA 5B0BA 1SJ4P 1RACB 1HHTP 1GXUA 2KT5A 3MM7B 1NK5A 1FE0A 4ZLJA 1D8YA 4EI2A 2W2QP 4W4MA 4LUBA 3NY0A 5B0GA 1UVJA 2QG9B 4OV6A 4UQGA 4X4QA 3UCGA 5EWFA 3DYAA 4UW2A 4YB7A 2RUGA 2JH3A 1TKXB 4F4ZA 4J9KA 2CUYA 4C11B 1D9FA 1L5UA 3AXMA 4CRJA 2WOMA 3I32A 5L1KA 2B4UA 2UXCJ 2WTFA 1RK8A 2UU9F 1D9DA 2GIQA 2ZE2A 3W61A 3QATA 4EEYA 2CPEA 3OW2R 2ZOGA 3LW5C 3FUYA 4L74A 1S9EA 4H4OA 1AUDA 1CJUB 5E3PA 4N8OA 2FTRA 3HKWA 2J6SA 2YKNB 1FERA 1FNMA 1J5EF 2UZAA 3H5UA 4MTPA 5HLFB 3EVMA 2KH9A 5IM0A 4X65J 3HO1A 2C2DA 2ROEA 3T5HA 2CJBA 5KG1A 2F1FA 1RWPB 1RTHB 1LQ9A 3WHIA 2RNEA 4AT1B 1SI9A 4USUA 1VC0A 1SKSA 4DMZA 2R2RA 3THVA 4ED4A 4Y28C 2GQQA 3GMGA 4C6AA 4PWWA 3OV7A 3E01A 4KPYA 5CHCB 4ZK7M 4AL7A 3ZTPA 2SXLA 1CS4A 1GMWA 1Q7LB 4YS2A 3DFEA
chains in the Genus database with same CATH topology
3B4MA 2UUTA 4ETXA 2RRBA 3FZ2A 3FGVA 5F9NA 1W2IA 2ZD1B 4B3MF 2RDJA 1QVGR 2KJWA 1MU2A 3HHLB 4KIAA 4XDDA 1HQUA 1X9SA 3CXCR 4R0EA 2K2PA 1Q4RA 4KV8A 5GADI 3WDOA 3M32B 4X66F 3TW0A 1N5SA 4DR7F 1X8DA 3OFEA 5C25B 2C2RA 1HWJA 3MECA 2ZH6A 3KHLA 1S1VA 3RB3A 1N6QB 1LW2A 4DS5A 1HFEL 1U1QA 3J7YU 3GG1A 4WFAQ 5C24B 5E5NA 3OQ2A 4CTAA 2PSZA 4U7UK 4C3MA 4C3KA 3JB9k 3P3DA 1U4BA 1ULRA 2DGSA 4HDHA 4ZVEA 2F9DA 4C8YA 4FXDA 4QPTA 2V4RA 5DETA 2M88A 3FEZA 1V3SA 1S6PB 3ZZRA 1DTQA 1VBYA 1S1WB 3SSRA 3UDCA 4EBDA 4QCLA 3FVYA 2BANA 3F41A 4M8LA 2B5JA 2EBEA 2XMMA 4MKBA 1VQ7S 1Q16B 1U6FA 1Y7PA 2VBZA 4C97A 1JJ2R 5DDRC 1VQLS 1SUQA 3TI0A 1RA7A 1RT5A 2CQ1A 4G1PA 2YKNA 1HBNB 4LF8F 5L38A 2A10A 1KFDA 3VF0B 4DFPA 2XZWA 1IJFB 1FXLA 5IZHA 2KYXA 1TV6A 1RTIA 2YNGA 3PX6A 5J2QB 4DR5F 4CO1A 4IG3A 4R5PA 1RT4A 2JC1A 4K4XA 2YH1A 1LWCB 1ZTTA 4X4UA 2CZ4A 3IRXB 3OFGA 4YR0A 2QA1A 2C3OA 4DF8A 2M8DB 3WBZA 5HLFA 4ELVA 3KNGA 4RBTA 2Z4PA 1FDBA 3GV7B 2OJ3A 2MDAA 4KHRA 1ZZNA 2MKHA 3HXMA 5IWAF 4PQAA 4Q43A 3KYLA 1JXEA 3PV8A 3RRGA 2B7CB 1RISA 3MI7X 1HARA 5JVGQ 4NLRA 3L7PA 2LA6A 4OI0A 2CQDA 3CJ4A 4QIWD 4FF1A 3IC1A 3JSMA 3AY0A 3O6QA 5CQGA 4A8KA 2VPWB 1SC6A 2PMHA 4I56A 4MJKA 3OTOF 2Q66A 3OXGA 4ILMA 4OI4A 3PRDA 5KFDA 2A1BA 2D3ZA 3FJ2A 3IRWP 1EETB 2DNZA 1VQNS 4ECSA 3QLHA 3S01A 4U67Q 3MAQA 1IR0A 5T14A 3RAXA 2XMUA 2VG5B 2EFPA 2JEFA 1VIOA 3I5BA 1XEZA 2YWHA 4OZNA 3QJLA 1VC5A 1DTTA 3TNVA 1LV5A 2N4DA 1XMQF 3U7JA 3CO9A 3CJ3A 2ZOMA 3BB5A 3R27A 2LKZA 4O3NA 4CO5A 1SV5B 5HMZA 3IAS9 4AXIA 4O3SA 1K0VA 3BQ2A 1V3RA 3BN4A 3ZZ0A 4BC9A 4LIWA 4AQYF 5FJ4A 1QUVA 2Y1JA 4WU2A 2KG0A 2WCXA 4BBYA 2BXJA 4KGKA 1S6UA 3CDAA 3N6NA 3HHLC 1DAXA 3CGIA 2AP6A 3GIIA 2AYBA 2HQ3A 3NGDA 1CVJA 4RZRA 3WX4A 3LOUA 4DV7F 4PWDB 4FXVA 3KLHB 2GGPA 4NA3A 2MGZA 3M8RA 4ZCLA 3KLEB 2VKZG 3R5AA 1TAQA 3QIPB 4M95A 4G3IA 3C8YA 3I0SB 5BJRA 2BR0A 1XC9A 3NMRA 3I82A 2ASYA 2ZD1A 2M5YA 1WI8A 3GSDA 3HHLA 2G13A 3QAEA 3DOKB 5CYMA 2ZHBA 4V19J 3MPVA 1VS3A 3G6YA 2DH8A 2I9SA 5B0EA 1Q8IA 3H4DA 4A8QA 4NXNF 2WB4A 2OPSA 2VQEF 2H5EA 5LL6d 1N6QA 1TR0A 2VG6B 3DRXA 2HW3A 4I1TA 4K5SA 4YY3F 5C24A 3NKYA 3CC7S 4B9UA 3QZ7A 2ZDPA 1X4FA 1QVFR 1VK3A 3I56S 4JI2F 5I3QA 5SUHA 2AX0A 3FRZA 2ALZA 4PUOB 1YRTA 2IC3B 1XBWA 2AYEA 4ED8A 2KM8C 2BBEA 2Q79A 1VJWA 4D3HA 3QJPA 3M8QB 1YJVA 2BYCA 3MOZA 5F3ZA 4F4WA 3W2WB 2GMHA 2K8GA 4IFVB 2VC1A 2R7TA 1O8BA 4N5SA 2D74B 4Z2XA 4FF3A 3J7A1 2J76E 2AYMA 5FDLB 2FDNA 1YITS 2DCUB 2J9EA 3MOJB 1HNIB 3AJ2A 4DL4A 3OTCA 3U02A 3S7RA 2QA4G 2HLTA 2BABA 1FRMA 2VB6A 3QO9B 2AGQA 2OPQB 2XC9A 3KMQA 1FRIA 1X5SA 3CCSS 4K4YA 3MEGA 3OXLA 2O3DA 4A47A 4Y2AA 3M05A 3IRXA 1QSLA 4B9SA 4J9LA 2CQIA 3MURP 1QTMA 4YEAA 1QJHA 3BGRB 1OSDA 4ZA1A 2FB0A 4WK1A 4PXDA 1QSYA 4P2SA 4C8OA 4CO3A 1FNXH 1UVMA 5E33A 3HVTA 1TL3A 4RW7A 1JMTA 3MMBA 4I2PA 2FLOA 2HWIA 5D4OA 2LA4A 1A6LA 2YX7A 3MR3A 1KNZA 4DG1B 3QJJA 2V8DA 1UA1A 5JVHQ 4ED1A 4JI3F 3M9NB 3CF5Q 4USHA 4ELTA 4B02A 2XG8A 2Y0SD 4DV3F 4I4BA 1IBKF 1FK9B 4CI0B 3FFIA 4XIUA 1HBOB 2F8EX 1N5YA 3R5BA 2CFXA 1P8GA 1VRUB 2RMLA 2VG5A 1N56A 4ED6A 2YX4A 1SQEA 4B08A 2PN6A 3NGKA 4F67A 3K0JA 2OFHX 3KK3A 5DDQC 4IH6A 4ECQA 4CQ1A 1QE1B 3QGHA 4DHVA 3B8HA 4DV6F 2E44A 1UL3A 4IH7A 1KQKA 4OI1A 4N56A 1N5QA 1NH7A 3CJ0A 1VBZA 3ZZZA 1FD2A 1N48A 1H98A 4L72B 3CIMA 2HS4A 2L9NA 3DI6B 2MQQA 3H2VE 4DSFA 4I64A 2FHJA 2R8JA 5KOWA 3CDBA 2NXUA 1GX5A 4XAKA 3T9ZA 3TOQA 3ZFVA 3Q8QB 1WACA 2DNYA 1T03B 4ZP9A 4OX7A 1LK7A 4RU2A 5K8PA 1TKZB 3GIMA 1QSSA 5F8MA 2CPYA 2M52A 3KLHA 4F26A 2AU0A 2BZ2A 3D0IE 2QMXA 2VZ9A 5AE3A 1UVLA 3KLEA 3SYZA 2R7XA 1BQNA 2EFGA 4QOTA 3PW4A 2XWXA 3M1VA 1X0FA 1X5OA 5DDOC 1WI6A 2FPHX 4DL6A 2X51A 5KFYA 3HVAA 1E6YA 2DIVA 4OJGA 3CC2S 4KAIA 2QMWA 3DU5A 4ES1A 5HO4A 2OD6A 1KLNA 5GAHU 3J7Z5 1UVNA 3T1AA 1KS2A 2P6TA 3EPGA 3BJYA 1DQ8A 4TLRA 4JI5F 3C46A 2D3UA 3KNAA 2DGTA 1JIHA 2KO1A 4LJMA 1R8BA 1IKYB 1JKHB 1FKPB 5A2QY 1KOOA 2VG6A 4LF7F 3SI8A 4FBUA 2GIRA 4NZ0A 2UV8G 2ZJQQ 1LXJA 2DNRA 2UUCF 4NMLA 4HVZA 1VQ8S 2WAQD 3DHWC 4PUOA 5KFIA 3CCMS 3TAMB 1NK4A 2NUHA 1B7FA 1HWIA 4NLXA 1VQOS 2RKIB 2ZM6F 3M8PB 3M8QA 3V6DB 4LF4F 3MFIA 1X4DA 3W2WA 1U25A 4IFVA 4NPOA 3OL7A 2DNNA 3BGFA 1GXLA 4DQPA 1C0UA 3CDEA 1UEVA 4KR0B 2AYGA 3I5CA 2N7CA 3UCZP 4C8MA 2ZDOA 1KHVA 2XB2D 3SSSA 2LYVA 2ZNYA 3MGJA 1RA6A 5GAHI 2RS2A 2XSJB 1HNIA 1L3KA 1FXRA 3CJ2A 4ZHRA 3R5DA 2MZJA 3EXCX 3OR1B 5K8NA 3MUTP 4Y3CA 1MWZA 2D7SA 1HNWF 2C22A 3NBPB 1S10A 3QO9A 2QV6A 3V4MA 1C1BB 2DO4A 2CPJA 2OPQA 2YWKA 3DLEA 4Y2KA 4E98A 4Q0BA 3MM9A 3BR9A 2NUUG 4I6AA 3DDNA 5KT7A 4C8ZA 3MEKA 2ZOFA 2AW0A 1Q79A 1OIAA 4DSLA 4F2RA 3IA0A 3CCJS 3FSIA 5E3AA 1IXKA 2JFDA 1DQ9A 1NH8A 2JDJA 4QR0A 2AQ4A 1PC5A 3I4HX 3I96A 1N8RT 2OTLS 1T3OA 4ZCMA 4OHXA 2XGPA 3RB4A 1SKRA 3NMAA 1WWHA 4DLEA 3ENWA 4PXEA 4HT7A 2CQ4A 2DHAA 4DV2F 3PW0A 2DH9A 4MH8A 1F60B 2HGNA 4R0JA 5KFRA 3F44A 3C6UB 2G0CA 3LPYA 2W4PA