3EGZA

Crystal structure of an in vitro evolved tetracycline aptamer and artificial riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for specific, high-affinity tetracycline binding by an in vitro evolved aptamer and artificial riboswitch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 19
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3egzA00
1WHVA 2DNGA 2J8AA 2MSTA 4TU9A 2VODA 1KQSR 2AYGA 4F02A 2MSSA 4U67Q 4WF9Q 1U6FA 2K3KA 2CQ4A 2VOOA 4P6QA 1FO1A 3SMZA 3NMRA 4M5DB 1BY9A 3UE2A 1R8PA 1D9AA 2DITA 3V4MA 3MD1A 4TLQA 1FHTA 1P1TA 3MUTP 2DHSA 2MY7A 1VBYA 2OJ3A 1X5TA 2GHPA 4QPTA 3TO8A 4CH1A 3CULA 4J5OA 4W90B 2G4BA 2X1GA 2RVJA 2N7CA 1XN9A 5GAEU 1QVFR 1A9NB 1WHYA 3S7RA 3BO3A 2M88A 4ERDA 4BS2A 4C0OC 2ADBA 1OPIA 2M52A 1WELA 4TU8A 3IWNC 2FC9A 5CA5A 1WG4A 3UCGA 1JJHA 1N88A 1U1PA 1H2TZ 2CQGA 3VAGA 5IFMA 1H2VZ 2X1AA 3L3CA 2BOPA 2DNNA 5JVGQ 2HZCA 3IRWP 5CYJA 2AYMA 4EGLA 2JVRA 2LCWA 2F3JA 3CCRS 2CQ1A 4PRFA 3THPA 1YJ9S 3EGNA 2ZJQQ 1X4AA 2DB1A 2MKIA 2JX2A 2RQ4A 3US5A 4QU6A 3CCQS 5HO4A 4IO9Q 2RS2A 2CPHA 2DNOA 3UCZP 1FJ7A 1WG1A 3R1LA 2CPZA 3CMES 3MI7X 1WTBA 1WHXA 2A3JA 2CQHA 1X0FA 2F9JA 2BZ2A 1M5VC 2X1BA 3DXBA 1NU4A 1X4GA 4C4WA 1H6KX 2RU3A 2XS7A 2X1FA 3MOJB 3TYTA 2MZTA 3P5TL 1YJWS 3CXCR 2D9OA 3RW6A 3ULHA 2KHCA 1SJQA 3CCUS 2CPEA 3RW7A 2K8GA 4QU7A 5LJ3Y 3U1MA 2MZSA 2YKAA 3SDEA 3VAMA 2MGZA 1X4CA 2N3OA 1CVJA 1NO8A 3OW2R 2DH9A 2KRBA 2KH9A 2CPDA 1VQOS 2DGSA 3CC2S 3CMAS 3CCSS 1Q82T 1R8HA 2UP1A 1AUDA 3G71S 2MKHA 1VQ4S 2CPXA 2JWNA 3NS6A 3MDFA 2YH1A 2KU7A 1N54B 1VQ6S 2HGMA 2M70A 2M7SA 3R1HA 1X5PA 3EX7B 5BJRA 1N52B 1OIAA 1VC0A 2SXLA 3U1LA 4LJMA 2RRBA 5GVQA 3UD3P 2AYBA 3I55S 4ED5A 1U1OA 1VC6A 3S6EA 1WI6A 3CF5Q 2MB0B 2FC8A 2DK2A 5MLCV 4C7QA 2VONA 2CQIA 2M0GB 1JJ2R 2YTCA 3Q2SC 2KRRA 2M9KA 2DNQA 4A8XA 3VF0B 2EVZA 1U1LA 5DETA 2NZ4A 2MKJA 4WFNQ 2MZRA 2OIHA 1WF1A 3MUMP 1M5KC 1UFWA 2RT3A 4F25A 1PO6A 1KC8T 1FXLA 4CH0S 1G2EA 2KXFA 2KM8C 1VBZA 5LJ5Y 1WEZA 5DM6Q 1VQ8S 5IQQA 2MXYA 1VQKS 1VQLS 2HYIB 4FXVA 1KD1T 1YI2S 2CPFA 3G6ES 2MKCA 2LQ5A 1U6BA 1VQPS 2MZJA 2DGVA 3TP2A 5H1SV 2D9PA 2U2FA 1OWXA 2Q79A 1YHQS 1VQ5S 3ZZYA 1B7FA 1PGZA 1K8AT 2PEHA 2HGNA 3LQVA 4WIIA 3VAJA 1U1KA 2MQOA 3MXHP 4V19X 3THTA 3Q2TC 2RNEA 3FEYB 1JMTA 2DIUA 5GAHU 1U2FA 2YH0A 3SXLA 2LYVA 2ZJRQ 1OO0B 2ADCA 5LXRA 2L08A 3PIOQ 3K0JA 1WEYA 2AD9A 5GADU 2O3DA 2PE8A 1WF0A 2LEAA 1M90T 2E5IA 2MQLA 2QFJA 3CUNA 3MUVP 1F9FA 5GAGU 2CPIA 2L9WA 1Q81T 3BO4A 1ZH5A 2CQBA 2RRAA 4OZ0A 3ZZZA 2E5JA 2MHNA 3UWTA 5D77A 2DHAA 3J7ZT 5DM7Q 1S79A 2MKKA 5GMKa 1A7GE 1U1QA 3CD6S 2EK6A 2OTLS 2JRSA 4Y00A 2FHOB 2D3OR 1UAWA 2LEBA 1X5OA 2MZQA 2RS8A 2CJKA 2LXIA 1X4EA 2KXNB 1M5PC 2J0SD 1U1RA 1DHMA 1YTYA 4RU2A 3CCLS 3B4DA 2V94A 1M5OC 2DHGA 3D2WA 1K73T 1VQNS 5EN1A 4WFAQ 5CXTA 4IOCQ 2MYFA 2M2BA 2DH7A 1X5SA 2G0CA 3N9UC 4YOEA 2MQNA 2MGZB 3VAHA 2N82B 1WF2A 2DIVA 2N3LA 1FT8A 4LMZA 3CTRA 1DRZA 2DH8A 2DGTA 4WFBQ 3HI9A 1UW4A 2DNYA 3SDEB 4TU7A 3EGZA 2QEXS 1IQTA 2AYEA 2RUGA 3P3DA 1W2BR 2CPJA 2M4MA 2L41A 5ITHA 2MJUA 2RQCA 1SXLA 1FJEB 1O0PA 4YUDA 1SJ3P 2DGXA 2MMYA 2HGLA 2MPUA 2FPHX 4CIOA 2GO9A 4W92B 2DNKA 2KFYA 2OTJS 1H2UX 3R27A 2LXUA 1KOHA 5HL7Q 3CC7S 2DNPA 1HD1A 4YB1P 2MZ1A 2XNQA 2EK1A 5LSLA 1SJFA 3DLLQ 2MJNA 2LKZA 2I2YA 3FEXB 3B4MA 3VAFA 4UY8T 3P6YC 4FXWA 2NLWA 1N8RT 1NJIT 2ERRA 2E44A 3J7YU 2QA4S 2KG1A 3G8SA 2U1AA 3UCUP 4Y0FA 1KOOA 5DDPC 1VQ9S 1FNXH 2MKSA 2M8DB 3JB9k 3BO2A 4ZKAA 1ZZNA 3CCJS 1WWHA 2DNHA 3PIPQ 3CCVS 4F26A 1Q7YT 2DISA 2CQPA 5DDRC 2HVZA 2LA6A 1M1KT 2KM8B 3S01A 2M8HA 1WG5A 2MQQA 2KYXA 2WBRA 3LPYA 1X4HA 1YIJS 5IM0B 2DNRA 1X4BA 1X4FA 3VAIA 1RK8A 3HHNB 2F9DA 2E5HA 1D8ZA 5D78A 3H2VE 3NNCA 3VAKA 4PR6A 1SJ4P 1WEXA 2B0GA 2DNMA 2JVOA 2XS2A 4OZ1A 2LECA 2J0QD 2E5GA 5LXYA 2DGUA 1L3KA 1U1NA 3VALA 4QQBA 5DDOC 1QVGR 3NNHA 1P27B 2DNZA 3BEGB 4Z2XA 1DBDA 2DHXA 3BS9A 2OSRA 2G1DA 1YWXA 1HL6A 2KT5A 3MURP 1VBXA 4WKRA 1U1MA 1HA1A 2DGWA 4PKDB 2CQ2A 2LMIA 1YJNS 1VQMS 1YITS 1HD0A 5LSOA 2OSQA 5FJ4A 2I38A 1X4DA 3G8TA 3NS5A 4CQ1A 2CQ3A 1JJ4A 3H2UB 1ZZFA 2CPYA 2XS5A 2XNRA 2J76E 3NNAA 1RKJA 1S72S 2YWKA 3G4SS 3S8SA 5DDQC 1WHWA 1UP1A 1Q86T 3UD4P 2DGQA 4LIRA 3G96A 2KI2A 2KN4A 3I56S 4IOAQ 2KG0A 1QM9A 2XSFA 2KVIA 5IM0A 2LA4A 2XB2D 3CPWR 4WCEQ 2CQ0A 4IUFA 2MQMA 3P49B 4UQTA 2DO0A 1FJCA 1WI8A 3G9CA 2FY1A 2KXHA 5JVHQ 3MD3A 2ZJPQ 1K9MT 1DZ5A 2DGOA 2CQDA 2MY8A 1VQ7S 2MQPA 1URNA 3CCMS 2CQCA 2DO4A 3CC4S 3CCES 2VOPA 1SJRA 1VC5A 2DNLA
chains in the Genus database with same CATH superfamily
1WHVA 1HIYA 5EX3A 4CLWA 5F41A 3DYAA 2DNGA 3UDEA 3KG4A 3G86A 5E41A 4TU9A 3RAXA 2VL1A 4QWAA 2ASJA 4LF7J 1U6FA 4ZP8A 3MHYA 4IG0A 3B8HA 4NA3A 2D3O1 4U7UD 1PC5A 5E3AA 2E1RA 1FE0A 1PJ5A 3EDQB 2MEWA 3SMZA 2XLJA 4FS2A 1SC6A 3W2VA 2WW8A 1SCJB 5LT5A 4JB8B 1KQFB 4Z37A 1R8PA 1RE1B 1WSRA 1TKTB 1C4CA 4ZLJA 2XHWA 2OD6A 3MD1A 4GVLA 1VQSA 5HQ8A 3K5LA 2O1PA 4EYHB 4L73A 4AFFA 2R2UA 4ED7A 5IWAF 1S10A 1I6JA 2YKMA 2UVWA 3BF4A 1T7PA 1VYAA 1WTFA 3M8WA 1RT2A 1FK9A 3VV2B 2OJ3A 1V3SA 3W66A 1J5OB 2KDOA 2C2NA 2FVSA 3TO8A 4A4JA 1RWOB 2ZC4A 5EGYA 2X1GA 4K8RA 2ACMA 2ZZTA 1U45A 1XN9A 4JI3F 4ETZA 2OTJS 1A9NB 1SQFA 1URRA 5L39A 1WHYA 2WONA 3L95X 3S7RA 1BWEA 5FD1A 3KLGA 1U02A 2W9AA 1RTDA 5E3PA 3BH6B 1RHUB 1WELA 5A8RB 1FDBA 1ZAXA 3HKZD 3V6HA 4TU8A 4EYIB 1G7CB 2H5IB 2NPFA 3PW0A 4B3SJ 2JC0A 3C14B 3N0VA 3K58A 2OMLA 2AGQA 5CA5A 4M94A 1WG4A 3UCGA 1JJHA 4ZPDA 1U1PA 1C0TA 2PA3A 4ZPCA 1BGXT 1PYOB 1UEKA 4RU9A 3OJUA 4DR7J 1NUEA 4NYPA 3TQ1A 4R5PA 2YNHA 2Y0BB 4NE9C 2V2ZA 4FP9A 2ASDA 2E9ZA 2K1RA 5IFMA 2XYPB 1KEKA 2J7KA 5I3UB 5KFXA 4X66J 1HBNB 3DOLA 3QPIA 4H4OA 2CZ4A 3MR5A 3VTIA 2BOPA 3EXYA 1HI8A 4L3NA 3CCVS 4FYWB 5IV3A 2HZCA 1LKZA 2BVZA 3O1LA 2UV8A 2FVRA 1LWCA 4NLUA 4O4GB 4U8YA 4X65J 3FRYA 2CQ1A 3BGFA 3M30B 1A0OB 2UVVA 4GKJJ 3THPA 4CM2A 4J9KA 3G6YA 3D6MB 4F0MA 3MPWA 1FESA 1P1LA 2BQ3A 2NR0A 2EBGA 4JUZA 1FRXA 1X31C 1XWLA 2A1BA 3CEDA 3EZUA 2W8LA 3NMAA 2H65B 4QWBA 3BKFA 5L9NA 1D09B 4ED3A 4RW9B 4ILMA 4DMZA 1P9QC 2BDPA 4M5NA 4IG3B 2AEMA 3C2PA 1WG1A 2UUTA 4NI2B 3IRXA 5F8LA 3OLBA 3R1LA 1WTBA 1DLOA 4ECSA 2KZZA 4AL7A 2LP4A 3IO1A 1RA7A 2ZFHA 3OR2A 4OFZA 4RWXA 4ZVGA 1X0FA 4LVOP 2ALYB 1WOSA 3A13A 2XSJA 3EPGA 2WVEA 4X4NA 2MLXA 4KY3A 3KHLA 4RNOA 2OI2A 5I42A 1RT1A 3KHHA 3BDPA 3F56A 1IKWB 5SUHA 4K4VA 4FF2A 3D3CJ 3R5BA 3CDWA 2VG7B 1S77D 5CD4A 3MM8A 3PFEA 5F8JA 1X4GA 2HEKA 4DSJA 4LF8J 1HWJA 2CKWA 3AJDA 3D68A 5ADZA 3UDVA 4ZPTR 5J1EA 2XS7A 4DR6J 1BHNA 5FLXY 1RT6A 4NLQA 4HLBA 3TYTA 3CJ3A 3GQCA 2MZTA 2HHWA 1U26A 3P5TL 3NL0A 5GAEI 1NDKA 1OMSA 2O01C 2MKYA 4NLDA 5EWFA 4GKKJ 1WUUA 3QBCA 4LF6J 4RR5A 3CXCR 2D3UA 3PR5B 2GGPB 2IJFA 4UQGA 3HD1A 4JI3J 3ULHA 1EB0A 2YPYA 1FXRA 2AQ4A 3HVTA 3CCUS 4ECVA 2K8GA 1UW9A 1IVZA 4NMXA 1EZZB 4K4WA 2V9KA 5T14A 1PKUA 2IM2A 1AZSB 2B9WA 3FKBA 3GJSB 3GTYX 3W63A 3U1MA 3DKDA 2WVBA 4ED2A 1R7IA 3NKYA 3SDEA 2BRLA 5HMYA 3VAMA 1LK5A 2ZHBA 1GX5A 1F6TA 2B7CB 4R8UB 5HATA 2CVEA 4WFXA 4WP8A 4X62F 2XMKA 3MM9A 2GVZA 2WSEC 5GAHI 2DGSA 4R0EA 1RT2B 4OZNA 4L74A 2RAQA 4ES1A 2YKMB 4MK7A 1R8HA 2GJIA 1DURA 3RUBL 4ENOA 4TYAA 3M32A 5J1PA 1VQ4S 1HBOB 2IJNA 4ZP7A 1RTDB 2CPXA 3QAEA 4HVZA 1UWBB 1ELOA 2PT0A 4JI4J 3NS6A 4DR6F 3R2CJ 1JLBB 2OPSA 2LDYA 2HQIA 3TQEA 4X4QA 1NDLA 2R9LA 1NB7A 1N54B 1VQ6S 2HGMA 3T6JA 2WONB 3R1HA 3H8YA 1DAXA 2X51A 4N7TA 1JLQA 2V8PA 3ITHA 3QYYA 3W64A 5BJRA 3C6UB 3ZC4A 3OL8A 2IBKA 3POTB 4R5PB 4GVBA 1S6PB 3FJ2A 1Q8LA 3OXGA 2K1RB 5GVQA 3CB4A 3I55S 1U1OA 4CCHA 3BBCA 1N0VC 2HWIA 5G0RB 4RUCA 1FCAA 2V50A 1AFJA 4UW2A 4X4SA 5F8NA 3LAMA 2WSFC 3O8WA 1V5IB 3CF5Q 5HJXA 2NSCA 1XR7A 1YGYA 1U8WA 4EBEA 4QYZJ 4ZHRB 1H98A 1B0TA 3IBFB 3U27A 3H20A 2CQIA 2M0GB 5KT5A 4UY85 2H1YA 3PRBA 1NH7A 4MH8A 4IG0B 5B09A 4ECRA 1FEHA 3KHRA 4U7CA 1FF2A 4A8XA 2DNQA 4TY8A 2V8DA 1KP6A 3TRGA 1RHMB 3MGJA 3JYTA 4M5MA 1S1VA 4WTYA 1RBAA 5HLFB 1C1CB 4TY9A 5CD4H 4NXNJ 1RUSA 3KLFB 3AH6A 3MEGA 5D15A 5KG0A 3RAQA 2MZRA 2OIHA 4FF1A 2KL8A 2EC2A 4P2SA 2GHVC 1UFWA 2VC0A 4DV4J 4NL5A 3W62A 4F25A 4CH0S 2IM0A 1LWFA 1G2EA 4LSNA 1YK9A 2GQQA 1HLWA 2R7QA 1MSWD 2RILA 1RTIA 3CMQA 2OEMA 1VQ8S 3G87A 3D28A 5EDWA 3OUYB 1VQLS 2CIMA 1OPZA 2ZD1A 3I0RA 3IRXB 2RF2B 2FDNA 2F8EX 2BJ7A 3BGUA 2AP6A 4CM0A 1WSVA 2CRLA 3CCTA 4OLOA 2VF3A 3K17A 3EPIA 2BJ3A 2YNFB 2VC1A 1VQPS 3JSRA 1U0HA 2HSEB 3WHIA 1JWWA 2XCPA 2U2FA 5D8HB 3PW5A 3OFGA 3N79A 3MPUB 1IKYA 1K44A 1VQ5S 3NCQA 4ED4A 2HVDA 4LSLB 1B7FA 2B8PA 3V2UC 4OZJA 2NZCA 5HMXA 2PEHA 4NCBA 2XMWA 2IHR1 5LSRA 5CH7B 1SI9A 1U1KA 2K2PA 4DLEA 5HAOA 2XHCA 3SFUA 1XC9A 4DUYJ 1TMMA 2AMCB 3GPAA 4A8YA 1F1BB 1NPPA 2AEJA 2DIUA 3GWCA 3QLHB 1GXTA 1U25A 2B9YA 5GAHU 3Q8PB 2YNIB 2LYVA 2ZJRQ 1QSSA 2CXEA 2W4PA 4M5LA 5BYQA 5ETNA 1RP5A 5A0YB 2I5JA 5LXRA 3UR3C 1U24A 4QWCA 1X60A 3BR8A 1NJZA 4LFBJ 2AD9A 3GG0A 2IAJA 3KKFA 4LBPA 3R5JB 2B5JA 1KLMB 2LEAA 3BM7A 3NBPB 3HD2A 4J9VA 2E5IA 4NEYA 1M90T 2Y8YA 6FD1A 3CUNA 1RXOB 4HR2A 5CZXA 3SCIE 4UZBA 2J9DA 1Q81T 5DZ7A 4CLYA 3SBMA 2DRDA 3KWMA 2C3MA 3MPDA 4CZCA 1TK8A 2CQBA 4LUBA 4C3MA 1ZH5A 4E0DA 1NKEA 4F0HA 4OZ0A 4JI2J 1HBMB 1S1UB 3CJ0A 1Y0HA 3FZBA 3J7Z5 4FYXB 3R7NB 3ZZZA 9ATCB 4DHVA 3E3XA 3ISZA 1KTQA 2ZDPA 1HNXF 4P9SA 3J7ZT 3G82A 2RDJA 5DM7Q 3CDBA 4OJ1A 1RB0A 4UTGA 4W98A 1B0VA 3SFGA 4ZN1A 4BHQA 3CD6S 3C6TA 2P9EA 4C8YA 2QN6B 2Z2LA 3EGVA 4FKXA 2GVZB 2E7WA 5JMNA 5F3ZA 2HRUA 1H7WA 1HQEB 4HDHA 2FHOB 3HVWA 2D3OR 4FDFA 2I2YA 2CZVC 1T9UA 2IYGA 3ZTQA 4I2QA 4Y65A 1SKUB 4I68A 1FEEA 4MMOA 2CJKA 4HEA9 2LXIA 3CO0P 4FNIA 1X4EA 2LLZA 1JLCA 1QDUB 5KFLA 1HYSB 3C8YA 4LVNP 2FVPA 5KFEA 4HYKA 5D3GA 3MECA 4KPYA 3CSKA 5K8NA 4X4PA 2J0SD 1U1RA 2ZBPA 2FY8A 4RU2A 1NHVA 2Z0GA 2HNYA 2ZITA 2F4VJ 1RAGB 1S12A 5THWA 3VQTA 5KFGA 3ENWA 3BBBA 2DHGA 2VH7A 5CABA 1IBLF 1R8CA 2D7SA 2LEPA 3J81Y 2NS1B 1T95A 2F40A 4WFAQ 1DTQB 1TP7A 1N48A 1R8BA 2DH7A 4PPZA 1VS3A 3QRPA 2DCLA 2QLFB 2YWEA 1HMVA 4KIAA 1RT4A 4AL6A 1FDAA 4KFBB 1JIHA 3O2IA 2N82B 3VGTA 2N3LA 4KSEB 1KRPA 3MM9B 5HSPA 1SV5B 4K0KJ 4QJVA 4LRCA 1CG2A 4ED8A 1ZAWA 4WFBQ 4L6V3 3HI9A 5LL6d 1N56A 4LSNB 3JS9A 2DNYA 4C8ZA 2W2OP 2R8JA 2VUGA 5E5NA 1UWBA 3QT7A 3LA0A 3RJMB 4DS4A 1UA1A 2C2DA 3NGUA 1NSKL 2AYEA 1Q95G 4XPEA 2UVRA 3A4TA 5B0AA 4DV4F 2M4MA 3ZNJ1 4J7CA 3BGRA 3VCDA 3M6XA 4KHPF 1KS2A 2H5EA 1SXLA 3TJAA 3T5JA 5H9EJ 4ZVTB 3KDOA 4MTPA 1SJ3P 2MMYA 3CE8A 3OTEA 4UOCA 3K5NA 4MIWA 4RNMA 1IXKA 2V8VA 4DX7A 2HQDA 2BJ9A 1CLFA 1TMJA 4O3NA 2DHHA 4LF1A 2BYCA 3DLEB 3EVOA 5C42B 2KFYA 3PX6A 3AT1B 1AUSL 3N6NA 1L5UA 3AJ2A 1KOHA 1S57A 5HL7Q 2R7OA 3CC7S 4J91A 3WDOA 4ALZA 3RR7A 4RBTA 4PG6A 2EK1A 1SJFA 4IRCA 1FNMA 4MIBA 4QPXA 2Y8WA 1GAOA 3VAFA 4P10A 4UY8T 3I87A 4DSLA 2VKZG 1HNZF 3I5AA 5CCMA 2NPIA 2E44A 3DC2A 4C98A 4JI6F 1DQAA 2KG1A 3ENQA 1RBOB 3I6PA 5B0GA 3BSCA 4Y0FA 3J81j 3H5XA 3BSNA 4I1TA 4P52A 1W26A 1BE4A 4DS5A 1J5EJ 1S1TB 1XERA 4L75A 3D0HE 4RX6A 2XY6A 3OFFA 1TV6B 3W2WB 2JNJA 1KKHA 2CNOB 3GSDA 3HVAA 4NLWA 4CRJA 4F26A 4H4MB 3PIPQ 3KNGA 2IYIA 3OL7A 5F9LA 4F50A 2HVZA 2GNKA 5HVFA 5M2PA 4PQAA 5DS7A 2AKWB 1NB2A 1VHFA 3A3OB 3DDKA 3IBCB 4AT1B 3MAAB 2HHSA 4R0JA 3I5CA 4PWDA 3J81U 4DV5J 2MQQA 2WBRA 3QSYB 2OFGX 2XMAA 1X4HA 2YXLA 3BH7B 1TFWA 4OYPA 5IM0B 1KLMA 2DNRA 1X4FA 1ZM4A 3WIUA 2DVIA 2I9SA 2HBYB 2YKPA 2PC6A 5GMEA 2QE5A 3HHNB 1JLCB 2R42A 2W2NP 3TUZC 2XMVA 3H2VE 4LF7F 1HYSA 4FBTA 3QATA 2BQUA 2IRXA 1SJ4P 2DNMA 3NGRA 2CJYB 4F4KA 3PYGA 4OZ1A 2J0QD 2E5GA 3ZZ0A 4QWDA 4KYZA 3VALA 3ILIA 5HVHA 1T3NA 3NNHA 3AY0A 2VIHA 2DNZA 4Z2XA 3V4IB 4JBCA 4WXOA 2ZWPA 3UN2A 4DFPA 3I82A 1SIWB 1YRXA 2YQ0A 4UOGA 3NG8A 3SSQA 1SL2A 3MECB 5MAOA 3R2DJ 2G1DA 3ZZTA 4DXLA 3PX4A 3EE3A 3GONA 3IS9B 3KLHB 4DV2J 4JYAJ 4TQSA 2KT5A 3LH2S 1IBCB 3PJXA 4RZRA 1PILA 1R3NA 1N5YB 3HVTB 3IGVA 4HHHA 2DGWA 4C8OA 3B82A 1CQNA 4GKJF 2UXDF 3DU5A 5EUHA 2LMIA 4FPIA 4UZCA 1LV5A 2FD2A 1EKSA 2EFGA 3TAQA 5HP1B 2V5HG 1NKCA 3QIDA 4OYWA 2HQGA 3LP1B 1D8YA 1FERA 4ZA1A 5BXIA 5KFMA 2HS3A 1XMOF 2W2QP 1FFWB 1TUGB 4UUWA 4WBFA 3RG6A 2CPYA 2XS5A 4KBIA 1R27B 5ETPA 2B7BB 3FK4A 1TKZB 5ETQA 3GV8B 1NPKA 3AD8C 3CJKA 4J9OA 3W2VB 1S72S 2OHDA 5DDQC 3OVSA 4DR7F 3UD4P 3NOCA 3MMAA 1SUQB 4QR0A 4YMEA 2KG0A 1HR0J 3PV8A 1CC8A 4DR1J 1VQYA 1FTRA 3PXGa 2DR9A 2KVIA 3DCAA 1RWPB 7AT1B 2J8SA 1CJTA 4C97A 5IQ6A 1NBEB 4PAAA 1HQUB 2GHWA 3WX4A 4UQTA 2ZH6A 2HQCA 2CJAA 3W5YA 2JFKA 2V8GA 1U48A 5KFSA 1YX2A 2HPUA 2OELA 3H2LA 2ZJPQ 1MWYA 2XTJP 4G1IA 1UTAA 2BJ1A 4C11A 1K9MT 1DZ5A 1CQMA 1JKHA 1S7IA 5KFQA 1VJWA 4USIA 4ANCA 3CCMS 1IWGA 4Q8FA 2FIUA 4PXBA 2AZ3A 4U8VA 2B43A 1NEEA 1JNRB 2DXEA 2QT7A 3MOZA 4RL1A 4RPFA 3ZNUA 1VC5A 1VLYA 2N7YA 1X9MA 1RDRA 2MSTA 2JEIA 3OD2A 4X84A 3VWSA 4HACB 4DFJA 3R5GA 2VPYB 2AYGA 2QRRA 1T9WA 4U67Q 5DG9A 2VOOA 4OJHA 1ICEB 1AT1B 1DJ0A 4Y2AA 2N4CA 4BLGA 1Y11A 1U8SA 5JUMA 2VBZA 2Z8QA 1ZM3A 1T02A 3QGPA 1ULRA 2XEXA 5EWEA 1BY9A 4NZ7A 1RTIB 1OSCA 4LT6A 1D9AA 2DITA 3V4MA 5LOQA 4H54A 3MTKA 4TLQA 3GCWP 1I1GA 3MZIA 3TZZA 5HI7A 3MUTP 3T5KA 2MY7A 2ZNZA 3K7RA 4DV7J 3DI6B 3D4JA 3KLIB 3DGVA 5E7OB 2BE2B 4CH7A 4USTA 3JAMY 5B08A 4P71A 2FZKB 2UXCF 2RQKA 4YY3F 3KTQA 3GIIA 3PO4A 4PWWA 1FKPA 1X5TA 4BWMA 4MKYA 4QPTA 3GV5B 3LP2B 2BM1A 3KXDA 1RSCA 2W4DA 1L3VA 4URGA 3NGTA 1M5SA 4K4XA 2RVJA 4DV0F 3FEZA 2HHXA 1S1XA 3M8QA 2J9CA 4U9RA 2NXJA 4CLZA 3QZ7A 2R7RA 4ERDA 2PO4A 4BS2A 1ZS6A 2M52A 5FIIA 1V9OA 3RU0A 3HF5A 4RNHA 5RUBA 1FX4A 5DQGA 4LRDA 1APSA 3V5RA 2DPJA 3M6WA 1JLGA 1VK3A 3MM6B 4ZP6A 5KFKA 3HO1A 2G2ZA 4OYIA 1H2TZ 2HHPA 5A0YA 4KKOB 1TL7B 3OR1A 4YB7A 4OX9F 2V4RA 3NGKA 3RB6A 5KT2A 2V9WA 4B9NA 1H2VZ 4X4RA 1N34J 4CLKA 3IAM9 3HXMA 3MMBA 4ZPWR 3PR4A 4J9MA 4JI4F 1UFLA 1WDTA 2MDAA 4K5SA 2DNNA 4NLRA 4Y3CA 2E1CA 2WOMB 3UPFA 2HAIA 3TANA 3FFIB 4OL8A 4Y6IA 2CJXB 3KJFB 3IA0A 4DCPB 3IRWP 4JYAF 5CYJA 2HK2A 2V67A 5ETKA 2JVRA 2C2RA 1LWFB 4NYZA 3Q8QB 2RRNA 4PRFA 3ZZRA 4PYAA 1JLEA 2ZUAA 3EGNA 3M4XA 1SUQA 1WDDA 2L9DA 3CJRA 3W5XA 3AOAA 1RWXB 1U2RA 2MKIA 3US5A 2QL5B 3IGNA 4QU6A 1N32F 3U1NA 4EK2A 1RLCL 3BREA 2I5JB 3TOQA 4DPYA 3KMSA 1F2HA 4IO9Q 1NJWA 5KFVA 4JI8J 1UVNA 1TU0B 4Y28C 3OVAA 1Y00A 2ZWOA 3FUYA 4X4TA 2CPZA 3QWUA 3MI7X 4LSZB 1FTCA 2QLBB 4RW8A 3ZZOA 5D4OA 3G6VA 2Q43A 2BRKA 2A3JA 3WX8A 2XBPA 3PHTA 4NCAA 1U6ZA 3DLBA 2JHEA 2BZ2A 1JLFA 3GZ7A 3QT5A 3MFHA 2J9DE 1XIQA 3DFEA 3THVA 5KFIA 4WTOB 1Z4UA 3KOAA 1HKAA 2X1BA 1EQ0A 1HW9A 3DLEA 5C42A 1BC6A 1FJ7A 1RWWB 1FRJA 2VASA 4DL5A 1NU4A 3R6GB 3OV7A 1U7LA 1NSQA 2AJFE 2G2OA 1H6KX 4ZVEA 2RU3A 4NXNF 3MOJB 3DXSX 1M1HA 1AA1B 4K59A 2G9OA 1RHRB 3GV7B 1RU2A 3MCMA 4YY3J 5KG4A 1YJWS 2P6SA 4DOZA 3CMES 4XAKA 1YJTA 1QY7A 2D9OA 1RGVA 1WOPA 5DRKA 4CO3A 4DV0J 2AU0A 5A8RA 1SJQA 2CPEA 3RW7A 5SZTA 4J9LA 3SV3A 3MEKA 4QWEA 1UVKA 3TVKA 3AODA 3BN4A 5T7LA 5LJ3Y 3JTPA 4N5SA 2BV3A 2YKAA 3PO5A 1UVJA 5G4DA 4LF9J 4NEZA 1K1SA 2I6WA 4F3OA 4NXMF 3MFIA 1PIEA 2VPWB 4MKBA 3OVBA 2AWZA 2MGZA 1DARA 2N3OA 1CVJA 3KK2A 1NO8A 2A6OA 2HURA 2AZ1A 4O44B 3W60A 3DLHA 2KRBA 4TY8B 4ZVHA 4LF4J 1DTQA 4RWWA 4Q45A 4ECTA 4J9RA 3V6JA 2UP1A 1AUDA 2VG5B 4C0HA 2XO7A 1V3RA 2FJBB 4ES3A 3ILLA 4YP3A 3G71S 2RKIB 4I2PA 1EIYB 1RAEB 1WC5A 2BKNA 2FLOA 3EDRB 2KZMA 1E6YA 1EETA 2IFXA 5KG1A 4DUYF 1C0TB 4JI5F 3H0PA 2JEFA 2ZE2A 5HVGA 1N36J 4FF4A 8ATCB 3EXCX 2EG2A 2GW8A 4RUAA 3EX7B 5D3GB 2ZE2B 1N52B 3UW1A 4JI1F 2X3DA 1OIAA 3PM9A 5IOLA 3OLAA 3R7BB 4C8KA 4XDCA 1KSPA 4H4OB 4LFBF 3U1LA 5KFTA 4BC9A 2W4CA 2L9NA 2V2QA 3UD3P 2AYBA 4X4VA 2IC3A 1VRUA 3G2XA 1VC6A 1HNVB 2CG8A 2QFIA 3F0NA 4JOUA 2NREA 4QYZK 3EICA 3UNGC 4A8OA 1VOMA 5AJ3J 2KJWA 5F3TA 4CNYA 1Y10A 4BBYA 2C22A 5I42B 4WIQA 1HQEA 3ENAA 2MB0B 1Q4RA 3I0SB 2Y0SD 2DK2A 3OQ2A 1ZTTA 2NQPA 2P6TA 4ID8A 2DY9A 4X64F 1FFGB 4OI3A 1KR4A 3FMBA 4WPAA 1TAUA 1REGX 2YTCA 1WC0A 3K8WA 1S4EA 2KRRA 2M9KA 3IM8A 2CAJA 1RZMA 2YWHA 4RW9A 3K5MA 2CNKB 4E2FB 3AXMA 4DL4A 4DWIA 2Z2ZA 4YDDB 5EWGA 1LNQA 2PFDA 3H59A 1Y3JA 2VBYA 4KO0A 3ZO7A 2C1EB 1C0UB 2G0IA 2OP5A 3VGSA 4HT5A 2Q6BA 1NK7A 2R2RA 3MUMP 3R9LA 1KLNA 3OSNA 5J2MB 3W7BA 2JL9A 2BMBA 1AZSA 5L1IA 3DMJA 2KXFA 2KM8C 1VBZA 4QZVB 3HFVA 1XMQF 4AXJA 3T3FA 5J2QA 3W2WA 1NM2A 4UT4A 3KMQA 3D6TB 4C6AA 4FXVA 5C5JA 4GC6A 3QT6A 2CPFA 5IT0A 1YI2S 1REVB 3FQKA 1QAYA 5C24A 4I4BA 3UI3A 1EAYC 2VA2A 1QUVA 5D4NA 3X3UA 1GXUA 1W2IA 1WC4A 2LQ5A 1B3TA 4LF9F 4PXCA 4U96A 3FZ2A 1GH8A 4IOBA 2XULA 3PX0A 1ZA2B 1SIZA 1IN0A 4ZLNA 1WJ9A 3HSZA 2HHTA 3IG1A 1CJUA 5D0GA 3JSMB 3KYLA 1SL0A 1ZM2A 3PACA 3HHLB 2DR8A 3QO9A 4B3OB 4MK8A 2CDQA 3BGRB 1NPRA 4D3HA 4EU0A 1K8AT 3M8YA 1LWCB 2HGNA 2B9XA 1SC4B 3LQVA 1R8AA 1R0CB 2AEFA 1BXNA 1R6VA 1RQ0A 2GIRA 2NSBA 5F0UA 3ZFVA 3M6VA 1RYSA 2E5LJ 9RUBA 1FX2A 5T7LB 3DRYA 4NRTA 3WC0A 1N6QA 3Q2TC 1JXEA 1SV5A 1JMTA 2QSFA 1HBNA 3DOLB 2YH0A 3M7VA 3SXLA 2X3GA 2K3IA 1Y5NB 1VGYA 2E1PA 4UF4A 2CJ9A 3VVTA 2BE7D 2DEIA 2IPOB 3MM5A 1UVMA 3HK2A 1FRMA 1WEYA 2HLTA 3D6HB 3F44A 4HL9A 1HWLA 3MAAA 2JC1A 3M2VB 4DFKA 5IT9Y 2PE8A 1DQ8A 1H74A 1WF0A 4ZDNA 3VZIA 2MTLA 2RDDA 3PYFA 1S1VB 1UA0A 1X9WA 3MUVP 4WXWA 3JTNA 3VR1A 5GAGU 2WW4A 3MM7A 3GFHA 1GTEA 4S0MA 2KFZA 4O3QA 4U6PA 1FRIA 4AL5A 1NZAA 1ZETA 4USJC 2MHNA 4PUOB 2C28A 5J2PA 3RBDA 2DHAA 4KGXB 2ATCB 3U02A 1A7GE 4AXIA 1U47A 4J9NA 3HHKA 4MYTA 3I31A 2HFUA 3V6KA 4Y00A 4ES2A 4F3MA 3JQJA 4N41A 8AT1B 2W2PP 5F0WA 4OQJA 4B9SA 4IR1A 2QZ8A 3RRKA 3SEOA 4NLVA 5KFFA 2AGPA 1X5OA 4C11B 1N5TA 4ANEA 3DOMB 5BYSA 2KXNB 1KVIA 2W7AA 1S9EB 2QYGA 1JJCB 2V6AA 4WIIA 1M5PC 1IUJA 2GMHA 1RT5A 1YRTA 1VCTA 3JYTB 1YTYA 3CCLS 3NY0A 4LIWA 1EKRA 3B4DA 1M5OC 2R7XA 1RA6A 1VQNS 1X7VA 5KT4A 2WOMA 4HHUA 1XNQJ 3T9ZA 3KLEB 3OTOJ 4DUZJ 5CXTA 2NXEA 4A48A 4IOCQ 5DGBA 2IM3A 3MM5B 5ETTA 3MAQA 4J9SA 1X5SA 3PJWA 2W2MP 3M32B 2G0CA 2IDEA 2XQCA 4CLSA 3OHBA 4JV2A 3LO3A 4A47A 1LOUA 1HNWF 1IM4A 1F5AA 1FT8A 3CTRA 1S48A 2KYZA 1BQNA 2A2CA 4R8UA 1KQGB 2YNIA 4KV8B 4OZ5A 4M8LA 1UL3A 1NSAA 3SDEB 3MTJA 2EI5A 3SSRA 3GJTB 3RR8A 1PYSB 2Z30B 3M8QB 2C2KB 2QEXS 1S59A 1KDNA 2CA9A 2WVDA 3SIPB 3P3DA 2QX0A 4ZVQB 2R8KA 2CNNB 4EO8A 1NMEB 4JV1A 2CPJA 5ITHA 2VQEF 2YQ3A 2OPSB 2MJUA 2XWYA 4Y2MA 1FJEB 2VFUA 3SQOP 1CC7A 1O0PA 4FN5A 4WP9A 4YUDA 3V81B 5HN0A 1HBOA 2DGXA 4J90A 1IQZA 4WFYA 3KLHA 4F4WA 4DL7A 4ILRA 3PW4A 5F8GA 3D1QA 1F3FA 2FPHX 3Q8VA 4Q2MA 1TUWA 2DCUB 2ZD1B 2VZ9A 4L76A 5F8MA 2MQ8A 2W1BA 3TNVA 2DR5A 1XMBA 1RTZA 2HWTA 1H2UX 4K2XA 3R27A 5B0FA 2PMZD 3SQGB 3EJMA 3MR2A 1HBUA 4PQUA 5A8WA 3W3SA 3GIKA 3N6LA 1A6LA 2HNDB 1NZ8A 2CJQA 2H54B 1C1BB 2XNQA 1CJTB 5E3CA 1LXJA 5I3PA 2GX8A 5LSLA 3T5LA 2RUSA 3DLLQ 4G1QB 2WK4A 3EUNA 3OXLA 3HMJG 4DZDA 4DR4F 1OQ3A 3KK3A 3MPVA 3K57A 1IBMF 2EG1A 2YX4A 1WOOA 2UV8G 3Q22A 3OJSA 4KC5A 4M5KA 1RAOA 1GEHA 3W9HA 3J7YU 3OL6A 3W1YC 5HP1A 2U1AA 5DLFA 4EWTA 1KOOA 2BJDA 4H4KA 4C8MA 3DRRA 1RWKB 4NYOA 2EKNA 4DN0A 1T3OA 2E66A 2FGCA 2I8EA 2MKSA 2XZDB 5IWAJ 5AE1A 1UVLA 4YR3A 4ZJLA 2UUBF 4PXEA 2A18A 1TL7A 1WWHA 3M8ZA 1Y4ZB 3OR1B 3A12A 2QA1A 4M63A 3QWPA 1BWVA 5T41A 2HBZB 1GMVA 3QIPB 3PEHA 1TL3B 2CQPA 1YZ6A 5DQHA 2ABYA 1NHKL 3NAIA 2EKYA 4USMA 4PXDA 3PCOB 2EPIA 4USVA 3A8IA 4RBVA 5AT1B 4DQQA 1NJXA 1WG5A 4G6VB 1TQLA 4ZK7M 3MEGB 1VI7A 3K8VA 2HRYA 3LPYA 1JK9B 4DQRA 1RTJA 4PZVA 2XCAA 3WIVA 1LW2A 1TK0A 4AD6A 3LAKA 3M1VA 3TR5A 1DLOB 1MROB 2ASYA 3RTVA 2E5HA 1D8ZA 2OKQA 4NLYA 1S6QA 2BE9B 3KUEA 4ID5B 1GK8A 1RJJA 1MROA 1U2CA 1XNRJ 3NNCA 3DRPB 1WEXA 2JVOA 3FBBA 3NWRA 4AQYJ 4DV1F 5KTQA 3TVZA 2QTWA 4F0KA 1OQ6A 2J0XA 4ETXA 4Z7YA 1RT3A 4CYUB 3DOMA 1U1NA 4EZ9A 3HHLA 5DDOC 1QVGR 1P27B 2WB1D 4ICLA 5B0CA 3RBEA 3B6BA 3RB0A 1IBKF 2DHXA 3BS9A 3L9ZA 2C2ZB 4DQIA 4B3MF 2D41A 2OSRA 4CO4A 1U09A 1PYTA 1HL6A 2XI2A 2LFVA 5HROA 5K8PA 1U0SA 1VDHA 1VBXA 2HQ3A 1HW8A 2XC9A 4GMKA 1U1MA 4Q5VA 3NS7B 1HA1A 5ETRA 4TQRA 1LW0A 4K4SA 5K5MA 2F8MA 3LGHA 1EHWA 1K47A 4C3KA 3DRRB 1S97A 4PG8A 4Q44A 3DOKA 3IN5A 1VQMS 3CD7A 1HD0A 1TAQA 4I6YA 1LFPA 5LSOA 1BLUA 3CD5A 2R3VA 1J27A 2I38A 3PHEA 5KG7A 4JI0J 3NS5A 2F63A 4H4KC 4IDKA 5K8OA 5KFWA 4CQ1A 3OTOF 2ZH2A 4DUZF 2IM1A 1TKTA 3KLFA 3HVRA 2BANB 1MWQA 1HHQA 1YSJA 2B4PA 2EW9A 3CWJA 3JSBA 4GRSA 4IYQA 4KFBA 2JJ4D 4URQU 3VGVA 4FBUA 3QQCD 1HNWJ 3S8SA 4DR4J 1RBLA 1G6BA 3ADAC 3G96A 2XMTA 2KI2A 3MMCA 3N28A 4IOAQ 1REVA 2XO6A 1QTNB 2GC8A 2ZBQA 3M1VB 4WYLA 5HK4A 5L9XA 1JXLA 1QM9A 2XSFA 2YKNA 1RT6B 2B51A 3N01A 4NCGB 4ATNA 5IM0A 1N34F 4C8LA 1XK8A 1G1XA 1FKAF 4WCEQ 4X4OA 1VIOA 2UUBJ 2XSJB 2J7UA 1MU2B 2VG7A 1SVDA 4PWDB 1YBUA 2DO0A 2ZZMA 1ZAVA 3NRBA 2J9EA 3JSMA 1RADB 4B9UA 3TA2A 4O4GA 4KHPJ 1R31A 4OYZA 1BQMB 4DV6J 2PIIA 4DV5F 5FDLA 3M2UA 2WVCA 4DX6A 2H3EB 2B56A 6AT1B 3BQ0A 3CC4S 4IRDA 3R97A 1SJRA 2R4FA 4JI7F 1F3VA 1Z1ZA 2DNLA 3C16B 3AD9C 2E29A 2Z2YB 2J8AA 4HKQA 3H90A 2Z4PA 2LQ8A 2AF6A 2YPZA 2BEFA 3DYAB 2MSSA 3BGLA 2I1RA 2P8IA 1SJ1A 1NKBA 4WF9Q 1ZYQA 4M5IA 1B4SA 3T9NA 1FO1A 5KFZA 3T19A 1MN7A 1RAAB 2KB2A 4MKAA 4KB7A 3TAMB 3FVYA 1ZBTA 2CFXA 2N4DA 3D54A 4MJKA 4EUVA 3NMRA 5DZ6A 3UE2A 1WKLA 3M8SA 4RW7B 4LRFA 5E0OA 4NLXA 2ZOMA 2VJUA 3DU6A 2CUYA 3BSOA 2VG6A 4OV1A 2LU1A 5CYMA 1F9EB 4HDGA 4LF8F 4B9LA 1HMVB 2V2VA 3QJPA 3MEEB 1UMJA 2W25A 2YKQA 5HANA 1Q53A 1R6YA 2W9BB 2V4JA 2QMXA 4JI1J 1RLDA 2B4OA 1WD6A 4DSEA 1TFYA 4NA2A 1T94A 1IKVB 3CULA 4I67A 4W90B 3HCXA 3UNYA 3AQPA 5G0RA 2AJQA 4ED6A 4YS2A 2GS8A 1S6QB 5A2QY 2W9CB 2M88A 3ILJA 3R6LB 4OZ2A 2GQ2A 2PDAA 2YVSA 3LALA 3POTA 4CO0A 3A8JA 3GE9A 3OT9A 3C6UA 1OPIA 5CCLA 2ATLA 2BW7A 3R7SB 1FVSA 5AXNA 2NUUG 2FC9A 1C2PA 3L7OA 4HI1A 4ZOSA 3BQ2A 2OPPB 1LW0B 4RW6A 4AQYF 1KTVA 3D67A 4ZCLA 3PW7A 1WC3A 4PG7A 4CTAA 5L46A 4YQWA 3Q8SB 1TV6A 2CQGA 2OPRA 3TUIC 4QYRA 5HROB 1Q16B 4ZN3A 3VAGA 4CLUA 2BM0A 3VVUA 4DX8H 3M2VA 4WU2A 3L3CA 2YWWA 1YQHA 3ET6B 1OY8A 1TL1B 3WBZA 1IBKJ 4DL2A 2Y1IA 4EMDA 3RRGA 2ZH5A 4ECWA 2YBVA 2Z56B 4J9UE 4RUHA 4Y2IA 4ECUA 5KT3A 5KFYA 1GQEA 3HLUA 2E9RX 1RI7A 3QJLA 2LCWA 2F3JA 3IWLA 3CCRS 2GV1A 2YKOA 1DY3A 5M2UA 1D1UA 2ZZNA 4O44A 2JOQA 3ZTSA 1N6QB 1YJ9S 2IA6A 2VG6B 2ZJQQ 4V1Ak 2B5JB 3NBPA 3RAMA 2BQRA 2JX2A 4EFAC 4LF5J 2RQ4A 1WKJA 4C48A 3DDNA 4JV0A 3CCQS 1LWEB 1VRTB 3FSYA 5ETVA 1PBAA 3UFCX 1U0HB 5A8KB 1YDLA 3MR6A 3OHAA 3RB3A 2ZEJA 3D1OA 2VFVA 3MMCB 4F67A 3UCZP 1XMOJ 3PY8A 5BR8J 3PEJA 1GT8A 3NXZA 4DR5F 2YKNB 3BB5A 3EM1A 3H5SA 4NCGA 3AOBA 3IAS9 1JKHB 4DPTA 5IV4A 4A8WA 3ZZUA 5KFOA 4F2SA 2F9JA 3FSXA 1Q78A 1CBKA 5KOXA 1CSJA 2J6TA 5AXLA 1MG7A 3EZOA 3OFEA 1RCXB 2EFNA 3MM8B 4P7VA 5HQLA 3H40A 1M5VC 1B64A 3DXBA 2QLJB 5E3QA 4G65A 4ZS6A 5KOWA 3KUHA 3OUYA 4EBDA 1UKUA 2V8HA 5D4LA 4LQ3A 2IY5B 1KONA 1RU1A 3P5BP 2KTQA 2AJ0A 1RKJA 4KAIA 2X1FA 2CJBA 4ED0A 2DKOB 3CIMA 1R0BG 2L48A 5CYQB 3C15B 3E01A 4O0NA 1LWXA 1VLOA 1MNEA 3KK3B 1KHWA 3C16A 2PN6A 4CLFA 4LFAF 4WZQA 1C0UA 4KE5A 5D0EA 5I3QA 4EBCA 2B3TB 4WP3A 4CO2A 1FDDA 4FPRA 2A0FB 2KHCA 4HT7A 1CEZA 1FI4A 3UDLA 3W5ZA 1UEUA 2FJDB 2QSWA 1JQGA 4QU7A 2QL9B 1IM6A 1UEVA 3GFYA 3LOUA 4WJBA 2IVFB 3A1YG 5JXSA 4MYUA 3N5BA 2MZSA 2OLWA 3AHPA 1S1WA 4WE1B 3LP1A 2VD3A 4IFYA 1P8GA 3LUYA 1X4CA 1HWIA 2Y1JA 1XR6A 4CLLA 2DH9A 1VJQA 3PG9A 1HNXJ 3M05A 2CPDA 4B3TF 4WWSA 3Q24A 1VQOS 3CC2S 3CMAS 2ZKUA 2HHUA 3R5DA 1PSDA 2XZWA 4KO0B 2PSZA 4X66F 2H4YB 2MKHA 2VPXB 2H4WB 1QTMA 2JWNA 2AX0A 2LDIA 3O44A 1MMDA 3D0GE 3MDFA 1UPPA 3C19A 1CULB 2KU7A 3HHEA 3C6TB 1Q8BA 2DEJA 2FZGB 1MN9A 2Q1LA 4UOHA 1JLQB 1H7XA 2M70A 4YEAA 1T05B 4X65F 3MM7B 2CG4A 3TWZA 1VC0A 1AYEA 2SXLA 2FJWA 1RHQB 2LQBA 3EWGA 4LJMA 2HIQA 2RRBA 4CDIA 4WKYA 4PUOA 4UUXA 3DHWC 3ENVA 4BC7A 3PRDA 4DG1A 2ZVSA 3BJYA 1UVIA 4ED5A 3HSGA 3ZTRA 2XY7A 4DG1B 1OY9A 2K7JA 3KLEA 4JI8F 4DEZA 3HDSA 4USWA 3S6EA 1WI6A 5BR8F 1DQ9A 1SBRA 1Y3KA 3PFOA 2DTJA 1DTTA 1RISA 4JI2F 5MLCV 3J80U 2UUAJ 4CLTA 1XBWA 3AJ1A 4AYBD 1T05A 1KNZA 2F8HA 4KRWA 4P72A 1S6OA 1VK8A 3HHLC 1S9EA 2DXFA 3IR5B 1X0PA 4D3GA 3Q2SC 2BE2A 3U7JA 4AUKA 2BACA 5KFRA 4O3RA 1RHKB 4RW4B 2EVZA 1C1BA 2FJXA 1F2GA 4KT0C 4PPDA 2X7IA 5DETA 1KVKA 1S0VA 2NZ4A 2J5AA 3HFKA 1AW0A 2MKJA 2B4UA 2JLEA 2PMHA 2ZOGA 4K4UA 3O5TB 4O4RA 4HHJA 1FDNA 1WF1A 4A8QA 4ZVPB 1SH3A 3TA0A 2P2CB 4ZIWA 3SCKE 1FXLA 1GMUA 7FD1A 1B99A 3DDIA 4HH1A 1IWAA 1YVFA 1OYDA 4IFVA 1V3ZA 2UU9F 4UOFA 2KO1A 4IH7A 3LANA 2HIYA 2PA8D 1WEZA 2E7XA 1RT1B 3CGIA 4I7FA 5D0RA 4OYOA 5DM6Q 1TK5A 2DR7A 1VQKS 2W7OA 3A8KA 2HYIB 2Y9HA 2HW3A 1T9XA 1UJ4A 2HNZB 4MAKA 5EX0A 1KD1T 3G6ES 3OXFA 1IBLJ 1QD1A 1D9FA 2JZ5A 3I0RB 4LBIA 1N4LA 3QFHA 4QBUA 1Q5VA 3GJRB 3VQSA 3WQPA 3LF0A 4CO5A 1U6BA 3BZQA 1YRUA 2IRYA 2MZJA 3L7PA 2F1FA 4DBQA 2RB7A 3D1HA 3BKUA 1YJVA 4MFBA 3TJ8A 3TP2A 3PZPA 5H1SV 2D9PA 3MR7A 4IG3A 4MFBB 5E3RA 4X62J 4ZLPA 4B3TJ 4C0BA 1OWXA 2ROGA 3UVJA 5CZVA 5KFAA 1IBMJ 2ZDOA 2VDHA 3ZZYA 3MWBA 5JJBA 3C46A 5H9FK 2BW2A 3T5HA 3GFZA 3M6UA 2MQOA 3MXHP 3Q8YA 3LWMA 2XMJA 2E9TA 1JLEB 4I56A 1TL1A 5GMDA 2RNEA 1YKWA 4ITSA 4JI5J 3DNCA 1RT3B 4N47A 4RLEA 3CVKA 1U2FA 1VISA 4FNHA 1OO0B 2ZOFA 2HVIA 1F0XA 2K7KA 4LF2A 3KK1B 3FFIA 2L08A 2KHDA 1Z2ZA 1QLNA 1RTHA 1FVQA 3CDEA 4ZVSB 3CJ8A 3FBFA 2O3DA 5GADU 4LFCJ 1E6VA 3MEDB 2AV5A 1HFEL 2VKRA 5K14B 4ZJQA 3M9NB 3JQMA 1YG0A 4A8SA 2BOAA 3GYNA 1N33J 2XMMA 3X1LB 2ZHAA 3CCZA 1F9FA 3TEHB 2CPIA 2L9WA 4ZCMA 4KQZA 4OI2A 2RRAA 5FLXU 2PI4A 3D9BA 3MAHA 2VA3A 4G3IA 1NAQA 2UUAF 2ZH8A 2YWFA 2W7PA 1XNRF 2HHVA 4KGVB 3I96A 3DMJB 1YLXA 1CULA 3I4PA 2MLZA 2FGOA 3H7HB 3OR2B 2NYIA 1S79A 1PC4A 5D77A 4GVBB 2MKKA 2GAGC 4PG5A 4NZ0A 1U1QA 4MK9A 2Z58B 2VG5A 2BBEA 2VDIA 4K5RA 4XDDA 4DQSA 2JRSA 3ETMA 2QA2A 4OJGA 1UAWA 2DT9A 4ZVRB 1M5HA 1EP4B 2KT2A 1DFDA 4HH0A 4FZVA 2MZQA 2HFVA 4DV2F 3RBZA 2HLUA 2YWGA 4R25A 4WFZA 4J9QA 3W9IA 2V2KA 4OYAA 1K1QA 3W8PA 4O0IA 4O3PA 3GYXB 4DDFA 3BYPA 5DG7A 2UXDJ 2HBRB 2RDIA 1N5VA 1V5VA 1DHMA 4IRKA 3BQ1A 5LMUJ 1DTTB 1FD8A 3GFXA 1EQMA 2HFSA 3SV4A 2V94A 3F41A 4Y2KA 3HHDA 4CI0B 1F60B 3KK2B 3D2WA 4EZ6A 3D7SB 2LU2A 3Q0AA 2M3DA 3D66A 1UCNA 1JXVA 2MYFA 5J2NB 4F4AA 5KFCA 1FA0A 2GA7A 3M2RA 1ZOTA 2XGQA 4G1QA 5KFNA 3M2UB 3N9UC 3FC9A 2HZAA 3A3PB 3VZHA 3VAHA 1RTJB 4X64J 4FYYB 3ZZPA 3J80Y 3CD0A 1P6TA 4OX8A 2FJAB 3ZTOA 3KJVA 2UVUA 4LMZA 2BJ8A 2WBMA 4I7FB 3LWLA 4K4YA 2DGTA 2OAUA 1S9GB 4MT1A 1X8DA 3TW0A 3F73A 4DR1F 2Y1RI 4K50A 1NXIA 1SC3B 2AHOB 1L3TA 1HI1A 4USKA 3I9V9 1XJWB 3O3LA 1M1GA 1UZDA 2A6MA 1NNDA 1PCAA 3AOCA 2HAFA 2EBEA 2RUGA 2Z57B 3CIZA 1N5YA 2C3UA 5KFDA 1W2BR 1H72C 4NOHA 2L41A 5AE3A 4ED1A 5L8RC 3BPSP 4M95A 3GJQB 1SPBP 2YNFA 3IMQJ 1RACB 4NLPA 5C25B 1ZPWX 4LFCF 2R7UA 2VFRA 3RGIA 2DY1A 3GSIA 3MMAB 4IQMA 4IFVB 2MPUA 5BYRA 2WSCC 5C2GA 2XLIA 4GO7X 2HMIA 3RZAA 5DQIA 2DRBA 1SB6A 2GO9A 3CT9A 3FMWA 2DNKA 4DR2F 2JEGA 3Q23A 4NLGA 1RAJA 2NUHA 2LQJA 2LXUA 5KFUA 2IIHA 3T6BA 3UVJB 4C8NA 2EFOA 2CDRB 5B0EA 1HD1A 4QIWD 4YB1P 2ALZA 1SQGA 4OHWA 4RBUA 2MZ1A 2CNLB 1T11A 1TL5A 3NCPA 2GCFA 4OJ3A 3FEXB 2VICA 2C2OB 3IR6B 4FXWA 3ET6A 1YBTA 2NLWA 3FGVA 2WTFA 4FS1A 2ERRA 1TL4A 4GO5X 3PKYA 1N8RT 1NJIT 4Q43A 2HWHA 2QA4S 3G8SA 2H51B 5I4MA 3AXKA 1HR0F 3PKMA 1BMQB 1FKOA 4JP8A 5DDPC 7FDRA 2R7WA 3J7AN 2IDLA 2JDJA 1WC6A 2HZVA 2M8DB 3OTBA 1CJVB 1C1CA 3JB9k 4P2XA 3BO2A 4OX7A 4IO1A 3CCJS 1FE4A 4G1PA 2YNHB 4M5GA 3T1YJ 1ZZNA 3J7YI 4DPWA 2DISA 4EI2A 2ACYA 1VR6A 3GR1A 3NAHA 2UZAA 2DXDA 4WK1A 3D5MA 5DDRC 4YB6A 1S9GA 2LA6A 4P74A 4DL0C 1NDPA 1BQNB 1KBRA 5HMZA 2YNGA 4OHVA 1RWUA 2M8HA 3S01A 2GZOA 1SKSA 2F4VF 4F4ZA 1JLAA 2BXJA 1XNQF 2C42A 2H9ZA 3G8QA 1YIJS 1T9VA 3H98A 3BV8A 4OZ3A 4JI7J 2VODA 2NCKL 5K14A 1X4BA 2VOPA 4B3RJ 5J2MA 1XQIA 2E7VA 5IC6B 3KLVA 4OHYA 2E1AA 4B3SF 4ECXA 5D78A 5E2QA 2UUCF 1RWNB 1BUXA 4QW8A 3MEEA 1FFSB 2B0GA 3H5YA 1S6PA 3CJQA 2KT3A 1GMWA 4F36A 2LECA 2WHOA 4CTAB 5K20B 4N76A 3W65A 2FHMA 1EP4A 4KHMA 5LXYA 1SL1A 1J5OA 1PG5B 3H4DA 2FLLA 1K0TA 4ZPVR 1WACA 3EZ5A 4K4TA 1EX8A 5CAAA 4DSKA 2DD8S 3BEGB 3W9JA 4N8NA 3VHQA 3GIMA 1NK8A 2QMUB 3Q83A 4I6WA 4NX9A 2KKHA 2NXUA 2ZH7A 2F4FA 3AA9A 1YWXA 2W9CA 4ZMMA 1NSPA 1S99A 1I94F 2DPIA 4ELUA 1CJUB 4WKRA 5KG2A 2V34A 2Y1LB 4LR8A 5DJBA 4F4XA 4E98A 3JAMU 4K2JA 3MM6A 4PKDB 1OSDA 2RIJA 1ZTWA 4QIVA 1FWPA 2JLFA 3PRVA 4O23A 4OLPA 4XO0A 1WC1A 3MR3A 2R2SA 2WAQD 4DF8A 4XTTA 1YITS 1YJNS 2KFNA 2V4JB 3SCLE 4B08A 3GCXP 2PMWA 2YY3A 1KVJA 3TVYA 2BKOA 2CQ3A 1JJ4A 5CYMB 4CWBA 3D3BJ 4I69A 2XNRA 1JLFB 2JH3A 5IS2A 1Y9OA 1SH2A 3GILA 2P9GA 3TAMA 2ZBIA 4A8MP 1GNKA 1VMBA 4ECZA 1NK4A 1Q7LB 2YQ1A 1HNZJ 1WHWA 2HHHF 2J6UA 4RW8B 3N5FA 3NEKA 2VQFJ 3I56S 2XWXA 2C3PA 2RMLA 1X9SA 4F2RA 2HK3A 3DLGB 5A2QU 4ZJOA 2YX1A 1NDCA 4ZLLA 2CQ0A 5C24B 4IUFA 2MQMA 3P49B 2ROPA 1RWVB 1CJKB 5CYQA 2CYYA 2JEJA 5CHCB 1FJCA 1S7HA 3V6DA 1S6UA 2W9BA 1IKYB 3TAPA 5J1NA 1CJKA 1MMLA 2VBXA 3B78A 1KWMA 4FKYA 5JVHQ 4KJIA 4B02A 4K7QA 4TN2A 3TARA 4RO0A 2R2TA 2CQDA 2MY8A 1VQ7S 3HSDA 2B6AA 3K5PA 4NASA 2GIFA 2XMUA 2CQCA 3DOKB 1RABB 4P73A 3ITHB 4USUA 1AROP 2IA0A 2XYGB 4M5HA 3BN7A 1TTHB 4XPCA 4QW9A 2ZH3A 3PVXA 2AGOA 1S4FA 1XEZA 3ZXWA 4B3RF 2MLYA 3PYDA 5L38A 3H5UA 4I0WA 1VBKA 3QGHA 3HHLD 1KQSR 3MMBB 4OYBA 4IH5A 2O67A 4F02A 2XS2A 5J1EB 2K3KA 2CQ4A 3SI8A 4P6QA 1HPZB 2WCXA 3GB0A 2ZM6J 5L1JA 3T1HJ 4K4ZA 3E8OA 2R7VA 4V19J 3CDAA 1FD2A 1QE1A 2RD5C 4M5DB 1EETB 4LR9A 1F9HA 3ICLA 1T03B 1O8BA 1MMNA 2GFFA 1FHTA 4B3MJ 1P1TA 1TVRB 3DGPA 4ID5A 4U95A 5F9NA 2DHSA 2R8IA 2ZH9A 3DRPA 2CZ9A 3L4BC 1VBYA 1I94J 1YJ7A 1QAXA 4YDXA 3ILOA 2OEKA 3MF5A 4TVAB 3LP2A 4F4YA 4GKKF 2GHPA 4LFAJ 1GX6A 4OX6A 4CH1A 3E2EA 3DLGA 4J5OA 2G4BA 1TUVA 1E6YB 2N7CA 1S0MA 1O5JA 5GAEU 1JNZB 2HVEA 1QVFR 5HMWA 4JI0F 2FHKA 4J9PA 4YHHF 2OFHX 3BO3A 1TKXB 2C3OA 3JQKA 3AA8A 3M8PB 4C0OC 1Q1KA 1LEOA 1RT7B 3IBWA 4ER8A 1TKXA 4QIGA 2ADBA 4JV5F 5L1LA 4DF4A 4I64A 1UETA 1F5BA 3NGDA 2GAHC 4M1KA 2EEYA 3NOGA 3AQOA 1QSYA 1HNIB 2RE1A 2MHEA 1N88A 2IVMA 2IC3B 3DRSB 1RCOB 4L3KA 3E01B 4EO6A 3RRHA 4W4MA 1BQXA 1T9YA 4CLPA 4DV1J 3DRSA 1SKRA 2ZBRA 4LF4F 5B7WA 1P9YA 3OTDA 2OUGA 5LM7E 3C3LA 3ONQA 4LREA 3IS9A 4KKOA 4C9DA 1ZM9A 2X1AA 2IAJB 3CJ4A 2FHJA 4HACA 1S0NA 4QCLA 5IT9U 1FKOB 3HP6A 3KG0A 2QJ3A 5JVGQ 1CPZA 1H38A 1VHIA 3BR9A 4DU7A 5C2CA 3TZXA 1UPMB 3V4IA 1D3WA 3P8BB 1NJYA 4A8FA 4O3SA 2AYMA 3BDEA 4NZ6A 4EGLA 4LR7A 4DSIA 1S49A 3FCVA 2OO4A 4IFYB 4ZIVA 4X4UA 4M5DA 4IH6A 3M8RA 1I51B 1RKIA 2FQQB 2ZH4A 1HBMA 1S1UA 2XYHB 5LMNF 4DX5A 2LVWA 4DV6F 4LRAA 3QRRA 1X4AA 1M0SA 2DB1A 3WC2A 4OI1A 2H48B 4NA1A 3CW2C 3GIRA 2WRMA 3R3TA 4PYDA 4RW7A 4K0KF 1GTHA 3IR7B 5HO4A 1MLAA 1OS5A 4ILLA 4ZP9A 3KK1A 4F8RA 2NXNA 2QL7B 3QRQA 3DLJA 1NHUA 2RS2A 2CPHA 2BUNA 2DNOA 4ZCKA 4ANDA 1Q8KA 2XZTB 3CO9A 1HQ2A 1WHXA 3UDCA 3KNAA 2PFFB 5J2QB 3HPOA 3SYZA 4LBHA 2CQHA 3AB4B 1C4AA 3PDNA 2V63A 4YFUA 2HHHJ 2EC0A 1SH0A 2CADA 2F65A 3Q86A 2FUG9 5D6GA 3R5AA 1BD6A 1R0AA 4DU8A 3MCOA 3P6YC 3V6DB 5IT4A 5H9FJ 1UWAA 2VU5A 4PEOA 3AAWB 3GR0A 3T1AA 1KFSA 3TEGA 1VRQC 4C4WA 2FVCA 4DV7F 1NCLA 1G4CA 3KG1A 2V0NA 2B6AB 2PI5A 1YJUA 4DZ6A 6FDRA 2UXCJ 3L7UA 4ECQA 1IKXA 2G1HA 2IRUA 2OPPA 4N77A 4NLOA 4RW6B 4PABA 3W8GA 5H9EK 5HLFA 4DV3J 1S9FA 2ROEA 1WNEA 3RW6A 2VFTA 2RHSB 2HG4A 3S1TA 1HI0P 1N5SA 3M30A 4KGMA 3PJ9A 5E33A 1H0HB 3KJNB 5KT6A 1Q8IA 2ILYA 5KT7A 3DN9A 4YHHJ 2DBBA 2NXCA 3HZEA 3LP0B 1N33F 2OPQB 2B8QA 4KGZB 2ZC3A 3FRZA 2FTRA 4KH0B 2RU9A 4ZVFA 4JV5J 1AFIA 4PWUA 1CS4A 3BSAA 1GFWB 1IKVA 3QNWB 1KQKA 2UXBJ 2R8GA 1NH8A 3M9OB 4Q7AA 3OW2R 1XTZA 2VFSA 4KPCA 3D6FB 2KH9A 2ZM6F 3T1HF 4OI0A 1Q82T 3CDUA 4QR2A 3CCSS 5J2NA 2BANA 4C3LA 2WVFA 4QOTA 1R89A 1S1XB 4DPXA 4QIFA 2Y3YA 3BPDA 1FWKA 2YH1A 5EHHA 3N4WA 4FVCA 3FCWA 1LFWA 1MWZA 5J2PB 5GAGI 3G6XA 1YJRA 5HQMA 5K9FA 2AX1A 3LGNA 2M7SA 2FVQA 2OMOA 1X5PA 2GIQA 3LGMA 4HTIA 1UZHA 5ETOA 3TJ9A 5A6PA 5IC4B 1QAIA 2FZCB 2ZVIA 2HRTA 1RT7A 3KLIA 5A76A 1KN6A 2RSQA 3O6QA 2FJEB 1FRKA 4DI6A 3HKWA 1FKPB 3MPYA 2HFNA 3OL9A 3JTOA 1NLKL 4LF5F 3N6MA 1NK0A 1NK6A 4DPUA 1N32J 2PEBA 3FBCA 1AXQA 2D3ZA 4ICLB 2FYXA 2QV6A 3MMJA 3QFWA 1E6VB 2AJ1A 3MEDA 3OPKA 2GMJA 1IJEB 2FC8A 4RNNA 3EYZA 2VJVA 3LTOA 3H42A 4FF3A 3EMTA 4C7QA 1HHTP 3CCWA 2G2YA 2VONA 1H3DA 2FB0A 4X2BA 1RT5B 2GJ2A 4Y34A 1JJ2R 3RBXA 2OPQA 3R5CA 4CO1A 1TKDA 4M5JA 4Y2CA 4B9MA 1FK9B 1U49A 4OX9J 3QAUA 3K5OA 3VF0B 5A8KA 4WZMA 1FXDA 4I6AA 2ZNYA 4F3QA 1U1LA 4DL6A 2IMWP 3TUPA 2VHGA 3H25A 2O5DA 5KFPA 2GGPA 4WFNQ 1Q79A 1PJ7A 4OYMA 1ZA1B 4ZITA 2QA4G 3K59A 1LK7A 4N8OA 3QIPA 2BR0A 1AB8A 1JX4A 1QUPA 1M5KC 2H5JB 2LXFA 2RT3A 3SZ2A 3TX0A 1PO6A 1KC8T 2RH3A 1K0VA 4DV3F 2JFDA 1EJ7L 2BX6A 2ZUGA 4RUBA 5LJ5Y 2IMOA 4IR9A 5IQQA 5LMUF 2MXYA 3ZTPA 2ILZA 1R43A 4BWJA 4ECYA 1IR0A 1RAFB 1JLBA 1KHVA 2MKCA 3QZ8A 4DN9A 3C15A 4IQXA 1FRLA 3GLJA 2OPRB 2P5VA 5KG3A 2ZKTA 2XM3A 3OSPA 4N56A 1V6HA 2VBWA 4DR5J 2Z2MA 4URSA 2AJ2A 2DGVA 2P9CA 3OTCA 4B9VA 2K06A 4DPOA 2GJFA 2AIRB 1HNIA 3QO9B 1HARA 4B17A 2Q79A 4B3OA 3CJ5A 3IWXA 4OHZA 1YHQS 1U4BA 3SQGA 3IG1B 3CJTA 2HNDA 3TX8A 2J0WA 3IM9A 1PGZA 1PBUA 4JI6J 1OYEA 4QR1A 1GMWD 1RT4B 2Q3PA 3NWGA 4NRUA 5DG8A 3VAJA 1L3UA 1T9TA 4F7VA 2GVDB 4V19X 3THTA 4A8KA 3I5BA 2DR6A 4RW4A 4J37A 3FEYB 3GG1A 2BJEA 3JXOA 2GMLA 2EWHA 3UN5A 5K8MA 1N36F 2HKEA 4P2FA 3QT8A 3IC1A 1H73A 2HS0A 2ADCA 4LF6F 2HNYB 5CQGA 3PIOQ 3K0JA 4ELTA 1IKXB 2ZHOA 3HZGA 3KFWX 1I5OB 2BKPA 4Q8EA 1LW2B 4L72B 3GU0A 4TKTA 2MQLA 2QFJA 3K2YA 4ZHRA 4BDPA 4OMFG 2RQMA 3M2RB 1TKZA 5M2RA 4NLSA 5AJ3F 4B9TA 2M5YA 5B0DA 3BO4A 2RF2A 3P96A 3QJJA 2ZBCA 5A6WA 4USHA 4NXMJ 2I0XA 2UXBF 1ROFA 3HULA 2UUCJ 4OYXA 2E5JA 5KAKA 3KJVB 2IVYA 3J7A1 5GADI 3QGIA 3HSJA 2DRAA 3LPEA 4I2PB 4OHXA 3UWTA 1T8EA 3RB4A 2FHJD 1Q0NA 4HTJA 4DR3J 5GMKa 3DM2B 3AD7C 2FJVA 2Q66A 1RAIB 4KGKA 2EK6A 4TXSA 1HNVA 4WK3A 4P2MA 4BCAA 2OTLS 4RKUC 1QAJA 3Q8RB 3KDNA 1HWUA 2V69A 2XLKA 2QLXA 2LEBA 1J5EF 2RHQB 2RS8A 3A3NB 3I9ZA 2G13A 2YX7A 3CJ2A 4ZCIA 3UQSA 3FQLA 2HFOA 3SSSA 2OEJA 2QO3A 2AT1B 5HBMA 1Z2LA 3C14A 2R7SA 4E8UA 2UU9J 3D0IE 5F8IA 3SCJE 1S1TA 2GO8A 2LQ9A 4IKAA 3VGUA 4DCOB 3HT0A 1XMQJ 1Q5YA 3I0SA 3TUJC 2W24A 4H4MA 4NWBA 3AB2B 2D69A 2W8KA 1K73T 1SKWA 4EEYA 5EN1A 4RJVA 4FYDA 3LP0A 2KVQE 1VIXA 4P7TA 4AE5A 4RNFA 2OH2A 3L09A 2F5GA 1VRUB 2UUWA 2M2BA 1QJHA 3FNNA 1JLAB 4TNOA 1TVRA 3DGPB 3H4BA 2XY5A 4YR2A 2FLNA 4YOEA 4OIXA 2A10A 2AW0A 3KJQB 2HFZA 2MQNA 3K89A 2MGZB 2V4QA 1NK9A 1WF2A 1B70B 4Z7CA 1S1WB 2DIVA 4WE1A 4DQPA 1OJ4A 2Q6CA 4P75A 3Q8UA 3T41A 3HJVA 2XI3A 1DRZA 2E1MC 2DH8A 2R8HA 3KUGA 3TA1A 3NGSA 1UW4A 1MU2A 1NRKA 2QIFA 1FNOA 4OI6A 4TU7A 4KV8A 5DGAA 3EGZA 2W01A 1IQTA 5L1KA 3HM9A 4LRBA 2JLGA 1B7YB 3BBFA 3DLKA 4A46A 2XG8A 2OD4A 2QGFB 3BGOP 3BKTA 3PYEA 4NI2A 4CT8A 3DLKB 1TZ0A 3QGGA 5FDLB 2RQCA 1PJ6A 4HI2A 2HGLA 3HFZB 3OFHA 3CJKB 5AXKA 3LW5C 5F8HA 1EARA 1WORA 2B9EA 2HNZA 2AJ4A 2VPZB 4Q2LA 4CIOA 2FLPA 4KTQA 4W92B 3IXQA 5KFJA 4ZPAA 5C7PA 1Y7PA 3QSIA 3PTWA 2ASLA 1SQEA 1Y5LB 4XIUA 5IZHA 2DNPA 4DLGA 4PQUB 5DLGA 3MCNA 4ELVA 2HQFA 1D9DA 2CVIA 4CNZA 1GXLA 1F5CA 1ACMB 1I3OB 2LKZA 2MJNA 1HPZA 3B4MA 1QSLA 1HQUA 2QLWA 2GVDA 5ETMA 8RUCA 4DFMA 1FJGF 1L3SA 3HX9A 1HHSA 5I3UA 4ZPBA 3P45B 1JB0C 2O66A 2VQFF 3UCUP 4TLRA 2R7TA 2E5LF 3W61A 1VQ9S 3NP5A 3GMGA 1W7WA 3AFGA 1FNXH 2CWKA 2L3MA 3UD5A 4YR0A 4ZKAA 2WB4A 2XGPA 5IXUA 2DNHA 3DHXA 3GP9A 3P4UB 1LQ9A 1N0UA 1W25A 4FVMA 4IDKB 4LQ9A 5AE2A 1Q7YT 4XK8C 1RAHB 2VB6A 5B0BA 2POKA 3ETOA 2EXUA 1M1KT 2PGCA 2KJVA 2KM8B 3GIJA 3HT3A 1IR1A 1MW7A 2BA9A 1J2VA 2HHQA 1SC1B 4DJBA 1UFKA 4MKVA 2KYXA 1R0AB 4DL3A 2CWXA 3IFEA 4YB5A 2APOA 2HBQB 4WU3A 4DCJB 3ELHA 3VAIA 5D4PA 1RK8A 4OI4A 4KH1B 5U47A 3R8YA 2F9DA 1FRHA 1O51A 4O3OA 2QYCA 2F7VA 2C3YA 1IR2A 3DM2A 1JLGB 3KLGB 3ISNC 5D0HA 3VAKA 4PR6A 4DSFA 1T0TV 2EFPA 3G82B 1NK5A 5KFHA 1PAUB 1L3KA 1UJ5A 2C2MB 2DGUA 2OGUA 1VFJA 1ZPVA 4QQBA 3TZWA 1HBUB 4DR3F 2J6SA 3PW2A 4CYUA 3EVWA 4PG4A 3FCHA 1DBDA 2IJRA 2VV5A 5AXMA 5ETSA 1OY6A 2B4VA 1YBAA 1N5QA 1S5ZA 4I2QB 2HS4A 1QE1B 4OZLA 4PCQA 4C2MA 2COLA 3UR0A 3UO0A 3DRXA 3FDSA 1CJVA 3IWNC 3MURP 1T03A 3B54A 4U7UK 5KFBA 4Q0BB 1CS4B 1FWLA 2CQ2A 3MCSA 3QLHA 2DJWA 2PD1A 4Q0BA 3DI6A 2D74B 3M9MB 4NPOA 2IBOA 3PNIA 3CJSA 4CT9A 2OSQA 1PAEX 2YNGB 4GC7A 4MIAA 1X4DA 5FJ4A 3G8TA 1HWKA 4YN3B 3WZ0A 3IP0A 2A2DA 2ZH1A 1D0EA 3BYRA 1IJFB 1TL3A 4KHRA 3H2UB 2RKIA 3GYGA 3I4HX 1XR5A 3TZYA 3KHGA 3QMQA 3FBEA 3UN3A 1TR0A 1ZZFA 3I32A 4TYBA 2J76E 2EFVA 3NNAA 3RYLA 1RTHB 1LWEA 1VRTA 2V68A 3CNQP 4FYVB 4OV6A 5ETLA 1Y5IB 1IKWA 2QG9B 2YWKA 3M8PA 3G4SS 4ZVOB 3NLCA 4DUTA 2HMIB 1UP1A 3FSIA 1Q86T 3NCRA 2DGQA 1FJGJ 1WKKA 4LIRA 1S76D 2GQCA 2KN4A 3ISND 1YZ7A 4WYWA 2JSXA 2C2EA 2QMWA 2QC3A 3HJFA 4FXDA 2XB2D 2LA4A 1O6XA 3CPWR 3E51A 4QIEA 4NMLA 5A8WB 4NLTA 5HJYA 3T1YF 1UJ6A 1RWMB 2J7WA 1KFDA 2BABA 1TELA 4F04B 1WI8A 3G9CA 2FY1A 1LXNA 2WZ1A 3EVMA 1ITPA 1B0PA 2KXHA 2NYHA 2VQEJ 1S0OA 1BQMA 3MD3A 4CP5A 5DO2A 3TI0A 3EGWB 1G3OA 5KG5A 5LMNJ 5KG6A 3A8EA 4KR0B 5C25A 5HBMB 2D1CA 1RYRA 1RHJB 2DGOA 2HVHA 3JSYA 1URNA 2MQPA 2RJZA 4LSLA 3V81A 2DO4A 2DYAA 3C66A 2EFQA 3CCES 3Q89A 4ZVUB 4DR2J 3OBIA 2G0JA
chains in the Genus database with same CATH topology
1WHVA 5EX3A 5F41A 3DYAA 2DNGA 3KG4A 3G86A 5E41A 4TU9A 3RAXA 2VL1A 4QWAA 2ASJA 1U6FA 4ZP8A 3MHYA 4IG0A 3B8HA 4NA3A 1PC5A 5E3AA 2E1RA 1FE0A 3SMZA 2XLJA 4FS2A 1SC6A 3W2VA 2WW8A 5LT5A 1KQFB 4Z37A 1R8PA 1TKTB 1C4CA 2XHWA 2OD6A 3MD1A 5HQ8A 1VQSA 3K5LA 4EYHB 2O1PA 1S10A 4ED7A 4AFFA 2R2UA 2UVWA 5IWAF 1I6JA 2YKMA 3BF4A 1T7PA 1WTFA 1RT2A 1FK9A 2OJ3A 1V3SA 1J5OB 2KDOA 2FVSA 3TO8A 4A4JA 2ZC4A 5EGYA 2X1GA 1U45A 4JI3F 1XN9A 4ETZA 1A9NB 1URRA 5L39A 1WHYA 2WONA 3L95X 3S7RA 1BWEA 5FD1A 3KLGA 2W9AA 5E3PA 1WELA 5A8RB 1FDBA 1ZAXA 3HKZD 3V6HA 4TU8A 4EYIB 1G7CB 3PW0A 2NPFA 4DQIA 3IWNC 2JC0A 3N0VA 2AGQA 3K58A 2OMLA 4M94A 5CA5A 1WG4A 3UCGA 1JJHA 4ZPDA 1U1PA 1C0TA 2PA3A 4ZPCA 1BGXT 4RU9A 3OJUA 4NYPA 3TQ1A 4R5PA 2YNHA 2ASDA 4FP9A 2K1RA 5IFMA 1KEKA 2J7KA 5I3UB 5KFXA 4RNNA 1HBNB 3DOLA 3QPIA 4H4OA 2CZ4A 3MR5A 3VTIA 2BOPA 3EXYA 1HI8A 4L3NA 2HZCA 1LKZA 2BVZA 3O1LA 2UV8A 2FVRA 1LWCA 4NLUA 4O4GB 3FRYA 2CQ1A 3BGFA 3M30B 2UVVA 3THPA 4J9KA 3G6YA 3MPWA 1FESA 1P1LA 2NR0A 2EBGA 4JUZA 1FRXA 1XWLA 2A1BA 3CEDA 3EZUA 2W8LA 3NMAA 4QWBA 5L9NA 4ED3A 4RW9B 4ILMA 4DMZA 1P9QC 2BDPA 4IG3B 3C2PA 1WG1A 2UUTA 5F8LA 3IRXA 3OLBA 3R1LA 1WTBA 3CMES 1DLOA 4ECSA 2KZZA 4AL7A 3IO1A 1RA7A 2ZFHA 3OR2A 4OFZA 4RWXA 4ZVGA 1X0FA 4LVOP 2XSJA 3EPGA 4X4NA 3KHLA 4RNOA 5I42A 1RT1A 3KHHA 3BDPA 3F56A 1IKWB 5SUHA 4K4VA 4FF2A 3R5BA 3CDWA 2VG7B 1S77D 3MM8A 3PFEA 5F8JA 1X4GA 4DSJA 1HWJA 2CKWA 5ADZA 2XS7A 5J1EA 4ZPTR 5FLXY 1RT6A 4NLQA 4HLBA 3TYTA 3CJ3A 3GQCA 2MZTA 2HHWA 1U26A 3P5TL 3NL0A 5GAEI 2O01C 4NLDA 5EWFA 3CXCR 2D3UA 3PR5B 2GGPB 2IJFA 4UQGA 3ULHA 1FXRA 2AQ4A 3HVTA 3CCUS 4ECVA 2K8GA 4K4WA 2V9KA 5T14A 2IM2A 2B9WA 3U1MA 4ED2A 1R7IA 3NKYA 3SDEA 2BRLA 5HMYA 3VAMA 1LK5A 2ZHBA 1GX5A 2B7CB 4R8UB 2CVEA 4WFXA 4X62F 2XMKA 3MM9A 2WSEC 5GAHI 2DGSA 4R0EA 1RT2B 4OZNA 4ES1A 2YKMB 4MK7A 1R8HA 2GJIA 1DURA 4TYAA 3M32A 5J1PA 1VQ4S 1HBOB 2IJNA 4ZP7A 1RTDB 2CPXA 3QAEA 4HVZA 1UWBB 1ELOA 2PT0A 4DR6F 3NS6A 1JLBB 2OPSA 2LDYA 2HQIA 4X4QA 1NB7A 2R9LA 1N54B 1VQ6S 2HGMA 3T6JA 2WONB 3R1HA 3H8YA 1DAXA 2X51A 1JLQA 5BJRA 3ITHA 3QYYA 3C6UB 3ZC4A 3OL8A 2IBKA 3POTB 4R5PB 1S6PB 3FJ2A 1Q8LA 3OXGA 2K1RB 5GVQA 3CB4A 3I55S 1U1OA 4CCHA 1N0VC 2HWIA 5G0RB 4RUCA 1FCAA 1AFJA 4UW2A 4X4SA 5F8NA 3LAMA 2WSFC 3O8WA 3CF5Q 2NSCA 1XR7A 1YGYA 4EBEA 4QYZJ 4ZHRB 1H98A 1B0TA 3U27A 3H20A 2CQIA 2M0GB 5KT5A 4UY85 3PRBA 1NH7A 4MH8A 4IG0B 5B09A 4ECRA 1FEHA 3KHRA 4U7CA 1FF2A 4A8XA 2DNQA 4TY8A 2V8DA 3TRGA 3MGJA 3JYTA 1S1VA 4WTYA 5HLFB 1C1CB 4TY9A 5CD4H 3KLFB 3AH6A 3MEGA 5KG0A 3RAQA 4FF1A 2MZRA 2OIHA 4P2SA 2GHVC 1UFWA 2VC0A 4NL5A 4F25A 4CH0S 2IM0A 1LWFA 1G2EA 4LSNA 2GQQA 2R7QA 1MSWD 2RILA 1RTIA 1VQ8S 3D28A 5EDWA 3OUYB 1VQLS 2CIMA 1OPZA 2ZD1A 3I0RA 3IRXB 2RF2B 2FDNA 2F8EX 4OHZA 3BGUA 2AP6A 2CRLA 3CCTA 4OLOA 3EPIA 2YNFB 2VC1A 1VQPS 3JSRA 1JWWA 2XCPA 2U2FA 5D8HB 3PW5A 3OFGA 3N79A 1IKYA 1VQ5S 3NCQA 4LSLB 1B7FA 3V2UC 4OZJA 5HMXA 2PEHA 4NCBA 2XMWA 2IHR1 5LSRA 5CH7B 1SI9A 1U1KA 2K2PA 4DLEA 3SFUA 1XC9A 4A8YA 3Q8PB 2DIUA 3GWCA 3QLHB 1GXTA 1U25A 2B9YA 5GAHU 2YNIB 2LYVA 2ZJRQ 1QSSA 2W4PA 5BYQA 1RP5A 5A0YB 2I5JA 5LXRA 3UR3C 1U24A 4QWCA 3BR8A 1NJZA 2AD9A 3GG0A 2IAJA 3KKFA 2B5JA 1KLMB 2LEAA 3BM7A 3NBPB 1M90T 2E5IA 6FD1A 3CUNA 3SCIE 5CZXA 2J9DA 1Q81T 3KWMA 2C3MA 4CZCA 1TK8A 1ZH5A 2CQBA 4LUBA 4C3MA 4E0DA 1NKEA 4OZ0A 1HBMB 1S1UB 3CJ0A 1Y0HA 3FZBA 3J7Z5 3ZZZA 4DHVA 3E3XA 3ISZA 1KTQA 2ZDPA 1HNXF 3J7ZT 2RDJA 5DM7Q 3CDBA 4OJ1A 3SFGA 1B0VA 4BHQA 3CD6S 3C6TA 2P9EA 4C8YA 2Z2LA 2E7WA 5F3ZA 2HRUA 1H7WA 1HQEB 4HDHA 2FHOB 3HVWA 2D3OR 2CZVC 2IYGA 4I2QA 4Y65A 4I68A 1FEEA 4MMOA 2CJKA 4HEA9 2LXIA 4FNIA 1X4EA 2LLZA 1JLCA 5KFLA 1HYSB 3C8YA 4LVNP 2FVPA 5KFEA 4HYKA 5D3GA 3MECA 4KPYA 3CSKA 5K8NA 4X4PA 2J0SD 1U1RA 4RU2A 1NHVA 2Z0GA 2HNYA 2ZITA 5THWA 3VQTA 5KFGA 3ENWA 2DHGA 2VH7A 1IBLF 1R8CA 2D7SA 2LEPA 3J81Y 2NS1B 1T95A 2F40A 4WFAQ 1DTQB 1TP7A 1N48A 1R8BA 2DH7A 4PPZA 1VS3A 2DCLA 2YWEA 1HMVA 4KIAA 1RT4A 4AL6A 1FDAA 4KFBB 1JIHA 3O2IA 2N82B 2N3LA 4KSEB 1KRPA 3MM9B 1SV5B 4QJVA 1CG2A 4ED8A 1ZAWA 4WFBQ 4L6V3 3HI9A 5LL6d 1N56A 4LSNB 2DNYA 4C8ZA 2R8JA 2VUGA 5E5NA 1UWBA 4DS4A 1UA1A 2C2DA 2AYEA 4XPEA 2UVRA 5B0AA 4DV4F 2M4MA 3BGRA 3VCDA 3M6XA 4KHPF 1KS2A 2H5EA 1SXLA 3T5JA 5H9EJ 4MTPA 1SJ3P 2MMYA 3CE8A 3OTEA 4UOCA 3K5NA 4MIWA 4RNMA 1IXKA 2V8VA 1CLFA 4O3NA 2BYCA 3DLEB 5C42B 2KFYA 3PX6A 1L5UA 3N6NA 3AJ2A 1KOHA 5HL7Q 2R7OA 3CC7S 3WDOA 4ALZA 3RR7A 4RBTA 4PG6A 2EK1A 1SJFA 4IRCA 1FNMA 4MIBA 4QPXA 1GAOA 3VAFA 4UY8T 3I87A 4DSLA 2VKZG 1HNZF 3I5AA 5CCMA 2NPIA 2E44A 3DC2A 4C98A 4JI6F 1DQAA 2KG1A 3ENQA 3I6PA 5B0GA 3H5XA 3BSCA 4Y0FA 3BSNA 4I1TA 4DS5A 1S1TB 1XERA 4RX6A 3D0HE 2XY6A 3OFFA 1TV6B 3W2WB 3GSDA 3HVAA 3PIPQ 4F26A 4NLWA 4H4MB 3KNGA 2IYIA 3OL7A 5F9LA 4F50A 2HVZA 2GNKA 5M2PA 4PQAA 5DS7A 3DDKA 1VHFA 2HHSA 4R0JA 3I5CA 4PWDA 2MQQA 2WBRA 2OFGX 1X4HA