3EGZA

Crystal structure of an in vitro evolved tetracycline aptamer and artificial riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural basis for specific, high-affinity tetracycline binding by an in vitro evolved aptamer and artificial riboswitch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna
total genus 19
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3egzA00
1WEZA 2HYIB 2NLWA 2J8AA 1Q82T 2HZCA 1ZH5A 2J76E 2MSTA 2YKAA 3MD1A 4C7QA 1VQ7S 3FEXB 2CQIA 2F9DA 5DDPC 2U1AA 4FXWA 5BJRA 2OSRA 2RQ4A 2AYGA 3NS6A 2QFJA 3VAGA 3G71S 1VQ6S 2KT5A 2AD9A 3THPA 2JVOA 3CC7S 2MKCA 1VQ5S 3CCJS 1WI8A 2B0GA 3CCES 4TU9A 3CCUS 2D9OA 4CIOA 2KXHA 2QEXS 2CPXA 1X4EA 2M52A 3CCQS 3UCUP 5GAEU 1H2UX 4Y0FA 5EN1A 5ITHA 2CQPA 5DETA 1DBDA 1SJQA 1VQNS 2MKIA 2DK2A 5LXYA 2BZ2A 2FY1A 1WWHA 1VQOS 1DRZA 3S01A 1YWXA 3S7RA 5HO4A 1QM9A 2K3KA 3CC2S 3U1LA 2QA4S 2I38A 2XNQA 4WFBQ 1U1QA 2DNMA 3JB9k 1A9NB 4QU7A 4ZKAA 2MKJA 2SXLA 1X4GA 2V94A 5IM0A 2MJNA 2DGUA 1KD1T 4QPTA 2DIVA 3MUMP 2MJUA 5CYJA 4C0OC 2FC8A 2N3LA 5LSLA 2XB2D 1FJCA 5LJ3Y 1WTBA 2CPYA 3CD6S 5FJ4A 4W90B 4WFAQ 3G8TA 3CMAS 5D77A 2CPEA 2CPDA 1H6KX 3TP2A 2LEBA 2MQMA 2KRRA 2ADCA 2CPHA 2MZQA 2Q79A 2XS5A 1O0PA 2GHPA 3B4DA 1AUDA 1IQTA 1OPIA 1UAWA 4IO9Q 2CQBA 2YH1A 3MDFA 1KOOA 3THTA 3I55S 5JVHQ 1WEYA 3B4MA 1N88A 2CQ0A 2M88A 1X5TA 4CH0S 3MUVP 4WKRA 1VQLS 2DNPA 1S79A 2LA4A 1FNXH 4PR6A 2ZJRQ 1VQMS 1X5PA 1U1KA 2YTCA 2HGLA 3R1LA 1M5PC 5DM6Q 1PO6A 2DNRA 3NNAA 4OZ1A 1FT8A 3R27A 1UFWA 3UE2A 2CPIA 1YJNS 1VC5A 4WFNQ 2MGZA 2UP1A 4P6QA 2DGOA 1U1LA 1H2TZ 2CQ4A 2RS8A 2OIHA 3NNHA 1K9MT 1URNA 1SJ4P 4ERDA 2U2FA 5DDOC 1L3KA 2D3OR 2K8GA 3CCRS 5IM0B 1XN9A 4C4WA 2ERRA 1JJHA 2KG1A 2AYMA 3H2UB 3CCLS 1YJWS 4RU2A 5CXTA 3IWNC 1N52B 3CTRA 3MUTP 4PRFA 4FXVA 2D9PA 2LQ5A 3CPWR 3NNCA 1WG5A 3BS9A 2MZRA 2MKHA 1VQ9S 2MQPA 2JRSA 3UWTA 1M1KT 1ZZNA 2A3JA 2DGWA 5LJ5Y 2LCWA 3VF0B 2KYXA 3U1MA 2JWNA 1VQKS 3NS5A 2MYFA 2L08A 2I2YA 3G4SS 5HL7Q 2RU3A 4IOCQ 4PKDB 1FHTA 3J7ZT 1VQ4S 1X4AA 1W2BR 2MQOA 2KI2A 1VBXA 4QQBA 2M7SA 2OSQA 2X1FA 1BY9A 5DDQC 1M5KC 2RS2A 2WBRA 1CVJA 1OWXA 2MKSA 2N82B 3VAJA 2KN4A 2CPFA 2DNOA 1UW4A 2NZ4A 2J0SD 3D2WA 3RW6A 2KM8C 1X4BA 3MURP 1X4CA 1NO8A 2DHXA 1K8AT 1YTYA 3EGZA 2MGZB 3CCVS 2GO9A 3MD3A 2OTLS 1FJ7A 5LSOA 3S8SA 3PIPQ 2LEAA 5MLCV 3MXHP 1VQPS 3FEYB 2CJKA 2MQNA 3G8SA 2M8DB 2RQCA 4LMZA 4TU7A 1Q7YT 1VC0A 2M70A 3G9CA 2PE8A 1WHXA 3ZZYA 1YI2S 1U1NA 2JVRA 2CQ3A 1KOHA 3P5TL 2DH7A 4LJMA 2EVZA 3L3CA 1R8PA 2VOOA 1HD1A 1FO1A 2CPZA 1HA1A 4IUFA 2N3OA 2CPJA 2DNYA 1K73T 2MSSA 3MI7X 3LQVA 2RT3A 2MY7A 2MZJA 2DISA 3US5A 1VC6A 1D9AA 2HGMA 3SXLA 3OW2R 4U67Q 4YB1P 2M2BA 1A7GE 2AYEA 2RUGA 1H2VZ 1HD0A 2DNLA 2M4MA 2AYBA 1DHMA 1U1RA 1U1PA 2KG0A 5JVGQ 1RK8A 2MMYA 3SMZA 2BOPA 1WHVA 4WCEQ 3G6ES 1JJ4A 2DNGA 2PEHA 2L41A 3I56S 3BO3A 4BS2A 1UP1A 4Y00A 2M8HA 2VODA 2ADBA 2LA6A 1WEXA 1SJRA 2XS7A 5GAGU 1WHWA 2YH0A 2RNEA 1WG4A 3VAIA 2MZSA 2KXFA 1X4FA 1PGZA 1YITS 1WI6A 2F3JA 3EX7B 2MPUA 4IOAQ 2M0GB 4J5OA 3HHNB 3EGNA 1WF2A 2KHCA 1SJFA 2DNZA 2DH8A 2DHAA 1YJ9S 3P6YC 5IFMA 2VOPA 3CC4S 3V4MA 4CQ1A 2CQGA 1Q86T 5LXRA 1RKJA 3CMES 3VALA 4EGLA 1D8ZA 2DGVA 3HI9A 2RRAA 2XSFA 3ULHA 1KC8T 2DB1A 1U1OA 2DGXA 3BEGB 2DNKA 1OIAA 2MXYA 2KH9A 5DDRC 2VONA 1N54B 1U6BA 1U1MA 4QU6A 3VAFA 4WIIA 3Q2SC 2CQCA 1NU4A 2DGSA 2DNQA 2N7CA 3DLLQ 1U2FA 2LMIA 1FXLA 2O3DA 1YIJS 2CQHA 2MKKA 5D78A 2ZJPQ 2E5GA 2LXIA 1SXLA 2J0QD 2KM8B 2YWKA 2CQ2A 2FHOB 2OTJS 2KXNB 2G1DA 1M5VC 2RRBA 1M90T 1WHYA 2F9JA 3K0JA 1X5SA 2CQDA 3CXCR 4YUDA 5GAHU 2MQLA 4UY8T 3H2VE 1WELA 4TLQA 3P49B 3BO4A 2X1GA 1M5OC 1N8RT 3BO2A 3S6EA 2OJ3A 1KQSR 2E5IA 2G0CA 3MOJB 2HVZA 3IRWP 1WG1A 1P1TA 2DIUA 3N9UC 1VQ8S 3CULA 5GMKa 3P3DA 4YOEA 5GVQA 5IQQA 1U6FA 4UQTA 3UD4P 2DITA 5CA5A 3CF5Q 1WF0A 4CH1A 2RVJA 4A8XA 3J7YU 2LECA 2DHGA 3SDEA 5GADU 1WF1A 5H1SV 1DZ5A 3PIOQ 2DNNA 2JX2A 3VAHA 1X0FA 4F02A 3NMRA 1HL6A 2DH9A 2E5JA 3DXBA 1JMTA 2ZJQQ 1NJIT 2G4BA 2E5HA 2E44A 3G96A 2MQQA 4M5DB 2DO0A 3VAKA 3TYTA 4V19X 4WF9Q 2KFYA 5DM7Q 3Q2TC 2DO4A 1VBZA 2MB0B 4F25A 3UCZP 2LXUA 3CUNA 4TU8A 2MHNA 4OZ0A 2KU7A 1ZZFA 1X4HA 2DGTA 1S72S 2L9WA 1QVFR 1OO0B 2XS2A 2EK6A 2FC9A 2EK1A 4Z2XA 2XNRA 1R8HA 3CCSS 2KVIA 1X5OA 1B7FA 2X1AA 4LIRA 2DHSA 2DNHA 3UD3P 3CCMS 2MY8A 2CQ1A 4F26A 2X1BA 1F9FA 4ED5A 3UCGA 2HGNA 3TO8A 1X4DA 1QVGR 2MZ1A 3ZZZA 1YHQS 2LYVA 3LPYA 2LKZA 3R1HA 1P27B 2M9KA 2MZTA 1SJ3P 2FPHX 3VAMA 3SDEB 4W92B 1VBYA 3RW7A 1G2EA 2KRBA 1JJ2R 1Q81T 1FJEB 2DGQA
chains in the Genus database with same CATH superfamily
2HYIB 1VLOA 4NE9C 2R7TA 2MLYA 3QT8A 4C7QA 1VQ7S 1I5OB 2XI3A 1KQKA 1U24A 3SV3A 1Y3JA 2DCLA 2U1AA 4DR3F 1RTIB 2IMOA 1YRUA 2V8VA 3NS6A 3TVZA 2I6WA 5ETLA 1X8DA 4LBPA 5EX0A 3CCUS 3GIIA 5CZVA 2EG1A 7FD1A 4JOUA 4Y0FA 4C2MA 5HN0A 4WP9A 4AQYJ 3AY0A 5HVGA 4IG0B 4JV5J 2ZEJA 4JI4J 3CC2S 2I38A 1LWFA 1Y4ZB 3BZQA 4K4VA 4IFVA 3KHLA 2ZH4A 2R7VA 1GMUA 4LR8A 2J7UA 1H3DA 4WFAQ 2AEMA 1UCNA 5DJBA 3MHYA 8ATCB 4K4TA 2YPZA 3MM8B 4DV5J 3HP6A 1YG0A 3X1LB 2FJEB 1YRTA 4LBHA 4IO9Q 2AT1B 3KJNB 2QMXA 2M88A 3FZBA 2DNPA 1HBOB 1HYSA 3HSGA 3J81j 2X3DA 2OGUA 4HHHA 2DNRA 1QTMA 4IKAA 1U0SA 5B0CA 3GG0A 1VC5A 4M5MA 3V5RA 5KFTA 1XMBA 4WWSA 4Q0BB 2JNJA 2UUAF 5D4NA 4U9RA 2F5GA 2BJ8A 5SZTA 2YXLA 2VG7A 1UA1A 2QGFB 2GQQA 3NNCA 4DV4F 4LR7A 4MK9A 1VQKS 5KG3A 4UW2A 3NLCA 5FIIA 5B7WA 3CCZA 2C2ZB 2EI5A 2AW0A 2QC3A 1LWCB 2B6AA 4QW8A 1YTYA 2MGZB 3M6VA 3MD3A 3PIPQ 1TAUA 3RAXA 2M70A 4FPIA 2F65A 3SCKE 1YI2S 2GS8A 5JJBA 1F1BB 1ZPVA 3GFXA 2KZMA 1GXLA 2RHSB 5HK4A 1MROB 3NWRA 3KLGB 4DS5A 2NQPA 3QIPB 4B3RF 2MZJA 2RUGA 3K5PA 4JI5J 3TR5A 2YNIA 3K2YA 5KFWA 2HG4A 3V6DA 1UJ5A 2MMYA 2ZNYA 2CWKA 2NYIA 1AZSA 2XS7A 1H7XA 4RKUC 3HHLB 3JTNA 1JLQA 2BKOA 2BV3A 2IAJA 2XCPA 1EKSA 4X4PA 5ETTA 3NBPB 5BYRA 2M0GB 2W9BB 2QG9B 4MKYA 2XMMA 3D68A 5MAOA 4QPXA 2WVBA 1HQ2A 1ZBTA 2HHWA 5A8KB 4OL8A 2B7BB 3QAEA 3QJPA 2ZBQA 4LVNP 3VV2B 1JX4A 5KFDA 4ITSA 4CLSA 1G6BA 2JL9A 2UXBF 3M6UA 1RUSA 4CO5A 1U1OA 2V4JB 2A2CA 5DG9A 2C3OA 4N47A 3KJFB 1S6PB 3MECB 3DOKB 4QZVB 5C5JA 5EUHA 2DY1A 3RG6A 3MR2A 4PYDA 1M90T 2JDJA 4RW8B 4DSIA 1FRKA 1TKZA 5T14A 1B4SA 2BW2A 3NCRA 3HVWA 2OPPA 2OUGA 2X51A 1HPZA 4LF1A 4I6WA 2IM1A 2V4RA 4LRDA 4U96A 4GKKJ 5IQQA 1UWBB 3QZ8A 2XLJA 4HACB 5KFKA 4LFCJ 2P9GA 4P2FA 4DX6A 1LFPA 3TUZC 2VQEJ 4PABA 5KFVA 1U0HB 3A3NB 2RB7A 3EUNA 1HL6A 1MSWD 2DH9A 3DLJA 2FJVA 4FKYA 4RUBA 2PIIA 4AL6A 4N5SA 2E7WA 1HMVA 3UCZP 3KJVA 1Q7LB 1Y11A 2MHNA 1LWEB 2HPUA 2AWZA 2Z4PA 4PQAA 3W1YC 2EK1A 1R0BG 3EZ5A 1HBNA 2HS4A 2X1AA 2MLZA 2GIRA 4H4MA 3Q89A 2BACA 4NI2A 1UVJA 1Q1KA 1BWEA 2CJQA 2MZTA 1JK9B 2IRYA 3MFHA 1Q81T 2AEFA 1TKXB 2J8AA 3DM2A 2HZCA 3C6TA 3J7AN 2E1MC 3MGJA 3PEHA 4Q45A 5KAKA 3HKZD 1XNQJ 5BJRA 3K5LA 3OPKA 3JSMA 4CO0A 1VQ6S 4C9DA 1RKIA 2DBBA 1EJ7L 4B17A 3HCXA 1FX2A 3JAMY 2PA3A 1TL7B 3KUGA 2MLXA 1DBDA 1VQNS 2XWXA 2BZ2A 1ITPA 1DRZA 4GVBA 4ATNA 4B3OB 2IHR1 4WFBQ 3TWZA 4RW7A 4QU7A 5CYQA 1N56A 1CS4A 1S1TB 2MJNA 3MUMP 1FJCA 5B08A 3MR3A 1NMEB 3RAMA 4K4YA 5D77A 2IRUA 1TL4A 4TVAB 3WIUA 2ZZTA 3TA2A 2CPHA 2XZWA 4M63A 2MZQA 2XS5A 4WE1A 4QWBA 1JWWA 3M1VB 3E01A 1OPZA 2BRLA 2JHEA 4X65F 1TL1A 1X9SA 3VZIA 1S79A 3CDEA 4LT6A 2IJRA 4MFBA 3UR0A 2HWHA 4YB5A 4DV7J 4M94A 1EB0A 5KFYA 2PD1A 2BE7D 2F8EX 3H8YA 3O1LA 2BJDA 4R0JA 1T7PA 4DL0C 4KHRA 3UDCA 1K9MT 2FUG9 5F8IA 4CRJA 2Z58B 4B9TA 1B0VA 4EFAC 2BX6A 2VHGA 3P96A 1NPPA 3LAKA 3NXZA 2HQFA 3MM6A 7FDRA 3G87A 2JLFA 2QLBB 3GP9A 4ETZA 1XC9A 5CAAA 1BD6A 3QLHA 3HJFA 3MMAB 1S6OA 3X3UA 1ZM4A 4C8MA 9RUBA 9ATCB 3IGNA 1HW8A 4L3NA 2CG8A 3CJ2A 4QQBA 2DXFA 3T1AA 4DU7A 1VRQC 3OSNA 4DV6J 1JNRB 1BQNB 1N32J 3D5MA 2KN4A 4ECXA 2QA2A 1Y9OA 2W25A 3JS9A 2QYGA 3UR3C 4W98A 4A8WA 4FYVB 1PG5B 3IAM9 2K1RB 2M8DB 4LMZA 1VC0A 5KTQA 3TA1A 1SJ1A 1VHIA 4USKA 4B9SA 3GR1A 2D7SA 3US5A 4U67Q 2GVZB 1TQLA 2DR8A 2M4MA 3BF4A 1IKVB 4LF6F 4O3QA 1K1QA 1P6TA 2PEHA 4Y00A 2ZVSA 1SJRA 4IFYA 1WHWA 2RNEA 2DRAA 5F8LA 3SSRA 3L7PA 1IBCB 3OL6A 3EGNA 1HNZF 1JLAB 3CJQA 2DR5A 4KGZB 3CC4S 3V4MA 4JI1J 3QZ7A 1VJQA 1Q86T 1RHMB 1DQ8A 1PYTA 2XSFA 1SL1A 3HSJA 3ENAA 1I94J 1BUXA 4I56A 3PDNA 2UZAA 1N54B 3PO4A 1U1MA 5A6WA 3EM1A 1WOSA 2LMIA 1YIJS 4Y3CA 2OTJS 1S4FA 1T95A 4DV1J 4XK8C 1C1CA 4LUBA 4NYOA 4FF3A 1TK0A 4YUDA 3BGUA 5GAHU 2C2MB 4NCAA 4MH8A 1NM2A 1REVA 5I4MA 1X60A 2DIUA 3H5UA 3K5OA 3RB0A 1YBTA 1WF0A 5LMNF 4YFUA 3HD2A 4ECRA 4G6VB 1QDUB 2N4DA 1TL3A 2VG6A 3IA0A 3D0IE 2ZJQQ 2LP4A 5DZ6A 4UOFA 5B0AA 5BR8J 5LMUJ 2MB0B 2AJ2A 4ILLA 3GJQB 5KFGA 2ZM6J 2RD5C 2RQKA 2ALYB 2GVDA 4QR2A 4OYBA 3MMBB 1S0MA 4ZLLA 3R5GA 3ZTPA 3F44A 3PZPA 2UVWA 3I9ZA 3VQSA 1P27B 1UFKA 1U25A 3VAMA 3P45B 1TUGB 4OHWA 3DGPA 4P10A 1RT7B 2BANA 2JEGA 1C0TB 2GHVC 4L74A 1A6LA 1NB7A 1T03A 2F8MA 3MEEA 3V4IB 2WSCC 4TQSA 4DZDA 1RLDA 1LW0B 4OHVA 3MZIA 1SCJB 2PMZD 4U8YA 2RIJA 3F73A 1NK5A 3CCQS 3VCDA 1SV5A 3KK2A 3N4WA 2XGPA 5IT0A 2P9CA 3S01A 3H4BA 2J6SA 3ZNUA 3BYPA 4MIBA 3SQOP 2IBKA 2KB2A 2CRLA 4N8OA 2SXLA 2V94A 2DRDA 5IM0A 2DGUA 4QPTA 4C0OC 2N3LA 1V3RA 4X84A 3OVAA 2CPYA 4QOTA 4YB6A 5HP1A 4W4MA 1PC4A 3MCMA 1MN9A 3BJYA 4X64F 1VI7A 2W2QP 1FFGB 1S7IA 2AX0A 3DYAA 2RAQA 3KK3A 1WEYA 4C8KA 3PX0A 4DV2F 1N34J 4ZIVA 3GFYA 3W3SA 3NP5A 1VQLS 4DXLA 1L3UA 2FVQA 2JLGA 4WXWA 5A8RA 2ZJRQ 2R2RA 3V2UC 3ZZRA 3CW2C 2P8IA 2ZH8A 2VH7A 2V2VA 1JLFA 2OIHA 1DTQA 2HIQA 2H4WB 3SIPB 2V69A 2NXJA 4O44A 1AT1B 2HBQB 1V6HA 4B3SF 1VISA 3BM7A 2R2UA 1NBEB 3M30B 3BH7B 4LSNA 2J6UA 5HROA 4HTJA 2FLOA 2AF6A 3J7ZT 3QYYA 4XDCA 1S9GB 3TW0A 2ROPA 1APSA 2PI4A 3SEOA 4I7FA 2RF2B 4TY8A 4X62J 2VL1A 2HAFA 4X4VA 3TNVA 1RJJA 2FHKA 2NZ4A 4CP5A 4EBDA 3MM9B 1DLOB 2DHXA 2IJFA 3CEDA 4DQRA 4OZ5A 1YJUA 3LP0B 4NCBA 1RTHB 3M8YA 3T9ZA 2YKQA 3VHQA 3SCIE 5A76A 3FFIB 3DLBA 3LQVA 3LWMA 1RTDA 2CJYB 4JI2F 1QUVA 1RAAB 2M2BA 3K5NA 3DLKB 1S5ZA 2R2SA 2KG0A 2R8GA 1HWLA 4ECUA 2IIHA 4LRCA 1YQHA 3M2RA 3W8GA 3R2DJ 2WB4A 2NR0A 4KV8A 5E7OB 4DX5A 1OSCA 4RO0A 3QWPA 1IN0A 3IXQA 3QPIA 1P8GA 1OY9A 3KNAA 2QSWA 4MT1A 5IFMA 2C3PA 4PUOA 4DR6J 4OI0A 4P74A 2XMJA 4LSLA 3D6FB 1D8ZA 2DGVA 2HLUA 1S4EA 4I69A 4QWCA 3AH6A 2DYAA 1UA0A 4Q43A 1IWGA 2FVPA 2NPFA 4F50A 4KSEB 5F3TA 2KH9A 5DDRC 4CNZA 4XAKA 4WIIA 5L1IA 6FD1A 1TL5A 1S9EB 4DZ6A 2PGCA 4DSKA 3A3OB 2F4VJ 4IOBA 5GAHI 1I1GA 4GMKA 4IDKB 2CNKB 2OJ3A 1KSPA 4C8OA 4DFPA 1Q5YA 3R97A 1KNZA 5AXMA 3HHEA 1UETA 2FDNA 3MFIA 1U6FA 2LECA 1FERA 4ANEA 4B08A 4A48A 3VAHA 2KVQE 1UPPA 4LQ9A 1XTZA 4Y2MA 2HNYA 1UMJA 4JI3F 4NLWA 5DM7Q 3VGVA 1VRTB 3CUNA 3BYRA 5GAGI 3MM7B 4RBUA 3EXCX 1QVFR 2EEYA 2AJ0A 3ILOA 2FC9A 1NAQA 4FYXB 3I5BA 4CO4A 4YB7A 2X1BA 4EUVA 4LF7J 1HNWF 4ED5A 3UCGA 3HF5A 4CTAB 1T9UA 3MEDA 3HXMA 2G0JA 4BDPA 4CCHA 4WK3A 1SC1B 1GX6A 1K1SA 5L38A 4JBCA 2QA1A 3UNGC 4BC7A 3BKTA 3M2UB 2XGQA 2J76E 5HVFA 2LDIA 3OTDA 2HNZB 5DDPC 3TJ8A 2VQFJ 1MU2A 1N33J 5AJ3J 4AL5A 4Z7YA 4Q8FA 4J9SA 3T1HF 4L75A 3KHRA 4TU9A 4P2MA 2OFHX 2BQRA 1SJQA 4DV0F 1YGYA 1RYSA 1YWXA 2YWHA 1QM9A 3U1LA 3QBCA 1U1QA 2WAQD 2VPYB 3VVUA 2ZE2A 3H59A 1Q79A 4FZVA 1N36J 1CLFA 1VFJA 1L5UA 3D6MB 2MTLA 4ELVA 3HFVA 2KTQA 1IJFB 2Q79A 2OPSA 3B4DA 1AUDA 1DTTB 2YKMA 3I55S 5D4LA 4ZS6A 4UF4A 1S1WA 1SBRA 1UJ4A 4KPYA 2H48B 3FCVA 1R27B 4YEAA 2BBEA 4CO1A 2UP1A 1Q8IA 1LWFB 1U1LA 2FZKB 2CJ9A 4IFVB 4P73A 4AT1B 4C4WA 1SKRA 2AYMA 2ZD1A 3SQGA 3PHEA 1RI7A 3IM9A 1VR6A 2NCKL 4R8UA 2CZ4A 3BN4A 3PM9A 3T1YJ 5HL7Q 1Q5VA 2V8HA 3D4JA 2WCXA 1CC8A 2QMWA 4X66F 5I3QA 4O4RA 3CCWA 3WDOA 3H40A 1HYSB 3N01A 4DUYF 2G2YA 3R2CJ 2J0SD 2CJAA 2KM8C 1FJ7A 4J9QA 1AUSL 2FVCA 3OXFA 2MQNA 2JVRA 3TJAA 2DH7A 4I67A 2XHWA 3IFEA 4I1TA 1FNMA 1KLMA 1FFSB 3GB0A 2RT3A 2KT3A 2QMUB 1VQYA 2AYEA 4LQ3A 4WKYA 3TAPA 1NHVA 1D09B 3CJ0A 1Z1ZA 2Q1LA 1DHMA 2V4QA 1ZETA 1U1RA 3KJQB 1N5YA 2EBGA 3V6HA 4LFBJ 1FDDA 3W2WA 1CULA 2BR0A 2HHVA 4IOAQ 3OFEA 3PKMA 1FI4A 2B6AB 4F4ZA 4ZPTR 2PT0A 4OQJA 2OEKA 4OI2A 4Q2MA 5ETRA 1M0SA 2Z2ZA 3CMES 2DY9A 3OVBA 1IBKF 4QW9A 1KC8T 3W5ZA 4CI0B 1RHUB 2YNGA 2HMIA 1FTRA 3P4UB 4F4YA 4RR5A 4CT8A 2CZVC 2YNIB 4B02A 2FJBB 3V6DB 2CQHA 4LF8J 1RHQB 2KM8B 4GRSA 2Z0GA 2CQ2A 1AZSB 4TN2A 3DLEA 1JXEA 1X5SA 2VF3A 2OD4A 1JXLA 4RW6A 2O1PA 3P49B 1RT5A 3S6EA 1UJ6A 4QIFA 3QJLA 2AGPA 3GJTB 3BGLA 2ZBCA 4ZA1A 2UUCJ 4YOEA 3IN5A 2DITA 4CO3A 2RVJA 4WIQA 4WP8A 4CLUA 1RWOB 3NMRA 4B9LA 3K17A 4IRKA 3DXBA 2E44A 5GMEA 1RAJA 4H4KA 3AAWB 4A47A 4Q5VA 1JKHA 3PYFA 3W5YA 3N79A 4BC9A 1U6ZA 4XO0A 4ZCLA 1OYEA 3SCJE 3ISNC 1V3ZA 5T7LA 4A8QA 3N6LA 3RBEA 1KEKA 1O5JA 1S76D 1B64A 1TKZB 1X5OA 4HH1A 1V3SA 2OPPB 4LIRA 3AODA 2HRYA 2VBWA 1HPZB 2HGNA 2OELA 1OYDA 3LPYA 4AXIA 2Z30B 3UDLA 3QGIA 1DJ0A 4ILMA 3W62A 4NXMF 4W92B 4XIUA 2VKZG 4K50A 1WEZA 1RCXB 1Q82T 1TK5A 3DI6A 3BDPA 2WVEA 2CQIA 3MTJA 3OJSA 3OHAA 4URGA 1GXTA 1ACMB 4YMEA 3LPEA 3KJVB 2AYGA 1FEHA 3CO9A 3ZTOA 3KMQA 2MKCA 4NA1A 1TFWA 2YKNA 1LK7A 5E3QA 1N0VC 4K2XA 1HBNB 2HHTA 5HO4A 2W2NP 3Q8QB 4TNOA 2YQ1A 4OMFG 4H4MB 5C2GA 3IS9B 3OL7A 3OR1A 2JH3A 3RBDA 2K06A 2FC8A 4M5LA 2HNDA 4HTIA 5EX3A 1NK7A 3IM8A 3ZC4A 2Y1JA 2CPDA 5M2PA 4JI8F 1GTHA 2A6MA 4JI0J 3MEKA 1K0VA 3DM2B 3C6TB 4O3OA 3PEJA 1ZOTA 2G9OA 1RTZA 2CQBA 3HZGA 4QIWD 3ELHA 4O4GA 3JSMB 2F40A 4Y2CA 1FNXH 1VS3A 1U1KA 3TARA 2HHHJ 1GT8A 3D3CJ 3FSXA 2BJ7A 4ZCIA 2YWFA 4GVBB 2CPIA 3AJ1A 1H2TZ 4RW7B 5CYQB 3FK4A 1CS4B 4DR7J 1L3KA 2ZZMA 2D74B 5F9NA 3H2UB 4UUXA 4YY3J 3FKBA 1NPRA 5J2NA 1YK9A 1NHUA 2DXDA 4JI7J 1B7YB 1TMJA 4RUCA 3RR7A 4TKTA 4OI6A 4PXDA 3G6YA 4ZVOB 4E98A 1YJVA 5KFQA 4WE1B 2MYFA 3G4SS 3KHGA 4TLRA 3E01B 3IG1A 2GX8A 3U27A 1TL1B 6AT1B 1BY9A 4V19J 3GFZA 4MFBB 2WVCA 1HBUB 5HQ8A 3MAHA 5H9FK 2VC1A 4DQIA 3LALA 4NLOA 5LSOA 5CD4A 4LFAJ 3D6HB 4OJHA 4CH7A 3OLBA 3D67A 1JIHA 5IXUA 5D3GA 3I9V9 4Q7AA 1H0HB 3MI7X 3MM6B 2MY7A 4K59A 4KRWA 2AJQA 3M6XA 3T6JA 2XWYA 3QLHB 4ID8A 1KONA 4PAAA 3BPDA 2H5IB 1VBKA 3G6ES 4HR2A 3I56S 4BS2A 1KN6A 1S49A 1ZM2A 5IS2A 2Y0SD 2Q6CA 4HI1A 1PGZA 4H54A 2UXCJ 3C16A 2VG5A 4ZVFA 1E6VA 4O3RA 3PR4A 5A8WA 4DR5J 4OYAA 1IKWA 3HM9A 3GLJA 3UN2A 5M2UA 2ZDOA 5LXRA 3MCNA 2JSXA 4GO7X 2GNKA 3R8YA 2W2PP 1S59A 4ED6A 1X9MA 3AD9C 3QWUA 5BYQA 3RB6A 3HLUA 2FHJA 4CLWA 2WONA 3AOCA 3QQCD 5D78A 2B7CB 2FLPA 2J0QD 3NCQA 1GTEA 2E5LJ 3K5MA 3NGSA 4IFYB 1U8WA 4AUKA 1XMOJ 4UY8T 3H2VE 1M5OC 4JYAJ 2C2EA 4F4XA 4ZCMA 5IWAF 4FYWB 5C2CA 3FQLA 4YR2A 2KJVA 3C6UA 1WG1A 5GMKa 1BE4A 2P5VA 1FD2A 4CH1A 3AA9A 3J7A1 3MM5A 3GU0A 3CJSA 3T5HA 2DO0A 3Q2TC 2DO4A 1J27A 3FEZA 5E33A 2ASLA 1AA1B 2AU0A 3BN7A 1SI9A 4C8LA 3KLVA 3T5KA 5JMNA 3ZZ0A 2IVFB 1OO0B 4DFMA 3TAQA 1C1CB 2IY5B 4PQUA 2KVIA 4M5HA 5CH7B 4PG6A 3W2VA 1PIEA 5DGBA 2BJ3A 1REVB 1UFLA 3DN9A 3THVA 1HNXJ 5K9FA 3W65A 3FQKA 1Q16B 1CSJA 4NZ0A 1TL3B 2VG6B 2HS3A 2DGQA 4YDXA 2MSTA 4TY9A 4UOGA 1DQAA 3G71S 1H7WA 4IG3A 3THPA 2JVOA 4D3GA 3CGIA 2BM0A 3IP0A 2GVDB 5GAEU 2CQPA 4I6YA 2V8GA 5LXYA 2GMJA 3N6MA 3UPFA 2MKJA 1HBMA 3D66A 3I6PA 5LM7E 4B3TF 4PXCA 4ZIWA 4ID5A 3CD6S 3NL0A 3G8TA 4ZP9A 2HLTA 4NLPA 3DGPB 2CPEA 1FKOA 4UOCA 2VICA 2VIHA 4QYRA 2AKWB 1T03B 1S6QA 2ZOGA 4ZN1A 3MEEB 4WFZA 3A8IA 3Q24A 3GTYX 4PZVA 3MDFA 2R4FA 2R7UA 3CJKA 3PJ9A 4C0HA 2UV8G 1SQGA 5KFHA 3Q8SB 4CH0S 2UVRA 4WKRA 4ZPVR 5ETPA 4KKOA 3D1OA 4J37A 1PC5A 1SV5B 4WJBA 1ICEB 2NXEA 2BKPA 2BYCA 1FT8A 4FBUA 4DR1F 3R7NB 2CQ4A 2YKPA 4ES3A 3ZZTA 5A0YA 5IM0B 4DG1A 5K8NA 1RHJB 3K7RA 1FFWB 3BR8A 2IA0A 5HP1B 2CNLB 4LRAA 1NK8A 3BQ2A 2MQPA 4J7CA 4IO1A 3R7SB 1EP4B 4R5PA 2FJAB 3DYAB 2VA3A 2FD2A 2DPIA 5HMXA 4RBTA 2P9EA 1UVNA 3ADAC 2H65B 3KLFA 3J80U 3DRPA 1RAEB 5A8RB 5E2QA 1RT3A 5CYMA 1KVJA 4C97A 3AQOA 1X4BA 2RDJA 2VB6A 1WKKA 4F67A 2AX1A 1JLFB 2ALZA 1RT1A 3M9OB 4DL6A 4A46A 3FEYB 1DTQB 1T11A 1EHWA 1WHXA 1U1NA 1YVFA 3BQ0A 2BRKA 1T9WA 1UEKA 4O44B 3C3LA 3OLAA 2B5JB 2N3OA 4RW4A 1VC6A 1IR1A 1NRKA 1NJXA 1KLNA 2C3UA 1HARA 3PCOB 3KYLA 1H2VZ 4LSNB 3HHDA 2Y3YA 4OI3A 1FRIA 3G86A 5HROB 1HW9A 3I0RA 2J9DE 5C25B 5FLXY 1NK0A 1Q8BA 4DFJA 4Q2LA 4KAIA 1AFJA 2RDIA 3BKFA 4ZPWR 5K14A 4DLGA 5IOLA 4I7FB 4TY8B 3C14A 1WI6A 2MPUA 2M5YA 4ELUA 1KQGB 1WF2A 3POTA 2XO7A 4F3QA 2CNOB 4EO6A 2GZOA 1TELA 1IM4A 1HNIA 4KHPJ 1N6QB 4DV3F 3SSQA 4BLGA 4DMZA 1RTDB 2J8SA 2G0IA 4DCJB 1WKJA 2EFPA 1IBLF 3PX4A 1O51A 4A4JA 4DR4F 1LQ9A 4OZ3A 2HKEA 4J9UE 5LL6d 2HHSA 2GA7A 2O67A 3M2RB 4KV8B 2CNNB 2MQLA 4RNNA 2E5IA 2HFSA 1NKEA 5E3PA 2ZVIA 5KG5A 3M2VA 1K47A 4LSLB 4DR2F 1J5EJ 4ZPAA 3M7VA 2W7AA 2OKQA 2XYPB 3HPOA 5LSRA 4HVZA 2K7JA 2CIMA 2VASA 2I5JA 2LXUA 2Y1IA 2C2OB 2HFVA 4TU8A 2BA9A 2F8HA 1LV5A 3RB4A 4LBIA 2KJWA 2L9WA 3ISZA 5I3PA 3MMCA 3C15B 2Y8YA 1U4BA 1KRPA 3D6TB 3I96A 1U26A 3BH6B 4A8OA 1WKLA 1RA7A 2W2MP 4L6V3 4HDHA 1DFDA 2YWEA 1UPMB 3H98A 5D0GA 1FE0A 1S12A 4MIWA 4YR0A 2LU2A 2ACYA 2HNYB 4KIAA 2L9DA 4ED1A 1UW9A 2HZVA 1PILA 3QATA 4DN9A 3MMJA 1IKXA 4C0BA 1HWJA 5F8JA 3EGWB 2B8QA 2C1EB 3UO0A 1NH8A 5GAEI 1RT6A 3DDKA 2HRTA 2QA4S 2YKOA 3QO9A 2FQQB 1UWAA 1R8CA 4OYMA 3MEDB 1BQMA 3M32A 5CYJA 5LJ3Y 1R0AA 3VWSA 3OTOF 5A6PA 3Q8UA 1S0VA 3KG0A 1FJGF 2UUWA 3GV7B 2LEBA 1MMLA 3OTBA 5ETMA 2UXDJ 1P9YA 2G2ZA 2GHPA 3BGRA 5HBMA 5JVHQ 3WBZA 4DUZF 4MYUA 2FJXA 1X5TA 2B9XA 4LSZB 1XIQA 1AFIA 1M5PC 4KFBA 3FRYA 5E3RA 4K4ZA 3W9IA 1VIXA 2WVDA 3NMAA 2XHCA 4KBIA 3ZNJ1 1YJTA 1OMSA 3HT0A 3R5JB 2OFGX 1KHWA 2BABA 2CXEA 4FXVA 1XNRF 1T0TV 1RTJA 4OX9F 2OPSB 1F2HA 4GKJF 2DR9A 2YKMB 2A6OA 2CJXB 1FRMA 4JI6F 4ZLPA 2A10A 2OSQA 4LF9F 1F3VA 1S1WB 4ECYA 3WHIA 4F36A 2MKSA 2XMTA 3VAJA 2YNFA 2NUUG 2ZOFA 3JTPA 3MURP 3OR2A 2V0NA 4JV2A 3EGZA 4B3MJ 1ZM9A 2Y0BB 1NSKL 3KOAA 4PEOA 2PMHA 4TYAA 1VYAA 3OUYA 5KFCA 3ENVA 2ZD1B 2X3GA 3JQMA 3SQGB 4DEZA 2JZ5A 3SXLA 2HGMA 1A7GE 4R8UB 2DNLA 4WFYA 4UUWA 2AYBA 3KKFA 1U1PA 2HW3A 1URRA 1QY7A 2J0WA 4A8YA 2CZ9A 3IWXA 4WPAA 4DHVA 1SH0A 4H4OA 2YVSA 3PXGa 1FWLA 4NLGA 3IO1A 1NSQA 3HHNB 4PWDA 1QE1A 2QYCA 2QL5B 3BQ1A 2YQ0A 1LXNA 4FBTA 1OY6A 1MROA 2HVHA 3NGUA 3J81U 3ULHA 4IH7A 4DBQA 2IM0A 2DNKA 2CUYA 1TKTA 4J9LA 4F0MA 4LF2A 3DLLQ 4FDFA 4ZVGA 2O3DA 2MKKA 4ZVQB 1WACA 2W01A 5EWGA 4KC5A 2VFTA 3HHLA 4OLOA 2G1DA 3B82A 1WHYA 3QNWB 4O3SA 4H4KC 2W9CA 1MWZA 2OLWA 3L7OA 2V8DA 1CULB 2QLJB 4NLQA 2G0CA 5IT9Y 3HK2A 1P1TA 3A1YG 2VFRA 1CPZA 5FDLA 3GFHA 4NXNF 1NXIA 1F2GA 2JX2A 1MNEA 4ZOSA 1XWLA 3TZZA 2HMIB 3PVXA 1S6PA 2Q66A 2GQ2A 2JEJA 4DOZA 3EZUA 3MPYA 4OZ0A 3PW4A 5EHHA 4KGXB 1S72S 1T94A 3T5LA 3CJ5A 4ER8A 4Z37A 3DLEB 5F3ZA 4KYZA 5DZ7A 4RW6B 4ZPBA 3A4TA 3Q22A 1H38A 3BBCA 2CQ1A 3C8YA 3BBBA 2LKZA 4X4OA 3TEHB 2ZH1A 3IMQJ 1RBLA 2HIYA 2KRBA 1JJ2R 1FJEB 5KG1A 1CQNA 4AQYF 2OSRA 3CJRA 4X2BA 3CO0P 1JNZB 2V2ZA 4JV5F 1WC5A 4KT0C 2BDPA 3FBFA 5T7LB 4NPOA 4DQPA 2QEXS 5F9LA 3UCUP 2ZZNA 2GHWA 1SIWB 4HEA9 2HURA 5ITHA 1GMVA 5KG7A 1RGVA 4J9VA 1TVRA 1RAHB 1Q8KA 1C0UA 2NSBA 4Y34A 4DV5F 4O3NA 1PYOB 3PRDA 1HR0J 4X4QA 4KGVB 4BHQA 4YHHJ 1GK8A 4AYBD 4DX7A 4QYZK 1YBUA 1H6KX 4K4SA 3BGFA 2DVIA 4IR9A 3FVYA 1A0OB 3CD0A 3CDUA 5L46A 5KFJA 1JLEA 2WOMB 1TL7A 4F04B 1NKCA 4RZRA 1NNDA 3EDRB 4PR6A 2RRNA 1NHKL 2YKNB 1CQMA 2YTCA 2KYZA 4NLRA 1PO6A 3GPAA 3GONA 4OZ1A 1IWAA 2IPOB 4FS2A 3W61A 1KP6A 3I87A 2GC8A 1YJNS 5L1LA 3I0SA 4RBVA 1SJ4P 1BC6A 2FGCA 2UU9J 3M8QA 2DR7A 3IWNC 1HWIA 1YJWS 1QAIA 2RU9A 4ZITA 4X4TA 4JB8B 2F7VA 1RQ0A 2HQCA 3AJ2A 3M1VA 3QAUA 2DGWA 1D9DA 3VF0B 3LGMA 1RWXB 1M1HA 4IOCQ 1PJ7A 1VQ4S 1W2BR 4O4GB 2ZHOA 4URQU 3OQ2A 4G1QA 1GEHA 2R7SA 5G0RA 1G1XA 4OHYA 2WZ1A 3PACA 3QGHA 3RW6A 2VC0A 3E3XA 1NDLA 4BWJA 4JI5F 3IR6B 1DARA 2QL9B 1Z2ZA 1N0UA 1HWKA 1SH3A 3PW2A 2VOOA 4RL1A 4ZVUB 5J2NB 2EKYA 1MMDA 2HWTA 3OSPA 2LEPA 3FGVA 2ATCB 4QIGA 2J5AA 3JTOA 3A8KA 3ITHA 4E8UA 4QR1A 3R5BA 3VZHA 4YR3A 4RNHA 1D9FA 5ETVA 1SQEA 3TI0A 2DNGA 3IG1B 2LA6A 5B0FA 1W25A 2Q6BA 4ALZA 2RDDA 2WK4A 4DPUA 5KOXA 3NOCA 2AJFE 1YITS 1NDCA 1B99A 2R3VA 4P71A 2UUBJ 1SJFA 3CT9A 2BEFA 3VGUA 1ZTTA 3DOLB 5F8HA 3SFGA 3H20A 1EQMA 4ZVRB 3VALA 5KG4A 3PJWA 5D3GB 2IM2A 3D3BJ 2COLA 2DEJA 1OIAA 2MXYA 4M5DA 5J2QA 4OHZA 3LWLA 1IBMJ 4QCLA 2VONA 3EXYA 1NLKL 3E2EA 2DNQA 3MWBA 2JFDA 5C42A 3I31A 4EEYA 1VCTA 2E7XA 4GKKF 4OV1A 1UVMA 3MR7A 5HSPA 4LFCF 1N8RT 3BO2A 1KQSR 2VQEF 4G65A 3C16B 2VG5B 4F8RA 1E6VB 3CIMA 5A8WB 1G7CB 2WSEC 5GVQA 5H9EJ 1F5CA 1YDLA 3B6BA 2Z2LA 3DOMB 2VPZB 2CWXA 3MCOA 1R7IA 4MKBA 2IDEA 4LF5J 4M1KA 1VDHA 3M8SA 3VGSA 5HI7A 3UD5A 4M5KA 2WONB 2AJ1A 3WX4A 2KU7A 3L4BC 4JV1A 2PN6A 3PR5B 1SH2A 4ZJLA 3TUIC 1QJHA 5KFIA 1LEOA 4EMDA 2GFFA 4XTTA 2B9YA 2XY5A 2NXCA 2MY8A 3ZFVA 5K5MA 3W5XA 4OX6A 5IV4A 1BGXT 3C6UB 1RYRA 3HHLD 4I2QA 1RHRB 1XNQF 3DLHA 4BWMA 1Y10A 1WUUA 2UVUA 3MM5B 2IA6A 3PKYA 1YX2A 2B9WA 1RWUA 5BXIA 4EZ6A 3OFHA 1TZ0A 1NSAA 2HWIA 3LF0A 3OXGA 1R3NA 1OQ3A 2B4PA 2B0GA 3QGPA 2D3ZA 3AD7C 2R8KA 3KLEA 1X4EA 2KL8A 1Q95G 1W26A 5HANA 4B9MA 5C7PA 4PQUB 4C98A 5DLGA 3S7RA 3E51A 3Q23A 3KXDA 3W2VB 3JB9k 4K8RA 1A9NB 3CE8A 2WHOA 2MJUA 8AT1B 4C8NA 4I4BA 2AEJA 4PCQA 2XM3A 3TP2A 3NG8A 1R89A 2AZ3A 2EFNA 5HMZA 4DV7F 4YQWA 3H90A 1O0PA 1IQTA 1IXKA 4UY85 1CG2A 3RB3A 3IR7B 2V50A 4CO2A 4IG3B 4KR0B 3PRVA 3PYGA 3MPWA 3OVSA 3OL8A 1X5PA 2IC3B 2ZOMA 3NEKA 1TV6A 1FK9A 2G13A 1GMWD 4ZMMA 3KLHA 1F9HA 2EKNA 3EVWA 2GAGC 2L48A 1UFWA 1FRHA 3N5FA 3UE2A 2LQ9A 4G3IA 2DGOA 3CJ8A 2ZKUA 1TP7A 1HNVA 1JJHA 1NSPA 3TRGA 2DD8S 3W60A 3DU5A 4ID5B 2R7OA 1S1XB 1FKOB 3KTQA 1NUEA 1XMQJ 3GQCA 1T05A 1VQ9S 3IBCB 1S6QB 4DV6F 2RE1A 5EGYA 4IRDA 4OI1A 1N32F 3UNYA 3NS5A 2L08A 3ICLA 1X4AA 2B8PA 2KI2A 3CJKB 3SBMA 3EDQB 3ZZUA 2FGOA 3K57A 1WOPA 4Y6IA 4KKOB 2R8HA 3D54A 2DNOA 2PO4A 2GGPA 4KH1B 3JSYA 4PYAA 4LF4J 3BSCA 4NRUA 1IJEB 1S1VA 5A0YB 3G9CA 2CQ3A 4DG1B 2F4FA 2EVZA 1FA0A 1RAOA 3BB5A 4CLZA 3QRRA 2MSSA 4OX7A 2Y8WA 2IMWP 5IT9U 4OJ1A 4OJGA 2D1CA 2J9DA 4R5PB 5J1NA 3MAAA 5KFLA 3R6LB 1OJ4A 2R9LA 3AFGA 5B0DA 4JI1F 2ADBA 4EZ9A 5GAGU 3KLFB 3DRSA 1Q53A 3F41A 3DRPB 3G82B 3WQPA 3CDWA 4LREA 4C8ZA 1F5AA 2AJ4A 1RT3B 5CYMB 2E1RA 4ZVPB 4YN3B 1I94F 1B3TA 4ICLA 3TZWA 1MLAA 2L9NA 2MDAA 3LP0A 1RT1B 2IYIA 3DLGA 3M8WA 2ATLA 1MW7A 3HI9A 3PW0A 4EI2A 4ANDA 3JQJA 1G4CA 5IV3A 4IQMA 4RW4B 1GX5A 4RLEA 1QUPA 4RJVA 4DV1F 4K5RA 2ZH6A 1BXNA 1NU4A 4YS2A 4USHA 4FXDA 3I0RB 1N5SA 2ZWOA 2KFZA 3I4HX 2XYGB 2GQCA 4HL9A 5HLFA 3QRPA 3P5BP 2C2KB 3TQEA 3K0JA 5K14B 4PG4A 3A3PB 1RXOB 4DUTA 2C2NA 2I0XA 3C14B 4TLQA 2AGQA 4MKVA 2XYHB 4ECSA 3POTB 2QIFA 5BYSA 1VQ8S 2Z57B 3DRRA 5BR8F 4AE5A 2XTJP 5LMUF 2XZDB 1E6YA 4ZVEA 2E1PA 2ZM6F 4ZHRB 1X0FA 3PG9A 1NJIT 1JMTA 1CJUA 4OZLA 1C1BA 1OSDA 3B78A 2ZUGA 3LGHA 5CZXA 5ETSA 3TYTA 5B0GA 2PMWA 2AQ4A 3GCWP 1QAYA 4RNOA 4OHXA 2XCAA 2H5EA 4ILRA 1D8YA 1B7FA 4WZMA 1Y00A 4M5NA 2ZKTA 2VFSA 3M8ZA 2EFVA 4ZLNA 3SFUA 1FX4A 4DQQA 2H9ZA 1TKDA 4LR9A 5ETNA 2HBYB 3M2VB 3KK1A 4RWWA 3KWMA 5I3UA 4K0KJ 5THWA 3Q86A 1JXVA 4DN0A 4EBEA 2RQ4A 2PFDA 2GAHC 2R42A 4CDIA 2I5JB 1RWKB 2KT5A 1U7LA 4FVCA 3PTWA 1WI8A 3CCES 2GV1A 2XI2A 2XO6A 5DO2A 3MMCB 4DR3J 3EVOA 5L9NA 3M6WA 1CJVA 2K3KA 2RH3A 2GJ2A 1HLWA 3C19A 2XMWA 4USVA 2OEMA 3DHXA 5LSLA 5FJ4A 1UEUA 2FYXA 5KFSA 2JC0A 1N34F 4NRTA 4HH0A 3AXKA 5KFEA 2E9TA 3QT5A 1YRXA 4ES1A 2H5JB 3D28A 1U45A 1J5OA 5KFRA 4L3KA 1OPIA 1WD6A 3CD5A 4EYHB 3ZO7A 4M5IA 1IKXB 1WDDA 1MWQA 1V5IB 3Q8VA 5ADZA 1EETB 1M5HA 5L8RC 3AD8C 3R27A 1RT6B 2DJWA 2ZC3A 3LO3A 3QO9B 3KMSA 3UVJB 2GMHA 5DDOC 2H51B 3M8RA 2B43A 3FRZA 1BQXA 4ELTA 1BQMB 3M32B 3N0VA 1R0AB 1NJYA 3OV7A 1V5VA 3CJTA 1YJ7A 1H74A 3CIZA 1BWVA 3W9HA 1UEVA 1UVLA 3QFHA 4KHMA 1DTTA 3HVAA 4X62F 2EFOA 2UUAJ 2KYXA 3EMTA 1AW0A 3BGRB 3KLIA 2RMLA 2I2YA 1R6VA 1FHTA 3HX9A 5HBMB 2X1FA 5KFAA 1M5KC 1UZDA 2IFXA 2WW4A 4DV4J 2WBRA 4O0NA 2R8JA 4KFBB 1UW4A 2PFFB 4P72A 1XR7A 3MXHP 3NCPA 4ZPDA 3CVKA 5LT5A 1ELOA 3P5TL 2VJUA 4LJMA 1FRLA 3HMJG 2X7IA 3MR5A 3JAMU 1RTJB 2FLLA 1H98A 1HD0A 4DWIA 2MEWA 3AOAA 3H2LA 2J0XA 3GYGA 4KPCA 1H72C 3SYZA 4B3RJ 4KY3A 2M8HA 2YNHB 3HZEA 1R31A 4DR6F 1Z4UA 2OH2A 4A8KA 1WG4A 3FMWA 3Q8RB 4AXJA 3PY8A 2YNFB 3PW5A 1XR6A 2DNZA 4WFXA 3HHLC 3OR2B 1FDBA 4CYUA 2ZH7A 4JUZA 4CQ1A 4ENOA 4NYPA 4A8FA 3DGVA 4K4UA 3I5AA 4NLXA 3NGTA 4QBUA 3OUYB 2ZH2A 4GC6A 2E7VA 2ZH3A 4OYZA 4HT7A 5D4PA 1TTHB 1RAFB 3K8WA 2F4VF 2EWHA 4P2XA 2UXBJ 1KVIA 2LXIA 1HI1A 4N56A 3RUBL 2BQUA 5KFOA 2RRBA 1I3OB 3RJMB 4H4OB 2A18A 3JYTA 4HT5A 1S48A 1MG7A 2ZITA 3D0HE 2LXFA 2WVFA 3MR6A 4PWDB 1QE1B 1NDPA 5KFFA 5F8MA 1ZAWA 1R43A 2R2TA 2PA8D 3LP1A 1HQEA 1GAOA 2LQ8A 5D0RA 2ASYA 4UQTA 4J91A 4A8XA 3V81B 2HEKA 2QSFA 4I2PA 1CJTB 3ZTRA 1BMQB 2V5HG 2CYYA 3RYLA 2MQQA 2CA9A 3BBFA 1TKTB 3RU0A 2EW9A 3PHTA 3VAKA 2C22A 2QX0A 4U7UD 6FDRA 4LF7F 2VDIA 1S0NA 2W9CB 4NX9A 3UDVA 4Z2XA 5K8OA 2KZZA 4GC7A 4C11A 2DRBA 1NZAA 2DHSA 3UD3P 4ZVSB 3KUHA 4U95A 3TO8A 3ZZZA 1RWWB 2LYVA 5FDLB 3C46A 2VQFF 1N33F 5AJ3F 1CJKA 2UUTA 2CDQA 2BJ1A 4NCGA 4Y2IA 2QE5A 2XMUA 4DFKA 2YQ3A 3TAMA 4USUA 5B0BA 4OYOA 2G2OA 2VBZA 3TX8A 1RP5A 3CJ4A 4X4NA 2POKA 1UKUA 2KXHA 4YP3A 2F63A 5ETQA 1B70B 2LDYA 5EN1A 2BJ9A 1N36F 2FY1A 1J2VA 2DNMA 3O44A 1WC6A 3H4DA 2W9AA 3CCTA 4ZKAA 1JJCB 3J7YI 3DC2A 2LQJA 2KFNA 1KD1T 2XB2D 4IQXA 2RKIA 3SSSA 1GFWB 1OQ6A 3LP2A 1X0PA 2HFZA 2XULA 3HULA 2VG7B 5KFPA 3KG1A 5CHCB 2MHEA 1EAYC 4F4AA 2CQ0A 3W9JA 5KFZA 1T02A 4DS4A 4UZBA 1VQMS 1N4LA 2ZH9A 3NNAA 1RSCA 3IS9A 4RUHA 2VFUA 2L3MA 1TVRB 1NJWA 4P6QA 4X65J 1C0UB 4WK1A 1FEEA 3DXSX 4ETXA 2U2FA 5A2QY 1HQUA 4IRCA 2JFKA 3T1YF 1WDTA 2O01C 3CTRA 2XBPA 4PRFA 5IQ6A 2D9PA 3GJSB 3T41A 2RJZA 4OLPA 4PXEA 3M8PA 1ZZNA 5LJ5Y 3MEGA 2FVRA 1RZMA 3U1MA 1JLEB 4OYPA 5D15A 2MQ8A 4RX6A 1S6UA 3NWGA 2MQOA 4KO0A 4DSEA 3AHPA 5AXKA 4CM2A 5K20B 3LUYA 4CZCA 1U48A 1EIYB 1KVKA 2N82B 5I42A 3PNIA 1JLQB 3KG4A 2IAJB 1X4CA 1QD1A 4OZJA 3CCVS 1WNEA 3I0SB 2CJKA 1R8BA 3QIDA 1KOHA 3M8QB 8RUCA 4IUFA 2DNYA 3MTKA 2APOA 1HHSA 1RB0A 1EARA 2OPQA 2CADA 2ILZA 3EPIA 4LFBF 3IRXA 3KDOA 2D69A 1SKUB 1RK8A 2PEBA 5JVGQ 1I6JA 2QV6A 3MAQA 1HBUA 1T9TA 3GYXB 2OPRA 5E0OA 4G1QB 1RCOB 5G0RB 3VAIA 2KXFA 4USJC 2F3JA 2DCUB 2QT7A 4LF6J 2NYHA 1MWYA 1YBAA 1ULRA 3KDNA 4EWTA 1XQIA 2ZBPA 4EGLA 2ZHAA 4LF8F 2C28A 3AB2B 1SC4B 2UVVA 3JSRA 3LGNA 1HNZJ 4NMLA 2KKHA 3ENQA 1F9EB 3PRBA 5K8MA 4QU6A 3Q2SC 3GV8B 2R7WA 3ITHB 4IH6A 3NGRA 1ZAVA 1IVZA 1D0EA 4NASA 2YWWA 1U49A 4WXOA 1HMVB 2YWKA 3NGDA 1M5VC 3DHWC 1KR4A 1VQSA 4EBCA 2UUCF 1HFEL 1PAEX 3O8WA 1WELA 2WTFA 1KQFB 5AXNA 2R7XA 3AXMA 3CJ3A 3A8EA 4P7TA 2E29A 3IRWP 3OXLA 3CULA 1PJ5A 4C3KA 4F2RA 3CF5Q 4TYBA 3SDEA 5H1SV 1VGYA 4NI2B 3PIOQ 3LH2S 4K7QA 3FCHA 4F02A 4B9UA 2E5HA 4QIVA 2HHUA 4M5DB 3T5JA 4F4WA 5J2QB 2V2KA 2Y9HA 2BMBA 2PC6A 3H5XA 2XSJA 2VUGA 5LMNJ 2W1BA 1KDNA 2E9RX 3CNQP 5C42B 1TK8A 2EK6A 4HI2A 2DTJA 1PJ6A 1RT2A 3Q83A 3N5BA 1F9FA 1NZ8A 1VRUA 1YHQS 5B09A 2VBXA 2V9KA 3R5CA 4ZP8A 4FP9A 2JOQA 1D3WA 1RDRA 4AL7A 1BHNA 4NEYA 4N76A 3MD1A 1AB8A 3W7BA 1LW2A 4WU2A 4F4KA 3NGKA 1F5BA 4WYWA 1JLCA 2AIRB 3AT1B 2K2PA 4ZP7A 1EQ0A 5IT4A 2LU1A 4OX8A 2XMKA 2IJNA 3VGTA 1IUJA 2D41A 2BE9B 2E1AA 3DU6A 3GR0A 1NJZA 2IYGA 4I68A 2KDOA 1XBWA 4MK7A 1DY3A 1WWHA 1FVSA 2P6SA 3LAMA 2PSZA 1PYSB 4JI0F 2HHPA 4BCAA 3A12A 1X4GA 4I2QB 4P9SA 2HQGA 3HSZA 5RUBA 5J2PA 3CMAS 4ECTA 1DQ9A 4P75A 1FKAF 2HZAA 2XLIA 2HQ3A 3HDSA 1ZM3A 3L95X 2HHHF 3HD1A 4PG5A 4ED2A 2HQIA 5J2MA 2QZ8A 3THTA 2R8IA 2BE2A 1R0CB 4X64J 4X4SA 4DR7F 3KLEB 2ACMA 4FF4A 2N4CA 1DAXA 4YY3F 4NLSA 2LQBA 2C3YA 4JI7F 4WFNQ 5AE2A 4DV2J 3R6GB 2RS8A 3EPGA 2K3IA 4IR1A 4HDGA 3NNHA 2Z2YB 2D3OR 3GIRA 2Y1RI 3F56A 4RU2A 3CCLS 5CXTA 5DQGA 3M4XA 2P6TA 3FNNA 5D0HA 3H25A 4JV0A 4NLVA 2LCWA 2LFVA 3TEGA 1QLNA 3SI8A 1KFDA 2YWGA 4GO5X 2RU3A 1IQZA 1JLBA 2GJIA 2WSFC 4B3SJ 1VBXA 1IR0A 4LFAF 3DRYA 3ET6A 4DPTA 4K2JA 1TV6B 4RNFA 1FK9B 3KLHB 4OFZA 1T9XA 1NPKA 1I51B 1KTQA 3GYNA 1K8AT 4DL5A 2GO9A 3ILJA 2FZGB 3WIVA 4TU7A 1AXQA 1HNVB 3I32A 4DX8H 1HA1A 4ZDNA 4LRFA 3QT7A 2QO3A 4YB1P 1EP4A 1T05B 5DG7A 2QTWA 1FDNA 2DPJA 3LW5C 2UXCF 2V67A 1WHVA 3ISND 3QSYB 4DR5F 2VODA 4JI2J 3R5AA 3TA0A 2QLFB 2KT2A 3NKYA 1HI8A 3GE9A 2CAJA 2GGPB 3DDNA 2DHAA 3NS7B 2ILYA 3P6YC 2JC1A 1RKJA 1S1VB 2I1RA 2B5JA 1Q4RA 4XPCA 1H73A 5GMDA 2DB1A 2BVZA 3BEGB 3FJ2A 1HKAA 3OTEA 2E5LF 3WC2A 1PKUA 3VAFA 5C25A 2Z2MA 3U02A 1XMOF 2N7CA 3CB4A 2CFXA 1PCAA 4J9PA 2HK2A 4JYAF 1SXLA 3MAAB 1FD8A 2J9CA 2W24A 3DCAA 4ED7A 3NY0A 2F9JA 4USMA 2OAUA 1SL2A 3DRSB 2J6TA 3PO5A 2HSEB 3BO4A 3DNCA 3PW7A 4M5GA 4UQGA 4ICLB 1RACB 1N6QA 1YSJA 2VA2A 4K4WA 4WTOB 3P3DA 2VU5A 3EICA 3DLGB 4MTPA 5CA5A 3BSOA 1KWMA 4UZCA 2E5JA 4OV6A 1Q8LA 3EZOA 4CM0A 5T41A 2BANB 4WF9Q 4HYKA 5HMYA 4PWUA 2B3TB 3HVTA 4OZNA 3H5YA 4Z7CA 2AP6A 2XS2A 5HLFB 1HNXF 4JI3J 1TU0B 3KK2B 3TUPA 1ZS6A 5CCMA 3CDBA 1X4DA 4RPFA 3DRRB 4DSJA 2WW8A 4DPWA 2M9KA 1Q0NA 2VZ9A 1SJ3P 1E6YB 3D1HA 2QLWA 2ZFHA 3G8QA 1HNWJ 4XPEA 2ZWPA 1U2RA 1CJUB 1C1BB 1ZH5A 4KJIA 1PAUB 4RWXA 4DDFA 4NEZA 1FDAA 2P2CB 3FEXB 2F9DA 1QSLA 2B4VA 4DPXA 3FZ2A 3VAGA 2NS1B 1BLUA 3DMJA 5A2QU 4R25A 3C15A 2LLZA 4ED8A 4CIOA 3GG1A 3KK3B 4ZJQA 2B4OA 3TVYA 2EG2A 5EWEA 5DETA 3PFOA 2MKIA 4ANCA 4AFFA 1RU2A 4NZ7A 2YPYA 3Q8PB 4YDDB 4MMOA 3T1HJ 1QSSA 4C48A 3OL9A 5L39A 4BBYA 2HQDA 4I6AA 5ETKA 1WTBA 4DV0J 5D6GA 2KO1A 3KK1B 4L72B 3I5CA 2EC0A 1RT4A 3T19A 3R7BB 5I3UB 2OP5A 2QFIA 3D9BA 4CLTA 3GV5B 4ZVTB 2CVEA 3HHKA 3EJMA 3HFKA 3SCLE 3MUVP 4X4UA 2Z56B 4CLFA 5J1EA 1UZHA 3KNGA 4O0IA 2E9ZA 3IR5B 4C8YA 1CJVB 1URNA 3HVRA 4OYWA 4USIA 3CCRS 1XN9A 2RSQA 2ERRA 1N52B 1SUQA 3MUTP 2RQMA 1PSDA 4N7TA 3BS9A 2OMOA 3LANA 4NLTA 1WOOA 2JRSA 3UWTA 3KUEA 1L3VA 3ENWA 1XR5A 1J5OB 1FKPA 3GWCA 4PKDB 5JXSA 2NUHA 4HKQA 4DL2A 2M7SA 1JLGA 2R7QA 5DDQC 3RAQA 3OFFA 1NCLA 2AV5A 2V68A 4CLPA 2ROEA 4QR0A 1NO8A 1XERA 5C24A 2XY6A 4FNIA 4X66J 3LA0A 1GXUA 3G6VA 2W7OA 1VQPS 1WSVA 2RQCA 3CDAA 3VTIA 3ZZYA 4DUYJ 4PUOB 3V6JA 3L3CA 3K59A 1R8PA 1O8BA 1IKYA 2CPJA 4F7VA 3PV8A 2DISA 2HVIA 1KS2A 5DS7A 2G1HA 2NZCA 1VJWA 3KLIB 3B54A 1FWPA 1JJ4A 2L41A 3HFZB 1WEXA 2VPWB 2YH0A 2M3DA 4KHPF 3BSAA 2XG8A 2N7YA 2EC2A 1DURA 1S1UA 3FBCA 1WC3A 3QGGA 4P2SA 2QJ3A 1MMNA 3OHBA 4K5SA 2NPIA 4F3MA 1REGX 1S99A 5H9FJ 1NDKA 2E1CA 1WC4A 3H7HB 3N6NA 5HJXA 3ILIA 1XEZA 2E66A 4LIWA 4M8LA 3RR8A 3R5DA 1TMMA 1IBKJ 2ZJPQ 1T3OA 1F3FA 4WBFA 3TJ9A 3M05A 2JLEA 3RBXA 2XMAA 3K8VA 4HHUA 1Y5IB 3OD2A 3TZYA 3RGIA 3TVKA 3ETOA 1J5EF 4NLDA 5KT6A 3V6KA 2HVZA 2YBVA 1QSYA 1N5QA 3NRBA 4CYUB 4RW9A 1RWMB 2CG4A 4HLBA 3BKUA 2BQ3A 2Q43A 3UD4P 4DPYA 4Y28C 5GADU 3UDEA 2O5DA 3O6QA 4ES2A 3AOBA 1HIYA 4ED3A 2ZBRA 1RTIA 2W8LA 1IM6A 3TUJC 4E0DA 2DXEA 2H3EB 3GSDA 3JSBA 5DQHA 2IM3A 4WYLA 2AZ1A 1MU2B 5DQIA 4CLYA 4A8SA 1TAQA 1PBAA 3CCSS 3JYTB 2RUSA 4IG0A 3BPSP 3FMBA 1S9FA 3ZZOA 4FF2A 2EFGA 5HMWA 2ABYA 4C6AA 4ZN3A 5DG8A 3LP1B 1HQEB 3J80Y 3ZXWA 4TXSA 2ZE2B 1T8EA 1HI0P 4I2PB 1G2EA 2HFNA 3MM8A 2ASJA 2NLWA 3K58A 2CKWA 2YKAA 4ECWA 2FB0A 2QA4G 3G2XA 5DGAA 1N48A 4NXMJ 1UL3A 3RRGA 4I64A 2AD9A 4LVOP 3CC7S 1VQ5S 1HBOA 3ETMA 2D9OA 3EYZA 5HQMA 2M52A 4ED4A 2JEIA 2RILA 1SQFA 3IGVA 4G1IA 4C11B 2W8KA 2FJWA 2ZUAA 4DSFA 3FBEA 2NREA 4FS1A 2UXDF 1V9OA 4ECZA 2QLXA 4Q0BA 1HHTP 3ONQA 2DIVA 2JJ4D 1X31C 2CDRB 3HKWA 4U8VA 2I9SA 1CJKB 1CEZA 2DT9A 2DR6A 3MF5A 3GIKA 3L9ZA 4NCGB 1GNKA 1T9YA 2KRRA 2ADCA 3TAMB 3RRHA 5HAOA 1NB2A 1Y0HA 3GMGA 2W4PA 2HFUA 2YH1A 5L1JA 3IC1A 2FJDB 4JI8J 4QWEA 1M1GA 3TX0A 3BSNA 5AXLA 1LWCA 5DM6Q 1FTCA 1L3TA 2FIUA 5LOQA 2MGZA 1R6YA 3WX8A 4USWA 1GQEA 4KH0B 2K8GA 3H42A 3TANA 2IBOA 2RKIB 2B9EA 3ZTSA 1WC0A 3KLGA 3UW1A 3QIPA 3SZ2A 3LP2B 2ZC4A 1SPBP 5FD1A 2I8EA 2YX1A 2MZRA 1KLMB 1XK8A 1M1KT 1VIOA 2WOMA 1Y5NB 1RAIB 4ZVHA 4MJKA 1T3NA 4RNMA 2BUNA 1S10A 4NL5A 4B3MF 3EWGA 3L7UA 3JQKA 4Y2AA 1Y5LB 4MKAA 1N5YB 3PJXA 3C66A 2RS2A 3VR1A 3GIMA 4FYYB 1CVJA 4XDDA 1VHFA 3NBPA 2IDLA 2W9BA 3W2WB 2CJBA 4Q8EA 3UN5A 5A8KA 4L76A 2VD3A 5E3AA 2OTLS 4UT4A 2LEAA 3G8SA 2OD6A 2JEFA 1HQUB 2HBZB 1GH8A 1RHKB 2YY3A 2CPZA 4RUAA 3M9NB 2V4JA 3N28A 3PYDA 1N5VA 3FDSA 3OW2R 2YNGB 1ZA2B 2IVYA 3M8PB 4CLLA 3MEGB 3DOKA 3MECA 5KT5A 1S97A 2WB1D 1RA6A 5ETOA 4RU9A 3SMZA 2GJFA 4URSA 4KO0B 1Q78A 3BO3A 3KHHA 1LK5A 1Y3KA 4RW8A 3PYEA 3K89A 5IZHA 5AE1A 4DCPB 1X4FA 3EX7B 5I42B 3E8OA 4J5OA 5B0EA 4EO8A 3U1NA 1RT5B 1M5SA 2HVDA 3IWLA 4KGKA 4MAKA 2CQGA 1UWBA 4HACA 2VDHA 2AGOA 1U0HA 7AT1B 2FVSA 3O5TB 3NAIA 1RABB 1ZAXA 3O3LA 4DJBA 1YZ7A 2OPQB 1NEEA 2EPIA 5F41A 4EYIB 3IRXB 4NLUA 2FY8A 1GMWA 3H5SA 2DGSA 3RTVA 4OYIA 2BM1A 4DI6A 4B9VA 1SL0A 1LWEA 1JKHB 1O6XA 4F0HA 4L73A 5KFBA 2FHOB 4JI4F 1FESA 2OPRB 1W2IA 2H4YB 2CQDA 1LNQA 3FCWA 2W4DA 5F8NA 3DOLA 5KFNA 3DDIA 5DLFA 1B0PA 2H54B 4M5JA 3Q0AA 1SC3B 1RBAA 2QL7B 4I0WA 5GADI 3VVTA 4O23A 1FRJA 1FXDA 5IWAJ 1TKXA 3G96A 1VK3A 4J9NA 3EVMA 1FCAA 1SC6A 3DI6B 3T9NA 3P8BB 2W2OP 2J9EA 2DGTA 2ZBIA 2V2QA 2OMLA 1P1LA 3ILLA 3MOZA 1NKBA 1X7VA 4N41A 4B3OA 3CCMS 3TZXA 2EFQA 4ZP6A 2MZ1A 3DOMA 3W66A 1S1TA 4ZPCA 4WU3A 1FRXA 1K0TA 4IYQA 5FLXU 2FPHX 3OR1B 4QIEA 3SDEB 5F0UA 2HNDB 1RWPB 4F26A 1EKRA 1KTVA 3WZ0A 4KE5A 5HJYA 3CD7A 2HS0A 1UTAA 2D3UA 2MKYA 4FXWA 2XSJB 2QFJA 1FVQA 5IC6B 1KKHA 2LVWA 4MK8A 2B51A 4FYDA 1HR0F 1U2CA 2CPXA 1B0TA 3QRQA 4YHHF 2XZTB 4QJVA 2O66A 1VQOS 1RT2B 1LWXA 3OT9A 2J7KA 1VRUB 1JQGA 2W7PA 4P52A 2C3MA 3ZTQA 5G4DA 4UTGA 2ZNZA 4DL3A 2BXJA 3U7JA 1RWVB 2ZH5A 4N77A 2YX4A 2FZCB 3QJJA 1G3OA 3GILA 1TR0A 2MQMA 1OS5A 1P9QC 4B3TJ 3MMAA 4OZ2A 1HWUA 1LKZA 1LW2B 4Q44A 5J1PA 1QAXA 1JLCB 1KOOA 3UQSA 4OI4A 3B4MA 1N88A 3J81Y 1L3SA 3DKDA 4J9RA 3MCSA 4DF8A 4GVLA 2KHDA 1BQNA 2UU9F 4FF1A 3R1LA 5AT1B 3O2IA 1NK4A 4K4XA 1SKWA 3MPUB 2V34A 2K1RA 2A1BA 2BKNA 4ERDA 2FTRA 2AMCB 4CT9A 2EBEA 4CNYA 1Y7PA 3OFGA 5F8GA 5J2PB 2V6AA 4NOHA 4DR1J 2LQ5A 1WG5A 5HQLA 2GVZA 2MKHA 2DKOB 1LOUA 1SKSA 3G6XA 2GIQA 2DHHA 5KFUA 1HHQA 2JWNA 1IKVA 4DQSA 1EX8A 2UV8A 5J2MB 1RE1B 4J9OA 2BE2B 1RISA 2IC3A 4ECQA 3BR9A 3F0NA 4KTQA 4ZJOA 2GIFA 3CSKA 2V8PA 1UVIA 3GZ7A 2CPFA 5D8HB 3I4PA 4TQRA 2CVIA 3D2WA 1JLAA 3FUYA 2HRUA 4JP8A 3S8SA 4DU8A 4CLKA 5MLCV 3H0PA 1EZZB 1Q7YT 1YLXA 1S1XA 1IKWB 1ZA1B 1U47A 3FSIA 4O3PA 1K73T 4F3OA 5F0WA 4PG7A 3QMQA 1TUVA 5EWFA 1VOMA 3IBWA 2OEJA 1S77D 4MIAA 1JLBB 2BOPA 2UUBF 2HK3A 2VFVA 5KFMA 1UP1A 4A8MP 3ET6B 2HHQA 3BDEA 2HFOA 3JXOA 4IH5A 2Z8QA 2J7WA 2VOPA 1KBRA 1IBMF 4PG8A 3T6BA 2W4CA 1U02A 1FNOA 5EDWA 3QT6A 3R3TA 2RRAA 2RHQB 3LTOA 5KG6A 2NXNA 1C4CA 3DFEA 2XY7A 1U6BA 3RZAA 1U09A 2CQCA 4KQZA 1U2FA 1FXLA 4DV3J 3W64A 3G82A 2C2RA 2KXNB 1YZ6A 4NMXA 4DCOB 1IBLJ 3MMBA 4DR4J 1NH7A 5AE3A 5L9XA 4KGMA 1JB0C 1ROFA 2C2DA 4LF5F 5E5NA 3OJUA 4NLYA 3UFCX 1SVDA 1D1UA 2YX7A 3QFWA 2PI5A 2VBYA 4C3MA 1RT7A 1C0TA 3I82A 1XJWB 1YKWA 4NA2A 4V19X 3V4IA 4ZLJA 4PPZA 1KFSA 1LW0A 2OHDA 2QRRA 4DR2J 4QWDA 3PX6A 1AYEA 1T9VA 5L1KA 4G1PA 3AA8A 5U47A 4NYZA 5CCLA 1TUWA 4DL4A 1C4AA 2XNRA 1R8HA 2HAIA 3GSIA 3RRKA 2XLKA 2H1YA 2A2DA 2DNHA 5E3CA 2HBRB 2D3O1 5KG2A 1SB6A 1F60B 1QVGR 1F6TA 1WSRA 3R1HA 4ZHRA 1RADB 1CBKA 1HBMB 1VBYA 1CC7A 2B56A 3RW7A 4R0EA 2A0FB 3D1QA 5HATA 1AROP 2HHXA 4J90A 1WC1A 2NXUA 3KFWX 4Y65A 4X4RA 2R7RA 3Q8YA 3HVTB 3CCJS 4U6PA 5KOWA 5E41A 4P7VA 1H2UX 1RLCL 2ZHBA 3T3FA 1NK6A 2DK2A 5SUHA 3TOQA 4OYXA 2XNQA 4Y2KA 2GW8A 2BOAA 2IVMA 5CD4H 2PDAA 4F2SA 3J7Z5 2ASDA 3ZZPA 4W90B 1S7HA 5CABA 1UVKA 3TQ1A 3M30A 5IC4B 3AJDA 4NWBA 1ZYQA 1UAWA 2XC9A 3OTOJ 3PFEA 4PPDA 1TFYA 4USTA 1ZPWX 3DMJB 1FJGJ 1ZTWA 1S9GA 4NZ6A 2LA4A 3CMQA 2RF2A 1WTFA 3W63A 4MYTA 2FHJD 2HGLA 4J9MA 3M9MB 4EU0A 3LOUA 3MM9A 1VMBA 1DLOA 3GCXP 2WBMA 4DUZJ 2GMLA 1RU1A 4UOHA 1F0XA 1XMQF 2DEIA 3A8JA 3A13A 3DRXA 3AB4B 2Y1LB 2KG1A 3C2PA 1S0OA 2FLNA 1RTHA 2VPXB 3FC9A 4ZCKA 4FN5A 5JUMA 1VK8A 1WORA 3FFIA 2ZDPA 2OI2A 3CPWR 4ZK7M 4S0MA 1FWKA 3EGVA 1PBUA 1Z2LA 4WTYA 3DLKA 3OTCA 1RT4B 1RWNB 2A3JA 1NK9A 5DRKA 2NSCA 1WJ9A 4QYZJ 2ROGA 3MPVA 1XNRJ 5D4OA 4LF4F 1EETA 1N5TA 1W7WA 5CQGA 4DSLA 2AHOB 2V9WA 2QN6B 4OX9J 2XEXA 1RBOB 4DPOA 1QAJA 5D0EA 1OWXA 5J1EB 4F0KA 2BW7A 4GKJJ 4C3LA 2B4UA 3UVJA 4PXBA 3UI3A 5K8PA 4HHJA 1K44A 4JI6J 3HSDA 4QWAA 2GO8A 4LF9J 2PE8A 2Q3PA 2F1FA 1HD1A 3IAS9 1FO1A 1HNIB 1SUQB 2EXUA 4DF4A 3D7SB 1D9AA 5KT7A 3B8HA 2IRXA 3S1TA 4U7CA 1FKPB 4FPRA 4EK2A 1S9EA 4FVMA 3W8PA 4WCEQ 3FSYA 3CWJA 3NAHA 3MPDA 5H9EK 1JLGB 4CWBA 2WRMA 5KT4A 2GCFA 2MZSA 5KT3A 4J9KA 4IDKA 2BJEA 2FHMA 2KHCA 4U7UK 3WC0A 2DH8A 1YJ9S 5C24B 2K7KA 4FKXA 4OJ3A 4WZQA 4DLEA 5KG0A 3HT3A 3VQTA 1OY8A 4ECVA 2DGXA 1U8SA 1IKYB 3BREA 4D3HA 3NOGA 1MN7A 5HVHA 2HVEA 4OIXA 1VRTA 2YNHA 2E5GA 5KT2A 2XMVA 4FNHA 3MM7A 4LRBA 3RBZA 4AD6A 3CXCR 3GIJA 3D0GE 3FBBA 4WP3A 3UN3A 2X1GA 1RAGB 3R9LA 3MOJB 1LXJA 4CTAA 4M95A 3N9UC 3EE3A 1S1UB 4NA3A 3BGOP 3J7YU 4E2FB 2DHGA 4PWWA 1WF1A 4N8NA 1DZ5A 1KHVA 2DNNA 5KFXA 4DL7A 3M2UA 2G4BA 5M2RA 2C42A 2HNZA 4NXNJ 2KFYA 3L09A 4B9NA 1VBZA 4F25A 1FE4A 1ZZFA 1X4HA 4ED0A 2VJVA 1SIZA 3BV8A 3GJRB 1LFWA 1R8AA 1X9WA 1IR2A 1FXRA 1YJRA 3HO1A 3IBFB 2XQCA 3SV4A 3AQPA 1C2PA 2OO4A 1QTNB 3OBIA 3V81A 4RW9B 2VKRA 2V63A 4K0KF 1CJTA 1FF2A 1S57A 4V1Ak 4KB7A 3QSIA 3HJVA 1VLYA 2VV5A
chains in the Genus database with same CATH topology
1U2RA 1WEZA 2HYIB 2R7TA 1Q82T 1C1BB 1ZH5A 2B9WA 1TK5A 3DI6A 4KJIA 4RWXA 1RWUA 4DDFA 3BDPA 4C7QA 1VQ7S 1FDAA 2XI3A 1KQKA 3FEXB 4EZ6A 2CQIA 2F9DA 1U24A 3SV3A 1Y3JA 2DCLA 2U1AA 4DR3F 1RTIB 2B4VA 1QSLA 2IMOA 3MTJA 1YRUA 2V8VA 3FZ2A 1GXTA 3OFHA 4YMEA 4URGA 3OHAA 1TZ0A 3OJSA 3KJVB 3NS6A 3TVZA 2HWIA 2AYGA 3VAGA 2NS1B 3LF0A 1FEHA 3CO9A 1BLUA 3DMJA 3OXGA 1R3NA 4R25A 1OQ3A 3KMQA 2MKCA 4NA1A 2B4PA 2B0GA 1X8DA 2D3ZA 2LLZA 3QGPA 5EX0A 3CCUS 4ED8A 4CIOA 3KLEA 3GG1A 3KK3B 2R8KA 3GIIA 1X4EA 2B4OA 5CZVA 3TVYA 2EG1A 2YKNA 1LK7A 4JOUA 7FD1A 2EG2A 5EWEA 4Y0FA 4C2MA 5HN0A 5DETA 3AY0A 3PFOA 4B9MA 2MKIA 4PQUB 5E3QA 1N0VC 4K2XA 4C98A 1HBNB 4AFFA 4NZ7A 5DLGA 3Q8PB 2HHTA 5HO4A 3S7RA 4IG0B 4YDDB 4MMOA 3E51A 3CC2S 3Q8QB 4TNOA 3Q23A 1QSSA 3OL9A 2I38A 1LWFA 3W2VB 4OMFG 4H4MB 3JB9k 5L39A 1A9NB 3IS9B 1Y4ZB 3CE8A 2WHOA 3BZQA 4K4VA 3OL7A 3OR1A 2JH3A 4IFVA 3RBDA 4BBYA 3KHLA 4I6AA 2ZH4A 2MJUA 2FC8A 2HNDA 2R7VA 1WTBA 4HTIA 5EX3A 4C8NA 2J7UA 4I4BA 1H3DA 4WFAQ 1NK7A 3ZC4A 5DJBA 3MHYA 5D6GA 2CPDA 2Y1JA 5M2PA 2KO1A 4PCQA 4K4TA 3TP2A 3KK1B 4JI8F 1GTHA 3MM8B 3NG8A 1R89A 4L72B 3I5CA 3MEKA 3HP6A 1RT4A 3T19A 3DM2B 1YG0A 2EFNA 2FJEB 5HMZA 2EC0A 3C6TB 3X1LB 4O3OA 5I3UB 1YRTA 4DV7F 2OP5A 3PEJA 4YQWA 1O0PA 1ZOTA 2G9OA 1IQTA 1IXKA 4UY85 4IO9Q 1CG2A 2CQBA 3RB3A 3IR7B 3HZGA 4QIWD 3GV5B 2CVEA 3HHKA 4O4GA 2QMXA 3JSMB 4CO2A 3HFKA 2F40A 2M88A 4IG3B 4KR0B 3SCLE 3MUVP 3FZBA 4X4UA 2DNPA 1HBOB 3MPWA 4Y2CA 3OVSA 1FNXH 3OL8A 1VS3A 1HYSA 1X5PA 2IC3B 2ZOMA 1U1KA 5J1EA 1TV6A 3TARA 1FK9A 2G13A 4ZMMA 3KLHA 1GT8A 3FSXA 3KNGA 2DNRA 2DR7A 2L48A 4O0IA 4ZCIA 3IR5B 4IKAA 1QTMA 2YWFA 1UFWA 2E9ZA 5B0CA 4C8YA 1FRHA 3N5FA 3UE2A 2CPIA 2LQ9A 3GG0A 3AJ1A 1VC5A 4G3IA 2DGOA 3V5RA 5KFTA 1H2TZ 2ZKUA 1TP7A 4RW7B 5CYQB 1XMBA 1URNA 3HVRA 1L3KA 4USIA 3CCRS 2ZZMA 4Q0BB 2D74B 5F9NA 2UUAF 1XN9A 1HNVA 2RSQA 5D4NA 1JJHA 2ERRA 4U9RA 3H2UB 3TRGA 5SZTA 2DD8S 4UUXA 3DU5A 1N52B 1SUQA 4ID5B 2RQMA 2VG7A 3MUTP 1UA1A 2R7OA 1PSDA 5J2NA 1NHUA 2GQQA 1S1XB 1FKOB 4RUCA 3NNCA 3KTQA 3BS9A 3RR7A 2OMOA 3GQCA 3LANA 4TKTA 1T05A 1VQ9S 4NLTA 4OI6A 4PXDA 3G6YA 2JRSA 3UWTA 1S6QB 4DV4F 4DV6F 2RE1A 4E98A 5EGYA 4IRDA 4OI1A 1YJVA 1N32F 5KFQA 1L3VA 3ENWA 1XR5A 4MK9A 1J5OB 1VQKS 3NS5A 4WE1B 1FKPA 2L08A 2MYFA 3GWCA 3ICLA 3G4SS 4PKDB 5JXSA 5KG3A 1X4AA 3KHGA 4UW2A 3NLCA 2NUHA 5FIIA 4TLRA 4HKQA 2KI2A 3E01B 3CJKB 3ZZUA 3IG1A 5B7WA 2GX8A 4DL2A 3U27A 2FGOA 1TL1B 3K57A 2M7SA 1JLGA 2R7QA 1BY9A 4Y6IA 5DDQC 4V19J 3GFZA 4MFBB 3RAQA 3CCZA 5HQ8A 1HBUB 4KKOB 2EI5A 3MAHA 2R8HA 1TFWA 3OFFA 2AW0A 3D54A 1LWCB 2AV5A 2DNOA 2PO4A 2B6AA 2GGPA 3JSYA 2ROEA 2VC1A 4QR0A 1NO8A 4QW8A 3BSCA 1XERA 5C24A 2MGZB 2XY6A 1YTYA 4FNIA 3M6VA 3LALA 4NRUA 4DQIA 4NLOA 3MD3A 1GXUA 5LSOA 3PIPQ 3G6VA 1TAUA 2W7OA 1IJEB 1VQPS 2RQCA 1S1VA 3CDAA 4OJHA 3VTIA 4CH7A 5A0YB 1JIHA 2M70A 3SCKE 5IXUA 3OLBA 3RAXA 3G9CA 3ZZYA 1YI2S 4PUOB 2CQ3A 3V6JA 4DG1B 5JJBA 5D3GA 1ZPVA 2EVZA 3GFXA 3L3CA 2KZMA 1GXLA 3I9V9 4Q7AA 3K59A 1R8PA 1FA0A 1MROB 3KLGB 1O8BA 4DS5A 1IKYA 2CPJA 2NQPA 3BB5A 3QIPB 1H0HB 3PV8A 2MSSA 3MI7X 3MM6B 2MY7A 4K59A 2MZJA 2DISA 4KRWA 4OX7A 4B3RF 2HVIA 1KS2A 2AJQA 5DS7A 3M6XA 2RUGA 3T6JA 1VJWA 2IMWP 3K5PA 2XWYA 3QLHB 4OJ1A 3TR5A 2YNIA 3K2YA 4OJGA 5KFWA 2HG4A 4ID8A 2D1CA 3V6DA 1KONA 2J9DA 4R5PB 3KLIB 5J1NA 1UJ5A 2MMYA 2ZNYA 5KFLA 3G6ES 1JJ4A 2NYIA 2R9LA 2L41A 3I56S 4BS2A 5B0DA 4JI1F 2ADBA 1KN6A 1WEXA 2XS7A 1H7XA 4RKUC 3HHLB 4EZ9A 2VPWB 1S49A 2YH0A 5GAGU 3KLFB 3DRSA 1Q53A 2M3DA 3DRPB 3F41A 3JTNA 4KHPF 1JLQA 1ZM2A 5IS2A 2Y0SD 3CDWA 2BV3A 2Q6CA 2IAJA 3BSAA 4HI1A 2XCPA 4C8ZA 1PGZA 1F5AA 2AJ4A 4X4PA 1RT3B 3NBPB 4H54A 2XG8A 5CYMB 5BYRA 2N7YA 2E1RA 2M0GB 2W9BB 4MKYA 2XMMA 2VG5A 5MAOA 4QPXA 4ZVFA 1I94F 4ICLA 1E6VA 4O3RA 1ZBTA 2HHWA 5A8KB 3PR4A 5A8WA 4OL8A 2L9NA 2MDAA 2B7BB 3QAEA 1DURA 1IKWA 3LP0A 1S1UA 3HM9A 3QGGA 1RT1B 3QJPA 4P2SA 1MMNA 3OHBA 4LVNP 4K5SA 2IYIA 2ZDOA 3DLGA 5M2UA 5LXRA 1JX4A 2ATLA 2JSXA 4GO7X 4ITSA 5KFDA 1G6BA 1MW7A 2JL9A 2NPIA 3HI9A 4F3MA 2UXBF 3PW0A 1S99A 2GNKA 5H9FJ 3M6UA 4CO5A 4ED6A 2E1CA 1U1OA 1X9MA 2V4JB 2A2CA 4IQMA 3QWUA 4RW4B 5DG9A 1GX5A 4RLEA 1QUPA 3N6NA 2C3OA 4DV1F 5BYQA 3RB6A 4N47A 4K5RA 1XEZA 3HLUA 2FHJA 2ZH6A 2E66A 2WONA 1NU4A 1S6PB 4LIWA 4M8LA 3RR8A 3MECB 3DOKB 4USHA 3R5DA 4FXDA 5D78A 2ZJPQ 2B7CB 3I0RB 2FLPA 1T3OA 4QZVB 2J0QD 1N5SA 3M05A 5C5JA 3NCQA 2JLEA 2KFZA 5EUHA 3I4HX 1GTEA 2GQCA 3K8VA 1Y5IB 3MR2A 4HL9A 1M90T 3K5MA 5HLFA 4IFYB 2JDJA 3K0JA 4RW8B 4DSIA 5K14B 4PG4A 1FRKA 1TKZA 4AUKA 5T14A 2I0XA 3TVKA 2BW2A 4UY8T 3H2VE 3NCRA 3HVWA 4TLQA 2OPPA 3ETOA 1J5EF 1M5OC 2AGQA 4NLDA 5KT6A 2C2EA 4F4XA 4ZCMA 3V6KA 2X51A 4ECSA 2HVZA 5IWAF 1HPZA 3FQLA 3POTB 4YR2A 1QSYA 4I6WA 2IM1A 2KJVA 3C6UA 1N5QA 2V4RA 3NRBA 1WG1A 4RW9A 2QIFA 5BYSA 1VQ8S 2CG4A 5GMKa 3DRRA 4HLBA 5IQQA 4AE5A 5BR8F 2Q43A 2P5VA 5LMUF 3UD4P 2BQ3A 1FD2