3EGZA

Crystal structure of an in vitro evolved tetracycline aptamer and artificial riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for specific, high-affinity tetracycline binding by an in vitro evolved aptamer and artificial riboswitch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 19
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3egzA00
1WG4A 3ULHA 2MGZB 2XS2A 2DGOA 1JMTA 2CQ0A 1M90T 2B0GA 2MQMA 5IM0A 2MGZA 4YUDA 3MUVP 1M1KT 2KXNB 2MQLA 1YI2S 2DH8A 1VQMS 5ITHA 2DGVA 2FC9A 2UP1A 4PRFA 1FXLA 2ZJQQ 3NNHA 2HGLA 2DGUA 3L3CA 1U6FA 2RVJA 4ZKAA 3CC4S 3SDEA 2CQ3A 1X4GA 2M4MA 3P49B 2DGTA 3MDFA 4W90B 2DNMA 2GHPA 3G8SA 1JJHA 3G4SS 1VBXA 3RW6A 1WG1A 1WWHA 2DNPA 5MLCV 2M9KA 3UD3P 1X4BA 5LSOA 3G9CA 2KG0A 2L08A 2RS8A 3IRWP 3CXCR 2JX2A 2D9PA 3MOJB 2LXUA 1U1NA 2VOOA 2N7CA 2ZJRQ 2CPJA 3CCRS 2DNLA 1U1OA 2DGXA 1FT8A 1R8PA 1R8HA 2MQNA 1Q7YT 1H6KX 1NJIT 3MUTP 3CUNA 2YH0A 3VAJA 1YJWS 2LA4A 1VC6A 2RU3A 2QA4S 2N3OA 5JVGQ 3THTA 1OWXA 3VAGA 1U2FA 3PIPQ 1L3KA 3VAFA 2I2YA 1B7FA 1VBZA 1HL6A 2M2BA 2X1GA 3G8TA 1YJNS 1FHTA 2KRRA 2ZJPQ 3NS6A 3NNAA 1DRZA 2DNRA 2LA6A 2EK1A 1K9MT 4C7QA 2LECA 1PO6A 2KXFA 3P3DA 3J7YU 2MPUA 1CVJA 1D8ZA 1P1TA 2CQIA 3BO4A 1QVFR 2CQ1A 2AYBA 2XS5A 1VQ9S 3S7RA 4FXVA 5DDOC 2DHSA 1ZZNA 1VQKS 2M7SA 1WF0A 4WF9Q 2DIUA 3LPYA 3TYTA 2MZSA 4J5OA 2MKKA 2M52A 2DIVA 1ZH5A 2OJ3A 1UW4A 4A8XA 1DHMA 2F9JA 1VQLS 4QU7A 2KVIA 1O0PA 3S01A 5GAHU 1JJ4A 2G1DA 2KRBA 5EN1A 1X4HA 2M70A 1UFWA 3SXLA 2MKCA 1VQ8S 5DM6Q 2M88A 2MMYA 1YIJS 1BY9A 2N82B 3CD6S 2DNOA 3PIOQ 2LEBA 1VC5A 2XB2D 3NNCA 4CIOA 5JVHQ 1DBDA 2KT5A 2O3DA 1WI8A 1N88A 4WKRA 2KI2A 5GAGU 5CYJA 3BO2A 2J8AA 1WEXA 2MKHA 1YHQS 1U1LA 4CQ1A 3R1HA 1NU4A 5LXYA 3CCSS 2DH7A 2MY8A 2MQPA 2FHOB 2DISA 1S79A 2YWKA 4IOAQ 2LMIA 3G6ES 2MJUA 4M5DB 3UWTA 2CPXA 1WEYA 2K8GA 1YWXA 2KM8C 1VQ6S 1N54B 1X0FA 2CPDA 1VBYA 2HGNA 3CCLS 4QPTA 3G71S 4IOCQ 1M5PC 2DGQA 2L41A 1KOOA 2BZ2A 4Y0FA 2KG1A 3CULA 2MKIA 2ERRA 1N8RT 2LYVA 2OSRA 1XN9A 2DB1A 3CCES 4ERDA 1WHXA 2MJNA 4ED5A 2AYMA 3CMES 2ADCA 4TLQA 2LXIA 2CQ4A 2RUGA 4LJMA 2YH1A 2HYIB 4TU8A 3U1LA 3SMZA 1UP1A 2MSTA 3FEYB 2CQDA 5LJ3Y 4QU6A 1X4AA 2G0CA 2XNQA 2J76E 3CMAS 3VAMA 1FNXH 2VONA 4P6QA 4UY8T 2DHGA 5CA5A 3B4DA 3MD3A 3THPA 3I55S 2QFJA 2DGSA 1WHVA 4Z2XA 2QEXS 3NMRA 1A9NB 2CPFA 3UCGA 1OIAA 2MSSA 2F9DA 5FJ4A 3CCUS 5H1SV 5DDPC 2LKZA 5DETA 4OZ1A 3RW7A 2RQCA 2CPIA 1U1PA 3V4MA 1A7GE 2J0QD 1WHYA 2RS2A 1X4CA 4F26A 2CQCA 3VAIA 3P6YC 1X5PA 1FJCA 2DHXA 5DDRC 2KH9A 1G2EA 1X4EA 5GAEU 3DXBA 2CPHA 3VF0B 2AYGA 2KFYA 2RT3A 2CQPA 1U1QA 2DNNA 1X4FA 4OZ0A 4WFNQ 2NZ4A 2JWNA 4WIIA 3DLLQ 3EGZA 1RK8A 2KU7A 1K73T 3R1LA 2SXLA 1QM9A 4RU2A 2DO4A 2LEAA 1M5OC 3D2WA 1URNA 3TP2A 2MZTA 3US5A 2PEHA 2ADBA 3VALA 3CC2S 2VODA 3B4MA 1X5OA 1HD1A 3HHNB 2DK2A 2KHCA 5CXTA 1OPIA 4CH0S 4YB1P 2EVZA 2DNZA 2CQHA 3HI9A 4UQTA 2MXYA 2LCWA 5BJRA 3JB9k 2CPZA 2JRSA 2YKAA 1DZ5A 1WG5A 1RKJA 3TO8A 1P27B 2MKSA 3CTRA 3VAHA 3MUMP 2U2FA 4QQBA 1K8AT 5LXRA 1N52B 1Q82T 4Y00A 3SDEB 2DHAA 3BO3A 2CQ2A 3U1MA 1HA1A 2OTJS 2KM8B 1U6BA 1VQOS 3NS5A 2DNYA 3CF5Q 2K3KA 2AD9A 1Q86T 3I56S 1NO8A 2OTLS 3S8SA 2MZQA 5LSLA 1WEZA 3S6EA 2DITA 2JVRA 2WBRA 3H2UB 2DGWA 2FPHX 2RNEA 1WF1A 2KXHA 3BS9A 2FY1A 1KC8T 2MB0B 2FC8A 5D78A 5GADU 3MXHP 4YOEA 5IFMA 1WHWA 3K0JA 1WF2A 4IO9Q 2E5IA 3OW2R 3IWNC 3H2VE 1FJ7A 1H2TZ 3P5TL 5D77A 1M5KC 2RQ4A 1X4DA 2M8HA 4FXWA 1FO1A 1HD0A 2D9OA 5IM0B 2LQ5A 2U1AA 2RRBA 1VQ7S 1SJ3P 1U1MA 2YTCA 1Q81T 2M8DB 4PKDB 2DNKA 3VAKA 3G96A 3CC7S 1SJ4P 4WCEQ 1UAWA 2HVZA 2CPYA 2N3LA 2MQOA 2L9WA 3Q2SC 1YJ9S 2X1AA 2MZ1A 1SJRA 2OIHA 2CJKA 4IUFA 2MQQA 4C4WA 3R27A 1VQ4S 2CQGA 2X1FA 1U1KA 2NLWA 4WFAQ 2DNGA 4C0OC 1QVGR 2I38A 2MZJA 2DO0A 2KYXA 4W92B 1JJ2R 1SJFA 1VC0A 4TU9A 1WTBA 2EK6A 3UCUP 3Q2TC 3LQVA 1VQ5S 2AYEA 2KN4A 1H2UX 1S72S 3UE2A 2OSQA 5IQQA 2JVOA 1W2BR 3MD1A 2XNRA 3CCQS 2DNHA 1U1RA 3ZZZA 4WFBQ 2D3OR 1H2VZ 2BOPA 3ZZYA 2X1BA 1SXLA 2CPEA 2CQBA 3CCVS 1KOHA 1M5VC 2HGMA 1VQPS 5GVQA 3CCMS 2J0SD 3J7ZT 1SJQA 2DNQA 2E5GA 4F25A 3CCJS 1KQSR 2G4BA 5DDQC 2MZRA 2VOPA 1ZZFA 1WELA 4EGLA 3UCZP 2E5JA 5DM7Q 4PR6A 2MY7A 1F9FA 1VQNS 3BEGB 3MI7X 2E44A 1WI6A 2MKJA 5HL7Q 4CH1A 2RRAA 4V19X 1D9AA 2F3JA 4BS2A 5LJ5Y 3N9UC 1X5SA 2GO9A 1IQTA 2PE8A 1YITS 4LMZA 2M0GB 3UD4P 5HO4A 5GMKa 1YTYA 1X5TA 2MHNA 3EGNA 4U67Q 2HZCA 3MURP 2MYFA 2XSFA 2XS7A 3FEXB 1OO0B 2A3JA 1FJEB 1PGZA 2DH9A 2V94A 3CPWR 3EX7B 2E5HA 4TU7A 1AUDA 2Q79A 4LIRA 1KD1T 4F02A
chains in the Genus database with same CATH superfamily
4DV3F 4DPWA 4B3OA 2C2RA 1WG4A 1AYEA 1J27A 1B4SA 3FKBA 3ZZTA 4J9SA 1DTQB 1UEVA 3VQTA 2AJ0A 2Q6CA 3VVTA 4O3OA 3CB4A 4USWA 1SUQB 1M1HA 4DF8A 5KFPA 3DLJA 3C3LA 3W60A 5K8MA 2B0GA 4MK8A 2CVEA 2UV8G 4YUDA 1M1KT 3GE9A 4IFYA 2GZOA 3QWPA 4WBFA 2MQLA 3MM9A 1RTIA 1UEUA 3UI3A 1T8EA 2FC9A 2UP1A 2Q1LA 4UTGA 3Q83A 4B3MJ 4KKOA 5HLFA 3H7HB 3NGKA 3TAMB 2HGLA 4YMEA 2RVJA 1XTZA 3CC4S 1R0BG 2IJNA 1JLGB 3G8QA 2VFUA 3SBMA 4CTAB 2Z2ZA 5D0HA 2M4MA 4WE1B 2DGTA 4M5NA 5T7LB 3OTOF 4W90B 3I0RB 2FGOA 1MMNA 1Z4UA 2DNMA 2GHPA 5DQGA 2XM3A 2CRLA 1TFYA 2RB7A 4NYZA 4J9MA 2I8EA 1VBXA 4TKTA 4KBIA 3ZTQA 5KG5A 4QWEA 3EVOA 4RJVA 2R8GA 4RUBA 2JJ4D 4DV0F 4CNZA 5DGBA 5DG8A 4M5MA 1RDRA 1TELA 1Y11A 3AD8C 4ZVOB 4USJC 1N32J 2JX2A 3FZBA 1PAEX 4YEAA 3MEGA 3NGDA 2UVWA 2LXUA 2VOOA 3NAIA 4KJIA 2F1FA 2ZJRQ 4U7CA 2BKPA 4OYOA 2C22A 4ED8A 3D1OA 1UA1A 2DGXA 1FT8A 4Q8FA 2FB0A 1N5SA 5A8RB 2ZH5A 3RZAA 4GKKF 2VJUA 3M8SA 3NOGA 3DC2A 1Q7YT 1XNQF 2EPIA 4R25A 4DJBA 4O0IA 5M2RA 2CXEA 3J81Y 4EZ9A 1PJ7A 2DRDA 2YH0A 3GWCA 4IYQA 1S76D 2LA4A 4JUZA 3LP2A 2XHCA 3W63A 4TQSA 2RU3A 3GV8B 2QA4S 3CO9A 3TW0A 2YNHB 2CVIA 4W4MA 2GW8A 3Q0AA 4BLGA 1FE0A 2QLFB 4R0JA 3KK2B 3EZOA 1RT5B 1UMJA 4NA2A 1UJ5A 2DR6A 3SCKE 2P6TA 4DX5A 3GZ7A 3KG0A 1C1BB 2JOQA 4ZCMA 1IVZA 2G9OA 2X1GA 4OI6A 4LBHA 3BSCA 3OTEA 2H48B 1H7WA 2KRRA 3FCWA 3NNAA 2ZH6A 1QSSA 1K9MT 4FYXB 5ETKA 2WB1D 2GFFA 2LVWA 4F04B 1FCAA 3P3DA 4I2QB 2J9DA 4ZA1A 4C8ZA 1D8ZA 1QVFR 4P9SA 4IRKA 1F3VA 1IJFB 2CQ1A 4MKVA 4KV8B 5E3QA 5E3AA 4ZS6A 4MK9A 3CJ4A 3WQPA 5DDOC 2YKMA 4QWAA 3HZEA 3H4DA 1VQKS 3N0VA 4C11B 1JLEB 1DLOA 1GAOA 2YQ0A 3CNQP 3LPYA 3TYTA 4TY9A 1EKRA 5KFBA 2MKKA 4ID8A 2ZDPA 4LSLB 1DAXA 1TU0B 2ZH9A 1NJXA 1HBOA 1EB0A 4ETXA 3TAMA 1BC6A 2HFOA 3OSPA 2X51A 2CJ9A 1E6YB 2DRBA 3M8QB 1ELOA 4DU8A 3DLBA 1WC6A 4Q43A 3MEDB 4PCQA 4CZCA 1LWCA 3HHLB 4OV6A 3T1AA 5HMXA 3JAMY 2R8JA 3CIMA 4DZDA 2HQCA 4A8SA 4HH1A 4DX7A 3A3OB 4XAKA 3SCJE 1WKJA 5C2CA 2DXDA 2KRBA 3QGPA 3UNYA 3C19A 5K20B 5E33A 2A18A 5CABA 3Q8SB 1RT7B 2W7OA 3MM5B 4QCLA 1G4CA 4JV0A 3QRQA 4P52A 1LK7A 3F41A 2FY1A 2JC1A 2EFOA 1VQ8S 4I68A 4CM2A 5DM6Q 4X64J 3AJ2A 3KLGB 1N6QB 3U1NA 4DV5J 3KJNB 3NP5A 3D4JA 4LBPA 3UQSA 5GAEI 3M8RA 3N01A 1UVNA 4DV2F 1DURA 4FS1A 2DNOA 4QR0A 4CRJA 3I5AA 2LEBA 5AXLA 2XB2D 3NNCA 1Q8KA 3W2VA 4JI6F 2ZZNA 1DBDA 5C24B 2H4YB 3R7SB 3T41A 1PYSB 4WKRA 2ALZA 1R89A 2V4JB 3J7A1 4RUAA 4U8YA 4DSFA 4NZ7A 3H40A 1SC6A 1WEXA 2N4CA 2OFGX 3MF5A 4RO0A 3CCZA 4CYUB 1B0VA 3EICA 4QPXA 1RZMA 1FRJA 1FD2A 1WOSA 3CO0P 4JOUA 4XK8C 2IM3A 4CT8A 4IQMA 2D3UA 1IM6A 2DH7A 3ETOA 5KFUA 2MY8A 3GJSB 1RT3A 2B4UA 4E2FB 3PACA 4QYZK 1RT4B 2HPUA 4U95A 3BH6B 4ED3A 3QJJA 4NCAA 2LMIA 1F3FA 1HBMB 4L72B 4Q2LA 1JLAB 3CCWA 4CCHA 4ID5A 1PSDA 3TJ8A 1A6LA 3KKFA 1YX2A 4CNYA 4ED4A 4EU0A 2ABYA 2H5IB 2HAIA 4UOCA 4ZCLA 5A8WB 5L38A 3FVYA 1N54B 2VASA 4ID5B 4K7QA 2VG7B 1VQ6S 5KFAA 1VBYA 2DCUB 3OL9A 3PYFA 2I5JA 2E1MC 5KOXA 1U47A 1LWXA 5D4PA 1BE4A 2NYHA 3QSIA 4M5JA 5DS7A 3THVA 3T1YF 3W8GA 4PWDA 2YPZA 2CYYA 3CW2C 4BWMA 5M2PA 2CADA 4ED1A 2NYIA 2GAHC 3IP0A 4AL7A 2YWWA 2BZ2A 2PMHA 2RMLA 1FTRA 5ETTA 3M32B 5BYRA 2NS1B 4A8OA 1NEEA 2A0FB 2MKIA 1F6TA 2BJ8A 2HNDB 2OSRA 3V6JA 3RR8A 2BJDA 5HMYA 5B0BA 3CCES 1Q8IA 5JJBA 3EWGA 1F9EB 4ED5A 2AYMA 4TLQA 2LXIA 2RUGA 3H98A 4F7VA 3A8KA 1S99A 1RAEB 3CJRA 3H5SA 3CGIA 3Q89A 4OYPA 4Y2IA 3NGRA 1KS2A 4R0EA 2VZ9A 1QUPA 2M5YA 1RTDB 2CQDA 1OQ6A 3M30B 3OUYA 1HWUA 2ZC4A 1V5IB 1TKZA 1RU2A 4UY8T 2DHGA 2YX7A 2VDHA 3B4DA 4N47A 2L48A 3LGHA 2RDJA 5KFJA 2ZVIA 3TAQA 1U4BA 1KSPA 3RR7A 2HRYA 2B5JB 3R2DJ 1A9NB 3RB3A 2QSWA 2CPFA 4ECTA 2CWKA 1OIAA 2FD2A 3MM8B 4L74A 5HI7A 5L9XA 4ED7A 3CCUS 3FMWA 1HFEL 2JH3A 2FJWA 4Q8EA 4RPFA 1NM2A 3PO4A 4AUKA 5H1SV 2XY6A 2KVQE 1YJ7A 2V67A 4IFYB 3B54A 3RBDA 3HF5A 5DETA 4OZ1A 4WFZA 3RW7A 4JI2F 4HLBA 2BE2B 5IV4A 5A6PA 4ED0A 4ZIWA 3D1QA 4YQWA 3ENWA 4DV1F 1QAJA 2B51A 2QMXA 2NZCA 2RS2A 2H3EB 2BANA 2YWFA 3OTCA 4WK3A 1RWPB 4UQGA 1JWWA 1BQMB 4DEZA 4KR0B 4R5PB 4ZHRB 1X5PA 3W9HA 4RW4A 3VAIA 5DGAA 3TJ9A 3P6YC 3NGTA 2VG5B 2DEJA 2QLXA 2Z56B 3QIPB 3W65A 1X4EA 2KH9A 2R2RA 1YLXA 3DXBA 4MYUA 2IFXA 2KFYA 2J7WA 2GO8A 2RT3A 3M2RA 1UETA 2VG5A 2D74B 4CI0B 2CDQA 3MR7A 4R5PA 2LDIA 2Y8YA 1S49A 2HFUA 4I6AA 1F9HA 4WIIA 3H2LA 2VQEF 1RK8A 3TZXA 2KU7A 3MFIA 5L8RC 2VF3A 2HHTA 2GVDB 2OKQA 2W2QP 1QM9A 4UOHA 5FDLA 2N7YA 4G1QA 1VIXA 3D68A 1M5OC 3TP2A 3FZ2A 2MZTA 2OI2A 2NPFA 3US5A 2E5LF 4DUYF 1NPKA 3ITHA 3D0IE 4DLEA 3V6HA 4B9UA 3IS9B 4ZK7M 2VODA 1LKZA 4DUTA 1X5OA 3EXYA 2AGOA 2DK2A 3IC1A 3CE8A 2KHCA 5CXTA 4CH0S 3N6MA 1GT8A 5AJ3F 2WW4A 4IH7A 1SQGA 3D3CJ 2MXYA 2CQHA 3TRGA 4CLTA 4DSJA 3UD5A 1H74A 2IY5B 3TQEA 5A6WA 4IG0A 3MPWA 3AODA 4LFCF 3FRYA 2Y8WA 5F41A 3E01A 1RKJA 1HNWJ 3TO8A 3ZTRA 4CLLA 1RCXB 1MG7A 4QQBA 4JI4F 2B6AA 5LXRA 1Q82T 4XDDA 4Y00A 1HMVA 1HNIA 2Y1LB 3DYAB 3SDEB 1CEZA 5ETOA 3IAS9 1SPBP 3SV3A 4NXMF 3IBFB 4DL4A 1HA1A 2W25A 3ISND 3JTNA 1FXDA 1IKVA 5HANA 3C16B 4ZCIA 3KJQB 2BE7D 3K5PA 1NDCA 1VQOS 1K1QA 2HSEB 4ICLA 4U7UD 2DNYA 2W01A 3EJMA 3ISNC 3T9NA 4DCJB 3CF5Q 3BB5A 2R9LA 1XC9A 1HBNB 1NZAA 2AD9A 1S6OA 2F40A 1Q86T 2OTLS 3PY8A 1Q53A 4ICLB 1SKUB 3CCTA 2QO3A 5ETRA 1WEZA 3S6EA 5HVHA 1EQMA 2YNHA 4DLGA 2QGFB 3C46A 2ZNYA 5B0DA 4OZ3A 3AY0A 3PR4A 4LVOP 4B9NA 1FNOA 5KG3A 1OYEA 2DTJA 2HURA 2RNEA 1KFDA 3BPSP 4HACA 4NI2A 5B0FA 1RAIB 3H25A 5E0OA 3C15B 5L1IA 1NCLA 4DL3A 2FC8A 4ZMMA 4DQIA 1RTDA 1Y5NB 1FRLA 2R7OA 1ULRA 2XSJB 1XMQJ 4ZJQA 1NKBA 1S1VA 1H38A 3MXHP 2V2VA 5KAKA 4YFUA 1SVDA 3OR1A 1V3SA 3K7RA 5HROA 3K0JA 4IO9Q 2KHDA 5DO2A 2V4RA 3PYEA 4L75A 4DFJA 2BKNA 5L1LA 1TL3A 3DRRB 2P5VA 4O4RA 4PAAA 2ZWPA 3OW2R 1FKOB 1HNZF 3H2VE 4ECZA 4DR2F 1TK5A 1NLKL 3DRXA 1ZA2B 3BKTA 3H5YA 4W98A 2Q43A 4Q7AA 1FKOA 3FUYA 4JV2A 4QIEA 3PV8A 1LWFB 1JXVA 3ILIA 1UVMA 1LXNA 1REGX 2KZMA 1CJUA 1OYDA 1F0XA 4DR4F 1G1XA 2WOMB 5KFTA 2EKNA 3MPUB 3ILOA 3M05A 1U1MA 2M8DB 1DQ8A 2ASDA 2B9EA 1YJTA 3D66A 1MROB 2DNKA 4OJ1A 3T9ZA 2A10A 4MKAA 4N7TA 3VAKA 2QYCA 5E41A 1N5QA 4X4QA 2H4WB 1SCJB 3H90A 3O2IA 2DT9A 5KFMA 1ZTWA 3OD2A 4Y2AA 4WCEQ 3NLCA 1DQ9A 2YQ1A 2ASYA 2FDNA 4KKOB 5CCLA 4F4XA 1M5SA 5HLFB 4KHMA 1YJ9S 4OHYA 2F63A 4LSZB 4Y28C 4BBYA 4LF7J 4OLOA 2NSCA 3MM9B 1Q1KA 1WC1A 3EMTA 4U8VA 1FE4A 1KP6A 2XI3A 4O3QA 2BUNA 3GG1A 2HS4A 2VU5A 2PSZA 1VJWA 9ATCB 2B4PA 4UY85 2Y9HA 1RT6A 2JZ5A 2MQQA 1VIOA 3IA0A 1TKXB 2CQGA 1VQ4S 2D7SA 4ECVA 1PBUA 4NXMJ 4NA3A 2MZJA 1UVLA 3MCOA 4EO8A 4LRCA 4KSEB 3NBPB 3AQOA 4RBUA 3TZYA 1YJVA 2ACMA 1JLFA 2KYXA 4EMDA 4XO0A 3MPDA 3N6LA 4JI5J 2F5GA 3FBBA 3QAEA 4LBIA 2YNFA 2J6TA 1WTBA 2CZ4A 5JMNA 1T0TV 1JLAA 4ZP9A 4WPAA 3UCUP 2EBEA 1C0UB 4LFBJ 5D4NA 3DGPA 3MMCB 3WBZA 2ASLA 5KFGA 4FPIA 3PRBA 1LWEB 4DPYA 1FX2A 2OSQA 4C3LA 2UXCF 3OFGA 3UVJA 5EHHA 2R7RA 3RRHA 1X7VA 3ZZOA 1N0UA 1CQNA 4CLSA 2C2KB 1X8DA 4DUYJ 2AV5A 2GJIA 3TARA 3NWRA 8AT1B 3R5BA 4HEA9 2D3OR 1H2VZ 1MU2B 1YRTA 2ZE2B 3DN9A 4NCGA 5CH7B 2EFGA 3TUJC 1Q5VA 1PBAA 2X1BA 3ZZYA 6AT1B 4M8LA 5C25B 3BDPA 1KDNA 3EPGA 3R3TA 2CNKB 1VQPS 2KJVA 4PUOB 2J0SD 4C3KA 3SCIE 3M9OB 3WC2A 1WC0A 1FERA 3CVKA 3KK2A 2NQPA 4HI1A 2NXUA 3MCMA 3AJ1A 1WD6A 1ZM9A 3MEEB 2RHSB 4WFXA 4F25A 5A0YB 5J1PA 4EBDA 1TKTB 3OXGA 3T3FA 3MCNA 4Q0BB 1FDNA 2DPIA 4NE9C 1N34J 1ZZFA 2W4CA 1KHVA 1ZAVA 1PYOB 2QLJB 4M5LA 4OHVA 1WELA 3RGIA 1VMBA 3WDOA 5HQLA 1NK6A 3JYTA 5I3QA 3UCZP 1T9TA 4LFAJ 4B3RF 2ZM6J 1JLQB 1VQNS 1BQMA 1IXKA 3K8WA 1S7HA 3MI7X 3QO9A 4LF5J 1YBTA 1IR2A 2E44A 4OZ5A 2MKJA 3RRKA 5KFRA 3P8BB 3ZTPA 4I7FA 3HLUA 4CH1A 1F5AA 3MAQA 2PMWA 2Z58B 3HX9A 4I6YA 3ENAA 1YIJS 3T5JA 4RBTA 4HH0A 2ZVSA 3HKWA 4WP3A 4X4SA 4DV6F 2BEFA 2B8PA 4BS2A 5KG6A 3GYGA 5IWAJ 3N9UC 2GO9A 2L9NA 4DHVA 1PILA 2UVVA 2FY8A 2VL1A 5KFVA 1CSJA 1MN9A 1HWIA 1T11A 2R3VA 5HO4A 3GYXB 3DRRA 1ACMB 1X5TA 3FQKA 4H4KC 4BWJA 2GIRA 4B17A 4AQYF 1IM4A 3EGNA 3IMQJ 2DCLA 3ZZ0A 4U67Q 1WDTA 2G13A 1UZDA 2LQ8A 2MYFA 2V8VA 3SIPB 3OSNA 4RKUC 2E5LJ 2C3OA 1GXLA 1OO0B 2A3JA 2P2CB 2ATCB 3ZTSA 5F8JA 2DH9A 3FSIA 3M9MB 1IR1A 1F2HA 4KO0B 5BR8J 4J9NA 2Q3PA 3EX7B 4DL6A 4C8OA 3QRPA 1KTQA 3LWMA 1IQZA 3W5YA 3JYTB 1XMQF 4EO6A 1TL5A 3N28A 3ULHA 4PG4A 1J5EJ 3RYLA 1H72C 1T95A 2GQ2A 2V50A 4DL0C 4D3HA 2AEMA 3ZFVA 2LLZA 4E98A 4X62J 2ASJA 2G2ZA 4FPRA 3RTVA 1M90T 4J9KA 2CQ0A 1EIYB 4JP8A 4LFCJ 3GFXA 3VHQA 1KQGB 3MAAB 4KTQA 4KGXB 5IM0A 1GMUA 3MUVP 1NDPA 3GIRA 4MTPA 1IKVB 2HHPA 5KFIA 2YNIB 3J81U 4LSNB 2KXNB 1FDBA 4RNMA 4DV7J 2DH8A 4ZVEA 1FFSB 3FSXA 4RZRA 1VQMS 2DGVA 5BYQA 1XK8A 2VQFF 4ECUA 4PRFA 3FFIB 1AUSL 2EW9A 2FYXA 3DOLA 1UJ6A 3KLHA 2ZJQQ 3UFCX 8ATCB 3W7BA 4JI3J 2DYAA 4LUBA 1U6FA 1QD1A 4GC7A 1HMVB 3DYAA 3SDEA 1L3SA 1PC4A 1PIEA 2QLWA 2ZBIA 3MDFA 3D6TB 4RLEA 1CC7A 4I67A 1RE1B 3G8SA 3DHXA 1JJHA 4CH7A 3G4SS 4XTTA 2XYGB 1WG1A 2DNPA 4ZPAA 4DZ6A 5MLCV 2JNJA 2M9KA 4CP5A 2ROGA 4LF5F 1U2RA 1RWUA 4P75A 4X62F 1RTIB 2V8HA 1OSDA 3OXFA 1I3OB 2FTRA 4IFVB 2XY7A 1N4LA 3DU5A 2WSCC 3V4IB 1H7XA 4P74A 3GCXP 4KPCA 1U1NA 2N7CA 1QAIA 5D6GA 2HNYA 4YR3A 3ONQA 1NAQA 5ETSA 1CBKA 4JYAJ 2CPJA 2JDJA 2B7BB 2DNLA 2UUAF 3MAAA 1RI7A 3I0RA 4HDHA 1U1OA 1R8PA 3AJDA 1IBKF 1CULB 1S9FA 5CZXA 1R8HA 2BV3A 3RB4A 3IM8A 4S0MA 1NH7A 1RKIA 4RW6A 2HVIA 3BZQA 3PDNA 4HHHA 1R27B 1HHSA 2C42A 3QMQA 1O8BA 3J7AN 2NSBA 3MEEA 2QLBB 3I9V9 1KQFB 2N3OA 2IVFB 2XMTA 1U2FA 4K4SA 3V5RA 1EETA 3QT6A 2UXCJ 1L3KA 1U0SA 5DZ6A 2J8SA 1U26A 1NSPA 1IKWB 2H51B 2W2MP 2I2YA 4MJKA 3PM9A 3J7Z5 1FEEA 1LWCB 1Y3JA 3CD0A 5CYMA 5LMNJ 5H9EJ 2PI5A 4LQ3A 1YJNS 1FHTA 1FVQA 1JXEA 3BBBA 1GNKA 1HBUB 2ZJPQ 3PRVA 1LWFA 5BR8F 2LA6A 4OX6A 1VFJA 3TEGA 4IFVA 3QSYB 3OFHA 2AJQA 1OMSA 1QUVA 1XQIA 3BQ1A 1YKWA 1P1TA 1LQ9A 3CJTA 2R7QA 3QRRA 5ETMA 4C11A 2AYBA 2XTJP 3M2VB 3M9NB 3HHLD 3NGSA 3VTIA 4CO4A 4F8RA 1HW9A 1VQ9S 1LW0A 1RTJB 5H9FK 4DPTA 4KO0A 3ET6A 4RR5A 4ZCKA 2WONB 1RWNB 2DHSA 3FEZA 3HKZD 3OR1B 5KTQA 2MEWA 3OFEA 1ZZNA 2V9WA 1YJUA 5LL6d 2IVMA 3DOKA 4Y6IA 1VBKA 2K1RB 1U49A 2IC3B 1UZHA 5EWEA 4LF7F 1T02A 2DIVA 2XEXA 3A8JA 2WVBA 5D15A 1ZH5A 1HWJA 4CT9A 5DLFA 1YRUA 3HVTA 3AXKA 2KO1A 5U47A 3K5MA 3E51A 1VQLS 3G6VA 4MFBB 1O0PA 2W7AA 2AEJA 3DMJB 4OJHA 3UN5A 4K4XA 1R8CA 4IO1A 1UJ4A 3M32A 2XO6A 4X4UA 3FMBA 2YBVA 2G1DA 2GGPA 2V8PA 3CD7A 4KHPJ 1NHVA 1R8AA 3Q24A 5KFKA 4HDGA 2VBZA 4EYIB 3DM2B 3DNCA 5LM7E 3O1LA 2MLZA 4I7FB 1HR0F 2XGPA 1RT1B 1SUQA 3FK4A 2OPSB 4A8QA 2J0XA 1KLMA 1VQSA 1XERA 2AX1A 2VB6A 2HBQB 3C8YA 3D67A 4HTJA 1K44A 3GONA 1CPZA 3T19A 1HQEA 4K4YA 4LF9J 2M88A 4DR2J 1KLMB 2POKA 1CLFA 2ZKTA 3JSMA 2Y0SD 3S1TA 1RT1A 3LW5C 1HQUA 5DJBA 4PXBA 2ZOFA 3A3NB 2XCAA 1LW0B 4NLWA 5HVFA 3KJVB 5J2PA 3LP0A 5AXMA 4CIOA 2VIHA 1XEZA 4PXCA 1C0UA 2O3DA 2B43A 1WI8A 3JQJA 1N88A 2QL9B 4ANDA 4DPUA 2KI2A 4IG0B 5GAGU 3PVXA 4DSIA 5LSRA 3HVAA 2RQKA 4RWXA 4CYUA 2BR0A 2QX0A 2R7VA 1JLFB 1FWPA 2MKHA 1YHQS 4GVBA 1NK5A 1NUEA 4Y3CA 3EM1A 3IS9A 3SV4A 3PW0A 1WUUA 3CCSS 3BM7A 3ITHB 2DR8A 1X9WA 4KH1B 4C8MA 1MSWD 2QA1A 3W2VB 4B9SA 2IMOA 5D0GA 2EFNA 2D3ZA 4OLPA 4WE1A 4N56A 4RW7A 3W62A 1RAHB 4FKYA 1Y00A 1HI8A 1Y4ZB 1RA6A 3QQCD 3G6ES 1HWKA 2VFRA 4OFZA 5ETVA 4QWBA 4B3MF 3OJUA 1IKXB 3UWTA 2HMIA 3I9ZA 3M6VA 1WEYA 2F4VF 4OQJA 3ZO7A 5L1JA 3HP6A 2K8GA 1YWXA 2RQMA 3TUIC 2GHVC 2CPDA 3PR5B 2BXJA 1HNXF 4IR1A 5SZTA 3IG1A 4FZVA 3VGSA 2HGNA 1QSYA 1WSVA 1AW0A 1EAYC 2D1CA 2KT2A 4QPTA 1VRQC 1RBLA 1X0PA 2H5EA 4N8OA 3FCVA 2CJXB 4UW2A 3J80U 4FF3A 2E1AA 3LO3A 4Y34A 1M5PC 4K50A 1YK9A 4Y0FA 4N8NA 3RBXA 5I3PA 1YZ7A 2BABA 4L3KA 1B0TA 3OLBA 1DTQA 3KLFB 3KK1A 2YQ3A 4UOFA 2ERRA 4BC9A 1C4CA 4EEYA 1UL3A 2LYVA 2OPPB 1N8RT 1TV6B 1MWQA 3HFZB 1CC8A 4A4JA 2AMCB 2JL9A 1WHXA 3NMAA 4ERDA 4I6WA 1AFIA 4ANCA 1JNZB 3A3PB 5F8MA 3CMES 4V1Ak 2CQ4A 3GFHA 1K47A 4B9LA 2YH1A 5KFNA 1QLNA 1HBOB 2HYIB 3QLHB 3I4HX 3G6YA 5KFOA 1N5YB 3SMZA 1FRMA 1UP1A 2MSTA 4ZVQB 5HK4A 3FEYB 3NOCA 2UUAJ 3VAMA 2FJDB 4ZJLA 2H9ZA 4P6QA 2XSJA 3RU0A 1NK8A 5CA5A 3OXLA 3BBFA 3CJKB 1W7WA 2H54B 7AT1B 2ZHBA 2QFJA 3GJRB 5L1KA 2QEXS 4LF9F 1VRTB 3NGUA 3QGGA 3K57A 4C8YA 2NUHA 3MR2A 2NR0A 3CCJS 2PO4A 1V3ZA 3L95X 2BM1A 4J9QA 2G0IA 2HEKA 5DZ7A 3PW4A 5DDPC 2HVEA 2ZUGA 1SH0A 2RQCA 3QAUA 3UNGC 4EFAC 3SQOP 2CPIA 4ZPTR 1U1PA 1FKAF 2L3MA 3BDEA 3V4MA 4CLKA 4F0KA 4LIWA 1S59A 1WHYA 3KXDA 1S0MA 2BJ9A 5KOWA 3FDSA 4MFBA 4BCAA 4H4OB 4WXWA 2E9TA 4DUZJ 4IOBA 1LV5A 4J9LA 2PDAA 1BQNA 2AGPA 3HVRA 2BVZA 3R7NB 5KFLA 4K8RA 2XZWA 5GAEU 3ZNJ1 3HM9A 1NKEA 3BGRB 1P1LA 1HQEB 1RTHB 5AJ3J 1U09A 3TI0A 2A1BA 5D0RA 4C6AA 1TFWA 3EYZA 1EP4A 3SYZA 1I94J 1Q4RA 1QSLA 4OZ0A 5KFDA 4UZCA 3GILA 4H4OA 4K2JA 2W2OP 2JEIA 2PFDA 4ZVRB 1R6VA 3EGZA 1VDHA 2C3PA 4KFBA 1L5UA 1XNQJ 2GS8A 2SXLA 1CJUB 4F3OA 4GKKJ 2IAJA 4KRWA 5F8NA 1YDLA 2ZD1A 4AE5A 4GRSA 4OMFG 2VPWB 1TUWA 1LEOA 1Y10A 1NK9A 3MEGB 4GKJJ 4PWWA 2Y1JA 1HD1A 2RDIA 2FLOA 3HHNB 2BBEA 1ZM2A 3QGHA 5AT1B 5F3TA 3BBCA 4O0NA 3SSRA 5EWFA 5CD4A 2EVZA 2DNZA 3HI9A 1F2GA 3GMGA 3I0SB 3IR7B 3M6WA 3OHAA 4ELVA 2QIFA 2LCWA 3IRXB 1RT2A 2MQ8A 4U7UK 1WG5A 4KGMA 4ZN3A 4KAIA 4CO1A 2DR7A 2FLLA 4A8KA 2FHJD 2VQFJ 3MUMP 5KFCA 2U2FA 2BM0A 4HR2A 2HK2A 2XMMA 2GMLA 3M8ZA 4HHUA 4M5IA 3UDEA 1K8AT 3UW1A 2FZGB 3I0SA 4V19J 4DR1J 5B09A 2DHAA 2KT3A 1NJZA 2VBXA 3GJTB 2RH3A 4OHZA 3W5ZA 2EWHA 5MAOA 2ZWOA 5GMEA 2WW8A 1OPZA 2DD8S 3Q8PB 3IN5A 1DJ0A 4TN2A 3E8OA 3OJSA 2IBKA 2FZKB 4F4KA 1HYSA 1CULA 1U6BA 2J6UA 1U0HA 3F0NA 1JX4A 5E2QA 3PKYA 5CYMB 4LF6J 3SSSA 4X4VA 1RAJA 1UW9A 2GVDA 1XR7A 2VHGA 4I69A 1EKSA 5F8HA 1NO8A 4RNFA 1KWMA 2MZQA 5LSLA 3D6MB 5C7PA 3VGVA 3LAMA 3MR3A 2JVRA 4CLWA 4EZ6A 1UVJA 1T9YA 2YKQA 5FLXY 2LU2A 3UDCA 3H2UB 4LQ9A 2DGWA 4AXIA 3M4XA 4F0HA 2E9RX 1R43A 1N6QA 4UF4A 3W5XA 1RYRA 1IWGA 1RYSA 2LQJA 3M2UA 5GADU 1N5YA 4P2XA 4PABA 2IM1A 1JLEA 1GTHA 1R7IA 4RW9A 4YOEA 2UUTA 3TX0A 1WHWA 4DSKA 1PJ6A 1T7PA 4L73A 3AFGA 2E5IA 4JI0J 3EGVA 3MECA 2QMWA 1U02A 2WHOA 3CIZA 3DI6B 4FVMA 2YX1A 2V2KA 1SV5A 2QYGA 2EKYA 3L9ZA 1FJ7A 4DV5F 3KMQA 1S9EA 3P5TL 3W2WB 3WC0A 4ECRA 2HWIA 4F36A 4X4PA 2O66A 3V6DA 4A8WA 1Q78A 2M8HA 4DUZF 1FX4A 4F4ZA 2V8GA 1W25A 2BRKA 2VKRA 1FO1A 4ZVFA 1HD0A 5IM0B 3FGVA 2LQ5A 2QV6A 2U1AA 4I56A 5E7OB 2ZM6F 2AP6A 2KYZA 1FTCA 1M1GA 1SJ3P 2EBGA 1ZAXA 5HATA 2ZZMA 4JI3F 2R7XA 4PKDB 4M5KA 3GR1A 2IHR1 2W8KA 4ZVGA 1S1WB 4FF2A 3CJQA 1LFWA 5C2GA 4J9RA 2Y0BB 2OD4A 1RBOB 4J9VA 2GVZA 5SUHA 1SJ4P 3SQGA 1LOUA 1UAWA 4GKJF 3T1HJ 4M94A 3A12A 4DS4A 4LT6A 3Q2SC 3TWZA 2NPIA 4X66F 4ZHRA 2X1AA 4RUHA 5D4LA 1T03A 1KONA 3K5LA 5J2QA 2OIHA 5BYSA 4DX8H 2BJ3A 4TXSA 1TVRA 2Z4PA 3D9BA 4C4WA 3R27A 1CJTB 1RHJB 3H42A 3IWXA 4LRAA 2E7XA 4P2FA 4WFAQ 1OJ4A 1VISA 4MT1A 4YR2A 2I38A 4EBEA 3NL0A 1ZETA 4RNHA 4LF8F 2IA0A 1RSCA 3GFZA 3HVTB 1JJ2R 2C2OB 2ZFHA 4GVLA 1UWAA 4TU9A 2B9XA 2I0XA 1HPZA 3JQMA 4C48A 3CJSA 1P9YA 3EE3A 4DPOA 3RAQA 4FP9A 4MIBA 2EFPA 4Q2MA 5ADZA 1S7IA 3K17A 1H2UX 4OX8A 5GADI 2ZBCA 1GX5A 1WORA 4OZ2A 1R3NA 4H4MB 2WVCA 5IQQA 2JVOA 1JLQA 3WIVA 1RT4A 4YS2A 1ZYQA 4NLGA 3MAHA 2P6SA 3IBCB 5T41A 4EK2A 1YRXA 2IBOA 3FSYA 1U1RA 4B3RJ 4ALZA 3ZZZA 3TQ1A 4WZMA 2NXJA 2XLJA 2G0JA 4C0BA 2ZUAA 3N5BA 1Q8LA 2HS3A 2BOPA 2IRXA 1SXLA 4X4OA 2E66A 4ZOSA 3DDNA 2CPEA 3DLHA 1AFJA 3TVZA 2W4PA 3CCVS 1M5VC 1VC6A 3KUHA 1QTNB 5KT2A 3CCMS 3J7ZT 5B0CA 3OR2A 2DNQA 2E5GA 4G65A 4F4YA 4PWDB 5C24A 1RTZA 1XJWB 4A46A 5I4MA 1S1VB 1KQSR 3TAPA 2G4BA 4DV6J 1H98A 2MZRA 2YWEA 4YB7A 1UFLA 1D0EA 2VOPA 1Y7PA 3D7SB 4JBCA 4DR5F 3KLIB 4EGLA 5DM7Q 1N5VA 4PR6A 4ECQA 1F9FA 2B7CB 3ET6B 5DQIA 2GIFA 3NS7B 4URGA 3KLEB 5HL7Q 4DFPA 2BJ1A 2QL7B 1TMMA 3CJ0A 2FVQA 2OPRA 1Q95G 2RRAA 4DU7A 5F0WA 4AL6A 4MMOA 2ACYA 4G6VB 4OHXA 5K9FA 4CO0A 4HKQA 3Q8RB 5LJ5Y 1D9FA 3BKFA 2UVUA 2ZOMA 1HBUA 1V6HA 4YDDB 1FEHA 1IQTA 2P8IA 2P9GA 1S9EB 2PE8A 1U2CA 3W2WA 1YITS 2WVFA 2O5DA 5KG1A 4K2XA 4I64A 1C0TA 2AIRB 2R7SA 3HZGA 2HHQA 4FBTA 5KFEA 2IC3A 3ZNUA 1YTYA 5I3UB 4TVAB 2FVCA 3AT1B 2GMHA 3V81A 3HK2A 3I5BA 3NXZA 1HI0P 1AXQA 3M8PA 4H54A 2HZCA 3VGUA 3MURP 1IR0A 1REVB 2XS7A 3FEXB 3H59A 1GTEA 4NEZA 4NX9A 4RUCA 3EXCX 1PGZA 4Y2CA 4YDXA 3HJFA 2VD3A 3QZ8A 3IWLA 1ICEB 2V94A 2DVIA 3A13A 3R5DA 3JXOA 1YJRA 3LP2B 2HFNA 3DLKB 4KV8A 3QT8A 1IKYA 2Q79A 2ALYB 1UTAA 1RGVA 3RG6A 4TU7A 3HSZA 4HI2A 3KLIA 3NY0A 1JK9B 4I1TA 3EVMA 2N4DA 3G2XA 3POTB 4ES1A 3OBIA 4FF4A 2XS2A 1NSAA 3RRGA 1KN6A 4G1QB 2DGOA 2BE2A 2WOMA 2AEFA 2ZITA 1V3RA 3AD7C 5C42A 1C1CA 3WX8A 1RT6B 4JI0F 3V4IA 4NXNF 5IT9U 5G0RB 3ELHA 4NLTA 4F67A 3BV8A 3HHLA 4L76A 2HHHF 2XCPA 1S1TA 3PJXA 2BMBA 4CLPA 2J7KA 5ETPA 5ITHA 3PW7A 2EG1A 3OL8A 1FXLA 3W8PA 5J2MB 3LOUA 4HL9A 4NLPA 4M5DA 4QWCA 3NNHA 4P10A 4FF1A 5HBMB 3L3CA 3AOAA 3Q8YA 5EWGA 1NH8A 2HLTA 1OY8A 2CQ3A 3R7BB 4M63A 1X4GA 1VR6A 1EARA 5A2QY 2QA2A 3R8YA 3P49B 3ENQA 2HQFA 3ADAC 4EI2A 2XULA 3PEHA 1DFDA 1MMDA 5A2QU 4N76A 2FJXA 1P6TA 4CM0A 2HNZA 4AD6A 5F8LA 1KHWA 1WWHA 4FNIA 5GMDA 3UD3P 1Q16B 4USIA 4C2MA 5LSOA 2UXBJ 1ZA1B 3CSKA 3KUEA 2KG0A 4B3SJ 3G9CA 1S5ZA 5J2NA 4IDKA 2L08A 1RJJA 2BRLA 1G7CB 3DHWC 1EX8A 2AZ3A 1JB0C 2K7KA 3D1HA 2D9PA 3MOJB 4C8LA 1B64A 2GMJA 2A6OA 3OTOJ 2W9BB 3I96A 4BC7A 5KFHA 3CCRS 1K0VA 4LF4F 4OX9J 2XMAA 4C3MA 1RU1A 3TVYA 2LU1A 1U6ZA 2AWZA 2CKWA 4FYDA 4P7TA 4K4UA 4TY8B 2Z0GA 1HNZJ 1FD8A 1GFWB 2HG4A 3OQ2A 4NYPA 2X3GA 3D6FB 2E1RA 3R5CA 1VI7A 4FN5A 1VLYA 2HVDA 1AB8A 4HACB 3FFIA 4ETZA 4OYBA 3MUTP 3CUNA 3OV7A 3JAMU 2BYCA 4IRCA 1HBMA 3O44A 1O51A 1TKTA 3N5FA 4TY8A 1E6VA 1OWXA 2AHOB 3THTA 3M6XA 4BHQA 4ZLLA 5DLGA 5KG2A 3RB6A 2FVRA 4JI4J 4JI7F 2AJFE 3KLVA 1PAUB 3QFWA 3VAFA 2XMJA 2OD6A 3H5XA 1D09B 1IBMJ 1S6PA 3FQLA 2PT0A 5C5JA 1B7FA 4URSA 1CS4B 1HL6A 3C14B 5KT4A 3OHBA 2PGCA 4NCBA 5KFQA 4QYZJ 1TL7B 3ZC4A 1S6QB 1TZ0A 4LRDA 2DR9A 3NS6A 3KWMA 2ZE2A 1FJGF 3HHDA 2DNRA 4EBCA 2I5JB 2EK1A 4DWIA 2Y1RI 3HDSA 4C7QA 2F7VA 3OT9A 4NL5A 2LECA 1X31C 3J7YU 1S0VA 2MPUA 1AZSA 2CIMA 3NKYA 1P9QC 2CQIA 3BN4A 4YB6A 4HYKA 2HIYA 3VQSA 2D3O1 1IBKJ 1V5VA 4OX7A 5THWA 2XS5A 3JQKA 3S7RA 2OH2A 2RF2A 5J1NA 1FDDA 2CZ9A 1WF0A 2E7VA 4WF9Q 2MZSA 5LMUJ 1WSRA 1S9GB 1J5OA 2ZBQA 4OYMA 4U9RA 3RUBL 2B56A 2HLUA 3B6BA 4DR3F 2CG4A 1FKPA 1S48A 3B78A 2OJ3A 1HHQA 1SB6A 1UW4A 4F4AA 3QIPA 1L3UA 2JLEA 2EC0A 2HHVA 3TANA 4A8XA 2F9JA 2WB4A 2HWTA 4RL1A 1TV6A 2YKNA 3R5GA 3RBEA 4QU7A 2KVIA 4KY3A 2F8MA 4RWWA 3S01A 3KNGA 1R8BA 1SH2A 2JLGA 2DBBA 5EUHA 3HO1A 2R7TA 3GIJA 3KK1B 1TKXA 4Y2KA 4J9UE 2DHHA 1EJ7L 4X4TA 1TK0A 1JJ4A 5EN1A 3GTYX 5ETLA 2C28A 3FBFA 3JTOA 1MU2A 1NB7A 1ZTTA 1AROP 2VV5A 2K7JA 2YKNB 4J7CA 2OPRB 2WTFA 1RBAA 2M70A 3BN7A 2CJQA 1UFWA 4NLRA 3SXLA 2FLNA 1NNDA 5IWAF 3PX0A 1E6YA 3UN2A 4OYWA 3DLGA 3DRYA 2DY1A 1HKAA 2CNOB 3UN3A 1SL2A 1M0SA 4ZVUB 2MMYA 4O3NA 1MLAA 2HRUA 1VLOA 2EG2A 2IJFA 1BY9A 4KIAA 4NYOA 2W2PP 2CFXA 4USKA 4RX6A 2CA9A 2N82B 4DQRA 1RCOB 3CD6S 1N36J 4NLDA 2NXEA 1G6BA 1ZPWX 3PIOQ 3Q8QB 1VC5A 4TYBA 3VR1A 2HNYB 1FWKA 3A4TA 2KT5A 4WYWA 1DTTA 3CJ2A 1FI4A 1VOMA 4CLFA 2OAUA 3C6TB 3BSNA 2PA3A 2RKIA 3BREA 4ATNA 3BO2A 2D69A 2J8AA 4DV1J 5B0EA 5D3GA 2BX6A 5IT0A 2VICA 1U1LA 5F9NA 4CQ1A 1NU4A 2ZZTA 2AX0A 3H4BA 3HULA 1AT1B 1S6PB 2FHMA 3EDRB 4NXNJ 4ZP6A 4I2PB 2F8EX 2MQPA 2R8IA 2RRNA 3DDIA 2OUGA 1TVRB 2XC9A 2KL8A 5A8KA 1S79A 1DARA 2B9WA 2YWKA 3Q8VA 4LREA 3J81j 2FQQB 1MMLA 4JV1A 1KNZA 2MJUA 3AD9C 3K58A 3OL7A 3DOLB 1NK0A 1NDLA 4O44A 1EP4B 2XWYA 3GYNA 1X9MA 3QO9B 4JV5J 2HVHA 3BF4A 2VDIA 4DX6A 4UUWA 2CAJA 1N0VC 2W4DA 2X7IA 3AA9A 3G86A 4IKAA 5H9FJ 2HHUA 3CCLS 3QNWB 2ZH7A 4ER8A 3GB0A 3LWLA 4USVA 3OL6A 1U0HB 2XGQA 1VQYA 3GCWP 2KFZA 5A0YA 1HYSB 4WXOA 1KEKA 2XHWA 1DY3A 2L41A 4ELTA 2FIUA 2K3IA 3KFWX 4DCOB 3CULA 1SQFA 4OYZA 2J9EA 1W26A 3GV5B 2FHJA 3NWGA 1I5OB 3B8HA 2DB1A 3AOCA 1ZAWA 1XWLA 2MJNA 3GR0A 1T9VA 3MM6B 4OI1A 5HQMA 2OMOA 4IR9A 1W2IA 3BKUA 1LW2B 1WTFA 3K2YA 2RSQA 1VRTA 3EVWA 3L09A 3V6KA 1HW8A 2F4FA 1LNQA 3U1LA 4KGZB 3QZ7A 4QU6A 1X4AA 1NHUA 2G0CA 2J76E 2H1YA 2HS0A 2XNQA 4X65F 4NI2B 1FNXH 2VONA 4Z7CA 4K0KF 1BGXT 4PPZA 2AU0A 1S0OA 4TNOA 2GJFA 2WVEA 4KGKA 3M2VA 3THPA 5KFFA 4F3QA 1N5TA 1WHVA 4Z2XA 5I42A 3NMRA 3LP1A 3P5BP 4Z37A 2MSSA 5FJ4A 1U8WA 4KB7A 2ILYA 1IBLJ 5J1EB 1RT7A 1HNVB 3H5UA 3V6DB 1TL3B 2IRYA 1RHMB 2RAQA 1IKWA 3UO0A 1FFGB 1CJTA 2NXNA 1S97A 3KK3B 4ZP8A 3RAMA 3KYLA 1FRKA 1DTTB 1VJQA 1JKHA 4DXLA 4DFMA 5M2UA 2J0QD 5HN0A 4LFBF 1RHUB 1X4CA 4F26A 3MMBB 2IJRA 1NK7A 1T03B 5CZVA 3QBCA 1TL4A 2CQCA 1MW7A 2B8QA 2CWXA 2EI5A 3BGUA 3QWUA 4OV1A 2DHXA 2CJYB 1KQKA 5CCMA 5DDRC 3GIKA 3W1YC 3PKMA 4JI6J 4PXEA 3VCDA 2CPHA 1HIYA 3SQGB 2KJWA 1WOPA 3VF0B 1ROFA 4PEOA 2AYGA 1N33F 2QE5A 1RUSA 2CQPA 2BQUA 3M7VA 1U1QA 4KHRA 3MHYA 2DNNA 3GIIA 1S10A 1X4FA 4PG5A 2G1HA 4K59A 4ECXA 3K59A 2NZ4A 1OQ3A 3NAHA 2BKOA 4YR0A 4RBVA 1ZS6A 1APSA 4NLVA 4DV0J 2IDLA 3TZWA 3IRXA 3TX8A 1RADB 1KTVA 2R2SA 4RU2A 3D2WA 1VK8A 1URNA 3C16A 3IM9A 1IBCB 4ZPBA 5GAHI 3A1YG 2ADBA 5KG7A 4DBQA 1KRPA 4HHJA 3CC2S 2O67A 3B4MA 2W2NP 4ECSA 2FZCB 1FXRA 5KT7A 1OPIA 1X9SA 4QIGA 2X3DA 3VWSA 3CJ5A 4YB1P 4YHHJ 4UQTA 2P9CA 3PJWA 4IQXA 3PNIA 4CLZA 3C66A 4ZN1A 2CPZA 2YKAA 5BJRA 3KDOA 4Q45A 1QAYA 1XR6A 3MMJA 4RW8A 1Y9OA 1HR0J 2I6WA 2MKSA 3LP0B 2OLWA 2JFKA 3ZZUA 3KHRA 3M2RB 3VAHA 4PXDA 4DL7A 3IR6B 4NPOA 3F73A 4PQUB 4NMXA 2VA2A 1SC4B 1PYTA 3K8VA 4DV7F 3WX4A 3D0GE 3CMQA 3LANA 4NWBA 1KVKA 4OZNA 3HSJA 2CQ2A 3BO3A 3BGRA 4E8UA 2HBRB 1S0NA 2Q66A 2MDAA 5KFYA 1TL1B 2HQ3A 1SJ1A 3U1MA 4C97A 4BDPA 3QJLA 3WZ0A 2XLIA 2DJWA 2OTJS 3W66A 3P45B 1JNRB 2V34A 2E7WA 3NEKA 3SI8A 2R7WA 1HNWF 2BACA 1FWLA 3NS5A 4KT0C 1C1BA 4ES3A 4B3SF 2QRRA 1OSCA 3BH7B 3IG1B 3I31A 4DF4A 1WNEA 2ZBPA 2E9ZA 2GJ2A 5LMUF 3I56S 1UWBB 2YXLA 1NXIA 3JSYA 4QIFA 3EGWB 3G82B 2WBRA 2YY3A 3H0PA 2IPOB 3TA1A 4QOTA 4WU3A 4C8KA 1U48A 3LAKA 5K5MA 1JIHA 4M1KA 1WF1A 2KXHA 2AT1B 3CJKA 4NLUA 3TJAA 1KC8T 1RWKB 1XNRJ 1Y5IB 3P4UB 5K8OA 2GQQA 2RUSA 4A8MP 2ROEA 4JYAF 2IYIA 3Q86A 4OZLA 4PG8A 1KBRA 2XG8A 1SL0A 4ANEA 3T1HF 2PA8D 3P96A 1LW2A 3T6JA 5IXUA 1RTJA 2B3TB 2GQCA 4P72A 3T5KA 1R0CB 2C2MB 2XMWA 3PHEA 3HJVA 5J2MA 4F0MA 2F8HA 7FD1A 1H2TZ 2V5HG 1FK9B 3IXQA 4KE5A 1M5KC 1U24A 2YKPA 2RQ4A 3AB2B 2HAFA 4DV4F 1J5EF 3OVAA 3OTBA 4FXWA 3IGNA 4M5HA 3TR5A 3W9JA 1N36F 2JFDA 1SIWB 1UCNA 2Z2LA 4TYAA 2D9OA 2R42A 2Z30B 3HSGA 5C42B 2RRBA 1SH3A 1TKZB 1VQ7S 4JI1J 2HNZB 2NUUG 2BE9B 4I4BA 2GAGC 4K4WA 1Q81T 2A2CA 3R97A 1XMOF 2C2DA 2HZVA 3UDVA 3POTA 1RP5A 4NLXA 2LQ9A 3L7OA 3NCQA 1SKRA 1K1SA 2VPYB 4WP8A 1VYAA 3C6UA 3KOAA 3PFEA 1HQ2A 1RLCL 5HAOA 2BW7A 2C2ZB 3KLGA 5HBMA 2UUBJ 2VG6B 5K8PA 1JQGA 2L9WA 2FGCA 3NRBA 3OVBA 1BMQB 3EUNA 2EFQA 2OHDA 3E3XA 2O1PA 3I6PA 2HRTA 3R5AA 4A8FA 1QY7A 4ILRA 2MZ1A 2H5JB 1C4AA 2GGPB 1NPPA 3GQCA 1WDDA 4JI8J 3QT7A 3CJ3A 1B0PA 1O6XA 3DMJA 2CJKA 4YB5A 4IUFA 3V81B 1KVIA 2X1FA 1U1KA 3LALA 2NLWA 1Z2LA 4WWSA 3BR9A 4ZLNA 1JKHB 5D3GB 2RDDA 2VKZG 4C0OC 5C25A 4WP9A 1TL1A 4OJGA 1QTMA 3PEJA 1HNXJ 1RWVB 2DO0A 2RIJA 4OHWA 3SZ2A 3PO5A 3GU0A 3ILLA 1SJFA 1D9DA 2GA7A 3KHHA 3RAXA 1NJWA 2GNKA 2UUWA 2B6AB 1RAAB 2UV8A 2UUCF 2QN6B 2HFSA 2EK6A 4QBUA 3CDWA 2FJAB 4PG7A 2XO7A 3LQVA 3AHPA 3Q2TC 2HFVA 2AYEA 1KLNA 5AE3A 3N4WA 5J2PB 2ZNZA 1QDUB 3W64A 1S72S 1TK8A 3UE2A 2V9KA 2HFZA 1F5CA 1TTHB 4RW7B 1SKSA 1QJHA 4F50A 1LXJA 2B4VA 4Y65A 4ENOA 2L9DA 2RD5C 2YNFB 3PYDA 2HZAA 4UUXA 2IIHA 3FJ2A 1UPPA 4WFBQ 2GCFA 4OL8A 2OELA 4GVBB 2HHWA 1ZBTA 2V4JA 3MGJA 4AL5A 4PG6A 1TAUA 2IRUA 1TP7A 3J7YI 4P7VA 1KOHA 1CS4A 4O3RA 4OI0A 5CAAA 3MM7A 5GVQA 3AQPA 1NDKA 4YHHF 2J5AA 5K14A 4F3MA 4WIQA 2BQRA 3TEHB 2HQDA 2E29A 2WCXA 2FVPA 3MR6A 4RW9B 1SC3B 3DLEB 4IH6A 3SSQA 1L3VA 5DDQC 1PKUA 1UEKA 1R31A 1TR0A 3B82A 3DOMA 4WZQA 1BLUA 2GHWA 1KVJA 5IV3A 1T9WA 1UKUA 1Y0HA 3MPVA 4PZVA 3DRPB 2DY9A 2E5JA 2HMIB 2JEFA 3X3UA 5AXKA 1XNRF 3BEGB 3A8IA 1QE1B 2RF2B 1R0AA 1WKKA 1URRA 4L3NA 5A8RA 4YY3F 2HHSA 3KHLA 1AA1B 1GMWA 5CYQA 4DCPB 3TNVA 4KHPF 2FVSA 2F4VJ 3OR2B 3TZZA 1AZSB 5FIIA 4CO3A 3BPDA 1IBLF 4OYIA 1XMOJ 1JLBA 2F3JA 3CEDA 4QW8A 1YG0A 4MKBA 3C2PA 3W3SA 3BGOP 1VRUA 1RAOA 1T9XA 2YX4A 3D54A 1FK9A 1TL7A 4EYHB 1S1UA 1UVKA 2HQGA 3C14A 1HI1A 2CDRB 2M0GB 3L4BC 5KFZA 1T3OA 3KDNA 4DN0A 2IAJB 1VRUB 5LT5A 3I5CA 4DS5A 4OZJA 4LFAF 2IDEA 1JLBB 1NSKL 2QJ3A 5HROB 3OTDA 5HP1A 1N34F 2K06A 3IAM9 4J37A 4ZITA 2YKMB 3O6QA 3PW5A 3KG4A 1NBEB 2C3YA 5KFWA 2NREA 4JI7J 1FJEB 1LFPA 4J9OA 2HWHA 2MLXA 1FVSA 3DKDA 1UVIA 4GO7X 2WAQD 4M5GA 3W61A 2JC0A 1RTHA 2OGUA 2UZAA 3ICLA 2PFFB 3MTJA 1CJVB 3PXGa 4LIRA 1KD1T 1OS5A 2GVZB 3LTOA 4L6V3 4FDFA 1RACB 3BQ0A 4DPXA 3PTWA 1FFWB 2OPSA 2D41A 2OO4A 1DQAA 3U7JA 4ZPCA 1S1TB 3Q23A 1IJEB 2LXFA 4K0KJ 2MGZB 3PG9A 1Y3KA 3T6BA 3MR5A 4DQSA 3AA8A 1JMTA 8RUCA 4FYYB 4QWDA 5AE2A 2ZEJA 2MQMA 2MGZA 1I51B 2HHXA 4HTIA 2AGQA 4QJVA 1C2PA 3FBEA 2DPJA 5IS2A 1XIQA 1YI2S 2NCKL 5D8HB 3I32A 4WYLA 9RUBA 4B9VA 2V63A 2NXCA 2XZDB 2UU9F 2LQBA 2V2QA 3CDAA 4LRFA 1NRKA 1X60A 2BW2A 2V69A 1MWZA 3WHIA 1GQEA 2DGUA 2EXUA 3GG0A 1H3DA 3FBCA 1NSQA 2R4FA 5IQ6A 4ZKAA 2P9EA 1N32F 2MTLA 1QAXA 3BQ2A 4DR4J 4PQUA 1S1WA 2UXDJ 1S9GA 1J5OB 1REVA 3PRDA 4ZJOA 4J90A 2Y3YA 4F2SA 4QR2A 1N48A 2ILZA 3E01B 3VZIA 3RW6A 3VVUA 4X4NA 1TMJA 3HMJG 1X4BA 5CD4H 4ZPVR 2BDPA 2COLA 3U27A 2C3UA 3BYRA 3GJQB 3KLHB 2QL5B 2RS8A 4G3IA 2AQ4A 2DR5A 3C6TA 5IC6B 3IRWP 4I2QA 3CXCR 3AAWB 4JI5F 2ATLA 1V9OA 4USTA 3HD1A 4KPYA 2V8DA 3CDUA 2VUGA 2ZH8A 1S12A 4XIUA 1S1XB 1RHKB 2VC1A 2XYPB 3IGVA 2QZ8A 3CDEA 5L39A 1EETB 2Q6BA 5EX3A 1RHRB 4ZVSB 4EUVA 2IMWP 1O5JA 2MQNA 2VBYA 3KLEA 1GMVA 2DXFA 3MZIA 4JB8B 5ETQA 5KT5A 3SFGA 2AW0A 1H6KX 1E6VB 1NJIT 1T05A 2HIQA 1ZM4A 4PQAA 5AE1A 3VAJA 2HW3A 3DFEA 2XBPA 1YJWS 4K4ZA 2QTWA 3F56A 3ILJA 4LRBA 4CWBA 5JVGQ 5DG7A 2KKHA 3VAGA 1PC5A 2OPPA 1BD6A 2Z8QA 3C6UB 3PIPQ 4U6PA 3I82A 1GMWD 3MMBA 2DXEA 1R6YA 3L7PA 5I3UA 2V4QA 1KR4A 4PWUA 2CJBA 1VBZA 2M2BA 2OPQA 2R2TA 2A2DA 4FBUA 3G8TA 5J1EA 2ZHAA 4O3PA 1DRZA 1HNVA 3IR5B 3M8QA 4DR3J 4DL5A 1IUJA 3DU6A 2EFVA 1PO6A 5I42B 2KXFA 3LF0A 3NG8A 1I6JA 3DLKA 4DR7J 2XZTB 1CVJA 3DRSA 1NJYA 3BO4A 4OI3A 4DMZA 6FDRA 1FA0A 2W9CB 3OUYB 4C0HA 4FS2A 3IO1A 4FXVA 4A48A 4URQU 3EZ5A 2V2ZA 1YBAA 5EGYA 2M7SA 4AXJA 2DIUA 2IVYA 2XMVA 2PEBA 4J5OA 3QT5A 4OI4A 5CQGA 2E1CA 1D1UA 2M52A 4B9MA 5JXSA 4ED6A 1G3OA 3PZPA 1PCAA 4PYDA 4DI6A 4DR5J 2CG8A 2OFHX 1VHFA 1DHMA 1VS3A 1JLCA 1RWWB 1XBWA 4R8UB 3AOBA 5AXNA 2YNIA 4IG3B 2R7UA 2J9CA 4YP3A 3QYYA 5GAHU 1Q0NA 2AZ1A 3RJMB 4LF2A 2C2NA 5T14A 4MKYA 1YSJA 3UR3C 4ILMA 4NEYA 3CWJA 1X4HA 1UFKA 1C1CB 4R8UA 2J6SA 3QATA 4F4WA 2PD1A 5CYQB 3MPYA 1JLCB 1VGYA 2JSXA 4AFFA 2MKCA 3KHGA 3AH6A 5E3CA 4WTOB 2XWXA 1FESA 4X4RA 2WVDA 1RWMB 4MIWA 2VFTA 4OYAA 1IWAA 4QIWD 3BJYA 2ZH4A 3GP9A 2R8KA 1NKCA 3KUGA 3DOKB 3K5NA 4AT1B 4OX9F 1SI9A 3ZZRA 1VCTA 5KT3A 4DQPA 1LWEA 4JV5F 1B99A 1RT3B 2JLFA 3DM2A 3D0HE 2IM2A 2WZ1A 4NLSA 3MFHA 4I0WA 2QSFA 4C9DA 5DRKA 4RW8B 1H0HB 3DGPB 3MMCA 2W9BA 1OY9A 5JVHQ 5HP1B 1NHKL 4LF6F 1YGYA 3D28A 3PX4A 5KFXA 1TUVA 3LH2S 3MCSA 5HVGA 4ZPWR 5DQHA 3GV7B 2GIQA 5CYJA 3DDKA 2MHEA 2Z2YB 3LPEA 2W7PA 2PC6A 2LP4A 4OIXA 3RBZA 2HBZB 3MEKA 3R1HA 5LXYA 3QPIA 2OEJA 3PCOB 4LF1A 1NMEB 2R2UA 2R8HA 4DV2J 1FJGJ 4H4MA 4X84A 5FDLB 1U7LA 4NASA 2K2PA 2FHOB 2DISA 3AB4B 5BXIA 2W8LA 2HK3A 2VPZB 7FDRA 5H9EK 2UUCJ 1JLGA 4CTAA 4X64F 5HQ8A 2FLPA 4IOAQ 3M2UB 3DXSX 3CT9A 1HWLA 4O23A 1CG2A 2MKYA 1QE1A 3PFOA 1U8SA 1R0AB 4M5DB 1SBRA 3TUPA 2CPXA 2ZDOA 4NMLA 4QZVB 3VZHA 4ED2A 3DRSB 1A0OB 2KM8C 2XYHB 4B9TA 1X0FA 3DOMB 2XY5A 1ZOTA 1HBNA 3D5MA 3SFUA 2WSFC 3K89A 4ZIVA 2QG9B 3M8WA 3G71S 2GC8A 4IOCQ 2UVRA 3GIMA 4ZPDA 1XMBA 4P73A 1TQLA 2DGQA 4Q5VA 5CHCB 5B08A 1KOOA 5F3ZA 3HT0A 2KG1A 3G6XA 2PI4A 4NRUA 5HJXA 1RAGB 2ZKUA 2WBMA 4LF4J 3EDQB 3MEDA 2VFSA 1OY6A 4JI2J 4EWTA 1SL1A 1XN9A 2WK4A 3D6HB 1D8YA 2UXBF 1GX6A 1RB0A 2QMUB 3MM8A 4DDFA 3QFHA 4KH0B 2ADCA 5RUBA 1MWYA 3O8WA 4LJMA 1U45A 4B3TF 2HBYB 2EC2A 1Y5LB 2J0WA 4LSLA 4LR8A 4PPDA 2H65B 3PJ9A 4TU8A 3GLJA 4X2BA 1K0TA 2ROPA 3HFKA 5LJ3Y 6FD1A 3CMAS 4P71A 1KKHA 1TUGB 1Q8BA 3FRZA 2ZHOA 1FJCA 4WU2A 1S1XA 3LA0A 3AXMA 1ZM3A 2IM0A 3MD3A 2CJAA 2KDOA 3I55S 2DGSA 1JJCB 4GC6A 3G87A 2I9SA 3OLAA 2KB2A 3T1YJ 1RWXB 3HSDA 3UCGA 2QA4G 1FRIA 2F9DA 1N33J 2PMZD 3KTQA 3MM6A 4GMKA 5E3RA 4A47A 2PN6A 2YNGA 3G82A 1CJKA 1WC3A 1HARA 2LKZA 1SV5B 1UPMB 2APOA 1BUXA 2HNDA 3DI6A 4K5SA 4MAKA 3W9IA 3KMSA 4DFKA 1I94F 4M95A 3VV2B 5F8GA 5KT6A 3D3BJ 1I1GA 1GK8A 1A7GE 1SC1B 4KFBB 2CUYA 2WRMA 3J80Y 2J9DE 4P2MA 2MLYA 1RT5A 3DCAA 4FKXA 4IG3A 2GV1A 2KFNA 3LGNA 4ZVTB 4XDCA 1HQUB 4QIVA 2JEGA 5J2QB 2LFVA 3JSMB 2V0NA 3R9LA 3PYGA 4WKYA 1G2EA 4FYWB 2C1EB 4RW4B 3TA2A 2VG6A 4USMA 2LDYA 4NRTA 3R5JB 4B02A 1BWEA 2XMKA 1RQ0A 1MROA 4KQZA 5B0GA 4YN3B 1RAFB 4WFNQ 2W24A 3HHKA 2XQCA 5IT9Y 5EX0A 2JWNA 2PIIA 2BOAA 3KK3A 4DOZA 3DLLQ 2AJ1A 4WK1A 3R6LB 2FJBB 4ECYA 1K73T 3R1LA 1WKLA 1M5HA 2DEIA 4I2PA 4NZ6A 2DO4A 2LEAA 5E3PA 4Q44A 5LOQA 2PEHA 4D3GA 3NCRA 4LVNP 2M3DA 5HJYA 3JSRA 4NLQA 4KYZA 3HT3A 3VALA 2DRAA 4DR6F 5IT4A 2OMLA 4X66J 2FJVA 1N56A 2VH7A 4NOHA 4NZ0A 4C8NA 1EZZB 4IDKB 1MN7A 2OPQB 2RHQB 1FDAA 2O01C 1YBUA 3N6NA 3HXMA 3CDBA 3X1LB 3JB9k 2JRSA 2J7UA 1DZ5A 3KNAA 4OYXA 4QR1A 1BHNA 1TAQA 4UT4A 1P27B 3CTRA 4ITSA 1RT2B 2W1BA 3N79A 2VJVA 1PG5B 2QC3A 2JEJA 2OP5A 1HPZB 1N52B 4J91A 3H8YA 2YPYA 1NPRA 1S77D 5IC4B 3DRPA 2W9AA 4FNHA 3QJPA 4N5SA 2HKEA 1RWOB 5F8IA 2UXDF 2ZH3A 4B08A 1RLDA 2EEYA 4FYVB 2RILA 3RB0A 1UWBA 2KM8B 2ZD1B 2RJZA 2G2OA 1YQHA 4ECWA 4PUOA 1EHWA 5D4OA 4DR7F 2IYGA 2V68A 2XI2A 3ETMA 2FHKA 2K3KA 3HVWA 1U25A 2B4OA 4PYAA 5FD1A 1CQMA 5B0AA 3U02A 4X65J 2VG7A 3PW2A 3IFEA 4NCGB 1YZ6A 1YVFA 5HMWA 4AYBD 3O5TB 5A8WA 2ZC3A 3S8SA 5G4DA 3BGLA 4K5RA 4U96A 2DITA 1B7YB 4O44B 2VC0A 4K4TA 3BSOA 3IBWA 1S57A 3OPKA 5B7WA 2LEPA 3BYPA 5ETNA 3HHEA 3LP1B 5L46A 2FPHX 3EPIA 3E2EA 1IKYB 3BS9A 4K4VA 2MB0B 1FRXA 1IN0A 4RW6B 2A6MA 5D78A 4UOGA 3HD2A 3GSIA 3M1VA 2G2YA 2HQIA 5IFMA 2YWGA 4CLYA 4MYTA 3TOQA 1WF2A 2CNNB 2OEMA 3JSBA 1F60B 3L7UA 3R6GB 5IOLA 3BSAA 3CD5A 3MMAB 1SQEA 1VK3A 3MM7B 1WC5A 4G1IA 4FXDA 3IWNC 4WJBA 2CNLB 2JHEA 1BQXA 1CJKB 1FRHA 3UR0A 3BGFA 4CDIA 1S6UA 3NBPA 1PJ5A 5D77A 2FUG9 4ZVHA 3VGTA 4C98A 1XR5A 2BQ3A 1HHTP 2UU9J 1X4DA 4DQQA 1SKWA 4P2SA 5KG4A 3MMAA 4N77A 3ISZA 3JS9A 3QGIA 2KZZA 1VHIA 2B5JA 1TKDA 1F5BA 3UPFA 4ZLPA 2YTCA 5E5NA 3HCXA 4XPCA 1NK4A 5GAGI 3T5LA 1RA7A 1Q5YA 2VFVA 3A8EA 5F0UA 1EQ0A 1F1BB 3DLGB 3M30A 4UZBA 4E0DA 3HHLC 3G96A 4J9PA 4OJ3A 3CC7S 3OVSA 1S4EA 1MNEA 1CJVA 4HT7A 2N3LA 2HVZA 1GXTA 2CPYA 2MQOA 4USUA 4TQRA 4ES2A 2ZH2A 2VA3A 4DR6J 4ZLJA 2GX8A 5FLXU 3QIDA 3HPOA 4RU9A 4A8YA 3FC9A 3ZXWA 1KFSA 5HMZA 4ZP7A 2XLKA 2ZOGA 2QFIA 1SJRA 1RHQB 2BANB 4LSNA 1BQNB 3I4PA 3M8YA 1RISA 4O4GA 1WOOA 4WFYA 3GPAA 1UA0A 2AJ2A 3GSDA 2DNGA 2AJ4A 1QVGR 4KC5A 1Q79A 1S1UB 2RU9A 3MOZA 4QYRA 1SIZA 3R2CJ 1FKPB 3ENVA 4DR1F 1T94A 1NZ8A 4W92B 3HFVA 3M6UA 3MTKA 1VC0A 4USHA 2RKIB 2UUBF 2CZVC 1DLOB 4FVCA 5J2NB 2F65A 4DG1B 4N41A 4IRDA 2FJEB 3PHTA 3KJVA 4OI2A 4DL2A 1VQ5S 2Y1IA 1ZPVA 1Q7LB 1FF2A 1LK5A 3Q8UA 4MK7A 2KN4A 4NLOA 5IZHA 2B9YA 1B3TA 1Z1ZA 2YVSA 4H4KA 1IBMF 1GEHA 2VQEJ 4ELUA 1ITPA 2QT7A 4YY3J 3O3LA 1W2BR 4ZVPB 5T7LA 3EZUA 1BXNA 3MD1A 5A8KB 2DKOB 2XNRA 4DG1A 3CCQS 4Z7YA 2DNHA 2VBWA 3ZZPA 4MH8A 1GXUA 4GO5X 2IA6A 3ZTOA 1T3NA 4LR7A 4MIAA 1J2VA 1T9UA 4HT5A 3JTPA 5KFSA 1P8GA 4JI8F 3DLEA 2OEKA 2BA9A 1RABB 5KG0A 3LGMA 4CO2A 4XPEA 2CQBA 2C3MA 2C2EA 2HGMA 5G0RA 1H73A 3CJ8A 4LF8J 2YKOA 4WTYA 1HLWA 3KLFA 1GH8A 1B70B 1SJQA 4O4GB 2E1PA 3DGVA 4DSLA 2V6AA 4B3TJ 3KG1A 1JXLA 2I1RA 3GFYA 1RXOB 5HSPA 4RNOA 3BR8A 3C15A 4DN9A 3NCPA 3LUYA 2K1RA 3T5HA 1HNIB 1S4FA 2AKWB 3K5OA 4B3OB 4JI1F 4AQYJ 2MY7A 3UVJB 4DV3J 2RE1A 4Q0BA 2AF6A 1IKXA 1BWVA 2KTQA 1WI6A 4DV4J 5K8NA 5F9LA 3MM5A 2Z2MA 5K14B 4ILLA 4V19X 4QW9A 4CO5A 3TUZC 3M8PB 3OFFA 3Q22A 3FNNA 3MWBA 3F44A 2ZBRA 1D9AA 2YNGB 2ZH1A 2XMUA 4HVZA 1L3TA 4CLUA 2BJEA 3SEOA 5D0EA 1Z2ZA 1D3WA 1C0TB 1X5SA 4LR9A 1WJ9A 5EDWA 5L9NA 3KJFB 5A76A 2Z57B 3V2UC 4LMZA 3UD4P 1NB2A 5GMKa 4NA1A 1S6QA 4KGVB 3MECB 5DG9A 4DSEA 1WACA 3PX6A 2HHHJ 2MHNA 5LMNF 4NLYA 4ZDNA 3WIUA 3SCLE 1WC4A 3TA0A 4Y2MA 2BJ7A 2WSEC 2WONA 3FCHA 3M1VB 2XSFA 1FNMA 4RNNA 3H20A 3QLHA 3I87A 2W9CA 4G1PA 3TVKA 2YWHA 1T05B 4O3SA 2VPXB 5JUMA 3CPWR 4F2RA 2E5HA 4TLRA 1AUDA 3UDLA 4F02A 4IH5A
chains in the Genus database with same CATH topology
4DV3F 4B3OA 2C2RA 1WG4A 3ZZTA 4J9SA 1DTQB 1UEVA 3VQTA 2AJ0A 2Q6CA 4O3OA 3CB4A 1SUQB 4DF8A 5KFPA 3DLJA 3C3LA 5K8MA 2B0GA 4MK8A 2CVEA 2UV8G 4YUDA 1M1KT 3GE9A 4IFYA 3QWPA 2MQLA 3MM9A 1RTIA 1UEUA 3UI3A 1T8EA 2FC9A 2UP1A 2Q1LA 4KKOA 5HLFA 3NGKA 3TAMB 2HGLA 4YMEA 2RVJA 1XTZA 3CC4S 2IJNA 1JLGB 3G8QA 2VFUA 4CTAB 2M4MA 4WE1B 2DGTA 5T7LB 3OTOF 4W90B 3I0RB 2FGOA 1MMNA 1Z4UA 2DNMA 2GHPA 5DQGA 1TFYA 2CRLA 2RB7A 4NYZA 4J9MA 2I8EA 1VBXA 4TKTA 4KBIA 5KG5A 4QWEA 2R8GA 2JJ4D 4DV0F 4CNZA 5DGBA 5DG8A 1RDRA 4USJC 2JX2A 3FZBA 4YEAA 3MEGA 3NGDA 2UVWA 2LXUA 2VOOA 3NAIA 4KJIA 2F1FA 2ZJRQ 4U7CA 2C22A 4ED8A 3D1OA 1UA1A 2DGXA 1FT8A 4Q8FA 2FB0A 1N5SA 5A8RB 2ZH5A 3RZAA 4GKKF 3M8SA 3DC2A 1Q7YT 1XNQF 2EPIA 4R25A 4DJBA 4O0IA 5M2RA 3J81Y 4EZ9A 2YH0A 3GWCA 4IYQA 1S76D 2LA4A 4JUZA 3LP2A 4TQSA 2RU3A 4J9PA 1VC6A 3GV8B 2QA4S 3CO9A 3TW0A 2YNHB 2CVIA 3Q0AA 2GW8A 1FE0A 4R0JA 3KK2B 1RT5B 1UMJA 4NA2A 1UJ5A 3SCKE 2P6TA 3GZ7A 3KG0A 1C1BB 2JOQA 4ZCMA 2G9OA 2X1GA 4OI6A 3BSCA 3OTEA 2KRRA 1H7WA 3NNAA 2ZH6A 1QSSA 1K9MT 2WB1D 2GFFA 2LVWA 1FCAA 3P3DA 4I2QB 2J9DA 4ZA1A 4C8ZA 1D8ZA 1QVFR 4IRKA 5E3QA 1IJFB 2CQ1A 4ZS6A 4KV8B 5E3AA 4MK9A 3CJ4A 5DDOC 2YKMA 4QWAA 3HZEA 3H4DA 1VQKS 3N0VA 4C11B 1JLEB 1DLOA 1GAOA 3LWMA 3LPYA 5KFBA 3TYTA 4TY9A 2MKKA 1NJXA 4ID8A 2ZDPA 4LSLB 1DAXA 2ZH9A 1HBOA 3TAMA 2HFOA 2X51A 2CJ9A 1E6YB 3DLBA 3M8QB 1ELOA 4Q43A 3MEDB 4PCQA 4CZCA 1LWCA 3HHLB 3T1AA 5HMXA 3JAMY 2R8JA 3CIMA 4A8SA 4HH1A 3SCJE 4XAKA 2KRBA 3QGPA 5E33A 2A18A 3Q8SB 1RT7B 2W7OA 3MM5B 4QCLA 4JV0A 1LK7A 3F41A 2JC1A 2EFOA 1VQ8S 4I68A 5DM6Q 3AJ2A 3KLGB 3U1NA 3NP5A 5GAEI 3UQSA 3M8RA 3N01A 1UVNA 4DV2F 1DURA 4FS1A 2DNOA 4QR0A 3I5AA 2LEBA 5AXLA 2XB2D 3NNCA 3W2VA 4JI6F 2ZZNA 1DBDA 5C24B 4WKRA 2ALZA 1R89A 2V4JB 3J7A1 4RUAA 4DSFA 4NZ7A 3H40A 1SC6A 1WEXA 2N4CA 2OFGX 3MF5A 4QPXA 3CCZA 1B0VA 4JOUA 1FRJA 1FD2A 4XK8C 2IM3A 4CT8A 4IQMA 2D3UA 2DH7A 3ETOA 5KFUA 2MY8A 1RT3A 2B4UA 3PACA 1RT4B 2HPUA 4ED3A 3QJJA 4NCAA 2LMIA 1HBMB 4L72B 4Q2LA 1JLAB 3CCWA 4CCHA 4ID5A 1PSDA 1A6LA 3KKFA 4EU0A 4CNYA 2ABYA 2HAIA 4UOCA 4ZCLA 5A8WB 5L38A 3FVYA 1N54B 2VASA 4ID5B 1VQ6S 2VG7B 3OL9A 5KFAA 1VBYA 2DCUB 2I5JA 2E1MC 5KOXA 1U47A 5D4PA 5DS7A 3THVA 3T1YF 4PWDA 2CYYA 4BWMA 5M2PA 4ED1A 2NYIA 4AL7A 2BZ2A 2PMHA 2RMLA 1FTRA 5BYRA 3M32B 2NS1B 4A8OA 1NEEA 2MKIA 2HNDB 2OSRA 3V6JA 3RR8A 2BJDA 5HMYA 5B0BA 3CCES 1Q8IA 5JJBA 4ED5A 2AYMA 4TLQA 2LXIA 2RUGA 3H98A 1S99A 3H5SA 4Y2IA 3CGIA 1KS2A 4R0EA 2VZ9A 1QUPA 2M5YA 1RTDB 2CQDA 1OQ6A 3M30B 3OUYA 1HWUA 2ZC4A 1TKZA 4UY8T 2DHGA 2YX7A 3B4DA 4N47A 2RDJA 2L48A 3TAQA 5KFJA 1U4BA 3RR7A 1KSPA 2HRYA 2B5JB 1A9NB 3RB3A 2QSWA 2CPFA 4ECTA 3MM8B 1OIAA 2FD2A 5L9XA 5HI7A 4ED7A 3CCUS 3FMWA 1HFEL 2JH3A 2FJWA 4Q8EA 3PO4A 4AUKA 5H1SV 2XY6A 4IFYB 3RBDA 3HF5A 5DETA 4OZ1A 4WFZA 3RW7A 4JI2F 4HLBA 2BE2B 4ED0A 5A6PA 3D1QA 4YQWA 3ENWA 4DV1F 1QAJA 2B51A 2QMXA 2RS2A 2BANA 2YWFA 3OTCA 4WK3A 4UQGA 1JWWA 1BQMB 4DEZA 4KR0B 4R5PB 4ZHRB 1X5PA 3VAIA 4RW4A 5DGAA 3P6YC 1MSWD 1FJCA 2VG5B 2QLXA 2KH9A 3QIPB 1X4EA 2R2RA 3DXBA 4MYUA 2IFXA 2KFYA 2J7WA 2GO8A 2RT3A 3M2RA 1UETA 2VG5A 2D74B 4CI0B 2CDQA 4R5PA 2LDIA 1S49A 4I6AA 4WIIA 3H2LA 2VQEF 1RK8A 2KU7A 3MFIA 5L8RC 2HHTA 2OKQA 1QM9A 5FDLA 2N7YA 4G1QA 1VIXA 1M5OC 4B9LA 3TP2A 3FZ2A 2MZTA 3US5A 2NPFA 2E5LF 4B9UA 4DUYF 3ITHA 4DLEA 3D0IE 3V6HA 3IS9B 4ZK7M 2VODA 1LKZA 1X5OA 3EXYA 2AGOA 2DK2A 3IC1A 3CE8A 2KHCA 5CXTA 4CH0S 3N6MA 1GT8A 5AJ3F 4IH7A 1XNRF 2MXYA 2CQHA 3TRGA 4DSJA 5A6WA 4IG0A 3MPWA 4LFCF 3FRYA 5F41A 3E01A 1RKJA 3TO8A 4QQBA 4JI4F 2B6AA 5LXRA 1Q82T 4XDDA 4Y00A 1HMVA 1HNIA 3DYAB 3SDEB 1CEZA 3IAS9 3SV3A 4NXMF 4DL4A 1HA1A 2W25A 3ISND 3JTNA 1FXDA 1IKVA 4ZCIA 3K5PA 1VQOS 1K1QA 4ICLA 2DNYA 3ISNC 3T9NA 3CF5Q 2R9LA 3BB5A 1XC9A 1HBNB 1NZAA 2AD9A 1S6OA 2F40A 1Q86T 2OTLS 3PY8A 1Q53A 4ICLB 3CCTA 2QO3A 4DLGA 1WEZA 3S6EA 2YNHA 3C46A 2ZNYA 5B0DA 3AY0A 3PR4A 4LVOP 4B9NA 1FNOA 5KG3A 2DTJA 2RNEA 4DF4A 4B3SF 1KFDA 5B0FA 2FY1A 3H25A 5L1IA 5E0OA 4DL3A 2FC8A 4ZMMA 4DQIA 1RTDA 1Y5NB 1FRLA 2R7OA 1ULRA 2XSJB 1H38A 1NKBA 1S1VA 3MXHP 5KAKA 4YFUA 3OR1A 1V3SA 3K7RA 5HROA 3K0JA 4IO9Q 2KHDA 5DO2A 2V4RA 4DFJA 5L1LA 1TL3A 3DRRB 2P5VA 4O4RA 3OW2R 1HNZF 1FKOB 3H2VE 4ECZA 4DR2F 1TK5A 3DRXA 3H5YA 2Q43A 4Q7AA 1FKOA 4JV2A 4QIEA 3PV8A 1LWFB 1UVMA 1LXNA 2KZMA 4DR4F 1F0XA 2WOMB 5KFTA 1U1MA 3M05A 2M8DB 1DQ8A 2ASDA 1YJTA 1MROB 2DNKA 4OJ1A 3T9ZA 2A10A 4MKAA 3VAKA 2QYCA 5E41A 1N5QA 4X4QA 3O2IA 1ZTWA 2DT9A 5KFMA 4Y2AA 4WCEQ 3NLCA 1DQ9A 2ASYA 2FDNA 4KKOB 5CCLA 4F4XA 1M5SA 5HLFB 4KHMA 1YJ9S 4OHYA 4Y28C 4BBYA 4OLOA 2NSCA 3MM9B 1Q1KA 1FE4A 2XI3A 4O3QA 2BUNA 3GG1A 2HS4A 2PSZA 1VJWA 2B4PA 4UY85 1RT6A 2JZ5A 2MQQA 1VIOA 3IA0A 1TKXB 2CQGA 1VQ4S 2D7SA 4ECVA 4NA3A 2MZJA 1UVLA 4EO8A 4KSEB 3NBPB 3AQOA 4RBUA 1YJVA 1JLFA 2KYXA 4XO0A 3N6LA 3QAEA 2YNFA 2J6TA 1WTBA 2CZ4A 1JLAA 4ZP9A 3UCUP