3EGZA

Crystal structure of an in vitro evolved tetracycline aptamer and artificial riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
b'TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural basis for specific, high-affinity tetracycline binding by an in vitro evolved aptamer and artificial riboswitch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna
total genus 19
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3egzA00
1BY9A 2HGMA 2DNPA 2E5GA 1FXLA 3SXLA 1VQ9S 1VQOS 2KI2A 3VAHA 2MMYA 2KH9A 2YH0A 3PIOQ 3HI9A 1KOHA 1VC5A 2VONA 2XSFA 1M5PC 1VBYA 1XN9A 2DGXA 3K0JA 3MOJB 2CQHA 3CCMS 1VQ7S 2XS5A 1VQ5S 4W90B 2LCWA 4W92B 4A8XA 3P3DA 2J76E 3UWTA 3ZZYA 4C4WA 2E5HA 2D9OA 1YJ9S 2OIHA 2MQNA 4QU7A 2VODA 5LXRA 2CQ2A 2MQPA 2A3JA 2MKCA 4TU8A 2G1DA 2NLWA 1M5KC 1HD0A 2ZJPQ 3VALA 2B0GA 1OIAA 5BJRA 2JWNA 2EVZA 4J5OA 1YJWS 3P49B 2LXIA 4M5DB 1YTYA 1X4DA 1U1LA 2X1FA 2OTJS 1JJHA 2KG1A 1UFWA 1KD1T 1U1MA 2EK1A 3CF5Q 3G4SS 3G6ES 2CQ4A 4ED5A 1X5TA 1WG5A 1X0FA 2DB1A 3MI7X 4F26A 1FNXH 1VQLS 1M5OC 2CPYA 5GVQA 2RT3A 1M90T 2AYGA 1CVJA 1JJ4A 3BEGB 1R8PA 3CXCR 1VQ6S 2FHOB 3S7RA 2CPXA 2G0CA 1FT8A 2NZ4A 3P5TL 3MD1A 3L3CA 2FC9A 4RU2A 3VAIA 3CTRA 2LEBA 1DBDA 1OWXA 2MZQA 1VQNS 5ITHA 5H1SV 4IUFA 2MKSA 1SJRA 2CPFA 5IM0B 3VAGA 4CH0S 2RRBA 2DHSA 3CCSS 5GAHU 2MZTA 2DGWA 3CMES 3TYTA 1WELA 2MHNA 2D3OR 5GADU 2DH8A 4LMZA 2MKHA 2DNZA 3G8TA 2Q79A 1WTBA 2MKKA 4YB1P 2HZCA 2SXLA 2PE8A 4IOCQ 2YWKA 1WHWA 2DGSA 1VC0A 2MZ1A 2KXHA 3G71S 1X5SA 2XS2A 3D2WA 4CIOA 3CUNA 4OZ1A 3UCGA 1ZZFA 2M7SA 2DIVA 3MUTP 1DZ5A 1X4CA 2CQ3A 2EK6A 2I2YA 3IWNC 1VQMS 5GAEU 1YHQS 2I38A 2WBRA 3OW2R 2DGVA 2KFYA 1FHTA 1B7FA 1U2FA 2AYMA 2MZSA 2K8GA 3VAJA 2DNRA 2X1BA 1Q86T 2O3DA 3CCVS 5FJ4A 1S79A 1PO6A 2FY1A 1SXLA 2DNMA 1D9AA 1WG4A 2AD9A 1KOOA 1X4EA 2QA4S 3VAMA 1M5VC 2CPZA 3NS5A 1VQPS 5LXYA 3ZZZA 3S8SA 3B4MA 2X1AA 2DNHA 3DLLQ 1X5PA 1IQTA 2DK2A 3NNHA 3B4DA 4QU6A 2MPUA 2KYXA 5EN1A 3CMAS 2XNRA 5LJ5Y 3BS9A 4FXWA 3MXHP 2RNEA 2ZJRQ 1JMTA 2MZRA 2KHCA 1Q81T 2JRSA 2CQDA 2RUGA 4QPTA 1ZH5A 3BO4A 3ULHA 2J0QD 1WHVA 2LQ5A 2N82B 2JX2A 4WFAQ 2M2BA 2VOOA 5DDOC 2KU7A 4Z2XA 3MUMP 3G8SA 1OPIA 2CQBA 2DGQA 2KVIA 3MURP 4PR6A 3G96A 1Q82T 3NNCA 1P27B 5DM6Q 2CQCA 1X5OA 3CCQS 2OSQA 3PIPQ 1DHMA 2DHGA 2JVOA 5CXTA 1U1PA 1KC8T 1HD1A 3CPWR 2RRAA 1WF1A 2MYFA 5GMKa 4U67Q 3FEXB 3U1MA 2OTLS 2MQQA 2DGUA 2LECA 1SJ4P 4YUDA 4WCEQ 1SJQA 1VBXA 4IO9Q 1K9MT 2E44A 2DO4A 1W2BR 1H2VZ 1G2EA 1YJNS 3VAFA 4QQBA 2RS8A 3CULA 3DXBA 1U6BA 4C0OC 2DHXA 2F9DA 5DDRC 3HHNB 2MGZB 3CCES 1WEZA 2HYIB 4CH1A 2CQGA 2M9KA 3I56S 3LPYA 1X4BA 3UCZP 2CQIA 2MSTA 2MZJA 1N88A 1NO8A 2LMIA 3LQVA 2F9JA 4C7QA 3CCJS 3UCUP 2KM8B 1SJ3P 1KQSR 2OJ3A 3CD6S 4WKRA 2CPEA 3S01A 3JB9k 3CC2S 1L3KA 4YOEA 3G9CA 2LXUA 2MY7A 1WHXA 5HO4A 5LSLA 5JVGQ 1ZZNA 2DH7A 1U1NA 2CQ0A 1AUDA 2DISA 2LEAA 2QFJA 1FJ7A 2KG0A 2MGZA 1X4AA 4LJMA 2YTCA 1NJIT 4BS2A 2MJNA 2VOPA 1QVGR 2DGOA 2DNQA 3I55S 2MQLA 3RW6A 2MSSA 2AYEA 1YITS 2J8AA 4UY8T 2X1GA 2L41A 3CCUS 5LJ3Y 3Q2SC 4IOAQ 2XB2D 2CPDA 4WIIA 2CPJA 3J7ZT 3NNAA 2U2FA 3EX7B 1P1TA 1U1QA 2YH1A 1F9FA 1FO1A 1N8RT 2XS7A 2ZJQQ 2M8DB 1H2UX 2GHPA 1URNA 1N54B 3UE2A 5DDQC 3CC4S 2OSRA 5LSOA 3V4MA 2FC8A 2LYVA 3N9UC 2UP1A 3MDFA 3U1LA 2ERRA 2CPHA 1RKJA 1K8AT 3R1HA 1Q7YT 1O0PA 3FEYB 1FJCA 4WFBQ 1A9NB 4TLQA 3CCRS 3CCLS 2L9WA 4WFNQ 1WF2A 2DITA 2DNOA 2KN4A 3P6YC 2M4MA 1X4FA 2BZ2A 2M8HA 1WHYA 2ADBA 1VQ4S 2MKIA 1U6FA 4Y00A 3NS6A 4ERDA 3SDEB 4ZKAA 2RQCA 3EGZA 1FJEB 1WI8A 3TP2A 3H2UB 2XNQA 2HGLA 2L08A 1K73T 3VF0B 2M70A 2MKJA 4UQTA 2KXFA 3BO2A 3S6EA 2MQMA 2JVRA 3VAKA 2QEXS 5HL7Q 2DNGA 1X4GA 2KRRA 2U1AA 1UAWA 3SDEA 4TU7A 1H6KX 3THTA 2CJKA 1WWHA 3RW7A 3US5A 2DNYA 2PEHA 1U1OA 2MB0B 1QM9A 5DM7Q 1R8HA 1HL6A 1X4HA 3R1LA 5IFMA 1YI2S 3UD3P 1JJ2R 3MUVP 1VBZA 1DRZA 4PKDB 2N7CA 1NU4A 2MXYA 1D8ZA 1RK8A 2DIUA 2MY8A 3R27A 2KT5A 1UW4A 5D77A 1N52B 3J7YU 2CQ1A 2M88A 2DGTA 2E5JA 1YWXA 2DNLA 5CA5A 2AYBA 2BOPA 2DH9A 2FPHX 4PRFA 2CPIA 2G4BA 2RS2A 3THPA 2LA6A 1WEXA 1VQ8S 3Q2TC 1S72S 1M1KT 2ADCA 4FXVA 1WI6A 5DDPC 1QVFR 1H2TZ 4OZ0A 1HA1A 3BO3A 1OO0B 1WF0A 3EGNA 2LA4A 4TU9A 3SMZA 1VQKS 4EGLA 5GAGU 2MJUA 2CQPA 4P6QA 4LIRA 4F25A 1U1RA 3H2VE 3UD4P 1A7GE 2D9PA 3TO8A 2K3KA 3CC7S 2YKAA 2LKZA 4CQ1A 2HGNA 2N3LA 3IRWP 5JVHQ 1YIJS 2HVZA 2M52A 5CYJA 2RVJA 4WF9Q 2F3JA 3NMRA 2DNNA 2KXNB 1U1KA 1SJFA 2DO0A 4Y0FA 2RQ4A 1WG1A 3MD3A 2RU3A 5MLCV 2GO9A 1UP1A 2KRBA 4V19X 2MQOA 2M0GB 2N3OA 2DHAA 2DNKA 1VC6A 2V94A 1WEYA 5DETA 1PGZA 2J0SD 5IQQA 2KM8C 5IM0A 4F02A 2E5IA 5D78A
chains in the Genus database with same CATH superfamily
2C2OB 2HGMA 1FXLA 2OPSB 3IG1A 2B8PA 4DR6J 2YH0A 2IMOA 1N6QB 4KTQA 2XWXA 4AYBD 3KDNA 1JQGA 3OL6A 2C28A 3ETMA 3W60A 4ZJQA 3RBXA 3K5NA 5F8JA 1LK7A 2XI3A 5D3GB 4KV8A 1KLMB 2EFPA 1RTIA 2V50A 2J6TA 4H54A 5A8KA 4LSNA 2VG5B 4DL2A 3KTQA 4P71A 1JJHA 1VDHA 1S1XB 3BBBA 1TMJA 3KDOA 3W9JA 1U1MA 1IBKF 5AXKA 3VQSA 2R7TA 3CJ8A 2HBQB 1U0SA 2IPOB 4NLGA 1HFEL 2GQCA 1IKXA 4K59A 3BSOA 1FDAA 4OYPA 5B0CA 4DCJB 1FKOA 3OUYB 3S7RA 3R3TA 3M8QB 3L3CA 3OD2A 1LFWA 4F50A 4N5SA 3N28A 2HRYA 5AT1B 1S6UA 4CTAB 4DXLA 5KFCA 4NXMJ 4FS2A 1JLGA 2BE7D 3PW5A 3R6GB 3LOUA 2QA1A 4X4RA 5I3PA 5GADU 1CPZA 4B9LA 4LFBJ 1OY6A 1F9EB 2W01A 3KHHA 3DGPA 2ZH3A 1GXLA 4PXEA 2R7SA 1MROB 3GFYA 1IJEB 3MUTP 1DZ5A 2GQQA 3D0GE 3L95X 2EK6A 4WZQA 3RZAA 3GR0A 4CLKA 4C0BA 3HHLB 3E51A 4H4MA 2HWTA 2D3ZA 1PO6A 1NSKL 3JYTA 3FBCA 4DI6A 4F2RA 3KUHA 1X5PA 4N56A 3BS9A 4FXWA 4ZCIA 8ATCB 4Q5VA 2M2BA 4DDFA 2LP4A 3GJQB 3NP5A 2DXFA 3KK3A 3HZEA 4L73A 3D3BJ 2HNDB 2YQ3A 4LR7A 5HI7A 4NEZA 3CEDA 4NX9A 4O44A 3AT1B 1N0UA 2HRUA 3H8YA 2QIFA 3MEKA 1NJZA 3W9IA 2E44A 3M9NB 2GGPB 1V5VA 4LRFA 4DV4F 2CG8A 3W5ZA 2RUSA 2BQRA 1XR7A 4J7CA 5HSPA 3M8PA 3OJUA 1APSA 4HVZA 1RT4A 1D09B 4IG0B 5GAEI 3GV5B 3BGRB 1RHMB 3I0RA 1HIYA 5G0RB 3KHGA 5IC4B 3AY0A 2RQKA 4KGMA 1FRLA 3R5CA 2DNQA 2MQLA 2YKPA 5C24B 5C25B 1VHFA 3J7ZT 3AD9C 1Z2LA 3CDEA 2YH1A 3CJKB 2RDIA 4L3NA 2PDAA 1S5ZA 2DPIA 2UP1A 2ERRA 2CPHA 1DAXA 3D9BA 5AXMA 3PY8A 4NCAA 1SQFA 4ZVQB 1Z1ZA 1U02A 2MKIA 1QAYA 3D28A 2UV8A 1EZZB 2H9ZA 4NRTA 4FN5A 3ICLA 3BO2A 2MQMA 2QEXS 3Q8YA 4ZCKA 4QR0A 2OD4A 4JOUA 1UKUA 1RAEB 3M6WA 2WONB 4DOZA 2NXEA 3C2PA 4DQSA 1HR0F 3IA0A 1DRZA 3R27A 4WP8A 3VTIA 1FDNA 1IM6A 4DSEA 3PFOA 5EGYA 4L3KA 2O66A 5HATA 1SVDA 4CLLA 5E0OA 4USTA 1H2TZ 1OO0B 1VQKS 5B0AA 4DUZF 1A7GE 2E1MC 3HM9A 4OJ1A 3MMCB 2MQ8A 2XMUA 3RRKA 2LU2A 4UOCA 1DFDA 2ZE2A 2GIFA 3TWZA 4CO1A 4TY8B 4OIXA 1LOUA 4X4VA 4Q43A 1VK8A 2V94A 1R0AA 1BHNA 1FDDA 7FDRA 3NBPA 2ASYA 2YBVA 1QTMA 2VKRA 5KT5A 1G6BA 3Q24A 4L75A 2AF6A 1VQ9S 2E1RA 2B4UA 4LVNP 1T03A 3OSNA 4B3TF 2UXCF 3I4PA 1U09A 1S7HA 2VFUA 2LQBA 3I87A 2NYIA 4FP9A 3LGNA 2NYHA 4Y3CA 1S76D 3R6LB 2XC9A 3T3FA 2J76E 3UWTA 2XMAA 2B4VA 2YVSA 2GAHC 4NMLA 1T9UA 3TUZC 1TUWA 4IR9A 1CULA 4ZOSA 2HHQA 5BJRA 3Q8RB 4ZHRA 3ZTSA 3C15B 1AZSB 1HMVA 1S9GA 2FZGB 2R8GA 4UUXA 3B78A 4AQYJ 1HWLA 4CLYA 4M5DA 4CT9A 3SV3A 4DR6F 1JLAB 1VQLS 4J9LA 4KHRA 3EJMA 3DRPB 2WHOA 5DRKA 1RBLA 4ANEA 5KFYA 3BV8A 3FMWA 2Y8YA 2ZD1B 4ZLPA 3M9MB 4JI0J 4MMOA 2YNIA 1TU0B 5F9NA 3PW7A 4M5NA 2Q6BA 3PR5B 2IDEA 2ALYB 3TA2A 2HQGA 2M7SA 2DIVA 2PMZD 2BXJA 2FHMA 4I6WA 2MZSA 3BKFA 1R31A 4P7VA 2DNRA 4CLUA 4DSLA 2FY1A 2QFIA 3ZTRA 1SXLA 1KOOA 4IFYB 3VAMA 2QLXA 2FLLA 2DNHA 4LBHA 5KFWA 4LRCA 2KYXA 4Q8FA 4ECSA 2HVIA 4KGZB 4NXMF 3RAQA 4MKAA 1LW2B 2ZITA 1RAGB 3UPFA 1C4CA 2V4QA 5DDOC 3KOAA 3MUMP 2UXBJ 3DMJA 1JKHB 1QAIA 5H9FK 3RBEA 1NK8A 4O4GA 2QC3A 5CZVA 4ATNA 2HS3A 2OSQA 3OVSA 4DR3J 1T95A 4RU9A 1W26A 3D0IE 5DGAA 1U1PA 3BPSP 4PYAA 3FBBA 3OXGA 4ED1A 1DTQB 4RBTA 4DV7J 2DR7A 1W25A 3OFEA 3V6KA 2BJ9A 3W1YC 2DD8S 4RW9A 3UVJA 5HQMA 2HS0A 4DZDA 3LUYA 3HT0A 2HHHJ 4MKYA 2MY7A 1J5OB 3IP0A 2JEGA 3GV7B 4URGA 2DISA 3HD1A 3ZXWA 3TA1A 3K7RA 4H4KC 2DGOA 2DXEA 1MU2A 4AUKA 1SC4B 1Y7PA 4MK9A 2BM0A 1VRTA 1CJKB 4GKJJ 3EX7B 2HURA 3QRQA 3UO0A 4LR9A 1IUJA 1QSSA 5ETTA 5T14A 3DU6A 3DI6A 3PTWA 4ES1A 2GA7A 2F8EX 1FJCA 2IIHA 5D8HB 1A9NB 1CC7A 2DY1A 2VBWA 2YWEA 3FUYA 1VQ4S 3H59A 1FWPA 4IKAA 1T9XA 4X66J 1UPMB 1Y00A 3OR2A 3QQCD 4K4SA 2GJ2A 2LLZA 3P4UB 3DM2A 4ZDNA 5L38A 4ZPDA 1JB0C 4LFAF 2CADA 5D0RA 2WZ1A 1XR5A 4LUBA 1X0PA 2VC1A 1D8ZA 1IBMJ 2FQQB 4GMKA 3TJ8A 5D77A 5ETMA 2PFDA 4X4NA 3NGUA 3BGFA 3C16A 4DG1A 3MCMA 5L39A 4K4VA 4ED8A 2JEJA 5KG6A 4JI2J 3SMZA 3ETOA 3JSRA 2B7CB 4DLEA 1RADB 1CJVA 4XAKA 5KFIA 3A3OB 2VA2A 2D9PA 2HBYB 3GFZA 1D3WA 4DL6A 2W1BA 1TMMA 3IBFB 5JVHQ 3QGPA 1VJQA 3IG1B 3R5GA 2PI5A 2ZM6J 2BRLA 1WG1A 2M0GB 5ETSA 3FSYA 4EK2A 3AJDA 2ZEJA 4LRBA 1RE1B 5IM0A 3VV2B 5ETOA 1Q8BA 5L8RC 1IKWA 3LWMA 2HKEA 1GTHA 2DR6A 4LF8J 3CCTA 3K0JA 4QBUA 5KFXA 2RILA 3W66A 3T6JA 3GCWP 4KV8B 1RTIB 2VPWB 4TN2A 4CO4A 5A8KB 4LSNB 2H5JB 4NLYA 3SSQA 3C6UB 4DR1J 2HHSA 4ZP8A 2CQ2A 1VRUB 3TNVA 2V2KA 3FMBA 4DFMA 3I4HX 3D4JA 3CJSA 3AHPA 3JQKA 1OSCA 5KFGA 1IKXB 1F3VA 4DX8H 2J6SA 1FKOB 4CYUA 1RWVB 4ETZA 2CQ4A 5F0WA 4L6V3 2ZUGA 4U8YA 4YY3J 3MECA 3R7BB 2CPYA 2OEJA 4OHWA 3FQLA 1M90T 2D3UA 4X4QA 5KT4A 4F3MA 2CFXA 1JLGB 1SC3B 5DZ6A 3RYLA 4B3RJ 4DR2F 4F4XA 2AP6A 2HQ3A 1B0VA 1MLAA 3Q86A 4C48A 2F7VA 3CGIA 3DGPB 1IKYA 1FTCA 3UDVA 4H4MB 1ZAXA 4OV1A 5F8MA 3MHYA 2ZZNA 1S1WA 4ZMMA 2DTJA 4OZ1A 2HFVA 3I5AA 2F40A 3JYTB 1XTZA 4UF4A 2WBRA 1DQAA 3G82A 4F4WA 1NAQA 1SQGA 4USKA 1WC3A 2F63A 1RSCA 2M3DA 4RUAA 1FDBA 5HN0A 4FBUA 3NNHA 3CMAS 3KK3B 2P9CA 1KHVA 1S1UB 1ZETA 3PO4A 3NWGA 5BYQA 5J1PA 4F0KA 4O44B 3NMAA 4LVOP 5H9EJ 1ITPA 3RBDA 5E3AA 2W4CA 2J9CA 1VOMA 3NNCA 3HSDA 2ACMA 2HHPA 3HXMA 4CO5A 5L1JA 1IBLJ 2GCFA 2XMTA 4X2BA 5DG8A 1SJ4P 2O5DA 4A46A 2XCAA 1S59A 3KNAA 2HWHA 2CXEA 3LO3A 4YR2A 3D6MB 1C1BA 3DDNA 4C0OC 2B9YA 4N41A 3I0RB 1RWOB 3GV8B 1WEZA 3BJYA 1C0UA 3LQVA 4OYMA 3IRXA 3EXCX 1L3KA 1KFDA 5KT7A 1XWLA 2MDAA 3KXDA 2C2MB 3AB4B 4JV5J 2V8PA 4C11B 2UXBF 2QX0A 1X4AA 3H7HB 3TARA 4Q7AA 4XDDA 2VOPA 2RMLA 5DLGA 3CDAA 3N6LA 2XY6A 1H2UX 3FRZA 5DDQC 4QWAA 4Y2KA 1K8AT 3N5FA 5IWAJ 1KP6A 1ACMB 5I3UA 3ENQA 2G2OA 1LFPA 3IR6B 4DQQA 3BM7A 2ZH4A 4EI2A 2M4MA 1X60A 3PV8A 2J0WA 3K59A 1AROP 3UN2A 3ZZOA 1RT2B 1FJEB 2MKYA 2O1PA 4N76A 4BLGA 2E5LF 2C2RA 2VZ9A 4EBEA 2J9DA 4DS5A 4CRJA 3S6EA 3MWBA 4GVBB 5HL7Q 2AEFA 1ZM3A 2DNGA 2RRNA 3P5BP 4DL4A 1RT7A 2U1AA 2V4JA 4TU7A 2QSWA 1H6KX 3MF5A 1UFKA 2B4OA 4GKJF 2WVFA 2FLNA 1CC8A 5CYMB 2I5JA 4GC7A 1TZ0A 3J7YU 5D6GA 1YWXA 4PRFA 2JJ4D 1PKUA 1EKRA 1SV5B 3BGLA 4C0HA 3ONQA 1S72S 3T9NA 3GG0A 1N48A 2ZE2B 1FFGB 2D74B 1FKPA 1AW0A 1WC4A 4DSKA 2MJUA 2YKMA 4F25A 2YKQA 4BBYA 4JI6J 2CJYB 2DR8A 4IOBA 1E6YA 2YKAA 3VHQA 2AQ4A 3NBPB 2OFHX 1YIJS 1R6VA 2UUWA 3RRHA 2DNNA 2RQ4A 1T03B 1IBCB 3A8KA 2VU5A 4ID5A 1IBMF 1JWWA 2D69A 4AL6A 3LP2A 1WDDA 5DS7A 4I1TA 4YQWA 3ZFVA 1VC5A 1AA1B 1NLKL 3B8HA 3M8WA 4JI3J 3FZBA 4Y2CA 3EMTA 2PD1A 4Y2MA 5F0UA 3AXKA 4ZHRB 2UV8G 3WZ0A 2VODA 1HMVB 4RLEA 1S9GB 4WFXA 2ZM6F 4R5PA 4M5DB 1UEUA 2HVDA 3CT9A 2PT0A 3ZC4A 5T41A 2JOQA 1KFSA 2HFZA 2Z2YB 4ZJLA 3G6ES 1PAEX 2OMOA 2FHJD 3PXGa 1RQ0A 1TKZB 2VQEJ 2XZTB 1ZPVA 5E3RA 1XR6A 4ZVFA 4O3PA 4F0HA 3QLHA 2BANA 3MGJA 2C3PA 2NZ4A 5JMNA 2FJDB 2KZZA 1NK7A 4M5IA 4HLBA 1HQEA 4EZ6A 2IC3A 2QLFB 3QPIA 3CMES 2XULA 1SKSA 1ZYQA 3MMAB 3D6TB 4C97A 4UW2A 1S77D 2YWKA 1Z2ZA 3DKDA 2HBRB 3MM9A 4DF4A 1RAJA 5E3CA 3C19A 2IVFB 1Q8LA 2F5GA 4WTOB 4NYPA 1H73A 1HI1A 2E9TA 3IGVA 3W3SA 4F4KA 3CJTA 1M5VC 4LSZB 1L3TA 3TOQA 3PYFA 4MJKA 3EYZA 3DGVA 1NB2A 4O4GB 2J9EA 3DU5A 4J9QA 3G87A 4WWSA 2APOA 3HMJG 4M5MA 2O01C 2YY3A 4OZNA 1WJ9A 2P6TA 4C2MA 2R7UA 1EAYC 2CQCA 2ZBPA 5J2MB 3VGSA 4RW9B 2W8KA 5FDLB 3G6XA 4UZCA 5I4MA 3UVJB 4YHHJ 1FVQA 3FSIA 3CO0P 1TAUA 3W2VA 3AXMA 2EPIA 1YJ7A 3QRPA 4QQBA 4F4ZA 1Q4RA 3Q0AA 2ASJA 5JUMA 1MU2B 2LMIA 2QA4G 3MEEA 2OJ3A 3UCUP 3VQTA 1P8GA 2XM3A 2CNLB 1WHXA 1G4CA 1VRTB 1SC6A 3KG1A 3O3LA 4I2PA 3RJMB 2MJNA 3RUBL 4O3NA 2L41A 3DI6B 2BVZA 1RT3A 3MZIA 2A0FB 2CPDA 3TA0A 1IBLF 3EVWA 4ED6A 2H4WB 3ZZ0A 3TEGA 1UVNA 1F9FA 4C98A 2Q3PA 1AT1B 3ZTQA 4F67A 3R7SB 4KFBB 3TVKA 5L1KA 1S0OA 2Z4PA 3NG8A 3T1HJ 4P72A 1Q7YT 3OR2B 4ZLNA 3TR5A 2LDIA 1TR0A 3GFHA 2W7PA 5BXIA 3NY0A 3DM2B 5JJBA 3PJ9A 4RW8B 1UEKA 2ADBA 1U6FA 1NDCA 4AD6A 2BM1A 3TP2A 4N47A 3MR2A 1U2RA 3L7OA 3NCPA 1X8DA 1K73T 1R8CA 1RA7A 4ZPBA 4OHVA 1PBUA 1O51A 2YKNA 3AQPA 4GC6A 2ZHOA 2YPYA 3C16B 4DG1B 2DNYA 3MR6A 1ICEB 1QM9A 2K7KA 3UD3P 3KG4A 2N7CA 4TQRA 4DV6J 1UW4A 1XERA 3PHTA 2E5JA 5IWAF 3PCOB 4MIBA 3IGNA 1BQNA 4K4XA 4UZBA 1NDPA 1CLFA 4HL9A 3LPEA 5IS2A 5GAGU 1RHRB 3G6VA 4XIUA 1JX4A 3CJQA 3M2UA 1U1RA 1HWJA 1RT6B 2LKZA 4WZMA 1SIWB 3IRWP 2YWFA 2PA3A 4WF9Q 2R9LA 2F3JA 3AD7C 1IKWB 2RU3A 4ZPTR 4CLZA 4ZPCA 2DHAA 4BC9A 1XNRJ 1U8WA 1GMVA 2DNKA 4OQJA 2HNZB 1PILA 4Z7CA 1FEEA 1BY9A 4WFZA 3SFUA 1R43A 3DDIA 4LBIA 1RT1A 3CE8A 3ILJA 5HVFA 1IJFB 3C3LA 4JBCA 4CO0A 2R8KA 3MPWA 1VBYA 4C8OA 4JI4J 2AIRB 2HFOA 1VQ7S 1XNQJ 2A10A 4DL0C 3CD0A 3ITHA 5B0GA 1YJ9S 2RDJA 4JI6F 4N77A 2A2CA 4CYUB 3VALA 4JV2A 5K20B 2JWNA 1YTYA 1X4DA 3MECB 4ZITA 5SZTA 2QA2A 4QIGA 3D67A 1JLEA 4KIAA 3GQCA 4MAKA 1WG5A 3HK2A 1TL7A 4F26A 8AT1B 3EPGA 4NPOA 5M2PA 1S0MA 4U95A 5IXUA 4JI3F 4DPTA 1R8PA 2RQMA 2PGCA 1IKYB 3A13A 1PJ7A 4H4KA 4BHQA 1NK5A 2CPFA 2YX7A 3KHRA 3M9OB 2FLPA 1S1WB 4KGVB 4JV0A 2HAIA 2VKZG 5T7LA 3G82B 2PC6A 3W5XA 2HK2A 3TAMA 3SCIE 4EYIB 2WVCA 1S97A 5A2QY 4URQU 1YHQS 1OSDA 2I38A 4OI2A 2VQEF 2KFYA 4YB6A 3OTBA 4CZCA 2A6OA 4HHJA 1BLUA 1NKEA 1Q86T 3H0PA 1YRTA 1YK9A 1WG4A 5LXYA 5J2NB 4OX8A 5AJ3J 3ZZZA 3B4MA 1IQTA 1C1CA 1EQMA 1MW7A 3HJVA 5LJ5Y 3UDEA 2MZRA 4OZ3A 4JI8J 3K8WA 2VV5A 4MIAA 1LWEA 3PYDA 2WB4A 4IYQA 4RNHA 5D0GA 2EW9A 1EQ0A 1P27B 4M94A 2OAUA 1NHVA 1C1BB 3KLHA 4CM0A 4UOHA 1T8EA 5CXTA 2LDYA 2W9CA 3QO9A 3PEHA 3U1MA 5HMYA 5KFSA 1SJQA 4ANDA 3IRXB 2DO4A 1BC6A 4ED3A 1YJNS 2ZDOA 5GADI 1U6BA 2UUBF 5BR8F 2XHCA 3OXLA 3PACA 1NZ8A 3W8PA 3TAQA 2HYIB 4B9NA 1KSPA 2M9KA 1K0TA 2F9JA 2NXJA 2VJUA 1NXIA 2LXUA 4O0NA 4IQXA 2CQ0A 2XLJA 4XTTA 2AJ1A 2KG0A 5A76A 3ZTPA 5E3QA 4BS2A 3GIRA 2MSSA 2AYEA 2HHWA 4O3QA 2CJBA 2VPXB 2XB2D 4NI2A 5I3UB 3A8JA 3R5DA 1EIYB 3T1YF 4K0KJ 3RB6A 4P52A 1YLXA 2LYVA 2YNGA 2J7UA 5KFFA 2YWGA 2F8MA 3NEKA 2B5JB 1I1GA 2QSFA 1HYSB 3O2IA 1ZTTA 3K89A 5HVGA 1V3SA 1TP7A 3B82A 4FF1A 1RT7B 2V4JB 2ZDPA 2ZH6A 4RWXA 1BQMA 2L9NA 3A12A 4LSLB 1PJ6A 1U0HB 4TXSA 2UVRA 3ZNJ1 2I5JB 4M1KA 3QJJA 4HI1A 1V6HA 1S48A 3SDEA 3THTA 5IT9Y 1WWHA 2IM2A 2HQDA 2ZH5A 1XMOJ 3H2LA 2ZKTA 4DV2J 2EKYA 1VBZA 2YNHB 3OV7A 1SBRA 2IJFA 2DIUA 3J80Y 1CJTA 1FKPB 3T1HF 2BOAA 2HHUA 2YKMB 5EUHA 2Q66A 4USUA 1V3RA 3M32B 1DJ0A 4TVAB 1B4SA 4Q0BA 2OO4A 2FJVA 1WF0A 1U26A 4U8VA 3DRRA 3G6YA 4FYWB 2FD2A 4UOFA 3GE9A 4ID5B 1S9FA 2KJVA 3JAMU 4ZA1A 2HPUA 1Q95G 3OBIA 1VK3A 1U47A 3IO1A 3LP2B 5IT4A 4ED2A 3GPAA 4CTAA 4J90A 2NREA 3OTDA 4KGKA 4DV6F 5G4DA 3FEZA 2R7QA 4A8YA 3LH2S 2BMBA 2XSFA 1RWXB 4ANCA 3UDCA 2ABYA 4DQPA 1MROA 1OYEA 3P3DA 2DCLA 2BUNA 2I8EA 2FVPA 4DHVA 4O4RA 4A8FA 2UUTA 3TUPA 2C42A 1VR6A 1U45A 3I9V9 1SH3A 2A3JA 3V5RA 2QLWA 1BE4A 5B09A 1N34J 4I56A 2B0GA 2EVZA 2E29A 2H48B 2LXIA 3RU0A 1XNRF 1U1LA 1T9TA 5E41A 1UFWA 3K5MA 2VG6A 5CCLA 8RUCA 3QLHB 4HDHA 2BANB 2FJXA 1T0TV 2V68A 2QE5A 4HTJA 2LQ9A 1WOOA 1X0FA 2DEJA 3MI7X 3LF0A 4MK8A 1NDKA 1HQEB 4PZVA 2G1HA 4JI4F 4DQIA 2W2MP 2XCPA 1HQ2A 3P5TL 1FXRA 3KJNB 3UDLA 1HBNB 2LEBA 1FF2A 1VQNS 1L3UA 1YSJA 1V3ZA 1SJRA 2GGPA 4U7CA 2IAJB 4HHHA 3MM9B 1KHWA 1TL3A 2A2DA 4NLWA 4Z7YA 4IG3A 3TVYA 3QBCA 2XSJB 1P9YA 2RF2A 1J5EF 1IWGA 3KJQB 3D5MA 2PE8A 2N7YA 4IOCQ 1VC0A 3H20A 3D2WA 1YZ7A 1ZZFA 1FA0A 4WP3A 2CQ3A 4E2FB 3BGRA 1VQMS 4TLRA 2LEPA 1BWVA 1MN7A 2BE2A 1NK6A 2B3TB 5C25A 2W4DA 4MH8A 2F4VJ 4DCPB 4J9NA 4QU6A 2MPUA 4KJIA 4KSEB 4USIA 2ZVIA 2ILZA 1JMTA 2NUHA 3NAIA 4NA3A 4QPTA 1K47A 1WHVA 2LQ5A 5DQHA 3KLVA 4LF7J 4RZRA 2CQBA 3R5AA 3Q83A 2QYCA 1RHJB 4NZ0A 3W2VB 2W8LA 4L76A 1VLOA 4DWIA 4F3QA 3CJ3A 2JLGA 3T6BA 4NL5A 2VDHA 1PJ5A 2LECA 3QJPA 3MEEB 2V9KA 3QT6A 2B9XA 4M8LA 4QIFA 5AJ3F 4HH1A 4I2PB 4J9RA 4JI1J 2MZJA 1NO8A 2Z2MA 3MOJB 2R7XA 4JI8F 3NWRA 1RT3B 3NLCA 4MYUA 5AE3A 1PBAA 2IRXA 4OZ5A 2UU9F 1OJ4A 2OPPB 2PA8D 1N33J 3PRDA 1HW8A 4KGXB 3QFWA 2HLTA 4ZPVR 1RCXB 2CG4A 2CPJA 2V34A 4NLPA 1YX2A 1YRXA 1U4BA 3TX8A 3R8YA 4OHZA 3MMCA 4ZN3A 4G65A 3W61A 4DBQA 2XQCA 2QLBB 1FERA 4HDGA 1HNZJ 1O0PA 1Q79A 3FEYB 4DPOA 4WXOA 1FX4A 2ZH2A 3POTA 2M8HA 2YKNB 2NZCA 2BW7A 3NS6A 4ERDA 3EGZA 1F60B 1WSVA 2COLA 1TKTA 3OL7A 5ETLA 4OLPA 1G7CB 2WB1D 2M70A 1CS4A 4C8YA 3GJRB 3M6XA 3DDKA 2XO6A 1SI9A 1GT8A 1M0SA 3G2XA 1FI4A 2K3IA 1BQNB 1X4HA 1SC1B 2L9DA 3N6NA 2KVQE 2MY8A 4KC5A 4EO8A 2R42A 4LQ3A 4DSFA 5HMZA 1R8AA 2GFFA 2QT7A 4ZLLA 1WACA 4JI5J 3M2UB 3H25A 2JLFA 4G1QA 2N4DA 5H9FJ 3CB4A 3FC9A 4K8RA 4EBDA 1TVRA 1GX5A 1T9VA 3K58A 4TU9A 1U2CA 4USWA 2UVUA 4DR7F 3TO8A 1JLAA 2XY5A 3KK2B 2AHOB 2WBMA 2ATCB 2CKWA 5KFKA 4CNZA 4FBTA 2RVJA 4PG4A 3PG9A 1UPPA 2YNFB 1XMOF 4WTYA 4NYOA 4DV2F 2KB2A 3B54A 3ZZUA 4EZ9A 1Y11A 4R8UA 1W2IA 4KPCA 4WFYA 2J0SD 2WVBA 2H51B 2QJ3A 4F02A 5L46A 2E5IA 4IH7A 2NS1B 2DNPA 4OI0A 1V5IB 3VAHA 2XMVA 2MMYA 3FKBA 3ITHB 2OI2A 2VPYB 3HI9A 4ES3A 2R2UA 1RAIB 1QUVA 3TUIC 2E5HA 5KFBA 3RBZA 2Y3YA 4RWWA 1SL0A 4YDDB 4OHYA 4D3GA 1JLEB 3LW5C 3GILA 1M5KC 4GKKJ 1XBWA 1OIAA 3PVXA 1WKJA 1TL7B 3P49B 1T7PA 1XC9A 5EWFA 2IJRA 4ICLB 2HQIA 2VDIA 3WC2A 3UI3A 2IMWP 3PX0A 3MR3A 1S6QA 2H65B 1M5OC 3Q23A 1HW9A 2RT3A 2FGCA 1NHUA 2XYHB 3MM5B 3PNIA 1VISA 2ZNYA 2P5VA 4ER8A 1G3OA 1CEZA 1MMDA 4NWBA 3Q22A 2XZDB 5GAHU 3BR9A 3O44A 4LMZA 1PCAA 1HBOA 3EXYA 3JQJA 1FRXA 2XS2A 4AT1B 5D4NA 2V8DA 4F0MA 1QLNA 1X4CA 4G3IA 5IV4A 3QIPA 2QL9B 3GWCA 2GVDA 2DGVA 4Q45A 2CJAA 5CD4H 2X1BA 4G6VB 5HLFA 5HVHA 3UR0A 3GYXB 2WTFA 3KJVA 3K57A 2DK2A 1NRKA 2I9SA 3MM6A 4C3MA 2ZJRQ 1HPZA 3KLHB 5HP1A 4Q2MA 4WU3A 2EBEA 2JX2A 4Z2XA 1REGX 4X62J 2W9CB 3QO9B 2ROEA 3PKMA 1R8BA 2EWHA 2HFSA 5F8NA 1U24A 1LWCA 2RRAA 1WF1A 2XMWA 2ZBRA 4HACB 4E98A 3VAFA 1WC0A 2F4VF 5DDRC 1PYTA 1KRPA 3HKWA 3OLBA 3LAKA 2ZOGA 4MTPA 2K7JA 1SJ3P 4C7QA 2EI5A 3CCJS 1RUSA 5HAOA 4NI2B 1XMQJ 3FRYA 2DH7A 2Q1LA 2HNYA 2VC0A 4LF7F 1QSLA 2BYCA 2YTCA 2AJQA 1WSRA 2XZWA 1YITS 2YNGB 3JSYA 3H98A 4GO5X 2Y1JA 1FRJA 3NCQA 4NASA 4RUBA 5GMDA 4QWEA 2W2NP 2GZOA 4RW4A 2G2YA 1BQMB 3EZ5A 4TLQA 2VUGA 3ET6A 2VFRA 2Y9HA 4JI1F 1P1LA 3D1QA 2R2TA 3S1TA 1K1QA 3AOBA 3SDEB 2ASLA 5KFAA 5SUHA 1KDNA 2XNQA 5AXNA 4Q2LA 4ZPAA 4USMA 3PM9A 2KXFA 1F5CA 1HI8A 4A48A 1KLNA 2JVRA 1CJTB 1YG0A 2R3VA 1X4GA 2KRRA 4DPUA 5FLXU 2CJKA 2CVIA 5IC6B 5IV3A 3DHWC 2PEHA 4OJ3A 5A8RB 3C6UA 3MUVP 2V5HG 1VRUA 1KVKA 4AFFA 1TL5A 1QAJA 4Q0BB 5KFQA 4FF3A 3DRRB 1HNZF 2IYIA 5J2QA 2RS2A 2Y0BB 4I6AA 2RIJA 1BQXA 3OVBA 5KG3A 2DEIA 1Q78A 1I51B 1SQEA 1EP4A 2ILYA 3GIJA 3BYPA 3FFIB 2EFVA 4JYAJ 3UN3A 4YB5A 5ETVA 2POKA 2ACYA 5KG1A 4G1PA 3BZQA 2KRBA 2F65A 2GHWA 2JZ5A 1TFYA 2PMHA 4RX6A 3TX0A 4NZ6A 1UJ6A 3QGIA 3SXLA 2ZKUA 3J81U 4JI5F 1AYEA 1FFWB 3MTJA 3PIOQ 1F1BB 3VR1A 1F5AA 2LCWA 3V81B 6AT1B 2QMWA 4F04B 5KFLA 1S4EA 5D0EA 1W7WA 2R8JA 3K5LA 1OPZA 5A8WA 2VG6B 1NHKL 3J7YI 3KJFB 2NLWA 4FVCA 4XDCA 2OP5A 2HHTA 1IQZA 1U49A 3KLEA 1WC6A 1VQYA 4PG8A 4H4OB 2CZ4A 2C3UA 1WC5A 1KD1T 1RT5A 1S1UA 4HI2A 4DX6A 4ZVOB 2FLOA 3MEGB 2YX4A 4F2SA 4ED5A 2UVWA 1WC1A 3HF5A 4OV6A 2AX0A 2DB1A 4OYZA 4QW8A 2PEBA 1T05A 2UUAJ 4U9RA 3GU0A 2D41A 4W4MA 2AYGA 1SJ1A 3NGDA 1IKVA 2J5AA 1XJWB 1QJHA 4FYYB 1TL3B 3SQOP 2FC9A 2QMXA 4IG3B 3TAPA 5KFVA 1OWXA 3KK1A 2RF2B 4KQZA 3WBZA 3L4BC 3QATA 1B3TA 3MTKA 3O1LA 5EWEA 1MWZA 2DGWA 4PG6A 2D3OR 1N5YA 2KKHA 2OEKA 2GW8A 4YB1P 1UA0A 2BE2B 1WOSA 2MZ1A 3G71S 2VHGA 1RWPB 4PQAA 3KMQA 1FWLA 2OFGX 1RLCL 3JSMA 4C11A 1QDUB 4CNYA 1Y4ZB 4BWMA 1FHTA 7AT1B 3DOLA 1H3DA 3KLFA 4O3OA 3GIIA 3CDUA 5D15A 3OR1A 3QZ8A 3F44A 3OXFA 5F41A 5KFOA 2FVCA 5EN1A 4ZPWR 3A8IA 1TV6A 4I6YA 2KHCA 1I94F 4QIEA 1KR4A 2RUGA 3GLJA 1K0VA 1TTHB 1FCAA 5HK4A 5IT0A 2VOOA 3WHIA 3EM1A 2AJ0A 4PXCA 3BSNA 4QYRA 5DM6Q 1RT2A 4CO2A 5FD1A 4NLQA 5DQGA 5KFZA 2ZH1A 3DNCA 5HJXA 1T3OA 4YUDA 2FZCB 4NCBA 4GVBA 2IDLA 1W2BR 3D3CJ 3GONA 3R2CJ 1Y10A 3OFHA 2RS8A 5B08A 3TEHB 1NSQA 2XI2A 5K9FA 3M6VA 4E8UA 4PPZA 3LP1B 5CYMA 3LPYA 6FDRA 4PYDA 1N32J 1KN6A 3NXZA 3G9CA 4I64A 4V1Ak 3VVTA 1ZZNA 4X62F 1SV5A 3D54A 1R7IA 3BQ2A 1Y5LB 5KFDA 3T9ZA 4UY8T 1EX8A 4ZVTB 3NNAA 4OYIA 5EWGA 1RI7A 4V19J 3U1NA 1TQLA 2E9RX 3FBFA 3HFVA 3W2WA 2XS7A 3POTB 2GHPA 1HNVB 3TVZA 4O23A 2KFZA 1Y9OA 3V6DA 4TNOA 3MDFA 3MOZA 3U1LA 1RHQB 4NLDA 1TKTB 3MR5A 3P6YC 1CS4B 2FJEB 5D0HA 2ZWPA 1WHYA 2AT1B 4Y00A 3JTOA 4DV5J 3H5SA 2ZC3A 1QD1A 3N01A 1HI0P 3MAQA 2DR5A 3PZPA 2FTRA 4B9SA 2C2KB 1EKSA 1CJUA 2QG9B 4NCGA 5DM7Q 3M4XA 2BE9B 4G1QB 4U96A 1KQGB 4TY9A 2OGUA 5KFUA 1L5UA 1TVRB 2M88A 4CLWA 3D68A 4RW7A 4FZVA 3R7NB 1MG7A 3CMQA 2G4BA 2HLUA 3GP9A 1WI6A 3OHBA 1HA1A 1VIOA 2LA4A 4EGLA 1RDRA 5EDWA 4LIRA 1Y5NB 4IR1A 1S99A 1TKZA 1AUSL 2WRMA 4IFVA 3K5OA 3QFHA 4R8UB 4LR8A 3M2RA 2M52A 2JH3A 1SJFA 4CO3A 3HFKA 4QW9A 1UP1A 3GG1A 4ZCLA 2Z2LA 1LWFB 3U7JA 4NZ7A 5DETA 5IQQA 1HNWJ 1OS5A 3WDOA 3CJ4A 2AGQA 3EDRB 3QRRA 2KI2A 5KFMA 1S57A 4CCHA 2JSXA 3CIMA 3TW0A 3MMAA 1N4LA 5EHHA 2VONA 4P10A 3HVTA 2CQHA 4B3MJ 4W90B 4W92B 3TJ9A 3VGUA 2YQ1A 2HQFA 1XK8A 1ZM9A 5DG9A 1RYRA 2MLXA 2V2VA 1VBKA 1MN9A 1O6XA 1UMJA 1S6QB 2D1CA 2ZHAA 3PX4A 5F8GA 4LFBF 4I2QA 2RJZA 2RU9A 1VJWA 5GAGI 3F41A 4NEYA 3GB0A 4N7TA 2DT9A 2KYZA 1QSYA 2Y1LB 3BEGB 4U6PA 3KLGA 3K2YA 3L7PA 1HHTP 2CPXA 5EX0A 1FT8A 5J2MA 5K8MA 3LTOA 3GIKA 5FDLA 3ISZA 1PYSB 3HULA 1NZAA 1GMWD 3HCXA 1HBOB 4YS2A 2W25A 3MCOA 1SKWA 3PO5A 2KO1A 1UJ4A 2DH8A 3QIPB 3O6QA 2GVDB 2MKHA 1X9SA 1WTBA 2MKKA 2CNOB 5HQ8A 1RU1A 2NPIA 1JJCB 5HLFB 4QOTA 4P2XA 3KJVB 3SYZA 2KDOA 4WK3A 2UUAF 3MMBA 1B7FA 3MM6B 2AYMA 1LEOA 2K8GA 2O3DA 5HMWA 1HPZB 5FJ4A 3Q8SB 3BGOP 2VH7A 1GMUA 2QA4S 5HP1B 1VQPS 4PXDA 4WPAA 2V69A 5CYQA 4KFBA 1RB0A 1HWIA 3IM8A 4O3SA 1RHUB 3ULHA 4OI6A 2J0QD 5ETQA 1R6YA 1AB8A 1OPIA 1LWCB 3T19A 4HKQA 4RW8A 3G96A 1GX6A 4ELVA 2FYXA 3CJRA 1RYSA 2DHGA 4USHA 1A0OB 3R2DJ 3AFGA 2OTLS 4WJBA 3GSDA 4KB7A 3CULA 3G86A 3WX8A 1QE1B 1RWWB 2HNYB 4KHPJ 1XEZA 1GEHA 1I3OB 2OD6A 4Y2IA 4A8OA 1KQSR 2CPEA 2WCXA 1UVKA 4PQUA 2CZ9A 4IH6A 3SQGA 2BRKA 1RP5A 4RW4B 3ILLA 3IMQJ 4JB8B 3CCUS 3QT5A 3UD5A 2F4FA 1H7XA 4ZVHA 3ET6B 1RT6A 1HLWA 1XMBA 4J9SA 3CC4S 3KNGA 4HTIA 4IO1A 3IFEA 4DV4J 2VB6A 2VL1A 2QO3A 2DITA 5CABA 2HNZA 2KT3A 1N32F 3V2UC 2BJDA 2LU1A 2V9WA 4KH0B 4MK7A 3O8WA 4OZ2A 2CJ9A 2Z30B 4NLOA 4Z37A 4RW6A 1TK8A 2B7BB 3VZIA 2JLEA 3B6BA 1F3FA 1S49A 5J2QB 4NE9C 4OX7A 4ED4A 4KO0A 1NJYA 2BX6A 4B3OA 3V4IA 2OELA 2KT5A 2L3MA 3UFCX 1EP4B 3I96A 4P9SA 1LWXA 4CH7A 2CPIA 4WKYA 3Q2TC 1HQUA 3HLUA 3J81j 2AZ1A 3W8GA 4DV5F 5F9LA 4CT8A 2AX1A 3EGNA 5IQ6A 3TZWA 3JSBA 2XMKA 3UD4P 3CC7S 3F56A 4FYVB 4U7UK 4J91A 1X9MA 2FVQA 4K2JA 5CYJA 1V9OA 3SI8A 2KXNB 3AH6A 4AL7A 4DN0A 1UVMA 3LALA 2AGOA 1VIXA 3MAHA 1HR0J 1VYAA 3JQMA 4M5JA 2H5IB 1HWUA 4TKTA 2KM8C 4EEYA 4AXJA 1HNIA 3RAMA 4GRSA 4NXNJ 4AQYF 3DLKB 4USJC 5A8WB 3SZ2A 2EG1A 2HHXA 2XS5A 3KLEB 3C6TA 4NMXA 2AEMA 1CG2A 1KNZA 2W9AA 2MQNA 1RT5B 2E66A 5E2QA 1SIZA 2EFQA 3QT7A 1DTTA 3H4DA 4JI0F 3BSCA 5J2NA 4J5OA 3TZXA 4KKOA 1T05B 1H98A 2VBZA 2R8IA 1JNZB 4I67A 1HNWF 1IKVB 2ZZTA 4D3HA 2E1CA 1KONA 1SH0A 2IM0A 3KK1B 1FNXH 2UXCJ 3E3XA 4ECUA 1C0TB 1VQ6S 4B3MF 2VFTA 1DQ8A 2G0CA 2P9GA 1LXJA 3DRSB 3M8ZA 3D6HB 1PYOB 2X3GA 4LF5J 1N5YB 9RUBA 5DZ7A 4K4WA 4N8OA 1X7VA 4UY85 1NJWA 2GMJA 3Q89A 1ZTWA 3TYTA 3K17A 3JSMB 4QYZK 1S0NA 2I6WA 2Q79A 1X9WA 3DOLB 1R0BG 4ED0A 1WD6A 3KLFB 5KFNA 4CIOA 4J9UE 4DR3F 1H7WA 4X84A 4YEAA 3OR1B 2RAQA 2W9BA 3OW2R 4PWDB 3AJ1A 4I69A 2PIIA 1U2FA 2Z8QA 1TV6B 2IM1A 4TQSA 4DV7F 2VQFJ 4B3SJ 2BR0A 1RU2A 2X51A 1NBEB 1IN0A 4NRUA 3ISND 1XQIA 3CJ2A 1UFLA 4DSJA 1R3NA 2HHHF 5KG7A 3R97A 3PW4A 1ZH5A 4OYOA 1ZAWA 2B5JA 4YFUA 1HYSA 3ISNC 2K06A 1S6PA 5KFJA 5ETKA 3MURP 1P6TA 3BH6B 2IHR1 3IN5A 2B56A 2IA6A 4LSLA 2QGFB 3CJ5A 1U0HA 2HRTA 1ZPWX 5F8LA 1VLYA 2QZ8A 3QGGA 2IYGA 4OHXA 4K4YA 1GFWB 3BGUA 2DHXA 2HFNA 4DL7A 1RWMB 5ETNA 1RTDB 2YNHA 2CQGA 2XLIA 2WOMB 2MHEA 4KYZA 3KMSA 2G0IA 3I0SB 4X66F 1U1NA 2QFJA 4LJMA 4QZVB 4ZP9A 3W2WB 5F3TA 1CBKA 3HJFA 3M32A 1Q5VA 1NDLA 3V6DB 4GO7X 2JC1A 1TFWA 1HKAA 4OFZA 2HHVA 2U2FA 4B02A 4FDFA 2XG8A 3T5KA 1FO1A 4FF4A 1REVA 1N8RT 2ZJQQ 5LSOA 1DQ9A 1YJVA 2D7SA 5C5JA 2DKOB 1TL4A 4IRKA 5J2PA 1YQHA 4KHPF 1NK4A 3IR5B 5DGBA 1UZHA 4O3RA 2PI4A 1WF2A 2DNOA 1SL2A 1ZA2B 4M63A 1UZDA 4OYXA 1DURA 2XGQA 1T02A 4WIQA 5KT2A 4JI2F 4ZKAA 2RQCA 3CDBA 4IRCA 1WI8A 1SB6A 3GIMA 1CJUB 3UN5A 4NCGB 2E1PA 2V2ZA 2GIRA 3BKTA 2XTJP 4A8KA 2WW4A 4RW7B 1U1OA 2H54B 1XIQA 2R7WA 4BWJA 5IFMA 3EVOA 2DJWA 1ULRA 3AB2B 4NLTA 1S1VA 3ZO7A 5LMUJ 2J8SA 4LBPA 5M2RA 2Q6CA 3J7AN 1BGXT 4LF8F 4IFVB 4KHMA 3QGHA 3WC0A 2HIYA 3M2RB 2N4CA 1OY9A 4S0MA 4C8KA 1VS3A 1K44A 2E9ZA 4ETXA 3H2VE 3VZHA 5LOQA 4DR1F 4OZLA 2V2QA 4KBIA 4F4AA 5LL6d 4IDKA 1KTQA 4ITSA 1HBNA 4I68A 4LFAJ 1AFJA 5KAKA 1VI7A 1YJUA 2FDNA 4MKBA 1PGZA 2AWZA 3HVTB 1FXDA 2IAJA 5C2CA 2XSJA 2A1BA 3CCZA 4YY3F 2CJXB 4FNHA 2EXUA 3WX4A 5HBMA 2NXNA 3ZZYA 3DLJA 4B3RF 4NLXA 1JLFA 2WK4A 2C2DA 4FPIA 1HBUA 4I2QB 2P2CB 3X3UA 1Q0NA 1PC5A 4C6AA 3NL0A 4M5LA 4ILLA 1FX2A 1YGYA 5L9XA 1JLCB 1YJWS 2YXLA 2OTJS 4CLPA 3QAEA 5LSRA 3KLGB 1S9EB 2Q43A 3X1LB 2FVSA 3D66A 4NXNF 1RWNB 5HQLA 1UTAA 2X7IA 2V4RA 3BH7B 5GVQA 1PSDA 3OTCA 5KG2A 5B0EA 1AFIA 3HSGA 5KFPA 5C42A 4DL5A 4AE5A 3IXQA 2K1RA 5KFEA 4ECZA 3M1VB 1FE4A 1LW0B 5B0FA 2BQ3A 2RRBA 4P73A 2P9EA 2UZAA 3ZZTA 2DNZA 3MMBB 2GHVC 2HZCA 5A6WA 4DF8A 3PYGA 1X5SA 4F4YA 1R0CB 2XEXA 3N4WA 2HG4A 1NNDA 3H4BA 2I2YA 1JLBA 4FYXB 2ZBIA 5CYQB 2KTQA 2OPPA 3NKYA 2Y1IA 4ZLJA 2XWYA 3GZ7A 4FPRA 3T5JA 3PRVA 1UA1A 1RAAB 4HEA9 2FJAB 4PWWA 4C8LA 3NS5A 1M5SA 4LF5F 4DR2J 2X1AA 3DLLQ 1N5QA 5DG7A 2C2NA 5GMEA 3TZYA 1ZM2A 2H4YB 3PYEA 2B9EA 3MEDA 2N82B 4JV5F 3G8SA 3QWUA 1GXUA 4ED7A 2DGQA 1NM2A 1E6VA 4X65J 1X5OA 3OL9A 4EMDA 3M6UA 3FZ2A 3PIPQ 2G2ZA 1DHMA 5KG5A 1YBUA 4U67Q 4DEZA 1N56A 3E01A 3QZ7A 4IO9Q 1K9MT 1FFSB 3U02A 5GAHI 1VMBA 2VQFF 4B3SF 4PQUB 5KFTA 3ZZPA 1S6OA 4L74A 1JLQA 3SQGB 2VJVA 4B9TA 3M30B 2OPQA 2CQIA 5U47A 1CVJA 2F1FA 4ECXA 3TUJC 1F2GA 3O5TB 3RGIA 3UNYA 1NCLA 4M5HA 3LP0B 4ECVA 5HROA 3H5XA 3HVAA 1RZMA 2KHDA 1I5OB 3I31A 4A47A 5LJ3Y 4ZVPB 4PUOA 3AAWB 2HSEB 1KKHA 2W2QP 4EO6A 3KK2A 2HAFA 4NLRA 3UE2A 4DLGA 2OSRA 4HT7A 4RBVA 1FK9A 3N9UC 4XPCA 2YNFA 4O0IA 2XYGB 1FRMA 4WFBQ 3T1AA 2ZH8A 1IR0A 3QT8A 4USVA 4J37A 4NA2A 4X64J 4RW6B 1T94A 3I32A 5KT3A 5K8OA 3BBFA 4CLSA 3FDSA 2XY7A 2IFXA 3PKYA 2UUCJ 2JL9A 2MKJA 4KO0B 2VIHA 4B3OB 3V4IB 1NH7A 2BA9A 5KOWA 3Q8VA 1UW9A 3DLEA 1UAWA 3RW7A 2GQ2A 2HIQA 2MB0B 1FJGJ 1T9WA 1B70B 1RTHA 3TRGA 1YI2S 4DQRA 3OQ2A 4FKXA 1HQUB 1Q5YA 2ZUAA 4G1IA 4QJVA 2DGTA 2RKIA 2C1EB 5CA5A 2BOPA 1D9DA 4BC7A 3T41A 3THPA 2K2PA 4F8RA 1EARA 1QY7A 4QR1A 4YB7A 4DJBA 4EFAC 1FE0A 1FRKA 4ICLA 1Z4UA 3GSIA 1TKXA 1FD2A 2E5LJ 3QAUA 5I42A 1NMEB 5KG0A 3A4TA 1GMWA 2RB7A 1BWEA 2DR9A 5KFHA 1HNIB 3MM5A 3NRBA 1NPRA 1WKLA 1WEYA 1RWKB 3EGWB 4PAAA 4CI0B 5LMUF 5D78A 2E5GA 2IRYA 2HZAA 2NXUA 3C6TB 2H5EA 2IJNA 2DGXA 1N5TA 2ALZA 2WVEA 3PEJA 1VQ5S 1DTTB 4UQGA 3PR4A 1GNKA 4KKOB 2GIQA 2OIHA 2BKNA 4QU7A 3TI0A 4B08A 5LXRA 3AD8C 1H72C 1WKKA 1EB0A 3VGVA 4HT5A 2G1DA 4XPEA 3CDWA 1UEVA 5C7PA 4LF1A 5KT6A 1S4FA 5CHCB 2BKPA 2OPRA 5AE1A 4DX5A 2CUYA 3EE3A 3UNGC 2Y8WA 2L48A 4ILMA 5K14A 3RRGA 1FNMA 2P8IA 3H5YA 2GJIA 4LF4J 1P9QC 3CXCR 4DR5J 1FEHA 3DOMA 2CZVC 3GJSB 4YP3A 3KFWX 4HACA 5J1EA 5CCMA 4FF2A 2DHSA 2GS8A 5HMXA 3C14A 4QIWD 2BACA 2Z0GA 2GO8A 4ZVSB 3BB5A 2W9BB 4QWDA 4ID8A 4L72B 2CWXA 2KXHA 3BREA 1M1HA 1YJRA 2EEYA 4PXBA 2CWKA 3AOAA 4YHHF 3PW2A 5CH7B 2W2OP 2LVWA 4A8WA 3IS9A 1RKIA 5D4OA 4Y6IA 1S0VA 4R0EA 5CD4A 3NOGA 4OYBA 2RSQA 1S6PB 3TQ1A 4X4TA 1YVFA 2JRSA 2OKQA 1F2HA 1Y3KA 4HYKA 1FNOA 3U27A 2WSFC 3W7BA 3NGRA 2MEWA 2KVIA 4OLOA 2ZWOA 3JAMY 4K5SA 2FHKA 3THVA 1OYDA 4MYTA 1KC8T 1EHWA 2V8VA 3CPWR 2AGPA 2QMUB 4WCEQ 3IWXA 2DHHA 3OLAA 4KE5A 3HPOA 5AXLA 2I1RA 3BYRA 2B8QA 4ZIWA 1R27B 2V63A 4UTGA 2W4PA 3AODA 5A8RA 1B0TA 5HJYA 3CCES 3HX9A 2HMIA 4JP8A 3I56S 2A18A 2EKNA 2JEFA 7FD1A 3S01A 3CC2S 1B7YB 3J7Z5 4RJVA 5LSLA 2GC8A 5BYRA 3HHEA 5KTQA 1MWQA 1REVB 1WOPA 3EGVA 2CNNB 4DX7A 4X65F 2GVZA 5F8HA 2X1GA 2OEMA 3QSIA 2FY8A 1MSWD 1Q8KA 2NR0A 4B9UA 3FFIA 5J2PB 1H38A 4EBCA 1VCTA 2ZNZA 2IBKA 1URNA 3LGMA 3K8VA 2AW0A 2DBBA 3SIPB 4UOGA 3I9ZA 4X4UA 2VFVA 3WQPA 1RKJA 1GAOA 3HHLD 3IC1A 2L9WA 3C8YA 1SUQA 1TK0A 3KWMA 3MAAA 3CSKA 3CIZA 3VF0B 3ILOA 3HHLC 1S1VB 1F5BA 2EFNA 3V81A 4WE1A 4QWBA 3KLIA 3LAMA 2JEIA 1NU4A 3M8PB 1VGYA 1RK8A 1RT4B 3D7SB 5J1NA 1LXNA 1UL3A 3NGSA 3L9ZA 2V67A 2DNLA 2DH9A 4LREA 4NLVA 3GFXA 4H4OA 5L1IA 3IM9A 4X64F 3HSZA 4OZ0A 3MEGA 4IDKB 1XNQF 3EWGA 1WORA 2EG2A 2UUCF 2RDDA 3DCAA 3OJSA 3BQ0A 3NGTA 4CQ1A 3FJ2A 1TK5A 2DO0A 3M8YA 1FJGF 4W98A 3CNQP 3KYLA 3IAS9 4LF2A 4MT1A 2KFNA 5HBMB 3WIUA 5C2GA 3D1HA 2R7OA 1Y3JA 4EUVA 2JC0A 2J0XA 2Y0SD 1JLFB 1UWBA 1RTJA 1M5PC 1HBUB 1HWKA 3HHKA 4KH1B 4OI3A 3LA0A 4C8NA 2PN6A 2DCUB 3WIVA 4ECQA 4C9DA 2LQJA 4A4JA 2M5YA 2ZH7A 2CDQA 3OT9A 4TU8A 1MNEA 3I6PA 3KKFA 3SEOA 1UVIA 4QPXA 1RLDA 2BQUA 1UVJA 1BXNA 3G4SS 3VCDA 5L9NA 1RA6A 4DZ6A 4CDIA 4QIVA 1X5TA 3FK4A 5C42B 5A6PA 4PG5A 2K1RB 3R5JB 1HNXJ 2QLJB 3MR7A 4RU2A 3K5PA 3SV4A 3HDSA 4FVMA 3AJ2A 4PWUA 4C8MA 2HWIA 1GH8A 2W7AA 3GTYX 5H1SV 1R0AB 4IQMA 3JS9A 1WNEA 4YMEA 1J2VA 2VPZB 3DLGA 4ECRA 4CH0S 3MFIA 5FIIA 1JLBB 4DUYJ 2BJ8A 2PO4A 3LP1A 5RUBA 3SBMA 2H3EB 4DFKA 2IVMA 2VASA 4K4TA 2WW8A 4TYBA 4ES2A 2NQPA 1TUGB 2WVDA 5DJBA 5GAEU 3OHAA 1FVSA 2VBYA 4LF4F 4K2XA 3VAJA 1CULB 2EFGA 4RUHA 2DNMA 3MEDB 4DR5F 3RB0A 4WBFA 2ZH9A 1HNVA 3NS7B 1E6VB 1GQEA 3MXHP 2RNEA 3JXOA 4URSA 2CQDA 3BBCA 3A3NB 3PFEA 4WFAQ 4DV1J 2C2EA 3BDEA 3H42A 3E01B 3FQKA 4ZVUB 4PR6A 1Q82T 2CJQA 3CCQS 4PABA 4R25A 3N5BA 1GTEA 4YR0A 1KVIA 1JLQB 2JVOA 1S1TA 2MYFA 3FEXB 2OPQB 4K0KF 2Z57B 2G9OA 2HS4A 3ENAA 3OTOJ 1MWYA 4RL1A 2FHJA 2MLYA 2YNIB 5HROB 1N88A 1ZAVA 4PUOB 5HO4A 1TL1A 2KL8A 1FJ7A 2NSBA 4HH0A 4DL3A 2XBPA 2UVVA 4LF6J 1FK9B 3LANA 2J8AA 2DPJA 1N0VC 3BN7A 3HVRA 4J9MA 3SFGA 2JFKA 5MAOA 3BSAA 1IWAA 3W5YA 4F7VA 5ETPA 2UUBJ 5BR8J 3CCLS 1LWFA 3DMJB 1RCOB 4ZIVA 2R8HA 1NK0A 3P45B 3DC2A 2V8GA 3DLEB 2VBXA 3V6JA 4ZVGA 5LT5A 2VD3A 1JK9B 4PPDA 1RTHB 2OLWA 2G13A 1GXTA 1KTVA 3GR1A 3CD5A 2RKIB 5E7OB 1RACB 4P2SA 3US5A 2C22A 4LFCJ 2XYPB 3MM8A 1TELA 3R1LA 5CAAA 1JJ2R 4HHUA 4OX9J 1Y5IB 3T1YJ 2AJFE 4KAIA 1IM4A 3QIDA 2CQ1A 1SH2A 4I7FA 1HARA 4AL5A 1ZM4A 2DRDA 3DYAA 1TKXB 3DHXA 5I42B 1M1KT 4CWBA 2ZFHA 4RPFA 1FWKA 1QVFR 4J9VA 4K5RA 1OQ6A 2W7OA 1RBAA 4PEOA 3M05A 2HGNA 1S7IA 4J9OA 3C66A 2DXDA 4RNNA 3W64A 3NMRA 1N34F 4Y0FA 2OHDA 2V8HA 4RO0A 2HZVA 1VC6A 5LMNJ 1Q16B 6FD1A 1NK9A 1GK8A 3CW2C 4LF9J 2YWHA 1SKUB 4M5GA 1D0EA 3IBCB 2KH9A 2NUUG 1EJ7L 1KOHA 1RTZA 3AQOA 3CCMS 3MPUB 4DS4A 5D4PA 2R4FA 4K4ZA 2OPRB 3N6MA 2MKCA 2E7XA 3EDQB 1HD0A 2EFOA 4RNMA 1HBMA 1RGVA 5K14B 2RE1A 1PG5B 3D6FB 2FVRA 3UW1A 5IOLA 1B64A 4ELUA 3HZGA 3M2VA 1U7LA 4LQ9A 2JDJA 4OJHA 1CJVB 4I0WA 2DYAA 3DOMB 1YBAA 2HW3A 2G0JA 5J1EB 2FHOB 3MD1A 3VAIA 4ZP6A 3FNNA 2CYYA 1DARA 4F36A 3C14B 3QWPA 4KRWA 5ITHA 1KVJA 1KBRA 1RAHB 3RAXA 5IM0B 3FSXA 2IRUA 1DLOA 3VAGA 3CCSS 2MZTA 4B9VA 1PC4A 1UWAA 3G8QA 1WELA 1QE1A 1VQSA 1UJ5A 3OSPA 1EETA 3C46A 1YBTA 1WHWA 2DGSA 2AJ2A 3IS9B 5FLXY 2XO7A 3CUNA 1OMSA 1RISA 2LXFA 3IWNC 1ZS6A 2ROPA 3CO9A 3ENVA 1HNXF 3QSYB 1K1SA 4ALZA 3VWSA 1D9AA 2JFDA 2AD9A 1S10A 2B6AA 3KHLA 2P6SA 3QNWB 5BYSA 4KPYA 3HFZB 3HO1A 3BO4A 3EPIA 1R89A 4DUYF 1NUEA 2KU7A 2B43A 1J5EJ 3ENWA 4A8SA 4DCOB 1N33F 1JIHA 5ETRA 2ZC4A 4M95A 5DLFA 4MFBA 1U25A 3HD2A 4U7UD 2YWWA 2XLKA 4FKYA 3BF4A 3P8BB 3M8RA 2HMIB 3DOKA 2XGPA 1VBXA 3FBEA 3KUGA 1F6TA 4X4PA 3J81Y 4X4SA 3MM7A 1N36J 2F9DA 2HVHA 3CWJA 1MMNA 4A8QA 4IRDA 4CH1A 2LQ8A 4WK1A 2GMHA 2MSTA 3IAM9 3JTNA 3CD6S 2KM8B 2GVZB 3OVAA 1NKCA 2VG7A 1O8BA 3CCWA 2VFSA 5JVGQ 1TKDA 4WYLA 4DV1F 5F3ZA 2ATLA 3FCVA 2MGZA 1NJIT 2ZOFA 3I55S 3RW6A 2QL7B 2AZ3A 1QTNB 2IVYA 3FCWA 1IR2A 3GJTB 1U8SA 2GX8A 3LWLA 5A0YA 2FB0A 1SUQB 2BKOA 4JV1A 2DVIA 3HHDA 3V4MA 2FC8A 4OJGA 3MAAB 5E3PA 3MPYA 3JTPA 1LK5A 3OTOF 4QYZJ 4WFNQ 2KN4A 4F3OA 2BZ2A 4DN9A 3KUEA 5KG4A 2W2PP 2BV3A 1YJTA 3DLKA 4I4BA 4WE1B 2UU9J 1FRIA 2PMWA 3KLIB 3MCSA 3DN9A 4LF6F 2FGOA 4Y2AA 3QYYA 5AE2A 3PHEA 2F8HA 1HL6A 5A2QU 1ELOA 2CVEA 4KY3A 5HANA 4QWCA 2WSCC 5CQGA 1C0UB 1A6LA 3Q8PB 3RR7A 2RHSB 2E7WA 1M1GA 2BBEA 5EX3A 1G1XA 3H90A 1URRA 4AXIA 2AYBA 2FPHX 4Q44A 4DV3J 1WEXA 1VQ8S 4OMFG 1KQFB 2HEKA 1NB7A 2JNJA 3BO3A 1IVZA 2QN6B 4Y65A 2DRAA 4P6QA 2CIMA 1RHKB 1AXQA 2DRBA 2N3LA 1FTRA 1C0TA 1YZ6A 3BDPA 4GKKF 1U1KA 3NGKA 4LFCF 2GO9A 3DRSA 1UWBB 2MQOA 2N3OA 1RTJB 1HHQA 1KS2A 3PW0A 1JXVA 2RD5C 2BW2A 4OX9F 2V0NA 3T5LA 3SCJE 1VQOS 1LV5A 4RUCA 5H9EK 2YKOA 3RB4A 2GMLA 4ENOA 4RNFA 1Q1KA 3CJ0A 3GYGA 3MPVA 1UETA 2Z56B 2OPSA 4K4UA 3H5UA 2D9OA 3AA8A 4UUWA 4DR7J 4PWDA 1LQ9A 2MQPA 1FESA 3DLBA 1VHIA 2Z2ZA 2VF3A 2ROGA 1N6QA 2FUG9 2MTLA 4ILRA 4OX6A 3P96A 2RH3A 2B51A 3F0NA 3DRXA 2KG1A 4NLUA 5LMNF 3H40A 2B4PA 1RAOA 3FVYA 4LF9F 5D3GA 1S12A 1KLMA 3ZNUA 2VG5A 4OI1A 3FCHA 4Q8EA 4QR2A 1S1XA 4ZP7A 3Q8UA 5K8NA 1E6YB 3EVMA 2QL5B 1JJ4A 5CZXA 2NXCA 3DLGB 4DPXA 3CTRA 2HBZB 5JXSA 1ZA1B 2MZQA 4P75A 3ZTOA 4DU8A 4JI7J 4RR5A 1YKWA 2VICA 3OFFA 3OUYA 4YDXA 2IM3A 3M8QA 5IT9U 2QRRA 4RNOA 3G8TA 3A8EA 1RTDA 1L3SA 4LRAA 1QAXA 4J9PA 2WOMA 2GV1A 3J80U 4CLTA 2IY5B 3I0SA 3UCGA 3J7A1 3PJWA 5KOXA 1B99A 4P2MA 4TYAA 3CCVS 1S79A 2QYGA 3OFGA 4Y34A 1F0XA 2O67A 1X4EA 4XK8C 4R5PB 3R9LA 5E33A 1FRHA 3S8SA 4BCAA 2R2RA 3B4DA 3HHLA 1D1UA 2XNRA 4ZVEA 3RTVA 1BMQB 1U48A 2H1YA 2I0XA 1D9FA 4UT4A 4DMZA 1XMQF 1VFJA 1TAQA 1S1TB 3BR8A 3SSRA 1T3NA 2BJ7A 2KZMA 4J9KA 9ATCB 5DO2A 1ZBTA 3D1OA 4P74A 2VA3A 2AJ4A 4RKUC 3D0HE 4YN3B 3FGVA 1HD1A 5GMKa 1HHSA 2X3DA 4DV0J 2IC3B 3HT3A 3M8SA 2HNDA 3NCRA 5F8IA 2BJ3A 2C3MA 2PFFB 1TL1B 4NOHA 4BDPA 3TANA 2R7RA 1WTFA 3HHNB 2UXDJ 3BPDA 3IBWA 3UCZP 4DR4J 1F9HA 2ASDA 3R5BA 1RABB 3MMJA 5THWA 3DRYA 1M5HA 1QVGR 3T5HA 4M5KA 4GVLA 3Q2SC 4IOAQ 5I3QA 4KR0B 4IG0A 4Y28C 1P1TA 1U1QA 5G0RA 4HR2A 2M8DB 3OPKA 1CQMA 3E8OA 2NSCA 1KQKA 1OY8A 5C24A 1JNRB 2ZBCA 2WAQD 3CD7A 2AEJA 4DU7A 1N36F 4B17A 4XO0A 3CJKA 3HKZD 1X4FA 3AOCA 3ELHA 4C8ZA 4WYWA 3HVWA 1J27A 4EWTA 3H2UB 2EC0A 2HGLA 1PAUB 3MM8B 4JYAF 2KJWA 4FNIA 3I5BA 4UQTA 3SSSA 2CRLA 2C3OA 5B0BA 2BABA 4P7TA 1Q8IA 4WXWA 4I7FB 3ZZRA 2XMMA 1NSAA 4ZN1A 3DYAB 1SPBP 4JUZA 2NCKL 4PKDB 1N52B 3M7VA 2E7VA 3UQSA 1RJJA 1JLCA 2WONA 4C3LA 2WSEC 3DXSX 3OL8A 5B0DA 2ADCA 2FJBB 2B9WA 4FXVA 1JXLA 1RXOB 1S9EA 3TQEA 2ZOMA 3PJXA 1IR1A 2JHEA 1RBOB 2CQPA 3EZUA 1IXKA 1DY3A 3HSJA 2V6AA 4OI4A 2HVZA 2E1AA 1NEEA 2EBGA 3MD3A 3MFHA 5MLCV 1KWMA 1T11A 1C4AA 3V6HA 3M1VA 1IBKJ 3CVKA 2W24A 4QCLA 1LW0A 4TY8A 4CM2A 1YRUA 2YX1A 5M2UA 2GAGC 4DPYA 3SCKE 2ZVSA 4LT6A 4DV3F 1XN9A 2QTWA 2BEFA 2CNKB 3L09A 1L3VA 4NLSA 2AMCB 4A8XA 4C4WA 2CDRB 2AU0A 1HBMB 1LNQA 5K8PA 2OH2A 3BN4A 1N5VA 4B9MA 2ZJPQ 3M2VB 1LKZA 4E0DA 3RG6A 2X1FA 2EK1A 3CF5Q 1FD8A 4PCQA 4DSIA 2ZHBA 2EC2A 4DFJA 2Y1RI 4EYHB 4FS1A 4K7QA 3IR7B 3C15A 1AZSA 3N0VA 2R2SA 3EICA 3VGTA 4PG7A 3GYNA 4ZS6A 1DLOB 2FJWA 3W62A 1Y0HA 5E5NA 1DBDA 3AA9A 1SKRA 4DPWA 1EETB 2OUGA 3BKUA 4IUFA 5K5MA 2MKSA 3DRPA 4WU2A 1YDLA 1RT1B 2Z58B 5IZHA 2MHNA 3W63A 3RR8A 1CSJA 3M30A 3HP6A 2ZD1A 2SXLA 2AKWB 4ECTA 3W9HA 2B6AB 4R0JA 4OZJA 3LP0A 4RBUA 4FXDA 5ADZA 1O5JA 1CQNA 2BJ1A 1NSPA 1Q53A 4ELTA 1KEKA 3VVUA 4DFPA 2XMJA 2CPZA 5LM7E 3I5CA 1MMLA 3IWLA 1BD6A 4LRDA 4JI7F 1UVLA 1OQ3A 2BDPA 1NH8A 3GMGA 4OL8A 2FZKB 1Q81T 1QUPA 4IFYA 4MFBB 3RB3A 4CP5A 2IA0A 3DOKB 2ZZMA 2C3YA 3TJAA 1SL1A 3MPDA 3W65A 4YR3A 1ROFA 1LW2A 1VRQC 4ECWA 3PRBA 3A3PB 2YPZA 3MM7B 1NPKA 3A1YG 4ZCMA 3ILIA 1JKHA 2MQQA 2DGUA 3MCNA 4ZJOA 4ZK7M 3GCXP 3BQ1A 3PDNA 1H2VZ 1UCNA 1G2EA 2VG7B 3DXBA 4OYWA 1FKAF 2MGZB 2DY9A 1N5SA 4X4OA 2D3O1 5T7LB 1X4BA 3EZOA 4MKVA 1DTQA 3TAMB 4WKRA 2HQCA 3JB9k 4KT0C 4YOEA 1I94J 2LFVA 2AV5A 3PX6A 2OMLA 1AUDA 2LEAA 2R7VA 5A0YB 3E2EA 3QJLA 2HVEA 1WUUA 1H74A 3OTEA 3KG0A 2GJFA 3QMQA 4FYDA 1BUXA 1J5OA 1ZOTA 4MIWA 4WIIA 3ADAC 1NKBA 1JXEA 3DLHA 1RWUA 3NOCA 2J6UA 1C1CB 4DV0F 3UR3C 1SCJB 1N54B 1PIEA 2J9DE 1Q7LB 1LWEB 3R1HA 1H0HB 3DFEA 1CJKA 4ECYA 4CLFA 3CCRS 2UXDF 1I6JA 4DR4F 4EU0A 3Q8QB 2MLZA 3EUNA 2FIUA 2NPFA 2L08A 4DUZJ 2IBOA 4K50A 2J7KA 1NJXA 3VAKA 1RAFB 2HFUA 5L1LA 3LGHA 4A8MP 4ZVRB 1D8YA 2ZBQA 1R8HA 5KFRA 2KT2A 3N79A 2GNKA 2CA9A 2MXYA 4DUTA 3I82A 1WDTA 3L7UA 4LIWA 4NA1A 1T9YA 4P2FA 3F73A 4B3TJ 2LA6A 2XHWA 4OYAA 4NYZA 2A6MA 5DDPC 5D4LA 5B7WA 2YQ0A 5DQIA 1B0PA 2J7WA 3NAHA 1NPPA 2HK3A 2K3KA 1C2PA 1X31C 2CAJA 4C3KA 1U6ZA 3TZZA 4N8NA 2PSZA 1TUVA 2BJEA 4WP9A 2RHQB 4V19X 2QV6A 3SCLE 4IH5A 2C2ZB
chains in the Genus database with same CATH topology
1BY9A 2R7OA 3CJ4A 3D1HA 2AGQA 2HGMA 4WFZA 1FXLA 3SFUA 2OPSB 1R43A 3IG1A 2KI2A 1Y3JA 4EUVA 5KFMA 2JC0A 1RT1A 3CE8A 2J0XA 2Y0SD 4CCHA 2JSXA 3CIMA 1IJFB 3TW0A 3C3LA 4JBCA 1JLFB 1UWBA 4CO0A 3MMAA 1N4LA 2YH0A 5EHHA 2R8KA 1RTJA 2VONA 3MPWA 1M5PC 1VBYA 1HBUB 1HWKA 4C8OA 3HHKA 2IMOA 4OI3A 4C8NA 3HVTA 2CQHA 1N6QB 2PN6A 4KTQA 2DCUB 2HFOA 1VQ7S 4W90B 2XWXA 4AYBD 4W92B 3OL6A 4ECQA 2A10A 4DL0C 2C28A 4C9DA 2LQJA 3CD0A 3ITHA 5B0GA 1YJ9S 2RDJA 3K5NA 4A4JA 4JI6F 2M5YA 4N77A 5F8JA 1LK7A 1XK8A 2ZH7A 2CDQA 2A2CA 1ZM9A 4TU8A 2XI3A 1MNEA 5D3GB 3I6PA 3KKFA 4KV8A 3VALA 5DG9A 1KLMB 3SEOA 2EFPA 1RTIA 4JV2A 2J6TA 1RYRA 4H54A 2JWNA 5A8KA 1UVIA 4LSNA 2VG5B 1UMJA 1S6QB 2D1CA 4DL2A 2ZHAA 1X4DA 3MECB 4QPXA 5F8GA 3PX4A 1JJHA 1YTYA 3KTQA 1S1XB 5SZTA 4LFBF 1U1MA 4I2QA 2BQUA 1IBKF 2RJZA 5AXKA 3VQSA 1UVJA 3G4SS 2R7TA 2QA2A 3VCDA 5L9NA 1RA6A 4QIGA 1JLEA 2RU9A 1VJWA 4KIAA 5GAGI 3F41A 3GQCA 4NLGA 4QIVA 4MAKA 1X5TA 1WG5A 1HFEL 3GB0A 5C42B 3HK2A 2GQCA 2DT9A 5A6PA 1IKXA 4F26A 2KYZA 4K59A 4PG5A 3BSOA 1QSYA 2K1RB 1FDAA 3EPGA 4NPOA 5M2PA 1S0MA 5B0CA 5IXUA 1FKOA 3BEGB 4U6PA 4JI3F 1R8PA 2RQMA 3OUYB 3K2YA 3KLGA 3L7PA 1HHTP 3S7RA 2CPXA 3R3TA 1FT8A 5EX0A 3M8QB 2PGCA 3L3CA 4RU2A 5J2MA 5K8MA 1LFWA 4F50A 3K5PA 3SV4A 3GIKA 3HDSA 1IKYB 4FVMA 5FDLA 4N5SA 3N28A 3AJ2A 3ISZA 4PWUA 4C8MA 2HWIA 2HRYA 1GH8A 1NZAA 2W7AA 4H4KA 1HBOB 1S6UA 4BHQA 4IQMA 5H1SV 4CTAB 1R0AB 2W25A 1NK5A 1WNEA 2CPFA 2YX7A 4YMEA 3KHRA 1J2VA 5KFCA 2VPZB 3M9OB 4FS2A 3DLGA 2FLPA 1S1WB 4ECRA 4CH0S 1JLGA 3PW5A 3MFIA 4JV0A 3LOUA 2HAIA 1SKWA 2QA1A 5FIIA 4X4RA 3PO5A 1JLBB 2KO1A 5I3PA 5GADU 1UJ4A 2DH8A 3QIPB 1CPZA 4B9LA 3O6QA 2MKHA 2PO4A 2VKZG 1X9SA 1WTBA 5T7LA 2MKKA 5HQ8A 3LP1A 4DFKA 2PC6A 2NPIA 2IVMA 2VASA 3KHHA 3DGPA 3SCIE 3TAMA 2ZH3A 4EYIB 1GXLA 4PXEA 4K4TA 2R7SA 5HLFB 1S97A 1MROB 4QOTA 2WW8A 3GFYA 4TYBA 1IJEB 3MUTP 1DZ5A 4ES2A 2NQPA 2GQQA 3D0GE 3L95X 2EK6A 4WZQA 3RZAA 3KJVB 5A2QY 3SYZA 3GR0A 4URQU 5DJBA 5GAEU 1YHQS 1OSDA 2I38A 2KDOA 4OI2A 4WK3A 3OHAA 2VQEF 2UUAF 2KFYA 1FVSA 4YB6A 4C0BA 3HHLB 3MMBA 1B7FA 3MM6B 3OTBA 2VBYA 4CZCA 3E51A 4LF4F 2AYMA 4H4MA 2K8GA 4HHJA 4K2XA 3VAJA 1BLUA 2HWTA 1NKEA 1Q86T 2D3ZA 2O3DA 5HMWA 1HPZB 1PO6A 1YRTA 2EFGA 3Q8SB 5FJ4A 4RUHA 2DNMA 1WG4A 2VH7A 2QA4S 5HP1B 3MEDB 4DR5F 3JYTA 1VQPS 5LXYA 5J2NB 3RB0A 4OX8A 3H4DA 3ZZZA 4PXDA 4F2RA 3B4MA 2ZH9A 1X5PA 1IQTA 1C1CA 4N56A 1MW7A 5CYQA 1HNVA 5LJ5Y 1E6VB 1GQEA 3BS9A 4FXWA 2RNEA 3MXHP 4KFBA 2MZRA 4ZCIA 4URSA 3K8WA 1HWIA 4Q5VA 2VV5A 2CQDA 1LWEA 4MIAA 4O3SA 3ULHA 3PFEA 4OI6A 2J0QD 4WFAQ 2WB4A 2M2BA 4DDFA 1R6YA 2C2EA 1OPIA 3BDEA 1LWCB 3T19A 4IYQA 4HKQA 3E01B 3FQKA 4RNHA 3NP5A 4RW8A 2EW9A 1GX6A 3HZEA 2CJQA 4PR6A 3KK3A 3G96A 1Q82T 4ELVA 1P27B 4M94A 3CCQS 2HNDB 2OAUA 1NHVA 2YQ3A 4R25A 3N5BA 1C1BB 5HI7A 3KLHA 1RYSA 1GTEA 3CEDA 4NX9A 4O44A 4YR0A 2DHGA 1N0UA 2HRUA 3H8YA 1KVIA 1JLQB 2JVOA 1T8EA 4USHA 2QIFA 5CXTA 1S1TA 2LDYA 3QO9A 3PEHA 2W9CA 2MYFA 3MEKA 3FEXB 3U1MA 5HMYA 2OTLS 5KFSA 1NJZA 2OPQB 1SJQA 4K0KF 4WJBA 2E44A 3M9NB 2GGPB 3GSDA 3IRXB 2G9OA 4KB7A 2HS4A 2DO4A 1BC6A 4ED3A 1YJNS 2ZDOA 4DV4F 3CULA 5GADI 1U6BA 3G86A 1QE1B 2UUBF 2HNYB 5BR8F 1MWYA 2FHJA 1XEZA 2BQRA 1XR7A 3OXLA 3PACA 3TAQA 2HYIB 2YNIB 5HROB 4B9NA 1KSPA 2M9KA 1K0TA 3M8PA 1N88A 2F9JA 2OD6A 4Y2IA 4A8OA 1ZAVA 3OJUA 4HVZA 1KQSR 1APSA 2CPEA 2WCXA 1UVKA 1RT4A 4PQUA 2LXUA 4PUOB 5HO4A 4IG0B 5GAEI 1TL1A 3GV5B 3BGRB 4IQXA 2CQ0A 4IH6A 2XLJA 2AJ1A 3I0RA 3SQGA 2KG0A 1FJ7A 5E3QA 2BRKA 5G0RB 2NSBA 3KHGA 4HH0A 3AY0A 2RQKA 4DL3A 2XBPA 4BS2A 4KGMA 2UVVA 1FRLA 3R5CA 1RP5A 2DNQA 2MQLA 2YKPA 1FK9B 2AYEA 2MSSA 2J8AA 3LANA 4RW4B 5C24B 3CCUS 2HHWA 5C25B 4O3QA 2CJBA 2VPXB 2DPJA 2XB2D 1VHFA 1H7XA 1N0VC 5I3UB 3J7ZT 3BN7A 4ZVHA 3HVRA 4J9MA 1Z2LA 3SFGA 3CDEA 2YH1A 3CJKB 2RDIA 3R5DA 2JFKA 1RT6A 3T1YF 1XMBA 5MAOA 4J9SA 3CC4S 3BSAA 3RB6A 4L3NA 3KNGA 2LYVA 4HTIA 3IFEA 4IO1A 2PDAA 2YNGA 2DPIA 2UP1A 2ERRA 2CPHA 2J7UA 5KFFA 1DAXA 2YWGA 5AXMA 3PY8A 4NCAA 2F8MA 2VB6A 2B5JB 2VL1A 1I1GA 3CCLS 2QO3A 2QSFA 1LWFA 2DITA 1HYSB 3DMJB 3O2IA 2R8HA 2HNZA 1NK0A 1ZTTA 1Z1ZA 2KT3A 3DC2A 1N32F 2MKIA 1V3SA 1QAYA 1TP7A 2V8GA 3B82A 3DLEB 1RT7B 3D28A 3V2UC 4FF1A 2V4JB 2BJDA 2LU1A 2ZDPA 2V9WA 2VBXA 2UV8A 4RWXA 2ZH6A 3V6JA 1BQMA 2L9NA 4MK7A 4ZVGA 3O8WA 4LSLB 5LT5A 2CJ9A 2VD3A 1JK9B 4PPDA 1RTHB 2H9ZA 4TXSA 2OLWA 4NRTA 2UVRA 4NLOA 2G13A 4FN5A 3ICLA 1GXTA 3BO2A 2I5JB 1KTVA 2MQMA 4RW6A 4Z37A 4M1KA 1TK8A 3QJJA 2QEXS 4HI1A 1V6HA 3GR1A 4ZCKA 3CD5A 1S48A 4QR0A 2B7BB 3SDEA 3VZIA 3THTA 5IT9Y 1WWHA 2JLEA 2IM2A 2OD4A 2RKIB 4JOUA 5E7OB 1UKUA 1S49A 2ZH5A 4P2SA 3US5A 5J2QB 2C22A 3H2LA 3M6WA 2WONB 3MM8A 2ZKTA 4DOZA 4OX7A 3R1LA 2EKYA 4DQSA 4KO0A 1VBZA 1NJYA 1JJ2R 1HR0F 3C2PA 3IA0A 2YNHB 1DRZA 4B3OA 1Y5IB 3V4IA 3OV7A 1SBRA 2AJFE 2IJFA 4KAIA 1IM4A 2DIUA 3J80Y 3R27A 2KT5A 2L3MA 3QIDA 3UFCX 3VTIA