3EGZA

Crystal structure of an in vitro evolved tetracycline aptamer and artificial riboswitch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural basis for specific, high-affinity tetracycline binding by an in vitro evolved aptamer and artificial riboswitch
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna
total genus 19
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3egzA00
2MKSA 1O0PA 2CQPA 1K9MT 3MUTP 4IOAQ 2ZJQQ 4CH1A 1Q7YT 2MB0B 2CPIA 2DNRA 2RS8A 2KG0A 3Q2TC 2N7CA 3CCUS 4LIRA 3MOJB 2JWNA 4YOEA 2WBRA 2BZ2A 2DH9A 4UY8T 2LXIA 5GADU 1U2FA 2MQNA 1WHVA 2MQOA 3NMRA 1VQ6S 4ERDA 1YJ9S 2ZJPQ 1Q86T 5GAGU 2RT3A 2MZSA 2V94A 1UW4A 1WHWA 1B7FA 3BO4A 2DNPA 1YJWS 2UP1A 1QM9A 1P1TA 2J76E 1FT8A 2LEAA 4C0OC 3P6YC 1N88A 1FJEB 2KXHA 2YH0A 4WIIA 3UWTA 1HD1A 2G1DA 3PIPQ 1SJ3P 2CPDA 1Q82T 2QEXS 1S79A 5DDPC 2HZCA 1N8RT 1OPIA 3THPA 3BO2A 1UAWA 3CD6S 3VAFA 2EK6A 2JX2A 4WCEQ 4C7QA 2LA4A 1VQNS 1JJHA 1VC5A 2DNGA 4TU9A 4CH0S 3MUMP 2RRAA 2MHNA 4YUDA 2MGZA 2KG1A 1VC6A 2CPEA 2KT5A 2VOPA 3CPWR 1HA1A 3LQVA 4W92B 3S7RA 1X4EA 3SDEA 1VBYA 2MYFA 5IM0B 2CQBA 1WEXA 4PR6A 3UCZP 1WHYA 3G6ES 1X5TA 2N3OA 2E5GA 3ZZYA 1DZ5A 5IM0A 2NZ4A 1ZH5A 1KC8T 2KHCA 1IQTA 4RU2A 1N54B 2I38A 1WWHA 2DNYA 1X4BA 1WF0A 1KOHA 4F02A 3HI9A 3NS5A 3CXCR 1VQ4S 1HL6A 2K8GA 4QPTA 3B4DA 1H2TZ 1PGZA 1YWXA 3EGNA 2OIHA 2M9KA 2MSTA 1WHXA 2MQLA 1YITS 1VQMS 2Q79A 2XB2D 2CQ2A 5HO4A 3CCQS 4M5DB 2JRSA 2U2FA 3EX7B 1R8HA 1QVGR 2KXNB 2DNKA 1F9FA 1YTYA 3CCRS 1M5OC 2I2YA 4QQBA 2MKHA 5CA5A 2VONA 1DRZA 5LSLA 2DGQA 2CQCA 2MY8A 2MPUA 2MMYA 1RKJA 1D9AA 2DGVA 2DO4A 1NJIT 2FY1A 2OTJS 2CQGA 2KM8C 5GMKa 3CUNA 5GAHU 2G0CA 3MXHP 5DDOC 2XS5A 3CCSS 2DGSA 5GVQA 3VAIA 1U1KA 1X5SA 1PO6A 3J7YU 1U6FA 2LKZA 2MZQA 2LA6A 4WFAQ 4WKRA 3VALA 1X4CA 3P3DA 2OSQA 1YIJS 5CYJA 3VAGA 2RQCA 1ZZNA 3TO8A 4U67Q 3L3CA 5CXTA 2LQ5A 2M4MA 5LJ5Y 3TYTA 1NU4A 2CQ0A 4WFNQ 1X4GA 1HD0A 1D8ZA 4QU7A 1WELA 1KOOA 3BS9A 2DGWA 4LMZA 1FNXH 1DHMA 3MD3A 3SMZA 2LYVA 1U1NA 2VODA 1H6KX 3MI7X 1WTBA 3U1LA 5DDRC 1ZZFA 2MZTA 5DDQC 2DO0A 3RW6A 2ZJRQ 2CPJA 1SXLA 1N52B 4ZKAA 2DGXA 2J0SD 2B0GA 1OO0B 2U1AA 3CF5Q 2KN4A 3FEYB 2RUGA 2XS2A 1SJ4P 3I56S 3U1MA 3RW7A 2GO9A 4A8XA 2CPYA 5ITHA 2DHSA 1FHTA 2G4BA 2DGUA 2KVIA 1U1QA 1YJNS 2MGZB 2FC8A 2HYIB 2MZJA 2JVOA 2M70A 3UE2A 5D78A 3UCGA 3CTRA 2EK1A 4F26A 1AUDA 2HVZA 1H2UX 4F25A 2DNHA 3SDEB 3CULA 4FXWA 5LSOA 1URNA 3N9UC 3US5A 2L9WA 2YKAA 2MKCA 1DBDA 3VF0B 1K8AT 2KYXA 4PRFA 1CVJA 1SJRA 2DH7A 2DHGA 3SXLA 1U1RA 2CQ1A 4Y00A 5LJ3Y 2DNLA 2MSSA 1X0FA 2K3KA 2M8HA 2X1GA 2J0QD 3G8TA 4WF9Q 1WG1A 1WI6A 2E5HA 3S6EA 2NLWA 1VQLS 5H1SV 2OTLS 4WFBQ 1FJ7A 2RS2A 1H2VZ 2E44A 2PEHA 5GAEU 3CCVS 2MXYA 1BY9A 2KU7A 2DB1A 3VAHA 2N3LA 2RQ4A 1FO1A 2HGLA 3UD4P 1L3KA 2AYGA 2CPFA 2DHXA 1U6BA 5JVGQ 1VBZA 4BS2A 1VQOS 2XS7A 3VAJA 2ADBA 2DIVA 2QFJA 1A9NB 1SJQA 4FXVA 3CCJS 2E5IA 3J7ZT 1FXLA 2PE8A 3CC4S 2MZRA 1KQSR 1U1MA 4CIOA 1OWXA 3CMAS 1JJ2R 1WEZA 2DK2A 3VAMA 1X4FA 2DGOA 2MZ1A 3TP2A 5MLCV 2CQ4A 2MJUA 3G8SA 3K0JA 4W90B 2M2BA 2CQHA 2CQIA 2KRRA 5HL7Q 5LXRA 2KFYA 2YWKA 2MQQA 2LXUA 1K73T 1XN9A 1VC0A 2L41A 3CCES 2KH9A 3R1LA 1WF2A 2A3JA 3MDFA 3R1HA 2RNEA 5IQQA 2DISA 3CMES 1WI8A 4TU7A 3VAKA 2ERRA 2CPZA 2CQDA 2DHAA 1U1PA 3IRWP 3NS6A 2J8AA 2EVZA 3H2VE 2XNQA 2VOOA 2M0GB 5DM6Q 3S01A 2F3JA 2YTCA 5D77A 1WEYA 2M8DB 1X4AA 4CQ1A 2OSRA 1WG4A 4OZ1A 1JMTA 2FPHX 2RRBA 2FHOB 3CC7S 2M7SA 2E5JA 4IUFA 1FJCA 3CC2S 2L08A 2HGNA 1X5OA 2AYEA 2XNRA 1VQ8S 1VQ9S 5EN1A 5JVHQ 2DNOA 2FC9A 2ADCA 3CCLS 2YH1A 2DITA 1NO8A 3OW2R 3HHNB 4IO9Q 1X4DA 2BOPA 4EGLA 2CQ3A 2F9JA 1S72S 2X1BA 2AD9A 3NNAA 4ED5A 3P5TL 4TLQA 1VBXA 2D9PA 2LMIA 3NNHA 3I55S 2HGMA 4OZ0A 3G9CA 2M88A 4Y0FA 2RVJA 1A7GE 2KXFA 4YB1P 1M5PC 3PIOQ 2DGTA 2MKKA 5DETA 2DNNA 3DLLQ 1QVFR 1VQ5S 4Z2XA 4UQTA 3UCUP 4J5OA 2OJ3A 2LEBA 2F9DA 2GHPA 1RK8A 4IOCQ 4LJMA 2CJKA 1VQPS 3MUVP 3G4SS 1Q81T 3BO3A 4C4WA 2M52A 3Q2SC 2MQMA 3JB9k 4TU8A 2AYMA 5IFMA 1UFWA 1YI2S 2KRBA 5DM7Q 1UP1A 5BJRA 2LCWA 4V19X 3R27A 2MY7A 1G2EA 3B4MA 2D3OR 1P27B 2MKIA 3D2WA 2DIUA 3FEXB 3G71S 3EGZA 2CPXA 5FJ4A 5LXYA 3H2UB 2RU3A 1JJ4A 3BEGB 2MJNA 2MKJA 1VQKS 3G96A 1KD1T 1M5KC 3CCMS 2QA4S 3P49B 3ULHA 1X4HA 2JVRA 1WG5A 2XSFA 3ZZZA 3V4MA 1M1KT 2X1FA 1U1OA 2DH8A 2X1AA 3LPYA 1X5PA 2KM8B 3S8SA 3MD1A 2SXLA 2LECA 2N82B 2CPHA 3NNCA 2AYBA 1YHQS 3MURP 2DNQA 2KI2A 1M90T 1OIAA 1R8PA 3DXBA 2D9OA 3THTA 4P6QA 4PKDB 1WF1A 1W2BR 2DNZA 1M5VC 2O3DA 1VQ7S 2MQPA 1U1LA 4QU6A 1SJFA 3IWNC 2DNMA 3UD3P
chains in the Genus database with same CATH superfamily
4GC7A 2BE2A 4DL5A 5HROA 2ZNYA 5I42B 3TVKA 4YOEA 4ES3A 5HP1B 1S6OA 2CJQA 4DQSA 4Q2MA 3KJQB 1UTAA 4JI4F 4M95A 2ZJPQ 4CO5A 3J80U 4I56A 3BO4A 3Q23A 1P1TA 1HWJA 3TQ1A 2LEAA 3OFHA 4UOGA 1J2VA 2PT0A 2ATCB 4K5RA 2V2KA 2EK6A 1S1UB 1TL3B 1U0HA 2DNGA 4N77A 3KK1A 2WOMB 2EPIA 3JS9A 1S9FA 1LXNA 4OX6A 4I6WA 3FUYA 4K2XA 3FSXA 3D6TB 2B8PA 4DFMA 2E9TA 4PWDB 2MYFA 1WC4A 1PSDA 2CQBA 4DR3F 1U8WA 4G6VB 4U7CA 1Z1ZA 4LR7A 4L3NA 3HO1A 3RTVA 3TAPA 4ZLLA 5D4PA 1Q95G 2IDLA 3BSNA 3DLGA 2ZM6J 4QPTA 4ED6A 1H2TZ 4R25A 3TRGA 2LLZA 3D4JA 2IM3A 4PYAA 3ELHA 3OLAA 3HK2A 2ZZNA 5HI7A 2MKHA 3G87A 4BLGA 4QIGA 3MFIA 4NLQA 1NJIT 1OJ4A 2VFRA 4HACA 3OPKA 5GAHU 2VG5B 3W8PA 3TOQA 1JKHB 2LKZA 4O4RA 4WKRA 5E41A 3TEGA 3CT9A 1ZZNA 4F3OA 3TO8A 1Q53A 4WFNQ 3RZAA 3OTBA 4WK3A 2ABYA 3T1AA 4WZMA 4X4QA 1OQ3A 5CQGA 4FF2A 1U1NA 2Z8QA 1YZ7A 4WFZA 1SQEA 3GPAA 2OO4A 1SXLA 3I0RB 2CG8A 5KAKA 2J0SD 4CH7A 2G2YA 2H5IB 4R5PB 1H7WA 1G7CB 4A8XA 2HBYB 1RWOB 1UVLA 3P96A 3MM6A 4DX6A 2MZJA 4X4RA 1NPKA 5KG6A 1LW2A 3RAMA 2DCUB 4WZQA 5HBMA 3KLIB 1JXVA 5L1IA 1RT5A 2X3GA 1SJRA 4IRCA 3SXLA 2QA4G 5F8IA 1XIQA 2X1GA 1SPBP 2PEBA 1C4CA 3BKFA 2VQFF 1XBWA 1XK8A 1KHVA 4IDKB 5H1SV 3H5SA 4DV3F 2AEFA 2IJNA 5KFWA 1RAJA 2ZWPA 3OSNA 4JV1A 5AE3A 1F60B 3MECA 3SSQA 1U6BA 4J9MA 1A9NB 1FFSB 3W2WA 4FVMA 3DFEA 2GJFA 2PE8A 1FXDA 1TQLA 3ZZPA 2DK2A 2F5GA 3N5FA 2CQIA 1VS3A 2KRRA 1HMVA 4X4OA 2LXUA 1GH8A 5CD4H 1IBLJ 5KFZA 3I4HX 2A3JA 1A0OB 3G6YA 2COLA 4OX9F 2C2KB 3GFXA 3PTWA 4NLTA 5DM6Q 4RNMA 3DHXA 2M8DB 3PYDA 2EFVA 1B70B 2MQ8A 3SQGA 1NJXA 2QG9B 1TZ0A 3D6HB 2ZH8A 1NDKA 2ZUGA 3A3NB 4LVOP 3DLEA 5EN1A 2QL9B 2IBKA 3SZ2A 2H51B 2AJ1A 5K8MA 1RXOB 1S76D 4M5HA 2PC6A 3WHIA 4CT8A 2D9PA 1CSJA 2GVZB 2A18A 2BV3A 4LF8F 5CCMA 4J90A 1LV5A 4J5OA 3SCLE 5D8HB 3R5CA 3EVMA 2AKWB 5DGBA 3DMJB 3SSSA 1FD8A 1SC4B 4BCAA 3I5BA 1RLCL 4I6YA 4LF5J 3D5MA 1GX5A 1P27B 2UZAA 4LQ9A 4KO0A 1ZM4A 4M8LA 1RISA 5F9LA 4HTJA 3DLKB 3IRXA 1BQXA 1X4HA 3UR0A 2IMWP 2A6MA 1OY8A 3FKBA 3I31A 1APSA 1FX4A 2W24A 4UUXA 1MNEA 2LECA 4LR8A 1C1CB 1QAJA 3Q8YA 3THTA 3T1YF 2DRDA 3RBZA 1RAGB 4QIFA 3MMAB 1SJFA 2HQCA 1D09B 3IN5A 1TL1B 1S9GA 1TKZB 4ELVA 2XSJA 3OJUA 1DJ0A 1VK8A 4CZCA 2RS8A 3AHPA 1V5IB 5F41A 1XEZA 4DWIA 4UY8T 2CZ4A 2NSBA 2WVEA 3UD5A 2K2PA 3W66A 3ENVA 4DV1J 4O4GB 1TK8A 3BO2A 1MWQA 3ENAA 1DTTB 4XTTA 1QTNB 2E9ZA 3UO0A 3R6LB 2VH7A 1QUPA 3J7AN 3S7RA 1WKKA 5E5NA 2N4DA 1NB2A 1N4LA 3G6ES 4RUCA 4NXMJ 2XHWA 4IH5A 4RU2A 4RW6B 1MN9A 2UV8A 2VJVA 1EETA 1SC3B 1C0UB 3FFIB 2K8GA 3CJSA 4GKJJ 2OIHA 2MSTA 4DUZF 5HO4A 3E2EA 2C3OA 2JC0A 2ZE2B 2AX1A 3HF5A 4RW7B 3UPFA 5LSLA 2CQCA 3IG1A 1BQNA 1YLXA 4WJBA 2AGPA 1BC6A 4L76A 3FNNA 4K0KF 4U8YA 1LWEA 4KKOA 4EFAC 5J2NB 4AYBD 3PRVA 3QIPA 1U09A 1NU4A 3IR6B 4J91A 3JSMB 2LEPA 3CVKA 2WVFA 5B09A 3HHLA 4AQYF 4DS5A 5J2QB 3OUYA 3TNVA 3ZTQA 2BA9A 3P8BB 5AJ3J 1OO0B 4JOUA 4WIQA 2RUGA 2YPYA 3D6MB 4WYWA 4NI2B 4FXDA 3U1MA 1W25A 2CPYA 3ENWA 3MM7A 2DEJA 3K5LA 1AFJA 1N5TA 3OR2A 2YKAA 4ED4A 4Y2MA 4LBIA 3GU0A 4MTPA 2V2QA 2M8HA 2L48A 1KQKA 1FVSA 1VQLS 2W7PA 2LU1A 2RS2A 3JQMA 4KY3A 4U7UD 1CLFA 1RI7A 1UCNA 1UWBA 2DHXA 2VKRA 3JYTB 1NH8A 3MR5A 3HVTB 1CJKA 1UWAA 4KB7A 4DS4A 4FXVA 3CJKA 2RU9A 1KQSR 2VC1A 2F40A 1I51B 1OWXA 2XCAA 3ET6A 5MLCV 5I3PA 1UZDA 2OI2A 4YB6A 1XN9A 1JLAA 2L41A 1VC0A 5IOLA 3R1LA 4DSLA 2ZOMA 4WE1A 3TVZA 3JTPA 2RNEA 2DISA 4HT5A 4DL7A 2QN6B 3ILOA 3TX8A 4FF1A 3H40A 1EAYC 4IG0A 1JMTA 4X4PA 3GFHA 2E5JA 4URSA 4KBIA 1RCXB 2IRYA 4FYDA 1CG2A 1WC5A 2KT2A 3I9ZA 2PO4A 4OX7A 3CMQA 4OHZA 1VMBA 4Z7YA 1C0TB 1ELOA 1P9QC 3GLJA 1YSJA 4OYOA 1VBXA 4R8UA 3DRRA 3PCOB 5B0FA 4NYZA 1M5PC 4K4TA 1FI4A 2PMZD 3ZZRA 5A76A 2W9AA 2HHSA 4Z2XA 1V5VA 1AW0A 4FF3A 3MAAB 1GNKA 4Q8EA 2K1RB 2APOA 1VQPS 2IY5B 2LP4A 3QATA 1FNMA 1N32J 2MQMA 2R7OA 4JV5J 4GMKA 4MKVA 5BJRA 5GAEI 1NM2A 3HVAA 4OMFG 5FLXU 5CYQB 1YRUA 4FNHA 1M5KC 4F8RA 2IM0A 2QE5A 1HBOB 2KZZA 1U1OA 3F0NA 3LPYA 2N82B 5KT4A 5K14A 2QYCA 2PA3A 2VHGA 1J5EF 1FRMA 4TNOA 3KNGA 3MCMA 2QFIA 1KRPA 4DR5F 2E7WA 5KG5A 3BYRA 3JAMY 4YR2A 1NAQA 5HMZA 4KC5A 4P7VA 1S9EA 3ZZUA 1YJ9S 2RAQA 3BR9A 1UW4A 3NEKA 2HIQA 2UP1A 5T7LB 4I67A 1B64A 2CWXA 2HNYA 3S1TA 2NCKL 4ELUA 4C8LA 4NZ6A 3ZZOA 2XM3A 1N8RT 1ITPA 3I82A 2Q66A 1HBNB 3QJPA 2YX1A 3VAFA 2R2TA 1U7LA 4NLDA 4Q2LA 3G82A 4CH0S 2RRAA 3PRBA 1G1XA 4Y2IA 1NDCA 4PG6A 4HEA9 1SUQA 4CDIA 4X64F 2F8HA 2YQ1A 1YJUA 3DM2B 2YKOA 4NYOA 2BEFA 3BGFA 2R8KA 3KJVA 1ZH5A 4I2QB 1XNQF 2XG8A 5D0EA 1S77D 3BGRA 1NSKL 3KLEA 2XB2D 1HNIB 2CQ2A 4YR0A 1RBAA 2U2FA 2Z0GA 1EHWA 3GR1A 4F4XA 2XMMA 4NRUA 1GFWB 4AT1B 2KHDA 4PUOB 2BACA 4AL6A 3OFEA 3E8OA 3PFEA 4ZPDA 1U0SA 4PZVA 1UL3A 1M5SA 4CYUA 1FFGB 4FN5A 1WSVA 3TZXA 2VQEF 1KWMA 3W9HA 3TYTA 2IVFB 3D67A 4RBUA 2JOQA 2R7SA 1LWXA 4J9LA 3OR1B 2A10A 2QMUB 4RW9B 3DDNA 4KHPF 1H6KX 1F5BA 2J9CA 3AT1B 4CNZA 3V6HA 2KFNA 3PX0A 2IJRA 2DGXA 4ID8A 4DEZA 5C42A 2IA0A 2HQIA 3BGOP 4QPXA 5KT5A 1K44A 2DY1A 1V3SA 4BHQA 4ID5B 3SCKE 5H9FJ 3IO1A 2YKMB 1AUDA 1EKRA 4DLGA 4P74A 3CW2C 1X0FA 3QLHA 2VF3A 1RAEB 3BBCA 8ATCB 3S6EA 2QYGA 3MM8B 3KJFB 2E44A 1ROFA 2HGLA 2XWXA 2QJ3A 3NRBA 4TQRA 3GFYA 3N5BA 5SUHA 4E98A 1YJRA 2J9DA 2DPIA 1TL7B 5F0UA 4PG5A 4A48A 2JDJA 5B0GA 1WKJA 1AA1B 2RMLA 3RR8A 4LBHA 3AXKA 2E1MC 2ALZA 3K0JA 3WC0A 3CCTA 2POKA 2V4JB 3CCES 4KTQA 1C4AA 2IIHA 4ALZA 4HHHA 1S4EA 4ZCLA 2PGCA 1HBMB 4QR0A 2DR9A 1VYAA 1V9OA 3J7YI 3SSRA 3HHLC 4N5SA 3W62A 5E33A 2ZH5A 4K2JA 1X4AA 4IYQA 4E8UA 1CJUB 3C3LA 1Q7LB 1CS4A 1WG4A 2VDIA 1UJ4A 4Y3CA 3KMSA 2FY8A 5ETKA 4IR1A 5GAGI 3MEGB 3AD9C 4EI2A 3LP2B 2BOAA 1S99A 5JVHQ 3V2UC 3HJVA 5KFHA 3RR7A 3FBBA 1HYSB 4FYYB 3PR5B 2GGPA 4RO0A 2QA1A 4P52A 5AXMA 2ZC3A 5I4MA 2WAQD 2RJZA 4OZ0A 3G9CA 2M88A 4JUZA 4JI2F 4QCLA 1RHUB 4QIEA 3QYYA 3IM9A 2FVCA 4JI1F 2GHPA 3JTNA 3R6GB 1JLGA 1FWKA 2QLFB 2V2ZA 3FCWA 2HS0A 1B0PA 1S1TB 4HTIA 2EFOA 3LGHA 1G6BA 3IGVA 1UP1A 1CC8A 3QGIA 3NBPA 3RAXA 4NCGA 4I7FA 2CPXA 2F63A 4KV8B 1WNEA 5CABA 2D41A 3LPEA 3SI8A 4FYXB 4F7VA 3FDSA 2XYGB 3W5YA 2QSWA 4YDXA 3MD1A 3C6TB 4HDGA 3DOMA 4WXOA 4DSFA 4ANCA 1B99A 1QE1A 2MB0B 3Q86A 4X84A 1RT6B 2BZ2A 5FD1A 3I9V9 4TY9A 1U2FA 3A8EA 1VJWA 5HMWA 3PY8A 4PAAA 1YJWS 2CWKA 1FKOB 2V6AA 2BQ3A 1AUSL 2QEXS 4L74A 4NLSA 3H8YA 5AT1B 1OPIA 1FRKA 3GWCA 2JX2A 3D3CJ 5KFFA 3QO9A 2VBZA 2D69A 4DCJB 1RWKB 4N56A 4KJIA 4DV0J 2JEIA 2VOPA 1S0NA 3M6WA 2GJIA 1JLBB 2YKPA 4LRDA 3RJMB 1IWAA 5EX3A 2V8PA 1ZAWA 1URRA 1KP6A 1WWHA 4NA2A 1UMJA 5HAOA 2XI2A 3C15A 1PGZA 1YWXA 2M9KA 2MQLA 3V4IB 3QBCA 2V9WA 2JRSA 1QVGR 2RQMA 3M4XA 1YTYA 3AD8C 2HNDB 2AU0A 2AJFE 4ZN1A 2MY8A 2ZH7A 2J7UA 4ZJLA 5KG0A 1HW9A 1YVFA 2MMYA 2DO4A 5F9NA 1RKJA 2OTJS 1FFWB 1PG5B 4DV7J 5GMKa 3R5AA 2EFNA 2BE2B 4KPYA 5HROB 1NB7A 1J5OA 4DJBA 4PPDA 2MZQA 1NNDA 3CO0P 3LP0A 2OSQA 2QO3A 2XCPA 4U67Q 2AMCB 2ACMA 4YY3F 3KG0A 2CQ0A 1WELA 3GMGA 4QWCA 4LMZA 4M5KA 3C14A 4JI5F 3U1LA 2MZTA 1C1BB 2DO0A 1NHVA 1TL5A 2HLTA 1U0HB 2QC3A 4ZCIA 3KK1B 2RE1A 1BUXA 3J80Y 2HS4A 3O1LA 4WTOB 2L9DA 3I5CA 1QSLA 2IA6A 2PMHA 1HHTP 4FXWA 4P2XA 3US5A 1R0AA 2A6OA 4PXDA 5DO2A 5B0DA 4URGA 5ETRA 2HPUA 4PG7A 1WG1A 2FGCA 2NREA 2E7VA 1QLNA 2MXYA 1BY9A 1Z2LA 4OYBA 1Y00A 1YRTA 1D0EA 3KHLA 4CO4A 2MLYA 2FTRA 2LQBA 3NGRA 2XS7A 2V0NA 2QFJA 2EFGA 4KFBA 1O6XA 4HACB 4USKA 1SH3A 1JJ2R 4OLPA 1X4FA 3HSZA 7AT1B 2MJUA 1TKTA 3TJ9A 4PWWA 1KLNA 3TAMA 3NXZA 5GMDA 4LFCF 4J9OA 4UQGA 4FYWB 2DHAA 4WXWA 2EI5A 2G0JA 2LDIA 1YDLA 5CHCB 5EGYA 4DG1A 3ITHB 3MOZA 2E5LJ 2HBQB 3NCPA 2OEKA 2R8IA 1XNQJ 1HFEL 2EG1A 3MM6B 4KGZB 3DDKA 1LW2B 4K59A 1GAOA 5HBMB 5FDLA 1V3ZA 1S0MA 2F9JA 1CC7A 1RT5B 2C3UA 2DKOB 1TAUA 4OLOA 2OPRA 4F36A 2MKKA 1NSQA 3KK3B 3NGDA 1PYOB 3OXGA 4OI6A 4ZVFA 2R2UA 1RK8A 3MECB 5T14A 4DHVA 3BO3A 3TARA 2A2CA 7FD1A 3W2WB 5IFMA 2FVPA 2GZOA 1ZA1B 2KRBA 2LCWA 2FUG9 4KHPJ 2GQ2A 3UVJB 4A8WA 1NSAA 2OP5A 1M1GA 5EWEA 1JJ4A 4WWSA 1HMVB 5E3CA 3G96A 1KD1T 1LK5A 4F4ZA 4AD6A 3CCMS 2HLUA 2BKNA 4UF4A 2AT1B 4OX8A 5D0RA 1KLMA 4FS1A 2AYBA 3Q8SB 1NJWA 4GRSA 1M90T 2UU9F 3W61A 2IJFA 1KHWA 3T5HA 2DNMA 1Q16B 3SQGB 2G1HA 2ZVSA 1S4FA 2JHEA 2JSXA 3Q2TC 3N6LA 3MOJB 1FWPA 3ISZA 4DR7F 3G6VA 4TLRA 2CJXB 2R7UA 1BWEA 5M2UA 2VA3A 2V94A 5KFMA 1FT8A 1N88A 1YKWA 4P10A 3KLGA 1N6QA 3EDQB 3M30B 2HZCA 2VG6A 3HXMA 1LW0A 3JQJA 2LA4A 2JC1A 3O6QA 1VC5A 1TMMA 3R9LA 2BW2A 5CD4A 4YHHF 2MHNA 1RTDA 2N4CA 4G1QA 2Z58B 1TL4A 3OQ2A 2FHJD 3SDEA 3MCSA 1WHYA 4ECYA 1X5TA 4C0BA 1DZ5A 3TANA 1KC8T 4KO0B 1W2IA 3ZO7A 1IR1A 2FLOA 1VQ4S 1HL6A 3IRXB 1WHXA 4ZLJA 5IV4A 5KT6A 2CVIA 1SKRA 2IAJB 2NS1B 4RUHA 1N33F 3OL7A 1UW9A 1GMUA 3MR6A 3HSJA 1U6ZA 5IS2A 4K4YA 3M2UA 3ADAC 3BN7A 4AXIA 4LF9J 1NH7A 2ZD1A 2KM8C 3CUNA 3VGTA 1S9GB 3R5GA 2XSJB 4RKUC 4LVNP 3DYAA 4OYIA 4H4OA 3T5LA 4KR0B 1WDTA 2WW4A 1I1GA 4ILRA 5GMEA 3VAGA 2RQCA 2C2EA 3QQCD 3MGJA 2W9BA 1H3DA 4A8FA 1B0TA 1HQEA 3EXCX 1PC4A 3K17A 2O5DA 1WSRA 3SMZA 1ZBTA 1JNRB 5DDQC 4WFXA 2OEJA 1KTQA 1RGVA 4B3SF 1REGX 4LRBA 1RTZA 4YP3A 3BM7A 2DGUA 5D3GA 2EK1A 4ITSA 3B8HA 2HVZA 4ZPVR 2ILYA 2FJAB 3TJAA 3M8QA 2AZ3A 5KT3A 3P5BP 2G0IA 4RL1A 1U1RA 3RG6A 3I6PA 1EETB 4DPTA 1X31C 3G8QA 5BYQA 1WD6A 1QSSA 1GXUA 4ZPTR 5E7OB 5GAEU 1BMQB 5C2CA 1NJYA 4NA3A 2XYHB 3NGUA 1FO1A 3O8WA 4DQPA 1TELA 3X3UA 4TQSA 5KFGA 1VHFA 3RGIA 1EQ0A 4TYAA 2ADBA 4U8VA 3IG1B 3JTOA 3OVBA 1BQNB 2WVDA 4A8OA 1EIYB 2OAUA 3ILLA 3BQ1A 1FJGJ 1LWEB 3OXFA 5C24B 4KKOB 3VAMA 3TUIC 1QAIA 4NLVA 5LXRA 4OZ2A 1E6YA 4C6AA 1NLKL 4DU8A 1NK5A 1VR6A 3QIPB 2WZ1A 3VHQA 4LFAF 3GILA 2HQFA 1LWFB 1H98A 1WI8A 3TA0A 3HHLB 4O44A 3QGGA 2EBGA 2J8AA 4ZHRA 3GIJA 4B3TJ 3O44A 1RWPB 3UNGC 5EDWA 5D77A 2DR7A 2FZGB 3A3PB 1RT7A 2GIQA 3MMJA 1X5OA 3GG1A 3BV8A 2HHHF 4WU2A 1I6JA 4DI6A 2V4QA 2V34A 4AUKA 2C3YA 4EWTA 1NO8A 3OR2B 2JLFA 2FJDB 5KG1A 4W4MA 3K58A 3BSOA 3JXOA 3HKZD 3NNHA 1SKUB 4YB5A 2AIRB 4P9SA 4Y0FA 5C25A 5HN0A 3UDCA 4DV2J 4M5NA 2ZBCA 1E6VA 3D28A 4U6PA 2HRUA 4XO0A 1H73A 1RT3B 5JUMA 1UWBB 3FZ2A 4LF6J 2CADA 4EZ6A 4X65J 4KE5A 1CJKB 3CJKB 3J81U 1FXRA 4B08A 4PCQA 4Y2CA 3PO5A 2FVRA 4RW8B 2BUNA 3UDVA 3B4MA 4B9TA 3FEXB 2XBPA 2QT7A 4DQQA 3D54A 4OJHA 1FEHA 1JLAB 4ICLA 1UEUA 2XSFA 4WE1B 4M63A 2HQ3A 4RU9A 1R0BG 2GQCA 2RKIA 2DNQA 2YKNA 3NGSA 2I1RA 2MQPA 1YBTA 2K06A 1PYSB 4IG0B 1S0VA 3NWGA 3WC2A 2QSFA 4QYZK 1OQ6A 3L7UA 3MFHA 2N7CA 3U1NA 1X60A 1ZPVA 2V50A 3NMRA 3GYXB 1W7WA 4DX5A 4FKXA 1HNVA 3W63A 2RT3A 4K50A 2ZOFA 2CKWA 1DQAA 2J9DE 1HNZF 5DG7A 1WKLA 4F3QA 5L9XA 3MPYA 1JLCB 3ONQA 3C2PA 3FGVA 2RUSA 2XGQA 5DJBA 4LRAA 5A8KA 1MMNA 3LQVA 5ADZA 1P9YA 1F5CA 1R3NA 1UJ6A 3K8VA 2B9EA 1XJWB 2B4UA 2FGOA 5IM0A 2NZ4A 3CDUA 3NAIA 3NCRA 1RT1B 2HFVA 1WF0A 2ZZTA 3CXCR 3GCXP 1FKPA 4DR6J 2R7QA 4CLPA 3CCQS 5AE2A 3SYZA 3VGSA 3EX7B 2DNKA 4KGVB 4YB7A 2XQCA 4J9UE 5FLXY 3W7BA 3W3SA 4WYLA 3D68A 4Y2KA 1BWVA 4A8MP 3JQKA 2C2NA 3VAIA 1JIHA 3B6BA 3J7YU 2FYXA 4MK9A 3HFVA 1Q79A 5EX0A 5KFNA 1T05A 4B9LA 2VA2A 5F8JA 1S9EB 3I0SA 1HI1A 4QW8A 1S6QB 2UXBJ 1FF2A 5I3UA 2J0WA 4FPRA 4DL3A 3MD3A 2HNYB 4ZLPA 2ZM6F 2ZJRQ 1N52B 4LSNA 1H0HB 2VBYA 5IQ6A 3KWMA 2XGPA 2Z2YB 1NK6A 2XS2A 2E9RX 3DGPB 1IR0A 3SQOP 4PXCA 3MEEB 3EPIA 4DUYJ 5E3PA 5KT7A 1S97A 4A4JA 2LXFA 1K8AT 2UU9J 5ETNA 2X3DA 1HHSA 4NYPA 4JI0J 2OTLS 2Y8YA 4GVBA 4QR2A 1DAXA 3PX6A 1L3KA 1XR6A 4R0JA 2UUBJ 1VQOS 1RHMB 2VUGA 2WONA 1BHNA 1UPPA 2LQJA 2YX4A 1GK8A 4CIOA 4OZLA 4B02A 4NLYA 2KKHA 1DTQA 4CYUB 2QLBB 1W26A 2D3O1 2D7SA 2E29A 5E3AA 3HZEA 2ATLA 5A8RA 4ED3A 2HZAA 3OL6A 5CZXA 3FBEA 4QYRA 2EVZA 2D1CA 3H42A 4CQ1A 4C9DA 2RDIA 4OZ1A 2P5VA 2NXJA 5BR8J 1N36J 3JSBA 1KN6A 4P71A 4IUFA 2AYEA 1ICEB 3R5DA 3GIMA 2XYPB 1WACA 2KZMA 1R27B 4ATNA 2B6AA 1NRKA 3C66A 4J7CA 2X1BA 3P5TL 2LMIA 1IQZA 1ZOTA 1SQGA 1PCAA 3AOAA 3QLHB 2YNFA 1IBLF 4IFYB 1K1SA 3C6UA 4LSLB 3BSCA 4DPYA 3D66A 2OMOA 1Q81T 4MKYA 1RSCA 4RZRA 1P1LA 1SKSA 3T5KA 1WC6A 1FDDA 1FX2A 5EWGA 3FBFA 3MMBA 3D2WA 1PJ7A 2HFSA 1KVKA 2Q6BA 2CJAA 2MKJA 4B3SJ 4OJ3A 3H20A 2QTWA 4B3OA 1GXTA 1S5ZA 3CJRA 4NLWA 2Y1JA 2ALYB 1OSDA 2CPHA 4KSEB 2LQ9A 3QRPA 2P9CA 1NMEB 3W5ZA 2H9ZA 2WVBA 1S1XA 4OHYA 3UN5A 3PX4A 3A1YG 3GSIA 3RYLA 1CS4B 1ZYQA 1N0VC 3C16B 1RYSA 3LWMA 2V8DA 4EO8A 2LXIA 3LGNA 3MEDB 1LFPA 4EU0A 2VIHA 2ZHAA 1QM9A 3G6XA 5K5MA 5LM7E 3TX0A 4IOBA 2GGPB 4OI4A 4WIIA 6FD1A 2HHWA 4ZPBA 1Q82T 2GIRA 4OI1A 3QIDA 1OSCA 1S57A 1RLDA 3KLHB 2R8HA 2XWYA 2BVZA 3EYZA 1FVQA 5J1NA 4QWBA 5A8WA 3LGMA 1JLGB 2W8KA 2MGZA 2Z2LA 1L5UA 4OYWA 3NS7B 3RRKA 3DKDA 3ZTSA 3W64A 1RAAB 2EWHA 2B7CB 5E2QA 5IWAJ 4PR6A 3NBPB 4OIXA 4I7FB 1IQTA 2NXNA 1N54B 4M5IA 2FLLA 2FZKB 4UZBA 2R7TA 2X51A 1VRUB 1X9MA 2VG7A 1F9FA 2JJ4D 2DXFA 5HANA 4DV1F 3DOMB 4DU7A 2DGQA 4K5SA 2GC8A 1F2HA 2W4PA 1YG0A 3QJLA 4ENOA 4DDFA 4A8YA 3CCSS 2FZCB 3DLHA 4DUTA 5ETVA 3TI0A 3AQOA 3KLFA 2DR8A 1JKHA 4PWUA 5C5JA 1NK0A 4LT6A 4Z37A 3L3CA 5LJ5Y 1I3OB 2PFDA 2KL8A 1D8ZA 4NXMF 2J6TA 2AV5A 4WP8A 3V5RA 1WC3A 1UA0A 5A0YA 4GKJF 1R89A 4ZKAA 2U1AA 1HNXJ 3QO9B 2CAJA 2G4BA 4R5PA 2OPPA 3FCVA 4DV4J 2H48B 1SV5A 2FD2A 1XR5A 1B3TA 4C11A 5B0EA 4X62J 3AA8A 3KLIA 4CNYA 3H90A 1B0VA 4XK8C 4JI7F 2RF2A 2OD4A 3M8ZA 1SL2A 2KDOA 4DN0A 2V67A 2FJWA 3KNAA 3C15B 5G0RA 1IKXA 4XDDA 1MLAA 4NCAA 4IDKA 4Y28C 4BWMA 2VC0A 2JEJA 4DN9A 1MW7A 3KUEA 3DLJA 3H7HB 1SI9A 1LXJA 2ROEA 2AHOB 5AJ3F 2MLZA 2F8EX 1TAQA 1J5OB 1EB0A 3LW5C 4C3MA 3OL8A 3K89A 1CBKA 4CLUA 3LP0B 2YWKA 3HFZB 5CZVA 4USUA 3EPGA 3OSPA 3GIKA 2IVMA 3VQTA 3N0VA 3O3LA 3D0GE 2BDPA 4RX6A 3A8IA 1T9TA 5LSRA 3RAQA 4NLUA 3C14B 3NLCA 1RTIA 2BJ7A 3AH6A 1UKUA 3S01A 4IH6A 4AL7A 3T6JA 4RUBA 1Y0HA 2FHOB 3CC7S 3CC2S 2Z2ZA 2GJ2A 2ZBQA 2WK4A 2X7IA 4UUWA 3M6UA 3ZC4A 4IQMA 3CCWA 2YH1A 1HR0J 4ECSA 3ICLA 4OYAA 1RWUA 4Q43A 4ECTA 1NKCA 4B9SA 3TR5A 3TZZA 5HQ8A 5KFIA 2FLNA 1XNRJ 3CJTA 5A6PA 3BF4A 3BYPA 3MUVP 4QIWD 2QMWA 4C4WA 4TU8A 5HQLA 1FERA 1UFWA 4C3LA 3AJDA 2AJ4A 2BE9B 4RNNA 3R27A 2MY7A 1TKDA 4XPEA 2I5JA 1TKTB 1VGYA 3CIMA 4MFBB 4F4AA 2Q43A 3RU0A 1FE0A 4CWBA 4DV6F 1QSYA 5HLFA 5GAHI 4DG1B 1OIAA 5F8LA 4P6QA 1C1CA 1JXEA 5L1LA 2DT9A 5KG3A 2Y3YA 2ZFHA 2CPIA 3MMAA 2KG0A 1EP4B 2ZHOA 1Q5YA 1N32F 3HHEA 4JV5F 2ZH6A 3UI3A 3FC9A 1WHVA 3WX4A 1WOSA 3VCDA 3I32A 4F67A 5FDLB 4JI6F 4F4KA 2YNIB 3P6YC 3DC2A 1HD1A 1RKIA 3PIPQ 1SJ3P 2DXDA 1K0TA 3GFZA 3HP6A 3Q22A 2PMWA 3GSDA 3K8WA 2CIMA 1YX2A 5L39A 2C1EB 1DTTA 1DFDA 4C8OA 2B9XA 1R7IA 3KFWX 2D74B 2CPEA 3QWPA 3EZUA 3GJTB 5KFSA 1FRHA 4NZ7A 4TXSA 1SBRA 4DL4A 2XHCA 3NOCA 4DCOB 3OTEA 4F02A 2WW8A 2AJQA 2CRLA 5AE1A 1PC5A 4O0NA 3PXGa 2BR0A 3PFOA 1IKYA 1OY9A 5DS7A 1KLMB 1TR0A 1M5OC 4QQBA 1KFDA 1YBUA 2CJBA 4U96A 2XS5A 1BQMB 2DGSA 1NZ8A 3IBWA 3WIVA 2FJBB 2B9YA 1KNZA 3P3DA 1KEKA 4X4UA 1YIJS 5J2NA 2LQ5A 2XLKA 3DN9A 3EVOA 2ZOGA 4HI2A 2VU5A 1N6QB 4DZDA 2RILA 1GMVA 4KGXB 2VG6B 4A46A 3LANA 1LW0B 4JI3J 3D1HA 5HQMA 4URQU 1FD2A 4K4XA 1LEOA 2DXEA 1TFYA 5ITHA 2HYIB 4NI2A 4HDHA 4Q8FA 2UVRA 4DFJA 3SDEB 2VL1A 2DCLA 2H4YB 3D3BJ 2KYXA 3MR2A 4EO6A 3ENQA 3IBCB 3HSGA 2HW3A 4WF9Q 1VK3A 4PXEA 4EYIB 1TK5A 4WFBQ 2BJ3A 2QLWA 5K8NA 4DV5J 4ZPWR 1CQNA 3UD4P 1HI8A 3PV8A 4V1Ak 4RW4B 2DIVA 4B3MF 3CCJS 3CD5A 2CNNB 2EFQA 3TP2A 1O51A 1LNQA 4DR4J 4H4OB 4W90B 2UV8G 2BRKA 1HBUA 5A2QU 4DPXA 4ZITA 1S6PA 3T19A 2J5AA 1MWYA 4FYVB 1LFWA 2W9BB 4OYPA 1NHUA 4ZLNA 4HH0A 3HZGA 3H2LA 1RABB 5IV3A 2FHJA 2J8SA 2K7JA 2OSRA 1F9HA 3D6FB 2RRBA 1RHRB 2L08A 2HK3A 5D3GB 3CDWA 1RCOB 3MMCB 3AOCA 4G1IA 1RWNB 3EXYA 5ETPA 1K1QA 3AA9A 2H3EB 4RR5A 4Q0BB 5B0AA 3M8QB 3OFGA 4EGLA 2J6UA 4DOZA 1NDLA 4JI8J 3I55S 3V6DB 4MIAA 3K5PA 2LU2A 3D1QA 5K9FA 1RA6A 3DRXA 1VQ5S 4NWBA 2ASLA 1IBKF 5HSPA 8AT1B 2F9DA 2XULA 3PW0A 3FK4A 4LJMA 3VV2B 1MWZA 3MAAA 2R3VA 2K1RA 2JL9A 2MKYA 3JB9k 2AYMA 2C28A 1YI2S 2P8IA 1GT8A 1RACB 2C2MB 4KH1B 2BQUA 3CDAA 3EGZA 3TA1A 4C8YA 1HWIA 4J9RA 1T9UA 1Q8IA 2HMIB 2XMUA 3OFFA 2ZKUA 2WCXA 5BYRA 3QZ8A 1Q0NA 1S1WB 4EEYA 2X1FA 1T8EA 2C3PA 1I94F 1AZSA 3BSAA 1HBOA 4PG8A 3UN2A 4O44B 4OJGA 3NNCA 3NP5A 1MROA 3BREA 3MURP 5KT2A 2EC0A 2J7WA 4ZHRB 2UVUA 3J81j 2PI4A 1ZTTA 4KRWA 5KFKA 1U1LA 3IWNC 3U7JA 4QYZJ 2H5JB 4JI7J 4JV2A 2YWEA 1RT7B 1ZTWA 2RHQB 3AOBA 1RHJB 4G3IA 1FCAA 2YVSA 3FEZA 4RWXA 4C0OC 2DTJA 4MYUA 1TFWA 2F4FA 2P6SA 1PIEA 1IR2A 3FBCA 1E6VB 1VQNS 1HBNA 4PQAA 1AROP 5KOWA 2A2DA 1VBKA 1HA1A 1VRTB 4W92B 3FCHA 1X4EA 1X9SA 4FPIA 2K3IA 2XY6A 2BANB 1RJJA 3IR5B 1WJ9A 4ELTA 2XLJA 4Q45A 3ZZYA 4LF7J 2GS8A 3M9NB 4IRDA 3TZYA 1FESA 2EKNA 4A8KA 2DJWA 2QZ8A 1UFKA 4ICLB 3M8PA 1L3SA 3J81Y 2HHTA 1HNIA 2RKIB 1XERA 4C0HA 4GC6A 3SFGA 4L3KA 3IM8A 5CA5A 1JLFB 2FY1A 1SKWA 2DPJA 2XY5A 4GVLA 1RA7A 4MK8A 5F8HA 5IXUA 1RUSA 1X5SA 3GJRB 5G4DA 4DV0F 3VALA 2V63A 4C8ZA 4F2SA 4H4MB 1RTJA 1NK9A 2OMLA 4I4BA 5J1EA 3ZNUA 1TU0B 4U7UK 2WSCC 3F56A 5CYMA 2LYVA 2P9GA 1M0SA 2B8QA 1WTBA 4NASA 5DDRC 3M32A 5KG4A 3Q8VA 2NR0A 3H98A 4NXNJ 3NMAA 2IRUA 2QV6A 2UXDF 1VOMA 4ZVOB 3RW7A 5B0CA 3DDIA 4LR9A 4XDCA 1U25A 5D78A 2JFKA 4CLKA 2HKEA 4DV6J 4DV7F 2AGOA 3H5UA 3DGVA 2DNHA 4ID5A 2ROGA 2L9WA 1DBDA 3EJMA 3N28A 1N5YA 3FJ2A 4I69A 3BBFA 3G8TA 4JV0A 1S12A 3KTQA 1FKPB 4X4SA 3KHRA 3I96A 2OPSB 4AE5A 2M5YA 3LP1A 2N3LA 1DQ9A 1S10A 1NHKL 2BABA 1NK4A 1OS5A 2KTQA 3GG0A 3NL0A 4JI6J 2ZVIA 3UDEA 3J7ZT 2B9WA 3CDEA 2D3ZA 2XZWA 1U1MA 3LO3A 1RP5A 3LA0A 1AYEA 4LRFA 4IQXA 1JLQB 4MK7A 4UTGA 2KH9A 1T05B 1WF2A 3R2CJ 2DBBA 3I0SB 1Q4RA 3T1HJ 2HVIA 2V4JA 3CJ0A 3UR3C 4TU7A 5CCLA 3NAHA 3LH2S 5ETOA 2M3DA 2HRYA 2I6WA 3VTIA 2MTLA 3CJ8A 4WTYA 4LSNB 1HHQA 3DCAA 3M9MB 1J27A 1JWWA 1X8DA 1CJUA 3OBIA 1S49A 1HPZB 4LSZB 5L1KA 2OH2A 5JMNA 5DZ7A 3MEGA 4ECVA 2WB4A 2EFPA 5L9NA 5IC4B 1LK7A 4QIVA 1MSWD 4JP8A 3NNAA 4ED5A 4TLQA 1UVJA 1MU2B 1XQIA 4YB1P 1Y5LB 2OELA 3CCZA 4KH0B 4GVBB 3DRSA 1S48A 3GV7B 3GZ7A 2IM1A 3WX8A 1IM6A 2F1FA 2V8VA 3O2IA 2JZ5A 4OHVA 4NZ0A 2FB0A 3HLUA 2WONB 3OTCA 2IFXA 4WK1A 1QJHA 4LBPA 2E5LF 2Y1IA 5F8NA 4CLYA 3T6BA 1G2EA 2CDQA 4UT4A 1DTQB 2DIUA 5FJ4A 4KHRA 2MEWA 3RB3A 4OYXA 2YKQA 3MM5A 3ILJA 2HG4A 4DF8A 4NCBA 2H5EA 2CA9A 2IMOA 5B08A 3HULA 2D3UA 1IBMJ 5A8RB 4IR9A 4DR2J 2RSQA 3Q8PB 1R8PA 3V81A 2RIJA 1IJEB 3OHBA 2ZKTA 3RRGA 1HWKA 2RH3A 4BWJA 4IOAQ 1XTZA 2BJ1A 3ZFVA 5HK4A 1YJ7A 4ZVPB 5GADU 1K0VA 4KT0C 1RT6A 3E01A 5KFPA 2MZSA 3EWGA 4IH7A 2WHOA 3IAS9 2YH0A 2W8LA 3CIZA 4B3MJ 5DG9A 2Q3PA 2ZWOA 3CDBA 5KFYA 1SH0A 4Q7AA 2HHQA 1NXIA 5HMXA 4NL5A 4HI1A 4ANDA 1VC6A 3GONA 2BM0A 2RDDA 1S0OA 3BDEA 5D0HA 1AXQA 4ZIVA 2FQQB 3EGVA 5KFCA 4W98A 5J1PA 2GHVC 2PDAA 3AODA 2GO8A 3MMBB 1DQ8A 2KHCA 1FDAA 1RHKB 2I38A 2DNYA 1X4BA 2P2CB 1KOHA 1IKWB 1YBAA 2C2DA 2GMJA 2UUTA 2ZH1A 4WU3A 4B3OB 1M1HA 4DFPA 1HKAA 1JK9B 1PBAA 1X7VA 3CNQP 1D9AA 2CQGA 2HNDA 3TA2A 1N34F 2HFZA 3ISNC 2VPWB 4UOFA 2EKYA 1PO6A 5KFOA 2MHEA 3PW2A 3AQPA 3DOKA 1RTHA 3T3FA 2O67A 3TVYA 1Q1KA 4ZDNA 1TV6B 3M2VA 1IBKJ 4HH1A 3ILIA 4C8NA 2DGWA 3WIUA 1HNWF 1UETA 5KFXA 2VZ9A 1ACMB 3HT3A 3KDNA 3RW6A 1BLUA 3DI6A 2JH3A 4LFBF 1DLOB 1C1BA 2B3TB 3CF5Q 5DGAA 3IR7B 2ZBPA 3H59A 3MTKA 5A8WB 5JXSA 2MGZB 3T9ZA 3UCGA 4ER8A 2EEYA 4LF9F 5DLFA 1I94J 1NEEA 1Q8BA 3MAHA 3POTB 1F1BB 2B4OA 4CO1A 2RQKA 1CJVA 5B0BA 3W2VB 2DHGA 2CG4A 3GIRA 3H4BA 2R7WA 3M1VB 1RAFB 1QTMA 3W9IA 4J9VA 4M5MA 1R8AA 4ZA1A 1GMWD 1ZS6A 3VAHA 3MR3A 3QSYB 2W2NP 3RUBL 1F0XA 2VG7B 2HEKA 5KFLA 3GB0A 1CULA 3DLBA 5JVGQ 4DXLA 1Y4ZB 2MZRA 2ZDPA 4KGMA 2DHHA 2BM1A 3OTOJ 4EMDA 2DGOA 2CQ4A 5IT9Y 3G8SA 3MAQA 4K4WA 3KLFB 2V5HG 3Q89A 3MM9A 3P45B 2FVSA 1GTEA 4HHUA 1MMDA 1TKXA 1ZPWX 1EZZB 1R6YA 2F4VJ 2CPZA 3VWSA 1U02A 3IRWP 2UVWA 1O8BA 2CVEA 5A0YB 3TQEA 3ITHA 3O5TB 1AFIA 4XPCA 4H4KA 3PEHA 1RWXB 4HLBA 2AW0A 4MKBA 1IKVA 2B5JB 4ZVEA 3V6KA 2OPPB 5DQGA 3DU6A 2OPQA 4BDPA 1Q5VA 2FC9A 1SV5B 4DZ6A 2J6SA 3UDLA 2V9KA 1FJGF 4ES1A 3ZTRA 2XZDB 4C11B 2CQ3A 2A0FB 2RF2B 4CI0B 2KXFA 4YDDB 4QBUA 3IAM9 4DSIA 3MCOA 2UXCJ 4K8RA 5G0RB 2AJ0A 4J9PA 4ZP9A 1IKXB 1SQFA 2QMXA 4OL8A 4J9NA 3KK3A 3IFEA 2XMKA 1UPMB 4B9VA 1Y11A 4B3TF 4RPFA 3DHWC 4LREA 1YZ6A 1HQUA 1T0TV 2WSFC 4ZVUB 3UVJA 1LOUA 4DPWA 4F4YA 2UXDJ 2HURA 2DH8A 4DSJA 3KG1A 4I2PA 1PKUA 2QIFA 3M2RA 3SCIE 3E3XA 3PW4A 1RTIB 1XMQJ 5KG7A 2VBXA 4FKYA 2DNZA 4DV2F 2E1AA 1NZAA 2CXEA 4QU6A 1Q8LA 4NE9C 1O0PA 1R31A 4CH1A 3BR8A 4ECXA 4I6AA 1P8GA 4NLGA 4LUBA 3W65A 4LF6F 2F7VA 3N6MA 2WBRA 4X65F 2DH9A 3EZ5A 4EBEA 1JQGA 4DF4A 3RB4A 1MN7A 2ASYA 2OD6A 2CJ9A 3L7OA 2DNPA 4D3GA 3R8YA 1FJEB 5D6GA 1EX8A 2HQDA 1PJ5A 1LWCA 5L46A 4ETZA 4BBYA 1RWWB 4PQUA 2ZBRA 2FJVA 3M30A 2Y9HA 4MAKA 2YNHA 1I5OB 2R4FA 1NPPA 5KFTA 4YUDA 1FDNA 2PN6A 2KJVA 5E3RA 2AJ2A 1WEXA 2AWZA 1SVDA 4IKAA 4CM2A 3DLGB 1BD6A 2Y0BB 3NGKA 2I5JB 1SL0A 4RNHA 4Q5VA 4DL6A 4ZN3A 3SCJE 4C8MA 2B51A 4FBUA 1YITS 1FTRA 2PI5A 3PKMA 5HLFB 3R7BB 1KTVA 3R5BA 4RWWA 5LMUJ 5IC6B 2IAJA 2HVEA 2I2YA 4P75A 2XEXA 2YWGA 4U95A 2YWFA 1SIZA 2AEMA 3D0HE 4N41A 2ACYA 2P6TA 4O23A 2ILZA 3GTYX 3A4TA 4DSKA 2GFFA 2NZCA 3L09A 2VB6A 1ULRA 4CTAA 4UOCA 3QJJA 3CGIA 2JLEA 3T41A 4B3RJ 3UFCX 3IBFB 5H9EK 2AX0A 2VODA 2GMLA 3MI7X 4C3KA 4DR6F 2B0GA 2VPXB 2ZBIA 2ASDA 3LALA 5HMYA 4JYAJ 2PA8D 3TZWA 4F25A 3SV3A 1D3WA 5LSOA 3AXMA 5F8GA 2C42A 4PRFA 4NLPA 4Y00A 5LJ3Y 2MSSA 3FRZA 4DCPB 4IFVA 3QRRA 4ECWA 5DQHA 2E5HA 1H2VZ 4X66J 2UXBF 3CCVS 5F8MA 3HHDA 4ZMMA 4OQJA 1IKYB 1Z4UA 1H74A 4DL0C 1VBZA 5LMNF 2VD3A 3UQSA 4CLWA 4MH8A 5EHHA 3CC4S 4AXJA 3CMAS 4B17A 4DR1F 1WEZA 1Q8KA 4OJ1A 2MZ1A 2OKQA 1ZA2B 5C24A 1NBEB 4L73A 4DUYF 4AFFA 3QSIA 2YY3A 4EYHB 3MDFA 1ZAVA 2N7YA 1T3OA 1VLYA 3VAKA 4C2MA 2EG2A 1H72C 4YN3B 1LWFA 2HHXA 4O3SA 3JSYA 4JI0F 1EARA 2Z57B 4ED2A 3PM9A 4FNIA 2Z56B 2BBEA 2HK2A 1D8YA 3CD7A 4FDFA 3DLEB 2NPIA 3ZXWA 5I3QA 1LKZA 2ZC4A 3TUJC 3OLBA 3T5JA 2UUBF 4L75A 5KFEA 5DQIA 1KVIA 3H25A 2R2SA 1Y10A 2VPZB 2HFOA 4IO9Q 1X4DA 4M5GA 2R8JA 2GA7A 1IWGA 3HPOA 2AD9A 1Q78A 4QW9A 3G2XA 1RAIB 1N34J 1A7GE 2H65B 3AB2B 1CJTA 3LAKA 1KVJA 1B4SA 2FJEB 5KFUA 1U2RA 4YEAA 3PHTA 2AF6A 2HSEB 1S7HA 2IRXA 2B7BB 4C8KA 4ZP8A 3Q2SC 1U47A 4JI4J 1RT3A 4K4UA 1RB0A 1L3VA 2GQQA 3PJXA 4F50A 2HFUA 3PJ9A 1HNWJ 1T95A 5BR8F 3VVTA 2F8MA 1N36F 4NA1A 3G71S 1OPZA 4DPOA 3PYEA 4RW8A 4ZIWA 3BPDA 1HBUB 3BEGB 4JBCA 4LFBJ 2DRBA 4NLOA 4DSEA 1S6PB 1L3TA 1CQMA 1WG5A 2W25A 1QDUB 3VVUA 2GVDA 2HWHA 3H4DA 3I5AA 2KI2A 4DPUA 1U24A 4ETXA 1SL1A 4PKDB 5DZ6A 1XMOF 3HD1A 5A2QY 3BZQA 4DR3J 1R43A 2R7VA 4ZJOA 2DNRA 1O5JA 1GTHA 3QGPA 3EZOA 1K47A 4H4KC 2MQNA 2V69A 3FQKA 4ERDA 1VI7A 3MCNA 2DVIA 3A12A 4S0MA 2J76E 1RT2A 3KUGA 3AJ1A 4PXBA 3UWTA 5M2RA 2IC3A 2CFXA 2CPDA 4O0IA 3IMQJ 4WBFA 4WFYA 3THVA 4ILLA 3THPA 2HVHA 3Q24A 3TW0A 3MPWA 1VLOA 4I1TA 4MT1A 4RLEA 1OYEA 1JJHA 5LL6d 4TN2A 2XO7A 3C19A 4GO5X 4KAIA 3BBBA 2W9CA 3QAUA 3ISND 1JLCA 3NCQA 1KONA 3PEJA 7FDRA 3GQCA 4A47A 5HATA 3L4BC 4NMXA 3ZZTA 1KQGB 2G2ZA 3K5NA 4OZNA 4P2SA 1VIXA 3BDPA 3NS5A 1T9WA 3EGNA 1RT1A 1N5QA 3Q8UA 1HQ2A 4G1PA 3BGLA 5L1JA 4TKTA 1R8HA 1AZSB 2KXNB 4B9UA 1X0PA 3OJSA 1MROB 1FRXA 2C2OB 1TVRA 5E0OA 1DRZA 1WDDA 3H5YA 1R6VA 2ZZMA 5MAOA 3WDOA 3PO4A 5GVQA 4KPCA 2LA6A 2XMVA 5CYJA 4USTA 1REVA 5B7WA 2VQFJ 2XC9A 5CXTA 4ED8A 1VCTA 4DV3J 2ZNZA 5IWAF 2RHSB 3NY0A 4ED0A 1R8CA 3OUYB 1VDHA 5RUBA 4LF2A 1S6QA 5KG2A 3IWLA 2Z4PA 4LF1A 4Y65A 3R5JB 3K5OA 3QT7A 3MM7B 3FEYB 3GIIA 4DMZA 2HWIA 2EXUA 4YR3A 2KVIA 5DG8A 4ZP6A 3HVWA 2HVDA 3DGPA 4OV6A 2GAHC 1RU2A 1A6LA 4M5LA 1H2UX 3MEEA 4R0EA 3N9UC 2IYGA 4GO7X 2W2OP 4DQRA 2CNLB 4OX9J 4YFUA 4NEZA 3MF5A 3RB0A 3M8PB 4TVAB 1N56A 1OYDA 4ES2A 1FXLA 3ET6B 2BQRA 3EVWA 1HNXF 3KYLA 4OI2A 3KK2A 1BGXT 4FZVA 2ZH9A 5HL7Q 3GV8B 2HFNA 4DV4F 3MPVA 4LF8J 1X9WA 1RTJB 2HRTA 5J1EB 4A8QA 4TY8A 4X62F 5DRKA 1T9XA 5CYMB 2RRNA 4WP3A 5DLGA 4LRCA 2XNQA 3M32B 2F3JA 2YTCA 3EE3A 4CP5A 4ECRA 3PG9A 3PACA 2NUHA 5HJXA 1PAEX 4EBDA 2DNOA 2W01A 3M8RA 4R8UB 2XMWA 3DRRB 5D4OA 2KT3A 3DRPA 4WP9A 4P72A 1N5YB 3T1YJ 2WTFA 3BQ0A 5DETA 3SEOA 1RU1A 3DLLQ 3LP1B 1U4BA 4IFYA 4ZVQB 2EC2A 1RT4A 1T9VA 4LSLA 1V3RA 2M52A 1T11A 2MDAA 3ZNJ1 3MZIA 2WB1D 2VPYB 1KDNA 3QNWB 2D3OR 2GX8A 3H2UB 2RU3A 4RNFA 4OYMA 4WPAA 2IYIA 5ETTA 4IG3A 4G65A 1SC6A 1KSPA 3HJFA 4NEYA 3GYGA 1RBLA 3P49B 2PSZA 4Y34A 1HR0F 1OMSA 5K14B 4Z7CA 4M5DA 4F2RA 3FSIA 2YNGA 1N48A 1SB6A 3TUZC 6AT1B 3CJ3A 2D9OA 4ZVSB 4CM0A 1M5VC 1VQ7S 3OXLA 1KR4A 4QR1A 2H4WB 3UD3P 3AAWB 5J2PA 3U02A 1XNRF 3AD7C 3EGWB 1AT1B 1Q7YT 4J9QA 2JWNA 3QMQA 4UZCA 2B56A 2AQ4A 3C16A 2J7KA 3CEDA 2MQOA 3IS9A 4NPOA 3N4WA 5GAGU 4L72B 1WHWA 2E1RA 4DUZJ 4J9KA 5LMNJ 3MEDA 4QJVA 4Y6IA 3DOLA 2XZTB 3IGNA 3G82B 1H7XA 4DR1J 5U47A 4WCEQ 1YQHA 1NSPA 4K0KJ 3DRSB 2BXJA 3EDRB 3KLHA 1SUQB 1S1VA 2KG1A 4F0MA 2KT5A 4I0WA 1FKAF 2VKZG 3LTOA 2XY7A 2GCFA 4PPZA 2W1BA 3KJVB 3AFGA 3UCZP 1UVMA 2E5GA 2LDYA 4AQYJ 2HBRB 3PRDA 5KFJA 3BGRB 3KLEB 2Y8WA 3VR1A 3MM5B 4X4TA 2DD8S 3B4DA 4LQ3A 5IT0A 1VQMS 1KFSA 3CE8A 1UVIA 3MPUB 1KS2A 4F0HA 2E66A 1RE1B 3OTDA 4C48A 3BJYA 2Y1LB 1VRUA 2LFVA 3CCRS 2ZDOA 1U48A 1S6UA 3V81B 2C22A 2MPUA 2DGVA 3TWZA 1WUUA 4O3QA 3A8KA 2G0CA 1B7YB 2YBVA 3FSYA 4QZVB 4KIAA 4USMA 1T03A 4AL5A 1X4CA 2JLGA 4CCHA 2W7AA 1WORA 3E01B 4NOHA 5J2MA 1JNZB 1HD0A 1U26A 1GEHA 2GNKA 3TAQA 4Y2AA 2JEFA 1IUJA 1ZAXA 2NXEA 1Y9OA 1FK9A 4MJKA 4FF4A 5C42B 2UUAF 2FVQA 2CPJA 2NQPA 1RAHB 3R3TA 2E7XA 3A8JA 2A1BA 3M8WA 5AXKA 2VV5A 1QD1A 3A3OB 2GO9A 1HWUA 3KKFA 3HM9A 4N8NA 1FA0A 1PAUB 3NOGA 1SCJB 3AY0A 4OFZA 3CULA 2CZVC 2O1PA 1M5HA 2LQ8A 4USWA 3HT0A 2OFGX 4USIA 3HCXA 1XMOJ 4NLXA 2K3KA 2HS3A 2ZH4A 4ECUA 1T9YA 2NLWA 1CPZA 2Q6CA 4K7QA 3PW5A 1UEVA 2AYGA 2CPFA 3KOAA 2BJ9A 2VJUA 2V68A 5K8OA 2FIUA 4JI3F 3KXDA 2WSEC 3PYGA 3QZ7A 2BKOA 4PYDA 5CH7B 2KB2A 3DOKB 1RTHB 2CQHA 1F3VA 2KFYA 2MQQA 2HHVA 3WBZA 4O3PA 3CSKA 3M2VB 2HNZA 1EQMA 2MLXA 3ZTOA 2VFTA 2R7XA 1P6TA 5K20B 4C97A 4USHA 3E51A 3KMQA 2ERRA 1N0UA 3QT6A 5LT5A 4HKQA 3M6XA 3B82A 1JLEA 3H2VE 4TYBA 4ZPAA 3DI6B 3IA0A 2B4PA 1G3OA 1GX6A 5KFVA 4DV5F 3NG8A 3RBDA 5I42A 4OV1A 5HP1A 3QAEA 2IVYA 1NK7A 3OHAA 3OW2R 2FDNA 3HHNB 1L3UA 2YQ0A 2BOPA 1T02A 1CJVB 4F04B 3KJNB 4NLRA 4DR4F 4ZPCA 1SJ1A 1J5EJ 2O01C 4N8OA 2DGTA 1IJFB 1F5AA 4DR5J 1S1UA 2R8GA 4CRJA 1TL3A 2WOMA 1RBOB 3OV7A 1CULB 2C2ZB 4HL9A 3W1YC 3R7SB 3W5XA 2IBOA 4F3MA 4PWDA 4NCGB 4OZ5A 5DM7Q 3WQPA 5AXLA 3QRQA 1NDPA 1BE4A 2W4CA 1WOPA 4OI3A 3MM9B 5IT9U 4DFKA 1FTCA 2QRRA 2QA4S 3ULHA 4XIUA 2JVRA 3ZZZA 1TKXB 4MFBA 2KM8B 1VJQA 4ZCKA 1GQEA 4JI8F 4GKKF 2O66A 2KJWA 1XWLA 2PD1A 1KKHA 2WBMA 1PYTA 3BH6B 5F3ZA 4H54A 4X64J 4JB8B 4QWAA 1RADB 1QE1B 2QX0A 2XMTA 4P7TA 2VG5A 1K9MT 3MUTP 1YJVA 4ED1A 4MIBA 2PFFB 4LIRA 1IKVB 3HDSA 3HMJG 2OPQB 1EP4A 2BKPA 5L38A 1VQ6S 3M9OB 1GMWA 1B7FA 2FHMA 3QFWA 3BGUA 2KXHA 1EJ7L 2G1DA 3DXSX 2YWHA 2YNIA 5LOQA 1LQ9A 4KHMA 2UUCF 1UAWA 5FIIA 3I0RA 1U8SA 2Z30B 2CNKB 1V6HA 2DYAA 1PJ6A 4LF4F 2WVCA 2CJYB 3CPWR 4LIWA 2VQEJ 2YQ3A 3W8GA 2HQGA 4ZVTB 3QGHA 3JSRA 1HQUB 4NX9A 2AGQA 4EZ9A 2YPZA 3HFKA 1AB8A 3IXQA 3OT9A 2HWTA 3MR7A 4OZ3A 3ZTPA 4I2PB 3M2RB 4YQWA 1Y3JA 1UFLA 2HAFA 1D9DA 2E1PA 4J9SA 4PG4A 3MXHP 2I9SA 2NSCA 2NYIA 1U1KA 4ECQA 3DU5A 4B9NA 2J0XA 6FDRA 4KQZA 1BQMA 5D4NA 1ZETA 3LUYA 1VQSA 1YJTA 5H9EJ 4QU7A 5HVGA 4LF7F 1U2CA 3HX9A 1FNXH 1LWCB 1RDRA 2I8EA 3M6VA 1JX4A 4E2FB 4PQUB 1XMBA 2KN4A 3KUHA 2OFHX 2YNHB 2P9EA 1FHTA 3CJQA 2FC8A 4FBTA 3N6NA 3CTRA 4F26A 1R0AB 3GV5B 4MYTA 3K7RA 2NYHA 3RB6A 2MKCA 5ETLA 9ATCB 3CJ4A 2NXCA 2DH7A 2CQ1A 2GVZA 2J0QD 1FE4A 4HYKA 1FRIA 1WI6A 3L9ZA 4DLEA 3MPDA 4DX8H 2EW9A 1T94A 1RWMB 2QGFB 3OVSA 4KGKA 1KBRA 4QOTA 3KLVA 2RD5C 4KFBB 3L7PA 4BS2A 4BC7A 1IBCB 1VRQC 4XAKA 3DMJA 3M7VA 2DR6A 2V2VA 2FLPA 3NGTA 4RW4A 4NXNF 1CEZA 4N76A 5A6WA 3TAMB 3P4UB 2IPOB 2ZH3A 2ASJA 3DLKA 2ZUAA 2XMAA 4JI2J 3QWUA 4RNOA 4CTAB 1RWVB 3CMES 4O3RA 2CQDA 4JI1J 3NS6A 4UW2A 3RBEA 1TMJA 2VOOA 1FWLA 1XC9A 3VZHA 1TL1A 4EK2A 1TKZA 3MTJA 2ZH2A 3KHGA 4FVCA 2FPHX 3OD2A 4X4VA 1VIOA 1VQ8S 2E1CA 3CB4A 4N7TA 3ETOA 2DITA 3R7NB 3MMCA 1MG7A 5KFRA 2V8HA 2L9NA 2OPRB 4ECZA 4WKYA 2QLJB 4Q0BA 1HW8A 4IFVB 4O4GA 3PIOQ 3G86A 2DNNA 3V6DA 1IM4A 2VASA 4UOHA 3T1HF 4UQTA 3HHLD 4A8SA 2BJ8A 1Y7PA 2VBWA 3UNYA 4ED7A 3CJ5A 3CWJA 5KFDA 2WRMA 1GXLA 4CO0A 3KHHA 1UJ5A 3UN3A 2MKIA 1F3FA 4RW6A 4ZK7M 2UUAJ 2MJNA 3A13A 1C0UA 3FFIA 4OYZA 2R2RA 2HMIA 1KQFB 5ETSA 3V4MA 1NJZA 5HVHA 3Q83A 4QWDA 2ZE2A 3CJ2A 2SXLA 1S1WA 5AXNA 4RW7A 1YHQS 2OEMA 3GP9A 3FRYA 3DXBA 1UVNA 1S59A 2O3DA 5THWA 3BB5A 5D4LA 4Q44A 4P2FA 2MKSA 5F3TA 2ZJQQ 1D9FA 1QY7A 2XMJA 2JFDA 2OHDA 1T3NA 4RBVA 3VQSA 3SV4A 3JSMA 3KLGB 1UEKA 3GR0A 2XTJP 3Q8QB 5J2QA 1S79A 2IM2A 1CJTB 5KTQA 4OI0A 4P2MA 4C7QA 2HIYA 2YXLA 1IBMF 1RTDB 3LF0A 4G1QB 3C8YA 4DR2F 3QT5A 2R7RA 3B78A 1JJCB 2KYZA 3PJWA 2BW7A 1U45A 4K4SA 2VFUA 1NKEA 2CYYA 4MKAA 1R8BA 4YY3J 1VBYA 1OY6A 3BKTA 1VRTA 3VZIA 3QFHA 3T9NA 2N3OA 5EWFA 2BANA 4JI5J 2BRLA 3GCWP 3KDOA 4ZVHA 3SBMA 4PABA 3VGVA 3I4PA 2RDJA 2QL5B 3PR4A 5L8RC 2Q79A 3M2UB 3CO9A 3BPSP 1N5VA 5D0GA 3JYTA 2ZD1B 2GVDB 3KG4A 3HVTA 2VONA 1YGYA 4YMEA 4K4ZA 2W2PP 3DYAB 1JLFA 3M05A 3LWLA 4USJC 5DDOC 2EBEA 5IZHA 3UW1A 1U6FA 5KFAA 5D15A 2AP6A 1TK0A 2B43A 4N47A 2B4VA 4IO1A 5F0WA 1HQEB 4E0DA 4H4MA 2JNJA 1EKSA 1KOOA 1RT2B 3Q8RB 3L95X 2I0XA 1DHMA 2IC3B 3HKWA 1UA1A 1ZZFA 3SIPB 3IWXA 3J7A1 1SJ4P 2W9CB 1U1QA 2DEIA 5HJYA 3PHEA 2JVOA 3PW7A 3Q0AA 4LFCJ 2GAGC 4M5JA 4GKKJ 3D1OA 2OUGA 1URNA 1C0TA 3K2YA 4QWEA 3M8SA 3VF0B 2LVWA 2DNLA 4U9RA 1S7IA 1TUVA 3W9JA 1F6TA 4CLLA 1SC1B 2PEHA 2DB1A 5C2GA 4L6V3 2OPSA 4CLSA 3EM1A 2BJDA 3OL9A 3RRHA 1TVRB 1SJQA 4ZVRB 4NRTA 1BXNA 1E6YB 5K8PA 3X1LB 2UUCJ 3HSDA 5CYQA 2VICA 2L3MA 2BE7D 2HHUA 1K73T 1REVB 3JAMU 4MMOA 3F73A 4C98A 1JLQA 4LF4J 3R1HA 2Q1LA 5M2PA 2BJEA 5SZTA 1U1PA 2KO1A 5KFBA 1DURA 1DY3A 4M94A 4CO3A 4K4VA 2M0GB 4RJVA 1WEYA 5C7PA 4RBTA 1FJCA 2GV1A 2HGNA 2AEJA 2XNRA 2NXUA 1G4CA 4OZJA 1VQ9S 1RHQB 2DRAA 2QLXA 4I64A 5BXIA 2ADCA 3H0PA 4X4NA 1HPZA 3LOUA 4P73A 2KFZA 4D3HA 3AB4B 3OTOF 5T7LA 1S72S 2BMBA 2W2QP 5T41A 5C25B 4EUVA 1SH2A 2W7OA 3C46A 3HHKA 3D7SB 1XR7A 3FQLA 3D9BA 1QVFR 1MU2A 1QAYA 2F4VF 2CJKA 1RAOA 4DR7J 2HBZB 2Y1RI 3DM2A 2OLWA 5BYSA 4V19X 2K7KA 4FS2A 3KK2B 5CAAA 2RB7A 3N01A 1Z2ZA 4I2QA 1RYRA 1U49A 2HZVA 1NK8A 3MHYA 4TY8B 1QUVA 5EUHA 2X1AA 1PILA 3F41A 2YKNB 1WTFA 3S8SA 4YHHJ 1ZM9A 4V19J 2G9OA 4HHJA 3BKUA 1DARA 4PUOA 2V4RA 1WF1A 2UVVA 4DQIA 2UXCF 2ZITA 4CO2A 2CQPA 2G13A 1HLWA 1SIWB 3K59A 1FNOA 4DX7A 2NUUG 4ZCMA 3CCUS 1HNVB 3DNCA 1QAXA 1Q86T 2GMHA 2DR5A 4IRKA 4F0KA 1F2GA 4DBQA 4ZOSA 1T7PA 1N33J 3OR1A 3DRPB 4RW9A 5DDPC 2BX6A 5HVFA 5E3QA 2GIFA 3CD6S 4OHXA 2FHKA 1ZM2A 1IVZA 4TU9A 2AZ1A 3MUMP 4UY85 5A8KB 3SFUA 1RT4B 1N5SA 1VHIA 3RBXA 1XMQF 1ZM3A 3QT8A 3R97A 2PIIA 1NUEA 2YKMA 3FVYA 5IM0B 3H5XA 3R2DJ 1YRXA 2F65A 1JB0C 3PZPA 4CLTA 2IHR1 3WZ0A 3HI9A 4IG3B 3FZBA 3PKYA 1F9EB 3BQ2A 3MM8A 1TUGB 5KOXA 1Y3KA 3BH7B 1FEEA 1IKWA 4M5DB 2XLIA 8RUCA 2YNGB 4YS2A 1TTHB 5KFQA 2VFSA 3GJQB 3BN4A 3PDNA 4MIWA 3LAMA 1TL7A 2FJXA 5J2PB 2DY9A 1PBUA 2G2OA 4HR2A 2CZ9A 2C3MA 2R42A 9RUBA 3D0IE 4WFAQ 1Y5IB 2V8GA 1UZHA 1YK9A 3IS9B 5I3UB 4CLFA 3FMBA 2M4MA 1VFJA 1X4GA 1TV6A 1VQYA 3BS9A 1HBMA 5JJBA 4LF5F 4PEOA 2J9EA 3DOLB 3NKYA 1HIYA 1TUWA 3GYNA 3PNIA 3ETMA 3PVXA 4OHWA 2KVQE 2XO6A 3I56S 5LMUF 4B9MA 2Z2MA 1RZMA 1DLOA 2DHSA 1IN0A 4DL2A 1YJNS 1S1VB 3LP2A 1WC0A 5IT4A 4USVA 2M70A 3UE2A 1IXKA 4NMLA 4ZJQA 3MEKA 4LFAJ 5H9FK 3VGUA 1HYSA 1UVKA 1NKBA 3POTA 1R0CB 1CVJA 1C2PA 4ILMA 3AJ2A 3TUPA 3W2VA 3MWBA 4O3OA 1FJ7A 3M1VA 1Y5NB 2KU7A 2ZEJA 2Y0SD 2RQ4A 2BYCA 4B3RF 4ZP7A 2YX7A 1WOOA 3VAJA 2HHHJ 1S1TA 2E5IA 3HVRA 1MMLA 4EBCA 3V6JA 4KV8A 2M2BA 2CDRB 1T03B 4HVZA 4JYAF 2QA2A 2W4DA 4ZS6A 2R9LA 4M1KA 2GHWA 3FMWA 5J2MB 3K57A 5IQQA 1VISA 2HAIA 3U27A 2C2RA 3F44A 1NCLA 3C6TA 2GW8A 2UUWA 5ETQA 1WC1A 1FK9B 4HT7A 5ETMA 4X66F 3M8YA 1FRLA 3IP0A 4J37A 5GADI 3EUNA 3N79A 2CNOB 2M7SA 4KYZA 1JXLA 4I68A 4RUAA 2B6AB 2W2MP 2ZHBA 3PYFA 2B5JA 3HD2A 3CCLS 2JEGA 1FDBA 3EICA 3NWRA 1FKOA 2YNFB 3DRYA 2HGMA 2RVJA 3C6UB 3IC1A 3EMTA 3ZZ0A 2OGUA 3UCUP 1FRJA 2NPFA 2OJ3A 2VDHA 3CD0A 3I87A 2LEBA 2ROPA 4IOCQ 4ZVGA 3GE9A 3G4SS 2YWWA 2XI3A 4FP9A 4O3NA 2CUYA 4ANEA 1HARA 1JLBA 2VFVA 1HWLA 3GJSB 1HNZJ 3OVAA 3W60A 4CT9A 5LXYA 3B54A 4X2BA 2IDEA 2H54B 1VQKS 3QPIA 2HNZB 1H38A 3V4IA 4F4WA 4BC9A 1M1KT 1RQ0A 1X5PA 3K5MA 1D1UA 1TP7A 4CLZA 1NPRA 2H1YA 1S1XB 2QL7B 1HI0P 3TJ8A 1JLEB 2HHPA 1W2BR 3J7Z5 3TEHB
chains in the Genus database with same CATH topology
3AAWB 5J2PA 3U02A 1XNRF 4GC7A 1Q16B 2BE2A 4DL5A 3SQGB 4JV2A 3EGWB 1Q7YT 5HROA 2YWEA 2ZNYA 2ZVSA 1S4FA 4J9QA 2JHEA 2JSXA 3Q2TC 3N6LA 1RT7B 5I42B 3TVKA 1ZTWA 3MOJB 2JWNA 3QMQA 4YOEA 4ES3A 5HP1B 2B56A 1S6OA 2CJQA 3ISZA 4DQSA 4DR7F 3G6VA 4TLRA 4Q2MA 4JI4F 2AQ4A 2J7KA 3CEDA 2MQOA 4G3IA 3IS9A 4M95A 2R7UA 4NPOA 3N4WA 2ZJPQ 1BWEA 1FCAA 5GAGU 4L72B 4CO5A 5M2UA 4I56A 2VA3A 2V94A 1WHWA 2E1RA 2YVSA 3BO4A 5KFMA 3FEZA 1P1TA 3Q23A 1FT8A 1HWJA 3TQ1A 2LEAA 4J9KA 4RWXA 4C0OC 2DTJA 1N88A 4MYUA 3OFHA 3MEDA 1TFWA 3KLGA 1J2VA 1N6QA 2PT0A 4QJVA 4Y6IA 3M30B 3DOLA 2HZCA 2VG6A 3HXMA 1LW0A 2P6SA 4K5RA 3IGNA 1H7XA 2V2KA 2EK6A 5U47A 4WCEQ 2LA4A 1S1UB 1E6VB 1YQHA 1TL3B 1VQNS 2JC1A 3O6QA 1VC5A 2DNGA 3DRSB 4N77A 2BXJA 3KK1A 2WOMB 3KLHA 1HBNA 2EPIA 2BW2A 1S9FA 1LXNA 4YHHF 4PQAA 1SUQB 1AROP 2MHNA 5KOWA 4OX6A 2A2DA 1S1VA 4I6WA 1RTDA 2KG1A 2N4CA 2KT5A 4I0WA 4G1QA 4K2XA 3FSXA 1HA1A 1VRTB 1FKAF 1TL4A 2VKZG 2FHJD 3OQ2A 2XY7A 4DFMA 2GCFA 4PPZA 3FCHA 4W92B 2E9TA 1X4EA 1X9SA 2K3IA 4PWDB 3SDEA 2XY6A 2MYFA 2BANB 3KJVB 1PSDA 1RJJA 2CQBA 3IR5B 4DR3F 4G6VB 3MCSA 4U7CA 3UCZP 1WHYA 1Z1ZA 4ECYA 2XLJA 4Q45A 4ELTA 1UVMA 1X5TA 2E5GA 3ZZYA 4C0BA 4L3NA 1DZ5A 3HO1A 2LDYA 3M9NB 3TANA 1KC8T 3RTVA 4KO0B 4IRDA 3TAPA 3PRDA 1FESA 1W2IA 5KFJA 3BGRB 5D4PA 3KLEB 3BSNA 3DLGA 2FLOA 3VR1A 1VQ4S 1HL6A 3MM5B 4A8KA 4QPTA 4X4TA 2DJWA 4ED6A 2DD8S 2QZ8A 1H2TZ 3B4DA 3IRXB 4R25A 1NK7A 4LQ3A 1WHXA 4ICLB 5IT0A 1VQMS 5KT6A 2CVIA 3M8PA 3TRGA 2LLZA 2IAJB 3CE8A 1SKRA 1L3SA 1KFSA 2NS1B 1UVIA 4RUHA 2IM3A 1N33F 1KS2A 3OL7A 2E66A 3OLAA 3OTDA 3J81Y 3BJYA 2HHTA 1VRUA 3MR6A 3HK2A 1HNIA 2RKIB 1XERA 4C0HA 4GC6A 3SFGA 2ZZNA 5HI7A 3CCRS 1U6ZA 2ZDOA 2MKHA 1U48A 5IS2A 4K4YA 4QIGA 5CA5A 3M2UA 1S6UA 3MFIA 3BN7A 4NLQA 3V81B 1JLFB 2MPUA 4AXIA 2C22A 2DGVA 1NH7A 2ZD1A 1NJIT 2FY1A 1SKWA 2DPJA 2XY5A 2VFRA 2KM8C 4O3QA 1RA7A 4MK8A 3CUNA 3OPKA 5GAHU 1S9GB 2G0CA 2XSJB 2VG5B 5F8HA 4RKUC 4LVNP 5IXUA 3FSYA 3TOQA 3DYAA 1JKHB 4QZVB 1X5SA 4H4OA 3T5LA 4KIAA 4KR0B 2LKZA 5G4DA 4O4RA 4DV0F 4WKRA 1T03A 4AL5A 3VALA 1X4CA 1I1GA 5E41A 2JLGA 4C8ZA 4ILRA 4CCHA 4F2SA 3VAGA 2RQCA 2C2EA 3CT9A 4H4MB 1ZZNA 2W7AA 4F3OA 3MGJA 3TO8A 1RTJA 3E01B 1NK9A 2W9BA 1H3DA 2OMLA 4A8FA 4I4BA 5J1EA 1B0TA 1Q53A 4NOHA 5J2MA 4WFNQ 1JNZB 3RZAA 3OTBA 4WK3A 2ABYA 1HD0A 1U26A 1HQEA 3T1AA 3EXCX 4U7UK 1PC4A 4WZMA 2WSCC 3F56A 4X4QA 1OQ3A 2GNKA 2O5DA 5CYMA 3TAQA 5CQGA 4FF2A 3SMZA 2LYVA 1U1NA 2P9GA 4Y2AA 2JEFA 1IUJA 1M0SA 2Z8QA 1ZAXA 1WTBA 5DDRC 1ZBTA 3M32A 4WFZA 1SQEA 1JNRB 4FF4A 1Y9OA 1FK9A 4MJKA 5DDQC 5KG4A 2NR0A 5C42B 2UUAF 4WFXA 2FVQA 2CPJA 2NQPA 2OO4A 1SXLA 3I0RB 5KAKA 3R3TA 1KTQA 2J0SD 1RGVA 3H98A 4B3SF 4CH7A 4R5PB 3NMAA 2E7XA 1H7WA 1G7CB 2A1BA 2IRUA 5AXKA 2VV5A 2QV6A 2UXDF 1VOMA 3RW7A 2GO9A 4A8XA 4YP3A 3BM7A 5B0CA 2DGUA 1UVLA 1HWUA 5D3GA 3KKFA 3P96A 4XDCA 3MM6A 3HM9A 1U25A 2MZJA 4X4RA 4N8NA 1LW2A 5D78A 5KG6A 1FA0A 3RAMA 2JFKA 2EK1A 4ITSA 3B8HA 4DV7F 2DCUB 2HVZA 3H5UA 3AY0A 4ZPVR 2AGOA 4WZQA 5HBMA 2DNHA 3KLIB 4ID5A 2ROGA 4OFZA 2CZVC 2FJAB 2ILYA 3CULA 2O1PA 2L9WA 3M8QA 1DBDA 5L1IA 1M5HA 1RT5A 5KT3A 2X3GA 1SJRA 4IRCA 2OFGX 3SXLA 4USIA 3N28A 5F8IA 2QA4G 3I6PA 1U1RA 1N5YA 1EETB 4NLXA 2K3KA 2X1GA 3FJ2A 2HS3A 3G8QA 4I69A 3G8TA 5BYQA 4JV0A 2ZH4A 1C4CA 1WD6A 4ECUA 2VQFF 1XBWA 1XK8A 1QSSA 1GXUA 2NLWA 1KHVA 4IDKB 5H1SV 3KTQA 3H5SA 1FKPB 1CPZA 4DV3F 4X4SA 4ZPTR 3KHRA 2Q6CA 3I96A 2IJNA 5E7OB 5KFWA 5GAEU 1RAJA 2OPSB 4AE5A 1NJYA 3OSNA 2M5YA 3LP1A 4NA3A 2N3LA 1FO1A 3PW5A 3O8WA 1UEVA 4JV1A 1DQ9A 4DQPA 1S10A 3X3UA 5AE3A 4TQSA 1F60B 2AYGA 2BABA 2CPFA 3MECA 1NK4A 1OS5A 3KOAA 2KTQA 5KFGA 3SSQA 1VHFA 1U6BA 3GG0A 3NL0A 4TYAA 4J9MA 2ADBA 5K8OA 1A9NB 3IG1B 3JTOA 3W2WA 4FVMA 2FIUA 3OVBA 3DFEA 1BQNB 3J7ZT 2B9WA 2PE8A 3CDEA 4JI3F 2D3ZA 1FXDA 2WSEC 2XZWA 4A8OA 2OAUA 1TQLA 1U1MA 3BQ1A 3LO3A 3ZZPA 1LWEB 3QZ7A 3OXFA 1RP5A 2DK2A 5C24B 4KKOB 3VAMA 5CH7B 3N5FA 4IQXA 2KB2A 3TUIC 3DOKB 1RTHB 2CQHA 1QAIA 2CQIA 1VS3A 2KRRA 1JLQB 4NLVA 1HMVA 5LXRA 4X4OA 2KFYA 2MQQA 1E6YA 2LXUA 3WBZA 2HHVA 1GH8A 1NK5A 5CD4H 4O3PA 4MK7A 3CSKA 2KH9A 1T05B 3M2VB 1WF2A 3QIPB 5KFZA 2DBBA 2HNZA 4LFAF 3I4HX 3I0SB 3GILA 1Q4RA 2A3JA 2HVIA 2VFTA 2R7XA 2V4JA 1LWFB 3G6YA 3CJ0A 1P6TA 1H98A 4C97A 4USHA 3E51A 3KMQA 1WI8A 3UR3C 4TU7A 5CCLA 2ERRA 1N0UA 3TA0A 3HHLB 4O44A 3NAHA 2COLA 3LH2S 5LT5A 4HKQA 3M6XA 3QGGA 2M3DA 4OX9F 3B82A 2EBGA 3GFXA 1JLEA 2J8AA 4ZHRA 3H2VE 4TYBA 2HRYA 4ZPAA 4NLTA 5DM6Q 4RNMA 3VTIA 3DHXA 3GIJA 3O44A 3UNGC 5EDWA 3DI6B 5D77A 2M8DB 3IA0A 2B4PA 1G3OA 1GX6A 2EFVA 2DR7A 4WTYA 4LSNB 3SQGA 5KFVA 3DCAA 1NJXA 3M9MB 4DV5F 1JWWA 3NG8A 4LSNA 3RBDA 1X8DA 1TZ0A 1RT7A 2GIQA 4OV1A 5I42A 2ZH8A 2ZUGA 3MMJA 3OBIA 1X5OA 4LVOP 5HP1A 3GG1A 1S49A 3QAEA 1HPZB 5L1KA 3DLEA 2HHHF 5EN1A 2OH2A 4WU2A 1I6JA 2IBKA 3SZ2A 3MEGA 2V4QA 4AUKA 2C3YA 4ECVA 4EWTA 2IVYA 1NO8A 3OR2B 3OHA