1URRA

A novel drosophila melanogaster acylphosphatase (acpdro2)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
VAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG18505 PROTEIN
publication title Three-Dimensional Structural Characterization of a Novel Drosophila Melanogaster Acylphosphatase
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 20
structure length 97
sequence length 97
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1urrA00
2FTRA 4FNHA 2PD1A 3LGNA 2KYZA 3HFKA 3BB5A 1OQ3A 3BDEA 2RSQA 4DN9A 5T7LA 4Q2MA 1KVIA 2OAUA 1K0VA 3KNGA 4NL5A 4ZOSA 5B0AA 1N5SA 1LQ9A 4Y2MA 4A47A 5F0UA 2K7KA 2GCFA 5B0GA 1YRXA 3TRGA 1Y9OA 3HHLB 1APSA 2CRLA 2L3MA 1XBWA 1OPZA 3KG1A 2ROGA 3UDCA 4HL9A 2KT2A 2EW9A 3DXSX 2BJEA 3HDSA 4FNIA 2ZDPA 2XMMA 1TL4A 3WDOA 2K1RB 1GXUA 1N5VA 2FIUA 4YDXA 2GFFA 1R6YA 1QUPA 1IUJA 1Q53A 2IFXA 3BM7A 5B0DA 5KAKA 2GA7A 4F67A 1FEEA 1TZ0A 2FB0A 1CPZA 1SI9A 2IYGA 1Y3JA 3BR8A 1SQEA 1URRA 2OFGX 3BGUA 2G9OA 2ACYA 2QIFA 3HHLD 1JK9B 4U9RA 1Q4RA 1YJVA 2HFOA 2HIQA 3BN7A 2GGPB 1MWYA 4A48A 1FD8A 2XMUA 1S6OA 3HX9A 2IYIA 3DCAA 5B0FA 3K7RA 2GO8A 3F44A 2AP6A 2KT3A 1RJJA 1X0PA 3TOQA 5IXUA 3MCSA 4OJHA 5T7LB 2W4DA 2QLXA 3KG0A 1TUVA 2QYCA 2OMOA 3FMBA 1X8DA 2JDJA 4OJ1A 2N7YA 4OJ3A 1N5TA 1Q8BA 1YG0A 4ZA1A 2W4PA 1YJTA 2GV1A 2HLUA 2OKQA 1FVQA 1VQSA 1X7VA 1FE4A 4A46A 1FVSA 3IWLA 2LQ9A 3QGPA 4Y2IA 2RU9A 4YEAA 5B0BA 2OP5A 1MWZA 3IWXA 2ROEA 3HHLC 4HH0A 1FE0A 3E8OA 3CJKA 4DL0C 1TR0A 2RMLA 2ROPA 2AJ1A 2BUNA 2BYCA 2HLTA 2HQIA 3MZIA 3I9ZA 4EFAC 2HFNA 1P6TA 1OSDA 1GXTA 2RILA 1CC8A 1Q8LA 1Y3KA 3LGMA 2AJ0A 4HI2A 1FESA 1KQKA 1W2IA 4OIXA 2QLWA 1YJUA 2KKHA 4QOTA 1AFJA 1ULRA 2XMVA 1OQ6A 5B09A 2BJDA 3GZ7A 4Q2LA 1KVJA 2N4CA 2ASYA 1SB6A 3LO3A 4Y2KA 2W4CA 3BF4A 5F0WA 1JWWA 2LDIA 2FHMA 2VV5A 3HHLA 2OFHX 2ZDOA 4OJGA 3TNVA 3FGVA 4HH1A 2PGCA 1Y0HA 1V3ZA 3T9NA 5B0CA 2K1RA 3VTIA 1AW0A 1AFIA 2AW0A 2LXFA 1P8GA 1U7LA 2XMWA 5B0EA 1S6UA 1N5QA 2Q3PA 1CC7A 2LQBA 2K2PA 2VH7A 2XMJA 5A6PA 2K7JA 1YJRA 4A4JA 4DPOA 3HF5A 2XMTA 2XMKA 3CJKB 5K9FA 1WD6A 1VQYA 3KKFA 4HI1A 3QMQA 2BBEA 3FRYA 1TL5A 2OD6A 2N4DA 4NPOA 2OD4A 5B08A 2GGPA 5A6WA
chains in the Genus database with same CATH superfamily
1FK9A 2VG7B 2XS2A 3F41A 3CJ3A 3UR0A 1EJ7L 3AB2B 4OI2A 1PYSB 4C98A 3ZZZA 4K5SA 1IR2A 3TRGA 3J7YI 3HSJA 3JTOA 1C0UA 2C3PA 2MKSA 1ZH5A 2IFXA 3RGIA 1GXLA 5KFKA 2I5JA 2CVIA 9ATCB 4YB6A 3BN7A 2Z2MA 4TN2A 1GTEA 3MPUB 4TVAB 4PWDA 1D3WA 3KUHA 1MMLA 2R7XA 3CCMS 2HLUA 2VPYB 4L6V3 4X65F 3PX4A 3UN3A 3OLBA 4IO9Q 3HHDA 4DFKA 2RVJA 4NLSA 3WX8A 3IBWA 2NZ4A 3KK3B 4XPEA 4U7UD 2N4CA 1PIEA 4QWDA 1YI2S 4IKAA 2I1RA 4B3OB 3V4IB 2AGOA 1RISA 1D1UA 1HYSB 3E01B 4DG1A 2KU7A 3SSSA 2FVQA 3RAQA 3GFYA 3DDKA 2LEPA 1ZETA 1X4HA 4P71A 1N36F 4NWBA 5AE2A 2BMBA 4OL8A 3RBDA 4K4SA 1M5SA 4DR7F 1SJ3P 2OI2A 1RT1A 1XWLA 3LA0A 4O3PA 1RB0A 1YJ9S 1H72C 3NLCA 4C8OA 5THWA 5C24A 2FVRA 4ED6A 3GB0A 1ZZFA 3Q0AA 4ZLNA 3V6DA 1S9EA 3C14A 3TZYA 5CYQB 1N4LA 5CAAA 1VGYA 3R7NB 5F3TA 4U95A 3GV7B 3ENQA 4HR2A 4OLOA 5LL6d 4HEA9 1EX8A 2KDOA 1AA1B 2C3UA 4ZCIA 2NPFA 5ETPA 5JJBA 2MJNA 5MLCV 2R8IA 2D41A 4CRJA 2ASYA 2F7VA 2MZRA 3LO3A 3BF4A 3KK1B 2IA0A 2MHEA 3W3SA 3BQ1A 2VU5A 1NB2A 3FSYA 3AB4B 2DR9A 4KHRA 2V8PA 5A6PA 3CVKA 1E6VB 4LT6A 5IT9Y 5HATA 4UOGA 1H0HB 3BDEA 3MPYA 1XK8A 4EBDA 2D3OR 2W8KA 1NK5A 1G7CB 5DG9A 3I5BA 4KH0B 3UW1A 4YOEA 4YB7A 2DHXA 3RB3A 4NZ7A 5HBMA 3JS9A 5J2PA 3TO8A 2Y1IA 2IHR1 3NKYA 4ILRA 3WBZA 1WG4A 2AX1A 4LBHA 1HPZB 1TP7A 3ITHA 1NSPA 1RAFB 5DDOC 5T7LB 3MF5A 1X9SA 1FKOA 1RT3B 4UF4A 2FQQB 1YGYA 3AOAA 1JXVA 4CLYA 5L1LA 5EX3A 3PYDA 2HQDA 1DBDA 3GU0A 2DK2A 4RBUA 4DV4J 4LR8A 4YB5A 4IUFA 4RZRA 1S1XA 2XZTB 3DM2B 2XM3A 4DS4A 3VQTA 6AT1B 1UCNA 2R42A 1N5QA 3OUYB 4M5HA 3NEKA 2XMKA 3CJKB 1NK0A 2DD8S 3MXHP 1VRUB 1OQ3A 3DRPA 2I6WA 3IGVA 1PGZA 2V9KA 5D3GB 1KS2A 4F3MA 5F0UA 2HVIA 4B3MF 1NRKA 3AODA 3H5UA 1E6YA 3K2YA 4CYUA 2JEGA 4K8RA 2GAGC 4XO0A 3N5FA 3BGUA 3KDNA 1NLKL 3W8PA 4QQBA 3PW5A 4CO1A 2L9NA 3PIOQ 4KRWA 1C1BA 1XTZA 1JLCB 3M6WA 2IVFB 3TOQA 4B9VA 6FDRA 4DS5A 3FC9A 2XI2A 2ZJQQ 2YNGA 2M5YA 4AYBD 2Z2YB 3DRRA 3VAHA 4I2QA 3HXMA 5DZ7A 2OPQA 3IN5A 2IBKA 1ZBTA 3BJYA 1S4EA 5KT5A 4C4WA 3QATA 1PG5B 3KG4A 3C16A 5T14A 1KQKA 5IM0A 4OIXA 5I42A 4OYOA 3UDVA 5H9EK 5HLFA 1SB6A 5GADU 3TQEA 2FHMA 4PG8A 4AE5A 2LP4A 2Z8QA 4CWBA 3KOAA 2JLGA 5DQHA 4QWBA 4J37A 2JSXA 2A6OA 2W9AA 4ECQA 1U1MA 3FRYA 2KFZA 2ZEJA 3SCJE 2XTJP 3ELHA 3B8HA 1PSDA 1VBXA 4ZPCA 4OHYA 3CO0P 4NLGA 1NK9A 3DU5A 3TX8A 2VA3A 4TNOA 4LSLB 2J9DE 1L5UA 3O3LA 3M8PA 3CJ0A 3G8TA 5KFVA 2WBRA 2OJ3A 4J5OA 4RWWA 2OPPA 5IWAF 2HRUA 3MCOA 2BEFA 4WKYA 4GKJJ 5IC4B 1HBNA 3SDEA 2DNKA 2EK6A 2HK2A 2N3OA 4ANCA 1UEKA 3OFHA 4K50A 4WK1A 1X4GA 2JX2A 5KFQA 5J1EB 4DL3A 2F8HA 2DPIA 1CC8A 4ZVHA 1Q81T 1FKAF 2GVZB 1RTIB 2GZOA 1ICEB 2ZBQA 1FFGB 3ENWA 4LF5F 1VI7A 3KLFB 3NXZA 2ZBCA 4AUKA 2RB7A 1NPRA 3ZTOA 3G71S 1A9NB 3MMCB 5C42A 1GH8A 2HNYB 4DPXA 1DZ5A 4IDKB 4AFFA 3CDBA 3J80Y 3QFWA 4TU7A 3M8QB 3C6UB 2MLYA 4JI3F 2YX4A 1JKHB 1H73A 3IRWP 1U0HB 2GCFA 2MDAA 2HRTA 2VG5A 2VL1A 3BKTA 3T1HF 1F6TA 2ACYA 4A8KA 2AV5A 3MCMA 1OY8A 3K7RA 3TUJC 1TKTB 1U6BA 1PAUB 2VQEJ 1DQAA 2BJ9A 3QT8A 5DG8A 5DM7Q 2BQ3A 2RAQA 3D28A 2XLKA 4EO8A 4NI2A 4HHHA 1RBLA 3MURP 5A8KB 1IBKJ 3GFZA 2QMUB 3OTDA 3ZNUA 1H7XA 2FYXA 1TL7A 3CB4A 1NDKA 3H5XA 4Z7CA 3OXGA 4CLFA 4PXEA 4ZK7M 4DV1F 3K59A 1NKCA 1C0TB 3M9OB 1PJ5A 2FLOA 1YLXA 4ZS6A 4QR1A 1KWMA 4JV2A 1WC3A 2NREA 1LQ9A 1VRQC 5F9LA 2V0NA 1SVDA 3US5A 2O1PA 2GIQA 2W01A 2ZH6A 3TJ9A 2HWHA 2G1DA 2XYPB 1VBYA 2KO1A 3QWPA 3MM6A 1O8BA 4RW6B 4X66J 1LW2B 5JVHQ 5IZHA 3MR2A 1OPIA 2HQFA 2W4PA 4ZVRB 4NRUA 1N33J 3T5HA 2RHSB 3DLEA 1M0SA 2CNOB 2POKA 4M5GA 3KHLA 4RU9A 3DDNA 1EP4B 2KG1A 3PDNA 1WWHA 3DDIA 2AJQA 1YWXA 3W8GA 3GV5B 2B9XA 3HT0A 1FI4A 5KG6A 5LJ5Y 4X4SA 3RW6A 1PC4A 4RW4B 4KR0B 4ED8A 2G2ZA 4NLQA 3PFOA 4LSZB 4NLTA 4FBTA 2JC0A 2XMJA 1HBOB 1I6JA 3LP1A 3GIIA 1HQUA 3MEGA 3PVXA 4P7TA 4ES1A 3Q8YA 2ZM6J 5KOWA 3IC1A 1SCJB 2XLIA 2E1MC 3W66A 4K4WA 4DEZA 3D66A 3FFIB 3Q8RB 1X9WA 4WP8A 2WW8A 4RWXA 2VFTA 1ZAXA 2E1PA 3WIVA 1JXLA 2LA6A 4QWAA 1TL3A 2GJ2A 1HWKA 4R5PB 2CQ3A 3RBZA 2UXCJ 1S7IA 1EZZB 2YX1A 1HWLA 4DV6J 4USHA 1I3OB 2VBZA 4UY85 3TVKA 2IRUA 3UI3A 3GV8B 5G0RA 3TZZA 5HI7A 3DLJA 4NXMJ 3I6PA 3F56A 3W1YC 2XWXA 3DGVA 1P8GA 4EWTA 1CJTA 3AY0A 3LGNA 2CIMA 1X5SA 3T3FA 1J5OA 2QLBB 4WP3A 4MH8A 3CD7A 4NCAA 4YR2A 1CS4B 5AE3A 3QT5A 4O0NA 4PXBA 3D1OA 3PW2A 1BY9A 4ILMA 3WDOA 1XC9A 2ZOFA 3PEJA 4YDXA 1NDCA 4B3RF 2VPZB 4LF4F 3O8WA 1KTVA 3BR8A 3NGTA 1CJVB 4CQ1A 2Z30B 2FLPA 4V1Ak 3Q8PB 4PQUA 1X8DA 1S1WA 4ID5A 2YKMB 4ECVA 4U96A 3K5NA 4DZ6A 2VOOA 1RT2B 4QPTA 1HL6A 1ZM4A 2VQFF 5HQLA 3GLJA 4USTA 1FKPB 4P9SA 1R8BA 4TYBA 5A8WA 4FDFA 2F40A 1U09A 1U49A 2XO6A 1F60B 1IR1A 1ITPA 2QL9B 2APOA 4ED7A 3WZ0A 2KXHA 2OEJA 4OHXA 3TZXA 1YZ6A 1WACA 4LF8F 5FD1A 3ISNC 4BC7A 1RXOB 2HHQA 2FTRA 5LSLA 3KJFB 2M0GB 4X84A 4P2SA 3VCDA 4N7TA 3M4XA 2WONB 2DGXA 5DLGA 2IAJB 2LU1A 1HD1A 1TL4A 5IT0A 2K1RB 4KKOA 1B0PA 4I56A 3BM7A 2BANB 1NH8A 3OTOJ 4FYXB 4O44B 3W2VA 1V3RA 1B70B 5KFPA 3PJWA 4JB8B 3BGLA 1S0NA 1WF1A 4ZLLA 1ZM3A 1XN9A 3BO2A 2ZHOA 1YJTA 1UL3A 4C8MA 4L74A 3EGVA 1RWMB 1NAQA 4JI0F 1SC6A 3X3UA 2F65A 1UVMA 4DV0J 2XNRA 2P6TA 4PR6A 1KSPA 2V94A 1NSQA 4L3NA 1GAOA 1HBMA 4IG0A 1ZTWA 2CVEA 3LH2S 5GAHU 3FSXA 1HNVA 2ZH7A 1SQGA 3CDAA 1CC7A 2YWKA 3MM9B 4ES2A 2GGPA 2IM2A 4JI7F 1YIJS 4F50A 4W90B 4USUA 2YTCA 3LP2A 2H51B 1RT7B 2YQ0A 3FBCA 1O6XA 4FS2A 3VALA 3CT9A 3EZOA 4DLGA 3R7BB 2K06A 3GWCA 5ETRA 3QIPB 2VKRA 4DCJB 3BEGB 1TAQA 1NJWA 2ZWOA 1FK9B 4U8YA 4LRDA 4C8YA 4OJ1A 4HHJA 3BO4A 3AD9C 3IMQJ 3CCQS 3CCZA 3NGKA 3AQPA 2PMWA 1WC6A 2VHGA 5KFUA 1C0UB 2HLTA 3IBFB 3AD7C 4NLOA 1SBRA 4HT7A 2UU9J 2ZH9A 2I5JB 4ANDA 3OJUA 4PWDB 4ZVTB 3LGHA 1PJ7A 1W7WA 1WG1A 2RS8A 2Q43A 2LQBA 3DOKA 4L76A 1FD2A 1RZMA 4MYTA 1TTHB 2DR8A 2PMZD 4IOBA 1REVA 3OBIA 4B3TF 3AA8A 3BBFA 3DHWC 3O6QA 4NCBA 4Q43A 3OPKA 3JQJA 4DG1B 4C97A 1GEHA 2FLNA 5E2QA 2IYGA 1Y3JA 2VIHA 2OHDA 5D8HB 1ZA2B 3N5BA 4PXDA 2DT9A 2CQBA 5GAGI 4DUYJ 3A13A 2C3YA 3UN5A 2UUWA 1PILA 4F0MA 3KYLA 4BS2A 1TAUA 1WKJA 4RX6A 4FPRA 5HROA 1RT1B 1YITS 3L4BC 1RAOA 2BE7D 1ULRA 2PEHA 3SCKE 2MB0B 5A76A 5C24B 4ELVA 2FHKA 5KG3A 3V6DB 1S9EB 3C14B 4Z2XA 3HF5A 2HZAA 4NZ6A 4QW8A 4HHUA 4FBUA 3TAPA 3H5YA 2HHTA 5CXTA 5AXLA 5KFDA 1NKBA 1FRIA 3NCRA 4YUDA 4JI4F 5BR8J 2LFVA 1SC1B 3M8ZA 3V4MA 4RNFA 3N6MA 3TEHB 2PI4A 5J1NA 4WK3A 3CPWR 1R6VA 4DSFA 1SJQA 2HIQA 1RADB 2FJDB 2YH1A 2CUYA 1FDDA 3CULA 1FJGJ 3W7BA 4PRFA 4ZA1A 2X1AA 1HNWJ 3THPA 3HHLC 1RP5A 5HBMB 1HR0F 5J2PB 1ZAVA 3TZWA 1TK0A 2A2DA 3ITHB 2F3JA 4OI6A 4ZP8A 1JWWA 3S01A 1HI1A 2EFNA 2HQGA 2QMXA 1FKOB 3QT7A 4CH1A 2BJ3A 3EXCX 1KR4A 3SFUA 1Q7LB 5B08A 1VLOA 2DGSA 4A8FA 1R8CA 2CPJA 2ABYA 1VQKS 2VASA 3B54A 2YBVA 3LWLA 1S1XB 2K7KA 1JLQA 3UDCA 3HSZA 5GMDA 1YQHA 4EUVA 4RPFA 3D3CJ 3EE3A 2HBQB 1SI9A 2BJ7A 4ZCMA 3CJ2A 1RWPB 2ADCA 1UPPA 3DRPB 2B4PA 3GILA 3CC7S 1RTZA 4ZITA 1U6ZA 1X7VA 3VR1A 1NKEA 1G2EA 3SQGA 1E6YB 4CYUB 1HNXJ 4I6WA 2X1FA 1I5OB 1ZPWX 2YWHA 2X1BA 3MMBA 3QAUA 3N9UC 5DDPC 1C1BB 3HULA 2KJVA 2HHXA 3EVOA 3HHLA 2YNGB 1RKJA 3U1LA 4B08A 3DRRB 4ED0A 4I2QB 5FLXU 1R27B 2OPQB 4A8YA 1SQFA 5E3QA 1Q82T 4QYZK 3RUBL 2PE8A 4GKKJ 4IFYA 3C16B 3T5KA 5IM0B 5I42B 2WOMA 2ASJA 5HLFB 2F9DA 4XDDA 1BHNA 4WU2A 1XNRF 2IJNA 4ZCLA 2AEFA 4DMZA 3MUMP 2DKOB 3PO4A 4JI2F 3PFEA 2GHPA 4DR3F 4DN0A 1VQNS 4JI1J 4X2BA 3RTVA 1X0PA 2MSTA 2V8DA 1OO0B 1U4BA 1IKWA 4N8NA 5L1IA 2QYGA 2HHPA 3MM5A 1S76D 5KFNA 1CQNA 3M8PB 1FHTA 1U48A 5D4NA 2D9PA 5JMNA 2ZE2A 1S99A 2OPPB 2D69A 2VFUA 2UXBJ 5CQGA 1HBNB 3SDEB 1FERA 1FX2A 4RW7A 3R97A 3BBCA 5HN0A 2KN4A 1RAJA 1ELOA 3GYNA 3I96A 3AFGA 2HBRB 3V5RA 2V2VA 1P27B 1WC4A 3TUPA 5BYRA 2UUCF 5FDLA 3BB5A 2DGWA 2I38A 4DN9A 1IKYA 3QRQA 5H9EJ 3K58A 1S1VA 5GADI 1PCAA 3HVWA 3D6HB 2VB6A 3EPGA 5C42B 2CKWA 2V2QA 4C48A 4URSA 2J6TA 3VAFA 2L9WA 2AJ4A 5D0EA 3KG0A 4G1IA 3BO3A 2VDHA 3W5XA 4CLWA 1UWAA 2UVUA 2DNRA 3V6HA 3OSPA 4KHPF 3I31A 2VG5B 4HH0A 1VQOS 2JEJA 2XHWA 1WI8A 2FHJD 2V9WA 3EWGA 3WC2A 2MKYA 5HMXA 1KONA 5AJ3J 4ECZA 2FJVA 3CUNA 4ELTA 1OWXA 4AL7A 2CWXA 3MPDA 3MM8A 3OL9A 2OPSA 5K5MA 2CG8A 4Q5VA 1WHWA 1KFDA 3OL8A 1HNZJ 2ZITA 3D0HE 1XNQF 2C1EB 3RRGA 2QA4G 3R9LA 4DR5F 4ITSA 2MQ8A 4WIIA 4NI2B 3ZZTA 2IC3A 2VUGA 3R5AA 5GMEA 2RQMA 2G0JA 4EO6A 5DDRC 3DOLA 4LMZA 2QT7A 1BXNA 1OS5A 2CQ1A 3M8RA 3CCSS 1HMVA 5HMYA 5J2MA 4EZ6A 2LLZA 1TL7B 3IS9A 2IMOA 1R3NA 2X3GA 4I1TA 1EHWA 1L3SA 1VQ8S 1WEYA 4NLDA 3I4HX 2CNKB 1RCOB 1VISA 4IOCQ 2JNJA 2VJVA 4RJVA 2MZTA 3IA0A 3UNGC 3ZTSA 4DV3J 2PA8D 3C19A 2NQPA 3MM6B 1YJWS 4GC7A 1NJXA 2XS5A 4RW9A 3BGFA 4DUTA 4FS1A 3MAQA 3M6VA 5E3CA 4JI8F 5LJ3Y 1JNRB 4NYZA 2RKIA 3KFWX 4B9UA 4IQXA 3T1YF 1QAJA 1UVNA 3OXLA 1RCXB 4DPOA 3DLEB 1LKZA 3N01A 2YKQA 3D2WA 2WSCC 2W2OP 2E29A 3CJ5A 2JEIA 4DL6A 1TFYA 2J76E 3NGUA 3RBXA 1NBEB 3FCHA 2F8EX 1SL0A 4HTIA 3QGIA 3LP1B 1HQUB 4LF2A 2NUHA 3MEGB 2AEJA 4B3SJ 2BKOA 3EDQB 3FBBA 4OZJA 3SSQA 3NBPA 3K0JA 3IWXA 1LWEA 1FE0A 4KC5A 5F8LA 2ZC3A 3CNQP 2IY5B 2W1BA 4HH1A 3E51A 4K59A 2XSJA 1Q16B 4DFJA 3KWMA 2A3JA 1W2BR 4USWA 1TL3B 2DNLA 1NO8A 2Y1RI 3QZ8A 4Y28C 4ATNA 4HKQA 5G0RB 1VBZA 3NWRA 5BYQA 2Z4PA 4WXWA 4PPDA 3EGWB 3LUYA 5HVGA 3TP2A 1F2GA 4ECWA 3MOZA 1NJYA 3AD8C 1SC4B 4F4ZA 4JI6F 1XMBA 5IQQA 4YR0A 1CJTB 3UVJA 3VAJA 4N41A 1J5OB 1TUVA 3FMBA 4Z37A 1AUSL 2E9RX 1VQ7S 5CD4H 5BJRA 1D8YA 1HQ2A 2OKQA 3NMAA 4JI5F 4IR1A 1TUGB 7AT1B 4K4VA 3S7RA 5HMZA 3PRVA 2O01C 4WFBQ 2PFDA 4QU7A 2KHDA 2RRAA 2PC6A 4CM0A 1AFJA 4QPXA 5L8RC 3BKFA 1IVZA 1GNKA 4PQUB 3D3BJ 2R3VA 1XR7A 3LPEA 2JH3A 1S1WB 4ID5B 2RU3A 4DJBA 3D0GE 2DB1A 2E5JA 2DGTA 1UFWA 2GW8A 1KVKA 3AXKA 1RWOB 3JAMY 3SXLA 5A8WB 1F9FA 4C7QA 3CJ4A 4M5DA 2OAUA 1WHVA 4FF3A 1S79A 5B0AA 2CPFA 2MMYA 4DU8A 1S1UA 5IV4A 3CJRA 4UZBA 1Q95G 1ZA1B 2I8EA 1SXLA 1GMVA 1Y4ZB 3C15A 3QPIA 4AQYJ 4ZJLA 1G1XA 2YX7A 5CCMA 2LKZA 8RUCA 1VQ9S 5L39A 2RQCA 1UJ4A 2YKNA 2GV1A 1AT1B 1VJWA 4F7VA 1SH0A 2HVZA 1S97A 4QR2A 4KKOB 3BZQA 3W2VB 1WKKA 1R0AA 2AYGA 2AWZA 2YQ1A 4FYWB 2ZDOA 1CVJA 3MEKA 1KEKA 3PW0A 3PX0A 5B0EA 3CTRA 1QM9A 1UZHA 3Q8VA 1DAXA 1NM2A 1H7WA 2W2MP 4RU2A 3VZHA 1DLOA 4RNHA 2R2SA 1WDDA 1REGX 3PACA 2OELA 1HBMB 2DH9A 3CCES 4IG0B 1GT8A 2H1YA 4Q7AA 3T41A 1FJ7A 5HJXA 2MKJA 1BQNA 1HNVB 3QZ7A 4WXOA 2IVYA 3L7UA 2CNNB 1RHQB 5LSOA 2QIFA 3RRKA 3MR5A 3U1NA 4DPUA 2DR7A 2GGPB 4P72A 1VHIA 1VQ6S 1QE1A 3O2IA 3A8IA 4CLLA 1FO1A 3LP2B 1FVQA 3EUNA 1FF2A 3FJ2A 2PDAA 3TA0A 1CJUA 4DV5J 2J7WA 4BDPA 2Y9HA 2CDQA 4AXJA 4MK7A 4WP9A 5EX0A 4DV4F 2KL8A 4UQGA 5B09A 1RHUB 3IXQA 5DG7A 1Y5LB 3EDRB 2I9SA 2GC8A 1GK8A 3OVBA 5I3PA 3LAMA 4H4KA 3ILIA 4X62J 5JUMA 3K5OA 4UZCA 1H98A 2BW2A 2M8DB 2XY7A 2CZ4A 3G8QA 3M2UA 3BH6B 2OD6A 2DIVA 4ZP9A 4FN5A 4DPTA 3OHAA 1QAXA 1QAIA 3HZGA 2CXEA 4OZ5A 5DGAA 1YBTA 4OZNA 5GAHI 4RNOA 4K7QA 2XHCA 4WTYA 3DOKB 3PRDA 4OJHA 1FWLA 1REVB 1Q5VA 3H90A 3Q8QB 1SUQA 4DQPA 4C3MA 1YK9A 2ZBPA 3IWLA 4K0KJ 3IR7B 2GHVC 5HO4A 4QW9A 4A8WA 3Q83A 3BREA 4IR9A 1OY9A 4IH7A 4UW2A 3VAIA 3KJNB 2R7UA 4F26A 4CO5A 1H74A 2PGCA 2BDPA 2LXIA 4NLWA 2MJUA 2BE9B 5HROB 2F5GA 2W25A 2PD1A 5ETQA 2DRBA 4NLYA 4UY8T 1Q0NA 4PYDA 4X4OA 2E44A 1TL1A 4ED4A 2XYHB 1TV6A 3A12A 1EKSA 1APSA 1MN7A 3UCUP 1KC8T 4ENOA 4F25A 5KFMA 2Q79A 3JTPA 2HS4A 2DYAA 3IR6B 4G1PA 4NEZA 5ETMA 1LV5A 1BWVA 1EB0A 3JQMA 4TY8A 4GKJF 1CBKA 4M1KA 3JXOA 2OMOA 4MJKA 1RE1B 5ETKA 4B9NA 1YG0A 3L9ZA 2OP5A 3HSDA 1NK6A 3CIZA 3T6BA 3CC2S 2KKHA 2EI5A 4NYOA 1D0EA 4YP3A 5L9XA 1VFJA 1AFIA 5ITHA 4KY3A 5CCLA 2KVIA 1YJRA 3UO0A 1UW4A 2UUBJ 4IYQA 1TK8A 5H9FJ 2CQIA 1HD0A 3W64A 1S57A 5KG2A 4IFVA 3J81Y 1A6LA 3N6LA 3ICLA 4K4YA 3CCJS 3CXCR 3O5TB 3CCWA 1C1CA 3HVTA 3G8SA 2O66A 1H2TZ 5KT2A 3SEOA 2RNEA 2AYMA 5J2QA 2RT3A 1SJFA 3F44A 1S59A 2VQEF 3J7AN 3RG6A 3OTEA 4NLPA 2A1BA 2GQ2A 2N7CA 1M5KC 2AKWB 1JLQB 2QFIA 4ZKAA 2ROEA 4LF6J 3CE8A 2KH9A 3Q86A 1RU1A 2J8SA 4DPYA 1JLFA 9RUBA 5IS2A 4F2RA 4PYAA 2ILZA 2H5EA 4E0DA 4CLUA 2DITA 2C3MA 2PI5A 2MQQA 3ZZOA 4BHQA 4C3KA 2M2BA 4A8SA 3H42A 3FDSA 5B0CA 3QNWB 1KOHA 1MROA 4A4JA 3SQGB 2HVEA 1RHMB 2VONA 5K9FA 2OSQA 1IM4A 3MMBB 4OX8A 4RUBA 1N0UA 3MMJA 2NXJA 1T3OA 1HLWA 2VFVA 3HHLB 3MR6A 2AF6A 2NYIA 4FYYB 5A0YA 3FNNA 1FFWB 4WE1A 4ZVEA 4IFYB 2A6MA 3UCGA 1YRUA 3D5MA 2D9OA 2WOMB 2ZH1A 2EFPA 2J9CA 2IA6A 1NB7A 2MYFA 1N33F 1BWEA 4DX8H 4ZDNA 2AGPA 1ZS6A 4S0MA 2IM0A 3T1HJ 2VBXA 2WB4A 4NXNJ 2DY9A 1UKUA 4F4AA 1O51A 2KXFA 3TR5A 1R0BG 1IKWB 2ACMA 2MY8A 1RLCL 4I7FA 1DFDA 2AW0A 1EKRA 1DY3A 3MM5B 4RL1A 4J9NA 2CZVC 1U8SA 4I68A 2MXYA 1U1QA 2DNNA 2J7UA 4URQU 1NU4A 3HFKA 2BABA 3JSYA 2ALZA 2ZE2B 2HQCA 2RDIA 2KM8C 4DHVA 4RW7B 3H8YA 4DDFA 1QTNB 1FRXA 2WW4A 1K1QA 2QX0A 2DR6A 2QGFB 2NXUA 2EFOA 4QYZJ 1AZSA 1MWYA 5FDLB 4DR4J 2VF3A 4G65A 3D1QA 1T02A 1IKYB 2C22A 3GG1A 1XR5A 2X3DA 3A8JA 1CJKA 1S1VB 2OUGA 3HJVA 2VOPA 5KT6A 4Y65A 1Y5NB 2XBPA 2EKYA 3PYEA 4DV6F 3QSYB 2GVDA 4KIAA 4NA1A 5A2QY 1HNIA 3CDUA 2KRBA 4C8ZA 4NXMF 5BYSA 1Y00A 2I0XA 4F0HA 1WC5A 2J5AA 8AT1B 3CJQA 1U7LA 3R3TA 2VODA 1U1KA 3GIMA 4PUOA 3Q22A 1UVIA 4JV0A 2VPXB 2D1CA 2OD4A 1PAEX 4AD6A 5C5JA 1WEZA 3BQ2A 1VJQA 3HPOA 3KNGA 3MM8B 2HWTA 2XMAA 4NLRA 2OPSB 1X4FA 2CZ9A 2CRLA 2P8IA 2CJYB 4UQTA 2FPHX 3ETOA 3JTNA 1FEEA 4DCOB 4ZVGA 1FXLA 4A48A 2IC3B 1WSVA 4ZLPA 3DOLB 2RS2A 4DL4A 4PABA 4I2PA 2XY6A 1D8ZA 4EK2A 1HMVB 5J2MB 2Q6BA 4ID8A 3MUVP 4W92B 1G4CA 1H2VZ 4F4WA 2RUSA 3IS9B 1NCLA 2PA3A 4EYIB 2RILA 3G6ES 4LBIA 3IWNC 3GONA 2MLXA 1JLBA 2E9TA 2NSBA 1IJEB 3MTJA 5F8GA 1KQFB 4LR7A 2V4QA 4N5SA 3VTIA 4ES3A 4NCGA 2EEYA 1VHFA 2RIJA 4OV6A 1U0SA 3FZBA 3OXFA 3ULHA 2RSQA 4ZVFA 4BWMA 4RW9B 1JLGA 1PYTA 2WRMA 1N32J 2H3EB 2VD3A 4CP5A 3HDSA 4J9PA 2W2QP 2RKIB 2HGLA 3HFVA 1KQGB 3OTOF 1LFWA 1VLYA 2EWHA 4R8UA 2WVBA 3M8YA 1VC6A 4YQWA 2DGVA 1UVKA 3SV4A 3GJSB 4P74A 3F0NA 1FVSA 4C9DA 4DV0F 1N6QA 1S49A 4ECRA 4DL0C 1HWUA 2WHOA 4C11A 4ECUA 2GIRA 3GFXA 1NK7A 2XULA 1T0TV 4C8NA 2CQPA 2BR0A 2VQFJ 2DO4A 3P5BP 3CC4S 3NBPB 4DQQA 1K44A 3NS7B 1GTHA 1LWEB 2A2CA 5AXNA 2MSSA 3JSBA 4M95A 1D9DA 4ZPDA 3A4TA 4ZPBA 5SUHA 2E5GA 4ZOSA 4ED2A 5E3AA 2VBWA 1U8WA 3TYTA 3RAMA 2XSJB 2YWGA 4G6VB 2Q66A 1TVRA 2GA7A 1U26A 5KFYA 5CD4A 1UW9A 4J9VA 3DRSA 2C42A 2UV8A 4D3HA 5KT4A 1DURA 3C46A 1BGXT 2W4DA 4EMDA 1MW7A 3N0VA 4HACA 2OTJS 1HHTP 2BRKA 2FVCA 2VZ9A 1RABB 3IAS9 2WBMA 4M5MA 4UUWA 3TAMA 3U7JA 2UU9F 3R5DA 4A8XA 2QLWA 3M7VA 3UVJB 3PY8A 3LQVA 2EVZA 4GMKA 3I9V9 4K2XA 4A8QA 4G3IA 1UWBA 4DV2J 3FEZA 4X4RA 1RTDA 2VBYA 3N4WA 4RR5A 4PKDB 4KV8A 2MQPA 4QWCA 4V19J 3CW2C 2V5HG 2GO9A 2R8KA 4MMOA 1IQZA 3OR2A 1X4AA 2AZ3A 2DISA 1S12A 4O3OA 4CDIA 5K8PA 1R0CB 1OPZA 5KFZA 4USKA 2BJEA 4MIBA 2R8JA 4OI4A 1X5OA 4PPZA 1YBUA 3R5CA 1FEHA 4KE5A 4O3QA 5F8MA 2CWKA 4X4QA 1NH7A 1T9WA 4CO2A 1EQ0A 1KOOA 1VR6A 1CG2A 4DUYF 1QDUB 4M5DB 5DDQC 3DXBA 4AL6A 1N5TA 4PWWA 2WB1D 3A1YG 1PJ6A 2LQ9A 1S1UB 2F4VJ 2FJXA 4QYRA 4HYKA 2ROPA 4FVMA 1IBCB 2W9CA 3M2RA 2G0IA 2ATLA 2BM1A 3G6XA 3C15B 3KDOA 2H4YB 4RLEA 1NJIT 3TI0A 2OIHA 2YKNB 4DR1J 3A8KA 1HHSA 4M5IA 2SXLA 2HS0A 2ZFHA 4MKBA 1MU2A 4LJMA 5MAOA 2BV3A 3KJQB 2XLJA 2IIHA 1R0AB 2J7KA 1LEOA 4J9RA 1GX6A 1QY7A 1KTQA 5BR8F 2GIFA 3CMES 4X64J 3SQOP 3ONQA 3X1LB 1FXRA 1M1KT 1DLOB 2ZZTA 2P5VA 3MR7A 5L38A 3W5ZA 1RJJA 1NZ8A 2B51A 4V19X 4H4OA 3K8VA 3W60A 2JOQA 1RWVB 5KFRA 4KTQA 2ZUAA 1TELA 1HNWF 2QMWA 1BQNB 1KDNA 4IO1A 2EC2A 4C6AA 3CSKA 3H2LA 4EFAC 3CCTA 2XSFA 3MECA 2IDLA 5F9NA 1KVJA 2V8GA 4C0HA 1BC6A 1QE1B 2DGOA 3QQCD 2W2NP 3KLHA 1I1GA 7FD1A 2LXFA 4NRTA 4ETXA 1CJUB 1U2RA 5DQGA 3LOUA 4FNHA 3J7ZT 1KLMA 4U67Q 3I32A 3UPFA 3DLGA 2CADA 2HG4A 4GVLA 1LK5A 5HMWA 1RT5A 2QTWA 2YVSA 3FQKA 4NASA 1I94F 4ZP6A 4IRCA 3HFZB 2ZHAA 3M2UB 4XK8C 2MZ1A 1WF0A 2CQ0A 2XWYA 2QYCA 2V4JA 4KB7A 3DGPA 4WJBA 1BE4A 3BQ0A 2WK4A 4DV7J 4YB1P 1FTCA 1HA1A 3KK2A 4P75A 4FXWA 3BDPA 3LANA 2ZJRQ 4L73A 1SJ4P 3W61A 4AL5A 3QJPA 2AT1B 2V8HA 5HAOA 4MAKA 5LXRA 1SUQB 4LSNA 5F3ZA 4OJGA 1B64A 3OFFA 2KFNA 1NHUA 4USVA 1XMOF 2HAIA 3W9JA 5GVQA 3G87A 2Q3PA 2DCLA 3W65A 3H20A 4AT1B 2KYZA 2JL9A 2P9CA 4N47A 1WKLA 4F4KA 3BSAA 2ZUGA 2MLZA 2CQDA 5B0GA 3MEDA 1HWJA 1IBLJ 3S6EA 4K5RA 2CA9A 1RTJA 4Y6IA 4WIQA 4DUZJ 1NEEA 4JI1F 1YJVA 4LF7J 2FJWA 4EZ9A 1VQMS 3J7A1 1EETA 4ZLJA 5HQMA 1L3VA 1TL1B 4OI1A 3GIKA 4N56A 1TV6B 4PG7A 1T9XA 2WSFC 2AD9A 4J9UE 2ZH4A 5E3PA 3V81A 3L95X 3OHBA 4EYHB 2VJUA 2C2RA 5L46A 2DR5A 2GMJA 5ETSA 4TY8B 3HI9A 2UXBF 2Z2ZA 1WI6A 1SIWB 3PV8A 1Q79A 3MD3A 2W2PP 2E9ZA 2BOAA 2MQNA 3VGVA 3NP5A 1S6UA 5LSRA 4RNNA 2NCKL 3L3CA 1B4SA 2M9KA 2CJAA 4DL2A 3H40A 4E8UA 1Z4UA 4ZHRA 5LMNJ 3I5AA 3QLHA 1TUWA 3KXDA 3G82A 1IUJA 1S10A 3FEYB 2FHOB 3CJSA 4M8LA 3K5PA 2G9OA 2M88A 3H5SA 2BACA 3HX9A 1P9QC 5L1KA 1XNRJ 4IFVB 1KN6A 4JI2J 2XO7A 2NR0A 3MD1A 2OMLA 1LFPA 2HYIB 1FWKA 3V6JA 1HW8A 1GXTA 3NY0A 1C1CB 3HVTB 4P2XA 5DJBA 3DI6A 5J2QB 3KUGA 4Z7YA 2JVOA 4DSIA 2J0SD 4H4MA 3M6UA 3BSOA 5D77A 1HNZF 1H2UX 1ZAWA 3PG9A 4M5JA 2O3DA 3V2UC 3FK4A 2HVDA 4Q0BA 2AHOB 2XGQA 1R8HA 2NSCA 3NGRA 1OIAA 3TX0A 3D68A 5HP1A 4RNMA 1JLFB 5G4DA 3I55S 3WC0A 4ED5A 2YWWA 3DYAA 3N6NA 2YY3A 2FHJA 2QA1A 1N5SA 1VQPS 4KO0A 4DOZA 1SKRA 1A7GE 5KFIA 1LWXA 1MN9A 5KFWA 2EBEA 4W4MA 1MROB 2UUCJ 5K8OA 3LW5C 3R27A 4NZ0A 3OVAA 2ZOGA 3I4PA 2HFSA 4QIGA 1FWPA 4J9KA 3WIUA 3MGJA 1YX2A 2X7IA 1UA0A 3VV2B 4TU8A 1D9AA 4Y2IA 1ZTTA 2MKHA 2O5DA 4DV3F 5A0YB 4WE1B 1KBRA 1BMQB 3ZZYA 3HD1A 4HDHA 2LU2A 2V69A 1X60A 4OYZA 4YY3J 2PO4A 5C2CA 2HRYA 1F5AA 4O4RA 2VICA 4KHPJ 1RAGB 2DXFA 3JSRA 6FD1A 4O3NA 4K4ZA 4A8OA 5ETTA 3RR7A 2DTJA 5IT9U 4O23A 1LXNA 1WDTA 2OPRA 3G9CA 4PEOA 1RBAA 3TA2A 1JJHA 4CLZA 4LF9J 3CCRS 1F3VA 2YH0A 4QIVA 1N5YA 1X4CA 4H54A 3DC2A 4HL9A 1DJ0A 3NS6A 4I7FB 3KTQA 4B02A 3LWMA 2DRAA 2B4VA 5EGYA 2EC0A 2YKAA 1KLNA 2QG9B 4FYDA 2E1RA 2DIUA 5B0FA 2AP6A 1Q5YA 5IFMA 3Q8UA 3FSIA 2ZNZA 1MWQA 1XMQJ 1RLDA 5E3RA 3KLEA 1YJ7A 4LVNP 1UEVA 3W63A 4K4XA 1T8EA 4JV5J 3I5CA 2CJBA 2G13A 1AZSB 1N34J 1S1TA 2UVWA 2KVQE 2E5LJ 4M63A 3QFHA 4DCPB 3D6MB 2MY7A 2AYBA 2GMLA 1CJKB 1FXDA 1KP6A 2V2ZA 3HKZD 5SZTA 3KKFA 3ZC4A 1M1GA 1KNZA 3GP9A 3TJAA 5KFLA 3N79A 2GVDB 1K73T 1HNIB 1YZ7A 3T9ZA 1FNMA 5GAEI 1UAWA 4CZCA 2XCAA 2ZKUA 1F5BA 2LA4A 1N5VA 2GQQA 4YN3B 2R8HA 1NXIA 4F67A 3PHEA 2CPHA 4PUOB 1QUVA 2M3DA 2DRDA 2XMUA 1U47A 2B8QA 3DCAA 3M1VA 4DX7A 2MGZA 4FXVA 1B99A 3HJFA 2GMHA 4XDCA 3HT3A 4P2MA 4FP9A 5D4LA 4USMA 2OEMA 1AB8A 5ADZA 1WOSA 1MWZA 1FNXH 1S48A 1QSYA 3N28A 2DNQA 1W26A 3B78A 3M30A 4QOTA 2KM8B 2B9EA 1FT8A 3BR9A 2W4CA 2B4OA 4FYVB 1T95A 3OR1A 3VGTA 4I2PB 5D0RA 3PTWA 2RUGA 2K7JA 3PYGA 2QSWA 3C6TA 3CJ8A 2LXUA 2XY5A 2UUAJ 4O4GA 2H4WB 2IJRA 1JLBB 1YSJA 3BGRA 2YQ3A 4ZVSB 1VDHA 1F5CA 2EK1A 4MFBA 3T6JA 1WC0A 3W2WA 4EGLA 1Z1ZA 4FNIA 4NCGB 1VS3A 4IQMA 4WPAA 1K1SA 3GPAA 2CPEA 1SPBP 2C3OA 4QIWD 1DTTA 3W9HA 4AQYF 4KGXB 3FBEA 3SIPB 1JLGB 4NA2A 4GRSA 1ROFA 3IFEA 2K3KA 3D6TB 1Y11A 1HARA 1HQEA 1N88A 3R8YA 3TJ8A 4JI6J 4HLBA 2R7WA 4Q8EA 2WVFA 5KG4A 4R8UB 3BYRA 3G6VA 2VA2A 4NYPA 3ZXWA 3CEDA 1GMUA 3CDEA 3VZIA 1HBUA 2OO4A 3PM9A 5AT1B 4JI5J 1OYDA 3R7SB 1R89A 2J9EA 5LXYA 1N6QB 4X4PA 3LP0A 2H5JB 1N0VC 2XG8A 4EI2A 5A6WA 4C11B 4WBFA 5RUBA 4ZPTR 5ETNA 2V34A 4J90A 2ERRA 4L72B 3J80U 1VRTA 1X9MA 3AHPA 3ET6A 4CLTA 4OZ0A 3EMTA 5F8IA 5LM7E 2EFVA 5KFXA 2BW7A 4OX6A 5K20B 4JV1A 2B43A 1TKDA 2QEXS 4DSKA 4ZN3A 5JVGQ 1TZ0A 4OFZA 3CJTA 5H1SV 2XEXA 3EZUA 2NZCA 4LFCJ 2FC9A 3ZZRA 3KHGA 2V8VA 1ZOTA 3P3DA 4I69A 3KMQA 1RHRB 4DWIA 2C2KB 2YNFA 3THVA 3E8OA 4DV5F 3RBEA 1UPMB 1TVRB 2OSRA 2J0QD 3K89A 3DRSB 1NPPA 4DR2F 3NL0A 2UUTA 2QA4S 2B7CB 1IN0A 3MHYA 4HACB 4X62F 3PRBA 3A3NB 2G2OA 4FF4A 3SI8A 4OYIA 1C4AA 1LW0A 2HHWA 1BD6A 3TAMB 2RDJA 3GG0A 3IR5B 1DRZA 4Q2MA 1SKSA 1S72S 3PXGa 4NOHA 3PR4A 1UWBB 2E5HA 4BLGA 2YPYA 5E7OB 2W7OA 4PAAA 4G1QA 1RTDB 4KV8B 4EEYA 1U02A 1C2PA 2HMIA 4NLVA 3QO9A 4ED3A 3OR2B 4WFNQ 4RUCA 4K0KF 2IM1A 2HAFA 5J2NA 4B9TA 1PBAA 1SL1A 5HQ8A 3DHXA 2ALYB 3MPWA 2OLWA 3HSGA 4F36A 1UP1A 3U02A 3R5JB 3A3PB 2MZQA 3SCIE 2JZ5A 3OL6A 2ZVSA 2B6AA 2DH7A 2YWFA 3QBCA 4YHHF 3EGNA 3DRYA 1GMWD 1VC0A 3R2DJ 1B7FA 2D74B 4DF4A 3MMAA 2N4DA 2ZNYA 1IKXA 2W9CB 3M2RB 1Q7YT 1XERA 4RBTA 4LFAJ 2FD2A 1RUSA 3HP6A 2HSEB 3MAAA 8ATCB 1VIOA 4TXSA 4F4YA 2EW9A 1WEXA 3ADAC 3MEEA 1T9UA 5M2PA 3BV8A 1MU2B 3W5YA 2HURA 1HKAA 3IM8A 1OMSA 5BXIA 2QRRA 4P6QA 4JBCA 5KFFA 2FY8A 1N52B 2A10A 2JDJA 2N7YA 1VK3A 1NUEA 2HQ3A 3P6YC 1S77D 1KRPA 1QD1A 4XIUA 3HHNB 3FKBA 2JEFA 1FE4A 2H9ZA 1LWCA 2LEAA 4LQ3A 2COLA 4LVOP 2G1HA 3A8EA 3QT6A 1NHVA 4OX9J 1WHXA 2RQKA 4ZPWR 3M9MB 1UJ6A 3MTKA 3THTA 1VC5A 3NRBA 3NOGA 1T03A 3NAHA 4H4OB 3UDEA 4O3RA 1Y0HA 1TK5A 2ZH3A 4LF1A 3HMJG 3AH6A 3PO5A 1X31C 2IM3A 4DI6A 1IBMJ 1VQYA 4LFBF 2UUBF 3C2PA 4M5NA 4BC9A 1HWIA 2CG4A 3MECB 5I3UA 4MK8A 4WWSA 3BPDA 1MMDA 1JB0C 3EVWA 5LMUJ 3MWBA 4P10A 4KAIA 1NZAA 2Z0GA 4A47A 1YRXA 2JLFA 1KHVA 4DZDA 3H2UB 2F63A 3KLHB 4FF2A 3M8SA 2HFZA 2HZCA 5KG0A 2KRRA 3GR1A 1VIXA 3PJ9A 2Y8WA 2GJFA 2CJ9A 5T41A 3GJRB 2IBOA 1KLMB 2GHWA 3DLGB 3MR3A 1IKVA 3GSDA 3FZ2A 4DF8A 3KLIA 1RT5B 4ED1A 2LQJA 4LF6F 3VWSA 1YDLA 3P45B 3E2EA 3MM7A 4A8MP 2Z56B 1PKUA 3H0PA 2ZOMA 4OYWA 3D0IE 2EFGA 5HSPA 2VG6A 1QSLA 2V4JB 3DGPB 3U1MA 2W9BA 3FMWA 3MDFA 2YXLA 4W98A 2U2FA 3KK2B 2BBEA 3TQ1A 1RWKB 3PKMA 2HW3A 1T11A 4UOHA 5KFTA 5DLFA 1X4BA 5KFGA 1ZPVA 4DX5A 3CCLS 2V68A 4DPWA 2ZZNA 2CNLB 4LSNB 2V4RA 1H38A 2AJ2A 5D78A 4ZVOB 4PCQA 3EM1A 2J0XA 1JLEA 4F04B 4BWJA 3K17A 1S6OA 2JRSA 1VBKA 3OD2A 1VYAA 2FLLA 2DNYA 3WX4A 1H3DA 3MEDB 4FZVA 2ZBIA 4X4NA 3ILLA 2PT0A 1SIZA 2HFUA 4MTPA 4NXNF 2F8MA 2HQIA 1RTJB 2CQ2A 3NAIA 1FRJA 5CHCB 4MK9A 3HK2A 2C28A 3SV3A 3GFHA 2Q6CA 3GQCA 1U6FA 2JFKA 3UD5A 1EETB 3BBBA 4YDDB 2C2NA 1RTHA 1EAYC 1WUUA 5J1PA 4HDGA 1GFWB 5KT3A 2DXEA 5KFBA 2C2MB 4JYAJ 1TKXA 3KUEA 3A3OB 3V81B 2BM0A 3V6KA 3F73A 2ZVIA 5JXSA 2DHHA 4QR0A 4PQAA 3TARA 2E7XA 3DLLQ 4DR4F 4U6PA 2HNDA 3MCSA 4IRKA 1VOMA 1T7PA 3PNIA 2MHNA 4ZHRB 3JYTA 1BQMA 3RB6A 3QLHB 2KZMA 1RACB 2M8HA 4KBIA 3G82B 5A8RA 1OSDA 3DOMA 2PN6A 3S1TA 3ZTQA 2FJEB 3ZO7A 2BKPA 1IXKA 2DBBA 1HI0P 2YKOA 1F1BB 3POTA 3EXYA 2EFQA 1NNDA 2DO0A 1W25A 1T9YA 1S9GA 5IT4A 1B7YB 5IV3A 4NPOA 3HO1A 4TLQA 2FZGB 2QLFB 3PKYA 1WF2A 3DI6B 4ZVQB 3ZFVA 1KQSR 2JLEA 2BJ8A 4H4MB 5K8MA 3EZ5A 3FCVA 2U1AA 5CZVA 5KG1A 1NK4A 4IG3A 1FDAA 1UFKA 2EPIA 1AROP 2DNHA 4C3LA 4Q0BB 4CTAA 2CQ4A 4ZJQA 2RJZA 5HP1B 1J5EJ 3DYAB 4CNZA 2BXJA 2VKZG 1DQ8A 2FZKB 2HFVA 4KGVB 1UJ5A 5C2GA 4XTTA 4KO0B 4RUAA 4ECSA 5E5NA 1TR0A 1M5HA 1MLAA 1M1HA 3FQLA 4HVZA 1B0VA 3NWGA 4ANEA 3TANA 3K57A 3G6YA 4FPIA 3ZZUA 3T19A 1IM6A 5FLXY 2H5IB 3H59A 4ZP7A 3AOBA 4WFZA 1MG7A 2DH8A 3VGUA 1PC5A 1I51B 1IQTA 2HHHJ 2HIYA 2UXDJ 3UD3P 2G4BA 4B9LA 2VC1A 4I64A 1N32F 2R8GA 3VF0B 4KQZA 1D9FA 3ZTRA 4KHMA 2QO3A 2BZ2A 2AIRB 1Q4RA 2OPRB 4QZVB 3M05A 1G3OA 1SJRA 4YMEA 1SL2A 3RYLA 1N5YB 1C4CA 4R25A 4I67A 2XS7A 3AJ1A 3UR3C 4ALZA 1FDNA 1WTFA 2BUNA 5DS7A 2L41A 4KYZA 1R31A 1TKZA 3EJMA 3MCNA 4N8OA 2X51A 1LK7A 3RR8A 5EUHA 4DR6J 3HVAA 1U1LA 3GSIA 4FXDA 1KD1T 5LT5A 4CNYA 3KLEB 1N8RT 2WCXA 3QMQA 3R6LB 1T05A 1QLNA 1GQEA 1YHQS 4ILLA 2ATCB 1FX4A 1S1TB 1HIYA 3TUIC 3D54A 2R7QA 3NMRA 3IG1A 4WYLA 4TY9A 1X4DA 3D7SB 2CQGA 4DQIA 2BJ1A 5E33A 4H4KC 1TU0B 4LRAA 5D0GA 5L9NA 5EDWA 1RSCA 1XIQA 4CT9A 3WQPA 3OJSA 3OFGA 2VFRA 4LUBA 1HI8A 5AXKA 2BOPA 1XR6A 4ECYA 3JQKA 3I0SA 2PIIA 4X65J 2RMLA 4C8KA 1S6QA 3CD5A 1XQIA 3VAGA 3QJJA 2PFFB 2G2YA 1ZM9A 2R9LA 4DSLA 5I4MA 3M1VB 2MGZB 3JSMA 5F0WA 4ZPAA 3FBFA 2IJFA 4DV2F 1HFEL 4QBUA 3Q2SC 2FGOA 4ZMMA 3G96A 4KPCA 2WVCA 3NS5A 1Z2LA 2K2PA 2LEBA 2R7RA 2WAQD 3LPYA 1VQ5S 3D67A 3R5GA 1VK8A 1SKWA 1Q86T 3QRRA 3VAMA 1FFSB 1N36J 3KNAA 3M30B 1QJHA 2DEIA 1R8AA 3CGIA 3GIJA 3HCXA 3RB0A 2RF2A 3OR1B 3T1AA 3KG1A 2DCUB 4DR7J 1FRMA 1GXUA 1U25A 3P8BB 3C6TB 2YNIA 3ISZA 1U2CA 3IGNA 4CIOA 3DMJA 1EQMA 4O4GB 1S0MA 4LRCA 1P1TA 3BGRB 5FJ4A 1QVFR 3Q2TC 4MFBB 1MNEA 3G4SS 2F4VF 2RU9A 3W2WB 2YWEA 2EG1A 4F0KA 2B8PA 3H4DA 1NDLA 4AXIA 2F4FA 5KOXA 3HKWA 2XMVA 4DFPA 1DTTB 2BJDA 2DGUA 3BSCA 1SH2A 5C25A 4LIWA 1NJZA 4DR1F 5IC6B 1RGVA 3QIDA 1T9VA 5KG5A 1U24A 1HQEB 2XMTA 1WD6A 2XI3A 4Y00A 1RHKB 2ZD1A 2ADBA 1GX5A 3KJVA 2RQ4A 2LMIA 2B5JA 2C2DA 1HBUB 3AT1B 2JVRA 1O0PA 3OFEA 2IDEA 5CYMA 4OYXA 4X64F 2GFFA 4ZCKA 1R43A 3K5MA 3LP0B 2XQCA 1RA6A 4LIRA 4X4UA 2E5IA 4I4BA 1VRTB 3TA1A 1Q8BA 3DLKA 3ET6B 2HNZA 4A46A 2QL7B 2H48B 2R2RA 5ETVA 2Y0SD 4DU7A 1P6TA 4ICLA 2DXDA 1S6PA 2J9DA 3B4MA 3TVZA 4FKYA 1UA1A 4Y2KA 4C2MA 1F0XA 3LF0A 3OV7A 1TQLA 3UE2A 3SMZA 4B17A 3KLVA 5H9FK 5C7PA 3HM9A 3BYPA 2YNFB 2BVZA 1U1PA 2J6UA 2LVWA 4WTOB 2WVEA 2NUUG 1KVIA 3GMGA 1RT6A 4JP8A 5KT7A 2QE5A 2ASLA 3GCXP 4CCHA 3P4UB 4B3MJ 3UN2A 1UTAA 3KLGA 1S4FA 1LW0B 2BRLA 4DLEA 4DBQA 5KAKA 2FUG9 3GTYX 2FB0A 1V3SA 1URRA 3EX7B 1BLUA 2AYEA 2NLWA 1MMNA 2GX8A 1YBAA 1JMTA 4MIWA 2MEWA 1WHYA 2ZWPA 1RT4A 4DV7F 2IPOB 1Y5IB 4BBYA 3RAXA 4G1QB 2BYCA 3DRXA 1DTQA 1CULA 1RYRA 3QSIA 1YJUA 1DQ9A 2E1CA 4X4VA 2HMIB 3P49B 3QO9B 3MPVA 2QSFA 3QGGA 4QWEA 1YVFA 4WZQA 1SKUB 2VH7A 5J2NB 3M9NB 2DPJA 4F3QA 2W24A 4ECTA 1V6HA 3Q23A 2F1FA 3AAWB 4NLXA 2HK3A 1NDPA 1L3UA 2LCWA 2YNHA 2CJXB 1RYSA 4WFXA 1ZYQA 3ILJA 4Y2MA 5CABA 3ENVA 5KG7A 1TMJA 1IBLF 2B6AB 3BPSP 1RWXB 4IRDA 1QUPA 4DUZF 3OSNA 1UEUA 5CH7B 2KI2A 4OHZA 4LF7F 4Q45A 3MMAB 1IKXB 4R0JA 2Z2LA 5IXUA 3GJTB 5IWAJ 1IBKF 3MFIA 1LWFA 4MKYA 1K47A 2FJBB 3MAAB 5HVHA 4NMLA 1UVJA 2HS3A 1I94J 2ZZMA 3MEEB 2WSEC 2CPXA 4DL7A 1YTYA 2UP1A 1Q8LA 4I0WA 1U1OA 2IRYA 4B9SA 1X0FA 3CD6S 1UZDA 5ETOA 3MI7X 4P2FA 3GZ7A 1CEZA 4KSEB 2N82B 2PSZA 3SFGA 3DNCA 2LECA 4Q44A 5E0OA 4LF5J 4R0EA 1RWNB 2CQHA 5EWFA 1LWCB 4P7VA 4DXLA 3Q89A 3PZPA 5EWGA 3EGZA 3EICA 2M4MA 3IRXA 2NXCA 3HLUA 2QC3A 2GQCA 4X66F 1T03B 3AOCA 3M2VA 4JI3J 1XMOJ 5LMNF 3SCLE 3I0RA 3NCQA 3DU6A 4J9LA 2CPDA 1B0TA 4FVCA 2AX0A 3D4JA 4ZVUB 3CCVS 1UMJA 5F41A 2GO8A 5I3UB 3HZEA 3GYXB 5GAEU 3K8WA 3M32A 2XGPA 1DARA 2ILYA 2F9JA 1IJFB 3MZIA 2QLJB 3I9ZA 2P2CB 1NMEB 3H7HB 3H4BA 1W2IA 2VDIA 3PW7A 1FA0A 1RKIA 3SSRA 1IWGA 2B9YA 4ER8A 4WYWA 2LDIA 4IOAQ 4RW8A 3FRZA 4CT8A 1IKVB 3VGSA 2OFHX 2JHEA 2P6SA 3KLIB 1UETA 3RRHA 4Y34A 4QIFA 2HHSA 3BKUA 1OJ4A 2ZM6F 4DV1J 2QL5B 2B3TB 4HI1A 3MM7B 4PWUA 3JAMU 1FRKA 5K8NA 4FF1A 4ZVPB 4YFUA 3D9BA 2VG6B 2CFXA 1H6KX 3EVMA 4WF9Q 2KHCA 1RDRA 2W8LA 2W9BB 3RZAA 3AA9A 1CPZA 1RAEB 2WZ1A 4DSJA 2UXCF 3R1LA 2R2TA 2ASDA 2BX6A 3IO1A 5CA5A 4Y0FA 2KG0A 2NPIA 1U1NA 4UOCA 4DX6A 2JWNA 4LQ9A 4YS2A 3L09A 5CZXA 4ETZA 1JLEB 1Y3KA 2AJ0A 4GVBA 5DM6Q 3J7YU 2GAHC 5DQIA 4XAKA 4YY3F 2AGQA 3CO9A 5HJYA 3LTOA 1WTBA 4CO4A 3RB4A 1URNA 1M5VC 2KB2A 3IM9A 4KFBA 5HL7Q 1RBOB 1HHQA 1WJ9A 2E7VA 3DLBA 3FEXB 3BN4A 1TL5A 3BS9A 3NGSA 1B3TA 1UFLA 4HTJA 2OEKA 4OV1A 2M52A 2FVSA 4LF9F 2ZH8A 4NL5A 5K14A 3MFHA 2BE2A 2AZ1A 4TU9A 4UUXA 1RTHB 2DNZA 2D3UA 2OH2A 2BA9A 3PIPQ 4OQJA 3BH7B 5F8NA 3DKDA 2QN6B 1SV5A 3KHHA 2V2KA 1TKXB 2MTLA 2OFGX 2DY1A 3UCZP 3ENAA 2XCPA 1XMQF 1F2HA 4B9MA 4M5LA 4OLPA 1JJ2R 2L48A 3EPIA 2DNMA 3FVYA 3D1HA 3QWUA 2KJWA 1JLAA 4BCAA 3Q24A 4JV5F 2VG7A 4HI2A 2R7TA 1N34F 2JC1A 5D4PA 2HNDB 1V5VA 1RWUA 1M90T 2E5LF 3QJLA 2UVVA 4P73A 2R7OA 3HVRA 3JYTB 1A0OB 1BQMB 1Q1KA 2DJWA 3J7Z5 3TUZC 1FRLA 5A8RB 3DOMB 2QA2A 3UDLA 4FKXA 3BGOP 1KFSA 2KTQA 2P9GA 4K4TA 2AJFE 2PEBA 2YKPA 2CPIA 3POTB 2FZCB 2K3IA 1S7HA 4B3RJ 4MT1A 4LF4J 2Y8YA 3GIRA 4RBVA 1S9GB 3KK3A 1YKWA 3LALA 3O1LA 5DRKA 1IWAA 2CQCA 4LR9A 4B3OA 3V4IA 2NS1B 3C66A 3OT9A 1HYSA 3E01A 4YEAA 3CIMA 4IG3B 4E98A 3I56S 4PXCA 3C8YA 5KFJA 4CTAB 1FTRA 2GNKA 1N54B 5HVFA 2MKIA 3MAHA 3UQSA 3FCWA 2I2YA 4OZ2A 1HW9A 4TLRA 2C2OB 2DGQA 4DSEA 4LF8J 3OTCA 4PG4A 2CAJA 5M2RA 3NNAA 1T3NA 2YPZA 1J2VA 4P52A 5CYJA 2UUAF 1WOOA 4KGKA 1WC1A 5CYQA 5I3QA 1N56A 1Y9OA 1Q8KA 2EBGA 2CPZA 1PBUA 4QCLA 5EHHA 2D3O1 1R6YA 1JXEA 1IR0A 3VHQA 2VPWB 1XJWB 2MKCA 2BQUA 4U9RA 4QJVA 3NG8A 2L08A 2Q1LA 3L7PA 4XPCA 1NPKA 2BQRA 3KK1A 3FUYA 2KYXA 2RD5C 4N76A 3VAKA 5IOLA 1WNEA 4ZPVR 2NXNA 1JNZB 1RAIB 4KT0C 1PYOB 4JI0J 3OQ2A 1G6BA 5B0BA 1E6VA 3UWTA 3CDWA 2AJ1A 3R1HA 1CSJA 3NGDA 2ZC4A 1NHKL 1X4EA 3ISND 2NYHA 2LQ5A 4KH1B 5F8JA 3PW4A 2DVIA 2HHUA 2ZBRA 3PJXA 3W9IA 1DHMA 3PHTA 1WELA 3B82A 1CLFA 1HPZA 1TKZB 1QAYA 3CCUS 1JIHA 4JI7J 3BSNA 5EWEA 1P9YA 5T7LA 1WORA 2IVMA 1T9TA 2A18A 2XZDB 3PEHA 1RT3A 2V67A 1JJCB 1XBWA 2QV6A 3J81U 2HWIA 1EIYB 4OMFG 1TFWA 3VVUA 5B0DA 5F8HA 1RHJB 3TW0A 3OVSA 4YR3A 4NLUA 4UOFA 1T05B 3GJQB 4LFCF 2KT3A 3IBCB 4CLPA 1RWWB 3T5JA 3DM2A 4OYMA 2HPUA 2R4FA 4KGMA 2JJ4D 1L3KA 4KPYA 3IG1B 3OUYA 1M5OC 3RU0A 1NK8A 3CJKA 1Q8IA 2CDRB 2MPUA 2M7SA 3AQOA 1WSRA 2DHSA 4ZJOA 3R2CJ 2DHGA 1VRUA 2A0FB 5KFAA 2DNOA 1L3TA 2Y1LB 4X4TA 4F4XA 1OQ6A 4PG6A 2MZJA 4JOUA 4WFAQ 5D3GA 1JQGA 4LREA 1RU2A 4U7CA 3CF5Q 1Y10A 2HGMA 2V63A 3HHEA 3I0SB 1MSWD 5KFEA 2XC9A 3QAEA 2H65B 4LRFA 3MUTP 3P5TL 1S6QB 3TAQA 2GJIA 1JLCA 5DGBA 2QJ3A 2W7PA 1TMMA 1F3FA 1ZZNA 3JSMB 2XYGB 2XNQA 4B3TJ 1FJGF 3Q8SB 4C0OC 3HHKA 4CLKA 2W7AA 1AYEA 1OYEA 4NEYA 2RDDA 3OTBA 1SQEA 2RRNA 4OHWA 1R7IA 1JK9B 2HFOA 4TYAA 1BQXA 1F9EB 4KJIA 2QLXA 4J9QA 4IH5A 4CO0A 1PO6A 4OYBA 2BKNA 3I87A 2LQ8A 2RF2B 2RHQB 3QGPA 4EBEA 2MQMA 2MQLA 2UZAA 3S8SA 5KFCA 4MKVA 1KKHA 3UD4P 5B7WA 1S5ZA 2YNIB 4Q2LA 4MKAA 3OW2R 4F02A 3DMJB 4WZMA 4GO7X 4O0IA 5M2UA 4UTGA 2M70A 3WHIA 1U45A 4LSLA 4URGA 2FVPA 4O3SA 5IQ6A 2R7SA 2J0WA 3VQSA 4DR2J 5HK4A 2HBYB 4LFAF 1K0VA 1FDBA 2WTFA 4J7CA 4EU0A 4OZLA 4I6AA 3SBMA 3QYYA 5C25B 2L3MA 1KHWA 3KMSA 1SC3B 4JI4J 2XMMA 1CQMA 1F9HA 5J1EA 3G86A 3CWJA 2AQ4A 2GVZA 1HNXF 2J8AA 1GMWA 1RTIA 4NE9C 2VFSA 2ZD1B 5D6GA 3T5LA 3KLFA 3OLAA 2G0CA 3KJVB 4U7UK 1WOPA 2B5JB 4I6YA 2D3ZA 3QRPA 3MMCA 3DN9A 1RQ0A 1FJEB 5CYMB 2K8GA 4CLSA 2HNYA 1HR0J 4OX9F 4IDKA 2QZ8A 2PMHA 4IH6A 3D6FB 1M5PC 3M8QA 4GKKF 3CMAS 3NCPA 3C6UA 5A2QU 2UVRA 2HEKA 1JKHA 5KFHA 2RE1A 2FGCA 2Y0BB 1U0HA 1AXQA 3DLKB 1V3ZA 3T9NA 2HNZB 2HVHA 2HGNA 1IBMF 3CMQA 2E7WA 2B7BB 4F8RA 4ICLB 2DEJA 1S6PB 5LMUF 1K0TA 1TKTA 3G2XA 4F2SA 4YHHJ 4DL5A 1J27A 1FRHA 2CJKA 3DXSX 2ZDPA 4WKRA 1RAAB 2NXEA 1FNOA 3H25A 2J6SA 5A8KA 2KXNB 3HHLD 1AUDA 7FDRA 1SH3A 2ZJPQ 3PYFA 3GR0A 1RT6B 4JUZA 5U47A 3K5LA 3PX6A 4CH7A 2Z57B 2B0GA 1VCTA 2IRXA 4M5KA 3KLGB 3ZNJ1 4DQRA 4C0BA 1C0TA 1LXJA 5D0HA 2VV5A 1ZM2A 3TNVA 1AW0A 4QU6A 1RT4B 1FJCA 1U2FA 3R6GB 5KTQA 4RW6A 3KHRA 4Y2AA 4OYAA 2R7VA 3GE9A 1DTQB 1LW2A 3ETMA 2Y1JA 1CULB 2OGUA 4OI0A 4J9OA 4C8LA 3TEGA 2ROGA 2FIUA 2XB2D 3IP0A 4LFBJ 1N48A 1EP4A 1BUXA 3B4DA 1VQLS 4DR3J 2HZVA 4TQSA 1LNQA 1NSAA 3ZZ0A 5AJ3F 1Q78A 3PCOB 4F3OA 4RW4A 4HT5A 2YNHB 5DZ6A 1VQSA 3R5BA 1K9MT 2AEMA 3H98A 4OX7A 1HBOA 4OZ3A 3DFEA 3SYZA 3VVTA 4ZN1A 4EBCA 1RAHB 1LWFB 4J9MA 1VQ4S 3FGVA 4J9SA 4NMXA 2FDNA 5AE1A 2XMWA 2FJAB 4TQRA 2HHVA 3AJDA 4L3KA 4OI3A 3TWZA 4JYAF 2AU0A 3H2VE 1S9FA 3JB9k 2P9EA 3FFIA 3LAKA 3U27A 2ZKTA 5FIIA 2OTLS 5ETLA 5KFSA 4OHVA 4Y3CA 1K8AT 4J91A 2KT2A 1X5TA 3IAM9 1Z2ZA 4R5PA 4GO5X 1T94A 1P1LA 2VC0A 1QTMA 3ILOA 3M6XA 1Q53A 3CD0A 2L9DA 3O44A 4DFMA 4D3GA 2R2UA 3IRXB 3RJMB 2XZWA 2IYIA 4Y2CA 4LBPA 2HBZB 5LOQA 2QFJA 4LRBA 1WG5A 4TKTA 4ECXA 3NOCA 3M2VB 2V50A 1X5PA 2UV8G 4K2JA 2CPYA 4ZIWA 5GMKa 4K4UA 3I0RB 1S0OA 4CM2A 5DETA 1JX4A 2LDYA 1XEZA 1ACMB 2EXUA 3J81j 2Y3YA 1JJ4A 4NX9A 1CS4A 3AXMA 2CJQA 3M32B 3L7OA 2FC8A 3TVYA 3M8WA 2C2EA 3C3LA 1XNQJ 4L75A 2JFDA 1CJVA 2B9WA 4WCEQ 4DR5J 2ZH5A 1YJNS 4WU3A 2O67A 2Z58B 3ZTPA 5D4OA 4PG5A 3UNYA 4Q8FA 1Y7PA 2YKMA 3QGHA 2CYYA 2KT5A 3GCWP 2AMCB 2KFYA 4B3SF 3AJ2A 4RW8B 2B56A 1RT2A 3B6BA 2IMWP 1UVLA 4U8VA 1FKPA 5EN1A 3UFCX 4DQSA 2B4UA 1FD8A 3RW7A 1J5EF 3P96A 3OL7A 4CI0B 5L1JA 2HKEA 2MQOA 2GS8A 2DNPA 1RK8A 2C2ZB 3ZZPA 2E66A 1LOUA 1V9OA 4E2FB 2RRBA 4MIAA 4ZIVA 4RO0A 1FCAA 2WONA 3MOJB 4OYPA 2E1AA 4WFYA 2IAJA 1O5JA 2K1RA 1R8PA 4JI8J 1OY6A 3T1YJ 1V5IB 2BANA 4O44A 3NNHA 4OZ1A 2HHHF 3E3XA 2UXDF 2FY1A 4GVBB 4NA3A 3I82A 4CH0S 2D7SA 3HD2A 4USIA 2DHAA 1VMBA 3SZ2A 4KFBB 2N3LA 1U1RA 2EG2A 4N77A 2H54B 5D15A 2KZZA 2WVDA 5E41A 2DNGA 3EYZA 3NNCA 5HANA 4OJ3A 1S0VA 4KGZB 1SJ1A 4MYUA 5K14B 2BE2B 3GYGA 2MKKA 4UT4A 2RH3A 2MZSA 4QIEA 4RUHA 4PZVA 3MM9A 3W62A 1YRTA 1OSCA 1SV5B 2HFNA 2LYVA 3LGMA 1FESA 5KFOA 4ELUA 1QSSA 4DR6F 1NSKL 2V6AA 4CO3A 1RT7A 4USJC 4M94A 1QVGR 3PR5B 1D09B 1RA7A 5AXMA 4GC6A 1RI7A 2EKNA 1EARA 4ERDA 3QIPA 1JLAB 5GAGU 2ZHBA 4RKUC 2X1GA 5DO2A 2ZH2A 3DLHA
chains in the Genus database with same CATH topology
1FK9A 2VG7B 3ZZTA 2IC3A 3CJ3A 3F41A 3UR0A 2XS2A 2KYZA 2VUGA 3R5AA 4Y00A 2JL9A 2RQMA 2P9CA 3AB2B 2ZD1A 4OI2A 4EO6A 5DDRC 2ADBA 4C98A 3DOLA 4LMZA 2QT7A 3ZZZA 4K5SA 4N47A 1GX5A 4F4KA 3KJVA 1OS5A 2LMIA 2RQ4A 2B5JA 3BSAA 2CQ1A 2ZUGA 3M8RA 3CCSS 2C2DA 1HMVA 5HMYA 1HBUB 2CQDA 5B0GA 3MEDA 3TRGA 2JVRA 5J2MA 3J7YI 1HWJA 4EZ6A 2LLZA 1O0PA 3JTOA 3OFEA 5CYMA 4X64F 3S6EA 1C0UA 2C3PA 4K5RA 2GFFA 3IS9A 2IMOA 1R3NA 2MKSA 1R43A 4ZCKA 1ZH5A 1RTJA 2IFXA 1GXLA 4Y6IA 1NEEA 5KFKA 2I5JA 2CVIA 3K5MA 3LP0B 4YB6A 2X3GA 4I1TA 4JI1F 1YJVA 3BN7A 2Z2MA 2FJWA 4EZ9A 1RA6A 4LIRA 4TN2A 1GTEA 1VQMS 4X4UA 3J7A1 2E5IA 1L3SA 1VQ8S 1EETA 1WEYA 4PWDA 4NLDA 3I4HX 1D3WA 1L3VA 4I4BA 1TL1B 1MMLA 4OI1A 3GIKA 2R7XA 1VRTB 3TA1A 1Q8BA 3DLKA 4N56A 3CCMS 2HLUA 4IOCQ 2HNZA 1TV6B 2VPYB 4A46A 4PG7A 4L6V3 4X65F 2MZTA 3IA0A 2WSFC 2AD9A 3UNGC 2R2RA 2ZH4A 3PX4A 3OLBA 2PA8D 2Y0SD 5E3PA 2NQPA 4IO9Q 3V81A 1P6TA 3L95X 3MM6B 3HHDA 3OHBA 4ICLA 4DFKA 1YJWS 1S6PA 2RVJA 4GC7A 2J9DA 4NLSA 4EYHB 3IBWA 2NZ4A 3KK3B 3B4MA 3TVZA 2C2RA 4XPEA 1NJXA 2DR5A 2GMJA 2N4CA 4TY8B 1UA1A 3HI9A 4RW9A 2XS5A 2UXBF 4Y2KA 3BGFA 4QWDA 1WI6A 4C2MA 1YI2S 4IKAA 1F0XA 4FS1A 2I1RA 3MAQA 3LF0A 1SIWB 3PV8A 1Q79A 3MD3A 3OV7A 1TQLA 3UE2A 4B3OB 2E9ZA 3V4IB 3M6VA 2MQNA 5E3CA 4JI8F 3NP5A 5LJ3Y 2AGOA 1JNRB 4NYZA 2RKIA 1RISA 1D1UA 3KFWX 4B9UA 4IQXA 3SMZA 1HYSB 3E01B 4B17A 1S6UA 3T1YF 1QAJA 4DG1A 3KLVA 1UVNA 2KU7A 3OXLA 3SSSA 5LSRA 4DPOA 4RNNA 3HM9A 3DLEB 2YNFB 2FVQA 1LKZA 3N01A 3RAQA 2YKQA 3GFYA 2BVZA 3DDKA 3D2WA 2WSCC 1U1PA 2LEPA 2J6UA 3L3CA 1X4HA 1ZETA 2E29A 2LVWA 1N36F 2NUUG 3CJ5A 2JEIA 4NWBA 5AE2A 2M9KA 1KVIA 2CJAA 3GMGA 4DL2A 1RT6A 4OL8A 3RBDA 4DL6A 1TFYA 3H40A 4E8UA 5KT7A 2J76E 4K4SA 2QE5A 2ASLA 1Z4UA 4ZHRA 3I5AA 4CCHA 1M5SA 4DR7F 3QLHA 1SJ3P 1RT1A 1XWLA 3FCHA 3KLGA 1S4FA 2F8EX 1LW0B 2BRLA 4DLEA 1IUJA 1S10A 1SL0A 4DBQA 3FEYB 5KAKA 4HTIA 2FHOB 2FUG9 4O3PA 4M8LA 2FB0A 3QGIA 1V3SA 3K5PA 1URRA 3EX7B 2G9OA 3LP1B 1HQUB 1BLUA 1YJ9S 3NLCA 2M88A 3H5SA 4C8OA 2AYEA 2NLWA 2BACA 3HX9A 5THWA 5C24A 1P9QC 2NUHA 3MEGB 1MMNA 2FVRA 4ED6A 3GB0A 1ZZFA 2GX8A 3Q0AA 1YBAA 5L1KA 3V6DA 1JMTA 1S9EA 4MIWA 1WHYA 4IFVB 4OZJA 5CYQB 1N4LA 1KN6A 1VGYA 3NBPA 3SSQA 3K0JA 1RT4A 4DV7F 1Y5IB 4BBYA 2XO7A 5F3TA 2NR0A 3IWXA 3RAXA 1LWEA 1FE0A 4G1QB 3MD1A 3GV7B 2OMLA 2BYCA 3ENQA 1LFPA 5LL6d 3DRXA 4OLOA 4KC5A 5F8LA 2HYIB 4HEA9 3V6JA 1HW8A 1DTQA 1GXTA 2KDOA 1C1CB 3HVTB 2C3UA 4ZCIA 2NPFA 1RYRA 5JJBA 1YJUA 2MJNA 5DJBA 2ZC3A 1DQ9A 5MLCV 2E1CA 4X4VA 3DI6A 5J2QB 2R8IA 2HMIB 3P49B 2D41A 2ASYA 2F7VA 2MZRA 3LO3A 3BF4A 2JVOA 3KK1B 4DSIA 2IA0A 3MPVA 3QO9B 2J0SD 2MHEA 4H4MA 2QSFA 3M6UA 3QGGA 3W3SA 3BSOA 5D77A 4QWEA 1HNZF 1H2UX 4HH1A 1ZAWA 3BQ1A 3E51A 4K59A 2XSJA 1Q16B 1YVFA 2O3DA 3V2UC 4DFJA 3FSYA 3AB4B 3KWMA 2DR9A 4WZQA 4KHRA 2VH7A 5A6PA 2A3JA 5J2NB 3M9NB 1W2BR 4Q0BA 3CVKA 1E6VB 1TL3B 1R8HA 4LT6A 2XGQA 2DPJA 2NSCA 2DNLA 4F3QA 5IT9Y 1NO8A 1OIAA 2W24A 4ECTA 5HP1A 4RNMA 1V6HA 2Y1RI 1JLFB 3QZ8A 3Q23A 2F1FA 1H0HB 5G4DA 3I55S 3WC0A 4ED5A 3DYAA 3BDEA 3AAWB 3N6NA 4Y28C 4NLXA 3MPYA 1L3UA 2YY3A 2LCWA 2YNHA 4ATNA 2FHJA 1XK8A 4EBDA 4HKQA 2D3OR 1RYSA 2W8KA 5G0RB 4WFXA 1B64A 1VBZA 1NK5A 1G7CB 5DG9A 2QA1A 1N5SA 1VQPS 1ZYQA 4Y2MA 4KO0A 4DOZA 5BYQA 3I5BA 3UW1A 3ENVA 5KG7A 1SKRA 1IBLF 1A7GE 2Z4PA 2B6AB 4WXWA 4YB7A 5KFIA 4PPDA 4YOEA 3EGWB 3LUYA 2DHXA 3RB3A 4NZ7A 5HBMA 3TP2A 5J2PA 3TO8A 4IRDA 2Y1IA 5KFWA 2IHR1 2EBEA 4ECWA 1F2GA 1QUPA 1MROB 3NKYA 4DUZF 4ILRA 3MOZA 1NJYA 5K8OA 3WBZA 3OSNA 3LW5C 1UEUA 3R27A 5CH7B 2KI2A 4F4ZA 1WG4A 4NZ0A 4JI6F 1XMBA 3OVAA 2AX1A 5IQQA 4YR0A 4OHZA 4LF7F 4Q45A 3MMAB 1HPZB 1TP7A 2ZOGA 3ITHA 1IKXB 4R0JA 3VAJA 2Z2LA 5IXUA 3I4PA 5DDOC 4N41A 1J5OB 5T7LB 1TUVA 3MF5A 4QIGA 3FMBA 4J9KA 1IBKF 4Z37A 3MFIA 2E9RX 1LWFA 1VQ7S 4MKYA 5CD4H 1X9SA 5BJRA 1D8YA 2FJBB 3MGJA 1UA0A 2OKQA 4NMLA 1FKOA 1RT3B 1UVJA 4TU8A 2HS3A 1D9AA 4Y2IA 1YGYA 1ZTTA 3NMAA 2MKHA 4JI5F 4IR1A 2O5DA 3MEEB 3S7RA 4DV3F 2ZZMA 4K4VA 5HMZA 2WSEC 2CPXA 4DL7A 5L1LA 5A0YB 5EX3A 1YTYA 2UP1A 1Q8LA 2O01C 4I0WA 4WE1B 4WFBQ 1U1OA 4QU7A 1DBDA 3ZZYA 2KHDA 2IRYA 2RRAA 1X0FA 4B9SA 2PC6A 3CD6S 1AFJA 4HDHA 2LU2A 2DK2A 5L8RC 3MI7X 4RBUA 4QPXA 1GNKA 4PQUB 3GZ7A 1CEZA 4KSEB 2N82B 2PSZA 4YB5A 4IUFA 1XR7A 3SFGA 4RZRA 2PO4A 3DNCA 2JH3A 1S1XA 1S1WB 4ID5B 2HRYA 2LECA 2RU3A 4Q44A 1F5AA 3DM2B 4O4RA 5E0OA 3D0GE 4DJBA 2DB1A 4R0EA 4DS4A 2E5JA 3VQTA 2CQHA 2DGTA 5EWFA 1LWCB 4P7VA 1N5QA 3OUYB 1UFWA 2GW8A 3JSRA 3PZPA 5EWGA 3EGZA 6FD1A 4O3NA 2XMKA 3CJKB 1NK0A 4K4ZA 2DD8S 2M4MA 3JAMY 4A8OA 3IRXA 3SXLA 3RR7A 2DTJA 3HLUA 3MXHP 4O23A 1LXNA 1VRUB 5A8WB 1F9FA 2OPRA 4C7QA 1OQ3A 3G9CA 2GQCA 3DRPA 4X66F 3CJ4A 4M5DA 2OAUA 1JJHA 3TA2A 3IGVA 1PGZA 1T03B 2V9KA 1WHVA 3CCRS 5D3GB 4FF3A 3M2VA 1S79A 2YH0A 4QIVA 5B0AA 1N5YA 1KS2A 4F3MA 2CPFA 1X4CA 2MMYA 5F0UA 5LMNF 2HVIA 1S1UA 3DC2A 4H54A 3SCLE 4B3MF 1NRKA 4HL9A 1DJ0A 3H5UA 3NS6A 4I7FB 3KTQA 4B02A 1E6YA 3I0RA 3NCQA 3DU6A 4J9LA 3LWMA 2CPDA 2DRAA 3K2YA 2B4VA 1B0TA 4FVCA 5EGYA 2AX0A 2JEGA 2EC0A 2YKAA 4XO0A 3N5FA 2I8EA 1KLNA 3BGUA 3CCVS 3PW5A 4QQBA 1SXLA 4FYDA 1UMJA 2E1RA 4CO1A 2L9NA 3PIOQ 4KRWA 1C1BA 2DIUA 1XTZA 1Y4ZB 1JLCB 3M6WA 3QPIA 5B0FA 2IVFB 5F41A 2GO8A 3TOQA 2AP6A 5I3UB 1G1XA 4B9VA 3HZEA 3GYXB 2YX7A 6FDRA 4DS5A 5CCMA 2LKZA 3K8WA 3M32A 2XI2A 5IFMA 5GAEU 3FSIA 2ZJQQ 5L39A 2XGPA 1VQ9S 2ZNZA 2YNGA 1DARA 2M5YA 4AYBD 2RQCA 1UJ4A 2YKNA 2GV1A 3DRRA 3VAHA 4I2QA 1VJWA 2ILYA 2F9JA 1SH0A 3HXMA 5E3RA 2HVZA 2OPQA 3IN5A 1S97A 3KLEA 4QR2A 1ZBTA 2IBKA 1IJFB 3BJYA 4KKOB 4LVNP 5KT5A 1UEVA 4C4WA 4K4XA 3MZIA 3I9ZA 1T8EA 3BZQA 3KG4A 3H4BA 5T14A 1KQKA 3I5CA 2CJBA 1W2IA 4OIXA 3W2VB 5IM0A 5I42A 2G13A 3PW7A 1FA0A 1RKIA 3SSRA 1R0AA 2AYGA 2AWZA 5HLFA 1SB6A 5GADU 2B9YA 1S1TA 4WYWA 2UVWA 2LDIA 4IOAQ 2FHMA 4RW8A 3FRZA 4CT8A 4PG8A 4AE5A 1IKVB 2OFHX 2JHEA 2ZDOA 4M63A 1CVJA 2P6SA 3KLIB 3MEKA 1UETA 1KEKA 3RRHA 3PW0A 2Z8QA 3PX0A 2MY7A 5B0EA 2AYBA 2GMLA 1FXDA 4Y34A 2JLGA 4QIFA 3KOAA 3CTRA 3HKZD 5DQHA 1QM9A 2HHSA 4QWBA 4J37A 2ZM6F 1DAXA 1H7WA 5SZTA 4RU2A 2JSXA 3KKFA 3ZC4A 1U1MA 2B3TB 3VZHA 4HI1A 1DLOA 2W9AA 3FRYA 3MM7B 4RNHA 4ECQA 4PWUA 1KNZA 2KFZA 2R2SA 1FRKA 5K8NA 4FF1A 5KFLA 3PACA 4YFUA 3N79A 3SCJE 1K73T 1HBMB 1HNIB 2DH9A 3CCES 4IG0B 1GT8A 3T9ZA 1FNMA 3B8HA 1PSDA 1VBXA 4Q7AA 4ZPCA 1FJ7A 4OHYA 2VG6B 5GAEI 2CFXA 1H6KX 2MKJA 4WF9Q 1BQNA 1HNVB 1NK9A 4NLGA 3DU5A 3QZ7A 3TX8A 4WXOA 1UAWA 2KHCA 1RDRA 4TNOA 2IVYA 4LSLB 4CZCA 2J9DE 2ZKUA 2XCAA 2W8LA 1F5BA 2LA4A 1L5UA 1N5VA 2GQQA 3O3LA 3M8PA 3CJ0A 2W9BB 3G8TA 5KFVA 3RZAA 2R8HA 4F67A 3AA9A 2WBRA 3PHEA 1CPZA 5LSOA 2CPHA 4PUOB 2OJ3A 1QUVA 2QIFA 4J5OA 3RRKA 4DSJA 3MR5A 3U1NA 2UXCF 2M3DA 2GGPB 2DR7A 4RWWA 2XMUA 1U47A 3DCAA 2OPPA 3M1VA 2MGZA 5IWAF 2HRUA 3R1LA 4FXVA 4WKYA 2R2TA 2ASDA 3IO1A 3HJFA 1VQ6S 1HBNA 2GMHA 4XDCA 3HT3A 3SDEA 2DNKA 5CA5A 1QE1A 3O2IA 4FP9A 4Y0FA 2EK6A 2KG0A 5D4LA 1FO1A 3LP2B 1FVQA 2NPIA 2N3OA 1U1NA 4UOCA 3OFHA 5ADZA 3EUNA 1FF2A 4K50A 2JWNA 4WK1A 1MWZA 3FJ2A 4LQ9A 2PDAA 1FNXH 3TA0A 1X4GA 2JX2A 1S48A 3L09A 5CZXA 1QSYA 5KFQA 3N28A 5J1EB 2J7WA 4DL3A 2F8HA 4ETZA 2DPIA 4BDPA 1CC8A 2DNQA 1JLEB 4ZVHA 1Y3KA 2CDQA 2AJ0A 1Q81T 4AXJA