1URRA

A novel drosophila melanogaster acylphosphatase (acpdro2)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
VAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CG18505 PROTEIN
publication title Three-Dimensional Structural Characterization of a Novel Drosophila Melanogaster Acylphosphatase
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 97
sequence length 97
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1urrA00
2W4DA 3UDCA 1WD6A 2HFOA 4Y2MA 1APSA 1JK9B 3KG0A 1ULRA 2G9OA 3QGPA 2PGCA 5B0FA 4DL0C 4Y2IA 1X0PA 1YJVA 2HQIA 5KAKA 4Q2LA 1U7LA 4HI2A 2W4PA 2RMLA 2HLTA 3E8OA 2FIUA 1Y9OA 2EW9A 1V3ZA 2ROPA 3TOQA 1X8DA 2ROEA 2ZDPA 3HFKA 1YG0A 2FTRA 2ROGA 4YDXA 5B0AA 3KNGA 3HHLC 1N5VA 1TL4A 2OFHX 2RSQA 1GXUA 2OD4A 1YJRA 2RILA 1FVSA 3QMQA 2GV1A 2L3MA 2N4DA 5B0EA 2LDIA 5B0BA 1Q8BA 2K1RB 3HHLD 3K7RA 2KYZA 3WDOA 4HH1A 1K0VA 1YRXA 1RJJA 4NPOA 4OIXA 2K1RA 2BJDA 2OAUA 2QYCA 2XMTA 3BN7A 1Q53A 2GGPB 3TNVA 1Y3JA 1S6OA 3BGUA 1AFJA 2OKQA 3LO3A 2FHMA 5T7LB 1OPZA 2GFFA 2OFGX 2HLUA 4ZA1A 2HFNA 1FD8A 2GGPA 1OQ6A 1R6YA 2Q3PA 1XBWA 3FRYA 1FEEA 4EFAC 4ZOSA 4NL5A 1CC7A 1TR0A 2GO8A 3BM7A 4FNHA 2XMVA 1VQSA 3LGNA 3BF4A 2JDJA 1YJUA 2W4CA 4F67A 5B0DA 2N4CA 2BBEA 2LXFA 2N7YA 1X7VA 2XMUA 3MZIA 5A6WA 4DN9A 5B0CA 2K7KA 1P6TA 2BYCA 3BDEA 5B08A 1GXTA 1MWZA 3FMBA 1P8GA 3LGMA 1SB6A 2KKHA 2XMWA 3T9NA 3GZ7A 3DCAA 5B09A 1OSDA 1IUJA 1S6UA 1TL5A 1FE4A 3FGVA 1N5SA 1KVIA 1SI9A 1KVJA 4A47A 2LQ9A 2OP5A 3BR8A 3DXSX 2HIQA 2XMKA 4DPOA 3MCSA 2RU9A 4OJHA 2LQBA 1N5TA 2IYGA 4OJGA 3IWXA 4HI1A 4Q2MA 4A48A 5A6PA 1MWYA 4YEAA 3F44A 4QOTA 5IXUA 1JWWA 2QLXA 3I9ZA 2KT3A 5T7LA 3CJKB 1AW0A 4U9RA 4HL9A 1OQ3A 1SQEA 2KT2A 2PD1A 3CJKA 4OJ3A 3BB5A 4A46A 1QUPA 4HH0A 2ZDOA 2AW0A 2OMOA 1FESA 3HHLB 4FNIA 3VTIA 2K7JA 1FVQA 3IWLA 3KKFA 1YJTA 2OD6A 1Q4RA 1URRA 2GCFA 5F0WA 4A4JA 2GA7A 1N5QA 3HHLA 2AP6A 5K9FA 1TZ0A 2AJ0A 2VV5A 3HDSA 1Q8LA 3TRGA 1CC8A 4Y2KA 3KG1A 1KQKA 1VQYA 2CRLA 2K2PA 1AFIA 2IFXA 1LQ9A 2FB0A 2BUNA 3HF5A 1TUVA 2AJ1A 1Y3KA 4OJ1A 2QLWA 2VH7A 2XMMA 5F0UA 3HX9A 2XMJA 5B0GA 2ASYA 2ACYA 1FE0A 2QIFA 2IYIA 1W2IA 1Y0HA 2BJEA 1CPZA
chains in the Genus database with same CATH superfamily
1EQ0A 3MEDB 3SV3A 3GIIA 2QMWA 4DV2J 4KB7A 4KT0C 1DBDA 2C3OA 3DDNA 4F25A 3D3CJ 4OYAA 3QJLA 4KH1B 3RW7A 3OD2A 1U2FA 2PI5A 4ZKAA 2YNIA 1UW9A 2HBYB 2LECA 3FRYA 5SUHA 3KNAA 2BKNA 2B4PA 2ZKTA 1FNMA 5HBMB 3H59A 3RG6A 1S9GB 2L08A 4NMLA 1V5VA 1Q0NA 1RBOB 2QRRA 3EICA 1ZZNA 4ZPCA 4FS1A 2EG1A 3HHLB 5HN0A 5ETPA 5KFIA 4NI2B 4ZLLA 2FGCA 3VF0B 4CLSA 2XYHB 1VBYA 5HP1B 2K2PA 4KHPF 1WI8A 4BWJA 2WK4A 2HWIA 1NK8A 4J9MA 2AJ1A 4ER8A 3NGDA 4P74A 5IWAF 1YDLA 3QGPA 4O3PA 2MSSA 3T9ZA 1U7LA 1WC6A 2D3ZA 3ET6B 3D7SB 2MHEA 2LXIA 4NLGA 4EEYA 1HNIA 2IRXA 3M7VA 5CA5A 2BR0A 3KDOA 4ECRA 1LWFB 4U8VA 5J1NA 1JLQB 3HHLD 2YWGA 1LW0B 3CJSA 1RB0A 3RUBL 1OY9A 2BM0A 4DN9A 2Z2MA 1VCTA 2YKMA 4DF8A 2AMCB 3A12A 2K3IA 2B7CB 1LV5A 1IBCB 4PAAA 2QSWA 4DV1J 2AX0A 1KQFB 4GO7X 1VBXA 3CMAS 4FN5A 1V5IB 3R1LA 2DH8A 4KE5A 1S1UA 2DEJA 2DNQA 3DOMA 4DSLA 2QL7B 2DK2A 1CQNA 1S1VA 1U47A 3C15B 3KKFA 1IN0A 1URRA 3SZ2A 4EBEA 1MNEA 2XNRA 3D0IE 1FDNA 1TAQA 5F8MA 2CQDA 3O3LA 2G13A 4NZ7A 4IFVB 5EWGA 2Z2YB 4J9UE 2B51A 1FRIA 3TYTA 3W9JA 5KFGA 4DDFA 4WYWA 3TJAA 4CP5A 1JLFA 4CT8A 2ALZA 1TL4A 2VG6A 2XULA 4ZVPB 3DFEA 3V6HA 3LP2A 3D3BJ 1C1CB 2VKZG 4P7TA 2APOA 1VQ7S 2FGOA 1WSRA 2CQ3A 2YNHA 3GG1A 1J5OB 3GYXB 4M5JA 2A0FB 3TAPA 4LVNP 3GP9A 3DLGA 2VOOA 1N6QA 2XS2A 1T9YA 1H73A 3DLLQ 2YPYA 4C97A 2WB4A 1Q8LA 3IBCB 3KUGA 1CC8A 1H2UX 3OR1B 3KHRA 1R43A 2FB0A 4HLBA 2LQ8A 1NK5A 5LM7E 4CLFA 5F0UA 2EC2A 3PX4A 1PC4A 1IBMF 4KJIA 1Q8KA 1CEZA 1TP7A 4ZVUB 1WDTA 2F63A 4GKKF 3KLIB 5DLGA 3M2UA 3C2PA 1U1OA 4PYAA 2MSTA 4DZDA 2FY1A 3MHYA 4DUYF 5KFOA 1SVDA 1RTIB 2HK2A 2UVVA 1FNOA 5KT2A 1XMQJ 4ES2A 1JLGB 4FNHA 1RISA 2W2MP 1T95A 4PZVA 5C42A 1G2EA 2VQEJ 4OX8A 3DGPB 3N9UC 2UUBF 3QWUA 2OPPA 5KFFA 5DG9A 1RT2B 3OL7A 4YUDA 1DQAA 3B8HA 2KFNA 3N6MA 1S1TA 1KQGB 4N76A 3TAMA 2VV5A 4AL7A 4J9KA 5E0OA 1VC5A 2DHHA 1XMOF 4XAKA 3TO8A 4DV2F 4ZHRA 1HW9A 5KOWA 3FUYA 2KG0A 2ILYA 1PAEX 2J0SD 1WHWA 3EUNA 4U7CA 3FCHA 4QR2A 1VOMA 4RNFA 4YDDB 3SQOP 3QRRA 1W2BR 2M9KA 1VLOA 3NWGA 3K58A 3VR1A 3R5CA 1RWOB 4H54A 3GCXP 3PM9A 3FNNA 3VV2B 2XG8A 1JJ2R 5L1KA 2BE9B 4R8UB 3BKFA 2WCXA 2K7KA 1UETA 4PKDB 1HNVA 3V6DA 3QLHA 2D74B 2CNOB 5HQLA 3HVRA 2ASJA 1RT1A 3AA8A 3UE2A 4A8KA 1NB7A 3ENWA 1Q79A 3RW6A 2YPZA 1TVRA 1RSCA 4OJ3A 2CNKB 2ZNZA 2GCFA 1N5QA 3HVTA 4NXNF 3OL8A 4DL5A 1F3FA 2R4FA 1S9FA 3IAM9 4TVAB 4ZVGA 4Q43A 1V3SA 2KM8C 1RWMB 2J9CA 3CO0P 2MKSA 1OYDA 2M52A 4KKOB 5HL7Q 5M2PA 4H4MB 2J0WA 1X9MA 1K47A 1YJVA 1QSLA 1T02A 1NZ8A 1U2CA 4CRJA 4R25A 1HR0J 2R2SA 2AEJA 1MMDA 3CCJS 1FTRA 5G0RA 3PW5A 4CM2A 1TQLA 3IA0A 2BJ1A 2GV1A 2LDIA 2DNOA 3FKBA 3M1VB 3DHXA 2CQPA 3BGUA 4WP9A 3GV8B 4I69A 1KLNA 1FD8A 2XM3A 3RGIA 1ICEB 2HNZA 1WKJA 4B9TA 1X5PA 1IBLF 2JWNA 3W1YC 1C1BA 2VFTA 1VQ8S 3C16A 4O23A 2Z0GA 4ECXA 1RAHB 1RTZA 3I0RB 3KK3B 3JTPA 3CPWR 1RT4A 4JV5J 2VG7B 3MMJA 4OI3A 1BUXA 2HZVA 4JI5F 1FX2A 1ZM9A 3CCMS 2MKYA 3NNCA 4RWWA 3HSZA 4DFJA 3GR0A 4LSLA 4GC6A 4NLDA 3IS9A 3WIVA 2L9DA 1S76D 3IR6B 4TQRA 4NLYA 3AJ2A 2WSCC 2I38A 3AOAA 2YNIB 3BN7A 1Z2LA 2OEJA 3SDEA 2M7SA 4Z7CA 8RUCA 4RUBA 5IQ6A 1X0FA 2IM1A 1Y7PA 2LEAA 2V2KA 3Q2TC 1U1RA 3ZTPA 4DV6J 3DXSX 2FJXA 2R42A 2ZVIA 1FDAA 1IM4A 1XK8A 1RTDB 5J1PA 2XY6A 2ATCB 4RW8A 2WSEC 4CLLA 3IWLA 4ELTA 2G4BA 5F0WA 2RRBA 4M5LA 3RB3A 2FJVA 4J7CA 4QIEA 3W7BA 3HJFA 5K5MA 2YNFA 4MYUA 2VG5A 4U8YA 1SQFA 3RB6A 3OJSA 3JXOA 1FJGF 2F9JA 1WC5A 4JI2J 3MD1A 5C24A 1HNIB 2J8AA 2ZH2A 2AF6A 1KTQA 1NJWA 1NU4A 2PFDA 1RHQB 4QWEA 3UNGC 1N4LA 2VQEF 2CWKA 1X4FA 2MQPA 3G9CA 3J80Y 4GVLA 4UTGA 2YKMB 3NLCA 2DHXA 4RJVA 4G3IA 5L9NA 2CZ4A 1FCAA 4DV3J 2GQ2A 3D1OA 1T9UA 2HVDA 4XTTA 2HIQA 2GIFA 1S1UB 3LWLA 3M8QB 3DOMB 4QIGA 1YJNS 2JX2A 4K4ZA 4NE9C 4C8OA 3LALA 3TUPA 1NMEB 1KR4A 2D9PA 3AT1B 4QWBA 3MMBA 5GAEI 3MMAA 4C48A 4IQMA 3J81j 1RHMB 3HD2A 5MLCV 1H2VZ 2BJEA 2RUGA 5C7PA 3NCQA 4MKYA 1X4GA 5CYQA 1M0SA 5J1EA 1JLFB 1SKWA 3CSKA 3HMJG 1F0XA 1UVMA 2VG6B 3J7A1 3DDKA 3LP2B 2HAIA 5KFNA 1HQUA 3ZXWA 4LF5F 1AZSA 1UVLA 1RJJA 4WK1A 3ZNJ1 3DOKA 1S6OA 2YWWA 2OKQA 1VQOS 4FVCA 3LWMA 1GX6A 5IT9Y 2C2DA 1YQHA 2YNHB 2DGSA 4ID5A 4Y0FA 1QVFR 5DDOC 4CI0B 2XZWA 4RBVA 3KK2A 1X5TA 2UUWA 3GIRA 3DLGB 1N6QB 1GTEA 1U1KA 2JHEA 3HVWA 3ADAC 1J5EJ 4LIWA 4LFAJ 4ZCKA 2ZHOA 1WG4A 1HR0F 1NK9A 3J80U 2DPIA 3MM6A 3UPFA 3VGSA 1TUVA 2QA2A 5B0GA 7FD1A 3CCSS 1JX4A 5A8RA 4DV0J 3T6JA 2DYAA 2C3YA 3G2XA 2BACA 4J9NA 1SH2A 3M2UB 3V5RA 2ROGA 4U7UD 1XNRJ 4F26A 4Y00A 4RNMA 1FERA 2QYGA 1NHVA 1YRXA 4U95A 1WNEA 4MH8A 4NYPA 3IM8A 2ADBA 4C2MA 5KFSA 2OTJS 5KG0A 4GRSA 5JJBA 5DM7Q 3W66A 2BE2A 5C42B 2KKHA 5J2QA 3MM9A 3PR5B 1SI9A 5GAHU 3BPDA 2XMKA 4DX7A 1H7WA 2OPPB 1NXIA 3Q8UA 2DO0A 1BLUA 2NQPA 2ZC4A 3R5AA 1VC6A 1S1TB 2FJEB 4WFXA 2DCUB 3TAMB 3S1TA 2YH0A 4OZJA 3KLHB 4ZHRB 2EKNA 1Q78A 2Y0BB 3KLGB 4DV5F 3N79A 5IT9U 2DY1A 2NUHA 2J6UA 4OZNA 4FKXA 2ZH3A 4OYOA 4LF7F 4O0NA 1FKOA 3SQGA 1L3SA 1D3WA 1U8SA 2ROPA 2VFSA 3A8IA 1W25A 2B9YA 2VPZB 3OXGA 5D4NA 4LF8J 2N4DA 1BC6A 4KY3A 2UZAA 3AA9A 3MWBA 4Y2CA 2ZBPA 1OY6A 4DV6F 2FHMA 3EJMA 3BEGB 5DS7A 1MN9A 1D09B 4P73A 2CPZA 1IJFB 2XZDB 3V6DB 3DLJA 1R31A 3QLHB 3T1YJ 4ZVEA 3HI9A 3OSPA 1X9WA 2W2OP 3F0NA 2OPSA 1FE4A 1TVRB 3TR5A 3OTOJ 4P9SA 4JI4J 3W9IA 3CCQS 1NM2A 4F4KA 3HVTB 3HSGA 1B0TA 3W8GA 2OD6A 1LXJA 2DCLA 4K4TA 4JI2F 1IKVB 4LF6F 1R8AA 1ZPVA 1JXVA 2VA2A 3NOCA 1S97A 2XCAA 1WACA 3BO4A 3KMQA 2VB6A 1UEKA 4C0BA 4DL6A 4DR4J 2IHR1 2MKJA 1CJKA 2MY8A 5A8WA 1ZA2B 3TA2A 2OSRA 2HBZB 3ICLA 2DGUA 1N88A 1HQEA 3WC0A 3W64A 1JKHA 1KVKA 4X4TA 2ZKUA 3HHDA 3RBDA 2HNZB 2VD3A 1R6YA 2C2MB 3DNCA 2EWHA 3BSAA 1C1BB 3BGLA 3C16B 4CTAA 2KT5A 1PAUB 3CD0A 2AT1B 1UW4A 2XO7A 3SBMA 1FFSB 2VICA 4NASA 5LOQA 4X84A 3TUJC 1SQEA 1RT4B 4DPXA 3ZZUA 1F5BA 4DBQA 4CLYA 2V94A 3F41A 2AP6A 2CJKA 4GC7A 3DU6A 4KRWA 1HHTP 3QT8A 1MG7A 1N36F 1P27B 4LRAA 2P9CA 3ZTQA 2H65B 3KYLA 4LSLB 2MQLA 2MLYA 3KG0A 2R7UA 3IS9B 1RWUA 1ULRA 3T19A 3CJ0A 4P71A 3AJDA 3OLAA 4Q7AA 1PBAA 1QAXA 4ED6A 3QT7A 4NYOA 3I5BA 4WTOB 3O2IA 1A0OB 3SDEB 4Z7YA 2HGLA 4FXWA 1FWLA 4C6AA 1D9AA 1M1KT 3R6GB 2LEBA 3LQVA 4DF4A 4KSEB 4MKBA 4OYXA 4OZ3A 3R27A 5IXUA 4X4SA 2JL9A 2QLXA 1C4AA 3JSRA 4K4WA 4RW8B 3V6JA 3ELHA 2FY8A 3D6TB 4URQU 4DV0F 2E7XA 2GAGC 4XO0A 3VVTA 2YNFB 2VG5B 4QPTA 2KHDA 5DGBA 3GIKA 5E7OB 3MOJB 4FYVB 3CMES 1CJTA 4NA2A 2WVFA 3CEDA 4DX6A 2IVMA 4MMOA 4CDIA 5C24B 3NS6A 4K5SA 4DX5A 4HI2A 3PFOA 1Q8IA 1F1BB 1WF0A 5KFYA 1RT3A 2NXNA 4CO2A 2HYIB 3IMQJ 1ZTTA 3TA1A 1YZ7A 3FBFA 1CULA 1TR0A 1WSVA 2W2QP 3M8YA 2WHOA 2G0CA 3IBWA 2P9EA 4ILRA 4I6AA 2Z57B 1BGXT 4ETXA 2OIHA 5CYMA 4C7QA 1NDCA 1U45A 2J7KA 3OHBA 5KG2A 3DRXA 3CJKA 2ASLA 1NBEB 4HH0A 2OMOA 2DB1A 1FVQA 3M6WA 5U47A 3MMBB 2AYEA 3MMAB 1UAWA 5HANA 2G1HA 2GQQA 2O3DA 3DMJA 3W61A 2XI3A 4USTA 3EGWB 3GU0A 2VQFF 5CYQB 5J1EB 4DR3F 2DT9A 3L4BC 2I8EA 5B0FA 1X0PA 2O66A 3TQEA 3HHKA 4CO3A 2BXJA 2JZ5A 2DXFA 4ZVSB 1HQUB 2J5AA 3T1YF 1AZSB 3UW1A 3Q23A 2YKPA 3DOKB 2EFQA 3CCZA 2MJUA 2HEKA 4IFYA 4NLUA 4ID5B 4ZS6A 4HKQA 4JI4F 2UVUA 1S6QA 2XMUA 2J9DA 5HMXA 1B99A 1N54B 5T14A 3UN3A 1N8RT 1PJ5A 4ERDA 1N5YB 3LANA 2DHGA 3H25A 1I94J 1DTQA 4DQPA 3LPEA 4FP9A 1U1QA 5HJYA 3I56S 4DR4F 2C2OB 3D68A 3HLUA 2C22A 5AXLA 3SEOA 2NXCA 3MM6B 5D4LA 1E6YA 1U1LA 3KWMA 4DL2A 1QSSA 4TYBA 1VBZA 5D78A 5A8RB 3KLFA 3QO9A 1U24A 2HRYA 3TVYA 2CWXA 3UQSA 5D3GA 3TX0A 1DY3A 5DQGA 1HWJA 4NEYA 1Q81T 3SIPB 3HFKA 1VQMS 2L9NA 4CWBA 2C2ZB 1MMNA 1GXUA 2J7WA 4KGMA 3FQLA 4B3SJ 2BJ8A 4OQJA 5LMNJ 1EJ7L 3H20A 4W92B 5L9XA 2B43A 3KJNB 3LP1A 3H5UA 3IO1A 4WF9Q 2BE2B 2N7YA 4NLQA 4LSZB 5J2QB 1QM9A 2EI5A 3MM9B 4L76A 3I5AA 2XMWA 5T41A 3Q8SB 3EVWA 3T5LA 2LQBA 3W2VA 4NOHA 4QOTA 3IN5A 4USKA 4JYAJ 3WBZA 2A6MA 1GMVA 5HROB 2LU1A 1PSDA 4ED0A 4MKAA 4MJKA 1X4CA 2AGOA 1BHNA 2BX6A 2BQUA 2E9RX 4MYTA 2MEWA 3TZYA 5KT6A 3P6YC 4WIIA 1FKOB 3MTJA 1G4CA 3SQGB 4KV8A 3FBBA 2CPEA 2CKWA 1I51B 3NGTA 5E3PA 4ECTA 1U1PA 3D6MB 1Q16B 3H40A 2Q79A 3BH6B 3TVZA 5IM0A 3QFWA 4Y2AA 2W2PP 1WKLA 2CJ9A 2F3JA 3HT0A 3CJ8A 1HI8A 1RABB 3CJ4A 5E41A 3LO3A 3QIPA 4OHVA 2VPXB 1QJHA 3GMGA 3ZZTA 4EFAC 2ZM6J 4IOAQ 2CZ9A 4NL5A 4B3MJ 3G86A 4MIWA 2QMUB 1KWMA 3AQOA 2OPSB 2EFOA 2NPIA 3IG1B 5IV3A 2VBWA 2BOAA 2UXCF 2A3JA 3MCNA 2B5JA 4PG6A 3QPIA 4O3NA 1N33F 3CCTA 4JI6J 3VTIA 2HQFA 2YX4A 5FJ4A 3RJMB 4IO1A 4K0KF 3OR2A 3H5XA 5FIIA 1YBUA 4KH0B 3GB0A 4ED2A 2QIFA 2CJXB 5KG3A 4CO0A 3M9MB 1CJKB 4UUWA 4W4MA 2NYIA 3PRVA 4JI1F 5A8WB 1S72S 2CXEA 1HQEB 1VBKA 1FKAF 5AT1B 1JKHB 2HZAA 3BV8A 4WTYA 2RF2A 3D0HE 2GFFA 4FYDA 1FEEA 2NS1B 2NXUA 3R3TA 1JLCA 4CTAB 3MR2A 3TP2A 4ZVQB 2N82B 4NXMF 3UWTA 2NXEA 2AU0A 2LLZA 3GPAA 4IDKA 2HHQA 4ZPVR 4QWAA 3X1LB 4NYZA 2GZOA 1IR2A 2W2NP 3Q8YA 5CXTA 2BKOA 4I2PA 1LK5A 2WW4A 1WEYA 3G6VA 1KN6A 1NH8A 1UEUA 2ERRA 4C3KA 1ZBTA 5F8HA 1UPPA 2E9TA 2E7VA 4LBHA 1ZM4A 1CG2A 5HAOA 3BSNA 3C6TA 1S9EA 4A8YA 4OZ1A 5CYJA 2UUAF 4UOGA 2JH3A 4ZK7M 4YY3J 3R7SB 3NGUA 3ETMA 4I56A 5J2PA 1RLDA 3QT5A 4GVBA 4X2BA 2K1RA 2CIMA 2LKZA 3DRYA 2C42A 2GGPA 2CQ4A 1I94F 5F41A 2GO8A 1HNXJ 3NGSA 1M1HA 3D54A 2FZKB 2MLXA 1NPRA 4N56A 1PKUA 4P72A 1SJRA 2C3PA 1PC5A 2MZTA 4C4WA 1BQXA 4LVOP 1TUWA 4RU9A 4USHA 4OYIA 2DPJA 1S10A 1TZ0A 1EIYB 4JB8B 5ITHA 4RNNA 4WIQA 3OFEA 3MM8A 1QVGR 1UL3A 3L7OA 3P5BP 4JBCA 1CJTB 2VH7A 2NUUG 1JXLA 1HNWJ 4B3SF 3PRDA 2FHJA 1JQGA 4LR7A 1RT3B 1D1UA 2J7UA 5F8JA 4HT7A 2BQRA 3V4IA 5KFPA 1RE1B 2IBOA 4I0WA 1UPMB 5K8OA 3D1HA 2UUCJ 1CULB 1S48A 1AFJA 1SKRA 3OUYA 5HI7A 3PO4A 4JYAF 3R8YA 2ZH8A 1VHFA 3HP6A 1XERA 4X4VA 4ID8A 4YFUA 1T0TV 1RT6A 5CYMB 3A3NB 3CJKB 2F7VA 4ZJQA 4A8SA 2CZVC 1TUGB 1WC4A 3R6LB 3CULA 1FNXH 1N34F 5LXYA 4K8RA 1VR6A 2UV8G 4UZCA 2J0QD 5G4DA 1FEHA 3W65A 3DMJB 2ATLA 2IFXA 5ETQA 1VRTA 5KFHA 4GO5X 3MPWA 1YI2S 2KDOA 3CJRA 3FZBA 5H9EJ 3KJQB 4YN3B 2Z2ZA 4M1KA 3ENVA 4DL0C 3EVOA 1IKYA 2RMLA 4O4RA 5GAGI 2UP1A 3UNYA 3FEZA 4B3MF 2M2BA 2H1YA 2R2TA 4PWDB 1RWNB 5L1JA 1TL7A 4IFYB 3I32A 2H3EB 3DLEA 4M5GA 2HVZA 2HLUA 3EM1A 3NKYA 3GR1A 1S6QB 1RDRA 1YJUA 2AZ1A 3H2VE 2YQ0A 4TN2A 5EX0A 4ZP7A 2CJQA 4ILMA 1RLCL 1MW7A 1HL6A 2DNMA 5A6PA 1DTQB 1UCNA 4DR7J 2YTCA 4ECSA 4YHHF 4ANCA 3BKUA 2R8JA 3SCKE 1XR6A 2CQHA 1E6YB 3PCOB 3H90A 3KFWX 5I3QA 5DG7A 2DEIA 3KLFB 3C6UA 3FCVA 4DMZA 2YWHA 4UZBA 1N48A 2HFOA 1RAIB 5D3GB 2YKQA 2NREA 2PGCA 1UMJA 3T5JA 2ZH1A 4OV1A 5HMYA 3AOCA 4J37A 3H2LA 2IAJB 2BW7A 5KG5A 1Q7LB 1R6VA 5EX3A 1D0EA 1UVJA 2ZUGA 4K4SA 3EXCX 4C98A 3LP1B 4MFBA 4WYLA 1NKBA 3UD4P 1OIAA 4DL3A 2RQKA 2K8GA 3ZZOA 2LQ5A 2V8GA 3QAEA 2DXDA 1DZ5A 3QSIA 5E3AA 3CUNA 3W2VB 2WRMA 4L74A 1U4BA 2PSZA 3AODA 2XYGB 2DNNA 4UY85 5DG8A 2BZ2A 5CHCB 2GW8A 3BB5A 2HMIB 1VDHA 5HQMA 2R8IA 5C5JA 4DUZF 1C0UB 3RBEA 1NK7A 3AD7C 1HWIA 1R27B 2WVCA 3K5MA 2ZBRA 3OSNA 2HK3A 3LPYA 4KV8B 5GMEA 4E98A 3AXKA 2QL9B 1B0VA 1QSYA 1WJ9A 3BBFA 5AJ3J 1BD6A 2AHOB 3DRPA 5IM0B 1ZS6A 4OYMA 3PY8A 3EGNA 3EPGA 4RNHA 1UJ4A 2IJRA 3GONA 3K7RA 1R0BG 4F4AA 3QIPB 3V6KA 4TU8A 2JJ4D 1O6XA 4USIA 1CJVA 4USMA 3PTWA 2OGUA 3OW2R 4RU2A 2CQ0A 2JEJA 1TKDA 1D9DA 1RTHA 1TL5A 2KYXA 1KHWA 2AJQA 2B5JB 2R8HA 2LXUA 4ECZA 5F3TA 3DLHA 5HK4A 1Y5IB 1HNWF 2QEXS 5RUBA 5EWFA 3OR2B 2C2EA 5KTQA 3U27A 1KQKA 4TYAA 1RHUB 4F4ZA 4RLEA 1S57A 3RAQA 2CNNB 1RWWB 1K1SA 1FJCA 2UUCF 3BH7B 2W4PA 2IJFA 3E8OA 4B3OA 3PXGa 2EG2A 1QD1A 4F8RA 3GV5B 3KDNA 4G1QB 2XGQA 4JI7J 2RF2B 3EDQB 2KYZA 1RUSA 5A76A 3FC9A 3V81A 4YOEA 1UKUA 1JLCB 4ZOSA 5HMWA 2B56A 4DR2F 3BF4A 4USUA 4F67A 2KG1A 4TLQA 3BPSP 4E2FB 4CYUA 1SJ4P 1YJWS 4IDKB 4DU8A 4EYIB 3I6PA 4PR6A 4W98A 3Q8PB 3HCXA 2E1RA 4I2PB 2HIYA 5E2QA 2V8DA 3H4BA 4DUTA 1Y00A 2VUGA 2CUYA 1T9TA 2WB1D 2WVBA 1M5OC 2AJ2A 2FHOB 4AXJA 5DDQC 3OVSA 2MTLA 4KHPJ 4X62J 2CQ2A 3J7AN 2QLFB 1SUQA 2JEGA 4UUXA 1S9EB 3TANA 2W4DA 1Y5LB 1HPZA 1NJZA 5IWAJ 1U09A 2PO4A 3PIOQ 1LWCA 1S5ZA 2I5JA 3L7UA 1HWKA 2Z58B 1M5VC 1X8DA 3ILJA 2AZ3A 4GVBB 2HQ3A 1Y11A 2K1RB 5ETLA 2G0JA 3AY0A 5LJ3Y 2DNHA 2GGPB 4KBIA 3MPVA 3CDWA 2KXNB 4WBFA 2LMIA 3UD3P 1RT7A 2MZSA 2M3DA 3AQPA 1SC6A 5DGAA 1KDNA 1GMUA 1CVJA 1XIQA 5LMUJ 1U1NA 5B08A 1MWZA 2IM3A 4LUBA 3DM2A 1DTTA 2V2QA 2JEFA 1S6UA 2MB0B 4IG0A 4HI1A 1B3TA 1EB0A 5T7LA 1G1XA 2HNYA 1WKKA 2IBKA 1B7YB 1F9EB 2XSJA 3PW4A 2LEPA 4A4JA 1QDUB 2HHVA 4JV1A 1R89A 3PACA 3EWGA 4LQ9A 3MM8B 5D0HA 5C25A 2AYGA 2P5VA 4DSJA 1HBOA 3MXHP 3TUZC 1K8AT 2XMMA 1A7GE 3EDRB 1FE0A 2QFJA 1MLAA 1SIWB 2VPYB 4TKTA 3M05A 2VHGA 4WU2A 2CPYA 3V4IB 2D7SA 3OTDA 4HACA 4AFFA 4KGKA 5ETSA 3PJXA 1VYAA 3VQSA 2VF3A 1FO1A 4OIXA 2BJDA 2F1FA 2X3DA 3OUYB 1S77D 2DNZA 4DPUA 1JNZB 2IVYA 2VDHA 2Q3PA 4PG7A 2XEXA 3HZGA 4B9NA 2EFGA 3A13A 2LXFA 1ZH5A 3MI7X 1P1LA 2C2KB 1FA0A 1I6JA 1VQ6S 1RT6B 2FHJD 5I4MA 4M5MA 1H72C 2LQ9A 4F0MA 3T5HA 3U02A 1EETA 4O4GA 3D5MA 4PRFA 5BXIA 5KFBA 1HD1A 2YKNA 3AOBA 1GQEA 2ZHAA 1Y10A 5HVGA 4CLTA 2QC3A 5AJ3F 4J90A 2ACMA 3H0PA 2RHQB 4P75A 5CZVA 4NLXA 1S4EA 3MOZA 2ZEJA 1HKAA 2V6AA 3O1LA 2KH9A 2IRYA 3I96A 3W63A 3BQ1A 1S49A 2POKA 4GKKJ 1NK6A 3GLJA 5ETTA 2YVSA 3N4WA 5AE3A 4LRBA 3FEXB 1RT5B 4USWA 2YX7A 1REGX 2PI4A 3DLEB 2OSQA 4DUYJ 3BJYA 1UJ5A 3FRZA 2W25A 4RX6A 1XBWA 2WSFC 3EE3A 2BQ3A 3H98A 4XDDA 4B3RJ 3BDEA 1S0NA 1SH0A 3RAMA 4XK8C 1T11A 1U49A 2NR0A 2R7OA 5CABA 5F8IA 1HQ2A 1N32F 1HLWA 4EMDA 4DL4A 3B6BA 5IS2A 1YX2A 2YQ1A 4WK3A 2C2NA 3MEGB 4P2FA 1RHKB 1J2VA 4RUHA 2DH7A 1NH7A 2W9BA 1XMOJ 2JRSA 3C6UB 3SYZA 4OYBA 4JI7F 2CPFA 2L48A 1KD1T 1Q4RA 3CO9A 1FDDA 3KJFB 2JLGA 3G82A 4NRUA 3MECA 4DFKA 1VLYA 3LA0A 4DR6J 1PYTA 3PJ9A 5H1SV 3CCUS 2UXBF 4J9SA 2WAQD 4DLGA 4MFBB 2DH9A 2VZ9A 2HVEA 4QU7A 1VQKS 1KFSA 2KO1A 3RB4A 3TZWA 1RKIA 2LP4A 2ALYB 1X5SA 2G2OA 4QIFA 3MZIA 4UOHA 1HWUA 4O3RA 2D9OA 5AXNA 3AFGA 2OI2A 3SFGA 3PKMA 1UFWA 2DR7A 3H5SA 4X62F 2N7CA 5IQQA 2QL5B 4DPWA 4WWSA 1GEHA 1FWPA 4RUCA 4NEZA 2VC0A 4OHWA 4NXNJ 2R2RA 4ATNA 4QR0A 1R0CB 3MCMA 4RW4A 4YB7A 1S99A 4BWMA 1RAEB 2OELA 5ETMA 4UW2A 3GTYX 1HBUA 5IZHA 4NLVA 3H7HB 1WOSA 3J7ZT 5KFRA 5JVGQ 2E5HA 1FI4A 5BYRA 1T9WA 3DRPB 3BREA 1D8YA 4NRTA 2YXLA 2HVHA 2KHCA 3IM9A 3MPDA 4FBUA 5LMUF 5L1LA 3UD5A 3ILLA 3NS7B 3SSSA 1XC9A 4PUOA 2BMBA 2GMJA 3AXMA 2CPXA 1CJVB 3TX8A 2W24A 1R3NA 3L9ZA 3HO1A 1DLOA 4TY9A 4U7UK 4M5IA 3LGNA 2IMWP 1IBLJ 1RTHB 2HS0A 4I68A 1SQGA 3NBPA 2O01C 2JFDA 4AL6A 5KFWA 1U6ZA 1NJYA 2V8HA 2L41A 1TKZA 2Y8YA 2EKYA 3K5OA 4AYBD 1RHRB 4J9RA 1UTAA 4LJMA 4HTJA 3RRGA 1T8EA 5CAAA 2M70A 2Q6CA 1AUDA 4URGA 2VBZA 3A8KA 4F36A 4JI5J 4ZVOB 4WCEQ 2ZH9A 4KPCA 4P2MA 2BM1A 2ZZTA 1M5PC 3W9HA 1H3DA 4B3TF 2V9KA 5KAKA 3HFVA 4B3OB 3I9V9 1VQ4S 5B7WA 2MZQA 2C28A 1HFEL 2WOMA 2X1AA 1CJUA 1LK7A 3V81B 1T9XA 3MUTP 2PA3A 2RS2A 2BOPA 4F4XA 4F2RA 4CYUB 4CM0A 3K0JA 1X4HA 3G8TA 1OSDA 4N41A 1KFDA 3RTVA 2BE7D 1SJ1A 3RR8A 3BDPA 1FWKA 3M32A 4FYWB 4OX7A 4TLRA 2DRAA 4C8LA 4HL9A 1AROP 2Q43A 3A1YG 3M9NB 1BMQB 2FLOA 3UCUP 3BO2A 1FXRA 3P96A 3VHQA 4NCBA 4C8NA 2CYYA 5HO4A 4TY8B 4OLPA 1SUQB 1DQ9A 4RW7A 3BYRA 2A2DA 4K2XA 1HPZB 3GQCA 1WWHA 1MSWD 4G65A 2WBRA 2ZJRQ 1APSA 1LWCB 2HS3A 1FJGJ 3FFIA 3UN2A 1E6VA 4ZVFA 2I0XA 1AXQA 2R7WA 3M30A 4FXDA 2V9WA 5F8NA 3TQ1A 1F6TA 2IMOA 2KVQE 4DX8H 4ZMMA 4B3RF 1Y4ZB 3AAWB 1OMSA 3LAMA 3D2WA 2FVSA 4F3OA 4IH5A 3I4PA 1RT7B 4OYWA 4M5DA 2QA4G 1UWAA 3IFEA 5D0GA 2VOPA 4QYZJ 2F5GA 4F0KA 5K14A 3DM2B 1DTTB 2MKIA 2Z4PA 4IG0B 1OS5A 2R7QA 3ZTRA 3T6BA 4WFNQ 4OI0A 4N8OA 3BKTA 2EFNA 4L3KA 3J7YI 1IWGA 3THTA 3BR8A 1LXNA 4EI2A 2HNYB 2H5JB 5CQGA 4ZPBA 2XSJB 3NMAA 4L75A 3MAAB 3QFHA 1TL1A 1O51A 2GMLA 5DO2A 5C25B 1T7PA 4KR0B 1HBOB 4ZLJA 1HWLA 1IKXA 4DR6F 1NNDA 2P2CB 1TELA 2B9EA 3E3XA 1ROFA 6AT1B 3M8PA 4KHMA 2FPHX 2AJ4A 4YMEA 4FS2A 3UN5A 3PW7A 2FVPA 1MROA 4LF5J 1O0PA 1S4FA 3T3FA 9RUBA 4Y28C 4NPOA 2XTJP 1RA6A 2OAUA 4FYXB 2D3OR 4M8LA 4IRCA 5KFXA 3HD1A 2FJWA 2QFIA 1X60A 3Q83A 5CH7B 1Z1ZA 3CCRS 3QGIA 3VALA 1UP1A 7FDRA 3VAGA 1NHUA 3G6ES 5CZXA 4MK7A 2LVWA 3ITHA 3TI0A 4AD6A 3PW0A 1EETB 2MZ1A 4O4GB 1QTMA 1AW0A 1NAQA 2YKNB 4C0HA 1RP5A 1HYSA 2RH3A 2NLWA 1FTCA 1GK8A 4C11A 1IBKJ 4CQ1A 4B9UA 1LKZA 1YTYA 4BC7A 4UOFA 1S9GA 1FRLA 4WU3A 5GAEU 3I55S 4ECYA 5LSLA 1TMJA 3IWNC 4QIWD 3Q22A 3DC2A 1LWEA 2ASDA 2CJBA 1LWXA 5KFDA 4LF9F 2DKOB 2RVJA 4LSNA 4OYPA 3P3DA 2RSQA 4TU7A 1XR5A 2FUG9 2H51B 1FVSA 3DN9A 4IOCQ 1UJ6A 4ZLNA 3OVAA 1SL1A 1VQPS 1Q53A 4I7FA 1Y3JA 3OXLA 2V0NA 3NS5A 2DTJA 1KOOA 5D0EA 2IM0A 4DL7A 2RRAA 1LWFA 1JLQA 4H4OA 2RQMA 4G1IA 2M88A 1KQSR 3VZIA 5EGYA 1S59A 3PNIA 2V50A 2JVRA 2W9BB 2UV8A 3CW2C 2OPRA 4CO1A 3C14A 1DARA 3MAQA 1YGYA 1BQMA 4DV5J 4UOCA 2E1PA 1FRJA 4FKYA 2B9XA 4C0OC 4C3LA 2G1DA 3TEHB 4LF7J 4HR2A 3G82B 3UCGA 3MECB 2G0IA 3K5NA 1RK8A 4CLUA 4AE5A 2GIQA 2JLFA 1ZTWA 2BRKA 4CCHA 3CJ2A 4YDXA 2XQCA 1AUSL 3OVBA 2FD2A 5IT4A 1SJ3P 2KXHA 1KEKA 2PEBA 4PCQA 4Z37A 2E5JA 1Q82T 1SC1B 3VWSA 4HHJA 1F5CA 3M2RA 3GIMA 1JLAA 3CJQA 1XTZA 3S8SA 3RBXA 3B54A 2DGXA 3SMZA 3KXDA 4PWUA 3QJJA 2RD5C 1RYSA 3QYYA 2RQCA 4FVMA 1VQ5S 2BRLA 4A47A 3N0VA 3NGKA 3D0GE 4F3MA 3VCDA 4UT4A 4QWCA 4X4RA 5I3PA 3ZTSA 2KTQA 4RWXA 2HG4A 4RW4B 2XI2A 4LF6J 3VVUA 2CJAA 4AL5A 3N5FA 2ZD1A 1HBUB 3M6VA 3GSIA 2XMJA 3UFCX 4YR0A 2EXUA 4IH6A 4ZPWR 4K4YA 3OPKA 2HQIA 1VJQA 3BN4A 5HMZA 2XLKA 2N3LA 1WDDA 3V4MA 4CLWA 4HHUA 3S6EA 2WZ1A 1YBTA 3A8JA 3HHLC 1VRQC 1N5VA 3OR1A 4PUOB 2PFFB 2A6OA 2Y3YA 2YX1A 3K5PA 3FSXA 1VK3A 3T41A 1DLOB 4EU0A 3W5YA 3LUYA 1S1VB 4F50A 1AA1B 3H2UB 3MCOA 5A6WA 1X7VA 3NBPB 5D15A 2UVRA 4PG5A 1CS4A 2N3OA 3CDBA 2A18A 5EDWA 3VGUA 1FRHA 1CLFA 2VBYA 1TKZB 2F65A 4QQBA 4GKJJ 4EWTA 3BGOP 2RE1A 1S1WA 1BQNA 4PPDA 1IJEB 2DGTA 2K06A 1H0HB 3PEHA 2F8MA 2QA1A 2F9DA 3KG1A 2O67A 3J81Y 1N36J 2EC0A 5HSPA 4DQIA 4A8OA 4EYHB 1P9QC 2VIHA 1JK9B 2RB7A 2HZCA 1BWVA 3NNAA 1C0TA 1XNQJ 2B4VA 3EZ5A 3D6FB 1SC4B 2IJNA 4FZVA 3M8ZA 4U6PA 3OBIA 5JXSA 5DZ7A 2IRUA 2ZDPA 1UZDA 4YP3A 2WOMB 1CJUB 2YKOA 4DCJB 3WDOA 5BYSA 2V4RA 1V6HA 1NLKL 1RADB 1QUVA 4DV4F 4IRDA 4ANEA 1GT8A 3VAIA 1IBKF 2KM8B 3GJRB 5H9EK 1RACB 1N5SA 4M95A 1KVIA 2YQ3A 3M32B 2RU9A 3VGTA 2FVCA 3I9ZA 2KT3A 5K20B 2GHWA 2GHVC 5HLFA 4P7VA 3I31A 3K2YA 4IR9A 2CPJA 4Y6IA 3K57A 1ITPA 4Y2KA 4ZPTR 4RW7B 2RKIA 1YJ9S 4A8FA 4KYZA 5KFAA 3IC1A 4QWDA 2ZJQQ 2LYVA 3G6XA 2XLIA 3R5DA 4Q44A 1E6VB 1GTHA 4ED7A 3M30B 2HVIA 4HDGA 2CVEA 1H38A 5D8HB 1U0HA 1Y9OA 5A8KA 1B7FA 4OV6A 1T05A 4ZCIA 3GJSB 1ELOA 3KUHA 2YWFA 2JVOA 3I0SA 3L7PA 3OV7A 3IBFB 3VGVA 2FDNA 4M5DB 4N47A 4DPTA 4A8QA 2HHHF 1WHVA 5K14B 4HTIA 3PEJA 3J81U 4RBUA 2BBEA 4ED1A 4CH0S 2HQDA 3LTOA 2HW3A 4DS4A 1JJHA 4ZPAA 1M5SA 3FGVA 3UDVA 3NP5A 4RNOA 3HHNB 1TK0A 1X4BA 4QYRA 2EK1A 2ZHBA 1QE1A 4S0MA 1B70B 3OFHA 1M1GA 1N0VC 1F2GA 1IKXB 1RHJB 3NCRA 2CQBA 2DNKA 1FDBA 1Y0HA 2VQFJ 1Q5VA 4DR3J 1ZA1B 1JLEA 3M8PB 3HHEA 4L3NA 1GMWA 4FPRA 1HNVB 4ZP9A 4N8NA 2B4OA 4B02A 1MROB 5J2NA 5ETNA 4WKRA 3I4HX 2XY5A 4BHQA 4KPYA 1RT1B 4CLZA 3O6QA 3ZC4A 4PXCA 4WP3A 3WIUA 4ETZA 3DI6A 2HFNA 3N01A 4N7TA 2V8VA 4OZ2A 3SI8A 2ADCA 3ZNUA 2VFRA 1UA1A 1FD2A 1REVA 3ITHB 1SB6A 2FQQB 4TU9A 2RDIA 4IOBA 2IA6A 2BJ3A 2RRNA 2DJWA 4RBTA 4B17A 3KMSA 4NCAA 4X64F 2KFYA 3QJPA 5KFEA 1KOHA 1HYSB 5E5NA 4C8KA 4C11B 2PD1A 5AXMA 3QWPA 3LH2S 1U6FA 4DHVA 2JC1A 3THPA 5G0RB 2QGFB 4KQZA 1F9HA 5A2QY 1WTFA 4L72B 4FF2A 4IG3A 1VFJA 1LWEB 1RTDA 4K4UA 3POTA 3HK2A 4B9VA 3E2EA 4IR1A 4LSNB 1F2HA 2ZFHA 1KKHA 2ROEA 2MQNA 2KXFA 2J76E 3QMQA 1HW8A 2GHPA 3NMRA 2MHNA 2CPIA 3P8BB 4I7FB 5AXKA 4NMXA 3T1AA 2OFGX 2X1FA 3NAIA 4GKJF 5B0EA 2KRBA 1VQSA 1U26A 3KK1A 4RUAA 2RQ4A 2C1EB 3GSDA 1P8GA 4H4OB 2Z30B 2BA9A 3A3OB 1GAOA 1X9SA 1X4EA 1OPIA 4FYYB 3C8YA 4OJGA 5CCMA 5H9FJ 1MWYA 2OEMA 2ZH6A 4IRKA 3ZZZA 3R5JB 2HHXA 4RL1A 2CPHA 2Y1LB 1TTHB 2OPRB 1RZMA 1WOOA 3C14B 3RBZA 1S0OA 2V69A 3KHGA 3T1HF 1BQMB 1XNQF 1HI0P 2KJVA 2GMHA 3M8QA 1RAFB 2P8IA 1QAIA 4H4KC 4EZ6A 1YKWA 3MM5A 2ABYA 1B64A 2F40A 2CA9A 2FVQA 5KFJA 1YG0A 6FDRA 2VA3A 4A8MP 1KBRA 3W62A 2R7VA 1U2RA 3M2RB 1JLAB 2HRUA 4ZJOA 5IFMA 4DI6A 3CIMA 1CC7A 3BM7A 1HBNA 1ZYQA 5A2QU 2E5LF 2HQGA 2QT7A 2AYMA 1KTVA 4J9LA 1PJ6A 1X4DA 2UXCJ 2UU9J 3D66A 4YEAA 2ZUAA 1N33J 2BV3A 2E1CA 4DFPA 2KT2A 4LRDA 4QU6A 1KONA 1YJTA 1OJ4A 4K0KJ 2ZD1B 2E1MC 4K2JA 4CNZA 1P1TA 2ZZMA 3JTOA 3MEEA 2Q1LA 2RUSA 1L3UA 4ZVHA 4O44A 3B4DA 4JI1J 5C2CA 2LDYA 3H8YA 3HSJA 4G1PA 4C3MA 3VAFA 4JV0A 4Q45A 4Y65A 4ENOA 3L95X 1R8BA 3KG4A 4FF3A 1VK8A 3MGJA 3QNWB 1U1MA 2XMAA 1VC0A 1HA1A 4C8YA 3O5TB 2CJYB 4EO6A 5KG6A 4NXMJ 4X66F 1ZAXA 4F3QA 3LP0A 2R8KA 1CS4B 2ZC3A 4C8MA 3CD5A 7AT1B 4K4XA 4LFCF 1AT1B 3HFZB 1R0AA 1K0VA 1N5TA 1RQ0A 2VASA 3OTBA 5GMDA 5K8PA 2ZZNA 3I87A 1S1WB 1BQNB 5I3UA 4PG4A 2CNLB 4EK2A 2ZH4A 1DJ0A 2HWHA 5E3QA 2E44A 3PX6A 2OLWA 3QIDA 3H42A 4DEZA 3QATA 3GILA 3FSIA 4CH7A 1JLBA 2W1BA 1LFWA 1ZOTA 4X4QA 3L09A 5D6GA 1PGZA 2U1AA 3MEKA 1C0TB 1SPBP 1F5AA 4ZIWA 3Q8VA 2Y0SD 4DQQA 2UUAJ 4PWWA 3KLHA 1V3ZA 1NPPA 2FTRA 4QJVA 3KLGA 3NCPA 2AIRB 1XWLA 1YJRA 3VZHA 3KK2B 3QT6A 1ZM3A 2QN6B 1WTBA 2E7WA 2XO6A 2OPQA 2CG8A 2FJDB 2VKRA 3G8SA 1NDLA 3MR5A 2N4CA 2KJWA 1PCAA 2VFUA 4EZ9A 1P6TA 4BBYA 2J8SA 2AX1A 3EVMA 3EPIA 1D8ZA 5BR8J 4HYKA 1VRUA 4CNYA 4DPOA 1SKUB 3IWXA 5HLFB 1JB0C 4OL8A 6FD1A 1JJ4A 2ZDOA 4ZLPA 3K5LA 2RKIB 4XDCA 4G6VB 4OHYA 3ENQA 2V2VA 2IC3A 2DGWA 2NSBA 3ENAA 2NCKL 2WTFA 2Q66A 1U0HB 5A8KB 2FIUA 4HT5A 2O1PA 1T05B 1IKVA 2KB2A 3Q89A 4UF4A 5A0YA 1Q8BA 3I0SB 3A3PB 5HQ8A 4JI3J 2B4UA 2FZGB 5E33A 2UUTA 4P2SA 1ACMB 2RIJA 1WEZA 3SSQA 1NK4A 3CXCR 4PYDA 1IUJA 3BGFA 4DV1F 4RW6A 1U02A 3FCWA 2J6SA 3OTEA 3LGHA 1DRZA 2GJFA 2YWKA 1QE1B 3CB4A 3R5GA 4ZN3A 5D0RA 3EX7B 2X51A 1N34J 4OZLA 4O3OA 3BBBA 2OJ3A 3K17A 1X31C 3NL0A 1X5OA 2MZRA 1WC0A 2OUGA 2XLJA 2EBEA 2B8PA 1D9FA 2O5DA 2W9AA 2OO4A 3HF5A 2AQ4A 4ED5A 2G2ZA 1JLEB 4DG1A 4OX9J 3HJVA 1HHSA 2EFPA 5L1IA 1Y5NB 4ECUA 4CO5A 1XMBA 4Y2IA 1HNZJ 4CO4A 1LW2A 2KN4A 2XS5A 4V19J 1IVZA 2CQ1A 5J2NB 1YSJA 2YH1A 3DI6B 3MUMP 5BYQA 2UU9F 3GJTB 1RAGB 1S0VA 4WFZA 3JYTA 1TL3A 5KG4A 1IQZA 1REVB 3FK4A 2BYCA 1M5HA 4OYZA 1SXLA 1GMWD 3NEKA 2HQCA 1QAYA 2R2UA 4QCLA 3N6NA 2A2CA 2J9EA 2MPUA 2A1BA 4YHHJ 5GVQA 3KJVA 1H74A 2UXDJ 3PV8A 1ZAWA 2VBXA 4K4VA 1NO8A 4LREA 3DRRA 4DZ6A 2CDRB 2W7PA 1NSQA 2H5IB 3BBCA 1UFLA 4IG3B 4P10A 3IRXA 2XC9A 2SXLA 3POTB 1RWPB 3CDAA 4M5KA 3MDFA 5L8RC 5CD4H 1UZHA 3Q24A 2DR9A 1QAJA 5GAGU 5DZ6A 4NZ6A 1NUEA 4ALZA 3MFIA 4NLWA 4NX9A 3NY0A 2OEKA 1XMQF 1G3OA 3KK1B 5IT0A 4BS2A 3NG8A 1Q86T 5M2UA 4ECWA 2GAHC 3CNQP 1Q7YT 2HKEA 2PE8A 2NZ4A 1TAUA 2V34A 4ZCMA 2KI2A 1CBKA 2U2FA 2PMWA 3W2WA 4IH7A 1VIXA 2B7BB 2V2ZA 2C2RA 4I64A 1R8PA 3CC7S 3JSMA 2BKPA 3B78A 3PJWA 4JV2A 4OI4A 4OI6A 5KT7A 3KHLA 3BGRA 4DUZJ 2NPFA 2R7XA 4RW9A 1FRXA 5GMKa 2CPDA 4FF1A 2X3GA 4QBUA 2LCWA 2PC6A 5AE2A 3A4TA 3LW5C 3UDCA 1PIEA 3TW0A 5F9NA 2V4JA 3MM5B 3O8WA 3UR3C 3JQJA 3ZZRA 2EW9A 1B0PA 2X7IA 2MMYA 1S79A 4BLGA 2V68A 5LJ5Y 1LFPA 5BR8F 4BC9A 2XWXA 1IR1A 2BJ9A 3CCVS 2W8LA 1W26A 1HBNB 2FJBB 3NAHA 3P4UB 1WHYA 3IRWP 3MTKA 1JMTA 1HD0A 3BQ2A 4B08A 2CG4A 2NSCA 2D3UA 4EBDA 4DFMA 1ZM2A 3MCSA 4MIBA 5DRKA 2EFVA 4CT9A 2DIUA 4U9RA 2CAJA 2DNRA 2BVZA 4YR3A 4F4YA 2OMLA 2BANA 1ZETA 3QRPA 5DLFA 1WORA 3GCWP 3HDSA 3KLEA 3TWZA 4AQYJ 3P45B 2DXEA 3G96A 3MEEB 5FDLA 4ES1A 1N5YA 2HHTA 1S1XA 3EZOA 1NEEA 3GJQB 4UQGA 2ACYA 4QYZK 4O44B 4JI3F 1N0UA 1FK9A 1V9OA 5IC6B 4X4NA 2D69A 3PO5A 2FLNA 3IR5B 2DGVA 2Y1RI 1RCOB 5BJRA 1VHIA 1AB8A 2HPUA 4NA1A 4O0IA 5ETVA 4DR2J 4WFYA 3PVXA 3LP0B 1XN9A 4R0JA 2AGPA 1GX5A 3T9NA 3GZ7A 5B09A 1R0AB 4KHRA 1R8HA 3QAUA 4KO0A 1DFDA 4Q2MA 4OI2A 4PQAA 2FJAB 5I3UB 1AYEA 4OX9F 4F04B 3OT9A 1EP4A 5IV4A 2FHKA 3ZO7A 1ZZFA 4JV5F 2QLJB 1HNZF 1NB2A 1JLBB 4NLPA 4MTPA 1YWXA 2EPIA 2AKWB 1RWVB 2IYIA 1W2IA 3DLKA 5HROA 3QQCD 2HHUA 2PEHA 4CLKA 3FBEA 4Q5VA 1ZPWX 5L46A 2OFHX 3CF5Q 2PIIA 4ZP6A 4J9OA 2Y8WA 2EBGA 3FQKA 2ZE2A 2RDDA 2OPQB 2Z56B 4CH1A 4NLSA 3BSCA 3PHTA 1KHVA 2DR8A 1FT8A 2W9CA 1VRUB 2UXDF 3AD9C 3PG9A 3MFHA 3TJ8A 4JI0J 1XR7A 4KIAA 1Q95G 3QZ8A 2V63A 3QO9B 4E0DA 3DXBA 1NJXA 1DURA 1QUPA 4DWIA 2GA7A 3R2CJ 2B3TB 1YK9A 4Z2XA 2HAFA 2VJUA 3IG1A 1WC1A 4LR8A 2IC3B 3M2VA 4K7QA 2HHPA 1IKWA 1TFWA 3K8WA 3FBCA 1VQLS 3Q2SC 3NXZA 4ELUA 1JXEA 2DVIA 2R7TA 1BY9A 3ILIA 3FJ2A 3JSBA 4N77A 4MK9A 2FVRA 2E5IA 2MYFA 3ONQA 5A0YB 2V67A 3NRBA 1SJQA 5KFZA 3JQKA 3KOAA 1FJ7A 1X4AA 1VQNS 4ZPDA 1SBRA 1BXNA 3PYDA 4J5OA 4ECVA 2GVDA 2UVWA 2R7RA 2JDJA 5KFKA 3CGIA 4ZCLA 2L9WA 4ZIVA 3FMBA 4P2XA 4RW6B 1RU2A 4DV3F 5CD4A 4ICLA 3ETOA 2HFZA 2J0XA 1LOUA 2MJNA 4LBPA 4QIVA 2M8HA 3GYGA 3ZZYA 1LEOA 2ILZA 1FRKA 3AB2B 1UFKA 4K50A 3G87A 3KTQA 2Q6BA 1WHXA 3OTCA 2HS4A 4DG1B 4CZCA 3GV7B 2JFKA 4FPIA 3EMTA 1LW2B 1S0MA 3CIZA 3MPUB 5D4PA 5KG1A 3MURP 3IP0A 1KC8T 4ZVRB 1NSPA 1VGYA 2RILA 1HMVA 2KZMA 1L5UA 2HHSA 1KS2A 5EHHA 1M5KC 4R0EA 2MZJA 3HPOA 2I2YA 5K8NA 1FX4A 4ZA1A 1YITS 3JYTB 3FZ2A 2RT3A 4AXIA 1TL3B 3HZEA 5DQHA 3QZ7A 4DU7A 5B0DA 1NDKA 3DYAA 1BE4A 4OHXA 2MQMA 4LFBJ 5GAHI 1N56A 3DCAA 2YWEA 2GNKA 5KFTA 2OP5A 4WP8A 4AQYF 4I6WA 2IYGA 1RCXB 1N32J 4NLRA 2LA6A 2NYHA 2G2YA 3MMCA 2DBBA 2XYPB 3ILOA 4XIUA 3B4MA 3KJVB 3CJ5A 1J5EF 2CDQA 2VL1A 3D28A 2K7JA 3KUEA 4CIOA 3MR7A 3C66A 4LFAF 3DRRB 1PYSB 1GH8A 2QMXA 3IRXB 2CFXA 1JJCB 2GX8A 2IM2A 3KHHA 2Z8QA 4KGVB 3ISZA 1YIJS 4FF4A 2W7AA 1C4CA 2GJIA 4IO9Q 2IVFB 2RS8A 1I3OB 3TOQA 4AUKA 5E3RA 4PEOA 3NOGA 5KOXA 4TQSA 2NZCA 1XNRF 2HGNA 4HH1A 2DGOA 2UXBJ 1K73T 4P52A 2I6WA 1FHTA 5ETOA 5SZTA 2WONA 3PW2A 2YY3A 4DJBA 4N5SA 1WUUA 2QE5A 2A10A 1EAYC 4NZ0A 3SV4A 4E8UA 3PYEA 1EARA 4HVZA 3W2WB 3DLBA 3G4SS 3B82A 3G71S 5I42A 1FF2A 3NWRA 3JSMB 1JWWA 4DPYA 1IM6A 1EQMA 1RXOB 3MD3A 4LIRA 1V3RA 4M5HA 2RDJA 4DQRA 3C6TB 3BGRB 4ZP8A 2XSFA 4RW9B 3TZXA 4YB5A 2ZOFA 3JQMA 5J2PB 3THVA 2OH2A 1WEXA 2QV6A 3CT9A 2FC9A 4J9QA 1MU2A 2V4JB 2JSXA 3WHIA 4X4PA 5KFQA 2CQCA 4EBCA 2VODA 2DHAA 4LMZA 2IA0A 1YHQS 4D3HA 3TA0A 2ZOMA 2B8QA 2OD4A 4LF8F 1HHQA 5ETRA 4JI0F 1SC3B 1SL2A 2XY7A 4LRCA 4ZITA 2MDAA 3U1LA 4J91A 2AV5A 5JUMA 4FDFA 2PN6A 2B6AA 3S01A 4KTQA 3P5TL 3OL9A 4DSKA 4PWDA 2EK6A 4LR9A 2PA8D 1PBUA 1O5JA 3D9BA 4LRFA 4OJHA 3CWJA 4A48A 3E01A 4JI8J 3OTOF 1EKRA 2V5HG 4O3SA 4MK8A 4FXVA 2BANB 4I67A 2XCPA 3KLEB 1NZAA 3ULHA 3G6YA 4C8ZA 5FDLB 3OL6A 1NHKL 1S1XB 3TJ9A 3FEYB 4I6YA 1RWXB 4WPAA 1FK9B 3DGVA 4U96A 5C2GA 1C2PA 3CDUA 5KG7A 4D3GA 4B3TJ 4L73A 1JIHA 2ZBIA 1NPKA 4M63A 1WG1A 1F3VA 2LQJA 3N5BA 2I9SA 3D4JA 3R7NB 3QGHA 1TKXA 4ITSA 1UWBA 1G7CB 4WXWA 1YBAA 2QO3A 2DR5A 3R97A 1IXKA 3JS9A 2GVZA 2IDEA 2IAJA 3PHEA 1GXTA 3CDEA 4KO0B 4CLPA 2KVIA 1VRTB 4J9VA 4X65J 3EYZA 1URNA 4QW9A 4OX6A 3Q8QB 3CMQA 3F44A 1OQ3A 5AE1A 1EP4B 1YVFA 4R5PA 2YBVA 4KFBA 3SFUA 2AW0A 1FESA 2VDIA 1SIZA 4XPEA 3GFYA 3N6LA 1IKYB 1S6PA 5MAOA 3SCJE 2JEIA 3M8SA 3W8PA 3MF5A 2CRLA 2VFVA 5D4OA 1AFIA 3JTNA 4ZN1A 1B4SA 5LSOA 3FSYA 2YKAA 4IUFA 3JSYA 4OJ1A 3DLKB 1TL7B 2LA4A 1RTJA 3T5KA 3VAHA 2HMIA 1FXLA 2PT0A 3ZFVA 1R8CA 4MIAA 1C0UA 3AB4B 2MGZA 8ATCB 2HFVA 4F2SA 4LFBF 2ZE2B 4ZJLA 1VQ9S 4DR1J 1S7IA 2XMTA 1TKTA 2C3UA 1L3KA 5LL6d 1SV5A 2VU5A 3Q8RB 1OQ6A 3UCZP 2FYXA 3L3CA 3PYFA 3OQ2A 3CCES 2W9CB 2H5EA 2HGMA 1VMBA 5HVHA 5EUHA 3RR7A 2RJZA 1Z2ZA 4KAIA 2BDPA 4BDPA 2QX0A 3WX8A 1WOPA 3SXLA 3TEGA 4FBTA 3GFHA 3W5XA 3M2VB 3MM7A 1IKWB 5DDPC 1OYEA 3F73A 3V2UC 4TXSA 3CVKA 2MQ8A 2QJ3A 1FKPA 2VPWB 3BQ0A 2HLTA 3I5CA 2AEFA 1RBLA 4DCOB 5H9FK 2B0GA 2DO4A 5J2MA 4IQXA 3W60A 2GJ2A 2GVDB 3LF0A 1CQMA 4PG8A 3GYNA 1VS3A 3M8RA 1T03A 2GO9A 2F4FA 1Q1KA 2E66A 4G1QA 3M4XA 2P9GA 4ICLB 4AT1B 3A8EA 1W7WA 3LAKA 4EO8A 2PMZD 3CJTA 3J7YU 4W90B 5KT5A 1FXDA 4NWBA 1R7IA 4OFZA 1DHMA 3JB9k 1I5OB 4LF1A 2FLLA 2GIRA 5CCLA 4A8XA 3H5YA 2DNLA 3PZPA 2ZWPA 2B9WA 1SJFA 2OTLS 3RRHA 1UVIA 1TK5A 1NKCA 2AD9A 2XHCA 1VQYA 2IIHA 3N28A 3M6UA 2DY9A 1YRTA 1PG5B 1F9FA 2J6TA 5DJBA 2LFVA 3PDNA 4EGLA 3EGVA 2BABA 3K89A 3PR4A 1TFYA 4ED3A 3LOUA 2KRRA 4LF9J 2HWTA 4LQ3A 4OI1A 1OY8A 4WZMA 4K59A 3EZUA 2MQQA 5B0AA 1HMVB 2F8EX 2BW2A 5B0BA 1HIYA 4LBIA 1Q5YA 4DS5A 4WXOA 3DYAB 5LT5A 4JI8F 3AH6A 1T9VA 1RGVA 4L6V3 2WW8A 9ATCB 4WE1A 3DRSA 3VAJA 3MMCB 3DHWC 1NSAA 1K0TA 2QZ8A 4LF4J 1HBMA 1LNQA 3RRKA 3AJ1A 5F8LA 1MWQA 5JMNA 5L39A 2DRBA 5IC4B 3C19A 2DR6A 4QZVB 2VC1A 3HX9A 1YZ6A 1TK8A 2Y9HA 1QY7A 3S7RA 3AHPA 4DV7J 1PJ7A 5KFVA 4NCGA 4PXEA 2DHSA 1OSCA 2D41A 1RYRA 2IPOB 2ZITA 2X1BA 3CC4S 2AEMA 2H48B 2V8PA 4BCAA 4HHHA 3DOLA 1GFWB 3TAQA 2XZTB 5LMNF 2QLBB 3TZZA 3Q0AA 4I2QA 4X65F 2AJFE 2WONB 4NA3A 3ZTOA 2R7SA 1S7HA 3TARA 5F8GA 2F4VJ 2FC8A 3I82A 2EEYA 3UVJA 2JNJA 4UY8T 4YS2A 5K8MA 5I42B 3PKYA 5KFUA 1L3VA 2YNGA 4F4WA 1XJWB 2E1AA 2QSFA 1VJWA 2I5JB 3BSOA 2HNDA 2XNQA 1JNRB 1OWXA 1SH3A 3TRGA 3FVYA 4HEA9 3CE8A 3TUIC 4ELVA 5L38A 1O8BA 2KU7A 2BUNA 3RYLA 1KLMA 1MU2B 1NDPA 4NLOA 2RAQA 3G8QA 1J27A 4DR1F 3ISNC 4Q2LA 4KGXB 2F8HA 4X4OA 3X3UA 1P9YA 1Z4UA 1WF2A 4B9MA 5E3CA 2E29A 5KFCA 1U25A 3KNGA 3J7Z5 4PABA 3EXYA 2MLZA 3OLBA 4I1TA 4U67Q 2MKCA 1T94A 1NSKL 4DR5J 4X4UA 1CSJA 2ZOGA 3TNVA 5T7LB 1FFGB 2RHSB 1EX8A 2B6AB 3DDIA 2ZM6F 2HSEB 4Q8EA 1KP6A 4Y3CA 3HKZD 4PPZA 1RT5A 1RAOA 3CJ3A 3UR0A 5DDRC 3HSDA 2OHDA 3E01B 4YB6A 4Q0BA 3PX0A 3OFFA 4J9PA 3GFXA 3HKWA 3C3LA 4OHZA 2K3KA 4V1Ak 1KRPA 2J9DE 5M2RA 1TV6A 4JI6F 1WC3A 1EZZB 3PYGA 2AJ0A 5DETA 4HACB 3WQPA 4EUVA 1YRUA 2AWZA 2DISA 3UDLA 1WG5A 5FLXY 4F02A 4PQUA 1WELA 2HBQB 4QR1A 3OHAA 3BR9A 2BEFA 1RKJA 3R5BA 3MEDA 3MEGA 1T3OA 2DIVA 2RNEA 2L3MA 4Y34A 3VQTA 1TKXB 3QGGA 2ZH5A 1UWBB 4RZRA 4JP8A 3KLVA 3IAS9 5HJXA 1IR0A 4DV4J 4Q8FA 2GVZB 4A8WA 1VIOA 3DKDA 1HI1A 2W7OA 5F3ZA 3LGMA 3GIJA 5HBMA 1IQTA 1U0SA 2CADA 2XS7A 1F60B 5EWEA 1KVJA 1MMLA 2H4WB 3QBCA 1XQIA 4TNOA 2JLEA 4R5PB 4KFBB 3QRQA 2WVEA 3F56A 1S6PB 5ADZA 3RU0A 3HHLA 4KC5A 3ZZPA 1KSPA 5HATA 4NI2A 1QLNA 3CCWA 3RB0A 2XBPA 4O3QA 3CCLS 5HP1A 3CD6S 1RTJB 4DSEA 2H54B 4ZVTB 3BO3A 3GE9A 2X1GA 4RO0A 2I1RA 1N52B 5LXRA 2MGZB 1WF1A 3U1NA 2XB2D 3ET6A 2D1CA 4JOUA 1K9MT 4YY3F 2XWYA 2W8KA 1FRMA 2AYBA 1TKTB 3FDSA 1SV5B 2PDAA 2MKHA 1LW0A 1M90T 1PO6A 1OPZA 3HVAA 3OFGA 2Y1IA 1NKEA 3WC2A 3UDEA 3IGVA 3BYPA 5DQIA 2HHHJ 1TMMA 1HNXF 4DOZA 4LF4F 2HFUA 4ES3A 2WBMA 5FLXU 3R1HA 4MKVA 1H7XA 1U6BA 1T3NA 3P49B 3M8WA 1SCJB 3IGNA 3US5A 5GADU 1K1QA 3IXQA 4RR5A 1YJ7A 4A46A 2GC8A 1RI7A 1RA7A 2C3MA 2PMHA 1FJEB 5THWA 4DV7F 3C15A 3MM7B 5KT4A 1U8WA 2HBRB 3K59A 2DNYA 2E9ZA 3SCLE 3IR7B 3CD7A 3BS9A 3ZZ0A 1WD6A 4Y2MA 4YQWA 1FKPB 4IFVA 4MAKA 3D6HB 3CTRA 2HURA 1BWEA 5J2MB 3FMWA 2COLA 2F4VF 2IDLA 1GNKA 4DXLA 3R9LA 1FFWB 3MR6A 2ZJPQ 3HM9A 4ILLA 4YR2A 3VAKA 3E51A 1I1GA 4WFBQ 4PXDA 2JC0A 4DQSA 1C1CA 1T03B 4OZ0A 1EKSA 2W4CA 2ZWOA 2V4QA 2P6SA 1S12A 2ZBCA 2BJ7A 3HXMA 2VONA 3GWCA 2D3O1 2DGQA 1J5OA 8AT1B 2ZBQA 3SCIE 4URSA 3OXFA 4X64J 4OZ5A 3QSYB 1EHWA 4M5NA 5JVHQ 2XGPA 1H98A 2QA4S 2KFZA 4ECQA 3BZQA 5K9FA 4ED8A 2H4YB 2R3VA 3PFEA 4QW8A 4DLEA 2KL8A 5KFLA 3H4DA 3M6XA 4NLTA 2QTWA 1Y3KA 4I4BA 3GFZA 1UVKA 4IYQA 3WZ0A 4DR5F 1NRKA 2ZVSA 2M8DB 1TU0B 4TY8A 3KLIA 2GQCA 4V19X 3PRBA 1A9NB 2FZCB 3RAXA 2HHWA 1RTIA 4WZQA 3JAMY 3ISND 4DSIA 4ED4A 1DQ8A 3VAMA 4UQTA 1JLGA 4F7VA 5B0CA 2R9LA 1WI6A 4XPCA 5KT3A 4KGZB 4WE1B 1NJIT 3DRSB 3D1QA 1PILA 3OJUA 2R8GA 4OLOA 2RU3A 3RZAA 4C9DA 3DGPA 1RBAA 5DM6Q 4DR7F 1HBMB 1U48A 2H9ZA 3W5ZA 1RT2A 1DAXA 3O44A 4ANDA 2GS8A 3T1HJ 1ZAVA 4LF2A 4F0HA 4MT1A 1MN7A 1NCLA 4JUZA 1A6LA 2JOQA 2WVDA 3M9OB 2ASYA 3UI3A 2CQIA 3R2DJ 4DN0A 4M94A 1CPZA 2DRDA 2M0GB 1QTNB 2G9OA 4NCGB 4B9LA 3MAAA 1UEVA 1XEZA 2NXJA 1VISA 3HULA 3MPYA 4K5RA 1UVNA 1H6KX 2CQGA 3DOLB 4IKAA 3WX4A 2M5YA 4I2QB 2QYCA 5EN1A 3PIPQ 3CC2S 2HRTA 5GADI 1HARA 5LSRA 2MKKA 2AGQA 4LT6A 4YB1P 4R8UA 3UVJB 3U1MA 2E5LJ 3SSRA 3Q86A 3EGZA 4DSFA 4USJC 1H2TZ 2YNGB 3DU5A 2VJVA 2IY5B 1K44A 2M4MA 1G6BA 1RAJA 1PYOB 5HVFA 3NNHA 3FFIB 2DD8S 3TVKA 2HNDB 2ZH7A 2DNGA 3K8VA 1RU1A 4ZDNA 2Z2LA 1SL0A 1KLMB 3JAMU 4GMKA 1LQ9A 5KFMA 1SKSA 2Y1JA 4PXBA 2QLWA 4DCPB 3MUVP 4KKOA 4H4MA 5ETKA 2W01A 3D67A 4WJBA 3UO0A 2XHWA 2MY7A 5D77A 4WKYA 5IOLA 1IBMJ 1GXLA 1YLXA 4RPFA 2E5GA 2QG9B 3M1VA 2KZZA 2DITA 3GG0A 2P6TA 2LU2A 4OMFG 2XMVA 4P6QA 3U7JA 5FD1A 4X66J 1TL1B 2HFSA 2ZNYA 1VI7A 1RAAB 4QPXA 3MR3A 4LFCJ 2DNPA 3NGRA 4Q0BB 4H4KA 3R7BB 1IWAA 4B9SA 1UA0A 1NK0A 5F9LA 3C46A 1TV6B 3W3SA 3I0RA 4RKUC 1OO0B 3KK3A 3MAHA 4FNIA 1RWKB 2MXYA 2CVIA 4WFAQ 4USVA 2VG7A 2UUBJ 2MQOA 3HT3A 1L3TA 2FLPA 3AD8C 1KNZA 4PQUB 4HDHA 2EVZA
chains in the Genus database with same CATH topology
4ELUA 1FKOB 1JXEA 3MTJA 3SQGB 2DVIA 4KV8A 3IWNC 2R7TA 4QIWD 3Q22A 3DC2A 1LWEA 3MEDB 2ASDA 1BY9A 2CJBA 2CPEA 2CKWA 5KFDA 5E3PA 3SV3A 4ECTA 4LF9F 3GIIA 1U1PA 3FJ2A 3JSBA 4N77A 2QMWA 4MK9A 2E5IA 2FVRA 4KB7A 2MYFA 2RVJA 4LSNA 4KT0C 1DBDA 3ONQA 2C3OA 3DDNA 1Q16B 4F25A 2Q79A 3H40A 3P3DA 5A0YB 3NRBA 3QJLA 1SJQA 3TVZA 2RSQA 4TU7A 5KFZA 1XR5A 2FUG9 5IM0A 1FVSA 3DN9A 4Y2AA 4IOCQ 3KOAA 3RW7A 1FJ7A 1UJ6A 1X4AA 3OVAA 2CJ9A 1SL1A 2PI5A 1U2FA 1VQNS 4ZPDA 2F3JA 1VQPS 4ZKAA 1HI8A 1SBRA 1Q53A 3CJ4A 5E41A 4I7FA 1Y3JA 3OXLA 3LO3A 2YNIA 3QIPA 4OHVA 4J5OA 2VPXB 1QJHA 4ECVA 2V0NA 3NS5A 2LECA 3GMGA 3ZZTA 3FRYA 4EFAC 2UVWA 4IOAQ 2DTJA 5SUHA 4NL5A 3KNAA 2R7RA 1KOOA 2JDJA 2B4PA 5KFKA 2ZKTA 3CGIA 4ZCLA 2L9WA 3G86A 4MIWA 1FNMA 5HBMB 3H59A 3FMBA 2IM0A 3AQOA 2OPSB 4DL7A 2RRAA 2EFOA 2NPIA 4RW6B 1LWFA 3IG1B 4DV3F 1JLQA 1S9GB 2L08A 2VBWA 4H4OA 4NMLA 2RQMA 4ICLA 3ETOA 2HFZA 2J0XA 1LOUA 2UXCF 2MJNA 2A3JA 2B5JA 4PG6A 4QIVA 4G1IA 2QRRA 3QPIA 2M8HA 4O3NA 2M88A 1N33F 1ZZNA 4ZPCA 3ZZYA 4FS1A 1KQSR 3VZIA 5EGYA 3PNIA 2EG1A 3CCTA 3HHLB 2ILZA 3VTIA 1FRKA 5HN0A 2JVRA 3AB2B 5KFIA 2YX4A 2W9BB 2UV8A 2OPRA 4CO1A 4K50A 5FJ4A 1DARA 2FGCA 3VF0B 3MAQA 4IO1A 4K0KF 1YGYA 3OR2A 1BQMA 1VBYA 5HP1B 3KTQA 3H5XA 2K2PA 2Q6BA 4UOCA 4KHPF 5FIIA 1WI8A 1FRJA 1WHXA 4BWJA 2B9XA 3OTCA 2WK4A 2HWIA 4C0OC 2HS4A 1NK8A 4J9MA 2AJ1A 4C3LA 4DG1B 3GB0A 4CZCA 4ED2A 3GV7B 2G1DA 2JFKA 2QIFA 5KG3A 3NGDA 4CO0A 3M9MB 4UUWA 1LW2B 3UCGA 2NYIA 3CIZA 3MECB 3QGPA 5IWAF 1S0MA 5D4PA 4O3PA 5KG1A 3MURP 2MSSA 3T9ZA 3K5NA 5A8WB 4JI1F 1RK8A 1U7LA 2D3ZA 2MHEA 1S72S 4AE5A 1KC8T 2GIQA 2LXIA 2JLFA 4NLGA 4EEYA 1ZTWA 1HQEB 1HNIA 2BRKA 2IRXA 3CJ2A 4CCHA 4YDXA 5CA5A 1FKAF 3OVBA 1JKHB 2FD2A 5IT4A 2BR0A 1VGYA 2RILA 4ECRA 1LWFB 1SJ3P 1HMVA 5J1NA 1L5UA 2KZMA 1JLQB 3HHLD 2KXHA 1KEKA 2YWGA 2HHSA 4PCQA 4WTYA 1KS2A 1LW0B 2RF2A 4Z37A 5EHHA 2E5JA 1M5KC 4R0EA 2MZJA 3D0HE 3HPOA 1Q82T 2I2YA 5K8NA 2GFFA 3VWSA 4HHJA 4ZA1A 1YITS 3JYTB 1F5CA 3FZ2A 3M2RA 3GIMA 2RT3A 1JLAA 4AXIA 1XTZA 3S8SA 1FEEA 1TL3B 3HZEA 5DQHA 4FYDA 2NS1B 2NXUA 3QZ7A 3R3TA 2BM0A 1JLCA 2DGXA 4CTAB 5B0DA 3SMZA 3DYAA 4DN9A 3MR2A 4PWUA 3TP2A 4NXMF 2Z2MA 4OHXA 2N82B 2YKMA 3UWTA 4DF8A 3QJJA 2AU0A 2K3IA 2RD5C 2B7CB 2MQMA 1LV5A 5GAHI 1RYSA 3QYYA 2RQCA 1N56A 3DCAA 4FVMA 2LLZA 1VQ5S 2YWEA 2GNKA 2QSWA 2BRLA 4IDKA 2AX0A 5KFTA 4A47A 1KQFB 2OP5A 2HHQA 4GO7X 3N0VA 3NGKA 4I6WA 4AQYF 2IYGA 1VBXA 4ZPVR 3D0GE 4QWAA 3CMAS 4FN5A 4F3MA 3R1LA 3X1LB 4NLRA 2DH8A 2LA6A 4KE5A 1S1UA 3MMCA 4NYZA 2DBBA 3VCDA 4DSLA 2DNQA 3DOMA 4QWCA 4X4RA 2DK2A 5I3PA 4XIUA 1CQNA 1S1VA 3B4MA 3KJVB 2KTQA 3CJ5A 4RWXA 5CXTA 1U47A 1J5EF 2CDQA 2VL1A 3D28A 4I2PA 1LK5A 2K7JA 3KKFA 1IN0A 1URRA 2HG4A 4RW4B 4CIOA 3C66A 4LFAF 1WEYA 2XI2A 3DRRB 3SZ2A 1GH8A 3G6VA 1KN6A 4EBEA 1MNEA 1NH8A 2XNRA 2CJAA 1UEUA 3D0IE 2ERRA 4AL5A 2QMXA 1FDNA 3N5FA 4C3KA 1ZBTA 1TAQA 2ZD1A 5F8MA 2CQDA 5F8HA 2E9TA 1HBUB 3M6VA 3O3LA 2G13A 3IRXB 2CFXA 2XMJA 4NZ7A 4IFVB 5EWGA 3UFCX 4YR0A 1ZM4A 2GX8A 1CG2A 2IM2A 4IH6A 3KHHA 2Z8QA 3BSNA 4ZPWR 3ISZA 3C6TA 4K4YA 1S9EA 3OPKA 4A8YA 2B51A 2HQIA 1FRIA 4OZ1A 3TYTA 5KFGA 1YIJS 3BN4A 5HMZA 2XLKA 4FF4A 2W7AA 1C4CA 5CYJA 2N3LA 4DDFA 2UUAF 4WYWA 2GJIA 3V4MA 2IVFB 2RS8A 2JH3A 4ZK7M 4IO9Q 3TOQA 1JLFA 4AUKA 4CT8A 3S6EA 5E3RA 5J2PA 4I56A 2ALZA 3HHLC 5KOXA 1N5VA 1TL4A 4TQSA 3OR1A 4PUOB 1XNRF 2PFFB 2VG6A 2XULA 2YX1A 2HGNA 3DFEA 3K5PA 4HH1A 4X2BA 2DGOA 3V6HA 3FSXA 1K73T 2K1RA 1VK3A 3LP2A 2CIMA 1DLOB 2LKZA 4EU0A 2VKZG 1C1CB 3DRYA 3LUYA 4P7TA 2C42A 1FHTA 2APOA 2GGPA 2CQ4A 1I94F 1VQ7S 1S1VB 2FGOA 5F41A 5SZTA 2GO8A 2WONA 2YY3A 4F50A 3PW2A 4DJBA 3H2UB 4N5SA 5A6WA 1X7VA 2QE5A 2A10A 2CQ3A 2YNHA 3D54A 3NBPB 4NZ0A 3SV4A 4E8UA 3GG1A 1J5OB 3GYXB 4N56A 2UVRA 4PG5A 4HVZA 3W2WB 3DLBA 2N3OA 3CDBA 3G4SS 3B82A 2A18A 3TAPA 3G71S 1SJRA 2C3PA 5EDWA 5I42A 1FRHA 1CLFA 1FF2A 2VBYA 1TKZB 3JSMB 1PC5A 4LVNP 4QQBA 1JWWA 3DLGA 2VOOA 2MZTA 1N6QA 2XS2A 4C4WA 4EWTA 1BQXA 4LVOP 2RE1A 3MD3A 4RU9A 4LIRA 1V3RA 2RDJA 1S1WA 4DQRA 3C6TB 1BQNA 4PPDA 4USHA 1IJEB 3BGRB 3DLLQ 4ZP8A 2DGTA 2DPJA 2XSFA 1S10A 4RW9B 1TZ0A 4C97A 1H0HB 2WB4A 3PEHA 2F8MA 1Q8LA 4YB5A 2QA1A 1CC8A 2F9DA 5ITHA 2ZOFA 3KG1A 5J2PB 3THVA 4RNNA 1H2UX 2O67A 3OR1B 3OFEA 1R43A 3KHRA 3MM8A 1QVGR 1UL3A 2FB0A 3L7OA 4HLBA 3J81Y 2EC0A 1NK5A 4JBCA 2OH2A 1WEXA 2QV6A 3CT9A 2VH7A 2NUUG 5F0UA 2FC9A 4DQIA 3PX4A 1JXLA 4J9QA 4A8OA 1MU2A 1PC4A 2V4JB 1IBMF 4KJIA 2JSXA 4EYHB 4X4PA 1P9QC 4B3SF 5KFQA 1JK9B 2CQCA 2RB7A 2HZCA 4EBCA 2VODA 2DHAA 1CEZA 1TP7A 3NNAA 1C0TA 4LMZA 2IA0A 3PRDA 1YHQS 2FHJA 2B4VA 4D3HA 3TA0A 2ZOMA 3EZ5A 4GKKF 2IJNA 4FZVA 1RT3B 4U6PA 1D1UA 3OBIA 2J7UA 5JXSA 5F8JA 4HT7A 2IRUA 2BQRA 2ZDPA 3V4IA 3KLIB 5KFPA 5DLGA 3M2UA 2IBOA 3C2PA 4YP3A 2OD4A 2WOMB 1U1OA 4I0WA 4LF8F 2YKOA 2MSTA 2FY1A 3WDOA 5BYSA 2V4RA 3MHYA 4DUYF 1V6HA 5K8OA 5KFOA 1RTIB 4JI0F 3D1HA 2UVVA 1FNOA 1S48A 1SL2A 2XY7A 5KT2A 1AFJA 1SKRA 1QUVA 3OUYA 2MDAA 3U1LA 2AV5A 5JUMA 4ES2A 1JLGB 4FNHA 2PN6A 5HI7A 4DV4F 3PO4A 4JYAF 4IRDA 2B6AA 3S01A 1RISA 1GT8A 2ZH8A 4KTQA 1VHFA 3VAIA 1IBKF 3P5TL 1T95A 3OL9A 2KM8B 3HP6A 5C42A 1G2EA 4DSKA 4PWDA 1XERA 4X4VA 2EK6A 4ID8A 1N5SA 4YFUA 4OX8A 2PA8D 1RT6A 4M95A 1KVIA 1O5JA 2YQ3A 3M32B 3N9UC 5CYMB 2RU9A 4OJHA 2UUBF 2FVCA 3CWJA 4A48A 3E01A 3QWUA 3I9ZA 2KT3A 2OPPA 2F7VA 3CJKB 3OTOF 5KFFA 2GHWA 2V5HG 5DG9A 4A8SA 2GHVC 1RT2B 4MK8A 3OL7A 5HLFA 4O3SA 4FXVA 2BANB 4I67A 2CZVC 4P7VA 4YUDA 3CULA 3I31A 2XCPA 1FNXH 1N34F 1DQAA 3B8HA 2KFNA 5LXYA 3N6MA 1S1TA 1KQGB 3K2YA 4IR9A 2UV8G 4N76A 2CPJA 2J0QD 3KLEB 3TAMA 4Y6IA 2VV5A 5G4DA 1FEHA 3K57A 4AL7A 4J9KA 1NZAA 5E0OA 4Y2KA 3ULHA 3G6YA 4ZPTR 4C8ZA 5FDLB 1VC5A 1XMOF 3OL6A 4RW7B 2RKIA 3DMJB 4XAKA 3TO8A 1S1XB 4DV2F 2ATLA 2IFXA 1YJ9S 4ZHRA 1HW9A 1VRTA 4A8FA 5KFAA 3FEYB 5KOWA 5KFHA 4I6YA 2KG0A 3IC1A 4QWDA 2ZJQQ 1FK9B 2LYVA 4GO5X 3MPWA 1YI2S 3G6XA 2XLIA 1C2PA 2KDOA 3CDUA 2ILYA 3R5DA 4Q44A 3FZBA 5H9EJ 1E6VB 1GTHA 5KG7A 4D3GA 4ED7A 2J0SD 1WHWA 3EUNA 4U7CA 3FCHA 3M30B 4QR2A 4M1KA 3ENVA 4HDGA 2CVEA 1VOMA 4DL0C 2HVIA 4RNFA 4YDDB 1H38A 5D8HB 1IKYA 2RMLA 4O4RA 1JIHA 2ZBIA 5GAGI 1Y9OA 5A8KA 1B7FA 2UP1A 3FEZA 4M63A 4B3MF 1W2BR 1WG1A 2M2BA 2M9KA 1T05A 2LQJA 4ZCIA 2R2TA 3N5BA 3NWGA 1ELOA 3K58A 4PWDB 2I9SA 3VR1A 3R5CA 2YWFA 2JVOA 5L1JA 4H54A 3PM9A 3QGHA 3FNNA 3I0SA 1TKXA 3L7PA 4ITSA 3OV7A 4IFYB 3I32A 2FDNA 2XG8A 3DLEA 1UWBA 1G7CB 4M5DB 4WXWA 4N47A 2HVZA 1JJ2R 2HLUA 5L1KA 3NKYA 3GR1A 4R8UB 4A8QA 1S6QB 1YBAA 2HHHF 1WHVA 1RDRA 2QO3A 5K14B 4HTIA 2DR5A 3PEJA 1YJUA 1IXKA 4RBUA 3H2VE 2BBEA 2WCXA 2K7KA 4ED1A 1UETA 2IAJA 4PKDB 1HNVA 3V6DA 3PHEA 1GXTA 4TN2A 3CDEA 5EX0A 4CH0S 4ZP7A 2CJQA 2HW3A 3QLHA 4ILMA 4DS4A 1JJHA 4ZPAA 1M5SA 2D74B 1MW7A 3HVRA 3FGVA 4KO0B 2ASJA 1RT1A 2KVIA 3AA8A 3UE2A 3NP5A 4A8KA 1NB7A 1VRTB 3EYZA 1URNA 1HL6A 2DNMA 4OX6A 5A6PA 1DTQB 4QW9A 3Q8QB 3ENWA 4RNOA 3HHNB 1Q79A 3F44A 1TK0A 3RW6A 1TVRA 1OQ3A 1X4BA 2YTCA 4QYRA 5AE1A 1EP4B 2EK1A 1YVFA 4OJ3A 4R5PA 2ZHBA 1QE1A 4KFBA 4ECSA 3SFUA 2AW0A 1FESA 4YHHF 1SIZA 4XPEA 3GFYA 2ZNZA 3OFHA 2GCFA 1IKYB 1S6PA 3N6LA 5MAOA 1N5QA 3HVTA 4NXNF 3SCJE 3OL8A 2R8JA 2JEIA 4DL5A 1N0VC 3SCKE 1XR6A 2CQHA 2R4FA