1URRA

A novel drosophila melanogaster acylphosphatase (acpdro2)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
97
structure length
97
Chain Sequence
VAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG18505 PROTEIN
publication title Three-Dimensional Structural Characterization of a Novel Drosophila Melanogaster Acylphosphatase
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 20
structure length 97
sequence length 97
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1urrA00
5F0UA 2BJEA 3HHLD 4EFAC 3BF4A 1YG0A 2IYIA 2XMJA 2HLTA 1TZ0A 2ZDPA 2VH7A 2OMOA 1TUVA 4OJGA 1S6OA 2N7YA 2PD1A 2QLXA 3WDOA 1CPZA 2FB0A 5T7LA 1FEEA 1VQYA 4HI2A 2ROEA 1KVJA 2K7KA 2GGPB 5B0EA 1V3ZA 1N5TA 2KT3A 2BJDA 5F0WA 1GXUA 1WD6A 2OKQA 5B0FA 3MZIA 3LO3A 2HLUA 1FVQA 1VQSA 2K7JA 4QOTA 3F44A 2K1RB 1X0PA 1K0VA 3KG0A 4HH0A 4F67A 1AFJA 2QLWA 3KKFA 3BDEA 2XMUA 4A48A 2N4DA 4DPOA 2CRLA 3I9ZA 3IWLA 3BN7A 2ROGA 2OAUA 3HDSA 2PGCA 2RU9A 2OD6A 3GZ7A 5B0CA 2VV5A 3TOQA 2LQ9A 3DCAA 4HI1A 1GXTA 1OQ6A 2KKHA 1AW0A 1KVIA 1X7VA 2GV1A 1S6UA 4OIXA 2IYGA 1ULRA 1R6YA 1TL5A 2AP6A 4Y2KA 3CJKB 4OJ3A 4DL0C 3TNVA 2G9OA 3VTIA 4OJ1A 2XMMA 5K9FA 2BUNA 1N5QA 1LQ9A 2GCFA 2W4DA 2FTRA 3FMBA 3TRGA 1KQKA 5B09A 1W2IA 1TR0A 1Y9OA 2RSQA 3T9NA 2AW0A 2FHMA 3DXSX 2GFFA 3BB5A 4Q2MA 1TL4A 4A47A 2GA7A 1Y3JA 2XMVA 1YJUA 3FGVA 2KYZA 3LGMA 2AJ0A 2K1RA 4HL9A 2GO8A 3HHLA 5A6WA 5B0DA 2XMTA 1SQEA 1OQ3A 4ZOSA 1JWWA 3K7RA 2LQBA 1QUPA 1IUJA 1N5SA 1Q53A 3KNGA 5B0BA 1AFIA 3BGUA 4FNIA 2EW9A 2KT2A 2ROPA 1N5VA 2JDJA 4OJHA 1YJTA 2ASYA 3KG1A 1OSDA 2OD4A 5IXUA 4Q2LA 3UDCA 2RMLA 2HQIA 2LDIA 1YJRA 1MWYA 4YDXA 1URRA 4NPOA 2LXFA 1FE4A 2XMWA 3BR8A 3BM7A 1SB6A 2GGPA 1FD8A 4NL5A 2BBEA 5B0AA 1CC8A 2QIFA 1X8DA 2QYCA 1Q4RA 1YJVA 4A4JA 2K2PA 3LGNA 2N4CA 4HH1A 1Y3KA 3HX9A 1JK9B 2OP5A 4A46A 5B0GA 1Y0HA 2HFNA 2RILA 2W4CA 5A6PA 5T7LB 1Q8BA 2OFGX 1SI9A 3QGPA 4FNHA 1XBWA 4DN9A 2Q3PA 2ACYA 3FRYA 3HFKA 2AJ1A 2ZDOA 5KAKA 4Y2IA 2L3MA 3QMQA 2FIUA 1RJJA 4YEAA 1APSA 2XMKA 2BYCA 1FESA 1YRXA 1Q8LA 3MCSA 3CJKA 1CC7A 4ZA1A 1P6TA 1P8GA 1OPZA 2HFOA 3HF5A 3E8OA 4Y2MA 2W4PA 1U7LA 3HHLB 1FE0A 3HHLC 5B08A 1MWZA 2HIQA 3IWXA 2OFHX 2IFXA 1FVSA 4U9RA
chains in the Genus database with same CATH superfamily
4LJMA 5HQ8A 3M05A 4ECTA 5DDOC 1QY7A 2B6AA 2AMCB 1CJTB 4RW8B 4WP9A 3GJQB 1LWXA 3K5OA 4OYBA 4QU6A 3FQLA 4BDPA 1SH2A 2RQCA 2JEGA 1HR0J 4ZCKA 4Y2KA 4RW4A 3OFHA 2N82B 2DVIA 2DT9A 1CJUA 2EFNA 1H2TZ 2C2OB 1L3SA 3TA0A 4CP5A 2XGPA 1PC4A 3QIPB 2LMIA 3HHNB 1NPPA 2HHQA 5J2PB 3HULA 2MZ1A 2XHWA 1YJRA 5EWFA 2ZUGA 6FDRA 2DIVA 3IRXB 5HROB 3JQJA 4NEZA 5D3GA 3NOGA 2CQHA 3W2WB 3G6VA 3QWUA 3M8WA 1BQMA 1SL0A 1U6FA 5CYMB 3KK3A 3H8YA 4DQPA 1IR2A 4LRBA 3K2YA 1ZTTA 4U7CA 2PD1A 4DF8A 1WOOA 4WFXA 2ATCB 3UD5A 1MMLA 1D9AA 2RB7A 2XNRA 4NX9A 1FFGB 3OVAA 2FLLA 1E6YA 3DFEA 2CQ2A 2RAQA 4RWXA 3GJSB 1S48A 1IJFB 2XLKA 1NB2A 5J2NA 3POTA 2GJIA 3WIUA 2DPJA 4I4BA 3DXSX 1FKPA 1D3WA 3VGVA 3I9V9 4N47A 1KQFB 4I6AA 2VB6A 4X62J 3GWCA 1FA0A 1XR7A 1QVFR 3QIDA 1WF0A 3V4IB 2APOA 3VAGA 3AAWB 2AHOB 3HVWA 1F9EB 7FD1A 1VGYA 2HFUA 2IRYA 1CEZA 1RHJB 3PR5B 2XMKA 1SC3B 1Q8LA 3HPOA 1YKWA 3CT9A 4DS4A 5L1IA 4OHXA 2E5LJ 3CIZA 2QMUB 2N7YA 4Y0FA 4V19X 2AGQA 3D0IE 2ZHAA 2QL7B 1EETB 2BM0A 3QAUA 3KG0A 2QYGA 1FNMA 4LUBA 3DOKA 3ULHA 4F04B 2J0XA 3SCKE 1SJ1A 4EO6A 4DUTA 3C15A 3LPYA 2BXJA 1NSAA 1WKLA 3BB5A 4C8MA 1ZA2B 4BWJA 3A3PB 4AL7A 3LAMA 1AZSA 1UVIA 2J0WA 4DF4A 3CTRA 1V9OA 1H74A 2EK6A 2FJDB 2DNHA 2BANB 2OPPA 4IUFA 5CD4A 3LP2B 2DGUA 3DLKB 1UAWA 3V6DB 4C8LA 1TELA 4URSA 1O6XA 2OGUA 3DDKA 3D68A 2HNZA 4QPTA 2M0GB 4MKVA 2RRBA 5D78A 2XTJP 4CCHA 3PX4A 3M2UA 3M2RA 5KFJA 4Y2MA 3MMCA 1CULA 3MMAB 3BF4A 1D8ZA 3Q2TC 1DURA 1DTTA 5D4PA 3NL0A 4NA3A 4B3MF 3JS9A 2OI2A 2J76E 3KK1B 3MEKA 4QIVA 3I55S 2CIMA 4DCPB 2GJFA 5AT1B 2PGCA 3O6QA 2VV5A 2DRBA 1Z2ZA 2VU5A 4TYBA 4PUOB 3NWGA 4RO0A 3D2WA 2FY8A 5MLCV 1RBOB 2B51A 1WF2A 1HPZA 3MM5B 3J81Y 1KTVA 4Q43A 4ERDA 1S10A 4USUA 3OHBA 3MFIA 1R8AA 3RRKA 1SL1A 4AL5A 2Q79A 2A0FB 5A8KA 4K4SA 3LGHA 3A12A 3PCOB 5CYQA 5JVHQ 2PN6A 2E9ZA 1Q1KA 2VL1A 2HFZA 1Y00A 5BYSA 2RDDA 3FCVA 3DRPA 1NJIT 1T9TA 5M2RA 2GC8A 1Q7YT 3I0SB 3UDLA 1Q81T 1B4SA 1UP1A 4KFBB 5D0EA 2V94A 4AXIA 1X9MA 3KXDA 2XHCA 3LANA 2R7WA 1XC9A 1HIYA 1BE4A 1SKRA 4LVNP 1DHMA 3FBEA 4KGVB 3IM9A 2Y1LB 3PEJA 4DL4A 4OI0A 2BJ8A 2KTQA 3R8YA 4DV3F 4YHHJ 4CTAB 2ZZTA 4C97A 1WEZA 4YB7A 4HTJA 4USTA 4ZPAA 4JV2A 2QT7A 4YS2A 1K0TA 4OZ5A 1N6QA 3ETOA 2P9EA 1S1TB 2FHOB 3W2VB 2C22A 3Q89A 4W4MA 1X4HA 5I3UB 1JKHA 2FGOA 3J7YI 2FVRA 1N8RT 3NGRA 2NSBA 1TV6A 2Y8YA 5IT9Y 4FF4A 1FJCA 4NCGA 4P72A 4DX5A 3CO0P 4CLFA 4JI4F 1JXLA 2UXDF 3VVTA 2YVSA 5DS7A 1SCJB 3T19A 1XQIA 1T11A 1Q95G 4K4ZA 5GAEI 3CJTA 3BGRB 2DYAA 4LQ3A 1XIQA 3DRRB 1HNWJ 1KLMA 5HBMB 1XN9A 1KFSA 2OAUA 1HYSA 2OD6A 3GZ7A 2RJZA 4USJC 4DDFA 1X31C 4ECYA 4OJ3A 4U6PA 3K59A 3FRZA 1KONA 3KG4A 2HVIA 4DR1J 2FPHX 1UWAA 3PFEA 3KUGA 4G1QB 3SBMA 3CXCR 1VIXA 2EFGA 2KT2A 1UJ5A 3I4HX 4KKOB 3HHKA 4KPYA 1GFWB 2QMWA 1NH8A 3HI9A 3PXGa 5I42B 4OV6A 3QT8A 5C2CA 3R5GA 3SYZA 2KZZA 2N7CA 1JLCA 4M5IA 3P4UB 2KG1A 3MEEA 2GVDB 4ZJOA 1KOOA 2HKEA 4FVCA 2W9CB 4M63A 2HSEB 5KG3A 4DV2F 2EG1A 2YWWA 4WKRA 2FZKB 2KFYA 1YJNS 3CGIA 1X5SA 2V5HG 1WD6A 2MEWA 1DFDA 2XMUA 1IKWB 3CJ4A 3MM7B 3HDSA 2MZQA 4PR6A 2IY5B 4PWWA 3OSNA 5F8IA 3CCSS 1DJ0A 1BQNB 4ANDA 2H4YB 2YKNB 2ZKUA 1N5QA 4J9PA 2IM2A 1QD1A 3KMQA 3QFWA 1SIWB 3H2VE 3VQTA 1Y3JA 1LW2A 4HR2A 3PV8A 1RHMB 4C4WA 4ID5A 4C11A 2ROPA 2RU3A 1UEVA 4DSEA 1WJ9A 3D1QA 4XDCA 4KH0B 2B5JB 4CLTA 5E3QA 3HZEA 2UUCJ 3BPDA 4O0NA 2CPHA 3G2XA 1FEHA 5B0GA 1C0TB 2HHXA 3NWRA 4IQMA 2OTJS 2AGPA 1YRXA 2W2PP 1SV5B 2JEFA 4M8LA 2BM1A 3CC2S 2BRKA 2QX0A 1KN6A 1J2VA 2IM3A 2HK3A 2BOPA 4Q0BA 4Q5VA 2BQ3A 1PSDA 3A8KA 3KK2A 3LQVA 4DPTA 5KG7A 3B78A 4DWIA 1S6PB 2XGQA 4ECWA 4KC5A 3AODA 2CVEA 3FEZA 3ZTOA 3J7A1 1SKSA 3C14A 4IDKB 5AE2A 4PRFA 5F8GA 4HHUA 5KFBA 2RIJA 4KGMA 4LF8F 3AB2B 2E7VA 2XULA 3D67A 3GU0A 3E3XA 5K8NA 1VIOA 4WE1B 1IKVA 4C9DA 1LNQA 4KHRA 3FFIB 4F4XA 2GAGC 3EXCX 2VZ9A 5A8WA 4X2BA 4JOUA 2AJ4A 5F41A 4QIFA 3R7BB 4ZCMA 2DGXA 4DR2F 2Y1RI 4JI1F 5KG0A 4ZPTR 4F4KA 4LF7F 2FIUA 1QAIA 2JZ5A 2OEKA 1NLKL 3M6VA 3TQ1A 2HBRB 3M32B 4I7FA 1RZMA 2YWHA 3HD1A 4NYPA 3OW2R 3E01B 3BEGB 2O01C 2I5JA 2D9PA 3I0RA 3FNNA 1GX5A 3R5JB 1RA7A 2HLUA 3CD0A 4ZVOB 2HQCA 1WHWA 1M5PC 4ZP8A 4NRUA 3GIRA 1FK9A 3C19A 2WRMA 5HANA 1HW8A 3AQOA 4ZHRA 2MMYA 1AT1B 2C2NA 2V8HA 3TUIC 3Q8UA 4LF2A 2VG6B 2OSRA 3CW2C 3HKZD 1XMOF 4G6VB 4C3LA 1UWBA 3BGUA 1RTHB 3I4PA 2M7SA 4DV0F 3Q8YA 4OX9J 1JLGB 3SIPB 1FFWB 3RBXA 3AD9C 1Z2LA 2JRSA 2P6TA 2NQPA 3R27A 1FKAF 4CO3A 3LP0B 3KLFB 2XZTB 4HYKA 5I3PA 2F7VA 5KG2A 4UY85 3KLHA 2NUHA 5LMUJ 3HM9A 2QRRA 1RK8A 3MM6A 4OYMA 4X66F 1Y11A 2X3GA 4JI6J 4EGLA 2WZ1A 3ZC4A 4I56A 1TU0B 4X84A 2R7TA 1GAOA 4NOHA 1DBDA 4KO0B 4UOGA 4DV6J 5H1SV 2VPWB 3TZWA 4D3GA 3ILLA 2L9NA 4ZVGA 4W98A 4NLVA 3GIKA 3GSDA 3CD7A 4XPCA 1UVKA 1JXVA 3Q8SB 2BRLA 2GA7A 2J9DA 5D4OA 4AD6A 1KWMA 3OR1B 5J1EA 4ZIWA 4ED3A 2XS7A 2YPYA 1JX4A 2W24A 2CQPA 4K2XA 5DGAA 5E3PA 1MWYA 1OWXA 2WOMB 5C25A 4NXNJ 2HQDA 1X8DA 1Q4RA 2LQ5A 3FSIA 4WFYA 4ES3A 4PPZA 3R5DA 2MY7A 3W3SA 3R7NB 1AXQA 2DXDA 2RS2A 4QR2A 1KBRA 1EJ7L 4L3KA 1FXDA 2NS1B 1YITS 4OHZA 1IM6A 3OXFA 4DQQA 3S01A 2MKHA 4FS1A 1UW9A 1NK4A 2H5EA 5DETA 4A8QA 3SV3A 3DNCA 4PWUA 2H65B 4TN2A 2Q6BA 3VAIA 1W26A 2Z2YB 4FYDA 5ETTA 3DM2B 4K4TA 3M30A 3TJ8A 1LQ9A 2B9XA 5B09A 1U0HB 4B3SJ 5F8LA 1FJEB 3P5BP 3ILIA 3H2UB 2YQ1A 5B0DA 4NLXA 2IVMA 3OJSA 1N5VA 4C3KA 3GFZA 2CJQA 1UCNA 4RL1A 2WVFA 3N79A 3NLCA 4FBUA 5BYRA 1M5KC 2HRTA 4M95A 1KDNA 3M9NB 2E5HA 3HCXA 3T41A 1FDBA 3ZZRA 1MMNA 4RLEA 3DOMA 4UZCA 1WHYA 4NCAA 4PQAA 3H25A 1U1RA 5DRKA 1JQGA 3D0HE 1OY6A 4RNMA 3TA1A 4O3RA 4DOZA 2IC3A 4G1PA 4FXDA 4H54A 4KSEB 4RU9A 1X9WA 5HK4A 2YKOA 5D77A 2ZE2A 3QGHA 4JUZA 3MDFA 2YNIB 5HN0A 2PMWA 3TZZA 2ROGA 4W92B 3DGPA 2QA4S 1UJ4A 3HJFA 4FXWA 1U4BA 3IMQJ 3UE2A 4LVOP 2ASDA 4ER8A 1RYRA 4BLGA 3MHYA 4IR1A 4MTPA 2MPUA 3HMJG 3S1TA 1SH0A 2HW3A 1UMJA 2DRDA 5LOQA 5JVGQ 1FKOA 2AEFA 1NHKL 3G82A 1S57A 3QWPA 1R3NA 4GO5X 4U8VA 2ZWOA 2RILA 3BJYA 1U09A 4B02A 2DNGA 2FD2A 3WBZA 1GTHA 5KFDA 4UUXA 1RP5A 1RWOB 4OYIA 2DD8S 2ZM6J 4J5OA 4DL0C 1C1CA 4C8OA 2M8HA 4BS2A 3WC0A 5IFMA 3CCJS 3AXKA 4XAKA 3KHHA 5F0WA 1ZAWA 4ANEA 2OPSA 3EUNA 3KKFA 5KFKA 2HK2A 5ADZA 3K5NA 1VC0A 3DCAA 1FERA 4G3IA 2XMAA 2AX1A 1DY3A 4ED2A 1S77D 1HBNA 2B4PA 2J0QD 2IMWP 1VISA 5IM0B 3M6WA 3ITHB 4ENOA 2ZBCA 2YNHA 1R0AA 2LEBA 5LL6d 2NYIA 2FLNA 2CG4A 2MZJA 2ZC3A 2CJYB 4ZVTB 1RAGB 3H59A 3G87A 4JP8A 1CSJA 4NWBA 3OTOJ 2J7UA 2W25A 3CJ0A 4OV1A 4CLYA 5ETVA 1WC0A 2C2EA 3T1YF 3PRBA 2ZH2A 3J7YU 3CUNA 5BYQA 2BJ9A 1FE0A 3SV4A 1HBOB 1EP4A 4DEZA 2KL8A 2XM3A 3PRDA 4USVA 3PY8A 3I56S 3FZBA 4XIUA 3T3FA 2MZTA 4MIAA 1VLOA 2DIUA 1IKXB 2UUTA 5GAEU 3IWLA 1IBKF 3X1LB 2HMIB 4A8FA 1HKAA 3MTKA 4DR7F 4MJKA 3X3UA 1HQUA 3M8SA 2W4DA 4B3OA 1Y10A 1HNXF 1A6LA 2HZVA 1XNQJ 4J9NA 3KHRA 1OQ3A 3QLHB 4P7TA 4WFZA 4Q2LA 4U95A 2LDIA 1NJXA 4OMFG 2HVEA 3OUYA 1WEYA 1TL3B 6FD1A 4YN3B 3OL7A 2AYGA 2I6WA 3KJVB 3GP9A 2V2ZA 2CQ3A 4DV1F 2DXEA 2OFGX 3TUJC 4A8OA 4DFPA 4B9UA 2QLFB 2POKA 2MQPA 3FRYA 2RQKA 3AT1B 1U1QA 3HHLB 3MEDB 3PO4A 2AX0A 3IBCB 2ZEJA 3TAPA 4CLPA 4IFVA 3WX4A 4JI0F 2PI5A 4OJGA 3KLGB 4PXDA 2CPDA 2Z57B 1K73T 3AFGA 3ZZ0A 2ZH1A 1FXRA 1QVGR 4DPOA 2DGWA 4ILMA 2CNOB 3P49B 4G1IA 1K47A 3ISNC 4NLQA 4NEYA 4J9MA 1B0TA 3ZTQA 4KBIA 4YR3A 1WG1A 3DMJB 3TNVA 3TI0A 1U8SA 2UVUA 4DL3A 1X4CA 5HVFA 3H42A 1TUWA 4AQYF 4PPDA 2FJXA 4U7UK 4RX6A 3QT5A 2ZOMA 4E0DA 3VHQA 4ES2A 2KXFA 2OPRB 2D74B 2HWTA 1R43A 1C4CA 3UD3P 3BGOP 2HWIA 3R9LA 2B8QA 2Y1IA 2JX2A 3PM9A 2RUSA 4J9KA 3DLEA 1ZOTA 1RT5B 3J81U 5K14B 1FJGJ 2YNGA 4CWBA 2Q1LA 4P73A 2B0GA 5E7OB 2R7VA 1NZ8A 2ERRA 4KV8B 5K8MA 1ZAXA 3NAHA 1DTQA 4HEA9 4KT0C 4NZ7A 3BDEA 1UETA 4HACA 5C2GA 3K8VA 2FY1A 1UVNA 3ISND 4OX7A 1I6JA 3MM9B 4JV0A 2MKIA 1TR0A 4PWDA 4KGXB 4BHQA 4I2PB 4A47A 2GQQA 3FMWA 1N88A 4CQ1A 1TMMA 5L38A 2RF2A 4ZPCA 2J6TA 4DHVA 3JTNA 3OD2A 4M5KA 4LSLA 4WK3A 3R3TA 4O3NA 3CDEA 1QM9A 4P10A 1NJYA 5B0AA 2BBEA 4P2MA 2VQFJ 2PE8A 2GVZB 2R2RA 5F8HA 1U6BA 1LWEB 3IBFB 2C42A 3R1LA 5C24B 3B82A 2J8AA 4GVLA 1APSA 1S1XB 4ZA1A 2IRUA 3ENWA 2B43A 2GIRA 3PYDA 2NYHA 2RKIB 1HWJA 3UI3A 2OMOA 4Q45A 1GMVA 2HHHJ 2CJBA 5T7LA 4O3PA 3IR6B 5AXKA 1IJEB 5IT9U 4R25A 3Q83A 1YRUA 2OJ3A 1FO1A 3TZYA 2FDNA 1N33F 2EKYA 5IC4B 3HD2A 2ZVSA 1FNXH 4F02A 3TUZC 1Q79A 3FSYA 1WKKA 2L08A 2U2FA 2E7WA 3TW0A 1AA1B 1MU2B 3WX8A 2E9TA 4FYYB 1XTZA 2UUBJ 3KHGA 2EFVA 2WONA 2ZHOA 3RG6A 2Z2LA 2ALZA 1KFDA 4OI3A 2UXCF 2V6AA 1CJTA 3Q8VA 1VBXA 2W2OP 3TYTA 3OFEA 2W4CA 1S1WB 4DN9A 4ZPBA 1JLBB 2CPXA 4JI2J 4I6YA 3PHEA 1U7LA 1HR0F 1NKCA 1JJHA 1M1GA 1X4DA 2F8EX 4L3NA 1YTYA 4CO2A 5DM7Q 3QIPA 1SL2A 1C1BB 5F9NA 3A8JA 3MAAB 5ETQA 1IQZA 3HT3A 4YUDA 5M2PA 5J1PA 1WOPA 3IRXA 4EZ9A 2XB2D 2AJ2A 4AE5A 2DGSA 1YZ6A 3UNYA 4PZVA 1NK8A 1WHXA 3AA8A 4X64J 2MKJA 4I64A 4HL9A 4BCAA 5CYMA 2CPEA 1WACA 3KNGA 4FNIA 3PYGA 4O0IA 3GG0A 4MK8A 1TKZA 1O51A 5SZTA 4USKA 1B0PA 2NZ4A 2DNPA 4NLTA 3TAMB 2KG0A 4DSKA 3DGVA 2CWKA 1X60A 2CYYA 4Y2IA 2XY5A 4DFKA 4ED8A 2AGOA 2R8KA 3T5JA 3TJ9A 4DL6A 4CH0S 3BSAA 4OHWA 1U1NA 4DSJA 4R8UA 1ZETA 3MCMA 3FK4A 2IM0A 3VF0B 3MR7A 4N77A 1S4EA 2EFOA 1S6OA 2HIYA 2Y3YA 4X62F 4DPUA 5B0EA 4F26A 3OTCA 1L3KA 4TYAA 2HNDA 1NHUA 2K1RB 3Q0AA 1AFJA 4CT9A 1FNOA 3LOUA 5HI7A 5D6GA 2JOQA 3M7VA 2HQFA 5EHHA 2JHEA 4K7QA 1OQ6A 1S0NA 4M5JA 4RBUA 4O44B 4PQUA 2PI4A 2VPXB 1S9GA 2AF6A 3UN3A 1BGXT 4CT8A 3OVSA 4ZS6A 2ZOGA 5B0BA 1QSYA 1C2PA 3OL8A 2M2BA 2XO6A 1FX4A 3VV2B 2RMLA 2EKNA 5ETLA 4ECZA 4YDXA 4EBDA 2LECA 4H4MB 1CS4A 2HNYB 1FF2A 1JB0C 3DRXA 1S5ZA 1F1BB 3QMQA 4YEAA 3KNAA 1X5OA 4CO1A 5CXTA 2GMJA 3PW4A 4C98A 3CC4S 5G0RA 1T7PA 5SUHA 4AUKA 1HBUB 3IG1A 3NGDA 1RT2B 2SXLA 4OZ2A 3M8PA 1RE1B 4ILRA 2BANA 2DRAA 3VAHA 1ZM4A 5KG6A 3ZZUA 5ETSA 4NMXA 1R0BG 2FHMA 3C46A 2CQIA 4RW7A 3OXLA 2GNKA 2VJVA 2JLFA 4LF5F 1RLDA 4K4VA 2CPFA 2GQ2A 5LXYA 3MMAA 4A8WA 1T05B 5ETKA 1YQHA 1TVRB 3JYTA 2R7UA 1P1LA 2GAHC 3CVKA 1S9FA 4OYAA 1Q82T 4I2QA 3MM8A 4ZVHA 3V2UC 1S1UB 2MHEA 1TKXB 1M5OC 4DZDA 4HDGA 2CJ9A 3CWJA 4JV5J 2FJVA 3GR1A 4KY3A 2DNLA 3OQ2A 2FJBB 3F0NA 5L1LA 1Y7PA 3FBFA 1FWLA 4CO5A 2MHNA 1Q86T 3DLGA 1HWUA 1HNVA 1NZAA 1SJ4P 5KT3A 4X4OA 3BV8A 3D3CJ 4FP9A 2GZOA 1S0MA 4A8SA 1F5AA 4J9VA 1J5OB 1EKSA 1N32J 2AIRB 2NXNA 2ZNZA 4IH7A 2E44A 1JXEA 3T6BA 5IQ6A 2LQ9A 3TEHB 5LSRA 1Z4UA 1RT3A 4C3MA 4DPWA 5HQMA 4BBYA 3QSYB 1ZZFA 3EPGA 5HJYA 4LF6J 4KFBA 2X51A 4WZMA 1R8PA 3P6YC 2CNNB 3TP2A 1NDKA 1KKHA 1NK7A 2QJ3A 1U1KA 3L95X 2H5IB 4RU2A 2PC6A 1RTJB 4Q8FA 4S0MA 3W8GA 3GV5B 2B6AB 1TL1B 2RQMA 2Y0SD 3HF5A 2E1AA 4W90B 2CJAA 4L74A 4K4UA 3ZZTA 5C5JA 5KFZA 1TL7A 4YHHF 1RTIA 2VH7A 3NCRA 4LRCA 2X1FA 2UV8G 4OZ3A 1V3RA 3P45B 4RW4B 3BKTA 1UEKA 1PC5A 1SPBP 3BSCA 3TWZA 1FT8A 3R5AA 3H20A 1S1TA 3HHDA 3AJ2A 2DGOA 1AUDA 4UOHA 2CPZA 5I3UA 1M5VC 4X4VA 2ZH4A 1JLAB 3QRPA 2PEBA 3CCWA 3MPDA 5JUMA 5EUHA 3IAS9 2R2SA 3GYNA 4YB1P 3MUTP 3V81A 2ADBA 1YGYA 2MYFA 3G6ES 2YH1A 2FC8A 2WVDA 3MURP 5A2QY 1OSDA 5IWAF 3BGRA 1MSWD 2QE5A 3IS9B 2QYCA 2AD9A 2AKWB 1HNWF 2GS8A 2QFJA 3W9HA 3PX6A 2HEKA 4ZPWR 1SUQB 1Y5NB 1GMUA 2G13A 1Y4ZB 2N3LA 3QRRA 3UQSA 1KP6A 1E6YB 2AYMA 4RWWA 1M1HA 2R7SA 3D5MA 5F0UA 1RHRB 2HLTA 2XYGB 5J2NB 4GKJJ 1VCTA 3WDOA 1ZM2A 4PXEA 3PIOQ 3DLBA 4WTYA 2JC1A 8RUCA 2GX8A 4KKOA 1VQ6S 2QA1A 3ZXWA 3KDOA 4P6QA 1Y5LB 5I42A 4OI1A 2ZJQQ 2VFUA 2LLZA 1ZYQA 1RAHB 5IZHA 4Q44A 4ZVUB 1L3VA 2CPYA 1R8BA 2ZKTA 2K3IA 4F8RA 2DCLA 4OQJA 3CDWA 4J90A 2ZH5A 4I0WA 2HPUA 3FC9A 2AWZA 4ELVA 4WXWA 3KYLA 1WI6A 1Q53A 2CPJA 2W7OA 1WG4A 1MWQA 1X5PA 3G71S 1K44A 2DK2A 4XK8C 4TLQA 3NS6A 5KFVA 1SIZA 2G2ZA 1NPKA 2ABYA 4ECRA 2NSCA 1RISA 2CA9A 3MM7A 2E5GA 3QGPA 2M5YA 4AXJA 4ZCLA 2UUAJ 1BQNA 2DNNA 2BQRA 2KM8B 2CQBA 3DDNA 8ATCB 1EB0A 4NLPA 2HGNA 4IKAA 4F25A 2XMJA 3C15B 4NLUA 2MKKA 4UF4A 4I67A 2YKPA 2F9DA 4ECUA 2J7WA 4ED0A 3IAM9 3ZZYA 2P2CB 2B5JA 1NXIA 3ILOA 2OELA 3PVXA 5FLXY 2UUCF 2LP4A 1N34J 2V8DA 2DXFA 4RW9B 2R9LA 1RWKB 2LXIA 3MPUB 1SV5A 2OPQB 4FN5A 2ZBPA 2KI2A 4QPXA 2HNZB 2FJAB 1RAJA 4MIWA 4DCOB 4K0KF 3M2UB 3M2RB 2XMWA 2J8SA 4ALZA 3FEYB 3Q8QB 3PDNA 5HJXA 1DQ9A 4B3MJ 1AROP 2KVQE 2M4MA 1S6PA 2YWEA 3EDQB 4V19J 4A8KA 5HP1B 2U1AA 2W4PA 2BJ1A 3NKYA 3EVOA 5E2QA 4DV5J 2OFHX 1GQEA 2DHGA 1WORA 4NRTA 3H5XA 3LALA 1H2VZ 1P9QC 5KFFA 4P7VA 2FJWA 4P2XA 4HVZA 1U1PA 4K50A 2RVJA 3OSPA 5J2MA 3VGSA 2JL9A 5A8KB 5DDPC 3NS7B 2HAFA 1B7FA 3D0GE 4OIXA 5CYQB 1F60B 4YY3J 1PGZA 2UP1A 1F0XA 2O5DA 4ZLLA 3MECA 3MXHP 4QW8A 2DNQA 2IMOA 3DRPB 5AJ3J 2E66A 3FCWA 2XS5A 3DI6B 2W2MP 2XZWA 3UCGA 2IDLA 2D41A 1UFKA 3IGNA 4MK7A 2Q43A 7FDRA 3SXLA 1U2RA 3GB0A 2FVQA 4OYXA 1VC6A 1TKDA 3PG9A 1YJVA 3F56A 4FKXA 1P1TA 3RW6A 5A0YA 1B0VA 1FESA 1HLWA 1TTHB 3EXYA 4MH8A 5KG1A 4DR3J 2E1PA 3MCNA 2E1RA 3SSQA 3P5TL 4DV3J 1FRHA 1IKYB 1BXNA 3G4SS 3BO2A 1EQMA 2D69A 3QZ7A 5HLFA 2PA3A 2CJKA 1R6VA 2XBPA 4OX9F 4C8KA 3H2LA 1KRPA 4FKYA 3RTVA 3LP0A 1FTRA 2XI2A 2PT0A 1G3OA 3EGVA 4IR9A 5HQLA 1EX8A 1HI1A 1KQSR 1JKHB 3DOLB 2KYZA 5LMUF 3BN4A 2P6SA 4KQZA 3HXMA 3L7OA 1R27B 1S59A 3OT9A 3CB4A 1FXLA 3VAKA 4QZVB 4IRKA 2FQQB 3CDUA 2DNZA 1EQ0A 2HG4A 4LFAJ 5DDQC 1XR5A 1O5JA 5GAGI 1A9NB 4KO0A 5IV3A 1S6QB 2ACYA 4DV6F 3N6LA 2EBGA 4TQRA 2FHKA 1Q16B 3T9ZA 2VKRA 4LSNA 3CDAA 3QT7A 3HSJA 4X4QA 1XMQF 2GGPB 1VFJA 1N5TA 3C3LA 3TAQA 1FVQA 1RABB 2Z8QA 2C3MA 3B6BA 3PYEA 3L3CA 4MAKA 4NXNF 1RWXB 4X65J 3LPEA 2P9GA 4F3MA 4ECXA 3JAMY 4F0KA 2E5JA 3R7SB 3TR5A 5E0OA 1T9WA 4J9LA 1RU2A 1TL4A 3RGIA 4F36A 3RB4A 1BHNA 2C2DA 5DZ6A 1UVJA 3FEXB 2I9SA 1JLCB 3CCZA 2VFVA 2FJEB 4EBEA 3GFHA 1JWWA 3MEEB 1RQ0A 2PEHA 3KJNB 3CJQA 1NSKL 3JSRA 3N4WA 1WC6A 3UR3C 4JV1A 4OLPA 4DV2J 1QLNA 1FHTA 2F8MA 4AT1B 3H0PA 4O4GB 2HFSA 2OP5A 3I82A 3DM2A 1JJ4A 4GVBA 2ZZMA 2GIFA 4LF4J 2UXBJ 4OFZA 3P3DA 1P8GA 2Z4PA 2WVEA 2F40A 3MF5A 1U0HA 3GCXP 2B3TB 1AYEA 1NNDA 4B3SF 4WTOB 1FTCA 5BR8J 5KG5A 3HK2A 1FEEA 4X4TA 1LW2B 5B0FA 2AYEA 4QOTA 2XQCA 4ID5B 1VQ4S 1T9UA 5KFAA 4CLWA 1K8AT 3DKDA 5HATA 1YX2A 4EK2A 4MIBA 1S4FA 2IYGA 1S76D 3CJKB 4ZP9A 3J7ZT 1H7XA 1XERA 4DX7A 2XMVA 4GKKJ 5U47A 1KD1T 2XY7A 1U1LA 3SCLE 3I5BA 3IA0A 3DC2A 1F9HA 4ZPVR 3K5LA 4DU7A 4ZLJA 3BKFA 2MXYA 3M8QA 1SB6A 1IQTA 1FWPA 4PG6A 1C4AA 1KQGB 2B9YA 2R3VA 1H0HB 3C2PA 2YNIA 4Q0BB 2N4CA 5D0HA 2MY8A 5CQGA 2G0CA 1XBWA 3U1NA 3KK2B 2DHSA 2PMHA 2YBVA 2XSFA 4LBPA 2F1FA 1IN0A 3TVZA 3Q8PB 3V6HA 4K59A 1F3FA 1FRIA 3C14B 1UVMA 2EPIA 2VD3A 2E5IA 1RT6A 3MR3A 3THPA 2ZH8A 2MQ8A 1IR0A 3RB3A 1EHWA 4ECQA 2EXUA 1VQKS 1NM2A 3EE3A 1AW0A 2E9RX 2VQEJ 2LEPA 3EZOA 1VBKA 2DNMA 2GQCA 1OSCA 3JSYA 4R0EA 4JI1J 2HGMA 5KFLA 2KB2A 1IUJA 1U1MA 4WKYA 4NI2A 4QCLA 4LQ9A 3KMSA 3ZTPA 4TU8A 3W5XA 5DO2A 3P96A 3R5BA 2OHDA 3HX9A 2A2DA 1NDPA 2ASLA 1IR1A 4HT7A 2V4JB 4M5DA 2Z2MA 2MZRA 3DDIA 1F3VA 2ZUAA 1RJJA 3NNCA 3MCSA 4CRJA 2MB0B 4DV7J 4USWA 2VJUA 3T1HF 4WZQA 4EFAC 2MLXA 3CJRA 2XCPA 3WZ0A 2V50A 2IA6A 3LP1A 4ZHRB 1CPZA 1UZDA 4KB7A 1WKJA 4USIA 2JLGA 4PXCA 3NS5A 2KRBA 4B08A 4OL8A 3WHIA 1U0SA 3PW2A 5L9NA 1UL3A 3M2VA 4OZ1A 3OTOF 4M5LA 1NAQA 4WU3A 2LVWA 2D3OR 1N5YB 1VC5A 1PAUB 1VBYA 1Q8KA 1GMWD 3HFVA 1G7CB 1HBOA 2QC3A 1QUPA 3HZGA 1JNZB 3KLHB 4E2FB 2HQIA 2ZNYA 2AEMA 3BR8A 1NMEB 5IV4A 4J7CA 1U48A 1S97A 1IKXA 1D9DA 3VQSA 1RWNB 2VIHA 2HMIA 1X5TA 1RTDA 4QJVA 2VF3A 2GMHA 3HHLC 2CZ9A 5HAOA 4XPEA 2Q66A 1DARA 4LFBJ 4DR6J 1ZAVA 3GV8B 2FVCA 1B3TA 1KS2A 4GO7X 3QLHA 2LYVA 4MYTA 4FZVA 3KLIA 2KT3A 1TP7A 4K5SA 5D0GA 2DY1A 3MPVA 4B9VA 4R5PA 1F6TA 1TL3A 1TMJA 2EBEA 2ALYB 3I5CA 2IHR1 3FJ2A 3FBBA 2NR0A 2XCAA 1NB7A 4YDDB 2GO8A 3W61A 3HHLA 3MEDA 3K7RA 4R0JA 1DRZA 2JDJA 1UEUA 3OBIA 4Z7CA 4J9QA 3PIPQ 1HW9A 4P9SA 3KLGA 4K4XA 3KFWX 3RUBL 1RUSA 4H4OB 1F2GA 1HWLA 2EI5A 1OJ4A 3FSXA 5HVGA 4LRDA 3RU0A 4MFBB 2HHWA 3HHLD 3CMES 2R4FA 1LV5A 3M30B 1WHVA 3C6UA 2FB0A 2F4VJ 2RT3A 1VHFA 1UJ6A 4WIQA 3R5CA 1N56A 1X4FA 2KN4A 5KFXA 3NAIA 4JI7J 2KXHA 4N8NA 1JLQB 4KYZA 5K14A 2RRNA 1XNRJ 3T9NA 1SH3A 4WK1A 1NBEB 2MQMA 3Q8RB 3DU6A 4ZIVA 2ZH3A 1RDRA 5CZXA 3DOMB 4MMOA 2IIHA 3MOZA 3ILJA 2DISA 2HURA 1SQFA 4NMLA 1HBMA 2IC3B 1NEEA 4KRWA 4LREA 4RW6A 3EGNA 2XNQA 1B99A 1WC5A 3MOJB 2ZE2B 1IBMF 2ILZA 3AH6A 3MM9A 3LUYA 2EFPA 1HMVA 2JNJA 1I1GA 2PO4A 4Z37A 2NXEA 3EVWA 3PKYA 2AJQA 3R1HA 1SXLA 2NXUA 5KFMA 4PG7A 1T9YA 1S9EB 3DLLQ 4DXLA 1NKEA 1E6VA 2Y1JA 1RCXB 4QYZJ 1X4BA 3UW1A 3SFGA 2DHHA 1KR4A 3BGFA 4O23A 4JI3F 2VQFF 1WTBA 1FKOB 4WBFA 2BABA 3G82B 1LWEA 3O5TB 3MEGB 5C24A 3RJMB 2M9KA 2KDOA 1S1XA 3HKWA 4Y2CA 4IOBA 4LIRA 4DSFA 5HMWA 5E3AA 4EI2A 2AYBA 3HSZA 3CCRS 1S49A 2BE7D 1ITPA 2LKZA 2PA8D 3ENQA 2HHHF 2J9DE 3GG1A 2PDAA 3MD1A 3J7AN 3OPKA 4RBVA 1N0VC 3CCTA 3CF5Q 1NH7A 2X1BA 2F9JA 5FDLA 3CJ2A 3M8ZA 3G86A 4J37A 2OPSB 4WU2A 3C8YA 5A2QU 2MGZA 4M1KA 3GYGA 1GEHA 3TJAA 4HKQA 1MU2A 1TUVA 3BGLA 3CSKA 1VQYA 4DS5A 1XJWB 5HMYA 2J9CA 3GFYA 2UVRA 1QAYA 2ZD1A 1HI0P 3CD6S 4P2SA 5GMKa 1FRMA 2YNHB 4ZJQA 2H51B 4MKYA 4DUZJ 2ZBIA 2BE2A 2CQGA 4JI2F 4CLZA 3ENAA 2YTCA 2WBRA 2VOOA 4TKTA 2DGQA 4JI8F 1T03B 5CCMA 4HLBA 2D9OA 3D9BA 4NLYA 4NLOA 3SMZA 1OPIA 3EX7B 2DR5A 1YHQS 2K06A 3MAAA 3G6XA 4Y34A 2DR7A 3MR6A 2Q3PA 1J5EJ 3ZNUA 3BQ0A 4P74A 2XWXA 1IWAA 2MLZA 4QU7A 1MWZA 5GAGU 1JNRB 2YPZA 4CLSA 3JSMB 4NLDA 3KTQA 4X64F 3JQMA 4B3OB 3CJSA 4DLGA 4RBTA 3PJXA 5GAHI 1W25A 4HH0A 2CQ1A 3NGTA 3KOAA 4URQU 2AZ3A 1V3SA 3D4JA 2W9BB 1ULRA 3TAMA 3MUVP 3VALA 5L46A 2DEJA 1REVA 4CM2A 2HFVA 3OUYB 2Y8WA 2AV5A 2OSQA 3R2DJ 1HQEA 1HHSA 3U1LA 4DJBA 2EW9A 4CLKA 5LMNJ 2EWHA 5FLXU 2BMBA 1PO6A 3QRQA 4QWBA 3DXBA 1PAEX 3QYYA 2E29A 3E2EA 4JYAJ 4QQBA 5KT6A 1CQMA 1ROFA 2HFNA 1KC8T 4L73A 4EBCA 4K8RA 2UU9J 1GTEA 3NEKA 1NDLA 4DFJA 3UPFA 3ETMA 3UDEA 3GQCA 3VAMA 3GILA 4HT5A 2ROEA 3ZZOA 1NRKA 2A2CA 4C0BA 3PW5A 3MZIA 1TKTA 1MROA 3L9ZA 2HBYB 2ZJRQ 2R7QA 4WIIA 3GTYX 1HNIB 2OTLS 4DV4J 1GXTA 4N76A 4QBUA 4B3TF 3I5AA 2F5GA 2XMMA 1T9VA 2BUNA 2IDEA 3SDEA 1R0CB 1LXJA 3KLEA 3CCUS 3DLEB 1HNZF 2QLBB 1FDAA 2KYXA 4B9SA 3K5PA 2BOAA 5RUBA 2YNGB 1T9XA 1QJHA 2D1CA 5J2QB 1VQNS 2ZH9A 1RT2A 1OY8A 4NLSA 2WBMA 5H9FK 3DYAB 3NOCA 3FVYA 2XSJB 4DLEA 3M1VB 4WFNQ 1IBLJ 2DKOB 3N9UC 3MMBB 5JMNA 1U8WA 3H90A 4FVMA 1ACMB 4RZRA 1Q5VA 2HFOA 2LQ8A 4HACB 2DR8A 1JMTA 2RDJA 1TZ0A 1FRLA 2DNKA 5H9EJ 1XR6A 3NP5A 4IG0A 1PJ6A 2AZ1A 4PWDB 5CABA 4MT1A 5E3RA 1NUEA 2J7KA 4PEOA 4EO8A 1LW0A 5DG9A 2IJFA 4OZNA 1V5IB 3B4DA 3QO9B 2B4OA 2J5AA 4CI0B 1RT1A 3MAQA 4LF9J 1N54B 4F3QA 3W64A 1RBLA 2CZ4A 3D6TB 3H7HB 4JV5F 2VDIA 4OI2A 2VUGA 3W63A 2LDYA 3MI7X 1TUGB 1TFYA 4NA1A 2DR9A 3S7RA 1YJTA 2IAJA 3KUEA 2NLWA 4ZJLA 2QLJB 3A3OB 2YXLA 1KLNA 3H5SA 2JJ4D 4LT6A 2R8GA 2BE9B 1UW4A 3UVJB 5T7LB 1VJWA 2PFDA 1NK5A 1GK8A 4C0OC 1CJKB 2VG5B 5L1JA 2NREA 2RD5C 1RWMB 2EC0A 4MKBA 2Y0BB 5D8HB 3QT6A 1FVSA 4LIWA 5HMXA 5KFGA 3K17A 2QLXA 2QFIA 4LF6F 2FHJA 4ZP6A 3CCQS 2KU7A 4DR5J 4KH1B 3RBDA 4TLRA 3NBPB 3PEHA 3RAQA 2W7AA 5B0CA 1KEKA 2HBQB 1RTJA 4ZLPA 1BWEA 2WONB 4ED7A 2UXCJ 2UV8A 4AFFA 4B9NA 4ED1A 3NGUA 4TY8B 1X0FA 5ETPA 1TL1A 3CEDA 2VHGA 1RHUB 3FBCA 3OHAA 5A76A 1YJUA 1X4EA 2RHQB 3BDPA 1S0VA 3FCHA 3I32A 3CCVS 4YB6A 3W65A 2KVIA 4EYHB 2HQ3A 2FHJD 2G1DA 5EDWA 4OX8A 4ZVQB 1VRUA 3BM7A 3JAMU 1I3OB 2CFXA 2R7RA 2K2PA 4UQGA 3ELHA 2MKCA 3S6EA 1UKUA 7AT1B 1UA0A 3L09A 4K2JA 3C16A 5ETOA 2VODA 5DZ7A 1PCAA 1JLAA 3RRGA 2VA3A 3FDSA 1U25A 2DGTA 2MSSA 1HA1A 4WPAA 2FC9A 1NSPA 3RW7A 1A7GE 1RHKB 3AXMA 1HFEL 1EKRA 1RT7B 3QGGA 3MAHA 3TUPA 4EWTA 4HHHA 3T5HA 3H5UA 2UVWA 2GIQA 1FJ7A 3QZ8A 1WDTA 3V6KA 3IS9A 4DL7A 2O67A 6AT1B 3BQ2A 4HI1A 2CKWA 5C7PA 5L8RC 2HGLA 1RWVB 4QYRA 3ET6A 1TKZB 1VMBA 1SUQA 2QV6A 3A8EA 4A8MP 1HHQA 2XY6A 3SSSA 3E51A 3UN5A 3GYXB 3OL6A 4GMKA 2RQ4A 3UDCA 3NGKA 4GKJF 3UR0A 4R8UB 1BC6A 4IG3B 3HVTB 4KTQA 2ZC4A 1VQMS 2UUWA 3W1YC 4Y6IA 4I1TA 2BZ2A 3OLBA 2HNDB 1RACB 4CLUA 2ZOFA 3ZZZA 3VZIA 2KM8C 1EIYB 2IPOB 1FDDA 4OYOA 4X4PA 3BBFA 4DU8A 1IM4A 4CNYA 1U2FA 3JQKA 1H6KX 5E3CA 4PQUB 2HHVA 2RHSB 5CD4H 2AQ4A 1LFWA 4EYIB 1TAQA 1V3ZA 2VICA 4YMEA 2Z58B 3EVMA 1S9GB 4ZVFA 5M2UA 2ZHBA 3RBEA 2B7CB 3CDBA 2UZAA 5A8RA 3KDNA 2O3DA 3IN5A 2V2VA 1UPPA 4DSIA 4AL6A 1QSSA 2V34A 3IFEA 3OL9A 3L7UA 2HZCA 2HWHA 4D3HA 4IO1A 4NXMF 2VC1A 1CS4B 3FGVA 2UUAF 1YBAA 5A6WA 3UO0A 3LWMA 2YNFA 3OR2B 3P8BB 5G0RB 1NPRA 1VQLS 4Y28C 3IG1B 4J9RA 3D3BJ 1Y0HA 1L3UA 4DN0A 3QAEA 3U1MA 5DLGA 5KFNA 3I31A 2DB1A 3M8PB 1OPZA 4RW9A 1N34F 1KSPA 1X9SA 4XDDA 4IQXA 2YWKA 4KGZB 1OYEA 2OPQA 4KJIA 4LBHA 4RW7B 1B64A 2RUGA 4LR8A 4LF5J 2R42A 1LWFA 5CH7B 1NK6A 2WB1D 3DRSA 2OMLA 4DPYA 1H7WA 3KLVA 2G4BA 3JYTB 3IP0A 2VG7A 5DQIA 4F4AA 1U2CA 2R7OA 1W2IA 5KFPA 3LA0A 4I2QB 3OXGA 2ILYA 3MM8B 5HP1A 2AJ0A 1U24A 2AT1B 1CJVA 4DV5F 4A8YA 4YR0A 3HO1A 4DMZA 3NRBA 2HRUA 3A4TA 2NXJA 4F50A 4TVAB 2YX1A 3G6YA 4B9MA 5HL7Q 3U7JA 4M5MA 3DLGB 1HNVB 4ZN1A 4TU9A 1WC3A 4RJVA 1Q8BA 3CIMA 2AJFE 3SQOP 2WVCA 1B70B 1AUSL 4DSLA 1IWGA 4YY3F 3OTEA 1ZS6A 2B9WA 3KHLA 3PACA 1HWIA 3DI6A 3Q86A 3OV7A 1RT3B 5AJ3F 2W2NP 1F9FA 1CQNA 4DUYJ 5KFYA 1DLOA 1U02A 2OUGA 1LK7A 2I8EA 1PYSB 1S79A 2YQ3A 4RNHA 2KKHA 1WOSA 3T5LA 1R31A 3H5YA 4UW2A 2RSQA 2KRRA 2IM1A 3BYRA 4Q8EA 4OYWA 4K4WA 3LH2S 3QJLA 2GW8A 4DR3F 1S1VB 4F2RA 1JLFA 2C3PA 1VI7A 2DNRA 3QJJA 4JI5F 1IKYA 2QG9B 3MMJA 3LW5C 1T3OA 3MTJA 3T5KA 4WFAQ 1TL7B 2L9WA 1RTIB 2QIFA 2A18A 3W5YA 2B7BB 2J6SA 1NK0A 2BA9A 3D6HB 3BBCA 1T95A 4IFYA 3IRWP 3HFKA 3RR7A 5DM6Q 1YIJS 1TQLA 5MAOA 2LA6A 3TEGA 4F3OA 2YKMA 5K8PA 3DOLA 2Z30B 3GONA 2A10A 2QGFB 2HHPA 4CH7A 4KPCA 3D7SB 1UZHA 2R8HA 3V81B 3B4MA 4DG1A 4NLRA 1OS5A 4CLLA 3N6MA 4LF1A 5IWAJ 1N36J 5GAHU 4PG5A 2EEYA 1RAEB 2M88A 5CAAA 4LFAF 1KQKA 4FYXB 1S6QA 3HSDA 5EGYA 1LEOA 1RAIB 1YRTA 1DQAA 4QWAA 2LCWA 2MKYA 3N5BA 2VKZG 5IXUA 2DPIA 2GGPA 1FD8A 1UTAA 2ZBQA 3SQGB 1CC8A 5L1KA 4QIEA 4FYWB 1XK8A 3EICA 3KWMA 3J80Y 3O8WA 1SI9A 2A1BA 2FZCB 5KAKA 2HYIB 2CADA 1RT4B 4X65F 3MD3A 5DGBA 2RNEA 4U9RA 2XO7A 2IYIA 2HAIA 1HWKA 1S99A 4RUCA 2HVDA 2ZITA 3GIMA 3G8QA 2F65A 4F67A 2CQDA 4L6V3 2MZSA 4ZVPB 4O4GA 2QMXA 5CYJA 4WF9Q 3Q24A 2MQLA 3M8YA 3G8TA 5E33A 2YQ0A 2IBOA 4C6AA 4RW8A 4F4WA 3AA9A 4LF4F 2UXBF 2V0NA 1QAJA 1GX6A 2I1RA 3D1HA 1BWVA 3THTA 2WSCC 2F4FA 1LK5A 5BR8F 4F0HA 4ZVRB 2C2KB 5AE1A 1S0OA 4DQRA 4OHVA 2V9KA 3RAMA 1T8EA 1VLYA 3L7PA 2NZCA 2BKPA 2FGCA 2ZDOA 4WYLA 3HSGA 3CJKA 3PW0A 5J2PA 2Z0GA 2OLWA 2IFXA 1WDDA 4V1Ak 4E8UA 2BW2A 4IO9Q 4GKKF 5E5NA 4IH6A 4F4YA 5HROA 5IT4A 1NDCA 4OYPA 2XS2A 2OKQA 3W2WA 5DLFA 5KT4A 2BEFA 2W9AA 1I94J 1HARA 4K0KJ 4HHJA 1WF1A 1RI7A 1MLAA 3IXQA 2VASA 4PCQA 2P8IA 3VZHA 1O8BA 3CPWR 2EC2A 3GIJA 4B17A 1M5SA 4LFCJ 5THWA 3PZPA 4EMDA 1D0EA 3GJTB 5FJ4A 3Q22A 2ASYA 5C42B 3W60A 1VRTB 2YWGA 1EARA 3O1LA 2V8PA 1VRQC 2ZJPQ 3TX0A 1CBKA 4FNHA 3V5RA 2VQEF 3V4IA 2W7PA 5J2MB 4B3RJ 9RUBA 2K8GA 1C0UB 2KJVA 1U49A 1VDHA 3VCDA 5B7WA 4F4ZA 1HD1A 3M8RA 4ITSA 2CAJA 2V63A 2ZWPA 4KHPJ 3MWBA 3MECB 1OO0B 1PYOB 3C6TB 1X0PA 4L72B 4Z2XA 2MTLA 3M4XA 3S8SA 2LQJA 4CDIA 3HFZB 3NMAA 2RU9A 3I87A 2M52A 4X4NA 2NPFA 2A3JA 1WELA 3GFXA 1Y5IB 2D7SA 2G9OA 2E5LF 1GNKA 1A0OB 2JLEA 2V4JA 1BQXA 1QE1B 1EETA 3M9MB 5FD1A 4DV7F 4J9SA 4ATNA 2B4VA 4RPFA 4ID8A 1AFIA 3T1AA 5A0YB 4WFBQ 4OJHA 2I0XA 5KFWA 4IOAQ 3D66A 3BPSP 3MFHA 1URRA 5AE3A 2HBZB 3G8SA 3O2IA 2JEIA 4P52A 4DPXA 2BYCA 2DH8A 5HLFB 2O66A 4YP3A 2G2OA 1N5YA 4LR9A 5GADI 5IS2A 5ETMA 3LP2A 3DLKA 3B8HA 4KR0B 2LU2A 3V6DA 2VPYB 3ZTRA 4I68A 4NASA 4QWEA 1N52B 2WW4A 2KHDA 3JTOA 4QYZK 2ZH6A 2HZAA 2IVFB 5ETNA 3CD5A 2A6MA 2P9CA 3KK1A 5KFIA 3ZTSA 1GT8A 5BXIA 1JLEB 1M90T 4LFBF 1Q7LB 4PUOA 4DR6F 5DG8A 1ICEB 2KZMA 1QUVA 2G0JA 4LSNB 1PJ5A 4CO0A 1D1UA 3MM5A 1V6HA 2V2QA 1XMQJ 1R8CA 1SVDA 3EJMA 4UOCA 2H1YA 2CXEA 3AB4B 2V9WA 3L4BC 2VPZB 3E8OA 1LWCB 5KFEA 1RA6A 4NE9C 4ICLB 5DQHA 1YI2S 4DR4J 4ANCA 3SEOA 3SZ2A 4CH1A 2ZDPA 2QL9B 3I0SA 3DRYA 2XYPB 3BO3A 2WHOA 4ZITA 1DZ5A 3AOBA 3TANA 1L5UA 2CRLA 4TU7A 5BJRA 1NJWA 2O1PA 2CQ4A 1KVIA 4CYUB 4H4OA 1BD6A 3WIVA 2DR6A 3FMBA 2AW0A 1RWWB 1N48A 3ENVA 2GMLA 1ELOA 3BQ1A 4MFBA 3AOAA 1VQ5S 4GVBB 2C2ZB 3J7Z5 3JXOA 4NLGA 2V4QA 3CCLS 2R2TA 3F41A 5CZVA 4J91A 1WSRA 2JC0A 3TX8A 1VQOS 2F4VF 1S7HA 1HQ2A 5F8NA 4CTAA 4CIOA 4O4RA 4F0MA 1PYTA 5CA5A 2MLYA 2YKAA 5D15A 1FD2A 2RE1A 1VQPS 1CJUB 2XI3A 3AJDA 1GXLA 1JLQA 3H98A 5T41A 4JI7F 4URGA 3W2VA 2XC9A 3THVA 3QSIA 1XNRF 1IVZA 1U26A 1RSCA 4FF2A 3QBCA 4IYQA 5AXMA 1N0UA 4NYZA 3V4MA 2Z56B 1MNEA 3MCOA 5DQGA 4DL5A 2BV3A 1K0VA 2QLWA 3SI8A 2VBYA 2ADCA 5D3GB 2CQ0A 1Q78A 4PYAA 4QR1A 2X1AA 1W7WA 1RGVA 1BQMB 2F8HA 3R97A 4WP8A 3M8QB 2GCFA 3NG8A 3OJUA 5HVHA 1HHTP 4EEYA 3DN9A 3KK3B 5CHCB 3OTBA 2W8KA 3DRRA 2D3ZA 4BC9A 3LGMA 5HBMA 2AEJA 5FIIA 4EUVA 4NYOA 4ZN3A 1T3NA 1PBAA 3I96A 2VDHA 1S9EA 4FDFA 2GHWA 4O3SA 4G1QA 4A4JA 2R8JA 4DR1F 1RT6B 3POTB 3CULA 5LXRA 3FUYA 1FKPB 1D09B 3SCIE 1OIAA 3AQPA 3MEGA 5LSOA 5IC6B 1H72C 3JB9k 3SFUA 2MKSA 2WSFC 1YZ7A 4OX6A 1XWLA 2GVDA 4I69A 2G2YA 1SKWA 2YKQA 2W9CA 4JB8B 5HMZA 2H54B 4NI2B 2DO4A 5DDRC 4ZVSB 1R6YA 4DX6A 4ED4A 4Q2MA 3M9OB 4RUHA 5J1NA 2DBBA 3CNQP 4OI6A 1RB0A 1IKWA 4M5DB 4ZMMA 4PAAA 3CJ5A 1WG5A 4UUWA 2JVRA 9ATCB 2OD4A 3U02A 3T1HJ 2YKNA 3DOKB 4Y00A 3LP1B 2VBWA 2BX6A 3V6JA 2YX4A 4ETZA 5T14A 1FWKA 2AJ1A 5I4MA 2RDIA 4N41A 1YSJA 1AZSB 4DUZF 1KTQA 5EX3A 3PJ9A 3M2VB 3RAXA 5H9EK 2B4UA 1UFWA 1C0TA 2EK1A 4YR2A 2OPPB 3DHXA 2R2UA 3TVKA 1GXUA 3EM1A 4CO4A 1T03A 2VA2A 3PO5A 3KJQB 2BQUA 2VBXA 1TK8A 1FX2A 2VFSA 4HTIA 1D9FA 1K9MT 2JEJA 1VOMA 3ZFVA 1YDLA 3MMCB 5ETRA 1CULB 3EGZA 2LA4A 1J5EF 5KG4A 1DTTB 2K3KA 3DLJA 1RTDB 2FVPA 2JVOA 1WNEA 1H38A 3RB6A 3JSMA 2OH2A 4IDKA 4P75A 2HS3A 2LXFA 3LF0A 4KE5A 1SJQA 2IJNA 2QSFA 5ITHA 1Y3KA 4N8OA 1RXOB 2CDQA 3KLIB 2C3YA 1HPZB 5LSLA 2ATLA 4WE1A 2W9BA 3MGJA 3FFIA 4R5PB 1O0PA 1VQ9S 4L75A 3LO3A 2NPIA 5LMNF 2BACA 3K58A 3GIIA 1B7YB 3VGTA 1UA1A 3M32A 2XZDB 1RHQB 5AXNA 3E01A 1TL5A 1IXKA 4RNNA 4JYAF 4LRFA 1PKUA 1G1XA 3DU5A 2UU9F 5EN1A 3IR7B 3K0JA 4LMZA 4ELUA 2I38A 2LQBA 3QGIA 4YB5A 2QSWA 1S7IA 4J9OA 2Q6CA 4KHMA 1FE4A 4PKDB 2FLOA 2XEXA 2HHUA 1U45A 2VG6A 1CG2A 2H9ZA 3UCUP 3C6UB 3BSOA 4A46A 4DI6A 1FDNA 2XYHB 3ONQA 3GMGA 2CVIA 2IA0A 4FYVB 1HNIA 1QDUB 1RTHA 3NNAA 4NZ0A 2WK4A 1RAOA 4DV4F 3EDRB 1JLGA 3H4DA 2BJEA 3ZNJ1 3K57A 2QA4G 1N6QB 3UN2A 3KLFA 3K8WA 2QN6B 2GO9A 1M5HA 4CM0A 5J2QA 4ECSA 2E7XA 4OZLA 3IM8A 3I9ZA 1TV6B 3DYAA 3K89A 1FFSB 2NCKL 2XSJA 3M1VA 4NCGB 2WAQD 3ADAC 4JI4J 3MMBA 1R7IA 1MW7A 4B9TA 2UXDJ 1IBLF 1HBMB 4JI6F 4E98A 3AJ1A 3CCMS 4RW6B 3RR8A 1IBMJ 2MQNA 4RNFA 3MR5A 4X4RA 3PTWA 1KLMB 3RB0A 2N3OA 3IBWA 3TZXA 2HQGA 3N5FA 4UY8T 1HMVB 1HYSB 4X4SA 1FI4A 1T94A 3FQKA 2ZBRA 5F9LA 4YQWA 4ES1A 5K20B 1ZTWA 2CNLB 3OR1A 2H4WB 3BH7B 1E6VB 3EYZA 3QO9A 2BDPA 2QZ8A 2JWNA 3R6GB 2C3UA 4IH5A 2C3OA 1G4CA 2WOMA 4JI3J 4LF9F 1J27A 2VFRA 2J0SD 4KAIA 1R8HA 1NU4A 4Z7YA 1H73A 4OZJA 2K7KA 1RCOB 4WXOA 1EZZB 2RH3A 1VQSA 2G0IA 1HI8A 2E1CA 3QJPA 3BYPA 1VYAA 1WEXA 4WYWA 5KT5A 3UVJA 2YH0A 4L76A 3BH6B 1CJKA 2DGVA 2VG5A 5AXLA 2BKNA 1N4LA 2EG2A 5GMDA 4CZCA 1SQEA 2LFVA 5FDLB 4FF1A 1MG7A 1PJ7A 4GC7A 1V5VA 1VHIA 1XMBA 3BBBA 4KIAA 2ZH7A 1TK0A 2MGZB 4NL5A 1FCAA 5KFOA 3GCWP 4X4UA 4DCJB 5D4NA 3HT0A 4DR5F 3NBPA 1SQGA 1ZA1B 1QAXA 2IRXA 2DH9A 2GHVC 2ZD1B 4TY8A 4XO0A 1QSLA 1P27B 2CQCA 4C11B 2XWYA 3HP6A 4DQSA 2JFDA 1NK9A 5LJ5Y 1KOHA 3SSRA 1JJCB 3D54A 4NLWA 2V69A 3NNHA 3J80U 2H3EB 5GADU 2BE2B 4PYDA 1URNA 3R6LB 1KNZA 2K7JA 1DQ8A 2HS0A 1QTNB 4MYUA 1EAYC 2N4DA 4OHYA 1RWUA 4JI8J 1SBRA 2IBKA 1S6UA 1G6BA 1HD0A 3G96A 3PJWA 3TRGA 4Q7AA 1TFWA 3MPWA 3EMTA 4ZKAA 2L41A 3DLHA 4TY9A 1ZM9A 4U8YA 4F7VA 5KT7A 3G9CA 3F73A 4J9UE 1M1KT 3A13A 4PXBA 1ZZNA 1RT7A 2BKOA 2ZZNA 3AD8C 5D4LA 4YFUA 4QW9A 4K4YA 1RADB 3CO9A 1Q0NA 4LF8J 2NXCA 2V67A 1D8YA 1BLUA 4LBIA 2B8PA 1IBCB 1LXNA 5F3ZA 1Q5YA 2A6OA 5F3TA 1IKVB 4C0HA 4B9LA 4UTGA 4ZCIA 1M0SA 1REVB 1TK5A 2YWFA 3FKBA 5A8WB 3RBZA 3RZAA 2JSXA 3MUMP 2GJ2A 4IRCA 1SC6A 1QTMA 1HQEB 4DR2J 4A48A 3TARA 4LF7J 1RKJA 4IG3A 5KFUA 3HVTA 2ZM6F 2PMZD 2Z2ZA 4QR0A 3AHPA 4I7FB 3EZ5A 1R89A 4C7QA 4NCBA 4ZP7A 3LTOA 2I5JB 1T0TV 2FLPA 3I0RB 3IO1A 1UVLA 3W5ZA 1SC1B 2X1GA 3HVAA 1S12A 1F5CA 1VBZA 1YBUA 1NJZA 5LM7E 4ZVEA 4USMA 1GMWA 3LGNA 2RS8A 1FK9B 1JK9B 5HO4A 4Y2AA 4OZ0A 5IM0A 3T6JA 3ITHA 3RRHA 2UVVA 1MN9A 1WUUA 3NXZA 1VS3A 1XMOJ 3KUHA 3VVUA 1TKTB 2QEXS 1FRJA 1MROB 1UWBB 4FBTA 3ZO7A 3UCZP 4B3TJ 4DV0J 3JSBA 3OTDA 2KFZA 3PNIA 2HHSA 2OEMA 2DNYA 4HI2A 4C8NA 1VQ8S 3SDEB 1HNZJ 4ZK7M 3OR2A 3KLEB 1MMDA 1W2BR 2MQQA 5KOWA 3GV7B 2ASJA 3FZ2A 4X66J 3VR1A 2KJWA 3MM6B 3BKUA 3CE8A 4UT4A 2X7IA 3DHWC 2XLJA 3IC1A 3TVYA 3TA2A 1BY9A 3TO8A 2B56A 1OMSA 4OYZA 2KT5A 3CMQA 4XTTA 1H98A 4RNOA 3A3NB 2CNKB 4P2FA 4IG0B 1XNQF 3W9IA 5KFCA 2H5JB 2NUUG 2VFTA 1H3DA 3H4BA 3O3LA 2COLA 3HVRA 1CC7A 2KXNB 1ZPVA 1LW0B 1SC4B 1SJFA 5J1EB 4OI4A 3QATA 2VOPA 2Y9HA 4MK9A 4NZ6A 3KJVA 1RT1B 2I2YA 2YX7A 5C25B 3W7BA 4FPRA 3M6UA 4MKAA 1H2UX 1RLCL 4QIWD 1PBUA 2IAJB 4ZLNA 3RYLA 2YY3A 2QA2A 4OJ1A 5K9FA 2W8LA 1NCLA 8AT1B 2VONA 1YVFA 3PRVA 1YWXA 4RUAA 2VC0A 1KHVA 3K5MA 2OO4A 4RUBA 1YLXA 3DMJA 2D3UA 1Z1ZA 3EZUA 5K8OA 4GC6A 5DG7A 1GH8A 3J81j 1RKIA 3I6PA 2KFNA 3QNWB 2MDAA 1SKUB 3PR4A 5KT2A 4DUYF 4QWDA 2OPRA 3BREA 2BVZA 2FUG9 2MQOA 3LAKA 1P6TA 3N6NA 4GRSA 2XLIA 2BR0A 2ZVIA 2D3O1 1RAFB 2CPIA 1WC1A 1RT5A 1PILA 4HDHA 1S1VA 2CUYA 3AD7C 4ECVA 2WVBA 2HVZA 1FJGF 4YOEA 2FZGB 3MPYA 2V2KA 2LU1A 2X3DA 2EFQA 2CZVC 3NCQA 1RBAA 4KV8A 1VRUB 4FPIA 4EU0A 1Y9OA 4FS2A 4EZ6A 4ZOSA 4NA2A 1F5BA 2DNOA 2C28A 3QFHA 3C16B 2DCUB 1X4GA 3KG1A 1P9YA 1VR6A 5KFQA 1AB8A 2DO0A 4P71A 2J9EA 5D0RA 5EX0A 4I2PA 3DGPB 3ISZA 4HH1A 1ZBTA 2WW8A 4QIGA 4KGKA 2V68A 2HS4A 4C8YA 3ICLA 1MN7A 3W66A 4U96A 4TNOA 4F2SA 1UPMB 3C66A 4FXVA 2DH7A 1N36F 3A8IA 3CMAS 5H9FJ 2QL5B 2CWXA 3PW7A 3UNGC 4BC7A 2BJ7A 3ET6B 4WWSA 2GVZA 4H4KC 4M94A 3QQCD 1RWPB 3SQGA 1WI8A 2W2QP 3TOQA 2RKIA 2PFFB 1WTFA 3GPAA 3W62A 3PHTA 1REGX 2R7XA 1BMQB 3BR9A 1RTZA 1DAXA 1C1CB 1RT4A 1YBTA 3AY0A 1SJRA 3EPIA 1WSVA 2LXUA 5JJBA 1OYDA 2DITA 3UDVA 2CJXB 2PSZA 1VK3A 4H4KA 4UOFA 2CG8A 1U6ZA 4DX8H 2E1MC 3HJVA 4WJBA 4N7TA 2KH9A 4BWMA 3A1YG 2PIIA 4FF3A 1HBNB 2UUBF 4UQTA 3N0VA 5B08A 3ZZPA 4ZPDA 1LOUA 5A8RB 2DTJA 5KFSA 1R0AB 3US5A 5DJBA 2OIHA 3HLUA 4DZ6A 4NXMJ 4M5NA 3JTPA 3U27A 2KHCA 1S1WA 1KHWA 2BJDA 1JLBA 1OY9A 3F44A 2QTWA 4TQSA 2XG8A 1I5OB 1KVKA 2WCXA 1VJQA 3T1YJ 4U67Q 2YNFB 2W1BA 3SCJE 4G65A 2AP6A 4PG8A 5L39A 5KFRA 1EP4B 5EWGA 1WWHA 1C1BA 3BS9A 3M6XA 4RKUC 5G4DA 1CVJA 4IOCQ 4ED6A 5KFTA 4JBCA 4PABA 2C1EB 5HSPA 5IOLA 1IBKJ 4NPOA 1BUXA 4WP3A 2WSEC 4Y65A 1HL6A 4CNZA 3IWNC 5LJ3Y 4DR7J 2DEIA 1CLFA 1HNXJ 5A6PA 1HQUB 1L3TA 3W9JA 1I94F 3GE9A 2H48B 1ZPWX 1LWFB 1YK9A 3EWGA 4ED5A 3DRSB 1RYSA 1YJ9S 3IWXA 5L9XA 3W8PA 2W01A 3D28A 2FYXA 2L9DA 2M70A 1YG0A 2MJUA 3BO4A 2VG7B 2IJRA 1WC4A 2BW7A 4LFCF 5C42A 4DV1J 1VQ7S 4TXSA 1VRTA 1CJVB 1K1SA 3NCPA 5CCLA 2WTFA 3VGUA 3PYFA 1PG5B 2DHXA 1JIHA 2F63A 5KFHA 5F8JA 4JI0J 4IFVB 2MSTA 1K1QA 1I51B 2K1RA 1C0UA 5LT5A 2DY9A 4B3RF 1TAUA 5GVQA 4O3OA 2FVSA 3GLJA 4WCEQ 1G2EA 2HHTA 2CDRB 3KJFB 4O44A 4N5SA 2OEJA 3CJ3A 3OVBA 4RR5A 4KHPF 3C6TA 3OLAA 1SJ3P 2KO1A 1RAAB 2M3DA 4ZDNA 3Q2SC 4AQYJ 1NHVA 2L3MA 2C2RA 1FRKA 4LRAA 3VAFA 1RU1A 1DLOB 4O3QA 3HHEA 3NGSA 4C8ZA 3GR0A 4H4MA 1VK8A 1T02A 1LKZA 1QE1A 3OFGA 2HNYA 4USHA 2DHAA 5I3QA 2BJ3A 1U1OA 4DQIA 3NY0A 4DFMA 2P5VA 2G1HA 3BZQA 5GMEA 5E41A 4M5HA 1JLFB 3IR5B 4JI5J 4ELTA 1HBUA 1ZH5A 3D6MB 2M8DB 3VWSA 3VTIA 4UZBA 3IGVA 2GFFA 3GJRB 3VAJA 5IQQA 2LEAA 2XMTA 4IFYB 2QO3A 3R2CJ 3CC7S 1DTQB 4ETXA 4DBQA 2C2MB 1YJWS 2WB4A 4A8XA 4QWCA 3H40A 1NKBA 2YKMB 2R8IA 4K5RA 3AOCA 3D6FB 4LSZB 2L48A 3LWLA 4IRDA 4C48A 1JJ2R 1T05A 5KTQA 1TVRA 4DG1B 3B54A 2AU0A 2HIQA 1ZM3A 3PX0A 2RF2B 1S72S 5K5MA 4LSLB 2ZFHA 3NMRA 4C2MA 2V4RA 1S1UA 3GSIA 1JLEA 3N28A 2V8GA 1TKXA 1KVJA 2J6UA 1U47A 3UFCX 4Y3CA 4N56A 2B9EA 3UWTA 3D1OA 1YJ7A 1F2HA 4U7UD 1LFPA 3BN7A 2V8VA 1XEZA 1X7VA 2F3JA 2GV1A 1NSQA 3TQEA 4AYBD 3CJ8A 2FTRA 3O44A 2GHPA 1Q8IA 2HVHA 3N01A 2HRYA 2VBZA 3UD4P 1PIEA 1J5OA 3WQPA 1LWCA 3OFFA 1FRXA 5IT0A 4DL2A 1N32F 4ICLA 5JXSA 1N5SA 2IVYA 4DR4F 3Q23A 2JFKA 2MJNA 2RRAA 4OLOA 3CCES 4M5GA 3PKMA 1X4AA 1N33J 4ILLA 2JH3A 5EWEA 4I6WA 2EVZA 3WC2A 1UFLA 3BSNA 2DJWA 5F8MA 5KOXA 2ACMA 4CYUA 3MR2A 1NO8A 3PFOA 3QPIA 4LR7A 4PG4A 3EGWB
chains in the Genus database with same CATH topology
2RKIB 1HWJA 4LJMA 2PO4A 3UI3A 4Z37A 5HQ8A 1U26A 3M05A 2OMOA 3PKYA 2AJQA 4Q45A 3R1HA 4ECTA 1SXLA 2NXUA 4FF2A 5DDOC 5KFMA 1QY7A 2B6AA 2CJBA 4IYQA 4PG7A 5T7LA 4O3PA 5AXMA 1S9EB 3IR6B 1N0UA 3DLLQ 4NYZA 1NKEA 5AXKA 3V4MA 1E6VA 1MNEA 5DQGA 4RW8B 1IJEB 2Y1JA 4R25A 4DL5A 2BV3A 1K0VA 1YRUA 2OJ3A 2QLWA 3SI8A 2VBYA 3K5OA 2ADCA 4QYZJ 1X4BA 4QU6A 3FQLA 3UW1A 5D3GB 1FO1A 2CQ0A 1SH2A 3SFGA 4BDPA 1Q78A 2FDNA 1N33F 4QR1A 1KR4A 3BGFA 2X1AA 4O23A 2RQCA 4JI3F 2EKYA 2JEGA 1RGVA 1BQMB 2F8HA 4Y2KA 4ZCKA 2VQFF 1FKOB 2ZVSA 1WTBA 1FNXH 4F02A 2BABA 1LWEA 3O5TB 3M8QB 2GCFA 3NG8A 3TUZC 3OJUA 1Q79A 3MEGB 3OFHA 4RW4A 3FSYA 5C24A 4EEYA 1HHTP 2N82B 3DN9A 3KK3B 2DVIA 2DT9A 2EFNA 5CHCB 3OTBA 2M9KA 2KDOA 2L08A 2U2FA 2W8KA 3DRRA 2E7WA 2D3ZA 1H2TZ 4BC9A 1S1XA 3LGMA 3HKWA 3TW0A 1L3SA 1MU2B 4Y2CA 4IOBA 3TA0A 4LIRA 5HBMA 4DSFA 2XGPA 5HMWA 2E9TA 1XTZA 1PC4A 5E3AA 5FIIA 3QIPB 2AYBA 3KHGA 4EUVA 3CCRS 2LMIA 4NYOA 2EFVA 1T3NA 1S49A 2WONA 2ZHOA 3HHNB 5J2PB 2HHQA 2MZ1A 2LKZA 3I96A 2XHWA 2Z2LA 2PA8D 3ENQA 2ALZA 1YJRA 1KFDA 4OI3A 5EWFA 2UXCF 2ZUGA 1S9EA 2HHHF 2J9DE 6FDRA 3GG1A 2PDAA 3MD1A 2DIVA 2GHWA 3OPKA 1VBXA 4O3SA 4RBVA 1N0VC 3TYTA 4G1QA 3IRXB 3CCTA 3OFEA 4A4JA 3CF5Q 2R8JA 4DR1F 2W4CA 1RT6B 5HROB 3POTB 3CULA 1NH7A 1S1WB 2X1BA 2F9JA 5D3GA 4DN9A 5FDLA 5LXRA 3CJ2A 3G86A 4J37A 2CQHA 4ZPBA 3W2WB 1JLBB 2CPXA 1FKPB 3G6VA 3QWUA 1BQMA 2OPSB 4I6YA 1SL0A 3PHEA 1U7LA 3C8YA 4WU2A 3SCIE 1U6FA 1HR0F 1OIAA 5CYMB 3AQPA 3MEGA 1NKCA 1JJHA 3KK3A 1X4DA 2MGZA 3H8YA 5LSOA 4M1KA 2F8EX 4L3NA 4DQPA 1YTYA 3K2YA 4HKQA 1MU2A 1ZTTA 1TUVA 4U7CA 2PD1A 4DF8A 3JB9k 3BGLA 3SFUA 4WFXA 3CSKA 1VQYA 4DS5A 2MKSA 4CO2A 2WSFC 5DM7Q 3QIPA 1SL2A 1MMLA 1C1BB 5HMYA 1D9AA 2J9CA 2RB7A 3GFYA 4OX6A 2UVRA 2XNRA 5F9NA 1XWLA 4NX9A 1QAYA 2ZD1A 1IQZA 3HT3A 3OVAA 2FLLA 4I69A 1HI0P 1SKWA 2YKQA 1E6YA 2W9CA 3DFEA 2CQ2A 4YUDA 4RWXA 3CD6S 4P2SA 5GMKa 5M2PA 5HMZA 5J1PA 1FRMA 1S48A 2YNHB 1IJFB 2DO4A 5DDRC 3IRXA 4B3OA 4EZ9A 2XLKA 2XB2D 5J2NA 1R6YA 3POTA 4MKYA 4AE5A 2DGSA 2GJIA 2ZBIA 2DPJA 4I4BA 3DXSX 4Q2MA 3M9OB 1FKPA 2BE2A 4RUHA 1D3WA 1NK8A 5J1NA 2DBBA 1WHXA 3AA8A 2MKJA 3I9V9 1KQFB 4N47A 2CQGA 4I64A 4HL9A 4I6AA 4OI6A 4JI2F 4BCAA 2VB6A 5CYMA 1IKWA 2YTCA 2CPEA 2WBRA 4M5DB 3GWCA 1FA0A 1WACA 1XR7A 4ZMMA 3KNGA 2VOOA 4FNIA 3CJ5A 1WG5A 4UUWA 4O0IA 4TKTA 3GG0A 2JVRA 3QIDA 1QVFR 2DGQA 4JI8F 2OD4A 3U02A 1WF0A 1T03B 3V4IB 2APOA 2YKNA 4MK8A 5CCMA 1TKZA 3DOKB 3VAGA 4HLBA 2D9OA 3AAWB 4NLYA 4NLOA 1O51A 4Y00A 5SZTA 3SMZA 3HVWA 1OPIA 3EX7B 1B0PA 2DR5A 2NZ4A 1YHQS 7FD1A 2DNPA 3LP1B 1VGYA 4Y34A 3G6XA 2VBWA 4NLTA 3TAMB 2KG0A 4DSKA 3V6JA 2YX4A 2IRYA 4ETZA 5T14A 2DR7A 1CEZA 3MR6A 2Q3PA 3PR5B 2AJ1A 2CYYA 4Y2IA 5I4MA 2XY5A 2RDIA 2XMKA 3BQ0A 4DFKA 1Q8LA 2XWXA 3HPOA 4ED8A 2AGOA 2R8KA 3T5JA 4DL6A 4QU7A 4CH0S 3BSAA 4N41A 3CT9A 1YSJA 4OHWA 4DS4A 1MWZA 1U1NA 4DSJA 4DUZF 4R8UA 1ZETA 5GAGU 1KTQA 1JNRB 2IM0A 3VF0B 5L1IA 4N77A 5EX3A 4OHXA 2EFOA 3JSMB 3M2VB 3CIZA 3RAXA 4NLDA 3KTQA 1S6OA 2B4UA 2N7YA 4X64F 4Y0FA 4V19X 1UFWA 4B3OB 2AGQA 1C0TA 2EK1A 4YR2A 2OPPB 3DHXA 4X62F 2R2UA 5B0EA 4F26A 3TVKA 4DLGA 3D0IE 3OTCA 1GXUA 2ZHAA 1L3KA 4RBTA 4TYAA 2HNDA 4CO4A 3PJXA 1NHUA 1EETB 5GAHI 2BM0A 1W25A 2K1RB 3QAUA 3KG0A 4HH0A 3Q0AA 1T03A 2CQ1A 1AFJA 1FNMA 4LUBA 3KOAA 2VA2A 3DOKA 3ULHA 3PO5A 4CT9A 2J0XA 4URQU 1FNOA 3LOUA 5HI7A 5D6GA 1V3SA 3SCKE 1SJ1A 2BQUA 2VBXA 1TK8A 2JOQA 5EHHA 2VFSA 2JHEA 1OQ6A 4EO6A 1S0NA 2W9BB 4HTIA 1ULRA 3LPYA 1D9FA 4RBUA 4O44B 2BXJA 1K9MT 4PQUA 2JEJA 3TAMA 1VOMA 3ZFVA 3MUVP 3MMCB 3VALA 1REVA 3OUYB 2PI4A 2VPXB 3EGZA 2LA4A 3BB5A 4C8MA 1S9GA 2AF6A 4BWJA 1BGXT 2AV5A 2OSQA 1J5EF 4CT8A 5KG4A 1HQEA 1HHSA 4AL7A 1DTTB 3OVSA 2K3KA 4ZS6A 3LAMA 1UVIA 2ZOGA 3DLJA 2J0WA 3U1LA 4DF4A 1RTDB 4DJBA 5B0BA 2FVPA 2JVOA 2EW9A 3CTRA 1H38A 3RB6A 1QSYA 1WNEA 1C2PA 1V9OA 3OL8A 3JSMA 2M2BA 2OH2A 2EWHA 2EK6A 2FJDB 1PO6A 2RMLA 2DNHA 4ECZA 4YDXA 4IDKA 2BANB 2HS3A 4EBDA 2LXFA 4QWBA 2OPPA 3LF0A 4H4MB 2LECA 3DXBA 4IUFA 4KE5A 3QYYA 3LP2B 2DGUA 1SJQA 3DLKB 2E29A 1UAWA 2IJNA 2QSFA 2HNYB 5ITHA 1FF2A 3V6DB 4C8LA 3E2EA 1Y3KA 4QQBA 5KT6A 1CQMA 1ROFA 2HFNA 1JB0C 4URSA 1KC8T 4N8OA 3DDKA 2CDQA 4EBCA 3DRXA 3KLIB 2HNZA 4QPTA 2C3YA 2M0GB 1HPZB 2RRBA 5D78A 5LSLA 2ATLA 3QMQA 4WE1A 4YEAA 2W9BA 4CCHA 3KNAA 1X5OA 3MGJA 3PX4A 4CO1A 1GTEA 3M2UA 5CXTA 2GMJA 3M2RA 3PW4A 5KFJA 3FFIA 4Y2MA 3MMCA 4C98A 3CC4S 5G0RA 1T7PA 5SUHA 4R5PB 4AUKA 4DFJA 3UPFA 1O0PA 3MMAB 1HBUB 1VQ9S 3GQCA 3BF4A 3VAMA 3IG1A 3NGDA 1D8ZA 3Q2TC 1DURA 3GILA 1DTTA 5D4PA 3NL0A 4HT5A 4NA3A 2ROEA 3ZZOA 1RT2B 4B3MF 1NRKA 2A2CA 4C0BA 2J76E 2SXLA 3KK1B 3MEKA 3PW5A 3MZIA 3LO3A 4QIVA 3I55S 2CIMA 2NPIA 5LMNF 3M8PA 2BACA 3K58A 4ILRA 2BANA 3GIIA 1UA1A 2DRAA 1TKTA 1MROA 3M32A 3VAHA 1ZM4A 2PGCA 3O6QA 2ZJRQ 2R7QA 2VV5A 2DRBA 1Z2ZA 4WIIA 4TYBA 1HNIB 2OTLS 1GXTA 4PUOB 3NWGA 4N76A 3D2WA 5KG6A 5AXNA 4QBUA 3E01A 3ZZUA 4B3TF 1TL5A 3I5AA 1IXKA 4RNNA 4JYAF 5MLCV 2XMMA 2BUNA 2B51A 1G1XA 3DU5A 2FHMA 3C46A 1WF2A 1HPZA 2CQIA 4RW7A 3SDEA 1LXJA 3MM5B 3J81Y 3KLEA 1KTVA 4Q43A 3CCUS 3DLEB 4ERDA 1HNZF 3OXLA 2UU9F 1S10A 5EN1A 3IR7B 3K0JA 3OHBA 2GNKA 1FDAA 2JLFA 1R8AA 3RRKA 3MFIA 4LF5F 2KYXA 1SL1A 4B9SA 4LMZA 4K4VA 4ELUA 2CPFA 2I38A 3K5PA 2LQBA 2GQ2A 3QGIA 4AL5A 5LXYA 3MMAA 2Q79A 4YB5A 4A8WA 5A8KA 1T05B 2YNGB 4K4SA 1YQHA 1QJHA 2D1CA 1TVRB 2QSWA 3JYTA 5J2QB 5CYQA 4J9OA 1VQNS 5JVHQ 2Q6CA 2PN6A 4KHMA 1FE4A 1RT2A 4NLSA 2ZH9A 4PKDB 1Q1KA 2WBMA 2VL1A 2FLOA 2XEXA 2HFZA 2E9ZA 2R7UA 1P1LA 3DYAB 2HHUA 1S9FA 3CVKA 1U45A 2VG6A 1CG2A 1Q82T 2H9ZA 4I2QA 3UCUP 1Y00A 3C6UB 3BSOA 3FVYA 2XSJB 3MM8A 4ZVHA 3V2UC 5BYSA 1S1UB 3M1VB 4WFNQ 4DLEA 4A46A 3DRPA 1NJIT 2MHEA 3N9UC 3MMBB 1TKXB 5M2RA 1FDNA 1M5OC 2GC8A 4HDGA 3ONQA 1Q7YT 3GMGA 3I0SB 2CJ9A 3UDLA 2CVIA 2IA0A 3CWJA 4FVMA 1HNIA 2FJVA 3GR1A 1RTHA 4RZRA 3NNAA 4NZ0A 2WK4A 2DNLA 4DV4F 1Q81T 2HFOA 3OQ2A 2FJBB 5L1LA 1UP1A 1Y7PA 4KFBB 1JLGA 2DR8A 1JMTA 2RDJA 2V94A 4AXIA 3H4DA 4CO5A 2MHNA 1Q86T 2BJEA 1TZ0A 1X9MA 3DLGA 1HWUA 1HNVA 1NZAA 3K57A 1SJ4P 1FRLA 2QA4G 2DNKA 1N6QB 3KLFA 3K8WA 5KT3A 5H9EJ 1XR6A 2GO9A 3LANA 3NP5A 4IG0A 2R7WA 4X4OA 1XC9A 4PWDB 4FP9A 1M5HA 1S0MA 4A8SA 5E3RA 1F5AA 2J7KA 1SKRA 4LVNP 5J2QA 1J5OB 1DHMA 4ECSA 2E7XA 4EO8A 2ZNZA 4IH7A 1LW0A 4OZLA 2E44A 5DG9A 3I9ZA 1JXEA 1TV6B 3DYAA 3T6BA 5IQ6A 2IJFA 4OZNA 3PEJA 2E5LF 2LQ9A 4DL4A 3B4DA 4OI0A 3QO9B 2XSJA 3M1VA 4NCGB 2B4OA 2WAQD 5LSRA 1Z4UA 3MMBA 2KTQA 1R7IA 1MW7A 2J5AA 4CI0B 4B9TA 1RT1A 3MAQA 1IBLF 1N54B 1RT3A 4C3MA 4F3QA 1HBMB 4JI6F 4DV3F 4BBYA 4E98A 1ZZFA 3EPGA 3AJ1A 4CTAB 4C97A 2CZ4A 3CCMS 1WEZA 4YB7A 4JV5F 4HTJA 4RW6B 3RR8A 4KFBA 4OI2A 2VUGA 2X51A 4WZMA 4ZPAA 1R8PA 4JV2A 2LDYA 2MQNA 3P6YC 2QT7A 4RNFA 3MI7X 3MR5A 1K0TA 1TFYA 4OZ5A 4NA1A 2DR9A 4X4RA 3TP2A 3S7RA 1KLMB 1YJTA 2N3OA 2IAJA 3IBWA 3RB0A 1N6QA 2NLWA 3ETOA 1NK7A 3N5FA 2P9EA 1S1TB 1U1KA 3L95X 2FHOB 3W2VB 4RU2A 2C22A 4UY8T 1HMVB 1KLNA 2PC6A 3H5SA 4X4SA 1HYSB 1RTJB 2JJ4D 1X4HA 4Q8FA 1T94A 4LT6A 5I3UB 1JKHA 2FGOA 3FQKA 3J7YI 2FVRA 3GV5B 2R8GA 5F9LA 4YQWA 1UW4A 4ES1A 1N8RT 1ZTWA 2B6AB 5T7LB 1VJWA 2NSBA 1TV6A 3OR1A 5IT9Y 1E6VB 1TL1B 3EYZA 1NK5A 2RQMA 4C0OC 4FF4A 3QO9A 2VG5B